1W3LA

Endoglucanase cel5a from bacillus agaradhaerens in complex with cellotri derived-tetrahydrooxazine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title Structural, Thermodynamic, and Kinetic Analyses of Tetrahydrooxazine-Derived Inhibitors Bound to {Beta}-Glucosidases
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 121
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1w3lA00
1Y7VA 4JKMA 4UFHA 3ALFA 3RMEA 4RE3A 2QPUA 4X0NA 3WENA 4W88A 1UWIA 1CXEA 3K8MA 4J3WA 3MMWA 3SCQA 4CCEA 1HKKA 1GCYA 1ZBVA 2ZUUA 2Q8XA 3PBGA 4AD2A 2FDMA 3AOFA 3BCFA 1UHVA 3IJ9A 4W8AA 2XIIA 5E0CA 1UD2A 4TX6A 1E71M 1B2YA 1ISZA 4U3CA 5BYWA 1IV8A 2C7FA 2J77A 1WZMA 4HP5A 1XSJA 3BSHA 4CU7A 3ZJ7A 4X0VA 4EAMA 2J7CA 4ZFMA 3WSUA 3WH6A 4DUVA 3IAQA 1WPCA 3ZR6A 4OJYA 2VTFA 3KZSA 4KMQA 1J0ZA 4AD3A 1W9XA 2ZUVA 4FLQA 3WD4A 2EQDA 1ISYA 4J3UA 1LL7A 1V6XA 4MJ4A 4AEFA 3N17A 2W61A 4WKFA 4CD4A 3MSDA 2XWEA 1HL9A 3WD3A 1SR0A 5FIPA 2CBJA 1NP0A 3K1DA 2FHBA 9CGTA 5BROA 2PWFA 1AVAA 2J7DA 1HKIA 3DECA 4B9YA 2BY2A 3KL0A 4QLJA 3U5UA 3K8KA 3VD5A 4CVWA 5FL0A 1C90A 4P7LA 3OLIA 3MU7A 4WK9A 1FH7A 3TONA 1XH0A 3UERA 1UKQA 1FFRA 2PWDA 4U2ZA 3WEOA 2WCSA 5M03A 3GBEA 1FP9A 1UD6A 2VZSA 3IJ8A 3CHFA 5A8OA 1QNOA 1CYGA 4XUYA 5BXSA 4D6IA 2J8FA 1CPUA 1J0YA 1TA3B 1FHDA 4U31A 2YA0A 1B9ZA 3CO4A 1WB0A 1XCXA 4YHEA 4UOZA 4PMNA 3AS1A 2XVKA 4Z2HA 1MQPA 3BLKA 1H49A 3MV11 4TOQA 2GK1A 4FK9A 4HMCA 1GOOA 3HU7A 3NIYA 2X1IA 1J0IA 1SYTA 5KZ6A 3WIJA 3WY1A 3VVGA 4Q22A 3VILA 4Y7EA 4CN6A 2W62A 3BAXA 4ATDA 1VFUA 1I1XA 2D22A 4D6FA 4F8XA 4UOJA 1BQCA 3G6LA 3RM4A 1CLVA 5ECUA 1FH9A 5DMYA 2XSBA 2X0YA 4Z2LA 2WCAA 1V0KA 4QLLA 3VMOA 1DWGM 1E6XM 1TMQA 2ZIDA 4PSRA 2O9OA 1DHKA 5A6BD 4CD7A 3TTQA 3TP4A 3CZJA 1PJ9A 4HU0A 1KR0A 1E40A 2W5FA 4WIWA 3AS3A 3D3AA 4AEEA 5BRQA 4DWSD 1UWQA 1QI2A 1C8XA 1KXHA 1XC6A 4CN4A 4UFIA 2ZUTA 1UKSA 2F61A 1CGWA 3CZ8A 1WCGA 2WZIA 3N13A 1HIZA 3A4AA 4DUWA 3K4AA 3EDKA 3N04A 5JIWA 2FHFA 4P7NA 2WMIA 2BNJA 2XFRA 3MO4A 3AMDA 1PIGA 2ZX9A 4BCEA 1V3MA 7TAAA 1PX3A 2J7FA 1JGIA 1WDPA 4P8VA 2BY0A 3AIBA 5A8PA 4LYQA 4OKDA 1JDAA 2YKKA 3CZGA 4J3TA 3GDBA 3WMCA 2VRJA 1BF2A 3A47A 2ZE0A 3OLGA 3QOMA 3ZO9A 3VKKA 3ZT5A 5JBDA 2J7HA 1CNVA 1WAWA 1JYXA 2YBTA 1OT2A 4CVUA 3T2QA 3AYRA 1BFNA 5ABGA 3L4WA 3ZJKA 2NT0A 2Z1SA 4UFJA 1OINA 5C71A 1E4NA 1GQLA 3A4XA 4CU6A 1K6AA 5I23A 3ZMRA 3AZTA 2B31A 2DIJA 3WF1A 1H2JA 3THCA 3SIMA 4MNLA 1KGUA 2PWEA 1FHLA 3CZLA 1C8QA 1UR9A 4M24A 4D6DA 2EPMX 5BRPA 2E8ZA 2WSPA 1PEZA 5A2AA 3U5YA 1JG9A 1LLOA 4AD4A 1VBRA 3K46A 4MNJA 3AYSA 4MB3A 3VINA 5JUVA 3MUZ1 4AZBA 2Y8VA 2WNWA 3L4TA 3APGA 1CXLA 4B3KA 1PPIA 1GQKA 1V3HA 2JIEA 5HDRA 2DH3A 4CGTA 4MNMA 1UKPA 3O6AA 3CUHA 3W82A 1GZJA 1RD6A 1CGUA 1WZKA 2OYMA 1WKYA 5A6KA 2WC7A 2D1ZA 4RE4A 1EH9A 5FL1A 2PWGA 2QHAA 1B3VA 4AZCA 3NSXA 3WMBA 2G3MA 3WQ8A 3BAYA 3KE0A 4KGJA 1XSKA 3B9EA 3T0BA 2YOCA 1G01A 3L4XA 2VRKA 3CLWA 4OZOA 2EO7A 4BS0A 3LPGA 4BQ3A 4NZCA 4Z2KA 4CU8A 4ZE4A 4WKAA 2VCCA 1V0LA 2X8RA 3OBAA 3VMNA 1EDGA 3S2CA 4QCEA 1QI5A 4PMOA 7A3HA 1O7AA 1MQQA 2DSWA 1X1NA 4KWUA 3FHAA 1JL8A 3SCVA 3CZEA 1XD1A 2G3IA 4PYSA 1J12A 2Y24A 3O2LA 3ARRA 1RH9A 1KCLA 2WHJA 1OM0A 5ABEA 1EQCA 1IZJA 3PZUA 5I2UA 4D6HA 5ABFA 3VM7A 1DWHM 4ACZA 1HN1A 2BY1A 4UQBA 5CJ5A 2JEQA 5D8WA 5D8ZA 2WHLA 2G41A 3L4ZA 1UD3A 1HL8A 1KCKA 3CHCA 1BAGA 1TG7A 1ESWA 2EEXA 4UQ9A 2A3BA 3ECQA 4PUDA 3VIFA 1W2PA 1AMYA 1QOXA 4L4OA 2BHZA 1TZ7A 1V0NA 2XWDA 3BAJA 3MUIA 3RO8A 1QBAA 1VJSA 4QFUA 2RGLA 5CGMA 4H8HA 1E3XA 3KWXA 3VD7A 3WL1A 4W5ZA 1CDGA 4ML4A 4TVDA 3PZGA 1ZJBA 4AYSA 1E0VA 2VOTA 4ZENA 3VIPA 1ITCA 1DEDA 1U30A 5FKYA 1JNDA 3IJ7A 4AISA 5IDIA 3NSNA 3II1A 2ZX8A 2GJPA 1E6SM 2W92A 1W1VA 1UH2A 2BXZA 2YLLA 2CXGA 3GNOA 1A3HA 4M82A 1UWTA 2YA1A 3L4YA 3OG2A 1JF6A 1US2A 2ZXAA 2W91A 1OWQA 3PZTA 2AOSA 2PBGA 1LG1A 5C70A 1IT0A 1UWSA 2D0FA 3WFZA 1BVNP 3AIVA 4AW7A 3VGBA 3W38A 5AY7A 2D24A 2OLHA 5D9MA 2X05A 1W1YA 3RJXA 3WF0A 2VX6A 4CD6A 4QP0A 2WMHA 1XV8A 4PMZA 1GOIA 3GNPA 2PC8A 5A69A 3ZT6A 5CPSA 1ZBCA 8CGTA 3ARTA 4F79A 2AMGA 3D5HA 1EHNA 1EOMA 3FW6A 4ZEPA 4P8UA 2XVNA 3TA9A 1WDSA 3CMGA 1VFFA 1WE5A 1HKJA 3ZJ8A 1UG6A 3AXIA 5BXTA 1CECA 3AHYA 4PTMA 2GK1B 2VR4A 3UG3A 1LL6A 3BH4A 2V3EA 1B3WA 1NWUA 1DWJM 1JDCA 3WDHA 1D3CA 3B9DA 4M80A 5E09A 4H04A 6A3HA 1UR2A 4PMYA 3FY1A 3WBAA 1KXTA 1Q6CA 3AMGA 2Y8KA 3AIQA 3FXYA 2QLYA 3GXMA 4FLSA 4UFKA 3VIJA 3EDEA 1ZU8A 3G6MA 1KWKA 3EBVA 3SCRA 1JNEA 3ZJ6A 7CGTA 3AS2A 1HJSA 2V5DA 5CLTA 2W67A 1LF1A 1EO7A 3GH7A 5JIPA 2ZUMA 1C3FA 3WKZA 1PAMA 4M8UA 5C8BB 2CKRA 3VIHA 4J7RA 2CETA 1OIMA 3BAIA 1BG9A 4PEEA 1TFVA 3PZIA 3KL5A 4H8UA 5E70A 2V3FA 4AZHA 4N0RA 2XJ7A 1OBAA 3T0AA 5AC5A 1LG2A 4KRTA 3QR3A 3ARPA 1BSIA 1UZ4A 3WD1A 4CD8A 3OZPA 2UY4A 4IISA 2WMIB 1TVNA 3UESA 1UD5A 2UY5A 1OGSA 1V3JA 4UOQA 1VF8A 4W7WA 4AZ5A 4A3HA 2BVTA 1GW1A 4W87A 3L2LA 1VEPA 1OIFA 3A3HA 1CWYA 3OGSA 2VNCA 5CSYA 1C8YA 1CZ1A 3DYMA 5EFDA 4U3AA 4YN5A 1VB9A 1JZ8A 1UA3A 1KBBA 3T08A 2ZICA 1UOKA 2GUYA 2XM2A 2WYSA 4JFTA 1HP4A 4JCLA 3W0KA 1GOQA 3O9NA 4OOZA 1CENA 3WF2A 1V3LA 4HA3A 1HXJA 3SUSA 5A6SA 2JE8A 1EO5A 3RM9A 4TUFA 4CD5A 4KH2A 2WKLA 2PB1A 3VMPA 4C7DA 