1QK2A

Wild type cel6a with a non-hydrolysable cellotetraose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
total genus 137
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qk2A00
1OC5A 1QJWA 1GZ1A 3VOJA 3A64A 1BVWA 1UP0A 4A05A 2BOFX 1HGYA 1OC6A 3VOFA 3A9BA 3VOIA 3VOHA 2BVWA 3RU8X 4I5RA 3RPTA 1UOZA 2BOEX 1UP3A 2BOGX 4I5UA 1CB2A 1OCJA 4AU0A 1OCBA 1TMLA 3VOGA 1HGWA 4AX6A 1UP2A 2BODX 1OC7A 1QK2A 4B4HA 4B4FA 3ABXA 4AVOA 1DYSA 4AX7A 4AVNA 1QK0A 1OCNA
chains in the Genus database with same CATH superfamily
2WJFA 3E9AA 4HPGA 3WL1A 3NOYA 2RUSA 2V69A 1C9DA 1XG3A 3M43A 2VD9A 2GJRA 3S2JA 1JXKA 2WMIA 2C91A 3TC6A 1TCMA 4AZ5A 1OC7A 3H54A 3HG2A 2VQUA 3W6MA 3BDKA 1XIBA 5L9FA 2OLSA 1EUNA 1LL7A 3VFCA 3EEZA 3O05A 4NSBA 1RCXB 4MNKA 3T42A 5TF0A 4MB1A 1M68A 2IQ0A 1Q85A 3UWQA 2BZNA 1GW1A 1EH9A 5LGZA 1GWJA 1AQFA 2JF6A 4FMVA 4A29A 3QJAA 1E40A 5A3HA 3G0SA 3ITXA 2XM1A 1PHWA 1QVBA 3KTCA 1M01A 2PPGA 5DY2A 5LYRA 4IQEA 2Y8VA 1A5UA 1MZHA 1JR1A 4C6EA 3FVDA 2QGHA 4HOXA 1JXJA 3CTTA 3KW3A 5BOFA 3VFLA 1A3WA 4KFOA 1ZP4A 1HKMA 4O4VA 1SZFA 3DUGA 4Y9PA 1EIBA 3SCWA 4HK5A 4UMCA 3JU2A 1K4HA 1E70M 5AHMA 3H2EA 2QPXA 2V8ZA 1AVAA 4HPJA 5FJPA 4W7WA 4LRSA 4U10A 4PA8A 4KCUA 4L4MA 3BWWA 2PDBA 4PB3A 3ORWA 4G7EA 3LGDA 3MV01 3RF9A 5KITA 1AK5A 5TNVA 4OIFA 5IDIA 2ZRVA 3QTPA 4A6GA 1SPQA 4V1XA 2G97A 4LC8A 4O0ZA 4EAYA 2HMCA 1EF2A 2YXXA 1KXVA 2PDYA 3B0VC 4HVXA 4W5UA 1NTHA 4D2JA 5E9XA 3W2NA 1V8EA 4B2DA 1EUAA 1GVIA 1TRDA 5D2TA 4H9ZA 4PB4A 3TKFA 3GXTA 4GISA 3WF3A 4JFWA 1UQZA 3DFTA 1VH7A 3VIGA 3TDFA 1EPXA 1WDDA 5HJXA 1OM0A 3IIOA 2QJHA 3EKLA 4CQCA 3QV7A 4FR1A 4DJFC 4MF4A 1ZZMA 2PURA 2TYSA 3FKKA 2GDQA 1A5LC 1O7AA 4WX2A 3QVQA 2OWCA 2CZVA 4EF9A 3C2EA 5EL1A 3OZMA 5IDZA 2X1RA 4KEUA 3NZRA 1KXTA 3CAVA 2YW3A 3S6TA 2OXNA 7A3HA 3IJIA 1T40A 1J4EA 1UD8A 3ARPA 2HV5A 1IXQA 3TE9A 2D69A 3CUZA 4JTQA 4B9ZA 4YPJA 1US0A 3BLOA 5FAGA 3AHVA 1R85A 4XZBA 1ZJBA 1GEQA 3GU2A 3MHGA 3NL3A 1BLIA 1US2A 4C6OA 3EOLA 2J8GA 4U5IA 1HJWA 1U5HA 1T7LA 3IANA 3E5BA 4K8GA 2VX7A 1ECQA 5RUBA 3W76A 2PLJA 2VEPA 4GUFA 1I75A 3FDKA 4DQWA 1MZRA 5DLCA 3K46A 3WLRA 2ZZ2A 4IMFA 2QS8A 1E55A 4B5VA 3KLKA 5FOOA 1E43A 3GTIA 4UFKA 2Z24A 1HKKA 1XL9A 1PYMA 1VCVA 4M56A 1YPXA 4J3VA 4UFHA 3NEVA 2WK2A 3L4VA 3THDA 4FXJA 1SVDA 2DSZA 4IM4A 3BAJA 2FH8A 4CU7A 2HXTA 1HZYA 5EMLA 1O1HA 2AAAA 1AH4A 4NZ3A 3GZAA 1Q8JA 4JHOA 2WKGA 4ZTXA 3N2OA 1XSKA 4R7JA 3WD1A 5J8LA 4DLMA 3VIKA 1QHPA 2HE5A 2ZRXA 1Z32X 3AMLA 4GUJA 5I3FA 4JTGA 5F7UA 5I23A 3UNTA 2GUBA 1AZ1A 5HPOA 2VO5A 4L9YA 4FZIA 3NL5A 4LVDA 1NWSA 5ENLA 5AYIA 1LBFA 5J04A 4K8EA 1XUUA 2PBGA 1HJQA 5ABHA 3H4WA 3NO5A 4XAFA 3KBSA 2ATMA 1VP5A 2XSXA 1KKRA 1VBGA 2QJNA 1SQ7A 2Z1WA 4LEQA 2YKKA 2FHFA 1Y7VA 3S46A 3RRXA 4A4AA 1RK6A 4AQLA 1XIEA 1R9ZA 2OT1A 5CZ0A 3M5VA 2XIOA 3VKBA 1A5OC 2Q8ZA 2ALDA 3LBMA 4B2DD 5AECA 4C1KA 3W87A 2YDSA 3OQ8A 4ZOBA 5BOOA 2Y4SA 1HQTA 1R8LA 4AD4A 4PMRA 4HPXA 5IHRA 2ZKMX 3LZ5A 5HUPA 4A3UA 3DFYA 4Q8TA 4NY2A 3IRDA 5K4XA 3EXSA 2ZZ7A 4JPGA 2PDMA 3O2LA 1UB3A 1EOMA 2ZUWA 3N9RA 4BWLC 3HPZA 4NUWA 4Q4SA 3ZR4A 4FX7A 5EMUA 4IGHA 1SFSA 1UZHA 3GVVA 3T2PA 2FH6A 1NQKA 2PSNA 5F2GA 1TQXA 4NJIA 1VR6A 3LMYA 2H3DA 1GKPA 1BPLB 4C65A 4XAGA 3AXHA 5HATA 5I5RA 4GIYA 5EFFA 4UCFA 4PEEA 4JS3A 3MMWA 5HINA 1LUCA 3B8VA 1EJWC 2VFEA 4PCNA 4CQ9A 4F2BA 1NFGA 3N2TA 3L5MA 1X98A 3O6DA 3OVGA 1ELSA 2C18A 2FHCA 3VD7A 4Q3MA 2BG5A 5DX7A 1LBMA 2YL6A 3R1ZA 3TX9A 1K8XA 1EEXA 4CEUC 1AQHA 4MMWA 5D02A 4KGLA 1VFTA 5AYZA 1Q6LA 3L4YA 1EYWA 1A5MC 2ZE3A 1XRFA 2P8BA 4DPQA 3GTNA 4F0SA 5E6ZA 4B5TA 3IGHX 3F5LA 1NELA 1IE7C 2CHRA 4Y6GA 2ONEA 2PDQA 3OVPA 2WNWA 3T6CA 2GJPA 3NO3A 4CN4A 3WQ8A 1HNYA 1BF6A 3P2VA 1XYCA 3QPZA 5AC6A 4D6CA 4G56A 3TQKA 3EWCA 5DFAA 3IAQA 3W86A 3GYCA 4BF9A 1DQUA 5K7JA 2CEQA 2WMIB 2AQWA 1R9XA 3K8MA 4OBSA 1XWYA 3CH0A 4Z2KA 4OQVA 1W3KA 3BJSA 4OV9A 4J35A 4M8UA 4C6IA 1QASA 3THCA 5FEPA 1Z41A 4A3QA 2H9AA 3LDVA 5REQA 1XC4A 2ZZ4A 4TVDA 2HNHA 2Y61A 4P2VA 3EX4A 2ZWZA 4V2XA 4Y8FA 3NYDA 2QCHA 4V33A 4I9JA 4HZ7A 4NILA 1KTBA 8XIAA 2J9ZA 1R3SA 4GXWA 1LM1A 3TYDA 4Q33A 3CUFA 3QR0A 1NJJA 3FFSA 1WNOA 3TYUA 1G67A 1ZBKA 5HDRA 1XD0A 3NPWA 2H3BA 5BNKA 1HKWA 3CYVA 4UR7A 3WQWA 1UA7A 4FXFA 5GNYA 1TVPA 4DYEA 4IGSA 2AKMA 3QH2A 4PN2A 1QU4A 2INFA 5JH1A 1UR8A 2E6FA 3G0XA 4TX8A 1CXHA 2R24A 3H12A 4A3YA 1UZ1A 1SW0A 3BG9A 2XGIA 3DKJA 3LXBA 5XINA 1YTEA 3REQB 2IUZA 5G5IA 3PZIA 3A21A 1CPUA 5C9UA 4HJWA 3LM7A 1O1ZA 3AIWA 3GVQA 4RPPA 3AXXA 2FZMA 3CS2A 1Q6CA 2QV5A 1JYWA 4DJFA 3BLDA 4WIWA 2IQTA 1V4YA 1E6ZA 1VAHA 3WQ4A 1EHAA 2BY1A 1I45A 4GLEA 2NX9A 2NW0A 1BQCA 3ONCA 4HSOA 2ZXQA 1W54A 3N6JA 3TQ0A 1ISVA 3QXBA 2NQLA 1CTNA 5ABGA 5I3HA 3HN3A 5ECUA 3N2MA 1DJWA 2BY0A 2DZUA 1TCDA 3G1SA 3PNUA 1QDSA 1UHVA 4MGGA 1F73A 5D9OA 1I6NA 2HK1A 1OZMA 3QW4B 5MF5A 2YBTA 4WRHA 3W7HA 1LORA 1S2VA 4OOUA 1MWOA 3QLLA 4QQUA 1TO3A 5MHBA 2BGNE 2EJ1A 3FYYA 3FLUA 3G6LA 2PMQA 4IISA 2R1PA 1I2NA 3GR8A 4X63A 2E8YA 1NQ6A 4GH3A 3BMWA 3A4XA 2YYUA 3BSHA 1ZUAX 3RNDA 1VHCA 4XK2A 3UR8A 4MNMA 3LXCA 1ADDA 3NM1A 2WANA 3KP0A 2C1GA 4KKXA 2Y7FA 3ID7A 2OR2A 1FHVA 4OUIA 1FX6A 3EOOA 1W9BM 