1C93A

Endo-beta-n-acetylglucosaminidase h, d130n/e132q double mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
b'KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFNDQYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
total genus 90
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c93A00
4PMYA 3SCVA 1HJUA 1BVZA 3M46A 4J28A 3VGFA 2G8ZA 4WKFA 3W26A 1CNVA 1NARA 3U57A 2VR5A 3WF0A 3WD4A 3VO0A 1W9DM 2CEQA 1WDRA 2FHFA 4M8UA 1GQKA 1C8XA 3JUGA 3AJ7A 3DHUA 4JAWA 2UY5A 1CGTA 1V3LA 1VFUA 4B9YA 4IISA 3OA5A 3BAXA 4FK9A 1MQPA 4MAVA 3WQ8A 2XGBA 3ZR5A 4BZYA 3WQ5A 4MAZA 5A2BA 4AD5A 3AIWA 3L4WA 5I6SA 1BG9A 1E72M 2XIIA 5IFTA 3K46A 3ARTA 4W5UA 4CVUA 1ESWA 1JZ4A 4Q22A 3VIPA 2DDXA 3PZMA 4A3HA 3U5UA 1QI2A 5JUVA 2ZUVA 1KCLA 1V6WA 1LQ0A 1HJWA 4AZ5A 1W3LA 2Y24A 3MO4A 3ARRA 1TCMA 3OIHA 3AROA 3CIVA 4WIWA 5ABFA 3LPPA 4H7VA 3NDYA 1TE1A 1YHTA 1H0IA 1JDAA 4E8DA 3RJYA 2JEPA 1ISYA 3VIGA 1TFVA 5M03A 3AS3A 4W88A 1HL9A 3B9EA 1HJXA 3LPFA 1NWTA 4UFHA 1GW1A 1GCYA 1XSIA 2BY0A 1SR0A 3TTOA 4P8WA 5BXSA 2XJ7A 1LG1A 3TP4A 1H5VA 1QPKA 5IFPA 4RE2A 1Q6EA 4P7NA 2J7EA 2CKRA 4UQCA 3GNRA 3W4RA 2NSXA 3ZMRA 2E4TA 1VEOA 1SMDA 5D9OA 4WKAA 2ZX8A 1CEOA 1C8YA 4JKMA 2VMFA 4U3AA 3VNZA 5CLWA 2GUYA 2D23A 2C0HA 1HKKA 1SMAA 4AW7A 3QOKA 4F9JA 1PEZA 1EOMA 4C7DA 2V3GA 4CCDA 2OSXA 3VTRA 3WMBA 1UWSA 1NQ6A 2JFEX 1ZBVA 1NOWA 1ZBKA 3VKKA 2D2OA 1EIBA 2J4GA 2XTKA 1EQPA 5LYRA 1E6PA 2X8RA 4YPJA 4Z2JA 4E2OA 1DHKA 4MNLA 3KL3A 1OIFA 1GHRA 2QV4A 4AZ7A 3EDEA 3RO8A 4Z2GA 1CYGA 2G4FA 4AEFA 2GJXA 3BLKA 1CGVA 4ZFMA 1JZ7A 2EPMX 3F4VA 1UQZA 2GDUA 3HN3A 1W9BM 2D20A 5ECUA 1CPUA 3EDKA 1JFHA 3A4XA 3AZSA 2CHNA 1TG7A 4U31A 5FL1A 3MUY1 4JKLA 5C8BB 1F4HA 2GFTA 4PMXA 1SYTA 1E0WA 3LPGA 1HT6A 1W9XA 4OUEA 3AHTA 2JIEA 5LA1A 2OWXA 3ZSSA 3RM9A 1JI1A 2BVYA 2J7BA 3AIRA 4PTWA 3GYCA 5CG0A 4UFKA 4R27A 5A8PA 1WZAA 8CGTA 3W0KA 1GZJA 4DWSC 2PF0A 1LL4A 1XSJA 2WVSA 4EANA 2XVKA 5BYWA 2BY1A 4P8UA 1G9HA 1E5NA 1DP0A 2VCCA 4KMQA 4PYSA 4U3CA 3W38A 3I3DA 2X1IA 4BQ3A 2E8ZA 3WH6A 2PWDA 4M82A 3AMKA 5I2UA 1FOBA 3KL0A 2WMFA 4DM1A 1CGYA 4IPNB 4D1IA 3ARWA 1MFVA 4D72A 3WQ6A 3FAXA 1IT0A 2EXOA 1Q6FA 4WK9A 3U5YA 5A3HA 3L4UA 2FGZA 1E15A 2J77A 4FLQA 4AIUA 4D6GA 1UH4A 1HIZA 2UWFA 2GVYA 1UWUA 1B90A 2J7FA 4OIFA 1MXGA 4AEEA 2WVVB 4J3WA 3PTQA 4B9ZA 2EPLX 3WNMA 1AMYA 1FHLA 3SCQA 1V08A 5A2AA 1W3HA 4AD3A 2EEXA 4W7WA 5D9MA 2J79A 4HPHA 1HP5A 4HOXA 1P6WA 4BCEA 2VZVA 1UKQA 3VGBA 3PZOA 3OLIA 3SCRA 2WHJA 4GI9A 4AD1A 5AYIA 3MUZ1 2DH3A 3AHVA 5CXPA 1CXLA 1GOWA 3WF4A 5ABGA 4D6HA 1KWKA 1W3KA 4A3YA 1WKYA 4H2CA 2QF8A 3SUSA 2CCRA 3WD1A 3M07A 3D5HA 4GZJA 1W2VA 1VFFA 1ZB5A 2WM0A 3N04A 3VGDA 1X1NA 3S2CA 5A94A 1CTNA 3RILA 4CUCA 1HKJA 1QOXA 1ODUA 1UD4A 1V3IA 1VBRA 3DYOA 3SIMA 3VM7A 3GXFA 5AYBA 4TX8A 2WCGA 3UG4A 1B1YA 4BA0A 1LL7A 2V38A 2JALA 4E4PA 3AFBA 1EDGA 2A3BA 4ZEPA 2Y8VA 8A3HA 4B15A 2GK1A 2ZXBA 1HP4A 3BSHA 1E5JA 2WMIB 4X0VA 5FCZA 3AHXA 4ACZA 3K4AA 3WDRA 2X09A 2ZX9A 2YA2A 3AMDA 3MV01 1B30A 3RDKA 1V3HA 2YL9A 5AY7A 3MUAA 4RE3A 5IDIA 3VD3A 1KXVA 1JDCA 5M5DA 2FHCA 4R5EA 3MSGA 4J3TA 3VPLA 4F8XA 2WMHA 3EYPA 1XH2A 3TOPA 2V5DA 1GVIA 2O9OA 2W5FA 1VFMA 2XM1A 1XCXA 1W32A 2FH8A 1H11A 2CPUA 1MW3A 3VIKA 3BGAA 1BYDA 2EPNA 3WDHA 4GQQA 2FGLA 4AWEA 5I23A 3QHNA 3WNPA 2UY4A 3UETA 1UKPA 4DM2A 4FF5A 2B31A 4C7FA 4M1RA 1QVBA 1CZ1A 3RCNA 4CD8A 4W8BA 3QR3A 4CN1A 1JYVA 4UFIA 1JYXA 1J12A 4PUEA 1JZ5A 1WDPA 5GNYA 5C70A 3WDIA 3VMOA 2OSWA 4QCEA 1BPLB 3EBVA 1U2YA 2D3LA 4LX4A 4GO8A 1U30A 4PMZA 4BQ2A 4MB5A 3WUBA 1E4MM 3ZIZA 4AIOA 1PJ9A 3OLGA 1W9UA 2ESCA 4AISA 3NIYA 4JHOA 4TVCA 3BLPX 3VNYA 1JD9A 3KWXA 4M24A 2V3EA 1FH8A 4AY1A 1U33A 3AIUA 2DT1A 2CKSA 3SURA 3ECQA 2XVLA 3UR7A 4X0NA 2YDRA 1JYNA 4D6JA 4HMCA 1J0YA 4WKHA 2J62A 2W61A 4UZUA 1KR1A 3NSNA 3M7SA 4IM4A 5CPQA 2VC9A 2JE8A 3DECA 3W82A 1TVNA 1RD6A 2WC4A 1V0LA 2WVUA 3B8SA 4MB4A 4BQ4A 1Q6CA 4GINA 1GHSA 1BQCA 4J3VA 4FLOA 3OZOA 1DWJM 2J75A 1R86A 2WKLA 3VIOA 3QHMA 2XFYA 2XFRA 5HOSA 1EOKA 1BG4A 3TTQA 4TVUA 3VGHA 1VEPA 2NW0A 1Q4NX 1J0KA 2VX6A 1IV8A 2EPOA 1XC6A 6TAAA 3PZNA 1GVYA 3WF2A 3VVGA 2VL4A 3IJ8A 4N0RA 1E4IA 3WD2A 4HU8A 1QI5A 2WXDM 3QGVA 2DT2A 1CXKA 2PWFA 3N11A 5A69A 1W9VA 1ISZA 1W91A 3FNDA 3VD5A 5BWFA 4W7UA 1ZBWA 3AHYA 4UOZA 3WD3A 1BLIA 1ZJBA 3WL0A 2DSKA 2PWHA 2QMJA 4AZCB 2WSPA 3RJXA 1ISXA 3CZKA 3CUHA 5CGMA 1QNSA 3M6DA 1E6ZA 4PUDA 3WSUA 3MMWA 3BCFA 3K8KA 4JIEA 1FH7A 1JZ8A 2WVVA 2VURA 3WMSA 4UQ9A 3K1DA 3BAKA 5KEZA 5F7UA 1M04A 2ZICA 1B3VA 2EBNA 1JD7A 3CZGA 2WBKA 4W7VA 4JZ5A 1NOUA 3OGSA 3IJ7A 2A3HA 2GSJA 5EB8A 4JCMA 3BC9A 2WK2A 4DWSB 3T08A 1GJWA 3CUJA 1RP9A 1KBBA 1R87A 2J74A 3W25A 1I1WA 1BYBA 4XUYA 1OSEA 1UA3A 2A3AA 4AMCA 4CCEA 3ARVA 2EO7A 3PZIA 1E55A 3ALFA 1W1TA 2QPUA 3W6MA 3ZJ8A 3FHQA 1WAWA 4J7RA 4PBGA 5IHSA 3WIJA 3VINA 4LYQA 5A1AA 4MNMA 5I78A 1RPKA 4AZIA 4PMRA 4PTMA 4XV0A 1FA2A 1PZ2A 1UKOA 3AIVA 1Z32X 1M7XA 4XB3A 3VDBA 2W63A 3PTKA 2OWWA 3CGTA 1D7FA 3AS1A 4WLCA 3VMNA 1C8QA 2YKKA 1VFOA 4AZ6A 1F4AA 5JBFA 3NSMA 2WMIA 1WB0A 5FD0A 2XWDA 1OIMA 1S46A 1D2KA 3L4ZA 4PTXA 3WEZA 4Z2KA 1UD5A 2E40A 2CIPA 3AIEA 2E0PA 4PMNA 1J18A 2V3DA 4BS0A 