5I78A 3ZR5A 2A3AA 3MUY1 4PTVA 1QVBA 2YDRA 2IUZA 4W89A 4HZ8A 4UFMA 1JFHA 1GVIA 2EPOA 1K9FA 3AZRA 1WP6A 4EK7A 3HN3A 1ODZA 1P6WA 3NDZA 1SMDA 1VEMA 2CHNA 1E15A 1NOWA 5EMYA 5A8MA 3M07A 2VZTA 3U7VA 3WUBA 1GHSA 1JI2A 2BVDA 2IXVA 1B3YA 4NI3A 2BXYA 5JBFA 1I1WA 3U7BA 4HZ7A 3W37A 3K4DA 1JD9A 4BZYA 5A6MA 1J0JA 3AIEA 1HJUA 4V2XA 3ZQ9A 2WBKA 4B16A 2UY2A 1GUVA 1E1FA 1BYDA 1U33A 3K8LA 3SCSA 2WLYA 1E5NA 2QF8A 5I0DA 1JYNA 1KXVA 2DDXA 2WM0A 3VDHA 2UWFA 1VIWA 3WD2A 3WDJA 2FGZA 2RGMA 2ZXBA 3SUUA 6TAAA 2WB5A 4W7UA 1BPLB 3PHAA 3AXHA 3DYOA 1E6ZA 4GZEA 4D6JA 2V3GA 2XVGA 2OSYA 1GNXA 3ARWA 1MWOA 4MDPA 3KL3A 3AIWA 2YL5A 2VT0A 4E2OA 1H09A 1J18A 2BFGA 5ABFB 4P8WA 1A47A 3VUPA 3VIGA 4ACZB 3WQWA 1QBBA 3NJ3A 1E73M 4M56A 1FOBA 2DT2A 3WDPP 1W1PA 3WUEA 2Z1KA 5EBAA 1JAEA 1VENA 1ZJAA 4FLRA 5I77A 3BCDA 3BLPX 1KB3A 3SCTA 1D2KA 1BG4A 3ARVA 4XZWA 4AIUA 3VGDA 1H41A 4C7GA 3EMQA 1EOKA 3VD3A 4P7RA 4F9JA 3VD9A 3ZM8A 3WF4A 5A8QA 2C8NA 1BGGA 4WJXA 4GPNA 3OGRA 3ARXA 1R8LA 1KR1A 2VQTA 1VRXA 3W6MA 3IK2A 1VFOA 2VX4A 5D4YA 4JAWA 4J28A 4ATWA 8A3HA 3ZOAA 5AYIA 4OUEA 2XM1A 4HA4A 4PMXA 2J62A 3PTMA 1W9UA 4FMVA 1H11A 4GKLA 1V6YA 4ACYA 3L4UA 1ZBKA 1XYFA 4LQ1A 3EDDA 3BMVA 4GINA 2YJQA 1JIBA 4PRWA 1QNQA 3W27A 2O92A 5A1AA 4KRUA 1FFQA 3CHDA 3LPOA 1JZ3A 2BV9A 4HMEA 1O6IA 1UYQA 4CCDA 1Z32X 2TAAA 2XVPA 2VX7A 6CGTA 4CUCA 3CH9A 2VX5A 1GONA 3QGVA 3L2MA 1GOWA 2XPKA 4H2CA 1M53A 2CKSA 4GI9A 3QHNA 3GH4A 3RPMA 2CYGA 1GQIA 2D20A 1CGXA 4H41A 2C0HA 1E0XA 1MXGA 2ZOXA 3HJEA 3WH7A 5CGTA 5IXEA 1E3ZA 1E0WA 1VAHA 4JFWA 4UZSA 4UTFA 5A95A 4HZ6A 1QNRA 1W9DM 4UR9A 2CPUA 4NSBA 1FP8A 1YHTA 1DTUA 2WVVB 5CZKA 2D3NA 2VCBA 2WC4A 2OWWA 3JUGA 4AY1A 3WDIA 2YL9A 1AQMA 1JAKA 4JIEA 1Q6EA 4EANA 1GJWA 4GO8A 2GJXA 1W2VA 1W3JA 3BMWA 3DC0A 2BS9A 2CERA 1JXJA 2VUYA 4K68A 1JF5A 1QW9A 3DYPA 4ATLA 1W3LA 4GZJA 1E9LA 2XYLA 1TA3A 2Y5EA 1CIUA 2CEQA 1UR4A 2FGLA 5CPTA 1EDQA 3ARQA 1OT1A 4W8BA 3TTOA 1V08A 3L4VA 4OOUA 3PZ9A 2YLAA 4JL2A 5D9PA 1V02E 3PZMA 2ZUSA 2ZX7A 4HTYA 4U5IA 1PBGA 4PUEA 4LX4A 3DHUA 4UQEA 2EPLX 1L0PA 1NOFA 1QHZA 4HOXA 5FCZA 1KBKA 3AIUA 1E6PA 3VX1A 1UD8A 1ISWA 3W28A 1L8NA 5LA0A 2FHCA 1OSEA 3WQ4A 4PTWA 4A4AA 1NWTA 5F7UA 3VGEA 3W25A 3WNOA 3T2OA 1EA9C 4OBRA 4WSKA 4MAVA 3FAXA 1G94A 2O9PA 1UH4A 5A6BA 2WC3A 4B15A 2XUCA 5CPQA 1BYCA 1U2YA 1UQZA 2DSUA 2WMJA 4IUGA 2D0GA 1TUXA 2OSWA 3NDYA 3OGVA 3WQ6A 1KXQA 1W9VA 4DWSA 2QV4A 2OSXA 3WQVA 2EPNA 5IHSA 1BTCA 3VM5A 4V28A 3T09A 1MW3A 1JZ2A 1G5AA 1OD8A 2E40A 1B0IA 4NRRA 5A94A 1MFVA 3AHVA 4JKKA 1J0HA 1V6UA 5HNNA 1JYWA 4TTUA 4EE9A 1JI1A 1E55A 4MJ2A 1HJWA 3UEQA 3FN9A 4QDMA 4LYRA 1CLXA 1F4AA 4GO9A 3CUGA 4TXEA 3RIKA 3MS8A 2E3ZA 4P8XA 2YL8A 4AIEA 2IXUA 3CIVA 4GI8A 4ZXOA 4AZGA 1V03A 3WUFA 3A6OA 3AMLA 4E4PA 1K9TA 1NP2A 3VDCA 3CMJA 5HPOA 1JDDA 3ARZA 3PZVA 3AQUA 3WH9A 2HVMA 5M17A 3A4WA 4R27A 3ARUA 4MNKA 4PMRA 1XD0A 3OLDA 4JFVA 2BHYA 1BYBA 1EGZA 4OBSA 2CITA 1W3HA 2BHUA 2WLZA 4JZ5A 4LGXA 3MV01 2NT1A 3AZSA 2EBNA 1CGTA 4D1JA 1KGXA 2W66A 1B3XA 5TD4A 4J3XA 2W63A 3I3EA 3BC9A 4WLCA 4PMDA 2XIBA 3WH8A 1ECEA 1XSIA 2VL4A 4NF7A 1J9YA 2NW0A 4UZUA 3VD4A 1NARA 4AD1A 3VDBA 1E72M 3PZOA 3ZSSA 1K9EA 2WXDM 5LYRA 1EIBA 4D72A 2J75A 4WSJA 3EMCA 5A3HA 1J0KA 4M81A 1HKMA 5I5RA 1C92A 1QNPA 1WDRA 2J47A 1TCMA 5GQBA 4W86A 3WBEA 2V38A 2WANA 5I24A 4AXNA 3LPFA 2GVYA 4U33A 2WCGA 3CTTA 3VNYA 1ZBWA 1CEOA 3UETA 3N1AA 1UR0A 3W29A 1OB0A 2YA2A 2FH8A 4AWEA 2GDVA 1JD7A 1ISVA 1AQ0A 3VIIA 4GQQA 3W4RA 4H8VA 4KGLA 1UKTA 4GZIA 2YDSA 4AC1X 4UQAA 1WNOA 1C7SA 1HJXA 4H7VA 2VZOA 2CBVA 4HPHA 2VO5A 1ZB5A 2J7GA 1WDQA 5D9OA 1V02A 1NM9A 3ZSTA 1VBUA 3AHTA 2XHYA 3N15A 2PI6A 3N18A 4P7OA 1R7AA 1MQRA 4BQ4A 1OGGA 3BAWA 1TE1A 2WVSA 5CG0A 4XX6A 1C91A 2WPGA 1B31A 3PZNA 1US3A 2EXOA 1CXFA 3AMCA 1W1TA 3W24A 1UWUA 3VIKA 3IAPA 4MB5A 3VX0A 3IANA 1MYRA 4E8CA 3WDQA 3AROA 4XV0A 3RDKA 3U57A 3SUTA 2PF0A 4JFUA 1E56A 3SCOA 5HOSA 2CHOA 3WELA 1BVZA 2JFEX 4U5KA 3GZAA 3VGGA 1R86A 2CNCA 2DSZA 1R87A 4D71A 2QMKA 3OLEA 3W6LA 2G3JA 2XGIA 3RJYA 4J3VA 4AIOA 4R5EA 2W4XA 4P7QA 3F5JA 1CTNA 2FH6A 1PX8A 4EKJA 3GXFA 1UQYA 2VRQA 5IFPA 2WHKA 2WZHA 2ESCA 3WEZA 3B8SA 1CXHA 1UWRA 1MFUA 5I6SA 2E4TA 2GSJA 2G3NA 2VQUA 1E6RA 1FH8A 3UCQA 3M46A 5EFFA 2O9RA 1E4IA 2ZX5A 1RP9A 4N42A 2DSVA 2QPSA 3PN8A 2D0HA 4AZCB 2PWHA 3VOCA 2JEPA 1B30A 1KFWA 3THDA 1FA2A 2DEPA 1J11A 2DGAA 3RM8A 1RP8A 4C7FA 5GPRA 5BXRA 4MPKA 3WD0A 4F66A 4AZIA 4YHGA 3CBWA 2CIPA 5AC4A 2J74A 1B90A 1HT6A 2V3DA 4JFSA 3EYPA 2GJRA 2Y2WA 4LXFA 2A3HA 2VJXA 4V27A 1ISXA 4AD0A 1G0CA 2WW5A 3M6DA 5E9AA 3S6TA 4UNIA 5E0FA 1GQJA 2D3LA 2OYLA 4PN2A 3SCNA 4M29A 3F5KA 3T2PA 2GJXB 1WO2A 3WMSA 1UKOA 5DO8A 3QHMA 5IFTA 3PTQA 3VU2A 1E6NA 2X0HA 3WL0A 3VDAA 1QI4A 4PCSA 1QI0A 2G4FA 4AZ7A 4XB3A 2WK2A 2G8ZA 1PIFA 4JHOA 2J7BA 1V0MA 3AIRA 4WKHA 3SCUA 2EJ1A 2NSXA 5ABHA 3AXXA 5BWFA 4JKLA 2XFYA 5BCAA 2ZXDA 1GHRA 1Q6FA 4MB4A 4D6EA 1LQ0A 4PCTA 2VZVA 3I3DA 5A2CA 4W93A 1JZ4A 1MW2A 1HF6A 1M03A 4S3KA 3WNKA 4XZBA 1E4MM 2J25A 3NYDA 4TVCA 1WZLA 3BXWA 2VVSA 3VNZA 3HMCA 2EPKX 1HVQA 2DT1A 2VURA 3CGTA 1HJVA 5CXPA 5CSUA 3AI0A 4PMVA 1BYAA 3AHXA 4E8DA 1HNYA 3MMUA 1XH1A 1IZKA 2UY3A 5GNYA 