1G94A

Crystal structure analysis of the ternary complex between psychrophilic alpha amylase from pseudoalteromonas haloplanctis in complex with a hepta-saccharide and a tris molecule
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 158
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2000-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1g94A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1g94A01
4KMQA 5FL1A 4D71A 2WHLA 5DO8A 1B3ZA 3WNPA 4P7NA 2DSWA 4NRRA 1BSIA 3TTOA 3LRLA 4HA1A 1E6RA 2VMFA 1BHGA 4F9JA 1WZLA 4HP5A 1UD3A 3B9AA 1TZ7A 1XHGA 5C70A 2F7OA 1V08A 2WLYA 3DDGA 1SYTA 4JAWA 3ZQ9A 4DO4A 1QHZA 2YJQA 2J7CA 1JAKA 3OB8A 3S5YA 2VZUA 1G0CA 1JFXA 4AC1X 3BMWA 3M46A 1JFHA 4EAMA 1UD4A 4ZXLA 4CN4A 1CLXA 1E55A 1BQCA 1HIZA 3AIRA 2AMGA 2VRKA 4CCCA 1KQZA 1GQJA 5LA2A 1DTUA 1TQSA 2E9BA 1V3IA 3DC0A 2VUYA 3AXXA 3CHEA 4V27A 2WMGA 2W63A 4OBRA 2EEXA 1JD9A 4P7RA 1OINA 2WKLA 3H54A 3GXMA 4PTWA 1UD8A 2WPGA 5CPSA 4BF7A 4HZ8A 3AI0A 2WMIB 4QLLA 2VQTA 3T2QA 3HG2A 2YL5A 4OZOA 2GJXB 3CIVA 4S3KA 3GBDA 1JIBA 2GDUA 2YLAA 4ACZB 4Z2IA 3PZTA 3EJSA 4MNJA 4WIWA 1EQCA 4R27A 4U3CA 5BXTA 5KEZA 4JHOA 1R87A 3E1F1 3L2LA 2J47A 3MKKA 2TAAA 1OB0A 2ZXAA 2F7PA 3ARRA 2F1BA 5GNYA 1H49A 2EPKX 1W91A 2DSVA 1JZ3A 3CUGA 1J0YA 2XFRA 1UKQA 2EPNA 5F7UA 4JKMA 5A8MA 1GJUA 2QF8A 4CGTA 2ZX5A 1X6LA 2CESA 2PWFA 5E1QA 1GZJA 1BG9A 1DEDA 1BFNA 1JDCA 4BQ2A 4AD4A 4Q7NA 2XWDA 1JZ6A 2W91A 3N11A 3SCRA 2WSKA 4AZ5A 3LPFA 1DHKA 3PTQA 5A2AA 5HNNA 5HDRA 1W9PA 4M1RA 2YKKA 5I6SA 1MQQA 5I77A 3EMQA 3FHAA 1I75A 1OIMA 2FGZA 1KWKA 5A6BA 2PBOA 5I23A 3CUJA 1MQPA 2EQDA 2BY2A 4D6EA 1C8YA 2JALA 2YA1A 4PCSA 1M7XA 4D1IA 4ML4A 1B3YA 3BVWA 1UKOA 4J3XA 5CGTA 3I3EA 3RJYA 1ZBWA 5A1AA 1GORA 3SCSA 1GPFA 3BAXA 2WHKA 2OSWA 2GDVA 3WH7A 2DT2A 3WFLA 5A6SA 2JIWA 2D73A 3M6DA 1WNOA 3DYMA 3BAYA 1BGGA 3AS2A 4XZWA 3HN3A 2XVLA 5IDIA 3DX2A 1V0LA 4HMEA 5FIPA 4Z2JA 2FDMA 2WAGA 4E8DA 2BFGA 2PB1A 4BQ4A 1CGXA 4QLKA 1J0IA 2ZUVA 1UR9A 5A6JA 5FOOA 2WSPA 2A3EA 4GO9A 2WWCA 5IXEA 5DT7A 4FLSA 1NWUA 3U5YA 1E71M 1E4MM 3FW6A 3W53A 3W38A 3SUSA 3S2CA 4D6IA 1J0HA 4WK9A 3GDBA 1X1NA 2WVTA 1HJXA 1E3XA 1QOXA 4UQBA 3POCA 1CIUA 4PTVA 4V2XA 5AY7A 3VIPA 1YHTA 4NZCA 1FFRA 3CHCA 3ZO9A 3AS1A 2XVGA 2F7RA 4NX0A 3WH8A 2DIJA 1C91A 1FH9A 3UETA 1TVPA 3WD0A 1H5VA 4MJ4A 3FXYA 2VT0A 2OW7A 2ALWA 4NZFA 4HU0A 1EQPA 3MU7A 1LG2A 4MPKA 4C7FA 3A4WA 1NM9A 1QHPA 5I5RA 3VX1A 3MI6A 1L8NA 4N0RA 1PX8A 3N1AA 4WLCA 1OSEA 2EJ1A 3PZQA 4AZCB 2X1IA 2WMJA 4OJYA 1VJSA 4LXFA 2VRJA 3VGEA 4LQ1A 3VMPA 2JIEA 4J3TA 3IAQA 3OZOA 5IFPA 1HVXA 2O9PA 1JZ5A 4X9YA 3SURA 1BPLB 1OGSA 3D5HA 1GHSA 3L4UA 4U2YA 4MAVA 4AY1A 4MTVA 1Q6DA 1RP9A 1QX1A 3W27A 4W89A 4W7UA 4JL2A 3PZNA 3VTRA 1KWGA 1E6NA 3SCWA 1PPIA 3EDDA 2WVSA 1KR0A 4AZ6A 4AMWA 5HXMA 4KH2A 1E4IA 4BZYA 3VD7A 1W9UA 4L4PA 3QGVA 1PX4A 3UCQA 1ODZA 1E15A 1ISYA 3RMEA 1EO7A 2IXUA 1DWHM 3VGGA 3RIKA 1FHLA 2PI6A 1LJYA 5M03A 3L4YA 3A4XA 1MW3A 4Z2LA 1OT2A 1Y7VA 2DPEA 3NSNA 3ARQA 3VINA 2OSXA 2CHNA 5I79A 2VX4A 1LWJA 3CHFA 1AMYA 1UD6A 3EJQA 4HMDA 1E6PA 4UQEA 3GBEA 1TE1A 1V6XA 5M17A 3DYOA 4PMOA 1NOFA 5CXPA 1EA9C 5A8NA 3GNPA 1FH8A 3CZGA 3PZGA 2XN2A 3VIOA 1JYXA 3W6LA 3W4RA 1FFQA 3L4TA 4Z2KA 4DO5A 3OLIA 1DWIM 2VRQA 4P7LA 4EANA 3GZAA 1K9EA 2YDRA 1ZB5A 3VPLA 1XH2A 3BVVA 3VDAA 3WD1A 4TXEA 4ZFMA 2DGAA 2OLHA 5A8QA 1NQ6A 3WNLA 3WDQA 3BLBA 3VNYA 4TVUA 1KTBA 2OSYA 3AISA 3S5ZA 5CSYA 4IM4A 1B2YA 3OG2A 4W86A 6TAAA 1EXPA 3WDPP 3BAJA 3THDA 4U5KA 5FL0A 2Z1SA 3W24A 1UWIA 2BV9A 2XJ7A 2Y8VA 5HPOA 1WZAA 1KGUA 1E1EA 4MNLA 4PMXA 1XSIA 4H8UA 4AZ7A 1E70M 4J7RA 2XHYA 1IT0A 2WVVB 2Y24A 4P8WA 1VIWA 4E2OA 2CNCA 3WQWA 1J9YA 1V02A 4MNKA 1LWHA 1QWNA 3U57A 2V3GA 4GKLA 1C7SA 3WNKA 3CZ8A 3IGUA 3I3DA 2VX6A 1QNPA 1B3XA 5LA1A 1VFOA 1WDSA 1R75A 2IGTA 3UERA 3AMLA 2A3AA 1OIFA 2G8ZA 3VUPA 3DHPA 4FF5A 3G6LA 2ZXBA 1CTNA 4AISA 3B9EA 2DSUA 4UFIA 2PC8A 2WB5A 3OLGA 1Q4NX 2X2YA 1UQYA 1GJWA 3CZKA 1UUQA 4UFKA 3ECQA 4D72A 3VX0A 4FNRA 1H3GA 1VB9A 2J62A 5HPCA 4QCEA 1XSKA 1R47A 4IISA 1CXLA 3CTTA 2WCSA 1JL8A 1JDAA 1JGIA 1BYBA 2WC4A 1O7AA 3EDJA 1SR0A 2DH3A 3U7VA 2XWEA 3ARWA 3BVXA 4OBSA 3J7HA 4MB1A 1TCMA 2ESCA 1CECA 1DP0A 3WF3A 3WQ4A 3D4YA 3L4VA 3QHMA 5CPTA 3D50A 4JCMA 1G1YA 2FHFA 1X6NA 3QR3A 2BY1A 2WVUA 4PUDA 4PBGA 2E8ZA 4HZ6A 4FMVA 1AQ0A 3K8LA 2GFTA 4AYGA 2W61A 4XV0A 2C8NA 1E56A 1LG1A 2GJRA 5JUVA 1W3LA 8A3HA 1U2YA 1PEZA 4D6GA 1KB3A 4UR9A 1UH2A 1B31A 5DFAA 3K8KA 1B90A 1M04A 1JXKA 3MS8A 3DYPA 2G3MA 1V6UA 4EK7A 4TTUA 3PBGA 1QWUA 1C8XA 1QNSA 1T0OA 1ECEA 4UFLA 1H0GA 2BVTA 2DT0A 2CCRA 4LYPA 3CUHA 1E9LA 3VIMA 1UD2A 1JNEA 1W1TA 4Z2GA 1KCLA 3WFZA 4JHZA 3BCFA 1C90A 2Y2WA 1HT6A 4UQAA 3VO0A 1V6VA 4K68A 2IXVA 4DWSC 3KLKA 2D3NA 4ZENA 3VIIA 1VENA 4ZE4A 2XFFA 3TOPA 2IUZA 3PHAA 3LPOA 2YA0A 5BXRA 4MDPA 2QMJA 3WDRA 3WL1A 4WKFA 3ALGA 2BVYA 1QI4A 1JYVA 3OGSA 2J78A 1ODUA 3WENA 3BSHA 2VJXA 1PIGA 2GUYA 2ZUWA 2ZUUA 3WY1A 4PMUA 1H41A 3OZPA 3PZIA 3GNRA 2VCBA 3NCOA 3W82A 3CUIA 3F5LA 2VR5A 3WMCA 1KXQA 1R85A 2CYGA 5BRQA 3L2MA 2A3BA 1HKKA 5D8WA 1GONA 2WC3A 4IPLA 4NXSA 3CBWA 1HXKA 5D9OA 2J74A 1E5JA 1XH1A 2GJPA 3GM8A 1V0KA 2E4TA 3MV01 