3BW2A 5T91A 4PBEA 3LM3A 3SRFA 4FOJA 4H1ZA 4H9UA 2VGBA 1DBTA 2NX3A 3TVAA 5K2ZA 2C15A 3W1XA 1IEIA 3RN6A 5I09A 1PKYA 3MT1A 3EOUA 1B2YA 3SUTA 4A2SA 2J6VA 3DDMA 4IJRA 1GOMA 3RHGA 5A94A 4WD0A 1EO7A 2DDXA 3D47A 9CGTA 3R94A 4IIEA 3HJZA 3LCIA 1VBJA 4NQ1A 3WBWA 1TELA 4PR4A 2R94A 5C54A 3WF4A 1ITUA 3GNOA 2YB1A 1L6GA 2R1KA 3W23A 4CD4A 3EB2A 1P1XA 4JKLA 4HU3A 3KTSA 3DI0A 1UBSA 4GO9A 1QRQA 2GL5A 2DQXA 8CGTA 4M81A 4H4IA 1WZLA 4JL2A 4M51A 1OFDA 3R58A 2L5HA 2V5BA 4W85A 3CV7A 1GVRA 4DRSA 1OGBA 2DJXA 4MPQA 1W32A 3H2AA 4S3CA 3MP5A 4Y2WA 3MCNA 2RJHA 3APGA 2PDCA 3TMQA 3STFA 4W7UA 5A6TC 3AIQA 3GDLA 3H4GA 2RDXA 1QOXA 3SCRA 1V6YA 1B3WA 4NJJA 2IPJA 3W85A 3HGSA 4PRTA 1S2UA 4M7TA 4C6DA 3PC0A 4C7GA 1FH9A 2QMKA 3UJFA 1I1XA 1GW9A 3GAYA 1AMKA 3OU8A 4XVEA 1Y65A 1W1B1 1E4NA 3O0KA 2DT0A 3W72A 2ZUNA 3F4NA 4B3ZA 1V0LA 2PU0A 1R9YA 5LZLA 1E0WA 3M7WA 4OJYA 2NQ9A 3S1UA 2XVPA 2OJPA 1ADOA 3OIXA 2W91A 1W3TA 4HA0A 3T8QA 4NIRA 4GO8A 1OD8A 4DXKA 3PBYA 3UERA 4PSPA 3UCDA 3VOHA 1EA0A 4S3GA 3S4TA 1D8WA 3MS8A 3CNYA 3CUJA 1W8SA 3C3UA 5CGQA 2PDXA 3FNDA 3PK7A 3CQHA 3OHIA 2ZX9A 1QPRA 3N1AA 3CWNA 1ZSXA 1WXYA 3LHVA 3RJXA 2A3HA 4WY0B 1JD7A 1NH6A 3R43A 4OECA 2C71A 4BKNA 3NVDA 2VGFA 4EVZA 3N6QA 2YCLA 3IWPA 4GVIA 1XH1A 2ZX6A 3MKVA 1TPVA 1YKWA 2ZXAA 1UUQA 1UJPA 1GT8A 2YCEA 3ZT6A 6ALDA 4QNEA 4W87A 1LRQA 1XG4A 3HG3A 4HA4A 3M46A 3E0LA 2GVGA 1KGWA 4Q8NA 1EP1A 3O15A 4XZWA 3NZ1A 4O53A 2CW6A 2PF8A 1F8MA 4MB4A 1QI0A 4PBFA 4PUNA 3AJ7A 2GZXA 3W7OA 5I3GA 4PL1A 3FHQA 5I7GA 1QFEA 3PTDA 3WH7A 3W27A 3GFYA 3B8IA 5FJRA 3PULA 4GZJA 3WDHA 5FSEC 4IICA 3T0BA 1CYGA 5K4ZA 3W28A 4GUIA 3WMBA 3TA6A 3VCCA 3W1PA 5JIPA 3URNA 1LG1A 1OGGA 4C5ZA 5KZMA 3T2QA 1WQ5A 2Z29A 4GX8A 2INZA 1MDRA 3ARWA 3T81A 3U8GA 2QVNA 3WNNA 4WOQA 4YTUA 5J5RA 5L6UA 2CETA 1DJZA 3CAKA 3DESA 5E93A 3VD9A 1YE6A 3VGFA 4DBWA 1M7JA 1JVNA 1W3LA 2BV9A 4AVFA 4UTMA 1H7NA 4K2SA 1WDSA 3AHYA 3VOFA 2BVYA 5LHEA 4MWAC 4ZMGA 3BLEA 3NPUA 4DBSA 5M5DA 4R88A 4KCWA 1JFHA 4MJZA 3BMXA 2VNCA 3V1HA 1SZRA 1AMYA 3UD6A 5HJYA 4PC8A 3MY9A 5I2UA 4H19A 4BA0A 4AZIA 3LTYA 4IP5A 4NZ5A 4A22A 3THQA 2BY3A 4AH7A 3DG6A 5A8NA 3CHEA 4RDVA 3IPWA 2Z6JA 1TJ0A 4O1AA 1NIUA 3DC8A 3ZVHA 1XC6A 4Y9NA 4RZ4A 2HXUA 2VVNA 2EG7A 2XYLA 4XO6A 3M0HA 4E8GA 2V81A 5DRIA 3E1F1 4ZGYA 1NF0A 2DGAA 1PS9A 1PO9A 1JRBA 3HV8A 3DHPA 3N11A 4LVGA 3T44A 4GOAA 1XGZA 4XD5A 1OJXA 3RX2A 1XSIA 4CQDA 2DZTA 5CSUA 1N2VA 2O0TA 4Z08A 4H7ZA 4G9PA 2FJUB 5HNUA 4EOUA 3IV8A 4Q32A 1DJHA 3SJNA 1YBQA 2WNZA 4JN6A 1OX4A 1Y5XA 1FWDC 1TQJA 3WCZA 2WVSA 4J2MA 4EF8A 1TWDA 1LF1A 3SFKA 3RG6A 1W9UA 3QTGA 1I4NA 4WSKA 3J7HA 5A8PA 2F8QA 4HNOA 1QNOA 1OB0A 1TSIA 4RKAA 4C7FA 3VTRA 4AZBA 3VD4A 2Y2WA 2TAAA 5A6MA 1IXOA 4C1LA 2WO5A 3GM8A 1XKYA 3PVFA 4GQQA 2ZWYA 2BY2A 1YNQA 5I77A 1CNVA 1EJRC 2ZRYA 2XGZA 2XDFA 2W63A 2DSUA 1BWVA 2B7QA 4QS6A 3WDIA 1QTWA 2PTXA 4XG1A 3M1ZA 2PWUA 3T4WA 2Y85A 4IXHA 1N82A 4MWAD 4JDYA 2HVMA 5CBJA 3W7EA 4ZQMA 1JPIA 1KO0A 3LHYA 1H0GA 4B5UA 3VIFA 4LY8A 3GR4A 1QI3A 5FEXA 5HANA 1JRCA 4EE9A 2VVSA 4XWUA 2P10A 4JYFA 3GXIA 2ZA1A 1G7VA 1TVNA 3AU6A 1B54A 4S3JA 2OEKA 3OBKA 1GONA 3E0FA 1KCKA 3ZR6A 5BU6A 4NZCA 4V15A 4NRSA 4HHMA 4IX0A 5CBBA 3TJXA 5LSMA 3EDKA 3N17A 4DO4A 3W1UA 1LWJA 4LY4A 1ITCA 1IT8A 1E1CA 3SB0A 1KWGA 2WB5A 4QJ3B 4ZOCA 4UTIA 1M1BA 2F9RA 3AXMA 2Q02A 1VENA 1TYGA 4H7CA 3DECA 4C60A 4RNFA 2XH2A 2WSQA 2ISSA 1QW8A 1TE1A 2ISFA 4D9PA 3SQLA 2GGEA 1YX1A 1OYCA 2DV0A 5FCZA 4TX9A 4D8ZA 4ATLA 3CL8A 3CEPA 3ELFA 1IT7A 4HU4A 3FXYA 1KBIA 3C5QA 4S3DA 1J9YA 1TV5A 3H22A 2OWWA 5K9CA 4GK8A 4PTWA 2JE8A 3CTLA 1CXFA 3HF3A 3M64A 3M0YA 3RCMA 1GCYA 1BTCA 2I5IA 3GDRA 3MSYA 2HDJA 4DWSA 4KPLA 1W2VA 5IBXC 1D2KA 4I90A 3ES8A 3PWIA 3UZ5A 3SGZA 2G5WA 4NT0A 3WH9A 4DI9A 4PBGA 3GG0A 4AEOA 1KM6A 1JCNA 3K1GA 1UD6A 2VRQA 2Y8UA 2DW6A 4CGTA 2RKXA 3ITTA 5DQPA 3VMOA 5I3JA 5U7SA 3LD5A 1XLBA 2WLZA 4NNCA 1JF5A 4JTAA 3KVMA 3PSWA 2Z1BA 3JRKA 4ZTYA 2QIIA 2GLKA 1N8WA 3LQGA 2C1HA 2E5BA 2WHKA 3AUJA 1V5XA 3HGOA 4CCCA 3UEQA 2VX4A 5SWUA 4E38A 3KRZA 1VLIA 2XGBA 1Q7ZA 4DWSD 3OVQA 1SFTA 3RM4A 5T9BG 2C79A 4KIEA 3M6YA 3MMDA 5HQEA 1K8YA 3EKZA 3H6OA 5AHLA 4G8TA 3U5YA 1XISA 3WJZA 2IS7A 4A8LA 1HL9A 2RGMA 2CFFA 3L65A 4FNRA 4FALA 4UQDA 3CHCA 3UYCA 4U28A 1DE6A 3HU7A 3LGEA 4P7LA 2J7EA 4UXDA 2XWDA 1FXQA 4WVXA 3CUGA 3NCOA 3R13A 5HQLA 3NQVA 5FL0A 2J7HA 4S38A 3GXNA 2H90A 4HSHA 5A6KA 1XV8A 1TZZA 1QK2A 3PP7A 1TPEA 1WX0A 2F6XA 4YJ5A 3AO0A 2QMJA 4JTKA 3UJRA 3CH9A 2X1TA 3VGEA 4Q8PA 3NL2A 4CNNA 5GJPA 1MRQA 1FVPA 3W71A 2FPTA 3B04A 2GQAA 2WCSA 3EBVA 2C19A 4WSJA 4LFYA 5CJMA 1WO2A 1H7PA 3W7IA 1WKFA 4Q8OA 3B8WA 3S2CA 1V6TA 2W79A 3SY1A 2PAJA 4C5YA 4C1NB 4DX3A 1UH2A 3N14A 2VEFA 4Q4KA 1LRNA 3AU2A 4CNPA 3JR2A 2XIJA 3N3TA 5G2IA 1SZEA 1JIBA 3AYSA 4IQDA 5CAKA 4XSMA 1PZ2A 3STPA 3EB3A 4NZ1A 4N42A 4Z1CA 1FP8A 3AROA 3G1FA 2I5GA 4PZVA 3WLKX 3NWRA 5CJNA 4CQBA 4YU1A 3BJTA 3KDOA 4F2UA 2EEXA 1FFRA 1OSEA 1XLGA 1QJWA 3Q65A 4LCSA 2A3LA 2ZZ6A 2VFHA 4MDOA 4BCEA 2OWXA 3T8LA 4FNPA 1I8JA 1O12A 2CBJA 2TMDA 4RW5A 4BZYA 4IMGA 2Z2UA 3VIHA 4E5TA 3OGVA 2PDKA 3WLNA 4AVOA 4DWDA 1F61A 4DNHA 1MQPA 2V5DA 1KR0A 