4RKAA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a347
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with DH03A347
rcsb
source organism Homo sapiens
total genus 137
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rkaA00
4OQVA 4WZHA 1ZNNA 3TJLA 3CLMA 3G24A 1ZHAA 2HTMA 1WDWA 1F2JA 2ZA2A 1N7KA 4JDYA 4W9TA 5FI8A 1YDOA 3DGRA 5HWNA 4UTKA 3NQFA 3I68A 4JTJA 5EA9A 2ZQ0A 1TIMA 3PULA 1OYAA 3V1PA 3MYPA 4A22A 2PCQA 4HSNA 4ICNA 1AW2A 3BLEA 4H6KA 1TTQA 1OYBA 1KM1A 3GXTA 2WO5A 1H60A 1QPNA 4M6VA 3LXAA 3ZR4A 4NT0A 1TPVA 3HG2A 3U2OA 3W7HA 3RU6A 3MJYA 3FYOA 3E9AA 4FEZA 3NA8A 2Q3OA 1EB3A 3T44A 2WOQA 1HL2A 1F73A 5FEWA 4UC5A 4Z1CA 4MOZA 3FKKA 4JYDA 3B05A 1DOSA 1MEIA 1GVRA 2A6LA 5CPNA 1WV2A 2QCMA 5C2XA 5AC6A 3SY5A 2WKJA 5EL1A 4GBUA 1H1YA 3L67A 2CLKA 3CIWA 3NPUA 4IGHA 1FUYA 2X1SA 4DO6A 4MYAA 3NQ8A 4LWWA 4R7JA 2QF7A 3LM7A 1VHNA 4IXHA 2TSYA 3W7NA 1H7XA 3TQKA 4LW7A 4Y9AA 4A29A 5K9CA 1OFPA 1FDJA 4NQ1A 1B9BA 3BW4A 1K8XA 4Y6GA 1KFKA 2Y63A 3SECA 3BGJA 3QPZA 5DCEA 5EMUA 1KTNA 1W8SA 3JRKA 1P5BA 3PG8A 3NAVA 2QAPA 1LLWA 3STCA 2GVLA 3D0CA 1H1ZA 3ABQA 3GNNA 3W88A 2WSQA 5A8GA 3IGXA 3LI0A 2ZRYA 4TU1A 5T26A 2ZBTA 3C2RA 1Q3NA 1LDCA 4M6QA 2RHGA 2XN1A 3DKLA 4LC6A 3DFQA 1P1XA 1JUKA 1AW1A 3UD6A 4HPJA 3TNOA 1W1ZA 2NLIA 5HMSA 4TMCA 3CM4A 1VJIA 1MEHA 5G5IA 1DKWA 3N34A 2Y89A 2CZ5A 3R89A 2DZXA 3P5YA 2Q8ZA 4BK9A 1ME7A 1L6YA 4UTMA 2E6YA 2Y88A 4GE8A 3L68A 4UFMA 1OFAA 4XKYB 5EBUA 1WBHA 2HSAA 3LLFA 2Z2UA 1K8ZA 2JBMA 1Z42A 4IMCA 2QDGA 3F4NA 3W9ZA 4PODA 1UUOA 5L9FA 3LLDA 4AH7A 4XKYA 4DPPA 1I4NA 2FPVA 3QEZA 3R8RA 3K30A 4H3DA 4N4PA 3EX1A 2DZTA 3LGEA 1FBAA 2WSYA 4GUGA 3R2GA 4HIBA 2QCFA 4JGDA 1GG0A 1O94A 3B0UX 1ICPA 3S1VA 4JN6A 3M43A 2X16A 2E5BA 1FWRA 1JCJA 3HG3A 4JR5A 1VRDA 3N19B 1QOPA 3DI0A 1TPEA 2G5WA 3NQ2A 3DFOA 1DJNA 1W0MA 2J9ZA 2P10A 1TB3A 4PL2A 2NX3A 2A85A 2QEZA 4G1KA 3C2VA 2X2GA 2VFDA 3L5AA 3DZ1A 1D9EA 3M6YA 2ZA3A 2FB3A 4O53A 4ONVA 3W7GA 2TPSA 4DF0A 1GVFA 1VLWA 4UTJA 1QO2A 2A21A 2QUUA 3O16A 2ZZ7A 2OJPA 3GR8A 5EYWA 1SO5A 3P7YA 4K38A 2Z6IA 2FPTA 1T8XA 1Z44A 3CEUA 2BX7A 1G69A 5F4SA 1KM2A 1TPWA 3R5EA 1LBFA 4HNTA 4Z1AA 5LNWA 4BI6A 4RR4A 3I6RA 5BMXA 1OF6A 1KFJA 5C55A 3RNDA 3QSRA 2XFWA 2DJLA 1SFLA 3STGA 4RZ6A 4FNRA 1GZGA 1TTJA 4JX4A 4NXKA 3CT7A 1SFJA 3FKRA 4JTUA 4Q33A 5AB3A 3FJLA 1Z41A 3W6YA 3WFAA 3BPWA 2EGZA 4Q32A 3FIGA 4AWSA 3NO5A 2B7QA 3F4WA 2OX1A 3SZ8A 5LNUA 3W72A 1EEPA 2DZVA 1R2RA 1RD5A 3IVSA 2AGKA 4N6FA 1W3TA 2ABBA 3C52A 4GJ1A 3HGSA 1YTKA 5G2WA 2C14A 5HUOA 1JQVA 2NWSA 4UCGA 3G18A 1UJPA 3B03A 1AMKA 2QDHA 3TX9A 1F7BA 1WOAA 5AHEA 1GJPA 2W79A 5D2XA 2DZSA 3O15A 4JTGA 3TAOA 1EWEA 1JULA 3TQ0A 2O7SA 4U4MA 4MIMA 2V30A 4WXZA 3QMTA 4WUIA 3NPVA 4PL1A 4MPQA 3NL5A 4C1LA 3LRKA 2ZZ4A 1SW0A 2Y7EA 4LVAA 3W1UA 4JXCA 2CZFA 1GTEA 1T96A 3A5FA 1Z48A 1B3OA 3NPWA 5AHFA 3BW2A 2V82A 1O5KA 1TMHA 3VE7A 1FCVA 4CQ9A 5FESA 5D09A 3IRDA 4O50A 5DXYA 1H7RA 3TAKA 4ZQMA 4WOQA 2CWNA 2FFCA 1R2SA 2W0UA 5IBXC 3B04A 5IM51 5DLCA 4DO5A 3MP5A 1OX4A 3SR7A 5HJLA 1SO3A 2BZNA 4ZQPA 1VCVA 3HG4A 5HWMA 1W31A 3L0NA 1VR6A 4ADUA 4JICA 3VI2A 5BMWA 1KM4A 3C8FA 2NUWA 2PURA 2P1FA 1MO0A 3G1HA 1Y0EA 4O18A 1X7FA 1F76A 1SU5A 1GG1A 1HUVA 3T78A 4O12A 4UIOA 2ZRUA 4HNNA 5AC7A 3Q94A 4ZQNA 2YW4A 1KTBA 4HSOA 3P81A 3G22A 2FIQA 1XI3A 1UUMA 1W5PA 1FDYA 4DQWA 2WJZA 5AHNA 1FXQA 5TQLA 3NEVA 5D30A 2H90A 4AWTA 3DFPA 4M5PA 1L2UA 4M7TA 4FXSA 4O15A 3CTLA 4RZ5A 4TMBA 4JDBA 3W2JA 5KMYA 3DHFA 4YCPA 4Y8FA 3GDKA 1DHPA 3P74A 3M5XA 5LHFA 1O5XA 3VCRA 5BW6A 4NZFA 3W1QA 2ZA1A 2ISWA 5I3KA 4QM1A 5FEPA 5J5DA 4UTWA 2V9DA 5D32A 4MLRA 1F6PA 4M7SA 1EUNA 3OVPA 2RKXA 3BGGA 1K3UA 3C2FA 4LS2A 4QSHA 3EWYA 2VEPA 3MI3A 3EWBX 4O52A 3EXTA 2VFGA 3P5ZA 4UTIA 1XBYA 2OT1A 4K37A 3LV6A 4OV4A 3P60A 2QAFA 1SO6A 4UMBA 2VFEA 4LVBA 4O1DA 1EWDA 2VEKA 5FF0A 2J24A 3ZFHA 3E12A 4NJIA 4UXDA 5EY5A 3W7PA 4D2JA 1H7OA 4LVDA 2C1HA 2PE4A 4AAJA 4DPQA 3HO8A 5I3GA 5LZLA 4AHOA 2ATSA 3W75A 1OK4A 1C29A 1G4EA 3KVKA 1LBMA 1BEUA 1I45A 2FPYA 3O05A 5F2IA 2ABAA 3G1DA 3GAYA 2NX1A 4IXXA 2FDSA 4WD0A 4R33A 4S2BA 1N55A 4GWEA 3S42A 3UWWA 1A5CA 1B4EA 1FWTA 2NWRA 3HPSA 4MYXA 1RVGA 2YFNA 4I7UA 5F1UA 5HULA 1G4TA 2TRSA 3GIYA 4CLMA 1T99A 3PUDA 1TV8A 3LXBA 4MZ1A 1K02A 2X1RA 3DAQA 4X9SA 5AYYA 3MMTA 4N9EA 3S1WA 4UR8A 4E2BA 4O54A 1FCQA 3S5ZA 1UCWA 4QNWA 3LRMA 3TU9A 2RDUA 3B8DA 5H91A 2RFGA 2QKFA 5EPDA 4IMGA 4KWVA 3W7CA 1EP1A 1XC4A 2A7NA 2NUYA 3BG5A 3KFTA 3S1UA 2E5CA 3TUUA 3SJ3A 1FWSA 2V8ZA 4O17A 3L66A 1BTMA 3IVUA 3NNTA 1W37A 2H6RA 2QCEA 2Q3RA 1SSDA 1VZWA 2KZHA 1RV8A 3GKFA 3P62A 4X3ZA 1DV7A 1LRQA 3PUEA 4LT9A 5KINA 2V0TA 5LHEA 3ABOA 4X2RA 4O11A 4RLIA 4GFSA 3EWWA 5AN7A 1DL3A 3IGUA 4A3UA 3W1XA 3NG3A 3U8GA 2B7OA 3DENA 5LGZA 2WNZA 1X1OA 3PBUA 2ZZ3A 1R46A 4RXFA 3O06A 4M19A 3IIZA 2GJLA 2A7PA 4FNSA 3PS7A 1Q45A 3UWZA 4NJHA 4LOCA 1ADOA 1ZENA 2V5LA 4JTIA 1SO4A 3QRHA 3W07A 3LBMA 1KW1A 1GYLA 3HGJA 5DBTA 1JCXA 2VXNA 3UZ5A 1AW5A 2YGYA 3RFAA 2CLEA 3HPZA 1ME8A 1OYCA 3QYQA 3THQA 4JS3A 2NXHA 3B06A 2C19A 3W1RA 3LV5A 4WX2A 5DN1A 1LOQA 4FX6M 1G4SA 4ZMGA 4PH6A 1JCNA 3IIXA 3W74A 3BW3A 3SGZA 3P84A 4ORMA 5U4NA 