1QK2A

Wild type cel6a with a non-hydrolysable cellotetraose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
source organism Trichoderma reesei
total genus 137
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qk2A00
4AVNA 3A9BA 1OCNA 3ABXA 1UP2A 1OCBA 1UOZA 1TMLA 3VOGA 4I5UA 1GZ1A 2BOEX 1BVWA 1QJWA 3VOFA 3VOHA 3RPTA 4AX6A 4B4FA 4I5RA 1HGWA 1QK0A 1OC7A 1QK2A 1OCJA 3VOIA 4AX7A 3VOJA 1OC5A 2BOGX 2BOFX 4AVOA 1DYSA 3A64A 4A05A 3RU8X 4AU0A 1UP0A 1OC6A 1UP3A 1HGYA 2BVWA 1CB2A 2BODX 4B4HA
chains in the Genus database with same CATH superfamily
1IR1A 3PBUA 4AZCB 5H8PA 1NY1A 3O6YX 2Y70A 4I90A 2GJRA 1YDOA 2WSPA 1XG4A 1E0UA 1QOQA 1GYNA 3SCNA 5CG0A 2WMGA 1WQ5A 1T41A 2J7FA 2YIHA 1EQPA 3KLLA 3MMTA 5K2ZA 4Y8FA 3ZYZA 3WX7A 4GFSA 3FV9A 2EPNA 1M7XA 4WKHA 3ATZA 3N6JA 3ISIX 3TR9A 2G3NA 1XIDA 3MSYA 4A6GA 1ONEA 2W0UA 5DCDA 4ZZ9A 2PDPA 4HOXA 3AUJA 4YHGA 1L6WA 1V08A 4CQDA 3QV6A 1F7BA 4PUJA 2BV9A 2PF0A 4NP7A 3ZQ9A 3AIRA 1HO1A 4A3UA 1P1MA 2CZFA 4QLKA 3V18A 4KEUA 1V5XA 3K2GA 3W26A 1EB3A 1JEZA 4EF8A 2ACUA 1P48A 1HJXA 1LLZA 2OWWA 1FDYA 2ABBA 4MY1A 1QPNA 2ZZ1A 1HKKA 4MFDA 3R6IA 2Z26A 1H09A 3PZIA 3S46A 4LVFA 2VRJA 2PS2A 3I65A 1TTJA 3JU2A 1M7OA 4GMEA 1OG0A 1V51A 2OODA 1OJXA 5CH9A 1EC7A 3SCUA 4JYEA 1KFCA 4UTUA 4PRTA 3ZFHA 2QCFA 1HG3A 2BTMA 4TU1A 4BA0A 5AC5A 1CXFA 1GYMA 1KD0A 3E38A 4AZGA 2C13A 3ABRA 3QGVA 2PDFA 2CKRA 4B5UA 4GG9A 2JKAA 3HPAA 1VB9A 4M6UA 4KEMA 5M17A 4NL1A 1WDWA 2ADAA 3V7PA 4K8HA 3W25A 3FY1A 1EZWA 3FIGA 5AVNA 1VYPX 1ITXA 3H2EA 3TYCA 4W7VA 1KGWA 4GY7A 1EWDA 2HRWA 3TN5A 1J0YA 1KBKA 4DO5A 4FAMA 2D69A 3I7SA 1I2NA 1TMQA 3STFA 2WWDA 4L1GA 1KBJA 1OSEA 3R94A 1VRXA 5GVJA 1GJWA 5EGRA 5CLWA 7A3HA 3E0FA 4GLEA 5AYIA 3CXOA 3DHPA 1GZ1A 1VC4A 5IFTA 1W5NA 4LAUA 4AZ6A 2BB0A 5AC8A 2A1YA 3TN4A 3GFZA 3UP8A 4GOAA 5FSDC 4XX6A 3TN3A 1LTDA 2VGGA 4JIEA 3ABZA 3C4UA 4NRSA 4DJDC 1E73M 4QIUA 1IZJA 2EG6A 3NL3A 5D32A 4GK8A 3VE7A 4UMAA 4MPKA 3M9YA 3BPWA 5E0KA 4GZ7A 1SFSA 4UQBA 1MNSA 3E12A 1MVYA 1VRDA 4CQ9A 7PTDA 3VDHA 1Z6KA 3GDBA 3R7MA 1W3LA 4GPNA 3AXIA 3DFHA 3MUCA 3QQ0A 4OKDA 3LLXA 4AD3A 3PP7A 3OZYA 3UNDA 1P0NA 1XQLA 5C7HA 3APGA 3E9AA 1AW1A 3TTYA 3W28A 5A6KA 2ESCA 2YZRA 2C19A 4H19A 9XIAA 3KBMA 1IEIA 5J8LA 3BCFA 2YJQA 4A4AA 3QJAA 1ZB5A 1NFPA 4XZBA 5EMLA 1LM1A 2G4FA 1PDZA 1KC7A 3T9PA 5DANA 5EPDA 3S1WA 3GXTA 1FFQA 2UBPC 1KKOA 6TIMA 3SM0A 4TTGA 4FEZA 3ITYA 4RCXA 3BWWA 3KS6A 1CWYA 1TJ1A 4HSHA 2ZWYA 1QK2A 5LGZA 2PLMA 3VGBA 4RZBA 4GWEA 1XLKA 5DX7A 6ENLA 3QR0A 5U7SA 1BXNA 3G1VA 1ZBWA 4HNUA 3QYSA 4UMCA 3TMLA 2A3HA 4TV6A 2Y62A 4DNHA 1ZPTA 4RNHA 4D8AA 1FHDA 2WCAA 2Z27A 1S5WA 2ZBTA 1J0KA 3H4WA 4L1WA 1Q6CA 4M1RA 1R2TA 4KCVA 1QNRA 1D2KA 1NVMA 1G69A 2OYLA 2YOCA 3NCOA 2HE5A 3N3TA 3B8TA 2WSYA 1CGWA 2V0TA 2NV9A 3A9BA 2VUNA 5H8UA 3BK0A 2CIPA 4LYRA 3P0WA 1GJUA 1Q4NX 4Z2IA 3T40A 3GIPA 3MYOA 1M5WA 4CQ8A 2IPFA 2OZ8A 1TKKA 4OT7A 4Q4KA 3EOUA 3W2KA 3CT7A 1FXPA 2J8GA 1PZ3A 3HV9A 1OZMA 3MMUA 2ZQ0A 4BI7A 1EJVC 1JIBA 4RW3A 3OGSA 4WKAA 1Q85A 3S42A 3V35A 4Z2GA 2FZ8A 5I03A 3ES8A 1E6NA 3C0LA 1KNWA 3MHFA 3PS7A 4RE2A 4GIAA 1ISZA 3ZIZA 3MDUA 1IGWA 2VUYA 4D6EA 2ANUA 3U3HA 4QE4A 1E4IA 2WPGA 3WQPA 2VX5A 3IGHX 1PSCA 3P84A 4QEHA 4GFIA 4ZO7A 3GG8A 1A5KC 2ODOA 3Q37A 2VD9A 2GGJA 2P10A 3UCQA 4DI8A 5IDZA 1RQHA 1K3UA 3OODA 1QBAA 1TMLA 3Q4DA 4P5UA 1KRAC 3QV8A 1PKMA 3TLQA 3TOYA 2VCAA 3VGGA 5LNVA 2J62A 2VURA 2VGIA 4H83A 2DZPA 3EB4A 2D3LA 2OYMA 4GY1A 1TPEA 2O9RA 1XLEA 5A6JA 2P5NA 3M5YA 4D72A 2A6NA 2ZC1A 3ONBA 1YX1A 1MUCA 3W7HA 4O1BA 3GU2A 3MTWA 4GYKA 1OX5A 4AY8A 4XD6A 2NX1A 5JUVA 3A22A 2FDSA 4LYPA 2R1KA 2WV8A 3C0JA 4QM1A 1ZCCA 3SGUA 3FAXA 1MW3A 4IFOA 4OHQA 3P60A 2D22A 4YYCA 3KTSA 3WDPP 3GTFA 1VGAA 4BF5A 3EPOA 2EPKX 2CKSA 4FSAA 1GW9A 1C93A 1FTXA 2DIEA 4Z2KA 1XV8A 4XUGA 2XWDA 5L6UA 2VC9A 4JFTA 1VKFA 1Q4WA 2ZVRA 4E5TA 3W85A 5C5YA 3F03K 2ZUTA 4B90A 3CMFA 4A3YA 1SVDA 2GUUA 4HKPA 4RJEA 3HQOA 3N6HA 3IS4A 3TSBA 3SN0A 4W9TA 1IT8A 3AXMA 3M41A 2WKLA 4KWWA 2BP1A 5CZSA 3SUSA 3WFLA 1K4HA 3N2OA 1QU4A 1HW6A 3UG8A 4AWEA 1R3YA 3COTA 2JF7A 3S5OA 1LJYA 2WMFA 3PPFA 1EH9A 4XZHA 4GQ0A 4LB4A 2P8CA 1H60A 4H9XA 2NX3A 1SPQA 3GQYA 2GZXA 3E2VA 1A5CA 4MLRA 3M0LA 4KPLA 3DEQA 2EKGA 1KM2A 4DLFA 4E2OA 5FAGA 2GSJA 1LROA 3OLDA 3BG5A 3BURA 2J7GA 3UF9A 2QVNA 5AFDA 2X1SA 4CU6A 5G2HA 3QHOA 2DEPA 2WAGA 1EPVA 2VMFA 1AJ0A 4W93A 5D2YA 3A24A 2NW0A 1C90A 2Z1BA 3I3DA 1IIGA 4JN8A 2JGYA 2V3EA 4UNLA 1E6ZA 4PEKA 1EO5A 4IICA 3LU2A 4HIBA 5ABGA 7XIMA 2O4QA 1O7AA 1JD7A 1EUAA 1E5JA 4MG4A 3CH0A 5G5IA 3V4BA 1Y65A 3R0UA 2O92A 1EGVA 4N6EA 2LLEA 3FNDA 3PFMA 4D2JA 3WQEA 4V2XA 2JF6A 2W61A 1Q6QA 2OFJA 3N73A 5DF0A 2DSVA 1CI1A 2ZX6A 2NQZA 2DSZA 3F5JA 1X6NA 4XZLX 3NFUA 3H53A 1BSIA 3QKEA 3HG5A 4HYRA 3RDKA 2Y88A 2JEPA 5LNSA 1W9DM 5C0QA 4RZ5A 3SUTA 3AALA 4DF2A 3TAOA 5EYWA 4A8IA 4IPPA 4HNVA 2QCMA 4GUFA 3P5ZA 1SQ7A 1RA5A 1EL3A 1LRNA 1HJVA 1SZEA 3H4XA 1CW2A 3O1NA 3CAWA 2OX4A 1OCBA 3W1PA 4E4PA 4YTRA 3HGOA 3TKFA 3NZ1A 1W54A 1D3GA 4AHQA 4IP7A 3ANYA 3KS5A 5CPOA 2Z2AA 1IEVA 3W1RA 2BVYA 1ZAIA 1TCMA 5I09A 4C6PA 2REQA 4JCMA 1UWIA 1P43A 4P7RA 1ZJIA 1OYCA 1TPH1 