1C93A

Endo-beta-n-acetylglucosaminidase h, d130n/e132q double mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFNDQYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
total genus 90
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c93A00
1H2JA 4CVWA 3WF3A 1CDGA 1C90A 3VDBA 1J9YA 2W66A 3EMCA 3WDJA 3BC9A 1JXJA 5IHSA 4PSPA 3RILA 2EPOA 1V3KA 2BY2A 3NDZA 4HMEA 3POCA 2JFEX 4CN6A 3GH4A 4DWSD 1UR1A 1W9PA 4JHOA 3PHAA 3LMYA 3AISA 4B16A 2WC3A 7TAAA 4HZ7A 2FH6A 3WNLA 2AMGA 4F8XA 2JIWA 2GK1B 4UCFA 2ZUVA 4PMOA 1KBBA 1E6PA 1W9VA 1EQPA 1J0HA 1KQZA 2ZWZA 1MW3A 2XTKA 3K8MA 5CJ5A 1V3HA 3F5KA 4V2XA 2BVYA 2W5FA 1GORA 4ZENA 3VDHA 1FOBA 4JFVA 1MXGA 2RGMA 2ZUNA 4UOZA 3MUZ1 5E0FA 2ZUWA 4PMQA 1JFXA 4C7FA 5ABEA 3VO0A 3CZGA 2WM0A 3VD5A 1LG2A 2YIHA 2EJ1A 2Y4SA 4BS0A 4RE3A 5I78A 2VI0A 3DHPA 4J3VA 4EANA 5A8QA 1N82A 3CZ8A 1UR0A 4CU6A 1DWFM 1V0MA 2VMFA 1G9HA 4L4OA 4W87A 5GNXA 1WZKA 4E8CA 3AS3A 1ZB5A 1OM0A 3WQ8A 2WHLA 3WDHA 1B3WA 3VTRA 2YDRA 6TAAA 3PZTA 1K9FA 1W9DM 4AZCB 5A6KA 1UWSA 3M07A 4AIUA 5AYBA 5CSUA 3OGVA 1NM9A 1I75A 3U57A 3KEHA 2OWXA 3OIHA 2XVPA 1HL8A 3O9NA 4EE9A 4HA3A 4JHZA 5HOSA 4AY1A 2GJPA 4N0RA 1V3IA 1JF6A 4FLQA 4DWSC 2DT2A 1KCKA 4P7NA 1UQYA 4BQ4A 1ITCA 3ARXA 1KFWA 4JAWA 4WKHA 2DSVA 1QHOA 2EXOA 2NSXA 3RJXA 1LL6A 1TZ7A 4PMXA 3ARQA 3T09A 2XVLA 2XJ7A 1HVQA 4TX8A 1OIMA 5D9OA 5ABFB 1WP6A 3BLKA 2VC9A 3WQ4A 1E6QM 2J7GA 1E5NA 1NWSA 1X6NA 3II1A 1CBGA 4S3JA 4AXNA 3UETA 4AW7A 1JI1A 1BF2A 1VFMA 4ML4A 1MXDA 1XSJA 4HZ6A 5CPSA 1KR1A 2ZXDA 1BTCA 2GDUA 1J0YA 5D9MA 2W62A 2QV4A 2GUYA 3AMGA 4AD2A 5BROA 3VIFA 3CGTA 3W53A 3VIJA 3ZR5A 1UH4A 1DHKA 2ZWYA 4DM1A 1W9XA 3SIMA 3BAYA 1KGWA 5BCAA 2DSKA 1Q6FA 1JYXA 3WUBA 3PZIA 3WF0A 2J7EA 1B0IA 4J3SA 2WVVA 1V08A 3WQ5A 3S6TA 2WMKA 3CZLA 3OBAA 5F7UA 1EDGA 2WWDA 1EHNA 1CYGA 4HOZA 1W32A 2PWFA 2VZUA 1CWYA 2F8QA 4MNMA 4NSBA 3UG3A 1NP2A 2FHBA 3CIVA 2JIEA 5AYIA 5DT5A 4U2YA 1LWHA 1E0XA 1E1EA 4FF5A 3VDCA 3MKKA 3AHTA 2GK1A 3I3BA 4JCLA 1ECEA 3VUPA 2BHYA 3AYSA 1KGUA 1PAMA 2A3BA 3AS2A 5ECUA 1IT0A 1U2YA 3VPLA 5E9AA 1EDQA 1W3HA 1S46A 1V6YA 5IXEA 3VD9A 4IPLA 2OWWA 2X05A 3O2LA 3APGA 3BAXA 1B3VA 2VQTA 4D6EA 1R86A 2CCRA 1FH9A 3NDYA 3RM8A 3NCOA 1J01A 1JD9A 2PC8A 4GQRA 2VZTA 2VZVA 1QNPA 2CKRA 3GDBA 3U7BA 4AZ7A 3VD3A 1KR0A 3CPUA 4TVDA 2UY2A 3AIUA 4MAZA 1BQCA 1FHLA 3ARWA 5A6JA 4IISA 5LA0A 2G3JA 1BYAA 3WQVA 4GINA 3BCDA 1E3XA 4LYQA 2O9TA 4W84A 4PMYA 2J62A 3WF2A 1V6UA 4PRWA 1G01A 2WVTA 4GO9A 2WZIA 4UOJA 2Y2WA 4D6IA 3LPPA 4OBRA 3WD0A 1JL8A 2WC7A 3HN3A 1HF6A 2FH8A 4OOZA 1DEDA 1BVZA 4W93A 4ATWA 1XCXA 3ZR6A 1ISYA 3SUSA 1E1FA 3K8LA 3UCQA 1XH2A 5I79A 1VAHA 4QFUA 2QPUA 3RPMA 1U30A 4BF7A 1FA2A 4IPNB 3E1F1 4YHGA 1QBBA 4D6GA 3L4TA 2EPNA 1J18A 1G5AA 3AZSA 3AHVA 1CXEA 2WHKA 5IFPA 2BVTA 2JF6A 2X09A 3TTSA 1BG9A 2WVUA 1TE1A 3K4DA 1BGAA 5ABFA 3ZQ9A 5HPCA 1IZJA 2NT0A 2DEPA 2VQUA 3WF1A 3CMJA 1HJWA 5LA1A 1UWRA 1V0NA 4UFLA 2VX5A 1E73M 3ALGA 2QLYA 4MPKA 3W0KA 4R5EA 3SCWA 2UY4A 5M3WA 1C8QA 4MJ2A 1JZ7A 3WELA 1W1TA 5A3HA 2WYSA 3N04A 4Z2LA 5A6BA 2BY3A 2WANA 1GOKA 5I77A 4CCCA 3O6AA 4UNIA 4XZWA 1PX3A 5HDRA 2D0HA 3WL1A 1SYTA 2CIPA 4OIFA 1LLOA 3BH4A 2EPMX 4ACZB 2XYLA 3TTQA 3ZJKA 3WEZA 1E40A 2WKGA 1QI4A 4TTUA 4X0VA 3WDQA 1EA9C 2G41A 3A4WA 1JZ2A 3MUY1 4JFSA 1NP0A 3T2QA 4JIEA 5A2BA 2E0PA 3WNKA 1CNVA 3QHOA 2QHAA 1NARA 2WK2A 4HP5A 3N9KA 1VF8A 1PX8A 2PWEA 2E9MA 3AMCA 4OJYA 4MB3A 3ZMRA 3WIJA 4PTXA 2O9RA 2WZHA 1ISXA 1GPFA 4CCEA 4D6DA 5CPQA 3VIPA 1UD5A 4ZE5A 3L4YA 4XUYA 4P8XA 1D2KA 3AXIA 1JDCA 3FHAA 2WWCA 5A1AA 5GPRA 3B9DA 4A4AA 1D7FA 1NOFA 2F61A 5A8NA 5EFDA 4EKJA 1EHAA 1VBUA 3GYCA 1AVAA 2WMFA 1KGXA 1ZL1A 2DT3A 2YLLA 2J4GA 4UTFA 4MDPA 1LJYA 4D1JA 1XHGA 3PTMA 1B3YA 1C91A 4MB5A 3PTQA 2XGBA 2XM1A 2WC4A 2AOSA 4AZBA 3EDDA 1HJSA 4AZIA 3VIIA 3F5JA 3OLDA 3A47A 4GI6A 1V6WA 1SMDA 1QNRA 3A4AA 3K8KA 2BNJA 1J0KA 3TONA 2BV9A 3WDPP 1YQ2A 2PB1A 1GOOA 2D23A 1MQRA 3AJ7A 4LQ1A 4WLCA 1E4NA 5DT7A 3EMZA 1HKKA 1E0VA 2EPKX 3WH9A 1MFUA 1V03A 2GVYA 4AZ6A 3GZAA 3M6DA 1MFVA 4U5KA 1BG4A 4AD4A 2J8FA 3WMBA 3WNOA 1XH1A 3T0AA 3VM5A 3ARTA 4PSRA 3DC0A 3GNOA 4DUWA 1Q6CA 1DWHM 1CGUA 1JF5A 3MANA 3CTTA 3QHNA 1BHGA 1CGWA 1VFFA 2CHNA 1UR9A 2CPUA 5DF0A 2EBNA 2O9PA 1B31A 3SURA 4C7DA 2VCAA 1UWUA 2QF8A 3OZPA 1HX0A 1BFNA 4GKLA 4H7VA 2A3EA 3MO4A 1OCQA 3F4VA 3DECA 2V5CA 2WW5A 3OLIA 3PZNA 2CBJA 2DDXA 1ZJBA 2ZX6A 2ZX5A 2VVSA 2G3MA 4M80A 5FL1A 4AYSA 5FOOA 4D1IA 2E40A 1UH2A 2WMJA 5A6SA 3IJ9A 4Z2KA 1FH7A 4UQCA 4HU8A 1JYVA 2WVVB 4W5UA 7CGTA 1W2VA 4EAMA 1R87A 1XGZA 3IANA 2OSYA 5CG0A 1V3MA 3ZOAA 2WMGA 2YOCA 1JGIA 1V3JA 1E43A 3WBEA 3VGGA 3AHZA 3WQ6A 5I0DA 4ACZA 4PCSA 4PYSA 4U3CA 3GM8A 3AIQA 2W4XA 4B9ZA 1EO7A 1M01A 3FHQA 2D22A 1HP5A 2XVNA 4A3YA 4W8LA 3ZT5A 2YBUA 1TMQA 1LQ0A 1MVYA 2YL9A 4MNKA 2ZUMA 4MTVA 1QNOA 3DYMA 4GO8A 3WSUA 3SCVA 1JYNA 2CXGA 1XCWA 4M1RA 3W38A 1KXHA 1UWIA 1XSIA 3W6MA 4ZE4A 5BXRA 4UQDA 3WD2A 4M82A 1JIBA 3NSMA 3WH5A 4W7VA 2DPEA 3FN9A 1H09A 2NT1A 4FLSA 3VIOA 1M04A 1C93A 5D8WA 1OGGA 3ZT7A 2YKKA 2Y24A 2ZXQA 1P6WA 1G94A 2J75A 3MSGA 4HA4A 3ZM8A 4J7RA 5I23A 5I5RA 3B9AA 1DWIM 4AD3A 1GHSA 2VRJA 