1G94A

Crystal structure analysis of the ternary complex between psychrophilic alpha amylase from pseudoalteromonas haloplanctis in complex with a hepta-saccharide and a tris molecule
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
total genus 158
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2000-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1g94A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1g94A01
1ISZA 3SCNA 3N15A 4AZ6A 3K4AA 2J79A 1DWAM 3APGA 1UG6A 2IXVA 1JL8A 2XGIA 3VPLA 3FXYA 4LQ1A 1GQLA 3SUTA 1HL9A 2WCSA 1UKSA 2YL9A 2W4XA 1IT0A 2WK2A 1E6NA 4MB4A 2WHLA 4JHOA 3VIFA 1MWOA 5E0FA 4MAVA 3HMCA 1HVXA 1TVNA 4D6HA 3VOCA 3MU7A 3TV8A 1KB3A 3THDA 1L0PA 2PWHA 1GJUA 5JBEA 3EDFA 4U3CA 2JF6A 2YLLA 2X0YA 4UFMA 4LXFA 2AMGA 3VD4A 3VVGA 2CESA 1OWQA 3GBEA 2BVYA 1QHZA 2DT2A 3T0AA 1HN1A 4IPLA 1BVZA 2G3JA 1GUVA 2W62A 2VZOA 1JXKA 3D5HA 3ZOAA 1UR0A 5BXTA 4CD8A 4FNRA 2WMFA 1W2PA 2Y5EA 4UNIA 4FLQA 4CGTA 4TTUA 2E40A 2VCBA 2VX5A 1HJXA 3ARSA 2ZUNA 1SFSA 1TQUA 3NDYA 4Z2KA 3VMOA 2EXOA 1J10A 2UY3A 3NCOA 1TQTA 1G0CA 1E73M 5AC5A 3WH8A 3HG3A 3UCQA 2GJXB 1Z32X 5LYRA 2J62A 2PBOA 2FH8A 3WD2A 3VIIA 2EPKX 1HKMA 3BUDA 3VM7A 5A6MA 3VMPA 4CD7A 3OLEA 2BVTA 4FLSA 5D8WA 1GHRA 4P7NA 2VX6A 4ZXOA 5CLWA 4TVUA 4C7GA 2X05A 1CXHA 2F7OA 3TTYA 1X6NA 2YLAA 1KQZA 3EMCA 4RE2A 3AZRA 3WQWA 1PZ2A 5CGMA 1UR4A 3HG2A 2W66A 3LRMA 1W1VA 2E8YA 3QR3A 5GQBA 1LQ0A 4QP0A 5I24A 1PZ3A 3BSHA 1VIWA 4QAWA 4W89A 3ARXA 1E15A 2A3BA 1B2YA 1CLVA 3GXPA 1V6VA 4DUWA 2D22A 3AXHA 3D50A 1HNYA 5A6BA 1WPCA 1H1NA 2J7CA 1PJ9A 3OGVA 5CSUA 3PTMA 1MQPA 3LPFA 3VTRA 2FGLA 2BVDA 4MNKA 3AROA 2CKSA 2V5CA 3VD9A 2WPGA 2ZWZA 1YQ2A 2XGBA 1WAWA 1KBKA 2YFNA 2BHZA 4KH2A 3UESA 5DT7A 4IISA 1R8LA 1E6PA 2O9PA 4D6FA 1M03A 2J77A 3IJ8A 4D1JA 3VSTA 1PAMA 1GOOA 3VDCA 4YPJA 2YA1A 2WWDA 2VVSA 2VMFA 1OGSA 2UY2A 3HJEA 7CGTA 1V6XA 1E0VA 1C90A 4HPHA 1QI0A 4QCFA 1WZKA 3AIVA 2WVSA 4U5KA 4QLJA 5GPRA 1IZKA 3N13A 3CUFA 5BXPA 3BUQA 3N1AA 2DT1A 4W87A 5A3HA 3BGAA 1VJSA 1M01A 2J78A 4UFHA 2EBNA 3RIKA 1HKJA 1BQCA 4GI6A 1EOKA 1PX4A 1H0IA 4AZ7A 3J7HA 4E8DA 8A3HA 1O6IA 1CYGA 2B31A 5EMYA 4CCCA 1VFFA 3IANA 5EB8A 4HP5A 4J3TA 3VD3A 4Z2GA 3K8LA 2JFEX 4CD6A 1UA3A 1HIZA 1W1TA 4TVDA 4ZEPA 3PZUA 4FLRA 5I77A 2VQTA 5EFDA 4BQ2A 2AOSA 2YBTA 2EADA 2ZUVA 3BUBA 4U33A 3CZGA 1B3ZA 1E0WA 6A3HA 1DHKA 4OIFA 1TZ7A 2F7RA 2FHBA 2VL4A 5A6KA 1J0HA 2Y24A 2ZUSA 2GK1B 5FD0A 3VX1A 2WCGA 3DYOA 4B3KA 1KWKA 1JG9A 1KTBA 4DUVA 2Z1SA 1V03A 1SMDA 4WKFA 4FNPA 1D3CA 1BHGA 3RO8A 4LPCA 2X1IA 2VRKA 3ZSTA 1UZ1A 1A47A 3PZNA 1P6WA 4CCDA 1UKPA 1UYQA 2XHYA 1BYDA 1UH2A 3GNRA 1WZAA 1QI4A 4UFIA 2VZSA 4U31A 3AXXA 1KGWA 4GPNA 4PMZA 1JNDA 2A3HA 4A4AA 1U33A 5LA1A 1E55A 3EJUA 4MADA 3RJXA 3E1F1 3WH7A 3OZOA 1JAKA 2X09A 4AEEA 4NRSA 1JZ8A 3WDPP 2G3IA 2EEXA 2IGTA 1J0IA 1OD8A 4OOUA 1EDTA 1LWJA 3CHFA 2J8GA 4NX0A 3TOPA 1FHDA 1DWGM 5BXRA 3KWXA 3ALFA 1CGYA 4LX4A 3CIVA 2ZXQA 4ZENA 4X0VA 3MMDA 4NRRA 2WMIB 4P7OA 3RM8A 1W91A 3SCVA 5E6ZA 1AVAA 5HPCA 4AD2A 2WZHA 1R87A 3CHEA 3QOKA 1XH2A 4MDOA 3LRLA 2WHKA 1KWGA 4AC1X 1Y7VA 3DDFA 4R5EA 3ECQA 3UR7A 1V3HA 1JF5A 2XVKA 4N0RA 2GUYA 1W9BM 4D71A 4AYGA 1E4MM 1W9XA 4DWSD 3K8KA 5JBFA 5HPOA 1TCMA 2UWFA 4JL2A 1G5AA 2PBGA 1VBUA 1AQ0A 3PN8A 1OGBA 5BCAA 3OIHA 1VEPA 3K4DA 3WH9A 4M1RA 3PZOA 3WUBA 3ARVA 2ZX6A 1E6QM 1J01A 1PPIA 3TONA 3JUGA 5AYBA 4AXNA 3AHZA 4F9JA 4HZ7A 1TA3B 1KCLA 3VM5A 2JIWA 4MNMA 1JYNA 1U2YA 2WLYA 3B9DA 4AEFA 3NUKA 1BPLB 5JUVA 3T0BA 2VURA 1J0ZA 3RPMA 2VRJA 3GNOA 4OBRA 4DWSA 1GHSA 4DO5A 1JZ3A 5DFAA 1ODZA 4R27A 5A6JA 1CGUA 4AD5A 3MSGA 1ZU8A 3S6TA 4QLKA 2J7FA 4GZEA 5AC4A 1W1PA 1UWIA 3AHTA 3ZSSA 3A4WA 3II1A 3EDDA 1G94A 1QWUA 4DO6A 3ZQ9A 2FE0A 1W3LA 2WVVB 4JFWA 3MSDA 3PBGA 1ZS2A 2F1AA 2QMJA 1UQYA 5FOOA 5E70A 3HZ3A 3SCQA 4OGZA 2OSYA 1CXFA 1WZMA 1R7AA 3O2LA 2D73A 2O9OA 4GZIA 3A3HA 1W9PA 1QHOA 4UOZA 3VIPA 1E3ZA 3WH5A 1MW2A 1DWIM 2D24A 1FHLA 3DX1A 2XN0A 3W28A 4KWUA 3ZO9A 3PZMA 2WVUA 3BUIA 2WYSA 4U3AA 5A2BA 1BYCA 3WDRA 4EAMA 1PIFA 5ABGA 1PX3A 1BF2A 4PTMA 1KCKA 1C93A 1GW1A 3WF1A 5CJ5A 2VJXA 3BVUA 1VB9A 1QVBA 5E9AA 3CZNA 2D0GA 3WD4A 1GONA 1H11A 1HP5A 2EPMX 2EQDA 2VTFA 1HT6A 5I5RA 1GPFA 5E0CA 4FNUA 1UD5A 1XSJA 1GQJA 2CNCA 4QDMA 1CXLA 1TE1A 4H8VA 1EXPA 2BV9A 3EJSA 1F4HA 4PEEA 3A6OA 1GQKA 2X8RA 3PZGA 2OWCA 3VIHA 1CNVA 3S2CA 4L4OA 2G4FA 2ZX9A 1V3LA 3FNDA 1WP6A 1T0OA 2WNWA 3U5YA 4WK9A 1GNXA 2YA0A 2OW6A 2FHCA 1KTCA 3L4VA 1GCYA 4ACYA 5CQ1A 3RM4A 1B3YA 4NZFA 4AWEA 4GO9A 4GXPA 1Q6FA 1E4IA 1E56A 2YL8A 2GJRA 5HXMA 2F1BA 3GTNA 5FCZA 4ATDA 3FHAA 2J7HA 4UQBA 2D20A 2WSKA 3UG4A 1GVIA 1RP9A 1NP2A 4W5UA 1HX0A 2E9MA 3AHXA 1G01A 3T2PA 1UR8A 1E3XA 1UD4A 4HOWA 3CZSA 4M81A 1UWUA 3EMQA 4AZGA 3AZSA 2EJ1A 4AIUA 1MW1A 2WZEA 1GORA 1HWWA 1UZ4A 4Z2HA 2OYKA 1JGIA 3I3BA 2ZUUA 1ITXA 3D52A 4FNQA 4J7RA 1H4PA 1FFQA 3CZLA 1UWSA 4F79A 3UR8A 2OYLA 3VIGA 1BLIA 5KEZA 2V3GA 3WKZA 4HA4A 1EDQA 4F66A 3AIWA 3AZTA 4Q7NA 4KRTA 4MB1A 4HMDA 3WY4A 4JCMA 3VGDA 3GDBA 2VX7A 3A4XA 4CU7A 5I79A 3SCSA 3W4RA 1UWRA 4DUXA 3OLDA 1R46A 1E6RA 5A6SA 4W7VA 3LX9A 3QHMA 4ZE5A 2WVTA 2AAAA 1QNOA 2XVNA 2WSPA 3B9AA 2Z1KA 2PWFA 