4RKAA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a347
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with DH03A347
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
total genus 137
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rkaA00
4YWIA 5D33A 1QR7A 4HNTA 3LCLA 3ATYA 1OG0A 3W7KA 1SO5A 2FPTA 4WY0B 3M7WA 4RR4A 4GFSA 3GAKA 1NSJA 1SUXA 2A6LA 3EX4A 1TPEA 2FIQA 1EPXA 1ZY9A 2C3ZA 3KAOA 3E96A 1H7NA 1KLYA 1QAPA 3MW7A 1OVDA 3OEXA 5G4EA 1A5CA 3FA5A 3SFKA 3QRHA 1VYPX 2C19A 3W2JA 2QCGA 4XZ9A 2VFFA 5FF3A 4LUIA 1NAL1 4LS1A 1H7OA 2PC4A 1W5QA 4LOCA 1WV2A 1OFQA 2FQIA 2V2DA 2VEPA 4XKYA 2QAPA 2QCNA 1D3HA 1PE1A 3O6YX 2A85A 4NNCA 4O50A 3TC6A 1CX9A 4AB4A 4FXRA 3G1AA 5G5IA 1GVRA 1VLIA 3SGUA 1JQXA 3MJYA 1XXXA 2QCLA 3O15A 3PBUA 1VQTA 3LLFA 3W84A 2EKCA 3WK2A 3TXZA 2C1HA 3TQKA 3D0CA 3NYZA 1AMKA 4TIMA 4UFIA 3TW7A 3L0NA 2AQWA 3QW3A 3WK3A 1TTJA 4LV4A 2YYUA 3NZ1A 5K9CA 2UV8G 4S1FA 3GX9A 1IXOA 1LOLA 2GOUA 5D02A 4KFOA 4O52A 1S5VA 1KTCA 1ZAJA 4HN4A 4MY9A 3JRKA 4OU1A 4EWND 3BGGA 4Z0JA 3TJLA 3LOTA 4P2VA 2GUUA 1XL9A 3KXQA 3W7HA 3GXPA 2R94A 1UASA 3L66A 5G2HA 5AYZA 2DZPA 4XWUA 2DP3A 3DHDA 3ANYA 2P0OA 3UXDA 3L68A 3TC7A 4JGDA 2VELA 2WSQA 1F05A 2WNQA 2VFGA 5D2TA 3RLUA 3G18A 3NOEA 3CIWA 4FHAA 1W3IA 3NXFA 1ALDA 2OJPA 1LYXA 3G0XA 3F1QA 5LNWA 3ZR4A 3FKRA 5EPDA 1SSGA 3IIOA 2CW6A 1OF6A 5I3IA 1GJPA 1WBJA 3P8IA 1GVSA 4CCEA 3QM3A 4I7VA 3ABRA 1QDSA 5T26A 2Q3RA 3NM3A 3G1DA 3O6DA 3DFNA 4WOQA 3WK1A 4AHQA 1VH7A 3MHGA 4O12A 1ADOA 1IF2A 2CLOA 2NLIA 4UTJA 3UD6A 3C2OA 3QH2A 3B03A 3CC1A 4E2DA 2TPSA 3NPWA 3NQFA 5HULA 4JTLA 2YXGA 4UFJA 5LHFA 4BR1A 3IEBA 5C5YA 1GTHA 3USBA 2PURA 4D2JA 3M5VA 4JTSA 4MVAA 3OVRA 1TMHA 2E6AA 4QSHA 4FNTA 4H6KA 4O28A 3SJ3A 2ZRUA 1ZCOA 3NNTA 4O4VA 4UCGA 1PHWA 1WOAA 1VCVA 1B4KA 5U7SA 4CQ8A 1K3UA 4XBKA 4ZQOA 3P80A 1Q6LA 5DY3A 2NUWA 3DBPA 2QJGA 1KLZA 4YL2A 4RCXA 5HJLA 4PEKA 5CZTA 2ZTKA 3W7RA 2WSYA 1ZALA 4AMAA 1OX4B 3QQ1A 4IX2A 2C6QA 1J4EA 2ZTJA 3NVTA 2P10A 3GIYA 3E0IA 3TNOA 3TROA 5C55A 1UUOA 4IPIA 4N6EA 4BI6A 2Y61A 3IIVA 5FF2A 2GJNA 3HO8A 1PCKA 3KVKA 3M44A 1LM1A 4EF9A 1A50A 1NVMA 4LVGA 3QSRA 4UTLA 2KZHA 2Q8LA 3GNNA 4O1DA 4HPJA 5E1QA 2XFWA 3GR7A 5K9XA 4GWEA 5DCEA 2RFGA 3GK0A 2H3DA 2TSYA 4DO5A 1LCOA 2ZRYA 1MSSA 2TYSA 4M5PA 3TFCA 5I3HA 4LV9A 3BG9A 1RR2A 1NF0A 4AEOA 1SFLA 1D9EA 4NNBA 2H8XA 1K8XA 3LTPA 3C56A 2NZLA 1VC4A 3PWAA 1P1XA 3NAVA 2JKAA 1UCWA 3P5YA 3W72A 1TV5A 1GPWA 1RQBA 1L6YA 4KWWA 3W2KA 3C2RA 3L0KA 4CLMA 5EL1A 3MHUA 4ZQPA 4KFNA 1AW1A 1TPFA 5EKYA 1KFJA 1FWRA 2ISVA 1NF7A 4Z1DA 1G4PA 3LCIA 4WJEA 1EWEA 3FJLA 5KSWA 5CPOA 3B0UX 4NXKA 3LHUA 1QMLA 2AGKA 1OYBA 1LORA 4IUOA 2WOQA 4LRTA 3EWUA 4DEFA 5CKSA 1QNVA 4OWGA 3HPXA 4DF0A 2ZA1A 3UZJA 5K4XA 1VHCA 3KRUA 4AF0B 3PY2A 3QZEA 4UMBA 4LC8A 1OJXA 2JKEA 1GVFA 4UMAA 3P61A 1TPB1 3LI0A 2Y6ZA 4O57A 4W9TA 2QCEA 2B7QA 4MFEA 2WJZA 1JR1A 3EX2A 1YXCA 4O1BA 2J9XA 4O4WA 5F4XA 4AWUA 3W1RA 1AG1O 4ALDA 3DU0A 1GOXA 1IXNA 2NUYA 4TMCA 1ZAIA 1LTDA 4WZHA 2Z0IA 3W7PA 4MZ8A 2YGYA 5CPLA 4MFDA 5FI8A 3HIJA 2VEIA 3IGUA 5DLCA 3C2EA 4NX0A 2J6XA 4O1AA 1FQ0A 4PTNA 1TJPA 5DXXA 5FESA 2CLMA 1FWNA 1EX5A 4NU7A 3NR0A 4S2CA 1IIHA 2A7PA 4NJGA 2ZRVA 1VYRA 3R5EA 3G1VA 1X1OA 1EP3A 1I4NA 3PUOA 5AHLA 3S6DA 4POCA 3A9IA 5CSRA 3W1PA 4DF1A 5DCBA 3MBFA 4UTKA 1VHNA 4HNUA 2V2CA 3G3DA 1G4TA 3Q37A 4JIQA 4JTJA 1F6PA 2X30A 1W5PA 4K8EA 1KFCA 3B0PA 4JIPA 1SQ7A 1K7EA 2B7OA 3CQ0A 2ZRWA 3DFPA 5F4WA 4GUHA 3PUDA 1CW2A 3C61A 5D04C 3PSVA 3TU9A 1WBHA 4UNKA 2ZCGA 4DBEA 2X1TA 4FX8A 2X1RA 3O6CA 1H50A 4DO4A 4ICNA 4EIVA 3C6CA 4UFMA 3W7IA 2PRHA 1XI3A 3MP4A 1EB3A 2E1DA 4Q32A 1LROA 4L4MA 4M7SA 1SW0A 5D05A 2A7RA 1ONRA 3IGSA 1FBAA 2A2IA 3HF3A 3A24A 5F1UA 5HUOA 4Q4KA 1T99A 3QC3A 5AN7A 1H51A 2ZZ1A 2RKXA 2BSLA 2ZFAA 1TPWA 2NV2A 4WX2A 3TX9A 1V5XA 1FDYA 1FWSA 2GQAA 3O63A 3LHYA 4TR9A 4YMZA 3VKJA 3W7EA 1W8SA 1QO2A 1RQEA 3O1NA 1EWDA 1LBMA 2CZ5A 3PB2A 1R47A 1SO3A 5AC6A 2PCQA 4RZ4A 1DOSA 3STCA 1P4CA 4FX6M 3LXAA 4QITA 2CZDA 1QCWA 2ATMA 4WY0F 1JCMP 3M0ZA 5D03A 4JYFA 3UXAA 1F6KA 1SPQA 2JK2A 4DELA 1E51A 3S1VA 1T8XA 2CLLA 2DJLA 3TIMA 3ZFHA 3BG3A 1TV8A 3NO5A 1ME9A 1OFPA 4BFAA 1VCGA 3TH6A 2RHGA 3SECA 3M9YA 3EKZA 1HO4A 4MOZA 1R30A 5CGQA 3RK8A 1HUVA 3W7GA 1GG0A 4S2BA 2B0MA 3LB0A 3WFAA 1TPH1 5D2WA 4Y6GA 5HR6A 3EWZA 1L6WA 4IOTA 3LTYA 2I14A 5A5WA 4FB7A 1I45A 3B0VC 4K37A 4CNPA 5IBXC 1YXYA 2H6RA 5AB3A 3GDMA 3VE7A 5K4ZA 1FUYA 1GTEA 3LGEA 3LRLA 1PL9A 1TPVA 3QQ0A 4N9CA 5LNVA 1EP1A 3TK7A 3HGRA 2A4AA 3PBWA 5CZJA 2GJLA 1H7WA 1XCFA 2YFOA 3G1SA 4Y8FA 1TPDA 3CWNA 3W1TA 4BWLC 2ATSA 3I7SA 1JRBA 4FNPA 4MLJA 4EVZA 1G4SA 3BV4A 4FNSA 4UFLA 2ZZ7A 3NL3A 4GBUA 4UMCA 5KZMA 2VFEA 3DI1A 2ZRXA 1TTQA 2OX1A 3O05A 1YYAA 3MUXA 3N9RA 1DVJA 2V81A 4LNYA 4YCOA 3GDLA 3NL2A 1LBFA 5I3FA 3I65A 3BGJA 4NJJA 1WDWA 4NZJA 2ZYFA 1HO1A 1HTIA 2B7NA 4AHOA 2DZVA 4HIBA 3ZWSA 2LLEA 5SWUA 3NPVA 1FCBA 1BWKA 3F03K 3G3MA 3VI2A 4UR8A 4C1LA 1RPXA 4RV8A 4WOZA 2WQPA 2DZWA 4TMBA 3TV8A 3WJZA 2B4GA 2G96A 4JTKA 5KITA 3DXIA 1Q45A 2Y7GA 1VJIA 4UTUA 1JCJA 3S42A 4QISA 4XBSA 3W1MA 1H7PA 3FYPA 1SU5A 2ZQ0A 2ZZ5A 2QKFA 3B04A 1FWWA 