1G5AA 4C5YA 3NO3A 4JX4A 3AUOA 3PZGA 4PTDA 5DMYA 4YWIA 4O53A 3GNXA 1EF2A 4PCPA 1LOSA 4JKLA 1K8YA 2OZTA 1XC6A 3BLLA 3AAMA 4H7CA 4NZ4A 4PTVA 2JIEA 3ZJ8A 3CV6A 3FJ4A 4IGMA 1PV8A 4JIRA 4PSRA 3SN4A 3FEMA 4K8EA 3AIWA 2VZTA 2FYMA 3EWUA 2ATSA 1XYAA 4M24A 3FYOA 4DJEA 3MVIA 4Q32A 1T8XA 1W3JA 2P0IA 4WXYA 2PA6A 4ICNA 3ZWTA 1GGOA 3BCJA 4ZXOA 2XFFA 1LCOA 4PH6A 5CJNA 4DNMA 3VD7A 3DC0A 1G4TA 4Q7BA 2ISVA 2OELA 3CTTA 1V3HA 3GVWA 3N2MA 4R7WA 1FRBA 2NXGA 4MVAA 1RP8A 4GGBA 4MNMA 4P7QA 3L23A 1M04A 3T05A 1GVSA 3EKZA 3ARVA 1TX0A 1X98A 4PB4A 1MUMA 5LNWA 4S3FA 1K8XA 3G1HA 1KO0A 2YLAA 4I9MA 3CTLA 3KX6A 4PUKA 3DI0A 3S8HA 2JALA 2P8BA 4QS6A 1IHIA 4KIRA 3R4IA 4EK7A 1C7SA 4PCNA 2PDLA 1IWPA 5E70A 1W1VA 4FLSA 2GQAA 3THAA 3DBNA 3HJEA 2X40A 1UUMA 4XAYA 2REQB 4RE3A 5LZLA 2QAPA 2YCJA 4WDUA 1FWAC 3G8EA 4Q8UA 1A5BA 2X05A 3DFOA 5CPTA 4HU4A 1WXYA 3ZJKA 3IJLA 1GZGA 2B4GA 3ZZ1A 3BDKA 3PAJA 1UWSA 2O9TA 4C1LA 2OOGA 2VZOA 4FA3A 2Z6JA 1PVNA 1FHLA 2J27A 4D6JA 4QRNA 2J75A 2QPXA 3WQ6A 1UWTA 4J40A 3VMNA 5CSYA 1YEYA 1X1NA 2UV8G 1AH3A 2OG9A 1UP2A 4UC5A 3DG3A 1XIFA 1POJA 3P14A 4ZSTA 3IVTA 2GGGA 1UOKA 5HNUA 2GQ3A 1EC8A 4CCCA 4EX4A 1JNEA 1V6VA 1LL7A 4PMJA 2GJPA 2QYGA 4UOZA 5A2BA 4L80A 1Z3NA 4CNTA 5I5RA 4IG2A 3TZFA 1N8IA 4ILSA 3TVAA 2WO5A 5D38A 3G5EA 3PWGA 3W7DA 3QFWA 3NZRA 2QJJA 1BQGA 3RMJA 2V5JA 5EU9A 3VIHA 4EVZA 3OVPA 4K37A 3BSHA 1RHCA 1SU5A 1VFSA 1DTNA 4WHBA 2FZNA 4KGJA 3TQVA 5IHSA 2BVTA 1JZ6A 4L6OA 4E38A 3LV6A 3LPFA 3WLKX 2B7PA 2HVNA 2VHLA 4PN2A 4FIRA 1QOXA 4UQDA 1K9DA 4B92A 1LOLA 5C9XA 4MB3A 1I8JA 2G3IA 5HQLA 2XIIA 5IRPA 3ZXWA 3GNDA 3GO2A 3T55A 2WJZA 3GDMA 3CPGA 2ZZ5A 2B7OA 2BGNE 2OX1A 5HULA 3A4AA 3DYPA 1QI5A 2DSWA 2E7FA 2QDDA 4Q4PA 1VFFA 5FJUA 1QNPA 5DY2A 4JTGA 1MQPA 1RA0A 3AXKA 3AXHA 2IKJA 1UBSA 3QHMA 1PO9A 5FJIA 4KRUA 1UWRA 2BLEA 4IF2A 4IGNA 3VM7A 4AYGA 1VBGA 1LQ2A 4IIEA 4N4PA 4ECLA 4AF0A 3UWWA 3WNOA 1SGJA 3GLCA 1A0EA 2V38A 2R94A 1K4GA 5DELA 4ENLA 1WA3A 2PAJA 5HPCA 3WEMA 3UNTA 1Q6OA 2BX7A 2WNZA 1H0IA 2VZSA 4X3ZA 2AL1A 5EMKA 3PZMA 4X63A 1W0MA 4LYQA 3BC9A 2J7BA 1RZMA 4OFCA 3PBWA 3S2LA 3WQFA 4DVOA 7TIMA 4NY2A 4H8VA 5C55A 4O8AA 1TYGA 2WBKA 4PBEA 2P3ZA 3ZOAA 4FMVA 1JZ8A 1JG9A 2IXUA 1EHNA 4ZSUA 4PUDA 3MCNA 1GG0A 1KCKA 2PWVA 3OZMA 3TW7A 2D24A 1NFBA 5ECUA 4Q22A 3UERA 3WKZA 4LTSA 4QP0A 1NJJA 1RP9A 4I5UA 3IK4A 5AZ0A 4HA4A 4XZIA 1OD0A 1RBOB 2ZZ2A 4IIGA 4GJ1A 4GJIA 1SZGA 5BU6A 1JFHA 1T5AA 1XDJA 1UWAA 3M0YA 3D46A 2BHZA 4JTJA 5CAHA 1SFJA 4WXZA 4PE8A 3B8VA 3SIMA 2FB2A 5M2FX 3W6YA 4N6FA 2DZBA 2VKZG 3S2MA 1QDSA 4KH2A 3RJXA 3ITXA 2E0PA 3WF0A 3PBYA 3USBA 4ZE5A 3L68A 2WQDA 3WY1A 3W70A 5K3VA 2YXOA 4MHBA 3TEVA 2A79A 3D6NA 1MNZA 4DJDD 3P80A 2ACSA 1H4PA 4N9DA 2PRHA 3ZR6A 2FMNA 4HZMA 5KZDA 3AYSA 4OV4A 4HSOA 4RE4A 4V28A 3WBWA 4PMQA 2OWCA 2YCEA 2ZX5A 3L4XA 1PKLA 3W9ZA 3PUGA 1BVNP 4G1KA 4K8GA 6ALDA 4I7UA 1PKYA 3H2FA 2C91A 1DJIA 3BW3A 3OHIA 2WJFA 1UD2A 3MHGA 3CO8A 3T2OA 3Q67A 3R79A 1U30A 1FVPA 1DJNA 2FHCA 2VTFA 1EEPA 4E2VA 3A21A 3E0IA 3MKKA 3SZ8A 2XGZA 1V3JA 1MZRA 1D9EA 2XSAA 3S0CA 2QF8A 1E4NA 4X2RA 3RAOA 2J9XA 1VZWA 2MANA 4AY1A 3QOKA 2Z28A 3WZ0E 4KESA 3ZMRA 5D02A 4EACA 8CGTA 3PB2A 3T0AA 1QXLA 3MC5A 4UFLA 2AMGA 3FOKA 2CWNA 3CAKA 2FGBA 1QW9A 4NZ3A 1JD9A 3W53A 1V0NA 3G22A 2OSWA 1P6BA 1DBTA 4LB3A 3U57A 3W23A 3RLGA 1I1XA 1EP1A 1XGZA 2WJDA 4GX9A 1CB2A 5HA7A 2JQXA 1E70M 3W7EA 2NLYA 1JCYA 4ZCWA 1M6JA 3KDNA 2AL2B 1HGWA 4TO8A 4RNIA 2RHGA 3MU7A 3RILA 3ARSA 2NLIA 1J12A 4F3HA 1PDYA 2WZEA 3SB0A 2E9MA 2NT1A 1W8GA 3EX6A 4HZ7A 2D2JA 4DJEC 1V6UA 1CXEA 2BHUA 4OTKA 2H8ZA 2PDHA 2CETA 1P0KA 2F6XA 5A6BD 2Z1WA 3O05A 3F7JA 2RUSA 5ABEA 3NNTA 4M1BA 2NX9A 3S3GA 1A4LA 4UB9A 3K8MA 1QJWA 4H2CA 5D9PA 5HUOA 4V27A 1M65A 3TC3A 1B3ZA 3VPLA 3DX5A 2WB5A 4IH3A 4YLWA 1ADSA 3F2DA 2OEKA 4ERAA 1M1BA 4W8BA 4GNKB 1E15A 3RX4A 3AIVA 1AL8A 3PNUA 4I9JA 4HPJA 3EPMA 3NA8A 4GE8A 3VK5A 1VBJA 3BGJA 3IJIA 3FCPA 2FHBA 3OOQA 2FQIA 4U31A 1ONWA 1GPWA 1VF8A 1EC9A 1EUNA 4HNTA 4LVGA 1LBMA 3AMLA 5T9CE 4IHCA 4MF4A 3G3MA 1FHUA 5C6MA 3S9IA 3CHDA 1TJRA 5REQB 2J9ZA 3FVDA 2X0HA 5A94A 2TPSA 1CPUA 1W2PA 2HZGA 3NQ2A 3BAIA 1GQLA 4H9TA 2YDRA 2PZ0A 5C71A 3EDKA 3F4WA 3F5KA 5TIMA 1GG1A 3LENA 3W29A 4YCPA 4MJ4A 5E0CA 5LYRA 3GTHA 4PL1A 1I6NA 4MB1A 5F1UA 5A1AA 1KW1A 4OWGA 1K1DA 2PSNA 4PUMA 1R3WA 1BVZA 4HMNA 3BAYA 2NQ5A 1FH7A 1WUFA 4O54A 1GHSA 3PZVA 2QPSA 5GJPA 2RKXA 2CNCA 4U3AA 1RPXA 3TAKA 4J1OA 1O95A 3ITGA 3D3FA 1L2UA 2J78A 4HJFA 2WK2A 1NARA 4QQUA 3M0JA 2VEKA 1PBGA 3BQ5A 4F48A 2C14A 1I4NA 2V9DA 3QHNA 2GSEA 2XSBA 5JBDA 4BQ3A 4YVVA 3M0IA 3W87A 4I5XA 4KCTA 1O66A 2V5KA 1I2OA 1C9WA 2DVUA 4BI5A 4PTWA 3RPDA 4NZFA 1NDZA 4ZO9A 3GSMA 3ZLFA 4Z1DA 1EP2A 4H1ZA 4NQ1A 1BYAA 2Q3RA 1FP9A 2A85A 4FOJA 3N15A 4QSHA 4IOTA 3PTDA 1VBHA 4XZMX 4CVWA 1Q7QA 4A8RA 3MUXA 1J2WA 4W7WA 2HCVA 3LM7A 3LRLA 3LNMA 4JFWA 1H5YA 1ZQ5A 4E3TA 1HP5A 2ISFA 3HG4A 3TCSA 5LIWX 3A5FA 4M19A 3TJIA 3WQ4A 3SO7A 2DT2A 3UVAA 4AD4A 2G37A 1WOBA 3KEHA 3HN3A 4RLIA 1PL9A 2V5CA 2VL4A 3WF1A 2WLYA 3SCWA 3H7RA 4CLMA 3B8UA 4HMCA 4R88A 4A8LA 3HQNA 1OY0A 2FZ9A 3W37A 3GNPA 5DT5A 3ZVHA 1AW5A 3R12A 1ECEA 1T6MA 