4OOZA

Crystal structure of beta-1,4-d-mannanase from cryptopygus antarcticus in complex with mannopentaose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
368
structure length
368
Chain Sequence
SEFLKASGSNFYYGGQKVFLSGVNFAWRSYGSDFGNGQYASNGPALKDWINKVKASGGNTARVWVHVEGQVSPAFDSHGFVTSTDSKKTLINDLSDLLDYANGQNVFLILVLFNGALQNNSNVQNLFWDESKLNSYINNALTPMVNALKSKPSLAAWEVLNEPEGTLQPGSDQNSCYDTSTLAAQGAGWGGKKFPMKQILKTINWISSAIHNADSKALVTVGSWSELTQTDSFGYRNHYKDSCLTGAGGKSNGIINFYQMHTYSHSGKWNQNAPFKVNRWAYNVNDKPLLIGEFASVCSQNEGIQNLYKYAYNNGYNGALTWQFNSGGDCSDTYSNQMYGMQALKGQNDQSGGKGGMVSVNINHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-based investigation into the functional roles of the extended loop and substrate-recognition sites in an endo-beta-1,4-d-mannanase from the Antarctic springtail, Cryptopygus antarcticus.
pubmed doi rcsb
source organism Cryptopygus antarcticus
molecule tags Hydrolase
molecule keywords Beta-1,4-mannanase
total genus 131
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2014-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4oozA00
1XGZA 3CHCA 2XGBA 3MU7A 2J7GA 3G6LA 3W4RA 1CZ1A 4CN1A 4WLCA 4P7OA 2VCBA 1DWGM 5JBDA 3A4XA 1XSJA 1CGUA 1HXJA 4HMEA 4PBGA 3SUUA 2DT2A 5I77A 1E15A 2Y8KA 1UQZA 2JE8A 3SCVA 4PTXA 3LPFA 4UOQA 5D4YA 1BPLB 4HMCA 4TXEA 5A2CA 4GIAA 1Q6GA 4JAWA 3T2QA 3NSXA 1R87A 4AZHA 4J3UA 4LPCA 5I3DA 2EBNA 1JZ4A 1UG6A 3T0AA 3CBWA 2WC3A 3ARPA 1EHNA 1OT1A 1M03A 1WDQA 4W86A 5ABEA 1E4MM 1JYWA 3CZ8A 1ISWA 4IPLA 4LYQA 4N0RA 4B9ZA 4QLKA 3VNZA 5BXPA 3L4UA 3WD3A 1KBBA 4CUCA 3FW6A 4P8WA 3M7SA 3OBAA 4MPKA 2GK1B 3L4ZA 4JHZA 3CHDA 4TX8A 1HF6A 1ITXA 2OSWA 4RE3A 2D24A 2ZWYA 2WM0A 1JXKA 3GXFA 4WKHA 3VD4A 3QGVA 1JAEA 4M80A 3WNOA 3WNPA 1W3JA 3AJ7A 2JIEA 4D6HA 4TUFA 1E70M 4AD2A 3KWXA 2J7EA 1HJWA 1FFRA 1XYZA 2BVDA 4KH2A 3I3DA 1F4HA 3AXXA 4UOJA 3AOFA 1PZ2A 2XUCA 1MXDA 3GXIA 3W27A 1V6UA 4MDPA 4J3WA 3BMVA 4AMCA 3OGSA 3K1DA 1E6ZA 1MW2A 2XHYA 5A6MA 1JZ8A 2EPMX 2WZEA 5CGMA 1PZ3A 3HU7A 2X0HA 2ZXQA 1VFMA 2CBVA 2WC4A 4HA4A 2VZTA 4CCEA 1ESWA 4H8VA 1QW9A 2V38A 1CXFA 2WHLA 1KGWA 2BNJA 2WMJA 5A3HA 4GI8A 2DSKA 2BY3A 3AIEA 4H8UA 5LYRA 1B90A 3RMEA 2CNCA 3B8SA 3K8LA 1UD6A 3WUEA 1XRVA 3AIBA 2CHOA 1C3FA 4D6GA 3F4VA 4R27A 4EK7A 4DM1A 2WCGA 3CUGA 3VGHA 5C70A 4CD7A 2B31A 1GOWA 3PZTA 3F5LA 4LGXA 4C7GA 1E5JA 2A3BA 2V3EA 1FOBA 3RM4A 2BVYA 2D23A 2W92A 5JUVA 1MYRA 5IFPA 1VJSA 1KR0A 2QPSA 5A6BD 1UKQA 3WDHA 3FAWA 3GH5A 4OJYA 2VL4A 3IANA 5A6LA 1BF2A 2XVPA 3J7HA 1G94A 4HMDA 5D9MA 4L4PA 3WF0A 2CESA 3GDBA 6TAAA 3AS1A 4B15A 4PN2A 1OGBA 2A3HA 4A4AA 4IM4A 1LL6A 4IUGA 2J75A 2VR4A 2XVNA 1HJSA 3AIUA 3VPLA 2YA2A 1CTNA 1LWHA 4ML4A 1V0KA 3VIHA 4W89A 1WZLA 1TA3A 1VFUA 3DC0A 4JFVA 2VVSA 5CPSA 3E1F1 1V6YA 2X2YA 3OB8A 1E6NA 2VT0A 3WQ5A 3CUIA 4GZEA 2Y5EA 1Q6EA 3AYSA 2WXDM 4BZYA 4UFJA 3VM7A 4AW7A 1H4PA 4BQ3A 4FLOA 3VUPA 3EDDA 4D1JA 2E3ZA 5DO8A 1JNDA 1CPUA 4AD0A 2PBOA 2VQTA 4UQCA 1KXTA 2YDSA 1KGUA 4W85A 5BYWA 3W38A 3VKKA 1E72M 3WF1A 1J12A 2QF8A 4RL3A 2EO7A 4CU7A 2YBTA 3NJ3A 3UETA 4AD5A 1JYXA 5GQBA 2QHAA 1OD8A 4H41A 1W9VA 1ITCA 1V0LA 2Z1SA 1ISXA 5FKYA 4AZ6A 1JDAA 4RE4A 4OZOA 3W28A 1MQRA 2D0GA 4Z2LA 4PMVA 2PB1A 1UWIA 4D6FA 2DIJA 2BV9A 3VDHA 2A3CA 1X6LA 4HA3A 3WELA 4QFUA 5A94A 1R7OA 4PMOA 5FCZA 1K9FA 3OIHA 1QBBA 1H0GA 1LQ0A 2ZIDA 2OLHA 3WDQA 2CYGA 3AYRA 1K9EA 1AQMA 5BWFA 1WE5A 3N11A 1S46A 1BG9A 2NSXA 5A6AA 1E73M 1WAWA 2J7DA 1XH1A 1GQJA 2OYLA 1V08A 4U5KA 2J4GA 5IFTA 1DEDA 5AYIA 2XSBA 4FF5A 3WH7A 4D6IA 2W91A 1JDCA 4GZIA 1NOFA 2ZUWA 1BYCA 1LL4A 4HTYA 4PMYA 4TVDA 5CSYA 2DPEA 2O9PA 1L8NA 4E2OA 1ZS2A 2BY2A 4MB4A 1MQQA 5EBAA 4BQ5A 5M03A 3CTTA 1PAMA 3TP4A 4KWUA 1GW1A 5LA1A 4JZ5A 1BLIA 3A6OA 1ISYA 3MV11 5JIWA 1PIGA 5GNYA 1ZBVA 2XPKA 2ZX9A 1UKSA 1H1NA 2BXZA 1MFUA 5ABFB 1VEOA 1W1YA 1CECA 1BAGA 4Z2KA 4A3YA 3QHOA 2O9OA 1WP6A 3WEOA 2BHZA 3SUVA 3VIKA 1H41A 1FHLA 4QLLA 2Z1KA 1BYBA 3OGRA 4IPNB 3WQ8A 5FOOA 4ZEPA 1E4IA 4MB3A 3S2CA 2GJPA 1CGTA 3CGTA 1QNRA 2XFRA 5IHSA 2ZX5A 3W6MA 5A2BA 2J8FA 4CN6A 3OG2A 3WNLA 3ECQA 1W1VA 3GBEA 2E0PA 4H2CA 4UQEA 5DFAA 4PMDA 4UFMA 1PBGA 4UQAA 2VZSA 3WY1A 5FL0A 4D6DA 1ZBKA 4JFWA 1BVNP 2D22A 4J3VA 2ZICA 4NZCA 3VNYA 3QR3A 1G9HA 3M07A 1WDRA 2J47A 4X0NA 1QNOA 1EDGA 4W84A 5E0CA 4UR9A 3ARRA 4NSBA 2GDUA 1JYVA 3AZSA 4AIEA 1WB0A 4J3TA 2XTKA 1QNSA 5I78A 3B9AA 4MNLA 4Z2IA 3WMSA 5CSUA 4AD3A 3N18A 4H04A 2IUZA 3GNPA 4OBRA 3ZSTA 2FDMA 4ACZB 2WWDA 5D9NA 1V6XA 3WQWA 5I6SA 1E6PA 5A6BA 1BYAA 4UZSA 2A3EA 4DUVA 3OGVA 1BQCA 4DWSD 3AS2A 4M81A 2Y8VA 1CGXA 5LA0A 1GUVA 1J10A 3BCDA 1AQ0A 1ZJBA 5ABHA 2VRQA 3POCA 4D1IA 3N9KA 1RP8A 1US3A 1E1FA 2NT1A 3PZOA 3PN8A 4AIOA 5I5RA 4KRUA 4AC1X 4JIEA 6CGTA 2WHKA 3CZGA 4CGTA 2J7HA 2ZX8A 2GSJA 3G6MA 5DMYA 3UR8A 1GOIA 1R7AA 4PCSA 3W24A 2DT1A 2Y4SA 1XCXA 3VD9A 3CMJA 3MUY1 3OA5A 3W26A 2X09A 2E9LA 4P7RA 4ZENA 3GXMA 2WHMA 3WENA 4AY1A 3W37A 4EAMA 4Z2JA 4UFHA 1K9DA 3AISA 5E09A 3PZ9A 3UG3A 2DGAA 3W0KA 4UQ9A 1CXIA 1U33A 4M24A 2CBJA 1PX4A 1V6WA 5BROA 4U33A 1XD0A 3NSNA 1OINA 5DT5A 5JBEA 4JCLA 3AMGA 1EHAA 4W5UA 2ZUUA 2WMGA 3CIVA 1LLOA 1GOOA 2XIBA 3FHQA 4X0VA 2EPKX 4XX6A 3BSGA 1HT6A 4PCTA 3NDYA 1JF6A 2UY2A 3VTRA 1AVAA 2GDVA 1ECEA 4QLJA 1XH2A 3WDRA 3UESA 