3W7JA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-6-040
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-6-040
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7jA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7jA01
3KFTA 3NNTA 5CSRA 1A5CA 3PBWA 2Y89A 4UMBA 2Q8LA 1FDZA 3MYPA 3GNDA 1TV7A 1HG3A 3GDLA 2E6DA 5EY5A 4UNLA 1GEQA 3F03K 3C6CA 4AWUA 3L9CA 3BLEA 3NAVA 1SW0A 1W5NA 4Z0SA 3W83A 4LY8A 2B7NA 3G1FA 1FBAA 5FEWA 4ZZ9A 1ZNNA 5CZJA 1O4UA 1FCBA 5LNRA 4MJMA 4UFHA 2WSRA 3LTYA 1YTEA 5D03A 5HR6A 3DH7A 1K03A 2C13A 3LBCA 1KTBA 3BW2A 4DPQA 4TIMA 2OMAA 4E2DA 2ZZ2A 3UWVA 3EXTA 5D32A 3GX9A 1VS1A 5FEXA 4UC5A 4L4LA 4JIQA 2QUVA 3PG9A 1FDJA 3ELFA 4FX8A 1E51A 2ZCGA 1SQ7A 3MHFA 5HWJA 2QAFA 2AAMA 1A5AA 3UZ5A 2OCZA 3IGXA 1I2PA 1LDCA 2ISVA 3HMJG 4O53A 3C2OA 3LCXA 3IIOA 2DZTA 2CLLA 3PUEA 4AEOA 1W37A 1XC4A 3IRDA 4BR1A 2R94A 3UYCA 1XBZA 4DO5A 1TPB1 4NQ1A 1Q6OA 1TCDA 3O63A 4FXSA 3NDOA 1X7FA 3TFCA 3QQ0A 2CLHA 1O5KA 1R2TA 3FKRA 4HPXA 3G8RA 1QOPA 3VE7A 1OK6A 4UFKA 3N73A 3FJ6A 2NZLA 4AHPA 1EX5A 2DZUA 4AWSA 2RDWA 2VFHA 4ZQRA 4O0ZA 4IMDA 2ZA2A 2E5CA 1EWDA 1WX0A 3P81A 3CIXA 3FFSA 1KM6A 4L4MA 1O60A 4M6PA 4JTKA 3M47A 3M41A 4A22A 4JTLA 4J9JA 4PC8A 3G8EA 1OFBA 3PUOA 3B03A 1FCQA 4JS3A 3O6YX 3RLVA 3QH2A 4LRSA 3FYPA 3W1AA 4DF2A 3LXBA 1O94A 4MIMA 4S2BA 5CZSA 1VCGA 3V75A 2V30A 1I8JA 1LRNA 5DXXA 4ML9A 3EKZA 4NNCA 4A29A 3UQNA 4DELA 2CWNA 4JTFA 1H1ZA 1SW7A 1TB3A 3TNOA 4EVZA 5FEZA 3CWNA 4X22A 5F4XA 2HS6A 4JY9A 4MOZA 5D2VA 1RR2A 2QAPA 1YYAA 4FHAA 1SO4A 1KM2A 2CLKA 5T26A 4RJEA 4DF0A 2RDUA 3LOTA 2YCEA 1FWSA 4MYXA 3A5VA 3QQ1A 6TIMA 1OF8A 3RMJA 3FOKA 1K02A 3M5VA 4HSNA 3WJXA 1B57A 3IVUA 3UWQA 5DCBA 2DZWA 5AYZA 1L6YA 1F7BA 3IIPA 1QO2A 2V2CA 1N8FA 2GQAA 4JTGA 5U4NA 3TQVA 4WUIA 4PL2A 3F1QA 1ZCOA 1TQJA 3CEUA 4UTUA 4KKXA 1RV8A 5LSMA 1PCWA 2CLEA 3DI1A 1ONRA 2VC6A 1SZGA 1Z48A 4MZ1A 3BW3A 1R2SA 4FF7A 3WJWA 2PRMA 5AHLA 3C3NA 5LNSA 1QDSA 2VXNA 3AO0A 1KFBA 4LVDA 1U5JA 1XCFA 4DF1A 1WXJA 4M5PA 4TMCA 3YPIA 3TJXA 2YDAA 2Z1BA 1EA0A 2VFFA 1I4NA 2QUUA 4NXSA 1T8XA 3W84A 3LCHA 2VFGA 3NQ6A 5H2ZA 3OA3A 3PULA 1Z42A 3MI6A 1JQXA 1DQWA 3A22A 4BF9A 2J27A 2P10A 5G4EA 2ZA3A 2PCQA 5A8GA 4YLWA 4U4MA 5D2WA 3LHTA 2J6XA 5FF7A 1SZFA 3SI9A 2E68A 1Q6RA 4GWEA 2FQIA 5KZDA 1AW1A 3M16A 3N19B 3GDTA 3BVJA 1GQNA 3USBA 1JCMP 2WKJA 3W7RA 3CTLA 1W3IA 3HGOA 3U8GA 4A3UA 4RXGA 3UXAA 4HN4A 4HNUA 3GZ3A 2Q8ZA 1XBXA 1ZALA 3W74A 1F74A 3W2JA 1B4EA 1OG0A 3O05A 4O4WA 3SSJA 1LRTA 2A21A 5HMSA 5DCEA 4RZ6A 2YYUA 3NQEA 4FNTA 4LVFA 4JDYA 4NJIA 4PA8A 4HHPA 4MUZA 1OFRA 2A1YA 2QJHA 3GAKA 5CPOA 5FI8A 1PHQA 2GUUA 1L6WA 5C54A 1LRQA 4JYDA 3TFXA 4HNVA 2FPVA 3O07A 5G1YA 4NU7A 5KZEA 3HQ1A 3O6CA 3VKJA 3P5ZA 4FXRA 2A6NA 2Y62A 1HO1A 1VRDA 4XWUA 3V1PA 3QMSA 2F7FA 4MYAA 4UFJA 1C8VA 2H90A 4ORIA 1VHCA 1OJXA 3WK2A 1TPC1 1LOQA 4JTSA 2TYSA 4QNEA 3TV8A 2HSAA 5F4SA 4WOZA 2ZRZA 5EYWA 3WJZA 2ZZ5A 4YXGA 4JYFA 2Y7EA 1OFEA 3M5XA 4AHOA 2V81A 1HTIA 3HBLA 4O1DA 2OX1A 3NQ7A 5AC8A 5HWNA 2ZRUA 3EX3A 2ZRWA 3L65A 4PH6A 2RHGA 3R2GA 5KITA 3NQFA 1ZY9A 3SR7A 2WSYA 4LC8A 4UTWC 1VYPX 3Q37A 3R89A 1G6CA 3T55A 1FX6A 1QCWA 3IGSA 3S9YA 1GJPA 4ICNA 3I65A 1N55A 3P80A 3MWAA 1A5BA 1KM3A 3G0SA 3NPXA 3MP4A 2H3BA 4FO4A 1TQXA 4YWIA 3P60A 1TRIA 5TIMA 3TSDA 1J4EA 1WBJA 1XKYA 3OBKA 1BTMA 4BI6A 4UTTA 1YTDA 1WOAA 3S1WA 3FEMA 4HIBA 2G96A 3L0GA 2VEPA 1O5XA 3P67A 1ADOA 3STGA 2AGKA 3NEVA 5TQLA 2WNQA 4XKYB 1F5ZA 4X3ZA 2AQWA 2OT0A 1S5TA 2WOQA 3S0CA 2A0NA 3EX4A 3ZWSA 4RZ5A 1M7OA 2BLEA 3G1HA 1UJPA 4IGHA 1M7PA 2E09A 4OBTA 3S1VA 4BI7A 1SU5A 5F1UA 1DV7A 4OE7A 4Q33A 1LZOA 3O8AA 3C52A 1GYNA 3IEBA 3MHUA 2CZ5A 5HR7A 3STCA 4JX4A 3TMLA 1L9WA 4KFPA 3P82A 5F2GA 2WV8A 4MLRA 4Z1CA 2JKAA 5HULA 2KZHA 3TAOA 3TQKA 2EF9A 2ZRVA 1O95A 3O15A 4UTMA 2J24A 2VOMA 3W07A 2VFEA 5E93A 4GBUA 1VZWA 4IX2A 1FWTA 5BMXA 3LXCA 1ICPA 1H61A 3BG3A 1I2NA 4IQLA 3DHDA 5DY3A 3LHWA 5HNRA 5EBUA 2FLIA 1JVNA 3WK0A 4K8EA 4AXKA 2FPYA 1JCXA 2R91A 5BW6A 1YLVA 2VENA 4UTIA 3H55A 4FNUA 3LHUA 5BOOA 1KBJA 2DZXA 3TCEA 3TROA 1TJRA 2FDSA 4K36A 1AK5A 1CI1A 3PF3A 3S5OA 1B3OA 5D33A 5EL1A 4CLMA 3E9AA 1JCNA 2EAWA 4A2SA 1GVSA 1KW1A 5D2TA 1WV2A 4KFNA 4QM1A 3HB9A 2Y7GA 2E1DA 5F2MA 1JJKA 3EXRA 3G3DA 4A2RA 5D30A 4WZHA 4X2RA 4XBKA 1W5QA 4IX0A 4CCDA 1DJQA 2XN1A 3GNNA 3RK8A 1LTDA 1ME8A 3HG5A 1TTJA 4YL2A 1NF7A 3W76A 1KBIA 2ZA1A 3DU0A 3U6WA 3PY2A 3UWUA 2XN0A 3BW4A 3VNDA 2C14A 4QQ3A 4I9AA 2Z0IA 4PCFA 4ZVJA 3NQCA 2DZSA 1W56A 3LV6A 2Z2UA 2VEKA 1F6KA 6ALDA 4Q32A 3MBDA 4MVAA 2EHHA 1A50A 3HG3A 4XKYA 4JTIA 1EP2A 5K4ZA 3LB0A 1R46A 1VH7A 5I3KA 4AHQA 3UPBA 2PRHA 4OV9A 3JS3A 2ISWA 4Y8FA 1UCWA 3FS2A 4ZL1A 1QPOA 4OV4A 5DCDA 1U83A 2HMCA 2RH9A 2PRLA 1RQEA 1M5WA 3BO9A 2NV2A 1VPXA 1OX6A 3LRKA 4O18A 1ICQA 3DXIA 5KINA 3ATZA 3AJXA 3TAKA 5IBXC 3I7SA 3TIMA 3E12A 3QM3A 2QCMA 2TRSA 4Z1DA 2QCHA 5G1TA 3LTPA 3F4WA 3NQGA 4IPJA 4H6KA 2ZBTA 3EWUA 3HOJA 5AHIA 3W1NA 1HUVA 3BK0A 2PC4A 4UR8A 1L6SA 3P7YA 1VLIA 2ZZ7A 2ZZ6A 3P8JA 4HNTA 3PAJA 1W31A 1EEPA 5D02A 3L66A 5F2IA 1KTNA 5K9XA 5LHFA 3DFOA 2FB2A 2I9EA 4O19A 5BNKA 4XQ6A 5D05A 3GDMA 2QJGA 2R8WA 3G24A 