3VGGA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltoheptaose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
554
structure length
554
Chain Sequence
b'YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 193
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vggA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vggA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vggA02
3TIEB 4KJYA 1JZ5A 4XNQA 5GRVL 4TVPH 1HKJA 5JOEA 4XMLH 4PP1D 4YE4H 3V0VB 4HULB 5CKAA 5SWQB 4ODXB 2CCRA 1KENL 2PXYA 5T5FL 3DYPA 1JFHA 3A4AA 4J28A 2D1ZA 1J18A 4HV8A 3FT3A 2A73B 1MHCA 1NFDB 1C1EH 1OGAB 1T0PB 1PZ5A 3IDGB 4Y89A 4HS3B 1Z0MA 3C60A 1JUFA 2YPKB 2Y9RT 5DF0A 4E5XB 1BLNA 3GSQA 4TUOA 4LCIH 3FO0L 2YMXH 1NUNB 2OP4L 4YK4C 1AGEA 1K9FA 2YA2A 5CGMA 3MMDA 2UY5A 4PMVA 2LTQC 2VR4A 3U0TA 5TE6H 2X1QA 4OKVB 3CHCA 1MIMH 2HLFC 1XGZA 5I71C 3L3OA 3WNPA 4P5TA 3PWUA 1MOEA 1V8HA 2DTML 2O5XH 1BVKB 5TDPA 4P5MA 1R3IL 1NCUA 1R5VB 2FO4B 1T20B 1WZKA 1W72L 3VXQA 2XSAA 2ADJA 4NRYB 4D0BB 1HI6B 3N06B 1N6QL 3QULA 3D1MC 1NP0A 3RY6C 2WLYA 2NY1D 2X2YA 3DVGB 4D8PB 1B0GA 3VXRB 2BMKB 2NY0C 5GPRA 1QRNB 3SE4C 2QHAA 2Q7YB 2CBUA 3CDYA 3AIRA 4P2RD 5CSYA 1GGIH 1WAAF 4JRYE 4HU8A 4YO0B 3HZMB 3BSGA 3GO1L 5HI4C 3TP4A 1QWUA 5ADPL 2WMHA 3TBTB 1PG7L 1M4KA 1G01A 5BW7A 1I9RH 4ZSOB 3OL2A 4R7DA 3EMCA 4PRID 4JVWA 2L7UA 2P5ED 3DECA 3VXSA 1GHSA 4OF0A 3LSOA 4LHUA 4DW2L 1BZ7B 2GJPA 3S6CA 4HG4J 3QI9D 2ZUQC 2YHGA 5EUOE 5K59E 1OP9A 1C12B 1C8PA 5DVOA 2QF8A 3EUUA 1I1AD 3QXDB 3MGOB 1DWGM 3HKFA 2EABA 2IGFL 4S1RH 4EVNA 1M71A 3SE9L 4FNRA 3VXTB 3V7AG 1DWIM 2H9GB 3OR6A 2FRGP 4XXCA 3RKPA 4ZS7H 1JCKA 3KPRD 5GGVY 2UVFA 3IDXL 4CMHB 3N85H 1BHGA 1FFPB 2R29L 1E28B 5F89B 1UA7A 4G3YL 3PZUA 4X4YA 4QWWD 4OSUH 1DZBA 3LZFL 4JFED 1LEIA 3QDMA 4ZODA 1KJ3H 4MAYC 1MRCH 1PAMA 4RDQF 1DVFD 1HSAB 5F21B 5A8NA 3U57A 2GK1A 1Q9OA 4NRXA 1OAZH 5FCUH 2IADB 3P4MA 3PZNA 3RTQD 4BSVA 5DVKA 4NZRH 1JTPA 2FCBA 1VFBA 5LAXB 1NGPL 3EMZA 5GSVA 2WAGA 2AQ1A 4UOZA 3QT2A 3W9EA 5IG7A 1UQSB 1MRDL 2XKSA 4HX1A 4M03A 3TT3L 1OCWL 1Z5LA 1I7UA 3H6JA 3PWJA 3LN5B 3L3GB 3E3QC 1HINH 3NCOA 1ZVHA 1DUYA 1Y18B 2A83A 3DRQB 2FYYA 2QPSA 2Z91A 2OTWB 4LEXL 4P49A 4U1MA 5FOBB 1IL1A 3NCFB 4NZUH 3O45A 2EDTA 3C09B 3HMXL 2EKJA 4W7WA 1XCQB 2AV1B 3PZ9A 1P2CA 2F74B 2YC1B 1G5AA 3QPQD 2FX7L 3MRNA 3CBWA 1UWEH 3PUCA 5E2UH 4Z76B 3IF1B 4HPGA 4F33B 2D03H 1D5ZB 3HE7D 2VOTA 1ADQA 2NY4C 1X6NA 4M82A 1F6LL 3WLBA 3KPSA 4XVTH 5CG0A 4JHZA 2WM0A 3FN0L 5HPMA 4WHTA 1A3RL 5GJSH 1REIA 3EOTL 1JF6A 2NY2B 4JRXD 1HWHB 1X5XA 4H41A 3C6LA 2V2TB 2OMNA 4PS4H 1LD9B 4G6KL 5CLWA 3ARFB 3VFVA 3VFPA 1FP9A 2R2HA 3VRIA 3C6SB 3IFOB 1IAIH 2K3TA 5F1SA 4X6CA 4U1NB 1BVZA 1P6FA 1MNUL 4DVBA 3RM4A 3QDJD 5FIPA 4LPTA 4PB0H 4ZNCD 1KSRA 4PJHE 3VWJC 3FB7A 5I15H 1OAUH 3FOLA 4P5TC 4PRAA 3QUXD 3FT4A 3H0TA 4KUCF 1F4AA 1HKLH 2O9TA 5KANI 1FV1A 1D5BA 1AXTL 5EC1B 4DQOL 4YAQA 4M5YL 3QJHB 4ZEPA 4D71A 3OKNB 2ORBH 1VADA 4PRWA 1UWUA 3U46B 3KL0A 5FIEA 4V28A 4I0PA 1MCQA 4PGCB 3FO1A 1SFSA 3UEQA 3M6DA 4MAYB 5DMYA 5DVMA 5HI3D 2XM2A 4M8UA 4JO3L 1AH1A 1Q94A 3HJEA 5MENA 3EJPA 5BOPA 4S3JA 4OCWL 3QEQB 5E0CA 4E0RB 1Q38A 2GJ6B 5BW7C 1A4KA 2Y36H 1JFQH 3DSFL 4MA8H 5FO7B 1CFTB 4OZIA 3RO8A 3CK0H 4D6DA 1C08B 2R0KH 4KK9D 4KVNH 2ZSVB 4ELKB 2EO9A 3RGHA 3UYRL 1FL5A 1UWIA 1WEJH 1BBDH 3L4XA 3LCYA 5FFLA 4IRSB 1CI5A 3D50A 4L9DA 4QRSB 1T7ZA 3MBXH 1NFKA 1NSNH 2E7CA 4WV1B 4U3CA 4HJGB 2Q8BL 1I3RA 5DJXB 5HHOE 1M7DB 2Q20A 2J3SA 3QB7C 4XXCC 5D4YA 4PJHF 2IANB 3AC0A 4L3EB 2EXWD 2XJ7A 1IVLA 3SGDH 4Y5VC 4YX2H 2F54B 2NY4B 1NLDL 1I8IA 2ZZUT 3LN9A 5E1AB 1LE9B 4Z7UE 3UTZB 1CR9L 4NZDA 4LQFL 3V79C 5CP7B 2Z31B 5FL1A 1ZOXA 4C83B 3LIZL 3CU1A 4RAVA 5HGDA 4EKXA 2XPGA 3JV4B 1H3XA 4LSQH 4NO2B 1BFVL 3K7UA 1KTDA 4FP8H 1HJUA 4FTVB 2D2OA 1JWMB 3QHZH 4F7MA 1J12A 4LSVL 2E0PA 3VGBA 5HDQH 3WXWH 1PLGH 4JFZH 3UO1H 2HJFA 4AC1X 4JLRB 4O58H 1DANU 2DT0A 4DOHB 5FKPA 1KIRB 1HEZA 2XG5A 2HLAA 2NW3A 4OGAD 3WEXA 1P4LB 2DT1A 1AKJA 1WBXA 3MRDA 2IAMA 3MJ7B 5T3ZE 1GZJA 1YEIH 1RK1B 2CKBH 1JPTH 3LKRB 5DEFB 1CL7H 4BZ2L 3HR6A 3HR5A 2EECA 4PJIB 3RRQA 2W60B 4GMSH 4H88H 4QRTB 2XWTB 3TWCH 1INEL 3FMGL 3GMLA 1UXSA 5HHME 1DQJB 2BDNL 1CU4H 2ZSWA 1VJZA 5BYWA 3H42H 2I9TA 2JJWA 4L4VA 1G94A 2WLZA 2VQTA 4QTIL 1RZGB 4U3XA 5JQ6L 2FL5B 3SJVE 1BVLA 5FDWA 5JW4N 1A47A 1Q1JL 1R5WB 2VZSA 4J3SA 3UTQA 5BVJA 4URIA 4LSUL 4NHUB 1OB1B 1OSZA 5L8JB 3C6LC 5BZDA 2JJSA 1GOGA 1S5HA 4L5FH 3I50H 4N90D 1GIGL 4KK6C 1KCVL 3EZ8A 5DRXA 5HHVL 1WWBX 3B9KA 5J7CC 2FH6A 5JA8B 3DURA 2RGSA 5FUOH 2VRAA 1GQIA 4P2RB 4I3SL 3RIAF 3MOAH 3S37H 2G5BB 5FGBC 1OWWA 4PJFB 3L3IB 3CXDL 4LRNH 2WW8A 2J8FA 4GH7B 4J4PA 4UV4L 2UWEB 4IPNB 1B31A 3H9HB 4F3FA 1X5GA 4ZSOE 4HPHA 3DHJA 3P4LA 3GXIA 1GPOH 1E4NA 3IJYB 5E8DH 2SEBB 5LG1A 3B5GA 1JGDB 1NFDF 4PGDB 3BPLC 2MMXA 5EPMB 2Z93B 5LBSL 2MKLC 2JK5A 3OKKA 1HKKA 3ALGA 3QHFH 3T1FA 1GJIA 4XNYL 3T2QA 3U7YL 4ZOBA 3F5WA 5IF0A 3P9WB 1I1AB 1RIHL 1HXYB 3QEHA 3H9YA 4JHWL 1J1OH 2UVEA 4XNMA 3V4PH 5HYSG 1SYVB 2DKUA 5KSAD 2EXYC 4M93B 5CEYB 4TTGA 5KTEL 3MRKB 1KPUA 1QFUL 4XPHL 2XIDA 3MUY1 2EYTA 3KPRB 2K7PA 3MV9E 4KJPC 4LNRA 4OLYL 