1S5WA 5K4ZA 3BARA 3TR2A 1ZJIA 2Y7DA 3IIPA 1A5BA 1HFBA 2NUXA 3ATYA 3EWZA 4HT3A 4XTIA 4K8HA 3W7KA 1YADA 3HF3A 3NQGA 5D2YA 1QPQA 2YYUA 4FX7A 4HPXA 2QJGA 3IIVA 2YCEA 1ZY9A 2J88A 1GTHA 2P0OA 4PEKA 5G4WA 4JYEA 1IF2A 3SW6A 3ELFA 1FWWA 3C0JA 2GQ9A 2C18A 3EKLA 3S5OA 4O14A 1DORA 1DVJA 1ME9A 3P61A 4K8EA 3O63A 4FHAA 4MZ8A 4TIMA 1IXNA 3G8RA 1I2PA 1SQ7A 3E02A 1LBLA 4FIRA 4CNOA 2WNQA 1VCGA 3KRZA 1WXJA 2Y7GA 4OU1A 4QIUA 4YWIA 3NQ7A 3ZS4A 4B5NA 1FXPA 1XBVA 2CLHA 1S3HA 2W6RA 3Q2DA 3MHFA 4YXGA 3CHVA 4O16A 1LRTA 3RMJA 3LBCA 1WYIA 4LVFA 4IQLA 5AOUA 5F1VA 4N2YA 1L9WA 2JK2A 1KFBA 1W5MA 4I7WA 2YFOA 1HG3A 5LNRA 1O60A 5I3HA 3RK8A 3N9SA 5ABTA 3VE9A 4E0CA 2TYSA 3DI1A 3W84A 1G7VA 2OT0A 3QSTA 3W7IA 1AG1O 3PAJA 2AQWA 3S1XA 2QCDA 1A5SA 2R94A 4JTEA 3PWAA 2Z0IA 1KLZA 1HO4A 4FNPA 3GDTA 4ORIA 1Q6RA 1TPUA 1PHQA 3GDRA 4WY0B 3IEBA 3PSWA 4IPJA 3OVRA 3W83A 3STEA 4AHQA 2JGQA 2WQPA 3GXNA 2Q8LA 1WAUA 5KITA 4WY0A 1AL7A 2FB2A 2CLMA 4O57A 2PC4A 2VENA 5FEZA 3LHWA 3NQAA 4K7YA 4NNBA 1UASA 5LSMA 2ISSA 2E5DA 1ML1A 1KBJA 4MUZA 3VFLA 3L5LA 2V2CA 3VKJA 3OG3A 3B0PA 1LTDA 4OGZA 2C0AA 2ZYFA 1F6KA 1TYGA 3GYEA 3WK3A 2BXVA 2CFFA 1PCWA 1KV5A 5HWJA 3UZJA 3PBVA 3NL3A 1H51A 5U7SA 3RLVA 3NDOA 1K7XA 1O4UA 3W85A 1TPH1 5G1YA 3W7OA 1WOBA 3MWAA 3IVTA 3WJZA 4CNNA 4TR9A 1JCYA 2X1UA 4EVZA 7TIMA 5KTLA 1JRCA 3UY8A 2YYTA 3Q58A 4K39A 3NL6A 4L4MA 4NVTA 3KRUA 3O6DA 1JJKA 1G4PA 2PRLA 4QQ3A 5D2TA 3T40A 3WJSA 5D02A 4Z08A 3W7QA 1GVQA 2BTMA 5I3JA 2LLEA 4RKAA 4OT7A 1TQJA 1PVNA 1W56A 3ABSA 3C2EA 4Z0JA 2EKCA 3BLIA 3LRLA 3M16A 3GR7A 2VELA 1VLIA 3DHDA 1PL9A 1X1ZA 1MSSA 3W2MA 3UWVA 3KHJA 1F05A 1J2WA 1Q6LA 3TSDA 3TCEA 4UMAA 5KZDA 5KSWA 1V5XA 3CU2A 5KZMA 4PA8A 4MFDA 3MHGA 1LYXA 1KM5A 3PSVA 1WBJA 5H2ZA 1PIIA 3W7LA 1QR7A 3BLFA 4LVGA 3TMLA 2X30A 1SR9A 1BKSA 4O1BA 5DXXA 5HINA 3NPXA 4LS0A 2CW6A 4FNTA 4HNVA 4IX0A 3LHZA 1I2QA 1EIXA 3W7JA 4JTLA 4MY8A 1B57A 3NQ6A 3W7DA 2IQTA 2Y7FA 3TXZA 3ZWTA 1XUZA 3UPWA 1NF7A 4DF2A 1M6JA 1FX6A 5HUPA 4AF0A 1G6CA 4DO4A 2F7FA 1LP6A 1S5TA 1TQXA 3W22A 3LCIA 1UBSA 4IMEA 2JGYA 5CPMA 1WQ5A 3DFNA 4N9DA 3OEXA 4A2SA 1C8VA 5DCBA 4Z1DA 3L5MA 2E68A 4MLJA 3QQ0A 3NL2A 5IBXA 2DORA 4JY8A 4A21A 5K2ZA 1OX4B 2ATMA 3FJ6A 1BWKA 4X22A 1ZAIA 1S5VA 4FIQA 2ZRWA 3HGRA 3WJYA 1M5WA 1XXXA 3R12A 1TPB1 4MY9A 1KM3A 1QMLA 5CZ0A 3ANYA 1F74A 3NR0A 1L6WA 4FO4A 3LTSA 3HB9A 3STFA 4BFAA 1KV8A 1THFD 4JNMA 1TPC1 3MBDA 3T4CA 1YDVA 1M7PA 3BO9A 3DFSA 3LHTA 5CPOA 3NXFA 1GPWA 3I7QA 4JEQA 2DP3A 5AFDA 2J9YA 4O4VA 2BWGA 1QNVA 1PCKA 2HS6A 1SW7A 1OJXA 3W7EA 2X1TA 4ZZ9A 5G2HA 5HQEA 3I7SA 2ZTKA 4JIQA 3YPIA 1SUXA 1I2RA 5K7JA 4CCEA 1O95A 4GUJA 1FWNA 2R8WA 4O10A 2ZZ5A 3TK7A 3GDLA 8TIMA 3EB2A 3RLUA 4NNAA 2NZLA 4JIPA 3W73A 5L6UA 3VNDA 4DELA 1OFQA 4JY9A 1YPFA 1WX0A 3F03K 5MHBA 1EUAA 1H5YA 2DU2A 1YPIA 4MFEA 4MKNA 4NXSA 1ALDA 1K03A 4EF9A 1SW3A 3GB6A 5LKYA 1VH7A 3O6YX 4XZ9A 3M5ZA 3EX3A 3L65A 4DBDA 3PUOA 4JTFA 2FQIA 1HO1A 3BV4A 4NX0A 1QPRA 1EP2A 4LNYA 2GVJA 3G0XA 4I9AA 1H7NA 2QCGA 3TW7A 3EX6A 5AYZA 2A7RA 4EOUA 3G0SA 4HN4A 5HR7A 1Q6QA 3QC3A 3W86A 1KTCA 2VKZG 1LZOA 3C56A 4RK8A 3S6DA 1R47A 1ICQA 4BI5A 2CU0A 4AXKA 2DZPA 3TA6A 1W5NA 4GRSA 4O0KA 2RDWA 1H7WA 1NAL1 2J9XA 5FF2A 2WNNA 3G1XA 1QOQA 4NU7A 4OE7A 3BVJA 3PBWA 4C1KA 5LNSA 3TFXA 5AHIA 3AJXA 4RV8A 4BI7A 2FLIA 1XL9A 4ML9A 1IIGA 4IMDA 3H54A 3ZWSA 4JTSA 4UTTC 4QAIA 1PS9A 2B0MA 2E09A 3NZRA 4LV4A 3DKJA 4FB7A 3TIMA 4FNUA 1QO5A 1YYAA 2C13A 3KVLA 5C6MA 3GZ3A 3BG3A 1IXQA 4HHPA 5LGXA 3A5VA 1TO3A 3A23A 1I8JA 4BWLC 3PR2A 3QJAA 1AK5A 1KFEA 2RDTA 3KVJA 3W1TA 3UXAA 1CX9A 2G96A 4AHPA 5D38A 2Z6JA 3UXDA 2ISVA 1OG0A 3NQEA 1P0NA 4IJBA 1RQBA 4LRSA 3TC6A 4O0ZA 1XKYA 3A22A 3DH7A 4WXYA 3WK2A 4JX5A 5G4EA 3DXIA 2F84A 3MP4A 1XUUA 3KAOA 2VFIA 1XCFA 1LRNA 3TH6A 4MJZA 3HPXA 2DJXA 4GUIA 5BOOA 2O7QA 1GWJA 3UNDA 5G2IA 3V75A 3OA3A 2ZZ6A 5AC8A 4XUGA 2B4GA 5F2GA 4EIVA 3DFTA 4FNQA 1DJQA 3M44A 4E2DA 5G1TA 4LRTA 3CC1A 1Q6OA 1SZGA 4UTLA 4NX5A 1W5OA 3PVFA 3W23A 3S5NA 2Z1BA 4UFJA 1TPFA 3W2LA 2V2HA 4MVAA 2A5HA 5F4XA 3LOTA 4XTDA 2FJKA 1IXPA 2HMCA 4LTSA 4ZL1A 3INPA 1W3IA 3JS3A 1CW2A 2I1OA 4DEFA 1CI1A 1F5ZA 1SZFA 4YCOA 2GOUA 3EX2A 3PG9A 2A0NA 1FDZA 3W7RA 1XDLA 4O13A 1ZALA 5DY2A 2A6NA 2YX0A 3G3DA 3NOEA 2OMAA 3SIZA 3TROA 1OVDA 4ZQCA 1C9DA 3OHIA 4O1CA 1XBZA 3P67A 1TTPA 1SZEA 1SZNA 1OF8A 3LHYA 1KM0A 3HMJG 4PC8A 1QFEA 3L21A 3PB2A 3DBPA 4R53A 1XDMA 3WJXA 3M1ZA 4WJEA 4O19A 4NJKA 3E0IA 4AVFA 4O1AA 2YXGA 3L9CA 4CQ8A 2I14A 3N14A 3W3OA 3NQVA 4XBKA 4JX6A 5CG7A 3W71A 3TFCA 4BR1A 3L0KA 3GX9A 5K3VA 3P8JA 3GAKA 2AAMA 3EWUA 2H3BA 4ZQOA 4JTKA 1K7FA 3MYOA 4GNJA 1VYPX 3W87A 4O8RA 5A5WA 2FTPA 3UQNA 3PM6A 2EHHA 3TSMA 3TV8A 3SI9A 3N2XA 3I65A 3KOFA 1W5QA 1N8FA 5CKSA 3ABRA 4LV9A 4HKPA 1TRIA 2WPBA 2Y62A 1LLZA 2YW3A 3MI6A 3T55A 3TC7A 1GEQA 1KM6A 4JD4A 1GT8A 3P80A 3DU0A 1U5JA 4CCCA 3NVTA 4I7VA 4K6AA 1OFRA 2QCHA 1FQ0A 1TJRA 4P61A 4ZVJA 4BF9A 5C54A 5D04C 3LCXA 5K4XA 4PTNA 1QWGA 1H63A 1A5AA 1NVMA 4NJJA 2C3ZA 4FF7A 3BK0A 4UFLA 6TIMA 3WJWA 1H62A 1LORA 2QJIA 1X6UA 4L4LA 1PHWA 2QCDB 1LOSA 5D03A 3W1LA 2EPHA 3N73A 1KFCA 4XWUA 4RZ4A 4N9BA 4DBEA 4KWWA 3WK0A 