3AICA 3ZSTA 2VR4A 4HZ8A 2IUZA 1US3A 2FHCA 5JIPA 3SCSA 2GDVA 2XFRA 4GZEA 2ZUSA 3MSDA 3I3DA 1W9UA 1E3ZA 2B31A 3SUTA 1W91A 4OKDA 1K9TA 4P7RA 4LPCA 4J3TA 5KEZA 4E8DA 1PZ3A 2EO7A 3AI0A 4V28A 5A8PA 3CBWA 2Q8XA 1ZBCA 3IAPA 1Q6DA 1ODUA 2QMJA 2BHZA 2VZOA 1ZU8A 1LWJA 2RGLA 3BLPX 3VD7A 3EBVA 2UY3A 5BXPA 4PCTA 4NI3A 2VRQA 1US2A 6A3HA 3N13A 4DWSB 1C92A 9CGTA 3UR8A 1CGVA 1E6NA 3GH5A 3W24A 3BSGA 3J7HA 4ZXLA 1OB0A 1KXTA 2J78A 3QGVA 5D9NA 4ATLA 3CUJA 3AZRA 3MV01 4W8BA 2J7HA 1DP0A 2DSZA 3K46A 5A8MA 2ZX7A 4UQBA 4B3LA 3ARYA 3ALFA 3SUUA 4HPGA 1QW9A 3EDEA 2D3LA 3A4XA 4J28A 3SEPA 5JUVA 4IUGA 1MW1A 1C7SA 4GZJA 3QOMA 4S3KA 2XVKA 1EIBA 4J3WA 1ISVA 2HVMA 2J7DA 4MJ4A 3IAQA 1HJQA 2VUYA 3AYRA 1A3HA 3WMSA 2WB5A 3W81A 2BS9A 3T08A 4XV0A 2J8GA 1IZKA 1UKQA 5EMYA 2VJXA 4CGTA 2DH3A 5KZ6A 1XSKA 1GQJA 2J79A 1E4MM 5I6SA 1QVBA 2O92A 1W2PA 1XD1A 4KGJA 3AS0A 2OYMA 3T0BA 1E4LA 2YA2A 1LL7A 2PBGA 1DWAM 2BVDA 3KL3A 1JDDA 3PZ9A 3VGFA 3VILA 3WENA 3W37A 3D3AA 4UQ9A 4V27A 6CGTA 3I3EA 1PPIA 1UWQA 3SUWA 2XFFA 3F5LA 4AZGA 1UKPA 4KRTA 5CXPA 1H4PA 3MUIA 1RP8A 4EK7A 4QLLA 5I2UA 2XFYA 2CHOA 4MNLA 4Z2GA 2DT1A 1SFSA 3VD4A 2ZXAA 2WXDM 3AS1A 3VINA 1KWKA 3VKKA 3ARPA 2UY5A 4TTGA 3POHA 5CLTA 2DSUA 1QOXA 5A95A 2WMHA 2ZICA 1TG7A 1UD3A 1HKMA 1UD4A 3W6LA 2VVNA 4U3AA 4D6HA 5JIWA 2JF7A 3WNNA 3BMVA 1CECA 3ARRA 2O9OA 3AIRA 4WSJA 4DM2A 4M8UA 4AC1X 1OT1A 3AMDA 4H8HA 1W9BM 5EBAA 3WD4A 5D9PA 5EFFA 2W91A 1H0GA 2WHMA 3EDJA 4ATDA 2OYKA 2VTFA 2XUCA 3OGRA 5HNNA 3ZJ7A 4QP0A 3ZT6A 1E9LA 4M29A 4WSKA 2G3NA 2IXUA 1F4AA 5A2AA 1BPLB 5AY7A 4J3XA 1JFHA 1XYFA 1GJUA 4AMCA 4HTYA 4H04A 3W26A 2BY1A 3A3HA 1QI3A 1GQLA 3L4VA 4E2OA 4UZSA 4E4PA 1JZ3A 1Q6EA 3VM7A 2CEQA 5GQBA 1HVXA 4UFKA 1BYCA 1CZ1A 1GCYA 1JXKA 3SCUA 3K1DA 4XZBA 1ZBWA 3BAJA 1J0JA 1M7XA 3OGSA 3QHMA 5C70A 4F9JA 4HMCA 2XGIA 2CNCA 3PZMA 1BGGA 5AC5A 4DWSA 4W89A 2VR5A 1QNQA 2XSAA 3KWXA 1J0ZA 4JCMA 1NWUA 3CHEA 3W29A 1TFVA 2D3NA 3LPGA 1V02E 1QI5A 3AIVA 3LPOA 4AIOA 1UR4A 1W3JA 2DQXA 1F4HA 2CBUA 4DUVA 1OINA 4QDMA 3MMDA 4AZ5A 4KMQA 4ACYA 2V3EA 4W7UA 1WO2A 3BXWA 2XG9A 3NSNA 3THCA 4P8UA 1BLIA 1UWTA 2PI6A 1E6XM 4XB3A 1C3FA 4H41A 2YJQA 1L8NA 4NF7A 1HT6A 1K9EA 4NRSA 4X9YA 1CXKA 1WKYA 3T2PA 4U2ZA 1OGBA 2OSXA 3CUFA 2JALA 1ZBVA 1WDPA 3G6LA 3ZJ6A 3SCOA 5A94A 1ZJAA 3IJ7A 3W4RA 3WDRA 2ZX8A 4KH2A 1B3XA 2E8YA 1FP8A 1EOMA 1CIUA 1Q4NX 2WCSA 3VNYA 4BQ2A 1TR1A 4N42A 4MDOA 2YLAA 3WF4A 3TA9A 1E6ZA 2V3FA 4CVUA 4JKKA 3OZOA 3N18A 1PJ9A 2QPSA 1MW0A 1ISZA 3EDFA 4CD4A 2FGLA 4TVCA 2WPGA 1MWOA 3L2MA 2VX4A 3BAKA 4JFWA 5DEZA 2Z1KA 4UQEA 1E6RA 3IK2A 3PZVA 1NQ6A 2ZUUA 4NZCA 3RO8A 1CEOA 1JNDA 4W8AA 2G8ZA 3BMWA 3WMCA 2A3CA 3SCQA 1FFRA 2XWDA 1UOKA 1JZ5A 2D2OA 2GSJA 4M24A 1MQPA 1VENA 1G1YA 2E4TA 1GNXA 4AEEA 1GOMA 1L0PA 1RD6A 3ARZA 1X1NA 1CGXA 4RE2A 1UZ1A 4CD6A 1XH0A 4F66A 2D20A 3GXMA 1PZ2A 4B15A 3GXDA 4JFTA 2ZXBA 3PBGA 4GI9A 1V6VA 3L4XA 3M7SA 4PMNA 5E0CA 2X1IA 3NUKA 1WNOA 3GTNA 1C8YA 2VL4A 4U5IA 4Q22A 1HXJA 4M81A 1V02A 1CLVA 3L2LA 1C8XA 3WUEA 1UYQA 4P8VA 1QNSA 1HNYA 1CENA 2JE8A 3EYPA 1ITXA 1FH8A 4M56A 5BXTA 5BYWA 3WQWA 1NWTA 4TUFA 3VGEA 4D6JA 1V3LA 2XHYA 4LYRA 1BAGA 1J10A 1GOQA 3BAIA 3FW6A 1Q6GA 1QW8A 1TVNA 3AXHA 4QCEA 1BYDA 3HJEA 3NSXA 1PIGA 2DH2A 4HOWA 2CITA 5FL0A 3CUIA 3MUAA 4UQAA 1CXIA 2DIJA 3JUGA 1UHVA 4TXEA 1ISWA 3WY1A 3D5HA 3ARVA 3VX1A 2J7BA 5JBDA 4H8VA 2PWHA 3VIHA 3RMEA 3W27A 3OG2A 1E72M 1E55A 1C7TA 4JFUA 1FHDA 3CMGA 3VMNA 1HKJA 1RH9A 4Z2IA 4JZ5A 1DTUA 1KQYA 1D3CA 3ZJ8A 1E71M 1W1VA 5DO8A 4UR9A 2J7CA 2J7FA 4CD8A 2EPLX 2WCAA 5E6ZA 1GVYA 2V5DA 2XPKA 3ECQA 1UD2A 3CZJA 1UKTA 2CBVA 3SCPA 3DYOA 5I24A 2VX7A 1UR8A 1BVNP 1VJZA 1O6IA 4CU7A 1E70M 3B8SA 2DIEA 1SR0A 2GFTA 1GONA 4LX4A 4WJXA 2XIIA 1H5VA 4UFHA 4NRRA 3VGBA 5E6YA 1OT2A 1GOIA 4KRUA 4MB4A 1V0LA 5AC4A 1W1PA 4WF7A 1GHRA 4LYPA 5GNZA 1E0WA 2CBIA 5FIPA 3AQUA 1CTNA 1W3KA 4GQQA 3K4AA 5DMYA 3TP4A 3TOPA 2D1ZA 4PMVA 2ZOXA 4GZIA 2AAAA 3QOKA 2OLHA 4BQ3A 1UD6A 1TA3A 1HJUA 1LF1A 2WBGA 3UESA 1NOWA 1WZLA 3PN8A 4D71A 4PMDA 4TVUA 3CHFA 2WSKA 2VX6A 3T2OA 2Y5EA 4MNJA 1EDTA 2GJRA 1PEZA 2WHJA 4RE4A 3GXFA 1JZ6A 1G0CA 2VO5A 4CN1A 4PTVA 2Y8VA 1E4IA 3AMLA 3THDA 4PUEA 2PWDA 1QI2A 3U5UA 4J27A 1H49A 1GW1A 1X6LA 1K9DA 4YN5A 2WMIB 4D72A 3HU7A 1XRVA 1VJSA 1UG6A 3WUFA 5A6BD 1UQZA 3T0DA 2YBTA 2VNCA 5A8OA 2J74A 5D8ZA 5FKYA 3NYDA 4AIEA 1DWJM 4IM4A 2OSWA 4PBGA 1VFUA 1IV8A 1Y7VA 4PTWA 3L4UA 1JI2A 3UERA 1UD8A 5D4YA 4OZOA 4ZFMA 1WZMA 3AMKA 1EQCA 2GJXA 3MU7A 4OOUA 1EOKA 3VIGA 5CSYA 3EDKA 3A6OA 1I1XA 4PEEA 1H41A 3N17A 1H3GA 4CD7A 4UOQA 1MYRA 1R85A 2WLZA 3CO4A 2XIBA 3BSHA 4PTMA 4R27A 4MB1A 3BCFA 4GXPA 1O7AA 4Q7NA 5BRPA 3CH9A 1OGSA 3NJ3A 2J77A 1YHTA 2XM2A 5BRQA 1HIZA 1R7AA 3PZQA 5JBFA 2WKLA 5M03A 1GJWA 3L4ZA 3BGAA 5TD4A 4RL3A 4Z2JA 2WBKA 5BXSA 2E9LA 3SCTA 1B1YA 3QR3A 1XC6A 2WAGA 1KBKA 2WLYA 5A69A 1W3LA 4PMZA 1VEMA 3U5YA 3VOCA 3AXXA 4D6CA 1HP4A 1GQKA 4P7QA 1TUXA 1AQHA 1KCLA 2JEPA 4KWUA 3ZSSA 4F9DA 1MW2A 3RM4A 3W82A 4FMVA 2YDQA 5I3DA 5IFTA 4PMRA 4D6FA 3WD1A 2UWFA 2X8RA 3VIKA 3VX0A 1V0KA 1OD8A 1JDAA 1HKIA 2CESA 1HJVA 3OLEA 4GPNA 4BCEA 2A3HA 1UH3A 4ZXOA 2J47A 5GNYA 