3W7JA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-6-040
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-6-040
rcsb
source organism Trypanosoma cruzi
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7jA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7jA01
1FWNA 2DZWA 4NJHA 3NZRA 3UWUA 5IBXA 4JEQA 2C15A 1VR6A 3NR0A 3LXBA 3VNDA 1VHNA 3KHJA 5AHFA 5AYZA 4NVTA 3B0UX 1LBLA 3E96A 1G4EA 3PWAA 4RR4A 1OK6A 1LBFA 2CLIA 1N55A 6TIMA 3QMSA 4UTTA 2WSRA 2ZCGA 3NQFA 3LLFA 1I2QA 2WV8A 3NEVA 3BG3A 3NPVA 3WK3A 3QH2A 5D2WA 1A53A 1GTHA 3G8EA 1TRDA 3W1AA 3E9AA 5DCBA 4UFHA 3C8FA 5E1QA 5F2IA 3NZ1A 3CQ0A 5J5RA 3L0GA 3OG3A 3SGZA 4ZQMA 4K8HA 1QDSA 3UPWA 1NVMA 2YGYA 3MWAA 3BGGA 2Z2UA 3NL5A 1KLYA 2A85A 2J27A 3W9ZA 1R2SA 1W3NA 1DVJA 2BX7A 5F4WA 1QPQA 1Q6RA 4BFAA 4LVBA 3W76A 1P5BA 1B3OA 1H60A 3NQ2A 3RU6A 1DORA 3TC6A 4TU1A 4UR8A 3PC0A 4HHPA 5EY5A 3BPWA 4OWGA 4KFPA 1H51A 1KM0A 3BVJA 3GK0A 4IQLA 3TJLA 4QISA 3KRZA 1THFD 3MP5A 1FBAA 1HFBA 3M5YA 4IUOA 4POCA 5DBTA 2GOUA 1DKWA 4NZJA 4M7TA 1W5QA 4OV9A 2J9ZA 2RFGA 1LOSA 1Z42A 1Q45A 4UFKA 5KINA 1RPXA 1Z48A 1Z44A 4UR7A 1QFEA 4UMBA 1SFJA 1AW1A 3QC3A 2ZZ5A 4Z1CA 2VXNA 4RXFA 1WA3A 5F1VA 3EEGA 1KM4A 3OVPA 5CZSA 3PAJA 1TYGA 2ZRXA 3EWBX 3HBLA 1SZGA 2VFEA 1OX4B 5TIMA 2QDGA 4M19A 2NV2A 1ALDA 3STCA 2VFIA 1JCLA 4ALDA 1VCGA 4RX0A 3O63A 1UBSA 3T78A 2JGQA 3N2MA 3BK0A 4PL2A 1D9EA 1KTNA 2QCEA 1WBHA 3EX1A 4EWND 3NVTA 5LNUA 5CSSA 2J24A 4UMCA 2G95A 3LCLA 3GDTA 3S1UA 5D33A 4M6QA 1JCYA 4ADUA 1SFLA 2ZA2A 5BRBA 2QCDA 5HR7A 2FLIA 4HIBA 1VLWA 5HMSA 1FDYA 3MHFA 4MPQA 2E1DA 4FB7A 4PL1A 4JD4A 5AC6A 3LTPA 1SPQA 3SFKA 2B4GA 1QOQA 1J2WA 3TK7A 1TJRA 5KZEA 1EX5A 1M6JA 1ZY9A 3R2GA 2WSQA 4N9BA 4CNOA 3TIMA 3BO9A 5EKYA 1JRCA 2PURA 3LRLA 3P82A 1ADOA 4KWVA 2VEMA 4CCDA 2RHGA 2TYSA 3W2UA 1LM1A 2X1RA 3L68A 3W2KA 2QCGA 3QMTA 4Y9AA 4LNYA 3EWXA 4ZQRA 3MHGA 4DO4A 1SQ7A 4Q33A 2FPTA 1YYAA 1F6KA 2QR6A 3UY7A 1XFBA 1SU5A 1VRDA 2ZA1A 1UASA 1K7FA 2D73A 1VS1A 1M5WA 1G6CA 2PRHA 4R33A 4N4QA 4UTKA 3NQ7A 2WNQA 3P74A 5BMWA 3L65A 4XKYA 1OFBA 4O1DA 1ICPA 3I6RA 4LS1A 1WOBA 1RQHA 1LROA 2WSYA 3LHTA 3TW6A 4O8RA 4JTTA 4O0ZA 3VFLA 4I7UA 1IF2A 4E0CA 3JS3A 4NU7A 3R5EA 4TR9A 3MO7A 3LCWA 2XN0A 1YTKA 2B0MA 2ZZ7A 2YXGA 4FO4A 4AEOA 4UTLA 5AOUA 2X1SA 4N9DA 2X30A 4HKPA 1A5AA 1JCXA 1XUUA 5CGQA 3UQNA 3GDLA 5F2LA 1HG3A 2CLEA 2CLHA 4MYAA 2GVJA 1R2RA 3D0CA 3UNDA 3P81A 4AB4A 1XC4A 3W7LA 2PC4A 3W2NA 4M7SA 3O15A 1SO3A 1XBVA 3MYPA 2G96A 4UMAA 1NAL1 1LDCA 3MYOA 3CWOX 3GAYA 3NA8A 3W73A 1WOAA 5LGZA 3O1NA 1FWSA 3P5ZA 2YR1A 1TREA 4O16A 1CI1A 3USBA 3V1PA 1VH7A 3NL2A 3BW3A 3SY5A 3EWYA 3LXCA 1H7OA 2QUVA 3M5VA 4ORIA 3DKJA 2LLEA 2QCCA 4LS0A 3H55A 3M7WA 5H91A 1XXXA 1Y0EA 1F05A 5G2WA 1XBXA 1LCOA 5AHLA 3W7KA 2R91A 3RMJA 3NG3A 1SO6A 1K7EA 1NEYA 1L2UA 3AO0A 4QQ3A 3G24A 3PSVA 1I4NA 4NX0A 2PE4A 3ZWSA 4NNCA 3BV4A 1I2NA 4JXCA 1KFKA 2YW4A 1MEIA 3W07A 5CZ0A 1GYNA 3HG4A 3NQMA 1K8XA 2YFNA 5J5DA 1VCFA 3IIPA 2BWGA 3NQEA 4IXXA 4YL2A 5EPDA 3PBWA 3SECA 1H7PA 4X2RA 4WY0A 4GWEA 2QJIA 4GJ1A 2A21A 4HSOA 1QO2A 1FXQA 1EP1A 5CSRA 4FF7A 4AHPA 1QWGA 3G18A 1WDWA 4JGDA 3A5VA 3W22A 3NQVA 3W1XA 2VFDA 2XN1A 4M6VA 3BLEA 5K4XA 3LV5A 4QNEA 4JTJA 3HB9A 4N6FA 1LTDA 3MI3A 4CQ8A 3W6YA 3DZ1A 2FB2A 3HO8A 4FX7A 3OA3A 1SW3A 3IGXA 5DLCA 4O57A 2XFWA 4MZ8A 2RDWA 3SGUA 4IXHA 4ADSA 3G1AA 3B0PA 1D3GA 1BKSA 5D04C 3W72A 3TQKA 3KAOA 5G4WA 4W9TA 5AHIA 4RZ6A 1BTMA 5I3GA 4DBEA 5DXXA 5FEXA 5LNSA 1SSDA 3P8JA 4UFLA 1HO4A 4ML9A 4NXSA 4JIQA 4RCXA 6ALDA 1HTIA 1RQEA 4DBDA 1H1YA 2W0UA 2NXHA 3RFAA 1M7OA 1NF0A 3NL3A 1C29A 3W7QA 3ATZA 1AW5A 4YCOA 4JS3A 5CG7A 4YXGA 2C14A 3G0XA 2DP3A 1AL8A 5FESA 2GQ8A 2DZUA 2QUUA 2Z0IA 5D2TA 1Z41A 2OT0A 1SZNA 2QCNA 2FQIA 5DCDA 3W1MA 3W70A 1W0MA 1EUAA 2RKXA 5AB3A 2H6RA 5K9DA 2E68A 1W54A 4JTKA 1ZAIA 4JTGA 1YTDA 4U4MA 1XBYA 4TX9A 5F2MA 4WQ6A 1O4UA 3W83A 3TMLA 3FYPA 3EB2A 5HJLA 2RH9A 5HWJA 4JX5A 4HNVA 5KSWA 3B0VC 5D03A 1TV8A 3W1PA 1AL7A 1I45A 3DI0A 3MP3A 5EA9A 4HT3A 1VYRA 3W2MA 1PS9A 3LGEA 4E2BA 1UUOA 3FKRA 2GQ9A 3O05A 2JK2A 3TMQA 3LM7A 4DEFA 3W7JA 3WJWA 2TMDA 3FLUA 2C6QA 1T0OA 5LNVA 3IV3A 4Z1DA 3GAKA 2E6AA 3GIYA 4S1FA 4GFSA 1FDZA 1TO3A 3BLIA 4LC8A 2P0OA 3UWQA 2DU2A 3M1ZA 2NV1A 3DKLA 4NX5A 4UFIA 5DY2A 1D3HA 4GUHA 4PFMA 1TB3A 2DORA 3WJSA 5BOOA 1E51A 1H7XA 2CLOA 5EL1A 1FY6A 2ATSA 1K7XA 3FOKA 5HWMA 2H3DA 2ZTJA 4B5NA 1Q3NA 5AYXA 2YX0A 1YDNA 5T26A 2V0TA 2YW3A 3L21A 4KFOA 4FNUA 1ZAJA 3RLVA 1OF6A 3LRMA 4AWSA 3MI2A 3C2FA 4MZYA 2VFFA 4JY8A 3L5AA 4MVAA 2HMCA 2NX1A 1JULA 5CPLA 7TIMA 1GTEA 2A5HA 3UYCA 4TMBA 5KITA 4P2VA 2P1FA 2BLEA 3ABOA 5HUPA 1K3UA 3W7RA 1H7WA 3IIXA 3T4CA 4PC8A 3B04A 3PB0A 3EX3A 1KTCA 5AC8A 1N7KA 1WBJA 1TPB1 1VLIA 1TPH1 3O07A 4X3ZA 5FF2A 5F1UA 4Z0JA 1KM1A 3ZFHA 2P10A 2CU0A 2JKPA 4MUZA 4CNPA 3C3NA 3TROA 3MHUA 1B4EA 2GJLA 2OMAA 1DBTA 4JYFA 1G7UA 3T7VA 3H53A 4ICNA 5K4ZA 1GOXA 3GR7A 4LS2A 4KKXA 1F7BA 1A5SA 2JBMA 3WJZA 4C1KA 5D38A 3L67A 4TO8A 3NQ8A 3G1XA 3P5YA 3UWYA 3NQ6A 4MYXA 3M5ZA 4NT0A 1RR2A 3F4NA 2HSAA 3QYQA 3RNDA 3M44A 1L6SA 4OE7A 4IMGA 1JVNA 1HUVA 2GJNA 4JX6A 2A0NA 4YCPA 1S3HA 4MIMA 