1KR1A 3CPUA 4OZOA 4CN6A 3IAPA 2YA2A 5ECUA 2BY3A 1EA9C 4OOZA 5D9NA 3ZMRA 3OZPA 2GDVA 3G6MA 4H7VA 2TAAA 1IV8A 3AS1A 4TXEA 1ISYA 3ARPA 1B0IA 3S5ZA 3F5KA 3NIYA 3CZ8A 1WZLA 4NF7A 3MUZ1 3U57A 2XTKA 3GH7A 4UR9A 1CGVA 3WENA 4YN5A 4B16A 1VAHA 5CG0A 3BVXA 4GQRA 4CD4A 1NP0A 1QW9A 3FAWA 2OLHA 3VUPA 1WDSA 1CECA 4BCEA 3WUEA 4NXKA 2J7EA 1BGAA 1WDQA 2ZXAA 1E4LA 4ML4A 1JZ2A 1XH1A 1R47A 3IK2A 3AIQA 5JIWA 3GZAA 4J3SA 4Q22A 3A5VA 1SMAA 3D3AA 1XD0A 1BFNA 1UR9A 1CENA 1BGGA 5D9OA 3T09A 2WKLA 3KLLA 4KRUA 4S3JA 3AYRA 3RCNA 7A3HA 1CTNA 1B3XA 2ZOXA 3UG5A 1DP0A 3SURA 3AHVA 1ISWA 4CU6A 1UOKA 5M17A 2QLYA 2WC4A 2VZUA 1UR1A 4P8XA 4P8WA 1E6ZA 5EBAA 1MW3A 4M80A 2PB1A 3POCA 4AD0A 2EACA 1PBGA 4ZFMA 3T2QA 3EBVA 1HTYA 4LYQA 2DSUA 4EKJA 3WNMA 4PUEA 2E0PA 1V3IA 2XSAA 2CPUA 2PF0A 3SCTA 3AS2A 1I1XA 1G1YA 1KXTA 3KE0A 4PRWA 4P7QA 3WUFA 3W24A 5D9PA 2UY5A 3M07A 2VX4A 5DO8A 4W84A 1QNSA 3F4VA 4B3LA 4OUEA 1J0YA 4AYSA 1QNRA 1JXJA 5BRQA 2XN1A 3BAJA 1ESWA 3SCOA 3O9NA 2J25A 4D6GA 2J7GA 1K9DA 1V0LA 2C0HA 3AYSA 3SUVA 1LG1A 4D6JA 3DYPA 3W26A 1Q6GA 5AYIA 4Z2JA 4WIWA 1CXKA 3GH4A 4HMEA 1ZJAA 2ZUTA 5A6AA 1ECEA 1J12A 2WMHA 4GO8A 1EHNA 4IM4A 3RDKA 2BNJA 1V6WA 1H0GA 3HN3A 2DQXA 3VSUA 1GOQA 3HU7A 2CXGA 3WMSA 4PCSA 3PTQA 3FAXA 2XVPA 1UH4A 1NWRA 4PTXA 1ZBCA 1KQYA 3N17A 4AZBA 1PEZA 3MKKA 4QFUA 2G8ZA 4JHZA 2Y4SA 4DWSC 1JAEA 3M7SA 1JD7A 4B9YA 3WDHA 1TUXA 1UH3A 3VU2A 2XM1A 1SYTA 4PMUA 3K1DA 4CD5A 1WKYA 1HF6A 3S5YA 1JZ5A 1RP8A 3WFZA 4AZ5A 3ZR6A 1KBBA 4URIA 4B15A 3D4YA 3EJQA 4OJYA 5BROA 1HL8A 3ZT5A 3WF0A 4CN4A 1KXHA 3CHDA 1BYBA 2OSXA 3POHA 3WUGA 4JFUA 1VJZA 1JZ4A 2WXDM 4XZWA 2W91A 3CUHA 1QPKA 2CITA 3LMYA 1JI2A 4AD3A 2DIEA 3PZIA 2WB5A 3EJPA 4MB5A 2QPUA 3WY3A 3U7VA 1LJYA 4U2ZA 4GIAA 4U5IA 4FMVA 1NOUA 4CCEA 1JI1A 4AMWA 1TR1A 1TG7A 3N04A 3U7BA 4D6IA 1MVYA 1DTUA 1A3HA 1H5VA 3N12A 3RJYA 1EO7A 3TTQA 3ZJ6A 3MMUA 5JBDA 4CKQA 1LLOA 1UHVA 4PMYA 3WY1A 4A3YA 1J9YA 3VMNA 1GQIA 3A23A 3MANA 2OWXA 2YL5A 4XZBA 3KL3A 1W3HA 4HA1A 2JE8A 3NDZA 3WF3A 4K68A 2ZWYA 4AMXA 3OA5A 1KXVA 3MUAA 4UTFA 2J47A 1X1NA 5A8OA 4H41A 1C7SA 1TQSA 4WLCA 4YHGA 1I75A 3VO0A 2XVLA 3ZR5A 2BXYA 3SCWA 4JFSA 2XUCA 2QV4A 3VGGA 4TX6A 1UA7A 3ARWA 4UQCA 1HKIA 4RE3A 3KL5A 4HU0A 1UUQA 3L4YA 1TMQA 1UKQA 1JF6A 4W7WA 5A8PA 3WL0A 4J3WA 1NARA 4OKDA 4GQQA 1K9EA 4AIEA 3UETA 3ZJKA 3N18A 2JF7A 4TVCA 1C8YA 2CBJA 3CZKA 4MNJA 4DWSB 4AMCA 2V3DA 1FH9A 1H09A 2DDXA 4WJXA 3WIJA 2F61A 1I1WA 5D8ZA 5A69A 1KFWA 4HOZA 3K8MA 3WMBA 3FN9A 3CBWA 2WWCA 4HZ6A 4WSKA 2PI6A 5HBFA 4FF5A 2QHAA 4TOQA 2X0HA 2F2HA 3D4ZA 3AJ7A 5F7UA 4C7FA 1QWNA 1NH6A 5BYWA 3A4AA 2X2YA 1ODUA 3WD0A 4GI9A 4JFTA 3CMJA 3ARZA 3AIBA 3OG2A 3GXIA 1DWFM 5FL1A 1B30A 2DIJA 2XFYA 3W6LA 1US3A 4PUDA 1EQCA 4ZXLA 4UFLA 3WNOA 2VRQA 2XG9A 1UASA 4BA0A 3IGUA 2ZICA 1QNPA 3QOMA 2EO7A 3LXBA 5M03A 2CIPA 3WH6A 4UZSA 5A95A 1E5NA 2Y2WA 2ZX7A 2NT1A 3T08A 4H2CA 4GI8A 2RGMA 4KGLA 3WFLA 1CXIA 1E9LA 4L4PA 3MUIA 1E4NA 3OLGA 2XIIA 2JALA 1ZBWA 1EDGA 1KXQA 2DSVA 1LG2A 2VC9A 3VDAA 3IJ7A 2CERA 4JCLA 3WQ4A 3BUPA 1BG9A 4UQDA 3WQ5A 1UWQA 4PMVA 3ALGA 5IDIA 4PCTA 5CXPA 3CZJA 5ABEA 3WF2A 3CV5A 1JDCA 5DEZA 3VIMA 1VFOA 1D7FA 1MFUA 3WF4A 4AZIA 1GOWA 1VFMA 4KGJA 4X0NA 5C71A 4BQ3A 5IHRA 1UKOA 1ZJBA 3MV11 2V3FA 3L4WA 3SCUA 4AZCA 1VFUA 2C8NA 1NOWA 4NXSA 2W5FA 4BQ4A 4CN1A 1EGZA 3BAWA 2EPNA 1BSIA 1G9HA 1W3JA 3AICA 5IFTA 1HJQA 3FW6A 3GBDA 2D3LA 5C70A 3VGHA 1M04A 4PMQA 2WCAA 5GNYA 1UD8A 1XCWA 5GNXA 2BY2A 4UCFA 3VGFA 4XB3A 3BLKA 3HG5A 3QHNA 2WHMA 2IUZA 2VNCA 1OM0A 3QHOA 1D2KA 4M29A 1NQ6A 5FL0A 1V6YA 1GVYA 4UOQA 4BZYA 2XIBA 3ZT6A 1MW0A 2WKGA 1CIUA 5EFFA 1JYXA 3WELA 2XSBA 1EQPA 1W1YA 5ABHA 2WMKA 3OGSA 1X6LA 4UZUA 4HTYA 1V02A 1DWJM 2PWEA 1FH8A 3GXNA 3BSGA 1PIGA 1AMYA 1E0XA 4MTVA 4W86A 3RM9A 5A1AA 6TAAA 4MJ2A 3MI6A 3VNZA 1ZL1A 4IPNB 3AFBA 2CHOA 5A2CA 3BVWA 1UKTA 3WDJA 2VCCA 2NSXA 4CVUA 3LPPA 1VF8A 4RL3A 2BHUA 3THCA 1JDAA 2WANA 5BXSA 2DSWA 2W61A 3VILA 1CDGA 3N9KA 2F7QA 2DSKA 2Y8VA 3MMWA 3EDKA 3FHQA 4E8CA 3EJRA 4PMNA 3KZSA 1MXGA 3VKKA 4D72A 2VUYA 1C92A 3B9EA 2C7FA 4J27A 1NWTA 2IXUA 2VO5A 4UOJA 4ACZA 1C91A 1XSIA 2QPSA 3EJTA 4B9ZA 2EPOA 3CMGA 1W9UA 5KZ6A 4CVWA 2DH2A 1ZB5A 3AMCA 3WN6A 3VD5A 4XUYA 3SEPA 1UD6A 2D2OA 5ABFA 3VGBA 2GVYA 2UY4A 3ARUA 1AQMA 1WCGA 3KEHA 3SIMA 4Z2LA 2CBVA 3T0DA 4UFKA 2E9LA 4HA3A 1E1EA 4ATLA 2OWWA 2FDMA 1FOBA 4J3VA 5TD4A 1QNQA 1MFVA 1K9FA 3CC1A 1B1YA 2YKKA 4EK7A 1JIBA 1K9TA 3MS8A 1UQZA 4D1IA 4JL1A 1H41A 1V6UA 4JKLA 4Y7EA 4DM1A 1PS3A 4NZJA 1C7TA 1QBAA 1SR0A 5A94A 5IXEA 1WNOA 3WMCA 2GJPA 1EIBA 1CEOA 5A8NA 2D0FA 4MNLA 1HVQA 1OIMA 1GOMA 3WD3A 2OYMA 3WNNA 3WDIA 3L4XA 1JZ6A 1J0KA 1SZNA 3BMWA 2WLZA 2EABA 3NJ3A 3WBAA 8CGTA 1NWSA 5FIPA 4F8XA 3BVTA 2VCAA 1CLXA 1VENA 2RGLA 4BF7A 2XWEA 2O9RA 1PX8A 2E8ZA 2YFOA 4JAWA 4J3XA 3A47A 3EDEA 2Q8XA 3KL0A 4LGXA 5CPTA 3EYPA 3W25A 2BXZA 1CXEA 1GJWA 2W67A 5A8QA 5M3WA 2A3CA 2W63A 1QI3A 4KMQA 1WB0A 3G6LA 3W82A 3L4TA 2YL6A 2CETA 3DX3A 4W5ZA 2YJQA 4TTGA 1V3JA 1Q6CA 2JEPA 3AIEA 3GXDA 1V3MA 2VR5A 2VVNA 1OCQA 1XGZA 4M56A 1LF1A 2VI0A 1CGWA 5HNNA 3AMKA 1QBBA 2VZVA 3BVVA 5A6BD 2X2IA 2D0HA 1HJWA 4MAZA 4HOXA 1QI2A 1E6SM 3BXWA 4PN2A 