3U3HA 3KOFA 3CZJA 4N4PA 4N4QA 5IM51 4H8HA 2ASHA 3RFAA 3FIGA 3T07A 4HPHA 3IGXA 3GHTA 4K38A 1IV8A 3V4BA 1H11A 5EA9A 4L6HA 2WM0A 1TZ7A 5A6LA 1BG9A 4O1CA 1EC7A 4D1JA 4Q22A 3MI6A 3AHTA 1ADSA 3NQBA 1ZNNA 4XZMX 2QCGA 4LSBA 1RQBA 4IMDA 2ZA2A 1U1UA 1TTJA 2R6OA 5MKGB 3M9YA 4P8VA 2RDUA 4GXMA 4WLCA 4AYSA 1H61A 1W9PA 1VEPA 2GSJA 3T0DA 4NAFA 3W00A 1KQYA 4IPIA 4NI3A 1CECA 1EX1A 3WLIA 1CT5A 3PWGA 1DXFA 3CMFA 4L4LA 1H09A 1IWAA 3ZJ7A 2EF9A 4FLSA 1RJQA 5M1TA 1JCMP 4OHQA 1IEWA 4HMDA 4XV0A 2TODA 4TXEA 3GH7A 3MMUA 3BQ5A 2FGZA 5F1UA 3QQ0A 1QWGA 1EC8A 5HOSA 3BCJA 2PWHA 4PMOA 2CCRA 4G6CA 5KZ6A 1CW2A 1EX5A 1AH3A 3RR1A 3RMJA 3QV8A 4GVHA 4M5PA 3VKKA 5ABFA 2PLMA 4PUDA 3W7CA 3SADA 4Q4QA 1ZFJA 4JIIX 4GHRA 5FD0A 4LF2A 1MEWA 3C0LA 4N6EA 2Y5EA 4I7VA 4X0VA 1EWDA 2WZIA 5CSSA 3LHZA 4J7RA 1J0YA 3E3HA 1OX5A 1J0HA 1K4GA 4ILSA 1Z48A 4CN6A 3JVAA 1NY1A 2X2GA 4C6BA 1A3XA 3QMSA 1T5AA 2VX6A 3ZLFA 5IXEA 2DVUA 4PMJA 1UZ4A 4KS0A 4PMNA 2QULA 5LIXX 2GUYA 1XKJA 1WBJA 4PUUA 2I5QA 1B3YA 1E6XM 1TIMA 4KEZA 3W1TA 1ZY9A 3I4EA 4IP7A 1FA2A 3AMCA 3U9IA 3OP2A 2IXVA 1EPVA 1BXBA 4GMEA 4GFSA 3HZ3A 3D3FA 1NDZA 2FGLA 2PD9A 1WZMA 4DJED 3W7JA 1DWHM 1W1IE 1QPQA 7ENLA 1G5AA 4XO7A 4EWND 1SR0A 1JZ3A 3T78A 4PUEA 2OQYA 2Z2BA 4WDWA 4PMVA 1GQIA 2E6YA 3GC5A 1NP0A 3EKGA 2V67A 3DG3A 4H9XA 1WOBA 1G7UA 4KW2A 4ZB0A 3T0CA 4ZOEA 2DUAA 1ML1A 1GEHA 3BG3A 3DBPA 3GLCA 4AW7A 2I57A 4X3ZA 1JDAA 2W67A 3SSZA 3S1WA 5CQ1A 2FZDA 1KW1A 1AJZA 4WUIA 4AUBA 1UR2A 4M1BA 1ME9A 2VR5A 3W83A 1MO0A 4DWSC 4J3TA 1QT1A 3QZAA 4DO5A 1CXLA 2J6XA 3OA3A 2E28A 1DIOA 4UTLA 1H1YA 1YNYA 5CPTA 3RO8A 4J27A 3KZPA 1UD4A 3H2NA 2I16A 3I3EA 2UY4A 2MANA 1MUWA 3VDCA 1POKA 4UOJA 1HKIA 1XPYA 1Q65A 4GIAA 5CPOA 4OT7A 4JN8A 1W1A1 1YTDA 3EDFA 3I7SA 4IMAA 3TR2A 1H62A 1GORA 3WJYA 3BAKA 3UCCA 4D8AA 1IT0A 5KZDA 1ZAIA 4ZO8A 2UZ9A 3LERA 3C8FA 4P7QA 2PU1A 4GC3A 4JQ1A 4HA1A 1ZBCA 3UESA 1C9WA 3HPFA 3R6IA 3EMCA 2O4MA 2DY3A 4N0RA 7REQB 3LK6A 2O92A 4W9TA 2OOFA 4CQ8A 1WYIA 2A2IA 3OLDA 2WQPA 4LBUA 2QV4A 3MUZ1 1VIWA 4X60A 3FYPA 3AYRA 7CGTA 2VGGA 1YW1A 1GPWA 1UH3A 3OB8A 2FZ9A 3P5YA 4G7EB 4TQTA 1I0BA 4DXVA 5EBAA 4UQ9A 4RJEA 1D3GA 3SW6A 4RV8A 3CLMA 1W5PA 1SYTA 4G1KA 2HROA 1OWQA 2CLLA 3PPCA 5AVNA 1CBGA 3O1NA 3SY5A 2BWGA 2NQZA 2ZC1A 3QHNA 3NQ7A 1RPKA 2ZOXA 3QGVA 4RL3A 4KFPA 3C6CA 3SECA 4RNIA 2YA0A 3GBEA 2EAWA 3FSUA 1NOFA 4ADUA 2CBUA 3UF9A 5DMNA 4C1NA 2DSWA 1PKMA 1UROA 2J74A 3R0DA 2QQ6A 4CEXC 3LI0A 3WJXA 1G4PA 2Y1HA 4M29A 3W1QA 2NVCA 5CC3A 2JF7A 4FI4A 3BVJA 2VZSA 4LBRA 4BS0A 4FK9A 2QCFA 4N9EA 1NF7A 3LBCA 1VIZA 3NG3A 3ANUA 3U57A 4OV4A 2PDJA 1YBQB 5D8WA 5IFTA 3CB3A 1SR9A 1N8IA 3GDTA 1XLHA 4UTFA 3THUA 3RLHA 3C2FA 3L0KA 2VD8A 1E15A 1W1PA 2Z28A 1QI4A 4MB5A 2ZRZA 2J7DA 4W8LA 3NL6A 5HWJA 1GZ1A 2IPGA 6CGTA 2R91A 1Q13A 1QATA 4JIPA 2C0AA 4JQ3A 3W1AA 4KWSA 1EDQA 1VFSA 3SRHA 4AC7C 1O5KA 2VDHA 2WCAA 1L0PA 3VO0A 1TV4A 4JTSA 2WHLA 4AIBA 2WM1A 2NV9A 2FHBA 3ARVA 2DPEA 5AHEA 3BV7A 3USZA 1PKLA 5KEZA 3EA2A 4FF7A 3HM7A 1B5TA 1PJ9A 2J75A 1VPYA 4I8DA 4GZIA 4CD8A 4JIHA 3SCOA 1T6MA 1OF6A 3LLDA 3DYPA 3QQWA 3B0XA 5CZTA 4PCSA 2OZ0A 1GOKA 1BRLA 3EWWA 2VZOA 1OC5A 3GXDA 2YXGA 1M5WA 3PG9A 4C91A 4LAOA 1XLDA 5JIWA 1EJSC 2X40A 1RVKA 2ZICA 3F03K 1DPMA 4XIMA 2VZUA 2WSPA 4H83A 3R89A 4L1WA 4ZXOA 1U2YA 1ZALA 2XH7A 3S5SA 1WAWA 3WD0A 3OYZA 3M0XA 2FDSA 3ZOAA 1V93A 3W6YA 5LNRA 5HWMA 5K9DA 2BXYA 3N12A 2FIQA 5E9AA 3UU0A 2VRJA 1B3XA 1AD1A 3BCFA 3TJLA 3KUMA 1FP9A 3N15A 2HISA 1FH8A 2UY2A 4EANA 3WQOA 2BOFX 2GVEA 4CCZA 1QMLA 4HZMA 3LV5A 1HJUA 1ODZA 1V3MA 1PX8A 5JQ9A 1VEOA 4FNQA 3GX9A 5GJMA 5TD4A 3R11A 1MXSA 5K3VA 2ZYFA 3VX0A 4Z1YA 5DCDA 1W5MA 3MTWA 4D6EA 1DYSA 2VUNA 3QHOA 1YPIA 2XFWA 1K9TA 2UWFA 4ACYA 3KVLA 3RX3A 5E6YA 1I0DA 1TG7A 3N18A 3OLEA 3WJWA 4HYWA 1FWJC 3IIXA 4O0KA 3VVGA 3D0CA 4XD6A 1QCWA 1W37A 3OG3A 3WQGA 3NDZA 1SFLA 4QS5A 4ERGA 3W7NA 1LL4A 3M7SA 1LDCA 4CD5A 1GJPA 2WMHA 3DYOA 3VM5A 3TOYA 1GQJA 5CGMA 2RGLA 4AX6A 1S1PA 3WNLA 1CLKA 4M7SA 3RM8A 4CQAA 3QV9A 3WK1A 1ME8A 3GG1A 3O6YX 1PUDA 3BH4A 2OG9A 3O16A 1OX6A 3GG8A 4LVAA 3GC4A 5D9NA 2PWDA 4WZHA 3TYZA 3IJ8A 4US5A 1VPQA 4HNTA 3PJWA 4A21A 4XAPA 3BGJA 4K1GA 3WJSA 3C52A 1XS2A 1DWAM 2Z7KA 3N29A 5AC4A 5C2XA 3MSDA 1X39A 1J0IA 3U7VA 5DT5A 2A6LA 3ATYA 3KVKA 5C9WA 1E71M 1V3JA 4JKMA 2E09A 5AB3A 4QBXA 4ASTA 1IZCA 2VELA 4KIRA 2ZX7A 3O6AA 3MV11 3NO1A 3FCPA 4OOZA 3LRKA 2XHYA 5CLTA 5LGXA 4LPCA 4GZ7A 2EPMX 3VNJA 3UR7A 2J79A 5DXYA 3RAOA 1RVGA 1OADA 4XZLX 1A0EA 3DHDA 4GYFA 2AQOA 4IIDA 4FA3A 1E0TA 3S9ZA 2G8ZA 2DZBA 5E09A 3NQCA 1A4LA 2D22A 2GWNA 4WJXA 2WAGA 2HE8A 2O9PA 3WF1A 3DENA 3BLPX 2G37A 1QOQA 2XVLA 1X1OA 2E25A 1VS1A 1WZAA 1E9LA 3NPXA 4JTHA 3F5JA 1Q6RA 1RPXA 4DBDA 4GYPA 3KDNA 3QFWA 4HN8A 2D2OA 3WL0A 3RYSA 4PTXA 4UR8A 3FK4A 1BYDA 2BVTA 4GQRA 2QXWA 3W6LA 2FQIA 2Z27A 3OODA 3G18A 1JFXA 3OQEA 3B8SA 1EB3A 3MW7A 3W22A 1XH0A 4JHZA 2FDMA 2WJDA 3UVAA 4ZQNA 4I8YA 1VFFA 2Z26A 1L6YA 2V5CA 4RXGA 1ZU8A 1F4HA 3ME3A 4FLQA 3KTXA 3R0KA 3LCHA 3VDAA 3N2BA 1B4EA 5GQBA 1QNRA 4I5XA 3CPUA 1LUCB 4EX4A 4AISA 1CXIA 1R2SA 4PCFA 3IS4A 3LPGA 4ZE4A 2FKPA 1DORA 4M6VA 1IGSA 2YZRA 3TYEA 