2CLEA 3NQDA 1FY6A 2H90A 1TTIA 1OX5A 4JTGA 1SSDA 3LDVA 4RZ5A 3OHIA 2I1OA 1F76A 4O10A 1XDLA 3FIGA 1ZJIA 3BARA 2RDTA 5CZ0A 4PC8A 4R7JA 1RZMA 1UJPA 4JTHA 4DXVA 2A5HA 5TIMA 3LCHA 1DQXA 1JVNA 1GYNA 1VRDA 3RF9A 3L2IA 4OV9A 1X7FA 5E0KA 3GDKA 3U8GA 4OE7A 1GWJA 3FS2A 4HNNA 3UWUA 3DGRA 2QCMA 2DU2A 3NQEA 3MYOA 5CSSA 2NWRA 1SO6A 2W79A 4CNOA 7TIMA 3W7MA 3PS7A 4E38A 3EXSA 2BX7A 4MY8A 1L6SA 5H91A 3N2XA 1GVQA 1FCUA 5D37A 2BWGA 3STGA 4UR7A 1LRQA 1LDCA 5IBXA 2QJIA 1VZWA 4B5NA 4Y90A 3LCGA 1DJNA 2BTMA 3BVJA 4DQWA 2VEMA 1AL7A 1B4EA 3G22A 1O60A 3IV3A 3O8AA 3OVQA 4MY1A 3ATZA 1B9BA 4N2YA 4K39A 2OT1A 2QUTA 3N9SA 3A5FA 2V5BA 3W2LA 1T0OA 3C0JA 3PBYA 3GDTA 2E6YA 1ME7A 2DZSA 1C8VA 4H3DA 5LHEA 2C15A 3C4UA 1JJKA 2WKJA 1YDOA 3LXCA 4R53A 5LNRA 4H4IA 2FLIA 4LU0A 1W31A 3TR2A 3BW4A 1VCFA 4N9EA 4NJKA 3PBVA 4JX5A 3YPIA 1JUEA 4O1CA 3S5OA 5BNKA 3P7YA 1DORA 3HOJA 4A2RA 3MI3A 3G8RA 2RH9A 3EX1A 3NGJA 3PULA 1HFBA 1I2QA 3TKFA 1FX6A 4GRSA 1YTDA 3UQNA 2OT0A 3W85A 2H8ZA 3M16A 4I7UA 4IXHA 3WJXA 4U4MA 6TIMA 4QJ1A 3GXTA 1KM5A 1RVGA 4UFHA 1KFEA 2ABBA 3M6YA 3O16A 5AHNA 1PV8A 2XN2A 3HG2A 3N2MA 3A23A 1OFDA 1RD5A 1QPQA 1O4UA 1YTKA 2QCFA 3N14A 1DL3A 4BK9A 4C1KA 3HGOA 2C0AA 3EX6A 1BKSA 1KV8A 1G7UA 3M47A 1GZGA 2NWSA 4N4PA 3W1QA 3QPYA 4LT9A 4TO8A 1FWTA 5ABTA 3RFAA 3DAQA 5D09A 2XN1A 2J9ZA 3S5ZA 3C2FA 1Z48A 5DBTA 3KRSA 3LBMA 1H60A 1OYAA 1EEPA 4UFKA 4UXDA 2Y7EA 1IXPA 4A29A 4IMGA 3H53A 3CPRA 1A5SA 3OA3A 2JGQA 4PFMA 1LLZA 1XKYA 3L5AA 3STFA 1S5WA 3INPA 2V9DA 4ADUA 2WO5A 3ABOA 1H1ZA 3W88A 2PE4A 3BLFA 3CU2A 3L9CA 4ORMA 3QMRA 1TCDA 2E5CA 2F7FA 3SI9A 1W37A 1G6CA 4QQ3A 1B57A 1ZHAA 3N19B 4LW7A 2OZ0A 3T78A 3LRMA 1F73A 4Y9AA 4MKNA 1R46A 4O15A 1LP6A 4FF7A 4GE8A 3EX3A 3RLVA 3U6WA 3TAKA 1SW3A 4FNQA 3DENA 1X1ZA 3PSWA 4J9JA 3M5ZA 3DZ1A 2HSAA 2GVGA 4JYDA 1KM6A 3LBCA 5AOUA 3W7QA 1SZNA 3L5LA 5C2XA 4JEQA 4EF8A 2O7SA 4UNLA 2DZTA 3DKJA 3I7QA 2G95A 5MHBA 3GYEA 4IX0A 1YADA 2OCZA 5FEPA 2ZZ4A 3MI2A 2GQ9A 4FIRA 5KMYA 1EUAA 5FEXA 5I3JA 5DY2A 4O54A 4LWWA 3TFXA 2QEZA 3MMTA 5EBUA 2Y7DA 2CU0A 4NUWA 2VKZG 2RDUA 3L5MA 3UWYA 3O06A 3LHZA 4A21A 5EA9A 1BTMA 1XM3A 1O5XA 3S0CA 2Y89A 3V1PA 5F2LA 5L9FA 3G1HA 1KBIA 3I6RA 3CLMA 1N7KA 1KFKA 2Y70A 1FXQA 3UWZA 4Z08A 3DKLA 1A53A 5FEZA 3L0GA 4NJIA 1YDVA 4QIUA 5F2GA 1EP2A 3S5NA 3A5VA 4ADSA 1VR6A 1W5OA 3W22A 5DBUA 2NXIA 3M5XA 3CT7A 1TTPA 1KM2A 3R13A 4FIQA 1F7BA 3LERA 3C3NA 4K7YA 4ZQNA 4ZZ9A 4Z0SA 1IGSA 4R34A 1I2OA 2E68A 4O19A 3C2VA 3LCFA 3W07A 2A21A 3PAJA 3S1XA 4LVAA 3QPZA 3HPZA 3FKKA 2P1FA 2J88A 5FF4A 2H3BA 1QFEA 3NQ8A 5HWJA 4XTIA 2C14A 1W0MA 3PF3A 1OABA 4UTWC 5L6UA 4DBDA 3M43A 5EMUA 3W7NA 3QSTA 4A22A 4QAIA 2WNZA 1S5TA 5K9DA 2DJXA 3FLUA 3E9AA 1DBTA 3UZ5A 3EXTA 4NVTA 3LHTA 1D3GA 4GC4A 1A5AA 5LNSA 2YFNA 2RDWA 1ZNNA 1F2JA 2ZZ6A 1TO3A 4JTIA 2Z6JA 2QJHA 4GJ1A 3TUUA 3TMQA 4O14A 3MYPA 3NQMA 4HHPA 3WK0A 5E93A 4UTTC 3LRKA 3TSBA 4PL1A 3IIXA 1HL2A 3PR2A 4PH6A 2Y88A 4MYXA 5D30A 1SZFA 1TV7A 1OFEA 4KKXA 1WA3A 3ABSA 1YPIA 4LY8A 1QOPA 3LCWA 4RXFA 3EWBX 1XBXA 1LOSA 1MO0A 2CWNA 4AHPA 4GUIA 5H2ZA 1TPC1 1BWLA 3HBLA 1J5TA 2C18A 1XUUA 2E5BA 1BEUA 2ISSA 1SZEA 5AFDA 4NNAA 2A6NA 2FB2A 4DPQA 3VE9A 1I8JA 1XBVA 4UTMA 4N02A 5I3KA 1Q6OA 3IRDA 1SW7A 4MLRA 3FFSA 1P5BA 3UPBA 2DORA 3W2UA 5KINA 3FJ6A 3V75A 3NQVA 2E77A 4NXSA 3W6YA 3HGJA 4XUGA 4NZFA 4O0ZA 8TIMA 3KX6A 4IMDA 5LNUA 4BI7A 3G0UA 1P0NA 3ABQA 3NL5A 4ONVA 3CHVA 1DJQA 5A8GA 4LVDA 3THAA 2XN0A 3W2NA 4ML9A 4U28A 3M1ZA 2B7PA 3LXBA 4MYAA 3PB0A 1FCQA 4JTTA 1VLWA 5TQLA 2NX1A 3LX9A 3AJXA 4AAJA 3TMLA 3TW6A 4OBTA 3DFSA 3UWWA 1VGAA 1VS1A 3CWOX 4BWLA 2EF9A 2CLFA 1F74A 1YTEA 1IIGA 2FPVA 5D38A 2A7NA 1K02A 3P74A 4IPJA 2YW3A 3W9ZA 3K30A 1UUMA 1WQ5A 4KWVA 4A2SA 5D2XA 1G7VA 1K8ZA 1P0KA 5AYYA 1KFBA 3NM1A 3OBKA 3TSMA 3PG8A 4TX9A 4IMFA 4ZQRA 3TSDA 2X1UA 2NUXA 1GYLA 4ZVJA 3IIZA 1QOQA 3STEA 4LUJA 3UYCA 4JX4A 2V0TA 3NQCA 3LI1A 1QPRA 4RX0A 5AHFA 3FEMA 5AC7A 2Y7FA 2VFHA 4JN6A 1MEWA 4UC5A 1YDNA 1PHQA 5CPNA 2TMDA 4DF2A 1JCLA 1FCVA 4OQVA 1OF8A 2YR1A 1W1ZA 1U83A 5BW6A 3DFOA 2X1SA 3RU6A 2Z1BA 4IQLA 4IMCA 1C29A 2A0NA 3U2OA 4UIOA 2QCHA 2NXGA 2R8WA 1K8YA 3HB9A 5F2MA 4WY0A 1TPUA 1JUKA 1JCXA 3B8DA 4YLWA 1KA9F 4AH7A 3H55A 3QMTA 2GQ8A 3EEGA 3NG3A 3ELFA 4O11A 3GAYA 3Q94A 4JNMA 3PVFA 4EOUA 4MPQA 3NA8A 5BRBA 5DN1A 3P60A 4IWWA 1EA0A 3GDRA 5CG7A 3NQ2A 5FF7A 3NQ7A 4BF9A 4HKPA 1ME8A 3LTSA 1O5KA 4XKYB 3BW2A 1H7RA 4DPPA 2QCCA 2YZRA 1ZENA 4AVFA 4M6VA 4MZYA 4GNJA 5AYXA 3NQGA 4JICA 5BOOA 4OV4A 3IGXA 1G4EA 1GEQA 2QDGA 2G97A 3HJZA 5G1YA 2EPHA 3W75A 4YCPA 4WXZA 3ZWTA 1Z41A 1W5NA 4JR5A 4GUGA 3UY7A 3P5ZA 4LRSA 3SSJA 4NQ1A 4LS0A 1HG3A 1FDJA 5KZEA 1KV5A 1MEIA 3KVMA 4FEZA 4IGHA 1LRTA 3SW6A 4MUZA 5EY5A 3GKAA 1K7FA 4JTUA 1KTNA 1WOBA 1AW2A 1XDMA 1H63A 3CB8A 3MP3A 4OT7A 4JYEA 3LV6A 1IXQA 4M6PA 5LSMA 3WJWA 1M6JA 1TRDA 5HMSA 4HSOA 1XBZA 4JY9A 4M6QA 3MBDA 2Q3OA 3L65A 2TRSA 2E5DA 4UTIA 2YDAA 4JS3A 2CFFA 3SR7A 1CI1A 2ZBTA 4AF0A 3S8HA 3E49A 4E0CA 3FOKA 3VCRA 1AW5A 1NFBA 3B05A 4N9DA 1TQJA 2R14A 2AAMA 4YXGA 3VFLA 2GPTA 4DO6A 2WNNA 1Q6QA 3W1XA 4LTSA 4RZ6A 5K7JA 2NXHA 1ZAHA 5U4NA 1N55A 3DFQA 4PODA 3T40A 4JX6A 