3QF0A

Crystal structure of the mutant t159v,y206f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIFLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qf0A00
5EKYA 3TIMA 5D37A 1NAL1 3EKZA 3LI1A 5G1TA 5DN1A 3G8EA 1LBMA 2LLEA 3EB2A 3BGGA 3KVJA 3TUUA 1GZGA 5I3JA 4LY8A 3DAQA 3PM6A 4QNEA 3HGRA 2X1TA 1X6UA 3O6DA 4QITA 3LBCA 4LT9A 3MI2A 2GJNA 2J88A 3S1VA 3K30A 4JX4A 3FJLA 3LCWA 3FA5A 4JS3A 3PWAA 1KLYA 1XXXA 3QFEA 3Q58A 4YL2A 4B5NA 1YADA 1VS1A 3M5VA 4OBTA 3EX2A 5K4XA 1FDZA 4MIMA 3W72A 2BZNA 4O16A 4Y9AA 3LHYA 1PVNA 4MZYA 3BVJA 5L9FA 2ZFAA 4L4MA 1F76A 5BW6A 1F73A 5AN7A 2V2DA 1WDWA 3P61A 4O15A 1ICPA 1P4CA 1R2RA 2BX7A 3GDLA 4JGDA 1T99A 4K7YA 3C52A 4JTLA 3TX9A 2EGZA 4IMFA 1SO4A 3V75A 4IMCA 1TPB1 1VRDA 3W1MA 1A50A 3HG5A 3RF9A 4FXSA 3G24A 3L66A 1WQ5A 1OFRA 4DQWA 1VLIA 3P5YA 3KVMA 5AFDA 3QPZA 3W7GA 4UFHA 4UMCA 2OMAA 1ONRA 3QMRA 3DFNA 2WPBA 3NXFA 4AAJA 1MSSA 1X1ZA 5EYWA 3NQMA 1XM3A 4WJEA 1C8VA 3PR2A 3M41A 1DV7A 2C6QA 5FEZA 2DZTA 1A5AA 4C1KA 1R2TA 2NXGA 4NJHA 4IJBA 1GG0A 1MEIA 2F84A 4UMAA 3O8AA 3L67A 1T0OA 1XFBA 5K3VA 3I6RA 3WK0A 2R8WA 4UIOA 3CWOX 4UNKA 1TV8A 3W7EA 8TIMA 2V9DA 3MP5A 3PBYA 3G1XA 4M7SA 3G1DA 3FYPA 2C15A 1ML1A 1OYBA 2W79A 5BRBA 6TIMA 2CLOA 1JQVA 4O54A 4H6KA 2YCEA 3G3MA 2Q8LA 4PL2A 4KFNA 5EY5A 1AMKA 4TR9A 2VEPA 3S5OA 5CG7A 2TYSA 3QSRA 4M6QA 4Q32A 1H7PA 5G4WA 4ZMGA 4CCCA 1VGAA 4LOCA 3G1YA 4NX0A 5IM51 4Q33A 4HPXA 3MI6A 1LLZA 5K7JA 5BMWA 3W7JA 3W7NA 4UTKA 5HMSA 4WOQA 3VKJA 3S5YA 4NJJA 1DHPA 4BK9A 3G18A 4EOUA 3IGSA 3NDOA 5FF2A 3W3OA 4YMZA 3MMTA 2QCNA 3TCEA 5BOOA 4QNWA 1OFPA 1VR6A 1SO6A 2JGYA 4EWND 5D09A 1W8SA 2CWNA 4LVAA 5LHEA 4ONVA 2P1FA 4FNTA 3G0XA 2NX9A 4M5PA 3CLMA 2C18A 2ALDA 4OWGA 5CGQA 5AYYA 4RJEA 5F2GA 4O4WA 1OFQA 3JRKA 4RR4A 3GVGA 3NQ2A 4TU1A 1M7OA 3WJZA 5KZDA 2GUUA 2OCZA 5D2VA 1K8XA 3A24A 4HPJA 4AHQA 1KFLA 5LHFA 1TTJA 3GXNA 3WJSA 4QQ3A 3LM7A 2FPVA 1G6CA 3T44A 1TQJA 5D2TA 3MWAA 1W5PA 3TXVA 3G1VA 3S8HA 1U5JA 1CI1A 3UQNA 2Q3OA 4LVDA 3DXIA 1OYCA 1THFD 2FFCA 3LTYA 1RQEA 4BR1A 3PVFA 5TQLA 4O14A 3N14A 1LYXA 3NOEA 4N9EA 3KVLA 4JTIA 1W54A 3BGJA 4JD4A 1LCOA 1O5XA 3UXDA 4FNRA 1WA3A 1F74A 3EEGA 4MYXA 2ZZ4A 1EWEA 5HWMA 2YDAA 1D3GA 4FIRA 3GDKA 1G67A 3C56A 4FX8A 1K7XA 1MZHA 4Z1DA 4LVBA 4R53A 1TMHA 4K8HA 2QUUA 3NL5A 4UFKA 1Q3NA 3LGEA 2E68A 3UZ5A 4DPPA 2QUVA 5FEXA 5U4NA 3PB2A 2A0NA 5AHFA 1VZWA 2QDGA 3B0PA 2YW3A 4WXYA 1SUXA 4MLJA 1QNVA 4JX6A 3G3DA 4P61A 3W2NA 3GR7A 2ZZ1A 3TW6A 3LTPA 3NVTA 3DZ1A 3QPYA 3N9RA 2WNQA 1EP3A 3C2OA 5LNWA 1Q6QA 4KWVA 1DOSA 1KFEA 1DVJA 3NL2A 3P62A 1GEQA 4NX5A 3T40A 3NZ1A 3WK3A 2E77A 3GYEA 4AVFA 3TSDA 2KZHA 4TMCA 5D04C 4O4VA 3BG9A 2NX3A 3OBKA 1XBZA 2ZZ6A 3GR8A 4RZ4A 3OVQA 4YWIA 4N9CA 4KFPA 3BARA 3ATZA 1B9BA 1TPC1 4HSOA 4JDYA 1TCDA 3FOKA 2ZTJA 1JULA 1L6WA 3SJ3A 2NV2A 5AHIA 1KLZA 2E6YA 5KINA 1AL8A 1AW2A 2Z2UA 1ADOA 3CM4A 3RK8A 3TSBA 1LTDA 4RK8A 2Y88A 2PRLA 3KRZA 4FNPA 5E0KA 2WJZA 4GXMA 3CTLA 3MYPA 4JTTA 5CZTA 4AWUA 3P80A 3PUEA 3L65A 1ZNNA 3EX6A 2NXIA 3NL6A 1VC4A 4YLWA 3EWZA 1CW2A 3HGOA 3KHJA 1GJPA 1TTQA 1I8JA 3C4UA 3HGSA 5D2YA 2VEIA 3W1NA 5DLCA 3S1XA 3IGUA 1RD5A 1A53A 2ZCGA 1W5NA 3QMSA 5CPNA 1K8ZA 1KBIA 2ZA3A 3NL3A 2YX0A 4U28A 1RZMA 5LNVA 1AG1O 1I2RA 5G2HA 2VFIA 5D33A 4NNBA 1WXJA 3ZWTA 1HTIA 4M6PA 4I7UA 5K9XA 4PCFA 5HUOA 5K2ZA 1QWGA 4WY0B 4BI5A 4GRSA 2A6NA 5CSSA 3TDFA 1VJIA 2DZSA 2X16A 4HN4A 1YTDA 1OFEA 4O52A 5K9DA 4WXZA 1SQ7A 2E5BA 2ZRXA 3DGRA 5HR7A 5E93A 3GNDA 2C13A 2H90A 3I7SA 2H8ZA 5MHBA 1GVSA 1LP6A 3W76A 4AWTA 3GAKA 3RFAA 3JS3A 5C6MA 3S0CA 1N7KA 1RV8A 1DQXA 1VPXA 1TPVA 1EP2A 3LV5A 3L5AA 4KWWA 1FWSA 5TBOA 3CB8A 1Q6OA 4PODA 3LRMA 1FWWA 1WYIA 1TYGA 4LC8A 5AYXA 2A7PA 2ZRUA 3T78A 1WOAA 4IXHA 4MZ1A 1TV7A 3C2RA 1H63A 1HUVA 3A22A 3G1FA 4S2CA 1OFBA 3KFTA 4UR7A 1QO2A 1IIGA 4LRSA 1OK6A 4JX5A 3TQKA 4PH6A 4K37A 4QIUA 3M47A 1RVGA 3BW2A 3EWWA 3IIVA 2WSRA 4N2YA 4OV9A 3GIYA 3WK1A 5DCDA 4N6FA 1H61A 3HB9A 1R47A 2E1DA 1RPXA 2DZPA 3ABSA 4Z1AA 3L5LA 3O06A 2GQ8A 2QR6A 3W1XA 3FS2A 3HO8A 1SZGA 3RLUA 2WOQA 3P60A 4O0KA 3W73A 2Z1BA 4A2RA 1KM0A 4MPQA 4O0ZA 5LGXA 3W2KA 4IQLA 1TPWA 3PBWA 4JXCA 4XTDA 2CU0A 1VYPX 2QCDB 1OABA 3C61A 1WBHA 5KSWA 4AH7A 3P74A 4AEOA 3W23A 1OFAA 5A8GA 1DORA 4LTSA 1L6SA 1PHWA 4JTKA 4WD0A 3W7IA 4YCOA 2Y7GA 4TO8A 3CEPA 2P0OA 1TB3A 5I3GA 4RX0A 2WQPA 4E2BA 3TJLA 1PS9A 2Z0IA 1GG1A 1C9DA 4W9TA 5C54A 1F05A 5LNUA 3OEXA 2A4AA 3MHGA 1VCVA 3BLFA 5HWNA 4J9JA 3I7QA 4GFSA 1SW7A 5FEWA 3KRSA 5SWUA 2CLMA 1J4EA 2HTMA 4N02A 4R33A 3M5XA 3HPXA 1O95A 3QMTA 1J5TA 5GVJA 1XI3A 2Y7FA 5KZEA 4XUGA 2OT1A 4JTJA 3TW7A 3ZWSA 6ALDA 5AB3A 3ABRA 3UWVA 2J9ZA 2X2GA 3Q37A 4ZQOA 3G1AA 1BWLA 3T4CA 1SZNA 4R7JA 1VH7A 4HNNA 1X7FA 3RU6A 1CX9A 1YXDA 2TSYA 4RKAA 2Q3RA 4FNSA 4Y8FA 1SU5A 3GKAA 3O05A 4ZQMA 2ISSA 3GDMA 1N55A 3C0JA 3D0CA 3MI3A 1BKSA 4QAIA 2W0UA 2EPHA 4N9DA 1F7BA 3TKFA 1ZJIA 4LS1A 2FDSA 3NQEA 4ORMA 3OIXA 5FI8A 3WFAA 1Z48A 4NQ1A 1XKYA 5L6UA 1H51A 3W71A 1FCBA 3IIZA 2PRHA 2CLKA 4QM1A 5D2WA 5G2WA 3LCLA 3B06A 3STGA 3GDTA 3S6DA 2ISVA 3LLDA 5HUPA 3UD6A 3HPSA 5U7SA 5F4SA 2WSQA 3W1LA 3IRDA 2QDHA 4HHPA 2E5DA 2WSYA 