3VGGA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltoheptaose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
554
structure length
554
Chain Sequence
YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 193
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vggA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vggA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vggA02
3O4LE 2EDJA 4YXHH 4QLKA 2A6KA 4HIIA 3R0NA 1XYZA 4UT6L 3VM7A 1OP9A 2OYKA 5ACZA 3KYNB 2OZ4A 4YFEA 4FXKB 4HFWA 3MV7E 3UZVB 5E99H 1DQDH 5FF6B 2YXMA 5IROC 1J18A 4Z76B 1LMKA 1CECA 3W6LA 3TBTA 5EU6D 3U0WL 3QFJA 3OKDA 4RDQG 2HT2D 1UYWH 3C6LA 4PJHB 4IRJD 4W4OC 3RPIA 1GIGL 1QR1A 1RHFA 1RZGB 1EVTC 1G7HB 2NY5L 2J12B 2R0ZL 3UTQA 3WFBH 4HPHA 1XCQB 2DM4A 3HLAB 1GOFA 5C3LD 5DJAB 5DVMA 4A6YB 2J7HA 5B22A 5C0IA 5INDB 4BSWB 5D7KD 2FNBA 3DVIA 2VX6A 4NJ9L 4PV9A 1R75A 3CUFA 5HDOA 1OF2B 2XY2A 2BNQA 2ZNXA 4ELMF 5F96H 4F7TB 3WH9A 1YYML 1JZ3A 3RWEA 1ISYA 1XCTA 4GSDH 4OZHF 1IGJA 3KDMA 2VR9A 3HB3D 5LXGH 2O9PA 2YWYA 1YY8B 3K8KA 5A6AA 1HKJA 3QDHA 3IDIB 2AW2A 3PWPD 1GOIA 4XBPB 2O9TA 4K9EC 1CD1A 3KL0A 1Z9MA 2VRAA 2G3JA 2DLHA 1QFWM 1ZHLB 3GJFB 2XWTA 5CILH 4KZEL 1T0MA 3PDOA 4PB9H 5ANMA 5I5RA 2MHAA 1F58L 3CSYA 3TBWA 3VW3H 1UASA 4U6XA 4GRWH 4PV8B 1ZLWH 4KV5F 4MCYB 4AMXA 7TAAA 2WKGA 5SV4A 5DSCA 1BGGA 2WSPA 4OUEA 3QHNA 4HPOH 1IGTB 4BFBD 2MMXA 1HQRB 4QHUA 2NY5C 1ES0B 3AISA 3KYAA 2I07A 2JJTC 5GRWA 3OLGA 5D6CB 1TETL 1YECL 4H26B 4NKOA 3WE6B 1UB5B 2DQGL 3FB6A 2JFEX 2R9HC 2IAMC 3BQUB 3SCWA 3VXQB 1UADC 1CL7L 1EZVY 4UV7H 4XPHH 1EZVX 1N26A 1MWOA 4G8GB 4YBLB 5E6YA 5ICYB 3RWHA 3QGVA 1LO4L 1KTDA 4PBWD 4G6AD 3C6SB 4PRID 3CU1A 3VU2A 2CLVA 3O2VH 1GHFL 4S1QL 3DX9B 5C09E 3EKCA 2VAJA 5F8RC 2XM2A 2UWFA 3PGDB 3RJQB 4GRWE 3G6JA 1ISZA 3HS0B 2J6EA 2OWWA 2WW5A 2DPEA 2LVEA 1ZU8A 2W92A 5JO5B 4OOUA 3IFLH 1NP2A 3C60D 2X89A 3S6CA 4Q0XH 4NO2A 3SDYL 3VFWA 1QQDA 5D7IF 3BN9D 3H8NA 4Z7VE 5EOCJ 4PRPA 5KSAB 1J05A 3STZB 1MH5B 4C54A 1SBBA 4LPVA 1G7JA 3S35H 2VH5L 3UR7A 2IAND 2F54A 3TN0D 4F7CA 2A83B 2YXFA 1UYQA 2XWBB 2FD6H 3RVXC 2WMIA 3AU1A 2AJYH 4NBYB 4AD4A 3OPZH 4GG8B 3VO0A 4DWSC 3MGTB 3DVNA 4ZUSB 4PJEA 4CVZB 2ZX8A 2DMBA 2J8UE 3MUGB 3VI3F 3QUML 1TTGA 2VZ1A 4ZUVB 3NIDE 4AH2A 4JRWA 1CXIA 1Z0NA 1NM9A 4E42A 1IGIL 3CFDA 3ZYIA 4GINA 1QLRA 3GMRB 4HUMB 1U8PA 1UWXH 4AIOA 4JFPB 4L8SA 43C9A 1I3VA 2J8FA 2GITB 2PUQT 5ADOH 1U3YA 2DM2A 3VWKB 4DAGH 3B8SA 5DRXA 1DEDA 4Z6AT 5HGDA 1E40A 3UJTH 3KPSE 5CBAB 4NUGL 1GYAA 1CE1H 3TIDB 4DKDC 4FA8A 3UG5A 1GAFH 1ZSDA 4Y4HC 4FLSA 3H2WA 2FHBA 3PN8A 3MXVL 4K3JL 2DBLL 1WBZA 2VKWA 4NHCL 4XC1H 3EDDA 3BPOC 4Y1AD 2AK1L 1B2WH 2GT9A 3BKYH 4G43A 4RAVB 4I18B 4QRTA 3IT8D 4MXVF 2O92A 2LU4A 4RFEB 4Z18A 2O5YL 3KNBA 3KR3L 4O2EB 1VRXA 4MAYA 1KIRA 4HIEB 2OBGA 4UT9L 3KJ4C 2OW6A 4KHXH 4WFHD 4JQVC 3PDGA 4XV0A 1V3JA 4HHAA 3WEMA 2ZPKH 1V3MA 5EO1A 1U91B 2WQ8A 1K4CA 4JANA 3V2AR 2HISA 3O2LA 2I9TA 1LE5A 4KK5D 2QV2A 4KQ4H 3WH8A 1G6RB 3HPJB 5T1KB 1T20B 2VC2L 2IUZA 5A2KH 3DETC 3BPLB 2DKUA 1CVRA 2CDEB 5CGYD 5TFSH 4ZFFB 4P7RA 3OF6A 1HXMB 4PJHF 1YJDL 3VFTB 2AJ3B 3ZMRA 2YDSA 5IKCB 1NP0A 2BFGA 2DT1A 5E8DL 2G60H 2J8OA 4ELKB 1SVZA 4KXZH 3FY1A 1KCKA 4H0GA 5E7BA 4FS0A 3RVTD 5E08H 2VCAA 1AO7E 1XF3B 4NDMB 5E03A 3P40A 4HMDA 1W0WA 3NGBB 1U30A 2OI9B 3RHWF 2OL3A 4Z78B 1G94A 5D1ZB 2E4TA 3WY3A 3V6ZA 3ZKQD 2R1WA 3LDBC 5I77A 3HAEH 4PCSA 1N5AB 4NO0A 3RPMA 2MOVA 2VRKA 2F8VA 4KJPD 3UTSD 3QR3A 2BNRE 3FN9A 3GO1H 3I75B 3SE8H 5E9AA 4G6MH 5J9PB 1P4LA 3L7FB 4FMFA 1BLNB 3C8DA 4K71B 2NW0A 5FOOA 3IDXL 4JQXA 4EKXA 3WUBA 2DWDA 4WGWB 2GJ6D 3OKOA 1VADB 4MA1C 5E09A 4LASL 3BH9B 5C2BL 3WKMH 3NH7H 5D1XC 2UY7A 4RNRA 1NOWA 1Y6KR 1K2DB 1FVCB 3VWJC 2WUBL 2YN3A 1TNMA 1U8NA 1UM6L 1X6NA 1T3FA 4N9OB 1JRHL 3VXPA 1YJDC 4PRAB 1PX4A 1BFVH 3RIAK 4N8CH 4AEIH 1AP2B 4M8UA 1A7QH 2H26B 1RUKH 4HXBH 4UT7H 5E1AA 3AUVA 1UWRA 3MRKA 1CU4L 4QHKI 1S5IL 1Z6JT 3ZTNH 3PP3H 1ULVA 1HI6A 2V5SA 1IAIL 2X4PB 2X09A 5HVHC 3K81A 3FQNA 3RIKA 4JHOA 1FFRA 5E56A 1IM3B 3VGBA 4WFEE 2OWCA 4OZOA 4QRPE 5DMJB 1EERB 1VHPA 4K9EH 4P2OD 3MO4A 1E27A 3V9FA 4Q7DA 5EO0B 2EE6A 4LSVL 1VB9A 4IRZL 5GGVY 3PNWB 1NQBA 3DO3A 4KKLC 1DQTA 5ITFB 4J8RA 1P2CB 2NW3B 4UT6H 2AXJA 3SBWA 5IBTL 3DURB 5IHZB 1T04B 3WN5B 2X44D 3CX2A 4WF7A 4NQDA 2EYTA 4OJFL 4WNQA 1BFSA 3U0WH 4BZYA 4R0LB 4NRXB 1GIGH 3QUYA 3GXTA 4RFNB 4KVNL 2NY5H 1E0OB 3FHAA 4HIHA 2R0ZH 3U82B 5GGQL 4ETQA 4HKBA 3SEPA 5GS3A 1TQCC 4PJAE 1AR1C 5F7FA 2FJHB 3U0TA 3EO1B 4D2NA 4EOWL 3HI5H 2BY0A 2WIIA 4JFFD 1XGYH 4DKEL 4CJ1A 4NJ9H 4CD7A 3F7YB 2X8RA 4FXLA 3WNPA 2CPCA 4UNVA 4S1DC 3GZKA 2NX5B 3WF3A 1YYMH 3FQTA 3VGHA 1OL0A 4K7FB 4RSVA 5IB5B 3DC0A 4WU7B 4YFDB 4PMRA 4U0QB 3AZTA 2EXWC 1E4XL 2OW7A 4GOSA 2GYSA 3RZCB 3L4UA 1V02E 4Y4HD 3HNVL 1YHTA 1D6VL 1ODAA 1TPXB 3PZMA 4KZEH 1QLEH 3QHTC 4KTDL 1GUVA 3WD0A 1F58H 2VWEC 1K6QH 1A1OB 3G6DL 4PJ9A 4E5XB 1HK6A 5E1QA 1QSFB 4JJ5A 5IVOA 3L7EA 1EHXA 1OGAB 5FF6A 4R96A 4Z76A 4NXKA 4R7NB 3QIBC 5JPNB 5F9WB 4BQ2A 1MREL 3RDTA 5FYJU 3T0ED 4Z2KA 2XN9A 3E8UL 1RZGA 3LN5A 5EU5B 1LHZA 2H45A 4ZD3L 3IGUA 4W88A 5DJAA 3MJ7B 3MCKB 3PHOA 4U0RC 2WVVB 