2FGZA 3WH7A 4HMDA 1UKOA 1B2YA 1WDRA 5E70A 4URIA 1J12A 2E3ZA 2XSBA 4AD1A 1GQIA 4QAWA 2A3AA 3VVGA 1K6AA 1U33A 4BQ5A 1QHZA 1UUQA 3M46A 2FHFA 4P7OA 1EH9A 5FD0A 3WL0A 4YHEA 3W28A 3VU2A 5A6AA 3MMUA 3PZGA 3CUHA 1GOWA 1JG9A 2PF0A 4L4PA 4AD0A 2G4FA 1HN1A 3OLGA 3SCNA 3GBDA 3TTYA 5A2CA 1VB9A 2ZIDA 1AQ0A 3CZEA 5BWFA 1CGTA 1BYBA 4TOQA 1UKSA 1JZ4A 4DUXA 5A6MA 2YL8A 1AQMA 2WMIA 4CCDA 1Z32X 1XYZA 4FLRA 4OUEA 3AZTA 4KGLA 2CYGA 2VCBA 4UFIA 2VRKA 2C7FA 1GVIA 1VEPA 2OYLA 1EO5A 3B9EA 2XWEA 3N12A 4W86A 3WN6A 3FNDA 2BXYA 3WUGA 3KE0A 4AISA 4U33A 2J25A 4BA0A 4U31A 8A3HA 3VMPA 4OBSA 3OB8A 1EXPA 1M53A 3PZUA 3HMCA 1KXQA 4PUDA 4P8WA 3TTOA 1VIWA 2CERA 4AZHA 4AEFA 3SCRA 4CUCA 1WAWA 3AIBA 2ZUTA 3VNZA 1PX4A 2WNWA 3AIWA 4AZCA 2ZE0A 3W25A 1OSEA 1PBGA 1ESWA 4PMUA 4B9YA 5IHRA 5CPTA 3U7VA 3PZOA 4WIWA 2EQDA 3VIMA 4CKQA 3UG5A 2W92A 1B9ZA 1WCGA 1JAKA 5HXMA 1EGZA 2V38A 5M5DA 3GBEA 2VZSA 2V3GA 3GNPA 1WDQA 2V3DA 1MQQA 5C8BB 1FP9A 1B30A 2G3IA 4FLOA 5ABHA 1OWQA 1A47A 1OBAA 3CLWA 3KL0A 4B3KA 1JD7A 4GIAA 1JYWA 3WKZA 1NOUA 2ESCA 3WEMA 2VCCA 1OIFA 4MADA 5LA2A 1SMAA 1I1WA 3DHUA 3CZKA 1CXHA 5CZKA 3ZIZA 5CQ1A 2JEQA 1J11A 3AHYA 3CHCA 2TAAA 5M17A 1CXLA 1RPKA 3L4WA 3MS8A 1UZ4A 4W88A 3UR7A 1H1NA 1ZBKA 1VEOA 4W85A 2X0YA 1KXVA 1HL9A 1QI0A 5A6LA 4WKAA 3RDKA 5ABGA 2EEXA 5DFAA 4LXFA 3KZSA 4JKLA 4TX6A 2YA1A 2W67A 1JZ8A 3WD3A 3MMWA 3WH6A 1TA3B 4Y7EA 2DT0A 4HA1A 4GI8A 4HU0A 1CGYA 3N11A 1R7OA 4A3HA 1VBRA 3RCNA 2WSPA 3WFZA 1LG1A 5LYRA 1HJXA 3WEOA 3NIYA 1FFQA 2BHUA 5JBEA 3AROA 4LGXA 3WBAA 1E15A 2Y8KA 2OWCA 4QLKA 4K68A 3IJ8A 3FXYA 1GZJA 3FY1A 4W7WA 1CPUA 3CHDA 2HISA 4WK9A 4BZYA 1H11A 3VGDA 5IDIA 1ODZA 2W63A 5E09A 1JAEA 1QPKA 2VURA 3RIKA 1WB0A 3VMOA 1LL4A 3VDAA 4C7GA 3CUGA 2DSWA 2F2HA 1UA7A 2YL5A 4QCFA 4UFJA 2CKSA 1KWGA 4HOXA 1PIFA 3WH8A 3N15A 1CLXA 2FDMA 1M03A 5FCZA 3N1AA 2PWGA 4W5ZA 7A3HA 3UEQA 4ZEPA 1AMYA 1VRXA 3AHXA 2WZEA 1WPCA 1KB3A 2VOTA 2GJXB 1H0IA 3FAWA 4P7LA 2D0FA 4YPJA 1B3ZA 3AFBA 3AIEA 4HPHA 2DGAA 3WNMA 3WNPA 4AD5A 5CGTA 5CGMA 1JNEA 3ZO9A 3EMQA 3FAXA 2Z1SA 3WDIA 1XD0A 1TCMA 1NH6A 3LPFA 3S2CA 4MAVA 3SUVA 2YL6A 3ARSA 1XV8A 2D24A 2WVSA 5CLWA 2XVGA 2PBOA 1E5JA 3RM9A 5EB8A 4WKFA 1GUVA 3OA5A 2E8ZA 3PTKA 1E56A 3KL5A 1J0IA 1V6XA 4UZUA 1TVPA 8CGTA 3GNRA 4UFMA 3MV11 4H2CA 4H8UA 4CU8A 2C8NA 4F79A 3UG4A 5C71A 3BAWA 1B90A 2CETA 4JKMA 2VT0A 4JL2A 4CD5A 1WDSA 1E6SM 3GXIA 1W1YA 4PN2A 3RJYA 3WFLA 4QLJA 2YA0A 4FK9A 5HPOA 1DWGM 1UA3A 4Z2HA 1RP9A 3VGHA 2BXZA 1NWRA 2D0GA 4AWEA 2IXVA 1WE5A 1R8LA 2E9BA 2QMKA 1UR2A 2W61A 2YDSA 3ARUA 4XX6A 5HBFA 4X0NA 1VFOA 3G6MA 2NW0A 3AOFA 1WZAA 2BY0A 3GH7A 4JL1A 2ZX9A 4J3UA 1QBAA 4CN4A 2WCGA 2C0HA 3DYPA 2X0HA 1CXFA 2MANA 2X2YA 1BSIA 2BFGA 1QHPA 1ZS2A 1OD0A
chains in the Genus database with same CATH superfamily
4Y9PA 4CVWA 4OE7A 4GOAA 1CDGA 4RPPA 3UY8A 2A4AA 2CZ5A 3RHGA 1JGMA 1H50A 3WDJA 3N4EA 5IHSA 2OG9A 4PSPA 2Z24A 1V3KA 2BY2A 3NQEA 1ZP4A 5HINA 4LH8A 3VNIA 3GH4A 1RV8A 2AL2B 4DJDC 4F40A 3WFAA 3H23A 3EB4A 3AISA 4B16A 3A3XA 1TVLA 2B7PA 2C15A 1HO4A 2QJIA 4L9ZA 2P5NA 1XLHA 2R1MA 4UCFA 2OR2A 1O12A 4G56A 4IGMA 2ZYFA 4Q4PA 1KBBA 3SN1A 2PU0A 4INFA 1KQZA 3BTNA 1FCUA 2ZWZA 4XD4A 2ZADA 5EKYA 5AOUA 1GORA 3T40A 3VDHA 4HPNA 2E77A 5F4XA 2RGMA 3M5VA 5DANA 5LXXA 4PMQA 1JFXA 4C7FA 4LS0A 4C6LA 3GR7A 2Y4SA 2HMCA 2VI0A 5I78A 3QXBA 1AMKA 5DCEA 3P5YA 4J3VA 4C6FA 5A8QA 3L23A 3CZ8A 4NL1A 1XW8A 3E12A 3LCGA 4JNZA 2OOGA 3GWQA 4EF8A 2H9AB 1HUVA 1WXYA 5GNXA 1B3WA 1LROA 1R30A 2QVHA 4HB7A 2IKGA 5AB3A 3PZTA 4PRTA 1JVNA 3M07A 1UP0A 4AIUA 3PFRA 3U57A 2Z1WA 1IEIA 3KEHA 2OWXA 4O10A 1K7FA 3OO2A 3OIHA 4HA3A 5HOSA 4PUKA 4I8DA 2VEGA 3CAWA 4ZQMA 4N0RA 1LM1A 1LBLA 3ABXA 4MVAA 1JF6A 3IJQA 4P7NA 2V0TA 3GSMA 1ITCA 1E0UA 1SFJA 4OGZA 2FYMA 1T8XA 1LL6A 3ARQA 3GX9A 3B8IA 2XJ7A 1M3UA 2QCMA 1OCJA 4K8GA 4MPQA 1EX1A 1OIMA 4NZ4A 4TX8A 1WP6A 3OZYA 3P6LA 4LY4A 1NWSA 3URQA 4AFYA 5D30A 1XSJA 1OYBA 1BTCA 3PJUA 5C6MA 3WJYA 4MKSA 4GZ7A 2Q71A 2GUYA 4HU3A 4AD2A 3M7WA 5BROA 4IT1A 3XINA 3W86A 3KP0A 2YCLB 2EG8A 2WQDA 3CB3A 5EMMA 4XZIA 3GNNA 1DHKA 1T0OA 1Y5WA 3FYOA 1RZMA 3KBNA 4Q4QA 1KGWA 1Q6FA 1JYXA 4JEJA 2CWXA 4XWUA 4H8NA 4FIQA 1EDGA 1KTBA 3PUDA 4UWMA 4LS2A 4DZIA 4ES4A 1VCVA 3NQCA 4PTNA 3EB3A 2PWFA 2J9XA 3UG3A 1NP2A 4LANA 4C6JA 1YEYA 2R1KA 4U2YA 3A9BA 4E2VA 3DHFA 3S47A 3PULA 4O8RA 3E0FA 4FF5A 3MKKA 4O8AA 3VUPA 1ECEA 3AYSA 1KGUA 2A3BA 3GXTA 3R0DA 1SO5A 4GY7A 2FKPA 4C60A 1SM9A 4JD4A 2Q8LA 3APGA 3N2XA 3T44A 5T9BG 2Z2BA 3CS2A 5BU9A 4D6EA 1R86A 1KFJA 2CCRA 1U1JA 2V63A 3U8GA 4DN1A 3DG6A 3RLUA 3IUDA 2BGNE 1SO4A 3WK0A 3U7BA 1IWAA 3H21A 4ERAA 1EC7A 1BQCA 3MO7A 3WQVA 4GINA 8XIMA 3BCDA 1E3XA 2O9TA 1AL7A 3NR0A 3SJNA 1Y65A 1RVKA 4GQ0A 1V6UA 1W3NA 3CT2A 1G01A 3P61A 4KKXA 2WZIA 3CYJA 4UOJA 3GDLA 3GKFA 3WD0A 4OBRA 3BQ5A 1JL8A 4V15A 2V2CA 3G3MA 4H6RA 1KO0A 2OZTA 1YXDA 4KFPA 1XCXA 1G67A 3ZR6A 4F0HA 1ISYA 3R4IA 1TWDA 1XH2A 4GD0A 1VAHA 5KZDA 3RPDA 3LQLA 3WQPA 4BF7A 2GLKA 1SW7A 3AXKA 3E1F1 4YHGA 3W7EA 1LRTA 1QBBA 2Z28A 4WOQA 4D6GA 1XLKA 3PAOA 1J18A 4IGNA 3AHVA 5CAKA 2BVTA 5CAHA 2ZRXA 5DCDA 3ZQ9A 5IM51 2ZZ4A 2DEPA 1HJWA 5LA1A 