1G94A

Crystal structure analysis of the ternary complex between psychrophilic alpha amylase from pseudoalteromonas haloplanctis in complex with a hepta-saccharide and a tris molecule
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 158
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2000-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1g94A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1g94A01
2YBUA 3BVXA 2J8FA 4ACZA 3G6MA 4E4PA 5I0DA 1D3CA 2CERA 1JAKA 4HA4A 3BH4A 4Z2LA 3A47A 3H55A 3CZKA 5CGTA 2TAAA 5A8PA 1VF8A 4DUWA 1R86A 4HU8A 1V6UA 1XYFA 2NT0A 3THCA 3BLKA 2ZICA 3BUIA 3DYMA 2WKGA 3A3HA 1JNDA 1MW0A 4DWSB 5A6JA 4QLKA 4J27A 4K68A 1GQKA 3VINA 5ABGA 3A6OA 1FP9A 2YL5A 4UZUA 2CBUA 2VJXA 2EO7A 1OB0A 3GXNA 4LQ1A 2UY4A 3AMCA 4TVCA 3MV01 4HU0A 4AWEA 2ALWA 2A3HA 4MB3A 1GOOA 4WKAA 1IT0A 3ZO9A 4W87A 3AMLA 1RH9A 5ECUA 1LWHA 4W5ZA 3EJRA 1JF6A 2ZX5A 4CVWA 1B3VA 4X0VA 3PN8A 4LYRA 5A69A 5CPSA 2VRQA 2BHYA 1UH4A 1WDRA 1DWHM 1JZ4A 1UQZA 3VD4A 3A22A 4NF7A 2AAAA 4JCLA 1B3WA 2DSKA 5LA2A 4OOZA 4LGXA 2YOCA 1CYGA 3FY1A 3N04A 3VGGA 5E0CA 5IFTA 4CUCA 4AD4A 1ZBWA 4HA3A 5JBDA 1CTNA 3DX3A 3DX0A 1BTCA 1UHVA 3VSTA 1PIFA 2PB1A 2Z1SA 3VDHA 1E73M 3POHA 1PS3A 4YHGA 3RM8A 3F5LA 3BLPX 8CGTA 1W1TA 3LRMA 1FH7A 1MYRA 2ZUSA 1E1EA 3VNZA 3ECQA 5CPQA 3A4XA 3VNYA 6TAAA 4ATDA 1KCLA 4E2OA 5KZ6A 2O9RA 1V3JA 1UD8A 4YN5A 3DX4A 3RJXA 4AIUA 3N9KA 1WP6A 4J7RA 1V02E 1E6ZA 1HF6A 4P8VA 2FHFA 2XJ7A 3W37A 1CXLA 4PCTA 4ZEPA 1QVBA 1TVNA 2G3NA 3UG4A 4P8XA 4UTFA 3AIRA 3W82A 3TONA 3WDRA 4C7GA 3H53A 3WDIA 4D1IA 3SCNA 4Z2HA 4NRRA 1WAWA 3ARYA 3WSUA 1PX4A 3OGVA 2D0FA 4PUEA 4OIFA 1UOKA 3D3AA 2WBKA 1XD1A 3QOMA 4AEFA 9CGTA 3EDFA 3MMWA 3II1A 1HJQA 3AZTA 2YKKA 4P7LA 1A47A 2WAGA 3AZRA 3I3BA 3AS1A 2W67A 4PMUA 1ODUA 1E0XA 2WHKA 4MB5A 1H1NA 4ATWA 1HNYA 1CGVA 1JDCA 1EDGA 4H04A 1XH1A 2YDRA 3FAXA 1GVYA 3GNPA 3HU7A 1ZB5A 2J7GA 1RP9A 5I77A 4PCSA 1W1PA 2ZX9A 2BHZA 4CD8A 1UD4A 2RGMA 3AYSA 4P7RA 1UZ1A 1UASA 3AS0A 3SCQA 5JBEA 1HVXA 4OGZA 3BVTA 1UR1A 3CZGA 4QP0A 4BS0A 3VMNA 1V0LA 1EO7A 3AIQA 1G9HA 3AHTA 1HN1A 1ZS2A 3WD1A 3EDDA 1BSIA 3ZSTA 3EBVA 3UG3A 1BPLB 1Q6GA 2GJRA 3AIWA 3CBWA 1E15A 2VCCA 4W7WA 3CUJA 2D22A 2PWDA 5D9MA 4N42A 3UETA 1R33A 3GDBA 4W8BA 1V08A 1K9EA 4NXSA 2JIWA 1UH2A 3B9AA 1HP4A 3W81A 2DSUA 3NSXA 3BC9A 3AIUA 3L4UA 1PX3A 5E9AA 2Y24A 4FLOA 3ZR5A 1GZJA 4MTVA 1IV8A 1R87A 3BSHA 3L4ZA 1EHNA 1US3A 2VZUA 1KWKA 3T0BA 5I2UA 2VI0A 4PTVA 3OG2A 4HOWA 3UESA 1CLVA 4BA0A 1U30A 2D0HA 3WDQA 3VDCA 1QI2A 3ARWA 1JYVA 4NZJA 1NP0A 2GDVA 3AZSA 4D6HA 3EJUA 3WDJA 3AS2A 5CSYA 2WMIB 2WMIA 1CXHA 4L4PA 3GXDA 1UD5A 3BUQA 1UZ4A 4Z2JA 4C7FA 3K4DA 3W38A 3OA5A 4UQCA 4MAVA 3CUHA 2YFOA 2CETA 1LL4A 4JHOA 5E09A 2WLZA 3NDYA 1E3ZA 2X2YA 8A3HA 1PIGA 1H3GA 1HKMA 3RCNA 3BLBA 4P7NA 4F8XA 1EDTA 2G4FA 3O2LA 3T08A 2BY1A 1JNEA 1M01A 3D4ZA 1CEOA 1OM0A 2BNJA 5E6YA 4HMDA 3M6DA 1E4LA 1GORA 1TQVA 1LF1A 2E9MA 2VCAA 3WNMA 4H7VA 2V5DA 5D8ZA 5FD0A 1MXGA 3WELA 4MPKA 1Q6FA 2DQXA 4GXPA 2WZHA 1CZ1A 4KH2A 1M03A 1CXKA 7TAAA 3KLLA 2BY2A 4W84A 2XVGA 2VQTA 2D24A 1UWSA 4TX8A 2O9PA 3VIPA 1L0PA 5EB8A 1UR2A 1PBGA 4HZ7A 1EA9C 2D2OA 5CXPA 3ZJKA 4GO8A 3FXYA 3SCRA 3EMZA 2GUYA 1BAGA 4HMEA 4NZFA 4P8WA 1AQ0A 4TOQA 1KGXA 3LRKA 3U5UA 4JFUA 2OWCA 2X0HA 2C0HA 2W63A 1JFHA 4NSBA 4XUYA 1LWJA 1KTCA 3BAKA 1E4NA 3W6LA 2WW5A 2F7QA 2NSXA 3NDZA 1HJWA 3AXXA 1XCWA 3AHXA 1K9DA 4UFMA 2A3AA 5GNYA 4J3SA 2O9TA 4WIWA 5JIWA 4U31A 2W61A 2W91A 1NWUA 1E6NA 5A8MA 2WKLA 4UNIA 3VDBA 2YDSA 2XVNA 3WQ8A 1GHSA 3ARVA 3CUGA 2WCAA 3CHEA 2GK1A 1VENA 4CGTA 4TUFA 1UD2A 5CLTA 3RMEA 1WPCA 1ECEA 3AXHA 2VO5A 2CITA 4Q22A 4GZJA 1CWYA 1LQ0A 3SUTA 4WJXA 1CLXA 4NI3A 4ACYA 5ABHA 2E9BA 2Q8XA 3RIKA 3TTOA 2VT0A 3BMWA 2YLAA 1CXEA 2D1ZA 1W9BM 4FK9A 1E1FA 3WUFA 2V5CA 4LPCA 3LXCA 1EGZA 3HG4A 1E6XM 3W29A 3WF0A 1O6IA 4AZIA 4AZHA 3HG2A 1TR1A 5BRPA 3T2QA 2Y4SA 1T0OA 3W53A 1CPUA 1YHTA 2UY5A 3HN3A 4X9YA 1OD0A 5FCZA 5AC5A 1HP5A 5TD4A 5DO8A 4D6DA 4FNTA 2VNCA 2ESCA 3NYDA 4UQDA 3W28A 4CU8A 1E5NA 5AYBA 2JE8A 4Z2KA 4LYQA 4FNPA 5HXMA 1W9VA 2EADA 4FLQA 3RPMA 1V3IA 3AOFA 2XPKA 1O7DC 3WMSA 3IGUA 3WENA 1XSIA 3VX0A 1B9ZA 2X09A 3PTMA 3CTTA 1H5VA 2X1IA 1ISZA 4QFUA 2YBTA 2BY3A 1WNOA 3VGHA 3BUBA 4AISA 3CHDA 1JXKA 3NCOA 5BYWA 4PTWA 4F9JA 5BRQA 1VEPA 2ZUUA 3VGDA 4H41A 1KGWA 3KEHA 1WB0A 4WKHA 1W2VA 1WZKA 4U3CA 1V3LA 2E3ZA 1O7AA 5I23A 5D9PA 3PZTA 4JKLA 2DSZA 3WQVA 5CJ5A 1WKYA 1JDDA 2BVYA 5CQ1A 4WF7A 4WLCA 1P6WA 3T09A 3MKKA 3OGSA 2GJXB 3WD3A 2VX6A 3L4VA 3GH5A 3CZNA 3IK2A 4FNUA 4HTYA 4TTUA 4HZ6A 2FHCA 1QOXA 3ZJ6A 3AI0A 1AMYA 1NQ6A 3WN6A 1OGSA 2A3EA 3CUIA 1W2PA 2W62A 3HJEA 2JIEA 2J7BA 2ZUWA 4JL1A 3WY4A 2V3GA 3QHOA 1J0JA 1V0KA 3AICA 1XC6A 2J7DA 1M53A 4HZ8A 1KBKA 4GZEA 6CGTA 2PWEA 1KR0A 1WZMA 1XCXA 2CYGA 3EDEA 4JFSA 3GZAA 4D6FA 1NM9A 1RD6A 4PSRA 3WY2A 2VZVA 1QNQA 3AHZA 3FHAA 3A23A 1OIMA 1UWRA 1KGUA 3ARQA 1XH2A 1QI5A 3UERA 4KGLA 4M1RA 1QBBA 1KQYA 3AMGA 2OSYA 1QNPA 2J7EA 1W9DM 1UH3A 4PN2A 3G6LA 1QI3A 5D4YA 3WEOA 3VIGA 2CXGA 2J47A 3CZSA 3NSNA 1BYAA 1LLOA 3D50A 3AXIA 2D20A 3RM4A 1LG2A 2G41A 3RO8A 3CGTA 3QHMA 2AMGA 1J0YA 2YDQA 2EABA 1L8NA 