1C93A

Endo-beta-n-acetylglucosaminidase h, d130n/e132q double mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFNDQYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
total genus 90
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c93A00
3AIRA 3QHMA 5M3WA 1EGZA 3VIKA 1HVQA 2ZX5A 3SCSA 3MO4A 2WWDA 4PMVA 3ZMRA 3THDA 1ZS2A 4DUVA 4MB3A 1WB0A 5GNZA 2WVTA 2BHYA 1C7TA 2W91A 1PPIA 1DWJM 2WKLA 4KRUA 1D2KA 4HPGA 1B31A 1KGUA 4JKLA 4CU8A 1W9PA 4ZE5A 4CN6A 1PBGA 2O9RA 3AYRA 2ZUUA 2WVSA 2VZVA 2ZWZA 2J8FA 1Q6GA 1GCYA 2C8NA 4LX4A 2PWGA 3CZEA 3OG2A 4W7VA 1EXPA 3VIIA 1CENA 1KWKA 1B1YA 3ZJ6A 3ZJKA 3AOFA 1BAGA 3PZVA 2G3NA 4TX8A 4U5KA 2CERA 3BAKA 3W81A 1GPFA 4F79A 3RM8A 4P8XA 5A6BA 1ODUA 2VUYA 3AZTA 5F7UA 4D6FA 1E5JA 1TVPA 1QNRA 1OBAA 1WZKA 1CECA 1B2YA 4E2OA 3WL0A 1J10A 1MVYA 2F61A 3BAWA 5FCZA 1QI4A 1W1PA 5E6ZA 1E6RA 2W66A 2NT0A 1JYNA 4FF5A 4EK7A 5BWFA 1MW1A 3RIKA 3W25A 3UESA 1FOBA 3AICA 3WEZA 1E43A 4V28A 3CMJA 2ZXAA 2GJPA 4HU0A 1W9VA 1VBRA 1KCLA 2WBKA 3O9NA 3VIFA 1E6SM 1MW0A 3VNZA 4RE3A 1C7SA 3KEHA 3K4DA 3WL1A 1V3LA 4MNLA 1XC6A 3UCQA 5BROA 3CHEA 5AY7A 4UFKA 2BXZA 3N18A 1MFVA 4F9DA 2D3LA 3CHDA 2WVVA 5EFDA 3KL0A 3GM8A 1HVXA 2DQXA 5JBDA 3AZSA 1KR1A 2E40A 2E8ZA 4F66A 3UETA 1SMDA 3MUIA 1N82A 1UHVA 3AS1A 3W28A 1O7AA 3MANA 3ARRA 4JKKA 2XWEA 3BCDA 1J12A 2CYGA 1NH6A 1E72M 2YLLA 3MMUA 4GO9A 3WQ4A 2VRJA 3M7SA 2E9MA 1UKTA 4HOXA 1UWTA 3CZ8A 2CXGA 3AHYA 3F5JA 4WKHA 1E3ZA 2Z1KA 5C70A 1H41A 1UR2A 3WDQA 4HOWA 3KE0A 3WNOA 1UD4A 3SCUA 3MUZ1 2EBNA 1HN1A 3GBDA 3MUY1 3ZOAA 2YA0A 4JFVA 3W6LA 3DHPA 4W8AA 2Y8VA 4UFIA 4BQ5A 1J0KA 1TMQA 5BXTA 2J7DA 3W26A 5FKYA 3AMDA 1CYGA 1H3GA 4YPJA 4U5IA 4D6HA 1O6IA 5HOSA 2EO7A 2AOSA 1A3HA 2UY5A 1HP4A 1JXJA 2DIJA 1E6NA 1EOMA 1ZB5A 1JFXA 3WY1A 1TA3B 4OOZA 3ARUA 3AISA 4W93A 4TVDA 3HU7A 2JIEA 1G5AA 2WK2A 3WNPA 3WUGA 1NQ6A 2AAAA 3UG4A 4D1JA 1GVYA 2XWDA 4JKMA 4XB3A 3VGBA 4AZCA 4EKJA 4UQCA 1KXVA 1XCWA 1UD5A 3WN6A 1MQRA 2BV9A 2XM1A 3AXXA 3IAPA 3W82A 2BY0A 3DHUA 4MAVA 2HVMA 5DEZA 2WANA 3WQ6A 3OB8A 2VO5A 2G3MA 3WDRA 3GNOA 4BQ3A 1E1FA 3N17A 3WSUA 1QNPA 4RL3A 4IM4A 3SEPA 2X05A 3GH7A 4JFWA 4PBGA 1OT2A 1UR4A 5TD4A 4Q22A 2GJXB 4AD2A 6TAAA 4UFLA 3GNRA 1CXHA 2F2HA 2FGZA 3KL3A 4U31A 2WHKA 1A47A 2ZX6A 2J4GA 2PBOA 5CLTA 5HNNA 2BVYA 1QHOA 5CPTA 1VIWA 4W7UA 1CBGA 1LL7A 2QF8A 1C91A 2VX5A 5DFAA 3ZIZA 4LQ1A 3WEOA 2XGIA 4AD4A 3WENA 3MKKA 3MSDA 2PI6A 2WC4A 3ZO9A 5E09A 4UFJA 1C92A 4R5EA 4UFMA 3SUVA 2WMHA 1PX3A 2VCAA 1DWAM 1HJVA 4N42A 1B3YA 3NUKA 1CGVA 5BXRA 5I3DA 2PWHA 1U30A 3PZMA 1M01A 1XRVA 1FP8A 3IJ8A 3GXDA 4HMDA 1G01A 3BC9A 4HZ7A 1PZ2A 1R87A 1V6UA 4CVWA 3F5LA 3WBAA 2E0PA 2ZUMA 2WAGA 4ZEPA 2VURA 4J7RA 2BVDA 2J78A 2VZSA 2Q8XA 3T0BA 5CLWA 4GQQA 4GZEA 1HJSA 1XSIA 1PJ9A 3UR7A 3PTKA 4MPKA 2GK1B 1CGWA 2PC8A 1KXHA 3AROA 4GO8A 1K6AA 4M1RA 4YHEA 2FHCA 4ML4A 4KMQA 4PMOA 5CPSA 2WMFA 3BAIA 1EA9C 4W7WA 4NF7A 5IXEA 1KB3A 3OZPA 4JL2A 3WUFA 1NWRA 1C8QA 2RGMA 3WD4A 5A2CA 2GFTA 3PZIA 3WD3A 1X6NA 1JD7A 1XYFA 1HKIA 1B3ZA 3N04A 3VMOA 3MMWA 3AS2A 4B9ZA 1M04A 4U3AA 3AI0A 4OIFA 4YHGA 4TTGA 2WHJA 3AIQA 1KBKA 4WLCA 3LPGA 1GJUA 1I1XA 2DGAA 1CLXA 1TE1A 1W9BM 1V3IA 5M17A 2XVNA 2IXVA 1CGYA 2ZE0A 3S6TA 1GZJA 4M82A 1QI2A 4AZ7A 1HJQA 2W4XA 3L4XA 1ISZA 3WKZA 2D3NA 2W62A 4IPNB 3CUGA 1ZJBA 3VDHA 1E0XA 4FK9A 3QHNA 1E3XA 2E9LA 3UERA 4C7FA 1EDTA 4F9JA 4CD6A 4B3LA 4ZFMA 1VJSA 4MTVA 2FHFA 5GNYA 4FLRA 4WK9A 5I24A 3SCRA 4M8UA 3CHFA 1OB0A 1E0VA 1UR8A 1JYWA 1BG4A 3TTOA 2WXDM 4H8UA 5M5DA 1GW1A 1J01A 3AIUA 1WNOA 1W3HA 3W38A 1I1WA 1HKJA 1E6ZA 4JFSA 1VEPA 3VM5A 2D0FA 3AS0A 3VPLA 3L4TA 2YOCA 5E0FA 4PMXA 3VM7A 1US3A 2VI0A 2YLAA 2E4TA 2MANA 2XHYA 3FHAA 2WHMA 3GXIA 1HIZA 1ZJAA 2ZOXA 3WIJA 4Y7EA 2WNWA 2J79A 3MUAA 4MNKA 1PIGA 4D6IA 3WQ8A 1NARA 2CESA 3HN3A 2XFFA 1XSJA 1UH4A 1OM0A 2JF6A 3CUHA 4LXFA 4W8LA 1XYZA 4ATLA 1GOMA 2D0GA 2B31A 3WDHA 4JCLA 2ZIDA 2EPNA 1V6XA 2XM2A 3VILA 1EO7A 3CPUA 3VOCA 2WB5A 2XSBA 3DC0A 4CD4A 1MW2A 4QLLA 4B16A 3PTQA 5A6AA 1WDSA 5A8QA 1MFUA 3VU2A 1CXIA 1JYVA 4PSPA 3CMGA 5DMYA 1AQ0A 2JIWA 4AY1A 3EDFA 1ZL1A 1BLIA 3GDBA 2AMGA 3L2MA 3LPPA 1HJWA 5HBFA 1G94A 3CZGA 2ZUVA 3VDCA 3CO4A 4TXEA 5BXPA 4E8DA 4AWEA 3VINA 1R86A 2CKSA 3MU7A 1ISYA 2WSKA 5CJ5A 2O9TA 2V3GA 2F8QA 2VNCA 5E70A 1TCMA 5CGMA 1HT6A 3BAJA 5IFPA 2WLZA 1ITXA 1VEOA 3B9EA 3GNPA 1QI0A 4D6JA 2Y2WA 1PX4A 2GVYA 3PN8A 3ZT7A 4PMYA 4PSRA 3M46A 9CGTA 1OD0A 3FXYA 1NWUA 1R7AA 2CBUA 1H4PA 2DEPA 3AQUA 4DWSC 5A8PA 5A95A 1IV8A 3POHA 4J28A 1G0CA 2ZXDA 3AZRA 3VD4A 1FA2A 1Y7VA 2EPOA 4JFTA 1DTUA 1MWOA 1K9DA 1OGBA 3EYPA 1V08A 4W87A 4M80A 2PWFA 5LYRA 2VMFA 1H1NA 1GHSA 3CUJA 3VIMA 1FHLA 2GJRA 5I79A 1E73M 2ZUWA 3CIVA 4C7GA 2PB1A 3BSHA 5HDRA 4WKAA 4P7RA 5ABEA 4AZGA 2Y5EA 2FGLA 3PZQA 1D7FA 2J77A 3WNMA 4PMZA 2OWXA 2QMKA 1GQJA 4FLSA 1ESWA 3WH9A 3O6AA 4GINA 2J7HA 1V6YA 4A4AA 3NJ3A 5BCAA 5D8ZA 2J7GA 2O9OA 3WD1A 3T2PA 4BA0A 3WF0A 3ARXA 3L4WA 4MB5A 1JFHA 2EQDA 3ARSA 4Z2KA 2C0HA 2XVPA 4AD0A 3KZSA 5I0DA 3ZQ9A 2DT3A 2D2OA 3WQVA 5A8NA 1W1VA 2XIIA 4GI9A 1XD0A 4J27A 1J0JA 3WDJA 4HMCA 4H41A 3AIEA 3UG5A 2VRKA 1VFMA 4DWSA 4WIWA 5ABGA 