3VGGA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltoheptaose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
554
structure length
554
Chain Sequence
YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords Malto-oligosyltrehalose trehalohydrolase
total genus 193
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vggA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vggA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vggA02
2VXVL 4XCCH 4FP8L 4HZLA 4N8VB 1CDIA 2DMBA 4Y19E 3W39B 1IEBB 3KS0J 2IPTH 3JV4B 2OQJB 5KG9B 5JUEH 3BDYH 3BKCL 3GJFA 3BYTA 4LSSH 2HKHH 3HE6A 5F93C 1ISVA 2W38A 3O2WL 4BA0A 3ZSSA 3Q5OA 3KWXA 4WDIA 1JXKA 3MRRB 2A0LC 3VJ6A 5BXTA 1JGVL 2R0KH 3L3DA 1HP5A 4HUXA 4NYLA 2WK2A 3SE4C 1RJLA 1QFPA 4F9JA 4PBXA 3V6FB 3RAJH 1CF8L 4MA8H 1I7RB 4N8VG 5F9WC 2VN4A 2J3SA 2QBWA 3EUUA 1CDBA 3K74B 3SDDD 3OXRA 1BVZA 5HYIA 1R0AH 3JUGA 4D94A 3RX8A 3F58L 3V7MA 4Q0XL 4AG4L 1JTTA 2J8UA 4GG8B 3CIVA 1UVQA 4LSVL 3BP5A 1K6AA 1W9UA 2EZ0D 3M8OL 4YDJA 1JNJA 2W0FA 2D3LA 3NZHL 4G9FA 3WKZA 5J6HA 4ONFH 1JF6A 2AXFA 3HNTH 4BQ4A 3QCTL 4Y8AA 2JK5A 2IH3B 2KZWA 2AV1B 1BIIB 4HJGB 2VL5B 2ZWZA 5D71L 3LN9A 3JTSA 4WWKD 3MXVH 2FATL 3DX8A 2DLTA 5A6AA 1TVHB 3REVB 1MW1A 3ZHKA 3MRCB 1F11B 3T2NH 3B5TA 4J4PC 5IB4B 4MHHG 4HWBL 1RVFH 3FQTB 4IISA 2VZSA 3C5SB 2VL4A 4XBGB 1ZWIB 4S2SA 4NRSA 3AREC 3KZSA 3NPZB 3MRJA 4QRTB 5IEKA 2V5YA 4K2UL 1KT2A 4PJHB 4LLUB 4AEEA 1B4JL 4AM0A 1M04A 1D5MB 3UAJC 2Z8VC 3V8CA 1CK0H 2DIAA 4KHTH 1FSKB 5J1AB 3D0VA 3MMEB 1DQJB 3TV3L 1OTUC 2DWEA 1CGXA 1NBZA 4I0CC 3G5XB 3VD5A 4MXQC 2GY5A 3C6SB 1E56A 4X0VA 1ZWIA 3RIKA 1MEXL 1OY3B 3SN6N 2ZPKH 4FN0A 1PFCA 3IGUA 2VAJA 3KPSA 1KJ3L 2Z8WC 4L8SB 4U1MB 3ET9F 1W3LA 5A3HA 4OLVL 5A3ID 5T1DH 1QSFA 4UI2A 3V4UL 1ZLUK 1BTCA 1N7ML 3NCCB 5IBTL 4CDHA 2CKBA 4TVSa 5AYQA 3O45A 2ZX8A 1S8DA 1SHMA 3JWOL 4JLRA 3TZVD 1MJ8L 3VFWB 1TDQA 5F70A 5JPNB 4O4YL 2XTJD 3RX7A 1W9VA 2I07B 2JF1A 1GC1C 3HZKA 4TTDD 5IVXA 2NCMA 3KPRE 3EDFA 4NP4L 3RZCB 2F18A 2ZUYA 4ALAL 1KBBA 2FX8L 3HC3L 3OKMB 4LEOA 1U92A 1WDSA 2X4TB 1A3RL 3PWPA 2GK0B 3VRJA 4YBLC 5K9OB 2V7HA 2DQCH 1K4DB 1DBKH 2MHAA 4FFYL 2QHAA 4B16A 4H1LH 1LWHA 3AIRA 3LQZA 4KUCD 3WNOA 2YKKA 1LDPH 5ICZB 5I8CA 5IKCB 4ACPA 5F1NA 3FTGA 5B8CC 4LKXA 3VFNA 3U7YH 1CU4H 3RWHB 2H3NA 1PEZA 3TEUA 4ZAKA 3VD9A 2DT1A 4ZUWB 3PWJA 3S37L 4M7JH 1SEBB 5C71A 3GJFB 3PL6B 3BCDA 4XMLH 4G6FB 2X1WL 5HYQA 1OSEA 1U3JA 3W81A 3KYKH 1CECA 2VOTA 5BJTA 4P8WA 1CFQB 3MSDA 1AQDB 4RMWA 3GSWA 2D9QB 3NUKA 1CGWA 1UXSB 5GIRB 5ECUA 2VL5A 5EA0H 2CKSA 2B4CH 5C0CE 5HDQL 1QYGH 5J6GB 1XGRA 3IYLW 3QUKB 2GAZA 4GBXB 4HXBL 2ENYA 4BKLA 4ZS7L 4Y4FA 3TYGH 1RUAL 3D69B 4J1UB 4YDIH 1NAKH 1DWHM 1CFSA 3DECA 3ARFD 3V6OC 1CZ8H 5F7HA 3QIUD 5CILH 1XH1A 2R1XB 1RUQL 4LPUA 3SDCA 1X1NA 3QHOA 4W4OA 4H1LG 2V3DA 2VH5L 2C4FT 1JZ8A 4RE3A 3VG9B 1F97A 5C8JB 4NCC1 3CLEH 3N9KA 4XVUC 1DL7H 2W65A 3X3FH 3RUGF 1U8JB 3VX1A 3A67H 2W62A 5M17A 4BCEA 4MDIA 1OCQA 3WIIH 2VAAB 1BVLB 1P5VA 4GRLD 1C5DA 3D2UD 2OL3B 3O4LA 2CMRH 5D2NB 2DQTL 4RBPK 5AZEL 7FABL 1FO0L 3RZCD 4YHLH 1T7WA 4RE2A 4D6GA 3MV7E 4D0DB 1RZ7H 4GI6A 1EJ6A 2BC4B 1VFMA 2EIEA 3IDJA 4KQ3L 2F61A 5E1AB 1UA6L 2EDWA 3BPNC 2YPLD 3GMOA 4KROC 2CXGA 3MA7A 4EKXA 5DI8B 5H37G 3VI4F 1QWUA 4PRHB 5I9QC 2C9AA 5C1MB 1EBAA 4G43A 2VB5A 1GXEA 3TC9A 4K71C 1SZNA 1XSIA 4TUOA 1NLBL 4KTDL 3RNKA 3X11B 3MRQA 1JNNL 3QUYB 3B6SB 4PRAA 4MQ7A 3LRHA 3BEVA 3WFBH 4Y2DC 5D71H 1BVKB 1HSBB 4D0BA 4PJ7B 5DZNA 3D0LB 4KAQL 4R2GC 4F7PB 2F54B 3C60C 4MAUH 3S96A 3W82A 1UR8A 3ZDYE 1K4CB 2EXWC 2MKLC 1OAXH 3VWJC 4X98A 2E0PA 1BQUA 1I9EA 2PO6D 1JZ4A 2DT3A 4Y4KB 2DQFB 3LPOA 2G2RB 2H2SC 4FFVD 3GUTB 5KAQG 1N6QH 3T1WA 1IZJA 1I1AD 1U8PB 4P23A 5MHSD 3AGVA 3C5ZD 4HIHB 4IOFC 5D7LE 1YY9C 1SMDA 1IMHC 2BVQB 2EYTA 4NQDB 3KHOA 1D7FA 2DLFL 2VDKL 5F21B 4B7LA 3AB0B 5KS9F 1LG1A 3GYCA 2ICCA 1GGIH 3N50A 2IADB 3MRGB 3CMGA 4Q9QL 5IOPA 4H8VA 3VFOA 4JFPB 3MRLB 1SYVB 1CNVA 1INDL 5AEAA 3RQ3A 2APTA 1U8MA 2X89D 4LHQB 3ZYIA 5I1EH 4HHAB 4OZOA 3MODL 3MRKA 3SDXA 2FGWH 2EC8A 4GINA 2G5BB 3FMGL 2QR0A 2GI7A 4LYQA 2JEPA 1F42A 5EZOL 3ROLA 3NA9H 1CS6A 1H8OA 3DUUB 5DJYA 5EC1B 2BS9A 4WFHE 4J3TA 5EZJA 1LGVA 4XCNB 1EQCA 2UWFA 1ZS8B 5GGSB 2OL3A 1HXMA 2ZJSH 1YEDA 3O4LB 3R06A 3EO9L 1IL1B 4OF8A 3HE7B 1D6EA 3CZLA 4Q97A 5E2VL 43C9B 1FVCB 3ELAT 2XN0A 2A9MH 4L4OA 2BVOB 3WY3A 5EC1A 5KBNC 1X6LA 1DQDL 3FT4B 1QYGL 4AENB 4F9PC 4HPHA 5GNYA 4TUKL 4HEME 3P9MB 1E6OH 5AUMA 1QNQA 3KS0H 2R29H 5B38G 4AQOA 3IAQA 1OW0A 2FEDD 4Y5VB 1LO2H 4LU5H 3PIQA 5EIIA 4PMOA 2YXFA 1LQSR 4UNIA 3PZUA 3VFSA 4Y19A 5DVOA 1RK0A 2XVPA 1LO0L 6CGTA 4UINL 1HWGB 3TO4A 4K7PL 4PBGA 4JG0L 5T1LB 2ZUXA 4LPXA 4WHYH 4QOKE 5EC2A 1BF8A 1A47A 1VRXA 2I9TB 5TGBA 1HJSA 3ZKMD 1GGYA 3WUWG 3S36X 2VDPL 3VA6A 4AY1A 2A6KA 3UERA 1G9NC 3TA3B 3OGCA 4N8CL 1B1YA 4PB9H 3OJVC 4RISH 3QRGL 3WN5C 4RMUA 1LEKB 1S78C 3JVGC 2OCFD 2UY2A 1KV3A 4OF7A 3OTTA 1MWAL 1OPGL 3SQOL 4O2FA 1IGIL 1SEBA 3S35L 3N1QC 1HIMH 2CEQA 2A3AA 3CZ8A 3PWVB 2OJEA 5C0RH 2AI0H 1GZJA 4JG0H 3B2UD 3OGOE 3VINA 4X7SL 5F89A 3WL9A 1H3WM 3OKNB 3ZTNL 2DQIH 3AZTA 4JQXC 1R3HA 1YMHB 3SE3C 1TUXA 5EUOB 