1UKSA 1VBUA 2VMFA 3ZJ7A 4B3LA 5ABFB 4J3UA 5FOOA 4ZXLA 4JFTA 4AZCA 3T0DA 2BS9A 1CNVA 3WIJA 1JFXA 1HJVA 1CDGA 4KMQA 1E71M 4L4OA 4U3AA 5E6ZA 4MNKA 2VRKA 1GOQA 3UR7A 2WPGA 1ZBKA 4QCFA 5E1QA 2IGTA 1NP2A 3WL1A 3U7BA 1V0MA 2OWWA 2CCRA 3NUKA 2F7RA 3M46A 1J0HA 1JAEA 5CSUA 1B90A 1V6YA 1VFFA 4M24A 1JYWA 4NRSA 3M7SA 3SCSA 3WF3A 3OLGA 3MS8A 2WMJA 4TVDA 2MANA 1CXIA 3WDPP 4TTGA 1ODZA 5HNNA 1W9UA 5HOSA 3PZNA 2FGZA 2FYVA 1E43A 2WVTA 3KZSA 4D6GA 5A8QA 1R8LA 2O9OA 1HX0A 4Y7EA 2J7FA 1HTYA 4HOXA 4CN4A 1ZBVA 2EACA 2WCSA 3KWXA 2DT2A 4AD3A 1JYXA 2WWDA 2X2JA 3VIMA 1HKIA 1I75A 4FLSA 3MUY1 3SUSA 2BXZA 1EOMA 1Q6DA 3AYRA 4PMZA 4W86A 5A2AA 5KEZA 3OLDA 2DSWA 2G3JA 2PBGA 5DT5A 3WNKA 5A2BA 4H8HA 4UQ9A 1QW8A 1Q6CA 4RL3A 4FNSA 3K4AA 4PBGA 2J4GA 3MUZ1 4AZ7A 1KFWA 4D71A 1RP8A 5A8NA 4PUDA 3CZ8A 1QNRA 3WF1A 4EE9A 3EJSA 3PBGA 1JDAA 4DUVA 2FH6A 4V28A 1Q4NX 2XFFA 3TV8A 3W6MA 2WVVB 2EEXA 4MDOA 1QHOA 2WHMA 4PTXA 3W24A 1JD9A 1JF5A 4GI6A 3WUEA 3PHAA 3AISA 1PJ9A 2DIJA 1E3XA 4M80A 2E8YA 2FH8A 3BXWA 2CNCA 1UKTA 4MAZA 4ZXOA 1KBBA 3ZMRA 1FFQA 1K6AA 3UG5A 1CXFA 3SCPA 4GKLA 4B9ZA 3MUAA 4PMQA 5JIPA 3OZPA 1UKPA 2OLHA 1JD7A 2BVTA 3TTQA 3I3DA 1JZ3A 1XV8A 4MDPA 1BLIA 1FHDA 3T0AA 1FA2A 1IZJA 3FW6A 1NOFA 1C8XA 2D3NA 2WANA 1TUXA 2V3FA 2HVMA 5GNXA 4MB1A 5A3HA 5DT7A 1VEOA 1W3LA 3HZ3A 1KXQA 3CV5A 4UCFA 5HDRA 3WBEA 2VUYA 4AMWA 3PZVA 1OGGA 2J77A 3CZJA 4V27A 3GBEA 4UQEA 2EPMX 3VGEA 2WZIA 1EIBA 2UY2A 3SCWA 1E4IA 1V6WA 4W8LA 1K9TA 2JF6A 3T2OA 2VZSA 1MXDA 1R85A 4TX6A 5BXRA 3OBAA 4ZENA 1HT6A 3AS3A 3OB8A 1JZ5A 3N11A 1MW2A 1UWUA 4D6EA 2V3EA 1V0NA 4EKJA 1J01A 3SUWA 1BGAA 3DDGA 2EBNA 4PMNA 5I6SA 2X2IA 4PTMA 5A1AA 1UA7A 3DHPA 4J3VA 1EO5A 3VDAA 2XGBA 3VOCA 2OYMA 3OGRA 3D51A 1JYNA 2DT0A 2YLLA 4UFIA 4IUGA 3PTQA 3S6TA 2JF7A 3D5HA 5I5RA 4AEEA 1H2JA 3CIVA 3W0KA 2G3MA 1FH9A 4V2XA 4JKKA 1DP0A 1HL9A 1UWIA 3VGFA 1WDQA 1OIFA 3SCOA 4N0RA 3GBDA 1RPKA 5CPTA 5DFAA 4S3JA 4PMDA 4B15A 1R46A 3S2CA 2WC3A 4PMXA 5D9NA 1WZAA 4PMRA 2W66A 3WNLA 2GK1B 2VVSA 3B8SA 1TQTA 1XH0A 2ZWYA 3CZLA 1KTBA 2EPNA 1ZJBA 4W8AA 3QHNA 5FL0A 3NSMA 3VX1A 1TCMA 3VTRA 1JGIA 1V3MA 1EHAA 1HKJA 4NX0A 2E0PA 1TA3A 3AQUA 1AVAA 3M07A 1JZ8A 3SCVA 4E8DA 1SYTA 4OBRA 2XWDA 4RE2A 5AC4A 2CHNA 1BYBA 3T2PA 3BAJA 4GPNA 3QOKA 1GNXA 4PMYA 4AD0A 4AD5A 3JUGA 3A4AA 1CGWA 5BXSA 1PZ3A 1GQJA 5JUVA 1FH8A 4TVUA 3BGAA 1WZLA 2XFYA 5A2CA 2PC8A 3EJTA 4MNMA 1WCGA 1MFVA 2QF8A 1QI0A 1NH6A 2YA2A 2YL9A 5I79A 3AFBA 1HJXA 3VD7A 5A6LA 1GHRA 4P7QA 1J11A 1QNSA 1FFRA 4GQRA 1UR9A 3ARXA 1Y7VA 3VGBA 1NARA 1DWGM 4LXFA 1XSJA 4OKDA 3VIHA 4HPGA 2D23A 4UOJA 4YPJA 1BF2A 3PZQA 3GNOA 4MNLA 5JBFA 4QCEA 3GH7A 1W3KA 2V3DA 1MQRA 2Z1KA 4UFKA 1H4PA 3ALGA 1UUQA 1LG1A 3GXMA 1C92A 1QW9A 3KL0A 3WD4A 2OYKA 2XIBA 3BVUA 3LPPA 4GQQA 3U57A 4AZCB 1VJZA 5IHSA 1W1VA 1TFVA 3PTKA 2WLYA 2EXOA 3PZOA 4B16A 1J9YA 5E0FA 4ZE4A 3KE0A 3KLKA 3B9EA 1TQSA 1PX8A 2WMFA 3FAWA 2WBGA 1MWOA 3L4TA 3L4XA 3LX9A 3MO4A 4DM1A 3RJYA 2XUCA 2WC7A 1J0KA 2QMKA 1C90A 2UY3A 1CIUA 2ZXQA 2GVYA 4P7OA 4GI8A 1DWJM 6A3HA 1CENA 1QPKA 3BAIA 4D6JA 4H8UA 4URIA 3AHYA 2VURA 4OJYA 3EDKA 3VU2A 2XSAA 2CESA 1R75A 4BZYA 4GZIA 1JZ7A 3ARUA 2IXUA 3A24A 1DWIM 1VRXA 7CGTA 4CCCA 2XVLA 3TTSA 3SCTA 2ZWZA 4W85A 4DM2A 1E56A 1VB9A 1Q6EA 1UWQA 3ZT7A 3AIVA 4EAMA 4AXNA 3MU7A 2RGLA 1SMAA 4HA1A 2FDMA 3DYPA 1H0IA 4M8UA 4IM4A 5CG0A 2YFNA 2CIPA 1FP8A 3DX1A 2YA1A 1QX1A 3OZOA 4UFLA 5A6BA 4CU7A 2F8QA 1H09A 2Y2WA 2AOSA 1KXHA 1IZKA 2BY0A 2NT1A 3K8LA 4X0NA 4OUEA 4P8UA 2WVUA 4QLLA 2QHAA 2Y8VA 1NOUA 3HG5A 4U33A 1ITCA 2YA0A 1I1WA 3GXPA 1D7FA 5HPOA 2JEPA 4A3HA 1OWQA 1GOWA 2ZUNA 1EOKA 3SCUA 1BQCA 2OYLA 1J10A 1DWAM 4BQ2A 3GXIA 4YHEA 2BV9A 1OINA 3WY3A 3AJ7A 2WYSA 4JIEA 2F7OA 4Z2IA 4UFJA 3CHFA 3GXFA 3VILA 2CHOA 4F9DA 1QI4A 5A6AA 5M17A 1G0CA 4GI9A 2D0GA 2ZXAA 1U2YA 4AC1X 1D2KA 3D4YA 4XB3A 4AZ6A 1OGBA 1QWNA 1V6XA 2BHUA 1GOMA 3GYCA 1W3JA 1JXJA 3BUDA 2VR4A 2WNWA 2QPSA 3GTNA 2BFGA 3WFZA 1MQQA 2VR5A 3N13A 1VFMA 1US2A 2WMKA 3NIYA 3BVWA 2XM2A 4D1JA 5C8BB 1C7SA 4R27A 3ZM8A 5M3WA 1GPFA 1SMDA 2A3CA 1KR1A 5EFFA 1XGZA 3OLEA 1ZBCA 4J3XA 2VX5A 1NWTA 3WKZA 1QHPA 4M29A 2XN0A 1EQCA 1QHZA 1CGUA 2PI6A 4OOUA 4M81A 2J74A 3SUVA 1E6PA 1EH9A 1FHLA 1MW1A 3BAXA 1H41A 1XHGA 3ZIZA 2J7HA 4Z2GA 1J18A 3ZR6A 2QMJA 3BAWA 1SZNA 3AMKA 1JIBA 3LPOA 2EPLX 4IISA 3ZSSA 3DDFA 2XN2A 2XFRA 2J25A 1B31A 3LPFA 1E72M 2CKRA 4DWSA 1C7TA 1R7AA 5IHRA 1MFUA 3W26A 1VFOA 2BVDA 2EPOA 3B9DA 3NJ3A 1I1XA 1JG9A 1E4MM 4M82A 2F61A 3WDHA 4UFHA 4AY1A 2CBVA 1ZU8A 4PYSA 1OBAA 1ESWA 2ZIDA 2XSBA 1F4AA 4E8CA 5FKYA 1WE5A 2ZOXA 4LYPA 3MUIA 1NOWA 3K46A 1VAHA 2CEQA 3ZOAA 1B30A 3WQ5A 2D3LA 1J0IA 5ABEA 2XTKA 3WH9A 5LA0A 3ZQ9A 2EJ1A 1CGXA 2QLYA 2QPUA 4FF5A 3VVGA 3O9NA 3W4RA 3E1F1 4AW7A 4WKFA 2X0YA 2DSVA 4A4AA 1SR0A 5C71A 2DIEA 2J7CA 1CGYA 5IDIA 1KCKA 1EQPA 5M03A 4UOZA 1AQMA 5DF0A 3VIIA 3TTYA 1W91A 3VD3A 3WMCA 5BXPA 1TZ7A 4H2CA 3D52A 3F5KA 1V3HA 1X1NA 2WWCA 2E9LA 3GXTA 1JL8A 1BYCA 1BVNP 1E9LA 1VIWA 4RE4A 1VJSA 1HWWA 4BQ3A 3A5VA 5IXEA 5EMYA 3VSUA 1TMQA 1B3XA 1H11A 5GPRA 3VSVA 5FL1A 2DEPA 1TVPA 1HXKA 5LYRA 3LRLA 5AY7A 3RM9A 2YIHA 1ITXA 4B9YA 2WC4A 2EQDA 2JALA 3LPGA 