1QK2A

Wild type cel6a with a non-hydrolysable cellotetraose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
total genus 137
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qk2A00
4B4FA 3A64A 3VOHA 3RPTA 4A05A 1OCNA 1HGWA 1OCJA 1UP0A 1QJWA 3VOIA 1OC6A 1OCBA 2BOGX 1OC7A 1BVWA 1UP3A 1QK2A 3A9BA 3VOJA 1QK0A 1UP2A 4I5RA 4I5UA 1CB2A 1TMLA 3ABXA 4AU0A 1HGYA 1UOZA 2BOFX 4AVNA 2BODX 2BVWA 3RU8X 3VOFA 1GZ1A 1DYSA 2BOEX 4AVOA 4AX7A 4B4HA 4AX6A 1OC5A 3VOGA
chains in the Genus database with same CATH superfamily
1GKRA 3TMLA 4DB7A 1EBHA 1MRQA 5EMMA 4PFHA 4LEFA 1D3CA 3LX9A 1IGSA 3QW4B 2H8XA 4FLRA 3W2LA 1NFGA 4P2VA 4JKKA 2CPUA 4EK7A 1UUOA 3B03A 1Q6LA 3RX4A 4UTUA 4GXMA 1C8XA 1MUMA 1DWGM 1V51A 3SN1A 5HJXA 1VBUA 2ZQ0A 2A5HA 2VZUA 3W7PA 4WJ8A 4NX0A 1B1YA 5IHSA 1CWYA 1H0GA 4NJGA 4IMDA 3EX4A 3GIPA 3QPEA 2BFGA 3I7QA 4EVZA 1A5CA 4MWAD 2INFA 4FNRA 1WKFA 1JXJA 2AQVA 1NWSA 3W72A 1O94A 1XD0A 3NPWA 4WY0F 1EEXA 3F5JA 1Z41A 4FF5A 3NQVA 4DJEC 3GKFA 1W3KA 4G7EB 3LGGA 3NO5A 3LCLA 4MAZA 5M1TA 1OFQA 3THUA 3E02A 1OB0A 4YVVA 1TWWA 1XLBA 4UQDA 5EFFA 1OY0A 4HYVA 3SFWA 3BZJA 1Q2SA 2CLMA 3NQCA 3BGJA 3N9RA 1IHIA 2HZGA 4YN5A 1GHSA 3GR4A 1A4MA 2GZXA 1GHRA 2FHBA 4BS0A 1JULA 2QUUA 4MB1A 4PMYA 1YTKA 3PBUA 3WMCA 3WQ6A 1YPIA 3OEXA 1FCQA 2WQDA 2JIWA 3G8EA 4KRTA 4AIEA 2C16A 1FWFC 2JEQA 4WLCA 4S3DA 3UT0A 3GW0A 3IVTA 1GTEA 1KXHA 5C0QA 1KFEA 4B5TA 1G0CA 3FDKA 1V02E 1I2NA 1O12A 1HJSA 4YTTA 1XH1A 1G7VA 3MANA 3IGXA 5L6UA 5CPMA 4DLMA 2DSUA 3K8MA 3GW3A 2ZUSA 3U5YA 1M68A 4HK5A 1C8QA 1KR1A 3UFYA 2WVSA 2V69A 1DKWA 1EIBA 3RO8A 3ITGA 4JTGA 3MC5A 2VDGA 5I3IA 3QY6A 3NZRA 1F4AA 5DELA 4YPJA 3BTNA 2ZE3A 1L6WA 2FKPA 1ITCA 4B3ZA 2E40A 3GHRA 4WRHA 2QCGA 3Q94A 1POKA 1UPPA 2BVWA 1A0EA 2PBOA 5U4NA 1TPWA 1RHCA 4PMZA 1KXTA 2YXOA 3B0YA 1EC9A 3ABZA 3GDRA 4AWTA 5C9XA 3ARTA 4MJ4A 1TPC1 1B3ZA 4RXFA 1C3FA 4M1RA 3MCMA 4NJJA 3OODA 4M81A 1XQKA 3F4WA 4NZJA 1J2BA 1BLIA 1EHAA 3VIPA 3PNUA 4JIRA 1W1IE 3WK3A 3TC7A 4NI8A 3N18A 3K13A 3QGVA 1PBGA 1UPMB 1I6NA 2HRWA 1VFLA 4UFHA 1GNXA 3HQNA 1Z32X 3U0HA 1LWJA 5FSDC 1XLAA 4Q32A 3C86A 5AYBA 1W2VA 4CQ8A 5CPNA 4NSBA 5GJMA 3CWOX 3B8TA 1GG1A 1GVQA 3V0SA 4JS3A 1XLEA 1NOFA 2DP3A 4IJCA 4D2JA 4QQ3A 4RXGA 4NAFA 1NH6A 4JQ3A 1NQ6A 4QJ4B 4L1GA 4LBUA 5AHNA 2LLEA 3KP1A 1M01A 3VD7A 1XUUA 3UG4A 3NQAA 4MB4A 1W1TA 1KB3A 1LOSA 1L9WA 4LAMA 3MWCA 1Y5VA 4PYSA 2KX9A 3VNYA 3GC5A 3IJIA 1GYNA 4IX2A 4PUUA 3OW1A 2AGKA 5F4XA 2AQWA 4XUGA 3FFSA 3UWYA 3LUTA 3URNA 3HPAA 3P82A 1BWVA 4L6HA 3R8HA 4ZO7A 3ZLFA 1CLKA 1BXCA 2ZUNA 4GBUA 3MUXA 4NZ3A 4L6DA 5EMUA 1JQVA 3LXAA 4AF0B 3AICA 2WV8A 1AQ0A 1XINA 1EF3A 3I7SA 3NSNA 4AZCA 1TPFA 3GTXA 3WNLA 3CL6A 4Q8TA 2IKHA 1CT5A 1CGUA 2Y5SA 3W1UA 1V7AA 2H9AB 4GZJA 1VEOA 1JCXA 1S2VA 4W85A 4O52A 2WMFA 2NVDA 3KOZA 2XN1A 3AQUA 3FA4A 4WVXA 5BRPA 3WLMA 2WNNA 4Y9OA 5G2IA 2QV5A 3D3AA 3AXKA 3B4YA 4IQLA 5FF2A 3FVMA 4WOZA 4OWGA 3FIGA 3B9OA 4MKSA 3KCJA 4QAWA 3RILA 4NL1A 1YPFA 3LBCA 3LMZA 3VNIA 1IE7C 4US5A 1AJ2A 3NEVA 4Z1AA 3TJIA 1YKWA 8CGTA 2OYMA 1OFPA 3GXFA 3LPPA 1P0DA 1N82A 1E4LA 2PDIA 2YCEA 2D1ZA 3OVPA 4Z2IA 2PP0A 2BP1A 3VA8A 3E5PA 1Q63A 3WJZA 3VIIA 3M7SA 4JTRA 4U5KA 1UWIA 3BC9A 3MSGA 2GJXA 1HFBA 4JL1A 1T41A 2GLKA 3OVRA 5DANA 1LUCA 4EPDC 5DY2A 2W0UA 3TYAA 1UR3M 2YCKX 2WCAA 3RGTA 4LS0A 2RAGA 2YB4A 4TV5A 5KZEA 4JKLA 4O54A 1DXFA 3ZVHB 3E2VA 4XTIA 1E72M 3NSMA 4O11A 2V81A 1H1NA 4GVGA 2J6XA 2V3GA 4UFMA 1Q3NA 3K8LA 3CU2A 3CAKA 2OLHA 4K6AA 5F2IA 5KMYA 2G5WA 1XHGA 3O0KA 5FKYA 3V5FA 2W27A 1UD6A 5D32A 1F76A 4G8TA 3EX6A 1QO5A 3LCXA 5M2FX 3N17A 2Z2BA 3BGGA 4UR7A 3EB4A 3H2FA 1FH7A 3QZEA 3O7UA 3FDGA 2VCBA 4JCLA 4YWSA 3WNPA 3DERA 3LRKA 3PVFA 2OLAA 4DPPA 1F74A 2VZTA 3M0XA 1U2YA 3AS3A 3S2NA 3COTA 3B8IA 4U4MA 3VDCA 2QMKA 3MMDA 3PZUA 2O9PA 1VPQA 2UY2A 3WH6A 4Y9PA 3VKDA 3QN3A 1WB0A 1EZWA 1J0JA 3NJ3A 1WDDA 3V1PA 3PBWA 4X61A 3PZNA 3RU8X 7REQB 2W9MA 3RJYA 2V63A 3EX1A 2TSYA 5H6HA 3KFTA 3BV4A 5D9OA 1MEHA 1LWIA 1WV2A 4H9MA 1J11A 4J3WA 1BRLA 3ZLGA 2QHAA 2QF7A 3W24A 1V77A 2NSXA 2YCIX 5ABFB 3XISA 1KRAC 1EB3A 2FPTA 3AHYA 2DZXA 3TR9A 3FKKA 3I7RA 5K2ZA 1BYBA 1JEZA 3SJ3A 1DJQA 4ML4A 2NQ9A 1XF0A 4RDZA 3EWDA 1B90A 4DWSC 3DFOA 3U8GA 4JTIA 1OFAA 1TPH1 4DZIA 4F8XA 1XIBA 3HBLA 1K7EA 4M24A 3RR1A 4KERA 4O57A 4AC7C 1XKJA 3W2MA 1RLDA 3ITTA 4FLOA 3GVGA 1UH3A 4E3TA 3MCOA 3NYZA 1FFRA 1LUCB 3TSBA 1W1VA 1K02A 4GYPC 3TFXA 1Y0EA 4U2YA 5EB8A 5JUVA 3WQ4A 1US2A 3SURA 1Q6FA 3S2JA 1PDZA 4JIHA 2ADAA 3HQPA 2Z2AA 1F3EA 3E2SA 3QR0A 1OJXA 1J0KA 4BY3A 1TIMA 5TBOA 1I75A 5CPLA 1X7IA 1L6SA 2Q3RA 4B9ZA 3NZQA 5M17A 2ZDRA 1E71M 2C14A 3EWWA 2DZBA 1ZP3A 3LDVA 3WDQA 3FGCB 4V1XA 5DEZA 3ZJ7A 3M0VA 4OOUA 3G77A 4GUJA 2ZUWA 2A7PA 4DIAA 2QJIA 5D33A 4DJFC 3OP2A 3MP3A 1K8XA 3CEPA 3HG3A 2ZZ2A 5T8GA 4XV0A 3TA6A 4X2RA 1VPYA 5BRQA 4PEKA 2WC3A 3CZ8A 4O15A 2PB1A 3S46A 1WZLA 2NX1A 3KLKA 3KS6A 5CAHA 4S3KA 1XCFA 1BQGA 1RK6A 1VLIA 1IR1A 5D8ZA 4JTFA 1BWLA 2WHMA 2YA2A 1FWAC 4CN4A 1OBAA 3MHGA 3DKJA 5D9NA 5DMLA 3BAIA 3AXIA 3QQWA 1NF0A 4XBKA 5BWAA 2D24A 1KD0A 2WHJA 4UTHA 1WKDA 4H6KA 5HANA 2BWGA 3W7LA 1PKYA 3W76A 3ME3A 1XGDA 