4D9PA

Crystal structure of b. anthracis dhps with compound 17
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
273
structure length
264
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate Synthase
publication title Structure-Based Design of Novel Pyrimido[4,5-c]pyridazine Derivatives as Dihydropteroate Synthase Inhibitors with Increased Affinity.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 264
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4d9pA00
3BOLA 2DQWA 3TYUA 4C1NB 3TYCA 2YCKX 4S3DA 4DJFC 2YCLA 4S3AA 4O1EA 3H22A 3MCMA 1Q85A 4S3EA 4DJED 2Y5JA 3V5OA 3TYEA 2DZBA 2YCLB 3H21A 3H23A 2VP8A 2BMBA 4G9PA 2DZAA 4S23A 4S3FA 4DJEC 4CCZA 2Y5SA 4HB7A 1TWSA 3H2FA 4S39A 1Q7QA 2YCJA 2VEFA 3NOYA 3H26A 1AD4A 1Q8JA 4DAFA 4DJEA 1TWWA 4DAIA 1Q7MA 1AJZA 2H9AA 4D8ZA 4D8AA 4NHVA 4D9PA 1EYEA 4MWAE 2Y0FA 3TYAA 4O0QA 4NL1A 4NIRA 3TYZA 4MWAA 4NILA 4DJDD 4S3CA 4MWAD 3H2CA 3H2EA 3TZFA 3TYDA 4DJDC 3MCNA 4DJFD 2YCIX 4MWAC 4DB7A 3TZNA 1TWZA 2OGYA 2H9AB 3H2OA 3MCOA 3K13A 4DJDA 3H24A 3TR9A 2VEGA 3BOFA 3H2AA 3H2NA 1Q8AA 4S3BA 4S38A 3H2MA 1F6YA 5JQ9A 4O1FA 2E7FA 4MWAB 4DJFA 1AJ0A 4PZVA 3TYBA 1TX2A 1TX0A 1AD1A 4C1NA 1Q7ZA 1AJ2A
chains in the Genus database with same CATH superfamily
4HHHA 2IXVA 4D6HA 1F7BA 4HU3A 1OD0A 4AIEA 1S2VA 3DYPA 1E6NA 3B8SA 2Z2BA 5FJJA 4JN8A 2PBGA 5CXPA 1W1VA 3M44A 2WMFA 3ZVHA 3W00A 1B0IA 3K4DA 4H04A 1V3LA 5D9PA 3ZYZA 3DFTA 3PSWA 3T6CA 2EXOA 4C7DA 5CH9A 4MLRA 1OCJA 3QM3A 1DHKA 4UXDA 3G3MA 1IT8A 3MW7A 4GYFA 2DUAA 4A3HA 2RKXA 4PN2A 4JTEA 2IW0A 3OJGA 3NQCA 3RR4A 4QTGA 5IFTA 3BSHA 3M6DA 1PZ2A 4OT7A 3ME3A 4DF1A 3AOFA 5HMSA 1SO3A 4AC7C 3CZKA 3LPOA 4PRRA 3QF0A 1AZ1A 1GPFA 3LV6A 2GVJA 3QPYA 2PWVA 3W87A 4IPJA 4NI3A 3S47A 5LA1A 2WCGA 3FN9A 4KGLA 1NTHA 2RDTA 1ISYA 4D71A 1P48A 3G24A 4PRTA 2W66A 5CJ5A 4Z1BA 4QJ1A 2A7RA 2XFWA 1LYXA 2YCEA 2WBKA 3NQDA 4BFAA 3RYSA 5AECA 3RO6A 1W56A 2OKTA 4HNCA 4WLCA 3B8WA 1CLXA 4WZHA 3TTQA 4RL3A 4UNKA 3N17A 2WLYA 1FWHC 1I1WA 4DJFC 3DI1A 4ZXLA 5I3DA 1K8ZA 2YZ5A 4L1WA 1GOMA 4UQCA 2G0WA 4JX4A 4HHPA 3S6OA 3UNDA 9XIMA 4HZ7A 2VP8A 4M8UA 4B90A 3GC5A 5ABFA 1KXTA 3KRUA 4JTCA 1SZGA 2CLPA 4AHPA 1S2AA 4RNIA 3W07A 4M5PA 5BYWA 4WDUA 4W93A 1MDLA 1GJUA 2YL9A 3T40A 1J2WA 2OQYA 1ZJIA 2DZPA 2P0OA 1ZP3A 4Q6JA 4JTIA 2NT0A 2FHFA 3W70A 4YJ5A 2I9UA 4M0XA 1JZ4A 2BSLA 3BTNA 5LNVA 3VMOA 1H7OA 1GVEA 3EA3A 3ZR6A 4HVXA 3H4XA 1US2A 5HUOA 2WLZA 2OQLA 5A95A 1SFLA 4LC6A 1GCYA 5B7YA 4LX4A 3GB6A 3G8EA 2FQIA 4FNUA 1W5QA 5CLWA 1KKOA 4DJFD 3GNNA 5E70A 1T0OA 3SUVA 1G94A 5TBOA 5DN1A 3AIRA 3UR2A 5JQ9A 5KZ6A 4XSMA 3KRBA 3L67A 5F4WA 1E4MM 2PGRA 3FOKA 3VGFA 3WYZA 3FYOA 3KWXA 1KFWA 2OEKA 3VX0A 4YN5A 3U0HA 4ES4A 1WE5A 4AH7A 3VTRA 4LAZA 4IIHA 1JCNA 3MV11 4ZQMA 1HO4A 1DOSA 5EMYA 3TYEA 5KTLA 4A6GA 2ON3A 4XZHA 3KDNA 2BMBA 3ZT7A 1UWQA 2Y5SA 3GVWA 2QV5A 1NFGA 3ZT6A 3CWOX 1PO9A 1WOBA 4AIOA 6XIMA 2YGYA 2HBXA 1SU5A 4XTDA 1HKIA 1CW2A 3QMSA 2Z24A 4DZ5A 3MANA 4CQDA 1P0NA 1I2PA 3SUSA 1OT2A 4ATDA 1V7AA 4GIYA 4NIRA 4RCXA 1W9PA 3GQYA 4KFNA 4NILA 2YL8A 3W1AA 2W61A 1PTAA 1EA0A 4ZR8A 3F5KA 3DG3A 3N3TA 3WLTA 3DYOA 4X63A 1H7WA 3PTDA 4R3UA 4LYQA 3NM3A 3NSXA 1CLKA 1K3UA 4LS2A 2JIEA 3CEUA 3W1PA 2YSWA 2QDEA 5C2GA 5I06A 2NV9A 1ML1A 3CIVA 1SZFA 2BTMA 4GYPA 2A7PA 2C79A 4JL1A 1XKJA 4I6KA 4INFA 5D2WA 4IUGA 1BYCA 1VBHA 4OV4A 3WD1A 1H50A 3SECA 4GQBA 7TAAA 4F79A 5BRQA 4HNUA 1LBLA 2FYMA 4BY3A 3FY1A 3VMPA 1OGGA 3RCMA 4GFIA 2W27A 3UNTA 2ZX9A 1EBHA 4JTHA 4I5RA 3A64A 1XDJA 2AQOA 1KM5A 4KFOA 3LCWA 2NV2A 2VJXA 4URIA 1MMFA 1W91A 1OX5A 1S2WA 4E8CA 1Q65A 1CECA 3FKRA 4D8ZA 3V0TA 3KVKA 4KWVA 3INPA 4NJGA 4G6CA 1KTBA 3GVRA 3W73A 1M3UA 1NF0A 1OCNA 3HG2A 3CHCA 1FWCC 2CBVA 4WIWA 2OYKA 4Y9AA 3OZPA 3SSJA 3KRZA 3DFQA 3T05A 3W1NA 1Y7VA 1EC9A 4RXGA 1XBYA 3KCLA 1PEZA 5LYRA 3MMWA 4PMYA 1YE6A 4GWEA 1FDZA 1B9ZA 4O15A 2XVNA 1Z8AA 1TWZA 2QCMA 2GGHA 2YB4A 2VC5A 1VFSA 5HWJA 3B9AA 1UG6A 3HGJA 3ES7A 2YA1A 4GIEA 4AZCA 4AD1A 4L56A 1W3TA 2WMIB 2HBVA 2DV0A 4AZCB 4IOTA 2Y88A 2GGIA 3NYZA 3CPRA 2FJKA 3SCUA 3R79A 5A6BA 1AJ2A 1H7NA 1W1A1 1W1PA 3QV8A 4GYPC 3BVJA 3UWVA 1VBJA 1RD6A 3LENA 2PDKA 3V1PA 3P0WA 2DUZA 1FH8A 3MSRA 2ZZ2A 5JBEA 5D09A 4GGHA 3O9NA 3S6TA 4DIAA 4RX0A 3FW6A 4L61A 4XD4A 2VEMA 1GOIA 1TRDA 3ITOA 2J75A 3WJYA 1E6RA 4PRWA 3KP1A 2ISFA 1AD4A 3W7LA 4ATWA 3AXHA 3E12A 5CLTA 4TX8A 1FDYA 1KKRA 2YFOA 1XBVA 2YW3A 2VYOA 4ICCX 1O5QA 3PS7A 1HKVA 5FF0A 2NV1A 5M5DA 4AQLA 1E1FA 4WDWA 1A4LA 4HNVA 1U33A 4S3JA 1Y0EA 1TPC1 2Z1WA 3POCA 2GPTA 7TIMA 3TJXA 2XISA 3TXZA 1CZ1A 3O1NA 1FWFC 2OGYA 3IS4A 3H24A 4GE8A 3LA4A 3CO8A 3J7HA 1N8IA 2VX4A 3GX9A 1DP0A 4JX6A 1ZQ5A 1QO2A 2J9XA 1FWGC 2P5NA 3QBUA 4KCVA 4CCEA 4HMEA 3W7IA 1A0EA 1FX6A 1QNPA 2DH2A 3O07A 1QAPA 3N1AA 1MWOA 4E38A 4S3KA 5LGXA 1QJWA 3FA3A 1R3VA 3FK4A 3V16A 4HYWA 4LV9A 1E9LA 3CHVA 3DGRA 2YCKX 3F5LA 3F5JA 3M16A 4MIMA 3NGJA 3P80A 1IE7C 3S46A 2XH7A 1OYCA 2Z00A 3RU6A 3WDIA 4XBKA 5AC6A 4UFIA 4IISA 2Q71A 4M1RA 4DJEC 1TVPA 5CGQA 4JTDA 4GUIA 3WX7A 2YCJA 4CQ9A 3OBAA 3ARZA 2IQTA 4ZB2A 1BSLA 3B9NA 3S42A 3L12A 3UYIA 3ALGA 4GY0A 1O94A 4C6MA 4UNIA 2PTZA 2VHLA 4MWAE 2GDQA 4CNUA 