1U8KA 4M1GL 5E00A 1QA9A 2WNWA 2WVUA 4GAFB 4TRPL 4PG9B 2AJUH 5BZWA 5GGTH 3BUYA 2BNRA 5F96L 3FCTB 3D85D 5LWYL 3SO3B 1GC1H 4J12A 4AEFA 3KYOB 3NN8B 4POZC 4NX0A 2XWEA 4QCFA 5IBTL 1JRHI 2WKGA 3RTQB 4IOFD 5LGJA 4QHNB 1BIHA 1F6AB 5F7HA 4ZUVA 1RFDH 4DKFH 4WFGE 4ODVH 5CINL 1CFSA 3CMOH 3WO4C 1BLIA 2OYLA 1BAGA 3GSVB 4U0RB 1JHKL 4YHYC 1UD6A 2YWZA 4DKEL 2YWYA 4OZHA 3LB6D 3WN5C 3VDBA 4UU9A 2X42A 3H9SD 1NGYA 3BP4B 2FJFB 3BP6A 4PRDB 1AD0B 1YEDA 3CH1A 1N7ML 1RUPH 3JV0A 2AEPL 2A6JB 2WIMA 4RSVA 5FCZA 3UG3A 3HE7B 1XR9B 1MCIA 5GIRB 2DQTL 2AKRA 2EC9U 3HI5H 2ZUWA 1TG7A 2OQJB 4CAGA 1DLHA 3KWWB 3QUKA 3TCLB 3QIUA 3U30B 2YD5A 4NOFA 3HZVA 4U31A 4WRLA 5A3HA 5CBEA 3C5ZA 2CKRA 4MQXC 1RUMH 5GS2H 4HKZA 4JRXB 5DHVA 5DC0A 2MQ0A 4KU1A 2GTZA 2XQYG 4L8BB 5BOZG 4J23A 2C7UB 4BF7A 5B3NA 3F58L 4XMPH 4KRPC 3HC0A 2PCPB 2B2XL 1MFVA 3CLEL 2NX5E 2OSYA 2IXUA 4LLUA 4S1DD 3U6RB 1XH0A 4F7CB 4UNVA 2QLYA 3QDJB 1JDCA 5FYJH 3W0KA 1ZEAL 1P6AB 3SUSA 3OGCA 4PJ9A 1A22B 3NOIA 4NM8L 3QUXB 1IKNA 4PY8I 2P7TB 4I18B 2EDXA 3RGVB 3UCRA 5D5MA 3ZJKA 3QG7H 2F58L 2OSWA 4AWEA 4XNUH 4OV6F 1ZTXH 2WZPD 1KBGH 3L9RB 5FECB 3LQAL 4RX4D 3WQ5A 2W65B 3B9KC 3G04A 3KR3L 1HP4A 4HHAA 3UDWA 4PJ5D 4OM1H 5D1ZD 2WAHA 2Z92B 4P4RA 4XP9H 4F8QA 3QPXH 4EDXB 2E3ZA 5TH2A 3D51A 2FX9L 2DKMA 1MFDL 5FXCH 3AY4A 4UDTB 1VGKA 1A9EA 4QRUA 3SKOA 1SBSL 5FUCC 2J8OA 1UJ3B 3CFJB 3IDYB 4PBVC 4BQBA 1LL4A 1BPVA 5I30H 1I1XA 5B38B 3X3FH 2BCKA 4Z7NF 3AVEA 3SCNA 1T2JA 2XZAL 3ULUH 1KTBA 1T0MB 5F9AC 5DSCA 4YFLF 3E3QE 4QNPE 4TNWF 3U2SA 5J6GB 5EOCH 5I8KL 1KWGA 4ZXBD 1JAKA 2A6DA 2VISB 2ZOKA 3IXTA 3BAIA 2KPNA 1KJ2H 2VSDA 3MNWB 4OD3H 3VFOA 1BZ9B 3MRBA 2Q87A 2QR0B 4ONFH 4PV8A 4NKDA 1BQCA 1QNSA 2YIHA 1S7TB 2DQEL 2J8UA 1RZ8A 3GBMH 5EIQA 5HPCA 4Z5RA 5JBEA 2GVYA 4GW5B 4JL2A 4KV5E 3UTTB 1G6RA 2H32A 1S3KH 2I07A 4AIOA 2MCG1 1FLRL 2F54E 3BESR 1K9EA 4HK0B 4KTYA 4NO3B 4NQCA 3L95A 1BEYL 2R23A 2GDUA 3CZNA 1U8LA 2P8LA 2KKQA 1VFFA 3OV6A 1GZQB 3G6AA 2CJUL 2EPLX 1RY7B 4AM0A 3D4YA 4K3DH 2QQQA 4NIKB 5TPWL 3OXRA 4KHXH 3OJMB 4DK6A 2GCYA 4MD4A 1E6SM 3MREA 4MDIA 2GITB 3SCUA 1NBYB 1IZKA 1A7RL 1ZSDA 1ED3A 3ZHDA 1UM6H 4Z95H 5INDB 5KVGL 3GSWA 4O2CB 3P9MB 2QMJA 1JGEA 3MLZH 4WNQA 5IB5A 1HL9A 3L2LA 5CQ1A 3V9FA 4HXBL 4LOUC 2A6IA 12E8H 5D6CB 4NQXA 3CDGB 1KGCE 1QSFA 4J2XA 1JIBA 3LKQB 1LQSR 1Z0NA 4FZEH 5FYKL 1H3VA 4LSSH 3EOAB 4X6BA 3HAEA 2X44D 2RIKA 4QNPF 4HUXA 1AMYA 1T22A 2XVLA 4WSKA 5A2LH 2AK1H 1U91B 4XBGA 4JGMA 3DVNA 5H35A 4P9HH 4KKCD 3P0VH 5DQJA 3VILA 1RJLB 2OSLB 4RGND 3OGVA 2UY6A 3BMWA 4NN6B 4P4KA 1UHVA 5DFVD 2VXSH 4I8DA 5DMKB 1V02A 4GRWH 3VD9A 4KV5F 1NBVH 4OI7A 1BGXL 4FFVD 3C5ZC 4JG0L 1FPTL 3WH6A 2BHZA 5M94B 1XRVA 3BI9X 4FZ8H 5E5UB 4XNZB 1T7YA 4YBLC 4ZUTA 3O11A 2YKLL 1J8HA 1W0YT 4M1CC 1I1CA 2DOCA 1OF2B 1CNVA 3BKCH 4QYOA 3OZPA 1MCKA 4AZCB 3VXSE 1WO2A 2Y06L 2W0FA 4KMTH 1JDDA 1L7IL 3WF4A 1AP2A 4BA0A 3VO0A 3ZKMD 4DAGH 3MRIA 2J7HA 4TPRH 3OX8A 5HXMA 4HFUL 2DICA 4PJFE 4K3JH 1ORQB 5HYJB 3HNVL 2YPVL 1QLFB 3ARTA 2YUWA 2F53D 1EHAA 3NFPB 3U36B 1GQLA 4X6EB 1EAPA 3HPJB 2OTUA 4QHKJ 3OAZK 1ZVSA 1MCCA 1PZ3A 2YUVA 3RWFA 4IDJH 2JEQA 1KIQA 3D3VD 3UDWC 1US2A 3QDME 2WVVA 4MCYB 3IAPA 3BGFB 3O9NA 3VXNA 2FE0A 2E6JA 3L3JA 5GZND 3BVVA 4L1HA 5GGRA 1V3HA 1UXWB 1YPZA 3AY4C 4BA8A 2EDLA 3OAZH 3MFFB 3OKDB 5F1IA 3V6OA 1BPLB 1FZKB 1H5BC 4KH2A 3U9UA 3VDCA 4MSWB 4KRNA 1CTNA 1QW9A 4BH7B 4RFEB 2VLRD 5EU6A 5JLZB 2IQAA 3DROA 5FGRA 3VE0B 2V17H 3HPLA 4NXSA 3D85B 3PWNA 3UJIL 4LKCA 3NIGE 1WDPA 4HUUB 2DQFA 3ZZ1A 2J6EH 4X5XB 5HI5D 3IDUA 4H1LB 2Y23A 3L3HB 3ILQD 4M6OL 4UQ3B 4F7PA 1KB5L 3AOFA 1MHPH 1A2YA 1NAMB 5DJZA 3MV8A 4ZOAA 2VDLL 3NA9H 4L4TB 4WU7B 4ZOCA 4PJFF 5GRUL 1MUJA 3BGMA 4I48B 5F6HI 3TO4D 3NABH 1RURL 1CD8A 1ETZA 2XWBB 4BUHA 1FVDA 3CX5K 4R5EA 3IS0X 4LSPH 3KPSE 1T0NB 2BERA 5ISZD 3O2LA 4FHBD 1P7KA 1R6VA 3O0RL 2EXOA 1KN2L 1JPGB 4APQD 2XY1A 3L3DA 1RH9A 3H9SB 1R3KB 3LRSB 3SDXB 3T77B 1E55A 3U0WH 4WW1B 1VF8A 4Q6YA 5EN2A 1ES0B 4X8JB 2N7AA 3PZGA 5INCB 1V3JA 3VIFA 1X5AA 4HJ0D 3V6BR 4KAQH 4PRPA 1IGYA 2N4IA 1EJOH 1BQHG 2DDQH 2V9QA 3LKOA 1N2RB 4M4RA 4PGJA 5FYLE 2GK2A 1I8KA 2BC4B 4GRLD 4EUPA 3W9DA 2DYPA 3BEVB 4JO1H 3BRDA 2BNUB 4M7ZB 4Z8FL 5CEXA 1E3ZA 5I74C 3NIGF 3B5HA 3R1GH 4DTGL 3WQVA 2PTUA 1XMWA 1QLRA 3DBXA 3GMQB 2Y2WA 2PBOA 1C90A 3KYMA 3T3ME 1FNSH 1H3GA 3OTTA 3N11A 1CDCA 4CVXA 4NYLB 4P4KC 4F15C 1US3A 4N0YH 1GGBL 4ODTH 1PYWB 1KR0A 4MNGA 1Z3GH 5CILL 2H6PA 4AY0A 1U8MA 5KSBA 3KYAA 5FA4A 5FKYA 2Z35A 3MRHA 3PWVA 3IJ8A 2X89D 3TESA 4LCCB 1CFQB 3MA7A 3D3AA 3S9DB 1XH1A 2AGJL 2R4RH 1M6OA 3S5LA 2YBUA 2WMGA 4GJTB 1IC5L 1F58L 3TV3L 3ARBA 4GW4B 4OZIE 1ZBVA 4NWTL 5BS0A 4UZSA 4LYQA 3PG2A 3SJVD 1A14H 1KG0B 3MLSL 4PJ5B 4UZUA 3CFDA 5D1ZB 4PJBA 1I7RB 4JQVA 1ZLSL 3UROR 2ZKHL 2CGRH 5ESVA 3WN6A 4OZ4A 3JWDH 4FQLH 4H8WH 4LLVA 5K9JL 2NY3C 4M81A 2P8MB 3KG5A 1MVYA 2R9HC 5MHSE 4UIKL 3I75A 3X12A 2CDEB 5E09A 4E8DA 5E9DB 2LU3A 4O9HL 5JUEH 2WMFA 1YDPB 4R2GC 5C6WH 4WEBH 3QUZD 4JDZA 3KS0J 5DUPL 1X3DA 4H5SB 5CJXA 5JIWA 4OUUA 2PYFA 4JFHE 4OFYA 4A6YL 1PG7X 2F1BA 4ZXBB 1CZ1A 3CHDA 3QR2A 5FUZL 3EAKA 5DT7A 2AV7B 1BZQK 2XPKA 5FL0A 4LPUA 4OD1L 4OZFA 