4OOZA

Crystal structure of beta-1,4-d-mannanase from cryptopygus antarcticus in complex with mannopentaose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
368
structure length
368
Chain Sequence
SEFLKASGSNFYYGGQKVFLSGVNFAWRSYGSDFGNGQYASNGPALKDWINKVKASGGNTARVWVHVEGQVSPAFDSHGFVTSTDSKKTLINDLSDLLDYANGQNVFLILVLFNGALQNNSNVQNLFWDESKLNSYINNALTPMVNALKSKPSLAAWEVLNEPEGTLQPGSDQNSCYDTSTLAAQGAGWGGKKFPMKQILKTINWISSAIHNADSKALVTVGSWSELTQTDSFGYRNHYKDSCLTGAGGKSNGIINFYQMHTYSHSGKWNQNAPFKVNRWAYNVNDKPLLIGEFASVCSQNEGIQNLYKYAYNNGYNGALTWQFNSGGDCSDTYSNQMYGMQALKGQNDQSGGKGGMVSVNINHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-1,4-mannanase
publication title Structure-based investigation into the functional roles of the extended loop and substrate-recognition sites in an endo-beta-1,4-d-mannanase from the Antarctic springtail, Cryptopygus antarcticus.
pubmed doi rcsb
source organism Cryptopygus antarcticus
total genus 131
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2014-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4oozA00
2CESA 2F2HA 3OZPA 1NP0A 4H04A 5E9AA 3BGAA 4BQ5A 5JIPA 3AISA 2WYSA 1LWJA 1QBBA 4J3UA 4U2YA 5M17A 1BFNA 1JL8A 4UQBA 1HKMA 3AICA 1UKSA 4HOXA 1GOIA 3GH5A 4D71A 1PX3A 2W92A 5DT5A 4PTVA 1MW2A 1TCMA 1V6YA 2ZWZA 4PTXA 5LA1A 3GDBA 3NYDA 4U33A 3PZGA 5DMYA 5GNZA 3AROA 2J7EA 2VOTA 3WFLA 1QI2A 2DIEA 4LGXA 3VGBA 4HA4A 4OBRA 3O6AA 5A94A 4WSKA 2NSXA 3QOMA 5ABEA 3WQVA 4LYRA 5JBEA 1VFMA 2D22A 3GZAA 1Y7VA 5CPSA 1WAWA 1MFUA 1ECEA 3GNRA 3LPGA 1IT0A 1E0VA 2WMIA 1JZ7A 3L4VA 4W8BA 1C93A 1U30A 2QHAA 1OT2A 2BHUA 3VVGA 2E0PA 3ZQ9A 2QMKA 3IK2A 1EO5A 4YN5A 2YIHA 1HJXA 3VD7A 2VR4A 1LL4A 1GNXA 2CIPA 4HZ6A 2F8QA 2J47A 1V3MA 1E1EA 5IXEA 1QHPA 5BXRA 4XV0A 5CLWA 3SUVA 4QLKA 3A6OA 1GONA 1HKIA 2W67A 1Q6FA 4P8UA 3THCA 1FOBA 2PI6A 1GZJA 1WDRA 4NF7A 1QI4A 2JALA 1CEOA 3BMVA 3CTTA 5JUVA 1XSKA 2ZWYA 4MNLA 2HISA 2A3HA 1E56A 3M46A 2EEXA 1MVYA 1JXJA 2J7GA 1CWYA 1BYCA 4P7OA 3BCFA 2YBUA 5BXTA 1CGXA 4TOQA 4CGTA 1VEMA 3WDRA 4KRUA 4QAWA 7A3HA 1V0LA 2J7BA 3VDHA 4F9JA 4AZ5A 4PSPA 1BQCA 4URIA 3SEPA 1KQYA 4F79A 2O92A 3AHXA 1ZU8A 2OYLA 8CGTA 1IZJA 5DFAA 1UA7A 1M03A 1V3IA 2YL6A 2ZUMA 1QNSA 4GQRA 2VZTA 2WPGA 3T2QA 2WMHA 1QW8A 2JF7A 3ECQA 3MU7A 3QHNA 3DC0A 2WANA 3KEHA 1EXPA 1RP9A 2ZX7A 1NARA 1B1YA 1VJSA 4M80A 1V6XA 1B9ZA 3CZKA 5D4YA 4JHOA 2Z1KA 2DT1A 2G4FA 3A4AA 4PMOA 1CGTA 1OCQA 1HXJA 3ARRA 4CU8A 3GXDA 1UR0A 2QPSA 3MUAA 3VMOA 1K9EA 1OD8A 3WNPA 1JI2A 1SMDA 3WMSA 5CQ1A 4DUVA 2Y5EA 2J8FA 3VX0A 3II1A 4OZOA 3WH8A 3D5HA 3VIIA 1JZ5A 5CSYA 1E55A 1M7XA 2WM0A 1W3LA 4DUXA 3VIFA 4CCDA 4AIEA 3K4AA 3CHEA 4W93A 1R7AA 3ZJKA 1CECA 1W32A 1UKPA 4ZE5A 3ZT7A 3CMGA 1PBGA 2WHJA 4X0NA 1DWHM 1JXKA 3VIPA 4BQ2A 1XYFA 1D7FA 1H0GA 1Z32X 5FD0A 4Z2IA 1CIUA 1CZ1A 1MXDA 3PTQA 2PWEA 3PBGA 1EHNA 1F4AA 2XVNA 1EQPA 1W9XA 4W8AA 1ISYA 5BROA 5GNXA 3ARVA 3SUWA 5CG0A 1E1FA 3WF0A 1V6WA 3W28A 2YA0A 2A3CA 4AXNA 1JAEA 1E6PA 4J3VA 2PB1A 2D0FA 2YLLA 2GSJA 4ZENA 1GJWA 4OBSA 4H7VA 3EDFA 2YJQA 3SCWA 3CBWA 3MV11 3OGVA 3SUUA 1VFOA 1KCLA 4P8WA 4PTMA 4MADA 1JF6A 4IPNB 3RJYA 2XWEA 1E70M 3VDAA 4BF7A 4UQ9A 2E8ZA 3WD4A 4AZCB 4P7QA 1GHSA 2DH2A 5FOOA 1GOKA 2VCBA 7CGTA 4D1IA 3BSHA 4HPHA 3VIHA 2WAGA 3J7HA 1QNRA 1CXHA 3FHQA 2J25A 1E73M 3FNDA 2BHZA 4AY1A 4PYSA 3GXFA 4ATDA 4QLJA 3GXIA 3MMWA 4GI6A 1ITXA 4AIOA 2PBGA 1L0PA 3BAXA 1BG4A 4UQDA 2JEPA 4D6EA 1ISZA 1G0CA 1KCKA 1HJVA 2O9RA 1J0JA 3FAXA 2CKSA 3T2PA 4NRSA 3N04A 4Z2LA 3AMDA 2DSWA 3N1AA 1DTUA 2V38A 2VX7A 3VUPA 3ZOAA 3PZTA 3ARZA 1NP2A 3N11A 8A3HA 3M6DA 1JZ8A 1OWQA 2VCAA 4DM1A 5AYBA 3NSXA 1VEOA 1C3FA 4BQ4A 5A6AA 1V0MA 2WKLA 2XIBA 1HVXA 1KGXA 1OBAA 1E4MM 3CUIA 1KXHA 3TP4A 1Q6EA 3W4RA 3AHTA 1ZL1A 3BLKA 5DEZA 3N12A 3PN8A 1D2KA 5AC5A 1LF1A 1P6WA 1UWSA 3SUTA 3L2LA 1EDTA 2DSKA 4UOQA 1MYRA 1LL7A 4CD6A 4PEEA 3LPFA 1HJUA 3UG4A 2PF0A 2EQDA 3WEZA 1W9PA 3WH7A 1V03A 2WCSA 3WUFA 4H8UA 1XYZA 4MDPA 3ARTA 2QLYA 2Y2WA 1XSIA 1CLVA 3CUHA 1ZJBA 1PPIA 2DT2A 1JZ2A 5HXMA 4GI8A 3DYMA 1W91A 5A8NA 1K9TA 4UQEA 4W7WA 2E9LA 3O2LA 2CITA 1J11A 2ZX6A 2HVMA 3UG3A 2XFYA 4GKLA 2VJXA 2WCAA 1FFQA 4DWSB 1DWIM 1NOUA 2W61A 1B3YA 4B3LA 4PBGA 5FKYA 1UZ4A 4UFIA 2CHNA 5TD4A 1PZ3A 2J79A 3K4DA 2CCRA 2BY3A 2VT0A 4D72A 3W27A 1CPUA 1V0KA 2G3JA 3RM8A 4MJ4A 1C8XA 4W7VA 2CXGA 3MSDA 1I1XA 2XHYA 2GDUA 3VINA 5CZKA 2FHCA 3ARUA 4P7NA 1WE5A 5FL0A 1BLIA 2RGLA 4AZCA 5FIPA 1PAMA 3AOFA 1OGGA 5IFPA 1C91A 1HJSA 3NIYA 2F61A 1CTNA 1BSIA 1AMYA 3G6MA 4GIAA 3RM4A 3AS2A 1SR0A 1NQ6A 2OWXA 2GUYA 1KFWA 4UOZA 5EBAA 2V3DA 1KR0A 3S2CA 4M82A 1R8LA 1UD3A 4NRRA 1KXQA 5A8PA 3NDYA 1AVAA 4HZ8A 2VX4A 1JFHA 1K6AA 5HPCA 1EOMA 1LG1A 5M3WA 2Y4SA 1YHTA 3L4YA 5A6BD 4OKDA 1WP6A 3WD2A 1BGAA 2VQTA 2WMGA 3NDZA 3VIJA 4M24A 3ALGA 2V3FA 1XD1A 1UD6A 4J3WA 3TTQA 3HN3A 2XGIA 3T0DA 4WIWA 3RM9A 1UWTA 3W26A 1IZKA 3WH5A 3S6TA 4CU7A 4JFSA 4MNMA 3VU2A 6TAAA 2J7FA 3AIRA 5I6SA 2A3BA 1C90A 1B31A 3LMYA 1HP5A 3POHA 5C8BB 1E5NA 4UQAA 3AZRA 3EDEA 2XPKA 4X0VA 3WF2A 3WUBA 4C7FA 5C71A 2C8NA 5D8WA 3VNZA 2YDQA 5JIWA 2WVUA 3RDKA 4MAZA 2GJXB 3WEOA 2UWFA 1H09A 4BCEA 5HOSA 2WCGA 1B30A 1CXLA 1UUQA 4D6JA 2DEPA 4ZXLA 1A3HA 1E5JA 4K68A 3EYPA 1KWKA 1ISXA 3A3HA 4PMXA 1GOWA 1QPKA 