3VGGA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltoheptaose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
554
structure length
554
Chain Sequence
YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords Malto-oligosyltrehalose trehalohydrolase
total genus 193
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vggA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vggA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vggA02
1NMBH 1XGYH 4M02A 1JVKA 1S78D 4PRPE 3NSNA 3NFNB 2CERA 3BH8B 1MFAL 3C08L 2AEQH 3NPZB 3HRZB 3U57A 3MXWL 1HEZA 4Z2IA 1EOMA 1U3HA 1BZQK 4HPOH 2C1PA 1U8JA 4QRRB 1J87A 2AV1A 5GZOC 4P5KB 2BVTA 4ZUVA 1GJUA 1YJDL 3D3VE 2V7HA 2X1IA 1MLBA 5JNYB 4NBZB 4GKSB 1HQ4A 1OARH 4C56E 1HWWA 2WVUA 4ZTPL 1BZ9B 5JBDA 3THML 1C5DA 2PN5A 5JNYA 1K3IA 2DICA 3EOBA 2YUXA 4Y0GA 5EZIL 2R4SL 5JHDB 5E9DA 1MOEA 3SDCC 1L8NA 3VDCA 2ICEA 3JSSA 1KEGH 4W8LA 4HPHA 5JQ6H 2FX9H 4F9DA 1E4WL 2IPUG 3RUGE 4NQEA 1DUYB 1XH1A 3MLTB 4P8UA 1FNLA 5C0BB 5I0DA 1UWEH 2NX5E 1FOBA 4NZRL 1JCKA 2EXWD 2VZSA 2N4IA 5DEZA 2Y36L 2JJTA 5AYBA 3TYGH 3C2SA 4Y16D 1CQYA 1SVZA 1EEYA 4JO3H 4AZ8A 3NABL 4EIZC 1G6RA 3CXHK 4Y2DB 2QEJA 3QAZC 4X0VA 2AEIT 5JLZA 2ICES 3WF4A 1EVUA 3WUWG 4UIMA 2HT4D 4PJFE 5JLZB 2CXGA 2EIDA 3RWJA 1R7OA 2K3TA 3MV8A 4A4AA 3D3VA 5F7KC 1V3IA 3BGFB 5CP3H 3VFRB 1NDMB 4XVSH 2OI9C 4WO4D 1L6ZA 4GI6A 1KCKA 4FQJH 5DD0L 4B5EA 2VDRL 2G75B 3MRBA 3DO7A 1EEZB 2AK4E 5EORH 3OKMA 3CXHJ 1S8DA 1M7DB 3FQRA 1HH9A 2P5EB 2BVQB 1AIFB 1B6DA 3QR3A 4JQVA 4Y89A 4Z7VA 1R47A 3O6FA 4M7ZB 1FHDA 3W6LA 1KNOA 5I8EA 2A9NL 3NIFE 1OF2B 4JM4H 5E99H 3QIUD 3IETA 4R7NA 2WHJA 4OQTL 2F1AA 5C92A 2FX7H 3QUXC 4HP5A 2I24N 2ZUTA 4ZUVB 5E6YA 5BXPA 1D9KA 3GMNB 5FGBC 5KOVC 4YHEA 2PW2A 5IK3B 1QSFB 2X1XR 1MFVA 4I48B 4KC3B 1ZHBB 1NFDE 5FYJU 3MMEB 2DOCA 4NHUB 4Y8DC 4HTYA 4P2QE 2QV4A 4MB5A 1KCRL 3NFNA 3KYMB 1R75A 1NFDB 2FYYA 3IJYA 4M48L 4JJ5A 1U8PA 3UTTE 4ACPA 4UR9A 3ZJ8A 1OLZA 1IM3A 2YPKA 3VIOA 1IEHA 4FQ2H 4PJDB 4Z0XB 3P77A 3IU3A 3JVGC 3BVWA 1S7WA 2GEEA 1NMAL 4YFLI 1G01A 8FABA 2ATKA 5F6IC 3C2AL 4F7PA 5HYEA 3A6BL 4OZGF 5FYLD 4HK0A 3FQUA 2BSED 3ZHDA 4GAFB 3TT1L 4Z7WF 4KI1A 3MRLA 5SWZA 3RMEA 2CRYA 5CCKL 3VIPA 1S7VB 1OCWH 4N1CA 3RTQA 1PZ3A 5HNNA 1J10A 3PNWB 4MQXD 4XBEH 5E2VL 3WNLA 2AK4B 5HPMB 1RJYB 1R3KA 1A6VH 1A6ZA 1LNUB 2JCCE 4X6FA 1KXVC 1MPAL 4KK9D 1DHKA 5I76B 5CP7A 3VKKA 2VITA 4HA3A 5TGBB 2IAND 4AQOA 1CDUA 4OLUL 4OCYL 4PLJC 4KTEL 4ZAKA 5D7SL 5BS0E 1IGCL 5HYJD 1F02I 3TBVB 1ISWA 3MLSH 2QF8A 5J13C 2DAVA 5HGHB 5TDPA 3CZSA 3GM0A 2WWMC 2CD0A 5TFSL 4AD4A 4ORGB 5C0JA 1KT2A 4ZDHA 3WIIH 5TF1L 2FYVA 2NX5D 3HG1B 3DIFB 2P5ED 3O6KH 1V3MA 2P47B 3TO4C 4L8DB 3IJSB 4QHKJ 2D20A 2XPGA 3WIHA 5C0BE 4PJGF 2IPKA 5D9OA 3F12A 1VGEL 5FYKE 3RUGB 3RRQA 2OSLA 2VO5A 2X09A 1XH2A 3TPUA 5HGDA 4UUJB 4G9DB 4G6JL 4NRXB 3GJFA 2ADIB 5J4MA 4KHXL 1CXIA 1RUPH 3MODL 3UR7A 1F42A 1B6UA 2AXGA 3M6DA 5A1AA 5BMFH 6TAAA 5I30L 1OAKH 4JDTH 2OL3L 1ISXA 2A6KB 4C56B 1IBGH 4TOYH 1YC7A 5EG6C 4G6ML 1MVUB 3T0DA 2YRZA 3RWDA 4O02H 1P7KA 5GGUB 5KS9E 5E94B 2BMKB 3QWOB 4FFVC 4GRLA 1A9BB 5A95A 2DQHL 1QHOA 2J3SA 2XKNB 2R8SL 3QRFM 2FSEA 2ARJQ 3RI5F 5GZOD 1R24A 4WFFE 5L6YL 5MENB 3O3EA 1AD9A 1XGPA 1LQSR 1TVBB 5CCKH 4FQ1H 4AC1X 2FDMA 3TBSB 5BZDA 1ORQA 4X99B 4YFEA 3WFDH 2DH2A 1H5BC 2Q86A 4LPXA 4WI9A 1A3LH 1AQ0A 2BZDA 2XYCA 2CHNA 4W6YB 3D18A 3VFSA 5C0AB 5IW1A 3SKJH 3WFCH 1JV5A 3JWDC 3MNWA 4NO3A 5L7XL 2DQXA 4A6YA 3BE1L 2GJXB 1J18A 5LJYH 4XRCB 4OCMC 2J2ZA 2OTUA 2AVGA 3BDBA 3MRGB 5GZND 4I5BB 5DC9B 4FFWD 3WKMH 2ADJB 1IAIH 5EOQH 1ZBKA 1X5GA 5GPRA 4JM2C 2DDQH 5D7IF 5F7NC 1JAKA 3OAYK 4I3SL 5FA3B 1CT8B 3KYAA 1UZ1A 2XVGA 3VFTA 1B2YA 2FO4B 1B3WA 1OP5H 1X5HA 4PRNA 3RQ3A 4G8GB 5D1QA 2PWHA 1HHGA 3SURA 1A7OH 1UZ8B 1P7QB 4LKXB 1ZJAA 4DVRL 1LP9F 5ACZB 4HIXL 4FNPA 4U1HB 2HVMA 3OF6A 3FT4A 5KS9F 3TTYA 5SX4I 1S5HA 4BZ1L 1CFBA 2ZPKH 3MFFB 2DTMH 4HZAA 5EU5A 2YJQA 4I0PA 2B8OT 3W0WA 1FDLL 3PZNA 2XWBA 5A2IH 4M48H 4I9WE 1JWSA 4ODWA 3MR9B 3FT2A 1KCRH 2FB4L 5J8OA 3P11H 3TBYA 4OCXL 3IF1A 5E8DL 4TNWF 1D5XA 4PJBF 1PKQB 2B4CL 5KW9L 4GXVL 5IBUG 4LPYA 4IUGA 1WDPA 4FZ8L 4LPWA 5EBGA 1LNUA 4X6FB 4YE4H 1KB5H 3I6LE 2ZNWA 4LLQB 4ORZC 4QEGA 2NY7L 3GK8L 3QJHB 5CEYB 1CF8H 1J8HE 2F15A 3QHMA 4M43H 1X5IA 4KDWA 4XNQA 1SY6A 2ZOKB 3O9WC 3U9PH 1ND0A 3EOTH 4BH8A 4WHDA 1HKJA 1Q9WA 1LE9B 4TUJB 5IOPA 1CDHA 2PYEE 4PJXE 3CFKA 3RHWK 4U1GC 2C4FT 4LPTA 4K2UL 4LPCA 5CFHA 2D22A 1A64A 4X83A 1UA3A 2CDGB 1T7WA 3GSWA 3P77B 3VXPA 2YBTA 3OKOB 2XG9A 2R0KH 1QYGH 2BNRB 2R4SH 4DM2A 1HCVA 2FB4H 2W5FA 4ETQA 5A2JH 3VIMA 4JFED 3CFCH 1N8ZA 3O11B 4S1SH 4O51A 1LWRA 3QDJA 3M07A 1JPTH 1NCDL 1RK0A 2CLZB 3OKDB 3AIQA 3F5LA 5CP3A 5T33H 4BZ1H 5DJ0B 4P9HC 5A43C 3K0WA 1T7YA 3OSKA 1EHAA 1BIIB 5ABGA 5GGRB 3WQ4A 1BFVL 4YDKH 1U8LB 2ZX5A 1QSFA 5C0NC 1XF2B 5HHPA 4GH7B 2XVLA 3WHXA 5AG9A 4AMWA 3BOVA 2F8QA 4Z78B 1BM3L 4KVCL 5HHOD 3T0EC 4V2XA 2PTTB 2VIRA 4LLWB 1BFOA 3NZ8B 4LNVA 3S34H 4JO1L 2UWEA 3V0WL 1AHWA 4IRJB 3QUKB 4JG1L 2XKNA 1OSEA 2MQCA 3VI4F 4ATLA 1MIMH 4OGYL 1XF3B 4KAQL 3VSUA 2FWOA 1OTUD 4TQEH 4ODVH 5TE6H 2D0HA 4U0QB 4PJBE 1FLRL 1SJXA 