4EDWH 2EH8L 1AO7D 2FIKA 3RWGB 3V6OC 5SWSD 2Y4SA 3RNQA 1DJSA 4HKBA 4LYRA 3UTTE 1D6EB 4MAUH 1CLYL 5D4QA 5EUKA 2Q8AH 4HU0A 4GG6A 4X5WB 4KC3B 4OZGB 3KAAA 1HKMA 4GAJH 1WIPA 1ZL1A 5C0DB 3W27A 1BD2D 2IJ0C 1QPXA 4HW6A 1OHQA 2CD0A 4P46B 5DJ8A 3BE1L 1DBAH 2IPKA 3MA9L 4PR5A 2CLZB 2VLME 1HQRB 2HFTA 1A4JB 1PZ2A 4H8HA 3JWOC 1MF2H 4IS6A 4OCYL 3WHE0 4OCRH 5DJ6A 1KCSL 1Q6FA 4G80B 4IOIA 3SBWA 3RPIA 1RZFH 3DXAA 1U58A 2Q86A 1DEEA 3QQNA 4YHPB 2GEEA 2HKHL 4Y1AA 3RWIB 1F4YL 1EEZB 3AMGA 2D7TH 2P8PA 4K3EL 4R7NB 1E6OL 1TPXC 1WFOA 5FF6B 5EU7C 3DV4A 3NIDE 3BHBB 1T6WA 1IQWH 1TNNA 1FNFA 4XP6H 4KGJA 5I1HH 1SJEB 1UD4A 1UR0A 3LX9A 1OB0A 3ZJ6A 4JHAL 3P4NB 3OHXB 5D71L 4BSWB 3FKUS 4K7PL 5IFHH 4QCIB 4RGNB 5L8KB 2CH8A 3DIFB 3TGXA 2DWDA 1ULVA 4AL8H 15C8L 2G3NA 1NDGA 4Y2DC 4Y5YC 4XVSL 1YEEH 1R87A 2OTPA 2NY3B 3EJYD 3VJ6B 3ZR6A 4YQXL 3GSUB 2W66A 4Y4KB 5CJOL 1M53A 5EC2A 1G7QA 5EWIL 4DWSD 3BVNA 4ZUUB 2DLIA 3GK8H 1UZ8A 2EDKA 3SUTA 1FL6B 3FOMA 5H8DA 3FO2A 1DBJH 1FH9A 5EZJA 2V3FA 4YHIA 4KK5C 1YJDC 5DFTA 1QBLL 5ICZA 3KLAB 4KKAD 3FTGA 4O02L 2EDNA 3H3PH 1FG2A 5HYJE 4J8RB 3WLWD 3MJ9L 1A1OA 4HUVA 1E9LA 4OOUA 3E8UL 5I77A 3QOKA 3G5XB 2HRPH 3IDNB 2F53B 2WUCL 1I3GL 4NKQB 4X9BA 2WV3A 2XN0A 4OGZA 1KC5L 3OKOA 4ZS6D 1LEGB 3ARBC 2W67A 2DWEA 5MEPB 3F8UB 2E7BA 2BNRE 4GSDH 3D3VB 1DBKL 1H1NA 3DDGA 4JQVC 2QKIB 5EZIH 4HGWB 5C0CA 4K2UH 4ZOEA 5IUSA 5EORH 2V5CA 3NCYS 1V6WA 1EEUA 1CGWA 3SCTA 4Y5XB 3RBGA 5BO1H 3CFCH 4WUUD 1EUTA 3G6MA 3QWOB 4KVCL 3MTRA 1NWRA 5T3XE 1N0XH 1NC4D 3LEVL 4WDIB 1W3LA 1NJ9B 3IGAA 4LLWB 4U1KB 3U0PB 1JBJA 2O5ZL 2VLRB 4W87A 3HB3C 2BSTB 5MERB 5CJXC 2I5YH 1B4JH 5F3HA 4GZEA 4LVOB 1XH3B 1AD9B 1J1XL 1E0XA 2V5DA 3EHBD 4HMDA 4PUBL 3SOBL 1NCDH 2ZNWA 4IIQC 4ODBD 5IMOA 3IDMA 1TIUA 3WD5L 4WTZA 1JV5A 4X99B 4JN2B 2QJDA 3NFNB 1UZ6F 1S9WA 4I5BB 4OGYL 3WIHL 3VWKD 2BFVL 5CZVH 4LRIC 4NO0D 2EIBA 4NUGL 2DPEA 5IMLB 1T4KB 2YFOA 1BJ1J 1MWAL 5ISZB 3EDFA 3GBNH 3CFKA 3VNZA 4Y5YB 1V7ML 3SDXE 3D87B 3LN4B 5IB2B 2GJZB 4BZYA 2GY7B 4MQTB 3ULSB 5E1QA 3SKJH 2PXYD 4R96A 2VABB 3GZKA 2EYSB 1XCXA 2ZE0A 3SBWC 4DEPB 2PWEA 2VDQH 1FNGB 2V7HA 2FEEI 4J3UA 3U4EB 3LKPA 3PHQB 5DQ9A 3C60D 3BAEH 5A40E 2HH0H 4H26A 4ZUSB 4QT5A 5I1KH 1T83C 4GRLB 1DWHM 1QEWA 2OWXA 1YMHA 1F3RB 4MA3B 5D5ME 4AK1A 1BFSA 3GNMH 3MRRA 1F11A 4KHTL 2FATL 3LS5H 1H4PA 4XCCH 5TQ0L 3M1BB 4AIZA 1VIWA 3VXOA 1XGQA 3QG6A 4X7SH 5DJYB 1ZB5A 3IJ9A 2Q6WB 1NCNA 3CPUA 5E9AA 3O3BA 5T1KA 3IKCA 4J6RL 5GRWA 5JO5B 5L7XL 4I77L 1KXVA 5DGQA 5E1HB 1CGYA 3NIYA 1G6RL 3T2NL 1EMTL 2NPLX 2XV6B 1ZHKA 1JI2A 2BNQA 3TBWB 4POYA 1I8MB 1XGRB 2OBGA 2BVQB 4X7EC 3PGDB 4LBEA 3D69A 3WDHA 4IMKA 3UJTL 1U41A 2BVYA 4OLVH 1QR1B 2VZUA 3SDXF 3H7BA 2NY5L 2XZZA 3OAUH 1BYCA 1C91A 2PW1A 5KSVB 1OIFA 4M62L 5IQ9A 4Q9RL 3HC3H 1W1TA 4PRNA 1Q0XL 4Q6IA 4UV7H 2WHKA 3AHYA 1HHKB 1RULH 4IIQB 5T1LB 1ODZA 2QQNL 4OV5A 2RAMA 4LHUD 1IJ9A 2EO7A 3FQTB 5ITBL 3DTXA 4LLMA 5E9DE 3VMOA 3HHRB 1HF6A 5BV7H 3QQ3A 4GO9A 5EU5B 1S9VB 4JFDA 3C08L 4AT6B 3QUZB 4MNQA 1NCCH 4B5EA 2DQGH 1ZHBB 2IQ9H 5JPMB 4KI5D 4MJIA 3V6ZA 4NQCE 3PDDA 5D5MF 1W0VB 3AMLA 2XVGA 4YIQB 3DYOA 3THCA 5DRWB 4O5LH 5HHQA 4PMXA 2NTFB 5JTWA 1KCRL 1AO7B 5SWSB 3SO5A 1R34A 4ZFFB 1EBAA 1A6ZA 3BKJL 5HBBA 3WFHA 2HWZH 2GT9B 3LRGA 4HWZB 4QP0A 5EDXA 3QDMD 5JW3L 1INQB 3W2DH 4RISH 3UBXG 2A3CA 1ERNA 3KXFA 1IGFL 3IK2A 2MWCA 1BD2B 4PBXA 4GKNA 3TVMA 3B8SA 1CLOH 2IFFL 3I6GA 3GM0A 5A94A 2XFXA 5SV3A 1HIMH 2AJXH 3X11A 1QSFE 2I9LB 1LLOA 1EFXA 3FT2B 5ESQB 4YR6B 1UVQA 3WY1A 4P0DA 3PJSB 1FDLH 4S1SL 4KDVA 1MCOL 1NGZA 4WFHE 5FM4A 2QSTA 1KLGB 1RZKC 1WFUA 2YN5A 1FH8A 1OM3L 1B3XA 3WD0A 3WKML 1YEGL 3WS6A 1E56A 3VU2A 3ARGA 3CU7A 4OCSH 1I4FB 3QCVL 5C07A 3DMMA 4HLJA 3WUGA 5EU3B 3WS3A 1U3HA 2CKBA 3L6FB 4MXVE 3WUWG 1INDH 2VX4A 2AJ3A 3EW3B 4NGHH 1QYGH 4J3WA 1RVFH 1NMAL 1J8HE 3QCUL 1OARL 3H8NA 4PGEA 1MCNA 3OG4B 4J7RA 1NMCC 4A2MA 2VDML 3KPSD 1A3LH 1CXFA 5L2JB 3FFDB 3C2SA 4MNHB 4NM4L 3CFBB 3LS4L 3D18A 4X83A 2C3WA 5I66B 3DX9B 4TVUA 2OCFD 1X5JA 4GZIA 3BZFA 4JB9H 5FCSH 4ZFOL 1UWGH 4NHCH 3G5VB 3O2VL 1ZAGA 2AAVA 5A16B 1AJ7H 2VRJA 2F15A 2WQRA 8CGTA 4NQEE 2R2EB 4HLZG 5FGSA 3OGSA 2C1PA 3O3UN 3FRPG 4YJZL 1LK3H 1VPOH 1S8DB 3BKML 4U1GC 4DWSB 4LCYA 2BVTA 4WFEE 4PV9B 4ETQB 3BP7B 1C93A 3T0BA 1CDYA 5TQ2L 5CJ5A 4KKLD 1A6PA 1XF1A 3M17B 1ND0A 5C3LD 3W4RA 3NH7L 2VL5B 1EX0A 5GJTH 4F9JA 5ALBL 2ZX7A 4V2BA 5C8JA 3D0VB 3EJZD 2VRKA 3U83A 2W9LA 1KXVC 4QHKI 1OAYL 3FRUA 1TJGH 3ARDA 2J78A 1YEFL 5C6TL 4HLZH 3EJUA 5GS3A 4N5ED 3V6OE 4I0PD 4MS8D 4HUWA 25C8L 1Q6CA 2CLRB 1P84J 3SEPA 5JHDA 3U4BH 4IMKC 5ENWB 3RWHB 1ACYL 2R2CA 5EU6E 2JB5H 2W07A 3ZDXF 5IW6B 5L88H 5MEND 4HOXA 4OM0L 5C0AA 1QFHA 4OIIL 3VSVA 3IRPX 1S9XB 4HIIB 5EZLB 4RDQG 4KZDL 5AG9A 4U2YA 4Q6IC 4KJPD 4YHZH 1UCBL 1QBBA 4PSPA 4WUUB 3UAJC 4TQEH 4PJEB 5DD0H 1MEXH 2ITDA 3WIJA 1NC4B 3ZHLA 1UKPA 3D2UB 1II4E 4R3SA 2XHYA 5GGTA 3GXFA 4RCAA 4MX7B 4HUKB 4XI5C 4A4AA 1WWCA 3W29A 5L6YL 4JM2A 1TDQA 5IOPB 4K9EL 5D7IA 4GOSA 3HCVA 4R4FH 3SKNB 5JQHC 2VCAA 4JFYB 1MW3A 2XTJC 3S4SG 4EEEA 1E0VA 2GDVA 2J8GA 5HYSA 5EU7E 1PKQB 3LH2L 1T2QH 1VBUA 5DFWH 2WCAA 3WMBA 1J0IA 3DARA 4YDVA 3JV6A 