1ZBKA 2WM0A 1V0MA 3I3EA 2BY1A 2PC8A 1HJVA 1OSEA 1B3VA 3CGTA 3GNPA 4IUGA 2X2JA 3WEZA 3VGEA 4JZ5A 1OGGA 5A6LA 3AS0A 5M5DA 4LYRA 5A8MA 1ITCA 1US2A 3PZTA 1F4AA 3WQ8A 2GJXA 2XM2A 2WMGA 1XH0A 1UD2A 1EHAA 5CLTA 2XFFA 2V5DA 3AS3A 1RPKA 1CBGA 1B9ZA 3WDQA 1ZBVA 5LA0A 5CSYA 3SCRA 2ZXDA 2ZX8A 2DEPA 2WAGA 3WQ6A 4MB3A 3WBEA 2E3ZA 3PTKA 3DYMA 3RILA 4XX6A 4HZ8A 1TFVA 4PTWA 5I0DA 3VD7A 1W32A 3H54A 4H04A 5CGTA 4AISA 1JNEA 3DC0A 1GOKA 4M82A 2PWDA 2XN2A 3BCDA 2CHNA 3WD1A 3MUY1 2O92A 2JIEA 1UD3A 2ZXBA 2WHJA 1R75A 5CZKA 3BH4A 4N42A 3AHYA 3WQVA 3CTTA 2V38A 2WMJA 1AQHA 4BQ5A 3DHPA 1TQVA 1NOFA 2VZTA 3K46A 2ZE0A 1VBRA 4YHEA 2A3EA 2GFTA 3ARYA 4NSBA 1JZ7A 3LRKA 4S3KA 4JFVA 2J75A 1R33A 3GXTA 3L2LA 1QI5A 2VR4A 1XV8A 3B8SA 2CCRA 3BAYA 1IZJA 3W6MA 3WSUA 3LPOA 1R85A 1XC6A 4MDPA 3WNKA 1FA2A 6CGTA 5LA2A 2FH6A 3DX2A 2A3AA 4M24A 3AISA 3VSVA 3BCFA 1XHGA 3BC9A 2XJ7A 3SCPA 3MV01 4V27A 4D6EA 3VNYA 1OD0A 2D3NA 4W88A 1E72M 1BG4A 5DT5A 1V3KA 4H8UA 1DEDA 5HOSA 2CBIA 4ZE4A 5BWFA 4W7UA 3LXCA 3T2OA 1RD6A 3WNPA 3D51A 5CPQA 3AXIA 2ZIDA 4CUCA 3W38A 5E09A 3GM8A 4FNTA 4PMDA 1XRVA 2YDSA 3F5JA 5FKYA 1QW8A 2XYLA 2OW7A 1FP9A 3ZJ8A 1HJSA 4LYPA 3QGVA 4PYSA 3AMGA 2ESCA 4QLLA 1C8QA 1O7DC 2VOTA 1HXKA 2WBGA 5DMYA 1OT1A 2W92A 3F5LA 4W8LA 2WW5A 4W93A 5AY7A 1C3FA 1FH7A 3SUUA 3BLBA 4JIEA 3VDBA 3OB8A 2CKRA 4FLOA 2D1ZA 3TTSA 1E70M 1CWYA 1W3KA 4JKKA 1JDDA 1UWTA 3IAQA 3WY2A 2NW0A 4F9DA 2DPEA 2BY0A 4UQAA 3ZM8A 1OIFA 2GK1A 3W37A 5DF0A 2E9BA 2VT0A 1BYAA 3BLPX 4P7RA 1V0KA 1XYFA 3AMLA 3CO4A 3GYCA 4P8VA 2XVGA 4RE4A 3PZQA 1B31A 2FYVA 1M7XA 4V28A 2DSZA 1LWHA 2O9TA 2VQUA 3ARQA 1QHPA 3BAXA 2OSWA 1CZ1A 1V08A 5E6YA 3NYDA 3ARRA 1LL7A 2BFGA 3PZ9A 2WC3A 2DGAA 1W9VA 1H3GA 1VEMA 2XFRA 4NZCA 1J0JA 2F18A 1HXJA 2CEQA 5D4YA 4JKMA 3BMVA 4P8UA 4WKHA 4PSPA 1UR2A 3W53A 2NT0A 4QCEA 1KGXA 4EE9A 2G3MA 1FP8A 1L8NA 4D6CA 3AMDA 4E2OA 2J8FA 4FNSA 3VIJA 4W8BA 2CBUA 1LL4A 4CU8A 3W81A 1Q6EA 1V02E 1HJUA 3ZT7A 1BTCA 1XYZA 3H55A 3CUIA 4Z2IA 2WMIA 4AIOA 3FY1A 3NSMA 3H53A 4PBGA 1JFHA 2ALWA 5I2UA 1VRXA 1E5JA 1WDPA 1CGTA 1E43A 3CUJA 3KLKA 1VEOA 3WL1A 3WEOA 1QX1A 2GDUA 4GINA 4MJ4A 1ISXA 2G3NA 3BAIA 4AZHA 7TAAA 3WNLA 3TP4A 1WO2A 1M53A 4J28A 3AI0A 2MANA 1DWHM 2YIHA 4J3UA 2QF8A 5CPSA 1BAGA 4MPKA 5JIPA 1S46A 1JFXA 1KR0A 1WE5A 3ZIZA 1JD9A 4U2YA 3AQUA 3ARTA 1O7AA 4W8AA 3BAKA 4E4PA 2X2HA 4TUFA 4UFJA 3VX0A 1J11A 1OBAA 1MQRA 3I3DA 1B3WA 1LL6A 1CPUA 1R7OA 4AZCB 3CHCA 1BVNP 5BRPA 3M46A 1TA3A 3L2MA 3W27A 3CH9A 3W0KA 1RH9A 4W85A 3VDHA 4AW7A 3HG4A 4DM2A 1B90A 2J4GA 4HPGA 4PMOA 4HU8A 3SUSA 1E6XM 2ZUMA 2XWDA 2YOCA 2E4TA 4DO4A 1ISVA 1MQQA 2QMKA 1N82A 1EOMA 5IHSA 1XSKA 4WF7A 2ZUWA 1H2JA 2HISA 2EAEA 4EANA 3AOFA 4X9YA 3GXFA 1KGUA 5GNZA 3EMZA 3RMEA 5C8BB 2WZIA 5A2AA 1W2VA 1EO5A 2V3EA 3VINA 1MXDA 2WVVA 1QOXA 1WDRA 5E1QA 2YDQA 1CGXA 2D23A 3DECA 1U30A 3A21A 2FGZA 3TTOA 4AD4A 1C8XA 1JYVA 3TA9A 4V2XA 3VIKA 3AIRA 3SUWA 1E40A 3L4ZA 3LXAA 1NWUA 2WC7A 4NI3A 1J18A 2BS9A 2WBKA 1Q6DA 3UEQA 4UQEA 2YBUA 4M8UA 3W29A 1TVPA 1OINA 1MYRA 4C7DA 1TQWA 2DT3A 2EPLX 1EH9A 1FFRA 3GH5A 2HVMA 3CLWA 4AY1A 5I6SA 5I3DA 3A22A 3DHUA 2YDRA 4WSJA 2FHFA 3N11A 4PSRA 5I78A 1Q4NX 1XCXA 3NSXA 3CUGA 2ZX5A 4WKAA 1R34A 4OBSA 3IJ9A 2G41A 3M6DA 2DT0A 2J7BA 3DX4A 1E1FA 4ACZB 4GZJA 2BHYA 1HP4A 2CYGA 4PTVA 2F7PA 3AIUA 4FK9A 2F8QA 1GOIA 4PMXA 3GXMA 3O6AA 3OGRA 3EDJA 5IFPA 3CZEA 4ATWA 2J7DA 1NM9A 9CGTA 4D6DA 3ZJ7A 1R86A 1HKKA 3L4UA 4TX8A 5ABFB 1E71M 2GSJA 2DH3A 1OB0A 3PZVA 5D9MA 1GZJA 4AD1A 3OBAA 3WEMA 3PHAA 4XV0A 3UG3A 2J74A 4P7LA 3DDGA 3VIOA 1V0NA 1W9DM 4H8HA 2JEQA 4GKLA 5I23A 2Y8KA 4UQ9A 3LPGA 1XD1A 3U5UA 2PWGA 1H49A 3A24A 3UERA 1JYWA 4HMCA 5HDRA 1K6AA 3MO4A 3OLIA 4BS0A 1YHTA 4PMRA 1OT2A 4A3HA 3DX0A 2XPKA 3NSNA
chains in the Genus database with same CATH superfamily
4XHQA 4BFEA 4DGUA 2J79A 2QCEA 4Q14A 1EJOH 4HUVB 1QNZH 4JFEA 1H1YA 1EANA 4LQ1A 3C3UA 5GJMA 2WCSA 2JQAA 2FX7L 1TYJA 2Y5TA 3RLSA 1M7IA 1E6NA 1CICD 3MRMA 3FN0H 2G75A 3GFZA 1EPVA 1IKNC 3DLQR 1E9QB 4TLTA 1UUMA 3VD4A 4JLRA 3SGUA 1IE5A 4NRZB 1IEAA 5E5MA 2W62A 1GUVA 5BPPA 4YHKL 3TH6A 4IDLA 2DQMA 3Q43A 3LGGA 4L2YA 1FYTD 1V7ML 4P3CH 4BIKA 1UWGH 2I16A 1V93A 3REWA 4ACTA 4Y1AE 3LCYA 1OX5A 2CIIA 3T71A 3NGFA 3O8XB 4N2EA 2QDDA 5AAMA 3BG9A 2X9WA 3QDJE 3W1QA 3CVHL 4G43B 2C3VB 2C1PB 4TVUA 5DRNA 3PM6A 2F7OA 1Z3GL 5JOPE 2EYRA 5I6MA 4MWAC 1H6EA 2ZOUA 3GI8L 3QIWB 2R2BB 1QSFE 1NQKA 2C1IA 2BC4B 2B7OA 4DJFC 1HNYA 1BWLA 1QASA 1WPCA 3VCNA 5EU6D 2YB1A 3RX7A 4X6CA 4H8QA 3T55A 5I0ZA 4GSDH 4G1MA 4PV8B 4MAYD 4YK4B 4RGNB 2V5CA 3FT1A 1TB3A 1WQVT 4GCAA 1R8LA 5C6PB 3RCYA 2FLBT 2NZ9D 4HZAA 4HS8L 1HZKA 3GMQB 1YXCA 1QFWH 3QTPA 1P6AB 2ZRXA 1ZY9A 4JFFB 2VMFA 5AVNA 1SEQH 4JGNA 1L6XA 5F1IA 1E9OB 1V6XA 4D0BB 4AZ8B 3LCIA 3FB5A 4OVVA 4W9FC 3N13A 1J9SA 1GTHA 3LSOA 4QNPF 2DT1A 3U6RB 2R27A 4Z7UF 3UWYA 2DEWX 1GYWA 3IANA 2P47B 2DDQH 2B7QA 3G6JF 4DPQA 5K4XA 5GIRB 1KM0A 4FLRA 5HYSG 3S35H 3G77A 3BSZA 4K5MA 3BUBA 1UUOA 4JIIX 3ANYA 3DPBB 4NP4H 2WKOF 1DHKA 1XGPA 3RKDC 5D71H 4N20A 2PD9A 2ZUSA 5B1JA 5K3VA 4LVGA 4AKQA 2A9MH 1XF4A 2F5AL 2C1OA 1SMDA 1KFAL 2K3TA 3OKOA 4PJHE 4IBSA 1BYDA 4B5TA 1F13A 