4WSKA 3WEZA 1G5AA 3HG3A 2Y5EA 3H54A 2GDUA 3F5JA 3WNNA 4AYGA 3IJ7A 5ABFA 1PAMA 2HISA 3DHUA 1E5JA 3EYPA 4HP5A 4CN1A 3TOPA 1CBGA 2WMGA 1K9FA 3WH5A 4UQBA 2C8NA 1UKOA 5CLWA 2JFEX 3WD2A 4PMVA 4UQAA 3VIJA 3WMBA 4U5KA 3UR8A 4AD2A 3BUPA 1JI1A 3ALFA 4OBSA 1E0WA 3VUPA 1Z32X 3IANA 4ZE5A 1E6QM 1PEZA 1MQPA 3K1DA 4U2YA 1UD6A 4W7UA 1X6NA 1OCQA 3VKKA 5BXTA 2PWHA 2ZXBA 2DH2A 4MNJA 1E40A 1GOIA 1C8QA 4HOZA 4PRWA 4CCEA 4NXKA 3GH4A 2X2HA 3I3EA 2W4XA 3A21A 2WVSA 1V03A 4DO4A 2C7FA 4KWUA 5GNZA 3VIFA 5BCAA 3EMCA 4UZSA 2GJPA 3CHCA 1B3ZA 5GQBA 4H8VA 1OT2A 5AYIA 3WNPA 5IFPA 2VCBA 5A95A 2CPUA 4BF7A 2ZUTA 3CO4A 2F1BA 1S46A 3IAQA 5E70A 1N82A 4D6CA 3CMJA 2D73A 2WK2A 3TP4A 1JZ2A 2VC9A 1UD3A 4J3TA 1QWUA 4DO5A 3FNDA 3ZT5A 1HVQA 3VIOA 3A4WA 3GNRA 1XSKA 3U7VA 2ZUVA 3PZMA 1ISXA 3EDJA 2QV4A 2XYLA 4OZOA 3WL0A 4B3KA 1E55A 1LJYA 1B0IA 4CU6A 3BMVA 1W3HA 2EPKX 1R47A 2GSJA 2JEQA 1BGGA 1VBRA 4AD1A 3EMQA 1G1YA 3HMCA 3VMOA 1ZL1A 4J3WA 3TA9A 4KGJA 1F4HA 2W5FA 3ZT6A 1KXVA 1E70M 4PEEA 5D8WA 3W25A 4LX4A 4W93A 2XHYA 1NWRA 1YQ2A 2XN1A 2XVPA 2DPEA 1HKKA 1UQYA 1FOBA 4UR9A 3WBAA 1HJUA 1OSEA 5BROA 3WF2A 5HBFA 1ISVA 4D72A 1BVZA 3MSDA 1UYQA 4WSJA 5D9OA 1EXPA 4DWSC 3IJ9A 2FHBA 1OT1A 2BXYA 4JKMA 2VTFA 1UWTA 3O6AA 1ZJAA 1V6VA 3CMGA 2VQUA 4CD5A 1JZ6A 3FHQA 2WVVA 4AIEA 4DO6A 4W5UA 4EANA 2J62A 4XV0A 3L2LA 2ZX6A 1ISWA 2CBJA 1W32A 2VOTA 3WQWA 1KQZA 1PPIA 1H49A 3L4WA 4AYSA 1UG6A 2WXDM 3MMUA 1TQWA 2OW6A 1EDQA 3MMDA 4EK7A 4TXEA 2Y8KA 2DT3A 1KB3A 2PWFA 4C7DA 4S3KA 4W7VA 1UKQA 1J12A 3PZ9A 3QGVA 5I3DA 5CGMA 4DWSD 1G01A 5EFDA 2X05A 1J0ZA 2GFTA 2WSKA 2DH3A 3WEMA 4KRTA 1LL6A 2A3BA 1HIZA 3W27A 1UR4A 1R34A 2G8ZA 3WD0A 2FE0A 5I24A 4JFVA 4MJ2A 1ISYA 3BAYA 3SUUA 1SFSA 3S5YA 5F7UA 4NZCA 4CCDA 2PWGA 3CZEA 5DMYA 5A94A 4BCEA 2ZUMA 2YL6A 3ARRA 3ZJ8A 3PZGA 4ATLA 4D6IA 3ARZA 3CPUA 5BWFA 4F66A 3WQ4A 3F4VA 4WK9A 3WNOA 1DEDA 1WDSA 2XGIA 5C70A 2NW0A 1UA3A 2ZX7A 3MI6A 2ZXDA 2OSWA 1E6RA 1E6SM 2XG9A 4JHZA 1TE1A 3EJPA 5HPCA 2CBIA 3THDA 5FIPA 4Q7NA 3UCQA 4U2ZA 2IUZA 1JI2A 4CD6A 4GO9A 1XYZA 3U5YA 2E8ZA 1CGTA 2WCGA 1H0GA 3K8MA 4FNRA 1GQLA 3VD5A 4AZBA 4AZ5A 2B31A 1AQHA 1GOKA 2PF0A 1XRVA 2WZEA 4RE3A 3WQ6A 2DDXA 3CLWA 3J7HA 2V38A 3VM5A 5A6SA 2F1AA 2WSPA 2J79A 3WUBA 3LMYA 1C8YA 1C91A 3KL3A 3S5ZA 1W1YA 1U33A 5EBAA 3LXBA 4JAWA 3VD9A 1UR0A 3N12A 2VX4A 2E4TA 3VO0A 5I78A 1HJSA 4JFWA 3AIBA 4UOQA 4IPLA 3BVVA 3WH7A 1GJUA 1BYDA 3N1AA 3PZUA 1GW1A 4MADA 2VVNA 1BG9A 3DECA 1M04A 2WHJA 4GINA 2W92A 3K8KA 3WF4A 5A6MA 1GONA 1OD8A 3MV11 3VPLA 2VZOA 3BCFA 4AIOA 7A3HA 4XX6A 5M5DA 1C93A 3RILA 4AMXA 2VL4A 3ARPA 2F2HA 4W89A 4KRUA 5A8OA 4CD7A 4HMCA 4JL2A 3BSGA 3GM8A 3KL5A 4AMCA 2G3IA 1B1YA 3IAPA 4R5EA 4BQ5A 1DTUA 2OSXA 4DUXA 4IPNB 1C3FA 4CD4A 4ML4A 4ZFMA 4HPHA 2J78A 3QR3A 2WB5A 5LA1A 1X6LA 3VIKA 4J28A 1G94A 1R7OA 3N15A 2ZE0A 2DT1A 1TG7A 1E0VA 3CH9A 4AZGA 4QAWA 4FNQA 2X8RA 3LXAA 1MW3A 4ACZB 1CECA 1GVIA 4CN6A 3ARSA 3L2MA 4XZBA 4MB4A 3SIMA 1QNOA 4M56A 3SEPA 4CKQA 2E40A 2PBOA 3WH6A 5A6KA 2J75A 3L4YA 2DGAA 4A3YA 4JCMA 3CUFA 2XM1A 3DX2A 4FLRA 3OLIA 1XD0A 4BQ4A 1B3YA 3UEQA 4QLJA 2WM0A 1DWFM 1QBAA 1WDPA 3PZIA 3VM7A 1TQUA 3WFLA 4GIAA 2F18A 2ZX8A 4QDMA 3BCDA 1BG4A 3AHVA 3VMPA 1NWSA 2O92A 2VX7A 2CKSA 4FMVA 5CZKA 1PZ2A 1KXTA 1GUVA 1HXJA 1UR8A 1GCYA 1BHGA 4MJ4A 1GQIA 4W88A 3EJQA 2XVKA 2J8GA 5A6BD 1VFUA 1MVYA 1KWGA 2XWEA 3SURA 1VEMA 1A3HA 2IXVA 2UWFA 2OW7A 1W9XA 4XZWA 3APGA 2WMHA 1V02A 2FGLA 3RDKA 3WUGA 1TA3B 1BFNA 3WY1A 3MSGA 2OWXA 4PMOA 3WH8A 3ARTA 3POCA 1DHKA 4CVUA 4JZ5A 3IJ8A 3DYOA 1HL8A 1B2YA 2YL8A 3N17A 3AIEA 3N18A 1W9PA 3FN9A 3AMDA 3OIHA 1M7XA 2VRJA 2WHLA 3CC1A 1LL7A 2YJQA 4F79A 2XIIA 4PSPA 5DEZA 2GJXA 2VZTA 4U5IA 2F7PA 3MANA 1WO2A 1V3KA 3DC0A 1GJWA 3AROA 2EAEA
chains in the Genus database with same CATH superfamily
3V6ZA 4ANKA 2I5QA 2XKNA 2Z35B 5I0DA 1D3CA 1E6JH 1XCQB 4IRSD 5C09B 5A3ID 2CLKA 4ANUA 4KROC 4XCFL 3SDAA 1I1CA 3MV9E 4NGHH 2QQLL 3TBBA 1NAMB 3CBKB 1GVSA 3IUHA 4Q8UA 1SHWA 5CGTA 1LMIA 4ETQB 4NNXA 3DXAB 5F8RC 5A8PA 1JGVL 4DUWA 4BQ9A 4HB7A 1RZIA 4U1MA 4GG9A 2ARJA 4BEQA 3IXAA 4PRHB 1PEWA 3BLKA 4O2FB 3U0WH 3AUOA 1D7CA 4LTSA 2DY3A 2FNWA 4DWSB 1GKEA 5DLMH 4JTRA 4REQB 4Y2NA 3TWCL 3PV6B 4PGDA 4J27A 4K68A 1L6PA 3ASOB 1L5GA 3PDOB 4NS0A 3T78A 3A6OA 1KELL 3CK0L 3U8GA 1UPPA 4X6DA 3CFTA 4WGWB 4MA8H 3GKWH 3US0A 2YL5A 2BERA 5EUOB 3QQ0A 3TWYA 4GVGA 5LJYH 3BQUB 5IFTA 2OZ8A 2V9UA 5D1XC 2CBUA 2VJXA 3TJPA 1N59B 3TVMB 5I8KH 2IPWA 3ZIYA 2UY4A 3N29A 3FQTB 1ME8A 1SQMA 3JWDC 4JFPB 4TVCA 2IKIA 2KQMA 4MQXD 1RQBA 4WXYA 3AXKA 1U3HA 3BN3B 4YSAA 1IT0A 1GOOA 2G60L 4Y7OC 2HFFB 3HNSH 1RZFL 4CMHC 1EBAA 4DVRH 1LWHA 3MNWA 2OB3A 1KIUA 3CC5A 2DBLL 3V6OC 3DFHA 3HZMA 5D71L 2A99A 2ZX5A 5I9QC 4OZGF 1A4LA 4NVTA 4MAUH 1CE6A 1EK3A 2XA8H 4KO9A 4QNPF 5F71A 5HR6A 4HIXH 4XQ6A 4RWHA 2WBXA 1UH4A 4FXGB 4MSSA 1BM3L 1WAAE 3C6LD 3ESVF 4HJ0D 4KERA 1OSYA 1UQZA 4F15B 1Z9SB 4YK4B 3VD4A 3MA8A 4URTB 4CQDA 3V4VH 3P77B 2D2HA 1N0LA 2ADGA 3KS0J 4NRXB 4E4FA 1UZ6F 4TSBL 4Y96A 3CX5K 3GNXA 2ATPB 2VLRA 1WWWX 4I5RA 4RW5A 3IIPA 3CZUB 4G7RB 4JR5A 4LGXA 3GR4A 1O5QA 1OAUH 1FO0B 2HUEA 3IRCA 3K5SA 4JKPL 3NNTA 1QPQA 5C08A 