4D9PA

Crystal structure of b. anthracis dhps with compound 17
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
273
structure length
264
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design of Novel Pyrimido[4,5-c]pyridazine Derivatives as Dihydropteroate Synthase Inhibitors with Increased Affinity.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate Synthase
total genus 91
structure length 264
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4d9pA00
4O0QA 4MWAA 4DJFC 3MCOA 3H2AA 4S3AA 4MWAC 2H9AA 1Q7ZA 3V5OA 4S3DA 4S3EA 3TYAA 1AJ2A 4MWAB 1Q7QA 1AJ0A 4DJDD 2YCLB 4DJDA 3TZNA 4O1EA 3TYBA 4DAIA 4C1NA 2YCIX 4S3BA 2YCJA 4D9PA 2YCKX 3H2OA 1EYEA 2VEGA 3H2NA 4D8ZA 3BOFA 4S3CA 3TR9A 1AJZA 2Y5SA 4DAFA 4O1FA 1Q7MA 3NOYA 4DJDC 1Q8AA 1TWWA 3TZFA 3H26A 4DJFA 4HB7A 3TYEA 1F6YA 1Q85A 4NHVA 2BMBA 3H22A 3MCMA 3TYUA 3H2CA 2Y0FA 2H9AB 4MWAE 2OGYA 4DJED 1TX2A 2DZBA 3H24A 4DB7A 3MCNA 3H2FA 4CCZA 2DQWA 1TWSA 3TYZA 1TWZA 1AD1A 2VEFA 2E7FA 3BOLA 1Q8JA 4D8AA 4S39A 3TYCA 3TYDA 4DJEA 2Y5JA 1TX0A 4S38A 1AD4A 2YCLA 4DJEC 3H23A 4G9PA 4NL1A 4C1NB 4S3FA 4NILA 3H2MA 4NIRA 3K13A 3H2EA 4MWAD 3H21A 2VP8A 4PZVA 4DJFD 2DZAA 5JQ9A 4S23A
chains in the Genus database with same CATH superfamily
5XIMA 1K7FA 2GUUA 3ABXA 5IXEA 3ZZ1A 1C91A 2ZZ4A 3B0VC 4HCLA 4L6OA 2XN1A 1YXYA 2J66A 1I45A 1XH1A 1R7OA 3C2VA 3U9IA 1W1YA 4BF9A 4CD6A 1W8SA 3EB3A 1RCXB 1V0NA 1TSIA 3O8AA 3W7GA 5JXQA 4FALA 1KR1A 1TIWA 3HU7A 1B54A 2Z2UA 3PPCA 1QNPA 1UKSA 4WR3A 1P0BA 3R43A 2GGEA 4XD6A 4LAKA 1D8CA 2Z6JA 3KVMA 1QR7A 1E6NA 4HT3A 3DIPA 4B4FA 2V9DA 1LL7A 1DHKA 3O06A 3PBVA 5DT5A 4HSOA 3QY7A 4UTFA 2CZFA 2Z26A 3E2SA 3G3DA 1CCWB 4KRTA 1VYSX 1B9BA 3FAXA 4F9JA 3ARRA 3HMJG 2B7OA 1NELA 3EX3A 3T0DA 1OZQA 1O5RA 4XIAA 4ZE4A 2WNZA 4IJRA 2IW0A 4KEMA 3RN6A 3Q37A 5DRIA 1REQB 1J0JA 4AD2A 3VDHA 1VBHA 1S39A 3EOEA 2R14A 5EMUA 2DQXA 3ECQA 4NI3A 3E38A 4Z2HA 3W7JA 3XIMA 2ZXAA 3GH5A 1UR4A 3WZ0E 3B8UA 4GQBA 1OGSA 2WBKA 3JW7A 3EEGA 4UR7A 1U1UA 1OYBA 4AUBA 1TE6A 3OZOA 1NP2A 1X8CA 1MW2A 3W1MA 3M0IA 3QTGA 2VMFA 1NWTA 5JBEA 3BOXA 3FVMA 3JUGA 4MWAC 4DI9A 4JQ1A 3TUUA 4TVUA 3TOPA 2IPGA 3T42A 3HQ1A 3LXCA 4FP1A 1Q6EA 1SYTA 2ZUSA 4JD4A 3IIZA 2WCGA 1Q2RA 2HISA 4LF1A 2Z1SA 2V5LA 5CZKA 3DERA 3N2XA 4LBRA 1OFRA 1T8QA 5K4ZA 4NKCA 4RW5A 4AZCA 5BMWA 2EPLX 2NWRA 1E72M 3VA8A 3IJ7A 1H4PA 1NSJA 2VUYA 2OZ3A 3PR2A 4ZO8A 2NVCA 3W2LA 1OFAA 4PTVA 4AWUA 3P3BA 1SW7A 4ATLA 4E2OA 1AFSA 1S2AA 4RPQA 5K7JA 3R25A 5FJRA 1E0XA 4O1BA 4A4AA 1EA9C 3APGA 1W3IA 1U5VA 5BXSA 3I3EA 1NH6A 3NO1A 1O1HA 4J28A 2FPTA 1KCKA 3PTQA 3BSMA 4NYYA 3E0VA 1EFZA 1XYAA 1C90A 1SZGA 2R82A 3AMCA 5A95A 3E0LA 4XZBA 1OF8A 1OIFA 4UTJA 4NJGA 5FI8A 3V1PA 1LCOA 4QXIA 4ERGA 2WQDA 3MTWA 1NU5A 3AXIA 2OU4A 4AYSA 1OFEA 4JOMA 8RUCA 1GVFA 2Y62A 2ISSA 3LLFA 1KXVA 3U2CA 1X96A 4EWND 2OSYA 2F9RA 4HNLA 1ODUA 1F6PA 4IP4A 1RP8A 3HQOA 2O9RA 4XO6A 1RVGA 1AJZA 4ZSUA 5B7YA 3NDYA 1S5MA 1VFHA 4K8EA 2XGBA 2D24A 3TTQA 3ZIZA 5AC8A 1Q6LA 1OCQA 4CQBA 4B5SA 3SM0A 3CQHA 1VYPX 4LU0A 2RJGA 1MDLA 3CMFA 4ZOEA 1UP0A 2YPIA 2O9TA 1MO0A 4AMCA 3M5VA 5BCAA 4L1XA 3EDJA 4JIHA 2AMXA 4GOAA 1AL7A 2KAUC 1HJXA 1XLDA 5D03A 4CD8A 4IPIA 3TCSA 4O1AA 2PWDA 2X7WA 2O7SA 3ANYA 2V5JA 3I6RA 5C2CA 4JIEA 1ZALA 3W82A 1CWYA 2PBGA 1C8VA 1J5SA 2XVGA 2G50A 1LQAA 2ZUMA 1DJIA 1R8LA 2EG7A 4S23A 3ID7A 1V3JA 1YBQA 5E09A 3L4YA 1P0NA 3OBAA 4A8RA 1J9YA 3VFCA 4GZJA 1WA3A 1A0DA 4UNIA 3EOLA 3FXGA 1KFJA 1KLYA 1RD6A 3FJ4A 3TWBA 1DL3A 3CL6A 3VXGA 4O1EA 3PUOA 1P6WA 1RQEA 9RUBA 3T55A 4UQCA 4LV4A 2QCGA 5M17A 1G6CA 3DU0A 3NOYA 4QDWA 1FWIC 3MO4A 1UH4A 1WO2A 5I09A 4IL2A 3T81A 5IHRA 5I0DA 4L4PA 4AEFA 3LBOA 4QE1A 3UWUA 4HBKA 2XPKA 4NJKA 4O12A 3C56A 3NZGA 1EPVA 1XCFA 4X22A 3WCZA 1T40A 1TV3A 3SCQA 3VAVA 1VFMA 4RE0A 1D3GA 4NAEB 4KKXA 2Z27A 2L5HA 4LB3A 2HNEA 4MGGA 4FA3A 4O8RA 4B4HA 1ECEA 3NQFA 1MXDA 5T8GA 3N4FA 3UGVA 2OLHA 4UFJA 4KERA 4ZCWA 4E8GA 2NLIA 1S2UA 3BW2A 4HSNA 4XTDA 2IPJA 2E1DA 3KW3A 1S1RA 4Q8WA 2ZTKA 2WNNA 4ZOCA 3TN3A 3NWRA 1KRCC 5BXTA 4QQUA 2P50A 3FYOA 1Q65A 2EEXA 1K7XA 1JPDX 2NXHA 5I79A 1NDVA 3LRLA 3NGFA 3WLHA 3W37A 1OVDA 4CU8A 1I60A 2D22A 4JQ3A 6REQA 3GNRA 1W5NA 4IFKB 3UVAA 5HNUA 1TZ7A 4EAYA 4B2DD 2GDUA 2PBOA 2XTKA 1GCYA 3A64A 1V3IA 1GQKA 1HKKA 3VGHA 3VILA 4YIWA 4IICA 4H2HA 3OQEA 1OYCA 1ADSA 3ZLGA 1K1DA 7XIMA 5H8UA 1FCBA 1W3JA 5LZLA 3S1WA 1VB9A 3OEXA 3DHDA 4C90A 2YXOA 4OQVA 3WQVA 4MWAE 3LV6A 4HD5A 1F8IA 1RV8A 1TPFA 5XIAA 1TUXA 3QZEA 4IXXA 1HNYA 1W3KA 2EJ1A 3P2VA 4PBEA 3SN0A 1MFUA 4PCSA 2QCMA 1CGYA 4PCTA 4UQDA 1TJ1A 2OG9A 1JFHA 4W8AA 2VEPA 3P8JA 4FNPA 4MUPA 3DUGA 3NPVA 2Y5JA 1VHCA 3Q94A 2DT0A 3URNA 4CN1A 1TQJA 4GBDA 2Z1XA 3ZOAA 1EO5A 5A8MA 3RK8A 2WVUA 3WYZA 4ORMA 3F4WA 1XGZA 2Y7FA 3RLGA 4LAOA 3FGCA 4R33A 2JFEX 4FIQA 4AIEA 2QDHA 1V4YA 3U6WA 5K2ZA 2QJGA 4MLRA 3TW6A 3N9RA 1IF2A 2Z2AA 5RUBA 4WDTA 3WQOA 4Q8VA 4FR6A 3EA1A 4FPSA 1VJIA 3MCOA 4WY0F 4PUWA 3WQEA 2NQZA 3N6QA 4PMUA 4EPEC 3KL5A 2I9EA 2GVGA 2P53A 3AMGA 1JULA 1H2JA 2YCJA 4FF5A 2HE5A 3R0DA 1E73M 2QDEA 1T0OA 4PUDA 3W3OA 3MUY1 1MVYA 4ROPA 3WQPA 3QRHA 1W3HA 4WK9A 2G4FA 4DWSD 1DXEA 1B3WA 3EPNA 4GD0A 