4Z9KB 2HA1A 3IDMB 1BQHB 4S1DD 3P11L 2OQJB 4CVUA 4U7KA 2IGFL 2PCPA 3OKMB 3RU8H 4NCC1 2WIMA 3VFWA 1JGEB 3EDJA 2CIPA 2QTEA 2DTML 4OJYA 2D7TH 3MV01 1EHLH 5JIHA 15C8L 5JXAL 5HGDB 5DJAB 2P8LA 2G5BB 5F7WC 2CPUA 5IKCA 1ERNA 3RWJB 5C0RL 3HLAB 4YEEA 1F8TL 2ZWYA 3SKOA 4FNSA 2VQUA 3HI6H 1BPLB 1LLOA 4P3DB 4PJFF 3O9NA 1CI5A 3UYPA 3BQUB 2VDOL 3FO2A 1DEEB 4M6MH 1DUZB 1DL7H 1ZWIA 3BSGA 5BYWA 2PR4L 1IC4L 4PGCA 4I13B 1J5OH 1X5AA 2F54B 2AK1L 3CDYA 4M3KB 4X8XA 4W7VA 3GMMA 1XF4A 4U1JB 2VDQL 4QRSA 2R29H 3IXTA 1SY6H 4G42A 4JCMA 1E4IA 1UD4A 4QDMA 5A3ID 4PJ8A 2FEDC 1B3JA 4NOFA 3V5KB 2VITB 1MUJA 2X4UA 4MPKA 4M6OH 5IF0A 3WKNA 3W4RA 5DMJB 3O4OB 4HH8A 2V3GA 4O4YH 4ZNEE 1RJCA 4JAMB 2JB5H 4G9FA 4XBPB 5BS0D 3P2TA 4FLRA 2KDGA 4AMKH 1MVFA 5C0EB 3VFPB 3LS5L 4L8SA 1K5NA 3EIFA 1W9DM 3FOLB 3N04A 3FCTA 4LASH 5IVZB 4D9QD 4QHUA 1YHTA 1BFSA 2YD1A 4IRSB 2F7OA 1J9CT 4L3ED 1AQKH 3BPNB 4U6XB 3ROOA 4PLKC 5BO1H 4GAJH 2YBUA 4GRWH 2NXZB 3V0VA 3F6LA 4JRXE 3E8UL 4HEPG 4PJDA 4KK6C 3RGVB 5HHOB 1V6WA 2E27H 4D1JA 1RI8A 4CW1B 3D9AL 2CDEA 4EUPH 1MCRA 2YPLE 1IC7H 2A83A 4YHKH 3ARDD 3QPXL 4YR6A 1PFCA 5IB2B 4YHPA 1DBJH 2C3HA 3HPJA 4K71C 3T0XA 4H0IA 3CH8A 2NY3C 4Y4FD 4HUVA 3WMCA 1BBDH 1OL0A 1WDQA 4NQSA 4PSPA 4OZGE 3RA7H 4HF5L 3GMRA 4QTHB 3N50A 1A4KB 4P4KA 4Z7WE 3KXFA 4CN1A 5AZ2L 1NC2A 1V8HA 4ONFH 4P2QD 2D0GA 2EIEA 3PE9A 2F61A 3ULSA 5J11B 4TVPD 4PTUA 3JTTB 2E0PA 4R7NB 3X13A 3IKCB 4JFZL 2MPAL 1LE5A 5DURB 3AHVA 3EFDL 5CZXC 5IHZA 3FB8A 1ZGLP 3MGAA 2BJML 5E5RB 1GPOH 1A1MA 3BVNA 5D6CA 1E5JA 1YECL 4XVJL 4OF8A 3BUPA 5DLML 4OFKA 4N8CL 3JUYA 2XWTB 4CDGC 3GHEH 3NA9H 3KXFB 4LL9A 4D0BB 4EQ3A 1GAFH 5T1MA 4QCEA 1XGZA 2WBWB 3ARBC 1PG7X 4KZDH 4L3AA 1KJ3L 2AXJA 1I8KB 3HPJB 3RDTD 1XCXA 3RNQA 3GBEA 5GGTA 4R0LC 4YHML 2VDML 3CJJA 2DWEA 3SE3A 3SPVB 4HIJB 3CSBA 4LPVA 5JW4N 4IRSC 3ZKXB 1WC7A 3O9WA 3T04D 5E4IA 5KSUB 3KL0A 4OIIH 4JKWA 1JGEA 4M7JL 3V0VB 2VYRE 4GOSA 4AZ6A 2OW7A 3VXOA 3MRKB 3HNSH 4S2SA 4Z7UE 4G80A 3AYSA 4QHLB 1OAXL 2YDQA 1N0LA 5I6XC 4V1DE 1KQYA 4E8CA 4P2OC 1N6QL 2P48B 2VZUA 1F90L 3CLFL 5GRWA 3QIWD 4POYA 3T2OA 1XSIA 4LLDA 1HIMH 1IQWL 5I79A 3CDFA 1HJXA 3AZTA 5C6TH 2MKLC 1BVZA 1S7SB 3WFEL 4JO2L 4UCFA 5EO9B 2V2XB 4I2XE 3P9LA 4V2BA 3U0PB 3C5ZA 4LCWE 4PJEE 3U2SA 2HMID 4HZ6A 5I8CA 1RY7B 2AV1B 5I6XB 4WDIB 1KGXA 3THDA 4NKDA 2EIBA 2R23B 4BZ2L 3BEWB 2Q7YB 3L4YA 1UR2A 5MI0B 3W81A 3L3KB 4W6WB 1OIMA 2V2TB 1U58A 4U3AA 3LSOB 4NQTA 3KPRA 3TYGL 4NYLA 3BESR 2H6PA 4AG4L 4GXUN 3VXNB 2Y36H 4AZCB 4NBXB 5BV7B 2F8OA 4QCIA 3RVUD 5F8RC 5T1DL 4LHUA 1SY6L 1RZJC 3IAQA 5TQ2H 3DSFH 2H1PL 3ARRA 1N2RA 2XACC 5F3BA 3KLLA 1MRCH 2AEPL 1B30A 1JNHB 3WO4B 3MYZA 2WMGA 4PEEA 4K8RL 4DW2L 5EZLB 3DV6B 1FFQA 4L3EE 3U1SL 5FO8A 5DD5L 1UENA 3O2DA 4NNXB 2IANB 1NMCB 2GK0A 1CL7I 4UNIA 1BGAA 1IZKA 5CD3B 4NRZA 1H5BA 3WF3A 2ESVD 1RVFH 3ILQC 1H11A 2J7HA 5FIEA 2P24A 1ZLWK 1V6XA 1FVDB 2DYPD 5FA4A 2G4FA 4LVOB 1LP9E 4P3WA 3FFDA 3MV8D 2CQVA 1UWXK 3MJ9L 2N1KA 4OZHB 5DJ2B 1E6QM 5BXSA 3MA9L 2DT0A 1E6NA 4HULB 4DK3A 4Y4FA 5LCVL 2B1AL 3VMOA 3L3OA 3LN4B 1TJIL 5BOZG 5HVHC 1Z9OA 3FQWA 4EI6A 3SDDA 1I7ZB 5IGXH 4JZ5A 3SE3C 4F2MA 5KTEL 4P2OA 1I3RB 2C7FA 2YRPA 3LRSA 4QTIH 3FONB 3HNSL 2YD7A 4OCLC 3V6OC 2B1HH 4MXWL 4O5LH 4M8QB 1G0DA 4B7IA 1KUMA 4XB3A 4OLZL 1N8ZB 3HCVA 3SCTA 5F1IB 4J3VA 2R1YB 5FKYA 3CVHA 5CLTA 5INDB 1FNEB 3QZWB 3QYCA 1K9DA 3WIHH 2I60H 4Z0BH 5HVGB 1RVFL 1YMHB 2XFXA 4MQTB 35C8L 5SWSE 3QNZB 4KK6D 2YK1H 3WFDL 1SZNA 4HD9A 1O7DC 3IDXH 4U1SA 5EB8A 4PMUA 1OW0A 3UETA 5F9JA 2EDHA 4PPTA 4J4PC 4O2FA 4EI5C 5DQ9B 2A73A 2ZSWB 3D18B 5D7IB 3VFSB 5C6TL 1HOCA 3DMMA 5GRJH 2BSRA 5L2KA 5IBTL 2GQHA 5BRZE 3H55A 2NNAB 3GSOB 1U92A 1GRWA 2V5YA 4X6EB 4UILH 4M4PA 2XIIA 5HI4D 2OWCA 1D6VH 1C5BH 2YKKA 1V7MH 2GUYA 4FQCH 1DQDH 3TYFB 3BZEA 1TA3B 4HGWA 4MNKA 3MO1A 2F8VA 2VSCA 4IS6A 4URTB 1MI5E 4AZ5A 4WFEE 2HFFB 3ESVF 4FLQA 1JWSB 4UQ3B 1T7VA 5E1HB 1KN2L 3KPLA 1DDHA 1VFFA 5AYIA 5A69A 3BD3A 1WO2A 2OTWB 3UZVB 1RJZA 1KACB 5D8WA 2O5YL 5EIIB 4W5UA 2MOVA 3VI4E 1W72B 2ESVB 1CFSA 4X7TB 1CICD 3EZJB 1T3FB 3ZSTA 2J4WH 1F2QA 4AY0A 1AXTL 5J9PA 1BD2D 1KJVA 2B5IC 4QXUL 4PJXB 1ACZA 3WFEH 5JA9A 5I1AB 3QIWA 3KLSA 1YJDC 4R4FL 4H26B 1JI2A 2AXGB 2E27L 3EBAA 4MXVF 3ARYA 4YNYA 4WHYH 4Z7QF 1CFVH 1I1XA 2J5LC 1T7XA 2NZIA 5LKNA 5EB9A 4I0PD 4F9PA 5C08D 43CAB 3IAGC 4DVRH 1AGEA 3AXHA 1MCPL 4DTGH 3J8F7 4AYSA 3FO0L 3RCNA 4K7PL 3TIDB 3BUQA 1IAII 1IAIM 1XGTB 3MRDA 4NC2B 3DVFA 2XGBA 2HP4A 3I75B 4KK5C 1AGBB 3RFZC 4KKNA 1WZ1H 3VWJB 2QR0B 2VZ1A 2VXTH 1GYAA 2IXUA 1MPAH 3GI8L 2UWEE 5EOQL 1QR1A 1U0QA 2J8UB 3MSPA 3FB7B 1O7SA 3BPLC 3QUXA 3ZE1F 1MCWM 3DX2A 1E0VA 2X10A 2IPTL 3I3DA 4LYPA 4JKPH 4ATWA 3DC0A 4HJJL 1OCWL 3VE0B 2J88L 3AFBA 1A4JB 1UKQA 3SKMA 3GRWH 5CEZD 4H1LB 3DDGA 5CP7B 2ERJB 1I7TA 2JB6B 4IHOB 2NLJA 4ZG1A 4OLEA 4ZNEA 1VIWA 1AY1H 3GIVB 1MRDH 4K23H 5C0CD 1A7RH 4G7VH 3B6SB 4R4BB 1UJ3C 3IXAB 2VLME 3FTGA 1WLHA 1R24B 1PQZA 2VLRA 1T5WB 1BEYH 4PBWD 3MRNB 5EOCJ 3GSVA 1RV6X 3L9RB 3M17B 4FQIL 1FZJA 1UQYA 2JIXB 5AYUL 3U36B 1DSFL 2X4QB 3FQTA 3PQYA 2VN4A 5JPNA 5A2BA 5L6YH 5DFVD 2J7EA 3CUFA 5IFJA 3FJTA 1RZ7H 3CFJB 2W0LA 3RWHB 3DXAA 