4Y9BA 3ZRFC 5D7EA 4X9HA 2Q76B 5TE4H 2AXJA 1T0NB 1ZT4A 3VXUE 2Y2YA 3TF7C 3BH9B 4IFOA 4NL1A 4JVUA 4FX8A 4XZMX 3BMXA 3RWDA 1QRQA 1UHVA 2PPCA 4XAFA 1DDTA 4NZDA 3NG3A 4OR1A 5GJPA 1PIFA 1ZGLB 3RO6A 1KBLA 4NQDE 3HB3B 5KAQF 2WXGA 2PB1A 2Z1SA 3VDHA 1KIRB 3O3EA 1GTHA 2Z6IA 3POHA 4HH9A 1Z7JA 3PU7A 1PS3A 4PJFF 1OADA 1CI1A 5EKYA 3M8OH 3ZKSD 3QG7H 2ZXCA 4Y4FC 4K8HA 3ATYA 5CEZD 4U3XA 2J1KA 3JW7A 1C5DB 2X1WL 4QRRB 1P4BL 1L9RA 1WXYA 4NKCA 4WUUE 2Y7MA 4JDEA 4Z7UA 4BE5A 4B41A 5ID1A 4KOBA 4OCNC 3EOEA 3RF9A 3O2DL 3LRMA 1FSKC 2VC2H 3F5WB 1E4XL 5IB5A 5FA5A 3BRDA 2ICWJ 1BYNA 1AR2A 2AQWA 2AQ1A 4KV5F 1THFD 4GKTA 1E1EA 1VIZA 1HH9A 2BVPA 3FTXA 4MKVA 4YVNA 3MNZB 3ECQA 3GC2A 4XZLX 4N8CL 4QRQB 4HQQL 3KWSA 4AQAA 6TAAA 4LVEA 1KCLA 2VR7A 3LMZA 3MUIA 1DSWA 5EWIL 2MMXA 4RISH 5C97A 3DEQA 3U6WA 2NQJA 4E2OA 5KZ6A 4ZMNA 4KJWD 2I85A 3QCVL 2XISA 1BZ9B 1K77A 4AI7A 2BC4A 2O6CA 2DQUL 2YUVA 4H13C 3RJXA 3HO8A 1K8YA 2VLRE 4IU3B 1CL7I 3SDAD 5DR5L 2PA6A 1JCYA 3ZDYF 3M1CA 1YNLL 3C09C 4XN9A 2OMUA 5LB1A 4QTHA 2XJ7A 1YMHB 1O1HA 1XF1A 2OGYA 2K6YA 2EDOA 2PPAA 2ESVB 3KTXA 3UF9A 2X1RA 3W37A 3HKFA 5J1TC 2YRPA 4BYHA 1K8CA 3HG0A 2QKIC 4PI2A 1TVNA 4ZW7A 2BWIA 3NCEB 4LVGA 4XZUB 2AJVL 2GT9A 3BZGA 1V05A 4NDMB 3TONA 1YDOA 3WDRA 4QNEA 2AEQL 4QHPA 3WNJA 4C7GA 3H53A 3M5ZA 4G80B 5EOTB 3K4ZA 2VOMA 4ES9A 4D1IA 4JHBA 1IGYA 1I0BA 5C0ND 1WAWA 4W4OA 3ARYA 4G8EA 4MSWB 5D1ZD 4ERIA 3OKKA 2EO1A 4AUYA 3VE0A 5EC1A 3RKDC 5J5DA 4AEFA 9CGTA 5JHLA 1WV2A 4NSKA 1CB7B 1YE6A 4EF8A 1W16A 1IXNA 3GQFA 1HJQA 3AZTA 3EHBB 4Z1PA 3MOAL 4NQXB 2AZAA 3AZRA 1ET5A 1GGBH 2AQNA 3AS1A 1ESOA 3Q7JA 4KY1L 4PWEA 3W7CA 1FDJA 5E2TH 1YO4A 3EHBD 5G4NA 3URQA 3S4TA 4O58L 3GKAA 1T7ZA 1E0XA 2WHKA 4O13A 3QBTB 2Q7NA 5IWLC 3ULVE 3HMXL 3B9NA 1H1NA 1Z9MA 2VLLB 1HHKA 4UWQB 1VFLA 2YGVA 4Z08A 1C29A 1CGVA 5IUSA 4CCZA 2FUTA 1CLYL 5BO0D 4H04A 1XH1A 1EZUA 4NWTL 1TV8A 4P2RD 1Q90A 2EEBA 4GW4B 3G04A 3RGVD 3HU7A 3NL6A 4B5NA 1ZA3B 3SDDD 4EI5A 5HHQA 4HT1L 4WJKB 4MX7A 2VLRD 1FHUA 3V16A 2NY1D 4JFXB 4IGBA 3CXOA 1FIGH 3KP1A 4QHRA 2DTMH 2ZX9A 4HZLA 1SRDA 4JQVA 1LBFA 4CD8A 1NEZG 3BEVB 3S96B 4XIMA 1ZCRA 1UZ1A 1KG0A 4TVPH 1UASA 1LNUA 5JXAL 1FO0A 2DM3A 4M1DL 1LQBC 2UY7B 3O45A 1HVXA 4JFHD 4OGZA 4LVNB 2YYTA 1AJ0A 4HCHA 4MHBA 4AWSA 1PLGL 1S8DA 3GVRA 1RPXA 5I9QB 4NNBA 3EOAA 5LDSA 5E6IB 3KOZA 5LUMA 3I02A 3QVQA 3ALXA 3HF3A 3P61A 3RJDA 3EX4A 2BPBA 3AHTA 2HRGA 3ILPB 4P5MA 4Y4KD 5C07B 1OC6A 4DZBB 4UI2A 1J8HB 2L7EA 1PDZA 4C5YA 4ALAH 1SUXA 4WUUD 4PJAB 3TW9A 2H47C 1XIBA 3X3GL 3EDDA 4LNVA 5GGVY 3QUYA 1EF2A 4MMXB 2WM1A 3S46A 2NXZB 3EBVA 4FTDA 2B1HL 5CAYB 2NQLA 3CWOX 2GLKA 1YMMB 1A22B 4WW2B 2C4FT 5INCA 3L5MA 1F8MA 4M6AA 2VCCA 3VFPB 5AZEL 3VJ6B 4X80L 5KS9A 2XIJA 1RZJH 2NY7H 1MI5A 4PJ8C 2I07B 3HA1A 4N42A 2NMSA 2ZSWB 3VFWB 1FE8H 4NIKB 3MRJB 5ETUB 1V08A 1OFDA 1K9EA 1A4JB 3QRGH 1F3JB 4D0CA 3IMWA 1LBLA 1UH2A 5J04A 2B5IC 3B9AA 3NCCB 1BQLH 5I6MA 2CKNA 3E38A 3PWUB 1M7IA 4PRBB 4QYOB 1BF8A 4GX8A 2NY6D 2ZCHH 4OGQC 5BNXD 3TIEB 2GFBA 3D18A 3S3JA 2ZZ2A 4Y5YA 1X1ZA 3LBCA 4S2SA 3SJNA 4B96A 1XLAA 4MFEA 1CFQA 3C5ZC 3SIZA 1QO5A 1HIMH 4XCEB 1GGBL 4AIZA 3R79A 3TFXA 3HM7A 2DYPB 3PF2A 1RALA 3FZUD 3EFFA 1F41A 1RK0A 2CLRA 4L8SC 1P1VA 4FLOA 4M6MH 5JPMA 1T6WA 1GZJA 3RX4A 4NFDA 4MTVA 1UWAA 1KOAA 3BKCH 2FGWH 1YJDL 2UVEA 5FYLD 1GYUA 1I6NA 2W07B 3V4VL 3UDWC 2HSAA 1IKNA 2VI0A 3NTYA 4LBEB 4NJ9L 1EJSC 3MCYA 4WFFE 1N0XH 2D0HA 3FCSB 3QZAA 2NY4C 2EDDA 3COOA 4LLWA 4GNJA 1VFHA 3DKJA 4JO3H 1QI2A 2IDFA 1EUNA 5DY2A 3WTTA 1X98A 3T6CA 3G1RA 3T1GA 1NCCH 3MVSA 3X1FA 1R17A 4Z7WE 1U8OB 5DVNA 4WCYL 3WDJA 1RHCA 1WUZA 3AS2A 4S1SL 2AJYL 4QE5A 2ALDA 1Y6NR 2C1GA 2WMIA 2Q3AA 3GXDA 1T80A 3BUQA 3CJPA 3SJ3A 4E3VA 1V7AA 5HI3C 1TCRB 2X4UB 4C7FA 3DIPA 4N0FB 4RDZA 3W7EA 2GVLA 4JQVC 3O0RL 4UQCA 2XSXA 3UT0A 1LEKB 1Z3RA 2YFOA 4PWFA 2G2RB 2CETA 4UM9B 3DBNA 1OIOA 5JXEC 4L4LA 3QQ9D 5DUPL 1Y65A 2NY2D 4JHUA 4NO3B 1MHPH 1WBZA 4X9BA 1XQKA 4WOQA 5E09A 5ICZB 1FCVA 1QMLA 4L9XA 1BOYA 1AD4A 2Y1AA 3NO3A 3VRJA 5HGDA 5F7EH 4IBSA 4XR8C 1YBQB 1M7PA 3HEIB 4F20A 3T2NH 1BQHG 5D7JA 1HNGA 3VDGA 4TLTA 4HAKA 1HKMA 1RUKH 4F2FA 5KINA 2MCPL 5EL1A 4N0YL 1NCAL 1URLA 3LCYA 1H62A 4HISA 1L5GB 4L1GA 5MEPB 3UBPC 1CU4H 3QWQB 2DQDH 4JMNA 4LNCA 4QCIA 1ZSXA 1XGQA 4PJBE 5SV3A 3RWEB 2OMUB 4DVBA 4HWNA 1EDTA 1QBLH 2GT9B 2G4FA 3GX9A 2DVXA 4P04A 4CQ9A 5D2LF 1M01A 1TSHA 1NBYA 1N3NA 1CEOA 1OM0A 4TF4A 2BNJA 5E6YA 5IMLA 3DU0A 3PG9A 4HMDA 5LAXA 3GS6A 4G6JL 4FGMA 2F74A 3RWIB 1GORA 2CUHA 4RDQF 5T33H 3QIBA 4M03A 4NM8L 3WMPA 1LF1A 4LV4A 4EPKA 1NCBL 2M26A 4DJED 4I9XA 3URNA 1OOWA 1IIIA 1KM5A 2ZOUA 4ZFFB 5IV2B 1XHHA 2G4JA 1OTUC 3LRSA 3MXWH 3KBJA 1MIEH 4Y8EA 1MXGA 4O2CA 2IV8A 1B0GB 3QFDA 4X6BB 4MPKA 2NZ9D 3DROA 4OQTA 5E2VL 2DQXA 5HVGB 4C56A 1XLMA 1XO8A 4S1QH 1A3QA 1UVQA 4L29B 1WF5A 4OLZH 4YGAB 3SODB 4KH2A 1CZ1A 1ZXQA 1WLHA 2HT4D 2FMNA 3D08A 3QO0A 2RDUA 4WI5A 1BFOA 1P9MA 2FZ8A 4IFRA 3PB0A 3L13A 4QO1B 1NFDB 3BW3A 3N25A 4WFGD 4LW7A 4MWAA 3KLLA 2XVGA 3OKEB 4PCYA 2D24A 3VIPA 3QIUA 1E28B 2JJSC 2L8AA 3GEWB 4ZFQA 5KOMC 1G7IB 2BNRD 3UO1L 5ICYA 3KS6A 5EB8A 4HZ7A 1EA9C 1DXIA 3AM8A 5D1QB 1S6NA 4A7GF 2AJZA 1A6VH 