3VGGA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltoheptaose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
554
structure length
554
Chain Sequence
YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 193
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vggA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vggA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vggA02
3ECBB 4YAQA 5AWNH 2D7NA 4OLVH 1PG7L 1G9NL 1R34A 43C9B 1WC7B 4WLCA 1L7IH 1X1NA 5IHZB 1I7ZB 1N2RB 5D8JH 3HR6A 1LP9F 2H2SC 3BZFB 4F57H 1K3IA 4PJBE 4Q9QH 3TCXA 3U7WH 3O3EA 2MCG1 3S5LB 4R3SA 1OGSA 4JLRB 4O00A 3HZVA 1VRXA 1J1OH 1UM4L 3LIZL 5D9OA 2FCBA 4JG1H 2CR6A 4LLWA 4R4FH 1G7HA 1LP9B 5GS0C 2J25A 3C8DA 1B31A 5E8OA 1C92A 1G7MA 2CBJA 5JUVA 3ARBC 1MYRA 1T2JA 1U8HB 1TQTA 4GKSA 3N15A 1I1AD 4YHKL 5DFTA 3SJVA 1QLEH 4FLOA 5ETUB 3WNLA 1Q9OB 4GS7B 4KROC 1PG7X 4YHLH 4UILH 3VI3E 3A6BL 3CO4A 1I9RL 1IC5L 1TENA 2VWEC 3D3VA 2AJSL 3KYNB 3QQ3B 5D9NA 2DI7A 1IGCH 3INUL 5IB2A 5A2CA 1OTUC 4GI9A 4JHZA 4PLKC 1V6YA 2MJWA 3V6OC 5CEZE 1H9VA 2APBA 2A9MH 3OKNB 3VFRA 1U93A 5DMGD 2VC9A 1NC2B 2B4CH 1V02A 3KPRB 4J2XA 2Z8SA 3OZ9L 2VLRB 1H8SA 1V0KA 3C5SA 1B3ZA 3UTOA 3RX5A 3TFKD 1MCOL 3GJFA 2QSCH 2HJFA 4KI5F 4NXSA 1NFKA 2BVOA 4X7CC 4J1UB 3DROA 4MJ5B 1XSIA 1NGZA 3TT3H 3TJHC 3MXVH 4LCYB 2XM1A 1FJ1A 3CH1A 1ZT4B 5DJZA 5ABFB 2VXVL 4GOSA 4PJ9C 4EXPX 1NPUA 5E24E 1R5IA 2UZYB 2ZCHH 2GSIB 5I8EA 3T3ME 1UD3A 1TR1A 3GSOA 4OFDA 2C3WA 5D7IE 4XVSH 1VAHA 1J88A 1FC2D 3OJMB 1LWHA 1H3VA 3PHOB 4JJ5A 3L4UA 5D4YA 2HVKB 3LY6A 3S4SB 4LVHC 5EC2B 4PJAE 1YECH 5C0GA 1JRHI 3CZEA 1IGIL 2EYSA 4WUUB 5A2BA 1BIHA 1FO0A 4IPNB 5EU7E 2DQTH 1BBDL 2H6PA 3LS5L 4Q6IC 1K6AA 4BQ2A 1NLDH 3IYLW 5CHNA 4HJJL 4JCMA 3MRRA 2X09A 5EOQH 4GI8A 4X0NA 1GOOA 4MXVF 4JQXA 3KPQA 1H49A 4FLQA 5T3ZE 4MD5A 4YDIL 2O61A 5ITBL 5I73C 2NXZB 3EYSL 2WHJA 5T1LB 4RWHA 5DUBA 2NW0A 4N1HB 1A02N 1NFDA 3D0LA 4YHNA 1JI1A 1AGBB 2E3VA 2FB4L 5CJBA 4Y1AB 2F74A 3H7LA 4A3HA 3SKOA 3OKLB 4HMCA 4JDVA 4X6EA 2I60H 4MMZC 2PXYA 1FVEA 3QXDA 5A6AA 1FAIH 1JYWA 1ZS8A 3L7FA 1D5IH 5HDLA 4Y19D 3UDWC 4V2CB 5DYOA 4OKVA 4YDLB 1E6RA 5IFHH 3EOTL 3QIBB 1QPPA 2Z91B 3ARRA 1PBYA 3WUWB 2B1HL 4L4VB 2P24A 1I9JH 3L4WA 4ZFMA 1OD0A 3BKML 4HWBA 4ZPTB 3WHXA 1XH0A 1LO5B 3SDCA 2ZXDA 5I16B 25C8H 3VI4F 5C2UB 3C5JB 1H0DB 1RPQA 1RJZB 4UB0L 4L8CA 5T3ZD 1FYTB 4LSUH 5F7HA 5E56A 2W66A 2AGJL 2OL3L 3HC3L 1JPTH 2E6PA 3CUPA 3QJFB 4KPHH 4L8DB 5JTWA 4APQD 5H2BB 3T0BA 4UT9H 2YN5A 4X4ME 1ZSDA 5EA0H 2E3ZA 4NX0A 3QXWA 3O2LA 1XCTB 3GFUA 2AK4B 3RWCA 2R0LL 4MJ6B 3MRHB 3QH3A 5C0AA 1A14L 1E0OB 5EMYA 3VINA 3LB6C 5KG9B 3NIDF 3GBLA 4OSUL 1A21A 1J1PH 4JRXB 4DN4L 1PJ9A 3MRDA 1ONQA 3HPLA 4Z78A 3NABL 3OXSA 4EVNB 4KJQC 4JE4B 5L8LB 3LKOA 3QEQA 4IPLA 4MDJB 1BQLL 3DNKA 1UVQA 4F37F 5F88A 1KN4L 4QRSA 3VFNB 4AIUA 5IVZB 3PZTA 4P9HL 3IFOB 3OKEB 5IEKB 1JHLL 1E3ZA 1YEKL 3A5VA 4O2FB 4R26H 4PG2C 2J4WL 3SQOL 5B39G 3E3QC 3MZGB 4RFNB 2AJ3B 1T1XA 2P7TA 2UY2A 1MUJB 2EDTA 3CXHK 4GXUM 1GJIA 1GZJA 1CFQA 2AEPL 2ZSWA 3MRFA 4RA3A 1E6SM 3AZTA 4M7LL 4OGXH 4KJPC 2VN7A 5J89A 1QSEB 4BFBD 3QDMB 1DBJH 4KVCH 3BPCB 4KAQL 5MENB 2EDEA 3CU1A 1GHFH 3AIVA 3OAZH 4P4KB 1KULA 1NBYB 2Z31A 5JHDE 4D6FA 2NX5B 4GZIA 4JKKA 2A3BA 1U8PB 5DZNA 5C9JA 2W0LA 2I24N 3AHZA 4HK3J 4IRJA 4JVWA 4Q9RH 3EOAA 3IJ7A 3DVFA 4XP1L 5EWIH 1GZPB 3ARDC 3BHBB 3VCLB 4YHMH 1ZU8A 2GITA 2NR6D 4GG6E 1B6DA 3BUQA 4P5KB 1JZ8A 1KNOA 1I3RA 1CDBA 4F3FA 2ZZUT 2JLLA 1UWEH 2CO7B 4AH2A 4PJIF 2V3EA 1MQKH 3QEHA 5DK3A 3GJFH 5IT2L 3PHQB 3EFDH 1QO3B 2IANE 4XAWL 5E4IA 1DBBL 1VHPA 1YEGH 1S7VA 4OF5A 2QMJA 1JWMB 2EXWD 3MLTA 3MOAL 4OBSA 5JW3H 4XB3A 4KKCC 4Y2DC 5JHDD 3CXDL 3DVGB 3TBWB 4PJIB 3SUWA 5AZEL 1YJDC 2XI9A 4PJXF 4FQXC 2A77L 2OXHA 1ZE3C 2L0DA 3NVQA 3ULVE 4BELD 3PF2A 5CJQL 2BOBA 5IB4B 3ESVF 4TOYH 4PGBB 2X5PA 1KIQA 1E4KA 1WAWA 3PZOA 2WIIB 4EUPH 2WMKA 2W9EH 1QFHA 2FJHB 4YBLB 5ICXB 4P2CG 2F58H 3EMCA 1NCCL 1HDMB 5I77A 4KTYA 1AKJB 5J3HD 2DLTA 4H1LB 2GJ6A 3BVUA 2UWEE 4KC3B 1BQUA 2EECA 3VU2A 4XZBA 1V6WA 1FZOA 3BQUC 3OGVA 1X6NA 3EDEA 4OGAD 3O41A 3THML 4ZXBA 2D7TH 5J6GB 1IKFH 4P5TB 3VWJC 4KHXH 5DMIH 4XNUL 1HQ4A 1YEHL 2ICCA 2EYRB 4F79A 3ARYA 4NWTH 3ZDXE 2IAND 2W61A 5D9SB 2WNWA 1DQTA 1JZ2A 2IG2H 4QLRA 2CKBB 5EORL 2QQNL 5M5DA 1CLCA 4TUJA 3BLKA 1E72M 3DV6B 4QRPE 3LEYH 3MRPB 5BVPH 1F3JB 5HHOA 4JPWL 1QNZL 2OZ4A 1T22B 1U0QA 3ULVD 4TPRH 5T3ZL 3WIFA 2R0WL 3IFLL 1S78C 4Y4KB 3MREB 2AJXL 1G7LB 2J12B 4IIQC 4CKQA 4MA8H 1ZEAL 5FUCE 4HWBH 5CGMA 4DUXA 2IAMB 4LEOB 4JG0H 1FFPA 1BFVL 5KSBF 2OTWA 4HBQA 1JYVA 3CIQA 2XNAA 3D0VA 4M1GL 5DEFB 3LXBA 3EBAA 1XCXA 5GRVK 1GQKA 4F7TB 3IJ8A 1ACZA 3JTSB 4TYUA 4ZTOH 5HYFA 4S1RL 3L5XL 4JN2B 1QPXA 4Y4HA 3QQ4B 3V79C 3DUSA 5KSBB 3PABB 5IFJA 3STLB 4P2RB 3O8XC 1ZT7A 2AK1L 1NCBH 5C8BB 1HHGA 1C5CL 2YPVH 4HMDA 1KFAH 3V5HB 4ZPVA 5I23A 3CVHA 4D71A 2F1BA 3CK0H 2BRRH 1VFOA 3K1KC 1QRNB 4GFTB 4ZUUA 2HVJA 1EBAA 1YEIL 1AQKH 1V0NA 1MWOA 2DOCA 3EUUA 2R69H 4RBPH 3P9LB 2VH5H 1L0YA 3SE4C 3TPKA 4BF7A 4UTBL 3IFNL 2ZUTA 4JFZH 3PGDA 3HC0B 2ARJB 4YFLI 3DIFB 3DGCR 5TF1H 2ZKHL 4UAOC 1MAJA 3RL1A 2WBKA 2YZ1A 4WJ5A 