4XZUB 3EJYD 3RCNA 3NSMA 4OD1L 1F4WH 3HPLA 4O2EA 4JPWL 3AS1A 3O3BB 3V0WL 4XB7A 2X4NB 2ZG1A 1ITXA 2IBZX 4UQCA 5D1QB 2ZSVA 1N4XH 1IJ9A 3BW9B 1I8LA 4GAYB 4XNQB 5L9DL 1G94A 3FOLB 3MOAH 5HGDB 3R8QA 5JHDA 4UQBA 2QLYA 1QBAA 5D72H 3VXUA 5JOFB 3FO2B 5E1HB 2Y6SC 4XWOD 4PJXF 4A3HA 4JFYB 4PRNB 4K7PH 1F2XK 3QCUH 4KKNA 3GSXA 4PJ8B 3JWOH 3U4EA 2ZNWA 1G6RA 4F7CA 4ZMAT 3N1FC 2FGLA 3RM4A 4FQIH 1JGVH 5CP3H 1U8LA 3WDHA 2N56A 3C5JB 5HYJA 1INEH 1OP5H 2EE9A 1B6UA 3QXWA 4NO3B 1CLZL 3E8UH 3ZKND 3OZPA 1INDH 1TZHA 3SGEI 1XF4A 4RAUA 4MAVA 4IOSD 2ITDA 3IRPX 5IJKA 5J3HD 4Y4FB 3BKJH 3P4NB 3F5WA 4BSJA 4C57C 3MU7A 1WNOA 1Z9MA 5IVNA 1M7XA 5DJCB 4PRNA 1ULVA 1U2YA 4KI5D 5CLTA 5KVEL 1P7QA 4JVPA 3OG6B 1EGJL 2R69L 3D0LA 1F13A 2Y06H 1RFDH 5IF0B 1A1NB 1TA3B 4HG4K 1A2YA 1RUAH 4LCWB 3ES6A 2FATH 3P4NA 4JKPL 5TF0A 3SEPA 1ZL1A 1KLUB 2AABH 4E0RA 4XH2A 5C0CD 1P69B 1IARB 4W70A 3KJ4B 2YD2A 3P9LB 3QEQE 3AI0A 2OWWA 4UFJA 2CPUA 4WO4B 4EEEA 3HRPA 5TPWH 3GBNH 5E7FA 1YJDC 4NSKB 3LCYA 4RGNB 4ZPTB 2WMJA 4X6CA 4HBCL 1AGDA 4YPGA 1HQRA 4NUJB 1RIHL 2QKIB 2B1AH 3RI5K 1NOUA 3EFDL 5TE4L 3BAEH 1CF8H 4MA8L 5IVZA 3GSUA 1JGEB 3DV4B 1DVFB 3S35H 5C0CB 3QHFL 4DW2L 4WW1A 4AIZB 4FNPA 1TTGA 1JGDA 4DKEL 5FA3A 2EPNA 3TJHC 2DLGA 2IC2A 2IANE 3PZQA 5IR1B 5GGVL 1ROWA 3B9KA 2NLJB 1FGNH 3MJ9L 4M7ZB 1BIHA 4LLVA 3DURA 2V2XA 1T83A 4K94C 5JHDD 3MX0A 1A3RH 1XGUA 5DSCB 1NM9A 4ACZB 4OD1H 5F96L 2J7DA 1YEJH 4HIIB 4JFEA 1UH4A 4Y2DB 2VXVH 3I6KA 1C7TA 3A6BL 1H15B 4OD3L 1MFCL 2NX5E 4BZ1H 4XPBH 3AHTA 4OZIA 2X4UA 5TQ0H 2V3FA 3QPQC 3DDGA 4DWSD 1QBBA 3F8UB 3AHVA 1VPOL 5BRZE 1MCKA 3V5DB 3O2VL 2OJEB 1R24B 2W9EH 3QEQA 5T1KB 1KWKA 1HJVA 2OYMA 4LSRH 1FNEB 4ELMB 2R8SH 5E94A 4MCYA 3RWDA 1ODUA 5IUSA 3EHBD 3G6LA 3RL1A 5TE7H 4EANA 4CNIB 1X6NA 3BW9A 1CICD 3EMQA 1SY6A 4QHUA 2ERJC 1IEAB 4GRMB 2WLYA 1C93A 4Y7MA 3D2UB 1Q72H 1URLA 4D0CB 3RUGA 2JK5B 4Z7WB 4J4PA 2GY7B 4KRNA 4BFIB 5HYSB 1H3XA 2HMIC 1U30A 1NCCH 2ZP0T 3NJ3A 1RP9A 4DUWA 2WHKA 2NY0C 4YGVA 5F89B 3WL9B 3VXSD 3NIYA 2DI8A 5D93C 1KPUB 4LASH 1E4XL 3WUFA 3UESA 4OCYH 4JRXA 5B38B 1FNHA 5C7XH 2EEDA 4JFFE 5I16A 4MA7L 1U0QA 2XG5A 3PWPB 2EYSA 3C5ZB 4PJDB 1ZBCA 2EO7A 4C7DA 5D70H 3WQ4A 4WY7L 1IGYA 1ISXA 2D7NA 2CJUH 1LEKA 2EKJA 1E6JL 3L4ZA 3SUSA 4KY1H 2VXQL 2WKGA 4ZFGH 3CIQA 3WHE1 3VM7A 2HT3D 3VNZA 4PMRA 5KVMC 4OTXH 1ZLUH 4F37F 3BUIA 5SWZB 2B1HL 3VMPA 4FNLH 2IPKB 2ZUVA 2BP3A 5I23A 1LO5A 1RHHA 4PJEB 2QQNL 1UR4A 2B2XL 1RULH 1MCRA 2EADA 5F1OB 1QR4A 5I1KL 2HTLC 3KPMA 1NMCB 1MRCL 3VGEA 1OM0A 4NJAL 2VWEE 1JTOA 5FGRA 1FV1B 1UQSB 3VIIA 1ZBWA 3W0WB 2XICA 5EIQA 4XP6H 4W7UA 1OLLA 1C92A 2OTPA 2PR4H 1G9MH 3U6RB 1G7LA 3MLXL 5C09E 4EI5D 4M82A 25C8H 4JCMA 1Q8MA 1R3JA 4BM7A 4WV1A 4IM4A 4AISA 4OLVH 1RZKL 4IMKA 3ZMRA 3CSYB 5C6TL 3QEGH 4HOXA 1ZKAA 3GRWA 1LMKA 5E8PB 5E8EB 5E0CA 2AV7B 3EBVA 2X1XR 1QI2A 4KK6D 3ZKSD 5D4YA 3DX6A 3SCTA 1J0IA 1I7UA 2NY2C 4FG6D 3RIAF 4NZTH 2E5EA 4AIUA 4HUNB 5LA1A 5EOCL 2EBNA 5D7IB 3EJRA 1E6ZA 3ZIZA 4Z0BL 2NQCA 4JFHE 4RMTA 2WKLA 4ODSH 2QSTA 1FNAA 2I26N 4F9LA 1W1YA 2X09A 4Y4FC 1HN1A 2QSCH 3BP7B 5B8CB 5DJ2A 2CR6A 3RILA 4X4MA 2W59A 4M7LL 4LDEB 4PJHE 3GSNH 2H2PD 2FIRT 3CX5K 3L5XL 4XI5C 2JTDA 4AH2A 1JPSH 1ZHNB 1T5XB 2PTTB 4PY7A 3ZL4L 3QOKA 5FECB 2A38A 3HZMA 4UQAA 2PTUA 3D3VD 4CMHB 3VWKC 4U6HA 1JD9A 2NY6B 3G6JA 2VRKA 1REIA 4B9YA 4WUUE 3EAKA 2FDBP 4AD2A 2VLKD 1TNNA 1XGYL 5DRZB 3VXOA 1I4FA 1ND0A 1YJDH 3UC0H 3KPRA 1J11A 5DI8A 5FCZA 4PRWA 2JB6B 1YDPA 2N4IA 1NKRA 3IXTA 3JVGA 3OKLB 3RTQD 4NZFA 4JRYA 1KLUA 4IPLA 5F7WC 5A6JA 2E7LA 4XNUL 4NT6A 1JMXA 1NUNB 1A7OH 2ENSA 2VQUA 3OB0K 4ZS7H 3LH2L 1ZSDA 3WFDH 1NMBH 2HFGL 5I2IB 2HN7B 4FA8A 1DQML 2H9GA 4RDQF 5HBBA 3O9WC 2F54A 4HCRL 4RBPH 2IG2L 4HWNA 3SCMC 5DO8A 4HS6A 4KK9D 5T1KA 3KPSE 1KIQA 5JOPE 3T1FB 2WVVB 1RIUL 3KXFE 3TVMD 1FPTH 3NZHH 2QKIA 4PJFE 1C16A 2Y36H 2AJSH 4XBEH 4XHJC 1IGML 3TTSA 1AO7A 4MZ3A 2QTEA 3H9SA 2MJWA 2X8RA 4DK6A 4I4WB 1NKOA 4XX1G 2AI0L 5EUOE 4P4KA 3FFDB 3WFCL 4LLDA 1LP9B 4ZODA 2VRQA 4Z7NF 4RFNC 4IRJC 1CTNA 4JZ5A 3HZVB 5C0FB 2K7PA 1OGTA 3CJJA 2UZIL 5KEZA 4ODXA 3CSGA 3QGVA 5JA8B 1KIRB 2CMRL 5EOTB 5C3TA 7FABH 4XAWH 4Z77A 4GRWB 3RDTA 1LEGA 2ORBL 2VUYA 2XFYA 1BBJB 1ZE3C 1ONQA 1MREL 1UM4L 1WPCA 1P9MC 3S5LG 4LPWA 4EVNA 2FJHB 4V1DE 2OR9H 4U1KB 2MCG1 3FT3A 4Z7UE 3NN8A 1X5KA 1NL0L 3RGVA 2JIXA 2VERN 3KPOA 4L9LB 1SR0A 2CIPA 4P2YA 5GS1A 5I8EB 1GW1A 2XZCH 4H88L 1AGCA 4KZDH 5D5MF 4NQXB 2VZTA 3NIDE 3NPSB 4GRLB 5BO1L 3O11B 1NGPH 3QH3B 3GI9L 3QEQD 3GSRB 4G7VH 1DWFM 1NQ6A 1T7YA 4M4RA 4MB1A 4H0IA 1F2QA 1JZ7A 4JY5H 4IRSD 1I9RH 4HMEA 3GM0A 2Z31C 5M7QA 2YBTA 4W5ZA 3G5ZB 2V5TA 2YEZB 2MANA 3SUTA 1L6ZA 3BP6B 4WU5B 1F4XH 5MEPA 2DM4A 4F7EA 1QLFA 1DTUA 4NO5A 4R90L 2OZ4H 3EYQD 4JANA 4WHCA 2FX8H 3BDBA 2VT0A 5FIEA 4KH2A 5C07A 2CDGB 2V7NA 3NACL 5DUMH 5F44A 1KELH 4YHPA 2EKSA 3LRGA 3QQNA 4LP4A 4QRTA 1YEIL 4W81A 1LJYA 5CPSA 4PJDE 1L9MA 2AJZA 1ISYA 3QFDB 4JDZA 2CO7B 1H3PH 1MCQA 3CZFB 3RTQA 5BS0D 1UACL 4MNKA 1J8HB 4HKJA 1OF2B 1CFBA 3GB7B 4XNQA 1KENL 1TENA 2GJRA 3WN5B 4XVJL 4QRUB 3LS5L 4OFPA 4WHTB 3VFVA 1ETZB 4TNWF 4I3SL 5TDPA 3V6ZB 3VXNB 4PSPA 3SCUA 2CKBB 4WVRA 1CLXA 