3VGGA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltoheptaose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
554
structure length
554
Chain Sequence
YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords Malto-oligosyltrehalose trehalohydrolase
total genus 193
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vggA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vggA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vggA02
3GSVA 4H2CA 5DHYB 4FP8H 2FHBA 3KPRB 3MV11 4XTRC 4IMLA 5IEHA 5EIQA 3MV9A 5EIVA 1GJWA 2XKNB 3F7RA 3KGRA 1MEXH 2AJUH 4Z7WF 5C0DB 4KJQD 5A3ID 4HIEA 3MLTA 4CKVX 4EDWL 1KTCA 2BVQA 1JV5B 2DYPA 3L5WB 3DXAE 3MROB 1T66D 3WFDH 1XH2A 5EO0B 4FQCL 5IM7A 5D1ZB 4WEMB 3M07A 3IRPX 4XNZC 2AK1L 1ZS8B 4WIQA 1UHVA 4NCC1 4DAGL 1NC4D 1U8HA 1JAEA 3DX4A 4WTWA 3OAYH 3AHTA 1INDL 2FJGB 5TE6H 1K3ZA 2FNBA 2AEPH 3T3PF 5FD0A 3LKPA 4F7PA 3PZQA 4FFZH 4OCSL 5IW3A 4OZ4B 3HMWL 1FBIH 5D2LB 1QFUL 3MA9H 4TOYH 3QAZC 3UPRB 4KWUA 4IOFD 3WUEA 4MA3A 2NW3A 3IFNH 4OLUH 5JOFA 2P5ED 1C7TA 5M5DA 1E4XL 3GKWH 4AMWA 4J6RH 4XP1H 3PGFL 3RAJH 3X3GH 1LP9A 3H9SA 1I9JL 1IGTA 1AHWB 1S7VB 3KPLB 5FKAB 2E0PA 5CGMA 2CCRA 5C2BL 1UZ8B 2BNQD 1FL3A 3MMWA 4XPFH 4AEFA 1MJUL 5F88B 4XX1G 3AIRA 3UBXG 2EE9A 3U0WH 4JGJA 2GSJA 2F1AA 1FL6A 5C09B 3ZE2F 1YC8A 3WF4A 2VDOH 5FDWA 1RIUH 5DI8A 4XVUC 4JJHA 2CKBL 1W72L 3MRKA 1DQDH 1MHEB 2OZ4L 1MXDA 1A8JH 2P8LA 2ZNWA 1HDMA 2IQ9L 3N50A 4NKIH 5CEXB 4QCFA 4HS8H 5I71C 1IKFL 4URTB 1QPKA 2FBJH 5EO9B 4H5SA 4Q9CA 3UJJH 4U5IA 5BVJA 1KTRL 1TJGL 4OGAD 3AS1A 1CS6A 4FLOA 2AK4B 3SO3C 4ELME 2PYEB 5TDNA 2PR4L 5M3WA 4WU7A 2EE2A 1R7OA 3HMXL 5JW5A 3MRGA 4C55A 5C0CA 4GPNA 3IDMA 1NKOA 4PJFE 3SJVE 5C0FB 2R8SL 1EGJL 4XP1L 1IAMA 2RHEA 3NA4A 4WDIB 2EYSB 3CZGA 1KN2L 4HUUA 2VB5A 5E1AA 3OXRA 1R0AL 3RUGA 4HIXH 4NHUB 3ULUC 5D71L 5DZNA 1B88A 1O5DT 1PX3A 1U8NB 1EBAA 3ARFA 1ZHNA 3CFBA 4W6XB 2Z31C 4NRXA 3EOYG 4XCFL 1TFVA 1ZLVH 3NIFE 3P4NB 3D0VA 1OGAB 4NXKA 5D7IA 2ZUQC 1S5HA 3POHA 3QWRA 3WHE1 5EC1A 4LOUD 3SKMB 5CJXA 4CD5A 4UILL 5TDOB 5ELIA 1JZ4A 1PBYA 1MVUB 4Y0GA 3EIFA 3RILA 1WWBX 1RULH 1PZUB 1MYRA 4Z77B 3IJHA 3BCDA 5F7EL 4IUGA 4FLSA 1D5XA 5IXEA 4W70A 1JGIA 2UVEA 4LHUB 4RZCB 3CUGA 4RQQA 1F11B 4NNYB 5JBFA 3UTZB 1SJEB 4GI9A 2CBIA 3GO1L 1BAFH 3SCVA 1F90L 4JFOA 4MJID 3JTTA 2VX4A 2YPLA 1E5JA 1NGYA 1IEBA 2B1HL 4G6ML 4GG6A 4YR6B 3ROLB 3DRTB 3PWLA 1NDGB 3GMLA 1TQSA 4YAQA 2ZCLH 4PCSA 4PUBH 3PWVB 2E7CA 4KJYA 4UNIA 1IC7H 1KCVL 1Q72H 5A3IC 1EQPA 2XFFA 3E6HA 4TVPL 5I71B 3DROB 1ND0A 1A47A 4ZTPH 1IGYA 1MQPA 3RIAK 4J3OC 4HPGA 5E99H 4UFLA 1IAKB 1QZ1A 3CCHA 3VD3A 1U8MA 1CBVL 2NY3B 4F7TA 4I13B 4V2CB 4GKZB 1R87A 3CDGA 4CVUA 1XH0A 4NO0D 2X9YA 2W91A 5C0IA 3BQUA 1VBUA 3CH1B 2QSCH 4DVRL 3B3IA 3GSXB 1NP2A 4L8SB 3EUUA 3HZYA 3VXSB 5JXED 5GSRA 3SGJC 4XCEA 3C09C 1AFVL 4KUZL 1TCRA 4KJPD 1RAMA 2A6IB 3OJVC 1S7XA 1N6QH 2ZUUA 4BH7A 4D0DA 9CGTA 4BFIA 3SE3A 1PX8A 1UWRA 5D2NB 4DO5A 4TTGA 1V7NH 3OG4B 4F79A 1V03A 1VENA 4DEPC 3ABZA 5E0FA 3RFZC 4LRNH 2XG4A 5C08E 4M9OA 3D69A 1MLBB 4YGAB 4HPYH 4QHNB 2WBJD 1DE4B 4XMKL 3N1QC 1AGCA 1CE6A 4Z7OF 3P9WB 2PF0A 5J6HB 1FA2A 3GXNA 5GGSY 2R0WH 4NBZB 1CFTB 2ADJA 3NCFB 4XC1L 1JFXA 3P11L 4PRAA 3N04A 4IRSB 2YN5A 3D2UB 4LSTL 2WYSA 2QHAA 4LP4A 1FO0B 4QT5A 1BJ1H 5AZ2H 4RMQA 1V02A 3RVWC 3PNWB 2CDFB 1JNNL 3DOSA 4RMTA 1LO5A 5ALBL 4YJZL 2KZ1B 2BRQA 3GNMH 1YEKH 4X4ZA 3PZUA 1C16A 2NY0B 3RL1B 3WUZA 3FT3B 4RGMB 2Q3AA 1HCVA 2DDQL 4FXGB 3GMMB 5JDSA 4G9FB 1U41A 3LPFA 1E0OB 3SKJH 5C0BA 1VHPA 4ZFZA 3SY0B 3DMMA 5A8QA 5E70A 4KPHL 5CBEB 3C6LB 2Z8VC 3PDGA 3EYQC 2V3GA 2E7BA 1I8IB 4P2OD 1HILB 3MOBH 1AI1H 4LIQH 1NFIB 1I8MB 4KVNL 3CO4A 4KVCH 4BSVB 4D9RD 3R06A 4ZUUB 1MFCH 2FX8L 4YXHL 1XGTA 2BJML 2B1AL 5I30H 2XWJA 3MRBB 4KQ4H 4PGZA 3RKDC 1UXSA 1WZ1L 4M6OL 4HGWB 1H49A 5KW9L 5IF0A 3FQUB 3OX8A 1WTLA 2AKRA 4BCEA 2R0ZL 3O2WH 1UA3A 4WUUA 4KZDH 4M8QB 4K3JL 3SDCD 1FE8L 4PJDE 2QQLH 2X4UA 2FX7L 3CTTA 5TQ0L 2AI0L 3T3MF 4P23D 4X6EB 3CUFA 5FK9B 4LKXA 2C5DC 1CL7I 2FB4H 3PHSA 4NYLA 4ATWA 1RSFA 3KPTA 2W0FB 1I3VA 1AGDB 1KT2A 2CLZA 3L3KB 4XPHH 3RWEA 3BH4A 2YD3A 5JLZB 5C07B 5C6TL 3SUWA 4OCLC 4ATDA 1NAKL 4D6GA 2O9PA 3CDFA 4XP4L 4NKOB 3LEYL 5GRZA 1HKIA 5FO9B 4XVTL 1BAGA 3OKNB 4OZHB 3AREB 4DQOH 2O26U 3RGVD 1J0JA 4GAYA 2LU7A 2OL3H 1RHHA 2UZIH 1TG7A 3FTGA 4NQDA 3LKRB 4GW5B 1FH8A 4ATLA 4NNXA 4APQC 1UENA 2HJLB 2YR3A 5HDRA 1EDGA 4EN3A 3VOCA 2X70B 1FO0H 4X99B 4F3FA 1ZLUK 4K9EL 2OR8A 5CMAA 2EDWA 5J8OA 1QSEA 1XF4A 2DSUA 1IAIL 1JG9A 3FO9B 1VKXB 4NUJB 2VJXA 4XMPH 3C8KA 1ZB5A 1D3CA 3RWCB 4AYGA 3QNXB 5EU3A 5HY9B 5IVZA 5EBWA 1CXLA 5CILL 1J5OL 1QW9A 1KR1A 3CC5A 3O9WB 2ADIB 1EXPA 1H3XA 1H0DB 4GMSL 5DUPH 3W2DH 3HE6D 2JJTC 4LVHB 4Z6AT 2BNRE 2FB4L 4YDJB 5HVHC 4QHLA 1ZA3A 3NFSL 4O2EA 3WO3B 4QHKJ 3F62A 2AJSH 3UXFA 3HE7C 2BDNL 1WUNT 4NO0A 4Y5XA 1JZ6A 4WRLA 3JWDH 5FYJD 1OSPL 4AISA 2Z93B 4Z2JA 3DX9B 4E41A 2XGIA 3G5VB 5CEZD 1JRHI 2AJYL 5GGRY 3QEGL 2O5XL 5LWYL 4JHAH 3UO1H 3LAFA 1KIQB 4P9HH 2LVEA 1U91A 3FB5B 3BOVA 4RGNB 2O61A 1RZIB 2NY6D 3ZR6A 4O2CA 3MS8A 5D7JD 2JJSC 4MTVA 3U0PB 2YWZA 5D7LA 3PXHA 1W9BM 5MEOA 3N13A 3PHAA 