3FNDA 3S88H 2EE3A 4GBXD 1NMBH 1O7SA 1QNZH 1A7PH 2IH1B 5D96C 3ZKNC 4PY7B 4EIGB 1FZMB 3PV6B 2E7LA 3VWKB 4H20L 1HYRC 1G6VK 1RZJH 4NO0B 3MGAA 3RVXC 4UQ9A 4AEHH 5I16A 4YXKH 4DKAA 3OR7B 2F19H 2R1YA 3MJ6A 2PYED 4CL7A 5EFFA 4D0DA 2DQJH 4YC2C 2AK4B 1UM4H 3CH8A 4KY1H 1HHJA 4MWFA 4XNQB 1RMFH 1GHRA 4I3GA 1IGMH 2PXYB 4F9LA 4XB3A 5CSZA 1PFCA 1FOBA 4FLQA 4DVRL 2YD8A 1ZANH 3WS6C 1PZ5B 1AKJD 1UWXH 2MFNA 5DD3H 5DLML 1RU9L 3ARGC 2IAMD 3P4OB 1MFBH 3C60B 4MNGE 3DMMC 3F7VB 5KSBE 5A6JA 3HS0A 3WFEL 1KEML 1U3HC 4JCLA 4K3HA 3HNTH 3LXCA 2A2QT 4QRRA 2HMIC 1R86A 2VLLB 1V0MA 1LL6A 1JP5A 1FH5H 5KS9E 1F3JB 1YN7A 1IAOA 4HBCH 1LO3L 1GRWA 1CE6B 2X4UA 4RE3A 2YFNA 4L4VD 5LGHH 1CE1L 1KN4H 3KE0A 1JNLH 3IFPA 3ZQ9A 3N1GC 5A6BA 1K6QL 3MSDA 1JRHH 1CLZH 4P5MB 4G5ZH 4PJBE 4YHLL 5I8OH 5HVGB 4JVPA 4GKSB 4JFXB 1D6VL 4XAKD 2VMFA 5GS1B 2GI7A 1FO0H 4K7FA 1G9NH 3SHSA 3O81A 3TN0D 3B9KD 1B0GB 1CG9B 5E8EA 4TSBH 4B7LA 5GRJL 3RBSA 1HWGB 4XZBA 1U33A 4UB0L 4GAGH 2VIRA 2AEQH 4PTXA 2NQCA 4BQ2A 3TA3A 4J4PD 3E6FB 3NZ8A 5IHLB 3MLRH 2BVEA 5HOSA 4ELMA 4UUJA 3I3BA 3IFNH 4GKOA 1KXQA 1GPFA 4TVPL 4OLXH 2XTJB 4GW1A 1GSMA 4XMLL 3D5HA 3LSOB 4JQXA 2M26A 1KR1A 4LHUB 1W9BM 5TD4A 3TJEH 1KTKE 1I3VA 3V5KA 2F2HA 4WI8A 1NH6A 4DZBA 4A3YA 1TZHB 5C0BA 2CYGA 1VACB 2ARJQ 4M6NH 1C1EL 3WIFA 5IR1A 4NQVA 4AYFA 5KSBF 4GG6E 1R24B 2F18A 1WIOA 1H9VA 1GCYA 1MLCB 4FQQA 2VDOH 4LCIL 4XPAH 5KS9F 2YMXL 3V6FA 4MTVA 4XX1G 3T04D 5DDHA 2WBJC 3BAJA 1YQVL 2NNAA 3VFMA 1KFAL 1MIML 4GKLA 4AZIA 3AZTA 4PJ8A 2AW2A 4ODUA 4GKZA 4Z7WA 5J0BA 4XCFL 3AUVA 2BNRD 4DFHA 2GFTA 4CU8A 3U5UA 3OMZA 1FFNB 2R0LH 4PJDA 3ZO0A 3MLPA 2O5XL 3DXAE 2YRLA 1DFBL 2BRQA 5TGBB 1UB5B 3MBED 1ZGLP 4Y1AE 4JM2C 4M6AA 2W0PA 2WBKA 4CD7A 3VOCA 1A8JH 2D4DA 4ORGB 5F93C 1C16B 1Y0LB 2H8PB 1NGXA 4AZ6A 1O0VA 1GGIL 1TZIA 4KJWD 2XVKA 5JXEA 2IF7A 2E7LC 2FYYB 3X3GL 3V5DB 1I9RL 2I26N 5SWZA 5DGRA 2X7LB 5LA1A 1R46A 1B0IA 3SDAD 3MRNB 4P5KB 5T1MA 2JFEX 1CQYA 4GG6F 4GG8B 2DQDH 2IPUK 1MI5A 2EDYA 5I24A 5FK9A 3SN6N 4ZFMA 3G6LA 3AREC 2PWDA 2KQMA 4F9LC 3QIUD 4OLZH 3IVKA 3ZYIA 3L5HA 5EMYA 1HHIA 2B31A 3ULVL 4WHTB 1W3JA 4S1RL 1DN2A 4LKXA 2D0FA 2D0HA 5E5MB 3BXWA 2PTTA 4M1CD 4AZBA 1TUXA 1PY4A 5CWSA 3VFVB 4JDTH 3WF2A 3BJLA 5D8JH 1KB5B 3UZQA 4OSUL 1DQQA 4F2MA 1KJ3L 1MRCL 3F7RA 5D9SB 3WY2A 1OAZL 5FCUL 2F8VA 3GKWH 3E2HB 4PJ9D 5HYEA 3FB7B 2LU4A 3KYKH 6FABH 1W9DM 3FOLB 5D1XD 1F4HA 1IAKA 3FT4B 4NZRL 5FM8A 5HD8D 1V6YA 1IC1A 3QFJA 3QUYA 3DDFA 2HT2C 3VXMB 3DSNA 3PHOB 3QQ4B 3T0EA 3EDDA 2DMKA 3G6DH 1MCLA 5CHNA 3TYGH 4YAQB 4ATLA 1WBZA 2VJXA 1HINL 2AXGA 5I78A 4ZAKA 4I0PB 5ACZA 1KCLA 2ZXQA 3FO1B 2APTA 2ZCHH 3WFLA 4UBDC 5IDIA 2D7OA 3TFKC 3LKSA 1UWEL 3ZKQD 1X4ZA 5E2UL 3IJSA 3TA3C 2FEDC 4XUYA 2D03L 1JGLH 5T3ZH 3STZB 2A9MH 3DUUB 2F5AH 3MNVA 5BMFL 2HT4D 3RVTC 1YHTA 5J6HB 1XCTA 1UKOA 1LWJA 2P47B 1NGWA 1JWSA 4XVTL 3V7AE 4F58H 2Y6SC 1M04A 4XZUB 2DQUH 3S35H 1AI1H 4XT1C 1D5IL 2GSGB 2IPTH 4PS4L 2DH2A 2J6EA 4X8XA 1Z32X 2O9PA 2X4TB 5ANME 5DJAA 1OWQA 2DD8L 4PFEA 4Y7MA 3LOWA 2B1AH 2AJSH 5CJQH 2YEZA 3P0YL 4FXLA 4KTEH 4KJQC 2F8XC 4GBXB 2FJHA 5DR5H 4PB0L 5I15L 4NQCD 1QQDB 1OAUL 5I79A 5CEZE 1KT2A 4MZ2A 3HLAB 1HKLL 5I1GH 5F3BA 3RVVD 3AFBA 1JTTA 5EIIA 6TAAA 3QJFB 4BQ6A 4PEEA 2PYEB 1MQPA 1AC6A 2ORBL 3DUSB 1QHZA 2AK4E 4JFPB 3K81A 3S36X 5DT1H 1B2YA 4ZFGL 2E7MA 4P3WA 1PW3A 4XHJD 3SCMB 2B7DT 1CD0A 3BJ91 1KBBA 5IFJB 1ZV5A 1E5JA 1FGNL 4WWKC 2WSPA 4MD0A 1HK6A 5HNNA 1CD9B 2OSXA 2G9HA 1AKJB 1AVAA 1E40A 1B6UA 2RFXA 3QQ9C 2Y36L 4A6YB 3EOBB 1JFQL 4JN1H 4WO4D 3DHUA 3WKZA 5E0FA 4MA8L 3CK0L 5GNYA 4H8VA 3DO7B 3CZEA 4KVNL 5C09A 4C4KO 2J47A 1AQDB 3L3KB 4YFEA 3VIKA 2BNQE 2XN9A 1WEJL 5K33A 3B6SA 2NTSP 4M48H 3RL1B 1U8IB 4XBPA 1ZS2A 4BZ1H 4AIUA 3MXVH 1LNUB 1NSNL 3BIKA 3KLHC 3T3PE 3I84A 2Y25A 1XGYL 1JPSH 5FDWB 2IH3A 3UTQB 1UZ4A 5BVJB 5GGSY 3UZEA 4QRPD 3STBA 1BMGA 2C1OA 2GY5A 1L0QA 5BZDB 1S5HB 1G9MH 4X4MA 2XYLA 1G7IA 1XGTA 3QHOA 4YX2L 2OYMA 3CX2A 4N9GA 5I17B 3C9NB 4XVUC 4N8VG 1JZ2A 4K7PX 3MLWH 3BZ4A 3T08A 3TN0B 1UASA 4Z77B 1GW1A 1R5IA 4G6AD 4LDOB 3WD4A 4LMQE 1YEKL 4IRJC 3MLUH 4G9DA 4ZENA 4JFDE 5KOVC 1RJYA 4MNQE 3BCDA 4LSQL 3NSMA 4MJIE 2GFBA 4FP8L 5A2AA 1F6FB 3WDIA 1S7UA 2NW2A 5B8CB 2F7OA 1E70M 3QHZL 2VLJE 5M7QA 1XF5B 3T0EC 4O2EA 2XTJE 5HDQL 5J4MA 4WFED 3WXWL 3T65A 3DC0A 4BKLA 1PLGL 4JFZL 5EOCJ 5FYKE 3UO1L 4O58L 1K8IB 4R2GD 5C71A 2A0LD 2JK5B 3LPGA 5AZEH 4TULH 1KXHA 4TNWK 3QDHA 3WE6A 4S1QH 4ODHH 3H3BC 3F5WB 1V05A 4Q0XH 2GJRA 3TH2T 3QEHB 2CKBL 4WFFE 4B9YA 1WCGA 7FABH 2MSPA 3GJFK 5HGHA 2ESVD 5GXBB 1T89C 3O6MH 3QFDB 5F9JB 5HYQB 1Q6GA 4GMSL 4H88L 1UH4A 3TWCL 1S7SA 4Q9QH 2EYTB 3QH3A 3T3PF 1BBJA 4G7VH 1WK0A 4HH8A 4HIEA 1CU4L 2D3VA 3H42L 2G3IA 1XF3A 4HZLA 1G7LA 2Y24A 3ZTNH 3VUPA 3GJFH 3G9AB 4LF3B 4WWKB 4I4WA 1VRXA 3IU4H 1EGJA 1EO8H 1K5NB 4LPVA 3MBEB 1QSZA 4L5FL 3RWCB 3I50L 1D5MA 1HCVA 1OGSA 4GI8A 2XVPA 2NZ9D 3SCSA 3ET9F 5J13C 4OLUH 4G7YH 4NBYB 2P44B 1CD1A 1FFQA 3MV8D 4WIQA 2O92A 1FYTA 4CRPA 3WMSA 4JPVH 3P2TA 2VXQH 5FUOL 3LHPH 3TO2A 2NCMA 4HIHB 2P5WD 4LEOA 1HJVA 1P1ZA 2ICWJ 3WBEA 5I1IH 3KL5A 2A77H 4LRNL 1W9XA 2ZICA 4OZHB 3WDJA 5C0EB 4UU9B 2O61A 1IGTA 