5AC4A 4BF7A 4TVCA 2YDQA 2G3IA 3WNKA 1E6PA 2FH6A 4HA1A 1GORA 2OWWA 1JNDA 4A3YA 4BQ4A 1ZBVA 2BS9A 2YBUA 5A6JA 4P8VA 4DWSB 1V0NA 4MJ2A 4GQRA 2XGBA 1NWTA 1US2A 3AHXA 1G1YA 1KXTA 3RDKA 2A3HA 2FDMA 2VTFA 1WDPA 4TTUA 1EQCA 4NRSA 3SCNA 1LG2A 3VIHA 3WH7A 4UNIA 2HISA 3TOPA 4AW7A 1CGTA 3NSXA 1MYRA 2YA2A 4AZBA 3CTTA 4AD1A 1H5VA 4OOUA 1J0YA 1SR0A 2ZUSA 3RJYA 2XVKA 4B15A 3VGFA 2WZIA 1JZ2A 3VMNA 1XSKA 1GUVA 4M56A 3HMCA 3JUGA 1DWIM 5FL1A 1W9XA 1J18A 4XX6A 4N0RA 2VOTA 4U2YA 4FLOA 4X0NA 1C3FA 1F4AA 3W4RA 1OINA 1BQCA 1JZ7A 4D1IA 1HJXA 3VDAA 3CUFA 3LMYA 1G9HA 3M6DA 2ZUNA 1KGWA 2TAAA 4GPNA 1CXEA 3IAQA 2VL4A 3VGHA 3N1AA 2GK1A 3DYOA 4OJYA 2EPKX 2ZUTA 3UG3A 2DH3A 5A6LA 1NM9A 5A6BD 1E55A 1HF6A 2J62A 3WH6A 5C8BB 3BGAA 2CPUA 3RM9A 4ATDA 4B9YA 1VFOA 1OGSA 4U3CA 2WKGA 3EDJA 2X0HA 4AZCB 3IJ7A 2J7EA 1BYCA 4GZIA 2A3BA 3DECA 1JYXA 3L4UA 1B0IA 4MJ4A 1SYTA 3CHCA 5A3HA 3WF3A 3TA9A 3QOMA 2WCAA 5I5RA 2V5CA 1DWGM 4CN4A 1DWFM 1QHZA 3QOKA 5I77A 2YL9A 1KBBA 4MB4A 1JDAA 1W32A 1WO2A 2ZXBA 1NWSA 4UCFA 1TR1A 2WSPA 2EPMX 2OYMA 4JZ5A 3I3EA 1R85A 1KFWA 4JHZA 1KQYA 1J9YA 5D9MA 4D6GA 3GZAA 1CEOA 2UY4A 5LA2A 4L4PA 4JHOA 3WD0A 4TVUA 1J0HA 6A3HA 4DM1A 1R7OA 4ZXLA 3VD3A 3OGRA 1UZ4A 1UUQA 4DM2A 5AYIA 1LG1A 1VEMA 1V02A 2VR5A 2J7BA 2PWEA 4Z2GA 2XVGA 4BZYA 2YDSA 2UWFA 1KQZA 2Y24A 3SCVA 1GNXA 2CBIA 3WEMA 3VX1A 4OUEA 4ZENA 1HKMA 1TVNA 2YIHA 5AC5A 3MSGA 3ZSTA 1IT0A 1JG9A 3PZNA 2CBJA 4YN5A 1JF5A 5FOOA 1E4IA 1QNQA 1H0IA 1VF8A 1XH2A 3WMBA 2D1ZA 1HP5A 4PUDA 3W24A 1ISXA 1J0IA 1EDGA 4Z2HA 1V6WA 2OSWA 3IJ9A 5CQ1A 4QFUA 4CD7A 2BY3A 1TZ7A 2BNJA 3T0AA 1GQIA 1CXKA 5DF0A 1CLVA 3PZGA 1LWHA 3GXFA 1Q6EA 4J3SA 5ABFB 3EMZA 4H8VA 1W3JA 1EDQA 1BF2A 5A8MA 2PF0A 4LPCA 1NP0A 3GH5A 1VB9A 4BS0A 1E6QM 1KXQA 3SCPA 4AZIA 1JAKA 3ZJ7A 3AMLA 3IK2A 4OZOA 1UZ1A 3MV01 5A2BA 1Q6FA 1UKSA 1JAEA 4WSJA 3AMGA 1K9FA 1AQHA 1QI5A 1QPKA 2FH8A 3NIYA 1S46A 3I3DA 1IZJA 2E8YA 3NYDA 1UD8A 1BHGA 1GVIA 3NCOA 1V03A 1VBUA 5BRQA 3WQWA 3T08A 3ARWA 4MADA 4AZHA 2BY1A 2XFYA 1UH2A 2OSXA 1EHAA 1SMAA 2WMJA 4NZCA 1WE5A 1C93A 5A6KA 1B9ZA 2E9BA 2QMJA 5I78A 4S3KA 4CU6A 4PMUA 3FAXA 2UY3A 3ARTA 1LJYA 3WUEA 3WQ5A 2BFGA 2YBTA 2W67A 3GH4A 4EAMA 4W84A 2XJ7A 5A6MA 4P7LA 1C8XA 1QVBA 5ABHA 3BLPX 3NSNA 4H8HA 2V38A 3ALFA 2YL8A 1KCKA 5JBEA 1PX8A 2JALA 3WH8A 2W5FA 3CLWA 2PBGA 1FHDA 3I3BA 4AC1X 5IDIA 3MMDA 1WPCA 1JZ6A 4LYQA 2BHZA 4WJXA 3MV11 2WYSA 4MDPA 1F4HA 2EXOA 4AIEA 4KH2A 3WF2A 2VCCA 3WFZA 3WFLA 2X2YA 3AHVA 4GXPA 1CXFA 2WW5A 1VFUA 2OLHA 4D6CA 3GTNA 5JUVA 3AYSA 3HJEA 2Z1SA 3K8MA 2VR4A 4J3WA 5I2UA 2W63A 3TP4A 1UOKA 1BFNA 2BVTA 1ISVA 2IXUA 3FN9A 5I6SA 2DPEA 1GJWA 4GZJA 2WMIB 3OGVA 4FLQA 1BVZA 1E71M 4QCFA 1H09A 4P7NA 4W86A 5ABFA 5A94A 5CSUA 2VT0A 3AXHA 3N13A 4M81A 4KRTA 4D6DA 3AMKA 3W53A 4W88A 1OIMA 1UR0A 3FHQA 3G6MA 3BAXA 5C71A 3CGTA 1B3WA 3U5UA 7A3HA 4UR9A 4AZ5A 3BMWA 4PN2A 2VZOA 1UQZA 1JGIA 3DYMA 2WCSA 4BCEA 4RE2A 2EEXA 4MB1A 3S2CA 3OLDA 3AHTA 4GKLA 2ZICA 3NDYA 1GOQA 3WNNA 1UD6A 3D5HA 2WMGA 2ZX7A 1PZ3A 1UWIA 8CGTA 1JXKA 1GHRA 1QOXA 1SFSA 1EIBA 4UOQA 3K8LA 4XZWA 4Z2JA 4XUYA 3BLKA 3L4YA 1HXJA 4HP5A 2VJXA 1HJUA 3VNYA 4HA3A 1GOIA 1UWSA 4AIUA 5LA0A 1M03A 4NRRA 5JIPA 1W1YA 3N11A 4GI8A 3VMPA 4HMEA 3VO0A 4AD5A 2FHBA 4PCTA 1WZLA 2G3JA 2WM0A 1CGXA 4H04A 1BSIA 3RILA 3A4WA 2YL5A 4UQDA 1HX0A 1CPUA 1FH8A 1CTNA 4H2CA 5JBFA 1WDQA 1GONA 2DSKA 2X09A 4WKFA 5HPCA 1K9TA 2QPUA 2NSXA 3QHOA 4PTVA 1W1TA 4D6EA 4AYSA 4QAWA 3VX0A 1GQKA 2D22A 1KR0A 4IUGA 3A47A 1ISWA 2NW0A 1GOKA 2WBGA 1E4LA 2A3CA 2VQTA 4D72A 3N9KA 2NT1A 3BXWA 2W92A 1W9DM 1IZKA 4UFHA 1CZ1A 3OGSA 1EHNA 4KGJA 1M7XA 1GOWA 1UR1A 2ZX9A 3OLIA 1XHGA 3TTSA 1QW9A 1JDCA 3W29A 1W9UA 5A6SA 4JFUA 1RP8A 3EBVA 4L4OA 5E0CA 5BYWA 5DT7A 2XUCA 3GXMA 1C8YA 2D20A 3VDBA 2VZUA 5CPQA 1FFQA 3SCOA 2G8ZA 3ARYA 1TUXA 1D3CA 1UWRA 1FFRA 4E4PA 3BH4A 1E4NA 2YA1A 4PMNA 4J3VA 1CDGA 1W2PA 2D23A 4W5ZA 1WDRA 1LL6A 4ACZB 3BMVA 3AXIA 4UQ9A 1JF6A 4OKDA 5GPRA 5CGTA 2E3ZA 2ZXQA 4HZ6A 1BG9A 1WKYA 3M07A 4Z2LA 3EMQA 5A69A 5D9OA 4PTMA 2VVSA 1UKPA 2WVVB 4UQEA 1I75A 4GI6A 1XCXA 1NP2A 3ARVA 3KL5A 1LQ0A 4P8UA 4CCDA 7TAAA 3TTQA 5CSYA 1E40A 2XYLA 2XIBA 1TA3A 4DUWA 1WP6A 3SCWA 1ITCA 1OCQA 4NI3A 2YDRA 1MXDA 3U57A 4C7DA 1RPKA 6CGTA 5BXSA 1HL8A 1FH9A 1WZMA 1XV8A 4PTWA 3ALGA 4EANA 2C7FA 3ZR5A 2WLYA 3ZJ8A 1JZ3A 1Q6CA 1JI2A 3L2LA 2WC3A 3OIHA 4JIEA 1Q4NX 2CCRA 1QI3A 2GUYA 2J7FA 2O92A 5AYBA 1VRXA 4W8BA 1ZU8A 4LYPA 4AISA 2A3EA 3OZOA 1E5NA 1MXGA 1JDDA 3LPFA 4E8CA 3EDEA 1UD3A 4P7QA 3ZT6A 1V3JA 1M53A 1XH0A 3WBEA 4DUXA 3VD7A 2CHNA 3TONA 1H49A 3DYPA 3J7HA 1LL4A 1ZBKA 5EBAA 3T09A 1FP9A 3A4AA 1C90A 3APGA 1GOOA 3PZOA 2DH2A 2J74A 4P8WA 2VX6A 3AIBA 2WVUA 3WH5A 1WZAA 2EJ1A 5D8WA 1ZBCA 1DHKA 3AIWA 5JIWA 2ESCA 1VFFA 2DSVA 3A4XA 3VGGA 2CIPA 5EMYA 2J7CA 4U33A 3VIPA 3W27A 4CKQA 4M24A 2CBVA 1CIUA 4CCCA 3BSGA 1U33A 1BYBA 1BYAA 4OBSA 2X0YA 1JNEA 5M03A 3F5KA 4QCEA 2O9PA 3QGVA 2A3AA 2YKKA 2J25A 1UKOA 5E6YA 1LWJA 1NOUA 1J0ZA 1CNVA 4AEEA 1V02E 5ECUA 3NDZA 4PMQA 4JAWA 2G41A 5D9PA 3WMCA 4WF7A 3RM4A 1AMYA 5IHSA 1WCGA 1E6XM 4UTFA 3POCA 2CHOA 5D9NA 2CKRA 3AFBA 2OSYA 2WHLA 4OBRA 