1PX3A 2OOGA 4HNVA 3CQHA 1BGAA 4DUVA 1FX6A 4BK9A 1E3XA 1ZL1A 3IACA 3RMJA 1O66A 1E9LA 3BLLA 4PMUA 1XM3A 3DFQA 1BPLB 1UKSA 2ZX7A 1GONA 2AAAA 5M3WA 1W3JA 1B2YA 2PDCA 4DHGA 1NDZA 4WOQA 1H0IA 2GJPA 1H3GA 2JFEX 5BWFA 2ZA2A 1JCTA 3SRKA 1GEHA 3TYZA 3OLDA 2F84A 3P84A 2JE8A 3A3XA 5A95A 1FKWA 4W8AA 4O0ZA 1I60A 3PR2A 3WNOA 2E6DA 4CCZA 2OLSA 3V7PA 2CW6A 4YCPA 1BKSA 5AYXA 4MNKA 4F0RA 4FR6A 1U33A 4NT0A 4HP5A 2FGBA 3IGSA 2C1GA 4LS2A 3SCUA 4Q3MA 3GG0A 2Z28A 4N6EA 1LLOA 3H21A 4WGXA 3L0GA 3UWEA 3NQDA 1J5TA 2P5NA 3S9IA 4HBKA 5BZAA 2I9EA 3C8FA 1T8QA 2ZUVA 2PDPA 3TYUA 3SRFA 4AFYA 1MW0A 4Y9NA 1R9YA 3AFBA 5F1VA 2NXIA 2BXVA 1C91A 1J0ZA 3BAWA 1FCVA 2G4JA 1XJBA 4KCTA 4NY2A 3UXLA 3EOEA 4XD5A 3VNMA 1TO3A 2NV2A 2VVNA 4N4QA 2X30A 5K9CA 1ME8A 2WM0A 3B9EA 4XK2A 3W7IA 3TAKA 2DSKA 1HO4A 3Q58A 1DE5A 4X2PA 4PTWA 4RJEA 2EPKX 1K7FA 4HU3A 1XYZA 2I9UA 3T44A 2ZX8A 1TE6A 4G5DA 3ALGA 4CQDA 3IEBA 3UWQA 1ADOA 2W3ZA 4JDYA 3R1ZA 5JBDA 2Y1HA 4AU0A 4US5D 3FCPA 1B5TA 4ZTYA 1OX4B 1A53A 3MW7A 3UXKA 5GNXA 1B31A 2R1KA 3M6DA 5AC8A 2L5HA 2GVLA 2Q6ZA 4K36A 3ARRA 4HPGA 4WSKA 3BARA 5AECA 4Y2WA 3EOUA 1DOSA 2Y24A 3AMLA 4HMEA 3ZR5A 3UJ2A 5EMKA 3BOXA 4IXXA 1G67A 1XLFA 2C13A 2G4FA 2A0NA 1BXNA 4YTQA 4FK9A 4QG9A 3LMYA 1W1PA 2HMCA 2AAMA 2ISFA 4RE2A 3SSJA 1E6RA 1L6FA 3NPXA 2XFWA 4UFLA 2X7VA 2O9TA 4PUJA 4RPQA 1P0NA 3BV7A 1PTGA 1YMYA 4S3AA 4AVFA 2E67A 5BOFA 2OKTA 3GHSA 2XUCA 3P60A 4S3FA 1PB0A 3BLEA 3KCLA 1NAL1 4NX5A 1P4CA 3RM8A 1VCFA 5B7ZA 4Q8QA 3EDEA 3AIUA 4C6KA 2VKZG 4LUSA 1UD3A 3P0WA 8XIAA 3ORWA 4GA8A 3N15A 3UWUA 1RY0A 1ICPA 3QSRA 3ZSTA 3MBDA 4DWDA 4Z08A 2QJMA 3CPGA 3GHUA 4GBDA 4MSSA 2PDGA 1S1PA 1XICA 2CEQA 1FKXA 3GRIA 3WD2A 4UZUA 3HG2A 1N8FA 2CKRA 1ISYA 5DRIA 3GZ3A 3NCOA 3CQIA 1UP2A 3Q65A 3TC6A 1Q65A 4ASTA 1KV8A 3SY5A 3LTYA 3NG3A 3QW3A 4FX7A 1I2OA 2OGJA 4MWAB 1V6TA 3SFKA 1JNDA 2PTDA 4K38A 3KOXA 3KE0A 1Z3NA 1HIZA 1KBIA 5D9MA 4LCQA 1XBZA 3DHUA 2G0WA 2EG7A 1TPUA 2P50A 3THQA 3W7HA 1FOBA 2VVSA 1TRIA 1ZS2A 2IQTA 3KDOA 3EEZA 4K37A 3URBA 1HJQA 4XD4A 3LSCA 4YWIA 2DQXA 3EX3A 3O8AA 5CLTA 4IMFA 5JIWA 4GXWA 5G4HC 1EQCA 2DVUA 5A8OA 5DO8A 1HP5A 4AVNA 1QFEA 3S1GA 1DTNA 2OX4A 2GOKA 5GNYA 3RXZA 1K8CA 1PKLA 1RR2A 3UBPC 5EYWA 2Y6ZA 2HV5A 1VB9A 1QJWA 4MZ8A 4NRSA 4NZ1A 3W75A 1R3YA 2H9AA 1S5VA 1E5JA 1HQTA 1OZQA 5A5WA 3ZXWA 2JK2A 3INPA 2XFFA 3DKLA 1P7TB 2WKGA 1NWRA 2DT1A 3RM4A 3NQEA 4XAZA 4B16A 3TE9A 1SMAA 2ZE0A 2PD5A 1OHLA 4LH8A 2ASHA 1WDSA 4YYFA 4Q8MA 1E15A 1X6NA 4KFOA 5IHRA 1Z69A 2PD9A 1BRLB 4EE9A 3V5OA 1RAKA 3CB3A 4JFVA 2Y8KA 4JN8A 3SY1A 3BGAA 1N7KA 3E5BA 3S1UA 4GZEA 4QQUA 4WQ6A 5J04A 1QR7A 4XX6A 3W1RA 3HMCA 4PUWA 2CXEA 2IPGA 2FQIA 3T05A 2CNCA 3NA8A 1W1ZA 1P0KA 1DXEA 1ZZMA 4HNNA 1KWKA 1F8IA 3TMQA 4OU1A 1UR1A 2P3ZA 3NVDA 1EJ7L 4GUFA 3OA5A 1OYCA 3WBYA 2CBIA 4L9YA 2J6VA 4L65A 1QUMA 2Z2UA 1QPNA 3F03K 1UJQA 2XU2A 4FIRA 2PRMA 4IHCA 4CCDA 2QCEA 4PCPA 4WDXA 2ZWZA 2VD8A 2BZNA 3N9KA 4ZQOA 4EACA 2WANA 3P81A 5EBAA 1PZ1A 3CUXA 3OB8A 2YKKA 4GUHA 2NWSA 4S39A 5C5YA 4D71A 4JIEA 2VC7A 5A6JA 3FAXA 4QS6A 1KNWA 3U5UA 2FPYA 3R8RA 4MLRA 2ZFAA 5A2CA 5D03A 1UIPA 4G1NA 4FB7A 4AEFA 1XYFA 1V3LA 1JCNA 2FJKA 3S6DA 1HL8A 1X39A 1V03A 4L61A 3UU0A 3LHWA 3VIOA 3Q2DA 4LU0A 1F73A 3FYYA 1DWAM 3ZMRA 1HXJA 2G3IA 3B8VA 4FXFA 2VX7A 1UWQA 1QI0A 2WSRA 2X0YA 3SECA 3LTPA 1HTIA 4UFJA 4WXZA 1OCJA 2OZ8A 2HS8A 4ATLA 4CD7A 3VOCA 5EA9A 2EEXA 2V82A 4QNEA 3S5NA 3SY8A 4UTLA 3AALA 2QCNA 4B5SA 2CZVA 1XXXA 2PDQA 3OLIA 2X2GA 5HNNA 4JYDA 4XAGA 1B3OA 2O9OA 1XGEA 1UROA 4F3HA 1Q8AA 1NFPA 3A3WA 3GWQA 3CHDA 3ABQA 3LHTA 5A8PA 1YNPA 3VVGA 1YHTA 4BF9A 2BLEA 3NWRA 3N4FA 1BF2A 1VIWA 4R88A 1CB7B 5CZ0A 1XRVA 3NQFA 4H8HA 1RQHA 1UG6A 4ZOCA 1JDAA 1JZ6A 2ZA1A 2J74A 4JQ1A 2V5BA 3KXQA 2AGTA 3B04A 5T26A 3HV8A 1PIGA 2QV4A 2BODX 2ACSA 2PWEA 3CTLA 2INEA 1QI3A 4PL2A 1L8PA 3M47A 2DDXA 2WVVB 4DXXA 2VC5A 2CLLA 1SO4A 3TJLA 3L0KA 2PGRA 3T2PA 1CGXA 4RLIA 3M0HA 3QF0A 1ZAHA 2ZZ7A 2CESA 5I00A 4DLFA 4QJ3B 3GC4A 4DBUA 2CFFA 1K4HA 3HPSA 1SJDA 2PC8A 1E0XA 2ICSA 2WM1A 4UR8A 1O95A 1M3UA 4ECLA 2YW3A 1O5RA 3MKVA 3CWHA 2XM2A 1GEQA 1R7OA 3TLLA 4H3DA 1O5XA 4O1EA 3WQWA 4IMAA 3ES8A 2OWXA 1AA1B 3BW4A 3NO3A 5CC3A 4R7WA 4JICA 3LLXA 3M5YA 2F6UA 1SZGA 2VNCA 1RALA 1U5VA 4Q8OA 3LI0A 3DYOA 3MZNA 4GY7A 4QM1A 2PURA 1U83A 1RH9A 2WYSA 4D6HA 2P76A 1UMLA 4B5VA 5F2GA 1E1CA 3DCPA 1H51A 2QAPA 3M0KA 1IIHA 4J40A 4XZMX 1ME9A 4PCNA 2GVEA 5HNUA 2XGBA 3EPNA 3NAVA 1J0YA 3ELFA 2ATSA 3TXZA 4A8LA 4CD8A 1MRAA 1RJRA 4POCA 3N29A 4RZ5A 2PF8A 4QDWA 3UR5A 1UP0A 3SRDA 4H6EA 4MTVA 2PMQA 3LHZA 1AL8A 1TX2A 4RNHA 5DF0A 2IPFA 1NDVA 3NM3A 2IKIA 5FF4A 4TTUA 3W86A 5IRPA 2ALDA 1JNEA 2E8ZA 3W2KA 4D8AA 5CJNA 2QCCA 1GJWA 3QXBA 3C0SA 3SZ8A 2E6FA 1F4HA 4QX4A 1E9ZB 1HGWA 1JZ8A 1MWOA 3KRBA 1N8WA 1OYAA 2INZA 2V5CA 1Q2RA 5C9WA 5FL1A 1NDWA 3TLQA 2ZZ1A 2I57A 3NZPA 5I07A 3V0TA 5C2XA 3P8JA 4N6FA 1PYFA 2GOUA 4GKLA 4S3GA 2XZ9A 4K2SA 2RDXA 2DZUA 3CHFA 4DAFA 2XN2A 4ZXOA 4IFKA 4PEEA 4YIWA 1XIJA 4HU8A 4C65A 4W9TA 3KOFA 3IWPA 1TV3A 2YDSA 1VFOA 3TQKA 2XSAA 3S8HA 4YMZA 1W1B1 2QPSA 1ZB5A 3MI6A 3C2VA 3V3WA 3K46A 3ABXA 2FH6A 4DVOA 1H7RA 