1IT0A 2ZX7A 4J28A 3NSMA 3AMLA 2DH2A 2YL9A 2WLYA 4CD6A 4HPHA 4PTMA 2F8QA 3U5UA 1NWUA 4XZBA 5BCAA 5HXMA 1VBUA 1V0MA 3KZSA 4KRTA 3ARSA 1TZ7A 2WVVB 3WF4A 1W2VA 2D0HA 2XJ7A 2RGMA 5DT7A 3II1A 1V6VA 7CGTA 5CPQA 1IZJA 1J0HA 4YPJA 1JI1A 3L4TA 2WMHA 2YIHA 3W53A 2NW0A 4HZ8A 1WNOA 3BAYA 4X9YA 3SCWA 3W25A 2WSPA 4AZ5A 4Q7NA 1JFHA 3K46A 1QW8A 2J7CA 3RM8A 1BYDA 1W9BM 3OLGA 4MAZA 3FN9A 1M7XA 1UH3A 1XYFA 2J79A 3UG4A 2GJXA 2W66A 3BAIA 4CN4A 1J9YA 1C7TA 1QHPA 4FLSA 5A8MA 1RPKA 4GO9A 1E3XA 2VURA 2EPNA 5EFDA 2X1IA 4BS0A 2E8YA 3BMWA 1W32A 4U31A 4EKJA 1PJ9A 1TG7A 3FXYA 5CXPA 1HNYA 2C0HA 2WBGA 5KZ6A 1ZL1A 2E4TA 1KR1A 2PWHA 3ZR5A 4WKAA 5HPCA 4WJXA 2UY4A 3ARUA 1DWHM 3LMYA 1B3ZA 3DYMA 3GBDA 4TTGA 3SCOA 3PTQA 3AXHA 1GJWA 3CLWA 4J3SA 2AAAA 3B9EA 1KXHA 3QOMA 1PIFA 2YA1A 4MAVA 1EH9A 4EE9A 1MFVA 1JL8A 1X1NA 1E9LA 3MANA 4DWSA 1E56A 1UD2A 3VX1A 3OLDA 1CXKA 1CBGA 3F5KA 4PMRA 4U3CA 4XUYA 4AEFA 1NP0A 2D0FA 1CWYA 1UR9A 1E0XA 1JZ6A 2Y24A 1G0CA 2G3IA 3GXDA 2CBIA 3PZVA 1LWJA 1EA9C 1UHVA 3NYDA 4AIUA 2ZXBA 3WNKA 1ZBCA 3L2LA 4HP5A 4WSKA 2VCCA 5A6KA 3DECA 3TOPA 4B3KA 2G8ZA 5HDRA 4M56A 2WCSA 1OCQA 1IZKA 1C8XA 4W8LA 4DUWA 3U7VA 3ZJ7A 1WCGA 3ARWA 4HA1A 1VAHA 3A47A 2J8GA 4DM2A 3IAQA 2XG9A 3WD4A 2J25A 1QI4A 3W82A 3MMWA 4PTVA 3BLPX 1VRXA 1VF8A 1XD1A 5DEZA 4JFUA 1I1WA 1SFSA 5A8PA 3WQVA 1CDGA 4MJ2A 3HMCA 3N15A 2XYLA 2W63A 3GNOA 3L4VA 4CCDA 2V3FA 3BAJA 3RIKA 4OKDA 4XB3A 3MSDA 3MMUA 1NOUA 2Y2WA 1OGSA 3WL0A 3AMCA 1LJYA 4MTVA 2ZUVA 1E1EA 3CO4A 3WMCA 3GYCA 3L4WA 3BAWA 4NRRA 1TMQA 1JYNA 5D9OA 2OSYA 1QVBA 1JD7A 2DSWA 4W93A 2QPUA 1J0KA 2VQUA 3EDKA 3GH7A 4XZWA 3AIVA 3CZLA 4MJ4A 1EOKA 5TD4A 1KWGA 1G5AA 2G41A 4L4OA 1GPFA 3NDZA 3GM8A 2WVSA 3RCNA 3W81A 1J0IA 2WZIA 2WLZA 4D6JA 3VD5A 1UD5A 2VOTA 3SCTA 1Q6DA 4C7DA 1C92A 1QI0A 5GNXA 3WN6A 3WQ4A 1V0NA 5CZKA 1JZ3A 1DHKA 3WNNA 3PZGA 1GORA 2ESCA 2V5DA 4CU8A 4KMQA 1V3HA 4CKQA 5DF0A 2FH8A 3THCA 3FHAA 3WMBA 1E4LA 1QNQA 4LXFA 1CNVA 4DWSC 1PPIA 1HJVA 1I75A 1YQ2A 3RJXA 3VIGA 3RPMA 1RD6A 1NH6A 3MUZ1 2WHJA 2WMIB 1E3ZA 1WZAA 3AHTA 3CPUA 3O2LA 2D1ZA 1BTCA 3UR7A 1KBKA 3N12A 4MB5A 4HOWA 3U57A 1KCLA 2C7FA 7TAAA 2XM2A 4OUEA 2XWEA 2JF6A 3TTOA 1K9TA 4QP0A 3MSGA 3PZUA 1LF1A 2W67A 3ZO9A 1G1YA 4F79A 2JIWA 4P7LA 3VM5A 3AROA 4PSPA 4UOZA 2VX7A 3ZIZA 3MV01 4KGJA 4W88A 1VEMA 4F9JA 1CXHA 1FP9A 4PEEA 1HIZA 1XHGA 1GVIA 3AQUA 1GVYA 2CKSA 3WKZA 3AHXA 3RM9A 1H11A 1CYGA 1ZB5A 4AZGA 1ISVA 5M3WA 1EGZA 3IAPA 5FD0A 1HKMA 1KQZA 4OOUA 3CMGA 4GPNA 2CPUA 1MW3A 1XV8A 3SCQA 3GNRA 1B2YA 3BLKA 3PHAA 2CHNA 4W7UA 3ZJKA 3WL1A 4RE2A 2QLYA 3VIIA 1PX3A 2CERA 3M6DA 3ARZA 1V3LA 2VR5A 1DP0A 3ZT7A 2J7FA 3SCRA 1OGGA 1XSIA 2VI0A 5E0FA 1UOKA 2IXUA 4W5ZA 1H0IA 5AC5A 3WEZA 1FHDA 2YLLA 4J27A 1U2YA 2VX4A 8A3HA 1YHTA 2GVYA 1XC6A 3ZJ8A 2EJ1A 1UH2A 4DWSB 3SIMA 4UTFA 5ECUA 3AS3A 5CGTA 3PTKA 4HOZA 5A8QA 4PMUA 2A3AA 2PWFA 5JIPA 4ZFMA 4W8AA 3RO8A 2PC8A 1KCKA 2VJXA 1OM0A 4Z2GA 3AZTA 1UZ1A 5HBFA 1H2JA 1QHOA 3MS8A 4JFTA 3EMZA 3OZOA 5A6SA 1B3VA 2X8RA 2XWDA 1ZBWA 4QCEA 1O6IA 2ZXDA 4NRSA 4ACZA 4B16A 2PWDA 3VIJA 1JI2A 1C7SA 2OSXA 4BF7A 4A3HA 5HPOA 1FFQA 3DYPA 1DWAM 3M46A 2D3NA 1JZ5A 4PYSA 1CEOA 4AD4A 3U7BA 3POHA 4JFSA 4UZUA 2GJXB 4B9YA 1DWFM 5CQ1A 1UWTA 1WDSA 1A3HA 3AXIA 1I1XA 3ALGA 1NWRA 1HL9A 1OB0A 4TOQA 3SEPA 1C93A 3SCPA 4MNMA 4JHOA 2VX5A 2VUYA 3IJ9A 4P7QA 3K8KA 4WSJA 4D6EA 1W1PA 3BGAA 2XFYA 3KL3A 4YHGA 3S6TA 1QOXA 5HOSA 5LA2A 2HVMA 1KWKA 1W9DM 1OT2A 3LPOA 1C8QA 1GOQA 4JL1A 2XSAA 1FH9A 1UR1A 1BG4A 1E6SM 1H3GA 2IXVA 2DQXA 1HP4A 2JF7A 3PZQA 3JUGA 2FGZA 3TTSA 2CIPA 2BS9A 1BFNA 3WDJA 3CUFA 1W9UA 4GKLA 1Z32X 3CHFA 2WAGA 3WFZA 2FHBA 2YDRA 2AOSA 1Q6CA 2ZOXA 3VINA 1UWSA 5GNZA 2YBUA 3EDJA 3IK2A 4LX4A 3UEQA 3VIPA 3WUBA 3EDFA 2OYKA 1G01A 1MXGA 5C8BB 1ODUA 2PF0A 1Y7VA 3VIFA 1B3XA 3FNDA 2G3NA 2W61A 4M82A 1BVZA 3AFBA 3T2PA 2WKGA 1UWUA 3VDBA 1P6WA 4AZCB 3FY1A 3BXWA 1CIUA 4M1RA 5A95A 1KXQA 3VO0A 1JAKA 4TX6A 5IHRA 1W9XA 1MVYA 2DSVA 2XFFA 2ZUMA 3N13A 4HU0A 4HPGA 5IDIA 1DWJM 5A6JA 4U5IA 1GJUA 2YL5A 3KL5A 3MO4A 7A3HA 1BSIA 2BVTA 2EEXA 3WDIA 4WIWA 4CCCA 3SUWA 1B0IA 2VCAA 3AHVA 1QHZA 3VIMA 3MKKA 3EMCA 4PMQA 1BHGA 2XVGA 2YJQA 4P8UA 1L0PA 4NI3A 4MB1A 4CVWA 3WF3A 3AIWA 4UQBA 1HVXA 1VJZA 1HKJA 3CUJA 1UA7A 4PRWA 4Y7EA 4FK9A 2YDQA 3B9DA 4BQ4A 2WMFA 5D8ZA 1H49A 2DT3A 1NP2A 4UQDA 2CEQA 2UY5A 3KEHA 2G3MA 4BA0A 1SMAA 1WZMA 2DDXA 3WH9A 1HL8A 1KFWA 1VIWA 2WMIA 2OWCA 1TE1A 3AIRA 3PZMA 2VZOA 3AICA 3PTMA 2BY0A 5AY7A 3ARYA 4PMNA 1UKOA 5CLWA 3VIOA 1QI5A 2VC9A 3NIYA 1JNEA 1EOMA 1NM9A 3ARTA 4YN5A 2ZXAA 3ARQA 2WWCA 2WANA 4QAWA 4TVUA 1XH0A 2O9RA 3IJ7A 1TFVA 1J0JA 1BGAA 1MWOA 2UY3A 3GZAA 4CD5A 1UZ4A 3D3AA 1Q4NX 4HZ7A 1E71M 1J0YA 3AHYA 1O7AA 3RDKA 2JEQA 2XVLA 5FL1A 3NCOA 4W87A 1E6XM 3I3BA 1V02E 2YA0A 3SCUA 2D20A 4OIFA 3WUFA 3EYPA 3K8MA 1UD4A 3ZSSA 4D6CA 1BGGA 4HZ6A 2DEPA 1TA3B 3WD0A 4S3KA 1J11A 2PWEA 4OBSA 4PUDA 3UG5A 1V3KA 1OIMA 2E9MA 3CUHA 1HJQA 2F61A 1W91A 3WH5A 5E70A 2W5FA 3BC9A 1US2A 3ZOAA 3W29A 5BRPA 1UR0A 2DT0A 1FH7A 5A1AA 3OLIA 1UQYA 4CD4A 1CENA 3A4WA 2JEPA 1HP5A 2WC7A 1D2KA 1VFOA 3W6LA 2WBKA 3VDAA 8CGTA 3SUSA 3TONA 2YL8A 4U2ZA 5JBFA 3D5HA 3THDA 3AS0A 1ISZA 1J01A 4U3AA 1V03A 2ZUNA 2CITA 1CGWA 2VNCA 3VILA 1TR1A 2BFGA 3TTYA 5C71A 1QI2A 