4IJBA 1E6QM 4J35A 1EDQA 3RCYA 4WD0A 3BQ6A 3K1GA 2J8TA 1UR3M 1TV2A 1XP3A 8CGTA 5LIKX 3KWXA 4NZ3A 3TJIA 4FX6M 4Q8PA 3CIVA 3IJ9A 3AXHA 3FKKA 5HJYA 2PC4A 3ORWA 4E2BA 3PUEA 3ZM8A 2FZNA 1W17A 3MB9A 3TW9A 4PCFA 4PC8A 2EPMX 2BVTA 1C3FA 4LUYA 4X3ZA 3PSWA 4J7RA 3VNMA 3W2NA 1CXHA 4ECLA 2QCNA 4WIWA 2VRKA 2ZX9A 3NOEA 1BQCA 2WC4A 2VUNA 3EBVA 1NOFA 3NDZA 1XG4A 1CW2A 3IS4A 2QV5A 4B5XA 2EG8A 1IT8A 3EKGA 5BU9A 2JGYA 3P84A 4MWAA 2Q01A 1UBPC 1AVAA 3WD1A 5HQLA 2UWFA 3TYAA 2IQDA 4V27A 1QW7A 3VUPA 1AZ1A 3ZO9A 1Q6RA 1JCYA 3GC5A 2QNEA 3QV9A 4BHYA 1J79A 3K5XA 2QVHA 5DQPA 4HU0A 1W2VA 2YR1A 1BHGA 1Q7MA 1BVWA 4PMXA 5LHFA 4HB7A 2X42A 3EWDA 1GKQA 2XSXA 3BANA 3I6EA 4B5UA 2BGSA 3U0HA 2O4MA 3W83A 1L6YA 4ZL1A 4FOJA 3UJRA 3XINA 2VR4A 3TEVA 3F03K 1ZBKA 1WPCA 2CLOA 5CSYA 3QQWA 4I9JA 2UZ9A 3AWNA 2QCCA 3CWHA 1JZ4A 2E6DA 5I3GA 1E4LA 4LW7A 1QDSA 1SM9A 2PP1A 2AGKA 2YDSA 1ME9A 4IUOA 4GC4A 1S5TA 2BXYA 3NPXA 3KTXA 2QUTA 2Z7KA 4MWAD 1NP0A 3WQGA 1QO2A 3CHDA 1B90A 3QQ0A 5F1VA 3DI1A 2QUUA 1EP3A 1P48A 4HZ6A 2WK2A 4IMEA 1QATA 1BKSA 2FDSA 3A21A 4DJDD 1NQ6A 1X6NA 2JF7A 1DV7A 5J5DA 2OPJA 1TYGA 5IBXA 2WNWA 3BAJA 2CZ5A 4CD5A 4TV6A 1K03A 4ZO7A 2Y63A 1CZ1A 5H91A 4Y8EA 1F4HA 5LXEA 3WK1A 3BLPX 1E9ZB 3A6OA 5C54A 2ZBTA 4EPBC 5JH2A 4XZLX 4AB4A 5DCDA 5C2GA 2XVPA 1UZ1A 4IP5A 4A8LA 1AW1A 3C5QA 4IGMA 1CX9A 2WVSA 4UQBA 1DE5A 3I68A 4GXMA 2NW0A 3WSUA 1R3SA 3F2CA 3VK5A 4XZIA 1ZL1A 1HL8A 1YPIA 4M7SA 1REQA 3FOKA 3CJPA 3ARYA 1FH7A 2CIPA 5U7SA 1LT7A 4JTJA 3L4UA 5HA7A 1TUFA 2WSRA 3VDAA 3ARWA 3B0XA 3AWOA 4ORIA 3RAOA 4W93A 1G4TA 5D9NA 2VX7A 3LBCA 3IGSA 4DF0A 4UCGA 3CPRA 3T8QA 1EEXA 4ZOAA 4L56A 3QHOA 1F73A 2BB0A 1F3WA 3QGVA 3OG3A 3S6DA 3LGEA 1XR2A 1EQCA 2VKZG 4I7VA 3W27A 4GZIA 2QDGA 4JIRA 1V6YA 2JK2A 5DXYA 3AJ7A 3T78A 3WKZA 2H8XA 3TH6A 4IGHA 3ITGA 5AHLA 3W28A 5REQB 4LAMA 4WOZA 4FX8A 4Y6GA 3VU2A 4BR1A 4CU6A 2QJHA 1QI0A 2GJXB 3Q58A 3TQPA 3OVQA 5KSWA 2E5CA 1O6IA 3S5NA 1W9UA 4ZFMA 4AZCB 1EDGA 3BG5A 4L80A 3NZQA 4M6UA 4M1RA 4BI7A 1P1XA 2GWGA 1GJUA 4Q8TA 2PU0A 3G1DA 3S2NA 3F5JA 2PDYA 4P7QA 3GZ3A 1BSIA 3ZLFA 3EDFA 4CCEA 4MYAA 4M8UA 3KRZA 2GDQA 3FDGA 3S2JA 1ZRQA 2C0HA 5GQBA 3TNBA 4ZTXA 4H7CA 3U5UA 5K4XA 1XSKA 2BY0A 1XRTA 1US2A 1ONXA 1GG1A 1RCOB 3WUEA 3BV4A 1MFVA 3P14A 1XLHA 1EGMA 2YSWA 1V02A 4IGNA 3OGSA 1QI5A 3RPDA 1F3EA 3SY1A 1KW1A 3VE9A 4DO5A 4LUSA 3QQ1A 1VFFA 3V0SA 4WJEA 5I78A 2YL8A 4E4UA 2HPMA 3UWWA 6REQB 2VWSA 1XBYA 1RP9A 3V7PA 3ABZA 3UJFA 1GTHA 3VCCA 3WLRA 2EKCA 3C61A 3CAVA 1GORA 2I16A 2X16A 2F6XA 4FXRA 4P7LA 2BGQA 3BLIA 1EJ7L 1Q45A 3P6LA 1WOAA 3BH4A 3GNDA 2Y2WA 1CXFA 3BE7A 1I2QA 4GXWA 4H6EA 2NT0A 5DFAA 1W2PA 2PA6A 2Y1HA 3TV8A 2FHFA 4KIRA 2PCQA 2J6XA 4JL2A 3ONBA 2OB3A 1TWZA 3M9YA 4JIQA 1GOKA 1IT0A 2ZXQA 3L66A 2VEFA 3W1UA 3D3AA 2OVLA 3NL2A 1DOSA 2ACRA 1N8WA 5F4WA 1T96A 2ZZ2A 3OB8A 4F4RA 4ZOBA 3IK2A 3SSZA 4PTNA 3G77A 2G3NA 5E6ZA 3NQMA 1MDRA 2FZMA 4PSRA 1R30A 5A94A 1E1CA 2X05A 2JIEA 1QI2A 1V6VA 2E1WA 3SCRA 4KWVA 4LV9A 2ALDA 3LM7A 3QF0A 3T44A 3FLUA 4NNAA 2PDNA 3WD2A 3L4ZA 2R24A 3QPZA 1E9LA 4C6IA 2PLCA 1EO7A 4X0NA 2BX7A 4J27A 3SBFA 4EXAA 1V3LA 3URAA 5D2XA 4BQ2A 1EOMA 3W2JA 2GSEA 4ZTYA 5HWNA 1CI1A 3AHZA 1L2UA 3V16A 5I24A 1LQ0A 1GGOA 1RJPA 2OEJA 3Q67A 4P61A 3KP1A 3RG6A 4FO4A 4NI8A 1TCDA 2Z6IA 5HQEA 1JPHA 1TX2A 1UZHA 1PZ1A 4PFMA 1W54A 1XCWA 3MP5A 3VI2A 4Y9AA 1IEQA 1JDCA 3DFYA 3AUJA 4JXCA 3W7KA 3GLCA 4O50A 1ZNNA 3VDGA 1DE6A 3GQYA 4S38A 3TQVA 1GZGA 3WDJA 4HPJA 3RMEA 3GXIA 1JQVA 3PVFA 2W4XA 4KWOA 4DRSA 1Z3NA 3MP4A 5ABFA 1M65A 2V5CA 2WC7A 4M80A 4A21A 5CPTA 1XRFA 3EOUA 4AC7C 1GKPA 3SFWA 4PN2A 2E09A 4XX6A 3TAOA 4WX2A 5HXMA 2QW5A 3E2QA 2C0AA 4H1ZA 1P0EA 3HGJA 1JF5A 2BHUA 3NQ6A 3HO8A 1UP3A 1MZRA 2Y7DA 4OBRA 1C92A 3A5FA 3VOIA 1VQTA 3EAUA 4I3GA 2C1HA 2PS2A 3HFYA 3G1FA 1B3VA 4O57A 4HU3A 2YYTA 2EXOA 4GZ7A 3SDOA 5FA5A 3QHNA 3S3GA 1CGTA 1W3NA 2B7PA 2DUZA 1ZY9A 2EF9A 1DQUA 3I4EA 4W9TA 2XIQA 4C6PA 1KKOA 1JI2A 3UF9A 3NVTA 3DG3A 1F3TA 1GHSA 3TROA 4V33A 1IZJA 3JZUA 3SY8A 2E7FA 4U2ZA 3OYXA 5B80A 2BDQA 4RCXA 4JY9A 2TPSA 1PIFA 3ZMRA 1WP6A 3EA2A 5LKYA 4GI9A 1RBOB 1ONRA 1X38A 5CGTA 1TTIA 2FMNA 2GK1A 4QJ1A 3FY1A 2P0IA 2EPKX 3U7BA 5A6MA 4JTIA 3CZLA 3BMWA 1JXJA 3OVGA 3R0UA 4XUYA 4GVFA 5TD4A 4Q8UA 1C8QA 5EMJA 3TWAA 1C7TA 3GXFA 4GC3A 4JIIX 1CENA 3SFKA 3AQUA 3WF2A 4X0VA 1HP4A 2FZ8A 1BEUA 1QCWA 2YCKX 5ABHA 3WJYA 1CLVA 2DSWA 3W29A 2ZA2A 1FDZA 5CZSA 1BWLA 3S9YA 3ABQA 2DZTA 1QNQA 1A50A 4C6BA 3LZ3A 4GJ1A 1AQ0A 4DYJA 5LNRA 4Y9OA 3KUMA 3N29A 4BFAA 1WQ5A 1Q66A 1FWNA 3S2MA 1P0DA 1H7WA 2D69A 2VCBA 3AISA 3PPFA 1KXHA 5REQA 4R3UA 1KA9F 3BLFA 2X7VA 1F2JA 3UZ5A 1XXXA 4W87A 4AWEA 4D71A 3UVIA 3EX2A 2GQ9A 3MPGA 3TTSA 5A6AA 3NR0A 5AB3A 2OYLA 1M03A 4ATDA 3PHAA 3LPOA 1JDEA 3QMTA 3AU6A 1J4EA 1Z41A 1IT7A 2AMGA 4D2JA 1QW8A 2BY3A 1VPXA 4L64A 1EF3A 6XIMA 1JL8A 3UPMA 3ZS4A 4C5YA 2FVKA 1UWUA 3LEPA 4MJZA 4JTTA 1ZAIA 3CL7A 4LSBA 3VD9A 2ZOXA 5J8LA 1Z69A 1W3TA 2D0HA 2OCZA 1ICSA 4HYWA 4MB3A 2YDRA 2QUVA 3BICA 4LCRA 3R6IA 4S2CA 2ZX5A 4REQB 2WMGA 5EB8A 3NYZA 4QHRA 3MDWA 3MBFA 1O68A 4QG6A 3W70A 4OWGA 4C1NA 1KFLA 3RYSA 1E70M 5EMYA 3PUGA 1LRTA 3SRKA 4OVXA 2CKRA 1VIWA 2VJXA 