5M3WA 2YPVL 5EMYA 4Y2OA 1P6FA 1Z5LB 1TQCB 4FXKB 3W11C 3NCEB 2DKUA 5KN5A 1MFVA 4PJEE 1NCWH 1UWGL 4NO2B 3OKOA 4UIKH 5I73C 4OV5A 1D5BB 1W72B 3SO3B 3BZEA 2R1WB 4Z0XA 1WFUA 4MLSA 5ID1A 4HF5H 5I30L 5DEGA 4UFIA 5D2LA 2CDEA 3VFGL 2WWMD 2IGFH 1E0XA 3Q6FA 5J1AA 2NX5D 3ZKQD 1MWOA 4D71A 2NPLX 1EDGA 2DQHH 5KW9L 4Q22A 3O2DA 1UJTA 5I1IL 1DP0A 1OTSD 5J11B 1M71B 4RX4A 2KQNA 2E7HA 3OZ9L 3RA7L 1KJ2L 4TSCH 3A23A 4PREB 4P2RB 3U1SH 3I6LE 4LPCA 1SYTA 4DK3A 3ZE1F 5H35A 4D2NA 1G84A 2ZSWB 4R7DB 1WQVT 2IMNA 3VG9C 4Z8FH 1S7WB 3P4OB 1I8KA 1Q6DA 4GO9A 4N0CD 4FTVA 5FB8B 2IWGA 1UJ3B 4CU6A 1JWMB 4LRNL 4U1IA 5EO1A 2IAMA 3EO9H 1U8NB 2AQ1A 3PJSA 1Y6KR 1ZT4B 4YLQT 2HG5B 2CK0L 5ACMA 2YD1A 5BXFB 1ISWA 3L3HA 1RZ7L 1JI1A 5C0DB 1GZPB 3G5ZA 1T0MB 4EDXA 1KXQE 1BYCA 3WD4A 1O7SA 3UTQB 1D6EB 3QDMA 1N6UA 3ZKXB 2EH8L 1NGPL 1QKZL 5SX4H 2XN1A 3HCVA 4NCC2 5GRUL 1UB6B 2GJ6B 5KSBB 3JTSB 3MBXH 3PP4L 4OCXL 3EYOB 1MRCH 4GRLA 4P23B 1KN2L 1OAKL 5SWQA 4ZUSA 1F6AB 3WDIA 2MTPA 2XN9D 3V6ZA 4Z7WE 1OB1B 3LIZL 5A2LH 1FCGA 4JRYB 1G6RL 4HWUA 4FNLL 4LKCB 2A9NH 5HDLA 4MCZA 2DQGH 1RUQH 1LDSA 4PCSA 1EFXA 1CLCA 3PZTA 2PO6A 1ZT1B 4P2OC 5GS0H 3KDMA 5IFJB 1G9EA 3JWNC 5GSVB 1I1AA 2VITA 4S0SD 4KRPD 3UYOD 4UOZA 1KEGH 5DT5A 5C0FA 5DVKA 1RZJH 3MRQB 2CKBL 5EN2A 4O58L 3KYOA 4OCYL 2CYGA 4XC3L 4Y4KD 1A6VH 4M00A 4PRHA 4JPIB 3TH4T 5T5NG 4LBEB 1B30A 3BVNA 5C0AE 3IJYA 5D2NE 5F3BA 1NBYB 2BMKB 5BOPA 1VA9A 3CZKA 3HMXH 1QW9A 3LEVH 4MCYB 3RWDB 3NVQA 2YS4A 5GGRB 4ELMA 2R56L 4Z2LA 3UTSA 4HWEH 4EBQH 1T04B 5F9WB 4X0NA 2P4AB 4V1DB 3VPLA 1KTLB 1U3HC 5LXGH 3ARTA 3F5WB 3FRUB 2ADJA 5ERWA 2OTWB 4J3OC 2IANB 1ONQB 5JW4N 2ZOKB 4NRXA 3UR7A 3L7FB 2WBKA 3X13A 3AS3A 4FQXD 4P2RD 4L1HA 4PJBF 1E15A 1K9FA 3D3VE 3CFIC 2OP4L 1RJYB 2VKXA 2YPKA 1PLGH 3LEXA 1R3LB 3T4AB 3D5HA 3UTSE 3P30L 4UFLA 2UYLA 3IFNL 3GNRA 3MFGB 4DGYL 5E2TL 1NGZA 1QFWM 2SEBB 4KJQC 4EDWH 4MVBD 2GK2A 2VQ1B 1A6ZB 2GJXB 1AIFA 5TFSL 1BD2D 5D2NA 4WI5A 4QTIH 4XAKE 4PJBB 3QA3A 4KQ4L 3ULUD 3EYSH 5JW4M 3T0AA 1NH6A 4NQCB 5D7LB 5DS8A 4OSUH 4F2MA 3VDBA 2W1NA 2Q8BH 3V7AE 3GO1H 2ICEB 3QNZB 2C1OB 3CVIH 4HLZH 5EDXA 3Q2CA 4YBQC 2IQ9H 1MLBB 4QCEA 35C8H 2V5CA 2PXYA 3ZE0F 3UYRH 1J9YA 1WDPA 3BAXA 1OGAA 1NJ9B 3I02A 3QHFH 3GGWB 3BAWA 3IFOB 4WUUB 3QDJD 3I84A 1R47A 1GNXA 5JORB 1A4KB 3D85D 4XP5L 4HUVB 4MWFA 2BERA 4TQEH 3WQ8A 3HMXL 3OLEA 2BOBA 4AD0A 3U4BH 4DCQA 4KU1A 4V2CB 2AJSL 3GMPA 2P5WA 4QRSA 4XBEL 4ZFOL 1VGKB 4H5SB 3GHBH 2E9LA 4B3LA 1HXYA 5KSAA 3IK2A 3WIHH 1F8TH 4DWHA 3JZ7A 2A2QT 1N64H 3BDXA 3CCHB 1S3KH 4E42B 2XNAB 1ZGLB 4OM1H 5M03A 3PNWB 2GUYA 5CJQH 3TO4C 1UXSA 4XMKH 1FGVH 1XGZA 1PKQB 1A7NH 1QOXA 2VRAA 4MDIB 1GVYA 3W6LA 4FMFA 2Y24A 4P2OB 5E8NA 2OW7A 3HNTL 4MNHB 3RY4A 2VLRA 1UA3A 2HISA 3TA3A 2AJVH 2XHYA 5DD0L 3PWUA 4W88A 3OB8A 1PBYA 3QEQB 5TGBB 2MQCA 1D6VH 1GAFH 1R24A 2DLFH 5IBUG 3DO7B 1US2A 3BWAB 1U36A 5TH2A 3OG4B 2QL1A 2VSCA 3MJGX 5HGBB 1K6QH 2V17H 3IRZA 4F33B 1X5ZA 2B31A 4MSWB 3FY1A 4G3YL 4K07A 4JY4B 1V3JA 5C07D 2DQUH 1GYAA 5AD0A 2H1PL 5SWSD 5E2WH 2DWEB 4J8RA 3NIDF 3PTMA 2NY5C 3EFFA 3DO7A 2XXCB 3BPOB 4HG4J 4PJIF 4HDIB 3LMJL 2OMBA 5D8JL 3CO4A 5CSYA 4ZUVA 2J1KA 4LLUA 1MEXH 2AKRB 3W0WD 3PWUB 4S2SB 4WKFA 3IDYB 3ZO9A 3NACH 4O51B 1KYOJ 2H6PA 4JZOB 3H9HA 5BS0E 2G60H 3C6LC 3DMMC 1GZQA 1H0DA 5GQBA 2BY2A 2DEPA 5IMMB 1KCVL 3LMJH 1KCUH 2AOSA 3DX2A 3KPNA 3MJ8A 2HRPL 3CMJA 1UG9A 4JPWH 3WXVL 3B8SA 4YHLL 1X5HA 4G9FB 5IK3B 5LXGL 2EEXA 4D1JA 4F79A 2IFGA 4CD4A 3GMPB 3T09A 4Q9CA 2JELL 3NABH 1U8MB 1AFVH 3QNYB 1MJ7H 5GHWL 1MIEL 1GOMA 2ATPA 1LK2A 4O2FB 3SIMA 2VUOA 3MMWA 4PRIA 2F53A 4QWWD 3CBWA 2MFNA 4L8CB 3AMLA 1M6OB 5E4IA 1MF2H 1IRAY 1OCWH 2CR3A 3BLPX 3ZYJA 4M43L 4JQIL 3DURB 3LHPL 1CGSL 3B5GA 4MS8C 3JUYA 5CP7B 1GJUA 4HA4A 4PRDA 1ORQB 4EE9A 5CUSH 1FBIL 4Y4KA 3CFKB 3EYVB 1MCWM 2W9DL 2H26A 3EDKA 4XGZB 3WY1A 2D9CA 5DHVB 4OZHB 1TZHB 2DQJL 1S7XA 2EAEA 1NANI 2GCYA 3TF7C 3IVKA 2XACC 2FWOA 5GS3A 5D7LD 5GRZA 4UQ3A 3W38A 3BKCH 1WWCA 3GMLA 4FZ8H 1CWYA 5ESVB 1V3IA 4U05A 1QI0A 2EE3A 4DEPB 4P7NA 1GOOA 2YJQA 4MNQB 3GFUA 4WRLA 1KTBA 2CESA 3H9SB 3MJ7A 3BISA 3MV11 2DH2A 1XD1A 2D7MA 4YHZH 5IGXH 4LFHG 1QFHA 4X6BA 4UQ3B 2DT0A 5JW4R 1J0ZA 2W9DH 1QSVA 4I48A 4I2XB 4L9LC 3BGAA 3QUZC 3SCQA 3RM9A 4PJ9C 1MPAL 1JF1B 3WHXB 5I1DB 5EZIL 2J78A 1RUKL 4N8VA 3TCXA 3QG7H 4S1DD 5I1CL 1BVLA 1I1YB 3S5ZA 3J7HA 1GC1H 3AICA 3HZ3A 2GW5A 4RWYH 5FA3B 2JB6A 4CVXB 3M1BB 4ELKA 1LG2A 3D6GA 4R96B 2BRRH 2W65B 4F7TB 4PG9A 4CUCA 1M6OA 4KKAD 4LVHB 3P11H 2ZICA 3OKNA 5CEYA 1XF4B 1RZGB 5EBMB 3NDYA 4YHOL 4F37K 2OW6A 4YGAB 3L4TA 3SQBA 4QKXB 4RCAA 3V6FA 3TH2T 3LRMA 4QLLA 2DMKA 5EWIH 3LOWA 5HI5D 5C0AD 4FNSA 4AZBA 1BYAA 1YC8A 1UZ6E 4QT5B 3P9LA 2H26B 4MXWH 4KI1A 1KIUA 3IDIB 1X9QA 4ODWB 4F7CB 1Q9LA 4U3XA 3Q5YA 4YNYB 4NKDA 1A3HA 1SY6L 4PGDB 2GJZB 3F7VA 5FYKU 2CUMA 1HHJA 3D39D 4PJFF 2MPAL 5IIEB 5JBEA 3WFHB 5I6XB 3AY4A 4YHML 4HKJB 3TFKC 3BP4A 5D7KD 2CDFB 2D7QA 5FYJU 2YPLB 3MACL 1CBGA 4O2CA 4HT1H 3QZWB 4ZSOB 3OKLA 4E5XB 1KTRL 5BMFH 1FJ1A 1N6VA 1IC4L 2YN3A 3UTSD 1B2WH 2WBJC 4FFZH 4JFQA 2E3VA 5DJDB 2UZYB 3EYFB 1BGGA 5DD3L 2YR3A 5E1AA 4XCYA 1E28A 1E6SM 5EU3A 4CBPA 2PWGA 3KPNB 