1XI3A 3W7DA 1M04A 4DM1A 5HPCA 4DI8A 3L0NA 3OGRA 1H7PA 1E1FA 4AD3A 4PTVA 5CC6A 1XKYA 1GK8A 4HSOA 3WQPA 1UP3A 4UIOA 2Z6JA 3JZEA 3D47A 4WJEA 5A3HA 4JTJA 3R43A 3WUGA 4ICMA 3W27A 4PODA 4HKPA 3GDLA 1GZJA 3TX9A 3MV01 3WLRA 3C6CA 4QISA 1PZ0A 4B3KA 5AY7A 3W1QA 4LUYA 3WQDA 2I14A 3MVTA 2J9YA 3PTQA 1TZZA 3U57A 3FJ6A 2CLKA 3C3NA 2EKCA 2X42A 4GCXA 2V67A 1V5XA 1WOAA 2VRJA 1Y5WA 2WBKA 2NZLA 4ZVJA 2X2YA 2HDJA 4H9VA 5FEPA 1UBSA 3WJSA 3WJYA 1KTBA 1AW5A 3O07A 2PFHA 1EZ2A 3KDNA 3M0LA 4KEMA 3CHEA 4OIFA 1JYNA 3UR7A 4FO4A 1FXPA 5HJYA 2Z1VA 1KGXA 3ARYA 3O6YX 2ZWYA 3NIYA 1TPVA 4QE1A 2WMGA 4O19A 1CDGA 1DQUA 1KQZA 2NLYA 3VCRA 4KBXA 5E6YA 1TMQA 2VZSA 3CQJA 3TTYA 1VYRA 1GQIA 3XINA 1M7JA 3TTOA 4MY1A 1FH8A 4NZ5A 3CV7A 3UEQA 1H41A 3CUHA 3STEA 1FWBC 1V08A 4O53A 2FGZA 2AL2B 3H2EA 1A3XA 1RUSA 1MO0A 4J3VA 5I03A 3EYPA 3ES7A 1XPYA 1O4UA 2G96A 2J7EA 5G2HA 3CHVA 4BWLA 1I0DA 3W07A 2Q01A 1MUCA 3TSMA 2A85A 5I3HA 3M0ZA 4TTGA 4AD0A 3PAJA 4LB3A 1SO3A 1QNSA 4KPLA 2YCLA 3U7VA 5D2WA 7REQA 1ZGDA 3SN4A 1EJRC 5FEWA 3QY7A 2FLIA 2BBFA 4H1ZA 2I7GA 1VEPA 1GVEA 1F5ZA 3UR8A 4RDYA 4PUEA 4A8NA 4E2OA 3UWWA 1R30A 2GFTA 5JBEA 3WZ0E 2GK1A 1CI1A 2EQDA 3W37A 4N02A 4AEEA 3VGEA 5D2TA 5E0FA 2GSJA 1FHVA 3PAOA 2WZIA 3GFZA 4YU1A 2XWDA 1EP1A 4NXSA 1XX1A 4LVDA 4AWSA 1ITUA 1W8GA 3U9IA 4HSHA 1KW1A 1C8VA 1TJPA 1QASA 3GXMA 4IWWA 4MZYA 2PTWA 3UG5A 1FHLA 2UBPC 2CYGA 4XD6A 1TREA 2WMJA 1GVRA 1XC4A 4IXHA 1XP3A 5GPRA 3W81A 3ZIZA 4IUOA 3AUJA 3CJPA 1TWSA 2PWVA 1K9FA 2OO0A 1TPDA 4BQ3A 1JCMP 2W67A 3GTHA 3CB8A 3W2NA 2NQJA 4Q8NA 1HZYA 1LT7A 1R46A 4QSFA 3SW6A 4C6OA 4CEUC 4MJMA 3UJEA 1PSCA 4IX0A 4GGHA 3AU6A 3TVAA 3BAJA 3NZGA 1EJTC 1S3HA 3BK0A 1NM9A 3KWXA 4C1NB 1GVIA 3NTYA 4C6BA 2PLJA 4FEZA 3B05A 1TA3B 1ONEA 3KVJA 2ZXQA 1VBGA 1A49A 3THDA 3OZOA 4LAZA 4TMCA 3E12A 4H7VA 1K1DA 1IEWA 1GGOA 2ANUA 1ZUAX 3FY1A 4KEVA 1JZ4A 4M8UA 1HW6A 4F9JA 4FOUA 1RVGA 4UMBA 4LX4A 3DX5A 4JQAA 1JG9A 5I3FA 3VDHA 1OEPA 2NV9A 4ZQRA 2E5BA 4PMDA 4F66A 4DJDA 4HU4A 3BH4A 1AH4A 1VC4A 3PBYA 3MMWA 1IGWA 1KO0A 3JW7A 3IJLA 3M44A 3LD5A 4MUPA 4HCHA 1S2CA 1VIZA 1QO2A 1BXBA 4YVPA 4YS1A 2GYIA 2VEIA 4FI4A 4UC5A 3KRUA 3RN6A 4HN8A 5LA2A 1FWEC 3WBEA 3GBDA 4LNCA 1ZBCA 4LALA 1R3TA 2Y4SA 3QQ1A 4MUZA 4DUOA 2YL6A 3DYPA 3LV6A 1MNZA 3MWAA 1NDYA 3T42A 3UPBA 4J4KA 4FALA 4KCVA 3QV6A 3LZ5A 3STGA 1EWDA 4PMXA 2PCQA 4YXGA 5ECVA 1GCYA 3BLKA 2X0SA 4MFDA 4M29A 3R58A 1NP0A 4HZ6A 3ZR6A 3OZMA 3O05A 2GVGA 2EPHA 3H26A 2FZ9A 3WUEA 1QVBA 4O0KA 1FWJC 3G5EA 4GIEA 2GUBA 4P8VA 3OLEA 1SJAA 1V7YA 3GE7A 4X0VA 1B3XA 2WBGA 1F3WA 4KCUA 4M0XA 3CPRA 3W22A 4ES4A 1DBTA 4ZE4A 2VRKA 2GSHA 5CC5A 3VC6A 3P5ZA 4F79A 2V9DA 4XZ9A 3LOTA 5BNKA 4GFSA 1E9YB 1BYCA 1U5JA 4H9YA 1QU4A 4MG4A 4EANA 3LBOA 1Y5XA 4G7FA 3AXHA 4S3BA 1H7XA 1UJPA 4DBEA 1AW2A 2J4GA 2IXUA 2GDUA 5XINA 2HPIA 4U31A 4H6QA 1I1WA 3NQMA 1ZAJA 6REQA 2NW0A 5GVJA 5LYRA 4HOXA 2TMDA 3M6YA 4OUIA 4Z1BA 3LI1A 1LWHA 1OX5A 1PVNA 1FTXA 4NRRA 3TH6A 4EX4A 2Z4GA 1DHPA 3B0XA 1OYBA 2NQZA 1O5KA 3BAXA 4RNIA 3H7UA 3KVKA 3BJSA 4JCMA 1TJ1A 3P93A 3WLOA 4QJ1A 3W73A 5FOOA 4RV3A 3B9DA 1EJXC 4MWAC 4LVFA 5HMSA 2DJLA 3CUGA 2R1NA 3TP4A 5CC7A 4TVDA 5F4WA 2O4QA 3I6TA 5K9XA 3UWZA 4DJDC 4OV4A 1IXPA 4HCDA 1UWRA 2O55A 2XINA 2ZXBA 1R3QA 1XYLA 3BQ6A 1YQ2A 3E2QA 2OG9A 1BAGA 1K7XA 1KGUA 3L4YA 1UD4A 3L7RA 1ZJAA 2PDUA 1QHOA 1SZNA 5C7HA 3T08A 1BVNP 3L4ZA 3W84A 1Q8JA 3KBWA 3DC8A 4A35A 2QDEA 1UD8A 3NO1A 4C7GA 4UNIA 1W6TA 3H23A 4CQAA 2CIPA 3SCVA 3ITYA 3T9PA 3AYRA 1R6WA 5E09A 1FDZA 4LGXA 2HSAA 4HHHA 5C6MA 4XBSA 2IMRA 3UGRA 3IVUA 4KQNA 3R12A 2NQ5A 3T55A 5REQA 1NOWA 1TA3A 3S42A 1KRCC 3S5SA 1PHWA 3IJQA 3GDBA 1TE1A 3LXCA 3W1MA 3EOOA 3IV3A 4GWEA 5GJNA 4GI4A 4R53A 4B3LA 3KBNA 3UY8A 4A3YA 1GQLA 3H4WA 4OTKA 1WE5A 2AL1A 4OOZA 3W82A 1EXBA 1WUEA 3ZVIA 3GUWA 3P7YA 4UOQA 5KETA 4NJHA 4PUNA 3IARA 1EL3A 3QJAA 2X09A 3IUDA 4E4PA 4JDBA 1LDCA 3ZSSA 1BYAA 2HK0A 3TC3A 3WNMA 2YA1A 2VD9A 3EOLA 1UH4A 2VJXA 4HZ7A 1JUEA 1HKWA 4Q8UA 3KL5A 1E51A 5CBIA 3R0UA 4LWWA 4PBGA 4Q4QA 2VGGA 1OFEA 1R47A 1GYLA 1M41A 3TW7A 3QLLA 3DESA 2AL2A 4FNSA 1XYMA 1G94A 3GH5A 5D9PA 1YW1A 3W85A 1GT8A 3GVRA 2OYLA 5LNRA 3GXDA 4Q7IA 2DIKA 2Z7GA 2DV0A 3PK7A 4XZBA 1XSIA 5I79A 2QCLA 5HULA 3E3HA 5G4EA 1C90A 4N4PA 1H5YA 3N9SA 1M1BA 2QCMA 4M6UA 4FXJA 1TV4A 2EGZA 1C9WA 4O14A 3CIXA 3WDPP 2FB3A 4B5WA 4ZO9A 1GVYA 1VYPX 3EPMA 4URIA 4DBDA 3QPZA 5CZKA 3TROA 4DZAA 5E5CA 1W8SA 3VOFA 2IPWA 2XIBA 3PS7A 4C7DA 5DT7A 1A5KC 2OEKA 2NWRA 2J13A 1W17A 5H1WA 5FJIA 1EGVA 3WL1A 1B4EA 2EPLX 1BHGA 1BVWA 3GU1A 3RDKA 1WBHA 4GD0A 1VFSA 2J47A 3P74A 3RLUA 1TELA 1MI3A 2HROA 3GTFA 3LHUA 1W1A1 1EJUC 1EJWC 4HPXA 4IP5A 1HKMA 3PTKA 3WQOA 2UZ9A 4LC6A 4NI3A 3QZ6A 3T2OA 3CL8A 1NELA 1ENUA 1MUWA 4IFOA 3AISA 4KESA 4H00A 4CCCA 2AKMA 2QPUA 1W0MA 1XISA 1OX4A 1IZKA 4ROPA 2JGQA 4A3HA 2WW5A 3MMUA 3M1ZA 3MQTA 3WD3A 4OV9A 3AIVA 4GUGA 3N3MA 2PAJA 3ARPA 2R1LA 3AHTA 4WEVX 4AHQA 3H2AA 4QE4A 1WPCA 2QZRA 2V6AA 4JQ4A 3P0XA 4CQ9A 4AD2A 3IRSA 2G50A 2J9XA 1OVDA 2W66A 4DRSA 3EXRA 1G4EA 2Q8ZA 4LUIA 1HJUA 3CAWA 1GVOA 3L9CA 3T0CA 1I8JA 3PJWA 3PHAA 4WZHA 4HJFA 1LYXA 1PWLA 4H7ZA 3ARZA 