1V0NA 1VHNA 1RQEA 4JIPA 4E5TA 3GDMA 8XIAA 1W5MA 1JZ7A 3WELA 5A3HA 5DMMA 3FK4A 1IF2A 1KRMA 2ALDA 3JR2A 2DW7A 2VGGA 4R53A 2D0HA 2D2GA 5B7ZA 1LLOA 2CHRA 1KCXA 2WKGA 5KSWA 4GUFA 3ZFHA 2HK1A 4A8LA 2R8WA 1V51A 3VNLA 3ZLGA 1JZ2A 3IWPA 1W37A 1TJRA 4JFSA 1NP0A 4JIEA 3GVVA 4XISA 3T0CA 1YIXA 3B0YA 1ECQA 5HUPA 4JYDA 4E0CA 3W02A 1M65A 3DU0A 3E02A 5KMYA 2E9MA 5I3HA 4HPJA 4MB3A 2QDGA 2WZHA 4GH1A 2NXHA 1GPFA 3MKVA 4CCEA 4IG2A 2PD5A 4D6DA 5CPQA 4ZE5A 5EMKA 3RLHA 2MUCA 3AXIA 3L12A 1JDCA 2TYSA 3JW7A 4ERIA 2WWCA 3LGGA 2DUZA 5I3FA 4O28A 4HA0A 1DJQA 3M0YA 1TPC1 4EKJA 1VBUA 3O15A 3W1MA 3EA3A 2ZRYA 2H6RA 2J4GA 4MWAE 1E0TA 2ZA1A 2YB4A 1LJYA 1G4EA 4M6PA 2PDMA 3E2QA 4MB5A 2XM1A 4ECLA 4OTKA 5C5YA 2AOSA 5AKQA 3EDDA 4GYPA 4FXJA 3VIIA 1XBXA 1QO5A 3FYYA 5I06A 1P7TB 3M0HA 4H9UA 2ZCGA 3TYEA 1EEPA 2I17A 6PTDA 5FJPA 2BNJA 2BWGA 3PR2A 3TONA 2BV9A 1YQ2A 3LRLA 3P3BA 2D23A 4NASA 5DT7A 2YBVA 4AVFA 1HKKA 1E0VA 2KX9A 3GZAA 4U5KA 2J8FA 1Z42A 3OOQA 2P0OA 1XH1A 4LF1A 4LOCA 4FB7A 1V93A 5CJMA 3DG3A 1Q6CA 1DWHM 1REQA 1JF5A 1SJDA 3QHNA 1G6CA 4HJFA 1P1XA 2WSQA 1VFFA 4BFAA 1UR9A 1KFBA 3PNUA 1DKWA 4DHGA 2EBNA 3M0XA 1VCFA 3GB6A 3O0KA 5AECA 1XUZA 1OCQA 3GW3A 2PUZA 2QULA 4DUOA 1VFTA 2J9YA 2V5CA 3ICJA 1YRRA 2VC7A 3GNXA 2DDXA 3BL3A 3EWXA 1DJXA 2ZX6A 2ZX5A 5FL1A 5J5RA 3RGTA 4YVPA 2ZZ1A 5A6SA 3LCHA 3NNTA 3QPEA 3QSRA 4Q6XA 4EAMA 1TYGA 1AA1B 4O1FA 4ILSA 3ZOAA 2YOCA 2FVKA 1JGIA 4ZR8A 1V3JA 1E43A 3LHYA 3KVJA 1CB7B 3VNJA 5I0DA 3FX4A 4ACZA 2XN2A 2E1DA 3QMRA 3PJTA 2QUMA 3LTYA 5CC6A 1XIJA 3DBPA 2NWRA 1GGOA 2XN1A 3FHQA 2NUWA 4MWAA 4A3YA 4B92A 2P1FA 3QLLA 4GY1A 1DXFA 1SQ7A 2A7NA 1K8YA 3F7JA 5MF5A 4MNKA 4WDUA 1W54A 4NZ1A 4AUBA 4GO8A 4QBXA 3RLGA 5MHBA 4C1NB 4FP1A 1XYMA 2R9RA 2QCDB 2PPGA 1KXHA 1YPXA 4UQDA 1TQXA 2AGTA 2WZMA 3NSMA 3WH5A 5I7GA 1SO6A 2NQZA 4LUTA 4KCVA 2DPEA 3FN9A 4OHQA 5A8GA 3CC1A 1XC4A 3EXSA 3QGKC 3MMTA 1NSJA 4F2BA 3UY7A 3ZT7A 4S3DA 2G4JA 3GXPA 2Y24A 4NUWA 2E25A 5F2IA 4WGXA 1P6WA 5FACA 5BW6A 1G94A 3RRXA 2IPWA 5I5RA 1VIZA 3B9AA 2VKZG 1Q63A 4UTTA 2GQ8A 1TJ2A 2VGFA 5TBOA 1XISA 4HZ8A 5H6HA 2C14A 1ZGDA 2IQ0A 2PFHA 4GZEA 5DMLA 3ISIX 1QO2A 3FGCA 1O1HA 2GSHA 2FDSA 3P8IA 1W91A 4J3TA 4E8DA 5HULA 5XIAA 1TTPA 2QXWA 1R3WA 2Q8XA 1KV5A 4H9YA 3EA2A 2QMJA 1JDFA 2BHZA 2VWTA 3UJRA 1THFD 4DB7A 3BGJA 3S4TA 3SZ8A 2QGYA 3OHIA 4XAZA 3I6RA 4DVOA 4ZXLA 1OB0A 1TRIA 2NUXA 5D9NA 4TMCA 1ZFJA 4ZQPA 4LCSA 4AVNA 4OECA 3G3DA 3BDKA 2HBXA 4B3LA 3ARYA 1QW9A 1M7OA 4Z17A 3A4XA 4J28A 4IUGA 3M16A 1C7SA 3QOMA 4DXXA 4J3WA 1GVSA 1ISVA 4MJ4A 3NPXA 1UBPC 1A3HA 5FJOA 4NAEB 4FNPA 2OO6A 1H7XA 1IEVA 3CM4A 1FXPA 3ITGA 4PUMA 3TNOA 4WZHA 5I6SA 3EPOA 2O92A 4M51A 4ZA0A 4NZFA 4EP8C 2OYMA 2I5IA 1TV4A 1H7OA 4Q32A 3T6CA 3LLXA 1EBHA 3DGRA 3VGFA 3KL3A 3VILA 5HUOA 1TWIA 3UT0A 1K7EA 1W5QA 1PPIA 1MEHA 3W76A 5C0QA 4AZGA 1TZ9A 5EL1A 3NZ1A 1RLCL 4DF0A 2CHOA 4MNLA 1UUMA 3VNKA 4Z2GA 4ZQRA 3QY8A 2PDJA 3T78A 1HQTA 2WXDM 3AS1A 4EVZA 2QCCA 2PP1A 1S2WA 2ZBTA 1FCBA 5CLTA 4C6NA 2WJFA 3SY5A 3Q58A 2ZICA 3QYQA 4I3GA 4N6EA 4KPLA 1DE6A 1UD4A 2VVNA 2ISWA 4U3AA 5JIWA 1PCWA 4GWEA 1CECA 4H7ZA 4FOKA 3S9IA 4KRZA 4GRSA 4IL0A 4KCUA 1N55A 4QTGA 4H8HA 4P5UA 1UZHA 4KERA 2W91A 1H0GA 2WHMA 3EDJA 4WR3A 1PV8A 4ZMGA 3OGRA 1EB3A 5HNNA 4QP0A 2PDIA 1F4AA 4DI9A 1BPLB 5AY7A 4ORIA 1JFHA 1GJUA 1UASA 3H7UA 1D3GA 4HTYA 2BGQA 3A3HA 1IGWA 2GVLA 5K2ZA 4E4PA 2Z2AA 2YYUA 3IPWA 2AQOA 2CEQA 5EYWA 5GQBA 1HG3A 2OT1A 3PWAA 1GCYA 3SCUA 3K1DA 3BAJA 1M7XA 1A5BA 4S3BA 3OGSA 1WYIA 1REQB 1W5PA 7XIMA 3PZMA 3TNBA 3VC5A 3PC0A 3FA4A 5AC5A 1JUBA 4W89A 3MBDA 1S38A 1TPFA 2VR5A 2XSAA 4XTIA 4JCMA 3G22A 5T91A 3MUXA 2BMBA 4LVGA 3N6JA 3H7VA 3T8QA 3BZJA 1W3JA 1F4HA 4HHPA 4MIMA 4PB4A 1W5OA 4XSLA 3TMQA 4AZ5A 3R43A 2V3EA 3NSNA 4P8UA 1YPFA 1UWTA 1I2QA 1E6XM 4O52A 4XB3A 3G1HA 3TWBA 4TU1A 3PVFA 2G37A 4RR4A 4I9MA 4IH3A 1EP2A 1QDSA 2OSXA 1TX0A 3S1UA 1L2QA 5FEWA 1R3RA 1WDPA 2EKGA 3ZJ6A 3IJ7A 1FP8A 1CIUA 3O6CA 2NQ5A 2YLAA 3NZQA 2E28A 1NAL1 2GQ9A 4X2RA 1MW0A 3OVRA 1ISZA 3EDFA 1IT7A 3R94A 4CD4A 2FGLA 4TVCA 2WPGA 3L2MA 3LCIA 5DLCA 3NEVA 1RJQA 4C65A 4UQEA 5AVHA 1E6RA 2IS7A 3INPA 2OCZA 5AHLA 4M5PA 4NZCA 3UXKA 1CEOA 1JNDA 2DJLA 2G8ZA 3BMWA 1R9ZA 2A3CA 3SCQA 1FFRA 3NVDA 2XWDA 1SJBA 1UOKA 4ZCWA 1PXGA 2FQIA 1I0DA 2FTPA 3MP4A 1TWWA 1VC4A 1KV8A 2E4TA 4L4LA 4MUPA 4MMWA 1RD6A 4QAIA 2B7OA 4CNTA 1UZ1A 4CD6A 4GIYA 4O1BA 4QSFA 4F66A 1FWEC 1NDWA 3W6YA 3C4UA 3G1VA 1ICSA 3EPMA 2XH2A 1ZCOA 4JFTA 1V6VA 3L4XA 3FGCB 1XG3A 4QQ3A 3TN3A 1EJTC 3GR4A 1S5WA 1HXJA 4M81A 3L2LA 3QJAA 1QT1A 2JE8A 1CENA 3P80A 1ITXA 5EU9A 1MMFA 5BXTA 4FX6M 4TUFA 3PPFA 2A21A 2XHYA 4HQVA 2HQAA 5G4HC 1TVNA 4IL2A 2YX0A 2PDCA 2XIMA 3A3WA 4AX6A 4HOWA 3MUAA 3W7IA 1OYAA 4TXEA 1ISWA 4REQB 3G1AA 1UROA 4I9JA 1GWJA 2BB0A 4QR6A 2I7GA 3VFCA 3RMEA 3OG2A 2A0NA 3VMNA 3DX5A 1SZNA 1TE6A 5CKSA 4JZ5A 4Q4RA 4H9TA 5GVJA 4LUIA 2A6LA 4CD8A 4HK7A 1GVYA 1K4HA 1UD2A 3MC5A 4LAUA 4LCRA 2QCLA 1VJZA 1O6IA 2HXUA 3CV1A 1HL2A 1E70M 1O1ZA 1SR0A 4Q7IA 2GFTA 1JQXA 1GONA 2P3ZA 4LX4A 4WJXA 5D2TA 2YCEA 4NRRA 3OEXA 3VGBA 3P7YA 4KRUA 3NQFA 4MB4A 4GACA 5AC4A 4PE8A 4CQDA 3RXZA 5FIPA 1CTNA 