1MI3A 4N4QA 4CCCA 3AS2A 1CDGA 1TKKA 3IAPA 2JF6A 4S1FA 3BG9A 3O6YX 1A5BA 3PUDA 3S5SA 3UETA 2ZBTA 3ZJ6A 2P88A 1BYBA 4UOQA 3GVVA 2KZHA 5G1YA 2Q02A 5A8PA 1PTGA 1F8IA 1TTQA 1EBGA 4QS5A 5A6BD 1YQ2A 1GOOA 2CHRA 1GHSA 5ABTA 5I3KA 3WLMA 1F07A 1OCBA 3NURA 3FGCA 4XB3A 3VNKA 1R7AA 1WPCA 3BO9A 3VYLA 4HCLA 4A8LA 1C9DA 3FGCB 2W92A 1GVSA 1OC6A 5DELA 4BQ5A 1XSIA 3HG4A 4GC3A 4F0RA 1JGIA 1G4EA 1OM0A 4PCNA 1V51A 2C3ZA 3ARWA 4BK9A 3BLKA 2DZBA 2J47A 1WV2A 5FJTA 1XIBA 3W2NA 4V27A 1UASA 4IGMA 2DZAA 3QHOA 4J3VA 2Z1VA 4AEFA 2VKZG 3PY2A 2VDGA 4J2MA 1AW1A 4NAFA 1SZNA 1JZ3A 4O8AA 4XZBA 2BOGX 2Z6JA 1ZENA 2A3AA 3VKJA 4I6VA 4KWSA 1CTNA 5I02A 3M7SA 4Q8QA 4FR6A 2G41A 2PDFA 4UB9A 1X7FA 4D9PA 4ORIA 3E3HA 3VE9A 1D7FA 3U2CA 3M0IA 4CVUA 3PAOA 2GGGA 2VZOA 1W1TA 1DVJA 4EXBA 2F6XA 4Q4SA 4Z1DA 1XH0A 2OXNA 2X1UA 3ZWSA 2QJIA 3P2VA 1HKMA 4H6EA 3P61A 3MCNA 4WJXA 1U2YA 1YDYA 1OFBA 2X0SA 1SZEA 1JPIA 2BBFA 4CU6A 1UA7A 3UJ2A 2OSXA 3LBMA 2Y2WA 2ACRA 3NPWA 4RE4A 5E6YA 1RQEA 3PVFA 1HKWA 1QR7A 5DEZA 3EBVA 3IJIA 4C6PA 1OBAA 1VCGA 4S3DA 1UWIA 2OU4A 1MUCA 2QMJA 4FNPA 2NUXA 3HGOA 1WZMA 4KRZA 3AICA 5E09A 1EH9A 1NQ6A 3CMFA 4R33A 4JFUA 1IZJA 1MQPA 4FF5A 4UMAA 1H41A 3FJ4A 2Q8LA 3IUIA 4ZQRA 3RDKA 4QXIA 4QR6A 1XGZA 4PB4A 4AVFA 3GW0A 4O17A 4HNNA 1QBAA 1B54A 4O1CA 4Q6XA 2E6YA 2FVLA 3CBWA 1P43A 3G1VA 2FB2A 1ZB5A 2OZ8A 1O68A 1NOFA 3UWEA 2WZIA 4H8NA 1AQ0A 1KRCC 1EGMA 1XIJA 4F40A 1IIHA 3T4CA 3OQEA 2IPFA 4NVTA 1JYVA 1ZFJA 3QPZA 1XS2A 4PTWA 1DWJM 3UD6A 2VFFA 2ZRVA 3P60A 1LLOA 4PMZA 4JOMA 2GQ8A 4GPNA 1EC8A 3I6RA 1YADA 2F8QA 2HE8A 1BAGA 3EWYA 3MKCA 3RMEA 1EJSC 4O8RA 4LYRA 4JFWA 3EWDA 3QR3A 4AYGA 1YTKA 1P6CA 1A3XA 2V5JA 4QJ4B 2DSWA 3LTPA 3VZZA 3LI0A 3W4RA 3GBDA 4JFSA 5M03A 2Q3OA 4JKLA 1WDPA 4Y9MA 4YVVA 3VX1A 3H22A 3JZEA 1XGDA 4AMAA 4DYJA 3TK7A 1QPKA 4NJKA 4P7OA 3RK8A 3BLFA 1RHCA 3WLKX 3H55A 3OG2A 4JTKA 4CNPA 1KV5A 3P7YA 4XZMX 2JGQA 1NEYA 3IANA 2H9AA 3CQHA 4C7FA 2BFGA 3MUZ1 4BKNA 2OX1A 2D3NA 1KM3A 5EA9A 1XINA 3UZWA 5L6UA 4O54A 4HK5A 1GOWA 3CS2A 4AMCA 4GQRA 1QOPA 3MC5A 2DSKA 1GWJA 1S5MA 3TZNA 3C61A 3L2MA 3C6CA 4D6IA 1HGWA 1GW9A 2CIPA 1Q8AA 4NUWA 3LYEA 4I8YA 4J1OA 4B3LA 2QIWA 3ARSA 3BLPX 2VWTA 1A53A 4IT1A 2QCNA 4PB3A 1VIWA 3WUGA 5JIWA 5H8PA 1Y8BA 1L2QA 1GTHA 3UG5A 3BG5A 3DX5A 4R9XA 1B3WA 3CT2A 3AWNA 2BP1A 4V1YA 3PHAA 5E0KA 4UC5A 2QCCA 1B3ZA 3QKEA 5DMNA 3CMGA 1EJTC 3FDKA 1IIGA 3AIWA 3H6OA 2ZOXA 3GTNA 3B05A 2VR4A 3SO7A 4OOUA 1JULA 4PTVA 2J9YA 2UWFA 2V3GA 4GG9A 2PDWA 3OYZA 1YIXA 3CGTA 4X22A 1XFCA 2XDFA 4O4VA 5REQB 3IUDA 3VNJA 5DY2A 4IMDA 3AS1A 2O7SA 4EPKA 1IEXA 4K6AA 4M7TA 4HU4A 4DM2A 1R0MA 2HPIA 4MY1A 2XG9A 3V1HA 3S8HA 1UZ4A 3S9YA 4CUCA 2ZTKA 2CHOA 1ZNNA 3KRSA 4GGBA 3PZQA 4KBXA 2VUYA 4FMVA 4MLJA 2J25A 3E0IA 5D32A 4Q3MA 4FIQA 1GT8A 2HDJA 3CTLA 4Y7EA 2YL5A 4PODA 4U5IA 3EX4A 2QULA 5CQ1A 1FWAC 3LPGA 1C8YA 2HRWA 4X0NA 1IV8A 4AZ5A 1XG4A 3SBFA 3AJXA 1TV4A 5DXYA 5IHRA 4Y96A 4GUJA 4Z2GA 2QDDA 4ZB0A 1Z41A 3AQUA 2EPLX 2W62A 3ITVA 3R43A 3EB4A 3KOZA 4MNMA 3SFWA 3RU8X 2YLAA 3UVAA 1HP5A 3LXAA 4C6QA 3BW3A 4UTHA 4LUTB 3B03A 1RBLA 1YXDA 3IGSA 4MTVA 4J3ZA 4KWUA 2X0YA 2OPJA 3SN1A 3WD4A 1Y5VA 2XZ9A 3N6JA 1S2CA 1A5AA 1RSCA 2J7CA 3TYZA 1JCJA 5LIXX 2WXDM 1UR1A 3MBDA 2Q6ZA 4C6OA 6XIAA 2IQDA 1MUWA 1QATA 3VKBA 1FY6A 3E0VA 4GISA 4BF5A 1OF6A 4HZ6A 2AOSA 1Q45A 1PJ9A 3PUOA 3RFAA 2VZVA 2VEGA 3WLLA 5DT5A 1VBRA 4IFKA 1W3HA 2OZ0A 5DMMA 3DIPA 6REQA 3BLEA 3WDRA 3MZNA 2WNZA 5HNRA 3APTA 3APYA 4OU1A 2FH6A 1QI3A 3IJ7A 2O0TA 3NQ8A 1H61A 2OT1A 2WSYA 2GVYA 2NXGA 3ENLA 1KR1A 2V8ZA 1E1EA 3RR1A 2CLMA 3O3RA 3OBEA 1V6VA 3IGHX 3U5YA 3UY8A 5KZEA 3AC0A 1A4MA 4HB7A 1SO5A 4PUKA 4J35A 4MJZA 1JDFA 3ES8A 3I65A 5I77A 3HQ1A 2J62A 1WAUA 1VGAA 7XIMA 2BNJA 3RJXA 1EF2A 1I8JA 4YCOA 3Q37A 3MZ2A 1W2PA 1GZ1A 5CBBA 4L6HA 1D3GA 1ZAIA 1OZMA 1R3QA 4PTDA 1WUFA 1VFOA 3K8MA 4M51A 1Q3NA 2YDAA 5DBUA 3WNNA 3NQMA 3ZR4A 3LGEA 3LZ3A 2DDXA 1LBFA 5C6MA 1CXEA 5AYIA 3GZ3A 4UTIA 3O06A 4NU7A 3RMJA 3EPMA 4PUWA 5LXEA 3RLVA 3WK2A 2NX9A 3M5XA 1H09A 1RP8A 2WCSA 5BOEA 2HS6A 1A5UA 2CLHA 1UPPA 2VC6A 3TDFA 2RUSA 1O5XA 5M3WA 1YNPA 2RJGA 2G3MA 2AGKA 2W0UA 4NQ1A 4QQUA 1JI1A 2ZFAA 3DBPA 3MVTA 4RPQA 4RNJA 4GC4A 3KBNA 5D8ZA 3NPVA 3H53A 2Z26A 2YCLA 1SO4A 4GHRA 1EPVA 9CGTA 1F74A 4WXYA 3DFYA 2YCLB 1JG9A 1PWMA 3NJ3A 1ZS2A 3DEQA 2XGBA 3QQ0A 4TMBA 4K37A 4HSOA 4W5ZA 1V02E 3S5OA 5LA0A 2PD9A 1F3EA 5BROA 1JQXA 4P2VA 3W0KA 5JH2A 3QOKA 2VR2A 4LC8A 5DMLA 4XD5A 4EAMA 3LHTA 1HF6A 3B0VC 3PWIA 2VR5A 4CD6A 2W91A 3OW1A 1JDAA 4LALA 1X97A 4FEZA 3OG3A 4ADSA 3C2OA 5L9FA 1P7TB 4UQDA 1BYDA 2P10A 1CGUA 4AIUA 2VMFA 3H2EA 2ZRZA 3NL5A 1HX0A 3DHUA 2EJAA 1E1CA 3F4NA 2PP1A 5D9OA 3HIJA 3MCOA 1AL7A 4H7VA 2W9MA 5KETA 1LUCA 4HJFA 3VABA 1E1CB 1A80A 4PBGA 4JYFA 3CLMA 2O9PA 4R7OA 3MI6A 4I5UA 4WX2A 1UROA 1C9WA 5HR6A 2QJMA 1NF7A 4IIDA 1AD1A 1KNWA 1YRRA 1TV2A 4M24A 5B80A 3FSUA 3ZJ8A 5JU6A 5A2BA 2D2GA 1Y5WA 5H1WA 4HU8A 1SYTA 2Y5JA 1JFXA 2FPYA 2NUWA 4J3XA 4S3FA 2R9RA 2H6RA 2QAFA 4N2YA 1OIFA 1TO3A 1EWDA 1TWWA 4I3GA 1FRBA 3QR0A 2VFEA 2OFJA 1AQHA 3UYCA 1VENA 1JAEA 1H3GA 2PLMA 3TH6A 1WB0A 3NTYA 3NPXA 4K1GA 4EF8A 3EX3A 1PWLA 4NAEA 3GYEA 4QQ3A 5FOOA 