4JFDE 3WS3B 4K55A 5KZ6A 3HMXA 5EU5B 4PJDA 3CVHL 4G43A 5ISZA 3ARDA 3KR3L 1GQKA 1G7JB 4K3GA 2AJXL 5HHPB 3IANA 3UYRL 5LAXA 3MBEC 3BH8A 3PN8A 4NPYA 3L4ZA 2Q8AH 4MXQC 3BISA 4NKDB 4Z0BL 1DANU 4JANA 4CUCA 4YK4C 1PLGL 4UTAL 4UBDD 4HXBL 5EH1A 3G5XB 4R2GC 1HX0A 5I1AB 3S3PA 4OJYA 3EJQA 1JNLL 1AC0A 2ICEB 1DDHB 1JXKA 3SOBL 3OHXA 4EUPA 1K4CA 1DBBL 4MNHB 1P7QA 4APQA 4RMUA 2VXTH 3BVUA 1UASA 1NUDA 1NQBA 4NZTL 4UBDC 2DQEL 1H1NA 3GI9H 3QIWA 4G80B 4JFDA 1MHHB 2WUBL 2EE6A 3T65B 1II4E 1UYQA 4G8EB 4NUGH 3TONA 3MR9A 4K7PL 4OZ4A 4Z2IA 1TJGH 1R3HA 4Z2GA 3QUKA 2DOCA 1NCBH 1QI4A 1J18A 3MUGA 4N0YH 4P3CH 1E1FA 1V05A 1JF1B 2AGJL 3FN0H 4WFFE 4GRWF 3ZSTA 3WQVA 2JJTA 3CGTA 3MLSH 4PJBB 1D9KD 4MA1C 4QFUA 4KK8C 1Q94A 2YSSB 2F8VA 4JO3L 1E6JL 4H1LB 2FDMA 5FHBL 2NY7H 2C4XA 1OGAE 4OD3L 2W65A 5HHOA 1MFBH 3M8OH 4MSWA 2X41A 5KSBE 2X1XR 4KKLC 4KDTC 3X13A 1LDPH 3MJ8A 5L0QC 5DS8B 1KENH 2F53E 4P5KB 2YDQA 4XBGB 4XHJD 5CEXA 3S37L 3TJHC 5J3HC 3QUZA 4WHYG 5EZJB 3MJ9H 4OFDA 3D6GA 3X3FL 1ACZA 4JY4A 3RZCA 5E8OB 5MHSD 4HT1L 1QQDA 1MCOH 3AXLB 3TBTB 4RX4D 4ZENA 5C0BE 1U30A 3ECBB 5I1LA 2DI7A 3MRGB 3L6FB 1OP5H 1GHRA 4NC1C 4H25B 3KDMB 3HJEA 2GDVA 1AJ7H 3T2QA 3MXWH 1SM3L 3VXOA 3VMOA 4FQIH 1F8TL 1R3LA 3H0TB 3IS0X 3V7MA 3A22A 2ZCLL 1N5YH 2GHWB 2AXFB 4I4WB 4W7VA 4P99A 4HZ6A 5AG9A 4IBLT 3FW6A 4HH9B 4NNPH 4LPWA 2IBGA 4BUGA 1B4JH 3D0VB 4P59L 4YX2L 1QSVA 3RX7A 4PGBB 5EC1B 5I8EB 2W60A 3WKNA 1JPTH 3P4MA 4JPIB 4CJ1A 3NUKA 1FFOB 4EJ1C 4J8RA 4UT6H 3KLLA 4BQ3A 4PJAE 1IGML 3BFOA 4K9EC 5FB8A 4L5FL 5CEZH 2DLFH 4RL3A 1CIDA 5FOBA 2F74A 3WE6A 4ODXB 3HG4A 4XP9L 3G6AB 1RUPL 4KK9C 1F11A 1HYSD 5F9WB 2ZSWB 4HUMB 5EOTB 1IGIH 4ZAKD 1B3JA 3TLRA 3WH6A 4AXNA 5EBGA 2CJUH 4QLRA 5ITFB 4G7YL 5DQJB 4GI6A 4ZPTA 3BZDA 4UNUA 3DRTA 1MFDL 1M6OB 3SBWC 5HBBA 4Z78B 3LN5B 5IQ7L 4O9HL 2CERA 1EV2E 1FVCB 5DK3A 4IMKC 2IAMA 1R3IL 2VZVA 3OZ9L 4BJLA 5FA4B 4OFVA 3UTTD 2VLKE 1RUMH 5IVNA 4JRYD 4HP5A 5F7HA 4BQ6A 3EYVB 5HHOE 3AROA 2X2IA 5HYJA 5C0NC 3QXAA 1NL0H 4AZCA 3BWAB 2R1WB 2I24N 1GORA 4P23B 3QXUA 2H1PH 3CUPA 2XQBH 3I6LE 1PFCA 1KIRB 4PJGF 1JGVL 5SWZA 1NGZB 1Q8MA 4OB5L 2QQNL 4N0FB 4RISL 1QNPA 2WWKT 2A6IA 1YEDA 1KB5A 1KTDA 1GAFH 1H0GA 5LQBL 4W7WA 3ZO9A 4MB1A 4F37F 1L0QA 1M7DB 5FOJA 5T1KB 3ARGB 1T4KB 2AVGA 2BVEA 5IK3A 4BH8A 5DD3H 4GRMA 2CSPA 4PJAF 2C1PA 1IV8A 1ZL1A 5INDB 1S7SA 1BYAA 3AISA 3RIKA 4NJ9H 2X0YA 4MNQD 5CSZA 1DE4A 4EDXA 3L3OA 4U1MB 2R9HC 2X7LA 2VLJD 5F7MC 4LHUD 3O2LA 3WY1A 3BLKA 1F4AA 1VADA 2VVNA 2ZPKH 3VRIA 3FKUS 1MAMH 4PRBB 3FL7A 3IJ9A 1NCUA 1QRNB 4NBXB 4QT5B 4FNLH 3H3PH 3FB7B 2XVLA 4JO4H 1WIPA 1GCFA 3VKKA 2R2CA 1EXUB 4PMVA 1HXJA 4JL1A 1AD0A 4NHCH 4H20L 3SPVA 3P4LA 3EDDA 1U8LB 1D6VH 3VGGA 5DEGB 1FNEB 2X4QA 3G04B 4M61A 2WW8A 1YEJH 1INEL 1BLNB 4WTXA 3NCOA 3KYMA 4GZIA 3J8F7 4TX6A 1FRGH 2DQHH 3TA3A 3RPIA 1T7VA 3JUZA 4LSPH 4X8XA 2OTUA 4OUUB 5DJDB 5BXFA 3DXAB 5CBEA 3PWPE 1HNFA 1ES0A 1NGQL 4I2XB 4XH2A 3WIJA 1W0YT 3T4YA 2WZHA 1DBML 2D7OA 4Z7WA 5CSBA 5GGTA 2ZWYA 4WLCA 3LHPL 2W0PA 1JZ3A 1S7RB 5IG7A 5DEFA 2WNGA 1NP0A 3N11A 1NFIA 3VFMA 3VXTA 4P2YA 1MUJA 3IETB 4LARH 2XN0A 3KYNB 1WVZA 1QVOA 2CIPA 4MJ5A 3QUMB 1GRWA 4MNLA 1YEFH 3QUML 4I2XE 1Z5LB 1X5KA 3L3GA 1D6EB 4MD4A 4JFSA 4I3RH 5HGAB 1DL7L 3HZKA 4X0NA 1KBKA 3VH8A 3UJIH 4P2QA 2BCKB 5HYQB 1UKQA 2CDGA 1CLZL 2X4UB 2Z92A 3GMQA 4K23L 2OYPA 4Z7NF 5HYJE 2YMXL 2XTKA 5E2JA 5HJ3A 4HOWA 4FFYL 4FFVC 1VGEL 4DK3A 1NFDE 3O8XA 1W1PA 4H8HA 4OGAC 5HYEA 2FYYB 3TV3H 2IFFL 4FQ2H 3UTTA 5C2BH 3KWWB 4MZ3A 5JORA 4GW4B 1A3RH 3BYTA 4P5MB 4PJ8D 4PRIE 5HHXL 3BDYL 5IHZA 2EDJA 3K8KA 4DGYH 1XGUA 5F97E 5FO9A 5BRZE 1RPKA 2OMBA 2GJRA 5GS0C 2GY5A 1BJ8A 5F8QC 4GAYB 1RP9A 3VNYA 4GXVH 1BBJB 4ODHH 4G8GE 3BPCB 3ILQC 1L6ZA 1NM9A 1BOGB 5L8LB 4DWSA 1HE7A 4W8BA 1E6NA 2FBOJ 1YMME 4NNXB 4KRUA 5LGHH 2WBWB 3EGSA 1S9XB 4EN3B 2FO1A 1A5FL 3L5IA 1JXJA 5I8CA 4ZPVB 4JPWL 3FQXB 4DJMA 3PWJB 3TBYB 4P0DA 4JFED 5E8DH 1MAKA 1P4IH 5F44A 1G7LA 4DUVA 4KTDH 5ECJE 3SDXB 5A6AA 1GL4B 4BZ2L 3A3HA 5HD8D 1U8OA 4D6DA 3B9AA 2QQKH 4K3EL 2IGFH 1MH5A 1HHKB 4ZOAA 3S88L 4DWHA 5A2AA 4YDJA 4HEME 4APQD 1G7MB 4Z0BH 1IBGH 4RWYL 1UFUA 3W26A 3F4VA 2EDEA 4HC1H 5CJQL 1WNOA 1JPSH 1S9VA 5I73B 4HJ0C 3T1FB 1UD3A 4U5KA 5FIPA 1RZ7L 3BMWA 4MHHI 2B0SL 4XPTL 4LLUA 5L2KE 1YUHA 4AW7A 3RNKB 1OSZA 4CRPA 1NDMA 3ZT5A 3F5KA 4JFTA 2VZOA 2V2WA 5D9SB 1BZ9B 3RIFF 2ZOLA 3FHQA 1LEGB 2WV3A 3VD7A 1FZKB 3HG1E 3UJTH 3LKSB 3L7FB 3EOTL 3IXAB 2MTPA 4ZODA 2E8ZA 5D1QB 4HK0A 3SE8L 5JOEA 1TE1A 2QTEA 3UR7A 4WENB 1V0LA 3B8YA 4UIKL 1T0MA 2HWZH 5D5MF 3OXSA 2HH0L 5K9QI 4U6HB 1QLRA 4F7CB 4BFEA 2V5CA 2VI0A 3VVGA 2X44D 2AQ3A 3PUCA 3I2CL 4GKLA 4WSJA 2WZEA 2L7JA 1J0IA 1JI1A 2ZG2A 3RP1A 5EFDA 1UOKA 4ZFMA 4KTEH 3PV7A 4XXDA 3IDJA 1N3NB 1M1SA 4H8WL 5GGTL 4JRXA 4QRSB 5KVGH 4AWEA 1EDQA 1KFWA 2FE0A 5IJVA 5DURB 4M48H 3G08A 4L4TA 2ICWJ 5JXAH 5D6CA 4Y1AA 2J7EA 1G9MC 1HINL 3BZFA 3S98A 2C3HA 4IIQC 1QR4A 3MV7A 4LQ1A 3TN0B 3ZDXF 3OMZA 3ILPA 1DEEA 2WQ8A 3IDYC 4OD2A 3C2AH 4JDZA 2DYPD 3FQRA 3CIVA 3HR5B 3WEXA 2J78A 3EOTH 2Q20A 4DUXA 1KGCE 2C1OA 2C3VA 5IJKC 4Y5VA 2UY3A 1I7RA 2J7CA 1CFQB 2IPTL 4KI1A 5IMKA 4X5XA 3IS1X 2ID5A 