3VGGA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltoheptaose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
554
structure length
554
Chain Sequence
YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 193
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vggA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vggA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vggA02
1N8ZA 5LXGL 1Z9MA 1WIUA 4HIEB 3MV11 2V9RA 3QHTC 5MENB 4JJ5A 3W25A 4LGXA 1PQZB 3UMTA 3V5KB 3IDJA 5A6KA 4POZC 3BH9A 5HI3C 1FAKT 2R29H 5DVNA 3V52L 5D71H 2UWEE 5FYKH 1H0IA 3UTTE 1JN6B 1BWWA 3FQRB 5I0DA 1U8JB 1R8LA 4AH2A 1JXKA 1K4DA 5I76A 5ID1A 2A3CA 4PG9A 4JQVA 5DJ0A 1MXDA 2AEWA 1HNGA 5BMFL 3O3EB 1A6ZB 4QRQB 4DAGH 4H41A 2PF0A 3NH7H 1UYWH 1BVKA 1JGVH 1W9VA 4NSBA 1JIBA 2CD0A 2CR3A 1FV1A 4JGUA 3RKDD 1BREA 2E6JA 1PKQE 4NQVA 1A1OA 3HE7C 4D0BA 4HDIB 2NCMA 1HL8A 2EXWD 4IRSD 3ROOA 3ULVD 1Q94A 3KPRE 4GQ9L 4J3OC 4X99B 4AMCA 1F4XL 4NO0A 5DGRA 4YFLI 3KPLA 2NY1D 3IXTB 3OSKA 4OKVB 4UFMA 2X2JA 4U1JA 1KCUH 5D2LF 5A1AA 4IS6B 1IGCH 3OAUL 3T08A 4N8VG 1G7PA 2IFFH 4X6EA 1ZWIB 3BQUD 5C0GB 1CE1H 3U4AA 1MWAL 1DBBL 1I1YB 2XTJE 3O4OB 4HS8H 3IKCA 4XVUC 4Z7WE 3UZQA 4U5KA 4FNRA 4FQQB 4BF7A 4UILL 3ZKQD 4Z7VE 5DJYA 4GBXC 3QOMA 3G6JA 4GMTL 2O92A 4GUPB 3ZSTA 1ZLSH 2BSSB 4M82A 4O9HL 3PWPA 5IT2H 5T1DL 4UOZA 3V95A 5BV7L 1P7HL 4P3DB 1OINA 3GIVA 4FG6C 1FNGA 2Y06H 1TPXB 1PZ5A 4N0UA 5FOOA 3AHXA 1KIQB 1A9BA 4F3FB 2YC1A 5C9JB 5E1QA 2NY6D 4TNWK 5K9OB 2E7MA 3DV4A 3GSOA 3F5WB 2YEZA 2AJ3A 2SEBA 5EC1A 5CJ5A 1N6UA 4PYGA 3VXRA 1KXVC 3CC1A 1WWCA 3WQ5A 4HWBL 4J1UA 2VLRD 1HHKA 2R9HD 3QPQC 1C90A 4M1RA 2XRAL 2OTPA 5I6XB 1Z9LA 1UR4A 3EYVB 4Y2DA 4PJBB 4J3XA 1DHKA 4LHUD 5DT7A 3QCVH 1BYCA 2UWEB 4MDIA 3UTTB 2VISA 1PEWA 1JF5A 2VXTH 4JM4L 4JR9L 2AXJA 5IB1A 1Y18A 5JXED 4RFNB 1KTLB 5EH1A 2CUHA 4N8CL 1K8IB 2H9GB 4Z7QF 1CD1B 3IU4L 4JZOB 2GT9B 4F9DA 4ORGA 5M3WA 3WUFA 4X7SL 5D1XC 4FQPA 2P5EE 1I9IL 2DMBA 4F7EA 5ADPH 3FOLA 5C0CA 4TRPL 2W38A 1SY6L 4P2QA 2V38A 4OSUH 1LO0L 5DFTA 3MUZ1 1LGVA 3KPRB 3ZDXF 4L1DA 4G6ML 1DLFH 2ZXBA 2F5AH 4OFVA 4PP1C 4WHTA 4OZIA 3S96A 5IB3A 1NCBL 1XHGA 4LIQH 4XP5L 2BCKA 1XGQA 1BJMA 1HI6B 4H1LG 2XTJB 4OGAD 4FZEH 1DBJL 4HULB 4PRID 4QRPE 2H8PA 1G0DA 1PG7H 3S7GA 4WTZG 1JWMA 1K9EA 1I8LA 3C8KA 1KSRA 4DW2L 2X4PA 4PD4K 1AY1H 3UBXI 2P24A 4Z5RA 2UVEA 4HCRA 3NCOA 4XMKH 3OHXA 1ISWA 1IQWH 3MLXL 5E8EA 2VZ1A 1GUVA 4W84A 2EPLX 1I3GH 4RAUA 1DP0A 2FO4A 3UESA 3CPLB 5EPMB 1P5VA 1EPFA 1PAMA 1CF8H 2G4FA 4UNIA 4WCYH 3FOMB 3FB8A 1D5XA 3QNYB 4AIEA 1NCWL 3EBAA 4XBGA 3N1AA 2J5LC 3TT1H 3MRBB 3LMJH 3QNXA 5MI0B 4M81A 4HX1A 1R24A 4LLVB 1UCTA 4PIRF 1XMWA 2FJGB 4TVSa 4P23C 4LLAA 2YWYA 2N56A 5HDBE 2E0PA 2KQNA 1NMBL 2AXHA 2XZQL 1JWSB 8FABB 2FNBA 1HEZA 3LKPA 3NIGF 5GS0D 1AI1H 5EOQH 4NC0B 4ZYKB 4FTVA 2ZUTA 1JFQL 4IBLT 3TNNB 4KRPD 5T3XH 4NZJA 5M7QA 1WKYA 5LAXB 1GGBL 4HWEH 3UTQA 4X9HA 1TJIL 5DR5L 1G7QA 3DI3B 5BVPH 2CERA 1FFOB 2MWCA 1ZGLB 3O9WC 1U8NA 2QTEA 3PGCA 4DM2A 1J5OH 5E5MB 4CMHC 4D6HA 3O2DH 3WO3B 1TETL 3MBEB 1A0QH 5IB2B 4LSTH 4FFVC 4PRAA 4YWGH 1CR9L 2D0GA 4QO1A 1URLA 4R8WL 3OGRA 3KWWB 5IOPB 1GOQA 1AHWA 2NY5C 1KPVA 3VWJC 4QRPB 4YFLF 1P84J 3OKDA 4AIZA 1G9NC 3IFLL 1L6ZA 3WD3A 4IDJH 5D7KD 5I1CL 5EBWA 1S7XA 1Z6JT 4JY4B 2DLIA 3TC9A 1MXGA 4B15A 2O5ZH 1QSEE 2QQKH 2VN7A 4Z8FL 4ZFGL 2EDNA 4H8WC 2X9XA 2DN7A 4AZ8A 1U8LB 1AC6A 2VURA 3RJDA 3RX7A 4YDVB 1KC5L 3WFEL 4JDVB 1CU4H 1UZ8B 4A6YH 5ISZB 1M7DA 4HF5H 2CSPA 4FQLH 5I74B 4F37K 1BOGA 4YPJA 4D6IA 1OW0C 2VIRB 1OT2A 2PW1B 4JHBA 5I1AA 2AOSA 1CGVA 3PQYA 1T0PB 4HK0B 3VD5A 4IM8A 2IBZX 4XMPH 3VILA 1F4WL 1H0DA 3KDMA 4OCSL 1ZTXH 4LAJH 1HYSC 1V08A 5GRWA 2VLMD 3S8WA 1I3VA 4I0PA 1QX1A 4TVPE 4PJFF 2CRIA 3UO1H 3U4BL 1MPAL 1OTUD 3HZYB 4LGSB 5TGBA 1EX0A 2D03H 1HINL 2EEXA 4R0LB 3OR7B 5J13C 5SWQB 1WBYB 2A74A 4HZAA 1RFDL 1N0XH 1P69B 1MVUA 2A6IB 4PMZA 3MCLH 3IAQA 2EH8L 3ZJ6A 2IANA 3BN9D 4D6EA 3ZE2E 3GSVB 1H8NA 3ARFB 3CFDA 2VO5A 4YXLH 2H3NA 3VGDA 5DRNA 5A2FA 2XY1A 1GGTA 5I8EB 4P8VA 4P59H 5DI8A 2A73B 4DM1A 4UDTA 1XT5A 3H6JA 1CZ8L 2IAMC 5KSUB 3O3AB 4MYWB 3QEQD 3QG6A 4F7CA 1B0IA 1TZGL 3LQMA 4WV1B 4KY1H 3DIFA 1OAQH 2K1MA 5EN2A 4YFEA 2CJUL 3KLHC 3F58L 4B9YA 3FRPG 3A6CH 1JHLH 4K3DH 3TVMD 3VFGL 4LHUG 5AYUH 1TR1A 5F7MC 3MSPA 3D25A 4KVNL 3ZLQC 4C56E 3C60D 3PWVA 1FL6B 3LQAC 3EJJX 2PO6B 2O9OA 5DD3H 2PUQT 2AJYL 5MERA 3AREA 1QSEB 1KTKE 4I18A 4XPBH 4L3EE 3Q2CA 3WS3A 1N2RB 4WWKB 4W6YB 1YEEL 3WQ6A 1JVKA 1KGWA 1Z9SA 4UIKL 4LLUA 3IJ8A 1RU9H 1AIFB 1QLEH 3AI0A 4Z2LA 3VXPB 4XHQA 1G0YR 1R6VA 3AOFA 5H35A 4W89A 1AC0A 3BIKA 4KHTL 2FECL 5E6YA 2XFYA 5IROA 4JL1A 5E2VH 3RWGA 4PJXB 3WD4A 1UKTA 2LV4A 1UOKA 4MXQC 1SEBA 1IAIL 2NY0C 4JFQB 3IF1B 4OLZH 3V4PH 3HAEG 1DQJA 2DSWA 4POZD 5HI3D 4L8SC 3IJHB 3PWLA 1M7IB 4HSQA 1OVZA 3FFCB 2BHUA 4WW2F 3RPIB 5C0BA 2P5WA 4M7LL 5DD5H 4RNRA 3RPMA 3PHAA 2DSZA 2BHYA 4POUB 4M62L 3VH8A 4B3KA 1DLHA 1RK1B 4PJ7F 4AZ7A 1MNUL 2XZAH 2VDKH 4R26H 4KHXL 4NQDD 4PJDF 5HYJE 3VG0H 1DSFL 5ITBH 5ESQB 4JVPA 3D3VA 2WVVB 3QI9D 2Q8XA 3ET9F 3CVHL 1KG0B 4YO0B 4N9OB 4V2CB 5F7DA 3RTQA 4ZE4A 5AYQA 4XB3A 1YPZA 