1TQXA 3L67A 3W74A 3ZS4A 4R33A 4JXCA 3W83A 3QW4B 1F5ZA 4JTFA 5KTLA 3GB6A 1XC4A 1FXPA 4JY8A 4CCCA 3QEZA 2R91A 1OX6A 5CZSA 3W7OA 2E6FA 3NQ6A 1VPXA 2V2HA 1A5BA 3SGZA 1O94A 4L4LA 1KW1A 1JUBA 3P8JA 5I3GA 1ICPA 3LCXA 3M5YA 2X2GA 2Z2UA 4PA8A 2CLIA 1KM0A 2OMAA 1OHLA 2VFDA 4MZ1A 3W76A 1EUNA 4O17A 1Q3NA 1LZOA 4TU1A 1N8FA 3VNDA 1XBYA 1O95A 2VFIA 3G0SA 3G1YA 2VOMA 3HMJG 5C6MA 1QPOA 2CZEA 1B3OA 5G1TA 1JRCA 5F1VA 2W0UA 1KBJA 3BK0A 3TA6A 4K36A 1H5YA 2Q8ZA 1Z44A 3G1XA 4JTEA 3B4UA 5D2YA 3W71A 3G8EA 4HPXA 4M19A 4M7TA 2EGZA 3PG9A 1W5MA 3L21A 2FPYA 3IVUA 2V30A 1KFLA 1H61A 1RV8A 2CLKA 4IXXA 3LHWA 2WV8A 1R2TA 1OK6A 3QFEA 4NT0A 4JD4A 2E6DA 1SR9A 2GVJA 3KOFA 5BMXA 4GXMA 1ICQA 2VENA 4A3UA 2QR6A 1JCYA 4WXYA 3UNDA 4CNNA 1L2UA 3BPWA 6ALDA 3GVGA 3MP5A 2QCDB 1L9WA 4N6FA 1W3NA 5D32A 2BXVA 3GZ3A 2A1YA 1V7YA 1SO4A 4IJBA 4UTHA 2BLEA 4NX5A 3H54A 3W73A 1J2WA 4FX7A 3CEUA 2QF7A 3LM7A 3W1AA 2EAWA 2J27A 1TSIA 4JDBA 2FJKA 3GNDA 4X3ZA 1W3TA 5C54A 5HR7A 4GUFA 3R8RA 1YXDA 3MI6A 1FDZA 2D73A 1S3HA 1YPFA 3GR8A 3UPWA 3OVPA 2HS8A 4K6AA 1M5WA 3NPXA 4ZL1A 3W2MA 3E02A 3EWYA 5J5RA 5KZDA 4LVFA 3LHVA 2V82A 3GLCA 4K7VA 3NDOA 5CPMA 4O18A 2FTPA 3BLIA 4ZQMA 3BG5A 4G1KA 2QUVA 1KTBA 3FYOA 1KM1A 1QPNA 3P82A 4N9BA 1AK5A 1LRNA 4ZQCA 1UBSA 3P67A 4Z1CA 4UTTA 1MZHA 1LLWA 3JS3A 3PM6A 4X2RA 5AHIA 5EYWA 2FB3A 2HTMA 3UY8A 2QUUA 4LVBA 1H1YA 2Y62A 1OFAA 2FDSA 1U5JA 3E12A 1GQNA 1SZGA 3IVTA 1UB3A 3KRZA 5LGXA 4OHQA 1TJRA 2YW4A 3QJAA 1ZFJA 4HNVA 3G1FA 5DXYA 3N73A 3S1UA 3DI0A 2ZA3A 3TQ0A 3TJXA 4HSNA 2WSRA 2CLHA 4UTWA 3KVLA 3RNDA 3KHJA 1Q6RA 3W7JA 2ZRZA 3GKFA 2ISWA 4CCDA 2QCDA 3LLDA 4E2BA 1OFBA 4MJZA 1KM3A 1THFD 5J5DA 1DQWA 1TB3A 2HS6A 3THQA 1GVOA 3TAOA 1Y0EA 1ICSA 2VXNA 4P61A 1AL8A 3W1LA 3QMSA 3R89A 1ML1A 3EKLA 2O7QA 2GVLA 4RXGA 1K03A 3P81A 3MO7A 2HMCA 1XFBA 2EHHA 1LOQA 3S5YA 4Z1AA 1T96A 2JKPA 3HG5A 1K7XA 3Q58A 3TE9A 2DZUA 1GG1A 2PRMA 1NEYA 2YCEA 2YSWA 3DH7A 4CQ9A 2BZNA 2E09A 3A21A 3N34A 3S1WA 5G2IA 5AC8A 1XUZA 4AWTA 3NZRA 4CQAA 5LKYA 1EIXA 3DFTA 1I2NA 5HQEA 2I9EA 3PC0A 1QO5A 4K8HA 3TCEA 1OK4A 1JULA 4N4QA 2J9YA 4O13A 3SY5A 1GT8A 3T44A 4ORIA 3T7VA 2QAFA 3HPSA 3TXVA 2ZZ3A 3M41A 4X9SA 1WXJA 1X6UA 3CTLA 3T55A 4O16A 4LC6A 2ZDRA 3A22A 1I2RA 3IIPA 4Q33A 1I2PA 1W56A 1G67A 4RJEA 3C8FA 4ZMGA 4X22A 3R12A 5DELA 3HQ1A 3HG4A 1JCNA 3C52A 5LGZA 4WD0A 4IMEA 1YLVA 2YYTA 3W3OA 3UWVA 4WUIA 2W6RA 4QNWA 5K3VA 2YPIA 1TYGA 4O8RA 3W7LA 3TDFA 5HWNA 3W7CA 2G5WA 1M7OA 1QWGA 2Y63A 4JDYA 4FNRA 2ALDA 2DZXA 1VYSX 3F4WA 1PS9A 3HGSA 4XTDA 4Z1BA 1M7PA 3Q2DA 3SZ8A 4MJMA 3NPUA 3UWQA 4WQ6A 3MHFA 5IM51 3LV5A 1G69A 3QF0A 4MIMA 1DHPA 4KFPA 4UUIA 1TRIA 3P84A 3NQAA 2JGYA 3BO9A 1LBLA 1H62A 3EXRA 3O07A 4RK8A 4K38A 1R2SA 4QM1A 3JR2A 4Y96A 3F4NA 3R2GA 4I7WA 3BLEA 3EWXA 2FFCA 3DHFA 3PUEA 3RMJA 3N3MA 3KVJA 5TBOA 5AHEA 3MWAA 2NV1A 2J24A 4AWSA 2NX9A 3CIXA 4GUJA 2NX3A 4FNUA 3KFTA 5HINA 2PRLA 2F84A 3T4CA 3OIXA 5AHMA 2VC6A 2ZZ2A 1X8FA 3EB2A 2QDHA 1JQVA 5F2IA 2JBMA 3W23A 3P62A 5FF0A 5G4WA 2V5LA 3G24A 5F4SA 5GVJA 2X16A 5HUPA 1OYCA 1TIMA 1DKWA 1R2RA 2VEKA 2Y85A 2WPBA 4FXSA 3S9YA 4RLIA 1PCWA 3GXNA 3W86A 4O53A 3QYQA 4QNEA 4RKAA 1H7XA 4ADTA 3W70A 2V8ZA 5K2ZA 3EWWA 1MEHA 2C16A 2YX0A 3BW3A 4I9AA 3W87A 1OX4A 2Z6IA 4PL2A 5G2WA 4LS2A 5HWMA 1DV7A 1RQHA 1C9DA 1OFOA 4FO4A 2ABAA 5DCDA 1PIIA 3NL6A 2C13A 1PVNA 1OFRA 2CZFA 1MXSA 1WAUA 3TQVA 5BMWA 3I7RA 3W1UA 3AO0A 4PCFA 4XQ6A 1Z42A 4HT3A 2IQTA 3WJYA 2ZA2A 3WJSA 3B06A 3CM4A 5HNRA 4NJHA 5D2VA 1WX0A 1W54A 3I68A 1WYIA 3NEVA 3CEPA 5LZLA 1KM4A 3HG3A 3W1NA 5FEWA 3SIZA 3W7DA 4OGZA 3OG3A 4O0KA 3IVSA 1TREA 1SFJA 4AXKA 4BI5A
chains in the Genus database with same CATH superfamily
2PBOA 5XIMA 1O1ZA 1OG0A 4PMUA 2AAAA 1YIXA 2E9MA 3WQDA 4PB4A 4B5XA 4GFSA 1SUXA 2DGAA 4HU4A 2FIQA 5CLWA 3E96A 1H7NA 4GHRA 2CBUA 3CB3A 3U4FA 4ROPA 1MXDA 3KUMA 3BLLA 3SFKA 4D6CA 4P8WA 2C19A 2CBJA 2GGGA 3VM7A 3AMDA 4ATLA 1QVBA 3CUZA 5FF3A 4LALA 4IIHA 4EAYA 4CD4A 4LOCA 2V2DA 4XKYA 3AZRA 2NSXA 1VPYA 3WNMA 3RLHA 4NNCA 5LA1A 1PXGA 1TZZA 1P6CA 3W6LA 3G1AA 2ZUWA 3AHVA 4GY7A 3WBWA 4IT1A 5BXPA 4TTUA 1V3JA 4AISA 1K6AA 1A3HA 2EKCA 1R87A 3LSCA 4TV6A 2C1HA 3M6DA 3D0CA 1W9BM 1ESWA 1AMKA 5AKQA 3L0NA 4UQCA 3NDZA 1JZ6A 3WK3A 1HVXA 1PB0A 2YYUA 3AFBA 4Q7BA 1V3HA 1JGIA 2UV8G 2GOUA 5I5RA 3ZVIA 2QW5A 3WBXA 1OINA 4HN4A 3BGGA 4Z0JA 3GU2A 3FNDA 4P2VA 1OT1A 5A6AA 1HNYA 1S2VA 4QE4A 2XFFA 3ZSSA 5CJ5A 2R94A 1UASA 2DZPA 4B5TA 4U31A 4XWUA 1GQIA 2GQ3A 1E9ZB 2P0OA 1AQFA 2VELA 3IJ6A 3AS1A 3VXGA 2WNQA 1LQ0A 5D2TA 4FHAA 1HJVA 3G0XA 4LYQA 3F1QA 3FKRA 4K3ZA 4L9YA 3LMZA 1EJVC 2CW6A 4CCEA 1QDSA 3O6DA 1EJWC 4RE4A 4AHQA 1YE6A 3MHGA 4O12A 1UP2A 4ATWA 1IF2A 3GQYA 3UD6A 3GTIA 3MPGA 3LUTA 1K8CA 4QG8A 3LA4A 2YXGA 4LSBA 3E5PA 3BV7A 3UW6A 5E5CA 3IJ7A 4JTSA 2YL5A 1OADA 2OWWA 2R1PA 2VCAA 4TUFA 4I90A 3QGAC 4BQ2A 3SJ3A 1ZCOA 7REQB 1KXQA 4O4VA 1VCVA 1J79A 3DEQA 3BZGA 3UCCA 2D0GA 2QJGA 5C0QA 4N0RA 2E4TA 4MADA 4NAEA 3AHYA 1YMYA 3D3AA 4AMAA 1KXHA 2ZE0A 3TWAA 2P10A 3AIUA 3TNOA 3TROA 2FHBA 4BI6A 4ZR8A 3M0MA 1PCKA 3M44A 4S3EA 1LM1A 3QSRA 4ZSUA 4UTLA 5FL0A 3GNNA 4ZOEA 3GR7A 3MWCA 2RFGA 4QCFA 