5HHOD 1NCCH 4ODVH 3RRQA 1MCCA 3ZYIA 4BFBD 4FNQA 2ZCKH 3BP4B 1OT2A 2AEIT 5T3ZE 2Y23A 2FATL 2AAVA 5EZOL 4LHUG 5FUCC 3WF1A 2ENSA 3OKDB 2P8PA 3HTLX 2ZUMA 4PYSA 1QVBA 3GH5A 4GRLC 5BV7B 4R3SB 3MMDA 1ZWIA 1BGXH 5C3LD 3SKUD 2BVOA 4XCYB 3LMYA 3MU7A 4R7NA 3WXWL 1LK3L 4L9LA 3MRIA 1HKJA 4AENB 2W9EL 3MRQA 4OJFH 5E09A 1U6AL 1U42A 2GJPA 3BUBA 2VZTA 3BYYA 4OKVB 3VFGH 5BV7C 4R9HA 4KK8D 1ODZA 5IGXH 1HSBA 4KXZH 1C8QA 4Z7NE 2ED7A 3ZMRA 3IKCB 5TF1L 3L6FA 4M56A 2A6DB 3VXUB 2OCFD 5E5MA 4DZ8A 2XZZA 2WWDA 1W0WA 4RGOH 1I1RA 3T2NH 4AZGA 5ECUA 4LIQL 3H0TA 1R3KB 3G6JE 4JN2A 5H37H 1BYBA 2ADGA 3V4UH 1P9MA 1U8IA 1N8ZB 2Z4QA 1ZBKA 1OIFA 3RWHA 4DW2H 5I66A 4W5UA 1CEOA 3B43A 4RMWA 5T33L 1BWMA 3S36X 4XBPB 4OCXL 1BD2A 4QXTA 4Y4HB 3T3ME 4R8WL 2EPMX 2W9LA 4NZRL 2EKSB 4UNTA 1RU9L 1BYDA 3C8DA 1HZHL 5E4EC 4WFHD 3KNBA 2YKKA 2ZXAA 4BK5A 4LPYA 4RFEA 4ACPA 7A3HA 2VISB 3G6JF 4XCCL 5JQ6L 3O41B 1H15B 4P7NA 2VIRA 4EANA 1G6RH 4QRPA 1OAXL 2F74B 2J62A 2YBUA 1S3KL 3LXAA 1DBKH 1FV1B 2X09A 3C60D 5FM8A 4U3CA 2IAMD 3HZMB 4K7PH 1J05A 3SE9H 4R5EA 5GQBA 3ZIZA 1CDHA 3BD4A 3BO8A 3VXMB 1JDAA 1LO2H 1PZ3A 1MFEH 4L29A 3TCLB 3QDJB 3QH3B 4ZQKB 4POUB 4GAJH 5L0QB 3C8HA 3CX5J 1G9MH 3UCRA 3LSOA 2DBJA 1M6OA 4PP2A 3U82B 3RU8L 2J5LB 1HT6A 1XZ0B 3T3PE 3VFRA 4ORZC 4W6WB 1UWEH 1NFDF 3IDNA 3QDHA 1T04B 1FJ1B 3T77B 2XNAB 4URIA 4KXZI 4R90L 1RZ8B 2WWMC 5JHDD 3MBXL 5T1MB 4Q9QH 3NAAL 5B4MC 3SURA 2ZPKL 3GM0A 2HKHL 3FN9A 5F9OH 4HDIA 1J1XL 4L8CB 4MA8H 4ONGH 1ODUA 4CD8A 1Q0YL 2A83A 1NLBL 4IMLB 3FFDB 1XD0A 1I9JH 1KGXA 4PJEF 1GZPA 3WFBH 3QIUB 5IR1A 1I1AC 2IG2H 4M43H 1TQBC 3DVNA 4OGXL 4YDIH 3VXPB 5I23A 4XNMA 3DPBA 2JELL 4MNGE 4JDVB 2YFNA 3QPQD 4I48B 2OTWA 2PBOA 5DVOA 2FJFB 2GK1A 1YMMA 1M7IA 1MAJA 1SMOA 2NXYD 1ZS8A 4XNXL 1UD6A 1MI5E 5J13C 2J6EL 2O5XH 5LWYH 3QCTH 3OF6A 1P7KA 4UQAA 4WW2A 4Y4KC 1S9KC 1VEPA 4G6FB 1FAKT 4FQLH 1G0XA 3LRLA 3JBG7 2MKWA 3UJJL 2FJHB 3HCVA 5D2LA 3QGVA 1CLYH 3FQNB 1FFPB 2Q7YB 3MLPA 2VDNL 5C07E 4ZUVB 2E5EA 1DQQA 4Q9QL 1P6WA 2X40A 4YHEA 2BSSA 1LWRA 1T5XB 2NTFA 1DWHM 2ESVD 2N1KA 2YPLD 1DQDL 4M7ZB 3I50L 3PZ9A 3NJ3A 3WQ4A 3WLWD 1AHWA 3QUYC 4FZEH 4LCWA 4P4RA 5HDOA 2I9TB 1O7DC 3GHEL 3IU4H 1I8KB 4F8XA 1W1TA 1BLNA 1AKJD 5D1ZC 3DHMA 1V6VA 4IM8A 3MYJA 2X1IA 3PJSB 3AIVA 4B41A 1KJ2A 4ZFGL 3VWJA 2BFVH 5K9KA 5TQ2L 3VRJB 5IG7B 3GKZA 3REVB 1W3KA 3STZA 1XF2A 3UERA 3Q3GA 2DQJL 3EOAB 5D96C 3VXTB 1ADQH 4W93A 4CKQA 3QUYB 2XG5A 3NZHL 5FGCE 2MKLC 1F4WL 2A3HA 3MLYH 4TSAH 1GHSA 2X5PA 5E00A 1NAML 2X9WA 5EB9A 5E8PB 4F9JA 2BC4B 2AJZA 2QHLA 3BKMH 4M1CD 2XM1A 2XHYA 1OD9A 1BGGA 4NQVB 4KJWC 3B2VL 3IFLL 4WU7B 4X7DC 2Q86A 2W5FA 4NQED 4YFLI 4TRPL 3SDCC 1GOOA 5IFTA 3VDCA 1JN6B 4TNWF 1NL0L 4PJ9C 3A67L 4JLRB 3V6ZB 3HRZB 3KLSA 3NA9L 4XNYL 1E4NA 3S96A 4WWKD 1ZS2A 3CHDA 1UR8A 3W0KA 4JRYB 3CHEA 3UTTB 2NMSA 2VR4A 4TVPH 1AGEB 3RTQC 5JHDE 1E27A 3IFOA 3M1BA 1OGAA 3MMEB 1HXYB 2NT0A 3MJ7B 4RAUA 2QF8A 4NM8H 5E8EA 5CJQH 2CBJA 1AR2A 2UY4A 4PB0L 5GGRA 4IM4A 5TDPB 1LEKB 3MV7E 3VGAB 1SEBA 3MLZH 4N9GB 4DM2A 1IC7L 1D5XB 2YEZA 5DRNA 3VILA 1NANH 2CMRL 3RZCD 1TQUA 2GJZA 1LL6A 4CCEA 1ZVSA 1JWSA 3ZE1E 4ZYKA 5MENA 4PG2A 3S7GA 1ZEAL 1BFVL 3BGFC 4OCSH 3AMDA 5H2BB 4UT7H 2RFXA 4R27A 1JNHB 2VXUL 4YHOH 3MODH 1RP8A 4CN4A 4JRXD 3WEMA 1WAAF 4ODUA 3CV5A 5C09E 1MY7A 1KJMB 3BCFA 1LJYA 4FQ1L 1WWCA 3SCSA 3IB4A 3GJFA 3D1MC 4RFOL 2R23A 4C4KT 4PTMA 2XZQL 4LPXA 2ATKB 3UG4A 1CNVA 4PP1D 1Z9LA 4W87A 1SJXA 1JPGA 2PYFA 4FQXB 5I79A 2WCSA 1XFPA 3P9MA 1E5NA 2I5YL 4K94L 3WO4B 2CR6A 1MCNA 3SDCB 3WH7A 1YUHB 2GKIA 3MANA 4UI2A 4WFFD 2EH7H 1ITCA 3VJ6B 3VIMA 4BQ8A 3DSNA 3A47A 3FT2A 2G41A 5DWUH 5FIEA 5KSAA 4JR9L 3SDAA 3AYRA 5GS3A 4MQ7B 3VXNA 1C5DA 1UWUA 4FNTA 4X6BB 4D0DB 4PJGA 2PR4H 3RDKA 5IJKA 2VAAA 5D96B 1MCPH 4HU8A 1TVPA 4ZUTB 4JAMB 5CG0A 5A8OA 1CFSA 5DK2B 5DT1L 2MPAH 1MLBA 1MLCB 4IS6B 4PJCA 1CTNA 1KSRA 2J79A 4AD3A 4DWSC 4K3DH 2YZ1A 4JY5H 4ORGA 1R3JB 1GOIA 2DMKA 4EIZC 3ULVE 5J6HA 1VPOH 1GIGH 4EN3D 3MQIA 4UQCA 4NWTL 2YL9A 4CD7A 1D9KB 5DSCA 5DEZA 3WBAA 4AZ6A 1X5GA 3RM4A 2IPUK 3ZL4L 4UB0L 5K9OA 3G6LA 1LP9E 3BGFB 4I9WE 3V7AE 3L4TA 1MQRA 1SEQL 3PNWA 1NBZA 4HF5L 4KFZC 4TVSa 5AYUH 1BFNA 1GGYA 2AERT 4P2OB 4B3LA 1YZZA 2VCCA 5A94A 5EWIH 2JK5B 5IKCA 1BQHB 2R2EB 5CD3A 4R96A 4Q2ZB 4L4TE 2NY0C 5HGBB 5F21B 4OM0H 2B1AH 3OR6A 3JWNC 1I7UB 4OSUH 4MAYB 1KTLB 5F3HB 5B8CB 5LXGH 1U3ZA 3SY0A 5D4YA 3CK0H 5CJOL 3U30B 1GQJA 1CF8L 3C6LA 4P2OC 4L8BA 5IMOB 2QADD 5KVMC 1CVRA 4V27A 3LRGA 1KJ2L 4X7FC 4F33A 4D6JA 1RUQH 3QBTB 3JWOC 4H1LH 4NC1E 1I8MA 4LU5H 3VFVB 2P42B 1S7WA 4NSKB 1AQHA 1A1OA 1E28A 4P5TB 4TYUA 3D2UD 4OIAA 2OW6A 2WC3A 2DM7A 2CGRH 1R5WA 1J8HB 1KLFA 4XHJC 1MIML 2PTTB 2BSRB 5INCA 1GIGL 1EAJA 1GNXA 4NT6B 2Q1EA 2YA0A 4PJ7E 4WI2A 3EJTA 3EYPA 3HRPA 2Z1SA 1HI6A 1J86A 1WFUA 1C7SA 3OQ3B 4XCYA 3ZYZA 1XIWB 3IF1A 2XWBB 1SHMA 3MRIB 3FNDA 3SCMB 4LLQB 5ESQA 1F90H 3S35H 2QKIB 2G3JA 1AGDA 3RWEB 3UTSB 4MJIA 4RRPA 1V3HA 5FF6A 2R56L 5AEAA 3O6KL 3TIEB 5E6YA 2WPGA 3FN3A 5IHBA 4PJ7F 1WV7T 3DRQA 1MOEA 2ZUNA 5F7KC 4XC3L 1TA3A 3HE7B 2FGZA 3JWDL 5I73C 1F3RB 4E42A 1G6VK 5JA9A 2DEPA 2CIIA 2Z9TA 1NGXB 4NKMB 1A02N 2BHUA 2PUQT 4PGDB 