4RKAA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a347
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with DH03A347
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 137
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rkaA00
4K6AA 3VCRA 4K37A 2TRSA 1VZWA 1K7XA 1PHWA 1SO4A 3NXFA 2X1UA 1PE1A 4M7SA 4O50A 2R91A 4Q4KA 4LS1A 3NDOA 5DBUA 3HGJA 3B06A 1OFAA 4JYEA 1J5TA 1HTIA 2NXGA 1OFDA 1R2TA 1O4UA 3DI0A 4EF8A 5D02A 2ZZ3A 1X1OA 5I3KA 3MP3A 3M5YA 1OG0A 3T40A 2I1OA 3P7YA 4GUIA 1ZHAA 4ML9A 3IEBA 1ICPA 1JRBA 3TW6A 1GEQA 1TV5A 4NX5A 1O94A 3YPIA 3O63A 4IX0A 1SZFA 3C2VA 3EXTA 1SO5A 3HOJA 3MI2A 3KX6A 1DJQA 5KZMA 4AWUA 1LOSA 3P61A 4GXMA 3LTSA 1EUAA 3NM1A 3PR2A 3N3MA 3W73A 1KFBA 4CCDA 1W3IA 4MPQA 1DL3A 4JDYA 3TE9A 1FCVA 4D2JA 3CPRA 4P2VA 3TQVA 3FYOA 4IPJA 3M44A 3DENA 1NF7A 2CZ5A 1NFBA 3L66A 1YDOA 3W87A 3BLIA 3TMQA 1WAUA 1XUUA 1GPWA 3C56A 3N9SA 5DLCA 1KTCA 2JKPA 4X2RA 2E5BA 3IIZA 4IXXA 1I4NA 1P5BA 5G2WA 4UTTC 1GVSA 3UWUA 3MBDA 3NL3A 1ZAIA 3NQGA 4O0KA 2QJGA 1LM1A 3P81A 4RKAA 1TPC1 4AHPA 1L6WA 1FY6A 3DFOA 1JVNA 2E5DA 4QIUA 3TA6A 1DV7A 4PCFA 3BARA 3KRSA 3N9RA 1DJNA 3M1ZA 1VHNA 4FIRA 1OJXA 1YTEA 4JTTA 1EPXA 2G97A 3LRMA 4CLMA 5EMUA 3LI1A 2ZA2A 1GYNA 2P0OA 3SFKA 2WSQA 5U7SA 3ELFA 1W3TA 3M5ZA 3DAQA 4W9TA 1LP6A 2Y6ZA 3LCHA 4UCGA 1EP1A 4YLWA 3EX3A 3LCGA 4UIOA 5CZ0A 1GTHA 3C0JA 1SFJA 1R46A 1TB3A 4BWLC 2CW6A 4PL2A 1S5TA 2EF9A 2HS6A 2HSAA 3B0PA 4GJ1A 4LVAA 2E6YA 1EIXA 4N4QA 3E12A 3GZ3A 1TV8A 3QEZA 3NQ2A 1G7VA 5G1YA 1TMHA 4TO8A 4WXYA 4Q32A 4ORMA 5DY2A 2QKFA 1RR2A 1OK6A 3G0SA 1ZNNA 1DOSA 1LTDA 3MHFA 5D09A 3RU6A 3W6YA 1GYLA 1YDVA 2J9XA 1JCJA 3HGOA 5MHBA 1EEPA 5HR6A 2H3DA 1MZHA 1Z41A 1LLWA 3EWYA 5I3GA 2C19A 2H90A 3QMTA 4GE8A 1RD5A 3EX6A 3Q2DA 3W85A 2B7QA 1S3HA 5T26A 4BFAA 5F2LA 3NL5A 1VR6A 1VH7A 2XFWA 3G3MA 1LRQA 5K9DA 1D3GA 3EWWA 1R47A 2W79A 3NO5A 3A9IA 3P8JA 3LDVA 1MXSA 7TIMA 1ZJIA 3EWXA 1XXXA 2WNQA 2WJZA 1LLZA 4A22A 1XBVA 3UWQA 2QF7A 4RX0A 4DPPA 4ORIA 1V5XA 3C4UA 1H7PA 4M6PA 5BNKA 4IQLA 1K03A 4YMZA 3PS7A 2NXIA 1KM3A 2QUVA 1PV8A 4JIPA 3LXAA 3W7JA 3NQVA 1WXJA 4LWWA 3PUDA 4LNYA 1E51A 1Q6QA 5FEXA 3S5ZA 3U6WA 1WQ5A 3W1QA 3G1SA 2DZVA 1VGAA 4ADSA 4LT9A 3B0VC 1HFBA 2ABBA 3GDLA 3LM7A 1YXCA 1LROA 1GTEA 2GQ8A 1W5MA 3CHVA 1H1YA 4GRSA 1DQXA 1RZMA 1Z48A 2V8ZA 3GR8A 3W7RA 4M5PA 3A23A 1TPEA 3QMSA 4UTWA 1PIIA 3KAOA 5F2GA 4EWND 4ZVJA 3ZWSA 2HTMA 4LU0A 4R33A 3W7EA 1IF2A 2YFOA 4UTLA 1OYBA 3EX4A 3OG3A 1AW1A 3A24A 3GK0A 1ZAJA 1IXNA 1GVFA 4IMEA 2BSLA 3NR0A 1A5CA 1FDJA 3S6DA 3QC3A 5HUPA 3TROA 3CEUA 5BW6A 2FIQA 4TU1A 4JTKA 4U4MA 3WFAA 3S8HA 1P0KA 4HKPA 5I3HA 3O1NA 3WK3A 1YADA 3GDTA 3STEA 1AK5A 2A6NA 1O60A 5FF2A 2WSRA 1F73A 1HG3A 2RKXA 3G8EA 3HIJA 1FQ0A 1OFEA 4OWGA 3LB0A 5HWNA 1AMKA 3E49A 3P5ZA 4XQ6A 4DEFA 3N19B 5AC8A 4LC8A 1M7PA 1IGSA 2CLKA 3MW7A 3I7RA 2ZRXA 4E0CA 2LLEA 4JDBA 1G69A 5G4WA 1TRDA 3STFA 5CZJA 3HB9A 1CW2A 1QAPA 1CI1A 1JCXA 4YCOA 2G95A 4LV9A 1WDWA 2WPBA 1EA0A 4K8HA 5CSSA 2J27A 3IRDA 3LOTA 1LYXA 3UWWA 3QRHA 4B5NA 3DFPA 3UXDA 3W1LA 3W76A 5D05A 2DZTA 1TV7A 5TQLA 2XN0A 3KRUA 4L4MA 5BMXA 5FI8A 1OFPA 2JGQA 4HNVA 3O16A 2OZ0A 2A7NA 4HIBA 3CM4A 4U28A 4YL2A 5HINA 5D2VA 3PWAA 3LTPA 4QM1A 3KHJA 4MZYA 4UFIA 5AHMA 4JD4A 3BW4A 4UTWC 3M16A 4N6EA 4JY8A 5K2ZA 2B7PA 5LSMA 1O5XA 5AHNA 3F1QA 5CZTA 3BK0A 4AF0A 4PFMA 3TXVA 4K7YA 3TAOA 5A8GA 1AL8A 4XUGA 3W7OA 1YPIA 3R8RA 3LHTA 3N34A 2BX7A 3LV6A 3NQCA 5HQEA 4JX4A 3C2RA 1H5YA 3G3DA 3P5YA 1QWGA 4LY8A 5LNRA 1SQ7A 1VYPX 2WKJA 3L68A 3C2EA 1OF6A 2Y7EA 4OE7A 3WJWA 2EKCA 5D30A 3W1MA 1L2UA 3CC1A 5EYWA 4PODA 4JTUA 1TTIA 3TJLA 3NPUA 1TRIA 3FOKA 3WJSA 2VC6A 5AYXA 4JTFA 2B7NA 4ZQNA 1SPQA 2GOUA 3G1FA 3LHZA 3IVSA 2QCNA 1F76A 3QFEA 1W54A 2QCLA 3GDRA 5J5RA 3PAJA 3S1XA 2ZDRA 2BXVA 2RDUA 2VENA 2VEIA 3ZFHA 3OVQA 1JQVA 2I9EA 2NUXA 3M0ZA 3SI9A 1XI3A 5HWMA 3TQ0A 4DO5A 3LRLA 3R5EA 3K30A 3OIXA 4RZ4A 4LW7A 5GVJA 2PCQA 4JICA 3PVFA 3BO9A 4GBUA 4UMAA 3KVLA 1B4EA 1JR1A 1CX9A 1VRDA 1VHCA 4UR8A 1GT8A 3G1HA 2FDSA 1XL9A 3LX9A 2E6DA 2Z0IA 3CB8A 4MY9A 3W7IA 4GFSA 4Q33A 2YX0A 2GJLA 3G0XA 3PBYA 2X2GA 2QCGA 4M19A 5L6UA 3WK0A 3W1XA 5FF0A 1YYAA 1X8FA 2HS8A 3EEGA 2NV2A 2VFGA 5EA9A 1OHLA 5G5IA 2ZZ5A 2WSYA 1YDNA 2VFIA 1W31A 4ADUA 1VJIA 1B57A 1OVDA 2DZPA 2FQIA 3TXZA 1MEWA 4WOQA 1A5SA 4OBTA 5CPLA 1KTNA 3EWUA 4HN4A 3W1TA 4WUIA 5IM51 3LXBA 2WO5A 4DELA 4AEOA 3PSVA 3V1PA 1G67A 2E6FA 3NNTA 1OFQA 5H91A 3WJXA 3TSDA 2QCHA 4AF0B 3L21A 2OJPA 4TX9A 3W84A 1L6SA 1IIGA 1MEIA 2GVJA 1QPOA 2J24A 4AWSA 4ZQCA 1JRCA 3VNDA 3W7NA 4Z0SA 3O05A 3PM6A 2DP3A 2FB3A 4UTTA 3EWBX 1F5ZA 2QJHA 2F84A 1OX5A 4UR7A 3Q37A 3GLCA 5FF4A 4M6VA 1XUZA 4MUZA 1TQXA 2WV8A 4RJEA 3G24A 2E6AA 1ICSA 2WOQA 1KFCA 2ZZ6A 3W2LA 4IUOA 3WK2A 2H6RA 3W75A 4O1DA 3RLVA 4N9DA 4RCXA 4O57A 3THQA 3SJ3A 2ZTJA 4XBSA 1EWDA 3F4WA 5BOOA 2QUTA 3P84A 2ISSA 5G1TA 4GNJA 4N9EA 4N9CA 5AN7A 4BWLA 1RV8A 1GG0A 3NGJA 3KVKA 3MHUA 1ZENA 2A21A 3QYQA 2V0TA 1C29A 1T96A 2FPTA 4JTLA 1QR7A 1WBJA 1UJPA 3LCIA 1D9EA 3TMLA 5F2IA 1UUMA 1XM3A 5CSRA 3HG3A 1LDCA 2PRLA 3RNDA 3G1AA 4JNMA 1ICQA 4PL1A 3HO8A 3EKLA 1QPRA 1VLWA 4WD0A 1HO4A 