4D9PA

Crystal structure of b. anthracis dhps with compound 17
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
273
structure length
264
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate Synthase
publication title Structure-Based Design of Novel Pyrimido[4,5-c]pyridazine Derivatives as Dihydropteroate Synthase Inhibitors with Increased Affinity.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 264
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4d9pA00
1TWSA 4CCZA 3NOYA 3H2FA 1Q8JA 4MWAA 4S3FA 4DB7A 1F6YA 1TX0A 4DJDD 1TX2A 2DZAA 3K13A 4S38A 3BOLA 2H9AA 1AJ2A 3H22A 2DZBA 3MCOA 4DJED 1Q8AA 4O1EA 4S3BA 3TYZA 4S39A 4D8ZA 3TYDA 2YCLB 1AJ0A 1TWWA 4C1NB 4D9PA 2OGYA 3H2EA 3TZNA 1EYEA 3H24A 3BOFA 3H2MA 3V5OA 4MWAE 3H2AA 2YCIX 4DAIA 2Y5JA 4MWAD 3H2OA 3TYAA 2YCKX 2Y5SA 1AD1A 1TWZA 4DJFC 1AD4A 4DJFA 1Q85A 4MWAB 1AJZA 3TYBA 4NHVA 4NILA 3TZFA 2DQWA 1Q7QA 3H26A 3TYEA 3H23A 3TYUA 4DJDA 2YCLA 2H9AB 3H21A 4PZVA 1Q7MA 4O1FA 4C1NA 4G9PA 1Q7ZA 2E7FA 4S3DA 4DJEC 2BMBA 4D8AA 2YCJA 4O0QA 4DJEA 4NL1A 4NIRA 2VEFA 3H2CA 4HB7A 3MCNA 3H2NA 4S23A 4S3EA 3TYCA 4DJDC 4S3AA 2VP8A 3MCMA 2Y0FA 4DAFA 5JQ9A 4S3CA 4DJFD 2VEGA 4MWAC 3TR9A
chains in the Genus database with same CATH superfamily
2DT1A 3DUGA 4IFKA 3OEXA 4CNSA 4M19A 3NR0A 1HKWA 1BTCA 1OX5A 2YCEA 3C86A 3W07A 2XGIA 2R8WA 4XX6A 5D05A 3R0KA 1RP9A 1TWIA 1VC4A 3HURA 3G1FA 4S3BA 2DIJA 1KKOA 1RR2A 3STGA 3VKBA 1CXFA 1OD0A 4F3HA 4JHOA 2NXGA 4A3HA 2XYLA 5A6AA 1OFDA 2Z1VA 2OQLA 4RNFA 4KETA 4CGTA 5A6LA 3C56A 2JEQA 3AXMA 4J7RA 4PRWA 1KFCA 4LYKA 1O68A 2WNWA 1TMQA 5FJJA 3UXLA 5DRIA 1C7TA 4KEVA 1M1BA 2W0UA 3H70A 3WF2A 1UBPC 5CEWA 2XVGA 2EPMX 3PPCA 3WH5A 2BOEX 1Q7QA 3PPFA 1Q6QA 3P62A 4RV8A 4QXIA 3KWSA 2VCCA 1LWJA 3UD6A 3HMJG 1IT7A 1XBZA 3IS4A 1FVPA 1CGTA 3K8KA 3O07A 3VOHA 2ACUA 2ON3A 4GUGA 1E6RA 1QHZA 4JYEA 3DXIA 1TV2A 1KM0A 4UTFA 3F5JA 2BY2A 2VP8A 4MFDA 4HZ8A 1JF5A 3VCNA 2ZUUA 2YFOA 1SMDA 1JD7A 1QDSA 3IVUA 4JIPA 3WQWA 2BG5A 7ENLA 3OQEA 4HZ7A 1TRIA 4PB4A 4QNEA 3SCSA 4H6RA 3QR0A 3R2GA 2PDPA 2XIOA 2OX4A 4DUVA 3BPWA 4LAUA 1EYEA 5I5RA 4JTCA 4XUGA 1UH4A 4KCWA 1NF0A 4LF2A 4R7WA 2A7PA 2VHLA 2FTYA 3N11A 4ZVJA 1P5BA 4I8YA 4R53A 4JN8A 1TZ9A 4YCPA 5D9PA 3VFCA 4A8IA 1VEOA 3WQOA 2A1YA 2VDIA 4O1AA 4H7CA 3SURA 4PMXA 1ZU8A 4A8NA 2D1ZA 4BQ5A 3QMTA 3BANA 5I79A 4LW7A 2PPGA 1KM3A 1I4NA 4K7VA 1ZRQA 3PG9A 4UTTA 1WQ5A 1VB9A 2F84A 3ZT7A 3LCGA 3C52A 1H11A 4GI8A 1DXEA 3CMFA 1FWHC 4YPJA 3LB0A 1VFFA 1M53A 3OLIA 1US0A 2DQXA 3I6TA 4CLMA 1G9HA 2A3BA 2OSYA 1LG1A 3N9KA 4NAEB 4KGLA 2HROA 1H7WA 4E8CA 1EHAA 4AIOA 1TFVA 4HNUA 4W9TA 3WD4A 1GVFA 4ORMA 1BG4A 3HJEA 3S42A 4DNMA 4LV4A 3T4CA 2C71A 2GUYA 3ARWA 3BOLA 3WUFA 3R79A 2Y7FA 3RLHA 4GQQA 4GVGA 4GACA 1I75A 5C0QA 5D2WA 3F4CA 4RCXA 3AC0A 5MKGB 6CGTA 4I9JA 4HMCA 4YVPA 4KKXA 3CHFA 4NNBA 4QQ3A 1UKTA 3GR8A 3CTLA 4MY1A 4ORIA 1WZAA 3ARPA 5FAJA 3ELFA 4OV9A 1UCWA 2J66A 1ODUA 1OGGA 1XYZA 1Q85A 4A21A 3CPRA 3ABRA 4IGMA 3CXOA 3QTPA 2QYGA 3N1AA 3DKLA 4PUUA 1EC8A 5CAKA 5BOEA 1P0NA 2PF0A 4XO7A 4PULA 1KCKA 3BJTA 2GVGA 3DESA 2J27A 1CLKA 4MSSA 1N8IA 3GVRA 3WCZA 2AMXA 1I1XA 3T78A 2FB2A 4DY1A 1LRQA 3C0QA 3G3MA 2D0FA 4RDWA 4Y8EA 4MWAC 2R1LA 5I78A 1EHNA 3GXFA 4XZHA 1O7AA 4ACYA 3KCLA 4H1ZA 5HNNA 1J6PA 1I1WA 3D5HA 1B3XA 4O1BA 1JQVA 2P8BA 1W9DM 4UMAA 2V2HA 3NQ6A 3FVMA 3I3BA 4PYSA 9XIAA 4LYQA 5BCAA 1Z9AA 2BASA 4KCUA 3UCDA 1D9EA 3KDNA 2VC9A 2FIQA 1CCWB 3V5OA 5T26A 2YKKA 5LNUA 2DUXA 3TCEA 4QNWA 1H49A 3DC8A 4LVAA 2C18A 5EB8A 5G1MA 1DXFA 4PE8A 4C6NA 1AD4A 3A4XA 3TIMA 4HMNA 2OLAA 1XIEA 4B15A 4LQ1A 1CI1A 3LX9A 3RITA 2BHZA 1OC5A 4X9YA 2Z6JA 1B30A 2DJXA 3MP3A 3M41A 1OFEA 3GHTA 3PZ9A 3LD5A 3NO5A 1XIFA 2WBKA 4G9PA 1RZMA 3FSUA 2ZC8A 3CPUA 5HQLA 1TQJA 1RY0A 4FNQA 2DJLA 1PVNA 2E6FA 4H9XA 3FDKA 2E6DA 3WNOA 3UXKA 1YPIA 4DZHA 2VZSA 5H1WA 2BB0A 3L7RA 1DJHA 2CZDA 2YPIA 3MZNA 3M7WA 5AYIA 5F2MA 1Y7VA 4ZODA 3UJFA 5PTDA 2V5BA 4NVTA 3H2FA 3W29A 1LLZA 1HXJA 3WEMA 1OCBA 1D8CA 3IJLA 1O66A 1QAPA 2QCCA 1LCOA 3S9ZA 1DHKA 2VX5A 2Y7DA 2BTMA 2G37A 5DFAA 3EXTA 3UZ5A 4S38A 4CKQA 1PZ0A 4US6A 4QS5A 1KLYA 1W3KA 4LVBA 3N3TA 4WR3A 3GVQA 1N7KA 3V1PA 4E4UA 1EX1A 3P8IA 1JAKA 5A6SA 3E0FA 4ZTXA 1U22A 1VFHA 3GIQA 1MNZA 2WCAA 4NAEA 3QLDA 5CC3A 1RBOB 1XFCA 1C9DA 3A22A 2VRQA 4CD6A 3DFNA 1XS2A 1ZP4A 3O0KA 4LUYA 5I3IA 1SW3A 1OB0A 4CN4A 3TNOA 3DHUA 1JNDA 5EBAA 1OGBA 1A5NC 2PLMA 1OM0A 2G95A 1PX4A 3PB2A 1TQXA 4H6QA 3MS8A 5HATA 3W86A 1SZNA 1JD9A 4PSPA 2XH0A 1LT8A 4JCLA 1E70M 5MKGA 3LXAA 1KBKA 2CITA 1T7LA 5LNVA 3SDOA 4MKVA 4N4PA 2WPGA 1X97A 2EF9A 2FJUB 4JN6A 1HL8A 5K9XA 3NQCA 2DP3A 3MPGA 1YBQB 1A3HA 1K03A 1TIMA 3VNJA 4R9OA 2PI6A 5A6JA 2FGBA 1W0MA 3OTRA 4ERGA 1TA3B 1XPGA 2R9RA 1R9YA 3LBOA 1J01A 3EEGA 2PWDA 1A5MC 2PDYA 3FYYA 4AISA 1VP5A 3SJ3A 1PO9A 3EPOA 2GOUA 2WVVB 1CTNA 1OFAA 3ONCA 1OABA 1XCWA 3LCLA 2WHLA 1X98A 3CGTA 4KWVA 1X39A 4KWOA 1UKOA 2CLOA 2E0PA 1BVZA 4E2BA 2A2IA 3WH8A 1D3HA 4IICA 3UJEA 3SGGA 3JS3A 3F5KA 3GUGA 1YDVA 1NDYA 4C6DA 3PZUA 4KFNA 3QSTA 2E6YA 4WD0A 1H5YA 2DDXA 4IIFA 4PL1A 2E8YA 1IXOA 4ZXOA 1ZHAA 2WC7A 4DBWA 3M6DA 2GFTA 5T8GA 4HHPA 4UFLA 1RQBA 