1TV7A 4GI9A 2P3EA 3AIEA 4ZSTA 5DMYA 5I3DA 1GOQA 1WXZA 4J1OA 1I4NA 1K9EA 4H7CA 4RE4A 1SYTA 2OYKA 3H55A 3F2DA 1VJZA 2WSKA 6TIMA 3GDTA 1LLWA 2P53A 1WDQA 1GQJA 2BSLA 4GMEA 3QKEA 5A8QA 3HQ1A 3KBMA 2RJHA 3CO8A 1I2PA 2OGYA 4XZHA 1RCXB 3CH0A 2DUZA 1ZQ5A 4GOAA 2F2HA 5KZMA 4JZ5A 3IANA 4DO6A 3P14A 4K3ZA 2EXOA 5C8BB 1JPIA 4B5UA 4HZMA 4Q4KA 3SN0A 1CLVA 1SVDA 2PTXA 4OHQA 3REQB 3O9NA 3UF9A 4JYEA 4LEQA 1I45A 1QI4A 5D2VA 3N2BA 2OEMA 3VNZA 4ACYA 1P0BA 3BG5A 9XIAA 4UFKA 2VQTA 4JHOA 1G4PA 4YNGA 4IQDA 4GUIA 4PCTA 3W1XA 5AHFA 4JNYA 5FAGA 2D3NA 3W00A 5AFDA 4C90A 1UKTA 3GXTA 4DNMA 1A0DA 1UZDA 4RCXA 4JYFA 4J2MA 8XIMA 2HVNA 2YDAA 4PE8A 4IISA 3ZJKA 4FOKA 4CCEA 3NQ2A 4NG3A 3LXBA 2B7QA 1ZPTA 3QH2A 3S1XA 3ZR4A 1S2WA 3PUEA 4O1DA 4PMOA 4PTXA 4EXAA 2OQYA 1H7NA 4GHRA 2ISWA 2E5DA 1HF6A 5G5IA 3E38A 4L4MA 4S38A 1TCMA 3TU9A 1SMDA 4I9TA 3DBPA 5HAOA 1SU5A 1SJCA 3MYPA 3MUAA 3EBVA 1W3HA 4IPJA 1QI2A 4R3UA 1ZCOA 3IRDA 2PLCA 5BOOA 1D3GA 1CBGA 2R6OA 1VEMA 5FJTA 4IT1A 3TN3A 1F3XA 3W7QA 2ATMA 1Z8AA 3TJXA 4J9JA 3P5YA 4P5UA 2J78A 1N8IA 3IIXA 3VFCA 1Z6KA 3KL0A 4C6LA 2I5GA 3M07A 4RR4A 1AJ0A 4DI9A 1UBPC 1AW1A 4X63A 1XDMA 2ZTJA 2E68A 4AZBA 4IUGA 3UPMA 5G1YA 3W71A 4KCWA 3DFYA 3M46A 1A5LC 4L9XA 5A6MA 3AJ7A 4ACZB 3GXPA 4X3ZA 3FGCA 2DZPA 2Z24A 2ABBA 1XIHA 3S0CA 1S39A 1YBQA 2CZDA 3ONBA 2PPGA 4GNKB 1KM2A 1FWTA 3WIJA 5F2MA 4M1BA 3TCEA 3VZZA 3LNPA 5DY3A 1L2UA 1A50A 2Z1BA 3G1HA 2V2DA 3F2BA 3GDMA 3LRLA 1K3UA 5EBUA 1LRTA 4ERGA 4Y7EA 2VP8A 1G1YA 4S3JA 4E3VA 4FIQA 1Q6GA 3W88A 1R86A 1UOKA 3IAQA 4RW5A 4E2VA 5DLCA 4NF7A 3OHMB 3NR0A 4KIEA 3KTSA 3SCTA 1XR2A 3N2CA 4ALDA 5LGZA 3OGSA 1KM4A 1UR2A 3DOPA 3QEZA 3RX2A 1D2KA 1EPVA 2FZDA 4OZOA 3LCHA 3P8IA 1CGYA 3T6CA 4Y96A 2W4XA 2ZZ3A 4IMGA 4B15A 2PP1A 2VZOA 3G1DA 4H9XA 4ZB5A 1PPIA 4NNCA 4I90A 3LHYA 1VPXA 4EOUA 4FXSA 1C7TA 5K7JA 3WLHA 4O17A 1L2QA 4F0SA 3PF3A 7TAAA 1LM1A 5IBXA 2C1HA 3RX3A 2WSYA 1E0TA 1V6UA 1BG4A 2HK1A 4GVHA 3FJ4A 1P6BA 3IGUA 5F7UA 2QCFA 2WSQA 1WZAA 2Y0FA 4GXPA 4AF0A 1T96A 2CZ5A 1YXDA 1XV8A 1REQA 2DZWA 3EXSA 4H8UA 5FF0A 4XIMA 3VC5A 4E4FA 4C6MA 5D02A 1IT7A 3EKGA 1IQ8A 4TUFA 1YBQB 4G9PA 2VR4A 1V6VA 3C0JA 3N4AA 1LRQA 4RX0A 3STFA 3GD6A 7PTDA 3UXIA 1BGGA 1MVYA 4LF2A 3GH7A 8A3HA 4AZIA 4AAJA 4K8HA 2QMJA 3NM1A 5JU6A 4XVDA 3R94A 2J77A 3NL3A 5DBUA 1AZ2A 3UA3A 1IEIA 2XPKA 2CXGA 2VZVA 3MBFA 4MJ2A 1R87A 3BSMA 5DN1A 5IXEA 4HHPA 4GVIA 4O1BA 2PGFA 4I3GA 4NYUA 3ZOAA 1LRNA 3PANA 2VEKA 3QYSA 5CZJA 5PTDA 3HG4A 4UNLA 3N6HA 3GU9A 4CNSA 2GQ3A 3T0DA 3RPMA 4KFPA 2O56A 2A3AA 1S38A 1C92A 4RDWA 5JBFA 1PV8A 4XQ6A 3WQEA 4H01A 5A6SA 3AHVA 1OT1A 5H8PA 5HK4A 1XIEA 3TQ0A 2UWFA 3AZSA 5MHBA 1OC7A 1RBAA 4GIAA 3IJ8A 3BLIA 1GOMA 2REQB 3VUSA 4B5NA 2FTYA 3IJDA 1HKKA 5A8GA 4DO4A 5G2WA 5AC6A 2CLEA 1ZY9A 3AOFA 4MOZA 1NP2A 3WD0A 4A05A 2RH9A 3VILA 2FB2A 3DG3A 3FYPA 3LGDA 3RIKA 1ADSA 2QPXA 5HXMA 3CS2A 1JRCA 4PTNA 4AY7A 2CLOA 2VM8A 3OOQA 3WQVA 5F4SA 4O10A 1ODZA 2J75A 4X0NA 4CNOA 3MMTA 3O6CA 2QXWA 3IS4A 1EH9A 2JIEA 3CMFA 2OQHA 1TWDA 1W3NA 3WJWA 3W1LA 3N25A 1OIFA 1A80A 1JJKA 1RA0A 1TCDA 4C1NA 2XVGA 1XPGA 4PC8A 4HPNA 1E9IA 2R82A 4BI6A 3T81A 2VGIA 4B9YA 3LZ3A 5ABGA 3B0UX 2CLFA 3EWXA 3KCOA 4XB3A 4HPHA 1FWGC 3VKJA 1JPDX 3MPGA 1W54A 3G22A 4ZODA 2V3FA 4NYYA 3EA2A 4M5PA 4P8UA 3FJNA 3GXNA 5JMUA 3WLQA 2ZRWA 4U3CA 3QMSA 4P7QA 5EL1A 3VIMA 1MZRA 3CZKA 2ONEA 4HVXA 2WZMA 4ILSA 3C4UA 1V0LA 2G3JA 1NWUA 1OK4A 3BLDA 1PIFA 3C0QA 1QW9A 3G3DA 1ZALA 1AK5A 4DXKA 3LCGA 2X8RA 4R7OA 2CLHA 3WLPA 4X60A 1HKVA 1EF2A 3BJFA 4QROA 3GK0A 1P43A 4GQ0A 4N9EA 2VGFA 1TJ2A 4HMCA 3C2RA 4JGDA 4ZQCA 2NXHA 1ZRQA 3UQNA 1WOBA 3H53A 3WELA 5GQBA 2VMFA 4HHLA 1C7SA 5CSUA 1TQXA 3W0KA 3T0BA 3LQGA 3H4XA 1IWPA 4PUMA 4F40A 5D30A 2QUTA 4CN6A 2JEPA 3ZVHA 2VTFA 1U1UA 2YCLB 5K4ZA 2OSYA 1KLYA 3ZT7A 3F1QA 4LF1A 3W6MA 1PE1A 4DYJA 4I7WA 4AHOA 5C9UA 3ABSA 2J7BA 3MSDA 4GH3A 3A64A 4HT3A 1RD6A 4FHAA 4IFKB 1T40A 2TPSA 2JALA 4A4AA 1FP8A 3WH8A 1KFJA 2WHLA 4AW7A 3WG6A 5HMDA 3H2CA 1DVJA 4V1YA 4B2DD 5CGMA 2V5DA 4JAWA 3FEMA 4MM1A 3SCOA 1SM9A 4YL2A 4Z2GA 3RLVA 4ICCX 1MQPA 3A4JA 3K1GA 4M82A 3IVSA 1K9TA 2TAAA 1YRRA 4M6VA 4J3ZA 3HFTA 4LSBA 3MCNA 1XYBA 3DEQA 3W7RA 3UP8A 1CXLA 2V30A 2HQAA 2J27A 1K4GA 4HOWA 3QYQA 4GISA 1HT6A 3N3TA 2PDWA 4W4QA 2ZADA 1H1YA 1KFCA 1ME7A 3DBNA 2O7QA 1EDQA 3O15A 4WSHA 2ACQA 2OCZA 4UMCA 2PLMA 4IMEA 4IPPA 2C7FA 3VM5A 2PDXA 1WKYA 1Q6CA 4WUIA 2F8QA 2DU2A 2ZX9A 5LNUA 3NDOA 2HNEA 3SEPA 2HTMA 4Q4SA 2ZXDA 2X05A 3R2GA 2I5QA 3WO8A 3Q4DA 1VYSX 4LXFA 2OSWA 3CV1A 1UIOA 3BE7A 1VHNA 1B57A 2FYMA 1YDYA 3VD5A 4EAMA 1MMFA 3KZSA 3FXYA 2NSOA 2WJDA 1FHUA 2J9ZA 2VR5A 4GG9A 4CD5A 5TIMA 3TDFA 4U2ZA 1EJVC 3AXXA 3AXMA 3BL3A 3CEUA 3GNDA 1F6YA 5IDIA 2EJ1A 3PZMA 4GACA 1P7TA 4NXKA 4GC4A 1CGWA 4M6QA 4UXDA 1V3MA 2HXTA 1WKEA 2PZNA 9XIMA 2WNZA 3NYDA 3G1RA 5HUPA 2PTZA 5KTLA 5I3KA 3GLCA 2FVLA 1VP5A 3MSYA 4UTJA 3MJYA 1XC6A 1TVLA 4O18A 1RJPA 4C6IA 1FHDA 1W9DM 4JX5A 1OFRA 4QHRA 5K4XA 2VUYA 3EDFA 5AVNA 1OCQA 3BXWA 5HWJA 1KTNA 2HCVA 1E0WA 3OTRA 2Q09A 3QQ0A 2BHZA 3HIJA 5H91A 5CGQA 4BKNA 2CLIA 3ARXA 1R3SA 4MGGA 3WFAA 1V3IA 4XZLX 3SUVA 1S46A 