1W3LA

Endoglucanase cel5a from bacillus agaradhaerens in complex with cellotri derived-tetrahydrooxazine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, Thermodynamic, and Kinetic Analyses of Tetrahydrooxazine-Derived Inhibitors Bound to {Beta}-Glucosidases
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE 5A
total genus 121
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1w3lA00
4KMQA 2X8RA 1QHPA 1BFNA 1TG7A 1NWSA 3RILA 2V3EA 4PUEA 4ACYA 3DECA 8A3HA 2WC7A 1NWRA 1WZAA 1DWHM 3WSUA 1CGUA 2G8ZA 5M3WA 2DQXA 4D6JA 1TA3B 3WF1A 2XGIA 1C92A 1BG9A 4JHZA 3AZTA 5DMYA 3K4DA 1MXDA 4WKAA 3VMNA 1GOIA 1C7SA 4GKLA 4F8XA 5IFPA 1V0LA 4H04A 4CU7A 3KWXA 3VMOA 1W1TA 2JALA 1ODUA 2V3DA 2CBUA 5FIPA 3OLEA 2CKSA 3ARRA 2WC4A 3CHFA 3T2PA 4B15A 3GH5A 1UWRA 3PZVA 2VVNA 7TAAA 4DM2A 1CTNA 1G1YA 4D72A 1QW9A 1UD3A 1B90A 2GSJA 2UY2A 2YDRA 4WSJA 3AIUA 5DEZA 3WUFA 3ZMRA 2BV9A 2D1ZA 3VX1A 5I23A 3IANA 3SURA 3CMJA 3WF4A 4ZFMA 3PZOA 3NSXA 1EHAA 2YLLA 3SEPA 1VBRA 5A94A 4L4OA 1WDQA 3KZSA 1DWAM 2WANA 3TTYA 3VD7A 4AD3A 1J12A 4GIAA 1HNYA 4W7UA 2ZE0A 2CXGA 3TTQA 4P8XA 1D2KA 2XSBA 4W87A 2EXOA 1TR1A 3I3EA 3THDA 3AJ7A 1JDCA 2A3BA 4CGTA 4B9YA 1E55A 1E6SM 1GONA 2J77A 4IISA 4V2XA 5DT7A 1HJWA 1KXQA 4X0NA 1A3HA 2WMHA 1C91A 2WAGA 3CZ8A 4E2OA 1PJ9A 3PZTA 4M56A 4N0RA 2WSKA 1KBBA 4JL2A 3WEZA 4CKQA 3L4WA 4CD7A 4D6GA 4MB3A 3WH5A 1OWQA 1UA7A 1KXTA 1JF5A 5C71A 4HPHA 3BLKA 3VGDA 5ABFB 3T0BA 4P7LA 1KWKA 3VIPA 1QI0A 5E0FA 3W28A 1ISYA 3N9KA 4BZYA 1JZ6A 2CBJA 3B9DA 4HMEA 3RIKA 3PN8A 4H8HA 4BQ5A 2JFEX 1HJQA 3WNPA 4CCDA 3CPUA 1KQYA 5A95A 5I24A 2WK2A 1VEPA 4M82A 4GZIA 3AMGA 4W5ZA 1QW8A 5CSYA 4P8WA 1HJXA 5DT5A 1WO2A 1NOFA 3T0AA 1JF6A 2G3NA 3WMSA 4PUDA 2YL5A 3GXDA 1QNPA 1CLVA 2YL9A 1J10A 3EDDA 2PWHA 4W7WA 2ZX8A 4J28A 2CERA 2VR5A 1UKQA 3TTOA 1E6XM 4AWEA 4ACZB 4D71A 4CCCA 5A2BA 3ZQ9A 4JFWA 1UHVA 3POCA 4P7OA 3THCA 2C8NA 2WVTA 2VURA 1CBGA 3UR8A 1AMYA 3RM9A 4BQ2A 1UWSA 3UG3A 5A2CA 4X0VA 4KWUA 5M03A 3IAQA 5BXSA 3HU7A 5HPOA 5HXMA 3VGGA 3GNOA 3A3HA 1XH0A 1ZL1A 1WB0A 3ARYA 8CGTA 3J7HA 1UWQA 4X9YA 1IV8A 1J0KA 2F2HA 1WP6A 5AYBA 2NT0A 2WMFA 2WM0A 2YDSA 5LA2A 3EDJA 1W3HA 3OZPA 2YKKA 4DUXA 3A6OA 4D6FA 1X1NA 3BAYA 1H1NA 2Z1KA 1SFSA 4UZSA 1BQCA 3GTNA 1W1VA 3K8MA 1XV8A 4PYSA 3PZNA 2CESA 3AMKA 2X0YA 3CHEA 3LPPA 1QHOA 2DDXA 5HPCA 3SUVA 5EB8A 3ZOAA 1K9DA 3WQVA 4URIA 3NSMA 1J0HA 2YA2A 4PRWA 3L4UA 4LQ1A 4LYRA 1R8LA 4P7QA 2DIJA 3CHCA 1L8NA 2DT2A 3PZQA 4Q7NA 5I0DA 4W8BA 1KR1A 1XC6A 3F5LA 1U30A 5TD4A 3ARVA 4JHOA 5EFFA 3WNMA 4OKDA 3HMCA 4F9JA 1UD5A 3AIRA 2CHNA 3WF3A 3ZSTA 3ALGA 4J27A 1WDRA 4YHGA 1W9PA 3SCUA 4P8VA 4WIWA 2GJRA 1H49A 2ZXQA 2DT0A 1IZJA 3WQ6A 3ARTA 4AZ6A 4GO9A 3VIIA 2VO5A 4HPGA 2E9MA 1UUQA 3W53A 4M80A 5ABHA 2J79A 2W92A 4DUWA 4HZ7A 1KGUA 1M03A 1UKPA 3HJEA 2WLZA 1BSIA 1JD9A 1MW2A 2FHCA 3HN3A 3OGVA 5JIPA 1US3A 5E6YA 1JFHA 5A69A 1CXEA 1XGZA 2D24A 1E3XA 4U3CA 1HJUA 1AQMA 4PMYA 3K8LA 1CPUA 4PMQA 3NJ3A 1P6WA 4CN4A 1E1FA 3PZIA 3A47A 1JIBA 3AIVA 1C93A 1OSEA 3ZJ7A 5FCZA 3U7VA 2WMJA 4MNMA 2WVVA 4R27A 2AAAA 1Q4NX 2CNCA 3GXMA 4UQAA 1ZS2A 1QHZA 3WMBA 2O9OA 1B31A 2CBVA 3PZMA 1QPKA 3VIOA 1BYBA 1GNXA 3W27A 3WH8A 4CVUA 3GDBA 4QCFA 2CPUA 3ZT6A 4RL3A 5A8NA 2EPNA 1I1WA 1CXKA 4MNJA 1KFWA 4AD4A 2WC3A 3DYOA 1DHKA 4JFUA 1JZ5A 5I77A 1BLIA 2FHFA 2BVTA 1JNDA 4QLJA 1UD4A 1CLXA 2YJQA 3QHOA 2VVSA 2JEPA 3KL5A 2G4FA 1J11A 2DPEA 1I75A 3BXWA 2YDQA 1W2PA 2J78A 3CO4A 1HT6A 2X1IA 1PIFA 1JXKA 1WNOA 4PCTA 2EQDA 4AEFA 5C70A 5CLWA 2VZOA 2PBOA 1E4LA 4OOZA 3BMVA 4RE4A 5E70A 3BAJA 4XZBA 3VD9A 3GBEA 2BXYA 3II1A 4MNLA 4UNIA 3VINA 2CEQA 5CLTA 5JBEA 4BQ3A 5CXPA 4NRSA 3EMZA 4HA4A 1GHRA 3AROA 3K4AA 1C8YA 1GQIA 1C3FA 3QHNA 3NYDA 4ATLA 1UH3A 2QHAA 3FW6A 3WH7A 4EK7A 1GOWA 1EIBA 1LG1A 3WNNA 1W3LA 1E56A 1BVNP 3RJYA 3SCOA 2FHBA 3CUJA 4Z2JA 5BXTA 3CZLA 3BLPX 1GQJA 3W38A 1RPKA 4W8AA 4PMRA 4Z2IA 3VKKA 4C7DA 1CXHA 3LPOA 1HJSA 1V3HA 1W9DM 3PBGA 2ZX6A 3VUPA 2J4GA 1UKSA 1RH9A 3WDPP 1G5AA 5FL1A 4MJ2A 3TONA 4PMZA 7A3HA 4B16A 5KEZA 2WKLA 2J7CA 2NSXA 4DM1A 2E8ZA 1N82A 3W29A 1LLOA 4AYSA 1ISZA 3BAXA 4U2YA 1EDTA 3BH4A 1E6RA 1BHGA 1EO7A 3L2LA 4QLKA 1VRXA 1UKOA 3W82A 1QI5A 2EPLX 4FLQA 2QV4A 3SCTA 3WL1A 1ITXA 4OBRA 3O9NA 1HIZA 5D9PA 2D22A 2HVMA 4YN5A 2E0PA 4HU8A 1ZJAA 2UWFA 5A8PA 1HX0A 1V6WA 2D20A 4ZENA 1KQZA 1US2A 4TXEA 3AICA 4LXFA 3WN6A 1JYWA 3MKKA 1WZLA 1JZ8A 4DWSD 1Q6GA 2RGLA 1JYXA 4MADA 4OBSA 1HL9A 1JI2A 3WDQA 1JAKA 5I3DA 2PWDA 2ZUVA 1H09A 3MUY1 4U33A 2E40A 1BGGA 3ZJKA 4AZ5A 2UY3A 4P7RA 2DH2A 4TUFA 1ZBKA 1B2YA 3CTTA 4EE9A 2BFGA 4QCEA 2G41A 1LL4A 3A4XA 3CUGA 2PC8A 2J7BA 1EQCA 3WNKA 3AXHA 3A4AA 1M7XA 3APGA 4BCEA 4S3JA 3DHPA 4OIFA 1VEOA 1KGWA 4JFVA 3EDKA 2VQTA 4ZXLA 1E40A 1NM9A 1CDGA 1D3CA 1GZJA 1V3IA 1NH6A 3VGBA 2VRJA 4CD4A 1JYNA 3GXIA 1TA3A 2JEQA 2WVUA 4UFJA 5GQBA 5JIWA 3GXFA 5IDIA 4KGJA 5HOSA 1M04A 2VJXA 3VD3A 2CBIA 5CPSA 3BAKA 2QMKA 4QFUA 4OZOA 2BHUA 4MJ4A 3M07A 3PZUA 1W9BM 1CIUA 1HF6A 5ABGA 4PTWA 3ZT5A 3WD1A 4A3YA 1JFXA 1LQ0A 3E1F1 3FAWA 2XPKA 5DFAA 1K9EA 1VJZA 4OJYA 2ZICA 4AMCA 1PX4A 1BYAA 3WDHA 3L4TA 3NSNA 2XSAA 3CGTA 3VNYA 2WMGA 4ACZA 4PEEA 