1C93A

Endo-beta-n-acetylglucosaminidase h, d130n/e132q double mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFNDQYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
total genus 90
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c93A00
3BCDA 4CN1A 3AZRA 1N82A 3GBEA 3GYCA 3AXHA 3POHA 3PZTA 3NDYA 1E0WA 1D7FA 1D3CA 1NWSA 1VENA 3RM9A 1UG6A 4M1RA 3W6MA 1MQQA 1J12A 4FLRA 2DH3A 1KWGA 4BA0A 3NSNA 1J11A 1ZB5A 2E8YA 2WKGA 3WFLA 4CU6A 4F79A 4P7RA 4TOQA 4CD8A 1EO5A 2BXZA 1JZ6A 3NUKA 4AZBA 3IAPA 2QPUA 4C7FA 3WUFA 2WMJA 4Q7NA 2GJXA 3BAWA 3QOKA 5A6JA 4CD6A 3ARTA 4TXEA 2DSUA 2VMFA 1WKYA 4ACZB 2DQXA 1PAMA 4UOQA 2W63A 1LWHA 2W61A 1B2YA 1HJSA 1TA3A 2CERA 4IM4A 3VIFA 2VX7A 1JXKA 1IZJA 1HJUA 4OUEA 4RE3A 1HJVA 1F4HA 5DT7A 2W66A 4P8UA 1WDPA 4UOZA 3WNNA 1JI2A 3CHFA 1QHOA 4CVUA 3F5JA 1KXQA 3BAJA 5A6KA 4M81A 4U2ZA 4P7NA 1TVPA 1H4PA 1BYBA 4CKQA 4Q22A 1E1EA 1CECA 1BFNA 4M29A 2W62A 1XSIA 1JFXA 1XD0A 1UKPA 4QP0A 4UNIA 1UOKA 2PI6A 3VMNA 1CGVA 3O9NA 5A6AA 3ZQ9A 1LJYA 5IHSA 2D3NA 4MAZA 4CU7A 2OYKA 1E6PA 2XIIA 1E4NA 1EGZA 3PTKA 4U3CA 4HPHA 1E4MM 1QNSA 1HJXA 3AMDA 4MB1A 5AYBA 3AMCA 1HKKA 2CBJA 3N04A 2VX5A 4A4AA 2WK2A 2EQDA 5HOSA 1QI0A 3W29A 1DWGM 1NOWA 5D8WA 4W88A 1AQ0A 3TTSA 1JDAA 1HN1A 1W9PA 2OWWA 3RPMA 2B31A 3SCRA 1JAKA 1Q6EA 1V3LA 1E6SM 3T08A 3AHXA 2J7CA 3THDA 1H5VA 1M04A 5DEZA 1V08A 3WH5A 1PBGA 4MNKA 1E3XA 1KCLA 4GINA 1H09A 2VZSA 2WHJA 1J0IA 4PUEA 3NIYA 1GNXA 2Y4SA 5M3WA 2ZICA 1DWHM 1JZ7A 1E40A 4HA4A 3WQ4A 4DM1A 2BV9A 2WWDA 2GK1B 2X0HA 3VO0A 3LPGA 2E9MA 3WDHA 2YDSA 3WEMA 1GQIA 1UA7A 5AYIA 2BFGA 1JIBA 1K9DA 2CHNA 1OWQA 5GNZA 4CCCA 1L0PA 1US3A 1P6WA 2J7GA 1UZ4A 2A3BA 4ZXOA 3FHAA 1W2PA 1EH9A 2G41A 1U30A 3L4VA 1JYXA 2ZX9A 4HTYA 4ATWA 4AIEA 2EXOA 4Z2IA 2CIPA 2D20A 1B3YA 2ZUWA 2XVGA 3VX0A 4HMDA 3WDRA 3SURA 4CD5A 1EO7A 2ZUMA 3W81A 3CUJA 2E0PA 3D5HA 3WQVA 4B15A 3AOFA 3WNOA 3S6TA 2YL8A 4OIFA 3U5UA 3CUHA 2WCSA 2XSAA 3AHZA 4UFIA 2WWCA 4HPGA 3M07A 2DPEA 3W24A 3HU7A 1GVIA 1Q6DA 3K46A 2DGAA 1V0LA 3FXYA 1OGSA 4L4PA 3OLDA 1KBKA 5C70A 2WPGA 5D9OA 4AD2A 3UG3A 1UD4A 2ZUNA 1BYAA 2BNJA 4UOJA 3SCQA 1W3KA 2J7HA 2JIEA 2VC9A 2VX6A 2WLZA 4X0NA 3MS8A 4V28A 2VNCA 4HOXA 3EDFA 1CENA 3ARVA 1MXGA 4MNMA 2ZX8A 1WDSA 1HL9A 1K9TA 4DWSC 4QLKA 1NOFA 3U7VA 3KL3A 1O6IA 2E4TA 1QI2A 2O92A 3DECA 1I1WA 1UD5A 1S46A 1UWRA 1HP4A 4PMNA 2VCAA 3NJ3A 4PN2A 4J28A 1E0VA 2WZHA 1M53A 1TZ7A 2XSBA 2GDUA 1EXPA 3ZJ7A 3IANA 3ZR5A 4R5EA 4JL1A 3EDJA 4B16A 1YQ2A 1UR8A 1UYQA 1RP9A 2YLLA 1ZL1A 1B0IA 4EK7A 3VDBA 3VGBA 1NQ6A 3WELA 2XWDA 2C0HA 1UKTA 1OIFA 1GOIA 1XH1A 4TUFA 5FKYA 1XRVA 5HXMA 2D1ZA 4LX4A 2YA2A 1EHAA 4UFLA 4UFKA 3KEHA 4CD4A 3M46A 3W53A 3CO4A 3WUGA 3MMDA 4AD0A 3UG4A 2WMFA 3VIKA 3GTNA 5A8OA 3PTMA 3ZJ6A 5CJ5A 3AXIA 3RM4A 2W91A 4PUDA 4HZ8A 1L8NA 1UH3A 3VIJA 2BHYA 4PBGA 3L2LA 1ITXA 1HKMA 2XHYA 2CHOA 5BROA 2CBIA 1E6RA 5IFTA 1JYWA 4RL3A 1ZBCA 4P7QA 3FN9A 1HJWA 4IPLA 2DT2A 4TVUA 1ISXA 1V6XA 3L2MA 1U33A 2QMJA 3A6OA 3WEZA 1ISWA 1FH9A 4QDMA 1E6XM 2DT1A 3KWXA 1YHTA 1JF6A 1C92A 3FHQA 4ACYA 3MUIA 4ACZA 2E9BA 5IHRA 2WAGA 5AY7A 4AZIA 4F9DA 1KCKA 2BY2A 5CZKA 4AW7A 2FHCA 2CITA 4JIEA 3GXDA 4UFHA 3TOPA 4IISA 4WLCA 4M56A 1B3WA 1UR4A 2VRQA 1R8LA 1E3ZA 2G3NA 3ZO9A 4PMOA 1GQJA 4CD7A 1R7OA 2XFFA 4AD5A 4LPCA 5JBEA 1G01A 5EB8A 4TTUA 5A3HA 3OLGA 5A6LA 1GUVA 3WY1A 3PBGA 1AQHA 5BRPA 2J62A 2OLHA 1UHVA 3QHNA 1V6WA 3ARSA 3VIOA 2WMGA 3NDZA 2OSYA 3NYDA 3WD3A 1GOWA 3QHOA 4QLJA 1W9UA 5CPSA 1FFQA 1Q6FA 3MKKA 4AD3A 1CPUA 2EJ1A 2FH8A 4KGJA 3W4RA 2W67A 3WN6A 1V3HA 3RMEA 1W1PA 4FK9A 2JALA 3PTQA 2WMIA 1E71M 3VU2A 4JAWA 4W89A 4AD4A 1WNOA 2PBOA 3CUFA 3FAWA 3SCWA 1BYDA 3VGDA 2EPOA 2TAAA 2WVTA 1E1FA 1OT1A 4WSJA 3L4WA 4NSBA 5CGTA 1UD2A 2F8QA 2VQUA 3CHDA 3M6DA 1KGXA 3UERA 1SYTA 4AZHA 4DWSB 4BS0A 5EFFA 1OT2A 4ML4A 1XH2A 4P8VA 1CBGA 4CGTA 1NARA 1VFFA 1ESWA 2Y8VA 5GNXA 2CPUA 1TFVA 3L4ZA 1JGIA 2YBUA 1LWJA 4UQBA 1DHKA 3WD2A 3I3BA 5BRQA 1KGWA 3RIKA 1X6LA 1CLXA 3WENA 1E9LA 3AIRA 3ARZA 4PMYA 1VJZA 1CGXA 2C8NA 1Q6GA 4HU0A 1M01A 3AIVA 4W5ZA 2JFEX 3AIEA 1R87A 6A3HA 3DHPA 3IK2A 4W7VA 4FLOA 3UG5A 1OD0A 4DM2A 2XFYA 1V02E 1C3FA 4Z2KA 3VIIA 4GXPA 2DSWA 1C93A 1B3ZA 3GBDA 5ABHA 2BS9A 2BXYA 3GH5A 3EBVA 3MSGA 3MV11 2Y8KA 2UY5A 1RD6A 3DHUA 3VILA 4HOZA 1VAHA 4ZEPA 2QF8A 2O9OA 3GNOA 1SFSA 1MFUA 4M80A 1JI1A 1C7SA 3AYSA 3W26A 4P8WA 4E2OA 1C91A 3VGEA 4QCEA 4U5KA 4LXFA 1R7AA 1UUQA 2VRKA 1KQYA 1V0KA 3L4UA 3D3AA 4UQEA 1W9BM 5AC4A 1UA3A 1UD8A 2GJPA 3AIWA 1Q4NX 4KRUA 4AD1A 3OGRA 2J74A 1LQ0A 5A2AA 3OB8A 1VEPA 3ZSTA 2ZE0A 3UR8A 2PC8A 2ESCA 2YA1A 1MXDA 1CTNA 3G6MA 2VVNA 1VF8A 1KWKA 2V38A 1B31A 3S2CA 3WNKA 4LQ1A 2F61A 4D6GA 3GH7A 2XJ7A 4GI6A 4FLSA 3GXFA 4YHEA 3ZJ8A 3PZUA 3BLPX 1PIFA 1BG4A 3K8LA 1EDTA 3WL0A 3BC9A 4EE9A 1E70M 3A4XA 5CPQA 2OYLA 3WUEA 5BWFA 1W91A 2CNCA 2YDQA 1M7XA 3WF1A 1FHDA 3DYMA 3T0BA 5AC5A 2PWFA 1GW1A 5C8BB 1UWIA 1CXEA 1E72M 3NCOA 2V5DA 3CMGA 2AMGA 1E56A 4OJYA 2EPNA 3O6AA 1LG1A 3ARYA 1WZAA 5I79A 4QLLA 1QHPA 3OBAA 3WDJA 1WDRA 4XV0A 1CGUA 4N42A 1G5AA 4MAVA 2PF0A 4B9YA 4AIOA 4WF7A 4MNLA 3AHTA 2RGLA 2PWEA 3IJ9A 3TTOA 2CYGA 5E0CA 