4HKXA 3SDAB 1WC7B 5E8DL 5ALCH 3SUUA 1JZ8A 3GJEA 1MCSA 4GMTH 3LVEA 3PQYA 1S5IH 1IM3A 5IXEA 4OT1L 1TLKA 4UNIA 2XA3A 3QHFL 1B3YA 1DLHB 4GUPA 5C7XH 2EPKX 2H45A 4PRPD 1MIEH 35C8H 3BXNA 2FWOA 2D3NA 3I02A 1CLCA 5I1DA 3DX8B 1FYHB 4IRJB 3TTOA 1J1OL 2IMNA 3V4PL 1JZ3A 1ZJBA 4Z7VA 5CLTA 4AD4A 1K85A 1CGUA 2VN7A 2WHLA 3I6KA 4HKZB 2A6KA 5DHVB 3TBYB 2DYPD 3VIOA 4JFTA 3MUAA 3HC4H 5I2IA 2XKNA 4M8VA 3BT2H 4AEIH 2NY6C 4NSKB 2WVSA 3HC0B 4P57A 4Q74A 5GGTL 2ZX5A 3T0XA 1T3FA 1T1WB 4JPIA 1GC1L 1FVEA 1CK0H 4AZ8A 2BXYA 2BK8A 4KK5D 1CXEA 5J3HC 4LLDA 3BFOA 4XXDA 4PJ9B 4L8SA 1C92A 3D6GA 5D1XB 1RFDL 4DKFL 1DN0A 4ODVL 3PGFH 2LE9A 1NOUA 3HTLX 1NFIB 1MWAB 5A43C 4PD4K 3VXME 5C0AE 5F44A 1BGAA 4Z78B 5ERWA 2WUBL 3CMOL 3VGAB 2XWJA 1QFWI 1A1NB 4GXUN 2XSBA 3ARBD 2BSSA 4HXAH 3P11H 4ZPTB 5FOJA 4EZMA 3L5XH 5BS0D 3BLBA 4QHUA 4YHKL 1WBYA 3PTMA 3NCJH 2EIZB 2APBA 2HN7A 1PEZA 3FFCB 2YDQA 5TH2B 3F7YA 1LDPL 1IGIH 1KJMA 4OLWH 3BDXA 4JFVA 4TUJA 1RUPL 1VGKB 5D7JC 1HNYA 4H8WC 4QRUB 3LV3B 4U6YA 4CCDA 4LSTH 2DM3A 2ZP0T 5D7IE 5J13B 4NXKA 4HF5H 3AU1A 5CXPA 3HI5L 1A7NH 4L9LA 2GJJA 3ZDYE 4EXKA 3HB3D 4PJGA 1DBML 5J9PB 1I7ZB 3QHTC 5AWNH 3PZQA 5I9QC 3PZOA 2APWA 1RUML 4OFYD 2J7DA 4AXNA 4Y16A 2A6DB 5HYFA 5ABFA 4MA1B 5JOPD 1QW8A 5HYIA 1Z9SA 3VFOB 3MRBB 4LCUB 3MRQA 5DC4B 4NKDB 4XMPL 4FLSA 3KPTA 4RMRA 1WV7T 2J8UB 43C9B 1MY7A 2EADA 3MMWA 1NAKH 5JDSB 1TQUA 1BFOB 5A2CA 2H32B 2I07B 1XV8A 5IHUH 4NQSB 4XPFL 3RDTB 5FYJL 3WNKA 1A1MB 1U8QB 1CFBA 3KWXA 1KQZA 1AR1C 4R26H 1HHGB 4FQXC 2WIIB 4XZWA 4I3RH 3UETA 5GS0C 3A6BH 4MDIB 3MKKA 3WFDH 4XNUL 3MRGA 4FLRA 1ZTXL 1KBGL 4PMDA 4TVPD 3Q6GH 1R75A 4QRRE 2DIEA 5CS7A 1LG2A 3TYFA 4OM1L 3MUZ1 1A6AA 2MPAH 1UYWH 1T66C 2JB6B 3QPXL 3MR9A 1OP5K 1F8TH 3B4NA 5D7IF 4Y1AD 3NCBB 1W0WA 1NWSA 2OL3B 1J0JA 1IAII 4NT6A 2XXCB 1NUDA 3AS0A 3TZVA 3LKNB 3ZDYF 3T4AA 2P24A 1FNAA 1MCPH 4WO4B 3ROLA 4H7VA 2QSVA 3REVA 4FABH 1P53A 5I30L 4QTHB 3KPNB 4JR9H 3X3FL 1T22B 1SM3H 2BHYA 3O6LH 1OP5H 4M1RA 3ULUL 5H35B 2FH8A 5MI0C 5DQJB 4PJAA 2M2DA 4XBEH 2B4CC 2UV3A 1SZNA 5EOCL 4KTDH 3OG2A 4XX6A 4KDWA 1S9KC 1KJ2L 1RHFA 1G7HB 4OD3L 3W0WA 1Z2KA 4ONFL 2X4OB 1CDGA 3GI9H 3L7EB 4HGKC 4EI5D 1JGIA 4QRPB 3GBML 3MROA 3VFRA 4UOW0 3UPCA 4ELME 1S3KL 4NRZA 3CSPA 1KXQE 3HA0A 5DK2A 4DCQA 5I8EA 2AJVL 1U9KA 3ES6B 1W2VA 3STLB 3FQXB 4XCNB 2HVKA 3G6JB 1K6AA 3W5MA 1DQTA 1AP2B 3WFZA 4BFIA 2NXYC 4W8LA 5C0BE 1ADQH 4K3DL 3QXWA 3MRIB 4YNYA 5I9QB 3OX8B 4KHXL 4PBGA 4BUGA 5DS8B 4L8SC 4MJ6A 2G2RA 2VVNA 1OSPH 4RAUA 3BMVA 4XCEA 1AIFA 4JZJB 4WI5A 4C59B 4Z95L 5CZXC 3B83A 5C0GB 2J7CA 3R06B 5CD5C 1AY1H 4YUEL 3MLZL 2B20A 1HSBA 3WHXA 1LP9E 2J77A 4M80A 2K1MA 5CD3A 1HJQA 4CKVX 5E6IA 5IHRA 4OIBA 3RWFB 12E8L 4Z7WE 4NN7C 3QIWC 1IGJB 5FO9B 3C5SB 2WVVB 4N8PA 4FQXB 4PJDE 5C0CD 1HIZA 4FZEL 4M3KB 4X6FA 3FB5B 4LSSL 5DZLA 5GGVH 4ZFOB 2J8HA 2ESVB 5JOFB 5FYLH 1OAKH 5E2TH 3JVGA 4P9HL 1N64L 3NA4A 3P0VL 4U1SA 4BYHA 1VSCA 5DXWA 5LCVH 2FJGB 2VXSL 4L9LC 1MELA 4PRBB 4Z6AT 4ENEC 2VXUH 4KWUA 3N1FC 3OJVC 3HPLB 1ZGLA 1NBVL 2A3EA 5LXGL 1XGPB 2BVUA 2Z0BA 3RQ3A 4AH2B 3BH9A 4Y16C 3SDCA 3DETC 3HZYA 4FZ8L 3R8BB 1SMAA 3OKEB 4KKNA 5C0NC 1ZHNB 4HUNB 4G8IB 5SWZE 4P2OA 1FCGA 3CVHB 1U8HA 3D0LA 3TPKA 2E4TA 1X7QA 2EPNA 3GSNL 5ILTH 2H2SD 5K9OA 1MUJB 3BGMB 1CL7I 4GQ9L 1MI5E 2P5WB 2E6QA 4DAGL 4TPRL 1ETZB 3BP5A 4K3JL 2J4WH 2VERN 1QFOA 3UBXA 2C26A 3KPMA 2ZCKH 4AJ0A 3MV7B 4UILH 2GSIB 4LX4A 1LP9F 4FFYH 4YDJA 1KJVA 2DTSA 3WEOA 3SDDB 2ADFH 2C8NA 2PI6A 4XWOC 3Q0HA 3LPOA 5DD1H 3UC0H 5IIEA 5KAQF 3RY5A 1ZT1A 1SEQH 4ZE4A 1WZAA 1MFEH 4PJDF 4M61A 1KELH 5BRPA 3L4ZA 3ZL4L 2FDMA 4IDJL 2Z8RA 5DZOA 3BDYL 3B8YA 2A3AA 4JL1A 2J7EA 4M4PA 2BOBA 5DMIH 1CICD 5EBMA 3OZ9H 3W82A 4FMFA 1FZJB 1JNEA 1GGUA 2PO6C 1R85A 2ADGA 2YPLA 3TZVC 3H53A 1OW0A 3S7GA 3MODH 3F5JA 4AD0A 5JORA 5GRYA 4ZG1A 4UTAH 3QIBC 3QFJE 4LPWA 5KEZA 3ARPA 1MREH 1HNFA 3T0EE 2GW5A 3WUWA 1KTCA 1UD5A 3T8XA 1QBMH 3Q1SH 4JJHA 3AXIA 3MO1A 2V17L 4FQHA 4GS7B 1ZLVH 3UP1A 2VITB 4U6VH 1S7VA 2J6EL 3ZJ8A 1WNOA 1QO3A 5IROC 5FA4B 5T1KD 2PUQT 3AAZB 3PL6D 1HYSD 4LLYA 3WF0A 4UIMA 4PCTA 3MA7B 5CP3A 2HTLC 1CDUA 3ALXA 3NA9L 1WAAA 4OGXH 3S97C 2MCPH 3NABL 3VH8B 3DX6B 4QF1B 1I9EA 1CXLA 5E95B 5A8PA 5BS0B 3AXHA 4LSPL 4Z2IA 1EXPA 1MSPA 4ZO6A 4LCWB 5D2NA 3CFDB 4ZYKB 1HDMA 1Q9WA 3FFCE 1NL0H 1P7QA 1YMMD 2NLJB 1Y7VA 3U0WL 2HISA 4PB9H 3FJTA 2ZX8A 3CPLA 4UQCA 4UDUB 4PJ7E 5LA0A 1EEYB 1EQPA 1OD7A 4TOQA 1DSFH 5FB8A 2VX6A 2W63A 3SQBA 3IDIB 3F5KA 3WD3A 5D1QA 4PTTB 4HK3N 4KAQL 4PJXB 4GINA 1UQYA 4JG1H 4OAWA 5BXSA 4JFDD 3W37A 5SX4H 5I6XC 2EDJA 5E6IC 1EJOL 1LO4H 4MNQD 2IG2H 1E1FA 1I7TA 4RWYH 2VQ1A 4NZTH 2DDQL 4MJID 3BUQA 3UTSB 3LRLA 4WTWA 1TZGL 4CMMB 2XICA 1NKRA 2HT3C 5DI8A 1I75A 3QP3A 4TVSa 1EHLH 1QHOA 1T7WA 3LXAA 4I9WE 4TSAH 4JFOA 3OJDB 3QXAB 4HFWA 5CUSH 4HWEH 3R1GL 1ISVA 2COQA 3JVGC 1CXHA 3IYLW 1B3VA 1FNSL 3RHWF 1WAWA 3RCNA 5EUKB 1LK2A 4RZCA 2BY1A 3CFEB 4N0YL 2VAAA 2XQBH 3KXFD 4ODTL 1Z3GL 4HH9B 1WQVT 5H94B 3TVMD 3NBNA 4O2FA 5IB4B 4P59H 1JPFB 3FQUB 4D6EA 3SDCC 2E9IA 3WF1A 2R4RL 5C0FA 4PR5B 5E8NB 1EFXD 1JJUA 4JO2L 4F7TA 4P2OC 3QIBB 1HOCB 3S4SA 3RJYA 3DGGB 4TTUA 4X0KB 