5DMYA 3RX2A 4K6AA 3TP4A 4HNTA 1H7PA 4GZIA 4JEQA 3L5MA 3PS7A 1X8FA 4MGGA 4B3ZA 1W5NA 1TA3A 1ME9A 3B9NA 1HJUA 1LRNA 2VEKA 1X38A 2INEA 2FTWA 1EZWA 3OODA 4GBDA 5AVNA 1PUDA 3PNZA 4K8HA 4A3UA 4O16A 1Q66A 2WSKA 2VX6A 4OFCA 4AU0A 4PL2A 2TMDA 2GJRA 4DF1A 3OYXA 5G2HA 4RE4A 3BSMA 1JZ6A 1LRQA 1G0CA 2VO5A 4CN1A 4PTVA 3NXFA 4RNJA 4PUEA 4YU1A 2PWDA 3W07A 5IBXC 2PWUA 1X6LA 2ZRWA 1RQHA 3HU7A 4GG9A 3CH0A 2PGWA 1VJSA 3A24A 2G96A 3T0DA 2YBTA 2PLCA 5JMUA 1XRFA 3NYDA 1OZMA 3LRMA 1WBJA 1TV5A 2CXEA 1TZZA 1XYBA 2CW6A 4A21A 1VFUA 3LBCA 2HBVA 5FF2A 3BLIA 3L4UA 4HNUA 3ORWA 3UERA 1UBSA 5KINA 3E2VA 4A6GA 1EQCA 4B5WA 4I7WA 2JKPA 4OWGA 3WLHA 1EOKA 3LCFA 3CHVA 3UWEA 4F2UA 1H41A 5BOOA 1W1ZA 4UOQA 2CLIA 3HPZA 3CO4A 1W1IE 3VAVA 3K13A 3EWUA 3QY7A 4PTMA 4DJFD 3QBUA 4KFNA 2XU2A 5BRPA 2OGJA 3LX9A 1DJHA 3IV8A 1YHTA 2XM2A 1H7NA 1N7KA 4NAFB 1KW1A 1T99A 2P50A 5F4SA 4RL3A 4Z2JA 3K30A 5D02A 3B03A 1B1YA 3EX1A 1EA0A 3QR3A 4B5TA 3N3TA 1SSGA 3H24A 2WAGA 4L1XA 3TROA 3S46A 1K8XA 3PANA 1TRDA 3VOCA 3BCJA 1R3QA 4D6CA 3AWNA 4O50A 4P7QA 2BSLA 2J9ZA 2JEPA 1BVWA 3L65A 4FMVA 5IFTA 4PMRA 4IZGA 1RK6A 3GLCA 1AUSL 1GG0A 3WD1A 2NV1A 3W9ZA 1V0KA 4GPNA 1AZ1A 3FA5A 2CLLA 1YXYA 2FGZA 1DIKA 4HMDA 1KLYA 4URIA 4B4HA 2CWNA 2YW3A 3PUOA 5ECVA 1V4YA 4Y8FA 3DXIA 4LTSA 5H8PA 3CWHA 4K39A 5CJNA 4DJFC 3M46A 1ME7A 3G5EA 1NF7A 2FHFA 4GMEA 4LUSB 1TTIA 2EF9A 4P7OA 1DORA 3W28A 2RAGA 3MMUA 2XH0A 1V77A 1GOWA 2QJJA 4BI7A 1K1DA 5BOEA 1VB9A 2ZIDA 1AQ0A 4XUGA 2CZFA 4JPGA 1JZ4A 3I4KA 4NNAA 5A6MA 4LV9A 1QPRA 1AQMA 2WMIA 2OZ8A 2KZHA 1U5HA 1I2NA 1NDZA 4YIWA 4GLEA 1GYMA 1E1CB 3A13A 2C7FA 1GVIA 3WLIA 1EO5A 3LUTA 3TYBA 4O54A 3FNDA 4ZGYA 4E4UA 4S3CA 3URBA 3KE0A 4U33A 3S5OA 2JKEA 4DO7A 3CK5A 3GNDA 1O5KA 3ZVHA 2I1OA 4CQBA 5HWMA 3FJ4A 4PUDA 1TIMA 1KTNA 4NILA 1EF3A 2G97A 3SCRA 1CT5A 3V4BA 1OZQA 1WAWA 2E6AA 3AIBA 3P74A 1TV8A 2UBPC 1WX0A 4HHMA 4WIWA 3SY1A 2ZZ7A 2W92A 4A3QA 3PWIA 1P0KA 2AQWA 1JAKA 3SBFA 4O13A 4YYCA 1WAUA 3GBEA 2HDJA 3LXCA 1FP9A 4FLOA 3FVDA 1A47A 4A8NA 1UJPA 1JYWA 2Q02A 2ESCA 3WEMA 1W56A 3R5EA 1N8IA 4IJCA 3O06A 3LV6A 3ZIZA 1P43A 3WQOA 1PHQA 3IIVA 6ALDA 3C8NA 1CXLA 1RPKA 3MS8A 1UZ4A 3KLLA 3A23A 1XFBA 4W88A 3RU8X 3G1SA 3RRAA 1ZBKA 3UR7A 1VEOA 4E8GA 2X0YA 2Y7GA 3KVMA 2PTDA 3BLLA 4HHHA 4WKAA 2GJLA 5ABGA 5DELA 2ASHA 4JKLA 3NAVA 4CNUA 3MMWA 1TA3B 4IMGA 1XCFA 3O0FA 4UMAA 1V7AA 2I16A 1ENUA 3N19B 3DIPA 1J2BA 1OJXA 4F48A 4WY0A 4HU4A 9XIAA 1FFQA 2IKIA 3AROA 1Q8JA 1E15A 2Y8KA 2OWCA 3HG3A 3IJ8A 3FXYA 1JDEA 3N3MA 1LWIA 1HW6A 4MZ8A 1CPUA 3TWAA 1XIBA 1NU5A 2PDUA 4WK9A 3TE9A 3LCWA 1DOSA 3VGDA 1HTIA 5IDIA 4XAGA 1UZDA 1X98A 1XBVA 3AUOA 2P3EA 5E09A 5EBUA 2VURA 4AQLA 4ZQCA 1WB0A 3VMOA 3S9YA 3H54A 3RK8A 1LORA 2DSWA 1NEYA 1S3TC 7REQB 3G2GA 2CZEA 4UFJA 1PIFA 2VDHA 3N15A 1C29A 1M03A 2OPJA 2VC5A 2PWGA 2QIWA 2OZ0A 2OO0A 4LF2A 3LDVA 3HGRA 1AMYA 2WZEA 1WPCA 3VOJA 1KC7A 3AJXA 3FAWA 3M0JA 2BOFX 3NO3A 2AAMA 2D0FA 3HPSA 1G4PA 8RUCA 2WNZA 4Z1CA 1W8SA 2Y5SA 4PB5A 2YZRA 3G77A 4EPDC 2HTMA 2VENA 3CQ0A 1DJZA 3WDIA 3GIQA 4I8YA 2OLAA 1TCMA 4XKYB 1NH6A 2Y61A 3B8TA 2IW0A 2WJZA 2YL6A 2D24A 2RDTA 1H7RA 4H9XA 2C0AA 2QJGA 4QIUA 2GDQA 2XVGA 2PBOA 1JEZA 3QMSA 3HV8A 3W7LA 3OPSA 2FJKA 2JGYA 2C13A 4XZNX 3GNRA 3MV11 3RN6A 4CU8A 2F84A 2C8NA 3W1UA 1EKOA 5C71A 2TPSA 1B90A 4JKMA 5XIMA 2FJUB 3GXIA 3DFNA 4QLJA 1OC5A 1OK6A 1JCYA 1OF8A 4FK9A 5HPOA 4Z2HA 1RP9A 2G95A 3N2TA 1NWRA 3KRZA 1SZGA 5C2XA 2YDSA 1BKSA 2HXTA 2VC6A 3E6EA 5HBFA 1VFOA 3G6MA 2NW0A 1WZAA 3M0KA 2CLFA 3F2BA 1SW0A 3CIXA 1ADDA 1F61A 3C0LA 1DJYA 5CBJA 4GNVA 1OD0A 3C2RA 2Z26A 3WF3A 1GVFA 1C90A 3W72A 2JKAA 4ADSA 4ALDA 4EF9A 2W66A 2ZTJA 4O1CA 4ZL1A 1A5LC 4NKCA 4JICA 4DQWA 1BEUA 1T5AA 2P0IA 4CN6A 1UR1A 1W9PA 4JHOA 3PHAA 3PBMA 2PDFA 3LU2A 2WC3A 7TAAA 2FH6A 1LZOA 1ZAJA 2JIWA 2GK1B 1XQKA 2ZUVA 4HYRA 2NX1A 1W9VA 2HCVA 1EQPA 1J0HA 1MW3A 5LIXX 3HPXA 1CB2A 1JPDX 4UB9A 4IGSA 3SRKA 2YPIA 5F2MA 3MPGA 4YYFA 1A53A 1WUFA 5HMDA 3NPUA 1TELA 2ZUNA 1A50A 1MDLA 3NOYA 4UOZA 5E0FA 4ZFCA 3VO0A 3R0UA 1CX9A 1S5VA 1I2OA 1IWPA 4P61A 4RE3A 3ITCA 2INZA 4Q8QA 5U7SA 4NZ3A 1H1YA 4CU6A 2NUYA 5C54A 2FZ8A 3EWBX 1C8VA 1WZKA 2YSWA 4KFOA 1ZB5A 3RUBL 4V1YA 3R0KA 3OVQA 4L9XA 4Y2WA 1NM9A 2NQ9A 4Q4KA 2XVPA 3O9NA 3CUXA 1Z44A 4JYEA 2CC0A 4KEMA 2WM1A 3B4YA 2J8TA 4FLQA 3SQMA 2PDHA 3SECA 1UQYA 1TWZA 1Q4WA 3BURA 3ARXA 1KFWA 4JAWA 4WKHA 5G1TA 2E5CA 3W1AA 1QHOA 4FSAA 1YYAA 2EXOA 3EB2A 3S2LA 3UA3A 4LW7A 4YTQA 1U5VA 2XVLA 4C6EA 1HVQA 1PTGA 5D9OA 5ABFB 3WLTA 1DV7A 3OU8A 3UETA 2ODOA 4AW7A 1Z89A 2OB3A 1VFMA 1MXDA 4UR7A 5CPSA 2NQLA 4UUIA 1AL8A 1S39A 1J0YA 2QV4A 1XLFA 4B5SA 4YLWA 3VIFA 1HZYA 1G69A 3CGTA 3W53A 3GDKA 5DY2A 3H4XA 1PYMA 2C6QA 1PWMA 3ZR5A 3QH2A 4PULA 1XUUA 3MWCA 4IJBA 4ZB5A 3MWAA 3VKDA 1IYXA 1ICQA 5BCAA 3KBMA 3WLKX 3PZIA 3WF0A 4LNCA 1QK2A 1FWAC 3S6TA 4R88A 5D2YA 2WMKA 3CZLA 1PHWA 1XS2A 3ZS4A 1QK0A 3HOJA 1RCXB 3M43A 4HOZA 4DYJA 1W32A 3UXLA 3LLDA 5AYIA 5DT5A 2P10A 4GK8A 1E0XA 2YGYA 1E1EA 5I3IA 1XLLA 5HMSA 1R6WA 3VDCA 1KBJA 2GGGA 3I3BA 4GFIA 5L6UA 5ECUA 1IT0A 4LV4A 1EDQA 3EKGA 3G1FA 5IXEA 1XDLA 4IPLA 1OCBA 2PGRA 2X05A 1AJ0A 3B8VA 