4AZCB 5CSUA 2PWDA 3I3EA 4PTXA 1BG9A 3WDIA 1O7AA 4D71A 1H1NA 1XCWA 3O2LA 2BVTA 4PSPA 1H49A 2W5FA 2X8RA 5FL1A 1C7TA 1QOXA 2GUYA 3ZT7A 3M7SA 3EMQA 1FA2A 1W9DM 1GHSA 2WHKA 1I1XA 1M03A 3SCSA 1EDGA 1I75A 5ABEA 4HA1A 2D23A 3WEOA 4U2YA 3GXIA 4AYSA 1JZ5A 2NSXA 4NI3A 3JUGA 1QNOA 1W32A 2YLAA 3AI0A 2V3EA 4HA3A 2Y2WA 3VGFA 4MB4A 2XVPA 4LYRA 1C8YA 4MJ4A 1R86A 1KBBA 3IJ7A 2CBVA 3A4WA 4HU8A 3TTQA 3T09A 5D9MA 3WD4A 2A3AA 1HKIA 3GXMA 4J3UA 4S3KA 1UWSA 2E3ZA 2WNWA 3VPLA 4NZCA 3WMSA 3SUSA 4TVCA 7A3HA 1E5JA 4MDPA 3HN3A 1J0YA 3EDDA 3CHEA 1GZJA 4HMCA 2J8FA 5M03A 2VR5A 5A2CA 1OCQA 1VB9A 2BVYA 2D2OA 4XX6A 1G1YA 3ZM8A 1V0NA 1NM9A 1QNQA 1HJQA 4OOUA 5IDIA 3WDPP 1WB0A 3SCPA 1QNPA 4W86A 4AISA 1D2KA 5BXSA 4ZENA 2CETA 6CGTA 1CGYA 1DWIM 3FNDA 1H11A 2WYSA 4D72A 2WHMA 2VI0A 3PZ9A 1UR0A 4YHGA 2VR4A 1JZ4A 1V02A 3K8KA 3AYRA 5E0FA 3ARPA 3N1AA 4PMDA 1KXHA 4GQRA 3CMJA 1B90A 3MV01 4LYPA 4JFUA 1UR9A 1HNYA 4TVDA 5C71A 1ZBWA 4MB5A 2VZOA 2G3MA 4E4PA 2X05A 1JZ8A 4MTVA 1V03A 5HDRA 2WC4A 2VZUA 3CPUA 2DSVA 2J47A 3SCVA 4DWSA 3WBEA 1J0KA 3VOCA 5IFPA 3AZTA 5CXPA 4TTGA 5TD4A 5DMYA 4W85A 3B8SA 2X0YA 5I0DA 3AS1A 4HZ7A 2YDRA 1CZ1A 5A69A 3DYPA 2GJRA 3W27A 2W4XA 5CG0A 4LGXA 3VKKA 4Z2JA 2JEPA 1QI4A 1IT0A 1TE1A 3OGVA 3VD9A 2OSWA 2XIBA 4J3XA 1FFRA 5A95A 3AXXA 2UY4A 1WZLA 5A94A 2MANA 7CGTA 1ZJBA 2ZWYA 4GZIA 4Z2GA 3N15A 5D8ZA 3VD7A 2CXGA 3WL1A 1E6ZA 5LA2A 1Q6CA 1E73M 4PMUA 3PZVA 5E9AA 4JHOA 4UZUA 2O9PA 3SCUA 3HMCA 3L4TA 2NT1A 2J7EA 3ARUA 8CGTA 3WD0A 3L4YA 1Y7VA 3VNZA 4GZJA 1ZJAA 3N18A 2V3GA 5E6YA 1DTUA 1SR0A 1VIWA 1XCXA 3CZJA 1C90A 3F5KA 2VCBA 4PMZA 4WSKA 1IV8A 4Y7EA 3WFZA 5JBFA 2WANA 1W9XA 2CKRA 4JFVA 2J8GA 1HF6A 1KXTA 5I2UA 2VL4A 3MSDA 5A8QA 3A4AA 4QCFA 4UTFA 3J7HA 4WKHA 3RM8A 4BF7A 3RO8A 1QPKA 4PTVA 1KFWA 2YJQA 3RJYA 7TAAA 4D1IA 5I78A 5ABFB 1ISZA 1GONA 1V3KA 1CYGA 2VVSA 3CUIA 1TVNA 1OB0A 1B3VA 2WSPA 3VGGA 1CNVA 3ARQA 1OSEA 1EDQA 3OZOA 3AIQA 3MU7A 3ARXA 4J7RA 1LL4A 1PX8A 2Y24A 4WIWA 3OIHA 3LMYA 3K8MA 2YIHA 3CZEA 3EMZA 3TTYA 3BXWA 1LLOA 1UWUA 1NWRA 1E4IA 2J7DA 3SUWA 2DH2A 1LF1A 3CIVA 4JCLA 1SMDA 1NOUA 5A8NA 2A3HA 3MO4A 1NP2A 2WLYA 4AZGA 1GJWA 4M8UA 2E8ZA 1GQKA 2JF7A 1CDGA 4XZWA 4NRSA 2GSJA 4KRTA 4UQDA 5DFAA 2WVUA 1PIGA 2EPKX 1MW0A 1K9FA 1Z32X 1B30A 2EPLX 5JIWA 4XB3A 1H41A 3BGAA 3ECQA 3WUBA 4W7UA 1AMYA 1KR0A 1XSJA 4P8XA 4KWUA 4W8BA 2VURA 1HKJA 1BGAA 1DWAM 3T0DA 1JL8A 2UY3A 3AS3A 3UETA 4HP5A 3GDBA 3T0AA 4AZ7A 1OD8A 2QMKA 3SUTA 3CBWA 3BAYA 4PSRA 1HXJA 1MW1A 2G4FA 2YKKA 5A1AA 1CXKA 2A3EA 2Z1KA 5BCAA 4M24A 3ALGA 3W0KA 1NWUA 1WAWA 3BSHA 5LA1A 1JNEA 4D6JA 1WDQA 4MPKA 4J3WA 3VMOA 4AY1A 1FH7A 4AZCA 1E6QM 2GVYA 3PZQA 3WH6A 2BY3A 4A3HA 1WPCA 4PMVA 2J25A 4MDOA 4H8UA 1KGUA 3AICA 2ZOXA 1EHNA 3LPPA 2ZUSA 5I24A 1DEDA 1B1YA 1FH8A 2J7BA 3AROA 1DWJM 1JF5A 1GJUA 1MW3A 3MANA 1XSKA 4PCTA 3POCA 4J3SA 1JXJA 4P7OA 3UEQA 2AAAA 4JFTA 4WKFA 3VIHA 3K4AA 3VX1A 3ARWA 1XH0A 4J3VA 2PBGA 3OG2A 1AVAA 1BVZA 1QW8A 2GK1A 3VTRA 2VZVA 3BAXA 1VEMA 1VEOA 3OGSA 3B9AA 3CZLA 5IXEA 3CHCA 3ZOAA 4JFWA 4TX8A 4EANA 1EQCA 3VDCA 2JF6A 1H0IA 5EBAA 3CZ8A 2Y5EA 5JIPA 3VDAA 1DP0A 4W84A 1E6NA 4FMVA 2UY2A 1UQZA 3GNPA 3SUVA 4H8HA 2FHBA 1ZS2A 4GKLA 5A8PA 1WE5A 1BF2A 3TP4A 2WW5A 2XPKA 5F7UA 4CVWA 2YL5A 2V3FA 4W5UA 4PEEA 3MMWA 4ZXLA 1WP6A 3FY1A 3B9EA 2WVVB 2E9LA 3WF3A 2JE8A 4GZEA 1LL7A 1VRXA 1BVNP 1GQLA 1HT6A 2DEPA 4DWSD 3AQUA 3CLWA 3VNYA 5M5DA 3WIJA 4DUVA 1CXFA 2ZXBA 1VFMA 4PCSA 4UQ9A 1CWYA 2DDXA 3A3HA 4F9JA 3ZIZA 4S3JA 5D9PA 5I23A 1E5NA 4GIAA 2DT3A 4QFUA 3WF4A 1X6NA 1JYNA 2ZX5A 9CGTA 3T2QA 1PJ9A 1OGBA 1UH4A 2ZXAA 4UQAA 3MUAA 4BQ5A 1QBAA 3VD4A 4W93A 3GZAA 1W9VA 1H0GA 2E40A 3IAQA 1XC6A 1CGWA 1W1YA 4E8DA 3N13A 3OLIA 4HMEA 3BAIA 3PHAA 4CN6A 1UD3A 5I6SA 2Z1SA 2D3LA 1XGZA 1LG2A 1HVQA 3U57A 3ARRA 1CXLA 2G3JA 3WF2A 3TONA 2OSXA 4DUWA 4JL2A 4E8CA 1BQCA 1W1VA 2ZXDA 1LL6A 1F4AA 3F4VA 2XUCA 2FHFA 4RE2A 2EO7A 1KR1A 3ZSSA 3N17A 1J0JA 6TAAA 1JG9A 1QI3A 1E0XA 2J78A 1CGTA 3WMCA 1JNDA 2VX4A 2VTFA 3BH4A 2WVSA 3AJ7A 4U31A 2WM0A 3BLKA 4PTMA 2DSZA 2VT0A 2CCRA 1J18A 2EPMX 4AXNA 2W92A 3PZNA 2WCAA 3ZT5A 5BXPA 4L4OA 1UWQA 1EIBA 2WZEA 4UCFA 5GNYA 1V3IA 3SCOA 2YA0A 5HPCA 2XVKA 1GOOA 2VRJA 4UR9A 3ZMRA 2AOSA 2FDMA 4PMRA 4H04A 1TCMA 2J79A 3QGVA 3AHYA 3HJEA 2G3IA 3PZIA 5CLWA 3GNRA 1GORA 1GPFA 3VD5A 2PB1A 1GOQA 4GI9A 2WXDM 4K68A 3QOMA 2WKLA 1GCYA 3QHMA 4H7VA 3VVGA 3OA5A 5ABFA 4M82A 2ZUVA 2WBGA 4QAWA 1BYCA 4OBSA 4F66A 1TUXA 1MYRA 1UZ1A 1E43A 3WMBA 2WC3A 4CCEA 3KL5A 2ZUUA 2BHUA 1V3JA 2D0GA 1XV8A 1VJSA 4XUYA 4GQQA 1W2VA 1PX4A 3U7BA 3BAKA 3I3DA 3W38A 2WMIB 1QVBA 4KMQA 1UR1A 1HIZA 3K4DA 1HL8A 1IZKA 1XYFA 1W3JA 2X09A 3L4XA 4R27A 1JYVA 1UR2A 2XVLA 3BCFA 1CEOA 5GPRA 1NWTA 4AWEA 3AIUA 4OKDA 4HOWA 3FW6A 3SCTA 2WZIA 3AISA 4Z2HA 3MUY1 1NP0A 1US2A 3VIGA 4BQ2A 3CUGA 2QLYA 4J3TA 5D4YA 1ISYA 1HX0A 5DO8A 3U5YA 4H41A 2VQTA 4WKAA 3WKZA 2YL6A 4B3LA 1TG7A 5I77A 1CXIA 4N0RA 5LYRA 1BAGA 5CSYA 1JDDA 3RDKA 2G8ZA 3ZT6A 2NW0A 1HVXA 1BGGA 1QW9A 4W87A 5I3DA 4ZFMA 1E55A 1JD9A 1DWFM 3PZGA 4UQCA 2XYLA 5I5RA 3EDKA 3T2PA 2WMHA 3W37A 1ZBKA 4W8AA 1KXVA 1AQMA 2D22A 2FGLA 1QNRA 3BMWA 