5BWAA 1P4CA 4MWAA 1LE9B 1G7JA 3MMEA 2BWIA 3UXIA 4U1LB 4AV0A 3WH7A 1ALDA 1XTMA 3WDPP 2EEXA 2J88L 3OKLA 4X6EB 2APSA 1QUPA 2WSQA 4L1BA 1QTWA 1NIDA 4MJIE 3CIVA 2ZXQA 3FUHA 2CHWA 3BD3A 4GSDL 3V5DB 5DJ6B 4MX7B 4UUIA 4J6RL 1XH2A 3QNZB 1QRKA 5I5JA 3GPEA 3X3FL 2HPTA 4HCDA 3T4YB 2XVKA 4EXBA 2GUYA 3WTUA 1BJMA 4J3OC 1BGXL 1N6QH 2PBGA 3B97A 1L2QA 4LT9A 2KMWA 1OF8A 1VEPA 4D3CL 3WH9A 5DZNA 4HKZB 1C1EH 3RRQA 1FWWA 4QS5A 2CC0A 4KTGA 4XVEA 3WKQA 1TA3B 1TZAA 4L8SB 5FYLD 4XE5B 3T0BA 5M1TA 1FG9C 2NUPA 4XB7A 3FGCA 3O63A 3NL6A 1I8KA 4PJ8A 3QNYA 3VWKA 5FHBL 1QEWB 2V2WA 4CNIA 3HE6B 1KCRH 3UBPC 2BNQA 4YDLC 3SDDB 1E5YA 4P2RD 2IKHA 1OTUC 3AHTA 4PJDF 4QD2E 2SEBB 3HJZA 4IDJL 1J8HA 4XNQB 2MNJB 3CNKA 3T6VA 3S1GA 4EMZA 3HZ3A 4HWBL 4UWQB 4Q4OA 2NX5A 4UOZA 5AL0A 5BRZD 1FHLA 5F6HI 4FQXD 3PDOB 1Q3NA 1BVKA 3MBWB 2E7HA 5ABGA 1FZJA 1KBPA 5DWUH 3Q6GL 4YIQB 4JFOB 1IL1B 5F9OL 4LLDA 2JK5A 1J87A 3DX8A 5DQ9B 4KBPA 3A9IA 5BXFA 3L5XL 2XKSA 3OQ3B 4NJAL 5LIXX 5H35B 2K6YA 1Z48A 2JKTM 3QJZA 1Q9KA 3B2DC 1T0OA 1VRSA 3N6YA 3OZLA 1JK9B 5KAQF 4MXWL 2C15A 1B3YA 2YZRA 3HGSA 1DE4B 2JQZA 2ZTBA 4E5XA 2J7HA 3A4JA 3MTRA 3EZ8A 2C79A 1ZSDA 3BOXA 4XXCA 3LLXA 2PDFA 4IOIA 2QEZA 3ISWA 1D7BA 3U7AA 3HPLB 2ZUUA 2CUHA 1ITXA 2D31B 3CZLA 1HCYA 3EGSB 2XJKA 2V3GA 3AXLA 3ULVF 3LTSA 1OAKH 4B41A 4M0XA 4LBEB 5ESVB 3MLTA 3RWHA 3H9YA 1R0AH 1HWGB 1P0KA 1T7WA 1E2VA 1PDZA 1E6RA 4KKNA 5A6SA 3F00A 2BX7A 5KZDA 2ICWB 3B9AA 4NIKB 1DLHA 5EZIL 3ME0B 3BVDB 2Y1AA 3ZE2B 4AJWA 4G1EB 4ZUTB 1HHHB 2W8CA 5D4IA 4FZEH 4U0RB 4C6OA 1WZLA 3GDLA 5ID0A 3VI3E 3N42F 4ZMLA 4ETQB 3IV3A 1ECYA 1ZV5A 4FEMA 4QF1A 5B3JF 5DXXA 2ED6A 4ODHH 4ABUA 3FQXA 2VLRD 4H9XA 2D2HA 4IIBA 2A77L 1XH1A 3D8MA 4KTYA 1KLUB 4N3TA 4NM8H 4X4XB 3T09A 3GKFA 3Q5OA 3Q06A 4UILH 4JYFA 3UTZB 4E9TA 2CZVA 3VE0A 1ZLSH 2Y9RT 4JFQB 4WCYH 4L5ZA 3PWVB 3EX3A 1UR1A 4IQEA 1FBAA 4GXUN 1L9OA 3TTEA 2VWTA 4GQGA 2PNDA 1KNOB 4PUEA 2BFVH 4CQDA 4NT6A 5SWZD 3R8GA 1TVBA 1I1XA 4BH8B 3WMQA 4YWGH 1KB5L 3AY2A 1DBJL 3FDKA 3KWSA 4KQNA 5AOUA 3H7LA 1S7SA 2XN1A 3SCOA 4IEFA 1X9UA 4LIQL 4LSDA 4WW2C 3UWEA 4XIMA 3GLZA 2GWNA 4YVUA 4ZFGH 1EZWA 1MFAL 2VDQB 1EHNA 1CBJA 4FXGC 2VIRA 1CYWA 5MEQB 1MCPL 1GOQA 2FL5B 2CXGA 3O0RL 1UM4L 3RY5A 1XLEA 2QVMA 3STLB 3FQRA 2TRHA 1DZBA 1OLZA 2ZRVA 1WISA 3MTWA 1I1RA 3NCJH 2G0WA 1KCUL 4UTBA 2Y4SA 5CCKL 1SZEA 4HC1H 1JUBA 1DL7H 2J20A 5XIMA 2WHVA 1BQHG 3QVQA 4MZIA 5E1AA 1HL8A 3WF0A 3I9PA 5SWSD 4IIFA 4AGQA 5HNRA 3A6CL 4IJBA 3H21A 2WBJD 4GUFA 3F4CA 4L48A 5F4SA 4XAYA 3GZ3A 3EJPA 3MREB 4K71C 4UILL 4E41E 2EDMA 1DQKA 3GSRA 5BZDA 2VFIA 4WCYL 3ZTNL 2VR2A 1JUEA 3FIGA 2ACSA 4FFTA 4ZMVA 4TQEH 4RX4A 3LD5A 1K3ZA 3H9SD 1W3HA 5I8KL 4K68A 3C2FA 5HDBE 3QJXA 2KS0A 3KR3H 5K69A 3GMLB 1T4WA 3H70A 1SXBA 1JV5B 3N1PC 3QWOB 4Y16D 3HZVA 3G7TA 2N56A 3KP0A 3ZTJG 5DMNA 2F9RA 2OX5B 3SPCA 4WW2A 4M5PA 2GTWB 4GKSB 2R14A 4YU1A 2ADGB 3DGDA 3JTBA 2X4QB 4NP9A 4N5UA 3LHTA 5KJ7E 3E2SA 3BP5A 4Q7DA 4XNXL 2FT6A 4U1HA 1IWPA 5D8JL 4HK5A 3SY5A 1PQZB 1XMEB 5EBUA 1J96A 4X60A 1KFWA 2F38A 3B7SA 2PF8A 2EILB 2OLSA 3REQA 2BMBA 4X2RA 4Z7WE 2F2HA 4K4KA 3MRBB 5BYWA 3H42H 1N0LB 4YLQT 2XFYA 4ZXLA 4BI7A 1BFOA 5DJYB 2XG9A 1QOQA 4IIQA 1DL7L 3MV8E 1RVKA 3B8UA 4O15A 43CAA 1TUFA 3K2GA 4DP1X 5FWQA 1F76A 4F0RA 4WI7A 1IXQA 1VHPA 32C2B 1LG2A 3P73A 3PGFH 1NC2A 2VC9A 4XXDA 4CNOA 1JPEA 1BG9A 3UJ2A 1DBMH 3CZJA 3K1GA 4OIAA 3KXFA 1NLDL 2BP8B 2PAJA 4AAJA 3P67A 4AZIA 2NQLA 2N0KA 3ARDC 4A2DA 5INDB 4BQ3A 1A6ZA 3TFKC 2Z31A 2BGSA 3L4WA 1ZLDA 3ISYA 1IBGL 3BV7A 5A7EA 3PWPE 4CN1A 2DF3A 3BAWA 4Y4KC 1OHQA 3FL7A 5MERA 5I1JL 4QTHB 4S23A 1OAYL 1M04A 4BQ6A 4N6RA 2NX9A 4RDZA 5HWMA 4J4PD 4CAGA 5E03A 5C97A 3AWFA 3QXAB 3PQYE 5EA0L 4PJGB 5DA0B 2XIBA 4CQBA 4YGVA 2G9HB 3D9AL 1WA3A 4XTRC 2BSED 4FXTA 1AMYA 3SDCD 4P4RA 1QRQA 4KESA 4OLYH 1RSFA 3O2DA 1EFXA 1PZUB 1NCHA 2GSHA 2VDOB 1TVDA 4M3HA 1JCNA 3GHBL 3MLZL 3DOIA 1VF8A 1IC5L 3O8XC 3UTOA 1FAIL 2WANA 5DZJA 5HATA 3CZUB 4B5EA 3TA3D 2V5JA 3WGUB 3EJRA 3BRGC 2GEEA 3LZRA 2FJFA 2VB5A 3U4EB 4GRMB 5HVHB 4QRPE 4LEBA 4YE0A 4UOJA 1OHZA 3U9WA 4X8CA 1W1IE 3OKDA 1O6VA 3SBRA 3QFDB 2NNAB 4IK6A 2C9XA 3CFIC 3QIWC 4QHKJ 4WWKA 4XUYA 2Y72A 4MNQB 4BZ1L 5IFAH 1UD6A 3PGFL 3VGBA 5IQ9A 4O0KA 5E7FA 2J73A 4L2LA 1DBBH 2ICCA 3CPLB 2PSNA 2GQHA 4KVNH 1WJ3A 4GVFA 2A3LA 5CBEA 5CC5A 2D9CA 1QPOA 3VCLB 3ARDA 2HJLA 2PGRA 1QBAA 5A94A 3VVWA 1QFHA 1KY7A 5CJOL 1NBYB 1JZ6A 1U1JA 4N2MA 4HUVA 1F3TA 3G18A 3HCVB 1NCIA 4N1CA 1F3DH 4BF7A 1IC7H 4XPFL 3W25A 4HIPA 3VXUE 4OFYD 4LUTB 1E9QA 4B4FA 2HTLC 4CJ0A 5T33L 4M4RA 4U1MB 2NY2C 1K6WA 3WLWD 2F58H 3G5ZB 2N59A 4OLYL 5D7IF 1MCIA 1E6SM 1NCDL 4X7FC 2IPJA 1EZLA 3MKGA 1VZIA 2Y22A 3VI2A 2JJWA 2FX9L 3O8XA 1HNFA 4P23C 3DJTA 3ZPDA 1NDWA 4OVXA 2PRLA 3WK2A 3P4NB 5D7SL 2ADAA 1AQKL 2YUXA 3WHE0 4LGPB 4Z7VF 4OLUH 1ADDA 1XYBA 3AS3A 1S78D 1CBGA 4G43A 5ESQB 2C3VA 3WDQA 2C1PA 3TSMA 2ZX8A 4MB3A 1J05B 5KTEL 3IRPX 5FGBC 2WYZA 3NCBB 2PWDA 3MUY1 2W65B 2O92A 3ES7A 3QIWA 2R2BA 4JANB 5DJCB 4Y1AD 2BC4A 2HT2D 3V6ZB 3R0UA 1WV7T 1V4YA 7PAZA 4PV8A 1L3WA 4UTAL 3NJGA 3KZPA 4I88A 3IRCA 3GHSA 3UAJD 3QDJD 2BVPB 1RD5A 1XQLA 1XF2B 4UTTC 3AITA 3WQOA 4NCDA 2CDEB 1A5NC 