1QK2A

Wild type cel6a with a non-hydrolysable cellotetraose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
363
structure length
363
Chain Sequence
b'TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
molecule tags Hydrolase
source organism Trichoderma reesei
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
total genus 137
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qk2A00
1OCNA 2BVWA 1UOZA 1OC5A 1OC7A 3A64A 1UP3A 1BVWA 1HGYA 4AX6A 2BODX 3VOFA 2BOGX 4B4FA 1GZ1A 1UP2A 1HGWA 4I5RA 3VOJA 1QK0A 3RU8X 3RPTA 4AVOA 1OCBA 1CB2A 4AU0A 3VOGA 1OC6A 2BOFX 3VOHA 4A05A 1QJWA 3A9BA 4B4HA 1OCJA 4I5UA 4AX7A 1DYSA 1TMLA 1UP0A 3ABXA 2BOEX 3VOIA 4AVNA 1QK2A
chains in the Genus database with same CATH superfamily
3B8TA 3M47A 4ADSA 5HQEA 1RQBA 3DG3A 1TV7A 3LU2A 3QN3A 1CDGA 2D20A 3R0UA 1EYWA 3WQOA 2QDEA 1F76A 1R46A 3PVFA 1JCTA 2Y0FA 4QE4A 3MTWA 3U57A 3A5VA 1HZYA 5CXPA 2DZTA 3LHWA 1XW8A 3BMXA 2BVTA 2RAGA 1Z69A 4YMZA 4JL2A 1A3HA 3NQGA 1W3LA 1AH4A 5A2AA 2IS7A 2PC4A 5G1MA 4IZGA 4GY7A 1FH7A 4ICCX 3IWPA 5CPNA 4F0KA 4FP1A 1FHVA 4AU0A 4X22A 4HZ6A 3URAA 1AG1O 5E70A 5M2FX 4NRRA 1JF6A 1EA0A 3UESA 3P0XA 1OC7A 3RXZA 3PZIA 2BVDA 3RF9A 2W67A 1LLWA 1F3EA 4PUJA 4LS1A 3WNNA 2EKGA 3L7RA 3DESA 1R3RA 1H7NA 1AJ0A 4IPNB 1GKRA 3B8IA 5A2BA 1BG4A 1NWSA 4RUBA 3WF1A 2XVKA 1OWQA 1NFGA 3N1AA 1RK5A 2WZIA 3Q67A 3KCOA 1QJWA 5IFPA 3SW6A 3UXLA 2DPEA 5XIMA 4NT0A 3W25A 4Y7EA 3VCCA 4EPEC 2CC0A 3GKFA 2J7DA 1XRSA 2Q3OA 3GXMA 4S3DA 1DWFM 1BPLB 1VFTA 1UA7A 4GX8A 2C14A 1HQTA 2PEVA 2QPUA 4A22A 4IIFA 2WVSA 5HDRA 1Q3NA 1XR2A 4JN7A 3IJ7A 3RAOA 1QI3A 4DBSA 3VC5A 2PC8A 5I79A 4FIQA 1UBSA 4TX8A 4Q4RA 4BF5A 4MY1A 5HPCA 1T8QA 3LHUA 2IQ0A 3W83A 3PAJA 3C61A 3SRFA 2ZDSA 1JPHA 4C6OA 2BTMA 3O9NA 2UZ9A 4R3UA 1QK0A 4IPIA 2Z4GA 1XYMA 1OF8A 1TO3A 4DM2A 3W24A 2C79A 3TA6A 4GISA 1J5TA 2EO7A 1QRQA 2GQAA 3DBPA 3ZLFA 2D0HA 3GR4A 3T0BA 2Q8ZA 3TJIA 4D6FA 2Y61A 1W1ZA 4MJ4A 2ZUUA 3CIXA 4DWSA 3TP4A 2GYIA 2G3JA 3LTPA 1EC8A 1MXGA 4GI9A 3P8IA 5D9MA 3UJSA 1CXKA 4HHHA 1E72M 2ATSA 2V3FA 3QSRA 4CN4A 4K39A 1R9YA 3KL0A 4JTDA 4NAFA 1L2QA 1GVQA 3U2EA 1YADA 3EXRA 3K8KA 3PUEA 4FXRA 4O4VA 1EC7A 3NQVA 3R25A 3A47A 3IUIA 2DZBA 5DY2A 4Y2WA 1P7TB 3A12A 3RFAA 3TZFA 4Z1YA 3SN0A 3VKDA 3M5VA 3AMLA 1ZAHA 4Z2KA 1P6WA 1LZOA 3WELA 3N14A 5H8UA 1UUQA 1PO9A 4RE2A 5H8PA 3TCEA 3CQ0A 3TN3A 2O7QA 3P84A 3QGAC 4JTGA 1I0BA 3KCJA 4LJ3A 2JGQA 4E8CA 3GH5A 1P6CA 3GFZA 4IJCA 3C2OA 1C9DA 1FKWA 1VJZA 3WF4A 4C60A 4AHQA 4PL1A 1M9HA 4V1YA 1H0IA 3KW3A 4JDYA 2FMOA 1IGWA 2QVNA 4FNTA 1XG4A 3WL0A 1BWLA 5FF0A 1FXPA 3L12A 1XBZA 1HKWA 4DZIA 1MUWA 1O1HA 1XLBA 4GCXA 3USBA 4BY3A 3N2OA 1S2UA 4MFDA 5C2XA 1YNPA 4TMCA 1U5JA 5CPTA 1VC4A 4MWAD 4NJHA 4EXQA 1GZ1A 1TCDA 2C19A 3MCMA 3VM5A 2HK0A 3OIXA 3SADA 2W0UA 2DZXA 4PMUA 1DJXA 4ROQA 3PSWA 4GO9A 1VAHA 4W7UA 3LV6A 4O13A 5E6YA 2DQXA 2OU4A 1XYAA 4GNKB 4OIFA 1PS9A 3W38A 3T9PA 4ZEPA 1P0NA 1U5HA 1MNSA 3DYPA 3SFWA 2XSBA 4Q4QA 1LF1A 4O0KA 3S8HA 1H1NA 4IH3A 4D6CA 3O3RA 2J7GA 1W1VA 4JYEA 1H0GA 1TWWA 2ZADA 3OODA 5HUPA 2BXYA 1PWLA 1KC7A 3GR8A 1S5WA 4LUTB 2XVNA 2PGEA 2V6AA 5CBJA 4O1EA 1PPIA 4UTKA 2R91A 3PPFA 1KA9F 3CPRA 3SY5A 2FGLA 4NY2A 1JR1A 2E8ZA 2PS2A 2WMIB 4ZO7A 3UZWA 5IHRA 1J0IA 5T26A 3BPWA 2WNWA 1UD2A 4OU1A 1IR2A 2F6KA 1KGXA 3WLTA 3MA8A 1G9HA 1EQCA 5LA0A 1KFCA 4EP8C 2DW7A 1LOLA 4Y9OA 4NP7A 2DGAA 3CMGA 4GQ0A 4H4IA 4DB7A 1N2VA 5CKSA 1YW1A 3W7PA 2YR1A 1VPQA 1B1YA 1RBLA 3BOXA 3KP1A 4JN6A 1GEQA 1O95A 1ESWA 4WDTA 4QGCA 4Z0JA 1Q6FA 4IISA 1J4EA 3V16A 3E2RA 3P67A 3STCA 5KINA 4H6KA 1W1A1 3COTA 1Q13A 1VHCA 3H4XA 1D3HA 1TPFA 3UXIA 2JBMA 3LRLA 4ERGA 5I3IA 3CHDA 2OYMA 3MZNA 3E5BA 4FXSA 4EPDC 5D4YA 4HU0A 4CN6A 2CZFA 3CXOA 3VGFA 4TUFA 3BLEA 2MANA 3L5AA 2ESCA 5LIUX 1L6WA 2PBOA 3PBGA 3ZJ8A 2E5CA 1H7WA 5F4WA 1FDYA 1CI1A 3GLCA 3NQEA 1UP3A 1RA0A 2JK2A 4MADA 4P7NA 1HG3A 3CH0A 1LLZA 2ZXBA 4C1LA 2DVUA 3OZMA 4US5A 4QE5A 3K2GA 1V6XA 1LUCA 2W79A 4XG1A 2VI0A 9XIAA 4H41A 3A24A 3VKCA 2CNCA 3P5YA 4LBSA 4K8HA 2JKEA 1XPGA 4AG0A 2R82A 3FFSA 1DJYA 2NSOA 1L6SA 1QW8A 3B8DA 4GI8A 3LXAA 4OTKA 4JTLA 3G1FA 3WL1A 3VKKA 3TH6A 2NV2A 5LA1A 1A5UA 3AMCA 1W2PA 1I75A 3QY8A 2YIHA 4XUYA 2J7EA 4GYKA 2AMXA 3T42A 1ZALA 3DN5A 3ZM8A 3SFKA 1D3CA 4YLWA 5G2IA 5AHNA 4J2MA 3AYRA 2D1ZA 3KUMA 2BXVA 4CNNA 3G22A 3OLDA 1Y8BA 3E2VA 4QDMA 4C7DA 4X61A 1XV8A 1E6RA 2WO5A 3QQWA 1NTHA 2HK1A 4N4PA 4AWUA 6ALDA 1RA5A 2ZQ0A 5G1TA 3KBVA 4KCTA 2J47A 2EPNA 3GIPA 4CCCA 2CLMA 2R1KA 3KBJA 1E70M 3LUTA 3VYLA 2DQWA 1EHAA 1RPKA 3LX9A 1NWTA 4PFHA 3VD4A 2VZTA 1XGEA 2ACUA 4GVGA 1XQLA 3ITXA 7TIMA 2ZRUA 3L4VA 4QBXA 3BO9A 1ISXA 3SRDA 4C5ZA 3DENA 4PMDA 4N6EA 2I9EA 3W37A 2ASHA 3EOLA 5BXTA 1XRFA 4B5VA 1GKQA 1BWVA 4S3KA 4ATDA 1HL2A 4KWWA 1VH7A 2Y7GA 5CLTA 1KD0A 3RJYA 3O7UA 5G5IA 3AI0A 4I8DA 4XKYA 3BW2A 3DFSA 4NL1A 1S5VA 4UQ9A 2J4GA 2FQIA 1B4KA 3GHRA 4HNVA 3M46A 3H2MA 3DKLA 3W7MA 4AEFA 5BWAA 4NYUA 1R38A 3G1SA 3LCGA 1VHNA 3GSMA 3QPZA 1OX4A 3TSBA 3TMQA 2VRQA 3G1HA 3RDKA 2OYLA 3D6NA 4A29A 4W89A 4NZ4A 4C90A 1IWPA 2ZXQA 3MWAA 3C0QA 3N13A 4Y9MA 2F6XA 4FI4A 2VEPA 1CPUA 4FEZA 4PSRA 3W2KA 2XUCA 1XBXA 