1FYTE 5INDA 1TETH 2YN5A 3VIPA 1YECH 4JL2A 5FIPA 2IQAB 3EYSL 2DQGH 3VIOA 1WWWX 1G7PB 2HFTA 4DO4A 1CL7H 4GKNB 5LA2A 3N0PB 3TNMB 1BZ9B 1CGUA 1FAKT 2MANA 1V0NA 3SJVE 2V5RA 2CRIA 3EYQC 4MWFA 2DYPA 2DH3A 1K8DA 1OSZA 2VERN 3ZJKA 5LGJA 3U6RB 2HVKB 4OUUA 1ORQA 4KAQH 5GS1B 1GHFH 1NLBL 4S1QH 4ORGB 1WPCA 1H49A 1CT8A 5HYJA 4KKNA 5FCSH 1BQHG 3S5LA 4YGAB 1ZHNB 3QUZB 1ND0B 5EU3A 4DUVA 3ZDXF 4CCCA 2WZIA 3SDYH 1OAQL 2NY3C 1R46A 1GGCL 5F7EL 1TCMA 1VGKB 1P84J 2VH5H 3WMCA 4NKDB 1NCNA 4AZGA 3T04D 1U42A 1HQRA 4JGMA 5A69A 1B88A 3LXCA 1WEJH 3GMOA 1ES0A 1TIUA 2DLIA 2X4RB 2ZUVA 5D6CA 1LWHA 3DECA 5DA0B 32C2B 4HFUL 2J79A 4P2RA 1PBYA 4NNYA 2DTML 1GCYA 1IGIH 2F5BL 1FL3B 3WO4B 1FFPB 1UXWB 2J8GA 4OLUL 1GGBL 1HQ4B 3WIHA 4N0UB 1SMAA 4JHAL 4FQXC 1K4DA 4RX4A 5JW3L 3LXAA 1G7QA 3T65A 3AIVA 1MRFL 1TENA 2HJFB 4NUGH 1U8OA 1X5FA 4P9HL 4YN5A 3PGDA 3MXVH 2IPTL 4K3JH 3RTQB 3X12B 8FABB 2DBLH 3FKUS 4DO5A 5FDWA 1LO2L 2HH0L 5DEZA 1FHLA 2AK1H 3IVKB 3X11B 5L8LB 1GZPB 5DC9B 3NUKA 2Q76B 3FO9B 1BVNP 1UQSB 4Z7NF 2ZCLL 5KSAA 2IPUG 2O5YH 3SE4A 3KR3H 4ERSL 2DQFB 4OZIE 1FBIL 4JG0L 3FW6A 1CLVA 5D9PA 1ZA3A 5DA4A 1J8HD 4UT9H 3GFUA 1HHKB 3S4SB 1PKQE 5DT7A 4X7EC 5CP3A 1U92A 3WMSA 3IJ9A 2QBWA 1HT6A 1JNJA 3SKMB 3MUGA 1RHHB 3HCVA 2F53A 4NOBA 5F9AC 5B3NA 2EPNA 5DQJB 1EGJA 3OKLB 3HPLB 3BUPA 1WCQA 4YDJB 4RGNB 5GGRY 4I4WB 1JWUB 4XH2A 3DX3A 3DO7B 1FC1A 4XP1H 1YJDH 1J11A 5B3JF 1JPTL 5E8DH 5IQ9A 2ED9A 4FQHB 3W38A 5DDHA 5CBAA 5J7CC 5DK0B 3RJDA 4I48B 5A2FA 3KPQB 4P9HC 3C5ZD 4G3YH 4Y88A 3QT2A 3R8BB 5C0EA 2DOCA 1FN4B 4DUXA 1MHHA 4Y2OA 4R2GB 5DHVA 1H0DB 1QX1A 3W37A 4XNUH 3GKWL 1F11A 3A67L 4N1EA 2EXWD 1LE9B 1FG2B 1BJ8A 3O41B 3MRGB 4YK4B 1LD9A 4D6HA 2VLRD 4M1DL 4ZXBC 5F7DB 4W6WB 3TWCL 3WL0A 1J0HA 2FJGB 1AIFB 2HT3C 3KHOA 5FYKU 3IDXH 3VVGA 4YPGA 4NFBA 3BI9X 3RKDD 3SKJL 5D72L 4JFDE 2XJ7A 4TULL 1G6RA 1EOKA 2YKKA 4L8CB 4CU6A 5SX5K 1T20A 5C2BH 4GO9A 3Q2CA 5JBFA 2C9AA 5ESAB 2AXGB 2CDEA 5HDLA 1U8KB 1N8ZA 2WUBH 5INCB 3FCTB 4NQVA 1UM6H 2ZOLB 5I1HL 1JRHH 2OJEB 5IKCA 2R23B 4ZFGL 3PXHA 4ELKA 2VXSL 3LRSA 4QCIB 2Y7QB 3RO8A 1CGTA 5BXSA 3WUGA 1CGVA 3CUGA 4PBVC 4WHTB 1XF3A 1CU4H 5T1MB 3DDFA 5GNYA 5I9QC 1BZ7B 5J6GB 1BBDL 1LJYA 1IAIH 4S1RL 4J3SA 5CZVL 2WIMA 3OJVC 4Z78A 3U7VA 5D1ZA 5IB2A 3RX8A 5E8OA 1YN7B 3U0PA 1S7WA 2X4UB 3QJFB 1HHIA 4LSVH 4IRZH 4K3GA 5EO9B 5GGRB 1R3LB 3QFJE 4LNRB 5J9PA 1HJWA 5DEFA 3G9AB 1TVBA 2C26A 5JW4R 5JIHA 2ITCB 5IBTH 2J75A 2Z91B 3N85L 4TXEA 2GHWB 3T0VA 4X99B 2X4NA 1VADA 3SDCD 2GFBA 2V6HA 4AZIA 4MA8L 4OJFH 3PL6D 1HSBA 2Q8AL 4G80A 5D2NA 5FYJH 4ZOEA 1KB5B 4HA4A 1A2YA 4P23A 3IJYB 4KVNH 2F74B 4IRSD 5GGQH 4QTHB 3MV9E 3SDDA 1GQLA 3UESA 4LLQA 1FSKC 4I77L 4EOWH 3SCRA 4ORZC 4DKEH 3WD4A 3MRBB 3K2MC 2VO5A 3VSTA 4GRLA 5KS9B 1H8OA 4MADA 3RY6C 1OT2A 3GHEL 4P3CH 4BK5A 2NY4B 2W0PA 2RBLA 1GH7A 1QFPA 5L0QC 3O9WC 4PTUB 1UC6A 5ANME 1A9BA 3RPKA 1E4XH 5I1GL 2J5LB 2P5EB 5TE6L 3WY1A 4PJGB 1KLUB 3WO3B 1EAPB 3HNVH 4HWZB 1D6VH 3PBGA 3O8XB 1T89A 4LRNL 1U2YA 5A16B 1XR9A 2Z8WC 2VDML 1T04A 3WUWA 3RY5A 1IM9D 1I85A 3G6DH 4JRYE 5FYJE 2IBGA 3DWTA 3K2UL 3GB7B 3S35X 2PCPA 5JW4N 2JCCA 1XD0A 5J12B 5CP7A 1BIIB 4MSWB 2W60B 1H3WM 4B9YA 4DKFL 4UMGA 3E8UH 1V7ML 3I3DA 4NJAL 4TQEL 4ZD3H 2VQUA 4D0DB 1FO0A 3TA3B 1ZHBB 3O6AA 1AKJD 1NAMA 2FJHA 4ZO8A 4C7GA 3SKNB 4MJ5A 1FCCA 3DXAD 2YPVH 3EYSH 4F33B 4Y5VC 1LL7A 3SKOA 4Y4FD 1U8MB 1FNEA 5MEQA 4LPCA 1GL4B 4O51A 3U7YL 5JZ7D 4NGHL 1MI5D 1YY9D 1CGYA 1E70M 5EU6B 3ZO9A 1O7DC 3G6JE 1AGDB 4AYSA 3JVGA 3OLDA 4JJHA 4JY5H 1B6UA 2XKSA 1JHTA 4LVNC 5IB3A 3SO3C 3LS4L 1NLBH 1IVLA 4JFYB 3MRHA 2RFXB 1RJZB 5ENWA 3VSUA 5IB1B 3DOSA 1TJGL 1U8QB 2YK1L 4PRPE 5KSUA 4G9DA 4B3LA 3AB0B 1HNFA 2F54E 5I1KL 5T1LA 3WFLA 1KV3A 1OAQH 4LLAA 4LVHC 1R3IL 2EYSA 2A9NL 2GJXA 1GGCH 1T21A 5F7EH 1QRNB 4R7NA 4PJEE 3FT3B 5JPNA 1JP5A 5EB9A 3SDAD 3JTTA 3QDMB 4PGZA 3T0BA 5IMMA 2G5BA 1KIPB 1IMHC 2WVVA 3GSXB 3ARGA 1CDYA 4JGJA 1M7DB 2XTLA 4HFUH 3QJHA 2B20A 1BYDA 2DTMH 3H55A 1E6XM 4DM1A 5HDQL 3RP1A 2F5BH 5EBAA 2VXQL 4IOIB 1BZ9A 4M7LT 1C12A 4OLUH 1GGBH 1MIMH 4JHAH 1E4MM 1FP9A 1HTYA 3QISA 2LAAA 5JW3H 4WRLA 3U6RA 2HVKA 6A3HA 3BO8B 4PPTA 1MRFH 1INDL 1OAXL 4JLRA 4U3AA 4ONHA 4RMQA 2EQDA 1DQQB 5HY9A 3PZUA 2IPTH 3DRTB 1WNOA 1CDUA 5JHDD 3JWOL 1QI0A 3TO4B 5LWYL 1LO2H 1B0IA 3QUZA 2HH0H 1MQ8A 4DK6A 3OKMB 3OB8A 2VNCA 4FG6D 2ICEB 2ZCLH 4QLJA 5D9OA 4MAUL 5DEGA 5AWNL 2EXOA 3BE1L 3CMJA 3MGOB 4ERSH 1FBIH 4JG0H 4PRIB 1JI1A 3W2DL 3O3BB 4HJJL 2QL1A 1MW1A 1CLXA 2BOCB 4XB7A 1H5BB 4ZAKD 4JVWA 4HWUA 2W63A 4U1KB 2Z8VC 4LLVB 4XWOD 5F72S 1BSIA 4CL7A 2X4RA 4ZFMA 1MHCB 5BXFB 1Q0YL 2QSTA 4FFVC 5CZKA 1YQ2A 2NY7L 3O81A 3POHA 3BPNC 3KL3A 3C60B 3RVWD 2NZ9D 1EUUA 4BCEA 1JWSA 2EIBA 1UXWA 1RFDH 4FQQB 4Z2LA 1IEBA 3OAZH 3MBEC 5FOBA 1RPKA 4TNVF 1TJHL 3KEHA 2IANB 2XN0A 2V2TB 1JPTH 2JE8A 1INEL 3GMQA 5BJTB 3WY2A 3VIMA 4HWBA 4AK1A 2Z9TA 1OGTB 1VFFA 5F97E 1UWTA 5GGSB 4W70A 4KKCD 2D2OA 4L29A 5A6LA 1R3HA 4KK8C 4OOZA 1MPAL 3B9KD 1F2QA 3KXFB 2DS4A 3JWOC 3MRDA 4JDZA 1SHMA 3ELAT 3WUZA 3IVKA 5CJ8A 3O3UN 2Q76A 3FO9A 3KPRA 1P69B 2X4OA 4UQCA 3PABB 4OZFH 3GKWH 3A67H 3GSRA 2QADC 3MBXH 4EN3D 4WFFD 