3KX6A 3W7CA 3KRUA 1SO5A 2A7RA 5EPDA 2G95A 4ZL1A 1KTBA 4JTFA 4K6AA 1H50A 4CNNA 3MHFA 4JTSA 2TPSA 2NWRA 3BPWA 4PEKA 5E1QA 3E12A 1ICSA 4ALDA 1JRBA 2CFFA 4GNJA 1QPQA 2OZ0A 4CNPA 4AHPA 2ZA2A 3CWNA 2ATSA 1T96A 2CLEA 2HS6A 3M43A 3STEA 3BO9A 4I7WA 2RDTA 4N6EA 3NG3A 2PRMA 4MJMA 1YXYA 1KFKA 3HG3A 2B0MA 3UWYA 4CCEA 5EA9A 2C0AA 1ZAIA 3B04A 1QR7A 4ADUA 4MVAA 5G5IA 4MY1A 3O07A 4GUGA 4H4IA 4ZVJA 3PC0A 3W1QA 1TTPA 4O1BA 3DBPA 4X22A 1OX4B 5EL1A 3DI1A 4GUIA 1K03A 5FEPA 2ZQ0A 4XKYA 1EUAA 3N3MA 4UMBA 5K9CA 4FHAA 2RKXA 1RQHA 1KTNA 1BEUA 3H53A 3S1WA 1LZOA 2H6RA 4IXXA 2ABBA 2BWGA 4O8RA 5DBTA 1VLWA 2WNZA 3OG3A 3CEUA 3LRKA 3KOFA 5DBUA 4JR5A 4BF9A 2WV8A 4POCA 3KAOA 4A22A 1PV8A 4JDBA 1PL9A 3PSWA 4ADSA 4S2BA 1L6YA 3L5MA 1JUEA 4RXFA 1SSGA 3CQ0A 2V81A 3W7PA 1UUMA 1AK5A 2WKJA 2FIQA 1QFEA 3W7LA 1QMLA 5LNRA 2JKPA 2BLEA 1OF6A 4BWLA 3EWXA 1P1XA 3O6CA 2E09A 4AB4A 4C1LA 2C3ZA 3TJXA 4O57A 5CZSA 3UXAA 4O11A 3W75A 1BWKA 4JYFA 4YXGA 3LHWA 3S9YA 1V7YA 1LROA 4G1KA 5AHMA 1TRDA 4MY9A 3W7DA 4BWLC 4WQ6A 1NSJA 3TAOA 2ZZ5A 1HG3A 5CZ0A 3UZJA 5J5RA 2UV8G 1VQTA 2CZDA 3PBVA 1GWJA 1W37A 1TO3A 3ABOA 3W22A 3LXAA 5DCBA 1W5QA 3JR2A 2V30A 2JBMA 2R14A 3O6YX 3CIXA 3EWBX 3L68A 2VFFA 2Y62A 3NNTA 1Z44A 1W5OA 3NYZA 4JTHA 1NEYA 3W2JA 1FCUA 3HG4A 3NPXA 3SY5A 2NUWA 3B05A 3S42A 3TQ0A 1TTIA 5DELA 3HJZA 3PB0A 1GOXA 2ZRWA 4RLIA 2NXHA 1VHNA 3AO0A 3P84A 3PG8A 3ANYA 4O1DA 4S1FA 3BLIA 1SR9A 2VC6A 5LSMA 1EWDA 2ZBTA 1TV5A 3E49A 3M44A 1J2WA 1Q6LA 3O16A 4H3DA 3QZEA 4XKYB 1L2UA 4UTLA 4AF0A 2XN2A 4WOZA 3FKKA 3UPBA 2YFOA 3W2UA 3CC1A 1T8XA 2ZTKA 3TQVA 2B7NA 4Q4KA 3TXZA 4O1CA 3NQ6A 4EF8A 3M9YA 4Z0JA 1JCJA 3OVRA 1YYAA 2FPYA 3I68A 1A5CA 1KM1A 2X30A 1QAPA 3SZ8A 3NO5A 4R34A 2OX1A 3W7HA 1DL3A 5KITA 3R13A 3VCRA 2QCGA 3M16A 5D38A 3W7QA 1G7UA 2YGYA 1EB3A 3UNDA 2GQAA 4IMDA 1LDCA 3FLUA 3H55A 3LCHA 2DZWA 2DJXA 4BI6A 2CLHA 1YTEA 1QOQA 5FF3A 4WX2A 3DFOA 2X1SA 1JCNA 1LORA 3FKRA 3UY8A 2CLIA 4DF0A 3NZRA 4ORIA 3TMLA 2ZRYA 5DY2A 4JN6A 4GBUA 4NZFA 4LS2A 4OE7A 5F2MA 3PUOA 2IQTA 1KM5A 3NR0A 3TAKA 1KM2A 2NZLA 4ADTA 3FEMA 1WV2A 4K36A 3W07A 3GKFA 4DBDA 4K8EA 1DBTA 4IGHA 4DF1A 4JIPA 2V5BA 1R30A 3F4WA 1BTMA 4OGZA 3CHVA 1KM6A 3L0NA 3AJXA 4K7VA 2QCEA 4BFAA 1H7RA 3Q94A 4NUWA 2QUTA 1LRQA 1ZHAA 4JNMA 5LZLA 1LRTA 1JCMP 4LV4A 4CQAA 2QCLA 4IMGA 1FUYA 1OHLA 2RDUA 3W84A 1PHQA 2GVGA 3QRHA 1M6JA 5AHLA 2I1OA 1W0MA 4O10A 3W83A 1NFBA 3NQ8A 4IUOA 1W3TA 4GUHA 2NUYA 4NNCA 4HSNA 1W1ZA 1Y0EA 2DZXA 1ICQA 1PE1A 3NAVA 1C29A 3NM1A 2YYTA 3LCXA 2VFEA 1LOLA 2EF9A 2G5WA 3PY2A 3TMQA 4Z0SA 1R46A 4M7TA 2O7SA 4LRTA 1MEWA 3YPIA 4E0CA 2D73A 1OK4A 2Y70A 5BMXA 4AF0B 2A2IA 3THAA 1H62A 2ZZ2A 1XUZA 3N9SA 1B4EA 4NT0A 4RXGA 5F1UA 1UJPA 3DKLA 4KKXA 1OF8A 1AW5A 3N2MA 2NLIA 3L0KA 4L4LA 3E96A 3O15A 4ML9A 5KZMA 5F1VA 2VXNA 1W56A 1SW3A 5AOUA 3PULA 3QM3A 2YFNA 4GC4A 3QSTA 5FF7A 1PCWA 2OT0A 4PA8A 1EX5A 3T55A 2P10A 3QJAA 3WJXA 1YXCA 2QAFA 1GT8A 4NU7A 4UTIA 1NF7A 4A29A 4IMEA 1QDSA 2TMDA 3NQGA 1SW0A 1OYAA 3BW4A 3NQAA 3E0IA 3PF3A 5LNSA 1H60A 4ICNA 3IVSA 3CT7A 1GVRA 3NEVA 4QISA 5KTLA 4GE8A 4UTJA 2W6RA 3KXQA 1WBJA 1LM1A 3TV8A 4CCDA 1G4SA 4MFEA 3GX9A 2AAMA 2GVLA 3ABQA 1QO5A 5I3HA 5CSRA 2ZRZA 1FWNA 2QCHA 3M6YA 3DI0A 1GPWA 1TPUA 1UASA 3TFCA 1ZAJA 4FB7A 3TU9A 5D05A 2C19A 1DJQA 3DHDA 4ZQRA 2Y85A 4CQ8A 3W87A 4HKPA 3W2LA 1GYNA 3PBUA 4LU0A 1OX5A 4LV9A 1FCVA 1N8FA 3IVTA 1GVOA 4GUFA 1W3IA 2V2HA 2YZRA 2QCMA 1WX0A 3S5NA 1FWTA 2V5LA 3P8IA 4HNTA 2J27A 3LX9A 4AHOA 3U6WA 3GNNA 3SI9A 3W7KA 1I2QA 3C8FA 3W1PA 1XBVA 4FNUA 3P7YA 1O4UA 3NM3A 3I65A 5T26A 4UXDA 5D2XA 5H91A 3L2IA 1FDJA 1XBXA 4ZQNA 1O94A 4IOTA 5AHEA 3RNDA 1KBJA 3LB0A 4NVTA 2VFGA 3QQ0A 4PFMA 2ZYFA 3LDVA 2BSLA 4PC8A 4NJIA 3B4UA 2PURA 3TNOA 1H7NA 4AXKA 3G22A 1M7PA 2OJPA 1G4TA 1JQXA 1ZALA 3SR7A 1SZEA 4LVFA 2QF7A 3UY7A 2GPTA 3STFA 3W7MA 1P5BA 3C2EA 1D3HA 1EPXA 5HQEA 3EXSA 3USBA 1LBLA 5I3KA 4EF9A 2JK2A 1ME9A 3GZ3A 2J9XA 3I7RA 1F6KA 3HF3A 4WUIA 2XFWA 4GWEA 2E6FA 2HSAA 3MO7A 3P82A 4ZQCA 1XDMA 4FX7A 3PSVA 4LVGA 2YYUA 3EX4A 1SFLA 3DFSA 2Y7DA 3DKJA 1LRNA 5A5WA 4NJGA 2O7QA 4Y6GA 1YPIA 3IIPA 3C6CA 1TRIA 4JY8A 2NV1A 4DO4A 3R8RA 3BK0A 4IX2A 1QPOA 3NQVA 1TPFA 1JUBA 3F4NA 1RR2A 2FTPA 2YPIA 3G0UA 5HULA 4JEQA 3SFKA 5I3IA 2TRSA 2Y89A 1TREA 5LGZA 3LXCA 4K39A 3BW3A 1LOQA 4FIQA 2QAPA 4K38A 2FPTA 4O53A 2H3BA 3VE7A 4TMBA 4LUIA 1VCFA 3W74A 1OG0A 5FESA 4P2VA 2RDWA 3WJWA 2C1HA 2RH9A 2C16A 3QF0A 3QYQA 1Q45A 3LHZA 3GB6A 2YW4A 2VEKA 3THQA 2RFGA 5H2ZA 3MYOA 3MHUA 2FB2A 2JKEA 3L21A 3NQCA 3TA6A 2Y63A 2A1YA 4LS0A 3DHFA 3LCIA 1H7OA 4LWWA 4DEFA 3HOJA 4DO5A 3LHTA 2QJIA 2GQ9A 1KM4A 4O18A 3QEZA 3EKLA 4MFDA 5F2IA 3P8JA 2Z6IA 1G7VA 4UC5A 2YR1A 3N73A 4U4MA 2XN0A 3S5ZA 3NQ7A 1JCXA 3A9IA 3TSMA 1RQBA 3SGUA 3ZFHA 2ABAA 3N2XA 4IWWA 4JIQA 1YPFA 2DORA 1SPQA 4O13A 2VEMA 3M5YA 2EKCA 2EHHA 2PC4A 3LRLA 4RV8A 3M7WA 1KV5A 3RMJA 4JICA 3CIWA 1H7WA 3SECA 1S3HA 3IVUA 5TIMA 4IPJA 4ZQPA 3UYCA 3P81A 2QJGA 3HIJA 1FY6A 1OX6A 3INPA 2FJKA 3VE9A 3LLFA 3P5ZA 2JGQA 1YLVA 3L9CA 4MZ8A 2DZVA 2GOUA 2VFHA 1ZCOA 1JVNA 1HO1A 4LC6A 1O60A 1VHCA 2VFDA 1U83A 3UWWA 4UCGA 4A3UA 3LERA 