4Q8VA 1PIIA 1GHRA 1K9TA 1JQVA 3N15A 4MGGA 1V6UA 3HTWA 4IXXA 3EX2A 2D22A 2NXHA 1X6LA 1ICQA 5DBTA 3O16A 2G4JA 1HJVA 2VWSA 1UKSA 4H8HA 1TPUA 4JYEA 1KO0A 3L0NA 4J2PA 4GQGA 1PZ0A 2TODA 4O28A 2G3NA 1J6OA 4NX0A 2VVSA 3VOHA 2VRQA 3MP3A 1EWEA 1GK8A 1LJYA 1M9HA 3UG4A 4GCXA 1ODUA 2DGAA 4ZSTA 1Z9AA 4BQ2A 1OSEA 2I57A 1UKTA 2BX7A 2OLSA 3N2OA 4ACYA 3G22A 1GG1A 4FLRA 1CNVA 3VNLA 3EPOA 4AY1A 4GY7A 5CPMA 2ZX5A 4C6LA 3TAKA 4UFLA 1SM9A 4C6BA 2FMNA 3GH7A 3H7UA 4BA0A 3TMLA 3RPTA 3W53A 1YLVA 3TP4A 4ICNA 2VGFA 2DZVA 2ZX7A 2J7GA 3UR7A 1VPXA 3NQBA 5D9MA 4ZOEA 5CBJA 1K9EA 4PE8A 3W6MA 3G1HA 4LV4A 4EXAA 1UC5A 4LOCA 1WBJA 1C8XA 2X2GA 1UWTA 3U5UA 2OO6A 2VRJA 3BLLA 4IPPA 3VDGA 2DEPA 4NKCA 4P61A 5HQMA 1XYAA 3WIJA 2ZA3A 3BK0A 4EP8C 4TTGA 3OLIA 1YYAA 5J04A 5C9UA 6ALDA 4A3RA 3P5ZA 4GQQA 3B9EA 3EDKA 3T2PA 1E6SM 1HL8A 2OGJA 4AY8A 5C54A 2QGHA 5GNYA 3RHGA 3GSMA 2Z4GA 3KL0A 5G4EA 1TREA 1CGWA 2OO0A 2YYTA 1P0KA 5A8MA 3ARTA 1XLCA 2LLEA 4R53A 4GI4A 1PTDA 3C3UA 3S4TA 1LM1A 2PS2A 4GJIA 4B5SA 1R87A 1R85A 1Z7AA 5BOFA 1TA3A 1KM1A 1YMYA 3CH9A 1QU4A 3AYTA 4H8UA 2PI6A 1FCBA 4DI9A 1JYXA 1TA3B 2VEKA 1YXCA 1UA3A 1TPH1 2A6NA 3OLDA 1E55A 1XYZA 5MF5A 2P3EA 3BE7A 3UCQA 2AQWA 3DESA 4JDYA 3E02A 4DO6A 4IL2A 1QMLA 5XIAA 1YNYA 4Q7IA 3MDWA 3ZR5A 3M0VA 4AD3A 4BEQA 5KZMA 3LHVA 2WWCA 5ABGA 5CPNA 4BJHA 3QLDA 4JTRA 5AYXA 2TRSA 2Y62A 3F03K 3I3DA 3RPDA 3WJZA 1A5MC 1R7OA 1DORA 4MWAA 3ABXA 5LZLA 5KSWA 1YBQA 5AC4A 3E96A 1VYPX 2F9RA 1DIOA 2NLYA 3GFZA 4JN7A 1YBQB 4RUBA 4JL2A 4RXFA 3AS3A 2VNCA 2PRMA 3VFLA 4HBKA 3MI2A 4ZFMA 5C0QA 3WK1A 1IZKA 3OZMA 1Q7ZA 2O7QA 2P76A 3TJ4A 3CLWA 4D6FA 4XAZA 2PTWA 1V4YA 4N9DA 3STPA 3VC5A 3VVGA 3PFMA 2E25A 3B9OA 2AAMA 1EIBA 5T8GA 4WHBA 3TLQA 5F2IA 1WDWA 2EPOA 4BF9A 4YYCA 2INFA 1NFPA 4V2XA 5BW6A 3UGVA 1E43A 1XQKA 4LRTA 2WBGA 1H7RA 4ENLA 2QUTA 2CWNA 4B2DA 1JRBA 3PBMA 5DXXA 2D2JA 3LNPA 1EXBA 2DT0A 4PUUA 2G50A 1YNQA 4UTTC 3B06A 3WQ5A 3SADA 3IIXA 4TX9A 3QQ1A 3MUCA 2WMHA 4LNYA 2W79A 1QOXA 1GQNA 2GJRA 3GWQA 3GXPA 1AODA 1T8QA 4O52A 4F0KA 3UT0A 2BXZA 1E0XA 4EKJA 3KAOA 4O19A 4CD8A 4DZHA 2DZUA 2A3EA 3LHYA 4CNOA 3SCSA 4LAUA 1H5VA 2PGWA 5TAOA 1W3KA 3QFWA 5D2VA 5DRIA 3R8RA 4MWAC 1I60A 4AF0B 2OVLA 1DJHA 2DSVA 4CNNA 3IJQA 4GKTA 2XM2A 4NSBA 2G3IA 1BYAA 2QQ6A 1NWUA 3BGGA 1PHQA 4MJ4A 4PTNA 1TVLA 3I68A 4JPGA 3OGRA 2FZNA 1SJCA 3OOQA 2EKGA 3WF3A 2C6QA 1KBJA 4HA1A 2QJJA 1QFEA 2JKEA 4YWSA 5FESA 4AAJA 2ZXQA 4ZQPA 4DELA 3F2CA 4LVAA 4RKAA 1UR9A 4GJJA 4C1LA 3QYSA 4UWMA 5ECUA 4PMUA 3IRDA 4PCTA 3SI9A 3TQ0A 3LV5A 3WDPP 3K8KA 1J6PA 3GTXA 3IJ6A 2WMJA 1J5TA 1BHGA 4S2BA 4IGHA 3VKKA 1E5NA 1GJWA 4QITA 3G77A 4HNLA 4DXKA 1RALA 2ZRYA 3HG5A 3I7QA 1X1NA 3N18A 3ATYA 4KRTA 2H3DA 2J7BA 3R2GA 1R46A 1V8EA 3OQ8A 3NNTA 1POJA 2XN2A 3EMZA 1Q6EA 3W29A 4JS3A 1Q6LA 4IJCA 3TWAA 1LOSA 4S3CA 3SURA 3N29A 3KXQA 3PZGA 4NZCA 2A79A 4HMNA 3LERA 1JGMA 2WHMA 2PU0A 1X6NA 3FSTA 4H83A 1IR1A 4Q8OA 3DFPA 4LS0A 5M17A 1PBGA 4FNQA 4CN1A 3P84A 3GO2A 2VXNA 5LNWA 1T7LA 1BVZA 5A94A 4PR4A 3POHA 3OGSA 1CCWB 1I2QA 4GCAA 1NH6A 3NQAA 2C7FA 1B4EA 5H6HA 4LY4A 1A0CA 2PLJA 4RV3A 2UV8G 3MP4A 1J0HA 3GNXA 4FAMA 5MHBA 1E51A 3FA5A 1US0A 4UQEA 1ZJHA 4H7CA 4R34A 3RM8A 3NO1A 3PZTA 1KWKA 4AX6A 1D7KA 1VCFA 4RW3A 2JBMA 1FHDA 4HMDA 4LBRA 3UWQA 2YYUA 4QDMA 2IPGA 1KC7A 3RX2A 4MHBA 3U9IA 4XAGA 5XIMA 3MWAA 3GRIA 1DJQA 3E0LA 4RJEA 1KCZA 2EQDA 4WR3A 1F05A 1L9WA 1PDYA 1QWKA 2WV8A 3WH7A 2C19A 2WK2A 4Y8FA 2F2KA 1RJQA 1JDDA 1UH4A 1PKYA 1QHPA 3WLPA 1BG4A 4A2RA 1FWIC 3ABRA 5LIUX 5CPQA 3CZEA 3BAWA 1DBTA 1THFD 2PP3A 3TA6A 3L2LA 4YNGA 2HXTA 1EEPA 1PZ1A 3WLQA 2PLKA 5F1UA 3VDBA 1SR0A 3P3BA 3MA8A 4F3HA 1VPYA 4OZOA 1ZBWA 3TYUA 1CPUA 1J79A 4ZBCA 3AU2A 1OX4B 3LXBA 3PJWA 1LLWA 4HCDA 2EG8A 4UOJA 3TW6A 4KRUA 4ERAA 1XUZA 3MHUA 3UGRA 1JVNA 3GC4A 1F4HA 1MEIA 3KOYA 4JTUA 3C0LA 5LXXA 1XPYA 3BCDA 4P7NA 3WMCA 3VZYA 1XIEA 1WOAA 3VCNA 3W22A 2VEFA 3BSMA 2OZTA 4D8LA 5SWUA 1V79A 1QW7A 2GDVA 4HK6A 1TZ7A 4O11A 3AHZA 1QASA 4RZ6A 3MBFA 4HA3A 1UP2A 1M68A 4ROQA 3VKDA 2PF0A 4J28A 4UBPC 1PYFA 2V69A 1QW8A 3I10A 4OJYA 5TD4A 4N02A 1HXJA 1Q4NX 2VFDA 3TZFA 3VOIA 1BGAA 2FVKA 1PKMA 2VX5A 5A6LA 1M1BA 3KP0A 3G5EA 5HA7A 4QEHA 3OB8A 1N55A 5AC5A 4OECA 4LT9A 1XWYA 5E0CA 1A5SA 2EG7A 2ZZ1A 3LQGA 1NP0A 2AMGA 2X40A 3B8DA 3DG7A 5JBFA 3I6EA 2G3FA 1JUBA 1HJQA 1R3RA 3FS2A 3N6HA 1TPDA 3EMCA 1TPWA 2ZRXA 3NDZA 3L9CA 2NSOA 2P1FA 4I90A 3UPMA 5K9CA 2YA0A 1UR3M 3VOCA 1DWHM 1QTWA 2G96A 5FL0A 4GNKB 5K7JA 1NDWA 1OK4A 2Y5EA 4XV0A 3W1MA 4DF2A 2EHHA 1OD8A 2O55A 3NVDA 4B5TA 3DGBA 3OODA 3MUY1 3NQ2A 1TUXA 1C93A 4UOZA 4K3ZA 3OBKA 3W2JA 3ITXA 4E2DA 3NL6A 1VIZA 1KRAC 3HA1A 2PTDA 3SCOA 4XX6A 2ZUWA 2DJLA 1OEPA 1GUVA 4NHVA 3LHZA 1XIDA 2CBJA 4N7QA 3VOFA 1FOBA 3L4WA 2Z0IA 3KHDA 1CXFA 1E6XM 4QROA 4TIMA 1OFEA 1ELSA 5HULA 1G7UA 2EG6A 4GO9A 4CEUC 4YTTA 2DT1A 4POCA 4B5VA 3JS3A 2XHYA 4NF7A 3R13A 3LU2A 4GI8A 2FGBA 5D2YA 2BOEX 3GTHA 2HVMA 1W9XA 2VUNA 3SUTA 2C14A 4GIAA 1XC6A 3T55A 4JNYA 3ICJA 4C6DA 3M0HA 4HA4A 3KBVA 3PF3A 5F2GA 2X7WA 3CQIA 3M5ZA 1RBOB 4E8GA 3MWCA 4H9VA 4HOZA 1EQCA 2Z7KA 3ZLFA 3BMXA 3VIHA 1SJBA 5CKSA 4TXEA 2VFIA 1BWLA 1JEZA 4H2HA 4FNRA 1FVPA 