3CWNA 2Y61A 3S8HA 3B4UA 3M5YA 1EP3A 1GVOA 2QUVA 5E93A 4LY8A 4POCA 3NGJA 5F2MA 2CLOA 1IGSA 1T0OA 1GVSA 4GXMA 4JTHA 1TREA 3P8IA 3T7VA 1VQTA 3EXSA 3NM1A 3TDFA 5I3FA 3FS2A 3QF0A 2R14A 2EF9A 3KVMA 3MI2A 1KA9F 4NZJA 1LROA 2ZTJA 3LDVA 3HBLA 3IIOA 4Y90A 2ZZ1A 3M5VA 3W2KA 3LXCA 3QW3A 3CWOX 1LCOA 2C15A 1W3NA 3ATZA 4K36A 3QQ1A 1W54A 4CNPA 5HNRA 4Z0SA 1TRDA 2PRMA 5D2WA 5EKYA 1OFDA 2YPIA 3N2MA 1NF0A 4UUIA 4GC4A 2YZRA 3A21A 1BWLA 2OZ0A 2BLEA 2NX9A 3P82A 5J5RA 5D2VA 2A4AA 4GUFA 4LUJA 5CZJA 3S5YA 2YSWA 3PF3A 3G1AA 5F2LA 2CLFA 1I2NA 3L2IA 3W1PA 3TW6A 1TTIA 4PCFA 1YXYA 1XFBA 1VCFA 5BNKA 3SGUA 5CGQA 5AHLA 1M7OA 3JR2A 1YDNA 3HGOA 4PFMA 4UFKA 3TMQA 4XBSA 1VYRA 3EEGA 3HOJA 3W7MA 4LU0A 1JVNA 2BSLA 3PB0A 5GVJA 3CPRA 1OHLA 2GUUA 1J5TA 3NYZA 3W76A 3H53A 2YDAA 1VS1A 2Y70A 2ZZ2A 4KFOA 1TV7A 4OHQA 1H7PA 3GNDA 5DY3A 3TKFA 4EF8A 4QNEA 2DZWA 3GDMA 1ONRA 3MHUA 4LUIA 3FOKA 3H55A 2NV2A 3HJZA 2XN2A 4RXGA 1PV8A 1EPXA 3M47A 4Q4KA 1TV5A 5DBUA 1P0KA 1JR1A 5SWUA 1A53A 5AHMA 2J27A 3LHVA 3MBFA 3OVQA 5AYXA 3N3MA 4UTUA 4NUWA 1RPXA 1YXDA 4CCDA 2VOMA 4QJ1A 4DF1A 3NZ1A 1VGAA 1LOLA 1MEWA 1IXOA 1ZAJA 4RX0A 4JTTA 1FCBA 4IPIA 3TSBA 4MJMA 3NM3A 4JYFA 1FY6A 2B7NA 3LCHA 1PE1A 2ALDA 1YLVA 1OFBA 3LI1A 1JUEA 3LB0A 2VEIA 3N9RA 3O07A 3BG9A 3GVGA 3QW4B 5TIMA 4IX2A 3FEMA 5C5YA 3LCWA 1RQEA 3M0ZA 1MXSA 4AF0B 4LC8A 4RCXA 1AL8A 3TQVA 3KX6A 3LTYA 4TX9A 4AWUA 1OX5A 2E1DA 2NXGA 1JUBA 2C6QA 1K7EA 3MO7A 4CQAA 3A24A 3Q37A 1JRBA 2E6AA 1RR2A 1IIHA 1D3GA 2TMDA 2Y85A 3USBA 1VC4A 3M41A 4KKXA 3W70A 2V81A 4WQ6A 3G1VA 4K7VA 4ALDA 5K9DA 4WOZA 1XM3A 1R2TA 4OWGA 3PBYA 1E51A 3G1FA 3LCGA 1OX6A 2V5BA 2E77A 1JQXA 3UYCA 2E6FA 3MW7A 4IMFA 3S0CA 4P2VA 4LS1A 4QITA 3E49A 3M9YA 3LERA 3O6CA 4EWND 2GQAA 3CQ0A 3C61A 3G0UA 3G1SA 2E6DA 3E96A 4IUOA 2ZFAA 1MZHA 1H50A 4MY1A 2V2DA 4KFNA 4UNKA 1KLYA 2G95A 2A1YA 4R34A 1G67A 3OBKA 1L6SA 2QCCA 3RF9A 2H8ZA 3IV3A 1TCDA 3FYPA 2VEMA 2QUTA 2QR6A 1NSJA 4O28A 3M7WA 3UPBA 2ZRXA 1GQNA 4A2RA 3THAA 1NEYA 5CZTA 3EX4A 3O8AA 2JKAA 4YL2A 5FF3A 3R13A 4ADSA 3GXPA 3QZEA 1KBIA 1OFOA 3CEPA 1SSGA 3UY7A 1ZFJA 1OABA 3F1QA 3G1YA 2QJHA 4QISA 1D3HA 3EKZA 2OCZA 3EXRA 4GUHA 4IOTA 3TXVA 4S1FA 4J9JA 1P4CA 3NQMA 3QMSA 4Z1BA 3A9IA 1GYNA 3W2UA 1TSIA 6ALDA 1ICSA 5DELA 3C4UA 2ZCGA 2WSRA 2CLIA 1NFBA 3FFSA 4AEOA 1EX5A 5BRBA 2DZUA 1G7UA 3UWUA 1JCMP 3EWXA 5HR6A 4NJGA 5D33A 1QDSA 3HIJA 4DXVA 4AB4A 5I3IA 1YTDA 3S9YA 2GPTA 2QCNA 5D05A 1EA0A 5CSSA 1A50A 1TPDA 3IGSA 3KXQA 4N6EA 5E1QA 2QCLA 3W1AA 1FCUA 5DCDA 4UMCA 3GK0A 3LHUA 2J6XA 3QPYA 4N9CA 3HQ1A 1J4EA 1HTIA 2CLLA 3LCFA 3LCLA 5LNVA 4UTWC 3C6CA 3I7RA 3GKAA 1YXCA 5KZEA 5FF7A 5FEXA 4O4WA 3PY2A 3MUXA 3SSJA 5CZSA 3OIXA 1OK6A 3QFEA 3WK1A 1RZMA 4ADTA 1DQWA 1V7YA 4OBTA 1ZAHA 3C2OA 3PC0A 3C3NA 1SPQA 1RQHA 3G8EA 1JCLA 1WA3A 1LM1A 4WY0F 3QM3A 4UFIA 4U28A 4UTTA 4OV9A 4FXRA 2JKPA 1UB3A 3U6WA 4E38A 2G97A 5D37A 2VFHA 3CB8A 3SFKA 1QAPA 3QMRA 4H4IA 4UFHA 2UV8G 2ZRVA 2GVGA 2RH9A 2PRHA 2CZDA 3GLCA 3FA5A 4UNLA 3MP3A 4BWLA 3TE9A 4XQ6A 5CPLA 2CZEA 3UWQA 2H8XA 2WV8A 3NQDA 3O1NA 3B0VC 3W2NA 1OFEA 2VC6A 2A2IA 4TO8A 1KFLA 4M6PA 4RJEA 5E0KA 2B7PA 3LTPA 3CIXA 2EAWA 2GQ8A 3QH2A 2HS8A 4AMAA 1K8YA 3G3MA 2YR1A 3UWYA 5K9XA 4KFPA 1U83A 1B4KA 4IWWA 3FLUA 1QCWA 1XBXA 1I2OA 2NV1A 1X8FA 1GOXA 4YMZA 4MZYA 2D73A 1TJPA 2ZRZA 4S2CA 1DBTA 2XN0A 1QPOA 3TJXA 2H3DA 1H61A 2C16A 2I9EA 2NXIA 2R91A 1VYSX 3LX9A 2VFFA 5CSRA 4N4QA 4N02A 3AO0A 5TBOA 2GJNA 2JKEA 1VPXA 4NNCA 5F4WA 4UTHA 1VHCA 5FF4A 3W1NA 4ZQRA 4HNUA 1YTEA 2ZDRA 3L0GA 4YLWA 3HG5A 4Y96A 1DQXA 4UR7A 3W1MA 1ZCOA 2Y6ZA 3NQCA 4FX8A 1R30A 3KRSA
chains in the Genus database with same CATH superfamily
1E9ZB 3G24A 2ACUA 2A3LA 3FDGA 4JDYA 1E43A 1N7KA 3DEQA 3L4VA 4GZ7A 1LWJA 3NVDA 4JTJA 5D8ZA 4NZ4A 1IWPA 3MKKA 3STPA 4BF7A 1UD2A 2PCQA 4HSNA 1AW2A 3BLEA 4H6KA 1KM1A 4AC1X 1H60A 3XIMA 4NT0A 3VD3A 1TPVA 3HG2A 3U2OA 3W7HA 1TWZA 5LIUX 4DYEA 3FYOA 3E9AA 3QOKA 3PFRA 4FEZA 3CQJA 3P6LA 1NDYA 1Q85A 1HL2A 1F73A 1IEIA 2EO7A 4MOZA 3FKKA 2F2KA 4NAFA 3PN8A 2VJXA 3RR4A 3RLHA 1VP5A 3SY5A 2D2GA 3R58A 4Q8VA 4GBUA 4JPGA 1EGMA 3CIWA 4IGHA 1GONA 1FUYA 3UERA 2X41A 3N04A 4CEXC 4IFOA 4LWWA 4R7JA 3WUBA 3WF4A 1VHNA 5DFAA 4DXKA 1TIWA 4LW7A 1M01A 4PMJA 3GFYA 4E2VA 2Y63A 3SECA 3IUDA 2WVTA 3BGJA 3ZYZA 2HXUA 4CGTA 1KTNA 4B90A 2BG5A 2GVLA 3D0CA 2WSQA 2Z4GA 4B92A 1BSIA 1I75A 5I3DA 1GVYA 4TU1A 4XV0A 1J0JA 2P8BA 3W24A 1I0DA 1RXOB 3R11A 2RHGA 2OG9A 2VRQA 1UD8A 3DKLA 1JUKA 4CCZA 1CTNA 4HJWA 4Z2LA 2ANUA 2EJ1A 4HPJA 5BZAA 3B8UA 2NLIA 5HMSA 1MEHA 3H26A 2O55A 2Y89A 2CZ5A 4DWSB 2DZXA 4PUDA 2Q8ZA 4BK9A 1L6YA 4UTMA 1UR0A 2E6YA 2OOFA 1NJJA 1TWDA 2VX6A 4EXBA 4UFMA 3T0TA 1DIDA 1ZBCA 2JBMA 1Z42A 2SFPA 4D8AA 3SJNA 4BQ3A 1UUOA 3UNTA 5JBFA 4LY4A 4AH7A 1DIOA 2X42A 1I4NA 4I6VA 1PO9A 1F4AA 3PANA 3R2GA 3UR5A 3A6OA 3B0UX 2DIJA 3MCMA 1JCJA 3HG3A 1ZBWA 4JR5A 3UZZA 3EDFA 5JMUA 1U22A 3VMOA 4JNYA 1OM0A 2P10A 4L4OA 1VFOA 2POZA 3L5AA 2FB3A 3URNA 3U0HA 1K6WA 2OYLA 1JGIA 1AZ2A 4UTJA 3O16A 4RDZA 3P7YA 1P0BA 4YVPA 2BX7A 5F4SA 1KM2A 1KRAC 2XIJA 1LBFA 1XINA 4G7EA 4BI6A 2CBVA 2ZXQA 3DDMA 1KCZA 3HV9A 3RNDA 