2NQJA 3RX3A 1B3VA 4CQ8A 1L9WA 4C6MA 3NDYA 1J01A 2PC8A 4IIHA 1QNPA 3NQ7A 4DAIA 2CKRA 1OX4A 4AZ7A 1R3TA 3RX4A 4C6CA 3KHDA 4TVDA 4MAZA 3AIUA 1R3SA 1FHLA 2I57A 3ARWA 4JYFA 3SDOA 5A6JA 4IISA 5LA0A 3G1RA 3VYLA 1BYAA 1O5RA 3KTCA 1QPOA 1J6PA 4JTAA 4LYQA 2QAPA 4Y6GA 4LC8A 1P0BA 4W84A 2PDBA 4US5A 1A0CA 4PMYA 3S0CA 2TODA 2VDIA 1H62A 4HYVA 1FKWA 2QAFA 4KQNA 1XI3A 2PDKA 2WVTA 1X1ZA 1O5QA 3IUHA 3HGOA 3W00A 3HN3A 3EOEA 2O55A 1BVZA 4IUOA 3MHGA 4ATWA 1R3VA 4GABA 1E1FA 5DN1A 2FZBA 4IPNB 3W1LA 3LNMA 1ZRQA 3L4TA 4IQLA 3KDOA 4WDWA 3ENLA 1CXEA 2V81A 3FLUA 5K9XA 3WLJA 2DZXA 1BG9A 1PE1A 4NJKA 3H55A 2DVXA 2I9UA 1FWSA 4LUYA 2VQUA 3WF1A 3CMJA 1UWRA 1E73M 3B0PA 3VOHA 5LGXA 3CQJA 4GVGA 4NG3A 1M9HA 3CMFA 1TV2A 1QU4A 1SZRA 1QJWA 4FI4A 5CC7A 3N04A 4NYYA 4ORMA 4PR4A 3KOZA 5A6BA 2V6AA 2Z6IA 2ALRA 1GOKA 3QTGA 2QF7A 2NX3A 2ZE3A 4K37A 4RE0A 4UNIA 5HDRA 2CIPA 4JNMA 4GY0A 5GJPA 3TTQA 1E40A 2GWGA 4TTUA 4IMCA 3HFTA 4FNTA 4A2RA 4I5XA 1ZAIA 5REQB 3S9ZA 3MUY1 1Q7QA 4DF2A 3LXBA 2E0PA 3ELFA 3CTLA 1CNVA 3TR9A 1E9ZB 2QHAA 4GIRA 1NARA 4L5ZA 2V8ZA 2WK2A 4HP5A 1VF8A 3CIWA 3V35A 2B7NA 3AMCA 3GW0A 3GRIA 3CL6A 1V7YA 1Z6KA 2HROA 2RHGA 1BQGA 3LM3A 2Z25A 3VIPA 4ADTA 1UD5A 4HZMA 1EYWA 4IPJA 3L4YA 4H7CA 4ZQOA 2QNEA 3ITYA 3FHAA 2XZ9A 5A1AA 5GPRA 3VE7A 1GJPA 3B9DA 3CJPA 3PBUA 3BOFA 4A4AA 1D7FA 1NOFA 1RVGA 3QQ0A 1L6SA 3LHTA 4O53A 3WMLA 4S39A 1GKRA 1SFLA 1EHAA 3NZRA 1UWAA 3GYCA 4QS6A 2WMFA 3LM7A 1ZL1A 4AHPA 1XYLA 3CUZA 5CPMA 1C91A 3STCA 3UPWA 5KETA 4UTIA 3L21A 4CQ9A 1FCQA 3BV4A 1DIEA 5C55A 3DCPA 4LRSA 4LEQA 1AH3A 3A4JA 3A4AA 3WG6A 3L0NA 4GI4A 1DQUA 1FWWA 1M68A 2R91A 1J0KA 1KTCA 1EWDA 1BXNA 2PB1A 1IR2A 3S5SA 2PRMA 4E3VA 2BP1A 4W4QA 4B5NA 4LQ1A 4WLCA 3M1ZA 3EMZA 4AEOA 2PU1A 2ZC1A 3WH9A 3M6DA 4L4MA 2RDXA 4LSBA 3WNOA 4E3TA 2Z29A 4G7EB 3VZYA 1ZAHA 3ARTA 1H7WA 3CB8A 3DC0A 4QE1A 3N2OA 3GNOA 2VD8A 4DUWA 1S1PA 2PZNA 2OU4A 4Z08A 3CTTA 4Q4SA 2IPGA 3TMLA 4C6QA 1CGWA 3U3HA 3P60A 3FOKA 4DO6A 4MUZA 3SURA 2ACUA 2VCAA 3OZPA 2CLPA 4J40A 1BFNA 2E6DA 3KBWA 5HWJA 2E5BA 2F7FA 1UUOA 1ZJBA 3WLOA 4M80A 2VVSA 3WO8A 4D1IA 4PUJA 2WMJA 2QUTA 4Z2KA 4LEFA 4QGCA 1FH7A 4W5UA 7CGTA 1YDYA 3GVRA 1W2VA 5D09A 3LI1A 1XGZA 2X40A 1ADSA 3C61A 4LU0A 1O4UA 3WBEA 3AHZA 4PCSA 4PYSA 4U3CA 4HT3A 1N2VA 3UGRA 5A6TC 3LSBA 3QFEA 1RAKA 2W4XA 3SRHA 1NF0A 4TV6A 4RZ5A 3W2NA 1EO7A 3KVKA 4QJ5B 4W8LA 3EWYA 5JH2A 3S8HA 1TMQA 1LQ0A 1MVYA 2EKCA 1C9DA 2ZUMA 4MTVA 1NFPA 5BMWA 1H63A 4ZQNA 1ADOA 1JYNA 3UYCA 2REQA 1KM1A 1RA0A 1XBYA 4ZE4A 2QUVA 5BU6A 4M82A 3P82A 4WHBA 4WXYA 3L5AA 3O07A 3BW4A 5H91A 3WQDA 1VS1A 4Q3MA 5BNKA 1J96A 2YKKA 3K5XA 5HQLA 1F73A 1VKFA 2ZXQA 4MLJA 4QJ1A 3PWGA 4HA4A 3ZM8A 4BEUA 4G7FA 3PPHA 3ZSTA 2HNEA 1Q2SA 4M7SA 4DXKA 3THAA 3E5BA 1US3A 2FHCA 1P48A 1RBOB 2GDVA 4ZB0A 3BV7A 4DYEA 1W9UA 2B31A 4GNKB 3OQEA 1DVJA 1OEPA 1K9TA 2EO7A 4J2PA 4IQDA 3CBWA 4AF0A 1Q6DA 1IEQA 3GXNA 2PRHA 3R89A 1ZU8A 1A5CA 2DIKA 3HGSA 1IXPA 4O1EA 4BI6A 1RUSA 1GVEA 2RGLA 3G1XA 3BLPX 3IUIA 4A29A 3E49A 3NQ2A 3PPGA 5AYZA 9CGTA 1E6NA 3BSGA 4M6VA 4UXDA 1OADA 1O95A 3W2MA 3CUJA 1P0NA 4JTCA 1DP0A 1F6PA 3KCLA 5CC3A 2ZX7A 4UQBA 3QZAA 5E9XA 5FSEC 1KM2A 3ALFA 1JRCA 4NX5A 3TVAA 4D9PA 1J5TA 5FAGA 1W1B1 4S1FA 1HJQA 3AYRA 3QSTA 4L1WA 2V67A 4R7WA 3T08A 1IZKA 1W3TA 5EMYA 5CG7A 5KZ6A 7PTDA 3B97A 4KGJA 4N9BA 3ITXA 4RDWA 3ABOA 3T0BA 4LVFA 1E4LA 3WLPA 1LL7A 2C18A 3CAVA 3FEQA 5AYXA 3TN6A 1BRLA 2BVDA 1JDDA 2X1RA 1ZNNA 4V27A 6CGTA 4UIOA 3TR2A 4KEVA 1UKPA 3MUIA 4EK7A 4QLLA 4DO4A 3TLLA 4DXVA 2XFYA 1F3XA 2DT1A 3S3GA 4F2TA 1ALDA 1POKA 2POZA 2QVNA 1LUCB 3NM3A 4TTGA 4TIMA 2DSUA 4EIVA 1LQ2A 5HNTA 1VZWA 3QFWA 4GVFA 1UD3A 3TW7A 3Q37A 4D6HA 2JF7A 3WNNA 3A5FA 3AIRA 2Y8UA 4JX6A 3WCZA 1W31A 4AC1X 4XG1A 1OT1A 1KBLA 1J4EA 1PL9A 1RK5A 5D05A 4A05A 3E3HA 4JS3A 1EUNA 2PTXA 5J04A 3ZT6A 3TFXA 1E9LA 1XLJA 5A2AA 4H6QA 3R8HA 4J3XA 3GU9A 5H8MA 4O17A 5HNUA 4MFDA 1YBQA 4BKNA 4IMDA 3R8GA 2QDDA 3L4VA 4UZSA 1HVXA 4UFKA 1AG1O 1BYCA 1K7XA 4DBEA 4N7QA 4DI8A 3UVAA 3QHMA 1V79A 3H6OA 5C70A 3NO1A 4F9JA 1KM4A 1BGGA 3GVQA 4S3FA 3VUSA 4DWSA 1U5JA 4AHQA 1DXEA 2CZVA 1JPMA 1J0ZA 1TJ1A 1Z9AA 1NWUA 3CHEA 2Z0IA 1TFVA 4WEVX 1V02E 4IPPA 2HPMA 2DQXA 1UB3A 1OINA 2YCIX 3N14A 1WO2A 3THCA 2E6YA 3MBFA 4Q8OA 3WQCA 4DIAA 1IR1A 1KM0A 2A5HA 1C3FA 4H41A 1TSIA 4JTHA 1HT6A 2GWNA 4X9YA 1CXKA 3BMXA 4D8ZA 1OYCA 1XYAA 1HO1A 4U2ZA 3CYVA 3V36A 1AH4A 1B3XA 4Q4OA 4BQ2A 4MDOA 3BE7A 3WF4A 1A5OC 1E6ZA 2ANUA 2V3FA 4CVUA 3OZOA 4ZSTA 3EX2A 1T41A 1VYSX 1HKVA 4MFEA 2ZRZA 4AG0A 2VX4A 1PIIA 3NQAA 3XIMA 4JFWA 2HJPA 2REQB 2Z1KA 2LLEA 4DELA 4M6UA 4GUJA 4ML9A 5EMLA 1TJ0A 2ZUUA 3P2VA 3RO8A 1XLAA 4IGHA 4IQEA 4BHYA 3LHWA 5CGQA 1Z69A 3RF9A 2PTYA 2VDGA 4M24A 2V68A 3WLSA 1GNXA 3KCOA 4ZTYA 1Q13A 1L0PA 2Y5JA 3TAOA 5D04C 3TC7A 3ARZA 3UR2A 1X1NA 4FO4A 3W1NA 2GUBA 4NVTA 1XH0A 4C5ZA 1EX5A 1PZ2A 4IF2A 2J13A 3TH6A 4H6KA 3GHTA 3GXDA 3LERA 3PBGA 3M7SA 3D3FA 2VL4A 5AC7A 4Q22A 1V02A 2OX1A 3ZWSA 1S2VA 1B4EA 2P88A 1O68A 3MCOA 3S1XA 2PDXA 3DHDA 4FNRA 1V8EA 2D69A 3WQWA 1NWTA 3VNDA 1N8FA 3NQMA 4IIEA 4LYRA 1BAGA 2Y7FA 3BAIA 2DQWA 2VFEA 1TUFA 1BYDA 3HJEA 3NSXA 1EF2A 