1W3LA

Endoglucanase cel5a from bacillus agaradhaerens in complex with cellotri derived-tetrahydrooxazine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
300
Chain Sequence
b'SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title Structural, Thermodynamic, and Kinetic Analyses of Tetrahydrooxazine-Derived Inhibitors Bound to {Beta}-Glucosidases
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 121
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1w3lA00
3OGRA 1PEZA 2IXUA 2OYLA 3OLDA 2UY2A 1IZKA 2V5DA 3WQWA 1UR0A 2YL8A 1PBGA 1E55A 4JHOA 3VX1A 2O9TA 1HJVA 1G0CA 4HPGA 3AHTA 3VGDA 3N11A 2O9OA 1JDCA 3AS0A 1EO5A 2WZIA 4UOQA 2BXYA 2ZE0A 1KFWA 1J12A 1ISWA 1Z32X 3EDJA 3OZOA 1BG4A 1GOMA 3B8SA 1TZ7A 3BLKA 4W7WA 4P8UA 3RILA 2Y24A 5CJ5A 1H41A 1WB0A 3PZOA 1C93A 4Z2GA 1XD1A 1E56A 1JF6A 5JUVA 1ITCA 5A1AA 1JI1A 2J8FA 2C8NA 1QNOA 1ZBWA 4L4PA 1ZBVA 4HZ8A 1Q6EA 5CSYA 3WD0A 3K8MA 3SCVA 2YBTA 3LPGA 2JF7A 3D3AA 4AEFA 2WC3A 1CXIA 3PZTA 1CXEA 4CD5A 3CUJA 1W2PA 1MFUA 1W9VA 2J7GA 1KQYA 1OD8A 1W1YA 4UQBA 5GNYA 1BLIA 1VFFA 4J3WA 4AD4A 4E8CA 3WD2A 4MNMA 3MMUA 2FHFA 1W1VA 3EDKA 3W81A 2E9BA 1UWSA 3VIKA 1P6WA 3AXIA 5E0CA 3W24A 5CGTA 2ZXDA 4PMVA 2WVTA 1XYZA 4MDPA 5E70A 1Q6DA 3ZT5A 3A4WA 3THCA 2EO7A 3QOMA 4AD5A 2D20A 5ABFB 4GI8A 4UFLA 1CTNA 2VCAA 2D22A 3EBVA 2JEQA 2WMGA 4DUXA 1DP0A 3VO0A 3PZIA 6A3HA 1TUXA 1V3IA 2G3NA 5CLWA 2VRQA 2CHNA 1CENA 1CLXA 4PMOA 2YL9A 3GDBA 1W3JA 1WAWA 3CZGA 3A4AA 3MU7A 1UA3A 1J9YA 5ABHA 3ARRA 3ZR5A 2CBVA 1RP8A 3OGSA 2Y5EA 2QF8A 4A3YA 2BS9A 2E4TA 1BF2A 5D4YA 1O7AA 4H8HA 3TTYA 4BCEA 1E0WA 4U5IA 1NWTA 1IZJA 1WDPA 8A3HA 4CVWA 2EQDA 1K9FA 2ZUVA 4D6IA 2YA1A 6CGTA 4U3AA 1EHAA 4PMUA 2WVSA 2VX5A 2YKKA 3L4XA 1J0YA 4AD1A 1E6SM 1RP9A 2ESCA 3ARSA 5D9OA 3SURA 3RDKA 3IK2A 2X8RA 3NSMA 2EPKX 2OSYA 4FK9A 4HZ6A 5IDIA 2A3HA 1W3HA 3WBAA 1H1NA 1C90A 2VX7A 3AQUA 4P8WA 3F5KA 3ZSSA 1OT2A 2A3AA 3WQ5A 3ZMRA 1NOWA 2FH6A 1TFVA 2V3EA 4PYSA 3VD7A 2WPGA 2PBGA 5E09A 3MUY1 1E72M 3OBAA 1GCYA 1ZS2A 2ZX7A 4L4OA 3QGVA 4UOJA 3WEMA 1R8LA 4U31A 2YLAA 1HL9A 1M03A 2X0HA 4AISA 2PWFA 4F8XA 3RM4A 4H2CA 4AMCA 1A3HA 3VM5A 1MVYA 4ZFMA 1UKOA 3WENA 1BGAA 1UR4A 3MUZ1 3PN8A 4GO9A 1SFSA 3MO4A 1G9HA 2E0PA 2VOTA 1E6ZA 2WHMA 5C8BB 2JIWA 5CLTA 4AZHA 4PMYA 4W8AA 1FFQA 1L8NA 2AMGA 2OLHA 3WFLA 2EJ1A 2ZUWA 3MUIA 4UQCA 1OGBA 1HJXA 4JL2A 1Y7VA 4W7UA 4W93A 1CGTA 3CUFA 3WEZA 1EIBA 4W8BA 4UZSA 3VU2A 4JZ5A 3W28A 2ZX5A 3SCOA 1E3ZA 2DT2A 4UCFA 1E5JA 3ARUA 5GNXA 2VURA 1DWJM 2XHYA 2OWCA 3IANA 3HU7A 4WKAA 1UR1A 2OSXA 2WHKA 8CGTA 3ARWA 5LYRA 3ARYA 1WCGA 3AZRA 3IAPA 3WDPP 2VCCA 4W84A 1OM0A 2WCGA 2FDMA 3WD4A 1E0VA 3L4ZA 4S3KA 2OWWA 3WH6A 3WIJA 4J7RA 3VGGA 4OBSA 1XGZA 2XSAA 3K4AA 2WYSA 3WDHA 1B3ZA 2CITA 1VFMA 1ZBKA 4CN6A 3T0DA 2E8ZA 2V3GA 3CLWA 7CGTA 2A3CA 2XFFA 4EK7A 2PBOA 1C7SA 4U5KA 1QHZA 3KL5A 1GQIA 4P8VA 4CN4A 1FP8A 3VDCA 1JAKA 1JDDA 1UKPA 4JKMA 3PBGA 1AQHA 2BHYA 2VO5A 3SUTA 4NF7A 4D6EA 5FD0A 4UFJA 3VIIA 5A3HA 5C70A 2AOSA 4UOZA 2E3ZA 4HTYA 3F4VA 4MNKA 2CCRA 3HJEA 1M53A 3ZT6A 4CUCA 3VGHA 4LYRA 1TG7A 1FHDA 4AWEA 1BHGA 4JCLA 1ZJAA 1KB3A 4PEEA 2WVUA 4UQAA 4X0VA 3AHXA 3HN3A 4HZ7A 4FLQA 2B31A 3F5LA 1BYAA 5A6SA 1VJSA 3BSGA 1TVPA 2G3MA 1VAHA 4Q7NA 3FXYA 5LA1A 1VF8A 1QW8A 1W3LA 4QDMA 5FL1A 1MWOA 2WBKA 4F9JA 1LWHA 2ZIDA 4JFTA 2WLZA 2X05A 1I1XA 5DEZA 3VIOA 1CXKA 7A3HA 4CN1A 1XV8A 4D6HA 2UWFA 1UD6A 2WMIA 2ZX6A 4AC1X 1KCKA 4BQ4A 2YA0A 5A6BA 3EDDA 2DDXA 2WCAA 2PF0A 4YPJA 3VD3A 2VNCA 3AXHA 5A8OA 5JIPA 1NARA 4D6JA 2QPUA 3CZJA 3WY1A 1AQ0A 3WEOA 2BY2A 1XHGA 3GNRA 2HISA 2W5FA 4JCMA 2XM2A 2QMKA 2CETA 1KGWA 1PIGA 5JIWA 3CUIA 1HP5A 1B3WA 2J47A 4AY1A 5A8MA 5IFPA 1HKJA 3TTOA 4ATDA 1W9DM 3VDHA 5DFAA 3G6MA 1CGVA 4PTXA 3IJ7A 3NIYA 4Y7EA 1JD9A 1W1TA 1MQQA 1V0NA 1LF1A 3E1F1 4IPNB 3T09A 4RE3A 1YQ2A 5D9MA 1HP4A 4DWSA 1JYWA 2BV9A 3ECQA 4D6GA 4M24A 3CO4A 1LG2A 1M04A 1QVBA 4HMEA 1Q6GA 1EH9A 1JDAA 1EQPA 3W6MA 4AZGA 1IV8A 3BCFA 5KEZA 3VOCA 1C7TA 1CGWA 1E6XM 4GI9A 1DEDA 1W9BM 4LQ1A 3SCRA 3CGTA 4JKLA 2JE8A 2D1ZA 2E9LA 2X09A 3L4WA 3GH4A 2CKRA 3AXXA 5A6BD 3VD9A 4ACZB 4JFWA 1OGGA 3MV11 5EB8A 4JL1A 4F66A 1UKQA 1H3GA 1UKTA 3VMOA 3WQVA 4GI6A 1G1YA 1VB9A 1HKMA 3AYSA 3QHOA 3WD1A 5A2BA 1E6PA 1QNQA 3FY1A 4H8UA 4X0NA 1BYDA 1B31A 3DYPA 3WDJA 2F8QA 1UYQA 1J11A 1WZLA 2BHZA 4B9YA 2YA2A 2XVPA 5JBDA 1HVQA 2BVTA 3WL1A 1QNSA 1EOKA 3W0KA 3GM8A 4J3XA 4GKLA 3AS2A 4DWSC 2F2HA 4W86A 2VI0A 3SUSA 2DSUA 1UZ1A 3ZR6A 9CGTA 4URIA 1TCMA 2OWXA 1G94A 3CZ8A 3WF4A 2XIBA 2WMKA 4PBGA 4UQDA 1CNVA 3PZGA 3B9DA 1BTCA 2Y4SA 3CHEA 4KRTA 4J3UA 1V6WA 3POHA 2WC4A 4CGTA 2WMIB 3N18A 1CZ1A 3ZOAA 4M56A 4KRUA 3UEQA 4J3SA 2VZTA 4PUEA 4AZ7A 2WM0A 4PMRA 3MMWA 4HMDA 3N1AA 2GJRA 5BXPA 5D9NA 5CPQA 2BY0A 5CQ1A 3AHVA 3KWXA 5A8PA 3J7HA 1KBBA 3WQ4A 5M03A 1X6NA 4DUWA 1TVNA 1H09A 1UH2A 3M6DA 4A3HA 1H5VA 2VVSA 3N12A 3GH7A 1QNRA 1EQCA 4UQEA 3QHNA 3ZQ9A 4OBRA 1XH2A 1EGZA 1E40A 4AW7A 3KEHA 1Q6CA 4IM4A 3SIMA 1QOXA 1SYTA 2XIIA 4W5ZA 3AJ7A 1EDGA 2Z1SA 2VC9A 1MYRA 1V3KA 4ATLA 4B3LA 3SUWA 2V5CA 4AYSA 3AMLA 2PB1A 2GFTA 4D1JA 3CUHA 4AD2A 1B0IA 1FH9A 4JFVA 2QLYA 5BXRA 1J0KA 3F5JA 1KXVA 6TAAA 