3BV4A 2IPGA 2OWCA 1H5VA 2O7QA 2XM2A 5RUBA 5E93A 4H4IA 1HW6A 3UW6A 3WK0A 3OVRA 1KFLA 4IPJA 2ZX5A 1XHGA 4HU0A 1W2VA 1GZGA 2Z1KA 3BQ6A 5FA5A 1HKMA 2PWGA 5F7UA 4NF7A 1J0HA 1ZS2A 4GYFA 3E1F1 1P6CA 4JX6A 1X8CA 4DN1A 4W87A 2Y8VA 3R0UA 4HTYA 4B2DA 1XV8A 4JFTA 3B8WA 4L1XA 1KWGA 2CERA 2X7WA 3IJ6A 3CZKA 1VAHA 3IUIA 3AHVA 1SQ7A 1OC6A 1RJRA 1P6BA 5FAGA 4S3JA 5LXXA 3TMQA 3O6CA 4EPEC 3O1NA 3GXNA 4KWWA 4PMDA 2GJXB 1R86A 3LOTA 3G0SA 3WJSA 4C5YA 3LZ5A 1NSJA 3GO2A 1IWAA 4QRNA 4IIDA 3AICA 3QV7A 1DJNA 4IQJA 3I3DA 4OECA 4A2RA 1WZMA 3QGKC 2XSBA 3A9IA 3W7PA 5H91A 3ZWSA 2ZRZA 4Y9PA 3PPGA 1Z89A 3HFTA 2BY1A 3DI0A 1UHVA 1J5TA 4LC8A 2BVYA 3KE0A 1F8IA 2WMIB 1GOQA 2I5IA 2ZRYA 1XM3A 3MT1A 4RNIA 4WKAA 1CGWA 5GNYA 5LYRA 1TTQA 4BK9A 3LY0A 1OEPA 2OVLA 4H6KA 3BK0A 2XFYA 4DJDC 1EWDA 3VIFA 1S3TC 3GU1A 4GFIA 3HBLA 3WELA 3TSBA 3R43A 2GGJA 2WHKA 4ZFCA 1UWIA 4WK9A 5HANA 1TTIA 2ZA2A 3SUVA 5HJLA 1UD5A 1M04A 1AUSL 1W9VA 4AZHA 4IQDA 3IUHA 4TMBA 4UB9A 3TAOA 2EPKX 3GU2A 2J78A 5HWNA 1MSSA 4J35A 4XQ6A 5H8UA 2INFA 2XIBA 1HKIA 1M7XA 2PDKA 1ZBVA 4CUCA 2CETA 2PGFA 4HCLA 4RZ6A 4AHPA 3W1QA 1CX9A 3AU2A 5I3DA 2XN1A 5D8ZA 3W7CA 3KVLA 3NJ3A 1YBQA 1ZUAX 3YPIA 3FAWA 3W1LA 2Q02A 1TA3A 3VK5A 4UR8A 4WY0B 4MWAD 1K7XA 4LUIA 2QCNA 3BZGA 2V67A 3ZVIA 3S1GA 3M7SA 3WLPA 2VFEA 2WVVA 4ZOCA 3TN3A 4B4HA 5JIPA 4O16A 2WM1A 3OZOA 3E2SA 4NNAA 4I5RA 1AQ0A 2V69A 5D09A 1CXHA 1W5QA 1E6QM 4AX7A 3GHUA 3A64A 3GTXA 3P5ZA 3KOXA 3LBMA 4TTUA 1IIGA 3QTGA 3V18A 1Q7ZA 1G01A 3VD7A 3UR2A 4ZOAA 3MP4A 3AJ7A 3KW3A 4EKJA 2ZYFA 4HPJA 5HOSA 2NV9A 1AZ2A 3TTOA 1W32A 1DQUA 3GRIA 4AMAA 2X30A 1UMYA 4HHLA 3CV1A 3I65A 3NOYA 4JIIX 5EGRA 3FA5A 3THUA 4GJJA 4AD2A 1AQFA 2CBVA 3ES8A 4O1EA 3EDKA 3SN0A 1JDCA 2GSHA 4KWUA 1UUOA 1PB0A 4GZIA 2QCFA 3H4GA 2WJZA 5FJIA 1XISA 2Y7EA 1GZ1A 4QX4A 1U5HA 1ZJBA 5CKSA 4H9MA 1LQAA 2PODA 1UA3A 2XUCA 2VVSA 3KUMA 5D37A 1HJVA 4MOZA 4QG9A 3LTSA 4OQVA 4M56A 4Q8UA 1HX0A 1FOBA 3B3DA 3TYBA 4FXJA 4P8WA 1E9IA 2B4GA 3PS7A 1XRVA 3USZA 1R3VA 2X2GA 4O19A 3BSGA 3A4WA 1W5PA 3IIVA 1Q4WA 1DV7A 3QY7A 2GJXA 2V81A 3HGSA 3RUBL 4ZCWA 3VA8A 5EMKA 1LDCA 4XZLX 3DHFA 1VPXA 1NU5A 3EYPA 2BVDA 1OK4A 3QEZA 2DV0A 2NX3A 2ZTJA 4ZQNA 1EBGA 2A3CA 4J3SA 1RA0A 3N2XA 1F8MA 3NZRA 4E3VA 1Y65A 3ZLGA 2PDNA 3QKEA 1VR6A 2FMNA 4YYCA 1WOAA 2Z6IA 4ZENA 2WMIA 3L4XA 3QFWA 4IF2A 3LHUA 3CUFA 1OY0A 3CUIA 4NZ4A 1B2YA 2FTWA 1J2BA 4Q4QA 2Y7GA 4UXDA 3GXPA 1VJZA 1FWTA 1UKPA 2INEA 1X7FA 2A85A 3W7MA 1XXXA 3GXIA 1QBAA 2O56A 4OBTA 1REQB 5C7VA 5HWMA 1KBIA 4RX0A 1VPQA 5AFDA 2IW0A 3L5MA 3WBWA 4JKLA 4L1WA 1FX6A 1EFZA 2OSXA 3PUEA 3BO9A 2DU2A 1XFBA 2PWHA 4CN6A 4DX3A 3MANA 2VT0A 3CL7A 3TC3A 1QK2A 3V4BA 2ZWYA 3TOYA 5G4WA 3RK8A 5LNSA 2NQ9A 1LROA 1UD4A 4JX4A 1TPUA 4WY0A 3TW7A 3NQ2A 3CHDA 2MANA 2GQ9A 4ATDA 3P14A 3SCRA 4DXVA 5FIPA 5FF0A 3ITTA 2G3MA 3CMJA 2DSUA 2XZ9A 4D1IA 5KZMA 1LYXA 2WXDM 3PTMA 4U5IA 1ZJAA 3HU7A 4HOXA 4B5XA 2WQPA 3QKZA 3WLQA 2UV8G 1ODZA 1WZKA 1FWEC 1H0IA 2WLYA 3BMXA 2Z26A 2W27A 4GI6A 5CPMA 4GIRA 4X22A 3IIPA 1YDOA 3EDJA 2QMKA 4P8VA 3HOJA 4CN1A 3FKKA 3E0IA 3TZNA 4G8TA 2Q3RA 5BXRA 2WW5A 4R7OA 1QW9A 2ISFA 5I6SA 3N18A 1CXLA 4Z42C 2C16A 4PMZA 1E5NA 3SY8A 3ABQA 1FWSA 2B7NA 3PUGA 3WQEA 1VHCA 5A2BA 2QAPA 3PWGA 4IUOA 3UZYA 4CD7A 2PA6A 4HK7A 4QEEA 3W53A 2X0SA 1QW8A 3W7HA 1M65A 2ZXBA 5GJNA 5MF5A 3SUTA 3LHTA 1XJBA 1GW1A 3RX3A 3W7QA 1TSIA 1V02E 3GIPA 5C70A 3DFSA 1KWKA 3RR4A 3FIGA 2PDFA 4G56A 4UTTC 1E72M 6XIMA 1OWQA 3T2OA 4DUWA 3M43A 3N2OA 1B9ZA 4W85A 2Y24A 4LVGA 4NU7A 1GWJA 3VNKA 2WMHA 1RD6A 3OHIA 1QHPA 5HR6A 1FQ0A 3LHYA 1LBFA 4MUZA 4PTDA 2X0HA 2NZLA 3FV9A 1TJ2A 2X1SA 1WDPA 4GVFA 5CBBA 1IHIA 5LA2A 1Z3NA 3DDMA 4LXFA 4AZ7A 4GD0A 1DL3A 2FGLA 1I0BA 5F4SA 1DJIA 2YB1A 4GI9A 1W1PA 2PDHA 7A3HA 1FWWA 4JTUA 4L64A 3WBXA 3S2LA 2IQ0A 3S2NA 1V0KA 3FJ4A 4GX8A 1J5SA 3OYXA 4ECLA 1WDWA 4MWAE 3EXSA 4AZCB 4EIVA 3HTWA 3DH7A 1DTUA 1UD3A 3TC7A 2B31A 1AD1A 3LGEA 1HKKA 3NQGA 4F66A 3TEVA 4UTWA 2C1IA 2ALDA 1JYVA 2E28A 2G50A 3NDZA 2BFGA 3VD4A 3W7DA 1C29A 4PEEA 1ITCA 5JH1A 2VX6A 2H9AB 3KWXA 4MZ8A 5A1AA 1I45A 2OWWA 2PDJA 3C2FA 4PUMA 1OVDA 1K9DA 4RE4A 4KFPA 5CC6A 2QW5A 4PEKA 1E56A 3L4WA 3TNBA 2FFCA 2QDGA 3M0HA 4O12A 5CPOA 1NOWA 3ENLA 5D32A 1GHRA 3WY1A 2HEJA 1REQA 3R12A 3B9EA 5D30A 4C6PA 1L6FA 3C3UA 2BP1A 5AECA 3EWCA 4IP4A 1FWIC 4GO8A 3TJXA 1QI0A 4LX4A 1YTEA 2AAMA 1QATA 2J7HA 3GTHA 2J9XA 1QBBA 1A50A 4GQGA 1Q8AA 3EPMA 4QEHA 3B40A 2O9PA 1O12A 4XO6A 1VEMA 1TJRA 3HQNA 1MZRA 4I5XA 3ZYZA 4NG3A 4RZBA 1EH9A 2V3EA 3SIZA 2YB4A 3S5NA 2JFEX 4IJCA 1F3WA 4ICCX 1R7AA 3FGCB 5D2YA 4ZQCA 2WMJA 3OLEA 1TWZA 1Z44A 1K77A 1UC4A 3GLCA 4GC3A 1JUKA 3CBWA 3S1VA 4FHAA 4MDOA 1H7NA 4QE1A 1R5YA 1C8QA 3VX1A 2O9OA 3GFYA 3H23A 3UEQA 2XZ7A 2IXVA 5DBUA 5CPNA 2G96A 2OODA 1SFSA 1OF6A 1I2NA 1AA1B 4RDYA 1LQ0A 2X42A 4X63A 3TROA 1W3LA 1S46A 3BURA 2WQDA 1VCVA 1TVLA 3B0XA 2QJGA 2JKAA 3CIXA 2UY3A 1XKYA 4XBJA 1YE4A 1EUAA 3NXLA 3L4ZA 2D2GA 1R3QA 4NP7A 3SZ8A 4BEQA 3S83A 1UD8A 1W37A 1FKXA 5DY3A 4DWSC 2ZUMA 1YDYA 4BKNA 1K9EA 4JL1A 5FF3A 1BF6A 1AJ2A 3W71A 1Q13A 3VGHA 2YDQA 1L6WA 5CXPA 4N9DA 2WWCA 3RM9A 1SZEA 4AEOA 2J7CA 2OGYA 2UY5A 2YBTA 3CAQA 1OYAA 2CLEA 