2XJ7A 3GMQA 1NBCA 4M6VA 4JFFA 2XH4A 2D3NA 5D96B 3M6YA 1E9OA 4FP8L 2OMAA 2FZNA 4WUKL 1NGQH 1QSFD 4D0BA 4AZ8A 4ZE4A 3KPMB 3KM2A 2HXTA 1J88A 2O72A 1YDOA 1QFWI 2JKSA 1H3WM 4JAMB 4LE8A 2R8SL 4EI5B 3PG9A 3Q8AA 4ZB0A 5AQ0A 1YIXA 5HDQL 1HJSA 3M0XA 3PJWA 3GIZH 1K8CA 5I1CH 1CD9B 4OF8A 1T2QL 5GIRA 3EYSL 1FH7A 4JIEA 1VIZA 3DPBA 4NN7B 2R29H 1IGJB 1E70M 5JORB 4JJ5B 2HRLA 4PHXA 4HWZB 3ZM8A 5T8IA 3VXPB 4GI4A 3TVMB 4YX2H 4P23A 1F2JA 2DY3A 5IOKA 5KYXB 1DBKL 4AU0A 4G3YH 3CO4A 2VQ4A 3IS1X 1EJXC 3PZQA 3DKLA 4KCUA 1UJPA 2ADIB 3BGFC 4UTMA 4PPTA 3CSGA 4LKCB 4PEKA 4DNLA 1LE9A 5EORL 3EWDA 1H3GA 4IBTA 4Z78B 3NIGE 4U1LA 2J1KA 3ITVA 4KKAD 3WYRA 1B0WA 3E1ZA 3K91A 4KKCD 3OSKA 3GSUB 4X6EA 5DFVC 2ARWA 1LOSA 1RUAH 4WUUE 4YZFF 4N9EA 4ZOEA 3OVQA 2Z1PA 3EGDB 2BIMA 3U0PB 3CFJB 3V5DA 3CUPB 2JF1A 5DJ6A 4MX7A 2YGNA 5GRUL 5IJKA 3QNZA 3CUJA 3ZZSA 1ET5A 4GINA 4UTTA 4NQDB 3T4YA 2VN7A 4FG0A 1IEIA 3AZUA 4EVZA 4U2YA 1VFLA 1NGQL 1F4WH 2J8UB 1ZV9A 4UFJA 1OBAA 4LOUC 4HKZA 1XAKA 1E0UA 1S5MA 4MJID 1TA3A 3W72A 2QPFA 2ZXEB 3KAAA 4L8SA 3IS0X 1XM3A 2XWDA 1QPXA 3HBPA 4Q0XL 3N43F 4DO4A 2OOGA 2C18A 1N82A 3LZQA 3S5LB 2HISA 2PYFB 1QEWA 1TEYA 4X9YA 3HE6A 2HXUA 3O45B 4HGWB 3SDDA 4XCNB 3OQEA 5A2AA 2SEBA 4XNQA 3KBWA 3HBQA 3SPIA 3KAOA 2F1EA 3UCRA 2TMDA 3O05A 1PUDA 3A21A 2FGZA 5GS0D 4BYHA 5T1MB 3ZZQA 5FYJH 4FXLA 4V2XA 2W9DH 2YARA 2L7EA 3PDOA 2JMRA 4GX9A 3MBWA 3W73A 1UVQB 3IAGC 4YIQA 4JFOA 1IL1A 2DZEA 3CLWA 3LKRB 4K3JH 3D69B 3PUCA 5DQ9A 1KJVB 1DV7A 1XCXA 4Q4SA 5H35A 1WX0A 2GQ3A 4AXWB 5KETA 1EFQA 1TJPA 2A99A 1A0EA 4K8EA 4IX0A 1JK9A 3CH1B 2ZA3A 1U8LB 1K2DB 2D2CC 4Y89A 3IU4L 3NYKA 4DVOA 4AJ0A 1I1YB 5HWNA 4JVUA 2J74A 1DE4A 3BDYH 5IVNA 1CU4H 1L9WA 3BLFA 2BVUA 3RMJA 1H6UA 1JP5A 1ZLEA 3A24A 1MCWW 3IFLL 3UTSE 1IM9D 3HPLA 3FSAA 5DJXB 1ISZA 3U4BH 3MYJB 2VH5H 3WJLA 5CIPH 2D31A 1IB5A 4ADJA 1ZLUH 4QGCA 3AJXA 2E77A 3EGSA 4YSPA 2YL9A 4F0HA 2WK2A 4LBEA 5ESVA 1CLYH 1UM5L 5B1CA 2J1WA 1TVNA 2A7BA 3MU7A 1HKWA 5JBEA 2X0YA 4S3DA 4FHBD 2CIIB 2ICWA 4XPBL 4LLMB 1YXDA 3ME0A 4G1EA 4ZUTA 4ZK8A 1HHHA 1FVEB 4OV9A 2OR8A 2HSIA 2Q8LA 4CGTA 3CMFA 1HJXA 2ZUNA 4LPVA 3NDYA 2EXOA 2Y1ZA 4ETQA 4OFIA 2VP8A 5GJTL 4FB7A 5IVZB 1S7XB 4DJEA 3O3AB 1U4EA 3LEYH 2MKWA 5C2UB 1NAMB 3M0IA 4ZXOA 2B2XL 4ZOAA 4R53A 2C71A 3TTYA 5JNYB 3STGA 3TJPA 4RE2A 1LQBC 4KXDA 1KLUA 5GVJA 5B38G 1W1VA 4X4XA 4UM8B 3IFOB 1VIWA 2VDML 5EEWA 2I14A 4YPGB 4QAWA 3UTZA 4QJ3B 4I9AA 4PY8J 1S5IL 1V6VA 4PYHA 4JFQA 4WGKA 3PWVA 3CEPA 4PODA 1RIUH 1NVMA 3HI5L 2PZ0A 1FA4A 3BLLA 1JPTL 4ZDHB 1XYAA 1O7SA 4ERSL 4HS6B 1A0CA 2AQ2A 4G9DB 5E9DB 3FFCB 3NA4A 3NSFA 3FPXA 5LIYX 4BH8A 3IGFA 3H9ZA 5EN2B 2D4FA 1RMFH 3URQA 3HJEA 1WZKA 4QLJA 1J2WA 3ABZA 3V4UL 1UOLA 5JIHA 2J13A 2QUMA 1M01A 3SODB 2NLJB 2PR9A 4PD4J 1B3JA 5JTWA 3K8LA 1CB2A 5MEQA 1HIZA 3FSWA 3HQOA 2FL5A 1M05B 1NMAH 1E90A 5T3ZE 3MPCA 3STLA 4WXZA 4QNPE 3E6FB 1HKLL 3MMEB 2H1LM 4Z7UE 3ZVHB 2FGWL 1QYGH 4W6XB 3G6JE 2F53D 4DPAX 1BHGA 4GSRA 3RPTA 1UZ1A 2PTYA 2OX4A 4D7PA 1R19A 4P5UA 3KDMB 3RDTD 3SGKC 5IF0B 5K9OB 4GXVL 3MQTA 4A8LA 3MREA 1EDTA 1LWJA 1ETZB 4BQ8A 5J11C 3S48A 1QD0A 5LWYH 4TQIA 4XNDA 4N87A 3QAQA 4OCRL 2Y07L 3K81A 4MCNA 1E6JH 1VP5A 4XZMX 4OU1A 3DHDA 4D71A 4AYGA 3IFNH 5JBFA 1RMFL 1M7PA 1OCZB 2HMCA 3OIHA 1D6VH 4E41D 3GMLA 3JVAA 3K4DA 5J9PB 1SN2A 1A5FL 4N2LA 3QWOA 1H62A 3ARVA 4KITB 1MREH 5A2FA 4PJIE 4G5DA 2OX5A 2W27A 1QAWA 2GTWA 5B7YA 4GKSA 2ADGA 3TJEL 4FQ2L 4ZODA 2X4QA 4H9TA 1AD1A 1II4E 2WXJA 4ZFOB 4PJ7B 1PQZA 4OCSH 5GZOD 4GH1A 4UNVA 3C5QA 4RBPK 1OQFA 4HAGA 1I3VA 3VCRA 4XZ4A 2XY1A 1AFVL 3S0CA 2MQ3A 4YXHH 3MRBA 1N0LA 1TLMA 3TX4A 3VE7A 4JY9A 2XWTB 2AQVA 3Q45A 2WWNA 3MJ9L 3Q67A 2HFGL 4XBEL 2YW3A 2WJEA 4Z7NB 1OV8A 4TVPL 4AV4A 2WVUA 2WYSA 2IPUK 1CCWB 3LEXB 32C2A 4PJDE 5T26A 1OADA 3WD4A 4I3SL 2JCWA 4JX4A 2EPMX 4BFNA 2AXHA 3FSUA 1ZSHA 3QV8A 2BP8A 1J8VA 4HSCX 4DZBB 3PZGA 3PRZA 1Z9AA 4M6NH 5E6IC 5INDA 1V3LA 5EY5A 3NGBC 3NZHH 4EWJA 5ACLA 3W1UA 4ACYA 4LBAA 3CLEL 1Q85A 3I6RA 3LHUA 3JXAA 4QTHA 1U9KA 2D20A 4LNRB 3AG1B 3C9NB 2DEXX 3GSNB 2WJZA 1M6OB 1G01A 1K8DB 1UR8A 5DVOA 2AJUL 1FBIL 3QXAA 4AIUA 1L6GA 4PJGA 1KD0A 4YDLB 2G9HA 3UR8A 3VIGA 3VNIA 3PWPD 4DBEA 5J7CC 1B6UA 1W15A 3SQOL 1KJMB 4O1AA 1U3YA 1WIOA 2FJGB 4LVAA 5I79A 1B4KA 1DL3A 1I1AB 1R46A 2AI0H 4O28A 3QUXD 2AAAA 3D5OF 2PWFA 1BZQK 3QC5X 3IAPA 2I56A 5ECUA 3PQYD 1ML1A 1C29A 1BOGB 4NUQA 3SKMB 2GDVA 2F6KA 2H2PD 3U4EA 4NQEB 1TVLA 4JO3L 1NIUA 2EXWD 3QFDA 4ZQNA 2NNAA 4UR9A 1FFTB 5T3XE 3BVXA 4MNQA 3LKQB 3MODL 1NBQA 5GS2D 1WBHA 1OTTC 3LXUX 4ELDA 4KO7A 2EEBA 3CPLA 4B2DD 4KKBD 4Z3FA 3IK2A 4HZMA 4J3SA 3QB7C 4JGMA 4MJZA 3VCLA 4WIQA 3KLLA 4PJFF 4GGBA 1T66C 2F8IA 4S3JA 1M9WA 3QXVA 1DP0A 2CU0A 1ISWA 3GXUB 4R4BB 3MSRA 4WRHA 3WJSA 1NBYA 1SDYA 5AKVA 1H61A 4NHUB 1A1MB 2GY5A 5JHBA 1XIIA 4DJDC 4ODUB 3T2QA 4AM0Q 2HG5B 4IRSB 2H5UA 5C07B 2Y70A 3EG9B 5CAKA 3F7JA 4LUTA 4JB9L 3UAAA 1UW9A 2YR1A 1CI5A 4U1MA 2UY5A 1KCZA 1HGWA 3G5ZA 4Y88A 1X5LA 2W07B 4NQVB 3LLDA 2DZVA 2I5YH 2PWVA 2Q8ZA 4NN7C 3FULA 3A12A 2ZYIA 1BXVA 1YEIH 2B7DT 2IMNA 1ECEA 1GC1C 3F2CA 3TVMC 2DWYA 2FWLB 3P4NA 5GJPA 4WFGE 4XN4A 5HHQB 2P0OA 3VSUA 2Q8BH 3ZIMA 4UANA 