4B9ZA 1EA9C 4C7DA 3CH9A 2PWGA 1VFOA 3WNLA 2XWEA 1BTCA 1J9YA 2BVDA 5CLTA 1UD6A 3GM8A 4OBRA 4EAMA 3AMKA 5E70A 5ECUA 5JBDA 1VFUA 1W1TA 4JKKA 1BSIA 1WZKA 4JZ5A 4AZ5A 1E15A 4NF7A 4D6HA 2FGZA 1A47A 2YOCA 1QI5A 3WQWA 3VGHA 5E09A 1HP5A 3KE0A 4P7LA 3A47A 2XG9A 3CGTA 5E6ZA 2XTKA 5FIPA 1UWTA 4JKMA 5CQ1A 2WC7A 4WK9A 2HISA 4FLQA 5A6BA 4D6IA 2IXVA 1V6UA 3W6LA 2VO5A 3G6LA 3WQ8A 1X1NA 2BHZA 2BY1A 1MQPA 1ISVA 2GFTA 3W25A 3WQ6A 1RPKA 2J75A 2XM1A 4W8LA 3VIMA 4AMCA 5BXTA 4JKLA 2WMKA 2NT0A 3WH8A 1XHGA 2WVVA 4CU8A 2HVMA 2XVNA 2GJXB 3EYPA 4C7GA 4IUGA 4U3AA 2DIJA 3WQ5A 2X1IA 3WF0A 1J0HA 1R85A 1V0MA 1KB3A 4D6CA 3SCNA 1TA3B 2ZWZA 4PRWA 1NH6A 3II1A 1JFHA 4H2CA 1UH2A 1W3LA 2XGBA 5KZ6A 3EMCA 3FAXA 4BQ3A 3RJXA 3DYOA 4B3KA 3WH7A 1ZU8A 2WB5A 5LA0A 3UCQA 3BMVA 5A2BA 2UWFA 1EOKA 2O9TA 5CPTA 1MFVA 1PZ2A 2D24A 2OWCA 5ABGA 8A3HA 5CGMA 5EMYA 3B9DA 2F2HA 4W7WA 2VJXA 3VUPA 5A6SA 1OINA 1WCGA 1VBRA 3WNMA 2XGIA 4AEEA 4ZE5A 1CXHA 5FL0A 4UFJA 3T2OA 1VBUA 2CEQA 3SEPA 4CUCA 1ITCA 4D6DA 1QHZA 4PTWA 4AZ6A 5FCZA 3ZR6A 1RH9A 1C8QA 4IPNB 1C8XA 2J4GA 4OZOA 4PMQA 2O9RA 2VOTA 5HNNA 4X0VA 1B3XA 1JAEA 3CZGA 4MJ2A 3VM5A 4BQ4A 3AS2A 2QHAA 4CN4A 1MWOA 3PZOA 5BXRA 1BHGA 1WZMA 1BPLB 1FHLA 4DUXA 4U33A 4YPJA 5M17A 2IXUA 3W28A 4GO9A 5JUVA 1PX3A 1H2JA 1JZ2A 3WDQA 5HPOA 4JCMA 1V3MA 4MADA 1RP8A 4URIA 1EOMA 3RCNA 2DT0A 4JFSA 3VMPA 3N9KA 5BYWA 4CCDA 4PMXA 2QV4A 2CKSA 1E4LA 1V6VA 5KEZA 1XD1A 2OWXA 1V6YA 1OGGA 1JDCA 3MUZ1 1PPIA 1TR1A 3NSXA 4YN5A 2JIWA 2WHLA 4A3YA 3DC0A 5A6MA 4XZBA 5GQBA 3OZPA 2EBNA 4AIUA 4NRRA 1J0ZA 4GO8A 3ALFA 5DT5A 1MVYA 1W3HA 2X2YA 3UR7A 4GI8A 2XM2A 3THCA 2J77A 5D9NA 3MMUA 4ATLA 3N11A 1UKOA 3PZMA 3VDHA 4PYSA 4ZE4A 4KH2A 3IJ8A 1GOMA 3LPOA 2D0HA 3SUUA 1TMQA 2Q8XA 1G9HA 3ZJKA 2A3CA 2YBTA 4J27A 1A3HA 1CLVA 4WJXA 3KZSA 1UKQA 3WSUA 1OIMA 3VM7A 4H8VA 1ECEA 4FF5A 5EFDA 3WH9A 4OOZA 2VZTA 1WO2A 3AMGA 4KGLA 2D0FA 3AHVA 3AIBA 2RGMA 3OLEA 1FP9A 1U2YA 4V2XA 2YL9A 1H3GA 2JEQA 1UKSA 2VCCA 3VD3A 2QPSA 1G94A 4UZSA 4ATDA 4Z2LA 1KQZA 1K6AA 4GPNA 5HBFA 3SIMA 2ZXQA 2V3DA 3AMLA 4UFMA 3K1DA 1GVYA 1ODZA 1OM0A 4D1JA 1J01A 4BZYA 2IUZA 3UESA 4F8XA 1QBBA 1ZBVA 3AS0A 3F5LA 3LPFA 5FOOA 5FD0A 1J10A 3AFBA 4JHZA 4X9YA 3WBAA 1B9ZA 2V5CA 2XFRA 4EKJA 4V27A 2PWHA 1PEZA 3VIPA 2ZIDA 2WBKA 3EDEA 1CIUA 3VINA 2GDVA 4U5IA 2DSKA 4MB3A 1FOBA 2VUYA 1GHRA 2J7FA 1JZ3A 1UQYA 3PN8A 2WCGA 1EQPA 1PZ3A 3GH4A 4RE4A 1SMAA 3APGA 2BY0A 3E1F1 2EEXA 4AEFA 3RILA 3WD1A 3WNPA 1K9EA 2CBUA 3N12A 2CESA 1GOKA 4MNJA 3KL0A 2OYMA 2ZUTA 3BSGA 2FH6A 3QR3A 5DF0A 2ZX6A 3W82A 4D6FA 3CTTA 1ODUA 3AZSA 3CZKA 4AC1X 1MW2A 2ZX7A 5A6BD 1G0CA 1MQRA 1XYZA 2C7FA 2WSKA 4D6EA 1OBAA 1BLIA 4BCEA 4HZ6A 3NSMA 1FP8A 1JD7A 4LYQA 3TA9A 4TX6A 2DIEA 5A8MA
chains in the Genus database with same CATH superfamily
1Q65A 3BCDA 5BOEA 1U22A 1IQ8A 1TWZA 2OTDA 1E0WA 1D7FA 4JDBA 1JPMA 2HXTA 1VENA 1V77A 3LCGA 2VEKA 2HTMA 4FLRA 2WZTA 3NQAA 3B9NA 2E8YA 3WFLA 4CU6A 4TOQA 3VOFA 3WLLA 2BXZA 1Y5VA 2QPUA 3QOKA 5A6JA 1TWIA 3TAKA 2DSUA 1WKYA 4ACZB 1UP3A 4HNUA 1DJHA 5HR6A 1PUDA 1B2YA 3N2MA 1GKQA 3MT1A 4C6EA 2VX7A 1XLBA 3CAVA 3P5YA 3N3MA 4DZ5A 3W87A 3S0CA 5LNWA 1F4HA 1XGEA 1B4KA 3FIGA 4UOZA 4NIRA 2PTZA 1DPMA 4AHQA 3USZA 3BAJA 2DP3A 1T0OA 3B8IA 5F4WA 1DIKA 4Q22A 3N6JA 3TYEA 2NXGA 1OFOA 3BARA 3ICJA 3G24A 5AFDA 4GKTA 4RW3A 1M5WA 5BU6A 3BWWA 4QP0A 1T41A 3XIMA 1CGVA 3O9NA 1PZ1A 2V68A 4BF9A 1RCQA 3G8RA 3QXBA 3M0LA 1E6PA 4CEXC 5FEWA 3BE7A 2PGWA 4DI9A 3IIVA 5C0QA 1QNSA 3WYZA 2CBJA 2C1IA 2VX5A 3GAKA 3URNA 3VCRA 5IOBA 4Y9NA 1MNSA 3O16A 1NOWA 4W88A 4JTUA 5XIMA 3TTSA 1JDAA 3G1YA 3RPMA 2X7VA 2Z1WA 2CXEA 3AHXA 4I8DA 1H5VA 1M04A 1PBGA 5LGXA 4MLRA 5H8MA 1J0IA 4PUEA 3NIYA 1OEPA 3M0ZA 1DWHM 2RAGA 3HM7A 4DM1A 1YTKA 5ABTA 2WWDA 2GK1B 3IJIA 5C9UA 4PRRA 4IGHA 3WEMA 1GQIA 4RE0A 3PPFA 5GNZA 4CCCA 3SM0A 2DZTA 2A3BA 3JZUA 4IGNA 3S83A 2G41A 1U30A 3ANUA 3H55A 3L4VA 1JYXA 1AJ0A 2AL2B 2Q3RA 1W1A1 4Y6GA 4TMCA 4AIEA 3KOXA 5FJJA 1XLKA 5HMSA 3GUWA 3EWYA 4E5TA 1VR6A 3WDRA 2ZUMA 2TRSA 3BLFA 3D46A 2OKOA 3CL8A 1BEUA 2ZZ3A 4OIFA 4F0MA 4IG2A 3KP0A 3S5YA 4BI5A 3W2MA 1UJQA 2WWCA 3M07A 4GUHA 4Z1CA 1Q6DA 1QXLA 2HEJA 2PTWA 2E7FA 2DQWA 3NQCA 3LNPA 1RLCL 3PJTA 2ZUNA 1K6WA 4UOJA 1V93A 3FVMA 1WXJA 1XM3A 2FJKA 3HV9A 3CB8A 3LV5A 2VX6A 4LAUA 2VEIA 3MDUA 4HOXA 2VYOA 4MY1A 1RXOB 3BLLA 1K4HA 4Z1AA 1RVGA 1ICSA 3MBDA 3U7VA 1VZWA 4LS0A 3DECA 3MI2A 4PMNA 2W9MA 4BFAA 1M53A 3CIWA 3G3MA 2IMRA 4QEEA 5LIKX 4JL1A 5HMEA 3O6YX 4HCLA 3VDBA 4IICA 3AXKA 1NQ6A 3REQB 4S2CA 1UKTA 4BI7A 1OIFA 1VP5A 1XH1A 2VGBA 1D8CA 1X1OA 3BPWA 2D1ZA 1K4GA 3QQ1A 1EHAA 4NXKA 3DCPA 3OVPA 4UFKA 1R38A 3M46A 1BQGA 2Z27A 4WDWA 3TAOA 2WMFA 3VIKA 3GTNA 3W2JA 2PDNA 4UXDA 3AXIA 3RM4A 2F38A 2Z0IA 2JKPA 1LLZA 1TTJA 1IXNA 2PDPA 3M5YA 2Z6IA 4KFOA 3VIJA 1PV8A 4QAIA 1LRQA 5DELA 1ITXA 1HKMA 1TYGA 5LHFA 2E68A 4O1BA 4P7QA 3BLDA 3FN9A 1HJWA 1R3TA 4IPLA 4JQAA 1XUUA 1I45A 2VGIA 4NAEA 1PKMA 3KWXA 2DT1A 3QPZA 1VC4A 2DZAA 3FHQA 4LVAA 2FTPA 2E9BA 1QNVA 3DOPA 2BY2A 4AW7A 1TV5A 2QYGA 3GXDA 1KM2A 1UUOA 1FKWA 1F3TA 2JQXA 1B3WA 4A05A 3E12A 1E3ZA 2G3NA 4Q4RA 1O4UA 3UZXA 3VNKA 3PUGA 