4W85A 3EDJA 3NCOA 4GQRA 4DWSB 2VR5A 3BGAA 4D6GA 4B9ZA 4HA1A 1S46A 1H4PA 3WNLA 1JXKA 2WMKA 4JCMA 1M7XA 4M1RA 2ZWZA 4YPJA 2WAGA 3WQ5A 4Z2JA 4AD5A 4W5UA 2OYKA 4ZE5A 1KWGA 1GORA 1DP0A 5A8NA 4L4PA 2JALA 2DH2A 1V6WA 3UR7A 2WVTA 1EQPA 3GM8A 2WMFA 1KQZA 4MADA 1I75A 1XGZA 4HOWA 2A3CA 3MKKA 4WF7A 4CN1A 2YBUA 1QNSA 1QPKA 1PX4A 3W53A 1E70M 1CGVA 5FOOA 3GXIA 1JZ7A 2MANA 2E9LA 4CKQA 1ZS2A 2ZUNA 2CBIA 1K9DA 1QHPA 4PMQA 1DWFM 2CESA 1E1EA 5E6ZA 4UQDA 1E4LA 3WNNA 4LYPA 3RILA 2AAAA 3WNMA 1ITXA 5DT5A 1MVYA 1CBGA 1UR1A 1NWSA 1NWRA 4MAZA 2X2YA 2XTKA 4GXPA 5M5DA 2VZUA 3CUIA 4DM1A 3LPPA 4IPNB 4W7VA 1H0IA 3PZQA 2WZEA 3FNDA 1QI3A 3WNPA 2Y4SA 1X6LA 4Z2GA 1H1NA 2XFFA 3OA5A 2BVYA 1CGYA 1NH6A 3VPLA 3WDRA 1WZAA 4RE2A 2CCRA 5DEZA 3VGHA 3PTKA 1LJYA 4JL1A 1GVYA 4PMUA 4UQCA 4UFLA 3CPUA 3WN6A 2WSKA 3ARSA 1NOUA 1BLIA 1C7TA 2E9BA 1MW0A 3KEHA 1MXDA 4GI6A 5I3DA 1E43A 3EDFA 4QLKA 3TOPA 3OB8A 1Q6GA 3MSGA 1V3KA 3ZIZA 1F4HA 1KGWA 1BGAA 1GJUA 3GNRA 3E1F1 4TX8A 3VIOA 1W32A 3FHQA 2J7EA 3ARYA 3M7SA 4D1IA 4RL3A 3SUWA 2XGBA 2YIHA 1M01A 1RPKA 5E6YA 2PBOA 3WF3A 1TR1A 4CCCA 4S3JA 1B3ZA 3GBDA 5M3WA 4LPCA 3MMDA 1VEOA 5DT7A 1VFMA 2ZUWA 3RCNA 3DHPA 3WUGA 1Q6DA 4D6CA 1UR8A 2DQXA 3W26A 1HJQA 4GIAA 3VIMA 3BAKA 3GXDA 4UCFA 4DM2A 2E0PA 4MDOA 1DWIM 1LL4A 4X9YA 3SURA 3TTSA 2VCAA 2DPEA 2XVLA 3POCA 2GDUA 4TTGA 4DWSC 3MUAA 4Z2IA 4PSPA 1G9HA 5KEZA 1D7FA 2D2OA 1YQ2A 5DFAA 5HXMA 3GTNA 1JFXA 4HOZA 2WBGA 1LWHA 2XG9A 3N9KA 1PZ3A 1JZ5A 4BQ5A 3AFBA 1JYVA 4TVUA 1OCQA 4HPGA 1HVXA 2BY3A 5CLWA 5A6LA 3QHOA 4AMCA 5LA1A 2VMFA 2CBUA 1XH2A 1ZL1A 3I3BA 2ZWYA 3EMZA 4URIA 1UH3A 5A2BA 1KQYA 3GYCA 2DT3A 5LA2A 3B9AA 3J7HA 2WKGA 4F9DA 4ZXLA 1V6VA 2ZXQA 3WFLA 3WH5A 1ODUA 4AZ6A 1R85A 2X09A 4J27A 1TVPA 2ZX6A 1QHOA 1PZ2A 4HU8A 1NQ6A 5I79A 3SUVA 1UZ1A 4FF5A 5CQ1A 3SEPA 4HMDA 2O9TA 1H5VA 1B1YA 3AISA 1BHGA 1XYZA 5GNZA 1OD0A 2WHMA 1DWAM 2VI0A 3CUJA 2WVUA 4Q7NA 3UG5A 1UUQA 2YL6A 4NRSA 1V3IA 1W9BM 3AJ7A 1R7OA 3VGFA 2JIWA 2OWXA 3W81A 4MB1A 1W91A 1QW8A 3N11A 4A3YA 4QAWA 2D23A 1C93A 3T0DA 4B3LA 2JF6A 3OIHA 1E5JA 2J8GA 3FAWA 2E8YA 1SMAA 2F8QA 1X6NA 2OWCA 2YDQA 1EXPA 2F2HA 3VTRA 4JHZA 3CZKA 3ZT7A 1W3KA 4U2YA 3WEMA 3AHZA 1XCWA 4BQ2A 5JBEA 3SCWA 4PBGA 1H3GA 4W8LA 4W84A 3F5LA 3BSGA 3AICA 5EB8A 3VO0A 3SCPA 2WWDA 1CXIA 3TTYA 3LMYA 2VVNA 1J01A 1VJZA 4BF7A 2WWCA 4OIFA 2J4GA 2V5CA 3POHA 4MTVA 1SFSA 2VC9A 1E6QM 3OZOA 2JF7A 3F4VA 2DSKA 5HBFA 1M04A 3GH5A 3UG4A 1EHAA 1XHGA 3N12A 2J79A 5DF0A 4IPLA 2DT0A 5AYBA 1GPFA 1CXKA 1UD4A 4PTXA 1HX0A 4IM4A 1XRVA 5HPCA 2WVVA 2GFTA 3UR8A 1JZ6A 2QMJA 5A6JA 1AQHA 4QCFA 1G1YA 2E9MA 2WMGA 1HP5A 3AMKA 3ALGA 3QOKA 1GOKA 5GNXA 3AS0A 3CUFA 1UA7A 1N82A 3CHEA 1J10A 4FLOA 1GOMA 4BA0A 4DUXA 5D9NA 2A3EA 1Q4NX 2HISA 1MW1A 1H0GA 1W9PA 1OGBA 2XSAA 4J3SA 3MANA 3NSMA 5FD0A 5IHRA 5A6AA 1EDTA 5BXPA 2DIEA 1LWJA 2J78A 3NUKA
chains in the Genus database with same CATH superfamily
4J5NA 3ALFA 1NU5A 3PG9A 4EWJA 1A49A 3LY0A 3M47A 1E9ZB 3MMWA 2E28A 4CCEA 1ZBVA 2IPWA 3SB0A 1QOQA 1C8VA 2FDMA 3IK4A 2C91A 3HQPA 1PL9A 2UZ9A 3PBUA 1E71M 3MVIA 5BYWA 1IV8A 1YTDA 4GZ7A 1WZMA 2H9AA 2V6AA 4IFRA 3ZS4A 4I5UA 3KZSA 4KMQA 1TPB1 3TIMA 3WBYA 1J0ZA 1ZLPA 3NQCA 3LNMA 4FLQA 2OQYA 2EQDA 1ISYA 4J3UA 2CU0A 4V1XA 1OYBA 1S2WA 4X60A 1LL7A 4H9VA 4MZ8A 2PLCA 3STPA 3FCPA 1ZCCA 2W61A 2J13A 4WKFA 3MSDA 3USBA 5RUBA 1T8XA 1W8GA 3WD3A 1JULA 1XYLA 5I3GA 4CNTA 1JDFA 2PWFA 2VFDA 4A8LA 1AVAA 2J7DA 3W7QA 1SJBA 4B9YA 3DECA 1IQ8A 3O0KA 3UWWA 1XBXA 1NSJA 4P7LA 3VABA 3BLEA 4ASTA 1UKQA 1EJRC 5AHFA 3W7HA 4K1WA 1SO4A 5EMUA 1LLWA 1FFRA 3GR7A 1IIHA 3RFAA 2WCSA 3VZXA 3UCCA 4AIBA 3OIXA 3WLPA 3IJ8A 3W73A 3L0GA 2OZ8A 1CYGA 4XUYA 1W5NA 2QCGA 4D6IA 3UFYA 1J0YA 1FWEC 3WK1A 2YA0A 4LUYA 4NZ3A 4PMNA 3N9SA 3T05A 1AA1B 4PCFA 1MQPA 3BLKA 1H60A 1RBAA 4MY8A 3M0LA 3TXZA 2DJLA 1J0IA 1SYTA 3WY1A 2XH2A 3NQEA 3VVGA 4GFIA 1YKWA 3HG3A 1E1CA 3LCGA 3SY8A 4CN6A 3BAXA 2D22A 3VNJA 5DCBA 1KKRA 2HEJA 3G6LA 3TQPA 2WCAA 4QLLA 5CBIA 3VMOA 1DWGM 4Q4PA 4D2JA 4LAUA 1TMQA 3FJNA 3P0WA 1EC7A 4D8AA 4GE8A 1KR0A 4AEEA 3XINA 4LBSA 4H3DA 2HNHA 1C8XA 1R9ZA 5G1MA 3UPWA 1U5JA 2QDDA 5HINA 3R10A 2WZIA 2OEKA 3N13A 1HIZA 3N04A 3DERA 4IQLA 2OVLA 2WMIA 4HTBA 2BNJA 4JR5A 1J6OA 3AMDA 3BV7A 2GGGA 1X98A 7TAAA 4P8VA 1JGIA 3VXGA 3U9IA 5A8PA 3KCJA 3KZPA 4OKDA 1EZWA 3GDBA 4KCTA 4JY9A 3RX2A 2HS6A 2OZTA 2D2HA 3AWOA 3D6NA 1TV4A 1YX1A 3VKKA 3ZT5A 5JBDA 3C0SA 4JX5A 4CVUA 1OT2A 1BFNA 3L4WA 3ZJKA 4KEVA 3L12A 5C71A 3WJXA 5CC3A 1GQLA 6ENLA 1ITQA 3NZGA 2FZBA 2XISA 1QFEA 1H2JA 1PE1A 3SIMA 2AQOA 2VP8A 4IICA 4GY1A 1C8QA 4M24A 3PB2A 3SQSA 5BRPA 1A5CA 2ZRZA 2WSPA 3B9NA 4HJWA 1MNSA 1JG9A 3O05A 4DX3A 3WLLA 1UJQA 2DORA 3H4XA 2GGEA 4KEMA 3AYSA 3VINA 4L4LA 4AZBA 3PVFA 4DPQA 1CXLA 1SZFA 3KOFA 4CEXC 2V5LA 3G1YA 1PPIA 2E77A 4CGTA 5HDRA 1R9YA 4XIMA 3S3GA 1EJXC 3NM3A 1WZKA 3E0LA 4JICA 3S9IA 1Z89A 4AMAA 5TAOA 2G3MA 1P1MA 3QYQA 3KE0A 3GU2A 3CB8A 3JZEA 4QSFA 2NQLA 4KCUA 2Z6IA 4HMNA 1AH3A 4JTCA 2XSXA 1V0LA 3VMNA 3BO9A 4IIEA 1F73A 4PMOA 7A3HA 4CNPA 1O7AA 4HNUA 4TV5A 4ADSA 1ME8A 4RNFA 1M7JA 3SCVA 3JR2A 1J12A 3OVGA 4FIQA 1JJKA 3K5XA 3I68A 4X2PA 1OM0A 2GQ9A 