1SW0A 3M6YA 2IQTA 5K9XA 1SZEA 1LORA 3BW3A 4K39A 1JUBA 1N55A 1H7WA 2QR6A 2A1YA 3M47A 3TU9A 3A22A 3KRZA 3GNDA 1W3NA 5CPMA 5DCBA 3W2JA 1F2JA 1LRTA 1I2RA 2TPSA 5AHFA 3ABRA 3PBVA 4MJMA 3P62A 3OVPA 2C16A 3NPWA 3EB2A 2NXHA 2GPTA 4OV4A 4X22A 3S1UA 4O17A 4K8EA 1H7RA 3E0IA 3SECA 2CLEA 2V82A 1LBMA 3W72A 3TAKA 1M5WA 3DHFA 3QW4B 4QISA 3O15A 2CLMA 1VYRA 4OQVA 2QJIA 2GJNA 5E1QA 3MBFA 3MI6A 3W2UA 3QZEA 1UASA 1KM5A 2DZWA 3LBCA 3SY5A 2AAMA 5AC7A 3Q94A 4BF9A 4FXSA 1I8JA 1DHPA 2ZA1A 3G22A 2A7PA 1B4KA 1IXQA 1GQNA 4FIQA 3PG8A 5DN1A 1TYGA 4N6FA 4S1FA 4UTUA 3TJXA 3BV4A 2YW4A 5FF3A 3NQMA 3MP4A 3UWVA 3G1XA 3JR2A 4HSNA 4C1KA 1XBZA 5AYYA 3BG9A 1S5WA 4ZQMA 1PHQA 4YCPA 2G96A 1XBXA 2B4GA 4M6QA 4O52A 3QM3A 1KBIA 2VFHA 1QO5A 3TSMA 2V30A 2G5WA 1SSGA 4FNQA 2VOMA 1F6PA 1TCDA 2C1HA 3NL2A 3P67A 3GKAA 5E93A 1TTQA 1K3UA 2VFFA 5LNWA 4JYDA 1BWLA 3DKJA 4GUJA 3TFXA 3A21A 2YDAA 3G8RA 3UPWA 2FFCA 4PH6A 5DELA 1A53A 4IWWA 5KINA 4DF2A 3W23A 4K36A 1TPWA 4A2RA 1JCLA 3C61A 3INPA 3RFAA 1W37A 1KM0A 1P0NA 2QCFA 3T78A 3UY7A 2J9YA 1U5JA 1QOPA 1SU5A 1W5NA 2Z1BA 5F4XA 5HNRA 4Y9AA 4Y90A 1F05A 3ABQA 3IVUA 1NVMA 4IX2A 3I65A 3IGSA 1RPXA 2DZXA 2R8WA 3PY2A 1QNVA 1TJPA 5K9CA 1KFLA 3DFQA 3IV3A 4FNTA 5F4WA 2FLIA 5U4NA 1P4CA 4LVDA 5BRBA 1NEYA 1OX4A 3HGRA 3B04A 2V5LA 2NUYA 1BTMA 2ZRYA 4I7VA 1W8SA 1JJKA 4K38A 3SSJA 1F74A 1WBHA 1FXQA 3HQ1A 4MJZA 4UTJA 3BLFA 4J9JA 1FWNA 2DZSA 1JCYA 4H4IA 5EKYA 4P61A 1GZGA 4KFOA 2VXNA 2ZBTA 4MLRA 3H53A 4DF0A 3AO0A 1DBTA 1H7XA 3TK7A 3RLUA 3B0UX 1LCOA 4MYAA 4ONVA 1N8FA 3M7WA 4NVTA 3WK1A 2V81A 4NT0A 4EVZA 1WA3A 2GUUA 3FFSA 4TR9A 3UZJA 4GWEA 1YTDA 3T44A 2Y63A 5CGQA 1W5PA 4N2YA 1G4TA 3TFCA 4NJIA 3W7PA 5AHIA 3CIWA 2FPVA 1KM6A 1QDSA 4OU1A 3R13A 3DGRA 1WOBA 3P60A 1OYCA 4AB4A 4O16A 3EKZA 1FCBA 3BVJA 3DZ1A 4HSOA 4LUJA 1L6YA 3L0GA 2CZFA 5K4ZA 4DO4A 3HG5A 1LBLA 4IMFA 3W22A 1OK4A 4G1KA 1D3HA 1P1XA 5DY3A 3IIVA 1JULA 5LNSA 3DI1A 1GVRA 5FEWA 4PEKA 2DJXA 3A5FA 2RDTA 1F6KA 1N7KA 2JGYA 3OA3A 4OGZA 3WJZA 3L5AA 4XKYA 1Q6LA 2EGZA 1W0MA 2YR1A 4BI7A 2FTPA 2QEZA 4EF9A 4NJKA 3T55A 5I3IA 5LGXA 4NXKA 1NAL1 2NX3A 2RHGA 4N02A 2VEMA 2Y85A 1QO2A 1XC4A 1JUEA 2OT0A 1TPFA 1PL9A 1JCNA 4CQ9A 4Y8FA 3KOFA 1VCGA 1QPQA 4CNNA 4ADTA 2CLFA 3FIGA 1NF0A 3Q58A 4POCA 2W6RA 2P10A 3I6RA 4IPIA 1R2SA 4DO6A 3MUXA 4MKNA 1TREA 5CPOA 5D32A 2BWGA 1TQJA 6TIMA 3VE9A 4JS3A 3EWZA 5C55A 1SO6A 4CCCA 3CEPA 3L0KA 4NU7A 3LTYA 3W71A 4FX8A 1OFOA 3E02A 3NZ1A 3FKKA 3MP5A 3UQNA 4I9AA 5HMSA 3I7SA 3MYOA 3F03K 5EY5A 2V5BA 3W9ZA 4NNAA 1TPB1 1TTJA 1X7FA 1H62A 1R2RA 5SWUA 3IIOA 5LNUA 4PA8A 3CLMA 4GUFA 1ME8A 2UV8G 2ISWA 1V7YA 3L0NA 4JEQA 3B4UA 3NEVA 1LRNA 1X6UA 3O07A 4NNCA 4RZ6A 4ALDA 3LBMA 1ZALA 3D0CA 2FB2A 3BGGA 3UNDA 3LCLA 5DCDA 4KFPA 4CNOA 1ME7A 1OFRA 2QCDA 3H54A 2QDGA 2X30A 4FO4A 3NQ7A 3NQDA 3VFLA 2GVLA 2V2HA 3E9AA 5K7JA 3P82A 2VFDA 2OCZA 3IIPA 5I3FA 2V2CA 1B9BA 1GWJA 3GB6A 3O6CA 3SGUA 1GJPA 1KV8A 2ZCGA 1Z42A 3QPZA 3NPVA 3W7GA 5LNVA 3S9YA 3UWZA 1MSSA 4O12A 2ALDA 2D73A 5E0KA 3TDFA 2E1DA 4BI6A 2H8ZA 4JYFA 2C6QA 3P80A 3W1RA 2Y7FA 4UUIA 3MO7A 3C8FA 3SR7A 4FX6M 3JS3A 4JTGA 4UNKA 4Z1CA 4RV8A 2B7OA 1ONRA 2PRHA 3CIXA 3KXQA 3VKJA 5H2ZA 1KBJA 5AOUA 1YPFA 1UCWA 4XZ9A 2CLLA 4UTKA 4O0ZA 2NX1A 1QCWA 3OHIA 5D38A 3W7MA 3C2FA 4O1CA 1PVNA 1VYSX 3L5LA 1G4EA 1OF8A 3W07A 2X1RA 1X1ZA 2VKZG 1RQHA 3GIYA 4XKYB 4PTNA 2R14A 4AHQA 1OABA 5LHEA 2YPIA 3G0UA 2Q3RA 3S5YA 1AW2A 1O95A 3LCFA 3M41A 4CCEA 2QAFA 1VLIA 3GNNA 2CU0A 4ICNA 1YTKA 2KZHA 1K02A 3LLDA 4EIVA 2ZZ2A 1KLZA 4LS0A 3C52A 3SIZA 5CKSA 1VPXA 1TO3A 2ZTKA 3M9YA 2YYUA 1VCFA 4LVBA 4O14A 5D37A 1RQBA 2ZFAA 3L2IA 1A5AA 1H63A 3TH6A 1UBSA 5D2YA 3BW2A 3UWYA 3BG3A 1WV2A 3W7HA 3M5VA 1M6JA 1QOQA 2DU2A 3DFSA 2TSYA 1LOQA 2Y7DA 1K8XA 1QPNA 4MZ8A 2HMCA 2QDHA 4Z0JA 1YLVA 2AGKA 5HULA 1EP3A 3C6CA 1TSIA 2RDWA 1A50A 3HMJG 3W70A 4NJGA 3PBWA 2Z6IA 3DFTA 4IOTA 4X3ZA 2A2IA 3PULA 3A5VA 2GQAA 2NWRA 1F7BA 1VQTA 4E2BA 3BLEA 4JIQA 3STGA 2NV1A 3HPXA 3G1YA 2WNNA 4E2DA 4L4LA 3OVRA 3ABSA 2E09A 2BZNA 4AMAA 3B05A 3W3OA 3S5NA 4QQ3A 3GDKA 3TC6A 1Z44A 3DBPA 5ABTA 4Z08A 4O19A 5AHEA 4JX5A 5IBXC 2VEPA 4IMGA 4UXDA 4WJEA 4HT3A 4ZQOA 4O28A 3QSTA 4O1BA 4ZZ9A 1KLYA 1ME9A 2QUUA 4LV4A 2QCDB 4RXGA 1ZFJA 3VI2A 4WY0A 1SR9A 3THAA 1UB3A 1I45A 2GQ9A 1K7EA 4NZFA 5C6MA 3HJZA 4TMBA 5K4XA 3W1UA 4CNPA 5KTLA 1Y0EA 4IMCA 3NYZA 1T0OA 1MEHA 2A6LA 1GVQA 2V2DA 4MY1A 5F2MA 4KFNA 4JR5A 4JGDA 1KM1A 2ZRVA 2J9ZA 4IMDA 3W83A 3EX2A 4JTIA 3HPZA 4EOUA 2JK2A 2RFGA 3KFTA 3QSRA 4LUIA 1O5KA 3NQEA 3TSBA 3MI3A 2XN1A 2Y89A 1QFEA 5D03A 1FDYA 5C5YA 1KM4A 2J88A 1KM2A 3TC7A 1VCVA 3RF9A 3EXRA 5AYZA 3W7LA 2Q3OA 3SW6A 4DBDA 3KVJA 3PUOA 4ZQRA 1EX5A 4MLJA 4Y6GA 5DXXA 3NQ6A 1XKYA 3F4NA 4O8RA 2QAPA 4HNUA 3DH7A 1FCQA 3W7QA 1RQEA 3M43A 1W5QA 4GUHA 3LCXA 4MIMA 1H50A 3LGEA 4WX2A 4X9SA 3OEXA 3RK8A 4R34A 3QF0A 4JTHA 4Z1BA 1J4EA 1G4SA 1HL2A 3T7VA 2EAWA 3S0CA 3QJAA 4Y96A 5D2TA 4LRSA 4M7TA 4LRTA 4DXVA 1TTPA 4DBEA 1T8XA 1OX6A 5AFDA 1C9DA 3LERA 4XBKA 2Y62A 4BR1A 3G1VA 1ZAHA 3H55A 1I2NA 1LZOA 3GVGA 1FBAA 3NVTA 3S1VA 4YXGA 4Z1DA 4RR4A 3QMRA 3TR2A 1FWTA 1LBFA 3DXIA 4FHAA 2NWSA 1IIHA 