1J5OL 3V5KA 1AFVL 1G0YR 3PV6B 5AYQA 4WV1C 5FYKE 1RU9H 4M1DH 3ULVE 4RE4A 4Y7MA 4U31A 2VDNL 4M1CD 4YDVB 3TWCH 1HHKA 3PJSA 3S4SA 4GG6B 4OF5A 4PJGF 3A6OA 5TF0A 2JEQA 4GQ9L 5JORB 1I7ZB 4U6YA 2GJJA 5CSZA 4C56D 5HYQB 5CWSB 4L4TB 2LE9A 3JV6B 2H41A 3SKJH 3R1GL 5D72H 1B0RA 4Y5YA 1T1ZB 3VA2C 1NAKL 4TULH 4IIQA 4Y1AB 1GPOL 2YWZA 5CSUA 1XGUB 3JV4B 1UWQA 4XPAL 3TV3L 4BH7A 2P5WD 4I4WA 4UIKL 2C3HA 1QFHA 4MD4A 5GNXA 4IDJL 3WQ4A 2EDDA 2L4OA 5CZXC 2NR6C 5I1HH 2ZOXA 12E8L 5FGBC 4ZFGH 2VXSH 3TNNB 1T1WA 5DFVD 4L4OA 4XXCC 2EACA 2X9WA 4OCXL 2XTJB 3VX1A 3KPQA 1QTYT 2HJKB 3PZGA 3RHWK 3KYOA 5FCUL 1G01A 1W1PA 3VDBA 5D70L 1ZL1A 4Z7OE 4MD5A 4LPUA 1R3KA 3W25A 2UVFA 3N1MC 1BBDH 4HG4J 1Y0LB 2N7AA 3EDJA 4S1RH 5CZVH 1BYCA 2EDRA 3VFPA 2X4SB 3O4LD 5B8CC 4L9LC 5IMKA 4GW4A 3STLB 4KPHL 4UNIA 4JZ5A 3QAZC 3GJFK 3MYJB 4JO4L 2GJPA 4NQDE 3MV7D 1BAGA 1AIFA 3LQZA 3N9KA 3N85H 5I66B 4KJYA 4EQ3A 3WS3A 1JYWA 4PJ8A 3FN0L 3N04A 3OKNB 1A6AA 1T1XB 5ESAA 1YEGL 5DYOA 2AXGA 1JXKA 3I85A 1JDCA 1TZIA 4WWKB 3WS6C 2W0FB 4X98B 3IFNL 5INCA 2R4SL 5JDSA 2NY1B 4L1HA 1UH2A 4JKMA 3UTSB 1I75A 3IDUA 2R23A 1P6AB 4WEBL 3TVMD 4I77H 1H3UA 2MTPA 2PW2A 4KI5C 2Y7QA 1J9CT 4C58B 5C1MB 4P5TA 1WWCA 4BYHA 4KH2A 5CJXA 2B5IB 1LK2A 3KVQA 1CG9B 2GJ6B 1CQKA 2CGRL 2JB5L 3OZOA 4LCYA 1FP5A 2C1PA 5DJ6A 5I75C 4FMKA 3HUJB 3ARWA 5I8KL 5CMAB 2ZSVB 3GHEH 5M95B 3QIUC 3LKPA 3DPBA 3GXMA 2YD3A 3ZSSA 3DTXA 2QQKL 3HE7C 4OD1L 1KC5L 5I1GH 1AQMA 5TDNB 5TE6H 3QIWA 3VE0A 1T66C 3NZ8A 3LOWA 3L4TA 3RVVC 1OY3B 2EECA 4LP5A 1E43A 5BRZB 1YEHH 1UXSB 3BVNB 4WCYL 4F9PA 2ZCKL 3DVGA 5EO9A 4LRNH 3MS8A 1MWAA 4LNRA 2VDMH 4FQ2L 2AERT 3SE9L 2ITCA 2EDQA 2XN9E 1WV7T 3K2UH 1K3ZA 5ABDE 3G5ZA 1MNUL 3U4EB 2DN7A 3T08A 4JG1L 4XVUD 5GZND 4XB8A 5BOZG 1FFNA 1C90A 1KB5A 4PD4J 4MB5A 5GRJL 2BVPA 4OFVA 4DKFH 1C93A 1V7MH 3IJYA 4OFYA 4P2OB 4NJAH 4TQEH 2EE3A 1HXYA 3HZKA 4UU9A 4JFQB 1C91A 3U9UB 4N90E 1H4PA 3VD4A 2B0SL 1CFNA 3D0LB 1FCGA 3BZEB 3MRBA 1EEZA 4PLJC 3U7YH 4QY8A 4JFXB 4KXZI 4LSTL 5DC4B 5KS9A 4NGHH 4I2XA 3QQ4A 5HYJE 4BH8B 5IF0A 5C09D 3VRIA 1Q94A 1DCLA 4DZBB 5EBWA 4PTUA 5A6BD 3LS4H 2WBJD 1EAPA 4MZ2A 4TPRH 2FZ3B 4N0FB 1TJGH 1A3QA 4H88L 3B4NA 1A6PA 4JFFB 3RIFF 1DN2A 4ZFZA 3N06B 5I1KH 3PZOA 4PG2C 4XCNA 4ZUUB 3GXFA 5JIPA 3GB7A 4J4PA 1R3IH 2A9NH 4V28A 4UQ9A 1WSST 1S9WB 2G75B 3GIZL 3H7LA 4AEHL 4MSWA 2W60A 4Q74A 4P2RE 1NL0L 4NZTH 2C7UB 3CZNA 1T83A 1C5DB 1YEEL 5I8CA 3H6JA 1PQZA 5BRQA 5MP6L 1CFSA 2CUHA 4YIQB 1MCLA 3MKKA 4ODXA 3UPCA 4CMHC 4EBQL 2A6DB 4GG6F 4U1JB 4NCDA 1PBGA 2EIZB 3SCSA 4EI6A 3KYMB 4IMKA 1MAKA 5C07D 4GKSB 3RFZC 1U8MA 5HDQH 5HI4C 1QI2A 2GCYA 4OV5B 5IHRA 2VXQH 1PZ5A 3D2UD 2FEEI 1B3WA 1DWIM 1HNYA 1FDLL 4HJ0D 1XIWB 3KLKA 5FGSA 3U2SA 2D20A 3KPSD 2V3FA 3IJ8A 1QNQA 1NDMB 1GRWA 4PJCB 4HWBL 1JZ5A 4P3DB 2XZCL 3T0EB 2EEXA 4UFLA 1GORA 4JFZL 3MLWL 1MY5A 2LAGB 1OAXH 2OR8A 5C3TA 1B9ZA 4B41A 1WZLA 2RFXA 4FFYL 2JELH 3JWOH 1QI5A 1CD0A 3TV8A 5LWYH 3RWCB 3QUXD 4M48L 1JYNA 2AP2A 1BIHA 2GTZB 5HGBA 1MCBA 1XSIA 1CDJA 1NJ9B 2IF7A 4BM7A 1HOCA 1XCWA 2WMGA 5I78A 3V6OC 1I8LC 2DKSA 2WK2A 1JPST 2J8HA 4Z7UB 2QHRL 4MAUH 5AWNH 1BBJB 2W4XA 1JUFA 3BE1H 4NI3A 1QRNA 3FT3A 1GQIA 4QRRA 5EPMA 4HJJH 5ERWB 2APFA 2NY2C 3NFNB 2F53E 3QDMA 2DIEA 2ADJB 5BVJB 2EC9U 4YHNB 3HNSL 3U7WL 4M43L 1I9IH 2ICWA 2QHLA 4M5YL 1Q0YH 1M7DA 4JZNA 5DT1L 3CFKB 2VVNA 4NZUL 3GEWB 3SUSA 1YC8A 2EDXA 2KQNA 2NY7H 4HV8B 5B21A 2XOTA 2Z1KA 5ID1A 1T0PB 2XUCA 2N56A 2OSLA 3NIFE 1R85A 1FC2D 5F3HB 1OSPL 4IOIA 4MNGB 5EIIB 3VMNA 4P7QA 4QYOB 2PYFB 1HHHB 5DVLA 3EFDH 4OAWB 1US2A 1TJHH 5M3WA 4X0KB 5GZOC 1INEH 4LEXL 4XP5L 2VXUL 3BO8A 1D5BB 4D9QE 3VSVA 1UKQA 5HI5D 3ULUC 5J1SC 2X40A 2IC2A 3TO4A 1E6NA 3DGGA 3I6LD 2P7TB 3GBMH 4CKQA 3DBXA 5D96C 1AHWC 3OKMA 1CICA 1DZBA 5ISZD 3ZKNC 2ICEA 3BH8B 3V95A 2BNRD 3HUJF 5MEOA 4UV4L 2XZQH 4NC2B 3MGOA 1J5OH 1AFVH 1NMAL 2BVEA 3HNTL 3O3BA 3VXOA 3H9YA 1IILE 2VDNH 4LBEB 3AJ7A 3SCVA 1WDPA 3EYOB 4LLVA 2RR3A 2XG4A 4HGWA 1DUYA 4K07A 4GQ9H 5AY7A 5DZOA 2H6PB 1MHCA 1VDGA 2UUDK 5JW5B 1VEOA 4MLIA 3R1GH 4WW2B 4MD0B 1NAKH 3IDMB 4OCRL 5ALCL 5DMGC 1ZT7A 1GPOH 3N1FC 1Q9WA 3Q3GA 4FXGB 1RK1B 4XPAH 3TV3H 2XM1A 4FQQA 1UM4L 3LV3A 4UIKH 1MFEH 3L2LA 2P8LB 3EJZD 4HK3J 5AZ2L 4IDJH 2GY7B 2Q20A 2FECL 5J1AA 2AKRB 5B39B 4LLYB 5E6IC 1J8HB 1JZ7A 2V2TA 1JGEB 5BJTA 3SHSA 2C3VB 12E8H 5BXPA 2H32A 2XSBA 2JIXA 3N1AA 4PG9B 2OTPA 1A64A 4OCXH 5GGSA 3EFFB 3GMPA 5MI0B 5FCUH 1Y7VA 3CXHK 1D6EA 3KXFA 5D70H 5HHPB 1PG7L 4QRPD 4JO3L 5HDBF 3MNWB 1ZTXH 5IUSA 1X4YA 2AQ2A 2HJLB 3BJLA 4P4KD 1OP5K 5F1SA 1AE6H 4BZ2L 1GC1L 5IR1B 2XWEA 4KPHH 1PFCA 4NRYB 4QRUB 4JO4H 4QNPF 4UINL 2XFXA 4MS8D 1QNPA 1QKZL 4V2BA 5JORA 4X7TA 3PWJB 5D2NE 1U95B 4L4TA 3C5ZB 1XT5A 3MFFB 2YD2A 4MX7A 1FL6B 3RGVC 2DMCA 1UJ3A 3BHBA 3HZVB 1CN4A 4Z95H 3FN0H 3JV4A 4E9LA 1NBZA 1YEGH 4KI5E 2FB4L 1C92A 3BW9A 4FZEL 2ENSA 3IFNH 2R4SH 4OIBA 2FX8L 2VLRB 4JFED 1FYHB 4W5UA 1HYSC 4UOW0 4BJLA 2YEZB 4WEBH 3ARBC 4LIQL 4UZGA 2VZUA 3MJ8B 3TNNA 1HCVA 3I84A 1BYBA 3MNVA 5KSBB 2ADGB 3O6LH 5LAXB 2E9IA 4LX4A 2HJKA 1F5WA 4ZODA 2ZWYA 3GXDA 1H5VA 3N12A 2CGRH 2JB5H 1E6SM 2BP3A 3AS3A 5I8KH 1Y0LA 3WJJA 5CD5C 4P49A 