1C8XA 1TTGA 1H0IA 6A3HA 4D1JA 1DVFC 4PJXA 4PS4L 3PZMA 1RFDH 2VLJB 4NN7B 5MP6H 1QSFD 5GSVA 3L2LA 3G5ZA 4F3FB 1DR9A 5IEKA 4XRCB 3U0WL 4PMYA 3OB0K 5DJCA 4CL7A 4LSTH 1KPVA 1B4JL 4PJFA 3S36L 1T7ZA 3D4ZA 4WSKA 2RGMA 2WCAA 1U3HA 4MD0A 3U4AA 2AXGB 3ALPA 1OARH 1CLZH 4WGVB 4OLVH 1CICA 1MFUA 1E15A 1Z9OA 3P0YL 3WBEA 5L8JB 1XR9B 5ITBL 4KGLA 2VIRB 2HT3D 4WI3A 1AD9A 5CS7A 4QOKD 4M03A 4J3WA 4WO4A 2V9TA 2J7BA 4XI5C 3NZ8A 1QFOA 4NIKB 3TF7C 4HV8A 3OZPA 3GXMA 1OAUH 3BO8B 4WEBL 3BIAX 5CBAA 2DQCH 3L5XH 2Y5TA 3BEVB 4UV4L 2DLTA 4WHYH 1FH5L 3QPQC 3QJHB 2AAAA 2I9LB 4NNPL 2JIXB 4DGIL 1QBMH 3P30L 5IUSA 2PYED 5DTFB 4Q9RH 3BAIA 3S5LA 3QIWC 4PJHE 4PRHA 2C0HA 2FIKA 5MEPA 2YDSA 4LGRB 4W86A 4F9LC 4FK9A 5MEOB 2R69H 2HTKC 1QBLH 4JDTL 3L3HA 1DCLA 3T0ED 3ZTJG 2P24B 3E8UH 3ARDB 3SKJL 4L8CA 3DIFA 4JFYB 4FA8A 5C09D 2XWTB 2YD6A 5J57B 4D8PB 5T5FL 3DC0A 1U8HB 1HHIA 2CYGA 2E6QA 2DIBA 3RUGE 2JF7A 4B9ZA 5JPNB 2FJGA 3FOLA 4D9LH 1A22B 1F4XH 4MAZA 3GXDA 3DVGB 3CZ8A 4KVNH 3TYGL 3F7VB 2BNQB 3QHFL 1WE5A 4IJ3B 5ESVA 4KHTL 1UWQA 4Q74A 2DBLL 3II1A 1NCBL 4JAWA 2DWEA 4JG0L 5ANMA 5CEZE 1ZTXL 4S1RH 2D7TL 1UM5H 4P4KA 1GH7A 2YD7A 3MGTB 1YN6B 5BOPA 2ED9A 1DDHA 2ZG3A 4XB8A 4PLOB 1JVKA 2FL5A 3VA6A 1P7QB 4LCIH 1WT5C 3L3DB 1P7KB 4GRWH 5I74B 1PZ5A 1Z3GH 2EDOA 2GK2A 4HIHB 4PJBF 1ZHLB 4AL8H 2YRZA 3G9VA 3AUVA 3HE6A 3GMOA 5T33H 4IPNB 1R3HB 2H1PL 2BZDA 1Q9OA 2OJEA 3FQNA 3SO3B 1IGFH 3VXUE 1WAAE 4LF3A 1LK2A 2R0KL 5DRZB 5A6JA 2MCG1 3AHYA 5TE4L 5C0RL 2DT0A 2QR0B 1FIGL 1OGTA 1UVQA 1WAAA 4P4KC 4F57L 5D7IE 1VDGA 2DS4A 3MFGB 1RURH 2EXWD 3TVMD 1DWFM 3BKYH 3BXNB 5T1KD 3G6DH 2YLAA 1OAKL 4WUUE 3CD4A 1DSFH 1E4MM 3NOIA 1QFUH 3MA9L 4LCUB 5IW6A 4YUEH 3AC0A 3D48R 5HXMA 4XP5H 5I19L 3V0VA 1RK1B 3ARFD 5IP4A 1F97A 4GSDH 4B7LA 4DUWA 5GGTH 3VIPA 3K8MA 3GI8H 3ZO0A 43C9A 2M1KA 4GUPB 3ARDC 4TOYL 1GQLA 1YJDC 4AD5A 1CGWA 3MRMA 5HI4C 1G9EA 1PKQB 4UT6L 3R8BB 3SGEI 4U3HA 3CZNA 4JKLA 1MREL 3C60C 3EYUH 4WY7H 5DJZB 5TPWH 4YC2B 5JUEH 5EU6B 5D7LD 1E6XM 4PRWA 1D6VL 2PB1A 1M71A 1ZHKA 1ZOXA 4NQVA 1E70M 4NO3A 2W1NA 1S8DB 4RFNC 1SYVA 1CD9B 2G2RB 3M17A 5CSGA 4KMTH 1E4XI 3RHWF 2UZXB 4LCYA 4N0CC 5CGYD 3VFOB 1OBAA 3V4VH 1PG7L 3C08L 2PCPB 5F7WC 1OTUC 4MNQB 2G5RA 5ICXA 5HNNA 5BXTA 1DQJA 1DSFL 1CG9A 4JHAL 1CGVA 5DQDL 2DSWA 5FGRA 4D9RE 3FHAA 4E2OA 3W11C 1RIVH 4AEEA 4WU5A 5JW4M 1NARA 4NQCD 4M7ZC 3ZT7A 4YHPA 5C8BB 3ROLA 3S5LG 2XVKA 2BY1A 3AHZA 4X83A 3MRJB 4PFEA 1W9VA 3PQYD 4H41A 1AP2B 1YMHA 1R0AH 2JALA 2HFEA 3EBAA 2H9GB 2ERJB 5JW4Q 1A9EA 3CH9A 1FVEA 5E0QA 2WBJC 3RBGA 3WE6B 5DT7A 4HS3B 4D0BA 3JV4A 4P46D 4TUOA 1UKOA 5KANG 1D5ZB 2JKXA 1HQ4B 2WWKO 4AM0B 4JRYE 3EYFA 4U4BA 5DA4A 3BVVA 3WUGA 3L95A 2RFXB 2NXYC 4F7MB 4WCYL 2BNUA 3MO1B 3NIFF 5A16B 4ZFOB 4NOFA 3UESA 3MCG1 4N8VB 4YXKL 1PZ2A 3DX8B 4K7FA 3BH9A 4Z78A 1WBXA 3QG6A 5TE7H 2FDBP 4M1DL 1ZGLP 4S1DD 2OSYA 4EI5C 3CH1A 4HLZG 4DN3H 2EEXA 1N2RA 2ZUTA 4QNPF 3T4AB 32C2A 4M8VA 3JWOH 4ZXBA 2WBJA 2ADFH 1CXIA 2BVDA 2B1HH 3GMPA 1MRDL 1PEZA 3B6SA 2OXGA 5FA3A 3ZE0F 1CU4L 3ZLQC 1CGSL 3GO1H 1GCYA 3GRWA 4P23A 4OCYL 2Z1KA 5A6MA 1B3WA 1HHGA 5ADOH 1I75A 4UDUA 4OF0A 2ZXBA 1J12A 4PRAB 1YEDB 2PWGA 3RJXA 4PJGB 5DLMH 1K8IA 1CQKA 2VVSA 5I1CL 3D9AH 4QXUL 5GNYA 1EZVY 1N82A 1TENA 5JW4N 3RWFB 4H7VA 2VZUA 2YZ8A 2JIWA 3ARQA 4RCAA 2GJ6D 1YHTA 5DK0B 2IPKB 3ROOB 1L7TL 4DEPB 5LG1A 3WIHL 5CHNB 3DHJA 1MLCA 2GCYB 3MV8B 1R3JA 1SQ2N 3G9AB 3ARUA 3BN9D 1YA5A 1ZT4A 3PZOA 4Z95H 5EU6E 1JZ7A 3GJEA 1IZJA 1K9FA 2D22A 1Q9KA 2D4DA 3VXRE 2DDXA 4YHMH 1NC2B 2EDLA 4JFEA 1H8OA 1H3WM 3UTQB 3KYAA 4Y19E 1QSED 4G3YH 2IXVA 2MFNA 5KVFH 1AGBB 1FBIL 1AD0B 2WSKA 1R8LA 1UR0A 3K46A 1XRVA 3H7BB 4JFEE 5J0BA 4GJTB 5TH2A 3KHOA 3KPOB 1QO3A 4L1HA 1J8HD 5DUBA 3U46A 1SVZA 2I60H 5I76B 3QI9A 4PR5B 3SEPA 3JXAA 3D51A 3RPIB 3S9DB 3PIQA 3KS0J 1A3RL 5J1SC 2XFXB 2J4WH 4C56D 2E6JA 3DX0A 2AJSL 2OK0L 5I8OH 2NY5L 5DEFB 4X6EA 5FK9A 4MCZB 1FGVH 2Z31B 2Z91A 2W0FA 3L3KA 2WAHA 1X5LA 3AMGA 1HYSC 2NX5A 2VLKB 3SDYH 1QLFA 1FL5B 1RFDL 3UBXA 4JE4B 1T6WA 2YD1A 3THCA 2EC8A 4U1SA 3F5LA 4NT6A 1AQDA 1P6FA 4YXLL 1Q6DA 2VDKH 5IB2A 2J47A 1NGWB 2QQLL 4I3GA 5A6SA 1F2XK 4LPVA 4Q22A 4ODHL 3MOAL 5KBNC 1Z9MA 4N5ED 1NBYA 4S2SB 4PG9A 1LILA 3MRFB 3W0WD 4POZD 1VA9A 1F6LL 2KQMA 2VKXA 4G9DB 2WUBH 1X5ZA 3H9HB 3TJEH 5EG6C 4DOHB 1F00I 1BFOA 1ZK9A 5GS0D 1MF2L 4O00A 3QULA 4XP4H 2ATPB 2O5ZL 1AQ0A 3QDGD 4FXKA 5E6IB 4M82A 3FOMB 5F6IB 3C8KB 4TSCH 1QNZL 1NCAH 2FATH 1XIWC 5EBWB 2EDYA 3K7UA 4KKLD 2YKLL 2E3ZA 1H0DA 4AYFA 2NY2B 3KE0A 3JZ7A 5D7IF 1WGOA 4GI8A 4PGCA 3MCLH 4KV5F 4NN5C 4LCCA 4LGSB 1IMHC 4Q9RL 3KVQA 5KG9A 2EDXA 2D0FA 2PW1A 1NFDB 5IEKB 1UQSB 1SJHB 4LLWA 1VERA 4NO0B 1P84J 4Y5XB 1MAML 4NX0A 1MJ8H 3FB6A 2OM5A 4V2XA 2EDTA 3I02B 1G7IB 7FABH 1M05B 3G6JB 3SE8H 4JO4L 1KLUB 4Z7VA 2PWDA 5E94B 5I1EL 3MOAH 5F89B 1OM3L 4MADA 2G3IA 2XTJB 3O3EB 3RWDB 4NN7C 1JD9A 4M6AA 1FFNB 3MJ9L 4OSUL 1LQSR 4GZJA 3F12A 3NZ8B 4XX1E 3BUYA 5EA0L 4Y5XC 4GBXB 3O2DL 5EU5A 4LMQI 2HVJB 3UTPD 1KCRL 1OSPH 5ISZB 2FH6A 4XUYA 5GZND 3LZFL 2QMJA 3T8XA 3QJHA 3SKOB 1EFXA 2F53A 1KNOB 5CPQA 3RNKA 3TM6A 3B2UD 2XICA 4FNLL 3QT2A 1RU9H 2F5AH 3W27A 4YEEA 2XG9A 