1XIWA 5FO8A 2JIWA 1CFNB 1A14L 3W39B 5DURD 1XGUA 1QWNA 3SCQA 3IFLL 4RQQA 3QEGH 4KZEL 4YHGA 4PJ7F 3ZIZA 5H2BA 2CGRL 5C07D 4QOKA 3JWDL 4PTVA 3DMMD 4ZDHB 4Y4HD 4FFZH 3MGTA 1CEOA 4H1LG 1ITBB 3G5YA 2F1AA 2FBJH 1D5XB 1G7MB 2L4OA 1XD0A 1C5DB 1AGDA 4UQDA 5JUEL 3S8WA 1T04B 4X4ME 3U48A 3P77A 4LVEA 1U6AH 3S6TA 5T3XH 5I1AB 1MHEA 4CVZA 1WWAX 4LHJB 2WWDA 3SPVB 2V9TA 4M5ZL 2IC2A 3VRLE 1MQKH 5IBLD 3QWQB 3CUJA 4EDWL 4EI5B 4HDIB 1OW0C 2R0ZH 5C08D 4H1LH 4X4XB 2CESA 1IEBA 3QO0A 4HKJB 4NKMA 5BWFA 4MAUL 3OAYK 1BAFH 2GUOA 4RGOH 4PTUA 2DIBA 1NAMH 2E27H 2Q8AL 3RA7H 3VXUD 2ATKA 1AGBB 3Q3GA 4GAJL 3G6JE 5ICYA 5DJ2B 2YA1A 4NKIH 1E6ZA 5I6XB 2IALA 5L0QB 4YHIB 5DVNA 3EBVA 5ICZB 1DBAL 3VFTA 3OPZH 3RIFF 3VXPA 3OAYH 1IT9L 3I3EA 3B3IA 3WV0A 3LY6A 3VFUA 1MF2L 3ARSA 3ARDD 2VUOA 3BWAA 5IGXH 1VESA 5M3WA 5DK0A 2JF1A 3V5HA 1KEGH 1R3LA 2FIRT 1RZFL 3OKOB 5AD0B 4C7FA 4PG2A 1YZZA 2ICEB 4JAMA 5JHDD 1ZT4A 4CVUA 4U1JB 5DQDH 4DN3L 1XT5A 1PX3A 2D7TL 4X6DA 2F7QA 3RILA 2OR8A 3NAAH 4AMWA 5D2NC 4W68A 5DRNA 4QY8A 1SBBA 1J11A 4ONOA 1HWWA 4V1DD 4XP6L 2MKWA 2HJKA 2IMMA 2MHAB 5ABGA 1X4YA 1YNTB 3VRLF 5A3ID 5IFHL 3EO1B 3WF3A 5D1QC 2GQHA 4HOWA 2CNCA 3MCKA 1JN6B 4MD5A 3TNMA 5DEZA 1GOHA 1RHHA 2DLEA 1NCTA 3MLXH 4AL8L 1NCBH 2XNAB 5E2JA 4L4OA 3HE6B 1OTSC 1WWWX 4OCMC 4LVHC 1MLBB 5IKCB 1YEEL 2ZG2A 3L5JA 4JM2D 4ODWB 3AHXA 4HIJB 5E56A 4C56D 1TQWA 2C3VA 3G6JF 1JHTB 3DVIA 2X2JA 3GUTA 4DK3A 3BYTA 1N59A 1UUQA 2AJZA 5CGYC 1ZA3B 4PRHA 1DBJL 3WQWA 3C87A 2CITA 1E4KA 2A74A 1DWJM 4HSQA 4I0KA 2XWDA 3FO9B 2VXTH 3H3PL 2CIIB 3BPNC 5C8BB 1HQ4A 1HXMA 3MV7E 4C54A 1AHWB 2HRPL 2EYRB 4Z7VE 3KNBA 1QI5A 2X4QA 3RP1A 4DO5A 3K4ZA 1UADC 3GSOB 2YBRB 1RUQH 2JE8A 1QOKA 1P9MA 1TNMA 1XIWC 3GBEA 3FO0H 1AFVL 3O4OC 4NDMB 1EVTC 3HG1B 5MEOA 2X9WA 4AMKH 3GRWH 4W81A 3EYOA 2QSCH 4N0UB 1JNNH 3IJHB 5IMKA 4BQ9A 3PABA 5EZIL 1CICB 1J5OH 4DGIH 5EH1A 3VFSB 5GS2D 1ZS8A 3KPOB 2VXVH 3LD8B 5BO1L 3L4TA 2V3DA 3CFCL 3RKDD 1S7QA 4NC1C 4G9FB 5C0JA 1CQKA 3CXHK 3I6LD 3O3AA 1N0XL 2DTMH 4FNUA 2AXFB 3BUIA 1EZVX 2JIXA 3MACH 3HAEG 3HRZA 3GDBA 1QSEE 3GNPA 1U8JB 4P2QB 3VXOB 1IM9A 4U1IA 2I5YL 3AB0C 5FYJD 3CZFA 1IBGL 4TNVF 4N0FB 5A6BD 1RJZB 3TIDA 5E4IA 4JHOA 2QV2A 3PHAA 1BP3B 5E94B 5T1KB 3PL6B 2V2WA 4JHBA 1E43A 2YL9A 5HHXH 1JGVH 2BSRB 2R56H 2YD6A 1NLBL 3INUH 3O3EB 1E4MM 4LLQA 3TIEA 5CZVL 3HAEH 4P48A 3V0VA 3CC1A 5SWQA 2PF0A 5KW9H 3BPCB 3GBNL 4PJGE 3GMNA 4KMQA 5F7MC 1U8OB 2FEDD 4LARH 2L7JA 2A73A 5DMGD 1YMMB 1L9MA 1MCJA 1NFDA 2NXZB 4QO1A 3IDGA 4HS3A 4PRNB 3RVTD 2EZ0D 1RPKA 1NEZB 2NSXA 4EN3D 3SKJL 3OIHA 2V3GA 3N15A 1DLFH 3NPSC 3RVUD 4LLMB 1HH9B 2G8ZA 4MQSB 2VDQL 3LQMA 4PJXE 3ULUD 1NQBA 5HGAB 4OKVA 3B2UC 4PG2C 2DQXA 2R4SH 3PTQA 5A6AA 1A9BA 1WDQA 3L4YA 3BAEL 3IU3B 1TQCC 2I60L 3UTSE 3V6ZB 4D6FA 2HH0L 1BSIA 5HJ3B 5I1KL 4XVJH 4OJFH 3KDMB 1FNEB 4M56A 5HHQB 1R5VA 2FO4A 1LE5B 1T20A 2VI0A 3GNML 4G42B 3WXVL 3RWJB 4NRYA 3LS5L 4D0BA 2F5BH 5MEQB 4KJQD 4PJ8D 4XCCL 3K1KC 5M95B 3WFHB 2CK0L 4JQIH 4HS6B 4X7SL 1LEKA 4MCZB 2ZUYA 4WW2C 3DVGA 4D8PA 2Z4QB 3VXRA 4BK5A 1QRNA 2QQLH 3TT1H 4GZJA 3MRJA 2Q7YA 3EGSB 4FK9A 5GSRB 1MRDH 4L3AA 1U2YA 3GNOA 2GUYA 4GKNB 3AJ7A 5J1AB 1UZ1A 3B9EA 4Y8DC 3RIKA 2DAVA 3HZMA 4YO0A 3N13A 2XFXB 4NCDA 2YBTA 4FMKA 3L4UA 3RI5F 5GRXG 2JLLA 2YL8A 3TBTA 3X11B 4FNTA 4LEXH 2ZWLT 5JDJA 4X7TB 1EFXB 2EBNA 3K8LA 5AZ2H 4JGUA 4ZSOA 5CIPB 1A7BA 1EEQA 4PLJC 1MY5A 5DD6B 2WC4A 4FFWC 5JXED 2BVOA 2DQIH 1N5AB 1BZ7A 3OAUL 1EDGA 2E5EA 2OZ4H 5JW4Q 1E4KC 3N1QC 5C07B 1C12A 3HC3L 3QHMA 2IGTA 5KG9B 3QXDA 4Y4HB 3SCPA 3MGOA 1GOQA 3W0WE 1RULL 4PJXF 2CKBB 3FN0H 3D39B 3PDGA 4M24A 1K4DB 32C2B 3EOTH 1EXUB 4Z0BH 3VXTA 2H9GA 1EUUA 5BV7L 4YHNB 4C7GA 3S37X 4PGEB 3DX7B 5TDNB 1E28A 1P9MC 5F89A 4K3GA 2P4AB 2B1HH 4Z7QE 1NCCL 2DQGL 3D18B 4UI2A 3ME0A 1OT1A 4NZCA 3NMEA 5JZ7D 4P8VA 2VO5A 1C5CH 4O5LL 5GRZA 2QHRH 2IADA 5TDOB 1AC0A 1DHKA 1NOWA 3B2VH 4EUPG 5GNZA 2GYSA 5C08B 4JCMA 2HWZL 5DUBA 3RZCC 4P3CH 2BVDA 1OTTC 3VXUB 2X2IA 3SQOL 3QUML 2WQ8A 4RISL 3W2DL 1GNXA 3M45A 1UQSA 3KPPA 2WW5A 2NY7H 3CCHB 4X7DC 5D2LE 4WUKH 3L3GA 1ZXQA 1NCWH 1VFUA 1Y18A 3ARQA 3DRQA 5I1LB 1R8LA 1TQCB 2AJXL 5GGQH 4GAYB 2OTWA 3QUYD 3CGTA 4WJ5B 5FOBA 5C8JB 5TF0A 1H15B 3T0ED 5EO1B 2AI0H 3MO4A 4QLKA 1G9EA 1XCQA 1FDLL 2AV1A 1GUVA 1IT0A 2F74A 2YC1A 3FRUB 5D72L 1KCUH 3M46A 2ED8A 2FECI 4ZPVB 4EUPH 4Z76A 4ZAKD 3IF1A 7CGTA 4NNYB 4F33A 2XN2A 1D5ZA 1UJTA 3RY6A 2XOTA 4OCSL 4NNXB 2OJZL 2Y72A 3UYRH 1MFNA 2QPUA 3ULVE 1YJDH 3GKZA 2C3HA 4NGHL 4RMUA 4Z7QF 1QYGL 5JUVA 3JTTB 4V1DB 3DJ9A 5AC4A 4U33A 1L7TH 2V2TA 2X70B 3VGHA 4GFTB 1LD9A 4ZXOA 1BG9A 5IESH 3EBAA 2Q8BH 2VT0A 1ONQA 2PETA 3C6SA 4PY8J 4UTBH 3IFOA 2NX5A 1A3QA 4JB9L 3GJFA 5L2KE 1UWGL 1B9ZA 1W8NA 4U1NA 4PMQA 4PJCE 5K9KB 1AJ7L 4LGSB 1FHLA 1KFWA 1RZ7H 1T1ZB 2WP3T 4RNRB 4WWID 3RNKB 3VMPA 4C56B 4MVBC 1NCAL 5HYSB 1LK3L 1VPOL 1LHZA 5D2LF 4W4NA 1I1RA 3JV6B 3ZM8A 3HI1B 1NBZA 1HN1A 1U8NB 3QJHA 1ZLUK 5D7LD 4Q22A 5FOOA 1H11A 4FG6D 1GQKA 5IJKA 4PGCA 5KSUB 4X0NA 1DQLH 1J0YA 2WMIB 5GJTL 3ALWA 1BOYA 3PBGA 4MAYA 5D6DC 2NYYD 2OLDA 3MV11 1WTGT 2XFFA 1IILE 4W6YB 2A3HA 1TJGL 4D0DB 1ZLUH 3QEQA 4DWHA 4E0RA 