4I18C 1SM3L 2B2XH 3WQWA 3O6FA 3FY1A 5TH2A 6FABH 4JO1H 4KI5E 4OCNC 5EUOF 2DMKA 4GRWH 1DSFH 3MCKA 3O3BA 4P2OA 5KS9F 4Q0XH 1S9XA 3BX7C 4OZGA 5I74B 2H32A 1VB9A 3D3AA 4RGNB 5CEYA 2DDQH 4ORGA 1NC2D 2Q1EA 4GAJL 5J6HB 3KPRD 4JVUA 5I71C 1KN2H 2VLRD 4LF3A 2OWWA 2X05A 4J27A 4OIIL 5L6YH 4PBGA 5HD8C 1FZMA 5EUOB 3QWRA 5KS9B 1QD0A 2A1WL 3SCQA 1SMOA 5GS2D 2HTLD 3V6ZB 5EBMA 3ARTA 5KJRH 2WAGA 1CICB 1DQMH 2WLYA 1QBAA 3HHRB 3VMNA 4NWUH 3VNYA 3CX5J 1GL4B 3V8OA 1RP9A 2FIKB 4LRIA 5EBAA 4IMKC 4X9YA 3QWQB 4GKZA 5HYSB 4L3EE 4DCQB 5C0FB 2VITA 3NMEA 2F53A 1OCWH 3O3DB 4JANA 4KI5D 2A83B 3EJZC 3RL2B 3Q5OA 4X6BB 1NMCC 5KANI 3NN8B 4GUPB 3PZMA 4DWSB 1S7SB 1FP5A 4L3CB 4L4VE 3WO4C 3C60C 1RUPH 2ADJB 1EMTL 1EVTC 3BN9C 5F89A 2V7HA 4WUUD 2OCFD 4IRZH 4KTDL 2R1WB 2PF6A 4D1JA 4GKNA 3VFWA 1AGEA 1KEGL 3FL7A 1INEH 2Q7YA 4HXAL 4HKJA 1BQHB 3OR7A 5D2LE 5C0BA 5KVFL 1HOCB 2RCSL 4PJ7E 2EIZA 3MUHL 1UZ6F 5J0BA 5F1IA 1DTUA 1FYTE 3RU8H 1MFAL 2ITDB 2NXZD 2BOCB 5T1LD 5CCKL 4K71C 1GGIH 5DD1L 4NKQB 1A6UL 1UWGL 4JO4H 2OLHA 3VXSB 4Z7WF 4TULH 2VKXA 3P4NB 4L3ED 5DJDA 2AK4E 3ALWA 2QKIA 4PJDA 2RAMA 3M46A 1U6AL 4X4XB 3G9AB 3QIBD 4A3YA 4FQLH 3U9PL 3ULVL 1DBMH 1PLGL 1Z3GH 3T2NL 5BOZG 5GNZA 4L4VD 4PRDA 4JFFB 4Z7WB 3VXUA 2RGSA 4JRXE 4N8PA 1J5OH 1KGWA 3MACL 2EH8L 3HNVL 3TTQA 2O9TA 3IFPB 3VFUA 1FH8A 4HF5H 2DLHA 1TQWA 1GC1L 5C2BH 3MRMB 5CSGA 4XMLH 1JGVL 1HSBB 4OQTL 5ILTH 2FR4B 3IANA 1QR4A 4R5EA 3NIGF 1JTOA 2PYFB 3I2CH 3NGBB 4IS6A 4YDVA 3BAXA 4H8WH 4MX7B 1RFDH 2DJ4A 4I0PA 1XGTB 2OZ4H 1FYTD 5IHLB 5HJ3B 2VNCA 3FOLA 4MA7H 3MANA 1B0GB 1A1MA 3GH5A 1TFHA 1DLFH 4N90E 5BXFA 4OCRL 4S3JA 3NDYA 5DO2D 1BPVA 3WDIA 1G9EA 4S2SB 5J06A 2EYTA 4M5YL 4UQ2B 2AK4D 3ZDZE 4JKLA 4M6NL 4FMFA 1A3HA 5EU6B 1IMHC 1OW0A 5J12B 2R1YA 3AM8A 4HV8B 4K3JH 1OTTC 2Z92B 3U0PA 5GISL 1OAXL 3HMCA 1HHHB 4U6XA 1LO4H 4PRBA 4JRXD 4CVXA 2NX5E 4Z7NE 3M8OL 1FNGB 3B3IB 1AIFB 5FV2A 3MUGB 3DETD 5F1OB 4EN3B 3MRNA 3EYOB 3QIWC 4U3XA 5LGKA 1MCWM 1IT9L 3FFCB 1Z5LB 4GRWE 4DN3H 1T21B 4ZSOE 1AHWC 4LGSB 3UJTH 1LO3L 1T66D 3IGUA 3CVHH 3KYMB 4NC2B 5F7NC 1KLFA 5IQ7H 4N90D 2WQ8A 1VACB 5IJVB 3R06A 1QLRA 2X8RA 2WV3A 3ZYOA 5I66A 1GVYA 4AZCA 2YBUA 2CBIA 1AP2A 1PSKH 2EDOA 4LKXA 2DYPA 1FZJA 2JIXB 1T80A 2NY7L 3BWAA 3RI5K 4OD1H 3PDOA 1I9EA 2Z93B 4F7CA 3ZKNC 3VNZA 4GRLC 3QDMD 3S37L 4JKPH 1H5BB 2V9RA 4HFWB 2DQFA 5MEND 4FLRA 4P4KD 2W07A 1N3NA 4ODSL 4FNSA 4OLZH 5BS0B 2NX5D 4XAKE 1WBXB 1QSZA 1FA2A 2IPTH 3CUGA 3BUPA 4W93A 3GSRA 1XF1A 3MX0A 1A7RH 5E8PB 1NEUA 5D5MA 4I3SL 3CDFA 4G8GA 3WS6C 3CFCH 4JHAH 4Z8FL 4NF7A 5HHME 4QOKA 1J0ZA 2DJSA 5DWUH 4WDIB 3QCUH 2NY1B 3VE0B 2FATH 3UJIL 4XPGH 1JF1B 4ONFH 2H26B 5HPOA 3KLLA 1IC7H 1MPAL 1N4XL 35C8L 3KPOA 2R4SL 1V6VA 5E7BA 5HHNA 4HZ8A 1ZLSH 4BYHA 2DT1A 3G6MA 1KYOJ 1MJ8L 4X4ZA 1ROWA 1AI1H 3H54A 4FZ8L 4QRUA 4ACZB 2P8LB 3H3BC 5TPWH 1OCQA 3HG1E 5C9KA 2X1OA 3GSQA 3O2DA 4W86A 1DBAL 1ZGLP 3WUFA 3TJEH 2JJTC 3C9NA 1AXTL 5FYKD 3MO1B 2NZ9C 4U1MB 2OWCA 5DURB 4XAKD 4O5LL 1FNAA 1MHCA 4HJGB 4F80A 5I1KH 2BY3A 5BYWA 3MNVB 5L9DL 4KDWA 1LF1A 3AMGA 4DKEH 2V3DA 2CIPA 1HSAB 5HGDA 2PTVA 5GGTH 3GMRB 4FXGA 1HXJA 2HRLA 1VIWA 1UYWL 3CZJA 2WBWB 4J3TA 2XGBA 5E94A 5JQHC 2NY5H 4NOFA 3AXHA 1LJYA 1U42A 3MA9L 1AKJD 5EO9B 3HI6L 5IMKB 4ZOEA 3S9DB 3VX0A 3MUAA 4P5TD 4U1IB 5FKPA 4EIZC 1JHKL 1HX0A 2A3AA 3OZPA 1QW9A 5L2KA 1OAKH 2VZ1A 2P8MA 4NKOA 2PO6C 4P48A 1RURH 1YDPB 1GOKA 3LH2H 3WJLC 2B0SH 5ACLA 3L3DB 3AB0B 3FT2B 4XX1G 1UJ3A 2WVSA 4KMQA 1S7TA 1F3DH 4LCIH 4JCLA 2Z1SA 3V52L 4YJZL 1G9HA 4U1HA 1KXQA 1Y18A 5C0DB 2HYMA 4BH7A 3GYCA 4Y4KD 1H3UA 1M04A 4DGVL 3X13A 1DR9A 1UZ8A 4QCEA 5D2NC 2UZIH 1WWCA 2Q76A 2WVVB 3EO1A 4TVPE 3QUKA 3PWVA 4GW4B 4Y5YB 5FECB 2XIDA 2IAMD 5I1CH 3BSZL 3PWNA 1KFWA 2R56L 4M8UA 5FV1L 1B0RB 4C59B 4DKAA 3TH3T 5ICYB 4I2XB 4HIJA 2XY1A 4D6IA 1EBPA 1RHHA 3PQYB 2X9YA 3DBXB 1SZNA 4X99A 4OZHB 5ISZA 5M95B 1RUKL 4YZFE 3NCJH 2YLAA 2AVGA 1I1YA 3SKJL 4PRPE 2D3NA 3MRGB 4MCZA 3ARZA 4K23L 4P2RD 4HT1H 4NKDA 5K9JH 5IB3B 1KB9K 1S5IH 1R3JA 1B4JH 5I1JH 5I79A 2VKWA 4RGNE 1OAYL 2J7LA 5C0RH 4KH2A 3UTTB 3QA3B 4E4PA 2LU3A 5EU5B 2ED8A 2XPGA 4BK4A 4QT5A 1ZV5A 4XPAL 5JXAL 2CK0L 2XWDA 1QRND 1PEWA 5MEOA 1J87A 1OB1B 1S9KC 5IQ9A 4TVPD 4B3KA 2FBJL 4NN7C 5F7LB 3QRFM 3C09B 3ZM8A 2ADFL 3NCMA 2WMJA 1AVAA 1XF4B 2VDPL 4JZOA 1MI5A 4DTGH 4B5EA 4XTRD 5IBTH 2L7UA 3EZJB 1F8TL 2Q8AL 3U0TA 4MNJA 1CZ8L 4WENB 4O4YH 1OM3H 4NM4L 4HIXL 4NQDA 5C92A 4L5FH 2F61A 1A1OB 2EXYD 4UQCA 3U7VA 5FYJH 1NEZA 1BX2A 3GMOB 2YPLE 3BGMB 3AHTA 4GBXB 3T4YA 1RULL 1AQDA 5F9WB 1WNOA 4XV0A 3L4ZA 1XGRA 3ARUA 1MWAA 1GAFH 4JO3L 4ZQKA 4RGND 4N9OB 3AS1A 1NDGB 1RIUH 3H8NA 3P9MB 1T0OA 5F8QC 4PRAA 3RY5A 1HIZA 1J0IA 1A6TB 3UTQA 3PZIA 1S7XA 1AC6A 4D0CB 1Q9WB 4KMLB 2VUOA 4JJHA 1SYTA 2Y7QA 1F90H 3QR2A 1FCGA 3BGFC 5BMFH 4YEEA 4NQCA 3WUEA 4IJ3C 3UYOD 3RKDC 4M02A 1IVLA 4R97B 2WWKO 5H35A 4N0CC 3HG5A 1CICD 1TVBB 5EU3A 5GSRA 5DMYA 1HWHB 4CD6A 4KUCF 1LEGB 1ZT1B 3JV6A 3U48A 5JW4N 3II1A 4CADB 1JI2A 4JPVH 4K7PL 3VXSE 5ID0B 5B8CC 5FYKL 1U2CA 4W4OC 5D1QB 1C16A 1K8IA 1U3ZA 3LS4L 4UQ9A 3K8LA 2XG5A 1II4E 3WIHL 4CMMB 2F54A 2WWMC 5ID1B 4BQ4A 2ESCA 1TZHB 