3VXUD 4FTVD 5E1AB 2DQHL 4XP9L 5ESQA 3TZVB 2HVNA 4L1XA 2D7QA 1P1XA 1J05A 4NLHA 5D2LE 1RURH 4KHXL 3M7SA 5ILTL 2W65A 3VU2A 1XF3B 1VLXA 3HR5B 2R82A 4JDTL 5DJCA 3KM1A 4AZ5A 1EJ7L 1AJZA 3SY1A 1I85C 3V6ZA 2Z7KA 2OSXA 5DVPA 4IP4A 2WXDM 4XZWA 5I3GA 3V8CA 4RMQA 2BVPA 3ZE0F 4AD3A 1A6TB 1XF2A 1U2CA 1B6DA 3EOOA 2GBTA 2CDEA 4MCZB 5L8LB 3V0WH 2XETA 4IHBA 5AWNL 3W74A 4AMWA 3N04A 3O4LB 2CCWA 1MVYA 2DMKA 3R79A 1DTUA 3RGVD 1IGSA 4HTBA 4H7ZA 3KPMA 1JPSH 1H6TA 3A23A 3DGBA 4DJDA 4JAMA 3NDZA 1TCRB 4EI5A 3SB0A 4OTKA 4S0HA 4ZOBA 5A8OA 2AITA 2VERN 1G7LA 2ADYA 3ABQA 3RYMA 4FXGB 3FCTB 2FATH 4H0GA 3LZLA 4TX6A 3HOJA 5F7HA 1X5IA 5BV7H 3MCYA 1IGJA 5JORA 3WL0A 4JJ5A 4I2XE 4HWZA 3W71A 3IVKB 3VXPA 2KDYA 1EVUA 3TVMA 4D8PB 2WYHA 5KYXA 2DDXA 2FVLA 1A7RH 3W7RA 1I1WA 1MFCL 3DHFA 3WTWA 2HPIA 2ADIA 1ICPA 3C5SB 4LKCA 4Z78A 3J8F7 1L6WA 1XUUA 3AQYA 3GSUA 4K71B 1NM4A 2ZX7A 2PTZA 1H8LA 3QTGA 4OI7A 1F56A 1KJ2H 2GCYB 1I85A 1GW6A 3EGDA 3U1SL 4PVBA 1GGYA 3CFJA 3U0PA 3CUPA 2ATMA 4G6AD 4C4KO 2BMKB 1JJKA 2JBMA 3AUJA 4A2MA 4NQDA 4P07A 1DJIA 4MBRA 5JUEH 3SJNA 4WU7B 4PMVA 3IDUA 5CF3A 1JVNA 4CQ9A 3KJ6H 3T0EC 4J12A 1IGIL 4N6QA 1VFMA 4TPRH 2J8UA 4D9PA 4RX0A 5C71A 4GC3A 4ORZC 4RGOL 4X4ME 4DFIA 1VFUA 4WUUD 2J27A 2W95A 4LHUD 2BZ7A 4OWGA 2HBXA 5EF2A 3F64A 1A7QH 3WGVB 4I7UA 4DKDC 4PRNB 3FSTA 3GHRA 5GNYA 3MXWL 5CINL 2HKAA 3EKLA 3P11L 2NXGA 2GJJA 3S5LA 2HVOA 2PYFA 1EFXB 2IUZA 3O45A 3P1VA 3QCVL 4HGWA 4XCNA 3WELA 2CKBH 1M1XB 2DD8H 1L9PA 1OCBA 3U9PH 1NL0H 4PG9B 2D9QB 4MJ2A 2AANA 4MD0B 4PL2A 3GJFK 4QRSB 3X17A 2EDEA 2E7FA 4OZIE 2EGZA 1KTNA 1CBVH 5I1KL 1L6PA 1UVQA 3QWRA 1RZIB 3LKRA 1F0LA 3D69A 3W7IA 3QUKB 1ULVA 4IW4C 1KJVA 2QHRH 2X87A 3RTQB 5JPNC 1C92A 4OCYH 4AXWA 5EULV 1KJ2L 3K2KA 2K1MA 4ZQKB 3NL2A 2DH2A 1ZB5A 3ECBB 2O1AA 3CH1A 3K72B 1U8LA 1K2DA 1YNYA 4EI0A 3CFEB 4WI3A 5JUEL 1I1YA 2V8ZA 3FB7B 5T5FL 4Y4KB 1CK0H 3KJ6L 2LAAA 4F2MB 5KVDE 1T89C 4PRHE 3KRBA 1OFAA 2WWKT 5EEYA 3IDMB 4Y2DC 2VGBA 1GGBH 1WSST 1T2XA 3DFSA 2SODB 3B7RL 5DJXA 3MYJA 4APQD 3B04A 4KY1L 2IGLA 4POZD 2OYMA 3OQ8A 4M4RB 3LBCA 4FAMA 4LL9A 1TFHA 2VCAA 3MB9A 1PX8A 4LGXA 4POYA 1P7QB 1PHWA 2YJQA 1XBXA 2DD8L 3TYBA 2O0TA 2VXVH 3C87A 1S1RA 5C7HA 4LLMA 4Q8TA 1OCQA 5CSZB 3UTSD 4FOKA 3NPSC 1CGWA 1Z3RA 1L9MA 3QV7A 1LDCA 4QRFA 3CDFA 1TPEA 3LKNB 4ZW3A 3RX3A 3P84A 3QEGH 1FVEA 4FCAA 3WTXA 2VEPA 1HO4A 2YPVH 1W3TA 1XMWA 4HHHA 3KTXA 3C60B 5A8MA 4H9UA 1USQA 1VCAA 3F85A 5FOBB 2RR3A 3IRZA 5IVZA 1S7XA 2VR9A 3O3AA 2QHRL 2DQWA 2GYIA 1NAMA 2OULB 5JQIB 1TG8A 4OCYL 5JNYA 4PJCE 2APTA 1JMZA 2ZP0T 5ITBH 1I8LC 3CJPA 1MHPL 4UM8A 3IFOA 2JIEA 4OHQA 2PYEE 4YPGA 1RZJL 4PTNA 2WMJA 2AS5M 1EZSA 4Y4FD 1EJOL 1QNZL 2GFTA 3M5YA 3LS4H 4ZDHA 3EWCA 2O56A 3SDXB 4HS6A 3GIQA 5C3LD 4G9DA 5E9DA 3FFCA 6CGTA 4BR1A 2IEPA 3FN0L 4FQCH 3VSVA 4V27A 1IKNA 5EN2A 4KZ0A 1E72M 5DT5A 2N1TE 2NY2B 3T2OA 5D03A 4RMRA 2NY0D 4TU1A 4GMTH 4JO2H 3OODA 4HYRA 2MCPH 1JCLA 2CGRH 2BW5A 4O2EB 4P3CL 2V82A 1UWGL 2NLJA 4WGVB 2XYLA 4PB4A 3QGVA 5I06A 4P23B 4FHAA 2QCHA 3Q8BA 3DX6B 2GPTA 1M05A 1OT1A 1MN4A 1AGFB 1YTDA 4Y19D 4IRJD 1RUSA 1SDAB 2BS8A 4JQAA 1ADQA 3VKAA 2NW0A 3PP4H 3E6FA 3MU3A 1FF5A 1MELA 3ZVHA 2VM4A 2DVUA 3C5JB 1XX9C 2PPCA 4V28A 4DJFA 1UYWH 4R4NC 3KDMA 2C9QA 4IK7A 5IF0A 5ITBL 5K9OA 3LQAH 1I8LA 3UCDA 5T3ZD 2VAJA 3LY0A 1KGXA 1W2KT 3KBMA 4EE9A 3RX2A 1EJ8A 1ETZA 3TVAA 1QFWL 5KN5B 3QQDB 3GFYA 2X9XA 1SEQL 4AIOA 4DZ8B 4F40A 3H53A 1NF7A 3AW5A 1TIUA 3A4EA 1F2QA 3S9ZA 1I4FB 3GBNH 4WI6A 1XEUA 3S1UA 5F7YC 1DWHM 2QF8A 3RZCB 3TF7C 2QGHA 5LDSA 3APTA 5DZPA 1GZHC 2DDQL 1TTBA 1AGCB 3KHJA 3M8OH 5J9PA 1BAFH 3MDWA 3N5AA 3S35L 2LTQB 1HILB 5IUSA 2CGRL 2A74C 4XE0A 4NP4L 3HG4A 5D71L 4FX6M 1PMYA 1E5CA 4G8FB 2GW5A 1HE8A 2PP8A 5FS5A 4RA3A 4ZFOA 2A9ML 4PJ7A 3I6LD 4HJTA 1P7BA 3W02A 2BTMA 1R3JB 2C13A 1I1AC 2QGDA 2AJZB 2BP0B 5FACA 4U3SB 1JERA 4KKQA 2YQBA 3C6LD 5E4IA 3BGFB 1TWWA 2XWTA 1YJDH 2BSCA 1QOPA 4WVRA 3NFNB 2AJXH 1OOWA 2K6ZA 3VIKA 3TN0C 1XLDA 3S83A 4M8UA 5HSFA 1TKWA 1EH9A 5I3IA 3LEXA 3OZ9H 2DQGH 4YEEA 4K73A 4XO8A 1R9YA 5CMAB 4ZR8A 5I78A 2NXYB 3ZN6A 2ZX5A 1VPQA 4WKAA 4MASA 1E1FA 5JIMA 1N6QL 4DZBA 2FEDD 4OFCA 5KS9E 2ZDRA 4K8RC 1C1EL 5D9MA 3P0XA 5TAOA 4JHUA 1V5XA 4REQB 1W9DM 2OG9A 1CIDA 4LNRA 1N8ZB 2E7BA 3ITOA 1G4EA 3B9VA 3UBGA 25C8H 1RLDA 3C9NA 3GSNA 2H6RA 1BAFL 1M6OA 1GS8A 1K8DA 3BJLA 1K6AA 4IRSC 4U4BA 1PXGA 1OT2A 2J12B 1KCRL 5FYKU 4LDOB 3RHGA 2PXYB 3GR8A 4YLBA 3K4AA 3D0AA 2RJGA 1F3RB 4I89A 3APGA 4PU2A 3KYNB 1LM8V 3DDMA 3SUTA 1KJMA 4ICNA 2EXSA 2FJGA 3HNTH 2P10A 4CNTA 4MKVA 1I1AA 1U3NA 5U7SA 5DWUL 4EJ1C 1QHZA 3EWXA 5C6MA 3D5HA 3RJOA 2NR6C 1BOGA 5C0JB 3SKMA 3TZVC 3OWRA 4NQEA 4P9HH 1J8KA 5LG6A 4MZ1A 4CNSA 2E40A 4G1KA 5CAHA 1A0DA 2DQGL 1TQTA 3FQTB 3LKQA 3UCQA 1SW3A 2O93L 2EPKX 2V37A 3NJNA 3OLEA 3NCEB 3BVJA 1D2PA 4FULA 1UUNA 4AGPA 1AQ8A 3PU7A 1KTKE 2X2UA 4WX2A 1J4EA 3VVVA 5GQBA 1Q6QA 4HA0A 1MFDH 1RFDH 2DL2A 4X7CC 3ARXA 4JTFA 1SHSA 3WTYA 3T5WA 4R4BA 5C0BE 5T3XD 1ME8A 4NHUA 5BZZA 1A1MA 4ADGA 5C8JB 3VTRA 3QM3A 4OT7A 1CR9H 3VD9A 4KWOA 1OAKL 2AHIA 3UJRA 3ZLQC 4ODUA 3LHWA 2HG5A 2MCG1 4IRSA 5C07A 1R0AL 3EG9A 4Y90A 3VSTA 1OY3B 4ADTA 5GGVH 