3HPZA 4FSAA 2QIWA 3T09A 2ZWZA 5D2TA 1JGMA 4AF0B 4QDPA 1OX4B 4URIA 3TXZA 2ZTKA 4AD3A 1QMLA 3C2VA 3G6LA 5TF0A 1LBLA 1ZALA 3BH4A 2VOMA 1JFXA 1ECQA 1FHVA 4IQLA 3GTIA 3OGVA 1DWIM 4GY7A 4NXKA 2VEMA 3QN3A 4NHVA 3AFBA 3ZQ9A 1KXTA 1TE6A 2FPYA 3PZOA 4LSBA 4JDBA 1QPRA 4BWLA 1NAL1 2FDMA 3AYVA 4H3DA 3MCNA 3GVWA 3A9BA 4AZCA 4Q8VA 2XTKA 3GDMA 1FDJA 3TMLA 1SFLA 1OFPA 3MVTA 1KGXA 2WZTA 3AUJA 3PTQA 5GVJA 1VENA 4UUIA 4PCTA 4LAZA 2H8ZA 1Z48A 1ZY9A 1RXOB 2VRJA 4B91A 1FXQA 2GSJA 2XJ7A 2H9AA 2QQ6A 3MCOA 4LVFA 3MJYA 1GKRA 5IOBA 1I8JA 3T1GA 4WRHA 3CH0A 3PPHA 4PRRA 1CGYA 2W6RA 3WLTA 2DVXA 1ZQ5A 3AS2A 5J5RA 1FH7A 1EB3A 3R7MA 3RRXA 4FNTA 1DIOA 3IGUA 2R1NA 2YFNA 2PAJA 3WMSA 1QNPA 4NJHA 5TD4A 3A5VA 3TU9A 3IWPA 1KRAC 3M46A 3IIZA 1F61A 4YWSA 5GQBA 2CXEA 2PE4A 1JCLA 1NOFA 4K8EA 3SCQA 1S1RA 3OLDA 1QPOA 1KM6A 3CJPA 4QR6A 4FLQA 1GPFA 1HIZA 1WAUA 3FGCA 1FWGC 4TXEA 2GGEA 1S5TA 3O6YX 3B9AA 4LWWA 1D7KA 3VIGA 1F3TA 3NQEA 2INZA 4H9UA 2W5FA 3IGXA 4AIUA 3UYCA 3R5EA 2KAUC 4Y9NA 4ZQRA 3OVGA 4J2PA 3RILA 4PUKA 5A95A 3LS9A 3GDKA 4AD4A 4J4KA 1F05A 5BOOA 4IPPA 3SQLA 3KL0A 4RK8A 2CHNA 5C6MA 4PCPA 5H6HA 5AB3A 1SFJA 1FDZA 3STEA 1LOQA 4JQ4A 4G2DA 1GEQA 1ZJHA 5CH9A 2P50A 1VYSX 3KRSA 1CDGA 7PTDA 3NL6A 4AHOA 4JPGA 4JFWA 4UFJA 2CBIA 3C2EA 2QGHA 3IJQA 2Y5JA 4XSLA 2PDLA 4EWND 3W2NA 4DZAA 3W7RA 1G69A 5LGZA 2G4FA 4GINA 3TWAA 1PTAA 3LYEA 3BWWA 2TAAA 3GG8A 2XVNA 3ARRA 3P0WA 4UR9A 2D3LA 3SFKA 1Q6GA 3B03A 3FYPA 4Q8MA 4BQ2A 4Z1DA 3KL3A 1UWTA 3O7UA 1Q7MA 1Q2RA 1SU5A 2ZX7A 1FCVA 4JD4A 1MFUA 3FNDA 3DFPA 4HIBA 2NVAA 4ZB0A 3QR3A 4DHGA 1NY1A 3DHPA 4DBDA 1RAKA 1H1ZA 3QGVA 4HA3A 3G1AA 4DQWA 4AF0A 1OX4A 2ANUA 2WM0A 2BGSA 2QZRA 3MCMA 3TKFA 5DT7A 5FKYA 4PUEA 1E6ZA 3GG1A 1L2UA 2FB3A 5K3VA 1TELA 4C6OA 2NQHA 1WUFA 2O9TA 1TZ7A 3UGRA 3VZXA 1Q3NA 1JZ5A 5E1QA 4IMCA 1OADA 1L8NA 4UOZA 2X1IA 4M51A 5D38A 2F6UA 2OKTA 3W6LA 2GDQA 2E25A 2Y61A 1Z69A 2XVLA 2J8FA 3Q94A 1A5BA 1KB3A 1E0XA 3ZS4A 2OEKA 4CQ9A 3NQMA 3NQ7A 1SMAA 3HPXA 2VD9A 4V1XA 3S6DA 5E5CA 3WDRA 4C6BA 3EPNA 3VKAA 4CQ8A 4W93A 1TREA 1GYNA 4HNTA 4E0CA 1UD6A 2Y2WA 4PH6A 1UC5A 5KZEA 3VABA 2ABBA 3W9ZA 4YTQA 3H6OA 2A79A 2ZRXA 2QEZA 3WIJA 4XVDA 5T9BG 4DYJA 2PRLA 1Q45A 1SO5A 3DZ1A 5E0CA 1O4UA 3OPSA 4MB5A 2H8XA 2ACRA 3P60A 4GJIA 4O1CA 4NXSA 5B80A 3P82A 4ZXLA 1KFWA 3U7VA 4H9TA 3QPEA 1RLCL 3W22A 3VGEA 4UTIA 1KXHA 2ISWA 4ILSA 4KWSA 3W1MA 4D6HA 2BNJA 3N2MA 4UCFA 3LNPA 3QHMA 3ZLHA 4JQ2A 3HM7A 3QYQA 4GWEA 1LL7A 4R34A 3CTTA 3UGVA 3VKKA 4KQNA 1JCTA 4A4AA 4Q7BA 3K1DA 5EFFA 4NSBA 5BU9A 1BYCA 2G3NA 2QUTA 3UQNA 1W3JA 1LF1A 3UXAA 3FFSA 5KSWA 4HN4A 3IACA 2ZDSA 3HFYA 5F1UA 1V0LA 2HSAA 4C7GA 4DWSD 4B5VA 2DW7A 3GY1A 1E51A 3LU2A 1WB0A 3LGDA 4MPQA 1ME7A 1VRXA 3L0NA 4GZJA 3W82A 3N9RA 1J0YA 2YJQA 4FK9A 3QQ1A 1GVRA 2D73A 4YMZA 3ABSA 5C71A 4ROQA 4JFUA 1W8GA 7TIMA 5KEZA 3HIJA 1KTCA 2RH9A 1KA9F 1VQTA 3BG5A 3LEPA 4AB4A 4KERA 5DCBA 3BJFA 4GY0A 2VXNA 2VOTA 1IE7C 4M81A 2HE5A 1ZJIA 8RUCA 1E9YB 1CLXA 1U2YA 2WNQA 4P8XA 5KZDA 2PTXA 5AVHA 1V6UA 3ORWA 4Q8WA 3GWQA 2GJPA 1LJYA 4WJ8A 3L5LA 2WV8A 7TAAA 4QHRA 5A8NA 1CWYA 4ADSA 3UR8A 3DECA 4AYSA 4QJ5B 1UR0A 3W6YA 1YQ2A 1GOWA 2DSZA 4MZ1A 3WQ5A 1WAWA 1XL9A 2W61A 2Z7GA 3KLLA 3WZ0E 4W84A 3RG6A 3TLQA 1TV4A 3MP5A 4YTSA 3K8MA 4AAJA 4HNVA 3PUOA 2X09A 3JW7A 3RX2A 2CCRA 1F3EA 3U9IA 1UBSA 1XIIA 2PF8A 3MUCA 3S9YA 2WAGA 3VNDA 1PYMA 3IJ7A 3VMPA 3CUXA 1OHLA 4JDYA 3WUBA 3DIPA 4QCEA 4L61A 2XFWA 3DKJA 4P7NA 1R2RA 2YA0A 1V93A 4UFKA 4BHYA 5EMLA 2MUCA 3CMGA 4DAFA 2PWFA 2B81A 3LV5A 3LCIA 3T0DA 3M6YA 4HPNA 3KZSA 2G5WA 4YJ5A 3RO8A 1JPIA 2YL6A 1BXBA 3CV7A 3FY1A 2YLLA 3VIJA 1V6VA 2A3LA 2VR5A 3CT2A 1JFHA 1JPHA 3N17A 4OT7A 4ROPA 4GQ0A 2OTDA 4XD6A 4DYKA 3L4UA 3MUXA 4ZGYA 4QLJA 2EJ1A 4HYRA 4J5NA 3OZYA 2YR1A 2A3HA 4YWIA 4US5A 1OZMA 4A8RA 2CLHA 3M9YA 2Z25A 1JYXA 3BUVA 1YTKA 2HBXA 2I56A 4JTLA 5CSUA 3DG7A 3MKKA 3WMBA 2WC3A 3PBUA 5EFDA 4YVXA 1AQMA 4O14A 4B2DD 4GYKA 3IRDA 3ZR6A 1NP2A 3VC5A 2VKZG 3VGGA 5HPOA 3B0UX 4K2SA 4Z08A 4JKMA 4D8AA 1WXZA 2P5NA 2NQ5A 3BQ5A 4NL1A 3T44A 1W17A 1H60A 8A3HA 2VELA 4PTMA 1R9ZA 4Q6XA 3IJIA 4ASTA 3VD5A 1DKWA 1MNSA 3GNDA 2Z1SA 1F3XA 3SRFA 3DYPA 4ALDA 3ARTA 3QZEA 3O05A 4NUWA 5HMDA 3PJUA 4QG8A 4FAMA 1IZJA 3AYRA 2OZ3A 2YXOA 5A8PA 5CPSA 5AN7A 3QOMA 5G1YA 2C1GA 3VCCA 3E0WA 3GU9A 1LOSA 3GZAA 3TDFA 1EC7A 4AXNA 5LIYX 4BQ4A 4C6IA 5XINA 5AHNA 4WJXA 3K1GA 2OWXA 3D47A 1U5JA 3VO0A 4DXXA 3EB3A 5CBIA 4ZZ9A 5FF2A 1BXCA 4O52A 2BGQA 3LHZA 4E5TA 3OG2A 3W72A 1TV5A 5B7YA 1UWSA 3MSGA 1DJYA 4B9ZA 3O16A 3RCNA 2PDXA 5G2HA 4QGCA 3T0TA 1EDGA 1KC7A 2NVCA 5A94A 4L6OA 2C1HA 5EMMA 4MLJA 4O13A 3EWZA 1OGSA 2W79A 1XGDA 3CYJA 5FSDC 3E2QA 3HF3A 3GM8A 2NX9A 1MWOA 3IAQA 3VZZA 3S9IA 4NQ1A 1W5OA 3EWUA 3AHXA 4TV5A 1DQXA 3VIOA 2RJGA 1OYCA 2E7FA 2EPLX 5G5IA 5AOUA 3H12A 4WXYA 1GT8A 4KF1A 4D6EA 4ZQOA 2QUMA 3MYOA 4IPIA 3WKZA 1XRFA 3U2OA 1XX1A 2OG9A 2V68A 3K46A 4PBGA 3EOUA 3KOZA 2FMOA 1KR0A 1UR2A 3BLFA 2I5GA 3Q58A 3NQAA 4J27A 4O17A 4J3TA 4AHQA 1UZ4A 3KBNA 3ZO9A 3U2EA 3C2OA 1TIWA 5LSMA 3PZTA 4IIBA 2C7FA 4JEQA 2BVWA 2FZMA 2OO6A 5BMWA 1LLOA 2FTPA 1TB3A 2XN2A 3G1XA 1JJKA 2UZ9A 4PMNA 3WK1A 1KFKA 2QDDA 3BG3A 