2HVMA 4OVXA 2ISSA 4GHRA 5F2GA 3PVFA 4E8GA 4EKJA 5LA0A 2E40A 4JTTA 2ZFAA 3JRKA 5EFDA 4O18A 2HXUA 1NDYA 5EBUA 6REQA 3W07A 1QI4A 2A3EA 4ZQNA 1F61A 1FBAA 1VEOA 4PZVA 5J5DA 1V3MA 1H7WA 4C6QA 3NPWA 2VM8A 5TD4A 1C3FA 1Y8BA 3R10A 1HJQA 1W9UA 5MKGA 3IV8A 4LCQA 1SO4A 3S4TA 3TE9A 4IMFA 4CQCA 3TQKA 4X9SA 5BRQA 3WMLA 1DIDA 2HE8A 4K38A 4YU1A 3SGGA 4PCFA 1VP5A 1VPXA 4BHYA 3M64A 3M5XA 3M7WA 2IPGA 5K9CA 3VOHA 2IXVA 3PUDA 4EOUA 3EXSA 1F9CA 5HPOA 1UZDA 1TRDA 3CIXA 3NQAA 2J6XA 3MI2A 2QUNA 5CGMA 2OB3A 4IIFA 2Z0IA 3TJLA 2POZA 1OADA 1BPLB 2XIQA 3VC6A 4RL3A 3WUGA 4W4QA 3LCFA 1OT2A 4HTYA 1JPDX 4I6VA 4PSPA 1VLWA 3B9NA 2TSYA 4IP4A 2V2DA 3EA3A 2I1OA 3HFYA 1EBGA 4PMVA 1F6KA 3UCCA 1CGVA 2OO6A 4J3ZA 4LX4A 1OB0A 2FZDA 1RVGA 1MMFA 3N04A 3SRDA 3IRSA 1S1RA 2PTXA 4O0QA 3G8RA 1PYMA 1W8SA 4N9CA 4F2TA 3VD3A 2W27A 4ZL1A 4TVUA 3LEPA 4LYKA 4GBDA 1FWNA 4YVXA 4M6PA 2C1IA 2VI0A 1Y7VA 1ADOA 1XBYA 5HNTA 4JN6A 3ZVHB 1U1HA 4L61A 4MJ2A 1LDCA 2D0FA 4N4QA 1LG1A 1DXIA 4TMBA 1JVNA 3NQ7A 4DBUA 5EMYA 5DT7A 2Y24A 2J8TA 4NX0A 3LI0A 4O14A 3M0XA 4AZHA 1VCVA 1XLLA 1W17A 3OQ8A 2I9UA 1TMHA 4CNOA 1TRIA 2EKCA 4FHAA 5BOOA 5MKGB 4IIHA 3QN3A 3QZ6A 4J4KA 1PX8A 1JUBA 3WH5A 4PB3A 2A3AA 2VFGA 1C8YA 5AVHA 1J5TA 4I7VA 4LJ3A 2JIWA 1M9HA 2PLKA 4UZSA 3AQUA 3KL0A 4ZB5A 4S1FA 4PB5A 1NWRA 1BYBA 1Y5VA 2QJGA 3CZEA 4QQ3A 4Y7EA 1JYVA 1F8IA 5AYZA 3F5LA 1JAEA 3GH7A 4NYUA 5FKYA 3MZNA 1J2BA 3ANUA 3EBVA 1XSIA 4HT3A 2G4JA 4P7LA 2XSXA 2IKIA 3SECA 1V6TA 3GR4A 1GEHA 3UZWA 1G4EA 3JVAA 4Y9PA 4C6JA 1P7TA 1EFZA 1A47A 3W6MA 5JH2A 3XIMA 3B8IA 3RF9A 1S5MA 3KTXA 2VC5A 3D47A 2RJGA 1XLHA 1K7EA 5F4SA 5CSRA 1S3TC 2INEA 5KITA 3SGZA 1JDEA 1LORA 3VIGA 4V1XA 5DXYA 1TV5A 5HJLA 2DT0A 4KT2A 2CEQA 4R5EA 3GVGA 4YTSA 1DJQA 4C7FA 3O06A 1MDLA 3TH6A 3NPVA 4L9XA 3WD3A 4FNRA 5FL0A 4HU0A 3LCGA 3THCA 2VP8A 4MUPA 4R34A 1D7FA 4S3BA 4JHMA 3VCCA 4DEFA 3SEPA 3NG3A 3W7OA 1R9YA 3FKKA 3QSRA 4CCEA 1XC4A 2E3ZA 3W7KA 2QF7A 2I5QA 5C2GA 2Z6IA 3KBSA 2E25A 4FR6A 4AG0A 4GKTA 1X97A 1G4PA 3HGJA 1QI3A 3ZSTA 3REQA 4UOQA 3DDMA 1ADDA 1MZHA 2XFYA 3K1GA 2J25A 3FXYA 4AD0A 4MWAE 2PDKA 5KZ6A 4H7VA 3CEUA 1FDZA 4FNUA 1XLJA 1YBQB 3E5BA 1OFPA 3SN1A 1PZ0A 5AC7A 5I23A 4QBXA 3WSUA 2PWGA 2G50A 4UCGA 5KTLA 4RPPA 3MKCA 3VNLA 3S1VA 3CQ0A 4PMNA 1EYEA 2PLCA 3LB0A 4CN4A 2XG9A 4I5RA 2UWFA 4LUJA 3WQVA 4CQBA 1XIIA 1YE4A 4LAMA 2UY5A 3W4RA 2F8QA 4WOZA 4HK5A 1SZNA 4GZIA 2EHHA 4UR8A 1I2PA 1DXEA 3SJ3A 2WMIB 2HTMA 3PSWA 3VUPA 2VENA 4YIWA 4OJYA 2YL9A 1FX6A 5EY5A 4PGLA 8XIMA 5DXXA 1XUZA 3PK7A 4Q4SA 3H6OA 1EOMA 1A5LC 1XYMA 4AD2A 1UIOA 4UCFA 4LUIA 3QY7A 3I7RA 1VPQA 1H51A 3LPOA 4XKYA 4JNMA 3S1GA 1UIPA 3RLHA 4C6EA 4IXHA 3L5AA 1YRRA 1CB7B 5FF2A 3UZJA 1HL8A 1KR0A 3LPPA 3SAZA 1J4EA 2NUWA 5EL1A 3LX9A 3FVMA 1YLVA 3BMVA 1XRFA 3ZWSA 1UWQA 3KZSA 2PCQA 1EDTA 1HKJA 2V69A 1BGAA 1Q2RA 2NV2A 3LCXA 3G3DA 3T2PA 3PPHA 3QY8A 3IIVA 3C2OA 5IOBA 3A47A 1WDSA 3OJGA 4EE9A 4HD5A 4IMEA 2HISA 4C65A 1IWBA 5HJYA 1E6XM 4Q4RA 7CGTA 2QUTA 4GINA 4HCLA 3UR2A 3V75A 3EGJA 3LHWA 1PE1A 4R33A 2EG8A 2O0TA 4O19A 2A6LA 4IZGA 1Y5XA 3H55A 2G95A 3NGJA 5DFAA 3BUVA 2BY2A 8A3HA 2I5IA 4RX0A 4CNNA 2NWRA 1Q3NA 2E5BA 3SCQA 4E4FA 4CN1A 2IKHA 1HP4A 2R1PA 1EWEA 2VCBA 1OFBA 3APTA 4S38A 4XKMA 1TIWA 4GUJA 1Z44A 5AC6A 1KA9F 3DN5A 5CBIA 1OFAA 2YW4A 2A5HA 3OLEA 3VNKA 3N12A 4ROQA 2NQJA 3W1QA 1Z41A 1QO5A 2C18A 3MO4A 1ZP4A 4UNIA 3A23A 2FTYA 2VC6A 4Q7NA 4Z1BA 4NVTA 4R53A 3DIPA 3INPA 5HXMA 2YDAA 4M56A 4RNFA 2X09A 3GHUA 5JXQA 3WLOA 4B5XA 1LQAA 3GYCA 1P0EA 2Z7KA 1JPMA 1KXQA 4C6DA 3A3WA 2PWFA 3KL3A 1CX9A 1XLFA 3W6LA 3S6TA 3S5ZA 1G7VA 3BVJA 4IP5A 5CPQA 3PTKA 4GYJA 4XKYB 4Y2WA 1DWAM 3TC7A 1BKHA 4O1DA 3L4VA 3QMRA 1GKRA 1EIBA 3MP3A 4UBPC 5AOUA 1RUSA 2ZUSA 4AW7A 2NXHA 1W3NA 3WJSA 1EJRC 1ONRA 3PBMA 1MFVA 1K03A 4AMCA 1UKPA 4S3EA 4AYSA 3CAQA 2FH6A 2QCDB 3BL3A 1KXHA 3BV4A 1Q8AA 2QHAA 3WNPA 3B0YA 1NWUA 1GVQA 2ACRA 1MRQA 2BODX 5I3KA 3ARWA 3URAA 1VCGA 2V5BA 4JHZA 5HNNA 3UJSA 4N42A 2A7RA 4MGGA 4CD6A 1LL6A 3AIBA 3BAXA 2V3DA 9RUBA 4G2DA 3BOFA 3U5UA 1UD4A 2FHFA 2WNQA 4RNJA 1XIMA 2Z1SA 2ZUWA 2CXGA 1O68A 4HNLA 4LVDA 3CUIA 4GRSA 1E0VA 1JI1A 2EEXA 3PZ9A 1E6SM 1B57A 4REQA 3BSGA 4CU7A 1F3WA 2PBOA 1YPFA 4JTDA 1EXBA 4NIRA 3RO8A 2Y8KA 5MF5A 3EDDA 1JGIA 1ME7A 1X1OA 3CZGA 1UOZA 5KMYA 1L6FA 3N2XA 1ZY9A 2AQOA 1GQNA 3OA3A 1PWLA 3CWHA 4CQAA 4YL2A 3ME3A 3DFNA 3HPZA 3GR8A 4AVOA 4XD5A 4N0RA 2G3MA 3LM3A 1A0DA 1GPFA 2XM1A 3PULA 1E3ZA 4JDBA 1IV8A 1Q6FA 3DH7A 4GIRA 3ZJ7A 4WCJA 3B04A 1Z42A 2E8YA 2VDIA 3LG3A 5AYBA 4ZFCA 4DJED 3O63A 4S23A 5D2VA 3G0UA 1W1ZA 4JEQA 1K02A 1SR0A 5FJTA 1FWFC 4K3ZA 1EA9C 1DIOA 1EEXA 4W84A 5M3WA 3L66A 3H2MA 4ML9A 4WKFA 3ZLHA 1KM0A 4Y9MA 4LCRA 5AKQA 4RK8A 1V4YA 3EDFA 3VDGA 3N4AA 2OKOA 4E3VA 4L4LA 3LGEA 3MWCA 4ZB0A 4NUWA 3M44A 2RFGA 3NM3A 3ABXA 3QPYA 2GLKA 3ANVA 1NIUA 2NV1A 4KS0A 2Z4GA 3DAQA 1OCJA 1XBXA 2Z1XA 4MAVA 2WQPA 3NOYA 1U2YA 3GXDA 3R11A 5XINA 3O0KA 4ICCX 3UR8A 2CZEA 2OYKA 4I8DA 3G24A 4HPGA 4S3AA 4XTIA 3N19B 1B90A 4IXXA 2G0WA 1YQ2A 1RBAA 1XIEA 5FJPA 1OC5A 4BR1A 4EXAA 2DZSA 1US2A 4IMAA 1OHLA 4DIAA 4ZMGA 1AQFA 4LF1A 4JQAA 1AQHA 1IZKA 1JULA 