1I1AC 3O4LE 3HE7D 5CJ8A 3PHOA 3CTTA 4RIRA 4WEUD 4E4PA 4PR5B 4JVUA 4B7LA 4HZ8A 3P30H 2C26A 5TFSH 4MNLA 3BP4A 1QPXA 3F7YA 3OKOA 1K6AA 5B8CC 3OAZH 5TQ0H 3AUVA 2V5TA 4CNIA 1EOKA 1X5XA 3BAEH 3HG1D 3VWKC 4YDLC 5BXRA 1OAXH 5AD0B 2D7NA 1BGXL 1ZT7A 5F3BB 4XVUD 2BNJA 5CIPA 1QBLL 1RZ7L 1VGEL 4L5FH 4Y4KD 2J7LA 4GBXD 3CHFA 4ALAL 3RZCA 3RNKB 3D87B 3WHXA 5CCKH 4OM1L 4S2SB 4HUVB 4X4ME 3CLFL 1MCCA 2ARWA 2V5YA 4BQ2A 1DANT 4FG6D 1OTTC 1PSKH 3EJUA 4AIUA 2FZ3A 1QQDA 1QFWH 4LASL 1NBVL 3LX9A 3VSVA 2EYTB 1FH5H 4D2NA 5I30L 2GK1B 5IB5B 3T0EA 5GGTL 3MV9D 3E6FA 5ALBL 3S35L 4NJ9L 4Q6IC 2CESA 3WKMH 4MZ2A 2HVJA 4HT1L 1TXKA 1O7SA 1ZA3A 4JY6A 1T22A 1C12A 4JQXA 4HQQH 1KUMA 1QVBA 5EU3A 4WU7A 3QPQD 3FN9A 5IFHL 5I19L 4W8AA 1XGTA 4HZ7A 1MCBA 3DBXA 4YHIA 3ILPA 2VABA 4C83B 2IPUK 3D39E 3EKCA 12E8H 2H32A 5DRWA 5LA2A 2QQLL 4X5WA 2X70A 4UTBL 5JPMB 4XXCA 1KJ2B 1GZQB 4JFOA 1RUPH 4HJJH 4U1IB 1FAIH 2PWFA 5HYJB 3MRKA 5JDJA 4F58L 3QNZB 2FJFB 4HXBH 1KBBA 1BJ1J 5C07A 3U0WH 5D1XD 4A2LA 4BZ1H 5INCB 1K9FA 5TE7L 4LLWB 1E28B 5ANME 2VXQL 3LRGA 2QHLA 3GSNL 5E8PA 1VPOL 3DX9B 1JYWA 2E7LC 1QACA 2BSTA 1NKOA 3NCJL 1A7PL 2GCYA 1G7IB 3VFWA 2VLJD 4XPTL 3SUWA 4MAYC 4ZFOB 3LOWA 3MLRL 3PIQB 4Y1AD 2H2PC 3SUVA 5E1HB 3MREB 3QDME 1P2CA 1QFHA 3Q3GA 3U1SL 3WQ4A 1JTOA 3FAWA 5CZKA 2D1ZA 5DS8A 1E6JL 4V1DB 5IVXB 1X6LA 2JEQA 1OARH 1CS6A 3GMLA 5CBAA 5CJQH 3QDJD 5FECA 3FTGA 1V6WA 3AS1A 1WNOA 4LNRB 4LRNL 3LRKA 1HN1A 2AI0L 1KENH 5D5MA 4QHLB 4H88H 3QXAA 4RFOL 5FCUL 3VG9C 2PC8A 3AXLB 3EOAB 3Q1SH 4U1MB 3VFSB 1EUUA 1G6RL 1MUJB 3BDYH 1UACL 3WH6A 5CSYA 5GIRA 1ZS2A 5JORB 4MJ6B 3ZO9A 5CPSA 3AIBA 2NY7H 1OSPL 4G9FE 2VNCA 3GSXA 15C8L 1C1EL 5HI5C 3T4YA 1MF2H 4AYFA 1JL8A 4LVHC 2DQCL 4DWHA 5T1LB 5FHBL 3DOSA 3QIWC 4YHPB 2R8SH 2ATPB 3T3PE 1WBXB 2BJMH 1H3WM 1KB5H 3RDTC 3JWDL 4YHNA 4P23D 2BMKB 1B4RA 1VCAA 1G9MH 4QHMA 4ESKA 1B2WH 3MLVL 4YNYB 5KVFL 3BSGA 1WB0A 32C2A 1BQSA 1TZHA 1UZ6E 2VXVL 1A7NH 1QOKA 3PE9A 5EG6C 1RIVH 1E56A 5F93C 5C6WH 2ZUWA 4F80A 4RGOL 5BZDA 1KWKA 4LEOB 5E4IA 2FHFA 2KZ1B 5ANMB 4POYA 1H11A 3RQ3A 5BYWA 1MLCA 3KZSA 1HQ4B 4MXWH 4TQEH 4X4XB 3U9PL 5JOFB 4Y4FC 4KZDH 3O9WD 4FQ1L 3KYNB 5EU5B 3W9DA 3AMGA 3ULVE 2IWGA 2CDGA 2FYYA 1BAFL 4L8CA 3OAYH 3GBML 4P5TD 1FZOB 3G5VA 2A9MH 3QHFH 4M48L 1RSFA 4FFVD 5BCAA 4HJGB 5DXWA 5D8ZA 3BPOC 4PMOA 3TJHD 4IMKC 5HDRA 3PV6B 3GSUA 4G5ZH 2VZTA 1LDPH 5LKNA 5I16A 2EKSB 2FO1A 3TWCH 2BVQB 4CVZA 2YPLD 4ZS7L 1B9ZA 3UPAA 5F9WC 3BUPA 1B0WA 4OI9A 4YHLL 4PREA 2K7QA 5DUPL 2XQBH 4NFBA 4XBEL 5FYJL 4YX2H 3ZQ9A 3RWCA 7A3HA 1LK3H 3UPRA 4PTVA 1S9KC 1ZHBA 4P46C 5DJAB 1A5FH 3BKYL 1K2DA 2NY2B 4X6BA 4G9FB 3QG7L 1LVEA 5GJSH 3BZFB 1VEMA 2Y7QA 1WLHA 3CXHJ 3FNDA 2VB5A 2LAAA 2VLRE 1M6OB 3QJFA 1S5HA 4WI7A 2VITB 5AWNH 2DM7A 3BP5B 3I3DA 1Y6MR 4WW1B 1P6WA 2D3LA 4M8UA 4AD3A 1WFOA 4ZTPH 1F8TL 2OW6A 4M02A 5DMIL 1HX0A 1XF3B 3SCTA 4N9GA 4D1JA 1DL7H 2W9EL 4XP1L 4UQBA 2GITB 2MQCA 3PXJA 1AQ0A 3C5ZB 2YPVH 1Y7VA 1EO8H 4RGMC 4PB0H 4BYHA 3SOBL 4LVOB 2WANA 2AEIT 1RJYA 5J3HC 1UYQA 1HYSD 2R2BB 2DSKA 1L7TL 4XAWH 1SEQH 4PGEB 5C09B 3U0TB 4Y8DC 4XRCB 1Q9KB 3TLRA 3V6OE 4ELKB 3EIFA 5CBEB 4JFZL 3N11A 1CQKA 2EE3A 4PJ8C 3Q6GH 4R4FL 1NSNL 1JRHH 3EFDL 4XNZB 1AGBB 1E3ZA 2DWDA 1JHKH 4WI9A 1XR9B 5FYJU 4JRYB 4LCUA 5IQ7L 1ACYH 5KZCD 3PZ9A 3L3DA 5FO8B 3EYFA 1IV8A 1KXTA 3QDGD 5L88H 3KPMA 5IUSA 3HLAB 4MAUL 5GS2D 1XIWB 5FOJA 5E03A 3MRDA 2FSEB 4AQ1B 1BJ8A 1BZ7B 2A0LD 1M03A 4WW2C 2DJ4A 3SJVA 3VXMD 2EABA 1ZVHA 4QEGA 3EJPA 1ITCA 1E0XA 4JHWH 1S7RA 2IAMD 2QBWA 3GB7B 3CZNA 1OCWH 2VKXA 2F9BT 4PYHA 5DT1H 4FNSA 1T83C 1IC4H 4PRIE 1TMQA 3L3HB 1CXIA 3EJSA 4LPYA 3UJIH 3IDNA 3KLHD 2DDQL 4PRPD 1L0XA 4EBQH 3ARBA 1QSFA 4DVRL 3ARPA 4UNUA 5A2AA 4JM2A 4OLUL 3MJ8A 1HH9A 1ITXA 2YD4A 2G2RA 5GS1A 4G80B 2E8YA 1CECA 2CK0H 2EDHA 2ORBL 3DLQR 2AK4A 4XPHL 3UAJD 5KBNC 4BZYA 2ZSWA 3MV8D 1YN6A 4X5XB 5IBTL 3L7EB 2FB4L 3MRRA 4M7KL 5GRXG 4D6CA 3HA0A 4YDKL 5C6TH 2V2TB 5M5DA 1J0IA 4J27A 1BD2B 2H26B 2PXYA 3P11H 2VLRB 4HIXL 3MRJB 4WEBH 5IF0B 4XP6L 4O5LH 2Q20A 1EHXA 1OPGL 3VNYA 1KN2H 4JKPL 4D0DA 3P73B 4DTGL 1OM3L 1TVBA 4PV8B 4NRRA 5AZEH 4XCFL 1JN6A 4HXAH 4X4YB 1JPFB 3FQRA 4HBCH 1U8JA 2CQVA 3HC3L 3K3QA 4MXQD 3WUBA 2R1YA 4FFWC 4ZAKB 4OFIA 2NY0D 1IAIM 2B2XL 1WZ1L 1AXIB 4FABL 3A21A 4FLOA 1Q0YL 2APTA 4BH8B 3O3EA 1A6ZA 4QRQA 4HPGA 3O6LH 3FO0H 3VIGA 4G7VL 5DUMH 4EDXB 2ZP0T 3RA7H 3PZGA 5D9MA 3T65A 4OD1L 4PGCA 1E40A 1XGRB 4GW4B 4PRHD 3PWUA 5BW7A 1W2PA 3DRQB 5HI4C 3DO3A 2YSSB 5ESAA 3M46A 2HFEB 4XCCL 2V5MA 1JI2A 2X2HA 1A3HA 2PYEB 3A4AA 4X99A 4JN2B 3ZYIA 4PV9A 3WHE0 4NXSA 5KN5B 1NCTA 3IFOA 4Y5YB 1WC7B 1I1AD 2VLLB 3KPPB 4JVWA 1ZWIA 2CKBL 3IU3B 5C0GA 1CG9A 1I1YA 4FFZH 1LWJA 5EU4B 4EI6B 4MJ5B 3A67H 5CEXA 3S88H 1QHPA 3QXTA 3MJ9L 2Z91B 5D7KE 3T77B 4GG6E 3RILA 3PZUA 1E4KA 4P3DA 1INEL 4O00A 3PTQA 4XI5D 3LXAA 3QZWG 4F3FA 3BKML 2WVSA 4NZUL 5E24E 2WHLA 5K9OA 4YHML 1V02E 3OB0H 3SCPA 1CL7H 1N7MH 1U42A 1D5IH 2X4TB 1OTTD 1I1RA 1DQQB 1CCZA 1Q6EA 2HLAB 2YBRB 4Y88A 2APVA 4XPGL 3VGEA 3D9AH 4PJBA 2Z4QB 3TBVB 3K8MA 3IGAB 3R8QA 4XC3H 1ORSB 3WBDA 4LPTA 4LSDA 3K2UL 2DIBA 2IADA 3X11B 1KTLA 1WGOA 2I9LB 2VLME 