4JIEA 4B16A 4W89A 2WZEA 4CU8A 3SCWA 1WDRA 3WKZA 4C7GA 2V3DA 2GDVA 1UA7A 2UY4A 5ECUA 3ZT7A 1DWHM 4WSJA 4BZYA 1GOQA 2W4XA 2YDQA 1VRXA 1R87A 2J4GA 2W66A 4YHGA 4W87A 1HX0A 4FLOA 3PTKA 5AYIA 3DECA 1QI3A 1MQRA 3VVGA 1WDSA 1ECEA 2WLYA 3W25A 4CCDA 1UWQA 4EAMA 1KR0A 1H0IA 4UR9A 4ATWA 1YHTA 2O92A 2ZUNA 3UETA 1ODUA 4UTFA 5I79A 4WF7A 3N13A 4CD6A 5BXSA 2D3NA 1GW1A 3NYDA 2G41A 3AMGA 3K8KA 5D8ZA 4XV0A 1CYGA 5E6YA 1K9TA 5I5RA 1MQPA 1HT6A 2NT0A 3AHZA 3TTQA 5M3WA 2WMJA 5A6AA 4GQQA 1UR8A 2WVVA 4NRRA 2J75A 3BAXA 3BSHA 3CIVA 4ZEPA 3LPPA 1FP9A 2WMFA 1KXTA 2D3LA 2PWGA 1H49A 4RE4A 3DHUA 3LPOA 3AROA 1V02A 3WH9A 2NT1A 4UFMA 5A6JA 5CSUA 1K6AA 1J01A 2DH3A 4KGLA 4CD4A 1E4MM 3OLIA 1VENA 3WMBA 3DHPA 4P7NA 1J18A 5DT5A 1KWGA 2EEXA 1TMQA 1X6LA 3K8LA 1B3VA 1BYBA 4GIAA 2FGLA 3GXDA 1QI2A 2VR5A 1MW1A 5BCAA 1BPLB 4M81A 3ALGA 3FHAA 1UUQA 3RIKA 4J27A 4RL3A 5M5DA 2DT1A 3WDRA 1OIFA 1QHOA 2CIPA 4CD8A 3RO8A 1E1EA 3BAJA 1US2A 2DSWA 2DT3A 3ZO9A 1HXJA 2BVYA 4H8VA 3TP4A 1MXGA 3VIHA 5AC5A 3RPMA 2CEQA 4AZCA 4XUYA 2X2YA 4FLRA 3WQ8A 4OJYA 4V28A 5E9AA 3A47A 4PN2A 1W9PA 1E43A 3UG5A 3VX0A 1FH7A 3ZJKA 3CZKA 3LMYA 3TA9A 2JF6A 2YL5A 4WIWA 4AEEA 4MPKA 5E0FA 3AS1A 4D6DA 1UWRA 1B3YA 4MAVA 2GK1A 4P8XA 4WLCA 1CDGA 2ZXAA 5HXMA 1DTUA 5A6LA 3AI0A 3S2CA 4QP0A 3BGAA 3PTQA 4WKHA 4MNJA 3VNYA 2D24A 4ZE5A 1NOFA 2Z1KA 3UR8A 1TE1A 2DEPA 4QCFA 4M1RA 3BAIA 3WMCA 1QW9A 1AVAA 1V3LA 2VX6A 4W88A 3CZLA 4DM1A 1GVYA 2V38A 2WSKA 1B90A 3VGEA 2VVNA 2WW5A 1E73M 2W67A 2XWDA 1J0ZA 2D23A 1WNOA 2ZUSA 4AIOA 4AXNA 1JYNA 2XGBA 1JNEA 5IHSA 1UH4A 2FHBA 1D2KA 4LX4A 1SR0A 2DSKA 1GONA 1F4HA 1E4LA 1J10A 2IUZA 4HA3A 5D9PA 1JZ7A 1E6QM 2YBUA 3CH9A 2VJXA 1EHNA 3AIRA 1MFVA 2J7HA 1QBBA 4ACYA 2JEPA 4HOWA 1E1FA 1B3XA 1XSKA 1LL7A 5EFFA 2WVVB 1C91A 4UZUA 4IISA 4PRWA 1KBKA 3VD4A 3WQ6A 2VQTA 3L4YA 4AD3A 3VD5A 3ZJ6A 1WZAA 3CZEA 2WBGA 3WF0A 1BYCA 3KE0A 3NSXA 2XYLA 2DIJA 2EPMX 3L2LA 4PTVA 2J7BA 1LJYA 1W1PA 5CPTA 2PWDA 4W85A 2O9PA 4YN5A 1JZ6A 4XZBA 3L4TA 3APGA 4U3CA 5FOOA 2A3BA 2G3JA 2NSXA 4KMQA 3T2PA 4PMZA 3NSNA 2WKLA 3WNPA 3U5YA 4OOZA 3AICA 5AC4A 1VIWA 1ISZA 1ZBCA 4OIFA 4M82A 1SMDA 3BH4A 3GNOA 3UR7A 1OBAA 1BGGA 1ZL1A 5CZKA 3CUGA 3AIQA 3GXIA 1W32A 3VPLA 3WELA 1JGIA 2ZX8A 3W38A 4V2XA 1NM9A 4OKDA 2X0YA 4D1IA 4MB1A 4MTVA 3POCA 1JG9A 4D6FA 3EYPA 5CPSA 3MSDA 1UQYA 3W26A 2XPKA 3IJ8A 3W27A 1CECA 1FA2A 3QOKA 4Z2JA 1FHLA 4HP5A 1OINA 5IXEA 3AS3A 1PX8A 2YL6A 3CHCA 3SCUA 3WMSA 2GK1B 1Q6FA 4XX6A 1BG9A 2XM1A 4HOZA 2EPOA 5BRQA 5EBAA 3ARZA 3SUUA 3M07A 4JFSA 4QLKA 2WK2A 1D3CA 4H7VA 1H2JA 3N9KA 2YDSA 1KGUA 5BYWA 3AIVA 2IXVA 4MDOA 1K9DA 1UH3A 2GDUA 3HMCA 1GOWA 1UHVA 5FL0A 5A2CA 4UFIA 1XSJA 4Q22A 1HJSA 4WK9A 3WSUA 4EANA 5E6ZA 2A3EA 3WBEA 1JZ2A 2PI6A 5EMYA 4PCTA 4JHZA 5I2UA 2DGAA 5KZ6A 2QV4A 3MS8A 1GUVA 4J3TA 4P7LA 2MANA 3WF3A 1KCLA 3GXFA 4AD0A 3GZAA 1O6IA 3I3DA 1CEOA 1GHSA 1GORA 3MANA 4AIEA 4OZOA 5HNNA 4XB3A 2XSBA 2G4FA 1ESWA 1LL4A 1GPFA 3ALFA 5HBFA 5ABGA 4V27A 3PHAA 3FAWA 1FH8A 4CCEA 4EKJA 2WXDM 4C7FA 3PZMA 5BWFA 4QLLA 3WL0A 1CGYA 3NDYA 4GINA 1HN1A 2VZUA 4HOXA 3AIBA 3ZM8A 5AY7A 1LLOA 3I3BA 1M7XA 2C0HA 7TAAA 3CMGA 3VUPA 2WCSA 4N0RA 2VZOA 1GOOA 4TUFA 4HU0A 3SCNA 1JFXA 1I75A 3WNMA 5I3DA 1GQLA 3OGVA 1V03A 2W63A 1C3FA 4XZWA 1HKKA 1PZ2A 2YJQA 1VBUA 4U33A 1DHKA 3KZSA 4NZCA 3ZSTA 5A95A 1EO7A 3L4VA 3T0BA 4KH2A 2WB5A 5DO8A 4HA1A 2DT0A 5LA0A 3T08A 1C92A 2Y8VA 2V3FA 1W3KA 3VM7A 1JXKA 2W92A 4NSBA 3WUFA 2W61A 4PMQA 5C71A 2ZUUA 2E9MA 1IT0A 4H04A 1R7OA 1W9XA 1GOIA 2O9RA 3WNLA 1TR1A 3CTTA 2NW0A 3PZUA 3U7VA 4ML4A 4X9YA 4TOQA 4U2ZA 2JFEX 2XVKA 1G5AA 4WKFA 3WUEA 1KQZA 1VEOA 3TTSA 4JKKA 4W5UA 1E70M 1MW3A 4CKQA 2XGIA 3FW6A 1GVIA 2DSZA 4TTUA 5A2AA 3T2OA 4D6CA 2VUYA 1JAEA 1V0LA 1H0GA 3VGBA 3VDBA 1V6UA 1UD5A 3U57A 3U5UA 1S46A 5A94A 1JZ5A 4M29A 1KXQA 1JD7A 2WWDA 3FAXA 2J79A 3WN6A 3L2MA 2YLLA 5BRPA 2BVDA 1OB0A 1V02E 4UNIA 1J0HA 4CD7A 1JXJA 1WO2A 1V3HA 4MJ4A 1V6XA 2JIEA 2WWCA 4BQ2A 3OG2A 3L4UA 3SCTA 3WNNA 4LPCA 4S3JA 3W29A 1WZKA 3VTRA 4M8UA 1UD3A 1J0IA 2CXGA 3DYMA 5I0DA 2ZWYA 2CERA 1NP0A 5JBFA 1NWSA 3GBDA 3WUBA 1H11A 4F79A 3OIHA 5A69A 1XH1A 4FMVA 1UD8A 3NJ3A 1EA9C 2XWEA 3SCPA 2C7FA 4ZXOA 1PPIA 4PCSA 4DWSB 1D7FA 5BROA 3PZ9A 3EMCA 2J7DA 4LYQA 1JYXA 2JALA 5DT7A 1CXFA 2ZOXA 2AAAA 3VILA 4BA0A 3IJ9A 3OLGA 4TX6A 3BAKA 4BQ5A 1BVZA 3O6AA 4MAZA 3W37A 3B9EA 2VR4A 5FKYA 1F4AA 3AMCA 4CVUA 1SMAA 1BSIA 2ZWZA 2GJPA 5GPRA 3AZTA 2J25A 1QPKA 5A8NA 1DWIM 2VZSA 1GJUA 1NH6A 1WP6A 4LYPA 3SUVA 3WDIA 2UY3A 2DH2A 1M01A 1W91A 3MKKA 4BQ3A 2XG9A 4D71A 2J62A 1A47A 2BXZA 1OWQA 1UZ4A 2XTKA 1JIBA 3ZJ8A 2X1IA 1GZJA 2VT0A 4TX8A 3SCSA 2Y2WA 3GBEA 3G6LA 3VKKA 3WNKA 3PZNA 4PUDA 2BFGA 2DIEA 4PSRA 1CLVA 1E3XA 4HA4A 2ZICA 2J8GA 3S6TA 4MADA 3OB8A 4FLSA 1DWFM 2ZXBA 3ZIZA 5HDRA 1CPUA 2PWEA 4PSPA 4HU8A 2OSWA 2WHLA 5ABEA 2WC7A 3B9AA 1PZ3A 3OA5A 1MW2A 3TOPA 2WSPA 2CNCA 5FIPA 2RGMA 1E4IA 3AIWA 1XD0A 3ARPA 2PWHA 1QBAA 2DQXA 1FFRA 1VEPA 4W7VA 3RMEA 3SEPA 3BXWA 2OYKA 4DM2A 1UOKA 4TVCA 4GZEA 1B2YA 4QAWA 4D72A 1ZU8A 2WHJA 4HMCA 1UWIA 2WNWA 5M17A 1H4PA 1V6YA 2D0GA 4BF7A 1U33A 2OYMA 1TA3A 3UG3A 1PJ9A 5I23A 3NDZA 2ZUTA 2CBUA 1E5NA 2CPUA 