4HU3A 2VT0A 1WZKA 2ZX8A 2FGZA 4LUTA 3W22A 3XISA 4G1NA 1TQXA 4B3LA 1BRLA 3NSMA 3FA3A 2J66A 3E96A 4LC8A 1XIGA 3NGFA 3AXXA 3HA1A 1IE7C 3IUIA 1F4HA 3RYSA 1G7UA 1YXCA 3CWNA 3O0FA 2YDQA 2H3BA 1CEOA 1ITUA 3L4YA 2YLLA 3GBDA 1UH2A 1WXJA 1PZ2A 3FGCA 2ZRYA 1MI3A 3PTQA 1A53A 4AD1A 4ES4A 1WAUA 3CV7A 1AODA 1KTCA 1THFD 2YX0A 3MS8A 4H6KA 3QC0A 4S3JA 3AHXA 3GXIA 5CC3A 1BFNA 1UG6A 2ALRA 1H1ZA 1R3QA 2W9MA 4EXBA 1ZBCA 5AY7A 3W00A 3W72A 3PM6A 2WLZA 3SSJA 4N9BA 5FI8A 2V5DA 1TZZA 1J10A 4CD4A 1IQ8A 4MKNA 3G1XA 3GC5A 4YTTA 1ZSXA 3AOFA 4LOCA 4DF1A 4IMCA 5I3JA 4F0SA 2XIOA 1EJWC 1O6IA 1W5PA 1UR8A 2KZHA 3AS0A 5F7UA 2WSKA 1KV5A 1TV7A 1P1XA 1QT1A 5CAKA 4KF1A 3A4JA 4GUHA 1RY8A 1BVWA 3L21A 5I3DA 1H2JA 5G4WA 1SZRA 3ARPA 3F4DA 4QDWA 2HS8A 3U6WA 2GQ8A 2I57A 3W7RA 1RVKA 1S2VA 3B8WA 4LC6A 4D1IA 4TQTA 1QMLA 4MB4A 5JBEA 4AAJA 2ZICA 1U5VA 3MKVA 3UYCA 4Z2HA 3WBEA 3B0VC 4W8LA 3T42A 3GW0A 3UZ5A 3WEZA 3U8GA 3CAVA 1GK8A 4Z1AA 3RIKA 2YXXA 2HPIA 3PZQA 3GYEA 2W91A 1WNOA 5CQ1A 2E5DA 2Y6ZA 1ZNNA 4X9YA 4JDYA 3C0SA 3TYZA 2OXNA 4IMGA 1BRLB 3KP0A 1ZU8A 4GQQA 1LWJA 1DQWA 3FS2A 2OWXA 4LUSB 3ICJA 3RU6A 2V67A 4JIIX 3UYIA 4PL2A 2WC4A 2JGQA 2FFCA 3DFSA 2ZRUA 3LD5A 2QEZA 4EF9A 3WLLA 1ZL1A 3GKFA 1KBBA 4GCXA 3DFPA 1RJQA 3FGCB 2FJUB 3OZPA 4DX3A 4OOUA 3ZVIA 1TB3A 4Q8WA 3S5SA 2W3ZA 3EDEA 4QDPA 1OCQA 3LCWA 3T0TA 3GVVA 4GVGA 3CMJA 1FHVA 1J6OA 1KFBA 4XZNX 4B5NA 3CHCA 4CEUC 4E8DA 3CUZA 1DHKA 1LUCA 1O1HA 1FKXA 5B7YA 4QNWA 2CXEA 3JR2A 3W1LA 3QEZA 2XUCA 4PODA 1US0A 4P8VA 1LYXA 1F74A 3BLDA 3NO1A 3RPTA 3JZEA 3TYBA 5D9OA 3VXGA 4U2ZA 4JTFA 3SCTA 1R2SA 4NJIA 1FWWA 2DPEA 4DPPA 1Q6DA 2PDIA 3A9IA 4DB7A 2B7NA 1WBHA 2R9RA 6PTDA 2VNCA 5I3IA 4EWND 1AQ0A 3QVQA 3S2CA 3QZAA 3PZOA 4FX6M 4M82A 4IJCA 4H6QA 4G9PA 3GG0A 4LBUA 1CXHA 2BASA 2R8WA 4K7VA 2NQHA 4C5ZA 2QCNA 1JDFA 4LPCA 1G0CA 4FNSA 2CESA 2Q09A 3GR7A 3VIOA 3WDJA 4KMQA 3UPBA 4WJ8A 1A0CA 1UB3A 2CHRA 5A8PA 4AZCA 2OEJA 5ENLA 1FWDC 3M0MA 3OG2A 1L8PA 3MHUA 3R43A 5I3HA 3UG4A 1JCLA 1DJXA 3DHUA 2F6KA 3F2CA 3ECQA 4B5WA 2PDWA 1XIJA 4HPXA 3SCVA 3STPA 1R5YA 3NQGA 5DMMA 1BWLA 4Q4OA 4L4OA 1EJSC 1QNOA 1H7OA 3BE7A 3QPZA 4ZTYA 4AVNA 3T4WA 3O6AA 1B2YA 4ZEPA 3U48A 3IPWA 1T8QA 3KBWA 4S39A 2H9AB 3HU7A 2QVHA 4GIEA 2XFWA 3M4HA 4B9YA 1A5SA 1H1NA 4HNOA 4AWSA 4X0VA 1RPKA 5A5WA 1B3OA 4J35A 4C6FA 3L2LA 1PX4A 4PC8A 3W1MA 1BWKA 2W5FA 3EMQA 1CLVA 2PTDA 3GFYA 1UKSA 3LYEA 3VA8A 4NXKA 1XL9A 2VR5A 4DELA 4UXDA 3WENA 1ESWA 1UW9A 1YNPA 3CQKA 2NWSA 2DZUA 1DE6A 4KWSA 3GM8A 1PYFA 3VNYA 1J93A 2BBFA 1BGGA 4I8YA 5AHFA 3W2MA 5JIWA 1ZFJA 3V0SA 4NNAA 5B7ZA 4IQJA 2TYSA 1L9WA 3UETA 5HMSA 2QGHA 4XSMA 4O1CA 1R85A 4CN6A 3KVJA 5T8GA 4ZENA 1OIFA 3TSDA 3S5NA 5BROA 1E71M 4HN4A 2E8ZA 5BZAA 1UC5A 2Y8VA 1UZ4A 4RZ4A 4M5PA 1B30A 4KIEA 3B3DA 1ZUAX 1VJZA 2I17A 3POCA 1DOSA 2CLMA 1OM0A 4OUIA 1VFUA 1DQXA 2QGYA 4NJGA 3KRUA 1Q8JA 2QCLA 3MT1A 4X61A 4F66A 3KOFA 1REQA 1KKRA 3KLKA 2X1TA 3OVRA 2BFGA 5CSSA 3EX3A 1OBAA 1BG9A 1GVEA 3KOYA 4K6AA 2VEMA 3YPIA 3W83A 5G2WA 4H7ZA 1MEHA 1NU5A 2PMQA 3UA4A 1XDLA 3WL0A 2P1FA 3QW3A 3TONA 4WR3A 3IJ8A 2BOFX 4JBRA 2D20A 2NQ9A 3ARQA 8TIMA 3LK6A 1AMKA 3W84A 3NYDA 2PP1A 3LXBA 1XYLA 4IMDA 1KFKA 2XVKA 2X30A 3P8IA 4DZ5A 2WNNA 3ZM8A 2B0MA 4M8UA 3AHVA 4JR5A 4AEOA 3KAOA 3VO0A 5CPNA 3PFRA 1KTBA 3H22A 3MB9A 2V8ZA 3W81A 4M29A 3QR1A 2JKPA 2BSLA 1GNXA 2ZDSA 2XIBA 1WV2A 2YYUA 3VTRA 3CUHA 2GVJA 1A3XA 2GGHA 1LF1A 1E9ZB 2G41A 3RRAA 5HQMA 4KFPA 1E0XA 2HK1A 2J13A 3UJFA 5EKYA 1D8WA 2CLEA 4Q4MA 5D03A 4NZ5A 3UG5A 5FAJA 2QXWA 2A2IA 4XAGA 4LAZA 1KFLA 3HPSA 4YYFA 1W3KA 2CZ5A 3CZKA 1SJAA 4ADUA 3TTQA 3DFQA 3OB8A 3CBWA 1MW0A 3M0ZA 3RLVA 1I45A 3A64A 1FWGC 3IRDA 3PWAA 1AZ2A 3BSMA 2XVLA 3J7HA 4JTEA 3WK0A 3M46A 3VNZA 1HJWA 3PG8A 4O10A 1DKWA 1Q5MA 2RJHA 1XLAA 1LP6A 4IT1A 3B03A 2C8NA 2OGJA 2R14A 5CBBA 3U2EA 1GOXA 1HKVA 1J5SA 4MIMA 4F2BA 1U22A 3CNYA 1TA3A 3U9IA 5BRPA 3MUAA 3BOXA 4DO7A 2WXDM 3BANA 1NP0A 1REQB 3LV5A 3FA4A 4HHHA 1WYIA 1XBVA 1WKEA 4UQEA 1F3XA 4H04A 4PRRA 3UR5A 3QMTA 4CUCA 5H6HA 3R89A 3WDRA 3PANA 3R5EA 2RAGA 2O9OA 4E6MA 2PDNA 1S5VA 1KXVA 5AECA 1IT0A 3L4ZA 3OZOA 1W3IA 1E0WA 4JKMA 2FLIA 5L9FA 4PBFA 1MDRA 3RCNA 3T6CA 1YXYA 1HJUA 5ABHA 3VGDA 2CC0A 3N9SA 3VILA 3PBVA 2X7VA 1JPIA 3RUBL 4J28A 2YGYA 2DH2A 4NKCA 5M5DA 1OQFA 3AWNA 1PTGA 2NUXA 1UR0A 3VGHA 4QGCA 3F1QA 3QH2A 3K8KA 5KINA 3VOFA 5HMFA 4MNKA 3CV2A 5D2WA 1U5HA 3DGBA 2QCEA 4DJFA 3ARXA 2CLIA 4XK2A 2V6AA 2W62A 3L0KA 3KRZA 2X8RA 5CGQA 1Q2SA 1WXZA 1LBFA 4JYFA 1NAL1 2VEGA 4O15A 1UA3A 3HFTA 1FCUA 2PTWA 2FTWA 3POHA 3GW3A 3PZUA 2YR1A 4L1XA 2Y85A 2FMOA 3BLEA 3H21A 1UR4A 1K9FA 4H3DA 3NSNA 4LQ1A 2J88A 2YCLA 5AC4A 1LL4A 3K1DA 3VD9A 2QT3A 1LZOA 2HWGA 1FCQA 4O50A 5CJ5A 1BTCA 3K30A 4UIOA 3SY5A 3TU9A 2PC4A 4QG6A 2EPLX 3H7VA 5CGTA 3SADA 3SIZA 2CWXA 4KFNA 1L6SA 1E6RA 3IV3A 5GNXA 2CLOA 1S39A 3UZYA 1TA3B 3QLDA 3GNNA 4H6EA 1B3WA 1FA2A 3L4TA 3W3OA 5LHEA 3CMGA 1F8MA 2CZDA 2VFEA 1KFWA 1GVIA 5LA1A 1A3HA 1XCFA 3RCMA 4HA1A 3HGRA 3RLUA 1WCGA 4PTNA 3TN6A 5HNRA 1JCNA 1YNYA 4RDYA 4O57A 3TDFA 3LSBA 4U3CA 3DYMA 2J79A 3JS3A 2VD8A 4W87A 3P5YA 4YNGA 4L7ZA 1K77A 5BYWA 