1NP0A 4Z2HA 1HP5A 1JYNA 2EPLX 1BTCA 2BY3A 3A4AA 4U2ZA 2D3LA 2HVMA 1BAGA 1KXHA 2CBIA 1ZS2A 2CXGA 5E6YA 3IJ8A 4U31A 2V3DA 4GZEA 1XC6A 4KRTA 1BLIA 4GQQA 5ABFB 1UR8A 1SMDA 1W2VA 2WZEA 1TQVA 2BXZA 4BQ3A 3A24A 4GQRA 2PWEA 3VILA 1H09A 4W88A 4LYQA 2EO7A 5IHRA 2C0HA 1V3HA 2D23A 4TOQA 4PMQA 2GK1B 3W29A 5CLWA 2W67A 1JZ8A 4A4AA 4FLRA 4ATWA 1GQLA 5E0CA 3WUFA 2X09A 2ZXQA 1ITCA 3VGHA 3WD4A 2J7DA 2OWXA 3AIBA 1VBUA 1E40A 2C7FA 1JZ4A 9CGTA 1TA3B 4TX8A 3TONA 3CV5A 2VZTA 2WCAA 3BMVA 4MB4A 3EMCA 5GNZA 3K4AA 1US3A 2WBKA 3CMJA 3ZIZA 1PBGA 4TTGA 4DWSB 4JIEA 2JFEX 4W87A 1UWSA 3ZR5A 2B31A 3SUWA 4AD3A 5A8PA 2PWDA 2YLLA 1VEPA 2VO5A 4L4OA 3ARSA 1PS3A 1TR1A 2UWFA 2OW6A 1DWFM 4W84A 3IJ7A 4GZIA 1O6IA 1KGWA 3WL0A 1XD1A 4FLQA 3NIYA 1IZKA 2J25A 3WSUA 4PMNA 1EDGA 1F4HA 3T2OA 1QBAA 3WQ5A 3FY1A 2XUCA 2OYKA 4DM2A 4AYSA 4J3WA 5ABEA 4GINA 3KLLA 1B0IA 4JFTA 4KGLA 1B30A 3WDIA 3W81A 2QMKA 1E6XM 2VCAA 1B9ZA 4AD2A 4W8AA 3W28A 2VNCA 3FNDA 3W6MA 2J79A 4J3VA 2VTFA 3OA5A 5DEZA 3WQ8A 1KTCA 4S3JA 3AHZA 4AD1A 2ZX6A 3AZTA 1Q6FA 1EH9A 5E0FA 5EMYA 1QI2A 4ACZA 2F1AA 3GH5A 4E4PA 3WDJA 4MJ2A 4AIOA 5KZ6A 3RILA 1IZJA 2PWGA 1WAWA 1BGAA 5IHSA 4R5EA 3O9NA 2VURA 4KGJA 5IFTA 5FD0A 3A3HA 4AZHA 4DUWA 4GI6A 1C7TA 3WNMA 2F7QA 3MUIA 3WH5A 4CCEA 5CQ1A 3WUEA 2J8GA 2VVSA 3AZSA 4CD5A 4M80A 1QW9A 4ZEPA 1VJZA 4D6DA 3II1A 3W26A 4B9YA 3GYCA 1V3LA 1UKPA 4NI3A 4OUEA 1V3JA 3VSVA 3WNOA 1WCGA 2YL9A 3A21A 4UFJA 3OLEA 3LMYA 2X2JA 1VFMA 3VIHA 1HKJA 2YIHA 3K46A 2VX7A 2ZOXA 4RE2A 2CKRA 4W93A 2WHJA 4JFVA 1J18A 1QNRA 2E0PA 3ZSSA 4UZUA 4B9ZA 5C71A 4AMXA 4ATDA 1BYCA 3AMDA 1UZ1A 1D3CA 3BAKA 3CMGA 4QP0A 4HTYA 3K4DA 1W1PA 4KWUA 2WLZA 1JAEA 2HISA 2J8FA 2XVKA 3KWXA 1U33A 3D3AA 3N17A 1KXTA 2W4XA 4U3AA 1WZMA 1V6WA 2J7HA 5A2BA 1BVNP 3BLKA 3CLWA 3CC1A 1B3VA 2DIEA 1FH7A 3GXNA 3WNNA 1CENA 1DWAM 4PMVA 1E72M 4PMRA 1UG6A 2DT1A 3HG3A 1RP8A 1JYWA 3CUFA 3H55A 1XYFA 4IUGA 1W9DM 2VQUA 4HU8A 2XM2A 1GOMA 5A69A 1BYDA 2UY4A 3AMCA 4WSJA 3SCQA 3AHVA 4MB3A 1EOKA 1LF1A 3WH9A 4CN1A 4FNSA 4FNQA 3RCNA 2WKGA 4AMCA 3G6MA 3GXTA 3VM7A 5D8ZA 3NSXA 1I1XA 3CGTA 1OWQA 1WKYA 3AIQA 1JI1A 1M53A 2VZOA 1UR4A 3KZSA 4TX6A 2WMFA 1HJQA 4AZCA 5GNXA 3WUGA 3N9KA 1R46A 5AYIA 4QDMA 3QOKA 1ZBCA 2AAAA 1LQ0A 2XGIA 4WJXA 2WZHA 1D2KA 2X0YA 3VDBA 2G3NA 2D24A 3F4VA 4RE3A 1CZ1A 2D1ZA 6CGTA 3VNZA 2D20A 2GVYA 2XN0A 1UD5A 2ZUSA 1G5AA 3LXCA 4UOJA 5ECUA 3ZM8A 2W62A 1TQWA 4BQ5A 1LLOA 1K9FA 1MFUA 2QLYA 2DQXA 3WIJA 5AC5A 3AFBA 2Y5EA 4EKJA 1HTYA 1V0NA 1QNOA 4PSPA 2WMKA 5D9PA 1HXJA 3WD2A 4YPJA 2V3EA 4LYRA 3WH6A 1EDTA 4P8UA 4MDOA 1E5NA 3AYSA 1KBKA 1UHVA 2F61A 4BA0A 3AHXA 2E8YA 1JNDA 5DF0A 2VX5A 1MVYA 3ARUA 1XD0A 1C92A 3WEOA 1O7DC 4UNIA 3LRMA 3NSMA 3VM5A 1VRXA 4JFSA 5EFDA 2DT3A 1XH0A 2CBJA 1JDDA 1MXDA 1CXFA 1AVAA 1J0ZA 4TUFA 5CJ5A 1GQIA 2XG9A 2OYLA 1WDQA 4CU6A 1ESWA 1ZBKA 4H7VA 5D4YA 2NT1A 3MV11 1UWQA 3FHQA 2WWDA 1CXEA 1WP6A 3GH7A 2X8RA 1MFVA 1NWRA 2XGBA 4CVWA 3ZR6A 2RGLA 3RM9A 3W37A 1HWWA 3N18A 4AIEA 2NT0A 4C7GA 5BWFA 1PZ3A 3FN9A 3WMBA 2ZUNA 1QI5A 3UG4A 1W3HA 4M29A 1JD7A 1NARA 3AMGA 3VD4A 3PZ9A 1GVYA 3KE0A 1GOOA 3L4WA 2EAEA 1E4LA 1QI0A 4B15A 4CVUA 1R7OA 1Q6CA 4EE9A 4NF7A 4M56A 3KL3A 7CGTA 3T08A 2CBVA 1KQYA 4QCFA 4HA4A 3ZT7A 4TVDA 2OWCA 1UKTA 2WYSA 3BUDA 1EDQA 3AIVA 3WBEA 2QV4A 2XN1A 2WVVA 1XV8A 2ZX8A 3MSDA 1V3MA 4AD5A 3AXHA 3CO4A 4AZBA 1HKIA 3D52A 1DWJM 1XRVA 1UA3A 3UESA 1NOUA 1TUXA 3KL0A 3AS0A 3OGVA 2WC7A 3A23A 5A6KA 3N15A 4Y7EA 3T0DA 1VF8A 3GH4A 1EHNA 2VZSA 1DWGM 3DX3A 3VMNA 3WQ6A 1H4PA 1HJVA 5BYWA 4AW7A 3AYRA 3WF1A 2WZIA 2BHUA 3L4XA 4H8VA 3VIJA 3OIHA 1IV8A 3WUBA 2D0GA 1A47A 1S46A 3NYDA 3CZNA 3MUZ1 3ZSTA 1E3ZA 4AWEA 3AZRA 1NOWA 2D0HA 3F5JA 1GW1A 1KXVA 3WEZA 3T0AA 4J27A 3VDHA 1N82A 6A3HA 1V6YA 3N12A 3WF0A 4M8UA 3WMSA 1MQRA 3WY2A 2CPUA 2OYMA 3HJEA 1R7AA 3IANA 2VZVA 2XTKA 4AEFA 1E73M 4GI9A 5TD4A 1G9HA 4UTFA 3B9DA 3EDEA 3PZOA 3EMZA 3VD5A 1UZ4A 7TAAA 1OM0A 1CXIA 3MUY1 3BUPA 3FAWA 4JFUA 3HG4A 3CHDA 1OCQA 3BUQA 4P8XA 1E1FA 3IJ9A 1GOQA 1XYZA 1CPUA 3KL5A 1FA2A 1LL6A 2F8QA 1CLVA 3MUAA 4WKAA 3SCNA 3ZJ7A 1V0MA 1MW1A 3POHA 4URIA 5D9MA 3QHNA 3RO8A 2CIPA 3DX1A 1TMQA 1E4NA 3WKZA 4HMCA 3RM8A 3MMDA 4CD8A 1VBRA 1QHOA 4MADA 4UFMA 5DT5A 3GXIA 2X0HA 4B3KA 3OLDA 3JUGA 3SCUA 4PRWA 4A3HA 4CD4A 1PJ9A 4DUVA 3ZJ6A 3K1DA 2WMHA 3GTNA 4CU7A 4D6JA 2BNJA 3D4ZA 1EO5A 3CPUA 3GXDA 4XZBA 2NW0A 1KR1A 2J7FA 5CLTA 3UR7A 5LA0A 1H2JA 2ZWYA 3AJ7A 3EYPA 3VIFA 4GO8A 1JF5A 3ARZA 1JF6A 2WBGA 4P7OA 3BUIA 3TTYA 1JXJA 1I1WA 5E70A 5AC4A 3BGAA 5CSUA 1GUVA 4JZ5A 3LPPA 3ZT5A 1BF2A 1RD6A 1UA7A 5CZKA 1A3HA 3EJPA 5E6ZA 2JEQA 3SCOA 1RPKA 3A5VA 5FKYA 2O9OA 1W1VA 2W92A 3AIEA 1J10A 3DX0A 3ARTA 4GIAA 7A3HA 5HBFA 1Q6EA 1ZJAA 5M5DA 1SMAA 2WK2A 4GZJA 1NP2A 3B8SA 1MWOA 3LXAA 4E8CA 2BY0A 4FK9A 1GNXA 3H53A 1JI2A 2E40A 4M24A 4M81A 5C8BB 4ACYA 1W9XA 4F8XA 4HOZA 1FP9A 2XFYA 4F66A 1W1YA 5JIWA 2GSJA 3M7SA 3HZ3A 4B16A 1V02E 4PSRA 1HKMA 2XSBA 1HL8A 1UASA 4PMZA 4ZXOA 1B3WA 2UY5A 2WNWA 3S6TA 3BC9A 4DUXA 1QW8A 1L0PA 4W5UA 1XCXA 1OGGA 1CGYA 4HOWA 3SUVA 4GPNA 3LPGA 3D51A 2VI0A 4XUYA 3MMWA 1UWUA 2VR4A 2O92A 4DM1A 1W9VA 3WD3A 1KFWA 2E3ZA 3ARYA 4ZE5A 5I24A 