2E40A 1JDAA 4D2JA 1E4IA 2HV5A 3MV01 2V2DA 2FPTA 3K4WA 3GXDA 3WENA 3IV8A 1K8CA 4DJFA 1O6IA 3R1ZA 1TPFA 5FI8A 3KHDA 1Q6LA 2D69A 1E73M 1S1PA 3BLEA 5K9CA 4PA8A 1MQQA 3RPTA 1KM4A 5DXYA 1YHTA 1TO3A 3CWNA 3WD2A 1C7SA 5HPCA 4FLRA 1U1UA 2ZVIA 4WLCA 4GQRA 3W1UA 1GOMA 1HN1A 1C92A 1P48A 5AC8A 3JZEA 2HWGA 1XYLA 5D9NA 4QP0A 1OCJA 3TTEA 3VOJA 3C0LA 4KCTA 1PSCA 4HU3A 1CPUA 4FO4A 5EBUA 2VGIA 1XG4A 2PBGA 1F74A 3LLFA 4OE7A 2RHGA 2GSEA 4L4MA 4DIAA 3GD6A 2ZX6A 2XSXA 4K3ZA 1O5QA 1MRQA 4IX2A 4MNLA 3QJAA 4O50A 2Q01A 1W2PA 4AQLA 1G4TA 1H1NA 1G4PA 4O28A 5C7HA 1R87A 3WBAA 3OOQA 1GQJA 3W2UA 1UR4A 3LV6A 2A3EA 2TMDA 1WPCA 3EZ4A 3RNDA 1NTHA 1G5AA 4X60A 3U57A 4JTHA 3CO4A 3KEHA 4NILA 4LS1A 4P8UA 1PIIA 4LPCA 1YPFA 3M5ZA 5JH2A 4MVAA 2CU0A 1WKDA 1HQTA 3VDAA 4O54A 4UNKA 2XDFA 2XH4A 3VE9A 4HA4A 1ICSA 1KBJA 3I4KA 3SI9A 3LCFA 3A5FA 2ZUNA 1XLHA 3MUAA 3WLLA 4AD1A 2J9ZA 4NX5A 4HN8A 1TMHA 4I3GA 4BWLC 4B5SA 1JCMP 1A5KC 3WH7A 2XWEA 4Q8NA 2EPNA 2X2YA 4J3ZA 4OHQA 3AMDA 3V3WA 3B8TA 2L5HA 1EJTC 3S1XA 1RPKA 1GG0A 4QLKA 4NX0A 2OOFA 4RDZA 4XZIA 5KITA 3EWBX 5CCZA 3D3AA 2PC4A 3FJ6A 1DJZA 2WHJA 3OIHA 1EL3A 4WHBA 4JN7A 1XRSA 4MY8A 3CQ0A 4J1OA 2AGTA 1UWUA 1PKNA 3UJ2A 4XIAA 3TYAA 1RY8A 4ICNA 3CZLA 4KRZA 1A0EA 1CXIA 5A8MA 3MB9A 3G1VA 1A80A 3PULA 3QC0A 2A6LA 2BY0A 2PFHA 4L9ZA 1RJQA 3SSJA 3U2CA 1QVBA 2OT1A 3M44A 2WMFA 3G2GA 3DHDA 4U3AA 4S3DA 1KFEA 2E8ZA 3RXZA 2ZUWA 1QWGA 2YOCA 1BF2A 3VPLA 1IEVA 3AWNA 5HK4A 1R30A 3NIYA 2JKEA 4MNJA 4N02A 1PV8A 1P43A 4AZGA 2R94A 4J3UA 1RK6A 3UESA 1TV8A 3SM0A 4WJEA 3PBMA 2VYOA 2J13A 4LVDA 2XH2A 5DXXA 3DC0A 1TX0A 3OHMB 3NL5A 4F2UA 4H7ZA 1XIHA 1JRBA 4V27A 4CD8A 2OT0A 2UBPC 4XB3A 1WO2A 2PTWA 1FP8A 4MJMA 1Q6DA 5A6MA 3FCPA 1H62A 4DM1A 1B3OA 4IP7A 4J3XA 4N2YA 3CEUA 3H2EA 1UP0A 3AQUA 4GZ7A 5ECUA 2QGYA 5FJRA 3FHQA 4CD5A 1V3JA 1TTPA 4JFSA 4YIWA 4GIEA 2XGBA 1DJGA 1XH0A 2D23A 1Y8BA 4EK7A 1XLJA 5JBDA 3R6IA 1N55A 4N42A 2DSVA 3NYDA 3UNTA 3V1HA 5JVLA 3L21A 3ITXA 3VUSA 5GNZA 1ZGDA 1TVPA 4H2HA 1H4PA 3JU2A 1PIFA 4M6PA 3N12A 2EG6A 4YN5A 5L9FA 5AHFA 1UP2A 5ABGA 2DGAA 1EJUC 4H41A 2AQOA 3TAKA 1JI1A 2WJEA 4GKLA 2B0MA 1YRRA 3GC4A 4C91A 3IJ8A 2Z1BA 1ME9A 3A47A 3HQPA 5AHMA 4ES4A 3HA1A 4B90A 4P7QA 1O5RA 5EYWA 5KMYA 2PGEA 3GDRA 4O10A 3CHEA 1R0MA 3HQOA 1KLZA 1EEPA 4DRSA 4GMEA 2GGHA 2OCZA 1EYWA 5H2ZA 2CLPA 1GCYA 5LNRA 1J18A 3UZXA 1K6WA 2QCGA 1XG3A 2VD8A 3M4HA 2E9LA 4FLOA 3LMYA 2E9MA 3BW4A 1OJXA 2BS9A 2DFAA 1QO2A 1H7PA 3H4XA 4C6EA 1TWWA 3TLLA 3SEPA 3WBEA 1WKYA 3UPWA 5C2XA 2JIWA 5CLWA 2QUUA 3KP0A 2X1RA 3BOFA 3UG5A 3M0MA 4FR1A 2WSQA 3AZRA 1QASA 3ZMRA 3UWUA 3W1RA 3SN4A 1AL8A 4L5ZA 3PVFA 4LCQA 2CKSA 1NDZA 3H7VA 1YW1A 3T07A 3H7UA 2XIIA 4Q4MA 1PHWA 8XIAA 4GIAA 4HD5A 1OT2A 2OZ0A 1T96A 3VE7A 2G3FA 3HG5A 3KM8A 4HA0A 1I60A 4C6CA 4JQ3A 4E8DA 1AH4A 3TR2A 3OBEA 2PWVA 3NNTA 3RF9A 4CU6A 4TTGA 1OZQA 4JZ5A 1XLAA 2C0HA 3UWEA 2VX7A 4PBFA 4U2YA 5F2GA 4AZBA 1SYTA 3CH9A 3WSUA 4JNMA 5FF7A 5CZ0A 3PZQA 3ZOAA 3M47A 2B7QA 1VYPX 4DPQA 3TCSA 1T8XA 5XIAA 5C9UA 4XAPA 4NYUA 1PX8A 4R33A 3U2ZA 2YYUA 3AS3A 2VC5A 3LQGA 3NO1A 4FI4A 5I0DA 4S3KA 3M0JA 1UD2A 3HV8A 1UASA 2FGZA 1ZPTA 1TV7A 1EGZA 1XLEA 2VJXA 1R3WA 1SW7A 2HXTA 2PDGA 2PLKA 5T91A 2W4XA 3B9OA 2DVTA 1RVKA 4X3ZA 1YDNA 1XF0A 4UMCA 1ZENA 2GJRA 5I2UA 1FCBA 2UY2A 1TWDA 1RQEA 5C5YA 3GG7A 1O5XA 1VZWA 4WDTA 2G97A 3NYZA 2NQZA 1IT0A 4UTJA 2Y5SA 1UMLA 3FJLA 2BZNA 1RH9A 1C8YA 2OB3A 5C9WA 4V2XA 4RE2A 3FLUA 4L7ZA 3G24A 2FQIA 2J24A 3OIXA 3GXMA 4O15A 3DFOA 4Q22A 3RIKA 2E09A 1UP3A 4TR9A 4C6JA 3RPMA 3SIMA 5GJPA 2D20A 2G41A 3QBUA 4PN2A 3MA8A 1BXNA 2CKRA 2OGJA 2XVPA 1JAEA 1FCQA 3TSMA 4AD0A 4XAYA 5K2ZA 3O63A 1JIBA 3NQVA 4RE0A 1Y5WA 4XISA 1V8EA 3JVAA 3A23A 3W23A 4N0RA 3VGDA 3PNUA 2WANA 4CD4A 1WCGA 3L9CA 4CCZA 1BQGA 2E6AA 4OUIA 3G0UA 3U3HA 2IUZA 4MKSA 2VZUA 4HPHA 3UJRA 3KX6A 5CG7A 3RHGA 2ZZ7A 2V5CA 3MC5A 4Y9OA 5HA7A 3EX4A 4XAGA 4DZ5A 1V03A 2Y4SA 3BAXA 2X0YA 3GH7A 1XGEA 5LIXX 2BXVA 2VCAA 3ZXWA 4A8LA 5H8PA 1EXBA 4AFYA 3F5LA 1V3KA 1EOKA 3S8HA 3W1NA 3OVQA 3N15A 1GYLA 1XYBA 3BVJA 4WKHA 4I7UA 2J4GA 3F7JA 1EQPA 3P3BA 1H0GA 1YXYA 2EO7A 1BRLB 2A0NA 5FEWA 1NWRA 3KL5A 3TWBA 2VEKA 1VFMA 1LT7A 4Y6GA 1ELSA 3B0VC 1D2KA 3OZMA 1VFSA 2OU4A 5C54A 1KM5A 5HQMA 4Y90A 3WO8A 3PZGA 1TMLA 3WNPA 1A5SA 1NDWA 3ZJ7A 3WK3A 1R8LA 4JTIA 2DORA 1TPDA 4G1NA 3OLGA 4EWJA 3GK0A 2XSAA 2V9DA 4A35A 1A4LA 1GJPA 1CIUA 1A49A 2BXZA 5I02A 1V5XA 1AW1A 2JK2A 4PFMA 3PR2A 5G2WA 5A3HA 3RCMA 2CLKA 2FDSA 1C9WA 5JU6A 2Y5EA 2XFFA 2WZHA 4IWWA 6TAAA 4FR6A 4ATLA 5CZKA 1IZKA 3WQVA 4IM4A 4XAFA 3TUUA 2AMGA 1S5VA 5CPTA 1B3WA 1KCZA 3S4TA 4ZO9A 3VOCA 4QFUA 3AS0A 4RV3A 3LDVA 4JOMA 2Z24A 3I10A 5CJNA 4FA3A 2R14A 3ANVA 1NWUA 2R1KA 1V6YA 5JIWA 2VUYA 3M1ZA 2OQYA 1PAMA 3ARZA 4M7TA 2PS2A 4MWAB 1JNEA 3GDBA 2Q71A 4UNLA 3NZPA 1QNOA 4HVXA 3R8RA 4V1YA 1Z6KA 1YTDA 1BFNA 4KEZA 3WEOA 5ECVA 1ALDA 3AIEA 5CSYA 5D9OA 4A3YA 1R85A 1GEHA 1JXKA 5IBXC 1PUDA 4WCJA 4E6MA 1L9WA 3Q45A 3EWYA 4S23A 3L2IA 3TVAA 2PDCA 1V6XA 5HQEA 4GKTA 3NPVA 2YZRA 4HPXA 4E3TA 4EP8C 2Y0FA 3RO6A 3BDKA 3G77A 3E5BA 5D33A 3IIXA 4JAWA 1V08A 3UWZA 1H50A 2HNHA 4W88A 4PUJA 8CGTA 2HTMA 2DT0A 3K4DA 1FA2A 