1TRDA 4OWGA 2RH9A 4RXFA 3B8UA 5FI8A 1IZJA 2HCVA 4DPPA 5I2UA 4D6HA 3MT1A 1SR9A 1KTBA 1T41A 4I6VA 1HN1A 1KM1A 5CCZA 2FPTA 3B0UX 2WHLA 1FRBA 3R5EA 1TX2A 1VJIA 2BBFA 1Q7MA 3ZFHA 1XM3A 4Z17A 2EEXA 5GVJA 3ECQA 4PUDA 1OABA 4INFA 3GKAA 3TFCA 2VUNA 2X40A 3M5YA 5TF0A 4HU4A 4L4OA 1TZ7A 1V0NA 3NQMA 3P93A 4GIEA 3EPNA 4NP7A 2RGLA 1GK8A 4HQVA 4H8HA 3KWXA 2X0SA 3H70A 1POJA 4PUKA 5FKYA 5AHNA 4HYWA 5DMNA 3IJ7A 3RITA 1DE6A 5JU6A 3NSNA 3W83A 1R46A 2W92A 1W1VA 4NXSA 1QDSA 2BXZA 3EB3A 3EB4A 1F3XA 1A3HA 4IJRA 4K7VA 1ONWA 2YA1A 4AHOA 3NQBA 4HSHA 2BZNA 2ZXAA 4L61A 3I4KA 4E2BA 4U10A 5HJLA 2AOSA 4S3FA 1UWSA 2D0FA 3THAA 1BVNP 3AIVA 3G3DA 5AHMA 4NI8A 4QEEA 5AY7A 3CK5A 3WF0A 4QP0A 1KLZA 3RN6A 3SIZA 4PMZA 1GOIA 3WX7A 1WUFA 2QR6A 3GNPA 3ZT6A 1ZBCA 8CGTA 2NQHA 2AMGA 3UJRA 1GG1A 3D5HA 1EHNA 1EOMA 4OE7A 4LYKA 4TV6A 4ZEPA 3EWDA 3TA9A 1H50A 1VFFA 1HKJA 2A6NA 1UG6A 2I9EA 3P80A 4PTMA 2GK1B 4N2YA 1BKSA 3CIWA 3BH4A 5EY5A 3WDHA 1DPMA 1S2UA 4M80A 4H04A 3S2MA 4FF7A 3PSWA 3WBAA 4QS5A 5C55A 4WD0A 4UTWA 4DBUA 4JN8A 1G69A 4B2DD 4UFKA 3R12A 3VIJA 3G6MA 4DJFC 2WQPA 1NFPA 1JNEA 7CGTA 3AS2A 1HJSA 3GB6A 1RY0A 5CLTA 6REQA 1EO7A 5A6TC 1XICA 2Y88A 2GJLA 5C8BB 2CKRA 3OVQA 1SQ7A 4BI5A 2BMBA 1QWGA 3PZIA 1PKLA 3QGKC 3BURA 1RK5A 3ZVHB 3P3BA 3ARPA 3MHGA 2YDAA 3WD1A 3P5ZA 2PGEA 3OZPA 3W2UA 3EX2A 1WQ5A 4IISA 3WQDA 3EWBX 2GJNA 4ZR8A 3IGSA 1V3JA 3S47A 3UZJA 3TKFA 3MUXA 2QCLA 3E12A 3L2LA 4LUTA 3UY8A 2CHRA 1OIFA 1DORA 2C0AA 3OGSA 3Q4DA 3EWYA 1UA3A 1UOKA 1TV8A 2GUYA 2VM8A 2YXGA 4BI7A 4JFTA 1HP4A 4JCLA 4DELA 3M41A 2C15A 3O9NA 2O7QA 3G1AA 4ZQCA 3WF2A 1M9HA 4Q6XA 4HA3A 2JE8A 1OK4A 5LNVA 2PB1A 1QASA 2FFIA 3ANYA 2YDRA 1M3UA 4F2BA 1RXOB 4JY8A 4ZOEA 4PL2A 4RDZA 3GQYA 4Q6JA 1GVIA 2EPOA 3HN3A 1ODZA 1P6WA 3NDZA 3H12A 2PDBA 4O52A 3TJXA 3I4EA 3O1NA 5HQMA 3VDGA 1VEMA 1KM4A 4DF0A 1E15A 5EMYA 4GQGA 2VZTA 1Q2RA 4O15A 3WUBA 5G2IA 2BVDA 2IXVA 4KPLA 2BXYA 5EMLA 3PUOA 3K4DA 4S38A 4KT2A 4DJDC 2UY2A 5D09A 2PPGA 1E1FA 4HZMA 2RDUA 2WSYA 3IVSA 2NQ5A 3SGZA 2ZA3A 3ES8A 4JX6A 3VDHA 2UWFA 1V4YA 4WXYA 3STEA 3WD2A 4K39A 1YDYA 1GZGA 4BKNA 2RGMA 1L2QA 2C1GA 3I10A 4ZMGA 3CNYA 4NVTA 2PODA 4MSSA 2XVGA 3MSRA 4NJJA 2OSYA 3GTHA 3GG7A 1WDDA 1DIOA 1MWOA 2VT0A 2O0TA 1MDRA 1OY0A 1O1ZA 3KTSA 3C3UA 4R7OA 4JBRA 2ABBA 3VUPA 5I09A 5HWNA 3DBPA 2ZDSA 1REQA 3QR1A 1FOBA 3LD5A 1SUXA 4JQ2A 5EBAA 4CNNA 2BGNE 4M51A 1K7FA 4C1LA 1JAEA 4TR9A 4V15A 3BLPX 5FEZA 1DBTA 3KXQA 1BG4A 4V33A 4XZWA 1Q3NA 2TRSA 2I5IA 2Z24A 2QQ6A 4MG4A 1EOKA 5HATA 5CZJA 3QLLA 3BQ5A 3VD9A 2DIKA 3WF4A 3GUWA 5A8QA 4WJXA 4GPNA 1YMYA 4H9UA 1AZ1A 3OGRA 3TU9A 1R8LA 1VRXA 2BASA 1YTKA 4RPPA 1EA0A 3H53A 4JIIX 3H26A 4F0SA 4LF1A 4DZAA 3NDOA 2PA6A 3KCLA 4G7EB 4JTAA 2D69A 3CTLA 4RCXA 4GKLA 4OGZA 1W8SA 3A9IA 3NQAA 1XGDA 3DH7A 2VGIA 4IG2A 1XPYA 2YSWA 3UWZA 3WLOA 2PDPA 1OFAA 2Y8UA 3MTWA 2NVAA 5I06A 5A1AA 1DTNA 5C9WA 1FFQA 1RBOB 1JZ3A 3E38A 1X8FA 2DZAA 3LGEA 3QJAA 4NT0A 4ZO6A 1Z32X 7REQB 3BUVA 2VX5A 3QGVA 4H2CA 4UTJA 4LVFA 4C6MA 3APTA 3H2MA 1S5TA 3RF9A 4ZOCA 4H41A 3G22A 4WDUA 1GVQA 1E0XA 4PUMA 4REQB 4F0LA 3WH7A 2GUUA 5IXEA 1E3ZA 4PB4A 1WDWA 2TSYA 4ZO8A 3PWIA 4C1NA 5A95A 3FJLA 3T6CA 1AJ0A 4UR9A 2CPUA 1I0BA 2XN1A 2WVVB 4LBRA 3JUGA 4OUIA 1AQMA 1JAKA 4JIEA 4DLFA 4EANA 2AMXA 3KUMA 1RY8A 2ZZ1A 2Q3OA 2PD5A 1PS9A 3HFTA 5D05A 1EYEA 3TN3A 1JXJA 2QCFA 1EPXA 3PB0A 4DF2A 1OJXA 3DYPA 1W3LA 3U6WA 1J5SA 1FWJC 1JCTA 1ZHAA 1TA3A 1Q5MA 1UR4A 1H1ZA 3L4VA 2VEPA 4OOUA 1D9EA 3PZ9A 4BF9A 1XPGA 1TWDA 1NY1A 4HTYA 4BWLC 4PUEA 1A0CA 3DHUA 3DHFA 5C9XA 3HGRA 4JYFA 3AIUA 1E6PA 1L8NA 5F7UA 1B54A 4HHPA 3VGEA 3DAQA 3WNOA 3T2OA 4GJ1A 3TQ0A 1EA9C 3FAXA 3UGRA 2O9PA 1FHUA 2R1LA 3N2XA 1MUCA 4R88A 2DV0A 3LG3A 2XUCA 2WMJA 2C14A 2Z0IA 1TUXA 3MYOA 2OSWA 4LC6A 5DCDA 2E5DA 1S38A 2DY3A 2EPNA 5EMJA 3ITTA 3R0KA 4AF0A 3T8LA 3RK8A 5A94A 1MFVA 3IUDA 2PFHA 1Q6LA 5HNNA 1QOPA 4FOKA 3F2CA 5D2TA 4TTUA 2VEIA 3ABOA 3N4EA 4JIQA 4EE9A 3NGFA 3NL3A 1E55A 1BKHA 3UEQA 1QO5A 4GY0A 5JQ9A 2E09A 4IX2A 4EF9A 4LYRA 1CLXA 4OV9A 4GO9A 3MS8A 3CV7A 4P8XA 4WQ6A 2IXUA 3I7QA 1EJTC 3WUFA 1JGMA 4FIRA 1GZ1A 1EEPA 3CMJA 2ZC1A 5HPOA 3KBJA 3MZ2A 2GVGA 2YZ5A 3GK0A 2YCLB 4R27A 3ARUA 4XZLX 4ZQNA 5BMWA 4E2VA 2ZKMX 1EGZA 3MBDA 1UP2A 1W3HA 1I0DA 1R6WA 4LVGA 2IKIA 4LGXA 3MV01 1LBMA 2H3DA 4O8AA 1SZNA 3NQ6A 4RNJA 4XTDA 1B3XA 5CKSA 5D32A 4J3XA 2RHGA 3I3EA 3BC9A 2FMOA 3WH8A 3CH0A 2AL2A 2NW0A 1PDZA 5CZTA 3PUEA 4UZUA 1QUMA 4KQNA 3IV3A 4AD1A 4C5ZA 2OELA 3PZOA 3ZSSA 2WXDM 4D72A 1RAKA 2R1KA 3E2RA 5F2IA 1HKMA 1C92A 1WDRA 2NXGA 3DI1A 3WBEA 3LXAA 4AXNA 3EGJA 4U33A 3IIXA 1ZBWA 1CEOA 3SJ3A 3D3FA 3ENLA 1UR0A 2POZA 1OB0A 2FH8A 5DRCA 2GDVA 1ISVA 3U48A 1AQ0A 4XQ6A 3TW6A 4H8VA 4KGLA 3TYDA 2YDSA 1EKOA 1XS2A 4QE1A 2UBPC 4G2DA 3H24A 1C7SA 1HJXA 4O1DA 4RZ5A 2DZWA 3V7PA 3TZNA 4YCOA 1WDQA 4GKTA 4NQ1A 1V02A 3N15A 1YXYA 4G8TA 3F4DA 3UGVA 3S8HA 1R7AA 2VELA 3BAWA 1TE1A 2WVSA 4IIFA 4S1FA 2I9UA 4IZGA 5JXQA 3PWGA 4KBXA 1W1TA 3CV6A 5FF2A 1F8MA 1Z44A 3OYZA 1DOSA 1JCMP 3KBSA 3P62A 3VX0A 2VOMA 4CCZA 3SY5A 4O4WA 3WDQA 2PS2A 5REQB 1DQWA 4G1NA 3NXLA 5F1VA 2PF0A 3CV1A 4DI9A 4I5XA 2CHOA 2JFEX 2QMKA 3OLEA 3FLUA 