4UUIA 5K4ZA 3U2OA 1PIIA 3QH2A 1K3UA 3M5ZA 1FX6A 4HNVA 1OFOA 5LKYA 4X3ZA 2CZEA 4GUJA 1ALDA 4X2RA 1K7FA 1XL9A 5CPOA 2A7NA 2ZZ7A 1IGSA 4M6VA 3ZR4A 3TE9A 2NX1A 1DKWA 5DCEA 5CPMA 2YSWA 5CZJA 1W31A 2NWSA 2QEZA 2H8XA 1TPEA 4EVZA 3E02A 1KFCA 1XUUA 3W86A 7TIMA 3IIOA 1FWRA 2CZ5A 1B3OA 3W70A 1ME7A 2QCCA 3UWZA 3B03A 1MXSA 4GJ1A 1G4EA 1S5WA 1X8FA 3TH6A 3OHIA 3TK7A 1K02A 2EAWA 3FFSA 1DJNA 4OT7A 4BI7A 3FYOA 3SW6A 4XWUA 5G2IA 1SSDA 5HR6A 3R12A 2R91A 1H1YA 2Q8ZA 3G1SA 4N4PA 2GJLA 3OA3A 3W1AA 1LBFA 3GLCA 3QQ1A 3SSJA 5AC7A 1A5SA 5DXYA 2YXGA 1VYRA 1GYLA 3A21A 3HG2A 3C2VA 3TFXA 1QOPA 4NNAA 1KFBA 5G1YA 3P67A 3W7RA 3B8DA 4RCXA 1F5ZA 2E5CA 5HWJA 4NZJA 1OFDA 2HMCA 3EWUA 4A21A 1I4NA 4AMAA 2ISWA 4UFIA 5C2XA 2J24A 4JTUA 2ZRVA 4N9BA 4EIVA 5ABTA 2QCFA 3NQDA 1TPH1 5AC8A 3MUXA 1Q6RA 1ME8A 4FX6M 2I14A 1LLWA 1A5BA 4MOZA 1IXNA 3V1PA 2QKFA 2ATMA 2DP3A 4O19A 3MJYA 3OVPA 4LUJA 1PCKA 1EUNA 1SFJA 2ZZ3A 4Y90A 3MP4A 5EBUA 2VENA 3M1ZA 1W3NA 1K8YA 3STCA 3W1TA 1GTHA 2A21A 3Q2DA 1I45A 3NA8A 5HINA 1QPRA 4E38A 3R5EA 3UWQA 3G0SA 2J9YA 1B57A 2DJLA 4UTHA 4O17A 3VFLA 1KW1A 3FJ6A 3KVKA 5F2LA 1G69A 3B0VC 5HJLA 3S1UA 4Z08A 1GQNA 4O50A 1XC4A 5IBXA 3A5FA 4WY0A 2FLIA 5HNRA 4DF2A 5DY3A 3GK0A 4JYEA 5AYZA 2BTMA 1JR1A 3BV4A 4O1AA 4ZZ9A 5AHNA 3SIZA 1O5KA 2VELA 3HGJA 4JTEA 4MLRA 5C55A 5IBXC 1L9WA 3SGZA 1KA9F 2DU2A 3FIGA 4WY0F 1FXPA 2E6AA 3C2FA 4JTGA 4QSHA 2CW6A 5FF0A 3IIXA 3H54A 1FCQA 1NVMA 1XDLA 4XBSA 3LBMA 2XN1A 3QW3A 4FF7A 2BXVA 4MYAA 1AL7A 3BG5A 3W9ZA 2PE4A 3DENA 2C14A 4CNOA 3VNDA 3DFQA 1X1OA 3GDRA 4MKNA 1I2PA 4UTWA 5F4WA 4UNLA 3QC3A 3EWYA 3W2MA 2X1RA 1Z42A 2X1UA 3RLVA 3NPWA 3QW4B 1JJKA 3N34A 4UFMA 4M19A 2I9EA 5J5DA 4NXSA 2A6LA 3W85A 1YDVA 2J6XA 3W1RA 4DXVA 1YDOA 1EP1A 3ELFA 5I3FA 2DZUA 4UTWC 4Z1BA 3LHUA 3WJYA 4CQ9A 3EXRA 1R2SA 4DPQA 3F1QA 4PTNA 1FDYA 3G8RA 1F2JA 3GAYA 3ZS4A 3PUDA 4FNQA 1JCYA 3A23A 3T7VA 4XTIA 4HT3A 1UCWA 4DELA 1GVQA 3LCFA 2GVJA 3WK2A 3LXBA 3LHVA 1I2NA 1VYSX 1EA0A 2QJHA 3W7OA 4NJKA 1JRCA 2CLLA 4UTTA 3TC6A 2VOMA 5FF4A 5EMUA 3R89A 2QCDA 1D9EA 4D2JA 3BLEA 4HIBA 4CLMA 5KMYA 4XZ9A 2B7OA 4JYDA 3DFTA 1H7XA 1IF2A 4UTTC 4KFOA 4TIMA 1P0NA 3PAJA 1GTEA 3TROA 2AQWA 4E2DA 1TQXA 2Y7EA 4QJ1A 1YTKA 1W5MA 3MP3A 1ZAHA 2ZA1A 2FQIA 3PG9A 4I7VA 3PS7A 2A85A 1WAUA 4XBKA 4LW7A 4N4QA 3EX1A 5D32A 5D03A 1P0KA 1EEPA 3NPVA 4X9SA 4PL1A 1H5YA 4UTMA 3LTSA 3EX3A 4AWSA 3GXPA 1V5XA 3HMJG 3IV3A 2NUXA 3IGXA 3VI2A 1FQ0A 2Z6JA 4YCPA 1HFBA 1SO3A 1ZFJA 4MUZA 3BG3A 3W6YA 1B4KA 2A5HA 4FXRA 2WNNA 1AW1A 3CU2A 2RHGA 1NF0A 1SZFA 3EXTA 3L0GA 3NGJA 3O63A 1EIXA 1XCFA 3DH7A 2CLFA 2V0TA 2HS8A 1OVDA 1MO0A 2FB3A 4IX0A 1KFJA 3TR2A 4MY8A 1GVFA 1H1ZA 1WOBA 2ZDRA 3MBFA 5D02A 1VCGA 1FXQA 1Z41A 4Z1CA 4UTUA 3A5VA 3C3NA 1MEHA 4OQVA 1UBSA 4UFLA 2B4GA 2B7QA 3LOTA 1KTCA 2V8ZA 4IPIA 1IXQA 1HL2A 1HO4A 2V2CA 2E6DA 4XQ6A 5BNKA 3E9AA 4RZ6A 1IIHA 1KM3A 3G1HA 3NPUA 1IXOA 1KV8A 1DQWA 3O1NA 2G96A 3TC7A 1TSIA 4TX9A 2Y61A 2JKAA 1K7EA 3NQFA 3ATYA 1TJRA 3IEBA 5G4EA 2F7FA 4MJZA 4NXKA 1JUKA 1ZENA 2B7PA 4O12A 1TIMA 4A2SA 1JCLA 2G97A 4O28A 1F6PA 2V82A 1IXPA 3UPWA 2H3DA 4FEZA 3B0UX 1TJPA 1TPDA 4OHQA 4JY9A 4UR8A 1M5WA 1QCWA 1QPNA 3HPZA 3GXTA 1LOSA 2WO5A 1OJXA 4I9AA 4WZHA 2PCQA 1ZY9A 3R2GA 1YDNA 2AGKA 4DO6A 1FBAA 2CZFA 4FO4A 3UWUA 4UFJA 3LCGA 3M0ZA 1S5TA 1G4PA 3LI0A 5D30A 3HQ1A 3CPRA 4RZ5A 3U8GA 3W1UA 4DBEA 2VKZG 3MW7A 2R94A 1S5VA 4HNUA 3W88A 1I2OA 5C5YA 5F4XA 3F03K 5CPLA 4OV4A 1UB3A 1E51A 1OX4A 2Y6ZA 3HBLA 3LV6A 5CKSA 5AC6A 1UUOA 3N19B 4LNYA 3DU0A 1XBYA 5DXXA 4Y96A 3DFPA 4OU1A 3MBDA
chains in the Genus database with same CATH superfamily
4HYVA 5ECUA 4M82A 3EKZA 3MZ2A 4UNIA 2DH3A 5G1TA 4DJEC 5DN1A 3VIGA 3AZRA 3T4WA 3N6JA 4AD4A 3TUUA 5I3JA 4LY8A 3PM6A 1J01A 2FTYA 2VHLA 1YNYA 3EMQA 4XZMX 4LSBA 4GZJA 1X6UA 1S1RA 4L1GA 3MI2A 1I1XA 3ZIZA 1B3VA 2RJGA 4HP5A 4E4FA 2Z2AA 3ERPA 3B8IA 3BQ5A 2EJ1A 3E0VA 4YL2A 5T9BG 3THUA 1UWUA 4Y9AA 3LHYA 3HA1A 3BVJA 2ZFAA 1YMYA 3VGBA 2O4QA 1F73A 5AN7A 2V2DA 2GGHA 3MKVA 4F40A 1M7XA 2WHMA 4CKQA 1MRAA 1ICPA 1P4CA 3LD5A 1IEXA 4IMFA 3RUBL 4G7EA 1PIGA 3OZPA 4S3FA 5CCZA 3G24A 2WMHA 1OFRA 1NP2A 1TZ9A 3KVMA 4CN1A 4B9ZA 1C7SA 1KKRA 3QPZA 4P7OA 1PKLA 4HB7A 1T6MA 5MKGA 3NXFA 4EE9A 4D8AA 5EYWA 3TTYA 3VGDA 3SCSA 4U10A 2GSJA 1DV7A 2DZTA 3WKZA 1R2TA 1MEIA 2F84A 1T0OA 2QPUA 1ZGDA 5FOOA 5K3VA 3W29A 1TV8A 1OZMA 2V9DA 3MP5A 5ABHA 2D0HA 4DO7A 3KUMA 3WF1A 4AZCA 2C15A 4TVUA 3KBNA 2AQOA 3MV01 3BMXA 3G3MA 4GIEA 4ZOAA 2PBGA 3IV8A 3MUIA 2Q71A 4RPQA 1MMFA 5CG7A 2TYSA 4ECLA 1ENUA 4M6QA 1H7PA 1K9EA 5G4WA 4BQ4A 1TZ7A 1EHNA 1XRSA 3G1YA 3H2CA 4MSSA 4NX0A 1S38A 3ALFA 4Q33A 2VURA 3W7JA 4UTKA 1JZ2A 4AISA 3S5YA 4NJJA 4ERIA 2BVDA 2J6VA 3OBEA 6PTDA 4EOUA 4NAFB 5FF2A 2P8BA 3APGA 4M1BA 1WDQA 2CHRA 4M81A 7CGTA 2VZOA 4QROA 1OFPA 2JGYA 4I5XA 4LVAA 3ZVHB 2X7WA 4FNTA 2I5QA 2NX9A 2GWGA 2BMBA 3CLMA 1UC5A 2NQZA 4OWGA 5CGQA 4RJEA 3CUJA 5F2GA 1OD0A 1NFPA 4TU1A 1PXGA 1M7OA 3WJZA 2GUUA 1K8XA 3A24A 4AHQA 1KFLA 1EJXC 3AXIA 4H9TA 3QR3A 1QWKA 1KO0A 2FPVA 3A13A 3T44A 1VFLA 4XO6A 5D2TA 1CXKA 4A3YA 2ACUA 2VP8A 3NZPA 1W5PA 3FN9A 4YIWA 3G1VA 