2DPEA 5A6BA 3WELA 4DUWA 1TA3B 1LG2A 1UD2A 1CIUA 3WQ4A 3PBGA 4UQEA 4EKJA 3T2OA 3MV11 1UOKA 4J27A 3WL1A 5DEZA 1WPCA 2YLLA 4W93A 2ZUUA 3LMYA 1CENA 3WD0A 1UUQA 3UERA 3GNPA 3VD9A 1FH9A 2V3FA 3TA9A 1EXPA 1XHGA 3F5JA 2NT1A 1MW0A 1O6IA 2D24A 1UQYA 3GH5A 3TTYA 3ZR6A 3GTNA 2IXVA 5D9PA 7CGTA 5A95A 4U2YA 2OSYA 1B3XA 1W3JA 5D4YA 1E6QM 1VJSA 2VX7A 2PI6A 4ATLA 1E70M 1PAMA 1W1YA 2C8NA 3BAWA 1V3KA 2J7CA 3L4XA 1XV8A 2YL6A 3WBAA 4S3KA 3VGGA 1UHVA 3AXHA 1XRVA 4OOZA 1H3GA 1CXEA 1K9DA 3RM4A 3W37A 3ARXA 3W6LA 4GI6A 3AXXA 5EFDA 1FP8A 3SCSA 1DWAM 1EQCA 5DT5A 5JBEA 1CXIA 1WZMA 1UR4A 3J7HA 4NF7A 2FH6A 1E71M 4HA4A 1US2A 1NP0A 4UCFA 1UR0A 5A8QA 2DT0A 3N15A 3UEQA 4P7OA 3GBEA 1MYRA 2XHYA 2CXGA 3WNNA 4LXFA 1X6NA 3AYRA 1E1EA 2DIJA 1G0CA 4WSKA 4PRWA 3K4DA 2JF7A 1HKIA 3AS0A 4F79A 1ZBCA 2OWCA 4N42A 1ZU8A 2BY2A 1KQZA 2BVTA 1UH3A 3GXMA 2VTFA 1YQ2A 2VNCA 2XWEA 4Z2LA 4CN6A 5CPSA 2W91A 1UYQA 3SCOA 1EDQA 2G3JA 2ZUSA 2YDQA 1KGXA 2WVTA 4AZBA 1O7AA 5A8OA 1AVAA 4KGJA 3BH4A 1BFNA 2OLHA 3SCNA 1NOFA 4PMOA 4F66A 1B31A 2ZXQA 2CERA 1MXDA 2XM2A 2BFGA 3APGA 3BMWA 4TXEA 4GI8A 1WZLA 2ZX6A 1GORA 3WH9A 4D6IA 4PSPA 1GUVA 3WNLA 1UH2A 4GXPA 4IPLA 3CZLA 1V02A 2BV9A 1IZKA 4MB1A 1OGSA 4BQ5A 4DUVA 1E0XA 1CLXA 2G41A 2WMKA 1V3JA 4H8VA 3T0BA 3DYMA 1OD8A 1E3XA 2AAAA 3FAWA 3NDZA 1UWQA 2QLYA 1E0VA 5E09A 5BRQA 5E70A 4EK7A 1GONA 1KXTA 1KBKA 3QHOA 3SCPA 3WQWA 5D8ZA 1GOOA 2W66A 2XUCA 4CU7A 3BCDA 3CHFA 4PSRA 3WH8A 1V6VA 5E0CA 1UKSA 2WPGA 1DEDA 2DQXA 3HU7A 1AQMA 4QCFA 3L4VA 1KCKA 1CWYA 4W8LA 3BXWA 5GNXA 1A3HA 4UOJA 2D3NA 2PBOA 3A3HA 2WWDA 5A6BD 1J01A 2J7GA 1KXHA 3CMGA 2AMGA 2WAGA 2VZOA 3ZJ6A 1WDSA 4OOUA 1E40A 2VCAA 4KGLA 5A8MA 2WWCA 2DIEA 1LF1A 2VR4A 1CXHA 2G3MA 2EPKX 2DH2A 3AYSA 5I0DA 1XSKA 1DWFM 1Y7VA 3CZJA 3AS2A 4AXNA 2DT3A 2W62A 5JBDA 3ZSTA 1XYFA 1TUXA 2WZEA 2PWEA 1BVNP 5BXTA 2D0FA 1KFWA 4H41A 2VX5A 3MMDA 2PBGA 3CZEA 3BAYA 3QOMA 3U7BA 3VD7A 3MKKA 4W84A 2ZX5A 3T2PA 1UWTA 4CCCA 1DWHM 1BGAA 5FKYA 2FDMA 1XYZA 5ABFB 2DEPA 1UWIA 4KRTA 3DYPA 4NRRA 3SUUA 1V0MA 1UD6A 1XH0A 3VIFA 4D6DA 3UCQA 1BTCA 2DGAA 1DWGM 1UWRA 2F8QA 1I1XA 2ZIDA 3AIQA 5DT7A 4KWUA 1VF8A 3VUPA 3FXYA 5CJ5A 4XZBA 3UESA 1ITCA 1EDTA 2JEQA 1VBUA 3BMVA 1V6XA 3F5LA 1UKTA 5BRPA 5A6JA 1JYWA 4ACYA 1UG6A 4AD0A 1HJSA 1V0NA 1JAEA 1LJYA 3RM8A 2Q8XA 2Y8KA 5FOOA 1OT1A 1VJZA 4TOQA 1B9ZA 4XX6A 4AZGA 4HZ8A 3VDCA 4UNIA 4J3UA 3W28A 1E3ZA 4QAWA 4D6EA 4W89A 1W2PA 2YIHA 4NRSA 1VAHA 4YHEA 2YA1A 2J78A 3T0AA 2QHAA 1JGIA 1GOQA 5I3DA 3O6AA 3AQUA 3DHPA 1H1NA 3MU7A 1G01A 3FW6A 3IJ9A 5AC4A 3KL5A 1GOKA 3W29A 3GXDA 1VB9A 4U5KA 1PIGA 2X2YA 1HX0A 4P7RA 3L4TA 1ODZA 4RL3A 3VILA 2VCBA 4GIAA 3ARQA 2ZXAA 1H2JA 4AYSA 2XGIA 1CECA 5CSUA 1OWQA 3VIJA 1LLOA 3KEHA 1V3MA 1NWRA 3PTMA 1C93A 1E9LA 3MMUA 2ZUWA 1PX4A 3WEOA 2WYSA 3IAQA 3EMCA 5IXEA 1M01A 1UZ1A 4Z2IA 2XIBA 2VRQA 1NM9A 3CZ8A 3A4AA 3ZO9A 5ABEA 4UFJA 3N1AA 1X6LA 1GOIA 2VJXA 4L4PA 5BCAA 1UD8A 1EGZA 1ISWA 4GZEA 4YN5A 3POCA 5M17A 1VIWA 4D6FA 3UG5A 2CBUA 2OYMA 2C7FA 1PIFA 5ABHA 2MANA 5HPCA 5JIPA 2A3CA 3GBDA 2XPKA 1EHAA 4PMDA 5DO8A 4D6CA 5A8NA 3A47A 4LYRA 4DWSD 1EO5A 3GNOA 5E9AA 4JFVA 5CLTA 3N9KA 3PZ9A 1UD3A 1HNYA 4B3LA 1E6XM 2VRJA 1XGZA 3PN8A 3IAPA 1EA9C 1KB3A 1WDQA 1FFRA 2GJRA 1FFQA 1HJVA 2YA0A 1QBBA 2XVNA 4M56A 2DSWA 4V28A 1E6NA 2PB1A 2YJQA 6A3HA 2Y2WA 3SEPA 2YBUA 4Z2HA 4JHZA 1VENA 3ZT7A 2XG9A 1BHGA 3N17A 2F2HA 3ARPA 1V6YA 4GZIA 1OINA 1R7AA 3KZSA 1KXQA 5HBFA 1PX8A 4CD7A 3CMJA 3RPMA 4UFMA 4CD5A 4NSBA 1J0IA 3WUEA 4V2XA 4AD2A 4D71A 3MSDA 3N18A 1UR9A 1E4NA 1WP6A 2CETA 4YHGA 7TAAA 3O2LA 3SUVA 3GH4A 3EDDA 4TTGA 4MJ4A 4HPGA 1VEMA 2J8FA 1BYCA 2VOTA 4ML4A 4MADA 3WDJA 1AQ0A 1JF5A 2VT0A 3G6LA 4UZSA 5AC5A 5A6LA 5GNZA 3BAJA 4B3KA 1CLVA 1XD0A 1QBAA 5I24A 4HMEA 3MANA 3GXIA 2VVNA 3I3BA 4U33A 1TZ7A 1E1FA 3PZVA 1ITXA 1H09A 3WH5A 4URIA 2VZUA 2WNWA 3VD4A 4QFUA 1CXFA 1E4LA 4AC1X 4OJYA 2XVPA 4CD6A 3WF3A 4CGTA 2X0HA 2VX4A 4WF7A 1ECEA 3CO4A 4W8AA 4E8CA 3OGVA 2ZWZA 5E0FA 3AXIA 1NWSA 2Y5EA 1UR8A 4ZXLA 1C3FA 4M29A 1JXJA 3KE0A 3WMCA 3SCTA 1OGBA 3WH7A 2IXUA 2PWGA 2GK1B 1QNPA 2BHYA 5CGTA 4ACZB 1BF2A 1JDDA 4ATDA 1HVQA 5A6SA 1QI4A 1J9YA 1KQYA 3AICA 2WCAA 4F9DA 3POHA 3THDA 1NWUA 5EBAA 4ATWA 3VIIA 2PC8A 1XD1A 4PCSA 3AMLA 4TX6A 3U7VA 4OBRA 1QHPA 3WNOA 1LL6A 3UG3A 4KRUA 4CKQA 4GPNA 3L2LA 5DF0A 4EAMA 3CH9A 1JG9A 2WHMA 3VGEA 1B3WA 4XZWA 1DWIM 2FHBA 2OYLA 4UTFA 3VX0A 1OD0A 3AZTA 2X05A 1HKMA 2WLZA 4PCTA 3MUIA 5E6YA 3NUKA 3AMGA 4LYPA 4P8XA 4ZE5A 3TONA 4HA1A 4FMVA 2WZIA 4JL1A 5A6AA 1RP8A 1ZL1A 5EMYA 4W5ZA 2WCSA 1GOMA 5FL0A 1AQHA 3VOCA 1JI2A 4AZHA 1GQLA 1H0GA 1WO2A 3AMCA 1NH6A 2YL8A 2YOCA 2G3IA 1B3ZA 1W9PA 1E6SM 1J10A 4HP5A 3ZJKA 5I79A 1GQIA 3OGRA 2O92A 2W92A 5TD4A 1EHNA 3GH7A 1G94A 3W53A 1QNOA 4Y7EA 1FP9A 1OCQA 2VZTA 2WLYA 2EJ1A 5A6KA 1JNDA 1GNXA 3WY1A 1MQRA 1HVXA 5CZKA 1SFSA 4PTVA 3ZJ7A 1QNRA 4UFLA 3A6OA 3OLEA 3ZT5A 4JFWA 2Z1KA 4S3JA 4B16A 1TR1A 5HNNA 4PMQA 1MQQA 2IUZA 4MNJA 2XVGA 3D3AA 1L8NA 4MTVA 1B2YA 4WJXA 4UQDA 1QHOA 3II1A 4LQ1A 3ARSA 3AI0A 4TUFA 2J7DA 3SCUA 3ARYA 2BXZA 1KR0A 1R7OA 3DC0A 2BS9A 1XH1A 2O9TA 5DFAA 4P7QA 3N12A 2Y4SA 1JZ6A 3G6MA 