2E5DA 1K9FA 2QCHA 4J2MA 3TQKA 2PP3A 1TPWA 1T6MA 3VGFA 1CLVA 4IJBA 5M1TA 4EE9A 2P1FA 2H3DA 1PJ9A 4RE3A 1CXKA 1U83A 2WCSA 3DGRA 2DZSA 2ZRVA 3AIBA 4CQBA 1UPPA 1RV8A 3E6EA 4Z2JA 3W27A 5C9XA 4ZA0A 3UU0A 4EVZA 2W63A 4HHMA 3WD3A 3FJNA 3H2AA 1HVXA 2V5LA 4BF9A 4ZR8A 3MI2A 1XD1A 3F2CA 3UJSA 3WBYA 4MJ2A 4UIOA 4HTBA 4D6IA 4CVUA 2OQHA 4S3GA 4Y9AA 1NFBA 4E2DA 1W3TA 1Y5VA 2EG8A 1XDJA 3OG3A 4WX2A 3MWAA 2RDWA 4DO7A 2WSPA 3EA2A 3TA9A 1POJA 4A22A 1V6TA 3GS6A 4HNLA 3SCWA 3DG3A 4QISA 3VILA 1B5TA 1QT1A 5A69A 1Z8AA 1DEDA 3SQSA 1JL8A 3J7HA 1BKSA 4I9TA 4A29A 1M41A 3MKCA 1QJWA 3MYPA 4YXGA 3KXQA 1XGZA 1HO4A 4M1RA 3AXIA 4OKDA 4R85A 4FNSA 3H2NA 3C6CA 4NZ5A 4UOQA 4Y2WA 4N9EA 3WF3A 3ARSA 4ZSTA 1DOSA 3DGBA 4GIYA 1A3XA 3RJYA 5DCEA 3QH2A 1BRLA 4HJFA 2GQ8A 5AY7A 2CEQA 1GVOA 1P4CA 4HU8A 3APTA 1PKMA 3EOOA 3W38A 3C8FA 1LLWA 3W88A 3EOLA 2IQTA 3UR7A 3MKVA 1K7EA 2J8TA 1EGMA 2J7DA 1XCXA 5DY2A 3EMCA 4GX9A 2LLEA 2E1DA 4YTTA 2A7RA 4QJ1A 5L6UA 4MM1A 2C3ZA 2CZVA 2IPWA 4ENLA 1DE6A 3QPYA 4G7FA 4XUYA 1LRTA 1FHDA 2A3AA 1JULA 2PWEA 1QOXA 5C2CA 4GYPC 3FHAA 3TN4A 1V02A 1F9CA 3BOXA 2C0AA 1F4HA 5HBFA 3ECQA 7ODCA 2QMJA 2XH7A 1WDQA 4MZYA 3QV6A 1DHPA 3WF0A 4K38A 4A3RA 1XYCA 2W67A 3N34A 4D6JA 3M0LA 3N9SA 3AIVA 2QVNA 4WDWA 3WQ6A 1JR1A 3TJIA 1FWJC 4GISA 1OQFA 5A8OA 2PURA 1K9TA 2ACQA 1SR0A 3AHYA 3R0DA 3AOFA 4FIQA 3OYZA 4DF0A 2EKGA 1AH0A 3GG0A 3BC9A 4OFCA 1CZ1A 2HE8A 3QGAC 2AQVA 1WX0A 4W7UA 5DT5A 3KBMA 2RDTA 2HVMA 4XZ9A 2Z00A 3TN6A 2VZVA 3SUUA 2Z2UA 1TWSA 4MG4A 4P7OA 1KM2A 4MWAA 2Q8LA 4XBKA 1ENUA 3GYEA 3GHSA 1HUVA 3F1QA 1KNWA 5E6YA 2P10A 1BSLA 4I6KA 4GNVA 1GK8A 4HK5A 2GVJA 3DX5A 3WD0A 2O4MA 3MI6A 2WVTA 1PHQA 3CWOX 2J7FA 2V8ZA 2ATMA 1A0CA 1AZ1A 1GYMA 2FH8A 3IPWA 4JQAA 4GUFA 3CLWA 3LK6A 4LF1A 1B4KA 2DPEA 3UP8A 2OKOA 3WLMA 3S47A 2DIKA 5I09A 4QDMA 6ENLA 3QVQA 2ZIDA 4IG2B 3I4EA 4LANA 3P74A 3F4VA 2PU1A 4M29A 1XC4A 4H00A 2Y63A 3WH6A 2C91A 1U33A 2W62A 2ZXQA 3GAYA 2CFFA 1Q63A 2WK2A 4ZO6A 2PBOA 1RP8A 4DJEC 1K8ZA 1JI2A 3PAJA 2B7PA 1E0VA 3KZPA 3OODA 4XVEA 2WMGA 2YZ5A 1H7XA 3ZR5A 2H6RA 3ZVHB 1DIDA 3U5UA 2YL9A 4N7QA 3KVJA 4BS0A 3DCPA 1JCJA 4HMDA 4R5EA 3LRLA 2NQJA 5CGQA 3RAOA 1LBMA 5BRBA 2RJHA 3RLUA 4M6UA 1XBXA 4DI9A 1BG9A 4AD5A 1QTWA 1ZB5A 3NPWA 4XKMA 2XGZA 5LKYA 1PIGA 2G0WA 3B05A 4X2RA 1ISWA 2XM1A 2YA2A 1X96A 1SJDA 3TV8A 4YHEA 2J79A 5J8LA 1A3WA 2PDIA 1JVNA 1UKQA 3T0AA 2HCVA 3AMLA 2XN0A 3T7VA 3W7GA 4HNOA 4MADA 3B0YA 4LU0A 1CW2A 1EIXA 3AHTA 3GW3A 3R13A 1UQYA 4I6VA 3LERA 3R8HA 3URAA 3G1HA 1GQKA 3VNIA 1W1VA 2E68A 2EPOA 4LOCA 2EBNA 1D8WA 3ZSTA 5HWJA 1XBYA 2ACSA 3BG9A 4OUEA 3PJTA 3ES7A 3O3RA 4TX9A 1EGVA 2R1MA 2TODA 4L65A 3RM4A 2QDEA 1H7RA 1ZBCA 1XWYA 2D24A 3AALA 5D2VA 4UQCA 4BI6A 1H3GA 4MF4A 5AYZA 1RPXA 4UFMA 4DUXA 2VDHA 1OFQA 3UZJA 5HNRA 5I03A 1QOPA 3FSTA 5BMXA 4P5UA 3AU6A 5AC5A 2PCEA 2RAGA 5A6BD 4WSKA 1R47A 4KIRA 4US5D 2ESCA 2WKLA 1U30A 4GLEA 4XTIA 2E1WA 3H22A 2HRWA 4OBRA 3BMVA 1XYFA 2OPJA 1HJWA 4YYFA 5DO8A 2YCLB 3BSHA 1XLGA 1A5AA 3EA1A 1WDDA 3I6RA 4GXPA 3KAOA 1XIBA 5FACA 2TYSA 3R10A 3MMTA 4LGXA 1LQ2A 1EZ2A 3TOPA 3KDOA 2NSXA 3VNMA 2W3ZA 4ZFMA 4IPLA 4DELA 1OBAA 1JCXA 3LPFA 2WLZA 3SW6A 5DCDA 3VVGA 2Q8XA 1Q2SA 1PXGA 4HSOA 1BGAA 1XICA 3BGJA 3T40A 2CLFA 1TPB1 2I9UA 4IPNB 3OGSA 2QF7A 1S2AA 3SY5A 3NM3A 1JZ4A 1V7YA 5I23A 2P8CA 1VJSA 2AKZA 1GOOA 3F4DA 3M0ZA 1DWGM 3AIUA 5E09A 4GRSA 2JE8A 3AZSA 3BLOA 1MUMA 4FF7A 1QPKA 2ZUTA 2V6AA 4FMVA 1KKRA 3PAOA 1PDZA 4ML9A 1KBBA 1PWMA 3UF9A 5LA0A 5IFPA 5FEXA 1NWSA 3MBFA 1GNXA 2DSWA 3DENA 3F2BA 3L2LA 2E9BA 3STFA 2P0OA 4GH3A 4QE4A 1XPYA 3VC6A 2DY3A 2POZA 5E9XA 4YU1A 2J77A 2YDRA 3FEMA 2BGNE 4QM1A 1GKQA 3GH5A 1ONWA 3PJWA 3O2LA 1MW2A 1K3UA 1WDRA 2WJFA 3GVVA 3CAWA 3SRKA 4F40A 3H2MA 2XHYA 3MUIA 4F2TA 1M3UA 3ZVHA 1W31A 1NIUA 4KH2A 2PDBA 1L6SA 6ALDA 1PX3A 3W85A 2J62A 3BXWA 1I2PA 1T5AA 5IM51 1R3YA 4R9XA 1WKFA 1HFBA 4PB5A 5LIUX 4DM2A 3WLIA 4N6EA 1QOQA 3SAZA 2ZZ1A 1HNYA 1KW1A 5M3WA 1KM1A 3T42A 4GH1A 2J9YA 2X41A 2JQXA 4KRTA 1G6CA 1FFRA 1ISZA 2PMQA 3UG8A 3IGHX 4I7WA 3PTDA 1XR2A 1JF6A 1ZAIA 4IH3A 2Z29A 3N6QA 1BHGA 3D6NA 1B54A 4MY9A 1E40A 2ZRUA 4MKNA 3PZMA 3K8LA 2Z27A 1J0JA 4S3CA 1AQHA 3PJXA 4JYDA 3N2CA 1LUCB 4EAYA 5EMYA 5HR7A 4MNMA 1HKVA 1MXGA 2FZDA 3LG3A 4EF8A 1FH8A 3CUJA 2REQB 1RQHA 3SUSA 4FOKA 5C9RA 3ALGA 3SCPA 3GC5A 3PSWA 4HHHA 1MUCA 4NY2A 1G94A 2JEPA 3PBYA 4Q33A 3SO7A 1J96A 4MYXA 3IAPA 4UCGA 1E55A 4PBEA 4U5KA 4JTJA 4GVHA 3S5ZA 4CCCA 3VM7A 2CLLA 5DF0A 9XIMA 1J93A 5DMMA 1QCWA 3WDIA 3KLKA 3GTFA 1WYIA 4XSMA 3SCVA 3AMGA 3IIOA 1MXSA 1XLMA 4OBSA 3GYCA 1WA3A 3MSDA 3LQLA 2WC4A 4S1FA 2UY4A 1RBLA 3G1RA 2VEPA 2IQDA 1XSKA 2YCLA 3HMCA 1UA7A 4LNYA 3WFLA 3OW1A 2X05A 4W4QA 3WL0A 1VF8A 3EKZA 2FZ8A 1ICQA 4DLMA 4H83A 4AW7A 1WE5A 5CPLA 4Z1AA 3H53A 2BXYA 2YL5A 1AH3A 5CQ1A 3ID7A 5M2FX 1HT6A 1V3LA 1OC7A 3EX1A 2QUVA 1F73A 4UTMA 1AL7A 1VIZA 4KW2A 3WUEA 4XV0A 5LXEA 1OINA 4V28A 5A5WA 4DO5A 5FEPA 2QT3A 3UNDA 1ECEA 4DJED 3LNMA 2R91A 2TRSA 1Q6CA 1JCNA 3ABOA 4L1GA 3E0VA 1TJPA 4E2VA 1IWPA 3K4AA 4NZ3A 5C8BB 1YYAA 2CBJA 4W89A 2CW6A 2QCDB 2R6OA 3SFWA 4AEFA 3CEPA 3IV3A 1S39A 3W1PA 4JTQA 1ADSA 3LXCA 4XD4A 1EP2A 1SUXA 