1TPH1 1FXPA 1DVJA 4QITA 4NQ1A 5HWJA 4IJBA 3GDMA 2A0NA 1IXOA 2AQWA 2CZEA 3W2KA 1A5BA 2A4AA 4WXZA 4RLIA 3N73A 3R89A 3LHUA 3UXAA 4OV9A 4S2CA 4DPQA 5TBOA 4HHPA 6ALDA 1Q45A 3MJYA 5HJLA 4O4VA 3GXTA 3B8DA 4O53A 3C2OA 3LRKA 3BG5A 2C3ZA 3LI0A 3MMTA 3PSWA 1EUNA 4JN6A 3PG9A 2PE4A 4A2SA 3N2MA 5EPDA 1H1ZA 1MO0A 4WY0B 1PCWA 1BWKA 4JTJA 5G2HA 2YYTA 1S5VA 4XTIA 1Q6RA 1Q3NA 3E96A 2JKAA 2X1TA 2X16A 2JBMA 5D04C 3I7QA 4KKXA 2ZZ7A 3N2XA 3EX1A 4R53A 5A5WA 1C8VA 2C15A 4QAIA 3KVMA 5DXYA 3W2NA 3LCWA 4MYXA 3QQ1A 3W1PA 4NNBA 3TQKA 1EP2A 3QW3A 4QJ1A 2CLHA 3UY8A 1FDZA 1VC4A 3AJXA 4GUGA 2OT1A 4O11A 2ZZ4A 2JKEA 1YXDA 4O15A 2B0MA 2QCMA 3QH2A 2PURA 1M7OA 4UTHA 4NJHA 2YSWA 4DQWA 2I14A 3NG3A 3UPBA 1EWEA 2Y7GA 3L65A 1TPDA 1TPVA 3I68A 3V75A 3TIMA 3W86A 3NPXA 5D2WA 1RVGA 2X1SA 1XBYA 4QNEA 3G1DA 5K3VA 1BKSA 2OX1A 3C3NA 4A29A 4WOZA 1IXPA 4HPJA 1SSDA 1H51A 2NX9A 1FWRA 2VELA 3O06A 4AH7A 1Q6OA 3ATZA 1I2PA 4NX0A 3NQFA 2W0UA 3GX9A 2O7QA 4HNNA 3HBLA 4O4WA 4UFKA 2YGYA 4AAJA 4UFMA 2YCEA 1DQWA 3GR7A 5KSWA 4AXKA 1AW5A 2A85A 4FXRA 3IGUA 3PB2A 3HF3A 4GC4A 1TJRA 4C1LA 3P74A 1OFBA 3UYCA 3TCEA 4UC5A 2O7SA 1UUOA 3MHGA 4O1AA 5F4SA 2NUWA 3VE7A 4RXFA 2E68A 2FJKA 1R30A 2PRMA 3FLUA 2TMDA 4JY9A 1SZNA 2CLOA 3PB0A 5EBUA 1TIMA 2H3BA 3GYEA 2H8XA 2XN2A 4QNWA 1KFJA 4NJJA 3HG4A 3NQAA 1SFLA 1WOAA 4FNRA 5DBTA 3QPYA 3W1AA 2EHHA 2P1FA 1TPUA 5J5DA 1JUKA 3OBKA 2A5HA 4UFHA 2ZRUA 2YFNA 2WNZA 4FNSA 5KMYA 5CPNA 4IXHA 1KW1A 2VEKA 2QCCA 3GAYA 1XDMA 2ZRZA 3TX9A 2BTMA 3HG2A 2ATMA 2Y70A 3O6DA 3NL6A 3ZWTA 1G6CA 3N14A 1OYAA 4LVFA 4N4PA 4MY8A 3LV5A 4A3UA 2ISVA 5BMWA 5FESA 1KFKA 4JXCA 1ALDA 1FUYA 3TUUA 3PC0A 4HNTA 1KA9F 5AHLA 5TIMA 3W88A 2TYSA 1EB3A 5FEZA 4OT7A 3LLFA 3NZRA 1WYIA 1PCKA 2E77A 4PC8A 2CWNA 2ZYFA 1VS1A 1H7NA 5FF7A 2ATSA 1W1ZA 5L9FA 3ABOA 1U83A 3O8AA 4JX6A 1LOLA 1FCUA 4A21A 5I3JA 3TNOA 3UD6A 1DORA 4YWIA 1W56A 1G4PA 1H61A 3FJLA 4LS2A 3W7DA 1OX4B 5LGZA 5AC6A 5KITA 4UTMA 4MFDA 4K7VA 3FJ6A 3NA8A 1NSJA 3USBA 3ZS4A 1WX0A 3LHWA 3STCA 4I7UA 1ZCOA 2BLEA 1KFEA 1I2QA 4NUWA 3FKRA 2Y88A 1KV5A 3U8GA 4CQAA 1W5OA 3L9CA 4OHQA 3SZ8A 2NLIA 2Z2UA 2E5CA 2ABAA 3NQ8A 4ZL1A 3CTLA 1G7UA 4MZ1A 1XCFA 5DCEA 3GAKA 4QSHA 4UMCA 2C18A 3ANYA 3PBUA 3QQ0A 2GVGA 5F1VA 4AWTA 3TKFA 3TV8A 4R7JA 2V9DA 1XFBA 1XDLA 1GVOA 3TW7A 3MWAA 5HR7A 3CT7A 2Y61A 2Q8LA 2RH9A 3GKFA 2DORA 1FX6A 4TMCA 3ATYA 5KZEA 1I2OA 3W7KA 4BI5A 4O10A 4NZJA 3T4CA 4XTDA 5IBXA 3U2OA 3L5MA 3EXSA 5F1UA 1H60A 1SZGA 3DU0A 4AVFA 3BGJA 4LOCA 1K8YA 1K8ZA 1K7FA 2Z6JA 1DKWA 2DJLA 1HO1A 1T99A 1ZY9A 5HUOA 2C0AA 4Z1AA 1KTBA 1HUVA 4ZQPA 2CFFA 3W7CA 3MYPA 3S42A 3G18A 4WY0F 3ZR4A 3GXPA 5G4EA 4H3DA 4XWUA 5FEPA 3W74A 2PC4A 3CU2A 1PS9A 3W1NA 2A7RA 5EL1A 2C14A 4UFLA 4LC6A 5KZDA 2YXGA 1ADOA 4H6KA 2FPYA 4WZHA 1GOXA 2F7FA 3SGZA 2EPHA 2R94A 3L67A 2ZA3A 8TIMA 4UFJA 3JRKA 4O13A 4JTSA 4HPXA 4LVGA 4TIMA 3CWOX 4BK9A 1H7OA 4UTIA 4MOZA 3GXNA 2DZUA 1JQXA 3CQ0A 1THFD 3M5XA 3IVTA 4CQ8A 4FB7A 1GG1A 1SUXA 2VFEA 5AB3A 3LHYA 3PUEA 5CG7A 5C2XA 3IGXA 3LXCA 5C54A 4KWVA 2WQPA 3DHDA 3S1WA 3LHVA 2YW3A 1SW3A 4DF1A 1AG1O 2OMAA 4O54A 5LZLA 3UZ5A 3P8IA 3CWNA 4NXSA 2CLIA 2J6XA 3DKLA 4IGHA 4UMBA 4RK8A 2Q8ZA 3WJYA 5LKYA 5D33A 4I7WA 5D2XA 1FWWA 2C13A 3O6YX 4E38A 4N9BA 4FEZA 3W2MA 3NAVA 3PF3A 3S5OA 1BEUA 4MFEA 2ZRWA 1YXYA 4FNPA 4MVAA 1QMLA 1SW7A 1FWSA 2ZQ0A 3R2GA 4UNLA 1J2WA 3IIXA 4KWWA 2CZDA 3NOEA 3BPWA 3FA5A 4JTEA 1AL7A 2ZZ1A 3FYPA 5CZSA 4FX7A 4RZ5A 4O18A 4AHOA 3NM3A 4FNUA 4WQ6A 1SO3A 3R12A 1B3OA 3DFNA 4ZMGA 1ML1A 5G2IA 3RMJA 3FEMA 5LHFA 2YZRA 2NZLA 3HGSA 1L9WA 3FS2A 3B03A 3HPSA 4S2BA 1JCMP 4LTSA 2QCEA 4FF7A
chains in the Genus database with same CATH superfamily
2TRSA 1VZWA 1IT8A 1US3A 1XPGA 3KS5A 1RBAA 2PTXA 2OWXA 2CESA 3CNYA 3WD1A 1V4YA 1AJZA 5AKQA 5A6TC 5I3KA 4Q8OA 3NJ3A 3VNMA 3MT1A 3P7YA 3WF2A 1JPIA 3KL3A 1EOMA 4ML9A 2W91A 3IEBA 1ICPA 5DX7A 1GEQA 1XG3A 8XIMA 1PTGA 3O63A 5BU6A 1KCKA 1SO5A 1WZAA 4Q6JA 4W88A 3SCUA 3P61A 5FJIA 2E3ZA 3PR2A 5D4YA 2VRQA 1EFZA 4D9PA 4D2JA 1UBPC 3TQVA 2GUBA 1NF7A 2CZ5A 1NFBA 1Q2RA 3TMQA 1EGVA 4F48A 2OLHA 1TX2A 3N9SA 1C3FA 2JKPA 3CPGA 3IIZA 1DWHM 1XLMA 1JI2A 1ZAIA 3RLGA 4WJXA 1TPC1 1UD6A 1FY6A 3KBMA 4ATWA 1JVNA 3TA6A 4QIUA 5TNVA 1JD9A 4ZODA 3W02A 4GO8A 3VXGA 4NP7A 4FIRA 1YTEA 1GOWA 2GUYA 3VU2A 2XVNA 4GIRA 2ZA2A 2P0OA 2QULA 4B2DA 3SFKA 2WSQA 2IKGA 3HJEA 3M5ZA 6PTDA 2CHNA 3LCHA 2OQLA 1YE6A 1H41A 1ECQA 1UZ4A 3EX3A 3AHXA 3AAMA 5CZ0A 1GTHA 3C0JA 3THDA 3GM8A 3VIPA 3EA3A 5C2GA 1S5TA 3N12A 3B0PA 2E6YA 5AYIA 3JW7A 3E12A 3ITLA 3GH7A 3QEZA 1TMHA 4WXYA 4PCPA 1AQFA 3LENA 1OK6A 3QTGA 1DOSA 1XSKA 5CPQA 3TJ4A 5D09A 3W6YA 2J9XA 1TUXA 3OGVA 3PZVA 5MHBA 1PYFA 5HR6A 2H3DA 3C5QA 1MZHA 5I3GA 2C19A 3R0UA 4GKLA 3BCFA 3WUBA 2B7QA 1E43A 3NL5A 3B97A 3G3MA 3GS6A 3VDCA 2W79A 3A9IA 3GBDA 1ZJIA 1CZ1A 3EWXA 1XXXA 3AQUA 5DRIA 1XBVA 3AIQA 3PPGA 4JQ1A 1X97A 3PS7A 2QS8A 5A8NA 1MFUA 4KPLA 4FLQA 3LPFA 1S2CA 3RR1A 2BB0A 5HANA 4Q7IA 1WXJA 3QHNA 4LNYA 2X8RA 2CHOA 1DJHA 3QYSA 1PWMA 3F4CA 2TODA 2WJEA 4NZ5A 4P7RA 2VT0A 3VD4A 3P3BA 4INFA 3S4TA 1IT0A 5FSEC 1GTEA 2YCJA 4GRSA 4NSBA 1Z48A 2V8ZA 4M5PA 2GDUA 3A23A 