3MSDA 5CG0A 4ATDA 4MAVA 1G0CA 1QNSA 3OLGA 2BY0A 2PI6A 4OUEA 1JNEA 4H8UA 2W61A 2EPOA 5A6LA 2J7HA 4FK9A 2WNWA 1WDSA 1DEDA 4J3TA 3CZJA 2YL6A 1O6IA 3IJ8A 3BC9A 1HP5A 2D3NA 5E09A 4MTVA 4U5IA 1EOKA 4CU6A 4HU0A 3AQUA 2VNCA 5DO8A 3G6MA 1QNRA 1D7FA 2XFFA 4OOUA 3PZGA 1UR8A 1E5NA 2FH8A 2GJXA 4JFSA 1ECEA 3SUWA 5D4YA 5D9OA 3SIMA 3WEOA 3AIEA 4W89A 1B3YA 3WD2A 1ZB5A 2O9TA 5KZ6A 1JYVA 1UWIA 4UOQA 2E8YA 6TAAA 4JCLA 4NF7A 5HBFA 1PZ2A 1W1PA 2IXVA 4DWSA 1PZ3A 1VEMA 3RO8A 3F5KA 3OLIA 3EBVA 1FFRA 3D3AA 3FN9A 5CPTA 1B1YA 1Y7VA 2WYSA 2EPKX 4AC1X 1QNOA 5A1AA 1MYRA 2EEXA 4H41A 4PMVA 4D6EA 3W81A 4W7VA 1XSIA 1ZBWA 1FHDA 3GNRA 3VVGA 4DWSB 4WJXA 3GH7A 2XVKA 1CGXA 4Z2GA 1AVAA 4JIEA 3WMCA 2O9PA 2WCSA 3S6TA 1LJYA 3WKZA 4B3LA 2Y8VA 4HZ8A 1V6UA 1FA2A 3EDFA 2FDMA 2QPUA 2WZIA 4UFKA 1U33A 1E9LA 5JUVA 1LL7A 2D0HA 2IXUA 2ZX7A 1WKYA 4PMNA 4GI8A 3VDBA 1UD6A 2UY5A 1KGXA 2VOTA 1E3ZA 3U57A 1NP0A 4FLSA 4CU8A 3ECQA 4MB5A 2XYLA 2W62A 4J3SA 1HKKA 3VMPA 3BAWA 5E6ZA 1KR0A 3BGAA 3S2CA 1KWGA 4JL1A 3U7BA 5IFTA 1IZKA 1OD8A 1VFOA 3SUTA 5D9MA 2W5FA 3VIGA 2OSWA 3VIFA 4MAZA 1F4AA 1H41A 4TVCA 3D5HA 3AZRA 1Q6EA 4AZIA 2W63A 3SUSA 4LYQA 4PMDA 4U31A 4V27A 1E15A 3CZGA 1ZJBA 3AZSA 1MW3A 2WHKA 2QMJA 2GK1A 1BVZA 1K9FA 2V3FA 4S3KA 5A3HA 3L4ZA 2XG9A 2X09A 3VIMA 3RPMA 3WNOA 4FF5A 2XTKA 4TTGA 3MS8A 5HNNA 1OD0A 2XVLA 3JUGA 1GVYA 1W1YA 3W0KA 3RJXA 4HP5A 4C7FA 5ECUA 1G94A 3AS1A 3GM8A 2VX7A 1B30A 1DWJM 1GJUA 5BCAA 1FH7A 3NIYA 2BHYA 1NP2A 3L4YA 1OGBA 5GNXA 4UQCA 3WF2A 3KE0A 4W93A 3MANA 1UA3A 1SR0A 1OIFA 2ZXDA 3VOCA 4TVDA 4M81A 1OT2A 3OGRA 2XVGA 4ZEPA 1E6PA 1X6LA 1MQRA 3WFLA 5ABFA 1UWUA 3KL3A 1V3KA 2BY3A 2F8QA 5BRQA 2O92A 4J3UA 1E4MM 4Q22A 5I78A 3FHAA 1GOQA 4GI6A 3MUAA 1CEOA 1WAWA 1ISXA 1OB0A 1ISWA 6CGTA 1V3LA 2FGLA 3OLDA 1ITCA 1EO5A 1CXFA 2CHOA 3N11A 3WY1A 3QR3A 4AY1A 3CLWA 3SCPA 2BS9A 3M46A 1EHNA 3AHVA 4MB4A 4AD2A 3QOMA 3ZT7A 4AXNA 3SCNA 4CD6A 4ATWA 3W6LA 4IUGA 2G3IA 2AOSA 1GQKA 2ZUSA 4JKKA 2ZWZA 4GINA 2J7FA 3FY1A 4QDMA 4J3WA 4KH2A 2XM2A 4U2ZA 2D0FA 3UESA 4ZE4A 2JE8A 3ZSSA 4KGLA 1VB9A 1VBUA 1JDAA 3UEQA 1E4NA 2CYGA 3I3BA 4AD1A 5LA0A 1XSKA 2E9BA 2DIEA 1XRVA 4GXPA 1UQYA 4UOZA 1MFVA 2WWCA 1UD2A 4D6HA 1Q6CA 3WFZA 2ZUMA 4QLLA 1DP0A 4MNKA 3FHQA 2J7EA 3AHYA 1GJWA 3VDHA 5I5RA 3VX0A 1ESWA 2VL4A 3VD5A 3EMCA 2WHJA 3VO0A 2CIPA 1TFVA 3CHDA 3T08A 1SYTA 3VM5A 5BXPA 5BXRA 1YQ2A 2BNJA 4XV0A 1VFMA 1KB3A 3AOFA 3MMDA 3LMYA 2WSPA 3N18A 2FH6A 4B9ZA 1ZBCA 2J8FA 1MXGA 5FL0A 1GOKA 3DC0A 4A3HA 1R7AA 1KCKA 1VIWA 4GZEA 3L2MA 4XX6A 1HVQA 3ZJ8A 4CUCA 4D6CA 4ZXOA 2CKRA 4HZ6A 2CITA 5CPQA 4LGXA 3CUHA 3WUEA 1JZ2A 1W3KA 3N13A 2VX5A 2X2YA 1WPCA 5D8WA 2WZHA 2OYKA 1GOOA 5A6BA 3W6MA 4AZGA 1E6QM 3NDZA 1CGVA 2GDVA 2W66A 1WCGA 1UR1A 4BA0A 4GPNA 3IK2A 1DWGM 2J74A 3WH6A 1JG9A 4BS0A 2VQUA 1UR9A 1XH1A 2BY1A 2WCAA 1DWFM 2Z1SA 5I2UA 3TP4A 4GQQA 4UFLA 3BAIA 1R85A 5FOOA 4RE2A 1PBGA 1VAHA 1BG4A 4NZCA 2XVNA 3CUFA 1G01A 3UETA 1XYFA 2ZXBA 3WBAA 4NRRA 2OSYA 1HKMA 1V6XA 2BXZA 1BYCA 3N17A 4Y7EA 1B3VA 3UCQA 1Q6FA 2ZUUA 3MMWA 9CGTA 2CETA 1EXPA 2XGBA 3I3DA 1B3WA 4P8UA 5A6MA 2J62A 4DWSC 1K6AA 1E5JA 4D6IA 2EO7A 1PIGA 4PTMA 2JF6A 2XFRA 3AS0A 3CBWA 2FGZA 3L4XA 4AW7A 3AI0A 1BAGA 3ARQA 1V0KA 5EMYA 3EDEA 2MANA 3SCRA 3L4VA 1UOKA 3T0DA 3WQWA 3WH9A 1MW1A 4CN6A 3FXYA 4PN2A 4TTUA 1J18A 4RE3A 2E4TA 2WVVB 2A3AA 2YOCA 1G9HA 3ARSA 4U5KA 2YIHA 2NT1A 4H8VA 2WMKA 2WCGA 1MFUA 3OBAA 4HMDA 1F4HA 1W9XA 1PX3A 2VCAA 1E70M 2VCBA 2W4XA 3WD3A 1DWIM 2Q8XA 3AHXA 3GZAA 1MQQA 2WMIB 4B3KA 5A8MA 1CZ1A 1QBBA 4YHEA 3RM8A 4CN1A 3WIJA 1O7AA 1QNQA 5CGTA 3VM7A 3ARPA 1UKTA 3WUGA 1LG2A 2BHZA 2PB1A 1J0JA 4M8UA 5A6KA 4PMXA 3UERA 3T09A 1J0ZA 1GUVA 1GVIA 4F66A 3AS3A 5IHSA 3W24A 1E0WA 1XH2A 2OYLA 4PTVA 1JD7A 2J7GA 4UZUA 5C8BB 1H0GA 6A3HA 3PZ9A 1QI2A 4GQRA 2OLHA 3IJ7A 3VD4A 1UH4A 4UR9A 3ZR5A 4UFIA 3VIKA 3GYCA 1EA9C 3AMLA 1RP9A 2V3GA 3OGSA 2DT1A 2ZIDA 2F61A 1HKJA 1B3XA 3CIVA 1K9TA 4H7VA 4F9DA 2OSXA 3EYPA 1UD8A 3ALFA 3WQ4A 5A6SA 1OIMA 3FAXA 1V0MA 4NSBA 2E9LA 2Y5EA 2QPSA 1JGIA 3MV11 2ZX9A 3WQ8A 2A3HA 2DSUA 3BCFA 4U3AA 1ISVA 4Z2KA 2PF0A 1JZ7A 2OWCA 2A3CA 1B0IA 3SCSA 1H3GA 2ZOXA 1UR0A 3VTRA 4PCSA 2DGAA 1CXLA 1TE1A 4W84A 1EQPA 1R87A 4KRUA 1VJSA 1YHTA 2WVSA 3T2QA 2VUYA 2VT0A 4AZCA 4ZE5A 2D23A 2WPGA 1WDPA 2XIBA 4IPLA 4J7RA 4BF7A 1SMDA 3WDRA 4HOZA 5I79A 1LF1A 1FP9A 3VIHA 1UR2A 1GPFA 5D9NA 1Z32X 2TAAA 5IXEA 4JKLA 4QAWA 3O2LA 4HOXA 1NQ6A 4AZCB 1UR4A 3ARXA 1OINA 3AHZA 4WF7A 3CZKA 4LPCA 3RCNA 3W37A 1QI3A 2VCCA 4WKHA 2BY2A 5FKYA 4HA3A 2CCRA 2VZVA 1BF2A 4QP0A 4WSKA 4FMVA 4PMOA 1OGGA 3NCOA 4HMCA 1JDDA 3OIHA 4D1JA 3WUBA 3VGEA 4PSRA 1V6YA 2WHLA 1LL6A 2D2OA 1TUXA 3PTKA 1HJVA 4CCEA 1J0IA 3N15A 1H5VA 5CJ5A 1OT1A 3M6DA 1E71M 1HN1A 1GQLA 1MQPA 2GUYA 1EDGA 3KL0A 3ZIZA 1HKIA 1H11A 4W5UA 1JI1A 1UH2A 1CNVA 4UCFA 1MWOA 1H4PA 3ZR6A 1LWJA 3CMGA 2WKGA 4LYPA 1Q6DA 3WF0A 2ZUNA 2DSZA 2WBKA 3G6LA 4YPJA 4E8CA 1GOMA 2GDUA 1SMAA 1TMQA 3NDYA 1U2YA 4HOWA 1W2VA 2WZEA 2W91A 1XCXA 2EJ1A 2WB5A 1KCLA 1W9VA 3AMCA 1BPLB 2XFYA 2G3JA 3SCQA 1B3ZA 3AHTA 5D8ZA 1OBAA 2XIIA 5AYIA 2QF8A 5E9AA 4WLCA 1ODZA 2XVPA 1OCQA 3QHMA 1NARA 5I6SA 3LPFA 4UQDA 