1A3XA 1LCOA 1J01A 3ZMRA 2TYSA 1B9ZA 3BTNA 3TFCA 2OSYA 1VRXA 1A49A 3V3WA 4AD3A 3IARA 1D9EA 4NNBA 5EMYA 1K8XA 2Z1WA 4E3TA 3LTPA 4MSSA 4EPKA 2NZLA 1VC4A 1U22A 3TP4A 3NAVA 3I6EA 4DWSC 1XGEA 1PPIA 3A6OA 3H22A 5GJNA 4F0HA 3TTOA 1Y8BA 1GPWA 2BG5A 2OZ3A 4PRTA 4KWWA 3VTRA 2VR4A 1EJSC 4C6DA 3L0KA 2XDFA 5EL1A 3QHOA 4ZQPA 3AWNA 4HPGA 1OIMA 4KFNA 3OP2A 4W8BA 4S38A 2ISVA 1NF7A 3FDGA 1UR1A 1ZP3A 4L1WA 4Q8UA 1QMLA 3FDKA 1OYBA 3THDA 3IV8A 1H41A 3F4VA 5CKSA 2IS7A 2INEA 1WKYA 1XINA 2ZA1A 3AISA 3N2CA 1VFSA 1IZJA 2BB0A 4O8AA 2Z4GA 3BJTA 3P61A 1TWZA 4ILSA 3VKKA 5EGRA 2PBGA 3RGTA 3LQLA 4MFEA 1JR1A 3EX2A 2J9XA 5F4XA 4I6KA 3I6TA 3W1RA 4LY4A 1AG1O 3MV11 3DU0A 1GOXA 3W81A 1IE7C 2VQTA 2FZ9A 4KRZA 5C9ZA 1LTDA 3W7PA 1W1TA 4WKAA 4XSLA 4MFDA 4QP0A 3GTXA 1S5NA 3GDBA 3CT2A 3W82A 3II1A 5HANA 1ZL1A 1FQ0A 2OFJA 1J11A 1KKRA 4NU7A 3NR0A 3AXIA 2DIEA 2ZRVA 5BXTA 4QS6A 4XZIA 1U33A 1I4NA 3VNJA 3VNIA 3S6DA 2GVEA 3S2NA 1HKVA 3IPWA 3W1PA 4DF1A 1E1EA 3MBFA 2V2CA 3V36A 3F2DA 1UD8A 2VEGA 4JTJA 4PUKA 2IW0A 2GK1B 3ZO9A 4K8EA 1SMAA 1KFCA 4HMEA 3ZXWA 3B0PA 4WDWA 3LD5A 4MB1A 3WD1A 1J12A 3PK7A 5F4WA 3RX4A 3C61A 4Z2HA 4LQ1A 3S46A 3RJXA 4FXFA 5A3HA 4UNKA 5CAHA 2DFAA 2GDUA 1NWSA 2X1TA 4FX8A 4J5NA 1BF6A 3SY8A 4DO4A 4J3SA 4YS1A 2CESA 1XIBA 1ZB5A 3SCOA 1H0GA 4W93A 4L4MA 2NW0A 2ZWYA 1FBAA 4MMWA 3RILA 2J8TA 5F1UA 1E70M 1E9YB 3ARPA 4CGTA 5AN7A 4M1BA 1P7TB 1FHUA 2OWXA 1C90A 4WDXA 1ZU8A 2ZFAA 1BVZA 4WX2A 2IQDA 5JMUA 1FDYA 2GQAA 3O63A 3VKJA 1V02A 1IEWA 4JZ5A 2VDGA 1XLFA 1RQEA 1LBMA 3B9AA 4RZ4A 1CGTA 1QHPA 1XIEA 1CBGA 1FWFC 3VKCA 2ATMA 1KWKA 1UWUA 1E6RA 4WY0F 2PTYA 1EQPA 1F6KA 3V1HA 5HOSA 2D1ZA 2JK2A 3S1VA 1UD2A 4JFWA 4AYGA 1T8XA 4US5D 1V3MA 1XRVA 3VOFA 1CXKA 1XH2A 1EHNA 1WZAA 1TJ0A 1VBUA 3W4RA 3SECA 3PTQA 1RBAA 1EBHA 1HUVA 4DZHA 1A47A 2B0MA 3WFAA 4Y7EA 1RVKA 3E2SA 4GMEA 4Y6GA 3T0TA 5HAOA 1UWSA 3LTYA 1DWFM 1I45A 3PPGA 3VE7A 5K4ZA 2PDMA 1FUYA 3LGEA 2DSWA 1U5VA 2CXGA 1DJIA 4ZB2A 4IH3A 3HGRA 2A4AA 2A3HA 2ZE3A 5CZJA 1V6XA 1M3UA 3BGAA 1TPDA 4AD0A 2ATSA 4A6GA 1JRBA 4FNPA 2D2GA 1G4SA 3WL0A 2WCAA 2QJMA 4UMCA 1EFZA 3DI1A 1R85A 2XM2A 3RYSA 1PTAA 1R5YA 3O9NA 2GWNA 1LBFA 2P3ZA 1E0VA 3BGJA 1BF2A 2HROA 4PMQA 2DZVA 1XQKA 2WANA 4A8LA 4LYKA 3FY1A 5B7ZA 4P8VA 1UD3A 3AJ7A 4NASA 1ISZA 3WJZA 1AZ2A 3PPCA 5KITA 3TQPA 3DXIA 2PD5A 2XZ7A 4XBSA 4B15A 3W1MA 4JHMA 1KQZA 3UWEA 3DBNA 3UXLA 3RX2A 1TTIA 5DO8A 4RZ5A 4JTGA 3OHIA 4NHVA 3WQPA 1J0IA 1R9XA 1XRTA 1OCQA 1TCMA 3SEPA 1WP6A 3AS0A 5TIMA 3WLRA 2WMGA 1JVNA 1GYNA 1JYNA 2OVLA 3U8GA 1FH9A 4HNNA 3UWUA 4RE3A 3WL1A 2G3MA 4MNLA 8RUCA 3FVDA 4A8IA 3CHFA 5MKGA 3KP1A 2QHAA 3QR0A 4W5ZA 4PEEA 2BVWA 3ARSA 3D5HA 3N2XA 1GVQA 3SRKA 5PTDA 4EP8C 1FCUA 3VIFA 2BWGA 3MTWA 1XYAA 4HCHA 1JIBA 1RH9A 1BGGA 3EDJA 4HJWA 1VZWA 1OWQA 2X40A 1NDVA 3L4WA 1HL9A 4DQWA 2W27A 1AL7A 3OBEA 3MU7A 1B4EA 3IV3A 4M6UA 1MFVA 2D2OA 1B9BA 3WNKA 1CXHA 3A5FA 4PUMA 3UJFA 1DXIA 4AZ7A 3C0JA 1YBQB 1Z89A 4P8UA 2E6YA 4HGXA 1BWVA 3LM3A 3MZNA 2CYGA 4H3DA 1CGVA 3C4UA 1JJKA 2YBUA 3KRBA 1KBLA 1B3WA 3D6NA 4H4IA 5XIAA 2FLIA 3TR2A 2W4XA 5EFFA 1VCFA 1HP5A 4J1OA 4O1EA 3YPIA 2JE8A 4O1CA 3S5OA 1KCLA 2PLMA 2GYIA 3HOJA 4ZB5A 4A05A 4A2RA 3MI3A 3WDRA 1LL6A 3OHMB 4AVNA 4QLJA 3ARZA 3NGJA 2H9AB 3PULA 3VGHA 4S3FA 1FX6A 1LWJA 1XRSA 1R3TA 2V69A 3PFMA 3M16A 3R0KA 5I07A 1QNPA 4I5RA 2OXNA 4UCFA 3VIPA 3A4JA 3O16A 4M8UA 5AHNA 1PV8A 3KCJA 4GKLA 1P1MA 3GW3A 3CZ8A 3A23A 5CGMA 4G6CA 3TYAA 2BOFX 1O4UA 1YTKA 3ITOA 2JF7A 3N14A 2FTWA 3SCPA 6XIAA 5CSUA 1DJHA 2P5NA 1KV8A 3WMCA 1VFFA 3M47A 2OWCA 4JHZA 3QPYA 1FWTA 2ALRA 2VUNA 1DP0A 3GBEA 1UKTA 1UUQA 4C5YA 3ABZA 5CC6A 1A0CA 5DBTA 2F8QA 4L6OA 1H60A 1OYAA 1RCQA 4B4FA 4D6JA 4GVGA 1EEPA 3CMJA 1DYSA 1OGSA 1UPMB 3MUZ1 3APGA 1QNOA 3INPA 2XFRA 4FPSA 1ZJHA 3BLFA 4E8GA 2XH7A 4B3LA 4GYPC 4WLCA 1F8IA 1UR8A 1Q6GA 1B57A 4H9VA 4H7CA 4LW7A 3F4DA 5A6BA 3IANA 4XD5A 1RY8A 3ZIZA 5AZ0A 1E1FA 1S1PA 1TWWA 4OBSA 1IEXA 1AQMA 1S39A 3EX3A 3U6WA 3R25A 2VGGA 1LQ2A 1X1ZA 2GZXA 2J7DA 3PSWA 3M5ZA 5CGTA 2HSAA 4AUBA 4UQ9A 4B3ZA 2EEXA 3W7QA 1W9DM 2CERA 3UR7A 2D3LA 1MVYA 3PZUA 3VCNA 1Q2RA 2OELA 1U1UA 2O7SA 1QBAA 2Y5EA 4AWEA 3CHCA 1W3HA 2PDBA 4IIDA 5F7UA 1E0UA 2ZZ4A 3RPTA 4JEJA 5KMYA 3PPFA 1HT6A 5FEXA 3SCTA 3B9EA 4K68A 3OVGA 3MMTA 1YW1A 3K1GA 1EXPA 4NUWA 3A4XA 1B90A 3S6OA 2I16A 4PRRA 3BAXA 1XM3A 5HNUA 1O5XA 2J77A 4W89A 3S0CA 4XAFA 1HVQA 3M0KA 3W27A 2ODOA 1DIOA 1KRBC 1XIFA 2OLHA 4ZSTA 3ITCA 4DYEA 2Y70A 3AICA 3EWCA 2G8ZA 4M80A 3IS4A 4ZEPA 4W88A 4NJIA 1NWUA 3AXXA 5DBUA 2NXIA 3PNUA 1TTPA 2IPWA 1KM2A 3MDWA 4BEQA 4V28A 4XAZA 4ZZ9A 3ONCA 3KOYA 1IGSA 3CUXA 3M64A 2E68A 2J7GA 4NILA 3S1XA 4LVAA 4S3CA 2XSBA 2ICSA 3G2GA 3FKKA 3TN5A 1V4YA 3O0KA 5HWJA 4XTIA 3SBFA 3PF3A 3EB3A 3UGRA 4GD0A 1BAGA 4A22A 1TMLA 2WNZA 4FSAA 4DZIA 2CNCA 4L80A 1DBTA 3UZ5A 4WGHA 2PDFA 2BVDA 1F2JA 3P3BA 1CGYA 4JTIA 1OC7A 3RN6A 5IXEA 4O14A 2CKSA 5E93A 2ZKMX 3LRKA 3W01A 3PR2A 4QG6A 3KOZA 4A4AA 3BAJA 1GW1A 4MG4A 3ABXA 3WDHA 4Q4PA 1OFEA 3ABSA 3LCWA 3EWBX 3W26A 1LOSA 1GUVA 4IQJA 3GHRA 1BEUA 1SZEA 2BVYA 2EPLX 3ITYA 5AFDA 2A6NA 3UG8A 2QIIA 4D6DA 1K70A 2PDYA 5CC3A 4N02A 