3WN5B 1T0NA 4P9HH 3I84A 2BCKA 4O9HH 5D2NB 4OGAD 2H3NB 2ADIA 4P7NA 5C0FB 4JRWA 3HPLB 1RU9H 4GW5B 1X6LA 2X4PA 4MJ6A 1FQ9C 4JFHE 3V6OE 1LD9A 1B4JH 1MFUA 4PLJD 2GAZB 1GIGH 3DVNA 4JR9L 2ZUWA 2OR8A 3CTTA 2OWXA 4S1QL 4OQTH 2J8UF 3HA0A 3I85A 5E4EC 5GSVA 3SDXE 1KCSH 3NOIA 4UTBH 3SO3C 1NCNA 1ZS8A 5C0JB 4BQ8A 5HHXL 3MLUH 3UTPE 4OT1H 1YY8A 1WWAX 3QDGD 3ES6A 4OUUA 3UBXA 2E9MA 1LO3L 3U7YH 4EAMA 1ZTXL 3GJFH 4UU9A 2F2HA 2G9HA 4ODSL 5BRQA 4GI9A 1TR1A 5DJ2A 4Z2JA 5K9QG 5IEHA 2W1NA 2VT0A 4PTWA 4GAYB 5DUBB 1KNOB 2JF6A 1IM9B 2BC4A 1JGVL 5KN5A 3G6DH 4QXGH 5I76A 3RWIA 4YXHH 1HQRA 1X7QB 4MMZC 3LS4L 5DJCA 4WIWA 2WZIA 3HAEA 4QO1A 2GUOB 3VFMA 2CMRH 1EK3A 3ULSB 4XXDA 1KGCE 3FB5B 4OB5L 5ITBH 2G75A 3MRBB 4NCC2 5E00B 2DLFH 4I8DA 4MJIE 4C54A 3QFJA 2FE0A 4R7DA 3JXAA 3MZTA 1A4KA 4P4KB 3IU4L 3UDWA 3C6SA 1HP4A 1VFMA 4D2NA 5D70H 3L5WA 1MJ8L 2E7MA 2EEBA 4LRNL 2BY3A 5EZOL 2I5YH 3D69A 1YN7A 4OZGA 1F3DJ 1KJ2A 5I19H 1UYWL 3OA5A 3DRTA 2NY4B 2HFTA 3T4YA 3HG1E 3QUYA 2XQBL 1J86A 3II1A 5E8EB 1KPUB 2OZ4A 2EH8L 5E08H 5D9NA 1U58B 4M03A 3BPOB 3FQXA 3WXVL 1R8LA 3P3YA 4WEBH 2X1WL 6FABH 2G3NA 3SDYH 5FCUL 1NEUA 5C0BA 4DAGH 4MNQB 4EUPB 3BAEH 5HYJE 4HPYL 4WDIA 1G7HB 2PO6A 4NQDD 1TCMA 1TJHL 4KY1L 4Y5VA 3L7FA 4J6RH 3V9FA 5FXCH 3K2MC 3EYUL 1C90A 1BZ9A 3KGRA 4N0YH 1GGBH 3BDYL 3MRRB 4Z8FL 1Q9LB 5HVWA 2BRQA 4IOSD 3RVWD 3SKNB 4JPKL 1OF2A 2BOCA 4ODVL 5TE6L 3BDXA 5GS1C 5GGQL 4BFIA 1T2QL 1LO4H 1RZKC 1E4LA 3DGCR 4F33B 3VXOB 4CJ1A 4PJIF 3UPCA 5CZVL 3QA3B 4PJ7E 2OR9L 4BQ6A 2FGWH 5D1ZA 1CIDA 4ISVA 3CSPA 2Y72A 5C09E 4P3CL 1A1NA 1ZWIB 5DRZA 2YA2A 4W93A 1U8OB 4MA1B 2C4FU 5T33L 2VLKD 1LEKB 5T3ZH 4BUGA 5DJYA 4LEOB 1MJUH 3UTTD 4AQ1B 4GKNA 3S37H 1JTOA 3I9GL 4N0FA 3OKLA 3EYUH 4MLSA 4Y2DA 3P0GB 3EYOB 2CIIB 5I1GL 2CCRA 4MSWB 5E8NA 3LXCA 1EO7A 2X6MA 4XCEA 1TIUA 2KH2B 3ULVL 2AJSH 3ARGB 4YUEH 3WH7A 4TN9A 1W0WB 4MCYB 3H2WA 1VJSA 3EDEA 5JDSB 1PEZA 3U4BH 4RQQB 1T1ZA 2OXHA 4ODXB 3KS0J 4N0RA 2P46B 2WINA 1EFXB 1CFNA 4MAYA 1WUNT 3VDBA 3RVWC 3LDBC 1CGSL 3QEQD 4JB9L 2XY2A 4KRUA 2BNUB 2VXUH 1MIEH 1T4KB 4UIKL 1ACYL 1S5IL 3VIJA 1BVKB 3L3GA 3RL1B 3JTSB 3IRZA 5KVFH 2OW6A 1OSZA 3WFHA 3L7FB 5ANME 1KSRA 2J79A 4Y4KC 1UEYA 5HHPB 1KWKA 4YH6A 3PDDA 4ZS7H 2CKSA 1IAIL 2OSXA 3DGGB 1E1FA 2V5CA 3DUUB 1LEIA 4WU7B 2IAMD 1U8HB 4GXUM 4CGTA 4YHPB 2FNBA 2BS9A 4D6EA 2XQYK 3GBDA 2J6EL 1N64L 2EE6A 4R0LA 3MUGB 4PJIE 3MC0A 1S9YB 1KYOK 4JN2B 3OGRA 3GMOB 1W0YT 4GKLA 3QXAA 4RX4D 5IHLB 3OLDA 4HZLA 5DGRA 1Z6JT 3C5JB 3HC3L 1QWNA 5ICYA 2VRAA 3U6RA 4MNGA 3DI3B 3S97C 3LRGA 2F53B 4JPWH 2G5RA 3SUWA 2AJVL 3AROA 3TV3H 5A8OA 2DIJA 4FQIH 4OKVB 3QIUB 3ARUA 1LE9A 1CBGA 1KXVA 5A8QA 1JHTB 1YEGL 4HH9A 1E4MM 2QHLA 2IBZY 4XPFL 2C3XA 4CDHA 2IAMC 3IDGB 1TQWA 5IMLA 4MJIB 4D9LL 4M1GL 5C0EA 3WL9A 5D5MA 5BQ7B 4Z76B 4Q6YA 3TWCH 1GZPB 3N11A 3CZGA 4HG4K 2FJGB 3QPQD 1V08A 4GMSL 3VFVB 4N0UE 4MWFA 4ATDA 1A6UH 1CFTB 3V5KA 1DE4A 3Q6GL 5IB3B 2EC9U 4M7KL 3SCPA 3HUJF 4M1DL 4ZFFA 1MCKA 3GNMH 2A77H 2G2RB 4PG2A 4ODTL 5K33A 3H9SD 4F37K 1HDMB 1T20A 4G8IA 4JVUA 3UZQA 5IIEA 4C83A 5IMMB 1ZEAH 1IAOA 2MFNA 3LV3B 3VH8B 4F37F 4PMRA 4CD8A 2VXQL 5I1IH 3ULUD 4Y19B 3DVNB 4HC1H 4LRIC 4P46B 4FABL 2AV7A 2G5BA 5T1KA 3AHZA 2IBZX 1AC6A 4D9QE 4HX1A 1BYDA 4CN4A 1MHPH 1NBQA 3GGWA 2DQJH 4K3EH 4PS4H 1RZIB 2L4OA 4HMCA 1KBGH 1X5YA 5A16A 1U3ZA 2GYSA 4RZCA 1H3UA 5EU6D 3VSTA 2OL3B 2DKMA 5GGVH 2V5RA 5DMIH 3U36A 2IAMB 1OAKL 5HYQB 2DI9A 1A1OB 2VZVA 1PEWA 5SX5K 3S35H 5AAMA 1SHMA 4PJCF 3S36H 1BD2B 5DYOA 2Z31A 2KBGA 1QBAA 4ZPVB 4NNYB 4M62L 3L4XA 1PBYA 2Q8BL 3KPNA 4MX7B 3SE8L 1A5FL 3HG1D 5ESAB 3WE6A 4Z78A 4F8QA 1FZKA 2AW2A 4PG2C 5J0BA 3KJ6L 5JUEL 3QUZD 3HC3H 1DN0B 5GGRA 1K6AA 3VIKA 5C08B 3F7YA 4ZYKA 1FFNA 4OFPA 1OM3L 2DQFA 4JFPB 5CSZB 1UM6H 2A1WH 2V5SA 4JZOB 1QI5A 4I0PC 2VC9A 1HJQA 5D7KE 5F93C 1N5AB 1RZKH 4LF3A 5CZKA 1E4JA 3MX0A 4X5XB 4AL8H 2J5LB 5ICXA 4I4WA 4M6OL 1XZ0B 1GC1C 2YRLA 3S35X 5HYQA 3I75A 5DO8A 5D5MF 4F15C 5IQ9A 3HZVB 1CGWA 3CFKB 1C08A 4AH2B 2DF3A 3QIBC 3RWEB 2A6KA 1JYWA 4PJGE 4U1LA 5D8JL 4JLRA 4XBEL 3AMGA 4OLWL 4UQDA 2AGJL 3MYJB 4JB9H 1ISYA 2EYRA 4ZPTB 1YPZF 3SY0A 2JJTC 2D23A 5AC5A 4AENB 3VO0A 5CZVH 2W65A 2R1YA 4RMWA 3ARWA 2OJEA 2EDEA 1IT9L 3RVXD 5I1AA 5KBNC 4BQ2A 3VXME 4RA0C 4G6FB 1WAAF 4PG9A 3BGMB 1BSIA 1FVEB 3SCMC 3NFPA 3TJHD 2WB5A 4CVXB 4Z77B 3DTXB 4GO6B 1VRXA 3PF2A 2JIXD 1HYRC 4NQXA 2E9JA 3ZKXC 5F97E 2W66A 3VD9A 3BGAA 4MB4A 2EYSB 4QRPA 3T1FB 3GZAA 3U5UA 1GGBL 1DDHB 2EEAA 4HDIA 3T3MF 2ZCLL 2X4NB 4KVNH 3GSRB 2P1YA 1YEJH 4P2RD 3M1BA 5HD8C 4LIQH 3U83A 4WU5A 5BXRA 1DE4B 3WENA 3FFDB 2DYPB 4X7SH 3DETD 4RFOH 4UDTA 3Q6FA 5EN2B 2P49B 4UINH 5CILH 3D1MC 1CG9B 2BVPB 1A2YA 5GIRB 5H37H 3SOBL 4DKAA 3PNWA 4P57B 1W3HA 1QLEH 4BF7A 4FLOA 5E70A 4NNXA 4AENA 3BAIA 2ICCA 3AXLB 2BOBB 3Q3GA 4QF1A 1RZGB 1VADB 5JXEA 1F45A 1NPUA 3KHOA 4R5EA 1U8QA 3HE7B 5D8JH 1HHJA 1WFUA 3G08A 1HP5A 4UBDC 4UU9B 4OIBA 4MD0B 2F7RA 3R4DA 3QXDA 1RHHA 1JNLL 4PRAB 1P6AB 2GW5A 3LX9A 5I77A 5ERWB 4PB0L 5E2TH 3CDGB 3PABB 1MI5A 1AKJA 3MJ7A 3RPKA 1LVEA 3TO4A 2Y07L 3BYTA 4L8BA 3CC1A 2BP3A 1QHZA 4AZBA 2Y07H 4M7LT 2EDBA 1GQKA 4R3SB 4NC1C 2YSSA 4LGXA 2VLJA 