3SURA 3VD5A 3CH9A 1UA3A 3FAWA 1HKKA 3WNLA 3F4VA 3GYCA 2DIEA 4TX6A 3SUUA 3K1DA 5CZKA 1UG6A 1E0WA 2VCBA 3U7BA 1QW8A 2XTKA 3WF1A 3ZM8A 3RPMA 4AEFA 3L4VA 4CD5A 1JZ5A 2V3EA 4V2XA 2GSJA 3RJXA 3A6OA 1UKQA 1UR9A 4DWSD 1W91A 3K46A 4X0VA 1W3LA 2JFEX 3WF4A 5HXMA 2IUZA 3ZSSA 5CG0A 3GBEA 3IANA 1E56A 1E4MM 4CU7A 1H0GA 5FIPA 1L0PA 5EFFA 4KGLA 3PZ9A 4AMCA 1PAMA 1B30A 3AMCA 1OIFA 1KWGA 2DT0A 4UZUA 4CVUA 1H11A 2D0HA 2WPGA 3ARZA 4CCEA 4AIOA 3SUWA 1AQMA 4RE4A 2XVLA 1MQPA 1Q6DA 4R27A 1TFVA 4HOZA 3SUSA 4JL1A 1UWUA 4K68A 1ECEA 3BAYA 1PIFA 1QBAA 3W37A 1R8LA 4AXNA 3FNDA 4QLKA 2WC7A 1LF1A 3OBAA 1E70M 4S3JA 1BVNP 3VGEA 2YJQA 4MDOA 1J11A 3THCA 4FMVA 4U2ZA 1EO5A 1CGUA 3ZT5A 5E9AA 5D4YA 5GQBA 2ZWYA 1KGXA 1V3HA 2V3FA 1BGGA 4LYRA 2VZTA 2DSWA 2QPSA 5I23A 1BTCA 2JEQA 3B9AA 1B3VA 1QNOA 5CXPA 4F8XA 3SCTA 3OLEA 1E9LA 3K4AA 2JF7A 2ZX8A 1HNYA 3NSMA 1UH3A 3L4ZA 4EE9A 3VGDA 2PWDA 3PZTA 4HZ8A 2VQUA 1U2YA 1W2VA 3WMSA 2G4FA 3CBWA 3N15A 1JZ8A 1NOFA 2CETA 4UOZA 4UOJA 3MS8A 3AHZA 5EB8A 4W89A 3CZKA 1BPLB 1V0MA 4XZBA 3RMEA 1DEDA 3O2LA 3OA5A 2Y4SA 2D24A 1EOKA 3PBGA 1YHTA 1UWQA 4PRWA 3EMCA 3VIJA 1RD6A 2GDVA 4PEEA 1CWYA 3LPOA 4BQ2A 5KZ6A 2J47A 4IISA 5IHRA 4PUEA 1E15A 3TTYA 2DSUA 4ATWA 3II1A 3WD2A 1E1EA 4ACZA 4J3UA 4ZE4A 1EQPA 5FD0A 3BCFA 2EPLX 1ODZA 4CN1A 3AS3A 3A3HA 5GNXA 4UQBA 1DWHM 3AJ7A 4JCMA 4J3TA 4PMDA 1XD1A 2J75A 2GDUA 2J8GA 2DT2A 1JI1A 1V3MA 3VD9A 4H7VA 2OYKA 7CGTA 2WCGA 1B3XA 4QLJA 1X1NA 1BGAA 1OSEA 1OWQA 1RH9A 1RP9A 4P7OA 1GQLA 2V5DA 1EH9A 1UA7A 1VAHA 2VRQA 3QR3A 4UZSA 3WDPP 2VX7A 2DT1A 2Y8KA 4PCSA 3FY1A 3ZR6A 1P6WA 2CITA 3VIOA 3VTRA 1MW3A 2GJXA 3WUBA 1BYDA 1UD2A 3WELA 1TG7A 2QV4A 3E1F1 3UEQA 2DSZA 3D3AA 1JZ4A 4J3XA 5BRPA 2VC9A 1CXLA 4QP0A 3RCNA 2XPKA 3VIGA 1WAWA 3PHAA 4AD3A 5KEZA 1V6VA 5DT5A 4PYSA 4NSBA 2XG9A 3EDDA 5A8OA 4HA4A 1QBBA 4QDMA 3PZUA 4B3KA 1HL9A 4M29A 4PTXA 3K8KA 4ZXOA 4PMRA 1MQQA 2QLYA 2YL6A 4UQAA 3SCQA 3U7VA 3T2QA 1V0LA 2BXYA 2QHAA 2X1IA 3G6LA 2BHUA 4A3HA 3CZLA 1JL8A 3CUIA 3T0DA 4W5UA 1DP0A 2WZHA 1AVAA 1V3KA 1X6LA 5A2AA 4CGTA 4TOQA 1K9EA 2JE8A 5A1AA 2OWCA 2OYLA 2VVNA 4IPLA 2VX4A 1LLOA 5DO8A 2XFRA 4HU8A 1VENA 1QNSA 1OD8A 3N12A 1FH7A 3ECQA 4GIAA 4D71A 4MAZA 1NOWA 3T2OA 2WMKA 1VJZA 3W6MA 3B8SA 3SIMA 4MNJA 2UY2A 3EDKA 3OLGA 1L8NA 1B90A 3FW6A 3CZJA 1ZBWA 4MNMA 4AZ6A 1OGGA 2W61A 1W3KA 3VVGA 2RGLA 2X8RA 1QHPA 3PTMA 4X9YA 2CNCA 4TUFA 3KWXA 5LA1A 2CEQA 2WZEA 4WSKA 2JEPA 1H2JA 4XV0A 4CUCA 1PEZA 1OT1A 4V27A 3AIVA 3U5YA 1JIBA 5HPOA 3B9DA 4Q7NA 1Z32X 3VUPA 2DDXA 3WDIA 3SUTA 2WWCA 3ARPA 4LGXA 3VKKA 5FL0A 1UQYA 3UR8A 5IFTA 4URIA 2V3DA 4CD8A 4KWUA 4ACYA 3W0KA 1JD9A 4Z2IA 2WMIA 2XSAA 4HTYA 8A3HA 1XH1A 1YQ2A 3ARQA 1UYQA 2BY2A 4HPHA 1V0KA 1XGZA 4W85A 3RO8A
chains in the Genus database with same CATH superfamily
2Z2AA 3VIKA 4I3GA 1NAL1 3SCSA 1XC4A 2V5JA 5GNZA 2WVTA 1C7TA 4EVZA 1AH4A 2BXVA 1XIBA 1PPIA 1ZALA 4ZQCA 5K4XA 1GOXA 1I2PA 4LS0A 5K9CA 1DWJM 4WVXA 4HPGA 3NPVA 3K2GA 1KGUA 3RMJA 1W9PA 1Z3NA 1OC5A 4NAFA 1GYLA 4JDYA 4JYEA 2Z25A 2WVSA 4DYEA 1R2SA 1VBHA 3UU0A 1POKA 1GKPA 4NXKA 2C8NA 1GCYA 1YDOA 4AVOA 5CH9A 2FZMA 5FF3A 5HQLA 3VIIA 1KWKA 1B1YA 3ZJ6A 1BAGA 4TX8A 1EF3A 3BAKA 2AQVA 4F79A 4P8XA 3AZTA 5LNRA 4US5A 3UQNA 5FI8A 1B2YA 4YVPA 4UB9A 1J10A 1MVYA 4I6VA 4Z0JA 1I60A 5E6ZA 1XDLA 1E6RA 1RCXB 3WLMA 1XINA 3CLMA 3S1UA 1QOQA 5DN1A 3UESA 1S2VA 2GWGA 4NXSA 4JIQA 1ME7A 2QUUA 1VBRA 1CCWB 4R53A 2WBKA 1O1ZA 3UPWA 1MEIA 1RD5A 1C7SA 3KEHA 3K4DA 1V3LA 1DJXA 2GSEA 4ZO7A 1W8SA 4NT0A 1XC6A 3UCQA 5BROA 2CZ5A 5AY7A 2DZBA 1YMYA 3CXOA 1MFVA 4F9DA 2D3LA 2FB2A 1RK5A 1P48A 3I6EA 3KL0A 2X2GA 3NPUA 3GU1A 3LA4A 4DLFA 3AZSA 4XISA 1L6GA 5D2XA 3NL2A 4B4HA 3M5VA 4XSLA 3FFSA 2XWEA 3S47A 1NH6A 1E72M 4H7CA 3FJ6A 1RY8A 4H8NA 2E9MA 4ZO9A 3ID7A 2CXGA 3NTYA 3QN3A 3TWAA 4NL1A 4WKHA 5C70A 1H41A 3BICA 3RFAA 4HOWA 1SO6A 1UD4A 2WSRA 4JTDA 4TV5A 3MUZ1 3ZOAA 3NM3A 4JFVA 3N3TA 4BQ5A 1J0KA 3RX4A 3AMDA 4GBDA 3RAOA 1H3GA 4POCA 4ZGYA 4JYFA 1XLCA 1PE1A 2XH4A 4HU4A 1A3HA 1HP4A 4LEQA 4S39A 3EPOA 1ZB5A 4LU0A 3P5ZA 4QDWA 1ZAHA 3AISA 4QJ1A 4HCLA 2Q8LA 4CNTA 1NQ6A 4ZB2A 3UG4A 4EKJA 4WDUA 1UD5A 4RDWA 4XIMA 2XM1A 1WV2A 4YNGA 2DJLA 1TELA 1TPWA 3O1NA 3OB8A 4ZCWA 3WDRA 3HG3A 3EOLA 3N17A 3U2ZA 3WSUA 4OV4A 4ZTYA 1X96A 4EPKA 4RL3A 1YTDA 3KM8A 4IM4A 2X05A 3L2IA 1UASA 2QCHA 4RUBA 3BWWA 1OT2A 3P67A 1GVRA 1HKVA 3Q94A 3HZ3A 1IT7A 6TAAA 3FJLA 3GKFA 5I3JA 1VPXA 3LENA 4GY0A 3UVAA 3P0WA 3V16A 2J4GA 4FI4A 4FNPA 2BVYA 1QHOA 1LOQA 5KETA 4O1AA 4JNZA 4HGXA 3FX4A 4M19A 3P93A 3K4WA 2O0TA 4GXMA 3CQJA 4NNAA 2WC4A 5E09A 2VELA 4UFJA 4OV9A 3PUDA 3NZGA 3W7KA 4UWMA 1KM5A 1SW7A 3OODA 2PWHA 1XRVA 1G01A 1RVKA 1PZ2A 1V6UA 3ERPA 3RNDA 4FIQA 4Q4RA 5MKGB 2E0PA 3UGVA 2WAGA 1OJXA 4LNCA 4LV4A 1HGWA 1F3TA 1MUCA 2J78A 4GZEA 1XLAA 1GTHA 3BSMA 2YZ5A 4LBRA 1PJ9A 3DFYA 2QKFA 3PTKA 1EJWC 4GVGA 1CGWA 3PC0A 4K1WA 3WK0A 4C6NA 3AROA 1O5QA 3CPGA 4PMOA 4KMQA 1LYXA 4W7WA 4W4QA 2PODA 3P0XA 4NF7A 2GSHA 3OZPA 4JL2A 3TN3A 1L6SA 1GQNA 1A53A 2D69A 1X6NA 1R2RA 4DI9A 4BF9A 3N04A 3VMOA 4L1GA 3AS2A 4GXWA 4L9ZA 1M04A 3STCA 4OIFA 3BLDA 4YHGA 4TTGA 2WHJA 4L61A 1KBKA 