4JHOA 4DWSD 4BZYA 5DDHB 3VFGH 3RI5F 2AJUH 3V4PL 3OX8A 2VCAA 5A6LA 3O2DH 3MR9A 3ARQA 1JPGB 2E7CA 5DQ9B 5DJ6A 4PRIB 3MBXH 4G6JL 2JIEA 32C2A 5T5FH 5D1XC 1BGGA 3FQXB 4KK6D 3AMCA 4V1DE 4R0LA 1R24A 3V4VH 2ZXAA 5CIPA 3DI2B 4LCCC 4NZTH 4MAYA 1NL0H 3QI9A 5B22A 1FGVH 1NCWL 5IESH 3VXSD 4NXKA 4PTMA 2CKBL 3FCTB 3WSUA 3WN5B 1BGXH 3W9DA 1KTDA 2ZPKL 5C09B 4TUKL 1CLZL 4L4PA 1T1ZA 3MSGA 1IAKA 4FN0A 5EU6E 5F96H 4M62H 4AG4L 5D7JC 3CIVA 1A6ZB 1KXHA 5JXEC 4JN1L 1T7WA 3HE7C 1WKYA 3QCTH 5CLTA 4JFFD 2AJZA 1QA9A 1MRDL 4KMTH 1GGBL 1YEDB 3UCRA 2ZUWA 3MO4A 1AFVL 1NMBH 2IPUG 3HC4H 1ITCA 4XMPL 3GJFK 5T33H 3P3YA 4NJAL 2QADC 4PJFA 1TFVA 1ZVYA 2ESVB 4ZYKB 4NPYA 2X4RB 4P2QA 1KWKA 1FAKT 3T0VA 4LEXL 4GQRA 4XNMA 1Q1JL 5BRPA 2VB5A 3MLWH 5DD0L 5IM7A 2Y1VA 1A1NB 3RFZC 2VABB 4OIFA 1GOMA 1KPVB 5CILH 5HYIA 5E8EA 1NMAH 3N12A 2F7RA 4HUMB 4UT7L 1RZ7H 2GIYA 4NN6B 4ATLA 5EU6D 5HYQB 4D8PB 4XCNA 2WBJB 1U95B 4WI2A 4ZAKC 1FV1B 1HHIB 2UYLB 3WIJA 4TVPL 4WO4C 4JDZA 1D5BA 3FT3A 4ZO7A 1T7XA 4XPHL 1K5NA 4EN3D 1EXPA 1AGCA 5DUMH 1NKRA 2D03L 1DBKL 1EEYA 3QUYB 1OGBA 3WH8A 2C3VA 3CVIH 3SCPA 2E7BA 1YEEH 4HWEL 1E1FA 3FN0L 5GSVA 4WHTA 3A6CL 3JSSA 4JPIB 4XXDB 3GXDA 3FO0H 3WDPP 4PRHA 2NY2C 1G9NC 5JLZB 5T5NF 2CUIA 3OKOB 3SHSA 2I26N 5DHXB 5HHQB 4HS8H 1US3A 2NY3C 3SCVA 3W11C 2JIXD 1OGAE 2R1XB 1MRCH 1I1RA 3U30B 5GRJL 1WDQA 3G5YB 1KBGL 1UH2A 4C56A 1OLZA 1LDSA 3EYQD 3BP7B 4Y89A 2X6MA 3TIEB 4YNYB 1SYVB 1QNSA 3G6AB 3HAEB 4Y4FC 2B7DT 3MLXL 1NBVL 4HA3A 4G7VL 3P40A 1QEWB 5IEHB 2G3IA 2HTKD 5BS0D 1RUML 3HZKA 2FO1A 3X12B 4NC1C 3VH8G 1K4CB 1ND0B 3L1OL 1HYSC 5HYJE 2Y2WA 1LQ0A 3HLAB 4MSWA 4FF5A 7CGTA 3X3GL 2G9HB 4LNRB 4GAGL 4WTWA 1V3MA 3GIVB 4WF7A 3E6FA 4LRNH 4BZ2H 3HI1A 2JB6B 4PMDA 4C7DA 4OLEA 1P69B 3QB7C 1NUGA 4RFEB 6A3HA 2NY1D 5A8MA 2N56A 4UR9A 5JO5B 4ZE5A 4ODHL 4OCXL 3CPLB 3U5YA 5DRNA 1Y0LB 3HFMH 1H41A 4Q6YA 3KZSA 1VFMA 4EKJA 4LIQH 1IKNA 1I3GH 4RBPK 3U4EB 3LX9A 3SOBL 1JWUB 4NRXB 4HGWB 3RTQC 1QFOA 3DWTA 4DGYL 5T1MB 4RAHA 4H25B 2D31B 2PW1B 3DX6A 3D48R 1D5XB 1OGTB 4NI3A 3CH8A 4JY4B 3TT1H 5DURD 1E6ZA 2ZCKL 1NLBH 5J13C 4LLYB 4WGWB 2NXYC 1R3KA 1KJ2A 4P23C 1E27A 4XB7A 5DVNA 1RVFL 2FZ3A 4CDHA 2YMXL 3C6LB 2GFTA 2OR9L 1DEEA 1WT5A 5FL1A 2F7PA 4JEGB 5A43C 5I3DA 4P46A 5C0CE 5B3JE 2R23B 3D25A 3POCA 3FQNA 2DQEH 3BYYA 5ABDE 1I7RB 1R8LA 3RDKA 1NSNL 3RY6A 3C2AH 5MERB 4NYLB 3WH7A 3X11A 3UR8A 4I2XE 5KOVC 5IHBA 1AD9B 1XR8B 3O45B 4F9PA 2W9DH 4OZHE 1W3JA 3QEUB 3GNMH 4WY7H 1T5WB 4EBQL 5CSBA 3MJ7B 1MJUH 3AMKA 1QVOA 3M7SA 4Q2ZA 4GW5A 5JOFB 3A67L 3P2TA 5GS3A 1VSCA 4LAQH 3CFEA 2QL1A 3MMUA 1XCQA 3F7YA 4MZ2A 3L6FA 3GRWA 5DFVD 1B3XA 3V6FA 3UTTE 4NQUA 5IUSA 3G6JE 4NKIH 1HKIA 2YK1L 5JUEL 2WWDA 2K7PA 4RFOL 1DVFA 5DSCA 2VDNL 1T6VN 1NWUA 2YL6A 3MLYL 2F8VA 3BXNA 5I1HL 5JA9A 5FEBA 3TBYA 5DVKA 5AUMB 4CL7A 1KCSL 2W0FA 3O3EB 1AY1L 3OQ3B 1Y6MR 2D0GA 4YBQD 4ZE4A 3WXVL 5CPTA 1A9EA 1E15A 4ZG1A 3HZVB 2JCCF 3CDGA 5FOOA 1MH5B 4N0YH 1MHPL 4W70A 5A69A 1QKZL 5DJ0A 3B83A 3PQYD 3MV7E 1OIFA 3FRPG 5E8NB 3GSVB 2VDKL 3N9GL 5D7LB 4P99A 5C6TL 4LCUA 4NRZA 5IJKC 3CLFH 3K2UH 5CGYC 1HTYA 2IGFH 3DXAA 2XICA 3ILQD 4GKSB 1JGEB 3SJVB 5KSAA 2JCCB 1RUAL 3C6SB 3P4MA 1B1YA 5ABHA 3CMGA 3TC9A 2QHRH 3UTTD 1X5YA 3FQWA 5IB2B 2XG9A 4CJ0A 1MQQA 2VQ1A 4K3EH 2DDXA 5EU4A 5FAAA 3CFDA 4HQQH 2O9PA 4RQQA 4W89A 2G8ZA 3VFRB 3GMLA 2YPKA 2ARWA 3BJ91 5E5MA 4U3HA 4AQOA 5ITFA 4PRNB 3QUXB 3OHXA 3DO3A 5KW9L 1J0KA 1FIGH 4I3GA 1YY8A 2OP4H 3C5SB 4X5LA 4LCWE 1WISA 3MV7D 3O0RL 5L7XL 4HWUA 5E1AA 3BIAX 1REIA 3DMMA 4G5ZH 1ZB5A 1KTLA 4S0SD 5FGBA 5J4MA 1N5YH 3OKKA 2DQHL 3P0YH 2BMKB 3I9GH 4GBXD 4Y88A 2UZXB 3JVGA 1JNHA 2BVOB 1UQZA 2WBGA 1O7SA 5K9OA 1KT2A 4TOQA 2RJMA 2VAAA 1KR0A 3MRKB 1NGZB 3G5XA 1C5BH 1I1AC 4P9HC 5DJZB 5DRXA 5LA2A 1J11A 3ARBA 5FIEA 1GPOH 2VX7A 4U7SA 2BCKA 3GMMA 5IWLC 3GSOB 2TAAA 2X2JA 3W29A 3BZDA 4KHTH 2BFVH 5I8KL 4JJ5B 5I76A 1W0VB 5B39A 4AISA 3DX7A 3LXAA 3ZTNH 2GK2A 3CFKA 4ACYA 5IP4A 4QYOB 2IPKA 2X41A 3F8UB 2EYSB 4O51A 1MW0A 2A73A 5FKAB 1K9TA 3GBNH 3RWHA 5DMGC 1FO0B 4QWWD 4Y16A 4R8WL 2H6PB 2W1NA 3UG4A 1NFDF 2VDMH 1ADQA 4LHUG 2OTUA 4IOSD 5AEAA 4ELKA 1O7AA 3RUGE 3IJHA 3TV3L 3S5ZA 2DTMH 5D1QD 2A6DA 3UJJH 3TFKC 5BWFA 4TRPL 4KUCD 3HS0A 2AW2A 5BXTA 1QWNA 1NFDB 4GMTH 3A47A 3D0LB 1F11A 4YHNB 3TA9A 3SEPA 2F74B 4ZUVA 4AM0A 4JDVB 4X6EB 3CUFA 1NGQL 1MXGA 3QXDB 1FFOA 4H20H 2J8UA 4J6RL 4JM4H 5EZLA 1ZS8B 3L7FB 4PRID 2OQJB 2XWBA 5DYOB 1A7OH 3QSKB 1TCRB 3CDCA 4PBXA 4WVRA 2K9UA 4PJ9A 5HHVL 3ZYIA 1JD9A 3U0WL 4UQDA 4PIRF 3WIIH 3ZYZA 2EXOA 1S9VA 4QHNA 5F1KC 4CKVX 3TV8A 2HN7B 3EYFA 1B88A 2JE8A 3EYUL 3UO1H 4RE4A 3LRSA 1BWMA 2VQTA 1JN6A 2Z1KA 5C09D 3TYGL 1A4KA 2Y23A 2X4QA 1MCPL 1FN4A 2PNDA 2X4SA 1P6AB 2D9QB 3QUML 3SDXA 1E43A 4NQEA 2M1KA 3VXMA 3F4VA 5EZOL 1RU9L 4RMTA 4BA0A 1R5WA 2XZAH 3H42H 4ODWB 4ETYA 1X3DA 1ZSDB 4GT7A 3ZJ8A 4OFVA 1LGVA 2F5BH 3GZKA 1OOAA 3FQTB 1XRVA 5DD3L 3QH3B 5C0AB 2XYCA 4LSDA 3NPSC 3EDJA 5IMOA 3SKNA 3W39A 5E5RB 2X89A 5MEPB 2W62A 2D4FA 1TZGL 2DN7A 1WAAE 5T1KA 1WZAA 3EOBA 1ONQB 3V5DB 1KJVB 3Q6GH 3HPLB 3TN0B 4Z78B 3TESA 3WD1A 4MQ7A 3HMXL 1TMQA 1CXKA 3QEQB 1G0XA 3ILPA 4FABH 1UVQB 2XWJA 