4LV9A 1QO5A 1TYGA 1J2WA 5K3VA 1H7NA 3MJYA 2Y7DA 3KRSA 4IOTA 1H62A 4GUHA 4WY0F 3LRMA 3GXTA 2ZZ3A 3BG9A 3EX6A 3C2VA 1QPNA 3SGZA 3CEPA 1CX9A 3I68A 5IM51 1V5XA 4NJGA 3LHVA 3G0UA 2B7PA 2ZRYA 4WQ6A 1MEIA 1IXNA 1JCLA 2EGZA 3KVLA 4TMBA 3TXVA 4LW7A 3IV3A 2O7QA 3L21A 4FIQA 4RKAA 1LLZA 2O7SA 3CIWA 1D3HA 4NZJA 5J5RA 2A5HA 2NXGA 3W7PA 1PV8A 4Y6GA 1RQHA 1YXYA 1Q3NA 3GR8A 1GVOA 4GFSA 2ZRXA 2WQPA 1LCOA 3TQ0A 3IVTA 2QEZA 1LLWA 3QSTA 4CNNA 3OVPA 4POCA 3ANYA 1CW2A 1T99A 3NYZA 1LYXA 5FF2A 2V0TA 1YDOA 5KMYA 1SO6A 2EKCA 1FXPA 1HO4A 4JR5A 3S5ZA 2QJIA 2V2HA 3L2IA 5EPDA 3NGJA 4LS2A 1NAL1 3HPSA 4UUIA 3CC1A 4O50A 2Y7FA 3B04A 4BWLC 4BK9A 2Y63A 4Y96A 2QCDB 1SUXA 5G2WA 3LHYA 4XZ9A 2BX7A 4R7JA 3QW4B 3L67A 3PM6A 3LGEA 5AFDA 4DO4A 4IMFA 2CLFA 3STEA 2Y61A 2A7PA 3UY8A 4FNPA 1QAPA 2QCNA 4K38A 1EWEA 3NZRA 2TPSA 1A5SA 4ADUA 3M7WA 3W7EA 2X1RA 2R14A 2JKEA 1LOSA 1JUKA 4E0CA 4DQWA 4O0KA 4RZ4A 3IGUA 4I7VA 1FY6A 5AHNA 4MZ8A 1TPH1 4B5NA 1SFLA 3R13A 4Z1AA 1AW2A 5J5DA 3LTSA 3NG3A 4ZQNA 1FCUA 1I2RA 4O54A 3L5MA 3UXDA 1BWLA 3RNDA 1TSIA 2ZDRA 3P5YA 1KFKA 2C16A 4YCPA 2YGYA 1H7WA 2G97A 4JTEA 1KM5A 3PSVA 3KVMA 3CHVA 3UD6A 1W3TA 4ONVA 3ABSA 1XDMA 3TX9A 4IPIA 4WX2A 4UCGA 1S3HA 3B4UA 4CQAA 1TO3A 3GDKA 2CFFA 4HNNA 4LUIA 4AWTA 4YCOA 3GLCA 2YXGA 3CM4A 3NQVA 3I7RA 3BARA 4MFDA 5DELA 4QIUA 1K8YA 1GTHA 4O10A 4CCEA 1VJIA 1ALDA 3CWOX 2GJLA 5AYYA 1QPRA 5A5WA 2JKPA 2RKXA 5F4WA 3DZ1A 3EEGA 3HGJA 2C18A 3W7QA 4XTDA 3S6DA 3S5YA 3W1TA 1QNVA 2A7RA 3LLFA 1R2RA 4N9EA 1WDWA 2RDTA 4LNYA 5HJLA 1G4TA 1P0NA 3S42A 3QJAA 1QPQA 5I3HA 3RU6A 5FESA 1R47A 1ZAJA 4ALDA 1I45A 3GB6A 4FNQA 4NJJA 5D2YA 4GUGA 3LV5A 4O8RA 1OYBA 1ZAIA 2A85A 1IXQA 2QCDA 3NL3A 4JTTA 1D9EA 4LOCA 2OZ0A 1GVQA 4JNMA 4ZQPA 5I3FA 3WK1A 4NJHA 3DFPA 3KAOA 4IJBA 5CGQA 1JCJA 3W6YA 4MKNA 1LM1A 2Q3OA 4FIRA 3ZFHA 3DKJA 4C1LA 1YPIA 4IMCA 1SPQA 4QITA 3MI2A 3W1RA 2C6QA 4PL1A 1FWRA 5I3JA 1RZMA 3NQ2A 3TC6A 4OGZA 2DJLA 4OU1A 1OYAA 2QCGA 3W85A 4JX5A 5CZ0A 4WXYA 1EUNA 4MY8A 3S8HA 3NQAA 1P5BA 3QSRA 3W7JA 5CPNA 1YDVA 3GKAA 3LXAA 1MEWA 4Z08A 2NLIA 3SW6A 1X1OA 1H7PA 2Y88A 2DU2A 1OK4A 4GUJA 3E02A 3W1QA 3LCGA 5DBUA 4N9BA 4JYEA 1YPFA 2E5BA 3EWZA 5AHMA 5LNWA 1KV5A 4EF9A 1FXQA 2VKZG 3EXSA 4LUJA 4LS1A 4O1BA 4M7SA 3T44A 1VLWA 4MPQA 5ABTA 3EKLA 4DPPA 4QNWA 2WPBA 4QISA 3B06A 2XN2A 1LP6A 2CW6A 1TPFA 1VCFA 3TUUA 3BGJA 3MP5A 1THFD 1YXCA 3QC3A 3UY7A 2J9ZA 2V2DA 1H1YA 2GVGA 2HTMA 1TPDA 1TV5A 3LBMA 5D09A 3C0JA 3FIGA 1PL9A 3NQ8A 3KRZA 4K8HA 3BG5A 4MFEA 2P0OA 3W75A 1PVNA 3SGUA 2CLIA 3MMTA 4M7TA 1VCVA 5KTLA 4A21A 3W1XA 2G5WA 4FB7A 5I3IA 2W79A 1EB3A 4UNKA 4O12A 3O16A 2FB3A 3TK7A 1W54A 4QAIA 2E5DA 2Q3RA 2YW4A 2ZQ0A 3CPRA 3W2LA 1Q6LA 1DHPA 4HPJA 1OX4B 3LDVA 3M5YA 2I1OA 2YR1A 3S5NA 3QMRA 4CCCA 4EF8A 4IMGA 4FNSA 3LI1A 4IUOA 1G7VA 3HO8A 4PODA 1VQTA 2A4AA 1FUYA 2TMDA 1FWWA 2QDHA 5DY2A 1RD5A 1G7UA 2GOUA 4OQVA 4R53A 3PVFA 1XL9A 5D37A 3FA5A 5HQEA 3UWWA 3UWZA 4K39A 3NL6A 3T78A 2JBMA 4ORMA 1JRCA 1MEHA 3A21A 4ZMGA 2NUWA 1T0OA 4BFAA 2NXHA 5I3GA 4O11A 2A2IA 3VI2A 3W7OA 4UTKA 4RCXA 1B9BA 3B0VC 3VFLA 2ZFAA 3SECA 3TMQA 3G1VA 4TU1A 1AW5A 4DEFA 3CT7A 7TIMA 1EUAA 4MZYA 5FF0A 3QZEA 4I7UA 1JULA 4LU0A 2YFNA 3PSWA 4ZQCA 4FNRA 3KHJA 2G95A 3JRKA 2BSLA 2B7QA 3A5FA 2WJZA 2QCCA 4WXZA 3W22A 4N9DA 3THQA 1T96A 1DBTA 1NEYA 3QPZA 4AMAA 1ZHAA 3TC7A 4LVBA 2NUXA 3THAA 5LZLA 3OVQA 2NX3A 1B4KA 1UUOA 3D0CA 3GK0A 1XBVA 4UFIA 5C5YA 1KV8A 1TTIA 3UNDA 3NPUA 3TSBA 1TPUA 1GWJA 2X2GA 1XM3A 3BLIA 2DZPA 4M19A 3P61A 4EIVA 4X9SA 4DXVA 3RFAA 4JTUA 3W70A 1KA9F 2GVJA 3NZ1A 1TPVA 4IWWA 1HFBA 1SR9A 1XUZA 2B7OA 1OX4A 4O1AA 3H54A 3LX9A 2ZZ4A 4NNAA 3VE9A 2NV1A 1H7XA 2C3ZA 2Z6IA 5HWMA 4EOUA 3UWYA 1IIHA 1G69A 1OFAA 1C9DA 2NXIA 1SSDA 3OHIA 3N34A 2WSQA 5AC6A 3ZR4A 1IXPA 5CSSA 2X1SA 3GIYA 1XBYA 1XXXA 3EX2A 3TH6A 1D3GA 4AB4A 5BRBA 1G4PA 2CZDA 4H4IA 3NA8A 4UMAA 1IIGA 3RLUA 4R33A 3HPXA 2BWGA 4OT7A 4JXCA 2E6FA 1G67A 5FF3A 1PHWA 2V5LA 2ATMA 3W88A 1YADA 2IQTA 1BKSA 3GXNA 2YPIA 1C29A 2C19A 3T7VA 4JD4A 4S2CA 1F76A 2QCLA 2FFCA 2GVLA 3M44A 4UTHA 2OT1A 3B0UX 1WAUA 3PC0A 1UBSA 3TKFA 4NUWA 4GUFA 2H6RA 1WYIA 3GXPA 4DBDA 4IXHA 5HUPA 2JGQA 3ATYA 3HGSA 4UIOA 3G1XA 1VGAA 3W7HA 5E1QA 2YZRA 5AHEA 3Q58A 2X1TA 1K8ZA 3L0KA 3MUXA 4O1CA 3CB8A 2QCEA 4N4QA 3MW7A 1XI3A 1DVJA 3STFA 2WNNA 5CPLA 4EWND 3FJLA 4O52A 1OF6A 1LBFA 2BZNA 1NF0A 3IIXA 3W23A 3E49A 3P74A 4O13A 1V7YA 3N2XA 4DBEA 2Y70A 1SZNA 3TW6A 1AMKA 1BEUA 3LCFA 3LM7A 4N6FA 5HUOA 4K7VA 1RPXA 1VC4A 5E0KA 3W7NA 1QOQA 2LLEA 3LLDA 2C1HA 4LWWA 2J9XA 1PCKA 5K2ZA 1FWNA 1VYRA 3TXZA 3DFSA 2X16A 3NXFA 2E77A 4LVAA 3DBPA 2WNZA 2RFGA 3EWBX 1YTKA 1J5TA 5CZTA 4UTWA 3ZWTA 1PIIA 2BTMA 4GC4A 4UMCA 4PFMA 1WOBA 1W5OA 5EKYA 4HSOA 2ALDA 3QEZA 3EWWA 3KX6A 4WY0B 3G1YA 1FCVA 3HIJA 1KTCA 5LKYA 1H5YA 1OFPA 2NUYA 3TR2A 3H53A 2V5BA 3SIZA 3OVRA 3C4UA 3OEXA 5F1VA 1H7RA 5AOUA 4ZQMA 5TBOA 3O6DA 1XDLA 1QR7A 3W86A 1JRBA 4FEZA 3A9IA 5KSWA 4NJKA 2BXVA 1QFEA 4O15A 2VEMA 2EPHA 3EB2A 3PBVA 3BV4A 1W5MA 1KLZA 2W6RA 4CNOA 1F73A 5KZMA 1W3NA 3W1LA 4CNPA 3W7LA 3PBUA 4NXKA 2YYTA 3QPYA 5AHFA 5K4XA 1P1XA 4KFOA 2P1FA 1JCYA 3QF0A 