4WSJA 3A23A 4AC1X 4B4HA 1MQRA 1UHVA 1IR2A 1EUAA 2P1FA 2VR2A 3EWBX 3VIGA 2XHYA 2YFOA 4KW2A 4ZOAA 4AG0A 4DWSB 2WMHA 4IM4A 3WK2A 7ODCA 4MWAE 4I6VA 1K8YA 1V0MA 3BAKA 5EMLA 4IJRA 1YDNA 4OBTA 5I02A 4K1WA 3N2MA 3DXIA 2A3EA 4WY0A 2W63A 4PB5A 2XDFA 2G37A 3RHGA 3U4FA 4MY8A 3GY1A 3VM7A 2FVMA 3GDKA 1HKJA 2BGNE 4ENLA 4DJED 3GB6A 5B7YA 3VKKA 1OD8A 3MS8A 5JQ9A 1JDDA 1XIDA 1TB3A 4N7QA 3AJXA 3CL7A 4HIBA 3R11A 3BUVA 4IP4A 3AS2A 3KX6A 4QR6A 3MO7A 1J5SA 3SBFA 2VWSA 3LCFA 4PZVA 4LV9A 5K9DA 4JHZA 1SO6A 3B9AA 3T8QA 4LQ1A 1ZBKA 3BDKA 1XIGA 3S6OA 2EHHA 4X9SA 2QGHA 2Y7DA 4QFUA 1AH3A 3HGJA 1M7XA 1JDEA 3RUBL 4AY1A 3KWSA 3RK8A 4YJ5A 3JUGA 1R0MA 4JEJA 3LN3A 3LHVA 4XUYA 3THAA 1XWYA 1CGTA 1SW3A 1MW1A 3PP7A 4L7ZA 5H8UA 1Q7ZA 5CZSA 1RLCL 1QPRA 5GJPA 4LFYA 1A3HA 1IYXA 3G3MA 4PN2A 3I65A 2E0PA 3W70A 2MNRA 1ZFJA 3NURA 1FCBA 4KWSA 4AD1A 2FDSA 3CUJA 2D0GA 4AYGA 4WY0B 1HX0A 3NQ7A 2ZDSA 2OQLA 4AZ5A 2DW7A 3PTDA 1RK5A 2V8ZA 3CTTA 1XLJA 1JFHA 3DIPA 1HL9A 1AQMA 1BSIA 4ZO8A 2WC4A 1GOOA 2GL5A 4CKQA 4QTGA 2Z1WA 3AIRA 4HSNA 1IXOA 3PUGA 1OG6A 3CNYA 4PB4A 3VPLA 3V36A 1JZ7A 4IL0A 4MVAA 2WWCA 4AD5A 1E6PA 4QIUA 5LIWX 2P88A 4QJ5B 3NNTA 1VFMA 3OQEA 3H4GA 4UTKA 2RDUA 2DSWA 3KVLA 5I78A 3CV6A 2HISA 1NARA 2DORA 4JPGA 1XD1A 2ACRA 3H7VA 3ZQ9A 4RNJA 3AYVA 2I17A 1XRSA 1TPEA 4XO6A 2GGEA 1S5WA 1GUVA 1R5YA 2DQWA 4J3XA 1TWIA 2J7HA 3EWCA 1BKHA 5H2ZA 2PC4A 9RUBA 3ITCA 2C71A 3HM7A 3JVAA 1W5OA 2W79A 3SCSA 1W2PA 1WYIA 2PWUA 3VI2A 2PS2A 2OMAA 1EP2A 4EWND 4P7NA 1KCKA 3WQFA 2XIIA 4GX8A 4HYWA 2GDVA 3G1AA 4MKVA 1KBKA 3FHAA 4BZYA 3U2OA 2VXNA 4EWJA 1QOXA 3I4EA 2EPNA 3AMDA 3V4BA 1REQB 4GZIA 3A22A 3GVVA 3PTMA 4U10A 2IUZA 1QNOA 1E0UA 2VFHA 4PB3A 5K3VA 4GQQA 4KRUA 5DCEA 3BZGA 5AYIA 1E73M 4KEZA 1ONXA 2BVTA 3FK4A 1LF1A 3ALFA 5I24A 5BCAA 4QG6A 3PB0A 1H7WA 1AD4A 3IUIA 5XIAA 4QLJA 4CVUA 1LBLA 2YL5A 3DFTA 4MNMA 3LPGA 2PWGA 3RCYA 1IIGA 3M4HA 3P80A 3B8UA 2BVYA 3AHXA 4DF2A 1RVKA 1I2RA 2VHLA 3PC0A 3QPYA 2QIIA 4QCEA 2OZTA 4ZGYA 3FEQA 3VGBA 4C6NA 1DV7A 2VC9A 3GX9A 2VO5A 3SUSA 1X7FA 1CEOA 2FVKA 5AOUA 1CZ1A 3UXDA 3L65A 1CTNA 2FIQA 1I9CB 4OUEA 2QT3A 2MANA 5ECUA 1MSSA 3WJXA 3C0LA 3E6EA 4A22A 2V2CA 4DY1A 1D8CA 1QATA 2FPVA 2PEVA 5EMYA 4A6GA 3PFMA 3FXGA 3IPWA 4ZEPA 1PCKA 4MZ1A 2J7CA 1CNVA 1VRDA 2WPBA 3D0CA 2BDQA 4JFTA 3KTCA 4OKDA 1VQTA 5FJRA 4R7JA 4AXNA 1XCXA 3SQSA 4OBRA 2ON3A 3ZZ1A 2ZX5A 4BQ4A 4AIOA 2HE5A 2DPEA 2WZHA 1Q85A 1OT2A 1UZHA 3VDGA 1UWTA 4QRNA 3BWWA 2WLZA 3FX4A 2G3NA 4IICA 2WB5A 3VDBA 1TIWA 1KWGA 1FXQA 4Y9MA 1W32A 2R1PA 3RYSA 3O0FA 4TV6A 4HYRA 4UTTA 4UNKA 1FWCC 3HG5A 1SPQA 4XAPA 1DJNA 5MKGA 2OZ0A 1FQ0A 3MB9A 1KGWA 5JIPA 3TNOA 2A7NA 3QOKA 2G97A 4K7YA 2RGMA 3N1AA 3F4VA 1E0VA 5CBJA 3SQLA 2EAWA 1LL7A 1OC6A 4XD3A 2Y62A 3WLNA 5D4YA 2YDRA 4E38A 4B90A 5E0CA 4F0KA 4K1GA 2V2HA 4QITA 1KCXA 3DC0A 1Z42A 2YL8A 3N4EA 2WJZA 3GM8A 1ZENA 1H2JA 3HTWA 3OIXA 2FMNA 1VFFA 1VGAA 4LUTB 4A8RA 4TIMA 3DYMA 5BMWA 4IL2A 1QK2A 1GPWA 2VQUA 2EO7A 1SW0A 1GQKA 3WY1A 4BQ5A 5ABFA 2QDHA 1M03A 2B7NA 4M19A 2BV9A 3A24A 1H09A 1P0EA 1XYCA 3KM8A 3RO6A 2V5KA 3EMCA 2F6XA 3GUGA 1KKOA 3BMXA 2C79A 2E7FA 4PBEA 4PL1A 5T9BG 1ZBWA 2PWFA 3GG8A 2QEZA 3VIKA 4PULA 4ZOEA 2DSZA 3WLSA 4JTEA 4R85A 3NL2A 2E6YA 3STPA 3MZ2A 1L6GA 2YYUA 3OU8A 3UYIA 2DIEA 1KBLA 4LJ3A 3UYCA 2RDWA 1D7FA 1UZ1A 5FF3A 1W5PA 3WH5A 1T99A 4Z2JA 4LTSA 3ABRA 3PBGA 2J7DA 3W6YA 3W7NA 3QV9A 4DEFA 2IKJA 2YL9A 2FZMA 2W6RA 4GLEA 3WQGA 5KSWA 3T0TA 1OABA 2D0HA 1G4TA 2H90A 3KS5A 4D1IA 3SUUA 3H70A 4DAIA 1PJ9A 1NIUA 1AJZA 1FRBA 5JXQA 4RPPA 4FAMA 4L64A 2I16A 1IEQA 1J79A 4OJYA 3WBXA 1J93A 4BWLC 1K9DA 4ORIA 3CYJA 1OFBA 4JBRA 4AQLA 4X9YA 5CH9A 3EA3A 4W5ZA 4MFEA 1AG1O 1CW2A 4WJXA 2VFDA 3QMRA 1VBJA 5I77A 1EHNA 1PUDA 3O63A 3EZ4A 1F8MA 2FHCA 1ICQA 3V35A 5EFDA 2FZBA 1P6WA 1NSJA 4IGNA 3SB0A 4UTMA 3A6OA 3PY2A 3HN3A 4UQAA 5LXEA 3MHUA 3GNOA 1KKRA 4PTMA 1WAUA 1YADA 4HU0A 2ZVRA 3BPWA 4JNMA 3A4XA 4IPIA 4IGMA 1TX0A 3RJXA 3G18A 1EUNA 1RBLA 2Q8XA 3ANVA 4KMQA 1H63A 2BB0A 4JIQA 1PZ2A 2XSBA 4YTUA 3W87A 2YZ5A 5HUOA 4IQEA 3QRHA 2G8ZA 2A6NA 2XJ7A 1XRFA 1X1ZA 1WXYA 1S3TC 4XVEA 4JFUA 3A13A 3CM4A 4LNYA 4AISA 4B91A 5FEXA 3STCA 1X8CA 4GYPA 2EBNA 4MDOA 2G3MA 1EKOA 2Y5JA 1RPXA 2HS6A 1EX1A 1EO5A 2VUNA 3S2MA 3U48A 3EOSA 5HQEA 3VK5A 4QAIA 3KUMA 4I8DA 3PZIA 1UYQA 3BVJA 4D6CA 4A3UA 5E93A 1NU5A 2FFCA 3H24A 1I2QA 5M5DA 3G1FA 2JF6A 4GJIA 3DH7A 4HK7A 4O4WA 4PCFA 5C7VA 2ODOA 2VT0A 3KLLA 2QDGA 5T9CE 3VD3A 1UR4A 4LANA 3PWGA 4L1XA 2CCRA 2YBTA 2QDDA 1OQFA 2X0HA 3CO4A 2YB1A 1LORA 2RDTA 4GIYA 4GYKA 3BURA 2P10A 2CWNA 1OGSA 1GKQA 1Q45A 3RF9A 2B31A 2JKAA 1UA3A 5CG7A 4S2BA 2A1YA 3UZYA 3AMCA 3EKLA 3EKZA 5AVHA 1TFVA 4C60A 1GVFA 1UR0A 1W9XA 2WCSA 1E56A 1HO1A 2WNWA 2E6AA 2YXXA 2Y5EA 4GQBA 3W9ZA 2VELA 4UQEA 3ZO9A 1BYDA 5TQLA 2VEPA 1A5OC 3MP5A 4J27A 4JTHA 1ADDA 3BW2A 1UQYA 2GQAA 1NEYA 3MKCA 3V16A 1P5BA 1A5AA 4DYEA 4YTSA 4HPJA 3AI0A 3II1A 6CGTA 1DWHM 3P2VA 1EGZA 2HJPA 1Q4WA 4IF2A 2NT0A 1T5AA 4W7WA 1Q6RA 1VCGA 3LSBA 4JTKA 1HKIA 1EYEA 1XIFA 3EXTA 2DH3A 3W38A 2A3BA 4UZSA 3QZAA 4H9UA 3F5LA 3NFUA 4AWUA 3QKZA 5AHIA 3BCDA 3PWAA 3CZJA 1F9CA 