4XX6A 5I3DA 2PBGA 1TQTA 1B1YA 3UEQA 2XVPA 1GQKA 4H8HA 4H2CA 5ABFA 3AIUA 1M03A 2Q8XA 2VC9A 5BXSA 1E6ZA 2PF0A 3AMKA 3DX4A 4X0VA 3W25A 5M3WA 1E0VA 1US2A 1C93A 2G3JA 3GXFA 2O9TA 3APGA 1GVIA 3THCA 8CGTA 2MANA 3NJ3A 3SCPA 2YFNA 3BVUA 2ZUTA 4FNPA 2UY2A 3PZMA 2GK1A 3IAPA 3MANA 2J7EA 1WDPA 3CZJA 2YOCA 3AHYA 2WMIA 4W7VA 1KCKA 4GXPA 4C7DA 1E6SM 4FNTA 3WY4A 1W9BM 1V03A 1GHRA 2GJXA 1GOKA 5EFFA 4WSKA 3AICA 4BS0A 3VMOA 4W7WA 4P8VA 3CZSA 4PN2A 1TA3A 3OBAA 1HVQA 4HOXA 4MNMA 4HPGA 3N04A 2V5CA 3BCDA 1XCWA 5GQBA 4BCEA 2WHMA 2FHBA 3RDKA 1CNVA 3U7BA 3F5KA 4DWSA 5BCAA 3ZJKA 2CITA 4NRSA 1WZKA 2F18A 3VGBA 5AYBA 3PZVA 1Z32X 2CKSA 4AZIA 3M07A 1HJUA 2DSZA 2RGMA 3SIMA 2YDQA 2DSKA 4OIFA 3UR8A 4OGZA 3TP4A 2FYVA 2Z1KA 2WXDM 2YBTA 1CGWA 3KEHA 4N42A 3UG5A 1CXHA 3HG5A 3AOFA 4AIUA 1RH9A 4W8LA 3VKKA 4AD0A 4NSBA 1JG9A 1TVNA 2WM0A 1ITXA 1EOMA 3VSUA 3TV8A 1R86A 3VOCA 1PAMA 4J3SA 2F2HA 2BHYA 3NDZA 2W5FA 3PTMA 3WY3A 4DO6A 2X05A 3ZJ8A 1EHAA 5ABGA 5A3HA 5JBFA 3HMCA 1UOKA 1K6AA 1EIBA 2J75A 3RJXA 4CKQA 4V28A 2QPSA 1FP8A 5E09A 1JZ7A 4LPCA 1OBAA 1GCYA 5JBEA 1R34A 2JEPA 4UQCA 4JCLA 2ZX7A 4PUEA 5JBDA 3MSGA 2JF7A 1JZ2A 3BVTA 2E9LA 1VEMA 2BXYA 1V3KA 2BS9A 2Y4SA 4QFUA 4JFWA 2E9MA 4F79A 3N13A 4H41A 5D9NA 3TTQA 1W3JA 3WF4A 5BXPA 5I2UA 2WW5A 1H11A 1C8QA 5I0DA 1ZU8A 3WEMA 3LXBA 3AIWA 1FHDA 1TFVA 1ZL1A 3K8MA 3T09A 2QPUA 3AHTA 3MO4A 5ABHA 2CHOA 1QVBA 1VAHA 2YDSA 3WQVA 1NH6A 4JKLA 4W85A 3BLPX 4MAZA 1HX0A 3VVGA 2J4GA 4RL3A 3EJUA 1UH3A 4JKKA 3ARXA 2CETA 2A3CA 1HJWA 1M01A 1CGVA 1SZNA 1E0WA 1HL9A 2FH8A 3T2PA 5A94A 3EJRA 4KRUA 1XSJA 3TTSA 3UG3A 5HOSA 1BYAA 3RPMA 2D0FA 3LRKA 3EDFA 1E0XA 3W0KA 1WDRA 2EPMX 4UCFA 2XIBA 1J0JA 1WB0A 1UR1A 1YQ2A 4NZJA 3GXPA 4P7QA 1J01A 2DEPA 4UOQA 4OKDA 3FAXA 4U33A 3PN8A 1E6QM 1P6WA 1AQHA 2XVNA 4D6CA 3AQUA 1Q6GA 4FLOA 5JIPA 5A6AA 1PZ2A 1UR0A 4PMDA 4YHGA 4YN5A 3ARPA 1D7FA 3VD3A 4HA3A 2XM1A 2FHCA 2EADA 4YHEA 2ZE0A 2V38A 1HF6A 3DHUA 1F4AA 3L4ZA 1ZBVA 3ZT6A 1WE5A 4PTMA 1QI3A 4F9DA 1R33A 4UOZA 2FE0A 5A6BD 2EABA 2ZWZA 1FOBA 2PWHA 5FCZA 3WF2A 4W8BA 3U5UA 3CZEA 3EDKA 4LGXA 3A47A 1KBBA 2YL8A 3VGFA 3SCTA 2EBNA 3WELA 5A6MA 4DWSD 2EACA 2BVDA 3BAIA 4PCTA 1PIFA 3VDCA 4WKHA 3BSGA 3SCVA 1MW2A 2XSAA 2YBUA 3A22A 1ZJBA 4X0NA 2D22A 4NXKA 1GOIA 4UFHA 5A2CA 1CEOA 3ALFA 2AOSA 3WN6A 1W32A 1C3FA 1TG7A 2ZICA 3RM4A 2G4FA 1SFSA 3ARVA 2DDXA 1UQZA 1E43A 3VU2A 5CPQA 4CU8A 4U5IA 5GPRA 1LL4A 2WANA 2EXOA 4MB5A 3QHOA 3VIGA 2J7BA 4B3LA 2WCGA 5A6LA 1H1NA 1ISWA 4CCDA 3OGRA 2ZIDA 5CGMA 4H04A 5LYRA 4CN6A 1PX3A 2G41A 2O9RA 4IPNB 1VFUA 4GI8A 4ATLA 1UWRA 4PMYA 2X2HA 3BAWA 2G3IA 2EPOA 1QNQA 1G94A 3AXIA 1CBGA 2ZXDA 4XB3A 1GOWA 3TA9A 1CYGA 3ZOAA 2X2IA 3SEPA 4A3YA 5E9AA 2JE8A 1CXKA 3T0BA 2Y8KA 1UWTA 4CD7A 4QLJA 1CDGA 2J77A 1QPKA 3DECA 2DH2A 3DDFA 4J28A 2CERA 2XPKA 3MMUA 5I78A 3VD9A 5CG0A 3EBVA 3BUBA 2YFOA 1TQUA 1HJSA 4OOZA 3SUUA 4TVCA 1NWSA 1HN1A 1CGUA 4WF7A 3BH4A 5BRPA 3NUKA 1CGTA 2JF6A 2ZUMA 5EB8A 3HU7A 1J11A 1UH4A 3QOMA 3VSTA 4D6FA 3AS3A 1R8LA 2QHAA 4D6HA 2VVNA 3CH9A 2NSXA 3LX9A 2ZX9A 1HNYA 1MW0A 2VCCA 2FH6A 1MXGA 4AZGA 2J7GA 1XGZA 4FNUA 2XIIA 4Q22A 5EBAA 3EJTA 4QAWA 1CWYA 2V5DA 4RE4A 1W2PA 1QBBA 1K9TA 3O6AA 2YA2A 1ISZA 4D1JA 1ISXA 4HPHA 2UY3A 2XYLA 2CBUA 2A3HA 2YL6A 4UQ9A 1OGBA 2VOTA 1ISVA 1EGZA 4JL1A 1BG4A 1OD8A 4AEEA 1H0IA 1NWTA 3AROA 3I3BA 4UZSA 1J12A 3CZLA 1OD0A 1UKSA 1WPCA 1UYQA 2FGLA 2CEQA 3GNOA 3NDYA 4HZ7A 3BXWA 4OOUA 2D2OA 3VIKA 4PYSA 1K9DA 1UR2A 3A6OA 1W3KA 1U30A 3ZMRA 1BVZA 4W5ZA 1J0KA 4LX4A 4CD6A 5DMYA 1WO2A 3WDHA 5A95A 1VFFA 4PEEA 3O2LA 3SUTA 4UQDA 4J3UA 4CUCA 3IK2A 5A8OA 3VGDA 5BROA 1LL7A 3PTKA 1KGXA 2V3FA 2VL4A 4PTXA 4AXNA 1AQMA 1OT1A 2OWWA 1G01A 2BHZA 4M82A 1VEOA 3PZUA 2W66A 1MYRA 3WBAA 1HP4A
chains in the Genus database with same CATH superfamily
2GEQA 2BMKB 3GS6A 4PRHB 1I2PA 2A73B 2UY7A 3WNPA 2X53A 4P7NA 3PQYD 4D3CH 4A6YB 3MSPA 4FDWA 2UZPA 4JKNA 1NF7A 2Y8UA 1JF1A 4CMMB 3T8MA 1VSCA 4JAWA 2ZXGA 1NGPL 3OB8A 3BMWA 1R5WA 3V4PH 1UD4A 1EJOL 3GB7B 4Z0JA 3TPKA 5ANME 4OIIL 4LALA 4IJCA 4OBRA 4NFCA 2OULB 2AJ3B 3DEQA 1YXDA 3ZE0B 5HHOE 3GDLA 4KCWA 1IEVA 4CNSA 4OZOA 5HJLA 3KBWA 3CIVA 3SN6N 2ESVB 3BX7C 5I82A 1JCLA 4C4KO 2YLAA 4OCMC 2VEFA 3CFEB 3QEQA 5DRCA 3MJ9A 1VH7A 4JQ2A 2IO5A 1WYIA 4K3ZA 4J4PA 3GI9H 1D6VL 1T89C 4KPHL 1J0YA 1UKQA 3RU8H 1DVUA 5TDPB 5A7BA 1RUML 3P3SA 5CZXC 1WAAA 5JHAA 2ARJB 1JDCA 1EHXA 1D5BA 1HCFX 2PYEE 3LUTA 1MQKL 3FT4B 3QPYA 2NYYD 4R7XA 5D2LB 4Y8EA 4GZ7A 1F8TL 3RBSA 5CKAA 4GMSH 4J9JA 4MNHB 5FOBA 5CZVL 2F0CA 2EQDA 5F3HA 2QZQA 1M7XA 3SGJA 4A67A 1EX1A 2X6VA 1NCWH 1GORA 1W1B1 3PPCA 3W11C 2CZDA 4FIRA 3WS6A 2XPGA 4PJDA 4WV1A 2PCYA 2ZZ6A 1INEH 3TJLA 1T96A 5AB9A 3OZ9L 3LHZA 2P0IA 2AQRA 3LQAH 2EJAA 1AQ8A 3FH7A 1B4JH 4CQBA 2MQGA 1ZSHA 2V17L 1ONQB 1JCMP 2D2GA 2DJSA 1VCBC 4N2HA 3DHDA 5G5IA 4UQ2B 2ZC8A 4YK4B 2FEJA 2CDGB 1P1ZA 4NX0A 2V5BA 4OGYL 5E24E 3ZZSA 1G7JB 3FU6A 5IMKA 1LOQA 4XGZA 5I1KH 4LFYA 1X5FA 5GGUA 5HJBA 3N1AA 2EJ1A 3MJ8A 1SSDA 3F2BA 3GG8A 2JKSA 2HYMA 1OKEA 2R1PA 3LCHA 2EZ0D 5EU6E 2XZQL 4OJCA 1OGAE 1BPLB 4DP7X 2HT3D 3HUJF 1U92B 5DZLA 2A83A 1DQLH 2IPTL 1NQKA 4RMSA 2OXHB 3R8BB 1PPIA 