4MB1A 4NSBA 1P53A 2Y5TA 2CMRL 2QQKH 1OGSA 1P4IL 4P8VA 4PMYA 4X0VA 4OD1H 1KC5H 4LDOB 4QTIL 4X6CA 4EQ2A 3STLA 1BFNA 4R7DA 3MRJA 1CD8A 5D1QC 5CIPB 5E8PB 5DJCB 3OL2A 3VUPA 1MFAL 2X1IA 1P7KA 3MYJA 4PYSA 1DVFA 4WCYH 4Z5RA 2ZCKH 3P9MA 2JCCE 2BMKB 4GBXC 1UH4A 3QUKA 4FQ2H 3SE9H 1A7RL 5E0FA 3UJJH 2P8MB 1HKIA 4UZUA 4ZQKA 3I02A 3FQXA 3G5XB 1I9JL 1MNUH 3DJ9A 3GGWA 4ENED 1N6UA 5JOEA 3MROA 1KTBA 4KRUA 3SOBL 4Z7UF 3AC0A 5GRJH 1FYTD 3CH9A 4WWKA 2W0FA 4IMLB 4X98A 3QXUA 1X4XA 2H3NA 5DMIL 3CDYA 1DP0A 1UENA 3WUWG 1ZKAA 4E8CA 1KUMA 2HFFB 4X8JA 3D3VB 3VRLF 5CJOL 4PGDA 2UY5A 2B0SH 3SJVD 5I6XC 2C3XA 4N1HB 4K8RD 4AIZA 2E9LA 4U33A 1I1AA 3ARFC 3OG6B 4LSTH 5HI3C 3SDCB 2IFGA 2BJML 2WP3O 3PL6B 4PREB 4N9GB 4QXTB 3S3PA 1UWSA 5IJVB 2ZSVA 2GSGA 5SWSA 2O61B 4KRLB 3FQRB 1A5FH 4APQD 5KG9B 5MEPB 3U48A 1HSAB 4BQ5A 2WWMC 4IRSB 5TDNA 1RP9A 3NCCB 1V3IA 4ZSOA 5BRZA 2PWEA 1E4IA 5IESL 4H88H 5CEZD 1UFUA 4P46A 4U1LB 5F1OB 4DZ8A 2BX5A 3WBAA 1Q6GA 5IK3A 3RUGA 2NYYC 5FM8A 3UTTA 1KBKA 3GTNA 4ZUTB 4X6EB 5FUOL 5J1TC 5T3ZL 1UR1A 3ARDD 1AC6A 3RWGB 4XP6L 4WO4A 3GIZH 4EI5C 4AEHH 5A6JA 2I26N 3TBVB 2H2PC 5C0NC 1NL0H 1X44A 4I0PA 2A6JB 4YHIB 3TTOA 1EX0A 4RZCB 3D5OF 5GHWH 3OZ9L 5MP6H 4N0YH 3CMGA 4IS6B 4NN5B 1G5AA 5C0GB 3KGRA 4B50A 2KPNA 3HZMA 4EBQH 2FX7L 3T4AA 4EEEA 1EAJA 3BZEA 3DUUB 3GSNA 1VBRA 4AMWA 4YXLL 2BZDA 4JFXA 3WY4A 1GJIA 2D23A 4KRMB 2X70B 3VRJA 2PO6D 5E95B 3TZVC 3VXTA 3E0GA 4HWBH 4DZBA 2E5EA 5GGTL 2XZCH 4CU8A 3CZKA 3BAYA 2YBUA 3IU3B 4E4PA 4JFZH 3MLWH 1FRGH 2AXHA 3HI6L 4XRCA 1LQ0A 1IAII 1XYFA 4YHYC 5A6KA 3RQ3A 4XHQA 1DEEA 1W72L 1AKJB 4FFYH 5TE4L 1ACYL 4HC1L 2L7UA 1WDQA 3DXAB 4PJDE 3NTCL 3DMMD 2YJQA 3OHXB 4M48H 2HMIC 4Y4FB 1KJMB 1J1XL 3STBA 1JF1A 3CVHB 1ZANH 1GVIA 1MI5B 3TC9A 5EBMB 1U3ZA 2PNDA 2QHRH 5EOQH 3V5HA 4PJXF 2BVDA 5E94B 4OM1L 3D25A 1B4RA 1C1EL 2DL9A 3CDGB 3UBXI 4NQUA 3HNSH 4LCCB 4XC3L 4M43H 3U7WH 2DSUA 3OZPA 4MLSA 4M5YH 4U1JA 5IBLC 5DT1H 4O2CB 4NZUH 4ATWA 1RZ7L 2DQHL 1E71M 1R24B 5ICZB 2W67A 2XWDA 4OV5A 2VLLB 1FQ9C 4LSPH 2KZWA 1M53A 1OSPH 2PF0A 1T0NA 1XIWA 3C2AL 3QDJA 4KROC 3S96A 4YEEA 3T8XB 1JCKA 1ZOXA 4YZFF 3MRIB 3MR9B 1ITBB 4LEXH 4XP5H 2VXUH 3HJEA 1Z9SA 4PGBA 1YEIL 1K8IB 3V4UL 3WNNA 3OSKA 1IAOB 3KPRE 2OSYA 1S7VB 4PJFF 1KT2B 3C09B 1E4XI 2IPKA 1U6AL 2BY2A 5BV7B 1OIFA 4OI9A 1A22B 4TUJA 2GTZA 2NW2B 2VURA 5F6IC 1JYXA 1EIBA 1NJ9A 1IL1B 2SEBB 4S3KA 4MHHI 1R7OA 1T6WA 4OGYL 4UV4H 1BF8A 1ZT1B 4WFGE 3V7AE 4FRWA 3HNTH 3WH6A 2X4QB 5E00B 3QB7C 2VITA 3NFNA 2GKIA 4JFDD 1A4JB 4GBXD 3CCHB 4NFCA 2AEPL 4Q9BA 3SGDH 4Y2DB 3ZZ1A 3D18B 1DWFM 5IT2L 3LSOB 3PWVA 5JHDB 2VYRE 5LG1A 1B31A 3GNOA 5KN5A 4OCRH 5ALCH 3VFGL 4TNVK 2YBRB 4F9JA 2NTFB 1TTFA 2YC1A 1QRKA 1XCXA 5GRVK 3MLXL 1C8XA 4PBGA 3GBDA 1JXJA 4QGYA 2ADIA 4OGAD 1ONQB 5F7YC 3S4SG 1UM4H 3WHE1 2CIIA 1HHHA 3H0TA 2ICCA 5AZ2H 4TX8A 3A4WA 3EJYD 3UTOA 3V7AG 2PW1B 4M7ZB 1TZGL 4ZAKB 2Y07L 4KK6D 1D5BA 1FL5B 2E0PA 3OXRB 2DLEA 3B3IB 1JNEA 5IBUB 3RL1A 4UFHA 1KCUL 4JO2L 1PG7W 1L7TL 3K80A 4OQTL 5DJ0B 3AIUA 2R0WL 2IMNA 3U57A 1PG7H 1YMMA 3V5DB 3O4OB 4JO3H 1RJLB 3H54A 1X5JA 3KS0J 2C0HA 1AGFB 1KGCE 2OR9L 2IXVA 1KEML 3ORJA 2XACC 4BZ2H 2BDNL 1KXTB 1GC1H 2YS4A 4Y5XC 3QFJD 3CFJB 5SWQB 3C6LD 3O6FA 4NQTA 4XT1C 2G3NA 4UINH 2WXDM 2RJMA 3F5WB 3KLHC 1QKZH 4F7EB 1KXQA 1ADQL 3PZQA 5JW5A 3HE6A 5I23A 3FFCB 3B9KB 4WW2A 4Z7WF 2N4IA 3OAYK 1QSEA 4F15B 2YL8A 1R5IA 3I6GA 2MQ3A 2BNQD 4WW1A 3VIHA 1RK1A 1WFTA 5DJZB 4RRPA 2H2PD 4Y0GA 3RWDB 2FB4H 4NSKB 4WTXA 1LEIB 1MJUL 4EN3B 1HWWA 2BNJA 2GUYA 2HWZH 1JWMA 2FX8H 3WIFB 2J78A 5B39A 4KTYA 1WAAA 4WIQA 2D0FA 1F97A 4GO6B 1YPZE 4LIQH 1MCWM 2CR3A 4PG9A 4C56B 1F3JB 3HMXL 4F37F 4FNRA 5FIEA 3ROLA 1DDHB 1S7RB 1ITCA 2FGWL 3D4ZA 4XI5D 1KXVA 1YMHA 2VABA 3ARXA 1JGDB 4TRPL 4P59L 2CMRH 3BLKA 1P4IH 2Y8KA 5BXRA 4QTIH 5IR1A 5HPCA 3KPPB 4J2XA 5CD3B 2Q7NA 2LABA 3HG1B 3PZIA 5FYJD 2BVOB 3GJEA 2LFGA 4U3XA 2IALA 2QPSA 3L3KB 4UQAA 4F58H 3PWJA 3BIBX 5C8BB 1A7RH 3MFFA 3WENA 5D71L 3U46A 1I9JH 1FH7A 2GSIA 3HZVA 4XNQB 3IJHA 4Q6IC 1JPGB 1HKKA 1BG4A 4NF7A 1IGYB 3SOBH 1U58A 5L88H 3O4LB 2ERJB 3IF1A 4GUPB 4UZSA 2D03H 1V6UA 1MFDL 5DMIH 5C0FB 3FO1B 4U3HA 3MV7B 5DJXB 2NCMA 4FTVA 1A1MB 4I2XE 5CJOH 1BX2A 3MJ8A 1TTUA 4FNPA 1WTGT 2CH8A 3CH8A 5LAXA 1WBYB 4F9DA 1AGCA 5GGUB 1TG7A 1QEWA 5F1KC 1W1VA 2BJMH 3MLSL 4M62H 4Z77A 5H94A 1RIVL 3WBEA 2BC4B 2X89D 4PTMA 2XYLA 1W2PA 4BQ6A 3EJRA 3FAWA 1QVBA 5SX5H 4PRPD 1CLZL 1NGYA 4X80L 1UG9A 5E8PA 1HYRC 5CIPA 1E6QM 5LGHL 4AENB 2RAMA 2GQHA 3TVMB 4YAQB 2F54D 4QCEA 1P4BL 4U1IB 3CZJA 5SWZE 5IESH 1DBJH 2BMKA 4A6YL 2GK0A 4XX6A 3BUBA 3LCYA 1ORSA 1OAZL 4M5ZL 3MRNA 3F4VA 2V5DA 3ZDZE 2ZOKB 4F80A 5T3ZH 2EADA 5I24A 3B5HA 3CFBB 4BK4A 1Q6DA 4XP9L 2FIKB 4XP6H 2OM5A 4HCRA 3TYGL 4YQXH 4JFVA 4QFUA 3S5YA 1NFDA 1LNUA 2K7PA 2WCSA 3OZ9H 4BF7A 2CBUA 3HI1B 2XIDA 3L9RA 1T1YB 4EZMA 4FNSA 1VFMA 4M8QB 5E2TL 2BOBA 2FX7H 2HFFA 3D3VA 4DO6A 5C0AA 4QWWC 1UZ8B 5TDPA 2W59A 3C08L 2WANA 3B2UC 5F9JA 2OK0L 4YXLH 5HTSA 2CXGA 1CWVA 5IW1A 4PREA 4DCQA 4H8WL 5IJVA 3WNKA 1FNAA 2V2XB 3G5YB 2CKBA 4NKIH 3B6SA 2O61A 1QHZA 4POZC 5GGTH 4XHJD 3FQRA 5KG9A 1NMBL 3SQOL 3BVUA 2AI0L 