3VG9B 3SE8L 5CINH 2BVQA 1CGVA 2PTUA 4WW1B 3RVTD 4HFUL 4LSTH 1DUYA 1BTCA 3AISA 1YC7A 2A2QT 3NZHL 4H0GA 1CFVL 5GGVL 4P7LA 4H7VA 2WBJD 3LDBC 2DMBA 3BPOC 1T1XB 1UYQA 1I8IA 4APQC 1AR2A 3JWDL 3VFPA 1QTYT 1T4KA 3MUJA 1CFQB 1VDGA 4K3DL 4RMSA 4CN1A 2YDRA 3NACL 1T5XB 3QUYD 1ZHBA 3SGKC 1FDLL 3UMTA 5E1HB 2GAZA 1RZKL 3WLBB 1W1VA 1JPST 4AIXA 1YUHA 5A2IH 5JR1H 2Z31B 3PNWA 4QHUA 4EZMA 1LK3H 1VKXB 1MLBA 5D6DC 1IJ9A 1QOXA 2MPAL 3FO9A 5BW7C 1TVPA 4PJEA 5C9JB 1B2WH 1CDGA 4F9LA 1UWTA 1IM3A 2OMNA 4IRJB 1AO7E 1T7YA 2XKUA 3DYOA 2W65A 1BYAA 3OMZA 3QUZB 3EYVA 3IAPA 1ZWIB 4WSKA 3PXJA 4GIAA 1YEFH 2GITB 3N13A 4UNUA 5DVMA 4EOWL 3S3PA 1KNOB 1I3RB 4MB3A 2IBBA 5DXWA 4D3CL 4F3FB 1J8HE 1NFIA 4S1SL 4NZRL 4AH2B 4PB9L 3KLAB 5I6XB 3QEHB 4P3CH 1U33A 4UFKA 4ZNEE 1G7QA 1DWFM 1P7KB 2G3MA 3VM7A 2VN4A 4JFOA 5LGHL 2F19L 1MW1A 3P0VH 4J7RA 3RM8A 1QG3A 2OI9C 5DVLA 3BT2L 1ED3B 3JUYA 3DVIA 4R90H 1F42A 5GS0H 5IKCA 5L8KB 2G3NA 5HYEA 1U9KA 3F65A 1XZ0A 5TD4A 3IXTA 3MLUH 3VFVA 5D8ZA 3KJ4B 3ZOAA 1XYFA 4F7PB 2DIBA 2ZCLH 4MS8D 1JFQL 3TF7C 3WEZA 2BOBB 4WHDA 1CDJA 5A40E 3T0EE 5TQ2H 4HPYL 2J8OA 2BXZA 4YFDB 4X0VA 5E2JA 1BOGA 4NQSB 4YK4B 2E7HA 1J9CT 2HLAA 2CLRA 3WKML 3MROA 1V5JA 1ADQH 2VRKA 2NR6C 3WEXA 3O41B 2O5XH 4ZXBB 1GYAA 3V0WL 1EXUA 4DOHE 1PEZA 3MV01 4C83A 3ARDA 1HQ4B 4LARH 1DN0A 4LPTA 3PZ9A 1VBUA 3KPNA 1TZIA 3F58L 5E9DA 1OSPL 1GOHA 1YEJH 4TX6A 3L5WA 1PBGA 4DQOH 3C6LD 3GKZA 5KAQF 4TUJB 3N1QC 4ATWA 2EXWC 1E9LA 4JDTH 4FQ2H 5HHOB 5AC4A 4ZFGL 3VXQA 2W63A 4PUBH 1F58H 5E2UH 5LXGH 5I8CB 2ICEA 2E6JA 5TE4H 1PIGA 1GZQB 4LSRH 4CDGC 2X9WA 1TPXC 4JGMA 3T0ED 4Y2DA 3QOKA 4FNTA 4K7FB 1HCFX 5D7LE 4L8SC 1R3HB 1QFWM 1T03L 1RZFL 2V2WA 3D0VB 2YA2A 2JCCE 5J3HC 5FGRA 1G6RB 4XC3H 1QYGH 4JY5L 3KR3H 1O0VA 1I3UA 4OGAC 3OJ2C 5EFDA 3PWUB 2YA0A 4NO3A 2H1PH 4Y4HB 3HRZA 4FQHA 2ICWI 5CBAA 4LKCA 2YD8A 4BSVB 4TVDA 1ZT7B 4XBEL 3KYKL 1FH5H 4LPCA 4ISVA 3VWJA 2V17H 3KXFB 5CUSL 3UTPD 2QPSA 3NCOA 3L2MA 5DT1H 1HHGB 4ZDHA 2CDFA 4UNIA 1UM6H 4D0BA 3CVHB 5ANME 1MCDA 1FP9A 3RX8A 2E5EA 3ULVC 1RIHH 4ZUUB 4MYWB 1HINL 3O6ML 2HVJB 5KANG 3WH9A 1N0XH 1OD8A 2EPLX 5AD0B 5L2JA 5IOPB 4POYA 5D7LD 2CLVA 4QXGL 2PCPA 5I78A 3FO1A 3I6KB 4ZOBA 1GC1C 3SJVD 3PGDB 4ODXA 3SDDD 1LMKA 2I07B 2J8FA 4Q9CA 3CLEH 4P59L 4PGZA 4OZGF 3RL1B 2ADGA 3VD3A 1GOGA 2NY4D 3GMQB 3AMDA 3W0WA 2I27N 5GGUA 1M53A 3O6FB 1F4XL 3I02A 4EI5B 1MFBH 5IW1B 3CSPA 4X6CA 4IBLT 3FQRB 4TXEA 5SV3A 1E4WH 3MCKB 1FRGL 1VERA 3QWOA 4G9FA 4ERSL 1RHFA 1S9XB 3F12A 4OZGB 2H32B 5LBSH 3BCFA 5CEYB 3TO4D 4ORGB 1OP9A 3QDGA 4XP6H 1E6NA 1WEJL 3MJ9A 4P9MH 1L7TL 1UH4A 4D0DB 3QUXD 1IFHL 5GGQH 3O8XA 2OMBA 1K2DA 4LF3B 1NJ9A 1ZHKA 2A6IB 2CIIA 4G8EA 4LGPB 1MCBA 3MRJA 1RUQH 4HS3B 2WINA 2EZ0D 2H8PA 5EBMB 2YFNA 2ZG3A 5FB8A 4FTVA 1VGKA 3JUZA 5CJOL 1CU4L 4LQFL 3WDQA 3U7YL 1MQ8A 2Y36H 5IGXH 1UACL 1S46A 4GS7C 2VITB 4DVRH 1EIBA 2F53B 4X7EC 3ALXA 4JANB 3V6OE 4FRWA 5FOJA 1OT1A 4WWKB 2BNRE 2EC8A 4I18A 1W3LA 4EDWL 4HWZA 5F89B 3P4LA 2V9QA 4XUYA 1FZKA 4E0RB 3VFWB 3ZHLA 3BKYL 3HUJE 3KPSA 3O6AA 2IFGA 2Q7YB 4HKJB 4XBGB 5C0BB 3UBXG 1BBJA 3TEUA 3BVTA 1G9ML 4PD4K 2C7FA 3UPCA 3NUKA 5INDA 2HKHL 3O6LL 5F1IB 1EOKA 4EKXA 5CSUA 3QFJE 2HTLC 4OZFH 5BO1L 1INDH 1LG2A 2EDDA 3MBED 3DJ9A 4V2BA 4AY1A 4Z7UE 4YXHH 5IFAH 4ETQA 1EJ6A 1IC4H 3T08A 1KB3A 2WUCL 2QKIB 1ESWA 2AEQH 4ONHA 3OB0H 1SJEB 4G3YL 4X9IA 3TP4A 1A7PH 1W1PA 4Z0BL 3VW3H 4KI5C 1U58A 1W72A 1J0JA 1N5AA 4PRDB 3N1AA 4X98A 2R4RL 4NGHH 3OSKA 4HIEA 4IHOA 2DAVA 3AHVA 5F9OH 2FSEA 2DQIL 1SVCP 4FFZH 2A3CA 4WCYH 4M7JL 3BRFA 1KPRB 2A6JA 4CAGA 2HJKA 5EZIL 3MRQA 3MFGB 2UY7A 4YDVB 5J1SC 2E7LC 1FGNL 3E8UL 4QNPF 3C60A 3F7PC 1WICA 1H3PH 2OJZH 3D51A 3HMWL 3PTQA 4Z2JA 2OS7A 3FOLB 2RHEA 1A1MB 2GTWA 1BSIA 4KDTC 4V28A 4GKOA 4X7SH 4JFDA 2NXZC 3HI5H 5ALCH 1UKOA 2EYTB 2XKNA 3IK2A 1YJDH 3OJDA 1YMMA 5C0AD 5EDXA 2R39A 2DM7A 5TFSL 3ZL4H 1VADB 3PP4L 2R1YB 2YSSA 3N85L 8CGTA 1JAEA 3WY4A 4YDLC 2O5ZH 4F33A 4U6XB 3QIBC 3ZE2F 5KVEH 2GT9A 1BF2A 4CVXB 1R3LA 3TN0D 2VERN 5E1QA 3VIKA 1JPSH 3NFNA 1N82A 1UCBL 2Z35A 4WV1A 3QEQD 4OCYH 2J79A 4JZNA 1CGTA 2GUYA 2KL6A 3WBDA 4MXWL 5E2WL 5KTEL 1UA7A 3FN3A 1J1XL 5BZWB 4LNVA 3TH2T 1QFUL 2VRQA 2ATPA 2ZUVA 1I9IL 4HPOL 3TIDA 1J9YA 4YWGL 3NBNA 3WENA 4PJGE 3NTCH 4PLOB 4NNPH 1QLRB 3H3PL 1L4IA 3DRTA 3UR7A 4JB9L 4YE4H 2HT3D 2XY2A 4H8UA 2CGRL 4E41E 1RJLA 2AI0L 2DYPB 4LKXB 2VLJA 5DJ8B 1V05A 2PTTA 5GGVY 2F7OA 4W7UA 5GRUL 2C26A 3PDOB 4F7CB 1U8QB 2QSTA 1JD7A 4PGDB 4DW2H 1O7DC 3ZDYF 1BGAA 4K9EL 2GFBA 3WCYA 5FDWB 3I3EA 2Z31D 4UIMB 1IGYA 4GLRI 3QDJA 3BEWA 5FYLH 4D6GA 5JBFA 2WWKT 2Y25A 4OLWL 4RCAA 4U6TA 5JHLH 2AV7A 2FD6L 4KV5F 3EDFA 2I25N 4XRCA 3MTRA 1KQYA 4W8BA 3DETC 2HKFH 2G75B 4IRJD 3IKCA 1TJHH 4G8GB 4OJFH 4YHIB 3MSPA 3OG4B 4QRRB 3T2OA 3W2DL 1HKLH 4QOKB 4KUZH 5A95A 3QUZD 4HCRA 3ES6A 3E3QE 4U1JA 3FJTA 3RGHA 4JRWA 4ZXOA 1YQVL 1T66C 4LLQA 4OIAA 1OLLA 3VD5A 3KPOB 1DWAM 1AHWA 4RFNC 3KE0A 1YNTB 2X70B 3RWEB 1JTTA 1ZANL 3NFSH 2OM5A 4QRUB 4Z0XA 2NW3B 4HPGA 4TOYL 1DLHB 1MRFL 1WFNA 4LMQE 1LILA 1X4YA 4PBVC 3GSQB 3VJ6A 2AERT 3SKMA 5L8JB 3CCHB 1N6VA 1FO0L 4QHMA 3ZZ1A 3IS0X 1OM0A 1UJTA 1HI6B 5F21B 