2XFYA 1BVNP 4GPNA 5CXPA 4UFHA 3VINA 2GJXA 1OGSA 4LGXA 4GQRA 4IUGA 1BFNA 3GTNA 2YOCA 4A4AA 1G01A 1R86A 3OLEA 2Q8XA 4BS0A 2W62A 3AISA 3DC0A 1V6VA 4F9DA 3K1DA 1V3JA 1NWRA 2J77A 3RM8A 3AZSA 2XVGA 3KL3A 3CMJA 1HL8A 1JZ3A 3CBWA 4JAWA 1JZ8A 4MJ2A 3BMWA 1DWAM 2J7EA 1J0JA 3ARQA 3VIMA 2PC8A 4DUVA 4H41A 5HOSA 2ZX9A 3OZPA 1CXLA 3D5HA 1UD2A 3PTMA 3ZJ7A 2CHOA 1EDTA 3BMVA 4PTWA 2XFRA 3ARTA 2VRKA 1NQ6A 2Y8KA 4PMXA 1ISVA 1MW0A 1JL8A 2F61A 4MB3A 3WH7A 4B3KA 2XUCA 5GQBA 1JF5A 2QHAA 3JUGA 2VZVA 4GZIA 1JYVA 5A8QA 3WH5A 1C8XA 3THDA 4KWUA 3RM9A 1QHPA 1MXDA 1CBGA 1EOMA 2VMFA 1KXHA 4B9ZA 1Q4NX 1HKIA 4JFUA 1QI5A 3BCDA 4ZENA 4Z2HA 3T2QA 2E8YA 4QLJA 2BNJA 3CPUA 2GVYA 3AMKA 3EMZA 3WH8A 2VTFA 4AIUA 4RE2A 1R85A 2CBIA 1XH0A 2VL4A 4IPLA 1E0XA 1GNXA 1HJUA 2XJ7A 3MUAA 1HVXA 1HIZA 3BLPX 1DWGM 3KL0A 5HPOA 4P7RA 1XCXA 1PX3A 3N04A 4Z2KA 2EXOA 4CU6A 4NRSA 4OOUA 4PMNA 1GOKA 3RJYA 1LL6A 3WF2A 2EBNA 4M80A 1VEMA 2BY3A 4E8DA 2CKSA 4J28A 4QCEA 3VMNA 4K68A 3II1A 1OCQA 1RD6A 5AYBA 2G8ZA 5A6MA 4ACZA 1AQMA 3VMPA 3MMDA 1B1YA 3W4RA 3GNPA 1K9EA 2VRJA 1UWTA 3N17A 3A3HA 4R27A 2WKGA 1ZJBA 3W6LA 1C8YA 4U2YA 1UR2A 5CG0A 4TTGA 4MNLA 1W9UA 2QPSA 3VIGA 1XCWA 1ODZA 1TA3B 1ITXA 3QHMA 1LG1A 1HJQA 3A6OA 1GQJA 1LQ0A 2E40A 4C7DA 1WPCA 5GNZA 3NCOA 3WNOA 2J74A 3DYOA 3TONA 4FF5A 4TVDA 1N82A 1U30A 1V3MA 2YDRA 1QI0A 1VBRA 2GJXB 1US3A 4PTMA 4AZCB 4TVUA 3VGFA 1CGXA 1X1NA 2BY1A 1PAMA 2J78A 4P7OA 1JNDA 4YHEA 3U7BA 3AFBA 1E71M 3MV01 4B15A 4AZIA 2XVNA 3W53A 5BXTA 3BC9A 5I77A 5DMYA 3NUKA 5D8WA 3WUGA 1GJWA 1XYFA 4WSKA 5I6SA 1CXHA 4P7QA 1QNPA 1UG6A 2GUYA 1ISXA 2HVMA 1EXPA 3WD3A 1L0PA 3GXMA 5EFDA 3FHQA 4CU7A 1ZB5A 2GSJA 2CBJA 5FCZA 1WKYA 1E4NA 1UQZA 5I78A 1OSEA 2J7FA 3EDEA 1UD4A 3IAQA 1WDQA 3AMDA 3O9NA 4E2OA 1OT1A 3MSGA 5JBEA 1BAGA 1W2VA 3M46A 2QMJA 2FH8A 1NWUA 1R7AA 4R5EA 1V0KA 1LWJA 4E4PA 4MB5A 3T0AA 3PZVA 3BAWA 1B9ZA 4KGJA 1PX4A 3AYRA 2DSVA 2D0FA 3AIEA 3W82A 4W8LA 3QR3A 3LPFA 4TXEA 3CHDA 2ZXQA 3SCQA 3CHFA 1AMYA 1BQCA 3N15A 5LA2A 1E6NA 2CESA 2EPNA 5IHRA 1EDQA 4GO8A 1RPKA 4ZE4A 1CIUA 1KR1A 1E15A 4GZJA 4LXFA 4PMDA 3M7SA 5IFTA 1HNYA 1QI4A 3AIUA 1UKSA 1XC6A 5A6KA 1HJWA 3GH5A 2D0HA 1CGUA 1VFOA 1WZMA 3A4XA 2WANA 2WAGA 4J3VA 4NI3A 3VIJA 3WF1A 2BHUA 4Z2IA 1KGXA 3K4DA 4N42A 2UY5A 3UESA 5CGMA 4WJXA 3GYCA 2W91A 4GXPA 1GHRA 4EE9A 3EDFA 3O2LA 1E9LA 1GQKA 2G3IA 3AOFA 4UQ9A 3VIFA 5DF0A 1UWUA 5ABFA 4Z2LA 1KWKA 2VCBA 2RGLA 2WZHA 3ARVA 1C8QA 3UERA 4CCCA 4MB4A 2YIHA 3EMQA 2VX4A 3VDAA 3AHYA 1I1WA 2XVLA 1V08A 2WMHA 1VFUA 1OD0A 2J7CA 3WDQA 1FOBA 1PIFA 4DWSD 1B30A 5TD4A 3FNDA 1ISYA 1V0MA 1HF6A 2FHCA 1OIMA 1JFHA 1U2YA 2TAAA 3VIPA 1JZ4A 1UR9A 5F7UA 2CYGA 4ZXLA 3RCNA 3VNZA 4HPHA 1WE5A 4AZ6A 5I24A 1NOUA 3K46A 3UG4A 3ARXA 3BAYA 4AZ5A 2D2OA 1CWYA 1JI2A 4AZBA 3RJXA 5HPCA 1NP2A 3WFZA 4QFUA 2VQUA 1VJZA 1RH9A 2DPEA 3UCQA 4OUEA 3I3EA 4UFKA 2FGZA 2EPLX 2ZUMA 1E6RA 1XSIA 3PZQA 1XRVA 3FN9A
chains in the Genus database with same CATH superfamily
4O4VA 4NXSA 1KM4A 3NO5A 4ZSTA 3EOSA 4DAIA 2O9TA 3QC0A 1HJVA 3GW0A 1G0CA 1V7AA 1VIZA 4HPGA 1XISA 1FCUA 3SW6A 1JDCA 4YYFA 2ZE0A 3KBWA 3TWAA 4DJED 1XICA 3OZOA 4O54A 1GOMA 1ZTVA 3GR8A 4RDYA 4P8UA 1KV5A 5KETA 3PZOA 1HQTA 4UTIA 1GKRA 5A1AA 1R6WA 1JI1A 3OZMA 1ZRQA 2C8NA 1QNOA 2ZE3A 4RK8A 3HO8A 4CLMA 2YBTA 1ZP3A 3LPGA 3WLMA 2WC3A 3H4XA 3NQVA 4FALA 1XLMA 3USZA 1MFUA 1TTIA 1W9VA 5GNYA 1BKHA 1XJBA 1VFFA 1PCKA 4J3WA 3G1YA 4E8CA 2OFJA 4IIDA 4MM1A 4MNMA 3MMUA 1MUCA 2FHFA 2P5NA 3W81A 4JTSA 2HVNA 2E9BA 1UWSA 1M7PA 3TN5A 4GHRA 4EX4A 2NUWA 4I9JA 4C91A 4KWSA 4MZ8A 2WVTA 2V5LA 3QV8A 4MDPA 3NOEA 3ZT5A 3R5EA 2EF9A 2EO7A 3NXLA 2IKJA 4AD5A 4GI8A 4HJWA 4XZNX 3HGRA 6A3HA 1VYRA 1U1HA 3SQSA 2OXNA 2VRQA 1CENA 3KM8A 1A49A 3TV8A 3MP3A 1WAWA 3CZGA 1TJ1A 2PEVA 1GOXA 3A4AA 3ABOA 1XDLA 2R24A 1RBLA 3MU7A 1UA3A 5ABHA 2PPGA 3ARRA 3ZR5A 1XW8A 4GZ7A 2QF8A 3SN1A 4S3BA 2E4TA 4F48A 3WQDA 5D4YA 4WXYA 4DBUA 1E0WA 4ZQCA 1NWTA 4NNCA 3TOYA 1TX0A 2EG8A 3B97A 2GWNA 3IGHX 4A05A 1GGOA 4GJIA 4D6IA 2NLIA 1EHAA 5DMNA 4PMUA 2WVSA 3COTA 4GVHA 1J6OA 5CEWA 2CLEA 1LORA 3BO9A 2B4GA 3LGEA 1HGYA 4FK9A 3WBAA 1W3HA 3HFTA 1MDLA 2OEKA 4P8WA 3GHUA 2Z26A 1VBGA 1SO6A 2X42A 1V51A 1SW7A 2V3EA 4IIHA 2OGYA 2WPGA 4MZYA 3K4WA 4JIRA 4LUSB 1YXDA 3MBFA 2WJFA 3MDUA 3TQPA 3E2QA 2A0NA 1VC4A 3OBAA 1GCYA 2A6NA 3GQYA 3FKKA 3KVJA 3QGVA 2KZHA 1R8LA 4U31A 1M03A 3OTRA 2R82A 2X0HA 3V4BA 3F4WA 3O07A 4AISA 4DVOA 3RM4A 4AMCA 1MVYA 4KERA 1UKOA 3UA4A 4PB4A 1BGAA 2GWGA 3N3TA 1EJTC 3MUZ1 3CWOX 3Q4DA 5FEWA 4YNGA 1S2AA 1G9HA 1E6ZA 2WHMA 2JIWA 2Y62A 5CLTA 3TU9A 1BWVA 2WM1A 3W7CA 1ZZMA 3OOQA 2B81A 3ITCA 4JL2A 4W7UA 1CGTA 1KLYA 1XRSA 2A7RA 2QCDB 1NFPA 1WDWA 2ZX5A 2FZNA 4X63A 4CQ9A 2R6OA 3M0VA 1E3ZA 4U4MA 1GWJA 3QQ0A 3LDVA 1JPIA 1K7XA 1DWJM 2OWCA 1XGDA 2VGIA 3IANA 3HU7A 1I2OA 3EWUA 4O28A 3LTYA 1IEQA 1IHIA 2ZVRA 8CGTA 2C19A 1YTKA 4C6FA 1AW5A 4YIWA 4JEJA 1KRCC 3WH6A 4A8IA 4J7RA 4GFSA 1SO4A 1XGZA 2XSAA 3C61A 1H7PA 5GJNA 1Z9AA 2PLKA 3GYEA 4HNOA 5AHIA 4IJBA 3WMLA 3NZGA 3T0DA 3PWGA 1XLDA 5MKGA 4ZTYA 4O11A 3FYYA 2YSWA 3IJDA 1C7SA 2Q02A 4HNCA 1J96A 1R0MA 2FKPA 1AQHA 4O1EA 4NF7A 4D6EA 3PBVA 4UFJA 1Q7QA 