4HTYA 4KGJA 5CGTA 1EDQA 1VJZA 5ABHA 2TAAA 1UKOA 3WBAA 5A8OA 1YQ2A 3AYSA 1O7AA 3BC9A 3BLPX 3ZJ7A 1EHAA 2ZXQA 4LPCA 4B15A 3OLEA 1BVZA 1C8YA 4XZBA 1WZAA 4WJXA 4ZXOA 1E6XM 2ZOXA 3CZEA 1AQHA 3MMDA 1J01A 4WSJA 2QMJA 3KE0A 1JYVA 2D1ZA 2EPOA 1CGWA 1JI1A 1VF8A 3WD3A 4U3CA 1Q6DA 4PCSA 4XB3A 4P8XA 4S3KA 4MPKA 4JAWA 1C8QA 2Y24A 3AMKA 4DWSA 5I3DA 1B2YA 1BAGA 3EDKA 5HDRA 5BXSA 3WKZA 3VX1A 3GNOA 2D2OA 4H41A 1LWHA 3W6MA 3GNPA 4J3XA 1UYQA 2BY2A 3IAQA 1EO7A 3I3EA 1J18A 1UHVA 3VPLA 3T08A 3B9EA 4A3YA 4TX8A 5A3HA 3M07A 3MUY1 4UFMA 3WNMA 2WVVB 3TA9A 1UWRA 3ARSA 3CZJA 1CNVA 1TZ7A 3EBVA 3UEQA 3OZOA 3RJXA 3B9AA 4UQCA 4E2OA 4UR9A 2FGLA 2PWHA 3WQ4A 3BAWA 4GO9A 4W85A 1CENA 2OSXA 5E6ZA 1UH3A 4FLRA 4PSRA 2OSWA 4NZCA 1QI3A 2WB5A 2AAAA 3K8LA 4AC1X 3F5KA 1E6SM 3MKKA 2D0GA 1H41A 4CD5A 4YPJA 3U5YA 3PZIA 1HL8A 3GTNA 4TUFA 2V3GA 1VFUA 2D20A 2EXOA 4QCEA 1CXFA 5BYWA 3CHDA 1E71M 1VIWA 1E15A 2VZOA 4JHZA 2XYLA 5LYRA 3T2OA 2ZUWA 1V08A 1KGUA 3AZSA 1HL9A 1WZMA 3W6LA 4AIUA 1GOQA 3MANA 4D6CA 2PC8A 2CBJA 4J3TA 2BY0A 5AYIA 3BAKA 5D9MA 2YL9A 4ZFMA 1BF2A 2J7HA 1PX4A 2AOSA 3AIQA 4ZE4A 4OJYA 3K1DA 2YBTA 1G01A 5I79A 3WELA 4EK7A 2E4TA 1ZBVA 1H2JA 2JFEX 1DWFM 2XM2A 1H4PA 3A47A 1UQZA 5CSUA 1QW9A 4ZEPA 2GJXA 1DWAM 4QDMA 5IHRA 3RCNA 1Q4NX 4PMNA 3BAJA 3VDCA 4CCCA 1AQMA 3N18A 1V3JA 3GH7A 3AIWA 3ZR5A 2CBUA 2WVSA 5I2UA 1ODZA 3F5LA 2WHLA 3WH6A 3WF1A 3W81A 3F4VA 4U5IA 4J27A 1CBGA 5ABFB 2VR5A 3IAPA 5E70A 1CXIA 5HPOA 4PUEA 1CDGA 4RE3A 1CXKA 1WKYA 1ODUA 1K9DA 1GJUA 1E6ZA 3VD9A 3U5UA 4MTVA 4V27A 1MQPA 1E4NA 3WMCA 1J10A 1X6LA 1W3HA 3WENA 4AWEA 2A3AA 2VRKA 5IFTA 3WL1A 4MAVA 5A6KA 4CD7A 2YA1A 3KL5A 5FCZA 5GQBA 1D3CA 3WQ8A 4MNJA 3WF3A 2ZUNA 4TTUA 4L4OA 5BRPA 1ITCA 3SURA 2DGAA 1MWOA 4MNKA 1HJWA 3WY1A 3VOCA 3AIBA 1Q6CA 3ZT5A 2G41A 3QHMA 4U3AA 4R5EA 5A2AA 1WCGA 2WVVA 4FLQA 6A3HA 1V3KA 2NT0A 1FHDA 5CPQA 1MFVA 5EB8A 3B9DA 4FLOA 3WNKA 2QV4A 3WDJA 2VVSA 1MXGA 4LYQA 1JDCA 1TE1A 2WMJA 1JAKA 4JFTA 1TA3B 4QCFA 5A95A 2O9OA 2D0HA 3AMLA 1GQJA 3PZVA 2XM1A 1GW1A 4MJ2A 2X2YA 1R7OA 5I77A 4CUCA 1VAHA 1OSEA 4PMRA 2D24A 3CMJA 3RIKA 4AMCA 5D9OA 4CN4A 1ISVA 3TTYA 4UNIA 2XGBA 1FA2A 2ZXDA 3WFZA 3D3AA 4UZSA 4GO8A 1ZS2A 1WB0A 4GPNA 3TTOA 2XUCA 3AXXA 2WHKA 5EMYA 3HJEA 1H3GA 2VRQA 2BFGA 4EAMA 1TR1A 3AXHA 3WL0A 2ESCA 4MDOA 1J0KA 2ZIDA 1EA9C 1DWGM 3B8SA 4JCMA 1HJQA 4HMDA 1UKTA 1MW1A 1NWTA 4JL2A 3ARQA 2NT1A 2GDVA 4W5ZA 3K46A 1HNYA 1DHKA 2J75A 4V28A 3RPMA 1HKKA 1VBUA 3VIOA 1RPKA 2V5DA 1EIBA 5AC4A 1CGUA 3I3DA 3VGHA 2WZHA 5A6MA 5JBDA 2WC3A 4XUYA 3CZ8A 3CZGA 4N0RA 3AHVA 1ZB5A 3OGRA 3BAYA 3BH4A 5I5RA 3SCQA 3FAWA 5ABFA 2OYKA 5E6YA 4PCTA 3WD0A 2WSKA 1JD9A 4RE4A 4PMYA 4AZHA 4M81A 5EFDA 3AHZA 3FY1A 1OINA 4UZUA 1DEDA 4AD5A 4UFKA 4MB4A 4S3JA 2V3EA 2WLYA 1TVNA 4FMVA 2CHOA 1BYBA 2BVYA 3DYPA 5M5DA 1QNQA 3GM8A 3APGA 1CYGA 3OA5A 3WDPP 2E8YA 1MW3A 4PN2A 3MSGA 2ZUUA 1UR8A 1E6RA 5C70A 1UKQA 4LQ1A 3E1F1 1UWQA 1FH8A 5KZ6A 1SFSA 1JZ4A 1GOOA 3WUEA 4W7UA 1EGZA 3ZT6A 4AZIA 4WLCA 3UR8A 4PUDA 1KGWA 4J3SA 4D1JA 1UR1A 1RD6A 3G6LA 4U2ZA 3WDIA 2UY2A 1US3A 3NSMA 3SCRA 3U7BA 5A2BA 4HMEA 3GXMA 4IPLA 3VD5A 1V6VA 2UY5A 4J28A 3EMZA 4TVCA 1TA3A 4HMCA 1TUXA 1E4IA 3OG2A 1B0IA 4DM2A 1M53A 1WDQA 4D6DA 4ACZB 1W1TA 1WZKA 4BS0A 1JYWA 3ZR6A 1MQRA 4HPGA 1UD5A 1WDSA 4JL1A 3ZO9A 3AJ7A 2WC7A 4AEFA 3UCQA 2VUYA 3WN6A 2FGZA 3CUFA 4B9ZA 2JE8A 4F8XA 2C7FA 2VQUA 1CLXA 1U2YA 1IV8A 3VMPA 2XSAA 4CN6A 4H8VA 1V0NA 5A6SA 2JIWA 1W3KA 4JKMA 4W89A 2WK2A 1UR4A 5EFFA 1UH2A 1NWRA 4MB3A 3BAIA 1KQZA 3WUGA 2E9MA 1B90A 2WMIB 3BXWA 1MW0A 2YL8A 2WVTA 3VMNA 4AD3A 1C7TA 1V6UA 3T09A 1G94A 2IXVA 4LXFA 2VZSA 2GFTA 2W4XA 1BGGA 3RO8A 4QP0A 1W9VA 2VI0A 4U5KA 3VM7A 1H11A 1JIBA 3AS1A 3SIMA 4TTGA 4HA1A 3VGGA 3VILA 4JFVA 1FFRA 2Z1SA 3SCVA 3OIHA 3PZUA 4N42A 2GJRA 3L2MA 4DUWA 4ATLA 4ATWA 3T0BA 2EBNA 1LG2A 5A6JA 1K9FA 1FP8A 3WSUA 1GHRA 3MMUA 1VB9A 2O9TA 4CD4A 5DO8A 4HP5A 1QI5A 5E0FA 1EH9A 1WPCA 1UQYA 1VRXA 4OOUA 4RE2A 1JNDA 4UFLA 2OSYA 3EMQA 3HU7A 4QLLA 3CHCA 1E72M 4IUGA 5A1AA 5HBFA 2CYGA 1M04A 1EDGA 5BRQA 1A47A 3CUGA 1S46A 2OYMA 1XC6A 2ZX9A 3KZSA 1H1NA 5BXPA 1X1NA 4L4PA 3W24A 4JFUA 3GYCA 4AZ6A 3TONA 3I3BA 1LQ0A 4P8VA 4F9DA 3KL3A 4AZBA 2OWCA 1XHGA 5IHSA 4GINA 4Q22A 1GQLA 1QOXA 3CH9A 3L4WA 4NI3A 2CPUA 2XIIA 3W29A 4H2CA 4UOJA 1E43A 1QBAA 1PZ2A 2VTFA 4Z2JA 2ZX8A 2E40A 1KWGA 1TMQA 3AS0A 3QGVA 4PRWA 5DF0A 2DSZA 1XCXA 4EE9A 3WQ6A 2X0HA 2XVLA 3DHUA 2IXUA 5F7UA 1JZ3A 2O9PA 5I0DA 3VIGA 3ZMRA 1JZ6A 2AMGA 4C7DA 3LPPA 3GBEA 2WKGA 1HKJA 1W9UA 1F4HA 4ACZA 2VCCA 4KH2A 1W1PA 2G8ZA 1GCYA 1TVPA 2YDRA 2C0HA 3T0AA 1VEPA 4EANA 2XG9A 3O9NA 4W84A 3FN9A 1KB3A 1XV8A 3PZ9A 4AW7A 1M01A 2XFFA 3OGSA 3WNLA 3NSNA 2J78A 3HMCA 3RILA 2E3ZA 3AS3A 4CU6A 5I23A 2GJPA 4AD4A 1ZBCA 4E8DA 2DSUA 3W0KA 2W66A 2JIEA 3W53A 1TG7A 3L4ZA 3A4XA 2W62A 2J62A 2XTKA 5HNNA 4GI9A 1QHZA 4A4AA 2WMFA 4HU0A 3UG5A 1HT6A 4AZGA 5I78A 1O6IA 1GORA 4A3HA 5A8MA 6CGTA 4D6GA 1GVIA 3TTSA 4C7GA 4XX6A 2VURA 1XD0A 1QHOA 1RP8A 3WDQA 2WMKA 4CD8A 3N17A 2G3NA 4GQQA 3IANA 3VNYA 2CBVA 3KWXA 4CN1A 2NW0A 1PEZA 3WH9A 3ZSSA 2PWGA 3AHYA 3CUJA 4WKFA 4AZ7A 3DYOA 1BPLB 1LJYA 4D6HA 4M1RA 3DECA 2WZEA 4TXEA 4V2XA 5M03A 2D3NA 2VX5A 1ZBWA 3N13A 1SMAA 2CKRA 5A6BA 3AI0A 2D3LA 1E3ZA 