4UR9A 9CGTA 2BNJA 1EO7A 2D1ZA 1RH9A 2JF6A 4W87A 1MFUA 4CN4A 5I77A 2NT0A 5HDRA 1HXJA 3PZUA 3ARZA 4W85A 4W86A 1JL8A 3RMEA 1CGXA 1G5AA 1K9FA 4UOQA 5JIWA 1MW2A 3O9NA 1LWJA 3WUGA 1KGUA 3SUWA 3WKZA 3OB8A 3CHCA 1L0PA 4CVWA 2ZWYA 3AOFA 3VX1A 5E6ZA 4TTUA 4P8VA 1C91A 5HPOA 3CUIA 2BHUA 4U2ZA 3ALGA 1Q6DA 4JKKA 4OZOA 3ZQ9A 1HF6A 4QDMA 1OM0A 4HZ7A 4AD4A 4AZCA 3I3EA 3W27A 3CHEA 3WFLA 2BVDA 1V0KA 1QW9A 2AOSA 2VI0A 3WEMA 4JFUA 3N13A 4EE9A 4MJ2A 4L4OA 3T09A 3WFZA 1BSIA 5CQ1A 4AIEA 5FIPA 1BGGA 4CU6A 4IUGA 1JZ3A 1QHZA 1UR2A 1CBGA 1KGWA 4GKLA 1V03A 1W1PA 3THCA 1HJQA 2E9LA 3VDHA 1HN1A 5CPTA 5DMYA 1GJUA 4CU8A 3ZM8A 1E6RA 2VVSA 2CBJA 2ZOXA 3MS8A 1CDGA 3ARUA 1N82A 4MPKA 3SCWA 4NI3A 4DWSA 4PMUA 2GJPA 5I5RA 1JXKA 1LWHA 2QMKA 2F61A 4V27A 3ZT6A 2Z1SA 2D0HA 1H4PA 1C7SA 3CHDA 4M81A 1QI0A 1XCWA 3EMZA 3WDPP 5BXPA 3NSXA 5C71A 2WHKA 1ZJAA 4J3SA 2WSKA 4U5IA 4Q7NA 1G1YA 2YL5A 1K9TA 3VIHA 1BYAA 4GQRA 4ZE4A 3HJEA 4J3XA 1TMQA 3AISA 5EFFA 1MVYA 5GQBA 2J7HA 3W81A 2A3EA 1JZ2A 1OT2A 2TAAA 1JF6A 3B9AA 2ZUMA 2DSVA 3PZTA 1PX3A 3UR8A 5IHRA 3FN9A 1A47A 1UZ4A 3K8MA 2GDVA 5D8WA 2WC3A 2CBVA 1B3YA 4PMVA 1VRXA 4KH2A 4QLLA 1CGWA 3WNKA 1M03A 2WANA 1QW8A 1GPFA 4NZCA 1C90A 1IZJA 1WE5A 2W67A 3LPOA 2E9MA 3AIBA 3W24A 1PZ3A 2J25A 3EDFA 5A6MA 5GPRA 2WHLA 4QP0A 3VDAA 5LA0A 2V5CA 1OGGA 1TA3A 1ZS2A 2BHZA 1K9EA 1WCGA 2CNCA 7A3HA 4WSJA 3OBAA 4HTYA 1QNQA 3NCOA 1H49A 2YLAA 1B0IA 2WB5A 3PZGA 2X0YA 1US3A 2WKGA 2BY3A 2E3ZA 4QLKA 1FHDA 1H41A 2D0GA 4QLJA 1CGUA 3VIMA 2YDSA 1D3CA 3CLWA 3S6TA 1R8LA 2CYGA 4P7LA 1Q6GA 3E1F1 4LGXA 2XFFA 4A4AA 4H8HA 1HL8A 3GM8A 1J0ZA 4RE4A 4HOWA 2WBGA 3L2MA 1OB0A 1E43A 2CESA 2XSBA 2VO5A 2ZUNA 3VMPA 4PEEA 2JIWA 2YBTA 4HA3A 4CD4A 2EQDA 4UQBA 2O9RA 3WBEA 1J0JA 2J8GA 3SUTA 1TVPA 2GJXB 2QPSA 4HMDA 1JAKA 1JFXA 2RGLA 2ZE0A 2E8YA 4FLRA 1PPIA 2G3NA 3PZQA 3EMQA 2W4XA 3NYDA 5CSYA 1K6AA 1KWGA 3AZRA 2WZHA 2OYKA 2J47A 2O9PA 2UY3A 3AHZA 3HMCA 4MDPA 3WF1A 5HXMA 3FHAA 2UY2A 4MNKA 2WC7A 3WQVA 3WUFA 4JFTA 2RGMA 3CTTA 6CGTA 2CITA 1W1VA 4JL2A 4HZ6A 2WMGA 4LPCA 3VU2A 2XSAA 3A4WA 3T2QA 4TVDA 5LA2A 2VQUA 2WW5A 4ZENA 1UA7A 3OLDA 1JIBA 1I75A 3ZOAA 4D1JA 3CPUA 1J0HA 1NP2A 3WN6A 3GZAA 4K68A 4OKDA 1R85A 5BROA 1BAGA 1QI3A 4C7GA 3T0DA 2XYLA 3B9DA 1V6UA 1ISVA 1MW1A 4OBSA 1PBGA 2VQTA 2DSZA 2E9BA 4M80A 1JNEA 4BF7A 1C7TA 4ZXOA 1J11A 1V02E 2D22A 3CUFA 5A2CA 3FY1A 3GDBA 3K8LA 4X9YA 4MB3A 2HISA 3IANA 4JFSA 2VUYA 4HOZA 4FLSA 3BSGA 1WNOA 2DSUA 3F5KA 4PN2A 1MWOA 1OBAA 3VM5A 2HVMA 4H04A 2VZSA 1DTUA 2WMJA 4DUXA 1GQJA 5BXRA 4H8UA 4MDOA 5D9NA 3PHAA 3CBWA 3OZPA 3TTSA 1C92A 3OG2A 4HU0A 3BAIA 2ZUTA 1EH9A 3L4YA 2ZXDA 1E73M 3WENA 4UQAA 2VRKA 4JCLA 1WZKA 2CBIA 3CUGA 2CHOA 3EDJA 3RIKA 5KZ6A 3NJ3A 3IK2A 5M3WA 1M53A 3WDQA 1E56A 1UR1A 2BXYA 4GO9A 2ZX7A
chains in the Genus database with same CATH superfamily
1HJUA 2AKMA 3VGFA 1K7XA 4GY7A 1ZENA 2G8ZA 5F1VA 2NQJA 1WDRA 3WLTA 2FHFA 1AZ1A 1XFBA 3WJSA 3ZXWA 3W7GA 2QIIA 2UY5A 1ZQ5A 2NZLA 2ISFA 4V15A 1POJA 4IISA 3OA5A 3KRUA 4ORMA 2XGBA 1H7PA 3JR2A 5F4WA 4DO6A 4MAZA 5A2BA 5I6SA 1NU5A 1YNQA 3L67A 3K46A 3KX6A 4IH3A 4W5UA 1XKYA 3VIPA 3WK3A 1FWNA 4MMWA 1Z48A 1S2WA 5JUVA 1K4GA 2GQAA 3ZLGA 2GQ9A 1W3LA 1XIJA 4EWND 3PNZA 4ORIA 3M43A 2VEKA 5IM51 3OIHA 4XBJA 2CZ5A 3VNJA 1H0IA 3T0TA 1K7EA 3RJYA 1QUMA 1V5XA 4A05A 3GW0A 3LGDA 4JICA 3HPZA 1ZAIA 1Q7QA 4AY7A 4W88A 2V9DA 3IV3A 4TQTA 1HJXA 1NWTA 2OCZA 2BSLA 1R47A 2BY0A 1XLIA 4IMEA 2JKEA 5BXSA 1X8FA 5TAOA 3STFA 5DANA 2FZMA 4HHLA 4V1YA 1GG1A 2Z2BA 3EEZA 2YZ5A 4QSHA 4PBFA 3ZZ1A 3P67A 1CCWB 2IMRA 2NSXA 2E4TA 2LLEA 1SMDA 5D9OA 5DXXA 4GY0A 4BI5A 4L56A 2DZAA 2VD8A 1T7LA 2C0HA 2NXHA 4QXIA 1BWLA 1GOXA 1PEZA 1EOMA 4JTAA 1OX5A 4Y9NA 3WMBA 2NXGA 1IHIA 1A5UA 5C7HA 2O0TA 5HR7A 3VXGA 4OTKA 4J5NA 4EXQA 4LS2A 2ZVRA 1DHKA 4MNLA 4E4UA 1OIFA 1GHRA 4O18A 2QV4A 3FA3A 3VKBA 3OJGA 3RO8A 4Z2GA 1CYGA 1PO9A 1CGVA 1UQZA 3NXFA 3TN3A 3N2XA 1KC7A 3EDKA 1PTDA 3A4XA 2CHNA 1TG7A 3PS7A 3W76A 4KETA 5AFDA 3D3FA 2PDYA 4LY4A 1HT6A 4L64A 4OUEA 5EL1A 3K4WA 4S3FA 5AYXA 3ZSSA 2QAFA 1JI1A 3DHFA 3EWZA 2VC5A 3RMJA 5CG0A 3B0PA 3N29A 4JTKA 4UFKA 2GOKA 3GDTA 1XINA 4R27A 2XN1A 1GVEA 2I1OA 2ACRA 1GZJA 1WUFA 4DWSC 5PTDA 4BI7A 3FVDA 2WVSA 3QXBA 4EANA 2CU0A 1XCFA 2BY1A 4P8UA 1DP0A 1UPPA 4PYSA 4BHYA 2CZVA 2V5KA 2WSRA 3I3DA 2X1IA 2Y85A 3BLDA 4GK8A 4YTRA 2GWGA 2PWDA 4M82A 5I2UA 1FOBA 1EF3A 4ZL1A 4IPNB 5CAKA 4D1IA 3VOJA 3L65A 3FAXA 1Q6FA 2Y61A 1THFD 2UWFA 3VCNA 2GVYA 4L6OA 1DE6A 4CNNA 4OIFA 4LF1A 4XD4A 4B9ZA 3SCQA 3MO7A 5A2AA 4DNMA 3NVTA 3VOHA 4AD3A 2EEXA 1UW9A 3GHSA 4GQ0A 2J27A 1HP5A 4HPHA 1JQVA 3B8TA 4FNQA 1ITUA 3RU8X 4N02A 1F3TA 1UP3A 1LQAA 2WHJA 4S3DA 3SN4A 5AYIA 2DH3A 4HU4A 2RHGA 3NURA 1J5SA 1CXLA 3WF4A 4Q4KA 2WM1A 3H55A 4IIHA 2A0NA 4M6PA 4ZSUA 4HSNA 1L6YA 1MUWA 4H2CA 4DI9A 3SUSA 2PMQA 4B5TA 3VI2A 4QNEA 2WM0A 1TWZA 3E6EA 4CUCA 1XICA 3L68A 2QUVA 1QOXA 4C91A 3RHGA 3RCYA 4ML9A 2C6QA 5HJLA 1ELSA 3DYOA 5KZEA 2WOQA 5AYBA 5LKYA 2YSWA 1EJ7L 1B1YA 4BA0A 1LL7A 3RG6A 5FAJA 1QASA 4POCA 4FR1A 2A4AA 4B15A 1V93A 1HP4A 2ISDA 5EY5A 3BSHA 4KFOA 3C0QA 3TZNA 1KBJA 5FCZA 4ACZA 2X09A 3AMDA 3MV01 1B30A 