4O0KA 5FEZA 1XYAA 2WBGA 3CPGA 4W7WA 3BMWA 1GOIA 3L12A 1BTMA 4D72A 1OK6A 1Z32X 2VVNA 2WKJA 1GQIA 2A7NA 1PTDA 3KTSA 1KR1A 3APYA 1J8VA 1YNQA 2I57A 5CBJA 3O9NA 4JIQA 1P1MA 4L9XA 1T8QA 1PKYA 2V5JA 4P2VA 1DJWA 1XH2A 1NP0A 1XUUA 3WJZA 3P81A 3B9DA 3WQDA 5K7JA 4R3UA 2GUUA 1XDMA 1DWAM 3ITYA 1B3VA 1KGWA 3RYSA 4E8GA 3S2JA 4REQB 4EAMA 1EF3A 1DE5A 2UWFA 4PL2A 3FYOA 4E4FA 2NVDA 4AYGA 2FVLA 2DZUA 5I77A 3P2VA 4MNKA 2Z2AA 3THDA 4AIBA 3N73A 4EANA 2XWDA 3QW3A 4PCSA 4WSHA 4GY1A 2ODOA 4NRRA 2AGKA 4MMWA 1EA9C 4M24A 3C2RA 5JBEA 4XTDA 3VOIA 5D2XA 1X6UA 2OYKA 3WL1A 4JR5A 1X1NA 4IFOA 1LL6A 4JCMA 4QAWA 4CNUA 3PF3A 4UC5A 1X7IA 1O95A 1LUCA 4ZBCA 1B0IA 1VCGA 1MDLA 4AH7A 2D2JA 3FEQA 3BLDA 3TW6A 4OOZA 2Y8KA 4HKPA 7CGTA 2REQA 2WB5A 1LRNA 3R25A 4K37A 3P6LA 4CNTA 3WN6A 4IL2A 1YXCA 3UPBA 4YHGA 4GVIA 1E4NA 5BOFA 4D1JA 2ZUSA 3PANA 4XAZA 3G5EA 2OOGA 4HYVA 2YCJA 3SGUA 2VEFA 1PKLA 4WZHA 4ERIA 3NPUA 1DJXA 4GG9A 4XZNX 4IIEA 1JEZA 1SM9A 1OIFA 4QCFA 1CBGA 3W75A 4QDWA 3BLIA 4IHCA 4DJDD 2IPJA 3BJSA 1NM9A 2ASHA 3C5QA 3O6DA 3A21A 3LCWA 1EJWC 3R89A 3LHVA 1QFEA 3TYZA 3V16A 1CXEA 3KCJA 1NQ6A 3D0CA 3R94A 4BR1A 3UY7A 1XRTA 2WNZA 2GJNA 1ONXA 4XZBA 2CZEA 5ABHA 1V79A 1W8SA 4C5ZA 5DANA 4BF7A 2FJKA 3T05A 4W8LA 3WJYA 3WJWA 4DAIA 4MGGA 2PTYA 3NTYA 5I3FA 2RDUA 3C2YA 3KS6A 4RPQA 4YTRA 3WX7A 3FVDA 3VI2A 6REQB 3UWWA 2Q8ZA 2Z7KA 1FBAA 3BCJA 3UG4A 1EJXC 3E3HA 2GUBA 1KCXA 4IT1A 2CHRA 4HNNA 1ZNNA 2VFIA 4DWSB 3AXKA 3UZZA 1X8FA 2A5HA 1HP5A 4JFVA 4I5UA 3HJZA 1JZ6A 1PWLA 2QCDA 3CV6A 4H6EA 2ZCGA 1UKSA 4OJYA 4AMCA 2VFFA 4QE5A 1D3CA 4KS0A 1NJJA 3EX3A 3KBSA 1HO1A 5CJ5A 3LMZA 3VMOA 3KOWA 2AAAA 1EP3A 3FDGA 4PUNA 4HK6A 1UIPA 1BSIA 4AZ5A 3HGJA 3GNRA 3N4EA 3IGSA 2YL8A 2PDMA 4IGSA 5F2LA 2V63A 1EWEA 2CZFA 3TN5A 3PBGA 2F2HA 1XC6A 3W4RA 3L0KA 2BX7A 2X16A 4GGHA 3UXIA 1SZRA 3EWWA 1WXJA 1VS1A 4E4PA 2EG7A 3S2MA 4PCFA 3TONA 1EEXA 1GQLA 3ITGA 3I68A 2DZPA 4Q4SA 3AZTA 4WGXA 1POKA 4FX8A 1QNQA 1GKPA 3W24A 4UTLA 5IHRA 4I90A 3AJXA 1TKKA 5CGMA 2Y70A 5IHSA 4REQA 1IV8A 4CQAA 1W1TA 1SZGA 1GONA 1Q6EA 5ABEA 4F8XA 4I8DA 4EXAA 2E3ZA 4QS6A 4ZO7A 1J0ZA 4O18A 5FL0A 2Z1XA 5CLTA 1EJ7L 3MO4A 4WY0F 4MPKA 3UG3A 3W28A 2Y89A 1BD0A 4ERAA 3DU0A 5G2IA 1E15A 2QNEA 4O0QA 2E5CA 3ISIX 2VZOA 2E4TA 3V0TA 3WQCA 3LPOA 5HJYA 4HYWA 4FOUA 1ZAHA 3P67A 1FRBA 4IQEA 3MSYA 4WGHA 3W02A 3MTWA 3E0LA 4GCXA 2O4QA 4UWMA 3R58A 3GW0A 3VCRA 3NZ1A 4PUDA 3VOFA 1VBJA 4L4OA 3M07A 1AODA 2DUZA 3CYVA 2I17A 3T2QA 1E1FA 1TX2A 4BI5A 1UPMB 3B8DA 5DQPA 5HNUA 1GGOA 4UZSA 1V7AA 1VEPA 3HPSA 3U6WA 1MW3A 2GGIA 4O8RA 4A05A 1L6GA 5D9MA 1AMKA 1X1OA 2D0HA 5CZSA 4XKYB 1UUMA 1W9XA 4BA0A 1FXPA 4N4QA 4H19A 2NSOA 4MIMA 3VUPA 1UZHA 2PLJA 4EF9A 3MU7A 5CGTA 4H9ZA 4Z0JA 1XUZA 1NF7A 1AG1O 2VC7A 1GVYA 4JX5A 4NJJA 3GAKA 3B8SA 4HCDA 3CLMA 4K36A 4S2CA 3WQ8A 4IMFA 3OBAA 4LUTB 2GZXA 2QJIA 3CQIA 3KBWA 3CC1A 3VDHA 4LAKA 1MZHA 4KESA 1V0MA 2QLYA 1DWJM 1F6KA 3I7QA 1XLKA 1VD6A 3NL2A 2AQWA 1M7OA 5BROA 3UWQA 3T0BA 3ZLFA 4A6GA 1L6YA 3HG2A 4PR4A 4C1LA 1JQXA 3WLKX 3M0IA 4NIRA 1EDTA 1TCDA 4EPBC 5CAHA 2DSKA 4N9BA 3S5OA 4C7DA 2F8QA 1F76A 2ZVRA 4KEUA 2O7SA 2HPMA 1IYXA 2PP0A 3G8RA 5EMJA 1DJQA 5DN1A 3V75A 5J04A 4ZEPA 4FF5A 3ANUA 3VIIA 5CZTA 6REQA 3PZVA 4LALA 4NZCA 4AU0A 1F6YA 3BSMA 1E5JA 3KRUA 3BLPX 2IKHA 1F2JA 1KFJA 1HG3A 5E0KA 1LTDA 4DWSA 1RD5A 4JICA 4NAFB 4QG6A 5E6ZA 1DTNA 2VX4A 2J74A 4M1BA 2BVTA 3MQTA 1QHOA 3CAKA 2VC6A 4BZYA 5LIWX 1OFRA 1HJSA 2PD9A 1Q65A 3IUDA 2ZA1A 4J40A 2V5KA 4BEUA 4NRSA 1UWQA 2HS6A 2C6QA 3FXYA 1M03A 3H4WA 4B92A 1V0NA 7REQB 4UQ9A 3WLJA 2HISA 1UROA 2J47A 3GQYA 2BY3A 3MV11 5M17A 4MB3A 2CZ5A 4W8BA 4F0HA 4NYYA 4TX6A 1WKEA 1JZ8A 4HOWA 1SO3A 3W7IA 2FHFA 1R2SA 5D03A 2HNEA 3BV7A 3NM1A 3EWDA 1ADOA 5HULA 1E9ZB 5CJMA 2CNCA 1RA5A 4PTWA 5BRPA 5IFTA 2AKMA 5I3GA 3G22A 3H2CA 4R88A 3E9AA 1JDEA 5FD0A 3JR2A 3UXDA 4MB1A 1VFTA 2DZXA 3HQ1A 2OEMA 3U4FA 4PSRA 2J75A 1KQZA 4JL2A 5TAOA 2YXXA 1IIHA 2O92A 4AG0A 2PWUA 1ZSXA 1L2QA 3T08A 4LUSB 3OVPA 2F9RA 4NJKA 4NZJA 4AZIA 3THAA 4Y9MA 4Q8OA 1A4MA 1LWIA 1VBHA 3BE7A 3TQVA 1E71M 3CHCA 1QNVA 3SCTA 3I3EA 1IEIA 3WQGA 3M5YA 3W2LA 3WDJA 2CESA 1WBHA 1S5NA 1J10A 4PMYA 3PSVA 2YGYA 4HJWA 6PTDA 4W8AA 5K9DA 1FFQA 1KRBC 1KCLA 1PCKA 2BOFX 4RNHA 2QR6A 1NFGA 2ZICA 1KV8A 3WLOA 1LP6A 3ITCA 3TH6A 1EDQA 3HO8A 1EC9A 3WD1A 1S38A 1ME8A 3NG3A 5LGXA 3LSCA 5CC5A 1E4MM 2XVKA 3BCDA 5AHLA 3LPGA 1H7OA 1QO5A 3F4WA 2NLYA 4FXRA 4QLLA 3UYIA 3APGA 1M68A 4EPDC 4O1DA 4XKYA 1QW7A 1HJXA 1WNOA 3KVMA 1FUYA 4ZL1A 2I9EA 3KRZA 3OJGA 2Z0IA 1Z7AA 1IXPA 4O53A 4O4VA 3A24A 5DMLA 5I3JA 4PMOA 2EEXA 1IXQA 1RCOB 3T8LA 4LUTA 1GVQA 1I2RA 3MO7A 4OGZA 4HGXA 4B5TA 3A3WA 2WNNA 4C6KA 3LTPA 3IK2A 4IUGA 3NWRA 1TCMA 3FA3A 4DO4A 2PRMA 4H9VA 5BWAA 4B3ZA 4WUIA 2VURA 3EOSA 4IXXA 5AVNA 1L0PA 4MYAA 1HZYA 3VKCA 1GVIA 2CLIA 3MW7A 1JCYA 4LTSA 3BAKA 3S6TA 4GNJA 2HPIA 1OG0A 3DFHA 4K8GA 3TJ4A 1ONRA 3NEHA 1LZOA 4F0RA 2NXHA 3L68A 4TVCA 2JF7A 3MWCA 1FH9A 3ABXA 3L4YA 4Q4PA 4NZFA 2NV1A 1THFD 1UUQA 2PLCA 5JUVA 2VWSA 4L6DA 4Y7EA 5M5DA 3LGGA 3VD9A 1Q6FA 1EXPA 3UT0A 4NAFA 4DXKA 1ZTVA 5A6TC 2PZNA 3QW4B 2FYMA 3UA4A 4XD3A 2BBFA 3KBVA 3L5AA 3EB2A 5I24A 3LUTA 4N6FA 