1PJ9A 1XCWA 2BVTA 4LX4A 4UFJA 3ZIZA 2DQXA 4CVUA 1E6QM 2D23A 2PWDA 4W5UA 2EPNA 3ZJ8A 4KMQA 5D9PA 1DP0A 3N9KA 5KEZA 3ZM8A 1ZBKA 3GBDA 2FH6A 1OIMA 4UFHA 2DPEA 3SCNA 2JEQA 5D9NA 4HOZA 1AQ0A 1G9HA 3VO0A 2VZUA 2X05A 3CPUA 3ALFA 5JBFA 3VM5A 3LPOA 3PTMA 3IJ9A 3KL0A 1QI0A 4MB5A 4R27A 2QF8A 3PZNA 3U7VA 9CGTA 3U57A 4U31A 1LL6A 1WDPA 3JUGA 4JZ5A 2DIJA 3OBAA 1W9BM 2WXDM 1FP9A 2BNJA 3K8KA 3WMBA 4OIFA 2J74A 1GVYA 3L4XA 1HN1A 4YHEA 3AIVA 1BVNP 3A4WA 2YKKA 1OT1A 1UD4A 1CGYA 5D8ZA 4AD1A 2CERA 3UR7A 1XH1A 4HA3A 3WF4A 3CO4A 4AD2A 1XH0A 3AIEA 4JKLA 1BYAA 3WNOA 2VZVA 3PZQA 3CIVA 4TVDA 3OLGA 2VX6A 4CVWA 2ZXAA 2WSPA 2ZUTA 2Y8VA 2X1IA 5E09A 3ARXA 3RMEA 3THDA 3F5JA 2VVNA 5CPTA 3ARPA 2BY1A 1B3WA 2ZICA 2DSVA 1BYDA 1HF6A 1H0IA 3GH4A 5ECUA 2J8GA 1V02A 5A2CA 4FK9A 1J0YA 2XVKA 4H8HA 1UD2A 5E0CA 2DT0A 4B16A 1OB0A 3VIMA 1LLOA 2ZX5A 3SCPA 4ACYA 1E3XA 4M29A 2ZXBA 4Q7NA 1R85A 1BG9A 2EPKX 1U33A 1OIFA 4AISA 3VIKA 7TAAA 4HOWA 1DWJM 3AZTA 3SCTA 3AXIA 2A3EA 2Q8XA 4UTFA 3VDBA 3MUIA 1KBBA 1NOWA 2WZIA 3L4TA 2G3IA 1B3ZA 4JIEA 3BCDA 5DT7A 2ZUSA 2ZUVA 1VFFA 1KBKA 4OOZA 2VL4A 1E0XA 2OLHA 4CCEA 1C7SA 4XZWA 2J4GA 1H49A 4EKJA 3QHOA 4E8CA 1UR2A 4CKQA 4IISA 3VKKA 3OLDA 1E9LA 4W86A 2CETA 1J12A 2WLZA 3NCOA 1V3HA 1JFXA 2WNWA 1BTCA 1OM0A 1H5VA 2WBGA 2XVPA 1XRVA 3WBEA 4Z2GA 1FH7A 2XJ7A 2PBOA 1ZJAA 3VGFA 2WBKA 1RH9A 4JFWA 3AYRA 3BSGA 2BXZA 3AFBA 3WDHA 2WHMA 4PMVA 2EO7A 1GQKA 4MB1A 1E0WA 3CGTA 2RGMA 3AIUA 5GNYA 4Z2HA 1C92A 3QOKA 3EMCA 3EDDA 3W37A 1GOMA 5LA2A 1XH2A 4UCFA 1UH4A 1NWSA 4JCLA 4M56A 3W82A 1NH6A 1JD7A 4PMQA 5CXPA 2YDSA 3MV01 3W38A 2EPMX 5GPRA 2GVYA 2JF6A 4KRTA 1G1YA 4OUEA 2BHYA 1WO2A 2GK1B 2EPLX 2WWCA 2BVDA 5A6LA 2WWDA 2UY4A 4GXPA 4HZ7A 3MS8A 3SCSA 3WD1A 2DH3A 1FH9A 2W63A 1ISWA 1GPFA 1PIGA 3TOPA 1I75A 1XGZA 2XVGA 3WIJA 4M8UA 2BV9A 1EOKA 4P7LA 2FHBA 4W87A 1J9YA 1BHGA 1UZ1A 1NOFA 3PZMA 1UA3A 3QR3A 1PX8A 2G3MA 2FHFA 4AEEA 4GZEA 3BMWA 2YL5A 3K8MA 4DWSD 5FL1A 1MQQA 4BA0A 4HU8A 1PIFA 3N15A 2DDXA 3WEMA 1KXTA 3UESA 3AMCA 3VD4A 5I24A 2FDMA 1KR1A 1HP4A 3VD3A 3IJ7A 3SUSA 1XSJA 3SCUA 5CLTA 2VNCA 1HVQA 1UG6A 3VTRA 3WQWA 1I1WA 1JYXA 1QVBA 1W2PA 3CLWA 4WK9A 4DWSC 4PTWA 2X09A 1GUVA 4QFUA 1QNOA 2FH8A 2Y8KA 2WW5A 4PMUA 4E4PA 4B3KA 3W25A 1N82A 5BCAA 1QNPA 2B31A 1OD0A 1CGVA 1UWIA 2VC9A 4FF5A 2W91A 4KGLA 3CHFA 2XSBA 5BWFA 1ESWA 3PHAA 3FW6A 1UWUA 5CJ5A 3M7SA 4X9YA 3POCA 4PMDA 4WKHA 1UD8A 1W2VA 2J77A 2XWDA 3PTKA 4FLSA 2VMFA 1V3LA 1JF5A 2CEQA 2V5CA 1GQIA 3AMGA 5A8QA 3UERA 3NJ3A 2X8RA 1JG9A 1VENA 3UETA 1SYTA 4Z2KA 1UR9A 1E40A 1VBRA 4Y7EA 3OLIA 1JGIA 4TVUA 4PMZA 3ARYA 1W3JA 4LYPA 4ML4A 4WF7A 3PZOA 4P7RA 3L4UA 1B3XA 4B9YA 1W1VA 2ZE0A 2YOCA 1NM9A 2BXYA 2UY3A 4AYSA 2MANA 1B3VA 1J0IA 5A69A 4JKKA 3VGEA 1Q6GA 1V02E 4D6IA 4J7RA 5ABGA 2WC4A 1TFVA 1EQCA 2IUZA 4W8LA 2VRJA 3MO4A 4NSBA 1UOKA 3WNNA 3AQUA 4BZYA 1L8NA 4D6FA 1J0ZA 1WNOA 4TX6A 1KXVA 2YLAA 1E4LA 3WQ5A 1W1YA 4GZJA 3EDJA 2CBIA 4F66A 2J7DA 3IJ8A 3NUKA 4BQ3A 1US2A 1OGBA 4GZIA 2PWFA 3ARWA 4IM4A 2W5FA 1W9DM 2XFRA 4RL3A 2QPUA 3DHPA 2GK1A 4KWUA 1FHLA 1OGSA 2E9BA 1G5AA 1JDAA 2J7CA 4AD0A 1R87A 1JDDA 1WZLA 3CZLA 4W88A 4YHGA 1NWUA 1X6NA 1JYNA 3ZSTA 2CNCA 2DT3A 5IDIA 3MUZ1 1R86A 4WKAA 5AY7A 1J0HA 2EJ1A 3FXYA 2VO5A 1CXEA 1HIZA 3VGDA 5LA0A 2BS9A 1E6NA 3FHAA 2YA2A 3SCOA 2X0YA 3ZJ6A 5CGMA 1HX0A 2OWWA 1JNEA 3OB8A
chains in the Genus database with same CATH superfamily
3OHIA 2P3EA 4IUOA 3BGAA 3R12A 3SY1A 2QXWA 2A7RA 1QW7A 4QS6A 5T9CE 2G4JA 3UWWA 4GABA 1LWJA 4AB4A 4RLIA 4J3UA 3TU9A 1BFNA 4D8AA 3E49A 3AICA 1TPH1 4HOXA 3GKAA 3QKZA 4R34A 1PX3A 4PODA 4MOZA 2PDFA 3GR4A 4ZO6A 3S5ZA 4ECLA 3SO7A 5CC3A 3W22A 3GDBA 2PDKA 5E5CA 3VUSA 4C1KA 4O13A 1JPDX 4HMNA 4JX4A 5K7JA 1QI2A 3R13A 4S38A 4LGXA 2EJAA 3MPGA 1EPXA 4JNMA 3LV6A 2Y7EA 6ENLA 1OX4A 2BGNE 4LYRA 1Y7VA 4XZHA 1M65A 1ECEA 3CAKA 1IT0A 1E0VA 4IXXA 5F1UA 4ZQCA 1OT2A 2QMKA 3GFXA 4DZ5A 4LVDA 3ATZA 4DPPA 3A23A 1HJXA 3VD7A 2VR4A 1LL4A 1GNXA 1HG3A 3MP5A 4YTTA 4LF1A 1MUMA 3SUVA 3W76A 2QIWA 5AECA 3KHDA 3A6OA 3P82A 4DAIA 2GOKA 4P8UA 1FOBA 4ZZ9A 3VOIA 3H7VA 3MCMA 4NF7A 1LOSA 1W5NA 1CEOA 4DXKA 3MC5A 2ZWYA 3T9PA 2A3HA 3BTNA 3E2SA 4WEVX 3W7PA 1L6SA 1YDVA 1EP2A 3LLDA 4G9PA 4ZO8A 4DJEC 4P7OA 4ASTA 3BCFA 2YBUA 1UZDA 3L12A 4EF9A 2P76A 4M1BA 4IJCA 3H22A 3KBNA 1VEMA 4KRUA 3TN6A 3S2NA 4KCWA 1SR9A 1I4NA 5CZJA 1XL9A 2E5CA 1OK6A 8CGTA 1H1ZA 1UA7A 1W8GA 2QCNA 3GX9A 1R3TA 1QMLA 1V3IA 4PULA 3P14A 2VZTA 4K36A 2NWSA 5C54A 1TRIA 2WMHA 3DC0A 3PF3A 4EOUA 2WANA 1EXPA 1NARA 3GIPA 4V1XA 1YRRA 4M80A 4MUZA 1OADA 4QDPA 1BEUA 2V8ZA 3L0KA 1V6XA 3NZRA 3CZKA 1EEPA 1XX1A 5CC5A 3V0SA 4AY7A 5CEWA 2JGYA 1VCGA 2G4FA 4PMOA 1OCQA 4GRSA 4O4VA 4XVEA 3W87A 1MUWA 3EWYA 1UPMB 5IOBA 3GXDA 3TJXA 3MUAA 2B7OA 3KCOA 4EP8C 5RUBA 4G1NA 4MFDA 2Y5EA 3VX0A 3II1A 4OZOA 4C6LA 3VIIA 3A3WA 1JZ5A 1DJNA 5CSYA 1UW9A 2QEZA 1M7XA 4LTSA 1NDYA 3ATYA 4TU1A 1W3LA 4AIEA 4KWOA 2J13A 4S3BA 9XIAA 3N4EA 1OYBA 1W32A 2R14A 1IQ8A 2WHJA 4O54A 3OO2A 1QAPA 2HS8A 4RW5A 5HJXA 5FD0A 4C1NA 2PWEA 1F73A 1TV4A 2ACRA 4MZ8A 1EQPA 4FEZA 1Q6LA 3ARVA 4GY7A 5CG7A 1E6PA 4B5XA 2YLLA 1GTEA 2Z2BA 4MM1A 5FA5A 3O6YX 1QPOA 4UTIA 4H7VA 2OOGA 1NSJA 1VFOA 1W3IA 3ZR4A 1PYFA 4GY0A 1GWJA 4LUSB 3V5CA 1JF6A 2ZZ1A 2XWEA 