1K8IA 2H9GA 1CD1A 5EC2A 5F7KC 1V6VA 4JZOA 2MHAA 3K80A 3MRMA 1QNOA 3AS3A 4KK5C 4KUZH 5DK0A 5EWIL 1B4JH 5ICXB 2I25N 3A6OA 3EJZC 4LSVH 1ISXA 3ILQC 1GYAA 1NEZG 3BAXA 4Z0XA 3VFPB 3SCWA 1GZPB 1QA9B 1R0AL 3CVIH 2W1NA 4AM0A 4P7LA 3AXHA 5LXGH 1AQKL 2YUWA 4BSVB 5JA8B 1JTTA 5ITFB 4LYPA 4AW7A 1EQCA 1VFAB 1L7IL 2CRMA 2X41A 3V52H 1YC8A 3LRSB 4GAYB 3QEQE 5I77A 3MYJB 1VJZA 2E7HA 2NY5L 4P4KB 1J88A 5DUBA 4FNQA 3WKNA 4JFSA 4K7PX 2YA2A 1UR1A 4MAYD 4NNXB 3OKKB 1II4E 2H2PD 1CFVL 1G9NL 5BMFH 3OB8A 3LV3B 1TENA 1AD0B 4ZUSB 1PG7W 4U3CA 1TTUA 2HJLA 3ZR5A 2HKFL 1PFCA 4JPIB 1ZJBA 3PJSB 3OZPA 3P9MB 4H8WL 3WN5B 1PZ3A 4ELMB 1EGJA 3H9ZA 4AZIA 4M8QA 1BZQK 3CPLA 1I9JL 1F4XH 4JQVC 4D6FA 1ZA6B 2GTWB 5C92A 5I3DA 3FN3A 3CFKB 2W0PA 4ZO8A 3OAUH 2R2HB 2DLGA 3VXNB 4NRYB 2H6PA 1CICD 2FJGA 1DBBH 2W61A 2YPKB 5DC9B 4UILH 2Z8WC 1HCVA 4GMTH 1JWSA 8FABA 5LYRA 4I3SL 3UZVB 5DHVB 2HTLC 4O9HH 5HGHB 5T1DH 3QIWD 4Y16D 5BV7H 4ZYKA 4AZBA 1IILE 1XGPA 5T3ZL 2F74B 3PTKA 1DUZA 3H42H 1N6QL 4JL2A 4NUGL 3WMSA 5LAXA 3R1GL 4R4NC 3G5YA 2IXVA 1IARB 3HE6A 2W60A 1FFOA 4AL8L 3DARA 1BHGA 4PRDB 4NQDE 2C7UB 5E5MA 3OR6B 3EYUL 1GPOL 1JMZA 1QSVA 3KXFB 1JHTB 1QHZA 5D9OA 4GXPA 5DJ8A 3WE6A 3WUWG 1I1WA 2XRAH 4MJID 4BUGA 1AR2A 4MNKA 3HPLB 4EUPG 3OBAA 1D2KA 5TE6L 3WD2A 1BQLL 1F97A 4TPRL 3KWWA 5IOPA 2AK1L 2PB1A 4JM4H 4JR9H 1C5BL 1NL0L 4DZBB 3BHBA 3BT2L 4FQCL 4JO4L 3TVMB 4AQOA 4F15B 3DXAD 3IU4H 4JFXB 2V5DA 3HG1E 4X7SH 3MLTA 2XVGA 4JY4A 3LQAL 1I9IH 3V4VL 4Y2DC 4CJ1A 4K7PL 1SY6H 1W1PA 1EJOL 1FPTL 1LO0H 3VIOA 3PL6A 4MNGE 1U8LA 4G6MH 2DLTA 4LDEB 3DMMB 1S3KL 3SUTA 3C2AL 1FHDA 1CNVA 3LQZB 2YBTA 4PMUA 1J18A 1MW2A 1UZ8A 2FH6A 5ISZA 5BRZD 8A3HA 3ZZ1A 1YQVL 1NCBH 4FRWA 4P46D 1MQ8A 4XP5H 4BQ3A 1JV5A 1N59B 3M8OL 1US2A 4ZUTB 4U1GC 3TGXA 1B31A 4KQ3L 3V4UL 1OIMA 4HK0A 3BP6B 3VDHA 1OD8A 2A6DA 1FVEB 3P0YL 2DWEB 4DW2H 2CKRA 3QXDA 3NCCB 1I7TB 3WH9A 1EVUA 4KV5E 3D18A 3W28A 1BFSA 2DL9A 1KT2A 3BVNB 4ONGL 3NPSB 1WBYA 4G42B 3MLXH 3QEUB 1JGLH 4PMNA 4PMYA 2A6IA 5J3HD 5HYSA 5ACZA 4H1LH 3THCA 1C5DB 3ARFA 3EYSH 3QI9B 1I8LC 1KCLA 5C0ND 4B7IA 5GSRB 5I8EA 2ERJC 1R5IB 3BO8A 3BGMA 3E6HA 3NDYA 2NT1A 3FJTA 1V6UA 2PNDA 2Y5TB 5KSUA 1FZJB 1MREH 2Y07L 2VLJE 3K8KA 3GI9L 5EORH 2XZQH 4WV1A 4OF5A 4JRXE 4IIQA 4Y1AE 1QNSA 3L2LA 1FVDB 1UD8A 2J8UB 1JFQH 4CW1B 1FCGA 4MNQD 4F2MB 5TJWK 1GCFA 4IUGA 5KAQF 1GGBH 4UOW0 3AMCA 4Y8AA 3AFBA 1UR2A 2DRUA 4Y4KB 1I4FB 4JDZB 1TJIH 5DR5H 4DQOL 4UZUA 3EFFB 3OJDB 3QDJE 4NN5B 4YEFA 4M6AA 5J0BA 1MCDA 4PCTA 4TVUA 5CSUA 3EDEA 3KR3L 2F7OA 1N2RA 4WWKA 1OAZL 43CAA 4PJIE 4UI2A 4WUKL 1KQYA 3NUKA 2VVNA 3GXMA 3L2MA 1TETH 1PVHA 3B3IB 1CR9H 4WI3A 3S5LB 5F7FA 3VXPA 4E0RB 1QTYT 3FQWB 4P7NA 1MFBL 1NEUA 5EBLB 1H49A 3N9KA 2QSCL 5FIEA 4JZJA 4PJXA 1QI0A 1HXYB 2J79A 3IFLH 1XYZA 4JFQA 5E7FA 2UZYB 5CUSL 1XV8A 1FNFA 1OLLA 1AO7D 2DQFB 2UY6A 1GGCL 1CE6B 5I1CH 2YA0A 1N3NA 2J6EL 2BSED 2VL4A 1TLKA 1OWRM 4P99A 1M7IA 4UNTA 5D5MF 4ZOBA 3FFCA 4BQ5A 2X1OA 3K4AA 4FFWD 4Z8FH 1CDIA 4W5ZA 4ZFGH 1AHWC 3K7UA 3N9GL 5FK9B 3NABL 1RK1A 4GKSB 5E2UL 3HI1B 1KC5H 2Q6WB 5D1XB 3U0PB 4U3XA 4XCYA 3WFEH 2ZUSA 4HKBA 5ESQA 1ZHNB 4QNPE 3WYRA 2WVVA 2ZOXA 4S10A 2OTUB 2FL5B 4NZTL 2OYMA 1X3DA 5JHDA 4MA1B 1BFNA 1UM6L 2CITA 1C91A 2VVSA 4PR5A 1Q6DA 4JRXB 4MNHA 4Y1AB 4OCSH 4YPGB 2CBIA 1YEJL 5I1HL 1GHFL 1FJ1A 5JNYB 4Z77B 3LN4B 1MPAH 4IRJA 2VLKD 2VDRL 3U4BH 5I0ZA 5EOTB 3DVGB 4ZODA 2BP3A 1KCKA 3FZUC 1RFDH 4ETQA 5AD0A 5F3BA 4QTHB 3W29A 2YPLE 5IEKB 2EH8H 5TDOB 3WNOA 1PBGA 3RNKA 3MUGA 1S7SA 2ATKA 2BSRA 2VL5B 4PJIB 4S2SA 2G5BB 3OL2A 5DJDB 1GOMA 3X3FL 1KB9K 4I0PC 3EO9L 1P9MA 2MOVA 2EYTA 2YUXA 2G8ZA 1MIML 2KBGA 3QFJB 5CGMA 5B38G 1UG9A 5TF1L 1TZGH 4LCCB 5ELIA 1KPRB 3SDCA 1ULVA 1YN7B 2MKWA 3W11D 3AC0A 2CJUH 5KSAA 1K9DA 3F58H 5ICZB 3VFGH 4O2CB 2OS7A 2ZPKL 4KVNH 5F96L 2VTFA 1OWQA 2AV7B 4OIBA 4YZFF 3GNRA 4DOHE 5LG1A 4PUBL 2AJYH 4ERSL 2WQ8A 2I5YL 1JXJA 3WN6A 1H5VA 2DH2A 4MJ2A 5JPMA 1T7VA 2G60L 1YEEH 1VFMA 3PWNB 2XGIA 2PCPA 4LNVA 3NN8B 1MCQA 1OHQA 1GZQA 3M45A 4UIKH 5A8MA 4U1IA 2EDWA 5HYJA 4U1KB 3SY0B 5C71A 1D5MB 3QNZA 2FJFA 3FO2B 4ODUB 4XWGL 5IFAL 2GYSA 4Y0GA 4KK5D 1GOOA 1E9LA 5INCA 5CMAB 4FNLL 1CDUA 3D52A 1E28A 4NZDA 3EJZD 1E6OH 3WDHA 3O9WB 4LLQB 2BNQB 3UC0L 3DX9A 4KHTH 1QBML 3ILQD 1IQDB 1MHEA 4CMHB 2YLAA 1QUNA 3QDGE 4N42A 4W5UA 4P5TB 5HGDB 1HCFX 1NCNA 1G7IA 3SQBA 2HMIC 1IAIH 2DQUL 1AGEB 1NAKL 3PDGA 1BLNB 3VXME 3V0AC 3DYMA 4LQ1A 2R2EA 4Y19B 5IVXA 4V1DA 4M7LH 4KH2A 1FNSL 1XF4A 1T5XB 4M62H 4PRPE 5IROC 2QSVA 4NKQB 3I85A 4LNRA 4KHXH 4UQCA 1V3LA 1FZKB 3DV6B 3KVQA 4RDQF 1FO0B 4X4MA 1DSFH 5E6IC 4QHLA 2FDBP 1E0VA 3EOAA 3CVHH 3VFSA 5H2BA 1GRWA 3PNWB 4JB9L 4FF5A 5CPQA 3UBXG 2I26N 4FQXB 3MA9L 3MV8E 1QNRA 3OXSB 3HAEH 35C8L 1NUGA 4YXHL 5JORA 4Q9QL 2AQ1A 4HUWB 4MJ6A 5D2LE 3HG4A 4NQEA 4ACYA 4NXKA 4U7SA 3ZHKA 4PY7B 2Z31B 3D6GA 1NANI 4MHHG 1OCQA 5T1LA 3TOPA 4AD4A 5I66B 5ILTL 4YHPA 3PGDB 2ATPA 4PP2B 5D96C 4TYUA 5DO8A 1WBXA 4DOHB 3VVGA 3C5SB 3DHMA 1BGXH 3RTQC 2BMKA 4JM2F 1QBLH 1RZ7H 1VGEH 4GXVH 4YNYA 1ZLUH 5ESVB 4AC1X 4ALAH 1OAYL 1F6AB 2HTLD 3C5JB 4BQCA 4OM1H 3DX0A 2Q7NA 4OFKA 3CLFH 4NO0D 3G5ZA 3GMOA 5J13B 