5A6BD 3VGHA 1WZMA 3DYPA 1QBAA 5AY7A 3DHUA 2JIWA 4AZHA 5BROA 1E43A 4GZJA 3AIWA 4KRTA 4W86A 1R7OA 3MUZ1 2J7DA 3U5UA 3F4VA 1CENA 4V28A 3B9AA 3VDCA 4AZBA 1JL8A 5CSUA 2ZUTA 5A6JA 2V38A 3UR7A 2Y2WA 2WLYA 2A3EA 2HISA 3GH4A 2ESCA 4MDOA 1EOMA 2EBNA 3CZEA 3RM4A 1V3MA 2PWFA 2XHYA 1E6NA 3WEMA 4R5EA 4UTFA 2VZTA 4E4PA 2YBUA 4GO8A 3M7SA 1DTUA 1FOBA 4DUVA 1I1XA 2Y24A 3ZJ6A 5JBFA 4Z2HA 3ZO9A 5AC4A 1UQZA 2JIEA 2YA0A 1CGTA 3O6AA 3DYMA 2WW5A 5CZKA 3WENA 4F79A 4AD0A 1QI4A 2V5CA 3MV01 4JFTA 2DT3A 1FP8A 1XCWA 1ZBVA 4ML4A 1FFQA 4W8LA 2DSWA 3AIBA 1C8XA 3RMEA 4CVWA 3IAPA 5AC5A 2RGMA 5EFDA 2WHMA 4WKFA 1BGAA 4D6DA 1XSJA 4HA1A 3WDIA 4M1RA 1NOUA 2VZSA 4Z2LA 2PWGA 3OA5A 1E1EA 4CD5A 5HDRA 3LPGA 3MSGA 5LYRA 2NW0A 1QOXA 3B8SA 4TOQA 4AIEA 2VZUA 3PHAA 2XWDA 1W9UA 4TX6A 1UZ1A 3OB8A 3CUIA 1E73M 3VILA 1MW0A 1XD1A 1MVYA 4IM4A 2OWWA 2X0HA 2VRQA 3VU2A 1GORA 4TVUA 1V08A 1TCMA 2AMGA 1E4IA 3AXXA 2J47A 2OYMA 1V0NA 3VPLA 5A8OA 3ARUA 1CGWA 2OWXA 4M24A 2VMFA 2GJPA 2YBTA 1UG6A 1E0VA 4TX8A 1C90A 2VC9A 4HTYA 3VDAA 4C7GA 1PAMA 4P7NA 1VFFA 2UY4A 3WNLA 3K1DA 1V02A 3RDKA 2O9RA 2ZUWA 1S46A 4PSPA 5M5DA 5DF0A 2J25A 3AMDA 3QOKA 5BRPA 3N04A 4N42A 5CGMA 2XWEA 3WDJA 1M53A 3CH9A 3SCWA 5E0CA 3WD0A 1CECA 1NWTA 2DSVA 3EMQA 2VX6A 4E8DA 4FLRA 1V03A 4UFHA 1WZKA 2J8GA 3POHA 3GNPA 1X6NA 1J9YA 3B9EA 1LWHA 3T2OA 5A8QA 4WK9A 3PTMA 4EAMA 5LA1A 2G3MA 1UWTA 4MPKA 2ZWYA 5BYWA 1TZ7A 4GI9A 2DH3A 4W88A 1OM0A 5GPRA 4D1IA 3WELA 2E3ZA 3FNDA 1RD6A 2ZX5A 3TTSA 4H2CA 1JAEA 3MMUA 1J0YA 1OGSA 1TVPA 4AISA 4J3XA 2VI0A 1B9ZA 1HL8A 4JCMA 2Y4SA 2XM1A 4PBGA 3UG5A 5A6AA 1AQ0A 3N12A 2WMIA 1H2JA 1FH9A 3BCDA 1AQHA 3K46A 1WE5A 3WBEA 3NUKA 5F7UA 1UYQA 3QGVA 2EPMX 1CYGA 2VTFA 1XHGA 4AIOA 5FD0A 1TVNA 4A4AA 1CGYA 4UFMA 1KXHA 3VIJA 4NI3A 1VENA 3AS2A 1QVBA 4JKMA 3BSGA 1HP4A 1V3JA 2IUZA 4AEEA 4EANA 2C7FA 4JAWA 1M01A 3SCVA 3W4RA 4MDPA 2QLYA 4AZ7A 4UQBA 3AFBA 5M17A 3OZOA 3A4WA 4UQ9A 1BTCA 1BYDA 3GBDA 1IT0A 5A2AA 2V5DA 3U5YA 1W3JA 5BWFA 4MB1A 1E72M 4UQEA 3IJ9A 1PX8A 1FH8A 1EDQA 3TA9A 1V02E 3ARWA 4PTXA 4XUYA 1W32A 1FHLA 1W91A 1PEZA 3AYSA 1V6VA 4J3VA 2GFTA 3AYRA 2XUCA 1HXJA 2PBGA 5IHRA 2WWDA 3PTQA 1VF8A 3BSHA 4UOJA 3AISA 5JBDA 2JF7A 2GK1B 5GNYA 1NWUA 1GW1A 1EH9A 3MO4A 3TOPA 2D0GA 4AD5A 1JZ3A 2ZXAA 4JZ5A 1XYZA 1CWYA 1EGZA 4M29A 2VRKA 3VNZA 2X05A 1E0XA 2WBGA 1RP8A 1GHSA 1VFUA 3UG4A 3W26A 2D3LA 4BQ4A 3MU7A 5GNZA 2VX4A 3AIQA 5EBAA 1HVXA 1CXIA 2C0HA 7CGTA 2BVDA 3SUUA 3WL0A 3ARZA 1UZ4A 1KBKA 2GJXB 2BVYA 3W25A 4L4PA 4PMUA 5CQ1A 2YLAA 3BMWA 1R86A 2PWEA 2Y8KA 3WD4A 1C7TA 2B31A 1A47A 1ZU8A 2DSKA 3KEHA 2YA1A 1KXVA 3OG2A 4XB3A 2WXDM 1GCYA 4IPNB 1XD0A 2XJ7A 2VR4A 4LX4A 1L0PA 3WQ5A 1J01A 3ZM8A 3MUIA 1PPIA 4FLOA 2GVYA 2DEPA 4AIUA 3F5JA 4EKJA 4W85A 4XZWA 2W67A 4K68A 3K8KA 4CD8A 3AXIA 3VGFA 1E6ZA 1C8QA 1H0IA 3N1AA 1JZ4A 2YL8A 1JXJA 2J75A 5ABEA 1NOWA
chains in the Genus database with same CATH superfamily
3M0VA 3IJQA 1Z41A 1KFCA 2Z7KA 3VE7A 4PUEA 3S46A 3DECA 4GHRA 4E0CA 3N2TA 5AZ1A 1O5QA 1K7EA 5M3WA 1CI1A 4Z1CA 1P1XA 2XGIA 1C92A 5HNUA 4JHZA 1VD6A 1F6KA 3STCA 1GOIA 4ZO8A 4GKLA 4DZ5A 4CU7A 4H04A 4O52A 3U2ZA 2V3DA 4I9JA 3OLEA 4WUIA 5IOBA 2GGGA 1XIDA 1A3XA 4B15A 1UWRA 2YDAA 2FVKA 7TAAA 1F7BA 4XWUA 1G1YA 3WBWA 2QIWA 3LBOA 2UY2A 3NQVA 4LRTA 4WSJA 3WLTA 3WUFA 4LCQA 3WK0A 3OU8A 3PJUA 3K4WA 3WF4A 3CMJA 2REQB 2V69A 4QSHA 1EHAA 2YLLA 4HHMA 2CLPA 1EFZA 2GQ9A 5A94A 2Z1BA 3QKZA 4XZ9A 1IF2A 3DI0A 4YJ5A 4ZOEA 3C0JA 1HNYA 4OUIA 1KM6A 2EF9A 4W87A 4KCWA 3GAYA 3I3EA 3AJ7A 4UTHA 2A3BA 4JTHA 4GRSA 4B9YA 1E6SM 2YYUA 4PUUA 3L0NA 3L0GA 1K02A 3TROA 1VP5A 3PZTA 2NLIA 2ACQA 3P81A 3ITOA 5B7ZA 1YLVA 4CKQA 3W7CA 4M6UA 3STGA 2YZ5A 4HD5A 3VA8A 1OWQA 4K8HA 4RNIA 4H00A 3VGDA 3USZA 1UWAA 1W3IA 1S2VA 4UXDA 3VIPA 3EZ4A 2OMAA 4N02A 4CNSA 1ISYA 3FEQA 3N9KA 4BZYA 4HMEA 1JCJA 3PN8A 4H8HA 1AFSA 1FHUA 4BQ5A 4NAFA 4CCDA 5M2FX 3M16A 2ISFA 1VEPA 2NQJA 4M82A 4DPQA 3AMGA 3LCWA 3NO5A 1W3TA 4PUDA 3GXDA 1CLVA 2YL9A 3MVIA 4JHMA 3G0XA 5FJPA 3W22A 4GVFA 3AXKA 3SRFA 2XN1A 4DY1A 3ZQ9A 4JFWA 4IQDA 3POCA 4L56A 1S39A 2WVTA 1SO3A 2VURA 3KRSA 1CBGA 3NZ1A 3VXGA 1RLCL 1FKWA 3AYTA 4FNTA 1AG1O 4DXKA 3UVAA 2ZZ1A 3RAOA 5A2CA 2G37A 4US6A 5C6MA 5BXSA 5HPOA 3VGGA 1WB0A 1TV8A 3GU2A 1NVMA 1IV8A 4LU0A 1ZPTA 5CCZA 4DBSA 2WM0A 5LA2A 3S9IA 1JUEA 1Q7ZA 1QPNA 1W3HA 3S6OA 2VP8A 3SZ8A 3NXFA 3EWZA 4D6FA 4IQLA 1D8CA 1X1NA 3F03K 3DEQA 1Q6LA 4UZSA 3VFCA 4WJEA 3P84A 3K8MA 3PZNA 2X0YA 1ZRQA 1QHOA 5F2MA 5HPCA 3VE9A 4JTEA 1XLHA 3GNNA 4J5NA 1CT5A 1W1A1 4LYRA 1ADDA 4M7TA 2FGBA 1Z69A 1M7PA 5I0DA 1YXYA 4W8BA 3SIZA 2HWGA 4H9TA 3F5LA 3UYIA 3WLRA 1XI3A 3PB2A 5EFFA 3HMCA 1LTDA 3C3UA 3AIRA 3W23A 2CHNA 4FXSA 2EGZA 2WQDA 1SM9A 4EVZA 4J27A 4HN8A 3KDOA 4LBUA 2P8CA 5HUPA 3QGKC 4HPXA 4LVBA 3WQ6A 3M7WA 4AZ6A 1D8WA 5F1VA 1RJQA 1KBLA 3VIIA 1G67A 2E9MA 3ATYA 3W53A 1UBPC 1UC4A 1M03A 1UKPA 3SJ3A 4NNCA 3FLUA 4XAZA 1JCXA 3H2EA 3OGVA 4HMNA 4UNLA 1R3SA 3CQKA 1OCNA 2Y89A 3ZS4A 4AVOA 4JQ2A 1HJUA 3S5NA 4IGSA 4LF2A 3W74A 3IJDA 3LMZA 2WO5A 3AIVA 1DOSA 2OLSA 5D2XA 2WZMA 4LCRA 3RCMA 2RDUA 2E5DA 2V8ZA 3USBA 3V35A 3IPWA 1EBHA 1RK6A 4TR9A 4MNMA 2WVVA 2GGJA 2AAAA 