5CXPA 2DMHA 5SWQA 1IC5L 3V4VA 4DP5X 3JWDL 5HINA 3D33A 1SM3H 2AERT 2V9RA 5D1QD 1KIPB 1MCOL 1TFPA 2WW8A 2XU2A 5I30L 2FJUB 3GKWL 1G4EA 2BIPA 4NZFA 1FWFC 1Z0MA 3SR7A 4HDIB 1NMCB 3LHAA 1ILUA 3TNNA 3LRKA 1FN4A 2CCWA 4YHNB 1NC2D 2OWCA 1QCWA 3OXRA 2C0HA 2GBUA 4E41D 4XSLA 4OD2B 3WQOA 1RVFH 3JV6A 1PZSA 4HS8H 4N8UA 2OXGB 2IKJA 1LWJA 3GVQA 5IMKB 3L2IA 3IDXL 5TPWL 2GQ9A 3W2JA 1E4NA 4NO0D 3WE6A 3A3WA 3NQ8A 3U2OA 1N10A 3LPWA 5EZLA 4YS4A 4JS3A 3RPIB 4RDBA 4UTWC 1MFNA 3WFEL 3BLLA 1S7SB 1DVXA 3M5VA 3ROLB 4GQPH 3VG9B 1XBVA 3PQYA 2Y63A 1NIFA 2VCOA 3V79C 3TS8A 4DF2A 1LORA 4EAEA 2HG0A 2A3AA 5GNYA 4J3SA 1NUDA 3DUSA 1ORSA 1EGJL 4AY0A 3LYRA 3RFZB 3OO2A 4WIWA 1L6SA 5JIWA 3ABXA 4C5ZA 5HD8C 2W61A 4JDEB 3U36B 4QJ5B 5ID1B 3CAVA 2OMXA 5B3JF 4JEQA 1YNPA 4KFOA 1T4KB 4PLOB 5EFIA 5GRZA 4RETB 1HWHB 3LA4A 4ZPTB 5EO1B 1A65A 4DJMA 3BGMB 5F96L 3LTSA 3V0JA 3NJFA 3STGA 2XVNA 3UPBA 5AOZA 3REVB 1MO0A 4Y1AD 4OI9A 4YSRA 5EHFA 1FZMB 4ODHL 1C8VA 4HZ8A 3ZN6A 3K6OA 3CUGA 5D03A 4Z1BA 2CKBB 2LFGA 2GK1A 1U8IA 1SXAA 2GYSA 4GQBA 2ZNXA 1IC1A 3UBHA 4TL5A 3WIAA 4CGTA 3RMEA 1MFEL 5CSZA 4C56E 5H37H 2E6JA 3BX7C 2JKNA 1ECEA 5K9DA 4OZFH 3NEEA 1GKPA 4OCMC 3AXHA 4Q9QH 1IC0A 2CITA 1S7VA 2VXQH 2BW4A 2CGRL 1LEIB 1TRDA 1TSIA 4GZJA 1CWYA 1EB3A 1RD5A 4WJEA 2OR8A 3KYKH 4CBPA 2G97A 4Q6JA 5ABHA 1TYJA 3UXFA 1U8MA 3O9WA 3IWPA 1YYAA 1QVOB 1CXEA 1MDAA 2ID5A 1CD8A 3H26A 1MDRA 3H3PL 2ZUQC 2VEGA 1AQKH 1AD9B 3O2WL 3P0YH 3T4YB 3UPRA 2DIKA 2Y7QB 4YDZA 1EGZA 5FYKE 1HFBA 1JNLH 4HF5L 1TTUA 2HRPL 1RERA 5FKAA 4FR1A 1MHEA 4F2UA 2I5IA 3GDMA 2HS6A 1Y0EA 1O6SB 4KXDA 3RZCB 3IKKA 1T1YB 4YWIA 4RDVA 4NQED 4YH6A 4K37A 2PTVA 2DEYX 2Y4SA 5DO2C 2HVJA 2JKTM 3BEWA 3ME3A 2FGBA 3SGGA 3W9ZA 4Q9RL 4YSUA 1OD0A 4ZX5A 2HS8A 4ZQKA 3BV7A 4PEKA 5FCZA 2GEEA 1KFCA 1UOWA 3HPAA 5EZJB 4PJHE 3Q8EA 3UEZA 1EO8H 2DQ6A 2J1YA 2Z8WC 3IM1A 3WFDL 2CM6A 3VYNA 4HMNA 3QP3A 1KLFB 2EDMA 4AMKL 1AQFA 2RCSH 4AGPA 2BOCB 3KW3A 3UZJA 2NY5C 4YDMA 4XNQB 4ZQMA 4E41A 4PR5B 2ARJQ 5ABZA 1BKHA 2NSQA 1B0WA 2CO6B 4LYQA 4NQTA 3H2PA 4R5VA 2DWEA 3VWKA 1J2BA 1S3KH 1JWMB 3L9BA 1W9VA 3IFPA 5KVEH 3MSPA 4OGXH 5BQDA 1NGQL 1KJ3L 4OF3A 3UROR 3DGBA 3GGWA 1Z5LA 2QSQA 1Y1UA 4OM1H 4YXHH 1LRNA 1O5XA 1IGMH 2Y7EA 3BJTA 3OJGA 2YD7A 1L9PA 4K5OA 4DOHE 4GP5B 3PHQA 4JM0A 5CPOA 1QEWA 2PGFA 3VXGA 3OMIB 3HFFA 3GHUA 5D32A 2H6RA 1XP3A 1EJ8A 4B5TA 4AE1A 2RUSA 1K4CA 4ZSOE 5C7HA 2YYUA 1L9SA 3R13A 2DJ4A 1ZENA 4YTSA 2RFXA 4OFQA 5CHNB 3ZO0A 3PGDA 4YGVA 5GRWA 4IBVA 1TZHB 5IDZA 4L4TD 4UWMA 3SJVB 4RAVB 2DJMA 2X4SB 3T42A 4HJJL 1BQGA 3MV8E 1DQUA 1WNOA 3M7WA 2ZCLH 4AISA 3ATBA 2WBJD 3B9KD 3NCOA 1HE7A 2BNUB 3RRQA 1VDGA 2DM2A 4F92B 2ESVD 2RB8A 2V2WA 2VSCA 4HJGB 4Q8BA 5KVFH 2CO7A 4H41A 4Q3MA 2PCPB 4JRXB 1KEGH 2CBOA 1CMOA 3O6FD 1WZKA 3QIBC 3DPBB 3N0PB 4NKQB 3BOFA 2E3ZA 1E28A 4I2XE 3Q3GA 1O7AA 5DLLA 5G1MA 1T6BX 4JKLA 1XF5B 1SVCP 3ALWA 3B0XA 5CJ5A 2FWSA 3DOSB 4FQJH 4I7UA 2BVYA 3HC0B 4Y5YB 1H1YA 3ARGB 1M6JA 5CQ1A 5LHFA 2P5NA 3CV7A 3L5LA 4WLCA 3GI8L 3IKCA 1ZE3H 3WJXA 2YWZA 5CGYC 3T09A 5AB9A 5F89A 3WUZA 1TETL 1T04A 3V6FA 4N2IA 3VFWA 1IEBA 2J6XA 4QXWA 4U6XB 2ZRWA 5FF6A 3LM7A 3QEUB 2J2ZA 2VN6A 3CZNA 3IK2A 1OLZA 1YUHA 4KUZL 4NQSB 2Q8AL 4YHOL 2HUHA 1CI5A 4HTYA 3W2MA 1LT7A 1QOXA 2Z31D 2FMOA 5C0CD 4XVJH 3A6BH 4QRRD 3ZJ6A 1UCBL 3ZY7A 4YSQA 1AMYA 3GDLA 35C8H 3KVJA 4DUOA 2AJ3A 5F7NC 5FDYA 5HQEA 4Z42C 1C5BH 3IGLA 7ODCA 2VENA 4I18A 3CUIA 4NP4H 3TH4T 3VXRD 1UW9A 4GIYA 1VGEL 4KROD 2PTDA 2Y6SC 4JM2D 1EDYA 1HQRB 2YAHA 5H4ZA 1KBPA 3Q13A 2ZKHH 4I4WA 2ZUWA 4U1HB 4JL1A 1V27A 1A49A 3EWYA 3VFOB 2A5HA 3AICA 2JKEA 1XC6A 3PJWA 4HK7A 4DVBB 2PCYA 3MMEA 2H0PA 2EC8A 4P4KA 5AVUB 3SKJL 1MUMA 4U3SA 4WWKD 1WKEA 2JI1A 4ES4A 1YMHA 5AL8A 4A1RA 3P3YA 4E38A 2YLKA 3DI2B 2FTYA 4S3FA 3BD5A 1MOEA 3ZE1F 5BUAA 1DIDA 2CYGA 2ATMA 3DTXB 1J1XH 1GMEA 1NM9A 3QIUB 4JFSA 1RD6A 4PP2A 1KRMA 1XLJA 4R96B 3EAKA 3FHAA 4UNKA 5BMFL 5E6SB 5HY9A 3P62A 1H6EA 3EPOA 3KXFD 4WKXA 4B3ZA 3ARQA 4GMTH 1QI5A 3P4OB 4OFYA 1H7WA 3W1RA 3FDWA 3AABA 1GZPB 5B7MA 2QAFA 4M1RA 5TDPA 1FVPA 2QCDB 3NA9H 2QGEA 4LCCC 1WDWA 3L1EA 2D31A 3K74B 1NLDL 1IGIH 2P5WD 3EOYG 4LAOA 4AG0A 2ICEA 2Q8AH 4K9JA 2FB2A 2A9BA 2CXGA 4Q9RH 1JK9A 1P2CA 1X9QA 2H3XC 2YAFA 3NSDA 4PJIF 4R0LA 1IBGL 4Y2DA 3H4WA 1BYAA 3LI1A 3NSNA 1XGEA 2Y7OA 4PIRF 5DI8B 3B8WA 2OFQA 4PTUA 3QI9D 3PWIA 3NXFA 2NY4B 3W7KA 4M6OH 1A7NH 2LOEA 1K4GA 3G8EA 4OUIA 4UC5A 4DESA 2VGGA 3RO8A 3HI5L 4JO1H 4FQJL 1NBVH 1JDEA 2XWBA 3WBYA 1EPFA 3UH8A 4H40A 2AMGA 4DQAA 3C0SA 3EUUA 4FOUA 2WZ5A 4XCEA 3STEA 1XGQB 3KEDA 1AQKL 2F8OA 1UKSA 3O2WH 4F24A 4QHMB 1VKXB 4S3DA 1CK0H 3VXRB 4LL4A 3V8OA 5MEPA 5FOOA 3L1OH 4JFTA 5LWYL 1L8PA 3W75A 4FXKB 2FQGA 3CM4A 4XP5H 1Q38A 4S23A 4ZQTA 1YY8B 3EH3B 3B34A 4MA3B 2C3WA 4XP9L 2Y0FA 1T4KA 5EFIB 5GVJA 2C1PA 1KDJA 1J5CA 3BSZL 3DA0A 2DFAA 4LLYB 3SBFA 3QFJA 4KVCL 3WLJA 4ERGA 5C55A 1ZLSL 1MF2L 4QXGH 1DJYA 1OAZL 3KGRA 5CSGA 2Q20A 3WUWB 43CAA 4DOHB 2WWMC 3TC3A 4YTRA 1RK1A 2EILB 2WLHA 4BZ2L 3UR7A 4G8FB 1CLOH 4QRSA 5J11C 3VI4F 2WJFA 4YR6B 1HKLH 1NGZB 4KVPA 4FZIA 5E1QA 4WOZA 4IQHA 4JZNB 4J39A 1NP2A 2B16A 4HCFA 4JHAH 5ANMB 1UB5B 5CG7A 3WL1A 2CSPA 