3S5ZA 4HGXA 1WQ5A 4I9AA 5AC7A 3ZVHB 3CL6A 3MUAA 3PAOA 4RE3A 2BGSA 2CWXA 5AN7A 1WKDA 2ZC1A 3MSGA 4F8XA 3W1PA 1Z8AA 4JX4A 3DGRA 1EUAA 4IGMA 1FWTA 2NUYA 1XCXA 4DF1A 3G18A 3C2FA 5I3FA 2ONEA 1UIOA 1CLKA 1MW3A 1V79A 1LDCA 2OFJA 1T40A 5I23A 4BF5A 1T8QA 3QHNA 3UETA 4FF5A 2B31A 1EJRC 1PTGA 1QVBA 1CZ1A 4CD8A 4X22A 3QSRA 3OOQA 6ALDA 1C8VA 3IGUA 4UFIA 1JYXA 4I3GA 4PUEA 1NJJA 1ME8A 1JZ5A 4NQ1A 1WDPA 1YTKA 2PDKA 5C70A 3WDIA 2F38A 1Q8JA 3EBVA 3BV7A 3H4XA 4XISA 4MB5A 3I6EA 4C1KA 5AKQA 1PJ9A 2RDXA 2ESCA 2BTMA 4AISA 5CBBA 3CYJA 1SZEA 3VNYA 3VOIA 3WLSA 3KWXA 5D04C 1K02A 4O8RA 4GX8A 3UU0A 3W1XA 1FH8A 1U33A 3DI1A 2CKSA 1UASA 2INFA 3SURA 4LEFA 3ECQA 2ODOA 5EMKA 4HIBA 4UR7A 3UR7A 4X0NA 5LIXX 2O7SA 4V1XA 3P2VA 3L5MA 5BU9A 2YDRA 3ONBA 2W61A 4UZUA 1KR1A 3TJ4A 3M7SA 4IM4A 3W7EA 4HN8A 3EZ4A 2FTWA 3QSTA 1XL9A 3N2BA 2DJXA 2V68A 5CZTA 4PB5A 4AH7A 1P43A 1TVNA 1RD6A 2WC4A 1Q65A 3PUDA 1C29A 4S3CA 2J75A 1ZHAA 3W1MA 3V5FA 5FF2A 3QHMA 5HOSA 3LBMA 3CMFA 3TTQA 4TVUA 3M0HA 6TIMA 2VX6A 2HPMA 5K4ZA 3G77A 4HSHA 1GVYA 3M0IA 5C2XA 4PFMA 1FWDC 2Y70A 1DXFA 1W8GA 5AYZA 1WXZA 1QI5A 2WXDM 4PB3A 3LI1A 4MOZA 1CXKA 4GG9A 1R3SA 3LN3A 1EJVC 5A69A 1EYWA 1W9VA 5BW6A 2KZHA 4R33A 1O68A 3SGZA 1NQKA 5CC5A 1IEVA 2TODA 2QMJA 2XU2A 1IGWA 1W5MA 3RJXA 4BWLA 2EGZA 1F7BA 3CUHA 1JPMA 3QTGA 1E9IA 2HNHA 1MZHA 1QPQA 4IXHA 4PUDA 4YTSA 3MMWA 3K8KA 3UGRA 2PE4A 3LA4A 4JIEA 3MW7A 3WLRA 4AHPA 3S9IA 1JZ8A 4GY1A 1TJ1A 3V16A 1YW1A 4NP7A 3TX9A 3TQVA 4OHQA 4LS0A 1Z42A 4O1EA 2IKGA 2Z1XA 3CZGA 3MYOA 1P4CA 2A7RA 2WBKA 4S3GA 3CV2A 3HQOA 4OT7A 2A3HA 4XSLA 4IIEA 3T08A 1HTIA 3CUJA 1XLBA 1T96A 3W25A 4FX6M 1SUXA 4OV9A 1OSEA 3ARVA 1JCXA 4KESA 1E55A 1TPC1 3ALFA 1XDJA 1LOLA 2VGIA 1PUDA 2FVKA 4XG1A 4RNFA 1J6OA 3ZJ8A 4DZ5A 5H8PA 1W17A 1OX4B 3DI0A 4PL1A 3I7RA 1M5WA 1DORA 2W6RA 2YCIX 4A29A 1RK6A 5A1AA 4MNMA 1R3WA 4PMRA 4XV0A 2CLMA 1FA2A 3V0UA 3MP3A 2PGWA 4L9XA 2W63A 4ZA0A 3IJIA 4L6DA 4LEQA 3VMNA 1GTEA 3BLLA 5JBFA 4QITA 2IQDA 1SQ7A 1V4YA 2PP0A 1D2KA 3WEZA 3P80A 3LLXA 4Z2KA 3Q4DA 1TV3A 2G96A 3M0XA 4C6CA 2OXNA 3WELA 4RE0A 1UD2A 5H1WA 2GL5A 3WQ4A 4DYKA 2H3BA 1DTNA 3HM7A 3RUBL 3PBGA 1Z41A 2CFFA 1XIMA 3VAVA 4RNJA 2C18A 4EKJA 1TO3A 1DV7A 1DXIA 1UOKA 4ZQCA 3HF3A 4J27A 1NF0A 4C6FA 5LIKX 2TSYA 5DEZA 1WPCA 5E93A 3EA1A 2ZUUA 3L9CA 4H6QA 4C6PA 1CENA 3NZGA 3ZR4A 1LRTA 3EX2A 3H23A 3A22A 3GNPA 4HYRA 3CWOX 5GJMA 3VD9A 1FH9A 2V3FA 2GUUA 1I0DA 1EXPA 3M5XA 1MW0A 1O6IA 3H2OA 3UJRA 3E0VA 1D8CA 5D9PA 5A95A 2OSYA 1W3JA 2VX7A 4BEUA 4FXRA 3SJ3A 1CI1A 5BOFA 4ATLA 4BKNA 1ZFJA 3S42A 3L4XA 3M41A 4B4FA 5EA9A 1UHVA 4DJFD 5H91A 3XINA 1QJWA 1DVJA 2PZNA 2ZC8A 1CXEA 3UWVA 4GI6A 3OA3A 3R12A 1FP8A 3SCSA 1TTPA 1EQCA 1A49A 1MI3A 1IXPA 3DESA 3J7HA 2FH6A 3NOYA 1US2A 1FWFC 3CHVA 3UEQA 1S39A 2Y88A 3AYRA 1E1EA 1U83A 2DIJA 4ZQPA 4WSKA 4PRWA 1BQGA 1WKEA 1FWEC 2XIMA 4KEVA 2OWCA 2ZYFA 4MPQA 1GEQA 1KQZA 1UH3A 2HNEA 3GVRA 3GTHA 2RDTA 4CN6A 5CPSA 4C1NB 1I0BA 2YDQA 3A64A 1VPYA 5AYYA 5JH1A 3CUZA 1AVAA 4KGJA 3BH4A 1R30A 1VKFA 4MUPA 1NOFA 2REQB 4Z1CA 2WQPA 3E0FA 2ZX6A 2R1PA 4GYFA 3WH9A 4XTIA 4RDYA 4GXPA 4IIBA 1WV2A 2C13A 3CZLA 1V02A 2OOFA 4MB1A 5M2FX 4DUVA 1BWVA 1YDNA 2Z26A 3DYMA 4GACA 2ZADA 3H24A 2RUSA 3LMZA 3FAWA 1UWQA 1M1BA 2Z28A 4M7TA 3CB3A 4G1NA 3GWQA 3RITA 2VGBA 4KWVA 2W66A 4CU7A 1A5CA 1VBJA 3H22A 1AQMA 2OKOA 5FF3A 5GNXA 1EUNA 1A3HA 5FJIA 1RBAA 1D3GA 4GYKA 3S5OA 1K77A 3CNYA 4E2DA 4AX7A 1SW3A 3AWNA 1E40A 4F3HA 2DIEA 1Q7MA 3IJDA 2G3MA 3KHJA 1N8FA 3IK4A 2P8CA 5MHBA 5I0DA 5G4HC 3GR7A 4NNCA 3LHZA 2QVHA 3GU1A 4OFCA 1Y7VA 3HGJA 1XQLA 2J8TA 4AXNA 5FESA 4B91A 1XYFA 3NFUA 2PWEA 2D0FA 1KFWA 1HW6A 3OHIA 4GVFA 3CZEA 2RJHA 3TR2A 3U7BA 4HB7A 3MKKA 3W7PA 3GAYA 2ZX5A 4UTHA 4R9XA 1UWTA 3DOPA 3N4EA 1DIDA 6ENLA 2R1LA 3P5YA 1FWBC 3OP2A 2QZRA 1XYZA 2C1GA 3U48A 4IL0A 3B8VA 4KRTA 4NRRA 3SUUA 3N14A 1XH0A 2ZE3A 2E25A 4KWOA 3KOZA 1A4MA 2B7QA 4Q8NA 3WLKX 2ZIDA 1DHPA 1VPXA 2OO0A 3GW3A 3RR4A 3VUPA 4G7EB 3RCMA 3WMLA 5I3JA 4JTQA 1O60A 1ZP3A 1OFOA 4O52A 1MRAA 5J5RA 2AL2B 2HS8A 7ODCA 4ILSA 5A6JA 2PF8A 3W2NA 2OT0A 5F2MA 1JAEA 4L9YA 3RM8A 2Q8XA 5FOOA 2WQDA 3UWQA 5HJYA 3W7NA 4HZ8A 3VDCA 4EIVA 1H63A 3NQFA 2H8XA 4QAWA 1W2PA 5D33A 1AJ0A 1EZ2A 3T0AA 3W70A 5J8LA 2OG9A 1S5TA 1R5YA 2QGYA 3BW3A 1NDZA 4HD5A 2FLIA 1WDWA 4A8LA 5AC4A 3W29A 1F8MA 3EB4A 2I5GA 3GXDA 3NQDA 4DJFC 3HPSA 4IGNA 3GYEA 4PR4A 1SR9A 3O16A 2TMDA 1Y65A 4GIAA 1GQNA 2ZXAA 4FOJA 4TV5A 2VD9A 3LRLA 4FOKA 2HJPA 1KM3A 3KEHA 1V3MA 3WLNA 3QC3A 1I8JA 2PP3A 1PX4A 1W31A 4FNSA 1E9YB 2OZ8A 1Q8AA 4DXVA 2X41A 4YTTA 3NZPA 1R3QA 2XIBA 4YVXA 1P0EA 1NM9A 3CZ8A 3C2EA 3N34A 1Y5XA 1DL3A 2ZRUA 1XPYA 2A2IA 4Q3MA 3RU6A 3GY1A 1XX1A 2HE5A 5K9CA 3ABRA 4JTJA 2NX1A 3CB8A 1MXSA 1ZGDA 2OZ3A 4LUYA 4H01A 4LCRA 4ZGYA 1IXNA 3UG5A 3CQJA 5CBJA 1PIFA 1VPQA 2MANA 4MYAA 3GBDA 5HINA 4PMDA 2AAMA 4LYRA 3SADA 3UA4A 3O8AA 3LTPA 5E9AA 1A80A 3PZ9A 1YYAA 4B3LA 4O13A 3IV8A 1EJUC 4NJJA 1TIMA 4IG2B 1FFRA 2I9UA 4DJEA 2GJRA 3KCJA 3BE7A 1FFQA 4V28A 2DSWA 2YJQA 3CEUA 2NLIA 2F2HA 1V6YA 3KZSA 1O1HA 3HMJG 1FDZA 3RPMA 4CD5A 1B4KA 4QISA 1AA1B 3GHRA 4AD2A 2NVDA 4LB3A 3LK6A 4YHGA 3LUTA 3UXLA 