2JK2A 3KVJA 2A6LA 3L5AA 2CZFA 3P84A 4I7WA 4E38A 3PS7A 1K7XA 1K3UA 5AN7A 2J88A 2DORA 5GVJA 3W73A 4UTTC 1SW3A 2WO5A 3HPZA 4ZQOA 2NX9A 3LCWA 1TTPA 3W7DA 3PBYA 3W87A 3MHGA 1SO3A 4BI5A 1JUBA 3LRLA 3KRUA 1Q6QA 1NFBA 3E96A 4RLIA 1HL2A 4W9TA 3LCIA 5G2IA 4LVGA 1IGSA 1EP3A 3M1ZA 1F6PA 1OX5A 8TIMA 2FPTA 3NQDA 3W1UA 3P8IA 1EP1A 1IF2A 1DORA 1MO0A 2JGYA 3INPA 3LI0A 4AVFA 3DFQA 5LGXA 3SZ8A 3L5LA 4MLJA 1WQ5A 3VCRA 3G22A 5BMWA 4JY8A 3W2KA 3CQ0A 1GTEA 1TJPA 3B05A 4UXDA 3S1XA 4KWWA 4O4VA 3FLUA 1TMHA 3MO7A 4LTSA 2PURA 4RXFA 4WY0A 1QMLA 1X1ZA 3M43A 4JX6A 4UFMA 3WJYA 1BWKA 1F2JA 4Q4KA 5K7JA 5DXYA 1W8SA 4M6VA 1GPWA 4N02A 1MSSA 3W7GA 2J9YA 3ABQA 3TSMA 3IIVA 4LRTA 4S1FA 2C0AA 1DKWA 2H3DA 3PB2A 3MI3A 4MJZA 4XUGA 1KM4A 2GQ9A 3OG3A 1OYCA 4AAJA 1OFQA 4WOQA 3SY5A 1YXDA 3QFEA 3W1MA 3QW3A 1H50A 3C2RA 3O1NA 4K37A 3MP3A 2CU0A 3DAQA 3ZS4A 3F4NA 2ZZ1A 1S5VA 3NQMA 3W9ZA 1Z44A 3A23A 1UASA 1SSGA 1OABA 2UV8G 1AG1O 5IBXA 4G1KA 3EWXA 3I6RA 3NPWA 3W2NA 2E6YA 1WBHA 3O06A 1P0KA 3FKKA 2V82A 3A24A 3OIXA 1ML1A 4HKPA 2Z6JA 2OJPA 2YFOA 1FDYA 1AL8A 1TV8A 2ABBA 1KFCA 1RVGA 1S5WA 3DKLA 3SFKA 3G3MA 3B0PA 4OHQA 4NVTA 4LC6A 1K8XA 3QMTA 3IVSA 1DJNA 3CLMA 1Z41A 3GDRA 3PG8A 5K9DA 5DN1A 4JTHA 2DJXA 5G2HA 1XUUA 4H3DA 2H8XA 3HG2A 5LHEA 2VEIA 1PS9A 3W7KA 4WJEA 2I14A 3BLFA 1KLYA 3N9RA 4N9CA 5D38A 3WFAA 4P61A 1M6JA 5SWUA 4JIPA 2CLMA 4WD0A 1ME9A 3ABRA 3K30A 1H60A 2VELA 1K7EA 1GVFA 1TIMA 1LBMA 2QDGA 1TPWA 5D04C 3TU9A 4RR4A 1SZEA 3QYQA 1LOLA 4CQ8A 3HF3A 2YX0A 3DGRA 4K7YA 4N4PA 1DQXA 2XFWA 1IXOA 3NM3A 3GR7A 2ZTKA 4FX7A 4JDBA 4Z1BA 1W5PA 3KOFA 5H91A 2CLOA 3N9SA 3DI0A 4PTNA 1DOSA 3UPWA 5CPMA 3L68A 4NX0A 1MXSA 4AF0B 1ZJIA 1SFJA 3M0ZA 3NPVA 1PE1A 4M6QA 2ATSA 4U28A 1TRDA 1VHNA 5HINA 4O17A 2VFDA 4DO6A 3LERA 4P2VA 1SO5A 5C55A 5C2XA 1EIXA 4IMEA 4BWLA 1W0MA 1I2QA 1LBLA 3EX1A 4RK8A 5CG7A 1P4CA 4O14A 1ZAHA 3T4CA 2E6AA 1FQ0A 3JR2A 4NX5A 1GVRA 3MYOA 3W1PA 2GQ8A 3NL5A 3M5ZA 4JTJA 4TO8A 1QWGA 3DENA 3W7MA 3CU2A 3KVKA 3TE9A 2YW3A 5FEPA 1ZFJA 2TSYA 4UTJA 1G4SA 5LGZA 1UB3A 4FX6M 4GUIA 5LNVA 2B0MA 3GVGA 2DP3A 3GAYA 1JUEA 1DL3A 4E2BA 1H7OA 4HT3A 3DHFA 4NT0A 1OHLA 1WA3A 1TPEA 2ABAA 3N14A 3W3OA 1NVMA 1KFLA 5MHBA 3P62A 3C8FA 1TTQA 1GYLA 3Q94A 4LV4A 1TREA 2HS8A 5AB3A 3MBFA 3PUDA 3W71A 1Y0EA 4RV8A 2NWSA 2NX1A 4PEKA 5U7SA 4GRSA 1F05A 2PE4A 3U2OA 1UUMA 1KM1A 3C56A 5G5IA 4KWVA 5L6UA 1VYSX 4CQ9A 2C15A 3G1DA 1AL7A 2CZEA 4N2YA 2X1UA 2ZTJA 4GJ1A 3DFNA 3G1SA 3Q2DA 3N3MA 4QSHA 1Q45A 3R5EA 1ICSA 4NNBA 4NZFA 4GE8A 3NOEA 1G4EA 1H63A 3UZJA 3BPWA 1GT8A 1N7KA 4XTIA 1GG0A 2VFIA 4LS0A 4AF0A 2Y6ZA 4O28A 5G4WA 1I2OA 5D2XA 5F2LA 3LCLA 3L0NA 1K7FA 5LNUA 4JGDA 3T40A 2YSWA 2QUTA 3W2UA 4JEQA 1A53A 3W72A 1W1ZA 2V9DA 3NO5A 3M9YA 3RF9A 4C1KA 5K9CA 2QF7A 3TJLA 1GG1A 3PWAA 3C2FA 2V8ZA 3EWYA 2FJKA 4D2JA 3GYEA 3S1UA 1JR1A 1X8FA 3W2MA 1MZHA 1VR6A 1XFBA 4MY9A 5DBTA 5L9FA 3B8DA 3HGRA 3FYOA 1L2UA 3PB0A 2X30A 4GXMA 3ABOA 1LROA 4JICA 4UFLA 2ZYFA 4IXXA 3NVTA 3PR2A 2Y85A 1KM0A 4Y90A 4RX0A 3M6YA 1OFOA 1YDNA 1LORA 4ADTA 2A7NA 5C6MA 3LHZA 1GZGA 1KFJA 4UTLA 5FF4A 2GPTA 3HG4A 3SJ3A 3TW7A 4LT9A 3NM1A 2ISSA 5AYXA 3G1AA 3E0IA 1ME7A 1RQBA 4MY1A 3QRHA 4AH7A 1JQVA 3TA6A 3N2MA 4O16A 1R30A 3W7IA 4R34A 2NWRA 4ADSA 2H8ZA 4GNJA 4QJ1A 2B4GA 1ZENA 3IIZA 5AC7A 3C61A 4TR9A 3HJZA 3KXQA 2GJNA 4N6EA 5EA9A 4YMZA 1OVDA 3GKFA 1OFDA 5DLCA 4Y9AA 3NR0A 2QR6A 4XBSA 4O57A 1KFEA 5CKSA 2QCFA 3TDFA 2F84A 3I7QA 3R8RA 3NL2A 3WK3A 2DZVA 3WJSA 1X6UA 2QKFA 3G18A 2FIQA 3W7CA 4UR7A 4OWGA 2W0UA 3G0XA 3R12A 1GOXA 3C2EA 1NSJA 4TX9A 4K6AA 1H51A 1EPXA 4Z0JA 2D73A 4JN6A 3DFTA 2FTPA 3BGGA 5EMUA
chains in the Genus database with same CATH superfamily
5AECA 2VL4A 2I5QA 4FF5A 5GJMA 4IF2A 2Y89A 3FSTA 4UMBA 1E6PA 1TWWA 4F48A 3OYXA 3FV9A 3S9ZA 1RD6A 3C6CA 4ZOAA 4GZ7A 3BJTA 4IGSA 3NUKA 1SW0A 2D23A 3WY1A 4LY8A 4B5WA 4CQDA 3MTWA 4PMUA 3UJRA 5JBEA 3S6TA 3GC5A 3RMEA 5D9PA 1FCBA 4HYWA 3RR1A 4S3KA 2WSRA 1GKQA 2QNEA 1YTEA 5HDRA 5D03A 2EPOA 2C13A 3LBCA 2CIPA 1Q2RA 3BC9A 5I09A 1KTBA 4DPQA 3PUGA 1VBUA 4MADA 4YYCA 2GUBA 2NVDA 2PFHA 4PUNA 3GG1A 5REQB 4JIQA 1CEOA 1FDJA 1E51A 4YTRA 4TVUA 4XG1A 1QXLA 5JUVA 3P6LA 3EDFA 2ISVA 4OUIA 3TN4A 3C2OA 3LCXA 3PUEA 1TPB1 1Q6OA 3KS5A 1KBKA 3QHNA 4NRSA 4ICMA 4J3SA 1BAGA 1L2QA 2PAJA 3TFCA 2L5HA 4WHBA 3F7JA 3GU2A 1JDCA 3C0QA 3QQ0A 4C6JA 4F79A 3FNDA 1OK6A 4UFKA 1F4AA 2NZLA 4GVGA 1EX5A 2DZUA 2RDWA 3ORWA 4ZQRA 4O0ZA 4IMDA 3AYTA 2ZA2A 2E5CA 2F38A 1EWDA 1WXZA 2HPIA 4L4MA 1O60A 1ISVA 4M6PA 4JTKA 3HTWA 1OC5A 3THUA 4JS3A 1NQKA 3RLVA 4GIEA 3FYPA 3WLJA 3W1AA 1JDDA 4YS1A 5CZSA 4TV6A 3WBXA 5DXXA 4ML9A 3UT0A 4MB3A 4NNCA 5CAHA 4AXNA 3TLQA 3UQNA 3VILA 2HE8A 1CGTA 1XLIA 2GWNA 2VI0A 1H1ZA 1OSEA 3TNOA 8XIMA 4GBDA 2HS6A 4IL0A 4ZFMA 2W9MA 4Z42C 3UA3A 3RAOA 3OIHA 1EKOA 4TOQA 4H8HA 2YCEA 2CYGA 3A5VA 3FK4A 4XX6A 3E74A 1KQZA 4CQCA 1BVNP 4KRZA 3UCQA 3S2NA 1WB0A 5ECUA 1L6YA 1QO2A 2V2CA 4JTGA 5U4NA 1IHIA 2WVTA 4PL2A 5A3HA 1O12A 1DXIA 3GBDA 4KKXA 5REQA 1ZP3A 3B8IA 4QBXA 4Q7IA 2SFPA 3ZO9A 4DVOA 5LSMA 1ONRA 4HK6A 3CPGA 1Z48A 3PJXA 3BW3A 1R2SA 4FF7A 2PRMA 3KRBA 3C3NA 2VXNA 3QVQA 2G3FA 