3DFHA 1LF1A 1PIIA 1T40A 2YBVA 4BF7A 4YHEA 3QLLA 4CN6A 3PP7A 4S38A 1DJWA 3GK0A 5T9BG 2Z1SA 1H1NA 4NRSA 3EZ4A 3TROA 1W8GA 5BW6A 4U4MA 4JTKA 2ONEA 1V6VA 1P0KA 4JKLA 4H8VA 3O1NA 4E8DA 1QTWA 5A6SA 1YADA 3GDTA 3IWPA 3RJYA 3STEA 2PTDA 2A6NA 3VUPA 5JBDA 3G8EA 4GKTA 3HIJA 1FQ0A 4I5UA 3SN1A 1PPIA 3LB0A 4HMNA 2XSAA 3E49A 3P5ZA 1BD0A 4JHMA 3N13A 4DEFA 1S2VA 4GQ0A 1VEOA 2X2YA 3OLEA 3MUCA 1EYEA 7ENLA 3DDMA 3CLWA 1C91A 3NQBA 2HE5A 1E71M 1XLFA 5M2FX 1R86A 5G4WA 3AIUA 4DUXA 5HK4A 2O4QA 3STFA 1OCQA 3WH6A 3BZGA 2BVWA 1WDWA 1EA0A 1LUCA 5CSSA 2ZE0A 2KAUC 2PGEA 2VMFA 3UWWA 3W1LA 2WB5A 1DIOA 5D05A 1YIXA 2FHFA 1TV7A 1E6PA 3U4AA 2DFAA 2OZ0A 3APYA 1VFLA 4HIBA 4U28A 3GTNA 3ARWA 1KRCC 4JD4A 3BW4A 4UTWC 3M16A 3BLOA 4JY8A 5K2ZA 2B7PA 5LSMA 4EXQA 1NOFA 2JF7A 4AF0A 4W87A 3DEQA 1E5NA 2R6OA 2GJPA 1IWBA 4XUGA 3EDJA 4PMVA 5C71A 2FKPA 3REQA 3G3DA 4LY8A 1XIBA 1VYPX 3BMXA 2WKJA 2JE8A 3L68A 3UBPC 3HA1A 1A3WA 4OE7A 2FGLA 1IEIA 5D30A 1V6YA 2AL2B 1EF2A 2OX4A 1U5VA 1DWFM 4ROPA 4JTUA 3RYSA 1TTIA 3TJLA 3NPUA 3WJSA 3PBGA 3TWBA 2VC6A 4NYYA 1FVPA 1I6NA 1EJSC 3BMVA 5CAHA 3SSZA 4ERAA 4L1WA 2MNRA 1SGJA 3CZKA 4C1NA 3WUFA 2F6XA 4IG2B 4CKQA 5I03A 3QFEA 1W54A 2QCLA 3WH7A 3VNLA 1TA3B 3PAJA 3S1XA 1US2A 4IGSA 2ZDRA 1Q66A 3T2QA 3SCVA 1BFNA 2YA2A 3H2CA 2RDUA 2VEIA 3ZFHA 3OVQA 1JCTA 4CN4A 4K1GA 3R5EA 2PC8A 4KEZA 3VIJA 4ZB2A 2R1NA 4HZ7A 5HXMA 2VX7A 1LL7A 3PVFA 1R3VA 1JZ4A 4L64A 4ZB5A 1VRDA 1CX9A 1LWIA 3G1HA 3CHFA 2E6DA 3CB8A 4FR6A 2YX0A 2GJLA 2Z7GA 4ZGYA 2X2GA 2QCGA 3H70A 4M19A 4C6KA 4CVUA 2POTA 2HVNA 2XWDA 4HJWA 4LPCA 1LLOA 3AMCA 1VBRA 3QR1A 3TW9A 5EB8A 1YDNA 4ADUA 5T91A 1W17A 2FQIA 4DIAA 2E9LA 4WOQA 1E6SM 4OBTA 5CPLA 1KTNA 3VKDA 3EBVA 3VZXA 2P76A 1N2VA 3UXLA 4HYWA 2CNCA 4DELA 3PSVA 3DG3A 1PXGA 4YTSA 3NNTA 1TE1A 3WJXA 2VZOA 3VGFA 1A49A 3V0UA 1EJWC 3MKKA 2OJPA 1MFVA 3QZ6A 1DIEA 2GVJA 5FCZA 4ZQCA 3VNDA 3OVGA 3AXXA 4Z0SA 1EIBA 5C0QA 3E2QA 1NDWA 4A3YA 1R5YA 2A3LA 1ZP4A 2QJHA 2F84A 4UWMA 1EZ2A 1WKYA 5A6BA 3A47A 3B9DA 2PDFA 2WV8A 2J77A 4RJEA 3ZLGA 3G24A 1I9CB 3WF1A 1QW9A 3KM8A 3GVWA 4LXFA 4GYPA 4UQ9A 1U33A 2WOQA 2PP1A 2REQA 3OODA 3MCMA 2H6RA 3QR0A 3RLVA 4N9DA 4RCXA 3MUAA 3RIKA 4O57A 4PEEA 2A3CA 3SJ3A 1EA9C 4EKJA 3SADA 2QUTA 5G1TA 4N9EA 1CTNA 3GH4A 4CD4A 6TAAA 4N9CA 3KL0A 4BWLA 1YNYA 1RV8A 1GG0A 1HF6A 2IMRA 2V0TA 2AMGA 2QVHA 4FSAA 1D8WA 4F3HA 2IQ0A 4IGNA 3TMLA 1UUMA 1XM3A 1LDCA 2XJ7A 1XIMA 4JNMA 3S2NA 1FWEC 1QPRA 3OZYA 1YE4A 1ZRQA 4HYVA 3M6YA 4Q22A 4UZSA 3VNKA 4K39A 1JUBA 2QR6A 3UA3A 1TMQA 3A22A 1MNZA 2DH3A 2WMIA 1UR0A 3RDKA 1LRTA 3KTSA 2INFA 5AHFA 4C60A 4MJMA 1HJWA 3QTPA 2C16A 2QV5A 2R1LA 1O7AA 3NPWA 3EB2A 5LYRA 4YYFA 3M07A 1TG7A 2CLEA 3ITXA 1DWAM 4ACZB 4B5UA 3OB8A 4Z2KA 3O15A 1GQKA 1KWGA 2QJIA 3CV1A 3L4XA 3AJ7A 1HNYA 1KM5A 3AU6A 1P0EA 1R3QA 4W84A 1TCMA 1V6WA 1GQNA 3XINA 1GK8A 3WYZA 1P6BA 4S1FA 1W3KA 2R1MA 4US6A 2DIJA 3WDQA 3MP4A 4JIHA 3JR2A 1BYCA 4MNMA 5CQ1A 1XBZA 3W53A 3BG9A 3IRSA 1MUCA 4DBWA 4YCPA 1E9LA 1XBXA 4M6QA 1QI4A 4OBRA 2VURA 1VBJA 4FNQA 2ACUA 3ONBA 3EAUA 4LB3A 1TCDA 3TYUA 2VRKA 1BWLA 2XWEA 3DKJA 3QY8A 1UP3A 4GUJA 4DJFC 4Q8WA 3G8RA 3VIFA 5CBJA 3EKGA 4IWWA 1DTNA 5KINA 1TPWA 1GORA 3RHGA 2EG8A 1KM0A 4C6PA 2QCFA 3GXFA 3LSBA 1E56A 1U5JA 2J9YA 4KGJA 3UA4A 1KFWA 1Y5VA 2Z1BA 5F4XA 1F05A 4ECLA 1JPKA 3URAA 4IX2A 1E3XA 4L7ZA 2GZXA 3IGSA 4AMCA 2R8WA 3S6TA 3EPOA 4IPPA 2A3EA 4U10A 5K9CA 4FNTA 5F4WA 3OBEA 4LVDA 1NEYA 4J2PA 5GJPA 3BUVA 3HGRA 3R0DA 2NUYA 2EXOA 2A3BA 3VO0A 4MNJA 3ZIZA 1UMYA 4AZBA 5CAKA 3U48A 2V63A 1B54A 4MSSA 3H53A 3TK7A 2WZEA 3RLUA 3B0UX 1JYVA 1LCOA 3E2VA 2BXZA 1N8FA 2QXWA 4GMEA 3U7BA 3O3RA 1E1EA 1P1MA 1WA3A 3FFSA 4TR9A 3K1DA 5IFTA 4GWEA 1YTDA 5EMMA 2Y63A 2JFEX 1GOOA 1W5PA 1HGYA 3TFCA 4S39A 4P7NA 1HN1A 3N18A 4AC7C 4RW3A 5CC7A 2YDRA 1WOBA 2P8BA 4GQGA 5C2CA 1OYCA 3ZJ8A 3MVIA 3EKZA 2IXVA 4YYCA 2CZFA 5K4ZA 2WMHA 1LBLA 4G1KA 4B3ZA 1P1XA 4LYPA 3O0KA 4PMNA 2FGZA 4J3XA 2D3LA 1K77A 4H2CA 1N7KA 2O9TA 1K9TA 1R3WA 3L5AA 4PB5A 1KKRA 1Q6LA 4JTAA 1CLXA 2FTPA 4QP0A 4RNIA 1PKMA 5LGXA 1XF0A 1WXYA 3WD0A 1NAL1 4N02A 2VM8A 2PTZA 1C8YA 5BOEA 1HL9A 2G4JA 1JCNA 4Y8FA 5A6JA 2CLFA 4V33A 2W6RA 4IPIA 4DO6A 4MKNA 3E0WA 2PWFA 1QI3A 2CERA 4JFTA 2XH2A 3PTDA 3AXKA 2D24A 4CCCA 1AQMA 3AHVA 4JFUA 3E02A 3MP5A 4OOUA 4QCFA 1UP2A 5HMSA 3I7SA 3MYOA 5EY5A 5CPTA 2V5BA 1O12A 3RR4A 1TPB1 3GG1A 1R2RA 1AQHA 4XV0A 4GPNA 4M1BA 3K46A 3FDGA 1E4LA 4QXIA 4Y7EA 2UWFA 3B4UA 1LRNA 1CDGA 4A4AA 1I0BA 3T09A 2J79A 1QJWA 3WQGA 2JQXA 4IPLA 5BXRA 2FB2A 3BGGA 4W8LA 1QI2A 3CQHA 4KFPA 4J3TA 2IPJA 3GXDA 6XIAA 1OFRA 3D3FA 5HNNA 3H54A 3NFUA 1HP4A 2QDGA 4KWSA 1UD3A 2ZWZA 4XZWA 3VFLA 3CHCA 2ZC1A 3P82A 1CWYA 3RJXA 3O6CA 3SGUA 3Q67A 3WQVA 4RZBA 1F8MA 2CYGA 5LNVA 5ABEA 1UQYA 4NYUA 4G8TA 4D6FA 3ARVA 2E1DA 4BI6A 4JYFA 4R88A 3H4XA 1FH9A 2C6QA 3VINA 2Y7FA 1MW3A 2FVLA 3SN0A 3C8FA 3GRIA 4ZEPA 4FX6M 3JS3A 4UNKA 4Z1CA 1E5JA 3CIXA 3KXQA 3OO2A 3UR2A 4GIEA 4XZ9A 1TV3A 2CLLA 3WX7A 4O0ZA 3WZ0E 3W7MA 3H22A 4O1CA 1PVNA 3L5LA 3W07A 3MY9A 2VKZG 5EGRA 2R14A 2W61A 5LHEA 3S5YA 2Q3RA 5HQLA 2DT3A 2FHCA 1XRTA 2Z00A 3SB0A 4CCEA 2QAFA 1A80A 2CU0A 