3VNYA 1R3YA 1UWRA 4FI4A 1Q5MA 1XH2A 3EKZA 5FF7A 3S6DA 3WQ8A 3A4WA 3HQOA 3IWPA 3LM3A 4L80A 3VNIA 3GXFA 3KTXA 3GR8A 3KVLA 1ECQA 5EFDA 3QZAA 4ZQOA 4QE1A 4Y2WA 1CGVA 3PZVA 3M47A 4J27A 4ZTXA 2WAGA 4GMEA 4YVPA 3AWOA 2FJUB 4PB5A 3Q4DA 4IM4A 2YXOA 3CUHA 1W17A 1Z3NA 4E4UA 3C3NA 3HJEA 3NQVA 1QK2A 1XYMA 1Q6OA 3GAKA 3GIQA 2HE5A 2XFRA 3ITYA 1WZAA 1ICPA 2J88A 3HM7A 3IK4A 2JKAA 3ERPA 4N4PA 3U2OA 1Q6CA 3IEBA 3KOFA 3M0ZA 1VFHA 4Q4PA 4NZ1A 4H9XA 1L2UA 3O7UA 5H91A 3EB2A 2BY2A 3OHMB 3SQMA 3L21A 1B4KA 2XINA 2CZVA 1K1DA 1XFBA 4DZIA 3W26A 3AHYA 4IP4A 1UJPA 3UVIA 4YS1A 2PRHA 4IHCA 3M6YA 3K4WA 4UTMA 4LTSA 3T7VA 3CB3A 5IM51 2QGYA 4PYSA 4B9YA 2XN0A 4Z1CA 2UY2A 4UZUA 3L23A 2C1GA 4AYSA 3LPPA 1HGYA 2E6FA 5A8OA 2WVTA 4IZGA 2QMKA 2D0GA 3W24A 1MW1A 4QCEA 3ZLHA 1GG0A 2XIJA 1XD1A 1S39A 3V5FA 2QCEA 3BAJA 3P74A 3C2RA 4QS6A 1KA9F 1D8WA 3Q94A 2PP0A 1J93A 4L65A 1NWSA 4CVWA 2V5LA 4DLFA 1GKRA 3B9DA 3PANA 1EDQA 5I00A 3A4JA 3IJ9A 4LPCA 3I7SA 5A8GA 1V02A 1E4NA 1FCVA 1OX6A 1XL9A 2IPWA 3S2NA 1H60A 1TWIA 3GXMA 2YR1A 3UZXA 2UY4A 4TVCA 1Q2SA 4E2BA 4LEQA 3MJMA 4G7FA 4AIBA 2QIIA 1KCLA 2ACSA 1CGTA 4IQEA 1E9IA 1MDRA 5BU9A 1JL8A 1A50A 5DY3A 1TE6A 1W8SA 2PDCA 4ICMA 4PL1A 4E5TA 3GDLA 4H9ZA 4UFMA 4GA8A 2QPUA 2FTYA 3WG6A 5U7SA 2ZKMX 3OTRA 2FPVA 1ONRA 3PAJA 4R27A 3E9AA 1WXZA 2WSKA 2FTPA 1UZHA 2BGQA 1FWDC 3AHVA 1KM4A 4QG8A 5AHEA 3MT1A 4L1XA 3PC0A 3TC3A 3NM1A 3BJSA 5FJRA 1UD4A 1WA3A 1RV8A 3LTSA 2CLFA 4FLOA 4ROPA 4JY9A 2NZLA 3WF2A 4HSNA 4O1BA 1MZHA 3V5OA 3IVUA 5G2WA 3PN8A 3DDMA 1XUUA 3MMDA 1JJKA 3HPZA 2X05A 4MY8A 3DHDA 3WDQA 3TN3A 3URBA 4MAZA 2HS8A 1H11A 5A6AA 2E9MA 3KW3A 2ATSA 1FA2A 1Q6FA 1J0JA 1TWDA 2BG5A 2KX9A 2BDQA 4U28A 2OWWA 3OZYA 3S2LA 1I2OA 3SUUA 4HPGA 1JF5A 4E8DA 2Z1XA 1OF8A 1QNQA 1F2JA 1JCLA 3A47A 5JH1A 5BMXA 4JQ3A 1UWUA 1LZOA 2ZDSA 1DTNA 1JDCA 4OFCA 3MS8A 5AHFA 3R25A 2CZFA 4L7ZA 4HJWA 3NSNA 1KR0A 1P5BA 2VEIA 3PZMA 3JRKA 5E0FA 6PTDA 5D04C 5EBAA 4TMCA 1KRMA 2AAAA 2G5WA 3NWRA 1QNRA 1J9YA 2DQXA 1K9DA 4Z08A 4RDYA 4XQ6A 3WLOA 2PWEA 3BGAA 1FCUA 1UR4A 5ABEA 1BPLB 5FCZA 1CEOA 4DO4A 2HROA 1POKA 3PZOA 1RCXB 1GOXA 3LRMA 4HN4A 4LW7A 5HWNA 1OFRA 3TW9A 1E3XA 4A3QA 2YDSA 3ZM8A 1SZRA 5HINA 5AY7A 1G9HA 2R6OA 2PGFA 4WGHA 1DJWA 4WVXA 4B4FA 1V3KA 4EK7A 2PDNA 4WSJA 3RGTA 3A4XA 1ZALA 4JIPA 3R58A 3W76A 2O56A 4DF0A 2IKHA 5DF0A 5LIYX 4FOUA 5AHIA 3P62A 2BXYA 2J4GA 1G5AA 4IG2A 4O10A 4NI8A 1U83A 3N2CA 3R94A 3VKAA 4PA8A 2QUNA 5K4XA 5BZAA 5C55A 2WQDA 3W7RA 4JFTA 4IGSA 2FGZA 7CGTA 3V35A 2Y6ZA 2PDJA 3CWHA 3AYVA 3CHFA 3W1LA 2GDUA 1B3XA 4IX0A 4MKVA 3FYPA 2RHGA 3W23A 4H19A 3VO0A 4AZ7A 4B91A 4GX9A 4LBSA 1GQKA 2Z1SA 3QMRA 3XISA 2OSWA 1V3HA 5HXMA 1DWFM 3UCCA 2E8YA 4H00A 4YIWA 4HZ8A 4K8HA 3SCRA 4X60A 4FO4A 2FB3A 3TA9A 3BCJA 5HATA 3EGJA 5TQLA 2PGEA 2AKZA 1E6ZA 3HPFA 1H62A 1R3TA 5M1TA 3PZNA 4EACA 5A2AA 1PHWA 4FNTA 4PBEA 1TMQA 4R9OA 1E5JA 3UPBA 1OFQA 2EJ1A 1V0LA 1JCTA 3WDJA 5KINA 1EJRC 1AVAA 2O9RA 2VGBA 2Q09A 2FTWA 3C86A 1OINA 1NOWA 4DVOA 3CXOA 3R5EA 4QJ3B 3M1ZA 5D2XA 2XJ7A 1UCWA 2FKPA 5EPDA 2FHBA 4DBEA 3MUXA 4X0VA 1OQFA 4IXHA 1HT6A 3VCCA 2HEJA 1UP3A 1UH2A 5GJMA 2QJHA 3QTGA 2Z1KA 1UWSA 1HTIA 4NT0A 1TJ0A 1HNYA 3VK5A 1EQPA 1DJXA 3CMJA 2ASHA 4FNSA 4WEVX 3A6OA 5JVLA 3VM5A 3SQLA 2PEVA 5EBUA 4REQA 1YPIA 2B7QA 2IUZA 2PSNA 2VGIA 1QO5A 2J77A 1BXBA 1EUNA 5CGTA 2YDRA 2GVGA 4ML4A 3IJLA 3TN4A 3RXZA 1QI4A 2WVVA 4L1GA 1W6TA 4DUWA 2XM1A 3T07A 3W2UA 4QAIA 4OTKA 3G0UA 1H2JA 3PJTA 1CGYA 4H2CA 4I7UA 4IMCA 5A2CA 3VGEA 5IBXA 4OV9A 2DU2A 5HPOA 2PB1A 4MPQA 1BWKA 4Q8PA 1ESWA 3GVGA 3TXVA 4KQNA 1REQA 2QDHA 4EPEC 3QV7A 2DP3A 1IYXA 5BRBA 3CU2A 8RUCA 4QSHA 3UP8A 2PPGA 2X09A 1KCKA 4PMQA 4EOUA 1Q6GA 5I09A 2V81A 3RLGA 1OK6A 1W3JA 1VEMA 3NEHA 4UR9A 4MNKA 1TIMA 4CNTA 4MZ8A 1XX1A 3W2LA 4LU0A 4DN1A 1M6JA 4WD0A 3P82A 3ABZA 1C3FA 3WL1A 2P53A 1AMYA 1F3TA 1MUMA 5D9NA 4Y90A 5AZ1A 1UD2A 3GS6A 1U5HA 2I14A 4M6PA 5K4ZA 2V38A 2YXGA 1V5XA 3LG3A 4FXFA 4GBDA 2GVLA 1I9CB 1OHLA 2A0NA 5LKYA 4ZVJA 3UF9A 4PMRA 2CBUA 2X8RA 1WYIA 1OFAA 3BANA 1WBHA 4PMNA 1XR2A 3VGDA 4DZAA 1ZBCA 3BICA 4UTJA 4HT3A 4CN4A 4MB5A 1RPXA 2E40A 4XISA 3AXKA 1LRNA 1EKOA 2VZUA 3CK5A 5BWFA 4UUIA 3DFNA 2BXVA 3KCOA 2R82A 1PCWA 5HMFA 1BEUA 2PWGA 3D3AA 4XUYA 4B16A 1JF6A 4W85A 1MW3A 3A9IA 3L4XA 3VILA 1J0YA 3T8LA 3G2GA 1P0EA 2WMGA 3DFHA 2GWNA 4S23A 1V0NA 3W7GA 2J78A 3EWXA 1VCVA 4KIEA 2QT3A 1R9ZA 2XFYA 3STGA 2PA6A 2CCRA 4Q33A 4QSFA 4MYXA 2X1RA 1EA9C 1TELA 1W5PA 4WRHA 2J6XA 2RH9A 4GH3A 3KTSA 4J7RA 2QCHA 5HJLA 2XIBA 3SFKA 1ZL1A 1I2RA 4FP1A 5AN7A 1KFCA 2ZX8A 3C4UA 1P1XA 4XZ9A 3LK6A 4J3SA 2PCEA 4DJDA 2NQJA 3XINA 4LSBA 2PE4A 1MVYA 3IIVA 2EGZA 3ECQA 3VGBA 2YIHA 3LLFA 2OMAA 3CV6A 1Q66A 3L7RA 2QCDB 4JY8A 3O6AA 1FTXA 4HHLA 1V7YA 1XIGA 3SCWA 4XAYA 4JQAA 1M53A 1D8CA 4NXKA 4TV5A 1K77A 1WKDA 3C8NA 4NYYA 1S5NA 2CKRA 3EX6A 5IRPA 2Z28A 3VIPA 3IACA 3STCA 1VEOA 1IHIA 2H3BA 3TN5A 1PIGA 2NQHA 1K4GA 1W5MA 4JKKA 4P8WA 2C16A 1NDVA 2JE8A 1IXNA 3BLIA 1TCDA 3WH5A 2JALA 3WFZA 4DY1A 3S5ZA 1SPQA 2V3DA 1B90A 3FAXA 3LB0A 2E09A 3EZ4A 3OA3A 1AUSL 4JR5A 2J13A 3SW6A 4E4PA 4GH1A 4F4RA 1RD5A 4DUOA 4A3YA 1OC7A 3AFBA 5I3HA 3OEXA 3HMJG 2D3LA 