3CZEA 4WKFA 3ZM8A 1H09A 4U2YA 1KQYA 2DH3A 3QOKA 3GH4A 4AXNA 3WIJA 2WYSA 2F2HA 2DSZA 3AIQA 1PX8A 3N04A 1HJXA 5HNNA 1M01A 5A8OA 4ZE5A 1UD8A 2WB5A 2VZUA 1X6NA 1VFFA 2EQDA 2J7BA 1J0ZA 1JXJA 2BHUA 5KEZA 3QHNA 1VBRA 1E43A 2WK2A 1E40A 2XVKA 1A47A 1V02A 1TVPA 4AD1A 1UD3A 2WZHA 1EDQA 2QV4A 1B31A 5E6YA 2CETA 4LYPA 3NUKA 4GINA 3GTNA 2QMKA 4J7RA 3VX0A 2TAAA 4E8CA 4S3JA 4JKMA 4LQ1A 5AYBA 1VEPA 3OLEA 3SUTA 2NT0A 2QMJA 4ZE4A 4JKLA 4Q22A 4F66A 3VGEA 4QDMA 1RH9A 2WW5A 4V28A 4TTUA 1TCMA 1E4NA 4GQQA 4UFIA 4DUXA 4FLQA 1UWRA 2W4XA 4UFKA 2ZE0A 2VO5A 1JGIA 3WD1A 1NQ6A 2Q8XA 5BRQA 1DTUA 4R5EA 3T0DA 1B3WA 3FAXA 2PWGA 3ZT5A 3ZMRA 2VZVA 3OZPA 4D72A 1MQPA 1V3IA 4CVUA 1GQLA 2BHYA 5IXEA 3WSUA 4BQ2A 1D3CA 3L4YA 1CLVA 2FHCA 3WH8A 3CHEA 4M29A 2YKKA 2V3DA 1EXPA 1D7FA 1N82A 1QNPA 4P8VA 4NF7A 1VB9A 2C8NA 1MW0A 1DWIM 4E4PA 2GK1A 2G3JA 1UR4A 5E9AA 3AZRA 1C91A 3UERA 3VD7A 1LG1A 4W7WA 1JFXA 1TVNA 1EQCA 1QPKA 3HN3A 1UR2A 2J78A 4AYSA 5I24A 4CU6A 2BY1A 3AI0A 1WDPA 5GPRA 4FMVA 1CXEA 1UH4A 2J62A 1JF5A 4M8UA 1KB3A 1JDDA 4AZCA 4PUEA 2AMGA 4KGLA 1B30A 1WO2A 2YL6A 3L2MA 1GCYA 3VVGA 1R85A 1FH8A 1JZ7A 3VMPA 1M04A 5A8NA 1JD9A 5I2UA 5I23A 1B9ZA 3CZKA 2VX6A 1NWTA 3ZT6A 2MANA 4C7FA 4MNJA 4JCMA 3CH9A 1E0VA 3DHPA 1GHSA 3VGBA 4Z2HA 3PZNA 3WEMA 1XCWA 9CGTA 4FLRA 1HX0A 3WBEA 1K6AA 4WK9A 3PBGA 1H5VA 1U30A 2D3LA 2VTFA 2WMKA 1E6QM 1GOKA 3PZIA 1J18A 2ZX6A 1WPCA 2GJRA 3DHUA 2DIEA 1JG9A 4J3XA 4B3LA 1UYQA 1AQHA 2D2OA 1FP8A 2UWFA 2WPGA 4HU8A 3BCFA 1E5NA 1GQIA 5E6ZA 2DSUA 3EDEA 4JL2A 4BCEA 2VMFA 1GONA 3UCQA 3CZJA 3MUAA 1CLXA 3F5JA 4ZXLA 2CKRA 1W9PA 1UKTA 3RJYA 2EPLX 4JKKA 1EO5A 1PEZA 1QI3A 1OWQA 1UA3A 4W7VA 3MUIA 3WNMA 2FGLA 6A3HA 5I79A 5BXSA 1HJUA 3BAKA 5BXTA 4PSRA 1WZKA 3VGFA 3LPPA 3LPGA 1NWSA 3BAXA 2O9TA 1KXVA 1LG2A 3ARVA 3VOCA 3QHMA 1UWQA 1OSEA 5ABGA 5CG0A 1W3HA 4V27A 4QCFA 3AMKA 1W3KA 1E0WA 2W62A 2OYMA 2YOCA 4MDOA 2OWWA 2CXGA 4LYRA 1XSKA 1HN1A 3APGA 1M53A 1R8LA 1VENA 3WDPP 2EXOA 5D9PA 2G4FA 1E55A 4ZXOA 3ZQ9A 3SCSA 1IV8A 5ABFA 2V3GA 1LL7A 5EMYA 5EB8A 1EIBA 1W2PA 3N17A 4K68A 4AEEA 2XGIA 3K4AA 4AZIA 3TTQA 1Q6FA 2CBUA 1EQPA 1W1TA 3VMOA 3VDCA 3MMDA 5CLTA 4HOXA 2ZUSA 3RILA 2BXYA 4MNKA 2WVTA 2E9BA 1ZU8A 1GNXA 4GI9A 1F4AA 2FH6A 4UNIA 4PMZA 2FHFA 1HKKA 1B1YA 4PTWA 1B3YA 1HKIA 4OOZA 2ZUTA 2CCRA 1V3MA 2OWXA 1UUQA 4EANA 2X0YA 4WF7A 1CXLA 4W8BA 1RP9A 4P7NA 5EFFA 1KGXA 1GQKA 2JFEX 3ZJ6A 4UCFA 1ODZA 3T08A 3EMQA 2WCAA 3ALFA 2E8ZA 3T0BA 1JZ2A 3ARXA 1WKYA 3BH4A 1CGVA 5A69A 4H8HA 2VRKA 1GZJA 2ZWZA 5FIPA 3WBAA 4ACYA 3WF2A 4PMXA 1EDTA 1EO7A 1C8YA 2X05A 4AISA 1TUXA 2WNWA 5CJ5A 3VU2A 4H7VA 2J74A 1SR0A 1ZJAA 4URIA 2V5CA 5D8WA 5I0DA 4MADA 3KL0A 3SCNA 4CD8A 4F9DA 2PBGA 4AZBA 4AWEA 1MW1A 3WD2A 4GQRA 3A3HA 1UR8A 3WQ6A 1CGYA 3A4AA 4TVCA 3VD3A 2O92A 4P8XA 1OBAA 3WH6A 3HJEA 4ATLA 5M5DA 1AMYA 4GO8A 1GOMA 4E8DA 2WVVA 4YHEA 3DYOA 4UFLA 3IJ8A 1FA2A 3I3EA 2E40A 3WUGA 4GXPA 5A2AA 3T09A 1HVQA 2WSKA 3AHZA 3K4DA 1UKPA 2VRJA 4XV0A 2PI6A 1GHRA 3SURA 2WVUA 3VGDA 1W3LA 2EPOA 3N1AA 1NARA 2J77A 3L4XA 3O9NA 3EBVA 5AC4A 4GZJA 2VVNA 1SMDA 1NOWA 5F7UA 2RGLA 3AMDA 1OIFA 3T2OA 3KE0A 4GI6A 4ATWA 1SYTA 3ZR6A 3VGGA 5CPTA 4D71A 1V3JA 3O6AA 2HISA 2YLAA 4IISA 2XM1A 1E6RA 4ATDA 2XIIA 1C90A 1OD0A 2JALA 2GUYA 4N42A 4F8XA 3TA9A 3VMNA 3WFLA 1QBAA 3BSHA 1JIBA 5M17A 4V2XA 4AZ7A 1R86A 2GFTA 2WKLA 3U5YA 5BXRA
chains in the Genus database with same CATH superfamily
1XGZA 4XBKA 1MXSA 3LG3A 3RF9A 3S4TA 3W4RA 4CN1A 1JCNA 2ZBTA 1GYNA 4O57A 1FWCC 1B4EA 1DWGM 4B4FA 3A4XA 1XSJA 1F3EA 3URNA 3O6DA 1XUZA 5XIMA 2Y8KA 3PUOA 2FIQA 1RY0A 2ZCGA 3UZXA 2Y63A 1BPLB 5DBUA 1Q6GA 4JAWA 2OZ0A 3NSXA 1R87A 2OOGA 1RLCL 1JZ4A 1UG6A 1I2NA 3T0AA 2NQZA 3CBWA 1GVOA 5ABEA 4BFAA 3LI0A 1C9DA 1WXJA 5L6UA 3TYAA 3VNZA 3L4UA 1KBBA 4CUCA 2YB1A 5DY2A 3FW6A 3M7SA 1UPPA 2XIMA 4JHZA 4K7VA 2CFFA 1ITXA 3GXFA 2VEKA 3VD4A 3R79A 4M7SA 4AWTA 3PJXA 1W3JA 2F2KA 3AJ7A 4D6HA 1XIJA 4M6QA 1HJWA 4PRRA 2BVDA 4NT0A 3AXXA 3AOFA 2J6XA 2DIKA 5CPOA 3W27A 1V6UA 3IGHX 1XRFA 3SADA 3S3GA 4DJEC 3URAA 2OKTA 4AMCA 3OGSA 2NQ5A 4DY1A 2CZVA 5A6MA 4EP8C 2WZEA 3TK7A 2Q3RA 4AAJA 2X0HA 1CI1A 2CBVA 3TC3A 1SZNA 3Q45A 3B8IA 4UTUA 4H8VA 4HHMA 4Z0JA 3R8GA 1X38A 3CQKA 3WQOA 2OXNA 3AIEA 4H8UA 3TR9A 1S39A 4LBRA 2CNCA 4K8HA 3B8SA 1WDWA 1VCVA 3WUEA 1L2UA 5HR7A 3AIBA 2CHOA 5G2HA 1C3FA 1R3QA 3AYVA 3TKFA 4NU7A 1S5VA 4R27A 1PL9A 2WCGA 4EK7A 3CUGA 4N02A 4J3ZA 1GOWA 3FEMA 1RK6A 1KM3A 2ZZ4A 1NFGA 2Z1WA 3P2VA 3I4EA 2QPSA 3CT7A 3FA3A 4MY8A 3WDHA 3FAWA 3GNNA 1KM6A 4UTMA 4KEVA 3RO6A 4L4PA 1TYGA 3R1ZA 4ZQNA 3A5FA 1TIWA 5I00A 2A3HA 4A4AA 3UXIA 3CQIA 2HBXA 1HFBA 2J75A 2C19A 3VPLA 1LZOA 1YDVA 1M41A 1LWHA 4ML4A 5T9BG 1WZLA 2ZVRA 1A5OC 1S1PA 2Y89A 3EPMA 3IK4A 1TA3A 4JFVA 1W5NA 1NAL1 3S6OA 3DXIA 5CPSA 4E8GA 3M0IA 3IPWA 3E1F1 3MCOA 4O8RA 1E6NA 3H26A 1VZWA 4XD6A 1AG1O 5EKYA 1FCQA 3MCMA 3O16A 4MVAA 4AW7A 4BQ3A 3IIVA 3EDDA 1TSIA 2INZA 5DELA 5DO8A 1XLBA 4FAMA 4QG8A 4IIDA 1W3NA 4GWEA 1E72M 3VNLA 2IQTA 2EO7A 4RL3A 2OEJA 2QIIA 3NJ3A 4ZQPA 4AD5A 4QNEA 5FF0A 2QHAA 3NQAA 4OGZA 3CYJA 1Q2SA 4KCUA 1LOLA 3W28A 4LRTA 1JVNA 4F2BA 3NO1A 1S2AA 3S42A 3GFYA 3QC3A 1R5YA 5CZTA 3KBSA 4FF7A 2ZIDA 1HTIA 1TPH1 5CBIA 3USZA 1WE5A 2YW4A 2R6OA 3IGXA 4XVDA 1GQJA 