1W3LA

Endoglucanase cel5a from bacillus agaradhaerens in complex with cellotri derived-tetrahydrooxazine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE 5A
publication title Structural, Thermodynamic, and Kinetic Analyses of Tetrahydrooxazine-Derived Inhibitors Bound to {Beta}-Glucosidases
pubmed doi rcsb
source organism Bacillus agaradhaerens
total genus 121
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1w3lA00
3FNDA 3VM5A 1MXGA 1DTUA 2IUZA 1ZBKA 1C90A 2WPGA 2PI6A 5FD0A 1WCGA 1QNSA 5HNNA 2BY0A 1W9DM 5LA2A 1WPCA 4NI3A 1JYXA 1H41A 3FAXA 2GFTA 2AOSA 1B9ZA 8CGTA 3L2MA 4E8CA 3IAQA 2WCGA 1JAKA 3A6OA 3O6AA 5ABGA 3EDEA 3TP4A 4AY1A 2DSKA 2QMKA 1FP8A 3POHA 1D2KA 3BC9A 1R7OA 3RM8A 2WC4A 1UD2A 1QNOA 2CEQA 1WNOA 2WSPA 4MDPA 1CTNA 2WVVB 1WO2A 3VIHA 1BVNP 2J7BA 1WZLA 1LG2A 2ZX5A 1WDRA 3KZSA 2WHJA 4MAVA 1FH8A 1DHKA 1PX8A 3K8LA 1QNQA 1E4IA 1H49A 2BVDA 3WF3A 1RH9A 1UA7A 2XFYA 1QNPA 2YA1A 1LL7A 2J75A 1C92A 2UY2A 3PZUA 1XYFA 4JFTA 3FW6A 3RCNA 1U2YA 4DM2A 2CCRA 2WKGA 1ZBVA 3A4AA 1W3LA 3TTYA 4TTUA 4BF7A 1XCXA 3WQ4A 1HKJA 1TMQA 1NARA 3PZ9A 5JBFA 3UETA 3M6DA 5BWFA 3OZPA 1TVNA 3AISA 3WEMA 3PZGA 5IHSA 3AS3A 1QBAA 2XGIA 1V3JA 1AVAA 1UWUA 1ZBCA 1UKTA 2XSAA 4OIFA 1VFFA 2W5FA 3WQ6A 1ZL1A 3WD2A 3CMGA 3GBEA 4UZSA 4E4PA 4H8HA 2UY5A 2E8ZA 5IFTA 5FOOA 1W9VA 4FLRA 1E1FA 3WF0A 2FDMA 4GZIA 2D1ZA 3BAKA 1PX4A 1BYDA 1OCQA 4XUYA 2CIPA 2PWFA 3OG2A 4D6CA 3AIEA 3MKKA 1HP5A 1LL4A 1LWJA 3DYPA 3KE0A 1SR0A 1MFVA 1IT0A 2DT2A 3SUVA 3FHQA 4HU0A 3W81A 1TCMA 2VCCA 1OWQA 3VTRA 2O92A 1BGAA 4OOZA 4AW7A 1HKKA 4W89A 4B3KA 5A2AA 5CLTA 5ECUA 1UR1A 2RGLA 1TUXA 1ZJAA 5JIWA 3OB8A 3VIPA 2PWDA 1PX3A 1XYZA 2E40A 4HMDA 2FGZA 2WVVA 3OLIA 2FHCA 2BVTA 4MJ2A 3CHDA 1WDQA 2W66A 4QFUA 1OD8A 1B3WA 1BG9A 3TONA 2EPMX 4URIA 4JCMA 2V5DA 3LPGA 5LA1A 3GNRA 4CD8A 5HPOA 3S2CA 1AQHA 1W9XA 3W25A 1W1PA 1X1NA 4P8XA 3KL0A 2J7GA 4EE9A 4M81A 4FMVA 5E9AA 