4Q8VA 4IIGA 1GVSA 1WXJA 5B80A 4GO8A 3VU2A 1B3VA 1W56A 2ZC1A 1ISWA 2ISDA 3VZXA 3JZUA 2BVDA 2WOQA 2WJEA 3L23A 1XBYA 4HA4A 5TAOA 2Z29A 3R89A 1AQHA 3S9ZA 1C9DA 1ZU8A 2XSXA 1J18A 4WK9A 3EWZA 1RSCA 3GYCA 2CZFA 4K8GA 3TW9A 4QDPA 3K4DA 4ZR8A 1MW2A 1QI5A 5KEZA 1FWNA 4C6QA 3TTEA 1L8NA 3PULA 4J3UA 4NAEA 1XYAA 2NLIA 4IZGA 1JD9A 3NEHA 3AAMA 5FESA 3CZEA 5D09A 4UTWC 1C29A 4REQA 3IK2A 3NGJA 4J2PA 1A3WA 4IG2B 4W88A 2CLPA 3USBA 3FN9A 1JAKA 4JXCA 4ZZ9A 5ABEA 5D38A 1PEZA 2ZUTA 1DJGA 5CPOA 3I6EA 3VE9A 1E5NA 5HMFA 3RNDA 1JCYA 4BEUA 1M5WA 3LTSA 4UR9A 1JAEA 2QCDA 2VL4A 3PBMA 1L6YA 4GVFA 2HWGA 3TOYA 5IDZA 2CHRA 7TIMA 3TN5A 1V8EA 2BTMA 4RUBA 3U7BA 1QOQA 4WKHA 3OG2A 1QHPA 2GWGA 3BJTA 3W28A 1P1XA 1E6SM 6ENLA 1KBBA 3L12A 2XH7A 4CEXC 4GY0A 1KQYA 1JVNA 4Q7NA 4QP0A 2QJHA 3B8SA 1KLZA 3VO0A 3KEHA 3TJ4A 4LVGA 3SIZA 3ZWSA 3ANYA 1Y7VA 1KM6A 1SZEA 3N2OA 4XKYB 4QEHA 4KFNA 3ZYZA 3IAPA 1NVMA 3LLFA 1CIUA 3WNNA 3POCA 5E9XA 2PSNA 3T7VA 1CYGA 3BO9A 2Y8VA 3SCNA 3MUCA 3D3FA 1HVXA 1E6NA 2WC7A 5A8MA 3WMBA 1F6KA 1R2RA 5A6BA 2VI0A 1GOKA 3SO7A 2OU4A 1J0IA 1O1ZA 3I3DA 3N14A 3SGZA 3KRSA 3MHFA 3GVQA 3OO2A 4O1AA 1E6ZA 3LGEA 5C2GA 2ZRYA 1QBAA 4L4PA 1KRMA 3SI9A 5CG0A 4HA3A 2XG9A 4RK8A 3L4VA 4NHVA 1D7KA 5EPDA 5AC4A 3H8AA 3S6TA 1UUMA 4JIIX 4DUXA 4LAUA 1H11A 1XG3A 5HDRA 1XH2A 4WF7A 1V4YA 3BMWA 3GYEA 1HG3A 3WBWA 1TTPA 4I5RA 4EPEC 2DSVA 1XLMA 4QGCA 1VBRA 5CJMA 1NFBA 3O2LA 1OF8A 2PDBA 2OTDA 3IJ7A 3FNDA 1BG9A 1O7AA 1U30A 2WSPA 4F0LA 3C52A 5HQLA 2X1UA 3VNLA 1GYMA 4XKYA 5HNRA 3HGSA 4HJWA 1DPMA 3MA8A 1HNYA 2NT1A 4CNPA 3WF1A 4LBSA 2ESCA 5E6ZA 1J12A 3TWBA 3LA4A 1WQ5A 1VR6A 3QVQA 1KXQA 3W2UA 4ZB0A 1KCLA 1QWGA 2PU1A 3MJMA 4Q7BA 1V0NA 3AIQA 3MKKA 2A79A 3FKRA 1W37A 4FSAA 2YZRA 5FJPA 4Z42C 4JTCA 1YTEA 1YIXA 1JGIA 4UOZA 1OC5A 3DI0A 2XIJA 3QSTA 1EJSC 4PMJA 3CWNA 4GE8A 1LZOA 3L2MA 4KGLA 4DJDD 1AODA 5IOBA 2PGWA 3ARSA 4TVUA 4XKMA 1KFWA 1V3JA 2IPJA 3WX7A 4O16A 1E6XM 4C6FA 2V68A 3VYLA 2PDMA 3CASA 3DHPA 1H62A 4CQCA 3D6NA 1Q6EA 1JL8A 3DG7A 2FJUB 4ZTXA 4R9XA 1PTAA 3N2XA 5I2UA 3CC1A 5C9ZA 3AHZA 3WFZA 5CKSA 3RFAA 2YPIA 2AMGA 2QUNA 1KFLA 4C5ZA 3OBEA 4E0CA 4KWVA 2VEMA 4ORMA 3GZAA 3ZM8A 1TSIA 3R10A 3PPFA 3CMJA 3WYZA 3M5ZA 4FZIA 3LV5A 2RHGA 3LERA 1RQEA 3M16A 2OODA 2IKGA 2PODA 4MF4A 3YPIA 3K4WA 2X1RA 4K7VA 1R3RA 3VOIA 2J8GA 3KOWA 1J96A 1Z44A 3C56A 3LB0A 1JZ5A 3P3BA 4FF7A 1QNPA 4EXBA 1SFLA 1VENA 2F61A 4Y9AA 4R33A 3BQ5A 4DNHA 2Y7EA 3KZPA 1SR9A 4PRTA 3QLDA 4UB9A 3NPVA 2EPMX 2XFRA 4IIFA 1TRDA 1S5MA 4HMNA 4M56A 4DJEA 1SR0A 1TV2A 4UCFA 5DX7A 3G6LA 4UTTC 3B97A 4AZGA 2A21A 4L4LA 3OBKA 5CPQA 2CBVA 2NUYA 3PWIA 3TAOA 1G01A 2DUXA 2BXYA 4NZCA 1UZ4A 3BICA 3CT7A 4GK8A 4BHYA 2ABAA 1TWZA 2BOEX 3UJRA 1XLKA 3CUIA 2Z25A 1QCWA 3PNZA 2CU0A 2D69A 4LC8A 4FNQA 3GQYA 4AWEA 2DZTA 4JKMA 3B0PA 4AH7A 3UY7A 3LPFA 3OLGA 1SFSA 1ZNNA 1ONWA 4XSLA 4PGLA 4ADTA 2KAUC 5BU6A 4Z0JA 3KBJA 5EU9A 2GGJA 2CC0A 3CLMA 5IBXC 3LPOA 1MYRA 1PHQA 5AKQA 3I10A 2QQ6A 3BMVA 3H7RA 2A2IA 1PL9A 1GTHA 3EGJA 4RKAA 3TN4A 3E0LA 1TTQA 4XWUA 3PUDA 3GNRA 4QDMA 2Q3OA 4W7UA 4B2DA 3C2FA 5JH2A 4RV8A 3VZYA 4LAOA 3H12A 5C70A 3NXLA 3VFLA 3JS3A 1UOZA 1Q13A 3QV8A 1S1RA 2OR2A 2H6RA 1EA9C 1XLLA 3CPUA 3VCNA 3BANA 2J25A 1FWHC 1CLXA 1JF6A 4OT7A 1R9XA 1JUKA 3DI1A 1F07A 2ZRXA 4I9JA 3WDJA 1H5VA 4Z1DA 1EDGA 2ZXAA 2GJLA 1S2TA 3LCIA 3TEVA 2Q02A 5KITA 2Z6IA 3LG3A 2HVMA 4E2BA 2BY0A 1KFKA 2Y89A 5I23A 1EC7A 3S2LA 3ONCA 4AX6A 2R91A 5AYYA 1QPKA 1JZ3A 1DL3A 4UCGA 4BA0A 3F2CA 5BXSA 2X41A 1XQLA 2OWCA 1J9YA 2CKSA 5BU9A 4LRTA 1FY6A 3EA1A 1MXGA 3BLPX 1EP3A 5D2YA 4MLJA 2O7SA 2NXGA 4WX2A 3HU7A 1YDOA 2WVVA 2XIMA 5ENLA 3WEMA 2PZ0A 1VFTA 1PZ3A 3LCWA 3S5YA 4IPNB 2X7WA 1GQNA 1OFDA 2DZSA 1JQXA 1IZCA 3E49A 2E09A 2IXVA 3WD4A 2V3EA 1B4KA 3MI3A 1FWSA 1OM0A 2V38A 4DJFD 4P61A 4ZXLA 3PB2A 3WL0A 5BXPA 1UWUA 1XBXA 5LA0A 5L9FA 4D9PA 1JYXA 3UZWA 2PTYA 4YHGA 5A8NA 3E0VA 3ZJ8A 3TYBA 2VX4A 2ZZ6A 2GPTA 3M0IA 5A6KA 4GJ1A 4RL3A 1WNOA 3P61A 4H2CA 1B54A 8RUCA 4PMRA 4UQ9A 2Y7FA 5EGRA 1AH0A 2YYTA 3FSTA 1ICSA 1XLHA 1GOIA 5KZ6A 3WKZA 4PRWA 4RNFA 3Q67A 4PSRA 4HA1A 3B4UA 2WJFA 1JPMA 4JTTA 3DHFA 4LCRA 3RLGA 5DT5A 4MIMA 1N2VA 5FL0A 1IEVA 2OZ3A 1OZMA 3WLKX 1EOMA 3ARQA 4LOCA 3W6LA 2W5FA 4JX6A 4LAKA 3RCNA 1HP4A 2CBJA 4H6RA 1KM3A 4GGBA 2QUVA 4NZFA 2C18A 1P1MA 1B9BA 4HD5A 4U5IA 3WF0A 2BX7A 4FLQA 3T4CA 4UQBA 1DIDA 5G1TA 1ZSXA 1VCVA 4TR9A 2PUZA 4IIHA 3I3BA 4YVXA 1LCOA 4F2UA 5D04C 1ONRA 3F4CA 3RMEA 3CZGA 3NQ6A 4AYSA 4N9BA 3S83A 2QJNA 2FZNA 3WFLA 3GS6A 1I0BA 3QM3A 5G1MA 2Y85A 2E77A 3SCQA 1R9ZA 4MB5A 3ENLA 3WNKA 4EF8A 2VOMA 1RY8A 1X1OA 1R3WA 2DZAA 4GRSA 4NAFB 4UOJA 2OJPA 4R27A 3QR3A 2V5LA 4JTSA 2C15A 5F2LA 4OECA 4CQBA 2OSXA 1EEPA 3MVIA 2R1MA 1LP6A 3MDWA 3UZ5A 3D46A 2W62A 3GSMA 3NQBA 5LKYA 1QPOA 4O1CA 4FX6M 1X6LA 2HPMA 1YPXA 4AXKA 4HCLA 1X1NA 2OX1A 5A94A 4GKTA 3HGRA 1JFXA 2HXUA 4JFSA 3I3EA 1PWMA 4NAEB 1UW9A 3A9BA 2P0OA 4PRRA 2G41A 5AHMA 3S3GA 3E0FA 3R0KA 4GI8A 1TTJA 1AVAA 4Z2LA 1DWIM 4JNZA 3O3RA 1LBFA 2NQHA 4E5TA 1BFNA 3ABOA 7CGTA 5FIPA 2F7FA 3B06A 3O06A 4CNTA 1GW1A 5TNVA 3AU2A 4DXVA 4C6CA 3DG6A 2VDHA 4IMCA 1DORA 