1G94A

Crystal structure analysis of the ternary complex between psychrophilic alpha amylase from pseudoalteromonas haloplanctis in complex with a hepta-saccharide and a tris molecule
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 158
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2000-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1g94A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1g94A01
4NZCA 3DYMA 1TQTA 3NUKA 1CGVA 3AXXA 1QWNA 1E0VA 3PTMA 3WNPA 2XYLA 4B3LA 5CLWA 4ATWA 2QV4A 1UR1A 4JL2A 5M3WA 4U2ZA 1XD0A 4AEFA 2DEPA 5BXRA 2WVVB 1HNYA 3PZIA 3BAYA 5ABFB 1KTBA 1E9LA 1KGUA 3RDKA 3D50A 4ZE5A 2MANA 2YLAA 4PBGA 4UZSA 1M01A 3S5ZA 4HA3A 3WH9A 2JF6A 5AC5A 3MSDA 3BAIA 3L4XA 1WDRA 1V03A 2NT0A 4CKQA 1CLXA 5A2CA 1TQUA 3N17A 4JCLA 4L4PA 3WH8A 1GQIA 2BV9A 1OD0A 4DM2A 2YJQA 1B0IA 1E1EA 2PC8A 3CZGA 3WN6A 3WEOA 3SCVA 2WWCA 2WMKA 3WDJA 1WZAA 3A4XA 1TCMA 4OZOA 1GJUA 2F2HA 1LL7A 1EO7A 4NZJA 3CZJA 1Q6DA 2C8NA 1Q6EA 1PJ9A 1C7TA 3GNRA 2XVPA 3SEPA 3RM9A 4X0VA 2VQUA 4AMWA 3VU2A 1DWFM 4CGTA 1LG2A 4KGLA 4Z2HA 1CWYA 3FNDA 2ZXBA 1UD3A 2BXZA 1V6WA 2VZUA 3PBGA 4UFMA 5LA1A 1KXTA 2FHCA 2E8ZA 1NOWA 1UWUA 4MJ2A 1VJSA 3U57A 1GPFA 4HMDA 4J3XA 1D7FA 2BVDA 4GQRA 4LYRA 4J3VA 2QMKA 3EYPA 3VIFA 1L0PA 1XH1A 3SCRA 5HOSA 1FH7A 3WMSA 3AICA 3VIPA 3CO4A 5BXSA 3W0KA 4E4PA 1XCXA 3WKZA 1E6SM 1HF6A 2E4TA 3TTOA 1BGGA 1EIBA 3W37A 5D9NA 4MPKA 5D9MA 2VURA 1GOMA 1QHZA 2CKSA 4FNPA 2VTFA 4M1RA 2HISA 3RM8A 2DGAA 5DT7A 4B16A 2F1BA 5IXEA 3L2MA 3FY1A 3MV01 2AOSA 1OIFA 1D2KA 3VD4A 2WNWA 3QR3A 5GPRA 3ZR6A 3W27A 3VMNA 3ECQA 3HG4A 4XB3A 1HJSA 1M03A 3F5LA 5CPSA 1QHPA 4PSRA 1E4IA 2VZSA 3GZAA 3AFBA 4F79A 1DTUA 1NOUA 3W6MA 4W8AA 1QI2A 1US2A 4J28A 2VZTA 4C7GA 2EEXA 4WKHA 1HIZA 2XPKA 3TV8A 4JIEA 4PEEA 3UETA 3PZMA 2WZEA 3MANA 1BFNA 2VUYA 3H54A 2ZXQA 2J7GA 4OBSA 4BF7A 1UQZA 4D6EA 2IUZA 4CU7A 2GK1A 2W61A 4UFKA 3T2QA 4AZGA 1DP0A 4D6HA 2J47A 4W8BA 2DIEA 3BAJA 3ZSTA 3DX4A 2DSZA 3GM8A 1GHRA 2YBUA 4NI3A 5HPCA 2XN1A 2D20A 2VR5A 3WF1A 2WMGA 2O9TA 4ACZB 4ATLA 1QBAA 3RILA 2YDRA 1JZ8A 3PZ9A 3RO8A 2D0GA 1OINA 2BHUA 3N13A 1GHSA 1MQQA 3GXFA 5A2AA 1PZ3A 4W7WA 3SIMA 1KBKA 1KBBA 2FHBA 5ABEA 5BXPA 3A21A 2XVNA 4M80A 3B8SA 3VGGA 1UKQA 1W2PA 3MMUA 3WMCA 1E3XA 3KL0A 4MB3A 2XUCA 3AHXA 1DWGM 1HJXA 1KWKA 4U2YA 2OWWA 1J0KA 1GQJA 3WY2A 1JF6A 4W5UA 2WMIB 5CGMA 4JFWA 3OZOA 1B9ZA 4UFIA 1KTCA 4EK7A 1V0NA 3AHYA 1S46A 1CLVA 3WD3A 1XSJA 3AS3A 3LPPA 1FP9A 4NSBA 4Z2LA 3VIOA 4W84A 1PAMA 4IM4A 4AD4A 2OW7A 4JHZA 5M03A 3GNOA 4H04A 2D0FA 4GINA 4AIOA 2VR4A 1QBBA 4JAWA 3VDHA 3KE0A 2PWEA 3VD9A 2CBVA 4PMUA 3S6TA 1ODUA 3W53A 3DX0A 2O9RA 3A4AA 3EBVA 5AY7A 1V6YA 4WSKA 2RGMA 3L4YA 1P6WA 1DWIM 4L4OA 2G3NA 4R5EA 3AHTA 3POHA 1R85A 2WW5A 4PUDA 4KRUA 1NQ6A 4JKKA 5E70A 3FAWA 1JNDA 3CPUA 4H8VA 3WNLA 4GQQA 1WZKA 1U33A 1KR0A 1JD9A 1UWQA 3T2OA 3VGBA 4BQ3A 4B3KA 2VMFA 1SR0A 3CZLA 4KRTA 1OM0A 4YHGA 3ARXA 1L8NA 3B9AA 2XWDA 1CBGA 1EXPA 4WF7A 5FD0A 4OOZA 3W4RA 1SMAA 4KWUA 4E8CA 3LRMA 3IJ8A 4P7OA 4GXPA 4UCFA 2YFOA 4AD0A 1FFQA 1JAEA 1UKPA 5E0CA 5CPTA 1Q4NX 3WD1A 2PBGA 1K9TA 2FGLA 4TTGA 3OLDA 3ARYA 4UR9A 5F7UA 2CNCA 3VD7A 3H53A 1VEPA 2X09A 3A6OA 3DX2A 3W25A 4W89A 1QNSA 3SCPA 4U5KA 1X6NA 1B31A 1BPLB 5CSYA 4UOZA 3M46A 1XH0A 5HBFA 3WUFA 3N04A 5CJ5A 3BVTA 2ZWZA 1B30A 4HU8A 4JFUA 7CGTA 3IGUA 3WQ8A 2F8QA 3ARUA 3LPGA 2EPMX 3WH6A 1HP5A 3IJ7A 2CHOA 4MAVA 4OKDA 1VFOA 2BY0A 3D51A 3GXTA 2WLYA 5E0FA 4ZFMA 5IFPA 4FLSA 2F1AA 3W6LA 5I5RA 4UTFA 4P8XA 4TUFA 1XD1A 1BYBA 1E0WA 4V28A 1TG7A 1UR8A 2J7DA 1V6VA 1XYZA 1KGXA 3PZQA 4HP5A 3TP4A 2Q8XA 1R7OA 3CUHA 2CXGA 4JKMA 3D52A 1QI5A 2VVNA 2ZXDA 2F18A 4U33A 1E15A 4FNSA 3PZNA 3CZSA 2W5FA 3VGEA 4TVCA 2E9MA 5E09A 1JZ6A 4CU6A 2FHFA 3ARVA 1V3HA 1B1YA 3BUIA 4JL1A 4UFJA 4P7RA 3BAWA 3EJRA 2YL5A 2X8RA 2XSBA 2ZUSA 1VJZA 1VFUA 5C8BB 2C7FA 2VCCA 2BXYA 4PMZA 4FNUA 3NDZA 3AIVA 1JYXA 4GKLA 3TTSA 1ISVA 1E70M 2D2OA 2G3MA 3K1DA 3D4YA 1E6RA 1NP0A 3PZOA 4D6IA 4LPCA 1Q6GA 2J62A 1VEMA 4HOXA 1VRXA 1E40A 4HTYA 1GW1A 2IGTA 1HKIA 1QHOA 2WMIA 1V02A 3ZMRA 1W91A 3ARQA 3BSHA 2WBGA 4AMXA 1E4LA 4DO5A 1B90A 4UQEA 2BS9A 3KEHA 1CXHA 3AISA 2XFFA 2NSXA 1HKKA 2Y8KA 5A6LA 2XIBA 2Y2WA 1W3JA 4D6FA 5HDRA 1HXKA 3TONA 5JBEA 1I1WA 1UWTA 3FHQA 1V02E 2XHYA 4AISA 3UESA 2F7QA 5A8OA 1UD4A 3BSGA 2XM1A 3WFLA 4AIUA 5I3DA 3WDHA 1KWGA 2WKGA 2DDXA 5CGTA 5HPOA 2BVTA 1E6NA 3O2LA 4EKJA 4FK9A 3VOCA 2EAEA 1V08A 1J11A 1UHVA 1E55A 3IJ9A 4QCEA 1UH4A 4ACYA 1W1VA 1E0XA 2G3JA 2EJ1A 1UWSA 1E73M 4X9YA 3W29A 5ABGA 1UZ1A 1EGZA 4GO8A 1U30A 3CH9A 3RJXA 4X0NA 1B3VA 4DUVA 1W1YA 3K8KA 5A6BD 3K8LA 3QHMA 2F7OA 1EHNA 1ITCA 3DX1A 3BAXA 1J0IA 3FAXA 2WLZA 1VEOA 3L4TA 3EJSA 4F8XA 4CD4A 3WL1A 1C92A 1JXKA 4Y7EA 1E71M 2ZX5A 3VO0A 3A23A 2WZIA 4Z2JA 1SZNA 1VFFA 4P8UA 3LPFA 4NX0A 1C8YA 2BFGA 5EFFA 1KXVA 1GOQA 4GI9A 2OLHA 4UFLA 1SMDA 1WB0A 1GQKA 3PN8A 3OB8A 4QLKA 2DSKA 3T2PA 1UD2A 3GDBA 2EADA 3N18A 4W7UA 2JFEX 3ARWA 2W62A 1ISYA 1C3FA 4AWEA 4OIFA 3T08A 4S3JA 4PMVA 6CGTA 1WKYA 3CHEA 2ZUNA 4TVDA 1MW3A 2EO7A 4D1JA 3QOKA 2PI6A 3SUVA 1QI4A 5A8MA 5M5DA 5A8QA 1XH2A 2PWGA 4AC1X 3HMCA 4CUCA 1E6XM 4QAWA 4AD2A 