4LEOA 1Q72H 1SBSL 3GXTA 4AMKL 4LASH 1NBVH 3LIZL 4CDHA 5I30H 4R4ND 1HQ4A 5KZCB 5GGTH 4HZ6A 5ALBH 3S35H 3QRGH 4PRHE 5JOFA 4M9OA 4NJ9H 4TTUA 3KJ4B 3GYCA 5E9DB 3KYNA 5EU5A 4HT1H 3GSWB 3RZCC 1U91A 2G5RA 5GS0H 2WSKA 5DZLA 1ZANL 3PWPD 5IFHH 5I19H 5HBFA 2IAMB 4WHDA 4ZSOB 1FE8L 1R5VA 2X1PA 5I75B 2C1OB 4Z7QE 2QQLH 3T0EC 3PV6A 4GRWH 5HDLA 4UTBH 4PRPB 3RY5A 2EKSA 1S7VB 2BVQA 3EJRA 3KS0H 2VZOA 3VXRD 4F58H 3CV5A 5IHUL 3LKRB 1M53A 1MFVA 3MMDA 2BNRA 4JQXC 1HSBB 3D5HA 5TE7H 3T2OA 2VXQH 1S7TB 3MV8B 4Y2DD 2OL3L 3D1MC 3GSNH 4LKCB 3BAKA 4NUJB 1VPOH 5JW4N 3F7PC 2FGLA 3UTOA 2VH5L 3ARXA 4UR9A 5DJAA 3CX2A 4OIAA 1E6NA 3NCJH 2QMKA 1V3HA 5LWYL 1A7PH 1OGAB 2EJ1A 1CGTA 3BZFA 3G04B 4XXCC 3PG2A 3MLRH 1YY8B 1T2QH 3V5HB 1M6OA 2ZWZA 2VITA 3VXUA 5HVFB 3BP5A 4WW1A 3U1SH 3BPCB 2BY3A 3AIWA 5A94A 1YYML 4GH7B 5C0CD 4X8XA 2NY0B 3C5ZA 4P2QD 3FFDB 2G41A 5C7XL 4PLOB 4LRNH 4YK4C 4ZQKA 3WUGA 2ZE0A 4L8SB 2X4QB 2AI0H 4UQAA 4RFOH 5FCUH 5C09A 3U0TA 2ZOLB 1F4YL 3DTXA 1KACB 1Q9KA 2CH8A 1IKNA 2QADB 4XRCA 5CBEA 5E2WL 1IZJA 2CLVB 1G6RH 4BFIB 3BEWB 3BDBA 3U7WH 1R5WB 2IPKB 2HTKC 4PRHB 3DSNA 3UTZA 4EXKA 3UTPD 4JRYA 2YS4A 1FOBA 3ME0A 3TBTA 1OSPH 4LCYB 4P2CG 2Y8KA 15C8H 4PJBF 1NGYB 1T1WA 1C1EH 5CEZD 1TA3B 3GH5A 2B4CC 4GO8A 2C4FU 1XIWA 4WDIA 2JELL 3EBVA 3LCYA 3S9DB 1HYRC 2FSEA 3QCTL 2DQCH 5D70L 5FHBH 3MO1A 1BZ7A 1E43A 4AZ5A 3NIGE 3NYDA 3VRIB 1ZHKB 5JW5A 2Y24A 3CZSA 1RZFL 4DZ8B 5KVFH 3MLVH 2WINA 1U93B 3GB7A 1AQDB 4P8WA 1D6EB 2DTSA 3P4NB 4GI6A 2VXVH 3D50A 3L3HA 1VERA 1CT8B 4ACZB 5EIIB 4RGOH 4R3SB 4FQHB 1BECA 4IOIA 4G80A 2VX7A 4ZO6A 2IEPA 2DT0A 1TFVA 5KZ6A 4HC1L 1AD9B 3U9PH 3D0VB 1A6TA 3BCDA 1QVOB 3EDJA 4FQ1H 4MADA 4Q2ZB 3RL2B 1A3QA 1H1NA 3KEHA 5TE4L 1BAFH 3GBMH 2V2TA 5LBSL 1BD2A 2H26A 4M48H 2EDJA 5CGTA 5IF0A 3MRJA 4FTVD 3FHQA 1GQKA 1MWAB 3MGOB 1UD5A 3SE8L 2O5YL 2OWCA 3CUPB 4L4JA 4P48A 1E1EA 4CADB 5EBGA 3P73A 3GGWB 3ZKNC 5DO2C 3IDIB 2E9LA 1HF6A 2PI6A 4X4YA 5HXMA 1TFHA 1FIEA 1KXHA 4ZAKA 4LYRA 2B8OT 1GHSA 1IGTB 3QO1B 4C7GA 3DETD 1EGZA 1U3HA 4YHLH 4ZNEA 4XCNB 4NP4L 5DUPH 3OX8B 5FYJH 4XBEH 3ZMRA 1WFUA 4Z78B 3QCUL 3TPKA 4OCRH 3AS2A 3MCG1 4HEPG 1OBAA 4U1LB 4KJWD 4FN0A 4X8JA 3O2DA 1ISYA 1XGRA 3BKYH 3ULUF 2XV6B 2WZEA 1K5NB 3QG7H 2X6MA 3DRQA 3EO0A 1UB6A 4PLNC 2WMHA 3ARDB 2Z8SA 1ZOXA 5ERWB 2PYEA 3BLKA 4JN2A 2DI7A 1S9VA 1QW8A 1IEHA 1WCGA 4MJIE 5KN5A 3WY2A 1SMAA 4U6VL 1F8TH 4DWSA 1WC7A 3PABB 5DMIH 3KPPA 2BNUA 4M43L 4XP1H 3IU3A 5E2TL 4G43A 3VINA 1IAOB 4PJFE 4E42A 5J11B 4AIXA 5AAWA 4PUEA 3DRTB 5EU4A 3MXWL 5HSFA 5IM7A 3PP3H 3ALPA 3DXAE 1L7TH 2I27N 4NN7C 1LO2L 2XQYG 4B0MM 3IJYB 3T77A 4JFZH 4X9FA 5F44A 1B3XA 4R4FH 1NSNH 3EFDH 3FZUD 3BP7A 3RUGB 3WSQL 5KSBA 4KKAC 5IQ7H 3QWOA 2CDFA 3VGFA 3HZKB 2NZIA 3PQYD 4UINL 3VG9B 2CGRL 3W9EB 1EFQA 4MAUH 4KGLA 1PGRB 2IMMA 2X4TA 3QH3B 4G9DB 3I2CL 3DGGB 5BRZE 1MW0A 4JPKL 3I3EA 1DQQA 4I0PD 1HJQA 5J6GB 1QLRA 2HLAA 2ADIA 2J75A 1CICB 5SWZB 1EIBA 2DQIH 5SX5H 2Z4QA 2AKRB 2IQ9L 1WVZA 1V7ML 3IGAA 4MLSA 1ORSA 3GXFA 2IAND 4YGVB 3MCKB 4LVHB 2DDQH 3X11A 4ZXBA 4BKLB 4Y16B 3VXSB 4X80L 4DVRH 4BA0A 4G8GB 4OLUH 3IJSB 3TESA 3QFDB 4BUHA 4MMZC 3SKNB 3AHZA 3RWFB 2VOTA 2X7LA 4DGVH 2ORBH 1CENA 1MAML 3R06B 4XPHH 3AZSA 2XYLA 5IBTH 2UV3A 2VXSL 3VFOA 2I9TB 3E2HB 3BX7C 3WNPA 2F5BL 2FB4H 4M7KH 3EYOB 4U49A 5HHQB 4YDKH 1BVLB 3VFMB 4JFTA 1QA9A 4OBSA 2V7HB 1ZLVH 1HWWA 3ZDYF 4HIXH 2E6QA 2EE9A 3ARBC 4BSVA 4XP6H 1T7YA 2VE6B 1GOFA 5ITFA 4JM2C 5A2KH 2XSBA 4JKPH 4DTGH 1OM3H 1BF2A 5GS1C 2CNCA 2XSAA 5LA1A 3ARED 4XCFH 3EYQD 5JDSB 4P4KA 4XB8A 1FORL 2BOBB 3RPKA 2HMID 1XH1A 2H2SC 3FN0L 2B2XH 4F9PA 4NNXA 3DXAB 1NFIA 1WZ1H 3OKKA 4FABH 4OM0L 2ZX9A 1Q0YH 3LV3A 4MNQE 2JF7A 2PXYC 3K4DA 2RGLA 4G7VH 1AD0A 1WAWA 4ZUSA 1YNKL 4PJ7E 1C7SA 3G9VA 4PJDE 4GKZB 2CLZB 1KYOJ 2ITCA 1E4XI 4JPIA 1F5WA 4K68A 3PJSA 1W9BM 4DKAA 3WN5A 4ELMA 4XCCH 5F3HB 5KOVC 3KLDA 1MVYA 1Q1JL 2WIIA 3W81A 1RUML 5BRZB 2LQRA 4OZFB 5GGRA 1BFVH 2IALB 1E70M 1ZA6A 4P46B 2GTWA 1DBAL 4X7FC 4K8RC 3CFKA 3QP3A 4LEXH 1RH9A 2R2HA 1MCSA 3TP4A 3VXNA 3NDZA 4NRYA 2CKBH 2UY3A 5C0BD 2P5WD 3D3AA 3M6DA 5FDWB 5L2JB 1JD7A 4G6AC 5BW7C 2IXUA 5DHVA 3MJ9H 4YHZL 1BGAA 1AO7E 4YHOH 3S6TA 5TH2B 4U3HA 3D3VD 2DLEA 5FO9B 3EDDA 4U1SA 1INEH 3BCFA 4QY8B 2VCCA 1SJHB 4HBQA 3RTQD 2FWOB 3G9AB 4LL9A 2HISA 5L9DL 1D5ZB 4X6FA 5DK2B 3BKMH 1A6UL 5CD3B 2EO7A 4YHMH 1IAMA 2FH8A 3SE3A 3O4OC 4HUKB 4PRDA 1PYWA 2PWHA 2C7UA 4OF7A 1MCEA 3OR6A 3K8LA 3O41B 3KXFA 4GXUN 4QHNA 4CVXA 1JHTA 5CEZL 2LE9A 4U1NB 4KZEL 3D85B 5MEPB 1CDGA 4PJXF 3RWEA 4XPGH 1E4KC 3HPLA 2X4NA 3NSNA 1QNZL 2DJUA 3WL0A 1JNDA 3WBAA 2M1KA 3BAYA 5FCZA 4HCRL 2VQ1A 4PEEA 5JXAH 1XR8B 3CUIA 3VIFA 3SHSA 4FQJL 2X4UB 3K2UH 3RZCD 1TVHB 1W2VA 4FS0A 4DZBA 3CDCA 3GHEL 1UWRA 4MNQB 2F8OA 1E15A 1D6VH 2HVKB 2VLKE 3HRZB 5IQ9B 3OF6A 5EWIH 3M1BA 4PJDB 3P4OB 3V9FA 3T0ED 4UMGA 1W1TA 2FRGP 2OP4L 3GKWL 1TCRB 2AEQL 3MLWL 4DGYL 3MLSL 1U2HA 4Z7UA 1LP9B 1TQCB 3WDRA 2V3DA 1R0AH 4C54A 4TSCL 4YEEA 2FBJL 4RFNC 3DMMA 1AQKH 3LQZA 3RGVB 3BXWA 3V79C 4UUJA 1L7IH 4C58B 2A3BA 3FT3A 1JF6A 2EIEA 3KHOA 1HXJA 2NY5H 4HMCA 4ZUTA 5GZNC 4YXKL 4AISA 5IW1B 2W91A 1P4BL 3BP6A 2AGJL 