4WY7L 2DM2A 3KPNB 4X6DA 3SB3A 4JW3A 5F7DB 4QNEA 3DBNA 4MMZA 2QBWA 2A3TA 1DWHM 1BZ9B 5KOVC 3RPBA 3PJUA 3JWNG 2A9BA 4IP7A 1KXVC 3RMJA 1WCBA 4QRRD 5TNVA 2BH0A 4OCSH 2HRLA 4HJGA 1NOFA 5B7FA 4GW5A 2AKRB 4P3DB 4R7LA 2Q86B 1G7IB 3Q3GA 1QEWA 2FPVA 2NPLX 1ORQB 4US5D 4NZ5A 2ENYA 4WFEE 4RBPH 1UEYA 3V79C 5INDB 1GGTA 4LUIA 4LF3A 3OG6B 1I7ZA 1QSFA 1NTHA 4EZMA 2BRRL 2W07B 3KYNB 6TAAA 1EXPA 1D2OA 3WJXA 1ADOA 1YLVA 3ZKQD 1XGUB 2Y8VA 5DDHA 2UVFA 2VM8A 2NXZB 1KGUA 3QNFA 2UY6A 4H8UA 3HBZA 4HEPG 4PL2A 2CO2A 5AG9A 3VACA 2XV6B 2A79A 4JB9L 3P0YL 1OLLA 3MFFA 4KI1A 1FRBA 2GEEA 4K3EH 3ISRA 2Q3RA 4O5LL 1T0PB 4W6WB 3G18A 3MLVH 4P5UA 4PJAE 4DAGH 1VFOA 3ET9F 4KPLA 3WQPA 3ATAA 2WMPB 1O9ZA 3OLGA 3UGEA 1C1EH 3GVWA 1FZKA 2JBMA 1NIEA 3ESOA 5DQJB 3LBMA 3LCWA 2AK1L 4LSPH 4MOZA 2BP1A 1CECA 3SE3A 1UENA 3QHMA 3CHSA 2XDFA 2ZWNA 7REQB 3QR3A 3SJVB 2ZKHH 3FDWA 2GJRA 2VQ1A 1UJPA 3I74A 4Y4HC 1U2YA 2ITCB 1JRCA 4M19A 5KZDA 5EUKB 3CWOX 1T0OA 2G5UA 3PVFA 1KJ2H 3RK8A 3P8JA 3MJ9L 4RISH 4Z2GA 2GFBA 4DWSC 4M6VA 4AVOA 2IFGA 2DKMA 2A4CA 5JW4N 4U1HB 5D2XA 3N4AA 5FO7A 2PTTA 1HUVA 5LIUX 3MI3A 1UXMA 3K2IA 4U6XB 2VJXA 1FV1B 3CDFA 4NERA 3TU6A 5C2UB 5EU7C 3I75A 3RUGE 4QROA 4PS4L 5LQBH 2CYGA 4F7TA 2CNYA 5JW4Q 3VAVA 1BV8A 4JDYA 3OVPA 1T6MA 2Y5TB 1A5SA 1NP0A 4KZEH 2QVFB 1FBAA 5DGRA 2BY3A 3K0WA 1PF3A 3MX0A 2HVOA 5FDWB 2JIXA 1SEQL 3PV6B 1T5WB 2V3DA 1K4DA 5E5UB 4QNPF 1RQ5A 3FC8A 5C0FA 4MYWB 2BLFA 1OFDA 4ZXBD 5KSBA 3AJXA 1H09A 4Y4HB 1BBDH 2YZ1A 4A4AA 2DZTA 8FABB 3RGHA 3KVQA 1E0UA 1UWYA 5JQ9A 1H5YA 5I75B 5E6IA 1VBUA 1OXYA 1JZ4A 4H5SB 3TONA 3MBFA 4HNUA 4Q56A 2ZYIA 3MWCA 4TTGA 4DWSB 5AC8A 1A5OC 5B1AB 3O2VH 2YYUA 1FFOA 2GJ6A 1CYWA 2Q8BH 3ZGIA 2AV1A 5I30H 4NWUL 3L7EB 2HDJA 3KLQA 2OZTA 2C7UB 5LCVL 3MTXA 4G6ML 2OS7A 3D85D 2POZA 4EIBA 4LVEA 1D5IH 4FTVD 1DDHB 3QFJB 2F6XA 25C8H 1E6XM 3KTSA 3EO9H 4ZR8A 1LDPL 3HZKA 5DJ6B 4AD2A 1HI6A 4B4FA 5C6WH 2VITA 2HEJA 3SO3C 2NY3C 2YK1H 3QIBA 4Y16C 3T9PA 1S7TB 5IZ7A 1XZWA 2F1AA 5FYLD 1IM9A 3MRFA 4TO8A 4UIOA 5KZ6A 4AUYA 2V0AA 4Z3IA 3AQDA 3L23A 2XX0A 4QRAA 3LI1A 5CQ1A 2YXGA 5BZWA 4NFBA 1Z48A 4RNRA 1E7UA 4FFYA 2JCCA 3OW1A 5CP3A 1HKJA 4F57L 4PJFE 4RE2A 1KELL 3D08A 2QT6A 2EUZA 3NDOA 2YUVA 3EYOA 4KIEA 3VTMA 1TZ9A 1RZIB 3R10A 4O1CA 4UTAH 2RQ8A 1JBJA 1YHPA 4TLSA 3SKMB 9XIAA 3C09B 3TCTA 3N17A 3CQ0A 3FYOA 4JQ3A 1P7QB 3Q6FA 1HCYA 3TH6A 5EN2B 1XF0A 3WNNA 3O0RL 2W6RA 1DVSA 3PWVA 4MUPA 3I7SA 4MDRA 2XM2A 2YBRB 3QHZH 2FVNA 3SO3B 2R39A 1VADB 4Y16B 1S8DB 4KI5C 4FNQA 4HWBH 1TTIA 5CC5A 4ZMWA 5D8ZA 1T80A 3VM7A 1PKNA 3AIQA 5IM51 5L88L 3ZQWA 2WNGA 5KS9E 4IBUA 1PZ5B 3KCLA 4G42B 4JTUA 3AM8C 3GHEL 4O16A 3T77B 3F4VA 5HNRA 1P1XA 3MO7A 4PODA 3G1RA 1FVDA 3P67A 3D69A 4C54A 2Y7EA 5C5YA 1OABA 1WBZA 4R53A 5KW9L 3PWLA 3W7CA 4EKJA 3WIIH 1A22B 1RQHA 2OMYA 4YPJA 1S9WA 5F96L 4NYYA 4OFVA 3KTCA 2P3ZA 5EEUA 5EC2B 3I02A 2MNRA 3KG5A 4JE0A 3PWUB 2ZCHL 1EEPA 4NQDE 1A4CA 5EFDA 1IAIH 3G77A 3H7BA 1AVAA 2HFEB 2WOYA 2ICCA 1N7ML 1WDQA 2B7QA 1P2CA 4PJ8A 2R69H 3BQVA 3TEYA 3GH7A 3UCDA 1KEGH 4DJEA 4NDMA 3MA9H 4HUXB 1ERNA 1C29A 4E41E 5JO5B 5TH2A 2F7FA 1GGOA 3V4UH 5JU6A 2E6PA 1ODAA 1U8NA 5CD5D 4WUUA 5FO9A 4HIJB 1VDGA 5IGXH 2VFIA 1OARH 4N8VG 2CBVA 1QLFB 5E7FA 2HMIC 2PODA 3ZT7A 3WJZA 2PETA 1VPOL 4KU1A 1I1RA 1USQA 4RRPG 3JYCA 4UDTB 2SFPA 5JQIB 4WY0A 1KN4H 4K7FB 4HH9A 1O5QA 4Y7EA 4L4LA 1UATA 4Y1AD 2XV0A 1EDYA 4JTFA 2YD8A 4KHTL 3HGJA 4ZQCA 1IVLA 3WMPA 1MI5A 5BZZA 1Z7JA 1U93B 4XO7A 3AREB 2H2SD 3VDHA 1REQA 2YQGA 4ZUSB 3HJEA 2W60B 5KSUB 3ULUH 2QR0A 4JO2H 5F72S 2WZTA 4CJ1A 3NO3A 1XDTT 5E08L 2OOGA 5IOPB 3CHXA 5JHMA 1J7VR 5C54A 1RUPH 2W59A 2Y5JA 4RNFA 3IJ9A 4X60A 3HMJG 4S1RL 4ABQA 3KPPB 3EEZA 2VLKD 1JMZA 5DMGD 2FPTA 4JDVA 5DSCB 4CD8A 5DWPA 3ABOA 3X11B 1CFNA 3UZQA 7TIMA 2AW2A 1OQXA 3PUGA 3B0YA 3MUGA 3VXPB 1OF2B 3T4WA 5IJBC 4OECA 4ESKA 2Z93B 2DVTA 1CE6B 3L3DB 3G1XA 5IKCB 3UR7A 3L9RB 2BNQA 4FAMA 4GO8A 1M2VB 5SV3A 3ARZA 4WVRA 1JGMA 3TTYA 3QA3A 4UNVA 1SOQA 1V5XA 1Z66A 3O6FD 5AC4A 1A3ZA 3ZT5A 2XZZA 3H2AA 2P0OA 2AAMA 3TBTA 4NKQB 5CSZB 1S78C 4BCYA 3D3VE 3QY8A 4GIAA 2V9TA 4K9EH 1NP2A 1MWOA 5BVPL 2OZ8A 3BWZA 4LU0A 4ACYA 3WLJA 3H9HB 3APCA 2NUYA 4GSXA 1N6QL 2O5XH 1V02E 3BP4A 4HN8A 2BVQB 4NNPH 3TSBA 3E0WA 4GH7B 5D7IB 2RGSA 4M7JH 3KNBA 1P6CA 3EKGA 1OGGA 1DFXA 2NY7L 1MIML 2XBDA 4GPNA 1IGJB 4G7EA 1IEIA 1R3JA 1OCOB 3P0WA 1TRIA 2D69A 5I3DA 1B1YA 3TA3D 4DVOA 2EDXA 5CKGA 3UEQA 5K9OA 4XMWA 1BDYA 4B5SA 1AD9B 3MGTB 1KTDB 5HHXH 5L6YL 1XLBA 2PF0A 2J3SA 2JQAA 1US2A 4YDLB 1YTDA 4LCUA 1KEMH 2YFNA 4M6ML 1KGJA 2DN7A 3I50H 1W9BM 1GHRA 3DGDA 3QIUA 2WBWB 5C0BB 4F9LA 4MWAA 5KSBF 4PCNA 4AWSA 3BCDA 2NQJA 4HHWA 3R8RA 1KJMA 4GX9A 4AH2A 1YN7A 3KS5A 5D8JL 5SWQB 3PBMA 3U4BH 4K8RC 1Z32X 4AZIA 3GSXA 5F7KC 2MOVA 4Y2NA 4NO2B 3KEHA 2AGTA 4Z3FA 3VKKA 4ZMXA 1H6TA 1VACA 1Z44A 4OZGB 3RYMA 4GQGA 2QSVA 3EOBB 4XD5A 2VXVL 1GHFL 1BQGA 1A4AA 3R7RA 1NBYB 5TK4A 5BOOA 4ZG1A 2DQJL 3UTTA 5EO9B 4DYJA 4JTDA 3GQFA 1JS4A 1MAMH 3O45A 2LLNA 4UQCA 3MSGA 3FPYA 5F4WA 3A9BA 3B7SA 1V3KA 4Q6IC 4JM2D 3LY6A 4NZRH 2R4RH 4OIBA 4UTMA 3FS2A 3GBMH 4LVNC 3NZSA 3U79A 3DENA 4AZ8B 4FG6D 1GOXA 3FTVA 1OM3H 5JDSB 32C2A 