3CUFA 5I79A 3SURA 1IT0A 2ZUWA 1GOOA 4TXEA 4A3HA 3T0AA 5C71A 4IISA 1BHGA 4R27A 3BUPA 4EAMA 3CLWA 2PWHA 2QLYA 1W2VA 4GI6A 3PZUA 3AI0A 3VILA 4QCFA 1E4MM 8A3HA 1F4HA 4YN5A 5ABHA 2GFTA 3WELA 3AZTA 4CD6A 4HOWA 2VO5A 1HVQA 1J18A 2WC7A 1H1NA 4H8HA 3APGA 4FLQA 3GXDA 5I24A 4QLJA 1ZBCA 3AMDA 2QHAA 3HJEA 4J27A 2J78A 3K4AA 1GOIA 1LLOA 1RH9A 2DT0A 4RL3A 3DC0A 4U31A 1EQCA 1CXLA 1MWOA 3WENA 1J0YA 1M53A 1TQWA 1NWTA 2WHLA 5DFAA 1RP9A 3HG3A 1MFVA 1VIWA 5BRPA 4NZFA 2BY2A 1XCWA 1QNRA 2YA1A 3CMJA 1J01A 4MB5A 1MQRA 1TMQA 4JCMA 3BVWA 1UKOA 3UG4A 5CSUA 2CHNA 1V0LA 3T09A 1QI3A 1EDGA 3BVXA 1XSIA 3RM4A 4J3WA 3CZKA 1WPCA 2XG9A 4M56A 3II1A 3WD2A 3A4WA 1UA3A 1H09A 3FXYA 1ESWA 1VB9A 3GXIA 3ZT7A 3KL5A 4UZUA 3KL3A 1E6ZA 3NSNA 1PX8A 3CV5A 4CCEA 1JYVA 2BY3A 1UOKA 2PWDA 4H8UA 2A3HA 3WF2A 1NP2A 5LYRA 3WF4A 3LX9A 2VJXA 2D73A 1O7DC 5E6ZA 2A3CA 1KXHA 4F9DA 3QGVA 4H2CA 2F7PA 1LL6A 1V6UA 1WDQA 1G0CA 2V38A 4C7FA 3VSTA 1KCKA 1BG4A 1WNOA 1T0OA 2NW0A 1K9EA 3AS1A 3WQ4A 3L4WA 1UH3A 5CLTA 1H0GA 1WCGA 3W81A 4Z2GA 4D6DA 1OT1A 2ZX7A 4W86A 3TTYA 2FYVA 2J25A 1DWAM 1EH9A 3SCOA 4CU8A 4UQBA 1W9UA 4F9JA 2VRJA 3UERA 4W5ZA 3BUDA 3CUIA 2OYLA 1OB0A 1IZKA 3OGSA 4WKFA 5A6SA 2WVTA 3AS0A 1OT2A 3PZGA 5IHSA 1QX1A 1CXKA 4RE4A 2WXDM 1W9PA 4P8VA 1GJWA 2YA0A 1JI2A 1JFHA 2BY1A 4J7RA 2JALA 1JZ2A 4XZBA 1B3XA 5DEZA 5TD4A 3ZOAA 5E6YA 4GZIA 1GVIA 4BS0A 1DWHM 4FLRA 2EPLX 2DT1A 4XV0A 2YL6A 2XIIA 4CN4A 4HZ8A 4UQCA 2YIHA 2GUYA 1H41A 4Q22A 3AYRA 2X1IA 3GBEA 1NWSA 3T0DA 1JFXA 2WM0A 4MDPA 3RIKA 5C70A 2EPKX 1RP8A 4BQ4A 4GO9A 3WH7A 3WNOA 1HJUA 3N15A 4URIA 4KH2A 3VMPA 1ZBWA 2IXUA 3ZT6A 1OWQA 5D8ZA 1UR4A 2WVUA 5A8NA 4F66A 3ZSSA 3RCNA 2G4FA 4J3SA 5I0DA 2WAGA 4E8DA 3NJ3A 1HXJA 2WMHA 4GIAA 4WSJA 3AIUA 5AC4A 2GK1B 1BQCA 2OSXA 4PCTA 1UR0A 2DSWA 1TQVA 1MYRA 3IK2A 3EDDA 1E6PA 2VT0A 2BNJA 4CCDA 4PMNA 3AIWA 2VX6A 1H5VA 1C90A 3AMCA 4MAZA 2XVGA 2GVYA 1E4NA 2ALWA 3VGFA 1MW2A 1V6XA 3CBWA 3LRLA 3DHUA 2V3FA 6A3HA 4NXKA 1W3KA 3CHCA 4AZ6A 1PIGA 3IAPA 3OZPA 3BMWA 2X2IA 3MU7A 4KGJA 4QLLA 2YBTA 3L4ZA 4OUEA 4KMQA 3OG2A 3VIGA 3THCA 3UG5A 3VPLA 1ISXA 3WQWA 4IPNB 2EPOA 3QOMA 1NOFA 2FH6A 2PBOA 4JFTA 1J0ZA 1W3HA 2F7RA 3MV11 3ARTA 3MO4A 4W88A 1KQZA 3VIKA 1X6LA 3E1F1 1UD6A 3OIHA 3GTNA 4HPHA 4M24A 1HJWA 5CPQA 2WC3A 1EDQA 2W92A 4MTVA 3MKKA 4MB1A 3MMWA 3D4ZA 3AXIA 1EOMA 1O6IA 5IDIA 4JHOA 3BUBA 3BMVA 1JZ5A 4Z2KA 1HVXA 4PTXA 2GJXB 4RE3A 4YHEA 4Q7NA 4BA0A 4LYPA 3ARSA 3A22A 4AZ5A 3WQ5A 4AYGA 4N42A 4UQAA 4PMDA 3KZSA 2D22A 3LXBA 1GQLA 2OSWA 2Y4SA 4MNLA 3GH4A 1NARA 4IUGA 1JYWA 3DECA 2ZOXA 5A6KA 4AZCA 1YQ2A 1ZS2A 3WNNA 3CHFA 5DO8A 4NXSA 1TA3A 2XM2A 4ZXOA 1IZJA 2J4GA 4AD1A 4D72A 1ZB5A 4PMRA 2UY4A 2ZIDA 3F5JA 3LPOA 4H41A 3F4VA 1OSEA 1BYDA 1J0HA 2WHKA 2EACA 2WYSA 3VIMA 1JDAA 3AMKA 4EANA 2V3DA 2VVSA 1BYAA 1ZU8A 2CETA 2BHZA 4XUYA 2V3GA 1V3LA 3WD4A 4TX8A 3RMEA 5A3HA 1JGIA 4P7LA 4D6CA 3SUSA 2JF7A 3GNPA 2FDMA 4M8UA 2XWEA 5GNZA 3K8MA 1FH9A 4FMVA 3NSXA 2CBJA 5DF0A 3WH5A 5BRQA 4OJYA 1UYQA 3UEQA 1QPKA 3MUY1 3VKKA 4TOQA 1OGBA 4NRRA 3GBDA 3PHAA 1UZ4A 4U5IA 3EDJA 4ZE4A 1H4PA 2UY3A 4MNKA 4M29A 4W7VA 2XGIA 1AMYA 5FL1A 1V3JA 2E9LA 5CZKA 2W67A 3BAKA 2EBNA 2D3NA 3SUTA 2X2HA 5A8PA 4PTVA 3GH5A 1XRVA 2Z1KA 1OCQA 2CPUA 1JD7A 3DX3A 1QNPA 1AQHA 4OBRA 2TAAA 4J3UA 1BVZA 1WZLA 1MXGA 5A2BA 2W91A 3I3EA 1PZ2A 5IHRA 2ZE0A 1KQYA 2YOCA 1M04A 2XVKA 3EJPA 3N12A 1TVPA 4WLCA 2JEQA 4UOQA 1EA9C 4LXFA 1BAGA 1RD6A 4PCSA 2PB1A 2QMJA 2XTKA 1UASA 5I2UA 1CDGA 5CXPA 3VIIA 3VDCA 1C93A 1E6QM 3ALFA 4NRSA 1GUVA 1CEOA 1CXFA 1LG1A 2WPGA 2CBIA 4DWSD 2B31A 2WWDA 2O9PA 3WNKA 1IV8A 1F4AA 2RGLA 2XSAA 3I3DA 4UNIA 4V2XA 5AYBA 1R46A 2D23A 1ZJBA 2ZX8A 2XN0A 2CIPA 3ALGA 1FFRA 4ZENA 2J75A 2V3EA 1ISZA 1Q6FA 5FOOA 1VF8A 5A6AA 1HX0A 5I77A 1JNEA 3BUQA 3UR8A 2ZX6A 3ZJ6A 3EJUA 3EDKA 1OGGA 2Y5EA 1E56A 4HA4A 3MUIA 1US3A 3VM7A 4ML4A 9CGTA 1HKMA 1GZJA 1I75A 3UR7A 1UR9A 4WJXA 4UQDA 2GJXA 2A3BA 4BZYA 2QPUA 1B3WA 2XJ7A 3BCDA 3AOFA 4GZEA 2GDUA 3AROA 3LRKA 3WFZA 7A3HA 3VDBA 2XVLA 2DSUA 1FHLA 1Z32X 4PYSA 5BCAA 2VZVA 2AAAA 3WUBA 1V3KA 1XV8A 3W82A 4M82A 1PS3A 4BCEA 2VNCA 1WP6A 3N9KA 1JDDA 2EABA 2ZICA 2VRKA 1R33A 3DYOA 4HZ7A 4NF7A 2VOTA 1J0JA 2X0YA 4DWSB 3A47A 2EQDA 5FL0A 3PTKA 3TOPA 1TA3B 2VQTA 1MQPA 1E43A 1RPKA 1DEDA 1R47A 1HJQA 1G1YA 2CCRA 4PRWA 3U7BA 4V27A 3OLEA 3N11A 4A3YA 5E9AA 1HN1A 4MDOA 1EDTA 2W63A 3WDQA 3AXHA 3BCFA 3ZIZA 1V0MA 4CD5A 1GOKA 3NIYA 2UY5A 3D5HA 2OWCA 2JIEA 2D3LA 3KLLA 1R75A 4CN6A 3B9EA 3NCOA 3ARZA 1JIBA 4MNMA 1PPIA 1JL8A 2WCGA 1JZ3A 1G94A 3GXMA 4AZBA 3CZ8A 3ZM8A 1SFSA 4MB4A 2OYKA 5GQBA 3SCTA 1LQ0A 3WBEA 3AZRA 4JZ5A 1QOXA 1JI1A 4OGZA 1BTCA 2XFRA 3AIBA 1PIFA 5EB8A 2Z1SA 3WF3A 2E9BA 4CD7A 5JUVA 2VI0A 2WHMA 1V0KA 4K68A 4PMYA 3OBAA 2QPSA 1JZ4A 1BYCA 5D9OA 1LJYA 4U3CA 4PTMA 4JFSA 4CVUA 2ZX9A 2DT3A 4AW7A 1I1XA 4JFVA 4UQ9A 1G5AA 3CUGA 3HZ3A 3LXCA 1EQPA 3A3HA 3DDFA 3W38A 3OGVA 3NSMA 3VIJA 1NWRA 5GNXA 1HJVA 1XSKA 2WSPA 4GPNA 4H7VA 2ZWYA 3S5YA 1WAWA 1EO5A 3BVVA 3VGDA 2J79A 3CMGA 1ZBVA 1ODZA 1TQSA 4N0RA 1UD8A 2WCAA 4UOJA 3AIQA 4A4AA 1LL4A 1QNOA 3WL0A 1TR1A 3VMOA 1HT6A 3PZVA 1GCYA 3HN3A 5DMYA 1K9DA 1UD5A 1H0IA 2E0PA 