5FUZL 1PX8A 1AFVL 1CFVH 5HPMB 1G9NH 4FMVA 1FVEA 1I7TA 2EBNA 2E9BA 5A6BA 2XPGB 3LHPL 5C07D 1MFAL 4MA3B 1XF5B 1IGJA 4Z95L 4NHCL 1I8MB 4A4AA 5F1OB 2R69H 2KUTA 2HKFH 2YRPA 2E4TA 3BYYA 1D7FA 4H8WH 1P4LA 5IBUG 2XTJC 1K4CB 5CGYC 1QSZA 2M26A 1C5DA 1I9JH 4HKZB 3MGTA 4XT1C 2N7BA 2ID5A 3QI9A 5D1QB 5L6YH 1J9YA 3SDDB 3F7VB 5GSRA 2D31A 3ARYA 2HTKD 5D71L 3C8HA 1IGFL 3CMOL 3RCNA 3VCLA 4LHQB 1X5YA 2WXDM 1UA7A 4I0CC 3VTRA 3B6SB 2HYMA 1UD3A 4I3SH 3QXUA 1FVDA 4D72A 3OZ9L 2ZCLL 2VLKB 3TIEB 2P8MA 2J8UA 5T3ZH 3RVVC 5EFIB 4CW1A 1JDDA 4F2MA 1N6QH 4NUGH 3PZQA 1JCKA 4XAKD 3ULUC 4IOFC 1NDGA 3V0WL 1I4FA 4JDZA 4F37F 3C6SA 5MI0C 1SMOA 3EFFA 3OJDA 5HVWA 5DRXB 2EKJA 4AL8H 1KIRB 3QDAA 2LVEA 2AJZB 2FHBA 4MD0B 3EYUH 1GPOH 5E0CA 2QHRH 2J1KA 4UQ2B 2EDYA 5I73B 2IH3A 3ECBB 3UJJL 1NJ9B 3NZ8A 4NRXB 5GS2H 2XIBA 1WTLA 1DBKL 1CFNA 1EO7A 3B3IA 2OLHA 4QYOB 4XNQB 3FQWA 3FRUA 1R47A 1UA3A 2DPEA 1C8YA 1D5BB 2QR0A 4DEPC 5TE6H 3T3MF 2LTQB 1BQLH 4TPRH 4IEFB 2AK1H 2A3EA 3QUYA 5A6AA 1OSZB 4JAMB 2NXZB 2DI9A 1IZKA 1C5BH 1J05B 1NL0H 3HE6C 4FA8A 1MFCL 3REWB 1X1NA 3BT2H 1S8DA 1AKJA 4FQCH 4JO4H 1HXYA 1E4IA 3HI5L 3V7AE 5IT2L 5IVXF 1G7MB 2YZ8A 5IXEA 5FAAA 2DQFA 4LSRL 1CE6A 4TTDC 1U58A 3LQAH 4Y4HA 5DO2D 3ZKND 4U0QB 3V4VH 5FOBB 1MHCB 2EIBA 4XGZB 4K7PH 1EJOH 1FPTH 4EUPH 1UKPA 4HAGA 4TUFA 3TYGL 1RZKC 3RGHA 5FUCC 4GKSA 4DKFL 1S3KH 3HI1A 3C2AH 1F58L 1LD9B 5JIWA 2Q6WA 4FZ8L 3U0PA 4JFEA 1CEOA 3CX5K 3RL1B 1ZHNA 3RBSA 1YQVH 2OTUA 4TUJA 4KPHL 2ENSA 3M8OH 3ZKMC 4AD2A 4CVUA 3G6AA 1BBJB 7CGTA 4KQ3H 3CSYB 3V4UH 4WFED 1RJLB 3G6JE 4CU8A 4JRXA 4X7TB 4G6KL 4XZUB 3VMPA 3PWPE 3P0YH 5AZ2L 3MKKA 4U6HB 4YPGA 5CZVL 4MCYB 1WZKA 5JNYA 4Z77A 4B9ZA 5DRZA 1YC7A 4N0UE 4YIQB 1KJ3L 4RFEB 3SPVB 3ES6B 4ONGH 1E6ZA 4A2MA 3DVGA 3KPOA 5DF0A 1J1XL 5I74C 3VH8G 3JSSA 4QTHA 3NBNA 1UGNA 4OF3A 2C9AA 1V0KA 4GW5B 2EC8A 3VXRE 3KYOB 4PJIA 4G8IA 2G5BA 3IDJB 5JQ6L 5DJDA 1Z2KA 3AMLA 3LKSA 3MR9A 4XX1E 5CILL 2DQEL 1ES0B 2C5DC 2Q3AA 2DKUA 4KKAD 4U2YA 1KTCA 3QFJA 4N1HB 4AH2B 2Y07H 3BZ4B 1LWRA 3HUJB 1A4KB 4PG9B 1EA9C 1QFUL 3GI9H 4LCCA 4FK9A 3W0WB 1YN7A 5MEOB 1KULA 2AJVL 3ARFC 4O2CA 3BDXA 2DD8L 1AY1L 2Q76A 2AV7A 3CJJA 4N90D 3HZVB 3SKOB 3UYOD 5INDB 1A1OB 4MQTB 5C0CE 4DQOH 4D0BB 1LMKA 4P2QE 2FEEI 2WUCL 3T0WA 1WWWX 3KR3H 1LO4L 5IHRA 4YBHA 3QQ3B 2OJEB 3PWNA 1OAZH 2K7PA 3RRQA 4WUKH 2YMXL 4WV1C 3DHJA 4IIQC 2YL9A 3LMYA 4U1KA 3RJQB 3SY0A 4OZIE 2EACA 1D5MA 4ODUA 4DN3L 4U1JB 1U9KA 4JFFA 4I3RL 4GLRH 3Q0HA 5L8KB 5AYBA 3SJVD 1A1NA 1MFBH 5CMAA 4X6EB 3OLEA 5E94A 3UTPE 4LLQA 2BNQA 5F7UA 3W37A 2QSCH 1IQDA 2PO6C 5DJYB 5L0QB 3NAAL 4S11A 5CEZE 3WENA 1WICA 5HGDA 3JTSA 1AI1L 3ARBD 4WWKC 5B21A 1QSFD 1AGEA 3U7YL 2BVDA 4JM2D 1FNGB 1BLNA 1GGCH 2D0FA 5E2JA 5GSVB 3O6FB 1PZ5B 1A9BB 4ZS6C 2J6EH 3VFVA 2AXFB 4LP5A 4XNYL 3L3IB 4M7JL 1AGFA 3QIUB 4Y19A 1WZLA 2FYVA 5KAQG 2YKLH 4JFDB 3RBGA 2H2SD 1NCCL 2XKNA 2AJ3B 2SEBB 4CCEA 3N9GH 4OB5L 2D9CA 3VXRB 3NABH 4JZJC 5E2UH 3B9AA 4PD4J 1FZKA 2NLJB 2PXYD 5FGCE 1HHKB 1MCFA 1BJ1H 2BK8A 4LSTL 1KR1A 2IH1B 1I7ZA 4NZTH 2ICWA 4MDIB 2VISB 4FQXA 2ZXAA 1B0GB 1UM6H 2NTSP 2OR8A 1IT9L 1X5IA 5IB1B 1QD0A 1Y18B 4NOBA 1EBAA 1ZS8A 3U7BA 3GMPB 3ZDZF 1C5CL 3SDXF 4FTVE 3UG4A 1YEJH 4LSSL 1GHFH 4HFWB 4PY7A 5I1HH 2KKQA 2Z31A 4K8RD 5J9PB 4FXKB 2GSJA 1EERB 1RZJL 4XNMB 2VDRH 5I66A 4F7EB 3LSOB 3PGDA 4WVRA 3KPSB 3WQ8A 1CVRA 4M6ML 1W1YA 3S36H 3V5DA 5ESVA 4G6AD 2QLYA 1MRCL 4PJHB 1F6AA 3C5JA 3VFNB 4S0SD 1CU4L 2WQRA 4DKDC 2D4DA 1HJXA 3BUIA 3X3FH 3TH3T 3BIBX 4LCWA 3V8OA 3EO9H 4FQLL 2F8XC 1QNPA 5A40E 2WP3T 4H8UA 4IRJC 1MIMH 1BGGA 3IFPB 3VIJA 4I3GA 4JKLA 4M7LT 3IXAB 1HVXA 4LAQL 4KI1A 2HH0H 1GJIA 2C7FA 5E9DA 4LMQI 1U95A 3V6FA 5LQBL 1JWMB 1B3JA 4DK6A 3C8KB 4NKIH 1Q4NX 4U5IA 4UU9B 2B4CL 4JCMA 3CZFA 4OJFL 2ERJB 3LKOA 5DVLA 2QPUA 5KANG 1SHMA 2ZPKH 2GSIB 3F4VA 4H20H 4ZSOA 4ACPA 3DUUB 2XN9B 1UQSA 4PUBH 3MMWA 5E8EB 4ERSH 2I5YH 4RAUB 3MCLL 2FO4B 5E5RB 2G60H 1GOKA 1W3LA 5J6HB 1S78D 3SDCC 2QV4A 5FGCB 3O8XB 1D5XB 1RY7B 4MA8L 4XBGB 4XWGH 3LKRA 4CBPA 5IFAH 2UY4A 3DUSB 5KG9B 5KSAC 3DVNA 3QNXB 4HFUL 4ZOAA 4AZGA 1W72B 3CCHB 4FNLH 4HX1B 3VRJB 4LGRB 1ODUA 4OLYL 1S7TA 2ZUVA 4XMLL 3UC0H 2R4RL 1EFXB 4NUJA 5JOEA 1QBMH 3HNVL 4JIEA 3PQYE 4G3YL 5C2BL 3AIUA 3KLSA 1HEZB 1DBML 1OGAA 1PDKA 3L5XL 4N1EA 2DQUH 2RB8A 3G04A 2JJSA 4UOQA 1NAKH 1YY8A 4WI8A 2OSXA 5A6LA 2VQUA 4QP0A 1JNLL 2HA1A 3MZGB 2MQ0A 5DD3L 1HHIA 2XFXB 1G7QB 4GS7C 2QLVB 3MC0A 5GZND 4UDUA 1U8NB 2IANE 1MCHA 3WL9A 3T09A 5DEFB 2H45A 3FFDA 3TNMB 3EMCA 1JGUL 5BOZG 3CNKA 3MZTA 1TIUA 1Y6KR 5KSBF 2X4QA 5K9KA 2ZOLA 3FB6A 1NBZB 2X9WA 2CLVA 3K1KC 2N7AA 4JB9H 3MA9H 1LQ0A 1R5WA 2IPKA 3FKUS 3G08B 3M07A 5JMOC 1UFUA 3DWTA 5ALCL 2XTJD 5CGYD 4F8XA 4V28A 3OKDB 4AIZB 2IG2L 4WF7A 4DGIL 1NGYA 1UA6L 3HS0B 1BF8A 1S7QB 2V17L 3V4PL 1YECL 3PDDA 5J57B 2DT2A 1QKZH 3QEHA 5EBWB 2B5IB 5ILTH 3WJJA 3IS1X 2C3XA 5C0DA 1IGYB 3VRIA 4UZSA 2GI7A 2BFVL 3LZFL 1BYAA 2MPAH 1EOMA 4KU1A 4JG0L 1U93A 1AQDA 2DSVA 3FQXB 1D6EA 3B5TA 5D7JA 3P4NA 1OAYH 4NYLB 4U31A 2FR4B 1GPFA 4BH7B 4EKXA 1CT8A 4ACZA 4YC2B 4PG2A 5EIIA 2WVUA 1UKQA 5F7HA 1O7AA 4J3UA 3RVVD 3TO4A 2ZIDA 4R3SA 2WHJA 