3TW9A 4U31A 1FY6A 1I0DA 4GJ1A 2ADAA 2QPSA 1OCQA 7REQA 4S3EA 4RXFA 3TYCA 4EXBA 1T0OA 1BKHA 1EQCA 1HL9A 1OSEA 1XIDA 1PEZA 1KGUA 5B7ZA 1O1ZA 3EEZA 2VI0A 3V5CA 4K6AA 4X0VA 3N2TA 1K4GA 1XSIA 4X2PA 2RGLA 4XZMX 3N6JA 3RDKA 1MRAA 2X40A 3QPZA 2FVMA 4M7SA 3RR1A 1XQKA 5BWFA 1UWRA 3P7YA 3GX9A 5LHFA 1R3RA 2OYMA 4FIRA 4NJGA 2WZMA 1GW9A 4ZO8A 2GQAA 2NV2A 4DEFA 1C91A 1CGUA 2VM8A 3PNZA 2OELA 5U7SA 3G1DA 3N3MA 1M01A 3ARXA 2GYIA 1AFSA 2QHAA 4ZE4A 4GA8A 1W3HA 1VRDA 1ITXA 1XINA 3NURA 2YLAA 3ATZA 4CU7A 2NXIA 1EKOA 3GC2A 3H2OA 4EXQA 4TOQA 3INPA 3CZEA 3CUGA 4FALA 1T99A 4WDUA 5FL1A 1VFOA 1RVGA 3V7PA 4W5ZA 3AXHA 2W9MA 4DLFA 1T41A 4LUSA 1GORA 1JZ2A 1CGVA 5HJXA 2PD5A 2NUWA 1AW2A 3BGAA 3LXBA 3TYUA 1Q66A 3T0CA 2QJMA 4O1FA 3A12A 1BQCA 5E70A 3CL6A 3KTXA 4B3KA 4A2SA 1U1JA 3N4AA 4JTDA 1IEWA 4I9AA 1B3YA 1TVNA 5I07A 3N4FA 4LYPA 4AY1A 3VFLA 4L80A 4JTRA 4B16A 2IKIA 5TIMA 1IGSA 2ZZ5A 4AEEA 2WOQA 3ANYA 2QXWA 3P5YA 1D7FA 3USBA 2NT0A 2PDUA 3KVKA 5F4WA 3GKAA 1FCUA 3Q2DA 3F4NA 1W3NA 3PFMA 4GBDA 3VIHA 1E6PA 3NVTA 4LT9A 1NEYA 4KCVA 4OU1A 4QAIA 3UERA 2GL5A 5LIKX 2E5BA 3VNLA 4S39A 1ADDA 2A4AA 1PZ2A 4BFAA 4WDXA 3W25A 3RN6A 4CU8A 3RCYA 4C6QA 3W00A 5AHIA 1KQYA 1MW0A 2YIHA 4LS2A 1Z42A 3OP2A 2VGFA 2YCKX 4GUHA 2FVKA 3KFTA 2CBUA 2Q6ZA 3FN9A 4D6CA 5FJPA 3E38A 1G7UA 2ZDRA 1CGXA 5ENLA 3V0SA 3GNPA 1N8WA 4RZ4A 1R3TA 2WVSA 4GHRA 4DBUA 3MUY1 1O1HA 3D3FA 3JZUA 3CUHA 1DP0A 4LY8A 1GJUA 3CIWA 1K02A 1FHLA 4Z2KA 4IJRA 4JEJA 1IQ8A 1ZFJA 3W3OA 4NI8A 1K8XA 1S5WA 1O60A 1FWCC 2X7VA 1F07A 2QCEA 1WP6A 3QHOA 4B4FA 2DH2A 2F61A 4TO8A 3W83A 1X38A 5E9AA 2GLKA 2R1PA 3V36A 2C13A 3K2GA 3DERA 4ICMA 5ABFB 3W74A 4TV6A 3MBDA 4IMEA 3H54A 2JGYA 2QULA 3QQ0A 4XD5A 2BV9A 3EA3A 3FOKA 4AWEA 1WUEA 3E02A 2XIJA 1ITUA 3PBWA 4IISA 4YS1A 1W5NA 1JXJA 1M7JA 2ZOXA 4H04A 1PL9A 2FH6A 4A3QA 3ZJ6A 3NUKA 5IDIA 3BARA 3CWHA 3CM4A 4HT3A 1QXLA 3GH4A 2DH3A 2V3DA 4RKAA 5KETA 3TE9A 3CU2A 2VO5A 3ZM8A 2ZXDA 3WH9A 3AXXA 1NH6A 2CXGA 1V3MA 1E3ZA 1CYGA 4R7JA 1CEOA 1C90A 2V3FA 2ZADA 1TG7A 2PDQA 5LZLA 5EL1A 3EKLA 3QZAA 4H8UA 4GXMA 3GUWA 2XISA 4XG1A 3A6OA 4PMUA 4B5NA 2OYLA 3U5YA 1VH7A 1PCWA 4EPKA 1TRDA 4GUIA 1HF6A 5HDRA 3UWYA 4DVOA 3GB6A 3HG3A 3HPAA 1JGIA 5F2IA 3NQFA 1RK5A 2J8GA 2I7GA 3ONBA 3WG6A 2NT1A 3QLLA 1EIBA 4PCNA 2QKFA 1X6LA 1DORA 4TU1A 2DZBA 5DEZA 2VTFA 3TXVA 4Q32A 2YDAA 4O8AA 3EDDA 3PBVA 4EX4A 3THQA 3AMCA 4U10A 3MVIA 2KZHA 1XBVA 3W84A 2TSYA 1E9LA 4UFIA 3UVAA 3BAYA 3C61A 1FHUA 1DPMA 4Q7NA 4F0LA 2DW6A 2YCIX 1EP1A 1ISXA 4DBEA 3D46A 4HNCA 1A5LC 2C15A 4UTWC 3N19B 4JBRA 3ZFHA 3IEBA 3NSXA 1XLLA 4AVOA 4Z2HA 4Z2GA 3EKGA 3S0CA 5KZ6A 5DRCA 1W9BM 3I7SA 3GXTA 3W76A 2KX9A 2F6KA 4KFOA 4Z1BA 4K1GA 1TPH1 2PZ0A 5HNTA 3RFAA 4KMQA 4WOQA 1MEHA 1BVNP 1UIOA 3UWVA 3WNNA 1TUFA 5DMYA 3AMKA 1YNYA 4JY9A 4HZ6A 2QJNA 4W5UA 4MFEA 1HKJA 4ONVA 3QSRA 1QK0A 3NDYA 1HJUA 2NW0A 1SVDA 4ZTYA 3QFEA 2P3EA 1P7TB 2EQDA 3UY8A 2O55A 3SN1A 4UMBA 1EZWA 4PTVA 4ZOBA 5H8MA 3EX2A 4QTGA 3PFRA 3L2MA 1VLIA 3WYZA 4UQDA 3PUDA 3HB9A 1IR2A 4LBRA 4LEFA 1SZFA 3NDOA 2OX1A 2ISSA 3IANA 2DVUA 1L8PA 4LH8A 4F79A 5GPRA 1VFLA 3BGGA 4OOUA 4F0KA 4QITA 4MLRA 4JTSA 3ZZ1A 4UNIA 2I16A 1MFVA 1QRQA 3DG6A 4LY4A 4Z1CA 1JYNA 2HVOA 4GBUA 5BXSA 5ABFA 2FHCA 2D0GA 1B31A 3ZWTA 1BWVA 2VRKA 3POHA 3S5YA 1PE1A 3PTKA 5FF4A 3GIYA 3ATYA 4RJEA 3U7BA 4HU4A 4IMGA 1BGGA 1VKFA 1QI3A 3WQPA 3GTNA 3NVDA 2EAWA 2P88A 1FWFC 4FXSA 3M0VA 3LLXA 2QV4A 5LNWA 4UBPC 2DT2A 1UG6A 2YX0A 5I3HA 3TJLA 1QI4A 3P93A 4WQ6A 4LAMA 3N29A 3W7LA 3A13A 1PZ3A 1W9PA 5HAOA 4S3FA 1IWBA 1GHSA 2OLSA 1IEXA 3W2MA 3G1SA 3AWOA 3NEVA 5TNVA 3RRAA 1J0IA 1OIMA 2HBVA 1CNVA 3LCHA 2QV5A 1K70A 1ZL1A 4L4PA 3BAWA 1R46A 3CQKA 3EB4A 3DAQA 4QSFA 4IOTA 4JTKA 3GE7A 2EHHA 2QUNA 4D9PA 3IJ9A 1XLDA 5KINA 4OWGA 2Y1HA 4FXFA 3ITLA 2NUYA 3UR5A 1BYDA 5EA9A 1W1B1 1SR9A 4YL2A 3ARYA 1RUSA 1VCFA 3LM3A 3W87A 3IRSA 2OEJA 4NKCA 4GFSA 1GTHA 1M9HA 4JKKA 3KOFA 1TZZA 3GNXA 2ZZ2A 1BYAA 3VINA 2PGWA 3DYOA 4U4MA 2FZNA 3P0XA 2WWDA 3GBEA 3WLSA 3HGOA 4KGJA 1SJBA 1QR7A 1Q4NX 4CNOA 1A53A 1ZBKA 1NDVA 2WJDA 1WV2A 2ZX9A 1UYQA 3NAVA 5AC6A 4HP5A 4JTTA 3NFUA 4DWDA 1TPEA 4TUFA 1YLVA 3E2VA 2YBVA 4R27A 5DX7A 4HSHA 2OZTA 1GQNA 3WNMA 4TVDA 2J7GA 3NZQA 4ZB2A 2P76A 1G0CA 4LB4A 4CEXC 2NWRA 3EBVA 4JY8A 3QZ6A 1UZ1A 2OMAA 3SCUA 3UCCA 1OT1A 3GNOA 4IXHA 3K5XA 3WF1A 1SW0A 2ZX8A 1SSGA 3E12A 3NL3A 1QI5A 1IR1A 3SCOA 3B8IA 3FK4A 4LFYA 4PMVA 4Q4KA 1A5CA 1UJQA 2O9RA 2VFDA 1RLDA 1UWAA 2PTDA 1Q8JA 4D71A 3UVIA 4B9YA 1XP3A 1X6NA 2G8ZA 1QNRA 3FAXA 4KPLA 5AZ0A 1W3IA 1UOZA 2GK1B 4NASA 1BAGA 4NI3A 1B57A 3L4TA 1AJ0A 3OGRA 3WFAA 1G4SA 1LOLA 1RCQA 3AYSA 3W26A 1FWNA 2FPVA 1OCNA 4Q3MA 3K30A 3LRKA 1JZ3A 1P7TA 1J79A 4GI4A 4MJZA 4DBSA 1TJ1A 2EXOA 4BCEA 3NGFA 1YKWA 5M03A 1OFOA 1W1A1 3PB0A 2HQAA 1BYBA 3M5XA 3PC0A 4J28A 1JDDA 3B4YA 3URBA 3LN3A 2ZKMX 5EMUA 4Q8TA 1OYBA 1FWBC 1Y0EA 3N14A 4GNKB 1EJSC 4GK8A 1FKWA 4UQBA 3CV2A 5CG0A 2IKJA 1IGWA 1CENA 1UR3M 4B5UA 5D8WA 1DBTA 3TX9A 4GC4A 2WZEA 3HN3A 2BSLA 4WEVX 3W0KA 3W73A 3EDFA 1GJWA 5FJUA 3VMNA 3UA3A 1AW5A 4P61A 3W2JA 4FNPA 1UH3A 3C8NA 2E77A 2CHOA 4K1WA 4AZ6A 4HZMA 4XIMA 1TV3A 5AC7A 5CC7A 1I6NA 3QMSA 4LS0A 