2YK1L 5AKSA 1GZGA 4XOAA 4IS6B 3F2DA 4AE0A 3UOAB 4LAQL 4FQXB 1M65A 3B97A 1HGYA 4ODHH 5CSUA 4C1KA 1EZ2A 2CR6A 4PJDA 5KYUB 5HI5C 4M24A 2EH7H 4MJHA 4NRSA 3H4HA 3PSWA 2NY5L 4U6YB 4PV1C 2JTDA 3MS8A 5JPNA 4BBWA 1O5KA 2H2PD 4IT1A 1M42A 3QA3A 5HHPB 4WHYH 1JE6A 3A6CH 3B6SA 4TTGA 2UZYA 1ODZA 1W9UA 3SB0A 4TSCH 3WV0A 3OZYA 5FF7A 4AEOA 4ZMYA 5CCGE 2WZAA 2DZBA 2FGZA 3MCLH 3EJCA 4RGNE 1DANU 1DANT 3WKML 4W9FC 5DVPA 2I5YH 3U0PB 3N2JA 4NI6A 4XOCA 1YEDB 4Y5XB 3ZE0F 2D2GA 2WVTA 1L6YA 4G72B 2AJZB 5DXWA 1KSRA 1QTYT 1D3HA 4LRNH 2Y23A 3GF8A 1SOQA 1UT1A 3CHSA 1GYCA 3KPSD 4TS6A 1R8LA 4AIZB 8A3HA 4RAVA 1R5VA 2R51A 4MDIB 5C09A 1HX0A 4AGNA 1X9LA 4L9LC 2F53B 3AUWB 2WAHA 3S2AA 4BGLA 4QRBA 1HTYA 1FVDB 4JHMA 1RZKC 2XWJB 4FFZA 4NKDB 5GGUB 4HOXA 3AWEA 3JTTA 4OFYD 3C6CA 1I8UA 2XIMA 4AKOA 5CBEB 3R4RA 3UTSD 1MJ7H 3LB6C 4UTAH 1ZOXA 1QBML 3M17A 4G9FB 4PTDA 2ICWI 2WAQA 4H6EA 2GK2A 3HS0A 4TQHA 4EDWL 2RAMA 1M05B 2X2JA 3QXWA 4WU5A 4HTBA 3IMSA 4LKXA 4NRYA 1DHPA 4APQC 2QKIA 4OVVA 1SF3A 1M3IA 3CFJB 1T41A 3CU2A 2NR6D 2JCCA 2JK5B 3MKCA 4Q4PA 2H2PC 5KEZA 5KSUB 4U3HA 1ZLVK 2IOIA 2CO6A 3KPMA 3QQDA 3CSGA 3GU1A 2DSWA 3PS6A 1UWGL 1XEUA 2OEMA 3IDNB 1VSCA 3H9SD 3NMEA 2GSIA 3GSWA 3O6FB 4L3CA 3WNKA 2QPEB 3E80A 2CH8A 4LZKA 3FN0H 3N6QA 1KGCD 2AITA 1MLCA 4AQZA 2JKJA 1YMYA 2F58H 1OPOA 1GKRA 1IJ9A 2VDOB 3ESOA 2VAJA 1QW8A 3N4EA 1VZIA 5DUBB 3BN9D 3K4AA 4OLXL 4PBGA 1T1ZB 1GW6A 1Q2RA 1UADC 1CG9B 2XIDA 3QH3A 3VW3H 1VQTA 1XC4A 4I4WB 2DLIA 2MQCA 2Y9RT 3CVIL 3S3PA 3VXPB 2SFPA 4KHTL 1W17A 1P48A 2HMID 5A8NA 3CX2A 3TURA 5XINA 1YYMH 4PUDA 1N8OE 3S5OA 2WWMD 4JG9A 1QNRA 3TT1H 2WB7A 4O9HH 5HGBA 3EJSA 1TQCB 4DP2X 3PBGA 4H20L 1DO5A 1U8KA 1ZT1B 4DUVA 4V28A 1NBZB 4PJ7E 3LKQB 1YEYA 2R9HC 2DLGA 1VLWA 2J71A 3PM6A 1QHOA 5D2NA 4DPCX 3VI3B 1C08A 2WHMA 1XAUA 4TUOB 5DFTA 3BWUF 2O6FA 5BVJB 1EEYB 2BIMA 1JZDC 4PD4J 5I66A 3HZVB 3V5HA 4KAQH 5GRUH 4JTGA 3FU6A 3G22A 3SE9L 4JYFA 4OFDA 3BKML 5A2KH 2IG2L 3S4SA 4G8FA 1YEWA 4QRSB 2VFGA 4MJ6B 2DIJA 1WIPA 1CI3M 4Z78A 4ECLA 4FFYL 4KHXH 5AZ0A 2FH8A 3VI4B 4FJ6A 3BXWA 1Q65A 1UKTA 5E5LA 1C5DA 1KBBA 1FFQA 2VMEA 3IYLW 4IIQB 5C0GA 3RWHA 1IO4C 1K6AA 2QJIA 3SCPA 3TN0A 4GT0A 2BSEA 2XXGA 3MUAA 4PMQA 1AW1A 3AWNA 4DLFA 1KXQE 3VUSA 3F4DA 4HEME 5F7EL 2PDQA 2NX3A 4L65A 1TE6A 5CSBA 5KG9B 2BP5M 1JD7A 1V7MH 3JV4B 1JZ3A 3STCA 1YEFL 5JH2A 4NHCH 3JTSB 2PD5A 5I6NA 2EO9A 4O5LH 5I1LA 1G1KA 1Q0EA 1BRLA 1F4WH 4P2RA 3ZZSA 4FDWA 3HS0C 4YHML 4Q8NA 2ADIB 3NDYE 1E9OA 3TNMB 2BP1A 1GVQA 1S7UB 3GIQA 1IZJA 3G6DL 2XFXB 2VZ1A 1IXOA 3QSTA 3NOEA 1GL4B 4CQAA 3JWNH 2X0WA 1LO4L 3V8CA 3PWPB 3ZHNA 4DW2L 1C8XA 3C52A 2D3NA 3MTWA 5FLUA 2IPKB 1RZGB 5I15L 4Z1DA 2Y6ZA 2V3FA 4FZ8L 1WBYB 4U1HA 5T1MA 1PLCA 4DJDA 5LGHL 3UO1H 3MDJA 5HPMA 1E1CA 3IDJA 3N19B 2IBZX 4MB1A 4AH7A 2BZ7A 4NRXA 1Z89A 3W22A 2G5RA 1NSNH 4JGJA 1X7TA 1S5MA 4ZMOA 2NQDA 1J48A 1WGVA 1VEOA 4LLAA 2CIKB 4C58B 4EBQH 5T3XD 3T5WA 2HMIC 3CV5A 3V1HA 2VUYA 3QULA 4U4BA 4AMWA 1HQTA 3KFTA 4OLZL 1OGGA 4PS4H 2J77A 2DWEB 2HCZX 1OSZA 2R23A 1XF4B 4M7LT 4QRRE 5CZRA 1YTEA 3D0AA 4H6RA 2OKMA 4JY6A 5DC9B 3SY5A 4XVEA 4MIMA 5ANMA 1V6WA 3N3EA 1KENH 2GTZB 5DJAA 1MXDA 3LKOA 1IEXA 4B90A 5BXRA 4RSVA 6ALDA 4P0DA 1JGEA 4HKJA 4G8EB 4L05A 4O57A 1HT6A 1DQLH 1N6UA 4GKNA 4OECA 1KT2B 2WKOA 5AVHA 5A6TC 1EZWA 2EC9T 4XAKE 3N11A 3T0EC 2OSLB 4MA1C 4UTBH 5FAAA 2JB5L 3A4DA 1MQKH 3V0HA 1UWUA 5DEGB 4Q9CA 1A8ZA 4L2YA 2V3EA 5CU9A 4XX1G 4XN2A 3TZVB 4R5TA 1E5UI 3ZDXB 5I0WA 1P7TA 5EUOA 4JB9H 2VWEC 1BGAA 4WTZG 1QSED 1H15A 3BP6B 3OKDB 3UZWA 2CBQA 3MBFA 4OUOA 5FM8A 3CFEA 1EZSA 4PTMA 3ZKNC 2VD9A 3UY8A 4IIHA 3PGFH 2CO4A 4J4PC 4NNXB 5DHEA 3TBWB 3TL5A 2YD8A 3DHPA 2XJLA 1IL1A 1CDIA 1EO5A 5CM1A 1NAMA 2PU0A 2XGBA 2OYMA 3HPXA 2ZG2A 2IBGA 2RFGA 2ZYFA 2G75B 3OGRA 3BZFA 5AKVA 3ILQC 1RUKL 5B21A 4XNBA 4AMAA 3FA3A 4GA8A 3D51A 4IGBB 4TRPL 4BCYA 1S7WB 1TPB1 3GK0A 4Z0BL 1UM5L 3HOJA 4R7WA 1RUAH 1Q8JA 1CX9A 1OB1A 3X3GH 4UFIA 3CHRA 2P3ZA 3HUJF 4RCXA 3S6TA 2JF7A 3D5HA 3LQAH 1P1XA 2CBTA 3GM0A 1E9IA 4GQ9L 3TQPA 4XP1L 1PSCA 1A2YA 1QO3A 1TNNA 1T83A 2ZKXA 4DGIL 1H2JA 3AYTA 3CIVA 4M6VA 1A7BA 3W0KA 4M6OL 3E2QA 1FH9A 3V4BA 1XLDA 4KMTL 3LLFA 2PP7A 1DBKH 3KYOA 2GUOA 1XCFA 2X1TA 4LCIH 1F4YL 2WXHA 4G3YH 4M1DH 2WXOA 4Y9CA 1NDVA 3T8XB 3GTTA 4NBYB 2QQ6A 1DBML 1WZ1L 2P44B 3ABKB 3QDJD 2IWGA 4PLJD 3DTXA 2J5LB 3NCJL 5LG6A 3B04A 3IT8D 1EFXA 3W7MA 4X5RA 1OYBA 5JXQA 3TWAA 3C6SB 4LLUA 4IRSC 5KTEL 3EBAA 3CU7A 3MBXH 4IDJL 4NQQA 5IEKB 4LASL 1CDHA 2UY6B 2WC3A 1CD9B 5FL1A 3NEXA 1QTWA 2LVCA 1HI6A 5J5EA 4PMXA 6XIMA 2JKSA 3V9FA 2J1XA 3DGCR 3Q2WA 5IP4A 3C61A 4LSUH 2W66A 4PMRA 5L7XH 1RA0A 4JY8A 3PDOA 4N8PA 1TQTA 3QPXH 4NKIL 5IM51 2KZKA 3FTZA 1KTBA 1FPTL 1OP9A 5KBPA 2DVTA 2EPNA 1ZJBA 3EO0B 5G4WA 3QEQD 3QHNA 2AQ3A 1YJDH 5FL0A 5FB8A 2BIQA 4KZDH 2DOCA 1IGJB 3QPXL 4Z7VE 4Y4HC 2CZFA 5IB4B 4Q8VA 3BJLA 1NQKA 2IDTA 5LXGL 1PS9A 3PVFA 3E6HA 5F3BA 1ZGLP 5D2LE 1EJWC 2GBTA 4Z3FA 5C0RL 3VTRA 3A5FA 2WTOA 3GSNB 5H35B 3TBVB 2L7JA 2OL3L 1D5XB 4UBDD 4L1BA 3ONCA 5I8CA 1DKWA 1JHKH 3RURA 1GZQB 4GRWE 4MBRA 2BC4B 5KSUA 1HUVA 5I6XB 4GUPB 4NO5B 1BQLL 1AQ8A 5TE6H 4BJHA 1HEHC 4UQ2A 4PUWA 3KDMB 4RE2A 