2VEGA 1XYCA 4L6HA 1KV8A 3EXTA 1GHSA 2OGJA 1GOKA 4D1IA 3VIHA 3EB2A 1G7UA 3FCPA 3J7HA 4E2BA 1QNRA 1CXHA 1JPHA 2OT1A 2A7NA 3GU9A 2J25A 2AKMA 4WUIA 1AH0A 3GXFA 4ATDA 1K8ZA 3G1XA 4UTHA 4LS0A 2CLMA 5EKYA 3WQDA 1OYCA 4AIOA 2PBGA 3BAXA 4GGHA 1XR2A 5FAJA 3OBEA 1ISZA 1A5CA 1KCKA 1V79A 2PPGA 3F4DA 4L65A 1JRBA 3RPTA 1O68A 2WV8A 1R9YA 1X97A 1I2QA 4C6BA 4ORIA 2BGSA 3E6EA 4WX2A 4X60A 3H24A 3K13A 3BCJA 2H8XA 3IIXA 3PPCA 1QTWA 1XFCA 4DM1A 1KLYA 1C3FA 3A24A 4BQ4A 3MTWA 1KD0A 1PKLA 4IG2B 4PCPA 1QPQA 3PBWA 4M3PA 5C2XA 3V18A 3G5EA 2G0WA 4PBFA 3L5MA 3PN8A 1MZHA 1UWSA 4IOTA 4MKVA 3CASA 1MYRA 4CD6A 2R24A 3LPFA 1LBLA 2P53A 3UGVA 1W9PA 4RV3A 2X0SA 4ZFCA 3CV7A 3EWXA 3M0KA 5HJLA 4UTWA 4ZL1A 1XSIA 3CUHA 1ME8A 1LP6A 1ZJBA 3WQOA 5K2ZA 1QUMA 5HXMA 1CW2A 3DYMA 4CNOA 2A5HA 1J96A 1VP5A 2CITA 3RU6A 1IEVA 3C61A 1YE4A 2ZX6A 1WXJA 4OUIA 3ZVHB 2WCAA 1OC5A 1FWAC 3QVQA 2W61A 1B3YA 3NQVA 1XRTA 4B3LA 4PBGA 4PMJA 4GVHA 3DFOA 1A0DA 5TD4A 1PZ3A 1S2TA 2BY3A 5KTLA 1PUDA 3W27A 2RFGA 3RM8A 3CLMA 3NEHA 2CXGA 3KP1A 4Q7IA 2XHYA 2GDUA 1FRBA 2VUNA 5D03A 4GZ7A 3SN1A 4GXWA 3GQYA 4LAKA 4REQB 4UNKA 1V77A 3AS2A 2I7GA 1VHCA 5ECVA 4K7VA 3VZZA 4ZTYA 1IT7A 1KR0A 1R8LA 1UD3A 2YX0A 2VX4A 1JFHA 1M9HA 4KW2A 1LG1A 5M3WA 4TV5A 2QUNA 1GYNA 1YHTA 1P1XA 3WD2A 3BVJA 4P61A 4M24A 3V1PA 1XD1A 2DJLA 3TTQA 3W1XA 1XXXA 1VFLA 1I60A 3W88A 3F7JA 3WH5A 3NOEA 4FOUA 4PCFA 4GC3A 4AAJA 1JQVA 4JFSA 1XW8A 3LMYA 1HP5A 3GY1A 4Y9MA 2C1IA 2PDNA 1J93A 5G2WA 3WUBA 1IE7C 3VNZA 3RDKA 4MAZA 2PGWA 2UWFA 3TSBA 4AU0A 4BCEA 5HOSA 2WCGA 4D6JA 3W7KA 2DEPA 4ZXLA 4RUBA 3FVMA 3HQPA 4ZQOA 4Z1DA 1TSIA 3A3HA 1QPKA 2PE4A 2YCEA 4HHPA 5F2IA 2J9YA 2RHGA 2YPIA 1O7AA 3YPIA 2XIOA 3BC9A 1R3RA 3ZJ7A 8RUCA 4LPCA 1HFBA 2ZZ6A 3XIMA 4FSAA 1E6XM 3HPXA 5XINA 1TTIA 3MMDA 3UZYA 4NYUA 2EPOA 3MSYA 2GUUA 1E0UA 3WD3A 5HMDA 1WV2A 2ATSA 4MPKA 3UXKA 4JAWA 3P5YA 5I3DA 3EDKA 5HDRA 3WKZA 1VC4A 3PY2A 3GNOA 1OFBA 2D2OA 1XPYA 3W1RA 4KCVA 4Q8NA 1S2VA 4LU0A 4O28A 5DMLA 2CXEA 1AG1O 1FQ0A 4HCDA 4L64A 2RDTA 3CZJA 5FACA 1CNVA 4JEJA 3EBVA 3TQPA 3B9AA 1XYLA 1W5OA 2FGLA 1A5BA 3TCSA 3MHGA 2X42A 3BAWA 2AQWA 3HG5A 5E6ZA 1R3WA 4MWAA 3NZPA 4PSRA 2OSWA 1VR6A 4NZCA 2CZVA 2V2DA 4A3QA 1W1IE 2WB5A 2AAAA 4Z42C 3CL8A 1EB3A 4DJED 3S5SA 4FX6M 1PSCA 2Z2UA 1FKWA 2DZSA 1FWBC 4TUFA 2V3GA 3WO8A 2D20A 1CXFA 3CHDA 1XLEA 3LMZA 4ERAA 1E71M 1VIWA 1UR3M 4INFA 3CQJA 3T2OA 3TVAA 4GJJA 2V5JA 3BANA 6ALDA 3AZSA 4EPBC 3P0XA 3MANA 4JN8A 2BY0A 3SSZA 3LM7A 2BXVA 1GT8A 3R0DA 4MFEA 4B2DD 3OJGA 2ZQ0A 3HQOA 2CLLA 1PX4A 4ZE4A 4OJYA 4QGCA 5I79A 4NZ3A 4IFRA 2JFEX 3DKLA 5D2WA 2W0UA 1DWFM 2PDPA 3A47A 2O4QA 3WBWA 5H2ZA 3Q37A 4ZEPA 3NGFA 1TO3A 4QDMA 4L1XA 4PMNA 3BAJA 3HV8A 2V6AA 2PU0A 3N18A 1SM9A 2CBUA 2VWSA 2I56A 1ODZA 3F5LA 2WHLA 3WH6A 3WF1A 4U5IA 4J27A 3H2NA 1EL3A 1SGJA 1CBGA 5ABFB 3IAPA 1A4MA 3GVVA 4S3EA 1ODUA 1K9DA 1GJUA 1E6ZA 3VD9A 4MTVA 1SFLA 2A6NA 3OZMA 3B0UX 4PR4A 3RLHA 3B8UA 3TA6A 3SY5A 2ONEA 1G4TA 3GG0A 5D2XA 2A3AA 4O1FA 3G1AA 1X7IA 3WL1A 4I7VA 1FX6A 5A6KA 4CD7A 5HAOA 3H2CA 4MNJA 1A0EA 1R2SA 1J2BA 3H23A 4MG4A 3A3XA 4J9JA 5FF2A 3LTYA 1Z7AA 3OZYA 3ID7A 4ZODA 4XSLA 4Q4RA 1WDWA 5J5DA 3WY1A 1TIWA 3AIBA 3W73A 3QHMA 1AJ0A 4R5EA 1R47A 3KVLA 4DJDC 2NT0A 3U0HA 3FSTA 2IPFA 1MFVA 3B9DA 4WR3A 1TWZA 2QV4A 3WDJA 3UVIA 2A7PA 1JAKA 2O55A 2IQDA 5A95A 1I45A 3LHWA 4M5PA 5C9ZA 1XBVA 2V2HA 3UD6A 2DZTA 4IIHA 4Q8OA 4XIAA 4CUCA 1OSEA 3RIKA 5D9OA 2EG7A 1EBHA 3TTYA 2PD9A 3LBMA 2ZXDA 3D3AA 4CNSA 3TTOA 4GPNA 4PTNA 2AAMA 1XRSA 4GUGA 1KFLA 7TIMA 4JIHA 1F5ZA 4X3ZA 3HJEA 1H3GA 2E6DA 1FXQA 1HW6A 4K2SA 5HA7A 1EZ2A 3GYEA 1KFEA 3WL0A 2ESCA 1J0KA 3NPUA 3CT2A 1DWGM 4JCMA 1UBPC 3K30A 4HMDA 3R94A 1FCUA 3ARQA 1IEIA 5G1TA 1WQ5A 3OA3A 3RPMA 4QS5A 2NQ9A 3SB0A 4DHGA 5AC4A 1TWDA 2OVLA 4H7CA 5HNUA 3M5ZA 3ONCA 3ZWSA 2PDLA 2X30A 5JBDA 4IMGA 4BI5A 2PDBA 3NQFA 4DJFC 1PO9A 4ZTXA 4XUYA 3TSDA 1D3GA 4GUHA 1I2NA 1ZB5A 1FDJA 3RFAA 4PCNA 3FAWA 2WSKA 1OX6A 3WLLA 1JULA 4RE4A 3LV5A 2V30A 4I6KA 1H50A 1TV7A 3FY1A 3RR4A 3T7VA 4WGXA 4AVNA 4AD5A 3KZPA 2V3EA 3WQPA 4DNMA 2YBVA 4YS1A 1YXDA 5M5DA 2PODA 3C6CA 3LA4A 3WDPP 2E8YA 3VOHA 3MSGA 1FVPA 3SY8A 4LC6A 3GDLA 3EWWA 1FXPA 5C70A 5C7HA 1BTMA 4LQ1A 3AO0A 1UWQA 2ZBTA 4B4HA 1UB3A 4GYPC 3GG1A 3WUEA 4W7UA 5DLCA 5F2LA 1VFHA 3ZT6A 3APYA 1Z3NA 1A5NC 4PUDA 4J4KA 4O1CA 2QKFA 4U2ZA 1QK0A 3VE7A 3WDIA 1U5JA 2QAPA 1US3A 3NSMA 5CGQA 4HMEA 3W1PA 3SGGA 2UY5A 4J28A 1TUXA 3OG2A 4HN4A 2QDGA 4F4RA 4H9VA 5L6UA 1EC9A 1MQRA 2PDGA 2RKXA 3ZO9A 3UCQA 4Q8VA 4L56A 3GTHA 3WN6A 4XD3A 1K02A 1UBSA 5LGXA 1CLXA 1IV8A 1Z8AA 3M64A 4IIGA 4NG3A 2XSAA 2HBVA 4GUFA 2EAWA 3PUEA 1TX0A 1V0NA 2JIWA 4JKMA 5EFFA 1UH2A 1M7JA 2L5HA 2PWVA 4LVBA 4QAIA 1B90A 3AWNA 3WCZA 1MW0A 2FPYA 2YL8A 3HPFA 2INEA 3LCLA 4GK8A 4IGNA 4AD3A 1C7TA 3E2RA 3CWNA 2ZRYA 4MHBA 5E93A 4X2RA 1G94A 2VZSA 1VYSX 3GVQA 2VWTA 4QP0A 4DF2A 3OG3A 2CLPA 2VI0A 4QHRA 2QCHA 3HFYA 3AS1A 3SIMA 3C0JA 4HA1A 3VGGA 1XYBA 2GJRA 3L2MA 5T8GA 3T44A 3SQLA 4ATLA 1MXSA 1ZY9A 1LG2A 1W8SA 1GHRA 3BLLA 3NR0A 1DJYA 3NURA 1VB9A 4PE8A 4DWDA 2GJNA 1UQYA 3QY6A 4OOUA 4Q8WA 4UFLA 2HXUA 2C6QA 3CTLA 1B54A 2OR2A 1ZGDA 4RW3A 3LLFA 1EDGA 2AQOA 1A47A 2REQB 3E3HA 2GGIA 5AHEA 1KV5A 1H1NA 3F2BA 1XLJA 2C71A 4ILSA 3GYCA 3ZLFA 