1PIGA 2DH2A 4DZAA 1JCTA 3H22A 3UNTA 4KF1A 2VELA 2HVOA 4WXZA 2DIJA 2Q3OA 3AYTA 1UHVA 4PTDA 3M64A 3GC5A 2Q3RA 3FS2A 3UG8A 4H8VA 1Y5VA 2OZ3A 5TNVA 1X96A 1U1UA 1TIWA 4I7VA 3CMGA 1HKJA 3QLDA 1R47A 1RH9A 4Z2IA 2DORA 3UP8A 2A6NA 4N4QA 5MKGA 4GC4A 3SFKA 3ZJ8A 4QX4A 1E71M 3L66A 1W1VA 1F8IA 4QITA 3FDGA 1YTDA 2J7CA 2J7FA 5H1WA 5E6ZA 3BPWA 3LRKA 2CBVA 3SCPA 4A3RA 2D73A 2PS2A 2VX7A 3UGVA 1BVNP 3TYAA 1NDYA 2PDPA 1K4GA 5CEWA 4GVHA 1H5VA 2YXOA 1T6MA 4WF7A 1GHRA 1E0WA 1W3KA 1R2RA 1BRLB 3K4AA 4GQQA 3OBKA 4Y9MA 2ACQA 1DXIA 3T07A 5HQMA 5CZ0A 3B9OA 2XH7A 3K4WA 2PURA 1W0MA 2I56A 3NZPA 4QEHA 2Y70A 2WBGA 3UESA 4IHCA 1VYPX 4XTDA 1WZLA 3NGJA 3PN8A 3EOOA 2VGBA 2VYOA 4TVUA 3CHFA 3H70A 4HSNA 4MKVA 5G2IA 1PS9A 3T2OA 2PDWA 3P67A 4UBPC 1EDTA 1FWBC 5EY5A 3EXTA 4XAYA 3GXFA 1VPQA 4F4RA 3ANUA 4QNEA 4ZOBA 3U5UA 4J27A 1H49A 1RD5A 4GH3A 4PZVA 2ABAA 2GGHA 3I6TA 2OXNA 3U4FA 1VP5A 3I7SA 4OBTA 5AFDA 1E9IA 4LAMA 4JQ2A 1ZP3A 2XDFA 4B5VA 4A35A 4IM4A 2OSWA 4PBGA 3V16A 5ENLA 4B2DA 3QQWA 4RNFA 1IV8A 2ATSA 3EKLA 4RX0A 1JCLA 4YCPA 4OZOA 3FV9A 3AMKA 4J5NA 1TPVA 3UXIA 1YBQB 2GJXA 3KCJA 3BLFA 4YVXA 4OOUA 4MYXA 3SR7A 3U48A 2YYTA 3FFSA 3FKRA 1R85A 1J2WA 1I2PA 2XIBA 1MNZA 2R94A 3W1QA 3KM8A 2D2JA 3CH9A 2Z1BA 3NJ3A 5FI8A 1M5WA 4KWWA 3SRFA 4MYAA 1HIZA 1XG4A 2RDWA 1TTJA 3BGAA 2E9LA 3SCTA 1W6TA 1XC6A 2DFAA 1NFBA 4NYUA 1EJXC 4IIBA 2ZVIA 3WX7A 3R1ZA 4UTHA 4GJ1A 3BVJA 2WLYA 1W3LA 4PMZA 1VEMA 1OVDA 3AXXA 4CQCA 1HP4A 1GQKA 1AQHA 2YB1A 4KWUA 5I3DA 1AK5A 4BI5A 2FZMA 4D6FA 4AH7A 4Y90A 3EX4A 2CESA 4DBSA 1OG6A 3OLEA 4BCEA 5FEXA 2A3HA 5FA5A 2JQXA 3V7PA 1UH3A 4QS5A 2J47A 1A3WA 4HPXA 5GNYA 4LCQA 1GW9A 2OLSA 1XIFA 2AMXA 5AN7A 5DRCA 1NY1A 3IIZA 3I7QA 2XSBA 1WBHA 2Y88A 4N2YA 2XZ7A 2Z00A 4JTRA 4FHAA 4I6VA 4I5UA 4GKTA 1TMLA 4BQ5A 3RU6A 3HB9A 4BF9A 5GJMA 3WBYA 1DPMA 1TPWA 1EH9A 4FOJA 4Y9AA 1ZSXA 5A6AA 3UPBA 3PZGA 5G4EA 2PF0A 2G4FA 3PPCA 3HF3A 3TTYA 5A2CA 4GIEA 4D8LA 4HNOA 3ZXWA 4FEZA 4HIBA 1UKSA 2XFWA 4DUXA 2ZFAA 4C1LA 2RH9A 2C71A 4IIGA 5DXYA 2ZRVA 4CCDA 1DE5A 3NL6A 3W71A 4RPQA 4KGLA 1ZENA 2PZ0A 5GJNA 4GXWA 2VRKA 2OODA 1DJWA 3RAOA 3F4DA 4GYPC 3MQTA 2IKJA 2YCJA 2HZGA 4EXBA 1DHPA 3SSJA 2BXYA 4AISA 4BA0A 4MWAD 3M9YA 3IIOA 1DL3A 3PY2A 2XIJA 4OBSA 3OB8A 1EXPA 3WJSA 4S3GA 1VFSA 3SO7A 4P8WA 1P1MA 2CERA 4AZHA 4AEFA 3P93A 1X8CA 3LOTA 3AIWA 4AZCA 1MUMA 3UNDA 4B9YA 1GOXA 4PMUA 5IHRA 3ZWTA 3NL2A 1Z7AA 1Q85A 5TQLA 5LNSA 3ME3A 2ABBA 3MSYA 3GHUA 3QW3A 4J2MA 1EGZA 2V38A 3H4WA 3E0IA 5AZ1A 5M5DA 3GNPA 4C6BA 1B57A 2V3DA 3GHSA 3V5FA 1K8ZA 1PO9A 2PGFA 1OWQA 1AW1A 4F0SA 4PODA 1EXBA 4B3KA 4MADA 2SFPA 5LHEA 3NA8A 3MDWA 3ZR4A 2X41A 2VXNA 3AHYA 3CHCA 2TAAA 5M17A 3N29A 3AO0A 2CLMA 3BLOA 4G5DA 3V5CA 4W85A 3APYA 3C86A 2AGKA 4GJJA 2EEXA 4BR1A 2PCEA 3KZSA 1MEIA 3E0LA 3P0WA 2PLJA 2YA1A 2CFFA 4Z1DA 3WD3A 4Y7EA 2DT0A 4HA1A 4GI8A 1G7UA 4JN7A 4MWAC 3OP2A 1VBRA 4LBRA 1H1ZA 1M7JA 3SJ3A 1A5MC 5D38A 1LG1A 1X6UA 4ZB2A 2OGYA 4QHRA 3S2NA 4ENLA 3IVTA 1Z48A 1TPEA 4JTGA 3E2SA 3V3WA 3WBAA 3KS6A 1TQJA 2GPTA 4K68A 3PJXA 4W7WA 4RV8A 3GIYA 1GYLA 1ODZA 1PCKA 2W63A 4Q7BA 2X7WA 4DZHA 1QPKA 4NNCA 3VABA 4DEFA 3LV5A 4R3UA 4C7GA 1RXOB 3NO5A 2WV8A 3DKLA 2YL5A 3RCYA 4HOXA 4JTQA 2DY3A 2PD9A 3S1VA 4UTTC 5FCZA 9XIMA 4ASTA 3N1AA 4GYJA 3NXLA 4PCPA 3N6QA 1KB3A 2GJXB 5JU6A 3TU9A 2HK0A 4P7LA 4BJHA 4EPEC 1M1BA 1QTWA 3APTA 4HPHA 4AD5A 2JGQA 1JNEA 3Q67A 4BWLC 3R58A 3EMQA 5DXXA 1XLMA 3B8UA 1XD0A 2QGHA 3W7OA 1TX2A 3S2CA 1T96A 3BJSA 3TZFA 2EPHA 1WUEA 3W22A 3A64A 4AAJA 3RM9A 3E0VA 5EB8A 1PKNA 3E74A 3PTKA 4PEKA 3KL5A 1PKLA 4UZUA 1TVPA 8CGTA 2PDNA 4H8UA 3EEGA 3YPIA 3FJLA 4XVEA 4F79A 1XICA 4F3HA 2CETA 1XPGA 4CD5A 1K70A 1E6SM 1MDRA 3P14A 1M6JA 2R1PA 4QEEA 3KRSA 2YA0A 1UA3A 4C1KA 5FJIA 4EWJA 3KFTA 3O6DA 1R8LA 3T9PA 2QMKA 1UR2A 2PDQA 4L6OA 5C9UA 1RY0A 3QC3A 2BY0A 4O4WA 3W3OA 3EWDA 2QS8A 3A21A 4CN4A 2C0HA 4HNNA 3W83A 1EFZA 3UWQA 3VDGA 3EX3A 1ZS2A 1H2JA 2DVTA 1YPIA 3VDBA 1J9YA 3ZZ1A 3S6OA 3EMCA 5HQEA 3CAQA 3MI3A 3RILA 2EPOA 1V6TA 4A8RA 1VCGA 1LOLA 4HMEA 4OUIA 3CAKA 1MSSA 5F1UA 1A49A 3CNYA 1WQ5A 1ONRA 2NVCA 4HZ7A 3K1GA 3WNLA 2NX9A 3KTXA 4HCDA 3N4AA 5DBUA 3CQKA 4PMOA 2XTKA 1OFRA 4XZ9A 5CJ5A 1MZHA 4GX9A 4IXHA 4O4VA 2DU2A 1KKRA 4HMNA 4V2XA 2BVYA 3U0HA 4IX2A 1IHIA 4ZOAA 4ZENA 4X60A 1TV7A 4JFVA 4UTUA 3QTPA 5D2XA 4ZO9A 3MUZ1 3L2IA 3D0CA 1RBAA 3CZGA 1K03A 2WM0A 3VD5A 4DBUA 1LG2A 2YIHA 4BS0A 4A8IA 2F38A 3U4AA 3KXQA 3DHPA 3NURA 4MJZA 4IQJA 3PSVA 3O6YX 4RW5A 3WLLA 1Q2RA 1DWFM 4RCXA 1G9HA 4L4OA 4W87A 4Q8VA 1QFEA 3UZXA 2KAUC 4LALA 1OM0A 3WQ8A 3TUUA 1GQNA 4GUHA 2WHLA 3R12A 3WDHA 4M6QA 3VTRA 2QCGA 4FNSA 2VFIA 6TAAA 1W9DM 4AZCB 5A6KA 3MY9A 3GG1A 3T42A 3GAKA 1PDZA 3UVIA 5CSUA 3W1TA 2FPTA 2DZWA 3LY0A 5G5IA 3HA1A 3HM7A 4JTJA 1HL8A 4JHZA 3G8EA 3B0UX 4K2SA 1FHVA 3MI6A 5LKYA 4NJHA 1VYRA 1V3IA 3EOUA 2DT2A 1KCKA 1SZEA 2QIIA 4GHRA 4BQ4A 1EJSC 2DSVA 4FR6A 3W88A 3RJXA 4RNIA 1S5NA 2H8ZA 1OG0A 1MUCA 2VC9A 1QOPA 1X6NA 4S3JA 4FZIA 3HG5A 1XR2A 2AKMA 2F9RA 1KR1A 2ZXDA 4WDTA 1D8WA 2CLOA 3PG8A 2POTA 5IRPA 3C6CA 4E38A 3DG7A 3NQ6A 4PMJA 3PM6A 1EWEA 2YW4A 1XGDA 3KDNA 3T7VA 4PCNA 3SGUA 4L56A 2C91A 