3MJ8B 3SGKA 2DTMH 1F8TL 3U9UB 1L7TH 1NDGA 2WUBH 5EO9B 4D0DA 2HTKD 1NBQA 1OAZH 2VLJD 4JM2B 1ES0A 4GUPA 5DUPH 3DIFB 3KLDA 4I0PC 2OXGA 3EIFA 3BPOC 3K81A 4UDTB 4DFIA 4ZOEA 4C55A 3TN0B 1CGUA 4DAGH 5DC9B 4K9EC 4TNVK 2RIKA 4XCFL 1YY8B 3ZHDA 3QDJE 5IQ9A 1IT9H 1SJVA 3P2TA 3GBMH 2F5AL 1A3QA 4U6YB 2X2YA 2GITA 5CBAB 3PWNB 1B0RA 4XVJH 4R7NB 3AIWA 3EDEA 1R7OA 1Y0LB 5GS2H 5C09A 3AQUA 3HE7C 1BQLH 3SKMA 4NZJA 1F4YL 5GGSY 4GBXD 1DFBL 3FQWA 4S11A 3QQ3B 4X5XA 1BEYL 4PJGA 5SV4A 4GO6B 1G7HB 3HAEG 1TQCC 2R29L 4QRRA 3BGFC 4MA1C 1PLGL 4K8RL 3GXDA 4K7PX 3HAEA 5I73B 1DE4B 5A6SA 3O3DB 1NC4D 3SUVA 2Q7NA 1NP0A 3UZQA 1JRHH 3PHQA 2QSQA 3AM8C 3HLAB 5ABFB 1IGCL 2P46B 4OLYH 1HNYA 5SWZD 4R8WH 2J74A 2KUTA 4G7VL 4Z7OF 5FYKE 5IHLB 3MRNA 4JFDA 2XZQH 3MNWA 1X5JA 4OB5L 3LKQA 1DE4A 4CW1A 4D9QE 1FNGA 1K8IB 3EMZA 1EO5A 4GXVL 4WW2A 3LPPA 4NC1C 3X11A 5DC4B 5J6HB 5EZLA 5GGRY 4AD5A 3WNLA 4OGAC 2YRZA 5A6KA 2DM2A 4V2XA 1L7IH 1MWAB 4P46C 1P4BH 3CH9A 3MR9B 1UOKA 1R3KB 1E72M 1T7ZA 1AO7D 4TULL 2FX7H 1H0IA 3EOBA 4F66A 1U92B 2KZ1B 1HHHA 3QXVA 3TZVB 4XC3H 5ITFA 4LSUH 3BXNA 2CLRA 1BD2B 2RCSH 5HDBF 1UZ4A 3TN0D 1J86A 1H5BA 5B21A 2NLJA 3IJHA 3TTYA 1FNFA 3LKPA 1FZKB 1FORL 3RVWC 4LSTL 3U0TB 4HWEL 4Z7WF 3WUGA 3HU7A 4CD8A 3TVMA 2HT2D 1FFOB 4CD5A 2Y1VA 2UUDH 1LD9B 4CKQA 2NX5A 4LOUD 3D52A 2O5YH 2IAND 5ICXB 1G9MC 1KJVB 2DWDB 2Z93A 4JDTL 4UDUB 1NFDE 1P4LA 1YN7A 5LJYH 3MNZA 5EU3B 4L4TD 2ESVA 3TBSB 4UCFA 3ARBA 5FF6A 1CDCA 2RHEA 1TPXC 4HUUA 3ULUL 3FQNA 3MRKB 3SDXB 1BX2B 1Q94B 2DL2A 4MZ2A 1IC5H 3BIBX 1XH3A 2HVKA 4XH2B 4LVNC 3IXAA 1Q6CA 3LPFA 5BVJB 4NBYB 4OZIB 3GKWH 4TYUA 4PTUB 1JG9A 3QO1B 3OKKA 1EJOL 4OQTL 5DVMA 3MJ6A 1W0WB 3ETBF 1OW0C 1NGQH 3CZJA 3ULVD 2F58L 1QVOB 2EE6A 1F11A 3ARVA 1JMZA 2FWOB 1BPVA 5HBFA 4U3CA 3U6RA 4BF7A 4OD2B 1HJUA 4LXFA 3L3IA 5F71A 2EXYD 1BQLL 3BKJL 3P0GB 4UT6H 3PABA 2Y07H 5IHRA 4C83A 1G7MB 3EGSB 5FCUL 3HRZB 1LHZA 2FGWL 4Y1AB 3O6MH 5C0AA 3TGXA 1XFPA 4LPYA 3NYDA 3RVTD 3SDDB 2XUCA 2EH8H 4H8WH 3Q1SL 1XHGA 3S6CA 3O3UN 1MFAH 3SE3A 1E4MM 3L3IB 1H49A 1E40A 2G3MA 2F5BH 1JCKA 2HRLA 1EZVY 4CJ0A 1QPPA 1ZLSL 4ONHA 2LE9A 4RSVA 5KS9B 2AEQH 1F4HA 2V17L 1SEQH 3CLFH 1BJ1H 4JKLA 4LDLB 2XIIA 4ZE4A 4ETYA 3T77B 1XF3B 1N6QL 2QV2A 3TNMB 5IESH 4PB0L 4KJPD 4BFEA 2R1YB 4NKIH 2JJTC 4AH2B 3N15A 1ACZA 5CPTA 3E3QE 5IMOB 1MFAL 2WC4A 4XTRC 1H8NA 1RZFL 3A4AA 4LSSL 1K8IA 3PABB 3LRLA 2D23A 1E27A 5DYOB 1AI1L 3RDTC 4XVTL 4R7DA 2OS7A 3VXTB 1KFAH 4WGVB 1Q9OA 3GIZH 2IH1A 3O3BA 4QCIA 4YHMH 3WNNA 3TV8A 4B9ZA 5DJXB 2BDNH 1HDMA 2QQKL 3CLWA 4OZGF 3QNXA 1NOWA 5I3DA 3HLAA 1IKNC 3ROOA 4JPIA 4RA0C 1HL9A 5CIPB 3S37H 4K8RC 1JPST 1R3HB 5HHMB 1T1YA 4PJIA 4DUVA 4OZFB 2AEPL 3MV8A 3W25A 1OLZA 3TP4A 3N13A 3WUZA 4CVZB 3C08H 3ARBB 4AL8L 4H1LA 3D51A 4TRPL 3GMNB 1UHVA 1VGEL 4EN3B 2OM5A 3NCJH 1KWGA 3WY2A 1QOKA 2V9RA 3WQ6A 3C60A 2M1KA 1GIGL 3GMMA 5ICYA 1F3DJ 4JZJB 3TT3L 1F6FB 3GIVB 2JJSC 3FN3A 3VUPA 5HVHC 1FFOA 5IT2L 3G9VA 4P59L 2WCGA 3SGDI 3ESVF 3MNVA 4P2RA 5GRJL 4NXKA 1KBKA 1HWHB 1A0QL 3H54A 1LO0H 4JFDB 1NP2A 3BRDA 5EG6C 4EDWL 4W87A 5CZXD 3SUWA 1H5BB 4POZD 4GXUN 4P8UA 2F74A 5FKPA 1KR0A 5I2UA 3GKWL 3CDGA 3DUSB 3ULSA 2BRRL 2CLZB 2OP4H 2AEWA 1NAKL 1BLNB 5BV7L 1IKNA 1D9KC 1DWAM 1CD1B 1O0VA 4LLYB 1JK8B 3VMOA 1EQPA 5DJ8A 3UTPD 1H8SA 1WBXA 3CFDB 3KXFB 1KPUA 3QEGL 1UWEH 1PZ5B 1RURH 3N04A 1WUNT 5IK3A 1FA2A 4NYLB 2Q6WA 2BHZA 4PR5A 5ALCH 1VPOH 1U95A 4X4ZA 5E2VH 1UWIA 5BWFA 2O5XH 3PDOB 5EBWA 1CK0L 1EGZA 1JN6B 3KYNB 5HHVL 4QDMA 1JHKH 2JF6A 5JIKA 2ADGB 2ARJQ 4NF7A 1S7WA 4YHNA 3MCLL 3QUYD 4JGJA 3B9DA 2WVSA 4QF1B 1SYSA 4KV5E 3MRBB 4M7ZC 1TQBC 2KKQA 2PYED 5B3JE 5DK3A 4YX2H 1CE1H 5E00A 1A6WH 1QHOA 4BQ9A 1OD7A 4OI7A 2WSPA 1K85A 5JUVA 2WANA 5K59E 1VADB 4KK8C 4M5YH 4IMKC 4LF3B 2C3GA 4MA3B 1MHHB 1QBLL 3ARUA 3EJZD 1M71A 2AW2A 3MGOA 3IANA 3WQWA 3WFLA 5EC2B 3PZVA 4KRLB 5IHUL 3DX7A 4MJIA 3UJTL 4FFYH 4UTFA 1CLVA 4OQ1A 5I9QB 5MERA 2YFNA 3GIVA 1QBMH 2DRUA 3C8KA 4YHEA 3VGHA 1HH9B 2VDNH 5A69A 2XPGB 5T5FL 4ALAH 5D1ZC 4XC1H 1ESWA 3NCYS 1SEQL 2ZUWA 1HL8A 4HIEA 3DX7B 3GKZA 3TBTA 3VE0B 2YSSB 3O11A 1G6RH 1FH9A 4K94H 1SMOA 1NFIA 1E5NA 5GHWH 5JZ7C 1S7QA 3ARFA 1QI3A 3T0VA 4OUUB 3FT4A 2BFVL 3S37X 1FG2B 5F7KC 2VDOL 4JZNA 3RIAK 1N5YH 3VRIB 3QHMA 3QOMA 1H5VA 5M5DA 4HK0B 3ZDXE 1JZ5A 1UD6A 2YL9A 4WGWB 4HPGA 4UUJB 4CKVX 4HP5A 1K2DA 4BQCA 3GTNA 1LILA 4Z2JA 4TRPH 2DN7A 2OYPA 4M7LH 4P3WA 3MA9H 4GAYA 4IRZL 5JW5A 3FB8B 1H3GA 3BE1L 2JCCF 1AQ0A 3ZHLA 4M6OH 1HXYB 3IU4H 1C12B 2GTZA 3GM8A 1AXTL 2BNUB 1ZA3B 2IEPA 4K2UH 1OWQA 2FEEL 5D8JH 4ENED 5L2JB 5BV7B 3MLSH 3DSFL 4LHUB 5K9KB 1UASA 4Z8FL 3FB8A 1KJMA 1UB5B 5EBMA 2XA8L 4J23A 2NXYD 3FT2A 1I1AB 2VITB 1ZLWH 3G6JB 3GHEH 4KKBD 2XWBA 2Z0BA 3IAPA 4L9LA 4NNYA 1EFXB 5CBEB 4TN9A 3NTCL 4ZNCD 4ZXBC 3MTRA 4LQFH 4Y16B 4AZCA 2QSCL 1DQLL 5F7YC 5CGYD 5FO7A 1EDQA 1JGUL 1KEML 1HT6A 4CN6A 5B8CA 2GSIA 4CCCA 5J9PB 5JPMB 1M7IA 3D3VB 1HHIB 3EYOA 4AK1A 5FEBA 2XRAH 4Y4HD 3VE0A 4GXPA 2LU4A 4HBCH 1HHGA 2ZUUA 4FFZL 3RU8H 1EHAA 2X2JA 3ZJ8A 2ZKHH 4ODTH 2FGZA 1T80A 1NC2B 2B5IC 4GQ9L 3E6FA 1N0XH 3PV6A 4WTXA 3L9RB 4TULH 4NUGL 3TWCH 1EUUA 1F3JA 4BH7A 2NTFA 2ZCKH 