3QY7A 3IVTA 4AZBA 5FJOA 2X1TA 4GINA 3ISIX 4Q22A 1QOXA 1TX2A 3CH9A 3U3HA 3L4WA 3LX9A 3W29A 4H2CA 1PVNA 1DE5A 1PZ2A 2VTFA 4RPPA 2A3LA 1KWGA 1TMQA 1XCXA 2VENA 4YCOA 2X0HA 3W84A 2Q01A 1AL8A 4HPNA 2NVCA 2F9RA 3PNZA 2GGJA 2PWUA 3FYYA 2CZ5A 1F4HA 1H1YA 3A5VA 4MJZA 2H90A 4ACZA 1W1PA 3FA4A 2C0HA 2E5DA 3TMQA 4EANA 2XG9A 1GGOA 3O9NA 4N02A 1KB3A 4JPGA 3H2FA 1M01A 4UR7A 1W3TA 2XFFA 2PDXA 2J78A 2E3ZA 3EEZA 4CU6A 1NFPA 4A2SA 3LCIA 2INFA 2W66A 3R79A 4AHQA 3WLRA 1JUBA 3A4XA 1EGMA 2J62A 2XTKA 4LV9A 3W7GA 3M1ZA 1KKRA 2W9MA 2WMFA 3L65A 1MRAA 9XIMA 2ZKMX 3UG5A 1HT6A 5I78A 4WDXA 1TVLA 1YNQA 4ZB5A 3V0UA 3WLJA 6CGTA 1GVIA 1POKA 4XX6A 3RHGA 3WLPA 3P2VA 3QQ0A 3N6QA 3IV8A 3H26A 3P6LA 3VNIA 5GJNA 3MW7A 1RP8A 2VFDA 3N2CA 1ZCCA 2R6OA 3WDQA 2WMKA 1ZPTA 1TPVA 2G3NA 4GQQA 4LW7A 5TNVA 2CBVA 1GQNA 4L80A 3MQTA 3ITOA 3EXSA 2NW0A 1PEZA 3TUUA 1A53A 1TPB1 3ZSSA 3WG6A 2C19A 1NDZA 1PV8A 4WKFA 1KC7A 4JDBA 5DQPA 4I5UA 1J4EA 4C6CA 4M1RA 3KBSA 4F2TA 5M03A 5BRBA 2FGBA 4EWJA 1ECQA 2DZXA 4F3HA 1PKMA 1PJ9A 1XCWA 2FZBA 2DQXA 4HU4A 4CVUA 2G3FA 4W5UA 1RVKA 3HQ1A 5D9PA 2R82A 3N9KA 5KEZA 3ZM8A 2Z0IA 3MZ2A 3A9IA 4GNKB 2DPEA 3SCNA 4QR6A 3VO0A 1UIPA 5K3VA 2EHHA 5T91A 3VM5A 4GBUA 3LPOA 3KL0A 1X8CA 2OT0A 1P48A 4LF2A 2QF8A 2ISVA 2QIIA 1PZ1A 1C9WA 3H54A 1WDPA 2F6UA 1W9BM 2PCQA 5I3KA 1FP9A 2XIQA 3K8KA 3WMBA 4OIFA 2NVAA 3TC3A 3M43A 4YHEA 1TJ1A 2I16A 4H01A 5D8ZA 4LEQA 4JIQA 3UR7A 4AD1A 3LRMA 1XH1A 2G37A 3CO4A 4OTKA 1Q4WA 3WNOA 3UWZA 4K1GA 2E67A 3CIVA 1NJJA 3R25A 4CVWA 1OY0A 1ME9A 1ONWA 2CZEA 2ABBA 1LUCB 4OU1A 2XH4A 3ARXA 3RMEA 1PTDA 4KIRA 3C86A 2VEKA 4M0XA 1LOQA 2X7VA 4IMCA 3ARPA 2BY1A 2ZICA 1AW5A 2C1HA 5A2CA 5E0CA 4TMBA 2DT0A 1LLOA 2ZX5A 4A29A 3FOKA 1E3XA 2X41A 1WOBA 4M29A 3TNBA 3EWBX 1VJIA 4Q7NA 1R85A 1VCFA 1OIFA 2Z1VA 3VIKA 1W37A 5T9BG 5AHNA 4HOWA 1DWJM 3SCTA 1XDMA 3ITTA 3PNUA 4UTFA 1UUMA 1KBBA 3MUIA 1B3ZA 4O17A 2CLOA 3CV6A 4FXFA 4US5D 3SJNA 5E1QA 2ZUSA 2WJDA 4DYKA 2OLHA 4FX7A 1C7SA 4XZWA 4IFKB 4PEKA 3W23A 4H9UA 4EKJA 4DJFD 1QR7A 3TQVA 2DUZA 4IISA 2PA6A 3VKKA 1RXOB 3PS7A 3HTWA 2WLZA 3NCOA 2Y89A 5EPDA 1H5VA 2XVPA 3WBEA 1V7YA 1L6GA 2XJ7A 2NQZA 3VGFA 3NL3A 3WDHA 1PWMA 1S5WA 4HSNA 4GWEA 4WDUA 3PUDA 2GUBA 2INZA 1W3NA 5GNYA 3W37A 1FCBA 1XIFA 1XH2A 5DXYA 8XIMA 4ZMGA 3M41A 3FJ6A 1NWSA 3MHFA 1F6KA 2C18A 4M56A 4L61A 3KBWA 3G0SA 2FLIA 5HWMA 2DZVA 2VHLA 4AVFA 2EPMX 3W71A 4JTDA 4OUEA 1WO2A 1THFD 2WWCA 1PHQA 5A6LA 1IEQA 3RNDA 2DU2A 1XPGA 2RUSA 4XTIA 3SCSA 4ZGYA 2R1KA 3TXVA 1MNSA 4IPIA 2WJEA 4Z0SA 1PIGA 4A22A 3TOPA 4OVXA 4GQGA 3R8RA 4P7LA 4MY9A 3UZZA 1P7TB 3PR2A 3DZ1A 5TF0A 4D8ZA 2YL5A 3IGSA 1ITQA 4HU8A 3N15A 1K1DA 2DDXA 2NX3A 4GX9A 3UESA 2VR2A 5LNWA 1KR1A 5U4NA 3SUSA 4HBKA 5M2FX 5EU9A 4ZCWA 1ZQ5A 4DJDA 1XFBA 2VNCA 1HVQA 3OYZA 3WQWA 1I1WA 4J2MA 4DWSC 2FZDA 3TXZA 4PA8A 1Q3NA 1QNOA 4HD5A 2QQ6A 4NX0A 3W25A 1N82A 2ZA1A 3UF9A 5BCAA 3B8WA 3DEQA 1AZ2A 3GNXA 3CHFA 4TR9A 2POZA 5BWFA 1ESWA 3UWVA 4OECA 4ICMA 4PMDA 4FNSA 4WKHA 3U4FA 4AMAA 4C90A 1V3LA 5C55A 5CSSA 2V5CA 3AMGA 1U1JA 3N2XA 4YYCA 3UETA 1QWGA 2BODX 1E40A 1UJPA 2D2JA 3OLIA 4NZJA 4DO5A 3NYZA 2DV0A 4LYPA 3QFWA 3EKZA 4B9YA 1SZGA 2FZ9A 4LCSA 4J2PA 1S1RA 1QT1A 4IMEA 2MANA 4JIIX 5A69A 4JKKA 3VGEA 4OE7A 4D6IA 4LANA 4QE4A 2QDHA 2A2IA 3DFSA 3GUGA 3WNNA 1UOKA 4XG1A 4BZYA 3QLDA 1XM3A 4UTMA 3B9NA 4D6FA 2XU2A 3GU1A 4ICCX 1KXVA 3GIQA 2G95A 2I17A 1G4EA 2PDQA 3EDJA 3IJ8A 3NUKA 4GVGA 3DUGA 4BQ3A 4HHHA 3W6YA 1A5LC 1AH3A 4KCTA 1YE6A 2QPUA 2ZRXA 4YL2A 4KWUA 4YVVA 1OGSA 1TWIA 1M68A 1Z6KA 3C2EA 2J7CA 3GU2A 1R87A 1WZLA 3CZLA 4UCGA 1TJPA 2J9XA 1NWUA 2VEPA 2CNCA 2DT3A 4LFYA 5AY7A 2VO5A 1HIZA 2PLJA 3VGDA 1N7KA 1KA9F 1FCQA 1G4PA 2BS9A 4UTTC 1XLBA 2OCZA 1W5QA 3BG5A 3OQ8A 2YCJA 3GFZA 4KPLA 1V4YA 3DGBA 3W7JA 3OB8A 3A13A 1TUFA 2CESA 4GYPA 4M6UA 4H04A 1HTIA 2DP3A 5JIPA 3AISA 4EPKA 1M3UA 2WYSA 3NQAA 3ZZ1A 5HUOA 4H6KA 5M17A 2X1UA 1TZZA 2HSAA 3GH5A 1G67A 2OQHA 3LHTA 4A21A 4NAFA 4KFOA 1D3HA 2ZZ7A 1DKWA 2PLKA 3T42A 3VNKA 3WJWA 5DMYA 4RXFA 2TMDA 3RX3A 4HJFA 2YCKX 1XG4A 3MSRA 1SO3A 2DIEA 4OBRA 1HGYA 4Q4SA 2NSXA 4LWWA 3W7EA 1S5VA 3GZAA 2HTMA 3Q94A 4EPDC 2EG6A 3N2OA 3GNRA 4E4UA 3PWGA 3L4VA 1U30A 2BHUA 4TIMA 3VVGA 2QGHA 3IK2A 1EO5A 4YN5A 3NTYA 3UWUA 2OELA 2CIPA 4I5RA 2J47A 1V3MA 2F6XA 3QZAA 2QUMA 2Q02A 1RCQA 3UYIA 3N2TA 4C65A 1HKIA 3GK0A 4I6VA 4EF8A 1Q6FA 1WDRA 4YWSA 3F1QA 1OFAA 1UPPA 3KTCA 4CQBA 5JUVA 4MYAA 1E56A 2EEXA 5BZAA 1MVYA 1JXJA 1CWYA 5CKSA 3AAMA 3TWBA 3VC6A 3CUZA 1EYEA 1M7OA 3CO8A 5FJRA 6XIAA 4HYVA 3ANUA 3GVRA 5CJMA 3HG2A 3P93A 3ENLA 2ODOA 4F9JA 4FZIA 4AZ5A 3SDOA 3NVTA 2O7QA 3G22A 5LIWX 3I10A 4S2BA 1I6NA 5DFAA 3MJYA 5FJJA 4YLWA 1M03A 1QNSA 4F0LA 4IPJA 1GVFA 4LYKA 3ECQA 2GL5A 3K1GA 5EMLA 3GR8A 2PD5A 5FSDC 1XLAA 2VFIA 2BOGX 2GVJA 1B1YA 3L5LA 4WY0F 1LBFA 3LOTA 4XD5A 4EXQA 4NASA 1OK4A 3A4AA 3JZEA 2OQYA 3ARRA 5CPMA 4ZSTA 3KLKA 3KOYA 1K9EA 3TQKA 3TN4A 5J8LA 3WNPA 1JI2A 1SMDA 2P3ZA 5CQ1A 4DUVA 2NV9A 2J8FA 4XD6A 1DOSA 4FXJA 1OCJA 3C8FA 4J35A 3QGKC 4Y6GA 3IS4A 5IM51 3VIFA 1W17A 2F38A 3TCEA 1P0EA 4E38A 4H00A 1TB3A 3NQ2A 2B4GA 3C0LA 1PBGA 3DFYA 1JXKA 4BF9A 3MWAA 1CI1A 3LU2A 2XH2A 1D7FA 1Z32X 1GEQA 1W9XA 4W8AA 1ISYA 5D2YA 5BROA 5EMJA 3SR7A 3SUWA 4JNZA 1UP3A 3W28A 1QDSA 