3PY2A 3ELFA 4O10A 3NPWA 5D30A 2JKEA 5DBUA 1DL3A 3I7QA 3QPZA 5G2IA 3FKKA 3W88A 3LI1A 1ME8A 1QAPA 2A2IA 2ZFAA 4JICA 1WX0A 3L5MA 3A23A 3CT7A 4PH6A 3UY8A 4ZMGA 3LLDA 1W1ZA 1ZJIA 4Z0SA 2QF7A 3TX9A 4XZ9A 4K7VA 5U4NA 3W87A 3YPIA 3NPXA 4IMFA 2FB3A 3TKFA 3PBVA 3GVGA 5DN1A 5HINA 2J88A 3LV6A 4UTMA 3NXFA 5DELA 3KVLA 3G1VA 2VFHA 2CZ5A 5K9CA 4S2CA 3TFCA 5L6UA 4MLJA 5F2GA 1KFLA 4ADTA 3MBFA 3W7IA 4RV8A 4WZHA 1FWRA 3DBPA 1W56A 2HS6A 1GVOA 3KXQA 3LCXA 1KA9F 4XUGA 2A7RA 3W1NA 5LNRA 3MP4A 3UWVA 1GVRA 2Y88A 1V5XA 3CEPA 3W7HA 2A6NA 2YPIA 4WJEA 4JDYA 3PB2A 1PV8A 1XM3A 1DQWA 3TXVA 4JYDA 2QUTA 1OX4A 1DHPA 3NQGA 1AMKA 3SR7A 2VEPA 1EUNA 3W1TA 5FF3A 1LOQA 1H7RA 3C2EA 2B7PA 1MO0A 1UCWA 4Y96A 5FF4A 4MY8A 1ZFJA 2Y7FA 2ATMA 1VPXA 3EXRA 4RLIA 1PVNA 5CPNA 1LYXA 3PUDA 3TE9A 4DO5A 3ATYA 3K30A 1QO5A 3G1FA 4UUIA 2YFOA 5CPMA 1VZWA 1KTBA 5E93A 1F6PA 3SSJA 1ZALA 3N3MA 5G1YA 3C0JA 2CFFA 3G1HA 3R8RA 2AGKA 4I7VA 2TPSA 3HG5A 3S5ZA 2OJPA 2GQAA 4Y6GA 3G1SA 1Q6LA 2GPTA 4O4VA 3PUEA 3TSBA 3UD6A 3TJXA 2WOQA 3UWWA 5DCEA 4QNWA 1G4PA 2Y7GA 3NYZA 4D2JA 4AAJA 5ABTA 5A5WA 4L4LA 3L5LA 4LT9A 2FTPA 5D2VA 2JKAA 4MY1A 4A21A 1DJNA 3G1YA 1P0NA 1QNVA 3TH6A 3NL6A 4UXDA 1YPIA 3E02A 3G3DA 4MKNA 2DZTA 4K6AA 3F4WA 3W71A 5D02A 3N2XA 3HPSA 3A24A 4JTIA 2NLIA 3WK2A 3HMJG 1IXPA 3ABRA 3FJLA 3PR2A 4ORMA 2Z6IA 3S1XA 3IIVA 1O95A 3QW3A 1G69A 1S5WA 4N9CA 4AF0A 1JR1A 4KFNA 3LCGA 2V30A 4HPJA 2FPYA 3U2OA 2W79A 3EX2A 3CIWA 2VC6A 3A21A 3LCHA 1EB3A 1PL9A 4NNAA 1SO4A 4O4WA 1GG0A 1QCWA 4O54A 2HS8A 4QJ1A 4G1KA 3GDMA 3LHVA 3BG5A 4X22A 1JCJA 3NAVA 4R53A 3IIZA 4K7YA 3QQ0A 2QCMA 4MFEA 4PCFA 3W2JA 2E5DA 5K9XA 1GVSA 3N73A 1KV5A 2C18A 1H62A 1GJPA 3FS2A 1EEPA 4LVDA 5KZDA 4RXGA 1LORA 4HN4A 5FF0A 2ABBA 3S1VA 5DY3A 3S8HA 3KVKA 3TA6A 3LI0A 5TBOA 2QAPA 4DPQA 3QEZA 4DF1A 3GZ3A 2CLKA 1IXQA 1R2TA 4LW7A 2B7OA 4MJZA 4AWUA 1FDJA 4UTUA 1XCFA 3O6CA 3S5YA 1H5YA 3HF3A 3TDFA 3S5NA 2A7PA 1PHQA 3TSMA 3BW2A 3NQDA 5G1TA 4LWWA 4IMDA 4GBUA 3DHFA 4UNKA 4HNTA 3TQVA 5K7JA 4K8EA 3HOJA 1RV8A 3CTLA 1I2RA 4M6PA 3GKAA 2A6LA 1MSSA 2NUXA 3IGUA 3W7CA 3DAQA 2V8ZA 1QPOA 5D2XA 2ZRZA 1TSIA 2G97A 3TSDA 1MZHA 1Q6QA 3TU9A 1R47A 2Q8ZA 1H61A 5G5IA 3W7NA 4FNSA 3T44A 2O7QA 3E12A 4Z1AA 3GXPA 3N9SA 4LRSA 4FX6M 3S1WA 4ZL1A 3OHIA 3BW4A 2RDUA 1K03A 1TPEA 2V9DA 1F76A 3O6YX 5K2ZA 1TRIA 3INPA 3THQA 2EAWA 5AHMA 3QQ1A 4GUFA 1O94A 4H3DA 2NXGA 3H54A 1IIGA 4CCEA 3KRSA 3STFA 3P8IA 2VELA 1XDLA 2F7FA 1FWWA 5KZMA 3EWUA 2OZ0A 4XTDA 3IVTA 4EF8A 4O1AA 3IRDA 5LSMA 1XBZA 4FNQA 4WY0B 2ZA3A 4OV4A 2ISVA 4O19A 1TQJA 1RD5A 1SO5A 4JN6A 3BARA 1QR7A 1GYLA 1OFRA 3U8GA 4NJKA 3PG8A 4YMZA 1TV5A 4AHQA 3OVRA 3VKJA 4NUWA 5I3FA 4UFMA 3WFAA 4IGHA 1TTIA 1A50A 3TXZA 2G5WA 3W7MA 2E77A 3WJXA 2CZEA 3L9CA 4EVZA 1JUKA 1NSJA 3W23A 2YCEA 3FA5A 4XTIA 3L0NA 4NQ1A 1SR9A 2DZSA 4GNJA 2ISWA 4M5PA 1SUXA 2V5BA 5AN7A 4WXZA 2QKFA 2WKJA 5C54A 4JY9A 3C2RA 2ZZ4A 3ABSA 4JTFA 4OT7A 1CW2A 3W84A 5I3KA 2YSWA 1KFEA 1VCVA 1IXOA 3PM6A 3B03A 3P84A 1B57A 4XWUA 3GNNA 3PVFA 5AYYA 2ZZ1A 1GZGA 1VYPX 5HULA 3TCEA 1XUZA 2ZRYA 2ZZ2A 3IVSA 2ZYFA 4GC4A 1N8FA 3LRKA 1LP6A 3KFTA 1MXSA 1T99A 3A9IA 1W5PA 3CLMA 3CPRA 5HQEA 1G67A 3FFSA 3LCFA 3I7RA 1LLWA 3DFTA 4WOZA 1TPC1 1EP2A 3KX6A 4OQVA 1JUEA 2NX9A 4EOUA 1PE1A 2I9EA 2ZRWA 2A7NA 3CIXA 1OVDA 2CWNA 3Q94A 4OBTA 4U28A 1T8XA 2H8ZA 3HPXA 2FIQA 3LDVA 2FPVA 4QM1A 2YZRA 1ZCOA 3DFSA 2V81A 1O5KA 3G3MA 1FCBA 1H50A 2OT1A 4A29A 4LVFA 2V82A 3S0CA 3E49A 4MLRA 3U6WA 3MUXA 3TAKA 3TFXA 3C6CA 3P60A 3W74A 3M9YA 3W3OA 3UPBA 4O14A 1OHLA 2CLLA 1EWEA 1TJPA 2Y63A 3DU0A 3DI1A 2AAMA 3NM3A 1NF7A 1YXCA 2I1OA 4Y8FA 1RVGA 1P4CA 4MOZA 2WJZA 2DJXA 2ZBTA 3LOTA 2VKZG 3RF9A 5HNRA 4J9JA 4QAIA 4QITA 2Y62A 2H8XA 1FQ0A 1EIXA 3CHVA 4NNBA 4WY0F 2X2GA 4CNNA 5G2HA 3O06A 2HTMA 3MMTA 4I7WA 4JTHA 3UXDA 3W86A 1K8ZA 1XDMA 1L6WA 4WXYA 2ZQ0A 4CLMA 4CQ9A 3CM4A 5IM51 3M6YA 4BWLC 1W5MA 5K3VA 4PA8A 3FEMA 1EPXA 2QJHA 2ZDRA 3N19B 3PG9A 3CB8A 4O15A 2C0AA 3N9RA 4TMCA 4ZQOA 3M41A 1ICSA 4UTWC 1VHCA 4UTHA 3KOFA 2PRLA 3OIXA 5I3IA 3LHWA 1YXYA 4O18A 3TV8A 3SJ3A 3N34A 3I65A 1ME9A 4MFDA 4CCCA 2C3ZA 3LX9A 3O6DA 1J4EA 4MJMA 1ZNNA 2QCLA 3HIJA 1NFBA 3UZ5A 5SWUA 1FUYA 4S2BA 1FCVA 1B9BA 2CLMA 4X9SA 3DFOA 4LV4A 3LTSA 2NXIA 2DJLA 4A3UA 1BWKA 4XQ6A 3W85A 1H7NA 3HGSA 4O50A 2PRMA 1KBIA 1WAUA 3G8RA 1LRNA 1EWDA 1KW1A 5F4XA 3G0SA 3Q58A 4YWIA 4AXKA 4XBKA 1X8FA 3N14A 5H2ZA 1V7YA 3S9YA 4O53A 5FEPA 4BI7A 4GXMA 1LRQA 1S5TA 1TV7A 3A22A 1TIMA 1W5OA 3DFPA 1ZENA 1R46A 1ZHAA 4LY8A 3EX6A 4A2SA 2AQWA 3W7OA 1O60A 1JJKA 1LBMA 1VYSX 2BZNA 3STEA 3NGJA 4TIMA 3QSTA 4N9EA 4UTJA 2WNZA 2NX3A 3DFQA 3OBKA 2WO5A 4E38A 1YLVA 3QFEA 2XN2A 1ML1A 3KVJA 5LGXA 3W1RA 3P67A 2R94A 3LBCA 2FDSA 2TRSA 1F74A 2YYUA 1X1ZA 3DGRA 1HL2A 1B4KA 3TW7A 1BWLA 3TUUA 1VJIA 1YDOA 3CU2A 3M5XA 3W2LA 4BI5A 4HSNA 3C61A 2ZZ3A 4FNPA 1TPFA 3ZWTA 3O16A 5FEWA 2CLFA 1GPWA 3TR2A 1P0KA 2GVGA 3Q2DA 4O1CA 3JR2A 3B05A 3DXIA 1U83A 4O1BA 3IIOA 4IWWA 1LOLA 3V75A 3LBMA 1AW2A 3L0KA 2J9YA 1L6YA 1OK4A 2E6FA 4Z1BA 2Z1BA 1KM5A 3L2IA 1W37A 2Y7DA 4DQWA 3BG9A 1OF8A 5FI8A 3NPUA 1UB3A 1HO1A 2H90A 4NJGA 1KV8A 1OFOA 3B4UA 3HG3A 