2DJUA 2GJ6A 3VRJB 3RZCB 3EO0B 3ECQA 1PZUB 3S5YA 2VDPH 4HZ8A 3W26A 1CFTA 4UAOB 3U4BL 3TTYA 5AG8A 3ULVF 1C08A 3GTNA 1YYLH 2ZSVA 4ELKA 2JB5L 5L88L 3Q6FB 2DSKA 5C9KA 2XG9A 1SY6H 1INEH 3FMGH 3CDCA 5EU4B 3UPRB 3RM8A 2AJYL 4OTXH 4IRSA 2HP4A 5C1MB 4QRSA 1G0YR 4BFGA 1JNDA 4YHZL 4WV1A 5E99H 4LAQH 5ETUB 4F57H 1V08A 4HJGA 2DM2A 4TQEL 5DD0L 5C09D 2UY7A 1Q1JH 5DJXA 2QL1A 4PJCF 1M7DA 4LSUH 4PP2A 2CDGA 2XN9D 1DP0A 1WAAE 2IANA 5IW1B 4CMHC 1N0LA 1ITCA 4L3EA 4P2QE 2X4UB 4D9QD 5J3HD 1NUFA 2F54A 3BO8A 4RE4A 4K8RC 1KCVH 4M8QA 5E1AA 1LE9A 4R4FL 4P3DB 1KCKA 5D2NE 3VA6A 1G7JA 2R1XB 5CP7A 4C83A 4LFHG 3VA2C 1FBIL 5HDBE 1NMBL 1G9MC 1QNZL 1A7PL 2DQHH 3JV4A 4NO2A 4R4BA 4OZOA 2LQRA 5HDRA 2B8OT 4FTVA 2EDRA 1FNLA 1JWMA 2UZIH 3BAKA 4BQ4A 3MOBH 5E2WL 1TETH 4ODSH 1RZJL 2CKSA 2ICES 1RD6A 4JLRA 4G8FB 4YXKL 2BY3A 3GMMB 2F19L 5HHPB 2CIKB 3HUJB 1VCAA 1KIRA 1CLVA 1FSKB 3VWJA 1K4CA 2NR6C 1P4LA 2DQJL 1UM4L 1D9KB 4QHMB 3MJ7A 3C09C 1RIHH 3EYPA 3W25A 1RMFL 1ZT7B 3UPAA 4EN3B 4JHWH 3LKRA 5DEFA 4P9MH 4NJAH 3E6HA 3RL2B 4PJIA 1RP9A 4DZBB 2VLKE 3O6FB 2W60A 4QRTA 5KTEH 3VG0H 1QFUH 3AYSA 1DQJA 2XKUA 3N04A 1OTUC 3K4DA 1D3CA 5DD3L 5F88B 3HZ3A 4TRPH 1MFBL 3GXMA 2ZUMA 1B3WA 4JFFE 3APGA 2YSSB 1KJ2B 4JZ5A 4JDVB 1RZGA 2CRZA 2FL5A 3EDKA 5F6IB 5LQBL 4CKQA 3V6FB 1R5WA 2QTEA 2Z1SA 1JWUA 2NY2C 1OB1A 1FH5L 2EEBA 4R97B 5J11B 3ARWA 4PJ8B 3T4YB 4YGVB 1P4BH 4KPHH 1U8PB 3ARFC 4ZUWB 5LGHL 1KN4L 4OQTH 1YEHL 1JNLL 1CGXA 4LPXA 1JRHL 2X5PA 5HDBF 1CLZL 5I8OL 4G5ZL 5A8MA 5JNYB 1CWYA 3SCVA 5FHAH 5ELIA 4QOKE 5BRZD 4PJFA 3L3IA 2VZOA 3U9PH 1JHKH 2WMPA 2E9JA 4NUJA 1FO0L 2EEXA 1G9NL 2UWEA 3BQUB 4NC1E 1HE7A 1FYTD 4CCCA 4YHOL 1QFWH 1NDMB 5EFDA 1UENA 4WTZG 4E41D 3DX0A 2W4XA 4MADA 2VZ3A 3IJYA 1T66D 3M8OH 1N7MH 2SEBA 5KN5A 1JGDA 2IUZA 2DT2A 1OIMA 4PGDA 4GAGL 5EPMA 1ZWIA 2E8YA 2IBZX 3MRFB 3VX0A 4Y5VA 3VFWB 5IJKC 2V2XB 2DQTH 3WJJC 4AIXA 2WWMD 4TTDD 3IFNL 4OLXL 2ICWB 2HAZA 4U1HA 3A6CL 3CVIH 4JFSA 3D39E 1SYVA 3TJEL 3KJ4C 5CEYA 3PQYD 3MRKA 2WC7A 4EAMA 5DK3A 2JCCE 5EB9A 4M6NL 2B5IB 3KPRA 3X13B 5BRQA 1LDSA 1XR8B 5IVOA 3F58H 5DD5H 4PG9A 5DJ0A 5I23A 1RZKH 2B2XH 1KNOB 3EYFB 2VDOL 1I1YB 3FCTA 3GFUA 4XPAL 3CLEH 4UNUA 2B0SH 3KYOA 3NN8A 2EAEA 2I27N 4CN1A 4IRSC 5I18L 1HHHA 2GJXB 5F6HJ 4WV1C 1YC8A 3J8F7 4QHNA 4Z2JA 1FIEA 4JEGB 1DQQB 2JJUA 5ACMA 3GSNB 2OYKA 3WL9B 5I75B 5JR1H 2FBOJ 3AISA 4X7CC 1W3HA 1JF1B 3ZDZF 4XWGH 3DX2A 1VKXB 1HVQA 3GSVA 5CEZH 3FY1A 4U6HB 3PWLA 4X6DE 3TM6A 3O8XD 2A1WL 3QUYB 2FHFA 4GQRA 4EXPX 2Z31C 2YD2A 4H25B 3WUZA 3BP4A 5EZOL 2FJFA 4PRDA 5IHZB 2ZJSH 2JKXA 4FXKA 4UT9H 2XUCA 2E3VA 2A6JA 4ZAKB 1CT8B 3U7WL 3MNZB 5ACZB 4XAWH 3O4LB 1V5JA 3HE7A 1XR9A 2KL6A 1JYNA 5A1AA 3P9LB 7A3HA 2VZVA 1B88A 2CO7B 2YD3A 2OQJA 4PP1C 2R0WH 4PMZA 1DDHB 3TCLA 4ZO9A 5DO2D 2JCCF 1ITXA 3IJSB 1TCRB 1X44A 5FGBA 3EFFB 3FXYA 1FJ1B 3MJ8B 4QXUL 5I8KH 3ILPA 2DQDL 4P8UA 4JRXA 4R0LB 5F7YC 1CDJA 1X4XA 2D73A 4L8BA 2X10A 2D24A 3PP4H 1S9YB 1XCTB 4OLZL 1QG3A 4XX1E 5M03A 2PCPA 1N3NB 2P48B 2W9EH 3C2AH 4PRHE 2ZWZA 2XT1B 4CCEA 4XP1H 2R39A 1KPRB 5LJYH 3QWRD 4Y16D 2X1IA 3DETD 3BPOB 3U6RA 5C0IB 4F7CA 4M7LT 4JDTL 3WD1A 1T7XA 3UBXI 5D8JL 4P8XA 2HG5B 1KTLB 2P7TA 4I18A 4YDLB 3RGVA 3KJ4B 5TPWH 1JGUH 5T5NF 3MX0A 1KB9K 4X6DF 2FX8H 1E6QM 5GZOC 3L9RA 3MSGA 3OGRA 3GKWL 5D7LB 2W65A 3EIFA 4QXGL 6FABL 1T5WB 3KYKL 2NY1C 4G8GB 2VL4A 2X9YA 1LO0L 2Z92A 4Q7NA 5HDOA 4EDXA 4AENB 3G6DL 3TYGL 4F7EB 1E6JH 3BISA 4UDTA 4WW2F 4KQ4H 4I2XB 3UTPD 4Y19E 2WZIA 4HA4A 1UJ3A 3CFJA 1GGTA 2AMGA 5FYKH 2ZCHL 3EFDH 2V5YA 2X4NB 3AXXA 4IMLA 5JW4M 4Y4FD 4V27A 1CBVH 2Q76B 4MXWH 1P69B 3QI9C 3A6OA 4CU6A 5J6GA 3QDGB 1UA3A 2N7BA 4NZFA 5T3ZL 3EDJA 3TPUA 2VISA 2A9ML 2WK2A 1HT6A 3FAWA 3PWPB 1O7AA 1I1AC 1A6VH 4XTRC 2WP3O 1S78D 3MNWA 3WN5A 2VWEC 2QR0A 1BGXH 4JG0H 1S7TA 3R8QA 4M93C 4F58L 3HI6L 3DGCR 3AYRA 4GW5A 3RZWA 3WQ8A 3UTTA 1U2HA 2DQUL 3S35L 4M1DH 1AI1L 3BIKB 4QWWC 3U4AA 1HXJA 4HK0A 4NO3A 1FH7A 3DNKA 1GZQA 3SO3C 3QZWG 5ID1A 1WKYA 1E27A 2DN7A 1BQHB 5IWLA 3NCCB 1XZ0B 1NFDE 3DRTB 2B1AL 1OGAE 2ZOLB 4Q7DA 2Z1KA 5CJQL 3RTQC 3NGBB 2XA8L 1NBYA 5HGGS 5DR5L 2X2HA 4N9GB 4PD4J 3IB4A 1OOAA 4UZGA 3BD3A 2XZQH 2X1PA 5INDA 3ZSSA 3AS3A 3TBVA 1KPVB 3W11C 5D7KD 4O2CA 3P9MA 1CTOA 2Q3ZA 3LRHA 2EPMX 5I1GL 4JREB 3E0GA 4A2LA 3BSZH 4EK7A 1AGFB 3B9AA 4U0RC 1QNRA 3R4DA 2BFGA 3CDGA 3QNZA 3SGEI 5DT1L 3EOAA 1YECH 5IHBA 1U91A 5E6ID 1B0WA 1HH6B 1HJXA 3HE7C 1RJLA 2OSLA 2ZIDA 4P23D 2NY1B 3VXRE 4K07A 1QRNE 2HT3D 4JN1L 1QI2A 3MUGB 5DMKA 4FQPA 3U30C 4Z0XB 1KLUB 1NANH 5ITFB 1NQ6A 5E4EB 1E0WA 4RA0C 3W5NA 1S7SB 5DA0B 2H41A 5FYJU 5D8ZA 3DO3A 4M48L 1XSJA 1JHLL 1KB5H 4PRIB 2P5EB 1WZLA 3WFBH 3RVWD 4AZCA 3BH8B 2HVJB 4NPYA 1JPSL 2AP2A 2R2BB 5IVXB 4TYUA 4Y8AA 4I4WB 3QI9B 4LPCA 3WL1A 1XCWA 2XI9A 3ARUA 2YDSA 5BRZB 3I9GH 4P2OD 1E15A 1ORQA 2ATPB 1QI3A 3AM8A 5HYJA 5E7FA 3N12A 1QLFA 3QUXC 3MLWL 3CSYB 5HHNA 5IBUG 3DX4A 1TA3B 4I18C 3RGVC 3TBSB 2V5TA 2MOVA 1MAJA 1N26A 4JZNB 3CLFH 3L1OH 4HWBH 4E41B 3NFPA 3U36A 4PGZA 2H26B 4X6EA 1FORL 2FB4L 3MLUL 3HPJA 3R0MA 2DM4A 1PIGA 3Q2CA 3S3SA 4JFEB 3O6AA 3A4XA 1DVFB 1IGTB 4NZJA 4HKXB 1R7OA 3WNNA 3ZKXB 5GNXA 4RMSA 