5A3HA 4UOZA 4MWAB 4V15A 3CASA 4MNKA 3QGAC 3W72A 2HVOA 4CUCA 1PTGA 1TG7A 4BY3A 1K03A 5K2ZA 3K13A 3CHVA 4AB4A 3LCLA 2ADAA 2V8ZA 3M16A 2V81A 1W5QA 2FZ8A 4FLQA 3TK7A 2B31A 1BYAA 5A6SA 3CL6A 1A5KC 4QX4A 5K7JA 4IPJA 4MY1A 1VF8A 1W3LA 4YWSA 3P7YA 4F9JA 3LLXA 1M6JA 4LTSA 1OCBA 2WLZA 4GFIA 2X05A 5DEZA 1F6PA 4PUJA 7A3HA 4D6HA 3NL2A 2WMIA 1KCKA 1OFAA 4BQ4A 2YA0A 3EDDA 1IR2A 3LHUA 4GY7A 3VKJA 3VD3A 2VNCA 2AQWA 3AXHA 1JUEA 3E5BA 4UUIA 4A2RA 1JPKA 3RU8X 5JIPA 4D6JA 2QPUA 4B92A 5CKSA 4AYGA 3CZJA 4JOMA 4I5XA 3T8LA 3WEOA 2W5FA 2CETA 1US0A 1KGWA 3KTSA 4REQB 2PDIA 1TTQA 1POJA 3PBMA 2QR6A 3TNBA 1CGVA 3IIPA 1WOAA 4Y7EA 4YVPA 1JD9A 2ISWA 3STFA 1B9BA 3PJTA 1LF1A 3T09A 3SN4A 1YQ2A 1OX5A 1JYWA 4D6GA 5JXQA 4YTUA 3CO4A 1M04A 1QOPA 2XGZA 1Y8BA 3GLCA 4PZVA 4PUKA 4ICNA 1QXLA 3EX6A 1J8VA 1E6XM 1AZ1A 1DEDA 4GI9A 3EX4A 3B4YA 4LQ1A 1P4CA 1FVPA 3KOZA 4JKLA 3RG6A 4YCOA 3GH4A 1TIWA 4HGXA 5KZEA 3GC5A 5IRPA 5HJYA 1F8MA 3M0XA 3VD9A 3H21A 4ACZB 4WCJA 3EWZA 2NVDA 1E0UA 1H51A 3MY9A 2FZDA 4KPLA 3QMRA 2Z2BA 3TW9A 1WKEA 4LT9A 1P0KA 4S2BA 2PCQA 1FWSA 3G3MA 3NO1A 3WD1A 2GQ9A 4DZAA 1VCGA 1NSJA 3NM1A 3W7DA 3FY1A 2A7NA 1B31A 3KBMA 3HPFA 1WZLA 4KKXA 4B9YA 2PDMA 2YA2A 3NAVA 2XVPA 2XZ9A 4DJEA 5JBDA 3UJRA 1FXPA 1WDDA 1EJVC 1HVQA 2ZKMX 1S1PA 3GM8A 4J3XA 1QU4A 2F2HA 4W86A 1DQWA 3SUSA 3MHFA 2X2GA 4EPDC 1TCMA 2OWXA 1G94A 3UY8A 3CZ8A 1T41A 4LSBA 1BTCA 3L21A 1ZNNA 4KRTA 5AVNA 3ZOAA 3UEQA 1A5UA 2WM0A 4DZ5A 4LOCA 3N1AA 4V1XA 2BDQA 2PSNA 4L6OA 3VUSA 5A8PA 4C6KA 4DRSA 1KBBA 2ZRZA 3QYSA 4DLFA 1P0BA 1VLWA 2TSYA 3ANYA 3P0XA 2XN0A 1EQCA 4UQEA 4WY0B 2Z1BA 4OBRA 2DJLA 4RLIA 3HPXA 3TSDA 1E40A 4N9DA 3KEHA 5D03A 2J6VA 4IM4A 1W5OA 2XIIA 3PJUA 1YLVA 2GPTA 3C4UA 1V3KA 4GXWA 3NGFA 4JQ4A 5MHBA 4AYSA 3OQEA 3LBCA 3AMLA 4C6PA 4D1JA 4AD2A 1IEIA 1FH9A 3E0WA 1I0DA 3LTSA 4JIEA 5AHNA 1ADSA 1P0EA 1TV8A 4CU8A 3R94A 1XUZA 2PP1A 4GYKA 4C7GA 2X1SA 3FEMA 2V3DA 2GDVA 3PBWA 1VD6A 4FXRA 4X61A 4BZYA 4WSJA 4ZOBA 1PL9A 2J4GA 4ERGA 1JGMA 4C6EA 3DECA 1MQRA 1ECEA 4CCDA 1KR0A 3A12A 1TJ2A 1H0IA 4OUIA 1Q7MA 4P2VA 3T9PA 2O92A 1OG0A 2ZUNA 3UETA 1ODUA 3N13A 4Q8MA 5BXSA 3OVQA 4G1NA 2ATSA 1GW1A 3AMGA 1Q6OA 5M2FX 3R1ZA 1CYGA 1PS9A 5T91A 5E6YA 3AHZA 2PC4A 2WMJA 3GTXA 4GBUA 5C54A 5HWNA 3NWRA 5IOBA 2GVGA 3MVTA 3CIVA 3UZZA 4O50A 4LS0A 2Q8ZA 3UXLA 5PTDA 1VQTA 1H49A 4RE4A 1VFTA 1X8CA 2C0AA 3WG6A 2PUZA 3WH9A 2NT1A 3QTGA 4UFMA 3BJFA 4C6CA 4ILSA 1FWHC 1J01A 4KGLA 4ZCWA 1NELA 1E4MM 1B3OA 4M3PA 3QEZA 1D9EA 4ORIA 4B4FA 1TELA 5JU6A 4AX6A 3K8LA 2AQVA 3W7PA 2FGLA 3W76A 2VR5A 1BPLB 4M81A 7XIMA 5LGZA 3EOOA 1F61A 3QF0A 1OIFA 5T8GA 3DENA 4CD8A 4OE7A 3RO8A 3NFUA 3BAJA 2DSWA 3ZO9A 2R1PA 1Z44A 4AZCA 3U4FA 4XUYA 3IIXA 4FLRA 4IP5A 2QIIA 4V28A 4LVAA 5CPLA 3UG5A 3ZJKA 3CZKA 4LUYA 3UGRA 1O4UA 3GU1A 4WIWA 4MPKA 2GQ8A 1UWRA 1B3YA 4P8XA 1UUMA 3W87A 1NIUA 4GY0A 2B0MA 3G1VA 1XIBA 4ZQOA 2DEPA 2E28A 1DJYA 3BAIA 1QW9A 3HG3A 2WSKA 1S2VA 2VVNA 3E3HA 4QJ4B 4LRTA 3S1VA 1LZOA 2D23A 4QSFA 4O0QA 1JYNA 4O18A 4HD5A 3BG3A 3GVWA 3VCNA 3SN0A 1F4HA 2YCLB 1J10A 5KINA 3W2LA 3DIPA 4C90A 4Y8FA 1H7NA 2YBUA 3P74A 4DI8A 2VJXA 4PFMA 1RA0A 4LUTA 1QBBA 3WK1A 4DF2A 2G96A 4F40A 2QGYA 2ZTJA 3HPSA 4J4KA 3LN3A 1B3XA 1RR2A 3HQOA 5EFFA 1TPUA 1XPYA 1Q4WA 3RPTA 1JUKA 3WQ6A 2VQTA 4ECLA 3L4YA 4UMBA 3VD5A 4NX5A 3R25A 4PH6A 1R30A 5HNTA 1QAPA 3GIQA 2XIMA 4GBDA 4HK6A 1LUCA 2R1NA 2LLEA 2EPMX 3IWPA 2J8TA 4Z1AA 4XSMA 2PWDA 4W85A 3RK8A 4R9OA 2AL2A 1I2QA 1XIGA 4YN5A 4XZBA 5F4SA 1RLDA 2HXUA 2G50A 4JNZA 1RHCA 3N6HA 3LCHA 3TN3A 4WR3A 2WKLA 3QY7A 3U5YA 4ROQA 3EWYA 5AC4A 1VIWA 3P8IA 4QIUA 8TIMA 5C9RA 1JPMA 5BOOA 1VBJA 3AIQA 3KVKA 1W32A 2Y61A 3PSWA 3KVLA 1VKFA 1NM9A 4HA0A 3V5FA 4OKDA 4MB1A 3GNXA 1UQYA 2Z7GA 1CECA 1XPGA 3CNYA 1FA2A 4N02A 3IS4A 4TIMA 1OINA 4Y9OA 3PNUA 3AS3A 3WMSA 2GK1B 2QZRA 1CLKA 1BG9A 2XM1A 4HOZA 5EBAA 4IXXA 4LC6A 4UTLA 4IPPA 4DLMA 2O4QA 3VC5A 3WK0A 2A79A 3THAA 1IEVA 3LCIA 1H2JA 2PGFA 1BTMA 2YDSA 5BYWA 3D3FA 2PF8A 5LXEA 1O94A 1GOWA 1UHVA 2WJZA 5CC3A 1XSJA 4FNSA 5FJJA 4EANA 3WBEA 2Z0IA 1FRBA 3DG6A 2QNEA 3B8IA 5EMYA 1EC9A 4JHZA 3EA3A 7TIMA 4P7LA 1TWWA 2IQTA 3GXFA 1K1DA 3NDOA 2GGEA 3U2OA 2PDYA 3STGA 4RNIA 5D33A 4QJ3B 4RNFA 3W07A 4NY2A 3A9IA 2VD8A 5C2XA 1ESWA 3W1TA 1LL4A 2HMCA 5ABGA 4DYKA 3CAWA 1DJWA 2ASHA 2CLLA 4F4RA 1YX1A 3OG3A 1CGYA 4HOXA 3ZM8A 3EWDA 5DRCA 5AY7A 1O68A 3I3BA 2WNZA 1GKPA 3OJGA 4N0RA 2VZOA 4TUFA 3SCNA 3CV7A 1GQLA 1XLCA 4OVXA 2BOEX 4S2CA 1HKKA 1VBUA 4HHMA 4F0MA 5A95A 1TTJA 4EF8A 1YADA 3PFMA 4JTGA 2QJIA 1K3UA 4AVNA 5T26A 2PGRA 1MSSA 2DT0A 4O1AA 2ZZ5A 4O1DA 3KBSA 2Q3RA 2W92A 4NSBA 3R11A 4GUIA 3U48A 1XM3A 1R7OA 1ONWA 2O9RA 1TR1A 1T7LA 3M0JA 2RDWA 4R9XA 2JFEX 4W4QA 3S6OA 1DXEA 1VEOA 3G1HA 4CKQA 3SY5A 3FW6A 4LVGA 4H7CA 4GYPA 4TTUA 5A2AA 3N9SA 2VUYA 2PU1A 1V0LA 5C5YA 5C9UA 1UMLA 1R5YA 1S46A 5A94A 3GAKA 3OZYA 1GVOA 1MUWA 2WWDA 4MOZA 1XFCA 1QK0A 2V82A 3WN6A 1YBQA 1Q8AA 4WDXA 4POCA 3TEVA 5CZTA 1W5NA 1AW2A 2ISVA 4CD7A 4DHGA 1JXJA 2JIEA 1F07A 1ALDA 3OG2A 2AKZA 3WNNA 1FKWA 4B5WA 3W29A 3UR2A 3AWOA 1R3YA 3W1RA 4US5D 3W01A 3UQNA 4MG4A 3DYMA 1XLIA 2PZNA 3FK4A 4Q4MA 3S2MA 2P3EA 2NXIA 2RDXA 2E5DA 1EIXA 