5CG0A 3AHVA 3M07A 3EMZA 1KGWA 3L4VA 3CUJA 3OA5A 1W3LA 5DT5A 1BVNP 5JIWA 3D3AA 1R34A 7TAAA 4FLOA 1GONA 2D24A 4BQ2A 3IAQA 2WMJA 1C8XA 1VBRA 4UFHA 1EOKA 2YLLA 5E1QA 4P7NA 2YKKA 2G8ZA 3AYSA 3MUZ1 1AVAA 1CENA 1B3ZA 4C7DA 5FKYA 3HG5A 3EJTA 4CN1A 2CEQA 1VFMA 4Z2IA 5A69A 3BH4A 3ZJ7A 1X1NA 3O9NA 3K4DA 3HG2A 1XHGA 5D8WA 5IFTA 2OWXA 1LWJA 2FGZA 5I78A 2WB5A 1FHDA 2ZXAA 1Y7VA 3EJQA 1NH6A 1BLIA 3CZNA 2WBKA 1MW1A 3WQ6A 3VNYA 1ITXA 3WDIA 4TVUA 3FHAA 3O6AA 2ZUTA 3SCQA 1WE5A 1GVYA 3VIHA 3G6LA 4HA1A 2D1ZA 3IANA 3MI6A 1VENA 4B9YA 3KWXA 4FNQA 3DHPA 1OGSA 5JBFA 2WK2A 3I3BA 4P8WA 2UY2A 1GNXA 2NT1A 3ZJ8A 3H55A 2GJPA 2G3IA 3PZTA 3BVUA 1HTYA 1JDCA 3WD0A 1D3CA 4AEEA 1ECEA 3VX1A 2A3AA 5M17A 3THDA 2CERA 1XGZA 1CPUA 1CXIA 3CHDA 3ZT5A 1WZMA 4RE2A 1UA7A 3DYPA 1LWHA 1UUQA 1LF1A 1M7XA 3G6MA 4PMQA 2WMFA 1PX4A 2J7FA 1EHAA 4AZIA 1VAHA 4MJ4A 2Y8VA 5HXMA 4TX6A 1R86A 2UWFA 2DPEA 3W24A 1W9DM 4AD5A 1VBUA 1HL9A 3OLGA 1OBAA 1TZ7A 2D0HA 1G01A 1JXJA 3EDEA 1JF5A 3WEZA 2ZUMA 5A94A 4DWSC 3U5UA 2WC4A 1FA2A 2E3ZA 1UR2A 3U5YA 5LA0A 2OW6A 2WZHA 4AZHA 1MW0A 3GH7A 2G41A 4B9ZA 3AS2A 1W9VA 1HP4A 3F5KA 5D4YA 1ISWA 3BC9A 1QW8A 2X2JA 1QI0A 3FW6A 3W28A 1QW9A 1CGXA 4OOUA 3WDPP 1CGTA 5BXTA 1DWJM 4GI8A 1XC6A 3LMYA 1UKSA 1JAKA 1CYGA 2J77A 1NWUA 2X0HA 2CKRA 4ZXLA 3SCWA 2Y24A 4U3AA 3GYCA 2WANA 1FP8A 4E2OA 4PMXA 2BHYA 2FE0A 1HL8A 3WIJA 1OIMA 4DM1A 1K9FA 2JE8A 2WVVA 3RJYA 1J9YA 4ZEPA 1C8QA 4MNJA 5ECUA 1OD8A 4EE9A 1ZL1A 3ARRA 3WQVA 2VCBA 1Q6CA 1CZ1A 2CBUA 3AIRA 3AJ7A 1WO2A 1R8LA 1W1TA 4HU0A 4W87A 3TA9A 1BGAA 4DO6A 3AMGA 4DUWA 4LQ1A 3AMLA 4DWSA 2YL9A 4GZJA 3VD3A 1MFUA 2EXOA 3MS8A 2DIJA 1A47A 3VNZA 3OGRA 2WCSA 5FCZA 1BG9A 3DDGA 3L2LA 3WEMA 1E1FA 1K6AA 2O9OA 1CIUA 2ZUVA 3WY1A 2EPNA 3J7HA 2WVSA 1HWWA 4HZ6A 1E3ZA 1UWIA 2QF8A 4J3TA 4D6JA 1H2JA 3WUEA 4AMCA 1MVYA 4HMCA 3AHZA 1QVBA 2J7BA 4HMEA 3VX0A 2XFYA 5AYIA 2DT2A 1A3HA 2W4XA 3VUPA 1UQYA 3SCUA 2DH2A 5BYWA 1W9XA 4S3KA 1AQ0A 2XGBA 1W32A 4TTUA 3ZJKA 4WIWA 5HNNA 4WKAA 5A6BA 3CZEA 2JIWA 3W26A 2C0HA 5KEZA 3CGTA 1WDPA 4LYQA 3HU7A 2DQXA 3BLPX 1R7AA 3POCA 2AMGA 3SCNA 1GORA 1BF2A 3WDRA 2O92A 4PMOA 1KB3A 2GSJA 5A1AA 2JEPA 3T0BA 4PSPA 5A6JA 5I23A 1U2YA 4AXNA 3ZR5A 5A95A 5JBDA 1J10A 4LGXA 3NYDA 5JIPA 3WNMA 2DSVA 2DH3A 1CTNA 3BGAA 1H49A 2A3EA 1CGWA 4CVWA 5KZ6A 5A6MA 1GOWA 4W85A 1N82A 3VSVA 2CESA 2YL8A 4M81A 1NM9A 1UKTA 1E5JA 1QWUA 3QHOA 5FIPA 2W66A 3CIVA 5GNYA 4AZCB 3FN9A 4YPJA 5EFDA 1B3YA 1YHTA 1R87A 1JG9A 1O7AA 4D71A 4MADA 1PBGA 4QP0A 2CITA 3ZO9A 5EBAA 1AQMA 3N1AA 4D6GA 3A24A 3S2CA 3VGHA 1MXDA 2HVMA 2FH8A 1KXQA 2V5DA 3WSUA 4ACZA 1TUXA 2J8FA 1DHKA 3BLKA 4PTWA 4HOZA 2VX5A 3UCQA 1CNVA 1C7SA 2WKLA 2VL4A 2OSYA 2J7HA 3MUAA 2J74A 4AY1A 5CQ1A 2IXVA 3WUGA 4W93A 2VX4A 1J12A 1H11A 1BSIA 1JZ7A 4XZWA 1W1PA 1CXEA 1PEZA 4AYSA 1H3GA 2ESCA 3A5VA 3VD5A 3JUGA 1WDSA 2X05A 1V3MA 1KR1A 1UH2A 3ARPA 4HPGA 3CC1A 3BLBA 3TTQA 1B2YA 3GXPA 3WY3A 2E40A 4AD3A 3MSGA 4JKLA 4QDMA 4AIEA 2VRQA 2VC9A 3VDAA 2CYGA 3VINA 1C91A 1E5NA 5ABFA 3VM5A 3SUWA 2F61A 3VTRA 4W8LA 4FF5A 3AIEA 3MMDA 4B15A 3SCSA 1TFVA 3CTTA 4PUEA 1JYNA 3B9DA 5BROA 3K46A 2GJRA 3EDFA 3RPMA 2XN2A 1V3IA 4FNTA 4WK9A 4ATDA 4XX6A 1SYTA 2WHJA 3EMCA 4D1IA 2E8YA 1KFWA 3WY4A 4CD8A 2GDVA 3WF0A 2VX7A 4P7QA 2WSKA 1KCLA 4CCCA 3M7SA 3QHNA 3GXNA 8CGTA 3AQUA 3BXWA 5LA2A 3VVGA 2YA2A 3WMBA 3LXAA 1TE1A 5BWFA 2BVYA 1PX3A 2YDSA 2J7CA 2ZUUA 3SUUA 2X2YA 1CECA 4PN2A 3PTQA 4BQ5A 3KLKA 5EMYA 1TVNA 4IPLA 5I6SA 2J7EA 6TAAA 2VZOA 3NDYA 4DUXA 1FOBA 1FH8A 1HKJA 3OLIA 2PF0A 3AZSA 3L4UA 2YFNA 1CGUA 4FNRA 3UG3A 3WBAA 4QFUA 3VSUA 4DO4A 1W9BM 1E72M 5D9PA 3U7VA 1XYFA 2V5CA 2YDQA 3M6DA 1G9HA 3EMQA 4AZ7A 1ZJAA 4LX4A 2PWFA 1UWRA 1UG6A 2J8GA 2VCAA 1ZBKA 2OYMA 1QNQA 1CGYA 3ZQ9A
chains in the Genus database with same CATH superfamily
4KZEL 4JD4A 1XRTA 4NZCA 4IMAA 1CCZA 1CICD 2XINA 1QBLL 2WYHA 2ZUQB 3BD4A 3MLWL 3QQ4A 2WGNB 2BB0A 1QWNA 1UZHA 3X3FL 4OI7A 1WA1X 3WAKA 4G6KL 1A6ZB 4B5NA 4M7JL 1FL6B 2VLJE 3G5XB 4K7FB 3S7GA 4IGBD 1EC9A 1JNHB 3T0TA 3UJSA 2QV4A 2Z4QA 5AVNA 1BD2B 2AJYL 2W1NA 3O3AB 4BFEA 5C86A 4AEFA 2DQJL 3A5FA 3GUTB 4UIKH 5I1LA 3MLPA 4WEVX 1YC8A 2AJVH 4WI0B 3CUXA 4L0ZA 3PZIA 4EPEC 1BX2A 1T1ZB 4XNZC 3TWBA 2C3XA 1JGUH 1KGUA 4DEPB 1P43A 2Q71A 3PAOA 4GFIA 1IGYA 2MANA 3CM4A 3EB3A 1OZQA 2YLAA 5CCZA 1JTPA 5LXGH 3KOXA 4PBGA 4DKEL 3L3OA 4PRIE 3T0XA 5CN2A 5BXFB 3KPNA 1JVOA 3O41A 3UY7A 2P5PA 2JF6A 3MSDA 2GSEA 1GZQA 4KC3B 3D3VB 3SQMA 2NT0A 3R79A 4J6RH 3G24A 1F6LL 5HBBA 4PB0H 4TUKH 4WFFE 1MUMA 4CMMB 4XC1L 3MRLA 3NL5A 3N17A 2BSEA 3QXBA 4ILSA 4XE5B 5EIIG 3NQ8A 4I9AA 2I7OA 1LUCB 3QAZC 2MCMA 4X6EA 3IIZA 1UACH 4L48A 4IHBA 1U91B 1GQIA 2PCFA 3MBXH 5HYJB 5HVHB 4L29B 1OD0A 2BODX 2NXGA 2PC8A 3GIQA 4FX8A 3DMMC 3WN6A 2GY7B 4YLBA 5I15H 1Z69A 3SCVA 5F1NA 3PWPE 5CBEB 1WZAA 1XP3A 4YHLH 3IMSA 2WMKA 2CUMA 5FA5A 3WE6A 1C9DA 1GIGL 4NO5B 4PCPA 3T9WA 1LL7A 3MCLH 3CQFA 2V2TB 2JKPA 4EO5A 1FVCB 2A77L 4WGHA 2CSPA 4NZJA 4HIIB 3QJTB 4JDVA 4DKDC 4YHPB 2EDYA 2BMKB 2IAND 4WVRA 2V69A 3UBGA 1RUPL 4AYID 2OL3L 3BO9A 3W7JA 4C6MA 4C6OA 1TTAA 1Y5WA 3F58H 4G6FB 3T0ED 3WTSA 1LBMA 1I7RB 5D2LE 3SE8L 3W9EB 1AOHA 2DQ6A 