4XMPL 3MCLL 1WLHA 1J9CT 3LRHA 4KRNA 2LTQB 3GMRA 3T04D 4XZBA 3GSUA 5DO2D 5BXSA 2VQ1B 3NCJL 3NPZB 4GMSH 1WBZB 1XGRB 5DUPL 1D5MA 4JFPB 2X89A 2H3NB 3KXFE 1E9LA 4PJ5A 2EO9A 4ODTH 4UOZA 4YPGA 2HP4A 5BYWA 2KDGA 4NQDE 3S97C 2CEQA 2UWEF 4GXPA 4IRZL 1KCKA 5IOPA 2DIAA 2EEDA 3CMJA 4LFHG 2W66A 1BX2B 4PJ5E 5C0AA 1QLRB 3WJLC 4JKMA 4C58B 1HHIB 3FCTA 2EYTA 2D2OA 4G80A 3X3GL 3QWOB 3BKYL 4ONHB 5BQ7A 3GK8L 3VFPB 4PREA 1H3PH 2DSKA 3PQYE 4I5BB 3OAZH 1S9YA 4HUNB 5EUOB 4Z2HA 5ACZB 5B3JE 5CJ8A 4IOFC 3P0GB 3IGAB 4XXCA 1MCDA 4EI6B 3MGAA 3T09A 2FD6L 2VDPH 4XVUD 2VDOL 3U2SB 3GBMH 4YBQD 4ACZB 3ZE1F 2J7GA 1KV3A 3BESR 3KLAB 4IIQB 2WMGA 3BRGC 3PP3H 4K23H 3VM7A 1UXWB 4AMXA 5KS9A 3HPLB 3GSRB 4HXBH 3IDYB 1WTGT 2VE6A 5EZOH 4OD2B 1CLOL 3VIKA 3CLEL 1HWHB 1EHAA 4PJGE 1CFNB 1K5NA 3F7PC 3WL9A 1I3RB 1LG2A 5FEBA 4LVNC 4PRPD 2WVVA 4N0YL 3NIDE 5D7SH 1YMMD 5GS0L 4BZ2H 1V6XA 2EPKX 3PABA 2EICA 4JFWA 3ZE0E 4X5XB 2NZIA 5A40E 4PJIA 3GNPA 4WKAA 3R0NA 1MCRA 3FFCB 4GXVL 1DWAM 4XAWH 4KVCL 1KN2H 4FLRA 3MUIA 3QXWA 3BI9X 1ZLSH 1Q9LA 3G6MA 5CSYA 3MSDA 3ARWA 5E08H 2R15A 4FQCH 4DO6A 3VINA 1JPSL 4KMLB 3VXSD 4ZAKC 3K80A 3GTNA 2ESVA 4MCYB 1KTBA 1ZBCA 3D4YA 2Y1VA 3WXVL 5L2KD 4IHOA 4YO0A 3H42L 4M1RA 1NC4A 1W72A 2H26A 2N7BA 3W39B 5BZDA 1RULL 1MCSA 4OQTH 3FO0H 4WFGD 4U3XA 2E3VA 5SV4A 1XSIA 1CT8A 4NGHL 1H8SA 3CZFB 5FHBH 5DJYB 5A2FA 5EIIA 2QHRL 4R8WH 1CLOH 3MFFA 1JDDA 3NACL 1GVYA 4DKFL 1YEHL 2A6DA 1DLHB 3ULUL 1E6QM 1OCQA 4I0PD 4WV1A 5FO7A 5HVFB 1MRFH 1W0WB 4M7LT 3SQBA 4LLDB 3DDFA 2VUOA 4CU8A 1CGTA 1AIFA 2XN9D 4NRYB 4IRSD 1XGYH 2P8MA 1HNGA 5C8JB 4MZ2A 5TQ2H 1U8IB 4ODXA 4AZBA 1B0IA 3FONB 4MWFA 1QR1B 3BC9A 3PQYA 1MCBA 4X4YB 1KJVB 4IDJL 2Q3ZA 3SE9L 1H3GA 3WD4A 1NGQH 3QQ9D 4X5WA 1CXKA 1MFEL 2M8XA 3HE6C 3BAKA 3VIFA 1X5YA 1AFVH 2JJVA 2OSLA 3KYOA 2D7TH 4K9EH 1W72H 3VIGA 1GPFA 2W9DL 4MGXA 1KF9B 4WHDA 5D7JA 5SX5H 3RI5F 5B38A 4M02A 3O41A 4GQPH 1HIMH 4PGEA 2EQDA 3LDBB 1A9EB 3FJTA 2O5YH 1G7PB 4OLZL 1I1FB 2AQ1A 4I3RL 3UZQA 1R47A 1GZJA 2XM2A 1NUNB 3W2DL 2QSCL 4JM2A 3FO0L 1V6UA 2EYRB 5DD0L 3O6FB 4PV8B 1FZJA 3EYFB 1KXVA 1INQA 1U8JA 4M1GL 4UT7L 4QY8A 2SEBA 5JIWA 1F3JA 3QIBD 1I8LC 1WK0A 3C5SA 3MRPB 4JCLA 1ETZA 2XKNA 2XZAH 3PV6B 4W4OC 2DJUA 2R2BA 4DTGL 1EJOH 5E7BA 3LKQB 3IDNB 3CU1A 5SWZB 3LRSA 3UC0L 3LIZL 3CDCA 3WMBA 2OI9B 4R4BB 2C3WA 3BZ4A 5D72H 3D3VE 1Q1JL 2YD4A 5T1MA 2Q6WA 3U6RA 1CPUA 3LCYA 5DVNA 1TJHH 1Q4NX 3THML 1ZAGA 4IEFB 2FIRT 5C71A 1MW1A 5HI3D 3WD5H 1BQSA 2W07A 4JGMA 3V0AC 2WP3O 4I18B 1GW1A 3MLTB 5BRPA 4ALAH 3UAJC 5CCKL 3UTSD 3X14A 4HA1A 5C0EB 1W1VA 3WLWC 4EDXB 3REWA 1QW8A 4WI6A 2ZJSH 12E8H 3WD3A 3LKPB 5JMRA 4WWKB 5IM7B 3WNPA 2GEEA 3CXHJ 3VXPA 5E8DL 3P77B 3I6GB 5GZOC 3ZJ7A 3HC4H 2HT4C 5KSBA 1LO3H 1PKQE 1GPOL 3DURA 3WCYA 5A6BD 4XCFH 5DK0A 4DFIA 5DD3L 4UV4H 1QPPA 2NY5H 5A1AA 5CHNA 5HPMB 1QOXA 1I1YB 2VX5A 4J4PD 4Q6IB 4ELMA 2XY1A 1YNTA 3UMTA 3A21A 3MLYL 4TSAL 3TA3B 3HAEH 1FNLA 3I6KB 3V8CA 5LGHL 4PYGA 2Z35B 5DDHA 4FRWA 1Q9KB 4P2RB 2LV4A 3MRRA 1LP9B 1FG2B 4ETQB 3CSBA 2VQTA 4Z7WB 2FYVA 3V6BR 4MD5A 4YXLH 2BNRA 1FL3B 5C08A 2XN9B 4EI5B 3RHWK 3KYNA 5D1ZD 4L4VD 1JHTA 2DMBA 1FO0L 3F5WB 2OR9L 3S3JA 1JZ2A 5EOCL 4LBEA 3OL2A 1RUKL 3A6OA 5BVJB 3DYMA 1SR0A 4RAVB 3WFCH 5FDWB 1FRGL 2AK4A 5F1IB 3MRKB 3UETA 3PHOA 3WHXB 3RPMA 3C5ZD 1ZT1A 5HI5D 3SQOL 4S0TD 2QADC 4K8RD 3U1SL 1EAPB 3HC4L 5F70A 1BPVA 2VCAA 2AV7B 3CFDB 4U1KB 2EKJA 4WDIA 4MCZA 2EYSA 4BS0A 5IB3B 3OTTA 3FB8B 1CBVH 4D6HA 1V8HA 1OPGH 2CGRL 5JUVA 4ESKA 1YDPA 5JW5B 3INUL 5MHSE 4JVUA 1MWAL 3RA7L 4DM1A 4Z7VF 4Z7QF 3O9NA 3O81A 5DF0A 1MIEH 3CFEA 4PJ9D 4WK9A 5C6WH 2CLRA 3HNSL 3O4LB 3X3FH 1BBJA 4P9HL 2OBGA 3TT1H 3CBWA 1MCOL 3RVUD 4JKPL 1NBYB 2CQVA 4OF5A 4S2SA 2YL6A 4DWSB 2CDEA 3QO0B 3MLVL 4J6RL 1HQRA 3X17A 2JFEX 4DVBB 4G9DA 2OSXA 4HBQA 3ARGC 5D7IB 3U4EB 1S5HB 5GNZA 4ZPVA 3WFLA 2VH5H 4YFLF 1ED3A 3Q6FB 5GS1A 1MVUA 3C9NB 5GISL 3WEOA 4JO1L 4JFOB 3WFHA 4NKQB 1XF1A 3U7YH 2IPTH 5I2UA 4YE4L 2YPVL 3SQOH 4DKDC 3PWLB 4Y4KB 3GHBH 3MBXH 4RQQB 3I75B 1HHKA 1F6AB 3S3SA 1HHHA 2QL1A 5GRVK 3QQ3A 3KR3H 4AZHA 4HPOH 1DBAL 2HFGL 4Z0XA 1ISZA 4ZYKB 1UQSA 3VFWB 4X80H 4KI5D 3GSQB 1O7AA 3NDYA 4WUUD 1U8MB 4PBGA 3O6MH 4PJCE 4GKZA 3RGVB 2ZOKB 3RY4A 2PXYB 1DN0A 5JPMA 1XR8A 2IMMA 1LF1A 1KJ3H 4IRJD 5IDIA 5JOPE 2B20A 1VFAA 4KKCC 4LOUC 1KXQA 1E0VA 1CLCA 3QEQD 4TXEA 1GZQB 3P0VH 2XPGB 4F58L 3CIQA 1HP5A 3UDWC 4WJ5A 3W9DB 1JPGB 3IXAA 2WUCH 4JM2F 1XF5A 5C0IB 4IOIA 4CBPA 3BQUB 2I07A 2Y9RT 4N8PA 1GGIH 2GSGA 3ESUF 1ROWA 4U6HA 4R4NC 3T2NL 1S7UA 1FSKC 4JN1H 1T66C 4AIEA 3TESA 4WFHE 4B50A 1EQCA 2Y7QB 3BRDA 1T03H 1YY8A 3FT2B 3N12A 1IGJA 1UJ3C 1UYWL 1C5DB 3WSQH 3HNTH 4ZTOL 2R29H 5IQ9A 2YLLA 1FO0A 2H3NA 5F1KC 5I6XC 4Z76B 4OGYL 5KSUA 3BLPX 5FV2A 4DOHE 5AC4A 4UV7H 4AIXA 3LQMA 1UZ6E 4XPTH 3KS0H 2FWOA 4O4YH 4P46B 2IBZX 5IGXL 4M24A 4IS6A 4PJCB 3BZFB 2K3TA 5D2LE 2UY7A 5HVWA 1S5IL 3QDJD 3QWOA 1AQKL 3E3QE 5DJ2B 2VERN 2FSEB 3STBA 4ZFZB 2QLYA 4D72A 3QFDB 1NEZB 5D2NC 2YK1L 4HCRA 3OLEA 2OYKA 4FQPA 2GUYA 3D87B 1LO5B 3HKFA 4P2QE 3TNMB 2P45B 3BX7C 1Y6NR 2MCPL 1BD2D 5DMYA 1CFQA 4H88H 5ABFA 4FXGA 1ZE3C 4E0RA 2WMJA 3HZ3A 2GK0B 1F42A 3KPMB 