3VNLA 3WQDA 1V03A 3NM3A 1RH9A 1Z7AA 3H26A 3W28A 4HYVA 2CBJA 4NJKA 3M6DA 4U33A 4TQTA 1M03A 2VEKA 4UOJA 4U31A 4OOUA 4TX6A 3MSRA 5EL1A 1WBJA 2X1RA 1DWJM 3HG4A 1JZ7A 3VZZA 5CAKA 3KTCA 3RLVA 4QNEA 4JTSA 4QLLA 1YDNA 3OLEA 2HQAA 4JFWA 4PMZA 3V1PA 3QH2A 4ACYA 2AGTA 3DYOA 4O19A 2PDQA 3CLWA 3FHQA 1D7FA 2CYGA 4E2OA 5FEWA 3FLUA 3MP5A 4GO8A 3VOHA 4C1KA 4RXFA 3BGJA 4O28A 3KOWA 2WNZA 4IFRA 4XBKA 4FS9A 3HMJG 1VD6A 2DZSA 1PE1A 2XN0A 4C7FA 3TXZA 3GVGA 3RCMA 3S5OA 3ARTA 1E3XA 1JNEA 1AUSL 4UR8A 1LWHA 4LTSA 1UZ1A 3DFHA 1HX0A 3UERA 3GBDA 2RFGA 1A5MC 4OKDA 1REQA 2ZX5A 2XWDA 2ZZ2A 2I57A 1E9YB 4U10A 1Q7MA 1VCGA 1GQKA 5FF3A 2XN1A 4D8AA 5K4ZA 3CIWA 1NDYA 2WMJA 3RPTA 2R9RA 4K7YA 3UNTA 4DO4A 3UD6A 2WCSA 3V1HA 4YNGA 5IRPA 1EEXA 2FFIA 2DIJA 3GNDA 1W8SA 3W7EA 1TELA 4LUSA 1B0IA 4Z1BA 3MB9A 1QPQA 3CTLA 1T7LA 4OHQA 1VLIA 5DMMA 3EA1A 3SGZA 3BW3A 3VFLA 1JPIA 1XCFA 1JYXA 4L80A 1CB7B 3S2MA 3U7BA 3NYDA 3NDYA 4DXKA 3UJRA 1UWIA 1V0LA 3QMSA 3O2LA 4OBRA 1U22A 2HCVA 3CEUA 1RD5A 4HYRA 3W86A 5A8PA 2J9YA 3TQPA 1R3WA 3AAMA 4B9ZA 4Q4OA 5DXXA 5EMUA 2PWDA 3S4TA 3VCRA 3MV11 2P1FA 5AECA 2PMQA 2E09A 3DG7A 1GOQA 1TPH1 1P0DA 1KXVA 1D3GA 4GC3A 5G4HC 2ATMA 3GHUA 4LH8A 1KXTA 1WUEA 2VGFA 3KRSA 4IL2A 5AYIA 1O7AA 4G2DA 5CSUA 3GTNA 2VDHA 4ZOBA 4Z2GA 1B5TA 4L9XA 1JGIA 1O4UA 3GFXA 2A6LA 2GPTA 3VDAA 1X1ZA 1H3GA 3W7OA 1EGMA 2Y5EA 4R5EA 2JALA 3U5UA 2Y7EA 4KERA 3UZZA 4BWLC 1RHCA 5LA2A 2O9TA 4GG9A 1EUNA 3S5ZA 1R2TA 1FRBA 2E6DA 2PWVA 4XD5A 3A4XA 3BICA 1GT8A 3W7QA 5BRPA 3KBWA 3KS6A 3OYXA 5DRCA 5D09A 1FWRA 4TR9A 4G1NA 5XIAA 1J8VA 4P7LA 2FZ8A 1ME7A 4P2VA 1A3WA 2D2GA 3PPHA 5A6AA 2I5GA 2GJXA 2VX7A 1XIGA 4IMGA 5EY5A 2D22A 1NY1A 1UHVA 3N9RA 3OOQA 3J7HA 1F74A 5I09A 1QPOA 4AYSA 1XGZA 4L1GA 4PTNA 3B0XA 3DYMA 3B9DA 4ZB5A 3C5QA 4QROA 3BMVA 3VIFA 2J78A 2PWUA 6XIAA 2F7FA 4AX7A 1F8MA 2QCDA 1IEIA 3QV7A 2PP1A 3WQPA 4J3UA 3LHTA 1TPVA 4K36A 4TIMA 3V3WA 4L4LA 1QATA 4AWSA 2C0HA 2EAWA 4G56A 2DIEA 1PXGA 3R94A 2YB4A 3SUTA 4R7JA 2BASA 4DHGA 1J0HA 3FA3A 3HF3A 4YL2A 2REQA 4TVCA 4NAEB 1SFLA 4MY9A 4H6EA 4UB9A 1ZY9A 2DSZA 4W84A 5JVLA 5IBXC 4WOZA 1MRAA 3UETA 3CAWA 3CZJA 2AL1A 4YTTA 3UGRA 2GSJA 4NNBA 5F2GA 4ZO8A 3T55A 4D6EA 2FZMA 4O1DA 2GDQA 1OK4A 1NP0A 4A21A 5C0QA 1AQHA 4PMQA 3AJ7A 4WSKA 2J88A 1I2OA 4QJ5B 2YSWA 1ICSA 3K4WA 1ZTVA 3FEQA 4ZQCA 3GNPA 1GUVA 2G97A 3BAIA 4F2BA 2V5JA 1AD1A 3H7VA 3SRHA 5A3HA 2DSUA 4BHYA 3UA4A 1KO0A 4N9BA 2INFA 5HINA 3UBPC 4CU6A 1WYIA 1BF6A 3LXBA 3RM9A 2HBXA 4DYJA 1CGTA 1GOXA 4O17A 2WHKA 1J5SA 1C93A 1XBVA 3O0FA 2FZ9A 2VFDA 3A3WA 2WBKA 1RZMA 3PZVA 4BR1A 1S5TA 3TFCA 3LMZA 3VNJA 2JF6A 3KTXA 3FHAA 3PWAA 2WZEA 5HA7A 2VR4A 1KBKA 2KX9A 4L9YA 5CCZA 4KKXA 3PPCA 2WJFA 2TRSA 4K37A 4Q8UA 3MYPA 5E0CA 3S2NA 3WBWA 2YCIX 4AZBA 1V02E 2HXTA 4X0NA 1C7TA 4EF8A 1UWUA 2C1IA 2XIQA 3DFTA 4XZLX 4FNRA 2VR5A 5HJYA 2NLIA 4TU1A 1JUKA 3UCCA 1IT8A 1U2YA 2CEQA 2VUYA 4KWSA 3XISA 1F4HA 1NH6A 1IIGA 2AAAA 2XGBA 3PC0A 3M0VA 4AD2A 1SZGA 1ZP4A 4DJEA 4M80A 5EB8A 1US3A 3QLLA 2WQDA 1RBAA 5DX7A 1AW5A 2X40A 1R5YA 4ORIA 2BHUA 3C6CA 1CCWB 3OPSA 2PLJA 1QNVA 2QJIA 2ZUTA 4AZCB 3KRZA 1H7PA 1K70A 1OCQA 1MXSA 1AMKA 4ZXOA 1BFNA 1E43A 1LOSA 4FLOA 4ZE4A 3B06A 1PL9A 4X2RA 3OEXA 3EWWA 3MVIA 2QT3A 1SSGA 1W1IE 2RH9A 4M7TA 1E1CB 4W88A 3VOJA 5BOOA 1QDSA 3ARUA 3A4AA 3IJIA 2VC5A 1TR1A 5I02A 3TTSA 2CCRA 3AIVA 4WSJA 4CEXC 4O52A 3PS7A 2OQLA 2BY1A 1O12A 1TCMA 3CT2A 2WZMA 3HFTA 1E6SM 2WHLA 3MUIA 3UZJA 4J40A 4RNFA 2WNQA 4R7WA 3FYPA 1TJ0A 3EXSA 4B3LA 3QF0A 3ID7A 1D9EA 4N9DA 2Z6JA 2I56A 2Z1VA 1JCXA 3T0DA 2VZUA 4LAMA 4UTFA 1DTNA 1MEWA 1KLYA 2X2GA 4C65A 3C2RA 5LZLA 2WV8A 1DL3A 1TWZA 2NVCA 3LPOA 4WRHA 1I4NA 2VGIA 2B81A 2YXXA 4WLCA 5D05A 3IANA 4HNTA 3KHDA 4FO4A 3ZR4A 5D32A 5EYWA 1TVNA 1EB3A 4RDYA 2BWGA 3CWHA 4H2CA 3LOTA 4H9ZA 3TJ4A 2NQ5A 4Q4MA 2GJXB 3EWUA 1BGAA 1OIFA 1VS1A 2X1TA 2OYKA 1K9TA 1PVNA 1VBHA 3WMSA 1OCBA 4HK6A 2WVVA 3H23A 1VF8A 1FWSA 3W00A 3NPVA 1UR2A 1XLMA 4OOZA 1EP1A 1I1WA 5LNVA 2PTWA 4ZO6A 4L1XA 4MJZA 1UP2A 4LC6A 4BA0A 2OO0A 3GG8A 5CSRA 2V67A 4ACZB 2CPUA 3QW4B 5HQLA 2NVDA 3PBWA 4H19A 5AHLA 5JBDA 2P3ZA 4RW5A 1B3YA 1Z9AA 2VFIA 9RUBA 3UCDA 1B3WA 1HJQA 3THQA 3VGEA 3B8UA 3BLKA 3IK2A 3Q65A 3CL8A 4X63A 1EIBA 2C3ZA 2OQHA 3LSCA 2GWGA 3NEVA 2EQDA 4Q4KA 2ZRZA 2E6AA 1CYGA 1IT0A 2NX1A 1K4GA 4TXEA 2XHYA 3VOFA 1UMLA 1ZAIA 2ABBA 1WKFA 2GOUA 4CEUC 1ITXA 5FJOA 2QLYA 4XZ9A 5H91A 4UTTC 5MF5A 4AVNA 2NV9A 3WDRA 4ZSTA 3STEA 4Q4PA 4FOUA 4D9PA 4S3FA 3SUSA 2Z0IA 4M6UA 3M41A 5XINA 3RILA 5J5RA 3UW6A 4K2SA 3VIOA 4OT7A 3OG2A 4XAYA 3TCSA 2A4AA 5LXEA 4B4HA 1W31A 4HK7A 3GIYA 1QASA 3STFA 4C6EA 4LALA 4CD4A 4J3XA 3QC3A 4QX4A 1YMYA 3QZ6A 4A8LA 4ENLA 3VE9A 2ZC8A 3ARSA 4FR1A 2PF8A 4AHPA 1ZL1A 4FLRA 5BZAA 1JG9A 3VNMA 5G1YA 2CXEA 4G5DA 4NX0A 1FWIC 2BY3A 3SGGA 5D2XA 2HSAA 2TPSA 3T2QA 3WCZA 5HMDA 2ZYFA 5EBAA 3EKGA 1I8JA 1UKQA 2DP3A 5D2WA 4WJXA 1KCLA 4NG3A 3R7MA 2CKSA 3M43A 3LGEA 4J3SA 4JQ1A 4YTSA 4QXIA 1CW2A 2F2HA 3W26A 5U4NA 3KL5A 1CGXA 2VKZG 2YXOA 1OYCA 1UZ4A 1VFHA 3N4EA 4U28A 4NILA 3TAOA 4XBJA 3SCNA 1OIMA 1HNYA 4OBTA 2ZTKA 4JQAA 5T91A 3OGRA 4FAMA 1QT1A 1T0OA 4V15A 4AY1A 1XH0A 3CV2A 4RJEA 