5A6MA 1K4DB 4LVNC 4XNXL 2EDKA 1ORQB 1WZLA 4JDVA 5HGBB 1YYMH 3KWWB 1BX2B 2SEBA 2Y8KA 1IGFL 4NJAL 2PXYC 3U0PA 3WDQA 2H2PD 3EO1A 1E73M 4Q0XL 2YA0A 4OLZH 3D39A 1I75A 5DQDL 3L3GB 1ZHLB 1HHJB 3GSQB 1BD2A 5DYOB 3VX0A 1NEZA 5D96B 1QFWH 5CJXC 3SGEH 4YDVA 3GBNH 4TUKL 4Y5VC 2VDKH 1KFAH 1R5VB 2VISB 3KAAA 4EUPG 1NWUA 3GSNA 2Y7QA 4WKFA 4JFQB 1GOKA 3EJJX 4PJCA 4ZTPH 3VGHA 2Y6SD 4NZCA 1R34A 5GGRY 3P30L 5I1DB 3WQVA 2J47A 2BXYA 3KEHA 2O5XL 3JV5A 3JWOL 1HHHA 2VABA 5C2UB 3BIKA 4CMMB 1FNSL 4GMTL 5BS0A 4WFED 3QRGH 3ZDZE 3VJ6A 5CJ8A 1VEOA 4HIJA 5D71H 4HIXH 1SM3L 1KENL 4IIQA 3W5NA 4NXSA 3S98A 4JY6B 2EYSA 1HHIB 4GS7C 3FO9B 1SJVA 1T21B 3BPLB 4XWOC 5GRZA 5AYUH 4J8RA 3LEYL 5D2LE 1ZVYA 3D87B 2WUCL 4P4RB 3CLWA 4J8RB 3EJQA 3F7VB 4PRPA 5KSVB 3B9KA 1GPFA 5EUOA 1FL6B 2DEPA 1DFBH 4YHNA 4QRRD 2CHOA 1Q94B 4MYWB 2R0LH 1IEBB 1CLYH 3ZDYE 4X6DE 1DCLA 1BQLH 4GBXB 4PRHB 1QNOA 2WWCA 5HI5D 4NSKB 4CMMA 3B9VA 3EFDH 1OQXA 2ZG1A 3VGEA 2Z4QA 4M1CC 2AABL 3HB3D 3K74B 4HMDA 4P48A 3MNVA 5IHZB 4MNMA 4R27A 3FB6B 3BSZH 1R85A 5CPQA 2AI0H 5ECUA 5F96H 2OSYA 4MDJB 3SKNA 4LCWB 4OV6F 4I2XB 1OT2A 4M6AA 5FYJL 4AH2A 2J62A 4W7UA 5CKGA 4PTUB 3DXAD 5D6DA 3ULVF 1C5CH 1AFVH 2OYMA 2ENSA 1QSEE 3V4PH 5JW5A 4YDLC 5D5MB 4MA8L 2Y8VA 2A9MH 1W9PA 5IB1B 1RUPL 3MODH 43C9B 1C92A 4KJQC 1MFBH 2R39A 2Y6SC 4XMLL 5TDNA 1BF8A 4OI9A 1BVLB 2V5DA 3NMEA 5DUML 3KJ4B 1X6NA 4EI5D 1JE6A 3EYFA 4K94H 1E43A 2LTQC 4P7LA 4M5ZL 5GJTL 3BH8A 1I1YB 3NUKA 4U2YA 4XGZA 3WH9A 4UNTA 1JMZA 4ELKA 2WIIB 2DMBA 4Z0XA 1K9FA 3C5JA 1G0XA 1XV8A 4CW1A 4MHHG 3FMGL 5TPWH 4WSJA 4PGDB 4KGJA 4K7PX 2PBOA 4NQDB 4FNRA 3O3UN 1FGNH 4LCUA 1CU4L 4X6DA 1E70M 4IEFB 4LSUL 2YS4A 4ZPVA 2LTQB 4PMYA 4PMOA 3NPSB 5A6LA 3PGDB 4MA1C 4JEGB 1IARB 5HDQH 4MZ3A 1ZHBA 2Y5TB 1FIGL 2GJZB 3GSNH 5ALBL 1TMQA 5DEFB 2NY5L 1PIGA 4NKIH 1AXSA 3GSNL 5ALBH 4XCYB 3HC4H 3FN0H 3NAAL 1C5CL 1KN2H 3NCFB 4MD0A 3FB5A 1XGRB 5HBBA 1N82A 3OX8B 1EMTH 2GUOA 3VFMB 2H26B 2LV4A 4BSVA 4JAMA 4XBPA 3ZDYF 3L1OH 5IVOA 1T4KA 3RKPA 1XIWC 3SGJA 3BVNB 5D6CB 4JE4B 1JUFA 3MBEA 5ABHA 3NBNA 1QZ1A 3D85A 4GW1B 1JUFB 2PW1A 2FECL 5D7LA 5HHVH 1BBJA 3X13B 5C3LD 2BVQA 4O00A 3IDYB 3UJIL 4AISA 2GTZB 1KIQA 4YO0B 4JPVH 4N8VB 3W38A 2QHRL 1EHNA 1H3WM 3GMPB 2JKXA 3TA3A 4JHAL 3SCMD 3W28A 2R0WH 3ARED 3ARDB 3IDXL 1C91A 4QYOA 3G6JA 4BYHA 4UIMB 2BNQA 4WIQA 4S10A 5F3HB 4RE3A 1EHLL 4WW1B 2BVEA 3K8LA 3SDAD 4UZUA 2YPLB 2YEZA 2ZKHH 3BSZL 3I50H 3IDNA 1HT6A 4L1DA 4DGIH 2QQLL 3CZJA 1GHSA 5CJOH 4YN5A 2ATPA 3FL7A 2ILLA 2YHGA 5I66B 1VEMA 5IESH 4N0CD 1I1YA 1RSFA 2NCMA 4YXLL 1UM4H 4MJIA 2OQJA 4H8WL 3WEMA 3NZHH 3FQTB 3WNPA 3ZE2F 3BT2L 2QKIB 2A74A 4HXAL 2ZWZA 4OAWA 2AAAA 4JG0H 5I8KH 3N9KA 1ZSDA 1B2WH 4MS8C 3PGFH 1RZJH 4P2YA 1ZA3A 5IEKA 2ADFH 4P46D 1UA6H 2JJSA 2JLLA 4LLYA 4NWUL 3LB6D 2XNAA 3VXNA 2E9WA 3B9KD 4IMLB 4HKJA 1FZOA 1EJOH 3QRGL 3OZ9L 4QRRA 2EKSA 5JBFA 3O8XA 1IGML 2Z1KA 3TTQA 1FG9C 4WI6A 1ULVA 5I2IA 4JY4B 5LGJB 2HFEB 4UB0H 1UD3A 3CFCL 3GRWA 3EGSA 2G8ZA 4PIRF 1OQOA 1FORH 3TC9A 3BAXA 2FIKA 4OF7A 3UC0H 5KSVA 1FZOB 5JW4M 4DUWA 5M7QA 1QHPA 4PBVC 3VWJA 3HAEG 3GFUA 4M7LL 5E5UB 3SDXA 1X5XA 5A2LH 4E41A 1PKOA 1N6VA 3O6LH 1JNEA 4ZTOH 3BZFB 1NGZA 3BRDA 4MXQC 1CN4A 4WUKL 1E5NA 2M8XA 5GHWL 4ENED 1GH7A 4TTDC 4D8PB 5D70L 3EYVB 2NXYB 4OZIB 2EEDA 3DYPA 3A67H 5I75B 1G1YA 4MQSB 2Y24A 5MP6L 3AU1B 3GSXA 3BCDA 4OCRH 1YNTB 1EVTC 4C7DA 1I3GL 5I9QB 5DMKB 5EOTA 1TVHA 1FNFA 1IGIH 3SJVA 1PBGA 5C86A 2A3EA 2EXYD 1YEKH 2WVSA 1BQHA 5HDRA 4F9JA 1QSED 1C12B 1JGVH 3T2PA 2XFYA 2Q87A 1UQZA 1EXUA 4PRBA 3EYOA 1JI1A 1PZ5A 2NTFA 1R3JB 5ID0A 3B9EA 1YQVL 4ZXLA 3ET9F 4P23A 3CLFH 1RULH 3BC9A 5L2KE 1OGAE 3MOBH 4DKFH 4PJIA 3ES6B 4OUUB 5T1KD 5EU5B 4UTAH 4C83B 3RPIA 2J7LA 4NXKA 3MO1B 5JHLH 4ODUA 2J7FA 3KJ6H 5JUEH 1IKNC 2IH3A 4UDUA 5D1ZB 1JG9A 3R06B 1UR8A 3H3PL 3MRHB 1FYTB 1P7QA 4KRTA 1RK0B 3OKDA 3JV4A 5BROA 3GMQA 2WMHA 2UY5A 3ARGC 2EKSB 3EHBC 4B50A 3MBEB 4N5ED 4Y4HD 3LEVL 4WFHE 3V0AC 1M4KA 2EDLA 4TUFA 2B4CH 5KW9H 2ZXDA 1HKKA 2APWA 1T0NB 2R15A 2DWDA 2R56L 4X9IA 3L3IB 2WMPA 2Z31C 3HR6A 1MREH 1NCAL 2FEEI 1KYOJ 4X8JA 5I18H 5K9KB 5L9DL 1YYLL 2OTUB 1VENA 5IMOA 2OR7A 1F58H 4XTRC 3C5ZD 3CUPA 5FUOH 1Z5LB 5E2UH 3H8NA 4PP2B 4PMDA 1I3VA 5TH2B 1OP3K 3CLEL 4S0TD 1MYRA 2WKLA 1RZGA 5J1AB 2VQ1B 1IQDA 1VCAA 1V3JA 1HTYA 5D72H 1CK0H 1T5WA 4H8HA 2CKBH 2ZXBA 1HK6A 3DURA 1A7OL 5TQ2L 2W0FA 3HC0A 2B31A 1ZMYA 1R5IB 4OIIL 4JFZH 4HIEB 2XQBH 3MJ8B 4FQ1L 5FHAL 3SEPA 5C09A 1D5IL 1E4XL 1EJ6A 2DSKA 5C07D 3V5DB 4KMLB 4MJID 5I19L 5IFAL 3D69B 3ZIZA 3FN3A 2PI6A 5DD3H 5I73C 2UV3A 4KJPC 4LLMA 1T89A 1M71A 2XWBB 4C58B 3E1F1 3C5ZC 4OD3H 5E6ID 3ZT7A 2BRRH 4NQUA 3LPOA 3K81A 3GNOA 1K6QL 3GBML 4L4TE 3LHPL 1NQBA 1SEQH 3RIFF 1FH5H 1C7TA 3NDYA 3FRPA 43C9A 4O02L 5F9OH 4KJYB 1BZ7A 4PREA 2BMKA 3DROB 5CKAA 4ZAKC 1VFBA 5DJ6A 4N5EC 1OTSC 5C7XH 1A6AA 3POHA 3MRDB 1Q1JL 5TQ0H 4OTXH 2WMIB 5B21A 1N4XH 4G8GE 1P9MC 4KQ3L 4PRNB 3KJ4C 5FF6B 2X4OA 4D9LH 3H0TA 1TJGL 5D1ZC 5DUBA 2O9TA 3MREA 2IFFL 2J7CA 1FRGH 2E9IA 2LFGA 2L7JA 5HYSA 1WPCA 1OINA 4BSVB 2Y2WA 3OGCA 1FH9A 4UQEA 4WV1A 3PWVB 4R97B 4J1UA 5SWSA 2XVPA 4L29A 3MGOA 2XRAH 2XPGB 1MEXH 