4UIOA 3R13A 5C55A 2DZXA 4IX2A 1G7VA 4UC5A 2V2DA 4QIUA 1F2JA 4QSHA 3M43A 5C2XA 3RLUA 2ZTKA 1EP3A 5HR6A 2H3BA 4P61A 1IGSA 4HNNA 4PEKA 1FX6A 3BGJA 1KM3A 1ZAHA 3W1LA 1PCKA 4BF9A 3LHYA 3O8AA 2JGYA 2WNNA 1M7PA 3L66A 5HUOA 4O11A 1CX9A 3MBDA 3LHZA 2Y85A 4N6EA 2BSLA 1YPFA 3C52A 1I2PA 4GUJA 3HGRA 3TAOA 3MJYA 4IX0A 4MY9A 2QCDB 1F73A 3M0ZA 2DZPA 4ZQCA 3VCRA 1WYIA 2UV8G 5U7SA 4LVAA 4JDBA 1FWTA 4NJJA 4LUJA 2NZLA 1AG1O 2X1TA 3QSRA 1QOPA 1OYBA 2EGZA 3I7SA 3SZ8A 4WD0A 4UFJA 1TMHA 3TNOA 1QPNA 1DOSA 3SI9A 5I3JA 4HPXA 4CQAA 3EWWA 5D09A 4OHQA 2VEIA 4Q32A 3WJYA 4FXRA 2NWRA 2CW6A 1KFCA 1TQXA 3GX9A 4C1LA 3C56A 2RDTA 5BNKA 4GUGA 3GR8A 4JR5A 3M16A 2B7QA 3VI2A 1QMLA 3FJ6A 4JTLA 3PBUA 3P80A 2F84A 5BMXA 2X16A 1YXDA 2BXVA 2EPHA 5I3HA 3W7GA 4DPPA 4LVGA 2Y70A 3TC7A 1SW7A 2E6YA 4NXKA 3R89A 3IEBA 4IPIA 3ANYA 1L9WA 1PCWA 3WK0A 4DO6A 3JRKA 2E09A 5LKYA 1TTJA 2ISSA 3HG2A 4NZFA 3HGJA 4FEZA 3LHUA 1KLZA 3PULA 4Z08A 5IBXC 2QJGA 4A2RA 1SZFA 1XKYA 4AHOA 4PTNA 2O7SA 1UJPA 1W5NA 4JTSA 4MZ1A 3C4UA 3RK8A 1TTPA 4XKYB 3A5FA 4R7JA 2Q3RA 4L4MA 4O0KA 1T96A 1X1OA 3DH7A 1W31A 2IQTA 4JX4A 1GT8A 4AF0B 2YYTA 5D32A 3VE9A 4WUIA 4UTTC 1QPRA 1OJXA 3ABQA 2Y89A 3G22A 4A22A 3B8DA 4LRTA 1OFEA 3FIGA 1LLZA 1DV7A 3HQ1A 5AHNA 1VGAA 4K39A 3DHDA 2QAFA 2ZRVA 5A8GA 4FIRA 2I14A 3S42A 4XBSA 1W8SA 2R8WA 4PODA 3VE7A 3C2VA 1Q6OA 2EHHA 3GXTA 1OFDA 4NJIA 1KFBA 4BK9A 3QF0A 1RQBA 1G4SA 2R14A 4N4PA 1YTEA 3W7PA 4UNLA 3GDKA 4OU1A 1IIHA 2X1UA 3NDOA 3PSWA 3UWZA 1TPVA 4ONVA 5FF7A 2C13A 3EX4A 4O17A 4BWLA 4K36A 3CEUA 2CZFA 3TQ0A 3W75A 3G0UA 3DFNA 1J5TA 3NNTA 2C19A 1OFQA 2V2HA 1WXJA 4ZQPA 3LERA 2WPBA 4DF2A 1ICQA 5E0KA 2A1YA 3I68A 2E5BA 5LHEA 4UTWA 1SW0A 3QPYA 3P62A 1TPWA 1TPUA 4YLWA 3LCIA 3QJAA 1A5CA 3W1QA 4JYEA 1IXNA 8TIMA 4LTSA 1OABA 1RZMA 2WQPA 4AVFA 1H1ZA 5EYWA 4BR1A 2EF9A 3GLCA 5LHFA 4LU0A 1UUMA 3LB0A 4JTUA 4O12A 2GUUA 1VQTA 3HPZA 5EMUA 3EWZA 2KZHA 2B7NA 3IGSA 3C2OA 4N02A 3W7DA 4FX8A 1JRBA 1A5BA 1KFJA 1OFPA 5LZLA 1I2OA 2PCQA 3CWNA 3SW6A 2VOMA 1OFAA 2A4AA 2OX1A 3CC1A 4H6KA 1DQXA 1G4TA 5GVJA 3IVUA 3NQCA 4JIPA 2NUWA 1KM2A 3P7YA 4GRSA 2YDAA 1JQXA 4R34A 5KTLA 1R30A 5D37A 2Y6ZA 2VFGA 4RJEA 4LV9A 2ZRUA 3HGOA 5D2YA 2J9XA 1LRTA 4OGZA 1YADA 1TCDA 1U5JA 4JTEA 4LC6A 4H4IA 3OEXA 4FNTA 2FFCA 2V2CA 5D05A 4RZ5A 1TPDA 4AH7A 5AHEA 3KRUA 1PIIA 5F4SA 1OG0A 3PS7A 1TTQA 3EKZA 2QCHA 3WK1A 1GVQA 2VENA 5C5YA 4FNRA 5AC7A 3QRHA 1C9DA 1SSGA 3NQAA 4WX2A 3S6DA 1OYAA 4N2YA 4DELA 1PHWA 1MEHA 1FXPA 1W3TA 2DZVA 4RK8A 5FEZA 4IMEA 4GUIA 1W3IA 4FIQA 4LOCA 4IPJA 2Y61A 1YDVA 5CZJA 3MW7A 4ZVJA 5MHBA 2Q3OA 1DJQA 4IJBA 3T40A 2FJKA 3LTYA 4E2DA 1P1XA 2QDHA 2Y7EA 3STGA 4AMAA 5BW6A 4IMCA 1FCQA 2ZZ6A 4HNUA 5TQLA 4EIVA 1GWJA 1XI3A 1KBJA 3QZEA 3EKLA 3W1UA 1K02A 2J6XA 4RZ4A 4K37A 4K38A 2QCFA 2ALDA 3B06A 2W6RA 3QMRA 1JQVA 2OCZA 3Q37A 5EBUA 1X6UA 4LUIA 1WQ5A 5G4EA 4DXVA 1GQNA 4FXSA 3F1QA 4UTIA 3PUOA 1AK5A 4O13A 4EF9A 3HJZA 3FYOA 1GG1A 4WOQA 3GB6A 2E5CA 1ME7A 3MI6A 5DXYA 4JNMA 2BTMA 3NOEA 2C16A 4UCGA 2GVLA 4AWTA 4Q4KA 3SIZA 4ZQNA 3DENA 2ABAA 5HWNA 1OX6A 1S5VA 3THAA 2NUYA 3GXNA 1WV2A 1BEUA 3NM1A 3GNDA 1X7FA 3GKFA 2V5LA 5CZTA 2VEKA 3EXTA 3ZR4A 2CZDA 4O52A 3ZS4A 3OVQA 3P61A 1OYCA 3T55A 1K8YA 5CPOA 4O28A 3M47A 1OX5A 3R12A 2NWSA 4DF0A 1C8VA 1GVFA 2E6DA 1F5ZA 3AJXA 2QEZA 1SZEA 4GE8A 4ZZ9A 3QM3A 1ONRA 3S5OA 5AFDA 2C1HA 1JCNA 3UXAA 4Y90A 4BI6A 1XL9A 1GEQA 3QW4B 1EA0A 3G1DA 2Z6JA 5KMYA 3W7EA 4I9AA 3NO5A 5C6MA 1O5XA 3E0IA 5L9FA 2TSYA 3LXAA 1VC4A 3PBYA 3PF3A 1LZOA 4FHAA 3GDRA 4IOTA 2Q8LA 3BLFA 1H63A 1I8JA 4KWWA 1MEWA 1FCUA 5CKSA 3KVMA 3GYEA 2EKCA 4RKAA 1JCMP 3EXSA 1KM6A 5LNWA 3F03K 3UZJA 1JUBA
chains in the Genus database with same CATH superfamily
1FWNA 2DZWA 3UWUA 5T8GA 2QNEA 3ANVA 2C15A 3NR0A 2QF8A 3LGDA 1V7AA 3UCCA 5A69A 5ECVA 5I3DA 3UJFA 1NM9A 1LBLA 4MNJA 3E96A 5BCAA 1G4EA 1M03A 4H8UA 4BJHA 5GPRA 3B0XA 4MAVA 3WLOA 4S3CA 4BKNA 4UZSA 3QMSA 1VD6A 2WSRA 1TVPA 2XUCA 3NEVA 4KEVA 3QH2A 5BRPA 2V3GA 4FSAA 2DW7A 3TZNA 3FSTA 1VBJA 1TRDA 4GYPA 4L80A 3FW6A 2P8BA 4UOZA 4GY7A 4IIFA 3C8FA 5F2IA 1V3HA 3UGVA 1GOKA 1NVMA 3QN3A 4JCLA 4F0MA 1RY0A 4Z2LA 2P53A 3TYDA 3DFHA 1W3NA 5F4WA 2ON3A 4JHZA 1Q6RA 2R1NA 1H2JA 2RDXA 5JBFA 1OD8A 3RCNA 4GD0A 4D1IA 1DORA 4UR8A 4AZIA 5AC4A 5EY5A 4GVIA 3GK0A 4IQLA 2XH0A 4D8LA 3KRZA 2NT1A 2OLAA 2VP8A 4FAMA 4TV6A 4JIRA 2O9PA 2WM1A 4MUPA 4IUOA 3KBJA 1DKWA 4M7TA 3UA4A 3PWIA 2RFGA 1LOSA 4PB4A 1J0HA 4UFKA 2YL9A 3EDDA 4MWAE 5BROA 1CB7B 2ASHA 4MNLA 2VHLA 4ZOBA 1AW1A 3ZOAA 5F1VA 3EEGA 2YIHA 3OVPA 5CZSA 3LU2A 2YL6A 5C7HA 2VFEA 5FSEC 2EJ1A 4ERIA 4JBRA 4ATLA 4YVXA 1JCLA 4ALDA 1VB9A 2B31A 4PL2A 1DTNA 3VXGA 3ITVA 2VQTA 2OYMA 4XIAA 3GDTA 2AL1A 3UYIA 1JCYA 4ADUA 4HA1A 5BRBA 1XIEA 1PYFA 5HR7A 2ESCA 3L23A 1FDYA 2FHBA 4AX6A 4GZJA 4JD4A 3GFZA 3WEZA 1XIMA 1TJRA 1TV4A 3T0DA 3CAVA 1EX5A 3TIMA 5EKYA 4XIMA 3WLTA 1M04A 2FH8A 4S3KA 3RGTA 4KW2A 3NVDA 3LYEA 3W2UA 6REQB 4I6KA 2KX9A 4Y9AA 1Q2RA 4MWAC 3EWXA 4P7LA 3MUCA 3LSCA 1PTGA 3NZGA 8XIAA 3L4UA 1SU5A 4GNVA 1CXHA 2IQDA 1M5WA 2L5HA 1ODUA 1Y5WA 4N4QA 2WNQA 3WBAA 3L65A 1PKMA 4XKYA 1OFBA 4LS1A 1RQHA 1E5NA 2HPMA 