1R38A 3W2KA 1OX6A 1I1XA 1TIMA 1KCZA 1W9BM 1M68A 4QQUA 2IXVA 1GZJA 1QI2A 3NQ7A 4M82A 4AZ7A 1HJQA 1UPPA 2W4XA 3EWXA 3DFPA 3GAYA 2PP0A 1M41A 3M9YA 3VDHA 1ZJBA 3ME3A 1K7EA 3FSTA 1WQ5A 2HVOA 4DBSA 3UERA 4C7FA 1TX0A 1W5PA 3SSJA 5GJPA 2EG7A 4O15A 1Q45A 1OZQA 4B3LA 4G7EA 4ZFMA 1VJSA 4MTVA 4Y2WA 3GW3A 4XZIA 5GNYA 5G4WA 4KWOA 3CHFA 4C6QA 1WAUA 4GCXA 3G8RA 3UA3A 1JYWA 3TTOA 4J1OA 1AW5A 1GW1A 1PKNA 1J01A 4JTAA 3N2XA 3W38A 4QM1A 3C8FA 3TROA 3VM5A 3PWAA 3AS0A 3VPLA 1AMKA 4IG2A 4O53A 4PMXA 3B4UA 4GFIA 2E4TA 2AKMA 3GDKA 1T7LA 1HIZA 3Q37A 1ZJAA 2C79A 3TEVA 3GVWA 1KRMA 1IXNA 1NARA 2XFFA 5CSSA 2VEMA 1OM0A 4ERIA 4HYRA 3EB2A 2PWVA 1HFBA 4ATLA 2V5KA 4MWAC 2OZTA 3MP4A 1GOMA 2B31A 3TJIA 4QG6A 4REQB 3GW0A 4JCLA 1V6XA 3OTRA 3VILA 1HTIA 2ZZ4A 3QC0A 1RLCL 2DVTA 3LTYA 4BR1A 5LXEA 4Q6XA 3PTQA 4WXYA 1UIPA 1MFUA 1SSGA 3JZUA 1AA1B 2XGZA 2QCLA 1GKRA 4PSPA 1JDEA 5DMYA 4XD5A 4AY1A 3FYYA 2HPIA 1YBQA 2FPYA 5H1WA 3IUHA 1XLFA 3L2MA 2ISVA 1G94A 2PD5A 3CZGA 3VDCA 4DYJA 4HA0A 1KLZA 2PLKA 3VINA 3F4DA 1R86A 2CKSA 4NZJA 1OFQA 4YU1A 4HHPA 5CJ5A 2O9TA 4F4RA 2VNCA 4UMAA 1Q6QA 3LS9A 4ZOBA 2JBMA 4K8HA 4AC7C 1O66A 1OY0A 2YXOA 1VFHA 2BTMA 1K70A 1OD0A 1X7IA 3WLJA 5I09A 1H4PA 4DWSC 5D30A 1Q4WA 5A95A 3A24A 3MHFA 4J28A 3HGRA 3KDNA 3GIQA 3UXIA 2ZXDA 3KBVA 2ZTJA 3VD4A 6ALDA 3H54A 2X1UA 4JFTA 2QIWA 4AWSA 5AC7A 1OGBA 2R1NA 5FEWA 5LYRA 5AVHA 4ASTA 2BVWA 4NJJA 1AODA 1GHSA 1R5YA 1FHLA 1XYBA 2Y6ZA 1E73M 2ZUWA 3CIVA 4C7GA 2PB1A 3W1TA 5BOEA 5HDRA 4WKAA 5I3IA 1S2WA 2FGLA 4C6EA 4O1FA 3M5YA 3B97A 1D7FA 2J77A 4DBDA 2IS7A 4E2VA 5T8GA 3GVVA 1AJ0A 4YIWA 4A4AA 3NJ3A 4UTJA 2G5WA 2J7GA 2OOFA 1PHQA 1ZENA 5D05A 4BA0A 4NG3A 5F4XA 2EQDA 4Z2KA 3ARSA 1PWMA 2GOUA 3ZQ9A 5FJIA 2C14A 2PZNA 3TLQA 3NOYA 5FESA 1O68A 4J27A 3EXRA 3ITYA 1J0JA 3U9IA 1U83A 4Y96A 4PH6A 3AIEA 3TYUA 4DWSA 2YW3A 3F4NA 3MVTA 3E74A 1TSIA 5ABGA 5AC8A 2PLJA 2A21A 4H6RA 3WNKA 3E0VA 2GPTA 2HK0A 4H00A 3RLUA 3U4FA 4A3YA 1TPB1 2YBUA 2PTZA 5A6JA 2ZZ7A 4CQ9A 2XGBA 1L6FA 3GR8A 3RDKA 4Q8MA 4M5PA 3H12A 5CC6A 2CC0A 2VTFA 2Z2UA 1S2AA 4NRSA 2CU0A 2DJXA 2E28A 3UCDA 3ENLA 3ABRA 4AZBA 2YA2A 3CTTA 4AD1A 4IIBA 2C0AA 4OOUA 4GH3A 4DJDA 2ISSA 1ALDA 4UTMA 4O1DA 2PDQA 1SJBA 4M56A 3HMCA 5I03A 3F7JA 3OJGA 2IPFA 4NILA 3BG9A 4U2YA 1TCDA 4UUIA 1F4AA 2INEA 1OINA 4E3VA 1HJXA 4I8DA 3CUFA 1KFKA 3G0SA 1RBLA 2FTYA 1O4UA 3S9ZA 2ZUNA 3FKKA 1XP3A 2VL4A 3N1AA 1KTCA 5LNVA 2ZYFA 5A6LA 4PB3A 5CGQA 5A6BD 3IIXA 2NUXA 4US5D 3RLVA 3WH6A 5C8BB 4B9YA 3S42A 3KOXA 1PKMA 2J7EA 1O5XA 3LCIA 2A3BA 4K7VA 3HQNA 1AZ2A 5A3HA 3LRKA 2R94A 3WF3A 1W5OA 2VD9A 3W7GA 4CN4A 4WDWA 4C90A 2E77A 4N9BA 1A0DA 1GVEA 3VOIA 1KBBA 4MB4A 4IJBA 1DL3A 1R6WA 2HXTA 4WY0A 1TR1A 3L0GA 5TQLA 3B9OA 3T42A 1J9YA 3NURA 2VWSA 1Y5WA 3DGRA 2QS8A 1FBAA 5K3VA 3QQ0A 3SQMA 1TB3A 3WD0A 1TPH1 3C8NA 4ZOEA 4DM1A 1GVSA 3Q2DA 1UZ4A 3NZ1A 2EG8A 2Z4GA 1XBYA 3TVAA 2XVGA 1EXBA 4G7EB 1ONEA 4IT1A 3LZ5A 4RXGA 6XIAA 1PSCA 3WEMA 4Y9AA 5BMWA 1JG9A 2MUCA 4YN5A 3PPFA 4LT9A 3E0LA 2VXNA 3RLGA 2ZDRA 2D1ZA 3OVRA 3PAOA 4F48A 2YGYA 4PUDA 3CWOX 4AWUA 5GJMA 2H9AB 4PL1A 1ZP3A 4L1WA 4CD7A 1TZ7A 2BNJA 2O7SA 3T0AA 1H7RA 5DF0A 4HK5A 3W7CA 2TYSA 1EJSC 3MY9A 4O0ZA 5DMLA 1GPWA 5ABFB 3I6TA 4DPQA 1W3JA 3RYSA 1EJUC 2YXXA 4MPQA 3IK2A 4JN6A 3QMSA 1UW9A 5CPMA 3SFKA 4I5UA 4JD4A 1Q6FA 3QVQA 2RDWA 1P7TA 3PSVA 1Z9AA 3GE7A 3RR4A 1QI5A 2HPMA 1S46A 1J93A 2VGGA 3I3DA 1IZJA 2P5NA 5DCDA 2R14A 3WBWA 4MJMA 3ARWA 1T6MA 3VC6A 3EWZA 3V1PA 2BY1A 5A5WA 4P2VA 1UH2A 3H26A 3LHTA 4NZCA 1PKYA 5A6KA 2C15A 2E9BA 4R34A 4S3KA 3NZRA 1BD0A 3ARTA 2X30A 2NQ9A 2IMRA 3GH4A 1S5NA 4EAMA 3FDGA 1C8XA 2Z6IA 4IMDA 3HTWA 4LJ3A 3TFCA 1GYNA 1OFAA 2YL8A 2CLOA 1F6KA 1PX8A 1ADDA 3B3DA 2JALA 4QE4A 5I3KA 2W5FA 3CLWA 2DVUA 4AC1X 3G1RA 5IDIA 1F61A 4MY1A 3VABA 1QPNA 1JZ6A 1V79A 3E2QA 3M6YA 3MV11 4FS9A 1Q6OA 4JQAA 4GUJA 3WFZA 3WFLA 1LUCB 1QATA 2X2YA 3R5EA 3P8JA 2F2KA 4LEFA 2WW5A 3ES8A 3GTNA 3AYSA 3HGSA 3CUZA 3L5MA 4L4MA 1S1RA 2BZNA 4JIHA 4J3WA 5FSDC 1UOKA 1ISVA 5IBXA 2IXUA 3S3GA 1PCWA 5I6SA 2DPEA 3BOFA 3LOTA 3FVMA 4GZJA 4ZTXA 2FZBA 2WMIB 3OW1A 3QYSA 3M0XA 1HO1A 4QCFA 4RZBA 5ABFA 3OHIA 1KFBA 2XU2A 4I7VA 4ERAA 4D6DA 1BTMA 1OIMA 4IMGA 4XAFA 3R6IA 3G6MA 3BAXA 1YTEA 4RLIA 1B3WA 3TAKA 4EXAA 5HJXA 1XLDA 4GX8A 3GFZA 4X22A 3W86A 2WCSA 5HJLA 3VKDA 4MB1A 4UTIA 4HHHA 3INPA 4RPQA 5LIYX 1ME9A 1UD6A 3D5HA 4UCGA 3LU2A 2V5LA 4UNLA 1SFSA 1G4PA 1XIEA 4L80A 1DJGA 4UTWC 4R7WA 4EWND 4YVVA 4BI6A 4WOZA 4Z2JA 2OQYA 3L4YA 2VUNA 2ZZ5A 2R91A 1HJUA 4UTKA 1DXFA 1FWAC 3IK4A 1GOIA 1UWSA 3KRBA 1K8YA 3LQGA 3N2BA 1RSCA 1VR6A 3R89A 2PPGA 1Y8BA 3HPZA 2G3JA 1UIOA 5G5IA 4C65A 3E3HA 5IBXC 3R13A 2RKXA 1WDWA 3B05A 5D03A 1T96A 4MM1A 1HX0A 2Y88A 1GONA 4TIMA 1K9TA 2QPUA 3S5ZA 2DU2A 4IX2A 4D6EA 1NDZA 1TPEA 4KWVA 4QS6A 3KOZA 3ABSA 3S2MA 2YFNA 1JCJA 1FKXA 4CNSA 4KWWA 2WBGA 4WUIA 2VQTA 5DANA 3N9KA 4J3ZA 1SFJA 2BLEA 2W92A 3M44A 1JCYA 5I06A 1XM3A 3E49A 3OGSA 1EHNA 3JR2A 1XHGA 4JY8A 4FOKA 1UR3M 5IOBA 3HGOA 5A6SA 1RP8A 3EBVA 1KKRA 4L4OA 4GUFA 2XIJA 4UNKA 2RJGA 2GL5A 1A3XA 3G1XA 3SCOA 2G8ZA 1JJKA 3ORWA 2OEJA 1I0DA 3CQIA 3W84A 4J3VA 1CDGA 4K37A 