3UQNA 3MCNA 2EPMX 2Z1WA 3LTYA 1RQEA 1F6YA 1YNPA 4O14A 4H04A 2RDXA 1ZJAA 2IW0A 1JPDX 1W54A 1LCOA 3CPUA 3B8WA 4M24A 1BVWA 1T7LA 4P8VA 3ES8A 3POCA 3B9DA 4NASA 1D3GA 3GDKA 1GK8A 4JHOA 5IFPA 1QVBA 4LVBA 1TMHA 2D22A 4UFKA 1JAKA 2GDQA 3LGEA 2WJEA 3MSRA 3ID7A 2A0NA 4H8NA 4DBSA 3GG8A 5AHFA 1VZWA 2OSXA 4MLJA 4JX6A 2BY1A 3RO8A 5FD0A 3W2NA 3GR7A 4C6NA 1JYVA 1NELA 1UH3A 3S2LA 5EMMA 1GOOA 1EP3A 3OGVA 3UZZA 3C2OA 1KCXA 5LNWA 1D7FA 3LQGA 4H7ZA 4KWVA 3CHEA 3IRSA 4C90A 5A6SA 2INFA 1DVJA 2CXGA 3W4RA 4KQNA 2IPWA 1US0A 1XG4A 4AVFA 3TSDA 2KZHA 4QGCA 3OBKA 3JUGA 2ZZ6A 3N15A 4IL0A 4QE1A 3OVQA 4YVXA 2FVKA 1POJA 3CL8A 3ANUA 3OO2A 3BARA 4IIGA 5BU9A 1PKMA 2OWWA 5I06A 2ZX5A 5BOFA 2V68A 3E3HA 3AWNA 4DVOA 3GTIA 4DXXA 2NV2A 5AHIA 1KLZA 2Z2UA 3RK8A 3TEVA 1QHPA 5FJTA 1XH1A 2Y88A 2HV5A 3NCOA 2Z7GA 1EJWC 4M6UA 3CV2A 3GSMA 1EC9A 3MDWA 1REQB 2MANA 3L65A 1UWIA 2NXIA 3EWZA 4N7QA 1BF2A 1D7KA 4EAYA 3HGSA 4PB5A 3ITOA 3W1NA 4IIEA 5DLCA 3WD2A 2Z1KA 2HBXA 1KBIA 1GHRA 3ORWA 4U28A 1RZMA 4QSFA 5LNVA 1O66A 1SGJA 2ICSA 2YIHA 2ZUUA 7TAAA 3UP8A 4LF2A 3M0VA 3MC5A 3AALA 1SJBA 4QLJA 4GRSA 3U57A 4GBDA 1PZ3A 1VJIA 1XS2A 2DZSA 3KM8A 5DEZA 3K4AA 3F2BA 4E3VA 4JFVA 4WXZA 5LA0A 3T09A 5B7YA 3ZJ7A 3CAQA 3GNDA 2Z24A 2C13A 2H90A 2D24A 3E0LA 2PGRA 2PDFA 3R6IA 2WQDA 1EH9A 4GI4A 1Q4NX 3RFAA 3S0CA 2VGGA 1DQXA 5CGMA 1VPXA 4IH3A 1EP2A 4H9ZA 2OEJA 1RCQA 3LV5A 4ERGA 4MG4A 3L5AA 3T05A 1FWSA 3CB8A 2PODA 3IUDA 4M80A 4LC8A 3T78A 2ZRUA 1WOAA 9XIMA 2BY0A 1QK2A 4MZ1A 2QHAA 4GMEA 1RP9A 3C2RA 1H63A 1XRFA 3IUIA 4DLFA 1WUEA 3GVRA 1U5VA 4LRSA 3WQEA 3OODA 4Q8TA 1E15A 4FLQA 3BWWA 4PMUA 4QAWA 1IEIA 2V3DA 3M47A 3WF2A 5BXSA 4N2YA 2WSRA 3H6OA 4GXWA 2O55A 5AY7A 2QDEA 4GY7A 1R47A 3SGGA 3ABSA 5DMLA 4PYSA 4JIHA 3O06A 1XIEA 4YJ5A 5ABFB 4PZVA 2GQ8A 3W1XA 1GZ1A 1XLJA 2D2JA 2WOQA 4UTFA 1XSIA 1FHUA 2Z1BA 1J0YA 4S23A 4DIAA 4MPQA 4W93A 3CQIA 4IQLA 2CHOA 1TPWA 3RG6A 4JFTA 2J66A 4MAVA 2PZNA 4IP5A 3I3EA 3PZMA 1NJJA 1EPVA 1Q8AA 3GBDA 3C61A 1RJQA 3W23A 5KEZA 1SYTA 2ZXQA 4YWSA 1TVPA 3GH7A 4JTKA 3W7IA 5CC5A 3QOMA 4KGLA 1XRTA 4IIHA 4GYPA 4W8BA 5I3GA 4GIRA 3TJLA 4C7FA 4W9TA 1DJYA 5LNUA 1OCBA 3V0UA 2J75A 5HWNA 4J9JA 3I7QA 2BHUA 2HVMA 1GEHA 1J18A 2CLMA 4N02A 3QMTA 1UR4A 1L2QA 2GK1B 1H09A 3WNPA 2OFJA 3GXIA 2Y7FA 3UEQA 5D8ZA 2J7EA 1QTWA 1O5RA 3TW7A 2Z1VA 4PTMA 3ABRA 2J9ZA 1E0XA 2X2GA 2Z2BA 1BWLA 4R7JA 3BDKA 2AMGA 3RU6A 1CX9A 2W3ZA 2TSYA 4FNSA 4W88A 2JEQA 3P6LA 1SU5A 4AYSA 3H26A 3KOWA 4ZQMA 6TAAA 2AGTA 3OZMA 4WDWA 1NDZA 4PUMA 1MUCA 1W1PA 8CGTA 1AVAA 1R85A 4QAIA 3S2NA 2W0UA 2X05A 1C7TA 2FDSA 1EGMA 1VBGA 4NQ1A 1TCMA 1GVEA 1JDAA 3VTRA 1FCBA 3IIZA 3I3DA 1AH0A 1V6UA 4IFRA 4QM1A 5D2WA 1VRXA 5G2WA 2OQLA 3STGA 3SCVA 3UD6A 3HPSA 5BXRA 3KBJA 4RW3A 2I16A 1IR2A 1SO5A 4MDOA 4GISA 4ICMA 3I4KA 4NSBA 1H50A 4O1EA 4CNNA 2D2OA 2ZXBA 4PEKA 1US3A 2IXUA 3SCNA 1JCTA 1A4LA 1ICSA 2RGLA 1JRBA 4GNJA 3GVWA 1WDDA 1BYBA 3M4HA 4AHPA 2W4XA 2ATSA 3AYVA 1NFGA 3M43A 4I7WA 1OWQA 2PRMA 1YXYA 1A5UA 3AS0A 2B0MA 3KOZA 2PI6A 2P3ZA 5EA9A 3DYPA 4ADUA 4J40A 4JKKA 2O9TA 3DBPA 4X22A 2IPFA 2HVOA 1X6NA 2P5NA 1K4GA 5JU6A 4GUIA 1K03A 3FXGA 4PSPA 3LUTA 1FFQA 3N3MA 3W00A 4G2DA 5K9CA 1TJ0A 5PTDA 3DFYA 1KGUA 1E9ZB 5CXPA 1J0ZA 1L6GA 2PLJA 2BWGA 1X39A 2WNZA 3OG3A 1UOKA 3KOFA 5DBUA 1CGYA 5I79A 2POZA 4ZFMA 3KAOA 2YA0A 2PWHA 1S1PA 1YDYA 2HZGA 3WF4A 1L6YA 4RXFA 3RYSA 5CJNA 2VCCA 4WJXA 2UY2A 3TTEA 4EWJA 8RUCA 1UA3A 2JKPA 2ONEA 3CAKA 1F61A 2PU0A 4KCUA 1KGWA 4Q8WA 1P1XA 3O6CA 3QOKA 2O4MA 4O57A 4ZTYA 1KBLA 4O11A 3UG5A 2ZUVA 3BTNA 4YXGA 3S9YA 5GNYA 4Q6JA 4XD4A 3REQA 1NSJA 3WDRA 2VDIA 2H9AA 5CZ0A 3UZJA 2UV8G 1VQTA 4EPDC 1AQHA 2CZDA 3NYDA 5HPOA 1W37A 1PPIA 2X0HA 3EPOA 5DCBA 2JF7A 3JR2A 2R14A 4M3PA 4Z2HA 2XM1A 1NEYA 3W2JA 3NPXA 2QJJA 3S6OA 3SY5A 4WGXA 3B05A 1UMLA 1VAHA 1TTIA 4F0SA 3T6CA 1E0VA 4A3HA 1TFVA 1GOXA 2G3MA 5JH1A 4S3AA 3ZQ9A 2X1IA 3NIYA 3P84A 4CQDA 1EIBA 1JL8A 4S1FA 3BLIA 4A8IA 1VEMA 2ZICA 1IT8A 3FVMA 2WMGA 4Q4PA 4M29A 4MJ4A 1OZQA 4JHMA 1O5QA 1KD0A 4C6CA 3QZEA 4XKYB 3VVGA 3WLSA 3W2UA 2X41A 1XIGA 1R3YA 4GIYA 4IIBA 4P7QA 3M9YA 3MMDA 4Z0JA 1JCJA 3WNLA 5A8PA 4J3WA 5A6JA 1EOMA 1KM1A 2V6AA 2OX1A 3VCRA 4QX4A 3AAMA 1G7UA 2YGYA 1VFOA 2GQAA 1G9HA 1UZ1A 1LDCA 3H55A 3LCHA 1V51A 4BI6A 2OO0A 1A0EA 2YL9A 5FF3A 1ISZA 3DFOA 4JTCA 4PRTA 2XZ9A 4D72A 1QATA 3FKRA 3S6TA 3LGDA 2CLIA 4DF0A 4FLRA 4DY1A 4BF5A 2I7GA 2NLYA 2ZRYA 2Y8VA 4OE7A 3PUOA 3SB0A 2NZLA 4RE4A 3ZLHA 2Z7KA 5EB8A 2JALA 3IJ8A 4DBDA 4K8EA 3ZM8A 3EB3A 3N11A 4K1WA 5LA2A 4DWSC 4HA4A 3NURA 4BQ3A 2NV9A 3ZOAA 3BOLA 4OGZA 3L0NA 2A3AA 2QCEA 3Q94A 1N8IA 1LRQA 2QVHA 3H4XA 4LV4A 2HQAA 1OHLA 5IRPA 1CBGA 4AD0A 5I78A 4C6IA 1S2VA 5AHLA 4F2TA 1NOFA 1W3TA 4GUHA 5BCAA 2QNEA 2YYTA 2QZRA 1LOLA 2EF9A 1B3WA 2V63A 2FH8A 3VGHA 1HIZA 4M7TA 1LT7A 2P8CA 3Q4DA 3YPIA 2J25A 2D73A 2Y70A 5A6BA 1RBLA 4DJDC 1UP0A 4FK9A 5A6TC 1H62A 2ZZ2A 4ATLA 4NYUA 2WLZA 4Y9OA 1XUZA 4GX8A 3T0BA 3WFZA 5F1UA 1XICA 3TYUA 1OF8A 3EMZA 1ONEA 5JIPA 2NLIA 4AUBA 4L4LA 1DIEA 3C3UA 2ZX7A 3PULA 2VRJA 4GC4A 2D2GA 4PA8A 1GT8A 4J27A 4IMEA 2TMDA 1SW0A 5HNUA 3NQAA 3E0IA 4U2ZA 