5F89B 1F6FB 1QLRB 2JH2A 3QXVA 4MWFA 1J2WA 5DO2D 3QCUH 3T2PA 5CH9A 3QQ9C 4NAMA 1GNXA 1SGJA 3PNZA 1C5BL 3BWAA 3KPRE 4LESA 2BVPB 3KLHD 1AH0A 4AD0A 2PPEA 2QW5A 1Q0YH 1H9VA 1K8IB 3A4AA 4JX4A 4L9YA 1UCBH 4BK9A 5FCUH 4D9QD 1H3PL 3WLRA 3JZYA 4L1DA 1VD6A 1OQOA 25C8H 3S5LA 3BGAA 4BZ1H 3FVDA 3PGCB 1KLUB 2V68A 2GITB 1JWSA 5L2JA 1I60A 4YXKH 4DYKA 2Z1WA 3ZE2F 1YNLH 3EJTA 4RNFA 4JTKA 4Z0BH 1IJNA 1EDHA 4FQPA 1ML0A 4FI7A 2MNUA 4DP9X 4GSDL 3QKZA 1JVOA 3GHSA 2ALRA 2XACC 4PJHB 5I1JH 2AGKA 2GEQA 3NQMA 1EANA 3QN3A 2ISVA 4U4IA 3CN0A 1KV5A 1CGSH 1A9EB 5HDQH 2QF8A 1QI0A 4HYWA 2GIXA 3OJ2C 5I79A 2RFXB 4PJBA 1KN2L 4HF5H 5EEZA 2H8ZA 2VLJE 1HDMB 3VD7A 4O2EB 1AS7A 2X4SA 2ACUA 5AB3A 3GMOA 4NPYA 4YPGA 1CZ8L 2YPLE 1Y5XA 4BKTC 4E5XB 4ETYA 1QNSA 4UXDA 3THAA 1UR9A 3PHOB 3NXLA 4GXWA 2DY2A 3D6GA 4A35A 2VDMB 1OT4A 3NPSB 2DQFA 1Y7VA 2VXUH 3QMRA 3QXDA 4WI9A 1NARA 3CVHL 4FNLL 2O55A 4MQ7A 5MEOB 2PDLA 1P6FA 2KT6A 4HPGA 4IRZA 3NR0A 4UOJA 4TX9A 2OJZH 2BOBA 5F0MB 4DZIA 1QFWH 5D4QA 4XWGL 4NOBA 2IOMA 4MNLA 5C9KA 3LD8C 5DK2B 4Z3GA 2W8CA 3QZLA 5IKCB 1GOFA 5AKQA 5D72H 3G6JE 3WBWA 4IIFA 2VERA 5C3IA 4NT6B 4LCYA 4D0DB 2KL6A 3IJDA 2ZKWA 1LO2L 4R5XA 1H4PA 3CJJA 5K33A 4IKLA 5D93B 5E08H 2HKFH 3ALGA 5KZEA 4NN5B 3D12B 2NYKA 2NVDA 2X0UA 4FI8A 1TWDA 4JS7A 3GDKA 4Y5VA 2HVNA 2CR3A 3DRTA 5HI5D 3FB6B 4K5PA 1CB2A 2OKOA 1QW9A 1C1EH 4APXB 1R6WA 2PYED 2PBGA 2OYKA 4ABUA 2IPKA 3LPPA 4G2AA 1DSFL 2X1XR 3NFSH 4GW5B 4KKBD 1QMUA 4L3EB 4Z3TA 5AG8A 5B3JE 3GMQB 3IGAA 5DGQA 3MOBL 3HA0A 5MERB 4PRPD 1HI6B 8XIAA 4ZAKC 2V5TA 4X4XA 3VXQB 3URAA 2IDQA 3TCLB 2WLYA 4GXFA 1INEH 1VBHA 1WX0A 3VH8B 1XBZA 3FRPA 5E0FA 3FB5A 3MYJA 4XNUH 3KLKA 4AIXA 5I71C 2QJDA 4ELKB 5ID0A 3KPMB 1AI1L 2VLKE 5FDWB 12E8L 4IEFA 4OLWH 2V8MA 4Q6IC 2X12A 4UM9A 1A5FL 5CO1A 4NRZB 3DX6B 4ZMZA 5GGTL 3Q2VA 2WBGA 3H2CA 3L4TA 1NFDA 4X3ZA 2ZUYA 3THML 3MO4A 4DM1A 3RJYA 5DELA 4HAFA 4W4OC 2NTFB 4FFZL 3V4PA 1YDYA 2WC7A 3NQ2A 2J88H 4LV9A 2VQ1A 1J0KA 1SFTA 3U2ZA 3X1BA 3OJVC 5AKRA 1WTLA 4NCC1 4UV4L 1HSAB 4AWTA 4JG0L 3W2KA 3QCVH 2QPXA 2GK0A 3GZQA 4TUKL 2RJHA 4UTTC 4AEHL 1F58L 1I8KA 3BAIA 1LDCA 4K8GA 5AUMB 5IHBA 5BMWA 3SQLA 1QO3B 4YHNA 1OGTA 4OJCA 3UGXA 3VCCA 4X5PA 5DMGD 1LK2A 2F8VA 2XSAA 1L7TH 3E3QC 3ARUA 1N70A 2J56A 3VD1A 1OABA 4H6KA 1PZDA 1IL1B 2J21A 1KW1A 1RZ7L 1T22B 3C5ZD 3LH8A 3CVCA 1OYCA 3MOBH 4L9LB 1QOQA 4JX6A 4XO7A 2YUZA 1RUQL 1WFJA 3SCTA 4CCCA 2AEPL 4RMTA 3KWVA 5IHLB 5F1UA 3MHFA 1SUHA 3BIAX 1VB9A 1Q6EA 5M1TA 4B91A 4QXVA 2QJHA 3TT1L 2WXRA 4AUBA 2JJTC 3AIVA 3HGSA 4EAMA 1I1AD 2R2EA 3GIVB 3TIDA 3WJLA 1SMAA 1YY9C 3EBHA 3NN8B 3VXTA 3ZE2B 3ECWA 2D7TH 2OSLA 5HP5A 1IWPA 4IBUA 5F9WC 2FZDA 5C0NC 4J23A 4PJHF 3VKCA 1MFEH 1IVTA 3DI3B 3N2OA 4FYTA 5AYQA 6ENLA 4L29A 2DZXA 3GB7A 2PMZA 1UFGA 1NMBH 5CEYA 1H09A 4NLHA 5KSBA 2AOSA 4X0NA 4BZ2H 3K8LA 3BWWA 5CEWA 4FE9A 4JRLA 1XIIA 4P8UA 1IGWA 4I48B 2F5AL 1JV2A 3JUYA 4LUSA 4QLLA 2AVGA 3RDTB 3OJMB 1ZLVH 1O75A 4IRZL 3V7AG 5KS9B 1PKLA 1TV4A 1K4DB 4WUIA 4OUUA 3GXPA 1D7FA 4LBSA 1EZLA 4NP7A 4R26L 1S5IL 4E0RA 3MRJA 5ETUA 1GOWA 1BREA 4K38A 4I8DA 4WW1A 5KETA 2DB8A 4DPAX 1EOKA 5IMOB 3JV0A 1CO1A 3UWEA 1D5BB 4OZGA 2ZTKA 2BV9A 1KYOJ 1GC1L 2B9AA 4FKHA 4PJAA 1OINA 2BOCA 3WY3A 1TIMA 3M0IA 4YX2L 3FQYA 3H1ZA 4JR9L 1XICA 4ZMTA 4YR6A 2WYSA 4JIEA 4PRHD 2F7OA 4XMPL 4FYSA 5DD1H 3MFFA 4DQWA 4DVRL 1KN2H 3MJ9L 4XO5A 4JAMA 4XT1C 1EC8A 3UNTA 3CHFA 2EE9A 1FWEC 3VILA 1NDMA 1O94A 1CGSL 1N2RA 2Z8VC 3RWEA 5HDQL 4GOAA 3TW6A 1WKFA 1TEFA 3N43F 2IH3B 4NZTL 2VLJB 1QI4A 1QRNB 3MJ7B 4MKMA 3SOTA 1ITUA 3G1SA 4OKVA 4BFIB 3E2HC 2ZXAA 4IMKC 2WWOA 4AC1X 4A2DA 2O61B 1D2KA 3D4YA 1LQ2A 3B0VC 2W07A 2XFXA 1KC5H 3V2AR 3NZSA 1YBQA 1CDYA 3V5DA 5C0JA 1KTKE 4P9ML 5JIIA 4ODSL 1LGVA 4YIQB 3TMQA 1MHHB 3UXIA 1W3JA 3MLRH 5FKAB 3MO7A 5HGAA 4AVHA 2IH1A 2PDCA 3VNDA 1RURL 3N13A 4HSHA 3U0WL 2X6BA 2WN3A 1CFQB 3R18A 5AVSB 5C09E 2WMKA 3M9YA 3KJ6H 1WV7T 5EU7C 5H8MA 4QLRA 3VZYA 3TPUB 4LT7A 2MNRA 2WQ8A 4XN5A 1NCTA 3HPSA 5MKGB 4QTFA 4K2UL 4X7SL 2XTJE 2D3JA 2WQVA 4AEIL 1IFRA 3RMJA 4B92A 5ITBH 4J3XA 1EEYA 5I66B 2VX5A 1LZOA 2BMBA 4X4ZA 2XPGA 3FQRA 1NWTA 3FT3A 2ZTJA 3WKZA 4P06A 3RWIA 5DA0B 4JO3L 2GVEA 4ZRGA 3OKLA 1QR7A 2P3YA 2J74A 4C6EA 1WCBB 4GB9A 1CDUA 1E6PA 1EH9A 4KK6C 3FJ6A 1FHLA 1GZQA 1MW1A 1XHGA 3FO9B 5E2VH 3RCYA 1GY1A 4X6DF 2J8TA 4YE4H 1BZ7B 3G2GA 2DM4A 1LK3H 2MPVA 4LQFH 3WTVA 4JIHA 2TSAA 3IVTA 1G5GA 1QFWL 3H7LA 4WW2F 1DXFA 4XBEH 2ACSA 2XJKA 3EWBX 3VXSD 1REIA 3JT2A 2PNDA 2FBJH 5FB8B 2VDLL 1FWGC 3C08H 2PDJA 5T8IA 2CKRA 1LP9F 3O2VH 4OQVA 3CH1B 4IRJB 3IPEA 2WWKT 2WLNA 7ENLA 4UF7C 1C7TA 4A2SA 2Y7DA 3CXFA 3VGAC 4YTQA 4ZFOB 5AEAA 1R7AA 3GMQA 3IGAB 2O4QA 3DO7B 3IS1X 1CVRA 5IHRA 2IAMA 1ZV9A 4LDLB 1N18A 5EBMB 3W26A 3C3UA 5GSVA 4Q6XA 4HK0A 1BWWA 4QHLA 4Y89A 2BVDA 4DKFH 2JJTA 3EO1A 1RCQA 1FFOA 5EC2B 1WUEA 1A0EA 2Z2UA 4HYVA 1S5HA 3SAZA 4PQXA 3MVTA 4ANVA 1F4XH 4FEIA 5B3SB 4XBPB 2XBDA 4I3RH 1E4MM 4NNAA 5M7QA 1FGVH 2GY7B 4LCYB 3WDHA 4D0DA 1TJ2A 4C8XA 4MNQA 5FYJH 3ZTJH 1NZRA 4ZUWB 1P4CA 3IU3A 4ZAKA 4BH8B 3B2DC 3QZ6A 4U28A 4AY1A 3LKNB 1U5VA 3RZCD 3KYOB 3O6KH 2CBVA 1GOGA 5D6CA 1HESA 1XR9B 1HILB 4FXTA 4ALAL 