2GWGA 4QG6A 1QFWH 1R5VA 3KJ4B 4TSBL 1XW8A 4AMWA 3TK7A 3FMGL 4Q2ZB 4A67A 4UT7L 5DU7A 2NXZB 1LG2A 1M71A 3RY4A 1Q1JH 2AQ2A 5JPNC 4MXQC 3HPAA 3OW1A 4ZO7A 2MHAA 4ONHA 4Y1AA 3N3EA 5CNHA 2ED8A 3H7BA 5J5EA 2BXZA 2G2NA 4HKZA 2ZADA 4L80A 1BZDA 2LAGB 3VH8A 3X14A 2ICCA 4JZNA 3C5XA 4ABQA 1Z9AA 1KO0A 5LLIC 2ZA3A 4FB7A 4MAUH 1YBQA 2E8ZA 3QZWG 1NOWA 3E2SA 2DQHL 1VJSA 4MJ2A 4PRHE 3VXUA 3N9SA 5DK2B 3VA8A 5IFHH 2DMGA 3EFOA 4K5PA 1KCRL 5F9OH 1D7FA 4LAKA 4GQRA 1VPXA 2ZCLL 1JWSA 3EYPA 1HE7A 3KUMA 1ZAGA 1L0PA 1XH1A 4IRSA 5F7BA 3CYJA 4GC4A 1FH7A 3SCRA 4KI5E 1TKWA 4YC2C 2R0ZL 2JKIS 1XGPA 2HUEA 4YEFA 3MKCA 1F86A 3D4GA 3QWNA 1EGMA 5IJDC 4DVBB 2WZ5A 1ID5I 3EGSB 5DXXA 4FXGB 1HILA 2BSRA 1LT7A 3WQCA 4DJEA 1XCXA 1YEGH 3TJXA 3TO2B 2L0DA 3WIIH 2FJGB 2VZ3A 4KCUA 4JPKH 3OTRA 4ODTH 1R30A 1EIBA 5D9NA 5KYUB 1FNEA 3C8DA 4MPKA 3WF0A 5C7VA 1H3WM 4OJCA 3X3FH 1KFEA 2VURA 4HPYH 4BJLA 4DRSA 1GOMA 3UJIH 4JDEB 4WZ9A 1B9KA 4OT7A 2D03H 3DJRA 3QMTA 2HISA 1E5CA 4H00A 2AAVA 1UUNA 3VRLE 4PUJA 4NZDA 2O5NA 1RL1A 3HE6B 2DORA 2IQ9H 4BFBD 2P76A 1T7ZA 2H0PA 4ZPVA 1AGFA 3GJFA 2DUZA 1HCYA 3BW3A 4K7FA 2AOSA 1W8GA 4K37A 1OIFA 4JX6A 1I45A 1CLOH 3L6FB 2HAZA 2O61A 1PDZA 3O07A 3P4LA 3QR3A 2ZRXA 3O3AA 4Q4OA 2O1AA 1AH1A 1I1RA 3W27A 4WY0B 5J3HC 3X1EA 3MY9A 2A77H 2HT3C 3FC8A 3HG4A 4QRTB 1ZANL 3B05A 3W23A 4JKPH 4A39A 1B54A 4DWDA 5I3JA 1F4WH 5HYSB 2WQVA 2R4RL 3DNKA 3M6YA 4F79A 2OGJA 1AS7A 3LCIA 1DTUA 1COBA 3LN5B 4QJ1A 2YMTA 1OCWH 4G9PA 3GNDA 4W8AA 4ERIA 5H35A 2GQHA 3DV4B 3FRPB 2A0LD 3IJYA 2HVBA 2NDFA 2Q10A 1OQFA 3TIEA 2OZTA 2VZTA 4POZD 4FQIH 3C56A 5CSRA 1HC1A 3BIBX 2XPKA 5FYLD 2J6EA 4KKLC 4OCSL 4HLJA 5GSRB 3ME0B 3SE3A 2JI3A 4YDIH 3EYFB 5TDOA 3VAEA 1TYGA 4KERA 2QAFA 5JQ6H 2J3SA 3BGFC 3UETA 3BZEA 3OGCB 5E2VL 4U4MA 4YVUA 4OBSA 1AFVL 1I3GL 3VWKB 3VXUD 3ZQXA 4BF7A 2X4UB 2WBJC 4CU7A 2E6FA 3G6AA 5HDBE 2GK1A 3P0VL 1UB6B 4D6HA 4PWGA 4AQ1B 3IKKA 1BOGA 1RURH 2ZOWA 3ZSTA 1SOQA 2DZTA 3AY4A 3GM8A 5FYKL 4GUPA 4F80A 2KYIA 5T1KD 2B15A 1DQIA 1W72H 4IK7A 5GRYA 3MRRA 2YBUA 4ZVJA 2XN1A 3D30A 2NX5A 1I82A 5D96C 5IVXF 1CG9B 1WH0A 3IS0X 2D20A 2VR5A 2GBUA 4C1LA 5E93A 2GI0A 1DVTA 4GXUM 4LCUA 4M7TA 3HR6A 5JH2A 2TSAA 2VDQL 3RILA 1IQDB 4J2QA 4LLUB 3WK2A 2A6IA 3QI9C 3C08L 3ENLA 3AU0A 3RO8A 4XGZA 1HCVA 4HKJA 4JYEA 2D0GA 1ZWIA 3H9SB 3TU9A 2HZGA 1EEZB 3U7WL 4G9FA 2Q7AA 3V52L 1SUJA 2UZPA 1IWAA 3W7KA 2V7HA 5AHNA 3RIFK 3LZOA 5A2AA 1SSDA 1Z48A 5REQB 1M1SA 1SSGA 3MRHB 4TX6A 2R0LH 3G1YA 4DKFL 4TNVK 3ZGHA 3OU8A 1C08A 3C5JA 5DEFB 2FHBA 1A4JB 4ZAKD 3LIZH 3UO1H 5DJAB 5MI0C 3A21A 5MENA 1FQ0A 1TNNA 1T03L 2XVNA 3QZAA 4AYFB 4JQ4A 4IQDA 3W7LA 3LKRB 3SJVD 1OSPL 4NX5A 5IBLD 1H5BA 1E3XA 2VLKB 3MHUA 4JREC 4RQQA 4MB3A 4H25A 3LV6A 1W72B 3MACH 4Q97A 1LMKA 2XUCA 3AHXA 1HJXA 3IVTA 1NJJA 4GH1A 2YD7A 1E9YB 3MGTA 2OMWA 3WNIA 4XP1L 1J0KA 3FSAA 4FRWA 3HF3A 5JXQA 1E0TA 3WY2A 2FVNA 5KYUA 3FUMA 4ZK8A 3WTUA 1AQ8A 1AANA 3NRQA 1FTXA 4JFWA 4YHYB 3CQQA 1S5HB 5LNVA 4WI4A 5HD8C 2C5DC 4FXJA 1WCQA 3O6CA 4EK7A 1X4XA 5K33A 1QRND 3AHYA 3MT1A 1ZLSL 3FSZA 4H1LG 4A2RA 5LN8A 2COVD 2YLKA 1GJPA 1OOAA 2O5XH 3WD3A 1MI5B 3L6FA 5GS2H 2O61B 2AK4A 2WNKA 3K6DA 3NQKA 1QUNB 4NSBA 3VIOA 4R5TA 3WG6A 4RH4A 5IVXE 5KSBF 4JRXA 2YR1A 4XD4A 4DO7A 1A6TA 3RJDA 4Z7NB 1K7EA 4E9SA 4UUIA 3MNWA 1MHEB 3QIBA 1F90H 2I85A 4L4VA 4JHZA 4OTXL 2QZQA 2W0PA 2PDBA 4YIQA 2IV9A 4ZXBB 1G0DA 3M16A 4FQCL 4FYTA 2OZ0A 1P4BH 3MNDA 4AIOA 3VI4E 1NFDE 4Z8FL 3ZLFA 1UXLA 2POTA 2CMRH 3VDHA 4YGVA 5TF1H 3KE0A 3IJEB 3ARBC 3NEOA 4N2BA 2VJ8A 4FQ2L 4B5VA 4LRIC 4ENLA 3STGA 5H8PA 3DX0A 3ZTJG 1FLRH 1SF5A 1ACXA 1A25A 2H45A 3PQYE 1DVQA 4LKCA 5L2JB 3GLAA 3CVHL 3JVGC 3EYFA 1XZWA 5FM8A 2P5NA 4TTDC 1J5HA 1NIBA 3D85B 2DYPB 3QUKA 4WUKL 2OMYB 3PGFH 3PBMA 4M43H 4WSKA 5AVRB 4YHNB 2H9AB 2OQJA 2V17H 1RUKH 4TVPH 5DX7A 4ERAA 2XWTB 1TMLA 3DUSA 4YHPA 3SDXF 2OPJA 5BZWA 5BOJA 1QR7A 3KCOA 3AHTA 2JIXB 2V5JA 4TUFA 2X1TA 2CZ5A 4LCCA 1B4RA 1ZHAA 4KTEL 2WW5A 3O2DH 4PUDA 2WTRB 2O5YL 3RU6A 4BCXA 3UXLA 4H8VA 4YZWA 3WH8A 5EC2B 4GQQA 4LQFH 2BS8A 4UDUB 2ID5A 1U33A 1YEWA 5KUKA 1H63A 2ABBA 2DMHA 2QNEA 4G6ML 3CWGA 3SPHA 3F05A 3RIAF 4B3KA 4O0ZA 3PFMA 1MCIA 5ABZA 1KRCC 3BESR 1WXJA 4KRTA 4BK5A 1GGTA 2CLOA 2QUNA 3ARXA 2OCZA 3IMBA 1CU4L 4TUJB 3H70A 1REQB 5C7XL 2F08A 4H9XA 1LEIB 1QO5A 1O5DT 4TOYL 3UBXA 1CBGA 3P74A 1Z5LA 3HN8A 1XQKA 3MV8D 3QO0B 5JXED 2GVEA 1FDLH 4EAYA 3PDGA 4KAQH 1KM3A 1RK1A 3LRMA 3TEUA 3EYUH 3IJ8A 4S2SA 2NY1B 4BK5C 4ERSL 2IANE 2IANA 3TO2A 4E2VA 2YFOA 3DO4A 4Q0XH 4AD0A 4PLNC 4EI6B 1E6OL 5ID1A 4XO3A 4O0QA 5DVNA 4JRXD 1SDYA 5IVZA 3ZZSA 2YB4A 5CPTA 3GSNH 1Q4NX 3WD1A 1KLZA 3Q1EA 4L4VD 3GBNL 5I1AA 2X3BA 3SGZA 1J79A 2PXYA 3DBSA 4FZ8L 4JG0L 3C2AL 1HQ4A 4KKQA 2CNCA 4HIXL 1C5CL 4TS6A 3AY2A 3VD7A 4CSSA 2X09A 3VGAC 4DPBX 2HMCA 4ENEC 3ASOB 3ZUNC 2Y70A 2EE3A 1WTGT 3VFSA 3QUXC 3PJXA 3MUHL 4YHZH 4D9LH 3SDAD 4I7VA 4W89A 5LXVA 6TIMA 5I1LB 1LD9B 2DQEH 4RESB 3TA4D 5HHQB 1F6PA 3ZVHB 1RZFL 4PVLA 1B31A 4NYYA 2DQWA 2AK1H 1C9SA 4G7EB 2WQXA 4XB8A 5IW1A 3C0LA 3ITXA 1CDIA 4MS8C 1IJNA 4TVPL 3GC2A 4RZBA 5HBFA 3SDCC 3N73A 3BEWA 3LNHA 3FIGA 1MCOL 4B3ZA 3BVTA 1MFEH 2I60L 2ZWZA 3LHAA 4X6CE 