3CAFA 3BN9C 4JG1L 1IAIM 3C87A 5IMMA 5D5ME 3B8SA 1RZKH 3OR6B 5I8KL 4DAGH 1ZGLB 1VJSA 3BP6B 1J5OH 2OWXA 3HI5L 3LVEA 4WFEE 5KS9B 3K2MC 5A43C 3WSUA 5TGBB 3CSYA 5FO8B 2AKRB 2A1WL 3DV6A 4MAVA 1BFSA 1IILE 2HLAA 3EJJX 5CJBA 4ZUSB 5CP3H 3EMQA 4X7CC 3V0WL 3HPJB 4BSVA 1IQDB 4N0UB 1FLRL 1VIWA 3ULVC 1BQUA 1H09A 2WMIA 2BVOB 4GRLD 1EEZA 4LKCA 1W8OA 3MRHB 5L2KB 2P5WD 4LKXB 4M8UA 2FEDD 5IF0B 3FQUA 5HHVH 1S46A 5E9AA 1A1OB 4K8RH 3ALGA 3CZKA 2HJFB 1KPUA 5C07A 1QEWA 5FKYA 2VL5B 5ESAB 2RGLA 4LARL 4UQDA 4WI8A 5MP6L 3A4XA 3CX5K 4NKIL 1E3ZA 1KG0A 1ZU8A 4RAHA 4LAJH 3WO4C 3H9SE 1ZMYA 1YYLH 3KL3A 3MGOB 3QQ9C 1YNKH 4FHBD 3BKCH 3PF2A 5FUOH 2UYLB 3U48A 3QFJE 3OKEB 3UJIL 2NNAA 2RJMA 5SX4H 5ADPL 1CWVA 3SCMA 3WKML 1VB9A 3QJFB 2C26A 2EIBA 1ORQB 2YMXH 1NC4B 1W72B 5AYQA 4N1EA 5TE4H 3W39A 4GW1A 1RZKL 1OT1A 5F6IC 4PRID 4TNWK 3AREA 4XBPA 1IRAY 2XUCA 3MNWB 4M00A 3GJFH 3GM8A 3RQ3A 3MFFB 2F58H 5MERB 3TZVC 1MI5B 1KTKE 5AYIA 3HS0B 3CHCA 5FECA 5I8OL 1DLHA 5M94B 3MLSL 2X4OB 4LSSH 1H15A 4ERSH 1O0VA 2GYSA 5E8NB 5T1LB 4X6DA 4PGDA 3ZZ1A 1YYML 3C08H 1U8PB 3A0OA 1QSEB 5H94B 1KB5H 1RJYB 4O58L 4X6FA 5J3HD 3MV9D 4YHZL 4YGVB 5EU3B 1I3GL 2J8UA 4P46C 2YD5A 4HZLA 1RJZB 5EULV 4DZBA 1KWKA 2BOCA 2Z93A 3UEQA 5D93C 4JB9L 1LWHA 3M46A 4LAQH 5KOVC 3X12A 4O02L 4BSWB 5B3JF 3Q0HA 2MHAB 1BVKB 1OB0A 2JJSA 1LE9A 3V6FA 4PBXA 2X10A 4U2YA 4QRQA 2AEPL 2O61B 5F7EH 3LEVL 2BX5A 1BHGA 2A73A 4PJEB 4Y4KD 4ZNEE 1E71M 12E8L 3CFKB 3LD8C 4V2BA 4RGOL 3S88H 2EYRA 1GOHA 2ILLA 5HGGS 1AKJA 3NIGE 4NQSA 3IRZA 2AS5M 1UKTA 3IFLH 1INQB 2OQJA 4QTHA 5BMFH 1KLGB 1QFWM 2Y5TB 4AQOA 2ORBL 1T83C 5MI0B 3ZJ8A 2F61A 3RDTD 2YC1B 4FQIL 2VZ3A 1G9NC 2J8OA 4PJAA 1BF2A 5DJ8A 3BE1H 1JF5A 3C5SB 5LAXB 5LJYH 3RU8H 4PTTA 1OSEA 3GSWB 3AZSA 1XGPA 3MNZA 4I9WD 3DO7B 2WAGA 3QA3A 5EWIL 4AH2B 3I84A 5J1AA 2J8UF 5TE6L 1U3HD 4CJ0A 4YDLB 1PQZB 4NM8L 3AGVA 3BAEH 4IOSD 3LKOA 2AJYH 1SVCP 4TVCA 1L9MA 1JMXA 4J1UB 2ICEA 3ZYOA 4AY0A 4NJAH 2JJWA 2P5WA 3FAWA 3FRUA 1OB1B 1Q6CA 1TNMA 3B5GA 3F6IA 3HI6L 4MNHA 2DLIA 4WTZG 4OZGB 1IKFH 4OFKA 5JIHA 5BRZB 2OS7A 3C6LD 1HIZA 4EOWH 4Q7NA 3G5XA 5LKNA 3REWB 1A3LL 3BIKB 4Z7UA 3EO9L 1E6OL 4WWKA 3NA9H 1UADC 1T21A 5DJAA 1K8DA 5EBMA 5IT2H 1A4KA 4FQQA 5F9JB 4WGWB 2GSIB 4YHOL 1YJDL 2XQYK 1T5WB 4JFFD 4FMFA 4LVEA 3UTOA 1T20A 4GAGL 4K2UH 5HPMA 1Z0MA 4PD4K 3T0AA 4L9LC 1ZLWK 2AP2A 3LOWA 4PJIF 4Q6IA 5HHMD 3QDMA 2XN1A 3QUXD 4HZ8A 4ZO6A 3QUYD 2UUDH 4HZAA 3MRLA 3R8QA 5CPSA 3FT4B 3WUFA 4JKKA 3MYJB 1PG7X 2I5YH 3WFBL 5K9QG 1RUPH 3ZHLA 4ODTL 3NN8B 1Y0LB 1R5IB 3SDXF 4XNXH 4OGXH 2VRJA 1G7HA 4OV6F 4QOKE 4K68A 4ZE5A 5IIEB 1C5CL 4KK6C 4JRXE 4XMLH 1Q94B 2YSSA 5KSVB 2VC2L 2IANE 3QHZH 3OWEA 5F1NB 4JVPA 1JI2A 3PWPB 3T0XA 3EYUL 4WY7L 5I0ZA 4J4PC 3RY6A 5HHOB 2WHKA 5CPTA 5F96H 3BPNC 4OBRA 2VDNH 3D18A 3MA7A 5GS1C 4JZNA 3AS0A 3V0VB 4LLYB 1HXMB 1WZ1H 4E5XA 3U9UB 1TTFA 4FQLL 1QI0A 3MYZA 4NC2B 3VFUA 3GXTA 2VLLB 3KZSA 4Z7UF 4GUPA 1QSFE 3VXOB 2DB8A 4MDIB 4U1KA 3MLXL 4OIFA 3S4SB 5EZJA 1VRXA 3TNNA 1F02I 5IB3A 2VDMH 2A6KB 4KTDL 1AQMA 3NBNA 3WF0A 4Y4HC 2JF6A 5KVFL 3I3EA 2KH2B 1YDPB 2A77L 3BPNB 1QA9A 4S11A 5ERWA 3PGCB 3ZKXB 4JY6A 5D72L 2XWDA 2VRKA 5EU4A 4H25A 2FHCA 2HRLA 3CFEB 5ITBH 5JW3L 2GTWB 5E95B 2CLVB 2H2PD 2CLRB 1LDPL 4L1DA 3APGA 4TUJA 4KH2A 1TVHA 3WD2A 5LQBH 4YHIA 6TAAA 2X4SB 5I24A 5C0ND 4OGZA 1IEAB 1T0PB 3C60A 5JZ7C 3WNLA 1KR0A 4X9HA 4PGJA 4RA0C 1GC1L 1ZVSB 4ZDHB 1NC2D 4C83B 1QUNA 5DT1H 4YDLC 2P43B 2PWFA 4GFTB 5JO5A 2Y8VA 4JO2H 2NYYD 2WB5A 2KL6A 2RBLA 4UIKH 1XMWA 3UYOD 3QOMA 4JO3H 4Q9BA 5FB8B 1LO3L 4PY7B 4BM7A 4GQRA 1MXGA 5E5UB 2I27N 5DJXB 3ZE2E 2UWEB 4WW2C 4Y4KA 3M8OL 4HPYL 8FABA 3I2CH 4JFFE 4NCDA 3O3AA 2VTFA 1EOKA 1F6AA 1TFHA 1NEZG 3WLBA 1OAYH 5I0DA 1OQXA 4RE4A 1RI8A 2R23B 1HTYA 3VXME 4M5ZL 2VLRD 3B9DA 2CXKA 1ISYA 4KRPD 3BXWA 2A74A 5BW7C 3TVMA 1BM3L 2OJZH 3NABL 3DX3A 1P4LB 4MNGB 1FP5A 1E4WH 4ELMF 5LXGL 4GG8B 1V3IA 3HI1B 2IAMB 4I8DA 5FM5M 4OLUL 1WF5A 5FCSH 3EJUA 4G8FA 1A14H 5CFHA 2O9TA 3QG6B 4LGPB 3HNVH 5E9DA 1N5AB 1VFMA 2IANA 4F15C 2CKRA 2YUXA 4O51A 4QF1B 1MQKL 3EYVA 2PYEE 3U9PL 3J7HA 4PSPA 4V28A 2V5RA 1IAOA 5F9WC 5E9DE 5T3XH 1IGIL 4MQ7A 3VWJC 4Z5RA 3VXNB 5HYJB 3QXAB 5D1XB 1JBJA 2M2DA 3MV8E 4EE9A 5HGDB 5ICZA 1XH3A 1PVHA 3GMNB 3GSNA 3OV6A 4LL9A 4C54A 1OY3B 3D39E 3VFNB 1C92A 1JNJA 3TO2A 3VGAC 4NDMA 8CGTA 1ONQA 4JL2A 1KIRA 1JK8B 1BFVH 1RIUL 1S7UB 1RZJC 4N0FA 3T0BA 3BVNB 3DX2A 1KACB 3TTYA 1GXEA 4KTYA 3F5JA 5ALBH 5F6HJ 1A9BB 3OKOB 1EA9C 4NM4L 4LSRL 1V0KA 3EW3B 3KPRD 2W62A 2V5MA 5I16B 1E4JA 5KTEH 3EMCA 1HCFX 2DF3A 4E4PA 2DQFA 3CJJA 3CFJB 1F6FB 1PJ9A 1UB6A 2VDRL 4XI5D 4Z76A 5T3XE 1OAKH 2W4XA 3VG0L 15C8H 5IHUH 1OARL 4RIRA 4HJ0D 1E4WL 2E7LA 2IPKA 3CVHH 3EO0A 5DMKA 1U8LA 3SJVD 3ECQA 1RQ5A 2XQBL 2K7PA 4LSVH 2LU4A 3SE4C 3BT2L 2E9MA 3X11B 2OYLA 5JOFB 3FB7A 4OCRL 1VPOL 1IQWL 2IH3B 2D9QB 5HHNB 3NFNB 5IESH 4GXUN 2CKBB 1FZMA 3SPVB 1FN4B 1TZHB 5BVPH 4J3SA 5IFHL 3GB7B 4OD1H 4PB9L 3OLDA 4PLNC 2FD6H 5IBUG 4UOQA 4E9LA 1E28B 4NBYB 4P5TA 5C6PB 2EDRA 3TO4C 5HDLA 1ZGLA 2X4RA 3QQNA 1PS3A 1SYSB 2NY4C 3TH3T 3UJTL 4GZEA 4YEFA 2P48B 2HKFH 2XXMB 3DV6B 3HAEB 4Y16A 4X4ME 4PJ9B 