1JEZA 4ML4A 3LCIA 4MADA 2QJMA 1AQ0A 2VT0A 4DBWA 2G50A 5A6LA 3LV6A 1MSSA 2Y5SA 3RK8A 3DUGA 4F48A 3GG8A 5I24A 3MANA 3TQKA 4U33A 1ITXA 3CV6A 4K7YA 2HMCA 3WH5A 1GT8A 5FSDC 4QFUA 4AC1X 2O55A 2XVPA 2HXTA 1LRQA 3WLOA 4EP8C 4WF7A 4YVVA 3CO4A 4C6EA 4W8AA 1NVMA 2E09A 4H7CA 2XZ9A 4I5RA 2ZWZA 3LNPA 5HQMA 1TTJA 1NWSA 3KDOA 1UR8A 4UTWC 1C3FA 3N2CA 4M29A 2GUBA 3WH7A 1OGBA 1XLFA 3C4UA 1R3RA 2PWGA 2GK1B 5C55A 1TB3A 3V0TA 3G24A 3MP5A 5J04A 3UZWA 1TMLA 1BF2A 4ATDA 2TRSA 3EB3A 1HVQA 1AH3A 5JVLA 1P5BA 3M1ZA 4HCLA 3W3OA 1J9YA 3D47A 4H6KA 4IL2A 1XFCA 1W1B1 3BGGA 2G37A 1IE7C 2R1NA 3IJ6A 3BGJA 4OBRA 5CGQA 1QHPA 2NQZA 1LL6A 1P6CA 3UG3A 5DF0A 4EAMA 2HSAA 3CH9A 1L6SA 3TMLA 3M0KA 1VYSX 2OYLA 1YNYA 3U4FA 2AL2A 4WXYA 4Q7IA 2CZFA 3NUKA 4LYPA 4YYFA 4JN7A 2G4JA 4WDXA 3KS5A 1F76A 1PZ1A 4W5ZA 3DKJA 3AU6A 4KEUA 4JTFA 4XVDA 3RR1A 3REQB 3UPWA 1H0GA 2X7WA 1PCKA 2G3IA 1B3ZA 1W9PA 1E6SM 4BFAA 2BP1A 3ZJKA 1GQIA 1REQB 2E5DA 4ADTA 1EFZA 3LEPA 3M9YA 1FP9A 4I8YA 3H21A 2QS8A 3H2FA 4DI8A 3ZJ7A 4UFLA 2PDNA 3OLEA 5CSSA 2Z1KA 3IVSA 2IUZA 3E12A 1VHCA 1L8NA 3QVQA 4WJXA 5T8GA 1QHOA 3II1A 1J4EA 3AI0A 1TPDA 1YTDA 3KTSA 4TUFA 2J7DA 3ARYA 4C6LA 2BXZA 1KR0A 5LIYX 1JULA 1WX0A 3U6WA 4NY2A 1F2JA 3VNLA 4MSSA 2YXXA 1PZ0A 2XIQA 3KM8A 3TWBA 5D2YA 3FOKA 3V5CA 3KS6A 3COTA 4F0LA 2BGQA 2D1ZA 4GGBA 5DMNA 2X1SA 1O5RA 1QT1A 1HGYA 1UMYA 1SU5A 5HDRA 1IR1A 3DN5A 4EXBA 1HXJA 3PZUA 2CLPA 3PWIA 4AVOA 4RZ5A 1XS2A 1LWJA 1DQWA 3SUWA 3PY2A 3OB8A 3WLPA 4QTGA 1P6BA 2CLFA 3VX1A 4TTUA 4XBKA 5DQPA 4FA3A 4I8DA 2OZTA 2E7FA 4HTBA 3O15A 1IEWA 3NQMA 3W27A 4EOUA 1TR9A 3WFLA 1V0KA 1QW9A 4JXCA 3GG7A 2PDXA 4EE9A 3T09A 4CU6A 4IUGA 4FXJA 1QHZA 1OFEA 2RKXA 4GKLA 3DERA 3R0DA 1W1PA 1XGEA 4DBEA 3PPFA 5CPTA 3PK7A 4UTTC 2VEGA 1E1CA 3ZM8A 3DG6A 2VVSA 5CZ0A 1VBHA 1N82A 3ANUA 4RR4A 3LNMA 4DWSA 4WVXA 3F2BA 4V27A 2Z1SA 1C7SA 3TFXA 3WDPP 1IIGA 3NSXA 2YW3A 1XIBA 5AHLA 1K3UA 4J3ZA 2QW5A 3VIHA 5D09A 4NL1A 4DAIA 3OTRA 4J3XA 1JPHA 4XQ6A 3VCRA 1MVYA 1VZWA 1AMKA 3GTIA 1OT2A 4YIWA 1JF6A 1PX3A 1NFGA 3FN9A 1D3HA 1UZ4A 5I03A 5G5IA 3LDVA 5D8WA 1NTHA 3GG1A 3LCHA 1W3NA 1VRXA 1POKA 1M03A 3NL6A 1XG4A 1LROA 3E2RA 4L4MA 5KINA 5XINA 5EKYA 4LC6A 1LLZA 3Q37A 2P53A 1R2RA 1PZ3A 2J25A 6REQA 2PGRA 4NAFB 4AU0A 1ZS2A 2CNCA 2BHZA 1WCGA 7A3HA 3CH0A 2BLEA 4WSJA 1ME9A 1M7PA 4HTYA 2YYUA 2DZTA 3NCOA 3THQA 1FKWA 3SGGA 2DQWA 3GNDA 1W5QA 1US3A 4FB7A 5LNUA 3Q67A 1P0NA 3H2CA 1UWAA 1K6WA 1TTIA 3FGCA 3MP4A 2F2KA 4DXXA 4P7LA 1G6CA 3ZFHA 4ERGA 3V3WA 1OCBA 2XFFA 1FKXA 1HL8A 4WDTA 4YLWA 2OODA 4GD0A 2ZUNA 3VMPA 3KLKA 4PEEA 4HA3A 4U28A 1VLIA 1J0JA 1WXYA 1TVPA 1KBLA 5HWJA 1JFXA 2KAUC 4RV3A 2QCCA 1DJWA 2GGEA 2E8YA 5CC3A 5FEWA 3KVLA 2G3NA 2VC7A 4UMBA 2W4XA 3NYDA 3BVJA 5CSYA 3AZRA 2WZHA 1U5HA 2OYKA 2J47A 4IQEA 2O9PA 5JMUA 2NVCA 1YPFA 4MDPA 1NDWA 4E6MA 3MHFA 3HB9A 3NGJA 2CITA 5D37A 4IMAA 4LVDA 4YWIA 2XSAA 2QULA 3HGRA 4HPNA 2V81A 1TPB1 4GE8A 3CL8A 5LA2A 4I6VA 3CWHA 4DBUA 2Q01A 4ZENA 1UA7A 4DELA 1JIBA 3WJXA 3QW3A 1XLMA 2QR6A 1UIPA 1R85A 3DKLA 5BROA 1P0DA 3DFNA 4C7GA 4FPSA 2XYLA 1JCNA 3QV9A 3TH6A 4ENLA 1YXDA 4OBSA 4H4IA 4NU7A 2FVLA 1PBGA 3JU2A 4M80A 4JIHA 4BF7A 1C7TA 1VCGA 2HBXA 4HVXA 1PYMA 3MHGA 1CX9A 2PDPA 2D22A 4GX9A 3GZ3A 3FY1A 3OW1A 4G5DA 1NAL1 3BTNA 2NV9A 1EGMA 3F5KA 4XBSA 1HGWA 1OBAA 3E9AA 3VM5A 1JUEA 4Y6GA 1ZLPA 2VZSA 1DTUA 1FCUA 3C2YA 3C86A 4MDOA 1ICPA 3ERPA 3CBWA 5JH2A 3TTSA 3AXMA 4DQWA 3BZGA 4HU0A 1HZYA 2ZXDA 5HANA 4JCLA 1WZKA 5KZ6A 3NJ3A 2ZA1A 3HG4A 5A5WA 1DJYA 5BOOA 3W7KA 5CJNA 4GIEA 2ZX7A 3IACA 4QQUA 1RXOB 4PMYA 3N9RA 3I7QA 5C9XA 4WKFA 5LIWX 1NARA 4C6QA 4LUSB 3CQHA 4H6RA 1GQKA 2G95A 2Z6IA 1GGOA 3PUOA 1C8XA 3DCPA 3DHUA 3NOEA 3NQ7A 4LSBA 1V3LA 4GQBA 3PPHA 2QUMA 1S38A 5HR6A 1MQPA 3WQ5A 7PTDA 1J2WA 1KFCA 5HNTA 1SSDA 3TU9A 4AD5A 3WLJA 3L4WA 4ZTYA 1E72M 2XIIA 3S1VA 3N9SA 1PV8A 3ARTA 1XW8A 3E0LA 1XISA 2F84A 4GJ1A 3KVMA 1OFDA 3F4NA 2WNNA 1TRDA 3AAMA 4LAOA 4LNCA 1TCMA 3AROA 4WIWA 5ABFA 3FJLA 4XO6A 4H7VA 3S2JA 3NDYA 1TE1A 3WX7A 1JDAA 3KAOA 2JEPA 3H6OA 1W5PA 3WQEA 5G2WA 2Q8ZA 3AS3A 1KLYA 3LPFA 4UFHA 3WLQA 1EA0A 1GW1A 2QNEA 3MJMA 5EMUA 4PCNA 1SR0A 4RV8A 4WD0A 5K2ZA 2HXUA 1LG1A 4XD3A 5C9UA 4N2YA 5IFPA 4NAFA 4M3PA 3N6QA 4TU1A 3KHDA 1CB7B 4UQCA 3GNRA 3RFAA 4Y90A 2ZKMX 1VEOA 2OZ0A 1CEOA 4GA8A 1C8YA 2VMFA 5CLWA 2GUYA 2D23A 3FV9A 3WJWA 3F03K 2AKZA 1QR7A 2V3GA 4C7DA 1XBZA 1NQ6A 5AHFA 4U4MA 1ZBVA 3IPWA 2J4GA 3I4KA 2XTKA 1PS9A 2J88A 5LYRA 2X8RA 4Z2JA 1NEYA 4N6EA 4X60A 1VFSA 3G1AA 3KL3A 2VP8A 3EDEA 3UZXA 3M44A 3QKEA 4QG6A 2FFIA 2GDUA 3L66A 5L6UA 1X96A 4C5YA 4LVAA 4INFA 5MF5A 1CPUA 4US5A 3ZVIA 3IIOA 4JKLA 4I9MA 1XXXA 5HJXA 3S47A 5TF0A 1PWMA 2DP3A 3QR0A 3B05A 3F4CA 2JGQA 2OWXA 4FIQA 4WJ8A 4KT2A 4WY0B 2J7BA 3AIRA 3THAA 1V7AA 4BEQA 4PBEA 2NWRA 8CGTA 3E5PA 3KBJA 4DJDC 2OLSA 5HNUA 5BYWA 3S9YA 2VCCA 3W38A 3W87A 3NQVA 2E8ZA 2C1IA 2HDJA 3LRKA 1HUVA 4NAEB 2ZZ4A 3NQEA 1Z9AA 1OZMA 4LCSA 1IT0A 3SY1A 3L4UA 2FGZA 4FLQA 1ZUAX 3H2MA 4AIUA 3ATZA 1UWUA 3B97A 3VZYA 1B90A 2J7FA 3YPIA 1J93A 1J6PA 1SO3A 1MXGA 4JPGA 3RRAA 3DFTA 1R9XA 3BJFA 4J3WA 2EKGA 3UXIA 4F0KA 4CLMA 1AMYA 1HO1A 3W1AA 1W3HA 