3W7KA 4PL2A 1O94A 3RM9A 4JX6A 3WX7A 3IJLA 1PX3A 4LS2A 1PCWA 3V75A 3OLIA 2WHJA 1V0KA 4ZO9A 2VWSA 3UWZA 1GZGA 5A8MA 2ZTKA 2VOTA 3SUSA 5A2CA 4UB9A 5LNVA 3PBGA 5DCEA 4H8NA 4FX8A 3UXDA 1VRXA 2VYOA 4IPLA 3UPMA 1OIMA 2CLFA 1F7BA 3W82A 3AIRA 2HQAA 1RBAA 4UQCA 5BRBA 2VEMA 3WBXA 5T26A 4HTBA 3C61A 4RW3A 3DAQA 1KRBC 2VR2A 4WSHA 4JL1A 1UR0A 1ZGDA 2F61A 3RILA 4X9YA 4XD3A 3AHXA 1RD6A 4H6EA 4HNVA 4U4MA 3PY2A 2E77A 4R33A 5CSRA 1BGAA 4LV4A 1C3FA 2YLLA 4US6A 3M6DA 1MW2A 3VIMA 2JK2A 1UIOA 4DZAA 1G01A 3B9DA 1FHUA 3TNOA 1FHDA 4AF0A 2CESA 2POTA 1GQNA 1OFRA 3PPFA 3SUUA 3ITCA 3MC5A 1ZBWA 2EGZA 5F1VA 4Z1BA 2YL9A 3BW3A 4EXBA 3HV9A 2Z1XA 4XQ6A 1TPFA 1TA3A 3K4WA 4E3VA 1QHZA 1KBLA 1DQXA 3VYLA 2PF0A 3TQVA 2WC7A 4L9ZA 3S1XA 4BI5A 4YTQA 2A7NA 4E8DA 1B31A 3GVGA 4N9DA 3ZWSA 2YDRA 5EMKA 4L61A 5D05A 4RR4A 2D0FA 4KRZA 5B80A 4Y9AA 3AXIA 2J27A 1XW8A 3VGBA 2VJXA 4QRNA 3G1HA 1JCYA 1YDNA 1VFMA 3VGHA 4EPBC 2VC7A 4XBSA 4XSLA 2ZTJA 1WPCA 1POJA 5LA1A 1B9BA 2ZVRA 1A5AA 3M5ZA 4DAIA 3GFZA 1WUEA 1GOQA 2Z0IA 1UPPA 3PJUA 2A5HA 1MNZA 1JYVA 3CAWA 2BP1A 5TIMA 1Q6FA 4ZCWA 1EJTC 1DHPA 3NM3A 3AS1A 4XUYA 4L1GA 2X2YA 1X38A 4O52A 1E0VA 1I2RA 1V6WA 1XRSA 4QP0A 4DBEA 4ROQA 4L9XA 3ABQA 1TWIA 3G8RA 2WYSA 1A5CA 2QDGA 5XIAA 3CZ8A 5PTDA 3DFHA 3TXZA 4QSHA 5AC5A 4YVXA 3KOXA 1GOXA 2Q3OA 3I4KA 1JNDA 2WZTA 3B8DA 3SO7A 2XFFA 2EKGA 4IL0A 3TTOA 4FB7A 1CENA 1OT2A 2V6AA 1PDZA 4FOUA 4J3ZA 3TV8A 4S2BA 3OG2A 5LXEA 4S39A 4LANA 2QUNA 3W1MA 4LVFA 4XIAA 2IXUA 4LS0A 1J10A 3L4UA 4HMEA 1KCZA 4MKNA 2EQDA 1CGYA 1QUMA 4AD3A 3B40A 2RDTA 2VEIA 1UQYA 3LTSA 1G6CA 4RDZA 1U30A 1KRAC 4GYJA 1FXPA 3ZLGA 5AFDA 3Q4DA 1XLJA 1UKOA 2GUUA 2QPSA 4AZGA 1IXNA 3G5EA 3LUTA 1TUXA 2D73A 2Z1KA 4K39A 2Y89A 3W7QA 3NOEA 4GQGA 4JTDA 4ML9A 5GNZA 5A8OA 4YHEA 4BK9A 4E4UA 3BQ6A 2NQJA 5C2GA 3E38A 4L5ZA 4QAIA 4TR9A 2Y7EA 3DHFA 4O13A 1TPC1 1XLMA 4NYYA 5HK4A 1XGDA 6A3HA 4PRRA 3I10A 3S9YA 4L1XA 3PBWA 2ABBA 3TW6A 4Q7IA 1PIFA 2R82A 5FJJA 3N25A 3WQ6A 5BYWA 1GVYA 5H8PA 1SO5A 2BX7A 4GNVA 2X1IA 3MKKA 4NX0A 4C6JA 3VKJA 1OVDA 3BJFA 5AKQA 3AMDA 3GD6A 1MXGA 3ZJKA 3W81A 4GC4A 3K8LA 1HTIA 1X6LA 1ZPTA 4C6FA 3UNDA 2KAUC 3WF0A 1TPDA 1AUSL 2CYGA 3T2OA 3NR0A 3OJGA 3VM7A 4JKKA 5LIYX 4MUPA 3LLXA 4LCQA 3NDOA 4U31A 1AA1B 2B7PA 2HPIA 4YS1A 6TAAA 2PBOA 4AAJA 2PTDA 1FWSA 3UWVA 4HK7A 4US5D 3AIBA 3GC2A 3B0YA 3UZZA 1YQ2A 2AQVA 3W38A 1DWGM 4MJ2A 3MBDA 2BHUA 1RP8A 3BLIA 4KWWA 3W7PA 1JZ4A 1JZ8A 3EOEA 1YDVA 4HZ6A 1W1YA 1LROA 4UQAA 2V2CA 1TJPA 2JEQA 4JY9A 1VF8A 3UBPC 1VKFA 1Q6DA 3W07A 5AYXA 3T09A 3DI1A 3AIVA 2F2KA 4HHHA 4F0LA 1PDYA 1LJYA 1XDMA 2QYGA 1IWPA 2E5CA 2EO7A 3CGTA 1DJIA 5IFPA 2OKOA 1LZOA 1XCFA 3ANYA 1YLVA 4AXKA 4P61A 3L2IA 3GVRA 1J0ZA 4A8NA 4YWIA 4HGXA 4C6NA 3O06A 3ARRA 3VIPA 1CGVA 1TA3B 1V03A 3PZGA 1K03A 1E72M 3LOTA 4J40A 3OBAA 1Z9AA 1BHGA 3QGAC 3H7RA 4C6QA 5D2YA 1IEXA 1PCKA 4A8RA 2AMXA 1UP2A 4FLRA 2X8RA 3OA5A 4POCA 2NT1A 3W2LA 1JCTA 5CSYA 2O9RA 3KZSA 1NDWA 3O0FA 3PM6A 1BQGA 4V28A 1WAUA 4U2ZA 4GFIA 4GINA 3HB9A 2ISDA 1TTIA 5C71A 2Y7GA 2FB2A 3PZVA 3S83A 4YLWA 4HBKA 1LLOA 3URQA 1UR3M 1DJGA 2Z6IA 1XIGA 4UOQA 3HA1A 3G6MA 1SO3A 4AXNA 3L23A 1WE5A 4FIRA 1DKWA 4EXQA 3FGCB 2GQ8A 1K9EA 1GTEA 3ONBA 3CQIA 1I9CB 4Z2LA 2NLYA 2GDVA 1KGXA 3NSNA 1A5BA 1FWEC 1VGAA 4JFTA 2ATSA 1B3OA 1H2JA 3H21A 1XDLA 4Z2IA 1LWHA 2FMNA 3KEHA 1HO1A 3CMGA 1CB2A 5D32A 4LOCA 3WO8A 5BWFA 4X22A 3KL5A 3N2CA 1WKYA 1VPXA 4OFCA 4E2OA 1X96A 2XIIA 1IR1A 4I7WA 1O5QA 4CD7A 3L4WA 1XI3A 3T0TA 1C92A 1IGWA 3WFLA 3DU0A 2OYLA 4DI8A 5HQMA 3UWYA 1OCNA 4A3RA 3MO4A 2DZPA 4K8HA 2BASA 2ZADA 3RPMA 4D6JA 3BSMA 3QBUA 4S3AA 3OZPA 4JTCA 2B7NA 2B81A 1CGUA 2JIWA 3PZMA 1X7IA 3AOFA 3NPVA 5A2BA 5HXMA 3SGUA 3U4AA 3CHDA 1J18A 1Z89A 4J9JA 2PC4A 4XKYA 1E6SM 2F7FA 3FS2A 4TTUA 3TAOA 4Z2GA 1L2QA 4R27A 1EZWA 2P0OA 1XYFA 3L9CA 3QQ1A 3MUIA 5A8QA 3BZJA 2VXNA 4QNWA 4MPKA 2XVKA 2RHGA 3W25A 3VGDA 3RR4A 2QCLA 1P0NA 2WXDM 1H5YA 5AZ0A 1VZWA 2V5JA 5FEWA 4DZHA 4IUOA 3GXPA 5B7YA 1NEYA 3P8IA 4DUWA 1MUCA 3EEGA 2ZE0A 4D72A 3VGGA 5CC7A 3QYQA 4Y7EA 2Z25A 2EPLX 3M5XA 1UW9A 3P3BA 3E0IA 4G2DA 2WC4A 5I3KA 2BS9A 4AY1A 2VFIA 5E1QA 2FZBA 1VFUA 3ATZA 1UKPA 3NQ2A 1L6SA 1JPMA 4WOZA 3MANA 1BSIA 1XBVA 2A3BA 4GKTA 1RH9A 3ABSA 1ONWA 3ZQ9A 1HJSA 4DUVA 2OCZA 4LU0A 3HTWA 3FAWA 3S0CA 1J96A 5JMUA 1FCBA 5K9XA 3EOSA 1V3KA 4LTSA 4RPQA 1UUOA 4MWAB 4RZBA 1Q6OA 3BOFA 3N4FA 4Z0JA 4ERAA 1CXKA 3GZ3A 4UR9A 2XVGA 1ZJAA 4WR3A 3K4AA 3KCOA 1ZLPA 4IMEA 1HT6A 1E6QM 4K6AA 1EP2A 3JW7A 4MYAA 4C6KA 1BYBA 2J9YA 2ZRWA 3LCLA 3UGRA 4JFSA 5A2AA 3E2VA 2OOGA 2ESCA 1C7SA 1FDYA 3KHJA 4H00A 2JQXA 4H8VA 2YSWA 3E96A 3XIMA 2D0GA 1XIMA 2VGIA 3R0UA 3CBWA 2WMJA 3GHSA 2IKIA 2I1OA 1ENUA 3HPXA 1F6PA 3PPGA 4P7OA 2HNEA 2VC6A 4XZHA 1PV8A 1QNVA 5I79A 2DSKA 5C6MA 1XBYA 3TYCA 1KFBA 1KV5A 1JUEA 3O8AA 4UBPC 3TN3A 2DIJA 2GWGA 3GRIA 1M65A 3GDBA 4Y90A 2X0SA 1JZ2A 2RDWA 4NAEB 1YADA 3B9EA 2YYTA 1WDPA 4RE0A 3QKZA 3F4DA 1RHCA 2BHZA 2NUYA 1Z8AA 4GNKB 3IUDA 3N4AA 3GFXA 3FGCA 1BEUA 1CLXA 1V02A 3URAA 4LNCA 4OU1A 1SJBA 2WNNA 1SJCA 3R8RA 1EWEA 2OKTA 1S2CA 1TTPA 3M0KA 5CBIA 1QBAA 3ARQA 4RDWA 1OABA 2XINA 