4P2QB 1CDIA 1HDMB 3IETA 2WSPA 3GMQB 3TJHD 3WDJA 4AEIL 4YDKH 1OW0A 3TV8A 3QUMA 2YBRB 2HH0H 2W61A 1IARB 1EEZB 3OGVA 4G8IB 1CVSC 2Z31A 2AGJH 5DGQA 1OAXH 1MWAA 3UG5A 1Q9WA 4YDVA 1XCQB 4D9LL 2PYEA 1TQTA 1D9KC 2ZUXA 5EZIH 1T0NB 5HYQA 1QYGH 4LCWE 3CXHK 4UZUA 2LTQC 2V7HB 5C0CB 3WNNA 1HJSA 1CIUA 5IHZB 4OTXH 5DRXA 4KZEH 1P6AB 5LCVH 2DTSA 4CD4A 3VTRA 1IC5L 3NIYA 2YKLH 4JFQB 2R69L 2VLJE 2VLRE 3KWWA 5DC4B 5EORH 1A6AB 1NMAL 3O0RL 4P8VA 2VLJA 5CLWA 2GITA 1DL7H 2VITB 1SM3H 5KSBF 3KPSA 1FORH 1XD1A 2ZSVA 2WVTA 5TD4A 2DH3A 4NQEE 3BGAA 2XVNA 4P9HC 3BPCA 3N06B 4QHUB 5HOSA 1U95B 3Q6GH 1EGJA 3MLUH 5ENWA 4LYPA 2GI7A 5J12C 4PMRA 3ZKSD 3QZWB 2AXGA 4RMVA 3U7BA 2W59A 1WCBB 3TA3D 1E4IA 4ZNCD 3BSHA 4YDKL 5A3HA 2COQA 1B3YA 1WC7B 2XJ7A 1SJEA 2V6HA 1J0HA 4WWID 1FP9A 1J1XH 1CWYA 5E5RB 4V1DA 3MLZL 2YPLB 3HHRB 4GKSB 1WSST 1SJHA 1UB5A 4UNVA 5I19H 5D4QA 5TFSH 5IMLA 2WWMD 3S36H 5IHRA 1T1WB 3BEVA 2F7QA 4P8UA 2D0GA 2AEQH 3BZEA 1T80A 2V2XA 3E6HB 5FYKE 4I0PA 5MEQB 3EJZC 5F89A 4GRWB 4KI5F 5I15H 5F6HI 1A5FH 4I3SH 2F8OA 3GNML 4ZG1A 3GNRA 4RE2A 5JHLH 3S4SG 3GIVB 2HT3C 3LPOA 5FYLH 3GH7A 4OAWA 4PRDB 4WW1B 1K2DB 3GK8H 1P4IL 2Z8RA 3OLGA 4AIZA 4KK9D 4TUKH 5GGVL 3CDGB 3LXCA 4JEGB 1XC6A 2W67A 5FL0A 3AYSA 2HVJA 1CTOA 3D25B 1DQML 3ULVH 3NCEB 1NDMB 1RUML 2NLJB 1TITA 2YS4A 1MCWW 2WHJA 1QG3A 3BDYH 2CJUL 3HZYB 2V2WB 5D9SA 3VXSA 4JFYA 3BPLB 3V6OE 1B9ZA 3K0WA 4ZD3L 1NMCB 1KEMH 2NY4B 4R4FL 4OV5A 4D94A 1P9MC 4K8RL 1ZA6A 5EZLB 5DVKA 3RL2B 3LH2L 4OZIA 4OCWH 2D73A 3GMRB 3DVGA 1R3IH 1Q6EA 1K6AA 1KXTB 2XSBA 3ARBC 2EH7L 1U8KB 3Q5YA 3IU4L 5LA1A 2VLRB 3LKNA 5DJ0A 1AE6H 1JTOA 2GAZA 3D0LA 3GGWA 2Y36L 2A0LC 5IFPA 1E40A 1YEGL 2MWCA 1CFTA 2ADJB 3FCTB 5I18H 2D3VA 3DUSB 5DZLA 5C0GA 3VIHA 4K3EH 2XSAA 4JFHE 4C56E 2UWEE 5BQ7B 3AXXA 1V6YA 4F7PB 1SBBA 4MB5A 5EC2B 4R0LA 2CDFA 2LAGB 2OJEB 1ZV5A 3UPAA 4O2FA 3JTSA 2P5EE 1YEIH 3QFJB 4MA3B 1NAMB 4FQQB 4ZAKA 4ZTPL 5E08L 3RUGF 3V5DB 3EYOB 3W25A 1T1XA 2H32B 4RX4A 4PBWD 5LA2A 4F8QA 5C0BB 2N4IA 1S7VA 3K3QA 3KPLA 2CHOA 3TYFB 3P9LB 3GBLA 4IIQA 3QDMB 2ZXQA 1EEYA 3VXQA 2L0DA 3AXIA 3GSRA 3V5KA 3S37H 5DMGC 4OCWL 5HVGB 1FPTH 5CP7B 1K5NB 4U7MA 5L7XH 1MJ8L 4RDQF 3R06B 1BJ1J 3FO1A 3MMUA 3HLAB 4PB0H 4R3SA 2WLZA 1A7RL 4MA8L 2ZICA 1CGSH 2B2XH 4P57A 3NSMA 2P8LB 4L9LB 2J8GA 3MRMB 1MJJA 3PZIA 5J7CC 5HHME 1QNSA 4PJXE 3MRQB 1NUFA 1BD2E 4YPJA 4HQQL 3RWGB 3VWKD 1UC6A 4PJHB 4TTDD 5EO9A 5I18L 4Y4FB 2F53D 4S1QH 2XV6B 1FNSL 4GXUM 4OZGF 3MJGX 3WDRA 4A2LA 2YK1H 3VH8G 5FM4A 4LLYA 4TVUA 2CKNA 1QRND 3IFPB 2XKUA 4XHQA 4AENA 4YIQB 3U1SH 1G01A 3M17B 1Y18A 3BMVA 5AZ2L 3MRCA 4ODVL 2BVYA 4MDIA 1E6PA 1JHKL 4QWWD 3VGHA 4JN2B 1CGYA 1LEIA 4OZFG 4ZOEA 3E2HC 4NHUA 1MW2A 3BUTA 5IVXF 2H26B 4MNQA 4N0CD 5CGYC 5I6SA 5JXAL 2HTLC 4LVOC 4KROB 1HINH 4R2GB 1QHZA 3CSPA 1HOCA 3N9KA 1X1NA 1R86A 5FYJL 4RFOH 4NQDB 5A2KH 2OJZL 3NABH 5EFFA 1K9DA 3W0WB 4XGZA 4QHKI 3ZTJH 1FLRH 2H2SD 5AZEH 1FNHA 1TVHB 2JCCE 5DVLA 3RWHB 4FZEL 5D9PA 4Z77A 2X0HA 3NSXA 3PHQA 1LG1A 3L4XA 2EADA 1JGVH 1LWJA 1Z32X 1I7ZA 1BD2B 4QXTB 4W4OA 3WF2A 4Q6IC 2G60L 3FONA 2IALA 4OF8A 3V52H 4NNYA 4X7TB 2MQ0A 3DBXA 4XWOD 1NWTA 2E27H 3KNBB 1CBGA 1HK6A 2O92A 4X5WB 1PLGH 4HK3J 1QKZH 5DD5H 2YL8A 3CC5B 3AIUA 2ADIA 2OI9C 4JO1H 3JTTB 4L29B 2IADB 3AJ7A 1IL1B 5A6KA 5A69A 1ZA3B 4NQXA 2BY0A 3OKKA 5D7JB 1WBXB 1V7MH 2FX7H 1FZOA 5C08D 3PWVA 4HS6A 5AD0A 1UD4A 3K4DA 4LRIA 3WLBB 4PRIA 4M62H 1TQCC 4U1GB 4DCQA 4F37K 3VIOA 3O6LH 3K2UL 1LK3H 4NZFA 1ISXA 4LVNB 3IXTB 3QH3A 4ZQKA 1IGYB 3C6SA 3ZYJA 1RJLB 4M6ML 1IAKA 1G9NH 3GMPB 2X42A 3DV4B 3O3UN 5JIPA 3RVXD 3LEYH 1H11A 5IHUL 4KC3B 4G8FB 5DQDH 4PJ7B 1IFHL 2EIEA 4MAUL 3MSPA 1CFBA 4HC1L 1T04A 5CLTA 3FFDA 3DX1A 1KYOK 4M1DH 2K7QA 3QUXC 4UFKA 1TZIB 3RMEA 3B3IB 3GSXA 4L8SA 3PV6A 1RZ7H 4O51B 2BSTB 3SE4A 1V0MA 2XY2A 4KRLB 1T2XA 1YYMH 4C7DA 3RZCC 4FTVA 3STLB 3L5HA 5MENE 2F19H 4OOZA 3S5ZA 5BXRA 2GW5A 2J7DA 4RWYH 2X1OA 2WUCL 5ICZB 5HHPA 2A83B 1AC6A 4HJGA 3RWFA 1OGAD 2VN7A 5IBLD 2D31A 2Y2WA 3LEXA 1UKPA 3TO2B 1CU4H 4HKZA 1B3ZA 5IR1B 4OD1L 1XCTA 4HX1B 2P47B 2Y6SD 2K9UA 3LN9A 3X14B 2XZCH 2O9OA 4PRPA 4QTIH 2HWZL 3MJ9A 4NZUH 3OKOA 3PBGA 4NO5A 5KSAD 1NANI 4X0KB 4KJPC 4X7SL 2JIEA 1FFPA 2DQFB 2NY4D 4KK5C 1K4CB 4DN3L 5IB5A 3OAYK 4JFEB 1TVNA 4AIUA 3A6CH 3TYGH 1LO2L 1VGEH 2BVUA 2ORBH 1I9RL 1MRFL 4P23C 2I9TA 4JFHD 2EO1A 1LVEA 3BE1L 3LQZB 1I8KA 3KPOA 4ELMB 4YHLH 3MO4A 1YPZF 1W2VA 1WDSA 4EUPG 4XWGH 5I76A 3CXDH 4KV5E 4QLJA 5DI8B 4Z95L 3DMMB 3I6KA 2IH3A 1T0OA 1MCWM 4P4KD 4AEHH 4FQXC 2R4RH 3QG7L 1IM3A 4HSQA 4FMKA 1DN2A 1H5BA 4KKBC 3LDBC 4U0RC 4WTZA 3KPPA 5F3BB 1V02E 3U0TB 4JIEA 3NGBB 2CKSA 2F5AL 4QXUH 2QV4A 1OGGA 4FTVD 5I8KH 1IT9H 3T1WA 2FCBA 1KBGL 3K1KC 1KJ2B 3VWJB 5CZVH 4RAVA 4D9QE 1ERNA 2WMFA 3SUUA 4TUFA 3LXBA 2CR3A 4QRTB 2G75B 5CJXC 2Q86B 3ELAT 1DJSA 2BOBB 2DKMA 1FSKB 3DVFA 3ARXA 1EAPA 4FNUA 1GOKA 2ITDA 4XX6A 5BJTB 4JLRA 3V6ZA 3QDGA 3QUXA 2BC4A 3TA3C 3B9KA 2AJZB 3A24A 2NY2C 3TCXA 3GBDA 2OYMA 4ZXBC 4WKFA 5C9JB 1ADQA 3GXPA 3C5JB 4P7OA 3AXLA 3TBTA 2FO4B 5KZCD 1OP3K 3QI9C 1E27B 1HHJA 1JN6A 4JG1H 1QSFB 5T3XD 3MMEA 4JQVA 2KBGA 4D0CA 4OLZH 2JJUA 3AS2A 1GGTA 