3ITXA 2GGIA 1GZGA 1TTJA 3A12A 1TV2A 3CT7A 4RNIA 4HYWA 3FJLA 2V63A 3WFAA 3D3FA 3AI0A 3ZR6A 1XD1A 4AWSA 4LNCA 1V3JA 2B7QA 2OX1A 1JXJA 2DZVA 1R2RA 3M64A 1RD5A 4DNHA 2Z7KA 3IVSA 1Q7MA 3C52A 5DMLA 4GJ1A 3DG7A 4KWSA 5G2WA 5HUOA 1JQVA 2NWSA 4AY1A 3LG3A 4I5RA 3B03A 2GWNA 1AD4A 5AHEA 2W79A 4PN2A 5D2XA 2DZSA 1JULA 3TQ0A 2V30A 1NOUA 3TZNA 1E4MM 4IJCA 1PTDA 1UD5A 3MKVA 3NL5A 4C1LA 2OKTA 2ZUMA 1CXIA 4Y9MA 1T96A 5EU9A 1B3OA 1B5TA 4D71A 3I10A 3BW2A 2PS2A 1JL8A 3L23A 5FESA 3H22A 1S2UA 4EK7A 1C92A 1E73M 3O3RA 4ZQMA 5E6YA 2FFCA 1PTGA 1RCQA 5AYBA 3B04A 5IM51 2Z7GA 5A3HA 1X1NA 4S3GA 5HJLA 4XO6A 2BZNA 2OLAA 1W31A 4J3SA 4C7DA 3L0NA 3EA2A 2OEJA 4DRSA 3VI2A 3PPGA 5BMWA 3C8FA 3BL3A 3WQDA 2P1FA 4EANA 3II1A 3GNXA 1X7FA 1F76A 1L8PA 4QTGA 1HUVA 1KD0A 1BRLA 4CU6A 5AC7A 3IV8A 2HWGA 4P7QA 1XJBA 4B2DA 2FIQA 4YTUA 3S6TA 5BWFA 1G0CA 2WJZA 2YL5A 1QHOA 4X63A 5D9NA 4BY3A 2ZX5A 1ONWA 4GY7A 4O15A 3IK4A 3KHDA 3IJIA 3EWCA 1IYXA 3FAWA 3BGAA 3M5XA 1O5XA 1V6XA 3BICA 3WH9A 5BW6A 4WGHA 2ZA1A 2QJJA 5I3KA 4QM1A 3CZLA 3GZAA 4UTWA 4GQGA 1ZZMA 4A6GA 3C2FA 1UWTA 4HZ8A 4MADA 4QSHA 1W6TA 4ZOAA 2VFGA 5CJMA 1QNOA 1S46A 3REQB 3WUFA 1DJHA 1PZ1A 1XIDA 2PWFA 1EWDA 3V1HA 4QP0A 4U31A 3K4WA 4DY1A 2VR5A 5M3WA 1N8IA 2ZX8A 3SQSA 5F7UA 1H7OA 2PE4A 3HO8A 2CHRA 2ATSA 3VIMA 4LF1A 4GKTA 1LBMA 4CNSA 1BEUA 3G1DA 4PUJA 4WD0A 4R33A 1KRBC 4GWEA 7REQA 3ZVHB 6ENLA 1B4EA 2NWRA 1GW1A 1JG9A 1ZGDA 1GQJA 3QV7A 4S23A 3DOPA 3UCDA 2TRSA 4CLMA 1T99A 1K02A 5BCAA 3DAQA 3MMTA 4OIFA 1FCQA 4BCEA 4IISA 4TX8A 5EPDA 1NWUA 3W7CA 1XC4A 3BG5A 3KFTA 3TUUA 5LA1A 1FWSA 4ATLA 4D1IA 3UG3A 2D1ZA 5T91A 3MSDA 3P62A 2XH2A 3TOPA 2ZXDA 3LU2A 4RLIA 4GFSA 4A3UA 3W1XA 2G3IA 4OUEA 3MDUA 4RXFA 2AGTA 3O06A 2GDQA 4CQDA 2A7PA 2NT1A 4MUPA 2FZNA 3LLXA 4LYPA 3UWZA 4NJHA 4LOCA 1BAGA 4Q7IA 1VIWA 2V3GA 2CWXA 3RFAA 3UFYA 4AZIA 3R4IA 2O0TA 1KQZA 3THQA 4Q8NA 3SN4A 1BYCA 2NQLA 2NXHA 3AHYA 3USZA 2WVSA 2PBGA 3W1RA 4YHGA 3BAKA 2XU2A 3IJDA 3IK2A 3SGZA 3POHA 1MUMA 3UP8A 1I9CB 1S5WA 1I1WA 3E38A 5K4ZA 1GQIA 3TR2A 1ZJIA 3ONBA 1HFBA 2R6OA 3SFWA 3C86A 4D6EA 3W7KA 2FGZA 1YADA 2AQOA 4HA0A 4EKJA 2WXDM 4HPXA 1RP9A 3IIVA 2YCEA 4NF7A 1ZY9A 4I8YA 1GTHA 4PEKA 3AXMA 5G4WA 3ELFA 3T2OA 4ZTYA 4M1RA 1S39A 2PF8A 3HA1A 1FHDA 3S5OA 3DBNA 4MGGA 2WPGA 3N29A 5C7HA 1V3LA 1WUEA 2Y24A 4MZ8A 1IXNA 1KWKA 3G8RA 2EPMX 3CGTA 3ZLGA 1VPYA 3PTKA 1FHVA 2A3EA 4Z2HA 1OD8A 3WELA 2GGJA 4OU1A 4DWSD 1E56A 4QIUA 4YWIA 3ZS4A 3KRBA 5DMNA 4MDOA 1FXPA 2W6RA 1S3HA 4IHCA 2AOSA 5H8MA 3CHVA 2BXYA 1NFPA 1PDYA 3RMJA 3WMLA 3LPGA 4PSPA 2W92A 1KFBA 4GLEA 2PDYA 1O60A 3N9SA 2D69A 1Y5WA 4E0CA 3QSTA 3W7IA 1AG1O 2AQWA 3AIRA 5H6HA 2W5FA 1A5SA 2R94A 3AMGA 3PWAA 2WM1A 4H7CA 4RDVA 3GXMA 4JQAA 4DBSA 1J0KA 2CETA 4ORIA 1TPUA 1TG7A 2OQHA 3GXDA 3IEBA 4IPJA 3W38A 2BY0A 3CNYA 5IHSA 2HBVA 3GIPA 4GX8A 1Q66A 4WY0A 1AL7A 3T6CA 2PC4A 3NQAA 4K7YA 2IXVA 2XGZA 1UASA 4KCTA 1RALA 3ZQ9A 3L5LA 1LTDA 3VOJA 3E0WA 3C0SA 1QI0A 3XINA 1B3YA 4C6EA 5HWJA 4ZO7A 3UZJA 3I6TA 5M2FX 1O4UA 3W85A 4Q7BA 4DHGA 5G1YA 1WOBA 2G41A 3MWAA 3M0KA 4QDMA 2EEXA 3O0KA 5I02A 5LXXA 4CNNA 5HOSA 5A6TC 2POTA 3K1DA 3Q58A 4O0QA 3NL6A 4Y7EA 4ZXOA 3SUUA 1G4PA 2PRLA 4OOUA 5D2TA 5D02A 1BXCA 4JFSA 3WNNA 1UOKA 5A2CA 3THDA 2LLEA 3AIQA 4J7RA 4RKAA 4OT7A 1UR8A 3BLIA 5HJXA 3AS3A 5GJPA 1PKYA 1HXJA 2ZX7A 3DHDA 1PL9A 1X1ZA 4L61A 1MSSA 1CEOA 3KHJA 2F6KA 1J2WA 4ZOBA 5I79A 3CU2A 4PA8A 2FZMA 3PSVA 2HZGA 1WKYA 3W7LA 4LVGA 2YL6A 2X30A 1KBLA 5IOBA 3N17A 5FL1A 2CYGA 1OT2A 3NPXA 3VC6A 3TW9A 2CW6A 4GH1A 4ZSUA 4JTLA 4RPPA 2OXNA 1B57A 1Q6FA 2IXUA 3NQ6A 2NVAA 1XUZA 1HKJA 3UPWA 4L80A 3KEHA 3CJPA 2Q09A 1DJGA 1TQXA 4F0MA 1WDRA 1UBSA 4NP7A 1NELA 3WD1A 1WQ5A 4PEEA 2PDPA 3OEXA 1OADA 1Z8AA 1W32A 4H19A 4Z1DA 4ZXLA 1AH4A 4PZVA 4W87A 5IBXA 2DORA 2WHMA 3B4YA 3PZ9A 3CAVA 4H2HA 2ZRWA 4ZFMA 1RLCL 2Q01A 4N0RA 3S2MA 1TPB1 4MY9A 4C6CA 1UIPA 3NR0A 3AYVA 3PJTA 3CAQA 1L6WA 1CGVA 3LTSA 3HB9A 1WE5A 3CYJA 1TPC1 3MANA 3L4ZA 1W91A 3T4CA 1ZBVA 3PZTA 3NXFA 1GPWA 3I7QA 4IMAA 4AVNA 1IV8A 4MHBA 2BBFA 2ZOXA 2BWGA 3T42A 1NWRA 3PZMA 2F61A 1PCKA 3R6IA 1OJXA 4ZZ9A 4CCEA 1O95A 5C2GA 3T4WA 1RK5A 1GYMA 3GU1A 1J0YA 2PWVA 3WH5A 4PBFA 2YBVA 2R8WA 1XSJA 3VIFA 3TK7A 1IR2A 2FVMA 2NZLA 3W73A 4DELA 3CV6A 1X8CA 4JY9A 2PWDA 4LEQA 1OZQA 4NXSA 1K03A 4YS1A 1F6YA 4P7RA 1SW3A 1XYCA 3H2FA 1ISWA 3FA3A 5IFPA 5JUVA 3O6YX 3M5ZA 4WCJA 2GK1B 4DBDA 1MVYA 3ABZA 3PUOA 2Z00A 3N2BA 4IG2B 2FQIA 3V35A 3BV4A 3MPGA 1QPRA 2E9LA 3T2QA 4I9AA 3G0XA 2QCGA 4CD7A 4KEUA 2A7RA 3GHRA 4GO8A 2D22A 3NQBA 4DX3A 1FWCC 5IXEA 2ZDSA 3PBGA 3C56A 1CZ1A 4XAZA 3M0JA 4TQTA 3SGGA 2J8GA 3PNUA 2CU0A 4KCWA 4BI5A 4UQBA 3KTCA 3TA6A 4GIRA 4GRSA 2TAAA 1RBOB 4ZB0A 1V3HA 2O9PA 2YZ5A 2RDWA 3VNLA 1H7WA 2HNEA 4K1GA 5IHRA 5FF2A 2WNNA 3G1XA 4CNTA 4F2TA 3KOXA 1QOQA 5LNSA 4L1WA 2PWGA 5AHIA 2J74A 2IW0A 4BI7A 1XL9A 2OWWA 4GG9A 3ZWSA 1A80A 5CLWA 2GLKA 2VL4A 1PS9A 3NZRA 4FB7A 3DKJA 1K4GA 3IJQA 1NQKA 5HAOA 5A2AA 3BG3A 3TQPA 3ALGA 1XX1A 3BLKA 1FFRA 2QIIA 4BWLC 4F0RA 3W1TA 3BTNA 3MA8A 1PWLA 3AZSA 2Z6JA 2YCLA 3S1GA 3UXDA 4W4QA 4DYKA 2ISVA 1OG0A 5KZ6A 2INFA 1RQBA 4LRSA 2G4JA 3P93A 