3SUUA 1F8IA 3W3OA 4RNJA 1B9ZA 1RCOB 4JEJA 1A5CA 4JIPA 3EDJA 5MKGB 1UYQA 7A3HA 2WKJA 5E0KA 2ZZ5A 1X7IA 4NXKA 4Q7NA 4I90A 5D37A 3LY0A 2XN2A 1I6NA 3AWOA 1T99A 3MT1A 2HMCA 4XX6A 5FESA 5DQPA 4AW7A 1XRTA 4F48A 3D47A 3W1RA 3H4GA 4AZ6A 4RE4A 1XYCA 2PZ0A 3CV1A 3T81A 4MJMA 2XH4A 3TWAA 1CX9A 4O14A 1OD0A 2E8YA 1M41A 2IPFA 3P74A 3QV6A 4GA8A 2YCLA 2FVLA 1XWYA 2GGEA 3ORWA 3STGA 4FR6A 1KM5A 2A0NA 3NPXA 3RPMA 2HPMA 1WDRA 1ZNNA 3W82A 3U2ZA 4A4AA 1W5PA 1RQEA 2YBTA 2QDHA 4JTEA 3PAOA 4L65A 3EX4A 5BYWA 1NWUA 1OG0A 3PK7A 2ZZ6A 5AC7A 3D46A 5J8LA 2PDWA 1F9CA 1TREA 3OZOA 5GNYA 4K8EA 2DV0A 3LQLA 4WK9A 3VKAA 1ZAJA 3APTA 2DJLA 4O54A 4FX6M 1HKKA 1XIJA 3G0SA 1UPPA 2VP8A 1XLLA 4R88A 4LAKA 2GVLA 1K1DA 4CD7A 3SAZA 5BU9A 1YBQA 3TYDA 1JZ5A 1E71M 4DWSD 3AXXA 3OVPA 2A3EA 3TIMA 1GEHA 2BHZA 3E38A 3CQHA 3ARWA 2FZBA 3UQNA 4MOZA 1S1PA 2VUNA 2TMDA 2W27A 2P0OA 3MI3A 3LPPA 1SZNA 5JU6A 2XPKA 3E0VA 3OQ8A 1A5BA 1KFKA 1GW9A 3KL3A 2NXGA 1T6MA 4ZCWA 4HPHA 1VCFA 3BAWA 4XKMA 1X6UA 4XTIA 3N4AA 3IGHX 3VO0A 1SZRA 1VYPX 1QPRA 4JTUA 5D9NA 4LS2A 1JYNA 2J74A 1ME8A 2Q09A 1V0MA 1HF6A 5FD0A 1IIHA 2X30A 5HQMA 4UTLA 3T07A 1EOMA 3VXGA 4B2DA 4MB3A 2NUWA 2Q71A 2YL5A 1C92A 1FWGC 3UEQA 1MQRA 1LUCB 3VD9A 1GVIA 5C6MA 3P80A 2BG5A 1RALA 3EMCA 2O9OA 4A3QA 1UR4A 2PUZA 1WDPA 3TYAA 4H9MA 2BV9A 2ZRYA 4ZBCA 2HVNA 1ISWA 3WF3A 2FDMA 3E0FA 2OX4A 2AL2B 3VGBA 1UD6A 1W9VA 4C6CA 4LVBA 2RJGA 1KRBC 4G7EB 4ZQRA 3AHYA 1BF2A 3HJZA 4LT9A 5FJTA 3I6RA 3RX3A 1KBLA 1EJUC 3UGVA 3OLGA 4B91A 4XBSA 2QJGA 4YWSA 1WDSA 2Y89A 3NQAA 4J5NA 3UXAA 5I23A 5C2GA 1FWJC 3OVRA 4JNMA 1E4NA 3L0KA 3O0KA 4ZO9A 1HJUA 2JEPA 1J6OA 1SQ7A 3WK3A 3O16A 1QR7A 1H62A 1BYAA 2A6NA 1BKHA 1E6QM 1WXYA 3MJYA 1W54A 3P61A 5JUVA 1KNWA 2JFEX 1IZJA 3W2NA 2H6RA 1QXLA 1WDWA 1GPFA 2PGFA 2Y62A 4AF0B 4LANA 4CGTA 4P5UA 1GVEA 1Q8AA 3CV7A 4PRRA 3TTEA 2J66A 1H5YA 5HULA 5FA5A 4J3TA 4GNJA 3QBUA 4MSSA 5AC4A 1U33A 3XIMA 4MDOA 1W3HA 4WF7A 2UY3A 3THDA 3ZZ1A 3ITLA 5BOFA 2IQDA 1DWAM 3MCNA 5GJNA 1YQ2A 4PMJA 4G7EA 4DWDA 2I17A 2ISVA 3PP7A 1J2WA 2V63A 3T4WA 1VCVA 3CLMA 4GX9A 1VIWA 5A94A 1GZJA 2Z27A 4YCPA 1R7AA 3F4CA 5T8GA 1UROA 3BDKA 3MW7A 4A6GA 3IS4A 1IEVA 3WEMA 1P0BA 2PWEA 1SM9A 1NDWA 1A5NC 1EJTC 1XISA 4LC8A 3QGKC 4DPQA 3SURA 1MFUA 3E12A 1EF2A 4LVAA 1QPKA 4E8GA 1H51A 2AOSA 2YYUA 2XIJA 3KOZA 3PTDA 6A3HA 5AN7A 1UR9A 2WCAA 3N9SA 1VB9A 4QS5A 4IM4A 1UIOA 4Q6JA 1MQPA 1JQXA 3FIGA 4X9SA 4HVXA 4K6AA 2DW6A 1DV7A 1Y7VA 5D2VA 3LA4A 1WV2A 1ZP3A 5AFDA 1OBAA 1Q85A 2PPGA 2XH7A 1OZQA 3AISA 1PB0A 3WSUA 2V5KA 4REQA 1EO7A 3UCQA 3FS2A 3CPGA 1VBUA 2ZX9A 1W9XA 4CCEA 4H7CA 1XD1A 3TSDA 4JQ3A 3MHGA 3ABOA 1DKWA 2J9ZA 3T8QA 3P2VA 3B04A 1VFLA 3WLRA 3GVRA 3BV4A 2KAUC 3AHZA 4CCZA 1UQZA 4JZ5A 2WKGA 2Y8VA 5FEXA 2ONEA 3IGSA 1PDYA 1TA3B 4MJ2A 3BLLA 4ADTA 1DYSA 2J8FA 4FIRA 1MZRA 1V3JA 1EHNA 1UQYA 2V8ZA 3B9NA 1OEPA 2F2KA 5TQLA 1V6UA 3IRSA 3W6MA 4UFLA 3CPUA 3W81A 3MC5A 3SIZA 1FWNA 2Z24A 1WNOA 1FWTA 3GAKA 3WQGA 1H60A 1U30A 4LCRA 1W2VA 1VPYA 3QSTA 4JTAA 2WPBA 3W1UA 3WDHA 4QSHA 2NWSA 3T7VA 4OFCA 4C6JA 1E40A 1U5VA 3NCOA 1EDTA 1TKKA 1OY0A 4AY8A 4HGXA 1XRVA 4G7FA 3NM1A 1JAKA 3VOGA 5AHIA 1QNSA 3W76A 4PC8A 3TXVA 1CGVA 2E4TA 2FGZA 3DC0A 3MKVA 2FJKA 3NURA 4PGLA 3DX5A 4N2YA 3EYPA 1VFOA 3GTIA 5BRQA 4EF9A 2BVYA 1I9CB 4N42A 5CG0A 4HNUA 5LNWA 2OWCA 5CG7A 4PH6A 9XIMA 3RRAA 3VIPA 5LIYX 3BMWA 4MFEA 2OOFA 2GLKA 4JOMA 4PR4A 1O6IA 1UG6A 4JFVA 4S3GA 3K8LA 4Q4SA 1F61A 5EMJA 4M5PA 5GJPA 3SJNA 2DZUA 3C0LA 2ADAA 3Q4DA 4DLFA 2DT1A 1FFQA 3F1QA 3O15A 4ILSA 1K03A 1XLDA 2X1UA 3V18A 1CENA 2NUYA 1HGWA 2Z2UA 3WEZA 3ZT6A 3NZGA 2QJHA 4GIYA 1N8IA 3GW3A 3NJ3A 1UJQA 1FWFC 5E0FA 3HGSA 4M19A 3ZR6A 1J6PA 3WLKX 1GYMA 1UC5A 4H9UA 3G1XA 5TIMA 2P76A 1FX6A 3WH8A 1PZ3A 1AQFA 4ZOCA 4NZ1A 1OABA 3H54A 4B3KA 4H9XA 3KOXA 1D8WA 2C1GA 1UZHA 4YWIA 4XVEA 5AC5A 3S1XA 4LYKA 3UWZA 1OGGA 4QS6A 3QOMA 5HWNA 1A5OC 3WBAA 2A2IA 3NPUA 4R9OA 4POCA 2PDNA 3T2OA 3F4WA 2I5IA 1M6JA 1RBOB 3INPA 1F3WA 3SM0A 4ZFMA 1R3TA 3V75A 3M5ZA 3PF3A 3GZAA 8CGTA 4ZMGA 1X1NA 1KR0A 2VRJA 3UT0A 1MRQA 2Z28A 2VWSA 1IXOA 3U9IA 4M7SA 1R7OA 4FLSA 4DIAA 4GWEA 2NX3A 3D3AA 3MP4A 4AMAA 4MMWA 3K4DA 1E6PA 1PKLA 1BYDA 3DFQA 3W70A 1AZ1A 4JQ4A 4QEEA 5AYBA 4IX2A 5HNNA 1HN1A 4IP4A 3IIOA 3FNDA 6REQB 1DIOA 1VEPA 4PB3A 1VFSA 3PJWA 3VVGA 5HPOA 2XYLA 2FH8A 5KZMA 4B5TA 1FKXA 3IIPA 5I7GA 4HNNA 1H7OA 3CO8A 4S2CA 3CZGA 2NV1A 2QMJA 1MYRA 1DXFA 4GE8A 2XFWA 1QBBA 4LCSA 4JPGA 1XLHA 5BW6A 4AIUA 3NNTA 3EB3A 2HS6A 1TTPA 3W53A 5FJPA 1ZJAA 4F0RA 3B0PA 4M0XA 2PB1A 2FDSA 1SW7A 4QCEA 1LL7A 4R33A 4WOQA 4AIEA 3PZTA 1TYGA 3UG4A 3QMTA 1EX1A 5CC3A 3WMBA 2A85A 3IK4A 3UP8A 1KWKA 4CQ9A 1AVAA 4D2JA 1EJXC 5GPRA 3G8RA 3HIJA 4AD5A 1QVBA 3L4WA 4JHMA 5I24A 2VYOA 4JNYA 4F2UA 5E93A 2Q02A 4O15A 1TQJA 1SVDA 4LRSA 4DZAA 4JBRA 1A47A 4LNYA 4OV9A 1XCWA 1YNQA 4O0QA 3LMYA 1KCKA 1REQB 1WZKA 4IT1A 3M7SA 1K8ZA 3ZT5A 3RNDA 2GGIA 2BDQA 1S5MA 4IHCA 2QCFA 4QTGA 3FA4A 2A5HA 3MU7A 2JEQA 3GVQA 3VZYA 2CIPA 4ZOEA 2PTYA 1PTDA 5KZDA 2TAAA 1WKEA 5K9CA 3AIWA 2VFEA 2XTKA 2PU0A 4HPJA 5K9DA 3SI9A 1BAGA 2CERA 3FGCB 5KETA 4L1WA 5C7HA 3VC6A 3N3MA 3L4YA 3PWIA 3F4NA 3AWNA 