4PE8A 1AQFA 4XBJA 3LSBA 3TW6A 3GXIA 4B15A 3JS3A 2XFFA 3PZ9A 3NZQA 1OIFA 2ZZ7A 4WDXA 1QXLA 4AEOA 5AOUA 3RX3A 2V67A 2PGEA 4XAFA 2WVSA 1JCXA 1XUUA 3H2OA 5CGQA 5F2LA 1HG3A 2CLHA 2XHYA 2GVJA 1XLGA 3HA1A 3P81A 2EPOA 4L64A 1XC4A 4H6QA 1JZ5A 4M7SA 1XBVA 4GQRA 2G96A 3CWOX 2V3EA 3UJ2A 1MUWA 3NA8A 3W73A 1WOAA 2X40A 7ODCA 2QGYA 3L4WA 5CBJA 2PI6A 2YR1A 2OSXA 4PBEA 1PWLA 1UD4A 3LXCA 4J7RA 1E1EA 3O0KA 3M5VA 4HB7A 1GK8A 1Q7MA 3ANUA 4LS0A 3N6QA 5BXSA 3M7WA 1XXXA 5G2WA 3W7KA 5GNZA 4C6CA 4FXJA 3GXMA 4QP0A 3TYCA 1SO6A 4HHLA 1OIMA 1L2UA 5FCZA 4QQ3A 2GWNA 2WCSA 1I4NA 4NX0A 2EQDA 2PE4A 4DZ5A 1F4AA 1XLKA 4J3SA 3VX1A 2P5NA 2YW4A 3DC0A 3W07A 3WQDA 3T6CA 3VNIA 4DWDA 2YFNA 4M81A 5A6AA 2WVTA 3IIPA 2BWGA 4IXXA 5LA1A 1JNDA 4JCMA 1VAHA 1V03A 3N2BA 4ZOAA 3SN4A 5IFPA 4GJ1A 2ZE3A 4HSOA 1FXQA 4PSPA 4FF7A 2ZX9A 4GKLA 3QYSA 1Q66A 2WAGA 4MKVA 3V1HA 2XN1A 4AZ6A 4EK7A 3AYTA 4DY1A 3VILA 4LAUA 3LQGA 1RJQA 2FB2A 4FX7A 3OA3A 2V69A 5DLCA 3OG2A 2HBVA 4O57A 2AQVA 2XFWA 5D04C 2Y24A 3MJMA 1BTMA 4DBEA 3PN8A 1SSDA 3ISIX 2H9AB 3TTQA 1LWIA 3FGCB 3GW3A 4UFLA 1E4NA 1FTXA 1K6AA 2OZ8A 3VPLA 2D23A 3N6HA 1FWHC 3M64A 3RFAA 1B3XA 2CXGA 2CC0A 1W9PA 3W7QA 3ATZA 3AIVA 1AW5A 4YCOA 1Z9AA 3QXBA 4YXGA 2DP3A 5FESA 3A64A 1U5HA 1QOXA 4NZ4A 5D2TA 2V6AA 1F3XA 3THUA 5E0CA 2WHJA 2FQIA 1ISZA 1DQUA 1W1PA 3WD1A 3QKEA 1TWIA 5I02A 1EUAA 1IGWA 3UPMA 3GTFA 1ZAIA 4IIBA 4UQAA 1YTDA 1PX4A 2VC5A 5F2MA 2GSHA 4JTRA 2WK2A 5D9PA 2CIPA 4JX5A 3S3GA 5I78A 5D03A 5A2CA 1XDJA 3W1PA 1AL7A 3BJFA 3WLPA 5EA9A 1QRQA 3W6LA 1IZKA 1J18A 3GXFA 1VYRA 4FR1A 5AYBA 3TTOA 3GU9A 3FKRA 4HJWA 3O05A 4DEFA 2FVKA 3QTGA 4PUDA 1UKSA 1T0OA 3LG3A 4GGHA 4Z1DA 1WDQA 3PTMA 4QG9A 3VU2A 4WGXA 4GFSA 4PRTA 2VO5A 1UKOA 1PDYA 3GD6A 3N4EA 4KCVA 2NV1A 3DKLA 4UFIA 1UJQA 2DVXA 2RAGA 3A3WA 3KL3A 1E51A 1FH8A 3VO0A 1D8CA 4G7FA 2H3DA 3PZOA 3SIMA 3B8SA 5AYXA 3VNLA 1KCZA 4MWAD 2V0TA 3L21A 1ISWA 4BQ2A 1P0EA 2ZUMA 1MRQA 2QZRA 3MI2A 1HW6A 4XZHA 3GWQA 4J28A 1ZZMA 3AIUA 2A3AA 1SFSA 4MVAA 2NX1A 1JULA 3QZAA 3ZLHA 3N15A 3GU1A 1GTEA 3OPSA 4LAOA 2ZE0A 4HNCA 1KO0A 3FN9A 4P2VA 3KLKA 4A35A 2HQAA 5HUPA 2OB3A 2OR2A 1H7WA 3H21A 3B04A 3AIQA 3CHFA 4L9ZA 2OYKA 1KTCA 2ACRA 1XR2A 4OIFA 4Z2GA 1N7KA 1WBJA 4F2TA 3CJPA 1J6OA 3O07A 4GIRA 5FF2A 5F1UA 2P10A 2X7VA 5BU6A 2CU0A 3T81A 2XM2A 1A5MC 3PZGA 4ZOCA 4MUZA 1POJA 1B4EA 4H2HA 3VGEA 2JIEA 2REQA 4JYFA 3D5HA 2CBJA 1EGVA 1BHGA 3SCOA 4UB9A 2IKJA 3HFYA 3AOFA 1EZWA 1F7BA 1H11A 1A5SA 2W67A 1LUCA 4TO8A 3NQ8A 1FRBA 3ABXA 1F4HA 3IJLA 4AXNA 3GO2A 3RNDA 1OY0A 3N12A 4QGCA 1L8PA 1HP4A 4R5EA 4DZHA 4OUEA 1J0YA 5D30A 2JKEA 3SUSA 1UWTA 5FL1A 5DBUA 3VOHA 1XIDA 3WD0A 3DBNA 1T40A 1FWIC 1AQHA 4YNGA 1R3TA 4RNHA 3A23A 4ZMGA 1YRRA 4Z0SA 2QF7A 4HHHA 4NZ3A 5U4NA 3W87A 3CL8A 2PWUA 4AZHA 1A4LA 6ENLA 4KH2A 4J40A 3QGAC 3GVGA 5HINA 4A4AA 4UTMA 3G1VA 2VFHA 1B1YA 4WKHA 5K9CA 4C1NB 1LLOA 4US5A 5L6UA 1KFLA 1MUCA 4ADTA 1UPPA 4W86A 4OZOA 3MUAA 4QS6A 4H9ZA 4LF2A 4NL1A 1HL9A 3W27A 1FA2A 3N3TA 3ZT6A 5LNRA 3MP4A 3AMCA 4PMDA 3W7HA 2A6NA 1UC4A 3LEPA 4JDYA 2DSZA 4FXFA 1ONEA 2GDQA 1IR1A 4JYDA 3GR4A 4G8TA 1DHPA 3N17A 3SR7A 1EUNA 4HPNA 2DT1A 1LOQA 2OTDA 2V63A 4LXFA 1W9XA 2GOKA 1VPXA 1I60A 1RA5A 3EXRA 2GQ3A 4AIEA 1LYXA 4DO5A 1B31A 3ATYA 1QO5A 3KWXA 3GTIA 4WSHA 1RD6A 3OB8A 1OT2A 4PMOA 1F6PA 4YVVA 3CGTA 2VMFA 3N3MA 5G1YA 3C0JA 2BHZA 1C9WA 2OFJA 2QULA 3WQ5A 1WPCA 2TPSA 3CO4A 4ERGA 5E5CA 3G1SA 1WNOA 3HU7A 3UD6A 2WOQA 3QV6A 3CK5A 3S6OA 5DCEA 4HOXA 2PDFA 2GSJA 1OGSA 4LT9A 1O68A 2WHMA 3EOSA 2FTPA 1TVNA 4MY1A 3R11A 1DJNA 3RN6A 3RLHA 1P0NA 2PSNA 3EWCA 3RJYA 3TH6A 3D3AA 1BSLA 3F4WA 3W71A 5D02A 1QNRA 3N2XA 4CQDA 2D0HA 2NLIA 2PDQA 4H7CA 3PR2A 1V0KA 4ORMA 3ZYZA 2Z6IA 3S1XA 1G69A 1S5WA 3RO8A 1PZ2A 3WLJA 3LCGA 2JFEX 1E43A 3N4FA 3LCHA 3MU7A 1PL9A 3SGGA 3T2PA 3P0XA 4D6CA 2YBUA 5TNVA 2ZX8A 3CZJA 2J79A 4DAFA 4EACA 3IIZA 4G7EA 4MFEA 1KV5A 2C18A 1W32A 3LA4A 4LVDA 4OTKA 5FF0A 1O5QA 4EXBA 2GWGA 1UZHA 3S8HA 2VR2A 2WNWA 2YA0A 4I9MA 2YB4A 5DANA 4DF1A 2CLKA 4D71A 2AAAA 4H7VA 1PX3A 1EBGA 5EMKA 3S5YA 1H5YA 3TDFA 4PMUA 4MJ2A 3NQDA 1XPYA 2XSXA 1A5OC 1I2RA 2G8ZA 3S2CA 2P50A 3T07A 1EFZA 5CBBA 1E6PA 4H2CA 3C0LA 1D8WA 3W7CA 1BYDA 3WEMA 5D2XA 2D3LA 1TUFA 1BG9A 4GFIA 3II1A 5G5IA 5FOOA 2O7QA 3GC5A 3E12A 3OLIA 4QSFA 3S1WA 2I5GA 1OCQA 3OHIA 4GCXA 2I7GA 1K03A 1OCNA 2V9DA 1QATA 3WLIA 3INPA 1I0DA 4GUFA 4H3DA 3FCPA 3KTCA 1VFLA 1V6VA 4KETA 1IIGA 1HZYA 1A80A 3BICA 1AUSL 5T9CE 5KZMA 3E74A 3POHA 1X7IA 3AXHA 1VBRA 1IEXA 1XBZA 3AS3A 2MANA 2ISVA 2PDWA 3HFTA 1RD5A 1SO5A 3G2GA 3SN0A 3V35A 1CXFA 3R58A 1OFRA 1FWCC 3PG8A 4YMZA 3L4TA 4C7FA 4LFYA 5I3FA 4JFUA 1C8XA 2G5WA 1UA7A 1DJYA 4AVNA 1NSJA 3TVAA 2YCEA 4D6HA 4I5XA 1SR9A 2V5BA 4J3VA 1OM0A 2VX5A 1DXFA 3WMLA 3U2ZA 3C2RA 1UD3A 1U1JA 1CW2A 1AJZA 3W84A 1R3YA 4X0NA 1VCVA 1IXOA 3P84A 1B57A 1GZGA 3TCEA 1DE5A 1L0PA 4EX4A 1EEXA 3IVSA 1UOZA 3GZAA 3ICJA 1JI1A 3A9IA 5HQEA 3EB4A 3FFSA 4DO7A 1AODA 3I7RA 1E6XM 1TPC1 2VCCA 4C91A 3FA3A 4PUKA 4RE4A 1PE1A 1V8EA 3AZSA 3CMGA 2DQWA 1CECA 4P7OA 3VNKA 4JQ2A 3CV6A 4X0VA 3B8TA 1FCBA 2SFPA 2OQYA 3EOOA 2OT1A 4HCDA 1UIPA 8A3HA 2GJXA 3S0CA 