1YTKA 3C52A 3W27A 3M9YA 1VCFA 3R0KA 4E4PA 3APGA 1MXDA 3U4FA 4AZIA 2WLYA 1FH8A 1RA5A 1A5AA 4RDVA 1H63A 3W7HA 2DU2A 3G1RA 2WZMA 2Y7DA 1XLJA 3ERPA 4MZ8A 4ZO9A 3URQA 3SRFA 1TE6A 1UWAA 2F61A 3HMJG 2HRWA 3H21A 3A64A 5E0CA 2DSKA 1JXKA 2V38A 1N82A 5C9XA 2GQAA 4ZA0A 4E2BA 3WF3A 4Z2JA 3HPXA 3IARA 2WKGA 2V69A 3W3OA 3S5NA 1ENUA 4Q8PA 1JYXA 1PKNA 3AXMA 5AHEA 2PWEA 2INZA 1JNDA 4WJEA 4ZZ9A 1KLYA 3KOXA 2QUUA 4LV4A 3P93A 2QW5A 2EPOA 3NGFA 3VI2A 1UB3A 4QFUA 4HTBA 3UGVA 1K7EA 1WAWA 5K4XA 1Y0EA 1TVNA 3NYZA 1QPKA 1ISZA 2CWXA 4KRUA 2BY2A 3WKZA 1T0OA 1MEHA 4PYSA 3WEZA 2A6LA 4FMVA 3CPUA 4KMQA 3AIWA 4IMDA 1FHUA 3EX2A 2IUZA 3SAZA 1DJGA 3R8HA 3DUGA 1FWHC 2JK2A 2OG9A 4M82A 1MQRA 4WR3A 2O0TA 2UY3A 3W29A 3TSBA 4Z2GA 3HPAA 4AD2A 1NWUA 2J88A 2X40A 4H9XA 4F0RA 1L8PA 3RF9A 5AYZA 3W7LA 3SW6A 5HOSA 3PUOA 5C9ZA 1EX5A 2P8CA 5LA1A 5MKGB 3LGDA 3NO1A 3KOZA 3LCXA 4A3QA 1Q7MA 3MO4A 3OEXA 3AS2A 4J1OA 4GYFA 1EJ7L 4Z1BA 3THUA 1GOIA 4S3EA 5REQB 3GSMA 3A13A 1TWDA 4EAYA 1D7FA 2EAWA 3S0CA 2VC5A 3QJAA 1CGTA 4Y96A 2QF8A 3A3WA 3HV9A 4RE4A 3DYOA 3M6DA 4DBEA 1CYGA 1OX6A 1C9DA 4XZBA 4Y9NA 4XBKA 4AZGA 3G1VA 1I2NA 1LZOA 4YXGA 1RPKA 1GNXA 3DYPA 4H7VA 3CHEA 2CBJA 2NWSA 4MB5A 2CETA 3LN3A 1IIHA 4LFYA 4D6GA 1BQCA 1JI1A 1FA2A 1OC7A 2A0NA 4AY7A 2AQWA 4EWJA 1L2QA 2CZEA 1AQ0A 1RK5A 1MUMA 4I6VA 4WXZA 1XKJA 3N73A 2HQAA 5TBOA 2GDVA 3JUGA 5HJLA 1Z7AA 4J2MA 4L61A 4Q8MA 2DVUA 4GZEA 1V3LA 2GVEA 3JZUA 2ZUTA 2C3ZA 3LI0A 3MMTA 2C0HA 3PSWA 1PDZA 2RJHA 3TCSA 4CNTA 1TV2A 2HVMA 4WY0B 1PCWA 4JTJA 2VZSA 3ZT5A 1H49A 3WQDA 4P8XA 1R85A 3T1GA 3WUGA 3EA1A 2X16A 2JBMA 3NZQA 5CJMA 1XWYA 3EX1A 2C15A 2V3DA 3KVMA 1QHOA 2OTDA 3KBJA 9CGTA 3T8LA 3QQ1A 4HOXA 3W1PA 3QW3A 2TAAA 3O6AA 2DUZA 4PMJA 3ARTA 1FWAC 4O11A 3KWXA 1OG6A 7TAAA 1ONWA 4B5WA 4S3JA 1G1YA 1S2UA 4WKHA 2ZOXA 1P6WA 4UTHA 3LPOA 4DQWA 3UPBA 1EWEA 3TIMA 4HHHA 1UH2A 3BAIA 5HAOA 4HP5A 3SGGA 3C3NA 4WOZA 3CL8A 1ZZMA 1H51A 3SQLA 4OZOA 4S3AA 1Q6GA 2ZXQA 3GX9A 2ESCA 4O4WA 3RX3A 2VR5A 4I9JA 1G9HA 3CWHA 4AAJA 3WQPA 1ZBWA 3MV01 3V5OA 5KSWA 2A85A 2ZUNA 1SMAA 3HF3A 2AL2A 1TJRA 3VDAA 1EC8A 1OFBA 1JZ3A 3A12A 3TCEA 4XAFA 4NAFB 3MHGA 2NUWA 3VE7A 4AZ6A 3LBOA 4WDWA 4RXFA 4V15A 1R30A 2G37A 3PBMA 2YA1A 3FLUA 4PULA 1VFHA 2HJPA 2QYGA 3N2OA 4PSRA 4OTKA 5EBUA 4IIEA 2KX9A 3GYEA 3QHOA 2H8XA 4QNWA 2X1IA 3HG4A 3GTXA 1SFLA 4HCHA 1E0XA 2W9MA 5J5DA 5DF0A 1FTXA 3W24A 1POKA 1JAKA 2HBVA 2IPWA 2ZRUA 4MDPA 2WNZA 1WPCA 3GBEA 4OJYA 1WDQA 5CLTA 4FNSA 5CPNA 3T8QA 2BDQA 5AYBA 3FAXA 4S3GA 2GJXB 4V28A 2OEKA 1E6XM 2OODA 1G6CA 4YTRA 2PTYA 3R25A 5FJOA 3LV5A 2YL8A 1QNQA 4KCUA 4A3UA 1UR1A 4X2PA 5BMWA 1WUEA 3HZ3A 3PHAA 1NWRA 1FUYA 3PC0A 4OBSA 3PZTA 3O0FA 4XSMA 5FEZA 1CXIA 3KDNA 2WBGA 1JF5A 1IEWA 2ZX8A 1PCKA 2E77A 1VS1A 1HXJA 5DFAA 1G94A 4TVUA 4AZ7A 1BSIA 5FF7A 3EDDA 3PNUA 4KEUA 5JBFA 2W4XA 3TN5A 1M04A 1VF8A 3UD6A 1DORA 4YWIA 5FAJA 2GVYA 1AZ2A 4QS6A 1G4PA 3AZTA 4KW2A 1OX4B 4G5DA 4XO7A 5AC6A 5KITA 4QEEA 4G7EB 2W67A 3NA8A 3FXYA 1OQFA 1NSJA 1W3HA 3SO7A 4S3DA 3S3GA 4QGCA 4IQEA 4NZ4A 1KFEA 3UYIA 3AS1A 1QNRA 4NUWA 1J9YA 1MWOA 4HZ8A 1WDPA 2VTFA 4OHQA 3IJIA 2NLIA 4Z2HA 3S83A 3AS0A 2E5CA 3VILA 2ABAA 4ZL1A 3M0JA 3CTLA 1QNSA 4MZ1A 1XCFA 2PD9A 5DCEA 4DJEA 3MSDA 4UMCA 2C18A 4HTYA 1UA3A 1S2AA 4P5UA 4AWEA 5F1VA 3DG7A 5FKYA 1XDLA 4ASTA 1GVOA 4HA1A 5HR7A 1F3WA 2Q8LA 5A8QA 1M7XA 3W7KA 1Q6EA 1W1IE 2MUCA 4XTDA 3MMDA 4XAZA 1DIDA 3DECA 3L5MA 4YS1A 3UJ2A 1HJQA 1CXEA 1UWIA 3MTWA 4AIOA 4AVFA 3MUZ1 1K8YA 1K7FA 2Z6JA 1DKWA 1ZY9A 2Z1XA 4ZQPA 2CFFA 5C9UA 4XIAA 3MYPA 2POZA 4US5D 2OELA 3TONA 3ZR4A 3GXPA 5I06A 1VFFA 4H6KA 1B9ZA 6ENLA 3SGZA 2X7WA 2GOKA 1L6FA 3TYBA 1ZBVA 1DJIA 2DW6A 3JRKA 1Z6KA 4H9UA 4H9YA 4LVGA 3F5JA 3CWOX 4AIBA 1H7OA 4BK9A 3NWRA 3WQOA 2DZUA 3B0YA 3IVTA 2ZUSA 1UKTA 4CQ8A 5DO8A 3I3DA 2CLPA 3PUEA 3IGXA 4C7GA 2WQPA 1Q6FA 1YBQB 4XD4A 1AG1O 8XIAA 1V0LA 2Y2WA 1Y7VA 3R6IA 3UZ5A 1BVNP 3CWNA 4AZHA 3WJYA 3TN3A 2DW7A 3VMNA 4I7WA 5D2XA 1XLBA 4GLEA 1CGWA 3W2MA 3NAVA 5D9NA 3UESA 1TR9A 3S5OA 1BEUA 4GIAA 5JIWA 3CIVA 3WLPA 5I02A 1J2WA 2QGHA 3I6EA 3FA5A 1TWWA 2QJNA 1KBLA 4IFOA 1AL7A 2ZZ1A 4S3CA 1NDZA 3H24A 4LAOA 3OLGA 4NI3A 4WQ6A 1ISVA 4UCFA 3WEOA 2YZRA 2NZLA 2XH7A 1L9WA 1I1WA 2XIIA 4LF2A 1MW0A 2BHYA 3OG2A 1DXIA 3N2TA 1TELA 3FHAA 4BF5A 2QCEA 4XKMA 4K37A 4XZLX 3VOIA 3WDRA 2ISDA 3B06A 1XLEA 1Q2SA 1OFAA 3CJPA 1HTIA 4RE3A 4OUEA 4AU0A 1R2TA 1ZCCA 3VMPA 4EF8A 2F38A 2CKRA 1M1BA 2C79A 1X1OA 3RO8A 2G50A 4GK8A 1UR3M 1IWPA 3TW6A 1TV5A 4NX5A 3B9AA 1PSCA 3FDKA 4ZOCA 1ZL1A 3II1A 3YPIA 2VGBA 2Z26A 1SM9A 1G0CA 1ISXA 4AD4A 4JQ4A 2X42A 1L6GA 3C2VA 3HOJA 1DJQA 4PMOA 5EMLA 3V36A 5KZMA 3E2SA 4L9ZA 5LIUX 3TYAA 4ZCWA 4LEQA 3OZMA 4XSLA 4LX4A 4MPQA 1DL3A 3FSUA 2I57A 3CPRA 1CCWB 3DENA 3MKCA 1MYRA 1DXEA 3L66A 2PLMA 1GPWA 3C56A 1XV8A 4X2RA 3WO8A 2E5BA 1EX1A 4IXXA 3UWEA 1P5BA 2FFIA 3B0XA 2QJGA 3KBNA 4ZOAA 1PX4A 1JYWA 4LYKA 3CUJA 3DFOA 2DEPA 4ZO7A 3BARA 1H0IA 2BMBA 4GYPC 3KRSA 4JKMA 4NF7A 1EPXA 2G97A 2PF0A 3FVMA 1F3TA 3DBNA 5LXXA 4HZ6A 2PDMA 4B5XA 2PB1A 1W3LA 1BPLB 2YBTA 4HMCA 4TVCA 1LP6A 1VBGA 2Y6ZA 1NP2A 1KCLA 1NIUA 4M0XA 3PZQA 1EGZA 3VCNA 