1TJIL 1QR4A 1W3JA 1CLCA 1XH2A 3UYRL 3HI6H 4JFTA 1QBMH 3RIFK 4UFJA 5DRZA 4MAYD 2VDRL 3Q5TA 3WIJA 3BVTA 1E0VA 1W72H 5TE4H 5GS0D 3S5ZA 1ACYH 4HC1H 2NY6C 3GH7A 4U1LA 3NTCH 1N2RB 1WT5C 4GO8A 2V9QA 4QRRE 5FYLL 3WFHA 2XXCB 1S3KL 5T1DL 1J1XH 4P4RB 1MOEA 1ZT4B 3OXSA 4Z8FL 1NBQA 3QULB 4R27A 4AZCB 1KJ2A 2F1AA 1YUHA 2WVSA 4GKZA 5C09B 1J0KA 2VLKE 1D5MB 4G8IA 3W81A 5AD0B 4E0RA 4OM1H 4GRWB 3AHTA 3BUDA 4RZCA 3AFBA 2XYCA 3OF6D 1C1EH 4K55A 5I2IB 5DTFB 2HVJB 4IS6A 3ISWA 2FGZA 2WBJB 2CUIA 4XC3H 2PETA 3AGVA 1A9EB 1OAUL 3KAAA 1RZ7H 1SYVB 4Z7VB 4PRHA 2DQHH 2XWJB 5JOFA 3DUUA 2W65B 2AK4A 3AAZB 4NO3B 2A38A 3V4PL 2VVSA 2BVTA 2GEEA 1I4FA 5ID0A 1S9VB 3O2DL 5HHOA 5F1IB 4QLRA 3LKSA 1BJ1H 3EUUA 2QMJA 3BZ4B 1EFXA 3VXMA 3F7QA 5J89A 5LVEA 2J8UB 4N8VB 3W9DB 4GW5B 2VMFA 4PLKD 4U1MA 4WENB 1YEIH 3LS5L 1Z5LB 3OGCB 1F13A 3QQ3B 4OD2B 3V4UH 1CLYL 2YPLA 1CEOA 4Q9QL 1P1ZA 5E8EA 3QA3B 3QPXL 3MMEA 5D8JL 3U30B 5DGQA 5ECJE 5EIVA 4ZUWA 5FYKD 2V7NA 3ULVD 4HOWA 3D2UB 1MW0A 3V52H 5FO8A 2EE2A 3KPSB 2Q7YA 3BQUC 2ATKA 5AG9A 1KPVB 2ID5A 3VA6A 3H3KA 4A2MA 3AREA 4RAUA 4YBLC 1CFQB 1P7HL 4OIIL 3L5WB 1ZK9A 1V6VA 1ZHKB 1MW2A 2AEPH 5D7JA 1KCLA 1HX0A 2X2YA 1T2QH 2APTA 1U2CA 3QUXB 5E4EB 4RDQF 3VFGH 1O6IA 4X4XA 4UUJB 1EV2E 3MLXH 4CMMA 5K9OA 1D3CA 3LEXA 5C0DB 1KQYA 1TA3A 4PR5A 3CIQA 2CSPA 4UIMA 3LD8B 3T8XA 2KZ1B 3MRFB 4Q9CA 5IFTA 1TZGH 4LKCB 4YHPB 2Y07H 4NPYB 4W8AA 2GVYA 5L8KB 5KSAC 3FFDA 4ZS6C 1K8IA 3INUL 4ELME 4JO2H 4LQ1A 1L7TH 4UDTA 3QNZA 4DW2L 3EHBD 4OQTH 3QCUL 3WEXB 2R0WH 4QHMB 1SMDA 3MREA 5L2JA 3SCMA 3ZKMD 2W9DL 1FGNL 3WD5L 1N3NB 1NKRA 4OLZH 2OR9H 4B3KA 1KEMH 4B7LA 4NQDD 3WUFA 4ZOCA 2H1PH 2BDNH 5CSYA 1ZT1A 5EOTB 4PMNA 3BIKB 2X4QA 1V6XA 2AJUH 3SDXA 4A4AA 4Y4KA 3QUYD 5IWLA 1FHGA 1ZBVA 1AO7B 1FFOB 2R2HA 3VFUB 4CCDA 4Q2ZA 1A4JA 4AXNA 3VWKC 1KTCA 1GJUA 4Y2DA 3D18A 1I7TB 1BYAA 1ADQH 3IETA 4F7PB 1OB1B 3ZR6A 4BQ4A 3X17A 2RGSA 5F3BB 4ODUB 3G9VA 2NTFA 3DV4B 1D9KA 5HVWA 4F66A 1RJYA 1ONQA 2BNRB 4EUPA 2ICWJ 2YMXL 1MJUH 3ILQD 3ARUA 1Q9KB 2ITDB 4I18C 4AZ5A 1FA2A 1FL5A 3B3IA 1H15A 4H7VA 1KELL 3HMXH 3GI9L 4IUGA 4ZTOH 3LKRB 4X6CE 5DJ0A 1I1RA 1PDKA 2VIRB 4W85A 5A2LH 4NN7C 3V5DA 4CD4A 2FGWH 2Y9RT 4M61A 2Z4QB 5FB8B 2DDXA 4QOKA 4PJ9D 3S8WA 3SCTA 1QPXA 3DX8A 4TRPH 2PYEA 2W5FA 7A3HA 3CFJA 4KJQD 1C8QA 3BPLC 5C9JA 3RDTD 1VJZA 1LWRA 1CF8L 2XN9D 5DD1L 1IGCL 4ZFOA 4M6AA 4YHGA 1MCPL 4LRIC 1EVUA 4UTFA 1GOKA 1UB6A 3HAEB 4F7EA 5EUKA 3UTZA 2JJSA 5I74B 3O6ML 5A8PA 1G7IA 3FFCA 3P4OB 5D71H 4K7PY 4K7PX 3ET9F 4QRPB 4D6IA 1MFCL 1DFBL 2NPLX 4WHCA 3CVIH 4F8TA 1CZ8L 4UI2A 4P4KB 1OAKL 2NZIA 3RWDA 1HIML 3FAXA 1LEIA 3IJSB 2G41A 3NGBC 5DVOA 3X13B 1MFDH 2OI9C 3WIFA 1UKSA 2DYPD 5MHSE 5D1ZC 3C5SB 3OJDB 3TCXA 1RQ5A 15C8L 1ODZA 5GS2H 3AIRA 3WXVL 4XMPL 1Z2KA 2ZUYA 4S0TD 5SWSE 3V7MA 2W1NA 5HYJD 5LGKA 2EZ0D 1KR1A 2CCRA 1UGNA 1L0XA 5JXAL 1W9UA 2GJZB 5I1CL 5CBEB 3VX0A 3P4NA 1J87A 3MLSH 3CIVA 4K71C 1RIVH 1XR8B 2LV4A 4ZSOE 1QWUA 4PJAB 3A47A 1JGDA 3U36B 3IAQA 4PP1D 4R6UA 1FJ1B 3EOYG 1UR4A 1CLZH 3RUGE 4X80H 3UTTE 3PWNB 5LGHH 2FO4B 2P48B 4OZGF 3QQ9D 4YPJA 5I79A 3C8KA 3N1GC 1P4BH 3HG1A 2WAHA 3NIDF 2BVOA 5JIIA 1KLGB 4KGJA 3KPOB 1F90L 1JAEA 2YFOA 3BKCL 1H9VA 1OAZH 4M5ZH 1TQBB 4MXVE 1E0WA 1TUXA 3LX9A 1KJ2L 1LP9A 2DTSA 5F7KC 4P2RD 1IT9L 5AEAA 4YDKL 2EXYC 4XNQA 5I1DB 2XVKA 4PTWA 4GZIA 4TUOA 3TYGH 5IG7A 3T2PA 5BVPL 3H9SA 4GUPA 3J7HA 3NFSL 4LVEA 4RX4D 3MUIA 3VD5A 1A47A 2K9UA 2ZZUT 4LSSL 4F7MA 5E2TH 3LVEA 2XFYA 5BQ7B 5DJXA 4JAWA 3WXWL 1SVCP 2ESVA 3EGSA 3S36L 4AY0A 4ZENA 3GJFH 3C08H 1WKYA 4CJ0A 3VXNB 3QDGE 5E8NB 2OK0H 3DHUA 5GGUA 4U1HB 3NPZB 3OKKA 4WKAA 4GRMA 1OCWL 5D2LF 3ILPA 4H8WH 4WI4A 3L1OL 3WN5C 3TLRA 1FYTB 1NMBH 3SQOH 1HJUA 1IAKB 3SGJC 2LU7A 1TJIH 5IOPA 3VXRA 1XC6A 3UYRH 2CETA 5KSAD 4R0LC 3NN8A 5F70A 1OT1A 4AIXA 4YAQA 4RFNC 4JRXE 3O11B 1MVUA 4JM2A 3LQAL 3G6AB 3KPLA 3SJVB 1ZWIB 3QEGL 1IGML 4MNQA 2HFEA 1S3KH 3ESUF 1KCSL 5J57B 4Z8FH 2Z31A 1DL7L 3QDAA 1X6LA 4M80A 4R4BB 5FO7B 2F53D 3MV8A 5F89B 3GXNA 5GGVL 3FN3A 3UG3A 4APQB 4JREB 1M71B 1BAFL 3WD2A 1UWEL 3TIEB 5DK2B 5HGHB 3LB6D 3OV6A 2YD9A 2NXYC 1BOGA 3VM5A 4AY1A 2ZG2A 1YEJH 4HKZB 5HOSA 3RZCC 1FV1B 1OAUH 3QDJE 5I30L 2DLFL 1S9YB 1T5WB 3N17A 1CLOL 1QHPA 3V8CA 2PTUA 2WNWA 2Q3ZA 1Q4NX 4D0BB 3EYFB 4NC1C 4C83B 1EHNA 3V4PH 3FRPG 1TPXC 3QEHB 2YA0A 3ARDB 4L3EE 2XICA 3O2DH 5CSGA 5C6TL 2CERA 1DUZB 1XAUA 2CXKA 4PJIF 4D9QD 3QRFM 4W6XB 1RZFL 3QXDA 1UD3A 2UY4A 3QEUB 1Z9OA 3FT4A 3EO0B 5F9WC 3TJHD 3LS5H 1GZQB 1N0XH 1CLYH 1FZMA 1XSJA 3BWAB 4Q9QH 1F4YL 2JIWA 1U3HA 1K5NB 4HT1H 5IFJB 3AIWA 5DJ8B 4ODSL 1N2RA 3LQAC 2YHGA 2ICES 3QPXH 4ZO9A 4KY1L 5D8JH 3VFNB 4NXSA 4P4RA 1ZT4A 4W4NA 1KNOA 4TUKL 5JNYA 1Q9OA 5KTEH 4UNUA 1E1FA 1XGRB 5BZDA 4CKVX 4J23A 3FOLB 1D5MA 4PGEA 3ZE1E 3SCOA 3CFIC 4MCZB 2OP4L 3K4ZA 5IB4B 2H2SC 1S7SA 5I2IA 3MLZL 3OR6B 2G8ZA 4MJ6A 1NGXA 1K9DA 4XPFL 4WI2A 1A9EA 1UR8A 3O3AA 5GS1C 2DQJL 3DMMB 3O2WH 4WHYH 3REVB 3C87A 5EZOH 2QSCL 1URLA 1A6VL 1XGPA 4OZIB 3T2NL 3DSFL 2FJFB 4XXDB 3NCYP 2D3NA 1PKQB 1XF5A 5JXEA 1QLFA 3RRQA 5D1ZD 2J8UA 5FUCC 3CTTA 1YMME 5DO2C 1RZJL 2GSJA 3WDQA 1JD9A 2XIBA 2AEWA 3INUH 3VXSE 