5BZDA 4Y4KD 3A4JA 2A4EA 4JS3A 2ZYHA 2VAAA 3WQ8A 1N8FA 4GFSA 1V8HA 4DP2X 1AQKH 1PCSA 2JELL 1JUEA 2CHOA 3MYJB 5CP7A 4HPNA 2FQGA 4HSNA 3T65A 1RQBA 4MA8H 3WIIL 3V55A 1GW9A 3GXTA 3HB3B 3TIEB 5HGAA 5JUEH 5IDZA 4NAFA 2EYSB 3LKOB 1AMXA 3Q2VA 1KT2A 3NSYA 3RKPA 4S3DA 5HGHB 1L6YA 4P8XA 3HMXL 1JPTL 3FQXA 3ELAT 5C07D 1BYBA 3LRSA 4YBLC 3MDJA 4BFRA 4PA8A 3CL6A 2XWBB 4J2MA 1I1AA 5JHDD 1NKRA 4L1BA 5F1NB 4O19A 2J7DA 1XLLA 4AGOA 2N7SA 2O6DA 5EC1A 4YBQC 3VI4A 4I87A 5KVGL 1XYZA 2CO3A 3ZQWA 3L1OH 2GVLA 4Y9CA 4TOYH 3PZQA 5C9XA 4QRUB 1BOGB 3O9WC 4O2CB 4A2EA 2O56A 3FBKA 1CDJA 1F02I 4HETA 3BKJH 3FQUA 3CUHA 4NHUB 2X12A 2BLEA 2IPGA 1BVWA 3B43A 4LOEA 2IAMD 3M88A 1QI5A 2IOMA 1D9EA 3P61A 1SEBA 3BEVB 3AQXA 4J5VA 4H6EA 2JXMB 4WJ8A 5BMXA 1X4ZA 4TLUA 1XL9A 3C0JA 2AK4E 4OKVB 3VGEA 2GJ6E 4Y7MA 3HVDA 3L3JA 1H7PA 2E9MA 2W5FA 5E09A 2FHFA 3LERA 4GXMA 3QUXD 2SEBA 1S3HA 4HXAL 5FYKE 1T7LA 1B5TA 2R8SH 4P7RA 3RWGA 1U6AL 4JZNB 2YGOA 3D0VB 5HHPA 4KRPB 5E6IA 1S2TA 2X1RA 3MB9A 2YL5A 1M6UA 2EUZA 2ZUSA 1MCRA 1E5YA 4HUWA 4QNPF 2E7LC 4AT6A 5J11C 1I0BA 3MRHA 5C8BB 3V6FA 2YXFA 1SOKA 3NFSH 4XZ4A 4PTTB 2O5ZL 1GOFA 3V7AE 4PMZA 1YADA 3GJFK 4LEBA 3IWUA 3NDZA 1JYXA 5EEXA 1XDLA 1JPGB 1IFHH 5DGQA 3TTSA 1M6OB 1CFMA 2YD2A 4I4WA 3LKQA 5I71B 1UYWL 6FABL 1DUYA 2MTPA 5E2TL 3RFZB 1TETH 1FZMA 3NQCA 4D8OA 1ZD6A 4D6IA 3D4YA 4IS6A 3WL9B 4CVXA 3TF4A 1JGLH 4GT0A 3SGJA 3DHDA 3KDMB 4HJEA 4UIOA 3U0TB 3PB0A 2ROYA 3GQFA 4GQ9H 1OK8A 4JDZB 1Q6GA 2J62A 1AZNA 2JELH 3L5JA 4QHNB 1ROWA 3TNNA 3NAAL 5EU6B 3LYEA 3U2ZA 4EXAA 3I6KB 4HWNA 4Q6KA 3RPBA 2OI9C 3GFUA 2A4ZA 2X3CA 3LKNB 2CKBL 4ADIA 3RUGE 1YPFA 3P14A 2WW8A 4JRFA 3BI9X 3GG0A 5DRIA 4X6CB 4FFVC 1A53A 2DLFH 1L7IL 2X7WA 4HWZB 5I75C 1V02A 2V2DA 2A6KA 4F8QA 3BSHA 4HUXA 4L8BB 1CI5A 4AMXA 2A4AA 1WISA 2QADD 1P4LA 4NJAL 3SDXB 1E4LA 5C55A 2BS9A 2J73A 3FF7A 1XIBA 2QR6A 3VNLA 3GMPA 4MNQB 3TBYB 1UP2A 4C6NA 5EMMA 4PW9A 4BFGA 3HG1E 5B1KA 5A6LA 4KV5E 1MCOH 5IFAH 2RAGA 1MRDL 1T5AA 2Z00A 4P5KA 4XHQA 4IKKA 4NHCH 5AAMC 3VCLA 2F38A 3ZHNA 1KM2A 3NZHH 3QUML 5JW5B 1IEVA 1E0UA 1E8WA 4XOEA 1I1WA 4UNUA 2AQOA 4JIHA 4WO0A 1BA9A 3C52A 5DQDL 3T0VA 1JRHL 4X7TB 1KIPB 1UG9A 3E7JA 1V02E 1UEMA 3QJUB 4JZJC 3LBMA 3OYZA 1NFKA 1QYGH 2Z8WC 1EZ2A 1X9RA 3FRPA 4L05A 5CLYA 1XIWB 2VDMB 2XN9A 5EO9A 3MODH 1M3UA 5EHFA 4JGUA 2F6AA 3UADA 1WAAF 4Q9QH 5DJZB 4F58L 4HD5A 1B4JL 3U6RA 5T91A 4NUQA 3OVUB 5B39A 3BSGA 3BIKB 3BQUA 5SV4A 4AIUA 5AYUL 1BQKA 2WKGA 2DDXA 2W65A 1Z3RA 4WTZA 5ERWB 3GR8A 1YNKL 1HO1A 3CN3A 3OZMA 4G8GD 4PL2A 1QBML 1Q94A 4R7WA 2VDPL 3UBFA 2C91A 3O2LA 4UXDA 4RNFA 4X98B 5HDWA 3F83A 1CFVH 5DR5L 4RDQG 5C09D 4F8LA 4O1FA 5C0JB 4AMKL 3KMDA 4ZQNA 3IJ9A 3P02A 3MDUA 1K8DB 2ZD0A 4O54A 3CSBA 5F93C 3MHZA 4BCYA 4J2XA 2B4CL 3TWAA 4ACYA 1S7RB 5HR7A 2VQ1B 2EJ1A 1TPH1 2G3JA 3MUCA 1WLHA 4LGPB 4A1RA 4M19A 1H6EA 1YRKA 5CGQA 1E73M 5I6XB 3W29A 3UX9B 1S2UA 4N5EC 4XPFH 1U9KA 2AKZA 1BQ5A 5EPDA 3HI5H 3UAJD 1KV3A 1NGXA 1U30A 4QYOA 2KQMA 5CN1A 2IQ0A 2H3NA 4DVOA 2ITDA 4DUVA 1W1YA 1CO1A 3O11B 3LVTA 3RWIA 1IF2A 3H21A 4MJZA 4YZFE 4RCXA 1L9MA 3BHBB 3K8LA 4GP4B 3QHMA 1TTQA 4OV9A 4DJEC 4HHHA 5TH2B 3EO0B 1SYVB 4KVNH 1G6CA 4WTQA 5IKCA 5SWUA 1P0DA 4S23A 2WLZA 2YAQA 1FKXA 4M3JA 2ZRWA 2NTFA 1RVFL 3EYSH 4MA7H 5K4XA 1H1YA 5DVOA 3M41A 5GS1B 4MJIE 3EJSA 4K7YA 1JCNA 5DCDA 1LRTA 2G75B 1RUML 1QPXA 4OUUB 4GQ9L 4FA6A 5FJRA 3F6IA 3S4SA 1E71M 4QE4A 5E5CA 2HFGL 3CSGA 4ES9A 1M5WA 1FWCC 3WHE1 3THML 4XX1E 2FZ3B 3QJFA 3DI1A 3BP4B 4Z2JA 1XGUA 5IROD 2KPNA 3B8YA 1SZNA 5EN3A 3QULA 1OWRM 1VFFA 5K4ZA 5KBLA 1ZMYA 3C0QA 5LNRA 2ZTJA 1BREA 1NWPA 3LB6C 1IC7L 1TR9A 3LPFA 4P8UA 1FX6A 4K0OA 3TURA 2XTJC 2BFGA 4PP2A 5JDSA 3Q05A 4JFFE 4X6CA 2YD4A 1QUPA 1ZPLA 4HJIA 4PLOB 2HEJA 1TEYA 1ET5A 4GI9A 1AGCB 1SMDA 2WUBL 1WB0A 5B39G 4AE0A 3TBSA 5E2UH 3TDFA 2ATKA 3HHSB 5H91A 1SBBA 4Q8NA 2EADA 2Z24A 3N18A 3TUUA 1HHHA 4OBTA 4XWGH 1I1YB 4JEQA 3G5WA 3BW9B 4LYRA 4HFUH 2W62A 1KCSH 4PIBA 4IBVA 3HC3L 4YDZA 5EA0H 4IRJA 3T08A 3SZ8A 4S3JA 5C0NC 1OB1A 3E1ZA 3R7RA 1KIQA 1YDNA 3V4PA 3X1NA 2EVJA 5TDPA 2QQQA 1VIZA 2TYSA 3GYRA 4LGSB 5DMGD 4Z7AA 1TTPA 2V0TA 2QUTA 4PFMA 3HQNA 2DL9A 1U8MA 3ZRFC 4RZ6A 3VI3A 4J4KA 5AW2B 4L1SA 3KW7A 3V0AC 2PI6A 1TLMA 3SDDC 3PULA 2IPUG 2OT1A 3N1MC 2FT6A 2Y7NA 1VFTA 4RK8A 3TFCA 1SLWA 1XIWA 1BD2E 2XU9A 2AJUH 4YHIA 3NIFB 1A1OA 3CC5A 4Y19E 1WEJL 4MJIB 5F3BB 5EO1A 2HPIA 3QPEA 2HLAB 2HJFA 2R0LL 2YBRA 3HRZA 4LW7A 4GRSA 4AC1X 1X7QB 1KBPA 3CUFA 4YHZL 4P57B 4YQXH 1SEQH 4ICCX 1WAEA 4PV1C 3SURA 2W65B 5ERWA 5FA4A 3EZ8A 3ZN6A 3RTQC 2H9AA 2B39A 3CEPA 2DJ4A 1OF6A 2FT7A 4ZAKC 4IQLA 3QIWD 4NLHA 4UQ2A 5C71A 4IISA 1Q9KB 3FN0H 4TXEA 3RPDA 3BUPA 4L4TE 2VOMA 2J5LC 2EDDA 1M65A 1T1YB 3ITYA 5F9JB 4JTRA 2E75C 1M6JA 1I8AA 2H90A 3GKFA 5ETUB 3N4AA 3PZUA 1OQOA 3GRBA 1DFXA 5EN2A 1E4MM 3F7RA 3IXAB 4JE4B 2AQ3A 2LU7A 4JFEE 1P5BA 4OE7A 8A3HA 3WJWA 1DVYA 1WFUA 5ESQB 4JFXB 4UDUA 3OXSA 5K7JA 5ABHA 1IBZA 5DRNB 5E6IB 2A6JB 2KQNA 1ND0B 1OCCB 1AD9B 1Q8MA 3P2DA 2R2BB 5AZ2H 1PDKB 3HS8A 1GKPA 1H0DA 2BIHA 1HVQA 2VGGA 2H3NB 2WC7A 4JQAA 1A1NA 1NQBA 3VOGA 2DQGH 2A74C 1LEGA 3PNWA 4NO3A 4H8HA 4XCCH 4TUJA 2C9QA 3HZVB 