4J3VA 1XC4A 3W9ZA 3L9CA 2OQLA 2BWGA 1VRDA 3UJRA 3W2MA 2YJQA 3CBWA 3L0GA 3OGVA 3Q58A 3SUUA 4ZOCA 1KCLA 5BMWA 3FEQA 4P8WA 4PTMA 2Z7KA 3RX2A 2PDCA 3S9YA 1E70M 5FI8A 2RJGA 2Z6IA 2FZ8A 3AJXA 3VDAA 4L1WA 4UMCA 3WD4A 2DH2A 2R1NA 2GZXA 3O6CA 5HMEA 3BSHA 5DCDA 2WAGA 1V5XA 3VNLA 3TSMA 4NJKA 1KRMA 4L4LA 3LYEA 5HUPA 1E73M 3FNDA 2BHZA 4PYSA 4FR6A 2GVLA 3GXIA 1TRDA 2ZRVA 4J5NA 3NQDA 3XISA 5LNSA 4MGGA 4S3GA 7XIMA 1BG4A 1RV8A 2BBFA 3IARA 3W75A 1J0JA 3FAXA 1G6CA 5I7GA 4NRSA 4Z2LA 3JR2A 3N1AA 1ALDA 3B8TA 2VX7A 1HL2A 3PZTA 5HMSA 1FDZA 1NP2A 4UTKA 1LM1A 1OVDA 3NQCA 1C9DA 3EGJA 2VCAA 3IEBA 3E0IA 1JCTA 3NDOA 1FWIC 1T99A 1V0MA 2DUAA 1WKEA 2XIBA 1HVXA 1NFGA 1KGXA 3D6NA 1FWTA 1KXHA 4O0ZA 2TPSA 3OTRA 1Q6EA 4JNYA 3VC5A 5LIKX 3FS2A 3BLKA 5DEZA 4GQ0A 1D2KA 3ABQA 3GHRA 3LUTA 1SFJA 4UOQA 1GK8A 4ROQA 5B7YA 3ITGA 2EGZA 2PF0A 3WEZA 3WH7A 1V03A 3DAQA 4LUIA 1XYZA 4RDYA 4HVXA 1XP3A 2Z26A 1RZMA 2DT2A 4RDVA 3FYPA 1AW1A 4BKNA 4EWND 3UWYA 4XKYA 4W7WA 2E9LA 1XQKA 1GG0A 4YU1A 1J11A 3UG3A 1TV8A 4GKLA 4DUOA 1FFQA 4Q33A 2J79A 3K4DA 4FNRA 3U2OA 4BEQA 3KBJA 4D72A 3M16A 3EB3A 3G77A 1CPUA 1C8XA 2JKPA 5LNUA 2IQ0A 1I1XA 3VINA 3SRHA 3W2KA 2TRSA 1AA1B 3CNYA 4F2BA 1BLIA 4K6AA 2RGLA 4MWAB 3DHDA 4UTJA 5IFPA 4KFPA 1JEZA 3NIYA 3S5NA 2XIJA 3BQ5A 1BSIA 1AMYA 4GIAA 3UFYA 4IPPA 3MJMA 2GUYA 5AYZA 4UOZA 3HBLA 3LRLA 3S2CA 3OIXA 2XDFA 4NRRA 4C6DA 1EC7A 1GEHA 2Z7GA 2OX1A 4LY4A 2Y4SA 5A6BD 1WP6A 1S2WA 3B0XA 1BGAA 2VQTA 2WMGA 3NDZA 4L6OA 3VIJA 5A5WA 1T8XA 2QUTA 3C2RA 3THQA 2XGIA 4NAEA 4LSBA 3RM9A 1UWTA 4FO4A 1REQA 3QQ1A 5CZTA 3S6TA 4CU7A 5LZLA 1HO4A 3VU2A 2HV5A 4GJ1A 3S83A 6TAAA 4PZVA 3TLQA 3NZQA 3FEMA 3VFLA 5I6SA 1F3EA 1B31A 4H9XA 3POHA 1NAL1 5C8BB 3FJLA 3EOOA 3VKAA 3C2VA 3AZRA 3WLNA 4C7FA 3BLIA 3MKCA 2QUUA 3NZGA 2FFCA 3B40A 3C56A 5JIWA 4HIBA 1AJ2A 2R1MA 3B3DA 1UUQA 2XH7A 4ZR8A 5KZEA 1PHWA 1E5JA 3NEVA 3EYPA 3O8AA 1ISXA 3KRSA 5AZ0A 3HPSA 3RCYA 2QCFA 2ATMA 5C0QA 1EJ7L 2XN1A 1SU5A 4KGJA 5CGTA 1EDQA 1VJZA 5IBXA 5LXXA 3Q67A 2QF7A 2J27A 2ZTKA 3SIZA 3CQKA 1RLDA 1J79A 4CQ8A 4K1WA 4KEUA 4WJXA 4JTSA 3W1MA 2HE8A 2FJKA 2D1ZA 1CGWA 2OO0A 1P0NA 1Q6QA 4XB3A 3V4BA 4P8XA 3PUOA 3BJTA 2CLHA 1C8QA 2Y24A 3AMKA 4DWSA 5BXSA 3L23A 1D8WA 1CLKA 2H8ZA 4H41A 3FGCA 5XIAA 2BY2A 3IAQA 3VPLA 5AHIA 4CQAA 2ISDA 3M07A 4JHMA 3G1DA 2GOUA 3TA9A 4DY1A 3ARSA 3EX3A 1TZ7A 4LVFA 3UEQA 4LUTA 3OZOA 3RJXA 3U9IA 3MZNA 3DG3A 4UR9A 2PWHA 3WQ4A 3L7RA 4W85A 1A50A 3EWDA 1UH3A 4DIAA 3QJAA 2HK1A 2WJZA 2VM8A 4BWLA 1QI3A 1Q7MA 3KDNA 3CPRA 4AC1X 3O3RA 3MKKA 2D0GA 1H41A 3L5AA 5C9RA 4O10A 1ML1A 2B0MA 4GYKA 2PUZA 2EXOA 1XGEA 5BYWA 1B4KA 2VZOA 3O7UA 1V08A 1KGUA 3THAA 3OVQA 1WZMA 4D6CA 3FK4A 2PC8A 2PF8A 4C6PA 3P61A 4CQDA 1YMYA 5JU6A 1V93A 3AC0A 5D9MA 2YL9A 3RR1A 4ICNA 4Q4MA 1XLMA 3UCDA 3T6CA 3MWCA 3AIQA 4DNHA 2QJGA 3F4WA 3WELA 2E4TA 1ZBVA 1H2JA 2OEJA 1K70A 1XGDA 1GOXA 1WBHA 4ZQPA 3E5BA 1QW9A 1TPUA 5FF7A 2GJXA 1DWAM 3MB9A 1LORA 3LSCA 3RCNA 3TR9A 3QV9A 1XBZA 3VDCA 4CCCA 3GH7A 1IWAA 2A0NA 2WVSA 3GC5A 5I2UA 3GAKA 4NL1A 5L9FA 1FWFC 4P2VA 3CXOA 4D9PA 3TROA 4LNCA 4MJMA 1X6UA 2OZTA 4PUEA 1CDGA 4LBRA 4RE3A 4UTTA 2CC0A 2ZZ4A 3U5UA 1KTCA 4FIRA 4V27A 5D05A 3CT7A 5EA9A 2C79A 3WMCA 3E2VA 1IR1A 3CB3A 3WENA 4AWEA 2ISFA 2VRKA 3MCOA 5IFTA 4MUPA 3H53A 3NVDA 1KCZA 5FCZA 5GQBA 3WF3A 3UY7A 1ICSA 3LTSA 4TTUA 2I14A 2EG8A 3SURA 1SVDA 4Y90A 4MNKA 1IWPA 2KX9A 3VOCA 1BXCA 3PPFA 1ZAIA 2G41A 2BMBA 4JTGA 1WCGA 1BD0A 2WVVA 1G4SA 3OEXA 3OU8A 4IIDA 1A49A 1FHDA 5G1MA 4UMBA 4UTWC 3ITXA 5EB8A 4FLOA 3WNKA 1ZSXA 2Z25A 3HOJA 1MXGA 4E3TA 4NJIA 2WMJA 4A6GA 1GKQA 4JFTA 4Y9PA 3LENA 3GKFA 4FS9A 3AMLA 3FFSA 4KIEA 3TYCA 3PZVA 1PIIA 2PZNA 5I77A 1VAHA 4PMRA 4WD0A 2ZDSA 1DXIA 4UIOA 1LLZA 2YB4A 3QV6A 2H3BA 4I9JA 4UNIA 4GVFA 3WFZA 4GO8A 2BDQA 1ZS2A 1WB0A 2PFHA 2XUCA 3GC2A 4WJEA 4Q8UA 5I09A 1Z9AA 1YNYA 4IL2A 2WHKA 1DJQA 2IW0A 3TAOA 1R5YA 2BFGA 4LY8A 3BJSA 2ZIDA 1VPYA 4U4MA 3VKBA 3B8SA 3OYXA 3S1UA 1JVNA 2WM1A 2NT1A 2GQAA 2GDVA 3H4GA 3IWPA 3KBMA 2WJFA 1HNYA 2J75A 4V28A 1L6WA 2Y5SA 1HKKA 4ADUA 4DXVA 2V5DA 1CGUA 1BRLB 2IPJA 3LNPA 4H9ZA 2ZTJA 3AALA 4FOKA 3CZ8A 3EX1A 1YLVA 1M6JA 3BWWA 2PP0A 2GPTA 3QPEA 2DW7A 4HA0A 1RJRA 1VLIA 3IIVA 3MBFA 2OYKA 3HZ3A 3FYOA 4I9MA 4QNWA 5K9XA 3LRKA 4AZHA 5HULA 1E0TA 5HQEA 1ICPA 3DC8A 3RPDA 1KM1A 1OFRA 4UFKA 4MB4A 3ZWTA 5D33A 3LTPA 1TVNA 3E9AA 4PUUA 2F6KA 1PZ0A 4O18A 2BVYA 1QNQA 3GM8A 3VXGA 4PN2A 3CC1A 4EPEC 2ZUUA 3PULA 1RA0A 1VFTA 1UR8A 1E6RA 4AHOA 4JQ3A 2GSEA 1H5YA 1FH8A 1YDNA 2VKZG 1N2VA 2HEJA 1Q6RA 4Q8QA 4M7TA 1EGZA 2OLAA 2Y7GA 1MMFA 4WLCA 3UR8A 4HNCA 3H2OA 4J3SA 1RD6A 2ZRWA 1I9CB 4EXAA 3V75A 1L6YA 1A5KC 4IPLA 2Z6JA 4I7WA 4FOJA 2V82A 4WOZA 4HMCA 3P74A 2ALDA 1E4IA 3FIGA 5BOOA 4CNTA 3TYBA 1M53A 4ACZB 4JQ4A 1TQXA 4TV6A 1HQTA 1A3WA 1R2TA 4PBEA 4HPGA 1UD5A 1WDSA 4JL1A 3GB6A 3QY8A 2WC7A 4A8IA 1GVQA 1OZQA 2RAGA 2QCGA 4BY3A 5H8MA 1R3VA 2VUYA 3LXBA 2FGZA 3CUFA 1W5MA 4B9ZA 1XIIA 1UC4A 6REQB 2NSOA 4FX8A 1OQFA 4GC4A 5A6SA 1Y8BA 4NNCA 2WK2A 4UC5A 1UR4A 1NWRA 4JTRA 4MWAC 2G50A 5SWUA 2WMIB 1JUEA 3BXWA 1J5TA 4E2DA 1O95A 2WVTA 3NQGA 3S9ZA 1SZFA 1V6UA 3EX2A 3EOSA 5HWJA 2W4XA 4FIQA 1VHNA 4ML9A 1U1HA 3SSJA 1MRQA 3VM7A 2DW6A 1H11A 3SW6A 3SCVA 3PZUA 3PJUA 4DUWA 1SO5A 2EBNA 