3WQ8A 2VX4A 2QQ6A 2PF0A 3IK4A 3IVSA 3CPGA 3O9NA 4UTJA 2J13A 2XJ7A 4MFEA 4R3UA 5I3HA 2ZRZA 5T9CE 4DWSB 1UA7A 1TPUA 3CH0A 3TFCA 1KBBA 5E0FA 2IQ0A 1UUQA 5HOSA 1V6VA 3TWAA 4Q4OA 3OJGA 1WNOA 3PBUA 1LG2A 1PWMA 1J5SA 2V5JA 4LV9A 1MW0A 3IVTA 2VMFA 1QNOA 2NQ9A 2CIPA 3LU2A 2QCMA 4HNTA 1DJGA 1XIHA 1I2QA 3C8FA 2ZUSA 1S5MA 3P7YA 5T26A 3SUVA 3W81A 2HXTA 2NQ5A 3GRIA 2PSNA 3J7HA 2GJPA 1R9XA 2FZDA 4BQ5A 2PFHA 5E9XA 4NJIA 3VIFA 1M7PA 2OJPA 3VAVA 4J5NA 4HJWA 5EU9A 3OQ8A 3W7MA 2XFYA 1D3HA 1H41A 1XIFA 3USBA 1LBLA 5CJ5A 4EF9A 2JK2A 3GZ3A 3CL7A 2J9XA 1DIOA 1ZSXA 4C7GA 1QUMA 2HSAA 3MO7A 1XYFA 1XDMA 2IPGA 2YYUA 2OQYA 7XIMA 3AHZA 2CCRA 2PWGA 3IIPA 5I3DA 1WXZA 2YZ5A 1OCJA 3R25A 3R8RA 4IX2A 3AS2A 3NQVA 4UB9A 1XJBA 2PWFA 3G0UA 3FJ4A 2Y89A 3DBNA 3NZQA 2CERA 4K39A 3LXCA 3DEQA 1VD6A 4FOKA 4QR6A 4WSJA 3MZNA 2QPSA 3VE7A 3BURA 4TMBA 3U3HA 1ADDA 2Z27A 1O6IA 1FWAC 4GFIA 3UGRA 2XIOA 2C1HA 2RH9A 2NVCA 2C16A 1DTUA 3FY1A 3LHZA 1CZ1A 1E3XA 2YW4A 2GGJA 3MUZ1 3PJUA 3QYSA 3NQCA 1KRAC 3DHFA 1QW8A 5H1WA 4PUUA 3NTYA 2SFPA 2CLPA 3PANA 4E4UA 3ZZ1A 1RY8A 1HVQA 3C2YA 2X09A 2HNEA 4MFDA 1IZJA 3N2OA 4IQDA 3MUY1 3NQ7A 4B90A 5CAHA 3QBUA 1QBAA 2G3IA 5DF0A 3ARXA 2CKRA 2OZ3A 1YPFA 3N6QA 2DORA 3SQMA 2PDPA 3WQCA 4E5TA 1W9BM 2INZA 3LRLA 4RV8A 4TUFA 1XYAA 4NI8A 4HK5A 1BSLA 4QFUA 3WNMA 1PKNA 1YRRA 4OZOA 4ZGYA 4XD5A 3INPA 2J7CA 5GJNA 2FJKA 3PUGA 4US5D 2JGQA 3BCJA 4XSLA 3VZZA 1L8PA 1ZCOA 4NZ1A 1HO1A 1ODZA 3WNOA 4ZOEA 4LH8A 3UWWA 4A3UA 4QHRA 4UUIA 1S2AA 5K4ZA 3OPSA 4RPPA 3ENLA 4W5ZA 3NZGA 5DMYA 5LKYA 1R5YA 3IGHX 3UVIA 3DG7A 1K7FA 5CPOA 1IGSA 4XSMA 3TE9A 2NX1A 3AS1A 1E4NA 5CPMA 4FMVA 3FDGA 1XUUA 4QLKA 4NZCA 3CO4A 3CBWA 3DN5A 4YTSA 3ZLGA 1ME7A 4O0QA 4QEHA 1C8QA 4FR1A 4ZR8A 6A3HA 4GJ1A 2W9MA 3TYCA 3PN8A 2O9OA 3F5LA 3WQGA 4JNZA 1RBOB 1K02A 1NQKA 3GR4A 4BI7A 3FYOA 5G2IA 5HR6A 3P93A 2WHKA 1J10A 2P88A 3VM7A 4B3ZA 4LAOA 4WEVX 4UQ9A 3EDKA 1PX8A 4RE2A 4NNAA 3P67A 4P8XA 2C0HA 1F5ZA 3ABXA 4D71A 3EWUA 2WXDM 3GG7A 2WBKA 4AMAA 2ISWA 4GX9A 2QMJA 4Z17A 4DXKA 2W5FA 2DQXA 3ZSSA 4LYQA 3AJ7A 4CQBA 1RJPA 2QCFA 4DYEA 3MWCA 2F2HA 3NQDA 1BVNP 1A0CA 3U0HA 5G4HC 4D6HA 1E5JA 2OZ8A 4EXAA 1J0JA 3I4EA 1UKTA 4QP0A 3BQ6A 3CAVA 3FEQA 4PTWA 4LUJA 3V5OA 1EUNA 1EZ2A 3MKKA 4Y90A 3AROA 4G56A 2A21A 4PFHA 2R9RA 1A47A 4E38A 3P14A 3R5EA 3G0SA 2J9YA 4LAKA 1VP5A 2OYLA 3BSGA 2PDXA 2ZC8A 3FJ6A 3KVKA 4NZ3A 2OGJA 2P0IA 4Z2LA 3S1UA 3M0MA 4O50A 3KL0A 5CBJA 1JDFA 3QC0A 3GXFA 3UA4A 1CTNA 4FR6A 1Y8BA 2BTMA 1W2PA 2OLHA 2WHJA 4DZAA 3FAXA 3K1DA 3O7UA 4CD6A 3ZJ8A 1O5KA 3HGJA 4JTEA 5C55A 2VR5A 1HN1A 2W61A 3V16A 2VT0A 1XCXA 2GZXA 5DMNA 4XB3A 1AJ0A 1P6CA 2VCBA 4JTGA 2BOEX 2FZBA 2CPUA 3CXOA 4PMQA 3H54A 1FCQA 1XDLA 1QK0A 2QV5A 3AHXA 3QTGA 4KRUA 1FWBC 1D3CA 1AL7A 2PE4A 1R7AA 2I5GA 3KCOA 3BMWA 4UNLA 3QC3A 3EWYA 4Q8OA 1Z42A 1X7IA 4ACZA 1W9DM 2EPNA 4JIRA 1M7JA 2R1KA 1JGMA 5C9RA 3UJEA 4C6BA 3WDIA 4L4PA 4GHRA 3ELFA 4F2BA 4UTWC 3PZIA 4ZBCA 4Z1BA 3LHUA 3WJYA 2ZX6A 4DPQA 2XWDA 2ISDA 1EQPA 3E2SA 3ZS4A 2WSPA 1EF2A 1DWAM 1GJUA 1QHZA 1JCYA 4QQUA 3A23A 3T7VA 4XTIA 4WJ8A 3QKZA 3DIPA 1ONXA 2UY4A 1TV4A 4UQAA 3TLLA 1FH7A 2GQ3A 2QJHA 4FOJA 4NP7A 5FF4A 5EMUA 1MFUA 3R89A 3SFWA 5LIWX 1IE7C 3MU7A 4BEQA 4YU1A 2XIIA 3ECQA 1IF2A 2JEPA 4KFOA 1R0MA 2JE8A 2HXUA 3ABZA 3LN3A 3VPLA 1ADSA 1XWYA 1HVXA 1CLKA 3H4WA 3MP3A 2ZA1A 3AIWA 3EOUA 5REQA 4NL1A 4N4QA 3EX1A 1ZUAX 5D32A 4B4FA 1OT2A 5D03A 4NAEB 3AIQA 4HTBA 5DANA 3MQTA 2UZ9A 3GXPA 3U4FA 2NUXA 4IG2A 4L80A 1V79A 2XU2A 1QI4A 3FNDA 4HJFA 1R8LA 3ZLFA 1U1HA 4HN8A 3W6YA 1MQPA 7REQB 1RA5A 1AW1A 2RHGA 1NF0A 3EXTA 1E4LA 3L0GA 2C79A 3O63A 4J28A 2HS8A 2FB3A 3KZPA 4G8TA 4MY8A 4NZ5A 1H1ZA 2Y24A 1MQQA 1WOBA 2ZDRA 5D02A 5F7UA 4Z1CA 5M03A 3AHTA 3ITVA 4H8UA 3B8TA 4PEEA 5DT5A 2ZVRA 2G4FA 2B7QA 1FWEC 4H7VA 4P8WA 1CXHA 4DJDD 1HO4A 3DECA 5BNKA 1IIHA 1KM3A 3N18A 3NPUA 4B3LA 1KV8A 2REQB 3NSMA 2Y61A 1O7AA 1J93A 3W53A 3IEBA 1B31A 2DY3A 4O12A 2D0GA 2V82A 5FJJA 2WBGA 3UPWA 1OB0A 4XG1A 1RHCA 1CGVA 4FEZA 4NHVA 2J79A 7ENLA 4UR8A 3HPZA 1RK5A 1UJQA 3GU1A 2JIEA 3LQLA 3ME3A 5CC7A 3U5UA 3U48A 4UFJA 1S5TA 5B80A 1LWHA 3CPRA 3V0TA 2CITA 1A3HA 1FWCC 3MW7A 4WKFA 3PFRA 1S5VA 1I2OA 3B0YA 3F03K 2R24A 3PTKA 1P1MA 1OX4A 4DJEA 5CKSA 2JQXA 3WD3A 1M68A 3PPFA 1XBYA 1JPKA 3DFPA 4OU1A 3UG8A 4PMXA 1I9CB 1JAEA 3H24A 4LUSB 3G8EA 2LLEA 1H2JA 1AA1B 2EO7A 3KVJA 2BS9A 4W84A 1E9IA 4UOQA 1OCQA 1FFRA 2DSZA 2X1TA 2IKJA 3LBCA 4WKAA 1ZCCA 4G5DA 3V18A 1VBUA 1YNQA 4JS3A 1I1WA 3Q58A 1QRQA 4OBTA 4NAFA 4PR4A 4C5YA 2BZNA 4GQQA 2V69A 2VRKA 4YPJA 2WM1A 3PPGA 3MUCA 4J7RA 1K9DA 3ZVHA 3P61A 3UYIA 3SCQA 1R2RA 3VIMA 1T99A 3AS3A 5KETA 3TX9A 2XFFA 1TMQA 2XWEA 1SO4A 1VIWA 4IMCA 1VRDA 3HG5A 3RF9A 1TA3B 3L66A 4LAMA 1BG9A 3K5XA 3W7GA 3DCPA 4KESA 4UMCA 3KBWA 1ONRA 2PDIA 2WPBA 4AAJA 1MW3A 1F3EA 1MSSA 1X1ZA 1XRVA 4WJEA 1C8VA 3M41A 1UKPA 2C6QA 5JBEA 1KXVA 3AZSA 4C1KA 4Q8MA 4UMAA 2PTYA 4HZ8A 4PB3A 1ITUA 1AD4A 2WMFA 3CWOX 4RNIA 8TIMA 2AOSA 4IFKB 3WY1A 3EA2A 2F6XA 1ML1A 5TD4A 1M01A 4JKMA 2AQVA 4PSRA 1JQVA 4H6KA 3IUHA 1ONWA 3FVDA 3PZTA 2XSAA 2CZVA 3AWOA 1TIWA 4UCFA 3QV8A 1NU5A 2FKPA 