4XO6A 4DJDD 2OB3A 2ZUWA 2GVGA 2GK1A 1RV8A 1KM3A 1HW6A 3GK0A 4L5ZA 1EBHA 2YBVA 4GI4A 4XZBA 2PD5A 3VIIA 2PP3A 3ZLGA 1KQYA 4H83A 1EZWA 4O11A 2OG9A 3NGFA 1XLCA 3GE7A 6TIMA 2I5QA 5DT7A 2EG8A 5H6HA 3SZ8A 4GXMA 3FY1A 4B92A 3MSGA 4P8WA 4K3ZA 2C6QA 1UH2A 4DY1A 3WUFA 4DRSA 3AQUA 1QMLA 2VGBA 1ZUAX 3EOUA 3QQ0A 1HP4A 4MM1A 5FJIA 3NZQA 1GORA 7REQA 5EU9A 1LBLA 2V5CA 1W5NA 3DU0A 3SCQA 3KWSA 4AEOA 2WVVB 3VIKA 3PG9A 3OBAA 4QJ1A 5CZKA 4A8RA 1OF6A 4UC5A 1PIGA 3IJLA 4LXFA 5D02A 3MPGA 2WSKA 2WM0A 5C71A 1RUSA 3VIHA 3N12A 2V69A 3TNBA 3UR2A 4HT3A 1J12A 4DF1A 2V5LA 1EH9A 1ZCCA 4ZODA 3L66A 2Y7DA 2FZNA 2E28A 1DHKA 5JXQA 3GZ3A 2GQ8A 2V3DA 4RZBA 1W9UA 4CVWA 4DM1A 1RK6A 1XSKA 3B0UX 4IJRA 3OZYA 3T0TA 3H2NA 4GCAA 3UY7A 1KBIA 1P0KA 3AZSA 3SECA 5AZ1A 1X8CA 2P8CA 4BK9A 1B3ZA 3UR7A 5E1QA 2Z1XA 4PSPA 8XIMA 2QPSA 1X39A 3ARYA 2ZUVA 5BNKA 1G1YA 4K1WA 3NTYA 4H3DA 2X7VA 3CWOX 4D1IA 2CW6A 3FEMA 3UVIA 1DJNA 2WC4A 5LYRA 3LTSA 3L0NA 1OT2A 2W61A 3CGTA 5DEZA 4C6PA 3K1GA 3VNYA 1A80A 4ZOAA 5CH9A 3PR2A 2OELA 5BXSA 4H8UA 3IIXA 3TKFA 5C2CA 2ZZ7A 1LOQA 3GH7A 2DVXA 4P7RA 5D30A 1GQJA 1SFTA 5I00A 4CQ8A 4WDUA 3T4CA 3M44A 2EKCA 3MO4A 5DCBA 3OQEA 5C70A 1TTIA 4X60A 3LBCA 5T9BG 1YXYA 2D69A 4Y6GA 3FYOA 1FH9A 3EMQA 5J04A 1XSJA 5CZSA 4AZCA 2QCDB 4XO7A 1XX1A 1E6XM 3BJFA 4OGZA 3DFNA 3KZPA 4CNPA 5JMUA 3UG3A 3N18A 3H6OA 1S2WA 1XCXA 3VIMA 1YDYA 2PLCA 3ZJKA 2XFRA 3I65A 1R30A 1VQTA 2VX5A 4BS0A 1L0PA 1SU5A 1V3HA 2KZHA 3UXKA 3ISIX 2HZGA 2W62A 3VX1A 1LQAA 4GYPA 3PZUA 1GVYA 1VBGA 3H55A 4Y9NA 4MWAE 3BAXA 4HOXA 3BOFA 3HV8A 2WMFA 2TODA 3K1DA 1A5SA 3AYSA 3EWDA 3CH9A 4HHMA 2VR2A 1Y5VA 2JIEA 1PBGA 1NARA 4JTFA 2PD9A 4JAWA 3PANA 4IX0A 5MKGA 1TZ9A 4WCJA 4KF1A 4ICMA 4JX5A 2QUMA 1X6LA 4G6CA 1ZJIA 3POCA 1OX6A 1EA9C 1E9IA 3GXNA 2G4JA 5K7JA 4DZ5A 1GG1A 5REQA 2R94A 5M3WA 4UFKA 3L21A 2BHYA 3MUY1 3UXDA 5A8QA 2O55A 3OVQA 1RJPA 4HU8A 1TVLA 2I7GA 3ARZA 1NVMA 2ZVRA 2Z1WA 4WHBA 1WKYA 2CHRA 1KXHA 1RD6A 3QPYA 3RLUA 1TQXA 5C54A 1XLJA 4URIA 2GDUA 1J0ZA 3BSGA 3OHMB 4F2TA 1MO0A 2O4MA 3MBDA 3TW6A 3A9BA 1HXJA 2YCKX 1JFXA 1VRDA 4M1BA 4YJ5A 2X8RA 1E0UA 4M6QA 3PPGA 1JPDX 1W9DM 1K7XA 2B4GA 1QOXA 4A3RA 5FAJA 3DXIA 1HO1A 1IEQA 3PB2A 5CGMA 3CZEA 2W5FA 5AVNA 4N4QA 2DSWA 4E0CA 3DFOA 2B31A 3WNMA 3CZ8A 3BAYA 3DZ1A 2Y70A 1MSSA 1H63A 3IJ9A 3RCYA 1FHLA 1XD0A 3H22A 1FWCC 3BLDA 4FLQA 4V33A 4CQDA 1L6YA 1R85A 5LGZA 2Z7GA 5LHEA 1SO5A 1CTNA 4C6NA 3AZRA 1Q6CA 2X1SA 4PUWA 4CQAA 1GJPA 4G9PA 2HVMA 1ZENA 1HTIA 5BRBA 4R34A 2XM1A 2DUZA 3FA5A 1T5AA 3IVSA 4JS3A 4NZFA 3HFYA 2PRLA 1DIEA 5DRIA 2QCMA 2QCNA 4IQLA 4G1KA 4WX2A 1R2RA 4AZGA 2DVTA 4GLEA 4KBXA 4ROPA 3JVAA 3GS6A 3O8AA 2WWCA 1GOWA 3H53A 5CPOA 3CTTA 1IZCA 4Z2LA 3M0XA 3SBFA 1ZS2A 4JNZA 1J0YA 3KX6A 2WANA 1ECEA 5I03A 4M6PA 3S42A 3FVMA 1RJRA 1DIKA 1VYSX 4OECA 1YTKA 1QNOA 1LT8A 2PBGA 4HCHA 4FXJA 4DAFA 5DCDA 5IFTA 4I3GA 8XIAA 3BLPX 4AXKA 4J27A 3SCRA 4S3BA 4IMAA 5CPQA 4C6DA 1YX1A 3HM7A 4A8IA 4GD0A 3WLHA 2OMAA 1CGUA 1O5RA 2OKTA 1LT7A 3IUHA 5CPMA 1SFJA 3D3FA 3TEVA 4FZIA 3EWYA 3N15A 3GAYA 1XDMA 2Z1BA 4Q8QA 2R14A 1A0EA 3A21A 2QXWA 3REQB 5AHEA 2R24A 3M0HA 5FJRA 4B5NA 4O57A 5K4XA 4FOJA 1TG7A 2C8NA 4B4FA 3CIVA 1QHPA 5CZJA 4X0VA 3QR1A 3H70A 1V51A 3AS0A 4HN8A 4A2RA 1VKFA 4KRTA 3L4TA 1UASA 3VUSA 1WQ5A 3WLPA 1KM4A 3N4FA 3BLIA 3HGRA 4OBSA 3MSYA 4BWLA 4QIUA 5EFDA 1V3KA 1NDVA 3VKJA 3CAQA 5HJLA 5F1UA 2IPGA 3SCVA 4BFAA 3OTRA 4AYGA 3UNDA 2VNCA 2YDRA 5A8MA 3V35A 1KM6A 4PTDA 3E2SA 1QWGA 2WKLA 3K13A 1R9XA 4UR9A 3W1TA 3HPFA 4Q8WA 3AU2A 3VE7A 4KPLA 3BG9A 5LSMA 5DY3A 3UWWA 1TZ7A 1T40A 3ITOA 2WXDM 1AK5A 1K6AA 5BXRA 3S2LA 4EANA 2BY2A 2P5NA 3AALA 3P81A 3QQ1A 4UWMA 2A7RA 3F5KA 1I45A 1SMDA 3WLLA 2NQZA 4DUWA 4E8DA 4PCNA 5KZ6A 5IXEA 4W5UA 1XIFA 1R86A 1PJ9A 1UWRA 3I3EA 1EX5A 2HS8A 3QTGA 4BEUA 3WDQA 3B40A 2C16A 4NJJA 3TC7A 3BSMA 4Q8OA 2PWHA 1XC4A 2R1LA 1W1PA 1Q2RA 3D0CA 1WBHA 4LBUA 1DXEA 1G7UA 2ZZ3A 4C6LA 1DHPA 4MB5A 2GK1B 1IR1A 4J2PA 1DQXA 3N73A 4ES4A 3TK7A 4H8NA 2J9XA 1B3XA 3HG5A 2AAMA 1ALDA 5M5DA 1QHOA 2GUYA 1EUAA 3IJ6A 4Q8PA 4GRSA 3UG5A 4FXFA 4NZ3A 3S6DA 3AMGA 1EOKA 1XXXA 1S39A 1YXCA 3R2GA 1Q6LA 1R3VA 2BGSA 4CVUA 1MW1A 2NUXA 2VQTA 4AVOA 4EPKA 3F7JA 1LP6A 2RGMA 2PDPA 4DUOA 1IV8A 3LYEA 4XB3A 5AVHA 1GVRA 3BQ6A 8RUCA 3PWGA 1BLIA 2CLPA 4PODA 4S38A 1EQPA 1MVYA 1AQMA 1Q66A 4JQ2A 4QLKA 1FCUA 2GJRA 1F73A 2WHJA 3TTOA 1CEOA 4KMQA 1W3TA 4GBDA 1TPWA 4JTJA 5I3HA 5A8NA 4Q33A 1YXDA 3UWEA 4KCUA 3KFTA 1IQ8A 4UTWC 2CZ5A 2QIIA 4PBFA 4PFMA 2DU2A 4GJIA 2XM2A 3CL7A 2QJMA 1TR9A 2E0PA 2R1NA 2ANUA 1QI4A 6ENLA 3ZJ7A 3CT7A 1KFBA 3UJFA 1NELA 4GINA 1JAEA 2NZLA 2VGGA 1NM9A 4PCFA 4HYWA 4M6VA 5CC6A 1TWDA 6REQA 5I06A 4ERIA 2YCJA 3KLKA 5C9ZA 2G96A 2V38A 1UUMA 3AO0A 1MDRA 3EOEA 4MWAB 4LU0A 4YU1A 1KV5A 1GYLA 2Z25A 3S46A 1X6NA 4JFTA 3KBMA 1PZ1A 3SDOA 2YPIA 4EOUA 3B4UA 3ZR5A 3FX4A 4PUDA 3I7SA 4JICA 1XIIA 2OVLA 4BI5A 4JGDA 3WJWA 3HPZA 2ABAA 2AKZA 5C9RA 1H61A 1P0EA 2DORA 1F05A 3JS3A 3BWWA 4FF7A 1AH3A 5EKYA 4MUPA 1G7VA 3H2CA 4D6GA 1BXCA 4AXNA 5L6UA 1RVKA 4NNCA 1I2RA 1BVNP 3IGUA 3QW3A 1E1CA 2E67A 3W22A 4D72A 4HHLA 5HXMA 4JKMA 1CBGA 5D38A 4REQB 4UR7A 4JTQA 2CXGA 4V1XA 