3G8EA 1QAPA 3N25A 4C6LA 3B0YA 1UHVA 4C6NA 3RHGA 3J7HA 2BHYA 1M41A 3H53A 4ZFCA 3C2YA 3TE9A 3C2EA 5FAGA 3SCWA 4KF1A 2WM0A 1NTHA 3OZYA 5DEZA 3AIBA 4DYKA 4GFSA 3IIVA 2PPGA 3GS6A 5I06A 1XIDA 2EAWA 1QPRA 4TQTA 3KVLA 4PULA 3DFHA 2XN0A 4WQ6A 5C9XA 3GBDA 2QPUA 5BOOA 1WAWA 3UW6A 4DWSA 3WD4A 1Q5MA 3UYIA 4DN1A 1RQBA 4CD7A 1EGZA 2HV5A 4GE8A 2A79A 1GHRA 4JFTA 3NQ8A 2RDUA 1IEWA 3PB0A 1B3OA 3LHYA 1OGBA 3A22A 4JEQA 4RNJA 3OA3A 4W88A 3R1ZA 2ATMA 1I1WA 1E40A 3EXRA 2VGBA 3M6YA 4GVHA 3QY8A 5E93A 4AZ6A 5HNRA 4FMVA 3Q65A 1UG6A 3EWBX 3W2KA 2ACQA 4IMAA 4W7VA 1SPQA 4MY8A 3V1HA 1J11A 2P76A 3EKLA 5IHSA 2I1OA 3NQAA 4PMZA 4IMFA 3AHXA 2F84A 3GTIA 3V5FA 3WELA 4UBPC 4JDBA 1W5QA 2FH6A 4JFWA 1FHVA 3JVAA 3MHUA 2J9YA 1WKYA 3CAWA 2J25A 4HP5A 1A0CA 1S3HA 3BO9A 1NAL1 4MADA 1W9DM 3STGA 5IOBA 2X0YA 5AZ1A 3M0XA 4JEJA 2ZRUA 2DW7A 1TPB1 5LSMA 1POJA 3GZAA 1EBHA 4BQ3A 2ZRXA 3WBYA 3A9IA 1R3QA 1OD8A 3VD7A 3UZWA 4D8AA 2O9OA 2E77A 3TN5A 2BBFA 3QOMA 5D4YA 3AICA 5G5IA 3GIYA 3PANA 1OFQA 2PCEA 1NEYA 2I17A 1B4KA 3GY1A 3KOWA 2BS9A 2GSJA 3M0LA 2JIWA 1AQFA 5HPOA 5M1TA 1J2BA 4ICNA 5HMEA 1EX5A 3CZGA 2WVVB 1IGSA 3E0FA 5LNVA 3H2EA 5D33A 3PZOA 1X8FA 3GNXA 2WYSA 4AZBA 2DH2A 3EKZA 1MW3A 4AAJA 4LPCA 2YGYA 4L4LA 4XD3A 1WZMA 3R8RA 2E40A 4L6HA 1YDNA 4JTAA 5FCZA 2DJLA 2VENA 1US3A 3AALA 1S38A 2D2GA 2JF6A 3DBNA 2V82A 5BMXA 3H4XA 3LCHA 4AMAA 3DAQA 1LRNA 2PMQA 2PDIA 3P0WA 2CLLA 3W84A 3QW4B 5LA0A 2WANA 1JQXA 4XAFA 2R9RA 3AC0A 3VNLA 6PTDA 2CZVA 2UV8G 4PCPA 1C7SA 4HVXA 1XLLA 1YPFA 5GVJA 5FJTA 3NDOA 3N19B 4NHVA 2YB1A 5DCBA 1A5AA 3E49A 4JTFA 3BLKA 5I3KA 3LNMA 4PMVA 4PODA 3N13A 3F5KA 4ONVA 3LCIA 1X6LA 3UXKA 4NRRA 1JPKA 2CLEA 3L0KA 4UFKA 3MUIA 1AD1A 4UUIA 1JZ7A 2RAGA 4UQEA 3AROA 5EFDA 4F9DA 3SRFA 4W8BA 3SAZA 3CZ8A 3H4GA 1PWMA 3ZWTA 4M1BA 3S1XA 5D04C 3M5YA 1C8XA 1KCLA 2PDKA 4I5UA 1UD5A 3TXZA 3QKZA 4IX0A 1YNQA 2PWGA 3IUDA 1DPMA 1FH9A 3BK0A 3CU2A 3C0SA 5CZJA 4FK9A 1RALA 2A0NA 4EIVA 4HZMA 4X63A 3UQNA 2VC6A 5G1MA 2A21A 3RUBL 5BXRA 3SY5A 1K02A 4AVFA 3C4UA 1FWRA 3N04A 5C9RA 2NT1A 3HM7A 5BZAA 3LB0A 1U83A 3NZ1A 1A5NC 3QPYA 2ZKMX 3CPGA 1DJGA 4GNJA 3ZQ9A 3ABSA 4YVVA 2VRJA 1QU4A 3H54A 2J7DA 3IVUA 2GPTA 3W7EA 3S47A 1E51A 4KFOA 1H51A 4CQDA 5JMUA 4FNUA 2I56A 3OBKA 1HGWA 3DFNA 2VR2A 4DI8A 4IIEA 4L4MA 4YYCA 3NUKA 1TPH1 1IGWA 2G3FA 4OUEA 1TTJA 2D3NA 4IG2B 3P8IA 5G2WA 1M1BA 2PLJA 2HSAA 4D6GA 3KZPA 1E55A 3W1QA 2VGFA 3N2MA 2QJMA 2Q8LA 1K7EA 2DUAA 3RMJA 4ZMGA 5AYZA 3AXKA 3RGTA 3IACA 3ELFA 4HIBA 1TB3A 2YCLA 2DY3A 4MG4A 4LRSA 2F8QA 3R13A 3M44A 1ME7A 4ZR8A 5L9FA 3QVQA 1XLCA 2G37A 3FDKA 5FESA 3G6MA 5FOOA 3SO7A 4PB3A 4DO6A 4N42A 3G8RA 4H9XA 5I77A 2KX9A 2NV9A 4KCVA 3DDMA 3ZXWA 4JNMA 4JX5A 3RFAA 3VKBA 3ZVIA 4HSHA 3RM8A 3NURA 5AN7A 2QDDA 1KLZA 1MMFA 1GOIA 3FK4A 3DFQA 3W75A 4ADTA 2YBVA 2YBTA 3FYPA 7ODCA 4RE3A 2ISWA 4GYFA 4ZO9A 1Y8BA 1HO4A 1XISA 1SFLA 3W81A 1TFVA 4US6A 3W88A 2CETA 3B4UA 5ECUA 1QK0A 3DC0A 3W00A 2V0TA 1WOBA 3QZAA 4HCHA 3LCWA 4YL2A 1GQLA 2X1TA 3E6EA 5CBIA 4JTKA 5C9ZA 1JUEA 2WLYA 1R3YA 5EA9A 4UOZA 2X2YA 2DJXA 3PAOA 1XI3A 2UY3A 3K2GA 4Z2JA 4AD0A 4GXPA 1GOQA 1PKMA 3H6OA 2WSPA 4OTKA 2Z1BA 4DJEC 3ZJ8A 5A8GA 2E3ZA 1DXFA 2ANUA 5A2AA 2LLEA 2V2CA 1FFQA 5HANA 3DZ1A 3VGEA 4RUBA 5GPRA 2ODOA 3QC3A 4WJXA 4MDPA 1TPUA 4D6HA 1AL8A 3FFSA 1XGEA 3RX2A 4HHMA 1PEZA 3ARTA 1E1CB 2XM1A 4EWJA 2OJPA 2YLAA 4OT7A 4B9ZA 2NSOA 5CSUA 3DCPA 1TREA 2OYMA 2W61A 1KGWA 4UZSA 5H8MA 2XH2A 4R9OA 3UNTA 3A4XA 4NRSA 3DYOA 2DH3A 1YE6A 1QT1A 2Y4SA 3VINA 1RHCA 1ECQA 5K9DA 4FLQA 2YW3A 1SVDA 4XAZA 4J3VA 1S2WA 1QUMA 1WAUA 3IJDA 3IUHA 4PBGA 4GVIA 3RLVA 3S46A 3C52A 3H24A 1LUCA 3BW3A 2Z24A 4CCZA 1JXKA 3MO7A 2HQAA 4PSPA 1VLWA 3ALGA 3VMPA 3GKAA 4O18A 3W86A 1P7TA 4NU7A 1SU5A 2F6KA 3CS2A 2PDXA 1T99A 3DOPA 3SUTA 1LRQA 1XIHA 1W1B1 4GUJA 4P8WA 4OJYA 2DEPA 1IR1A 2VELA 2Y89A 2GGGA 3NPWA 3KLLA 4GKLA 1AW5A 2O56A 1LM1A 1HUVA 5A6BA 4R53A 2FQIA 1EJUC 4H00A 1SW0A 3IK4A 4CNUA 3K30A 2NX3A 3AYSA 3GNNA 3T08A 1UBSA 1D3CA 5CZ0A 1EZWA 2CBUA 4L61A 3THDA 2B7NA 2RDTA 1I0DA 4I9MA 5EFFA 4HKPA 3CYJA 2EBNA 1AMYA 1J18A 2F2KA 3K46A 4R34A 4QEHA 3CZJA 4K8GA 4EKJA 1V79A 3GAKA 4Z2GA 1OFOA 3VIMA 1WDRA 2E67A 3VO0A 3S2LA 3NQGA 4LNYA 5A6BD 5B7ZA 1LT8A 2XN2A 2ESCA 4DF2A 1MUMA 2QCDB 1UPMB 5A8QA 1ZPTA 4TX6A 2J75A 2J27A 3M4HA 1ME8A 4LCSA 3F1QA 3OLEA 3M46A 2ATSA 4GIYA 4UIOA 5IFTA 5JIPA 4ZQPA 1OGGA 3W71A 3AFBA 3WD0A 4S39A 3A3WA 1CBGA 2BXVA 2GK1B 3QV6A 3VM7A 2VWTA 1XIJA 4F2TA 3AUOA 5D8ZA 2FGZA 3L0NA 5F4SA 4YN5A 3KL3A 4O54A 1FHDA 2PC8A 1VRXA 3LQLA 2VD9A 1JCXA 4CEXC 1PUDA 2WMKA 3P7YA 1OM0A 4K6AA 2YJQA 2DZAA 4WVXA 4Y9PA 3UWEA 3GH4A 2VGIA 3ZLHA 1W5MA 4HGXA 2FTPA 3AMLA 4GA8A 1WDQA 3W26A 1JZ3A 2VDIA 3GVQA 4E0CA 2R94A 3VMNA 3FSTA 1O66A 4NVTA 3E0WA 1IIGA 3KBVA 2VZOA 2E6AA 4P7OA 4F0LA 4Z1CA 3CGTA 4V2XA 4DF1A 1JNEA 4Y9MA 4YHEA 2PDMA 5LNUA 4JQ4A 3RDKA 4IH3A 3K8MA 2W67A 3V3WA 2DZVA 2Y8KA 1KRBC 1DYSA 2GQAA 5AKQA 1KD0A 1KBIA 2QKFA 2BXZA 1IV8A 1J8VA 3MT1A 4UMCA 3B8TA 3P80A 3T05A 1EF2A 4GX9A 5C6MA 1SUXA 2NQHA 3NJ3A 2FZBA 3VIHA 1ML1A 3O7UA 1VBUA 3RPTA 3CEUA 5I6SA 3HG5A 3AIWA 4DO7A 2J9ZA 1FTXA 3UA3A 4YS1A 1OT2A 1RQHA 3W7LA 1ZJIA 