2RDXA 1IEWA 1J5TA 1TPB1 1R9ZA 1XIFA 1GQJA 3EOOA 4UTUA 4KT2A 4DJED 3VKCA 1WKFA 5BRPA 1UHVA 3QHNA 2X1RA 1UPMB 1RCOB 3RFAA 1V6WA 3ARSA 2HK1A 2OSYA 4PB5A 4HCDA 3C0LA 1GOWA 5I3GA 3OQEA 2A5HA 5CPSA 4HNVA 3TZFA 2C19A 3MKKA 3O6CA 4N9CA 4AD3A 4KGJA 2W67A 3QGAC 3BG9A 4MFDA 1TPVA 2AQOA 2WMIA 4Q4QA 3KTXA 1SW3A 4IXXA 3CUFA 3SCWA 2TAAA 4GA8A 3HPFA 3B3DA 4FAMA 4AF0A 4DYEA 3UP8A 3H22A 2XIOA 2FZ9A 3ITLA 4NAFA 2X40A 3UERA 1SYTA 1K8CA 1CCWB 4AZHA 5FJTA 4ML4A 1SJAA 4J5NA 2W27A 4CGTA 1TV3A 2Y8VA 2CPUA 4XUGA 1PSCA 3ISIX 4F0KA 4ZMGA 1UW9A 3I3BA 1A5LC 3GWQA 1KGWA 2INEA 5H91A 3MWAA 5TF0A 3ARZA 4ZOBA 1Q6GA 3H7UA 4A29A 1EYWA 1F7BA 4W5ZA 2JFEX 4G6CA 5AYZA 3AIEA 5G2HA 3NL5A 2EF9A 4KCWA 1R87A 3ERPA 3OVQA 3IK2A 4FLOA 3UG5A 4GJIA 3QZAA 4M7SA 1V02E 1C3FA 2YSWA 3IGXA 5KITA 4JIPA 1K8XA 2E5DA 4G1KA 4LUIA 1ZALA 2E5BA 2QNEA 3KXQA 3WK1A 1XIDA 4J4KA 5HUPA 5G1TA 5FJIA 3QY6A 3OJGA 4DXKA 1XYBA 1NTHA 3EX2A 3VILA 1F9CA 2PGFA 3ORWA 1KA9F 3FFSA 4HPJA 5ECVA 4HNLA 3C4UA 1MFUA 3RXZA 3AYSA 1KM1A 3WCZA 2ZYFA 3NXFA 3NZQA 3TROA 1WDWA 2CWNA 4U5KA 1UUQA 1KQYA 2CLHA 3HGJA 3L4UA 3D3AA 4UQEA 2Y70A 4EPBC 1UD8A 2GJPA 4AD1A 3S2MA 1LQ0A 4XKMA 5D33A 2X1TA 4FXJA 1WBJA 1VEPA 5CC7A 2YB4A 3U4AA 2ZE0A 3UR8A 2ESCA 3LTYA 1CTNA 2F6XA 1OG6A 1M6JA 5J5DA 3R12A 3O06A 1B31A 3GW0A 1EYEA 4PTNA 2ISVA 4LQ1A 4D6GA 4H83A 2C0AA 3F4NA 4YHEA 3BLPX 1VHNA 2X42A 1JVNA 1FY6A 3WL0A 3BC9A 4EE9A 1K77A 1YDOA 5HATA 3LLFA 5CPQA 1F8IA 3O0FA 2YDQA 4KRZA 1M7XA 4AQLA 3MMTA 1Z8AA 3H53A 3T0BA 5AC5A 2GYIA 4B4HA 1OCJA 2FZNA 2PWFA 3NQFA 1GW1A 3JR2A 1UWIA 1E72M 3NCOA 3WJSA 1E56A 3W86A 1AH0A 2F6UA 1WZAA 4LAMA 5I79A 1TCDA 3RK8A 1HTIA 4XV0A 3C8NA 4MZYA 4H7ZA 4RZ5A 1CGUA 2D69A 3PUDA 4N42A 1G5AA 4RNJA 1N8IA 1DJXA 1XBVA 1YNQA 4B9YA 4AIOA 4WF7A 3AHTA 2PWEA 3MA8A 5E0CA 4AZCB 5CSUA 3SFKA 3E0LA 3P81A 3NO1A 3KAOA 2FLIA 2QW5A 2YB1A 2O0TA 4KEVA 4FPSA 1DJQA 1I2NA 1H1NA 4PSPA 3AO0A 4KEZA 1Q6OA 5FL1A 1TPH1 4E4FA 7TIMA 4IP4A 3WJYA 1SW0A 1M03A 3SCSA 2R91A 1EDGA 4M19A 5IDZA 1CB2A 3B97A 2B4GA 4U2YA 1L6SA 2ZA2A 5EMUA 3NVTA 4GC4A 3F4CA 3IK4A 2QCNA 4JXCA 4CEUC 2NWRA 2BTMA 2V3EA 1KFLA 3QJAA 4MB4A 3KVLA 3SSJA 4LYRA 1C8YA 1R86A 1Q5MA 3DKJA 2WJFA 5D9MA 4QJ4B 2DVXA 3UNDA 3P3BA 3SN1A 4J3UA 3E5BA 2E3ZA 2DZBA 4IZGA 5AHEA 1XKJA 3U6WA 7A3HA 3HN3A 2IKJA 2J8FA 2PU0A 5M03A 4F2TA 1GEQA 1VB9A 2D2OA 3TV8A 1NM9A 1FWCC 4IX0A 4G5DA 1XLLA 3TVAA 3WDPP 1WB0A 1IR2A 1QNPA 3TYBA 3LX9A 3ZFHA 4A3UA 4QRNA 1GK8A 2CETA 6CGTA 4BF5A 1IXPA 1PE1A 4A2RA 4KWWA 3OEXA 2GVLA 2Z00A 4K37A 1V02A 5E0FA 4NJIA 1UR9A 3NQ8A 5C71A 2YGYA 2OQYA 2EKCA 2XIQA 1RV8A 2X05A 1JZ8A 1JRCA 3MUCA 1TIWA 4Q32A 3W1LA 1U83A 3A24A 2V82A 3WBEA 1LUCB 4FNQA 4ZB5A 4QE5A 3MQTA 1XYMA 4IGSA 5CXPA 1XIMA 4YS1A 3L0KA 3NYZA 2X0YA 3TN3A 4IFOA 1IWAA 3P14A 4JTDA 4O8RA 4DIAA 4Y90A 4KBXA 5CG0A 4Z2JA 2O4QA 4IIEA 4MHBA 1IT0A 4AUBA 1XQKA 2OSWA 1FFRA 5DY3A 1NFBA 2UY4A 3R8GA 1WZLA 2XSXA 9XIMA 4F0RA 2X2GA 1IIGA 4HQVA 3UJ2A 2ZWYA 1KM5A 4GZIA 4I9AA 4Z2GA 1IXQA 3AYTA 2JK2A 2ZQ0A 3N15A 2ZVRA 1J6PA 2CXGA 3BL3A 3WL1A 3E9AA 3KCLA 1Q6CA 2FPYA 4JHOA 3C6CA 3L67A 2O9PA 3W6YA 3HMCA 2QDGA 4X61A 2V3GA 2BOEX 5E6YA 1DTUA 4GXMA 4HHLA 3OG3A 2P76A 1R3RA 2G4JA 3M64A 2YCKX 3NQDA 2WANA 3CWHA 1YDNA 1KXTA 4H6RA 5I2UA 2VL4A 2PP3A 4GVGA 1AW5A 3QLLA 4JTJA 1QPKA 2HJPA 3PJXA 2GJLA 3GE7A 2YJQA 3RJYA 1FXPA 4D1IA 3MP5A 1IHIA 3N19B 4NYUA 1V3KA 4YYFA 5C9ZA 3CUIA 1QPQA 3I7RA 1OB0A 5CBIA 4DJDA 2H8XA 1EDQA 3OZOA 3AIQA 1O5XA 4LYKA 3ARXA 4J7RA 1CLKA 2CZFA 5FEZA 3EX1A 3BXWA 4O12A 5AC6A 1DL3A 4H9ZA 2C91A 1LF1A 2ZBTA 1X39A 5A8NA 1DOSA 1LDCA 2A3HA 1F61A 2WLYA 2HWGA 3A22A 5K4XA 4HSHA 2CLKA 4ALDA 5B7YA 4XZWA 2GSJA 5DFAA 3VABA 2EPLX 1Z32X 5JIWA 3MDWA 4D8LA 5C7VA 4L4MA 1S2UA 1XPGA 4O14A 4AVOA 5DANA 3C52A 3WBXA 1JQXA 4ROQA 2XH7A 1HKJA 1BGAA 1ITUA 1DWAM 4B5SA 4Q8NA 1H62A 3AS3A 3LXCA 3NQMA 4B91A 1UIOA 2PDWA 3BAYA 1J2WA 2G4FA 2NWSA 5H8PA 2YKKA 4NX5A 4RZ4A 5JVLA 3W0KA 1WQ5A 1NWUA 1WAWA 3FSTA 1JNEA 2GPTA 4RPQA 2HRWA 2A4AA 3VMOA 1FH7A 3TJIA 2GVYA 5CGQA 1SGJA 4LBSA 4JX4A 1EWEA 4H1ZA 4DXXA 3G1FA 4L9XA 4MDOA 4H8UA 4WJEA 3PSVA 3W1PA 3GD6A 2CLEA 5I24A 1B1YA 1FH8A 4GXWA 1JF5A 3PAJA 3RR1A 3WLPA 3ZVHB 2O7SA 2WNZA 1X7IA 3UEQA 4O0KA 1GVOA 1AQFA 1F6PA 3B4UA 3H70A 4WKFA 2POZA 2PBGA 3OG2A 4NJGA 1BVZA 1AD4A 3BV7A 3FJLA 2G96A 1DIDA 1LBLA 3A3WA 2GK1A 5I3HA 2VZVA 3UPBA 4QTGA 2A7PA 3FYYA 2P50A 4G1NA 5JU6A 4LT9A 4ZOCA 3RG6A 4ML9A 4OQVA 5AHIA 3MKCA 3P8IA 5JIPA 3BG5A 3TH6A 3FX4A 1E6NA 2V2DA 3GNPA 1R0MA 4H8HA 2FHBA 2QJNA 6ENLA 1Z89A 1P6BA 1ZS2A 4C6JA 2PLCA 3TP4A 4ZTXA 4FIRA 3MP4A 4REQB 3AU6A 1M9HA 2ZRUA 4EPDC 3K2GA 4EF8A 1FWSA 1FWWA 3G1XA 1B54A 4GZEA 1ZFJA 1VRXA 3CQKA 3RU8X 1VCVA 1VFTA 3BICA 4QROA 1KBJA 4NP7A 1XRSA 4UQ9A 2DDXA 3A3HA 3UXDA 3O05A 3PANA 3M0MA 4GIAA 1DQXA 3WF4A 2ODOA 1X6NA 1PJ9A 2ZXAA 4JYDA 4LS2A 1E9IA 1WKEA 3VD4A 3R0DA 3GZAA 1W9VA 2E40A 2YFOA 4GUGA 4L80A 4PL2A 1CGWA 5K2ZA 1GQNA 2X30A 3UW6A 4JTAA 1TV2A 4AHPA 4MZ8A 4AC7C 6PTDA 4FF7A 3QV9A 2G3JA 3WF2A 2OSXA 3BLOA 1BQCA 5HR7A 1F4AA 3BURA 2PUZA 1FBAA 4Z1DA 1TJRA 4O57A 2AKZA 2ACRA 4RE2A 3BOFA 3N17A 2V5LA 4GVHA 2J78A 3O15A 