5HUPA 3TTEA 3NOEA 3W7PA 3LNPA 1BD0A 3KZPA 1XINA 4I9AA 3UR7A 3CUGA 4J3WA 1XBZA 3DC8A 8RUCA 4O12A 4Q8PA 1W3HA 3PWIA 2VGFA 4WY0B 4KGLA 3VKCA 4DPQA 2QUMA 2F2HA 1I0BA 1PUDA 3EX4A 1GQIA 1SYTA 1XFCA 2OMAA 2PLJA 1KB3A 1BLIA 3UCDA 2C0HA 1OIMA 2GK1B 5BRBA 3K5XA 2ZRZA 3GNOA 1Q6GA 1JUKA 3SFKA 1P0DA 2DV0A 4Q7IA 2BG5A 2DH3A 3S1UA 2X42A 3UGVA 2DZVA 5D9MA 1IWAA 4Q8QA 2ZA1A 1L6YA 4UOJA 4AHPA 3PHAA 3MPGA 3V1HA 1TE6A 2YCLB 2VEIA 2PURA 4DWSA 3I3EA 2BZNA 1ML1A 1R6WA 3LQLA 3MWAA 3WQCA 2GWNA 4WDWA 2PU1A 1VENA 1A49A 3OP2A 1EKOA 2DP3A 3ZJ6A 3TK7A 4W5ZA 1YHTA 3UVIA 1KBLA 4OGZA 3T0CA 5A2CA 1EGZA 3GB6A 4XBKA 1JYWA 2GL5A 4IQEA 4XUYA 1FDJA 4YWSA 2QDGA 3UD6A 4GH3A 4BI6A 2O55A 4FOUA 1D7KA 3GDKA 3W74A 2BGQA 5G2IA 1WP6A 2F6UA 2XDFA 2PTZA 1JQXA 2DZXA 2HV5A 2OEMA 3WD0A 4LWWA 1GT8A 5JQ9A 3MANA 4EPKA 1BXBA 3USZA 3KHJA 4MFEA 3TTOA 2D3NA 4ZQPA 2E6YA 3RITA 1HKIA 3N4FA 2E28A 3QQ1A 4KERA 1UUOA 2QZRA 2JBMA 4XVDA 5LKYA 2XPKA 3RR1A 1MQQA 5CPMA 1WBJA 1XWYA 4P8UA 4HMDA 2C1GA 3E1F1 3FLUA 3I7QA 4O4WA 5FSEC 1KM4A 5DN1A 2Z2UA 5G1TA 1E4MM 5F1VA 1K8CA 3THDA 3E2RA 3W7LA 4DBEA 5GNYA 2WSQA 4ML4A 4ATWA 3CL8A 3WD1A 4A3QA 4HZ6A 1Z69A 3T7VA 2Z00A 2Y7DA 3R8GA 2WCGA 4QG8A 3TTSA 1KBIA 3TFXA 5K4ZA 4J3SA 3P3BA 1QI2A 2ICSA 1J79A 4QITA 3CU2A 1WKFA 3LXCA 3NZQA 2NVAA 3URNA 2C16A 3PSVA 4LV9A 1MYRA 1U1UA 3GG7A 1IEWA 4G56A 4A29A 3S2JA 2XZ9A 2FTPA 1ALDA 4ADSA 3C2VA 3OO2A 3B97A 4F0LA 2V30A 3PJXA 3LPGA 3IEBA 2R82A 4CU8A 1AZ1A 3KXQA 5TNVA 1XFBA 5AYYA 1KFJA 4LXFA 4DWSB 6CGTA 3EOSA 4UZUA 3I6TA 1OABA 2QJHA 1CENA 3CH9A 1FCBA 3C3NA 4O0ZA 1CGTA 2Q71A 4JTQA 3BAWA 3KTCA 1QR7A 1MO0A 2BDQA 3DG6A 3MJMA 1YDVA 4YJ5A 1I2RA 4JQ2A 1PIIA 4PEEA 5ABFB 3V5FA 2P88A 1R87A 4RE0A 5G1YA 3TC6A 2GDUA 1X8FA 4GKLA 3LZ3A 4QAIA 3VIPA 5H2ZA 3SJNA 1YMYA 1JDDA 2WZMA 3VZYA 1XR2A 1DEDA 3WLMA 3W1TA 1CXLA 2QW5A 3MUZ1 3DECA 1R46A 2RGLA 3N34A 3CK5A 2CLKA 1HL9A 3BG3A 1H63A 3GZAA 3MZ2A 2EJAA 1PIGA 2WW5A 4ATDA 1QWGA 1E6QM 2R1LA 4C6OA 2QPUA 6A3HA 1E9LA 4PUEA 3UWUA 1PCWA 3PZTA 5A6SA 3B05A 4JY8A 1W6TA 3S1XA 3T0BA 4S2BA 1W1A1 3UPWA 2IQ0A 1GOWA 3SW6A 1FWJC 3T81A 1UA7A 2Y0FA 1C8QA 4E4UA 1GOIA 5TF0A 3V16A 1EDGA 2WHJA 3MO7A 1DORA 1EZ2A 4HP5A 4TIMA 1UZHA 5CC6A 1V6WA 3E2QA 1AH4A 1E1FA 4GO9A 3GU1A 1TJ0A 3H23A 3C8FA 2OCZA 1VS1A 4GVIA 3K4AA 3B40A 4AZBA 3W24A 3TNOA 1EF3A 2OTDA 3IARA 3MSGA 3NEHA 3TYDA 5I24A 3VM5A 7TAAA 3EYPA 3VNJA 1ZJAA 1ZHAA 1XUUA 1OYAA 3E74A 2BY1A 1F07A 3KP1A 4Y90A 1GOKA 2AQWA 5GJNA 4RDWA 3LHYA 2FPVA 3PUEA 8XIAA 4J9JA 3IIXA 3GH4A 1BYDA 2OGYA 3R13A 3T08A 5CC5A 1F3EA 1DWJM 4DJFC 1DJZA 1P6CA 4WLCA 2Y5EA 5A69A 2MNRA 4QEEA 5KETA 3WQ8A 2W63A 1SMDA 1UUQA 3M7SA 4RPQA 3KOZA 1UP0A 2OU4A 2IPJA 1TG7A 3TYAA 2SFPA 2WVVA 2WHLA 4JIPA 4LS0A 4IM4A 1J01A 4BJHA 2BXYA 5AYXA 3B0PA 2X0YA 1H61A 3WMCA 2VDGA 4NXSA 2FVLA 4RV3A 1K9TA 3TROA 2Z7GA 1E1CA 1I9CB 3WCZA 1H7NA 2ZVIA 2WKJA 2XVGA 2QDHA 3ELFA 3M5VA 2E4TA 4DBDA 4G7EA 3QW4B 3WK3A 4BY3A 3V0TA 4FLOA 5TQLA 3EPNA 2HMCA 5LIXX 1QTWA 3QBUA 1NM9A 4OOZA 3LMZA 3W2NA 3WJZA 3AS3A 4JTAA 3VIJA 3T8QA 4B4HA 1SJDA 1HVXA 4LGXA 3KVKA 3C2FA 3WN6A 1TCDA 4LVAA 4GXPA 4OQVA 2ISDA 3R25A 2VELA 2YA1A 1PX3A 4R9XA 4WF7A 3QLLA 5F2MA 4AXNA 4C6MA 4BCEA 5HOSA 3IJQA 3N2TA 1HF6A 2QJNA 5A6AA 4LBRA 3B4YA 1R7AA 3QSTA 1W3TA 5I77A 1PB0A 3T0DA 4W7UA 4Y8EA 6XIMA 3UFYA 2W66A 3M1ZA 2ZX7A 2F7FA 4B4FA 5FCZA 4B5TA 2IUZA 4QJ1A 1A5OC 2P53A 3PF3A 4MYXA 3L5LA 1UMYA 1QOPA 4XV0A 1N82A 3Q2DA 1JXJA 4CD5A 4DUVA 1UR1A 2YA0A 3N9KA 1UHVA 1R3TA 2PD9A 3OYZA 5BW6A 4NYYA 2GYIA 4UFJA 1V0LA 1GKQA 3VIMA 3CASA 1LWHA 3BGAA 2PEVA 1D3CA 2J4GA 4KRTA 2E6DA 4GUIA 1P5BA 3VNIA 1EJUC 2GVEA 4MADA 1DJGA 4EIVA 1O12A 1GOMA 1BEUA 2OT0A 3MI3A 2CCRA 4UTLA 5D8ZA 5TBOA 3LHZA 5H1WA 1NOFA 3NDOA 2WMHA 2D23A 3O6CA 1V0KA 3AMCA 1CT5A 4LUYA 1W1IE 2WVVB 3WLIA 2AMXA 3H70A 1V03A 3DYOA 1EJXC 1W1B1 1QRQA 3FKRA 3SRHA 2QKFA 2XN2A 3I68A 1S2AA 1XRVA 5DCEA 2ZOXA 2ZRWA 4J5NA 1B4EA 1E1CB 2WWCA 3QKZA 1SW7A 4FLRA 2YB4A 4M80A 3AHTA 1VFOA 3G0XA 1SSDA 4DWSC 4G7EB 3CYJA 3UESA 1YPXA 4OUEA 1FWRA 5KZEA 1YPIA 3IVUA 4UWMA 2PE4A 5FACA 4NT0A 4F79A 4BEUA 3OTRA 2QULA 2XHYA 3NXFA 1MEIA 1XS2A 3TWAA 2QUUA 3KFTA 4M51A 4B9ZA 3BMXA 1TVPA 4IQLA 3WLTA 2DZTA 2XGIA 3QV9A 1V93A 3HMCA 4MSSA 3U4AA 4DI9A 4F4RA 1KFEA 1SO6A 4IIBA 4WDXA 1GQJA 3NVTA 1BHGA 2P50A 3KCJA 5I06A 4XAZA 4KWVA 2FH8A 4X2PA 4IGHA 4YTQA 1DWIM 1ZBKA 1PTDA 1A5NC 1L2QA 3S6OA 3W27A 3NQ6A 5K9XA 1MXSA 3G1FA 3P61A 3U4FA 3OW1A 1KR1A 1YDYA 5BMWA 3H4GA 5F2LA 3LLFA 4Q8MA 5FEZA 2ZXBA 3FAWA 5I00A 1IXPA 1V0MA 1OF6A 4DRSA 3MA8A 4RXGA 3TNBA 3ITLA 1F2JA 2J7CA 2VQTA 3CPUA 4PFHA 5FD0A 1JXKA 4GXWA 4UFKA 4K36A 4OBSA 1QHOA 3B06A 5C54A 4V15A 3JZUA 1KRBC 1T99A 2E5CA 4GXMA 3IK2A 3TYUA 3RK8A 3MW7A 1R9XA 5FJOA 4JHOA 4HHPA 3CEPA 3LCLA 4C6IA 3WQDA 2GUBA 4GYPA 1SM9A 3P7YA 5F4XA 3R58A 2PDMA 4FLQA 1OK6A 1RLCL 2WYSA 3TP4A 3W7GA 4HOZA 2DVXA 4HMEA 3W1UA 5E6YA 1C7TA 3PBGA 2H90A 4NG3A 4LW7A 4UQ9A 5HMEA 4M6QA 4UTMA 4Q8TA 3L0NA 5HJXA 1JZ5A 4UFMA 1YTDA 5FF7A 2POTA 4KCWA 4GYFA 2XM2A 1XGEA 1XLCA 5C9RA 4WVXA 1EGMA 3WBXA 3C56A 3ZS4A 1UJPA 1DWHM 1JCJA 4AISA 1GQKA 2I56A 2AL2A 3B8DA 