3AHTA 5DS8A 4BBWA 1WTLA 1VAHA 3IARA 5JYLA 2AEQL 2YOAA 3NN8A 4Y5XC 4RDQF 3UROR 2C13A 2CRMA 4X9IA 3JV4B 1VKXB 3UVAA 4WW1B 2REQB 1JOIA 3FB6B 4ZMOA 5AZ2H 3MUJA 4D7PA 2P80D 4YE0A 1E0WA 4Y88A 4HCRH 4DVBB 1I7TA 4R97C 1YNTB 5HOSA 4L8DA 1C12A 1PXGA 4JGJA 2BSTA 1B2WL 2XIBA 4I13B 2Z4GA 3MDUA 1LDCA 2CBOA 5HYJD 5BV7L 4LE8A 3NEHA 3LNPA 2W0PA 2XVNA 4F5CA 1U8IB 5IESH 4RCAA 1GAFH 5IMMA 1EP1A 3G6DL 3CIWA 3UJTH 5TQ0H 2HVNA 4YHEA 1KG0A 2YMOA 4J2PA 4ALDA 4N1HB 4ZDHB 5GHWL 1NJJA 5HD8D 1N8WA 3MLTB 5DD1H 2HLFD 1L9OA 1LO2H 2H9GB 3VQMA 4MKVA 4X9FA 5JR1L 1NVMA 1CU4H 3LLXA 4NJHA 1BD2D 3G1AA 4M7LT 1FL3B 1RIVH 4P99A 3ECVA 4GAGH 4EPBC 5T3XH 4Q6IB 1QZNA 3OR6A 1XGDA 4C5ZA 4XP9H 5INCB 2MJWA 2EZ0C 4JJOA 1W31A 3FFDA 2VDGA 4Y5XB 4GQZA 3L3JA 3DFPA 1TPC1 5AW2B 2LLEA 1ZLWK 3L0GA 4YCPA 1UWRA 1F41A 4QOKB 3CH1A 4QTGA 2G3IA 1B5TA 1QNQA 1A5FH 1ZTXH 3TA9A 1EJ8A 4QIUA 4KJYB 3UPAA 5IOKA 1F6KA 3GHBH 3HPLA 3RNKB 3S48A 5DHMC 4OI8A 4PN6A 4V2CB 1TELA 1AGEB 2XPKA 5CG0A 1TV3A 1ZWIA 3RVVD 1CGUA 3HG1D 1CGTA 4DJFA 4JFZH 5J56B 3SW6A 3C52A 2NSXA 2ZX9A 2CRYA 1A6UH 4AM0A 4NI8A 3FU3A 2C14A 5JA9A 4PJEB 5TF1H 3AQXA 5HUPA 2BCKA 2V5DA 4G70B 3M6YA 2BIMA 1KCSH 5JIDA 3B9KC 1TEYA 3U9UA 1AS8A 1N64L 2A3HA 4MD5B 4NJ9L 3QW3A 3AROA 3QSTA 5T26A 4OD3L 4C6NA 4S2SA 3TF7C 3CZLA 3AXKA 4KKPA 1EV2E 4GHRA 4O8RA 4RFNB 5FA5A 3U36B 4QSFA 4ZA0A 1JFQH 3FA4A 4OCWL 5DVNA 5DEFA 3EKZA 2PO6A 4RIRB 5AYZA 3PGCA 3JWNH 5DMYA 3CK5A 5SWUA 3REVA 2FTYA 3BGGA 3NIDB 1T7YA 4YO0A 1CUOA 5J3HC 3UCRA 1CBVH 3PREA 3FCBA 5HBBA 2Z8VC 4GT7A 4TUUA 3DBXA 3OZMA 5KSAA 1LQ2A 3IRZA 1PTAA 3SY6A 3UC0H 5DO8A 2BTMA 5FO2A 4PLJD 5HATA 1A7PH 1Q9KA 4GW4B 2BNRA 2NY1D 1NLDH 4TM9A 5K39A 4A3UA 4B27A 4HP5A 3N2TA 1DUYA 3WTYA 3DDGA 1H5BA 3E8UL 4BKNA 4YXKL 4NRXA 5GJSL 3WGVB 5EUOA 4QXGL 5EU9A 4ZXLA 5D1QD 1HIZA 2RQEA 1X8FA 1GQJA 2AI0L 4ZMZA 3RPIA 3DC0A 1BVKB 1U2CA 3D39B 2G0WA 3B9KB 3WTSA 4MVBD 3VNIA 2Y06H 2SEBA 1BIIA 4HZ8A 3L08A 3BTNA 3TZVC 5IEKA 3GBDA 2X7WA 3TYFA 4PY8I 2DICA 3PZTA 3N2BA 4GG6B 1ALDA 5F0PB 1U5JA 2K7PA 1EERB 1AJ0A 4JHOA 1WA0X 1NCGA 2J2ZA 4U1GC 4QBXA 2OMVA 4RA3A 3IACA 4Y19A 1AHWA 3P0VL 2EPKX 2OMWB 1VCAA 2XFRA 4NGHL 4HHMA 2PDIA 3TX4A 4JQIA 4UZGA 4OAWB 1VRDA 1LVEA 1R5YA 3W9EA 2N01B 5IQ7H 5HDRA 1X5JA 5XIMA 3P2TA 4U6HA 4ZX6A 2OR8A 1NDZA 5EIIA 5CCKL 1PNDA 5A6BA 1ZY9A 2Z91A 1T04A 2BY2A 2GTQA 1QLRB 4GEJA 3DIVA 2CKBB 5ENWB 3QUYC 1E7VA 1FIEA 1OAXH 1J79A 4XC3H 2I5GA 2RFGA 5FIPA 5FCSH 3TYUA 1KA9F 2BFGA 2B2XH 1PLGH 2ZUVA 4CADB 3BKJL 5I1JL 1AQDA 1I7UA 4YWGL 3EYFB 3NYZA 4X4ME 4P2RE 4ZXBC 3TLRA 4LPYA 1JCTA 2YCLB 3JVFC 4UQBA 5IWLA 4HULB 2NQLA 3TZVB 4LVBA 4LCCC 1CG9A 4QF1A 4N28A 4XNDA 2ZA3A 3FGCA 1HHIB 2TRHA 2ICSA 4RZ5A 5KVFH 1ONXA 1XX1A 3KXFB 2X89D 4B4HA 1PX8A 1URLA 3QDJA 1ZLSL 4P2QA 5T5NF 3LBCA 1AR2A 2Z29A 3W2JA 3X14A 1T5XA 1QR1A 1ZXKA 4MAVA 4PJGE 4WI3A 1L9SA 5GJTL 4PJ7B 3EH5B 2MHAA 5KZCD 3IGAB 4E5XA 5D37A 3LY0A 3PDOB 1WKDA 1R3HA 1DYZA 3CDGA 2QVKA 4FXKA 5CUSL 1L6FA 1Y7VA 3QUYB 5DT1L 2CHNA 1BX2A 4O2CB 3JTTA 3LV3B 1LD9B 1TE1A 4NL1A 1R2RA 5A8NA 4DH2A 4N26A 2EO1A 1WKFA 1S5MA 2E1WA 2OQJA 1M7DB 4ODHH 4DPPA 3GZAA 2WLMA 4LCCB 4JPWH 4DXKA 2APSA 3CX2A 3V6BR 3LN4A 1P5UA 4AUJA 4WFFE 3OG2A 5I1HL 5JQ6H 5BVJB 4LASL 3DMMD 3HGRA 4MNQA 1FNFA 1RL1A 4JQ1A 4CQAA 1X9QA 4NO0B 3GUFA 4HKZB 4PQXA 2XHYA 3GSNH 4LS0A 3LHYA 5H37A 3UJJH 1BM3H 1DL3A 5J11C 1V7NH 4PMFA 3CLFH 3U57A 3BPNC 1OC7A 3ZWTA 2GI7A 4IJTA 1O7VA 3US1A 4P8QA 1DKWA 4CC4C 4M02A 3K71B 4G7FA 5AVVB 3F6IA 4KK6D 3S37H 2EVJA 5ABTA 1DVYA 1NCHA 4KKAD 1KLGB 5LIKX 2JLPA 4A04A 4L3EB 3E3HA 4D72A 2A38A 3CQKA 2KPNA 4JQXA 2OX5B 1MFDL 3KS0H 4YHMH 5E1GA 4HCHA 4KQ4L 4MQXC 1S9YA 1H0DB 2V68A 2BS8A 1W2KT 3BVXA 3QXAA 3ZDXF 4XMZA 3I84A 4HKXA 3FEMA 1RCXB 1HS6A 3BYTA 3MRCA 3HHSA 2OP4L 1J5SA 1TJIH 3STLA 3V36A 4WK2B 4HZ6A 2FVLA 1YJDC 1E56A 3GD1C 4KKQA 4Y5VC 4D6GA 4KEUA 2HVKA 2W95A 1MCRA 4E36A 4EK7A 3HI6L 3QXWA 1DVFC 4W9GC 1QNSA 4E9VA 2WWMC 2MCAA 1H0GA 3AUOA 3KDOA 3P30H 2I32A 3G7TA 3NPVA 1TZIA 3QJZA 3VO0A 1MNUH 2C3GA 2ADGB 1CLCA 4ZENA 4ZE4A 2YD7A 1JPHA 3BPNB 1LEKA 3LDVA 4XPBH 2R0WL 3J8F7 4WKFA 3G5VA 4K8RH 3ALGA 4JQIL 2YD4A 1QI4A 4OM1L 3OGSA 1PIGA 4LY8A 4XCYB 4GVHA 4TSBH 1H41A 4JZOB 4JRXA 4XPGL 4JFXA 1OCNA 3CXOA 4F27A 4U7MA 4UT6L 1RURH 2D7PA 1G9ML 3L5IA 3BV7A 5HI3D 3NQDA 1M6OB 1QO3B 3EXJA 2V5SA 3CS2A 2P5EA 3R25A 2LGNA 5DY3A 2CXGA 2GG1A 4X5WB 2EVHA 4GZEA 1XC6A 4O4VA 1ME8A 1INDH 4JFFA 5JUEH 2PWEA 3L9EA 4Y5VB 1GPOH 4ZAKA 3RX8A 4MWFA 3B3DA 1QPRA 3ZDZF 1IAOA 4ATWA 1DVFB 1KY7A 1F5ZA 4RAHA 3K6IA 1BXCA 3U2JA 4X6CB 1EGJA 1E40A 4TLTA 5A16A 3FVMA 1M42A 1ZHLA 3CMJA 3IK4A 3TESA 3D30A 4UT7H 5FSEC 3QKZA 2RBLA 2ZT9C 1AOHA 3JR2A 5JHLA 3QS2A 2PWDA 1SY6A 3CT2A 5BS0D 2VO5A 5C0QA 1U91B 3QN3A 1T8XA 4OGXL 4GSUA 1W0VA 4MJMA 3H12A 4H0IA 2YGQA 2WQ8A 2I9LA 5M94B 2W80C 3GM0A 1I0BA 1RJCA 5FUCE 3W5NA 3QCUH 5IVXE 1IKOP 3C8HA 1B30A 2M8XA 1JZEA 1UA6H 5DMGC 2QMKA 1PZ0A 2PE4A 4Q9CA 2ICWJ 1LE5B 4DZ8A 3I9GL 4KCUA 3W6MA 4JRFA 2F8VA 2QJDA 3RX4A 2EIDA 2F74B 3B5GA 2GQ9A 4JGDA 3IJSB 3HUJA 1IIIA 4MA7H 1WAWA 2F9BT 2FCBA 5I19H 3MCKA 4A55A 3W7OA 2YUZA 4DUWA 1HINH 2EDBA 4ZTXA 3GU9A 1MXSA 3O6CA 