4L4LA 2ZRYA 5E1QA 2QUTA 4ZXOA 2PDFA 2V67A 1D7FA 3NURA 3H8AA 3PZ9A 5EMLA 3VYLA 4AQLA 2J7DA 3C8FA 3SRKA 4ONVA 4O13A 4JX4A 2NUXA 4C5YA 4H3DA 2ZOXA 3VILA 1GG1A 5CPMA 2XSXA 4WDUA 3BAKA 4K2SA 3VKBA 5CAHA 4MAZA 2E1DA 4FXFA 2Z4GA 5C2GA 2ZWZA 4LRSA 5GPRA 2QCDA 1GJUA 1WP6A 1N7KA 3RFAA 5BW6A 3TYDA 4DN1A 3UCCA 4X3ZA 2UY3A 1M01A 1JJKA 1A3WA 1W91A 3LXBA 4B91A 1DTNA 5LZLA 4H01A 4ZQMA 1L6YA 2XG9A 4D71A 2J62A 2PA6A 2CW6A 1FWFC 3L2IA 2VT0A 3K5XA 2Y5JA 4GI4A 1QK2A 3LRMA 4WOQA 3G6LA 1J2WA 5IBXC 3O1NA 2BFGA 4AU0A 4PSRA 1E3XA 1A4LA 2ZICA 4HA4A 2Y7FA 3S1GA 3UJSA 2ZRWA 3MTWA 1BXNA 1S38A 1DWFM 2ZXBA 4R88A 1CPUA 2PWEA 3NZRA 1XKJA 5G1MA 3OA5A 1MW2A 2RGMA 1E4IA 2OX4A 3RF9A 3FXGA 2DQXA 4W7VA 3RMEA 3SEPA 1U5HA 3BXWA 1UOKA 1RVKA 3HFYA 2ISDA 1I60A 1IEWA 2A1YA 1XIMA 2OZ3A 1L6SA 4ZODA 4B3ZA 4ADSA 4JTDA 4UBPC 2J66A 2D0GA 3LQGA 1MRAA 2DORA 4BF7A 2BZNA 3CPGA 4B4HA 1Y5VA 3WJZA 4JNMA 3M47A 2O56A 4XUGA 3TUUA 2CPUA 2X1UA 2QYGA 4GPNA 2GJXA 4GQRA 1PDZA 3INPA 1UBSA 2X1RA 1PSCA 2YOCA 4BS0A 2Q8XA 2W62A 1ZJHA 4HCDA 4I3GA 5D2VA 1V6VA 3K1DA 3RM8A 4XAFA 4HYRA 1E1CA 1KD0A 4XAPA 1JZ3A 3IACA 4MJ2A 3BMWA 2J7EA 1PB0A 3ARQA 2PC8A 4NVTA 5HOSA 2ZX9A 3H7RA 3OZPA 3D5HA 1ZLPA 1UD2A 3BGJA 3PTMA 1EDTA 1EZ2A 3MO7A 1GVSA 2FIQA 2YX0A 2PLMA 4PR4A 5HQMA 4PMXA 3G8RA 3ZLGA 2XUCA 1JF5A 2O4MA 2QHAA 3JUGA 2P76A 1XBXA 3ONBA 6ENLA 1R2SA 1C8XA 2J24A 1BXBA 4PFHA 1T99A 1CBGA 1EOMA 4REQA 3DKLA 3M0MA 4B9ZA 2WV8A 7PTDA 3C3NA 3DERA 1W3TA 4ZENA 4QEHA 4IQDA 2E8YA 4QLJA 3U3HA 1G67A 3CPUA 2HTMA 3E12A 3RITA 3EMZA 3R10A 4RE2A 3QR0A 3BLFA 1XH0A 3CUXA 4FIQA 3TZFA 2XJ7A 4OFCA 3MUAA 4EWJA 3BLPX 3KL0A 1YE6A 5HPOA 4P7RA 2VYOA 3S42A 1ZAIA 3UG8A 3N2MA 2PS2A 4GH3A 4PRTA 1PXGA 1S2TA 2C3ZA 4M80A 4E3VA 2BY3A 4Q4PA 4E8DA 3VMNA 3I6EA 3QQ1A 3TMLA 2FLIA 4N9EA 1RD6A 5A6MA 4NAEA 5H6HA 4PBFA 3EOEA 4ACZA 4DAFA 2INEA 5BRBA 3VMPA 4YWIA 3A24A 5F2GA 3PP7A 1YPXA 3MMDA 1U83A 3GNPA 3AUJA 9RUBA 3N17A 1C8YA 4DY1A 5EMUA 3S9IA 1AG1O 2CLKA 1UR2A 4DIAA 5CG0A 3LEPA 2C6QA 8XIMA 3HQNA 1I2RA 3OYZA 1RQEA 3QHMA 3RPDA 1LG1A 2BP1A 1XCFA 4FNTA 4KQNA 4CEUC 1R9YA 4TVDA 4C6IA 1H5YA 3F2DA 3MHGA 3GY1A 2DZTA 4TVUA 3W73A 1GK8A 1IEXA 3UZXA 4GWEA 4P7OA 3MT1A 5LIWX 4MYXA 1Y65A 1E71M 3V1HA 4A6GA 4M7TA 4UTWC 1G4TA 4YTTA 1KNWA 1LLZA 4HK7A 2H8ZA 1OX4A 3VNLA 1XG3A 1Y5XA 8RUCA 5EL1A 1VZWA 4AFYA 2BGNE 1ISXA 4TQTA 3CJPA 1SFJA 4PTDA 2Q6ZA 5EFDA 1QATA 4CU7A 1ZB5A 5FCZA 2CBJA 1WKYA 1E4NA 4FOJA 5I78A 4PL1A 2VGFA 3N2XA 3O9NA 1IXOA 4R7WA 5CC7A 2BASA 2YCIX 5JBEA 1XG4A 3ITGA 4JQ1A 3M46A 3I6TA 2CZDA 5H91A 4IF2A 3V3WA 4NJHA 1AMKA 1J4EA 4E4PA 3CC1A 1YDOA 1TR9A 1F6KA 3UD6A 3MSRA 4ICCX 2HEJA 1PHQA 2DSVA 3AIEA 4P5UA 3W82A 1JPHA 4W8LA 4M51A 3UBPC 5A5WA 5G4HC 3LI0A 1AMYA 1BQCA 1QMLA 3HB9A 5LA2A 5E0KA 4XKMA 4D8AA 3PJXA 3C2OA 3L5AA 1O5XA 2GL5A 2EPNA 3DX5A 1EX1A 4L7ZA 2PDNA 2HBXA 1HKVA 1EDQA 4HSHA 1RPKA 3MYPA 1A5OC 1AUSL 3W7KA 1QI4A 4G7FA 1O1HA 1CGUA 1WZMA 3A4XA 3KUMA 4L9ZA 4ZFCA 4US5A 4QR6A 3B9NA 4FS9A 4NNBA 1KGXA 4WGXA 3UESA 1IWBA 3GYCA 2W91A 4EE9A 1GHRA 3H2FA 1E9LA 3VIFA 5ABFA 1RQBA 3OP2A 2P1FA 2NQHA 3UZ5A 4CCCA 2OELA 2F38A 2VX4A 1EX5A 2PLJA 1MNSA 2HDJA 2XVLA 1V08A 2CLOA 2QDGA 1K4GA 1OD0A 4Z0SA 5DN1A 3I4EA 4FIRA 3WDQA 2CLFA 1ZCOA 1FOBA 5BNKA 3N6JA 3FNDA 3PANA 3PPCA 1U1JA 1U2YA 3VIPA 1JZ4A 1M41A 1OK4A 4C6DA 4ZXLA 3GZ3A 3VABA 2HE5A 4KRZA 1DIDA 4EPEC 1VHCA 4AZ6A 2YBVA 2REQB 4E38A 2Y7DA 4LY4A 1XIIA 5HPCA 2Y0FA 4IL0A 3PJWA 1IWAA 5TNVA 4QFUA 3UXDA 2VFEA 1XLJA 4D8LA 3PPGA 2DPEA 4OUEA 5AN7A 4PC8A 1E9YB 2ZUMA 4RZ5A 3CAVA 1DJHA 1LQAA 5G1TA 1PEZA 4MWAE 2UY2A 4UTMA 2V5DA 3WQWA 1UR0A 2CFFA 4AY8A 3TAOA 5A6TC 1M65A 5I3HA 2QT3A 3VGDA 2X16A 5BOFA 4L1WA 4UOQA 2BXYA 1ISWA 4JTFA 1SGJA 3BLKA 5D09A 1PKLA 5CJ5A 2C13A 1HO1A 1H41A 1WB0A 1A5CA 1BXCA 4NJJA 2VDIA 1C93A 4GACA 5HA7A 4DELA 3RHGA 1E56A 1ITCA 1MRQA 5HUOA 2YDAA 4L4PA 1ZBVA 4HZ8A 1Q6EA 2OKTA 2Y8UA 2RKXA 3HZ3A 4WEVX 1ZCCA 2BLEA 2JF7A 3D3AA 3D46A 4AEFA 4W9TA 3EAUA 1CXIA 4WDWA 1CXEA 3CUJA 4L1XA 3VZZA 4UB9A 1OD8A 4QISA 4RZ6A 1Q5MA 1BLIA 4GVGA 2R14A 3CS2A 4AD4A 3N4EA 3EDKA 5F1UA 3O3RA 3A3WA 1OC5A 1P6WA 4H1ZA 4PMVA 1HUVA 1XYZA 2XN1A 2OKOA 2V5JA 2D20A 5DMLA 5TBOA 1ICSA 3NEHA 3TN4A 2VCAA 3EBVA 4N4QA 1DP0A 4LU0A 1ZALA 1TUXA 1QRQA 2NX1A 2PFHA 1V3IA 4MKVA 1CLXA 3JR2A 3GDBA 1R3RA 3CTLA 2OODA 3WQCA 2ALRA 2UV8G 3B0UX 2AKMA 4KCVA 4CNOA 4EAYA 2CZVA 2CBVA 1RP8A 1T96A 1TPH1 1M5WA 4UIOA 3KBJA 4H8HA 3TTYA 3UNTA 5C9ZA 4O15A 3OIXA 1AJZA 1C8VA 5AB3A 3GB6A 3MVIA 2FB2A 4YS1A 3AO0A 4CVWA 3EB2A 1K9FA 3LK6A 3TYEA 3UFYA 1EJ7L 2YKKA 1J0YA 2D2JA 4HNVA 2ESCA 2G4JA 3SURA 3IK2A 3NSMA 5FJTA 4LVFA 1H1NA 1FWAC 1O66A 1C90A 2VX7A 1M3UA 2PRHA 3F5KA 3ZSSA 1OT2A 1N55A 1GEHA 2FH6A 1RCXB 3VD7A 3F2CA 2PBGA 4PUUA 3OW1A 4BI7A 2CZ5A 1BWKA 1E72M 1XWYA 4L4OA 6XIMA 4UOJA 3QPYA 1G7UA 2YLAA 1HL9A 1OZQA 2HV5A 2PWFA 1WA3A 1E9IA 1FDYA 4H19A 2DZBA 4MJMA 1UR4A 3M1ZA 5LIUX 4GO9A 2E0PA 5C8BB 2DZPA 4PMYA 2ZA1A 5EA9A 3GG1A 4FNRA 1FFQA 1L8NA 5AYYA 3ONCA 3W1PA 3WFLA 5G5IA 2ZUWA 3MUIA 3OBEA 1OGBA 1HJXA 1NF7A 4OGZA 2P3ZA 3SO7A 2WSQA 3WEZA 5G4EA 4GCXA 4RX0A 3M44A 3R0DA 3TXVA 4MWAC 4H7ZA 4WKAA 3DBNA 1WAUA 4H9VA 