5JXQA 3B8TA 1KLZA 4I7UA 3ISIX 5DXXA 3RLVA 7PTDA 1K9FA 5A69A 3C3NA 2YA1A 1EBHA 2X7WA 2VHLA 1XIFA 5CAHA 4ICNA 3VKAA 3L21A 2BGSA 3BOXA 3BXWA 3QOMA 1PAMA 4LB3A 1XD1A 5HNRA 2PD5A 1I60A 4AD1A 2E4TA 1IXPA 1HL8A 3Q94A 1W1ZA 4QG9A 2FVLA 1O5RA 4ZO7A 1TMHA 1JL8A 3RXZA 3T1GA 2BODX 4O1FA 3CT2A 1I2QA 3ICJA 2Y63A 4H7VA 4RE2A 7TIMA 4MZYA 1JZ7A 2A85A 3WLSA 1U1JA 1UMYA 1BWKA 1ZRQA 2WSRA 1SUXA 3GDMA 5D09A 3K4DA 1KFJA 4Q8QA 4DXXA 5U4NA 2JEPA 3N34A 4DJDA 1US3A 4G7FA 1EQPA 3FKRA 5F4WA 1QW9A 2OQHA 2CLEA 3BURA 1AL8A 2YPIA 2YCJA 2B0MA 2CLKA 2HS8A 3UJ2A 3EWZA 3TFCA 4AD5A 3OGRA 3M0MA 4LRTA 3ARTA 1FKXA 3N4EA 4LCRA 2YA2A 4MVAA 4ZE5A 3KOZA 3H7VA 3HQPA 4RE3A 2Y62A 3R12A 2R8WA 3VNLA 4HD5A 5FF0A 3CZGA 4EPDC 1GJWA 3L68A 1XPGA 2J7FA 2XZ9A 4Z17A 2P0IA 3WZ0E 1E4IA 2XSAA 4H6KA 4HQVA 1ALDA 3W7DA 5CPNA 1TWZA 3FDGA 4NJHA 1O66A 1BWLA 4IIBA 1GPFA 2GJLA 3A23A 4C6LA 4NJKA 1LWIA 4KEVA 2RFGA 2WW5A 2DQWA 2A1YA 1KM5A 1SO4A 3TSBA 5CPLA 1HKVA 3MZ2A 1MXDA 3KXQA 3EYPA 3KOYA 2FTPA 2GOUA 3UR5A 3H8AA 2EPOA 3KE0A 3LHTA 3BAYA 3P84A 1ZCOA 3QFEA 3T55A 3F4CA 2ON3A 3LCWA 1CDGA 4LQ1A 5EMJA 2YB4A 1RSCA 1R3VA 4EPEC 1J79A 4BJHA 2V5LA 3GYEA 5LA0A 3W01A 3TN4A 3A5VA 4PUJA 1S46A 1PBGA 2WKJA 3VNYA 1VLWA 2J78A 3QSTA 4HCLA 3UZXA 4MG4A 3GIQA 1UOZA 4EWJA 2CLIA 4FO4A 2VDGA 1DTUA 1WOAA 3SEPA 4L80A 3PG8A 4S3BA 2JIEA 3QOKA 1QI2A 4LAZA 3EX2A 4F79A 3PZ9A 3SCVA 1J2WA 2F38A 2A6NA 1XIJA 1UR1A 3TW7A 4ADTA 5A6SA 1EHNA 1DWFM 3QMTA 1NFPA 4LGXA 1RQHA 2JGYA 4GNJA 4MAVA 4JEJA 1JDDA 3B03A 3WKZA 2EJAA 3SZ8A 6PTDA 5A6JA 2CC0A 3MBFA 4JTEA 2EPKX 2FTWA 2GVLA 1LRTA 1TREA 1DVJA 1MDLA 3AS2A 1JNEA 3MHFA 1H7XA 4EACA 3UWUA 3QR1A 4PTVA 1BTMA 2EBNA 3W88A 3GU1A 3IUHA 4KCTA 3WMSA 2HCVA 1XBXA 1XUZA 4I9TA 4AZHA 3NQ8A 1G94A 1UR4A 4I6KA 3L4XA 4J3SA 3CV6A 4CNOA 1XBZA 2HBXA 1OCBA 4NAEA 4NYUA 3HMJG 1EJXC 1GHRA 4E2DA 1UUMA 1DL3A 4BQ5A 4EPKA 4PEKA 1ZJIA 4QJ1A 2D1ZA 1FHLA 4FF5A 4ZENA 1ZP3A 4D6FA 1Y5VA 1O6IA 4AWUA 5BMWA 3GXFA 1OBAA 4UFIA 4JDBA 4JNMA 3TK7A 4HK6A 4ALDA 1H7WA 4MOZA 2VFFA 4DBUA 2NUXA 1VJSA 2XU2A 2OFJA 4CCEA 3T9PA 3A4AA 3CL7A 3UCQA 5DF0A 4DUXA 2YL8A 4MZ1A 3SFWA 1KV8A 1X1NA 3ZSTA 1GYNA 4TO8A 3SQMA 3TMLA 4UZUA 3URBA 1X8CA 2LLEA 1K8ZA 1TTQA 4BQ3A 3AMKA 4N6FA 2O56A 4XAYA 4YHGA 2YJQA 3GK0A 4Q8WA 5BRQA 1YPFA 3NQGA 4PH6A 5F4XA 2PDNA 5TAOA 1BG4A 1WZKA 2DT3A 3E12A 2VOMA 1GUVA 3VZYA 3RCNA 3V35A 1WBHA 3QR3A 3KBMA 3EX6A 3PPHA 1H51A 3LCFA 2W3ZA 1S5WA 1R3WA 2PDIA 4DUOA 1AL7A 1JF6A 4UTWA 3SCSA 3UJEA 2G41A 4BEUA 1E5NA 2OX1A 5C5YA 1EIXA 3S2LA 4RE4A 1NSJA 1P6WA 1E56A 1UH4A 5LXXA 1E6NA 3NGJA 3M07A 4KEMA 3F7JA 3LCGA 2Z1VA 3SIMA 2V9DA 3BICA 3RLUA 3KRSA 3QHMA 4P8WA 1A5SA 2BDQA 1XFBA 1MNSA 3MUY1 3H53A 4QG6A 4H2CA 1M7XA 1AG1O 3ZT7A 1DHKA 3IIZA 2CXEA 1R38A 3NYZA 1SFJA 3UG4A 3R7MA 1VBRA 3IEBA 1K7XA 1LT7A 5EKYA 3HQNA 2PEVA 2YLAA 4AYGA 4ECLA 3IRSA 2A3AA 4J3UA 2W66A 3VCRA 5H91A 4S3KA 2XUCA 3WG6A 3CEUA 2VZTA 3EZ4A 1UWUA 1BXCA 4DVOA 1AQ0A 4UIOA 3IIVA 3DKLA 1GYLA 1KKOA 2BFGA 2OO0A 3VXGA 1VFLA 4WXZA 3UPWA 5M17A 2VRKA 4O54A 2E0PA 1RA0A 5FF7A 2PP0A 1ESWA 2VL4A 3A12A 4HMNA 3QC3A 3TN6A 3ZVIA 1VEMA 4GZEA 4RZ5A 1VFHA 1S5VA 2NV2A 3VCNA 2O9OA 1QXLA 4ICMA 2O55A 4B15A 3TROA 1B30A 1J6PA 3S47A 1SJAA 3LV6A 4PODA 3O6CA 4W5ZA 1Q6GA 3AUOA 3AALA 4NVTA 4MFDA 4S2CA 1A4MA 1A5NC 4KWVA 1C29A 3UQNA 1VBUA 2PP1A 3G1YA 4YYCA 5LIKX 4LUSA 2D2GA 3KCJA 3D6NA 2WZMA 3PZUA 4DEFA 2HVNA 1V77A 2X05A 5M03A 1PEZA 4QHRA 1R3RA 3GY1A 3IAPA 3L5AA 3GTFA 1IIGA 4PUWA 2WPGA 1E9YB 2ZDRA 4GACA 2NQ5A 3UZJA 1FWRA 4K7VA 3PUGA 1W9VA 4DLFA 2W0UA 3ZS4A 4Z2JA 2ZDSA 1WCGA 1JEZA 2PGRA 3S8HA 4QLJA 1OYAA 4J4KA 4JFVA 3QEZA 3AMGA 2VMFA 4R7OA 3R25A 3GW3A 3KLLA 4QXIA 2PS2A 1P5BA 3EXRA 4IG2A 4NJGA 3MPGA 1AW1A 5AC8A 3R8GA 4O18A 4F0RA 5D2VA 4BR1A 4DM1A 3WLPA 3P14A 5AHFA 2I9UA 1C8QA 3I3DA 2YFNA 4AMCA 3GIYA 4H41A 5DT7A 5E0KA 2DUZA 2VX5A 4LUTA 4NXKA 2PDGA 3ZO9A 3NZGA 3G1RA 6XIMA 2E68A 3C2VA 2D24A 4YN5A 3LQLA 3OIHA 1V7YA 3KCLA 1TJ1A 1Q45A 1P48A 4RCXA 2E9BA 1B1YA 1SZGA 4H8UA 5DMLA 3VPLA 3E0WA 3PJTA 2V82A 3BLLA 4Q6XA 2QDHA 5HWNA 1LOQA 3B0PA 1LP6A 1TRIA 2JALA 3S5YA 2OO6A 1XXXA 3TOPA 1F6KA 2E8ZA 3DC0A 4DNMA 2WLYA 3ABRA 7REQA 2HJPA 4AEEA 2W27A 2XVNA 4ATDA 3W02A 3TC7A 3VE9A 1YDOA 3BLKA 3MSGA 1TWSA 1JZ5A 3E74A 4AD0A 5FF3A 2D3LA 2ZX5A 4IJBA 1XJBA 2WNQA 1OX4B 4FIQA 4B90A 4L7ZA 3CM4A 4Q8VA 3GWQA 1SGJA 1Q7QA 3TZFA 3KS5A 1H5VA 1TPWA 2OZ3A 2VQTA 5HULA 1KFLA 5H8MA 3ARSA 1GVQA 1J93A 4W4QA 1KBJA 4KERA 4HA3A 3CL6A 1MEIA 4XUGA 2DORA 3FOKA 5A8GA 5KTLA 2G4FA 3MMTA 3M5YA 4K36A 1M53A 1ISWA 2FJKA 4L6DA 3A4WA 4UTKA 1JAEA 2GGIA 2PDFA 4A8IA 4MWAE 5EFDA 5TBOA 4CUCA 5HR7A 3HPAA 3GVWA 1H63A 1ZS2A 3LA4A 2JGQA 1LYXA 1ZB5A 4WGHA 3EXTA 2V30A 3V36A 4Z1DA 1FWAC 4YCPA 3IV3A 3LENA 3DERA 1K8CA 1MQQA 1WDQA 2G3NA 3DH7A 4QCFA 1UWIA 5M2FX 1G69A 3EWDA 1K6WA 4MNLA 3EMZA 1EGMA 3DIPA 1XLCA 1EA9C 4O4WA 3BAXA 3UVIA 2GVJA 1Q5MA 1S2TA 2GJNA 1VRDA 5G4WA 3AFBA 4AF0B 4MY1A 1JAKA 2ACSA 2REQB 2BXZA 4GY0A 4OTKA 3TNBA 2YCIX 4BFAA 3VX1A 4BHYA 4HJFA 2V63A 2UV8G 1JULA 2INEA 4IIHA 4H3DA 1MQRA 3DG7A 2GPTA 3B0UX 4O1BA 1RV8A 4R3UA 4GUHA 4BQ2A 5D37A 