1RUSA 2CNCA 3GXMA 1IWAA 4UQAA 4H6KA 1PUDA 3A9IA 3CMFA 3QR1A 1ZS2A 1QHZA 4ICCX 1R9ZA 4GYPA 1H60A 4JIPA 3G1HA 2CBVA 5LIKX 3RLHA 4CVUA 3GDBA 3ZT6A 5F4WA 3O1NA 2DZSA 2OTDA 1CXKA 2RDXA 4MNJA 5KZMA 4E5TA 3BQ5A 1KFWA 5HAOA 1JDFA 4DZIA 5D37A 4HJWA 4OGZA 1ADOA 3KZPA 1JNDA 1XLIA 2Z0IA 4WJ8A 1JRBA 1UD4A 5FJIA 5C9ZA 5KTLA 2HBXA 1SJAA 2DPEA 4I5XA 2YDQA 3T4CA 1U1UA 4KIRA 1JXKA 4PCTA 4GG9A 7TIMA 2PGEA 5C70A 5CLWA 2PBOA 2C19A 1LOSA 3BMVA 3W7JA 1ZLPA 4PH6A 3PSVA 1TV5A 3GBEA 3LHYA 2WNNA 3GG1A 2CEQA 2NQ9A 3EOLA 2GGHA 4OV4A 4NRSA 3EMZA 1TX2A 1GQIA 1THFD 3QHNA 4ATLA 1JCTA 1UH3A 3FW6A 1GOWA 3WNNA 1UP3A 1W3LA 4HPJA 4L64A 1BVNP 3RJYA 1XPGA 2P76A 3S2JA 3IJIA 4RV3A 3NQGA 2FPYA 3SR7A 3PPFA 3W38A 3RFAA 3CEPA 4PMRA 2DUZA 2PE4A 1LQ2A 1W1ZA 1S1PA 1V3HA 1W9DM 3PBGA 3L23A 3VUPA 1UKSA 4H9UA 2WJEA 4GBUA 3L67A 1EA0A 5KEZA 1YTKA 2NSXA 1KA9F 4MFDA 2E8ZA 4LS1A 3F7JA 4KERA 4AYSA 1G4EA 3GG7A 1UB3A 3ABSA 1KBJA 3BH4A 1E6RA 5ENLA 3L2LA 4QLKA 3TAKA 3BSMA 3UD6A 1UKOA 3W83A 2J9XA 4IX2A 2JBMA 1QI5A 2EPLX 2QV4A 3R7MA 1QOQA 1ITXA 4OBRA 3VNDA 5D9PA 2HVMA 3VAVA 2DFAA 1ZJAA 5A8PA 2JKPA 2E77A 4Q8OA 4ZENA 3SY1A 2CZFA 1JYWA 3MKKA 1WZLA 1Q6GA 3DFOA 1HL9A 1JI2A 3WLKX 4NX5A 1DXEA 4JTLA 5LNUA 1H09A 3MUY1 3LS9A 1ICQA 1BGGA 4JIRA 3ZJKA 4EWND 4C6MA 4DO7A 2R82A 1E0TA 4FNPA 4IP4A 3GWQA 4O1EA 1ZBKA 1K03A 1F8MA 5LHFA 3IVSA 1VCGA 2VC6A 5DBTA 1ADSA 2ZC1A 2A79A 3T6CA 4GKTA 1XIMA 3E0WA 1PKLA 3KOWA 3PB0A 1QNVA 4S3JA 4ZA0A 1KGWA 3NR0A 4JFVA 1AH3A 1V93A 3B0PA 4GQGA 3LXBA 4AUBA 1XIBA 1TE6A 3W7DA 4CD4A 4IFKB 1FWAC 5JIWA 1A5LC 2V9DA 3JU2A 1TZZA 3WLNA 3C5QA 3ABQA 2QMKA 4NG3A 3PAJA 3Q45A 3M07A 3PZUA 1F3XA 4N9CA 5CZTA 2BX7A 2VXNA 3S1VA 1R9YA 2C13A 1UPPA 3MCMA 1F6YA 1U1HA 4I7WA 4PTWA 3ZT5A 4OHQA 4A3YA 5G2WA 1IWPA 1VJZA 4F0RA 3W87A 2Q02A 1K8CA 1PX4A 3TIMA 1M68A 1BYAA 3TN4A 2DW6A 5FSDC 5BMXA 3JZEA 3TYCA 4JTCA 2YCEA 4PEKA 1Q5MA 3WK3A 1GKQA 2ISSA 3CGTA 1GVQA 3VNYA 2WMGA 1UZHA 3TJXA 4PEEA 1MDLA 4PFMA 4MAVA 1QNSA 5I3HA 3I68A 4EPEC 4HU3A 2QT3A 5A6LA 3M5ZA 3ANVA 2AAMA 3WLMA 2XZ7A 1GK8A 4A8IA 3E2QA 4IQEA 2ICSA 5LHEA 3IJ8A 4DBDA 2NWSA 4EACA 5CBBA 4U5IA 4HU0A 3AQUA 2VNCA 1QNRA 1D7FA 2A7PA 1EPVA 1W5QA 4QS6A 5LXXA 3H53A 2QAPA 2FH8A 4XZNX 1Q4WA 4IXXA 4HN4A 3WLQA 3ICJA 3WEOA 3WJSA 3DKLA 1B3YA 3GG0A 5HMDA 3RU6A 2O9TA 3V16A 2E8YA 3QLLA 1SW0A 3KBNA 5G1YA 3F5KA 3OLIA 1QMLA 4FNUA 4IGHA 2QR6A 2I17A 1Y7VA 1O68A 3P6LA 1FVPA 5HQEA 3OYZA 3TYDA 4H41A 4D6EA 4NNAA 3W81A 1FDJA 1ZBWA 3VNJA 1G6CA 3WQPA 3RG6A 3GNRA 3VVGA 4F0KA 3GH7A 4FI4A 1QFEA 2XVKA 3FV9A 3GQYA 1AVAA 3PBVA 1OEPA 4IT1A 1SFLA 3PUDA 2O9PA 2GVJA 4PUWA 3GD6A 4B3LA 2Y8VA 4HZ8A 1J79A 2ISVA 2QPUA 3KHJA 1U33A 3RYSA 5BRBA 1LL7A 1FWBC 4O54A 3VDBA 3UPMA 1KGXA 1H7OA 1I6NA 4IIHA 1XP3A 9XIAA 3TW7A 1QRQA 5H8PA 2XYLA 3VMPA 3BAWA 4IP5A 4C6FA 3BGAA 4GJIA 1KWGA 4JL1A 3T05A 1FY6A 3B8TA 1PHWA 5EGRA 3EA3A 2C1HA 2GQ3A 3VIGA 1R9XA 4Q7BA 1F4AA 1Z3NA 4Y9AA 3D5HA 3AZRA 4AZIA 3CEUA 2W63A 3FJLA 3OVRA 3B8VA 3H2MA 4V27A 2ZRYA 2ABBA 2FMOA 1ZJBA 4O8AA 1F61A 3M41A 1K9FA 3KS5A 4S3KA 3L4ZA 1IXQA 3H4WA 2YXGA 5I00A 2Z28A 3HTWA 1VGAA 1J2BA 4L1XA 4K6AA 3EPMA 4XKYB 1RK5A 1VR6A 1FQ0A 3RJXA 4HP5A 4C7FA 3ITVA 3AS1A 3JRKA 1B30A 1DWJM 1GJUA 4H6EA 1I60A 2TPSA 3NIYA 4BKNA 3L4YA 3P80A 1OGBA 3A3XA 1RPXA 5DRCA 1IYXA 5DANA 4DF1A 1SR0A 1FKXA 4TVDA 4QXIA 4RW3A 4GFIA 4M81A 3MBFA 1OT2A 2PDCA 3OGRA 1PDYA 2XVGA 1W37A 1UWUA 2VGBA 2BY3A 4FIQA 2O92A 4J3UA 3LGGA 1E4MM 1MRQA 4X2RA 3NOEA 1FWSA 3FHAA 2NV1A 4R3UA 3MUAA 3UWWA 3GHRA 3KTSA 5HQLA 4NL1A 2NVAA 3N11A 3WLJA 2NUWA 4AY1A 1ZHAA 1PXGA 5LIUX 1EHNA 1ONWA 1XQKA 3C0LA 4I8DA 1Q2SA 3SCNA 1FHVA 3KS6A 1AW1A 4DZAA 1XBXA 4IUGA 1QPOA 2ZUSA 4LWWA 1XLKA 1K3UA 3PM6A 1ITQA 3W7EA 1FTXA 4U2ZA 2D0FA 2Z1WA 4AEOA 1TIWA 3ZSSA 4XTDA 1VBUA 1JDAA 3BLDA 3UEQA 5KITA 3GY1A 2NXGA 4HNLA 4TV6A 3UXIA 1EJ7L 1UQYA 4UOZA 1UD2A 1Q6CA 2VEMA 4QLLA 1SZRA 3FHQA 4DI9A 3VDHA 2NUXA 4V33A 1IZCA 5E1QA 1ESWA 3EMCA 4KFOA 2WHJA 3TYEA 1TFVA 3M0XA 5AHLA 1SYTA 3T08A 3VM5A 5BXPA 4XV0A 2I56A 2QCDA 3UXAA 3N18A 2Z25A 4GNVA 1PB0A 3W2JA 2J8FA 3ORWA 1VLIA 5FL0A 3SO7A 3IV8A 2WM1A 3DHFA 4A3HA 1KCKA 4FP1A 3MCOA 3L2MA 3E0IA 1LUCB 4ZXOA 1YKWA 2CKRA 1O95A 2CITA 5FEPA 1B57A 3GIQA 1JZ2A 2XH7A 4QAIA 4DNMA 5D8WA 4J3ZA 5C9RA 1OQFA 3E2VA 3GUWA 2DY3A 2P1FA 2IW0A 3DG3A 1Z44A 2HSAA 4BA0A 2OLAA 4KEVA 2J8TA 4QSFA 5EMMA 4DBEA 1JG9A 3E5BA 1CX9A 1UR9A 1KM4A 5EU9A 2BY1A 4Y9MA 2WCAA 3R0DA 5I2UA 1N8IA 3H12A 3BAIA 5MKGA 2NLYA 1VAHA 1TX0A 1UJQA 1NQKA 4WEVX 1G01A 1TPB1 5AB3A 3OA3A 2YCIX 3TWAA 1BYCA 1CCWB 1B3VA 3BQ6A 3CK5A 3UCQA 2ZUUA 5AHFA 1H1ZA 4H8NA 3FYYA 3N6JA 3DGBA 3I3DA 1B3WA 4P8UA 5A6MA 3UR2A 2TMDA 2PDBA 3DC8A 1I0DA 3CBWA 2VFFA 1A49A 1V0KA 4AX7A 1ZY9A 3HGRA 2QGHA 3EDEA 4QISA 2MANA 3UZXA 3G22A 3CTLA 1XCFA 2F9RA 3L66A 4CN6A 1VPYA 1Q6QA 3HM7A 4NI8A 1KM1A 3NZRA 2YOCA 2NQ5A 4WZHA 1G9HA 3ZR4A 4OWGA 4XG1A 4MMWA 3NQ2A 4XISA 3MPGA 3UP8A 2WMKA 3TX9A 1MFUA 3NO3A 3MJYA 3M5YA 1EP1A 3WD3A 1I8JA 1HL2A 1DWIM 2Q8XA 3BZGA 8XIMA 4A2RA 4H3DA 1CZ1A 2SFPA 1Q6OA 4YHEA 1TB3A 3RM8A 1O7AA 2E7FA 1E51A 1U1JA 4M3PA 4I5RA 2DJXA 1J0JA 2GVEA 2Z6IA 4GMEA 1GVIA 4F66A 4LVDA 