2CHXA 3BHBA 1H1NA 1REQA 2B81A 3TTEA 2L04A 1B9BA 2O5XL 4U1GC 5LJYH 5LHDA 1GOXA 1QRNB 5I6XC 3RTQB 4XVEA 3VE9A 1Y1UA 2HTKC 4TQIA 4RDZA 5AHLA 1DUYB 5BU6A 1LL1A 3E2HC 3SSGA 2FYMA 5E8DH 3NCBB 4YS4A 3K4AA 4Y19D 5ICXA 5I73C 4PV9A 2WBJD 3GHRA 1NPJA 4RLIA 1Z9OA 1KIRA 4OI9A 3OIXA 2CA3A 4U31A 1EQCA 1E4HA 3FCSA 3QRBA 1M9WA 3BDYL 3MACL 3RURA 1MIMH 1CXLA 1PD1A 2EDNA 1P48A 3FKKA 5B7FA 4K8HA 3QPZA 1MWOA 2H1XA 5KZEA 3I6LE 1KJ2L 1NWTA 1TQWA 4Y6GA 2FBJH 3C8NA 3KVPA 3NQDA 3FQNA 4JDBA 3RWDB 2OMZA 5FFGA 1GGBH 2NNXA 3TEXA 2NV9A 5I71C 2L5HA 5IVXA 2JKJA 4NZFA 2JGQA 3BWUF 1S7QA 2OMBA 1HINL 2NY4B 2BIIA 3GSWA 5DJCB 1P1ZB 1J01A 4FQ2H 3BVWA 3WBYA 3S3SA 4R2GC 1WUFA 4KEMA 4Z0SA 1MUCA 2CHNA 4FXRA 4FFYL 2VMEA 5E9DD 3AU6A 5CSSA 3T09A 5DZOA 4XPTH 3EOUA 3PGCB 4EIGB 4DZ8A 3SKMA 4J3WA 1J8RA 3ZYOA 3ES7A 1W1IE 4R97C 1D9KC 1IGYB 4QR6A 3CFJB 5CGBA 5T1LA 1BEUA 2WLIA 4GFTB 1ONXA 1T1XB 2DP3A 4HBKA 4RFEB 2V30A 4OECA 2B0MA 1DE5A 1QTPA 4L4TB 4UOW0 3RL1B 2DIKA 4PTNA 4PJXA 2KERA 2FAUA 3C09C 2MCAA 5LWYL 1OK6A 1SO5A 1M7DA 5E6SB 2Z8RA 1AH0A 4UZUA 3L12A 4G7FA 4B5UA 5F7YC 4GO6B 4OCWH 1A7RH 1H8LA 2YBVA 3NRFA 1PKYA 1NEYA 2OQYA 4Z1YA 2A3HA 1NP2A 1MVUA 5E8NA 4E41E 3EXLA 1M1XB 3CFBB 4HYWA 3LX9A 5JHDE 2J4WL 1O7DC 1IMHC 2WWMD 3OODA 2F0CA 2A3CA 2X4RA 4ZZFA 2BIQA 5MEPB 3I9GH 4DP6X 4N0CD 3WIFA 5F44A 2QJDA 3S0CA 4K7PY 1WBZA 3VXRA 1A5SA 4Z7VF 4N8VA 3I10A 3MUUA 3W1TA 4MCZA 2V38A 4HWEL 3PHQA 2Q8AH 3TE9A 1INQA 3LH2L 1LJMA 2EP6A 5KSVB 4M6NL 1I53A 3MRMB 4AKPA 4YSEA 2NW0A 3U2CA 3MV9E 2RALA 2OZ4L 2J20A 3I9IA 1F3XA 2IDFA 2Z2UA 1H0GA 3BPCA 1WCGA 4OKVA 1JGVL 5C0AB 4D6DA 2WJ5A 3TN3A 1PZDA 2ZX7A 2YC1A 4FFVD 3EWYA 3ANVA 4I0PD 4IP4A 4W86A 4DJED 1LVEA 4JFQA 1A9BA 4K5NA 3GU2A 2J25A 2OMXB 1TJGL 5C9JB 1AD1A 3SCMC 2VE6A 4FFZH 4MXQD 4ZFOB 5ILTH 4PJCF 4N86A 3SIZA 5K39A 4S2CA 2FX7H 4MMXC 4AB4A 3W85A 4JUTA 1TPUA 4CU8A 1GEHA 5EBWA 3AG4B 3WTWA 4UQBA 2VSKB 1ZY9A 4P4RA 1V4YA 2A9NH 3ITVA 4UB0H 3CHRA 4XPBH 4W5ZA 3V0GA 1W5QA 3MRGA 2OYLA 1A22B 2NXHA 1RFDH 5CKAA 2NY5H 4NPKA 5LSMA 3DTXB 4F3HA 5BOEA 1JGUL 2NUTA 3KPSD 2BSTB 3GZPA 5A6SA 1JFQL 4TL5A 2G3FA 4ZX4A 2V2XB 2ENSA 3TPKA 1AQKL 2IPJA 2V5LA 4AITA 3KBWA 3L5WB 1SJEA 3HJZA 4JQIH 2J8UA 4O1EA 2OK0H 5HYSG 3NQ6A 4H7CA 3JV4B 4XMKH 5AZEH 1JI2A 3ABXA 2BY1A 1L9PA 2HG0A 4FR6A 4GBDA 4YNGA 2VKXA 3FU7B 4GW5B 1WWCA 2JALA 4XZBA 3SKJH 1B3XA 1K03A 3CSFA 1Q8AA 2FMOA 3WJLC 3LTVA 1MWAB 4IEFB 2PCEA 5DEZA 4XAKD 1A3RL 3T6QC 4J4PC 1IX2A 4N2LA 1G9ML 5T1JA 4A66A 2I9TB 5C07A 2ESVD 2IQAB 1DWHM 1KM1A 2V8ZA 3CV1A 3DU0A 4C6IA 4XV0A 5BWAA 4MXVE 3D06A 4BELD 3O9WD 1IR2A 4QS6A 2XIIA 2CQVA 4DPAX 2QHLA 2P1FA 3I75A 4LLMA 1AACA 1BBDL 2GUYA 3IF1B 3KR3H 4IIQB 4IRJB 4TUOB 3LEVH 3GBEA 4XOCA 5XIMA 4WJG3 2DVXA 3TOYA 1B4TA 3QZBA 5E23A 4XOAA 4XBGA 2BFVH 2DY3A 1Q0XH 3WDQA 4WO4D 5B1BB 4BQ4A 4GYKA 1HJUA 4HPXA 5FHBL 3KYOA 2ZDRA 4URIA 3VKCA 3JWDC 4C91A 2Z7KA 2IQTA 2IXUA 4BA8A 4XN2A 3HAEH 4QRRE 4BWUA 2X7LA 1G7PA 1IC0A 5C1MB 3DERA 5BMFH 4PG9B 3RZCD 1EJXC 3ZSSA 2G4FA 4FG0A 5I0DA 1Q3NA 2J4WH 1G7JA 4E8DA 1WYJA 2DD8H 5CZVH 5EZIL 4FX7A 1FWJC 3KOFA 1PHWA 3HHRB 3IRZA 3H8NA 1DDHA 2WMHA 3LBOA 1K1DA 4RDYA 4DI9A 5D5MA 1U3NA 2AABH 4KMLB 1TV7A 3EGJA 1A7NH 3HFFA 3PWUA 4WNQA 3S36L 3EDDA 4F2EA 2JCCF 4ZYKA 4J3OF 1E6PA 2GJ6B 1GYCA 3KLSA 4LPXA 1A5NC 4ZQMA 3W2KA 1NMCC 1BAWA 1WIOA 4XVOA 5D6CA 3T7VA 3APCA 4LLDA 4GYJA 5H8UA 3D39E 1WKDA 5CPLA 3BAEL 2HZHA 4U1JB 1GVSA 3FQ4A 1I8KB 1KNOB 5D7JA 3UT0A 3STZB 2G30A 3C87A 4NYLA 2XVGA 2F1EA 4UTIA 4Z23A 1A5BA 4L9XA 4A2HA 1FDZA 4MJJA 2ZKYA 1C8PA 4OLYL 5GGQL 3VD2A 1NU5A 3TEVA 3VGFA 1U8NB 2DS4A 5CS7A 3VQ1C 4QRPD 5I6NA 1RHFA 2DQUH 4LEEA 5FYLH 1E9OA 2GSIB 3CPLA 5SWSD 1XX1A 4YHML 3HZVA 1OO2A 1SXZA 4YFDB 2BMBA 5AVZB 3LS9A 6A3HA 4M1DH 1MKFA 4J8RA 4DF2A 4MJID 4EDXA 4LHUB 5IFAL 3JUZA 1I8JA 1FGNL 1S5MA 5I74B 3PIQA 5B7MA 2FFCA 3QDAA 3R19A 2ACQA 3MU7A 4KJPD 3QWRD 2EUVA 2HX9A 4Y9BA 2WB7A 4QLLA 1Q38A 2WLKA 3Q6FA 1F4WL 3FSVA 4FFTA 4GBXD 1A4MA 4AYFA 4UNKA 2ZRZA 3QLDA 5DJXA 1P6BA 3MJ9H 4NQDE 1YN7A 3DBXA 4I3SL 4U1LB 2EDRA 2XPGA 3HNSH 4PYHA 2UZ9A 1ADQL 1I85A 3L9BA 5FK9A 4EI5B 2HFEB 3MV7D 1S5NA 3MOAL 2EPOA 4H25B 3IJQA 4PJAE 4IPNB 2FH6A 1ZA3A 3P40A 4NZUH 5D7SH 1ELSA 1SGJA 1ICSA 5LBSA 3C12A 3WQFA 3PAJA 3MGTB 2ODHA 3IN2A 1JWMB 3ARTA 2EDMA 1XIJA 2A7NA 2K70A 2APFA 4XI5D 3LTYA 4PRTA 4PJEA 4PRIA 4V2BA 4Z7VB 5DHVA 1X6LA 2XN9D 3E1F1 5LXXA 3BQ6A 4L37A 3UP1A 1PSKH 2XA8H 1PUDA 3OIHA 4UTJA 4Z7VE 4C56D 2YXVA 4ICWA 4BFFA 1JPSH 2ATKB 4QPEA 4UT9A 4LDOB 2YZ1A 2QEZA 5FW6A 1F2JA 3N40F 4G8GB 1TO4A 1JUFA 4YHOL 1TE6A 5G1MA 4PB3A 4DB7A 4MTVA 2YQBA 3KR3L 3MKKA 3CQIA 2G60L 3CMOH 4MB1A 5HUOA 3D4ZA 2IPFA 3HI1B 1FWDC 2YQGA 5HVGB 5I8EB 2C1PB 4KXBA 4MX7A 1A8ZA 4XCFH 3VXMB 3VXTA 1V79A 3QI9B 2AGKA 3WCZA 3ZE1B 4OLUH 1RK5A 4JRXB 5FGRA 3BMVA 1JZ5A 3CLFL 3CAFA 3PREA 1DVXA 4Y5VC 5C2GA 4L4VB 3R4RA 4RE3A 4X4YB 3I6LD 5KVDL 5CBIA 1K4CB 2FL5B 4X7SH 3G1VA 1N8OE 3BN9D 4UTWC 4HUMB 3MBWA 3T1FB 2DBLL 4JJ5A 4BA0A 2E7HA 3ARSA 4LYPA 3RYSA 3UOAB 5JORB 4C6QA 4NQDD 4ECLA 4OFYD 4LNRA 4R83A 4TPRL 1BZ7A 3BFWA 1Q85A 1SN5A 1THAA 5MEPA 1QVOA 3NP4A 5J1AB 5SWZA 5D05A 1RU9H 3KZSA 1RZ7L 4N9OB 