4D6DA 4DXXA 3KRUA 1NF7A 4MPQA 3GNNA 3ARQA 2NQ9A 1PWMA 5AHMA 2TYSA 5ABTA 2ALRA 4IG2A 4TOQA 1LM1A 5LHFA 1L6GA 4BQ3A 3WF0A 1L8NA 1ENUA 3PULA 4HA3A 4C6BA 3P7YA 2CLEA 5ECVA 3RM4A 1W17A 1Q4NX 4WGXA 1IYXA 4PMXA 5CPSA 3U7VA 2QJJA 4XAZA 1JIBA 2YL9A 1G67A 2YA2A 3EOOA 2VCBA 3DDMA 5CEWA 1GQIA 1RY8A 2PDXA 4XWUA 2YJQA 1ZRQA 3AYVA 3HQPA 1IEXA 2Z2BA 5IM51 1JI1A 2OTDA 4WSHA 3GKAA 1EJWC 4JN8A 4HPGA 4AAJA 1E9ZB 2OCZA 4YN5A 3LGGA 4Z42C 2DSKA 3JUGA 1TMHA 1TPUA 4DBUA 4IGHA 5A6JA 3UPMA 3BARA 3W1MA 3ME3A 1W32A 1W5QA 3EPMA 3KLLA 5DF0A 2G3IA 4YHGA 4HMCA 1X98A 3KOFA 4ATWA 1WOBA 2E25A 2V3EA 5GVJA 5D2YA 5JIPA 2CHNA 3MKKA 2A3BA 1PTAA 1HVQA 4L4MA 3RR1A 4F0SA 5A1AA 2PLMA 4GYPC 4EIVA 4CD8A 1ZBCA 3SY1A 3VDHA 4RNIA 1FWDC 4MYXA 2OJPA 1HKIA 5C9XA 2RDTA 4HPXA 4YXGA 4AF0A 2HTMA 5CGQA 3MI2A 1ADOA 5IDIA 4GZJA 3GUGA 2BGQA 1PX8A 3K30A 4AD3A 6TAAA 3ABSA 5EFFA 3KBSA 2HE8A 4YPJA 5LNSA 2C15A 4HJFA 2ZRXA 3GY1A 1ADSA 4KGJA 3E1F1 1M1BA 4LV4A 4TVUA 4EAYA 3L23A 4YCOA 4CNOA 4W93A 1C7SA 2OZTA 1O5QA 2DUXA 3JZEA 4LF2A 4HPNA 3P82A 2QNEA 1H11A 4KRUA 4PTXA 2YOCA 3R4IA 4H2HA 1V7AA 3W7RA 5DMLA 1AH0A 4UQBA 4RDZA 2Q3RA 4HB7A 4ZFCA 3RU6A 3W1AA 4RX0A 3GH4A 4PYSA 1XYLA 3LD5A 1UR3M 3GC4A 4XK2A 3ITYA 3QMRA 3TSMA 2VTFA 4LV9A 1DEDA 1HUVA 4ATLA 2PDBA 2OT0A 4EXAA 3GIQA 3ZOAA 4WIWA 1JCLA 4LSBA 3OW1A 3AROA 4TV5A 1YE4A 1UWSA 4Z1AA 3LENA 3PBYA 2CBVA 3AXKA 2FPYA 1CXLA 1XIHA 3UZXA 4IIDA 2QULA 4BJHA 2CHOA 1NDZA 1SFSA 2WJEA 4AZ7A 1M5WA 3W2UA 1HL8A 3NEHA 2Q8LA 3WYZA 2AQVA 1VBRA 1UH3A 1E55A 2RDXA 1E1FA 3N11A 2H90A 3A13A 5A6BD 1XC6A 2W6RA 4Z1DA 4DQWA 1RLDA 3WENA 4B15A 4DBDA 3GC5A 1LL4A 2D24A 3M0MA 3WY1A 2VX6A 4FHAA 5GNZA 5M1TA 4J9JA 4BEQA 3WX7A 4ZVJA 2Q8XA 4BZYA 4M81A 2DSVA 3SCWA 1BHGA 4J4KA 1TE1A 4Y9AA 4BQ4A 1I2PA 3C0SA 2XJ7A 4DJDA 2B7QA 2Y2WA 5A6LA 2PDHA 1WX0A 3WUEA 4IPJA 3IJDA 4KFNA 4W8AA 1XKYA 4EE9A 1JZ4A 5IBXA 2PDJA 1JZ6A 3I6TA 3T78A 3O6AA 2CBUA 3PJTA 1WXJA 2PZNA 4HA1A 4GFSA 4QCFA 1J0KA 1GVSA 1WAWA 1JNDA 1S1RA 4H9VA 3FCPA 2C1HA 4LS0A 2OX1A 1TV2A 3EPOA 5REQB 4PBEA 1CZ1A 3VAVA 4JTRA 1Z8AA 2Z26A 2UY2A 3EWCA 4LRTA 1V4YA 2BY0A 2CZDA 4A3HA 5TAOA 2QGHA 3P6LA 4P8XA 2IUZA 3M5YA 1OCJA 2D3LA 2E1DA 2VZVA 4JIQA 3DG6A 2WW5A 5FEPA 4YS1A 2O9RA 1TTJA 1XQKA 4E2VA 1XBYA 2FJUB 1R3SA 1ODUA 4H6QA 3PZGA 1XS2A 5DLCA 3RR4A 4DWSB 1YPIA 1KTNA 1JZ8A 2XH2A 4RCXA 3BXWA 3GD6A 1JDCA 3EDDA 3KXQA 4IFKA 3WMLA 3G3DA 1RQHA 3FSUA 4HQVA 3RIKA 3PM6A 1B3VA 1FBAA 4OE7A 3MHUA 1G0CA 3QHOA 3CNYA 5KMYA 4RDWA 4U2YA 1G4EA 4UTTA 4LB3A 2GJPA 1JGMA 5IOBA 2ZTJA 3IUDA 5E9AA 1E4MM 3NQDA 1NQ6A 1JEZA 4AY7A 1Q2SA 2A3HA 2OO6A 3HGJA 2B0MA 1DWIM 3WD2A 2WC7A 2P50A 2CETA 1PAMA 2QCGA 3OA5A 3M6YA 4PUKA 4I6KA 2ZX7A 1VJIA 2ZX8A 1E5NA 3GG7A 3L68A 3PZNA 3BV7A 1OZMA 4QISA 1V3IA 1XUZA 4CU8A 4Q7IA 2DZWA 3WLNA 3I68A 2CLOA 4A2SA 2DEPA 3PZ9A 1EJSC 5A6SA 2QDDA 1EEPA 3WNPA 1EJVC 1Y0EA 4U5KA 3SSZA 3BCFA 3QKEA 1ISZA 1AMYA 5CBIA 3N6HA 3B05A 4JYFA 4YTQA 2PDFA 4F8XA 7ENLA 4KIEA 4GOAA 1B30A 1HFBA 3VOIA 5LXXA 2ZIDA 5CZTA 3MUXA 1XFBA 3W29A 2FPTA 2UWFA 3TQVA 2QUTA 1KWGA 1IWBA 1EC9A 4GPNA 3TC3A 3GDLA 1VENA 3QVQA 3LDVA 4KH2A 3EBVA 4C6FA 5D8WA 3HG2A 1A0CA 3KZSA 4RW3A 2QIWA 3IJ8A 1F6KA 1O5XA 3VNZA 2WZHA 1EWEA 3W1LA 5BWFA 4XIAA 2J6VA 4L6DA 1DJZA 4PUEA 4AVFA 4I7UA 1XYBA 3GYCA 1QI5A 2I1OA 3UWUA 1OSEA 3NZPA 2WVTA 1YDOA 4B16A 2VZOA 4J1OA 4LW7A 1A5LC 4AZIA 4GHRA 3GUWA 4QM1A 3UJEA 4E38A 4ACZA 2WVUA 4DN1A 2OGJA 3ARPA 4O8AA 3HPXA 1VJSA 2FHCA 3CUGA 2E1WA 4IOTA 5FL0A 3C8FA 3SUVA 3G1RA 4GZIA 4MG4A 4BI6A 1C8YA 1KKOA 4DO7A 2OPJA 3A5FA 3B4YA 3WD1A 3M0ZA 2XVGA 1VRXA 1DBTA 3P62A 4M24A 4CNTA 1K8YA 4AC1X 4GXPA 1BXBA 4UNLA 5U7SA 4LOCA 3DFYA 1ICPA 1YLVA 2BGNE 3W72A 4A3YA 1ITUA 4IMEA 2WMGA 3B8VA 1M53A 1P48A 1XLIA 3E0IA 3GM8A 4S23A 3NO3A 3SIMA 3ALFA 3DHFA 1KTBA 4JIIX 1F7BA 1WZLA 1DOSA 1TUFA 1G69A 2PGWA 3H8AA 3FSTA 3MCOA 4F40A 2YDAA 3QRHA 3PUDA 4IUOA 3I3BA 1CGWA 4LEFA 3W9ZA 4UFMA 3FJNA 5D8ZA 3IPWA 3DUGA 1OB0A 4EAMA 3PBVA 1FDZA 3U5YA 1VLWA 1C9WA 4UMAA 4MAVA 3GQYA 5D2TA 3TROA 4DJFD 3BSHA 3LRKA 1GHRA 3H12A 3RN6A 1LQ0A 3BC9A 3II1A 3S6TA 4QEHA 2HISA 1OHLA 3CQJA 3GU2A 3ABXA 3GDTA 2NXHA 1X1OA 2D0GA 4HSNA 3TR9A 4K8GA 4DJFA 2VC9A 3W2MA 3W85A 4LB4A 1C29A 4CLMA 3ZYZA 4DNMA 2VFHA 2QW5A 3G18A 4O1CA 4HSOA 2GUUA 3BQ5A 2JF7A 2OLAA 3I4KA 4ZSUA 4AC7C 3M0IA 3TQKA 4PTWA 3GXTA 3BVJA 3LCFA 1V3MA 3C3UA 2FFCA 1XG3A 4GZ7A 4RR4A 4HBKA 3WFLA 4QLJA 2GVYA 1JD9A 3G1YA 4GIEA 1QK2A 2XSXA 3MY9A 1GG0A 3LRMA 4CU7A 1DJHA 2DZAA 4TTUA 3LPGA 2ZCGA 1FUYA 3EPNA 2D2HA 5DO8A 3M07A 5EMYA 3UG8A 1F6YA 4WDWA 4US5D 1W37A 2WMHA 2PDKA 2Y5JA 3FW6A 2HXUA 3W88A 4OQVA 1ZSXA 3Q2DA 2A7PA 4WDXA 2VCCA 2WYSA 3TN5A 1N8WA 2A79A 1O1ZA 2X7WA 4UOZA 1GW1A 1P43A 1EP3A 1Z44A 4RPQA 3R58A 4O8RA 3FOKA 4IGSA 4QQUA 4JCMA 1I60A 3FXGA 3W2JA 1F07A 3NL5A 2PFHA 3M16A 1OM0A 5F1VA 1UC4A 4GVFA 9CGTA 3AOFA 1GQLA 4GABA 3HJEA 5KTLA 5HNRA 4HN4A 1CXFA 2DT2A 2X1IA 3FJLA 1JI2A 2OZ3A 4W87A 3ABQA 4LQ1A 1M7OA 3S6OA 3MUCA 3O6DA 1XYZA 4HU3A 4MIMA 4KGLA 3DECA 2F84A 1H2JA 2XGIA 3V36A 2NSXA 1ONXA 2EXOA 2WK2A 4AD4A 4WXYA 4MVAA 1HJVA 3WJZA 2Y8KA 4CNUA 3KDNA 3NXFA 4F9JA 1MI3A 2EJ1A 3DCPA 