1FNSH 3A6OA 4GMTH 1UVQA 4PGCB 3KS0H 2Z91A 2GJZA 3S35L 1A14L 1TG7A 4WHYG 4AD2A 3L3DA 3VDAA 3HG1A 2O5XH 2ZG3A 4N0FB 1S7UA 5DMGC 3DX7A 3ZLQC 2VR5A 2JK5A 3E0GA 5IB5A 5D93B 2VJXA 2DQTH 1N5AA 2HRPL 5GNXA 4UT6H 3AIEA 2HFFA 4X6DF 4APQA 1FH5L 4WY7H 4XMPL 4ZS7L 3BH9A 4GG8A 3PL6B 5FGCE 3SBWC 2YXMA 4UAOC 4X6BA 2VUYA 5J56B 2FRGP 2A6JB 5I8CB 3WQ5A 1GONA 2NXZC 4S3JA 5J6GA 1ZT1A 2CKRA 1A6ZB 1HJWA 1U92B 4JFDA 1S46A 3ULVE 3UTOA 1H8OA 2BY1A 2VISA 2VXQH 3RTQB 2A73B 5M17A 4JHZA 3EO0B 2Q8XA 3GXTA 1BQUA 1A9BA 4RMVA 3UX9B 3QSKB 4FZEH 4X4MA 3EBVA 5GS0D 4ACYA 1QP1A 4K71B 3HUJA 3U4BL 3V6BR 2DJSA 4G80B 3FT3B 4G6AD 4GBXD 1OTUC 3ZHKA 3AM8C 4V2CB 1AP2B 1DEDA 1S7WB 2P4AB 4Y5VB 3MU7A 4W4OA 2SEBB 2M2DA 2GVYA 3BKYL 1JTTA 3VIFA 2Q7NA 2N56A 3MNVB 4WHTA 5EO0A 3RUGF 4H1LA 4HHAB 1BIIA 5TE7L 4P2QA 4APQB 3RWFB 4XMPH 5D9MA 4UV4H 5CUSH 2VSDA 1NFDA 3IJYB 3VRLE 1GHRA 2CLZA 2BRRL 4OFYA 2EKJA 4J3UA 1GXEA 3O11A 3B9DA 2EDFA 2F54D 1QR1B 3GXNA 4HKZB 4PV9A 5C07E 2P5WD 3P9MA 3SGJC 1KBKA 4G5ZL 3HFML 1OGSA 3MANA 4JFDE 5HHNB 4FTVE 3DRTB 3VA2C 2V3EA 4QLKA 1HKLH 1MXGA 1BM3H 1ZLUK 3HMWL 3SDDB 1TJIH 3A6BH 4R8WL 5CSBA 4GQQA 4QHNB 1UCTA 2PXYD 4UFJA 1CFQA 1HSBA 1FV1B 2ZCKL 5I78A 5BS0B 5MEPB 1QLFA 2AJZB 4HXBH 3GNPA 3KXFD 5FHBL 5BV7H 5I1EL 2BOBA 3Q3GB 2BDNL 1NCCH 3PQYE 4H26A 3RJDA 2WCSA 4BQCA 4JHWH 3SDCB 3WD0A 4MWFB 3QG6B 3O4LB 3JWOH 4KJWD 5J11C 3F5JA 4XCCH 1V0MA 5A6BA 5J6HA 1FP5A 1XF1A 3O4LA 2NY2C 4NN7C 4AY1A 3QHZL 4FHBD 2GK0B 1QFWM 1BLNA 1UCBL 2DM7A 1G9NL 2YPVH 4O4YL 4P2RB 4PREB 3WYRA 5EU6E 3KL5A 4U5IA 2OX5A 2EDOA 4OJFL 4WU5B 3IFLL 1U36A 2DL9A 1JN6B 2EDRA 3ARBA 1OGTA 1FNGA 2CBVA 5T3ZL 1XCTB 2QADB 3U0TA 2YDRA 3BHBA 2IGTA 1HZHH 1T2JA 5IVXB 5FOOA 5H8DA 4M61B 5IBUB 3QDHA 3T09A 4MNGB 3PGCB 1FAIH 1NBZB 4DGYL 1JD7A 5ABDE 5AZEL 3QFDA 4NOBA 2X5PA 4TSAL 4F7CB 3N1PC 2YUZA 5GGTH 4W70A 3P4MB 4NZRH 1UYWH 4P23C 2W61A 4HIIB 4NSBA 4R0LB 2MCG1 4M81A 3RX7A 3KPPA 3VG9C 4N9GA 4LDLB 4PJ5B 3KPTA 4UINL 4P2QB 1WZKA 2FX9L 2CO6B 2H3NA 4FXLA 5IJKA 4X80H 4ZUWB 1H1NA 3EHBD 1T7ZA 1Z5LA 4WW2A 4JFFE 4X80L 3Q5OA 3C6LA 4H8WC 3KNBB 4Z95H 1YMMD 3RU8L 5TF0A 3B2UC 3LKOA 2GJXA 3RL1A 4JHWL 4LRIA 2DD8H 3HE7A 1MLBB 2DWDB 2DM2A 4G8FB 2OI9B 3WFZA 4NF7A 1G7JB 4L3CA 1I9RH 4X5XA 5IF0B 1D5BB 1R3IH 2FZ3A 5GGSB 5C0BD 5F1IA 3VRJB 5E0FA 3O6FB 2GJJA 2ZCKH 5KSAA 4DGYH 5B39B 3RAJH 1DWIM 4JG1H 4TSBH 1VSCA 2P5EE 5IW6B 3VINA 5A3HA 1ZHNA 5GSRB 4UDTB 4TYUA 3IJHA 4PGBA 2Z9TA 5B22A 1S7TA 4ZUTB 1OPGH 4Y1AD 5ISZD 2V3FA 1E4WH 3WHE0 3GB7A 1YDPA 3BLBA 4U1MB 4NQVB 3OKLB 5DRWB 4RGNE 25C8H 2BNQE 2DQCL 1CD9B 4HUKB 4W87A 4JO4H 5L8KB 5DF0A 4KZDL 1U8OA 3ARSA 4OZHF 4GZEA 4OUOA 1EXUB 4PRBB 3S88H 2R1WA 3FW6A 3QISA 5JORB 2IAMA 1P7KB 1ROWA 5D7LD 4RNRB 5GZNC 4PTTA 5JQHC 4AEHL 3MV9D 3R8BB 1RZKL 4LSVH 4Q9RL 3B2VH 3NPSC 1TQTA 2IXVA 4NM4H 3EYSH 3RJXA 5KSBE 2VURA 2R1XB 2W65B 4D6IA 1WAAA 5FYLE 3A5VA 3RKDC 2WUBH 5KVDL 1UB5A 3MOAH 1HNYA 4JN1H 2QHRH 2IWGA 4B3LA 4K7PY 4HPGA 1C93A 4DUVA 4HZ8A 4TVCA 5KVGL 1A7RL 1S9WA 3H7LA 4ZFGH 3CVIH 4NC1E 5MEOA 1LO5B 1HXMA 2OS7A 3QZWG 1TDQA 4NO0D 5MEQA 4NZFA 4W85A 4OLXH 2J7GA 4XZBA 3NYDA 1T04B 1KIRB 2YL9A 5AYQA 4EUPA 5IB2A 5E56A 3N1QC 3L95B 4D6CA 4M1GH 4LSTH 4ZAKB 3GI8H 2R2BA 5LGKA 3OHXA 1TETH 4YDJA 5F89A 1PJ9A 3U9UB 1VFAA 5JW4Q 1OM3H 4FTVA 1I8MA 2VLKE 4JQXC 4YXHL 3VXTA 3IFNL 3H3BC 4EJ1C 1J1PL 3D2UA 4ONOA 3KPSE 1MF2L 3LKQB 3O2LA 1CU4H 1P2CB 3OXSA 5JO5B 2CIKB 3C8KB 1FCGA 1IGYB 3EJZD 3MXWH 5GJSL 3H9SA 3HJEA 4XP4L 3FKUS 1NM9A 4O2FB 5F9JB 1Q9WB 4DFHA 4HUXB 5FYKL 5IVZA 3FQUB 1INQA 1BEYL 3NGBB 4C4KO 1OAXH 1MFEH 1NGWA 1JPFB 4KKAD 4KUZH 2C1OB 4ZUUA 4L8SB 3A23A 3CV5A 3D4ZA 2F18A 3WSQH 2QSQA 3NIYA 1A3HA 1U8NA 3MPCA 4E4PA 5C7XL 2E6QA 1HSAB 1FPTL 4CN6A 3R1GL 4LNRA 1YY9C 5DJXA 2FECI 4JDTL 1IM3B 2MKWA 1RURH 3QEUA 1MCCA 3D0VA 1PZ2A 3OHXB 1OLLA 1FFRA 1RH9A 3EJYC 5IBLC 3AM8A 5E2VH 4IOIB 4Q6IC 4YHMH 2VAAA 3HZMA 2BNQB 2VLKA 2CLVB 5EA0L 1CDYA 4RGNB 3OWEA 1AJ7H 1I8IB 4OZ4A 1PG7L 4KKBD 2EYTB 3VH8A 1H3PL 2F54A 4XAKE 4J12A 3CMOL 1D6VL 2A6DB 3TBWB 5MEQB 5FM5M 4ZOAA 4KKAC 3VMPA 4GAGH 5F9AC 3BQUA 3HI6L 5GSVB 5A40E 2HT2C 4K7PH 5MEOB 3L3OB 3LN4A 2DIBA 1I9IL 4LKXA 4YO0A 2DLIA 3ALPA 1JWMB 2XWJA 3QQ9D 3MV7D 1VEPA 4FXGB 4YAQA 1F4XH 2AP2A 1LL4A 2K7PA 4NQCE 5DUMH 4Q9BA 2JF7A 1FVDA 1CT8A 4N1EA 1E6JH 4NQED 2XJ7A 3MBXL 4EN3A 3BD5A 3UCRA 4F80A 3QG7L 1YMME 5EZJB 3I9GH 1HXKA 4O2CA 4K9EC 5DMKA 2YD9A 2DMKA 1QSFD 1DR9A 2DLTA 3EO9L 1NC2B 1D5ZA 1OB1B 2EDJA 4BQ4A 2XVNA 3WLWD 3QO1A 2JEPA 2F5AL 5LAXA 4Q9QL 2XN1A 3AHXA 4CD7A 3DV6A 4AIUA 5CINH 4YGAB 1GOHA 2AI0L 4U33A 3WMBA 4GZJA 2VXTL 5I1KH 4PTVA 3EJSA 3EMCA 4ETYA 4BSJA 2VR9A 1KN4H 1X5KA 3ZKND 2HKHL 3QUKA 4EOWH 1UADC 2F53A 5F6HI 3H9SB 2VRKA 3AMCA 2WANA 1YUHB 1FHGA 2HLFD 1RP9A 1E6SM 1UWTA 5C0DB 2WC3A 1JHKH 1H0IA 3VFGL 2NY1C 4L4VB 1F6FB 2EDWA 3GMOA 4XNMA 3U9UA 1I8MB 4ZEPA 4IPLA 3AS1A 4PJ7B 3PZIA 4M29A 3TT3H 3RX5A 1NANH 4C55A 5I24A 1NGXA 1CICB 1CD1B 1V03A 3O3EB 4TVPL 5ADOH 1CNVA 3QULA 1YYML 5B39A 1XR9B 4OF0A 3UBXI 5CG0A 4IRSA 1M05B 4U1KA 1J1PH 2YD2A 5A6JA 3KLDA 1WDSA 3VUPA 5SWQA 2OP4H 3O45B 3U2SB 2CGRH 2OCFD 1TZIB 4G8FA 1WCGA 3BO8A 4DJMA 