4X61A 2CKSA 2WZEA 4NF7A 3VIOA 4MB3A 2IQDA 1CB7B 2YIHA 5D9PA 2PWVA 3CIVA 3MCMA 1SW7A 3Q37A 2WVTA 4FP1A 1PX4A 4I9AA 3R5EA 1HUVA 4K3ZA 2PC8A 1LQAA 3H4XA 4ACZB 3RIKA 3NGFA 3U4FA 3HQOA 4ZVJA 3TEVA 3PB2A 2WOQA 1IEVA 2AOSA 3WNOA 3F1QA 4GX9A 3W84A 1H50A 4UTUA 2DH2A 4N9BA 3BPWA 3VIJA 1OT1A 4W88A 1AFSA 1YYAA 2TRSA 1UP3A 3E6EA 1GYMA 1W0MA 2ZBTA 4HT3A 3VZZA 5BU9A 3MKCA 1J01A 2PP3A 3ALGA 4XBJA 1QR7A 4U2YA 2I9EA 5CXPA 5AY7A 3E5PA 4LH8A 1DIEA 4CNUA 4ICCX 3C0JA 3CV2A 4WKFA 2QJMA 1HP5A 4ZODA 3M0LA 1XCXA 3PFRA 2X30A 2DEPA 5I78A 3PUOA 1S3HA 4XBKA 1JCXA 2G3JA 5MKGA 2GGJA 3UPBA 5FESA 3AS3A 5CZJA 3QF0A 5F4SA 4MY8A 3H2CA 4J28A 1YTKA 4G5DA 3VABA 5DMMA 1JPHA 3W2JA 5JUVA 3SY8A 3GS6A 2G3IA 1UASA 4FXRA 5XIMA 3WELA 3VA8A 1FCVA 4JQ2A 3TTQA 2OODA 1FCUA 2EKCA 2VC9A 4DB7A 3OGSA 2AL2A 4DJEC 1R46A 2ABAA 1BGGA 1M7OA 2VCBA 4D8LA 2ADAA 2QUTA 1Y5WA 1Y0EA 1T96A 1PSCA 1TKKA 3TFXA 5LNWA 2V38A 1X6NA 5FIPA 2CLHA 1RXOB 1W3NA 4S23A 4EK7A 3DZ1A 4LUYA 2X42A 3BE7A 5CJ5A 4JIQA 4GE8A 4B4FA 2J47A 2PWFA 2QCDA 1TIWA 2ODOA 4MKSA 1H1NA 2P3EA 2Z4GA 3EDDA 3EWYA 3FN9A 1R7OA 3C0QA 4L6OA 3TJ4A 3AAMA 2A7PA 3MI3A 2G0WA 3P5ZA 3TIMA 3RGTA 4H01A 5DY3A 4DO7A 5FL1A 1EOKA 1XINA 4WJ8A 3RDKA 3WK3A 1OD0A 5CGTA 3G8EA 1GZJA 4AVNA 4U33A 1XYBA 3K8KA 3L2LA 4M80A 3AIUA 3LNPA 4F3HA 4UNKA 3G1AA 1TPB1 3CUXA 1N7KA 2QW5A 3W70A 2WZHA 4DIAA 4E4PA 4UMAA 3KFTA 3UG5A 3UY7A 2J7BA 2VFDA 3QW3A 1VYSX 2E7FA 3ZJ8A 3S9IA 1N55A 3LU2A 2AL2B 4UFJA 4Q4PA 3CIWA 4EAMA 3HPSA 4DJFD 1E9ZB 3LI1A 4GRSA 1W91A 1V3LA 4Z2HA 4O17A 4ZQCA 2F84A 1KXQA 1PXGA 4HU0A 4IG2B 2GSHA 3T4CA 4J1OA 4LJ3A 5HJLA 4A05A 1P0DA 1S5TA 4O16A 2C14A 5FJOA 3VILA 4GUGA 3TA9A 3A9IA 3KWXA 3NXLA 2OZ8A 2WCGA 3PTMA 1TVLA 3SDOA 3NURA 1CWYA 2ZUVA 1FDZA 3TWBA 3TH6A 1HXJA 4DWSB 1CZ1A 1BSLA 4XVDA 5CCZA 5BRPA 1Z69A 3CB8A 2QAFA 3UW6A 4AHPA 1IYXA 3EPMA 3UYIA 1ME7A 1O60A 3ITYA 1W56A 3OEXA 1LQ0A 4WDTA 3G3MA 3N9SA 4H9VA 4AHQA 2GQ3A 3ENLA 3B9OA 3I7QA 1Z44A 1UC4A 2YZ5A 4TV5A 1AW2A 5D04C 4F0HA 2ZIDA 4WY0A 3N13A 1M9HA 4XKYB 2HS6A 1DWJM 2E1DA 4HB7A 2XISA 4PCTA 3TUUA 1PWMA 3SUWA 3TWAA 1P43A 3UG8A 3BANA 3L67A 2V2DA 1QPOA 5DCBA 3NEHA 4MTVA 1QHOA 2CBIA 2NSXA 2BOGX 5BMXA 4ZB2A 2PGFA 3LPFA 3A4JA 4IPPA 4AX7A 3JZEA 3FA5A 3TC3A 5ABFB 4WJEA 2QGYA 3RU8X 3CU2A 3IVSA 1EJ7L 3S3GA 2QUMA 5HNNA 4HU8A 4B3KA 3KL0A 3WBAA 4AWSA 3P62A 5E0CA 1NP2A 1DOSA 5FI8A 3KWSA 2WVVA 1XQKA 3TW9A 3AC0A 1VQTA 3NQFA 4W84A 3TN5A 3M47A 3VIIA 3W73A 3KRBA 1B57A 1MW3A 1VCGA 1CLVA 2J88A 3LY0A 4QISA 5F2MA 2VTFA 2IKJA 3C8NA 1U33A 4JNZA 3TYAA 1KFWA 3EWBX 3GW0A 3ITGA 3U5UA 1W3IA 1M7PA 1W9XA 2FVMA 1W17A 2Q8LA 1M41A 3LRMA 3LSCA 4TVUA 3UG3A 1UZDA 1FRBA 1QAPA 1J0JA 3PN8A 2F6UA 2QJIA 4GD0A 1MVYA 5HNTA 3LPOA 2YL5A 1TPUA 3GSMA 3W2KA 3QKEA 4MSSA 3N6HA 1X97A 4KF1A 1WXZA 1DQWA 2OPJA 1KFCA 2NX1A 2NWSA 3PR2A 3P0XA 1XH2A 3LX9A 1LL6A 4GIRA 1FCQA 4K1WA 1LOSA 2X1UA 4B92A 3W74A 4JTLA 4JHMA 3B4YA 2QDDA 4PMZA 3IJ7A 4F0MA 1YRRA 1NFBA 2WBGA 1T99A 1BKSA 1P7TB 3B9NA 4KESA 1E1CB 5FSDC 2QEZA 3MWCA 4EIVA 3K13A 1DIKA 2DIKA 2Z2AA 3PZTA 3LEPA 1RUSA 3EWXA 2CNCA 2R1NA 1D9EA 4M82A 4NHVA 4JCMA 3TJIA 3E49A 3H2FA 3BW4A 4GI4A 1KRMA 4QGCA 2UBPC 4REQA 4M0XA 1FWFC 4QJ4B 2C3ZA 2PI6A 3EMQA 4Q7BA 2QF8A 3LZ3A 2H8XA 3V1PA 2PZNA 4L4PA 4BI7A 1E1FA 2NQHA 5BCAA 5HUOA 3GUGA 3JS3A 4KQNA 3LTPA 3MU7A 2PUZA 4LALA 4HHLA 3LMZA 4UMBA 4CU8A 5LKYA 3M0ZA 4A3HA 3U2OA 4QROA 1NM9A 1J12A 3W3OA 1YEYA 1PWLA 1XYMA 3GNXA 1XF0A 1R3YA 1TMQA 3CLWA 3LN3A 4W8BA 4JQAA 3S5NA 1QNQA 4O15A 2IPWA 4GQ0A 4P8UA 5A1AA 2IKHA 3TTEA 1WKDA 3VI2A 4HNNA 5E70A 4JY8A 4JCLA 1AJ2A 4GY7A 2PFHA 1K9DA 3H55A 3NJ3A 4WQ6A 2NXGA 2C8NA 4GY1A 3IJ9A 1NWUA 3UJSA 2KX9A 3TCSA 3FVMA 5FJUA 1I2OA 2V3DA 3DX5A 1LQ2A 2PGWA 5JBFA 2GYIA 2ZQ0A 1A50A 4TMCA 3WH6A 1W5QA 3VNIA 1E5JA 2WMKA 2A3CA 3HIJA 4P7NA 4RXFA 3WFAA 2AGKA 1HJVA 1R5YA 3G3DA 3I65A 3LG3A 1S2WA 1RALA 1PZ1A 3E0VA 1SM9A 1XIHA 3MHUA 4DM2A 4JQ4A 1J8VA 2J8TA 2XFRA 1EGVA 3KBWA 4LC6A 3W9ZA 4NZ4A 3HG5A 2QJJA 1XRVA 1Z42A 2A21A 1HO4A 4JIRA 5CZSA 2DP3A 3FX4A 1BVWA 4WKAA 2J66A 3P8JA 1AQMA 1UG6A 2XIBA 1BAGA 4V1YA 3BARA 4BWLA 3WLTA 3ZYZA 4AD2A 4F4RA 4KMQA 3LS9A 1TFVA 1KWKA 3WF2A 5T9CE 1FWWA 2NLIA 2XJ7A 3TONA 1ISXA 2DT2A 1RCOB 5HMEA 3G1DA 4Q6JA 4HIBA 3RITA 1SJDA 5G2HA 1FBAA 4Q8UA 3W26A 3VINA 3U2EA 2G3MA 4QQ3A 2ACRA 2ZUUA 4NNAA 4FNTA 1JCLA 1MSSA 4LYRA 3SRKA 4S1FA 3SURA 3Q58A 4RK8A 1F07A 1XGEA 2QIWA 1DIDA 2WJEA 9XIMA 4ERIA 1OFOA 3RU6A 2WVUA 1W6TA 4IGNA 1QBBA 3NA8A 2R14A 2VENA 4I5RA 4DHGA 2Y24A 3HOJA 4AIOA 1OFQA 4OE7A 1BYCA 3BGAA 3WNMA 3UWWA 1W2PA 4DAFA 1QWKA 2YCKX 3KX6A 3SCPA 1E4LA 4AZ7A 3AQUA 3SN1A 1R0MA 3AJXA 1GVOA 2XG9A 1AZ2A 5G1MA 4DJEA 1LOLA 2AAMA 1X8FA 4NAFB 4JGDA 4D6GA 4U5KA 4TMBA 2J8FA 1R3TA 4PMXA 4PMDA 2FTYA 1P1MA 1JYNA 7XIMA 5DEZA 4ZOAA 3IK4A 5C8BB 2DFAA 3KM8A 2KZHA 4GQBA 2WSYA 4ZZ9A 4M24A 5G2WA 2BGQA 4NNBA 1D3HA 3NSXA 2F2HA 4ORIA 1F2JA 4YTRA 2HWGA 3GHUA 4UQEA 1RBOB 1REQA 1YHTA 1GJUA 1B3ZA 2P1FA 4DJDD 1ICSA 2I14A 1KNWA 1HN1A 2XWEA 3A64A 2WHMA 3S6OA 3FJ4A 2E9MA 4QDPA 2Y70A 1C8YA 5DANA 1RD5A 4AWEA 5C9XA 3OVRA 2G96A 1JYXA 2BXVA 3A22A 2C16A 1MFVA 