1AJ2A 1KXVA 3FV9A 3FDKA 2NW0A 4EXQA 2XVLA 2X0SA 1US0A 2FGZA 3UPBA 3VOFA 2CLLA 3UNTA 3CMJA 1TJPA 3DU0A 3WDPP 2AAMA 1NF7A 3A4WA 2I1OA 4IUGA 4Y8FA 1J11A 4MOZA 3E0FA 1DIOA 2DJXA 2VKZG 4HPGA 3RF9A 1XF0A 4QAIA 3HQPA 3VX0A 4QITA 2OLHA 4FPSA 3WLNA 2ZUVA 3RCMA 1NDYA 4C5YA 3QV7A 3WH6A 3FHAA 3TCSA 4NNBA 2X2GA 3REQA 3WENA 5G2HA 4WXYA 3CTTA 2ZQ0A 3PZIA 3BTNA 5IM51 4BWLC 5K3VA 3ZR5A 1DJHA 2CHNA 1L6GA 2ZDRA 3U57A 2W27A 3BSMA 1XQLA 2C0AA 2OLSA 2BMBA 3N9RA 4TMCA 1VFHA 2PRLA 1IZJA 1K9EA 4O18A 3TV8A 1ENUA 2HK1A 3I65A 4J2PA 3SCVA 2C3ZA 4LPCA 1OZQA 4E3TA 1YX1A 4XK2A 1WKEA 4IT1A 2FJUB 1FUYA 4S2BA 1P6BA 4WKFA 4C7GA 4OKDA 4P7NA 4PRWA 2DJLA 3TYEA 1M53A 3HGSA 1MNSA 1KBIA 2IPFA 3QY6A 3BMWA 5A8QA 3Q58A 4HA0A 4Z42C 4XBKA 1X8FA 2NLYA 1XLAA 2VZSA 4O53A 5FEPA 3UVIA 5HMEA 1TV7A 4GA8A 4H8VA 3LY0A 1M7XA 2W4XA 3BOFA 1W5OA 1MW3A 2CKSA 3CWHA 4GY1A 4L61A 1ZENA 4A2SA 3W7OA 5EFDA 1O60A 3I3DA 4IISA 2BZNA 2DUXA 4Q22A 3ONBA 4N9EA 4FLQA 2NX3A 3DFQA 4HK6A 1M01A 2WO5A 5J04A 2Y5SA 1ML1A 3R4IA 1X1ZA 3DGRA 2PDXA 1VJIA 3CU2A 4IF2A 4BI5A 1XINA 3F4CA 2Y8KA 4PCNA 1E15A 2ZC8A 4JTQA 1KQYA 2ZADA 1E6NA 1Z89A 5FIPA 1P0KA 4IP4A 3KZPA 1GORA 4O1BA 3IIOA 4HBKA 4IWWA 1BTCA 4QS5A 1QBBA 1NDVA 3LBMA 4E3VA 2WXDM 4NAFB 4Z1BA 3L2IA 1W37A 3NDYA 3UG5A 3WQWA 2Y7DA 1OF8A 5FI8A 3NPUA 3WLRA 3OIHA 4PMRA 1OFOA 1Q65A 3AYSA 1PSCA 3HQNA 4YWSA 5C55A 4IX2A 1EGZA 3AXXA 1TZ7A 3MY9A 1KBLA 3KBMA 2QGHA 1T5AA 1KXQA 4ZB0A 4PEKA 4Y9NA 3IGHX 2QV5A 4IFKA 3CH9A 3I3BA 3CZLA 4HMEA 3L66A 4WIWA 4O11A 3CHCA 2HPIA 1K9TA 1CX9A 3TYBA 4H9MA 1U2YA 3PAOA 3HGRA 3MJYA 3HJEA 5EB8A 3VCRA 2IW0A 1ZBCA 2VURA 2NZLA 3QSRA 4IQEA 2IPWA 1QOPA 4UFJA 1A0EA 1ZTVA 1DOSA 4OECA 2GVEA 5D09A 4OHQA 2VEIA 3FJ4A 3WUEA 2HBXA 3WJYA 3I10A 2MUCA 1TQXA 3GX9A 3C56A 2RDTA 3M16A 3FJ6A 5BMXA 3EWDA 1YXDA 4JFTA 1HP5A 2C71A 2Y70A 3B0YA 2VUYA 4IPIA 3ANYA 4Q4PA 4V27A 1OBAA 3UCDA 3WK0A 2VGBA 4G9PA 2HZGA 3JRKA 1TTJA 3UG4A 3ARWA 3IK4A 1P1MA 4WVXA 3T08A 1TJ0A 3BXWA 3AIRA 4AW7A 3R8GA 4A2RA 1KXTA 3QY8A 2WLYA 2EXOA 4NYYA 4JTSA 1Y8BA 3RK8A 3GQYA 3CUXA 2XWDA 2Q3RA 2CKRA 3QGVA 1X1OA 2UBPC 3V0TA 1M1BA 1RVKA 1XSIA 4KF1A 1MW1A 3MKKA 5HJXA 1TE1A 4PMJA 3DFYA 1EX1A 4LRTA 1B3YA 4XG1A 4AWEA 3HQ1A 5AHNA 3DHDA 4KGJA 4Q6XA 2ZRVA 2J6VA 3S42A 1ESWA 3SQMA 2R8WA 5ABGA 1S1RA 4NJIA 2ZVRA 5REQB 2PWEA 1RQBA 2R14A 2FTWA 3OGVA 1RP8A 1IIHA 3NGFA 3PSWA 4YTUA 3SO7A 3UWZA 3CQKA 5FF7A 2C13A 2PLCA 3T9PA 2WMIB 3CEUA 2CZFA 4H9YA 3TQ0A 4MNKA 1RA0A 3E0LA 4GI9A 5JBEA 4JQAA 2E0PA 1OFQA 3IUHA 4ZQPA 1RH9A 4BF5A 3KE0A 4UTWA 1TPUA 3LCIA 3CHEA 8TIMA 4DJDC 3OLDA 5HXMA 2MNRA 5IXEA 2WQPA 1PXGA 4AVFA 2EF9A 2BODX 3R10A 4LU0A 1UUMA 3LB0A 4JTUA 4O12A 2BP1A 1JZ7A 2BY1A 4V15A 4HZMA 4N02A 1JPHA 4X61A 5A2BA 1I2OA 3WQ4A 2VOMA 2HVMA 3PZUA 2A4AA 4QG6A 1A3WA 3UG3A 3M4HA 4HK7A 1G4TA 3ARYA 5GVJA 4JIPA 4JEJA 2XJ7A 1WZAA 1UD8A 2WC7A 2JEPA 5D37A 4IPLA 4XKMA 2BG5A 4W8AA 3HGOA 1YADA 1TCDA 3RU8X 4E4FA 4S3GA 1FKXA 4AH7A 2PDJA 4NRRA 1CLVA 1VJSA 3HZ3A 5CLWA 5F4SA 1OG0A 3I3EA 1Q7ZA 1TTQA 2F9RA 2WBGA 4HJFA 3E38A 3R25A 8RUCA 3L12A 1EJTC 3VD5A 4FNRA 5AC7A 3VKBA 1TJ1A 1RAKA 3SBFA 2XIIA 3AS0A 3S6DA 2BFGA 1PHWA 3SCTA 4L1WA 2H9AA 1IT7A 2ACUA 1AH3A 4Z1YA 4EPEC 1W3IA 5CZJA 4IPJA 2Y61A 1YDVA 2DZBA 4ZVJA 4YPJA 1XH2A 3MO4A 2Q3OA 3SRKA 2FJKA 3WX7A 1Y7VA 1Q4NX 1Q6DA 4BZYA 4F0KA 4AMAA 4IMCA 5TQLA 1XI3A 1CGXA 4Q8NA 4QE1A 5HNNA 1K02A 1GOMA 1WKYA 3K4DA 3IJIA 1GNXA 3TJIA 2QCFA 2ALDA 4O1FA 2W6RA 3QMRA 4ZA0A 3Q37A 1KBKA 1V6XA 1X6UA 4B5TA 1GQNA 1DJWA 1E6ZA 2R9RA 3KOYA 1UZDA 3DYPA 4H6EA 4B3LA 4OBSA 1O7AA 4H9VA 4PBGA 1UR9A 1J01A 3S47A 3GB6A 4A8IA 2PFHA 4LQ1A 3VD4A 1HGWA 1O66A 5DXYA 2BTMA 1QW9A 1V79A 3PJXA 1IEVA 3SIZA 1QK2A 3EDEA 2ZUWA 4ZQNA 3VNYA 4RW5A 4TX6A 5HWNA 5C9ZA 3VKKA 3K4AA 4PMQA 3MCNA 3GKFA 4S38A 1OYCA 2YDRA 3UG8A 5CPOA 3CYVA 5G4HC 1V77A 3AHVA 3GUGA 2VDIA 3RILA 2QEZA 4GE8A 5AFDA 3QLDA 3EPOA 3UXAA 1L6FA 2QPSA 1VFMA 3NO5A 5L9FA 2TSYA 1VC4A 3PF3A 3LENA 2QPUA 4JTCA 3PNZA 4KWWA 4FA3A 1YE4A 4M1RA 5CKSA 2FHCA 3KVMA 3GYEA 1RCQA 3OW1A 2DH2A 4RKAA 2XIJA 4PMZA 1KM6A 1X38A 3CUJA 1F8MA 3GHSA 1HKJA 4NJHA 3NZRA 4Q8VA 1VR6A 3P93A 1VHNA 4XZLX 2UY3A 4RR4A 3M0LA 2Z00A 4DNHA 1WDDA 3N2CA 3S4TA 1US3A 1CGVA 4CCZA 3NQFA 1I2QA 4WDWA 4LB3A 3DG6A 3NPVA 2GVYA 2J7HA 1A53A 1LQ0A 3ERPA 3VINA 4LAMA 2PGRA 3RXZA 3VIOA 3R1ZA 1D7KA 4RZBA 3NZ1A 1CYGA 2A3HA 5J5RA 2IQ0A 3L0GA 4K8HA 3UFYA 1QDSA 1UR8A 3UPWA 2E3ZA 3DIPA 3BGGA 3POCA 1FWBC 3E2SA 3VGGA 4GVGA 4CD8A 5GNXA 2A85A 3W9ZA 4PMNA 2XISA 1RK5A 3NO3A 4DJDD 3ZLGA 1DVJA 2BX7A 3BE7A 3ARTA 4BFAA 2HE8A 1E3XA 4LVBA 1P5BA 3CMFA 3NQ2A 3TC6A 3NSMA 4HHPA 3UERA 1EYWA 4KFPA 5AVNA 1GVYA 2PTZA 1CB2A 3TJLA 4U3CA 2ZOXA 4US5D 1THFD 1XIIA 1H49A 3WCZA 4J4KA 4INFA 1HFBA 5EMLA 1XX1A 4YJ5A 2ACQA 3H24A 2X7WA 1R85A 1SVDA 4NZJA 3E5BA 5LYRA 4C1NA 1W5QA 4OV9A 1VF8A 1Q45A 1RPXA 3VA8A 1Z44A 3WKZA 1E6RA 4UR7A 1QFEA 3B3DA 4DRSA 3SUTA 2D0FA 3A9BA 5AECA 4AZCB 2ZZ5A 1KNWA 4AIUA 1WA3A 1A49A 1QI4A 1ECQA 3E0VA 4RUBA 1Z8AA 4CKQA 4X60A 1OX4B 1TV3A 3C8NA 5TIMA 4J2MA 5HPCA 4M19A 3R0KA 4ZB2A 4LYKA 1CXKA 4P8VA 1ALDA 3AXKA 1QK0A 2F2KA 3RMEA 1VCGA 4RX0A 