2WSRA 4U5KA 3IRDA 4I8YA 3ZZ1A 2BP1A 5IFTA 4C6QA 4FF5A 3LGDA 2W91A 2ISVA 1UPMB 2ZUWA 4Y6GA 1LL4A 4PMYA 4F0SA 4P61A 1UIPA 1I2PA 4E2OA 1ZS2A 3W1UA 5EBAA 2CLIA 3W7CA 3R25A 5LA1A 2NQHA 1ISYA 5JIWA 5FAGA 4WR3A 1TTPA 2ALDA 3L67A 5LIKX 1XF0A 1UKSA 2YPIA 3KBJA 1H1NA 1VEOA 3QZEA 3L23A 1OK6A 2G96A 3WEOA 2BHZA 4N6EA 3VIKA 1H41A 5TIMA 1QATA 1LM1A 1XLCA 2PTXA 4LB4A 5EBUA 1MI3A 3U4AA 1MMFA 4MB3A 5I7GA 2GJPA 2R82A 4MWAE 2XFRA 3TC7A 1WQ5A 3I6RA 4TO8A 4CN6A 3ECQA 3T42A 1W1VA 3CWNA 2E0PA 4GY7A 4UFMA 4D6DA 3M0KA 4JFWA 1BVNP 4Y9PA 4NZCA 1P7TA 1V5XA 2VDHA 2PRMA 3M07A 4O17A 1KBLA 1WDRA 1Y5XA 1QNOA 1EDGA 1R3TA 2POTA 4RZ5A 4J3TA 4AIEA 2XTKA 4Z2IA 4H04A 3EWDA 4LBSA 2HE8A 5EYWA 1LUCB 3KBNA 2GSEA 3GNPA 4NZ1A 1JULA 3RCYA 3ZSTA 2FDMA 4O15A 2WWDA 5D9NA 1E6PA 5A6BA 1BYAA 4Z1CA 3URQA 3OGVA 3PP7A 4NKCA 3LXCA 2QJGA 1A0EA 3G18A 1CGXA 2INFA 3DZ1A 3GK0A 1J10A 2A21A 1SU5A 2FMOA 4Z17A 5XIAA 3UD6A 3N9KA 1RP8A 5HWNA 2V2DA 1US3A 5FF4A 3ITTA 1SO4A 2TRSA 3BLLA 4KRUA 1EJUC 2CZDA 3CZGA 3DN5A 2J7HA 3G6MA 1RSCA 3LCWA 1EBHA 2Y4SA 4GK8A 3B06A 1DXEA 2J9ZA 4FNUA 2V30A 1HO1A 2X09A 5FSDC 2E9LA 4C1KA 3QFEA 3DOPA 3KVMA 1POJA 2R1PA 3W2JA 4EAMA 4Z2JA 1PZ0A 2ABAA 1DJZA 6REQB 1QRQA 2CXEA 3W7EA 4M24A 2OLSA 1V6WA 2XH2A 1XLGA 3B0VC 5MKGB 3M64A 4Y90A 1NTHA 1OINA 1O1HA 5DT5A 3XISA 2H8ZA 5JBEA 3AMGA 1OYCA 4YTQA 5CAHA 1EHAA 5CBBA 2ZUUA 3CIVA 1GOOA 1IIHA 3BJTA 1IT8A 2EPKX 4XX6A 3BSGA 4PCTA 3E02A 1JF6A 1TV7A 2UY2A 3VTRA 1H1YA 1AH3A 2QAFA 1ZLPA 4NAFA 1W5MA 4QLJA 4E6MA 3WDRA 4Q4KA 4Q4MA 5BMWA 2YL9A 4JYFA 4IF2A 4B91A 2Z27A 3KCOA 4I6VA 5HXMA 1VBUA 2FPTA 4KRTA 2WVVB 1QWKA 3KTCA 3FJ6A 2G37A 2ZTJA 1V6VA 3NPVA 7CGTA 1IZJA 4HYWA 1TO3A 1XKJA 3L4TA 2YIHA 4DBDA 2HQAA 1OX6A 3CV6A 2H90A 3K46A 1O60A 3H2CA 3U2EA 1UJQA 3O63A 2J79A 2BMBA 5G4WA 3AC0A 2W66A 4LYKA 3GHRA 1C7TA 1JDFA 4QJ5B 3EWZA 2VURA 2FZ9A 4OQVA 3BMWA 1CCWB 4KEUA 4U31A 2FTPA 1P6CA 1TG7A 1QCWA 1FWDC 4JTUA 4A2SA 5CXPA 3L0NA 2NQJA 1L9WA 5KZ6A 3PC0A 2E4TA 1XUUA 5D2YA 3QQWA 1JPDX 4WKAA 2UY4A 4NJKA 3ARUA 1L6FA 3LMYA 3U6WA 4GYPC 4J3SA 3B9EA 5CG7A 2BGSA 3QOMA 2YA1A 3HFYA 2IPWA 1RA0A 2GVEA 1NDWA 4JQ1A 4DWSA 5DMNA 1E56A 4JS3A 3S5ZA 4H00A 1CXKA 1XM3A 2ZA3A 2VENA 1B4KA 3MHFA 3L68A 5PTDA 3RHGA 1VYSX 1XIEA 1GWJA 4DAFA 2Y24A 1EJVC 2G3IA 4JY9A 3ITXA 1UUOA 1LWJA 4ZB0A 2X1SA 2O4MA 5LNVA 3DENA 2WKJA 2ZXBA 3WNKA 4WSKA 2DZVA 1XLAA 3W1XA 1KV5A 3GD6A 1P48A 4FNPA 1F76A 4HIBA 3ARWA 4HA1A 4QBXA 4IOTA 1VAHA 2KZHA 2J8GA 3TR2A 3CUZA 3RMJA 4E38A 4JBRA 4LSBA 4H6RA 3WQVA 3WLTA 3HMCA 4D9PA 2XYLA 1AA1B 2YX0A 1FDZA 3GNOA 9XIMA 2V3FA 1H7OA 4R53A 4MMWA 1JPHA 2P88A 4OKDA 1R9YA 1SR9A 5B7ZA 1Y5VA 3TFXA 2VWTA 3MMUA 3V5OA 3WK2A 1OGSA 4AMAA 4DO5A 3OODA 1E1EA 3WMCA 3A9IA 3H2FA 4L9ZA 1QJWA 3L4WA 4GI4A 4KIEA 1TMQA 2OSYA 1X8CA 2J24A 3NOEA 1XYAA 4W93A 1SSDA 4Q8NA 4O1FA 3EA2A 3E96A 2VWSA 3WJSA 2Q09A 3BG3A 1G5AA 4X61A 1P5BA 1GPFA 3AUOA 3A3WA 3I6EA 3AWOA 3C86A 2W27A 1UD5A 4BWLA 5C9WA 3N73A 4XK2A 3SCTA 3Q94A 4GYJA 4KQNA 3GDRA 4JTJA 3WN6A 1V0NA 5CZKA 1JZ3A 4IT1A 1YLVA 2V0TA 3WNNA 4CU8A 5GVJA 2I56A 1LBMA 2FH8A 3FHAA 3V5FA 1QNQA 1EJSC 4LXFA 3PPFA 1Z41A 2CLMA 3LXBA 4C6BA 3VIGA 2PE4A 1HL2A 4YJ5A 1RD6A 3MUZ1 2WMIB 3QGAC 3JU2A 3CPUA 4DJDA 5H2ZA 3UR7A 1WKDA 1KBKA 2Z1BA 2C7FA 4GQGA 2XM2A 5T91A 2JF6A 3TTOA 2A7PA 1S38A 4QP0A 3MSGA 1U83A 3ITLA 3PZUA 4MPQA 2W67A 4REQA 3NNTA 2JIWA 4WY0A 3MV01 1JQXA 2E5BA 3G1SA 3MWCA 2ZYFA 2G97A 4GKTA 3NZ1A 1Y8BA 3QGKC 1H61A 1CYGA 4L1GA 4AZGA 1K03A 2AGKA 4BEQA 5FD0A 1HKMA 1KTNA 4UTLA 3E38A 5FESA 1ICSA 1EEXA 2CPUA 1XV8A 3SCQA 5CCZA 3UWYA 3NPUA 3GNRA 2QZRA 3LRKA 3OQEA 2CHNA 3WLSA 3N9SA 1QDSA 3N4FA 3ABOA 3W2KA 4IQDA 2YBVA 1DP0A 5KZDA 4ADUA 4L4LA 2VI0A 4I7WA 2NVCA 5E0FA 3GNXA 1H0IA 3ITYA 4C6MA 3WEZA 3F2DA 1WXZA 2YLLA 1SSGA 8A3HA 4JTLA 3S1WA 1XC6A 5JVLA 3EOLA 2P0OA 1PCKA 5DX7A 4UTFA 3TJIA 2GGJA 1U1UA 3KBWA 1EFZA 3I4KA 5CGTA 1YDNA 3PTKA 2VGIA 2J13A 1Q63A 5CPNA 5A8QA 5D33A 4PMUA 2GLKA 3LNPA 2PC8A 3GTFA 4CQAA 3AZTA 4YVPA 2BWGA 5CJMA 1QHOA 3MS8A 3W70A 2PPGA 3TYCA 3BLDA 2OZ8A 2X8RA 2XWDA 1NFBA 3ZXWA 4H6KA 4Q8UA 1O6IA 1XPYA 1VS1A 1E1CA 3QQ0A 2PWDA 3VIJA 4H9YA 2A0NA 2GVGA 4BF7A 2HK0A 1ALDA 1FFQA 2F9RA 1D8WA 3SJNA 1DWAM 1JZ5A 4PYSA 4ERIA 3MHGA 3A9BA 3U7BA 3R8RA 4L1WA 4YWSA 3UFYA 1DWFM 1LLZA 5CQ1A 4GA8A 1WDSA 1A3HA 1NWRA 1O94A 3M5VA 1I45A 4HHLA 4TOQA 2NUYA 3SCPA 1BXCA 2Q6ZA 3IJ9A 3K8KA 4D6EA 1DIEA 5LGXA 1W1PA 3BGAA 4N9EA 4TMBA 2X30A 1PDYA 4XG1A 5LA2A 3BQ5A 1YTEA 4C6KA 3CL7A 3LPOA 1GOQA 2XSAA 4LV9A 6REQA 1FH9A 1X1ZA 3ZFHA 2VD9A 2L5HA 3CM4A 3WDJA 3CUFA 1A5CA 1Q6LA 2C79A 3IUHA 3IIOA 2HNHA 2V9DA 1R46A 3NPWA 2YDRA 2YFNA 2ZOXA 3B97A 1UWSA 3LCLA 4M0XA 3QFWA 4LX4A 2E09A 4Q4QA 4FA3A 4IG2A 4IGHA 1Z8AA 1MXGA 1ODUA 2F6KA 2HMCA 1BVZA 3AFBA 3VCRA 2WZMA 2PGEA 4AY8A 3EAUA 4LUIA 3BXWA 1CIUA 4M1RA 1JPIA 1KA9F 4GY0A 3UJSA 4UTJA 4HMNA 1WDDA 4TX6A 1Q6OA 1XW8A 4HU0A 1MVYA 2XFFA 2ZUMA 3N13A 4MLRA 1EB3A 3VI2A 2W79A 4JXCA 3GFZA 4TU1A 3R13A 4K8GA 4U5IA 4RCXA 1GJUA 4HSHA 7A3HA 3MO4A 3A3XA 5D38A 2EEXA 3VCCA 3MSRA 3WDIA 4WIWA 4CCCA 3SUWA 4QE1A 1UBPC 2DW6A 2VCAA 4AC7C 1QHZA 2R1KA 2NV2A 3FK4A 3EMCA 1BEUA 1UCWA 4NAEB 1IWPA 4CVWA 4YS1A 1GTEA 1T41A 1R2TA 2YDQA 3B9DA 2WMFA 5D8ZA 3ELFA 3SN4A 3KEHA 4BA0A 3SQSA 