1M05B 2OYKA 4AMKH 1IM3A 3ULUD 4IOFD 4QT5B 3LIZH 4QRSA 2J8HA 1HWHB 4L9LB 3S3PA 4MGXA 3IS0X 3GXIA 3NGBB 3PQYB 3UPCA 3RDKA 1QRNA 3RL2A 3PTMA 1H0DB 3KDMB 4L3CB 4I0PB 4W85A 1ZANH 5TQ0L 2VDPL 3RVTC 1JPSL 1MWAA 1KR0A 3A3HA 1V3IA 1N4XL 1IEBB 3CUPA 3WXVL 4CADA 3MUHL 1FE8H 1NWTA 3FO1B 5C0BE 1MVUB 2P5WE 1GOIA 1V5JA 2HG5B 1ND0B 2IANB 5GRUH 3HE6D 1QHOA 4WUUA 1V6XA 2YRZA 3CFDB 4X5LA 3RIAF 1KFWA 3QO1A 4F79A 1CXFA 2H3NB 3D3VE 5IHUH 3TTSA 2Z8RA 4PJEB 5DRNB 4TTDD 1QFWL 4XCNA 4HK3N 3OX8A 4UDTB 4XVJL 2OL3H 4WHYG 4Z78A 4N8VA 5GISL 3QG6B 2VH5H 4HHAA 4U1LA 4OCNC 5BZWB 2EDEA 4U0RC 1ORQB 5LWYH 1EEZB 4UQEA 2X9YA 4HWBA 5EN2B 1XSIA 4LVNB 2G75B 1VRXA 2FGWL 3ARDA 2AABL 1KEGL 3WFCL 5C86A 4JAWA 3L4UA 2DLFL 3SCMB 3BE1H 1QPPA 3IKKA 5EZLB 3L5HA 3ZKMD 4WIWA 5DD1L 1W1VA 4LLDB 2V2XB 4LKXA 5MERB 3AREB 3OJ2C 3PABA 1SVZA 2Q3ZA 4RWHA 4I18B 5GNXA 1YYMH 3MJGX 4K3JL 3WS3B 1OD0A 3AIRA 3RWIB 1ZB5A 3MROB 5GRVK 5C7XH 3PL6D 2NY2C 3VI3F 1FAIL 4OF6A 3DRTA 3OLIA 4NSKA 4HXBL 5F7YC 1F4YH 4ZUUB 1G84A 1ZLWK 1H2JA 3CU7A 5E2WH 5ISZD 2J7HA 3T0EE 5HHNB 3BIKB 1WITA 3RUGA 2E9MA 1PLGH 3MRFB 4MVBC 2X4OB 1P7KA 3W4RA 3IYLW 3DYPA 4ZUVA 1W3JA 1FHGA 1YEFL 1AE6H 3C5ZC 5CWSA 2WUBL 3W9EA 5E1AA 3N13A 4LVOC 5EO1A 2NTFB 3QH3A 3NOIA 3DGGA 4UTFA 1FNHA 3WFBL 5D70H 5J6GA 3RM8A 1IKNC 2Y25A 1CICA 5SWZA 1GQLA 4KDTA 3X14A 4LF3B 2CCRA 5SV3A 4KJYA 4XNZC 5FYLD 5LGKA 1UZ1A 2IGFL 4ZE5A 3BKJH 2PBGA 1NEZB 1MW1A 1DQTA 4PJGA 2A6JA 4CKQA 4YN5A 4EZMA 3MOBL 4BKLA 3SO5A 3VXSA 3ARFD 3I84A 5DC0A 4G8GA 5C07E 3IJSA 4JO3L 3H8NA 1XIWC 3QFDA 3MLZL 4Z7UF 2VRJA 3WUZA 5A3IC 3RWFA 1GC1L 4ODSL 4P9HC 4D71A 4NRSA 2VC2L 4HC1H 4H1LA 3PHOB 4OLEA 4I9WD 4JLRA 1P7QB 4K55A 4RIRB 1A22B 4AYGA 5EA0L 2WMKA 4PLKC 2I9TA 2DJSA 1JBJA 1KV3A 3EYOA 5TE4H 5HHQA 1F2QA 1NAMH 1BVLA 2JIXB 3BP4B 4WTZA 3VFMA 3OKOB 2YK1L 2RCSH 5LBSH 2V7HA 2GIYA 4K94L 4EKJA 5C3LD 1BMGA 3TA3A 4KXZH 2HVMA 3D2UB 2Q86A 1NOUA 2O5YH 3TN0B 2BJML 1KB5L 3O6AA 1ZT7B 3PDOB 1H8SA 4P2OB 5CIPB 5I1KL 5GZOD 1G9ML 4HP5A 1TQUA 5E8OA 2V9QA 5DYOB 2R1XA 4FNPA 4WWKD 3HJEA 5D4QA 4MB3A 3CSPA 5D5ME 2ZG2A 4CAGA 4B16A 1KLUB 5CPTA 2FZ3B 1QQDB 1F3RB 4NP4H 4ZS6D 4XAKE 3T0EB 3QCUH 1IEAB 2CLZA 3MV7B 4JE4B 4HU8A 1HHJA 3A4WA 2HVJB 1OIFA 1T1ZB 1ZA3B 2YUVA 4JY6B 4M24A 2WMFA 4LPCA 2DYPA 4ZAKC 4PY8J 2VN4A 1U3HC 4OZFA 2IALA 3KL0A 4U6VH 1P5UA 2CXKA 4LSQL 5DRWB 5IHBA 4M43H 1CIUA 5E2TH 1LDPL 3FFCD 5BVJB 3TTYA 2IBGA 1L0PA 1BEYL 3TWCL 4KI5F 2YD2A 2FE0A 2OWWA 5L2JA 4HIHB 3TFKC 3MXWH 5TD4A 2HLFD 5C9KA 4MXVE 1EO5A 1LO2H 5C07B 2ICWI 5EUKB 5TH2A 1X5AA 2ZWYA 1OB1B 5DMKA 2ESVB 2JF6A 1FC2D 4QY8A 2J88L 1LK3L 1MJJB 5E8PB 3WSQH 2BSTB 1VFBA 5IWLC 4H26A 4O51B 5JHDD 1A5FL 3BZEB 4Y5YC 4DWSC 4NX0A 1UB5B 1LO5A 4ZNCD 5CD3A 1SQ2N 1IM9A 5GGUA 4TUKL 3KYMA 2GUYA 1CDYA 4F57L 4UINH 5LGJA 2CGRH 4FNUA 5KVEL 1NUNB 3TEUA 7FABL 2IC2A 1WIPA 3I2CH 4JPKH 3ZYJA 1P2CB 3QUXA 3Q3GB 2F53B 4U1NA 3D85A 5MEPA 3WIFB 4IRJD 2XXMB 4JFYB 4TNVF 3VD3A 4UOW1 5DS8B 4K7FB 1CDJA 1FZMB 2IQ9H 1V7MH 4WFEE 1MCJA 1MH5B 3FTGB 4DO5A 3NFPB 4UB0L 1EO8L 3ELAT 3UR8A 4YZFE 2UYLA 4D3CL 2X4UA 1TVHA 2J25A 1NGWA 2VR9A 4XAWL 3QXAB 4X80H 1SEQL 3ALGA 4MDPA 3BAIA 4LLYB 1Q0XL 2HVKA 3M7SA 2VDLL 4HA3A 3Q6GL 3HRZA 1VACA 5IQ9A 4M3KB 1T80A 4PJDA 1LE5A 3P4OA 4OGXL 2VXSH 4J3TA 4U2ZA 2F5BH 3GSXB 1FFRA 1LP9A 3T4YB 3SDCD 5I5RA 1NOWA 4KMTH 5BQ7B 4RMTA 3CMJA 5KSAD 4AZHA 1RZIB 3W27A 3RGVA 1KIPB 3SKMB 4XBPA 4JREB 3SGEI 4OZGA 1GH7A 5DC4B 4QHMB 5BXSA 2G3IA 3QIBA 1A2YA 2LVCA 3EOBB 5J4MA 4D9LL 5IFPA 1FORH 2AQ2A 1CZ1A 3KS0J 2YWZA 3FN0H 5BZDB 4PSPA 1EV2E 5C8BB 5HYJD 1B1YA 1OP3H 1ZV5A 4PBGA 4XVSL 1CL7I 1JK8B 4N90E 1MQKL 2AJXL 1XF5A 4ONOA 4PTUB 2J4GA 3H9SA 4NPYB 3RP1A 4L8CB 5I1GL 4P4KC 5D9SB 1K4CA 1Q1JH 1RUMH 2WBJD 5B22A 4F9PC 1G7JB 3FRPA 3U5UA 1OT1A 1DR9A 5D1QA 3GNOA 3UTSA 3SJVE 1DBAH 3SDDA 1DANU 3F7VA 4TSAL 3AIVA 3T8XA 2GUOB 5B3NA 1KFAL 4V1DD 3RWJB 3BEVB 3UX9B 1GL4B 3B6SA 1FVCB 3NCYS 1QSFE 1J0HA 3GMMA 3WN5C 5TF0A 5JMRA 1TZIA 4YHZH 2W9DL 1VGKB 1OGBA 3F7QA 3FO0L 2VCBA 3TIEA 2Z1SA 4MMXC 5EFIA 2CHOA 3RWCB 3UPRB 1ZHBB 1CD9B 2QQNH 5L9DH 4JG1L 1FIGL 2FX9L 4Y5XA 3SDAA 1A6UH 4J7RA 4DKEL 1DQLL 3DHUA 4X6BB 5DRXA 3BW9B 1KIRA 5FM8A 4WI2A 5KOMC 2Y7QB 4NQED 1WF5A 1OGTB 3BWUC 3QJFB 4UQ2A 5CEZH 3B83A 2QV2A 3HAEA 1NJ9A 4K9EC 4NRXA 4KZEH 5FYKD 1Z3GL 1ZVSB 1H3GA 5T1LD 1GQJA 4MD4B 1QNZH 2B1AL 1HWGB 4C55A 3SGDI 4HCRH 3GMRA 4PBXA 4MNMA 1OSZA 4JAMA 5FUOH 1RJYB 3GMNA 4FQJH 5FYLL 1OM0A 1FH7A 4WSJA 3REWA 4OD3L 1VJSA 3GHEH 3H0TB 3SE3C 3CMGA 3RVTD 2GHWB 1GOWA 5D7SL 3WXWL 2ZZUT 4F7MB 3STLB 3CIVA 5I1DA 3W0KA 4E8CA 2DWDB 5FOBA 2P4AB 1I1FA 1ZT1A 3VGHA 1ZHLA 1DWAM 4W7UA 2OP4H 3GKWH 3L3DB 3EYFB 2VX5A 1KXTB 3QWRA 4XGZA 4DGYH 3MLSH 2YBUA 3CFBA 3KPMB 5D93B 1WQVT 1D5IL 1NCAL 4TSCH 2FBJH 3GBLA 1US3A 2Z8VC 1TMCB 1W32A 2NXYC 1LD9A 2DB8A 1QFWM 5D6CA 1A02N 3RL1A 3SJVB 3TVMC 4F15C 2TAAA 1S7RB 3N18A 3L3JA 1RD6A 1HKMA 3KWXA 3ZYOA 1HILA 4XXDB 1ZJAA 2VDML 1BBJA 4YXKH 3CSYA 1RJLA 1P4BH 3ARBB 1QSFB 2Z93A 3MOQA 2AGJH 5FUZH 1ZBCA 1AFVH 4XZUA 4OLVL 2P49B 4S1RL 1UWXK 4U6HA 4OFYA 3PZNA 2BNRD 3LHPH 3DMMC 4MCYA 4XH2A 3HFML 5H37G 3SPVA 4YIQA 4RFEA 