2AQVA 1AACA 2WLIA 3BWAB 3V52H 4K5PA 3WUEA 4CEXC 4ZEPA 4D6DA 4DZIA 1WCGA 4YVPA 4IOSA 3ZE1F 5AVYB 1UIOA 3QXUA 5SX4H 3CFCL 4G8EB 4IIQC 1RMFL 4MZYA 3VC5A 3BDYH 1SO3A 3CQFA 4S1SL 2NV2A 3UJEA 3M1BA 3PJLA 1A2YB 3TIDB 4XOBA 4TV6A 1ME9A 2UWEB 3SBWC 5FYJH 1BJ8A 3NO1A 1CD1A 4J3OF 3TA3C 5A2BA 3GLEA 3LPWA 1MHCB 2H0PA 4G1EB 3FUIA 3P4NA 4IUGA 3MV7D 2VL5B 5IHHA 3TT1H 1OAUH 3LZNA 4CKVX 3SDCA 1PKQB 3MAWA 5B1CA 2C3HA 2MIZA 4DW2L 4O1BA 2Q3OA 3C6CA 1JRHI 2HNHA 4FNSA 2K3TA 4POZC 1CK0L 1E0OB 4ZTEA 2VWSA 4JAMA 1WIPA 5C9KA 4YVVA 1T03H 1ROWA 2ADYA 3HTWA 4JO4L 4BI6A 2J8UF 2DLGA 5ITFB 1DCEA 1XX9C 3UGXA 2Z2BA 1U3HD 4AUBA 3V5KA 1FWJC 4X80L 2MQ0A 4UOJA 4Z0XB 4EDWH 1W5OA 2AFNA 1FORH 4H19A 1MFUA 5IHZA 3JUZA 2XUWA 1S7VA 2OMZA 5B21A 3HRZC 4I8YA 4MQSB 4Y9FA 4B60A 3CZUB 3AHXA 1GTFA 4WK4B 3WO4C 5KYXA 3CYJA 1ZLVH 3WQCA 5IROA 1JHTA 4BHYA 3TA3B 4W1TA 4JM2C 5MEPA 1JDDA 2H32A 3NSYA 1XTLA 5CJ5A 5D7LA 1HHGB 2CKBH 5DUJA 4FG6C 2OYLA 4F33B 1MJ7H 4WJKB 3MBXL 3MV11 1IMHC 2WWDA 4JGNA 3RNDA 3QWOA 4PG9B 2QHRL 4IG2B 3ZR6A 4HQQL 5BWFA 3FN9A 2X38A 2EEAA 3UG4A 4IBWA 3AG4B 1MY5A 3Q58A 2VXSH 1Q90A 1NEZB 5DHYB 3L4WA 2XCMC 3QULA 2X4PB 1V51A 3GW3A 1HSBA 2GKIA 3CWHA 4GT0A 5JOPE 3APTA 5D70H 1UKTA 5B7MA 3H3PH 3FT9A 3WBEA 4Q8MA 1E4JA 1GYNA 1K5NB 1E50A 5GRJH 3GMOB 3WUWA 4XBGB 1Z41A 4PWHA 1ETZB 3A23A 4FOMA 5BWAA 2A74B 4PTUB 4A21A 2KT6A 3FU7B 4MX7B 5CO1A 4S1QL 1DWGM 3VE0A 3VMNA 3WQ6A 2B14A 1DFBL 5HD8C 3T0XA 2HLFC 3VIJA 5IK3B 2B59B 1XXDC 4MCYB 1EGJL 1KIPA 2D0HA 2WGXA 1YEWA 2ZP0T 4K2UH 1W17A 4BFOA 5JHLL 4ES4A 4AVFA 5EYWA 3ABSA 3K74B 4GI9A 4HCFA 4YDJB 3FS9A 4MDIA 4M1CC 5K9KA 1DXEA 4WKAA 1V0MA 4R5VA 1GRWA 1X7FA 3RX5A 4XWOD 3I7QA 5K9JH 1CLOL 2LU7A 1KB9K 3GXIA 4B3KA 3TR2A 4A3HA 3HPJA 4DUVA 3T71A 5CSSA 3GTNA 4NPJA 4S3DA 3PG9A 1W0WB 3FA3A 2FB4L 2J7FA 1YN6B 1A02N 3HO8A 1G84A 1I1WA 2WJFA 4IKKA 1RZQA 3LOWA 1A7QL 1RD6A 1UA7A 3GDCA 4H8WH 1QTSA 5ID0B 5AW9B 3SCOA 4UU9B 4WJG3 3V0AC 4A7VA 4E8CA 2E40A 1S1PA 2YR1A 5C8BB 2A4EA 1W1YA 4Z7VB 1ETJA 4IOIB 5D2YA 4FABL 3SKJL 2XSBA 4X5RA 3GSVB 1RIUL 4QTHA 2DL9A 4WI6A 1O5KA 4X61A 2P3EA 1L0PA 2IQAB 1E28A 3D51A 3ESVF 4GBXD 4E9TA 3VXNB 3C6SB 4HWZA 1D8WA 3GK8L 3D12B 4NKCA 1PU0A 4KERA 3AB0B 4Y2OB 2JB5H 2NUPA 4NWTH 4X0VA 3AMKA 3S42A 4IKJA 3OKOA 2CIKA 1OT4A 3AHYA 5HHMB 2IQ9H 1KCKA 1MUWA 4C7DA 3WY4A 4N2MA 2C9RA 1R24A 3O2WH 4OZFG 1A6PA 4XAGA 5LIXX 3R79A 3OIXA 1E9QA 3DSFL 1RZKH 4PLJC 4HPGA 1UCBH 3F4CA 2JJSA 1OCCB 3RDKA 4G7RB 2XJLA 3REWB 3F5KA 5BCAA 3DKLA 2CKSA 4YGVA 2CDFA 2BSLA 4O58H 3UR8A 4OIFA 5DMIH 5FA4A 4KROD 5D1QC 1CGWA 2MUCA 3LCIA 1RH9A 1ZT4B 5DVOA 1QEXA 1KYAA 1ZQ5A 4MXVE 1OCJA 4Y9BA 4Q4IA 1CTMA 4MVBC 4FHBD 3N9GH 3VRLE 3C61A 1TZAA 1F3TA 1O5DT 3CFTA 5I8CB 2DMCA 5A3HA 43CAB 1V05A 4LPCA 1PY9A 3B05A 4HGKC 4WI2A 4JCLA 2NNCA 3QUGA 8XIMA 1KM6A 5ICXA 4H41A 1DQTA 5BOJA 1DLFH 1XLMA 3F7QA 1TFVA 3NQFA 2BSBA 1E67A 1F6AA 4XWUA 5LCVA 3LKSA 2G97A 1R3RA 5F7EH 4IRSA 3L3HB 4RL3A 3QXDA 1CC3A 4BI7A 4G8GA 3ZRFC 2J9ZA 4PB5A 5CEZE 1YJDH 3SDXE 1CGVA 3QDHA 4GUJA 1PDKA 3U9PH 2O72A 3FO9A 3UO1L 3ZE2E 3WK2A 1TEFA 1G9NL 2DZWA 2ZSVB 1YEYA 1UVQB 1KTNA 1HOEA 1WBXB 3HLAA 4V15A 1F1AA 1OAQH 4XXCA 3ZDYB 3H0TB 4YN5A 4ZSTA 2CBPA 3S5SA 3MACH 3U4KA 3VXOB 4HNCA 3APMA 1AGBB 3HE7D 1QOQA 3H2WA 1YEKH 3N6HA 3NGFA 1HF6A 3X12A 4PJ5E 4PTMA 1U95A 2XV2A 3RFZC 5TE6H 3HZYB 2D4FA 2PWHA 1W6TA 1ZAJA 3MJWA 5L8KB 2A1WH 4F0SA 4Q74A 4WJEA 4XCNB 2EBNA 5FX3A 1PG7L 2EACA 1IZCA 1LRNA 2GIXA 3BAIA 1YE4A 3O9WD 1VGKB 4QO1B 3EEGA 2CHDA 4QHPA 2EXYD 2D03L 1ZJBA 2WPBA 1GOIA 3UY7A 1ORSB 2B16A 1NCNA 1NDVA 3NJNA 2DDXA 1K8CA 1F6LL 5CPQA 4ZPTB 3E2VA 2OLAA 3CV7A 4LP5A 3PAVA 3IDIB 4WDTA 3OGRA 3H3BC 3G1FA 3LKNB 1I0DA 2VUNA 3S3BB 5FF3A 2GK0A 4JFEB 3WS3A 4AC7C 5TPWL 2DY2A 4WZHA 1R9ZA 4HIXL 4JCWA 3U6XS 1CDGA 2R27A 2PN5A 3PXLA 1KYOK 4XMLL 5ABAA 3NUKA 5I18H 1ECZA 4E2BA 2OV0A 1R8LA 4Q8VA 1EAPA 4ZRGA 5AHIA 3QVAA 1CFTA 3QJVB 4Q22A 3V3WA 1OG0A 3STCA 5LLIC 5D1XD 3TN0D 4LH8A 2YAPA 2BBFA 2QTVA 3RFZB 5F2LA 1TMLA 4V1DE 1GOFA 1AGCB 3C9NB 4AF0A 1WAPA 4Z76B 3VXRA 3A3WA 3HNSL 1EVTC 1S2AA 5IW1A 1CFSB 2R0KL 1LILA 4FE9A 3LRSA 4JHWH 4CNPA 4JRYB 4YX2H 2WXQA 3DMMC 2IG2H 1UYQA 5FYKL 1GL4B 1RK5A 2ED7A 3V0TA 5GIRA 2I57A 1K9DA 1UCWA 1OCWL 2A6KB 3US0A 3VE7A 3SDDC 4AVKA 2Q3XA 3BKCH 5A95A 4WR3A 3W1ZA 4HBKA 1U8LB 3LGDA 5BOZG 1BREA 2B39A 4FNLL 2PDFA 4HV8A 1NBZB 2OWWA 2BLEA 4KKAC 2QCDB 4C56B 4PR5A 5BMFH 3GJFB 4LDOB 5JW3L 5DELA 6XIMA 1NGZA 3NSDA 1NCAH 3M5ZA 1IC0A 3WEXA 3FSAA 2WLYA 4JO1L 1HDMA 5EO0A 3E6HB 1D9KD 1G0CA 4AC1X 5C07A 3TLLA 1HHKB 2BO0A 1XDJA 3DX7A 4QPEA 1FG2A 4UTJA 3F7YA 4OCXH 4IP4A 2FTPA 1KBGH 3A67L 4TV3A 3T65A 5I1AB 2WMIB 1GZQA 3OAYH 1V77A 2GJXB 2WBJD 4S3KA 4PWFA 1RZJC 2G3XA 1MH5B 4FCHA 1EEXA 5LXEA 4E68A 2IKHA 4TVPH 1T2XA 4L1WA 3QI9C 3SDDB 4JIPA 2WZ0A 4IQLA 4OF5A 3ME0A 4G9FB 1E3FA 2DSVA 2W9LA 4R96B 8RUCA 3G0SA 1ZK9A 3V9CA 4CGTA 4Z78B 4LWWA 2PWFA 1PSKH 3V6FB 3MCMA 3ATEA 5C7XL 4B6ZA 3Q9QA 1NELA 1CE1H 1TETH 1JHKL 1I6NA 1LMIA 3VOIA 4L1DA 3WAJA 4F24A 2C9PA 1C8YA 5C0JB 5HI3C 3BVWA 5B80A 4OZFB 1ZVNA 1H15B 1PS9A 3BW2A 1GPFA 1MREL 1M7IB 1EA0A 3L1GA 1GGCL 1P4LA 1FZMA 3QUXC 4TTDD 3HC0A 