4TR9A 3S5OA 1KQZA 3EDDA 4Q32A 1EJSC 4ZMGA 4QDWA 4AC7C 1VGAA 3D5HA 1E72M 5IXEA 4NY2A 4HPXA 3MI6A 2BV9A 4BHYA 4F66A 1FWFC 1XDJA 1DHPA 3M6DA 1HZYA 3A64A 2HISA 4AVOA 3G18A 1HW6A 3NDOA 3W3OA 1V02E 3VGGA 4ENLA 3TCEA 4QNWA 1VR6A 4ZXLA 5D09A 5E0CA 4GACA 4BS0A 2BXZA 2MNRA 4M5PA 3S1GA 3DOPA 4BEUA 3JRKA 4RR4A 3GVGA 3LYEA 4GVIA 2OCZA 4HPJA 5LHFA 1CWYA 1TTJA 2J74A 3GXNA 3KBVA 1TQJA 3E6EA 2E0PA 2G0WA 3BZJA 2DW7A 3MWAA 1REQA 4E2VA 3ARSA 3TXVA 4ZO7A 5I0DA 3UR8A 2DIJA 1OYCA 2EG6A 4LJ3A 4NYYA 2FFCA 5TQLA 3NOEA 4J3VA 3KVLA 3BGJA 3GZAA 3KS6A 5I00A 2FMNA 1JIBA 4ZODA 4FI4A 1F74A 4P5UA 1EO7A 3EEGA 1QW9A 2YB4A 1EWEA 5HWMA 3VUSA 5C9ZA 4FIRA 3SCTA 1K7XA 1DJWA 3W27A 4R53A 3L4VA 3WBEA 2QUUA 4RV3A 1Q3NA 3E1F1 2E68A 3SURA 3UZ5A 2QVNA 3RX4A 3N9KA 5FEXA 1JZ6A 2O0TA 3ZSTA 2HWGA 4WK9A 4GI9A 4FPSA 2ZZ1A 2WVVB 1U1JA 4L9ZA 4RDZA 3GVVA 2PZ0A 3DZ1A 1W91A 3QPYA 3N9RA 4J3TA 4DI9A 1R3RA 3GNOA 1F8MA 1DOSA 4X9YA 1GEQA 4NX5A 3WK3A 2VEGA 3NDYA 3O3RA 4G6CA 2QW5A 4Q7IA 3OQEA 4UZSA 5D04C 4O4VA 2O9RA 2BASA 1IEWA 3MS8A 2VX7A 3CZEA 4MWAC 1BYDA 1A5OC 5HA7A 1KWKA 3VNMA 5IHRA 2PC8A 1F8IA 1F3XA 4OVXA 1ISWA 1GONA 2G4JA 1ECEA 4Q7NA 1TCDA 3FOKA 3KTSA 3H23A 4C6PA 4D1JA 2CBIA 4RNFA 4GYKA 2E6YA 1AW2A 2TAAA 3PZNA 3CM4A 1K6AA 2DIEA 1RBAA 2BBFA 1XV8A 2PU1A 1V77A 7PTDA 1QI5A 5E0KA 1JFHA 2OSWA 3CTLA 4JTTA 3G5EA 2YXOA 4Q22A 4AWUA 5ABFA 3PUEA 3VFCA 3VCNA 1B1YA 2HJPA 2VRQA 3FA4A 3HGOA 5AVHA 3JZUA 2WC7A 1TTQA 1I8JA 5D2YA 3JW7A 3SM0A 5CPNA 4EAMA 1W5NA 2DH2A 1VFUA 3VIIA 2ZA3A 3EDFA 3USZA 3KTCA 2WVUA 1I2RA 3OG2A 1OADA 1JZ5A 2W92A 4H2CA 4I7UA 1KCZA 5GNZA 4PCPA 5HUOA 5K2ZA 4WY0B 3R4IA 3MPGA 2VC9A 2I56A 5CSSA 3TDFA 4ZO9A 5EMLA 4HN4A 1YTDA 1OFEA 3RJXA 3LSCA 2E5BA 2ZRXA 3DGRA 4CUCA 5HR7A 3UXIA 1HL9A 4AIOA 4MNMA 2PPGA 1B5TA 5EBAA 1UKSA 1HKKA 3T81A 3W76A 1LWIA 2EEXA 3SJNA 1JD9A 3JS3A 2GK1A 5C6MA 4DBWA 4W8AA 4MWAB 4KEUA 5EMJA 3AMLA 1TPVA 5HDRA 1CNVA 4XZBA 1R3WA 4KWWA 1CXFA 3I3BA 1FWWA 2JFEX 1FWGC 3TA9A 1KR1A 1UR0A 5DMMA 3QVQA 1R3SA 1HUVA 3G1FA 3KFTA 4UR7A 4DJFC 3EB4A 3U7VA 1QO2A 2FVLA 1XLAA 3TQKA 1E0TA 1MVYA 3QKEA 3GHTA 1BAGA 3BJTA 1RVGA 3IIVA 4LYPA 3GIYA 1JYNA 4X2PA 1H5VA 3P3BA 4AZGA 3WK1A 4N6FA 3PWGA 3PNUA 1RPXA 1WKFA 3M0YA 1XLBA 2DZPA 3WUBA 1LUCB 3N29A 2DSWA 4B92A 3LK6A 1OD8A 4Z1AA 3L5LA 2OOGA 3F4VA 1QASA 3A9BA 1QI0A 3HO8A 1SZGA 4L1XA 3P60A 4O0KA 5JH2A 4GQRA 2X8RA 3GXMA 1EJVC 1XIDA 4U2YA 4HQVA 3VNJA 5CQ1A 3PBWA 2Q6ZA 3DYOA 4XTDA 3GTXA 1GORA 3GVQA 2J62A 4C6DA 1OABA 4M0XA 4AEOA 4HCHA 2I5IA 1DORA 1RK6A 3N4AA 3VU2A 5E6ZA 3SN0A 1L6SA 4FALA 3L4XA 1EXPA 1EBHA 3PTMA 4WD0A 2Y7GA 3GG0A 1PSCA 4MDPA 1TB3A 3BANA 1BXBA 2WQPA 4E2BA 4ATWA 4ZE4A 1RPKA 1JZ8A 2Z0IA 1GG1A 1C9DA 3ZR5A 4Y7EA 3OBAA 3N6HA 4I5RA 2PF8A 1SW7A 4BF7A 5FEWA 1WKEA 1J4EA 2HTMA 4R33A 1OBAA 3HPXA 3KE0A 3CV7A 4PRWA 5TAOA 1J5TA 3EOEA 4XUGA 2CETA 3AU6A 4E3TA 3BSMA 3UWVA 2OB3A 3Q37A 2HBVA 2V5DA 3G1AA 4QBXA 4HNNA 1X7FA 4I9MA 1YXDA 1WZAA 4RKAA 3O05A 2DT0A 3M46A 3WG6A 3C0JA 1E9YB 3MI3A 3B8UA 3ONCA 4AD2A 3MVIA 2YDQA 5HBFA 1IT7A 1F7BA 3TKFA 4XZLX 2ZC1A 2FTWA 3K8MA 4IGSA 4DLMA 3QZ6A 1E1CA 3OIXA 3R1ZA 5FI8A 1Z48A 1HJVA 1OCNA 5GQBA 1XKYA 4FLOA 2B31A 4XAYA 1RY0A 1H51A 5D4YA 3KRBA 2DSKA 3FCPA 3HU7A 3S6DA 3L2MA 3LLDA 4L64A 3OYXA 5U7SA 4UQBA 3T42A 2QDHA 4HMCA 4JIEA 3KX6A 3W7CA 6XIAA 1HJWA 5D8WA 5EPDA 2G95A 4ZL1A 1KTBA 1J96A 1MI3A 2GJRA 3VGFA 4Z42C 2R82A 3COTA 4MNLA 1U30A 1UR9A 3NVDA 1US2A 5EFDA 1WXYA 1RP8A 4URIA 3NXLA 3B3DA 2HS6A 2GVEA 3STEA 1HKJA 3KWXA 1J0KA 1KFKA 4WGHA 1UKOA 3GU9A 2QIIA 3UZYA 4XZHA 1Q63A 3B04A 4MVAA 5G5IA 3WBAA 2Q01A 3HPFA 3O07A 4H4IA 1W32A 4B5VA 1J79A 2FHFA 4GCAA 4QDPA 1TTPA 3CQJA 1M41A 4RL3A 4IL2A 4FS9A 3EA1A 5FEPA 2Z1SA 4XKYA 3VXGA 2WZHA 3UF9A 3O0KA 4LEFA 4U3CA 3T1GA 1TWDA 1RQHA 3LENA 4PUJA 5TF0A 3MCOA 3S1WA 4A6GA 4O8RA 5DBTA 3H8AA 2CC0A 1UWQA 2Y0FA 4RE0A 4GZ7A 4JR5A 4BF9A 2J8FA 4POCA 3GU2A 2QS8A 1K70A 2I17A 1SMAA 1PL9A 5E70A 3PSWA 4LBUA 3U9IA 1HQTA 3L5MA 4IJRA 3CQ0A 4MGGA 1KCLA 2WKJA 1AK5A 4WSKA 1HL8A 1QFEA 3W7LA 1OF6A 1ELSA 4AB4A 1UOZA 4C1LA 2C3ZA 4OBRA 3TJXA 5CZSA 2WYSA 3M0LA 2VEFA 3PZQA 2GSEA 2O9PA 5DX7A 1EGVA 3LHWA 1V7YA 4XZWA 3PPCA 4HD5A 4MY9A 4KWOA 3UBPC 4WQ6A 5CLTA 2OWXA 1HG3A 2D0FA 3B40A 4G7EB 5J5RA 6XIMA 3PBVA 3ARWA 3VCCA 2D69A 2QLYA 2VC5A 3EWBX 3L68A 2VFFA 2C71A 4GYFA 3NNTA 1W5OA 1BTCA 4JL1A 3HG4A 3TQ0A 7A3HA 1FHDA 1W3KA 2E9LA 2ZRWA 4RLIA 1VHNA 4YYCA 3PG8A 2RJHA 4PULA 4GXPA 2DEPA 3NSXA 2ZBTA 3E49A 3M44A 4JEJA 1S39A 4TTGA 3O16A 4H3DA 3WLPA 4AZCB 1L2UA 4WOZA 3WH7A 3FKKA 3UPBA 2YFOA 1UD8A 2ZTKA 3WZ0E 1WDPA 4Q4KA 1GOIA 3T0TA 4EF8A 3OVRA 1R87A 1CYGA 3I68A 4D6CA 4AW7A 4LPCA 4Q4RA 3WEZA 3CV6A 3NO5A 1V0KA 4R34A 3W7HA 2QULA 1J0HA 1JNDA 2ACSA 4YTUA 1XGZA 3W7QA 3LPFA 3HJEA 1C8XA 4GKTA 1T8QA 3LEPA 3UNDA 4YYFA 2E67A 1RALA 1X98A 1CT5A 1J12A 2X1SA 3NSNA 1JCNA 3RGTA 3UY8A 5IOBA 4B5WA 2BGSA 3TMLA 1SZRA 1JYWA 2J47A 4NZFA 4DWSA 1KM5A 1KM2A 3M64A 3K8KA 3FEMA 4REQB 4QE5A 2UY3A 1ZU8A 1XLLA 4IGHA 4JIPA 1UR1A 4KGJA 4XAZA 5CLWA 2BY3A 4LNCA 1AJZA 2Y5SA 1KM6A 3AJXA 4BFAA 3AC0A 1OC7A 1H7RA 2F61A 2QUTA 2JF6A 4CU6A 4L5ZA 