1NWRA 5JMRA 3DYPA 2XFXA 2OTWA 4DKAA 1UM6H 1C16B 1P4IL 3DGCR 1ITBB 4OLUL 3CHFA 4WFEE 5DURB 1TQUA 4FQCH 5LA2A 1F3DH 4DM1A 1KIQB 2WVVA 2PI6A 4PJCE 1E4XH 2CD0A 4QO1A 3V4PL 5E70A 2BNRA 4MJ2A 5GS0C 1JI2A 2VLRD 3N1GC 1NCCL 5L6YH 1JD7A 1DLFH 1WZMA 3QPXL 3AUVA 1ZVHA 1HYSD 1S9YA 4LGSB 1B3JA 2YMXH 2NY6C 3U4BL 2Y9RT 1MFDH 3H9HB 4QHLA 3RIFF 4N0UE 4QHKI 3IJYB 1UR2A 1PG7X 3QISA 5D7IA 5D6DA 4LBEA 2OI9B 1PZ2A 4JFZL 3QEHA 3MV9B 2XA3A 1XF2A 4XNZC 2GUOB 2DM3A 4GMTH 2J4WL 4MPKA 3MGTB 3D39B 3DXAA 4NM4L 3DHPA 1WIPA 5L2KB 2J7LA 2CBJA 1XR9B 5IVXF 4ETQB 4PLJC 4U1JA 4G8GB 4M1CC 4HU8A 4X80H 3SGKC 4DGIL 3QXTA 4JIEA 1WBZA 1T5WB 5CD5D 5HI3C 5HY9A 1R5WB 3BZFB 5CILL 1MREH 1UM4H 1EAPA 5IVXB 1V7NH 4WWKA 4NO2A 1G9NH 3VXME 1GQIA 4Z76A 1N82A 4P3CH 5GRJH 5CEZE 2ADIB 4AD4A 2J8HA 4NQVA 5IXEA 1LO5B 2HAZA 4OZFG 3BP7A 1O7VA 3FO0L 4ORGA 1L4IA 3MSPA 4S10A 2C26A 3UJTH 3OX8A 5GZOD 1XGQB 1BWMA 4KRUA 3P77A 5HDQH 1QG3A 5L8LB 1DEEB 4ATDA 3MRHB 5T3XD 3B9EA 2LVCA 2Q86B 2WZIA 5GNXA 5CWSB 2ZJSL 1EIBA 5MENA 4EXPX 5I78A 3K1KC 3GMNA 2O5YL 5ACZB 4ZYKA 4JFFA 1WAAE 5DK2B 5BZWB 2HT4D 4B53A 2QADD 3ZOAA 2YD6A 7CGTA 4YHYC 4LVEA 1UWXH 2RR3A 2ZX6A 3SE4A 5C2BH 3DXAB 4K3DH 3VFNB 5T5NF 3N85L 1IGMH 4NBXB 4OF6A 2NY1D 4YK4C 4I77H 5EBAA 4OZGB 2A6DA 4M7LT 4WI6A 5DQ9A 5DZOA 3VXPA 1CR9L 4LARH 4HXAH 3BMWA 3T2NL 2A6IB 5BW7A 2VCCA 4AZHA 5ETUB 5MENB 4PCTA 4IOIB 3EO1B 4DOHB 1GQLA 2RCSL 3GMOB 4NQEE 4L3EA 1DANT 4OCRH 3REWB 1A6VL 4G8GE 3CH1B 4MNLA 3KL0A 1TETH 3HI6H 1E4LA 2NW2A 4GLRI 1YEEL 1TLKA 3F62A 4ORGB 4EI5B 5DEFA 1DEDA 4UBDD 3QB7C 1KXTB 4K68A 1NJ9A 3I02B 2WC7A 4Q6IC 4QOKD 4G9DA 4S3KA 1MCNA 3VXMB 1A9EA 3FQXA 4X4XB 1LQ0A 5BRZA 3F5JA 4BQ6A 3LIZH 2FLRT 4LNRA 4MDJB 2F7OA 3BP5B 2WINB 1AXIB 5CHNB 3VFMB 2B1AL 3BYYA 4L4PA 3JTTA 2JJWA 4KTEH 2ICES 3HKFA 4X83A 1R86A 1NCNA 3RVVC 1IGCH 4ZS6C 4P9ML 2X4PA 1LEIB 1VFUA 1NFDB 2APBA 3O8XD 3F7YA 3GI8H 4JN2B 4OZGA 4W89A 4DVRH 1E4KC 4XP9H 3L5XH 1MQKL 1ORSA 2VZ1A 3DVGA 5H37H 2P5WE 2K9UA 2XTLA 4KMQA 1AD0A 4MQTB 1T22A 4N5ED 4L3CB 3MCKA 4AXNA 4WHTA 2QHRH 4ODVH 2YLAA 1QD0A 2OQJA 3TLRA 3U5YA 1G7IB 4PRBA 4XNZB 5EB9A 3L95A 4UT9H 4HS6B 5AAWA 2HH0H 4WO4D 3FONB 4O5LL 2UUDK 1JHLL 1G7QB 1ZHLA 3OXSB 3LZFL 1T83C 1C8PA 2CDGA 4FQHA 3VIMA 2IH3A 3B6SA 2CRZA 2J75A 2WMIA 1MNUL 3L9RA 1R3IH 1T5WA 3CUPA 3S5LA 3DVGB 3I3EA 3P40A 4PP2A 2CHOA 3G04B 4KVCL 3TA3D 1U3HA 3LXCA 3C5JA 3T04D 3E1F1 4UDUA 3KGRA 5KOVC 4H04A 4HWZB 1M7IB 3D3VA 2XKUA 3MGTA 3WKMH 1TPXB 3HB3C 4L5FH 4WSJA 3QAZB 4HUXB 1ZXQA 1WKYA 1C5DB 3QUXB 1IQDA 1ZAGA 3RGVB 4R27A 3FNDA 3WLWC 1KPRA 3BUQA 1TQBB 5CZVH 4LQFL 1J0YA 2MSPA 4MNJA 1A9EB 3FQXB 5IB3A 2BX5A 3QA3B 2ESVE 2W60B 3S88L 5D70L 4YWGH 1J1PH 4HW6A 4TSAH 1B3WA 2OX5A 1PQZA 5ITFB 4OZFH 4R0LC 1JPFB 5E9DE 1I1RA 3MRMA 1U3HB 2NY3B 1TJIH 1YEFL 1QFUL 3TO2A 3DSFH 1B0GA 2P5EA 1DHKA 4RFNB 4Y5YB 1UEMA 3U7WH 3GXMA 2B0SH 5J56B 2VURA 3BZ4A 4X7TA 4OCSL 2VLLB 3D69A 2E9BA 1QLEL 1AFVL 1MJ7L 2V5RA 3BLBA 1CFVH 1AO7B 4AMKH 2XZQL 1NAMA 3ISWA 5D1ZB 2F1AA 1OGGA 5IHSA 2HLFD 1MAML 1VAHA 5SWSE 5ALCL 3WE6B 4RE4A 2X4OB 1RUKH 2VZ3A 5CAYB 5JLZA 1FLRH 1MPAH 4YBHA 2GCYB 3MXWH 5JR1L 2DQCL 1E3XA 4QFUA 2Z93B 3NGBB 3EZ8A 2WWKO 1VEMA 2ZWYA 3UTTE 1E6QM 1QACA 4YFDB 4JFXA 4KJWD 3VD3A 1QLEH 2NMSA 4UZUA 4M8QB 3IDIA 4FK9A 4WF7A 3I85A 1FN4B 1IM9D 1QEWA 4CRPA 2EICA 1NGWB 3EOTL 1Z9OA 3TJEH 2Y4SA 3FTGB 5F6IB 3WFZA 5FM5M 3QWRD 1LE5A 5EN2B 1JYNA 5HGAB 3RFZC 4YDJB 4PYGA 4M93C 4M6ML 4HGWB 2NR6D 5EZIH 5K9KA 2YL8A 1GORA 4LLYA 2VDNL 4GW4A 1U58A 2WIIA 2CDEB 3WL0A 1YEKH 4MD5B 1I7RA 1BQHG 2NW3B 4HXBH 1UKOA 5DTFB 3PWLA 1BMGA 2VXUH 5EPMA 4AL8H 1UENA 1MVYA 2PW2A 3IJSA 4MAYD 2FZ3A 1I3VA 2GUOA 3L7EB 5D1XA 2O93L 4JREB 2C3XA 2FEEI 4KK5C 3M6DA 4QNPF 4ISVA 2BSSB 4MJ5A 3DVNA 4ZUSB 5GGTA 4M6NL 4DOHE 5CKGA 3TN0A 2XZZA 5IHBA 2P7TA 3WFCH 1VEOA 3MRNB 4LGRB 4UUJA 4ODUB 5L6YL 5F88A 3WCYA 4IPNB 4UT7L 1JL8A 4NRYA 5GRUH 4YH6A 3UYPA 3ZE2F 4P7QA 4XZUA 4XNYH 5DO2D 3WFDL 1AR2A 1EGJA 2YD5A 3PZNA 43CAA 2R0LL 3TA9A 1ZVSB 4MAUL 5IWLA 4OQTA 3VRLF 2IG2H 2CRMA 2VYRE 3DGGA 5FYKH 1MFEL 2AABL 3RPIB 4ONFL 3HG5A 4OKVB 1JWUB 1QRKA 4CCEA 1FYHB 1UD2A 4GQ9H 1OD0A 1GGIL 3A47A 3GK8L 4M3JA 3PZOA 2A6JB 1MJUH 4JFPA 3L4YA 3BZ4B 5CEZD 5IMLB 5IVOA 3FB7A 4M7KH 4EUPG 4NP4H 1U6AH 4AJ0A 4M80A 1CE6A 1DEEA 4W5UA 5IBLD 3QDGA 4UTAH 2ICWA 4PJCA 4WHDA 1SM3L 1CG9A 4Y89A 1ZLSH 2JCCA 6FABL 1I3UA 1TCMA 4R4ND 1KFWA 3RWIA 1ZANH 1VESA 3DPBA 1CIDA 2VDML 4M1RA 2WXDM 5D9MA 4NGHH 4D9LL 5E2UH 2X4RA 3U0PA 2JE8A 3VU2A 1KNOA 1SJEA 4QTHA 4Z7OE 1XCTB 3W6MA 2AJUL 3HMWH 5E00B 3C6LB 4EN3A 1IZKA 4CL7A 1CIUA 3OB0H 1EXUA 3PGFL 2EKSB 5DQJB 3MOBH 1Q6GA 2I5YL 4JO2H 5CG0A 2GSJA 1FVEA 2YWZA 4Z7QE 3RWFA 3TYFA 3GNML 1MCEA 5A8MA 2WZHA 3BAKA 1WBYB 4G6AC 3MRRA 4YZFF 3VJ6B 4P4RA 3N9GH 3Q5TA 5IP4A 5F6HJ 2ZCHL 2BNUA 4Y5VC 4XXCA 3CAFA 3PL6D 1D5ZA 5DFVD 3KR3H 3GUTA 4Y8DC 1I1XA 4JDVA 3O6FD 3CPLB 5L9DH 4UTBL 5LYRA 4I9WD 2AS5M 4NQED 1J05B 1J1OH 3B9KD 1GL4B 5CJQL 1JHTB 2DQIL 3DX3A 1HSAA 2PXYB 4CAGA 3M17A 2UWEA 1INQA 2VDOH 1IGJB 3G5VB 5EU5B 1CDHA 3BSGA 1RULL 4IRJA 1BZ7B 1W0WA 4YBLB 2VH5H 4D3CL 3WFEL 2HVJB 4F7EB 1BFSA 1NBVH 4AIXA 3NA4A 3SOBL 