1TQXA 2GVLA 4IFOA 2DZXA 1QPOA 1P6WA 1OF8A 4HN4A 4NYUA 2VZVA 4E0CA 3WJZA 3PZOA 3OLIA 1JJKA 3URQA 1XGDA 3SCRA 1TRIA 2PDWA 4GI9A 4A3QA 4CNOA 3MUZ1 4IOTA 2EG6A 3MCNA 4XAYA 4F40A 3BK0A 4XZHA 1KWKA 1GVOA 3CS2A 3DGBA 1YRRA 1WKYA 3IIXA 3WQCA 2QF8A 4KPLA 2CCRA 4O10A 4S3AA 4GC3A 1A5AA 3D5HA 1W2VA 3TN5A 3EPMA 5D2WA 4Z1YA 4FNRA 3TYUA 3RILA 2PWUA 4Z0JA 1HKJA 3M0MA 4YMZA 1EP2A 2Y7DA 1VBRA 3VM7A 2V2CA 3UG4A 1FWWA 3G5EA 4P2VA 2JALA 3P74A 2CLOA 4HYWA 4O4WA 1Y5VA 2ZXBA 3IJLA 3LS9A 2VFGA 1E5JA 1KV8A 4ZOBA 4A8RA 3TC3A 1X38A 3K4AA 3EGJA 4O4VA 1V3HA 2YX0A 1KFBA 4ES4A 2A6LA 4ICMA 5EMMA 5IDIA 1KKOA 3UD6A 3QMTA 1J5TA 5BNKA 2V5DA 1GVIA 4MIMA 1VFMA 3KWSA 4P5UA 2QV5A 3N6HA 3WDHA 3FJNA 3STGA 3EKZA 4AF0B 4GQQA 2FGLA 4N7QA 3VABA 2FVMA 1XDMA 4HSOA 4C7FA 2DZBA 4CNPA 5C9ZA 1DQXA 3NM3A 4E3VA 1G69A 4CN1A 1JYVA 4KWWA 3LU2A 3EOEA 3MB9A 5GNYA 3UWYA 2NXIA 1XYBA 4XAZA 3VMOA 2OSWA 4QCEA 1BPLB 1EX5A 1L2QA 1U2YA 1X7IA 4GO8A 3KOYA 1FCQA 2POTA 3WUBA 1E4MM 1Q5MA 3CXOA 3GDKA 3TEVA 3PJUA 4ZMGA 1JUKA 3RGTA 4JHOA 3FSTA 4AIBA 4H9MA 3HG5A 4M24A 2OGYA 2V3EA 3RLUA 4PODA 4MY8A 3H4WA 1O5KA 3MUXA 3AIUA 5A6TC 1W6TA 4ASTA 2GPTA 1RJRA 4Q4QA 1BVWA 4ZB0A 3MDUA 2QCMA 4PB4A 3SGUA 4GIRA 4YCOA 2R6OA 3FIGA 4D6JA 4HMCA 5CPOA 2D73A 4KRZA 1PL9A 4XK2A 5CPQA 1YXCA 4IICA 2QUTA 3M64A 2ZZ3A 4BY3A 2CW6A 1EC7A 2BODX 3MBDA 2C19A 4K7VA 1OVDA 4HJWA 1RR2A 1TVLA 1V0LA 2WVUA 3GKFA 3KVJA 4WY0A 1BXBA 4WQ6A 1GHSA 2CLIA 4QAIA 3UWEA 4FLOA 1DWJM 1TJRA 4PUKA 2XFYA 2XFRA 3H2NA 1EOKA 4GCAA 3SRDA 3T44A 4JIIX 4PEKA 4TMBA 1VEPA 2NW0A 1OC7A 2B4GA 4H9TA 2FDSA 1F61A 3S8HA 2IQTA 3MKCA 3WF2A 3F2CA 3IJ8A 4HNCA 5AC6A 2ACQA 4XKMA 1EPXA 4N0RA 4LOCA 3GXTA 5FJTA 4HU8A 2QXWA 3QGVA 3HV8A 2OX4A 4JN6A 1EIXA 3FNDA 3VD5A 3WFAA 4GUFA 3E2QA 4IMFA 1ZJBA 5GVJA 2DVUA 1OHLA 3R1ZA 3QMSA 4I9TA 3CZKA 5FJRA 1K03A 3DG7A 1NY1A 3QQ1A 4ZBCA 1E6ZA 1IR2A 3HPAA 1JCYA 4FX8A 2P50A 3BCFA 3KDNA 3VE9A 4UQ9A 2HROA 3K1DA 5LNRA 1LT8A 4F2TA 2TYSA 4RPQA 1YPIA 3W73A 2PGEA 4XZMX 4GYPC 4A35A 4NT0A 3BICA 4XVEA 1FHVA 4JZ5A 1NOUA 3NM1A 3OGSA 4MZ8A 4GISA 4JCMA 3BC9A 2WK2A 1GJWA 1KBBA 2B0MA 2PC4A 5E0KA 4N4PA 4XUYA 3QM3A 4CCEA 1TZZA 2QCEA 3E2SA 4GGHA 3W6MA 3UVIA 3IRSA 4XUGA 1QMLA 3F4DA 3FHQA 3GR8A 2Z27A 3TQ0A 3G22A 3BZJA 5DBTA 1FBAA 4LYQA 5I78A 1RPKA 1DYSA 1X1OA 1XRFA 4FIRA 1UKOA 3AIVA 1D8WA 4RZBA 4AQLA 3ORWA 1B57A 3IRDA 2YGYA 4XB3A 3VDBA 2OWWA 3CGTA 3AS1A 3P7YA 2E5CA 4WLCA 2WSQA 4O54A 1Z69A 1VFOA 4I90A 1UUOA 1IIHA 3A5FA 5FD0A 2QF7A 3CIXA 4ERAA 1OIMA 3KCOA 4G2DA 4ZQOA 3B40A 3OBEA 3OVGA 3G8RA 1ZAHA 1SM9A 1J18A 2V3DA 4U10A 2F6XA 3A23A 1LG2A 4JY8A 4IMDA 1IZCA 1UP0A 4GVHA 4MJMA 3T2OA 1KM0A 3MV11 1R3YA 4AF0A 1XIEA 3QFWA 3LX9A 3UGVA 4JTUA 4W93A 4H9VA 1UUQA 4D8AA 3DX5A 5RUBA 1RAKA 4J2PA 3OZMA 1A0DA 4HCDA 1RLCL 2NT1A 4UTWA 4X9SA 1UQYA 4JX6A 2X1RA 5GJPA 5REQB 2QIWA 3BLOA 3ZR6A 3GTNA 2IXVA 5D4YA 1E6QM 1VJSA 2D2HA 2PI6A 4CEUC 2PTYA 3VFCA 2YL6A 4S3KA 4S2CA 2QCGA 1XRVA 3FA5A 1OG0A 5I02A 3ARXA 3W6LA 3AXXA 3DFHA 5EFDA 3VKDA 1S2UA 1DWAM 4DJED 3IGXA 1W5NA 5JBEA 3N6JA 4IGHA 1H50A 1TUFA 4NF7A 1NP0A 3EA2A 1UR0A 4CQ8A 2PZ0A 3N15A 1A5KC 3GBEA 2XHYA 4P7OA 3Q58A 1LOQA 4Y9AA 3SBFA 2X7VA 1S2AA 5CAHA 3A13A 3IUDA 2JF7A 3O6CA 4KFNA 4F79A 1V77A 2Y1HA 3GXMA 2IW0A 2VTFA 4GKTA 1R3VA 3BUVA 1YQ2A 2VNCA 2XWEA 2W91A 1UYQA 1H62A 1C9DA 1EJTC 1AUSL 3SCOA 2FZBA 3EWXA 3WZ0E 1WBHA 3TYBA 5TBOA 1KGXA 3HPFA 4B5XA 2WVTA 3WQFA 1O7AA 3I68A 4XAFA 1BFNA 2NX3A 3SCNA 5I3KA 4GVIA 3WQPA 1MXDA 8RUCA 1KCZA 2BFGA 3APGA 4TXEA 4GI8A 1EWDA 2GLKA 4NZ1A 1UH2A 3A5VA 4NNAA 1YBQB 3LD5A 1EBHA 4IPLA 2Y7GA 4UIOA 1KLZA 1AODA 2BV9A 1IZKA 1G4EA 1M6JA 4RDZA 2A85A 1OJXA 1E0XA 4JQAA 1CLXA 1DJHA 4H8VA 2HQAA 3KW3A 3U2OA 3GU9A 3UF9A 1SO5A 3R10A 3PSVA 1E3XA 1TV8A 3CPGA 3FYOA 4DBDA 1MDRA 3H54A 3NDZA 2QLYA 5HUOA 3P6LA 4B5SA 1KRCC 5E70A 4EK7A 1YADA 1KXTA 1KBKA 3N2MA 3QHOA 3SCPA 2PODA 3WH8A 5HNRA 5E0CA 2OEMA 1T41A 2DQXA 4Z08A 4QCFA 3L4VA 1CWYA 1ITQA 3JW7A 1LUCB 4GH3A 5KSWA 2PBOA 3TE9A 5A6BD 4KCVA 1W3TA 1KXHA 3AXKA 3CMGA 2YCEA 3ZJ6A 2DVTA 4OOUA 4D8LA 3KBSA 4NZ4A 1CXHA 1YPXA 2WV8A 2DH2A 4MHBA 4N9DA 1XSKA 4L1GA 1DWFM 4QRNA 3AS2A 1YDVA 3W1UA 4LRTA 2BXVA 2XFWA 4PL2A 2W62A 5JBDA 1TUXA 1F07A 3TROA 4H41A 2VX5A 1Q3NA 2EHHA 3ME3A 3MMDA 3BAYA 4BI6A 8TIMA 2IPFA 4CNSA 1SZFA 3R25A 5FKYA 5I3GA 2Y89A 3MJYA 4H1ZA 2CLLA 1BTCA 1YNPA 2DGAA 2XN0A 1W5OA 1IEIA 2V82A 1A53A 1OCNA 4KWUA 4Y96A 1VF8A 1L2UA 1I6NA 2FTPA 4HK7A 4YVPA 1BEUA 1A3WA 1GKQA 3DG3A 1ITCA 2POZA 3RLVA 3C61A 1VBUA 4O1BA 1V6XA 3I65A 2JKPA 3K5XA 1UKTA 2ZA3A 3GVGA 1OF6A 3TTEA 4Q32A 1HJSA 2YFNA 1V0NA 1OT1A 3WLLA 1VFHA 3ISIX 4UNIA 3H26A 3CQIA 1E3ZA 4D6EA 5AC8A 1VAHA 4YHEA 3NWRA 1AJZA 4M0XA 1R46A 5I3DA 3U2CA 2FPYA 3DHPA 2F6KA 1G01A 3FW6A 1GOKA 2PTXA 3PWAA 3JVAA 4XKYA 4IT1A 4IX2A 2P3ZA 2E1WA 4PA8A 1ZY9A 4P7RA 3L4TA 4PRTA 3FKRA 1WA3A 2VCBA 2NWSA 2E6FA 3LHUA 5LHFA 1H2JA 3UJEA 2BVWA 3RLHA 4ZZ9A 3HFTA 3PTMA 1JCLA 7TIMA 3B03A 1PHWA 2PWVA 5IRPA 2QJIA 2IPWA 3IAQA 3L2IA 4MVAA 3NEVA 1TJ2A 1UZ1A 1RJQA 4H7ZA 4ZO9A 1ONWA 4IQDA 3RRXA 4AEOA 3A4AA 3ZO9A 5ABEA 3GXPA 3K30A 4H9ZA 1F6PA 1X6LA 1GOIA 1UD8A 1ISWA 