1DJQA 2A3CA 4E8CA 3OZMA 1LJYA 5BYWA 4OFCA 3LA4A 3F2BA 3FNDA 4JYEA 2CHRA 1EB3A 3ARSA 2J4GA 3DBPA 3GU2A 4X60A 4DZIA 1UWAA 2ZUWA 3QHMA 2FLIA 1KM6A 1TTQA 2Z7GA 4CN4A 1PIIA 5LXXA 4IJCA 1JR1A 4NZ1A 4GY7A 1NDWA 5KINA 2C6QA 3HV8A 1BVNP 3MI6A 5KMYA 3HN3A 3WO8A 1TMQA 3I6TA 3TN4A 4REQA 1KV5A 4LBSA 4EACA 4K1GA 1UKTA 2Y5SA 3LYEA 4X9SA 3NL6A 3KEHA 1XYBA 3NG3A 2V3DA 3FA4A 2W66A 3UWVA 3GFXA 3QW3A 4O10A 4AVNA 3HMCA 3SRDA 3VGDA 1EUAA 2QR6A 3TTOA 1UP2A 3C86A 2CLMA 4J3WA 2G41A 3P5YA 1L9WA 1CXLA 1J6OA 1PAMA 3O05A 5CC5A 5EGRA 1ODZA 1K8YA 2OTDA 2VZUA 3UPBA 3USBA 2RDXA 3TYCA 3NZPA 5HPCA 3C8FA 5FACA 1GWJA 1W6TA 3DI0A 1HX0A 3WNMA 2DW6A 3VC5A 1XLIA 1SFTA 3AOFA 3MQTA 4G9PA 1DIDA 3LRMA 1MW0A 3ARZA 4WDUA 4C6FA 4AEEA 1AW2A 2DZXA 2OO6A 3NTYA 4EAMA 3C0LA 5I5RA 4HOZA 2X1RA 4MKNA 1TRIA 5E0FA 7REQB 1R47A 3TK7A 5MF5A 1EIBA 2PWVA 3CUIA 1JZ8A 3WLTA 1BWVA 4HU4A 2VOTA 1EQPA 1G4SA 3QJAA 3CXOA 2WCSA 4QS5A 1G1YA 1U33A 4LT9A 4ZSTA 4XZNX 3SCSA 3GE7A 1CGXA 1U5JA 5F7UA 5FJIA 2J77A 1YXCA 4KQNA 3BGAA 1GQJA 4B9YA 5GJMA 4QG9A 2DZUA 3N3MA 3WUGA 2HPIA 2O0TA 1RLDA 3EZ4A 3IRSA 4KCTA 1QASA 4QSHA 2XIMA 2X40A 3VGBA 2PF8A 3S9ZA 4PYSA 1JG9A 1RCQA 1TRDA 3V5CA 1E5NA 3DFSA 3LY0A 3M16A 1OX4A 3WBXA 4JICA 1F8MA 1TWIA 2HRWA 3QKEA 2OOGA 4BZYA 3W1LA 2CPUA 3BW4A 1I9CB 3NAVA 3NSXA 5CBJA 4IZGA 1D7FA 5D9MA 2QUNA 2WMIB 5A6JA 3CV1A 2FFCA 1KR0A 3G6LA 3LS9A 2XUCA 1OADA 3OIXA 1KO0A 2F7FA 3W1RA 2H6RA 1XIMA 4HU8A 3UD6A 4QROA 4P8XA 3AYRA 2WMFA 4LXFA 4RDZA 2O7QA 2HZGA 1W8GA 1R0MA 3GDRA 2XWEA 1E0UA 3PM6A 4E38A 1GYNA 2QLYA 4L1GA 4GHRA 2O4QA 2ISVA 4OHQA 1O1ZA 4QX4A 5D2VA 4HNUA 4FOKA 3LENA 2Q02A 1BLIA 4AX6A 4CQ8A 3WJXA 4NXSA 5DCEA 3ABOA 2DDXA 5E9AA 1LLOA 4NUWA 4Q4PA 4I90A 5KZEA 4U2YA 1TV7A 1KM2A 4J1OA 3KBWA 1Q3NA 4Q4SA 3TTEA 5ABEA 1R9YA 1NFBA 2FDMA 1S2CA 1GVRA 3PZMA 3AI0A 2CBIA 1D9EA 4H8NA 1UQZA 3SJ3A 1FWBC 5CSSA 1RPKA 3O2LA 3SGZA 5CPQA 1A5LC 4UFIA 3C0QA 4AZ5A 4K36A 3EDDA 1TKKA 4CQ9A 3KHJA 1EJRC 4LYPA 3B9AA 3A47A 1JNDA 1A4LA 2EG6A 3NNTA 3MSGA 5F2GA 4YTTA 3ITOA 3UCDA 2JKPA 3MU7A 2WHMA 3EDKA 4LUIA 3M0HA 5I3DA 4OGZA 3BWWA 3V0TA 1WDSA 3VC6A 4G2DA 1Z48A 2OKTA 1DWHM 3QLLA 1LWJA 4E2VA 3M0YA 4RLIA 3PBMA 2A2IA 1KTCA 4OU1A 4S3FA 2HNHA 4L9ZA 5HNNA 2NQJA 1XUZA 4E5TA 4NIRA 1XSIA 3K1DA 4QIUA 1B4EA 4U28A 3WF0A 3LGGA 3RX4A 1VBJA 3O9NA 4AIBA 3WX7A 3P0XA 1J01A 2WVVA 4LOCA 4F48A 2FMOA 4GYKA 2GJXA 4LNCA 3CL8A 3KZSA 3FA5A 1VS1A 1E6ZA 2GDVA 2WSYA 4JTDA 1RJRA 7PTDA 5JH1A 1TELA 1UQYA 4TXEA 1I75A 3L23A 3GDLA 2GJNA 2VL4A 4AU0A 3DYPA 1S3TC 3GVVA 3VPLA 1PJ9A 2IPWA 1UKPA 3TTYA 4YVPA 5A6LA 4HA0A 1S2VA 5CC3A 1QHPA 4GVGA 5MKGB 5IDZA 1QMLA 3SEPA 3W7NA 4PFHA 4EF8A 5A8OA 1B2YA 2XGIA 2C79A 1W32A 1A0EA 1O7AA 1W5PA 4LS0A 5A3HA 4IIDA 2WC3A 1NDYA 4JNZA 1X97A 4JS3A 3AS3A 3QEZA 4H7VA 2CLFA 2PZNA 2FKPA 1P43A 4DY1A 4C6EA 2QVNA 1J2WA 1KB3A 1VCVA 2VC9A 1FCVA 4DBSA 4IX2A 3IGHX 4LUSB 1OFDA 1XHGA 4LUTA 3RLHA 5D32A 2ALRA 3CTTA 3SADA 1DHPA 4BF7A 4J4KA 3F2DA 3P62A 3TU9A 4WDXA 4DAIA 4WY0A 4FXSA 1FWFC 2D2OA 2WB5A 1CXKA 2HE8A 4NQ1A 4BWLC 3W7HA 2ISDA 1UR0A 1G0CA 4TTUA 1QXLA 4BEUA 2OGYA 4EE9A 5DMYA 1HGYA 4GI4A 1O95A 2RFGA 2OODA 3LNPA 3OW1A 5AVNA 2PEVA 2D0FA 4UC5A 5GJPA 1AQHA 3CUHA 4B92A 3BAYA 2D20A 3GG7A 3OYZA 3O16A 5LA2A 4N9EA 4MB1A 4R7JA 5T91A 1Q6DA 3WBWA 3PZUA 3F4DA 3N3TA 3OVPA 1R3VA 4C1NB 2VDGA 4CN6A 3WQWA 4F0HA 6TAAA 3E2VA 1FP8A 1IZCA 3L4WA 3M64A 4GGBA 5FKYA 3G24A 3PBWA 1HO1A 2Y5EA 5I3HA 2XFFA 4KRUA 4GYPC 3USZA 5PTDA 3NSNA 6ALDA 4HK7A 5J5RA 3GXMA 1JCLA 1K9TA 3N2OA 7A3HA 3WLKX 3PNZA 5IRPA 3LTYA 2BFGA 3CBWA 1ISYA 2BP1A 1KBLA 1UKQA 2NUWA 3SQMA 3UZXA 3H2CA 3LPPA 4Q6XA 5CPSA 2C1GA 4Q22A 1CYGA 3ZR4A 4GK8A 3ERPA 1Z6KA 3W53A 4PEKA 2WHKA 2HJPA 5H8PA 3MZNA 4IQEA 2EKGA 4MTVA 4LQ1A 2VM8A 3RXZA 4OBTA 1B57A 3QR3A 4C6KA 3MANA 1XBVA 4EXQA 3KBNA 1M7OA 4PTMA 1E9YB 4GJIA 1LP6A 1NJJA 1AD4A 1FWSA 3VIPA 1CIUA 3KVJA 3MJMA 4CCCA 4LYKA 2E9MA 2O9PA 3KBSA 5AHNA 4ML4A 3WENA 4NASA 3R8GA 4QDPA 5DY2A 4QCFA 3VIFA 5AHEA 3K4DA 2W79A 2GVLA 1A5BA 4PZVA 3CMJA 4W89A 3BC9A 1FXPA 2PDJA 2A3AA 2X1SA 1GNXA 2W62A 4C7DA 5AFDA 3UETA 3ARUA 2FHBA 2FH8A 4DJDA 1W9PA 2EQDA 4JTUA 4XZHA 3KCLA 5DRCA 1ADOA 1EJWC 1K9DA 2J8FA 4PB5A 1XLAA 1RR2A 2ZX6A 1KQYA 1LROA 3UEQA 3W24A 4DJDC 1BVZA 2GWNA 1FHLA 2EHHA 3OA5A 1DJHA 1K6AA 1NY1A 1GOOA 4CNNA 3W6LA 1UASA 3HG2A 3EOSA 2QEZA 3WLLA 3RIKA 3UPWA 5KTLA 2C19A 5DY3A 1JD7A 5ENLA 5BRBA 3L21A 4B3ZA 4QAIA 3QN3A 1ELSA 5BROA 1FWEC 3GFYA 1MXGA 2OSWA 1JCNA 4Z17A 3EX6A 1YX1A 1OYAA 3H23A 2R91A 2BOEX 1H5YA 3GXNA 3S1GA 1HFBA 1XBZA 1XLFA 4QE4A 4UXDA 4DHGA 4KBXA 4US5A 1F9CA 1W31A 5EPDA 1OSEA 3A5VA 4XQ6A 3VMOA 3CQIA 6A3HA 2NXIA 4AQLA 4IWWA 5D38A 3WDQA 3TXVA 1LQ2A 1V93A 2INEA 3EXTA 2VOMA 2PP3A 1Z42A 3W02A 4MY9A 1E3ZA 4MWAB 4WLCA 3KBJA 1G9HA 3GW3A 1TR1A 4RNHA 3NO3A 4WSJA 3CUJA 4H6RA 3W22A 2QV4A 4RZ6A 3EYPA 2GL5A 4OE7A 1PDYA 1R9XA 4G56A 2PUZA 3IJ8A 2WCAA 2ZZ5A 2ZZ3A 1LZOA 4NF7A 1UCWA 3PBUA 1CGVA 3MSDA 3GUWA 4ZQNA 1XPYA 5C7HA 2Y0FA 4H01A 2A85A 5HMSA 1DKWA 2X0HA 4U3CA 4KWSA 1LYXA 3KCJA 1GQNA 3TLLA 3CUZA 1XM3A 1JPIA 3TMLA 1E9IA 3E5PA 3GU1A 2WJDA 4QJ4B 4A2RA 4K3ZA 2CBJA 5BOEA 1OG0A 3WQ6A 3GYEA 3BVJA 