2AGKA 1FQ0A 3A9IA 2V2DA 3HGOA 4UTIA 3S5NA 2WCGA 3ZT7A 4RZ5A 1LQ2A 1RCQA 3EB4A 5I3GA 3MMWA 4QAIA 3TX9A 7ODCA 3ZO9A 4JTTA 4Y8EA 1QHZA 2AMGA 3KBNA 4FALA 1RSCA 3TLLA 3QLDA 2E77A 4B5UA 3TYEA 4AISA 1KGUA 5B7ZA 4UNKA 3QFEA 4AEEA 1VYRA 1NP2A 1PHWA 4CQBA 1BWKA 4XZWA 3BTNA 4HCDA 3VNKA 3BG5A 4LUSB 5F2LA 5FEZA 7REQB 3LHVA 3TYZA 3GDKA 3T05A 2YL6A 4M51A 2H3BA 1BSIA 3H7RA 1XYFA 4UZUA 1GPWA 4NKCA 4PMNA 3RLHA 3W7JA 4JDBA 1PCWA 1W91A 2QV4A 2WOQA 3LPFA 4JFUA 3SUWA 3CUFA 4GUGA 3L5LA 1UD3A 1TMQA 2IKGA 4D8ZA 2VDGA 2YFNA 4XZHA 5M03A 1GJWA 2ISDA 2V2HA 1GHSA 2VHLA 1AW1A 2GGGA 1HGYA 3DERA 4P61A 2D73A 4U2ZA 1VR6A 3HOJA 2V5DA 3WJXA 3EDEA 3N2BA 1KM2A 1TFVA 1TV8A 4I5RA 5MHBA 5FJJA 1TTQA 2CLIA 2H8XA 2XFFA 2X09A 4M3PA 4BKNA 3GFYA 2A3LA 3AFBA 4QITA 1XLEA 3IV8A 1BTMA 2WQPA 4HNOA 3H24A 1CGYA 2ON3A 1YPFA 1GJUA 4QE1A 3RHGA 5I78A 1OFOA 2WJDA 4DO5A 1PCKA 3WBXA 3ABRA 3V5OA 1UD5A 4B5WA 5A8OA 5C5YA 5CZ0A 3TOPA 3FAXA 1UR8A 3NQ2A 1JXKA 1Q6EA 1G4PA 4LAZA 3VIGA 4IF2A 4XISA 3EX1A 1ELSA 1P7TA 2WWDA 1PKYA 3URNA 6PTDA 4IIHA 1A49A 3NQCA 5LNUA 4H9YA 1RLCL 2WB5A 2VXNA 3G1AA 1E56A 4H6RA 3MYOA 3EDFA 3UFYA 2X0SA 2CZEA 1SGJA 1Z6KA 3CUZA 4GQRA 2V2CA 3P0WA 1XPYA 1DTUA 2DH3A 1XGDA 1I2NA 1OFRA 3QM3A 4XAFA 3NIYA 3TLQA 4NAEA 3WH9A 4GIAA 4J3WA 3VOCA 3JRKA 3LZ3A 4RPPA 3ZWTA 5DMNA 4XD3A 3ZVHB 3OIHA 4JTIA 2OQYA 2J77A 3KHJA 1TPEA 1PEZA 3W74A 2IKHA 1VEOA 3GHTA 2PDYA 1G01A 5ABFA 3GG0A 2JGYA 2F9RA 3G2GA 3KM8A 4FNSA 2BP1A 4ERAA 4O10A 1KRAC 4ZGYA 4AD0A 4S39A 4PTVA 1LBMA 1UR0A 2GGHA 1T41A 1UP0A 1ZBKA 4WVXA 4IIBA 1A0DA 3QR3A 2BZNA 2XU2A 3ZWSA 3AS3A 4Y96A 1US2A 4DJFC 2V5BA 2GZXA 1TZZA 4KETA 4DJED 3FK4A 3SGUA 2ZZ1A 4MKSA 3VPLA 5A5WA 4YYCA 3T8LA 2WLYA 5C9UA 5A6BA 4CD6A 4XSLA 1Q45A 3G6LA 1O66A 1XLGA 3M9YA 2QUVA 4DBWA 1LYXA 7CGTA 5EA9A 3PFRA 3WNLA 1E4LA 1UWQA 5DBUA 4JHZA 4FF5A 3APGA 3O63A 1Q6RA 4DUVA 2FPVA 3GXDA 3GRIA 1Z3NA 2W91A 3OHIA 4MKVA 2O0TA 1UKTA 4MPKA 5D9PA 2E3ZA 1HT6A 4RKAA 2XIOA 1SW3A 3NYZA 3GDRA 5CJMA 2E68A 4PEEA 2NQLA 1TV5A 3GTHA 3TOYA 1MZHA 2W9MA 2Y85A 3A4JA 4ZB0A 4Q32A 2QS8A 3G8EA 4HKPA 3TR2A 3M0YA 5DCEA 1F5ZA 5B80A 3KVKA 1M3UA 3AZTA 5E09A 1M7XA 2QMKA 1W1YA 5HANA 5F2MA 3GU1A 3MI6A 1QUMA 3VGHA 2A3AA 2PDLA 4GKTA 2OZ0A 2B7PA 4GMEA 2OFJA 4HOWA 3WH7A 1CT5A 1OG6A 2OEKA 2ZUNA 3CC1A 3WQ8A 3AHVA 4NF7A 5I6SA 3W6YA 3IV3A 1AZ2A 1DE6A 1Z41A 1WZMA 4IMDA 3W71A 1EDQA 4R85A 2OGYA 1HJXA 1SO4A 2PI6A 3CK5A 2PF0A 4E4PA 1DWGM 4GH1A 2IMRA 1CXEA 3CHVA 3ZSSA 1FP8A 2F8QA 3LXCA 4MB1A 5E5CA 3UWQA 1XIMA 4RLIA 2VENA 3TE9A 1ONRA 3V0SA 1BKSA 2QYGA 2VD9A 2XIBA 3GDBA 3W7CA 3LSBA 3AUJA 4PB4A 3DIPA 1V6TA 1XJBA 4NNAA 1V6WA 1OFBA 3LI0A 1YYAA 2WSQA 3MO7A 3GO2A 1VPXA 4A05A 4WD0A 1OGSA 3NSNA 3WQWA 1AD4A 2NXIA 2HROA 5I3KA 3TDFA 4FPSA 3W07A 3RUBL 3VCNA 2XFYA 3DHUA 1MEHA 2C18A 2BFGA 4L61A 5AZ0A 1W3JA 5DMYA 4R27A 1W3NA 1JRBA 1YHTA 4PCTA 3GXPA 2HEJA 3ZJ6A 4LAOA 4UZSA 3V5CA 3UVAA 1A5AA 2WJZA 4V27A 5KEZA 1AODA 4U3CA 2P88A 5HJXA 3G24A 1GTEA 2IQTA 3L0GA 1JPKA 3VMNA 4IGMA 1KTCA 3VX0A 1QFEA 3P5ZA 4MZ8A 1V93A 4L64A 3VIJA 5BCAA 1TIMA 3OBEA 5HMSA 4ML9A 4XIMA 3BE7A 1LROA 1G94A 4RXGA 2OOGA 3GHSA 4IPPA 1ZJHA 1K02A 3CU2A 3M5XA 3H21A 1E0WA 3NA8A 3VINA 1FWEC 1PHQA 4DUXA 4Z08A 1NFBA 3NVTA 2VQUA 4L56A 2V30A 1QW7A 4D1JA 4UUIA 4ZB2A 4FOKA 4X3ZA 4IQEA 3EWZA 1EO5A 3PBUA 1Q6OA 1E5JA 3THUA 5CJ5A 1L6FA 1VFFA 4QAWA 4AMCA 4PUNA 1WXZA 3S2CA 3R43A 3C0JA 3EMZA 2GJLA 1EFZA 3IVUA 5ABHA 4H04A 3IVTA 1QWKA 4N7QA 3WD3A 3FV9A 2W66A 1S2AA 1QOQA 1DE5A 1W5MA 1H50A 3JZUA 4MNKA 3AU6A 4YHEA 4QDPA 3BUVA 4WUIA 1H09A 1KFJA 2V81A 5I3JA 1PUDA 2YDSA 5G2WA 3E0WA 1UB3A 4FB7A 2J79A 1QNPA 5H8MA 1TPB1 1FWBC 1XL9A 1ZPTA 3F2BA 3AC0A 3ELFA 4HD5A 4I8YA 1E6ZA 3TW9A 1C90A 3NR0A 1K6WA 3P60A 3CYVA 5ABFB 1SJCA 2CLHA 2J24A 5JQ9A 5FACA 4UMCA 3I7RA 5K3VA 1H7XA 3NL6A 4HNLA 2WHMA 1PKNA 1BVWA 3F2DA 4UXDA 1R47A 4F79A 2PWGA 3W0KA 2G3NA 1C8VA 2VEFA 3TC6A 2HDJA 2Z2AA 2IXUA 1BTCA 1KRMA 4GGHA 4TX9A 2OWXA 3F4VA 1XP3A 4O12A 3L2IA 1J93A 4MYAA 4IJBA 1R2SA 3VTRA 5AOUA 2EGZA 2QVHA 4N9EA 5HUOA 2TSYA 4LNCA 2V82A 1PTGA 3S5YA 1FFRA 3IACA 2CFFA 2FLIA 4BF7A 1A4MA 3L4XA 3QV8A 3M7WA 3DFPA 5A6KA 1YE6A 3MMUA 4S3EA 3E96A 5BMXA 1A5KC 1Y5WA 3EKLA 4H8HA 2R1MA 3EX2A 5FCZA 2VMFA 1DJQA 3TMLA 4W8LA 5FL1A 3A6OA 1W1TA 3GDMA 4H01A 2EJAA 1XSIA 3B3DA 3AMDA 1S3TC 3BCJA 4GQQA 1IEWA 4YVPA 3AIEA 3H2OA 3MVTA 1TB3A 3N3TA 2RHGA 1Y65A 3QOKA 1XIEA 6CGTA 3L2LA 4X9YA 4PMYA 2VL4A 3TNOA 3ZS4A 1RJQA 4HMDA 2YXGA 3BCDA 1VFUA 2OZ8A 1RY0A 5C8BB 3EKZA 3M64A 4JX6A 4U4MA 2FVMA 3SEPA 1NOUA 4NVTA 3UWVA 2OSWA 5G2HA 1WDQA 4F3HA 1LWJA 4CKQA 3K5XA 4LUIA 3UYIA 1FWAC 3SO7A 3E6EA 3L9CA 3XINA 1JDAA 1I0DA 3VNDA 1NSJA 3MKCA 4AHOA 4HU4A 3I10A 4IIEA 3FKKA 4RZ6A 4ICNA 1BYBA 2PODA 5EMLA 1PKMA 2QEZA 4U3AA 3G0XA 4I7VA 4ZQOA 1SUXA 5FF7A 4JY9A 1BXNA 4UBPC 3P8JA 2J25A 5FKYA 1VEMA 2CLLA 4DWSC 2AKMA 4WY0F 3GTXA 4MWAA 3TJXA 1WUFA 4I9AA 1OJXA 3A4WA 3ECQA 4DZHA 3LI1A 2GSEA 5IDZA 3E0LA 3NXLA 4GY0A 2A3CA 2VWTA 4N9CA 4ZA0A 3UZ5A 3HG3A 5AC8A 1J79A 2PDCA 2X2YA 3CMJA 4UTHA 3R11A 4UQCA 3VILA 3LQGA 3SSJA 4IG2B 5L9FA 3HQ1A 4LYRA 1U1UA 4TO8A 4UFJA 2YZRA 4DX3A 3PZMA 5GQBA 4I7WA 