3CL8A 4AG0A 3GNOA 1UB3A 3EWWA 2BWGA 3TQKA 2GWGA 4AB4A 1OG0A 5EMMA 4H41A 1VD6A 4C6IA 3NA8A 4W4QA 1CI1A 1YTEA 4DO5A 3WSUA 3BZJA 3OVRA 4GD0A 4KCWA 1IXOA 2CZDA 2E6DA 4JFVA 1TPEA 3KZPA 3AMCA 4HN8A 1J4EA 2D2HA 1S3HA 3K8LA 4Q22A 2GL5A 1PSCA 1LOLA 5FL1A 2XFFA 1KFKA 3CUXA 4GVFA 5G2HA 1FH7A 1X38A 1LT8A 4ZCWA 1HKKA 2A3BA 3G1AA 4A05A 3V5CA 1O4UA 3GUWA 2WANA 5CZSA 3ZOAA 4BCEA 3EWZA 1TMHA 4S39A 1TYGA 4HIBA 1KBKA 1PKNA 1V3MA 4GRSA 5HNUA 1XCWA 2F61A 5C7HA 2RGLA 3PBGA 3LCXA 3UZZA 3ARPA 2D2OA 5CSYA 1GTEA 2BOFX 4HCHA 5CZKA 4DO7A 4PMOA 3IJ8A 2FZMA 1EP2A 1RQBA 2XH4A 3DFSA 1KGXA 1UH3A 3B0UX 4DJDD 2XWEA 5I3IA 1MXGA 2GQ3A 4JTLA 1ZCOA 4GINA 5BXSA 1C90A 1U1JA 3HGSA 3U2ZA 3ISIX 3NXFA 3QC0A 2QF8A 3LTYA 3UU0A 3MB9A 1R5YA 1TPFA 3DOPA 3G1XA 2J27A 2YBVA 2DW6A 3H4WA 4HQVA 4ZE5A 5JUVA 4GI6A 3GZAA 3L66A 1RBAA 3MSYA 1QUMA 4JTQA 1T8XA 4XKYA 5K3VA 3ALFA 4KT2A 4ZZ9A 2PDPA 2ZUVA 4XKYB 1ISXA 5C2XA 1OFOA 2QCFA 3KS5A 3WF0A 1OZQA 3W7EA 1M01A 3NL2A 3TROA 3TW7A 3R0KA 4PCSA 4FALA 3R4IA 3O63A 1H49A 2ADAA 4FXSA 1XXXA 1IT7A 4IIFA 2GOKA 3W7OA 4PBFA 1DHPA 3BAYA 4EE9A 1H0IA 3W7KA 2V6AA 1QI0A 3T08A 1B5TA 4LFYA 2AMXA 1J11A 2QUVA 4L4OA 4Z1AA 5KEZA 2V67A 2WMIA 3AHTA 3GFXA 4PH6A 3EOLA 4O0ZA 1B9BA 3WN6A 3SCNA 1G4SA 1V0MA 2JIWA 2PDIA 3RM9A 4U31A 3TSMA 3TC7A 3FVDA 1KM0A 4QISA 5FF3A 2XPKA 4Q8NA 5E9XA 4RNHA 1RJPA 3D5HA 4Z2IA 3MKVA 3T8QA 5A8NA 2E5CA 1VHCA 3WLIA 2A7NA 3M0KA 2A3LA 4XVDA 5I2UA 3N6QA 4I9JA 1EDGA 1L0PA 3JU2A 1E0TA 1MZRA 1JCXA 2B7NA 1TPVA 2XYLA 5D37A 3QZEA 1K6WA 1A5NC 2DT2A 3KOXA 1IWAA 3VD7A 4UZSA 3V3WA 1BFNA 2UBPC 4FPSA 1IEVA 2ZRWA 5I5RA 5CBIA 3W1XA 1GOKA 3WK3A 3FX4A 1VR6A 4PTXA 3VIJA 5FAGA 2ONEA 4NJIA 1WAWA 3VIOA 2B7PA 1P0BA 2GQAA 1A5OC 1U5JA 5BWAA 3WUEA 1S2UA 3MPGA 4C60A 1YPXA 4E0CA 3UESA 3CH0A 1S2TA 2C18A 3CC1A 2OYLA 1JUKA 4QGCA 3CQJA 3UR5A 5C71A 4F2BA 4JEJA 2QKFA 2JK2A 1RCOB 1V6XA 3DUGA 4A35A 3LMYA 1UBSA 3VOJA 1PZ3A 3A22A 2E5BA 1AZ2A 3LCGA 4ZODA 1TJ1A 5F2LA 4UTWA 1UD6A 3HPXA 2Y89A 3S3GA 4C91A 2Y7DA 5LA2A 4D72A 3R8HA 2Y1HA 1HJUA 1I2NA 2NQ9A 3T09A 3SEPA 1LF1A 3W7MA 1J8VA 1KCXA 4EPBC 2OZ3A 3AS0A 4FOKA 2XIIA 3CUZA 4E3TA 3NCOA 3GXTA 2EO7A 1VC4A 3P5YA 4KF1A 4LVGA 1XCXA 1UUMA 3FHAA 3U48A 3QFEA 4IP7A 2V68A 3LX9A 4JHOA 3T0DA 2VX7A 3VFCA 1G69A 3K4AA 3U4FA 2GGEA 5AFDA 2ICSA 1VAHA 2ZVRA 3KM8A 5JIPA 1W9BM 3WQEA 2GQ9A 4IUOA 2Y7GA 1ADSA 1EUAA 3ARRA 3G18A 3HFTA 1FWSA 3PK7A 3D46A 3E5BA 3EKLA 3QSRA 1LROA 4GZJA 4LYPA 1BF2A 4WY0A 3L2IA 1G01A 1KBLA 2OOFA 4LCQA 3NQ7A 3H54A 3UWWA 4WY0B 2YX0A 1XRVA 4AXNA 1XYBA 1R9YA 4LY8A 3TWBA 1G7VA 4UMBA 1UBPC 2O92A 1O12A 2YCIX 4IQJA 3K5XA 3THCA 1ZY9A 2V3EA 2AL2B 5BU6A 3W6LA 3VPLA 2CLKA 4HMCA 1O1HA 2P50A 3NYDA 3TEVA 1A5CA 4S3BA 1PV8A 3AI0A 4PUNA 2G97A 5AC8A 1G4PA 4I7VA 2NVAA 2WJEA 3CB8A 2PWDA 3VGHA 1VB9A 5CSSA 4H1ZA 5DO8A 2OJPA 3I3EA 1DWIM 1W9UA 1F5ZA 3RO8A 2J8FA 4X9SA 3QRHA 5HAOA 4XZNX 2WW5A 3HOJA 4AZBA 4PTMA 5CC6A 3H23A 3H8AA 4XZLX 5A6JA 5AC7A 2SFPA 3F4WA 4XAFA 5EB8A 4RNFA 1G67A 4F2UA 2VEPA 1BF6A 3EWBX 1MQQA 4MJMA 3AXXA 1UUQA 1EF3A 3AMGA 1OWQA 2R1MA 5T9BG 2C15A 1R9XA 1DWAM 4NXSA 4U10A 4O4WA 4Y9PA 2Z1BA 4IH3A 4YTSA 3FHQA 4DBUA 1NAL1 3IPWA 1W3LA 3W81A 4W84A 4NJJA 2C13A 1UKOA 4YU1A 2CBIA 5AOUA 2PBOA 3ZS4A 4JCLA 4AEEA 3WH6A 4C6KA 4K38A 1KTNA 1VFMA 1X8CA 4A8NA 2ZRUA 3IRSA 2JEPA 2PFHA 4M19A 1VJZA 1X8FA 2VELA 1XGEA 4TX6A 3BV7A 4OUEA 4DBDA 4MG4A 4ZQCA 1V77A 3CT7A 3CYVA 4JTAA 1EFZA 3GIYA 3D3FA 1PB0A 1WKFA 2QJNA 2ZUNA 2NVDA 3RCYA 1SGJA 1EZWA 2VC7A 2E7FA 4Q4OA 5CSRA 4LB4A 2HVOA 3K1DA 2PTXA 3EDJA 3TTOA 4U3CA 3TIMA 3VC6A 4QDPA 1GEQA 4F0SA 2DVXA 3PG8A 1QHOA 1WDQA 4FR1A 4W86A 2ZA2A 3ITTA 4O1EA 1FFQA 3QSTA 3CQKA 3QZ6A 1FWEC 4Q4RA 2X7VA 5LNUA 1XV8A 3PPHA 3RF9A 2R8WA 4Z1YA 2P3ZA 3QYQA 1SJAA 1H0GA 3NGFA 4D6JA 1F3WA 3BARA 2ZE3A 2X1IA 1ZJAA 1J96A 5FJUA 4PUEA 5ABHA 2D23A 1EDTA 1UKPA 2GJXA 4AX7A 4H6QA 2YDQA 3IUHA 4ECLA 4DWSA 3BH4A 2GJXB 2X1SA 3CZGA 2V82A 1E72M 1BRLB 2POTA 3HFYA 4DWSB 1XP3A 1UKQA 4RE3A 1P1MA 3VA8A 3L4VA 3JUGA 2NQLA 3DI0A 3FA4A 3V4BA 3WQ4A 4EX4A 4QG6A 5AVNA 4M82A 3W1QA 1ZU8A 4S2CA 3W71A 3H7RA 3TJIA 1ADDA 3GH4A 2ISDA 4C5YA 4MFDA 5KMYA 2ZICA 1HZYA 1R2SA 3SY5A 3TUUA 1PPIA 2BY0A 2GJNA 4QBXA 3KEHA 8A3HA 3PNZA 2R91A 3LSCA 3NZ1A 5FEXA 1FBAA 1ISVA 1FWWA 5I3JA 2CITA 3T42A 1KBBA 3DC8A 5AKQA 3WEOA 3MU7A 3AIUA 1TUFA 2BODX 5G1TA 2ZZ5A 3W85A 4G8TA 3SCQA 3SRKA 4JHMA 2MUCA 4WSKA 3TOYA 1NWRA 3UZJA 1PX8A 2R94A 4OHQA 3OYXA 1GONA 1PS9A 1QI2A 3GG0A 4PCPA 3LOTA 5E9AA 1VYSX 1KRBC 1PIFA 3JW7A 4GFSA 4WKHA 4ZGYA 3GU2A 4MYAA 2HJPA 1JYNA 1RZMA 4LVBA 3R7MA 4PGLA 1EOMA 1DXEA 1M65A 1N2VA 3B0YA 3LHWA 4I5XA 4RK8A 2QVHA 4QE4A 1W54A 1DYSA 4QDWA 5I03A 3LBOA 2WC7A 4MDPA 2C8NA 3WCZA 2WNNA 2WMKA 1D3HA 4DEFA 3CUJA 9RUBA 2Y85A 1GQLA 2VQUA 3W82A 3WUFA 1JPHA 4ACZA 1DE6A 1Q6QA 4LF2A 4ZEPA 4OE7A 5F4SA 5REQA 4ACZB 1FCQA 4XD3A 4N9CA 2VENA 2GJLA 3GNDA 2OQHA 3TLLA 2XUCA 1E9YB 5CAHA 4JCMA 4IMEA 1OJXA 4GLEA 1VF8A 3CHEA 3F7JA 5J8LA 3TSDA 4YCPA 1EJVC 3LEPA 4TTUA 4H9MA 4LAOA 5IFPA 4DWSD 3UZYA 2UY3A 4C6CA 5CG0A 4XVEA 4H3DA 4AZHA 2CPUA 2FPTA 1DXFA 1CXIA 1MFUA 3PBWA 4G5DA 1ODZA 2OSYA 4LF1A 1XSKA 3SCTA 3NZQA 4M81A 