3PP7A 4BY3A 2WCGA 1ZCOA 3C4UA 3BLKA 5AC4A 1LM1A 4MAZA 2EKCA 3PN8A 4RL3A 2HK1A 3P80A 3SRHA 1E3XA 2BODX 4AX6A 3QXBA 3TQ0A 2WSYA 4IZGA 1TJ0A 4BF5A 1PS9A 4G5DA 3LI0A 4DF2A 3SY1A 3UPMA 5C55A 3MMUA 2VCBA 3TTQA 2WO5A 2JGQA 1BPLB 3WK2A 1D3GA 1S2TA 1OG6A 1NFPA 3GSMA 3TFXA 1HL2A 1H63A 3LZ3A 5A8QA 3BZJA 2VL4A 3WDPP 2RGMA 2WVUA 3BW2A 2FKPA 3N2BA 3FXGA 4QJ3B 5HMSA 3VIKA 3OA5A 4H8VA 4GO9A 1MQPA 2IMRA 4C65A 1SO6A 2ZZ4A 1LG2A 3TTYA 4XBSA 1NQKA 1VBUA 2I14A 1XLCA 4X9SA 2DZWA 1E0UA 5G4HC 4PTXA 2ZE0A 3AIRA 5F1VA 1W1YA 4CQDA 2GQ3A 5G4EA 1HTIA 3W70A 4Z1YA 1UZDA 5CPQA 1VBGA 5JBFA 1ZP3A 2YXGA 5GNXA 1IZCA 4JIHA 4LB3A 2DZAA 4LRSA 3B04A 4U2ZA 1ZAJA 4PC8A 1A47A 3W81A 1I9CB 4UQEA 3MZ2A 1QUMA 3VNYA 2GGGA 1W1IE 3A4AA 1GZJA 1J9YA 3MMWA 5J5DA 3G3DA 3MY9A 4IIHA 3WEZA 3W1TA 8XIMA 4H7VA 1EO5A 3GR7A 3LSBA 3TSDA 3PY2A 1P0KA 1VPYA 4WKFA 4Z2IA 3CNYA 1H51A 2DUAA 1NOUA 2Y88A 3AI0A 4MB4A 3CS2A 2HXUA 4DI8A 2A6NA 4CQCA 1EO7A 4F4RA 1T40A 3VM5A 4DNHA 2WYSA 2GK1A 3QRHA 5SWUA 3NSNA 1BWKA 1TR1A 7XIMA 3W2KA 4JGDA 4K68A 2BMBA 1G67A 1ML1A 3LI1A 1I2OA 2FZ9A 5XIMA 3WJXA 4LRTA 4B5WA 3N04A 2PU0A 1E6SM 3QQWA 1A0DA 3GDTA 2QCLA 3Q67A 1C3FA 2R24A 2ZQ0A 3ZJKA 4FZIA 3EAUA 1U5VA 1R7OA 3RU6A 1RCXB 3QOKA 1BVWA 4Z2LA 4KBXA 4RUBA 1F6PA 2NLIA 2F38A 3M0XA 3P61A 2C14A 3GBDA 3W7NA 3QY8A 1EF2A 3TA6A 4P7LA 4PGLA 3II1A 3S1WA 4LNCA 1CECA 1WBJA 1DYSA 3LPPA 1WOBA 2OLHA 3MHUA 4GXWA 1RBAA 4O0ZA 2IPFA 1HP4A 1H2JA 3VXGA 1S2WA 3TP4A 3I6EA 1LL4A 1DVJA 4L6HA 1V3IA 4FX6M 3NA8A 2YW4A 1IEQA 3MHGA 4JQ1A 3VU2A 4MTVA 5REQB 4W7VA 3WMCA 4TVUA 2JF6A 2JKPA 4HBKA 1FP9A 3R4IA 1OX6A 3WNLA 1O94A 4AVNA 2PTZA 4CNPA 4Q7IA 5HUOA 1B4EA 4Q4RA 6XIAA 1GOKA 5CZJA 2RFGA 1UW9A 6A3HA 1EX5A 2WKGA 3CB3A 5F4XA 2QVHA 3KBJA 1SSDA 3URQA 5FSEC 2HJPA 1O5KA 3N6HA 2D2OA 2YA1A 3PZIA 5FJTA 2Y8UA 1ITQA 2D3NA 3WQFA 1J0KA 2ZA3A 2ISDA 2HZGA 2FLIA 1HJQA 4JNZA 1V6WA 1FWAC 1B1YA 3OB8A 3SCNA 2Y85A 3W7OA 4AWSA 2P0IA 1G1YA 3U8GA 3H55A 2C8NA 2VR2A 5EY5A 2CLMA 2VZTA 4RNJA 4RR4A 3W01A 4DYEA 1XI3A 3T2PA 1EUNA 4FPSA 5DBTA 4PRTA 3GFZA 3WDHA 1RJPA 3GFXA 3P84A 3P8JA 4RDVA 1JPMA 2OR2A 3WNKA 1UB3A 2HMCA 3B8VA 1XLBA 3E2RA 3IARA 1FTXA 4FNUA 1UOKA 3NGJA 2P53A 4MHBA 2ONEA 3SB0A 4H9YA 5I7GA 1HVQA 2NUXA 1E1EA 4UOJA 4AIEA 3RLVA 5LA1A 1WZLA 1MUWA 4UR7A 1NVMA 1ESWA 4OV4A 2AOSA 2VFGA 4GABA 2QF8A 3STPA 1QWKA 3REQB 3MSRA 2CYGA 4F0MA 5GJMA 3JRKA 1KD0A 3TFCA 4PB3A 2HDJA 5ABTA 4UTKA 1P0BA 1JPKA 3AUOA 1XLFA 2OO0A 2JIEA 3VKDA 4RW5A 4FB7A 4PFHA 2QIIA 4FP1A 4ZQPA 3W7KA 2RKXA 3CO8A 1VGAA 2C79A 3QM3A 4MUPA 3OA3A 5BU6A 3XIMA 3VNZA 2QDHA 2BDQA 1TR9A 1KBLA 2HVNA 2J6VA 3MDUA 4QROA 2W91A 6TIMA 5AYXA 5DMNA 5FOOA 3IJDA 3BAIA 1UQZA 3OZPA 1XKJA 1J4EA 3CAVA 3S6OA 4IMDA 4M6VA 4C60A 1E6XM 3C0JA 2WSKA 2VQTA 4TX8A 3TK7A 3PZNA 4M0XA 4JNYA 3ARQA 1ONEA 4JTAA 4C6FA 3HG4A 2PSNA 3TZFA 3ZIZA 1C93A 3OBKA 2VMFA 1KTNA 5AYBA 3RX4A 3LENA 1Q5MA 1GUVA 4GCAA 1Z41A 2ZC1A 5G1TA 1SPQA 4UTUA 4C90A 2ATSA 3CZ8A 4H2CA 1BEUA 1V4YA 4K7YA 1YE6A 2PB1A 4JHMA 4Z0SA 1QU4A 3O15A 1KRCC 1C8VA 4LAOA 1H41A 4DZIA 1XYMA 1CB7B 1VBRA 4LBUA 2GWNA 3WFZA 2JALA 3DI1A 3TC6A 4IX0A 3NQBA 2Z2BA 3BL3A 4Q8QA 2ICSA 5REQA 2D2HA 1IT8A 3N25A 1XLIA 1DQWA 4LC6A 3QV8A 3ZJ8A 2ABAA 3V5FA 3MMDA 4F0SA 4WVXA 4CNNA 2P3ZA 4AUBA 3ZT5A 4ML4A 4PUWA 3CK5A 2OSWA 1V77A 4P7RA 1TPVA 2PCQA 3LBCA 4D6DA 3RU8X 3U0HA 5DELA 1VIWA 4IIGA 1J12A 1MI3A 4O11A 1GG1A 3SRDA 3QYSA 3GNNA 2F2KA 3RM8A 5AZ1A 5EU9A 1MDRA 2ZE3A 3AAMA 2D22A 3T8QA 1H61A 4S2BA 2O0TA 3VYLA 2GVEA 5A6BA 2PC8A 4RPPA 4JIRA 3KTCA 5BXTA 3R8GA 3POCA 4RW3A 4J9JA 4U3CA 5A2AA 1PPIA 4HQVA 3LHWA 2Z1WA 2CC0A 3B9NA 3HV9A 3ARVA 2V5DA 4Q8PA 1E1CB 3CIVA 2GWGA 5IBXA 4INFA 2QS8A 3QY6A 4AY8A 1XW8A 4C1KA 2EJAA 4HPGA 5JQ9A 3RMEA 1KV5A 1JG9A 2DZVA 1YX1A 3DBNA 3DFTA 3DEQA 3THCA 2V2CA 4PTNA 4G7EB 4M82A 2J7BA 1J6OA 4CCEA 1W6TA 4TMCA 4BI7A 1S5MA 3VDCA 4UTHA 2Y62A 1KXVA 4YNGA 2IXUA 1J2WA 4KEMA 1V3HA 2B7OA 4JTEA 4J3VA 3SGZA 1XQLA 2GDUA 3SQMA 2G3JA 3REQA 3EXRA 3E49A 5IXEA 1FWDC 2NX1A 1MVYA 4NT0A 2OXNA 3E5PA 3SBFA 1I2QA 3IVTA 5K4XA 4D6GA 2C19A 4DJFC 1CB2A 4XZWA 5DLCA 5D04C 3FW6A 3XINA 5U4NA 3VOGA 3AIQA 2ZXAA 1XDLA 2DQWA 2W66A 3HGRA 3WUGA 1NELA 1VFUA 1W56A 1IF2A 4L56A 5HUPA 4GZEA 1A5UA 3GHRA 4GOAA 3L66A 1XSJA 4MDPA 1W1ZA 2NWSA 4ZB5A 1OD8A 3T81A 1KXQA 1EOMA 3WLRA 3FX4A 3MHFA 2X1UA 4GUJA 2FHBA 3BICA 5EPDA 4AWUA 2AL1A 2BWGA 1VYRA 3W1XA 3VKJA 1YNPA 2ZBTA 4M6QA 1P0EA 4ZSUA 1HGYA 3AYTA 1U1HA 1PYFA 1US2A 2VNCA 2BHUA 4G6CA 1W5MA 1K1DA 1VHNA 4JIEA 4U33A 3ALFA 3K13A 4POCA 1DXIA 3DYMA 3DN5A 4CEUC 1A5OC 3EOEA 4OTKA 4ZQMA 4D8ZA 1B90A 1TPC1 2XINA 1F5ZA 3U4AA 3KHJA 1YADA 2DIEA 1HGWA 4ADTA 3QR1A 5JXQA 3CB8A 4C6MA 1Q6RA 2Y6ZA 1KTBA 3A4JA 2ZUVA 3ZT6A 1LWHA 3CZJA 1AMYA 1JRCA 4WXZA 4GYPA 3ICJA 4LCSA 4CCDA 2A21A 4Y96A 3XISA 4ACZB 3CT7A 4RLIA 3NO3A 2ZZ6A 2CPUA 1F7BA 5EKYA 3GZ3A 4FNRA 1TUXA 2R82A 4F9JA 1EBHA 2CWXA 2RDXA 2G4JA 4HA1A 3PM6A 2GDVA 3SECA 1UH2A 2IS7A 1R2TA 4ZE5A 3MUZ1 2G3IA 4IMAA 9CGTA 2TPSA 4L4LA 3VAVA 2YBUA 2F7FA 2BLEA 3STCA 1ZZMA 3B97A 3GKFA 3URNA 4PODA 2Q3OA 4WOZA 1QI2A 1B3ZA 3O6AA 4JS3A 3WLNA 3VZYA 5KTLA 3AHZA 1QNSA 4DF1A 4X0NA 2PGRA 3SR7A 4Y