1QPKA 1BG4A 3NCYS 2C5DC 35C8H 3HZKA 2N7BA 2FO1A 4JFYA 2O5ZL 1CICC 3HE6A 1BOGA 5DWUL 1YEHH 2FX7L 2EH8H 3T0VA 1D5MA 3SE9H 1OTTC 1KFAL 4HA1A 4UAOB 5DEGB 3QHOA 1T0MB 2BHYA 4YNYB 3H3KA 3LKRB 1I85A 5A6SA 4MNQE 1DVFC 3FFCA 3VWJD 2R29L 2FDBP 4OCSL 2HKFL 4E41D 1W0WA 4GLRI 5D4YA 1DQMH 4BM7A 4IRZL 3IJSA 5GS3A 5D1XB 3PP3K 4HK3N 3TM6A 3BP7B 5KTEH 2WVVA 2VLMD 4D0CA 2X1PA 1J8HD 5CWSA 4RGOL 1IE5A 4G6KL 1J0HA 2XQYG 2YFNA 2KZWA 2CMRL 2J77A 5A2CA 4KRMB 1KB9K 4LBEB 4LSDA 3QDAA 2D3VA 2I60L 3L5WB 4Z0BL 3VFUB 4PMZA 5DJAA 3W0WB 1YDPB 4X4ME 1MCQA 4PRWA 2MQ0A 2RFXB 3HNTH 3SDAC 1PAMA 5F44A 3BZEB 4K9EL 2JJUA 5IHUL 3MRMB 1DLHB 1P5VA 1NDGB 2UY2A 5J06A 1GGUA 1OCQA 4EANA 1Y18B 4PJHE 3GKWL 2OTPA 5EU6A 4GQ9L 1KCLA 2AJYL 3DMMB 1W72H 3QUYD 4X7EC 1JF6A 1RZ8B 3O6LL 4QTIL 2NY4D 1RIHL 3ALGA 2FWOB 3OKEA 1OPGL 1YEFH 2DDXA 5AWNH 4IRZH 2EDXA 4RGMB 4M00A 1ORSA 4F9LA 3CH1B 1H2JA 4PV8A 1UWUA 3OG2A 3IK2A 2V7NA 1AH1A 4NUGH 3P0YH 5FDWA 3NN8A 1YQVH 3H42H 3IDIA 5L7XH 3GMRB 2WKGA 1N3NA 2H2SC 4ZUWA 1OGGA 3P40A 5IM7A 4JFEB 4M82A 3GI9H 4NO0A 1YEHL 1V0KA 3EJYD 1Q0YH 3QQNA 4FRWA 4OUEA 1Q9OB 1JGDA 3WELA 2VL5B 1OD7A 4B3KA 4N68A 4LCIL 1ADQH 5IG7B 3HHRB 4DAGL 5HHQA 4HCRL 1HYSD 2OP4L 3CDGA 3PABA 3FONA 5FUCE 4UOQA 1UR4A 3OJDA 4OD1H 3ARFD 3LQMA 4WUUD 4M9PA 1CECA 4PRAA 1NBZA 3L2MA 1BJ8A 4MQ7B 3V5HB 2PW2B 5IK3A 2NTSP 3ROOB 1DVFA 3U7YL 2Q6WA 4IRJD 1M03A 5GISL 2DQGH 2OZ4H 3W39B 2D9QB 3HUJB 3HG3A 3BPNC 5E8PB 1FNGB 1CVRA 3ARBB 1ND0B 5GS0H 4OZHA 1BYAA 3FOLA 5F7LB 4M7ZC 2X4TB 2ZNXA 2BSTA 3MNZB 3F5KA 4M4RA 5E00A 1EMTL 2IQAB 4P5TB 3M8OL 4PYHA 1RZ8A 4PJBA 1JAEA 5T1LA 4OFYD 3D0LA 5EZIH 3VFNA 5HJ3A 4LLQA 4P23D 4D6GA 4QNPF 1AKJD 4PJHF 4YDIL 5C0IA 1JGUH 4MDJA 1KTLB 4Z5RA 1EEZA 2XTLA 1IM9A 2BC4B 5KN5B 1U95A 1J8KA 4IDJH 5SWSD 1CXHA 4G3YL 4BQ5A 3OZ9H 5JUVA 1W3LA 3VU2A 1K85A 4NBYB 5DQJB 1NCWH 3NACH 1MQPA 2X1QA 1UH4A 1CFQB 2XXMB 3TPUB 2OLDA 1A7PH 3GMMB 1A7NH 3PP4L 4X5WB 2IPKB 5EOCH 1JZ7A 1FO0A 2VZTA 3VXSD 2XZCH 4ONHA 2GK2A 4GSDH 4KTYA 1TQVA 4W89A 5M03A 4C7FA 4XVUD 5JW3L 3O2WL 1N6QH 2QMKA 3ABZA 4P2CG 4EI5A 1UVQB 5I71C 2D2OA 5HDBF 4UTBL 3TN0A 4Z2HA 2DQUH 2V2WB 4PRDA 3CK0L 1KPVB 5FECB 4AEEA 2WM0A 1BPVA 3G6JE 2B0SH 2F5BL 5J3HC 2Q8BH 4EZMA 1EH9A 5C0FA 3N1AA 1DWAM 4B53A 1EGJL 1KPRA 2HLFC 4S1RH 2IF7A 3P4LA 5FOBA 5DEGA 1S7XA 1E4KC 2D7MA 4NDMB 4KKLD 1E6RA 1AP2A 3I6GA 2VDMH 4NKQB 1RD6A 3WD3A 3FT3A 3GSNB 4MA7L 1Y6MR 3EJPA 2KUTA 4XVUC 1V6VA 1J8HA 1FZJB 5C9JB 1KBGL 2AKRB 4HWBL 3O41A 1TQSA 3H53A 2CKBA 1RUQH 4FQQA 3CVIL 3QPXH 1M71B 3VGBA 3W39A 3CVHL 3U7VA 3MKKA 1VPOH 4E0RA 5J12C 2F53D 5FK9B 2WP3O 4RA3A 3O6FC 3V5DA 4X9HA 4WTWA 1T66D 4WKHA 4KDTA 4OBSA 1FBIL 3SKMB 2VLJB 1I7UA 1OGAD 2XZCL 1R5IA 1T0PB 2YSSB 3MUJA 5F7MC 3WF1A 1H4PA 1I9JH 1ADQL 1ES0B 2FH6A 5HYSG 3BN3B 5AY7A 4JDZA 3QDJB 5L2KB 3D39D 1KENH 3SCMA 5F1OB 7CGTA 1DBKL 4HW6A 1NP2A 3EJUA 4HV8A 3KPSD 4Y2DC 5DQ9A 2XN9B 4NO0B 1JNNH 4RE4A 3CZKA 3QHTC 4EDWL 2D3LA 1NQ6A 2ITDA 3I6KA 4NI3A 4I48A 4AD0A 1U3YA 1Y0LA 4U0RC 1WT5C 3RBGA 3VXPB 2Z8RA 3M45A 1RHHB 2J6EH 4KV5E 1HILB 3TVMA 1AO7B 3PV6B 3VFOB 2OL3A 4OM1H 2BX5A 5SWSB 5FD0A 3G08B 3HMXA 1CLYL 1N5YL 2VDKL 5F88A 3SQOH 5AWNL 2C3VB 2VVNA 4LGRB 4OCNC 3OJVC 1NWRA 1W72L 2O9PA 2UWFA 2V38A 4JL1A 3IDJB 2V5MA 3T0BA 1NP0A 3HCVB 3BVTA 5I1LA 1BWWA 1JDDA 3C8DA 1ACYH 5HI4C 1HL8A 4Q2ZB 4FABH 1NAKL 1KTBA 4RMTA 5B4MC 5BO1L 4PB9H 3FFCE 1T3FA 3SCNA 2XFRA 5FO7B 3FRUB 3DUSB 2AQ3A 1KR1A 2UUDH 2IG2H 3BKJH 2E40A 2NY3B 4XMLH 2DD8L 3B5TA 1NOUA 2C3WA 3T0WA 3K7UA 3W9EB 1S78C 1OWWA 7FABL 2EE9A 2C7UB 1FGVL 3KPRE 4A3HA 2A83B 1ED3B 3B9AA 1QBBA 4JVPA 3TYFA 3KPRD 1LP9B 1NCTA 4HIEA 2O92A 5CJ5A 4YBLB 4RRPG 2P24B 5D4QA 1JFQL 5EUOE 4X6EA 4LQFL 4HQQL 4LKCA 1L9MA 2VC2H 3N13A 4OCSH 2DT1A 5CD3A 4MXWH 4O5LL 4X0NA 5IW3A 2RR3A 2PUQT 3FFCB 3L6FA 2H2SD 4K7FB 1HINL 5CAYB 4JZNA 4NWTL 5KSAD 5CGYC 2JELH 4QHKI 3AB0C 4PP2A 3L3JB 4G43A 4UFKA 4WTXA 3LRMA 1QVOA 1JZ8A 1D5MB 1F11B 4NO2B 2OJZH 5IMOB 4PJ9D 4PJCE 3TEUA 1YC8A 1NMAH 1KB5L 5HHMD 1FJ1A 4N0UA 3AREB 3MXVL 2QV2A 3GHBH 1I9RL 2R2CA 5DVMA 2D7TL 5SWQB 1MQKH 5JXAH 1WAWA 1ADQA 1H0DB 5F89B 1U8PB 2EC8A 3WUWB 2ZCLH 4QRTB 1FC1A 3B9KC 1U8IB 4RFNC 4LF3B 3ELAT 3EGSB 1HIML 3RIAF 3S37L 4J3TA 4TTDD 4KK8C 4X99A 5DJ8A 4NJ9H 2XOTA 4JRYA 3L4TA 1FLRH 1D6EB 2V9QA 2IH3B 1DN0A 3MLZL 3VFGH 2VLJE 1BECA 4ZXBD 4XWGH 1FL3A 3QI9B 3KYOA 3RTQC 2NY0C 1TCRA 5ID1A 4MX7A 3DSFL 1EA9C 3QEQB 3N18A 1OAZH 2QQQA 3A0OA 2NW3A 1KLUA 2VUOA 4JRXD 3MV9A 4NO2A 2HVJA 2JELL 3IFPB 3MLWH 3UYRL 1ETZB 3NDZA 4HGMA 3VNYA 4V1DB 3PZQA 1UB5B 4H2CA 1YNLL 2WMFA 2QKIA 3KPOB 4NRYA 3X3FL 3MA7B 4MD4B 5KSAC 1GZQB 3HNTL 1R5WA 3LKNB 1YPZE 2C3GA 3N85L 1TVHB 4WVRA 3QQ3A 1P4BH 4X0KA 2W60A 5J1SC 3GXDA 2DJUA 1WIOA 3GZKA 4RISH 3MLPA 4GG6A 1A3RL 3GH5A 4E42A 4N0YL 5ILTL 1CTOA 4OJFH 5C0CA 2BVOA 1EAPB 2AJSL 3UEZA 4EEEA 3GJEB 1L7TL 1I8LA 3CPLB 3RUGA 3UG5A 1B1YA 3MV9B 3OLGA 5DJYB 3T4AB 1ODUA 1LEKA 5FOJA 1M7IA 3G6JB 4LU5L 4KKLC 3G6DL 1G1CA 4ZS6C 2VL4A 1QSZA 4XPHH 2OJZL 1MCFA 4MAVA 1TQCC 3CPUA 3HZ3A 5IMKA 3LSOA 2VMFA 3IJHB 4ERSH 4CD4A 4JRYB 5EU3B 1C8YA 1I8IA 4KPHH 4OZ4B 1EV2E 2A0LD 3MCKB 4ZFFB 3SUUA 