3DI1A 1W37A 2Z28A 4OKDA 2QXWA 4FR1A 4DAFA 3KP0A 1J5SA 4HZ6A 3H4GA 3IGSA 3KP1A 4XBSA 1ONXA 3MKVA 2A6NA 1OC6A 5D9OA 3V0TA 1JUEA 4BHYA 3S6DA 1FWHC 3FA5A 4GJJA 1PUDA 2X40A 4O16A 3GG0A 3KBJA 3GDMA 4IFKA 3UYCA 3CT7A 4CCDA 1AJ2A 5AECA 4JTCA 4FNUA 4B2DA 1TA3A 4DUWA 6REQA 5E0KA 4GVIA 5JU6A 3DFOA 6CGTA 3V1HA 4PTWA 5K9XA 4EANA 2C7FA 3SGUA 3ZJ8A 3L2LA 3AU2A 2BX7A 1P0DA 4JTJA 3VKJA 2CCRA 4L1XA 4F0RA 1QI3A 4XSMA 2YCJA 2GUYA 4CQAA 5AYBA 4DEFA 1GJPA 2A3EA 4Q3MA 4F2TA 2H90A 3W7JA 3ZT6A 4JEQA 1K8CA 4IP4A 3TCEA 5GVJA 1Q7MA 4B5UA 5F1UA 2OB3A 1G67A 5C9WA 1I0BA 1H49A 1LL4A 3J7HA 2VEFA 3A4AA 2C19A 3QPYA 2DH2A 5J5RA 2FFIA 1ZP4A 4P8WA 3AIBA 1XKJA 1YXDA 4CLMA 4KRZA 3WG6A 4H01A 5K2ZA 1BEUA 5JIWA 3A4XA 1VJIA 4U33A 5AHEA 4CCCA 1OADA 1O5RA 1YTKA 2FMOA 4K8EA 1QPQA 3W1QA 3F5KA 1FCUA 2O9PA 2PDIA 1MI3A 2ICSA 2YKKA 3CYVA 4AG0A 3QBUA 5ECUA 1V5XA 2IPGA 3QMTA 4PBFA 1EWDA 3WMCA 1EJTC 3PBWA 3W7PA 4WF7A 4B5XA 3RM4A 3UZYA 4QS5A 4TQTA 4DJFD 1E6XM 3POCA 3AO0A 3KFTA 2CHOA 2WHLA 3VCCA 4M3PA 3DC8A 1I2RA 1HKKA 3WNLA 3AAMA 3VOFA 3FK4A 3G1VA 1R3SA 5CZKA 3VFLA 1V51A 1QW8A 3ZYZA 3W2MA 4FNRA 4CD5A 2V3EA 3RJXA 3NQAA 3W71A 3DEQA 3PK7A 3AWNA 6ENLA 1QXLA 3K46A 4X0VA 4NVTA 3UR2A 1TPFA 3WF4A 2IUZA 4EPBC 3B06A 2CZFA 1F5ZA 2IKIA 2VEPA 1EEPA 4MFEA 3THAA 1K02A 1CI1A 4O18A 3SAZA 4S3DA 1TTPA 4A05A 1OIFA 4CVUA 4NKCA 3TSDA 2D0HA 3ARZA 4IXHA 1REQA 3R11A 1Q6DA 5AHMA 3UBPC 5HUOA 2WJZA 2D2HA 4HOZA 5DY3A 2P8CA 2Y70A 9XIAA 1W8GA 4R88A 5BZAA 2CZDA 2D2JA 1R47A 3ZLGA 3N2MA 2H3BA 1XICA 2VR2A 1BVNP 5DMMA 2FPVA 3THCA 4CCZA 3MBFA 5E9AA 2V6AA 3FV9A 3MTWA 3WCZA 1NIUA 1KGXA 2A6LA 2V3FA 2GVEA 3H2NA 3R25A 4LYRA 2VZTA 2DSWA 5FF0A 1BTCA 2JEQA 3EPNA 3SCTA 4JIIX 3RU8X 4GNVA 2Y5JA 1E9LA 1M6JA 5K7JA 3NGFA 1UH3A 1HZYA 4UTTA 3VGDA 3PZTA 3WBYA 4ZQPA 4E4UA 5KTLA 1U2YA 2G4FA 3E2VA 5I7GA 1B54A 3SW6A 5DMNA 3LHWA 4Q8VA 2I16A 1XBXA 3MSRA 4XZBA 3UWWA 3IVSA 3B0UX 4X60A 1DEDA 3WJXA 1B4EA 4IIEA 2Y4SA 1JUBA 3H21A 3PBGA 1TZ9A 2ZFAA 3CIXA 1XJBA 4PRWA 3VIJA 5G1TA 4LF1A 3GXTA 5KZ6A 5EGRA 1US0A 1H7XA 1FWJC 3KBWA 3UR5A 3WD2A 1E1EA 1FWEC 2C16A 2XH7A 4LCQA 5HR7A 2ADAA 3SY8A 5FJOA 3VZXA 3AYVA 1BKSA 4NAEA 4CN1A 4UQBA 1DWHM 5CZSA 3AJ7A 4PMDA 1AW2A 1XD1A 4HMNA 3L68A 2AL2B 2WCGA 1JCXA 3LUTA 1B3XA 1RA5A 4QLJA 4G9PA 1Q8JA 1DIKA 1X1NA 1Q2RA 4P7OA 4YCPA 2RDTA 1GQLA 1OFOA 1PWLA 2XH0A 4IFKB 1UA7A 1QK2A 2VRQA 3KLKA 3QR3A 3RPDA 3MP5A 2DT1A 3C86A 1D3HA 3PFMA 4BI7A 2GJXA 1TV3A 3WUBA 5K9DA 1TPC1 2Y8UA 1UD2A 4MMWA 2TRSA 3LRMA 2QV4A 4R7OA 3D3AA 1BXBA 2EKCA 4O12A 1OF6A 2XPKA 3ITOA 1LWIA 4KWSA 3BQ5A 5DT5A 4PYSA 3EGJA 1CT5A 4NSBA 3RGTA 4HA4A 1W3TA 3BV7A 4ADTA 1Q5MA 3RX3A 2ATMA 2QCNA 2QLYA 2YL6A 4DJEC 2BSLA 3L7RA 4GYKA 3YPIA 2PLCA 2GVGA 2QHAA 5AKQA 2BHUA 1Z8AA 4W5UA 2O55A 3UJRA 1V3KA 1IQ8A 2PCEA 4N4PA 5G4EA 4CGTA 4TOQA 1K9EA 3IACA 1A3WA 1ADSA 2ZRVA 3BL3A 4TO8A 5A1AA 3EX2A 2VX4A 4B5WA 1OD8A 3H2MA 3HPAA 3BG5A 4BK9A 2E6DA 1NOWA 1P1MA 1X7FA 4YMZA 1CB2A 3SIMA 1VFLA 4MNJA 3W88A 3FW6A 1B90A 1DE5A 1ZBWA 3DN5A 3VZZA 1EYWA 1Y65A 4UMCA 4DUOA 5AFDA 2I5GA 1GVQA 4X9YA 5A6TC 2CNCA 1H1ZA 2JEPA 4CUCA 1PEZA 3EA3A 4PEKA 1OT1A 3AIVA 5HPOA 3MUCA 1XBVA 3DBPA 4DIAA 1KC7A 2EG6A 3VUPA 5FEXA 3TCSA 3PVFA 3T55A 2PWUA 3OBKA 4LGXA 3VKKA 1B9BA 5IFTA 4URIA 4PBEA 2W27A 1YPXA 3B0YA 1Q13A 5E9XA 2Z00A 2JKEA 2WMIA 3GIPA 4HTYA 2TODA 8A3HA 3USBA 1XH1A 3F03K 4EWJA 2P0IA 1JQXA 2VDHA 3ITLA 1O95A 2YYTA 1XGZA 4W85A 3EWUA 3ZFHA 1BWVA 3IIVA 1Q63A 5M3WA 3QHMA 4H9VA 1EGZA 2G96A 2BASA 2ZX5A 3VNKA 3NOEA 2WWDA 3R94A 4PMVA 3L66A 1D8WA 4JTIA 1P6CA 4MB3A 1BWLA 2BHYA 3THQA 4O14A 2V2HA 2NV2A 3W2JA 3KBSA 1JQVA 2QVHA 4JN7A 4JKLA 3RCMA 4M6UA 4CU8A 5LZLA 1ZLPA 3A23A 1XWYA 1O94A 2O9RA 3AYRA 2QCDB 2ZUUA 4KESA 3KCLA 2VZVA 3GY1A 4Y90A 3FLUA 1OYAA 2ZWZA 3PTDA 3AALA 4LX4A 1QAPA 1QT1A 4W7VA 4Y8EA 2ANUA 1EXPA 3EEZA 1VYRA 3OPSA 3ZJKA 3AOFA 3PZVA 2G3NA 2PURA 4U5KA 3WLSA 2JGQA 4XZMX 3EX4A 4WY0F 4CNOA 3TC7A 1E5JA 1TVPA 1OEPA 1U5JA 4PGLA 1CECA 1QPOA 1YNPA 1W1PA 4R85A 3H70A 1JYNA 3SJNA 3AWOA 3BLIA 1DHPA 2NLYA 1OG0A 1EPVA 3WEZA 3W7DA 1EP1A 1E43A 2FKPA 2ZXAA 1QRQA 4HU0A 1IEXA 6XIMA 3O9NA 4WOQA 5DLCA 1JCLA 3VIFA 3VNMA 3VNZA 3IRSA 3WL1A 3DXIA 2PLMA 3BO9A 4MNLA 1S5WA 3EWYA 4HHMA 3CHEA 4ICCX 3QY6A 5U7SA 3R10A 3TW7A 3DG7A 1EP2A 2OXNA 5EFDA 4S3CA 4IGMA 3QZEA 4L7ZA 4IJRA 3GM8A 2DQXA 5CAKA 5JBDA 3O63A 2E8ZA 4F66A 4FP1A 3MANA 4A8RA 3BCDA 1MMFA 3GNNA 3PB0A 2YLLA 1WUFA 2D73A 3M0YA 4QE5A 3M7SA 4IL2A 4NJHA 3FYPA 3QY8A 4C1NA 1UWTA 4O0KA 1X39A 5KMYA 3N25A 3OQ8A 4HYVA 1XIHA 2Z1BA 5L9FA 1UR2A 3O15A 1FWRA 2O4MA 4E2BA 1GT8A 4JTSA 1UCWA 3KE0A 7ENLA 4IPPA 3L65A 3ABZA 3QR0A 1RQBA 2YA0A 3HO8A 3QKEA 1TMQA 5BXTA 4O8AA 1ZAJA 1DV7A 1CYGA 4JEJA 1L2QA 2QNEA 4GH1A 4XBJA 3GHSA 2PDUA 5HOSA 2GJLA 3N6JA 4E5TA 2EO7A 2Q02A 4QQ3A 2DIJA 1G7VA 1EOMA 4DZ5A 1JFXA 3HG2A 3TQVA 1H5YA 3MP3A 4LC6A 3CV7A 1TA3B 3NFUA 3ARUA 4W93A 3GD6A 4GNJA 2JIEA 2WK2A 3WUGA 2AAAA 3OVQA 4D1JA 1GVYA 4AZCA 1XCWA 2J9YA 1MQRA 4YLWA 3AXXA 3H53A 2DZAA 1ZSXA 4MAVA 1XIJA 1QK0A 1W5NA 2NWRA 2OLAA 1V77A 3BW3A 4BQ3A 1E1FA 2YW4A 3NZPA 2QDDA 4CEUC 5DX7A 4JFWA 1NY1A 3NWRA 4O1EA 4AIBA 