2W0KA 2W07A 4NQVA 5GPRA 5HYQB 4GNVA 2CXKA 3TAOA 4FZEL 1F6YA 4C83B 4LO9A 4HN8A 2B31A 5KMYA 2VXQH 4KUCF 1HCFX 3QP3A 5HJBA 5T5NF 5HHQA 3OAYK 1XVSA 1QO5A 4CVZB 4RFEB 4ODHL 2YQ3A 3DKHA 3DX7B 4OM0H 3TZVA 2HTKC 4A55A 2W0PA 2RGSA 4BE6A 4KZEH 4FG4A 1KWKA 4NM8L 1W6WA 1WOBA 1XF3A 3HR5A 4NO0D 3SO3B 4N2OA 4UMGA 4MXQD 4LPCA 1ZLSL 3IDGB 4O19A 3NURA 4XT1C 4LCWE 2FO8A 4LCUB 4MGGA 4L5FH 4M61B 1KELH 1A6TA 4OLEA 4OZHF 2ESVE 2X09A 1P5UB 4NRSA 2BFVL 1HE7A 3BK0A 2FKPA 4MCZA 4X5QA 5EB9A 2Q2LA 2MCAA 3T0CA 2EDOA 4YWGL 2MTPA 3NFPB 2CLZB 5F1OB 3O4LA 1E5BA 3ALFA 1OQXA 3HJ0A 1TNMA 3FVDA 4ZX6A 4AD2A 5FWRA 1H8OA 5H37H 2P5WE 1TCRA 2JKLA 4ZFGL 1ELSA 1UURA 4WO4C 1QZNA 1W0VB 4B6ZA 4FXGA 3FCTA 4FR6A 4HGMA 4HMNA 4KJWC 3GIPA 3WUBA 2LHAA 1PPIA 3APYA 1KCLA 4FNLH 3FH8A 3NCJL 4G5ZH 3IVKA 2VURA 3C08H 1RUMH 4D8PA 4HC1L 4EOWH 2PDHA 4R27A 5A6JA 1W6TA 3LCGA 2UVEA 4AD5A 3MSGA 1ZU8A 1XGDA 2IWGA 3BQUD 3E9UA 3C5SA 3II1A 1POKA 3L7FB 2XWXA 4KEMA 2H3DA 2OQHA 2FE0A 1W3LA 5BO1H 5FOOA 4MFHA 1BPVA 4AQLA 4GZIA 4IBLT 3RTQC 3VIPA 3ROOB 4LAZA 2A4CA 2D24A 3U2SB 2C0AA 4PV1C 3G5EA 4RXFA 2Z7WA 2E6YA 2GCYA 5J11B 1KCKA 4ILDA 4TQEL 1IEBB 1U91B 2BMKA 3O0LA 1FX6A 3ITGA 4BKNA 3HGOA 3VI4F 4Z1BA 4WU7A 4XTDA 1T7VA 2VSDA 4R7OA 5E0CA 5TE7H 3SBPA 1FVPA 3L2NA 1KC5H 3N25A 4LCCB 2HS8A 1Z9MA 3KR3L 1YNKH 2GQ8A 3SKJH 4BHUA 4R7JA 2WNWA 3U5YA 2E7CA 2PLKA 2YA0A 3UL4A 1W80A 1KTCA 1JGVH 1A0QH 4J5NA 4LAJH 3RX5A 5MF5A 3MGTB 4PE8A 1O94A 3BZFB 3C8NA 4C6EA 2F1BA 4PRNA 3M47A 1LO5B 3GIYA 2ENPA 3C2RA 4PVLA 2DJUA 3CZSA 3FTGA 2JNZA 3F05A 3H42L 1CDIA 1M1XA 2CLHA 2PE4A 3TEWA 3KWUA 3GRGA 3C08L 1ECQA 2W9MA 2CZEA 1DCLA 4PG9A 4EOWL 3LUTA 4PL1A 1U42A 4MD0A 4QRSA 4NVTA 1WUNT 4GUPB 2JGQA 3S3DB 4NKCA 5BOZG 3LX9A 3C60C 1RZIA 4PB0H 5JHAA 3OTTA 3W83A 2BY3A 3QUKA 3M0YA 3QG7H 4DVRH 3CH0A 3ZMRA 1SOSA 5D9SB 1RJPA 5KAQG 1DBML 3RTQA 4AUBA 1EXGA 3CZ8A 5EIIA 2ZZ1A 2YXVA 2J71A 4ZQKA 2DAVA 3WENA 3ECBA 5E6IB 3K72A 2B7NA 3TJXA 1QW9A 3NGBB 4BEIA 4K8HA 5HJXA 3CFEA 2H8XA 1EV2E 2G37A 2X6MA 3FB7A 4HYWA 4J39A 4Y4KA 4JRLA 4Q97A 1EQWA 2ZWLT 4JW3A 4F2MA 3VFUB 2D7OA 1BGGA 4LCYB 4RZ4A 3CIQA 3IDMA 5TPWH 2ON3A 5GGQH 1A50A 4J6IA 3TXZA 2ALAA 1RSYA 4HHGA 2Z1BA 3TS8A 1TXKA 1QK0A 1TRDA 2XXFA 1FQ0A 4K36A 3FJTA 4PY7B 3V75A 1ZLWK 1LYQA 3F2DA 2K45A 4N24A 3HA1A 5KTLA 1ZAGA 2E0PA 1U58B 3THQA 1P7QA 2DQCH 3HI6H 4PRHD 3TEVA 3KE0A 1AIFB 2CH8A 5EYWA 4EPDC 1MEXH 2QCDB 4OUEA 5CSZA 5U4NA 1HQRB 1SN5A 3E38A 3LKNA 5I6PA 3HTLX 1FNLA 4NWTH 4WIWA 3L1FA 4YNGA 2P76A 1ZTVA 4PI0A 4NO5B 3C60A 1ZHNB 1IXPA 5FOBA 5IFAL 5KZEA 1RKRA 4B5WA 1BD2B 1F6FB 3MACH 4A7GF 1UH4A 2ENQA 3UZXA 1DBBL 3DUUB 5F97E 3N14A 1FWBC 1KQYA 2OK0H 4KVNL 2GJNA 2G8ZA 4WOZA 3NQGA 1PG7W 1XHHA 2F68X 3VA8A 1TZGH 1MI3A 5JOPD 1RP8A 4URIA 4OV6F 1IKOP 4GNJA 3HEIB 2WQSA 5L8JB 1R5WB 4JQIA 3E6EA 3C12A 2XH7A 4F1SA 3SDXA 1IC7L 1YUHB 1D5XB 4R7VA 1JI2A 1X4XA 3TKFA 1T3FB 3EYVB 5I2IB 3WY3A 3RZCC 2H0EA 1J1XH 5MEOB 3FFOA 2TSYA 3QJSB 3JZUA 1G7LB 2F58L 2AL1A 2PYED 4GQBA 3N12A 2JTYA 4MJ5B 2VO8A 2LTQC 3GBLA 5JBDA 3R25A 2I27N 4WHYH 4A66A 3WY1A 3PUEA 3B6SB 4QJ1A 3G24A 4O2EA 4HA1A 1TJGH 2FZDA 3PJXA 2A73B 1MCHA 1X1NA 3D12B 1TQSA 3UTQB 4R8WH 2P3ZA 3L5IA 3LENA 3DX6A 4M02A 3PWUB 2VD8A 3US0A 2A7RA 3UXLA 1WFJA 4OLUL 4RZCB 1AGFA 3LNPA 2QV4A 3VGGA 2XUCA 4RE3A 1HKIA 1TMLA 2MH4A 4HK3J 5E08H 2Z2AA 4KKLD 3CE1A 1UKQA 1YA5A 4HD9A 3JQOB 4OM1H 5FGBA 3DERA 3NJMA 1C8YA 4QNWA 2VDKB 1WUFA 2E1DA 2ISDA 2XVBA 3RB7A 3CBWA 3ZRFC 5E1HB 3C5JA 3TNOA 4K8GA 3N85H 1QWNA 1XPGA 5TBOA 1A7OH 4GI9A 2VEMA 3UX9B 2X1SA 1OD9A 1O6SB 3H7VA 2H0PA 4PUDA 1TZGL 2NXYC 3IGUA 5F7BA 1NPUA 5A95A 5KN5A 4RDQF 4LCRA 3QQDA 5AW4B 4BRJA 4O02B 3I7SA 3UP1A 4DZ8A 3IMBA 1EDGA 2WGNB 3DFTA 2NQ3A 3UJFA 3SAZA 1R3TA 3QEQE 1I4FA 3DENA 4OFQA 2CHRA 4UTCA 1J1XL 3RZCA 3HPFA 3DG3A 2BINA 5L6UA 1YCSA 5ABAA 2WWMD 4L8DB 3GIZL 5I76B 1AGCA 1XX1A 5I1CL 1ZDQA 5GGTH 1HILA 2PXYC 2DQJH 4H1LH 3SGEH 2R29L 2P50A 2A83B 1R17A 4G8FA 2I7GA 1WS8A 1B2WH 5DGQA 4YX2L 1PLGH 2V9UA 2PTTB 3UROR 4G3YL 1R3JA 3QHNA 2WHMA 4Y9BA 5GGSY 4OLWH 3WJMB 3M88A 3DVFA 5JA8B 1MCNA 2H26B 4DP5X 3ITLA 1MW0A 2WKGA 2AJZA 2BP0A 1QVOB 4U3SA 1JYXA 2YMOA 3OGSA 1X6LA 3GHUA 1DWJM 1C9SA 3VRLF 2EC8A 4LAKA 3NFNA 1HNGA 4E4UA 1QU4A 1TTQA 4DBUA 1YUKB 1AO7E 1JDEA 4WVXA 2AK1H 1RUAL 3D3VE 1ZANH 1BVWA 2VABB 3BQVA 3EOSA 5BXSA 1QWGA 2W61A 2LOEA 4M03A 2ODHA 4U6XB 5CMAA 2O7QA 3RAJH 4I0PB 4YHIB 4XNMB 3R7MA 1C12B 5FOJA 1WGOA 3D05A 2NXHA 3T0EB 1F4WL 5CLYA 3FCGA 2Z2UA 1BF8A 2Y7QB 1R3SA 4JK0D 3TESA 3OKKA 4AE0A 3KEHA 1HL2A 4UFKA 4HNTA 3CHPA 1XF0A 1TDQA 3MVSA 4REQA 1D7KA 2QADB 3VNMA 1GA2A 2MQGA 2C3WA 1N8ZA 4NO3B 2YSTA 3MC0A 1ASQA 4MZYA 5GGTL 4HIJB 4JL1A 4PJAE 4Q8NA 3V35A 5J89A 1AR1D 1YX1A 2PXYA 3MNZB 5CP3A 4CKVX 1RPUA 1WOAA 3AY4C 3KYNA 2H45A 2A6KB 2AQQA 2CJSA 4XN1A 5D09A 5FYJL 5CPTA 2W9DL 3PDDA 1ZRUA 5TJWK 2QJDA 1CD1B 5FF3A 1HCZA 4FI6A 1Q0YH 3HFYA 4TQTA 5HMDA 4K3JL 2OJEB 4NZDA 4KNTA 2I9TB 5C0JA 1QI2A 4PP2B 2LVEA 2HNEA 4FFZH 5JPNB 1QZ1A 5I74B 1HJVA 4B97A 3EGXB 5M5DA 3CQIA 1US2A 3FQTA 3SO3C 3PWAA 2QUNA 5D32A 2J66A 3LN3A 2YN3A 2FB4H 3T8LA 4ENED 3BDYL 1EXUB 4XO9A 4NJIA 1CU4L 2YLKA 3PTKA 3FO0H 