1A6PA 5TPWL 4K9JA 1IQWL 4G42B 2ATPB 2LQRA 2Y4SA 5FV2A 1KRMA 8PAZA 3GMLA 5EPMA 1JULA 4KQ0A 4XN9A 1E9PB 3P0VH 4ODWA 2JJTA 2FATL 3O4OC 4ZW5A 1JYWA 5F9JA 4QSHA 4DZBB 3KCPB 1ETA1 2ADAA 4IF2A 2QQNL 4OU1A 3ABSA 4K8GA 2RDWA 4PCFA 1IL1A 4N1EA 4E8CA 4DP1X 4C6DA 2SFPA 1DQMH 1OANA 2ADFL 4BWLA 4PJDE 5EU7E 3WAJA 5ESQA 4N24A 3U4EA 4N2EA 2QIWA 1P53A 1KJVB 3N29A 2A6JA 4L9LB 1FRGH 3PG9A 3QVQA 1WHPA 2X4TB 4LLQA 1UACL 3X1BA 3KDNA 3STZA 5GGRB 4QQUA 1O0VA 2CIKB 2X1XR 4B9KC 1FY6A 1TO3A 2HXUA 1GZPA 4B3EA 4ZXOA 4K36A 3NSJA 2Y2YA 1R3JB 4BFIA 3N6JA 4IOTA 3UXAA 1Q90A 1HHJA 4Z3TA 4PRPE 1CICA 4V1DE 5I75B 4GOAA 1AQFA 3DOSA 2EHHA 3LPOA 1I8UA 2PDKA 4F9LC 4WNSA 3F4VA 1QCWA 1OSEA 2ZSVA 1WT5A 3HE6C 3HMXA 1DVFD 1KGYE 2O6FA 3QG7L 1N59B 4HK3J 5FKPA 2PTXA 2X1WL 3BW4A 2WHKA 2X1PA 5AVVB 2V9DA 1NSNH 3V0EA 3OAZH 5IHUH 1U8PA 3R0MA 3LXUX 3BP5B 1KZYA 4A6YL 3LDVA 4C5ZA 2QVFB 5CIPB 3AMKA 3OF6D 1IGTB 1JNLH 4UM9A 2W38A 5DA4A 4BSJA 2V3DA 1V7NH 3NA9H 2CO6A 2VVSA 4MNHB 3IDUA 4Z42C 5IF0B 3A4DA 2AP2A 5EEVA 2CETA 3HRPA 4Y4KA 2IDCA 4LAZA 1P4BL 1QSZA 4NZ5A 3CSYB 2DAVA 2NY2B 4ADUA 5AYQA 1WEJH 3DZ1A 5DUMH 2BXVA 2A6NA 4P7LA 3OKMB 4LL9A 4KT2A 4G59C 1GPOH 4YTRA 2XDFA 1I8IA 2ITCA 2P7TA 2XWCA 3DA0A 1IAIH 3INUH 1BZ9A 1NJ9B 5TFSH 4Z77A 4QXUH 3NPSB 3ULUE 3G5ZA 3GNPA 4ZI8A 1J9RA 3GS0A 1FAIH 5AW7B 2AQPA 1HIML 2O72A 3OL2A 3B0VC 5FO9A 3PGFL 1KBGH 2DM7A 2I69A 1RZ8B 4G7YH 4IIQA 2CBJA 2J8TA 4C8XA 3VQ2C 4DP4X 4OJYA 4HT3A 2GGJA 1S5WA 3UEQA 4HC1A 4TOQA 1HHIB 3H4HA 1OGBA 1FVPA 3OQ3B 1XGDA 4UM8A 4X0KB 4DFIA 1RALA 5T1LB 3FN0L 1AKPA 1AG0A 3PHAA 1QTSA 4DK3A 4MNKA 1H3VA 4M29A 4G6JL 2R94A 2E67A 1U5VA 2YSTA 3VTTA 5T1KB 3K3QA 5IB2A 3TT1H 4FO4A 1AMYA 3D0LA 2FEEL 1FPTL 2Z6IA 1N64L 4POZC 1AS6A 2DW7A 5HD8D 2NXYC 5FL1A 1V3JA 2Q01A 5D1QE 5CZKA 2X6CA 3WEBA 2PDGA 3R4IA 3IDIA 3SQBA 2W67A 4YXGA 1MCPL 5FWQA 2F68X 3K72B 2ZJSL 4WI8A 2EBNA 2VGBA 2D3NA 3AQDA 3GH5A 3KTXA 3TJHD 1XRVA 3TYFA 3W0WB 1OCQA 1IILE 2UY7A 1U8IB 1MG2C 1UT2A 4JFDD 2CPUA 2CKBA 4N0UA 5IK3A 1QNPA 2HV5A 3L08A 1EEQA 5IMMA 2CZDA 1JHTA 1EEUA 2CK0L 3HS9A 3KM2A 3O4LE 3P30H 4DIXA 3NCJH 2AMUA 3I3EA 5AW3B 1F73A 1PZ2A 4QX4A 1FHGA 2ZE0A 3HG0A 4Z0BL 4C4KT 3M44A 3I74A 5DMKA 2SODB 2YOCA 3KLHC 1ZHLB 3L5MA 2X2GA 1QNVA 2XVKA 4RFOH 4U1KA 3VIPA 2AJ3B 3BZ5A 1TJPA 1D5IL 4WEBH 3N12A 4D94A 3BEVA 2IEPA 5FHAL 4GJJA 2H47C 3VFPB 1TVLA 3IFNL 3ILQC 4U6VH 5F9DC 3T8VA 3AXLA 3A4EA 3O2DL 4UMSA 2EO1A 4WO4B 3UZJA 1D6EB 2VEMA 5DRCA 3C09B 2OMXA 5C9JA 3CVBA 1DUZA 2HFFB 5MEQA 2FO8A 3TM6A 2RJGA 3O0KA 3NVDA 2NY1D 3IBEA 4GAGH 1M7OA 5HK4A 2Y1ZA 2CCLA 3K0WA 3F00A 4HK6A 2OFQA 5CD5C 5LG1A 4D3CH 1M9HA 5I2UA 5GJPA 1S7WB 2QBWA 1IIGA 5J5RA 3W9DB 1VD6A 2M83A 3NQVA 3R94A 1ZV9A 5F2MA 1MCQA 2CJSA 2UWEF 4TLTA 4AC4A 5AVUB 5IB4B 1FV1B 1C93A 1EKOA 1MHPH 1E6QM 2F8OA 1VFAA 4ONGL 2X4SA 2GKIA 4R2GB 1B6DA 5BUPA 5IT2L 1PV8A 3I6TA 4NRSA 3UZVA 5HDOA 1CXFA 2RJMA 4NQSA 5GJSL 4BE5A 1FZMB 3BKYH 3KWVA 2B31A 2QTEA 4DWSD 2WWDA 4QOKB 2WTOA 1GS7A 4L1GA 3LQLA 2NVAA 4PH8A 1TKKA 3KDMA 2IG2H 5LXGL 2KC0A 4L3EB 5HI3C 2RA1A 3KLHD 3MP3A 2DWTA 3CV2A 3QDJD 5DS8A 5T1LD 3SRFA 3LNIA 4XVSL 1OGAD 2XETA 3MLUL 1MHHA 3QQWA 1LO4H 4UV7L 2W60A 1R46A 1GGCH 4KKAC 4NQVA 3J8F7 1MFCH 4FQQB 3ALGA 3WFDH 2YPLE 1NLDH 2WXIA 4Y4KB 4ZENA 4ZS7L 4R8WL 1WFIA 3P6LA 5F7DB 1EZSA 3WK1A 1OTTD 1VP5A 4YPGB 1AKJB 5A6AA 2FKPA 1XBXA 5DBTA 3UWVA 3GUWA 4Q4QA 3VNDA 4Z7UB 3V1HA 3BUQA 1R5WB 3GB6A 3ARDA 4U1IA 3VFMB 3ZVIA 3B83A 3MRFB 3BUVA 3GMQB 2EDLA 5GS3A 1OGGA 3T4CA 4M6AA 4WCYH 3S48A 3EBAA 4J1UB 5GGVH 5CAYB 2IIJA 4I8DA 3Q06A 1E56A 1IHIA 3I9GL 4EP8C 4KDWA 5CBAB 1PE1A 1FL6A 1SBSH 4R5VA 1N5YL 2YGPA 1KBIA 4ML4A 2MEJB 4M8QA 4HYRA 1AQDB 4ZMVA 3GGWA 1D9KB 5FOJA 4GBXB 2CDGB 1A6UL 2XZQL 2YUWA 5I03A 5C0AD 3WU1A 1B3WA 3F62A 3Q44A 4AMAA 5E8PB 1JBJA 3BCDA 1I3RA 5I1IH 2AEPH 5T1KA 3TA3C 25C8H 2A83B 4MZYA 7A3HA 3VDBA 2XVLA 1T0MA 1JQXA 1SPQA 2VLKD 4GAGL 2E28A 5H1WA 2OQLA 1ONWA 5BCAA 4EIZC 3EADA 4WK2B 4KV5F 4ZQPA 3WUBA 4H9UA 2PCXA 2X5PA 2VEIA 3QYQA 1SJXA 3FEMA 1IEAB 5K93A 2GTZB 4B7LA 1L9RA 3F7LA 1OLZA 3GMLB 1R5IB 4M82A 3MRLB 1URLA 4M7SA 1PS3A 3W2DL 3KCPA 4JO5A 4X80L 5IGXH 5BRZA 2PLMA 2NQ5A 3V35A 3DVGA 5D2LB 3U4BL 4IMLA 4BD4A 5GGVY 1T4KB 3QZMA 5CEZL 4I1PA 4I9WE 3AITA 2BOGX 4R3SB 2DB8A 3NIFE 1NCOA 1IGWA 2E9JA 3F85A 5DMLA 1QQDA 1JZEA 2NUWA 3DYOA 2XXGA 1KNOA 4XBKA 4JHAH 4DWSB 4P3DA 3RVUC 5TIMA 3JT0A 3MLUH 4JNZA 3KAAA 3QDJA 3TOPA 1KCWA 1TA3B 1NEUA 3EO9L 4H13C 4APXA 4QBXA 5D04C 1GGCL 3DGCR 4S3BA 1DEDA 4L4TD 1T7VA 1DQJA 2J72A 4BFIB 3OLEA 1UGKA 3Q45A 4M5SA 4W6WB 5FGCB 4KESA 1EDTA 1A4KB 4NILA 5AHMA 3AXHA 1XR9B 5MF5A 3BCFA 3FOMA 1I2PA 4AF0A 2W80C 3QBTB 2GGIA 5CU9A 2EVGA 1DXEA 3IACA 1KRAC 1T6BX 1HH6A 2LOEA 1VHCA 3BG3A 4Z7UE 1MUWA 4KU1A 5EZPA 3D07A 1KCRH 2KMWA 4QRBA 5TPWH 1U5HA 2XH0A 1RZPA 4GI4A 4P59L 1R75A 5KN5B 1FV1A 5ISZE 2FFIA 2A5UA 4P2QA 1JIBA 4PJ9C 2FNBA 1IGTA 3HGOA 3S37X 3N3TA 3ISYA 5C5YA 1JL8A 2QQNH 3HS0A 4GAJH 4G1KA 1JZ3A 3T3MB 1E7VA 3V4UH 1LO4L 4MA3A 3QDGE 3H2OA 3IRSA 3B8TA 3RGVC 3LHUA 5AALA 3CPGA 3CZ8A 1RLBA 2R0WH 1S7SA 4L3EA 4YHKL 4D0CB 4IIFA 4GYPA 4XISA 4AGMA 1ERNA 1TTCA 3EF4A 3MV9B 1LQ0A 