3UETA 4GI6A 2V3EA 1UIPA 5BXPA 1M04A 3QZEA 1PIGA 4PUMA 3CHVA 5HA7A 4ZEPA 1LTDA 5G1YA 3C2YA 3WN6A 3POCA 3EDEA 2YOCA 4ZBCA 3ITVA 4XKMA 5EBUA 4DF1A 3ARYA 1MEHA 5FA5A 1UKQA 3PUDA 5A5WA 5A6AA 4QM1A 2Q3RA 5JBEA 2WMGA 4Z42C 2P53A 3NQ6A 4FR6A 1O68A 2VCCA 4ZFCA 3CV1A 2J25A 1OQFA 3PFMA 1RQEA 1TMLA 2VWTA 2ZZ5A 4LXFA 3HMCA 3WLOA 4AMAA 2VURA 4LYKA 2HRWA 5CPSA 3M0IA 4ATWA 1C91A 2V0TA 2DVXA 3AISA 1F3TA 3V7PA 1X7FA 2SFPA 1S3TC 1A49A 9XIAA 2FZ8A 1RP9A 3RPTA 3IK2A 2GGGA 1CX9A 1B3VA 4GI8A 5LHFA 1V7AA 3ALFA 3MYOA 5JU6A 4ZFMA 1PE1A 4ROPA 5DBUA 5ABEA 1JDFA 3STEA 3WK0A 1V6UA 2BLEA 5I3DA 4QITA 1L6FA 3STCA 1D8CA 2Y5JA 1A53A 1P4CA 4FEZA 4JX5A 2Q09A 1EDTA 3A9BA 4UQBA 1Q6EA 1ZQ5A 4JNYA 3M16A 4XZNX 3FA3A 3F2CA 3KVJA 4MKVA 1V3IA 3O9NA 4YCOA 1OYBA 4EXAA 1ZHAA 2E67A 1B4KA 2CZEA 4UFMA 3TCEA 7TAAA 1V02E 2PWEA 1HVQA 1A0CA 3PTQA 3P80A 1F3EA 2OT0A 3HJEA 3MO7A 5AOUA 2R9RA 4CU6A 3L7RA 4NL1A 1VJZA 2CU0A 4R9OA 1BRLB 1U5JA 5D9MA 4GGHA 3BZGA 4FOKA 5IRPA 4ONVA 4GH1A 1NU5A 1H0IA 4D6DA 3GNRA 3LHUA 4PRWA 3VAVA 2FFCA 4YTTA 4HNUA 4ZB5A 3V5OA 1PZ3A 1DTNA 3OLGA 2XTKA 4UNLA 2YBUA 3AZSA 2D3NA 3DCPA 4WHBA 2Q8XA 3CC1A 1SU5A 1XP3A 4G1NA 1BVNP 3N9KA 2ZXBA 3SQSA 1GTHA 1FH7A 5GPRA 3MSRA 8RUCA 2HK0A 3VD3A 3GNPA 4PB5A 3R4IA 4IHCA 4O1EA 1MMFA 1KTNA 3M4HA 4IX2A 1TZ9A 1GQKA 3MUXA 4C6PA 4UCGA 1UD5A 4MLJA 4DYKA 3TLLA 3WUGA 1OFPA 3W2UA 1XDJA 1NVMA 5CLWA 3QSRA 4CNSA 4FLOA 3OYXA 3V0TA 1EO5A 4PMYA 5LIWX 1ZENA 3WLJA 4FPSA 1UD3A 3MQTA 1QOPA 1ZL1A 3ES7A 1NDVA 3ANVA 4YL2A 4D6IA 1P0BA 3GH5A 2DT1A 1D3CA 1KRCC 3COTA 4OVXA 2BVWA 1WA3A 1VJIA 1A0DA 4FAMA 4XB3A 4H6QA 2ZA3A 5C0QA 4FX6M 1BD0A 1PL9A 5KINA 4L4OA 3PWAA 2DSVA 4GYPC 1DJQA 5AHNA 5CC5A 2Y0FA 3CWHA 1BF2A 2OTDA 1OY0A 4D71A 2QKFA 3KOWA 1G1YA 4TX6A 2HVOA 5IHSA 3APYA 4W93A 2A7RA 4MUZA 4LVBA 2GSEA 4E3TA 4WEVX 1GOWA 3K1DA 1UMLA 1EDGA 4RLIA 3BTNA 2QT3A 2OX4A 2AGTA 2VCAA 1GOOA 2ALRA 1JCJA 4DY1A 4O8RA 3CPGA 1Q6QA 1NDYA 2GQ9A 2ZUMA 1U1HA 1Q4NX 3B8UA 2IMRA 5DN1A 3I3BA 3T08A 2DZWA 3L0NA 1XYZA 3NFUA 6ENLA 5F2LA 1JJKA 2QHAA 4OKDA 2ZX8A 5G4HC 4I9MA 2XM2A 5FJTA 5LNSA 4CNTA 4AZ6A 3ZSSA 1J5TA 1HFBA 1V3HA 1VCFA 3TTYA 1MYRA 1Q2RA 4TU1A 1BXNA 1M3UA 3VNZA 4DF0A 1YIXA 2FZNA 1OEPA 3BGGA 2QJGA 1QPKA 4AY8A 1OG0A 4QLKA 4PYSA 3ZWTA 1QO2A 3GAKA 3T7VA 1FFQA 4JICA 3H23A 1IEQA 1OFBA 5AYBA 4N2YA 4N9CA 5E0FA 3MWAA 3AHZA 4F9JA 3DGBA 1S5MA 1HG3A 4LW7A 4R85A 5FACA 8A3HA 1D7FA 2XFYA 3C0SA 3L4TA 4ZQOA 4HTYA 2GK1B 4R34A 3DGRA 1IF2A 5I06A 3WQ5A 2E1WA 1KCXA 1L8PA 2VM8A 4ZXLA 2A79A 3GU9A 5I07A 4MADA 2BVDA 4F66A 3W1LA 1SW3A 3HGRA 5C2CA 4GJ1A 3GKFA 5D30A 1C93A 2X0YA 2ZFAA 4LF1A 1XR2A 3M0JA 1OINA 1E6PA 3WUBA 2OMAA 3WH8A 4BF5A 4XZ9A 4H9TA 1TR9A 5A6BD 3ZLHA 1R47A 1W1VA 4Q7NA 3AIEA 1TX2A 4F8XA 4QSFA 2FLIA 1EF3A 1I2PA 5HAOA 2VUYA 1GKQA 3VUPA 4UTTA 1H3GA 1ZBVA 1UCWA 3P0WA 4CN1A 3VC5A 2OLAA 4JFUA 3Q67A 3W7LA 3II1A 1UOKA 1OG6A 4P8XA 2DZXA 4GVGA 1KFKA 1UR9A 3CHFA 1FUYA 4O8AA 1ONRA 2CLPA 1OCJA 3CZEA 3ZIZA 3LLFA 4M6UA 3VU2A 3RLGA 3FW6A 2CKRA 2J24A 2HBVA 3W29A 5HPCA 2OSWA 2CERA 3FEQA 2POZA 3S6DA 3W7MA 2HEJA 2UY5A 2A4AA 3UFYA 3GG7A 3B9AA 1GG1A 3EPNA 2XN0A 2J13A 4X9SA 3WLLA 5I0DA 3AWOA 3ZZ1A 2BTMA 2D2JA 8XIMA 1XLFA 2YBVA 1L2UA 3DYMA 2GOKA 4A2RA 3QC0A 4IF2A 2J62A 2WMFA 1EKOA 3XISA 1RY0A 3ABXA 3VOCA 4YIWA 2PLCA 3UGVA 3TLQA 4XISA 1UP0A 2Q6ZA 3DOPA 4QE4A 1NAL1 2C0HA 2BOEX 3BV4A 3VKDA 1FKWA 4I5UA 1N8FA 5AYYA 3VDBA 1VHNA 2VP8A 2CHOA 3CYJA 4JX4A 5DO8A 3MVIA 3W2MA 2OQLA 1JI1A 4AC1X 2PB1A 1A47A 3IARA 2OGYA 3EB4A 1IR2A 2WVVB 5T8GA 2C6QA 5FEZA 4IXXA 1EL3A 4ZSTA 4WKHA 4JXCA 1NWRA 2V2HA 4B5NA 2R1MA 3NDYA 3NAVA 1XYAA 4IFKB 5BXRA 3VOJA 3TU9A 1WXJA 1E9IA 1XFCA 3RUBL 1PZ0A 3UY8A 1J6OA 2FPYA 5D2WA 2CLOA 1MW0A 2G3FA 3SCTA 4PULA 1XX1A 4E2VA 2Q01A 3NUKA 1PTAA 5C55A 5D2XA 2XSBA 2E6AA 1ZAJA 4ZA0A 2CZFA 3WK2A 3G1XA 2QCNA 2CWNA 2QCDB 2CHNA 2E9LA 1GKRA 4ZSUA 1V6VA 1RLDA 3K5XA 4HPNA 1J5SA 3ZFHA 3WQFA 4JTTA 2Z00A 1MW1A 3QN3A 1UWSA 3PBMA 3T40A 3KAOA 3DFQA 3L66A 4HNLA 1E0UA 1F74A 3SBFA 1SZNA 4JBRA 4C6CA 2OZTA 1H4PA 4KETA 1L8NA 3JZUA 2HSAA 1FOBA 1KM4A 1JZ6A 3BMVA 1H41A 1ZAHA 3NVTA 2X09A 1YE4A 3P6LA 2W9MA 5KSWA 3HFYA 1X1ZA 4KBXA 1FWHC 1OK6A 3BG5A 1BVZA 2DIEA 4LNYA 3D3AA 4REQB 3FYOA 1ICPA 3SI9A 2EG8A 1XLKA 1UWRA 1C90A 3ABOA 3E2RA 2E6DA 1YNPA 1R2RA 3PHAA 3TAKA 3EPOA 4YVVA 1XLLA 3PZNA 1OIFA 4H2HA 4XTIA 4KCVA 3H24A 1UD2A 1SMDA 2O9TA 2CXGA 4HOWA 1F5ZA 4RUBA 4Z1AA 1CXEA 1J0KA 1DE5A 3HGJA 2RAGA 3CASA 4GCAA 4JTJA 1XQLA 4MLRA 1OGSA 4QX4A 3B97A 1HVXA 1P7TA 2PZ0A 3CJPA 3OPSA 1FWGC 1EBGA 3VZXA 4LX4A 3N04A 3L0GA 1S1RA 4P7RA 1E3XA 4NX5A 3ITLA 3KRUA 1REQB 5KETA 3CQ0A 4QDMA 2GDUA 3AXKA 1FTXA 3WQVA 3YPIA 1WDRA 2PCQA 2PDUA 4F40A 3UP8A 3GNDA 4O10A 3I6EA 4IFKA 4GKLA 1YXYA 5F2IA 2ZZ1A 4PFHA 2B31A 2P50A 2YDAA 3ERPA 1UWQA 4Q8MA 4MWAA 1TV7A 4YNGA 3EGJA 3MCOA 4OZOA 4O11A 2CITA 1JQVA 3CWOX 3IVTA 2W4XA 5G1TA 2WSKA 3USBA 1JD9A 3FJNA 3IGUA 3AS0A 4HCDA 3FV9A 3VMNA 3WQEA 1K6AA 4WGXA 2DU2A 3MDWA 4IQJA 3QM3A 1NOUA 3UZYA 1KTCA 1LCOA 2Y6ZA 2WKLA 5J5DA 3G0UA 1PB0A 4QAWA 1RJRA 4QEHA 3DFPA 5CZKA 3HFTA 1JUKA 4QE1A 1ONXA 4GJJA 4JN7A 1XYLA 