1LRTA 3GFXA 1JCMP 1FUYA 4XVEA 3S5SA 4L7ZA 3S9IA 3ALGA 1VENA 4L56A 3IAPA 2PWEA 3H22A 3QRHA 4YNGA 3S2CA 2I1OA 1W0MA 4O10A 1A3WA 1NFBA 2YJQA 4ML4A 4DJDA 4HSNA 1Y0EA 2DZXA 3OOQA 4Q8VA 1A5KC 4ZB5A 1ZP3A 3I10A 2VFEA 4CVUA 2G5WA 5BXTA 3TMQA 7ODCA 4Z0SA 1R46A 2O7SA 4C1NA 1OK4A 2F6UA 5BMXA 1R6WA 2A2IA 1A49A 1WCGA 2WZEA 3RHGA 5FAJA 4KKXA 4AWEA 1AW5A 4H2HA 5C7VA 3KP1A 3K13A 4I9TA 3PHAA 3PJWA 3WFLA 3E96A 4MWAD 2VXNA 2KX9A 2VWTA 3AMCA 2W66A 2YFNA 4GCXA 1BGGA 5FF7A 3QSTA 1EX5A 3T55A 4LYRA 3TTQA 4A29A 3GDBA 1GQLA 1OYAA 3RN6A 4D6DA 1GCYA 5LNSA 3SADA 1KXTA 4ICNA 2QGYA 3TW9A 1UP3A 3NEVA 4QISA 4GE8A 2DIKA 1GNXA 1WBJA 1WZMA 3QGVA 5FIPA 1G4SA 3ARQA 2AAMA 2GVLA 1NOWA 1QO5A 5A69A 3CT2A 2ZXDA 1FWNA 6ENLA 4IICA 2WZMA 4F79A 4OUEA 5JMUA 1GPWA 1UASA 3OLGA 3HN3A 5D05A 4WDXA 3FDKA 5I6SA 3W87A 3WCZA 1XLGA 4LU0A 1V0LA 1N8FA 3TZNA 3SQLA 1Q6GA 1XFCA 3S5NA 4Y2WA 1RVKA 3LX9A 4AHOA 4TX6A 1JPIA 2IUZA 3W1PA 1AQFA 4ZE5A 1UZ4A 1XIBA 1FKWA 4KCTA 4A8LA 1O94A 4EP8C 4MKVA 5AHEA 3RNDA 4B2DD 4NVTA 4H7CA 4PFMA 2BSLA 3KBMA 3DYMA 1CPUA 1V6XA 3RR1A 2PURA 4MPKA 2DT3A 5I09A 1W1YA 4AXKA 3POHA 1MW2A 2HEJA 4GY0A 2PDNA 1WDRA 3SRKA 1VF8A 3UY7A 1XD1A 1EPXA 3ZVIA 4LXFA 3EXSA 4GH1A 2YA2A 4PUDA 2JIWA 1E0WA 3FW6A 1GZJA 3GIPA 1F6KA 4WUIA 2XFWA 3HQOA 2X40A 2YCLB 3HM7A 4GWEA 1TUFA 1YPXA 2EXOA 2WSKA 4LVGA 3MCMA 2VVNA 4DJFD 5D9MA 5BOEA 4L6OA 2FGLA 5AKQA 3TYEA 1YPIA 3C6CA 2NV1A 2Y4SA 1G01A 3VDHA 3BK0A 1QPOA 1DXIA 1N8WA 3BOFA 4C91A 1RR2A 4TV6A 3BAWA 5HULA 4JEQA 3T8QA 5LGZA 4FIQA 2QAPA 2XGIA 4QXIA 4GPNA 3PNZA 1Q8JA 2A3CA 4TQTA 1EDQA 1DJIA 3BICA 2WWCA 4XD3A 5FESA 4P2VA 3VD3A 3R8GA 5HNNA 5HNTA 3CZJA 3WDQA 1MRQA 3UCQA 2VEKA 3THQA 4GGBA 1B2YA 3MYOA 4M1RA 4LS0A 1PEZA 4DO5A 4AG0A 3NO1A 1FWDC 1KM4A 3QEZA 2EG7A 1TWZA 3V0SA 4AY8A 3P8JA 2Z6IA 1G7VA 4UC5A 2YR1A 1OY0A 2WMIB 3S5ZA 1WKDA 3E2VA 4ZOBA 3TSMA 1RQBA 1KCKA 3ZFHA 3OB8A 4S39A 4A3RA 2IPJA 9CGTA 2EHHA 5EMYA 3V36A 3U7BA 2WB5A 4JICA 5CBBA 2FJUB 3IVUA 5TIMA 2HVNA 4IPJA 1FA2A 1OX6A 4X60A 3W37A 3QLLA 3LZ5A 2BB0A 5A94A 1H1NA 3VE9A 3LLFA 3L9CA 1YLVA 2C8NA 4MZ8A 1AUSL 2VFHA 1JVNA 3M0HA 4N0RA 1VHCA 1DWIM 1V3MA 1Z69A 3QH2A 4V33A 1K3UA 5FACA 1A5NC 1QPKA 2CZEA 1ALDA 4AZ7A 2FZ9A 1GHSA 2NQHA 2J78A 4M6VA 3ZR4A 1TWIA 3LPOA 4FZIA 1DKWA 3VA8A 1R86A 2YSWA 4HA1A 2WAGA 4C6FA 2ZOXA 5JVLA 1TPEA 4EVZA 3E02A 1XKJA 1XX1A 1TKKA 3W70A 4PMYA 4A35A 1MXSA 1TE1A 1JI2A 1S5WA 1X8FA 1Q7ZA 4H9XA 1IWBA 3OHIA 1OIFA 4XWUA 2ZXAA 2PB1A 3R12A 2R91A 4BCEA 3R0KA 1UPMB 3GWQA 1P6BA 1UYQA 3GLCA 1K8CA 4DUOA 1GOKA 2R1LA 1VYRA 1GYLA 5EFFA 3TQPA 2PDYA 3C2VA 3HG2A 1WO2A 4S3KA 1UC4A 2BXYA 3KW3A 4KCVA 4RCXA 3I6EA 4PMDA 4NRRA 4NZJA 4L9YA 1CIUA 3WQWA 4A21A 1I4NA 4CVWA 4UFIA 5C2XA 1T5AA 2J24A 3BLPX 3S47A 3WO8A 5ABTA 2PD5A 1ZTVA 3GY1A 1E55A 5AC8A 2WM0A 3MUXA 1ITCA 3TC3A 2WC3A 4C6LA 4FX6M 3GG1A 1LLWA 1HF6A 4HOXA 4OOUA 3ZT7A 3V1PA 1E70M 3FGCB 3TN3A 2ATMA 2DP3A 4O19A 4MF4A 4P7RA 2YL8A 1QNSA 1B54A 1OSEA 4B4HA 1CGUA 2ZZ3A 3VKBA 2PBOA 4L4OA 4Q4MA 1XW8A 2VENA 5I02A 3M1ZA 3CUGA 1K8YA 1EJTC 3STCA 4KF1A 3Q2DA 4HTYA 1UD4A 2PLCA 1QPRA 4LFYA 3UWQA 4IMAA 3N1AA 1D2KA 2TODA 1M65A 3BAYA 4W5UA 1R9ZA 5F2LA 1G69A 3FK4A 1ZB5A 1G5AA 5HJLA 1EDGA 4G1NA 1XC4A 2Z29A 4JZ5A 3V7PA 4BKNA 4DF2A 3GC2A 3GK0A 4D6IA 3QGAC 3CL6A 3BV4A 2V3FA 4CN6A 3CUFA 4WLCA 4ZSUA 4LYKA 3SIZA 2XSBA 2VELA 4S3JA 4NAEA 2DU2A 4WY0F 1E4IA 4KWSA 3L23A 4AZBA 4H1ZA 3VILA 1NARA 1E56A 4H8VA 1F4AA 4PTXA 3TONA 3C2FA 4UR9A 4QSHA 2VX6A 3CLWA 2PDHA 2CW6A 2GDVA 1NVMA 1V03A 4MUPA 2XN1A 3P2VA 2AL2B 2BOGX 3TYZA 4FF7A 5J8LA 7REQA 2XH2A 3BLDA 2Q09A 4F0MA 2PWDA 2PP1A 3MDUA 4UTWA 5F4WA 3T2OA 1ODUA 3ANVA 1BGAA 2X1UA 3NPWA 4RDYA 1IWPA 3ES7A 1QW7A 4NXSA 2WWDA 3W1RA 1H4PA 4R9XA 1MDRA 2XIMA 5I3FA 2UWFA 4B15A 4CQ9A 3M0XA 3EXRA 4PTNA 4AIEA 1FDYA 1VFTA 3G8RA 1F2JA 4RDVA 1IEVA 3GAYA 2REQA 4MB4A 4FNQA 1UCWA 1BG4A 1W1TA 1FTXA 3WK2A 3LXBA 1CLXA 1I2NA 1PB0A 3T08A 1EA0A 4HU3A 4NILA 3WL0A 4NJKA 1HKVA 2CLLA 4FA3A 2VOMA 1MWOA 3WH6A 2BG5A 3AXKA 1SFTA 4GJJA 2QCDA 2J8TA 4D2JA 3OTRA 4HIBA 2Y5EA 3W82A 3WQPA 4PMOA 8XIAA 3GTHA 4TIMA 1P0NA 3PAJA 1GTEA 3TROA 1KC7A 1GYMA 4E2DA 1TQXA 3HTWA 3LSBA 2VR2A 5BWFA 1W5MA 3GS6A 3W26A 3KL3A 2FQIA 2PEVA 4H41A 4I7VA 3EEZA 1WAUA 5A3HA 4XBKA 4LF1A 2QF8A 1EEPA 1ZL1A 4DYJA 2VDGA 4PL1A 3EAUA 2Y5JA 3UZXA 1DPMA 2FZMA 3WBYA 3M0IA 3EX3A 4W4QA 2OOFA 4AWSA 3TNBA 1V5XA 2EKGA 3URAA 4HOZA 1ZRQA 3VI2A 5LYRA 4PE8A 2PAJA 3EDEA 4YCPA 1SO3A 5J04A 2A5HA 4AD5A 4H6EA 9RUBA 3NGJA 3TJ4A 5HMEA 4NRSA 2V0TA 4J1OA 4Q8NA 3TR2A 1GVFA 1C3FA 2VM8A 1VCGA 1Z41A 1XLCA 1EHAA 3CB3A 1MXGA 1MEHA 4OQVA 5M1TA 1GW9A 1ISXA 4UFLA 1YE4A 1RCXB 4IPIA 1O12A 2E6DA 1RSCA 3WH5A 4XQ6A 1ZJHA 4Z2JA 2ZDSA 3UZWA 5HPCA 5AC5A 5M5DA 4M51A 3OIHA 1FWHC 3S2JA 1TSIA 3R94A 3ATYA 3UVAA 3V3WA 3EA3A 3WDHA 3CIVA 5HQLA 1JCLA 2G97A 2CKSA 1GPFA 3R43A 1F6PA 1IXPA 3FV9A 1TA3A 2H3DA 5I03A 3B0UX 1TJPA 1IT0A 3WBWA 2PDWA 4EKJA 2WO5A 4JHZA 1ZP4A 4W8LA 4QE4A 3XISA 1FBAA 4C6KA 4FO4A 5GJPA 1G4PA 5D30A 3HQ1A 4RZ5A 3U8GA 3W1UA 4QJ4B 4DBEA 1HGYA 3ZMRA 4CGTA 2ON3A 1S2UA 1S2TA 1WP6A 1BXCA 4HNUA 3W88A 5F4XA 