4BQ4A 1J48A 1KCUL 3K6SB 2OMUA 2VM4A 3U6RA 5HJ3A 1A3LH 1MDLA 2GQHA 4D6IA 1DJNA 4NKMA 4U10A 4MD4B 4W9CC 4H40A 3LZPA 3AAZB 4XPAH 3QI9B 2ZUYA 2HB0A 5I5RA 1WDWA 1RCYA 2XTJD 2BJMH 3EGXA 2VR8A 3AXLA 1G1CA 1UYWL 4WI0A 3IVTA 1X1OA 2O9PA 1RJLB 3OQ8A 4K3JL 3NQVA 4U2YA 4A6YH 4OGAD 1PMYA 3WJJC 1KFKA 3QBUA 2D2HA 2GUOA 2PS2A 3VFCA 4JX0A 3Q2LA 3DARA 2E5CA 3S36L 4ABWA 4AMWA 1SFLA 3GDRA 1MCIA 3KLDA 3RIKA 4M5YH 4ZYKA 4X7DC 1SZGA 1MFNA 4UM9A 4MNGE 2NY3B 3O3EB 4K1WA 5T33L 2QQNH 4P23C 3VA2C 3E80A 2WWOA 3VINA 4JTIA 2QPFA 4I2XE 1LWJA 2NR6D 5FUOL 1B4RA 1IFRA 3O2DA 4S2CA 4HMDA 2L7JA 2L7QA 3QUXB 5E23A 1P4BL 3DYOA 3N0PB 4NCDA 4AQLA 2P9RA 4NN7C 1I9EA 3T42A 3TNNA 3W6LA 1SJHA 2DEXX 1XVSA 3L4TA 4Z2KA 3N6QA 1IGTA 4G7VL 3GTFA 1NSNH 3HC3L 3IETB 2AABL 4IGBC 4OW6A 4TXEA 3PV7A 4K4KA 4NFDA 5AB0A 4A3QA 3UU0A 4F7CB 4OFPA 5TE4H 3FQWB 3HZMA 2VJ8A 5HUOA 2ZWSA 1RXOB 2QDGA 1YYCA 3AU2A 5BS0B 3APFA 2H1XA 1E70M 3LHVA 3IXTB 1X7QA 4ECLA 3CN0A 3RE0A 1RK1B 3OX8A 5DUBA 1QWNA 4DOHB 1YEFH 2F8IA 5HY9A 3IGUA 3QH3A 1QTYT 1XIJA 4N5ED 2Q8AL 2ZYRA 2WQRA 4K23H 4GCXA 4ZFOB 3UIZA 1AG0A 4A2MA 4XP5L 1YVLA 4UYPA 3F7RA 5E2VH 2R0LH 4K7YA 2CKNA 4P23B 4DKEL 3WMLA 5BOPA 3FONB 2H26A 3EFFB 2ADFL 1XSKA 4YSSA 4M3HA 4OZ4A 3W7HA 4EXAA 1AFSA 4JTJA 2XWEA 4NN7B 1NIDA 3TCEA 4NJAL 2HJKB 4LIQH 1XO8A 1KCWA 3VD2A 3GY1A 2C4FU 4NT6B 1N6VA 2OXGA 5DJZA 4XKMA 5C0EB 5JPNC 2N0KA 5I1DA 3R4IA 6REQA 4IGBB 4K5NA 4FXRA 1JGDA 4UR9A 4F3HA 3M86A 3OVQA 1T1ZB 3BVNA 3UAAA 1JNJA 3K2GA 2QPDB 3BAEH 4NQED 3A12A 2OMBA 2GYSA 3PL6C 3U9WA 1MCOH 4P49A 4RFEA 5ELIA 2XLLA 1V6VA 4XBJA 5D96C 2QFPA 5E2WL 3UZWA 1AH3A 4HPOL 1IGCL 4UTHA 5JIHA 4JS7A 3IWUA 5JXAL 1IEHA 1HW6A 4PEKA 3LN5B 4P46D 3WGUB 3NGBC 3BSHA 1YMME 1TTBA 4P5SA 4UR8A 5CJXC 2Z31A 3PZIA 1NCUA 12E8H 4ECNA 2WYZA 1NAMB 5REQA 2WSDA 2ZAHA 2X42A 3L2MA 4P5TD 3GZOA 4WRLA 1GONA 4IPLA 4OR1A 5DWUL 3S3PA 2VAAA 3MRDA 1E5JA 4IMKC 1NUGA 2PP7A 1CMOA 4Z8FL 3RNQA 4XOEA 4P57B 5C1MB 5MERA 3IJ8A 1HKVA 1UW9A 5F1NB 4C6IA 4G1KA 5JPNB 1SMDA 2EP6A 3NG5A 2WZEA 2Q1EA 2QGYA 1ICQA 4XN9A 2A21A 1GZPA 3N43B 2M2DA 4QT5A 4TQEH 4MA3B 2I85A 4YDNA 5DN1A 4RH4A 4DEUA 1E9OB 2DORA 2JJTA 4OLXL 1TA3B 3LEXA 3PL6B 4KNSA 4MB4A 3L3IA 5CC3A 3ZUNC 5IV2B 4KHXH 2PMQA 4L05A 3K7UA 4UDUA 2A6DA 5EHFA 4AD3A 1KFEA 3FUFA 2YLLA 3SOBL 2VGFA 5IW6B 4L4OA 3MRBA 1TR1A 1FA4A 1A7RL 1IAKA 5EA0L 4Z7WB 4TOYH 2DWDA 1L9NA 2NVDA 2J25A 5EBWA 1CGSL 1HFBA 3GSOB 3NGBB 1OD7A 2MOQA 5J6HB 1F4HA 1QO2A 2OYKA 1E8YA 1MZZA 2KBGA 4JTTA 3QC0A 4YWIA 1RZ8A 1JUFA 2H5UA 3V0VB 1BQHA 1WUFA 3HLKA 5EOCJ 4WCYH 3QCTL 3L3OC 4S3JA 1MJ8H 3IWVA 3NOIA 1CT8B 4M6QA 3TE9A 5EMYA 5C0DA 1KNOB 2PDNA 2J56A 2EIZA 4HLJA 4PG2C 3ES6A 3O2DL 3EF4A 4NPKA 4R5EA 4JY4B 4TRPH 3AG2B 1IE7C 3KRZA 1IRAY 3WFAA 1DXFA 4NG3A 4FA3A 2GSGB 5LWYL 3C6LD 4NCC2 4PTNA 5K9DA 3ERPA 3M0HA 2P24A 3II1A 4PJHB 5K59F 1EZWA 1N68A 3VIHA 4MFEA 2XN9E 3CIQA 4W93A 2E0PA 5C71A 1S5WA 5C0RL 3TV3H 4GI4A 4QP0A 2G9HA 3WIFB 2J8FA 4GBXC 1NC2A 1U33A 1BFVH 1OFEA 5LNSA 2VLRB 4YVUA 1KXTA 3GJFH 2AQNA 4OZHE 4R0LC 4PJAF 4XMVA 1XR8A 3LCYA 4JIHA 3CLWA 3CHRA 3VH8B 3VXUD 5EC1B 1LP9E 3REQB 2BWDA 1WXYA 4JKPH 3UCCA 4M7SA 2IXQA 3OGCB 1JGVH 4PTTA 4L1LA 1BZEA 1R3LA 2NYYC 3RPDA 4IBYA 1AJ7H 4K8EA 4LUSB 4Z7OB 2DDQL 5ESAB 2MTPA 1GGBH 2R8SL 4ZUUB 4EIZC 3FRPG 3PQYB 2VN3A 1NDMB 2GI0A 4NQVB 3S47A 3NQEA 1N4XH 1TTCA 2AAVA 3ZTJG 1QLEL 4X6EA 3QG6B 1HH9B 3KBHE 1FNSH 2IFFL 4AZCA 3KPOB 5HR7A 4QDMA 4U1IB 4ERSL 4F7PA 1UB5B 1FE8H 3KZPA 2LQRA 3T6QC 5FFLA 3BP7A 4ETQA 1RULH 2GVYA 4X3ZA 3NJLA 2C79A 4KCTA 4HIIA 3EGSB 3RHGA 3DIDA 3BLEA 5HVFB 5HYQB 3PJSA 3FUDA 3IPFA 2Q7YB 3C2RA 4QTIH 2LAGB 2KZHA 3MNZA 3NH7H 1OSYA 2BINA 1NIUA 4HEME 2PPEA 1HKLL 4GBXB 3AYSA 4WKZA 1ZE3C 1EZVX 5DJAB 1KUMA 1BZ8A 1WYJA 5LNWA 3VCLA 4PI2A 2HJLB 3KWWA 3VM5A 1RHCA 4AYFA 1XH0A 1BWLA 2PP8A 4OZFH 1GYVA 4LVNB 5AC7A 3SCMD 5FJTA 5CJNA 3QQ3B 2HT3C 5XINA 1C5DA 1IGWA 1MFVA 1SYVB 3BANA 2FIQA 2QPEB 4YJZL 1YNLH 4HAFA 1T21B 1T0NA 3SFWA 5ICYB 5BO1H 5AUMB 3UABA 2ZSWB 1QMLA 4M48H 4R97B 3NL6A 2W0UA 1IAMA 4BHUA 4J23A 1UWGL 5DRXA 3RVUD 1IJNA 4RWYL 4AE1A 3W71A 4K7PY 7CGTA 5H2BA 4MXWL 1T7VA 4DP1X 2BXVA 1WUZA 5C2XA 2EIMB 2QV4A 3MC5A 4NUJA 1XV8A 2KI6A 4AZBA 1WFNA 3FQTB 3CK0L 2F19L 5TJWK 1A6TB 3FB7B 4LU5H 2OJ1A 1DL7L 1X96A 4MFDA 2BOCA 1G7MB 5FYJU 2O6CA 3PBUA 3MRRB 3HE7C 4C83A 1VF8A 2H3KA 3FQNB 2ZCKH 4OCRH 3OHXA 1S9XB 3BMXA 2IJ0C 1IEAA 5KYWB 4XBPB 4XMKL 4U3XA 4S3BA 3G0UA 2HE8A 2WQSA 1FDYA 3MXVH 2HNEA 4C60A 3V5CA 3IDMA 3FU5A 3TC7A 1YPZB 1OFBA 2QUNA 1YLBB 3LSOB 4M5SA 3O9WC 2A9NL 3T1FA 2EXYC 3K6DA 1YZZA 4Z0BL 1JNLH 4C47A 5G2NA 2DUXA 3B9DA 5LXVA 1E6OL 7TAAA 3NO5A 2O30A 4JTKA 2OB3A 1GOQA 3RLHA 3C08H 4NZ1A 3SCNA 9RUBA 3ITTA 4F2FA 4D8PA 1BVNT 3GKZA 1VIZA 3QC6X 4P9HL 1TMQA 1LTXA 3GGWA 1VBRA 3SO7A 4WI7A 3RVTD 3UTQB 1UG9A 3BEVB 8XIAA 3SDAD 1PD0A 1FHNA 3S1WA 3VFMA 4S3EA 4QRRB 4ZPVA 5LA0A 4HKBA 2OL3A 4RLDA 1WHOA 1J96A 1JF6A 1X4ZA 1DHPA 4Q52A 1MJJA 1HO1A 4QYOA 4EPEC 4JGUA 1NFDA 1YRKA 4P48A 5F4XA 4YIQB 2JEQA 3EWUA 1LL1A 3GC4A 5EOTB 4GZJA 1J6PA 1RUKL 2IADB 3TN0C 3L45A 2Q2LA 4F1ZA 1W9XA 4TSAL 1MRAA 3UBXB 1QNVA 1DQKA 1HL8A 3JSSA 3S6TA 5C09D 