1XCFA 4AD5A 3YPIA 3U57A 5CAKA 4KRUA 3KL0A 3C3UA 2Z1BA 3CK5A 1TVPA 3E0LA 9RUBA 2QUUA 1YE6A 1W9PA 1T8XA 2VFGA 5H2ZA 4ICCX 2ONEA 3PULA 3MI6A 4BCEA 1JQXA 1PJ9A 2YL6A 3WO8A 2P10A 5G4EA 2HROA 2PCQA 4GNKB 4QXIA 5D2WA 3H12A 1UWIA 2OKTA 3LHTA 4CVUA 7TAAA 1SZFA 4I9MA 3ME3A 2XZ9A 4P8VA 2X41A 4KCTA 1TIWA 3EPOA 4FALA 5A8NA 1OT1A 1XSKA 3NOYA 1UZDA 4L5ZA 3HGOA 1FWAC 2HXUA 4NZ3A 4RXGA 3GFYA 4GK8A 5CXPA 3TN3A 1LT7A 1Q4WA 3T8QA 4O4WA 3T4WA 2ZC8A 2A21A 3P14A 5C2CA 1MNZA 2YYUA 3VD9A 3AS3A 3T8LA 2VX5A 1HL9A 3NQEA 3QHOA 3WNKA 4PA8A 1OFRA 1UWRA 5FI8A 3ERPA 1L6WA 1JIBA 3VO0A 4BEUA 1LRQA 4V27A 2W61A 4NU7A 5KZEA 3HQ1A 3VKJA 4FXRA 1K6AA 2A6NA 3KTSA 4MYAA 2PDLA 2Y8KA 2H90A 1IT8A 4DWSD 1VHCA 4TX6A 2NVCA 1RCOB 2TYSA 1H11A 1R5YA 4ERAA 4OBSA 1V6XA 2WSKA 1TG7A 3FAWA 3WJZA 4I90A 1K9TA 4F8XA 4KEMA 2HNEA 4AHOA 4PMZA 3BV7A 2V81A 4JHZA 4GQRA 5JIPA 1UZ1A 3WH9A 1E3ZA 2ZRUA 3HU7A 2OSWA 3TYAA 3R2GA 4WJ8A 3EWCA 3SR7A 3OZOA 1UIPA 1DJZA 1XLCA 2XH4A 3R89A 4PR4A 1QCWA 3IGSA 3S9YA 3KOZA 3A47A 1QU4A 1N55A 3H4XA 2XFYA 1CDGA 3MWAA 2UZ9A 5AC4A 1SGJA 2H3BA 3VD7A 2OFJA 4MJ2A 4DYKA 2Z2BA 4EE9A 3H4GA 4AVOA 3NWRA 1EDTA 1FOBA 1V7AA 2HZGA 1MMFA 2X1IA 1ADOA 2ZUSA 2PDNA 3S47A 3SADA 2DUXA 3ZT5A 3GNPA 4DJED 3QPEA 2YA0A 1M7OA 2HE5A 2W63A 1FH7A 4HNLA 4BI7A 1SU5A 1DV7A 5C71A 4XZNX 3L4ZA 4Q6XA 1LZOA 5FL0A 3IEBA 2CZ5A 3MJMA 5HR7A 2INEA 2WM0A 1UWTA 1L9WA 4KFPA 3P0XA 5F2GA 4RNJA 4Z1CA 1BF6A 3OJGA 3TN5A 2ZRVA 3HPFA 2X8RA 3GTXA 4IX2A 1FWTA 5BMXA 1XLHA 3BQ6A 3LXCA 1AQHA 1KRBC 3DHDA 1YEYA 5DY3A 3ARPA 2G3JA 1E6NA 4GABA 1JVNA 2V69A 1W1B1 4IZGA 3GUGA 1Q8JA 4AXKA 1SM9A 3WD0A 4AY8A 2PGWA 3LHUA 1IEQA 3VK5A 1AK5A 2DV0A 3S5OA 3E9AA 4QSFA 2EAWA 1POJA 3AC0A 1ZSXA 2ZXBA 2QIWA 3WLMA 1GVIA 4XBKA 4OTKA 3IJ7A 4IX0A 2XN1A 3RK8A 3HG5A 2GGIA 2XGBA 4Z17A 3W76A 3PY2A 5CC6A 4RNFA 3VNDA 4H2CA 3NQCA 3ITGA 1HKJA 1AD4A 1F6KA 4L65A 6ALDA 1UH2A 4H1ZA 1I6NA 2F2KA 4MVAA 2EHHA 1A50A 1J0YA 3DEQA 3QKZA 4B5SA 1AD1A 3EPNA 3EWDA 2GVEA 4XIAA 4AD2A 4OV9A 2ISWA 4MAVA 1UCWA 3FS2A 4F9JA 2O55A 4RNIA 2HMCA 1RQEA 1I75A 3BO9A 3H26A 1VPXA 3DXIA 5KINA 1J6PA 1X98A 3ATZA 3T0TA 4IP7A 3TIMA 1A0EA 1Q6CA 3SAZA 3PZOA 2G41A 2TRSA 3AIWA 3WLHA 2R1PA 4IPJA 2ZBTA 4I8YA 3BK0A 5HNUA 1BXNA 2XDFA 1HVQA 2ZZ6A 3W27A 1UKOA 4YYFA 3VU2A 4TQTA 3RJYA 4XQ6A 1LUCB 5A95A 1QO5A 1EDQA 1J2WA 1EFZA 4OFCA 3MJYA 4M8UA 1OD0A 3H2EA 3BG9A 4A3RA 1IT0A 3EX6A 3C2VA 3LMZA 1QPNA 1WUFA 2HPMA 1OIMA 4LJ3A 3I68A 3A3XA 4B2DD 1V5XA 4NJGA 1IR2A 4X0VA 1EA9C 3RO8A 2EGZA 4TMBA 3H2MA 3ABXA 1U1UA 1XLKA 3L21A 1BPLB 2BY1A 1MUMA 4TTGA 3CIWA 1A80A 1RQHA 3GR8A 3AIVA 1GVOA 4ZEPA 1GEHA 2ZRXA 5GQBA 4O8AA 2ALRA 4HOWA 3QSTA 4QROA 4L9XA 4CNNA 1JZ8A 3PTQA 3ANYA 1NOFA 3NYZA 1Q7MA 1LYXA 5FF2A 1OT2A 4E3VA 2C7FA 1FXPA 4JR5A 5EPDA 3NGJA 4LS2A 1NAL1 4UUIA 2JQXA 1T8QA 1D8CA 4WSKA 3BAYA 3VMPA 3M6DA 3TYCA 5FCZA 3PM6A 4F2UA 3STEA 4FNPA 1QAPA 4DXXA 2TPSA 4LXFA 2X1RA 4H9YA 7CGTA 4DQWA 4IMAA 4GMEA 3SB0A 3UFYA 5A6JA 5J5DA 3LTSA 3NG3A 1I2RA 1E0TA 1BWLA 1LUCA 4FXFA 3UXDA 1V0MA 1WDDA 3RNDA 7XIMA 1UC5A 2O92A 3K1DA 4R3UA 1RP9A 2C16A 1M7JA 3XISA 4Q8WA 1H7WA 2VCAA 4JTEA 3PSVA 1MNSA 3CHVA 2ZVIA 2OSXA 4FR6A 3B4UA 3ITCA 4CQAA 4XO7A 3FW6A 1ZU8A 3GDKA 4YCOA 3GLCA 2YXGA 3MANA 3NQVA 3I7RA 4MUPA 4D6EA 3GG7A 4S3EA 1E1EA 1K8YA 2ZXAA 2YJQA 5DRCA 3T2PA 2XVKA 3EKGA 4CD8A 3TN6A 5A5WA 4U5IA 3BOLA 3DZ1A 3J7HA 1F4HA 3AHVA 1VRXA 4PTWA 3S6DA 3SCWA 2PUZA 4W89A 1WDWA 2RDTA 4PCTA 1DYSA 1R87A 3RPTA 3CLWA 1G4TA 3S42A 3TTEA 4KWOA 5RUBA 5DO8A 2POTA 4FNQA 3QTGA 2R1NA 5FJTA 3LV5A 3EDJA 4O8RA 4V2XA 1YMYA 3NL3A 5ABEA 3IS4A 2GDQA 4EPKA 4NG3A 4JNMA 4NJHA 1DWGM 5HQMA 4F0HA 3W6YA 2Q3OA 1GONA 1W9DM 4FIRA 3R8HA 3H22A 3QHMA 1SPQA 2ISDA 1DIDA 4H2HA 3T42A 1TUFA 2DJLA 3BLDA 5CZ0A 4WXYA 3SCUA 4MY8A 3S8HA 3D47A 4FZIA 3LXAA 1TJ1A 3DN5A 1JG9A 3CQIA 3EMCA 4KRTA 1AMYA 2VD9A 3WF3A 4GUJA 1W3KA 3ZJ8A 4JYEA 1YPFA 1KRAC 3F5LA 1O6IA 4LS1A 1LQ2A 4HPGA 1VLWA 4MPQA 5M1TA 1A4MA 3ARQA 5ABTA 2XN2A 3A4AA 4H9MA 5FSDC 1TPFA 1VCFA 3TUUA 3MP5A 1THFD 4U2ZA 2XIQA 5ECVA 3V3WA 1EJ7L 3KWSA 1OBAA 3PPCA 3AYSA 1IWPA 3KRZA 3SBFA 3STPA 2G50A 4MFEA 3JUGA 5C9ZA 1V6YA 1PVNA 4Q8QA 3EEZA 5I3IA 1EB3A 4C7GA 4O12A 3H70A 4G7FA 3THCA 3OP2A 2BBFA 2QULA 1Q6LA 1M65A 3CQHA 4HPJA 3U2CA 1CPUA 2YR1A 3W29A 3NURA 4OOZA 2QMJA 3LLXA 4MB4A 1E4LA 3QYSA 4PODA 2PF0A 1GQJA 2D0HA 2JFEX 2BASA 1SVDA 3UWWA 5HQEA 1S2UA 1Z6KA 3NL6A 4ORMA 4WJXA 4ZMGA 2AGTA 4KQNA 4W87A 4O11A 3W7OA 2ZOXA 4RCXA 1B9BA 1GPFA 3B0VC 3VFLA 3SECA 5BCAA 2VD8A 1HJXA 3TMQA 1AW5A 1S38A 2NQ5A 3SUUA 2AOSA 1EUAA 4MZYA 1CCWB 4XKMA 1LL6A 2YFNA 4YTTA 2HWGA 2VDGA 4Q8PA 4CD7A 4PMOA 1DIOA 4CD6A 2G95A 4H9UA 4PB3A 4IG2B 1PIGA 3HM7A 3AMCA 3E6EA 4WXZA 1DBTA 1NEYA 3OW1A 3TC7A 1W17A 1ZJBA 4QCFA 4LALA 5LZLA 3OVQA 2NX3A 5EGRA 4UFIA 5C5YA 4HCDA 1TTIA 3PFMA 3UVIA 3UNDA 3TSBA 3ZT7A 2X2GA 1M53A 2OQHA 2DZPA 3PPFA 4EIVA 1OCJA 4ERGA 3UGVA 4JTUA 3W70A 1UPPA 3W01A 1NWSA 3VUPA 5A6TC 3KTCA 4YPJA 4O1AA 3H54A 2ZZ4A 4NNAA 4Y2WA 2YBUA 1EYEA 4UR9A 3AYVA 5CLTA 5DMMA 1C9DA 1SSDA 3N34A 1JDAA 5AC6A 2X1SA 3QY8A 4GIAA 2VGGA 4EP8C 1UH4A 1XBYA 2QZRA 3A4WA 4MWAC 