3SRKA 3PB2A 4RZ5A 3WSUA 3OP2A 4N9DA 3NQEA 1RY8A 4O0QA 4O8AA 3F4NA 3SZ8A 1EH9A 3BV7A 3CH0A 3CHCA 1QASA 5CZSA 4I8DA 4IG2A 4XUGA 2LLEA 2CYGA 2JQXA 3CUGA 2BX7A 5MKGB 1XC6A 2OO6A 2ZX9A 1O60A 3TC7A 3KW3A 3TWAA 3W24A 4NX5A 2VGIA 4AZ6A 3TONA 4G2DA 4QSFA 3BLFA 5DCEA 2Q71A 3QN3A 5T26A 3HIJA 3VKCA 2CPUA 4NKCA 3M0MA 1XYAA 1H63A 1QBAA 4UTUA 2ZX8A 2E40A 3CS2A 4J40A 3AS0A 1ZNNA 3QGVA 3S8HA 1OF6A 3TTEA 4F0KA 1QCWA 4O0KA 1IYXA 2J24A 4KS0A 3DHUA 3M0LA 4FI4A 4KETA 3USZA 1BVWA 1T0OA 4LV4A 3OW1A 2J9ZA 4C7DA 3LPPA 3RRAA 2WKGA 5LKYA 2OEKA 2FQIA 3NGJA 3URNA 2HXTA 1JRCA 4KH2A 1RBAA 1RCOB 1Z41A 4GGBA 1H7RA 5CZ0A 2E77A 4W84A 1ZHAA 3PZ9A 4AW7A 2HPMA 4S3AA 4Q4PA 3WNLA 3ME3A 4GIYA 3H21A 3COTA 4R9OA 5LHFA 3TH6A 3P8IA 2GJPA 4V33A 1PE1A 1ZBCA 4IF2A 2QJMA 1SO6A 5K9CA 2NQLA 3LCFA 2DSUA 4A05A 2JIEA 3MUXA 4C6JA 3L4ZA 3RUBL 2W62A 5DRIA 5AFDA 3AYTA 4GI9A 3DG7A 4A4AA 3FSUA 4HU0A 2C14A 1O6IA 4UNLA 2OZ3A 2YYTA 3R8GA 4D6GA 2HJPA 2VURA 1XD0A 2XIMA 4ZB2A 4AY8A 1SO4A 3VNYA 3RXZA 2YZRA 3KWXA 4CN1A 3WH9A 3V7PA 2EF9A 2PWGA 3AHYA 2ZA3A 3A4JA 3QH2A 3CUJA 2NXIA 4B5UA 2DFAA 5D04C 4D6HA 2WZEA 4TXEA 3P8JA 3Q4DA 4V2XA 4JTUA 4H6EA 4NXSA 2VX5A 3MY9A 3WQEA 2ACQA 3GHTA 4H6RA 1W6TA 1KM3A 1K8YA 2PDMA 1TQJA 4UFJA 4XZIA 4IIFA 4E6MA 4U28A 1DP0A 5HATA 1SSGA 3GBDA 4KESA 1K77A 4HOZA 3OVRA 2VZUA 2X05A 1S2AA 3FV9A 3TMLA 3PTMA 3PWIA 3LS9A 1QI0A 4JQ2A 4MB5A 3AUJA 3M5YA 5CAKA 9CGTA 1X1ZA 1LL6A 3WFAA 2BNJA 4X22A 4RZ4A 3AIVA 1BVNP 1RD5A 3GVWA 5I03A 4KFNA 1RK6A 4NP7A 3DFHA 1L6FA 1XIGA 4AD2A 4FNQA 1XH0A 1GTHA 1CB2A 4C6EA 4ZOEA 4EVZA 1Q2SA 1DJXA 1JCLA 1NFBA 1KO0A 2WSPA 4B5VA 2X1IA 2OPJA 3BGGA 1YPIA 3RYSA 1B3WA 5DY2A 2DSVA 2FZMA 1HF6A 1H0IA 4AC7C 2J8GA 5G5IA 4H8HA 3E38A 1UD2A 4AF0A 4B16A 4H9TA 1YPFA 3NO5A 4ACYA 2C91A 5HQLA 3GW3A 1DORA 3NOYA 1PB0A 4JEQA 4H8NA 4MF4A 1R3YA 4AQLA 2Y61A 1JR1A 1UOZA 3N25A 3UQNA 5CC7A 2Q8XA 4XZ9A 2WZIA 3FLUA 2G3IA 4JIEA 3BCDA 1H7WA 2ICSA 1YBQA 1KBKA 1O1HA 4CCEA 2QDDA 4N6EA 2ZC1A 4E5TA 4YWIA 1UR2A 1IGSA 4O50A 5EMUA 5KMYA 3DOPA 1OX5A 3PP7A 4ADSA 1JFXA 1F8MA 3K4WA 3G1YA 4HZMA 4Z2GA 2KAUC 1FH7A 3W02A 4JYEA 2WBKA 3DFNA 1RH9A 2GLKA 2YFOA 2BXZA 4BF5A 2XSXA 2EO7A 1E0WA 3HF3A 3BOXA 2RGMA 1RLCL 1T6MA 2A6LA 2QDEA 3LCXA 4KCUA 1C92A 2WNZA 4AG0A 4YIWA 1EJXC 4KWWA 3FDGA 4XVDA 2X7WA 1NH6A 4PMQA 3W38A 3W7LA 1F8IA 4XD4A 4UUIA 4AVOA 1G1YA 4XBKA 2EPLX 1Q8AA 1XBYA 5AYXA 3MS8A 3WD1A 4N9BA 3PWAA 3A12A 3BOLA 2W63A 1ISWA 2P88A 2FPVA 1I75A 1TELA 1XGZA 1VYRA 3WIJA 5AN7A 2PTWA 3STEA 2FHBA 1J9YA 3T78A 1F07A 2OX4A 4JYDA 3IJDA 1NOFA 2C0AA 3IJQA 3QR3A 2JKAA 3OBKA 2X40A 4LBUA 2FHFA 1TE6A 4AEEA 4GZEA 3DERA 5FL1A 4JIRA 2Z29A 4L4MA 3T8LA 3ABRA 2HBXA 4G7FA 1KXTA 2YXOA 3HGRA 1O1ZA 9RUBA 5I24A 3K2GA 2FDMA 1HP4A 3VD3A 4A8NA 4FALA 4YJ5A 3URQA 1UG6A 3R6IA 4IICA 1FWDC 4NAFB 1JYXA 1K4GA 4S2CA 4K37A 4WK9A 2X09A 3QV7A 4NIRA 2VD8A 1EIXA 2Y8KA 1FWGC 4E4PA 2Y0FA 4NY2A 1QNPA 2B31A 2HROA 4MWAD 2VC9A 1CGVA 4BFAA 3PUGA 2W91A 4JTKA 4Q6XA 4X9SA 1MEIA 3FW6A 1UWUA 3KVJA 4RNHA 3A5FA 3MVTA 4HT3A 4IQLA 4QJ4B 2J77A 1I8JA 2V0TA 2CEQA 5A8QA 3O0KA 3UERA 3NJ3A 2O4MA 2X8RA 4DBWA 1VENA 4WVXA 4HGXA 4Z2KA 3LSBA 1UR9A 1RAKA 2FTPA 2W6RA 3EPMA 4AYGA 1KM0A 3STGA 5CAHA 3H55A 5FEXA 4LAUA 4PMZA 8TIMA 1W3JA 4ML4A 3KTXA 3KUMA 3PZOA 1HO1A 5AB3A 4BI6A 2ZE0A 3MO7A 1OZMA 3HGSA 2UY3A 1Q6OA 3ANVA 1P43A 1Q45A 3ABZA 4YTQA 4J7RA 1TFVA 2IUZA 4K7YA 3VNDA 2VRJA 4NQ1A 5C5YA 4LS2A 4JY9A 5LNVA 1J0ZA 3DI1A 1F74A 3MHUA 4TX6A 2CZDA 4N4PA 1XJBA 3URAA 3WQ5A 4RNIA 3NQ6A 4GE8A 3SI9A 3T1GA 1EUNA 2YYUA 3TQ0A 3UW6A 1MDLA 1P1MA 2W3ZA 5EGRA 1W1B1 1OGBA 2G97A 1X98A 2GWGA 4IM4A 4RL3A 2X1RA 1FHLA 3KOFA 3LHVA 1G5AA 3O0FA 1KFCA 1JDDA 1FKXA 1XUUA 4YHGA 4QE5A 1X6NA 3ZSTA 3LK6A 3MUZ1 3W2UA 1V6TA 2PS2A 4JX6A 3DDMA 4IX0A 3FHAA 2YA2A 3GNDA 2PDJA 2DZUA 1JNEA 3LGGA 1EJVC 4AHPA 3ZYZA 2F2HA 3BARA 5HMFA 1YIXA 2WZMA 5GJPA 3V16A 1OCNA 3QGAC 5C2GA 4HNUA 3B03A 3IUHA 1JL8A 1PYMA 2PDYA 1P5BA 4G5DA 4HPXA 5DT5A 2GDQA 1MW2A 3L2IA 1TCMA 3WBYA 2QCEA 2F84A 3NYDA 1K3UA 2VOTA 3E74A 4ZQMA 1P6CA 3WFLA 1VS1A 4B4FA 3QF0A 3VGBA 4HA4A 1A0CA 1MSSA 3EA1A 3O6AA 5A94A 4ZB0A 3QOMA 3I65A 3WQVA 5JBEA 1VFMA 1IGWA 4E0CA 1ZJHA 1WAWA 3LG3A 2HRWA 4M6VA 3N73A 3D3FA 2QHAA 1UUOA 3ZQ9A 5G4EA 5BOFA 2IPGA 1W5PA 2YIHA 3JRKA 3P5ZA 4FP1A 5D32A 3W00A 1PCKA 3QRHA 4HZ6A 4OWGA 4JXCA 1NQKA 3EX4A 4R88A 1QHPA 3TJ4A 4XV0A 5BXRA 3ES7A 3EXRA 3TV8A 3BSMA 3QYSA 4QLKA 2R1LA 3IUIA 3GNNA 2W67A 3THCA 2QJHA 4V15A 3W86A 1GZJA 3PFMA 4I7UA 5DXXA 1QI4A 2JALA 3BMVA 1Y5XA 1XSKA 4MNLA 1ELSA 2WKJA 5EBUA 3OOQA 3M46A 1SQ7A 4XKMA 3VKJA 2ISSA 5BNKA 3WK1A 2H9AA 2OKOA 4YMZA 1BYCA 1IXQA 1R6WA 1TPEA 2NV1A 1GYMA 4GH3A 1JCNA 1XS2A 3PFRA 3T4CA 4TOQA 1EBGA 4K3ZA 3E12A 3KFTA 3EWZA 4CGTA 3WDRA 4QAWA 7A3HA 2J7BA 4WY0A 3VDHA 4N9CA 4PSPA 4URIA 3SEPA 2DVUA 4C6MA 1KQYA 4F79A 3V5OA 1ZU8A 3QPYA 1OF8A 3SBFA 1T40A 2WQDA 2YL6A 2ZUMA 4GQRA 4O1BA 1ZP4A 3T2QA 4QG9A 3KEHA 1VJSA 3RRXA 1U1UA 1YYAA 1BF6A 3E02A 3DI0A 1B9ZA 1LLWA 1E1CA 4O11A 4HJWA 1W1ZA 2CWNA 3RG6A 4H19A 1JPIA 4IGSA 3VMOA 4U10A 1UCWA 2QZRA 3R4IA 4WCJA 2E5BA 4GYJA 1V7AA 1E55A 4MY1A 2WM0A 2EKCA 4DI8A 3PC0A 3NQ7A 3WLKX 4CCDA 2VELA 3R11A 1RVGA 8XIAA 1XIHA 1XWYA 3CHEA 4W93A 4UR8A 4D2JA 1ZALA 3ZJKA 1CECA 2O7SA 