4NKQB 3OR7B 3QA3A 2AEQL 4DW2H 4HIJB 2VLJE 5EN2B 2DQEL 3IDJB 4P2CG 1XH0A 4LEOA 1B2YA 4NNXB 3RM8A 3BAXA 1YA5A 2K3TA 2V2WA 2W9DH 2FX9H 1C16A 1FGNH 3FB8B 4NO5A 1MEXH 1Z3GL 4TSAL 5DUML 3WD5H 2UWEA 1W0YT 1KXQE 4WU5B 2HTLC 4YJZL 1ZLSL 4GAYB 3WO4C 1CFQA 4W86A 1E28A 3BGAA 3L5WA 4P23D 4JR9L 4X4MA 5I73C 4QRSA 1QSEE 5I16B 4XWGL 1ZHKA 3SDDD 4Z2JA 1KWGA 2EKSB 1ZLUK 1DN0B 4R4NC 3P4MB 1BHGA 4H5SA 3NFPB 4P2QA 2QQLL 4PGCA 2WC4A 3V0AC 1WAAE 5E2JA 3RTQC 4NCC2 1UEMA 4MDPA 4GRLD 2HLFD 4MA1B 1IGFL 1MRDL 3P77A 1CE6B 1UVQB 4ZPVA 1HXJA 2YMXH 3REWB 2CBIA 1JPFB 5D1XB 3G08B 2CKSA 1E4KC 4R90L 4L3CB 5B4MD 3M7SA 1HDMA 4NPYA 3IAGC 4JFDB 1EHAA 4X5WB 1UCTA 3BAKA 1RZJC 4OCLC 1KELH 1QFUL 3W11D 3GI9H 1WC7A 4MDOA 1VEPA 4HLZH 4C55A 4MDIB 3CUPA 3MSDA 1PD6A 3MLTA 5B39G 3FHQA 2JK5A 4YFLI 3OJ2C 4HX1B 1RZKL 2DQCL 3OAUL 2V5MA 5DWUH 1TFHA 1N3NA 2D3VA 2JKXA 4Y16A 1PJ9A 3PHQA 4GXUN 3L5HA 4RIRA 3MA7A 4RGNC 1CF8H 5DD1H 4PFEA 1AO7A 5CKGA 1MCPH 1PY4A 1T7YA 4HS3B 5DHXB 1BOYA 3KG5A 3VCLA 2F7RA 4BFEA 3KZSA 3B9VA 1OTSC 4CD5A 3BEVA 3A21A 3O6MH 1W0VA 2A6KB 3NZHL 4HIIB 2D0GA 3W9EA 1IC5H 5H37H 2F19L 4B9ZA 1DFBH 5ACZB 4ALAL 1CZ8H 2WLZA 4HFWB 4D6CA 1EDGA 1HHGA 3EW3B 4FTVE 1CXLA 1OAKH 4ONOA 2WC7A 2JF6A 4K94L 3TBTB 1R3JB 3QFJB 1B3JA 3OKDB 3O0RL 4L8BA 4LYPA 3C6LB 4R2GC 3RPIB 4F37K 1B0WA 1QR1B 5GIRA 4LVOC 1NGZA 15C8H 4J3XA 3T0WA 3UTQB 1S7QA 4XMPH 1TVHB 3ULUF 1M04A 3RVUD 2FSEB 5C0IB 2IBBA 1MYRA 5JXAH 5I1CH 1MFBL 1FAIL 2YUWA 1PX3A 2VIRA 4PV9B 2V3GA 2UUDH 1GVYA 4QP0A 3MV9B 43CAA 2FEDC 2DSZA 1U36A 5T1LD 3BXNA 1U41A 3BCDA 5TD4A 1JGVL 2DQUL 5KSVA 1XCTB 2X1XR 1RZKC 4JHWL 3KPNA 1IGJB 5GRVL 3BUQA 1ZLVK 3A4AA 3KDMB 5CFHA 5D7LE 3DROA 3QBTB 3MQIA 3BSHA 4M8VA 4Z2IA 1WB0A 2IADA 4X0NA 1F90H 5GSVA 3TBYA 5JQHC 1CD1B 3BKCH 2J3SA 1KIQA 1NFDE 3ARGD 3VGAC 1T2JA 1KJ2H 2IH1B 3D85A 3P4OA 1N0LA 1IT9H 1T0MB 3RNQB 5ANMB 4YDKH 1AGEA 5FO9B 4YBQD 3SGDI 4FQCL 2MHAB 3CSYB 3TBWB 1HWGB 4U6XB 1UM5L 3QCVL 2D7NA 2WYSA 5C0AE 1OD9A 3D9AL 4XZUB 5BVPH 5IROA 1GGIL 3IJSA 4L4JA 1D5XA 3X13A 4W4OA 4D0CA 4K94C 5DSCB 3CMOH 2EH8L 1OP5H 1YNTA 2NLJA 4LSSH 4OLYL 3II1A 4JRYB 3WXWH 1ZVYA 1X4ZA 5HYSA 4L3AA 2YPKA 2FECI 3HMCA 2I07B 4AD1A 5DD0L 2FBJH 4PRWA 4HWNA 2XG5A 5CBEA 3FB6B 3QUZD 1OCWH 2Z35A 3UTPE 3EMCA 4PP2B 3L1OH 5B3JE 5AC5A 2VZOA 3MJ9L 1Y6MR 3SY0A 1C5CL 2GK1A 2V7HB 3R4DA 1BM3L 1KTDB 1WZMA 4P3WA 1F4WL 1T5XA 3D39A 2CLVB 3LQAH 6FABL 2P42B 3RDKA 2E6PA 4K23L 3QEGH 1IGMH 3IRPX 1W9VA 3G6JB 1KCSH 5EC2A 1X7QB 3T77B 4D9RE 1DL7H 3IGAB 2YUZA 4YE4L 2WVTA 3PTKA 1H3XA 3NACL 1V02A 1MHEB 5GGVH 3F6LA 3MRQB 1QO3B 4NO2B 4XNZB 3U7BA 1BAFH 3M17A 4PRHE 4PRPB 1AD0B 1J05B 3WEZA 3MU7A 1RULL 2AK4E 2NY4C 5KZ6A 1G7JB 2F54B 2WMIB 1DQLH 3AU1B 3B5GA 2J5LC 5HHOE 5I30H 3LRMA 2DLFH 3ZKXC 4W7WA 1CLOH 2JJTA 3VXME 3DVNB 4PJEB 3QHFL 3O8XC 1WICA 4AT6A 4AH2B 3TP4A 5C6TH 2IAMA 5EULV 1LEGA 3CFDB 2YPLE 1RZFH 1WIUA 3KPRD 3IFOA 3K74B 3CLFL 1U8PB 4OCWL 3T1FA 1EO5A 3UC0L 3VNZA 2XVLA 43C9B 2XQYK 5J12C 2ENYA 2DIBA 5DRXB 3U79A 4PMUA 1CQYA 4PJBF 4O2FA 5HGDB 2L7JA 1NC2A 1NWUA 1F4YH 5DRWB 2AJVL 3L3GA 3WIIL 3GUTB 5L8JB 4ODSH 1ZSDB 3TA3C 1P6WA 2GI7A 3SIMA 1A7NL 4KY1H 5A8QA 4P99A 5CUSL 1WBZB 3JXAA 1W2VA 3NCBB 4ACZA 4TUKH 3MODL 2HTKD 4IHOA 4R26L 5F89A 4H2CA 3BT2L 4AC1X 1IEAA 4NYLB 4QRTB 1NH6A 3NSXA 5ELIA 3HR6A 5CEXA 5HGHA 2Q8XA 3KNBB 3W24A 1TDQA 2HT2C 2QQNL 3MLZH 4IRJC 4MAYB 3UAJD 1KIRB 4UFKA 5FOJA 4XPFH 1ZGLB 3LPOA 1EGZA 5K59F 2HLAA 2DQJH 4OGZA 2BRQA 2O9OA 1U33A 2A74A 4HHAB 2QSCH 4DWSA 3HN3A 1A6VH 1SZNA 4G9FE 5EO1B 4EUPH 1EO8L 4TVPH 2RCSL 1K4CB 3QEHA 4JANB 3BH4A 1HH9B 1RVFL 1LE5B 4KDTC 3AB0C 2MKLC 5EG6C 3KWWA 5CEYA 3L4VA 3QEUA 4WDIA 3IANA 5DHYA 1RZJH 1DBAL 4JY6B 2D7TL 5M5DA 3HB3C 4X4YA 5DZNA 3CLEL 1GZQA 1UCBH 3FL7A 1I7UA 3BWAA 2FWOB 3D4YA 4KI1A 4LLMA 2AEQH 1SY6L 3MLVL 2DQEH 5DJ8A 5K9JL 3SDXE 4OD3L 1I7RA 3JWNC 1CFTA 3ARSA 4LQFL 3UCQA 3GNPA 1LK3L 2GK2A 5KVDL 1KOAA 1F6FB 1Z3GH 3MTRA 5DUMH 4PJ8D 1HF6A 1KB9K 5J11B 3FONA 4ZTPL 1ZLSH 1KTLA 1UD2A 4HS8L 3HG2A 2OL3B 1TFVA 4P7NA 1RZ8A 4HH9A 1K9FA 2DD8H 3G6MA 4OIAA 1B4JH 1C7SA 4XWGH 1NFIB 2DB8A 5F93C 1A14L 4YO0A 5JLZA 5I71C 2BV9A 4B53A 4TVPE 4EDWL 3TBSA 2QQLH 4P5TD 1P4LB 3NCJL 4JQVA 2ICWI 3REVA 3SUWA 3CXHJ 4OZIA 3MJ6A 5CG0A 2DWDB 3OKOB 4XXDA 1MRDH 4NWUL 2VDPL 4BELD 3QUMA 3TCLA 1JTTA 3TH3T 4J1UA 1PX8A 1VSCA 4RNRB 2D4FA 4R90H 1Z32X 1IQWL 4G6AC 4XVTL 1U8NB 3QIWD 2J62A 2J7EA 1PKOA 3CC5A 1T2XA 1T3FB 3FQUA 4QOKE 1GW1A 1EDTA 1QFUH 1H5BC 2ZIDA 4EXKA 2PYEE 4KDWA 1PZ3A 4V27A 3IDJA 2QR0A 5AYBA 3GBEA 3MRKB 3LKOA 3QXWA 3OAUH 3APGA 1HI6B 5IBUG 3C60C 1CBGA 3FQNB 3FZUD 5C08A 3BN9C 3E3QE 5JOPE 4OFYD 1E27B 3WQ5A 4CN4A 2JJVA 2W0LA 3TN0C 3I6KA 3NZHH 2R15A 4J8RB 1UWIA 2DEPA 1F00I 2F19H 3G6JF 3FTGA 1J7VR 2NQCA 3E2HB 4ALAH 3W4RA 5ESQB 2WM0A 2DQTL 4FQ1L 3FT2A 4HUUA 5E9DA 1CDBA 4NQDB 2EYTB 4WNQB 3WJLC 1Q6FA 4K94H 5HYFA 5IEHA 4XNMB 3BP7A 2YZ1A 3O0RH 4XAKE 5D1XA 5EUOA 3QUYB 2Y2WA 3VWJA 1R5WA 4HIHB 2KUTA 1NGWA 4ETQB 4HKBB 5MERA 4I0KA 3MZTA 3HRPA 3ZE2E 1NUNB 3U0TB 1KB3A 3BDYL 4AYGA 4HWEL 4M4RA 4OLXL 1MFBH 1FAIH 4MDIA 3EO9L 1A6UH 1XGQA 2VXTL 4U2ZA 4LOUD 1DWAM 4HX1A 