1SFJA 3MZ2A 1NJJA 4DNHA 3K4WA 4BWLC 3LGGA 2Y1HA 3NZPA 1FWBC 2VDHA 4PL2A 5JVLA 1S38A 1MZRA 4NIRA 3FEQA 1EIXA 4N4QA 3S47A 3VZYA 3GIQA 1PIFA 3NQ2A 1EXBA 5IFPA 4WSJA 1G7VA 1E4MM 4AD0A 4NZ1A 1RR2A 3G0SA 4N0RA 3MHFA 3WQ4A 5H8MA 1YDVA 2VZVA 1EEPA 5C9RA 3AHZA 2H90A 3Q2DA 5ABGA 1S3HA 2CCRA 4P7LA 3RU8X 3WNNA 2WPGA 2Z24A 1EF3A 5K9DA 4WDXA 1R47A 5D8ZA 4GINA 2CHRA 4NILA 3P8JA 1ITUA 7TIMA 3AC0A 2ZX9A 3WLOA 4A22A 1XLIA 2PDBA 4HVXA 3C4UA 1BQGA 1OIFA 1A5MC 3ECQA 1RJPA 1XSJA 1IGWA 3R7MA 3ABXA 3PUDA 3THCA 4Q4SA 5FEXA 3S5ZA 3UR5A 2VDGA 4G6CA 3D3AA 1WQ5A 3W1QA 1VGAA 1O66A 2QGYA 4ES4A 2GFTA 3B0VC 3T2OA 2E40A 3TLLA 1YXCA 3BMWA 5FIPA 3CHVA 3EMCA 3IAPA 2DSVA 1RZMA 3W7RA 1EJUC 4ZSTA 1XC6A 4UTWA 4HOWA 1V51A 4Q4PA 1IWAA 3QOKA 1PKLA 4HOZA 4LU0A 1YNQA 5CBBA 3EX4A 2PBGA 1C9WA 2PWUA 3A24A 3SCSA 1ZAJA 1SYTA 1IXNA 4IMEA 1FDJA 4GZ7A 4J7RA 3KOWA 4JFSA 1JGMA 2Z4GA 3P0XA 4URIA 4I8DA 4ZB0A 4HKPA 2RDXA 3DOPA 1AK5A 3RUBL 3N04A 4NY2A 2RJGA 1S1RA 2QDDA 4OWGA 5HWNA 1FWIC 1AMKA 4XQ6A 1WP6A 2QHAA 1CLKA 1UW9A 4LC8A 4LNCA 4L1GA 1K6AA 2E8YA 2D0HA 3MW7A 3I7RA 4E0CA 1OGSA 2LLEA 3DHUA 2D2GA 4JDBA 3IS4A 4H6RA 3CHDA 3V16A 1CW2A 1BXNA 1LL4A 5GNZA 1CI1A 3LK6A 2HV5A 5A6MA 3BSMA 2G95A 4KESA 2WPBA 3AWNA 2DIKA 3IRDA 3LOTA 3QRHA 3QGKC 1BYBA 4J35A 3UT0A 5TQLA 4L4MA 2PDXA 5FI8A 2JGQA 3O16A 4ZTYA 4GI6A 1XRFA 4F2TA 3OLDA 1PEZA 2A7NA 2EG6A 2J8FA 3CM4A 4YL2A 5HINA 4QM1A 2NV9A 1K8CA 1R87A 1NELA 4IMAA 1UKPA 4N6EA 2Z1KA 3LD5A 3RPDA 3AYTA 2QIIA 4K68A 2EPMX 2E4TA 4PFMA 1R3YA 3MJMA 3I3EA 3MC5A 1AL8A 3UXIA 3LHTA 4F0HA 3ARQA 5BXPA 1DIKA 1A5NC 3C2RA 1H5YA 3P5YA 5GNXA 3EWDA 3L4WA 5LNRA 1SQ7A 4JPGA 2Q71A 3C2EA 2DH2A 1WCGA 3WJWA 2EKCA 3W1MA 3QY7A 3CC1A 4ATLA 5EYWA 1NOWA 1TRIA 3TTEA 1YHTA 4H9TA 3KUMA 5I7GA 4JTFA 5J04A 2X09A 4ZQNA 5J8LA 3RCNA 4DWSA 1V93A 3IVSA 1FOBA 1YNPA 4GA8A 5J5RA 2XHYA 3E3HA 4CEUC 3L23A 3RX2A 2D0FA 2HEJA 4L56A 2NUXA 3SI9A 5HWMA 4MWAE 3TQ0A 1XYZA 3OIXA 3ARXA 4FOJA 5ABHA 1AJ2A 3UERA 2PCQA 1PKYA 5JH2A 3BO9A 3W6LA 3KVLA 1VIZA 1JR1A 5F7UA 1VHCA 4UR8A 1GT8A 2J75A 1XL9A 3POHA 2EEXA 2PDHA 1RA0A 2Z0IA 5A95A 2XINA 2WHJA 1ADDA 3WK0A 1YYAA 1X8FA 2HS8A 2ZDSA 2ZXAA 5DMNA 1LUCB 1XLAA 4OKDA 4Q6XA 3UG3A 3UZYA 5EA9A 4PSPA 5G5IA 1GYMA 3ES7A 3VD9A 3TZFA 2C7FA 1B57A 4F2BA 3TXZA 1P0BA 3V4BA 2E9MA 2Z29A 3LUTA 1A5SA 4US5A 3H8AA 4FXFA 3LXBA 2WO5A 1B31A 3BAYA 4QTGA 1M68A 4H1ZA 5DMLA 1GQLA 3BXWA 4R3UA 5GNYA 3TSDA 4AF0B 3L21A 3B8TA 4TX9A 2G3NA 1I0DA 1MEIA 4H41A 4AWSA 1VFSA 4BS0A 1JRCA 1R9YA 4Z1YA 4JQ3A 5A6KA 4GJIA 4Q8TA 1O1ZA 4UTTA 3URBA 1OT2A 1QATA 2OEMA 4M6VA 4P7QA 2H9AA 4E8CA 4D8ZA 2E6AA 4CN1A 3H2MA 2BOGX 2ZADA 4IUOA 5FJUA 1EXPA 2ICSA 4YTTA 3VC6A 3CMJA 3AMLA 3SUVA 2ZTJA 1XYFA 4XBSA 1EWDA 3P84A 3PPHA 2ISSA 1X1NA 4GNJA 1QHZA 4LYQA 3SCWA 3AIBA 5AN7A 4RDYA 2E8ZA 3TC3A 3MHUA 1E0VA 2PDJA 1ZENA 3UG5A 3R79A 4E3TA 1C29A 2PTWA 1T96A 2FPTA 1QR7A 3WLNA 4AZCA 2WCAA 3QR3A 5F2IA 3OJGA 4H9MA 4ZTXA 2G4FA 4IL0A 4PMUA 3VGEA 2PLCA 3EKLA 1HO4A 2FGBA 5XIAA 4W4QA 5K9XA 3QV9A 3GVVA 4GQBA 1SZEA 1BHGA 1JZ7A 3BW3A 4Q4RA 3AICA 3GO2A 1E6RA 2VC9A 4PMQA 3WMSA 5CPMA 4JTQA 3W2JA 1F2JA 4DZIA 1I2RA 1UQZA 4R9XA 3U2ZA 4X61A 3ABRA 4H7CA 4HA3A 5DANA 2HPIA 4Y9MA 4CU8A 1GPFA 2NXHA 1DJXA 1JAEA 4DXXA 1EO5A 4X22A 2JIEA 3S1UA 1H7RA 3E0IA 4JL2A 1LBMA 2C8NA 1TWZA 4MJ2A 5A2BA 4D1IA 2GJNA 3W2UA 3QZEA 3BOFA 4OFCA 4NAFA 1EHNA 2YKKA 4F66A 4ZOBA 2XVLA 3Q94A 4BF9A 1FWJC 4AVOA 3TVAA 1DHPA 2XGZA 3G22A 2A7PA 1P43A 3IJ7A 4EK7A 4ILSA 1B4KA 4FIQA 4AC1X 2Y4SA 2GLKA 3PJUA 1GKRA 4KEMA 5FL1A 1E73M 4HD5A 4ZXLA 2O9PA 4HSNA 4C1KA 1QASA 1KQYA 1UD2A 4MUPA 1MVYA 4FOKA 1BF2A 3CUGA 1JEZA 2CIPA 2V30A 4LEFA 2G5WA 3V7PA 1SSGA 3AIRA 2VOMA 4PBFA 2C1HA 3P67A 3GKAA 4IGMA 5E93A 5LNWA 4LCSA 3BTNA 2YDAA 1C90A 2IQDA 4IIDA 2FFCA 4HN8A 1EPVA 2JF6A 4DF2A 4IF2A 3EOLA 4A2RA 1JCLA 2VEGA 1J93A 1V7AA 1W37A 3AISA 1P0NA 2WZHA 3UY7A 4C7DA 1SJAA 1VPYA 3NSNA 4Y90A 3E5PA 2G41A 1RK6A 1VAHA 3IVUA 4FP1A 1AODA 3VK5A 1VJZA 2BHUA 3NEHA 1ADSA 1TJPA 1GHRA 3UFYA 3WL0A 3R4IA 1SFTA 3EMZA 1FKXA 3SUSA 1KO0A 1OX4A 3KWSA 2V5LA 1FKWA 1BTMA 4EAMA 5BRQA 2IKJA 4G7EA 4MJZA 3MU7A 4AQLA 3A6OA 4UTJA 1OCJA 4J9JA 1FWNA 4Z2LA 4QSFA 1D2KA 3RPTA 3P6LA 4H4IA 3TR9A 2WMIB 1GZGA 2VD9A 2ZBTA 3AO0A 1DBTA 3OGRA 4ZBCA 3GNPA 4QJ3B 3AWOA 4G56A 2Q02A 1BSLA 3T0DA 2V81A 2QPXA 2WLZA 4EP8C 1BVWA 3OQ8A 3T44A 1CXKA 4L6OA 3EGJA 4XUYA 3RX4A 4MB3A 1G4TA 4NJIA 3PPFA 2FPVA 1V3KA 3AZSA 4YVXA 1FP8A 1VJSA 1GOMA 3R13A 1BG4A 3N25A 3WQWA 1A47A 4D6EA 3ITTA 1FCBA 3BVJA 3DZ1A 1L6YA 4GQRA 5D9PA 4LF1A 3KP1A 3CQKA 4DO4A 1A3HA 3GNXA 4G2DA 5DY3A 2J7HA 3H23A 3O2LA 5LNSA 3ZLFA 1GVRA 3AMGA 2RDTA 3OA3A 2JGYA 3WJZA 2P5NA 4QBXA 4XKYA 4QQUA 5HPCA 2HPMA 2YR1A 4PUWA 4EF9A 2OWCA 3VIHA 1UD4A 3QFWA 4EE9A 1QO2A 1JUEA 3KLKA 1PL9A 3WFZA 3KOFA 4CNNA 2DUXA 3FIGA 3I6RA 2RUSA 3GC2A 3MWCA 1TREA 2UBPC 1XGEA 1GOKA 2W27A 2QIWA 2BWGA 1JFXA 1TQJA 2Z7KA 2XUCA 4WVXA 2QNEA 3VDHA 1VIWA 3KP0A 4NU7A 2MANA 3LTYA 3L4YA 4H19A 4QROA 1WKDA 2CXGA 1FFQA 1NWSA 4ZENA 4I9AA 3UQNA 1EC9A 1KNWA 2E67A 1RCOB 1WUFA 4NNAA 1TTJA 4B15A 4LAMA 3T0TA 5SWUA 2J13A 4GISA 2NLYA 4QDMA 5C70A 