5I7GA 4DB7A 3SY8A 1G4PA 4H4IA 4UMAA 1G1YA 1NP0A 4WF7A 1BYCA 2BWGA 4J4KA 1G67A 1PHWA 3O0KA 1YADA 1YPXA 3WUGA 2IQTA 1LJYA 1F76A 1H49A 3V5OA 3PZUA 1E4NA 2BB0A 3IK4A 4JQ4A 3M44A 4UTHA 1EO5A 2D0GA 5I24A 4LF1A 3GXPA 4IXHA 5HUPA 3GG8A 2FYMA 4UIOA 1TVNA 3G1XA 3L0KA 3UU0A 1RA0A 3KOXA 3STFA 2WNNA 1FVPA 3AHTA 4DZAA 4W7UA 4GYKA 3UG5A 2B81A 1V7YA 2XSBA 2Y70A 2HDJA 1ZL1A 1MW1A 1BEUA 3VC6A 1UR8A 1JXKA 4LX4A 3LM7A 3BSGA 4K7VA 1RY8A 4JL1A 1HJUA 5E0KA 3W7NA 2Z1XA 2HVNA 6XIMA 1WZKA 2OWWA 2C1HA 4LWWA 1A0CA 2J9XA 1PCKA 1TWDA 3NXFA 5M3WA 5DMLA 5H8MA 1AFSA 3DBPA 1YKWA 1YTKA 1J5TA 1O66A 1AODA 2Z24A 3R6IA 3ZWTA 1DJXA 2BTMA 4WRHA 4PFMA 1W5OA 5EKYA 1CNVA 3AMKA 3QEZA 3QY7A 4AIUA 4YVVA 3RR4A 1H5YA 3ZQ9A 3EMZA 3V36A 3BLKA 3OVRA 5F1VA 3OEXA 3NIYA 1H7RA 2HRWA 2C0HA 1QR7A 2VRJA 3WQCA 1QFEA 4IUGA 4O15A 4ZXOA 3PNUA 3KZSA 2E25A 1BSIA 1LG2A 3MV01 5CPSA 1E43A 5K4XA 1A5LC 4BF5A 5GNYA 3UJSA 1J0ZA 1OC7A 1DQUA 3S2MA 3RX4A 2Z25A 2CZFA 4I7WA 3ZLHA 4DIAA 2VR4A 3JU2A 3VD5A 1Y5XA 5GVJA 3W73A 5AC5A 1VPQA 3M0YA 2WO5A 3NJ3A 1T7LA 3H2FA 3GVVA 3W87A 4J3TA 3VNKA 4BI5A 1FWIC 3CZJA 1Q6QA 1DXFA 1NFBA 1Q66A 2NQ9A 1PX3A 4HU4A 4BY3A 3AALA 5G2IA 1IGSA 1F6PA 1OX5A 5E9XA 3W1UA 2PDKA 3CHEA 4L4OA 5JVLA 1V6TA 2JGYA 3INPA 1C91A 4AVFA 6PTDA 3DFQA 5GJPA 4MLJA 3UVAA 1WQ5A 3QOMA 3W2KA 2XUCA 1BF2A 1TJPA 1TJ0A 3AMGA 5MKGB 1TFVA 1RLCL 3UERA 4FOUA 3RPMA 4LTSA 3MO7A 4RXFA 4NHVA 4RW5A 4UFMA 1F2JA 1W8SA 1GPWA 3ZLGA 4NI8A 5HPOA 1NDVA 3WD4A 2J9YA 3ABQA 4NYYA 2RDXA 3MI3A 1A3HA 3OG3A 4XV0A 2ZIDA 3UGRA 2XPKA 1Q7ZA 2E28A 1OFQA 1KXVA 1J5SA 3W1MA 1H50A 1DP0A 2CU0A 2HVMA 2PWHA 3EOSA 1W1VA 3MDWA 1Z32X 3K46A 4ZB2A 1JPDX 5E0FA 2YOCA 4Q4PA 1AG1O 3EA2A 2O9TA 1XIGA 4FP1A 5A6LA 1TV2A 3WQDA 3I6RA 3NPWA 2J8FA 3KL5A 3S6OA 1B3YA 3WQPA 3A24A 1ENUA 4JN7A 4ZTXA 2Z6JA 4LBSA 3WBWA 3TVAA 5BRQA 2BOEX 4PRTA 2D24A 4R7OA 1TV8A 2ABBA 4NSBA 1B0IA 3AIQA 3DKLA 2P3EA 4PSPA 2FTWA 2NQLA 3QMTA 3IVSA 5A94A 1DJNA 4JAWA 3GDRA 4P8XA 3LUTA 4WK9A 4LYQA 3K1GA 3L4XA 3HG2A 3WSUA 3W7KA 3MQTA 1Q6EA 2CNCA 4HHHA 2I14A 1XH1A 3BLFA 1U33A 1GW1A 1MI3A 1QNSA 1JPMA 4N9CA 1H1NA 2G37A 4U33A 1UWQA 3VDAA 3ABRA 1R86A 1H60A 2VELA 1K7EA 3AS2A 2E1WA 1GVFA 5MKGA 4FOJA 3CV6A 3U5UA 4XD3A 3MWCA 3UR8A 1SZEA 3QYQA 1LOLA 3D5HA 3LZ3A 3VYLA 2YCKX 3DGRA 4K7YA 4N4PA 2J78A 5E0CA 3GXDA 2C79A 4KEVA 4CEUC 2ZTKA 1CXHA 4FX7A 3GR4A 4JDBA 3M0XA 4Z1BA 4WGHA 1W5PA 2X7VA 3N9SA 1XC6A 3DI0A 1FKXA 4NX0A 4M3PA 3ZLFA 2EXOA 3RYSA 3AZSA 3NPVA 4M6QA 3BJFA 1TRDA 4X60A 1VHNA 2R1LA 3HZ3A 1FA2A 1PTDA 1SO5A 4GH1A 2Z1WA 3TNBA 3RM4A 1AQFA 2I5IA 1LBLA 3CUIA 1JCTA 3L23A 4ROQA 3WLTA 4KCVA 1ZAHA 3WMLA 4E3TA 4F9DA 4JTJA 4TO8A 3TE9A 1I60A 1G4SA 4QFUA 4DM1A 2B0MA 3CH0A 4DWSC 2DP3A 4DAIA 4E2BA 2C71A 1XYMA 4FLSA 3MKVA 2AKZA 2XZ7A 2QJJA 4M56A 3W3OA 1X1NA 1NVMA 1E9IA 1KFLA 3P62A 2V3FA 1J0JA 3Q94A 3DDMA 1YNQA 1TREA 5BU9A 3SSZA 3W71A 4OECA 1DTNA 2NX1A 4AD4A 3O7UA 2J7DA 5U7SA 4GRSA 4OZOA 2PLMA 2GGEA 5IDIA 1UUMA 3CMGA 1XLEA 2ZX7A 1RCXB 3G1DA 1CWYA 2CZEA 3GH5A 3MZNA 3TWBA 3WD3A 2Z7GA 4ZO8A 2X7WA 3Q2DA 3PBGA 4UZSA 2CXEA 4ZXLA 1UROA 4XZMX 4M24A 4NZFA 3NOEA 1ZBWA 4LUSB 2OWCA 3UPMA 5C0QA 3UXLA 4H01A 1N7KA 3GNOA 1GG0A 2QHAA 2VFIA 4LS0A 3VC5A 1GOQA 5LXXA 2WM1A 1F8IA 2Q8XA 2C1IA 4GKLA 1US3A 5LNUA 3T40A 3RRXA 4E8CA 1A53A 4XBJA 3WUFA 1KFWA 3RF9A 2YBVA 1S5NA 4C7FA 4EXAA 3EWYA 2QVHA 2FJKA 1UQYA 2IMRA 2YCJA 2QUMA 3A3WA 2J13A 4H9XA 1X7IA 3GYEA 1JR1A 3ID7A 1MZHA 1QW8A 1HJQA 1R9YA 1CT5A 4DAFA 3T0CA 2X30A 4CEXC 1G9HA 3RU8X 1TE1A 1FHLA 2ZYFA 2F6XA 3WCZA 2GUYA 3PR2A 3CAVA 4Y90A 1X39A 4JHMA 3MCNA 3BAWA 4HBKA 1U22A 3LHZA 3CMJA 5BWAA 3PK7A 3C2YA 3TW7A 4LT9A 1XV8A 3NM1A 3APTA 3UESA 3G1AA 1ME7A 2WC3A 1PIFA 3QRHA 1JQVA 1VFOA 5BZAA 3REQB 4RW3A 3FYYA 4IPPA 4QJ1A 4TTUA 2JF6A 1YHTA 2B4GA 3IIZA 2EPKX 4TR9A 3NSMA 4AEFA 1UD6A 3NSXA 2DSVA 4Y9AA 3NR0A 4XBSA 4RDWA 4G8TA 1VFHA 4PUDA 1Q8AA 4Z1YA 5CKSA 2BY0A 3NL2A 5LA2A 2DZVA 1X6UA 3K8MA 4G56A 2FIQA 4UR7A 4LUSA 3NDYA 4YNGA 2OOGA 3G0XA 3R12A 1HF6A 2VURA 2NV9A 2I57A 1C92A 4K6AA 1XRSA 1US2A 2FTPA 3BGGA 5EB8A 3NNTA 1RUSA 3DOPA 5CSRA 4NILA 4C65A 2WANA 1FDZA 3MYPA 1TV7A 5EY5A 4ZOBA 1GEQA 1PWMA 3AROA 3IUIA 4GYPC 4DHGA 2PTYA 3BAXA 4AYGA 3L9CA 1V8EA 1W5NA 3W83A 2B7NA 3G1FA 1UD5A 1FBAA 4FSAA 4AQLA 4FPSA 4ZZ9A 2PP1A 1AH4A 1UWUA 3ONBA 1WDQA 2QIIA 3V16A 2PU0A 4CVWA 1K03A 2FZBA 4G7EB 4NY2A 1FHUA 4G2DA 3QKEA 4QG6A 2YKKA 4TIMA 2PTDA 4B5VA 2XISA 1EF3A 3M0KA 2QUVA 3CNYA 3ELFA 4FX8A 2ZCGA 1A5AA 2OCZA 1AUSL 3REQA 3HA1A 3BCFA 1LDCA 4O53A 4PN2A 3UR7A 3IIOA 3IRDA 4V33A 3UYCA 3ZJ7A 4HZ8A 3VGBA 4W7WA 1QI3A 4LAUA 4UWMA 4Q4QA 1IEVA 3NDOA 1X7FA 1DPMA 3QR0A 4B92A 1TV3A 1SFSA 1O5KA 4ZE5A 4B16A 3VE7A 2OG9A 1XCWA 4JQ1A 3EOEA 4AWSA 5HNNA 1WX0A 3P81A 3MPGA 1KM6A 1P43A 5BOFA 1AJ0A 4C6MA 1POKA 1V4YA 4GJIA 5AYIA 4GQGA 1E1FA 4PC8A 3FGCB 3PUOA 1FCQA 1CXIA 3O6YX 4LRSA 1O94A 4MIMA 3UP8A 1JF6A 2BGNE 3L4VA 3V18A 3EKZA 2HK1A 2FKPA 4JTFA 2R9RA 1SW7A 2GQ3A 1UR0A 4GACA 4PMVA 3CWNA 5F4XA 2FVLA 3S2JA 4GCAA 1YYAA 2O56A 5T26A 1KM2A 4RJEA 4LYKA 4DF0A 3MC5A 2RDUA 4D6DA 1XYBA 3LOTA 1FWSA 3URNA 5DT7A 4MNJA 1OF8A 3TYBA 