4L65A 3BANA 4BEUA 3QQWA 1JCXA 1VFLA 1LRTA 1UJQA 4C6QA 3W7GA 1XDJA 5AYXA 4HSNA 1U5VA 2VCCA 3QM3A 5E5CA 4O0KA 3QN3A 1I2PA 1E0VA 3L4ZA 2OWWA 3WIJA 4IIGA 3UPWA 4MFDA 3ABXA 3VGGA 3SQLA 5FJPA 1SO5A 3EWCA 4ZO8A 2YCJA 2WYSA 1W0MA 4FI4A 3WDHA 2PDLA 3L12A 1VFMA 1ZBKA 4RPPA 2V3GA 1QO2A 1W8SA 1ZQ5A 1QUMA 1EJSC 3CLWA 2QF7A 2DUAA 1XYBA 4EK7A 2PBOA 1LT7A 1OFRA 4IMEA 3U6WA 3KL5A 4P8VA 1FWJC 3R8GA 4CN4A 1FP8A 3VDCA 1JAKA 3SRFA 3Q45A 5CSSA 1JDDA 4CCZA 4JKMA 5ABTA 4LAUA 1ITUA 3I7RA 3SUTA 3E02A 4ZR8A 1TWIA 3OEXA 2E3ZA 1W8GA 4HTYA 1RVGA 2E6FA 2Y7EA 2CCRA 3VGHA 4LYRA 1FHDA 4IMCA 4AWEA 3SSZA 2PRLA 4JCLA 5T9CE 3H7VA 1TV5A 4X0VA 4HZ7A 4B5NA 1X38A 4IH3A 4E4UA 2EG6A 1VJSA 1EWDA 2AL1A 3EX3A 3VFCA 1QW8A 3URNA 1S2CA 3MP5A 4GG9A 4LF2A 3U9IA 2O7SA 3VIOA 3W7EA 3UJ2A 1CXKA 1XLFA 1XV8A 4XZMX 3S2JA 2PTXA 4AC1X 5A6BA 4GD0A 3UJEA 1H7XA 4K38A 2PGEA 2ZFAA 2C71A 3WY1A 5D2WA 4CNSA 4GMEA 1F74A 2BY2A 3GNRA 3NQ2A 2I5IA 1ICPA 1W1B1 3V0TA 3CUIA 1HP5A 2VUNA 3LS9A 3UWUA 3B8VA 4IMFA 4YMZA 2FPVA 1LP6A 2CLIA 4C6MA 4JD4A 1W9DM 2HQAA 3G6MA 2Z1WA 4PTXA 1F9CA 3IJ7A 4ERAA 4AEOA 2PCEA 3OODA 1W1TA 2ZZ7A 2Z2AA 4IPNB 4M6PA 1HP4A 4FSAA 3L67A 4M24A 3G22A 1QVBA 5I3IA 5SWUA 4HK5A 3G1AA 3NR0A 1JDAA 1EQPA 4AZGA 4C6OA 3BCFA 3VOCA 3GKFA 1XLGA 3OHMB 3SCRA 1GYMA 3CGTA 2JE8A 2D1ZA 2E9LA 5BMWA 2BOFX 3ENLA 1KA9F 3W1AA 1X97A 2H6RA 1L6FA 3UCDA 2HBVA 4HN4A 4JFWA 1OGGA 5EB8A 4FEZA 4JL1A 1OC6A 2V9DA 4LEFA 5MKGB 1H3GA 1UKTA 4V1YA 4GI6A 2PDPA 3BTNA 2G37A 1HKMA 3AYSA 5XIAA 4IGMA 4RZ4A 3DI0A 3QHOA 1EXBA 4KESA 2ZZ6A 3MWCA 3EWWA 4HU4A 3TCEA 1MDRA 1S5MA 1XLBA 3T6CA 1K8YA 3UXKA 1W54A 3F1QA 3DYPA 4M6UA 3RR4A 2BHZA 3DFNA 2FVKA 3NPXA 4C1LA 3LBOA 3KOYA 1Z7AA 3GHTA 1A5BA 2NWRA 1EWEA 1QT1A 3AS2A 4DWSC 4QITA 1DPMA 2VI0A 1L6WA 4UCGA 2XIBA 1Q63A 4UQDA 2O55A 3PZGA 1F5ZA 3E38A 3QMTA 4M5PA 5J04A 3T1GA 2Y4SA 3HQ1A 4WQ6A 1P43A 2HS6A 2WMIB 3SGGA 1CZ1A 2J13A 1SSGA 4KRUA 1PCWA 3WLIA 3EZ4A 4PMRA 3MMWA 4HMDA 3HV8A 4MF4A 3FOKA 2GJRA 1JDEA 2WZTA 2BY0A 5CQ1A 5C7VA 3KWXA 3AWNA 1LT8A 2VFGA 1PYMA 3LXCA 4B5UA 4XBSA 3M6DA 4Z0JA 3T07A 3ATZA 1QNRA 3QHNA 3C2EA 2PRMA 1XH2A 3SIMA 1NF0A 1QOXA 4ZB5A 1S5TA 4W5ZA 2Z1SA 1MYRA 1FQ0A 2RJGA 3M43A 4ATLA 1TPWA 1SJAA 4HMNA 4FOUA 4LUIA 1K02A 2QW5A 2PB1A 1ECQA 2GFTA 3UWQA 3CUHA 4H9TA 4XO6A 1DE6A 1Z3NA 1ADOA 1XQKA 3DXIA 3KAOA 1KXVA 4AHPA 1X7IA 3W2KA 2I57A 4V33A 1Q3NA 5IM51 3HG4A 3WKZA 3FYPA 1V7YA 4MKNA 1UA7A 7REQA 2ZA3A 5ECUA 4MVAA 4I9TA 2YDQA 3TMQA 3VI2A 1YTEA 2W66A 4YHGA 3R12A 3TZNA 1PKYA 4DPQA 3IK4A 3MKCA 4Y9PA 1UWQA 4IIBA 3VE7A 4QEEA 4WX2A 1EEPA 2DVUA 3WLQA 1E0TA 3PSVA 1O5RA 1SFTA 4OV4A 5EYWA 4MFEA 3PUEA 1FCBA 3GVVA 1K9TA 3MJMA 1HT6A 2NT0A 5A6AA 4GQQA 1UR8A 2WVVA 1TJRA 3S1XA 3EGJA 3WLLA 3Q2DA 2PWUA 4WUIA 4ZEPA 5JVLA 3LPPA 3R89A 4HNUA 1FP9A 2WMFA 2BGQA 1XP3A 1G7VA 2D3LA 3TR2A 3BL3A 3BJTA 1NFBA 3AROA 2O7QA 3KBVA 3VOFA 5A6JA 2DH3A 4XVEA 1AL8A 2YYUA 4GNJA 2TMDA 1VHNA 5DY3A 1UB3A 3G1DA 2VM8A 5DT5A 1KWGA 1EPVA 3K1GA 4L4MA 3P8JA 3NZ1A 1QI2A 3PWAA 4IICA 3W1MA 4UTUA 1R47A 1UUQA 3RO6A 2ODOA 2DT1A 3WDRA 3W70A 2CIPA 2DVTA 1XDMA 3TYAA 1RBAA 3MUXA 1YIXA 4XD3A 1GTHA 1RD5A 3TC6A 3KCLA 5AC5A 1J6PA 2EKCA 3ELFA 3UVAA 4N4PA 2ZQ0A 5B7ZA 4JN8A 4OJYA 3IRDA 5E9AA 4EWND 4I8YA 5KZMA 1W9PA 4L61A 4LWWA 3W1XA 4RE0A 2GGHA 1FKXA 3TA9A 4YXGA 3M64A 2YR1A 3ABZA 3SI9A 2HE8A 1NDVA 3EX1A 4PE8A 4RXFA 4FX6M 4J40A 3QVQA 4Q3MA 3AS1A 4PULA 4WLCA 1QDSA 4JY8A 5HXMA 3IUDA 4NZJA 1DTUA 5H2ZA 2IS7A 2J6XA 3S2CA 1W37A 3BGAA 2ZZ3A 4Z42C 4WKHA 1YMYA 2J9XA 1NOFA 1JCYA 1T40A 4M6QA 2DUXA 4FXSA 3UWVA 3G24A 3LX9A 3QY6A 1V3LA 5HNUA 3ITTA 4W88A 4DM1A 3G1FA 2V38A 1NDWA 2P8CA 1B90A 5D37A 2V2CA 1E73M 4IMDA 3ZLHA 1J0ZA 1KCXA 5GJMA 3FA5A 5ENLA 2E1WA 5KSWA 4KEUA 2BBFA 3L9CA 4H00A 1JNEA 5IHSA 2FHBA 1EPXA 3RCYA 1D2KA 4LX4A 1GONA 1KM1A 1EP3A 2IUZA 5D9PA 3KFTA 4AWTA 2FQIA 2F2KA 4WHBA 1H7WA 4HU3A 4QGCA 1NJJA 5JQ9A 4GYFA 3MCNA 4Q8UA 1LL7A 1EJRC 1C91A 4UZUA 1PUDA 4IISA 4CQAA 1MEWA 3VCCA 2ABAA 3W7RA 2BSLA 1TPEA 5FJUA 2Y1HA 3DEQA 4XWUA 8XIAA 1BYCA 2CU0A 3KE0A 2AGTA 2XYLA 4INFA 2J7BA 3EPOA 3TCSA 1A0DA 5CPTA 2A6LA 2W3ZA 1L9WA 1LOLA 5F2MA 3AU2A 4GC4A 5FF3A 1JZ6A 4JGDA 2YGYA 4FP1A 5FOOA 2CWNA 1ZFJA 4H9MA 2G3JA 2NSXA 2YW4A 3GHRA 4PMZA 1RV8A 4HIBA 3RMJA 4FX7A 2BODX 2PDUA 1IGWA 1RJQA 1KM0A 4I7UA 4JQ2A 1BGGA 3KTCA 1DYSA 1OC7A 4AVOA 1PZ1A 5C6MA 4WRHA 4WVXA 2FFIA 3R2GA 3MSDA 2V5BA 3UXIA 2G0WA 2OT0A 2QCMA 4JYFA 1J2BA 1IGSA 3B3DA 3CYVA 3CHCA 1PX8A 4LVDA 1Q6FA 4LBSA 3TFXA 4QDWA 4QXIA 2REQA 4EVZA 3ARZA 4R33A 3SUUA 2EKGA 3C2RA 1FWTA 2WK2A 3EKGA 1D3CA 5KMYA 4H7VA 3NGJA 1KGUA 7ENLA 3BSMA 1IIGA 1K9DA 5G2HA 2GDUA 3HMCA 2NXHA 4UFIA 2A3EA 1EFZA 3LUTA 1K8ZA 4PCTA 4F0RA 1GPWA 1NFGA 2DZAA 1KCLA 2FTWA 3WLNA 3SGUA 4AD0A 3GZAA 3NVDA 1O6IA 1OF6A 3W2MA 3CT7A 3IVUA 3W7IA 3ZXWA 2A7PA 3JS3A 2QQ6A 2Q8LA 3ABSA 4NJGA 2XSBA 2VKZG 3UYCA 2XFWA 3P82A 2PMQA 3RXZA 3PHAA 1THFD 4CCEA 4EKJA 4DO5A 4C7FA 3P14A 4IG2B 3PZMA 4LUTB 3WL0A 3IGXA 4GINA 1OFEA 2VZUA 1YPIA 3AIBA 2QPXA 3S5OA 1LLOA 1F2JA 1CX9A 3P80A 3CMGA 3VUPA 2WCSA 1GOOA 2DIKA 5I3KA 1P48A 1KFCA 1I75A 2E68A 3WNMA 5I3DA 3M5XA 5DLCA 1PTAA 2W63A 4XZWA 4S3CA 3VNKA 