4HHHA 4MLRA 4OOZA 3FFSA 1P5BA 4XBJA 3UPBA 3W2UA 4IUGA 3NTYA 3UF9A 2VHLA 4FAMA 2HQAA 1M41A 2E77A 3H6OA 4NZFA 1FWBC 4HU3A 2OGJA 1GKPA 2OSWA 3THAA 4ML9A 1VENA 3HPAA 3VD4A 1JNDA 3UVAA 3DYMA 3LX9A 4Z2JA 4OBTA 3CUGA 3H2OA 3UWWA 4DY1A 1ISXA 2EF9A 1SJDA 3ZT5A 5A6LA 1IIGA 4GGBA 3K4AA 5D38A 4IPJA 3P74A 2D20A 1NOUA 1QI3A 1ZLPA 1RLDA 1G7VA 1KFBA 2VUYA 5M1TA 3V5CA 3VDHA 5A95A 4X0NA 4ZQRA 1PSCA 4S39A 3TSDA 4WDUA 1OGGA 1PYFA 3IIZA 4KCVA 2XWDA 1LUCB 2V0TA 4ZO7A 4U2ZA 3ME3A 1CCWB 4EWJA 1KNWA 1XH1A 3FEMA 2XSAA 2GOKA 2CITA 1T8QA 2TMDA 4IJCA 4DF2A 2ZUUA 1FCVA 4MDPA 3ZQ9A 2YR1A 1W1ZA 2INZA 1LWIA 3VGFA 4GI9A 2Z2BA 3SQSA 4NYYA 4DWSB 4A3QA 5C7HA 4Z2KA 2Z1BA 4GYKA 4IQLA 4IMCA 4P7RA 3U2OA 2GGHA 3VC5A 3HB9A 4XD3A 5CAKA 4A35A 3QMTA 2GQ8A 1MQQA 4OFCA 2RUSA 3ELFA 3GHSA 4GX8A 4FZIA 5BRBA 1Q4NX 3NA8A 5DN1A 3TOYA 3ZR5A 3GDRA 2ZICA 3EB4A 3WD4A 4RDWA 4BF9A 4HKPA 5FJRA 4GIEA 3A4AA 1MNZA 3BW2A 2AL2B 1ZENA 2X2YA 5C71A 4M6VA 3N6QA 2G3NA 4TX6A 4B2DD 4OV4A 3IGXA 1G4EA 1UJQA 3RPDA 4NZ4A 2XVPA 1JCTA 1F9CA 2W62A 3HJZA 1HKIA 1KGXA 3EOEA 2J78A 4PMNA 3P5ZA 4PFHA 4DRSA 2ZWZA 1HG3A 3VD5A 4L7ZA 4EX4A 4FEZA 1J96A 4IGHA 9RUBA 4ZCWA 5EY5A 3TTSA 3URBA 2XFYA 4CN6A 3MP3A 4OT7A 4QLLA 1M6JA 5HMSA 1XIHA 1DHKA 2ZX7A 2Q3OA 2J13A 2D24A 3GG0A 2CFFA 3BCJA 3SR7A 1Q7ZA 2WCSA 1UC5A 2ZBTA 3SRHA 2XG9A 4E0CA 3B05A 1TQJA 1H3GA 4M3PA 1CXIA 2AAMA 3ECQA 3VFLA 1U1HA 2WNNA 1GZ1A 3W1XA 3KS5A 4IGMA 4D9PA 3B40A 4W7VA 1TQXA 5C2GA 3W74A 3UJSA 4FOKA 3W83A 3WLOA 1QK2A 4JTFA 1XWYA 1BVWA 1FXPA 1KGWA 4K1GA 5CC7A 2QQ6A 2R91A 3MB9A 3V5FA 1VPXA 2V2HA 4L4LA 4HHLA 1KW1A 1JUBA 2Z2UA 4PA8A 2CLIA 2OMAA 2G37A 4MZ1A 4IM4A 3W76A 5JUVA 3H2FA 4HA3A 4DJEA 1GOWA 1JPIA 1LZOA 3VNDA 2D0FA 1XBYA 3T9PA 1B3OA 1JRCA 4JN7A 3O0FA 4GZJA 4MPKA 2I5GA 3BK0A 4K36A 3VC6A 3WDJA 1TA3B 2I7GA 4DJDD 1S5MA 2X41A 4PGLA 4JIEA 1SJCA 3N9KA 4HU8A 4HPXA 2DVTA 3L21A 2FPYA 2PDGA 1KFLA 2OSXA 7CGTA 2CLKA 3TTQA 3LHWA 4HTBA 2WV8A 1PZ0A 4Q8PA 1OK6A 3FA4A 3D3FA 1U5HA 4R3UA 2E6DA 1SR9A 3JZUA 4AZ6A 4PUEA 3E2QA 2OYMA 2VDHA 2E9LA 4GXMA 3IJLA 2VENA 1JPMA 1NQ6A 2QR6A 2VVSA 3SB0A 1QI5A 2XYLA 4E3VA 3WQVA 4IG2B 1L2UA 2BV9A 1JAEA 3MP5A 2QCDB 3AYTA 2BXVA 4D6GA 3GZ3A 4AC1X 1V7YA 3NSXA 1SO4A 2OR2A 3NXLA 4NX5A 2P8CA 1J2WA 4BEUA 1XYLA 2ZUMA 3LM7A 3W1AA 3VUPA 2ZADA 2EAWA 3N4EA 4JDBA 2FJUB 1MFUA 3R8RA 3MI6A 3KCLA 3ZSTA 3EMZA 5BWAA 1L0PA 3OVPA 1M5WA 4ZL1A 3FSTA 3R1ZA 5J04A 1XP3A 3E02A 3T42A 2Y5SA 1SZRA 1EXBA 2JALA 5CPMA 4KRUA 2C71A 4R9XA 3CTTA 2DT3A 4DO7A 2XINA 3P82A 3U4AA 2BXZA 2DV0A 4Y8EA 1AK5A 3VCCA 1E4NA 4U2YA 4ZQCA 1EJXC 4XIMA 5EYWA 2HTMA 3OOQA 2WKLA 2CXEA 4LVBA 4UOQA 1OFAA 1U5JA 1GOKA 4V33A 3E12A 1SZGA 1UB3A 3KRZA 3MANA 5LGXA 1DIEA 4KQNA 1TJRA 3GIQA 4H01A 3E38A 3KDOA 1E6SM 3S1UA 3DI0A 4MJ4A 3TJXA 1ISVA 3L12A 4UTWA 3RNDA 4OBRA 2DSZA 2GDQA 4CD8A 3GBDA 5D9MA 1CLVA 3MVIA 2FFIA 3LLDA 4YYCA 1KM3A 1THFD 1HGYA 5J5DA 1ZZMA 1TB3A 4AZGA 2HS6A 1GVOA 2UY3A 3NFUA 3IRSA 4QSFA 1MW0A 1ICSA 2VXNA 3W1LA 3R89A 5CG0A 4AC7C 3K8MA 5REQB 4OTKA 1K03A 4S3AA 1XFBA 2EHHA 2WVUA 1LOQA 2DIJA 1Z7AA 1F4AA 1T96A 2JKPA 4PTWA 4WHBA 4GO8A 1AMYA 2C79A 4X2PA 4FR1A 3K46A 1B54A 3H23A 4US6A 4MKSA 4LB3A 3DH7A 3WLKX 3A21A 3B9NA 4RDVA 2AGTA 5G2IA 6REQB 4LCQA 3R7MA 3J7HA 4K8HA 1E4MM 1OK4A 3UETA 1HX0A 1Q65A 2J9YA 3NQBA 3MCNA 3TLLA 1G01A 3EOOA 1W9VA 3HPSA 4X9SA 1WXJA 3T55A 3M0JA 3WH9A 4LC6A 3FVMA 2VRJA 3A22A 1I2RA 1FP8A 3AI0A 3UZYA 3GNPA 1I2PA 1G67A 4RJEA 3WF1A 4ZMGA 1KCXA 3A3HA 3BC9A 1PX4A 5E6YA 1E0TA 4MGGA 4WUIA 1US0A 2VT0A 3W53A 1KFWA 3TDFA 2G5WA 1M7OA 4HTYA 3BSHA 2DZXA 3F4WA 1JZ2A 1M7PA 3DG6A 3OJGA 3Q2DA 2VX6A 2Q71A 5IM51 3VIIA 4D8AA 3W25A 4PUNA 3QF0A 4MIMA 3BO9A 2JFEX 3ISIX 5A6KA 2PZNA 4HZ8A 5JBDA 4K38A 1R2SA 1BVNP 1P6BA 1TR1A 3CL8A 4ACZB 3NURA 3R2GA 3WKZA 4R88A 5AHEA 3MWAA 1X96A 3EPNA 1HJSA 2J24A 4K8GA 4Y9MA 3KTXA 1TVLA 3WQGA 2NX9A 4KF1A 5HINA 2PRLA 3OIXA 3K4WA 4J40A 4BCEA 5EMKA 2DVXA 4BHYA 3VOHA 3XISA 3ANVA 4KIRA 1DJZA 1JQVA 1WDQA 1CDGA 1C93A 2JBMA 3FXGA 5FJTA 2V5LA 4Q8MA 4AXNA 1DWAM 1DKWA 4C6PA 2BXYA 2Y85A 5A6SA 1GKQA 1UOKA 1PCWA 3CQJA 3W86A 3AOFA 4O53A 4D71A 4C6LA 3DYOA 4QNEA 1YHTA 2CZVA 3W70A 2V8ZA 4PCNA 3NZQA 1KKOA 5K2ZA 3CAKA 1ZSXA 2YX0A 2CBIA 2Z6IA 1L8PA 1WKDA 2YB4A 3QC0A 3MSDA 1TZ9A 4DBWA 2DPEA 1C9DA 2J66A 3GNOA 4L6HA 2AKZA 1PIIA 1EYWA 5M03A 3NL6A 2C13A 1XS2A 4FOJA 3S9IA 1OFRA 1TV4A 3LG3A 4QEEA 1DXFA 2CZFA 2XTKA 4PUWA 4J3VA 3TQVA 4BJHA 4PTMA 2HBVA 3HN3A 4PCFA 4XQ6A 2ON3A 4Q7NA 1Z42A 1ITQA 2ZA2A 1A4LA 5C9XA 5HNRA 5D2VA 2OYKA 1WX0A 5IDZA 3I68A 1WYIA 3URQA 3CPUA 3U3HA 5LZLA 4NZ5A 3W1NA 3UZWA 4LAZA 1IWBA 2AQVA 4XV0A 4YWIA 3GVRA 1QR7A 1XCWA 3A3WA 3AXKA 4U5KA 5H8UA 5FAJA 4URIA 2I5QA 4WY0B 4RR4A 2QNEA 2VNCA 3DC0A 1NSJA 3H2MA 2A6LA 3VPLA 2F38A 1PJ9A 5IDIA 3KAOA 3NZPA 3B97A 1K9DA 3MKVA 1QAPA 3MW7A 1OVDA 3OEXA 1KRMA 4PBFA 1A5CA 2VC5A 2C91A 4R7OA 3AUOA 3QRHA 2F9RA 2V6AA 3W2JA 1UWQA 2H9AA 4NAFB 4LUIA 1O66A 1XLIA 1NAL1 3GXDA 4CCZA 8CGTA 1AJZA 1W5QA 1WV2A 2FQIA 2VEPA 4D1IA 3G6LA 3BMXA 4O50A 4HMNA 2ZUVA 1O1HA 1V02E 5DT7A 1V0NA 1VLIA 1JQXA 3MJYA 1XXXA 2QCLA 3O15A 3PBUA 4HNLA 3LLFA 4QJ5B 2BHUA 