4RL3A 3ANYA 4O1FA 2C91A 2CWXA 3CHEA 2CZVA 5F7UA 1Z32X 1R8LA 4GH3A 3WG6A 5I77A 5AB3A 2XGZA 1GWJA 1KB3A 2BOEX 1TWSA 3W2LA 1XI3A 1DORA 2O56A 4BF9A 3NQ6A 1X8FA 5D33A 4ZQNA 4UFHA 4RE0A 1QCWA 4LEQA 2BXZA 3ZIZA 5ENLA 2X16A 4HK5A 3A22A 5ECUA 2YZ5A 3BAKA 4B90A 1V08A 4QQ3A 4PUUA 1W9BM 4DO6A 4EXBA 3OO2A 3THAA 1OYAA 2PLKA 2Y7FA 2FTYA 1EDGA 3PJUA 3RMEA 4IQDA 4HSHA 1B9BA 1PZ0A 1N55A 1OVDA 2BX7A 4IFOA 1WO2A 2XG9A 3T08A 4CQCA 1UMYA 4OV4A 3PJXA 2G3FA 4DYEA 4F9DA 2WPGA 4Q8VA 3L65A 3BW4A 4L4OA 4Q7BA 4GQBA 2E6YA 2OT1A 3HO8A 4CD5A 3B9EA 2OEMA 4QDWA 1S46A 2VD8A 5AC6A 3R8GA 5HR6A 4HOZA 5LKYA 1YIXA 2VDIA 2F61A 1GVFA 3AHXA 4ZQPA 4XZNX 2VURA 4MY8A 5CSYA 3NUKA 3AYTA 3R0KA 4FNPA 1B4EA 2QPXA 2INZA 5CSSA 3PZOA 2WZTA 1KCZA 4P7OA 1UW9A 3E49A 4IPLA 3N2CA 4R7OA 2EPLX 3DGBA 3MMTA 2UY5A 1WOAA 5TNVA 3WDPP 3OVGA 2J8GA 1GZGA 4AB4A 3EX6A 1GTHA 4O18A 2QHAA 1DWHM 1K7EA 1YDVA 1K9EA 1R9ZA 1E1EA 1MW3A 1U83A 2OXNA 4LF1A 4XVDA 4Q22A 1LJYA 1S5NA 1WE5A 5CPLA 4HHPA 4CUCA 4JIRA 3NSXA 2P10A 1XM3A 4F0HA 1QTWA 3TWBA 1OK6A 3C52A 2GVEA 3KEHA 2YA0A 3GWQA 4K68A 1K8CA 3ITGA 2O7SA 5A95A 2Y24A 2GJNA 3DI0A 3WNOA 1IHIA 1RXOB 3W7DA 3R0DA 5TF0A 2B7NA 4FMVA 1E51A 3HB9A 5CC7A 3ANUA 1A53A 4I5UA 2YKKA 3WEOA 3R13A 1FA2A 1JJKA 1E15A 4GYJA 4UTWA 3BZGA 1U1JA 3GVVA 3WDIA 1ZFJA 4PUMA 3WKZA 1PYMA 1Q5MA 4KWUA 4GJJA 3O07A 3WLOA 4H7VA 3M0LA 3S9IA 2CLKA 4ZTXA 4B9YA 5ABEA 2VX4A 3R6IA 1JDFA 4NAFB 2V68A 2F6UA 1RP9A 4ADUA 3NG3A 4LVFA 2YDQA 4AX6A 4QG8A 4WJEA 3AS2A 1KRCC 4NSBA 2FIQA 1YEYA 4ZENA 3C56A 1DJIA 3HMCA 4ML4A 3IEBA 3R10A 3T09A 3G5EA 1PIIA 3W1XA 4OVXA 3SQMA 3EGJA 1DP0A 3LLFA 3RGTA 4EWND 3AIUA 2Z29A 5EMMA 5FSDC 1FTXA 4JFSA 1R6WA 4JX4A 3RU8X 4IXXA 5JH2A 4HZ7A 3VM7A 1TRIA 3I3DA 3VGGA 2IKIA 2ODOA 3SN4A 2VEGA 2ZXAA 2GQ9A 1OQFA 3PTMA 2R1PA 3WH6A 1S2VA 2VC7A 4J3ZA 4GNVA 2J6XA 4MLRA 2ZRWA 4PULA 2E40A 1FHDA 3K4AA 2EPHA 2L5HA 3P14A 2D2OA 3NZRA 1UOZA 3C2VA 3VA8A 2CBIA 5HNTA 1SZEA 2C0AA 1YPXA 3E5PA 2FVKA 1WCGA 4IL0A 1JYWA 4L6OA 3QYSA 3W4RA 1US0A 4WY0A 4BCEA 4EK7A 1DXIA 4YVVA 1ZB5A 3BGAA 1WAUA 2JIWA 3NOEA 2QGYA 4DVOA 3M4HA 3W7LA 2J13A 4HIBA 2GVJA 3TYCA 1S2TA 3TA9A 4WR3A 5CC5A 3MV01 1UD4A 4EVZA 1ONWA 3NGJA 3N34A 4IWWA 4PZVA 3BG3A 2NT1A 3S83A 4U5IA 3K8MA 5HBFA 1JZ3A 4EPBC 1EXPA 3BOLA 2DY3A 3LNMA 4JEQA 5HATA 4KFPA 2I16A 4KEVA 1W9PA 4O50A 1SYTA 3LCIA 3BL3A 3EZ4A 2NQHA 1W3KA 5H2ZA 3WH5A 2PCEA 4LYPA 4Z2HA 4KQNA 2R8WA 4P8VA 3T40A 3WNKA 3QTPA 1K4HA 3A3XA 3QEZA 4PRTA 3EOSA 2O92A 3UF9A 3R5EA 3IJQA 3OZPA 2VVNA 3LG3A 4N02A 4KIRA 4IXHA 1O68A 2QDGA 3URQA 1OFAA 5IHSA 2Y8UA 5BXPA 1FH8A 4DEFA 3MWCA 3S9ZA 3V7PA 3V4BA 1ZCOA 4HCLA 3W84A 2JKPA 1Q63A 2CESA 4JYDA 3DAQA 5HK4A 3SY8A 1J9YA 1CXIA 4W5ZA 3R1ZA 2H9AA 1IXPA 2GSHA 3UWYA 2CITA 1P5BA 3B03A 1EBGA 1IGSA 4NHVA 3LV5A 4M29A 2J8TA 1H49A 2X0HA 2Z1SA 1ITCA 4XZIA 1BRLA 3EWBX 1E0XA 3LEPA 3BJSA 3TN4A 4H1ZA 1E9LA 4R9XA 4AIBA 2G5WA 3LCXA 3R8HA 4GIRA 4K1GA 4GQGA 1L8PA 3U8GA 1P1MA 4WKFA 2G0WA 1V5XA 4UTMA 3VABA 4H00A 3WFAA 3VDBA 3PTKA 1UA3A 3BK0A 3WZ0E 1OFEA 2E5BA 5KSWA 1XFCA 1CXHA 3R89A 1KW1A 1XLAA 2PSNA 2GUBA 3MHFA 1QO5A 1EJ7L 1Q65A 5E6ZA 1TJRA 1L2UA 1OX5A 1ME9A 3S1VA 1NF0A 3U6WA 2NVAA 3B8WA 1MFVA 2PE4A 1QW9A 3ZSTA 1OX4B 2DUAA 2ISWA 1EWDA 4R53A 1HVXA 5D03A 1WPCA 1IE7C 4WEVX 3CB3A 2QQ6A 2Y1HA 3S2JA 2HNEA 2PDGA 3O06A 1XIBA 1DJWA 1LTDA 1EF3A 2G8ZA 4ORMA 3ENLA 4MF4A 1FVPA 3KAOA 3SJ3A 1UD8A 3L5MA 4PL2A 3W1QA 3AIRA 3VI2A 2G50A 1ECQA 1XDJA 3WK2A 1HP5A 2B7OA 5JH1A 3BLOA 1X38A 3JR2A 1I2QA 4ALDA 1UWTA 1GK8A 3E9AA 4I6VA 1VBJA 1LDCA 4HP5A 1MEIA 3WJYA 4LY8A 2WLZA 1Y5XA 2VEMA 2VO5A 1GNXA 2PA6A 4FSAA 3SQSA 1M7PA 1V3LA 5H1WA 4JHOA 1XH2A 1SMAA 2BODX 3TV8A 3R79A 3O6YX 2ZWYA 3F2CA 1JL8A 1UUOA 3F4DA 3CQIA 3EEGA 3JW7A 5CAHA 1BGGA 2PURA 3G77A 3MQTA 4JTKA 2GQ3A 4E4FA 3CZKA 1NOFA 2ISFA 3HTWA 1EZ2A 3T0CA 5AKQA 7PTDA 3VDGA 5FAGA 5AYZA 3RG6A 1LL6A 4AWEA 5FI8A 3CYJA 3THCA 5K2ZA 1UBPC 3VMOA 3MDUA 1EPXA 4WXZA 3GC2A 3VFCA 1X97A 1X7FA 3ARRA 1AJZA 4ZZ9A 1CWYA 4XAGA 2ZUSA 1JD7A 2DFAA 4UIOA 5LIXX 1J96A 1KM1A 1HJWA 2XINA 1XDLA 1QBAA 4S3AA 5EGRA 1GKPA 1H5VA 1JVNA 1B90A 4Z2IA 1XHGA 3M0JA 2XIIA 2YB1A 4AZHA 1RP8A 4WJ8A 2Q01A 2QCEA 4AZ5A 1P1XA 4MLJA 1B2YA 2G41A 4GUIA 3L4UA 1LORA 1TPC1 2VJXA 3CV6A 1BG9A 4GJ1A 4PMVA 3WMCA 4QJ4B 2ZICA 4C6QA 2P0IA 4B2DD 3PN8A 2DT0A 3NSMA 3HU7A 1UOKA 2J7CA 1N7KA 2VOMA 3LBOA 2FB2A 3STPA 4B3ZA 2QF8A 1A4LA 1ZBWA 3N25A 1PYFA 1GOIA 4MZ1A 2W4XA 3H2FA 3PY2A 1V02A 2QR6A 3CQKA 3QY7A 4JXCA 3CUIA 3LBMA 4ZE5A 1AL7A 3UYCA 4HJWA 2J62A 3TVAA 1QOPA 2VEIA 3NOYA 2RDWA 4NXSA 2BVWA 2IPWA 2XVLA 2Z7KA 1TVPA 4QG6A 1GOOA 3EA2A 1TSIA 2QV5A 3FVDA 2HNHA 3SCPA 3MS8A 3U4FA 4UCGA 1OADA 4GZEA 3DEQA 3EEZA 4E4UA 1M7JA 1CB2A 1HIZA 3BAJA 3WK0A 1XUUA 3PG8A 4HTBA 1KXQA 4E2BA 1CIUA 4KWOA 1D7KA 3CEPA 5E9XA 5HR7A 1XKJA 1JUBA 3WUBA 4YTRA 4DBEA 4H8VA 3GXIA 1TV3A 4JKLA 2ISSA 3C4UA 3N2MA 5AYXA 3LCWA 3N29A 4TVDA 5K9XA 4L4PA 3HBLA 1VFMA 4KEMA 1OCNA 1WA3A 3NAVA 1IT7A 4GY1A 4Z17A 3A64A 4DI8A 1WZAA 4QJ3B 3UA3A 1LRTA 3TYUA 4M56A 4TMBA 4TTGA 4NI3A 3NWRA 3RK8A 4L7ZA 1IZKA 2ZBTA 4KS0A 1MW0A 1ITQA 1ICQA 1NEYA 2PAJA 4XKYB 2FTWA 3LM3A 3S3GA 