3SN4A 2P3ZA 1J96A 2R6OA 1KM4A 3G1DA 3BDKA 2ZTJA 3W74A 1N2VA 3BH4A 3F2DA 4U31A 2VT0A 3CUZA 3FYOA 4NNAA 5AC7A 3ZT5A 3NL2A 4GI4A 5CC3A 1V3IA 2YA0A 3HA1A 2OQHA 1GOOA 4OGZA 1AZ1A 2ZA1A 1GVQA 5FJRA 1FWIC 4E2BA 4PUJA 1GPFA 1XI3A 4TMBA 3TYDA 4NX0A 3GUGA 3GVQA 4GI9A 3M0IA 5DMMA 4CQCA 1HL2A 4F0SA 1GCYA 3T9PA 1FWAC 5BOOA 3P5ZA 3VCNA 3OA5A 4PFMA 1ZCCA 1O66A 3MVTA 1BYCA 1MEHA 1GEHA 1O68A 2BHUA 4K6AA 3E02A 3WQEA 3T7VA 3UR2A 4GQQA 2PE4A 5H6HA 1YTEA 3U7BA 3BAKA 5KSWA 4LWWA 4KMQA 1JUKA 5BW6A 1KRAC 1XLJA 1XIGA 1OFBA 1TX2A 1W3JA 3L4XA 3G1SA 4DJEC 3AIUA 4OKDA 2PP0A 3FW6A 3SCTA 1F07A 2TYSA 2WZIA 4GQ0A 1QU4A 4S3CA 4IPPA 1B5TA 4ERIA 4J3TA 3W71A 4L5ZA 2PP1A 4LC6A 3U5YA 1TMLA 3E0IA 4ZZ9A 3RMJA 4DF0A 5I77A 3QV8A 5LYRA 2J27A 9RUBA 3PFMA 4E4UA 1D3GA 3UA4A 3UCDA 1BGGA 3H6OA 4W87A 2IPFA 1XYLA 3ITCA 3ZR4A 2ZDSA 1SSGA 1Z9AA 5TAOA 2OPJA 1PYMA 2XYLA 4N6FA 3GTHA 5I5RA 3EDKA 1IGWA 2WMHA 3TW9A 2QJHA 2WSQA 2GLKA 4Z08A 2XN1A 1KXVA 2D22A 3T44A 1P43A 3BMWA 3CH9A 2XIJA 4LUJA 2XWEA 3IWPA 4DPPA 1ZENA 3B8UA 3N9SA 1VQTA 1OZMA 4Z1YA 3IGUA 1UD6A 3L65A 3TNOA 3GM8A 3LD5A 3UR5A 5E70A 5F4SA 1W1TA 4JKKA 5I02A 4GMEA 4RDWA 1BSIA 1R5YA 4OBTA 1DQUA 1XDJA 4D6HA 3L5AA 3LGEA 3M41A 3WQWA 3LM7A 3NG3A 2XG9A 2G37A 3LTSA 5DX7A 5FIPA 4IFKB 1UWTA 5CQ1A 4IXHA 3OHIA 1RALA 1IWPA 4WK9A 3C8FA 4FLQA 3UGVA 5A6BA 4E8GA 2V5BA 3W6LA 4H19A 3WQ8A 2BHZA 4EVZA 2Z7GA 1P1XA 1X8FA 1ISVA 1RPKA 4ERAA 3GFXA 4YCPA 4ZO6A 3B8WA 3HG3A 3WH8A 1MNZA 4DQWA 3GIYA 1SFTA 2PLJA 1MRAA 4BJHA 3WF0A 1V0MA 3LZ5A 4KWOA 1KB3A 2ZWZA 1JCJA 4PRWA 4LALA 1JGMA 4S3AA 4H2CA 1SSDA 2XGBA 3EMCA 3DG7A 1ONEA 5T9CE 4BQ3A 2E1WA 3OO2A 3DYOA 1XRTA 4KFPA 4H7CA 5LA0A 3MCNA 5BU9A 2UWFA 1XRFA 1EOKA 3U48A 2O9TA 1R6WA 1ZY9A 1PZ2A 4XBSA 2H6RA 5BZAA 2F2HA 4W7WA 5A6SA 1SJBA 4FX8A 1V7AA 1DJIA 1YMYA 1CXHA 3NDOA 1VBUA 3KRBA 3UVAA 3SEPA 1ITCA 3KM8A 1WBHA 3WLKX 4PTWA 5REQA 2YBVA 2VFGA 5TIMA 3W88A 2RFGA 1RH9A 3CYVA 3NZ1A 4KWVA 2XN2A 1RVKA 3SECA 1H7RA 4FB7A 4F0HA 2VC7A 4LV9A 3RNDA 1K02A 4JEJA 5BXRA 1BHGA 5GJPA 3EX4A 1WV2A 4YPJA 2HSAA 5M17A 4JNZA 3W28A 4K1WA 1H2JA 3B9OA 1J79A 2W0UA 1X6UA 4JCMA 2Z1BA 3W1NA 1V3MA 2OFJA 4PEKA 3QQ0A 4MADA 2J66A 2ZRVA 3QV6A 1W5OA 3W7GA 3N9KA 5BYWA 4ZA0A 1KTCA 2PPGA 3BW2A 3RLVA 3GDKA 2DV0A 3U3HA 3EKZA 4WHBA 2VD9A 3MUZ1 4CQBA 5I7GA 1IEQA 1TR1A 3E0WA 5A6MA 1A5UA 1SZGA 2PWVA 3NL6A 4NXSA 4MYXA 2EBNA 4NASA 8RUCA 1B4EA 2NQLA 3EWZA 2X2YA 4XIMA 2J77A 5D9NA 2Y7FA 3HQNA 4EXBA 2PDBA 4C6NA 1ME9A 3APTA 3IRSA 4Q3MA 4QE4A 2FMOA 2R8WA 1EGVA 3LPOA 2D0HA 4OU1A 2Q8XA 1IF2A 4O10A 5HMFA 4J27A 3VNIA 1A3HA 4L9ZA 4WJXA 2SFPA 3P84A 3TDFA 2DZVA 1OIMA 5DBUA 3E2SA 5BNKA 3CEPA 1JCMP 1DTNA 4JN8A 2A3LA 1YBQB 1E0UA 4LNCA 3AHVA 4NG3A 3R4IA 3XINA 1Z7AA 4V2XA 3GNXA 2JEQA 2EGZA 2VCCA 4JNYA 4ATDA 1KQZA 1K6AA 3EKLA 5HBFA 4R9XA 3H21A 1KRMA 4PFHA 3IARA 3O07A 4JTIA 4F40A 4XBJA 1LP6A 1J01A 4JBRA 3M0HA 4A2SA 3WBAA 4HVXA 4GH3A 2V5CA 2BGNE 3VIPA 5FF3A 3WLQA 2ZIDA 2RDTA 2WBKA 3JW7A 1CIUA 4O18A 1ZJHA 1GHRA 1WUFA 3T8QA 1UQYA 2QAPA 4A35A 2X41A 4RX0A 2TSYA 3E1F1 3NQGA 4PCFA 5AHMA 3RILA 4WY0F 1IIHA 3ITGA 3L0GA 3EB2A 3R6IA 1QPOA 3L66A 2ZUTA 1FCUA 1FCQA 5C9WA 3HOJA 3Q4DA 2WKJA 1PCKA 3W82A 3OW1A 5CZTA 3AZSA 4F4RA 3CZKA 1MW2A 1GVFA 3OZMA 1ZCOA 1XYZA 2C7FA 2QV5A 4ILSA 1OBAA 2Y62A 4BCEA 3NSMA 1VHCA 1FP8A 1JD7A 3BANA 3TA9A 4C6PA 3GKAA 2X0SA 3GBEA 5DCBA 3UWYA 3AXHA 4NI8A 4A8RA 4HZMA 4O0ZA 4R53A 4KF1A 4L7ZA 1OYCA 3LI1A 3C5QA 4HSOA 4ZOEA 4YVPA 2E5CA 1UG6A 3IV3A 3NOYA 3R94A 3CQHA 3NSNA 1ZB5A 1W1B1 3GNDA 2R1KA 4IIDA 1G6CA 4C7FA 4GIEA 2VFIA 3BQ6A 3WUFA 3ARTA 1F3WA 3GR7A 2Z4GA 2NQHA 3A21A 4ZQNA 1HJSA 4IM4A 2CERA 3P0XA 1IZJA 1HW6A 1S3TC 1HJVA 4EWND 1WDPA 3WNNA 2ONEA 3OP2A 3F5JA 3GRIA 3ABRA 3PBVA 4P7NA 4DUOA 3BLEA 4R7JA 4CKQA 4G2DA 4W4QA 1CECA 3FGCB 4Z0SA 1E0TA 4HT3A 1HUVA 1KRCC 4A8IA 3AXMA 4DF2A 1JFXA 1XD0A 2PGEA 4IJBA 2NUXA 2GWGA 1UOKA 2PI6A 3VMNA 3NURA 1W3TA 3U8GA 5T8GA 5LIWX 5A6AA 3ZQ9A 4MAZA 2FVMA 4O1EA 3BUVA 1EGZA 3PTKA 3UPMA 4U3CA 1VD6A 4HPHA 5AZ0A 3P61A 1EC7A 4JY8A 4IT1A 3AMDA 4DJEA 4LJ3A 4NVTA 1UWAA 1D9EA 4Z0JA 2NVCA 1HKKA 3DGBA 4A4AA 2BGSA 3EGJA 3NPWA 2WK2A 2EQDA 1XLIA 3P82A 5HOSA 1QI0A 1DWGM 4GCAA 4RK8A 5D8WA 3D3FA 4GISA 3ENLA 1AQ0A 2WPBA 1OFEA 3ABOA 1KM3A 1HN1A 1W9PA 3W7PA 3PPGA 2OELA 3SCRA 1JAKA 1W54A 1O95A 4QBXA 1RAKA 1VFSA 2O55A 2OZTA 3TLQA 3W3OA 1X38A 2VZSA 4DVOA 2WHJA 1JCYA 1FVPA 2PDJA 2F84A 1GNXA 1HKWA 1A5MC 2ZICA 1JZ7A 1E40A 4LUSB 4AX7A 5TBOA 3WMLA 5HNRA 2BV9A 5E5CA 5LIYX 3STEA 3VO0A 2E9MA 3WDHA 5FF7A 4ADUA 2YDSA 2FPVA 1Q7QA 1OWQA 1L0PA 2VWSA 1GW9A 4J2MA 4M6VA 2J7GA 1UZ4A 1SQ7A 3W75A 2C16A 4NL1A 3R5EA 1W2PA 4PR4A 1A49A 1DV7A 1TKKA 2DIKA 1F6YA 4C90A 3NL3A 4OFCA 3P0WA 2DUAA 2FB2A 4LV4A 4BR1A 2D20A 1B3YA 2ZFAA 2ZUWA 3T1GA 4CD5A 3LU2A 3CUJA 1QTWA 3D5HA 4PUKA 2QJJA 4B15A 4FNRA 3WNOA 3FKRA 2YL8A 1Q13A 1BXCA 2YCJA 2WCSA 2PRMA 2XSAA 5LXXA 2DZSA 4HPGA 3W24A 4MPQA 2DPEA 4LU0A 3QEZA 2PA6A 3NAVA 2DGAA 2QIIA 3M0XA 1OGSA 4L4PA 5C70A 5C6MA 3C2EA 5D9OA 4J9JA 3PPCA 3BW3A 2GQ9A 1UD4A 1W5QA 3C56A 1W3KA 2J7HA 2JIEA 1REQB 2VC9A 3BG3A 2WLZA 1EP1A 1TV8A 3MS8A 1I2RA 4V28A 