1JYVA 2OLSA 3A22A 3DH7A 3WQCA 2OQYA 3WK2A 5BRQA 4C6PA 1WDPA 3DXIA 3LD5A 3KAOA 1VRXA 3N4FA 4M82A 4Z17A 2O7QA 1GWJA 4Q8TA 2GSEA 3WDRA 1PZ3A 4IFKA 5G1TA 1VFSA 4LRTA 3WLKX 1ECQA 4J35A 2PEVA 1B1YA 4JZ5A 3W23A 3S5NA 4HSHA 4MM1A 4UFJA 3W2LA 3LZ5A 1JZ6A 5CSYA 3VDHA 4A3RA 4GNKB 1NP0A 1IXPA 1NWTA 3INPA 2HEJA 3GQYA 1QNSA 2XVLA 1PX3A 1YQ2A 1CW2A 4WHBA 1F3WA 2EPNA 3EZ4A 4HN8A 1DXEA 2A0NA 3RILA 3W7RA 3U3HA 1MUWA 1XDLA 1YPXA 1ZJHA 4IQDA 5A69A 2PZ0A 2OMAA 8A3HA 2NQ9A 4O1CA 3VMNA 3E3HA 1EJWC 3U5UA 3P67A 1TTPA 4WSHA 1WB0A 1OF8A 4NYUA 4CD6A 4JHOA 3L21A 2UY2A 3C0QA 3V0UA 3WJXA 3B8SA 3G6MA 4QJ5B 1OGSA 4C65A 1JZ5A 4KS0A 4XBKA 5CG7A 3A4XA 3GX9A 2E3ZA 2Y2WA 4ZQOA 5CGMA 4XD6A 3VU2A 4HGXA 2Z1WA 4GNJA 1JZ3A 3W87A 1HX0A 4AD5A 1M7JA 4IIGA 3TSMA 4K2SA 3S2CA 3I65A 4AD4A 3VX1A 1N8FA 4LV9A 4S3EA 1TRIA 2X7VA 4V15A 2Y62A 3EOOA 1Q2SA 1POJA 1LLZA 2JALA 3BH4A 5ABEA 1HKMA 2BMBA 1UYQA 4JD4A 3TVAA 1CENA 3DU0A 1U5JA 3V3WA 4I7VA 1XIGA 2V3FA 3QR0A 1UH4A 4X61A 1FHUA 3N2OA 3VDGA 3LCXA 2VUNA 4PTNA 1XLDA 2C3ZA 1QPKA 3M0MA 4QXIA 1LORA 1YNQA 1HL9A 1P0DA 2QGYA 3IS4A 1DWGM 1PHWA 1LOSA 4C6NA 2EPHA 4QFUA 7ODCA 2Z1XA 4M56A 4N9BA 3ID7A 1VFUA 3ARSA 3D46A 2Y61A 5C70A 1GVOA 4X0VA 1C8XA 1FP9A 2DEPA 3NGJA 3KBWA 4E8CA 1IGSA 2CBUA 4IQJA 1C7TA 3FN9A 4DZIA 5LA2A 3P8IA 3C0LA 1VQTA 2WZHA 3I3BA 3QF0A 3KVMA 3K4AA 4NZJA 1LROA 3LDVA 2OWXA 3LPFA 4Y90A 2ZZ1A 3QW3A 3WDPP 1GQLA 3SUTA 1KC7A 3UJ2A 1LCOA 2NQHA 1A0CA 4Z0SA 5CZKA 4AD0A 3N2MA 4H9YA 5D9PA 3FEQA 4UUIA 2YZRA 4HK6A 2NX9A 3JZUA 3GNPA 3QGKC 5REQA 2HK0A 3A4JA 2GJPA 2PDQA 3E6EA 1UR9A 3FW6A 4LUJA 2ZX9A 1JDDA 2YSWA 3OOQA 4U33A 3G1AA 5F2LA 2CLFA 2E8YA 4PCFA 5HPOA 1YXYA 1ZB5A 1DWIM 4TTGA 4HYVA 3RU8X 3GG8A 4NI3A 1V6TA 1YDNA 2W61A 3HGOA 2VVNA 4UFKA 2BGNE 3NZGA 1CNVA 1XRVA 3HOJA 2DVXA 5GVJA 3CPRA 1J0HA 3MSRA 3W76A 3OQ8A 3H53A 2JEPA 2YDAA 3TYEA 2DUZA 1VS1A 4OHQA 4KF1A 4HB7A 3GNDA 2FZBA 4PB5A 1ELSA 5DY3A 1BTCA 4B9ZA 3WF3A 3QV6A 3MHUA 3URAA 3SUVA 1R3YA 3M47A 4Q4KA 1GOKA 1TV5A 3K13A 3KDNA 2J27A 5DF0A 1RPXA 1W1VA 2VOMA 2WM0A 1VGAA 3EOEA 1ZAJA 3OZMA 3TYBA 1FCBA 3TSBA 2I5IA 3CHDA 4PCNA 4MJMA 5GJMA 1FY6A 1PE1A 2J7GA 2V68A 4V1XA 1JUEA 3BG9A 3GVGA 4GACA 3WENA 3AMKA 2WZMA 4KBXA 3THUA 3KBJA 4BEUA 1M1BA 4LC8A 2WC4A 4TX9A 1HGYA 1OX5A 1C90A 2VHLA 2WMHA 1LUCA 4AU0A 3OLIA 3RM4A 2C6QA 4CQAA 3DN5A 2J8TA 3Q37A 2E6AA 2G0WA 1PWMA 1RR2A 4F2UA 3RO8A 4AIOA 3NTYA 1D3GA 2Y85A 3USBA 4XD5A 3UCQA 4FXFA 1Q5MA 4RE2A 4MB3A 4RDYA 2D20A 4JTQA 4OWGA 2E77A 4WR3A 3W6LA 3OLEA 3VMPA 3WLTA 2E6FA 3MW7A 2NQZA 2Y8KA 4GZJA 2QV4A 3CAWA 4GI6A 3S0CA 3DECA 2HROA 4LS1A 2EBNA 4LYRA 4KESA 3ZLHA 1HJQA 1E1FA 3O6CA 4EWND 4DJED 3C61A 5FACA 3GTNA 2E6DA 3E96A 1MZHA 3GVWA 1H50A 3PFMA 4MY1A 5HXMA 3LYEA 1S2WA 2FKPA 4R34A 4HJFA 5AY7A 4R85A 4J40A 4W8BA 1L6SA 3EPMA 2H8ZA 3IV3A 3FYPA 4R88A 4LAMA 1NSJA 6REQB 1GQNA 3LPOA 4R27A 4QLJA 1O68A 3RG6A 3F4VA 1XLIA 2JKAA 2WAGA 3Q45A 1J93A 4AVOA 1X39A 4B3LA 2VI0A 4FSAA 4MG4A 3SN0A 4H01A 1AD1A 4PCSA 2Y5EA 2ICSA 3UY7A 3GUWA 3WBYA 1FWEC 1BGGA 1O5QA 2I16A 4XAPA 1I1XA 3N25A 2BP1A 4I90A 2QJHA 4QISA 4LUSB 5XINA 3EXRA 4QEEA 4GPNA 3TXVA 1P4CA 3KCLA 4GY0A 3VD9A 5HJYA 3WQEA 3U5YA 1QXLA 3W2UA 2WSRA 3G6LA 4AEOA 4JFTA 3UEQA 1EX5A 2DZUA 2R82A 1X96A 3F5JA 4H6RA 5HR6A 4LGXA 2HCVA 2FZ9A 5D33A 2I5QA 4DXVA 3MV01 4ZBCA 1JF5A 3KXQA 4N6EA 1UPPA 2QS8A 4HHLA 1UKPA 1V02A 3WN6A 1IR1A 1UQZA 2BVDA 4N9CA 4KEMA 1LF1A 3TYZA 3VKAA 2CLLA 3VGBA 4RW5A 4UTWC 3GKAA 4QDWA 5FF7A 2ZVRA 1NDZA 3CQHA 2PP1A 2IPWA 4PCPA 1KGUA 1YMYA 3SSJA 2WSPA 2XUCA 1E6PA 1E5NA 4DYJA 1OK6A 4FLQA 3V16A 1EJ7L 1S3TC 5DT5A 3VTRA 1OC6A 1EBGA 4I3GA 1X6NA 4EAYA 3PC0A 1SPQA 3O0FA 5CAKA 3N6QA 4NKCA 1LQ2A 2XH0A 1LM1A 4WY0F 3QM3A 1MRAA 1J0IA 1QI5A 1UB3A 2UY5A 4QS6A 1QAPA 1GEHA 4LBRA 4PMYA 3QMRA 1JI1A 1UR3M 4UFHA 1CWYA 3GW0A 2PRHA 7ENLA 4UNLA 1TJ0A 3MCNA 1QTWA 3O1NA 4C6DA 4M6PA 1FHLA 3EA1A 3CIXA 2EAWA 4L65A 3LK6A 4KH2A 5K9XA 1B4KA 1CGTA 1XBXA 1I2OA 3VD4A 3GFXA 1GOXA 3VX0A 4XG1A 3EOSA 2D73A 4MZYA 3GR4A 1TJPA 1DBTA 2XN0A 1V79A 1EXPA 4F0HA 3P3BA 1W2VA 4YWSA 4W8AA 2G3NA 4M0XA 1XIIA 3LX9A 4J3TA 5CSRA 2VFFA 1W1IE 4N02A 3AO0A 1H0GA 4LYQA 4RW3A 4IPNB 4NNCA 4UTHA 3W1NA 3L0GA 3MSYA 5FJPA 4YLWA 3GVRA 5HBFA 2VR2A 2X1IA 2MNRA 2PGRA 1EOKA 1R30A 3TCSA 1ZNNA 2V69A 1H41A 3CLMA 1PSCA 4W9TA 2D24A 3V5FA 3ZJKA 4AZ5A 2PPGA 4Q4OA 4Q4RA 5EA9A 1R0MA 4GVIA 4XO7A 3TOYA 5XIAA 1OYAA 1EH9A 3CPGA 2VTFA 5HK4A 1UA3A 1GW9A 3ZIZA 4ICNA 3BAIA 1BG4A 1NH6A 3U9IA 1OYBA 1AMYA 2WO5A 4WKAA 1QPNA 4M6VA 4GVHA 2WC7A 1IZKA 1WKFA 4NAFB 2HXTA 4KEVA 1J2BA 1E4LA 2XSBA 3NA8A 2PTWA 3EOUA 1EB3A 4K3ZA 2CITA 3L2LA 4GABA 3F5LA 1UOZA 4D6JA 2OVLA 2AL2A 1DOSA 3CUGA 2INZA 3T81A 1MEIA 3BMVA 1GVRA 1DJXA 5CPNA 4EPDC 2E0PA 1UIOA 1HT6A 4W88A 1H1YA 3L67A 1J6PA 3R7MA 2F38A 3E2SA 3S4TA 2B31A 3ZXWA 5CJ5A 2QF7A 4LAUA 3N2TA 2PDLA 2J66A 3W7NA 2VZVA 1NDVA 2VWTA 4QX4A 5EMLA 1FDJA 1B9BA 3TN4A 3IUHA 4XZHA 5DCEA 4HMEA 2XIBA 3JRKA 3VKKA 1CB7B 1UMLA 3WBAA 2IQ0A 2XH4A 2FDMA 3BSHA 3BV7A 1H1ZA 3ABQA 3IAQA 3LI0A 5T26A 2IQDA 1JZ4A 4JIEA 1HKWA 2XIOA 1AW1A 3UD6A 1MZRA 5JH2A 4NIRA 4BJHA 4WKFA 1EDGA 2INEA 