3AHZA 4PTXA 5FJJA 1PS9A 4WOQA 3RX2A 4AC1X 4A2RA 1FWSA 1R3VA 3GS6A 1HVQA 3SQMA 4XAPA 4HJWA 4I9TA 5GNZA 4CNPA 5K9DA 1UR9A 2J47A 4O52A 5HK4A 4R7OA 4NJHA 1E3XA 3H24A 5EMUA 1ISXA 3C8NA 1QNSA 3SUVA 4FR1A 1PAMA 5F2IA 4JCLA 2Y89A 4WSHA 2EGZA 5LXEA 5AHNA 1FQ0A 4FZIA 3L4UA 1JCTA 4FXFA 4POCA 4OECA 2VQUA 5C70A 2Q8LA 3PPCA 2GDQA 4C1NB 4CVUA 2RDWA 1CIUA 4XG1A 4HK6A 1BWVA 3MUIA 5K4XA 4WSJA 5D04C 1S3HA 4GZJA 3QC3A 2ZZ3A 2PDQA 3IJDA 4MJZA 1M01A 4GX8A 3LTSA 4ZOAA 3EB3A 4H8NA 1FWTA 3UXAA 1CYGA 2Y2WA 1SFTA 1N55A 1B3VA 5LHFA 1EO7A 4LANA 3THQA 2Y7FA 3A5VA 5JU6A 4D6CA 2PDUA 3CZJA 5DBTA 1AA1B 5E9AA 4ROPA 3SFWA 1CXIA 3PJTA 1Y0EA 1GVFA 3RJYA 5C9ZA 5REQA 1CBGA 2IQDA 1ZCOA 4HK7A 3BAJA 3WFZA 2XTKA 3GFXA 1KM1A 4GQRA 4W86A 1VFHA 2VO5A 4PUWA 3BLFA 1XXXA 4K1GA 4HVXA 1W9BM 1R0MA 3C52A 4WJEA 5FEWA 3H2AA 3FXGA 2QMKA 1FFRA 4LSBA 3F2BA 3VIFA 3N1AA 3W86A 4Z17A 1VIZA 2ZXAA 2ZZ7A 3WQ5A 4Z0JA 2WANA 3HMJG 3GE7A 2GJXA 4LRTA 3WLHA 4ZFMA 3WJXA 4E0CA 2HQAA 4DAFA 2CFFA 4DZAA 1PIFA 3WL1A 4RKAA 3ZT5A 1Z9AA 5J5RA 4JICA 3ITCA 1F6YA 1TPVA 3ARUA 1KV8A 1WO2A 4ZVJA 3KOWA 1E4LA 1QATA 4ORIA 2XYLA 1DQUA 3GH5A 3STCA 1RQBA 4IX2A 5A95A 3FN9A 2G3FA 2VOMA 3EXRA 5CEWA 1KM5A 1Q6LA 5C7VA 4ACYA 1YW1A 1HTIA 2RDTA 3H26A 1FWEC 3BLKA 3LXAA 1OVDA 4YPJA 3XINA 1TPUA 4A3RA 4KQNA 4J27A 4TX9A 2Z25A 4AEEA 2ON3A 3AZSA 3LOTA 3VDBA 4QLLA 1IXOA 3VVGA 1M7PA 4XISA 5D33A 3BQ6A 4UTKA 5CPSA 4AX6A 2OQYA 1QK0A 4XAFA 3AIQA 2D2GA 3CPRA 3U2CA 3N18A 2PWDA 2X0SA 3NUKA 1W5OA 4GI9A 3ENLA 3CUXA 2UY2A 4F0MA 2ZE0A 1CLXA 1VYRA 4U10A 4EXQA 1E9YB 1XIBA 4MLJA 4FIQA 2ZYFA 3O7UA 1W5QA 1TWIA 1YKWA 5HR6A 3B8SA 1PZ1A 1ZAHA 1Q7MA 4NRRA 1TTQA 3GXPA 3HF3A 4MTVA 3WH9A 3KBNA 4LAOA 4OV9A 4IWWA 3UQNA 2QIIA 3UY7A 1JDAA 3MCOA 4D6DA 3DFYA 5HMDA 3W02A 1KLZA 1Q6RA 1XLDA 4ERIA 1FWHC 1OYBA 1RLDA 1AJZA 1E1EA 3EOLA 4US5A 3PJWA 4R85A 2TAAA 4J2PA 4R27A 2DUXA 3OHMB 4IUGA 2G5WA 1F6PA 1RJRA 4V33A 3GVQA 4D6IA 5EB8A 3LS9A 1I0DA 3GAKA 2ONEA 2GJXB 5D8WA 5DRCA 1LLWA 4W85A 1X6UA 1S38A 4DAIA 2RH9A 3IWPA 4L4MA 4C60A 1AK5A 1LT8A 2A3CA 1XSJA 1HO4A 3LRMA 1QASA 3GDLA 3O07A 3BARA 1JCXA 1EIXA 3QY6A 1B31A 4H2HA 1VIWA 4FP1A 1GTEA 3TMQA 3N25A 4CD7A 4E8CA 2GFTA 2JE8A 5JIPA 5CLTA 2WZHA 1JPKA 4L64A 1OFEA 2PGWA 3WJWA 4ZOEA 1B9BA 3W7NA 4QJ4B 4O1AA 1XSKA 3MBDA 1ZP3A 4Y96A 1XLBA 4ATLA 4GJJA 1Z32X 4LEFA 4JPGA 3L0GA 4HBKA 2DU2A 4HOWA 3NR0A 3T78A 4HTBA 5HINA 3IIPA 1A5AA 1C92A 3FW6A 5FOOA 2Q8ZA 1UWUA 4KETA 4HHMA 4J3TA 4AEFA 2D0GA 3VKJA 3CIWA 4QAWA 2W6RA 3P8JA 3DENA 4HZ8A 4EPBC 2ZXQA 4I7WA 2UY4A 3HIJA 3UBPC 2YFNA 3BV7A 3G77A 4C7DA 2VEPA 3PAOA 4F0KA 5TAOA 3OG3A 2QMJA 3CQHA 3AYTA 4LU0A 3UWVA 1O4UA 2Y1HA 1H3GA 1FXQA 3QTGA 1BAGA 2WVUA 2AKMA 4WIWA 3L67A 5BCAA 2R1MA 1NF7A 1QNQA 1TR9A 2QIWA 5B80A 1R30A 4Q33A 3LRKA 3UXLA 3ES7A 3GDRA 2J6VA 3MBFA 3BO9A 3LBMA 3AJXA 3BW2A 1NH6A 4Y9AA 3G6LA 5K7JA 5HANA 2PBGA 1JDCA 1QCWA 3NQMA 1ICQA 3QGKC 4R9OA 3QGAC 2WHKA 3EX2A 2DW7A 4RDVA 4FB7A 3VAVA 2CHOA 1H50A 1UASA 2BMBA 1XF0A 1JUEA 5KEZA 1AQMA 1XH1A 4QX4A 4M81A 3CB8A 2WMJA 5AZ1A 2YBUA 2HXTA 3NL5A 3N29A 1IF2A 4PYSA 2CLHA 2CERA 3QTPA 5KSWA 1JFXA 4F9DA 1TZ9A 1VAHA 4L9ZA 3SCPA 3E02A 4EPDC 1J96A 1TJPA 3FSUA 4D6FA 4H4IA 3BCDA 3CLMA 3LZ5A 1H41A 4GYPC 1Q66A 1B9ZA 1VYSX 4BQ5A 3VMOA 4IISA 4CCZA 3LLDA 4W5UA 3N2CA 2VWTA 3M6DA 3O9NA 3KVLA 1JI2A 3SSZA 3K8LA 1IZCA 2V68A 2YXGA 4BF9A 1QAPA 3EOOA 2O9PA 1J9YA 1PHWA 2PC8A 5LSMA 3GBEA 5LA2A 2D2HA 3H2CA 4MNLA 3BZJA 2PTYA 1WDQA 4F2UA 4UFIA 3RMEA 4J3VA 1UKOA 1PPIA 3G2GA 2E67A 3C2YA 3G1SA 1FUYA 3KDOA 4JTKA 1ZENA 2GVYA 1G9HA 4URIA 1ENUA 1UD3A 3Q58A 2Y5JA 4AWUA 3HG3A 3VE9A 1R3RA 4QNEA 3P2VA 5HWJA 4PTMA 1KQZA 1M03A 4B16A 3DBPA 1SJCA 3F4NA 4XTDA 3DG7A 2ZC8A 2ZRVA 1TELA 4JL2A 4NF7A 4XBJA 5FF4A 4YMZA 4HYVA 4FI4A 3HZ3A 4NZJA 3QPEA 1DWGM 4MOZA 4HCHA 1DPMA 4DJFD 1X96A 1XYBA 1NOWA 2X16A 3NQBA 3TW6A 4JS3A 4AUBA 2BNJA 4S3GA 1X7IA 4H00A 2YCIX 2BHYA 3AISA 4DUXA 1PHQA 4N7QA 2VGBA 3L2MA 4DM1A 3N17A 2NSXA 3AIEA 4Q6JA 1XISA 1YBQA 1DTUA 4B2DA 2XIJA 3DERA 4FNPA 3MQTA 3P67A 2V2CA 4UQAA 5CZTA 5A8QA 4QHRA 3NPXA 3EB2A 4F0RA 2VEFA 4A8NA 4CD8A 1R86A 5IDIA 1XD1A 4QFUA 4YVPA 4NAFA 3IUDA 3EKLA 1W2VA 5EBAA 3WFAA 1WX0A 3H7UA 2BVWA 1GKPA 3EKGA 1W9VA 2XH2A 4U2YA 2WMIA 2GQ9A 2DZAA 2QLYA 1FWIC 3GK0A 3PNZA 4R7JA 3LHTA 4E2BA 4CCDA 2XN1A 1W9XA 3CZ8A 4IJRA 1XDMA 3PN8A 3RU8X 3W2LA 2AGKA 1SMAA 3CJPA 3TWBA 2DY3A 3CYVA 5AHEA 3QYQA 1AMYA 2R91A 1ICSA 4NZCA 1UD8A 1H5VA 1POKA 3GAYA 5A8OA 3B0UX 1ZJBA 2A3BA 2B81A 1AL7A 1TVLA 2PU0A 2XH7A 4GC4A 3WD2A 3O6DA 4HCDA 3WNNA 2C1HA 4QROA 2EXOA 2PWEA 2YDSA 4QLJA 3VKAA 1HKWA 3LI1A 2EAWA 1GVRA 4JTHA 3W75A 3KVMA 3VKBA 5M03A 2HNEA 1QI0A 1FP8A 3RX3A 3OEXA 1KGXA 3EMZA 2ZUMA 1MEWA 1FCVA 1CCWB 3SQSA 2DGAA 1F3TA 2NXIA 1VPYA 2YKKA 1O5XA 1ME9A 1EQCA 2B31A 4PCSA 5HATA 4L5ZA 3OBAA 4M0XA 1YTEA 1RAKA 4Z1YA 4O17A 4Z2LA 1M53A 3MDWA 3U7VA 1AG1O 2ASHA 1A5UA 2YFOA 3HTWA 1BG4A 3CHFA 2EPMX 4MUZA 2JKEA 1ZS2A 2A7NA 2CLLA 1D8CA 1HQTA 4JX5A 3GKAA 4GBUA 4LAKA 1LOQA 3LA4A 1C29A 4Y9OA 2PD5A 2H6RA 4S2CA 4BS0A 3GTNA 1V7AA 3VI2A 4XZ9A 1O94A 4UR9A 4DWSD 5D09A 3W0KA 2V3GA 3BH4A 1UQZA 