4V28A 1U30A 3RMJA 3V35A 4XD6A 4HSNA 1KKRA 1AZ2A 4C6DA 3WJXA 2QMKA 5DCBA 5AYZA 3IIPA 1N8FA 2GQAA 5DMNA 3WDIA 1XLBA 2Y0FA 1REQB 1TQJA 2WYSA 4UTUA 1GVYA 3DG7A 2PP3A 1RV8A 3DESA 1Q4NX 2CLEA 3DI1A 1E0WA 4MZ1A 5HMFA 1E40A 2EPNA 1QDSA 4EACA 3AO0A 1EXPA 1TUXA 1ESWA 4JTCA 3CUJA 4H41A 1WXJA 4M5PA 2PD5A 1NFPA 3TEVA 1UJQA 5EMKA 1CXFA 1VBGA 5HBFA 4NI3A 2VFFA 1I4NA 1C7TA 4NXSA 2DUZA 3NQ6A 2NSOA 3MUCA 2PWGA 1DQWA 3A22A 4BF9A 2J27A 2ZA3A 1QBBA 4L6HA 5A8GA 4UQDA 2WHMA 3FEQA 3IAPA 1RALA 4XD4A 2J6XA 2J66A 4GWEA 3FGCA 2D3LA 3DFHA 3AIBA 1D7KA 2I16A 3BVJA 3USBA 1KXHA 4NAFB 1GOMA 1JCMP 2ISFA 2WKJA 3KM8A 3W7RA 5C9WA 4LB4A 1W3IA 3UXAA 1B3ZA 4HNUA 1JAKA 1WKFA 2Q8ZA 4E2VA 3W74A 4JEJA 3VOIA 4U3AA 3O05A 1Z8AA 1NDYA 1QNRA 4FNTA 4LVFA 4NJIA 5CJNA 4H7ZA 3FA3A 4MUZA 4QE4A 2BVWA 3CQJA 4GVHA 3VGHA 1UD4A 4HZ7A 5C54A 1KWKA 2J75A 4HNVA 3H24A 1LWIA 4UTFA 3P5ZA 4JIRA 3WD2A 1REQA 2PEVA 1RK5A 1DWJM 4XVDA 4ACYA 1CGVA 5D9NA 1TPC1 2Q71A 3HN3A 4QNEA 3VIIA 4WOZA 4ZENA 3GTFA 5EYWA 4CU6A 2VEGA 2IUZA 2ZZ5A 4YXGA 2OR2A 4JYFA 2Y7EA 1OFEA 3AU2A 2VT0A 1MDRA 1A5UA 5IHRA 3N2OA 1QRQA 4QHRA 4AISA 3WLOA 1EQPA 1NARA 1Z7AA 1LQAA 3EX3A 3LK6A 2ZRWA 3VIMA 5KITA 2ZKMX 1IWBA 1ZY9A 3CHCA 2FZNA 3FCPA 3VKKA 4LC8A 2XGZA 3PZIA 3TYZA 3IANA 3UZZA 1VYPX 4UTWC 2XH7A 5LYRA 1FX6A 4B2DA 2DIEA 1GJPA 5CZKA 1HIZA 4HA3A 3P80A 5BXSA 1A5BA 4J28A 1HNYA 4FO4A 3P60A 2Z7KA 4AVNA 3T81A 5TIMA 1BTMA 4BI6A 4WKFA 2NLYA 4NAFA 4NYUA 3FEMA 3AXMA 1ZBKA 3JZEA 1O5XA 3KBVA 3AWOA 3STGA 4C6NA 3AWNA 2AGKA 3EOUA 3QGKC 1KO0A 3NEVA 2WNQA 2Y24A 1S5TA 2WOQA 2A0NA 4L1WA 3RCNA 3ZWSA 1DHKA 3G1HA 4IGHA 1M7PA 2E09A 3S1VA 5F1UA 3WKZA 4Q33A 1DIKA 3K8KA 2PDGA 2PMQA 3C52A 3N6JA 1GYNA 1QUMA 4DZHA 1A5KC 2J7CA 1EBHA 1UP0A 1ZCCA 3TTQA 2Z29A 3P82A 3BAIA 2F6UA 3TAOA 1O95A 2P5NA 3GTNA 3W07A 2VDIA 4GBUA 2GSEA 4IQLA 3GRIA 5A6SA 5M5DA 2FLIA 4Q7NA 3WK0A 2CLPA 1PYMA 4QEHA 1JCXA 3M64A 1YLVA 4UTIA 1KBJA 4P5UA 4C6LA 4IIFA 4K36A 5AYBA 2ACRA 5D33A 3WH7A 2KAUC 1JCNA 1GVSA 1KW1A 5D2TA 1CXLA 4QM1A 3HB9A 2Y7GA 2E1DA 4L80A 3URAA 2OZ3A 1QI4A 3GHUA 2GJPA 5D30A 4IM4A 3GNNA 3WIJA 3EOOA 4IIBA 1TTJA 1WKDA 1KBIA 3DU0A 3S1GA 1RAKA 3QV7A 3BW4A 4I9JA 4LANA 4MNMA 2FGLA 4QQ3A 4HSHA 4DJDD 4PCFA 2F2HA 4ZVJA 1W56A 2Z2UA 1HKWA 4AIBA 4AD0A 1CXEA 3HG3A 4PMRA 3MDUA 3ICJA 1FWBC 3CUGA 3B9NA 3ES8A 2VVSA 3N2TA 2JE8A 1U83A 4WDUA 5B80A 2RH9A 1OCQA 2PRLA 3QTPA 1JZ4A 1PYFA 1OX6A 1ICQA 4D6CA 1KKOA 5GNZA 4HZ6A 3TAKA 5IBXC 4AC1X 3QM3A 2QCMA 1XD1A 3WDQA 4NZ5A 2J7BA 3IAQA 3I3DA 4QS5A 3F4WA 3NQGA 1MXGA 3IWPA 4W84A 5AHIA 1ONEA 1HUVA 1L6SA 2CPUA 1XPGA 1JI2A 2MANA 1UOKA 4GD0A 2XVPA 3WL0A 1VEMA 1CBGA 4AWEA 1KTNA 5LHFA 3GUWA 3M07A 4IIHA 3LU2A 5BNKA 4Z2KA 5D05A 4L7ZA 2CBUA 2PBOA 2RGMA 3QC0A 5CQ1A 5K3VA 1DEDA 1Q13A 2QPXA 4GUHA 2ZZ3A 1C9WA 4IICA 3OOQA 1PTAA 1W8GA 2X2YA 3W25A 2XWEA 3SGZA 4PTVA 4JFTA 1KBLA 3WLNA 1QK2A 3LHVA 3UW6A 1IXNA 3KVLA 1IZCA 3TXVA 1JGMA 2O7SA 3BAJA 3KWXA 4MMWA 1D3HA 2X40A 2A5HA 4G1NA 4GISA 3W7PA 4Y6GA 3CAQA 1YXYA 4XD5A 1Q3NA 4D6JA 4H9TA 1J10A 4GFSA 2WQPA 5DEZA 2QEZA 3P3BA 3CAKA 4L61A 2WWCA 3CT2A 4POCA 1CW2A 8A3HA 5C9XA 1PX4A 5KMYA 2GL5A 4HCHA 3MY9A 2BGQA 2V2HA 3HPSA 3ITTA 4BWLC 4PUUA 4BK9A 2Y63A 5A8OA 2CC0A 4Y96A 3E2VA 3APYA 3TWAA 2QCDB 1SUXA 1FKWA 3LHYA 4I5UA 4DUOA 3NZPA 2BX7A 2PA6A 3FHAA 3L67A 4DO4A 1BVZA 2CLFA 2A3BA 2Y61A 2A7PA 3L4TA 1PDZA 2QCNA 1J12A 1EWEA 1A5SA 3WF2A 1Y65A 2VYOA 3RLHA 1XQLA 3GHRA 1E6ZA 4RZ4A 1GOOA 4I7VA 5AZ0A 4DUXA 4MZ8A 4CUCA 3WQVA 1SFLA 2QV4A 5AKQA 2NQZA 4Z1AA 3U4FA 3M0IA 4ZQNA 3L5MA 1ZB5A 1TSIA 2Y5SA 1DJHA 4ACZB 1ZS2A 4XZHA 3LQLA 1KFKA 1V3JA 5EMLA 1EXBA 1IEIA 4P7NA 2UBPC 4ONVA 1ZUAX 3ABSA 1XDMA 3TX9A 4WX2A 4AIEA 2I5GA 1SMDA 4LUIA 4AWTA 3HURA 2VR5A 1JPHA 3BARA 1TX2A 3AJ7A 4U3CA 3M4HA 3WLIA 4O10A 1VJIA 1ALDA 3CWOX 2PDIA 5AYYA 2WWDA 3IUDA 3WDRA 1BG9A 1QPRA 4R27A 3LYEA 2JKPA 2RKXA 4Q8TA 1RJQA 5E5CA 3MVIA 3VIPA 1RA5A 3MSYA 4XTDA 3S5YA 4M0XA 3W1TA 2A7RA 1R2RA 8XIAA 4N9EA 4LNYA 3VVGA 4IL2A 3LG3A 1P0NA 5IDZA 3QJAA 1CGWA 5AVHA 5FESA 3GB6A 2HXTA 4NASA 1JNEA 5CH9A 5CC5A 2A85A 1TMLA 1IXQA 2QCDA 1D9EA 1X8CA 3FY1A 4M51A 1QW7A 3T0DA 2PSNA 5I3FA 2F61A 4J35A 3WLLA 3BSHA 5GNXA 5EMMA 4GFIA 1VFMA 2PBGA 3SURA 2XVNA 3ZFHA 3H7VA 3DKJA 4C1LA 1YPIA 3AFBA 4QITA 3MI2A 4PL1A 1FWRA 4WKAA 5I3JA 3T1GA 3NQ2A 3K2GA 2ZE0A 5JXQA 4H19A 1QI2A 4GA8A 2IPWA 1W1PA 3GNXA 3QV8A 1OYAA 4JX5A 2IKHA 1XIFA 3NQAA 3WX7A 3W7JA 1YDVA 1Z69A 3ANVA 1EGMA 2P88A 3GKAA 3QFWA 1ZPTA 3CV1A 3WLPA 2NLIA 3D3FA 2YDQA 4XISA 1OK4A 4RZBA 3LCGA 5DBUA 1BD0A 1EYWA 3TTSA 2E5BA 1V3IA 2HISA 4GY0A 2J74A 1FXQA 3EXSA 3VKDA 3DHPA 1B9ZA 3ALFA 3LN3A 3EKLA 3RIKA 5A2BA 3B06A 4NZCA 1MW0A 2IXVA 1EHNA 4MWAE 1UZHA 1YXCA 3UY7A 2J9ZA 4PTMA 1NWTA 1F61A 2VM8A 1ISWA 1TV5A 3LBMA 5D09A 2BMBA 4A35A 4KT2A 2IPFA 2YBTA 4UQEA 2AL1A 1UMYA 3C0JA 5H1WA 4MM1A 3W75A 3SGUA 3MMTA 1PKYA 4A21A 3W1XA 1K70A 3UG8A 1KNWA 1E0VA 4NZ1A 4P7LA 1OGGA 1N2VA 4W8AA 4MDOA 3O16A 3DC8A 1NQ6A 4QAIA 4IT1A 2Q3RA 3SCPA 3OZPA 4QX4A 4DI9A 3MSRA 3CPUA 3SRKA 3MMWA 3KTXA 1H3GA 1DHPA 4Q8VA 5A6BA 3LDVA 5D8ZA 1TWSA 1XIIA 3AXKA 4EF8A 4IMGA 4FNSA 4IUOA 1P6BA 