4URTB 1J1XH 4LGPB 4G43B 5EFIB 5FHBL 1GPFA 1RQ5A 2OZ4L 1NUFA 5ESVA 4ODXB 3VW3L 3MA7B 1MWAH 1WE5A 4XPGL 4CD6A 1T2XA 4WI9A 4ZE5A 3I2CL 4I2XE 3MRMB 3AREB 4ELMF 3N1PC 5J1SC 3HG1E 2O92A 3HR6A 1JVKA 3PE9A 4JVWA 3UP1A 4LLQB 2D03H 3CFKA 4GT7A 1F5WA 3T0BA 2ATKB 4PG9B 4M43H 2BNQE 1GJWA 2QF8A 4W8LA 5E99L 1FLTX 2JIXB 2VLJE 2G75A 1NBVL 3BPLC 5BRZB 4OT1H 2F2HA 1OGBA 1IGFH 3P0YL 1JNHB 1VHPA 5KSUA 3VFTA 3LKPB 2VN7A 3UO1H 3OBAA 5HGDA 5CJ8A 4Q6IB 5CEZH 2WW8A 2WMHA 4ERSL 2BMKA 1MW3A 2DYPA 3IETA 1Q72L 4NZUH 1HVXA 1UWQA 3QJHA 1Y18A 3P73B 3L5WB 3EYPA 5TF1H 3FO9A 2XI9A 4WO4A 1T1ZA 2UWEF 3EJPA 4LLMB 5CP3A 2BSTB 3CVIL 3BN9D 2BOBB 3O2VH 4LPTA 3V4VH 2VI0A 2Q6WB 4P9HC 1YN7B 3TIEA 4EQ2A 3RWFB 4GKZB 5HYSG 4XPBL 4ONHB 4HH9B 4I5BB 3VRJB 2X4SA 4P2QE 1R3JB 4ZFFA 5CZKA 4TUFA 1NL0H 4U6HB 4FQXA 4PGEB 3X3GH 3GH5A 2FHBA 2VXTH 5KSUB 5IEHA 2J5LB 4OLUH 4F57L 5E8DH 1WDQA 1SJEB 4QTHB 5D7JC 1RUML 2CH8A 3O6FA 2VC9A 5D7SH 1N7MH 1RVFL 3FMGH 1BHGA 1KLFA 3DXAD 4G9DB 2ARWA 3VH8G 3CZSA 1FL5B 5AC4A 32C2A 4ZUWA 4MNMA 4X4ME 3W27A 1BD2A 1DQTA 4NQCE 4BELD 5FD0A 2J7EA 3OAZH 2X7LB 4MAYA 4XMPL 2FIKA 4J12A 3F6IA 3FAXA 1G0CA 1IQWH 5A16A 4J2XA 3ARPA 2EDXA 4JQXA 1NAMH 1EHLH 1JDDA 2F53B 1NCDL 1IGYB 1MWAA 4MJID 1U6AL 4N90E 1G01A 4X7FC 3H7BA 2ATPB 3SKMB 4I3GA 5A6LA 2HWZH 1J5OH 1NAML 5DD6A 1YN6B 1FAIH 2WM0A 2XM1A 2BFGA 1EK3A 1KTLA 3QO0A 4OFKA 5HJ3A 2WSKA 1MRFH 4K3HA 3MO4A 3P9WB 4YQXH 2Z35B 1YQVL 4OGXL 2ESVB 5SX4I 3RKDC 3VWJB 3FXYA 4AZ5A 1NMBL 1YNTA 3S36L 4IRSA 1MOEA 3ILQC 2FCBA 1U3YA 3QIWA 3QHZH 4NO0A 3OAYK 4LLWB 5CJ5A 1NLDL 1TJHH 3CH1A 5C0ND 2E7CA 4NX0A 1S3KL 2ZX5A 3MS8A 2L4OA 5J11C 1H3PL 1J5OL 1GVIA 3VTRA 5TQ2H 5GS0L 3FB7B 2W91A 1OP5K 3GBDA 4NQVB 1HQ4B 2BSRB 3KYMA 4Y1AE 4XNMA 2X6MA 5K9JL 6TAAA 2AV7A 4PBVC 4PV9B 4S1QL 1UD4A 4JVUA 1P9MA 4GZEA 1NCAH 5KSAC 1A5FL 2P5EE 3MRIA 4YHKH 1MW2A 1QWNA 1HKIA 5DJ8B 3ULVL 4UV4L 3CUIA 4E5XA 1KGUA 3RWCA 3OAUH 1XCQA 3NFSH 1OWRM 4R7NA 1HZHH 5I77A 3RX5A 4ZFMA 3G6JF 4JHZA 3HR5B 5EZLB 2E8YA 2FIKB 5DVLA 3QEHB 2MNUA 2VZVA 1AR1C 5T1LD 3ULVE 3LEYH 3RUGE 1U8QB 5DGRA 5J8OA 2XJ7A 5J9PA 1J18A 2NZ9C 1W72H 2ZUTA 3SJVE 4OF3A 2C1PA 4K3EL 4N68A 4XPAL 4BYHA 5EOQH 2ZE0A 3W39A 2NY4D 3C60B 3TYGL 1DVFA 2EPKX 2VE6A 1FC2D 2YZ8A 1AGBB 4ZFGL 1OGAE 5J4MA 3W9DB 5E08L 3QIWC 1JDCA 1FH5L 3UBXI 4XCYB 4UIKL 2WHJA 2DJSA 1DWJM 2NY3D 1NCWL 1UWGH 4GKZA 1MCDA 5TF1L 1A3LH 1IC5L 3ZJ7A 4X4YA 3ARXA 2WBGA 2Q3AA 2VR4A 4NBZB 2J7HA 1EMTL 4JPKH 4LIQL 3ZR5A 4Y16D 4B0MM 1F3JB 4BH7B 2V2WB 3B2VH 4NJAH 2GFBA 4HU0A 4AMCA 4FXGA 3FQUA 2EDTA 5IHZB 5I15L 4K23L 5HD8D 2F7RA 5MEND 1U8OB 3RI5F 5JXEC 2MWCA 1Y0LA 3UTSB 3GSRA 2P7TB 1XGUB 3HPJB 1KJ2B 5LVEA 5CBAA 1DUYA 1U8KB 4JREC 4D6EA 3VNYA 2P43B 3U7AA 1RURL 1H41A 4DO6A 4F3FA 2XSAA 2AXFB 4NIKB 4XX1E 1XH0A 4E8CA 4HK0A 1XV8A 3LH2H 4AT6A 5EU4A 2FNBA 4HUWA 1FYTD 2K1MA 4OFVA 4HV8A 4Y5YC 2JIWA 3UPRA 1NMCC 2ADFL 4OZGE 4UMGA 2EIDA 3QHTC 2X9YA 5HHQA 3SY0B 1LWRA 4ACYA 4U7MA 4WFGE 1A7RL 4NQDD 4U1LA 4WCYH 3T0EA 4UQDA 1G9NL 5I19L 4X6CB 1MCOL 3HC3H 3EOTH 3RZWA 4L1DA 4OUEA 1HKLL 3CU7A 3QFJB 2YA1A 1LP9A 3LD8C 1KULA 2BCKA 1AE6L 4R2GB 5GGQH 2PXYC 2ZXQA 1HH9A 2EIBA 1WT5C 2CBUA 4I9WE 4PRHE 5HNNA 4L8BB 4HKZA 3ARDA 2NXYB 3QUMA 5JQ6H 5I1GL 5FUZH 3MBXL 1A7RH 3VH8B 5IB2B 3SGJA 4LIQH 1J8HA 3WMSA 2A74B 1HINH 4PS4H 2C8NA 1MI5A 3KR3L 1FO0B 3R4DA 3H42L 2ILLA 1TITA 1MAMH 3CVHB 4Q9RL 4W85A 3MRPA 3MLRH 3IDMB 3MSGA 2PTVA 4APQD 5C0GB 3GSVA 5ELIA 3QXDB 2KPNA 4XCEB 3SDDC 3QJFA 4QRPA 3WKML 1NFKA 2XZCL 1U8OA 4PJXB 2DD8L 5DJZB 4YHNB 2C3VB 2XOTA 4PYSA 1GUVA 4XNXL 5D2NC 2BCKB 2X42A 3RY5A 3VXRB 3H2WA 4PD4J 4NDMB 1C08A 4ZUTB 2A83B 4PJ5A 4X6EB 3W24A 4IM8A 1FGNL 1G0DA 5DVNA 4X4YB 4OM0L 1FZOB 4JRWA 5K9OA 2EXOA 4XGZA 3QUMH 2EO1A 3BGFB 5FA4A 4DWSB 4JKPH 4WWKC 1N0XL 2XYCA 4HOZA 4L4VA 2QPUA 1NCTA 4PJ5E 5I8EA 6FABH 3UDWA 1OOAA 4YXLL 4BQ5A 4PJGF 4BH8A 4JHWL 2OWCA 3MLUL 1ZHNA 2PTTA 2WP3T 4J4PD 5HYJD 1IILE 4LSDA 4PJAB 4ZXLA 2IQAA 1W2PA 1WC7A 2O5ZL 3ARED 3VXMA 4NQSB 2CBIA 3SKJL 4JRXD 3RWIB 2YHGA 1QVBA 5C70A 3UG5A 3UAJD 4FFWC 1NFDF 3GBNL 5D1QA 3AMDA 4ZAKC 5LWYL 3CUHA 4HPOH 3EW3B 3AHZA 5FK9B 3S98A 4FQPA 5I74B 3ZDYF 2E3ZA 3F7YB 3BUPA 1YMMA 5LGJA 3QXAB 3MOQA 3VFSB 5TJWK 4UOW0 2LQRA 4HC1L 3SKNA 3WENA 1F58L 3DX6B 1XCQB 4JO1L 2BNQB 4HKXB 3T0ED 1A7OL 4HKBA 3R8BB 5HHME 1ODZA 1KPVA 4JM2C 1HXJA 3MC0A 4MJ4A 4O5LH 1GCYA 1LP9E 4ZOAA 4WTZG 2J2ZA 2HLAA 3O8XA 1Z0NA 4W86A 1ETZA 1FIEA 4FTVB 4XNXH 5FB8A 2D73A 1S7XB 2XTJC 1V6VA 4TTDC 1OF2A 1Q0YL 4PRBB 1X4YA 3I3DA 4P2OA 1H4PA 3VVGA 5C92A 2Z1KA 4YR6B 5D72L 3FJTA 1NQBA 3HNSH 1JPGB 4GRWH 1C90A 4PJEA 3WELA 1IQWL 4KI5F 5KTEH 1MHCB 4HS3B 1I7ZB 4IOIA 1XIWC 4OZ4B 2P8PA 3IDYC 2KBGA 5KVDH 3FO0H 2ZUQC 2DPEA 1MH5A 1UZ6F 4KTYA 4ODWA 3VXSB 4N90D 1GGCH 3C2AH 1QRNE 1R5WA 3OMZA 5FUZL 1ZANL 2DBLL 3AMGA 3DMMB 5EU6A 4JAWA 1OL0A 2XN9A 1V7NL 4RFOH 5C86A 5FYLL 1MRFL 5DUBB 4Y5VA 1RJZA 5DQJA 1IAOA 4ZXBA 1L0PA 2WBJA 2D4DA 5C07E 1EX0A 2V9TA 1HNGA 4PY7B 1EV2E 3NGBC 4OV5B 3JV0A 5DR5L 1ADQH 1QW8A 4MNQE 1PAMA 4JJHA 4PV8A 5CINH 2CXKA 1B90A 2J4WH 4R96A 1RHFA 2O61B 3G6DH 4L4VD 3GSNA 3PQYD 5C6TH 2J5LC 1MFEH 4YDIL 5DMKB 