1EX1A 4M7SA 5HWNA 4TV5A 4AY7A 2C7FA 4NAFB 3F4VA 2ZADA 5DBUA 1WDPA 4R3UA 4UQCA 2C15A 3TLLA 1KCXA 1L0PA 4W88A 1N7KA 3L4WA 1GCYA 3VYLA 1GTHA 1A4MA 4ZGYA 2DVTA 4DYKA 5BNKA 3UXDA 1XYCA 2GJLA 3UGRA 4DY1A 2ISWA 1KLYA 1OG6A 4H9UA 1FOBA 3E6EA 2GUYA 3BZGA 5CSUA 1XKYA 1TVNA 3NL2A 1RSCA 1E72M 1IXQA 4K2SA 5IFPA 4HU8A 2GOUA 3TW9A 4FF5A 4QE5A 2O7QA 3UU0A 3ARYA 1YTKA 3AROA 4TXEA 3B9EA 3U2OA 3ARRA 1JF5A 2XJ7A 3LTYA 1E40A 1GHRA 2OLAA 2BS9A 4N2YA 3VGEA 2PODA 4U5IA 3VFCA 4GUGA 2AQVA 4Z42C 4LVBA 1EP3A 1S46A 2E68A 3VX1A 2QCDA 2ZZ4A 4Q4QA 1GVOA 2X1RA 3TUUA 3EDJA 4F40A 3K4WA 3IJ7A 5F4WA 2OSYA 5A6LA 1SUXA 3CWOX 1NF0A 4RW5A 1Z48A 5I2UA 1IXNA 3IGSA 1AW2A 3AWOA 3M47A 3EAUA 3ORWA 2PI6A 1IIHA 1WKDA 3HV8A 6TAAA 1QW8A 1X8CA 2V3FA 4P61A 4CEXC 1AVAA 4J3XA 3DU0A 3FFSA 1KCLA 1QW7A 1AH0A 4X0NA 2EG7A 4K1WA 3SURA 4JYDA 5BXRA 4LY8A 1UPMB 5EMJA 1US3A 2QDEA 5CBJA 1DJYA 3ZT7A 3GHRA 1VH7A 3ABSA 3VCRA 1K70A 1N2VA 5BXTA 1HT6A 5EMMA 1J18A 1Q65A 2OLHA 2NQLA 2VX6A 4U28A 3N13A 3L7RA 5I7GA 4F8XA 1GOQA 2J24A 3DZ1A 3TQPA 4DXVA 1XH0A 3C2RA 4A3HA 3ERPA 2Q02A 1WZLA 5DMNA 3O8AA 3IIOA 3I4EA 2EO7A 4H9MA 4ZR8A 4EWJA 1JAKA 1EJTC 3I6RA 4I6KA 3GHSA 2WVSA 5I02A 4AWTA 4JNYA 3II1A 3OU8A 5U4NA 3WEOA 3UG3A 3UY8A 1TX2A 4G8TA 4XD4A 1J0HA 2A0NA 5IBXA 1HNYA 1LWIA 1XI3A 4B15A 2AOSA 2YSWA 3R2GA 4IPNB 3RR4A 3TQ0A 1WB0A 4WD0A 1AJ2A 3WQGA 3OBKA 1ZJHA 2GJNA 3PB0A 4FPSA 1S2WA 2VR2A 4WZHA 3GTXA 3NXLA 1J0ZA 1OZQA 1W31A 5CZJA 5GPRA 4WDTA 3Q65A 2BY3A 4HA0A 3DOPA 2X2YA 3UJ2A 4JOMA 4QISA 3P6LA 3UPMA 5D30A 4ZE4A 4K68A 4GI8A 3THUA 3CUJA 1BYCA 1G01A 4NJKA 5DO8A 3EWZA 1QHPA 1XPYA 2R6OA 2ALDA 3OVQA 1VBUA 2WM0A 1SO5A 2HVOA 3R1ZA 2XH4A 3EOEA 3LCIA 2YL5A 3DFTA 4Z1CA 1V79A 2CBJA 3C86A 2CZVA 1RV8A 3NEVA 2VJXA 1JYNA 3PY2A 4JFUA 3ZLGA 3AZRA 1R38A 3JW7A 4A2SA 2O7SA 4E2DA 4ZO8A 1CECA 1LRQA 3SCSA 3V5OA 2IS7A 4AZ5A 4IG2B 1VQTA 4JTSA 2I7GA 4HPNA 3UZXA 1DHPA 4XIAA 4NI3A 2CHNA 4BZYA 1H0GA 1RD5A 4HYWA 1BKSA 4Q6XA 4BWLA 1OGSA 2CW6A 3VUSA 5I79A 3HPFA 4PMYA 3TV8A 1JCMP 2CYGA 4TMCA 1XHGA 1DJHA 5C2XA 1ZALA 4US6A 3PUOA 3GD6A 5LIUX 4ORMA 4WX2A 1TUXA 4JY9A 4ZOBA 1PXGA 4QG9A 1W56A 2I5GA 3KOXA 1G6CA 3H12A 4MM1A 1GWJA 4D71A 1MWOA 3LUTA 3GIYA 1NP2A 2PGFA 5A3HA 3IAPA 1S2CA 1CDGA 2E6FA 3BXWA 4PCTA 1UD6A 4MWAA 1ITCA 2W79A 5I07A 1TJ2A 1YYAA 1W91A 1DP0A 5D2XA 4WSKA 5JMUA 1TUFA 3VU2A 2G96A 2DIJA 1BXCA 3N4EA 3I6EA 1J8VA 4KWOA 2OT1A 2YBTA 2F61A 2G8ZA 5IXEA 1GEQA 2NSOA 4UMBA 5KZMA 3RFAA 1Z7AA 2WKGA 3W1NA 1V77A 1AUSL 1K6WA 3MVTA 3WJYA 1KWKA 4AF0B 5D37A 1RJPA 3GNRA 2H3DA 5BU9A 5DEZA 3NJ3A 4JL1A 4DUWA 3C2EA 1MRAA 4LV4A 3MJYA 3KHDA 2HSAA 3PZNA 2XN0A 3RXZA 1GJPA 3LCHA 2TODA 1XKJA 1WZMA 4MKVA 4O13A 5BOEA 2ATMA 4ZA0A 1ZRQA 1O5KA 2VFDA 3TJXA 1UC4A 1IGSA 3CM4A 1CTNA 1YNQA 3ONCA 3QV7A 3GXNA 5JH1A 4PULA 1FWCC 4LS2A 4IUOA 2XZ7A 1SZFA 3WDIA 3F4CA 4LUSA 2FJKA 3VOCA 1Q13A 4NI8A 1UD5A 4MY9A 5MHBA 2PP0A 3NAVA 4RUBA 3TSMA 3CB3A 2Y61A 4KW2A 3DESA 1NWTA 1ISWA 2WVTA 3QRHA 3WQOA 1ISYA 2PDBA 2Y4SA 3WMBA 1XD0A 4O28A 2VZVA 2WPBA 2R1NA 1XYFA 3MV11 1L6GA 3A4WA 4P7NA 2Q01A 3SRKA 4JFSA 3W1AA 4HA3A 4ZQRA 1OCNA 3W7JA 2O4MA 3TXVA 3DXIA 4QXIA 3VOGA 4UTJA 1TWWA 1E51A 1H1YA 1ECQA 2Y7EA 2YA2A 3UEQA 2PDJA 4OU1A 2QR6A 1XCXA 3V3WA 3LHVA 2WZTA 4NJJA 4DYJA 3EWBX 2PGEA 2WC3A 2VFFA 4PRWA 1XLMA 5FA5A 4FALA 3DHFA 3A13A 5BWAA 1SW3A 4FK9A 4G6CA 1UR3M 4MWAB 1TE1A 1NELA 4NNBA 1TIMA 4BEQA 1A50A 3BLPX 4INFA 3S9YA 4KBXA 3U5YA 3FJLA 4HPHA 3EMCA 2IMRA 2QAFA 1HFBA 1HUVA 1TZ7A 2ZZ6A 5CG7A 1MW2A 3K13A 1GW1A 1Q6EA 3KBJA 3RM9A 5HR7A 5E1QA 4YN5A 1A80A 1DL3A 3WF2A 4O1EA 3UWZA 1IT7A 2FPTA 3U0HA 2ZTJA 5A6MA 3K4DA 4BK9A 4IFRA 1D3HA 2FKPA 2I16A 2ZA3A 1TPFA 3W7IA 2B7QA 4UTIA 2PGRA 3A3XA 1WOAA 3NM1A 2V82A 3RGTA 2IW0A 3LGDA 2PDYA 1JZ4A 2PCEA 3VMPA 3WK1A 4YTUA 2CBVA 3CLWA 3B0XA 3UWYA 1S5TA 3M6YA 5GJMA 1OWQA 4LNCA 5T26A 3CL7A 3BGGA 4YXGA 3T44A 1Z89A 4O16A 2VCCA 4TX6A 3R0DA 3RN6A 4HN8A 2BXVA 3KL5A 5FESA 4AFYA 1OINA 3S6DA 3WF3A 2H9AA 2PP3A 5C9UA 5RUBA 4O0KA 1DYSA 3G1DA 1VBRA 3HQ1A 5HDRA 1JJKA 1T7LA 4N9EA 1W5MA 2CU0A 4H8UA 3VNMA 3RPMA 5G4EA 1XPGA 1E55A 3ITOA 4NHVA 1LBLA 4MKSA 3S5YA 3NURA 2QV5A 1TSIA 3AICA 3T07A 3IACA 4UTFA 1FKWA 1JRBA 5I3GA 3NO5A 4EAYA 1M3UA 1XW8A 3GU9A 3NQ8A 1EHAA 3HO8A 3SUUA 4IJBA 1EA0A 1GZJA 4XWUA 5I0DA 3UT0A 1XLGA 2O56A 3L65A 3WQWA 7REQA 1OT1A 1NFGA 2HDJA 1GORA 1TR1A 2YW3A 3T8LA 1XGDA 1WZAA 4N02A 4PMZA 1FWBC 3NQCA 1TPDA 5DQPA 4JFVA 1NTHA 2D0HA 1K7XA 1S2UA 1XRSA 3AHYA 2XVPA 5CZKA 2ABAA 4AIEA 4FX8A 1UKQA 1R9ZA 3HPXA 2HBXA 2XU2A 1I60A 3ITTA 4M6VA 2VVSA 2W92A 4PMOA 1AD4A 1DWFM 2J77A 4H01A 3QR3A 5D9NA 3BJSA 4ACZA 1B54A 3EWDA 3UWEA 9CGTA 3VD5A 2GWGA 4GGHA 1K8ZA 3NL6A 4IFKA 1NWSA 2DJLA 3LN3A 5IBXC 4WK9A 1GUVA 1AD1A 1E5NA 4MNJA 4RDZA 1C8VA 2INZA 2CLFA 4GO8A 1NOUA 4UFHA 3RNDA 2P3EA 1XQKA 2YCKX 1TTIA 1ZAJA 4DM2A 1ONXA 3RRXA 5BXSA 3WDQA 3PR2A 3BAKA 1PKNA 4IL0A 4QDMA 3NSXA 3WF4A 1X7FA 1RXOB 2IPWA 4JQ3A 3RM4A 2VRKA 3B9AA 3GHTA 4JIQA 2XH0A 2A7PA 1FH8A 2Y63A 2DZWA 4ZTXA 3UXKA 3ID7A 3GUGA 2VX7A 2XWEA 1JNDA 2I14A 3FYYA 4RXFA 2Q6ZA 2E6AA 4P7OA 1B3XA 2ZCGA 1HN1A 4P8WA 1Z8AA 2XVNA 