2VNCA 5I07A 2YZ5A 3CV1A 3EDFA 4MNMA 3B0VC 1ZGDA 4B4FA 2ZX8A 1HL9A 3TSMA 3KL3A 1OHLA 4REQA 1QI2A 2O92A 1I1WA 4XZMX 3GSMA 2V81A 1UWRA 1W56A 2VCAA 4DJFD 2PD9A 1TZ7A 3N73A 2GDUA 3ZJ7A 4M51A 3CEUA 3EDJA 2FVLA 3U0HA 1GOXA 3SIZA 4O1CA 1UR8A 3UZWA 1ZL1A 1ZNNA 3NQ7A 3WFAA 4EK7A 2AQWA 3VGBA 4NILA 2XWDA 1P6CA 1EX5A 2QEZA 3COTA 1PKNA 5FKYA 1XPYA 4LX4A 2I5QA 4CD4A 4LAKA 3C3UA 4EIVA 4JTSA 2ZTKA 3MMDA 2TODA 5A8OA 3PTMA 3UWUA 3ZJ6A 5CJ5A 2OU4A 2P3EA 3W2LA 3EOLA 3LHTA 3DBNA 3F03K 1QMLA 1UH3A 1XIJA 2QGYA 3S3GA 1ENUA 4HYVA 5LNUA 3USBA 3M16A 3LLXA 1RQEA 3FDKA 2CBIA 3A9IA 5IFTA 1FRBA 4DZIA 1ADSA 1ZBCA 1OQFA 1XYAA 1VGAA 3S6OA 2QCEA 3B0XA 1ISXA 3L2MA 1U33A 2QMJA 3A6OA 1FH9A 4QDMA 3OOQA 3V16A 3D0CA 4QX4A 1NF0A 1JF6A 3YPIA 1FDYA 3THAA 4YTTA 4AAJA 3ZZ1A 3RRAA 3F4DA 4F9DA 3H4WA 1IE7C 4Y96A 3W7MA 3HG5A 4DHGA 4FXSA 4NUWA 2FHCA 3MZ2A 2CITA 2G3FA 4QG9A 3G3DA 4UFHA 2QPXA 3TOPA 2BXVA 1EB3A 4WLCA 4I9TA 2VRQA 1R8LA 4IHCA 4CNSA 3E5PA 3ZO9A 4JQ1A 4I3GA 3SJ3A 4GYKA 3FA5A 5CPOA 5A3HA 3OLGA 4RDVA 3TLLA 3NQBA 5A6LA 4GUJA 3CNYA 2IW0A 4GVIA 1W3IA 2J62A 3SB0A 4C1NA 4HTBA 3T6CA 3UPWA 4Q8PA 3ANYA 1FWBC 3VIOA 2WMGA 2V5KA 3TNBA 3WD3A 3QHOA 1MSSA 3MO7A 1Q6FA 3PJWA 3LBOA 1F3EA 3TJLA 3WN6A 3RMEA 1ZJIA 4K36A 1E71M 2W6RA 4JAWA 3V5CA 1WNOA 2VFDA 3TC6A 2EPOA 4PL1A 1NAL1 1E1FA 1OT1A 3L4WA 2PDMA 1XCFA 3TFXA 2H3DA 3TSDA 1U5JA 2F8QA 2PC4A 2VQUA 2DW7A 3GIPA 4DWSB 1OT2A 3M0VA 1H1YA 4C6OA 3SFWA 3FYPA 1XH2A 1CBGA 4ZQMA 1NARA 3VCCA 1VFFA 3TK7A 4L64A 2Y5JA 3WD2A 1J5SA 4WSHA 5CJMA 1CLXA 2DJLA 2XFWA 3UY8A 1UZHA 2BG5A 2OEKA 4MWAB 1O5QA 1VJZA 3B4YA 4B5VA 3DH7A 2BB0A 5BMWA 5DN1A 1QO2A 1NVMA 1TJ1A 3DHPA 4XAFA 3QN3A 4DM2A 1UBPC 4YCOA 1FXQA 4Z2KA 1DHPA 2F9RA 2GGEA 5CPMA 5KZMA 1P0DA 3S1WA 4WDXA 5RUBA 3TWBA 4ICCX 1B3ZA 1VJIA 5U4NA 2A79A 4AFYA 2IKIA 1OYBA 3NR0A 4NZ1A 2BXYA 3MV11 1IGSA 1VPYA 2UY5A 3NO3A 1RD6A 4KIEA 3LSBA 3LOTA 1VAHA 1N8FA 4WQ6A 1TSIA 3IGSA 1SFSA 1F74A 4EXAA 3KBVA 4M80A 3W85A 4QJ3B 3VOJA 5FACA 3W26A 4ENLA 3A64A 4ZQOA 4ZR8A 4FNTA 4GY1A 4LXFA 1R7AA 1X8CA 1X96A 3M7WA 4MKVA 2OT0A 3G0SA 4UMBA 4V1YA 3OGRA 4QHRA 1OY0A 5A2AA 2QCHA 4AEOA 1FWHC 1MDRA 3ZSTA 2OGYA 1EKOA 5DBTA 3DDMA 1MXDA 1BF6A 4A21A 1OFPA 4Q8MA 2IQDA 1EWDA 5LIXX 1AFSA 3QR1A 4CQDA 2F61A 4C6FA 3GG0A 4IMEA 3KBSA 1UMLA 1P7TA 3ZJ8A 4G9PA 2XIMA 1ML1A 3KTSA 4MMWA 3V0UA 4Y2WA 3MYOA 3A4XA 3UYIA 4I9MA 5HQEA 5BWAA 2CNCA 3VZYA 1TVLA 3WF1A 5AYYA 3IV8A 5C5YA 3W7JA 4GNKB 5CG7A 2V5DA 5AHFA 2AMGA 4OJYA 2EPNA 2BLEA 4Q4PA 1N8WA 1TTIA 3ZLFA 1S1RA 2XH2A 5H8UA 4UUIA 1QHPA 5D02A 1WDRA 3HBLA 1ZHAA 4M3PA 2CHRA 3CWOX 4AWSA 4MNLA 3VK5A 3IJ9A 2CYGA 2V2CA 3PNZA 1F76A 1KTNA 4YL2A 4PTXA 1LBFA 1HFBA 5A6TC 1O7AA 3PVFA 3W7EA 1OCNA 4D71A 1CB7B 3BMXA 3EPNA 2BVTA 4XAPA 2QGHA 1I2PA 2W5FA 2Z24A 1C7TA 2GUYA 3WLHA 4HD5A 1ECQA 2VOMA 1W9DM 1T40A 3RITA 4HA1A 4AU0A 3L5MA 2GQAA 4AYSA 2NSXA 4KKXA 4Q8WA 2YZRA 5MKGB 3M5VA 3BSMA 3RCYA 3W02A 4HA3A 3VGFA 2C15A 4EOUA 5FSDC 3IJ7A 2CBVA 3A4WA 3T09A 4GJ1A 4JTGA 2Z7KA 2A3AA 4JNMA 2GGHA 2HVOA 4XAYA 2DVUA 3TW6A 2WNWA 4MY8A 4MDPA 4RJEA 4JX6A 4XAZA 7XIMA 2VR5A 1GKPA 1OCQA 4WY0B 4XX6A 1G1YA 1NDYA 1V0NA 2DZPA 4ZQCA 4O13A 2QXWA 4EP8C 3GHRA 4HIBA 5EGRA 4HNOA 4AISA 4W86A 5FAGA 1D2KA 3UZZA 4DI8A 4ZENA 2VR2A 1CGYA 1DWIM 4OVXA 1KTBA 1H11A 2WYSA 4LFYA 1S38A 2WHMA 1KW1A 3QKEA 1EC9A 1FCVA 3N9RA 1R9YA 2VR4A 4N6EA 3W1RA 2FKPA 3K8KA 1XGDA 4PMDA 1KXHA 3CMJA 3MV01 4TVDA 3V0SA 1HNYA 1ZBWA 1NIUA 2BZNA 1RQHA 2VZOA 4KEUA 4O16A 1SO3A 5GJMA 4M0XA 1ZLPA 1R30A 4O1DA 1UP2A 1AW2A 3S1XA 3CPUA 2DSVA 1PXGA 3MZNA 3PWGA 3AZTA 3KBMA 3KBJA 1DBTA 1KO0A 1QCWA 5TD4A 3B8SA 1ZAJA 2CW6A 2GJRA 5EMJA 1TE1A 4LUYA 3VD9A 1RLDA 5H1WA 1EBHA 1JRBA 4J3XA 3F2CA 5HA7A 3LM3A 5A94A 3VZXA 2MANA 7CGTA 2YCIX 3UGRA 1KBIA 4V33A 3UXLA 1U1HA 4PMUA 2CZVA 3VYLA 3LQGA 3SCUA 2NQZA 3L4TA 4ZFCA 2DJXA 2J7EA 5KZEA 1Q3NA 2Y85A 1Y7VA 3VNZA 4GZJA 4INFA 3N18A 3GVRA 3KOYA 3T4CA 2R24A 4FR1A 2IKGA 5LSMA 1SR0A 1CI1A 1VIWA 1G69A 3CZJA 1C90A 3PJUA 3F5KA 5FJOA 1LOLA 3AAMA 3GDMA 3LCHA 2EG6A 2QCFA 4GVFA 1WKDA 5JBFA 4YXGA 5F2IA 2J8GA 4E0CA 3GAYA 4EX4A 1LOQA 4FHAA 4QCFA 4BF7A 3RO8A 3ABQA 4PTVA 7TAAA 2VGFA 5ABFB 3VKJA 2QDEA 3FJ6A 3CQJA 3VKDA 2WSPA 1GYLA 4B3ZA 1CNVA 1QFEA 3CWNA 4ZO8A 9XIAA 3GC4A 4L56A 3QPYA 4ZO9A 3DU0A 4Q8OA 2Y24A 2C1GA 3LMYA 3OIHA 3EXSA 2YIHA 4WRHA 5ENLA 1FTXA 1LLOA 3DFHA 3MI6A 4NJKA 2DH2A 4JCLA 1NOUA 1AUSL 3SO7A 3UXIA 3P60A 4AHOA 4KRTA 1KCZA 3IVUA 1K9FA 4PUNA 1MW0A 1B30A 4IL2A 1H41A 3BGAA 5AB3A 1KNWA 1XQLA 3E2QA 3MHGA 4KEMA 1AMYA 3K4WA 4N02A 1KR0A 1XSJA 1NU5A 1R9XA 4W8BA 3A23A 4GQGA 1ADDA 4JIQA 1JL8A 2UY3A 2OQLA 3UETA 4AXKA 5C9XA 2QMKA 5D2YA 3RO6A 3EWDA 2A3EA 5BCAA 1WAUA 4H9YA 1GYNA 3BW4A 3W01A 3ALGA 4IGMA 3BSHA 4QXIA 1OG0A 5I3FA 4PRTA 5T91A 3PZQA 2BY3A 3ID7A 3WK0A 4A3HA 1MZHA 1WPCA 4PMVA 3LGDA 3CU2A 4IMGA 1LM1A 1ZQ5A 3WLMA 4E38A 4RR4A 1GJUA 4FP1A 3U2OA 1A5SA 3SGZA 5DLCA 3TX9A 3O6DA 3QW3A 1GTEA 4LBRA 3APYA 2WNQA 2Y5SA 3K4AA 4LS1A 2BDQA 3EOEA 5KETA 1OX4B 4L6DA 3S2NA 3UG8A 2PDYA 1V5XA 1THFD 3BAXA 4QQ3A 1GVRA 3FJ4A 2Q09A 4TX8A 3VDCA 1H0IA 4U4MA 4YTUA 5EBAA 2CFFA 2Y5EA 3VDAA 4W84A 