3RZCA 4MJ5B 1KN4L 3MLTA 3T77A 1ZAGA 5A2AA 3CZNA 4NFBA 4YC2B 4C56D 2PW1B 1MFCL 5C2BH 1SJEB 2W07A 3BN9C 2DQHH 5GGSA 4XZUB 1PGRB 4GXPA 1ZOXA 5JOPD 4JM2B 5HHMB 3UC0L 1PLGL 3EO9H 3S8WA 3P9LB 1OIFA 2WVTA 2KQNA 2E7BA 3QHFL 2VXSL 1U8NB 4JFTA 2I9TA 4UQ2A 1UWXH 3HTLX 3KNBA 3RI5K 3F5WB 4XC3H 1U93B 2KPNA 4Z7WB 1KELL 4KK9C 4BK4A 3B8YA 4X98B 2IG2L 3BKJL 5JOEA 4NWUH 5EO1A 5I1EH 3BAEL 1A3LL 3NCEB 1R33A 2Y25A 4K7FA 3TZVA 1UR1A 4X6DB 2CIKA 4HS6A 5I66A 4ZXBB 3LH2H 3W24A 1L7IL 5E1AB 2D24A 2DB8A 5HHOE 1JYNA 3VXRE 2ZX9A 4OGZA 3MRIB 4JRXB 5C0AD 2YEZB 4I3SH 3LKSA 2WIIA 2EACA 5HVHB 2RGLA 4Q9QH 3D48R 2O9OA 4WUUE 4GJTB 5F70A 2CLRB 1VFUA 3S96A 3AZRA 1KIRA 2A0LC 2XZAH 3Q6GH 5KANI 3ARDA 3D52A 5T1MB 4CCDA 4D94A 3QXWA 1MW3A 1DN2A 5TDNB 1DBML 1P6WA 4FNQA 1NOWA 4JFEE 5FO7A 1LK2B 5C3TA 2DQDH 1GOGA 5DD1H 3GH4A 4G6MH 3JUGA 2BERA 5CBEA 4XPAH 1RIUH 4Q2ZA 3DO3A 5ADPL 4W4OC 1WBXB 2FJFB 4TX8A 3WFBL 4NIKB 1KPRB 4E5XA 1QLFB 2AJXL 2AJZA 1NSNL 4JFWA 2GI7A 5KANG 4WI7A 3H54A 1IILE 1MCNA 5L2JB 3MRGA 1A5FH 1WWBX 2PWEA 1BTCA 5DI8A 3ILPA 1LQ0A 2MSPA 3PWLA 1MJ7H 2O61B 2F54E 5HVFB 5C0CE 2VWEE 3A24A 1CS6A 1R0AL 2FD6H 4R4FH 5KJRL 3OPZH 2ITDB 1FVCB 4Z6AT 1EHXA 3CX5J 5CEZE 4AMKL 5D96C 1FZMB 3D2UD 4FFWC 4GKNB 1AC0A 5DMIL 3CHDA 1IGJB 4YGVA 4EIGB 4QCFA 3GXFA 1T5XB 2P8MB 3HS0B 4JM2D 1MREL 1ZA6B 2DJ4A 1IKFL 4Z7NF 1V7NH 3VRIA 1X5FA 3ALXA 3QQ4A 1U3HC 3W9DA 4NKIL 3VX1A 1FNAA 5BMFL 4KUZL 2OL3H 4PFEA 2NXYC 3RGVA 3BUBA 2HLAB 3AAZB 5EO0B 4KHXH 2X2JA 4D0DB 4W6XB 4I0KA 4Z5RB 1GJIA 1OVZA 4U1IA 1KTLA 3REWB 4F7EA 4GRLD 2EAEA 5GQBA 2EH7H 1FFPA 1CIUA 3ARTA 2P7TA 1DQDL 5IV2B 4PJBB 2F74A 2W62A 2Y06H 1BVLA 1NL0L 1CZ8L 1AQKL 1E28B 1Z2KA 5FUZH 4XP5H 4WWKC 4LSPH 5HY9B 1NLDH 4U4BA 1E28A 4LARL 3IVKA 1K9EA 1XIWB 4Y88A 1C8PA 3LS5H 4QRQB 1GOOA 1HYSC 4YLQT 4QOKE 1FL3B 3QI9A 3DPBA 4G8EA 4Y5YB 5DD1L 5I1GH 4R90H 3MJ9A 4LIQE 4GG6E 5LGHH 3BZ4B 2VCCA 1NFIB 1K4DA 3RM8A 3MBEC 1YEDA 3LHPH 1E9LA 5F72S 4GW4A 4AEIH 3W9DB 1KGWA 3IXTB 5DK2A 1PD6A 3UTZB 4OCRL 3RNKA 1ZANH 3TO4B 4OV5B 1Z9MA 3OG4B 1WEJH 5KVGH 3C9NA 4JFFA 2BNRA 2EEXA 2OR9H 2F19H 3UZEA 4HUMB 2FGWL 1RAMA 4YHGA 2HRLA 5T1LD 4K3DL 4L29B 3JZ7A 5IOPB 1K2DB 2EE2A 3S36X 3BUYA 5KZ6A 1TZHB 3EFFB 5DO2C 5E99L 5C0RH 1NUGA 5HYSB 5D72L 4MNHA 3MCLL 4JHOA 1VADA 4WFFD 5JR1H 3O9WD 1C1EH 1UACL 3KYKH 2X9XA 2R4RL 1JXJA 1ZKAA 3U48A 5JDJA 1BFTA 4J23A 2E5EA 3VFNB 4JFQA 4NN5B 1X7QA 4FFYL 4KQ4L 4PJ8C 1YJDH 4QXUH 1TZGL 1TJHH 3N9GH 2H41A 5CXPA 2ESVA 1Q72L 4YDVB 3A6CH 3C6LD 5HGAB 1YEKL 1MWAH 1RJZB 1AO7D 1NLBL 3GSQA 2C7UA 4WEBL 4YHYC 4DEPC 4PY8J 3SDYL 1J7VR 5I9QC 1BAFH 1EERB 2XIBA 1U41A 1PYWA 5GS2D 3P0YL 1E6OL 3O3AA 3MV7E 4ERSL 3TJEH 5FYKD 3SDDD 4AZHA 3S4SA 4HOXA 4TRPL 1VACA 2FGZA 2WVVB 1WEJL 4Z77A 5D6DC 1QFOA 2FL5B 2WNGA 1YQ2A 4NZJA 5HHQB 2XZQH 4DWSD 4YE4L 3UTZA 2X4RB 4EE9A 1ONQB 3TH4T 5EBWB 1Q9OA 3LN5A 5A6BD 2Y4SA 4FNTA 1CLOH 5FA3A 3BUTA 3EDFA 1RUKH 2YC1B 3HI5L 4M6NH 4AT6B 1T0MA 2NY6D 5DO2D 2Z8VC 5GS1B 2NR6C 3C87A 3CUPB 4I5BA 3GMNA 4U3CA 3LXAA 1X44A 3QNZA 4XX1G 4QRQA 3ZJ6A 3BWAA 3WNOA 1RMFL 4PLNC 4CVZA 1BAGA 2DL2A 2QADD 2YC1A 3OLEA 2P44B 5BVJB 3Q5YA 1LO2H 4R2GB 3ULUE 2XTJE 5I74C 4K8RH 5DDHA 1TMCB 2P7TB 3UJIH 1S9VA 5J89A 4ZD3L 5ENWA 1ZT1B 4EKJA 2NXZD 4IHOA 3OXRA 1KULA 1DLHA 4PRHD 3VI3E 4GKZB 4TSCL 4UDUB 3SQOL 1LGVA 5ABFA 4S3KA 3SDAB 4L4VA 2BVDA 1NDMA 2AXHA 1CD0A 3VE0A 4PJ5D 3RWGB 4ODWB 3JVGA 4Z8FH 3WF2A 5MENE 2O5ZH 4OCWL 1CL7H 3RHWF 3T4AA 4P23B 4QRPB 4MJ4A 3T1WA 4CBPA 1H49A 3K46A 1IGMH 1BQHG 1NCBH 3I50L 4I77H 4AM0B 3TA3D 1XF5A 1DJSA 4LCCA 5KS9B 1G9MH 1NBVL 4MB1A 3OGSA 5BV7L 1ZBVA 4U6YA 3I6GB 3VD3A 1DSFH 2Y9RT 3MACH 3RZWA 4PSRA 4WV1B 1C8XA 2PB1A 5HHME 1XSKA 2W0PA 5L2JA 2OJEB 1CLZH 2QL1A 3RBSA 1INEH 3QCUL 5FOBB 4ZE4A 1ZEAL 3KYKL 5DD5H 5CEXB 2FBOJ 1IV8A 1K4CA 5FKAB 1D9KC 4H0HB 3RO8A 3QUYC 4PRIA 3QI9D 3HMCA 2GKIA 5CJQL 4Y5YC 2OSLB 1K2DA 5FF6A 3RKDD 4BA0A 1UM5H 1N2RB 2WP3T 1W1PA 3WKML 4ZNCD 2I9LA 5KSBB 3NCOA 4W8BA 4JR9H 5D8ZA 4RAUA 4ZSOA 1VFBB 2B2XH 2Q8AH 4L8SC 1AQMA 1UWIA 1JV5B 1DBMH 1QPXA 5EIVA 5IMMA 2X9YA 3CBWA 1S7RB 2NZ9D 3TBWA 2FX8H 2ZOLB 1MNUL 4NYLB 4U1KB 2AQ1A 4F57L 4HWZB 2GHWB 3ZKSD 1XR9A 3MV9E 4EBQL 1T1WA 2Q3AA 4B9ZA 1HVXA 3MQIA 1VESA 2ZUXA 1NGXB 1RIVL 4JZOA 4LP4A 5K9OB 3W6MA 3X3GL 5ESQB 5IB3A 3BSHA 4RFNB 1X4ZA 1EGJH 4XPGL 1GHFL 4XNMB 3TCLB 1JPGB 4S1RL 3BMVA 1MEXL 1B88A 4Y5YA 2NXYD 3WD1A 1YPZB 5EO9A 1MCHA 2XVKA 5ESAA 4TUOB 3F62A 1NFKA 1TPXB 4HWBA 5HPMA 3FQNB 3GH7A 1DFBL 1P9MA 1I1AB 3KLAB 5CJQH 1UG9A 5EDXA 1Z0MA 1NGWB 1NLDL 4FA8A 1ZLWH 1GPOL 4TXEA 4EK7A 2LE9A 1NGYB 4FQHA 1W32A 4ENEC 5EOCL 1NARA 1JHTA 3PHAA 3QDMB 2D0FA 5C0ND 3WO4C 1Q0XH 8FABB 1RJLA 5AD0A 1JJUA 3MRKA 4S2SB 4KMTL 3BXWA 5D1QC 3REWA 4HAFA 3QHFH 3C8KA 5FYKU 2ZXQA 4OCYH 1NBVH 1G9ML 4G3YH 2ATPB 3KDMB 4Z2KA 5KSBF 3LPPA 3NAAH 4XXCA 1JPSH 1TQCB 3L5XL 1JPSL 4CADB 2WK2A 2XY1A 5T1KB 3UTTB 1E6XM 3DYMA 1UB6B 2JTDA 4U1NA 4XX6A 1CL7L 2CK2A 3BJLA 5MEND 2JB5L 5F3HA 3OV6A 2VQTA 4EDXB 4UV7H 4HWEL 3FO1A 4PJ5E 4F57H 1U8HA 3TNNA 5EFFA 3WEXB 1E6ZA 2FJHB 1FZMA 3CXDH 2YPLD 1CGSH 5C09D 4DTGL 2PO6D 1JDCA 5GS0L 1ZE3C 3S2CA 2ED7A 3TFKD 3CD4A 