4R96A 5F1NA 3GHBL 4TSCH 3PL6B 4P4KC 2P5EB 4G6MH 1MJJB 1MHCB 4Q7DA 1ZMYA 2KH2B 3PV6A 4GRLA 2VZSA 4RAVA 3AIRA 3FQUB 1HJVA 4KQ3H 5F7YC 2YR3A 5FFLA 1C8XA 4OFPA 5D9PA 1YYLH 5DC4B 4Z95L 4LDOB 5CKGA 5CP3A 3IJSA 3O6KL 3WH6A 1CBGA 5ADOL 5C8JB 2VRAA 1VPOL 2YRZA 1JGUL 1ES0A 4NZDA 5C86A 1KQZA 2IQAA 4AZ8A 4AD1A 2X4PB 4ZXBD 2V38A 1Z2KA 3F5LA 5GS1A 2C7UA 5C6WH 3D18B 1NOFA 5FKPB 4ELMA 3BH9A 4WIQA 5L2KB 1KWGA 4QGYA 3L3HA 1FVCA 4XVUD 3S4SG 3N04A 4LVOB 4DZBA 2VVSA 1IARB 4RA0C 3KXFE 4YX2H 1XR9A 1S3KH 2KPNA 1HZHH 3GM0A 1MVYA 1NAKL 5HHOD 1CT8A 1S7TB 3QO1A 1Q72L 4WFFD 4FQCH 4U1HB 4LSVH 2VLMD 5JPMA 5JNYA 3CZKA 3R8QA 4BH7B 1QBLL 5DUPH 3SCSA 5GZOD 3B9DA 2VXQL 2Y72A 3X13B 1W72H 4XVTH 1F4HA 3SBWC 3GIZL 2WZIA 3EO1B 2R0ZH 5BXPA 4EXKA 1V3LA 3WFDH 3S3SA 4FMKA 1QSFB 3O4LA 1A3LL 1JP5A 3PWNB 4YBLC 4YGAB 1G0CA 5CBEB 4EUPG 5HBBA 3JBG7 3PTMA 1KB5B 1RHHB 2WZPD 2XA8L 3GO1L 4PP1D 3QPXL 1SYSA 4X99B 4P5TC 1H2JA 2NPLX 2R0KH 3QPQD 4Y4HD 5IK3A 1A6WH 2C4FT 1I1YB 2EEAA 3U2SA 2IMNA 2HFEB 5MHSE 1A0QL 5E8DL 3MNWA 3KXFD 3C08L 1R3JB 1CD8A 3SKUD 1QLFB 1D2KA 1H15B 4FZEL 4BFIA 2PO6A 3PGFH 5CMAA 3RNQB 1HN1A 2XPGB 3WJLA 2YD9A 1CBVH 1TA3B 4WU7B 5JIWA 3SCNA 3O2WH 5IQ9B 4Y4KC 4KK5D 3N11A 9CGTA 1QR1A 4ONOA 4JPKH 5IVXE 3TPUA 1PX8A 2IAMC 2W67A 1FHDA 5IHUL 3DUHA 1M6OA 4JZOB 5D2NA 2OK0L 3WKNA 2CITA 3T65A 3MV11 4K2UH 5BJTA 1FG9C 2FHCA 3WD5H 4UIKL 3LZFL 3RAJL 1HH9A 1X5LA 3QDGE 1NEZB 2ZNXA 3O6FD 1BX2B 4Z7OF 1FBIL 5JQ6H 4EI5D 1W9BM 1M7XA 5A6SA 4OT1H 3CZFA 4KKNA 4FOMA 1SEQL 4M00A 3TYFA 1GXEA 1T1WA 1CFNA 1XGRB 3TGXA 5L88L 3VX1A 4XP5H 1FORL 1MWAB 3GUTA 3S36L 1NAMH 3GSNB 2BSSB 2COQA 1OAQH 4PRAB 4LU5L 2BXYA 1DQDL 3UTQB 1G84A 4V27A 1S7XB 1RMFH 3NA4A 4PREA 4PSPA 4OOZA 1NUDA 3REWB 3IB4A 2EIEA 1OP5K 4NQCB 4I3RH 4HUVA 1Q9LA 1RH9A 1KGXA 3RPMA 5H35B 5HY9A 1KLGB 4BUHA 1QNOA 2CHOA 2CJUL 4XHQA 5GSRB 2C8NA 4JQIH 3ZKMD 4WW2B 3GHEL 3S35L 3JV6B 1IGTA 1ITXA 3VXPB 3OR6B 5JMRA 3SDAD 4A6YA 4N0UA 3ULSB 2ERJB 3IVKA 3BVNB 4IOIA 4XTRC 3ISWA 1H3XA 3OG6B 1UG9A 2F53D 3FT4A 2EXYC 4AEHL 4J23A 4H8HA 2HWZL 4X6FA 1Q9KA 2P42B 4U05A 3D69A 3QJHA 4WWKD 4UBDD 1D6VH 4UINL 5D8WA 3Q6FB 4I4WA 4OGYH 1GSMA 1ODUA 5MEQB 4L4TA 4NZFA 5I74C 2P46B 1TJIH 4W4NA 4RGNC 3MR9B 5DK2B 3Q5YA 4NCC1 2Q20A 4OLYH 5DJ6B 3LPGA 2WVUA 1CDCA 5C0BD 2B5IB 1BM3L 3CSYA 2VX5A 4YXLL 1OT2A 2VX6A 4XNYL 1KJ3H 15C8L 1U91A 3OXRA 4TNWK 2NY6B 2VLKB 3RJDA 3G04B 4I9WE 5CIPB 3S35X 2WZEA 4MAYB 1A7BA 2UY5A 4M6MH 1CICC 5F7MC 3QI9B 2GJXB 4NNYA 1BG4A 3LMYA 3W24A 4UQ3B 3MV9A 3W9DB 1KTDB 4WI8A 5CP3H 1FFQA 5BRZA 4JQVC 1ZLVK 3VRJA 1IAKB 1MIMH 2AABH 2RGLA 4LVEA 4PJFF 5C0IA 1Q0YL 4S1QL 5ABEA 5LQBL 2X2HA 5I75B 3VGFA 4U3CA 3U46A 1QA9B 2E7MA 4LVNB 4DWSC 4W4OA 1A3RH 5FK9A 3U79A 4HXBL 5CD3A 1OP3H 3AFBA 2UVEA 3SCWA 4RGMB 3GI9H 4PY8I 4OOUA 1JNNH 4WNQA 3SGJA 4UDUA 4JFVA 2ZUUA 1PKOA 4G8IA 3DVNA 4P2QB 4WKFA 2PYEA 3TCLB 1F45A 1V08A 1G6RL 4XNMB 4ENED 4QCFA 4I9WD 5SX4H 4R9HA 2EICA 4KK6C 2XT1B 1TTGA 3CXHJ 3RWJA 4HZ6A 3VKKA 4MQXD 5IM7B 4DVBA 2XN2A 5LGJA 1UGNA 2FL5A 2GW5A 3T4AA 2YD4A 1C93A 5D1XA 5DS8A 3EMZA 3LKNB 3BKCL 3NAAH 2DBLH 4LCCA 1T0NA 1BYCA 2OXGA 2GJRA 2H3NA 2UUDH 5F93C 4XPFL 3TZVB 2A38A 2DLFL 4OF6A 1KIPB 4Y2OA 5K9KA 3BAYA 1LE9A 4Y5VB 1WDPA 2HRPH 3WMBA 3WFHA 4O2EA 1HKMA 3LPOA 1D5BB 5I1LA 4D72A 4G8FA 1QWUA 5D7JA 4MD0A 1K5NB 5DGRA 1AGCB 1EEYB 3HE7A 4L1HA 3S88H 2OSWA 4QRRE 5GSVB 4NIKB 3CFBA 3NGBC 1KCVL 5E00B 2WW8A 4X9HA 3BC9A 4NZUL 3RIFK 1NP0A 4UCFA 1ORSA 2VRJA 1ISWA 5DQJA 1R87A 1RZ8A 5CFHA 3MCLL 4NT6A 3GKWL 4RAUA 5DHYB 1OWWA 4OM0L 2DYPD 3T3PF 4PJ5B 4E9LA 1B0IA 5B21A 5DMJB 1N26A 2BVDA 4KZDH 5AYUH 2OYLA 1CWVA 2D3LA 3SGDH 2EO1A 1KLUA 4R4ND 4UOW0 3EDKA 3TH4T 2V2TA 1UXWA 5J12C 4BQ6A 2QV2A 3VGGA 4ZUSA 1ZGLM 4FNPA 4QHLB 4FQIL 2P5EE 2DWDA 3L4YA 1YC8A 5MP6H 4CD7A 2PR4H 1H1NA 3FRPA 2NTFB 5C0EA 4OIBA 4ZAKA 4EN3C 2EDWA 4O9HL 2BSTA 4LMQI 2Z4QA 4M43H 3I6LE 4G8GD 3SUVA 4QRRD 4M1DH 3I6GB 4LLDA 4ZFZA 2GI7A 1JK8A 1YMHB 4WO4A 4F7EA 2AJYL 2ZX5A 4LP4A 5J7CC 3U1SH 1YN6B 1QQDA 2AQ3A 5BRQA 3VRLF 4LYPA 4HUUB 5CWSA 5EN2B 3LMJH 1HK6A 2BNUA 4P3DA 3K80A 1C12B 1XH3A 3APGA 3T2QA 3U82B 3B2VL 1HIMH 3EYQC 3K1DA 2FGWH 4X6DE 4A6YH 1H5BC 3PL6D 2CR3A 2P5ED 1UQSB 2DLGA 4YQXH 3BDYL 2HTKC 1R3KB 1HXYB 1PZ5B 4Z9KB 1R7AA 1KJ2B 5DJAA 4XT1C 5EOCL 5LAXA 4BQBA 1NBZA 4N68A 5CZVL 1ZA6B 2CO6B 4WEUD 2YUZA 3OGSA 3S3JA 1NC4A 3PP3H 1EVUA 3RIKA 1QNQA 4P46B 5DQDL 1QSFE 3RNKA 2D24A 3D25B 2XRAH 4AEIL 3WO3B 1NOUA 4DO5A 3FQNB 1XC6A 2NY1C 3BUYA 4IUGA 4N5UA 3BEVA 3X11B 5EOTB 4YHPA 5F7EH 4HLJA 3ARGB 3H9SA 4CVZA 4G6AD 3MLZH 4WU5B 5L2KD 4U3AA 1OPGL 1IM9B 2DL2A 1E3XA 4M3KB 3EAKA 4Q74A 3BSHA 1UR8A 1YYMH 2Q6WA 1RI8A 1T04A 4Q2ZB 2D22A 4GW5B 4WUKH 1S7UB 1WQVT 5E99L 2VDOH 2R8SH 1DANT 4H5SA 2P5WE 3RVWD 3OF6A 2X7LA 3CFEB 1E6OH 1KENL 1XCQB 2VAJA 3L6FB 1TJGH 4LFHD 2F9BT 4LHUA 1N59A 1KCUH 3KJ6L 3QXUA 3V6FB 1N6QH 4KRTA 4AIZB 5IV2A 3O3AB 1C7SA 5A16B 5CGTA 1DVFB 1QOKA 3EGSB 3IDJA 4U1SA 3V8CA 2EE3A 2DQGH 2EH7H 1HT6A 1QSFD 4P23A 4P3WA 2QHAA 3QRGL 4GSDL 2W0FB 1KIRA 3BPNB 4PJHF 5I9QB 1MY7A 3WXWL 1OWRM 5ADPL 1UR1A 3CDGB 3KDMB 4RISH 5DJ0B 1A64A 3A24A 4NQTA 5ECUA 