5MHBA 2ZZ6A 2HK1A 3NYDA 2VFFA 1UR1A 3UGRA 3G1RA 1F6KA 3GHUA 4N9CA 3ARQA 2YDAA 2BY2A 3L2IA 1OABA 1SO3A 1OB0A 3H2MA 3OOQA 2XFWA 2CLIA 3G1SA 4ADSA 4PGLA 2V68A 3GTHA 3PWAA 2V2DA 2YZ5A 1A3HA 3B8VA 4MHBA 4JPGA 3W7OA 2RHGA 5HWJA 2V6AA 1J0KA 4F3HA 4IXHA 3N1AA 1EP1A 1DQWA 4G7EB 4GI6A 3AO0A 5AYXA 3LHTA 3TZNA 3IUIA 1PTGA 2CW6A 3MSYA 2QAPA 4OIFA 1TO3A 2V63A 1M7PA 5L6UA 4YHGA 2Y70A 1P6CA 5CEWA 4BQ5A 4K38A 3UU0A 1HL2A 2Z1VA 3UERA 1EXBA 1SJAA 1W1A1 4NAEA 1ONWA 5CXPA 4US5D 4U3AA 3ITXA 4O0ZA 5HINA 3MCNA 1ZAHA 1H09A 1PBGA 3R4IA 3IJQA 1V3HA 3NL3A 3MKVA 3ARXA 4ROQA 3TJ4A 1QI4A 1TPVA 5A8PA 1U1HA 2FIQA 2VC5A 1OK4A 2OWCA 4ENLA 3NQEA 3MBDA 2HROA 1O60A 2OR2A 1YRRA 3F4VA 3T4CA 2QT3A 3TSBA 3VNYA 3PJWA 5C71A 1LWHA 1PB0A 3LUTA 1WXZA 4DNHA 2WO5A 3SB0A 4XB3A 3W9ZA 3LXBA 4F0KA 3AZTA 2OT0A 2INZA 1MRQA 2JQXA 3BAXA 3RX3A 3YPIA 4B90A 3SN4A 5AOUA 4AWTA 1HJWA 2GOUA 4F0SA 1TA3B 2PD5A 4A05A 2BGNE 4TV5A 3A13A 2X0SA 4ZODA 1DWFM 4K2SA 1E4IA 2E28A 4JTCA 3ITLA 3KCOA 1UZ4A 2DFAA 2QMKA 4JNYA 3LOTA 3LHUA 2Y61A 3ITCA 1GW1A 3N17A 4RW3A 4DXXA 5AHIA 3MHGA 4MFDA 4FOUA 2J78A 4GLEA 4QDMA 2GOKA 4GKTA 1YTEA 1BF6A 1DTNA 3TIMA 4DUWA 4I7WA 4RX0A 5FD0A 4C6CA 4QLLA 3WDPP 1A5UA 4ZGYA 2WJFA 3TC7A 1EWDA 1CEOA 2HVOA 3VX1A 4JTGA 1CECA 5ABFB 3CZEA 4HNNA 1QOXA 1XRVA 3WLSA 2O55A 4G5DA 3UFYA 2QGYA 3GXDA 4ZZ9A 2ZA3A 3HGSA 4IFOA 5AY7A 2CITA 1HTIA 4U31A 3R79A 5EU9A 4MZ1A 3WLOA 1JCJA 1AZ2A 4GACA 4WSHA 3GAYA 5AVHA 1RK6A 4N9BA 5EMLA 4B5TA 1EC8A 4DPPA 5I2UA 3LV5A 3THCA 3WDRA 3TFCA 4LC8A 3N34A 4AXNA 4PH6A 2HBVA 1MXSA 5FJPA 2D0GA 4AZGA 4UTMA 3ITTA 1ISVA 1JZ2A 1AJ0A 4RZ4A 3WJWA 3MZ2A 1KNWA 4B5NA 4PUMA 1O94A 3UR2A 3BSHA 5JU6A 5LIUX 4S3BA 4ZXOA 5HOSA 4Q33A 4L1WA 1PTAA 4GO9A 4IP7A 3ZJKA 3TX9A 3O15A 3WQ5A 5CLTA 1CGUA 4M82A 4TMBA 1V7YA 2WNQA 5EL1A 3PZNA 4AY1A 1UPPA 4FNTA 1WDWA 1QK2A 3H55A 1G4PA 3WY1A 4FR1A 4IG2A 1Q4NX 4G6CA 4MB5A 5HMFA 4AY7A 3DG7A 3VIOA 3PS7A 3HJZA 4P7RA 4XBSA 3M1ZA 1K8ZA 2ZIDA 3ATZA 4XSLA 3S1UA 2D73A 4WRHA 3QOKA 4L7ZA 1KTNA 2TODA 2PB1A 4H41A 3SIMA 3VCRA 1OWQA 1U30A 2J6VA 4BA0A 3TAKA 1QI3A 4ACZB 3STFA 2Y7EA 3KOZA 3MI3A 4GRSA 1N55A 4NZFA 5M2FX 2HK0A 4UQAA 3DX5A 2UBPC 1C29A 4HA3A 3T0BA 2VEMA 1XV8A 4KESA 3B97A 4TVCA 3EPOA 2I5QA 3FJ6A 1TVLA 4NJJA 2E6FA 5CG7A 4O0KA 1FOBA 1QPKA 3KS5A 3MUXA 1Z32X 4Q4QA 2H9AA 4MM1A 5C7VA 2EPHA 3VYLA 4JKLA 1GZ1A 4IMDA 4E4FA 2Z28A 1EWEA 4DZ5A 4D9PA 2OGJA 3H12A 1XLBA 2PURA 1UH2A 3W4RA 4BK9A 2WZMA 4S1FA 4D8ZA 5LA1A 4RNIA 2P1FA 3THAA 3DGBA 1XW8A 3FJNA 1XKJA 2CCRA 3DESA 1EYWA 4IMCA 3CO8A 1UH3A 1SZEA 1XCXA 4PBFA 4LUTB 1KFBA 1Q63A 3VZYA 4FEZA 1UJPA 1S5NA 1WB0A 3ES7A 4DUXA 1WZKA 2R8WA 2DZSA 3B0PA 1GT8A 1XH2A 3IEBA 1G4EA 1R5YA 4AD1A 4K68A 3TA9A 1J6PA 1O5KA 5FL1A 4HJFA 3HIJA 3WQFA 3BGGA 3GNPA 3TQKA 1OBAA 1JRCA 1YIXA 3TA6A 1K8CA 1Y5XA 4WXZA 5I03A 5E1QA 2NQ9A 2ISFA 2PD9A 3EOOA 3BJSA 5D8WA 3FAWA 3GK0A 4YXGA 4WCJA 1WX0A 4IUGA 3N9SA 3N73A 5MKGA 3R58A 4ZQCA 2BVYA 1E15A 2J9XA 1VFOA 3W01A 1HQTA 2AKMA 1B30A 1US0A 1XIGA 4KRZA 4DJFC 4XUGA 5IM51 3KOYA 2I9UA 4S3EA 3GNOA 3KS6A 1Q7QA 4I5RA 3OJGA 2XVNA 4Z0SA 3URQA 3CWOX 3RLUA 3W7IA 2ABAA 3D5HA 3GX9A 1JCMP 2BV9A 2ZC8A 1GUVA 5EMKA 3TSDA 1PZ2A 2V30A 2E9BA 2PWFA 4XSMA 1TV8A 4WUIA 1VC4A 3EMCA 4E3VA 4M29A 4DZHA 1PYMA 3UCCA 4LY8A 5KEZA 1XIEA 1PX4A 3NGJA 3C3NA 4ZE5A 3O0FA 1KQZA 5HNTA 1KXTA 3MV01 1SZFA 5TF0A 1PHQA 3LPGA 4Q7BA 1UUOA 2AQVA 4KT2A 1SQ7A 2Q3OA 3L9CA 3CV6A 3CH0A 3B8SA 2YA0A 2WZEA 1WXJA 2A6LA 2J8GA 3E0IA 3QFEA 1JD9A 2R6OA 3FIGA 1FRBA 2ZXBA 1KC7A 3ANVA 5I02A 3W1PA 1LOLA 3AIVA 5H1WA 3N2BA 2ASHA 5DBUA 2C71A 4AD4A 3DFPA 4NX0A 2JEPA 3AXMA 5HUPA 2BWGA 1WBHA 4PUNA 2WSKA 2DT3A 3TW7A 1XD1A 2PTXA 4PRTA 1W5OA 4WGHA 1MEIA 5ABTA 1XYZA 3BAKA 1FKXA 3TC3A 2FTWA 3IIPA 2YXGA 2ADAA 4QQ3A 2YCIX 1T7LA 1V0KA 1XDLA 4GISA 3UG3A 3HA1A 4FXJA 1IYXA 4IHCA 1AH3A 4HNOA 5AYIA 3E9AA 1Q85A 3W7CA 4H9ZA 4LS2A 3WNKA 5FF3A 4KH2A 2X09A 3UYCA 1E1FA 3T07A 2DSZA 1V51A 1GK8A 1FBAA 3WFLA 4C6MA 3DG6A 3WQ8A 4DO4A 3ZT6A 3BXWA 3U3HA 1AQMA 2NQLA 3THUA 3L67A 5XINA 3CQ0A 3QSRA 3B04A 3MWAA 4YCPA 1TMHA 2QIIA 3RR4A 1NWSA 2KZHA 3MWCA 1L2QA 4LCQA 2FVMA 3G1AA 1JYVA 1UD2A 1A47A 5ABGA 4UTKA 1XYLA 3LRKA 5KETA 1TE1A 4H9MA 3GO2A 2PLMA 3A12A 1NF7A 2V67A 5HAOA 2BOGX 1R3RA 4OBSA 3H21A 5JUVA 1QNVA 2PDFA 1HF6A 4KETA 3UESA 1LORA 1FKWA 4DJFD 1C8YA 3EA3A 3EDEA 3MV11 4M51A 2ZRYA 2FJUB 3PK7A 1AH0A 1AJ2A 5H2ZA 1FQ0A 2G0WA 5JBFA 3LBMA 3Q45A 4Y90A 5C0QA 4KMQA 4GYJA 2H3DA 3CHVA 2OWWA 3ZSTA 1E1EA 1JFXA 1X98A 4A8IA 2C16A 4IGSA 4PCNA 2D3LA 5EBUA 4FS9A 4H04A 1F6YA 1X6UA 1I8JA 1PE1A 1ZGDA 5DT7A 3ARPA 1V6TA 1YHTA 2HBXA 4Z08A 2I57A 3AU2A 4IPPA 3CMGA 1OINA 4B5VA 4H83A 5TBOA 1BGAA 1PKYA 5M03A 3ZT7A 1QNOA 2RUSA 5F1UA 1VYRA 2RDWA 3GXPA 1A80A 1KRAC 1UOZA 2REQA 4HN4A 1FXQA 7REQA 3WH7A 3W7QA 4MF4A 4URIA 2CFFA 3APTA 5BRPA 1OX5A 2A6NA 1H11A 1E6XM 2PSNA 3IJLA 5AC7A 1ZP3A 4HHHA 5A69A 2VTFA 4K1WA 3VFLA 4TVDA 2E8ZA 3XISA 3PY2A 2TYSA 4TTGA 2VQUA 3L4VA 2ZDSA 4WZHA 2G4JA 3SUSA 3GHSA 4CQCA 5A2BA 1QBBA 4EANA 2OYKA 4AIUA 1FDJA 2VEIA 2J7FA 3WJZA 5HULA 3W07A 1XLGA 1UW9A 4TUFA 1ALDA 1EJXC 1ZAJA 2VZTA 2DT2A 5LGXA 3L4XA 1Q6FA 1GKRA 4LEQA 