4J4PD 3FQTB 5FGCE 1JGVH 4F57L 2DQUH 4NZDA 4U6TA 4JHWH 3T3MF 4UDUA 5F7WC 5IV2B 3EMZA 5M17A 5DUBA 1LP9E 2KL6A 3NCEB 2PC8A 5L0QB 3HKFA 3O9WB 3VG9C 2E3VA 1DLFL 1RUPH 3O6KH 3H9SE 4NQXA 1QYGH 1WZ1L 5DR5L 2XTJC 4FQCH 3V0VA 4X6DA 1UM5H 3QCVH 1X3DA 4HMEA 4PJ9B 4HK0A 4JJ5B 2ESVE 3D9AH 3L7EB 4KK5C 2F61A 1WO2A 4R96B 3FJTA 1R3JA 1I8IA 5SX4I 3S37X 3RDTB 5CGYC 3NCFB 2XN9B 4OLYH 3ULSB 4W7VA 3LN5B 4BQ8A 1UZ4A 1XFPA 5D8WA 1GOGA 1TVHA 4WTWA 4PYGA 3OA5A 5DD0H 3MLYL 3PHOB 2FSEA 4KDVA 4GH7B 3WQWA 4P8UA 1DE4A 5I1EL 3VXRE 1OLZA 1RUML 4AYFA 3AXXA 4DJMA 5IM7A 4MZ3A 5JW4M 3MV9A 4XCCH 1F3DH 3RVTC 1P5VA 2J25A 1DJSA 3MJ9H 3QNXA 1I8MA 1C5CH 1X5YA 2VDKL 1H0GA 2CQVA 3B43A 3OAYH 1D7FA 1BM3H 4MNQE 3BCFA 4JQIL 3D50A 1WGOA 1YNLL 4MWFB 1QRND 1CNVA 4LCUA 2WZEA 1FP8A 4F3FA 2DYPB 3FXYA 4PMQA 1F4WH 4QRRD 2BSSA 2QSVA 1K8DB 1OSZB 4J6RL 5LGJB 4RMSA 2WCAA 4OUUB 3MV8E 1ORQB 1U8IB 4WWKC 2OSXA 3DX4A 6FABH 5FD0A 3QDMD 1KTRL 5HHQB 4KJPC 1CT8B 5HYJB 4D9LL 4BS0A 5DJ2A 4OUOA 2IH1A 3S5LB 4YE4H 3DX7A 3RNQA 5FO9A 1C5BL 4I8DA 2AJSL 3NACH 5EU3B 2B5IC 5E7FA 3A4XA 1CK0L 4JHZA 4PSPA 4XZUA 5A8MA 4LMQE 3VD7A 2QLVB 5JUEL 4QF1A 5DJYA 3QIBA 1RULH 2EDHA 3UBXA 1JF5A 3L2MA 2CKNA 2JJWA 4JRYA 3E6HB 3GMOB 3EOBA 1F4XL 4MXQC 3SCPA 4MJIA 3QHFH 4YHMH 2YDRA 1Y18A 4ESKA 4P2RB 3TO4D 2XA8L 1MCIA 4G42A 4NNYB 1ZXQA 3ECBB 5C0BA 1W9BM 1OB0A 1Z9LA 2VE6A 3ULVF 4WHDA 5D93B 4PP2A 4MQSB 1CICD 4E2OA 4OCWH 2V7HA 3Q1SL 3UC0H 2Y1VA 5TGBA 2CLZA 1K4DB 3SQBA 2ZNWA 1UD4A 5KAQG 4S0SD 1G7QB 4R9HA 3T65B 4JE4B 4J7RA 3CLWA 4P2OC 2AJVH 2WBWB 4OFKA 5HGGS 1U8OB 3WIIH 1QNOA 4AEEA 5FK9A 4BSVB 4AIEA 1A7NH 1LG1A 3T77A 1X7QA 3IGAA 1KN4H 1GOHA 2MKWA 5FDWB 3W0KA 4R26H 4LLDB 5E4IA 1QPPA 1MHEA 1XH3A 3MRQA 5EU7E 2ILLA 3BT2H 1QO3A 4H1LA 4F9LC 3DUHA 1AD0A 5JA9A 2QQNH 5D7KE 9CGTA 1ZA3B 4LYQA 3BC9A 4Z7OF 5D5MA 2WWKT 2JIXD 2GIYA 5ALBL 1OVZA 4NFDA 1U92B 4TSCL 2WMJA 3BP4B 4DN3L 3FNDA 4WKFA 3CC1A 1EO8H 2RCSH 1FNHA 2CIKA 2FE0A 3HCVB 3KXFD 2F53B 4DQOL 2P4AB 1LO5B 2X1QA 4Z7WA 5FHAL 1U3JA 3BZFB 2OQJA 1IZKA 5GNZA 4M7KL 4ZPTA 1B6DA 2E6QA 3PWPE 1W9XA 3ZE0F 4XH2B 1FH5H 3ZLQC 4FQXA 1DBAH 2D7TH 3CLEH 1V08A 5IQ9B 4JGUA 2UWEE 5DDHB 4H04A 5DRWA 2QHAA 3GUTA 5J8OA 3MLVH 5K9JH 3RL2A 4OD3H 2R69L 4L4TD 3ARPA 4LQFH 1LK3H 4X4ME 4N8VG 1AI1L 5KVDH 5LBSL 5C0EB 1C08A 1JNLL 1NC4A 2EH7L 3LXBA 1MHHB 3R0MA 5DHVB 4NYLA 4ZTPH 4HS8H 1F11B 2B7DT 4LHJB 4P2QE 1P7QA 1UKPA 3B9EA 1LD9B 5AAWA 3T0EC 1A14H 1ZGLA 2XNAA 1BVKA 2X4TA 4PY7A 4EDWH 3S34L 4LCIL 3NCJH 1KJVA 2XTJD 3LKNA 4LCWA 4YPGB 3MUJA 3NJ3A 4Z0BL 2OX5A 2UZYB 1HH9A 3UXFA 4M6OH 5T3XD 3FB5B 2VDPH 4NWUH 4I3RH 2OXGA 4LARL 3EBVA 3K8MA 3EYUL 4QEGA 5KANI 3MRMA 1KENL 3L4ZA 4H25A 1N8ZB 1VERA 1IQWH 4JY6A 4NQVB 4XVTH 1HIZA 1PYWA 1AXSB 3TESA 2FWOA 1DVFD 4XVSL 4CW1B 3LRSB 1UWGL 4ONGL 3I3BA 3NVQA 4C7DA 4KK9D 1F3DJ 3PF2A 2IQ9L 2EDTA 3T3PF 3TA9A 1BP3B 4JFOA 1MUJA 3AXHA 2IJ0C 2W91A 3O3DA 2DQIH 1F6AA 3HZ3A 3ARRA 5IB2B 4AW7A 2IWGA 5B8CB 4U5IA 4WWKD 4GS7C 5E8OB 1KR0A 3U0PB 3NA9L 2FLBT 1X5HA 1S7WB 2NY1D 1NFIA 3AHVA 4ZXBA 1HHIB 3HR5B 3Q5OA 1E5NA 1DSFL 5DEFB 1TVBB 3VILA 3PIQB 1HEZA 1W3KA 1QNZL 3LN4A 2DJSA 3ALWA 1RZIA 1I1AD 2DQTH 2X4NB 4XGZB 5MHSD 1TQUA 2GFBB 4OSUL 3THML 5BW7C 3ZJ7A 1IBGL 3P2TA 1HSBB 4HLJA 4G80B 5BS0A 1I9EA 4NHUB 5D2NB 1V3LA 3S36X 5SWSD 3UEQA 2XKNA 1PVHA 1MCSA 1A2YB 4P23B 3CHDA 4TNWF 2E7LC 4JPKL 3SDDB 3V0WL 3ES6A 4OKVA 4IPNB 4LLQB 1FG9C 4MXQD 5BRZD 1NOFA 3BDYH 3U1SL 4HWEH 3LPWA 4OLXH 3VIFA 2EIDA 4P46D 3SO5A 3EO9H 2KDGA 3QH3A 2VXTH 5I1LA 2DIAA 3UTTD 2EEDA 2FL5A 4GRLB 5LQBL 1UEYA 3ARZA 4F57H 5I75B 4M7LH 2A3AA 5GXBB 4WO4D 4QXUL 2F15A 2AV1B 4OFDA 1IKNA 4I0PD 1A9BB 3T4YA 4OZFA 2D9CA 2C5DC 4H8UA 3BXWA 3HZYA 1NBYB 4FNLL 3UDWC 5E5RB 2BY3A 4V1DA 2VAAB 1BJMA 5GRXG 1WZ1H 1XR9B 5DR5H 1J9YA 1EA9C 4LLWA 1BREA 4Y8AA 3WUWB 3NAAL 5ESQA 3WLWD 2PCPB 2Z1SA 2JCCB 1JPSL 3PQYA 2IBZY 3HAEG 4HKJA 4XNMA 5CP7B 2IBZX 4PMDA 3AY4C 1U93A 1DANU 3AM8C 2PB1A 2PXYB 1ZJAA 1BWWA 1FO0B 1ESWA 3ARTA 4X9IA 1NAMB 4POUB 5TQ0L 4MJ5B 4MXWL 2FIRT 2HKFL 1ZBWA 1RUMH 3HFML 4GQPH 3B2VL 1JFQL 3SKOB 1H41A 3SCQA 1XF2B 1FNEB 3C5ZC 5MEQB 3D39E 5EZIL 4O51B 2FYYA 3U4BL 2I24N 1KCVL 2VDKH 3PZ9A 1FGVL 3RY6A 4JQIH 5IV2A 1YNLH 3BUTA 4WEUD 1GZJA 4WUUA 1QA9B 3O9WA 4J6RH 1JHTB 5IB3B 3ZT7A 2IPUK 1YN6A 1JNHB 3MRHB 1CGSL 4PEEA 5ENWB 4D9LH 2YD4A 4DK3A 1JK8B 4GJTB 3QNYA 4YHZL 5KSUB 3RWFA 4G9DB 3VXUA 1C5BH 2AJSH 4ZDHA 4GT7A 2LTQB 3RKDC 2E6JA 5T1LB 4YR6A 1CK0H 2EYSB 3X3GL 2A3HA 2GJXB 2AQ1A 2CRYA 1XIWD 1T21B 1E5JA 3QDJD 5JUEH 2XXMB 3WNLA 5FV2A 2NT1A 1EEUA 2GY5A 3ULSA 4F2MA 3JTTB 3FOMA 5IMMB 5HHME 4GPNA 2G5BB 3L3HA 4XBEL 1T22B 3OGRA 1F4XH 2QJDA 1WITA 3ARGB 1J0IA 4X6BB 1MFUA 1A1NB 3QJHB 2XA8H 1JFXA 4Y5VA 4RAHA 1N5YL 2R1XA 4N0CD 1MAML 4U1NA 1M6OB 1C12B 1LO4H 3Q1SH 3H53A 3GRWL 1PPIA 4LPYA 4LU5L 4RBPK 3PUCA 4AZ8A 1U8IA 4JLRB 4JM4L 4ONHB 5HHQA 3BISA 5HDBE 5HY9B 3T0AA 2FATL 5A2JH 1QPKA 5C0JA 4ZOAA 2EEAA 3MV01 1DQJA 3BESR 4K3EL 3VD3A 4UBDD 3FB7B 1GXEA 3SDCC 1BTCA 1ZBCA 5DEGB 3W0WA 3ZHLA 3PL6C 4PJDB 3BAJA 3P0VL 3L3JA 4IDLA 2CIPA 1WLHA 2NY2B 1HWHB 1NWSA 4IRSC 3E6HA 1J12A 5ALBH 5A43C 4NRZB 4G7VL 4TSCH 