1DQQA 4PRPD 1AGDB 4NN6C 4WW2F 3O6ML 2OSWA 1OP3H 3BLKA 5HGHA 4NKOA 2WLZA 3FRPG 1MFNA 1G7LB 3N1GC 4UOZA 1EDGA 4LEXH 4PV8B 4KQ3H 3LPWA 4K94L 3W2DH 1AR1D 2NMSA 3C60C 2NTFB 4TNVF 3GJEA 4CKVX 4MZ2A 1ISVA 4YEFA 1US2A 3UO1H 3QWRD 5F9OL 4LLVA 2VE6B 5EU6B 3TZVC 1R3KB 5B38G 1I3GH 3FN9A 1GZPA 1OAYL 4GG6B 1EX0A 4CU6A 1A6VL 1RUMH 1BQCA 4QY8B 1YNTA 4YHLL 5MP6H 2DM4A 4QOKB 2W9DH 4L9LC 4FF5A 3VFOA 5K9JH 4WGWB 4P5MA 4RMUA 3QP3A 4JO3L 3WS6A 3AOFA 3O4LE 1T03H 4XCEB 1PG7W 1NGYA 2K9UA 4N90D 4WEUD 3QNYA 4F3FA 4D8PA 5IHBA 3PGDA 3G5ZA 3PQYD 2XUCA 4LHUB 4OF6A 2IQ9L 1WCBB 3BN9D 4TRPH 3CZFA 4KHTH 4D0CB 5JW4R 2VVSA 3M7SA 1CWVA 3ZYJA 4FTVB 5F7UA 2R2EB 4ZO8A 4W7WA 1XT5A 2B4CC 3RAJL 5DK2B 2WSKA 4GAJL 3L95A 4F15B 1G7QA 4U6XA 1U30A 3WBAA 2IADA 2P5WE 1PSKH 4NN6B 3WXWL 1NFIA 3A6CL 3UBXG 1QR4A 2FH8A 5T5NF 1AGFB 3MUY1 4HUWB 3QO0B 5JHDE 3NA4A 4APQD 3VFPA 1NCBL 2MMXA 3EOAB 1C7SA 1ZA3B 5IEKB 4G6KH 3I2CH 3OBAA 4JQIL 2BNUA 5LXGH 1ZSDB 1CPUA 1NFDF 1HHKB 4QRRE 1E0WA 1EO8L 1QI2A 5DSCB 4QHLA 3V7AE 1F13A 2Y1VA 3O3DA 1T1ZB 4HKXA 1QFWL 4QXTA 1FFPB 1EEUA 2R1XA 2XZQL 1G0YR 3AMKA 2H1PH 3Q2CA 3KPPB 3MOBL 4DKFL 3MLRH 1V3HA 2OXGA 1NH6A 4YHNB 2HLAA 3AAZA 1U8MB 1Z0NA 2Q20A 1DWFM 4JN1L 2AGJH 3PWPB 2XM1A 4NGHL 4A6YH 3GK8H 4AM0A 3H6JA 3RZCD 5DS8A 1I1FB 5A6KA 2DWEB 4H41A 4N5UA 4WW1A 1TNNA 5D9SA 1M7IB 1FYTD 4ONHB 4XB7A 1OARL 3G5ZB 2VI0A 2VCBA 5CS7A 5DK3A 4AEFA 5D2LF 5EC2B 1KTDA 3WHE1 3CPLA 5FDYA 5D7JD 4NQVA 4F3FB 4WSKA 2HT3C 3QI9C 3RWCB 3VJ6B 4JL2A 1MCIA 1XD1A 1FLTX 3FRUA 4ZFZA 4RWYL 1DANU 2NY0D 2V9RA 3DX0A 3M46A 2OWWA 1YY9D 4BFEA 4LEXL 4ODSH 3CMJA 4XCCL 1XH3A 5ICZA 2VAJA 3BVVA 5IW6A 1RHFA 3T65B 1DBBL 4XHJC 3DDFA 1A1MB 3MA7A 5I1LB 3WD2A 5DSCA 4HEME 5KEZA 4GW1A 5GGTL 2IALA 3LVEA 2NX5A 2HFGL 1NL0H 1JMXA 5FUCC 2HVJB 3IFPA 1UM4L 2CDFB 3PDOA 1C5DB 5E8PA 1CLVA 1QA9A 5CMAA 4ZQKB 3PTKA 4HMEA 1XGRA 3RL2A 2P43B 5GRVL 2GFBB 4I1NB 4CU7A 1ZBWA 1O5DT 1U8JB 3RM9A 3NSXA 4F79A 3P4OB 2X8RA 3DI2B 6A3HA 5C8JB 1ECEA 3CU1A 1US3A 4HV8B 3IFOA 4EDXA 3HRZA 4CAGA 1F00I 3W11D 3BX7C 3N15A 5CPSA 4UQAA 1LD9B 4JRXA 3WMSA 3VVGA 4J6RL 1MH5A 3SKJL 4EVNB 3AUVA 4IM4A 1ZT4A 2YFOA 1KC5L 3S4SB 3DVIA 4OLVH 2EPNA 5LA2A 4NC0B 3ZKMD 1MJ7L 2AERT 1ITCA 2JALA 1QVBA 3NZHL 4RAVB 4W8AA 2C1OA 4HFWA 3F7PC 1F11A 5C8BB 3REVB 4PGJA 1EUUA 3QNYB 3CMOH 3MUAA 4BH8B 1A6TA 1UQSA 4NT6B 2NY1B 3GRWL 3EO0A 1RFDL 3OKEB 5KAQG 3CFEB 2WBKA 5FM8A 1TENA 2ZX8A 3NFSH 4ZFOA 2CNCA 5F7EL 2NYYC 5K9JL 4OZFG 5F7FA 4YK4B 4G7YL 2Z0BA 1CXFA 32C2A 4LCWA 3KYNB 2WBGA 4AEIL 1OAYH 2BNRD 1A7QL 3AB0B 3TCLA 1VFAB 5ECJE 4GAYA 4WFGD 3BH9B 1XCQB 5CEZH 1U6AH 3ZOAA 1OY3B 4UOW1 1PY9A 3GSRA 3QHZH 3MR9A 4R90L 3VFUA 1E15A 1S9XB 1XF4B 3AS0A 4H1LH 4HLZG 1AR2A 3FB7A 1MWAB 3O2DL 3BVXA 1X4YA 1YY8B 1CLXA 2EBNA 2APXA 3MFFA 2JE8A 4LAQH 1A0QL 4JKLA 5DJDB 2MNUA 1R0AH 2PO6C 3OAUH 2DRUA 4FFVD 1QFPA 2VDLH 3LH2L 3VOCA 3AMLA 3WEXA 4DOHB 3SKOB 5F9WB 1X5JA 3GMLB 1FG2B 3RY6A 3STBA 3CZEA 1AJ7L 5BRZB 1F6LL 3PWVA 4OM0L 1GC1L 5TDOA 3HMWH 3BP4A 5EC1A 5D7IE 5HHXH 5TF1H 4WO4A 3IGAB 2PTUA 1MCWW 3L5HA 3D3AA 1UKOA 1OSPL 3U4EA 2BCKB 5D2NA 1KQZA 4J3SA 3DXAB 2D73A 3BKML 2PWDA 4S1QH 4HGKC 3NIDE 4U6YB 3ZO0A 3HE6B 3O6FD 4PMXA 2HJLB 3CO4A 4YHOH 3QDMA 3GJFK 1Y0LB 3OIHA 5K59E 1QEWB 2JIXA 1XF5B 5JOFA 1MFEL 3MNWB 3SBWA 2XYLA 5SWZE 1XF3A 2FEDD 4RIRA 5IHSA 2MQ3A 3T3ME 5C0AA 1H41A 2FD6L 3F7QA 4NQCD 5KJRH 3CUJA 3KPLB 1B9ZA 5F6IB 2E7CA 1H3VA 1Q38A 3GSUB 3WBEA 4XH2A 1RFDH 5I6SA 3B4NA 3VD4A 3PHOB 5DA0B 3NGBC 4JQVC 1YECH 4M6ML 4MD5A 4QNPE 1PX8A 3UR8A 1I7UB 4MQ7A 2YL8A 5HXMA 4WGVB 5IXEA 4GRWB 2J7DA 1FL5A 3QOKA 1RK1B 2NR6D 2I26N 2P8PA 5CBAA 1J05B 1NC4A 1RMFH 3IKKA 3L5JA 5CSGA 4YBQC 3RDTB 3CFDA 5ENWB 3VRIB 5ADPH 3RY6C 4BA8A 4MA8H 4WV1C 4AD5A 4O51B 5FV1L 3AY4A 5DD6A 3ZKQD 4G7VL 4GINA 3MMWA 5H94B 1D5BA 1IGCH 1IGJA 2JK5B 4YGVB 5IFPA 3TNMB 2XKSA 3QT2A 1IQDB 2X4SB 4HSQA 1WICA 4KKCD 4L3EA 2DQDL 2X9WA 4RMSA 3ZR6A 5DRNB 4L4TA 2GJ6E 2M26A 1N3NB 3QIBD 3S37X 4Y1AA 5ISZA 1JZ6A 1J01A 2IGFH 3N0PB 3QXDB 2HJLA 2X89D 1XGTA 1MVUA 1J12A 1CDJA 2IPTH 1E3ZA 3SUVA 2D03H 3IRPX 1QLRB 4TUJA 2AAVA 2WAGA 5EULV 3WBDA 1P4IL 3BUIA 1G7IB 4X7FC 3VH8G 5I8OL 3VXQB 4BS0A 5FYKH 1W0VA 4U5KA 1ZGLM 2GT9B 3LN5B 2FJFA 3L6FB 3GMQB 3S34L 1CENA 5FECA 4YDLB 4UTFA 1CZ1A 4KVCH 2EDTA 3QEGL 3I02A 3MRHA 5KS9A 1LO4L 3PHSA 2X2YA 5DGQA 5JIPA 5A94A 4F2MB 3IF1B 1KC5H 4KH2A 1EUTA 1KOAA 3SCRA 2OTWA 4M61A 1REIA 3AVEA 3QUMA 3VGFA 2DSUA 1F6AA 4H8VA 3PG2A 2X41A 3ARZA 4H25B 4Y4FB 1NEZG 3VXUA 3IS0X 3QUMB 4Q7DA 5EBAA 1I3UA 1NC2D 1CWYA 3F4VA 5FGSA 3OKKA 2ESCA 2R0KL 4DWSA 3P0VH 4ELMF 1UH2A 2O5YH 3ZKMC 1C12A 4RMRA 2J8HA 4B7LA 4D6FA 3KYNA 3QFJD 3LY6A 3T2QA 1OAQH 4XB8A 4K8RD 3HRPA 1GGCH 5EUKB 3AHTA 2XA3A 2MWCA 1T1YB 3WS6C 3U9PL 3SIMA 4NQCB 4XHJD 4L8CA 4Y5XC 1CGUA 3QEHB 3ZT5A 2DSWA 3ZDZF 2EYRB 2DLHA 1TFVA 1DL7L 3W11C 1HSBB 4C59B 3S5LA 3ZO9A 3QIUC 3WN6A 2MANA 2H9GA 5DWUH 4U7MA 3RIAK 4D71A 5I16B 1MJ8H 1ZK9A 2XWDA 1QBML 2AK4D 4NFDA 2AQ2A 3L3IA 2HH0H 1FNEA 3K8MA 3LKQA 3O2VL 3RM4A 2CGRL 4OCXH 4AJ0A 4EKXA 4YUEL 4F58H 3QJFA 5IW1B 3LZFL 1N59B 2G3MA 5I1HL 4JQIH 5LXGL 1WE5A 1G9NH 2YPVL 4KQ4H 3LZFH 3A4AA