2JGQA 1M7JA 2QCEA 1WBHA 3EX1A 3NVTA 8XIMA 4KRUA 4KERA 2OG9A 3U2CA 4JQ4A 4FP1A 3S1UA 3IUIA 5D33A 3VZXA 2QCDA 3WLSA 1E6QM 2VOTA 4OBRA 1IE7C 5HMSA 3GG1A 3MHFA 4PL1A 1KWGA 3SN1A 5JQ9A 1SPQA 3GC4A 5I00A 2AL2B 3TK7A 5HMDA 1R38A 1ZY9A 3F4DA 2WSQA 2A3BA 3NZPA 2PURA 2BOEX 3ITLA 4WDUA 3CZKA 1XQKA 4I9TA 1E73M 3GFYA 4KWVA 3USZA 4AIOA 4CN4A 3QMTA 2NSXA 3O7UA 3MHGA 3RM9A 2J8GA 2JF6A 1C8YA 1UD5A 3KRBA 1F6KA 6TAAA 2QR6A 2ZA1A 1N8IA 1K7FA 1WE5A 2W5FA 2PRHA 1YE6A 3ZSTA 1ZP3A 2ALRA 1AZ2A 4YU1A 4O1DA 1ICPA 3I6RA 1WOBA 3RHGA 3TYAA 1KGWA 3MC5A 4JTTA 2FKPA 3TN3A 1SGJA 3KL5A 5AY7A 4E0CA 2XFYA 4GACA 2XN0A 4ZSTA 3KP1A 1Q6EA 2ISFA 2X1SA 5TAOA 1E5JA 4HKPA 5EMJA 5IOBA 2PZNA 3GDLA 1UR4A 2CLEA 1WAWA 1J96A 4Z2KA 1SJCA 3GS6A 3D0CA 3WEOA 1JDFA 4CD5A 5I0DA 2Z1SA 5A95A 1R6WA 5H8PA 3ARRA 3W2NA 3VIPA 1CENA 1SO3A 1H41A 2G3NA 2JALA 1FWEC 3GAYA 5BXPA 1CGWA 1BF2A 5LGZA 3O1NA 1FWSA 4ILSA 1TREA 4O16A 1CI1A 1XICA 1VH7A 3NL2A 3BW3A 2QUVA 3RLGA 2VYOA 1RXOB 3F4VA 2Q71A 1ITUA 2LLEA 2QCCA 1W6TA 4YHEA 2PPGA 1Y0EA 4XISA 3IJ6A 1LCOA 1E9YB 3CV7A 5AHLA 3SRFA 1SMAA 9CGTA 3NG3A 3GTNA 3F5KA 1K7EA 4C6QA 2GK1A 3G24A 1JGIA 1RHCA 3T42A 1W17A 4NNCA 1AH4A 1KFKA 3WDRA 1GYNA 4PUNA 4MAZA 4W7WA 4DJFC 2IS7A 4ACZB 5CC6A 4LUSB 5J5DA 3NQEA 1RSCA 5EPDA 3AHZA 2D0GA 3PBWA 3SECA 3ARZA 2HVNA 2QJIA 3DC8A 1QO2A 3EOUA 1EP1A 1TA3A 2ZUNA 1KWKA 2WKGA 3CH0A 3G18A 2IUZA 3OZMA 3WDHA 4ZGYA 3WNOA 2VFDA 2ZICA 4F2UA 4M6VA 5K4XA 3LV5A 4TQTA 1UR0A 4N6FA 4AYGA 1LG2A 3DZ1A 1EO5A 2PDIA 3MMWA 1U30A 2Z7GA 1KD0A 4UQ9A 4MZ8A 2RDWA 3SGUA 3MMDA 4ADSA 3G1AA 2XZ9A 3KTXA 1BKSA 3W72A 4W9TA 1QNOA 5I3GA 4URIA 3EDFA 5FEXA 4R85A 3W81A 4DVOA 3WG6A 1E0VA 3N25A 4ML9A 4NXSA 3HMCA 4JIQA 4YVPA 2X0HA 4EANA 4MMWA 1M7OA 5LXEA 4XZWA 3WQ6A 3H12A 1E70M 2C14A 4IFRA 4DWSB 2QUUA 2OEMA 3VZYA 2XTKA 1HF6A 3BOXA 2UY5A 3W70A 2RKXA 2H6RA 1W54A 4JTKA 4JTGA 1J2BA 4U4MA 1XBYA 1O4UA 4R9OA 2UY4A 3EB2A 5HJLA 1JIBA 3VVGA 2WANA 5HWJA 4ZE4A 5KSWA 1JPKA 2Z24A 3T05A 2J7EA 3WQCA 2O9TA 4P8XA 1QW8A 4HT3A 4ZEPA 1UUOA 1F3WA 3SCWA 4J1OA 1TX2A 3W7JA 4K8GA 4GC3A 3QHNA 2E6AA 2D24A 5HQLA 1J0KA 1TO3A 4NX5A 1PTDA 1WCGA 1D3HA 3URAA 2DORA 5BOOA 2VWTA 1ZBWA 2YB1A 5EL1A 1YEYA 1FY6A 2ATSA 1YKWA 2EPLX 1X6LA 3FYYA 3QR3A 5HWMA 2ZTJA 4B5NA 2PTDA 1XH1A 1YDNA 1XRSA 4GJJA 4KFOA 4FNUA 3LRMA 5A6KA 4G5DA 2CERA 2VFFA 4JY8A 4LCSA 3L5AA 3HM7A 1YNPA 5CZKA 4GYFA 4C60A 4NHVA 4MWAA 4BQ4A 3GVRA 2BLEA 2VUNA 3EA3A 1UQYA 4U10A 3W7RA 4JN7A 4RDVA 5DRCA 1M3UA 2YBVA 4V2XA 1TPH1 2VZUA 4LCQA 4CNPA 4CU7A 4KT2A 1DBTA 1UWRA 4JTDA 1JZ8A 4ICNA 1GKRA 1ZJHA 1V6WA 4NYUA 3L67A 2OQLA 2E25A 1AH0A 4NRSA 4TUFA 1RR2A 3F4NA 1CLKA 3FA4A 4ZXLA 4GZ7A 3M44A 3GH5A 4DM2A 3UZYA 4OE7A 1JVNA 2IXVA 4REQB 1S3HA 1FH9A 4NKCA 2GGGA 4MIMA 1I9CB 3PY2A 3ELFA 4B5UA 3QOKA 1YIXA 2NQJA 1UMLA 3QPZA 5G2IA 2X8RA 3AS2A 2ZFAA 5A6SA 1WX0A 3IJDA 4QLJA 3EZ4A 3RR1A 1ZJIA 3QHMA 4LYQA 3NPXA 3U9IA 1E6SM 3LLXA 2J88A 2Z29A 3LV6A 1QJWA 4MM1A 3OBEA 4S2CA 3CXOA 5F2GA 2PD5A 3W7IA 4JIIX 4WZHA 3DBPA 4ZO8A 3XIMA 4XUGA 2A7RA 3EBVA 1V5XA 3SEPA 1EKOA 2PTYA 2YPIA 2DV0A 1XCXA 4IMAA 5B80A 2EKGA 1DQWA 4H9XA 4RE3A 4XD4A 2PDYA 4M82A 5GJNA 2VEPA 1KCKA 3WD3A 3W1TA 5IHRA 1UCWA 5CBIA 1KCLA 1H4PA 1JZ3A 1ZFJA 2D2GA 4WEVX 5RUBA 4KGLA 3M07A 2RGLA 2E8YA 3WBXA 2PAJA 3TE9A 1NOWA 3LZ3A 3TW9A 3HN3A 2OELA 1TE6A 1US2A 2YFOA 2Z1WA 4W7VA 1XV8A 5HBFA 2OWWA 4Y9MA 2CFFA 2XVGA 3O3RA 2Z26A 2ZX7A 2OJPA 5KETA 3PPGA 3TSBA 1CLXA 1NELA 3E0WA 1VFTA 3W25A 4L4LA 5E6YA 3KOZA 3G1YA 1QNVA 4UXDA 3E02A 4KESA 3TTYA 4L6HA 3HPSA 3VKCA 3WO8A 1JFXA 2R1MA 4XVEA 3WK2A 3WDJA 5HAOA 4B91A 3ABRA 3AWOA 3AISA 5CJNA 4KFNA 2V30A 4HPJA 2W79A 3KBNA 1V3MA 3A21A 1SO4A 3GU2A 1XLJA 3U5UA 1QCWA 3BZGA 3U2EA 1SMDA 4LH8A 2AGTA 4G1KA 4FALA 3GDMA 2WLZA 1J79A 1JCJA 4R53A 1B90A 3QQ0A 4PCFA 3Q4DA 3N73A 1U22A 1GJPA 5KZDA 1UZ1A 5REQA 1REQB 2VD9A 3H2AA 2ABBA 3G1RA 3KVKA 3TA6A 3ABZA 3GXDA 3WD2A 3GZ3A 2E9MA 4ZO7A 2OEJA 2VRKA 2DZAA 1BYBA 4I5UA 1FDJA 4UTUA 2E28A 4IP5A 3HV9A 2BXYA 1PHQA 4XAPA 3CNYA 2ZKMX 3BW2A 4DIAA 2B81A 4GBUA 3DHFA 4M24A 5CGTA 2EEXA 4C6PA 1A5NC 2NUXA 1IWAA 3WNNA 5HNTA 3IGUA 3WDQA 2CHOA 2VR4A 2V8ZA 1OINA 1CT5A 1G1YA 1LWJA 2XSAA 3UA3A 2G97A 3UZZA 1MZHA 1W8GA 1JYXA 4UWMA 1R47A 2Q8ZA 1H61A 3W7NA 2BVTA 3T44A 1I0BA 4FX6M 7REQB 4B2DD 3WUBA 1ZBKA 2RDUA 4NSBA 4HN8A 1V6UA 4LUTA 3LNPA 3GVQA 4NAEA 4QX4A 5A8MA 2EAWA 1CBGA 3R8HA 4H9TA 3QQ1A 1O94A 2BY2A 1C8QA 4HYRA 1S2TA 2DW6A 3H54A 4CCEA 3P8IA 2BBFA 3KM8A 3MT1A 3P6LA 4UQBA 3OGRA 2XZ7A 1FWWA 1NOUA 3ITXA 4EF8A 4QJ4B 4WY0B 3ZVHA 2WMGA 4UQDA 4O19A 3ZXWA 3CL6A 1EYEA 4JN6A 1S38A 3J7HA 4YS1A 1GYLA 3MV01 3TLQA 3DYMA 3VMPA 4JPGA 3OVRA 4NUWA 2HNEA 1HJUA 1TTIA 3N29A 4LB4A 3LN3A 3W7MA 1VFFA 3WJXA 4AIBA 5FAGA 4UNIA 2PWHA 1NTHA 3W23A 4DN1A 3FA5A 1IEQA 3R0UA 4UBPC 3KWSA 2VC9A 1YHTA 3VGDA 4IL0A 2ISWA 1OC6A 3QTPA 1CXEA 3HPFA 2WKJA 3PPCA 5C54A 3CQJA 3ZT5A 5CJ5A 3WF0A 5HA7A 3AHTA 3TN6A 3VOIA 2Q6ZA 3WL1A 3MKCA 3AMGA 1XPGA 3PVFA 1TJ2A 1VYPX 1ZJAA 4F40A 2HE5A 5B7ZA 4EAYA 5CC3A 2ZRYA 2ZYFA 5M2FX 1N8FA 2PF0A 3LRKA 4MKSA 1MXSA 3V18A 3CPRA 3CIVA 4XSLA 4S3DA 3DFTA 4JFVA 4H8NA 4OQVA 