3WK2A 3TXZA 1R0MA 3TQKA 2CHNA 4JHOA 4D1JA 2FYMA 2ZX8A 3AIQA 3SN0A 3TW7A 4I9MA 3HZ3A 4YJ5A 1TTJA 3NZ1A 4H7ZA 2XIMA 4B9ZA 3GS6A 4PMDA 2PWFA 4S1FA 3GX9A 1LOLA 5D02A 2QZRA 4KFOA 3AALA 4N7QA 3WIJA 1KTCA 3M0XA 1K9EA 2OB3A 3JRKA 4OU1A 4AIEA 4Q3MA 1B5TA 3UPMA 3GXPA 3AROA 2DUAA 5AYZA 4XSMA 1JG9A 1FWHC 3DHDA 3XINA 3UXDA 3L68A 4JGDA 1YDYA 1M1BA 3ZJKA 2FZBA 4L4OA 3RLUA 3R79A 3CIWA 1QNSA 2QDEA 1M9HA 5HJYA 5CLTA 2F2KA 1LYXA 1NFGA 5I2UA 3BOXA 3ZR4A 1Z32X 5EPDA 3UCQA 3OO2A 1OF6A 5I3IA 4AZ5A 1R38A 1WBJA 3P8IA 4HOXA 1GVSA 3QM3A 3ABRA 5T26A 1AD1A 4LPCA 1PIGA 1TJ1A 1VH7A 4D8LA 3I3BA 2CLOA 1OZMA 2NLIA 3C2OA 3QH2A 2EKGA 3B03A 2OODA 1X38A 4QGCA 3BH4A 3RUBL 4NG3A 3NPWA 5HULA 4IGSA 5LHFA 2WKGA 3IEBA 1EEXA 1Q6DA 1BSIA 4MDOA 2PURA 3M5VA 3OYXA 3N29A 2BY3A 4DAFA 2OEMA 5LIKX 3DCPA 5LIUX 4L6DA 2XJ7A 1G5AA 2ZRUA 5FJIA 5U7SA 2NUWA 2TAAA 1OCNA 3HPFA 3TOPA 4YL2A 4RCXA 1BQGA 3W7RA 4R9OA 5H8PA 3VD3A 5KZ6A 4IQDA 3WMSA 1EQCA 3DUGA 3WYZA 5HBFA 4GABA 3WF3A 1P48A 3NVTA 3Q4DA 4QG9A 4IPIA 1WCGA 2Y61A 1P6WA 3IIVA 4QQUA 5FF2A 2BS9A 4UB9A 3L4ZA 1WKFA 1A50A 4LVGA 5DMYA 4HPJA 2CC0A 5E1QA 3K8LA 2XFWA 1NQKA 4D6FA 2H3DA 1OG6A 3RO8A 1FHDA 4MNJA 2E0PA 4PMXA 1E15A 5BZAA 4W8LA 4D6IA 1V03A 2H8XA 3IUHA 3C56A 4XO6A 3QOMA 2JKAA 3WEMA 1ZRQA 1RQBA 4F0KA 3W2KA 5C8BB 2X42A 1BKHA 4RE2A 1IR2A 3C2RA 5EU9A 4CLMA 2GUYA 2WBGA 3MHUA 1E0XA 1TPFA 5EKYA 1FWRA 3QTPA 4AYSA 5M2FX 4AY8A 4WJEA 3COTA 2ACUA 3A4WA 3KE0A 3FJLA 1BXBA 4NXKA 5A2BA 4EK7A 4HNCA 4JQ1A 1XLLA 3VO0A 2AGKA 1JXJA 4QTGA 2D69A 3QR1A 4IUOA 2XU2A 1NY1A 1QNVA 3FCPA 2XGZA 1VHCA 4ZE5A 1FKWA 2ONEA 4GBDA 1XKJA 3PY2A 3QZEA 1BXCA 2I5IA 4LC8A 1JDDA 2WC3A 1OSEA 1HP4A 3LI0A 2Y6ZA 1EJUC 2PWGA 3NCOA 4O57A 3KHDA 4W9TA 1F61A 1YXCA 5FCZA 2E7FA 2I56A 3WBAA 4QAWA 4AWUA 1XHGA 3H4GA 1Y7VA 3RIKA 1IEVA 3OB8A 2HXUA 3QLDA 4YVXA 4GQGA 2O9OA 1BG9A 2NUYA 1ZAIA 1Q6EA 4WZHA 2Z0IA 4ZA0A 1I0DA 2WSKA 4ZFCA 3NGFA 3HIJA 2VEIA 2Y8UA 3IGUA 1VIWA 1V77A 3N15A 1WXYA 4O1AA 1UH3A 1O6IA 1TJPA 4GXPA 5FESA 3VIKA 1FWNA 5I0DA 3VKBA 1GJWA 4OZOA 5JIWA 4ZTXA 3PUOA 3SDOA 4POCA 2R1LA 4CD7A 4D6HA 3EA3A 1ZBWA 1DXEA 4JIQA 2FGZA 5IFPA 2PDPA 4PMYA 1W5PA 3F5KA 4JIPA 4AIOA 3QBUA 1Z8AA 2ZRWA 4G7FA 3AIWA 5AC4A 3T2PA 3SUTA 4CN4A 4L56A 5BYWA 3E74A 1PKYA 1XD1A 3NZGA 4RE0A 2PU1A 1BTCA 1KXTA 2PRHA 1LROA 4M7SA 1SW0A 5D05A 3SJNA 3IGSA 2WSPA 5HUOA 1Q66A 3B0YA 4F48A 3BUVA 4Z2LA 2CBVA 2UZ9A 2ZXAA 1OZQA 2RKXA 2PGWA 2BSLA 4S3JA 2WVTA 1EF2A 5KEZA 3KBWA 2D2JA 4ERAA 1LQAA 2NV2A 1C92A 3K4DA 3OZMA 3S83A 1V5XA 1FWSA 4YMZA 4YTSA 1W8SA 3PPHA 3W6MA 5I09A 2CZ5A 2G3JA 3F5LA 2PCQA 1DOSA 1D3CA 4K2SA 1P4CA 3STCA 4FLSA 4INFA 2Y8VA 4XO7A 4QITA 4JQ4A 1XSIA 3W00A 5D03A 2XVNA 3VOCA 1SPQA 4RPQA 1TG7A 4YIWA 3RITA 2O9RA 4W7UA 2PB1A 2DJLA 3N2TA 3TIMA 4H9TA 2Z28A 1TV8A 2ADAA 4IFOA 4Q8WA 1EDGA 4BFAA 2GGIA 1VCGA 3TH6A 2RHGA 1LUCA 2VMFA 1R30A 5CGQA 3WY1A 2ASHA 4CNUA 3DHPA 2ZX6A 1TPH1 3URNA 2P53A 1PO9A 3CO4A 4QJ3B 1KR1A 3GC4A 3I4EA 4IOTA 2EJ1A 4K37A 5IBXC 3LLXA 5AB3A 3WFLA 4IL0A 1GTEA 1LT7A 3TK7A 1C8YA 3PBWA 1NM9A 2GJLA 3ITGA 2YFOA 4DLMA 3G1SA 2FH8A 1I0BA 3CWNA 4JL1A 4FLOA 4GI6A 1I9CB 4H8NA 1EGVA 4YHGA 5JQ9A 3NL3A 5KZMA 4GX9A 1OCBA 3GZAA 1MW2A 3LNPA 1TTQA 2OX1A 5LIWX 1YYAA 3N9RA 1DVJA 4LNYA 3LY0A 4CEUC 2OQHA 4WRHA 4NJJA 4NZJA 4KBXA 4H9ZA 1DWHM 3UP8A 5SWUA 3NPVA 1FCBA 3G3MA 1CGXA 4RV8A 1FWAC 3BLKA 3IK2A 4Q8VA 4G8TA 1Q45A 1JCJA 4J27A 4OOUA 1TELA 1EZWA 2GUBA 3CASA 2ZQ0A 2ZZ5A 3UERA 3B04A 2CLEA 3NQDA 1XPGA 2H90A 4DLFA 2QPXA 1VB9A 3B4YA 1TWDA 3A64A 1SSDA 2I1OA 4ZE4A 3BARA 1RZMA 4JTHA 1DQXA 1VRDA 3RF9A 4DN1A 3L2IA 4OV9A 5TNVA 1HJUA 1XLHA 1OQFA 3QTGA 1GWJA 2J47A 1MRAA 3NQEA 4XZLX 3MYOA 5DF0A 1KD0A 4QR6A 4H2HA 2J75A 2PEVA 3NJ3A 1M04A 4E38A 3FYYA 2WZEA 5G1MA 2BX7A 1KC7A 2X0YA 1L6SA 5D37A 3LPOA 1LDCA 5IBXA 3AZTA 2YDQA 3PTDA 5HMDA 1W9UA 1MUCA 3O8AA 4NAEB 4MY1A 3ATZA 4N2YA 2QUTA 2WAGA 4J28A 3W2LA 3GDTA 1ME7A 2Q09A 3AU2A 2RDXA 3PFRA 4XG1A 2C15A 2QF8A 3C2YA 1YDOA 1W1B1 3LXCA 5LNRA 3T81A 2F6XA 4QE1A 4DBUA 4XVDA 3UGVA 4N9EA 2IPGA 4E8DA 1R9YA 8XIMA 3MO4A 5BNKA 1DORA 1I2QA 4GRSA 2WHLA 3W85A 3R8HA 3TTEA 4I7UA 4IXHA 2MANA 2V38A 1RVGA 1KFEA 4KH2A 2CWXA 1ITCA 2XVLA 7ENLA 4MKVA 5T8GA 4LCSA 1RD5A 3EPMA 5MKGB 5CBJA 4S3GA 1DL3A 2VTFA 2C0AA 3EX6A 3RCNA 1G7UA 3W1QA 1XYFA 3WDIA 1ZS2A 3V0UA 5JIPA 5ABTA 3RFAA 3DAQA 2XN1A 4HCLA 2Z29A 2YIHA 5I77A 2VGFA 4B5SA 3U7BA 4DX3A 2FGBA 3F2CA 3CH0A 1ISYA 4UFKA 4NL1A 4PSRA 4A29A 3H53A 2XGIA 3OA3A 4M51A 1XKYA 3GFZA 2PF0A 4HU0A 1QNQA 2HVNA 5C7VA 3T0AA 1S5WA 2V9DA 1P0EA 2WO5A 2OZ8A 3CU2A 2NQHA 3QMRA 4ES4A 2E5CA 3SI9A 2DZBA 1UH4A 1CECA 4ZOAA 4NRRA 4F66A 3IGHX 2PUZA 2OZ0A 3LRMA 4REQB 1H2JA 3SN1A 1R46A 2W3ZA 4FF7A 5ABFA 3RLVA 1CIUA 1XRFA 3DENA 4MUPA 3WLQA 3DZ1A 1KRAC 1KM6A 3LBCA 5AOUA 4B5UA 3QY7A 3OODA 4DHGA 1SZNA 3L5LA 2OG9A 1EC7A 1WZLA 3GVQA 1V6WA 5IHSA 2DZTA 1GZJA 4HYVA 3LGDA 2GQ9A 1H11A 4FIRA 3V35A 3WNLA 4AG0A 4W86A 3VIOA 5I3JA 4GGHA 3TFXA 2P3EA 9XIAA 2Y7DA 4H00A 3GTFA 2INFA 3B8UA 2VKZG 3WLLA 1XD0A 4IP7A 3LHZA 2ANUA 4I8DA 1RJQA 3E6EA 2Z7KA 4ROQA 3DFHA 3D47A 3CBWA 1KBIA 3VM5A 3NWRA 4C1NB 4HNOA 1GEHA 