3AS3A 1E0WA 2OYLA 3GTHA 2R91A 1JD7A 3EX3A 4MWAE 4UZUA 3PZ9A 3BMXA 4A8RA 1RALA 2PU1A 3SGUA 3VD4A 1UH4A 1DJXA 3ZR5A 3LY0A 1VFHA 4HCDA 3LZ3A 1RP9A 4KWWA 3HV8A 2R1PA 4WHBA 3UA3A 1HKJA 3CIVA 4QTGA 2OSXA 4BJHA 3ALFA 5T9CE 5A6SA 3FAXA 4NSBA 5FA5A 4J2MA 3GDRA 1JGIA 3WQ8A 2NQZA 4JS3A 4XSLA 1SJDA 3BVJA 3N4FA 1Q7QA 4AXKA 3KRZA 2F6KA 1R87A 3QV8A 3T2QA 1A5BA 4ZE5A 2J27A 2WPGA 4G7EA 1WDPA 4ASTA 4O4VA 4QR6A 4IPLA 4BF7A 3A12A 1XLLA 1A5UA 3R12A 3WDRA 4DX3A 2V2CA 1LF1A 3D46A 3VIHA 1P6BA 5D9NA 1Z32X 2AMXA 1AD1A 3QFEA 4AZCB 3REQB 1OG0A 1OINA 4UMCA 2NV2A 3UJ2A 3AHZA 1H1YA 4HU4A 1QI3A 2VCCA 5FKYA 2G5WA 4HSOA 1WOAA 1MEWA 3UWQA 1CW2A 1I2RA 4HK7A 4C1NA 3AYVA 3C2RA 3NCOA 2C71A 4RDZA 3WUBA 3VGEA 5EMJA 4F48A 2DVUA 2VFIA 4PMJA 3KX6A 2QDDA 1EP2A 3A23A 1W3NA 3A64A 4CCEA 4ZGYA 3N15A 1H5VA 3VKCA 5CJNA 4LAMA 3M6DA 1FCVA 4IIGA 1LRNA 4DJFC 1BWLA 3G0UA 1HFBA 3V0SA 2CXEA 3L12A 5CJMA 5RUBA 3TFCA 4C5YA 3ZR6A 3HPSA 3FK4A 3KOXA 3BLLA 4DO6A 4YWSA 3CMGA 3W7OA 3MSRA 4LYPA 3WF0A 2ACUA 4LEQA 1JCYA 1UUOA 1BWVA 5EBUA 2ZZ2A 4JEQA 1SVDA 1SMAA 3O07A 5CBJA 3BL3A 1BRLA 3HG2A 4JNZA 1W2VA 2WZEA 2W91A 1XCXA 1R6WA 2HS6A 4AVNA 2EJ1A 5CBIA 3IEBA 4LVGA 2PDGA 1BPLB 2XFYA 4O1BA 4I9AA 3RUBL 1B3ZA 5D8ZA 3P93A 3QM3A 5AYIA 4R34A 1GKRA 3UZZA 5AYXA 3UNTA 3PUOA 2XVPA 3V3WA 3LPFA 3HQNA 3T4WA 3DYPA 3VK5A 3APTA 4J4KA 2JIWA 4NJJA 2I7GA 3B0UX 4JR5A 4LBRA 3WLHA 3AIWA 2OT0A 4W86A 4G6CA 5HULA 3CM4A 1CENA 3F4WA 3C3NA 3QEZA 3VDCA 4D8ZA 3LXAA 4JTDA 1K7XA 2RHGA 4AZBA 1A5CA 3SDOA 3U2EA 4XAFA 2OODA 3A3WA 2WLYA 2HISA 2NX3A 3GH4A 2ESCA 4MDOA 3S4TA 2J6VA 1V3MA 1V79A 3C2OA 3H2CA 3PBWA 2PU0A 4MG4A 1PWLA 4D2JA 2AKZA 3QXBA 1TPUA 4YVVA 1DTUA 2YW3A 4ENLA 1I1XA 3RLUA 4Z2HA 2FMNA 2V6AA 2EAWA 2R24A 5FJTA 4NX0A 5CZKA 3WENA 5D09A 3DZ1A 3JS3A 3RITA 2VKZG 1ZBVA 1FFQA 1C8XA 4IOTA 3IAPA 4AH7A 5C55A 4BEUA 3V4BA 1XM3A 5L6UA 4CD5A 3LPGA 3MSGA 4ORIA 3EPNA 5LNVA 1OK4A 1WUFA 2FZDA 2NW0A 3S2LA 1QOXA 5HMSA 2YFNA 1DE5A 3E49A 4XZMX 4JTKA 2IKGA 1W9UA 4TX6A 3CAWA 1SO5A 1J5SA 4M51A 3OQEA 4L4LA 1DXIA 1E73M 3VYLA 2Y1HA 1MW0A 5GJMA 1PV8A 1OJXA 5DCEA 2VRQA 4QRNA 4IMFA 3QY6A 1A0DA 3OP2A 1TCMA 1N7KA 1E4IA 1PCWA 3GU1A 2OYMA 4H7CA 1EP3A 1CGWA 3O8AA 2VMFA 1UIOA 2GJPA 2YCLA 2YBTA 4WXYA 3W73A 3W1QA 4NXSA 3EOEA 2HPIA 2P3ZA 1EJXC 1R3VA 4TX8A 3SBFA 3NPWA 4LAKA 4C6DA 1EYWA 1PAMA 2GVLA 2UY4A 4UR8A 3WNLA 1V02A 2ZUWA 4JX4A 4PSPA 4Y9NA 3N3MA 3MO7A 4EPKA 2ATMA 5BRPA 2OZ3A 4N42A 3R2GA 3WDJA 3CH9A 3SCWA 3UFYA 3TW6A 4A21A 3GTIA 4F0HA 3EMQA 3GFZA 2DZUA 3LRKA 2DZAA 4UFHA 4IMDA 4L1WA 3LOTA 2J8GA 3DHDA 3W7QA 1AMKA 4MKVA 2Z2UA 3GNPA 1XYBA 1LWHA 3OHIA 4EAMA 2ZWYA 5BYWA 3EXSA 2EHHA 1OM0A 4D1IA 2GDQA 4K7YA 1XDMA 3EA1A 4GGHA 1R30A 1OX4A 1K4GA 1G4TA 1JAEA 3LCLA 3W88A 2V5LA 4A29A 1DJWA 4Y8EA 3MMUA 3I6TA 2OZ0A 4GYKA 4AISA 4NP7A 1QXLA 3GYEA 2GYIA 4F40A 3CIXA 1B9ZA 2Y7GA 4R7WA 3T44A 1IE7C 5A6AA 1AQ0A 5HATA 3N12A 4I6KA 4IFRA 4EXBA 2NX1A 1YMYA 1AQHA 3WBEA 5F7UA 3QGVA 3VNMA 3S9YA 2OQHA 3FS2A 4Y96A 1TVNA 1CGYA 1KXHA 4L6OA 3V0TA 3HOJA 3AS2A 2HK1A 3DBPA 3ZVHA 1J5TA 4JKMA 1EC8A 1V3JA 3P74A 1IHIA 4AEEA 1VC4A 4JAWA 4GY1A 1M01A 5E5CA 4MDPA 2ZRXA 4FNSA 4B2DA 2X2GA 3DFTA 4K39A 5A2AA 3MBDA 3U5YA 3H21A 3QQ0A 4UQEA 1V8EA 1YPFA 4R53A 3U4FA 1FH8A 3SQMA 2VC7A 4LYKA 1H7RA 1EUAA 3MUCA 1W32A 1W0MA 1PEZA 4RZ6A 4J3VA 2GFTA 4RZBA 3QZAA 5IHRA 1VF8A 3GFYA 4WY0B 4ZFCA 1LT8A 3M1ZA 3WO8A 3VKJA 1X1ZA 1XIIA 1EGZA 3ENLA 1XJBA 2VRKA 1E0XA 2WBGA 3CUZA 2IMRA 5GNZA 3QTGA 4JY8A 1HVXA 1Q3NA 4BEQA 1TMHA 4LV4A 1TV2A 1P1MA 3BJFA 2GJXB 2BVYA 1AQFA 4O10A 1XF0A 3QRHA 4MZ1A 3BARA 3EAUA 4L4PA 1TJ0A 5HR6A 1S5TA 1A5MC 4O8RA 3WD4A 1C7TA 3A9BA 4KPLA 1A47A 1Y5XA 3I6RA 3OG2A 4XB3A 2OKTA 2PDQA 1CB7B 4IPNB 3EWYA 4N9EA 1PPIA 1QUMA 1VZWA 2GVYA 3N2CA 1EZ2A 5HANA 4E4UA 3B04A 3TW9A 4XZWA 2RFGA 3TK7A 4K68A 4FALA 3AXIA 3GUGA 2ZBTA 1C8QA 1DL3A 2DJLA 1QPQA 5H8UA 4XSMA 2YL8A 1X7FA 3G5EA 2E5BA 3TR2A 2ODOA 1EC7A 5LKYA 4KMQA 1FWGC 2X8RA 4AMAA 2GWGA 4NZ5A 4ACYA 3HQPA 3W1UA 8A3HA 4XVDA 2WC7A 4IIDA 3PWGA 1PE1A 5CKSA 2YW4A 4NKCA 4B5WA 3LBCA 1TA3B 3WF1A 4JTJA 3P0WA 4CQ9A 4WKAA 1LBLA 1V0LA 3VMOA 2JALA 3DI1A 3IRSA 2A6LA 1SR9A 2VELA 5FIPA 2CKSA 8TIMA 3CHFA 4H83A 4B3ZA 1XICA 3HFYA 2YCLB 1UC5A 4UCGA 4F2TA 3RRXA 4DM2A 1CTNA 1QW9A 2YR1A 2V81A 1W1B1 3CV6A 2YDRA 3BURA 2BV9A 3GZ3A 2HS8A 3IANA 3SURA 4ZFMA 3M43A 1K6WA 3MP3A 1OF8A 3LNMA 4G5DA 1REQB 5CAKA 4AAJA 3H23A 1EC9A 4L4OA 4QE4A 4Z42C 2PSNA 1DWAM 2Z6JA 2OCZA 3TTYA 2QCMA 3VD7A 1J12A 2OG9A 3Q58A 2PP3A 2GPTA 1D2KA 4E6MA 2XSBA 1GYNA 2EXOA 4PFHA 3THDA 5KZDA 1JDCA 3N34A 3PG8A 3F2BA 4IISA 4V2XA 5DT7A 3SGZA 4ZZ9A 1HJWA 3W72A 3MWCA 4HJFA 2O4MA 4X0NA 3CZ8A 4E2OA 1I2QA 2OEMA 1PJ9A 4GCAA 3SRDA 3GK0A 4JL2A 4XAGA 4H9YA 4N7QA 3CQHA 4Q8QA 3B0VC 2RJGA 4PCPA 1P0EA 3QBUA 5D32A 2G50A 5C71A 3O6YX 3T0BA 4P7LA 3R0KA 5HNRA 1KWKA 3W2UA 5EMKA 3QGAC 3P0XA 4Y2WA 3NM3A 1JZ6A 3M0MA 3F4DA 4K7VA 3RIKA 3HO8A 1IEQA 3E2SA 3WNPA 4G1NA 2Z7GA 4PULA 3MQTA 3CPUA 4Q4PA 2BSLA 3O7UA 2WK2A 2YCKX 4GZIA 4S1FA 4A8NA 1QW8A 4P8WA 5D30A 3SGGA 4QNEA 2G3NA 2YL5A 4H6QA 3WJZA 3C8NA 5BZAA 3B8UA 4HTBA 5ABTA 3EDDA 4FO4A 2ZX8A 1Q66A 2OX4A 2CERA 