2NX9A 1JYVA 4BS0A 1G01A 3DEQA 1OVDA 1Z6KA 4U28A 2YZRA 1ZCOA 2E7FA 2OGYA 4QQUA 4QTGA 3VDHA 1JNEA 1P6WA 4PULA 4G56A 4MLRA 4LBUA 3MUXA 3TAKA 1TR9A 3C6CA 2FVLA 4ZTXA 1AVAA 2HCVA 1LF1A 2D1ZA 7XIMA 2WJDA 1OHLA 3L2LA 3TOYA 4GZEA 5E9AA 1EWEA 1BXBA 1HNYA 3EPMA 2WSKA 1W2PA 5JXQA 1SR0A 3VFCA 4YIWA 1HJSA 2PF8A 4AD1A 1P4CA 1I6NA 3SCPA 3AYRA 1NU5A 2CYGA 4AD3A 2Y62A 3FXGA 3AS1A 2H8XA 3T8LA 1XIJA 2DGAA 3CPGA 4Q8TA 2XH7A 1BQGA 3CHVA 1E1FA 4WY0F 3B8VA 3O06A 4YHGA 2HTMA 3KS5A 4JTHA 3UXDA 4MGGA 5CSYA 4HYWA 1JAEA 1L6WA 4CLMA 4GXPA 3M6YA 5FJPA 1EGMA 1W5MA 4HPHA 3FEMA 2J4GA 4B16A 3B9AA 4DZAA 1XIBA 1IYXA 3N19B 3U48A 1XGEA 2OU4A 3OLEA 2DDXA 4ZQOA 3M41A 1ICSA 1P7TB 4J3UA 1VHCA 4UTHA 4U2YA 2A3LA 4TXEA 2VCAA 3LHWA 1YXYA 1R87A 2WSPA 1ME9A 1X39A 3C0SA 4FK9A 3LQLA 5G1MA 4F0SA 1VKFA 1WZMA 2AQOA 1ZNNA 2QCLA 1SM9A 1NFBA 5SWUA 1FCVA 1B9BA 2CLMA 2NXIA 1BWKA 3GIPA 1UWQA 3VIKA 3MUY1 2PRMA 4OUIA 2YA1A 3G8RA 4PGLA 2W3ZA 2DFAA 1EWDA 3EGJA 5F4XA 3WQPA 1E9LA 1LQ2A 1OGGA 3CV2A 1JFHA 3NURA 4H1ZA 5FJTA 4BI7A 5CJMA 5GQBA 3CZGA 1QHZA 2G50A 2W91A 2DUZA 3U3HA 3DFPA 1R46A 4BQ5A 4A6GA 1VYSX 3NGJA 5D9OA 2FZBA 3AICA 1KQZA 3OBKA 1OCBA 1RCOB 2FVMA 4AZ5A 1JDCA 3GNRA 3KVJA 2V5DA 3P67A 3PZVA 4GGBA 2R94A 1UD2A 1ZLPA 4NIRA 1W9VA 1WDSA 2TRSA 2XGBA 2YYUA 2QV4A 4KEUA 1B2YA 1EJXC 3M5XA 2OYLA 5D8WA 1P6CA 4HSNA 1YMYA 2R1PA 3VKDA 2XVNA 2CLFA 4QAWA 2VI0A 4PUEA 2GVGA 3Q2DA 3CL7A 2JE8A 3ARSA 5C9RA 1Q13A 4RNFA 3UU0A 2HDJA 1GQLA 2J9YA 2HVOA 9RUBA 2E6FA 2Z1BA 3VDCA 4QRNA 1GOQA 4DQWA 3BG9A 1HO1A 3UVAA 1DWFM 4F9JA 4S3FA 1FHUA 4H41A 4KMQA 1JDDA 4MADA 3VNZA 1G7VA 3JW7A 3APGA 4QE5A 1QNPA 3VCNA 3R43A 2V2DA 1F2JA 2ZUTA 4QSHA 2ZWYA 5FL0A 2PDUA 1OADA 5HR6A 7ENLA 3BGJA 4ZXOA 1PCKA 1G94A 4BF9A 2I5IA 3WELA 1M7PA 4HMNA 5HUOA 3VDAA 2WC4A 4Q8UA 3C5QA 4UTFA 3CV1A 2PDBA 2AMXA 3MBDA 3LHZA 2Y85A 1QBAA 1EA9C 2VVNA 4HU0A 3SQLA 2OQHA 3N11A 3GNXA 1F73A 4ZQCA 2UV8G 4JDBA 4LUJA 3WMBA 5XINA 4GX9A 1H0IA 4C5ZA 2PWFA 4A8RA 5BXTA 4ZFMA 4MTVA 5I3JA 3M7SA 2E40A 1TWWA 2NWRA 1KFCA 3H7UA 2GDVA 5BNKA 2NV9A 4GUGA 3VI2A 2CXEA 1ONXA 4GLEA 2X16A 4K2SA 3GC2A 2E6YA 5I23A 3R89A 4H01A 3IEBA 4L1XA 4JNYA 1PCWA 1BGAA 4CD4A 1BYAA 1I75A 2WPGA 1XYFA 4IGSA 2VC7A 2E09A 4RDWA 4V1XA 2EG6A 2ISSA 4LF1A 4FF5A 2NT0A 4NZFA 3TWAA 1E56A 3OVGA 5IBXC 2QJGA 3SRHA 4XO6A 1XKYA 4FLSA 3A3HA 2O56A 4MZ1A 1VFUA 1KRMA 1TTPA 4XKYB 4R7JA 4L4MA 1UPMB 2V68A 1BXCA 1RALA 3M0YA 4L4OA 1EDTA 1VBHA 4AF0B 4UTTC 3ABQA 2BASA 3GSMA 2WWDA 2Y89A 3G22A 3B8DA 4D72A 2BDQA 4Z2HA 1DV7A 4K68A 1O12A 3CT2A 4CNSA 5A8GA 4FIRA 1GKPA 1QHPA 3JVAA 2J7CA 3TA9A 4PCSA 1CTNA 1VFSA 2EHHA 3EB3A 3BAWA 1KFBA 1MFUA 3OJGA 4P7QA 3V5OA 1QNSA 2OWXA 1G4SA 5LIYX 3W7PA 2G3JA 4PFHA 1TPVA 4GK8A 3EX4A 4BWLA 4NI8A 2PTXA 4M80A 1J5TA 4D6EA 3NNTA 1O1ZA 1UMYA 1WXJA 2WPBA 1FVPA 3WFLA 3I68A 3WLMA 2WVVA 5LHEA 2XIBA 4B9ZA 4N42A 2FTYA 1TPWA 2YCIX 4IG2A 1CPUA 3QJAA 5FACA 1IXNA 2DIJA 4LTSA 1GYMA 1OABA 5AKQA 2DT0A 4K1WA 5EYWA 4GO8A 2ZX6A 5LHFA 1JF5A 3N2OA 2J13A 2O55A 1VQTA 1GQKA 4M29A 1EC8A 3IGSA 4C6KA 1V02A 1ZPTA 3PTDA 2P76A 2IXUA 2DT2A 2VX4A 2PCQA 3SW6A 3CWNA 5LZLA 4ECLA 4L9YA 3CC1A 4H6KA 1DQXA 5XIAA 4W93A 1A5UA 2R6OA 5FA5A 3ARQA 3AALA 2YDAA 1JQXA 5KTLA 5I07A 2Y6ZA 4CVUA 2VFGA 4RJEA 3RUBL 4XZNX 3W38A 2IPGA 1PPIA 1DWGM 4JTEA 1EDQA 3OEXA 3OBAA 5D05A 1TPDA 1ELSA 5DO8A 1Q2SA 4R7WA 2XSBA 3H6OA 3PS7A 3OA5A 1QI5A 4YTTA 4E4PA 5M03A 4W4QA 4M0XA 5M5DA 1GVQA 1QVBA 1B3WA 3MV11 4DXKA 2BV9A 1TELA 1UW9A 4GG9A 3ZMRA 3XINA 2OO6A 3AHXA 1UR1A 3NQAA 3ALFA 3AROA 4Z2IA 1TUXA 3PPFA 3WUFA 1KXHA 3EA2A 1MEHA 1FXPA 1GQJA 2DVTA 3RX4A 4GH1A 5FEZA 4IMEA 2EJAA 1ZUAX 3CBWA 4LOCA 4DBUA 2ODOA 3M0MA 4KCUA 5CEWA 4GQ0A 4IJBA 3T40A 3MB9A 3CAQA 3EMZA 2OXNA 3QGKC 1P1XA 2Y7EA 2P3ZA 2VM8A 3V7PA 3O0FA 1JD9A 2ZZ6A 3UJRA 3VGHA 1JL8A 2G3IA 4K37A 1MRAA 4L6OA 4C6IA 2ACSA 3OODA 4GPNA 3H4GA 5EBUA 2OCZA 5C9UA 4CQCA 5G4EA 2OOGA 1XW8A 2CZVA 1W1B1 4TV5A 3FJNA 3IWPA 3PUOA 2P0IA 1K4HA 2J78A 5A6LA 3FYOA 1EC7A 3W24A 4U2ZA 2E5CA 3NOEA 4UCGA 4LBSA 2GVLA 2XM1A 4GIEA 2O92A 4AWTA 2XDFA 1K9DA 4YTSA 2POZA 3THAA 2NUYA 1WV2A 4XB3A 3ES8A 1X7FA 5CAKA 3ZR4A 3DX5A 3WQVA 4BEQA 3OVQA 3RIKA 3GBDA 4O28A 3WNMA 1OX5A 3R12A 2NWSA 2VRJA 2D2HA 1V51A 4ZENA 2E6DA 3WF3A 3AJXA 4Q7NA 1MFVA 3ME3A 4Y90A 4F66A 3G1DA 2Z6JA 1QASA 2AMGA 5C6MA 3LXAA 1A0DA 1LZOA 2PDPA 3GDRA 2Q8LA 3BLFA 2HXTA 1MEWA 1XFCA 2CETA 4HGXA 2CWXA 4O0QA 1AJ0A 3WN6A 3BANA 1PBGA 3DN5A 4ZSUA 5BRQA 4FLRA 4AD2A 3LXBA 5AHFA 5C2CA 1BYCA 5AYZA 3LMZA 1B3VA 2CBUA 2POTA 3VOJA 3PWAA 1OK6A 2CLIA 1N55A 3IUDA 4IM4A 4NASA 2YBTA 2ZCGA 2REQB 3LLFA 2WV8A 1E1CA 2PDMA 3BG3A 3WK3A 5D2WA 2QIIA 1GTHA 1E9IA 2O9RA 1D7FA 4OFCA 3VGFA 4LAZA 3W1AA 2V3DA 1LUCB 3CQ0A 3OG3A 3SGZA 4ZQMA 3BQ5A 3T4WA 2YGYA 2ZWZA 1B30A 4B5WA 1OC5A 3WQGA 1QPQA 4XVDA 3W76A 3BLOA 1B3OA 1H60A 3RU6A 4HMDA 2BVDA 3T09A 3PC0A 3VK5A 3ZJ6A 4QJ5B 3O2LA 1H51A 1Q4WA 1LWHA 1C7TA 1ZU8A 1KKOA 3ITGA 1VBGA 3WIJA 2NQ9A 3MA8A 3MP5A 1HKIA 4DJDA 1J0ZA 4CVWA 3NOYA 3AU6A 4POCA 5DBTA 2E67A 3Q67A 1IT0A 4M6UA 2J9ZA 2O9OA 2GGHA 1TMLA 4MDOA 1Z42A 1TWDA 5KINA 2QXWA 2CESA 5D8ZA 3A4AA 1PZ3A 1EO7A 