3BW3A 3XIMA 4BI5A 2OLAA 1LUCB 4U33A 3T0BA 3L4VA 5I02A 4KH2A 3Q94A 2AL2B 3LV6A 4MY9A 4NX0A 3T08A 1R3QA 4C65A 4GQBA 4IJCA 2FPTA 1Q6QA 4I9AA 1FWWA 4DJDC 3D6NA 4OV9A 3PZUA 4TMCA 4U2ZA 1AW1A 3H70A 4WD0A 3WUEA 1C9DA 3IUHA 3B0VC 1SZNA 3TTSA 3ERPA 4R3UA 5HQLA 4JTHA 4O1CA 1ZENA 1MW3A 3ABRA 4Y6GA 2ZRUA 1CI1A 3T2OA 4D6CA 3GD6A 1H0GA 4O14A 2X40A 1M68A 4E2DA 3LHWA 1FX6A 1PV8A 2X7WA 4G1KA 2J79A 4CNPA 2I5QA 1T6MA 3L2MA 3QSTA 3A21A 2ZTKA 2YLLA 4H9YA 5TAOA 2BVDA 3BK0A 1OB0A 4UNIA 1SM9A 5FJOA 3NQCA 1WO2A 1Z89A 4S3EA 4AWUA 1HG3A 4BQ2A 3EXTA 3L4UA 4O8AA 4LPCA 4S3JA 1YNPA 1EA0A 3G77A 1UD3A 1J0IA 4AIBA 3TSMA 5I0DA 3CXOA 4AH7A 1NP0A 1NWSA 3WUBA 1RBOB 4NJKA 1XH1A 2R1LA 4JEQA 3WBXA 4PCSA 1A50A 1HO4A 2ZRVA 3AJXA 1H50A 1EUNA 4G8TA 3GX9A 1GZ1A 4F0KA 4GQGA 4LYQA 1H7OA 2KAUC 1J5SA 1CXFA 3OO2A 4YVXA 1BVWA 4JTJA 4TX6A 1NTHA 3TR9A 3O6AA 4ZQRA 3DU0A 3B9EA 3QGKC 2VR4A 1UPPA 4LALA 4HPNA 1RAKA 3PR2A 3GFYA 1JUBA 1BSIA 7ODCA 1W56A 5FESA 3SADA 2JBMA 1FWCC 2VC6A 4BF9A 3L23A 2FTYA 3QJAA 2VEMA 3MKKA 2NQZA 3NTYA 2XTKA 4OWGA 4GGHA 1UP0A 3NQAA 1GZJA 2OCZA 3KVMA 4XTDA 4QNEA 4JIIX 4PUDA 1XF0A 2ABBA 1CLVA 3WK3A 2J8GA 2XH2A 4MADA 3S3GA 4FLSA 4IHCA 5HDRA 4I7WA 2OSWA 2WHLA 5ABEA 2QJJA 2GUBA 4X2PA 3IVSA 3TOPA 2WSPA 4JX5A 3AIWA 3DG7A 1K8CA 1KBJA 5LIKX 4K7YA 1XD0A 2PWHA 1FFRA 4S38A 4EPKA 3A22A 3TN6A 4UNKA 2OYKA 4GZEA 3E0VA 3E2VA 1TIMA 1KFEA 4IIFA 3HGOA 4JY9A 2WNWA 3F4NA 1GVEA 4DJFC 1H4PA 5HMFA 2ON3A 3MMTA 1QASA 3P67A 2OYMA 3BZJA 3F03K 5I23A 3BWWA 3NDZA 2DJXA 1YBQB 3GG0A 5AECA 1RJPA 3MI2A 1FCQA 2XFYA 2QUMA 2V69A 4NI8A 5CXPA 4UFHA 2ZVIA 1VR6A 4GUHA 2FJUB 1BFNA 3GTNA 2HROA 5HWJA 1R86A 1O95A 3CB8A 2RUSA 3TFCA 3V16A 3KL3A 3CMJA 4KT2A 3FSTA 5HQEA 3S5YA 4JAWA 1J0JA 3VIMA 2GZXA 4DB7A 1H7RA 1CXLA 3I6RA 4OTKA 1OFOA 3BMVA 3S5ZA 4PTWA 3ARTA 3BGGA 2F61A 4MB3A 3G0XA 2A3LA 2IPGA 1JYVA 5A8QA 1FUYA 1ZY9A 1ME9A 4KWUA 1CT5A 1BRLA 5KZDA 4EP8C 2HWGA 3ISIX 1EC7A 4ZZ9A 1QI5A 3BCDA 2AAMA 4ASTA 1AH0A 2BNJA 2OEMA 2UBPC 2R1MA 3WH8A 4TU1A 1FDJA 1OQFA 4AIUA 3QTPA 1R85A 1IQ8A 4S23A 3B0XA 5C0QA 1K4HA 1HVXA 1HIZA 1XYAA 2ZZ4A 1ZSXA 1NU5A 2EXOA 4DXXA 3EX2A 4CU6A 4XG1A 1TSIA 5DQPA 1GOKA 1Q65A 4QQ3A 4ML9A 2TPSA 4AG0A 2C14A 2FZMA 1UW9A 1AH3A 3E0LA 5LNRA 1W1ZA 4NIRA 3II1A 4Y96A 4E4FA 9XIAA 2G8ZA 2OZTA 2CWXA 3XISA 1JDFA 1S2WA 2I7GA 1B1YA 1Q6LA 3S5NA 4IPIA 3C5QA 2DZWA 4H8NA 4R27A 2WKGA 1ZJBA 3W6LA 1WOBA 2G95A 4IMGA 4U2YA 1ELSA 4O1BA 3GRIA 3PF3A 1NY1A 3MZ2A 4TTGA 4KS0A 2QAPA 3QW3A 3G1XA 3VIGA 1XCWA 4UTTA 1HJQA 3M5YA 3A6OA 1LQ0A 4F0LA 5GNZA 1CCWB 2J74A 1FDZA 5CC6A 2OT1A 4DXKA 3PG8A 1N82A 1V3MA 2ATMA 3MA8A 4IGHA 1ZJIA 1QI0A 1VBRA 2GJXB 4PTMA 3S8HA 1TYGA 3VGFA 3TYZA 2BY1A 1PAMA 3URBA 1TPC1 5LIYX 4YHEA 5AHLA 3U7BA 4JTLA 5REQA 1E1CB 3MV01 1S1RA 4B15A 3STPA 3T4CA 1UIPA 5I77A 4NP7A 4UR8A 5D8WA 3WUGA 2QCNA 2ZA2A 1XYFA 4P7QA 1AJ0A 1IXQA 1X39A 1LRNA 4E8GA 3ITVA 3R0UA 1A0EA 3NA8A 1P1MA 1S5WA 3FEQA 1OZMA 5KITA 2HZGA 4AUBA 3U2CA 2OOFA 4WSHA 4HZMA 4LV9A 2QMJA 2EAWA 2FH8A 2QDDA 4NAFB 1EJXC 1R7AA 4R5EA 3IVTA 1LWJA 4QROA 4KWVA 3TA6A 1TWDA 1GVFA 3FA4A 3W7NA 4Q7IA 1MUMA 3CWNA 3TLLA 1DJNA 3GTHA 4UC5A 3HQPA 3BAWA 4UTJA 4KGJA 2INZA 2OQYA 3CQJA 4GOAA 3V5OA 1XKYA 4E5TA 4TXEA 2GDQA 2ZXQA 1IF2A 4LAKA 1G69A 2ZCGA 1DE5A 1E6NA 4OBTA 3JZUA 3GG7A 2IKHA 2FGBA 2RJHA 3JRKA 4GO8A 5IFTA 3AIUA 3E96A 1UKSA 1IR1A 1XC6A 1VJIA 1HJWA 3MW7A 4GISA 2D0HA 3TSBA 2VHLA 4NAEB 2WANA 1IT8A 1H1ZA 4J3VA 4NI3A 3WJYA 3UJFA 4Z2IA 3UWWA 2UY5A 5TIMA 2WKJA 3DFYA 4XD6A 4UQ9A 4E0CA 2PP0A 3BW2A 3GR7A 3LRKA 4UMCA 3GUGA 5CBIA 5CZ0A 3STCA 4HSOA 3FDGA 2VCBA 2IPWA 3ARVA 3UERA 3WFAA 3AHYA 2CC0A 3TQVA 3P2VA 3TIMA 3B4UA 2WMHA 2PDWA 1S3HA 3A9BA 4Z1DA 3W7MA 1ONRA 1QPNA 1PIFA 2CLHA 1TE6A 5TD4A 3LV5A 2HXTA 2KX9A 4GX9A 1V0MA 1WBJA 1JFHA 3EXSA 1DL3A 2CYGA 3C56A 4L9XA 4PEKA 1MNZA 3FDKA 1CW2A 1NOUA 5IDZA 3K46A 2ONEA 3ARXA 2PP3A 2D2OA 1JI2A 1OX4B 1XX1A 2PDBA 4NZ1A 1XFBA 3RJXA 2OO6A 1ML1A 2MNRA 4FR6A 1XYMA 1EEXA 3CEUA 1LBLA 3I3EA 4UFKA 2BTMA 3HPZA 3JVAA 2PLCA 2EPLX 3FN9A 3OGRA 4IZGA 4A2SA 2IXUA 2OYLA 4DO6A 1EP2A 1ZPTA 1IZKA 2QV5A 4MLRA 4NZFA 2C91A 4X9SA 1SZGA 2QUUA 4JTTA 3N11A 5BU6A 3TXZA 2O9OA 2VENA 2WZIA 3HG2A 3EDJA 2NWSA 3PUGA 3B8SA 3NQDA 3RILA 3WQEA 1JCMP 4GNKB 1KFJA 1W1A1 2VXNA 1WXJA 2E67A 2J8FA 3CUZA 2NSOA 2BB0A 2FVMA 2OX1A 4GABA 2XIQA 1ZBWA 5CSYA 3M0HA 1PYFA 4JN7A 3QMSA 3ZS4A 3PZTA 4CD5A 1W2PA 4DBEA 1KQYA 2H9AA 1W1YA 4ZVJA 2P0IA 3PAJA 3VNIA 4F0HA 1W1VA 3FVDA 2VDHA 3W3OA 3VIKA 3AXIA 3W24A 5F1VA 3C52A 3QRHA 1VGAA 4S3DA 3ANVA 3SFWA 4B90A 1H63A 1PIIA 4Q33A 3WBYA 3SDOA 4AC7C 3W6YA 1Q6DA 4JYEA 1A4MA 1VP5A 3RYSA 3THCA 4Y8EA 1WV2A 2PTYA 5ABFB 4UFLA 3KS5A 1CTNA 3BLIA 2DVXA 2JEQA 3VO0A 3PZIA 1V6TA 2G3NA 3VCRA 3KLKA 1ADDA 4G7EA 1Q6RA 3O6YX 2CHNA 4PMOA 1KRMA 1W3JA 3A5FA 3R8HA 3EEZA 4UNLA 3C0QA 5LXXA 1RY0A 3PTDA 2PDJA 1TMLA 1J9YA 4XZHA 1S3TC 3LTPA 5T9BG 2OO0A 4LAZA 3BLOA 4A3YA 2BS9A 1BF2A 1O7AA 3C0SA 1LTDA 4BCEA 4LEQA 4U5IA 1IZJA 1LROA 1WDPA 1UBPC 8A3HA 3NQEA 3UZYA 4U3AA 4PB5A 3KCJA 2QCLA 3L4XA 4AD1A 2X0SA 1E6SM 4GA8A 5D9OA 3FYOA 2X8RA 4HZ6A 1D3GA 2A3HA 3AQUA 3IIVA 4IMAA 1HW6A 2A3AA 3WQ5A 3TVAA 