5IV2B 1UXWA 4GRMB 2X4RA 3MFFA 3OKDA 3PQYB 5AZEL 4TULL 2RGMA 2WZEA 1UJ3C 3PDOB 1FZKA 3IDYC 3GI8H 3MCLH 3NZHL 4OUOA 4S1QL 4ODHL 5E6YA 4MSWA 4Q0XL 1ZA6B 3BXNB 2FWOB 4X5LA 4KK9C 2CKNA 4RFEA 5I1DB 3VE0A 7FABL 3FB8B 1W3KA 2YPLD 3D85A 3O6ML 1PEWA 1QVOB 2A6KB 3MQIA 1UWSA 3RWEB 4PLKC 4HUUA 4Q9QL 3IETB 4X5XA 4W7VA 3GMRB 4G7VL 4H1LA 4NCC1 1L8NA 3L3HA 4MLIA 3GB7B 2BZDA 4UQ3A 4W89A 2EEAA 5DJCB 1NAMA 3IGUA 1FHGA 2IFGA 3ZTNL 4GO8A 4L4TA 4WU7A 3T2OA 2WCGA 5FD0A 3WL0A 3RU8H 4I48A 4OUEA 3TV3H 2EXWC 1WDRA 1IAIM 4NQDD 1YY8B 2XWBA 3D25A 3AIUA 4OLUL 3GMOA 4G7YL 1C5BH 2V3EA 3MLSH 1ZHLB 1ORSB 3O8XB 5FAAA 4E4PA 4MNLA 4NFCA 1JPGA 1UB6A 3H3KA 5IWLC 1KWKA 4Z7NE 4JPVL 1XF2A 2VXQL 1R3KA 3LHPL 3SDXA 3T77A 4WW1A 5JW4R 2BSSB 5I1IL 4OCNC 1ES0A 4X8JA 1DWFM 3O4LE 5INCA 1VHPA 4D0CA 1QBAA 1P7QD 4OBRA 5C70A 3F7YB 2XQYK 2G5RA 3OXSB 1XC6A 4TSCH 5ALCL 5F7LB 4FQIL 3M7SA 2F7PA 4U6YB 3RMEA 2R8SH 4XCYB 4GMTL 1KIPA 4A6YH 3O2DA 1S5IL 3SGJA 3DLQR 3BEVA 2AQ3A 4NKOB 2BNUA 1K2DA 4M6MH 1QKZH 1MIEL 35C8L 2V7NB 4EE9A 1UM5H 2EH8H 2EICA 1RZIA 3GMQA 1YNLH 3FB6A 1F90H 4KROD 4NYLA 1YY9D 4NN6C 4CJ1A 3VCLB 1Y6KR 5IB3B 2VB5A 5E03A 2UZYB 1LO5B 1NUGA 4PTWA 3PIQB 3HC4L 1PYWA 2DS4A 4OCXH 3BT2L 4AEIL 4TUFA 1GAFH 1LMKA 1U0QA 4LCCA 1JPST 1CFQA 5IB1B 3O9WD 3PP3H 4KI1A 3QEQE 4XNZC 3QGVA 4F9DA 2GJ6E 1CK0L 1AXIB 2QADD 1AXSB 1H5BA 4TX8A 1CDHA 5KAQG 4RX4A 4GW4A 3QNXA 1FCCA 1X5ZA 4G6FD 5ICXB 4G8GE 4D3CH 3ALPA 4JRYD 2CPUA 1CGTA 2DI9A 3PGFL 1M7XA 1U95B 4PJ5A 1T03H 5D1ZA 3LEYH 1I7RA 2HKHH 4DM1A 4MJ2A 3OF6A 3OKLB 4DGVH 3AM8C 4QHLB 2P8MA 4K3EH 1M7IB 2VURA 2J88H 3L5XL 4I2XE 1E6OH 3UJJH 1DBBH 2CDEA 5CZKA 1PQZB 3G08A 4J1UA 5E9DA 4R90L 3NCJL 3GRWA 2IANE 5TE7L 3MR9B 4O51B 1YDPA 3A0OA 4L3EE 1MAMH 4NQUA 4Y4FB 1IGIL 2QSQA 4JHAH 4OLWL 1QNOA 4UFIA 1Q8MA 5I8CA 4K94C 4H5SA 4S2SB 1VDGA 1MAKA 2D9QB 4LSTL 1GZPB 4XC3H 4ZXBA 3BGFC 3PWPE 3VD4A 1TTGA 4GO6B 4OF5A 2AV7A 1GOMA 1M05B 3TH3T 1A7NL 4J3XA 5BXFB 3WUBA 1YQ2A 2G75B 5KSAC 3RUGB 4QDMA 2C0HA 3RWGA 4PJAB 1U3ZA 4YHML 3ZE2F 5AWNL 1V6VA 4FTVE 4HMEA 1R33A 2OMBA 3ARZA 4OZGA 4X5WA 3ROOA 2F8OA 3N9GL 5DHXB 4BS0A 5C0DA 1F42A 1RQ5A 3GSXB 5AYIA 4DOHE 1UD3A 4P46A 2NMSA 4NRZB 2OJEA 5I8EB 1LJYA 4IOFC 5EO0B 1HQRA 1TVHB 1OAXL 2MNUA 4KUCD 4N0CD 3AMCA 3TNNA 3AIBA 2VH5L 1MWOA 4PJIE 4R26L 2E9MA 1L6ZA 2WUCH 3DI2B 4G80A 1KC5H 1XF4A 4KQ3H 3UTOA 5KJRH 3SGKA 4YHPA 3A6BL 3WFDL 1C3FA 3EYVB 3RWIA 43CAB 4RAUB 4E2OA 4XCEB 1UKQA 4ACYA 1EEZA 4BH8A 1IGCH 4UTFA 4WKFA 3BCFA 4W5ZA 4YDIL 3GH7A 5CMAB 3SKUD 2MPAL 1UYWL 5I73B 5C3TA 1SJEA 1TVBB 4E9LA 1F8TL 5AYUH 5BV7B 3P4NA 3OHXA 3LXBA 1K9TA 4QCIA 4P23B 1P5UA 1X5FA 3DIFA 3FQWB 5IFAH 2O5ZH 4NI3A 1F3DH 1EQCA 1WIUA 4P2RE 4JR9L 1HTYA 1IQDB 1SM3L 2CDFB 2E6PA 3O6LL 4NQEA 1G7PA 3SGJC 3VJ6A 2DIJA 3PGCB 1Q72H 2UWEE 3GSUA 2UYLB 4XBEL 3THMH 4AZGA 2ZNXA 4KTDL 3F65A 4M7ZC 4Y4KA 1G1CA 4ZUUA 3QUMB 3CFIC 1Z9MA 3GI9L 3DWTA 5IVXE 1FL6A 4H0IA 4OGYH 1DQDH 1J88A 3F6LA 2BFVH 1UOKA 3KLAA 4ALAH 4ZO8A 1DE4B 4NRRA 4MMZC 4PJIF 1GONA 3LQZB 1MWAH 1U8HB 2OI9B 3D0LB 4J8RA 5DHYB 1X7QB 4O00A 2X1OA 2VWEE 4EJ1C 4LCCC 2DLTA 5K9OB 1J05B 2M1KA 5KSAB 5B39B 1ADQL 4XV0A 2Y07H 3QEUB 3KPRE 4CD5A 3NFSH 1LEGA 4YXLL 4L29B 4XPBL 3NTCL 2OZ4A 2RB8A 2Q1EA 1OSPL 4YBQD 4AIEA 5EOTB 4JFEE 2DB8A 5D1ZC 1UA6H 2QKIA 4HGWA 3PN8A 5A6SA 4ZD3L 3WDRA 1MCRA 3MRPB 1ZT1B 4NO5B 4Y5XA 3CD4A 3QWOA 4G8EB 3SE8H 2FEEL 1JXKA 1NARA 3OG6B 4WDIA 1H0IA 1NJ9A 3QNYB 4K71B 4LLWA 4U1KA 2VX5A 2VLRA 2YRPA 3UERA 2BSTA 2UWEF 5FYLL 4DJMA 5MERA 2YPLB 4QRQB 1M1SA 1OAKL 5E2TL 4IJ3B 5FGCB 1F2QA 4ZXBC 1XH3A 1AD9A 2Y5TA 1OTTD 5LCVL 5HHOD 1AGCB 4XPTL 5J8OA 5IVXF 2EKSB 3FW6A 4QXTB 2VXUL 2P1YA 3MO1B 4X99A 4JN2A 1IM9D 4HT1H 2Y7QB 5TFSH 2WWCA 4I5BA 5C9JB 2BX5A 2D31B 3RIFK 4NQDB 3I2CH 1B0RB 5IMLA 3FONA 5ISZA 4LIQL 4ZFZB 3ESVF 4X9FA 1K8DB 4Y2DA 4Y5YA 5ILTL 3V4UH 1MJUH 1TJIL 4P46C 5IMMB 3A5VA 2G4FA 2G60H 4JRXE 3MLVH 1UR9A 4L8CB 3LN4A 3ZE1E 5IB2A 4F9PA 2GJZA 1UR1A 4TUKL 4WI6A 4YFLI 3ULSA 2J4WL 1A5FL 5I0ZA 2ZCKL 4IUGA 3VFGH 3UESA 1BTCA 1K9DA 2VABA 4UILL 4AQ1B 4FFYL 4XNXH 1GYAA 1FNGA 1BOGB 5JW5B 3SGKC 2OL3H 4PMRA 4ZMAT 5DD1L 3UC0L 3C08H 3PHQA 1E4XI 1I85A 3QDJE 1N4XH 4P7QA 1SEQL 3CPLB 5T3ZD 5HY9A 1MFEL 4KXZH 4ZUSA 1KELL 3B5TA 3GGWB 4HA3A 3PF2A 4GRLA 5DO8A 4OF8A 4MA3A 2X4PB 5HHMD 3VM7A 3OZ9L 1QD0A 5KS9A 4UFKA 3WQ4A 1I7TB 5EBWA 3M1BA 3CV5A 1JL8A 3CHFA 3BKJH 1HZHH 4RGNC 2QLVB 4KROB 4OD2B 3MODL 3WBDA 5JW3H 3NSXA 2YUZA 5DJYA 1V6XA 5DFVC 1MREL 1OL0A 4JY4B 1BJ8A 2D7PA 1WISA 4DZ8B 2WWKT 1OY3B 4MJ5B 4FFVC 4XC1H 1QBML 2C4XA 3Q1SL 5JO5A 4HEPG 1EV2E 3O9WB 4Q9CA 2ZCLL 3RPKA 3TBWA 1I8MA 1LK2B 1NC2D 2QADB 4RZCB 1XGRA 4U6VL 4Y4KC 2YOCA 1QRND 2BVQA 3VD7A 3PGDA 3FQRB 2J7GA 4FXGB 3KEHA 4JRYB 4X98B 1QR1A 1PDKA 5AY7A 1ISWA 1OM3H 3ZE1F 4JY5H 2GTWB 4BFEA 3ZKMC 5KSVA 3MI6A 1YEGH 1QLEH 4OGXL 5EFIA 1UWRA 1N8ZB 5T1LA 4IIQA 4CUCA 1W72B 3FQTA 3HNSH 1R3HB 1A6TA 5EUOB 1TFHA 3G5ZB 4H8UA 3GM8A 3IDJB 1SY6A 1NL0L 1OARH 3AFLA 3S36L 5ID0A 3ETBF 5EU5A 1S9VA 4LRIA 3RDKA 4AT6A 3QUZA 1R3JB 4PB9L 4RE2A 4ZNEA 1ZHBA 5CSGA 5DEGA 3V52H 1DSFL 3MS8A 5F7WC 1W0VA 3S96B 1FGVH 5GS0H 1WT5A 1EGJH