1VS1A 3E0WA 1Q8AA 2VC5A 4GX9A 3GNRA 5D32A 1CXHA 2F2HA 3PUEA 2FGZA 3KL3A 4U31A 2ZX6A 2PBOA 4WR3A 2GQAA 3IPWA 5CLTA 5HNNA 3MVIA 4MY8A 3MZNA 3F1QA 2QF8A 4EF8A 1C91A 1NDWA 4LQ1A 4YTQA 2XGIA 3WEOA 3MSDA 2EPHA 2V5BA 2PI6A 4IHCA 1XFCA 3LBCA 4YL2A 4UFMA 3TUUA 4Z1DA 1PX3A 1DWAM 4DJFA 1UP2A 3Q67A 2ABBA 2QEZA 4UTTC 1PYMA 1U30A 2GUUA 3EWDA 2ZBTA 1FP8A 3T78A 4AX7A 4WJ8A 4CVWA 1IHIA 1YDNA 1TPDA 3P2VA 3H2CA 5I3FA 3BJFA 4ZEPA 2VURA 4UMBA 4IIDA 3BV4A 2XFWA 5C2CA 1UJQA 5C9UA 4V1YA 2NVCA 5KITA 1Z6KA 1V6TA 1K6AA 4YHEA 5CPSA 1EA9C 4Q8PA 3LCGA 3WUFA 3N29A 1NWRA 3KTSA 4NI8A 2VGBA 5A2CA 2GFTA 3BLOA 2QJJA 1RZMA 4GCAA 3MMWA 1XIIA 4YYCA 1IEWA 2OPJA 3TSBA 3S1GA 3LPGA 1GJUA 1WKEA 1TE1A 2PDBA 1MEHA 5M17A 2XVNA 3ZWTA 1CGYA 3SBFA 3S6TA 4K8GA 4DO5A 3OU8A 4HIBA 3SR7A 1ISZA 4KEZA 4Q33A 3WKZA 2PTXA 2D3NA 5LIWX 2W62A 2Y62A 4G5DA 1E0XA 3QHNA 1K8ZA 1E3XA 1NEYA 2E9LA 3TYDA 2WOQA 3AXKA 4CD6A 3TQ0A 3WLOA 5D02A 3LNMA 4TMCA 2XN2A 3URQA 1GTEA 3BVJA 1XIDA 2OT1A 4WK9A 4Z1BA 1VYSX 4M8UA 4DO6A 3OG3A 1XIGA 1UR8A 3PSWA 1BG4A 4H8UA 1ZFJA 3AIUA 3C56A 5AB3A 3W02A 1WNOA 4PB4A 3RO6A 3LD5A 1W3HA 3RPTA 1WKFA 1NSJA 4KCVA 2E09A 3TFXA 3L4TA 3PULA 2VDGA 2QAPA 2YOCA 3VM7A 1US3A 2YLAA 1OFPA 3ZWSA 2ZE3A 4C1LA 5CAHA 1TQXA 2WHMA 4BI5A 2OMAA 3GTFA 4MYXA 4GHRA 4JN8A 3RU6A 2ZOXA 2CLHA 2CWNA 3MUAA 3B03A 4YVXA 4D6IA 2R1PA 1IGSA 2CESA 5CEWA 3H4WA 3F2BA 2G0WA 2JF6A 2GUBA 5BU9A 3T40A 3RR1A 4AU0A 2GGHA 1TJRA 3UWUA 3C2VA 2RJHA 2E6FA 3TNOA 2ZIDA 2EPNA 3CAWA 4GKTA 4LW7A 3H24A 1YEYA 5E5CA 1VHCA 3DC0A 3UNDA 5A6AA 5DBTA 2WSQA 3QRHA 2DORA 1CXIA 3IIPA 1EB3A 4O52A 3G18A 3ONCA 5HBFA 2OU4A 3WX7A 2ZUVA 4ZQRA 3CO4A 4B90A 1MDRA 3Q4DA 2B7NA 2UBPC 5M1TA 4QTGA 4H9TA 4B5NA 5LGXA 1DIEA 4ORMA 4CQBA 5ECVA 2WSKA 2V3GA 3S0CA 4IOTA 1TCMA 4UIOA 1HT6A 1XLKA 3BAJA 4ZQMA 1ITXA 1VEOA 3B9EA 3UP8A 1QI0A 1TZZA 4D6JA 2Y2WA 2GVYA 3G1AA 4ZO6A 5LKYA 4PMYA 2OX4A 1F76A 3TH6A 1GW9A 1R7AA 1EEXA 2DEPA 3VFCA 3C6CA 5C9XA 3AZRA 1FA2A 2TSYA 1MWOA 4PRTA 3CJPA 3EYPA 1IEVA 1PV8A 3GR7A 4M80A 2PWFA 1WXZA 2VMFA 3REQA 1IE7C 2GJRA 5C5YA 3HPSA 4P7RA 5ABEA 2C71A 4GYJA 3DIPA 1O60A 3PZQA 2NX9A 1D7KA 3LY0A 1PVNA 1LT8A 3NPWA 4PMZA 4FLSA 4UC5A 2OQHA 4O17A 3O6AA 3RXZA 2J7HA 3ZR4A 1JDFA 2FZNA 2O9OA 4DNMA 3DDMA 3FEQA 4GUGA 4S3FA 3SRDA 4TU1A 4IIFA 3WF0A 4LSBA 3ARXA 3L4WA 1G69A 4YJ5A 1JFHA 4AD0A 4XK2A 3W2LA 3ZXWA 4CEXC 1XLBA 3WQVA 4OECA 1TMHA 4LY8A 3OQEA 4GI9A 3B8UA 5CKSA 1XD0A 3MJMA 2PRHA 2YCLA 3WDJA 1IR2A 1E0TA 1YADA 1S5VA 5B7YA 3QPZA 2FH6A 4MLRA 2OWWA 1JNDA 3FSUA 4ZQOA 3BDKA 2BS9A 4P8VA 4MZ8A 1NWTA 3S5NA 3QQWA 2NV1A 4KFPA 1XFBA 4UNIA 3EWWA 3TOPA 4XIAA 3XISA 4H9MA 1W6TA 2YYUA 4KQNA 3TV8A 1MYRA 2NWSA 3UYIA 3HQPA 3NDOA 2I17A 2ZUSA 4DY1A 4B15A 1A0EA 3CTLA 3VGFA 1JZ2A 3N3MA 1XSKA 4TR9A 1U22A 1W9XA 3BUVA 4XX6A 4XKMA 4N0RA 2VOTA 1RK6A 2JKAA 4AQLA 3W4RA 1NVMA 1U1HA 2I7GA 3LMYA 4UTLA 4NQ1A 4A3QA 3W7HA 4GYPC 1CXEA 4GPNA 3VGHA 4Q4PA 3HJZA 2ZVIA 4ZQNA 3CL7A 2A5HA 4MWAD 5C2GA 1NM9A 4EP8C 1E55A 1OYBA 4C6DA 3BURA 3KS6A 1FWWA 3BGAA 3RM9A 1VFOA 4S3GA 2X0HA 3IJ7A 3E0IA 4GZIA 3DECA 1JYXA 1TREA 4RDYA 1OFEA 3MUXA 4MJ4A 3R7MA 1RY0A 3NVTA 3T0TA 4S3BA 1DPMA 1DWFM 1FDYA 1P1XA 2E1DA 5I77A 3EOSA 1JDAA 3R1ZA 1NWSA 4UCFA 1EGVA 3W7NA 3GYEA 4JZ5A 5LNSA 1WBHA 2ZA1A 1R85A 1S2UA 1EJ7L 4HVXA 4GOAA 1TWIA 4HSNA 1NJJA 5LA2A 3TN4A 4JHOA 2GDQA 4TVUA 3KVLA 1PIIA 1AK5A 3VD3A 3MMTA 3CHVA 2WJFA 2OQLA 3NNTA 4QJ3B 4KFNA 5AN7A 1RUSA 4KF1A 2J7BA 5D33A 3W75A 1ICPA 4AXKA 2G95A 2RDUA 2YDSA 1UZDA 2CBIA 2QT3A 5AHIA 3LK6A 1RXOB 1OFRA 3QW4B 7ODCA 3ZSTA 1IT0A 1JPHA 3PZNA 2NQHA 2QV5A 4IQDA 5FOOA 1UZHA 1ITQA 1XKYA 1H7PA 3WMBA 4DJFC 4Z2HA 3VKBA 1JPKA 2QGHA 1BXNA 2Z7KA 2FIQA 1DJQA 2OCZA 3W3OA 1CLVA 4HNCA 1KA9F 4GYFA 1LWHA 3GXFA 1Q6EA 3D6NA 4B5TA 1KM3A 2ACRA 2RAGA 2PF0A 4LPCA 2E6YA 2REQB 5EMKA 5ENLA 1KXQA 1KBIA 3TKFA 3AMLA 3KOWA 5A2BA 2NLIA 4LYKA 2VP8A 1S2TA 2V67A 3PBYA 4PTNA 3UPBA 2V0TA 4G1KA 1K9FA 1OVDA 2HCVA 4GVFA 1AQHA 1XUUA 1QPKA 3T8QA 3TYEA 3M0HA 3H7UA 3DFQA 1UD8A 1BHGA 3LV6A 5CZJA 3T08A 2GOKA 2WNZA 2XFYA 2OSXA 4NX0A 1M1BA 2DZVA 2DZSA 1WE5A 1B9ZA 1X38A 2QMJA 3W85A 2KZHA 3FAXA 2UY3A 4MOZA 1LORA 5CCZA 2BFGA 2YBTA 4FZIA 3PBUA 3URAA 1RLDA 3S5YA 1GKQA 4WRHA 3NSNA 4NYYA 1NFPA 3ALFA 3KAOA 1JPMA 3GSMA 3N4AA 3GDTA 2G37A 1IEQA 3WH8A 4J9JA 2HROA 2BG5A 2E7FA 3ES7A 3I3BA 3AJXA 3TQKA 3MI3A 4QEEA 1F4HA 2NVDA 2OODA 2VCCA 4RV8A 2GQ8A 5FJJA 1H7NA 3BLFA 3GUWA 1NDVA 1VFUA 2ISDA 1KFEA 4D8ZA 4ENLA 1JGMA 4MUZA 1V4YA 3T4WA 2VR4A 2VOMA 4LF2A 2VFIA 1ELSA 2Q71A 1QMLA 2DIKA 3FN9A 1YE4A 5JXQA 4IICA 1EF2A 1UUMA 1KTBA 1YIXA 3NAVA 3WK1A 4P7NA 1GZ1A 4FNTA 3CQ0A 5CSUA 3AXHA 4Q8WA 4KRTA 4W88A 3NQEA 2YB4A 3PAJA 3USZA 4LH8A 1Q7QA 4R9XA 2V2CA 3BMWA 1O1HA 4PN2A 4XTIA 2GGEA 3H6OA 1PDZA 2QVNA 3L0NA 3E6EA 3OLDA 3AHTA 3LG3A 5TF0A 3WNNA 5FACA 3DU0A 5EY5A 3N2TA 4DBEA 2DUZA 2WMGA 4L4LA 1W54A 2ZX7A 8CGTA 1JXKA 3A13A 3VE7A 1QJWA 2YX0A 4HKPA 4IPIA 1XR2A 4NY2A 3TE9A 4XZWA 3SGGA 4XUYA 4HP5A 1EX5A 1BVWA 2VJXA 3N9SA 4NAEB 4GUHA 4HA3A 5LA0A 1W1YA 3N11A 4GI8A 4WZHA 4X2PA 5HJYA 3VMPA 3ITGA 3VO0A 4L6HA 4LB4A 3EAUA 1WZLA 2WM0A 1BSIA 3QV7A 