4NKCA 3P61A 2ZUSA 1PTGA 3VNKA 3W7GA 4L64A 3A3HA 5CG7A 1G4EA 3BAWA 1TV8A 3A24A 2QUVA 1KB3A 2OYMA 3R79A 2ACQA 1GQLA 2OEMA 4NZJA 3LRLA 2X1SA 3NQAA 4RNJA 3MVTA 3CK5A 2XPKA 4O50A 3QY6A 3POHA 2D23A 1G4SA 3AZTA 2DVTA 3A3XA 1HX0A 3N73A 2W5FA 1UJQA 1RA5A 4R5EA 3UXKA 4HHPA 4J5NA 1E3ZA 2VDIA 1W3HA 4O14A 2CPUA 2OGJA 3TZNA 1VYRA 3SJ3A 2W62A 5FAJA 3E2QA 2CZ5A 2E5DA 4R7WA 4NI8A 1E4MM 3S1GA 3IACA 4IPNB 3VD5A 1UKTA 2PWGA 2WWCA 1ITQA 1OK4A 3PZOA 2NXIA 3LHWA 2PDLA 3PZQA 3LBOA 3KBJA 2X7VA 3WLMA 4X0NA 4YVPA 2V5KA 5D38A 3SN0A 4DZ5A 5C9RA 4GXPA 1RLCL 4E4FA 4HKPA 4V27A 2ZC8A 1HW6A 4XTDA 5CPMA 4UZSA 3GH4A 4W89A 5GVJA 4RNHA 1PIIA 1CEOA 2TSYA 3U7BA 5BOEA 2NSOA 4TVCA 3V16A 2J7CA 2PLKA 4TUFA 5DELA 3WDRA 3QYSA 5DRCA 3B4UA 3OZYA 1FWBC 4QG8A 3RJYA 4NP7A 3L12A 1IZJA 4R53A 1JUBA 4F0KA 1B0IA 4IGMA 3QY8A 1HL2A 2REQA 4O57A 4P5UA 4D1IA 4HYRA 4Y8EA 1Z7AA 4WXYA 3LNMA 1SO6A 1ONEA 4PTDA 5B7ZA 3LSBA 5HMSA 2BHYA 4E6MA 2VT0A 1K70A 3PTKA 1JQXA 3MJMA 1KGUA 3H2MA 1MUMA 5BXTA 1UA3A 4B3LA 2V68A 4M1RA 3ARXA 3E2SA 4E0CA 4CLMA 1FWIC 4H9MA 1OF8A 2AL1A 3UA3A 1F3XA 1KLYA 1CCWB 1QNPA 3W24A 1GGOA 3EDJA 4ZQRA 3OOQA 1B90A 3V5FA 4UUIA 4ZR8A 1FWNA 3ZXWA 5LA2A 4LUIA 1R86A 3AYTA 4MJ4A 4ZO6A 1KA9F 2OEJA 3AYVA 3I6RA 3NQMA 4OGZA 4NRRA 1EQCA 1R2TA 3CO4A 1R30A 5C7VA 4I3GA 1Z3NA 2FPVA 5C9ZA 2C1IA 3KBVA 3FJLA 3BUVA 2XN1A 3WBEA 1IIHA 1ODUA 3MDUA 1PYFA 3EWUA 3LCXA 1A80A 1JG9A 1PHQA 2QCEA 3C4UA 4X2RA 3C2RA 1E0XA 1OFAA 1BKHA 5FF4A 3NQDA 2DUXA 2CIPA 2W61A 4ZQPA 4KT2A 3BCDA 1I1WA 4N02A 2IW0A 1KBKA 4XX6A 4MNJA 4K68A 6REQA 2XN2A 3U2ZA 3S1VA 1FWCC 1WV2A 3U48A 3ABZA 1L9WA 4GBUA 1LBLA 4CCDA 3W7RA 1DEDA 1WB0A 1EXPA 2BNJA 2Y5SA 3BSGA 2YFOA 6XIAA 9RUBA 2ANUA 3B3DA 3WD2A 1YXCA 1W9DM 3CZKA 3ZMRA 2JKEA 4F2TA 4CD6A 4F9DA 1MFUA 5KMYA 1K3UA 1F8IA 5A95A 3GTXA 5JBDA 4FXSA 1KCLA 5H8UA 3GDKA 1NARA 3BC9A 3CUIA 1P6CA 3C86A 4DZIA 3AICA 1K02A 4C7DA 3BLFA 2XIQA 5FJIA 2XH0A 1D7KA 5GNXA 3F2DA 4WK9A 1PKNA 5EGRA 1M6JA 3ECQA 4NG3A 3RPDA 2Z7GA 2VZVA 2PDPA 3TTSA 4IIFA 3U6WA 1KQZA 4O0QA 1A3HA 4QIUA 1F9CA 1H7RA 1QPNA 4XZIA 2YXOA 4PMUA 1Q7MA 3WENA 4GABA 4DF2A 2PRMA 3STGA 1QNSA 1V51A 3WDPP 2TPSA 1W31A 4QE5A 3KL3A 3LXAA 3QV6A 1G9HA 2GVYA 7ODCA 4WY0F 1XICA 4HMCA 4MDPA 2YX0A 3A5FA 4I6VA 2X41A 1Q2SA 1VB9A 2EHHA 4OWGA 2NV1A 2YDQA 3EAUA 3QLDA 3RCYA 3I68A 5REQB 5I24A 1K7FA 2F6KA 1DV7A 2G4JA 1V0MA 3N19B 2CLMA 4PGLA 5JVLA 3TSDA 1TUFA 3S5OA 1TJRA 4B5WA 1V08A 3M41A 4IH3A 4J3WA 3SCUA 4PUKA 3D46A 2QCMA 3WEMA 2VR4A 1IQ8A 2ICSA 1FDJA 3WFZA 2R1LA 2QDEA 3SSJA 2OSYA 1S5NA 1LG2A 2RJGA 4KWOA 4LAKA 4IP4A 2WC3A 3VMPA 4EP8C 4F48A 5LNUA 4INFA 2O4QA 3L2MA 4IUGA 3W4RA 5EY5A 3SGGA 1W5NA 2BMBA 2Y88A 3CO8A 5IOBA 3TSMA 4XAZA 2OYKA 1NWTA 4PTNA 3IJDA 1Z6KA 3HQ1A 1KM1A 1R6WA 3SCNA 3DFSA 5EYWA 2QAPA 4HP5A 2P3ZA 4RV3A 5HBFA 4ZL1A 2PODA 4ML4A 1TR1A 3NNTA 3G2GA 2EPHA 3KP1A 4AZCB 2GK1A 2H6RA 4JYEA 3WUEA 4GI9A 3FSTA 4A35A 4YTSA 3QY7A 1OCQA 4GA8A 2D20A 1U5VA 3PF3A 4IIGA 3KHDA 4LB4A 1F4AA 3SCQA 1JGIA 4X2PA 3FAXA 4L56A 4IFRA 3SAZA 1RAKA 3WNKA 3LYEA 1KM3A 1EZ2A 1EFZA 3RMEA 3B05A 2OSXA 3LB0A 3TYBA 4ACZA 4WDUA 1VBHA 2G50A 4GPNA 5D8ZA 2PGEA 3QRHA 4AB4A 1WP6A 1EYEA 3ZR5A 3OW1A 3QPYA 1QK0A 3VNMA 3DN5A 3VUSA 3WLQA 4TTGA 3FHAA 4MM1A 2PA6A 4MY9A 1Q63A 4DJDC 3GQYA 3QPEA 4N7QA 3KS6A 3NTYA 4MZ8A 4QCEA 2P8CA 3UA4A 1YXDA 5FF2A 4AG0A 2DZSA 3MA8A 1JPKA 5CH9A 3WMLA 2DZAA 3UWEA 1FY6A 1OZQA 4AY7A 1XCWA 1P0EA 3R10A 4MYXA 3IUIA 1OFEA 2P76A 3VC6A 8TIMA 4M6PA 1ZCCA 1ECEA 2PTYA 4HZ8A 5HMDA 2NWRA 2ZCGA 3OHMB 4C90A 1DJYA 2YW4A 4HSNA 3P93A 3GE7A 1TE6A 2PE4A 2O7SA 2GJXB 3GHRA 1LLZA 5G4EA 4MFEA 4LWWA 3GIPA 3WDQA 5H2ZA 3VKCA 2NT0A 1O95A 1EC9A 4AIEA 1HJXA 2QLYA 1F6YA 1T8QA 3INPA 3P60A 4IOTA 1ISZA 5AC7A 1KBBA 1M03A 2FB3A 2FGBA 2FVKA 4PSRA 2NVDA 4O28A 3K2GA 4NU7A 1W3JA 1MRAA 2QPUA 4UTHA 3G77A 5H1WA 3LPPA 1W1TA 1H7OA 2E3ZA 1JDCA 5CEWA 1IWBA 2ZUTA 3WNPA 5AN7A 5D03A 3GUWA 5AHIA 1Q4WA 4UNIA 3WSUA 4C6MA 1XLIA 1XM3A 3T0AA 3MUAA 3EA1A 3ITOA 4YWSA 4NXSA 3ZVHB 2IKGA 2BBFA 4KH2A 4EKJA 1F05A 4FHAA 1V79A 3PAOA 1V0NA 3RRAA 3NIYA 5H6HA 2CZDA 1HGWA 1P6BA 3HG4A 4JTRA 1SMAA 4HNCA 2PTWA 3GTHA 4O12A 4K37A 4ADSA 4J3XA 3TXVA 3V0UA 1E73M 2EXOA 2GFTA 1HGYA 3W1RA 3BL3A 1FWTA 3MZNA 1JI2A 3WUFA 3AZRA 3MP3A 1G4TA 1ZJHA 3VDHA 1TB3A 4CKQA 1KFEA 1AODA 1RK5A 5FKYA 2X16A 3W37A 2J7GA 2ISVA 4R9XA 1V6XA 3IJ6A 3ARZA 1ZTVA 3O63A 2ZVIA 5GJNA 4LUTB 1KD0A 1QI5A 2QR6A 2YGYA 3F4WA 3JUGA 3OTRA 4ENLA 2AMGA 5EPDA 4O1DA 2H9AB 1EXBA 1GNXA 3GKAA 1S38A 5CPQA 1PPIA 4ES4A 2FFIA 3E02A 3FXGA 2MNRA 2D0HA 3S5ZA 4UWMA 3SN4A 1RR2A 4UTTC 2VI0A 2OLHA 1KC7A 2HPMA 2Z1SA 4FNSA 2HZGA 3WEOA 2PCEA 1KM2A 2V3GA 3FJ6A 4XD4A 3TP4A 2WQDA 3W75A 1U22A 1C8XA 2NUWA 2BB0A 1K77A 1BYAA 3LGGA 3NSMA 3WQPA 4LV9A 1TJ2A 4IPJA 4U3AA 1RBLA 4LAMA 3N3MA 2E40A 3SM0A 4CVWA 4WF7A 4OBRA 3VE7A 1G0CA 2XZ7A 2OELA 3P74A 4QTGA 5E5CA 1Y8BA 2OB3A 2AKZA 4H6RA 1KXHA 1R7AA 3PS7A 2A3EA 2EPNA 2P5NA 3MI2A 3V18A 2YCLB 1E51A 4LUSB 4L65A 2RH9A 2PRLA 3D5HA 2D2HA 2PDHA 1GVFA 3BAIA 3CZLA 1DJXA 4S3EA 3K30A 1CGWA 4AZCA 4WDXA 4UFLA 3OBEA 4LYPA 4QJ5B 1HIZA 3GO2A 4QDWA 1NOWA