4E5TA 4Z08A 1ZBVA 4H8HA 4ZOCA 5BOFA 1FH8A 5FEZA 3L0GA 2IMRA 1YDVA 2FDMA 3TTYA 3LQGA 3W02A 3M5XA 4FIQA 1F7BA 3C3NA 4UQDA 4IZGA 1PAMA 4DI9A 1I2OA 4O19A 2ZIDA 3C2VA 4LH8A 3W07A 3PAJA 5BCAA 6A3HA 1HQTA 2BY2A 5BU9A 2WYSA 4MWAD 4GXWA 1PZ1A 1QFEA 3M0VA 3WO8A 1X6NA 1W1PA 1OABA 4XAPA 2NT1A 5L6UA 3M43A 3SY1A 2DQXA 3MMWA 2X8RA 5K9DA 3RCMA 4NZCA 1Z9AA 1A4MA 3EXTA 4NVTA 1V0MA 1ITUA 1A5AA 5LNSA 2YFNA 1ZNNA 3R0UA 1TO3A 5FD0A 1W1A1 3R58A 2QJHA 2XIOA 1JPDX 3TUUA 3QLLA 3JW7A 2HWGA 4G5DA 1C3FA 2WMFA 4HHPA 1Q13A 3WSUA 1R86A 4H9YA 3ARVA 3IK4A 4LF2A 4B2DA 3AWOA 5DT5A 3L4VA 4PH6A 3U2CA 1RCOB 2J8FA 1SZFA 1DWGM 4G7EB 1XBXA 4AHPA 1DE5A 5H2ZA 3G5EA 5CPSA 1BWLA 3MSYA 2FVLA 2XUCA 1JDAA 1VBHA 3POCA 2C1GA 3U0HA 4N42A 4HOZA 1E3XA 3GYCA 1Q6OA 2W91A 2PDXA 4ASTA 1DWJM 4ZTYA 3NQVA 3HGJA 2DIKA 3ZLGA 4O0ZA 5TAOA 4C6KA 1E9IA 1UWRA 3KX6A 4HYRA 3SRDA 3WZ0E 4AZHA 4BI7A 3G0UA 1P0NA 4IIEA 2GWGA 4L9XA 4ONVA 4QS5A 5BU6A 3FEQA 3W2NA 1DIKA 3LXBA 1IQ8A 2CIPA 3VIJA 2V3GA 4AD2A 3TW6A 2BY0A 3EDKA 3DFSA 4J3WA 1VGAA 2FTYA 3E2VA 3VK5A 2FPVA 3FGCA 1GNXA 2A7NA 2UBPC 4LGXA 3CV6A 5D2XA 1R7AA 4ZENA 1P0KA 1Y65A 2BP1A 3N1AA 3NM1A 3C86A 4CVWA 4U10A 4JBRA 4FMVA 3OYZA 3B8TA 5HDRA 1JDFA 1XCXA 3LI1A 2KAUC 3BSGA 1H09A 2VFHA 4GKTA 4HA0A 3ZT6A 1PHQA 2REQA 5CPNA 2QVNA 3Q65A 4XZWA 2UY4A 4EPDC 3OGSA 1U83A 5BW6A 2X1SA 3Q45A 3I3EA 1C29A 3CH9A 3CK5A 5LIYX 3ES8A 2NQZA 1NH6A 5F2MA 1EF3A 1TPUA 1E6ZA 1JCXA 1PUDA 1KA9F 4LBUA 3GTHA 3NUKA 1WE5A 3NG3A 4G9PA 3WF4A 5DEZA 2O55A 4O11A 2B31A 2PCEA 3GAYA 4JNMA 4KEUA 4EOUA 5AY7A 1AQHA 3NQ2A 3FK4A 3VOGA 5FF7A 1UA7A 1PBGA 1QI0A 1O5KA 3VNLA 4DPPA 2QCCA 4F2TA 4XISA 4AVFA 1A0EA 4B91A 4MZYA 5AYXA 3M07A 4JICA 1JD7A 5BOOA 2PGFA 3MUY1 2QDGA 3QV7A 3W38A 1QW9A 5HMEA 4G1NA 1ZJAA 2IKGA 3ZJ8A 4GUGA 3UY7A 4LRSA 4LS0A 1AJ0A 1KV5A 1MEIA 1QU4A 1LRTA 5H1WA 4MUZA 5GNZA 1QTWA 3MCOA 4XUYA 3VVGA 1WOBA 4YHEA 2RGLA 3VZXA 2BGNE 1UZDA 1W3JA 2BY1A 1MQRA 3NSNA 4M6PA 5LSMA 3B9OA 1XBZA 1ZPTA 4M6QA 1S46A 2OX4A 3L65A 2TRSA 3QHMA 2YXOA 4JS3A 3VX1A 2QYGA 3S8HA 3E49A 3ONBA 4MF4A 4CQDA 3FA3A 1A3WA 1X97A 5M3WA 4WEVX 4YXGA 2GPTA 4TVCA 4H7VA 3S47A 5AYIA 4RZ6A 4IP4A 3OLDA 4B9YA 5K7JA 1ZAHA 1DJWA 2VWSA 4JX6A 4R33A 3LGGA 4JXCA 4L1GA 4US5A 1W6TA 5KTLA 4H9UA 1ONEA 2XVKA 3FXYA 2PLJA 1TKKA 5A8PA 2Y24A 5CQ1A 3NQ6A 4J7RA 4HYWA 2EPKX 1O94A 1ICPA 1OC6A 4JCMA 3WX7A 3H2EA 1KM0A 1OHLA 1VEMA 4Q8QA 4G56A 4Y9PA 1Q3NA 4TU1A 4CQCA 3RLGA 3G0SA 1KBBA 3G1YA 2CZEA 1SJAA 5F1VA 1WZKA 3TA6A 2PWDA 1H5YA 3R6IA 3TCSA 2HNHA 3G1XA 3UYIA 4DWSD 3OBAA 5LXEA 1HJQA 3W71A 5KETA 2XIQA 4RW3A 3PNZA 3FAXA 2JIEA 7REQA 2EGZA 3QOKA 1TE1A 2V30A 3AXMA 1PEZA 4D6EA 6ENLA 2J7EA 4DJFC 2FZNA 3QFEA 4NT0A 2ZC8A 1LG1A 3EAUA 3CS2A 3ARYA 5BMXA 3NSMA 4ZFMA 4MHBA 3KOXA 4EXBA 3FSUA 4WXYA 3UNDA 7ODCA 1WKEA 2A3CA 3BPWA 3GVGA 4DWSA 3ZJ7A 4IJBA 4UTHA 5J8LA 4Y9NA 3H54A 3ZLFA 2JQXA 2PDHA 1Q6CA 4FF5A 1XGDA 2HE8A 4E4FA 5REQA 1UZ1A 3SRFA 4GUFA 1E1CB 1RP9A 1FDZA 2D73A 4GVIA 1S3HA 3GR8A 1A5NC 5A1AA 3UPWA 3WLTA 1R3YA 1HN1A 3M0LA 5FJJA 4GVFA 2A3AA 3W2MA 4JIRA 1VEPA 1UKOA 1XF0A 4OJYA 3EWYA 4LVFA 3LHVA 2V82A 3BQ5A 4Q4SA 4O18A 4G1KA 3T09A 4IHCA 3FYOA 1KM1A 1L2QA 3CWHA 4WK9A 1XISA 4MB3A 4P5UA 1UBSA 3P67A 4UTTA 1B30A 1MZHA 1LLWA 2BOEX 3JS3A 4X2RA 4YPJA 5AHIA 3HQPA 2VDIA 1CB7B 3SUSA 3ANUA 2QUUA 3WMLA 3N2OA 3VIMA 2EG7A 3QVQA 2PWUA 3LPFA 1E5JA 3VU2A 3A12A 2C7FA 3WQFA 1BSLA 4IJRA 1CB2A 4HNVA 3M0IA 1OEPA 1YRRA 2CEQA 3TQ0A 3QKEA 4HSNA 4YN5A 1YEYA 2WSRA 4UTFA 2UWFA 1F8MA 2W61A 2CLHA 3HMCA 5CXPA 3AMCA 3KVLA 3KHJA 1Q6RA 3WH6A 4IFKA 2PA6A 3WQWA 3BLPX 4CNTA 2QCDA 2WJEA 1EOKA 1UA3A 1OFBA 4E2BA 1S2UA 4XIAA 2VI0A 4R85A 3BDKA 3V7PA 4B3KA 1YNQA 4GZIA 2Q01A 2O7QA 3P81A 3UJEA 3MO7A 2BDQA 2P88A 4G2DA 2G4JA 3Q58A 5M17A 2DZUA 4UZSA 3ID7A 2R24A 2VX4A 1HKJA 1M68A 1MXGA 2EG6A 3MVTA 4C5ZA 3BAKA 2BZNA 2R9RA 3N34A 5LXXA 3S1WA 3IJ8A 1DIDA 3LSBA 3TYBA 1XUZA 5LKYA 1EIXA 2YBVA 3BJSA 2DT1A 2I9EA 1YE4A 2JEPA 1T41A 1ODZA 1UYQA 3T44A 3T7VA 2GK1A 3C0SA 5T9CE 1SGJA 1KO0A 1PTGA 1X6LA 4GZEA 2QAFA 1AUSL 2ZZ3A 7PTDA 1X6UA 4Q8OA 4P7NA 5EMMA 4AD1A 4U33A 3IIPA 4Q33A 2E28A 1W56A 5DELA 3HQ1A 3HG4A 3D46A 4U5IA 3CZEA 1JCNA 3SCSA 2VR2A 3C52A 3HFYA 4WD0A 1YLVA 3W3OA 4UZUA 2I17A 1IT8A 5K3VA 2YPIA 3PJXA 3SIMA 2ZVRA 3EA1A 3MJMA 2Y63A 1XLJA 4JQ3A 1T5AA 4XZBA 4IG2A 4DJDA 2ALDA 4Z1BA 3HGSA 3SZ8A 3WQ4A 2V63A 3EGJA 3KTCA 3UWQA 2X0SA 3C0QA 3LV5A 2QMJA 1IWAA 1DHPA 4LAMA 5CBIA 3P84A 3G77A 1LBLA 4GYPA 3EXRA 3O07A 1CLXA 4RK8A 1VFOA 3N25A 2Z1SA 2Y4SA 3L4XA 1IZKA 2J7FA 4AY1A 1UQYA 4L65A 3AIEA 2FFCA 4ZB0A 3RMJA 1GW9A 2JEQA 3CV1A 2NV1A 2DH2A 4AWSA 4GUJA 1UQZA 3EMQA 4FNUA 3CZKA 5I02A 3S2JA 5I06A 2CKRA 2PD9A 2YA2A 4NZ1A 3EB2A 3VMOA 5F2IA 3W23A 5FF0A 5G4WA 3G24A 5F4SA 5GVJA 3ZR6A 1TIMA 1V3LA 2VEKA 3S9YA 5EFDA 4RKAA 1ISWA 3BURA 2FMNA 3S4TA 3QV9A 4JFSA 1OX4A 2XH0A 3CMFA 2NQ5A 3TN4A 3BZJA 5G2WA 2IQ0A 4HK7A 4LS2A 4MB5A 1TR9A 3DN5A 4F9JA 4FO4A 1XLBA 3WQ5A 1V0KA 1PVNA 2QUNA 4RDZA 1YPXA 1MXSA 1B3ZA 2R6OA 1WAUA 4LEFA 2XH4A 2DUZA 2DUXA 2IQTA 1UZHA 3WJYA 3E5BA 4NJHA 5E9AA 3CEPA 1NDWA 4NI8A 1JGMA 1RCXB 3WQOA 5FACA 3W7DA 3OG3A 3KBVA 