1EZWA 1BKSA 2W79A 1UQZA 3W76A 3LGGA 5EU9A 3S1VA 3HQOA 3W22A 2WW5A 4IMAA 2GQ3A 5F7UA 2DORA 4CVWA 1SU5A 4W5UA 3VE9A 1A5BA 3F7JA 4ZXLA 4QQUA 3LLDA 4KQNA 1YPXA 2E9LA 5LNVA 3NEHA 2PF8A 3RLGA 4H6KA 1X1ZA 3QVQA 1GQLA 2F6KA 3JRKA 4L9YA 3VNYA 5M5DA 4LNYA 4OECA 2QVNA 2PEVA 3GTIA 3JS3A 4K39A 2ZXBA 4KESA 4PCSA 2YXXA 5T9BG 1GVEA 3H2EA 4PGLA 3HPZA 3QY7A 3SAZA 1S2WA 4F9JA 3EB3A 3HB9A 1YPFA 5D9PA 5I23A 4QFUA 1GG0A 3ES8A 2J9YA 1T7LA 1VBHA 4HGXA 9CGTA 1OGBA 4BQ5A 3MUAA 1TPUA 2QCCA 3VUSA 2OO6A 3NGFA 1XC6A 1REQA 5M2FX 3N13A 3OLIA 4NNCA 3BAIA 4CN6A 4DJFC 3W1AA 1UD3A 2PDKA 2Z1SA 1NDVA 3W73A 1TJPA 3L2IA 5H2ZA 1LG2A 1HVQA 5AHLA 3EX6A 4IMCA 1CXLA 4US5D 4Q4OA 2Y8UA 1Z41A 1EPXA 4E8CA 2ZXDA 2PLKA 3WBWA 2IPWA 2QULA 2XUCA 1ZAIA 2H9AB 1JPHA 2FIQA 2VHLA 3ZSSA 2Y7DA 3DUGA 1JG9A 3C0SA 2R1PA 3WJWA 1FWRA 3WMCA 2Y6ZA 3WLSA 1L6WA 3N2OA 3P74A 4B5XA 6ALDA 3VKBA 3BLKA 2GVGA 3G18A 5DXXA 1J18A 2EPMX 3PFRA 3PZNA 4L4OA 4YVVA 3N2XA 1GZGA 3VFCA 4UCFA 2RKXA 3CM4A 3DIPA 4V15A 4JEQA 3LN3A 1ONWA 2VRJA 1VYPX 4I5UA 2FDMA 1EJUC 2VFEA 4H04A 2J79A 4WXYA 3QGVA 4F0LA 3QFEA 3LA4A 3W23A 3NPUA 4Z42C 3GNRA 1GORA 3VD5A 4FO4A 3GR4A 1DORA 2PB1A 2NQJA 2G50A 1XBZA 1Q85A 4AWTA 3QOMA 1S5MA 2WKLA 3H2NA 3GO2A 3QHMA 3VVGA 2VDHA 2WBGA 1PHQA 3IUDA 4QAWA 2KAUC 3D47A 4OBSA 4F66A 1C9WA 2J8TA 1TUXA 2PLMA 5FESA 3DXIA 3WMBA 1A80A 3KL5A 4NZ4A 2BSLA 4UIOA 2VENA 2D0GA 4MIMA 1XV8A 3R1ZA 2Z29A 3VAVA 3P2VA 3OIXA 2CU0A 4YYCA 1YTDA 1Y5XA 2JGYA 1UR1A 3S9IA 3DGRA 3K4DA 1PDYA 4IIHA 1KM0A 3BCFA 1CEOA 5GPRA 1NWTA 3KFTA 1ZTVA 2GL5A 3B0PA 3PNUA 4Z2HA 3MUY1 2P8BA 2L5HA 5DY2A 3L23A 5D2TA 1NP0A 1US2A 2C79A 3N14A 4QGCA 2A7NA 4M6UA 3CUGA 3L68A 3QM3A 5G4HC 4H41A 4S2BA 3HIJA 4GLEA 1EP3A 3U2ZA 1KLYA 1CXIA 4F2BA 4N0RA 1BAGA 3EWWA 1NFGA 7ODCA 4K3ZA 1A4LA 1HG3A 2G8ZA 3STCA 2XINA 1FUYA 1HVXA 3URQA 1QW9A 1RUSA 4IX2A 5FJPA 5I3DA 1KFBA 1JD9A 4CLMA 3EXRA 1V6TA 3WBYA 1DWFM 2PRHA 3PZGA 2R1MA 3T2PA 1EF2A 4DX3A 3W1UA 1EBGA 3FEQA 4XWUA 1TB3A 3WJXA 3H54A 5FAJA 3MW7A 2GWNA 2P5NA 4JX5A 4C7DA 1YADA 4GGBA 1J9YA 3OZYA 3TFCA 1YEYA 1JEZA 4OBRA 3TXZA 4LCSA 4ONVA 5AECA 3NPVA 1K3UA 1RD5A 1VFUA 4JIIX 2OLAA 1FCBA 4MZ1A 2RH9A 3IJLA 4JZ5A 3KDNA 3MC5A 3HPSA 1K7EA 4P2VA 4N9DA 2B7OA 1QI5A 1OF8A 3VGHA 1HP5A 4LUTA 3CGTA 4OHQA 1PS9A 2HE5A 3E96A 1QRQA 1Q2RA 4D6IA 2IXVA 2BOFX 4FNPA 1XFCA 2ISWA 3W25A 4S23A 4RCXA 2J75A 2XM1A 3VIMA 5J04A 5D30A 4MG4A 5BXTA 5LKYA 3H8AA 4FX6M 2WVVA 2HVMA 3N2CA 3WQ5A 1XISA 3GXNA 4D6CA 1NH6A 3E0VA 2ISSA 3SGUA 1JFHA 4L1XA 2LLEA 4IH3A 1UH2A 1HKVA 2ANUA 4B3KA 3WH7A 3L21A 4C1LA 5CSSA 1AZ2A 4S3FA 1MFVA 2D24A 2OWCA 3BJFA 1H1ZA 4JTLA 2YXOA 3PULA 5ABGA 8A3HA 1CX9A 3ZVIA 3R0UA 3VUPA 1WCGA 1AL8A 4D8AA 3WNMA 2XGIA 4AEEA 4O53A 3T2OA 1JPDX 3URBA 4KS0A 1A5OC 2CEQA 4CUCA 1M7JA 2FTWA 4AZ6A 1IXOA 4M5PA 5FCZA 3R13A 2J4GA 3DN5A 4OZOA 4PMQA 1E1CA 4IOTA 3V4BA 1XXXA 1B3XA 4N2YA 1JAEA 1XUZA 3M4HA 4MJ2A 3AS2A 4C5ZA 2QHAA 3SQMA 3PZOA 1FHLA 4PODA 4JTCA 4DUXA 3BOLA 4U33A 2Q71A 1LBMA 1PX3A 2QKFA 4AWUA 4JN6A 3UJSA 1W5MA 3C2FA 3G1RA 1BXNA 1AG1O 4GBUA 3DC8A 3W2KA 4EAYA 4DJDC 2ZC8A 2GSEA 4R85A 4UB9A 2CLIA 1AL7A 1EF3A 3RCNA 4JFSA 1WA3A 3VMPA 7REQA 1EXBA 4PMXA 2ZZ7A 2HDJA 2QV4A 4KCTA 5KEZA 3PBMA 1XD1A 2EAWA 4O1FA 1R2SA 2C3ZA 1OGGA 5DCEA 1JDCA 4UMAA 3KOWA 4F3HA 4GUFA 3DC0A 1LQAA 3N6QA 2WZMA 4IUOA 3OZPA 4GC3A 3JVAA 3B0UX 2PZ0A 4NZ5A 2A6LA 5DRIA 2NX9A 5K7JA 1I2OA 1EJXC 4ATLA 3VDHA 3PZMA 4C6QA 3M5ZA 1RBAA 2QUNA 4DN1A 6TIMA 4QG8A 1SZRA 2RDWA 5FF4A 3SUUA 4XKYA 2I9UA 3R10A 3WLTA 3IJQA 1L8PA 3LZ3A 2H90A 5HUOA 2YBTA 3QKZA 1CLVA 2DVTA 3KZSA 4IG2B 4O50A 3VM7A 1PCWA 5MKGA 4FF5A 5EFDA 4OOZA 4HKPA 3GVGA 1EIXA 1Q45A 1ME8A 2VZTA 1KFKA 5F1UA 2D0FA 1H7XA 3N2BA 3KWSA 1U2YA 4ERGA 3NZRA 2YL9A 1FDJA 1UKSA 1G94A 3IRDA 4UZSA 4Z2LA 4GPNA 4M6QA 3VXGA 3SIMA 1TPDA 4Q4MA 1SM9A 1MEWA 2A21A 1GVYA 4WY0A 4D1JA 3AWOA 2IUZA 3UESA 4F8XA 3LPFA 3AS0A 1RHCA 1IYXA 1J10A 4JHZA 4X9YA 3RYSA 2VUNA 2ZRXA 4Y8FA 3HFYA 2XFRA 4EKJA 4V27A 1PEZA 4KW2A 4B5NA 2GDVA 4U5IA 4GABA 1FOBA 1JZ3A 3G77A 3TQVA 3B05A 2PCEA 3W72A 3W7HA 1EQPA 3CUXA 3ITOA 5DQPA 2ATMA 4RE4A 1SMAA 2E28A 3DHFA 5PTDA 2OGJA 3MY9A 1O5KA 4AEFA 3MUXA 5K9DA 5J5RA 5HNTA 1K9EA 2CBUA 1XBYA 2CESA 4DJFA 1GOKA 3KL0A 2OYMA 3BCJA 4MGGA 4HJFA 2J9XA 4UTJA 5HNUA 3QYQA 3AALA 3DENA 3LMZA 1VPXA 1ODUA 3EKGA 3B04A 2ZX7A 1G0CA 3UJRA 4R3UA 1K8ZA 4NNBA 5D37A 3QMRA 2WJDA 3UT0A 2BWGA 1T6MA 4TX6A 4XVDA 1FHVA 4HNNA 5AZ1A 5A8MA 1RJRA 3AZRA 1P48A 1KV8A 4QNWA 3N4EA 3POHA 5BOFA 3N29A 3NDYA 4WEVX 3PM6A 3RPTA 1NWSA 4IPJA 3Q94A 1S2TA 3W6MA 4A8NA 3TWAA 3C2RA 2QR6A 1J12A 2DH3A 1G4SA 1OCBA 1KWGA 4BA0A 1J11A 1L9WA 4XIAA 4P7RA 3H2CA 1YIXA 1EO5A 1JZ6A 2FZBA 3NUKA 3UBPC 4UNKA 4Q7NA 2GJXA 2JKEA 2O56A 2Z6JA 3SRKA 4JHMA 4UOQA 1N55A 2W63A 4BEUA 1LWHA 5F2LA 4H6QA 1BVWA 1TA3A 1JXKA 1HJUA 3A5VA 4LCQA 4OUEA 3UXAA 4JTHA 4P8UA 4FXFA 3NQEA 1JI2A 3PTDA 2V5JA 5A6KA 4M81A 4GYFA 3ZS4A 3LI0A 3GU2A 1E1EA 3LG3A 1BFNA 1DJGA 2BBFA 4M29A 3R89A 1UKPA 2VDIA 2ALRA 4CQ9A 1EA0A 4B2DD 3W1QA 4N7QA 3GQYA 2D3NA 2TPSA 2VM8A 4ZODA 2QUTA 3EWXA 1E4NA 2I17A 3GDLA 4XAGA 4ZQRA 3KOFA 1G4TA 3O7UA 4Q7IA 