1YNTB 4Z95H 4KTEL 2BXYA 2ZSWB 3ES6A 2D7TL 4NHCH 4QGYA 5TQ2L 2WKLA 1QG3A 1E4LA 3PHQA 4J3SA 2C1PA 2NY2D 2J7BA 2VUYA 4CRPA 2YD1A 2PXYB 4HTYA 3KYOA 1YEKL 2VC9A 5GRJL 3ARRA 1RHFA 2A38A 1X5JA 3VXUD 4D0DB 1PD6A 1TVBB 4PJBE 4TVPL 4HUUB 3RU8L 1L0QA 1R85A 4MVBD 1IGFH 1ES0A 3CMOH 2CDEB 4QLRA 1OGSA 1E5NA 4EVNA 3NPSC 2R1YB 3BZ4A 3HUJA 1A4KA 3JV4B 2D24A 3C5ZD 3BJLA 3W0WA 3PF2A 1EH9A 1W0WB 3OWEA 3P4LA 4ODVL 1TCMA 5MEOA 5CJBA 5JW3L 3OZ9H 4MQSB 3EW3B 2ZCLH 5T5FL 5C09D 1UQYA 3CFJA 3GDBA 5A2IH 4CCCA 1JGEA 3QI9C 1EDQA 5GRZA 2EDOA 4EIGB 3T65B 3BD5A 1CVSC 3FY1A 4PGCB 2JALA 3V0WH 3HZVA 3SKOA 4F8QA 5INDA 1IGML 3PWUB 5ESAB 3VI4F 4JRYD 2DDXA 1C08B 5JO5B 1R87A 4ONFL 4OT1L 1G6RA 3QQ3A 2OJEA 4HKJB 4PV9B 3LD8B 2GW5A 1IT0A 3UJJH 1XIWD 1ADQL 3BLPX 5A3ID 1DBKH 3IFOB 5GNZA 3BSZL 2PF6A 3ZT6A 1E73M 4KI5C 3KE0A 1CG9B 4PLKD 4PBVC 5E08L 2DT3A 4Y4KC 5EIQA 5E9AA 4X4ZA 4HPYL 4NN5C 1CIDA 1MFCH 2O93L 5CEXB 1PZ2A 2B7DT 1F42A 3HI5H 1D3CA 2AJUL 3GSRB 4BZ2L 1WP6A 3I50L 1UKSA 2OK0L 4UT7L 5HDQL 3H42L 5HYIA 1MEXL 4LSRH 5GSVA 3O6FA 3G6DH 3RIFF 1V0NA 1A7OL 4WY7L 2AXFA 1WJ3A 2UZXB 3L3IA 3QIUA 1RVFL 5F7EL 4UT6L 4JFDA 1KNOB 2H1PL 4YHKL 3SKJH 3DGCR 3P9WB 3TYGH 4H04A 1U8MA 1BSIA 4S3JA 4DKFH 1F58H 1BD2D 3ARGB 2MANA 4FZ8H 2NLJA 4KQ4L 3VUPA 1U0QA 3ULUE 2WMJA 1FCCA 2IH1A 3BPNB 1A6WH 1D9KA 4M3JA 2EYRB 4KPHH 2OJZL 3MYZA 1E6XM 3DX8B 4L4VA 4Y4HC 2GDVA 4ZEPA 1B0GA 1MVFA 2IADB 1A6AB 3MFFB 1CBVL 5T3XD 3GMPA 4G6KH 4D9RD 4ZAKD 4OUOA 4BSWB 5AZ2H 1KJ2L 1ETZA 1U3HD 2W0FA 5EC2B 1U6AL 4FLSA 2MHAB 5CZVH 5FL0A 3MRMB 3WIJA 4HFWA 1A14L 5J9PA 4FXKA 5DK0B 4XNMA 1KJ3H 1XFPA 3U7AA 3LSOA 3KPSA 1J1XH 1ZSDB 3HMWL 3O45A 3ULSB 1FL3B 4Z0XB 2FGZA 1YZZA 1S9XB 4MA1C 4N1CA 5I18L 3TFKD 3L3GB 4PJHA 4AM0B 4I0KA 2HT3D 3VFNA 2J78A 2PYED 1EMTL 3LEVL 1WFNA 5JQ6H 4ZFOL 1TVPA 3PV7A 5CILH 4ZFFB 1IL1B 2DQEH 3MV01 4DWSD 1ONQA 3IFPA 5DUBB 1NGPL 3MNVA 3PGFL 5FUCE 1FG2A 3IXAA 1QFUH 4W4NA 2RHEA 1V6YA 3QB7C 6TAAA 1TQSA 3JXAA 4XP4L 3QUMB 3QPXL 1PS3A 2EPOA 2WWCA 4UU9A 3GJEB 4TX6A 1HKFA 5GPRA 2AJVH 3ZKXB 2DD8H 4H0HB 2HJLB 4KKCD 2CHNA 2GSIA 4Q7DA 3DUUA 2XN9A 4Z18A 1JGLL 4PJCA 2WUCH 3HNTL 4RE3A 4NOFA 3H7BB 3QAZC 1LO4H 4M8QB 5FB8A 5JW4M 3O6MH 4LCCC 3J7HA 2YMXH 3EUUA 5J6HA 3EYSL 2DOCA 3NCYP 4LFHD 3O8XA 5ISZE 4NZRL 3IDGA 3MRIA 4ODXA 4DN3H 3ZJ8A 4OIIH 3PXHA 3DUSA 2HRPL 4I3RH 4P5MA 5KG9A 3HI6L 5B39B 1RIUL 1W72A 3CCHA 1MFUA 2H6PB 3VRJA 4AEHL 3LXCA 1YMMA 1RULL 1NWUA 1EFXA 3D0LB 1MREL 4Y5VB 1F6LL 4LPUA 4L8DB 5DK3A 5EORL 3F5KA 3NAAH 5F8QC 3DUHA 1R3JB 1OAUL 4ZXBD 4PCSA 2EPMX 3U7YH 2O61B 1XGPB 1DUZB 4DEPB 5FF6A 5GQBA 3G5YB 4XNYH 4M7JH 5FYLE 1N0LA 2XFXA 3EGSB 3HE6B 2PBOA 2W60B 2GAZB 1NCCH 3B9DA 2J7EA 1EEQA 5DEFA 3AGVA 5EBMA 4OB5H 3DC0A 1QRKA 3RUGF 5E7BA 3MS8A 4P5TC 3NFSL 5DJ8B 3WE6B 3A24A 3N1MC 4M1GL 2MNUA 4CD8A 1ZK9A 1NBZA 3HNSL 4I9WE 1CFTA 3O2VH 3TJHC 4WFGD 3G08A 1IT9H 4N0CD 3MRPA 2H32H 4P4KD 4OUEA 3BHBB 4HMEA 4FQIL 1C5CH 1U92B 3HS0A 4GZJA 1S7QA 3NIFF 4ONHB 4LSSH 3MLTB 1RZJH 2X0HA 4PJGF 1X4YA 1KN4L 1IGYA 1DWGM 4M6MH 2GY5A 2CLRB 4FQXC 3BAWA 5IP4A 3PL6B 3FQXA 1MRCH 1XF2B 4NYLA 5FGBA 2FR4A 4BH7A 5I2IB 3ZIZA 5C8JA 5CAYB 1JYNA 5J12B 3N1QC 5KS9B 4TX8A 2OZ4A 4XCEA 4S0TD 5M94B 1T2JA 4M6OH 1M05A 1O7VA 5KVDL 1IAII 1JV5B 2Z31C 2HFFB 4GQRA 4QT5A 1UXSA 4GAJL 5C70A 3MRLA 2R0KH 3CO4A 3WIHL 2P44B 3RJXA 4L9LA 1EHLL 4ZENA 4LAQH 4CD7A 4PJXE 3ISWA 5LQBH 4QHKI 4RBPK 2A6DB 1LNUB 3CPUA 2B39A 2IPUG 3QXDB 2B4CH 4L3CA 4OJFH 4Z2IA 4H7VA 1A7RL 5JBEA 3QHZL 1IAKB 2CKBA 3D18B 4XP9L 2F7PA 2OXHA 3MUY1 3HC0A 1KT2B 2W67A 1IEBA 3VKKA 4OD2B 2BC4A 3FFCE 4HZLB 3BVTA 3FO1A 4RRPA 3EO1A 1CI5A 5SX4I 3N85L 2HG5A 1ND0A 5HYSB 2KZWA 5ACZB 5B3JF 3JZ7A 3KJ4C 3ULVL 5JR1L 4LOUD 4RGNB 1KB3A 2DGAA 5I1JL 3KXFD 4MA8H 4NBXB 4PJEA 3NA9L 4UQDA 3K2MC 4HFUH 3HMXL 3BO8B 2A0LC 3BGMB 3E6HB 4R90L 5C0AA 3MI6A 4P9HL 5JHDE 1FP5A 1MIEL 4OLYH 4QRTB 4XMLH 3SO3C 2R4RH 2RAMA 2NY4B 3HNVH 3AS0A 5I75C 4JQIL 4G3YH 2XWBA 5BZWA 4WJ5A 5C2BH 5K9JH 3HMCA 1ORQA 1DBMH 4IIQB 3L5XH 1EEZA 1K3ZA 4UAOC 2WLYA 2G75A 2NXYD 1U36A 2VDNL 3TIDA 3SCMA 1JNLH 1DVFB 5DJZA 4HMDA 1FQ9C 5EZLA 4Q58C 3OF6D 4LLDA 2V2XA 1OP5H 3S35X 3UAJC 1BQHB 2EXYC 3RWIA 43CAB 3MROA 4FXGA 2WC7A 1JGUH 3MRQB 4P2RB 3DMMD 2JJSC 4NNYA 3NIYA 4U7MA 3GJFH 4ZUUA 5JPNA 1Z32X 1OWWA 2A6KA 2F8VA 2CKSA 4NHUB 3PZTA 1E6OL 3JWOL 4NT6A 5F6HI 5HHNA 2J8GA 3U30C 3GNPA 3MRFA 2X4OA 2KPNA 1UT9A 4JZJB 5ALCH 1T66C 1MCOL 1UENA 1DWIM 4JHOA 2IG2H 3C9NA 4NO2B 1DEEB 4QKXB 4DGIH 2WW8A 1UA6H 4JO1L 2V17H 4H0GA 1YECH 4AMWA 2NTFA 1KB9J 3CXDL 2HT4C 5A6BD 1DJSA 2V3GA 1N3NB 4W88A 1JNNH 3BXNB 3VWJA 1PPIA 2QADC 2HN7B 1Q9WB 2BFVH 5EO0A 3LZFH 1VA9A 1FG9C 4LF3A 1CWVA 4JG0H 1N64L 1QI3A 4ZUWA 1NEZA 5FL1A 4WLCA 3GSQB 3T2QA 3QHOA 4TVDA 1R75A 1CLYL 1RIHL 4R97B 2VMFA 3E8UH 4FHBD 3GM8A 3H54A 2HKHL 3NZHL 4X6DA 4XCYB 2EDDA 4HKBB 1GVIA 1O0VA 2GSGA 1UADC 4NWTL 1GGYA 4WWID 1X7QA 3VMOA 2XVPA 1LP9F 2E8ZA 3IFNL 4KFZC 5JHDB 2GVYA 3TV3L 3HTLX 3WJJC 4QLJA 1G94A 1P7QA 5F89A 4AJ0A 5HYEA 4MNHB 2ZUQB 5I1EL 4OZGF 2JIXA 3ZL4L 3T3ME 2WWKO 1FJ1B 2BRRL 4GMSL 2VDPH 4IRJB 4PG2C 1JPSH 2XWEA 1MJ7H 4X7EC 1T0OA 4KI5D 3D2UA 1N4XH 