1VKFA 4YHGA 3SCNA 2FGZA 4DJFA 1FWWA 1G7UA 3VNIA 2GOUA 3PVFA 4Z2JA 4UQ9A 3TZFA 3DGBA 1ZGDA 2JBMA 3CO8A 1XYLA 2WCSA 1HQTA 3PANA 2OYMA 4BFAA 3CJPA 4W4QA 5I3GA 4OOUA 3MCOA 2A2IA 2RUSA 4UTKA 4A3QA 5CG0A 2ACUA 2ZFAA 3CHFA 4URIA 3G1VA 1NTHA 3NCOA 3CT7A 7TIMA 1MVYA 3QZEA 3W53A 5H6HA 5DQPA 2WSPA 3VOHA 3SM0A 4LEQA 4QDPA 2XIBA 2OLAA 4RPQA 1XQKA 5A69A 3BLOA 4PBEA 2PLKA 9CGTA 1UBPC 1R3RA 4JNZA 4N9DA 4B5XA 3AISA 1MWOA 3QPZA 5AY7A 5DFAA 3VIFA 3UEQA 1OIFA 1KR0A 3QLDA 4J3XA 4GYJA 1B4KA 3WEZA 3SN1A 1KV8A 1MQQA 3P2VA 3LD5A 3B8SA 1TPUA 4K1WA 1GWJA 2E4TA 1XM3A 5CPTA 1NP2A 4X9SA 3RFAA 3VUSA 4IP4A 4GPNA 3NZ1A 4WSHA 1HJVA 1TPVA 4IWWA 1HFBA 1ONXA 3WNMA 2B7OA 4HTBA 4QAWA 5DX7A 4GQQA 2C3ZA 4P7OA 2AL2B 5HWMA 3AYRA 3UJFA 4EOUA 1FWEC 2WBKA 1GOWA 2PWFA 2MNRA 2W27A 2AQVA 4D71A 2WSQA 3IJLA 3ZR4A 1MW3A 3SIMA 1XXXA 4MKSA 4AX7A 3EX2A 5FIPA 1QNPA 1D3GA 1TVLA 5I78A 3RLUA 4L9YA 3AUOA 4OT7A 5IOBA 2V5LA 2ATMA 1S46A 4IPLA 3GXNA 1CLXA 4B91A 1C29A 2C19A 4R5EA 4JD4A 1RBLA 2OWXA 4J5NA 3F5JA 4EAMA 4HTYA 3I4KA 1TX0A 2OO6A 5CBIA 1UBSA 4RDZA 5A6KA 4RPPA 3W24A 5J8LA 4S3BA 2ZX6A 1QI0A 1WYIA 3THDA 4GGBA 3I6TA 2J7FA 2JGQA 3HGSA 2WVSA 1J0HA 1VGAA 3W7HA 3Q58A 2GK1B 1K8ZA 3MUXA 2G4JA 2XTKA 2QCEA 4N4QA 3MW7A 3WQWA 1DVJA 1TZ7A 3QGAC 4LFYA 4F0SA 3FJLA 4O52A 1OF6A 4C1NA 2BZNA 4R9OA 3E49A 3OB8A 1TMQA 1RSCA 3AAMA 3LNMA 4DBEA 3CZKA 4W5UA 2V6AA 3S3GA 1OD8A 2PCEA 4N6FA 1E6RA 1NFGA 4GXWA 4J1OA 4D6HA 5XIAA 5CJ5A 3A12A 1B90A 2V63A 3NZGA 4O0QA 2VNCA 3PZNA 3IACA 3UBPC 1HX0A 5KEZA 4AMCA 4XSLA 1R3TA 4LVAA 2DW7A 1XINA 1PPIA 3OBAA 2V3GA 2AL2A 2RFGA 3EWBX 5CZTA 1EPVA 1LT8A 1JZ7A 1F3EA 1WOBA 2J77A 5I07A 3G1YA 1FCVA 4I8DA 4E6MA 4IGNA 1DJIA 1KGWA 2NUYA 3TR2A 3SCOA 3SIZA 3N12A 3B40A 3CO4A 2IPJA 4DBWA 2DFAA 1XDLA 1A47A 1WPCA 3GIQA 3SUSA 1NY1A 1PZ0A 1J11A 4U31A 3PZMA 1QBAA 3CIVA 3V7PA 4DUVA 3PZTA 5D8WA 2DSWA 1NH6A 3BV4A 1W5MA 2ZX8A 4CNOA 1C90A 1F73A 3W38A 5BWFA 4FLOA 3GFZA 3ECQA 1P1XA 4KFOA 3C5QA 2P1FA 3NTYA 4US6A 4FR1A 2YLAA 2DVUA 1E5JA 4DBSA 1ZP4A 4XB3A 4AYSA 3RGTA 1VENA 1CB2A 1K7XA 4JFVA 4JIEA 4QE1A 3UG3A 4PGLA 1RY0A 4LCRA 3U4AA 2H9AB 3NSNA 4XUYA 4ZQOA 3MHGA 4BKNA 4PB5A 1JUBA 2XIIA 3LRLA 3KRUA 5DRIA 3LCIA 1XLDA 4LVGA 1MW2A 3M1ZA 1CGXA 4L9ZA 2FPTA 4R85A 5TD4A 2Z1VA 3P8IA 3VM7A 1EP1A 1DIEA 4RDYA 1MO0A 3F4VA 1W6TA 2NQJA 3DC0A 5LGXA 3L5LA 5LIKX 1BWVA 4WR3A 1GORA 4NAEB 1E15A 4W8BA 3IRSA 3VCRA 3CQ0A 2IXUA 1HXJA 1AA1B 1QATA 3WQ5A 3S1XA 4KWWA 2BNJA 1TMHA 3SUTA 3M43A 1J79A 1OG6A 3SCTA 4Y9PA 5K7JA 1ODUA 3WQEA 3CV2A 3A3HA 1GJWA 2OODA 4W88A 3IIVA 4S1FA 2C0AA 3VD3A 4XUGA 1J18A 2MUCA 3NEHA 1W91A 4XSMA 4AEEA 2J79A 3AHXA 3GE7A 3SY5A 1YXDA 2OLHA 5A6AA 4K37A 4J2MA 3DAQA 3ZS4A 1JZ5A 1UP3A 3W9ZA 2INFA 1Z44A 5E6YA 4JTAA 1US0A 2QYGA 1IGWA 3OG2A 1VJSA 3RX2A 3N4EA 4JTRA 5LA1A 2ASHA 5D9OA 2PDMA 1UR9A 2YIHA 2E6YA 1WBHA 5IXEA 1P0KA 1XICA 4GYFA 3FKKA 3W26A 3N17A 3RDKA 2EG7A 1ML1A 3VOFA 5IFTA 4HKPA 2OJPA 4XZBA 3OLIA 2H9AA 3VMOA 1KFCA 3WQFA 2Z26A 2DT0A 3DCPA 4GJJA 4OHQA 4LC6A 1K8XA 2XG9A 4KCWA 3CLMA 1Z41A 3R10A 3Q65A 4FLRA 2DJXA 3WF4A 5G2HA 3OO2A 4DX3A 1XUUA 2ZUWA 1WZMA 4F3HA 2FHCA 1PS9A 3KP1A 2OPJA 4WJEA 2PD9A 2E7FA 1XH2A 4P61A 1M6JA 1OCNA 3R1ZA 5SWUA 2XJ7A 1P6CA 4JIPA 1XGDA 4WD0A 1LLOA 1KC7A 7REQB 3VKAA 4NAEA 4JKLA 3WNPA 4XVEA 1TPWA 2C1GA 2AMGA 3TU9A 4F66A 1XLMA 3TTYA 4S3DA 2DSUA 2FVMA 2OU4A 4QGCA 2YX0A 2DUAA 2EJ1A 3NM3A 1V08A 1IQ8A 1T5AA 3AXXA 4BF7A 3L12A 3ZVIA 1M04A 2CLOA 3G5EA 4PTNA 5BYWA 3RX3A 3BCDA 4C5ZA 4OJYA 1LQ0A 2ATSA 4CQBA 3HFYA 5HINA 3WEOA 1VF8A 1GGOA 3FX4A 1JYNA 4CN1A 1EIXA 4GZEA 3I3BA 1W9UA 3APGA 3EX1A 3G6MA 3HMCA 4LY4A 1JL8A 1E6XM 2E9MA 2A3LA 4O14A 3T4CA 3JR2A 4NX5A 3MVTA 3MSGA 3MYOA 3W1PA 2GQ8A 3M5ZA 4Q8OA 2V68A 2YW3A 3BJSA 1XYAA 4GUIA 4KETA 3GVGA 3BSMA 3PN8A 3GAYA 1CZ1A 1S2CA 3DUGA 5XINA 3WDJA 4HT3A 2Y8UA 1OHLA 2ABAA 3W00A 6CGTA 4H6EA 1PO9A 1CLKA 3B9OA 4EXQA 3IJ9A 3N13A 2CHRA 5CGMA 2FZMA 3MUIA 2HS8A 5AB3A 4XAGA 3MBFA 3PUDA 1B30A 3PTMA 1UUQA 1PEZA 3GW3A 3M46A 7REQA 2PE4A 1P1MA 3AIEA 3GYCA 3M0JA 1JD7A 4QG8A 4PE8A 1FWFC 1ITCA 4GC3A 1T41A 1VYSX 2G8ZA 1AL7A 1B31A 4N2YA 2VC5A 3BURA 2ZTJA 4GJ1A 4ZODA 1XRTA 3WBYA 1ITQA 3N3MA 3R5EA 1JF5A 3GXIA 2VRQA 2VMFA 1Y7VA 1BYAA 3QY6A 5LIUX 3VABA 4Y8EA 4LH8A 1M01A 3UZJA 1IEXA 3CL8A 1W32A 5D2XA 1HN1A 1L8PA 1OZMA 2CESA 1QNOA 4JGDA 1K4HA 2QUTA 3W2UA 3R43A 1W1ZA 1AQMA 4JEQA 4P7QA 3KZPA 4W86A 2V9DA 4C1KA 4NP7A 3H2CA 1GG1A 3C2FA 3V0SA 2V8ZA 3N29A 4X0NA 4D2JA 3NGFA 3LENA 5HATA 4MY9A 3P0WA 5L9FA 3BOXA 3FYOA 1W1TA 4GXMA 2UY2A 3VDGA 1M41A 1LROA 3SRDA 2I9UA 2XWDA 4X2PA 2Y85A 3M6YA 1OFOA 1UP2A 3HJEA 2GPTA 5I00A 2WCGA 2CHOA 2V67A 2WCAA 2ISSA 5AYXA 4U10A 3E0IA 1AZ1A 4MPKA 3A6OA 3IJQA 3W7IA 1Q85A 2WVVB 1HZYA 2OEJA 1O5RA 3C61A 1AH3A 3KXQA 4N6EA 1ISZA 1EJUC 1OZQA 1UR4A 1MZRA 2BY3A 2XSAA 3AQUA 4IPNB 5DLCA 4AC7C 1KFEA 2QCFA 4S3CA 1ITUA 3I7QA 3GQYA 5JIWA 3RJXA 2IQ0A 3UR5A 3AHZA 3RCMA 4LAOA 2PDCA 1V03A 2VUYA 3UCCA 4F0MA 3O9NA 2ZUUA 1UKPA 1V79A 1H51A 4WCJA 3FAXA 2YCLB 3TA9A 3EMQA 4YN5A 1A5CA 3PBWA 4A8LA 4WGXA 3GNDA 3GDLA 3U5YA 3G77A 4UNLA 2W66A 4AZ6A 3F03K 1EHAA 4YTUA 