3UBPC 2QPXA 2G3JA 4LAOA 1KCZA 3M6YA 4RZBA 2YGYA 3HURA 4Y9PA 3TYZA 2W4XA 1P7TA 3CEUA 1PX8A 4ZA0A 3GXFA 4IIHA 1UQYA 1YIXA 3GIPA 3SRFA 4S2CA 1A5MC 2WZHA 3XIMA 1UUMA 3WEZA 1CXHA 5AVHA 3W1AA 5I6SA 2PZ0A 3C8NA 3C56A 4IMGA 1J6PA 4C6KA 3QY8A 2G3NA 1PV8A 3TW9A 3WLRA 3EX1A 1FH8A 3UCQA 3W1RA 1MUMA 4OV4A 2QPSA 5HNUA 4AZCB 3HGOA 3THDA 2DGAA 4D8LA 5F2MA 4LRSA 1SU5A 1HO1A 3KS6A 5BXRA 4WSHA 3WD0A 4A35A 4F66A 2CIPA 2V3DA 4UTHA 3LX9A 2A3HA 3RR1A 3F1QA 4V27A 1TREA 1AZ2A 2Y7FA 1P1XA 4QJ3B 5E0FA 1GQJA 2D3LA 3SCNA 4M29A 1POKA 2ZRYA 3WMSA 3UNTA 3QHMA 3PTQA 4US5D 2ZTKA 3LEPA 3WL0A 3W7OA 4PCSA 1QI0A 4E5TA 2WK2A 4H7ZA 2G8ZA 1W17A 1D8CA 4PR4A 4NYUA 1H61A 2J24A 2PRLA 3SCUA 4KFNA 3GAKA 4KWSA 4RXGA 4X3ZA 5BCAA 3KBNA 2ZXDA 1Q6FA 3AYVA 3CO8A 3MA8A 3I3DA 4O19A 4J2MA 2WOQA 1JZ4A 1U1JA 3UT0A 1M03A 3JU2A 4B2DA 2LLEA 1WZLA 4MOZA 4JTIA 1SZRA 2J6XA 2EPKX 4MUPA 3W07A 1NF0A 5CXPA 5CSUA 3AI0A 3LN3A 4PMVA 1BYAA 3W7RA 3AHXA 4JTFA 3MMUA 1X8CA 4IPPA 1BXCA 4ZL1A 3UWUA 3EDJA 1JEZA 4PTDA 3EZ4A 4B90A 4PEKA 4B9ZA 2QAFA 3KDNA 4X22A 2WMKA 2IPFA 3OOQA 4M1RA 4L1WA 3WQ5A 3G0UA 4BEQA 4W5UA 4LB4A 2OYKA 4FHAA 1QRQA 4HCLA 1U1HA 4WCJA 1CW2A 1DP0A 5G4EA 3SECA 4RDVA 1CB2A 2I5QA 4L6OA 3GM8A 2WMFA 1Y65A 4HOWA 3MKKA 2EF9A 3W86A 1QPKA 2NWSA 1PX4A 5LIWX 2C1IA 1CGVA 4GY7A 1M7OA 5HA7A 2PURA 4CKQA 5I3JA 3C2FA 2CBIA 4UCGA 1K9DA 4RDYA 2NV1A 4PMQA 3P84A 4WY0A 2Y62A 3GHUA 4LYPA 1F3EA 3RILA 2AAAA 1MVYA 4J2PA 1NWSA 3GXTA 3CXOA 3N73A 2PDFA 2Q3RA 4I7UA 3W71A 3FNDA 4AC7C 1OQFA 2CZVA 2GUBA 1QI3A 3T44A 4YVPA 1AJ2A 3QC3A 5HR6A 4JEQA 2BVYA 4H8NA 3U8GA 1NH6A 2PGRA 1M6JA 2EJAA 5DBUA 1AD4A 4KFOA 4GGHA 2F9RA 1M41A 3ARSA 4DNMA 1Y5VA 1LP6A 3S6DA 2E9BA 5I3DA 1E43A 2GQ8A 4QLKA 2ZZ6A 3TOPA 3OB8A 1G4SA 4HPNA 3CAKA 3ZIZA 1V79A 1OG6A 4ORIA 3GNRA 1QAPA 1ZY9A 2J7EA 3CHVA 2DZXA 4YTUA 4LEFA 1W5OA 1NQKA 2XGBA 2PP1A 2ACSA 5E6YA 1FXPA 3VFCA 3WF3A 3GNNA 2OT0A 3O06A 3UJEA 4GRSA 4S3JA 1B3ZA 3GBDA 3TCSA 3EB2A 1VEOA 3NVTA 3DHPA 2E1WA 3WUGA 4UNLA 1FDYA 3TLQA 3W02A 1ELSA 4MKVA 2DQXA 3ZLHA 2XIMA 3G1XA 4NNAA 3BAKA 4MDOA 2CLOA 3MCMA 1V7AA 4MIMA 4LC8A 3SURA 3TTSA 1MRAA 2DPEA 1IEXA 1LDCA 3V5FA 3MUAA 1DQXA 2D2OA 3GTNA 1HGWA 3CL6A 2VR2A 1VC4A 4HOZA 4LS0A 1LWHA 3CAVA 5F2LA 4BQ5A 4C60A 4TVUA 3W70A 5DXYA 3W7NA 1XIFA 3KAOA 4NAEB 3QHOA 3DC8A 3UJ2A 3NTYA 5LA1A 2VMFA 3V36A 1Z42A 3R94A 4Z0SA 3WJYA 4URIA 5FA5A 4EVZA 3GYCA 4FP1A 5J04A 2DT3A 4HCHA 4OQVA 4C6CA 3TQKA 4C6DA 3TUUA 4ZXLA 2G50A 4PB3A 1ODUA 4FX6M 1ICSA 1PHWA 2JQXA 1TX0A 1TVPA 3ANVA 5I79A 1UZ1A 3VOIA 3CQHA 3C2OA 4MLJA 3SEPA 4LAZA 3B0VC 4KWOA 2NSOA 4LU0A 1Y8BA 3UJFA 3L21A 2NWRA 4ZQRA 3M64A 1XYZA 5GNZA 3PPCA 3W3OA 1DWAM 2H90A 3LMZA 3CUJA 3QR0A 1WXYA 3MWAA 3E2SA 4QG9A 4NRSA 2XZ9A 1NTHA 1R7OA 4O13A 4EOUA 1V8EA 1VLWA 3QYSA 2OWXA 3UD6A 3W81A 2VC6A 2D23A 2I5GA 1ITUA 4X61A 1LBLA 4B3LA 1TWSA 3OIHA 2GZXA 3S1WA 2E8YA 3W1MA 2YDQA 1MDLA 3VTRA 4DYKA 1W3KA 4U2YA 3P7YA 3C2VA 3AHZA 3V35A 3M0IA 4BQ2A 5CC5A 1AW2A 3MI2A 1LOLA 3F5LA 1KV5A 3CQJA 2FJKA 5EB8A 3VO0A 2WWDA 5HK4A 1R5YA 2VVNA 1VJZA 2ON3A 4BF7A 4Z1YA 2WWCA 4OIFA 2RAGA 4C6NA 2IW0A 3QKZA 3IIVA 1UROA 1DJYA 3H2OA 1LWIA 5HBFA 3ISIX 3DFNA 3UG4A 4I8YA 4Q8TA 2DZTA 1EHAA 2BX7A 1YEYA 3MMTA 1JCLA 3CAQA 1KFEA 1GPFA 4WR3A 1CXKA 5TBOA 3IIPA 1KKOA 1JPKA 1DV7A 4DJED 1XRVA 5HPCA 1RUSA 7XIMA 4GXWA 3SN0A 3BGGA 4TU1A 2NQZA 4MWAB 2E9MA 3ALGA 2QGHA 3QOKA 4O0KA 3N3TA 3AS0A 4C91A 3THQA 2FLIA 1UA7A 3BLLA 5FJTA 4FLOA 5DELA 4BA0A 3E5BA 2A3EA 2FB2A 1LRQA 2HISA 1MW1A 1W9PA 4XZMX 3R13A 2Y63A 3MJYA 1R2RA 2V5BA 3IRDA 1Z3NA 5BXPA 2OOFA 3NUKA 2ZZ4A 1Y7VA 2RDTA 4GISA 4JKMA 4UFHA 2QPUA 3PBMA 3WENA 1JUBA 1YDNA 3GHTA 1SSDA 1TJPA 3BSMA 1CXEA 1XYAA 4GNVA 1CI1A 4IMEA 2PLKA 3ZLGA 2Q8XA 3PBGA 1EF2A 1UHVA 5FJIA 2R1NA 3IJ9A 2XIIA 2P50A 2Q71A 5G1YA 4PODA 3MHFA 1NDVA 3VC6A 1XSJA 1VFSA 4EAMA 2J7CA 1FTXA 4DUVA 5H8PA 3ZR6A 2Y61A 4GUJA 4OJYA 4RV3A 2VTFA 1XIDA 3WG6A 1OX6A 2ZQ0A 4DHGA 5FESA 2ZUVA 3SBFA 3MKVA 4MJ4A 4OECA 3TLLA 2ZRVA 3N17A 4GWEA 4CD4A 3S2JA 1QPNA 3UW6A 4MM1A 1X6UA 1SR0A 2XH0A 2AQVA 2FHBA 9CGTA 3NAVA 3ITLA 2BY2A 3U5UA 4QLJA 4UTIA 5LNUA 5FL0A 1C90A 2TMDA 3OLIA 1FH7A 2OKOA 1XH0A 2PWDA 4U2ZA 4BK9A 1EX5A 2HMCA 1EF3A 1FP9A 2Q6ZA 2QS8A 1QNOA 2OEMA 4HT3A 2J27A 4B91A 5DMLA 1CPUA 1LYXA 1B9ZA 3CO4A 1FWTA 3ONCA 1WBJA 2C13A 1XBZA 4GBUA 3R8HA 4ZFCA 3BW2A 2GK1A 3CUXA 4HMCA 4ZOBA 4Y96A 3T7VA 3WQGA 3JVAA 1Q6OA 5KMYA 5E1QA 4ATDA 2V9DA 3VAVA 1LT8A 3FJ4A 2OOGA 3TA6A 3VCCA 5DMYA 4UTUA 5EA9A 4LANA 5LGZA 3DFPA 1VHNA 4IGHA 4G9PA 1E6XM 1CT5A 2ZIDA 3M0YA 3P74A 3FOKA 1OX4B 3FGCB 3EX4A 4N6EA 3CZJA 1GKPA 4HU0A 5EGRA 4WIWA 3UCDA 4R53A 1UWQA 1QI2A 2CLEA 1C9DA 4Q4QA 4FNSA 3I6EA 1BWVA 3KOXA 2DW6A 1LQAA 4C90A 4ZSUA 3RYSA 4FS9A 1IWBA 4LS1A 4YNGA 3ZVHA 3K4AA 2R1PA 2FZ9A 1UOZA 5JIWA 2R8WA 3KDOA 1B5TA 3M0VA 2VGBA 1TTJA 5C2CA 1A50A 2ZX9A 4HGXA 4AG0A 3LDVA 1EJ7L 4A29A 4QTGA 1WDPA 2BY0A 4XO7A 3LHTA 4FALA 3FEMA 5F4WA 3L65A 4E6MA 1BF2A 3N4FA 3OLGA 3ZO9A 1RK6A 2IQ0A 1WAWA 1JYXA 2ACQA 5CPOA 2YBTA 3T2QA 3AYRA 2PUZA 1SO5A 4MFDA 3MVTA 1KW1A 5LIUX 1K6AA 3E0FA 1MZHA 3WF1A 3QW3A 1SJCA 4MNLA 1KGUA 1FDJA 1FWAC 4D6DA 5CC7A 2ACUA 