3TN0A 3WXVH 2F58L 4DO4A 4ETQB 4XI5C 3PDOA 4P2OA 3H2WA 5IVXE 4V1DE 4GXVL 5A6SA 1J1PH 1H5BB 5DYOA 3MUGB 1S7SB 2ATKB 2BSRB 1U8HA 1WAAF 5SWSB 3X17A 2ZICA 3S2CA 4OGYL 5AC4A 2FEEL 3N50A 1KLUA 3B8YA 4OQTL 2NX5B 1Q72L 2XGBA 5LVEA 1NMCB 1HZHH 2XNAB 4XVJH 1PY9A 3KGRA 1G0CA 2EADA 1IEAA 3QRGL 3S5YA 1F3DH 5GISH 1T6WA 3MV7A 2UY5A 3QUYD 2YDRA 3SDCB 3U57A 3A5VA 4NQEE 3UEZA 1T1ZA 1FYHB 2X4SA 4KUCF 1AQMA 4HWZA 5KSAB 2FGWH 2AABH 1AKJD 1NPUA 2M8XA 5GS0L 1KEGH 3WFCH 5FYKE 1G9HA 2DLFH 4GRLB 1N82A 2CKNA 5F9DC 4HU0A 1XGZA 5DD1H 4M7ZB 1YQ2A 4Y4HD 4K3JH 5F9JB 5BVJA 2UUDH 1DUYB 2PCPB 3SKUD 4WHYH 3CIQA 5F7WC 3U9UB 4HIHA 4Z2JA 3QUZB 1BTCA 3ARDC 4PJ5A 3E3QE 3L6FA 4JFED 5EUKA 4EOWL 4GS7B 4QRRA 4JANB 1OB1A 2ESVA 4EUPA 1FLTX 1MJJA 1IFHL 4GINA 1MHEB 3OKNA 4HG4K 5C6PB 1VAHA 4O51A 5D7LB 4YHYB 3BZEA 5FV1L 1UB5A 4NQCB 4EEEA 3C6LB 3RM4A 1YEFH 3MUJA 2WBJB 1HSAB 4JRXD 2WUBH 1K85A 1T2QL 3AMKA 4NQTA 2IBZY 5J11C 1MJ8L 5BO1L 3MXVL 1BFTA 3WFBH 2F53A 3C8DA 1JZ4A 3WIFA 4NCDA 5IIEB 3HG5A 4XZBA 4JFYA 2R2EB 3IDUA 1NMAH 4K7FA 3Q5OA 1XF4B 3PZOA 3BH8B 1FZMA 4NNPL 5D4YA 1F02I 2IGFH 1MH5A 3NFPA 1MSPA 4X6CF 3MOBH 2IMNA 5BRPA 1K6QL 2BNRE 5D8JL 2BVPA 4LLYA 4JO3H 5H2BB 3MLZH 2CPCA 3OLGA 2FDMA 1UWUA 1GC1H 4ODSH 3U7WL 5T5NF 5F7LB 2VC2H 2WCSA 2VT0A 1CICC 3TNMA 2WYSA 4H5SA 4C4KO 3QFJD 4KDTC 2P8LA 5EA0H 4UV4L 1DZBA 4NQEB 5K33A 4KKNA 1SYSB 1UWQA 5A2JH 5C0IA 2YK1H 4K94H 5BQ7A 4AD5A 4K9EL 3VXUE 1RZIA 3H9YA 4Y16C 1M04A 3I6LD 1KIPA 2I07B 3L4ZA 4A3YA 3VFTB 4ZD3L 3SKMA 2DEPA 2MKLC 5I1KH 2GJRA 3MMEB 5D72L 3DECA 4G6FD 5B8CA 3EOBA 4GRWF 3LPGA 2VRQA 1WCQA 3K4ZA 3E2HC 2G9HB 3VWKA 3BPLC 3MLUL 3G5ZB 3GMOB 5C09E 1CN4A 1CFBA 3S4SB 4X0KB 1BQCA 1V0MA 5EUOB 1QYGL 4JFFD 1JK8A 5D1ZB 4YR6B 3TA3C 2EPKX 5D6DA 2JB5L 1LILA 5CHNB 2YL6A 2BNQD 4PTUA 4AEFA 4JRYE 4BK4A 3O3DB 4UIMA 4S1DD 4NPYA 1U91B 4LIQE 3RKPA 3FONA 5D9SA 3BRDA 2F8QA 4OZ4B 2F19H 4HPHA 4GZIA 1G7JA 1Z9OA 5DEZA 3HUJF 25C8L 2HJKA 2EZ0C 1EEYA 2A3HA 5IMKA 1I7RB 1R5VB 2AXGB 2XT1B 4LSQH 2FX7L 3ZDZE 5ICYB 1H3VA 4U0RB 1PIGA 1Y0LA 1KLGB 4I2XA 2GUOA 4Y19D 5M03A 3QWQB 4L29B 2WBWB 1BEYH 3RWJA 3MTRA 2ZCHL 5DJXA 1GW1A 4AK1A 1KWGA 4O2FA 3BEVA 3TA9A 1T0NB 1FVCA 1N5YH 2J6EA 1AJ7L 2BNRB 5CQ1A 1TQVA 4FLRA 4KK9D 1VGKA 2WB5A 5KJRL 3MJ7B 3WF3A 3VXOB 1HIML 4LLMA 3ARTA 2J88H 3WQVA 4OCRL 4R7DB 3AU1B 4FQXD 4C57C 1W9UA 1KXQA 3U4EB 5EIVA 4PTMA 4TUKH 1CFQB 3BW9A 3S3JA 3AICA 4F57H 1F45A 3MACL 5KVEH 5IW6B 1BD2E 7FABH 1OGTA 1F00I 3FQTA 4OFDA 2XA8L 1LO3L 3VXUB 3LRMA 3IETB 5BRQA 3AIEA 1BVZA 1L4IA 2Z31D 4RAVB 4WJXA 5DZOA 1T04A 1ZVSA 2WZIA 4JFVA 3RIKA 4MD4A 3IDMA 3FQUB 4IJ3B 3BVXA 2F1BA 2P42B 2ADJA 3MFGB 4AEIL 1P4IL 4NQSB 4UB0H 1J8KA 1RZ8B 5DJ2B 3OGOE 4D9RE 3RAJL 4D3CH 5T3XE 4ZQKB 1YEDA 3QQNA 3ETBF 1MOEA 3H0TA 1P6AB 3DTXB 3WD5L 1J8HB 4ZNEE 1LE9A 1Q0XH 2VDLH 4NFDA 1HKIA 1X44A 1WTGT 5C0NC 1NC4B 1CWYA 4Q9RH 2WMGA 4LCWD 4NO5A 4F7MA 3NCBB 3ULUH 5JUVA 3STLA 3CC5B 1M71A 3UTZB 5F72S 2QMJA 4OGXH 1CGSH 4PRNA 3VA6A 2WNWA 3TBTB 3GK8L 2OBGA 1E6SM 3RIAK 3GBEA 5A8OA 3VJ6B 1SJVA 1T1WB 5E9DD 4WDIB 2PYEE 5DVKA 3HG3A 3FB7B 1HDMB 3S5LG 1AXTL 3MO1B 5HHVL 3L5IA 4NQXA 2RFXA 4OZHB 1LJYA 4LU5L 1OAKL 2DQIL 2JJTC 5JW5B 3SDXB 2WINB 3BUYA 4XXDA 4HOWA 3HR5B 2VDOL 5ID0B 2RR3A 1DCLA 4WO4B 1O5DT 4D9LH 3HCVB 3VRLF 4MD5A 2HRLA 3WO4B 4I8DA 1TQCC 1A4JA 4XVSH 4IOIB 4LPVA 5K9QI 2FIKB 1F3JB 1MQKH 4DGVL 2AJXH 2BVTA 4PJHF 1BG4A 5E8NB 3RGVC 1A6TB 3EMZA 1YNTA 3W38A 5KSBE 2EXYD 4KK8C 3RWHB 2X44D 3EHBD 3KAAA 3UYRL 3QIBC 4AZ6A 2ADGA 5H8DA 2DICA 1RZKH 1DN0B 1OGAD 3T4AB 5I1GH 3A47A 3SGJA 1ZL1A 5ADOH 1JNHB 4NKOA 3WH7A 4Y7MA 4Y4FA 4KGJA 5L7XL 3JUYA 1X4XA 1JUFA 4TSAH 4KAQL 3BD4A 4OOUA 4HUUA 1JGDA 1RUKH 4OOZA 3IDXL 2CDEA 1J1OL 1T66D 1JFHA 1CK0L 1KFAH 3AROA 4O58L 1GJUA 2W07A 3JV4A 2OYPA 1U3HB 1W0WA 1UWSA 3OAZK 2HT4D 4NKMB 2W9DH 4UNVA 4PJCF 1MHHB 4RCAA 3WSUA 2QADD 1UHVA 2BZDA 5D1QC 4NWUL 2FLBT 3SN6N 1DWHM 3I02B 3DX7B 1B3VA 4JG1H 1FIGH 3MBXL 3SDDC 2FX9H 4X8JB 3OIHA 3OV6A 4ODBD 4DKEH 1JG9A 1DQLH 4NQUA 2B1HL 3UXFA 4K3EH 1KGXA 2ZG1A 1C16A 3EO0B 1JGIA 1UB6B 2VAAB 1C08A 5JO5A 2VSDA 1S9VB 1WO2A 4HKJA 1JMXA 1PX4A 4GQPH 3T1FB 1BFVL 4H25B 5J89A 1Z3GH 3OKEB 3ZTNL 4LEXL 2KL6A 4DWSB 2LU7A 2YD7A 3HZMA 4N5EC 3B2VL 2BNUB 4WFGE 3SCOA 2B1AH 2GJXA 4G43B 4K2UL 3U5YA 1ESWA 2RJMA 4E42B 4LDLB 4Y5XC 3SDAC 3VDCA 1J11A 5FYLH 5D7JD 2CBJA 2AVGA 5IM7B 43C9B 4OD3H 2Z35B 4YHOL 5IR1B 5IMLA 3L95B 1XH2A 4R6UA 3GSRA 4P4RB 5D7SH 3TO4D 2DQTH 5B4MC 5I73C 1KLFA 1VKXA 1U8IB 3WXWH 1DWJM 4LPWA 3FAXA 3BP7B 3HRPA 3N04A 5F1SA 2J7CA 1BZ9B 5KSBB 1MRFL 5BS0A 3VA2C 3F7RA 1I1XA 3W24A 3D4ZA 3UROR 1VHPA 3O11B 3QWOB 2CDFB 4A6YB 5ECUA 2LABA 2LTQC 1KNOA 4ELME 3BIAX 5DWUH 4BA8A 2XVKA 5KSVA 1QRND 1UJ3A 1NCAH 2WCGA 2NXZC 4PJ8A 1LEIB 5DGQA 1PKOA 3HHRB 3W11C 3ARGA 3M17A 2YD5A 1QLRB 2ADIB 4WTXA 1W91A 2R56L 2ICCA 2EYRA 3PN8A 4NGHL 1KYOK 3STBA 2RGMA 2W66A 4NCC1 3DX8A 5JXAL 2VDMH 1EAJA 3MA7A 4WUUD 3IGUA 3SEPA 2XVLA 4ZXBB 1NQ6A 1A6AA 3MFFA 4W7VA 4LMQE 4OLVH 4NCC2 2VDQH 4S1RH 4BSWA 1CDBA 1D6VL 1XCWA 3UETA 5DQJB 4KVCH 4HKXB 2X7LB 1MELA 4W86A 1MCWM 3CFEA 3HFMH 1WWAX 2GK0A 3VI3E 3GH7A 4X98B