2EIBA 5FKYA 1WE5A 3OXRB 2GVJA 2ZOXA 4LYPA 1NOWA 4K7FB 2GJ6E 3RFRA 2CEQA 2E1WA 2DJSA 3M6YA 2K1MA 2WINB 4MNHA 5CILH 2IAND 3EYFB 4XVUD 2BOFX 1AZVA 3D39B 3WQ5A 4JTLA 3TKFA 1TVHA 5HJ3A 4JRWA 4XI5D 2PP1A 2WQPA 2XTKA 3WH9A 3SBWA 7XIMA 2EJ1A 1B0RB 3ULAB 5ID0B 3ULUF 5JPNC 1QJWA 4FF5A 2OCJA 4JB9L 3GTXA 3OBKA 3ZRCC 4PJBB 1ITQA 1GGCH 3MJ7A 4GW1A 4G6MH 3CYJA 3GVGA 3S1VA 1WWCA 3UJIL 3GI9L 4B5XA 3QSKB 3CFEB 3QF0A 5IEHB 2PP3A 3F7RA 4GRLD 2FO8A 2J7CA 3M0JA 4GKZB 1CLYH 3SDCC 4MMYB 2PKDA 3FYOA 2WXNA 5TQ0L 5IDIA 1PKMA 3WQWA 1S3KL 2Y06H 3S3GA 1XYMA 3RUBL 3S2MA 2GITA 3VIIA 1UWYA 2C9QA 4O58H 1OGAE 3BE1L 5IB2B 1T7YA 1FWIC 1PVNA 3D52A 4KY1H 3QC0A 4XPAL 2V0TA 4FQCL 1L7IH 4Q8OA 3FSZA 1GYMA 2HWZL 4HWZA 4PV8B 2PDFA 3LRHA 3PQYB 1BYCA 3NOYA 5DCBA 3WQPA 5IOBA 1UZGA 1JSYA 1MVFA 2PTUA 1VIWA 1OQFA 1QLRA 5LGHH 4IG2A 1KKOA 4YWGL 3QY8A 4HPXA 3MYOA 1NPUA 3PUEA 4YSOA 3DVNB 5LZLA 1VZGA 3VSVA 5CR8A 3ZDYE 5KBNC 1J5DA 1HZHH 1WFUA 2QT6A 2DEPA 4I5UA 3MTRA 4NY2A 2VXSH 3BPCA 4FJZA 3GG8A 3OAZK 3FQUB 4JDTH 5K59E 4DHGA 4N86A 3LRLA 1TZOA 4KTDL 3N85H 1AAJA 3PHOA 5G5DB 4UR7A 3DOSA 1BX2A 3PG8A 4R26H 2DI7A 5D4IA 3SY6A 1F4WL 1KLFA 3KDPB 4WFED 1NUGA 4X6DB 4HIIA 3W2NA 3P73B 5IJVA 2G5WA 5CEZE 4J3OC 5HBBA 2PDNA 3E0FA 4ZUTA 4KFPA 5ABFA 2XWTB 2B7DT 2DZEA 1E5JA 1P4UA 3EYPA 1CYWA 4GP4B 3ZE0E 1MY5A 1S1PA 1FORL 3S36L 2A2QT 1MAJA 2WMGA 1UM6H 4N22A 5K9OA 1MRFH 2YPVH 2QADB 1IXQA 5EU3B 4F2MA 4UQBA 2EIDA 3N44B 2AL2B 1NPNA 3N1FC 2O93L 1RI8A 1IWBA 5AVVB 2PCXA 3EOLA 4GYBA 3KS0H 1JPGA 3RLHA 2R0WH 4U5KA 4E9VA 3RR1A 3UR8A 4AD2A 4OBSA 1Z32X 4ZX6A 2JBMA 3T71A 1XGPA 1J1PH 2FECL 5D1XA 5EUKA 2J4WL 3ULVF 1MQPA 1IKFL 1YNQA 2P8MA 1E4WL 1RZ7H 4XTRD 1TJRA 4QR7A 3IK4A 3X1EA 2X53A 3KBFA 4EI5D 1KLGB 1G6RL 2AQRA 3WXVH 4YXHL 2H9GA 4Z3HA 2VL5A 3VKKA 5BXTA 5DRIA 4HUUA 2PWHA 5KVEL 3EH1A 4O9HL 2Z2AA 3QFWA 1KENL 4AG4H 2HFFA 4OZFG 1DDHA 3QNXA 5ITFB 1SHXA 1E40A 4MNJA 3OJDA 2YRBA 4LEBA 1VPYA 5F8QC 3V0VA 3UA4A 2CO7B 3NRQA 4YIQA 4HGWA 5HTSA 2VN7A 4PRWA 5D2XA 2L3BA 3SY0A 1U93B 2ZVIA 3GH4A 3TOYA 1U3JA 5TE4L 4NB7A 4JQ3A 2PXYD 5LBVA 3I75A 2JWYA 1YUKB 2WVSA 1IGFL 3THMH 4KBXA 1M1XB 4KWUA 1R0AL 2N7SA 2FO1A 1AXSB 1O68A 3W9DA 2CLFA 3BH8B 3CVHB 3I7RA 5FEPA 5C6MA 1V6TA 4I87A 3UGUA 2G30A 5GQBA 1OT2A 4GRLA 3DGGA 5AYIA 4U7MA 3WMQA 2Z64C 1OK8A 2V5MA 1UJPA 2YSSB 1DVYA 2CPUA 4QGTA 2ZUTA 1YYCA 2F1BA 4XXDB 1P0NA 4KTEH 3UADA 1N82A 3U36A 1MI5D 4RAHA 3CMJA 5F4XA 3EWUA 4BFGA 3KBWA 5ALCL 1JZ2A 2NYYD 2Y72A 1UD3A 3OA3A 2DYRB 4DO5A 4H25A 4UTAL 1U22A 3ERPA 1MJ7L 1E50A 4HFWB 4Z3IA 3FNDA 3VIOA 1AGFA 3FT4B 1MNUH 1AKPA 3EWDA 3A4WA 4CDGC 2I9UA 3UWQA 4EI6B 1PYFA 3TCXA 1RUMH 2GJZB 2SEBA 3G5VB 2TSYA 1SY6H 5DTFB 3HR5B 4GY4A 2NQCA 1EX5A 3NQ7A 3OXSB 5IQ9B 3EDJA 2QV4A 3ARGA 4HWZB 4J3BA 4PV8A 3V6FB 4B3KA 6FABL 1D7KA 1YEGH 4K1GA 1VFAB 4H1LB 3OAYK 1QQDB 4PRIE 5F7YC 1G9NC 4HIPA 5DX7A 3V9CA 1KEML 3BMVA 3FQ4A 1R3WA 1YY8A 3JTTB 4PJEE 1XZWA 4G6KL 3GYEA 1DCEA 5DZVA 3OPZH 5CZ0A 1BGGA 3ESMA 3L3HA 1YPZB 5TGBB 3QDGD 2JGYA 2YD4A 5KMYA 3EMQA 1ZIAA 1UWEL 4N2GA 1PNCA 1UXSB 1F6LL 1NFAA 4DGYL 4LHUB 4UBDC 1DVQA 1SYVA 1JPMA 2VXUL 3DDMA 2WQAA 3BG3A 3N9GH 3DZ1A 1NQBA 3LS4L 4UT6L 4YBHA 2KUTA 4C6QA 3S88L 1IAOA 4W93A 4PA8A 4W9TA 4M1GH 2J9XA 1QFUL 4US5A 3QZWB 2DUZA 2X1QA 3BP5B 1FUYA 3KH3A 3U79A 4AV4A 1EWDA 3QIWC 1HKKA 4UR9A 1EEZB 1Q9OA 1I2NA 4UM8A 3GY1A 3FRUB 2FX8L 1HJUA 3CFQA 4OCWL 3SZ6A 3RIFK 1ZFJA 3MSDA 4HZMA 2HROA 3MGTB 2DU2A 3MW7A 3APDA 4J8QA 4XC1L 1D9KA 3N6HA 4GAGL 3N44F 3UPCA 1UZ8B 1GGOA 2OGJA 4FIRA 4EVNB 5LNDA 1IQ8A 4B5WA 5C2CA 3EH4B 5T3ZH 3I50L 1S7QA 1UWTA 1XG4A 4QQ3A 5KVDH 3IJHA 1UB5A 1ZUAX 3R0DA 4CD5A 1RUPH 3D9AH 5EC1B 4PUUA 4AIEA 5I3IA 3KLAA 2KPWA 3QUMB 5DZOA 5EF1A 4LIQH 4W5UA 2J62A 4Q52A 1HU8A 3LUTA 3VNMA 1JGLL 1U8KB 5JHDB 1HYSD 2BTMA 2VOTA 1BEXA 4MXWH 3FONB 1TX2A 3V0TA 3O6YX 2V0AA 4U1KB 5I1EL 5CWSB 3BWUC 4Z8FH 2DWXA 4KKRA 3VXOA 1OHZA 4Y8FA 4AF0B 3VQ1C 3I2CH 1EC7A 5CC5A 5CC6A 3GIZH 3FH8A 5F6IC 1IC7L 3MMEB 4MA3A 1NCHA 3MMUA 5DUPH 3MMDA 5KS9F 3ZLFA 3FOMB 1INQA 1RJLB 2G60H 1XAKA 1DXEA 4OZ4B 1RZKH 5LIUX 2JV6A 4G9DA 4OV6F 1U93A 4M8QA 1CTMA 3TH3T 4BWTA 3B3DA 3CQFA 3WJWA 3JT0A 1UC6A 3OHXC 1T89C 4PVMA 3TFKC 1J5HA 1AA1B 3N3TA 3HLAA 2APVA 4Y5VB 5I00A 4DLMA 5G5DA 4X6CE 4S3KA 3OVUB 2I9TA 1UKQA 4ODVH 4HXAH 3B8DA 4JTIA 1EL3A 1EUUA 3NCBB 5F6HJ 1QSEB 2W81C 4EUPG 4F5CA 2IQAA 2NXIA 3C2EA 3KTSA 1B0RA 3QGVA 1GTFA 4EQ3A 5I3DA 3EKCA 3LK6A 4NUGL 1BLNB 4MNGB 2PCQA 1G01A 2PXYC 2GSIB 3GSWB 4HBQA 4Y4KC 1OAYH 2OJ1A 1T1XA 2W60B 3TUUA 4GPVA 4XPFL 2P24B 1G4TA 4C1LA 5ALBH 4MJJA 1S78C 2A3BA 5CBEA 1ZRUA 3BO8B 4DPRA 3HBPA 4KKBC 3W27A 2Z92B 4WDWA 4Q4KA 2G8ZA 4KZ0A 5EU4A 4FSAA 2FE0A 1XGPB 2UUDH 5EUKB 1IEWA 4KOCA 5E6UB 5HPMB 3X1GA 1V4YA 4BWLA 1SFSA 1DBMH 1WZ1H 1QFWI 3MXWL 5FSDC 1BCIA 3S6CA 4NZCA 2BVWA 2RQEA 3WCYA 1P0DA 1CD0A 2AP2A 3GFUA 2R9RA 4M61A 4QIRA 4LSSL 3R94A 4FQHB 4FHKA 4O14A 2YN5A 2O0TA 4D2NA 2DLEA 5LAXB 4F0MA 2YL6A 4FL4C 5K9CA 5FA4A 4GUOA 2RR3A 5EUOE 4ATLA 1AD0A 4BZ2A 1A3WA 2EYRA 4W4NA 4X5WB 3ARZA 4NENB 3CPUA 5EOCH 1Q7MA 1QRNE 4XNAA 2JLLA 1EAPA 3WNOA 4WI6A 2GC7C 3UBXB 1TWIA 5C70A 1AHWC 2NW0A 1UA3A 1T1ZA