3H2NA 1GCYA 5ECVA 4HNTA 3LCLA 4E2OA 5E0FA 1Z3NA 2PGRA 1SO5A 2FPTA 2PS2A 3GAKA 1TPEA 2O9TA 2C3ZA 1KLYA 4F2BA 3TA9A 4QDWA 1MUWA 5G4EA 3S9ZA 4I9TA 1B2YA 3FA5A 3TJIA 1Q6FA 2QCGA 4XZ9A 1TMQA 3F2BA 4LS1A 1A5OC 5GQBA 1D7KA 2PC4A 4WKFA 3S3GA 4JKMA 3VNZA 5ABGA 2QAPA 2QCNA 3LEPA 1D3HA 2VD8A 1PE1A 3O6YX 3F4CA 1R3QA 4KEZA 2OOFA 4AB4A 4FXRA 5I23A 1QATA 1JFHA 3WCZA 3SGUA 3QR3A 1VQTA 4GYJA 3AUJA 3W84A 1GOMA 2ZUNA 5A2CA 4IIGA 4WSJA 3N04A 4XVEA 4HJFA 1RY0A 3SQMA 4QBXA 1B3XA 5CBBA 4UFIA 2YBTA 2AQWA 3QW3A 4PUJA 4F2UA 2VURA 4C7FA 2VZUA 5K9CA 1PKNA 4UOZA 1IXOA 3H2CA 2GJXA 1XYCA 2AQOA 3V4BA 3KZSA 4PCPA 3UEQA 3FN9A 4O52A 5CCZA 2BVTA 4MY9A 3ENLA 4EWND 1GHRA 2NQLA 5FOOA 1XL9A 3H2AA 1J0YA 4Q4QA 4NI3A 3GG8A 2OO0A 2DP3A 2XVGA 1TVNA 2PI6A 4AVOA 2WSQA 1IV8A 1FHVA 1W3IA 1YNPA 2YA0A 4TTGA 1ALDA 4ZXLA 1UKQA 3MA8A 1E56A 5LNWA 1O5QA 1SSGA 4G7EA 3IIOA 2GLKA 3NM3A 3G1DA 3EOLA 3DFNA 4WOQA 2NQJA 3KEHA 2Q8XA 3VIGA 4MM1A 4F0RA 1JZ4A 5ECUA 2DT0A 3NQFA 1CTNA 4BR1A 1HZYA 3KZPA 5C5YA 1GTHA 1MWOA 4D2JA 4MVAA 4PZVA 1TMHA 2E6AA 2WXDM 3MMDA 4WGXA 3NNTA 3EMCA 1Z69A 4UCGA 1PHWA 1WOAA 3EDEA 1Q6LA 5HJLA 1KRCC 3BJFA 3SCQA 3VUSA 3QV8A 2WSYA 4JKLA 4CEXC 1W9PA 4IX2A 2J6VA 2C6QA 1J4EA 3KDNA 1JZ5A 3GIYA 3E0IA 5C55A 1VJZA 4N6EA 2O4MA 2OKOA 1XQLA 2IPJA 3HO8A 4C6OA 2KZHA 4O1DA 3VKDA 3REQB 5IRPA 4TOQA 4M5PA 1L6FA 4NF7A 5BRPA 1DPMA 1ZP4A 3BG9A 1RR2A 3SADA 3BAWA 3QGVA 1BYCA 3PWAA 1P1XA 3NO1A 2ZX9A 1XDJA 1O5RA 2XM1A 3W24A 3W72A 1TV5A 3GWQA 2CETA 3S5SA 4PMJA 3RPMA 3MV01 4KEVA 1B3VA 4DZ5A 1KFJA 1JL8A 3H4XA 5BROA 4Z1DA 4UR9A 1G4PA 3AIBA 1CZ1A 3ES7A 1XH0A 3GU1A 3LHUA 2A3EA 1VAHA 2C1IA 3S2LA 3RHGA 2WOQA 4LRTA 3EWUA 4DEFA 1POJA 3G1RA 1ZBKA 4OWGA 4QXIA 4XB3A 3RXZA 4DF0A 4GOAA 1TJ2A 3KRUA 3WUFA 4AF0B 4A3RA 1OJXA 4UMAA 1EA9C 1XIIA 3B8IA 2P0IA 2B7QA 1NWRA 2XWEA 3SCUA 2WJZA 4DWDA 2FGLA 3WLPA 3L4TA 4ALDA 1H0IA 5I3DA 5A69A 1BYDA 5ABHA 1S2TA 2WJDA 1O68A 3SN4A 4MZ8A 3MUCA 1C8XA 2VRKA 5FI8A 4DUWA 3BXWA 3ALGA 4TQTA 4PTNA 5DXXA 1PTDA 3EOSA 2CLMA 4X60A 1P0BA 3WLJA 1EX5A 2IXVA 4V27A 1F3TA 1IIHA 2A7PA 4L4PA 4O1FA 4L64A 1EJ7L 4C7DA 1VYRA 4XKMA 3R5EA 1I1WA 1EP3A 4QE5A 5AHLA 2VO5A 2HPIA 3A9IA 3LNMA 4AD5A 4GIYA 4UTKA 4HNUA 3IAQA 3VDAA 3MKKA 2Y1HA 2YXXA 4GFIA 4AFYA 1IR1A 4QRNA 3DFPA 2ACSA 1MI3A 3PUDA 1CW2A 5D04C 3PSVA 2OEJA 5BRQA 3CV7A 3VIHA 3N11A 2ZCGA 4M1RA 2X1RA 3LENA 1CNVA 3WF2A 1V7AA 1PIFA 3BANA 2FHFA 4UFMA 1TWIA 3KP0A 1WUEA 2PODA 3MP4A 1EB3A 2E1DA 4Q32A 4J3XA 4IMAA 2A7RA 1ONRA 2O4QA 4KESA 3HF3A 3OQ8A 2JIWA 3CYJA 1OY0A 1T99A 2J25A 3ICJA 3L4YA 5T9BG 3SAZA 1EO5A 2SFPA 1H51A 1WB0A 3APTA 3MCMA 1TPWA 3TX9A 2BHZA 3LHYA 1QO2A 3UVIA 1OC5A 1W17A 3N2BA 2WVSA 3PB2A 1R47A 5AC6A 3N3TA 4FX6M 1NDZA 1E40A 1Q4WA 1QUMA 3GUWA 3LXAA 2CZDA 1QCWA 4QDPA 1PX8A 4JYFA 5H6HA 3UXAA 1UR9A 2NLYA 1J18A 4DELA 2NVAA 5JVLA 4AZBA 1E51A 3L2MA 4DBSA 2CLLA 3TYZA 1HIZA 3KL5A 3BG3A 3NO5A 1K77A 1LWHA 1OFPA 4DYJA 3M9YA 2CCRA 1HO4A 3E0VA 3JVAA 3RK8A 4KMQA 4S2BA 1C91A 1F3EA 3LB0A 1RK6A 4S3KA 2FMOA 1L6WA 2HVMA 2EPNA 1XIGA 2WB5A 5A5WA 3U57A 1V3KA 2G3FA 3B0VC 3RRAA 2H6RA 2DY3A 3O2LA 4J35A 1QOXA 1J5SA 2YL6A 1PL9A 1TPVA 4N9CA 5LNVA 1EP1A 3KLLA 4S23A 1H7WA 5A2AA 3WLIA 5A94A 3DHUA 3W1TA 4NRSA 4EANA 1FWEC 4MLJA 3BV4A 4EVZA 3WD0A 4FNSA 5FA5A 4UFLA 4DM1A 3ARRA 4GBUA 4FLQA 4R27A 1ZTVA 4HZMA 1GOIA 4DJED 4RUBA 4CVUA 3O05A 4OKDA 3AU6A 4YCOA 3GDLA 3NL2A 3FHQA 3OGRA 1RD6A 1UWTA 2YOCA 3I65A 2E1WA 1WDWA 1B1YA 1H4PA 2WZHA 1HO1A 2ZYFA 2B7NA 2VQUA 4AHOA 3WD3A 2VEFA 2X7VA 3EYPA 4MB4A 2QJJA 3THUA 2YL8A 3F03K 2VRQA 5DANA 4C1LA 3NVDA 3SURA 4WOZA 4KWSA 2DZWA 4PMVA 4TMBA 3V0TA 4JTDA 3TV8A 4AIUA 2B4GA 1XYZA 3VX0A 2G96A 3VFCA 4UTUA 3S42A 4QISA 3QY6A 2FVKA 2DSVA 1H7PA 3CYVA 1SU5A 1XIMA 2QKFA 3UG5A 1FWWA 3IJDA 1FY6A 1M03A 3QY8A 5AECA 1OX5A 2PWHA 1HF6A 1UH2A 3LDVA 4QLKA 4CD6A 6TAAA 3UU0A 4Z2IA 4O10A 3AIRA 3PTMA 2YA1A 3FIGA 4R7JA 1UJPA 4DXVA 3LCHA 3OQEA 3ZVHA 3GC5A 1X7FA 5D4YA 4OE7A 1V3IA 4AX6A 2DU2A 2Y0FA 1T40A 2NWRA 2IKJA 3A47A 4ZOBA 3OU8A 3VKAA 3VILA 4CNOA 7TIMA 3EXSA 1A5UA 3CPGA 3WDPP 3T2OA 3STGA 4UR7A 4GIRA 4NIRA 4B5NA 3LCGA 1DJNA 4DUXA 4NZ3A 2VEMA 4M0XA 1CGUA 1J2BA 2FZDA 3B8WA 4K39A 2FKPA 4C60A 4XZNX 2DT2A 4C1NA 1JF5A 3PUGA 2YCLB 3PBYA 2PDCA 4Q4OA 4GYFA 2WK2A 1C8VA 5C9WA 5LHEA 3MSRA 2WKJA 1V08A 4HMCA 1GQJA 1UBPC 4LU0A 1XJBA 3BW4A 4NJKA 3PBVA 4JX5A 1XSKA 2QMKA 3A13A 4JPGA 3P7YA 2QIWA 4Q8TA 2RH9A 1GQLA 4H1ZA 3TKFA 1W1VA 4TVUA 3UQNA 3POHA 4FA3A 1REQB 1R3WA 3LPPA 3WJXA 4U4MA 6TIMA 1BFNA 4QJ1A 3GXTA 4UFHA 4A3YA 2ZX5A 4J2PA 5HJXA 1QPQA 4NP7A 2QCFA 2YZ5A 4DYKA 3DDMA 3DERA 4C1KA 2OTDA 4CUCA 3LZ5A 4UNIA 1GZGA 1F4HA 1M7XA 2HDJA 4LT9A 5D09A 3GXFA 4CU8A 2J9ZA 3GVWA 1W3KA 1D7FA 1UMYA 4E6MA 4LCRA 3C2FA 1UR4A 2HBXA 2PP1A 2HEJA 4XK2A 3WBYA 1M53A 3WF0A 2Y7EA 4HVXA 4IMGA 3CPRA 2YCLA 2JGQA 1HKMA 1LLZA 4KPLA 3L5AA 3STFA 3U9IA 4GCAA 3ABOA 3W88A 2PE4A 1E5NA 3L9CA 2WC4A 4ORMA 1JAKA 2F7FA 1W37A 4AZCA 3TW9A 1G6CA 1EJRC 1ZCCA 4GG9A 4HBKA 2NV9A 1JDEA 4QQ3A 2BMBA 1QBBA 3N19B 1P0DA 3T78A 4QJ4B 4MKNA 4O15A 4J3ZA 1NP2A 5C9UA 1T7LA 2YDSA 4GE8A 4C6NA 3PJTA 3TAKA 4J9JA 3RCYA 3PZ9A<