3PWJA 2EDRA 4LCUB 4NRZB 2DKUA 1KCRH 2VC2H 2ADIA 4M7LT 4PJHB 1H0IA 1KOAA 1OARL 5AZ2H 3KPLB 4M7ZB 4NBXB 5I1IL 3AB0C 1JNJA 1ZAGA 5KN5B 3LKRA 2PW2B 2R29H 1KTCA 3FQWB 5DFVC 2J1KA 1IGFH 1GOIA 5GRYA 3KPPA 5EU4B 2E9LA 5HGAB 4JHWH 3DX4A 5D9MA 1ZXQA 3CFDB 4K8RD 4KI1A 4XBPA 5A8QA 4RQQB 1OAZH 5I1EL 3IETA 2YPKB 4Y5YC 1XF3B 3W6LA 1AQ0A 3OKDA 2C1PA 5SWZE 4B3LA 2DQDL 3OHXB 4UQBA 4R2GB 1JL8A 3ZO0A 1JFHA 1I85C 4KTEL 4YBQC 5D71L 1YY8B 3QEGH 1F6FB 1OIMA 5FXCH 2X44D 4B53A 1EGJA 3GNPA 5E1AB 3DMMB 1KTLB 4UV4H 3OKKB 1ORQA 1MAKA 4RL3A 4AENA 12E8L 4PGCA 1X44A 4AMKL 2GY7B 4OD3L 1JNHB 1IGMH 5K9OB 4AXNA 4LSSL 4ORZC 1I1FA 2VAAB 4N1CA 3V7MA 1SJXA 1K8DA 3G5XB 3ILQC 4TQEL 4JREB 3DX8A 3ROOA 3L3KB 5IJKA 1FSKB 1OAUH 5DJYA 4FQJL 4LSQL 4AJ0A 1RZJL 3UC0H 1A7NL 3AS0A 5HDQL 3NCCB 3GMMB 3L3JB 3U9UA 3BAJA 4QTIH 1CVSC 4NQCD 5JW5B 2QLYA 4J8RA 5I76B 2BS9A 2YL5A 5B39B 3JWDC 2G5BA 3DX7B 4LQ1A 3ZE0F 1FL5B 2WPGA 2VLKE 3CFKB 3UEQA 4UZUA 2IPKB 3C09C 3BUBA 4O51B 2CKSA 3RWHB 1XGQA 3SCTA 4Y16B 2Z9TA 1U8NA 1RZKC 1GIGL 3OKMA 5JA8B 1S9YA 2OTUB 3P30H 3W5NA 8FABB 5DLML 5ENWA 1RIVL 3RIFF 3IJHB 1GGUA 2AKRA 2J8UF 3GDBA 1LO2L 2A6DB 3BDXA 2FHBA 4Z2LA 4GQPH 4M6OL 5DRZA 3K8MA 5EO1A 4GBXC 3UYRH 1C5DA 5F9WC 3C8KA 1F11B 4ZOCA 4QCIA 2PWDA 1SHMA 4KVNL 1PG7H 5C08B 1G9NH 1XCWA 4ZUVB 1E4MM 3WQ6A 3H55A 1NCTA 2FX7L 8A3HA 2J8UB 2GJZB 3S8WA 1IGJB 5EZLB 3KLHD 2XWBB 4JO2L 1ZHLA 1WWWX 2D4DA 1I1AA 3P11L 2ZUQB 3MV9E 3GXNA 1XAUA 2NY6D 3C5ZB 5FO7A 2VLKD 2B20A 5SWSB 2FGZA 3SDXF 1W0YT 4R97C 4MAYD 4JFEE 1LL6A 1UM4H 1BVNP 2HFGL 3EYFB 3LIZH 1P1ZA 1MCLA 4E5XA 4QWWC 2DSZA 3LRSB 4MWFA 1BQCA 4D6JA 4IDJL 3PWLA 2J7HA 1A4KB 4YUEL 4PJBA 4S10A 1FN4B 5GZND 3SDXB 4YHKH 4NQEB 3BD5A 4OBRA 5D1QC 4G80B 2UWFA 2FECL 5TE7L 3VXOA 4LYRA 4W7VA 1G7JB 1DQJA 4KK9D 1R5WB 1NGXA 4BZ1L 3A6BH 4I5BB 1I9RH 4PTTA 1IC5H 2Q86A 1BZ9A 3V6BR 3MRLA 2AJSH 3GB7A 4NP4L 1FL3A 3INUH 3ROLA 1C08B 1H4PA 4LLVA 2XYLA 4MNGB 3VWKB 2RGMA 5IVOA 2YIHA 1N8ZB 1HILA 1LK2B 5I1GL 4P2QD 4F7MB 5T1KB 1MHEA 1EO8L 3KYAA 3UAJD 1KB5L 3EOBB 3FMGL 4GAYB 4M1CD 4MQ7B 4HZAA 3OZ9H 2E40A 1UCTA 2MHAA 4LX4A 5IB5A 1M4KA 3ILPB 2XWJB 2Q8XA 3BVWA 1PKQB 3BSGA 3LEXA 2BVQB 2A3HA 3KNBB 4F15B 4WFHE 1MCOH 1I8LC 4PJ5E 1UT9A 2AXGB 2VCCA 3WN5C 4JFPA 3T1FB 4NHUA 4N9GB 4KGJA 3BH4A 3TZVD 2CYGA 4M61B 2BNJA 3BOVA 1H3TA 4HH9A 3D39E 1I8IB 4P4RB 2VXVH 4NHCL 3RKPA 3VFPB 1X5IA 3MV8B 4QRTA 4MVBD 4FK9A 5LYRA 4JRYB 4K8RL 1NQBA 4XP9L 5AY7A 5A8NA 4ML4A 3W38A 4YXKL 1TETL 1MFDL 5FGSA 2GAZB 2H2PD 5K59E 2IXUA 3Q0HA 3IRPX 1EERB 1IGIH 2V2XA 3PNWB 1ZA3A 4QHUB 1E4NA 1MLBB 3WE6A 1D5MA 1BBDH 2V6HA 3LS5H 2XZQL 1BFNA 2DB8A 4HJJH 2FJGA 1KIUA 3LPWA 4O02L 3V4UL 2B1AL 4PJCF 1IM3B 5AYQA 4WFHD 4PJ5D 1Q6GA 43CAA 1KELL 3QQNA 2W65B 1MWAL 3LV3B 1YNKL 1P5UA 4YDIH 4PJAA 5ITBH 1CLOL 3RVTC 5JXED 3GSNL 2VX4A 1NH6A 2V7NB 4NN6C 1LHZA 5HDBF 2XPKA 4JAMA 3BP5A 2FB4H 4C4KO 4PJCB 5LKNA 2VYRE 2WBJC 4G43B 2GEEA 5FKYA 4D2NA 3IKKA 4JY6B 4MNQB 1U92B 4HKBA 5C3LD 3MNZA 4JFOB 1VFBA 1PYWA 1WIPA 3EOTH 4ESKA 1PD6A 4HX1A 1GQIA 1P4BL 3BWUC 1ECEA 1QACA 2B1HH 3QUYC 3BKMH 1I75A 4PCTA 5KSVA 1XZ0B 5T1DL 3BIBX 5FO8A 3ELAT 4D94A 1INQB 3VFVB 3Q2CA 4L4OA 4N0FA 1B3JA 3SGKA 4F9DA 4UB0H 4HC1A 5DJXA 4PEEA 2FECI 1W9DM 4NO2A 4OCWL 5IMLA 5J1TC 4AW7A 2AGJH 2OL3H 3HC3H 3U30C 5BW7A 1QI4A 2HLAB 2ZX9A 3MROB 4XCCL 3RQ3A 2IQ9L 4NC1E 4Y5XA 1IEBB 2R0LH 1EXUB 4Z76B 5D7SL 4C83B 3LKSB 1A14H 1DN0B 4DWHA 1TZIB 2QPUA 2P4AB 5DF0A 5E9DB 2LU4A 2FEDD 4MXQD 5CEXA 3L5WB 1BVKA 3EO9L 3THDA 5I30L 4OSUH 2QJDA 4DN4H 2BNQB 2KZ1B 3LKQA 1UA6L 4X4MA 4PMYA 3HN3A 1VFFA 3G6DL 3NABH 3VGHA 1SJHA 3TA3B 1NDMA 4L8BB 2A6KA 4HIHB 1VGEL 1BQLH 3VXQB 4XHJD 2V5RA 1IAIL 1NGWA 2X9XA 1KN4H 3RWGA 1FNFA 1BEYL 3ZKXB 3VFSA 4P9HH 3S96A 4MS8C 3ARGD 5D7KE 1JHLH 3VO0A 3VGAB 1YEKH 3RVVD 2DQJL 1S5HA 1W9VA 2X4TA 3GMPB 1ZJAA 3EO0A 1IM9D 4ZD3L 4XPTL 2J4WH 3SQOH 1CE1L 3VIOA 5FCZA 1B3VA 4PJHE 2V2WB 4HUWA 1A9BB 4X0KA 2OX5A 4MJIE 2AEPH 4H0HB 4QXWA 1G9MC 4M7LH 3AVEA 4YIQA 3CU7A 3U6RA 3I50L 4NO3B 1P7QD 5M7QA 4KAQH 4FQHB 1Q8MA 5CBAB 1U8OA 2DQCL 4LKCB 4GMSL 1Z9OA 4M3JA 1DVFD 4AD5A 1GONA 1YN7A 3C6LC 4XNXL 4PJ8B 4ZDHB 2CDFB 4I0CC 3VXRB 1J0YA 3SCRA 3UX9B 3TVMB 3OGCA 5FDYA 4D0BB 4W8LA 1ITBB 3H9HA 2CEQA 4BKLA 1DJSA 3C87A 5ECJE 4OM1L 4XP1H 5GNXA 2WMIA 5EG6C 3SGDI 3AYRA 3F5KA 3RZCB 1P7HL 3HG2A 2R2BA 3T0EC 5IG7B 5JHDA 2HJLA 1GNXA 4ZODA 3BGAA 2CLVB 3Q48A 4Z7VB 1HJQA 3FO1B 4X6CF 1HEZA 1Q6FA 4NRYA 3QNYA 1T89C 2YS4A 1HVQA 4QEGA 2WZHA 1HJSA 1MNUH 1ACYL 3F5WA 4TSAH 3X17A 1VJSA 2ADGB 5IT2H 1UWXH 4HEPG 4L8SA 3W0WB 4D9RE 4XAWH 1BLNA 1DBBH 2EDBA 1MXDA 3I02B 1NGYA 2IBZX 3MUY1 5CLWA 2EADA 1A4JA 4ONGL 2BVYA 4X6CB 3WN6A 4GG6A 3MOAH 3WFCL 3CXDH 3QWOB 1N6UA 1XD0A 2AEIT 1F3RB 1WBZA 5AZEH 2CKNA 3HR5A 2A77H 3PZNA 2GUOB 1F4AA 4GXUN 3RY4A 3ARPA 3MMEA 4U5IA 3I3DA 4PV9A 1OP3K 5CJQH 1VJZA 4R2GD 2IANA 2GDUA 1K2DB 1NJ9B 1ZHKB 1BQSA 2CIIB 5C6PB 4G42A 4AYGA 2HT2D 2X2IA 3PZVA 3M6DA 3IDMA 3MRJB 3DMMD 2WINB 3STZA 1NCCH 2H8PB 2QHLA 4PG9A 1FE8L 2GJPA 3K4DA 3SCMA 2D0HA 3EJSA 1FVDA 3BIKB 2XXCB 3THMH 2EDQA 5FB8B 1QHPA 2HH0L 1VGKB 2K1MA 3FB6A 4YR6A 4WFEE 2VR4A 1SY6L 