3IIZA 1QI5A 2ZZ7A 4P7LA 3LCFA 4WUIA 3ZVIA 2FGLA 2QYGA 2EF9A 3NOEA 2NSXA 4R88A 3AIBA 4HGXA 3MP5A 5HJYA 4JICA 2O4MA 4KESA 5FF2A 2PUZA 2W63A 2ZIDA 2YZRA 4H6RA 1F6YA 1HJSA 1LDCA 2MNRA 2X16A 1WUEA 4JEQA 1AJ0A 1BKHA 2OTDA 3IJDA 4GABA 4JNZA 1AMKA 4B5XA 1TPB1 2FFCA 5J5RA 4AZGA 4MF4A 2QW5A 3TTSA 3LLDA 1H5YA 4LUTA 5EMLA 3WBAA 3W7DA 3GR7A 1MRQA 3KVMA 2J74A 1B57A 4NP7A 2HSAA 1HFBA 1J18A 1UQZA 4YPJA 3VNZA 2GJPA 3GG7A 3M43A 3WL0A 4B5WA 1I6NA 2BHYA 1N82A 3LCHA 1OADA 4QLLA 1M5WA 3P67A 4ADTA 4C5ZA 3G6LA 1IEIA 3TFXA 3C2YA 1KXQA 3ZVHB 2H8XA 5C9RA 3LY0A 4F2TA 3OIXA 3KCJA 3E5PA 3OPSA 2QZRA 1HP4A 3SCVA 3UPWA 1QDSA 4AC1X 3B8IA 1X1OA 3EMQA 1JD7A 4DBSA 3W2KA 3WBXA 4GJ1A 3GXDA 3EEGA 4PSPA 1BGGA 3RPMA 1K03A 3WBWA 3T9PA 4HA0A 3UA3A 4CKQA 3BURA 4DM1A 2WC4A 2WSQA 3NZRA 4NX5A 1LOQA 3BOXA 1XLEA 4HK7A 2XU2A 1JIBA 5HOSA 1I75A 4JAWA 4LUIA 4ALDA 3KVJA 3O2LA 3S1UA 3W7NA 5D33A 3T0AA 2C1HA 1FWBC 4C6EA 1NOUA 1QPOA 1KBIA 1E0VA 1HW6A 1BLIA 3HMCA 1Q85A 1FHLA 2XTKA 2XVLA 4IX2A 1UC4A 4Q4KA 1D3CA 1XLKA 2QVNA 2BVWA 5FAJA 3T0BA 1Z42A 3N14A 5BMWA 3GIPA 1DIDA 4H9UA 2YPIA 1O1ZA 4Y9OA 3S9IA 2D69A 4HYVA 1SMAA 3UXAA 5CG7A 3B4YA 4C6JA 1MXDA 4P8VA 2R1PA 3HBLA 4YXGA 2C0HA 3UY7A 4TOQA 3FEQA 4MDOA 3SGZA 1W0MA 6TIMA 5ABFB 4LBUA 1A49A 4RLIA 5C8BB 2W4XA 4Z2HA 3IAQA 3OVPA 5HBFA 1FDJA 2XN1A 2ZYFA 6ENLA 3SGGA 3QPEA 1UUOA 4EXQA 3ZIZA 2UZ9A 4NZJA 4LANA 1O95A 3AXIA 2XH2A 1XLDA 5ENLA 4IJRA 4AZIA 2P8BA 3W37A 2QNEA 3K1GA 1GGOA 1KV8A 3CQ0A 5I24A 5HQLA 4Q8WA 4LS1A 3URNA 3WLHA 2ZXDA 4XK2A 1H1NA 3WF4A 4UTKA 5AZ0A 3S1GA 2QCLA 3FAWA 4O1AA 3THQA 1L6YA 2BLEA 3L65A 4EWND 3GBEA 3BCFA 3ZJKA 4GKLA 2YW4A 2WZMA 3PZ9A 4LVFA 4W5UA 4W9TA 4O14A 1XKYA 4ZQNA 1NELA 1P7TA 1T41A 2D20A 3FJ6A 3EOUA 1BD0A 4MM1A 2OEMA 3HG3A 3BJTA 4H01A 4C7GA 1HUVA 2FH8A 1KB3A 3OLEA 3WJXA 1R8LA 3EWUA 4G1NA 4DAFA 4DLMA 1XG3A 1QNOA 4ZA0A 3QH2A 3NQEA 5FACA 4MVAA 1V08A 4S3GA 1CYGA 3SRFA 2JEQA 4HYRA 1C8QA 3WENA 4D2JA 1RY8A 3RX3A 3OVQA 1EX1A 1HL2A 1V93A 5ECVA 4H9TA 5LSMA 4GACA 4NRRA 1AG1O 1UR8A 4I7WA 2GGJA 4OKDA 2XVGA 2BHUA 1BXNA 1PXGA 1ZPTA 7PTDA 3BAIA 1AH0A 1JZ8A 3DECA 1DQXA 5BXTA 4GYKA 4ILSA 1F9CA 1WO2A 3FVMA 1OY0A 3W38A 3MHFA 3H2NA 2Y70A 4W89A 3GYCA 1PDZA 3TONA 1EC7A 4UTUA 1C92A 3FFSA 2D73A 4NJHA 1VZWA 2ZDRA 4KPLA 3KE0A 2CYGA 1J5SA 4OIFA 3T4WA 1AL8A 3WY1A 1UD5A 4IF2A 4OVXA 1W3NA 1O5KA 4I9AA 4FHAA 3WMBA 3GU9A 3M7WA 3ATZA 1E56A 1W37A 3RITA 4XIMA 1L8NA 1KTCA 2GLKA 3C52A 3ARYA 2I56A 1W5NA 1WP6A 3PBYA 1V0KA 1P4CA 1HVXA 1C8VA 5CCZA 3K2GA 1S5VA 3QJAA 1K6AA 3L0KA 4DYKA 1DJGA 2G3JA 4JTTA 4MMWA 4PULA 3IIPA 1MXSA 3S83A 1HJWA 4C6FA 1BG9A 1QPNA 2NX3A 4BF7A 1YEYA 4C6NA 5AVHA 1FKXA 3C2EA 3CL7A 3GTFA 4V28A 4A3UA 1UZDA 4KGJA 1L6WA 3QY7A 2ISSA 3II1A 3AZSA 3P0XA 3C2VA 3S1WA 3MUAA 2PD5A 5I3GA 3M46A 3AHXA 2NT1A 5E1QA 2NWSA 1A5KC 3EEZA 2XSXA 3NXLA 1BVWA 2WO5A 3M41A 5MKGA 4JIQA 5CAKA 4XTIA 3M9YA 3AZRA 3IV8A 3UEQA 5IDIA 4IIBA 3U7BA 5MKGB 2DSUA 4AEOA 4WXZA 1YXYA 4MFEA 3YPIA 3G1FA 1E0WA 2OLAA 1Z48A 4B3ZA 3KDOA 3VZXA 2ZXBA 5FEWA 3S1VA 3GXIA 1YTDA 1MNZA 3EYPA 1CX9A 3NDYA 1LWHA 2W3ZA 4OUIA 3S9ZA 1N7KA 2PZNA 1LRTA 1WZKA 3K30A 2YBUA 3V75A 4Z42C 2DY3A 3L4ZA 1XM3A 3WLNA 2QXWA 3VIIA 2CLOA 2IXUA 1RY0A 1OABA 4GYJA 1UD8A 4RDWA 4LJ3A 4G7EA 1E70M 4ADUA 3ZSSA 3MVIA 5G2IA 1Z32X 1YKWA 4HPJA 5DCBA 2WCAA 3ZLGA 2PDXA 2FIQA 4G7EB 3UXDA 3TR2A 2WNWA 1H1ZA 3BXWA 4DJEA 3KUMA 5CZTA 3WO8A 1MW0A 3G1DA 3HQPA 3GVQA 3ABOA 1NSJA 3USZA 3VDHA 2CEQA 3OLGA 3TQPA 2D1ZA 4EWJA 2YA2A 3QW4B 2YBTA 2WSPA 4MSSA 3W3OA 3LXCA 4X61A 5EFFA 3M5YA 1VHNA 3HPSA 5K9DA 3DHPA 1S46A 1SFJA 3CZ8A 2PZ0A 4FF7A 4MB4A 3EXTA 4GUFA 3VD9A 3N2TA 1EEXA 1GPWA 4EF9A 3WQGA 1O6IA 1SVDA 2Z27A 5IXEA 1XYLA 2DUXA 4Y9NA 9XIAA 1XF0A 5EL1A 1L6GA 4DPPA 1M04A 3GUGA 3E2QA 3E2VA 1WDDA 1XD0A 3HGRA 4PEKA 1NM9A 3SB0A 3DERA 1LRQA 3IGUA 1VKFA 3VE7A 3H7VA 3T2QA 3VIGA 4MB1A 3G0XA 4GUGA 2CW6A 2OEJA 3O0FA 1UMLA 3DKLA 5D2TA 2ZZ3A 1VJSA 3VIMA 4CCZA 3GKFA 2ISWA 2J6VA 5HK4A 3BC9A 4MAVA 2ZZ4A 2NXIA 3GHRA 1QPRA 4FXJA 3MSDA 3QEZA 3GHSA 3TMQA 3F4CA 3PM6A 2EPNA 2NW0A 1GQIA 3P8IA 3I4EA 4FX7A 4LRSA 3QV6A 3PB2A 5T91A 3GDKA 5TIMA 2BHZA 3GH5A 3PP7A 2WZEA 1H4PA 1R47A 3W72A 1MW2A 1PCKA 4BHYA 4RE0A 4C90A 1VS1A 1XIFA 3WH9A 1ME8A 1SUXA 1NVMA 1HN1A 3G6MA 4JTFA 4CLMA 2XIQA 3B0XA 2ZVIA 1SW0A 7ODCA 2F84A 2HPMA 3TE9A 4IQDA 3PUGA 4FLSA 4DRSA 2WWDA 1EPXA 3CV7A 1TX2A 4O50A 1CGXA 4RPPA 2ABBA 1JFHA 1PKLA 1IGSA 3PJXA 4OBTA 4WQ6A 2AGTA 4ZTYA 2PMQA 3MYOA 1MO0A 3TN6A 3PNUA 2OCZA 2ZX6A 4CD7A 4KCUA 4DJED 4O16A 3HV8A 3N3MA 3TJLA 4GVGA 1KW1A 2BVTA 1VYRA 1JYWA 3QGVA 1WNOA 3K46A 3QV9A 3NOYA 4OWGA 2ZCGA 2X1TA 1Q8JA 3FXGA 1TQXA 1Q7MA 4RZ5A 3JR2A 5GPRA 4AF0A 4UTLA 3BSGA 1EHAA 4UMCA 1JI2A 4AWTA 1DL3A 1DQUA 1P0DA 5FEZA 1X98A 4IPIA 2VDIA 3CAKA 2DPEA 4IFOA 3O6CA 2ZTJA 4GNVA 1GZJA 3KFTA 3QTPA 1RUSA 1VLIA 3T81A 3W25A 1KFBA 4XIAA 1A3HA 1ENUA 4ERGA 4QE5A 4NAFB 1IZCA 3U4AA 3NQFA 3V0SA 1TV3A 1K8CA 4XUGA 2HK0A 1T96A 3LZ5A 3PG9A 1IEQA 3VD5A 1KGUA 2F2HA 1MQRA 1E73M 4I9MA 1ME9A 3KBWA 3M5VA 3PUEA 3B04A 4GNJA 4D6DA 3KBSA 2R14A 4AD5A 3N11A 3ARUA 1LQAA 2DSZA 3MHGA 3FJLA 5T26A 4L9YA 4AWSA 3SZ8A 3OIHA 3NEVA 5LNSA 