1E9IA 3GUWA 1XH2A 3P62A 3W7MA 3LBOA 4HHLA 3V36A 3VDAA 4X60A 3H54A 3WELA 3G1AA 2CITA 4IIDA 2YPIA 1PCKA 4U4MA 4JTUA 4A21A 3UA3A 4Q8OA 3AFBA 3SI9A 5JVLA 3QQWA 3HQPA 4WY0F 4JEJA 2VXNA 1JZ2A 3EA2A 3ABQA 1UROA 1CGYA 3ZSSA 4BWLC 1W1YA 3T4CA 2OLSA 1PWMA 2QCGA 7REQB 1KM6A 1XJBA 4MPQA 4JX6A 3WLPA 7ODCA 1DJWA 1CGUA 3D5HA 4PMXA 4ZXLA 1W32A 3OGVA 4MMWA 3IUHA 1NQ6A 3VNDA 1I1WA 1JQVA 3W7QA 4XB3A 1WDRA 3TJ4A 2J7EA 1GVYA 4NU7A 3DCPA 3D0CA 2PF8A 3O16A 1F05A 4ACZB 1TWDA 4JNZA 2ZX9A 3EEGA 4JZ5A 3WNKA 4LALA 4KFOA 2VVNA 4KKXA 1EBHA 5G1MA 1PEZA 3OLIA 4IFKB 1CXKA 4L65A 3GIQA 3SQLA 3IJ9A 3VIIA 3ABOA 2ZWZA 1M68A 4DZHA 4MWAC 2Z1VA 4PUUA 5D2TA 5DRIA 1VEMA 2OVLA 6REQB 1V3IA 2FVMA 1NDVA 3U7BA 3ATYA 1O60A 4GABA 3LDVA 3RO6A 3Q94A 3TA6A 1DVJA 3IAQA 2DDXA 2J7HA 3KM8A 1OK4A 2QV4A 1VLIA 1BSLA 2ACQA 1HZYA 3AC0A 1AFSA 2OQLA 2QNEA 2GSHA 2L5HA 2PWHA 2XIMA 3AMDA 4ADTA 1OC6A 2XGBA 2GPTA 4GVFA 2EQDA 3WYZA 3NDZA 4HGXA 1DIKA 4FNTA 1KRCC 1EYWA 3C0QA 1MXDA 1VR6A 1N8FA 1RCXB 4D6HA 2FFIA 3SRFA 2FB3A 2Y5SA 1F5ZA 1G4SA 2OZ0A 3VIKA 3VZXA 1QPOA 4YCOA 5AN7A 1K6AA 3OIHA 2ZUUA 4US5D 2WCSA 4GISA 4QE1A 3G6MA 1JZ3A 1BF6A 1T96A 2C79A 1JF6A 4KEVA 4L6HA 5D05A 4QS5A 4JTRA 1G94A 4KWUA 4BKNA 1ICPA 3OBEA 1J0IA 3EXTA 4QTGA 1V7YA 4DO4A 4EAMA 2IKGA 4CNSA 1IEXA 3VC5A 2OJPA 4LY4A 3BJFA 4A35A 4IX0A 5J04A 2FDMA 4Z08A 4P2VA 3I10A 4IPJA 3E0WA 3EWCA 5HWMA 2Z2BA 4Z0SA 2V63A 4BFAA 3AU6A 2Z24A 4Q3MA 2BVDA 2CLPA 5A2AA 2FZBA 3PG9A 4AB4A 3GTIA 1QUMA 1EPXA 1YDNA 4AXKA 2AAMA 1VD6A 3SCRA 2V5LA 4OE7A 2NVCA 1OX6A 1C91A 1GONA 2PWUA 2WBGA 1J0JA 2PRMA 4EPEC 5BMXA 1WPCA 4H6RA 1K7FA 1UKTA 1QPQA 3L9CA 4CKQA 1T0OA 4H9ZA 1ISVA 3TIMA 3NQFA 2X41A 1UH4A 1XLIA 1VHCA 1C8XA 4RR4A 2WSRA 2VZUA 3M5ZA 1P0BA 3CS2A 3IGXA 2TMDA 1B0IA 4HNNA 1OGBA 3TCEA 3AI0A 3HGSA 1U33A 4PR4A 2MUCA 2TRSA 1F73A 1R2RA 3WLJA 2G3JA 5BWFA 3N3MA 3FA5A 4LT9A 3W38A 4A05A 1O5RA 1R7OA 5M1TA 3WD4A 2GGEA 1W1TA 1F4AA 2Z29A 1JR1A 2E77A 2W4XA 2DQWA 1YE6A 9XIMA 5T9BG 4CNUA 4LBSA 1OC7A 1GYLA 2FZMA 1LRTA 3VOJA 3WLRA 2BXZA 2ZKMX 1X1ZA 2ZDRA 5IM51 2DSUA 4YS1A 3W01A 4LEQA 2HROA 1UP3A 2OOFA 3E0LA 1U83A 4NSBA 2UZ9A 2BGSA 2WM1A 1S5NA 1L8NA 4O11A 1BQCA 3HJZA 5C8BB 2WNWA 2WMKA 2PPGA 3W1XA 3DUGA 1DV7A 4QSFA 3BLIA 4MYAA 3LBCA 4WY0A 4MDOA 1P4CA 1QBBA 5GQBA 3PJUA 2D1ZA 2QCHA 3VKDA 1V02A 1TPWA 4D8ZA 1W1PA 2VC7A 4H9YA 1E6PA 1YXDA 4D6GA 2OR2A 4GNVA 3I3BA 1SJBA 5FIPA 2A3LA 1H49A 1TWSA 4MDPA 4NNCA 4WGXA 2PZNA 4DHGA 4IPLA 2JEQA 5HBFA 3GDTA 3PC0A 4QJ5B 4GD0A 3ALGA 2GK1A 3C61A 3VABA 3OYXA 1P7TB 5FEPA 3WBAA 5AHMA 3U2ZA 4H8HA 2X2GA 5DMLA 5E5CA 3NZGA 4XVEA 3TYEA 4GACA 1JPHA 3N14A 4B91A 4KCUA 5AHIA 1TREA 4MAZA 2F2KA 4QCFA 3QMSA 1OFRA 3WLNA 4TVDA 2Y8UA 1UPPA 3QXBA 4J7RA 5FL1A 4MY8A 1ZGDA 1TTPA 4KRZA 3CQJA 1Q63A 3W82A 3BTNA 1VHNA 3KUMA 3GWQA 2RDXA 3B9OA 1V6YA 3B4UA 3W73A 2YB1A 4LF2A 1TPC1 3HOJA 3AYVA 2E9LA 1TV3A 3C3UA 1OX4A 2E1WA 4MZ8A 4MZYA 4XBSA 4AZ7A 1H11A 1WE5A 1RCQA 4FXSA 3AMGA 3IANA 3ALFA 3P74A 5A8MA 4PMUA 3R8HA 3REQB 3RCYA 3WBYA 4ZBCA 3MP5A 1KWGA 3HB9A 1Q45A 1RY0A 1LT7A 2P0OA 3GZ3A 4Q8NA 3L12A 3ZT6A 3GVRA 3WMSA 5C2CA 4PMRA 1LG2A 2E9BA 1TQJA 1ELSA 4RZ6A 4FXJA 2QCCA 3WIJA 1ITQA 5SWUA 4AIOA 1XCWA 4UTHA 4ZQOA 1WDDA 1XX1A 1CLKA 4GCAA 1ZBVA 4K39A 3LY0A 4DXXA 3WK2A 3FSTA 2OO0A 1XG3A 4GC3A 3LMYA 3S9ZA 3BMWA 3M16A 1FY6A 3CIVA 2H8XA 4UTTA 3WLSA 1U1JA 4QJ3B 3SUWA 4LRSA 3W7CA 5I6SA 2GGIA 4B2DD 3UJRA 1XYZA 4IQDA 5LIKX 5HAOA 2AAAA 2Q8XA 1RK5A 2DW6A 4XO7A 2X1IA 1UH3A 3OPSA 4PUNA 3WH7A 3C5QA 3CGTA 3Q45A 4F0HA 3EEZA 2ZE3A 2ZTKA 4HNCA 2F38A 1HKMA 1K9EA 3OGRA 4IPIA 1MW1A 4UTWA 4C90A 3K46A 4GQBA 1SSGA 2VFIA 3WUBA 4AVFA 3DKLA 3M0VA 3KCLA 1NSJA 1SO3A 4LCSA 4DBWA 3UXIA 1BTMA 3VINA 3TOPA 2HK0A 1EXPA 1KXTA 3EZ4A 1KQYA 3CC1A 5LXXA 3BOLA 1QPKA 3SCOA 4GI4A 3CHEA 2HEJA 2DQXA 3T09A 4BF7A 4FF7A 3ZR4A 2OQHA 3FDGA 2V2HA 2OKTA 2DUAA 5IHRA 2VRQA 4L56A 1OX4B 1VJIA 3KBVA 5LNUA 4AH7A 2CBUA 3ITVA 2GVGA 3MUY1 3WUFA 1B1YA 2HPMA 2AGTA 4AX7A 1MSSA 3M0HA 5ABFA 4TUFA 4AHOA 5LGXA 1S1PA 2X7WA 7ENLA 1OGGA 2CBIA 3ARTA 3KE0A 4DWDA 3NPUA 4ONVA 3MYPA 4CGTA 3QM3A 1BF2A 3DGRA 3EA1A 1EJ7L 1R47A 3DKJA 4ICMA 4ALDA 3WNLA 2XFRA 4C91A 2WHMA 2ZUNA 4AIUA 1JGMA 5A6TC 1RQEA 3A4XA 5AB3A 1QNVA 3A12A 3N6QA 4NAEA 4NZ1A 4PFMA 3E3HA 2GOKA 3OLGA 4WEVX 4NILA 3OA5A 3T1GA 4U33A 2Z1KA 2VDHA 3CV1A 4YHEA 5C9WA 4AZIA 4O4VA 3TR2A 4H9VA 3QF0A 5I3FA 3SBFA 1IYXA 4MB5A 1ZZMA 2VWSA 4C6NA 2ZIDA 2FPYA 4LS1A 1CNVA 1KTNA 3EWWA 1QFEA 3VOIA 5CCZA 1NQKA 3S2NA 4TR9A 1WAWA 4TX8A 1OD8A 3TXZA 3CL6A 3SDOA 3KRSA 2A21A 3MI6A 4L9YA 3P0XA 4H41A 3WDHA 4DYEA 1KM3A 2NT0A 1WUEA 3WNMA 5EA9A 4EANA 2DIKA 4M7TA 2ZUVA 1QO2A 1MXGA 4QR6A 1NEYA 3HBLA 4JKKA 1HX0A 1UJQA 1VFMA 4DF0A 2JK2A 2DJXA 5AHLA 2HBVA 3VGFA 4J3UA 3AS2A 3FHAA 1XRTA 4WJXA 4AMAA 2WJEA 1N8WA 1YIXA 4KEZA 4BQ2A 3R0KA 4WRHA 1H7PA 1HGYA 4FS9A 4FNQA 4D1JA 2KX9A 3PPGA 5CXPA 4S3CA 4ZOCA 1EOKA 4PMDA 4ZQMA 2DT1A 2D2OA 4UUIA 2YZ5A 1OFDA 4XO6A 5LNRA 4AIBA 3ZO9A 3NZPA 5FJRA 1RH9A 3FYPA 4WUIA 4ZB2A 4GVHA 1SR9A 5XIAA 3NTYA 2EJ1A 3TZNA 2W67A 4IGSA 4JTLA 1TV4A 3M0KA 3LSCA 4OBRA 1UZ1A 2XISA 4OIFA 1VCFA 4RV8A