4XNUH 2XZZA 3SDDC 1YEHH 5C08E 4OV5A 3AHYA 4D9RD 3RWFB 4QXUL 5EORH 2QQNH 3D9AL 4OQTA 5E0CA 2UUDK 5E2VL 2GSGA 3CHFA 2UWEA 1V0MA 1IAII 2BY1A 2VDQL 4JPWH 3NIFE 3HE6B 1QNZH 1QSVA 4XXCC 4HWZB 5SWSE 5T3ZH 2R0WH 3IFLH 1FZKB 3V0VA 4Y16D 43C9A 3PZUA 1WC7A 2AJXH 1SBSL 3KPSB 4K9EC 1HXMB 3CMOL 4AD3A 3QUXC 5LWYL 1ZEAH 1BBJB 3U7AA 4G7YL 1P84J 1N2RA 3FHAA 3MRBA 4JZJA 3BZFA 3ULUE 1BFVH 5FOBB 1Z9MA 4QRPA 1CECA 3HAEG 5C07B 4HZLA 2EZ0C 1EZVX 4M1GH 2BSRA 1RZGA 1CE6A 1KJ2L 3RPKA 4ZMAT 4WFED 1LEKA 4S1RH 1LO0L 1JDDA 4JFWA 3L5XH 5C08D 1WFOA 4ODTL 1UG6A 5TQ0L 4ETQB 4MNLA 1V0LA 4MNGE 4OZIF 5IW3A 3LRGA 2AK1H 5SWQA 2IPUK 4NUJA 4WK9A 1U58B 1C5CH 1Q9OA 1N5AB 3IDNA 3C5ZD 1RAMA 1EFQA 4YDJA 4HIEB 4IHOB 5SWSD 3IRZA 4ZS6C 2FSEB 2LTQB 3IDIA 3KYNA 5F97E 4D6EA 1GRWA 4OZIB 2WXDM 4CMHB 1YEIH 1RJYA 1PKQE 2IWGA 1B9ZA 3SPVA 3C60B 1D5ZB 2C4XA 3UTZB 3ULUD 4UTBH 3OKNA 3IJYA 3IFNH 4NQED 3GRWL 3HZYA 4OUEA 2GTWB 4JQXC 1B3WA 3WFBL 2ZKHH 4LXFA 3V5KB 1D6EA 1W9UA 3K3QA 6TAAA 1SM3H 2C9AA 3MBEC 1NUFA 3LPPA 3MV8E 3H3KA 3UERA 4JRYE 3VWKD 2E27L 4JR9L 4U6VL 1MF2L 4XWGL 4YHOL 4RMRA 2YSSB 2LAGB 1Y6KR 2X89D 1NCDL 5F9AC 5T1KD 4F33B 4HH8A 4WI9A 4FNQA 4GAJH 5CSYA 4UNVA 3O11A 1H3WM 1OGGA 4D9LL 1UR9A 3NFNB 2J3SA 3VIJA 2I5YL 4WV1B 4WRLA 4OIIH 4JZNB 2GSIA 2K3TA 3VG0L 4LPYA 2A1WH 3EBVA 3PHOA 4K94L 5T3XD 5I0DA 2EPKX 3S4SA 4M56A 4XB8A 5EC2A 3BP4A 1NGPL 5D70L 3AIQA 3TIDB 4WTXA 3VDAA 3VXNA 3N06B 2VE6B 4DFHA 1S7WA 5HGBA 2IXVA 2C3GA 5EFIB 2J6EL 3IDGA 2E7LA 2XTJB 5I1DB 4WWID 4DO4A 3MV8D 4C7GA 2VLJB 1NQ6A 2PTTB 3C8HA 4JRYD 4MNQE 5JIHA 4W88A 3FOMA 4DZ8B 1IBGL 2PETA 2VQUA 4Y19E 5T1LA 1OTSD 4U0QB 3WL9A 1U8MB 1EMTH 3OA5A 5DR5L 4EUPA 4KTDH 3QDJB 4Q9BA 4OUOA 4H04A 3BEWB 1WFUA 4L3EA 5F44A 1KEGH 4HXAH 2AV7B 1EDTA 1T0MB 3TN0C 3UTSB 4ZS7L 5KVFH 4FFWD 4UFMA 2RCSH 1U8JA 4ZEPA 1CIDA 2Z91A 3IKCB 3L3IB 2BVEA 4UU9B 4LYQA 3VG9C 4L4VA 2YXFA 1MFAH 5CCKH 4U1JB 4C55A 5DD1H 4ZUTA 1BIIA 1A6UH 1LO5A 1QBML 4D1IA 4RX4A 1UWGH 1WO2A 5FHBL 5I16A 5D2LA 1TVHA 1ZVSB 2X4OA 1T3FA 3C5JA 4MA1B 1H0DA 4PJ7A 4DUWA 2V5CA 4MNQD 2HT3C 2BSED 1U6AH 2BDNL 2BC4A 3SDYL 3R0MA 3IJ9A 1FYTA 3U9PH 3ULVH 3T2NH 1PLGH 3ET9F 4PY8J 1ZKAA 4L8DA 2CRMA 5H2BA 2BNQE 5JBDA 3MACH 2EH8H 4R96B 5F1NB 3HNVH 1ZHNB 5HVWA 2AK4A 1GC1H 1XHGA 2Z31C 3PV6B 4GRLB 3DC0A 1JGVH 2Y5TA 4OQTH 3IDYB 4P57B 3TTYA 4EANA 1YQ2A 5IFTA 1ISVA 1EK3A 1MAML 3V95A 3TNNA 4UOW1 1M03A 4ELMF 1CL7L 4IM4A 4IRJC 3HJEA 4JRXA 3PN8A 4Z7QE 3IJSB 4ZFOA 1DFBL 1WDSA 2NY0B 4OCRH 1E6PA 3QUZC 4MMXC 4PFEA 5E09A 3QHFL 4XPBL 4M5YH 4OZ4A 4Z18A 3HCVA 2IQAB 4KY1L 4QO1A 1WLHA 5GS1B 5B38B 2C7UB 4M6NH 4PMXA 3P77A 2YC1A 3OKEA 5I6XC 3GBML 5E9DD 4O2FA 3L3HB 1FVCB 4WEBL 5GISH 1OAXH 4M8QA 2EC9U 2AJ3A 2BNQD 2RR3A 4DZBB 1MUJA 3M8OH 3TA3D 3VXRE 3QO1B 3BPLB 3ULUL 4XX6A 3FB5A 3DRQA 2CK2A 1IT9H 5JPMB 5JNYB 3KJ4C 4XCFL 3B9KA 3GJEA 3QDMA 2F1AA 3N17A 4KRLB 2Q3AA 5FHAL 1LO3H 2JK5A 3QXAA 4AK1A 1LDPL 1ETZA 2ZXQA 1MEXL 4RMWA 2NX5A 4U4BA 1XIWA 2XG4A 4Z7VE 1E6QM 4HUKB 4ZOAA 4RSVA 3A4WA 3KYOB 4XGZB 2FDBP 2F5AL 1U8PA 4YK4C 1MFNA 2W38A 2NY7H 5C7XL 2FX9L 2EPNA 2BP3A 3AREB 4ZSOA 3A3HA 4ZXBC 3RILA 2OLDA 3S37H 1GZPA 5F7KC 4YHYB 1CTOA 1QP1A 3BHBA 3IGAA 5M94B 1KR1A 4M80A 4ODSH 4P5KA 1UB5A 4AMXA 4XVUC 4GQ9L 2GHWB 2Y9RT 4PJ8D 4O58L 2OSLB 4NN5B 3VXRD 3WNNA 3BN3B 5T3XL 4BFIB 5GS2H 1JNEA 3TVMD 1UWIA 2IBZY 5CMAB 1J05B 3PZGA 1AR1D 4JGUA 5JDSA 1QUNA 3PHQA 4WFGD 1U3HB 4I3SH 5D72L 4Z8FH 1TQCB 4ZFFA 4XCYA 1FCCA 3W25A 2CXGA 2XFXA 3PGCA 1S8DA 3RZCD 2NZIA 4O2CA 5GZOC 4X83A 3QO0B 3DVGA 3UJIH 2YUWA 4RZCA 1MPAH 1JUFA 1N4XH 1PDKA 35C8H 2R4SH 3TPUB 3WIHA 3OAUL 4K3HA 1RK0A 1MJ8H 1KXTA 4DGIL 4FZ8H 1A6PA 5BJTB 2AQ2A 3HA0A 1TVNA 3VPLA 3DGGB 2LQRA 3W0WD 4YPGA 2FJHA 1DBAH 5ICXA 5JW4Q 5ESAA 4PP1C 3V9FA 4P8UA 3W4RA 3CZFB 5M17A 3QPQC 1AKJA 1AXTH 4Y4HC 1FNSL 1CFNB 1P6WA 2P44B 1J10A 2FX8L 4O5LH 1CF8L 1EEZA 5J6GA 4CCDA 3KLSA 4UT6L 3QG7L 5L9DH 3SE9L 2VR5A 1CL7I 3ZT5A 1W2PA 3HG1A 4PREB 3VTRA 2VO5A 3BO8A 5D9SA 1TG7A 2O26U 1UOKA 1UYWH 1NCAL 1Q9LB 1KTKE 4QTHB 2D2OA 5DK0A 5HY9B 3DV6A 3MA9H 4KK5C 3IDUA 1EQCA 3F5JA 1F3JA 3HI6H 5C07E 4PJXB 4BQCA 3IS1X 3DV4A 5HPMB 4IRSB 3MYZA 4Y4KA 3MREA 1BZQK 1JHKH 2VSDA 2DSUA 3ALPA 3IVKB 4IOIB 1LEIA 1EZVY 3FT4B 4LEOA 3LQAL 1FP8A 3O6FC 4X6FB 1QRKA 4EI5C 5B4MD 1AXSA 4MAVA 3D69B 3QJHB 4R7NA 4TTUA 4I4WB 3HE6D 3E0GA 2XQBL 3V52H 3ARFA 1M01A 2FRGP 4Z2GA 1J0HA 2KQMA 5IBLD 1EOMA 5F3HB 1T0PB 3MLRL 1CFTA 2VDLL 4DGVH 3KPSD 5KSBA 3FB7A 2IF7A 3K74B 5GNYA 3CSYB 2QSQA 3DO7B 2X1XR 4LSPL 4DKFL 5JMOC 1P4IL 2LAAA 3OXRB 1LP9E 5EO0A 3BSZH 5I2UA 2R56H 4FHBD 4QHKI 5C07D 1YNLL 3V5HA 4A2LA 5DD6A 1UD6A 1G94A 5I18L 4JM2D 4URIA 5DZOA 5E0QA 4ZENA 3ZKMC 4P7QA 3L9RA 1V6UA 5A6BA 1CQKA 1RUKH 4NZJA 3SDAC 5ERWA 5BRZB 1WCBA 3ARVA 4HUXA 4LRIC 3SKJH 3P9LA 2W4XA 4K23H 1CK0L 3EJJX 2IMMA 3WEOA 5C0IB 3PV7A 4BUGA 1E73M 3HC0A 1AGDB 1OAYH 3AOFA 4U6HA 3BZEA 4WWKC 5F3BA 4UBDC 5CD3B 2XWTB 4XPAH 2Z0BA 5JXAH 2CK0H 3MLPA 2PWEA 5HSFA 3KPRE 5K9QG 4LASL 4JFYB 4PRPA 5C3TA 2Y06L 2VLRE 2I9LB 2FBJH 4UDUB 4G8IB 3DVNB 1E4LA 5TJWK 5LVEA 3Q5TA 3U4BL 1S9WB 2ADFH 3QIUA 4Z2HA 5F9JA 3AUVA 4H26A 2VDPH 2JKXA 