3JVAA 2GGEA 4WDTA 2B7PA 3BW4A 4WRHA 3ZT7A 5A8GA 4X0NA 4MLRA 4BQ2A 1XYFA 1H0GA 1O94A 3O15A 3W1NA 1CZ1A 3PTQA 3PBGA 4XKYB 1EHNA 1KM2A 3B06A 4TX9A 3ZS4A 4QTGA 2EPHA 5GNXA 4ZQNA 1EWDA 1E1FA 2GYIA 3SGZA 4AXNA 2YA0A 2A3CA 2ZCGA 3M0YA 1XUZA 3CU2A 1TWWA 1ZRQA 2D0FA 1NDVA 4OBSA 3JU2A 1ZENA 5C7VA 3EDFA 4GLEA 3SCWA 4Y2WA 3MV11 3QR0A 3RAOA 4XAPA 1VPXA 1W54A 2X2GA 3C2YA 1ZLPA 4JTQA 1R30A 2B7QA 3RJYA 3CM4A 5FJTA 2QAFA 3H6OA 4BF7A 4HYWA 4P7QA 1JJKA 3QPZA 7CGTA 2P10A 3PTDA 4HPHA 4I9AA 4HCLA 2G5WA 1LT8A 3KDOA 1TJ0A 1UP0A 4AY1A 3EOLA 2BVWA 2V9DA 4QLJA 3IACA 3L68A 4NJHA 4GI6A 1ITXA 3KRUA 1L0PA 4D6EA 3KM8A 1G0CA 3WQCA 3IPWA 2GQ8A 1JQXA 3A22A 2CKSA 4GFIA 3T2PA 3R89A 3WMLA 2DSWA 1REQB 2HQAA 2V38A 3VOFA 1DIEA 4UTLA 3ZOAA 4AIBA 3ARZA 3GXNA 2XN0A 5FEZA 3S4TA 2ACUA 3NM3A 1OWQA 4MZYA 3LBCA 3W1AA 3QC3A 2VEFA 3GDTA 4GNVA 2WKLA 5HR7A 3MVIA 5I3IA 3RGTA 3TP4A 4PTDA 3W4RA 1DJIA 3AHTA 3IIPA 3N12A 3P67A 4DXXA 1XI3A 5AC5A 4NXKA 2DSKA 3S47A 1K7XA 3IGXA 2Y70A 4PEEA 2CWXA 5E0KA 3UG4A 2CLIA 1TKKA 2EQDA 3NXFA 2MUCA 4XAZA 5JH2A 3FKKA 4MDPA 3ARTA 1VGAA 4Q32A 4AWUA 2Y2WA 1A5AA 1JZ2A 2FMNA 2ZZ5A 3G0XA 5F2MA 1W91A 5A8NA 3I6TA 4KKXA 4UQEA 2X1SA 4Q4OA 2HVMA 2YCIX 2XFYA 1DJGA 3WLSA 2VJXA 4ADTA 3SRDA 1B5TA 1TV5A 4DWSB 1DWIM 3DENA 2QVHA 2HVNA 5FKYA 4C6FA 1UZ4A 4UFIA 4DYEA 2CHNA 3LBOA 1EJTC 4IGHA 1QRQA 3GD6A 2G3JA 3LERA 3V1HA 2NUXA 4MJ4A 4W7VA 4L6DA 4LUTB 3MSDA 3O05A 4FPSA 2FHCA 4JYFA 4P7NA 1WE5A 5FL0A 4BI7A 1EX5A 1IXPA 5EMMA 4O1DA 1XKJA 4AZCA 4R7JA 3PB0A 3L67A 2Z1WA 2VOMA 3VE9A 1OGGA 2J8TA 1C91A 1XYMA 1ENUA 3KS5A 1A5OC 3MCNA 2ZE3A 3G6MA 3RM4A 4DLMA 2WQPA 4QROA 2V69A 4M82A 5A8PA 1AVAA 4HZ8A 1K6AA 2AQVA 3KOZA 3PM6A 4OKDA 4A3UA 4NZFA 2V3FA 1LOLA 4GCAA 4PRRA 1UD6A 4UXDA 4J3WA 4QXIA 3HN3A 4WIWA 1JPKA 3W26A 1X7FA 1H7OA 3PBUA 3EA3A 2Y1HA 1WXYA 1KRAC 3UJFA 3SN0A 1EJUC 3AIRA 4LT9A 5KZDA 5H1WA 2A3BA 1C90A 4LCRA 1EJSC 3SGUA 1FBAA 3KAOA 1EA0A 3EDEA 4WQ6A 1RBLA 3IRSA 4X0VA 1RQBA 2C8NA 5D8WA 4GQBA 5F4SA 2YDQA 2NX9A 1Y0EA 1JGMA 2WVUA 2GJXB 5FESA 4C6IA 1B30A 2PRHA 1CXLA 1MO0A 2GGHA 1LRTA 4DZHA 2Q8ZA 3QSRA 1GJPA 4K68A 4A35A 3LGEA 3VCRA 3H4WA 1KWKA 3NQBA 2RJHA 3B4YA 1GOWA 4HTYA 2TAAA 5A8OA 3WBAA 3KCJA 3M0HA 3DX5A 4DVOA 3AYSA 1SZRA 3BLPX 4N7QA 2E6AA 1EX1A 3FJNA 1EHAA 4XTDA 4LNYA 3PPGA 3OLEA 3H7UA 1BVZA 1Q63A 3W74A 4ZXOA 2ZOXA 4RNJA 1J01A 4DBUA 2CW6A 2QMJA 3KE0A 3W1QA 3UPBA 2UV8G 1JI1A 7ODCA 4IP4A 1UROA 2R94A 1VF8A 1CB7B 4U3CA 4IQJA 5C2CA 4S3KA 1HKVA 3GDMA 1WDDA 2I5IA 1I2PA 5H8UA 1BAGA 3KX6A 4DPQA 3VX1A 3C5QA 5DX7A 4AXKA 3W6MA 1UYQA 1EO7A 1J18A 2NUWA 1SSDA 1QJWA 4A3YA 4TQTA 3MUY1 3WNMA 3CJPA 2WVVB 2VP8A 2FZNA 4FA3A 4UQCA 1LCOA 2Y7FA 4E2OA 2Z4GA 3CIWA 4GKTA 3WYZA 3KTSA 4GCXA 2BZNA 2OSXA 4KWVA 3BW2A 4NZ4A 4FLRA 5ENLA 4AX7A 1R2RA 3UP8A 7PTDA 2PGFA 3DHFA 3F5KA 1CT5A 2Y8UA 1FWWA 4FR1A 2XINA 1WOAA 3TZNA 1F05A 4YPJA 2QCDB 1CX9A 4PB4A 1VFUA 4QCEA 3SRFA 3R10A 4C5ZA 4IQDA 4JHZA 5BU9A 3TLLA 1P0KA 3M4HA 3EAUA 4EXBA 2XZ7A 5G4HC 3O63A 1WYIA 3B8VA 1EGVA 1SW3A 1RCXB 3W1TA 3W6LA 4AIUA 2ZADA 1GOQA 4J3TA 2I5GA 5AHFA 1N8WA 2HVOA 5AYIA 5DCBA 3B8IA 3BAKA 2QYGA 1E51A 1UWAA 2AGTA 1XIMA 4WOQA 1Y5WA 4F0RA 3EWCA 4ZFMA 4AWSA 1Q2RA 2CLEA 1BF2A 2J7HA 3QMRA 2AOSA 2POTA 4QG6A 1G01A 2QJNA 4EK7A 3JS3A 1K03A 3HQNA 3CEUA 4XAFA 5CSUA 3PPHA 4ZOBA 2Q8LA 2OJPA 1EFZA 1KBJA 1MZRA 3LXCA 3PJTA 2ASHA 5IHRA 5I00A 4LUJA 3PAOA 4IP7A 1V3JA 3AIWA 2GWNA 1ZAJA 3W81A 3CQHA 2DY3A 1NF0A 4Y9NA 3CWOX 1KLZA 1CXIA 1A5UA 1CXKA 4C6NA 4GD0A 2BOEX 4LUYA 5I07A 2E09A 2XISA 4WDWA 1AFSA 4QX4A 1MQPA 5I3GA 4KRZA 4YXGA 2RDXA 1AD4A 1E4NA 1JDEA 4Z1CA 2FTYA 1DXEA 1J10A 3TX9A 4PUNA 3W7RA 5J04A 4Z1AA 2YA1A 3ZLGA 4UMAA 2NWRA 4DJDD 3H8AA 3CPGA 2Y7DA 2ZUNA 3NPVA 1K7EA 4L4OA 3N4FA 5BRPA 2E6YA 3W01A 1DHPA 2DGAA 4IJRA 4Y8EA 1HJWA 1YXYA 2AL2B 4HB7A 1O5RA 2NQJA 3ZT5A 4U3AA 1UMYA 1V3KA 5CPQA 1IIHA 3SADA 4LYQA 1JDCA 2OOFA 3BJFA 1TE1A 1KBIA 1NELA 2O56A 2D0HA 1FY6A 1WA3A 3MI2A 1F2JA 1DBTA 3QSTA 4OHQA 1GQJA 4GH1A 1J8VA 2C15A 2XM1A 1GW1A 1H7NA 1TREA 1R7OA 2XN2A 2GQ3A 4C60A 1IEWA 3CMJA 4CN4A 4DQWA 1D7KA 4HKPA 2XGBA 1FA2A 1KM6A 4UZSA 3HG4A 3CL6A 4XWUA 4GI4A 4OV9A 4OV4A 3IJ6A 5EMYA 1DIOA 2VC6A 2VRQA 3APTA 4IL0A 4EAMA 4FNPA 3AXHA 4QISA 4LRTA 4MDOA 3KP0A 1EA9C 1V51A 4DO6A 5K4XA 4IMAA 2E68A 1HJQA 1UKTA 3S6DA 3QTGA 4JL2A 4PGLA 2YZ5A 3KRZA 4BK9A 3GG7A 4W5ZA 3VZYA 1OC7A 1DHKA 2ANUA 3VIOA 1RPKA 3D46A 1DQXA 3V36A 3BW3A 1DV7A 3WLMA 2OTDA 2DZWA 2OZ8A 3P3BA 1HKWA 2VFFA 2WC3A 5CSRA 1LBMA 3N3TA 3RN6A 4F2UA 3CZGA 2RDWA 2R1PA 4R9XA 2BTMA 3MKVA 3HMJG 3BH4A 3BK0A 3NQMA 4JICA 3WD0A 1PDZA 3ZXWA 3W1UA 1JD9A 3REQB 4QG8A 4M81A 1XCFA 2Q3RA 1OFOA 4UZUA 3SQMA 4S3JA 4XQ6A 4CQCA 1XQLA 3W7DA 2HS6A 3M0XA 2CHOA 4RDZA 3SM0A 4CLMA 1IR2A 3USBA 3R1ZA 3KCLA 3KOWA 3N4AA 2JGQA 3E0WA 1UZHA 1UKQA 4E3VA 3XINA 3DXIA 1QWKA 3FA5A 3G3MA 4IZGA 3E1F1 3IVSA 3GG8A 5KZ6A 4C91A 3UA4A 1T8QA 5K4ZA 1JZ4A 1GOOA 4H2HA 3MT1A 3VA8A 3VAVA 4AZIA 2CFFA 5IBXC 4DBDA 1HGWA 3KBVA 2PZ0A 3W07A 3G3DA 3G6LA 5A2BA 4B5WA 1EJRC 1K4HA 4Q8PA 2BGQA 4CNUA 2A21A 2BOFX 1L2UA 3M0VA 3VD5A 3W7NA 4QITA 1V6VA 3EMZA 1TA3A 1FWEC 3UXIA 4IJBA 1XRFA 2WSYA 1Q5MA 4G56A 3CB8A 3DU0A 1QOPA 3IVUA 3W7QA 4JTTA 3PJXA 3LGDA 1DPMA 2C7FA 1TPDA 2HNEA 1XIJA