3U8GA 4FA3A 3A4WA 1LTDA 4UQDA 5EL1A 3BK0A 1CTNA 2PE4A 4LUTB 5HPCA 3O6CA 1XBZA 4J5NA 3EZ4A 1ML1A 4PTVA 1W1TA 3LLFA 2MNRA 1GQKA 1ISWA 3A47A 2NT1A 3G1DA 1W9DM 4HNUA 1SZNA 4UFHA 2Z27A 4LS1A 3UWYA 1UR1A 2ZX9A 2FPTA 2NQ5A 3TTSA 1JDCA 1H50A 4CQDA 5LIKX 4DZHA 4EPEC 2AQWA 2X42A 5E0CA 5BYWA 1PS9A 3KWSA 4AY8A 3CWNA 2I14A 2VZUA 5CPQA 1IXPA 4DZAA 3UZWA 4GGHA 1D3CA 1FFRA 3N2CA 3VCNA 3C0LA 3MA8A 4FB7A 4FOJA 2ZRYA 5F2IA 4W5ZA 1EC8A 1ZJIA 4KEMA 1DYSA 1FWFC 3VKAA 3BMVA 4UQ9A 3V5OA 3P62A 2PTWA 3CT2A 4Z0SA 1R0MA 1KM2A 1LBLA 3M07A 1UOZA 3TR9A 2QJIA 3SRKA 2QCGA 3LEPA 2VVSA 1UKPA 2WVVB 4X63A 4Z17A 1EGMA 4M7TA 3KL5A 1HGYA 2WJEA 1AW1A 7REQA 4QSHA 1LQ0A 3D46A 4P8UA 1M9HA 2X1RA 2GVLA 2XYLA 1WP6A 2BBFA 2WV8A 4GBUA 1TWZA 4NI3A 2YDRA 1MXDA 1E1CA 4C7DA 3WBXA 1QFEA 1HL8A 1FH9A 2Y5SA 9XIMA 1WZMA 5CZTA 5EBUA 5EYWA 1G4EA 3WQGA 3M0VA 2WLYA 1JZ3A 1Q6CA 1U5HA 3WLHA 2WC3A 1EJVC 4JIEA 1W56A 4GFSA 4LYPA 1E5NA 1MXGA 4E8CA 3EDEA 2VC7A 5DELA 2Z26A 1M53A 3CV1A 3VOHA 4DUXA 3MCMA 1FHUA 3ELFA 3O8AA 1LT7A 3DYPA 4XVEA 5BOFA 1C90A 1IXQA 1MZRA 3IIOA 3PZOA 2J74A 4IG2B 1KV5A 3TYAA 1SFLA 3AXMA 2VX6A 4DQWA 3N19B 3WH5A 1WZAA 3HOJA 3ANVA 2EJ1A 2GQ3A 5BU6A 3R12A 1ZBCA 3WLKX 2DSVA 5EMYA 2J7CA 3LZ3A 3NO3A 4JQ3A 4WGXA 4ADSA 4HNOA 1BF6A 3SFWA 1BYBA 3HURA 1BYAA 5M03A 4G2DA 4B91A 2QJHA 3QGVA 2J25A 5E6YA 3TK7A 4PMQA 2C6QA 4O1CA 3HM7A 3G0UA 2HRWA 1QR7A 4ZODA 1AMYA 1Y0EA 3MWCA 3W70A 2WM1A 4PODA 2OSYA 2INZA 3SURA 3L5AA 1UA3A 4HTBA 1S3HA 2DIEA 3SUUA 4S3AA 1LRTA 1XGDA 2VCBA 1CB7B 3FA3A 2BOGX 2XTKA 3WF1A 4GWEA 3CEUA 3T8LA 2R6OA 3T0CA 4C1NB 1UKQA 5HMSA 1P0BA 3HG5A 3GFYA 1W3LA 2JFEX 5HXMA 4YWSA 3NO1A 8XIMA 2ZVRA 1H0GA 2C3ZA 4PC8A 1X6UA 3IJQA 3PPHA 4N4QA 5EFFA 3U48A 4AMCA 1PAMA 3AMCA 3MC5A 1S1PA 4UZUA 1IIGA 3TXZA 1H11A 1TVLA 2A79A 4A8IA 3W7OA 1VCGA 1S5MA 4AIOA 3SUWA 4RE4A 2XVLA 3DCPA 4R27A 1A5SA 1VLWA 3VCRA 3GLCA 2YPIA 4JL1A 4K68A 4Q7BA 1L6WA 4A3RA 3H2EA 3DG6A 1PIFA 3N4FA 3A3WA 1RALA 1KBLA 3FNDA 2Y7DA 3ZVHB 3OBAA 3BMXA 3SN4A 1YXCA 3VGEA 2OTDA 1XW8A 4MDOA 4FMVA 4MWAA 1CGUA 3VI2A 3CIWA 2OEMA 5D4YA 5GQBA 2ZWYA 3MO7A 4N7QA 3MWAA 2E25A 1V3HA 4HPNA 4I9JA 3PR2A 1QU4A 3S2JA 2AL1A 2VKZG 4JIPA 2XN0A 3CO8A 1QNOA 4KERA 1Q66A 3K4AA 3KCJA 3NSMA 1GWJA 2ZZ2A 2YSWA 3GNDA 2P3ZA 1PYFA 2PWDA 4LBUA 4QG8A 2QUNA 5HK4A 1RJQA 1MNSA 3N15A 1EZWA 2CLKA 4FSAA 4UOJA 1VBJA 3NO5A 5EB8A 4W89A 4EF9A 3KVKA 3GRIA 3OYXA 1GGOA 3CV2A 4IXXA 1EOKA 2EJAA 3BW4A 1UWQA 2GDVA 4PEEA 3LPOA 3V5FA 3W73A 3GZ3A 5CZ0A 4I9AA 1PO9A 4ATWA 3QW3A 1ITUA 3FYOA 2ACSA 4J3UA 4ZE4A 4DO7A 2REQA 3V36A 4F40A 4JBRA 4HJWA 3G22A 4J3TA 2J75A 2GDUA 2J8GA 3R0DA 1V3MA 1D3GA 3VD9A 2OYKA 1TTQA 3WLNA 1SU5A 4AWTA 3TJXA 1BGAA 3ICJA 1OSEA 1RH9A 1J2BA 5G2WA 2IQ0A 1JPDX 2I9EA 3HGJA 4JTTA 5C9RA 4YTTA 1LRNA 3WDPP 4IUOA 4PCSA 4XAGA 5G1MA 2CITA 5C55A 3W2NA 4AHPA 2YXGA 4HBKA 1H62A 4RX0A 5FEPA 1RJPA 4J3XA 2DZTA 2V63A 4DAIA 3GDLA 2VC9A 2R1KA 1T5AA 3VIGA 1WAWA 1F7BA 4MKNA 1QPRA 4AD3A 5HA7A 3R8GA 3P81A 4RZ5A 1SZEA 3PZUA 1KNWA 1HL9A 2FDSA 4PTXA 4Q32A 4ZXOA 3OA3A 1MQQA 3V0SA 3U7VA 3T2QA 4A8NA 1S38A 3G6LA 3CZLA 3CUIA 3TMLA 3E5BA 3OBEA 1AVAA 2DV0A 5CG7A 3T6CA 1Q65A 4G8TA 4KCUA 2RHGA 4JTGA 4IGNA 2PDXA 2OWCA 2OYLA 2VVNA 4IPLA 4RV3A 4XKYB 3ZVHA 2XFRA 5SWUA 1F6PA 1GEQA 3S8HA 3LXAA 4MAZA 3W6MA 3EXTA 3B8SA 1RQEA 3W7EA 2POZA 2IKGA 1XG4A 2VM8A 2VFGA 1L8NA 1W3KA 3VVGA 2X8RA 3PTMA 4TUFA 3IRDA 2VC6A 1TYGA 4WSKA 3WLPA 4V27A 2ZRWA 4GISA 4J2MA 2DDXA 5PTDA 3SUTA 2R82A 4MSSA 1ICSA 2RUSA 5CJMA 3UR8A 1UQYA 2V3DA 1S5TA 2VEGA 4AFYA 4ALDA 1JD9A 4Z2IA 2VWTA 4DWDA 2J6XA 1FTXA 3ABXA 1NQKA 1XRFA 3A21A 2P88A 1YQ2A 5KZDA 3HPXA 3ARQA 1UYQA 2BY2A 3LMZA 1V0KA 2R1LA 2A7RA 1F6YA 3RO8A 1HVQA 3BW2A 3MO4A 3ZMRA 1IIHA 3STEA 4DUVA 5LGZA 4FOUA 1WB0A 1K3UA 3EX6A 2W91A 3OP2A 2PSNA 3EWCA 3W9ZA 1S39A 3HQ1A 3BZGA 1ZRQA 2WKLA 4KRUA 1B31A 5KZMA 1ZGDA 4GZ7A 4ZE5A 3C2FA 1WX0A 4CN6A 3L21A 3G1YA 3M16A 2I5QA 3UZ5A 1DIDA 2J8FA 4BEQA 3L67A 4DLMA 1PCKA 3GHTA 3CZEA 1QASA 1VFSA 3LHUA 1W1ZA 5DCBA 3EWBX 1CENA 3M0JA 1LZOA 4H6EA 1IR1A 4FO4A 5KZEA 4RW3A 1GPFA 2C1HA 5A6BA 2PDYA 1ODUA 2B0MA 3A5FA 2YZRA 1WZKA 1VYPX 3UD6A 1K03A 3WJWA 3WL0A 4FNQA 2F61A 4I7UA 4LUTA 2PRMA 2V30A 3S5OA 4H19A 4EK7A 2FZ9A 4DN1A 1XXXA 4WDTA 2P1FA 3AYTA 3W87A 1FOBA 1VKFA 4LVAA 3IVUA 1J79A 4V28A 3CMJA 4DF0A 4AUBA 3MI6A 1TPVA 2GJPA 2D2GA 3N14A 3GC5A 4C6IA 3CB3A 1B3OA 1MW0A 3KUMA 3DX5A 3LGEA 2ON3A 2QPXA 3QKZA 1KTNA 1PZ0A 1KRAC 3GG1A 1O12A 1TV2A 5BNKA 3N18A 1IXOA 2ZRZA 3I65A 2O7QA 5I07A 2WVVA 2Y1HA 4KEVA 4LOCA 5E93A 1PTDA 2XZ7A 1Q85A 1KR1A 4UR7A 3UETA 1I2NA 4L65A 3W28A 1AD1A 3AUJA 3LERA 4JKKA 4LB3A 2ZZ1A 1J12A 1SGJA 5DY2A 3MMUA 3WQ4A 2VRJA 4AX6A 2E1WA 1UKTA 1DJNA 4HOXA 2XZ9A 3AHYA 1VPQA 1E3ZA 1X8CA 2Z1KA 4G7FA 4WX2A 3EKGA 4O8RA 4S1FA 1ZCOA 1E9YB 1SJAA 3C0JA 2X1TA 3WNOA 3PF3A 3BOXA 4KS0A 3SCUA 1FWSA 4IQJA 2RH9A 4PZVA 1T8QA 4W8AA 1DKWA 3PPGA 3QY7A 4CNPA 5F2MA 5CBIA 5CBBA 4RK8A 1O6IA 3FIGA 2GGJA 4DJEA 1OYCA 3GFXA 3VC5A 2EF9A 2UY5A 3QC3A 5HATA 1DJZA 3OIXA 1NFGA 2GQ9A 2QZRA 3ITVA 1FWCC 3GK0A 4JX4A 4NZ3A 3TA6A 3CQKA 3UJFA 1G5AA 3WNPA 4XBKA 4CQ8A 5D2WA 2XWDA 