4GUHA 1F05A 1KNWA 4DF2A 3SZ8A 2A21A 3TW6A 4YN5A 3POCA 5M17A 1RHCA 3NQ2A 1VYRA 4Q8MA 5F2GA 1W1ZA 4XTDA 1XM3A 1YEYA 3KUMA 4Z42C 5T9BG 4AC7C 3C2OA 4DWSD 1EO5A 5G1MA 3GNOA 2QPXA 1Y5WA 3N9KA 5JQ9A 1HNYA 1E6XM 2VRJA 3U8GA 3GUWA 3IAPA 1F6KA 1RBOB 1RA5A 3E02A 4MKSA 3WCZA 1KTCA 3MT1A 4IXXA 3QQWA 7REQA 4LBSA 1T8XA 2Y2WA 4Z2HA 4JHZA 3PM6A 1BHGA 4GZIA 3W84A 1JGMA 5CCZA 1R7AA 3TNBA 2A7NA 3B9OA 1FVPA 3DH7A 2QGHA 3EEGA 2PUZA 4NSBA 5AB3A 4V2XA 4LFYA 5K9XA 2AL1A 1UR9A 2PSNA 1WP6A 1BXCA 2ZRVA 3GVVA 4Q33A 3O2LA 1BF6A 3EDDA 4TTGA 4MJ4A 4HPGA 2VOTA 2RDUA 2ISSA 2VELA 1YE6A 1WOBA 3MC5A 4CNUA 4AFYA 5GNZA 3SRKA 3TA6A 4HMEA 1RPXA 1LUCA 2PDFA 1ZJHA 4LBRA 4N9CA 3GFXA 3LQGA 4LAKA 3VD4A 2WNWA 1E4LA 3W7RA 2YYTA 4OJYA 3FYYA 4JNZA 2VX4A 2NVAA 1JPIA 3W7MA 4ZB2A 4E8GA 3EXTA 3WBWA 2Q3RA 1GJPA 4JTLA 5E0FA 2Y5EA 4ZXLA 4JQ3A 4EVZA 1JXJA 3NDOA 3WMCA 2R1KA 3PUEA 2QDGA 4FZIA 2NUWA 1A5NC 3R94A 3ES7A 5CG7A 1TPFA 3HGSA 2AQWA 3D0CA 4ACZB 3SY8A 1JDDA 2YB1A 4PCPA 3CJPA 3VCCA 1QI4A 3FK4A 2MNRA 1WXJA 3KBNA 3GDLA 4F9DA 3VOGA 3THDA 3T78A 1NWUA 4GRSA 4C6DA 4PCSA 1W54A 3MVTA 3AMLA 3GTXA 2Z0IA 1BSLA 1FWCC 4R7WA 3WNOA 4IP5A 4UTKA 1TMHA 4PUJA 4YWSA 2ATSA 4GBDA 4XZWA 3TQPA 4UTFA 3C8NA 3VX0A 1OD0A 4O11A 2X05A 3ES8A 1AW2A 3MUIA 1JVNA 1AJ2A 3NPUA 4HA1A 2GSEA 1RP8A 5EMYA 4M1BA 4AWUA 7XIMA 4LVFA 3PR2A 3EOOA 1XI3A 2WCSA 4GYJA 4FI4A 2H90A 4JNYA 4IGSA 5EGRA 4FSAA 4AZHA 3KP0A 2FFCA 3TUUA 2YL8A 2IKJA 3QYSA 1W1IE 1U22A 3EKLA 1N7KA 4O19A 3OGRA 3IUIA 4DWDA 4JGDA 2O92A 3GFZA 2W92A 1LYXA 3W53A 4UCGA 4KBXA 2RJGA 1OCQA 5FAGA 2Z7GA 1F73A 2WLYA 1QXLA 2EJ1A 4GUGA 3SRHA 1GNXA 3WY1A 1MQRA 1SFSA 4PTVA 4JFWA 1TR1A 3FKKA 1W3IA 4PMQA 4JHMA 3VC6A 4MNJA 2XVGA 1UZHA 3KTXA 2OMAA 2I9EA 4LQ1A 3ARSA 5IDZA 4Y8EA 2RH9A 4WXZA 4RX0A 3O07A 2BS9A 5HA7A 2ASHA 2DZWA 1ML1A 4RCXA 2ZA2A 1QPNA 3O6DA 3G1DA 1C9WA 4UR9A 3SM0A 9CGTA 3LY0A 2BNJA 1XR2A 3UCCA 3UXAA 4GH1A 4QS5A 2JF6A 1JRBA 1K7FA 4CN4A 1BKHA 3M0JA 2NT0A 1O5QA 3PG9A 3M7WA 3UW6A 1XBVA 1JL8A 1CGXA 4EWJA 4UOQA 4W9TA 5JIWA 1ZJIA 2A3LA 3QPYA 4WDUA 3WUGA 3H7RA 1L0PA 2ZWYA 3VYLA 4A2RA 3N4AA 4J9JA 5E6ZA 4UUIA 3VK5A 4P8VA 3UG8A 1OY0A 3EOUA 4H9XA 4U2ZA 4JKKA 4OZOA 1HF6A 1OM0A 4HZ7A 4AD4A 4AZCA 2XH2A 3W1QA 4DZAA 3I3EA 3UY7A 3CHEA 3WEMA 2EG7A 3TYEA 4RDWA 2OTDA 4L4OA 2H9AB 1BSIA 4M6UA 4AIEA 5FIPA 1BGGA 4UBPC 2BASA 1CBGA 1KGWA 2P0OA 1V03A 1TTQA 1XLLA 4ADUA 1FCVA 3PBMA 1EC8A 3THCA 3CQKA 1HJQA 4LYKA 3B0UX 1GJUA 1EEXA 1I60A 2C3ZA 4JQ4A 1LBMA 2QUUA 4HHMA 5MKGA 3ABOA 4MPKA 2I14A 4NI3A 1FWHC 5I5RA 4DJDA 4XIAA 2QMKA 2D0HA 1YE4A 4M81A 3NNTA 2GDQA 5C71A 1ZJAA 4J3SA 1DIKA 4YS1A 1VQTA 4U5IA 4RXGA 2YL5A 2HV5A 4HNNA 1HKVA 3HJEA 3FVMA 5EFFA 3QV6A 1JCJA 4A8NA 5GQBA 4B92A 1OYBA 2A3EA 1JZ2A 4NUWA 3VKCA 3B9AA 2PPGA 5FEZA 2ZUMA 3GE7A 2Z00A 4Q4MA 1FWSA 4GJJA 3GXNA 5IBXC 4O50A 1JUBA 3Q2DA 2WZTA 3LENA 1XYLA 2CBVA 2GQ3A 2FGBA 4L6HA 2C79A 1CGWA 2W3ZA 3C8FA 2WANA 4FHAA 4PFHA 1RALA 3UJSA 3LXBA 1WE5A 3MCOA 2PDQA 2Z1WA 1TX2A 2R14A 3ITGA 3C56A 3RX4A 1IEQA 1XG3A 4HNUA 1TPWA 3EDFA 1KM1A 2WHLA 5LA0A 2V5CA 1TA3A 4FO4A 4ZB5A 4GOAA 1H49A 1KRBC 4US5D 1HO4A 5DMLA 1B0IA 1AQFA 3TZFA 2E3ZA 3EX1A 2KX9A 3LCGA 4QLKA 3FXGA 1FHDA 1H41A 3STPA 5FJJA 3LHTA 3F7JA 2YDSA 1D3CA 3S6TA 1O95A 1R8LA 2CYGA 1Q6GA 4EAYA 1X97A 2VEMA 4LALA 3T9PA 4IFRA 3C5QA 3S1GA 4ECLA 2WBGA 4WX2A 1OB0A 2XSBA 2G3FA 2VO5A 3P93A 2JIWA 4NILA 3WBEA 2J8GA 1VRDA 2GJXB 3TMQA 4XWUA 3B0XA 2QPSA 4HMDA 3E2VA 2RGLA 2VFEA 1PPIA 2QAPA 3PZQA 5C54A 3CM4A 1XIGA 2JK2A 1GPWA 3EMQA 5EU9A 3W7CA 2A1YA 3GIPA 1K6AA 1KWGA 1G4PA 5G4EA 4DO5A 1S5WA 4HZMA 2EAWA 3V1HA 3KOWA 2UY2A 2RGMA 1SW0A 3VE7A 4ONVA 3OYXA 1W1VA 2QT3A 1UPMB 4HZ6A 2WMGA 1SZNA 3V7PA 3CYVA 3VU2A 4ROPA 4TVDA 1H1ZA 2J66A 2FPVA 4WOZA 1I9CB 4MUZA 3CPUA 1J0HA 3WN6A 1BAGA 1I2NA 4HK6A 4ZR8A 1MNSA 3T7VA 3EKGA 3L21A 3UPBA 1DJQA 2E9BA 4PGLA 3TLQA 3LSBA 3GNNA 1J11A 3GSMA 4QDWA 3T8LA 1KFJA 4X9YA 4JFSA 4MM1A 3OIXA 3WBXA 4CCZA 1GYNA 1W1A1 3O6YX 2HVMA 3GC4A 4H04A 1EXBA 4D2JA 4ROQA 2PDHA 2WMJA 3ITYA 1S5MA 1P48A 5BXRA 4H8UA 2C15A 1LT7A 3OZPA 3HQPA 2ZUTA 2VRKA 1MEWA 1XKJA 3GRIA 3OYZA 4JN8A 3EDJA 3L0NA 4GIYA 2HVNA 3IK2A 2XGZA 2H9AA 3OPSA 4UMCA 5CC6A 2HS6A 1E56A 1UR1A 3SSZA 2YW4A 3URAA 3SCVA 1BVZA 3M46A 4IZGA 1MEIA 3MMTA 2IKHA 1D7KA 2VR5A 2QCLA 3WF0A 4REQA 3WK1A 2ADAA 2CEQA 4O57A 1FY6A 3DFOA 2Y62A 1CGTA 1QK0A 2J9YA 1VFUA 4YL2A 3HIJA 4G8TA 5DCEA 4JTSA 3BAXA 4FK9A 3TSBA 4MAVA 3WQ8A 3NL3A 3ZR5A 5CC7A 4HKPA 1S1RA 4HNVA 3AIWA 1BG9A 2X16A 2J24A 2NV1A 3BOLA 1UJQA 4FS9A 4MWAA 4K8EA 4Q22A 3LGEA 3NPVA 3PZMA 1VIZA 1PIIA 3AUOA 3GLCA 3U5UA 2AMXA 2IQ0A 1KCLA 1S2TA 5G2HA 1P7TA 3C3UA 4BR1A 1J96A 3ARRA 2ZRXA 5FF7A 1OFRA 1KFLA 3A12A 3NTYA 3TKFA 1XLGA 3EWWA 2ZRYA 5BOEA 1YHTA 1OG6A 2JKAA 4E8DA 1A5MC 3R89A 2PRHA 4IIDA 4R53A 5FJUA 1SO6A 3USBA 4PCFA 1HL9A 2R24A 4GYPA 1GCYA 4RZ4A 3TTOA 4P8WA 2XJ7A 3PBUA 1F3WA 1QPKA 5D05A 4RE2A 1Q6EA 3VNMA 3R58A 2QDDA 4P7NA 2J7EA 3MI2A 1ONXA 3W4RA 1MO0A 1SFJA 3ZMRA 4R88A 4WKAA 3BOFA 3S6OA 3G1FA 2VXNA 4JKMA 4U3AA 3PG8A 3SFWA 1HKKA 3BCJA 4F9JA 4JQ2A 2OSXA 5G2IA 3VTRA 3O06A 1H7XA 4JD4A 4AAJA 2E5BA 3S2MA 2D2OA 1EIBA 