2NXHA 2VR5A 4O12A 1TPDA 4OT7A 1UKQA 3TTOA 3SB0A 4ZOAA 4WOQA 4AWEA 1XBZA 4ACZB 4IFKA 5A2BA 3CAQA 3QW4B 1Z7AA 2WQPA 3BCJA 3PUGA 1H7WA 4YIWA 3FA5A 1L6WA 2EG7A 4Q33A 1AL7A 3RM9A 4BQ2A 3MYOA 3UG3A 3S5YA 5M03A 4JYFA 5KZEA 3QVQA 2A4AA 2ONEA 1OFBA 3A3HA 1XH0A 2A1YA 8CGTA 1UWQA 3VKDA 1WP6A 1OY0A 5LGXA 2WMFA 4GUIA 3EDJA 3OZPA 4FAMA 3A6OA 3TU9A 4AVFA 5HWMA 1TZ9A 1WXYA 1H1NA 1IR1A 2VM8A 1F3TA 4FX8A 1WV2A 1OCBA 3NEVA 4Q7IA 4S3GA 2CESA 3LPPA 3XISA 1TPFA 2FPVA 3MYPA 4U28A 1S2AA 3EWXA 1ZJIA 1K9DA 1OFDA 4PRWA 2FZNA 2OELA 3WFAA 2OO0A 3B05A 4P7QA 3F4NA 2INEA 5BWAA 3NTYA 1KR1A 4JPGA 4NYYA 5FAGA 2HROA 2BWGA 4OKDA 1KM3A 2FVMA 4F9JA 4LB3A 2DQWA 3M0HA 3OZYA 1Z89A 1DJQA 4TO8A 3ZSTA 2RDTA 1FWIC 1WDRA 3G3MA 3SCUA 4P8VA 4WIWA 4C6IA 1H49A 2ZXQA 2DT0A 4JN8A 3TSBA 4XTIA 1IZJA 5LNRA 5C5YA 4GO9A 4HPGA 5D38A 1UUQA 4S2BA 4Z0JA 1QR7A 4ERAA 4M80A 2J79A 1R47A 2W92A 1ICSA 1RJPA 4C5ZA 3S1UA 1US3A 2Q01A 1EBGA 2G97A 1NDZA 4U3CA 5GJPA 3K8LA 3Q65A 4QIUA 1CPUA 3KTCA 4PMQA 3NJ3A 3CHVA 3SM0A 1PTDA 1FCUA 3QY8A 1LCOA 3ZLFA 3CIWA 4AU0A 3M0ZA 1OSEA 1KCXA 1SW3A 3GDTA 4IIFA 3U7VA 5XINA 1DBTA 3TLQA 2X7VA 3N9SA 1FWRA 4QQ3A 1IIGA 5TAOA 2CLOA 3H7RA 3R8HA 4YNGA 4PE8A 2O9OA 1B31A 1QK2A 3U8GA 3VIOA 1BYBA 1GNXA 3W27A 3WH8A 4QCFA 2CPUA 4Q4KA 3VKAA 4RL3A 1NSJA 4KKXA 2X1RA 3LB0A 3TAOA 3RR1A 3IACA 2HE5A 3DYOA 1A4MA 1HKVA 3IGSA 3CLMA 4N9DA 2ZZ7A 3BE7A 4QLJA 4GISA 2QUTA 4B4FA 2VVSA 2JEPA 3KL5A 3HF3A 3BXWA 4HK6A 1W2PA 4ZBCA 2X0SA 2EQDA 1BF6A 5G4EA 1Z42A 2IQTA 4OOZA 4ZO9A 1OYCA 4LUTB 4GD0A 4QJ1A 3IUDA 2C91A 5DY3A 4DJFD 4D8LA 1GKPA 1DIKA 5TF0A 4DYEA 2JK2A 5K2ZA 2BXYA 2OX1A 4UNIA 2PUZA 1K4HA 2DIKA 4NZJA 3VINA 1VRDA 3P14A 2XZ9A 1Y8BA 4HA4A 1C8YA 2IKIA 4DUOA 1C3FA 4CCZA 1VHNA 5CC7A 2Z27A 1LG1A 2Y7DA 3EKLA 1XW8A 4GIYA 3SCOA 3LQGA 3FYPA 4DBWA 2ABAA 4UTMA 3CUJA 3XINA 4Z2JA 1EJTC 5IRPA 1RBAA 3BLPX 3VKKA 2CZDA 1HJSA 4IH3A 2AL1A 3SQSA 4LVAA 1Q65A 3WDPP 4RW5A 2JQXA 1W31A 3TONA 2FZ8A 2HMCA 3V0UA 4B16A 2WKLA 2C1IA 2J7CA 4ONVA 1N82A 3TYBA 3C2YA 1VHCA 1LLOA 4RNFA 1ISZA 3C61A 2ZYFA 3RF9A 1BHGA 2GLKA 3JR2A 1VRXA 2Y5SA 3DFHA 2PD9A 3FA4A 1VFTA 3S83A 3SCTA 4L5ZA 3MKVA 4KEUA 3TNOA 4JICA 4NAEB 4OFCA 4REQA 5I02A 1HX0A 1XLMA 3PFRA 4PB3A 1Q13A 1DJGA 1JYXA 2RGLA 5KSWA 3VNLA 3PVFA 3WDQA 1JAKA 2ZUVA 5C2XA 1Q85A 4U33A 2IKHA 4WY0F 5FF4A 4O11A 4O1AA 1W56A 4GK8A 4QJ3B 4TUFA 1B2YA 3CTTA 1N8WA 4EE9A 3CB8A 1J96A 4YTTA 2G41A 1WYIA 2PC8A 3CV1A 1OFRA 2GQ8A 3PULA 1HGWA 3NQ6A 1SZEA 4IMEA 5HJLA 3T7VA 1M7XA 3APGA 5F1UA 4BCEA 1TELA 2YXOA 4MHBA 5H6HA 1PS9A 3F4CA 1PHQA 4JBRA 2CLKA 2VQTA 1E40A 3CS2A 4ZODA 1D3CA 3NFUA 4XK2A 2VRJA 2OGYA 3GXIA 4JTQA 5GQBA 5IDIA 3GXFA 3KBMA 3QV7A 5HOSA 1M04A 3VD3A 2CBIA 3BAKA 2QV5A 1IXNA 4MJ4A 1E0UA 2DUXA 1VBHA 3CWNA 1EIXA 3GDLA 1I4NA 5EMUA 4S3FA 2VEFA 3WD1A 5DFAA 2AGKA 3NPUA 5CG7A 4AMCA 5BNKA 2RUSA 4FF7A 3QTPA 1C8VA 4JIQA 3SY5A 3UCCA 4ACZA 2PS2A 1A5AA 4ATDA 1FWFC 1G0CA 3OLGA 2VYOA 2PI6A 2FQIA 1JNEA 4OUEA 4U10A 2W61A 4IFOA 4FK9A 1D9EA 4C6EA 1WDSA 4J3TA 3CZJA 2YL6A 1O6IA 3TQKA 3LA4A 5F2IA 2D3NA 5E09A 1YYAA 1RQHA 1AUSL 4GE8A 1EOKA 1R2RA 5CGQA 3G6MA 4FA3A 1OFEA 1U5HA 3ZZ1A 1UR8A 1E5NA 2PZNA 5C7HA 2V2DA 2GJXA 4TX9A 3SUWA 5I3JA 5D4YA 2Y7FA 1AD4A 3SIMA 1F5ZA 1X8CA 3AIEA 1EX1A 3NYZA 4W89A 3VC6A 3WD2A 1UWIA 4UOQA 3FIGA 5HBFA 2Y63A 1W1PA 1PZ3A 4S23A 4M7SA 4F2BA 4UTWA 3GTFA 1ZCCA 1DIDA 1KRCC 5BOOA 3TC3A 3EBVA 1JR1A 2H9AA 3O63A 4KWSA 1IR2A 1GT8A 4MPQA 1KD0A 4BWLC 1CGXA 2E5CA 4Z2GA 1FBAA 1P48A 1BD0A 1KW1A 1RCXB 3UU0A 4G1KA 4LV9A 2DZBA 2Y61A 1FA2A 1BRLB 3LCIA 4UFKA 3GX9A 2PLJA 4XBJA 1E9LA 3O06A 1ZP3A 3F2CA 2ASHA 4LFYA 1WKYA 2TYSA 2VOTA 1P7TB 3U57A 3W1LA 1A3WA 1BVWA 5FJRA 4NXKA 4MY1A 5E6ZA 4F0MA 5BU6A 3R25A 2PTWA 3S2CA 2VEPA 2Z24A 1T8XA 2I57A 3CXOA 5JMUA 3BG9A 1ICPA 3R0UA 3VIFA 4A2SA 4TVCA 3C8FA 3BV4A 1Q6EA 4N6EA 3K13A 4LYQA 5DY2A 4U31A 1E15A 3CZGA 2WHKA 2QMJA 3G8EA 5A3HA 3Q67A 1LBMA 4MOZA 5FSEC 3RPMA 1AJ2A 2OKOA 2XTKA 3M64A 4AWTA 4TTGA 3MS8A 4I9MA 4LNYA 2CLLA 1T99A 1OD0A 2UBPC 2TRSA 5ECUA 3ATZA 3TLLA 3EB3A 5K9XA 4XZHA 3HGOA 5D2VA 1RA0A 4JQ4A 4UQCA 3KE0A 3UBPC 3AC0A 3TEVA 1OIFA 2R94A 5C9UA 5C9XA 1SJCA 5XIMA 4AY8A 4R7JA 1X6LA 1MQRA 3BUVA 5ABFA 3QV9A 3Q2DA 1GZ1A 1F6PA 5EYWA 2R9RA 5I78A 1NTHA 1GOQA 3PC0A 4WVXA 1A53A 1ECQA 1ZSXA 1CEOA 3TOYA 1J2WA 5K4XA 1ISXA 3H7VA 3I65A 3CLWA 3SCPA 2BS9A 3ZVIA 3ITCA 3AHVA 4MB4A 4C6PA 3D0CA 3QOMA 4DVOA 3ZT7A 3VUSA 1XPYA 3T0CA 4CD6A 3W6LA 2ZFAA 3QQ1A 4GINA 3HPAA 4LAUA 3FY1A 4QDMA 2GJNA 4J3WA 3KOZA 3PP7A 2XM2A 4ZE4A 2QIIA 2JE8A 1VB9A 1MUMA 5KETA 2ZTKA 3N73A 4AD1A 5LA0A 1XSKA 2E9BA 4HB7A 4MWAD 2DIEA 3NQFA 2X41A 1XRVA 1M3UA 4JOMA 3WFZA 2ZUMA 5T91A 1DP0A 4MNKA 2QDEA 3AHYA 1T0OA 4Z1YA 1KM0A 3GXTA 2VL4A 3C4UA 3RCYA 3HA1A 4DJDD 3VO0A 2CIPA 3C0SA 4O4WA 3OIXA 4HYVA 2BOEX 2BNJA 4DWDA 3LMYA 2FH6A 1WX0A 4US5D 1ZBCA 4FXRA 4O19A 1GOKA 4HA0A 4LC8A 3RU8X 3ZWTA 1E1CB 1R3YA 5IBXA 1YE4A 1AODA 4CUCA 4O0KA 2QVNA 1GQNA 5KINA 3TSMA 1XKJA 4LGXA 1R0MA 4QROA 1XRFA 2VX5A 2X2YA 1BXBA 2JGQA 3KCOA 1WPCA 2OYKA 2WZHA 1P4CA 2XIMA 3H2OA 1GOOA 5DCBA 4IWWA 2HVNA 4WR3A 3B8WA 2WJFA 2GDVA 4PL1A 3IJ6A 4HSNA 1WCGA 1POKA 