1Q6DA 4HHMA 4TOQA 1W3LA 2H3DA 2QNEA 3SR7A 4AMAA 2NX9A 2O0TA 2EF9A 4GABA 1E3ZA 4IJBA 4DF0A 1R3VA 3RR4A 2NQLA 1CECA 4Q8WA 1OFOA 5H8MA 1RP8A 1SZRA 2X1IA 4MYXA 3VOGA 3SQMA 3QFEA 4GX9A 3MO4A 2UY3A 2FTPA 4TU1A 3UD6A 2XIOA 3K2GA 1Z89A 2DVTA 4CU8A 3KL3A 4LY4A 2ZOXA 5SWUA 3WUBA 4DWSA 1PKNA 4ZE5A 3TONA 5C54A 1T8XA 2VCCA 4JY8A 5REQB 4G2DA 1MQQA 4LYPA 1SQ7A 3G0UA 3F4DA 4FXRA 5HINA 1J6PA 4HQVA 3L5AA 3WBAA 3EDJA 3OIHA 1SZFA 5A6LA 2ZTKA 5AN7A 5A69A 4MB3A 2POTA 3OPSA 2D22A 3W53A 1Q7MA 2E1DA 3REQA 3NOEA 4LUSB 2E3ZA 4GI6A 2W92A 3DENA 3NDZA 4PH6A 1W3TA 4O50A 2B0MA 1NJJA 5DRCA 3CZLA 2PU0A 4O28A 1QXLA 3PFRA 3L4UA 4RE0A 4QSHA 3L4TA 3AO0A 1V93A 2YIHA 3VIFA 3PM6A 4HNTA 3ITOA 1UCWA 1W3IA 1EBGA 1W9BM 2G3FA 3HZ3A 3A47A 1PCWA 3TV8A 1KC7A 1QPQA 1YDVA 3CYVA 5LIKX 1DTUA 1S5TA 4AVOA 4PUKA 3NOYA 4N42A 3S47A 3S5ZA 1CXFA 1U5HA 3I6RA 1JF5A 3TZFA 4CD6A 4JN7A 4M51A 1CXEA 2VX6A 2ZVIA 5FCZA 4DO7A 2R24A 1R2TA 4MNJA 3KBVA 4NUWA 5G4WA 1TUXA 1XRTA 4B5XA 3ZT5A 1LJYA 1UMYA 6ALDA 1JPKA 2QCDB 2UY5A 1Q66A 1EO7A 1SJBA 5IFTA 2W91A 5A6AA 4KF1A 2GJXB 2H8ZA 5AYZA 3T2QA 2XGZA 5E0KA 5AC5A 4E4UA 1ZJBA 4QCFA 3R4IA 1X8FA 4U3AA 5CAKA 4HGXA 1JI2A 2DT2A 1QTWA 2QVHA 3PSWA 3FA5A 5BXTA 2XTKA 3G8RA 4MAVA 3WQ5A 1XIMA 3HPFA 3E0WA 1ZLPA 2GJRA 3VNKA 4GNVA 1AUSL 3A9IA 4R5EA 4BEQA 1MDLA 1ZP4A 4O8RA 1FA2A 1YE6A 4OBSA 5BROA 2V0TA 4KIRA 5DXYA 4FMVA 3DAQA 2RKXA 4PSPA 3THCA 3V5CA 4G1KA 3A4AA 2GUYA 2QLYA 4WKFA 2QF8A 2ISSA 1J2WA 5BRBA 1GZ1A 1OGGA 2QJJA 1Q4NX 1VAHA 2Y61A 3Q45A 2OT0A 2GGHA 3LBMA 1WDRA 3S9YA 4JIPA 2XIQA 3HOJA 2A3CA 2GK1B 4JOMA 3R7MA 5HWMA 4W86A 1ITQA 5ABTA 2VDIA 6XIAA 4S1FA 3H2NA 2A4AA 4FNUA 1YXCA 2DW6A 1D3HA 3CMGA 4KGJA 3UR2A 2DH2A 2VEGA 1MEIA 2X16A 4NJKA 1KA9F 4YLWA 2DZVA 3UG8A 3ZFHA 1JGMA 3AROA 1V02A 3I4KA 2BGSA 3SSZA 3BAYA 3RG6A 4W84A 1W5QA 1FDYA 1PX4A 4BI5A 3HB9A 1Z7AA 1LG1A 1M6JA 3W7GA 2BOGX 2VFIA 1KV5A 5CXPA 3GTIA 3GG1A 1EPXA 1G9HA 1AD1A 2ZRZA 1W31A 4H41A 5TD4A 1UR9A 2ALRA 5IFPA 4DELA 2DT0A 2F2KA 2ZIDA 2NX3A 3VIJA 3BCJA 5CQ1A 3E0IA 2J88A 4ZB2A 3VGFA 4MNLA 2YSWA 1UKPA 4GYFA 1G7UA 2YBVA 4ZSUA 2CWXA 4ROQA 4IFRA 2EG6A 1TV5A 4U33A 5HA7A 2P8BA 3APYA 3AWNA 1TKKA 3H6OA 3SIMA 3O16A 4H9ZA 3W02A 3NXFA 3W7OA 1B0IA 1CXHA 3UZZA 1LOQA 2F9RA 3KBSA 4JTAA 3TWAA 1K70A 1O68A 4DZ5A 2QW5A 1KCZA 1TTIA 3KVMA 4M80A 1X98A 4L56A 1B3YA 1KM1A 4I7UA 2X40A 3VX0A 4M6PA 2QGYA 1ZJIA 2ZA3A 1U1HA 1W9VA 5LXXA 1O60A 2VFGA 1H60A 4DBSA 3EB2A 5MKGB 3OJGA 4EPBC 3QMTA 3HMJG 4H8VA 4BF5A 3BLOA 3AIBA 1JZ2A 4U28A 1RJQA 2BHUA 4IIBA 3ICJA 1WP6A 1QRQA 4W87A 1K03A 5I6SA 1EWEA 2YDQA 3CIVA 5HPOA 2SFPA 1H61A 3SDOA 1CGVA 4Z2KA 3VGHA 4E8GA 1RZMA 5FACA 1I1XA 1W5MA 2YJQA 2PRHA 3B0VC 3TXVA 1GW9A 1S2UA 4MMWA 1OG0A 2YGYA 3F4NA 4N9CA 4L6OA 1NF7A 5LIUX 5C55A 4WDTA 4P7RA 1PAMA 3AWOA 3OZPA 2REQA 5LHFA 5GNZA 3R79A 3D5HA 4US6A 2FMOA 1FWIC 1X96A 2AQOA 3L67A 2AMXA 5D37A 3LM7A 3UA4A 2GQ9A 6A3HA 3L66A 3IIVA 4QLLA 2QCHA 1DQXA 4WXYA 5CBBA 4IG2A 4EP8C 2NV1A 1E6QM 4QXIA 4CGTA 1MXSA 1DWFM 4E8CA 2G95A 3APGA 1OCNA 3IIZA 2PCEA 4KT2A 1UH2A 2WAGA 4Q4PA 3KOYA 1WDWA 1TUFA 2J7FA 1A5SA 2D2GA 1TR9A 5DQPA 5HJLA 3U6WA 1V6XA 1CPUA 3MT1A 4INFA 1PX8A 1UA7A 1W91A 1M53A 4NNAA 4W89A 1N55A 1A4LA 3U3HA 4BJHA 4BF7A 4HNLA 1PKMA 5C2CA 4Z17A 3WDIA 4ZCWA 4W93A 3LEPA 2GVJA 4XZNX 3A5FA 1E55A 3HQOA 3GO2A 3SJNA 4NIRA 4L1WA 4Q8PA 1EA0A 3WLLA 5FEZA 3I68A 3LYEA 1FWWA 1T7LA 8TIMA 2DT3A 3CQKA 2FTWA 1XLGA 2BHYA 2D0FA 5D8WA 2OXNA 4UBPC 5AZ1A 2XH0A 3NSXA 4C7FA 4NILA 1DXIA 5AHEA 2ZKMX 5E1QA 1RPKA 3W1PA 3H54A 2J62A 4Q4OA 4P8WA 3VKCA 4EXQA 4C5YA 2YLLA 4JX4A 1VFUA 3CLWA 4RZ6A 4F9DA 2H3BA 3DGBA 1DJYA 2TODA 2ZUMA 3PJUA 4A2SA 3P62A 2OFJA 3CK5A 1RXOB 2HEJA 3W7CA 2PF0A 1DJZA 4AUBA 2XH2A 3L21A 1F61A 4O4VA 1M7OA 3SCWA 4AZ6A 3GU2A 6TAAA 1VHCA 1EC8A 1QMLA 2QJGA 3GNXA 2WXDM 7XIMA 1S2AA 5FJUA 4N9DA 4WCJA 3S2CA 1NWTA 3NQ8A 1X38A 2YR1A 3BOLA 4W5UA 1SO5A 1UWAA 3EAUA 3FHQA 1HGYA 4L5ZA 1EQPA 2PRLA 3SGGA 3GG7A 3WN6A 4IPLA 2BNJA 4XAYA 2BGQA 1O1HA 3QGAC 1VZWA 1QHZA 1AL7A 4FR1A 3UXAA 3VNDA 3HJZA 1BTCA 2PBGA 4GO9A 4PMVA 1AMYA 5CGTA 2QAFA 1XGZA 1OADA 5FJOA 4JTDA 5IM51 4O12A 4QLKA 3WEZA 2FFIA 1WUFA 4ZA0A 1IWAA 2WCGA 5BYWA 5BXRA 5C9RA 3KHJA 1VD6A 1CENA 3PZQA 4Y90A 4ACZA 2QR6A 2D2OA 4NJIA 1TQJA 3MYOA 1K77A 2ZRVA 4WDWA 1SFJA 1ML1A 2XM1A 1EFZA 4JD4A 3KHDA 2CERA 1ECEA 2R14A 3BCFA 3TK7A 2ZZ4A 2WVTA 4CUCA 1M65A 3GR8A 3N04A 1VH7A 5HMEA 4HN4A 4XZIA 3FV9A 4O0QA 3IJ9A 3M43A 4YTRA 2XFYA 2I1OA 5I3GA 3PG8A 1FP9A 2A7RA 2C8NA 4F2BA 2Y7GA 3N2TA 2E28A 1GG0A 3E2RA 2EPOA 1Q6OA 4LS1A 3N13A 1XLIA 1OD0A 4E6MA 5HOSA 3VCCA 1F6PA 2GWNA 4A3QA 3DN5A 1AZ1A 3JRKA 1TYGA 3ITXA 2J8FA 1P6CA 1B30A 1AFSA 4Z2HA 1JPHA 2KZHA 2AKZA 1GKPA 5DFAA 4EIVA 5A1AA 4GFIA 4O13A 4E2DA 4D6IA 2ZBTA 4LYKA 3BG3A 1CCWB 2VWTA 3FVDA 2VOTA 2IS7A 2O4MA 3HURA 2XZ7A 3GIQA 4CNUA 4C6PA 1A5UA 4FPSA 3M0JA 1O6IA 2PE4A 2ACUA 5DMNA 2CHNA 2V5JA 3NDYA 3EMQA 3BLFA 4ADUA 1YTDA 3AZTA 1VJIA 3IV8A 2VC6A 3K1DA 1K6WA 3QC0A 3T8LA 4A21A 1QNRA 1K8ZA 4NU7A 1HN1A 1TVPA 3W83A 4MYAA 1ESWA 4NKCA 1GJUA 4RZBA 3FW6A 1F3TA 2O9RA 4C6DA 2XWEA 3U2ZA 3CGTA 3PZGA 2BMBA 2ISVA 