1JPMA 3LA4A 2DSKA 3N34A 1BKHA 3WUEA 4E3VA 1LJYA 1IWAA 5GNXA 2WW5A 1RJQA 1UR1A 2Y88A 3OQEA 1EGZA 3VKBA 5EBUA 4LUTA 4D72A 1WBHA 4DWDA 2FH8A 3F4NA 1E40A 4PODA 1OCBA 3PJXA 3UG5A 5L9FA 3LLDA 1B0IA 1ESWA 1KXQA 4XKYA 1HKKA 2ZC8A 1M41A 3L12A 4DPPA 2DSZA 4QCFA 3K30A 3AIBA 4ZOEA 1PAMA 3EX1A 2DZTA 2WSYA 2QCFA 4JGDA 4NSBA 1ICPA 3QKEA 1C7SA 5E0FA 5E6ZA 4HTBA 1Z7AA 2E5BA 5E09A 3AS0A 1FWRA 1CB2A 4H6EA 4IP7A 2XFYA 3N15A 3N19B 1QOPA 3K4DA 2Y4SA 3AUOA 1S2TA 3NQ2A 3TC3A 4H9XA 4J28A 1J8VA 2O4MA 1DJNA 1W0MA 2J9ZA 4PL2A 5A8PA 2NX3A 1TX2A 3OBAA 3CUXA 3C2VA 2VFDA 3DZ1A 1D9EA 4KT2A 1UWAA 5AZ1A 4IT1A 4C6QA 4G7EB 3W7GA 2TPSA 1VLWA 1PEZA 2A21A 2QUUA 3ARQA 4YU1A 2OJPA 3GR8A 4AIUA 4RE3A 2Z6IA 2FPTA 4V27A 1Z44A 2Z2AA 3AYSA 3GH5A 2PTDA 3R5EA 4HNTA 4WDTA 4RR4A 3PTDA 1DIKA 2DVUA 3GH4A 1SFLA 2XGBA 3F5KA 4RZ6A 1YIXA 3TYDA 3FKRA 1Z6KA 4JTUA 3RUBL 5AB3A 3W6YA 1V0KA 4QEHA 1WP6A 2EGZA 4A3HA 3WD0A 3AIEA 5IDIA 4GIEA 4FOJA 1EA9C 1Z3NA 5ABGA 1JZ8A 1XGEA 4H9TA 3TX9A 1OQFA 1WOAA 4FF5A 2IKHA 1O6IA 4REQA 1POKA 3ZLFA 2O7SA 3DG6A 2W62A 3KLKA 3OJGA 4U4MA 4MIMA 4M3PA 2XVNA 3H2OA 3VD7A 1FWIC 3QMTA 4GYPA 1XICA 2Y7EA 1DYSA 3W1UA 2GDUA 2OYMA 2CZFA 3A5FA 2GYIA 3AWOA 1A49A 4N7QA 4IL2A 4CD8A 4EX4A 3NPWA 3VYLA 2VCAA 5AHFA 2HNHA 3VZYA 3BCJA 1FCVA 3KBNA 5RUBA 5BU6A 1KGXA 4H9VA 4B4HA 2BHUA 4C6KA 1XCXA 1V02E 1OBAA 3TAKA 2CWNA 3GO2A 4Q8PA 5IBXC 5DLCA 2HE8A 2IPGA 1QHPA 5HMDA 1R3TA 4ZQPA 1XLMA 3HG4A 3NO1A 4G9PA 1E6SM 1HF6A 4IF2A 1E0VA 4NAEA 1VR6A 1BRLB 1YNPA 4MNKA 1KM4A 4UB9A 3T05A 4JQ3A 4LCQA 1KKOA 2WLZA 4O18A 4D6DA 1GG1A 3NIYA 2Q8XA 6XIAA 3MSGA 4O12A 4UIOA 4C6IA 5J04A 1E9LA 3WQGA 4DJEA 4HSOA 2JQXA 3B9EA 3S47A 3GUGA 2NSOA 4RNJA 1UUMA 3DG3A 1FDYA 1MW0A 3NEVA 2H90A 2DT1A 3WMCA 1W1A1 3F2DA 3KDOA 4M7TA 4FXSA 1XYLA 3CTLA 4TMBA 3GS6A 4NI8A 1BQGA 3DHFA 3RX2A 1R9ZA 3F4CA 1DHPA 3MO4A 5A6MA 5LHFA 3RX4A 4NZFA 3AXHA 3LENA 2ISWA 4UQAA 5J5DA 3MCOA 1TZ7A 2EXOA 5D32A 1F6PA 1EUNA 3OVPA 3SCUA 1WXZA 2RKXA 3UZYA 4QROA 1HNYA 3WQVA 4LS2A 2NLYA 1VKFA 4A3QA 1ZLPA 2ZKMX 1XG4A 3LUTA 2VEPA 3TN5A 3R0KA 1PUDA 3WF1A 3WD3A 3DCPA 4K37A 2D0GA 4GMEA 3LV6A 3VA8A 2QAFA 3JW7A 4L4PA 4UMBA 3VIIA 2Z29A 2VEKA 3VIJA 4WVXA 4UXDA 5FJJA 2JF7A 1XP3A 4EPBC 4H8VA 4Z2KA 3A4WA 3W7PA 4D2JA 4LVDA 4AAJA 4DPQA 5I3GA 3SCVA 5LZLA 4AHOA 1UA7A 1BGAA 4L6HA 4BZYA 1IGWA 1MFUA 1C29A 2ZXAA 3WL0A 5ABFA 1I45A 3FGCA 2PA6A 4S2BA 1PKLA 3W27A 1M68A 1R8LA 3KTXA 2DV0A 4GBDA 4M1BA 1LWHA 1R3SA 3HPSA 1S5NA 4MYXA 4PB3A 2YFNA 4I7UA 5HULA 1G4TA 1WDSA 1Y7VA 2Z27A 1Q4WA 1TV8A 3D47A 3LXBA 4MZ1A 4F79A 2P88A 4X9SA 4UR8A 4MAZA 3GTHA 4QNWA 1K9EA 3LRMA 3TU9A 5H91A 2RFGA 1XIFA 2HDJA 3SRDA 2W66A 2ALRA 2RDXA 2PP3A 5LA0A 2J77A 4KWVA 1EP1A 2A7NA 1VFMA 3KW3A 3I4KA 4CVWA 4U5IA 4M51A 3L66A 3MJMA 1XRFA 5BWAA 2QLYA 4RE4A 2F2HA 5KINA 2XHYA 3ABOA 1UH3A 1UPMB 3DGBA 3IGUA 3I3DA 1HVXA 1UR2A 2ZADA 3MTWA 4JCLA 4WJ8A 3DENA 4LANA 1IEWA 4QJ4B 3LSCA 2QPUA 1R46A 4MNMA 2WVVB 4M19A 3VAVA 3PP7A 3ZJ8A 1CYGA 3PS7A 1F3EA 3SN1A 2Z24A 1LQAA 1ZENA 3H21A 3MUY1 1KW1A 1P43A 3HGJA 5DBTA 1QHZA 1G1YA 3UZ5A 1MI3A 4WIWA 1AW5A 2CLEA 3HPZA 2MANA 4QE4A 2VZSA 3QYQA 1TELA 4FP1A 3B06A 1IHIA 3CUIA 1G4SA 4ZMGA 1VFFA 4QG9A 2PWEA 1MDLA 3V36A 3KOYA 5U4NA 3FJNA 1M9HA 1A5BA 5A6KA 2NUXA 2XVPA 3ATYA 4K68A 5H8PA 3WX7A 4J3XA 1IE7C 4XTIA 3OA5A 4FZIA 3AU2A 4G7FA 1QPQA 4FX7A 4MWAD 2QJGA 4XAFA 3IPWA 1FWWA 1PX4A 1RA5A 3MU7A 2C18A 2CEQA 2XSXA 4Q3MA 1DVJA 1JPKA 4K8EA 3ZOAA 4TIMA 3BSMA 2WHJA 2V5JA 2YCIX 3IJ9A 1SQ7A 3E02A 4FIRA 3FVMA 3PHAA 3EA3A 1VCGA 2GSHA 2BY2A 2Y7GA 1FFQA 1PYFA 4JFVA 4QLLA 4L6DA 4CD5A 1V6VA 2CLHA 2WC3A 4AC7C 4YXGA 4O16A 1LRTA 1XYBA 3LBCA 4LVFA 3CH0A 2BGSA 3GH7A 4IQLA 2GQ3A 5I3HA 4WSJA 3RK8A 3PZNA 3VE9A 3AXKA 5A2BA 3W84A 3S1XA 4DUOA 2OU4A 4LF2A 2OR2A 3MWCA 2OSYA 1T7LA 1OCNA 1IT7A 4JTEA 2V5KA 3WNOA 3CPUA 1KLZA 1HO4A 1ODZA 5A8NA 4XZBA 1VIZA 3RJXA 4RE0A 2ZUTA 4XVEA 3LN3A 4WY0B 4HA1A 5CEWA 3OVRA 4PULA 4AHQA 2OFJA 3IACA 4HZ7A 3SADA 2Q8LA 5KITA 2YXXA 2VCCA 2J7FA 4O57A 2VENA 4NNBA 5ECVA 3VIGA 1UWQA 2ISSA 2E5DA 2V5DA 2DSWA 1KBJA 3VFLA 2ONEA 1MQPA 2V2CA 2EQDA 3VKJA 2DPEA 3B0PA 5T9CE 1F6KA 3RRXA 4HNOA 2J7DA 2VD9A 2CFFA 1EQCA 4R7OA 3NL3A 5U7SA 1K7XA 6CGTA 4AD2A 2HVNA 3W7OA 4YYCA 3DYMA 3IVTA 3UJRA 4DIAA 1E6ZA 3WJZA 2PGFA 2PTYA 3B40A 4WDWA 4R7WA 1XQKA 3GE7A 3W29A 1FVPA 2HVOA 2PWHA 1JRCA 4CQCA 3FY1A 4H83A 4XZMX 3S3GA 5BU9A 3KRUA 2PD5A 3K5XA 3NSMA 3C8NA 4PMXA 2G50A 1JJKA 3O6DA 3WJSA 1OIMA 3JU2A 3OYXA 3L4YA 5HNNA 2HPMA 2QW5A 2BTMA 1V8EA 3FCPA 5I3JA 4WDXA 2XIIA 3JUGA 2XINA 3WNLA 1W56A 4ATDA 3C2EA 2EKCA 4YN5A 2QGHA 3VUPA 4Q22A 2PC8A 2VELA 4U3CA 2UZ9A 3W2MA 1QNPA 3KBVA 3OHMB 1UR4A 4CKQA 5KZDA 5KSWA 5KZMA 4MFDA 3N4EA 2X7WA 1WBJA 5H2ZA 4YTQA 4XSMA 2AL1A 3OW1A 3LQLA 3VC5A 1MNZA 1SR9A 1BKSA 4O1BA 3KWSA 3RCMA 3KS6A 1D7FA 4LS0A 4D6GA 1UWIA 2HISA 1W3JA 4GD0A 4HPNA 1EIXA 1WPCA 3W7JA 4US6A 3W7DA 1ADSA 3LY0A 4IM4A 3KUMA 2DSUA 4UBPC 1NF7A 8CGTA 1XLCA 1M6JA 1FX6A 5HUPA 4F8XA 4DO4A 2PBOA 4HU8A 3A64A 2QDEA 4HMCA 3MUZ1 3E1F1 2VURA 3ZSSA 3A13A 1CXFA 4B5WA 1PB0A 2CKSA 5K2ZA 2EJAA 1FWDC 3VO0A 1DEDA 4X22A 2XJ7A 2NW0A 2D0FA 