4GQ0A 1L0PA 4XZMX 4AF0A 2CLHA 2B4GA 1LF1A 3CH9A 1B5TA 1E0WA 2WMIA 4PUKA 1EUNA 2ZZ1A 5HJXA 2ZRVA 3NSMA 2RJHA 3PTMA 4C65A 2B81A 3VD3A 2IMRA 3GD6A 1VKFA 2XZ9A 4RDYA 1H7OA 4MPKA 1K9EA 4RDWA 2HXUA 1UWQA 3CM4A 1SZRA 3HG3A 1H62A 1KWKA 1PWLA 2OOFA 4A2SA 3BLEA 3WEOA 3LSCA 3MA8A 3ME3A 5CQ1A 4B2DA 3LG3A 1JAEA 4RV3A 5JIWA 4GUIA 4KWUA 1OCBA 2GSHA 3ICJA 3S4TA 1RJQA 4IPLA 1XLMA 1IXNA 2E25A 1WDPA 1CDGA 4P2VA 4FLRA 3W38A 3S8HA 3FA3A 2DT1A 3QSTA 1WV2A 4HYVA 2INFA 3L7RA 4ZVJA 3G18A 1R46A 4PUJA 1V6WA 4HZ7A 4D6JA 4PUUA 1QNSA 2EGZA 5CBBA 2YW4A 3EX4A 3ATYA 3EWWA 3W2UA 3SCOA 2DIEA 1ZCOA 4Y7EA 1TVPA 2WSQA 4KIEA 1UD3A 4CNOA 5I3JA 3WFZA 2YIHA 3BCDA 1YBQB 4LVDA 4NNBA 4O15A 4GWEA 1QWGA 3KX6A 3U5YA 3VGGA 3WL0A 9XIAA 2WPGA 4YTSA 1DP0A 5CC6A 3HQNA 4XO7A 2VGGA 5LIXX 4WKHA 4X2PA 3M5ZA 2C13A 1BYCA 3N2TA 4Q6JA 1SFJA 4BF5A 2AAAA 1XC4A 3CK5A 4D6EA 3PWIA 5D2YA 5T9CE 2QIWA 2PWUA 4AF0B 3B03A 5M5DA 3VKJA 4UTLA 1FH8A 3F7JA 1WZLA 2NWSA 2ZUUA 3WLMA 3ITYA 5E70A 4RR4A 4MZYA 4C60A 3B9DA 4NZ4A 4G1KA 3NM3A 3AHTA 4XD4A 3ZSSA 1IEVA 2JALA 3PJTA 5D9OA 4J2PA 5CAHA 1B1YA 1H1ZA 1G94A 1P4CA 2BLEA 1E5JA 3A9BA 4H6QA 5CAKA 1YE4A 2DSVA 3OODA 4D6DA 8A3HA 3BGJA 1RSCA 2E9LA 1DJZA 4J5NA 1DTUA 4U4MA 2XH0A 5E0KA 3LLXA 2VEGA 5HR7A 4JHZA 2R1NA 2QGHA 4H9VA 2XISA 3TMQA 4HHPA 1F4AA 3BTNA 1TCMA 4DJFA 3NFUA 3TYEA 3UP8A 2GGIA 3OVRA 4EP8C 4N7QA 1WKFA 2HS8A 4V28A 1M01A 5BW6A 2FZDA 2NUXA 4YCOA 3BAWA 1AK5A 3APYA 1XG3A 1K70A 4JTSA 4GMEA 3EMZA 2HCVA 4U33A 3D6NA 4KFNA 2IQ0A 5E0CA 1PYFA 1CXIA 4RE2A 1ITCA 3R89A 3M07A 1KCZA 3GFZA 3FSUA 3KLKA 1BQGA 3KWSA 4MNJA 3MDUA 5D2TA 3SJNA 4CKQA 1VP5A 4NSBA 1YXDA 3WLNA 3FX4A 4CQAA 1V0MA 3I65A 2D23A 3ALFA 3VCNA 1JGIA 1YEYA 2C91A 5CKSA 4KW2A 3PULA 1NWRA 4OV4A 4YPJA 1E6RA 1POKA 1RA5A 1IXOA 3PWGA 4KPLA 4L5ZA 1UC5A 3D0CA 4DBUA 1PIGA 4ZQRA 3CB8A 1JYXA 2C1IA 2ZUTA 3KOFA 1FCUA 3U7VA 3VOFA 4KEUA 5AC6A 3OLIA 1DIEA 5HBFA 5HMDA 3EGJA 1XUUA 3CLWA 1WKEA 3W6MA 3DHPA 1TZ9A 2XZ7A 2X30A 2PTZA 4S3CA 3STCA 2E6YA 3W25A 2QPXA 3A4JA 1ITXA 1I2PA 2CC0A 2DV0A 2VO5A 5EMMA 2QXWA 3CWNA 1JCTA 3UXAA 1VIZA 2DUXA 2PDWA 4MKVA 4DB7A 3QTPA 4M56A 5CGMA 1Q6CA 3E3HA 1H1NA 4HJWA 4QG8A 2PF0A 1UYQA 4NY2A 5EY5A 1L8PA 3LCXA 4HK6A 3T9PA 1H50A 3VIIA 3WJSA 4A35A 4DUOA 1UD4A 4S2BA 3AZSA 1EIXA 4J3TA 1NOUA 3P60A 4EPKA 3CT2A 3OGRA 2W5FA 3R2GA 3UY7A 3WL1A 2Q6ZA 4TR9A 3I7SA 1W37A 4IIGA 1ZS2A 2R1PA 3M7WA 3WNOA 4FAMA 4R7WA 3N15A 4AW7A 6XIAA 4JCLA 4AZHA 3VDBA 4GY0A 2BNJA 4UCFA 5IDIA 1S1PA 1HG3A 4OECA 1IEIA 3E02A 2C14A 2V81A 3CB3A 1HT6A 1YADA 3LU2A 3M47A 4U5IA 2V3EA 3NO5A 4HHLA 4LC6A 4TO8A 3S5ZA 4O1DA 5A5WA 1FFRA 2GJRA 1W9BM 2OX4A 3EXSA 3LSBA 5HJLA 2IKGA 4M24A 1XLEA 2F38A 4HZ8A 1Z44A 4UFLA 5KZMA 3ZVHB 5I3IA 2PDLA 3BV7A 3DGRA 4Q3MA 3GC2A 4RDVA 3H22A 3UA4A 4F79A 4H8UA 4GYPA 1PL9A 4DPQA 1A5SA 1FP9A 1RY8A 1PX3A 1TJ2A 4GIAA 1K9FA 4O4WA 2DZBA 1QFEA 1BAGA 1Q4WA 5LYRA 2BSLA 3FKRA 1XBXA 1I6NA 4LUJA 4UTWA 4XVEA 1FUYA 1G01A 3NQ7A 3GVWA 2JGQA 2VFGA 1BTCA 4PRWA 3LERA 4ACZA 2PTWA 3DKJA 1FWHC 4QE5A 4JFUA 4RE4A 2ZWZA 3TJXA 4O4VA 1TPEA 2VCAA 1VF8A 1O12A 1W0MA 4UTWC 1P5BA 3ONCA 4UOQA 2HS6A 1CPUA 4OUIA 2VFIA 4F66A 2VX4A 2G3MA 3N6HA 4DUVA 2XDFA 4NL1A 3IIOA 3SW6A 2Z00A 2WWDA 1W3LA 1BXCA 4JR5A 4AD5A 4GG9A 4IOTA 9XIMA 4ZQOA 1A5MC 2Q71A 1OFPA 1UMLA 2G3JA 2XIBA 3KTSA 1IQ8A 4PL1A 4RZ5A 1ITQA 4UFHA 1ZFJA 2OT1A 3BG9A 3IARA 3ZWSA 4M19A 1YYAA 4WKAA 1J0ZA 1SO5A 1MNSA 4GBUA 2PODA 3PB2A 3O6AA 1HJVA 3LTSA 1IWAA 2WM1A 3GU9A 3GDMA 4JKMA 2W63A 1R3TA 1DEDA 4L4OA 4ZQMA 5D2WA 1ZJAA 2PDHA 1UC4A 4CLMA 3GR4A 3TN6A 3TZFA 5DMLA 1VBGA 1UMYA 3S6TA 2OZ8A 2I7GA 3VUSA 1K4HA 3ZFHA 1M6JA 4JN8A 5FSDC 1QNRA 2VXNA 3MC5A 2QHAA 5M3WA 4RZBA 2Q8XA 1XPGA 2NUYA 2CZEA 3AIUA 4TOQA 3IV3A 1S5WA 2O92A 3RJXA 2HVMA 1CXEA 3L68A 3NQ2A 2NVDA 2IPFA 5IFPA 1Y0EA 2WJEA 2XHYA 3JZEA 3K4WA 1RPXA 3VNKA 4AFYA 4MVAA 3R7MA 2Z0IA 1HP5A 3NXLA 2DSUA 5GNZA 4YWSA 2P0OA 1PO9A 3MKKA 4UFMA 1F07A 1OK6A 5DLCA 4UTHA 4FNQA 3CC1A 1H61A 1UROA 1E0TA 2VC7A 3AS0A 3T0AA 1XQKA 1YTKA 1EHAA 4D72A 2X1UA 4QRNA 3NXFA 1EP2A 1GEQA 1BG9A 4KS0A 5DMMA 2A5HA 3CQKA 1QJWA 4H9TA 1SSDA 1XYMA 2WKLA 1SSGA 3RILA 2A1YA 3GSMA 1NVMA 3LQGA 2XJ7A 4B3LA 3CAKA 3QMRA 4N2YA 3PPHA 1JDAA 3H2NA 2EJAA 4MB4A 1M53A 2CWNA 2NSXA 1TMLA 1XX1A 1HVXA 4ZENA 2XINA 1Q2SA 3RM4A 2ZRZA 4NJIA 2MANA 1RBLA 1MUCA 4AEOA 1SJDA 4N0RA 4LALA 4YTQA 3CUFA 2A3BA 4JAWA 3REQA 3AIQA 3JS3A 1M7XA 4E8DA 1VFSA 2GUYA 4DNMA 5H6HA 4AH7A 3UJEA 2VQTA 2QCHA 1H7RA 3QR1A 4Y96A 4R7OA 4LF2A 4Q4KA 1G7VA 4KEZA 5CGQA 1BGGA 3I3DA 5A1AA 5C8BB 3CIWA 2VRQA 1K4GA 3QM3A 3DHFA 4MNMA 1L6SA 3TYDA 1IWBA 1TVNA 1VD6A 4IFKA 2G8ZA 1UR9A 4CU7A 2Z1WA 4JCMA 4H3DA 1SR0A 3S1VA 1UR8A 4AX7A 1FA2A 1XQLA 1HKMA 3O07A 1H0GA 2C18A 3H7RA 4JDYA 2W92A 3WLQA 4IFRA 3L2MA 1Z9AA 5FF2A 3IIXA 3LDVA 3R10A 1M68A 5K3VA 1YQ2A 1E43A 1XKYA 2J24A 1CTNA 1ZJBA 1PX8A 1UIPA 1BKHA 3B05A 4PMOA 4RJEA 4LH8A 1KGXA 1TJ0A 4TX9A 3UXIA 3WEMA 3PTKA 3WQ4A 3VZZA 2XVLA 1KBKA 4LBUA 3G1YA 3DXIA 3RO6A 2W27A 1RY0A 1SJCA 4NAFA 4PEEA 3PZ9A 4Q4OA 3W1NA 4D1JA 4WGXA 3EWXA 3EWUA 1Y5WA 1DBTA 2PLKA 4GY1A 1PSCA 3HJEA 2ZVIA 3N6JA 3Q2DA 4HTYA 1Z8AA 3S2CA 4O16A 1L8NA 