4JKMA 4XB3A 4C6BA 3JRKA 5AYXA 4C6MA 1KXVA 3WN6A 2PGRA 3BPWA 1YXYA 4OHQA 5F1VA 3IAPA 3W82A 2BY0A 1TMLA 3DHUA 1ONWA 4GABA 2IKJA 2VD8A 3M41A 3R0UA 5DEZA 2WANA 1OX4A 1YRRA 1KM4A 2VO5A 2G3MA 4B5SA 3GS6A 3LRLA 3GNOA 2YFOA 3THUA 1QNPA 4AHQA 2Q3RA 3SEPA 1SO4A 1XG3A 3ITXA 4LUYA 1W3IA 4PBGA 3QEZA 5TD4A 4Q22A 4HN4A 4UFLA 1RR2A 5D09A 2AAMA 3KDOA 4RZ6A 3KBMA 4PE8A 2DFAA 1LL7A 3W1AA 4M6QA 2Z1WA 4HYWA 5DFAA 3GC2A 3PPCA 3L0KA 4AD4A 1I45A 4JPGA 4KKXA 1MO0A 4LUIA 5FF7A 3U6WA 3ZO9A 1KM1A 4GA8A 1SFTA 1PHWA 3SUVA 2NXHA 2WMHA 3S9IA 1RHCA 2VCAA 4N42A 1MUMA 3MCNA 3CL8A 5FA5A 2UZ9A 4NJIA 4JOMA 4YYFA 3KHDA 5BXRA 5I3DA 3PZMA 3O3RA 4F0LA 1I9CB 2V8ZA 3GXDA 4HMDA 4KCWA 3BC9A 3H7VA 1R87A 3WBAA 1WYIA 3MHUA 4UXDA 2ZUMA 3URBA 4J7RA 4HN8A 2BVDA 2VZSA 2Q8XA 2F84A 5CLWA 2QGYA 3F4WA 4GQQA 1HJSA 3UNTA 1XSIA 1TO3A 3UR7A 4MPKA 2KAUC 3VXGA 3BGGA 2PC8A 4DJDD 3RUBL 1A5KC 1NU5A 4G6CA 2I9UA 2OZ3A 3H8AA 4M1RA 4I9TA 4FPSA 4ML4A 5XIAA 3BAIA 5HQEA 3TDFA 1ECQA 5IXEA 2PTYA 4D8AA 4LBSA 3E5PA 1C8QA 2RGMA 4A2RA 3WD4A 2XIQA 4IWWA 1W1A1 1JD7A 1XYFA 3XINA 1ZJHA 1B3ZA 5C6MA 2QUMA 4B9ZA 1ICQA 1TKKA 3CV6A 1P0KA 2FTWA 3AIQA 4F0MA 3L5LA 3GU9A 4WLCA 3H2AA 1B4KA 2DGAA 2PDPA 3FVDA 5BRBA 1Z44A 1V3IA 1AUSL 3NQCA 5G4HC 2ZE0A 1H63A 5CC3A 3QH2A 1AH0A 2ZA3A 3L4XA 4C6JA 3B8TA 3HG4A 5F2GA 3KS5A 2Y0FA 3VNDA 2FVLA 3LHYA 4OUIA 4QBXA 4IPNB 4K1GA 4FK9A 5K4ZA 3N6HA 1QDSA 4JTEA 5AZ1A 1A5CA 4M6VA 3JS3A 4O13A 1NTHA 3S1WA 4FLRA 3SCRA 4ZFCA 4EAYA 1TX2A 9RUBA 3T44A 1QNVA 1E0VA 4RR4A 1PZ1A 2WXDM 1OQFA 5M5DA 3V18A 1KD0A 1TJ1A 5EMLA 5HMFA 1XPYA 2CLPA 1I1WA 1HKJA 2X7VA 4JFSA 1VEPA 4J35A 5CPNA 2D0FA 1ZNNA 4V1XA 3HFYA 2MANA 2Q09A 3FHAA 1H7WA 2B7OA 4U4MA 2Q8ZA 4HCHA 2OT0A 1WA3A 2FMNA 2V81A 4Y7EA 3VA8A 3UZXA 4MNKA 2ACQA 1XPGA 1MNZA 2V82A 3DKLA 3WQ8A 5FF4A 4MKVA 1SO3A 5J8LA 4BEUA 4LXFA 3EA1A 1XYZA 4MGGA 3CL6A 4LVBA 3GG7A 2XN1A 4GC3A 2PGFA 1KBJA 3HV8A 2D0GA 3WDHA 1TJ2A 1XRTA 2XM2A 3STPA 5BMXA 1SPQA 3BLEA 3VOCA 2WB5A 1DQXA 1DTNA 1MW2A 4CD4A 3G3MA 1DOSA 3TR2A 3F2DA 1F3XA 1THFD 3G2GA 5HULA 1GK8A 4DYKA 3RF9A 1ZL1A 3GDBA 3IUDA 3BOLA 3LPPA 3DKJA 1DJYA 4TXEA 1PDYA 2LLEA 4Q4MA 3LCFA 3R8HA 5BXPA 1P4CA 3W1LA 2A85A 3ABQA 4AWEA 4E8DA 3TC3A 1LOLA 4DELA 3B8VA 3Q65A 1EUNA 3B0XA 3W07A 4YXGA 2JQXA 1K77A 4YWIA 4PR4A 4MYAA 4XZHA 2V9DA 4BKNA 2F8QA 1M7OA 1ZTVA 3QXBA 1XRSA 4GJ1A 2EHHA 3G5EA 2J27A 1F8IA 5IFPA 3GNPA 4LC8A 1K7XA 2XIMA 3LCXA 4PSRA 4AVFA 4DJED 3M46A 3FXYA 2GVJA 2DZWA 2E67A 4HPJA 3AQUA 3QQ1A 3APYA 3ITTA 3POHA 3PY2A 4QG9A 1YDVA 1BKHA 3WQFA 2E5DA 1X1OA 2PDFA 4QROA 1Y7VA 4FXFA 4PTDA 2EPOA 4LFYA 1DTUA 1K9DA 1TIWA 4W87A 3VIMA 3H2FA 5I79A 3H55A 2DZUA 1I2QA 2P50A 4XKYA 1L9WA 1FHVA 4AZGA 4MFDA 2Y5EA 4GMEA 3CNYA 1A4MA 1FY6A 3F2CA 2QMKA 1GQJA 1ESWA 1J6PA 4L5ZA 4Z08A 4GINA 4V15A 5BCAA 5D8ZA 3VAVA 3WD1A 4GK8A 4RDZA 1OFBA 3T2PA 5HNUA 4MB5A 2F38A 4JTRA 2J88A 3KZSA 5I0DA 2DT3A 2CWXA 5TAOA 2DUAA 5DXXA 2P53A 3TYBA 1XL9A 1UB3A 5EA9A 3CPRA 2DW7A 4HMCA 4U28A 3TJLA 4QAIA 1WOBA 3GTXA 1VFMA 1Z7AA 4A35A 3SIZA 1ZY9A 2V69A 5G2IA 5H8UA 5AC4A 4BF7A 2YDQA 1WXJA 3UCCA 1E6PA 2DW6A 1GORA 4NZ5A 4BQ4A 1ZBVA 2HS6A 3TQPA 4MJ2A 4O0QA 4MZYA 4PFHA 1US2A 3AHXA 4IQLA 2J9XA 3QSRA 1WDPA 4HU3A 1EQCA 2ZZ6A 3SCNA 3C61A 1LG2A 3VIHA 4E4FA 1PL9A 3WH7A 2H8ZA 2AL2A 1CGTA 2DUXA 3KXQA 3W00A 3RJYA 2XVKA 4ZA0A 1XYAA 3JUGA 4HNLA 1DWIM 5FL1A 4XQ6A 5CJNA 3TLLA 3EXSA 4FLOA 1HL2A 4YCOA 4B4FA 4B92A 1BQCA 1YYAA 3IJDA 4D1IA 3QFWA 3VDAA 2OGYA 2NQLA 1VRDA 1W17A 2TAAA 3IAQA 1ZPTA 2HQAA 4GY1A 2EPKX 2DH3A 2ISWA 5FSEC 4N9EA 4DXKA 1Q7ZA 4E2DA 4C6OA 1M7JA 3B8DA 4ATDA 4IH3A 4U3CA 2WKGA 3W7IA 3QV6A 4AZCB 3Q45A 3I7SA 3L4UA 1FKWA 1B0IA 1PB0A 1SYTA 2WCAA 1NF0A 5I5RA 2V5CA 1JVNA 3ATYA 1K6WA 1DWGM 1G4SA 2YBVA 3P60A 1Z48A 3P80A 3UXAA 1QHZA 4JQ1A 3QOKA 4I90A 2YL9A 2Z1XA 1W32A 2QAFA 1O5KA 2HTMA 1WO2A 1A49A 1T99A 2WSPA 3QMRA 3E38A 1KFWA 3WK2A 4JHZA 5D9MA 5T9BG 4D6GA 1G7UA 3KOYA 3IS4A 4OE7A 4NASA 2UY4A 3DESA 1J0HA 2Y85A 4ZXLA 2DZXA 3OGRA 3QJAA 2PU1A 1UUQA 5AYIA 1UROA 1LG1A 3SB0A 2F6UA 4PB5A 2VR5A 1S2CA 2PWEA 3E2SA 4Z2GA 4PFMA 1RPXA 4NNBA 2Y7EA 2H8XA 4PRRA 1KQZA 2Y24A 4N6EA 1GNXA 2ZADA 4OUEA 4ZENA 1HKMA 1TVNA 4I8YA 3MSGA 1SZFA 2OEKA 1AL7A 3GXPA 2CBJA 1UC4A 3P8IA 1MZHA 2PU0A 1JRBA 2C1GA 1QNQA 2QQ6A 4O4VA 2DVXA 1H0IA 3TJ4A 2A7NA 3CWHA 3UA4A 2AMXA 3TZFA 1HP5A 3W24A 1EDGA 2IQDA 3FCPA 3GNXA 3IJ9A 1AL8A 4QFUA 5HUPA 2NX3A 2BY3A 2H3DA 3GO2A 1A5LC 2IPWA 4RPPA 2CZVA 4J3SA 3F4CA 3EMZA 5IRPA 2Z2BA 1H60A 4H8VA 1A0CA 1BF2A 4EOUA 3CAQA 3GH5A 4BS0A 3SCPA 3AU6A 4RNHA 3UWQA 4XAZA 1JAKA 2B7PA 1ADOA 1TRIA 3ZJ7A 1OCJA 4N02A 5HANA 1ONRA 1DIOA 3WQOA 2BDQA 1T8XA 3I4EA 2PDHA 3FGCB 5C54A 4WSJA 3AMGA 3H7RA 4XO7A 3NIYA 2QCDA 3NEHA 1P0NA 1GVIA 3MDWA 3NCOA 4YTUA 1VBUA 4MKSA 1K4GA 1E0UA 1E9IA 2FZ8A 4AZHA 1B5TA 4JX5A 5MHBA 3VNIA 3CYJA 1KM0A 3URNA 1G6CA 3UF9A 3W72A 1C93A 3ATZA 5AHFA 4CU6A 4PMUA 4XVDA 4KETA 4Z1YA 2HDJA 3KRSA 4TMBA 3LCHA 3S4TA 1KM6A 4MF4A 2XJ7A 5A6MA 2OOGA 3R8RA 1QVBA 4YTRA 3BLPX 4H8HA 2V38A 3HB9A 5I00A 1TJPA 2NV9A 2PUZA 4BF5A 2J66A 3SN0A 4D2JA 1FHDA 1QW7A 3MMDA 1WPCA 4WJXA 2EXOA 4AIEA 3MKCA 3P61A <