2WCAA 4D8ZA 3N3TA 1UKOA 1M5WA 1ZU8A 3R12A 1O12A 3GHTA 1QMLA 3ANYA 1F74A 1U1UA 3STFA 1KV8A 3CUZA 4LPCA 1RA0A 5I24A 3MBDA 4M81A 4AFYA 3DFSA 5ECUA 4DJFA 4DNMA 4PTVA 1TZ9A 4JEQA 2DP3A 3H7VA 2J9YA 1XD0A 1CLKA 2ISDA 1F8MA 1QNVA 1UD3A 1KR1A 2UY4A 1PJ9A 2X1TA 3WF2A 1E0XA 1XCWA 5EMMA 5G2HA 1SUXA 2IS7A 1I2RA 6REQA 4JHMA 3UA3A 3CMFA 5M1TA 4O10A 3ME3A 3SRFA 4AW7A 1XLBA 5A6SA 1CXEA 4LYKA 3DIPA 4GA8A 1AJZA 2JFEX 5L6UA 1YPFA 2DW6A 3F03K 2YCKX 4DM2A 1H5YA 3H8AA 4MFEA 2UBPC 4LUSA 3TYCA 5CAHA 1U1JA 1HJUA 4FK9A 1KCLA 4HMDA 3GVVA 2VCBA 3PJUA 3WQ4A 4UNIA 2QPSA 4XX6A 5LKYA 4Q6JA 1JD7A 4XK2A 4JKKA 3WEMA 5C2CA 3VUSA 4JTFA 2OYKA 1Q6EA 4IIFA 1EP2A 3T1GA 3O6AA 3TW7A 3EX6A 5AYZA 4EOUA 1V0LA 3U48A 4JIHA 1H1NA 1DP0A 1RJPA 1A5LC 1LZOA 2ODOA 4RK8A 3UR7A 3CL8A 4F9DA 2YCJA 3UXKA 1EPVA 1VFLA 4O1FA 4XZNX 3CH9A 1NAL1 1VBJA 2J9XA 1IWBA 3UJSA 4H9ZA 5CBIA 3XISA 3VOHA 4OE7A 3ITTA 5TD4A 4QBXA 5LYRA 1XSIA 3AJXA 4HBKA 4XVDA 1UP3A 1ZJBA 2FLIA 2VX5A 3H54A 1EJXC 2C7FA 1YKWA 1Q63A 4QE1A 2B0MA 2FZDA 2E09A 1P6CA 4FNUA 1WCGA 3KVLA 5C6MA 2CESA 2NT0A 1VF8A 1O1HA 2YCLB 3OO2A 1I8JA 4U2YA 3W28A 1FWJC 1AK5A 2RDTA 4F0KA 2GL5A 1EIBA 2GJXA 3UXAA 1WXYA 4Z42C 5D38A 2ZC1A 3QVQA 2XM1A 1XLGA 4XD3A 4Y9NA 4WXYA 2PD9A 1UP2A 1KKRA 5G4EA 2F84A 1XUUA 2VFIA 1XCFA 2J75A 4IFKB 3B9AA 1DIEA 3HPXA 4C7FA 2J78A 3V75A 4B5XA 5AC8A 4XUGA 1UP0A 2R1LA 4UR9A 5JBDA 2YA1A 3M44A 1TZZA 3RXZA 4UTLA 4BQ5A 1W5OA 3PVFA 4GJJA 4NL1A 2V3EA 3S2LA 1TPFA 1KNWA 3ARZA 3IJ8A 2A5HA 1GKQA 4XTDA 2FJKA 2HMCA 3HJEA 4ZL1A 4V1YA 1SM9A 3JS3A 4QR6A 5E9XA 4DEFA 2OZ8A 1CI1A 1F5ZA 1JNEA 3CO4A 3PG9A 1VJZA 3GIQA 1XRSA 4O13A 2YBUA 1ZALA 4U2ZA 3R94A 1QK2A 3GTXA 4Q4SA 4ZQCA 3CT2A 3MY9A 3U4AA 3OG2A 2I5GA 2PDKA 4NZ5A 3NUKA 2VDGA 2CLPA 3TA9A 4L1GA 4GNVA 4AVFA 4O1AA 4PUNA 1UC4A 3L9CA 4CQ8A 3DC8A 5I03A 3N14A 3W3OA 3NQVA 3BANA 2Y8UA 3TFCA 4JOMA 4BR1A 3OGRA 1CLXA 1UKQA 1TX0A 2YA2A 1XDJA 2Y5SA 3FNDA 5FJUA 1K7FA 4Q4QA 1NY1A 3RO6A 3UVAA 1XC6A 4O8RA 2FTPA 3UQNA 3TV8A 3SI9A 4PUMA 1S38A 4C5YA 3SIMA 1W5QA 3ABRA 3EPNA 2B81A 3SCNA 2W4XA 1W17A 2YW3A 3TC7A 4ZGYA 3VGHA 1JDAA 4ENLA 3P80A 4CCCA 3FHQA 4K6AA 3NVTA 1AVAA 1OFRA 5A8MA 2QCHA 1FQ0A 2OKOA 1M03A 4OFCA 4ZVJA 5MKGB 5C54A 3FXYA 4PMOA 1YBQA 2QQ6A 1V51A 1NTHA 1V6WA 3H2NA 1AZ1A 4NJJA 4FF7A 3AIWA 3WJWA 1H62A 2P5NA 1K9FA 2OB3A 4L4LA 2CHOA 4MWAA 2QCDB 2ZUWA 4LFYA 3W1LA 1CXKA 1DWAM 3WLOA 3F2CA 3AHTA 2NVDA 4KWWA 3WK0A 2FGLA 5KEZA 3M0VA 1VJSA 3B4UA 3T2PA 3WQ6A 4M6UA 2QUVA 5F2MA 2CLOA 2H9AA 1GVSA 3T7VA 5DMYA 5I3FA 5D9MA 2R14A 2WMGA 5GNYA 1KA9F 1H09A 1RBAA 3HBLA 3W2KA 4XKMA 2P76A 2Y1HA 4R9OA 1M04A 1E71M 3ATZA 3M0IA 4K36A 3S6OA 1W54A 5REQB 3ZT6A 4KQNA 2PRMA 5I77A 2YPIA 3COTA 3UXIA 1UHVA 4P8XA 1SJCA 3WQPA 3E0VA 3AUJA 2BLEA 3ALFA 4P8WA 4GCAA 1KB3A 5D2VA 4QDPA 4GUFA 2A4AA 3SEPA 2VX7A 3ECQA 3S5YA 3R8HA 2QXWA 2YB4A 1J96A 1H11A 1G01A 1I2NA 3W1PA 1TTIA 2E1WA 4G56A 3S46A 3MKCA 2PODA 4XIAA 1UWSA 1VYRA 4LSBA 3OLGA 1OT1A 1GZJA 2VQTA 2GUUA 3NYZA 3UW6A 4W8LA 3MB9A 3VGDA 3QTGA 3POCA 2ZZ2A 4KFOA 1H7PA 3RITA 2VNCA 3TKFA 4KGJA 4QNEA 1T40A 4LB4A 2DZWA 3MV11 4I8DA 3WQ8A 3UESA 3EMQA 2NV2A 3CASA 2ZUNA 2YOCA 5DBUA 2QMKA 3B0YA 4YHEA 1NIUA 5SWUA 1A53A 5AHMA 5JH1A 1MRQA 3MBFA 1ITUA 1MMFA 1XPGA 3N3MA 4NUWA 3HURA 4CCDA 4QJ1A 3NZ1A 1LOLA 1TJ1A 4KRZA 1XIBA 1GCYA 4DBWA 4JTTA 3UU0A 3NM3A 3CZ8A 4FS9A 3C5QA 3QLDA 1MNSA 1P0EA 4S3BA 1N8WA 4PMRA 1FH9A 5I6SA 2NVCA 2ALDA 4LJ3A 5GNZA 1E0UA 3ARXA 3LI1A 5CXPA 2WWCA 3N9RA 4CUCA 1LUCB 1SGJA 3BZJA 3O07A 2Z28A 3CQKA 4IX2A 1QI4A 1RQEA 2XGIA 5JBEA 3M0ZA 3N9KA 1MXSA 4AF0B 4CU7A 3TQVA 1ONEA 3MMWA 4B15A 2V3DA 2XTKA 1UROA 1K7EA 3MO7A 3W0KA 1TKKA 1JRBA 3GHUA 4B9YA 1J01A 3WD2A 1ITXA 2TMDA 1CGUA 3VNKA 3M41A 3BQ6A 3KBMA 4WQ6A 4ICMA 4PFHA 1JPDX 1GJUA 1Q65A 1K9TA 3GHSA 3ARUA 1XM3A 4F40A 1JZ2A 3OP2A 2ZUVA 4DLMA 1OX6A 2V5BA 2X8RA 3CL6A 1XIJA 4M8UA 3BOLA 3JZEA 3FSTA 5AYIA 1C91A 4QITA 3M9YA 2GQAA 4TTUA 1H4PA 1QT1A 1MFVA 2F6UA 2PTXA 1JPHA 1BYDA 4H04A 1PKMA 4AEFA 1NP2A 4IH3A 2A1YA 3RN6A 1W8GA 1G67A 3OBKA 3SBFA 2QCCA 3RF9A 3BAWA 1TCDA 5C7VA 3BSGA 3LGDA 9XIMA 2QR6A 1I0BA 3RAOA 3QC0A 3THAA 1NEYA 4OBSA 3CMJA 5FF3A 1EGVA 4ADSA 3QZEA 1V77A 5CC5A 3P14A 4L56A 3EAUA 1ZFJA 2PLJA 1IQ8A 3E0LA 1OABA 1JXKA 3AQUA 2I9UA 3WH8A 4IOTA 3WQOA 4CNUA 1GVIA 4S1FA 1UWUA 3NQMA 3P0WA 3QHOA 4DJEC 4H6QA 3VIPA 1KWGA 3PPHA 3EB3A 1TSIA 4DUXA 2ZCGA 4YVVA 4IIBA 2J8FA 1SMAA 1HJWA 5BRBA 2DZAA 1DE5A 1JCMP 4WJXA 1GOWA 1FWHC 5D05A 2R1KA 4G8TA 3WQWA 5DCDA 4UMCA 4V33A 5JIPA 3LHUA 5LXEA 1HGWA 4U10A 3HQ1A 1J4EA 1HTIA 5MF5A 1XLJA 3I7RA 3KBSA 3WG6A 3TWAA 2DW7A 5FKYA 1T41A 1OB0A 4O4WA 2Z1KA 3MUXA 3DFYA 1Q6CA 3QFEA 4JTAA 4ADTA 1DQWA 2FZ8A 1ZAHA 3NURA 4RV3A 3T07A 3C3NA 1RQHA 3G8EA 4UWMA 2WANA 1F8IA 4ACYA 4B91A 4UFIA 1PDZA 1BHGA 3QHNA 2JKPA 3CZJA 2G97A 2YDQA 1RD6A 3T0BA 1G5AA 4PTDA 2CZDA 5DO8A 3Q67A 2C91A 4UZUA 2CZEA 3UWQA 1QK0A 2WV8A 3B0VC 4EPKA 1K1DA 2VC6A 5G4HC 1H0IA 3LTPA 1XH1A 1V6UA 2XFFA 3G3MA 2YR1A 3OLDA 3T0AA 1JGMA 4KFPA 4AWEA 4IWWA 5EMJA 1QASA 1QCWA 1UKTA 3TYAA 3VOCA 4YMZA 3WMBA 4HCLA 4C7GA 3WDIA 4M80A 5G1MA 2H3DA 1EJRC 3TTSA 3M0LA 1DWHM 