4L3EB 1HIZA 1CE6B 3D18B 3QI9D 1NEZG 1FSKC 2XQBL 2RAMA 1NDGB 1T66D 2NT0A 5C8BB 3BQUA 1IBGL 3FOMA 2DBJA 3FN9A 4EUPB 2RB8A 3ARFC 2H32B 3WL1A 2OR8A 2ZOXA 3C09B 5L2KA 3QWOB 1YZZA 1HCVA 4X80L 4JEGB 4CN1A 8FABB 4UQ2B 3WO3B 4PTUA 1P2CA 4AENA 3HMXA 2XVKA 3LSOB 3V6OE 1Q6EA 1J1PL 2AQ3A 1V0KA 5GRXG 2P5ED 3O81A 4R0LB 4XVUD 2CSPA 3B2VL 3C5SA 5CWSA 1ZT7A 1FFPB 4J3UA 5FGBC 1RZJL 4JFEB 3GGWA 5TE7L 4HSQA 5ITBH 4OLEA 3IDJB 3VXTA 4KGLA 1EEZA 1TFHA 4GRLC 4ACZA 3RWGA 3RZCC 4QRQA 1B31A 1IAIL 3K7UA 3SBWC 4PUBL 4HLJA 4DZBA 1DVFD 3V5HB 2WWDA 3GO1L 1WLHA 4RFEB 5DMKA 5F7EH 5I6SA 4ONOA 2EDKA 5LKNA 2A9NL 1ZLVK 3UO1L 3M46A 4LAJH 4P2CG 4B3KA 1J7VR 1W1VA 1NGZB 4LSQL 1PKQA 5FGSA 5EZOH 3CV5A 4GW4B 2YPKB 4R5EA 4TUKH 3P30H 4L3EE 4JHAH 3ZLQC 2AJYL 4MQ7B 4GRWE 3CMOL 2HJKA 1EH9A 5TDOA 3PHAA 5KSAB 4PFEA 5L2JA 4Q9QH 4UT6L 2DJUA 5T1DL 4LEXL 3RUGB 4YDKH 3UX9B 5I1AB 1I8LC 4LLMA 4QAWA 3CUFA 3MUY1 2EXWD 3MUHL 3WJJA 1I75A 1KIPA 1RH9A 4KHTL 4XPGH 4EN3D 3QJFB 4QRPB 3DV6A 4YHIB 4FFVC 4RGNE 4UU9A 4MLIA 5MENE 1J1XL 4M5ZH 4KKCD 4WUUA 3MBEC 1SJHB 3X12A 1DSFL 2NYYD 1RPKA 2GJ6A 5KSBA 4OLWL 1QNPA 3G6JE 1FYTE 2VDQL 5T3ZH 2IBBA 2HJFA 1T3FA 1CFQA 4O00A 5K93A 3H55A 1MY5A 4TPRH 1U8HA 4Y5XB 3T3PF 1CGTA 3GMRA 2C1OA 4YE4H 3LN5A 5DDHA 3KAAA 3KLHD 1UCTA 1BQSA 5LQBH 4HC1H 5DGQA 4F8TA 3PL6A 4LP5A 1FZKA 4LVOB 1XAUA 4L3CA 3RJDA 4Z2GA 3IJHB 1BYDA 4FQJL 4ZUVB 3HAEB 3JV6A 2SEBA 2EDRA 1DBAH 1ZJBA 1I4FB 3SDCB 2RJMA 2YFOA 2ZXBA 3M8OH 4WW2C 5LG1A 4OLWH 5BS0A 4NQDE 1S7TB 1RZ8A 2APWA 1FYTA 1RAMA 4M5ZL 4D6IA 4NKQB 1Q0XH 3O3AB 3GJEA 5D1XD 3SCMA 1F6LL 4PG2C 3O2DH 2QEJA 5IM7A 3VIKA 3CX5J 3HJEA 1YECH 1GHFL 2AEQL 3NTCH 3VSVA 5TH2B 2HVJA 3TBYB 1GOHA 3SE8H 5CHNA 2VIRB 3RPKA 1WDRA 3A6OA 1UJ3C 4HFUH 4U6YA 5L0QC 2F9BT 3EYUH 5D96B 2XWBB 5I8KH 2DQDH 1MY7A 2FX9H 3GSWB 2E6JA 2R2BA 1QRNB 1FH8A 2DSKA 3TCLB 5HYQB 1DL7L 4P57B 4DKFL 5FL0A 4YPJA 5C0JA 2EYSB 3C5ZA 2Y06L 1FH7A 2N7BA 1CE1L 1C5CH 3G6AA 1CXHA 4E42A 5BYWA 1W72A 2GYSA 4IEFB 3BE1H 3BZEB 2C4FU 3B8YA 1E0VA 4Y19D 4XNMB 5BQ7A 1C8XA 1MH5B 3NH7H 4R4BA 1Z9SA 5ISZE 2O9TA 4JCLA 4PN2A 3P4OA 3MKKA 4YEFA 1P1ZA 1YPZA 1DQDH 5E7BA 4IMLA 3OAZK 2X70B 4JFFB 4GG6F 4F8XA 4GKSA 2OZ4A 1CDJA 5IGXL 1G9HA 1UYQA 1VADA 3JXAA 3NDZA 1JTPA 4JRXE 2XIDA 3T2OA 1FV1A 4LCUB 4PJ5D 1S78D 3MRPB 4CMMB 1BAFH 2WMPA 5A40E 1TVHA 3REVA 1ZGLP 1EOMA 4TXEA 1P6WA 1JV5B 4NWUH 2G5RA 1B3YA 1OTTD 5HJ3B 1A21A 1JZ6A 4PJHF 5GRWA 1WCBA 1AGEA 5HGHB 1MFCH 5MEQA 4AD1A 1ZTXH 4ZOBA 1QSFE 4C4KT 3DRQB 4QXUL 5T1KD 5F7MC 1UFUA 1YEFH 2VLLA 2R4SH 1H0GA 3QG6B 4JM4H 5HHMD 4ZTOL 4WIWA 2AK1H 2FX9L 5ADOL 3I9GL 4M61A 4RISL 2CJUL 1B3ZA 2B4CL 2NY7H 3AY4C 2YDRA 1OCWL 1FLRL 4JFQB 1VBRA 1J01A 3BVTA 1HHKA 2ZX9A 1V6UA 4QY8A 4TSBL 5IB1B 3MV9A 4QRUA 2AJXH 4OZIE 1WC7B 3PZIA 1NGXB 5D8ZA 3CGTA 4LSPH 5F7FA 3PQYB 2NXZC 3EFDH 4HJ0D 3ZTNH 1ZTXL 1PVHA 4WI8A 5GJSH 4JFEE 5JO5A 3TBYA 5J12B 3MUAA 1ZS8A 1SYSB 2AJXL 2ED8A 1CGVA 1LEGB 2I25N 3AHYA 1E4KA 1LO2L 2CPCA 1GGCL 3C2AL 1ED3B 3VWKB 3GMMB 5B39B 5HPOA 1QA9B 2HRPH 5ETUA 2WNWA 1AKJB 4WJ5B 3CZGA 4K3GA 5CJOH 1PYWA 3L7EA 5CEXA 3T0DA 2X4QB 4RA3A 5FUOH 5MP6H 5D9PA 3MRDB 3AXIA 5DRNB 1N26A 1U58B 2WIIB 1EO8L 2BVPB 4W4OC 4F9LC 4NKIL 5DHVH 5J3HC 5F9OH 4G42A 3RPMA 3INUL 3HE6C 1NDMA 2PF0A 4N0FB 4M48L 2V3GA 4YC2B 4A6YB 1N8ZA 3RNQB 3ULSB 4LCWA 2XT1B 3QQ9C 4X9BA 3IJ8A 2R2HA 5B4MD 1OM3H 2X2IA 5EOQL 4KI5C 4MJ6A 4CGTA 3KXFD 2NNAA 3KPPB 2BVQA 2EDDA 2DI7A 2PO6B 1UZ8B 5EUKA 5C9JB 1FN4A 1QEWB 3TESA 2R0WH 5DHVA 1T03H 4CVXA 1G7IA 4MNQD 1MLCB 3CUJA 4N9GB 4ODHH 4RNRB 4RL3A 5FOBA 1OB1A 1JPSL 3UTTD 4S1RH 3B3IB 1T22B 4X98B 3P11L 5I8KL 3S7GA 4NKOA 2ED9A 2EDNA 4MD4A 5GGVH 3PHOA 5AY7A 2AAVA 1Z2KA 3QUXA 1WTGT 5GZND 1KQZA 1SBSL 5BZDB 2V7NB 3HG1B 1DQQA 1HKMA 3UZVB 1FFPA 1B4JH 3SCSA 5KVFH 1N8ZB 3RNQA 3A22A 5AUMB 2ZZUT 4X7CC 5D1ZA 3O2DL 5D7IF 1LK2B 3HFMH 1BLIA 5CSZB 4WEMB 3JTTB 4E4PA 4M7KL 1XH3B 3KHQA 4ZSOE 5L8KB 3SDCC 1MJUL 4HV8B 4BQBA 4MAZA 1UM5H 2OMNA 3HE7A 1V6YA 2IAMD 1IGJA 3FFCD 1I1YA 1UWXK 3SJVB 4HCRA 4V27A 2FHCA 4OLZL 4PJ8C 5DYOA 1JF1A 4PLKC 1FDLL 5I1DA 3L4XA 2XVNA 3LDBB 5F6HI 3D18A 1GH7A 3MRFA 3THMH 5DWUH 3VDAA 1GGTA 4HGKC 1EVTC 1MAKA 5AZ2H 3LKSB 2Z92A 4O2EB 2WZPD 1KIPB 4YQXL 1A9BA 3UROR 4X7SH 3C8DA 4IHOA 1P2CB 1Z3GH 3QPQD 3FB6A 5HHVH 2J7BA 1ORSB 4C4KO 3H3PL 3CXHK 4OV6F 1OAXL 2WC3A 5DUBA 3S4SB 3DYMA 1EHXA 4L29B 4PY8I 3X17A 2EYTB 3CDYA 3T65A 4H0GA 1WFOA 1J8HE 5ICXA 2FX7L 4AIOA 3WD3A 2VDPH 3EHBC 4P9MH 2PW1B 3PTKA 4MA7H 1A6TB 3AZSA 5IBUB 2YRLA 1CLOH 4XVSL 4JJ5A 3VXQA 3WXWL 3VIJA 4GPNA 4NZRL 5DJ6B 4XP1H 4QNPE 4FQ1H 3D3AA 1MLCA 1E1EA 4MDJA 5BXSA 1UH2A 4X9FA 3H0TA 5SWSB 2WB5A 2O61A 3G5VA 5EU5A 1PPIA 3SGDH 4RGND 1G0XA 3LKNA 3BAYA 3KPLB 1UA6H 5GISH 4HPYL 3TTOA 4P5MB 5I2IA 1RK0B 4RAHA 1JNEA 3INUH 3OLIA 3D1MC 3T08A 3U46A 1DDHA 3HS0A 1OSPL 4NJ9L 3VFRB 1X4ZA 1N4XL 4CADB 3OSKA 3MRIB 3E3QC 4B7IA 3QWOA 1V03A 3PDOA 5EBWB 1S7UB 2YD8A 5DHYB 3BP6A 4WU5A 4JFDD 3LQZB 5C6PB 5L0QB 4U3AA 3I6GB 2Y23A 3I6LD 1MCSA 4AMKL 2HFFB 1F00I 1X5YA 1IC7L 2HJLB 4OFDA 4ZD3H 5IMMA 3BH9A 1TCRB 3KYKL 3RM8A 4QHUB 3SDAD 2CO6B 5DFAA 5I17B 1CEOA 2HTLD 1X5GA 2OJZH 3VGAB 