3QG6B 4NO0A 5KBNC 2Q8AH 1F8TH 2EKSA 1CZ8H 2XA3A 3T4AB 5EOCJ 4BFGA 4GXVL 4HIXH 4NM4H 3G5ZB 2AAVA 3GXMA 5SX5H 1I7UB 4PRWA 3B4NA 4OZFG 4ZNCD 1RULH 4MB4A 4MNHB 5K9KB 4W6XB 4JO3H 4PP2A 3BVXA 2ZG1A 1TQSA 3DPBA 3WFHB 4O2EB 2EACA 2Q87A 4LLAA 1FQ9C 4YEFA 5I1LB 4WUUE 4MD0B 2YPLA 4QLKA 4KRUA 4CW1B 2WSKA 4X6BA 4U1LA 1JXJA 3Q1SL 3NN8A 4GUPA 2D1ZA 3L95B 1TQBC 4I48B 1R0AL 1DZBA 1UM5L 4B7LA 3CDYA 4PSRA 2ADJA 1A7QL 5HI4D 4JVPA 4ENEC 1HHJA 3FN9A 3Q3GA 2IGTA 5KZ6A 4GRMB 4K7PH 2XZCL 2X0YA 4MQXC 4RAUB 5FYKH 3CC5B 1QX1A 2YD3A 5GJTL 1HOCA 2VLJD 3L3OB 3HG4A 4Y1AE 2YA1A 3LS4H 2HKFL 3W81A 3BAWA 1JGLL 4MXVE 3WIHH 1WF5A 3BE1L 2LVCA 2Y07L 2ITDA 3AS3A 3FRUB 3MJ9L 1KLUB 1OW0C 5GGTA 5F7DB 4FQQA 3AM8C 5KVDL 5TE6L 3V4PH 3VXSA 1IQWL 2J78A 3QDJD 3KL3A 3MMWA 2DWDB 3BW9A 3BP6A 2XIIA 3JUGA 3UTSD 4H1LH 5C0EB 4G6JH 4MB5A 4X4XA 2DH3A 2N7BA 2BSTB 2CXKA 3O9WA 1JMZA 4LLDB 3CFJA 4ZFZB 2OYPA 4F7EB 4RMVA 5D1ZA 1NCWH 4E8DA 1VEOA 3S7GA 1CGUA 2CKBH 1I4FB 1PQZB 2BFGA 4AWEA 1L9MA 3PHAA 2FR4A 3VI4E 2ZPKH 4P3DB 2OR8A 2NNAA 4TUKH 1CLZH 4Y1AD 2PYFA 2VZUA 4NJ9L 1MFEL 1BD2B 3MXWL 4AG4H 3OZOA 4V1DA 3BRDA 1XH3B 3F7QA 4JN1H 1CXHA 2QBWA 2CPUA 1B0GA 3UEZA 1OSEA 3KWXA 2F15A 1MRDH 1GGBH 2HLFD 4R4NC 2HG5A 3AZRA 4UQ2A 1AFVH 3R1GL 4XMPH 2XN0A 1UWXK 4NJAH 1JPFA 5DC0A 1LLOA 5EU6A 1TUXA 5F70A 5LAXB 4HV8A 3VIPA 1LNUB 1M1SA 3JZ7A 3PIQA 4LEXH 3U36A 4AT6A 3MS8A 1Q1JH 1NC4B 1HHHA 2EPMX 2V3FA 1F2QA 3NIDE 5DD0H 4LL9A 2UY3A 1T7VA 1E0WA 1IRAY 3LHPL 2ZX7A 1I8MB 3CMJA 1CR9L 1FNGA 2FO4A 3RNKB 1VFAB 1RZJC 3VMPA 1A6AA 4EN3A 1J12A 2DKMA 2WK2A 3AU1A 3BUYB 2XGIA 4KJWD 3PJSA 2ICES 4YHPB 4UT7H 1Z5LA 1T21A 3H9SB 4CVZB 3MZTA 2HISA 5SV4A 2HT4D 1FG2A 5INCA 4FMVA 3KYMA 5FA3B 3AIEA 1QSEE 1UB6A 3QDME 1T04B 3UBXI 1X9QA 1CN4A 5MENE 2XJ7A 4BK5A 3VGBA 3HNSH 1E5NA 4PYSA 4TVPH 2AV1A 1TTFA 2X7LB 1RJCA 3A22A 4WI7A 4XPHH 3B8YA 4FQ1L 1T2QL 1N59B 2D03H 1DBKH 3PL6C 2Z93A 4WKHA 3BRGC 1U8IA 2AMGA 4HWEH 3FN0H 1H3GA 1X5JA 4HFWA 3A6CH 2APTA 4CD4A 3KPMA 2XVPA 5E6IB 1X7QA 4AZIA 1HWGB 2AQ1A 3CZGA 1WBXA 1AXIB 3DYPA 1KIRB 1CXLA 4WEMB 5FCUL 1A6VL 5TDOB 5E8PA 3T0XA 1DCLA 3NCBB 3ARED 5GRJH 1KBGH 4N0RA 3PWJB 2YOCA 4G6AC 4LLUB 4WDIA 1FIEA 1QSED 3EIFA 3MLXH 1NBVH 2WANA 4G7VH 2EJ1A 1RUMH 4HEME 1KXVA 4G6KL 2XN9B 1LL4A 1KEML 5FYKE 4AIOA 4LVOC 3L1OH 1OGAA 4PJIE 4ACZA 3RVWC 3X3GH 2CESA 4CRPA 2H9GA 1U3HD 4GAGH 4WKAA 3ZE1F 2SEBA 3RVUD 4BQ3A 2VZOA 1ZJBA 1PZ3A 2EE9A 2VXSL 3QHZL 2ZICA 5JOPD 3MO1A 3IETB 4U1MA 3GI8L 3L5IA 3QHMA 3TWCL 4ODHH 4OCXH 4PJXE 5HYJA 3OKDB 4J12A 3LSOB 4G9DA 2C1PB 3MOBL 3MNVA 1WIOA 4N8CL 4PB0L 2MOVA 1ZBKA 1HSAA 3GMRA 3FO2B 4PBWD 3CNKA 4C4KT 4YH6A 2VL5B 3SOBH 1A2YA 2J5LB 2XOTA 1G5AA 4RIRA 1EHLL 4UTAL 1ORQB 4DGYH 4PGEA 5IROC 3QP3A 3WFZA 4HIIB 4AENB 2MCPL 3WS3A 1OBAA 2DD8L 4GW1A 5EO9A 3RGVA 4D9QE 1OSZA 5GGRB 3T8XA 4OGZA 1HQRA 1K8DB 2ZCKH 4HS6A 3WF1A 1JNLL 4UV7L 3TBSB 3DX8B 1R5VB 2VDRL 4U1IA 3AMLA 5DD5L 2IJ0C 4P2YA 4BH8B 2W59A 1JVKA 1RVFH 5HDOA 4HCRL 4MDIA 2YMXH 2OR9H 3U9UB 2B31A 3MLVL 4W6YB 3TNMA 3VA2C 3L3DA 1DQQB 2WC3A 1SMDA 3FT2A 1AQHA 4K8RC 5J1AA 3QUMA 2APVA 1NSNH 1XGQB 1CQYA 4IRSD 4XMKL 2APFA 1U8NB 3OKMB 4R6UA 1S9YB 1R3IL 3QT2A 1ZLWH 1I1XA 2WVVA 2FIRT 1JWSB 3K0WA 5ENWB 4GW4A 5FECA 4EBQH 1HF6A 2Q8BL 4ZUWA 4IOFD 5C0CA 3OIHA 5KSBE 4D9QD 1I85A 3A67H 5EO1B 4P2RE 4XWOD 1B0RA 1C5DB 4BSWA 2OYKA 1D9KB 4JL2A 1CFSA 3CD4A 4I2XA 4JZ5A 1DL7L 1XSJA 1B90A 3QYCA 3RM9A 4OZHA 2YK1H 5JUEH 2FBOJ 3MFFA 2RBLA 3RA7L 2X4NB 4DAGL 4RFOH 4TSBL 5JZ7D 3MRGA 2XN1A 2IADB 2VDNH 1QRNE 3THCA 2IALB 3MLYH 3BAEL 4H88L 1L0QA 5I1HH 4DEPB 3BUTA 1YPZF 1KCSH 4UDTB 1AY1H 1BYBA 4HKZB 4WJXA 1OWQA 4X80L 3WXVH 4PMVA 1EAPA 5E95B 3QA3A 3UTTA 3G6JA 3ZJ7A 1MHPH 5EU5A 1QKZH 2BJML 5GJSL 1GQLA 3LN4B 2F7QA 3G6LA 4X7TA 1P1ZB 2BVPA 4WW2C 3OGRA 3VGDA 3PTKA 2VDKH 3N9GH 4RWYL 5I19L 5C6TH 5BRZD 5ICZA 3WD0A 4DUVA 1YPZB 1YHTA 5DZLA 1CXFA 3LKPB 2ERJC 2APXA 5BV7B 4PTUB 5E08L 3AGVA 4OJYA 2CDGA 2Z8VC 1RUAH 2NLJA 3WQVA 4D6DA 2YD2A 1NGXB 1F4WL 5IIEA 2CRIA 1BZ9B 1H8OA 3GSUA 3MV7A 2YEZA 4M81A 2EPOA 2ICWA 4JFSA 4LK4A 2HFFA 3VD4A 3CZ8A 4LLVB 3BGMA 4GBXA 3WHE0 1HILB 2QQKL 3KLHC 4LHJB 1QFWL 5EUOE 1MHEB 2B5IC 3RMEA 5KS9E 2PWGA 1PGRB 1B30A 3N1FC 1MELA 1NDGA 3P9MA 1BVLB 2ARJQ 5F6IB 2NY6C 5KW9H 1A6TA 1D7FA 4OCSL 5IB5B 1Q9WA 3O0RH 5L7XH 4MAYC 4GXPA 3LEXB 5TDNB 1V7ML 2DQHH 3KLDA 4YHZL 4PLJC 3QFDA 1ZTXL 3BXWA 4NO5B 5C1MB 5ABGA 3EDDA 4NHUB 1EHAA 5DA4A 1J18A 2X40A 1LEGA 1ZT1A 4U6YA 5GZNC 4GKLA 3PWPB 4HAFA 5I2IA 4FS0A 4ATDA 4CADA 4LFHG 4KK9C 4LCWA 5I75C 2ORBL 5ID0A 5CPSA 1W91A 4HA1A 4LVNC 3PBGA 5ESQA 5D1QA 4TUOA 3T3MF 4HAGA 5I8KH 2YLLA 5D7IF 3S34L 4CMMA 5IR1A 1HL8A 4RGMC 2WAHA 2WW5A 3ZO9A 2V2XB 4PJAF 4HGKC 1ZA3B 1HE7A 3UAJC 1D5MB 4R8WH 4NNXA 1JPGA 4D6CA 1W3KA 4M1CC 4XZUA 2FJGB 1GCFA 5ALBL 3VXTA 1S7RA 5D7IB 4P0DA 2GK0B 3TV3H 4JFHD 4POUB 2YZ8A 1A3QA 1BD2E 4YC2B 4PJAB 4JFXB 1UZ6E 5DT7A 2G2RB 4TRPH 5DHVB 1T7ZA 4P7NA 2C0HA 3RCNA 3BP5B 3J7HA 3TZVC 2VXTL 1ZOXA 4KKLD 3FHQA 5IB1A 4JFFE 1NGQH 2JELL 4Z7WE 3WN5A 4RRPG 4F2MA 4J6RH 1CZ1A 4Y5VC 4W84A 3RUGA 1ZGLB 4OLUL 4HKBB 1MCNA 3RDTA 2WUBL 3WF2A 4JFQB 4MVBC 1VFBB