5C9RA 3H2EA 2C16A 3IANA 4QE5A 3GU9A 2I9EA 2NXIA 4RNHA 4W7UA 2I56A 9XIAA 4R3UA 2XDFA 2JKEA 3B8IA 1E70M 4ZQRA 1YTEA 3N13A 2ZDRA 1B90A 1H2JA 2WZTA 4AEEA 4S39A 2VDHA 5ENLA 1EJSC 1ZCOA 2Y6ZA 4FX8A 3AROA 3KRSA 4WZHA 3H2CA 3M07A 1ZHAA 1TUFA 4TV6A 2ZA2A 4IIEA 5FI8A 3SURA 1EJTC 4AY7A 3U57A 3CHFA 3NO3A 3DGRA 3N1AA 5HWNA 3NQFA 1TUXA 2E9BA 1XISA 3V1PA 1VFTA 1L2QA 4MWAE 1ISVA 4A22A 4M29A 5HMFA 1TTQA 2WVVA 3S2NA 3GRIA 4DAIA 5PTDA 3I4EA 1LT8A 3CLWA 3ERPA 2V5CA 1W2PA 2AL2B 2FHBA 4H8UA 2IUZA 2Q3OA 3T44A 2WOQA 4Z1CA 4Q8OA 4PRRA 1XG3A 3B05A 3LPPA 4L5ZA 1Q4NX 3TTEA 1A5KC 3MMUA 4MKSA 1WV2A 2QCMA 2BOGX 5C2XA 1Y8BA 2CKRA 2WKJA 3APYA 2OPJA 5EL1A 4J27A 4JKLA 3GXIA 2CLKA 1XRTA 3NPUA 2JEQA 1PZ2A 3ITGA 4CVUA 2FMNA 5I07A 4MSSA 4DO6A 4QG8A 1RK6A 3NQ8A 3RPMA 4N42A 1NARA 4IXHA 2TSYA 1H7XA 4PTXA 5J8LA 1Q8AA 4HCDA 5BYWA 5K9CA 1TA3A 4NQ1A 3BW4A 1K8XA 4Y6GA 1KFKA 1V3IA 4QHRA 3PWIA 1W8SA 3BLPX 3D5HA 1P5BA 3NAVA 1K77A 1BWVA 1LLWA 2OX4A 1KO0A 4OOZA 3STCA 1WKEA 3NGFA 3W88A 3GNNA 5A8GA 4HA4A 4FLRA 3IGXA 3VNJA 3RM8A 2ZRYA 3LQGA 3SO7A 3C2RA 1Q3NA 4M6QA 2XN1A 3DFQA 4C6FA 4E2OA 2VUYA 4KERA 4ZENA 3DHUA 1RVKA 1W1ZA 2ASHA 1WUFA 4NZ1A 4TMCA 2X05A 2PWUA 1VJIA 3BJFA 2O9RA 4LUTB 5G5IA 3LEPA 4J3UA 1ME7A 2ON3A 3L68A 5C71A 2PP0A 4XKYB 2BVWA 4BQ2A 1TCMA 1Z69A 3AXXA 2VD8A 4JL2A 3W9ZA 3GYCA 3SDOA 4MJ4A 4WEVX 3AIVA 2C71A 1XV8A 1J10A 3QEZA 2CZVA 2FGBA 3MUIA 2HRWA 5EMKA 6XIMA 4JFWA 1FBAA 2D2OA 1B3ZA 1E4IA 2J7BA 1O94A 1S1PA 4IIDA 3EPOA 4GYJA 3RMEA 2ACSA 1V08A 2G5WA 4JKMA 2PDHA 4KRUA 4OKDA 5FJIA 4AYSA 1Z32X 5A1AA 1KRMA 4FOUA 3DFOA 3NZQA 1TB3A 4X9YA 4JQ2A 1Y5VA 2PTZA 5HDRA 5I7GA 2WNWA 1R86A 2X2GA 4B5SA 6TAAA 3QYSA 1NOFA 2ZA3A 3M6YA 3UGVA 1AH0A 4FOKA 4O53A 1UW9A 4ONVA 3EMZA 4PMQA 1QO2A 3A3HA 2ZZ7A 4H8HA 2OODA 3KCJA 2OZTA 3L4TA 3L7RA 2WBKA 4DJDD 1W9BM 3I6RA 4QAWA 5TF0A 1OF6A 3UYIA 3S9ZA 5C55A 4GOAA 4PUUA 3STGA 5IDZA 3PTQA 5HPCA 1V6YA 4Q33A 3VM7A 3BXWA 3WLNA 5A6AA 7TAAA 2EKGA 4MKVA 4Q32A 5C9ZA 3RLGA 2PDGA 2PF0A 2HVMA 3NO5A 3SZ8A 5LNUA 3IWPA 3UR2A 2AMGA 4PR4A 1KXHA 2AGKA 1W3TA 3WBEA 1U30A 2ABBA 2OTDA 3SB0A 3HGSA 3SRKA 3R0UA 1YTKA 2C14A 1HP5A 4REQB 4UCGA 3APGA 1UJPA 3QXBA 4LBUA 1XLEA 1F7BA 1WKDA 1GJPA 3JVAA 5I78A 3O15A 2Q71A 5AKQA 4AIEA 3TAOA 1EWEA 1R9YA 4QCEA 4D6FA 3ANVA 1EZWA 2QMJA 2VQUA 1D8WA 4WXZA 3TEVA 4I5UA 4PL1A 2IPFA 4HVXA 1DXIA 1PIFA 4MPQA 4NHVA 3LRKA 2ZZ4A 1SW0A 1DPMA 4JQ1A 3KM8A 3H24A 1GKRA 3ZZ1A 7A3HA 1V3MA 4U3AA 1NFGA 3VFCA 1W9VA 4XIMA 3UJEA 2Z26A 3LGGA 2V82A 1WAWA 1TMHA 3VE7A 4CQ9A 3ARTA 5DXYA 1R9XA 3URQA 1AH3A 4C91A 3W26A 4NAEB 2AMXA 2W0UA 1BQCA 4QLKA 3MP5A 2V6AA 4JIRA 1BSLA 4KEZA 1SO3A 1VCVA 3EDDA 4H9MA 3F4DA 3VILA 3V0SA 4JICA 4P7OA 2PURA 3T08A 1J9YA 1MO0A 1VEPA 3G1HA 3W6MA 1Y0EA 1YE4A 1AJ0A 1SU5A 3NDZA 3WY1A 3T78A 3VABA 2ZRUA 4HNNA 3WZ0E 1WZKA 2FMOA 3Q94A 4DJFC 2YW4A 3QY8A 4I9TA 3P81A 3G22A 4TUFA 2VC5A 4ZE4A 1W5PA 5FSEC 4DQWA 4Z1YA 1ITCA 2FHCA 1UG6A 4E5TA 1Q13A 5D30A 5CBJA 1JIBA 5XIMA 4ZB5A 4AWTA 1C3FA 2Q02A 2WJEA 1MW2A 2GUYA 4M5PA 3UF9A 1MDRA 4DI9A 3HU7A 1L2UA 4ATWA 4RZ5A 3F2BA 3W2JA 4Z2IA 2EPOA 4YTRA 3FVDA 3HPAA 3U7VA 3T8LA 5ABHA 4MF4A 1KFWA 3VCNA 4L9YA 3UZWA 3W1QA 5FEPA 2YKKA 1GKPA 4PMNA 1K3UA 3MI3A 1FH7A 4UTIA 3RCNA 1XBYA 3SRHA 4A4AA 1YW1A 3VGGA 3QQWA 3QY6A 5C0QA 1V03A 4CN4A 3E0FA 3V18A 4PBGA 3P60A 4IL0A 1SO6A 3KCOA 5DMMA 2VFEA 4LCSA 1QW7A 1S2CA 2FYMA 2PLKA 3E12A 3L4UA 4NJIA 3ONCA 1QATA 4J3VA 5EY5A 5ABFB 3FGCB 2DSVA 2C1HA 2QPXA 5HATA 1DJWA 4PMZA 3W75A 2XIQA 4W5ZA 1G4EA 3KVKA 2FPYA 3CHEA 5F2IA 1QWKA 1I60A 2NX1A 4IXXA 1N55A 1BXBA 4C6BA 3UVIA 2ZUSA 2XVGA 2DT0A 4Q8UA 2XSAA 1FWTA 3SUSA 4AZHA 1IT8A 1QW9A 5F1UA 1U1HA 4F48A 1XIMA 1F4HA 3VOIA 4PUKA 5CBBA 5AYYA 3S1WA 2VEFA 4E2BA 1HP4A 4O54A 2WCGA 3S5ZA 1UCWA 1XYFA 3ES7A 2WZEA 2RDUA 1H3GA 1HJVA 2FH6A 1JFHA 3TP4A 3R0DA 4DLFA 2ZWZA 1EC8A 1J6OA 3SJ3A 3VNYA 4KIRA 4H1ZA 1ISZA 2O9OA 1BTMA 3CTTA 1W37A 2Q3RA 2Z2BA 1SSDA 1VZWA 1N82A 1ONXA 4LT9A 2V0TA 3KE0A 4X2RA 4O11A 3E2QA 3EWWA 5AN7A 1VAHA 3MUAA 5AC4A 2CCRA 3D3AA 2OEMA 5EMYA 1F07A 3NG3A 3U8GA 2WNZA 1X1OA 3PBUA 1GUVA 3PAOA 2OSWA 4K8GA 3GU2A 3IIZA 2GJLA 4FNSA 4F3HA 4HU0A 1TMQA 2OZ3A 1Q45A 1A3HA 4Y8EA 1SO4A 3LBMA 1GYLA 4NG3A 3E2VA 4NRRA 2YGYA 1ME8A 3CV2A 1LL7A 1AQMA 3BOFA 4L64A 2C19A 4WX2A 1GOQA 4GISA 2PDFA 2DH2A 1E6QM 3NWRA 4EAMA 1EDTA 1S1RA 2AAAA 3P84A 2CNCA 2C1GA 3BARA 3CZEA 2J25A 2FVKA 2Y7DA 2QVNA 3BJTA 3EWZA 3GWQA 2GGGA 3AXIA 1WO2A 1ZTVA 2YYUA 2J88A 4HU4A 4HU3A 3SW6A 3TJ4A 3C0JA 2GQ9A 3EKLA 3CZGA 4PYSA 1H49A 4O14A 1DORA 3O63A 3OGSA 2GFTA 3PZUA 2BVYA 4DB7A 1AODA 1I2PA 5JQ9A 2WSKA 2ESCA 1LBLA 5FIPA 4A8NA 4IGSA 3UA4A 3SQMA 2WNQA 4E6MA 5B7ZA 4F2BA 1R6WA 1WXJA 1GOOA 4AYGA 5A8QA 4JN8A 3NQ7A 2PGWA 1XBVA 1LG1A 3BJSA 3MHFA 1NQ6A 3WLMA 4Q8WA 3BCDA 5AOUA 1L9WA 1LL4A 2JK2A 5MKGA 3NOYA 3BAYA 5LNRA 1HZYA 1IZJA 1EC7A 2DFAA 2VYOA 4NILA 3TNBA 5ABTA 1XQLA 4LX4A 3W82A 2QDDA 3DI1A 5C9XA 4MWAC 2AKZA 5E70A 3PAJA 5I23A 4JL1A 2QCDA 3LS9A 3OU8A 1SZRA 4B16A 4ROQA 2XH7A 2Z0IA 2O9TA 3KTSA 3R1ZA 4FNPA 2OO0A 1FRBA 2PB1A 1Q6RA 4QJ3B 1FWFC 5M03A 2FJUB 2PAJA 3STEA 1QU4A 5FJOA 2JGQA 2WQPA