2FZ8A 4E4FA 1AD1A 4PA8A 3SM0A 3CLMA 4QHRA 1F61A 4GUFA 1ME8A 4O8AA 4JEQA 4V1YA 3KTXA 5B7YA 3AHYA 4DI8A 1ZALA 4U3CA 1UA7A 1POJA 1V3HA 3UNDA 3NUKA 4DYEA 5DCDA 3H4WA 2IW0A 2AMXA 4MKSA 1HKKA 2QCDA 2XIQA 2X7VA 2XPKA 4FO4A 3K5XA 4LUYA 1MDLA 4HU4A 3E9AA 1B5TA 3PJTA 5I3FA 2V2CA 1F9CA 1BWVA 1KXHA 2C71A 3QQWA 3ZM8A 2ZCGA 4Q7NA 2NQLA 1Z42A 4A6GA 3NPVA 1N8IA 3S9YA 3UWZA 3VDBA 2ALDA 1IV8A 3TDFA 3W01A 4W85A 2HE8A 3E5BA 4HJFA 3RG6A 2PF8A 2OFJA 2ACSA 4JTGA 4JNYA 1ONRA 1M03A 2BHZA 3LU2A 5H2ZA 1UCWA 4PCNA 4UTKA 4F0SA 1JGIA 2FZMA 5D38A 1JZ8A 1WO2A 1VYSX 4GYJA 3RLHA 1G4EA 4IM4A 3WNLA 2X1RA 4Q8NA 4D6HA 1KGWA 4HK7A 4IIFA 1EBGA 4AHQA 1ONXA 1OABA 2YPIA 2PGFA 1LQ2A 1YPXA 1AW2A 2VO5A 2WKLA 3M41A 1A0DA 3GNNA 1F3EA 3WF0A 4ZO6A 3AU2A 4PB3A 1FHDA 4G1NA 3LLDA 2ZZ2A 1KLZA 5CEWA 2DSZA 1VPXA 1TO3A 4O14A 4JFWA 5BYWA 3BJSA 3LZ5A 1ZUAX 3L2IA 1NARA 3NIYA 3V5CA 1XCXA 3UJFA 3NDZA 1M6JA 3WBAA 4PTWA 1K8XA 1QPNA 1UWTA 1A4MA 2QDHA 3ZXWA 1YLVA 2VOTA 2HK0A 3W70A 1KR1A 3ZZ1A 1TR1A 1J18A 4IOTA 2UZ9A 1A5LC 3A5VA 1UR2A 1F7BA 5CBIA 1XLHA 3BLEA 5D9OA 2WANA 4JIQA 2QJMA 3G1YA 4M8UA 3UF9A 4L4LA 1E0UA 5KETA 2VCBA 2E09A 2BZNA 4RPQA 1S46A 3DBPA 5HATA 1ZBCA 4J3VA 5I09A 4H01A 4O19A 4JX5A 4IMGA 1RSCA 4O28A 4F8XA 5IXEA 1ME9A 1V02E 1UR4A 1ZFJA 2W5FA 3WDPP 4DLMA 4IFRA 4KRZA 3W28A 4JCLA 3THAA 6XIMA 1JNEA 4F9DA 4NZFA 4D6IA 5C6MA 5KTLA 3SUUA 4YPJA 4B3KA 2V2DA 1P48A 5F2MA 1Z89A 2OSXA 4JR5A 4GQQA 1UUQA 2ZRVA 3W83A 1U1HA 4JTIA 4FLSA 4D6DA 4EOUA 3K8LA 1Q13A 1EYWA 3ZMRA 4LUIA 4Y9PA 1O5KA 1JZ5A 3NQEA 6CGTA 1E15A 1HP5A 1EEXA 3MI3A 2Y89A 2BGQA 2CEQA 1KM2A 2RGMA 3TC7A 3U57A 1V0KA 3QGAC 3B4YA 3OTRA 5CLWA 4NL1A 8RUCA 4DBDA 3KVJA 1Z9AA 4MLJA 3NQ6A 1J5SA 3NZGA 1TX0A 3DH7A 1FCQA 3W7QA 1IEVA 3M43A 3M0IA 1BGAA 3R8GA 4B9YA 1H50A 1IR1A 1XSIA 3RK8A 3QF0A 1ZSXA 3HV8A 1AJ0A 1HL2A 4TV6A 1UJQA 3S5SA 4QS5A 3QV8A 3WLKX 4I90A 4DXVA 1FWDC 3OW1A 1V0NA 3OP2A 3ZVIA 2R24A 1T8XA 2E1WA 2Y5JA 2Y62A 4BR1A 5I78A 3PUGA 4BY3A 3WLHA 4L6DA 3NVTA 3S1VA 1E6NA 3TR2A 4BQ5A 3SCTA 3DXIA 5AC5A 3MQTA 4WDUA 1FXPA 4Q4QA 5HBFA 2BVYA 4TVDA 3IGHX 4IJBA 1IXOA 4XAGA 4XB3A 3W2KA 2XG9A 2CC0A 3BDKA 3R89A 2YXOA 3DIPA 3UXAA 4KERA 2QT3A 2A3AA 4HHPA 2FZBA 3MJYA 4GABA 1QBAA 3GXTA 3DX5A 1XLLA 3PG9A 4A2SA 5DMMA 5EPDA 1J12A 4AXNA 4GI9A 5GPRA 2YDQA 1BWKA 4M3PA 2YYTA 1S5VA 1Q3NA 1XFCA 2X1TA 3V18A 2Z25A 1X38A 5D04C 4KKXA 3VOJA 1C8VA 3KZSA 3I4EA 1ZPTA 4QAIA 5DXYA 1OWQA 1IT7A 7PTDA 1EP2A 1XLGA 3KL5A 2CLHA 1W9PA 1VP5A 4WEVX 3UY8A 3AJXA 3TYDA 4GUGA 4HPNA 1IE7C 2D2JA 2JKEA 5CSUA 4R85A 1OCNA 1LQ0A 2NVAA 2PDKA 2F9RA 2CBUA 4NJHA 2YSWA 2DQXA 2HVOA 4O1FA 3NG3A 2Y7GA 2BOFX 3V75A 4WF7A 4KBXA 3OLIA 1R7OA 2X1SA 3G1DA 3WLLA 4A29A 4IIBA 4CQDA 2VQUA 2W66A 5IHRA 1J0ZA 1Q6OA 3ATZA 1I2PA 3NQFA 2W0UA 3QKEA 3FA4A 3C0LA 2A79A 3HBLA 5ECUA 4HU3A 4JKKA 3M0MA 4CD6A 4YVVA 3E0LA 3KS6A 1E3ZA 2YCEA 4UQEA 3WH5A 2I9UA 3BCDA 5E6ZA 3EB3A 3GR7A 3J7HA 1TKKA 4FXRA 4RE0A 3SQSA 1UZDA 4GC4A 4P7OA 3UYCA 1Y65A 2O7SA 4O1AA 4PRWA 1CEOA 4W7WA 2FJKA 2HDJA 2TMDA 3FYYA 4JY9A 3EDFA 1Z69A 3N6HA 1CIUA 5ENLA 1MW2A 4FLOA 1KFJA 4NJJA 3AYVA 4DJDD 4FNRA 5DBTA 1QWKA 3W1AA 2P1FA 5BU9A 2XGIA 2OU4A 4JIRA 1KW1A 3G77A 2DZBA 3GAYA 4C7FA 3LPGA 4EXBA 1DWIM 4W89A 4BQ2A 1F8IA 1S3TC 2Y70A 4UQBA 1Q6DA 3O6DA 3NL6A 2HXTA 3N14A 1BRLA 4N4PA 4MY8A 2ISVA 2V68A 1XD1A 4KIRA 3FK4A 1NTHA 4JXCA 3M4HA 1P6CA 1QUMA 4HNTA 2B31A 3W88A 2PDCA 3LLFA 2IKHA 4BHYA 3L2LA 3MB9A 3A4AA 4TOQA 4ATDA 5L9FA 3ABOA 1U83A 1FCUA 2X41A 3VOGA 1SJBA 2WM1A 2D2HA 3VM5A 3KBSA 1CGVA 3H2EA 1H61A 2PD5A 1R9ZA 3CL7A 3VYLA 3VAVA 4MFDA 1C8QA 5I77A 1JPDX 3USBA 1RALA 2GGEA 3N3TA 3WLTA 4PN2A 3M0VA 3ITVA 4MPKA 2Y88A 3I4KA 3SZ8A 3KW3A 2Z2UA 3LYEA 2GQ3A 3NQ8A 3CO8A 1G7UA 4M51A 1XICA 4QSHA 5BOFA 4MF4A 2I56A 2OQHA 4EPEC 3PBUA 3PFRA 2OO6A 1GOQA 3NSXA 4YTUA 1BVZA 2DT1A 2V6AA 3EOOA 2V9DA 2BV9A 3A3HA 4GZJA 4PB4A 1UKSA 3PTQA 4IICA 2Y61A 3GKFA 2DORA 1I2OA 4O1EA 2NVDA 3OZPA 4Q4OA 1EDGA 2F6UA 4NZJA 3AUOA 9RUBA 3TNBA 2DUAA 3GFZA 3U7VA 1PZ0A 1CNVA 5F1UA 1SZGA 3DU0A 4CEXC 4Q3MA 3BGJA 4DZHA 1Z3NA 1GONA 2DJLA 1HO1A 1T99A 5HUOA 4PZVA 1TZ7A 1E9ZB 4FLRA 1HUVA 3W7CA 2VX6A 3G18A 4WY0F 7CGTA 3CUZA 2VVSA 5G4EA 1QK2A 4XWUA 2DDXA 2PC4A 3W1NA 3VGBA 5EL1A 3KOYA 2C14A 4UFLA 2YXGA 1ADOA 4PCTA 4WZHA 1HKJA 3GY1A 1XX1A 1C92A 4RW5A 1UD5A 2W3ZA 2D22A 3RITA 2X0HA 3W0KA 2G0WA 3AOFA 4JTSA 1K9DA 4UTIA 5IOBA 2J6VA 3XIMA 3ZLHA 3EOSA 1M3UA 3GXNA 2QVNA 3M5XA 2VGGA 4W8AA 3WQ6A 4FB7A 1GG1A 4H6EA 2VFEA 4QJ4B 3UEQA 5AB3A 3LHYA 1CB2A 1MUWA 4DBSA 4E3VA 1BTCA 4IISA 3LXCA 2PLKA 2Q09A 3RN6A 5C54A 4KWVA 1OADA 2YW3A 3GG7A 2ZUWA 4L4OA 3TN4A 1A4LA 2WCSA 1EJTC 4UMBA 2QUNA 2CPUA 5D33A 4JHOA 3H2AA 4M1RA 4DWSC 1I60A 3AMKA 3R2GA 3IIXA 4GY1A 3BPWA 4PMZA 4PTXA 5CZSA 4RZ5A 4AHOA 1XH2A 2O9RA 1JPHA 2YB1A 4QLLA 4FNUA 1SO3A 3GQYA 3PJWA 5E5CA 5G2IA 1EDTA 2VGFA 3FEMA 4M24A 4P8VA 3B03A 3HPSA 4S2BA 7ODCA 4LTSA 4W7VA 3VCRA 5H6HA 4A3HA 1K7XA 3NXFA 2X1UA 1PE1A 3HPFA 2R91A 4LUTA 3SBFA 3HGJA 2FZ9A 1J5TA 2FTYA 4DN1A 2NXGA 1OFDA 4NKCA 3DI0A 1ITQA 5D02A 3VPLA 3B9EA 1YKWA 3MP3A 1OG0A 4UZUA 5PTDA 1UD8A 4GUIA 2WC3A 3C8NA 2J8TA 