4UIMB 2XC8A 3DC0A 3EH3B 4F3HA 5CEWA 1P5UC 2UV8G 4NZ4A 4AY0A 1UD3A 4Y2DB 3CQKA 3URBA 5HHOE 2DW7A 3AHYA 1KKOA 5HJYA 3U4BL 3ONCA 4KVPA 5LGJB 3VXOB 2VH5L 4B9PA 1TQVA 1IT9H 3ARYA 2VELA 2K4AA 5C8JA 4TVPE 1JGUH 3HBZA 2XY2A 3MCOA 3P60A 2Y7NA 4JNXA 4ODSH 1CLYL 1SFLA 2XIQA 3UAFA 3RLVA 3MJ6A 3VNYA 2Y69B 4C56B 1T1WB 3AY4A 1DEDA 1WAEA 5IFJB 5HYQA 3SGJC 2LVCA 3NPSB 1JBJA 3QJTB 4ATTA 3NG3A 4H20H 4JDBA 4UOW0 1YEEH 2YDSA 1F9CA 1J86A 2JI3A 2C1GA 4C83A 4RWYH 1D5RA 3ITCA 1V7YA 1PKLA 1USZA 5H1WA 1GEQA 2NLIA 4CVZA 4QUOA 3LEYL 4RFEA 2W92A 4TX9A 3SUUA 1NIAA 3DX7A 4FFZL 3QPEA 1JDDA 2LR4A 1AAJA 4F9DA 3W37A 2OM5A 3L0NA 3LH8A 4ILSA 1XYFA 2VN6A 2OU4A 2C16A 2AQSA 3IDGA 4NQXB 1RIUL 2Z65C 1BEYH 3VQMA 5TDPB 1RZGB 4LCUA 4HJEA 2DGAA 1G9EA 4M61A 4PP1D 3O3DA 1P5UA 1IF2A 3TYUA 2W80C 4Q6XA 4NLAA 4C60A 5D2VA 4FNSA 2NY6D 4LCCC 1LRNA 3NFPA 2CLZA 4JR5A 4AI7A 2HNHA 1GGUA 1ZMYA 8TIMA 1OAQH 1L8PA 1JGUL 5EDXA 3TROA 1F1GA 2O61B 3JVFC 2GIMA 1WO2A 1SYSB 4HETA 1FNFA 3BAKA 2R69A 2ESVD 4YSUA 1W0VA 2FIKB 3TBSB 1EBPA 4U6HB 3SGJA 3AWOA 1P6FA 4X99B 1NMAL 2XBDA 1LVEA 4L23A 4HPGA 3SUSA 1XIGA 2P52A 4CEXC 1FLTX 1DN0B 4D9QE 2P5WD 1QYGL 2X6VA 2EAEA 4MAUH 3MRCB 2UZ9A 1B54A 1E30A 1TKWB 3L7FA 1T7YA 1M1BA 3SGKA 4OFVA 1QOXA 3GIVA 2GJLA 2OKMA 5DRCA 4ZUSB 1WAUA 3ROOA 5DO2C 2P28B 3U2SA 5HNUA 4R3UA 5L7XH 1OZTG 3E96A 5LWYL 1WAPA 1LYXA 5LGXA 3MV8D 1IEBA 4MS6A 2H2SD 1U91A 3C61A 4I1PA 4DXXA 1E6JL 4B9JA 3LLFA 2G41A 3IFNL 1GS6X 3AQZA 1UCTA 4WHTB 1TENA 4PTVA 4LCCA 5JHMA 2ACUA 1D6VL 4LCQA 2O26U 4XC1H 5HHME 1M6JA 5FECB 4H8WC 4DOHB 3MC5A 1E71M 1MREL 3PHOB 2VEGA 4FXRA 2EYSB 3MGTA 2A74B 1CB4A 2WO2B 1MCKA 5DRXB 1Q6LA 3BZFA 2APVA 1FP5A 4S1QH 4KI5C 2AERT 1LO5A 4PBVC 2Z3FA 1TITA 3WIAA 2ODOA 4OCSL 3QW4B 3UERA 2AKMA 5HDRA 2JK2A 3OLIA 1R4XA 1T7XA 4YXHL 1CTOA 1UC6A 4JS3A 3X1EA 4M8VA 1AYRA 5FM4A 1SJXA 2W4XA 3PWIA 2DEYX 3QQ3B 2FPYA 2GJZB 2PMZA 3ULVE 3HMCA 3TN0B 1HVXA 4GUPA 3VOIA 3TYDA 1NPNA 2VRAA 5DC2A 5CSGA 4F0SA 2DT2A 1Y5XA 1JXKA 3MLYH 3KPRE 4WENB 1SHWA 5D9SA 3NTYA 1QO2A 4TTUA 4QG6A 1ONWA 3ETBJ 5T1JA 4G2DA 3BFQG 1A5KC 4JM2F 4IBYA 5TDOB 4M6NL 5DZAA 1E0OB 5E6IA 3TGXA 3NZHL 4QRPD 1RJQA 3VIIA 4R90H 1HKMA 1QPNA 1OK4A 5B3JE 5BNXD 3DETC 1MRDH 1O1HA 2D03H 2ZSVB 3W6YA 1FG2A 2GT9B 3Q58A 3VFUA 3ARFD 4RRPG 4CSPA 3QDMB 4LCYA 4QP0A 5IHWA 5L2KE 3U6XA 2DZSA 3HE7C 3BT0A 1MCDA 4PYGA 3GRWA 4PG2C 3AXHA 3QV9A 5DD5H 3NIDB 1GK8A 1TPUA 4PY7A 3BSZH 3K6NA 4ZFFB 5F9DC 4PGDB 3HA0A 2XGBA 2YFNA 1U58A 2XH2A 2CXEA 2AI0L 5L8KB 4G82A 1PAMA 4R2GD 1AIFA 2X1QA 3TO2B 3DHJA 5D1XE 2QCDA 2N7BA 1OZUA 1BD0A 1P4IH 1HQRA 4U5KA 5EMKA 5IMKB 3C6EA 3LHAA 5EUOB 3OG6B 4W87A 1VJSA 5F7DB 1AFSA 4D0DB 4LLWB 4P2VA 4LU5H 1H5BC 1U8KB 4FXJA 4NO5A 1VFFA 4UI2A 1DOSA 5AW6B 1ZHNA 3IJHB 4NBYB 3MLYL 1A4AA 1BD2A 5D7JC 1IKFH 4BQ2A 1CDJA 2XJLA 5CPLA 4NZ1A 1YE6A 4QXWA 3DUUA 3GTIA 4AQEB 3EJCA 1UWEH 4Q74A 1XRTA 1KTBA 2PO6C 4PR4A 4NNPH 3P5ZA 3MKVA 1PBYA 4LFHG 1N7MH 1U22A 1AH0A 4XN9A 2EDTA 1R5WA 1MEWA 4QOKE 2AGKA 3AXXA 1YUHA 1D5XA 1T3FA 3EYVA 5ANMB 5I2IA 1JAKA 5EOTB 3QISA 5MEOA 3V5KB 3E2RA 4A2EA 5AVVB 1ANUA 3E5PA 4NX0A 5D6DC 1JPMA 2AKZA 4LX4A 4MJ5A 3VKJA 4OZ4B 1QUNB 1AVAA 5KBMA 2I5YL 1QRNE 2YUZA 3B6SA 2GZXA 4DKTA 1TTIA 4MDOA 3UC2A 4RNRB 3ECQA 4WTWA 1YEIL 3EOAB 3DFPA 4OZHE 3IMSA 3LZ5A 1NEYA 3RNQB 2X7LB 2A73A 2ZQ0A 1E4MM 1RK1B 3L9RB 3GX9A 5AENA 3UTQA 5DRWB 3PWUA 2Q8BL 4RZCA 3WBWA 4J2MA 2WGXA 3VZXA 1UIPA 3WLMA 7TIMA 1N26A 3DXIA 4ZTXA 4GUQA 5AB9A 4S11A 1XBDA 1H5BA 1RURL 4JHWH 4OBRA 3GY1A 3C2EA 5DFAA 3GVQA 3C2YA 5DUMH 5D7JA 3OAZH 4AVNA 3EDDA 3BT2H 4ONVA 3WLPA 4F7TB 4ZW7A 4JFWA 5DWPA 1O6SA 2DS4A 3SCQA 4JM4H 4DFHA 4I0PC 1DBTA 1J8SA 4J3OH 1FKWA 2P44B 3V0WL 5F6HJ 4YTUA 4B3EA 2BOCB 7ENLA 2CO3A 4O02A 3Q94A 1HOCB 3WF1A 5AYUH 1JPSL 3EFOB 4DH2A 3BO9A 1QVBA 5GHWH 3N34A 2EQDA 5MEPB 1GPFA 2QADC 3NQ2A 2QZ5A 5BUPA 4PGCB 2HT4C 4TV3A 3GSNH 1EXPA 2BV9A 3UWQA 4NPYA 4L8DA 5FKPB 4WO4B 5I76A 5D6DA 1K7FA 2FATL 3VE9A 3BYTA 3V5CA 4CMMB 3FTGB 1NFDF 2O4QA 1W8NA 1PTGA 1IAOB 5BV7L 4AWEA 4TTDC 1FDLH 1E4IA 2A83A 2GJRA 5HXMA 1TU2B 3QEQD 1N4XH 2ZAGA 4HEPG 3SGEI 1A7RL 3L48A 2PTTA 1E3XA 1SRDA 1KM1A 2OT0A 4YC2C 3RX4A 3WJMA 2QUVA 1UWUA 2H26A 1QVOA 1P5BA 2DQ6A 1Q65A 3D52A 1MZRA 5AW9B 1SGKA 4QE4A 4IFKB 4KC3B 1TTUA 2BWQA 4YWIA 3OL2A 2UY6B 5MI0C 5KJRH 2WNZA 4Z1PA 4I1RA 2VX7A 5I74C 3LQZB 5EIIB 4UQ3B 3SD5A 1E7UA 1QNOA 2VABA 2JGYA 2Z1KA 1N67A 3R1GH 1EA9C 1BEXA 4QXGH 3SKOB 4U6XA 4I0PA 4YHIA 2HV5A 1X44A 4XNMA 1OLLA 3GAYA 1C12A 1DSWA 3S5ZA 1GKOA 3T0EA 3MPGA 4TPRL 3KPPB 2OS7A 2Y7QA 4CNPA 2QR6A 3AVEA 4MQXD 3I50H 1KBLA 3D3VD 3UH8A 5CHNB 2OB3A 1A7QL 4NXKA 2PURA 2MSPA 1WDQA 1IBYA 5EHFA 4NO3A 1QR1B 5AW3B 2WO3B 4HIJA 5D9OA 3NEXA 5I0WA 5GGVY 2XXCB 3MNZA 3P80A 4LP5A 1M2OA 2CKBL 4MQ7B 3U9PL 1EHLH 4C1NB 4P8XA 1NZRA 2A6KA 5B7MA 1E6ZA 1G1KA 3SRHA 1NL0L 3PJSB 5C6TH 4J3BA 4IG2B 1YEKH 3RIFF 1CD1A 4QTGA 4UTBH 3C6SA 1CBVL 2HMID 1XZ0B 5DO8A 2FIRT 2OJEA 3HG0A 3W2NA 3BE1H 2I9TA 1DIEA 4JIQA 2NUTB 2BOLA 5I6OA 4RMUA 4D6GA 4PP2A 1LG1A 2VLKE 2PP3A 5D7IE 5JPNA 3FU9A 2ZUTA 3QSRA 4A8NA 3EGXA 4EXQA 3R1GL 3SQBB 3ZDZF 1JZIA 3HN3A 4XODA 3LQMA 3FTZA 3IXAB 2D8KA 2I57A