4Q7BA 4E3VA 2E8ZA 1R30A 4B3ZA 4AD4A 4CQBA 2Y8VA 3L4TA 3APGA 3EKGA 1W5PA 1UP0A 4ZVJA 4B3KA 1QU4A 1GQKA 2DJXA 2JIEA 4JS3A 3IIZA 4MNMA 3O6AA 4GNJA 3W82A 2CLFA 1KM3A 3VCRA 3V0SA 3DG6A 3WMBA 4DUOA 3BAYA 4KGJA 1F7BA 5FSEC 1TPC1 4XKYB 3UWYA 1J2WA 1N8FA 4MJZA 3CLWA 1XUUA 4ERGA 4Y2WA 2VCCA 4O10A 5T8GA 1EDGA 3NO1A 4QCEA 3UWEA 2CFFA 2Z28A 3CM4A 3L0NA 3F03K 3TDFA 2O4MA 1MQQA 2DSWA 3NQDA 2ZTJA 3KVMA 1B9BA 3FHAA 1JL8A 1XD1A 2G3IA 4US5A 4PYSA 3BG9A 3WK2A 5IM51 3O2LA 4QE5A 1KCLA 1Y5XA 1Q8AA 9XIAA 1LRNA 1EQCA 3VE7A 4B5NA 3PZUA 4JOMA 3UA4A 5CEWA 1IWPA 1K7EA 5IDZA 2ZZ2A 1AFSA 2I7GA 3LHYA 1I6NA 3BCJA 1XISA 4XO6A 2BY1A 5FJPA 3QQ1A 2WSQA 4O14A 5D8WA 5KINA 2G41A 1UD3A 4QQUA 3CHCA 1BAGA 2NUXA 1ESWA 2P0OA 3S4TA 4F4RA 5C0QA 5AKQA 3MW7A 4XZNX 1AMYA 1Q6RA 3TTEA 4RZ4A 4Y9NA 1L6SA 3S2LA 3G18A 4Z1CA 1G4EA 3VD7A 1JQXA 1ZJBA 4CNSA 4ZENA 1DEDA 1IGWA 4AISA 5IDIA 2QJNA 2ZX8A 3L67A 3NZ1A 4O0QA 4GH3A 3CS2A 2XIQA 3OG2A 3TOYA 2W91A 1OWQA 4Q8OA 3EKZA 3PZTA 3G77A 2PBGA 3VKDA 2HROA 3E2VA 3WFZA 4G7EA 3V1PA 2D24A 2X05A 2D73A 3TZFA 4LCRA 2VX6A 4CD6A 1XV8A 3VNLA 4S39A 2BVWA 1PO9A 3R0UA 3LBCA 4F79A 5LGXA 2PCEA 4H4IA 3GDLA 3F4WA 2PTWA 3ITGA 3FW6A 4H9TA 3WLJA 1X1OA 3GFXA 2XVNA 3CMGA 1WE5A 3NO3A 4IMAA 4XAZA 1ZALA 1CECA 1DJHA 1EUAA 4CQ8A 4JNYA 1T5AA 2CLIA 1LL6A 2YCIX 3NPVA 1XIJA 2JGQA 2YR1A 2A7NA 2V3EA 1B3WA 3S5NA 1DWJM 1JDCA 3B9DA 5I03A 3R7MA 1GYLA 4KERA 3UXKA 5C6MA 1UR2A 3B8WA 2PDJA 5LIXX 2X7WA 4O57A 2Z25A 2QLYA 1ALDA 1XIMA 1ZU8A 3RLUA 1OC7A 3EBVA 4ZZ9A 2PEVA 4LUSA 1A5BA 5DQPA 2W67A 3TYBA 5JIPA 4FNPA 1JRCA 4KESA 3PP7A 3FSUA 1ADSA 1TVLA 4IGSA 2DZUA 4MWAD 1Z48A 4A8NA 3P14A 1A5NC 5FF4A 1TFVA 5J8LA 4DYEA 3KL5A 5E70A 3HJZA 4N0RA 2XJ7A 4AZHA 1OBAA 1LG2A 3HQNA 4KRTA 4N4QA 1VFLA 5FF7A 4E8GA 4CD8A 2A4AA 3GG0A 4FNQA 4HK7A 4JIPA 1TVNA 3KS5A 1OGSA 1G4PA 4A3HA 2BVTA 3RX3A 4W87A 4H9ZA 5LXEA 3SQMA 1UZHA 4O54A 5CSYA 4A8IA 1CZ1A 3DYMA 5EFDA 4NX0A 3GG1A 3S46A 2WYSA 2J9XA 3BOXA 3W0KA 1GOQA 2P88A 3DFQA 1CENA 1ZAJA 1V3LA 1W3IA 2A1YA 3DFTA 2L5HA 2I16A 4TUFA 2WKLA 2A7PA 3VMPA 4JQ3A 3EX3A 3S2NA 3C0LA 1Z41A 5MHBA 1QVBA 3T0CA 3NM1A 1GVRA 3FV9A 3W7MA 4HZ8A 3E96A 4UFMA 1A5KC 3PPHA 3P6LA 1K9FA 1RD5A 3FVMA 3SQLA 1F6KA 1N8IA 3M5VA 4FA3A 3U7VA 1GHSA 1JI2A 4C6FA 2ASHA 4NI3A 1B3YA 4BI6A 1PZ0A 1O1HA 3UYCA 3ABQA 3N4AA 2P3ZA 4IIGA 9XIMA 1ENUA 3U7BA 4HZ7A 1JD9A 3LZ5A 1J0JA 3DG3A 3DFOA 4V2XA 1EIXA 4XD5A 3OU8A 3ABRA 2OZ3A 2I17A 3I6RA 4GI4A 1UP3A 1GUVA 3HBLA 1U33A 4K6AA 2WLYA 1E5NA 3M5ZA 2TPSA 1VP5A 2IKGA 2DZBA 4NL1A 2WM0A 4IP5A 3WDJA 4NKCA 3PM6A 3A22A 3SUUA 6TAAA 2E25A 2J88A 4EPKA 1P4CA 1TWZA 5HMFA 4O1BA 3GVWA 3RRXA 3V0UA 4N9CA 2XZ7A 2ZRWA 2AAMA 3SADA 1GNXA 1R3RA 4FOUA 2VGFA 1DQUA 2V81A 4MDPA 3AIWA 2YL5A 4LCSA 2ZVIA 1BRLA 4DVOA 3H2FA 2A5HA 4YCPA 2X41A 1H09A 2YZRA 1FWWA 5ABFB 4P8WA 1YBQA 3RCYA 1A47A 1QPOA 3V5CA 4DJEC 4GNKB 3NJ3A 3WDPP 2VFFA 2PDYA 1W1PA 3BZGA 3OQ8A 3WUEA 3WLMA 3H8AA 1XIHA 4MJMA 4FLRA 3B8VA 1KB3A 1OF8A 1UMLA 1Z8AA 2R24A 3ARVA 3G1DA 4GYKA 8TIMA 3L68A 3HPZA 4DJEA 4C7GA 3REQB 5H6HA 3NPWA 2CXEA 3LB0A 1RJRA 3VD3A 3LCWA 4P7RA 3ZM8A 4H6KA 3DX5A 3W1UA 2ATSA 1NF7A 4K8HA 2QGYA 1XGEA 4MY9A 3ARXA 1KR1A 1ICPA 1W1B1 1VFOA 1EP1A 3LGGA 1EPVA 1KM6A 1R2TA 3PAOA 2OO0A 8A3HA 4G56A 3ZOAA 3L5MA 4NZ4A 5T9CE 5K9DA 4EPEC 2BWGA 5KZEA 4R3UA 1KFJA 1V6YA 1R3SA 4WOQA 5REQA 2GQAA 4B4FA 3RLVA 1ZBKA 1GEHA 4ZQOA 4JN6A 2YPIA 4JNMA 3EDDA 3R25A 4GINA 2YJQA 4IGNA 4PRWA 3BPWA 4WGHA 3CASA 3DOPA 2PRHA 4KRUA 1H62A 4NHVA 4KIRA 2RUSA 4LNYA 4XD4A 5M2FX 3VK5A 1JUKA 3OODA 2BV9A 4AWUA 3IJIA 1FKXA 2ANUA 1A0EA 2P53A 3GVQA 2TAAA 1P0EA 1RHCA 2VX7A 3IGUA 2ZYFA 4Q4MA 1GOWA 2XPKA 1FDZA 1LT7A 1T8QA 3QHNA 1I4NA 3PK7A 4HYVA 1GQIA 3N6QA 2D20A 1CGXA 2Z2AA 2C0HA 2R6OA 3WK3A 4F48A 2F2KA 3HV8A 1MXGA 3NZQA 2ZOXA 4QGCA 5CGTA 1N8WA 4JFWA 1V93A 3G1RA 2QCNA 3CUZA 4HZ6A 1TPEA 2J66A 2QJJA 3NXFA 3SY1A 3QY6A 3WLHA 3LXCA 4MY1A 4HJFA 3PS7A 1WYIA 2D3NA 2VCBA 1XXXA 1XDMA 5ECVA 2NXHA 3BJSA 5C2XA 4Z1BA 3MCNA 4DZHA 3H6OA 4HVXA 4DJFD 1W1IE 4GO8A 1MI3A 4B92A 1F05A 3DC0A 2JKAA 1FXQA 4L4MA 1VGAA 4K68A 1J96A 4UBPC 1JF5A 1QK0A 1QW9A 4ATLA 4GZJA 2AL1A 2E6AA 2XIJA 3PBWA 2CEQA 4GLEA 3ARQA 3G1FA 3NG3A 3VFLA 1DJQA 1V02E 2ZUSA 1W3TA 4C5YA 3DFHA 3GWQA 4U5IA 1OG0A 4LX4A 4Q3MA 4I7VA 4B5WA 4Q8NA 4Q7IA 5FCZA 3TVAA 4QSHA 3CB3A 2HV5A 2FHCA 4H6EA 1OSEA 3LV6A 2XDFA 1G7VA 4QHRA 4MAVA 2WJFA 2Y0FA 3LHWA 4HU3A 1I2QA 4DO7A 3GD6A 7ODCA 2WC3A 4B15A 3BOFA 5CPQA 4FSAA 1UQZA 8XIAA 1YNYA 2PDNA 4Q8QA 7PTDA 2D0GA 4RW5A 5I3HA 1TJ1A 3NDYA 3WQ6A 4FXRA 1W9VA 3KRSA 5DXXA 2OQLA 3WFAA 3GVRA 2PC4A 2GYIA 3BWWA 3GUGA 5PTDA 1JZ2A 2E40A 4OU1A 3VKJA 2EAWA 4BHYA 1W31A 5DY2A 4WXZA 3QSTA 1NELA 1HJWA 3FN9A 1ADDA 3EXSA 4QDMA 1W1ZA 4R9OA 3R58A 3UY7A 3CUGA 2E3ZA 5H8UA 3CIVA 3DG7A 4GI8A 4A2RA 1O60A 4AZGA 1V03A 3A6OA 1EX1A 3ARZA 3N14A 3PZVA 3WH9A 5DANA 1MUWA 5M17A 3CQ0A 1XD0A 1YW1A 2GWNA 1BYBA 5C9RA 2CITA 2BHUA 2WLZA 1KNWA 1F61A 1EL3A 1ECQA 1HW6A 3EWZA 4DWDA 4L1GA 3EPMA 4HSOA 3HF3A 1ECEA 4KEZA 5CH9A 2VL4A 3OW1A 3H7VA 4RW3A 5MF5A 4JPGA 3LBMA 2GDQA 1DJNA 5I07A 1VBGA 1K77A 3F2DA 5LYRA 5CSSA 1CB7B 1X7FA 1J0KA 3URAA 6PTDA 