2D0HA 3W24A 1E0VA 1XSIA 2BHZA 5BROA 1JYNA 4JKKA 3WMSA 4AZHA 3T2QA 2WXDM 4PUDA 4GXPA 2VVNA 3HMCA 5IXEA 1NWTA 1JFHA 3EMZA 3ARZA 4Z2GA 1E55A 5GNZA 1B3YA 3ZR6A 5A2CA 4UFJA 2WLZA 4EAMA 1VEPA 3DYMA 3D3AA 4PBGA 3THCA 4JFVA 1BF2A 4TVDA 3ARSA 3MMUA 5CLWA 3EMQA 1U33A 2VTFA 1OGSA 1G1YA 2F61A 2UY3A 1UKPA 4H2CA 5CXPA 2EXOA 4U33A 4GI8A 5CQ1A 5GQBA 3NJ3A 5DMYA 4JFUA 2D23A 2WMGA 5CGMA 3AYRA 4ACZB 1U30A 3BMVA 2F8QA 2EJ1A 1JG9A 4FLQA 4W7WA 2WMFA 3MU7A 1CPUA 3AIVA 2O9PA 5E09A 4LX4A 4BQ2A 4GIAA 4UFMA 4JL1A 4PMVA 4CD7A 4HZ8A 1GQKA 3VMPA 5I77A 4EK7A 4D6JA 3KWXA 3AOFA 3POCA 1PZ2A 1UD8A 5A6MA 1OGGA 2WVTA 3AIUA 3NDYA 4PSRA 1E6NA 2EPNA 6A3HA 2D0GA 3WEZA 3W37A 4TTGA 3VIIA 5FL1A 1VFUA 3HU7A 1V3IA 5HPCA 2WZIA 1QI3A 4RE4A 4DUXA 1EDTA 1UWQA 2ESCA 4HOZA 2A3HA 3OIHA 4P8VA 1E5JA 3VVGA 4H41A 1E71M 1MXDA 3VOCA 4C7DA 4JHZA 2DSZA 2ZXDA 5KZ6A 2XM1A 3SCOA 1WB0A 1UH4A 3VKKA 1TG7A 1XV8A 3BAXA 1QOXA 3ARUA 1WZKA 4JAWA 2YBTA 3WNMA 2XHYA 4Q7NA 1HF6A 3VGHA 1HT6A 3M07A 4UR9A 1E73M 3W28A 1W32A 3MUIA 3UESA 4X0NA 1QI4A 4JL2A 3WELA 3AHZA 3GH4A 1HN1A 4NRRA 5EB8A 2DIEA 5AY7A 2VL4A 4AWEA 1VIWA 1UA3A 4R27A 1J0KA 2WMKA 1E3XA 2WK2A 3II1A 4D72A 4QP0A 5E70A 1OIMA 3SEPA 3A3HA 1HNYA 4W93A 3GNOA 1VEMA 2W67A 3WH6A 1EQPA 3AFBA 1ISVA 4OJYA 4PSPA 5DEZA 2VC9A 4MB5A 1JZ4A 4AZ7A 2GJXB 3WIJA 1CGVA 2JF6A 4BS0A 2VCAA 1H4PA 5DT5A 1JD7A 3ARWA 1GOQA 3N17A 4J7RA 3EDDA 2VZSA 1B1YA 1YQ2A 2ZXBA 4MNKA 1KGWA 4LYPA 3L4XA 4AZ6A 3AZSA 4IISA 5E0CA 4ATLA 3CMJA 4J27A 3OLDA 1XRVA 2XPKA 5IDIA 4GI6A 1CNVA 1M53A 2OWWA 3NYDA 1GOKA 4DUWA 4DWSD 3GXDA 1BHGA 1NQ6A 3OA5A 3BLKA 1QHPA 2CBIA 1FH7A 3DC0A 6TAAA 1CWYA 3VINA 5ABHA 3CZLA 2XGBA 1B3VA 5A8NA 1CENA 1XD1A 1FHDA 2J7EA 4M80A 2PF0A 5I0DA 2YJQA 3MUAA 2CITA 3IJ8A 1D7FA 1J01A 1E56A 1JGIA 2V3DA 1OSEA 5JUVA 4UQCA 1ZU8A 4QAWA 3IAPA 1E1EA 4MAZA 4FLOA 2Y4SA 1WZAA 2EQDA 3VGGA 4AC1X 2CKSA 3WUBA 4KGLA 3WQWA 3WENA 1WKYA 1EQCA 2ZUWA 4P7RA 5HXMA 