3S2NA 3EWUA 4XVEA 1XGEA 2GL5A 1XLEA 2C15A 3KUMA 5G1TA 3N9RA 4NVTA 1KO0A 4UFLA 4RDWA 5FOOA 4RE2A 1BG4A 2AQWA 3CUFA 4IIBA 5GVJA 3NQDA 1XYFA 2FTYA 4NRRA 2OSYA 1V6XA 4MY9A 1QASA 3MMWA 3M44A 4UNKA 2J62A 2QS8A 5I06A 4NJIA 5AHIA 4HNTA 4D6IA 1PIGA 4P61A 3EOSA 2XFRA 1S5MA 4AW7A 1BAGA 4QITA 3ARQA 3W1AA 5EMYA 4G7EB 3WJYA 4GUGA 3T0DA 1JPMA 3WQWA 1MW1A 2HTMA 3KLKA 2ALDA 2E4TA 4ZSUA 3RGTA 3TQ0A 4UMAA 2WVVB 3TMLA 2PD5A 4QE1A 4PRRA 3ARSA 4UTTC 1PZ0A 3GKAA 3B9NA 3MA8A 4WD0A 3W2MA 3M0IA 3HURA 2NT1A 2WCGA 3H22A 4HMDA 5JQ9A 1F4HA 3UVIA 1PX3A 1JPHA 1H51A 2VCAA 2VCBA 4JYDA 3I7SA 1DXFA 3AHXA 4M0XA 1MQQA 5A8MA 5AHMA 3NL2A 4AHPA 1XDLA 2F6XA 3KP1A 3NNTA 3I4EA 3WUGA 4Q8UA 2BHZA 2PB1A 1EYEA 3KTXA 5A6KA 4PMXA 3OTRA 4MJZA 3FKRA 2J7GA 3ZLGA 5C8BB 1H0GA 3FCPA 4UTIA 3BOFA 1K7FA 1AH4A 3W86A 1QI2A 1RHCA 2GOUA 4IL2A 2FFIA 2VGIA 1PCKA 3KDNA 4V1XA 3VIKA 2VWSA 1X38A 3EEGA 1EA9C 4P2VA 3T40A 3OGSA 1WDDA 2QCHA 4FOJA 2F61A 2GUUA 1K9TA 3EYPA 1UD8A 2XINA 4MZ8A 2Q8ZA 2E9LA 3WQFA 3C2VA 2Y5EA 3LCFA 2QPSA 2ZX9A 4JTGA 3H2FA 4WDTA 3R94A 3V18A 2OWCA 1LLZA 3UXKA 3SCSA 2POTA 2DGAA 3LRLA 1CXLA 4JYEA 1X97A 4AX6A 3ELFA 2D2GA 4LH8A 2PDHA 3QMRA 3OOQA 2ZA3A 4AZCA 4LJ3A 2B0MA 4JQ3A 3TN5A 1RA5A 4GJ1A 5I79A 4CNTA 4KWOA 3MKCA 2QQ6A 2TAAA 2QJGA 4QAWA 1TREA 3O2LA 4JKLA 5U4NA 4HOXA 3GTXA 3G24A 3OZMA 3ARXA 3BG5A 4F2UA 3LGEA 2CU0A 3R43A 2R1KA 5AYYA 4WF7A 1I2OA 4G2DA 4LPCA 4Q4OA 5A5WA 3W37A 3VFLA 4WKHA 2BY2A 2WJDA 2CCRA 1RD5A 4Y9OA 4C6BA 1BF2A 4PMOA 3UT0A 3GXNA 1JDDA 4GBDA 2IS7A 4PSRA 1WUEA 1Y0EA 4O13A 4R9XA 4FPSA 3QLDA 1J0IA 5CJ5A 3RPDA 3GR7A 1E71M 1HN1A 1QCWA 2QNEA 5LXEA 3TR9A 1XYCA 4MJMA 4HHLA 1EDGA 1LM1A 3QW3A 3IV3A 4AY7A 5HINA 1YDVA 3TDFA 1CNVA 2PFHA 3TJ4A 1MWOA 3PPGA 4ZTXA 4GNKB 3SN4A 2OO6A 2WKGA 2JGYA 2WBKA 2OGJA 2ZKMX 1ENUA 1FWDC 2H6RA 1QWKA 4E8CA 3IVTA 1DKWA 3A4JA 1TO3A 2PWUA 3OG3A 1KCLA 4W9TA 3AHTA 1OBAA 1R3RA 4GUJA 1Y5WA 2V5KA 2Y88A 9XIMA 2QF8A 3OO2A 5E9AA 1YBQB 5C2CA 4WLCA 1ODZA 1XYAA 3V5FA 2HV5A 2PGRA 3VGHA 5HWJA 3GRIA 1QBAA 5AY7A 3K5XA 2Z2AA 3ITLA 3CL6A 1KFJA 1R7OA 3SAZA 4DRSA 3U5UA 1K1DA 2Z2BA 4OVXA 3UR7A 2Y2WA 2ZC8A 2A3EA 1X96A 1YXDA 3M47A 3CZEA 3VCNA 1BTMA 3E96A 2XHYA 5MHBA 1E6NA 4K38A 3WEMA 4A22A 5DXXA 4Z17A 4UTFA 5BOEA 3EX4A 3QMTA 4V15A 3BJSA 4JGDA 3IGUA 1TJ1A 2Y24A 5JBFA 4KESA 5AHEA 1UQZA 3SSZA 5AC4A 1B5TA 2JIEA 2YA0A 4WDXA 1XRSA 3O6AA 4X3ZA 4C65A 1SSDA 4C90A 3G1SA 3MV01 1OCJA 4FOUA 4NAFB 2DT3A 1XLFA 3TA6A 4ML4A 4ORMA 4IMGA 3AIBA 4WKFA 3XIMA 1BGAA 1XSJA 3W01A 1NOUA 1J4EA 2TODA 1NJJA 3LV6A 2PWGA 5HDRA 3R5EA 5LYRA 4RNJA 4RXGA 1PKNA 2ISDA 3B8SA 2B81A 4TOQA 4JQ1A 2VZUA 3KCLA 5T9BG 1ZP4A 3B40A 1UIPA 3C2EA 5HK4A 3G0SA 2OWWA 2X0HA 2YYTA 3CV2A 3VU2A 2XSXA 2AMGA 2NUYA 1F73A 4MLJA 2VOMA 3NO1A 4DHGA 1V0NA 1M5WA 3VPLA 3CU2A 2BG5A 2QCEA 2H90A 1ITUA 1NDYA 3TCEA 1ZFJA 1BXNA 1UBSA 3LHVA 2PODA 1XG3A 2ZA1A 4UR7A 5E0KA 1FDYA 1WKEA 1JJKA 4HTYA 3VDAA 1LYXA 5DMLA 5HMFA 1IEXA 1ML1A 4GUFA 3HBLA 4JN7A 1Z6KA 3RDKA 2O9RA 3HIJA 4PUNA 3W7NA 2ZZ4A 4JDYA 1VCVA 2OQLA 3QOKA 4LVFA 3N04A 5CGMA 4AHOA 1M53A 3W6YA 3EKGA 2Z4GA 1IEWA 3OVGA 2VEKA 5HWNA 4BI7A 3T1GA 4FLRA 1V03A 4JY9A 4R85A 5DN1A 1VS1A 5LIYX 3GC2A 3GVVA 2QKFA 2C18A 4DO5A 3PTMA 4HPNA 3HV9A 4MPKA 1IXPA 4HK5A 1L6GA 4Y6GA 3WELA 4ADSA 3ZYZA 1RD6A 1J6PA 3TTSA 4H2CA 3H4GA 5DQPA 4KW2A 2J88A 3BTNA 4UTWC 5FESA 2Z1VA 4IJCA 1OGSA 1SFTA 3VCRA 1OFQA 2VI0A 5C9WA 1HL8A 4JCMA 1SZGA 2XM1A 5CSRA 4OTKA 1S5VA 2DVTA 5I7GA 3EPOA 1U5JA 2XGZA 1FH9A 3BCDA 2FIQA 1IT7A 4S3EA 4EOUA 3LXCA 3W1RA 1WE5A 3NUKA 1CYGA 1M9HA 3C52A 1EJRC 4RZ5A 2WSYA 3V75A 2QGYA 4E3TA 1TTPA 2IUZA 4EANA 1VKFA 1OHLA 3SCVA 3W4RA 4K1GA 1SQ7A 4HCHA 3M5XA 4AZ7A 5M17A 4EXQA 2QUNA 4JN6A 3GBDA 3HB9A 4GXWA 3LHZA 4GACA 1TSIA 3TZFA 3IARA 1V02E 1S2CA 4PTXA 4NQ1A 2HXTA 4Q3MA 3AYSA 1V6VA 2Y8UA 1YDYA 2XUCA 5A6TC 3T07A 1HXJA 2PBGA 1V6TA 4GQBA 3PTQA 3BSHA 4UOJA 3AISA 5JBDA 5GNYA 4ZQMA 1H61A 3G2GA 2CC0A 4N4QA 2D0GA 1RJRA 4Q6XA 2ZXAA 4KCVA 1TV3A 4O0ZA 3A5VA 4PR4A 1T7LA 4L4MA 1L9WA 3VNZA 2IQDA 2OXNA 3MU7A 2VX4A 4ICNA 1YNYA 3DDMA 1OC5A 2PF8A 3WLLA 4LNCA 4RX0A 4B2DD 3SUUA 3WL0A 2DZVA 1UZ4A 3QPZA 4Q4MA 3NQAA 3QF0A 1DJIA 5CQ1A 1OG6A 3BMWA 4I7UA 3DIPA 3FGCB 4LY8A 4UTKA 2Y8KA 4EAYA 2B31A 6XIMA 1ZU8A 2DSKA 1QPRA 1ZAIA 4OQVA 4KF1A 3TZNA 2YA1A 1NELA 2OPJA 3PBMA 2O55A 1GCYA 3U3HA 4C1NB 2KX9A 2XJ7A 4LX4A 1L0PA 3EB2A 5FAJA 1J01A 1QJWA 4O1DA 4FLOA 2DEPA 3F5JA 3QSRA 1B9BA 1BWKA 3N3TA 2ANUA 2E25A 3S3GA 3VGFA 2G3FA 3N1AA 5FF7A 1TPC1 1JZ4A 1JXJA 3H2AA 4EPBC 2IKJA 1QHPA 3T8LA 5HQMA 1TG7A 1NWSA 3RILA 5HNTA 4LANA 3UPBA 3SADA 1L6SA 1DWHM 3WSUA 2PTZA 3G3DA 4DJED 4YYFA 2G8ZA 2ZRVA 2RDWA 1BQGA 4D6JA 3LCGA 4IPPA 2QULA 3IJLA 3ONCA 1JQXA 1F3WA 3K4DA 1AA1B 4EPDC 1ONRA 1MXDA 3VMNA 2V68A 5JH2A 4WOZA 4F8XA 1ONEA 1ODUA 1BSLA 1EJSC 4M1BA 3T2PA 3RX2A 3CASA 3DH7A 3PZVA 2C3ZA 2VVNA 4Y90A 3S5OA 1WOBA 5FI8A 1B90A 1EF2A 3W1XA 3W7LA 5DEZA 3ZMRA 3VX1A 5I23A 3W1TA 1J6OA 3PZOA 3NSXA 3H55A 1QOPA 4Q4RA 1Q63A 3DKJA 1F3EA 3KZSA 3WJWA 2WANA 3P67A 4S2CA 3GR8A 4HGXA 4AD3A 4X2PA 4W7UA 1QO2A 4IJBA 2ZE0A 1VLWA 4S3AA 1TR1A 1LUCA 2HQAA 3INPA 3SN0A 4CGTA 3DFYA 1GONA 