2WANA 1US0A 2X42A 2ZRXA 2WCGA 3CTTA 4IPJA 4WUIA 2C3ZA 3UZXA 2GQ3A 2YA2A 1M1BA 2QUUA 4KWVA 4OT7A 3ELFA 4UXDA 1MSSA 1DL3A 4GZIA 1VS1A 4N7QA 5HWJA 4I9TA 4WOZA 4ERIA 4L5ZA 2VZOA 2CBVA 2QIWA 2DVTA 3QMRA 2B4GA 3NQ7A 2HZGA 1NM9A 3ZSTA 1VBUA 1XKJA 2PLMA 1MQRA 1OGGA 2HK0A 3GAYA 4CEUC 3LLXA 3M1ZA 4Y8EA 3P0XA 4N9EA 1QPRA 4HPXA 4YYCA 2EXOA 1YDOA 4PULA 1TJ0A 1ONXA 3MCOA 4Z0JA 4HD5A 2XIOA 3IANA 3TQVA 1YNPA 2J8TA 3EA2A 1GG0A 3EOOA 2W79A 3SUTA 1TPVA 3QH2A 3QV9A 1ZCOA 3GDRA 2INEA 1E56A 1GT8A 4CQDA 5HOSA 4O1FA 1XLDA 1UPPA 4PBEA 3RJYA 1SFJA 3DEQA 3B40A 5LZLA 2B81A 2KZHA 4ADTA 1DE5A 4R5EA 4NAEA 1IXOA 4P7QA 3F5JA 1OEPA 4MPQA 4EKJA 1FWSA 4QXIA 4WDXA 1OZQA 4E0CA 1SM9A 2ESCA 1TV3A 1KRAC 1J5TA 2HXTA 4NX5A 1MFUA 1AUSL 2VDGA 1IIGA 4IQEA 4US6A 4YWIA 1Q63A 4ML9A 5B7YA 3IWPA 5T9BG 4F3HA 1FWBC 5DN1A 2Q8LA 4N42A 4NNCA 2D0HA 1QCWA 2PWHA 1FCQA 5AFDA 1T0OA 2JEPA 1KFWA 2DEPA 1J11A 4AY8A 3RM8A 5GPRA 3NYZA 3CBWA 4AFYA 4PA8A 2J74A 1I8JA 4LXFA 1IEVA 1ZP3A 4ALDA 5E9AA 4ZB0A 3S6TA 3AWNA 1LOSA 4JXCA 3F5KA 3T2PA 4LJ3A 4K1GA 2V69A 4KCWA 1WO2A 3TC7A 5IFTA 1E6NA 5B7ZA 4GA8A 3VDAA 2WM1A 1QI4A 1L6YA 1TZ9A 5JH2A 2J9ZA 1N2VA 1PUDA 3DGBA 4G7FA 1QWKA 1PIFA 4JHOA 5CSRA 4ERAA 2J7BA 1V0MA 1Q7QA 3H22A 3UXAA 3AIRA 4GACA 4WKHA 4XZHA 2EJ1A 2YYUA 4EF8A 4WY0F 5LHEA 4MB4A 4JTSA 4D6EA 4N9DA 4PCTA 3S5SA 2ATMA 3TX9A 5K2ZA 4MWAC 4GUGA 5HUOA 4XZBA 2J25A 1K1DA 1SJDA 3ABXA 3BMXA 3N2BA 2VVSA 3VNZA 3HMCA 3EA3A 2DT1A 3LBOA 3GW0A 4HNCA 3D47A 4O53A 4E8DA 1HNYA 4ZTXA 1XH1A 3QGAC 4W85A 3TN4A 4AQLA 1VPXA 3VZYA 4IQDA 4MWAA 4C6OA 3BGAA 4I8DA 4D6GA 1FX6A 3WMLA 3RGTA 4HA1A 2CWNA 5CAHA 1S46A 2QF7A 4GX8A 2ZWZA 2WAGA 3FJ6A 1KWGA 3N6JA 5A8NA 2PDHA 4H6QA 2DH2A 2EG7A 3QRHA 1Z9AA 4YXGA 4NAFB 1D3GA 1I75A 5D37A 3QEZA 1J4EA 4NZ1A 2KX9A 1QNSA 3W53A 3OEXA 1TIMA 2INFA 3ORWA 3LLDA 5BZAA 3GXIA 3N29A 3LCXA 1KBLA 1JZ7A 2PF8A 2ZUNA 1ME7A 2BG5A 3CQKA 1GVOA 1QHPA 2F6XA 1DWFM 1DHPA 1LRTA 3AXKA 1E1EA 2E6FA 4UQDA 3S0CA 1A3WA 4MHBA 3B05A 3UXLA 1QTWA 3WNNA 3N9RA 1ITXA 2VEKA 4Y8FA 5DT5A 2PU0A 1CBGA 1R47A 1VFTA 4GVFA 1SPQA 3P61A 1UR1A 1LUCB 2XTKA 1BWKA 4DXXA 5M5DA 4QX4A 2VZUA 4DM1A 3LPPA 2F38A 2HS8A 1XFBA 4W7VA 3IRSA 2ZRUA 2WZEA 3LQLA 2CWXA 5BWAA 3MY9A 3W7LA 1DXEA 3WNPA 3T1GA 2Y4SA 1X6LA 3OA5A 1IXQA 4GCAA 5LIYX 1AQFA 3STFA 3VPLA 1WZAA 1S2AA 2Y1HA 3KP0A 4DBEA 2Z2BA 4NJKA 3PTKA 3VGHA 4JL1A 4UQCA 4UFLA 5EKYA 3WN6A 4IFOA 3TAOA 3QPZA 2A6LA 3LCIA 3W6YA 3EDFA 5HWMA 1Q6GA 1V3KA 1IEWA 2F6UA 3E1F1 3PJXA 4D1IA 3UPMA 4RL3A 2G0WA 3R8GA 3TR2A 1RPKA 3GDTA 4LAKA 3N19B 2QUMA 4NG3A 1TR1A 3KLLA 3DUGA 1SO6A 5M3WA 4E2DA 5I7GA 3MMDA 5DT7A 1R2SA 1B4EA 4LUTB 2V67A 2A2IA 3VC5A 1M65A 3GXDA 4UCFA 4DM2A 2E0PA 3PBVA 4DBWA 1DWIM 5CPNA 3VUSA 4X9YA 2VCAA 3OO2A 3IUIA 3MP5A 3L2IA 4DWSC 2ODOA 4PSPA 1G9HA 4H9YA 5T91A 5KEZA 2Z1WA 3D46A 2NQ9A 4EACA 1JFXA 4A3UA 4Y9OA 2WBGA 3M0ZA 2XG9A 4AWTA 1PZ3A 3ICJA 2V2HA 3AFBA 3CPRA 3GFZA 1S5MA 1OX4A 5F4XA 4HPGA 2NQJA 1HVXA 4UMCA 4M0XA 3BJTA 1RA0A 3E0VA 4HNTA 1VH7A 4AMCA 3LI1A 4UMBA 3TNOA 4JTJA 1O5QA 4GQBA 1GVEA 2HK1A 3EMZA 3UVAA 1UH3A 4JQ4A 5LA2A 3B9AA 3J7HA 2UV8G 3MYPA 4ORMA 4DIAA 2ZXQA 4CNUA 4L7ZA 1OX5A 1XLMA 1NQ6A 4YTQA 5SWUA 3SGUA 1B1YA 1BHGA 1OD0A 4K8GA 2JKPA 2XFWA 4M1BA 5C9ZA 4O16A 4Q7NA 3U2CA 4W9TA 1UUQA 3O8AA 5EYWA 1TSIA 2C6QA 1W5MA 1V3IA 1JUEA 2PE4A 1NVMA 3VGFA 1I2RA 1TV5A 3N11A 4A3YA 3B8TA 4TX9A 3NL2A 2JF6A 4C6QA 3ZYZA 3FAWA 2F8QA 1X6NA 2HPIA 5BW6A 1UUOA 4QG6A 3ZT7A 1P43A 3SCWA 4PBGA 2PP0A 5HNTA 3MO7A 4LNCA 1JCNA 1F6YA 2Y89A 4PFHA 3PC0A 2P3EA 1A5UA 4IL2A 1OZMA 1PKNA 3PJWA 5K4ZA 3BGJA 1R3WA 4MTVA 1E6QM 2JF7A 1O12A 1M04A 2QJHA 1XHGA 2WNNA 4JTHA 3W01A 2DT0A 1ZRQA 5EMMA 3NFUA 4ONVA 4A3QA 1UD4A 4IM4A 1UBPC 3DFSA 2QULA 1GGOA 4XKYA 3UR8A 2QMJA 1AQHA 2Z29A 1XUZA 3GRIA 1TPDA 3WLIA 3FYPA 3AMKA 2Y6ZA 3SRKA 2ONEA 4NJGA 1YPXA 4GYJA 2FIQA 2C1HA 4DJFA 2Z4GA 3DXIA 3NA8A 1GOMA 1XLKA 1VFHA 1OGBA 4I3GA 2H8ZA 1ZZMA 1EDTA 5CBJA 1TJRA 1BQGA 4XBJA 2C19A 2Q02A 4GJIA 1FCUA 3RMEA 4X0NA 2Y5SA 4W88A 2OR2A 3ZWTA 5DY3A 3RPDA 1UWIA 3GNXA 4YVVA 3K8MA 1GCYA 3T55A 2EPHA 2W3ZA 1TQJA 1XLIA 1K7XA 4BY3A 4AD2A 5L9FA 1OC5A 3AOFA 1GQNA 4DO6A 1IT7A 3SSZA 5E0CA 1UD2A 4TX6A 3KBMA 4U3CA 2C7FA 2CLMA 4PUWA 1Z6KA 4HP5A 3BSHA 3LXBA 2P8CA 3WH6A 3WSUA 3IAQA 3M5XA 4AD3A 1VD6A 5EU9A 1W9XA 3S5YA 3NPXA 2CC0A 2TYSA 4AEFA 1MRQA 1RVKA 2XWEA 1UMYA 1VYPX 4FR6A 1HL9A 3U2EA 1U1UA 1T96A 1XYBA 5FIPA 2CBJA 3CL8A 4OHQA 1A5SA 1NP0A 3MI6A 4IGMA 1A5LC 3BE7A 3L0KA 3B8IA 3K8KA 3MC5A 2WNQA 3MU7A 1XRSA 4YJ5A 1W5QA 3HQOA 3TONA 3EXRA 1TELA 2Q8ZA 5M03A 1UD6A 2OO6A 2PAJA 2VZSA 4R7WA 3U4AA 5A8OA 5BXSA 4IJCA 3W7PA 2J8FA 1TA3B 1FHDA 4DJDA 3P8IA 1KM5A 1SW3A 1WB0A 4YHEA 4UOZA 3AS1A 1J79A 3I7SA 4UC5A 4FNTA 3UA3A 1E51A 3S6OA 1H49A 2G5WA 2JK2A 4FK9A 2NVDA 3HU7A 3NIYA 2ZE3A 1K8CA 3N2MA 3VILA 2W62A 1K02A 1I1XA 1VFUA 3IVTA 4EAYA 4F8XA 5I02A 3B04A 1BQCA 3RM4A 1CLVA 5ECUA 4XSLA 5CPMA 2X0YA 4Z2LA 1V0KA 2GVEA 2OFJA 4PSRA 1Z69A 1DHKA 3UNDA 5A6BD 1MMFA 2Q09A 4LY4A 1PJ9A 3CL7A 4LWWA 3GIYA 3G24A 2W0UA 3AS3A 3D3AA 4KS0A 1RLCL 1AK5A 3GZ3A 3M4HA 2BGQA 3MPGA 3FVDA 1XC6A 4UFIA 2ZUTA 4WVXA 4AF0B 3VE9A 4A05A 