1WZMA 3KS5A 3T7VA 2XU2A 2Z4GA 2VZOA 3AICA 1AD1A 1F8MA 3UU0A 2Y1HA 3ARYA 3KW3A 5CLWA 1EXBA 4HNTA 1A5BA 1KCXA 4LNCA 1NM9A 4MFEA 3L5MA 2ZXAA 3ARQA 4FB7A 1XH0A 1TFVA 1J0JA 2UY3A 2W3ZA 1UZ4A 3D3AA 2BASA 1SFJA 4HZ7A 4A2RA 5HNTA 5FL1A 3INPA 1R9XA 3VNDA 1JEZA 2Z6IA 2BGNE 4N9DA 2DVTA 3LBCA 4A3RA 3MI6A 4AFYA 1XGEA 1V02E 2JK2A 4KCWA 5KINA 3VOHA 4V33A 3OYXA 3WFAA 1SJCA 1MRQA 1V7YA 3ZSSA 4HZ6A 4O16A 3SY8A 1W5OA 2C14A 2H6RA 2A1YA 5HQEA 4HJWA 2FTYA 1HJQA 3NQGA 3BC9A 1Q5MA 1Z89A 3GHSA 3ZOAA 4KWWA 2XIOA 1RJPA 1IQ8A 4AHPA 2P76A 1YBQA 3QV9A 1FH7A 4NUWA 2OODA 2YCEA 1RZMA 3MTWA 1O68A 1CENA 3A4WA 4FXSA 3GVWA 5I3GA 2WC7A 1D2KA 5J8LA 1VFOA 1UR3M 3W6LA 1KW1A 2WBKA 4NX5A 3VDAA 1XPGA 4IMGA 1XLKA 2X1RA 3HB9A 1RBLA 1V03A 3HFTA 2CITA 2VYOA 5SWUA 3BLIA 3CZEA 4QS6A 3IJDA 2XH7A 1KQYA 1UB3A 4A35A 1RQEA 5ECVA 4H7CA 1T8XA 3N04A 2YXOA 5DN1A 4C6DA 1KV8A 4GZ7A 1X6NA 3GXNA 3HZ3A 3BGJA 3E0FA 2I1OA 1PKYA 3QHNA 3JR2A 1XICA 3UZYA 1POKA 4KWVA 4MGGA 2ACUA 1GJPA 1ICQA 5C9RA 2XGZA 1ME9A 1REQB 1EJRC 1P0KA 3EPNA 1TVPA 1UD3A 2WZHA 1NELA 3P8IA 2HRWA 5E6YA 1OVDA 3GTNA 4R34A 3B4YA 4S3JA 4LQ1A 1V6TA 5E1QA 4RNJA 1F5ZA 4HBKA 4JKLA 4S3DA 3UPMA 3B03A 1EKOA 1M7OA 5C2GA 5BOOA 3CK5A 4Q4RA 3WD1A 1EC7A 4GUJA 1EUAA 1SO6A 2Q8XA 3EX3A 5BRQA 4R5EA 1B3WA 3AU6A 3ZT5A 4AWSA 3R12A 4NJJA 5DCDA 3S5OA 1RK5A 5I3KA 1ADSA 1EGVA 4CVUA 3W9ZA 4BF5A 2BHYA 4ZODA 3EWWA 5E5CA 1CLVA 3U9IA 2FHCA 3WH8A 2HWGA 4FHAA 1EXPA 1RCQA 3EX6A 1O4UA 2CZ5A 1UZHA 4JQAA 2GK1A 4I90A 3QN3A 2EKGA 4ZCWA 5RUBA 3UWEA 4S3FA 3PS7A 3A5VA 2IKIA 4Y2WA 2J78A 1DV7A 4AYSA 5I24A 4C90A 4DJDD 3LTYA 1AW1A 4M19A 2DZXA 1TPUA 3T0CA 4DN1A 4Z1YA 1CXEA 3RU6A 2J62A 1ZAIA 3QR0A 4M8UA 4RX0A 3CS2A 1KB3A 4PUEA 1B30A 3C52A 1TCDA 5G2WA 1R85A 1FXQA 1FH8A 3UVAA 3W87A 1EP3A 1PB0A 3R0DA 3CZKA 4TMCA 3CO8A 2MANA 4C7FA 3UWUA 1AH0A 3LLXA 4JCMA 1E0VA 3P61A 4IG2B 3UXKA 3BE7A 3IS4A 3PZNA 3H55A 1VD6A 4C6OA 3TSMA 3WBEA 1LBLA 2X41A 3PBGA 1U30A 2B7QA 2D3LA 3LZ5A 2WM1A 2I5QA 1E6QM 3WQPA 3ABQA 1WPCA 3IV8A 1PO9A 2G0WA 4J3XA 1JG9A 1F6PA 1UYQA 2QJJA 1W54A 3MVIA 4FX6M 3EWUA 2UWFA 1Q4WA 2WPGA 1G6CA 1O12A 1L2QA 4IH3A 2CHRA 2PDBA 3LI1A 4JL2A 3BW4A 4G7EA 3CZJA 3P5YA 3W2UA 4ZXLA 1NDVA 1RPXA 3NDOA 3PUEA 3NOYA 4AF0A 4JTQA 5D05A 3IIXA 4JKKA 4TQTA 4QJ1A 1GVSA 1FKXA 1OWQA 1PEZA 2DW7A 3MUIA 4GHRA 3WNMA 4L4MA 2Y7DA 5I79A 1HJUA 4YXGA 4Q3MA 3KOXA 4AU0A 1FRBA 3R5EA 1NWSA 2E5DA 3M16A 5A8GA 1WV2A 3QHMA 2KX9A 4EXBA 5CG0A 3BPWA 4V27A 3Q2DA 2DVUA 1E0WA 3C2VA 4EXQA 2W62A 2OYMA 2X0SA 4QNWA 4IJCA 4GUGA 4LYRA 2E1DA 2ZRXA 2NVAA 1HGWA 3WDPP 5D9PA 1E55A 2CW6A 2QCMA 5AZ1A 1OABA 5ABFA 2V3GA 1L6GA 1RV8A 2BVWA 2WSYA 3V35A 4AZIA 4PA8A 3VMOA 3SN1A 2QUUA 2POZA 2YXXA 2CLPA 3GXPA 2ZUSA 5CSSA 2PDKA 1TRIA 4K1GA 2BXYA 1OC5A 4MNKA 1PKMA 2DZWA 4EAYA 1ZU8A 2OT0A 1DYSA 3F7JA 4LJ3A 4FOUA 2FHFA 1BQGA 1HKKA 3T44A 1OCJA 5I07A 3MBDA 1JCJA 3ANVA 4FALA 1DJQA 1XIIA 1HKWA 1NEYA 5BWAA 4P7NA 4UNKA 4DI9A 1Q7ZA 3S9IA 3N34A 4FOJA 2V6AA 1RBAA 4DUOA 4PMJA 1YE6A 3ARXA 3BH4A 1O1ZA 2WJDA 2FDSA 3M0LA 5FIPA 3WBAA 1S2VA 3GVRA 4O19A 4GYKA 3SBFA 1AL7A 3ICJA 4AISA 2WNWA 2X7WA 3BJFA 1GOXA 3G2GA 1SR0A 3QC0A 3G1FA 2V5CA 4IQLA 1AW2A 4PL2A 4F9DA 4YYCA 4HPNA 4XAGA 3GDMA 3R2GA 4PBFA 4Q8PA 3A3HA 1TKKA 1CGYA 1LTDA 1YW1A 1J6PA 5BU6A 4JR5A 5D09A 1JUBA 1TWSA 2PDUA 4UFLA 1PUDA 5HWMA 5D30A 4LOCA 1F07A 3I3EA 3UW6A 3WUGA 3BVJA 1Q13A 4Q4SA 2B4GA 3VZZA 4H9ZA 3SDOA 4X3ZA 2PP1A 2Q02A 1K8CA 3F4DA 5C7VA 3W7QA 4BWLC 1GT8A 1DPMA 1UKPA 2VRJA 4XV0A 1ZUAX 4OVXA 4QG6A 2WVUA 1EBGA 3JW7A 3EBVA 2CLOA 5HMEA 4GZJA 3AALA 2X1UA 2RGLA 1NF0A 3AMDA 1AH4A 4Q7IA 5CPTA 3LSBA 3LV5A 2AKMA 1V3JA 5IRPA 1IXQA 1E6RA 1YDOA 2REQB 2ISWA 3SB0A 2QCDA 3LCFA 2GUYA 3VKAA 4N42A 4NJHA 3TA9A 3WFLA 5ABTA 2NX1A 5K3VA 4KERA 2EPHA 3I7RA 5LSMA 5M17A 4ZOCA 4HQVA 4V2XA 5I3HA 4IFKB 2HTMA 4PCNA 5A5WA 1CZ1A 1RA5A 4AUBA 2I5GA 2VCBA 4C6FA 1GYLA 3SAZA 1CGUA 3SECA 3SUUA 2DT2A 1E15A 4YTRA 3UG8A 3SCVA 5CC6A 4PTXA 3LPFA 2NWRA 2CWXA 3BSMA 1BVWA 1VGAA 2XH0A 5H8MA 4J3UA 3PAOA 2E6YA 1K8ZA 2XN2A 1DIDA 2WC3A 3ARPA 1EHNA 1OT1A 2JKPA 2Y5JA 4HVXA 5REQA 3CZ8A 1ISWA 1TV2A 1WUEA 3O3RA 1MNZA 5BXPA 2JGYA 3WD3A 4IIBA 4MPKA 4IX2A 4PGLA 4LUSA 4F4RA 1HF6A 3VOFA 1JPKA 3LB0A 3QGVA 3RPDA 3WNOA 3B40A 4MWAB 3W2NA 1SO5A 3LEPA 3WNPA 3DCPA 2XZ9A 3QXBA 2I16A 2TPSA 4JN7A 3SIZA 1EIXA 4L56A 1FFRA 4KKXA 4QS5A 1VFHA 4UOJA 5HMSA 1DXIA 4J2MA 4MDPA 1ZJIA 2CZEA 1UOZA 4XTIA 1OK4A 4DQWA 3K1DA 4RUBA 1OF8A 2OOFA 3P62A 1T96A 4AVFA 1AMKA 1JUEA 5T26A 2V38A 3PNZA 3TSDA 1CXFA 1SVDA 2ZC1A 5FJUA 4ICMA 2WMJA 3R94A 3UT0A 3TJLA 3HG5A 5FJIA 4ZQOA 5LYRA 4X2RA 4YVVA 3RMEA 3GG0A 3GQYA 3K8LA 4YWIA 4DBEA 1MEHA 5L9FA 4DM1A 1J8VA 5C70A 2JQXA 3EOOA 3PZTA 3F5LA 4C7GA 2A3BA 1OCBA 4M6UA 1MYRA 1ECQA 3MYPA 1OFEA 3A22A 5J04A 2PDGA 2PLCA 3IANA 3J7HA 4AVNA 3NQDA 2ANUA 3WF0A 1OHLA 4B15A 1LL6A 2OTDA 3AIUA 4IMDA 2RAGA 5I3FA 1DORA 1W3IA 5M2FX 5EA9A 4IIHA 1VFUA 3ENLA 1V6YA 3TMQA 3P67A 2FVKA 9XIAA 1TWWA 2VT0A 3WQ5A 1S5MA 2A6NA 4GZEA 2OCZA 5DXXA 2Y5EA 1Q6EA 3KRSA 4BZYA 1L6SA 2FB3A 1H4PA 3DFPA 4FLOA 1XC4A 1ZTVA 2E3ZA 1V77A 2QT3A 1CPUA 4RV3A 3S8HA 5HANA 2V63A 4IP7A 3KOFA 4IPIA 2YDSA 1KGUA 4W85A 2PRHA 3VKKA 4FX8A 2QF8A 4JICA 2YBTA 4QITA 2P53A 7ENLA 4WGXA 4H41A 1W9VA 