4OB5H 3P0YH 1W3HA 1KGXA 3RHWK 4P5TB 3WO4B 3K0WA 4ZUUB 3N06B 4XVTH 4C54A 1E4WH 2XPKA 4U5KA 3PHQB 5DJYB 1F02I 3LKNB 1P84J 1KLGB 2Q1EA 3LKRB 1RJCA 3WF4A 2L0DA 5IB1A 5IWLC 2F5AH 5C8JA 2Z35A 1YA5A 1KXTA 3QNZA 4KDVA 5E8NB 4KZEL 4D9RD 5BVPH 3EYUL 1WB0A 1XYZA 5I17A 3VW3H 4DAGL 5C9KA 1AGFA 2C7UA 4ZTOH 2VZOA 12E8H 5IW6A 2XG4A 3KJ6L 4KUZH 5D2LB 4D1IA 1WZAA 4U2YA 2VDKH 1BG9A 5T33H 5ISZD 2EZ0C 2EPMX 5J0BA 3S4SA 2XQYG 1GOFA 1Q0XL 1JGUH 1KEMH 4NQDA 2ICWJ 4DCQB 2VX5A 3QP3A 2CIIB 4PJAE 4LU5L 5HVWA 3SDXE 1GCFA 3NFNA 2CETA 4PP1D 5D1QD 3ARWA 1BAFL 1JV5A 1CU4L 1T1YB 2MOVA 3NABL 4P23C 4UV7L 4YN5A 1KLGA 4XT1C 1CLYL 2M2DA 2GDVA 2H2PC 1ZEAL 4X5WB 5DMIL 1FVCA 4XI5D 4PJ7F 2IPUK 1A1OA 3PF2A 5DJAB 1QFWH 3T4YA 3QUXC 3QFDA 3UTOA 5DMGC 2DLIA 2CBVA 3H3BC 4NN5C 3VWKD 2JB5L 4MMZC 1TZIA 4FS0A 1NCAL 1CXKA 1LO3H 2GJ6E 5KSBE 1J05A 2QMKA 3W5MA 1ACYL 4W84A 4PGDA 2W9EL 1I1FB 4PLOB 5JDSB 2E40A 3H9SE 3SDXF 5A2KH 2J8GA 5D9SA 1RV6X 3WEXA 3IU4L 2W4XA 1V02E 1EJOH 1ZHBB 2KQMA 3I6KB 1V0LA 3W9EB 3LS4H 3KPRD 1NEUA 2COQA 3FRPG 3RTQC 5KZCB 4XPTH 3TYFB 4RWHA 2A77H 2YPLA 5B3JF 3GBML 2XIBA 2CLZA 3P4LA 1BZ9A 4TVPH 1DWIM 3LXAA 2D3NA 3IFOA 5HGAA 3LB6D 1LO4H 2FL5B 2R23A 1I3GL 5FCUH 5HYSA 3P0VL 5IQ9B 2AJYH 4NQSA 4MX7B 1W8NA 4JLRB 4JFED 4Q9BA 3VFWA 4KK9C 3NFPB 3HI5L 1TFVA 3TV3H 3TVMC 5CJXA 1A7BA 1IQDB 1NPUA 3KJ4C 1QSED 5IVZB 1WAAA 3CDCA 2CUIA 5E03A 4UNTA 1YPZF 3DIFA 4IDLA 3TT1H 4DO5A 2BVDA 2LU7A 2ITDB 1G7MA 3EGSA 4JZJA 2JKXA 4G8EB 4GKNA 2DKMA 2BVUA 2R9HD 3CSPA 4V1DD 3MV7A 4PBWD 4HZLB 1CVSC 4FQQA 3LN4A 1UXWA 2NNAB 3NCBB 5DHXB 5BRQA 1MJJA 1R3LA 1DBAL 3T4AA 1X3DA 1BM3H 2VVNA 3AU1B 2Z91A 3OHXA 4NRZB 3UR8A 3EYFA 4FQJH 1HKKA 1BD2E 3KG5A 2AK4B 3S8WA 5DD5L 5CEYB 4M56A 2JJSA 2JLLA 4H8HA 4PJXA 2N7AA 4LMQI 4PJHA 2D7TL 3MBEA 4N1HB 1P84K 3O4LD 1G7JB 3VGDA 3QAZC 2HG5A 1L7IL 1H15A 3TOPA 4GXUM 4MQXD 1PKOA 4HUUB 4XP6L 1M53A 1UD3A 2D31B 1WZ1H 1RY7B 2WPGA 1MQRA 3WJJC 2WWKT 4P2QA 4OCMC 5FYJH 1G7PB 4XV0A 1RU9H 4JY6A 1W91A 15C8H 4LLVB 1JAEA 2BY3A 3MZTA 3D25B 3OKYA 1KN4H 2ZSVB 3MANA 4JPKL 3BRFA 3L6FB 4HKZB 1SBSH 5DFWH 3S3SA 2CCRA 2Z31D 2CIKB 1VFAB 2VXUL 4ORZC 3OA5A 1JN6A 1CXEA 3KYNA 3C87A 4WLCA 4NCDA 3GBLA 4OAWA 3B9VA 4WY7H 2AGJL 3CK0L 1UC6A 4ERSH 3QIUC 3MLZH 4MNQA 4YEEA 4WFFE 1WAAF 4IBLT 1A1MA 3LVEA 4P3CL 3U36B 4N0FA 1MSPA 3JWOC 5JW3L 4OZHF 1AE6H 4WENB 1N5AA 1PKQE 5FHAH 1AHWA 3ZJKA 3W0KA 4Q7DA 3PJSB 3OJDA 3RVXC 2F74B 5FKPB 4Y4HA 5FYJE 2B39A 1XSKA 3HE6B 4YXHH 3DBXA 3T2PA 5FOOA 2D03L 5C0EB 4U1SA 4WFED 4MJIB 3PGCB 5FGCE 5T3ZE 3EBAA 3I3BA 2PC8A 5I66A 4J6RH 5BROA 1T0NA 4XBPA 2FB4H 4JFZH 3W11D 1MHHA 2X0HA 3QT2A 2JJTA 1W2VA 3WH7A 5JO5B 1BOGA 2Y72A 5CJOL 4KROD 3AB0C 4R4FH 4Y19B 3S35X 1IKFL 2OSYA 1W3JA 2F8QA 4BZ2L 2WAGA 3V6OA 5ESQA 3IDUA 2EACA 4OGYL 5BVJA 2OLDA 4LLAA 1RU9L 3LX9A 1FP8A 4OKVA 2FSEB 4MGXA 3NMEA 5HHOA 1QSEB 4TUJB 5MEPB 2GJPA 3EJSA 1WIOA 4NRZA 2UWEE 4YFLI 1UGNA 5L2KD 4O02H 2ZNXA 3WF1A 4TSBH 4O58H 2CERA 3BMVA 1S7VB 2GHWB 2ZOLB 1NEZA 2GK0A 1H5BC 3GJFK 1LD9A 3WDRA 4P48A 1AGFB 2C7UB 1JPFA 2DMCA 1VB9A 1C1EL 1KC5H 2H2SD 1YJDL 3UC0L 1E27B 4FQLL 1BM3L 2GSGB 5HTSA 3WIHA 5ABGA 3QIWB 1T4KA 4IOFD 2VDLH 3O3EA 1OHQA 1P4BL 1VEPA 4N0CC 2GT9B 4DW2H 3BQUD 4IS6A 4IDJL 3G9AB 3RBSA 1D2KA 2OLHA 1I1CA 4FMKA 5FM8A 1KB9J 5DA4A 5E6ID 3R0MA 3QI9B 1HJXA 2VMFA 2AMGA 4U5IA 2BDNL 1IAII 2QQKH 3T77A 2L7JA 1ZHKA 2XN9E 5IM7B 5BRZD 1V3LA 3LRSA 3BH9B 5TPWL 4S1SH 1MCHA 3QQ4A 4L9DA 3QCVH 2OSWA 4NO5B 4NM8H 1TMQA 1LO4L 1D3CA 1JFQH 5I18L 2DQUL 1GSMA 3ALGA 4PMYA 3Q1SH 2XA8H 2EH7L 4BFGA 4H5SA 5MEQB 1Q6FA 4YE4L 4P5TC 3ARGC 4QXWA 3WO4C 3EKCA 5AYBA 3FFDA 2HH0L 1EAJA 3DX0A 3C08L 2VWEC 3QZWA 3MNWB 4POUB 4QXGL 4ZSOA 4GQQA 4JL2A 1YNLH 3L4WA 1NC4B 1JGLL 1HXMB 3PDGA 3BGMB 1FRGL 5C0GA 1F4AA 2YBRB 1W72L 4G9FD 4O51A 5CGMA 4AZ7A 3LQAH 4F15B 4XCNA 1FFNB 2WHLA 1WT5A 3I50L 3VFTB 4F7PA 1DFBH 5CKAA 3HN3A 2EDLA 3MJ9A 4ZPVA 4OZIF 35C8L 3FT3B 4YDLC 4NOFA 4OLXL 5IROA 1YEGL 4XRCA 3V2AR 1G9ML 2ADIA 3NPSC 3CC5A 2Y7QA 2HVMA 4KZDL 5CQ1A 3OZ9H 3PV6B 3KPRB 1QX1A 3KWWA 3RGVD 4MSWA 3KPTA 4RMSA 3AREA 1R75A 4F33A 2X40A 5L8JB 1OQXA 2EDFA 4WNQA 5A6BD 3M07A 1QP1A 4MWFB 2DICA 1LEIA 4DO4A 2YXMA 5E5RB 2HJKB 2FLBT 3AIUA 4N1CA 3F58H 2VSDA 1F45A 3R1GH 1S5HB 5ESAA 3RKPA 4I4WA 1XR8B 3SY0A 1HVQA 1AMYA 5CSBA 1BFNA 5IB3B 3C2SA 3GSXB 4PD4K 4PJ8A 3ILPB 4BQ2A 1HJQA 1HI6A 4YAQA 3M1BA 4N9OB 1FBIH 2F8OA 1ZBKA 5LCVL 3LPWA 2HJFB 4QHLB 2FRGP 5HYJE 1YNKL 3DRTB 4PTTB 1ES0B 4GUPB 1BVKA 1HSBA 1HWWA 4U6TA 4UZSA 4XUYA 4XAKD 3BEVB 1RMFL 3ULUE 4OGZA 2X1PA 1M01A 4QHKJ 1ADQL 5IMOA 1WGOA 4KRPB 1XYFA 4F7MB 3UTZB 3VMNA 4E41B 3VXRA 5FKAB 1A6WL 1GGBL 3FFCA 2F1BA 1D5XA 3GMQB 3EJYC 4JB9L 4JFHD 4CADA 3G5YA 3L1OL 2EIZA 3FO9B 3QDMD 4E9LA 1QFOA 4QRPE 5DRZA 1IVLA 4ZD3L 4QLKA 1NSNH 3VRLE 2Z4QB 1U2CA 5KSBF 3GSVB 1BX2A 1Q94A 3SQOH 4DN3H 5F9JA 3V79C 1O7DC 4FF5A 1BZQK 4WV1B 4BFBD 1OTUD 1QNOA 3ZE2E 2V2TB 1EXUB 4AMWA 1HILA 4MXQD 1MI5E 3B9AA 4G6JH 1FFNA 2X9WA 2VZUA 5JPMA 2X10A 5I1GH 5A2FA 4TTUA 4QYOA 4H8UA 3ARYA 5I71B 5FO7B 1E1FA 1VBUA 2D3VA 1WZKA 4WUUD 3IDXH 3F6LA 5CP7A 1JP5A 1AD0B 1NOFA 1YC7A 3SHSA 5SWZA 4XVSH 3WXWH 2XXMB