3EXRA 3EFDL 2PR9A 4JZ5A 3WBEA 3HE7C 1JI1A 5E56A 5BS0E 3O05A 5B4MC 1YNQA 1HEZB 2BVQB 1OL0A 2P46B 3SHSA 4JLRB 5E2VH 3MKVA 2Z1SA 1C16B 3RNKA 3ZDXE 1XTLA 5E0QA 5LGJA 1D7KA 3WF3A 5DZLA 1DYSA 4Y0GA 5I26A 3IDJB 3ECBB 4RA0C 5DR5H 1CFQA 3MC5A 1SHXA 1GH7A 2VLRA 3DX7B 4OUIA 1LP9E 3N9GL 1MPAH 4JPSA 5AG9A 3OBAA 3QJRB 4R97B 2QPSA 32C2A 3NZHL 3QUMH 4PJ8A 1ANUA 5D9OA 5C09A 3SPIA 2ADIB 4MJ5B 4U3CA 2LU5A 4DW2H 3CD4A 5IV2A 2E5DA 1KKRA 5AW9B 1IGSA 4J3OH 1JUKA 2IALA 2EIBA 3Q3GA 1OP5H 3G6JA 5HULA 3K72A 4KROD 5DZPA 1O7SA 1T8QA 3SGGA 1LGVA 3I50L 3T8QA 3HZ3A 3LXCA 4QXGL 1T7XA 1U58A 1NOLA 4HGKC 1EQPA 5D9SB 3DDFA 4O1CA 4WZHA 4Y96A 1M2VA 3W38A 3OGVA 2BOCA 3GVRA 1EDHA 3HQPA 3IJHA 1Y18A 2RDUA 4ZMZA 5IMOA 3NSMA 4G6CA 5CJMA 4HIBA 4BI6A 5DK3A 5EEYA 1UIPA 1ZVNA 1KPUA 3P4NB 1TVBB 1CLCA 1DQWA 2OEKA 3P0YH 1NL0H 4LF3A 4LP4A 4J3BA 4H7VA 3GI8L 3J2PA 2ZZ6A 5F96L 3AU2A 1A9EB 2DZEA 3QQDB 1AZRA 3CZFA 3S5YA 4JK0D 1G67A 4AG4L 2D7PA 5I3KA 1JGEA 3HNSL 4WUUD 2K6YA 2EIZA 3ZUCA 2J79A 2FSEB 4Q8MA 2L7EA 1CFBA 1EVUA 2KI6A 5L6YH 5FYKH 4AYMC 1YTDA 4Z1AA 2ISFA 3TW7A 1HE8A 4F8TA 4P2YA 3EO9H 2WCAA 4UOJA 4KCWA 3TN4A 2NX9A 3W2NA 2FZMA 5CZSA 2FCBA 1FPTH 2ZC1A 5E8EA 3QJHB 3VMOA 3CTLA 4U3AA 2WWKT 1GCYA 4P3DB 3CB8A 1ME9A 2HVJB 1K9DA 4OJFL 1YECH 3JSSA 2NNCA 1MCWM 4JPIA 1DBKL 5KJRL 3DFQA 3W9DA 3V6ZB 4DLFA 1J7VR 3HPFA 5CGYC 3FO9B 3CUJA 3RF9A 1EJFA 4LCYA 5B3SB 3PDOB 4PRNA 2WN2A 5EU7C 1ZHKB 3S3GA 2WO4A 1U4FA 3D69A 1ACZA 2NXYB 2FT8A 5AN7A 3MA7B 5I76A 1J8HA 4WV1B 3TBVB 2WMJA 3VXQA 3PJWA 4NHVA 5DJ8A 4F7PB 4UFHA 1MY5A 4AGQA 2HPMA 1UCTA 4B9CA 3S3JA 1L6GA 1BFOB 4HWEH 4ZNCD 5E1QA 5IBUB 4KHXL 1W8NA 2H2PC 1FHUA 3AAZA 3GUGA 3RX4A 2GB2A 3EKLA 2EE6A 5JYMA 3FCSB 5D5MF 3EZ4A 1YDPA 3EWCA 3QORD 3CT2A 4HJGA 4MXVF 1HO4A 1LQ2A 3GTVA 1CB4A 3SQRA 1TPB1 4GVGA 3G1DA 4CQDA 4Q8OA 2XQ0A 3JWNC 5DJ6A 4F7CB 1MNUH 3VQMA 2BTMA 4Z1CA 4HZMA 4ZTOL 1T3FB 2H1PL 1AXSA 3SGKC 3T77B 2P5ED 3QRFM 3QE5A 2V81A 1FNHA 4CN1A 3D08A 2CEQA 3C2RA 3ETTA 3GSWB 4GKNA 4TSCL 3ORWA 3ZJ7A 1DBTA 1TWIA 1IIHA 5JOFA 2FWLB 2P8PA 4OFYA 3VXPA 3KPPA 2EZ0C 2VITA 3H42L 3VUAA 4Q9CA 5D8WA 1YEEH 1RZ7H 3GIPA 1SLUA 3AYTA 5LNWA 2WB5A 4A3UA 1KC5L 2CZNA 3TZFA 5IQLA 2J6VA 5F2GA 2VDPB 1TUFA 4LVHB 2EG6A 1Y7VA 3P67A 4DN1A 3EJQA 3VXRD 1NH6A 3CFJA 4KH9A 1BLIA 3G3LA 3BKYL 1YA5A 5T3ZD 1FN4B 4JZOA 3IFOA 3MRJB 2VC2B 5B1CA 1T66C 2VDIA 4RXFA 5T3XD 1Q0YL 1ITXA 2CBTA 3MBEB 1F6AA 3WKMH 3U82B 4BKTC 3O6AA 2ZUTA 2VN7A 5INDB 2ADIA 4MJ5A 2LLEA 5MKGB 3CXHJ 4TTDD 1PKQA 3OR7B 3CWNA 2NLIA 3QUZA 2D1ZA 2PCPA 5C7HA 3IANA 4LSTH 4B9YA 5EEZA 2CXEA 4HCLA 5JBFA 1OGSA 3VJ6B 4XKMA 3I3BA 2NYYC 3ETBF 5E8NB 4FADA 2ESVB 4OGAD 5B4MD 3PJNA 5K69A 3QXVA 2GITB 3UGXA 1G7MB 3MNZB 4F37K 4KK9D 4GG6A 1KD0A 2R1MA 3D47A 4Y9GA 5CC7A 2GJPA 1NC2A 2V8MA 4YVNA 3PZTA 2FX8H 4N8VB 1SXBA 4AG4H 2WY3B 3P73A 3GW0A 3PHQB 3ZL2A 3WD0A 1D3CA 1INQB 3MX0A 3RX7A 4WDIA 3VX1A 4MCYB 5IW6A 1BBDH 3WLMA 3IU4H 1LEKA 3TX9A 3MJ9A 1AGEB 3I2CH 2FJFB 4BQ9A 2FIQA 1C8VA 1JNLL 5C0AA 1ZALA 5HQEA 4PJ9D 3ZT5A 1CQKA 3H3KA 5TDNA 2FJHA 3DYPA 3TT3H 4E9LA 4YHNA 3BKCH 3V7AG 4ZQTA 4UIMA 4PMQA 4NDMB 1QO3A 3C8KA 3BSZH 4X5WA 1WA0X 2HRLA 1QSFE 1JPHA 4KUZH 4A7TA 1NFGA 1FL3B 4N2GA 4DOHB 1BWKA 1FWEC 3TJEH 2K1MA 2RTTA 43CAA 5L9DH 3VAVA 3SCMA 4C6FA 2EKSB 4NUGL 1ZOXA 4ROPA 3QWQB 2E4FA 3INUL 3WJMA 1DL7L 4BZ1L 3UH8A 4FS0A 5G55A 3X13A 4IMCA 3PP4L 3W24A 3FXIC 2I7SA 3EJYD 3T8MA 1KJMA 2NY3C 4L1XA 1YEEL 1OBAA 3ZKMD 3FRUB 4HGXA 2JB5H 4OF3A 3KBNA 4B5TA 3H22A 2VKWA 4ZFGL 1Q6QA 1JXJA 3TLRA 3WEZA 4Y90A 3P3YA 4IDJL 4ACPA 1S7TA 4G6JH 5KVFL 4E0RB 2E3ZA 2WC4A 3QV8A 3BE1L 1RVGA 4DWSC 1NF0A 3APMA 3U7YH 2EC9U 2BIMA 3BPOB 3RPKA 4PHZA 1FHVA 2WZHA 4KJQD 4NKDB 5F9WB 4O0KA 1EZVX 3FU5A 5I73B 4PFHA 1Z5LB 4ZOAA 1MAJA 4B53A 3UJRA 2I16A 3OJDA 1XGRB 3P9MB 1VBGA 5CD5D 2OGYA 2RH9A 3BJSA 3NQAA 2H3DA 1CX9A 1AO7E 1E4XH 4HU2A 4ATTA 5KZCD 5TQLA 1OAYH 2DZAA 5HWJA 4X9SA 1KKOA 3CDZB 1GG0A 3H12A 4AENA 1RZKL 4GYFA 3QC0A 2QR0A 2ZCHH 3RWCA 1BLNA 5C07B 2EDTA 4JCWA 5LQBL 3ANUA 3DUGA 1FORH 4DPCX 4OOUA 3WDPP 1CF8L 3ERXA 4AQAB 3QQ3A 5CF3A 3M1BB 1DWJM 3K1KC 3MNVA 1WBXA 2AVFA 4ZMXA 4HNOA 4O00A 4JPGA 4PBFA 4IHCA 1UKSA 1CYGA 3TFXA 1NWUA 4JRYA 3R43A 3N06B 1OARL 2AZUA 1M7UA 4QT5B 4UTAA 4ICXA 5KS9A 1QLRA 2HVOA 3L0NA 1HAUA 1ZLDA 4WWID 4TNVF 5IHHA 1VR6A 1E8YA 1BQUA 2W88A 4WJ5B 1KG0A 3CDGA 3MJ9L 2YEVB 1HL8A 1MUJA 3KEDA 3MRJA 4P4KC 4AWJC 4B97A 3WIJA 4DM1A 3WBWA 1T1ZA 3RJYA 2UVFA 3PWPD 3P4MA 4ZEPA 1DZBA 1IC4H 1ADQA 4PG9A 4KHTL 5D7JD 4PV8A 4Z7OE 2RCSL 3DO7A 1FIEA 1ZL1A 3ARRA 1DQKA 3IEAA 3ALXA 1RCOB 2VCBA 1YG9A 1R5IA 4Y4FD 2XA8L 2B7QA 5I1DB 1QLEH 1GYMA 3AIRA 4U49A 3OMIB 4B96A 3AJ7A 5KVEL 1KPVB 3SPVA 5GZOD 1R8LA 4HU0A 4W87A 1HHKA 1BGAA 3FB7A 1EXUB 4TVPE 5ALBH 3EYQC 5U7SA 3LDBC 1D5IH 4WEBL 2EDQA 5EIVA 1R24A 1PG7L 2W0FB 2WBJB 4QHUB 4UZGA 3K5RA 4DWSA 4L1DA 1A4BA 3MX0B 3BKCL 4OJEH 3VD3A 3VWKC 4ZW3A 3LQMA 3MGOB 3OKOA 2EXSA 3GHEH 3PWNB 4APXB 3QPXL 2WZPD 4MD5A 2ZZ4A 1EAPB 4CC0A 2HVJA 3JWDH 2C9PA 2Q8LA 4XMXA 4BBWA 2XJKA 3KCJA 3DDGA 3FOLB 1TFHA 3L2LA 4M1GL 4W9DC 5F3HB 1EDYA 1ZXQA 4HIQA 4Z7NE 3CN1A 4LLYA 3WFDL 4HIIA 3GYCA 5FF0A 4OCNC 5IM51