2G5WA 5IOBA 2Z25A 1EQPA 3GC5A 1QPRA 1OFBA 4Q4OA 1IQ8A 1X8CA 4Q8UA 2R1MA 4AZ7A 1A50A 2UV8G 1PTAA 2G4FA 2GJXA 3RN6A 4QE5A 1JZ7A 3F4VA 2CLHA 3HN3A 1W9BM 2D20A 1ENUA 1TE6A 4Q8QA 3QTPA 4U31A 3MUY1 2DW7A 3PFMA 3ITOA 3K1GA 4CQAA 3TYAA 3RPDA 4PMXA 3LPGA 3QC0A 1W9XA 4LRSA 4NNBA 2PDMA 3RM9A 1JPDX 1KTBA 4PTWA 4Z0SA 2Q02A 3W75A 3S1UA 4DO4A 1WZAA 3G1SA 3G1VA 2VEIA 3W0KA 1EEPA 4R34A 2ACSA 2PF0A 5EBUA 1LL4A 1XSJA 2PDCA 2XVKA 3USZA 1E5NA 3CPRA 4KMQA 4CEXC 1JCTA 4EXAA 1PXGA 4HJFA 5D2TA 3P61A 4BQ3A 3P3BA 2OELA 2WMFA 1CGYA 3ARWA 1MFVA 3G0SA 3WQ6A 1XYCA 3W07A 3BARA 1GVFA 4WK9A 5A3HA 4ADSA 1MUCA 2J77A 4JIPA 1UH4A 3NA8A 4Q4RA 4ZO8A 2WPBA 1UP2A 1LM1A 3S0CA 4Y9MA 4AEEA 2QCDB 2P1FA 2WVVB 1RY8A 2DZUA 1V08A 1FDYA 5CSRA 4W7WA 3VZXA 2J79A 3P0XA 1AL8A 2A79A 3S6DA 4BCEA 1WKFA 3CIWA 4S39A 4AD1A 1M7JA 1ZZMA 5CXPA 1W0MA 4C6IA 4D6HA 4Y9PA 1W3KA 1Q2RA 3LTYA 4IX0A 3U9IA 3KRZA 4PUMA 2Z1VA 1HL2A 1XF0A 2OEJA 3OVQA 2VR2A 1X1NA 3R6IA 5A94A 4FP1A 5DXYA 4GFSA 4MWAE 2PLMA 1BXNA 1UD4A 3IJQA 1SPQA 3SIMA 1U5JA 2ISWA 3GXFA 2WCGA 4R3UA 3S2NA 4XAPA 4EF9A 1Q45A 2QDHA 2V6AA 3GAKA 3OBKA 3P8IA 1GG0A 3AFBA 1EDGA 1S3TC 5G1YA 2Y8VA 1EWEA 2GOUA 3AHXA 3WDRA 3RDKA 5D2VA 5AY7A 3HURA 5HMDA 4B4HA 1JDCA 1ECQA 5M5DA 4NVTA 1OYCA 1PDYA 2FHCA 4R5EA 1XQKA 3VUSA 3EYPA 3NO3A 4LW7A 3QF0A 2XM1A 1W32A 2V69A 2FH8A 1H11A 2X42A 4KCWA 2R91A 2DU2A 3OEXA 1S2VA 3UZYA 1U5VA 2UY4A 4ZOEA 4DM2A 4JYEA 2OU4A 5CH9A 4H6EA 4W8BA 3P82A 3NVDA 4WZHA 1XLJA 1NF7A 1PWLA 2OGJA 2Z1BA 2QJJA 2FKPA 1KCXA 3R11A 3EXRA 4IFKB 2VDHA 3W85A 3QMRA 1T0OA 3RX3A 1XRSA 4LX4A 4K8HA 1U30A 1IWAA 1JDEA 4GC4A 4BQ2A 3ZIZA 3JZUA 4AIOA 1AD4A 3HA1A 2FZ8A 3R43A 3OLGA 3NIYA 2YCLA 3BLPX 4H9UA 3CC1A 3M16A 1JD9A 3BG5A 4ZFCA 4S38A 1I2PA 3DDMA 4AY1A 2DT1A 4PULA 1DJZA 1O12A 4PUNA 2XDFA 1PVNA 3L5AA 1FDJA 1RJPA 5C2GA 1JYNA 4O12A 1J0YA 4WKHA 2D2JA 1RBLA 1EYEA 2PEVA 3SIZA 2PDIA 1LP6A 1M9HA 2VC9A 2R9RA 4H83A 5HMSA 1GEHA 2JE8A 2P0IA 2FPTA 3W22A 4MFDA 3WBYA 4C6JA 3B8SA 3S46A 4BQ4A 1Q6CA 1BQCA 1A0EA 3WJYA 3OZOA 1R86A 2H3DA 2WKLA 3BG3A 4FXFA 3WQOA 4RUBA 1EPVA 1IV8A 1JRCA 1TWWA 3PZNA 3VVGA 2VL4A 4MLJA 2DZVA 2VENA 3QW4B 2YR1A 1U1UA 3NR0A 3WD2A 4EPBC 3NQAA 1R2TA 2DT2A 4HHPA 3N11A 3LRMA 4W7UA 1ZBWA 4UOZA 3WL0A 2D2GA 4XZIA 5CZJA 5CGMA 1QNSA 4HNLA 3M6DA 2B7PA 3W00A 3LGGA 4JTGA 1F6YA 3WSUA 1JPKA 2OR2A 3O3RA 2QCDA 2WVVA 4PMJA 3IARA 4JDYA 4TO8A 2R8WA 3BAKA 1XUZA 3PBVA 2PDLA 1E1CB 3GHTA 2EBNA 4C60A 1JD7A 2L5HA 4W7VA 3LOTA 3LXCA 4O28A 3Q45A 3SFKA 2GSJA 4DWSB 3QLLA 1RP9A 1DE5A 1VJIA 3ZS4A 4LV9A 2J74A 4LS1A 1UA3A 2EO7A 3PZIA 4D9PA 3GDMA 2HTMA 4Z1AA 3H7VA 1WAWA 4J7RA 2P88A 2V2DA 3T1GA 3WIJA 4AXKA 3VINA 3HGOA 1L6FA 3QLDA 3G0XA 1F3EA 4AWSA 1VR6A 4AZIA 4Q8OA 4PTMA 4D8ZA 2PDUA 3SQMA 1K1DA 1PZ2A 1N2VA 1TWIA 3W83A 3CUXA 4IIGA 2PRLA 3ONCA 3U2EA 1R2SA 1AK5A 3S5YA 4TMCA 4GWEA 4X61A 1C8QA 1DBTA 2YKKA 3P8JA 4AZ6A 3BO9A 3GVQA 1RQEA 1I4NA 2CXEA 3NSMA 3EWUA 3U4AA 1IYXA 4K8GA 3OODA 1WB0A 2XWDA 1S46A 3EX3A 2VGFA 3GR4A 4H3DA 4RW3A 4UWMA 3L4ZA 4PTXA 4C6KA 4O1DA 1SJBA 4ALDA 3E5BA 4N9BA 2O4QA 2E40A 3IGHX 6REQB 3CAKA 3AIEA 1TV2A 2E0PA 4PMNA 4BS0A 2YDAA 5A6BA 1WYIA 4DUWA 2BWGA 4H2HA 4WHBA 1LWIA 1XLEA 2X40A 1IWBA 3EWDA 1CIUA 3GHUA 1DIEA 4QROA 3L23A 4QM1A 2FB2A 4JIRA 3LYEA 5LGZA 4E2VA 1T5AA 3QY8A 3RXZA 4ZOAA 3WL1A 3FGCB 2YLLA 2HCVA 4RK8A 1XDLA 2GVJA 3LMYA 2YBVA 3UERA 4XZLX 1EKOA 3TNOA 4IFKA 3F5JA 1R0MA 1H7WA 3GH5A 3TTYA 3G3DA 4GBUA 1VH7A 3T07A 2ZQ0A 1YKWA 7CGTA 4U2YA 1B3XA 3EXSA 5LZLA 1E70M 1W1YA 2FQIA 2C8NA 1TELA 4HA0A 3BAWA 4TIMA 1V3KA 3WBAA 5C2CA 3VGGA 2V8ZA 4OOZA 1H3GA 1K9DA 3W37A 3NL2A 4QR6A 3QYQA 2VFDA 1CXIA 4HA4A 3AUJA 2E28A 4UCFA 3UNDA 3K2GA 2DT0A 2GYIA 2X1TA 3W2UA 2CZEA 5DMMA 3WNNA 1QWGA 5LGXA 2DZSA 4LXFA 1X6NA 3LBOA 1YTEA 1SO4A 3WQDA 1G0CA 2H6RA 4GUJA 3W72A 3TC7A 1HKIA 4N42A 1ZU8A 2BY2A 2BVTA 1Q6OA 1FTXA 3N3MA 4Z2LA 4K6AA 2ACUA 3M5ZA 2G3JA 2ZUSA 1TSIA 1TYGA 2VDIA 1V51A 1TPVA 1JR1A 2ANUA 2CHRA 1OC5A 1W56A 3WLMA 4LUTA 2OLHA 4YNGA 3BL3A 1A3XA 2PD9A 4F66A 1B31A 3PAJA 2XM2A 3NO1A 1MDLA 1GYMA 1H7NA 4NKCA 1I2RA 1LOSA 4D6IA 4FEZA 5H8UA 1GUVA 3WNLA 1ZALA 4UTMA 3PF3A 5B7ZA 1R6WA 5CZSA 4KF1A 1M3UA 4BQ5A 3AO0A 3W7QA 4QQ3A 2WMKA 1V3JA 3T0BA 4NXSA 3HG2A 1OD8A 4FR6A 2AAAA 3GFYA 1IT8A 1KV5A 3ABQA 3OQ8A 2J13A 5E09A 4M5PA 1M65A 1GONA 4C6OA 3WQWA 3C3NA 5KETA 4QX4A 3BLFA 3CHFA 4O1FA 3IUHA 4NZFA 1V6VA 1UKSA 2WPGA 4Q8PA 5I00A 1KCKA 2BOGX 3PSWA 4NX0A 4OVXA 2D3NA 5E9XA 3GC2A 3A3HA 2WWDA 3P84A 1J01A 2J7GA 5D03A 2AMGA 2WAGA 2VZOA 1WDSA 3ELFA 4IP7A 4KGLA 5A8MA 4L1WA 2WSYA 2VR4A 1RA0A 2E6YA 3KVKA 2EPKX 2EPHA 3AYSA 4X63A 2GJLA 4WDWA 3XISA 2C1HA 2DT3A 2BOEX 1EC9A 5HWNA 3ZSTA 1R3TA 2WZEA 5BXTA 1BVNP 2HK1A 1B54A 2PBGA 4LAMA 1RLDA 3VD7A 4A8IA 4K38A 4W84A 3BLEA 4CCCA 3H70A 1DWHM 4I5UA 3RO6A 2XISA 3TXZA 3DFSA 4HNOA 5ABFB 2ZZ1A 2DEPA 2VUNA 1UMLA 2HBVA 1V0MA 3VIFA 3CLMA 3UCQA 1DWGM 2F8QA 4DPPA 5L9FA 1EJWC 4H9YA 3NYZA 2PDBA 2V0TA 3NQ8A 1QTWA 3UWZA 4XIMA 3FXYA 3B9NA 5G4WA 3TSDA 2YCJA 3PVFA 4PUWA 2WJZA 3T4WA 5E5CA 5BRPA 2Y0FA 4ACYA 3ABXA 4JNMA 2GWNA 1KM4A 4Z1DA 2ZDRA 2R82A 4NZ3A 5GJNA 3DFPA 5D38A 2Y8KA