2R9RA 1TIWA 4HNOA 4H9ZA 3EXTA 3MI2A 3KX6A 3GTIA 3PZGA 4AWUA 2VZTA 4B2DD 1EBHA 2V5CA 1EUAA 3NM1A 1XIHA 4KGLA 3SRHA 3N3MA 3W73A 1ODZA 1KFBA 4CCDA 1NP0A 1W3IA 4D71A 1J6OA 1Y5XA 5BXSA 1FCVA 4P2VA 3FYOA 4PTVA 4IPJA 3M44A 4NZCA 4C90A 1GCYA 3BLIA 1OZMA 3U2EA 1WAUA 3CUIA 1XUUA 5I3DA 1CECA 1PDYA 1XYMA 4IHCA 1KTCA 4U3AA 3EB4A 1W1VA 4L4PA 2YXXA 3SCOA 4UTTC 1UWRA 3UWUA 4PCSA 2OPJA 2R1KA 2Y0FA 4O0KA 2AQOA 4RKAA 3PZOA 4AHPA 1L6WA 3F7JA 4PCFA 3DHPA 1UG6A 2Z1WA 1EKOA 4DZ5A 4JEJA 2J4GA 3DFYA 1OJXA 3H2OA 4CLMA 5EMUA 3LI1A 3OGSA 2WVTA 2ON3A 1OM0A 2BGSA 5U7SA 4F0KA 1UH4A 5A2AA 4W9TA 5HNTA 2J7CA 4TX6A 4UCGA 3M64A 3CO4A 4AD5A 3RO6A 3PZ9A 5E0FA 4M80A 1XIEA 4J28A 1YEYA 2CW6A 3FHQA 2I5IA 3R1ZA 2OVLA 1IHIA 1RCQA 2EF9A 4MDOA 2HS6A 4LVAA 4DZAA 3BLKA 3GZ3A 2ZC8A 1S5NA 4H8NA 1XIFA 5G1YA 1A5KC 4Q32A 5DY2A 2QKFA 2WSKA 3RM4A 1LTDA 3SURA 2V3FA 1JCJA 3HGOA 5I00A 1VPQA 3TTSA 1Z41A 3EWYA 1SMDA 3QMTA 1RD5A 3WD4A 5T26A 4W8BA 5F2LA 1OD8A 4C6IA 3GUWA 2Y8VA 7REQA 1VH7A 2XFWA 3ITOA 1LRQA 2PBOA 4ZOEA 3EWWA 1ELSA 2XGBA 4QE4A 4RDWA 3H7UA 2WJZA 3NCOA 1XIDA 3UWQA 3QHMA 5EFFA 4IIHA 1V5XA 4B92A 5BNKA 4IQLA 4R9OA 1K03A 3OQEA 5LIWX 4YMZA 3GNOA 4S3BA 3KLLA 1XHGA 1CLVA 3F4DA 4NHVA 1LT7A 2QUVA 4K1WA 4JIPA 3LXAA 4RPPA 2VGIA 1E51A 2OZTA 1W1PA 2NT0A 3RM8A 4JQAA 2EPKX 5C7VA 2DZVA 4WDTA 3S9ZA 2ABBA 5DQPA 1LROA 2GQ8A 3UZZA 2OYKA 3FVDA 1DQXA 3VMOA 2PDPA 3GR8A 2OB3A 4EX4A 4WGHA 2PGRA 3WQ5A 3QMSA 1JZ2A 3CV2A 4EWND 3OIHA 2NQJA 3ZWSA 3T0CA 3UG4A 4R33A 2YFOA 3UP8A 4UTLA 5AZ1A 4DX3A 1J01A 1GVFA 4JFVA 2BSLA 1A5CA 2BOEX 4M81A 2WMGA 3T2PA 4L9XA 4ZE5A 4IT1A 3S8HA 4LH8A 3IANA 3SFWA 3VUSA 5I3HA 1YMYA 4XZIA 3UZWA 2VNCA 5FF2A 2RKXA 4ERGA 2QPUA 3JVAA 1T7LA 1H5VA 5I23A 3EDKA 3ZVHB 2PODA 2ZRXA 3CH0A 3WLRA 2R1PA 4FALA 1TFVA 1CXHA 4HQVA 1P7TB 2AGTA 4XIMA 3AXIA 5CZJA 5FACA 3BLLA 3PTKA 1QAPA 9XIMA 2VEFA 4LV9A 4K8HA 3BC9A 2J27A 1GW1A 4DM2A 3F5KA 2PEVA 3M0KA 4AW7A 3DFPA 3W76A 1D7KA 2DZTA 1O6IA 2XN0A 3KRUA 5BMXA 4LBSA 1OFPA 6REQB 4FS9A 4HHMA 1JDAA 2ZVIA 3EMQA 4KH2A 2BY1A 5D2VA 3PWAA 3LTPA 1F4HA 2YA0A 3ZJ6A 3B40A 1O5XA 1OB0A 5AHNA 3F1QA 2WMJA 4BQ3A 1OEPA 3R94A 3ALFA 2INEA 1W9VA 5A8GA 4TQTA 4J27A 2G3MA 3IJ8A 2BG5A 2F8QA 3N34A 1WDDA 3S2JA 1D3CA 4V2XA 1IQ8A 3LV6A 3NQCA 1HT6A 4KCTA 4JX4A 1UC4A 2GGGA 3RILA 4JOMA 1FP9A 4I5XA 1KKOA 3VNZA 3UR8A 3OOQA 3QPEA 2QLYA 1Z8AA 1XINA 1L2UA 4NAEB 3LM3A 3MVTA 3HTWA 4IIGA 3GVRA 4LUSA 2HZGA 1XQKA 4XAPA 3FOKA 3USZA 4QLKA 5C9WA 5C8BB 4LANA 1M01A 2B7NA 2PU0A 1SPQA 3FW6A 2GOUA 4QLJA 2V5DA 5B7ZA 3GTFA 3H7VA 3LHZA 1H2JA 2GK1A 2OGYA 1UZHA 1R38A 4XAYA 1IYXA 4CVWA 2VENA 1EGMA 5KZ6A 1JQVA 2I9EA 1XI3A 4UOQA 1W9UA 4GI8A 3LRLA 3K30A 2YB4A 4UR9A 3VVGA 4LW7A 5GVJA 2F6KA 4UMAA 4GBUA 2OYMA 4A8IA 3LX9A 2CBIA 4MY9A 3W7IA 4GFSA 3G0XA 3PBYA 3M0LA 5L6UA 3W1XA 1PX8A 4DBUA 4MB1A 1B3VA 2BP1A 4UQDA 3EEGA 2NV2A 5AC4A 3VD7A 5A6BD 1HJSA 3WLQA 2VFGA 3ZOAA 1AMYA 1OHLA 2WSYA 3IAQA 1VJIA 2ACRA 1OVDA 2DZPA 1MEWA 2QV4A 1JZ6A 3EWUA 4HN4A 4AIUA 5IM51 3ZO9A 4LB4A 2VJXA 3ITCA 3U2CA 3DCPA 3V1PA 1G67A 4I6KA 4ZFCA 1QRQA 3DC8A 1W2VA 2QCHA 2IPGA 1BXBA 3QZAA 3W84A 1L6SA 2WHKA 1U30A 1QPOA 1J11A 4HB7A 3ZJKA 3SRDA 3CV6A 1N8WA 3H7RA 3PM6A 2DP3A 2FB3A 3PAOA 3RXZA 3VDGA 1DHKA 3N29A 1ISYA 3EWBX 3VGDA 1F5ZA 3SCRA 1OX5A 4UR7A 4C6NA 3QV6A 1W9BM 1V8EA 1OGBA 1XUZA 4MUZA 1TQXA 2WVUA 5HJYA 2Y8KA 1V0MA 1RD6A 4G9PA 1XLDA 2W62A 2W63A 3VC5A 1KFCA 1GJWA 2ZZ6A 2SFPA 3W75A 4O1DA 4IQJA 1NFPA 2WZIA 2Z2AA 3F4WA 5BOOA 1XGZA 4PMDA 1JDCA 3UGRA 3WMCA 1PX3A 4YWSA 4DWSB 1V77A 3N11A 4YJ5A 1EQCA 4GY0A 5A8MA 5DT7A 4JTLA 1WBJA 1UJPA 1X96A 3LCIA 3Q4DA 1Q4NX 2PRLA 3G1AA 3U5UA 3ENLA 1ICQA 4PL1A 3HO8A 1VLWA 4C65A 1UPPA 3CAQA 4HNCA 3V0SA 2VP8A 2PLJA 1LORA 1N55A 4MAZA 2A1YA 3TU9A 3KRZA 1W3NA 1DYSA 2TPSA 2VD8A 2HISA 3P62A 5I2UA 5BZAA 3K2GA 1HVXA 4AYSA 3K4AA 3V35A 2WW5A 2E9BA 4WGXA 3N17A 2GPTA 2ZX6A 3GHTA 4OV4A 4PUMA 2WM0A 2GDQA 4L6HA 2WAGA 3W72A 3TAKA 3GIPA 3URNA 2YLAA 2CLMA 4B9ZA 5E1QA 1ZBKA 1ZTVA 1A0CA 3MDUA 1W3JA 3LBCA 4RV3A 4HPHA 3O7UA 1I8JA 2ZA1A 5E6YA 4BQ4A 1IXQA 3ORWA 3TJXA 4PUEA 1G5AA 3BV4A 3GHSA 3NDYA 4AD1A 3G1XA 2OQYA 1S5WA 4K8GA 4ZQMA 1PHQA 3CXOA 1X6LA 4XZMX 4ROQA 2ACQA 1HVQA 1EL3A 3BE7A 2G96A 2B4GA 2XIBA 2OZ8A 5FJRA 3I10A 4D6CA 2Q6ZA 1KBIA 3T6CA 2VFHA 2X05A 4WIWA 1QO5A 2H9AB 1J96A 1RY8A 3AZRA 1AA1B 2ZUUA 2EKGA 2D1ZA 1TTQA 1K3UA 1VFUA 2VFFA 2ANUA 4PUUA 2GL5A 5HPOA 3Q65A 2YCKX 2XFYA 4PH6A 4MWAD 1A53A 1NM9A 3W23A 4K36A 3TLQA 3MSRA 3NURA 3KCJA 1UROA 4NG3A 3RFAA 2XVGA 2O4MA 1F3XA 5E9XA 3T78A 4E8GA 1QOPA 1T8QA 1SU5A 2JEQA 1W5NA 4FA3A 1BAGA 3EYPA 1NVMA 3UCCA 1MMFA 3I65A 2DZXA 3PY2A 5EU9A 4B4FA 4AZCB 3IJ6A 3OU8A 4Y8EA 3IV3A 1NDYA 2FLIA 1P4CA 5BRBA 5E9AA 3B04A 2D0GA 4I7VA 1W8SA 1JJKA 3MCOA 3SSJA 1F74A 1WBHA 3HQ1A 3T07A 3N4AA 2DVTA 3KBVA 1JCYA 5EKYA 1WNOA 4MLRA 3L12A 2WWDA 1ITXA 3I6TA 3PWGA 3NXLA 3UXKA 4DXKA 2WHLA 1HL8A 4MYAA 1W91A 4A8RA 4ONVA 4NVTA 3WK1A 2PWGA 5LA0A 1FHLA 4NT0A 4JHZA 4WK9A 3GUGA 5CGQA 4N2YA 1RAKA 3W7PA 4IH3A 3CIWA 5AHIA 1A5OC 3UJRA 1KXVA 1UZ1A 4CNSA 1QDSA 1PAMA 4S3FA 3B3DA 4GH3A 2EJ1A 1JIBA 3DGRA 5BRPA 4AYGA 1S5MA