1K1DA 4WVXA 4ICMA 3U9IA 4BY3A 6REQA 1HJXA 4MB1A 5AYBA 4RXFA 4XO6A 3AMCA 3N04A 3C2OA 3LQLA 5EBUA 1JPIA 2BP1A 3H4XA 1MZRA 1EEXA 1ZUAX 4NU7A 1M7PA 3R43A 1S39A 4AF0B 5KZDA 3GIQA 1DE5A 2R82A 1Q6EA 2J7CA 5DEZA 1V08A 1YDYA 3L7RA 4O0QA 4AB4A 4NAFB 2A0NA 1KCLA 4GINA 1ME7A 2ICSA 2Y4SA 4DF1A 4FEZA 4HA4A 3WQ4A 4UR7A 2P0OA 3F4WA 2X0HA 4JTQA 2I16A 5L9FA 5LIUX 4C5YA 1LWIA 2H3BA 1JIBA 1K9DA 3LERA 1P6WA 4YJ5A 1WOBA 8TIMA 4ZXOA 3OTRA 3FHAA 1VBGA 2NV2A 1MRQA 2KX9A 1K7XA 1LYXA 3IVSA 1M7OA 4ATWA 1IEIA 2C71A 2EXOA 1H63A 4Z2IA 2CIPA 5HINA 1L6GA 1F5ZA 5E1QA 2PD5A 3OYZA 3IS4A 4HMDA 1EO7A 1Z44A 3B0YA 2E77A 4XQ6A 2E0PA 3WQVA 2QS8A 1XG3A 4L6HA 2INZA 3NQVA 3HO8A 1BRLA 3U5UA 1OX4A 1TR9A 3AHZA 3A13A 3F1QA 1NELA 3JU2A 3NM3A 3FXYA 3OLDA 1KBKA 2I57A 4AD2A 3UG3A 5JH2A 3PY2A 1BYAA 4UTLA 1DE6A 1Q6QA 3LSCA 4X0NA 4D8ZA 3KDOA 3ARVA 3N4AA 1QR7A 1S5WA 4QLKA 1NOFA 1O6IA 3R8HA 2E4TA 1I6NA 1M41A 5GVJA 2QCDB 3WLJA 1A5KC 1HP4A 1IEXA 4LVFA 3OYXA 3NJ3A 4PN2A 4J28A 2WZHA 3RF9A 2XSBA 1EXPA 1SJDA 3INPA 2W3ZA 1TO3A 3QW4B 3ZR5A 2D73A 4YIWA 5HQLA 3OBKA 3C61A 1RP9A 2A2IA 1B0IA 1SZNA 1R3WA 3O0KA 1I60A 3THQA 3WELA 2HZGA 4JICA 3MB9A 2E09A 1O12A 1J6OA 1GVSA 1O5RA 1U5VA 4TUFA 4LVBA 3DI0A 1VLWA 2OODA 4XO7A 4DZAA 3VOIA 4JS3A 4UFLA 1Z42A 3TJ4A 5AKQA 3KEHA 5CZSA 1WX0A 3W53A 3CO4A 3WUGA 1V7YA 5B7ZA 1A4MA 4AD0A 3UG4A 5HJLA 1A0CA 1MDLA 5HQMA 4HU4A 3BLIA 1XINA 4FNUA 1TPC1 3WLIA 3E74A 2BHYA 3L2LA 2XHYA 3WJZA 1HZYA 4IQJA 3PBYA 2FJUB 4RL3A 2DT2A 4TVUA 2FYMA 2REQB 4Q6XA 3WEZA 1ISWA 1Q7ZA 1IR1A 2GZXA 4IMDA 4MSSA 2PDFA 3MUIA 1A50A 4ACZA 3FEMA 4XZLX 1H61A 3NO5A 1FWTA 2WAGA 3KP1A 4AZIA 3GB6A 1KKOA 3K30A 1W31A 1KCKA 1VYRA 4KPLA 2J9ZA 4B5UA 4GGHA 4G8TA 4LF2A 1PO9A 1UIPA 5MF5A 3H7VA 2I56A 4OT7A 3AUOA 3CXOA 2YYUA 3UYCA 4Q8VA 1JPKA 3OBEA 5G2IA 3RPDA 1MEIA 4JTTA 4UC5A 2QCMA 4PUWA 1SO4A 1OFQA 4AY8A 5JBEA 1RK5A 1G01A 2I7GA 4TTUA 3RCMA 4IQLA 2EPHA 3BGGA 3WY1A 1QPNA 3PBGA 1AQHA 4BEQA 4GYJA 1LLWA 4L1GA 2J13A 4JPGA 4FIQA 2OG9A 3SSZA 4TQTA 3NDZA 1P0BA 2VC5A 3KLKA 3S46A 1VS1A 2Z2UA 3NYDA 2I5IA 3T05A 4QLJA 3FCPA 3LHUA 1KFJA 2WM1A 1CPUA 3GHTA 4FK9A 2JALA 3VU2A 2IKHA 4W89A 4AD4A 3QC3A 1O1HA 2J6VA 1S2AA 5CSRA 2PBOA 4BWLA 3LCLA 4J35A 4ZSTA 1DQWA 1BYDA 3VGDA 3H24A 3LYEA 2OXNA 3GR8A 5DXYA 1DXIA 2WVTA 1XKYA 3ZWSA 4NSBA 2G0WA 1UD2A 4U28A 3CHDA 4JR5A 3M6DA 1KGXA 3S42A 1W6TA 1PB0A 1XBXA 1EPVA 6XIAA 3R58A 4L61A 4RV3A 5GNXA 2HK0A 4GACA 5AVHA 4N9BA 2YBUA 1LWJA 4UQBA 5BRQA 3RIKA 1X6LA 4ZVJA 2GVJA 3DFYA 4UTKA 4HCHA 3GKFA 2FB3A 1E9LA 3GDTA 4PMYA 1CGXA 1FWFC 3QR0A 2C8NA 3EA1A 4HU0A 3LCXA 2D2GA 2AL2A 3AIVA 4ZCWA 2ZADA 3LRMA 6A3HA 1OYAA 1YKWA 4W7VA 3I7QA 1OD0A 2XFYA 3VIIA 4GXPA 2HXUA 4QR6A 1SJCA 1C93A 3M9YA 3R79A 3GBDA 5F4XA 5ABHA 3EA3A 3G1AA 1PWLA 1KM6A 1VYSX 7PTDA 1EP2A 2Q8ZA 4HOZA 4ZEPA 2NQ5A 2V6AA 1PKYA 3SI9A 1PWMA 3ITXA 2DUXA 4YTQA 1C7SA 1XLMA 3QMTA 4P8WA 1C91A 1W8GA 1ICPA 4E2VA 2I1OA 4M1BA 2VRKA 2ZC1A 3MI3A 1V0KA 5AC4A 1HGWA 2Y0FA 1UA3A 1XLCA 3AIWA 1Q4NX 3CQIA 3FOKA 4I6VA 1JUEA 2PC8A 1Z3NA 2YA1A 1HQTA 3I6RA 2OEMA 1KWKA 1R3SA 3S2CA 3UY7A 3WNKA 3KBNA 3LCWA 3O63A 5EMLA 3BQ5A 3GH7A 2XJ7A 4FLSA 3GXPA 2QIWA 3LS9A 3REQA 3T55A 1E70M 3NM1A 2VC6A 2OYLA 1BSLA 3WUEA 5BWFA 3C86A 1W91A 3UFYA 3R0KA 3OVRA 3WLOA 1XJBA 3Q58A 4JD4A 1PZ0A 1EFZA 1CXEA 1BD0A 4DO5A 3O6AA 3ARYA 4TX9A 1K7FA 1PKLA 4UR8A 2E25A 4L4LA 4LB3A 3TKFA 4QLLA 5HMDA 3VZZA 1YDVA 3SW6A 4PA8A 3LNMA 2ZZ1A 2PWDA 1BG9A 4QS6A 5J8LA 3GTFA 3TMLA 2BMBA 3MHFA 3BJSA 5HWMA 3EZ4A 3MVIA 4FS9A 4CCZA 1QWGA 1SO5A 4CNTA 2Z26A 3QPEA 2VP8A 3ZT7A 4XZ9A 3M7SA 1S1PA 5AN7A 2WHKA 4PB4A 1I75A 1POKA 2D23A 3B8VA 3WEOA 5JXQA 4HN8A 2BX7A 2NVAA 3QRHA 4AYGA 3KVKA 2YLAA 4HK7A 3SGGA 1ZZMA 2NX3A 4LB4A 3CTLA 2XVPA 8XIMA 4MJ4A 1KBBA 4Y9MA 3TTQA 1YNPA 3WD4A 2AAMA 4FXRA 4Y9OA 1RY8A 3T42A 4LAZA 3GXMA 2CLLA 4S3KA 1UWSA 4DAFA 3VPLA 1R2TA 4NZCA 4N9EA 5CH9A 3WMSA 4V1XA 1TQXA 1CW2A 3CHEA 1GZJA 3L0NA 5A2CA 2UBPC 2ZRZA 2BVYA 4HK5A 1X97A 1EJSC 4L1WA 1BWKA 4S1FA 4ADTA 3BZGA 4DO7A 1HJQA 4TO8A 1YXCA 3W1MA 5IDIA 2GOUA 1EJ7L 3SCPA 2OOFA 5BXSA 2Y89A 4R88A 5LZLA 2B7NA 1SFLA 3Q65A 2OOGA 1TWSA 4A3RA 1GKRA 4JQ4A 1DKWA 3GXTA 2ALDA 3AYRA 3ARPA 4U10A 1B90A 1IZCA 4LYPA 1JUBA 4H3DA 3CJPA 4MB5A 2AKMA 3H7RA 2G3MA 2V67A 3W84A 1H7NA 4XTIA 5EL1A 1LQ2A 2WC4A 2VZUA 3ELFA 2X1SA 2J47A 4RDZA 4CNOA 3E0FA 2VFHA 4S3EA 5IFPA 3TCSA 3ZLHA 4TTGA 1EC8A 5DMYA 4I9JA 3H2FA 4WOQA 1RCXB 5I0DA 3AS1A 2E6FA 4HZ7A 3DX5A 3PAOA 1CZ1A 2QQ6A 4I7VA 3DYPA 4DBDA 2JEPA 3EEZA 2CZEA 2XIBA 4XD4A 3AXXA 2QJIA 2PCQA 2RJHA 3VI2A 4E6MA 1ZJBA 1W17A 4AH7A 5CBBA 3KCJA 1AH4A 2GJNA 2X7WA 1I0DA 2Q6ZA 4US5A 4UBPC 3T07A 2CLFA 3HGRA 1E73M 3NZGA 5E9AA 1W3NA 1XR2A 2ADAA 4C6DA 2NT1A 3NQ6A 3ARUA 8CGTA 3S4TA 3OHMB 2VXNA 3WD0A 2QCGA 4MFEA 4LRSA 4GQBA 4GY0A 4H8NA 1A3XA 2DW6A 3L5LA 4WUIA 1XIEA 4XISA 2OEJA 2VCBA 1WXZA 4PMZA 4XZIA 4YMZA 2INFA 1IV8A 4Y7EA 4GX9A 1VCGA 3C0QA 3UZ5A 4WKHA 3RM8A 5HANA 3TN5A 1L6YA 3P7YA 3EPMA 1KFWA 1ISZA 2AMXA 3EOUA 1GONA 1H7OA 1CYGA 2VVSA 3SQSA 2ZVIA 1UC4A 1B3VA 3VGGA 4DBEA 4TV5A 1TX0A 3MU7A 3QSRA 4AX6A 3RR4A 3K8MA 3LENA 3EMZA 1UWUA 3SQLA 4WZHA