4KEUA 4NVTA 5KZDA 4LYQA 3KP0A 2RFGA 4K8EA 4PMQA 4YYCA 1EIXA 3R8GA 3EDDA 3UGVA 2VFFA 4CLMA 2WZTA 4MJZA 5I0DA 3AS0A 1HUVA 4XIAA 3LENA 1XUZA 3C5QA 1BSLA 4Y6GA 4DJFA 4FS9A 5EMJA 4L9ZA 1EDTA 3WMLA 4KH2A 3TQPA 1BEUA 3SGUA 3S4TA 3GHTA 1OCBA 2YW4A 4FP1A 2A6LA 4TXEA 1W9UA 3UCDA 1PIIA 3O6AA 2D23A 3HV9A 1QBBA 4LYRA 3N6JA 2HNHA 1H7OA 3A12A 4WD0A 3USZA 2QS8A 2WKJA 1E4IA 4LV4A 3SCRA 1LBMA 3RPTA 2P8CA 1PTDA 4ZBCA 2VEFA 3DECA 2GVYA 1EGMA 1HVQA 2PDJA 1YNQA 5LIYX 5DCDA 1K6AA 3VUPA 4R34A 5FAJA 1IT0A 3C3UA 1CXKA 4L80A 3EWYA 2NVAA 3E9AA 5CZTA 1YLVA 3QTGA 3CUFA 2RUSA 2F38A 4F2TA 1M9HA 3N34A 1SSGA 4JEQA 4Z0SA 1KRBC 5C71A 1FWRA 3FSUA 4ATWA 1TJRA 1KTCA 2YA0A 1UKOA 2QUMA 3ZWTA 4OVXA 2J8TA 2BG5A 4PA8A 2UV8G 1OINA 1BVZA 4D1JA 3FYOA 6XIMA 3WF3A 1JD7A 3WMSA 3TR2A 1PS9A 3C2OA 1LTDA 1M7PA 4AB4A 3EX2A 2OELA 4M7TA 2R9RA 3M9YA 3TTSA 2XISA 4DZHA 4M7SA 4A3RA 1PYMA 4JL2A 4E8DA 2WMIB 3T4WA 2GUUA 3AC0A 2E1WA 5EKYA 4Q6XA 1B9ZA 1VLWA 3G1XA 1ELSA 1BQCA 1J01A 4LCSA 3TCSA 2O92A 4IIEA 4KKXA 4ZFCA 2Z1SA 3ERPA 1VBHA 1XFBA 4UUIA 1U1JA 2JQXA 1NQKA 1O5QA 3B8DA 3CQ0A 2UY4A 1J4EA 4OE7A 4NASA 1EOKA 4DYKA 4XBJA 2D3LA 3GXIA 2X1SA 3VKAA 2X1TA 3DFNA 3NL5A 1DYSA 4QBXA 4JTLA 2CZEA 4HK6A 1A47A 4PMNA 2WKLA 3B3DA 1S5NA 1QNVA 1GWJA 3PZTA 3UW6A 1QOPA 3G0SA 4H19A 2Z26A 1DJXA 4KWOA 3W29A 3WUFA 1QT1A 2BXZA 3WEOA 1R38A 1DIOA 5AB3A 3IK4A 1XH0A 1PDYA 4GC3A 3SUWA 4LUJA 1SSDA 3ECQA 4NZ4A 5A2AA 2TYSA 2DJXA 3W01A 3HFYA 4IQJA 3S1WA 3C61A 1XL9A 4HNOA 4IGSA 2TRSA 3GNPA 2XGIA 3DHDA 4PCSA 4WKAA 3V0UA 1RD5A 1PO9A 3EDKA 2VENA 4N0RA 3S5OA 1R85A 3QFWA 1A0CA 1TPB1 1E70M 2XVLA 3OG3A 3CHCA 2PDKA 2B81A 3IIOA 1XS2A 4UTIA 2IW0A 3K30A 4MWAA 3UZXA 1UUQA 5LNSA 2C6QA 3R0DA 4BQ2A 2JBMA 4OQVA 1KR0A 5J5RA 2WMIA 3W4RA 4GIRA 3OYZA 5U7SA 1AQFA 3W2JA 3L68A 2EJAA 3T1GA 4HMDA 3VKBA 2BY1A 1XBVA 2C3ZA 2PA6A 1MZHA 3Q37A 5HR7A 4FA3A 3QHNA 4LPCA 2GDQA 3IGHX 3N11A 1RA5A 1GJPA 3QTPA 1RV8A 5CPTA 3KRZA 2B4GA 1C8YA 4A2RA 4A29A 1E40A 5DMMA 5CPSA 1LQ2A 3G6MA 4MADA 2Y88A 4K68A 2WWDA 3VD9A 3FAWA 1LLZA 2FDMA 4R9OA 1RCOB 2A3HA 3W25A 1H1ZA 4TO8A 4I5XA 1TJ0A 5LNWA 5DXXA 3L4WA 3TYEA 2VURA 3NGFA 1UD5A 1E4NA 3M5VA 1HJXA 3PJXA 1JR1A 3L5LA 2VYOA 1MW3A 3ARVA 5HBFA 4D72A 2CITA 3WDRA 1MEWA 4J3SA 2HBVA 4AEOA 3VINA 4KETA 3K8KA 3MTWA 3CAQA 3WCZA 3KW3A 1A5MC 1QW7A 1POJA 4ZQNA 4LW7A 1QW8A 3POHA 4XSMA 5CJ5A 4G7EA 1YYAA 3SCPA 1VRXA 1WO2A 1JRBA 3GR7A 6REQB 3CXOA 3TFCA 3URAA 1V3KA 5FJJA 3A3HA 1XG4A 3U4AA 4MKNA 3GAKA 1HJVA 4UTWA 1THFD 5HATA 3DDMA 3PPCA 2YXGA 1UC5A 4RZ4A 3NQGA 4KWWA 3MU7A 2IQ0A 3VOJA 1NTHA 5I5RA 1IEXA 3LM3A 2POZA 1YXYA 2XVNA 2Z00A 5I3JA 1SFTA 1W5NA 4B4FA 2A3LA 2WPGA 1KFBA 4WHBA 1SGJA 1JXKA 4DPQA 1IF2A 1A5NC 3UWVA 3WF2A 5FI8A 5HNTA 4G6CA 3M7WA 2JKEA 3A4WA 3UZJA 3HGOA 2FHFA 1JCLA 3QBUA 3FLUA 2WVUA 1LT8A 3PN8A 4WGHA 4AMCA 4FOJA 1BWKA 1VFHA 3M5XA 2DEPA 3TNBA 3FS2A 2ZC8A 3VTRA 4V27A 1ZJHA 3MUIA 4MHBA 3QHOA 3ATYA 3B9NA 4MDPA 4YHEA 4V33A 4FNTA 4H83A 3VMPA 3GC2A 3GTNA 3W1NA 2C91A 4ERIA 4TVCA 1SW7A 3CT2A 3R13A 4B92A 3MY9A 3DFHA 2VCAA 4EPKA 4QE5A 3L2IA 1TZ7A 5J8LA 1NOUA 3WLIA 5HQMA 2WK2A 4REQB 5I06A 3T09A 4GY1A 1E4MM 3C2EA 1FDJA 1XLDA 1V3HA 1FCUA 4HNCA 3JR2A 3GVWA 1TG7A 1RP9A 5CSYA 3H22A 4ZQPA 2YCJA 4EAYA 3W1AA 3TTQA 2VFEA 3UJSA 3LNMA 3WQ8A 2FGLA 1XDLA 2J79A 1ZTVA 2NUWA 4DO5A 4JN6A 3QV7A 1FFQA 2RJGA 2E4TA 4CVWA 4S3CA 2BASA 3WK1A 1ITXA 4W8BA 1VJSA 2PLKA 2WMKA 2Y2WA 3TYCA 2EG8A 2HE8A 1ISZA 3G1VA 4GQRA 4Y8EA 4D8LA 3QR1A 3SADA 3OZYA 1JYVA 1L0PA 1JIBA 4M3PA 5A2BA 4MPKA 1X6UA 5M03A 2I56A 3TW6A 1Z48A 4P7LA 4TQTA 3T07A 4AX7A 4O8AA 5E9AA 5JVLA 1WX0A 4FNPA 3LY0A 1SUXA 4UTFA 1ISVA 4Z1YA 4K39A 3OA3A 4J35A 1KM5A 1DJHA 4XO7A 4GCAA 3CIWA 3T78A 1WA3A 1KM0A 2DFAA 1P48A 1OIMA 1JDFA 5I09A 2E9BA 3VMNA 2OT1A 1BTMA 3PZ9A 2BY3A 3P67A 1DP0A 4KS0A 2WNQA 4GPNA 3W74A 3AUOA 1OK6A 5A6BD 3GKAA 3QC3A 3R5EA 3BOFA 1BD0A 4S23A 5LSMA 1TMHA 5CSRA 1F7BA 1YNYA 1J10A 4C91A 4LBRA 3L5MA 3UPWA 4H04A 1E1EA 1UWSA 3R6IA 4GJJA 1QNQA 3TKFA 5LZLA 1IWBA 2BOFX 3AS1A 4S2CA 2B7PA 2WQPA 3WLTA 3W1TA 1HL2A 3ARWA 4J3TA 3DGRA 1TR1A 3QY8A 4Q22A 3WENA 4JR5A 2Q8LA 1J0HA 5LGXA 2Z7KA 4WR3A 3IIPA 2EKGA 1LL6A 1V6YA 2YLAA 2YX0A 5BW6A 3TYDA 3TSDA 2W61A 1ECQA 5JH1A 3UVAA 2OOFA 3DFPA 4ZL1A 4KWUA 2NUXA 4AZ7A 2E5CA 3MDUA 3VABA 3HPZA 1GOXA 1VS1A 2OO6A 2XN0A 2VX5A 4DM2A 2C0AA 3ZT6A 4BFAA 1US3A 5HWNA 4O1FA 4PUDA 3TIMA 2CETA 1FH9A 4JTUA 3VOHA 4RDVA 3SUTA 3OYXA 1UASA 3E74A 3WF4A 1H49A 1V6WA 2OWWA 1Q6QA 3G0XA 3J7HA 2FH8A 1DIEA 4LVAA 3C8NA 3IJ6A 3XIMA 1WZMA 1WZKA 4BR1A 3WQCA 4LB4A 3RRAA 4PBFA 1XLCA 3WH7A 4G56A 3VMOA 1R8LA 5CLWA 3VIHA 2WHKA 3WH9A 1JYWA 2OVLA 3NUKA 3LQLA 4CNNA 2YBUA 4GZ7A 3O1NA 2VGBA 1Y8BA 1BF6A 4C1KA 3UNDA 4LVBA 2JF7A 2WLYA 3PPHA 2GGIA 1R2SA 2Z1XA 5AHLA 4JHMA 4X22A 2PGEA 4PTDA 4C6JA 1MDRA 4I9MA 4HTYA 3N19B 3GNNA 4DX3A 3G1SA 2P0IA 1W9PA 3NPUA 1DJWA 1D8WA 3E1F1 2ZZ5A 3M41A 3KTXA 4ONVA 3UJFA 5LIXX 3GFXA 1IT8A 4V15A 2QKFA 3R25A 1QK0A 4DBWA 3W7MA 1ZHAA 3UCCA 2OB3A 3WDHA 5LNVA 5RUBA 6PTDA 1Y65A 2J66A 2WO5A 4GYJA 1B3WA 2DUAA 2PDFA 3T0AA 1JCJA 3RCMA 5I7GA 3AYSA 3EB3A 3VX1A 4I7VA