4CD5A 4N42A 5CGMA 2OB3A 2HK1A 4I9TA 5FJPA 1VBGA 3WNLA 1W1B1 3PPFA 2WPBA 4NNBA 2PDYA 1LG2A 1ITQA 4B5UA 1KM2A 2I7GA 1FXQA 3C8FA 1TWSA 3TKFA 2CU0A 8CGTA 1ZSXA 2IS7A 4FX6M 4RZ4A 1US3A 1Q13A 2B4GA 5FEPA 1RCQA 3E0FA 3QR1A 2VZTA 2GK1A 3UWUA 2VCAA 2I17A 1I0BA 3L5MA 2GK1B 1ZZMA 1P6BA 3SGUA 1EGVA 1X7IA 3GC2A 3CAQA 1A0DA 5D4YA 4W8LA 1XIMA 3H4GA 4V33A 5JXQA 1Q63A 3B8UA 1TJ2A 4HU0A 3S2JA 3UXLA 2XIOA 3LRLA 1EL3A 1GZGA 3W02A 3PB0A 3ZXWA 1W1YA 3TR9A 3WLSA 1O5RA 3TAOA 2WHLA 1I4NA 2CHNA 4YVXA 1ITXA 3N13A 1XLLA 4DBWA 2R1KA 3FKKA 3VIKA 2CZEA 4JBRA 3UG3A 4Z2JA 1CXKA 1JZ2A 4IIGA 3N19B 1BQGA 1UIOA 1GOQA 5TNVA 4HZMA 4EVZA 4GX8A 1D2KA 4X3ZA 2EEXA 2ATMA 2OOGA 2E28A 3G1RA 2ZUUA 3WD0A 3VCRA 2CFFA 2QPXA 2BV9A 3NR0A 1F6KA 4O53A 2E6AA 1QT1A 1FWRA 4Y8EA 4W87A 1Q7QA 2HTMA 2G95A 3W75A 1WXJA 3PWGA 3A5VA 4Q32A 1IT0A 2V2HA 2VCCA 4D8AA 1P6WA 2DZWA 3EB3A 2RJHA 1TV5A 3OGVA 2Z6IA 3TYAA 1RK6A 2R24A 4AU0A 4M6VA 4AUBA 1J0ZA 2NQ5A 3GG1A 2XGIA 3VI2A 2CLEA 3W86A 2A85A 1EX5A 1E71M 1IF2A 2V0TA 2YOCA 3E38A 1N8WA 3NL3A 1OX4A 3RX4A 2H9AB 6TAAA 3UZ5A 2Y63A 3TC6A 1R3SA 3G1YA 3NVTA 1E15A 1IR2A 1AFSA 4UFHA 3COTA 2JGYA 3OU8A 4FS9A 5C7VA 5DANA 2Y7EA 4K7YA 3CJPA 3W28A 3AXMA 3R11A 4K1WA 5D30A 3FXYA 4UIOA 1LT7A 5AHNA 3SJNA 1TFVA 3UR8A 1VRXA 3D47A 3DZ1A 4Y6GA 3O15A 3M0JA 1KLYA 1EYWA 3QN3A 5LHFA 1RQHA 5AHLA 3O0KA 3NG3A 1CLVA 1FHUA 3ZJ7A 4GIRA 1E0UA 1KFEA 4OGZA 2XZ7A 3U8GA 4E6MA 2HVNA 5FKYA 2TMDA 1XBXA 1FQ0A 5HNTA 1OT1A 4TVUA 3A5FA 1N8FA 2F38A 2Q8XA 2VO5A 2QJGA 1K02A 5CC3A 3DCPA 1GYLA 3VUPA 5FJIA 3AYRA 5JMUA 2ALDA 4ZMGA 3WBYA 1RH9A 4O18A 3BQ6A 5HWMA 3C5QA 1B3VA 1U5VA 4N6FA 3GR4A 1K7FA 4JIHA 3BMVA 2WVUA 2V2DA 2RAGA 2E1WA 4PMXA 1R30A 2WJZA 2NUYA 2WB5A 2V30A 5GNZA 3THUA 5AYBA 5FJOA 4WKFA 3W01A 1V6TA 1K8YA 1TZ9A 2CESA 3QHNA 3FYYA 1V3JA 2EPKX 2OELA 4W88A 3UJEA 2MANA 1QOQA 5EKYA 4OOZA 1EJ7L 1DJNA 3LPFA 1Q2RA 1E9ZB 4C1KA 4R7JA 3VKCA 2HNEA 2YFNA 1YDNA 4KERA 4JD4A 1AQFA 1EO5A 4MUPA 4L4LA 4MKNA 2I9EA 2DVTA 2EKCA 1WZLA 4LEFA 1L8PA 3A23A 2DVUA 4M6UA 3EXSA 3NUKA 3A24A 3SM0A 3CUFA 1I45A 2X41A 4A22A 5F7UA 3CYJA 4U5KA 1BVNP 1PUDA 1CXLA 4WSHA 4D6CA 5I6SA 1XW8A 1NARA 1SR9A 2PDGA 4LWWA 1XYCA 4WJ8A 4HD5A 4MNLA 1JNDA 1QK0A 1VPQA 2HISA 3QW3A 4H9YA 3WD2A 3H2CA 3FIGA 3W7QA 4QIUA 4YMZA 4JYDA 4AWEA 3B4UA 1HG3A 4EIVA 1WDRA 2J7DA 4WF7A 2PWHA 3RCNA 2PCQA 1XDLA 2FVMA 3CIXA 4GOAA 1QRQA 1AQMA 1VFUA 4E2VA 3I6TA 3ITCA 1UOZA 3ZMRA 1BXCA 1R38A 3AROA 1DEDA 5FSDC 1JDEA 3L4TA 1ZHAA 1RAKA 2EPMX 3QKZA 3WZ0E 2PDHA 5DT7A 4ZSUA 2W67A 4B4HA 4B92A 4A21A 2E67A 3TQVA 3F1QA 4UR8A 2VTFA 2D24A 4BI5A 3CWNA 1F6PA 4KWWA 3PULA 4I8DA 1UOKA 1DE5A 3RLUA 2WZTA 3D0CA 4IFKB 2ACQA 5AHMA 1LL7A 4YLWA 3UFYA 6REQB 2VD8A 5XINA 5CEWA 3W7PA 4DHGA 5CPLA 4DUVA 2RDUA 4LYKA 1T5AA 2TPSA 4KIRA 2W5FA 1ISZA 1L6FA 2EBNA 3GG8A 2CLLA 3THDA 3LN3A 7ENLA 1SQ7A 3CIWA 2J66A 2WC3A 2JFEX 1GORA 3Q58A 3S2MA 4RZBA 5FSEC 5A6MA 2XGZA 2GOUA 2A1YA 1G0CA 3NSMA 4L5ZA 1ZTVA 2PC4A 4QHRA 3W7CA 1W32A 3PR2A 5FF4A 4J9JA 1TJRA 3DG6A 3VD4A 4QNWA 4QJ5B 4AD4A 1W3IA 2FLIA 4H8VA 5BCAA 1JCMP 1FH9A 1F8MA 3E74A 3HN3A 4N9BA 3LNMA 3EA1A 5LIKX 3LQLA 4FXRA 5FIPA 1FWNA 2OODA 3RN6A 2EAWA 4HTYA 1F73A 3V36A 1OC5A 2PTYA 3MJYA 1G1YA 2Z2UA 4EANA 3MTWA 2HNHA 3N9KA 4YTUA 2F6UA 2GUBA 3ZQ9A 3FLUA 2WVSA 4YHEA 3EPNA 3SUWA 3N9RA 4G9PA 4W7WA 5B7ZA 1EOKA 3DYMA 2V3FA 3N4FA 4MOZA 4WDXA 1GVYA 4ATLA 5IDZA 4E4FA 3ZSTA 3PSVA 2O4QA 4IMFA 3UWZA 1M03A 1OGSA 3VU2A 2ZUMA 1QNVA 2B7OA 1NY1A 1OG6A 4W7UA 5EMKA 1CENA 1UMYA 3MKKA 3IVSA 4BQ4A 4JQ1A 4X2PA 4BQ3A 4E3VA 3VIFA 2BZNA 3FDGA 1CWYA 3TCEA 1DPMA 2VT0A 1KXVA 1HO1A 1XH1A 3CPUA 3WFLA 3TYDA 1ZLPA 2GFTA 4QEEA 4AHQA 4HHMA 3RAOA 2J7HA 2R1LA 4ZE4A 4BS0A 1XQLA 2WM0A 1DTUA 2CXEA 3R0DA 5CPOA 2DW7A 1I0DA 2QR6A 3AO0A 4IQLA 3WQDA 2ZWYA 3F2BA 1LORA 2POZA 1CIUA 3SR7A 1HKJA 2OG9A 2KAUC 1XIIA 2INEA 3WQ6A 2Y24A 1KQYA 1UD3A 5DCEA 1YW1A 1E4LA 4KEMA 2QV4A 3DAQA 1XPGA 1UWAA 1X6UA 5KZDA 2JQXA 2Z2AA 3TYCA 3R0UA 3CPGA 2WHKA 2GSEA 4LNCA 3IV3A 1DV7A 1LUCB 5C5YA 3SAZA 2HWGA 4N0RA 1GNXA 1Q6DA 1OFDA 1Z69A 4DXVA 3LDVA 3H2FA 3G1SA 1U22A 1M41A 3H26A 1B30A 1ZAHA 2PDLA 1MNSA 3GNRA 1AJZA 2J24A 3WBEA 4IMGA 1XLMA 3AIVA 2A4AA 4HP5A 2Y0FA 4BI6A 1FHVA 1XLHA 3L68A 4JX5A 2OT0A 2VM8A 4GXWA 4HPNA 3WLJA 2BS9A 3DKJA 6A3HA 4AZ6A 1XCFA 2PDQA 3FV9A 4F8XA 4IMAA 2CKSA 3GAYA 4NY2A 2WYSA 5H8MA 1ZCCA 4L6OA 1WQ5A 1UHVA 2BGSA 3H2OA 3EDFA 2DH3A 2HMCA 1H7XA 5FD0A 3PTMA 2TYSA 2J7EA 2V9DA 4XO7A 2E77A 3VNMA 3AUOA 1W5OA 3UJSA 1M7XA 1MYRA 4P7QA 4NAEB 4D1JA 2WHJA 5C9WA 4ONVA 2RFGA 4QLJA 4KS0A 5EY5A 3BOLA 4U2ZA 3WKZA 4Z2KA 4AXKA 4NNCA 4KEVA 2A21A 1R2TA 3LBCA 4WJEA 1CT5A 5EMUA 1PYMA 3D6NA 1XLIA 3NFUA 2JF7A 3U6WA 1LCOA 1DQWA 1LWIA 1TV7A 1XRSA 1BQCA 3REQA 3LSBA 4JTJA 3WLRA 1QBBA 4HPHA 1E4IA 4KMQA 1JRCA 2YL6A 4O57A 3REQB 4JQ2A 2PWFA 3R1ZA 4MZYA 3QHMA 4MUZA 4F0LA 1K7EA 4C65A 3FCPA 2Z7GA 4G56A 3NZGA 1SFTA 3BAXA 4L6DA 3C0SA 3KS6A 3C2FA 3SY1A 1V6WA 5I0DA 4NG3A 4GUHA 1ZJBA 3MSGA 3USBA 7REQA 1K70A 2ZA1A 4U3AA 2WM1A 3E0WA 2DZTA 3UXKA 4DYEA 3WNOA 3APGA 2Z29A 3S2CA 2VC9A 7REQB 3NO5A 3W7JA 4F9JA 3S5NA 1ZRQA 2VOMA 1E40A 4AVNA 2EPHA 1ONEA 2VCBA 1FXPA 