1YDYA 3QV8A 1F7BA 3FHAA 1ENUA 1V6XA 4OZOA 3MJYA 4K7VA 2GYIA 4MY1A 4LFYA 4NP7A 3LMYA 3T2QA 3CTLA 3UR8A 1QOQA 3VNJA 4DXKA 3PN8A 1KBBA 2ZWYA 3FJLA 3U4FA 1BD0A 3CHCA 2CZDA 1GVIA 1B0IA 1E6PA 1HVQA 4DZAA 4RV8A 1EPXA 2YZRA 5BXPA 1XH0A 4Q7NA 1NFPA 4UTTA 4O53A 3FVDA 4LVAA 3LXAA 4W5ZA 3BLOA 1NARA 4BY3A 1R2RA 3I4KA 2IQTA 4QGCA 3VIKA 1JI1A 4A3UA 3AYTA 1QO5A 2P5NA 2UY5A 3PBYA 2WJZA 3I10A 1XIFA 4QEEA 4JL1A 1CLXA 4N4QA 2DVXA 3DC8A 3PSVA 1O5QA 5HUOA 2VFDA 4AIOA 3BJFA 2ZA1A 2FB3A 1JVNA 3NEVA 1Q8AA 3WNPA 3IAQA 2QPSA 2PRMA 4L9YA 1WYIA 2VFEA 3W6YA 2YL6A 2R1LA 4DBEA 4O13A 2CKSA 2I5GA 1MQRA 2DVUA 3C0JA 1W1PA 1OCJA 1XF0A 1SO6A 1L6WA 1KM0A 3DFOA 4YJ5A 4HOXA 4LAUA 4DLFA 1I2RA 1Q8JA 2QCFA 3G2GA 1R38A 1ZBVA 2Q3RA 2YA1A 3ARVA 2VX5A 4HPHA 3SI9A 1PV8A 3MI2A 3B3DA 3COTA 4UNLA 4AG0A 4BI6A 3MW7A 3CASA 3LHVA 2G95A 4ZO6A 3R94A 3HBLA 5AHMA 2CLPA 4KWWA 3OU8A 5CH9A 1BYAA 4FXFA 4JHMA 5TQLA 1K8XA 2GVJA 4UZUA 2GLKA 3CEPA 5CZTA 4JQ2A 1GQIA 2E68A 2FHCA 4XISA 4I6KA 2VHLA 3BZJA 4BWLA 3N9KA 4YTUA 3UWZA 5T9BG 1T5AA 1QWKA 4XVDA 2R1KA 1SW3A 1RD5A 5BRQA 3WMCA 1HJSA 5FJJA 4IPJA 1KV8A 1XLKA 2CERA 2Z25A 1UKOA 4ZEPA 2ONEA 1OC6A 4JX6A 3AYVA 2X8RA 2V5KA 1ZQ5A 3HPXA 4RXGA 3VD5A 3LM3A 4FSAA 3PZIA 3KVKA 2CESA 3OHMB 5EYWA 3UG4A 2PGFA 4P5UA 4XAYA 1A49A 4POCA 4LRTA 5J04A 1HJQA 2VT0A 2WOQA 3R12A 2YCEA 3VM5A 3HV9A 4XBJA 5E5CA 4Y2WA 1HKIA 4MSSA 1J0IA 2PDGA 3VIGA 4CD4A 4JTQA 1FWTA 3KAOA 3NCOA 1N7KA 1VEMA 1E71M 2VNCA 4K7YA 4DEFA 1H7XA 2Y8VA 1JUBA 4XIMA 2YKKA 2FZ9A 3ZJ6A 2GGHA 3O0KA 3A4AA 3UXDA 4HYRA 3HOJA 1E4NA 3IJ6A 2NV1A 1L6GA 3W76A 4AHPA 2ZRWA 4FI4A 4AZIA 4AD3A 7ENLA 3MMDA 4PE8A 4GH1A 1ICQA 1TR9A 3GHRA 4KGLA 5I3FA 1XJBA 1OF6A 1MW1A 4LVFA 4MJMA 2PGRA 4LTSA 1G67A 3M0VA 2BY1A 1LG1A 3B0UX 3PJXA 3SQSA 4C7FA 1OIMA 1J96A 3AZRA 4UQ9A 2Z4GA 4ADUA 3W1XA 1LWIA 2WQPA 4I9AA 1BSLA 2VR5A 3OBEA 2H90A 3SCNA 4W4QA 1G69A 4J3UA 3LMZA 3EB2A 3BG3A 1ADDA 1YDVA 4CUCA 3TSMA 4MDOA 1VEPA 2E8YA 1J12A 3UXLA 1PDZA 1IWPA 2FYMA 4DWSC 1N8FA 5G4WA 5AC4A 1G5AA 2A7RA 1JGMA 1U2YA 5JBDA 2VVSA 1VGAA 2ON3A 1KFEA 1X1NA 5FJUA 2OEMA 4GCAA 1MQQA 1YNYA 3MYOA 5LIYX 7TAAA 2XFYA 2QCEA 2WHJA 1R87A 1DJXA 5I7GA 5C5YA 2AL2A 3OHIA 1C93A 1GW9A 3L5LA 1B31A 5D05A 1BFNA 4C7GA 1IIHA 4Q8NA 1I2OA 3DFTA 3DECA 4QITA 1N82A 3GIQA 1WDDA 1KBJA 2GFTA 2CU0A 1HKJA 1FDYA 2I5IA 3R8HA 2GUBA 1OEPA 3MVIA 2OQHA 5U4NA 4QP0A 4ZXLA 1LDCA 5JVLA 5LHEA 1UWSA 1AG1O 3UZZA 3BMXA 5C9UA 3BUVA 2A4AA 4YNGA 4JTLA 3KL0A 2ICSA 3CIXA 2W91A 3UWQA 4JGDA 3WLPA 4IQDA 4X2RA 3QR0A 4JYDA 3QFWA 3GVRA 1EC9A 1UD6A 3HZ3A 1SMAA 3C2FA 1DJYA 2EPNA 1WBJA 4FHAA 4XKYA 3U8GA 1GZJA 1BF2A 3P5ZA 3WF1A 1KXQA 5FF4A 1G7UA 3G3MA 1LTDA 1GVEA 3WFAA 5FEPA 4LJ3A 3S9IA 3S83A 1B9ZA 1E56A 1Q13A 4HMCA 2AAMA 4TIMA 3F4CA 3UG8A 4A3HA 3B8IA 1W91A 1RK5A 1BWKA 2YX0A 5HATA 1UA3A 3WH5A 2QULA 3RM9A 1FWGC 3C2OA 3VKAA 4F0RA 3RJYA 1LLWA 1PZ0A 2PWEA 3U2EA 2YBUA 4JBRA 4HPXA 4PMJA 4PTXA 4ZB2A 4FB7A 4IL0A 5LIWX 3NM1A 1BG4A 4GIRA 2PDCA 1JDFA 4DWDA 4LVBA 4LGXA 3POHA 3PTDA 4QSFA 5I23A 5JQ9A 4AVOA 3HFTA 4K39A 4V1YA 3SN1A 3VDCA 3KBMA 3UZJA 1SMDA 4WEVX 4NXKA 3OQ8A 4W8LA 4S3DA 1B3ZA 3GBEA 1VHNA 2FPVA 1EH9A 5HQMA 2G5WA 4NNCA 5HWMA 4IM4A 1YLVA 4UB9A 2XM2A 2YXXA 3PJUA 3QMSA 2P10A 4N4PA 4GI8A 3W72A 3IJIA 1KWGA 3AIEA 1N2VA 5BOFA 1TPWA 2VDHA 4H9UA 1T8XA 3U4AA 1H3GA 2OLAA 1C9WA 3MKCA 3NIYA 1WUFA 2ZYFA 2TMDA 1EBGA 5A8NA 1JZ5A 2E4TA 4N9DA 3RRXA 4AHQA 3B4YA 4QJ5B 4ML9A 1OZMA 3VTRA 3GC4A 4YU1A 1TWSA 2WZIA 2R1MA 5DELA 1W1VA 4JYFA 1XICA 2C8NA 4NAFB 1XFCA 1V3MA 2V8ZA 2DU2A 4KFPA 1OX4B 4PL2A 2V69A 2AOSA 4J3XA 2POZA 3AXXA 3DENA 1ZBWA 2QF8A 2AL1A 2MUCA 3HB9A 3QGAC 3CNYA 2JBMA 2BODX 4HA4A 2ZX8A 3WEZA 5E9XA 3MVTA 2XH4A 1RBAA 1KCXA 2UY2A 3B06A 5F2IA 3SZ8A 3TFXA 5G2IA 3N11A 4JY8A 3IRDA 4L65A 3RRAA 2ZZ7A 4HTBA 2G97A 4BEQA 3C6CA 1GOXA 1TG7A 1TV4A 5EKYA 1ZENA 1D7KA 4QAWA 4MAVA 3BPWA 4M6VA 2FJKA 3WK0A 1XRSA 2OMAA 4MMWA 3NPUA 5TIMA 3VKDA 3L2LA 4I6VA 1W1TA 3UY8A 3M0KA 5CG0A 3BCJA 3M6DA 2BASA 3OLGA 4MYXA 1TWWA 2J47A 1DWAM 2REQB 2OLSA 3MCMA 3TYUA 3WG6A 2W6RA 1A3XA 4TU1A 3ANUA 5TAOA 5DMNA 3K4AA 3WD3A 3GTFA 4E2DA 5KZDA 1V6UA 4YVXA 4RXFA 2SFPA 1YDOA 3AMKA 3TYZA 5K9XA 4NZCA 2F2HA 1ITUA 3G0XA 2AKZA 3DHUA 3FW6A 2RKXA 1GVYA 4JZ5A 1U1JA 1UR2A 1JJKA 2JEQA 1MWOA 1EX1A 1LG2A 2TAAA 3S5YA 3E74A 5FIPA 3IGUA 3PFRA 1FWWA 4LY4A 3EWZA 1B3YA 3IVSA 4WJ8A 4M3PA 3SUUA 3QV7A 3C8NA 2J7HA 5DANA 3PG8A 3WQCA 4H19A 4PMQA 2QCDA 2CYGA 4IMGA 4XAGA 4ICMA 4IQJA 3B9EA 3TC6A 1BXBA 4LX4A 2BG5A 2QJJA 2PU1A 3V5OA 4C5ZA 3TP4A 3N12A 3G1HA 3SIZA 4RK8A 4WXYA 1A5KC 4K8HA 3NL5A 1DJNA 1SFSA 3T09A 5K9CA 1R2TA 3MHFA 4P7NA 3WDHA 3L5AA 4AWSA 4NG3A 3QPEA 3TR9A 1U22A 3U57A 3PAJA 1QTWA 3T7VA 3A23A 1V0LA 3URBA 4A6GA 4TX8A 1XWYA 1XLJA 2IKIA 4M7TA 1X7IA 4H8VA 1LBFA 1I1XA 2XSBA 1JZ6A 4J2MA 1MUWA 4AC1X 3KM8A 4QCEA 3BAIA 3VVGA 4H8HA 4KCUA 4N02A 3H70A 3SUWA 1XFBA 4JHOA 1M7JA 3GUGA 1YW1A 3CZKA 1Q6OA 1YPXA 3H7UA 2OEKA 2A7NA 3GVGA 3HGOA 4OOZA 4QM1A 3PPGA 3T6CA 2QJIA 3WF4A 3T40A 1GJWA 2FFIA 3FYYA 4XKYB 3SECA 4IPNB 1ZHAA 2OSXA 1QRQA 2ZX7A 4AXKA 4UMBA 3VNIA 3IV8A 1X7FA 5I00A 2V3FA 2WZTA 3TONA 3PG9A 2VP8A 1SO4A 1RA0A 4GUGA 