4O5LL 5HD8D 4DN3H 5A6MA 5CPTA 3C9NA 3RGHA 1Q6EA 3QUMH 2ZUQB 3ECBA 4DQOH 1YMMD 2C1OA 3CVHL 4B15A 1ZA6B 5FHAH 3N11A 2VLME 5FA3A 5IIEA 2Y8VA 1TCRA 4M7KH 1JWSB 2P49B 1IQDA 4U2YA 4RGMB 3S88L 4JPWL 1IEBB 3CZFB 3TH4T 5FOBB 5ETUA 3O6FD 3GSVA 3GMQB 2Y6SC 2YRLA 1R6VA 1LEKA 2AAVA 4NN5C 3NPSB 2DH2A 4BSVA 1W9PA 4ODHL 1MSPA 4L29B 3M1BB 2BXZA 1R3HB 2R69H 5MENA 1DBBL 3HE6D 4NHCH 1AI1H 2X7LA 1UD6A 1CI5A 5LBSH 3DI3B 1IZJA 3MRDB 2CUMA 4JDZB 4LLDA 1QSED 1JNLH 1BVLA 4XPTL 2EH7H 5D96B 3X14A 4WTZG 3KPRB 2X4OB 3DSNA 3NBNA 2EYRA 3GSRB 3D0VA 4PJ7A 3WFZA 3WL9A 5HNNA 3V5KB 1RMFL 4UQ2B 1EEQA 4OFPA 2EPMX 4PBXA 1CDCA 1E6JL 1I1YA 2M26A 5AZEL 5C86A 4JN2A 3PJSB 1INQA 3GM8A 1UZ6F 3S34H 4LCIH 4U6YB 5CSZB 2E40A 3BP4A 3GMLB 4RA3A 5CINL 3H9ZA 4JFSA 5BV7L 1R86A 4LDEB 5FM4A 3KLDA 4Z0BH 3HRZA 4CVWA 1B0RB 4Y5YB 3DARA 4X7SL 3BRFA 2D3LA 4IIQB 4Y4FC 1LO5A 2MPAL 3EJSA 3GNML 4LARH 2V17L 1VPOL 3BZFA 2VC2H 2QQQA 3EYUH 3CFEA 4W68A 4BH7B 1KENH 5JZ7C 1YY9C 2Q86B 2NXZD 4YEFA 2JCCF 3MBEA 3U5YA 4MD4B 1J0YA 3WH5A 1KQZA 1ZJBA 2WUCL 4YHOL 1UOKA 4XVSH 1UWGH 4ONGH 5I1AA 5BRPA 1T1WB 5HXMA 1G9NL 1PEZA 1KSRA 3U9PL 1NCCL 4LCCC 5C08E 2IQ9H 2BS9A 4HSQA 1Y6NR 3KYOB 4MD5B 1R3KB 3LKQB 3HTLX 3KYKL 1XD1A 3VFPB 1YQVL 1XF4B 1ZS8A 4MNHA 3NSNA 1FZJA 1VF8A 3GSUA 5IMKB 4GW4B 3AZSA 4X6FA 1OPGL 3NA9H 1HHJB 5L2KA 1JZ8A 4WV1A 3SDAC 5I18L 5GRYA 4HP5A 5E9DE 1KFWA 2Y25A 4W8LA 4FTVD 4D1IA 1DSFH 3BMVA 5EFFA 2APVA 3LQZB 2ZWLT 5EUOE 1AVAA 1QNZH 3C09C 4KJYB 3DX2A 5BV7C 3WS3B 4OSUH 1FPTL 4PJ8B 3FB5A 3THMH 4MQ7B 1S8DA 4LASH 2AEIT 1IBGH 2XIIA 4PCTA 2LQRA 4KMQA 1A6AB 3LRLA 5DYOB 1NARA 1KACB 5GSRA 4QT5A 1TZIB 2D31A 3TONA 2VSCA 2W38A 3S6TA 1U8HA 3DX1A 2GDUA 5JDSB 1FZOA 2F7PA 4JPKH 5ESVA 3UPRA 3V0WH 3KPMA 3OG2A 1AXSA 3U1SH 1A6ZA 1LO3L 5FGBA 4CW1A 1OWQA 2PW2B 4P5TB 4NN6B 4XXCA 2MCPL 1G9NC 1LK2B 4TVUA 1IARB 3QHZL 3KLAB 1MQPA 3VIKA 3WCYA 2A73B 5LQBH 5KVEL 1S5IH 1YPZB 4LCYB 4D3CL 2C1PB 5DJ6B 5J3HD 5C6PB 3MRLB 1JN6B 4FG6C 5D2LA 3DUSB 4QXUH 4XZBA 4P48A 4N0RA 3LKPB 5BROA 3EYPA 2IH3B 3DTXB 3VOCA 4XNYL 5B8CA 4L9LA 1A7OL 3QIWB 3VE0B 4DFHA 2IGFL 3NZ8B 4X6DE 4FNLH 5IDIA 3R06A 1KTKE 4ZAKC 3HR5A 3D3VD 3DVGB 2X1WL 5C0AD 4XWOC 2EDKA 5IEKA 1MWAB 2MQ0A 4PRBA 4JKKA 1BQLL 4HJGA 1ZMYA 2CDGA 3PIQA 2B1HL 4PJXE 5E5MA 3NAAH 4LLUB 1MQRA 4DN4L 4XGZA 4D72A 2R2BA 1ITXA 3G5ZB 2OMNA 4NM4L 3RNKB 3MFGB 4P0DA 1JPSH 5EORL 3RVWC 2NZ9C 1FFNB 4URTB 4NHUA 1V5JA 2BVPB 1YEDA 5FM5O 2C4FU 2O93L 3WS6A 4CUCA 3JWDL 2MFNA 5E70A 5GJTL 3M6DA 3UTPD 1HXYB 2J4WL 3HZKB 4UU9B 1FLTX 2DI8A 4MXWH 1G7LA 5EOCL 2HKFH 4CVXA 3FO2A 1CFNB 1ZLUH 3HFMH 4WKHA 3B2VH 1JFQH 4KKCC 3BEWA 1EEZB 2VR5A 5EZIH 1ROWA 1QFWL 4QY8B 4YZFE 3U4BH 4PLOB 3B9KC 2EO1A 1CZ1A 1WWAX 1N59B 3UYPA 1KCVH 4EIZC 4I2XB 3QQ4B 1FGVH 5IF0B 4NQCA 1QFOA 3VRIB 4PJIA 4PY8I 1Q94B 4HMCA 4PJFE 2AV1A 3QIUA 5EBWB 1FOBA 3NIGE 5EDXA 2Y6SD 3HE7A 2VUOA 4EN3C 4D9RD 1QUNA 5K9QI 2VWEE 4U7SA 1ISVA 1CGSH 1NBYA 2YKLL 2MWCA 4Y19A 2E27L 2VAAA 1CYGA 4M1CC 5E2VL 3PV7A 4YHZH 3VDHA 3FO0L 4H8VA 5I17A 4PRHD 4KTDH 2Z93A 4ZFZB 1CXFA 2FLRT 4H1LH 2AK4D 4XCNB 4JO1L 1ETZA 2VRQA 3L4WA 3X3GH 5SWZB 1JGUL 5A95A 5HHOD 1QI4A 4MJIE 5C6WH 2UY2A 1EFXD 1MREH 2AQ3A 3VXMD 1KBBA 5DZLA 3WFCL 4U1SA 3EJQA 5I8CB 1PQZB 5C0BE 1BD2A 1CFSB 2PXYA 4ODXB 4XBEH 3JWDC 1BFTA 5KJRL 2YPLD 3L5XL 2UYLA 2A9ML 4EI6B 5DFVC 3MSPA 5A3ID 3HC0A 1N5YH 3GZAA 1XF2A 2GCYB 3UBXG 4RE2A 1MAMH 4PSRA 2X42A 3OMZA 5I15L 1PZ5B 1JVKA 3U2SB 3GRWH 1IAIM 4ODTL 5IP4A 5CGMA 1CGXA 5IQ7L 2W9LA 1QA9A 3ARED 2ERJC 3HG3A 2H8PA 2AXFA 1JNHA 4MQXD 1NUDA 4MYWB 2QF8A 2G9HA 5D7JD 1SJHA 2FH8A 2FATH 1JK8A 1VIWA 2BSTA 1EQPA 4NZJA 5ECUA 1S78D 4X7DC 1PIFA 4HU8A 5HGBB 4QHNA 4JZJB 4PS4L 4HUVA 3IJ7A 1BGXL 4K3EH 1HOCB 5D5ME 1UA6L 3SGKC 1BPLB 2YOCA 1X5AA 1JUFB 5GGSY 2RIKA 3P0VH 4QRRB 5EPMB 5EA0L 5EFIA 3QG7L 2R2EA 1B1YA 3EOAA 4GSDL 2ADFL 1ZLVH 3QYCA 1T4KA 4Z7WE 2F9BT 4NQEA 4MVBD 4PD4K 4MHHG 1T22A 1JGLL 4G7VH 4R97B 3TVMC 2DSKA 2ICWB 1I8KA 2VLKB 4X6BA 4TN9A 4JZNB 4JCMA 1A1NA 5EB8A 4KMLB 1I1FB 1AD9A 5I2UA 4GW1A 1H1NA 4HDIA 3CVHH 5ID1B 3TFKD 3SCMD 2OSLB 2V5TA 1RUQL 3WL1A 3S88H 4JPWH 1M6OA 4PB9L 1V03A 5F1NA 3VW3L 1BMGA 2EDWA 2J7BA 3BAEL 5A6SA 1T80A 4H20L 4HUWA 5DRNA 4NKMA 4Y4KD 4CNIB 4Z7QE 1E6PA 1B3ZA 3SCUA 4P9HH 5EZLA 1MLCA 3WDRA 4ODHH 4Y2DD 3RM9A 1DBBH 1W72B 3BN3B 3DGGB 1REIA 5CLWA 1XZ0A 1D9KD 2R1YB 3DBXB 4XPTH 1CICB 1E4JA 1GOWA 3FB7A 4FLQA 5ACLA 3V6OA 1I8LA 3RZWA 1G0CA 3IS0X 5MEOB 1A6TA 1CIUA 1RJCA 4TVPD 2ATPA 4PJDA 4XVUC 4LCWE 5GZNC 1RMFH 1TVNA 4HKXA 4KTEL 5AZEH 3VXOB 2X1PA 1T03L 1J8KA 2ZSWA 4HGWB 1DUYB 5BZWB 4NRZA 3GMNA 5CINH 1YZZA 5BV7H 2HN7A 2DL2A 4N42A 3O2VL 4LMQI 3MUZ1 2PKDA 4X7SH 1DHKA 1DLHA 3DRQA 1J1PL 1ZT7B 2MPAH 1ZA6A 3GNMH 3CHCA 1Q9WB 3SE3C 2V17H 1VPOH 3PWLA 3Q3GB 1BLIA 6TAAA 4LAJH 4QOKD 4G8EA 2P8PA 3RWIB 5FKPA 3LV3B 4FNTA 3CZFA 4EIGB 1VBUA 4EDXB 3QO1B 2PYED 4MJ2A 5J1AB 1EEYA 2COQA 2WUCH 4I9WE 2EJ1A 1PLGL 2H32B 4M81A 2JIXB 1M1SA 1G9NH 2WBJC 3U9PH 2WMPA 3GMPB 3M1BA 4JPIA 1JL8A 3FFCD 5JOPD 1D6EB 4KMTL 3MCLL 5ABHA 3QI9B 4E41A 4ELMB 5KS9F 1YQVH 3M46A 1M03A 5HVGB 1F8TL 4UQ2A 1ZGLM 1OPGH 4LSQL 3CFCL 5JXEC