3E0WA 3KBNA 1UZ4A 4O1FA 4PCPA 5H8UA 3OQEA 4Z0SA 4YHEA 2QLYA 4B4FA 3BMVA 1X6NA 4GXPA 3AU6A 3CZ8A 1N8IA 3EPMA 3ARXA 5FEWA 4V1YA 2ZE3A 5CZJA 4KGJA 5LNRA 4MJMA 1R3VA 2AAAA 4UFHA 2PPGA 1DWFM 5HR6A 3DH7A 4PRWA 3PTDA 1I1XA 2VCBA 3BW2A 2PWEA 4ZE4A 2OMAA 1PZ2A 1GZJA 4XZLX 3UWVA 3EXTA 5FEXA 4GZJA 4S38A 3H4WA 1SQ7A 1SR0A 5HWJA 2QAFA 2AAMA 3BE7A 2J25A 2WVVA 2XIMA 1I2PA 3UF9A 2QJMA 3HMJG 2DZTA 2Z28A 3GU1A 1W37A 1XC4A 4BR1A 2AKMA 2R94A 1YX1A 2GVYA 1QASA 4EANA 4MAZA 1FP8A 1MRQA 1R2TA 3G8RA 4AFYA 4IQJA 1H0GA 3FJ6A 4PMQA 2VFHA 2D2HA 3CIXA 1S2VA 1OGBA 3DBNA 3M47A 1RCQA 1A5OC 4A22A 4JTLA 2YB4A 3G8EA 3T0BA 1OFBA 2NW0A 3T07A 3QH2A 4DF2A 3V5CA 2YCLA 3NYDA 1PZ1A 2QUNA 2ZUTA 2A3AA 4DELA 3B4YA 3LA4A 4AD1A 2CWNA 1MFUA 4Z2LA 4X22A 4AG0A 3TYEA 4JY9A 3SQLA 1RR2A 3VX0A 2W62A 2WW5A 4ZO7A 1V0KA 4FHAA 1E70M 1SO4A 2CLKA 3VNLA 3WLQA 1ZZMA 3RCYA 2DZAA 5G1MA 1L0PA 2D3NA 3BMXA 4C6FA 4MYXA 3QQ1A 1YIXA 4H9ZA 1JXJA 3M5VA 1E0UA 4L1XA 1BSLA 1B57A 3IVUA 3UWQA 2DZWA 1F7BA 1WUEA 4PZVA 1C8QA 3WFZA 2DIJA 3CEUA 1CB7B 1RLDA 2PDJA 4WLCA 3SCRA 2QV5A 4HOXA 2VC6A 4DYEA 3E0VA 1EOKA 1EQCA 3CGTA 5LNSA 1KFBA 4LVDA 2UWFA 4RE3A 1EDGA 1BHGA 2YDAA 1NM9A 1EA0A 3GY1A 4A3YA 4ENLA 3SCQA 2PGRA 2WJDA 3UZYA 5CSYA 1UPMB 4LAZA 2QXWA 3MUZ1 3VZXA 1FHDA 3OA3A 2UY5A 1Z42A 3BLLA 1W9VA 3VD4A 2CXGA 1HKMA 1ITXA 2DIKA 4HA4A 3SI9A 1Q6RA 2FQIA 3K5XA 1AW1A 3IJDA 3N19B 3VKBA 3DYOA 1R3YA 1GQNA 1IWAA 2P50A 2XHYA 4DJDA 4TXEA 2E3ZA 3POHA 2HBXA 3BZJA 4EKJA 1XBXA 1ZALA 2DEPA 3F2DA 3KCOA 1E55A 1B4EA 1OG0A 3SSJA 3A4JA 1LRTA 5HMSA 5DCEA 4RZ6A 3BDKA 1F3TA 4CN6A 3AZRA 5M2FX 2WC4A 3HQNA 3GM8A 4HHPA 2QJHA 5CPOA 2GOKA 1PHQA 2VJXA 1CTNA 2GUUA 4BS0A 3GC4A 3LQGA 1JI1A 1VIWA 3ARUA 1K9DA 3VGGA 4JYDA 1ELSA 3CYJA 1G01A 1TKKA 5G1YA 2J62A 3AMLA 4DLFA 4KH2A 3TP4A 1VP5A 2Y62A 3WG6A 1VRDA 4XWUA 3V1PA 2F7FA 4UFJA 2VWSA 1P0BA 4GOAA 4ORIA 2GYIA 5CBJA 2WZIA 1OJXA 1LOQA 3N25A 1I0DA 3TV8A 2HSAA 1K8CA 2ZRZA 4G6CA 2X0HA 3R4IA 2PTXA 3VOGA 5C70A 3WNNA 5E09A 1PX8A 1QVBA 1PSCA 2BG5A 4O1DA 2OX1A 3NQ7A 5AC8A 5HWNA 3N3TA 2RHGA 4TVCA 3KE0A 4ZR8A 3NQFA 3L4WA 1SFTA 4UOQA 2WXDM 4ZOCA 3AIRA 4CU7A 1C3FA 1LG1A 3T55A 2PTZA 3U2EA 4ICNA 5BROA 2HBVA 4M29A 4JHOA 1KM3A 3NPXA 3MP4A 4E8GA 3JVAA 1EZWA 1J4EA 1WBJA 4PEEA 1X97A 1WKYA 4UTTA 3MU7A 1N82A 1D3CA 1YTDA 1WOAA 3QXBA 3S1WA 2QF8A 3B8UA 2VEPA 1Z89A 3VZYA 4XKYB 3BH4A 1HJSA 2GGGA 4X3ZA 2AQWA 2OT0A 3CAWA 3S0CA 3KBJA 4RZ5A 4BJHA 1UJPA 4F40A 2V38A 4Q8NA 2VC9A 4OE7A 3GC2A 3O8AA 3CV7A 3EDDA 3EBVA 2VWTA 1JFHA 3STCA 3RLGA 2Z00A 4C5YA 1LF1A 4MLRA 2JKAA 4XAFA 5HULA 2KZHA 1SJAA 4ATWA 3O15A 2J24A 5E93A 1NOWA 2W3ZA 1ICPA 3W37A 3BG3A 2YA2A 1I2NA 2D1ZA 1VFSA 5LIWX 3ZR6A 4K8EA 3TZNA 2PTWA 4F0RA 1XH0A 1C8YA 1LWJA 2CITA 4HD5A 4Q22A 2DZXA 3TROA 1H09A 1TJRA 3PF3A 4CLMA 3KS6A 2XU2A 4MSSA 2G3NA 4A2SA 1WV2A 4KFNA 1JJKA 1OADA 3V5FA 3EXRA 1A3WA 3G3DA 2ZUVA 1ONWA 1PAMA 4WZHA 2D20A 1JPIA 1W5QA 1R9ZA 4CCDA 1BTCA 1UW9A 1LTDA 3OHMB 1UWAA 1ME8A 1XS2A 2ZA1A 3U6WA 1MQPA 1ECQA 1VAHA 2XN0A 4WDTA 1Q6DA 1GVEA 2FZ9A 2WMFA 1LWHA 2Z0IA 4I9AA 1DWIM 3IGHX 5BXTA 3EB3A 2ANUA 3C8NA 2P0IA 1XIMA 3TW9A 2VEKA 5DF0A 4DRSA 1X6LA 3MBDA 1UWSA 2BHYA 4XKYA 4G5DA 1XSIA 3LB0A 1R46A 1VH7A 1GOKA 4KF1A 2PRHA 4ZL1A 3JS3A 1QPOA 3ALGA 4N7QA 4JCMA 1M5WA 3BUVA 4JKMA 1IT7A 3LRKA 1RH9A 5BOEA 3AJXA 3I7SA 3IARA 4F2TA 1V51A 3WL1A 1OC6A 2QCHA 3VNZA 5G1TA 4DUWA 3LTPA 4KEZA 1TV4A 1V6VA 1E6QM 2OGYA 4IG2A 2J7EA 3W1NA 2Y8VA 3UZWA 4UR8A 5I23A 4HA1A 3P7YA 1VLIA 2ZZ7A 3P8JA 4HNTA 1W31A 1HT6A 4E4UA 1EEPA 5D02A 1XW8A 2QQ6A 1WZAA 3L66A 4GI4A 4ML4A 3DFOA 1YQ2A 2I9EA 4LSBA 3GDMA 4EAYA 3G24A 4LV9A 1TYGA 3U7VA 4Q4SA 2Y7DA 3KRSA 4IOTA 2FMOA 3LRMA 4FS9A 2J47A 3B0XA 1K1DA 5A6BD 4WIWA 3CEPA 1CX9A 4YVPA 5IM51 2HCVA 1L6GA 3S9IA 2OELA 3G0UA 4W7VA 2ZRYA 3RM8A 1MEIA 4B5UA 1JCLA 1PDYA 4FIQA 4DJFD 3VOJA 4NZJA 5J5RA 4LAKA 3R0DA 2V5DA 5ENLA 5JBFA 2INZA 1LCOA 3IVTA 1HP4A 5JQ9A 4EPEC 4R9XA 2OZ8A 4HHMA 4AY1A 5I79A 5E9AA 1E4IA 3ZVHB 1H0IA 1T99A 3GWQA 2WJEA 4J27A 3TYUA 1SO6A 2EKCA 5HK4A 1HO4A 3S5ZA 2BXYA 3L2IA 2QS8A 2D0FA 2RAGA 3CC1A 4O50A 1ISYA 2AQOA 2Y7FA 4XK2A 5HPCA 2GJRA 4ZO9A 1B3WA 4I9TA 5G2WA 1GW9A 4H6QA 4XZ9A 1R3SA 1R7AA 2XGIA 5AFDA 1KCKA 5I03A 4A4AA 7ODCA 3GFXA 3W7EA 1MRAA 2Z1SA 2JKEA 2WC7A 1LOSA 2HQAA 1JUKA 4E0CA 4N0RA 2FJUB 3QGVA 5FD0A 4MNLA 2WMGA 4B5NA 3H7RA 4IFRA 1AW2A 3IJ8A 2NQHA 3GU9A 4HK5A 4FI4A 1FCUA 4TUFA 2YXXA 5CPQA 1W1A1 2V5JA 3F5KA 2ZDRA 3NFUA 4AY7A 1FP9A 4B9YA 4YCPA 2YGYA 2DSKA 4F0LA 3KVMA 2HNHA 4OUEA 1W3TA 3T9PA 4OKDA 3VXGA 1XJBA 2VEFA 4IPIA 3FA4A 1UYQA 3LGGA 4DI8A 2ZWZA 2DH3A 4R7WA 1TO3A 2CFFA 4HNNA 1A3XA 4A05A 1DJYA 3CM4A 4H04A 1CIUA 2NVAA 1WO2A 3PHAA 4MFDA 3F2BA 2VVNA 5I06A 1RBAA 2Y5JA 1S2AA 1V02A 4CCEA 3EAUA 1J0IA 1FH9A 4M82A 4FOKA 2GZXA 2X0SA 1X38A 5F4WA 3EEGA 3HGJA 3W7QA 1GKPA 1QHPA 2JIEA 1QNVA 2GSJA 1TR1A 3LLFA 3ZVHA 1R38A 2IKIA 1TR9A 1ZAJA 1I45A 1GZ1A 1NDZA 3H8AA 4Y9MA 3LSCA 3T05A 5D2YA 3VOCA 1VJZA 1OYBA 2VZUA 1ZAIA 4JTTA 1SJCA 1KQYA 3UG4A 2OZ0A 1GVQA 4ZQPA 3DFPA 1E9LA 3KAOA 2XM2A 5CGQA 1JCJA 4ERIA 3OGSA 1LM1A 1WDPA 3EB4A 4NZ4A 3F2CA 3E3HA 4JCLA