2YW4A 3GYEA 2RJHA 1NAL1 4KCVA 3F03K 4LUTA 1KKRA 1JULA 5ABGA 2JE8A 5TD4A 6XIMA 2XDFA 4O0ZA 3BJTA 4V2XA 3SCTA 3VUPA 3RO6A 4NI8A 1DVJA 1FP9A 3VKBA 3WLQA 4IMCA 3IIZA 3VK5A 2D23A 1WKDA 1UKSA 2PRMA 3LTYA 2ZX6A 1OFDA 2VOTA 2ZE0A 3DOPA 3QFWA 4LFYA 2IXVA 3TQ0A 3U4AA 4O16A 2UBPC 3ONCA 2OWWA 2XISA 3IAPA 1G6CA 2DZVA 3PB0A 2ZA1A 4MGGA 3I7QA 1V77A 3WJSA 2X05A 3TAKA 1SR0A 3USZA 2C13A 2BSLA 5HAOA 3N17A 2XZ7A 2WAGA 1FOBA 1LLOA 3PFMA 1J10A 1JRCA 2WSYA 1JXJA 2QCLA 2QKFA 4S3JA 4CNSA 1K7FA 3AUOA 1LWIA 2R6OA 3V5FA 2XZ9A 3PZQA 4PRWA 4PA8A 3TFXA 3CHCA 5CJNA 3WF2A 3K46A 1PDZA 4XV0A 4NRSA 3HA1A 3PUOA 4LCQA 1GOKA 1Q8JA 3V0UA 1KGWA 1JZ2A 5HMEA 2OODA 1IWAA 1SW0A 1E4IA 3ARVA 2HV5A 3DH7A 4MAZA 1ZZMA 3OBKA 4DF0A 2Y88A 3QY6A 5HWMA 3C8NA 2EHHA 3PHAA 5DFAA 4DPPA 2BS9A 5LIWX 1AA1B 3WBYA 1FWHC 4RZ4A 1ISYA 4WZHA 3KTSA 2ZXDA 2E9LA 1EP2A 2AQOA 5T9CE 2FTPA 4UNIA 3W7HA 3QR0A 2WMKA 4PN2A 2C7FA 3VD7A 4HZ8A 2J7BA 1Z48A 3ITTA 5EMKA 2IKJA 1MW2A 2HJPA 4RV8A 1G5AA 4US6A 4F0MA 1KLZA 4C5YA 4NUWA 3AHTA 1V7YA 2LLEA 4ECLA 4O4WA 3SRKA 4X2PA 2VRKA 4M1RA 1BQGA 2WMIA 1ZLPA 1DQUA 3N9KA 1B31A 4C1NA 5F4XA 3AIBA 5AYYA 2J27A 3WQEA 5CQ1A 3OB8A 4RK8A 1AL8A 1XIDA 2RUSA 1T96A 3QZAA 3B9AA 4LAUA 4E6MA 4Q3MA 5I0DA 3VNIA 2ZZ4A 2ZVIA 4LUYA 1JF5A 1TJPA 3FGCA 4QG9A 1H4PA 4NX5A 1H41A 4F66A 2BMBA 3Q37A 3WD4A 3C3NA 3MP3A 4S3CA 1XF0A 2EG7A 3WO8A 3PNUA 3R12A 4IIGA 5F2IA 4FNUA 2VFFA 1R0MA 1FHUA 3N6JA 2ZRVA 2VVSA 5LIKX 1P4CA 1SR9A 3B9OA 3EB2A 2QAPA 2OSXA 1BD0A 2BLEA 3CWNA 4C7GA 4LUJA 4JTCA 2CWNA 2BOFX 1TPDA 3IIVA 3BGGA 2OEJA 3CUXA 3HZ3A 4YIWA 2ZUMA 1EGZA 4DYKA 2YL8A 4FA3A 3RX4A 3CUJA 3UJ2A 3N2TA 4EACA 3AS1A 3GNXA 3L4ZA 4HA4A 4IQJA 2C71A 1FDJA 1E0VA 1QAPA 5A2CA 4Q8MA 1A3XA 3EXTA 2GDVA 5SWUA 2PWFA 3U3HA 3IRDA 5F4SA 2WM1A 2NWRA 2PTZA 1JCNA 1W1B1 1YBQB 4C6KA 1JDEA 1EJRC 2G37A 4GVHA 4RDVA 3EA3A 2OR2A 2DJXA 3LGDA 1CLVA 1MWOA 3GVWA 3APYA 1T8XA 4A3UA 1E6NA 2QF7A 4ZR8A 1NWRA 4LBRA 5I3DA 4PCPA 3OP2A 4C91A 4I5XA 4NZCA 3WQ4A 4AIOA 2NW0A 3WIJA 2NT0A 1J18A 2IPJA 3Q45A 4MZYA 3GB6A 4OUEA 3LZ5A 3QHNA 1HKVA 1ML1A 3ZQ9A 2E7FA 3WQFA 1LRQA 1M01A 4XUGA 3ITVA 3JU2A 3W7GA 4IICA 3W7KA 3S1GA 4AD1A 4W7VA 4UQDA 3HN3A 1ZU8A 2J7HA 4GI6A 3MZ2A 1WP6A 3MDWA 3ZFHA 2YFOA 3B8SA 3FN9A 4YYFA 4HNCA 5EBUA 2G95A 4KEZA 1S38A 4HTYA 2WC3A 1QNRA 2J7FA 4E3VA 2CLFA 2ZC1A 1ZJBA 4QSFA 3KWXA 1F3TA 5TBOA 1KCXA 3T0AA 1IXQA 3ARXA 3ATZA 4J28A 4MHBA 1DQWA 5BU6A 3W1PA 1BSLA 3L2MA 2P53A 3RRXA 3AXHA 3LB0A 3TTYA 1F3XA 2WNNA 1CECA 3KP0A 3CBWA 4E2DA 1XLKA 1NFPA 3DKJA 2P8BA 1O5KA 5EPDA 1RPXA 1ZHAA 3QXBA 3KCLA 3N19B 1J2BA 3S9YA 3T6CA 4RE3A 3G0UA 1YTDA 4E3TA 1W56A 1V0NA 5HWJA 1L9WA 4M82A 4INFA 5LGXA 4J7RA 4OUIA 4AUBA 3RPDA 3MMDA 2A1YA 4GK8A 1C91A 4DLMA 2I9UA 1IF2A 2PDIA 1BYCA 1BRLB 4XTDA 1WB0A 4J3VA 3REQA 1TRDA 2RGLA 4NJIA 3RO8A 3UU0A 3W27A 4BQ5A 3AXMA 4EKJA 5DANA 5A6MA 2YX0A 2ZA2A 5I2UA 3RITA 2X42A 4J35A 5C9WA 1MUMA 4LGXA 3WQVA 2H9AB 5BROA 4ONVA 1K8XA 1DPMA 3T2PA 1IXNA 1FCBA 1GONA 4EWJA 2FKPA 1SPQA 1LBFA 2Z6IA 3OGSA 1GQNA 2DH2A 1OINA 3CO4A 1AQ0A 3CMFA 3MJMA 5FF2A 3W6LA 3GU9A 3RLGA 2FHBA 1Q7ZA 5FIPA 5PTDA 1JCJA 1V79A 2HVOA 3QKZA 3HPAA 3W73A 5AHFA 4JKKA 1DIDA 3OU8A 3LM7A 4S2BA 3WUGA 3FDKA 1QI0A 1EGVA 1QI2A 2GGJA 3QGVA 3LCHA 1P6BA 3H2EA 3FXYA 4FK9A 3S5SA 3S1WA 1PX4A 2RDUA 4GKLA 3UY8A 3CASA 1V8EA 3NQBA 1TMLA 3ICJA 4K7VA 3RJXA 1POKA 2A7NA 3C2FA 4DAIA 4UFIA 4UOQA 5DXYA 3GNOA 2XVPA 1K9FA 1S2CA 1OFQA 1JFHA 1F6PA 2MUCA 4JY8A 4NZ5A 1SZFA 3C86A 3C2YA 1NIUA 1M04A 1R3YA 3ES8A 1EIXA 1H1ZA 1KBJA 3GX9A 3WFZA 1POJA 2YLLA 3ERPA 4PEKA 2FMNA 2OLHA 5J5DA 4N6FA 3AMKA 3WQ6A 3TUUA 2ACQA 2E9BA 2HWGA 4PBGA 3G3MA 4I9JA 3I4EA 1JCYA 3BANA 4AQLA 1W3IA 1HKMA 3WDJA 1ISVA 4DELA 4JCLA 1HO4A 2RKXA 5BOEA 1I1XA 4ZTYA 4PTMA 3F5JA 2EPMX 3NDOA 3GXFA 2EPKX 3I6EA 1N8FA 2GWNA 2W63A 4OJYA 4Z2JA 2FB3A 2NLYA 2G3MA 4W85A 1Q7QA 1VZWA 4ZXLA 3BZJA 1AW2A 4P7QA 1E0TA 3EWXA 4CN1A 3W02A 3Q94A 3U0HA 2ZA3A 4H9TA 2BBFA 4OWGA 2YCLB 3NVDA 2XSAA 4GXWA 3A23A 2ICSA 4Q8NA 4GBUA 3RX2A 2E9MA 4XD4A 3SN1A 1WDDA 3V0TA 2PCQA 2VM8A 4MWAC 3H2AA 3F5LA 1G4TA 1SJDA 4UTUA 1YKWA 4F4RA 4OZOA 1RVGA 4B5XA 2WSPA 4AWTA 2QAFA 1TJ2A 3PTQA 2V3GA 4MDPA 3O05A 3KDOA 4A8NA 4XSMA 5G4WA 3HQOA 1Q4WA 4PCSA 1SJAA 4NIRA 2D3NA 3LHYA 1TX0A 1X96A 4GUFA 4WKAA 3WN6A 1B57A 1TX2A 2PGRA 2JQXA 3WD0A 1QNQA 3G6MA 2JKAA 1LCOA 3W7NA 2MNRA 3G1DA 4YVXA 3D5HA 1UR1A 3LK6A 4W4QA 2V0TA 4D8LA 3VGDA 3CB8A 3HURA 2EBNA 4MTVA 3KVMA 4GUHA 5HOSA 1TV4A 1LG1A 4O53A 2J75A 3FJ6A 5GNXA 1EL3A 4XD6A 2OLSA 1Q6GA 4Q6XA 2PTXA 4KWVA 2W92A 1W0MA 1Q6QA 1KM0A 3M0KA 3WQ5A 1ODZA 4KEUA 2PP0A 2QUNA 2EG6A 1J11A 1RAKA 2ZOXA 4W7WA 4HA0A 4IP5A 3MUZ1 5CGTA 1A50A 2NQJA 1MUCA 3CS2A 1DJGA 1TUXA 2YBUA 2ACRA 3SR7A 2QCHA 1V6YA 3SCOA 3SCSA 2ZDRA 3KS5A 2HBVA 2EEXA 7TAAA 3N2XA 2OSYA 3TTQA 1JUEA 4FX8A 3RM8A 4Y8FA 4MNLA 4JR5A 1JDDA 3NL3A 1S3HA 3TJLA 4C6MA 3ONBA 3DHDA 4PMOA 4Z0SA 4AH7A 1QPNA 3DGRA 5HMFA 3WLJA 2DT3A 4IFKB 4QNWA 3LNPA 1VGAA 1V6VA 4MKNA 4MNJA 2POTA 3TONA 3GTFA 2BNJA 3QC0A 1N82A 2GFTA 3R8RA 4DI9A 3LHZA 2Q6ZA 2XWEA 1RR2A 3KVLA 3WLIA 1EPVA 3DI1A 2QUUA 3UPWA 3VMPA 4DF2A 1Q6DA 2Y5SA 3ATYA 1R87A