3BOXA 2Z1SA 1ISXA 1JDAA 4OZOA 1XXXA 4DJEA 4Z2LA 2DIJA 4F2TA 2I14A 4CQ9A 2A3CA 3OZMA 4HA3A 3WELA 1W37A 3TNOA 3VYLA 4PMOA 1K9FA 3PBYA 3P7YA 4LANA 1H0GA 4M1BA 1G4EA 2JKEA 4B5VA 1TV4A 1LQ0A 3RN6A 2V5LA 2OLHA 4I6KA 1K9EA 2ZC8A 1J2BA 3KDOA 1QOQA 5LNWA 2NSXA 1A0CA 2PGWA 5A6AA 3GHUA 1E73M 1ZCCA 4WJEA 2OYLA 1V08A 1Z48A 4MYAA 2J4GA 1DEDA 2XSBA 1Z44A 1JUKA 3SW6A 4HZMA 2EG6A 1W1ZA 1JDCA 3DHDA 2QDDA 4TVDA 5EY5A 4J35A 5CSYA 4XVEA 2RJGA 2R1MA 2V5KA 1MQQA 3IIZA 3WK0A 5F2MA 2ZVIA 1ZJHA 1GKQA 1J79A 3USBA 3TAKA 3A12A 4KWUA 2ZZ3A 1ZSXA 3GXTA 4JIPA 2YR1A 3MV11 1PIGA 1QT1A 3GB6A 2A5HA 3G1HA 3TCEA 5LIUX 5ABFB 1BAGA 1VFSA 4Z2KA 4A3YA 3W85A 3GRIA 1S2WA 5I06A 4JQ4A 4ROQA 4XBJA 1BYBA 3OGRA 2Z7GA 2Z00A 4X60A 2QIWA 2X40A 5IHSA 3W6MA 3HPXA 1K1DA 2O56A 3OG2A 4C6PA 2QCFA 2YDAA 5DFAA 4PMDA 1HO4A 4UQAA 1KRCC 4H19A 3WY1A 5FL0A 4ZO6A 1ZBKA 1UIOA 2AL2A 2NQ9A 3IJQA 4IXHA 1XISA 4OU1A 1YKWA 1O5QA 1M65A 3M0ZA 3ARRA 3GKFA 4Y96A 3V36A 5I78A 2HPIA 3B9AA 4DWDA 5AFDA 5FACA 2IUZA 3S1XA 3NL2A 3DFYA 4CNSA 2Z0IA 3P82A 2PWVA 4Z0SA 4QROA 4G1KA 3W7MA 4QX4A 4UZSA 2A3EA 4ZO7A 2E1WA 5D2WA 1BQCA 4M81A 3HTWA 4L6OA 2OB3A 2Y8VA 3H70A 4J40A 1LT8A 3BLEA 3POCA 1W6TA 3SFKA 3FV9A 3GG7A 3ANUA 2OPJA 3PN8A 4AC1X 4MWAD 4LUSB 4HNCA 2WNQA 4G6CA 4CGTA 2HXUA 2GSJA 5DMYA 3UR8A 4UTHA 1R7AA 4IMAA 4L9XA 4A29A 1A0DA 4JQ2A 1XCXA 4JPGA 3VD9A 3CMJA 3MUY1 3OA5A 2Z25A 1GKPA 3GW3A 4ZENA 4P7RA 3K13A 3MSYA 1PZ1A 3GXMA 2P5NA 3WENA 3CXOA 3HURA 1QR7A 5CZJA 4UFHA 2ASHA 2YCLA 3AISA 3MA8A 3KRBA 3RRAA 2Y7FA 3RCMA 4RZBA 5E09A 3UG3A 3DX5A 3OQ8A 2OELA 3MWAA 5C0QA 2Q01A 1UWAA 4EPEC 1UP3A 2Q8ZA 2P8BA 5BROA 4U33A 1F3TA 3F03K 3KXQA 3NSNA 4EF9A 3NTYA 1KM4A 3T40A 1WAUA 2GGGA 3FJ4A 3HF3A 1VPXA 2VOMA 4JCLA 4R7JA 3NWRA 5CKSA 1LLOA 4XKMA 1UMLA 3FHQA 4JTAA 4HN8A 4IMFA 1K4GA 4U4MA 4NI8A 1HT6A 3ES8A 4FOKA 1AVAA 2H3BA 4ICNA 1ECEA 1LROA 3UESA 5AOUA 1IT0A 4J28A 3NSMA 3FS2A 3VZYA 2DH2A 4OWGA 2WLYA 4PTMA 4RW5A 3KFTA 5LKYA 4GC4A 3KZSA 2RDXA 1TZ7A 1W2VA 2D0HA 2XJ7A 2RGMA 3II1A 4RDYA 3M43A 1QWGA 1QW7A 3PWAA 3EOEA 3DHFA 4MY9A 1JI1A 4JTEA 2PDLA 2NW0A 2EGZA 4HZ8A 3BAYA 4X9YA 3SCWA 3W25A 2WSPA 2PDMA 4AZ5A 2VP8A 4G8TA 3NEHA 1W9BM 3FN9A 3C3UA 2GJXA 8XIAA 3MPGA 1WBHA 1QHPA 3VCNA 4K6AA 2EPNA 4LRSA 2X1IA 4BS0A 2E25A 1PJ9A 4WCJA 1ZAJA 3N6JA 2O7SA 5REQB 1K02A 3B8TA 2A85A 4DZ5A 4R9XA 1YNPA 1S3TC 1KR1A 1FWNA 3OVGA 3UP8A 5K2ZA 4IJBA 5HPCA 3WQGA 3RRXA 3LQLA 3GBDA 1GEQA 3SCOA 3PTQA 4DJDC 3AXHA 3CLWA 4FSAA 1ITQA 2DJLA 3LBOA 1JL8A 3WG6A 2HS6A 1W0MA 1V93A 4GE8A 1CBGA 1GGOA 1BF6A 3TJXA 4U3CA 4XUYA 4GVIA 4AEFA 4L5ZA 2D0FA 3LXAA 1UR9A 1JZ6A 1G0CA 4BF9A 3NYDA 2TSYA 3PF3A 4HP5A 3H2NA 5A6KA 3TZFA 1VCGA 4B3KA 1H62A 1TB3A 4RXGA 5HDRA 4P5UA 4HK6A 1IZKA 4W8LA 4E2VA 2O4QA 3U7VA 3ZJ7A 1WCGA 1TWIA 4K7YA 3A47A 1OCNA 4DM2A 3IAQA 2XG9A 3TC6A 2J25A 4QQ3A 1QI4A 2E77A 6TIMA 3TEVA 1RD5A 1VRXA 5DEZA 1B57A 4JFUA 3S46A 4DF0A 3RX4A 1A5SA 5A8PA 2W6RA 4FR6A 3OG3A 5LHEA 4YYFA 2W63A 3APTA 4J2PA 3B8WA 3LERA 4CCDA 2XDFA 3T0TA 4XB3A 3MSDA 3UQNA 3W02A 1NOUA 3BWWA 3P0XA 4R9OA 3AMCA 2CWNA 1PWMA 4GYPA 2PEVA 3QLLA 3MY9A 4Q6JA 2ZZ2A 3BAWA 4Y9OA 1G7UA 1G7VA 2NXGA 1JYNA 4AHQA 1R3YA 1KFLA 3PJTA 3B8VA 1JD7A 1Q7QA 4MKVA 3S83A 3H24A 4ALDA 2QPUA 1J0KA 4HCDA 2GWGA 3H22A 2OU4A 4XZWA 1VBJA 3CZLA 4MJ4A 1EOKA 4Y8FA 1KWGA 3BV7A 1XLLA 4NZ4A 5IOBA 2NUWA 3NDZA 1OYAA 1VC4A 2WVSA 2Z6JA 2DZBA 2WZIA 2WLZA 4CNTA 1H7NA 2GUUA 4D6JA 3VD5A 2VOTA 1L6YA 4C7DA 3S1GA 3G24A 1QI0A 1JRBA 3QM3A 3SR7A 2QS8A 1SJAA 1H7WA 2AL2B 4L61A 3HG4A 2VHLA 4KMQA 4CKQA 1JCXA 3IIPA 1TTQA 3RLVA 1P0NA 1E4LA 2NXIA 4INFA 4JNMA 4DWSC 4A3UA 1YQ2A 3RJXA 1ONEA 3E74A 4GX8A 1FDYA 3RPMA 3KUMA 2WHJA 2YFOA 3E12A 3AHTA 2D1ZA 3C5QA 3E5PA 4ZZ9A 2PP0A 4MB5A 3U57A 5HUOA 1M9HA 1AJZA 3W86A 2PGFA 3EKLA 2BXVA 1VHNA 3UY8A 1I0DA 4XKYB 3ZO9A 1G1YA 4F79A 2HK1A 4UNLA 3AROA 4PSPA 4UOZA 4W88A 1BKHA 1CXHA 1HIZA 4I5RA 3QY7A 3CAVA 1GVIA 3AQUA 2WZTA 3H53A 2ZKMX 5M3WA 1VRDA 2WO5A 5AYXA 2VFGA 3H8AA 4MFDA 1MW3A 3GVQA 4DO6A 3UYIA 4AG0A 3DGRA 1OY0A 3K2GA 1R9ZA 3PHAA 1ZQ5A 1A5KC 3WL1A 5AECA 2QLYA 3VIIA 1PX3A 2WV8A 1GQNA 5H6HA 5C9ZA 2VR5A 3NQCA 3I6TA 4JIIX 4Z1DA 3SCRA 4JNZA 1OX4A 3QPYA 4BJHA 1UOKA 3KBMA 2GQ8A 3NQ7A 1FHDA 4Q8TA 3S0CA 1D7KA 1U2YA 7TIMA 1ADDA 2BB0A 5HNUA 3PM6A 2HCVA 1Z69A 3W7RA 3ZJ8A 4DWSB 3S2NA 3SIMA 2BBFA 2XZ7A 5ECUA 4DXKA 3C2EA 4GQBA 3AS3A 1KFCA 1DJHA 1TPDA 4TV6A 3PFRA 1P0EA 1I4NA 3C2FA 3IVTA 5H8PA 5JIPA 2PTYA 1E1CB 3RO8A 4WQ6A 5DBTA 3WJZA 4JGDA 3TW6A 5HBFA 4CQ8A 4JFTA 3OZOA 1XP3A 1B3VA 3AUJA 4QCEA 1H7XA 2ZXDA 1TPWA 4NRSA 4ACZA 3UXDA 1VBHA 3QW4B 4ZMGA 4KBXA 2OSXA 4PEKA 3D6NA 3DYPA 3M5ZA 5LHFA 4QHRA 1UW9A 2D3NA 1IE7C 1V8EA 3CEPA 3POHA 3Q67A 4UZUA 1AK5A 5AHEA 1B54A 3AXIA 4WY0F 1I1XA 3ALGA 1EJWC 1HL9A 1OB0A 2VGFA 1Q6QA 3KRUA 4EF8A 4P7QA 4WSJA 1LCOA 3C8NA 4YHGA 1KRMA 4DI8A 4Q8WA 4KWOA 4NASA 3S6TA 1ME8A 5F2LA 4CNPA 5HOSA 1FWWA 4RZ6A 3KM8A 3WLHA 2HVMA 3LBMA 1IXOA 3P93A 4JL1A 1BG4A 1E6SM 1RALA 2PCEA 2DQXA 3N14A 2PDCA 2C1HA 4LWWA 3PZQA 5HJYA 1KBJA 4NAFB 2BS9A 4B5WA 4US5A 1W9UA 4GKLA 5BZAA 1LORA 1ML1A 2WAGA 4Q7BA 2FHBA 1FWHC 2AOSA 1Q6CA 2PODA 3VINA 5GNZA 4I5UA 4JOMA 3UYCA 3IK2A 4NX0A 2FB2A 3WUBA 3PTDA 1G01A 3HG3A 2QGYA 1Y7VA 3VIFA 2G3NA 3CL8A 5E93A 3T2PA 