2WMJA 1QU4A 4XUYA 4LUTB 4W7WA 3PBGA 1KRMA 3TYBA 4PUNA 5DXXA 3SRHA 4Y96A 1LLOA 1P0DA 3MBDA 3EGJA 2PDGA 5EKYA 2F9RA 1TG7A 3CZGA 3TIMA 5D37A 1NAL1 1XQLA 1JD7A 1JXJA 3LI1A 1E6SM 2G37A 3EB2A 3BGGA 1KXQA 1I6NA 1GZGA 4NIRA 3ITXA 3DAQA 4QNEA 1NDVA 3B8VA 4J3SA 3EWDA 3O6DA 4QITA 2Z28A 3RDKA 3VC5A 2GJNA 3BGAA 4L65A 1FHVA 3K30A 1E0UA 3FJLA 3LCWA 3FA5A 4Y8EA 3PWAA 1KLYA 1XXXA 3QFEA 3M5VA 4NI3A 4K3ZA 1UR3M 1FDZA 4MIMA 1TV3A 2PS2A 3E0FA 2D3NA 1PVNA 2QT3A 4TXEA 4MZYA 5L9FA 4B5UA 3ARPA 4L4MA 3D46A 1F76A 1WDWA 4LBRA 2XH0A 1RJRA 2BX7A 4K7YA 3C52A 4JTLA 2EGZA 1WUFA 3RITA 1NDYA 2O56A 1S46A 1R3TA 2WCGA 3L4YA 3W1MA 2B81A 4FXSA 3NOYA 1Y5WA 3CMFA 3BXWA 4DQWA 1VLIA 3P5YA 3UCCA 4IIFA 1GVYA 5AFDA 3MO4A 1EYWA 3RX3A 3ZT5A 1AMYA 3EOOA 1DYSA 3QMRA 5CJMA 5EMKA 4U5IA 5BYWA 1YHTA 3NQMA 1ZBKA 4HPGA 1XM3A 5FJIA 1B3ZA 2WJDA 3WMLA 3PR2A 2E9MA 3TTOA 2PCEA 1A5AA 5GNXA 4NJHA 2NXGA 4IJBA 1GG0A 1JDCA 1SMDA 1XFBA 3I6RA 3WK0A 2R8WA 3W7EA 5A6MA 3G1XA 4PUKA 1MZRA 5HMFA 1MQRA 1OYBA 2W79A 2P50A 3CQKA 2AL1A 2G3FA 1DWJM 3T0DA 3C8NA 2Q8LA 4PL2A 2EG8A 1JEZA 2WVVA 4GNVA 1NM9A 4QCEA 1AMKA 1B3YA 3IS4A 1HKIA 2XGBA 4V28A 2GGEA 3RLHA 4PCNA 3SSZA 5FSDC 1UP2A 5IM51 5K7JA 3AXXA 4GOAA 5BMWA 3W7NA 3GUGA 4BK9A 5A95A 3WQVA 4L6DA 3IGSA 4OKDA 3VABA 3JU2A 4YMZA 2NT1A 3MMTA 4OBSA 2QCNA 1T41A 1LWJA 2VGIA 5BOOA 4MMWA 1W8SA 2CWNA 4IUGA 4ONVA 2PDLA 3G0XA 1EJUC 5FJUA 4S3BA 1XGEA 2PGFA 3F4DA 2ALDA 5AYYA 3DESA 1OFQA 2OLAA 3NQ2A 4EXQA 5KZDA 4UZUA 3IACA 5D2VA 3FHAA 3AIUA 3VKAA 5H8MA 3N17A 3WH9A 3WJSA 4QQ3A 3LM7A 3DGBA 1V3LA 3MMUA 2XH4A 4C6JA 2QUMA 4LAZA 2FYMA 3KWSA 4XO7A 3SBFA 3S8HA 1U5JA 1DP0A 1CI1A 3DXIA 1EJ7L 3LGGA 4BR1A 3PVFA 4GVHA 4JTDA 3RRAA 4JTIA 3CASA 3AUJA 3AIEA 4JD4A 4GZIA 4LBSA 4FNRA 2WVTA 1WA3A 2V3EA 1S5NA 3KLKA 3UJFA 3UT0A 4MYXA 2ZZ4A 4INFA 1X6LA 4GY1A 2YDAA 3PJXA 1VBJA 1G67A 1DJZA 3C56A 1MZHA 2GJXB 3I6TA 4K8HA 3GTNA 1UD2A 2NVDA 4DPPA 2QUVA 4U3AA 5U4NA 3UETA 2YW3A 3N04A 1QNVA 3UR7A 3WSUA 4G7FA 4F0HA 3UJ2A 1VB9A 1P7TB 3WL1A 3C5QA 5H6HA 1CGWA 1Q6QA 2CHNA 2XTKA 2J7GA 4HA3A 3P62A 4HSHA 4MWAA 5CPQA 3T40A 2DVXA 4OIFA 3GD6A 3WLJA 4TMCA 3BG9A 2NX3A 5XIMA 2QIWA 3VOFA 4EXBA 1Q6EA 3F7JA 4B91A 4YWIA 4N9CA 3B9AA 1HJSA 1UIPA 1J11A 1BPLB 2VO5A 4CD7A 3ATZA 4JBRA 1B9BA 4XIAA 1TPC1 2ZWZA 4HSOA 3SY1A 4KH2A 4H8HA 2ZTJA 4ZSTA 3RCMA 3SJ3A 1ECQA 1AL8A 1ADOA 4DUXA 3TSBA 3WENA 3H70A 4RK8A 2J7HA 2PRLA 3UNTA 2AKMA 2BP1A 2PUZA 4W89A 5B7ZA 3OZOA 5CZTA 4OOZA 3P80A 2XVPA 3SO7A 3PPHA 1ZNNA 3EX6A 3NL6A 2I9UA 3EBVA 1IV8A 4DZIA 3KHJA 2Z4GA 3OW1A 3EDJA 1BKHA 3C4UA 4UBPC 3CMJA 1G94A 4GIAA 3S1XA 3IGUA 1RD5A 1A53A 2ZCGA 4ZXOA 1K8ZA 3GC4A 3NL3A 3R0DA 2YX0A 4BQ2A 1AG1O 4TX8A 2NW0A 5G2HA 2VFIA 2ODOA 3OLDA 3CJPA 3KCLA 1HTIA 3OLEA 5K9XA 4XKMA 4PCFA 3QHMA 4DB7A 1QWGA 2DSUA 3VOIA 3HPAA 1QXLA 1XISA 4P7NA 2X16A 4CNSA 4O52A 1WB0A 1XHGA 3QR1A 2ESCA 4B5XA 1W2VA 2H8ZA 4H9MA 4WHBA 4AWTA 1XLKA 4WF7A 1N7KA 4D1IA 4Y9MA 1TELA 1TR1A 1EFZA 1O1ZA 2DZBA 4Z2KA 4D6FA 5TBOA 4E8DA 4DJFA 5C9WA 1XG3A 1Q6OA 2WVSA 2D23A 2WCAA 5CPTA 5AYXA 2A7PA 4IXHA 2HROA 3A22A 5A6LA 2V67A 4HCLA 1OFBA 3DDMA 5M2FX 2RAGA 1IIGA 2FGBA 1E6QM 3CWHA 4ACZB 4F48A 2J7BA 4I9JA 4QIUA 3BC9A 3BW2A 3LA4A 1XLMA 2D20A 3BH4A 1H61A 4R7OA 3TR9A 3C86A 4KPLA 3GE7A 3VKDA 2QR6A 4Y9NA 3SY8A 1EA9C 4K8GA 3RLUA 3W73A 3H7VA 5A6BD 1KM0A 4MB5A 4O0ZA 1PO9A 2W62A 3W2KA 3RRXA 4JXCA 3K4DA 3CS2A 3NDZA 3NO3A 3E0WA 3TZFA 3VDBA 4LX4A 1WBHA 4AH7A 1OGGA 1OFAA 3A3HA 3HV9A 4LTSA 1OGSA 4IJCA 3TN4A 1XYCA 3PWIA 3G77A 2R1NA 2FH6A 3CEPA 3AI0A 4RNHA 1PS9A 1ZBVA 4KMQA 5C54A 3LPGA 1LF1A 3OEXA 2OLSA 4GABA 1V3KA 2DUZA 4GFSA 1R38A 2FFIA 1CB2A 5SWUA 2YCJA 1WKYA 3M5XA 2ZKMX 3QV6A 5GVJA 3MMWA 1M1BA 1JFXA 1PYFA 4I3GA 4HGXA 2VTFA 4JTJA 4QEEA 3IJDA 4F9JA 5AZ1A 4IG2B 3ZWSA 6ALDA 3OLIA 4IISA 4ZQOA 3T4CA 5FL1A 1E6ZA 1VH7A 4HHLA 2YBUA 1HP5A 4JFSA 1YKWA 1UROA 1RUSA 4JFWA 2EQDA 3GDMA 1N55A 4KEMA 1EOKA 3D0CA 1BKSA 2EPHA 1AJ2A 1ZJIA 2VI0A 4ORMA 2E28A 3WFAA 3EKGA 3VDAA 3UWEA 1D8CA 3KP0A 4WDTA 2ISVA 3FSTA 5HUPA 4B5SA 2EPOA 1U2YA 1KRBC 1UH2A 4JQAA 2GLKA 5F4SA 3W1LA 3IRDA 4FP1A 5T8GA 2X7VA 3GQYA 4K6AA 2W27A 1OGBA 2E8ZA 4JTSA 4YHGA 1M9HA 3E5BA 2FVMA 4ALDA 2CFFA 2OZ0A 1K9FA 4CNPA 3K46A 1T96A 5C7HA 2CLEA 5LIUX 3SUWA 3BO9A 1XP3A 4ROQA 4ZB0A 4GZEA 3VINA 1A5MC 2D2HA 3W6LA 4QG9A 2RGMA 3WLKX 4CCEA 3H4GA 1DHKA 4CD8A 4MY1A 4GUGA 4GJIA 4ZVJA 3PC0A 3W1QA 4HOWA 3ITYA 3SEPA 4HU4A 4O1BA 2XVKA 1OX4B 5EL1A 2ZQ0A 6REQA 4W86A 1XIJA 3GBEA 2BGQA 2XG9A 4UMBA 1N82A 1EL3A 2RKXA 2ISFA 3EYPA 1KTNA 5CAKA 3H53A 4GC3A 1VBHA 2H6RA 2WK2A 1VFMA 3CEUA 3WMBA 3HQPA 3WQDA 1GGOA 2OKOA 3GO2A 1W1IE 4A22A 4QRNA 1PV8A 4JDBA 1HX0A 3HFYA 5A1AA 4ADSA 3SIMA 4IGMA 3QZAA 4PMJA 2V81A 1XLDA 3BAIA 3BSHA 1UUMA 3W7PA 5GJMA 3WLRA 4CNTA 2BLEA 1A4MA 2E09A 3RO6A 4LAUA 3CK5A 3O6AA 4DYKA 3W75A 1H3GA 2E3ZA 4JYFA 2BVTA 4GI6A 4REQA 3RM8A 4OFCA 4G1KA 5AHMA 1TRDA 3W7DA 4F0LA 4BWLC 3A3WA 1RH9A 1ISVA 4XIMA 1ZS2A 1F3TA 2C1IA 3QY6A 3W22A 3LXAA 3FXYA 1W5QA 2JBMA 3JZEA 3CIXA 1BSIA 3WD1A 5FCZA 4B9YA 3STPA 1X96A 2QJNA 3NYZA 2WCSA 2NUWA 3S42A 3WUFA 2GL5A 5DELA 5IDZA 3HJZA