3A4AA 3N2CA 3XISA 4QEHA 2FHFA 3BARA 3ME3A 1MO0A 4F0HA 3LNPA 1PIGA 4BCEA 3AIBA 2HXUA 3HG2A 5G2HA 4LYQA 4XZIA 2ISSA 4O0ZA 5KITA 4NU7A 2HBXA 2YKKA 2IPJA 2GL5A 2ABAA 2ZE0A 1XLBA 5J5RA 3GFYA 2HPMA 2R1MA 1R3VA 1YDVA 1XJBA 4KIEA 3CU2A 1VYSX 3S9ZA 1I2NA 4K36A 1OINA 1H7RA 4CU6A 5I23A 1DIKA 3AZTA 1SW7A 2B31A 3LHUA 2XN2A 1TV7A 3SW6A 2P5NA 1FHLA 3CZLA 4P2VA 2AL2B 1XKYA 4K8EA 4LVDA 4I6KA 4IP7A 4O18A 5A2AA 3U5YA 1KM0A 1LLOA 1VBRA 3HGJA 3K46A 4MNJA 3VKAA 4MB3A 2YXOA 4FXJA 5JUVA 3MUZ1 5D38A 2Z26A 1Q8JA 1TR9A 3O3RA 1K4HA 3H2CA 3UXDA 4IPIA 4C6PA 3QMSA 4EP8C 4QE4A 1UKPA 2PTYA 3VI2A 2QCMA 1GZJA 2FVLA 3PNUA 3N34A 2Z2UA 1WKYA 1RPXA 2WC7A 2D1ZA 4RE4A 1EH9A 1SFLA 5FL1A 2PWGA 3CEPA 1LOQA 2RDWA 1F2JA 1SGJA 1PDYA 3C2EA 5KTLA 3L4XA 1TO3A 2EO7A 3QN3A 3LPGA 4Z42C 1EFZA 4CU8A 4XG1A 3GLCA 4WKAA 3RLGA 1G7UA 3SZ8A 5IBXC 3MBFA 3V75A 3KW3A 4NNBA 1HG3A 5KSWA 3PY2A 4E4FA 1R3QA 2BOGX 2GOUA 4KWUA 3W1QA 4Q8UA 4A6GA 2NLIA 1WKDA 4QDWA 3CZEA 1VBHA 2CLPA 1ZGDA 2WHJA 3APYA 1F74A 3BG3A 5ABFA 3L23A 1W0MA 9RUBA 1NEYA 4JTUA 1ME9A 2OG9A 2B7PA 4MVAA 5CJ5A 2JEQA 1HL8A 1KCKA 4HNNA 1RQHA 3GU1A 4UQ9A 3C86A 2Q01A 5FJUA 1TMLA 4K37A 1P7TB 4GVIA 2E6YA 5DMMA 1W2PA 1QATA 4QISA 2IQDA 2QCDA 3KRBA 2XWDA 3P5YA 1XIBA 2OX1A 3MUIA 4X63A 1QBAA 3ZR4A 3HZ3A 3JS3A 3KOYA 5XIAA 5CGMA 2BGSA 4BWLA 4W5ZA 3REQA 4H83A 4AYSA 3LUTA 3VIPA 1HGYA 1ITCA 4XWUA 1JNDA 3W75A 1RQEA 3PBYA 3II1A 2XN0A 1OFRA 1TKKA 1UH2A 1PVNA 4S3CA 1B3OA 1PCKA 3GNOA 4PCNA 1O5RA 1UWTA 4M82A 1RCOB 1JF6A 1US2A 4IH3A 1LG1A 3LU2A 3NEHA 3CC1A 1OC6A 1XINA 1A53A 1B57A 4IHCA 3VGBA 2VD9A 5D9MA 1W1YA 3RJXA 3GX9A 2FMNA 2WMHA 2BODX 3JW7A 3KM8A 1GTHA 3R4IA 4XZ9A 1XLCA 4QM1A 2GSEA 1TPUA 3ARTA 1I2OA 1ONRA 3W1NA 2A85A 2YB1A 4ILSA 1OFQA 1X39A 4PRRA 3KLKA 2OU4A 4P8UA 3V0TA 3LCFA 3CLMA 4LB3A 2NVCA 3AXIA 4N02A 1M7PA 1OFPA 3BLDA 2IKHA 5HQLA 2O7SA 1NWUA 4JHMA 5HMDA 1D3CA 1SSGA 4WZHA 5E09A 3PG8A 4IMDA 5T26A 3QFEA 3KBWA 3VNIA 1VRDA 3NQ2A 1JDEA 1Q66A 3AC0A 4FLSA 1YRRA 3EDEA 4JTKA 4NZ5A 3SCRA 1DJWA 1KTCA 2V30A 2Z1BA 4UR8A 2NV9A 1MXSA 4ENLA 3U0HA 4HNOA 3URBA 4Q8VA 3CT7A 1IEQA 3WKZA 2AQWA 3LK6A 1PAMA 3TAKA 4Q4RA 4V1YA 4M8UA 3IS4A 3T0TA 2CETA 1OIMA 4ZBCA 2A7RA 4CQCA 4H8UA 3BANA 3T0AA 5AC5A 3QR3A 4FB7A 4I7WA 4QITA 1KA9F 1BSIA 1UZ4A 4I9MA 4GK8A 2DVXA 3GW3A 2BSLA 3UESA 2UY5A 3FFSA 4UB9A 4UOQA 4W7WA 5FEWA 1GW1A 2KAUC 3SSJA 1VEPA 2E5BA 3A3HA 1CWYA 4DY1A 4GJJA 1IZCA 2PDKA 4XUGA 1JZ8A 1KBBA 3KHDA 2FZNA 3HOJA 4OOZA 3FA3A 1VPYA 1OCNA 4WY0B 3KVJA 3SUSA 5A6SA 1EO5A 3TWBA 4YTRA 2OODA 3RM9A 2G3FA 5FJOA 4CD5A 2XU2A 4KH2A 2Y70A 3GTIA 4C7DA 1FUYA 1O66A 1RCXB 3MUY1 4IWWA 2D2JA 2IUZA 2PGWA 4W89A 2VKZG 3AJXA 1W56A 1JFHA 1EGVA 1JPMA 1WP6A 3CWOX 3RLHA 4H7CA 1SMDA 2EG6A 2ZCGA 3GSMA 3W7KA 2WO5A 5A8MA 1IGSA 3GDMA 2PDQA 5A8GA 1EP2A 3A64A 1I1WA 1RQBA 1HJUA 1SZGA 3A23A 1KC7A 3P8JA 4B16A 2GGJA 4X2RA 5AB3A 3M0XA 1RBLA 3W85A 3K8LA 2R82A 4Q4SA 1H1YA 3OZMA 2QF8A 4RX0A 3E6EA 4A22A 3B97A 1KXVA 2DDXA 4F0KA 1EJVC 2IPGA 2PDIA 2QJIA 2QJMA 2FGZA 1TCDA 2ZXBA 3F7JA 5E5CA 4C6JA 2WB5A 3G8RA 1AG1O 1XLAA 3Q2DA 1BPLB 3PHAA 3AU2A 3AXHA 1HKWA 3DYOA 2X2GA 3TMQA 4GZEA 2V3GA 3VKCA 3GIQA 3KBVA 1NFBA 1HL2A 1TZZA 3GXPA 3BW3A 3TN5A 3B9OA 2BTMA 1ZUAX 3KL3A 2OTDA 3MHUA 1H7WA 1V7YA 3RO6A 4C6EA 1L6WA 4R7JA 2V68A 4YMZA 1IR2A 2ISWA 4ACZB 2QUVA 3B0YA 4YIWA 2IS7A 3C61A 4YLWA 3WQWA 3DU0A 3A24A 1E73M 4M6QA 2PU1A 4NXKA 5D2VA 1GYNA 2HQAA 4ROQA 1K3UA 3QY7A 1VENA 1ZJAA 5I77A 3SDOA 1MZRA 3ERPA 3KVLA 3SCTA 3TE9A 3KRZA 3CWHA 2QAPA 4AIUA 4EPBC 2YB4A 3SM0A 2F84A 3EMQA 4S3DA 1F3WA 1SZEA 4LRTA 3C4UA 3IGHX 4JD4A 3QBUA 1BGGA 5D04C 1KBIA 3NOYA 4JTDA 3EOEA 2DU2A 1XIGA 3G5EA 2VQTA 2VX4A 4I90A 3NEVA 4ATWA 2F6KA 3OVRA 3PR2A 5AYIA 1OFBA 4HA4A 4PMXA 2J62A 4RJEA 4FMVA 1H11A 1EB3A 3O63A 3S42A 3ITYA 3TC6A 4GUHA 4QROA 3L4UA 1MEHA 1TTIA 5FEXA 4LQ1A 3BMVA 4DXKA 1JIBA 1WXZA 1ZNNA 2WJDA 4FOJA 3W27A 4JYDA 1LZOA 2O92A 2PTDA 1FWDC 4HB7A 2FZ8A 2OGJA 2H8XA 4DXVA 3C5QA 1XC4A 4HMEA 1UYQA 3UPBA 4CCDA 4XK2A 4MYXA 2XVPA 6CGTA 1C29A 4CUCA 4UTKA 1GONA 1BTMA 3L2MA 4RK8A 4B4HA 3GH4A 3RPMA 5D33A 2CYGA 4XVDA 1LM1A 3S5ZA 4G5DA 4AVFA 2Z7GA 2DVUA 1AL8A 3CPGA 3VOGA 1QPQA 3LCLA 3R1ZA 1XL9A 1XRFA 4UZSA 3Q94A 1QNRA 3S1VA 1W9DM 1F6PA 4KW2A 4IXXA 2NX9A 1YHTA 4GC3A 3E3HA 4CQ9A 1DTUA 1SJAA 5CZKA 1O68A 1TPWA 2WC4A 3W2KA 2OWWA 3UR2A 3WJZA 3TK7A 3TFXA 2YL9A 1ZTVA 3MSYA 3Q58A 3M16A 4IX0A 3N3MA 1U22A 1EZ2A 4H2HA 3NURA 1NJJA 3R43A 3KOWA 3V18A 2W27A 1YPFA 1W3JA 4QJ1A 2CERA 4RR4A 5ABTA 1ADOA 2XYLA 1I2PA 4JDBA 2FGLA 5CPTA 5I3FA 1EDQA 4AX6A 3C2YA 3TYCA 5D9PA 5CGQA 2I57A 2FPVA 3PZMA 4PRTA 1AW1A 1OYAA 1VLIA 5XIMA 1PBGA 8RUCA 1L0PA 1NOFA 1QHZA 2QUTA 3GNDA 3JRKA 4GGBA 4HOXA 5CZSA 3VX1A 3W28A 5LA0A 5AC8A 1S2TA 1NDZA 3WQ4A 4MKSA 4B5SA 4A4AA 1NWTA 1S3TC 4WSKA 4OBRA 3TJIA 5A6BA 1QJWA 4YWSA 1BYCA 2C16A 1U2YA 3LRKA 4S3AA 3V3WA 4S2BA 3DDMA 3OGVA 4HA0A 5FJRA 3CYVA 3RNDA 3SO7A 3HPAA 5IHSA 3M0HA 3VM5A 1A4LA 4XBKA 3T09A 1MW3A 2E7FA 1G5AA 1B0IA 4NRRA 5B80A 1IWAA 5CBBA 3PFRA 1J0HA 5FAGA 4IF2A 1V6UA 1JYWA 4MJ2A 4M6UA 4NAFA 1K6WA 3ZXWA 1F4AA 4H19A 1GVFA 1VBJA 2YL8A 4LV4A 4AIEA 3HGSA 4E4PA 3VDCA