1UWUA 3VDBA 4GC3A 1P6WA 1TIMA 1TPC1 2P3EA 3FY1A 1KM5A 1U1JA 5A95A 3NO5A 1LYXA 1IEVA 1HKVA 3MP3A 4KESA 4HPGA 3SRKA 3W2MA 3LHZA 4M51A 4EXAA 2OQYA 2DUXA 1A3XA 4R33A 3BK0A 3H2AA 3TNBA 4LB3A 3VIMA 3MKKA 3AO0A 1KFBA 3NR0A 1A49A 2YJQA 1V7AA 4NI3A 1XIGA 1KKRA 2PCQA 1VJZA 3ITCA 1UA7A 4Y7EA 2GOKA 3F1QA 1H49A 1Q2RA 4FNSA 3PANA 1Q3NA 1XDJA 2G3MA 2OG9A 2AGTA 4OBTA 1W5PA 1TE1A 4K3ZA 3B05A 3PZMA 2FJKA 1A5MC 3B0YA 4AB4A 4KWSA 2IS7A 4IIGA 5AY7A 1I8JA 3ORWA 3ES7A 4UTWC 4DYJA 1GYMA 3IJIA 3VIOA 2ACQA 2VC9A 1EOMA 3ARTA 3MKVA 4YN5A 4QDWA 5HULA 4L1XA 2WWCA 2WANA 3IJ7A 5I09A 2PDYA 1MWOA 3VKCA 3GZAA 4CD5A 1Q4NX 3AHYA 3QMRA 2FZBA 4HJFA 1EX5A 4IFRA 3NCOA 3QY6A 2PSNA 1ADOA 3FJNA 1H5YA 1HGYA 1J5TA 4W87A 1E6XM 3G0XA 4IFKA 4AQLA 2R14A 2PUZA 2YA0A 4XD3A 4OIFA 3EYPA 4HNOA 1XYMA 2PDQA 1SPQA 4D6CA 3UR2A 1S5WA 2B7OA 2DEPA 1TA3B 4S3KA 3VNMA 2FZDA 1ME7A 2ATSA 1XQLA 4HK7A 1Y65A 1YTDA 4WY0B 3DG7A 2H3DA 3K1GA 5E70A 2QCCA 5HQLA 3CQ0A 2ZZ1A 1VR6A 1TZ9A 3QYQA 4GJ1A 3W1MA 1XX1A 5A1AA 3OLIA 4CD4A 3M1ZA 3AJXA 4IPJA 2JEPA 3B9NA 3FEQA 3SRDA 4YIWA 3MJMA 2BOGX 1EUNA 5FAJA 3IARA 1DKWA 5LNSA 4HK5A 3PVFA 3LCHA 3VFCA 3SUSA 3D5HA 1J01A 4H6EA 2GWNA 2VNCA 4ZL1A 2BFGA 5C71A 4GNVA 3QPZA 1Z42A 4GX9A 2E28A 4LVFA 1FWSA 4QM1A 4NNBA 1JPMA 1XLIA 2F2HA 2DSZA 1GG0A 3FYYA 1HJXA 4IP4A 2Y85A 5A8OA 3WLIA 2GYIA 1MEIA 2WB5A 1P1XA 4LAUA 3NQ8A 2WSQA 4JN6A 4V1XA 3VFLA 2EQDA 2CU0A 5AVNA 4P2VA 3L66A 3W7HA 1VBRA 3SN0A 3EXSA 4K2SA 4LF2A 4IL0A 4ZO9A 4R88A 3UJFA 3C6CA 1A47A 1TJ2A 4AD1A 2RH9A 3TH6A 2R8WA 4LYPA 4U10A 3R11A 1JJKA 4J7RA 4XKYA 1F2JA 1VEPA 1MRAA 1OC6A 4Q22A 3MB9A 1ONWA 2QCDB 1E4NA 3I68A 4O28A 1UWRA 4X9SA 2ZE0A 7REQB 3H7VA 3TOYA 1DTUA 2ZADA 4IXXA 2QCNA 1VYRA 5F4XA 4LTSA 2VZVA 3OZPA 4DF2A 4D72A 1MQPA 2QEZA 4NXKA 1K70A 1UP0A 3I7SA 1K8YA 3QKZA 4IX0A 3MKCA 5C7HA 3DKJA 1F61A 3W7PA 1RR2A 3HV9A 1IHIA 3L4YA 5AKQA 4GBDA 4ZQRA 3C56A 2PDNA 4PCFA 4QJ3B 4NF7A 1VB9A 3EWXA 1DWIM 4YCPA 5JMUA 2G3JA 5E9AA 1C91A 1MSSA 1KRBC 5BRBA 1LG1A 1GVFA 4V15A 2HEJA 2PS2A 3ZVHB 1TVNA 1LWIA 5GJPA 1EQCA 1QPKA 3HN3A 3QR1A 4CU6A 3REQB 3HQPA 4BI6A 1YRRA 3WQDA 4YVXA 3R0KA 2EAWA 1OADA 4FMVA 1TRDA 3G5EA 3N2MA 1UH4A 2OEKA 3NZGA 2QQ6A 3LHTA 1PYFA 3E9AA 2E5CA 1YYAA 2DZSA 4DBWA 1WO2A 2YL6A 1JDEA 1J2WA 3K5XA 5A8NA 1JD9A 3BLFA 5I2UA 5I23A 4JTDA 1EWEA 5BW6A 1NWTA 3S2JA 4B5NA 4S38A 3TWAA 4I9AA 2ZZ6A 1QPNA 3KLKA 4MNJA 2C13A 3WEMA 1SUXA 3KOWA 3GC4A 4FLRA 1ZP4A 2PA6A 3LUTA 3LRLA 1EEPA 3U48A 4PUJA 2WMKA 1RQBA 3UNDA 3UF9A 1J18A 2ZX6A 2GJRA 3CU2A 3DHUA 2A4AA 3W1NA 4U28A 3GY1A 1VHCA 2EKCA 4CQCA 3BCFA 3V0SA 3MC5A 1GQIA 2YXGA 4WDWA 4I7UA 3L5AA 4BY3A 1GONA 3UCQA 3RNDA 2OKOA 1IEQA 4WRHA 4GVHA 4GQ0A 3OYZA 3ATZA 1QI3A 1UA3A 3BANA 4DNMA 2ZRYA 2FGLA 6A3HA 3W88A 4H7ZA 2I9EA 3G1XA 3O05A 1BKSA 3LPGA 1XBXA 3TE9A 1LG2A 5KETA 1W56A 1OSEA 4PUNA 1W3HA 4US6A 3JZUA 1KLZA 2MNRA 1W3KA 2UZ9A 3EB3A 4MDOA 4GXMA 4O54A 1R2RA 3COTA 1XSKA 3O07A 2HNEA 5G2IA 1VENA 2EXOA 3G3DA 3S9YA 1N2VA 2G4FA 1RJRA 4DYKA 3SCSA 1AQFA 1IV8A 1LL7A 5EMYA 3BOLA 2DFAA 3N4AA 4RJEA 2VC5A 4DJFA 4K68A 2JGQA 2XGIA 1IEXA 3TTQA 4FR1A 1CX9A 2I17A 4JTRA 2CBUA 1EQPA 1W1TA 1ZHAA 3VDCA 2O0TA 4HOXA 3R10A 4UMCA 3FOKA 4IGSA 4KEMA 4O10A 2E9BA 3NQMA 1IWBA 3NYZA 1GNXA 1BWLA 2VD8A 4UNIA 4ES4A 4PTWA 5KZEA 1ONRA 3PB2A 3T55A 1LOSA 2ZUTA 3W7JA 2OWXA 1OF6A 1UUQA 3BW3A 3SJ3A 1MZRA 3R58A 5EFFA 1KGXA 5HWJA 3RAOA 2Y6ZA 2FMNA 5J5DA 3QSTA 4UCFA 1ODZA 3FKKA 3T08A 3ALFA 3CEUA 4E2DA 4JTIA 3S2MA 1G67A 3ERPA 1WKYA 5A69A 3F4NA 1GZJA 2ZWZA 3PJWA 4ZQCA 1DVJA 3FDKA 4ACYA 4XISA 3WF2A 3DI1A 3Q58A 4PMXA 1EO7A 4LVGA 2X05A 3C0LA 2XN0A 4OV4A 3U2OA 5D8WA 5I0DA 4MADA 4JTCA 1DJWA 4UTIA 4WGHA 3SCNA 2FZMA 4CD8A 3T81A 2PBGA 1WBJA 4AZBA 3SY1A 4GY1A 1MW1A 3WD2A 7REQA 1SFLA 2Y0FA 4KF1A 4TVCA 1PV8A 4P8XA 4AH7A 4GIRA 4B5SA 1AMYA 1IXPA 4OECA 1VPQA 4GO8A 2WVVA 4YHEA 3W7NA 3ID7A 3HG2A 3IJ8A 2E6AA 3NZPA 4CCZA 1N8IA 4GXPA 3T09A 1HVQA 1UUMA 1DJNA 4AXKA 2PI6A 3NQBA 3SURA 2FGBA 3VGDA 1W3LA 2EPOA 3L4XA 5AC4A 2ZA1A 3O1NA 3KE0A 1DQXA 1SYTA 5D04C 1RAKA 1DL3A 3VGGA 1T6MA 4LU0A 1LDCA 3M41A 3RK8A 4HHPA 2XIIA 1EJ7L 5AVHA 2JALA 1MEWA 4F8XA 2BX7A 3GS6A 1BXNA 1SM9A 2HS8A 3BSHA 4GNJA 1JIBA 4LUTB 3BZGA 2NV1A 2WKLA 4UIOA 4ENLA 1PKLA 4EVZA 1U5HA 3TIMA 1FWRA 3UWZA 4MSSA 3QRHA 3MU7A 2J7GA 2FFIA 3SI9A 4WLCA 2ACSA 2QJHA 2BLEA 4YU1A 3TX9A 2VUNA 1HQTA 1UQZA 4H3DA 3TUUA 1SZEA 4UOQA 3QJAA 5D4YA 4JX6A 3LCGA 1FBAA 4HMCA 1XYLA 4GIAA 2VELA 3T2QA 4AZHA 4NJIA 3LRMA 3CT2A 5I3DA 2EBNA 3T78A 4ZBCA 4HNNA 1AFSA 3HOJA 1K7EA 1M03A 3M0HA 1WDQA 4O52A 1E4MM 4C5ZA 1JYWA 2BZNA 2YZRA 3ZVHA 4QLKA 2Q3OA 4GUFA 1B5TA 2XINA 4G9PA 1RVGA 3M0YA 3L4ZA 1HW6A 7PTDA 4JQ3A 3AYTA 1IR1A 4H8NA 4RE3A 2OSWA 2D24A 3KHDA 4LVAA 4CEXC 2EHHA 4M80A 1EF2A 4FI4A 5FEWA 3EX2A 1XLEA 1P7TB 3W75A 1E70M 3FSTA 1XG3A 2AQOA 4B4HA 1XYZA 3T4CA 3I3DA 1F4HA 3TQPA 1XFCA 3EWYA 1MXDA 3GXIA 4I8DA 1QU4A 2OJPA 4BI7A 4O1BA 3TLLA 4J3WA 4HCLA 3CIXA 1A5LC 1UASA 1MW2A 3WQEA 1JZ8A 3L0GA 2OO0A 4ZOEA 2ODOA 2EPMX 1PZ3A 3V75A 4EPBC 1M7JA 1QFEA 3HU7A 4OE7A 4BEUA 1VFMA 4DO4A 4KFPA 3M5YA 4HA4A 1XLHA 3VKDA 3AU2A 1T0OA 1ESWA 1QW9A 3TZNA 3W1TA 1EL3A 2FTWA 2BNJA 2X7VA 3TYEA 1XLDA 4GI8A 4BKNA 4H9XA 3V1HA 1A5UA 1YNQA 5CEWA 5H91A 5HA7A 1B90A 