1VYSX 1SSGA 3E0LA 1MRAA 4MUZA 1KXQA 3EWCA 1MI3A 1A3HA 2WMHA 1C91A 2J66A 5LSMA 2D2HA 4N0RA 2WSKA 4XZLX 3BLOA 3WEZA 3L4WA 3UCDA 4CD7A 4D6GA 7ENLA 4BI6A 4MB3A 4LUIA 2QUMA 4LUYA 3RPTA 1JF5A 3AAMA 1TJRA 4HPHA 2X7WA 4MIMA 3VZYA 5ABFB 1OZQA 3IWPA 1Q8JA 1QI0A 4JTIA 1UMYA 4HVXA 2VFDA 3VZXA 1S2UA 2DZPA 2XU2A 2CBJA 3B9DA 4A6GA 2HXUA 2JFEX 4US5A 1EF3A 3W7HA 3UZWA 1XWYA 4C91A 5A95A 4GWEA 3GDKA 5I24A 4PB5A 2AGTA 2YXXA 2EKCA 4XBSA 3N14A 1HJXA 4JTAA 4K8EA 1B54A 1NOFA 3T0AA 1JF6A 3HG5A 1ZZMA 3EX6A 5AZ0A 4H7ZA 4UBPC 1QNPA 3WQCA 4DYJA 3VCCA 1QWGA 1J10A 2HK0A 2PWHA 4J28A 3H54A 2ALRA 4E3VA 4NASA 3KBWA 1E6XM 5I3KA 2FKPA 3ANUA 3PWAA 1JGMA 4MWAA 4H01A 4D71A 4CCCA 4MVAA 3NQ8A 1UHVA 4P7OA 3THCA 5D2TA 1EKOA 3NL3A 4NY2A 1ALDA 3KVJA 2QDHA 4FR1A 1QTWA 3IAQA 2E6DA 4YMZA 3DAQA 3GE7A 1KKOA 3GNOA 2PDNA 4X9YA 1J0KA 2F2HA 2NT0A 3CWHA 1RQEA 3LD5A 3AJXA 2YKKA 4DUXA 4MFEA 2VD8A 4UTLA 3A24A 2OQYA 3LI1A 4KIEA 1BQCA 3LHUA 4Z1BA 4KFPA 4PYSA 2OR2A 4KQNA 4WDUA 3CHEA 3M0YA 4XD6A 2DDXA 1P6CA 1IT8A 5EB8A 3UWVA 5K3VA 3WQVA 4URIA 1H7XA 2V5JA 3GW3A 3B4UA 3U9IA 1J0HA 2HBVA 3WCZA 1MZHA 1I9CB 1LT7A 1R8LA 4IXHA 1RR2A 2DIJA 1O94A 4ZSTA 1RQBA 1V5XA 3MHUA 4BF5A 2DT2A 3PZQA 3SY8A 3OEXA 5AOUA 3UWUA 2PDIA 4IMAA 1U30A 3KBJA 4M19A 4BFAA 4JHOA 2Q8LA 4M6QA 3FEMA 1UD5A 3DESA 3UGVA 3WF3A 3WBYA 3CT7A 3ALGA 1HUVA 5G4HC 1A5OC 1OFOA 1H7PA 2GJRA 2WJZA 3OBKA 2QCNA 3ARTA 1OF6A 4L6HA 5REQB 2XIOA 5TNVA 3NDOA 1HW6A 3DUGA 5DX7A 5ABHA 4DUWA 4HZ7A 1KGUA 3HJEA 1RCOB 5IDZA 1JD9A 4S38A 1MW2A 2HE8A 2I5GA 4A05A 4WXZA 3QPYA 1QU4A 5JIPA 4R7OA 5E6YA 1JFHA 1Y5VA 5A69A 3AALA 4BK9A 1X7IA 1SFJA 4ES4A 1R3TA 4I8YA 4CN4A 1E1FA 1JIBA 1C93A 1TTIA 3UWZA 5H1WA 2R1LA 3IVUA 5FCZA 4EIVA 3OHMB 2WMJA 3GVWA 3ITGA 3G1DA 3N2MA 3B0YA 3URQA 3LLXA 5AHNA 1JRCA 2DZWA 3IUHA 1H62A 3WMBA 1M7OA 3RNDA 1I2NA 1KRMA 4UB9A 4EP8C 1D7KA 4HNNA 1O1HA 4C6OA 4HQVA 5A8NA 1AJ0A 1I1WA 2PMQA 3I7RA 3M5VA 3ERPA 3THQA 2WC3A 3HG3A 2PRLA 1DHKA 4G56A 2FHFA 2QCDB 2PTXA 1IGSA 4IPJA 1PVNA 3RX3A 1RAKA 4QDPA 3LTSA 2G4FA 1I75A 3CO4A 4JNMA 1JCNA 2X1IA 5DXYA 3UXLA 3L21A 4L80A 1L6YA 3FKKA 4RE4A 2EG8A 1TWSA 2HDJA 3GKFA 2ATSA 3MI3A 4TU1A 4CEUC 1JDEA 4L7ZA 4MNLA 1DQUA 4O18A 5REQA 4AB4A 1O5KA 3HPFA 3SSJA 3FFSA 1TIMA 1VYRA 3G1XA 4HYRA 2HRWA 4XQ6A 5JBEA 4BQ3A 2ZA2A 5CXPA 2FTWA 3FVDA 2W6RA 2P50A 4UTJA 3URNA 3WH7A 7XIMA 1EIBA 4GVIA 1ZUAX 4GQ0A 3MHFA 3UG8A 3DXIA 4K1WA 4IF2A 2FHBA 1BEUA 1EJUC 3S9ZA 3CZLA 3L0KA 4W8AA 4XO6A 3CV7A 3F2DA 2QEZA 4C7DA 3NG3A 1CXHA 2PGFA 3LPOA 2ZX6A 1DJNA 5CZJA 2DW7A 1RH9A 1G5AA 3W7RA 3R79A 5FL1A 4MJ2A 1Z8AA 2A3LA 5AECA 4PMZA 4H9ZA 4ZQNA 1TRDA 4Q8NA 3W29A 2J9ZA 1G4SA 5FJOA 2GGEA 3KAOA 1PYMA 1EDTA 1VIZA 4J2PA 1RSCA 4IP7A 3FDGA 3T9PA 4FLQA 4PUKA 3PR2A 2RJHA 3WL1A 1XL9A 1XFCA 4YN5A 4I7VA 5LZLA 1F8IA 5G2IA 3C56A 3N2BA 4LXFA 2VUNA 1JZ8A 1R3QA 1VJIA 4PODA 4MADA 1RBOB 3S1WA 2PDWA 1DQXA 4IICA 2E40A 1X6UA 1KLYA 2UY3A 2AL2A 1ME8A 2F2KA 4HIBA 2DH2A 1L8PA 3S5ZA 3GHTA 4MF4A 2PDKA 2O0TA 4ZB5A 4DB7A 2BFGA 4C60A 4QCEA 1LL4A 2O7SA 2J7BA 1EQCA 4NILA 4A3RA 4WRHA 3AXHA 2VENA 3A4AA 3L9CA 1GZGA 2I1OA 3DN5A 3DHPA 4OIFA 2XISA 3CT2A 2MUCA 2X30A 1VEOA 2H3DA 4FZIA 2PP1A 3EDKA 4HYWA 2R6OA 5CPMA 4ZXLA 4YVPA 1IEVA 4BWLA 2Y85A 5CZ0A 1V3IA 2Y62A 1NH6A 4KETA 5I03A 4YTUA 1GG0A 5AVHA 1JYNA 4FNQA 1TA3A 2MNRA 1X39A 4H9XA 4UFJA 4KGJA 2VJXA 2NQLA 5CPSA 5IBXC 3P61A 3MDWA 3NXLA 1POJA 2BHUA 1PTAA 3MB9A 1GVRA 4Q32A 2ZVIA 1ME9A 4C6KA 4AC7C 1CIUA 4FOKA 4RDVA 1HF6A 5ABGA 5J5RA 2F7FA 2CLFA 1JFXA 1LQ0A 3FAWA 2XPKA 2R8WA 2ZICA 3LRMA 1EGMA 4ERGA 2XSAA 3UQNA 2OFJA 2V0TA 3MSDA 5CG0A 3GU9A 4NUWA 4WX2A 2EPOA 3KVKA 2J7HA 1UUMA 2WNWA 4C6LA 3L7RA 5HJXA 1JCLA 2VGGA 3BW4A 1TWDA 4ZCWA 3BC9A 1HP5A 4MTVA 1H50A 1KTBA 4G7FA 4RK8A 4CU6A 4GIEA 4OOUA 4C6NA 3WQDA 4O1CA 3MSYA 2FYMA 2RAGA 4JFSA 1ECEA 2W3ZA 2GSEA 3EA2A 1GEHA 3FSTA 1KFLA 6TAAA 4JCLA 4NF7A 2PCQA 4XD5A 1PZ2A 1HKWA 1G7UA 4S3DA 1X98A 4Z0SA 1S38A 1VEMA 4B5NA 4I90A 1FFRA 3D3AA 5CPTA 3KXQA 1B1YA 2JKAA 3BOXA 4AC1X 5A1AA 3LM7A 4PMVA 3BLEA 2VFGA 1KRAC 1FHDA 3PG9A 1HTIA 4DWSB 1VH7A 2R14A 3QQWA 4JIEA 2BODX 3WMCA 2G96A 2YFOA 3S6TA 2WCSA 1LJYA 3WKZA 4RDYA 1V6UA 2WV8A 1Z48A 2FDMA 5C0QA 2VFHA 4XD4A 3G1RA 3E2RA 1XUUA 5JUVA 2IXUA 2ZX7A 4PMNA 4GI8A 4QG6A 4I3GA 4L6DA 1UD6A 2BBFA 5D04C 2UY5A 4Q6JA 2CLIA 3E0VA 1JQVA 1MMFA 1E3ZA 3MMTA 4N9BA 2XIJA 2J13A 2W62A 1HO1A 3KVLA 2NVDA 1KR0A 5L9FA 4CNNA 5EL1A 4ERIA 1VFSA 1IZKA 1AW5A 3SUTA 1A0CA 5D9MA 1UMLA 2E1DA 3BGGA 5E9XA 3DFNA 4MAZA 3IIPA 1H41A 3MTWA 1PIIA 3H24A 3SUSA 2GOKA 2CZVA 3W71A 3V36A 4YLWA 3NWRA 1ZAHA 1QATA 2GK1A 4ZQCA 3BO9A 2CW6A 4QG9A 3VIMA 4D8AA 1WXJA 4FF5A 2OOFA 2PA6A 3N19B 3TCSA 1DJYA 3VNKA 1WKFA 3JUGA 1XQLA 1GVYA 3BDKA 1WAUA 4TIMA 1G94A 3GM8A 1Q2RA 5BCAA 1F05A 4OECA 2YPIA 1NP2A 3GVRA 3E6EA 5GNXA 1PTGA 3O15A 2CWNA 4MZYA 4W93A 3MANA 1UA3A 4PC8A 3S47A 3VOCA 1T8QA 1TTJA 2VC5A 5PTDA 1EX5A 3G1FA 1V7AA 4ZEPA 1E6PA 3CQJA 4GGBA 3W7KA 1K8ZA 1G4PA 1V3KA 3MDUA 5BRQA 4KBXA 1KCZA 1SUXA 1WAWA 3PJTA 4B91A 6CGTA 1YPXA 3RMJA 2FGLA 1ITCA 1EO5A 1CXFA 2POZA 3Q37A 3UY7A 3WY1A 3QJAA 1G69A 1TCDA 1SU5A 3QYSA 4I6VA 3U2CA 2DUAA 5I3FA