3ZMRA 3SY1A 1CB7B 1TFVA 4PYSA 3GWQA 1TWSA 4MKSA 1EGVA 5E09A 3MUY1 4Q4QA 3CQHA 2GVLA 2NVCA 3PM6A 2WQDA 1J93A 1DJIA 2FJKA 2GQAA 4F8XA 4ES4A 4H2CA 2OQLA 3VM5A 4XKYA 3WENA 4H9ZA 3C86A 4XD5A 3B40A 3C0JA 4Q8NA 4JN6A 3UGVA 3PN8A 3MO4A 1XIJA 4JIQA 1TREA 1QNVA 4AZHA 1XIHA 3E0IA 2AMGA 2OLHA 2EJ1A 5H8MA 3P84A 4PMJA 5LNUA 2PTZA 4B5TA 3STEA 4W93A 4UZSA 3VU2A 3W28A 4EOUA 3ZWTA 4UCFA 4C1NA 1E5JA 3ARUA 5GNXA 2VURA 3PG9A 3O6CA 2IQDA 3O05A 5I09A 3JU2A 2W0UA 1MZHA 3PB0A 2OSXA 5H8UA 4B2DD 3HF3A 3ARYA 1KRBC 1WCGA 5HR6A 3WDPP 2C15A 4W84A 1OM0A 2WCGA 4TMBA 3RNDA 4JTCA 3KCOA 4NHVA 3WD4A 1BEUA 4IG2A 3H2EA 3D0CA 4GCAA 1AJ2A 2OPJA 4JTAA 2C1GA 1JPDX 1UOZA 1B3ZA 4L5ZA 1TV4A 2AGKA 2QJNA 1KBIA 2A3CA 1IYXA 1QHZA 1L6GA 5EMJA 3HBLA 1GQIA 1OG6A 1GJPA 3NL3A 3VOHA 1TCDA 3IV8A 3ANUA 3M0LA 2BHYA 3QSRA 5FD0A 3KOXA 3VIIA 1A80A 2C16A 5C70A 4NQ1A 2AOSA 3L66A 4MSSA 2DZUA 3AYTA 3F4VA 3FIGA 3W2JA 2QEZA 3HJEA 1KCZA 3KW3A 1SZFA 3CT2A 2PDXA 1REQA 4F0SA 4Z1CA 1BHGA 2J9YA 1KB3A 4UQAA 3AHXA 2IMRA 1YE4A 1OJXA 4BK9A 3BSGA 4DWDA 2G3MA 1PE1A 3LQLA 5LA1A 4QJ1A 5FF4A 3CLMA 4QG6A 5FL1A 2WBKA 3IARA 1LWHA 3RR1A 2RFGA 1VBHA 4JFTA 2YFOA 3T44A 1DIKA 4CN1A 2Z00A 4UTKA 5CCZA 1UD6A 2Z28A 2ZX6A 2Z7KA 3W7JA 2DDXA 2WCAA 3KWSA 1IXPA 3G3DA 4Q6XA 1DVJA 3L5LA 4L64A 5A8OA 4Z1BA 4LCQA 2WO5A 1YW1A 3W1LA 3I4KA 1XHGA 1EZWA 2XM2A 3O0KA 2GOUA 3WLHA 1P6CA 4ALDA 1VS1A 5JIWA 2XZ7A 1EB3A 1Q8JA 6TIMA 5A8MA 1XLAA 1HKJA 2OR2A 3TTEA 4ATDA 3VDHA 5DFAA 3S4TA 1YDYA 1M7OA 3S9YA 3NZQA 3DHDA 3E1F1 3ORWA 2XH0A 4ADUA 4F2BA 2BV9A 1DJQA 3ECQA 4LVBA 1LG2A 4FHAA 4HMEA 2HS8A 1EH9A 1VYSX 1IXNA 3LENA 3CIXA 1UMYA 5D30A 1RSCA 4TX9A 1W9BM 1OEPA 3QZAA 3L4WA 1I8JA 3AXXA 3U0HA 2JQXA 1G4PA 1HL2A 3VMOA 3YPIA 3R79A 2VOMA 4B5XA 5DXXA 5A2BA 4KIEA 4NILA 4H8UA 4X0NA 1BYDA 1X96A 4XO7A 2PDQA 3URQA 3WDJA 3MBDA 2F8QA 1UYQA 1J11A 3TYUA 1SVDA 3VZYA 1YEYA 4Y9MA 1R2RA 1QW7A 2QCHA 1XYCA 1BWLA 4ZOCA 2UZ9A 1VLIA 1M9HA 3WL1A 1QNSA 2HNHA 4GJJA 3G8EA 2Y88A 3JW7A 3MCOA 4GKLA 6PTDA 3SECA 3M4HA 5FEPA 2NX9A 1KLZA 3ZR6A 3B8DA 1RCOB 4URIA 3RAOA 5EMKA 3H22A 3IJQA 3W85A 4LS2A 1I45A 1CNVA 3B9DA 3IIZA 4PCPA 3CV1A 3HGJA 3L0KA 3APTA 1NVMA 4CGTA 2RDUA 4KEVA 3S6DA 4M56A 1LBFA 1A5NC 2C79A 2VZTA 2Y6ZA 4PUEA 4AZ7A 3ZR4A 5CC5A 3WBWA 2GSHA 5D9NA 4CQBA 5CPQA 1C29A 3GK0A 1DHPA 3EWBX 1MO0A 2P8BA 3J7HA 2ZDRA 3WQ4A 3T7VA 4DUWA 2J9ZA 1H09A 4A3HA 3CM4A 1H5VA 4L80A 3CL7A 4DYJA 2B7QA 3TYBA 1SJCA 3GH7A 3N12A 4K37A 3N34A 4D8ZA 2Z25A 4FO4A 4NXKA 3HV9A 1UC5A 4BR1A 1BF6A 1EGZA 1LOQA 4A3QA 1Q6CA 2JGQA 1SYTA 2V30A 4LNYA 1EDGA 1QPQA 3LNPA 5HMDA 5I07A 1YRRA 4DJEC 2V5CA 3HM7A 2I17A 4GQ0A 3RLHA 4IP4A 2QCGA 2PODA 4D2JA 1TRIA 4GKTA 3NQBA 1B0IA 2QLYA 1J0KA 3F5JA 2FMOA 3CIWA 2NQJA 1FWNA 2J88A 3H24A 3VFLA 4FNPA 1WDRA 2UY4A 4N6FA 4XBJA 4HTBA 3ZT7A 3RLGA 1OFDA 3SGZA 1TVLA 4DF1A 1VRXA 5K9CA 3WZ0E 4RV3A 1HX0A 4FLOA 3PTKA 5BU9A 2GLKA 3PK7A 4Q4KA 5HMEA 1DBTA 3NPUA 1TWZA 4A21A 4UR9A 1YHTA 5I79A 3WLJA 4WF7A 3IGUA 2D3NA 3VOIA 3NYDA 2WNNA 3WLTA 5I3GA 2G41A 2XIOA 5C2CA 3ID7A 5D8ZA 4XV0A 1N8WA 3BCJA 5I5RA 1MQPA 5EGRA 3E5PA 4O8RA 2O0TA 4ZO7A 4LJ3A 3NEVA 3M9YA 3IJIA 3GDKA 2J75A 3BAXA 3BSHA 4JQAA 1KFKA 2G97A 3N25A 2DU2A 1KXTA 1YPFA 5AHFA 4H2HA 5FEXA 3ES7A 1YYAA 2PWGA 1VFHA 3WQPA 3DHUA 3LPOA 1RY8A 2BXVA 1V02A 4I5RA 5CPNA 1Z41A 3H2NA 5CSUA 1QR7A 3OLIA 1VENA 3DZ1A 3SY8A 3WMBA 2V63A 4BHYA 3B8TA 3W9ZA 3CQIA 4NJIA 3N2CA 1B3VA 3GXDA 4RUBA 1MW1A 5GJPA 3FHAA 1RA5A 4J27A 5LSMA 4S39A 4U28A 4QNWA 1EL3A 5FJIA 3MYOA 1VH7A 4B2DA 4IT1A 2POZA 3MI6A 1MXGA 5H1WA 4C60A 4L6HA 3OYXA 5BMXA 3RPMA 4EXAA 5MF5A 2CEQA 4RDVA 4X22A 3ZFHA 4HVXA 3GFXA 2WJEA 4PN2A 4N7QA 1PZ0A 2R9RA 1MXSA 1JCTA 1R3SA 3LMYA 2SFPA 2YL5A 1Y0EA 2GQ3A 4AEEA 2Z24A 2I14A 1ZGDA 3U2EA 4MAVA 4HB7A 1OCJA 3C8NA 5A6LA 4QP0A 2AMXA 4ZB2A 4GRSA 4MNJA 3VNYA 2D24A 4PBEA 4ZE5A 3UR8A 4QCFA 4YVVA 4Z1YA 3O63A 5FAJA 1P1XA 3WMCA 1AVAA 3KX6A 3CZLA 1V77A 5HMSA 5AYZA 1GVYA 1KTCA 2CZFA 2J27A 7REQB 3VGEA 3KZPA 3FGCA 2W67A 1B57A 1A53A 3PAOA 4L9YA 4NL1A 2FTPA 1WNOA 2ZUSA 4NAFA 4AIOA 4AXNA 2ZZ2A 1FWIC 2XGBA 1T0OA 3M0YA 1UH4A 1FWRA 2DSKA 4CNNA 3MDWA 4HA3A 3QBUA 1JZ7A 1LYXA 4HN8A 3CH9A 2E77A 4AXKA 5A8GA 1MFVA 4HHHA 1Q7ZA 3W75A 3CU2A 4HHLA 4L6DA 1O5KA 3SSJA 1VCVA 1ITQA 1E1FA 1XSKA 2WVVB 4CQDA 4PRWA 1KBKA 2Q71A 4Q7BA 3BLDA 5I00A 4G5DA 2IKIA 3GDTA 2EG7A 3G5EA 4AD3A 1RK5A 3G1RA 3CB3A 4HCHA 3ZJ6A 1WZAA 1UZDA 4LUJA 3WF0A 2Z6IA 1MI3A 4J3ZA 3NSXA 3N6QA 3DHFA 3L2LA 3DUGA 3C0LA 3F7JA 4N6EA 4Q6JA 3WQGA 1SJDA 5BOEA 4LF1A 2HPMA 3L4TA 4MUPA 3APGA 2VELA 4U3CA 2A3BA 4KMQA 3NSNA 3WYZA 2NV9A 3WNPA 3BQ6A 4OOZA 3AICA 4XBKA 4Q8VA 3UPMA 2E5BA 4M82A 4QBXA 1SMDA 3BH4A 3GNOA 3QKZA 5D02A 3QR1A 4PUNA 1XLLA 3B8UA 3DC8A 2FB3A 2WJDA 5CZKA 3CUGA 3QY8A 4EF9A 5U4NA 1LOSA 2P50A 2H3DA 3V5CA 1JGIA 2ZX8A 3EKZA 2OGJA 2X0YA 4D1IA 4C1KA 4MTVA 5DCEA 3THQA 2F84A 3LA4A 3DFPA 5CPSA 3SJ3A 5L9FA 3W27A 4ENLA 1W17A 3QOKA 4E2VA 1G6CA 4Z2JA 1FHLA 1L2UA 2YL6A 3GR4A 3SCUA 3W7OA 4XX6A 3V35A 5BRQA 4JICA 1EF3A 3P62A 1T5AA 1VRDA 3LZ3A 5LKYA 4JFSA 4YU1A 2OTDA 3LRLA 5DELA 4QLKA 3RGTA 4MPQA 3AIVA 3ME3A 1WYIA 4MDOA 2OOGA 1FHVA 4Y2WA 4MY8A 2R8WA 4HNTA