4HPXA 4ZGYA 2QCEA 1XRVA 4JTKA 3HQNA 2X1TA 3UGVA 4JNYA 1F74A 3F4VA 3HBLA 1WXYA 4CD7A 4GD0A 4LGXA 5FSEC 3SRFA 2BVYA 2ZRUA 3CYVA 2W92A 5G1MA 1KR0A 3FLUA 3IUIA 3R4IA 3U0HA 1OG6A 3GH5A 4OJYA 3DH7A 5HATA 1QUMA 1BF2A 4HHHA 1G94A 4HMDA 2XISA 4F3HA 2QV5A 1GVQA 4K36A 5D9MA 2ONEA 6TAAA 3AS1A 4PN2A 1WA3A 4HNUA 3FVDA 3W74A 4IUGA 5DCBA 5LIXX 3I65A 2XVNA 1HJSA 4F0MA 2DZTA 2YA2A 2IPFA 3EEGA 4DHGA 3L65A 2VVSA 4O4WA 4RNFA 2Y61A 3OTRA 3OB8A 1VCFA 3CUIA 1XIHA 4EX4A 3M9YA 5CGQA 5BU9A 4KW2A 3M0VA 4N9BA 2AL1A 4OHQA 3AYSA 1XBZA 2WXDM 3V16A 4LT9A 2NLYA 4ADTA 4FO4A 1FKWA 3VUPA 4D8AA 4D1JA 4MY1A 3G0UA 3M44A 4S2CA 2H8XA 3ATYA 4R3UA 4G7FA 1SO3A 4FPSA 4UQCA 4B3ZA 5EMLA 5BYWA 3W38A 3GR7A 3IUDA 3FYOA 3E2QA 1FCBA 1OD8A 3SGZA 1AODA 1ITCA 1V0LA 4H2HA 1TR9A 5FKYA 4AZ6A 1GKRA 1W1B1 2NQLA 1MQRA 2D0GA 4PMVA 2BG5A 2QUNA 4JDBA 4NP7A 4D6FA 3URBA 1X6LA 4XUGA 3ZWTA 3RX3A 4RV8A 4GUIA 3DFTA 2WQPA 1VYPX 5FCZA 2PD9A 1R30A 3P3BA 2XN1A 1M1BA 3N19B 1QBBA 5AHIA 1XFBA 2HVNA 5FF2A 4Q4PA 2CYGA 4JD4A 1AQMA 3QV8A 4LBUA 3FIGA 4J9JA 2A6LA 5BMXA 1BG9A 4BR1A 4O18A 5G4EA 2J7DA 4GVGA 1R3WA 2C0AA 3G77A 4JYDA 4ORMA 5AYIA 1XIDA 3EPOA 4D6IA 1TZZA 2GDQA 2Y5SA 3R8HA 4HTYA 2O9PA 1HUVA 4IMCA 1RY8A 4OV9A 4Z1AA 6PTDA 2BY2A 4MB4A 3P74A 2Z1VA 4BQ5A 5M03A 3A24A 3CTTA 1X6UA 4QISA 1PAMA 3TP4A 1OX4B 4JZ5A 1BLIA 2ZDRA 2IW0A 5GNYA 4LVBA 1ZBVA 2XPKA 3NM1A 2VEIA 3ITOA 2ZX9A 3GW0A 3XIMA 2QW5A 4O0ZA 1CECA 5JQ9A 1WP6A 1VP5A 3SUVA 3MJYA 2Z1KA 4IPNB 3WQ8A 4ZEPA 3DKLA 4IPPA 1E4IA 1CGTA 3GTXA 5A2BA 2YSWA 3KDNA 3WNLA 3IWPA 2VEFA 4F0RA 4HSOA 4PFHA 4RDZA 3QSRA 3G1RA 3EOSA 3T6CA 2TMDA 2V68A 3AAMA 5AHFA 3PJUA 1G9HA 2D2JA 4LC6A 3W1LA 5IDZA 4IUOA 4X0NA 4O53A 3BDKA 2GDUA 5HAOA 1WB0A 1E9YB 3GE7A 3WMSA 1NQKA 3HQ1A 3N18A 3O15A 1IXNA 3NL3A 1TREA 3N2TA 2DVXA 1D9EA 4ACZB 1R3RA 3WQWA 2F7FA 4R85A 1MZHA 2GQ9A 4DWSD 3AS2A 4HT3A 5LA0A 1GUVA 2REQA 3BCDA 1AQ0A 1FUYA 1ICPA 1FWIC 2GL5A 5ABHA 2RHGA 5HNRA 2VRQA 2QVHA 3MVTA 4D1IA 2NT1A 1SW0A 4B5TA 1H60A 3SGUA 4AIOA 5I5RA 1BXBA 5JH2A 4CQDA 2PC4A 2FLIA 2H9AB 4JIEA 6CGTA 4XZMX 2ZX8A 3BGGA 1GOIA 4PCSA 3W24A 4AF0B 1ZNNA 3P6LA 2ZDSA 4G2DA 5XINA 3PULA 3Q37A 1QASA 2QJNA 2WHMA 1U5VA 3W37A 2TODA 2RDUA 1XRSA 1FWAC 4AX7A 1K9DA 3BCJA 4LEQA 1TV5A 3PZ9A 5DRIA 2DGAA 3H54A 3LENA 1U33A 4C6NA 2IPGA 1MDRA 3EX1A 1XD0A 3I10A 2IQ0A 4IL2A 1EF3A 4XO7A 3HGRA 3R0UA 2NXHA 3RFAA 2J66A 4DNHA 4M6VA 4W5UA 2WMGA 3A13A 4DX3A 3Q4DA 1VFTA 3DEQA 2A7NA 4X0VA 2FPVA 1ZCOA 3D47A 2GDVA 5CZSA 3EA3A 4EOUA 3T07A 5C9UA 4A8LA 3U5UA 5BCAA 4X2PA 3M5XA 3KHJA 3L5LA 3WF4A 5DT7A 4AEOA 1QAPA 4OTKA 5CPQA 1J0HA 2GVJA 5AHLA 2INEA 3C2OA 3MI2A 3W53A 2VFIA 2Z2AA 4N4QA 2J7CA 5CBJA 1BYDA 3OLGA 4MAZA 1M7XA 5CH9A 1D8CA 3UG4A 4I3GA 1ITUA 3W1QA 2DJXA 4CN4A 4FLSA 2NSOA 2E8YA 1W32A 4GGBA 3UNTA 3ZR4A 4EKJA 3FXYA 2PFHA 4KPLA 1ZL1A 4ZSTA 2GGHA 1F73A 4WJXA 3TQ0A 1MDLA 4LY4A 2XFWA 1B3ZA 3DYMA 5LIYX 2P50A 2FQIA 3FCPA 1PWLA 1XRTA 4DIAA 1UBSA 2VFEA 2NUXA 1PIFA 4EE9A 4Q8VA 1XBVA 3EXRA 1E9LA 1RLDA 3S9ZA 3VUSA 2HROA 3VX1A 3F5KA 1XDMA 2B0MA 3V18A 4FX7A 1NP0A 3LHWA 4MUZA 3WLOA 2GZXA 1E0XA 3TWBA 1QPQA 1F6KA 1P4CA 2Y70A 4LC8A 3GXDA 2CBIA 1EA9C 1DJXA 3V1PA 4AIUA 5LNUA 4MWAA 3REQA 2NVDA 1ZBCA 3L2LA 3QLDA 4IQJA 1R6WA 3RG6A 5AB3A 1DXFA 3DECA 3TOPA 3N9RA 3T8LA 2G8ZA 3STEA 4O8AA 1PVNA 1US0A 3ABZA 2V2HA 3Q65A 4G5DA 4PFMA 3QYSA 4S3EA 3QEZA 3E0WA 3N2BA 5DY3A 3MZNA 4PTVA 3BLPX 1KNWA 1VF8A 4O14A 3VDGA 3BO9A 3TA6A 3TW7A 1TJ1A 1I1WA 1SFSA 5LXEA 1UC5A 3NVDA 3LD5A 2QXWA 3BAJA 1F9CA 3F2BA 4ZTXA 5D32A 2DZPA 4MTVA 3CO4A 2F38A 4MOZA 3GYCA 3WBWA 3G22A 4RE0A 5D9OA 1QVBA 3IACA 2DSWA 4Q8MA 3OEXA 4DXXA 3U4FA 3NXLA 4DBUA 1UP2A 2QCLA 2HXTA 1QPOA 2G41A 5CC5A 3VZXA 4L4OA 3GM8A 3VA8A 1Q65A 3V5CA 4CQBA 1J0IA 1O95A 5LGZA 2PLJA 3GC5A 4HA0A 3CIWA 3BOFA 4JTHA 1Q6DA 5HK4A 3TROA 3OHIA 1DHKA 1YXCA 3K30A 2ESCA 1V3HA 3ZS4A 5DF0A 4S3GA 1G4PA 3THCA 5JU6A 3GSMA 1YPXA 4PUUA 4M7TA 2PDXA 1CNVA 4W4QA 1PPIA 4GFSA 4NZ3A 3C2YA 1I75A 1YEYA 3GR4A 1NH6A 1XWYA 3PNUA 3CB8A 1E3ZA 4UTTA 1WZAA 3WQCA 3IGSA 3OO2A 1BTCA 1F05A 3EX4A 2RJHA 4HOWA 1KCLA 7TAAA 1UMYA 3KRZA 4OUEA 3GVVA 1MO0A 1AZ1A 5KTLA 1QO5A 3WK3A 1IZCA 4MJZA 2PDFA 2V67A 4P7LA 4EWND 4DPPA 2VX7A 4IICA 1QMLA 3R7MA 1VEMA 4PEEA 1XHGA 2GJLA 1GW9A 2X42A 3QPEA 1GVYA 2CKSA 3FXGA 1OQFA 3WKZA 3AHXA 3RM9A 1H11A 4MZ1A 1ZB5A 3CTLA 4QR6A 1ISVA 2NWSA 3THUA 1EGZA 4A22A 1KQZA 3V4BA 5CC3A 3UZ5A 3H4XA 3HO8A 3EEZA 4UUIA 3LCIA 3ZLHA 2WJFA 2OGYA 4NXSA 1SFTA 4H1ZA 4RE2A 1ZGDA 4QEHA 1BWVA 3ARZA 5K9CA 1V3LA 3ZT7A 2FFCA 2J7FA 2WNZA 5FI8A 3IJLA 4F0KA 3OVQA 3W07A 2IXUA 4GH1A 3KLLA 3CPRA 3PK7A 4WOZA 3W7OA 2IPJA 1YHTA 2Z2UA 2GVYA 1YDYA 1YTKA 1RUSA 3A64A 3HA1A 3UGRA 4K39A 3P81A 1QTWA 3H12A 3UZWA 4PULA 1X96A 1WKFA 1QXLA 4A8IA 4HOZA 1TX0A 3MW7A 3VK5A 4QE5A 3QZ6A 5CAKA 2A3AA 8XIMA 3PBUA 2PWFA 3TDFA 4ZFMA 4QRNA 4ZOAA 2VJXA 3WQFA 1OM0A 3WLPA 1VQTA 1VH7A 2P8CA 1UZ1A 1Q45A 1FWGC 5A6SA 3WK1A 1W17A 3UZZA 1ZBWA 4WZHA 1Z9AA 4YNGA 4L9YA 3UVIA 3FSUA 1R3SA 1C7SA 2VFDA 3VKBA 5C2CA 1FWJC 4A3HA 5HPOA 1BSLA 4ZVJA 3LTSA 3STCA 5U7SA 4AD4A 4L80A 2GJXB 1UWTA 3S5SA 4B90A 3SEPA 1C93A 4MNMA 2R1NA 1UC4A 4DLFA 3THQA 2XFYA 1DE6A 2C18A 1D3GA 1W3TA 3TJ4A 1KWKA 4MIMA 1W9DM 1OT2A 1T40A 3IJ6A 5IBXA 3SQLA 3IGUA