3DKLA 3E1F1 3M0MA 3WLIA 4Z1YA 4F2UA 4LEFA 4JIPA 1GTEA 5D9PA 5HK4A 1ZB5A 3INPA 1VJSA 1CLKA 3W7PA 2DIJA 5DBTA 3AHYA 3REQB 1EJTC 1X1ZA 4G7FA 1KTBA 1LOSA 1CB7B 2DGAA 1F74A 3S42A 5EBAA 5AECA 5A6TC 1XSJA 1MEHA 2CEQA 3TKFA 4Q7IA 4GO8A 1UOKA 1N8IA 2Q09A 1XGDA 3UJ2A 1ZU8A 2PDUA 9CGTA 2FB2A 1R6WA 2OZ0A 1CB2A 2E5DA 2FPYA 1AH4A 4E4PA 4JTEA 3H2FA 1H49A 5GNXA 2BVWA 4FX7A 3SCVA 2CNCA 2WWCA 3W7MA 2ACSA 3F5LA 2XH7A 4U10A 4HNVA 1W1ZA 4E3TA 2WMHA 4ERAA 4UTIA 3GM8A 3IANA 5A2CA 3I3BA 1YMYA 5G2HA 3BCFA 4NZ5A 1JF6A 3F4NA 3KDNA 3W87A 2I14A 3TR2A 1UJQA 3GWQA 1KGUA 2JKEA 2C7FA 5AHFA 1OD0A 4WHBA 3H7VA 2CHOA 4PUEA 3CLMA 4ZB0A 3LCLA 2GQ8A 1AMKA 3HQPA 4HMEA 3NZRA 1LOQA 3VIJA 4AYGA 4M81A 4W5UA 4LAZA 1EOKA 3VABA 2WXDM 2ZUVA 3GR8A 1JPMA 4O14A 4MJ4A 4EPDC 2GQ3A 3ZR6A 1MRAA 3GTNA 1XINA 2Z2BA 1WKDA 4Q8QA 3G22A 1H5VA 2YA2A 1DJWA 4C6OA 2YFOA 3H2OA 1W9XA 3RR1A 1Y5VA 1R3WA 2CXEA 1UB3A 4HQVA 5KITA 4PMYA 4B15A 4JFSA 3O1NA 3T2OA 1ZUAX 3EEZA 4DJED 1OC5A 3FXYA 1Y7VA 1H7NA 4QFUA 1F3XA 4H7ZA 3N4AA 1K77A 1A5OC 3BURA 4QJ3B 4DIAA 4CGTA 3RF9A 2ZICA 3IWPA 3KTCA 3N2CA 1Z7AA 2YDQA 3BOLA 3PF3A 4O11A 3WIJA 3P81A 4DWSB 4EOUA 2HDJA 2DIKA 3GG1A 3MUZ1 1VRDA 1BTMA 1GONA 2OX1A 1LUCB 1GPWA 1KM3A 2NV2A 4F40A 2GZXA 3HPFA 4GCXA 3WNLA 1E3XA 4MAZA 2ZVRA 3VNZA 2H8ZA 1IXQA 3ZJ7A 4N6EA 4V1XA 1C9DA 1ISWA 1DIKA 1IE7C 3PC0A 1JIBA 4Q32A 3VE7A 1Z89A 4LVGA 1UUMA 4XK2A 2YYUA 2J74A 3GDTA 4GUHA 4J3ZA 3GIPA 4GUFA 4Z1DA 3PZVA 2IXUA 2XFRA 4H6KA 3SGGA 3BDKA 4RL3A 4EF9A 4HMDA 2J7CA 4DX3A 3G0UA 2JE8A 5AC5A 4Z2KA 4O1FA 3KOXA 4WOQA 1VAHA 1SZNA 4WY0B 5G1TA 4PMRA 2QQ6A 1GPFA 2XIJA 2VX6A 4OKDA 4XV0A 3U2OA 3QLDA 4MUZA 3GRIA 3ITVA 4WF7A 1YTDA 3T0TA 3HF3A 2VD8A 2AQOA 1OQFA 4XD5A 3I7QA 3S6OA 3UG5A 5D09A 3JR2A 1DXIA 4GINA 2WKGA 4YTRA 3CQJA 4UTUA 1RUSA 4MOZA 3LX9A 3OLDA 1XL9A 3CAQA 4GIEA 4A8NA 1FWJC 3NQDA 5DO8A 3WH9A 4HCDA 4BS0A 1RAKA 1VZWA 3T1GA 1OT1A 4YLWA 3AAMA 2E5BA 1M9HA 3K13A 2ZE3A 1LBMA 1H60A 3ES8A 3IVTA 4QBXA 1HIZA 4LS1A 4GABA 2DORA 4QLJA 1TWDA 3K8LA 3LI1A 3A3XA 3HURA 3WMSA 4Q4RA 1X1OA 2AGTA 2POTA 2PTDA 3CUXA 3FEMA 1A3WA 4Q8MA 3E5BA 3B8DA 1A4MA 4HNCA 4BCEA 3B40A 1XDMA 2A3LA 1EYEA 4UWMA 3GXTA 3T8LA 1MZHA 3CT7A 4ERIA 3L0GA 4UR9A 4ALDA 1BRLA 4IT1A 2WPBA 5AYYA 1NOWA 3DN5A 1ISZA 3V35A 2BOFX 5CPNA 3PFMA 4NJHA 4R85A 3LHZA 4F8XA 4R27A 3G1VA 1X39A 3N4EA 1TQXA 1PTDA 3B9NA 3T0CA 5CJMA 1BPLB 4C1KA 1I2NA 3WLJA 3A3HA 1ZP4A 2A7PA 1PVNA 1GJPA 1VFUA 3GDKA 4PTWA 3A24A 2Y24A 5A6SA 1IZKA 1HL9A 1ESWA 3UWYA 5CPOA 2RGMA 1DWJM 2H3BA 4CCDA 1FY6A 1OC7A 3VKKA 1BYDA 4D6CA 3IGXA 4GZEA 1HZYA 3GG8A 3M0JA 3W74A 3STEA 4A3QA 3UJSA 2PP0A 3MY9A 3BMVA 4PMDA 3L65A 1V02E 4CNSA 3MMUA 4I7UA 4V15A 4O8AA 3GTXA 4H2CA 3MMTA 3C3UA 4C1LA 3SURA 3LCGA 2VURA 1KM1A 2B0MA 1EEPA 4DBWA 3ZVHA 2PGWA 1MEWA 2B31A 1ZCCA 2VZSA 4Q8OA 3AMDA 5CJNA 4O17A 3EB4A 3BZGA 3KFTA 2HWGA 4I9TA 2VVNA 4QLKA 1KFKA 4WDWA 3FV9A 3CHFA 1T41A 4X61A 3O6DA 3D47A 4MIMA 4G7EA 4UMAA 1PS9A 2IUZA 3NQCA 1MI3A 5BWAA 1TV5A 3W0KA 4IF2A 2Y85A 4GH3A 2AQWA 2FTYA 4Z2IA 1P6BA 3HPZA 2ZTJA 3W1TA 1J10A 1EA0A 1PCKA 4UOJA 3G0SA 1WXYA 5A6KA 3S5OA 3SGUA 3TJLA 1WZAA 1TPDA 3O63A 2P8CA 1IXPA 1PKNA 3PNUA 4DJEA 2WMJA 5F2MA 3WH8A 3DEQA 3RCMA 3UR5A 2HTMA 5ECVA 2A3HA 2V2HA 6CGTA 4C6QA 3SR7A 3C2RA 1BYBA 2QF7A 1VJZA 4B16A 1H0IA 3VOGA 2DVTA 4NILA 3HG4A 2D2HA 1DVJA 4E6MA 2OQLA 3WQDA 4JX4A 5CSRA 3ENLA 3WDIA 2HMCA 1XIBA 4GPNA 3P67A 2TSYA 1GG0A 1S2TA 4PTDA 5T26A 4OOUA 2RGLA 1UWTA 1F76A 1V3KA 2C3ZA 3UR7A 3IAPA 2E0PA 1ICPA 4O19A 2CWXA 4PR4A 4DYEA 1XDJA 4QTGA 1U5HA 1PPIA 4LYQA 1GEHA 3MYPA 3TYBA 2WLZA 1H63A 2PDBA 1UWIA 3BOFA 1I0BA 5LNWA 3GG0A 1JEZA 3JU2A 1O5XA 3DYMA 3W73A 3M7SA 4HNTA 4PB4A 4QNEA 1RH9A 3SRHA 3D46A 4GQQA 2BTMA 2GGJA 3UCQA 5DN1A 3WUFA 4P8UA 3FN9A 3MUAA 3WN6A 3KRUA 5C55A 1GYMA 1FWAC 4H4IA 1KRMA 4Z1AA 1OG6A 1W56A 4W7WA 1CT5A 2CXGA 1P0KA 4M5PA 3WK3A 1LLZA 2W0UA 4AISA 1FVPA 4NT0A 5G4EA 4I8DA 3UZYA 1PZ3A 1XYFA 2ZE0A 1K6WA 3VNDA 1ZZMA 3QYSA 1ISXA 4D6FA 2XIIA 8XIMA 1M04A 2FGBA 2Y6ZA 2ZADA 4XZ9A 3ISIX 1JAKA 4KCWA 2OWXA 3VOJA 4IQLA 3P61A 4IIFA 4XWUA 4W85A 3OIHA 3VX0A 2GVYA 2NVAA 3CHEA 3N18A 1IR2A 3GH7A 8TIMA 1E6SM 3CV2A 4JN7A 3BLDA 2FGLA 4LWWA 4W84A 4WKFA 3B9OA 2PI6A 1QPQA 2YCLB 2Z29A 4PRRA 2QJNA 4XG1A 1VH7A 3IPWA 1K3UA 4FLOA 3SUVA 1P7TB 2VEKA 4AY8A 4FNRA 4EX4A 4DAFA 3BQ5A 1RXOB 3UNDA 4QS6A 3LTPA 3H4WA 1MYRA 2YOCA 3FEQA 2PDPA 1EL3A 4L9XA 2BMBA 3CPUA 4KEVA 3STPA 4CNTA 2AL2B 4D1IA 1OCNA 5FF7A 1VLIA 2QCLA 2V5DA 2CHNA 1VPYA 4O52A 3O6YX 1RLCL 2QAFA 1O4UA 2A3EA 2WW5A 3U2ZA 4JTHA 2WZHA 3KRSA 4R9XA 5FL0A 4GX8A 4A3YA 4IISA 1OJXA 3HPSA 3KDOA 2P3ZA 2ABBA 4RNFA 3NEHA 4BI5A 1LL4A 2WHLA 1F5ZA 1VBRA 1FWDC 4NZJA 1XC6A 1W1IE 2XU2A 4ILSA 5AZ0A 3V36A 2MNRA 2Y88A 5CLWA 3V18A 3WK2A 1HW6A 1J5TA 1SR9A 4N6FA 4ZBCA 3B8WA 3WBEA 3EWCA 1J0YA 2DZPA 3A4WA 4M6PA 4UR8A 1UD8A 4O1CA 4DXVA 5C9WA 1CNVA 5C70A 4RPPA 4X9YA 3R5EA 2ZDRA 1HJUA 3GB6A 2VFHA 1V08A 3QC0A 1D2KA 4GJJA 4CEUC 1E4MM 3AIRA 5AYBA 2OXNA 3TDFA 3S0CA 4JTRA 2PRHA 1BXNA 4HPNA 1VFTA 3W7DA 2PZ0A 1EDTA 3GHTA 2WV8A 1HN1A 4DM2A 2ZCGA 2H9AB 2HEJA 5F4XA 4GFIA 2NZLA 1ZBCA 2IS7A 1W9VA 4AHOA 2B7QA 1F05A