4BF5A 1OAKH 3O9WB 4APXA 1WVZA 1R9FA 4G3YH 2PRMA 4KUZH 4W5UA 1XCXA 1QAPA 3VB8A 3TCXA 1QBML 4JYEA 3MMWA 2VR4A 3ZTCC 1N12A 3G04B 5GSRA 3G5XA 5IB3B 5DC4B 4L0PB 4DLFA 3DROA 5GGSB 2EEBA 1FF5A 4OZIE 2XIMA 2VC9A 5BXSA 3SADA 2NDFA 1K4GA 3APGA 4FXLA 5TE7H 4HG4K 2AL1A 4KKCD 1BKSA 2VR2A 1AG6A 1TSHA 5BRZA 1OP3H 2EE6A 3RZCD 1PTZA 3EIFA 4YVNA 3DI1A 5SWZD 3N55A 2CDEB 3HIJA 4UT6A 4BS0A 3VZXA 3CZSA 4D0DA 4NIKB 5FA3B 2OMTA 2IPWA 4F4RA 3I4EA 3TO4A 3DGBA 5KS9F 2CJUL 2W9DL 1S7XB 4KAQH 4OCYH 4DYKA 1T3FB 2G96A 2I07A 4XNUH 3K2KA 4MMYB 4G6AD 2Y2YA 4AD0A 3LIZA 4A8NA 1Y18B 1TVNA 3WFHA 3QRLA 3P40A 3URBA 1OB1A 4NO5A 4YQXH 4ZL1A 5HGDA 2PDBA 1MCWM 3MMTA 2AV7B 2O5YH 3RUBL 3PTMA 3QUKB 2WBJC 5C8JA 3NACL 3LH9A 1UOKA 4I3RH 3W1PA 2J8UA 2QPSA 2PYFB 1DIOA 1NAMH 5C08D 4GNVA 4FQ1L 1XGYH 4NNYB 4HSCX 4U1GB 2H2PD 1FNHA 2E9MA 5D9NA 1N2VA 1KSRA 1K4CB 2WW5A 4PY8J 5J57B 1FG9C 2YDSA 3B34A 4NUQA 1FWAC 3Q6GL 2HJFA 4BZ1H 2INZA 4GLRH 1GKPA 1IFHL 5D7KD 3U48A 1M01A 4R90L 1H6UA 4Z77A 4MHHI 4OV5A 5A94A 2KH2B 5B7EA 2CGYA 4PGBB 3THQA 4LNRB 3FRPB 4V33A 4Y4FA 4KO5A 1NPNA 3PXHA 2YKLH 1KJVA 4PRDA 3PN8A 3DN5A 4GKZB 5IVNA 3MCYA 5FCUH 4I3SL 1JPFB 5KYYA 1ZIAA 5D71L 4YHGA 3MV8D 4HWEH 1UC5A 4DF1A 4ZXBB 3DXAD 5CILL 3ZTNH 3QT2A 2GVLA 5C0GB 4Z1DA 3PAJA 3ZT6A 4GFIA 1AI1L 4PGEB 2PU0A 5I1CL 4R7OA 2BSRA 4W8BA 3H9SD 3OAUH 2YL8A 2WJDA 4U1NA 4Q14A 1D6EA 3SCVA 4KRPD 4ADIA 5HHVH 2XTJC 4LLWB 1UFUA 2MCMA 1EQWA 3O0LA 4MRCA 3P77B 5DJXA 4OV6F 4JTQA 4X6BB 1RBLA 4X99B 5GS0D 4KQNA 2AGJL 4MM1A 1KIRB 3SE9H 5BZXA 3HGOA 3GIYA 5KYUA 4MB5A 1A9BA 2VH5H 3D85B 4YSEA 4B3LA 4HXAH 2QSCH 4FTVB 4CCDA 4HZLA 4QDGA 3LZFH 4N6RA 4UINL 3VQ1C 1VFUA 4ML9A 1OTTD 4YE4H 1G94A 4IEFA 1U3NA 3IM1A 4ZOBA 2PW1A 4HCLA 1LROA 1XF5A 1NEZG 3NQBA 4L9LA 3PFMA 2NR6C 3MMUA 4B41A 2HFTA 2YFOA 3I6GB 1NWSA 3MNWB 2OL3L 4WF7A 3HU7A 4AQ1C 2OKOA 4HVXA 4J39A 1GG1A 3GIQA 4JZJA 2P8BA 1GVOA 3EPNA 1XGZA 4R4ND 4RE4A 5IB4A 3LEPA 1W2PA 4IUOA 3FT0A 2X6BA 5I15H 1BG4A 3P02A 2VR9A 1FNEB 2HUHA 4G80A 3C8KA 2XH2A 1Q6QA 4XN2A 5KETA 4YDMA 3BP6B 5J11B 3GU2A 1BVZA 1Z3GH 1LK2B 4X4YA 1FUYA 2AK4E 5C0AE 4ADTA 2DLEA 3MBWA 3WEBA 2IWKA 1D7KA 2CRIA 1IWBA 2EKGA 4N5EC 3F6LA 3BQUD 1S7SA 3HN5A 1D9EA 2MKLC 4Q0XH 3FTUA 2I60H 4AXNA 1SJAA 3FN0L 5AEAA 4M82A 4HD5A 2WO4A 4H88L 1IEXA 2YZ8A 1SZRA 4OFQA 4JFDA 5C97A 4H6RA 3VYPA 3DX5A 2ZE3A 2WINA 4ICMA 5I16A 1XSOA 1MRFH 2CR3A 3WJLC 3MRNA 2BDNH 2I69A 3OB0K 4WQ6A 5CD5C 3CD4A 4Z0SA 5A6IA 3FDGA 3ZQ9A 3LYEA 2ZRXA 1IEBA 2OI9C 4B9PA 4DHLA 4C91A 4G7YH 4H20H 2ARJQ 4JFHD 7XIMA 2QIWA 3O06A 3AXXA 4F0KA 1V27A 3LIZL 2QJNA 2Q6WA 1CCZA 3D0AA 1N70A 3H54A 1GMEA 1UD8A 2NXIA 2ON3A 1CDCA 1BRLA 3DV4B 1A6VH 4V1YA 4A7UA 2XYBA 4FTDA 3LVTA 2F53D 4EF3A 4ACZB 5ILTH 2YPKB 4Y2WA 1KRCC 4WIWA 2CFFA 1BAFH 4F20A 4JQVA 3NBNA 3V6OA 3GU1A 2H2SC 4AX6A 3NFSL 1Q0XL 4LEOA 3S96B 5DA4A 3QCVH 3HBPA 5I76A 4QIRA 5C6TL 4O4YH 5E1QA 3ABGA 1FCUA 4GJTB 3MA7B 4HSNA 4K7VA 4JTGA 5CP7A 5HNNA 1V10A 3ARDD 5I77A 1XIDA 3UPCA 4YZWA 4O10A 3I10A 3HNVH 1NFDF 2VB5A 2XXGA 5ICZB 3T4AA 2DZBA 3NQIA 1YEIH 3UPMA 3T0TA 2H45A 5AB2A 4L1TA 2XV3A 1MCNA 2GDVA 5KVEE 2EYRB 3A4JA 2QDVA 1FN4A 4N8CH 4S1FA 5ISZE 1HHJB 2PB1A 5E8NA 1EWDA 5C0IB 5EZJB 1J1OH 4KT2A 3O6FC 5F71A 1E71M 3H7RA 3W53A 4PB9H 3O8XD 2GUUA 2PZ0A 1X1NA 4Y1AB 1UP0A 1HJXA 1DBKH 2DQWA 1CS6A 2IAND 1E4XL 4FEMA 3UYRL 2CH8A 2FJHA 4JIQA 1KC7A 4H25B 5FM5M 4NQEB 3V16A 3DKJA 4N2AA 4IDLA 1BQLH 1TVPA 3VFWB 2Q3AA 1UJTA 4GKOA 4W4OA 5MENA 3CBJB 4EWND 2OSLA 3QUMB 2QCLA 4K7PL 2O1AA 3D2UA 3PANA 1OSEA 2WMJA 2PGRA 2WXJA 4WENB 3IAQA 1KBJA 1NA8A 4QRQA 5GJNA 2BIQA 5LNGA 1URZA 5E6SB 2E5BA 3KPRD 3W07A 1XZ0B 3XIMA 2VLKB 3IUHA 4HJWA 5EKYA 4KH2A 1XF4B 4KEZA 2B0MA 3U7WL 1EO7A 4WW2C 4ONFH 2YXMA 4I9JA 2Q76B 3EOLA 2JJUA 1MEHA 5ALBL 3KBMA 2CA4A 2Z8SA 5EF1A 4ZQOA 2R29A 4QXTA 3QJUB 3L3GB 3EUDA 5HWNA 3O6FB 4QHRA 1NZRA 1JMXA 2K7QA 3C6LC 4OVXA 3VXSE 5EWIL 4EANA 1RHHB 1BM7A 3IMTA 3ETBF 5F7AA 1MF2L 3VFVB 1PYMA 2E27H 4J6RL 2F6UA 1CJYA 4IIQB 3OTTA 4YAQA 4GWEA 2XJ7A 3MRKB 3O6YX 1DJQA 4KQ3H 1KPVA 1WZAA 1UCTA 1BWKA 3AQZA 1YEGH 3LD8C 4PWJA 1XSIA 4MAUH 3GMLB 3TMLA 1KBLA 4Q9QH 4HT1L 2HH0H 4F9PC 3QZ6A 4YHZL 4MBOA 3W7DA 1LWHA 3GSUB 4NQXB 2X1QA 4XVEA 1MPAL 4NBZB 1X5KA 5C9RA 4ONHA 4C6LA 3QJFA 4ICWA 2G8ZA 3VUPA 3O4LD 2ZXBA 4WW2B 1H3TA 4LGPB 1XWYA 2E9WA 4N0YL 3MBDA 4NHCH 3ABXA 2IKJA 5E2TL 2UZYB 4K07A 5JHDA 3LH2H 3VG0L 2YEZA 3IFPA 5KVGE 3EA1A 1B88A 3IRPX 4L2LA 2YCJA 1US0A 3GMNA 2NQ3A 3N85L 3C6LB 3MRLA 1VPQA 1AQ0A 3ITCA 1N6UA 5JOEA 2VENA 3DX8B 1H8NA 2LVCA 3Q8CA 3G5WA 1KYUA 1VHNA 4WWOA 2D2CC 1I9RH 1NWPA 3MP3A 1XLHA 4PRID 4RPQA 3YPIA 3M64A 1KM2A 3TEUA 3BDBA 1QVOA 3HRZB 2CCRA 3LD8B 5TDOA 1ZJIA 3FSOA 4PJBA 5AWNH 3WO4B 3IDXL 3UPRB 1HQRB 5D2VA 4ZTOL 5LHFA 3BT2H 2YCIX 5J9PB 2GQ3A 4JM2B 4R7DA 4MDPA 2P47B 2P76A 3T0EA 3WDRA 2ICEC 2VERA 4HK7A 3WL1A 5C0CD 2JKXA 5FACA 4YDVA 2XKSA 3SCMC 2EUVA 1NFAA 4JJ5B 1E8WA 4FXGA 3ZTJH 3W82A 4N7QA 3LHPH 4XR8C 3LV6A 2VR5A 4LEFA 1L2UA 4JPVH 5AFAA 1HKKA 3DI0A 4Q8BA 2AQWA 3BHBB 2UUDK 3B7YA 3RVUC 1J8VA 3GM8A 1JNHB 1NUFA 1CDYA 4DVRH 1MEIA 4WFHE 3C60A 4BEIA 1N67A 5HYJB 3NAVA 2CBIA 2PXYA 2H9AA 5LO7A 3RVVC