1ZJIA 1UH4A 4F0MA 4HBKA 2X30A 2Z4GA 3KZPA 3WBXA 1XDJA 4DM1A 1W9XA 3SIMA 3BAYA 3WLNA 2DSKA 5FSDC 3WUBA 5DBTA 4J3SA 4ZVJA 2WVVA 1LBMA 1UJQA 5F7UA 3KUMA 1A4MA 3STEA 2XINA 4UR8A 3TKFA 3PTDA 1VQTA 1CYGA 3O1NA 1NIUA 4E2BA 1MRAA 4JTFA 1BF6A 2QJMA 2VZUA 1CWYA 4MNMA 4NSBA 2YCKX 3GFXA 3WLMA 3MHUA 4NT0A 2JIEA 2HS6A 3LZ5A 2OVLA 3RYSA 3LBMA 4WD0A 3VNMA 3CEUA 3AHTA 2EG6A 2Z6JA 3H2OA 4IG2B 4JCLA 1E9YB 3TOYA 1AJZA 3MCMA 1W3HA 1S46A 1V6YA 3VD9A 2OWWA 5LNRA 2VQTA 3C0QA 4O11A 1FH9A 4KW2A 1JD9A 4GQRA 2L5HA 2VZTA 3BANA 3QPZA 2O7SA 3IGXA 1VGAA 3GDBA 3VD3A 4S2CA 2D2HA 3RMJA 3NL5A 4ZODA 3DH7A 5T26A 3STGA 4ICCX 2G3JA 2V5JA 3LMZA 2FPYA 3MVIA 2Q09A 1IQ8A 1IZCA 5CZTA 2FTYA 1XQLA 2H9AA 2OKOA 3WF2A 4YMZA 4UTKA 3KAOA 4IJRA 3NTYA 4ICMA 2Y2WA 4HGXA 3LPPA 3BQ6A 4O12A 3ONCA 4DLFA 3PB0A 5FJUA 3DOPA 1DEDA 1XIEA 1OX6A 1YTEA 3H2MA 5DMNA 3U2OA 1PYFA 3K8LA 4R9XA 5I79A 2Y89A 4QFUA 2UZ9A 1XIHA 1U30A 3MT1A 5AHEA 1FA2A 3TQVA 4WVXA 3EWWA 4H01A 2EPNA 2PEVA 3AZSA 4IIDA 3IGUA 2WHKA 5IFPA 1F8MA 4GNJA 1WDDA 2JF6A 3OQ8A 1EC9A 4JDBA 2WVUA 3V75A 3TAKA 1TE1A 3K4DA 1EP1A 1EL3A 3U9IA 4UFLA 1XIDA 1KNWA 2QLYA 5JVLA 1XDMA 4MPKA 2ZZ5A 4QDPA 4Y96A 2NLYA 4Q8NA 4R5EA 2R14A 3SCWA 1Q6LA 2UY4A 3DZ1A 5M3WA 1XGEA 1C8QA 3WJZA 3TV8A 1W1TA 1JCJA 1GTHA 4Z2LA 2OJPA 1WOBA 2XGZA 1OFBA 2YCLA 2BY3A 2WANA 4CCZA 4GX8A 2WNQA 3W7KA 3GKAA 4MF4A 3TC3A 1BWVA 2C19A 3O6AA 4XZWA 4JQ1A 1PWLA 6TIMA 4BF5A 4OIFA 3R7MA 4ZO7A 4RZBA 4ACZB 3WEZA 5CBIA 1QI4A 2NXGA 4GYFA 1EA9C 3JRKA 3DKJA 3A4WA 2FFIA 4MWAB 1EC8A 1YDNA 3VOFA 1OY0A 5A2BA 2IKHA 3WNKA 2V5LA 3QHOA 4MY8A 1RSCA 3LG3A 1SVDA 5IOBA 1JUKA 3N9KA 3ABQA 3QR1A 1PX8A 1TPUA 1TCDA 4OJYA 3HURA 4M7TA 3ZMRA 2I5QA 3WIJA 2X1UA 2ATMA 4YCOA 2O9RA 1ISXA 3H7RA 4LUTB 3HQOA 3ID7A 4WJEA 4EPBC 3WQEA 2VEIA 4P8XA 4LT9A 3KLKA 1M7PA 5CZSA 1IWBA 4R7JA 5F1VA 4CEXC 5K4XA 2RDUA 3IGHX 1YDVA 4A2SA 1EUAA 4ZTXA 3HPFA 4DLMA 5CC5A 3KOYA 1ONXA 3AAMA 2HS8A 1EYEA 4O1DA 3OW1A 3OZMA 4RLIA 2DT3A 2PC4A 1G7VA 2GVGA 4UTFA 4MDPA 5K4ZA 3M5ZA 4D1JA 1B3YA 1K6WA 3LCXA 4ICNA 2QQ6A 2WC4A 1GK8A 2I14A 1QPQA 1HJSA 4AZIA 3F5JA 1DJGA 4I9AA 3A47A 4GI6A 1AJ2A 2OQYA 1SMDA 4K38A 1QNRA 3K8KA 4DJEA 4X2PA 3NGFA 3C3NA 1GOOA 5DY3A 3AJ7A 4P2VA 3B40A 4CLMA 3N73A 4AZ6A 4IIFA 1BG4A 4AD4A 1XX1A 3IVUA 3WMBA 2GVEA 2Y62A 4PSRA 1Y0EA 2QJHA 1CGUA 4GBUA 1Q65A 3MANA 1GEQA 2CPUA 4XD6A 3GC2A 2CLEA 1B31A 2ONEA 3W85A 2EAWA 1DJIA 4GKLA 1OFPA 1XBZA 3CWOX 1VHCA 4LS1A 3F4VA 2A7PA 4AWTA 3GFYA 3CO8A 3DECA 4L61A 2QKFA 2J66A 2WW5A 3OLIA 2CBJA 1Z3NA 3CQIA 4S3EA 1XLEA 4TV5A 2G3MA 1FRBA 2BG5A 2E40A 1UH2A 4GC3A 3UFYA 4HU8A 1OCNA 5F2LA 3H2AA 1JYVA 2WVVB 2W6RA 4KCWA 1R87A 2OSYA 4DNHA 2NV9A 1V3MA 1UIOA 2HNHA 5D2VA 2YZ5A 5CG0A 5F4WA 1LYXA 4DY1A 3SN0A 3MZ2A 3KTSA 3AIQA 3G1YA 4G6CA 4RUBA 3ONBA 4Y9NA 2QPXA 1I45A 5HJXA 2Q8ZA 1PTAA 3QM3A 4N9DA 1S5TA 3PSWA 2YL9A 4EWND 3HG4A 1QNOA 3DYMA 3V1HA 5PTDA 3XISA 1XINA 3QF0A 5HATA 1KA9F 3WSUA 3SCVA 2CXGA 3W75A 3VA8A 4EX4A 1XCWA 4M1RA 3REQA 1UWIA 1QW7A 2X1TA 1XSIA 2NSOA 1FUYA 3W6MA 4UMCA 3WD2A 1JIBA 3GVGA 3IVSA 4IOTA 4NXSA 2W3ZA 3TN5A 4LB3A 3A22A 3I7RA 3IJDA 1C93A 1RQBA 1XIIA 1PDYA 2VOMA 2R6OA 1A4LA 1OGGA 3B06A 3T1GA 4LUJA 3MSGA 3PB2A 1DWIM 4X61A 2VRJA 1FDZA 4DX3A 4NZ5A 3UXDA 2OOFA 3GY1A 3TXZA 2ZUSA 1P6CA 3MDUA 3I3DA 4WSHA 2V69A 1P4CA 4U10A 1RJRA 4P7RA 5KEZA 1LP6A 2OELA 4GGBA 3HJZA 5A8PA 3DN5A 4US6A 3NQGA 1P7TA 3G1DA 2GJNA 4O0KA 1ZBCA 5SWUA 4FIRA 3PAJA 5IDZA 1S2UA 4AX7A 1Y5XA 4O0ZA 3UD6A 1PSCA 4IFOA 1M41A 4FALA 2E67A 5BXPA 4NIRA 1AW5A 1US2A 3N13A 3BZGA 4PCFA 1N8WA 3UR8A 1CGVA 5G4WA 3W24A 4UCGA 3J7HA 2XSXA 3PG9A 1KXTA 1XRSA 1UIPA 1I2RA 3PF3A 4GVIA 4ATLA 3AZRA 4JTTA 3MV01 1JULA 3OHMB 1UP3A 2DSZA 1UC5A 1R46A 4J35A 4HPGA 1DQWA 3SEPA 2V82A 3T55A 4GZJA 1XKYA 4UNLA 2HVMA 3F4CA 3KHJA 2J7DA 4QM1A 1EPVA 3IAQA 2VUYA 3ABSA 1I6NA 3M0LA 3EA1A 1TR9A 3TQKA 4XV0A 3N2CA 1E51A 2J8GA 2V2HA 2VJXA 4CGTA 1SSDA 1HFBA 1GQJA 2J79A 1E4MM 3NDOA 4WY0F 4YWIA 3FVMA 1W2PA 2OQLA 1S2AA 4TMBA 3V0TA 1WV2A 2QCEA 1ITQA 3OBEA 5FEZA 2YA2A 3V1PA 4LYKA 1DWAM 1QATA 3T81A 3DI0A 3W37A 4OV4A 4UQ9A 3I3EA 3GAYA 3HPAA 2E09A 3F5LA 3GU2A 1DIDA 1UP2A 5CXPA 1H4PA 3LEPA 4O57A 1F5ZA 5I2UA 3LSCA 4XZHA 4DJDA 2X7VA 1SFSA 3BUVA 2ZXAA 4K7YA 3W7QA 1MRQA 4JN8A 2E5DA 4C1NA 3CL7A 2HWGA 3LS9A 4FX7A 2QCDA 2BXVA 1IXQA 3R8RA 3VKKA 3ARPA 2ZTKA 4GYKA 2UY5A 3POHA 1W3IA 2WMHA 1IXOA 1VBGA 3MSRA 2P8BA 4S38A 3R6IA 3U6WA 3BMVA 4RKAA 4IMFA 4DRSA 4M8UA 4R85A 3AMDA 4FXSA 3WD4A 3HO8A 5DQPA 5EFFA 4X3ZA 2OQHA 3MP3A 2OYKA 1V5XA 2VTFA 2XUCA 3EKZA 3ZJ7A 1DIOA 3P8JA 5HR7A 2G3NA 2IXUA 3W1PA 4H9ZA 4JX4A 2PDGA 3V18A 2I5GA 3SI9A 5G1MA 4KESA 2Z1XA 1XYFA 4H04A 1ICPA 3SSZA 4B90A 2GGEA 3LXAA 2BY1A 3SAZA 4AHOA 1Q6EA 4JX5A 5FESA 1UMLA 1F05A 4LVAA 4NQ1A 3GIPA 2G0WA 1JXKA 1NQKA 3O7UA 1ZBWA 1J0JA 5I3KA 4G8TA 3DGBA 4MY9A 2Y1HA 3GUWA 1KRBC 2W9MA 3LYEA 4KWVA 1QNQA 3KWXA 2UV8G 3B4UA 1XIGA 4JQ4A 1FX6A 1QI5A 3LPOA 1FHUA 4CNNA 4AIOA 2C1HA 1UR4A 3BOXA 3SQLA 4MJMA 2O56A 2CBUA 1L2UA 5HAOA 3FDKA 3TW6A 3MMDA 3LK6A 3UWVA 4W7UA 3BXWA 3NPVA 5LHFA 4XD5A 1JCMP 1BLIA 3VCRA 1OX5A 1QPNA 2PI6A 3VZXA 1TTQA 2ISD