2DSVA 1Z48A 2P8CA 4AC7C 1OCJA 2HXUA 5FJRA 4UMBA 3WQFA 3QC3A 4Z1CA 2VXNA 3GG8A 1GHRA 2X09A 3URQA 2OODA 1TYGA 4NY2A 5M3WA 1S5MA 2ZRXA 3EWBX 6XIMA 3HBLA 1SZGA 3B4YA 4I9JA 3H22A 1UIOA 3BGAA 4C6LA 3O63A 1FH7A 4HU3A 1O6IA 3BK0A 2PU1A 2GUBA 1A4MA 1KTNA 1DP0A 4EWND 1R3VA 5LNUA 5CSSA 4DAIA 2J24A 1OWQA 3VCCA 4GY0A 3V4BA 1XP3A 3RPTA 4M56A 4M6QA 3PBGA 2FZDA 2D2JA 4GCAA 4EXAA 2Q09A 4RDZA 2D20A 5ABFB 3PP7A 4P7RA 1H5VA 1ZCCA 4HIBA 4U31A 3TR9A 3R94A 4MPQA 2E1DA 4FB7A 3UGRA 4GZIA 5AC6A 3H8AA 4EAMA 3SFKA 2HV5A 2C7FA 4EWJA 2QVNA 1J2WA 1C91A 5KZEA 1F07A 1M6JA 4N9BA 4F48A 1OT1A 3E2VA 3H2EA 2OOFA 3P82A 2G0WA 4RPQA 4CCDA 2RHGA 2RUSA 2TYSA 5KEZA 1R5YA 1RK6A 1NH6A 1ZJBA 1UH2A 3W2KA 2QCGA 4HCLA 2FFIA 1XD0A 4LNYA 2PP1A 5DMLA 3E2QA 2WBKA 4PMYA 4Q4RA 1OD0A 2FPTA 5A1AA 1A3HA 1VRDA 1UASA 2GL5A 1XRVA 3GNPA 4PMVA 3VIIA 3B8WA 1G6CA 4R33A 1ZQ5A 4UTKA 3AMDA 3NQ7A 2YDSA 1E55A 1RLDA 3S2LA 1E3ZA 1UH4A 2QUMA 2W63A 2WZMA 4Y7EA 4KEZA 1LROA 2WSYA 2DPEA 4TVUA 1XLBA 4O0ZA 2E9LA 3VFLA 3WQOA 2XVKA 3CYJA 3JU2A 1RY8A 4TR9A 3MO7A 4N0RA 1YTKA 1KKRA 1W2VA 2B0MA 5BOFA 1V0MA 4ZBCA 4FO4A 2VZTA 4UTLA 1REQA 2INEA 4N9DA 3DECA 3MVIA 1A5AA 3VGBA 1Q6FA 2AKZA 4R9XA 3S6TA 1UKPA 3MANA 3THDA 3H2NA 1NDWA 5A6BA 3UF9A 4AB4A 3L4YA 3W7LA 3IPWA 2BY0A 2PC4A 1EJRC 4DYKA 3O15A 3MYPA 1LL6A 3SUUA 1NAL1 1LDCA 1PIGA 3EMQA 2YCLA 3P3BA 3BAJA 3VDBA 4B5VA 3VIHA 5C9WA 3P5ZA 3GIQA 1XS2A 3VD3A 3V1PA 4EKJA 3SY5A 5DFAA 3EWYA 2Y1HA 3WLKX 4Q4SA 2XH4A 3ZJ8A 1DXIA 4JN8A 4ORIA 1JAKA 7REQA 3BAXA 4GNKB 1V3LA 2WJEA 2IKIA 3M0VA 1F05A 1UD6A 1F3EA 1JXKA 2R91A 2QMJA 2YLLA 1NOFA 3RX2A 1WDPA 1XRTA 1AD4A 3AO0A 3PSVA 1MW0A 4X63A 3ZWSA 2Y8VA 3AYVA 1I2NA 3ITCA 1MEIA 3HG4A 3NQMA 1SJAA 3AU2A 5GJMA 5A8PA 2G37A 1Q8AA 2Y0FA 2QJMA 4JKLA 1H7PA 4K1GA 4WY0A 4HU4A 2X0YA 3K4WA 1HIZA 4HNOA 2F61A 4TTUA 1WDWA 4JGDA 3W22A 3WY1A 3NQVA 1NWTA 3OYXA 3E3HA 2V5JA 4JTJA 3SCNA 1LTDA 2YKKA 4CQ8A 3W6YA 2JIWA 3FX4A 3D3FA 4S3AA 3N18A 2W92A 3OZPA 3B0PA 1D3GA 4W85A 2C1IA 4PYSA 1IT8A 4HTYA 3KAOA 3TQKA 5G4WA 5DXXA 4B92A 5LNSA 2J75A 3P8JA 1X97A 1HO4A 4P8WA 4RCXA 2BS9A 5I5RA 6ALDA 1HTIA 1RQEA 1H1YA 1NF0A 4XX6A 1C29A 3D6NA 1D3CA 5C2GA 4JS3A 3EOEA 3G0XA 3GFXA 4B4FA 4J27A 2GQ8A 5HJYA 1JZ4A 2DZUA 2Z0IA 3O6AA 1JDEA 3IARA 5I77A 1JCTA 1Z41A 2OT0A 1W1VA 3LPFA 4S3EA 2BVWA 2QCNA 5CPSA 2D2OA 3WH5A 4XZBA 2W61A 2VTFA 1MUMA 1W0MA 3CAKA 5AB3A 5K9DA 2E68A 1UR3M 1K6WA 2VZOA 3PZQA 2HEJA 3TJ4A 2NQLA 3W83A 1R9YA 1V02E 1DWJM 4HD5A 2Q02A 3FYPA 3TMLA 2FZMA 2GJXB 5GJPA 5FJOA 4HNVA 3B0VC 1TV8A 2EG7A 3DI0A 3MP3A 1UUQA 1VRXA 4E2BA 2PLMA 3LGEA 5MKGA 4G2DA 2GQ9A 2JK2A 3VD7A 3LM7A 5ABHA 1W9UA 4IPNB 3WJWA 3FLUA 1NQ6A 4IFOA 2C6QA 3W02A 5LNVA 5E0FA 4RNJA 4C6FA 3GAKA 2VT0A 3GIYA 4S1FA 1Z3NA 3UWQA 3W53A 1J0JA 1W3KA 1B54A 1N2VA 3IJ7A 5DY2A 1FFRA 1TB3A 3NDZA 3REQB 3E6EA 3NFUA 4C6BA 1XG4A 3WJSA 3FOKA 3P0WA 3VM7A 1Q6GA 3GY1A 2Z28A 3UJEA 3GH7A 1Q3NA 2YX0A 3IS4A 3G6LA 2YW3A 3NEHA 3SSZA 3GYCA 1ZAJA 4AWSA 1BRLB 4ZE5A 4EE9A 3OZOA 3RJXA 1KRAC 5JBDA 5JH2A 4IPPA 4A3YA 1UHVA 2CCRA 2HMCA 2YXXA 2A5HA 3L4XA 4WSJA 2XWEA 3UYCA 1JXJA 3VABA 2P1FA 5I03A 3ABOA 3WNPA 3V5CA 2PUZA 1CWYA 5A6MA 4PC8A 3PB0A 4CU6A 3U4FA 4CN1A 1Y5XA 2NSOA 4UCFA 5HMFA 5CH9A 4J5NA 1TPB1 4IGNA 1GW9A 4UOJA 2JKPA 4E5TA 4GBDA 1NFGA 3MHUA 1PX8A 2GJLA 2W9MA 1NP0A 5FKYA 3WLQA 4US6A 4LEFA 2WW5A 2WVUA 3H53A 5I09A 2XPKA 3CLWA 4JZ5A 2VGIA 4Q8OA 5K4ZA 3GR7A 2JBMA 4C1KA 2Y4SA 5D38A 1EBHA 4YTQA 2PZ0A 3P5YA 3K8LA 3NQ6A 2XGZA 4MYXA 4NT0A 5TD4A 1VFOA 3QYQA 2V3FA 4LY4A 2W66A 1L6SA 1P0BA 3OO2A 2QMKA 1KCXA 1HUVA 2EPMX 1EZ2A 2GJNA 2A0NA 4YCPA 1V0NA 4KRTA 3TLLA 2V38A 4O10A 2UZ9A 3NPWA 1XIFA 4JKMA 4DYJA 1BVZA 3MUIA 2GGIA 4IIHA 3W88A 3OLGA 2G41A 3JZEA 4O8AA 2Z2BA 4PH6A 3UY8A 1WP6A 3TX9A 4XZ9A 2NVDA 4K7VA 3H7RA 3AUOA 4IMFA 4P5UA 3UW6A 2FB3A 4DX3A 5BXRA 3RG6A 5DN1A 1EC9A 3NXFA 2WHKA 3SCSA 4X2PA 5DELA 3KVLA 1AFSA 3WNKA 4DWSC 4W5UA 3L2MA 1GHSA 1FWRA 1W56A 2HS6A 4DBWA 1GVOA 3KXQA 3LCXA 3ARUA 3W1NA 3ZO9A 3K5XA 1BAGA 2GLKA 1GVRA 3CEPA 5BWAA 3SRDA 4DJFA 1F9CA 4PUMA 1K77A 3PB2A 3R6IA 4HNLA 4IGMA 1PV8A 3GUWA 2QUTA 3MDUA 4IFKB 4XZIA 3NQGA 1Z7AA 3MMUA 1GJUA 3C2EA 1H7RA 3O9NA 2B7PA 1MO0A 2WB5A 4MY8A 2Y7FA 3SUWA 4K3ZA 4X9YA 2J7BA 1PVNA 4Y8EA 5CPNA 3PUDA 4DLMA 1EPVA 1DTUA 3E1F1 3K30A 1UR2A 4XAYA 3U7BA 4B90A 4WHBA 3MCMA 5CPMA 4QEHA 3BAYA 1ITQA 4C7DA 4IIDA 3WSUA 5E93A 1ZALA 4DHGA 1ONWA 4WK9A 1GGOA 4PMXA 2AGKA 4W84A 4I7VA 2PCEA 3S5ZA 4NZ5A 4U33A 3VIJA 3DYOA 2GQAA 1BGGA 4Y6GA 3PUEA 3TJXA 3UWWA 4D9PA 2Y7GA 4A3HA 3NYZA 5ABTA 4AAJA 4KCWA 4LGXA 1EJUC 6REQA 3STPA 2HJPA 1EOKA 1PZ0A 1FHDA 5D2VA 2JKAA 4A21A 4UOQA 3NL6A 1YPIA 4MKNA 2DZTA 4K6AA 2INFA 3KBSA 3A24A 4JTIA 2C91A 1NDZA 1GZJA 5BWFA 3TP4A 3HMJG 1NWRA 1IXPA 4AD4A 3ZR6A 2I9UA 3FJLA 1DWHM 1TZZA 1O95A 3QW3A 4N9CA 4AF0A 2ZC1A 1CDGA 1BPLB 2J8TA 3EX2A 3CIWA 4NNAA 2QJJA 1EB3A 1TV2A 4O4WA 4O54A 2HS8A 4U5KA 5EBAA 3LHVA 4FOKA 2QVHA 4ICMA 1B3ZA 4CD6A 4K7YA 2PGWA 3V36A 4QHRA 2E5DA 2PC8A 5K9XA 1W1TA 4WF7A 1NJJA 3AIBA 3SURA 1EEPA 1E72M 3H70A 5FJIA 3S1VA 1HKKA 5DY3A 3KDNA 2PMQA 3LI0A 4PB5A 5TBOA 1F6YA 2ANUA 5IDIA 3QEZA