3OKNA 4OZHA 5FYJE 3AOFA 2HMID 4Y2DA 4YHYB 2WK2A 3POCA 4ZUWA 1Q0XL 5TDPA 1RD6A 4JFQA 1NWSA 2OL3A 1TPXC 3AM8C 1KGUA 1F4WH 3WDHA 5LA0A 4FP8L 1EZVX 3LB6D 4PRPE 4HWUA 3M1BB 3AHVA 2GITB 5HGHA 1P2CB 3P0YH 4ZSOA 4MAYC 1QBML 2MPAL 3P30H 4M7KL 5MENB 4NP4L 4F58H 5BO1L 5C7XH 5J11C 1O6IA 5ENWB 5GGSA 3W82A 4C4KO 3CZSA 4KJYB 1X4ZA 2ICES 3IYLW 5E6IC 4ZO8A 4M1CC 5H35A 2BHYA 4ZFGH 1XIWD 3RTQB 4ONOA 1ND0B 4FQHA 4XPGL 1I9IL 2VDKL 2ZSWA 2HVKB 4QHLB 2HYMA 1SZNA 4HUXB 1MSPA 5C0AE 1EFXD 3CCHB 3QRFM 3WNMA 2FEEL 1I7TA 2WW5A 5DQJA 3AZRA 1JGLL 2PYFB 3BUYB 4L4VA 2DGAA 1P7HL 1FNGA 4XTRD 4NRSA 3WSQL 3ARBD 3LQAL 2WC7A 3U7WL 1CK0H 3PWPD 3S5YA 2ZKHL 2APWA 3LX9A 4YQXH 1K9TA 1V5JA 3GJFB 3N85L 4J7RA 4NRZB 4RSVA 3RGVA 1WB0A 2Y36H 4KKCD 4PB9H 4WFED 3SUSA 4X9BA 1UKSA 1Z3GL 5EPMA 5AC5A 2WINB 1RZIA 4RBPK 1LL4A 1G7QB 1ORSA 3AFLA 5DHVH 2VQ1A 3D39D 3HZVA 4CN6A 1MJUH 5F7DA 1IC4H 3WS3A 1CI5A 4NP4H 2WIIA 3RJQB 4GBXD 3V8OA 1REIA 3A5VA 2V7NA 1XF5B 3D25A 3GXFA 3CFCH 1CXHA 3H55A 4ONFH 4KHTH 2EDBA 2PC8A 5IOPB 1Z9SA 3DUUA 3OR7A 1UQYA 3LHPH 1YECH 1N4XH 3UO1L 3PTQA 3VWJD 3DWTA 4W85A 1OPGL 2P1YA 3RWJA 1M03A 4HWBA 5FDYA 3O3BB 4B15A 5CEZL 1ZBWA 1S9YB 4WIWA 5JR1H 1W0VB 3G6DL 4K7PX 2Y4SA 4D71A 1C16B 3MREB 3W9EA 1M7XA 4YDIL 5J11B 1CDGA 3NTCL 2VMFA 3UYPA 4HTYA 2ZX7A 4KRMB 1A7PL 2D9CA 2J3SA 4PLKC 3GSNL 3D9AL 4Q2ZA 1BIHA 5HGBA 1EEQA 3DUSA 3GIZL 4HWZB 4JHBA 5GRVL 1MHHA 1OIMA 1L7TH 3HPLA 3QNYB 2NT1A 5IVXA 4CVZB 2ICWI 4NQCB 1NFKA 1BZQK 1U2YA 2B31A 3QUKB 5HDBF 3WL9B 4N9OB 3B5TA 3QEHA 4F33B 4ZAKB 1JUFA 3HG1B 3I3BA 1W9UA 4U1NA 3V5DA 3BJ91 2XWJB 3MRBA 1LE5A 2WWCA 1EIBA 1UJ3B 1UM4H 5F3HA 1J1OH 4I0PC 4HUKB 4DTGH 3ZM8A 2AK4E 4WUUB 3U83A 1EEYB 3PP4L 5B3NA 3N9GL 2E9BA 1P69B 2E7HA 3ALFA 5CWSB 4X98B 4HLJA 3WIFB 1A3LH 1S7WB 1F2QA 5I3DA 1SMAA 3ZJKA 3HC3H 1HJVA 5DD0H 1XIWA 3IF1B 4P57B 3PL6D 5IROC 1J8HA 4L4OA 1NBVL 4IHOB 4FTVE 2HJFA 3RWGA 2ZJSL 5M03A 2Y72A 4A6YB 1KYOJ 1BOYA 3TTOA 4NO2B 4H26B 2G60H 3A4AA 3KLKA 5I1KL 5EIIB 3BKJH 2BXZA 1U92B 3ET9F 3WUWB 5IESL 4S1RL 3ECBA 4N5EC 2XGBA 2V17H 4G7VH 4MX7A 3HFML 5IFHH 2FX9L 1Y18B 2FH8A 1XH1A 1UQZA 1US3A 1VEOA 2XWEA 3RI5K 1RIVL 4LLDA 5CEYB 3HAEG 1EMTH 1TJIL 1GOFA 5EU7C 1BWWA 3WD5L 1LEIB 3NPSB 1AVAA 4NSBA 1PAMA 2YD2A 1VSCA 2AXFA 5E24E 1LO0H 3DX6A 1W9XA 4X9YA 3FO9A 1VKXA 4TTDC 1KJVA 3CH8A 3UEZA 5HY9A 3NCYP 3O6FC 4HS8L 2EIDA 3O9WA 3ORJA 1G9HA 4Z2KA 2WHLA 2DKSA 3MV8D 4YHNB 2W60B 4MQXD 1G9NL 3BP7B 5KVEH 2DT3A 3W0WA 2BFGA 1DHKA 3SDAD 4X0VA 1U8QB 5I1EH 1OL0A 1TMCB 1LNUB 3TOPA 4TSCL 5F71A 2CRYA 1EUTA 4M43L 3GBNL 5JZ7D 1G7PA 3GDBA 4XV0A 2AJ3B 4KROC 3TFKC 2GJ6B 3HB3D 3WFCL 1VBRA 3P4OA 3TBVB 4E41B 3CUIA 4YGVA 3DBXB 4GBXC 5EA0H 5I1CH 2HTLD 3BAJA 2F19L 2B5IB 4HA3A 1U8JB 4TX8A 3RVTC 3CMOH 1BQCA 1EJ6A 3EMZA 1NCDH 4QY8B 3S6TA 1MFVA 5F8RC 2LU3A 1U91B 4EUPH 4YNYA 1RZKC 4ZPTB 2HT4D 3X12B 4OCMC 1AD9B 3OJDA 4JZJB 5DMIL 2MHAA 4MDPA 3LS5L 3U0PA 4KROD 3TFKD 3S5LB 5GXBB 2AABL 2NSXA 2B4CH 3AAZA 2O5YL 4LFHD 4PRHB 3DVIA 4F57H 3BUDA 5CBAB 1L7IL 4PJDF 4WO4C 5ACMA 3CFKA 4R4BA 4YC2C 2ESVE 4YBLC 3C6SB 1CXFA 2H8PA 3DTXA 4I1NB 4QTHB 5D7KE 3SDDD 2EO7A 1Z6JT 1UWIA 2YHGA 1S9WB 2F54B 2NY1C 3BH8B 2WMKA 4LLMB 4YUEL 4JVWA 1L8NA 8A3HA 2NY6B 3KXFA 2YC1A 3IAQA 5BOZG 1LEGA 1MW3A 2RR3A 3THDA 3L9RB 3TN0C 5ID1B 3Q2CA 2C4FU 3D52A 1TUXA 4HQQH 3JV5A 4R0LC 1E6OH 1NGZA 4XVSH 1QFWH 1Y6KR 2F1BA 1OF2A 5ESVB 5CUSH 5J1AB 4JZOB 4UINH 3DIFB 4BA0A 5CSUA 3DSFL 3M6DA 4S0SD 4JPWH 2IEPA 3LKOB 5A6LA 4CADA 3L7EB 5GGUB 5F9DC 1MVFA 4ZEPA 3LRMA 2ZCHL 3C5ZB 3RCNA 1S7SB 3OAUH 2VURA 4Y19B 2A9ML 1C5BH 2F9BT 2BNQA 4ALAL 5CCKH 5DQ9B 3SGKC 2D20A 2GTZA 3LS5H 3BP5A 3IDJB 4OLXL 2IBBA 3L3OB 4U1MA 4HIHA 2LAAA 4X4XA 3L2MA 3LV3A 5CGTA 3V4VL 3OLIA 1YN6A 4Z7OE 5FM5O 4PRBA 1Q9OB 3MBED 4P2RA 3MRRB 4X8JA 2YUWA 4LEXL 3AU1A 4BKLB 1E43A 2FL5B 1JAKA 2NW3B 1FIEA 4FOMA 3RDTA 4Q6YA 4Y1AB 1EXUA 4L3CA 1B2WL 5IBTH 3WUWG 5HSFA 2HVMA 5HHQA 4L8DB 2VOTA 2WP3T 1ZHLA 5JIKA 4K3HA 1A6ZA 3AXHA 1SEQH 1JHTB 2E6PA 2G9HB 3HU7A 5JTWA 3GMOB 3G04A 1UZ8A 5EOQH 3E2HB 2W63A 1KC5L 1LK2B 3GHBL 4HKXA 5DRZA 5DXWA 2V9QA 3OJMB 3OGCB 4Y4HD 1MW0A 1CE1L 3MLRL 5F1IA 1OAZL 5IMKB 1OGTB 4I2XA 1ZGLM 1RK1A 5F93C 4GKOA 5IFAH 4JFVA 2DTML 1P4BL 5L88L 3BXNA 1NWUA 4N5UA 3B2VH 1C08B 4G6AC 3W6LA 3MPCA 5DUMH 1RZFH 4H04A 1MUJB 2O5ZH 2Y24A 4TN9A 3SDXE 5ID0B 1KFAH 3T0EA 5HYSG 1QSEE 4M62L 4AD0A 4M29A 5DHXB 2OR9H 4H5SB 5DMJB 3L3GB 2VKWA 4R26L 4HMEA 2G3MA 2X4TB 4CVXA 4FMVA 4OM0L 5D2LF 3HNTL 5I2IA 1S3KH 4PTXA 43C9B 4HMCA 4FABH 3MA7B 1WZLA 3D5OF 1U0QA 3SDDB 3E6FB 5SWSB 4JFFA 4U7KA 2EJ1A 1HXMA 1R24A 1I8LA 3ZDYE 1HEZB 2P7TA 3BD5A 4MJ6B 4U0RB 4F2MA 4I4WA 1MI5D 3M7SA 2PO6B 1HQRB 2QSVA 2PI6A 3N17A 4U1LB 2OWCA 2FYYA 4ODSH 3EJPA 5K9JH 1FFRA 2Y07H 1AO7A 4PGBA 1ZHNB 3L3JA 1DQJB 4JHWL 1CG9B 1HYRC 2H2PC 3D85A 1WJ3A 2ICWB 4TULH 4GMTH 3MLWL 4D0CB 2DWDA 1F58L 2ZXDA 4NGHH 4H0HB 2VZSA 4OLWL 1FHGA 1UWXK 3RGVC 5FUZL 2R0KH 4G9FD 2VSDA 2CITA 3HI6H 1A6VH 4BQ4A 5JBDA 1DFBL 3O2VL 4R4ND 3EJSA 1FNFA 5EO1B 2AI0H 5HGHB 5DHVB 5L2JB 5ITFA 3VFWA 3IK2A 3B4NA 1BM3H 4YHPB 4Y89A 4Y88A 3QEQA 1MWOA 1TQWA 2FECI 1WIUA 4GG6B 2ZOKA 4AYSA 5DJ6B