1LP6A 3ID7A 1UZ1A 5LNRA 1LLZA 2ZC8A 3LGGA 4WKAA 1LWJA 3W84A 5DCDA 4DNHA 1ME7A 3P81A 2R1NA 4LH8A 4TQTA 4XKMA 2C1IA 4AHOA 4O1FA 1WKEA 3ELFA 3RM4A 3AJ7A 3L4YA 4B15A 1TX0A 3VM7A 4KH2A 2CZ5A 4RV8A 1GYNA 5GQBA 2DQWA 3U2EA 4Q7BA 5G4HC 2VZSA 1Z44A 1GEHA 1UP0A 3PFRA 1UR2A 3MCMA 1OGBA 1EJUC 3AYSA 2HXUA 3WELA 1J01A 1H7PA 1JR1A 3MMUA 3TTEA 4PUDA 3PBVA 3URAA 3GD6A 3B0PA 3P93A 3B8TA 2ZQ0A 4F0HA 2OWXA 2E1DA 3MUIA 2I5QA 2AKMA 3EX1A 3I3BA 3NAVA 3FEMA 4XG1A 3OO2A 5C9ZA 1YDOA 3I4KA 4L64A 3HURA 1U1UA 4K8EA 5I23A 3DENA 3HQNA 4CQAA 1J12A 1F3XA 1PAMA 3KX6A 1TB3A 2VD9A 2X42A 3MV01 5EGRA 3ARXA 3L0GA 5T9CE 4UTTA 1EP1A 4WCJA 2RDXA 3W9ZA 3VMNA 3W74A 4AISA 4DI8A 5GVJA 1WCGA 2X2YA 2PU1A 5CJMA 3WEZA 4AWUA 1Y5XA 2G37A 2WOQA 4OBSA 4CQCA 3DC0A 1O66A 2Q8ZA 1F4AA 2VL4A 4N9EA 4PMJA 5I07A 2J8GA 4NNAA 3OP2A 5GJNA 1JCYA 2IKIA 2E3ZA 2F7FA 4MZ1A 4D1IA 2CNCA 1QCWA 3H2AA 3RRAA 3QY8A 3N04A 4KETA 4UTFA 2V2CA 1FWTA 2PURA 3R10A 4OQVA 4MWAB 4FA3A 3ANYA 3PWAA 4EPDC 1DWGM 1C91A 1LL4A 2ZZ6A 2ZWZA 3LGDA 1LTDA 4X9YA 4P7RA 5BXPA 1YHTA 4GI9A 5FA5A 3QGKC 3THAA 2ZC1A 5BOOA 3QLLA 4W8BA 4P8XA 3KLLA 3UA4A 1MSSA 2WSRA 1ZGDA 4UFKA 1MRAA 4GVHA 1OVDA 3QY6A 3HB9A 1XLBA 3F4DA 3W1UA 3SN0A 3CAWA 4V1XA 4NZ3A 1JPKA 3KZSA 4DUXA 2DZXA 3ANUA 3H70A 3ZZ1A 4IJBA 1TTJA 4QLKA 2Q3RA 4CQ8A 3EWCA 1XBZA 2WKGA 1O7AA 2X0HA 4HNOA 4L4MA 3BV4A 4R5EA 2A2IA 4HPXA 5A8QA 5CZ0A 3AALA 2NLIA 1MEWA 3CZJA 1GQJA 4L4PA 1R86A 3A21A 3CAVA 5G4WA 3QMTA 4QAWA 3A13A 3KTCA 1K7XA 4JKMA 3LM7A 3ARVA 3R6IA 1KFJA 2FZDA 4FZIA 4A2SA 4DPQA 3GW3A 4A29A 2J79A 4RDZA 2E9BA 3K13A 3OVGA 3XIMA 1UQYA 3AIQA 2FHCA 3RJYA 1DJYA 1NJJA 1W31A 2DZSA 4PZVA 4GVIA 4US6A 2XIMA 3GXNA 1WDSA 3BGJA 4GY1A 2OX4A 1TIWA 4F48A 4QM1A 4WY0F 1TJPA 3GNPA 5HANA 4AY7A 5IBXC 5A5WA 3ORWA 2B0MA 5CC5A 1KQZA 1UW9A 2Y8VA 2NQZA 5EMJA 1CB7B 4KW2A 4TO8A 5CPSA 2FZBA 1W1IE 1K9FA 5I79A 2AL1A 2QUUA 5G5IA 3FNDA 3AZTA 4KFPA 1XJBA 4KEUA 2QEZA 4LAMA 3NO3A 3PPCA 1ITCA 3W1RA 2YXXA 2CETA 3QGAC 3NIYA 3N34A 3G0SA 4G1KA 4PSRA 5C2CA 3M07A 3W6YA 3M0LA 2D0HA 5PTDA 2UY5A 3VOGA 4U2YA 3R8GA 4DXXA 3UJRA 3T0CA 4FOJA 4R85A 3W7HA 2OR2A 4JTSA 2QCDA 4MWAD 4P5UA 3M4HA 3UCDA 5DRCA 2FMOA 4CEXC 3T1GA 1KGWA 3SDOA 1TTIA 5U4NA 5BNKA 3UG8A 4M1BA 3FJNA 2B81A 2Q01A 4WOZA 2DORA 1BTMA 2RGMA 4AD2A 4ML9A 2GYIA 3HJZA 5I78A 1XLAA 2GZXA 2FZ8A 3H2MA 1LQ0A 2Y4SA 4NZFA 3L4UA 2I5IA 4M56A 4MY9A 3STFA 3HZ3A 3KL3A 3ZO9A 5A3HA 2VX6A 1A47A 3GHTA 5IOBA 1E6PA 2DIKA 3KBMA 1JPDX 4Q4QA 5H2ZA 4KCTA 4J3TA 3DN5A 2PLCA 1ZAJA 4S3AA 1VLWA 8XIAA 4GXMA 3EDDA 2PWUA 1TTPA 1RK5A 4BZYA 4IFRA 3G8RA 1BWVA 1GVQA 1LQ2A 3HV9A 2C71A 1AH4A 1RA0A 4RR4A 1C29A 3NDOA 1WX0A 3AAMA 3SJ3A 1HL9A 4B5NA 3W1TA 4JN6A 2H90A 4B2DD 3HO8A 5M2FX 2VFHA 4GZEA 4K8GA 5IHSA 4D6EA 4DNMA 3B40A 2B31A 3SSZA 3A3XA 3MYPA 3R89A 1BKSA 4TUFA 1SMDA 2WPGA 4NL1A 4XZWA 4TV6A 5F2MA 1FWJC 4PFHA 4DQWA 4BEUA 3VGGA 1GVIA 5JBDA 3WQWA 1RPKA 2ACUA 4JGDA 2DFAA 3TVAA 3ITLA 3IVTA 4DJDC 3WH8A 1X1ZA 4LCRA 4RW5A 1TRIA 3JVAA 1RR2A 3QVQA 3MO4A 4XO6A 3AMDA 1ITUA 1SSGA 3V0UA 1ECEA 1TR9A 3MI3A 4CQBA 3LI1A 2E8ZA 4M7SA 4LAKA 4HOWA 3W27A 4QCFA 3WQPA 3TYBA 4JXCA 4C1NA 4QG9A 3AUJA 4AD0A 4ZO9A 1DXIA 2JKPA 4L9ZA 1TMLA 2VI0A 3CEPA 4HNTA 3QXBA 4C1NB 2GUYA 5FI8A 3A9BA 1ONWA 4ORMA 4UQAA 5C9XA 3JZUA 1SO6A 1Q4WA 1IEWA 3V7PA 1M7PA 2ZUSA 1NDYA 1AW5A 4ZO6A 1NWTA 3PTQA 3N9SA 3WNMA 2HCVA 1VJIA 3CV2A 4UQ9A 2WJFA 2IPJA 2XSBA 1VP5A 1RLCL 4HSHA 5CJNA 3LCLA 2A3CA 3WEMA 3B3DA 3W83A 1QXLA 4LUJA 1SFSA 4FIRA 4K2SA 4XAPA 1KD0A 5D38A 3GKAA 4O0QA 1XIHA 3BW4A 5F4XA 3GM8A 3A4AA 2ISVA 3MY9A 1XICA 1FP8A 3N25A 1VFTA 1XRTA 1YE4A 3EAUA 4JDBA 3CO4A 3N2BA 1HIZA 4EAYA 1JNEA 2CLIA 4PUMA 3GK0A 4XBJA 2PC8A 4LGXA 2E4TA 4A8RA 4IL0A 5E93A 1YDVA 3QOMA 3VAVA 2A6LA 3M64A 1E3ZA 4H7ZA 1VBUA 4ZO7A 2G4FA 3VXGA 5HMEA 1DIKA 2O9TA 4GQ0A 4AW7A 1E6QM 2DT3A 3HF3A 3M0YA 3WJSA 2BY3A 4J40A 3G3DA 2HZGA 3RUBL 1RLDA 1TG7A 3E49A 3CUGA 4QRNA 3WD3A 4S3EA 3UXIA 1DIEA 4LB3A 1S1RA 3VUSA 3UBPC 1GW1A 4ZXOA 1ISWA 5K2ZA 3EXRA 3ITGA 3N4EA 2PDMA 1PX4A 3Q2DA 1I1XA 4UCFA 1LBMA 3RLHA 2NWRA 1RVKA 3H12A 3RNDA 2H8ZA 1TZZA 4A4AA 4CNSA 1OFPA 2D0FA 4BWLA 4D6GA 4YYFA 1V3IA 1X39A 1SW3A 2FZ9A 4PCFA 3ARQA 4QFUA 1EHNA 3EOSA 1OIMA 1A3WA 4JIIX 1EYEA 4XSLA 4PL2A 2E68A 4IGNA 2QHAA 3AU6A 3KWSA 3EOOA 3HU7A 1NIUA 1JUEA 5CPTA 4J5NA 1EZ2A 4MPKA 5F1VA 3BJFA 3LRKA 3UQNA 1TR1A 4GXPA 4Z0SA 4MNJA 7A3HA 3QQWA 2DJXA 5LIWX 4L9XA 1T40A 1SSDA 3STEA 1KFLA 1NP2A 3BLOA 3AMLA 4M80A 4Q8MA 2L5HA 3TNBA 4PC8A 1XLGA 3U7VA 3GLCA 3O8AA 2V5BA 3N73A 2WZHA 1X96A 4JHZA 4WGXA 1ICSA 3BQ5A 4N6EA 1QW9A 2Y61A 4UQBA 4U4MA 1TE1A 2AQVA 2ODOA 5GNXA 1TV8A 4YTRA 1U1HA 2V5CA 1W2VA 5CC7A 3BLDA 3NPUA 4YWIA 2HV5A 1IXQA 3KBJA 4HOXA 1CXHA 1CBGA 4NZ4A 3QC3A 4Z2LA 4FB7A 1UPMB 1SW7A 2BY1A 3GHUA 1ZP4A 1RVGA 3GFYA 3T78A 2CWXA 1ZBVA 3WK0A 4KKXA 1T99A 3CM4A 2IKGA 1XHGA 3IARA 2XVKA 1J10A 4FSAA 1B2YA 4BWLC 1AH3A 1UR0A 1GKQA 2RDWA 3WUBA 4PUJA 4Z17A 2WKJA 3CTTA 5LHEA 4ZOCA 3LCIA 4O1DA 2A3HA 3MQTA 4JTGA 3TV8A 3RRXA 1S38A 3S1XA 4M29A 3WNKA 1V03A 2V5KA 1JAKA 4O13A 4RDVA 1TQJA 2X30A 2Y7FA 4YL2A 1K4HA 2BASA 3RIKA 5KITA 5A6KA 1B3YA 1G4TA 4XZIA 3T0TA 5TF0A 1V