5IFPA 3VDHA 2JE8A 2O9RA 2XVNA 4IUGA 2Z1SA 4HZ7A 1XHGA 1MYRA 4KH2A 4PCSA 4UOJA 4CU6A 2VVSA 2WVSA 3SCRA 4XV0A 2BXZA 1UH2A 2JEPA 2ZUUA 3VMOA 3A4WA 3TTOA 4GQQA 3BCDA 5EFFA 3WF2A 1QHOA 3APGA 1HJXA 2XWEA 3VILA 2WCAA 4W8AA 2E4TA 2V5CA 2DH3A 3QHNA 2XIBA 1W3KA 4JZ5A 3CZEA 5CGTA 1HJWA 4AIOA 4PUEA 3MSGA 5FCZA 1BYAA 3BLPX 3VUPA 2WVUA 1KGXA 1C93A 1W9BM 5GNYA 3WUGA 1UKOA 4DWSC 4BZYA 4Q22A 3MV01 2J7HA 1CXLA 2DQXA 2C8NA 2EO7A 3PBGA 4HTYA 4X0VA 4PCTA 1GVYA 1Q6CA 1GONA 1HJQA 1RP9A 3NSMA 5GNXA 4E2OA 1JZ6A 1RPKA 1O6IA 2YDQA 3AMDA 3AIBA 1LQ0A 5A8OA 1RP8A 5BXSA 3T2PA 1FHLA 1WE5A 3PZNA 1PEZA 3L4VA 1N82A 2OSWA 1EDQA 1Q6EA 4OOUA 2GSJA 3PTMA 4D6GA 4D1JA 4YPJA 1E40A 4W85A 4D6FA 1A3HA 2IXVA 2X1IA 2ZOXA 1E43A 3CZ8A 3ZT7A 3WDPP 2GK1B 1GQJA 1V02A 1HVQA 2OSYA 1HKMA 2VZVA 2VURA 1K6AA 4AISA 2EPLX 3NUKA 2FH6A 1J10A 3ZJ8A 4B16A 2CBVA 1XGZA 4LYQA 2E8YA 2D3NA 1QI2A 3W38A 2J78A 1VB9A 1DP0A 3W53A 1E6RA 2YDSA 3AS0A 3THDA 4F9DA 3TA9A 1V03A 1G94A 1BSIA 1NM9A 1H2JA 4DM1A 2J47A 4CVWA 3WDQA 3WF1A 3AHXA 4OUEA 4PN2A 3CTTA 4AD3A 4W88A 2CPUA 4F79A 1J0YA 5BRQA 3PZOA 3T09A 3RJYA 5AC5A 1CXKA 5BXTA 3GTNA 1EHAA 5C71A 2ZXAA 3RPMA 4YN5A 1LLOA 1ISYA 3AMGA 4PMRA 2OYKA 2FH8A 1HKIA 4D6IA 4UFHA 5JBDA 1HP4A 2VI0A 2WC7A 1JYVA 1KQZA 4YHGA 3MMDA 3U5UA 2A3BA 2TAAA 2V3EA 4GINA 4AIEA 1G5AA 4D71A 2JIEA 2PWHA 3CGTA 1VBUA 4IPLA 4JIEA 5E6ZA 1MW1A 3LPOA 3VGBA 3WNKA 1GPFA 2WBGA 4NRSA 4L4OA 2YIHA 4BQ4A 1BAGA 1UR4A 2VNCA 1JF5A 4CU8A 2XUCA 4W7VA 1GOIA 5M03A 3M46A 1R7AA 1OT2A 3ARVA 4H8VA 2G41A 1Q6DA 4RL3A 1ITCA 4UOZA 4TVCA 3AMKA 3WMBA 2DH2A 3FY1A 3M7SA 4UFKA 3GZAA 1UZ4A 4W5ZA 1X6LA 1DWGM 3SCTA 1ECEA 3CUIA 2GK1A 4EANA 4UNIA 3SUUA 4BQ5A 3KL5A 3GYCA 4W87A 4RE2A 1UQZA 1M7XA 3EMCA 2VR5A 3U7VA 5I2UA 4U2YA 2W92A 4U3AA 4ATWA 3VNYA 4WK9A 3NIYA 2ZWZA 1L8NA 2CBUA 3O9NA 2VRQA 1ITXA 2JALA 1H3GA 1US2A 1CEOA 3QGVA 4J28A 5A6AA 1D3CA 3DECA 2VR4A 3G6LA 4AYSA 4LGXA 4UQBA 3WUFA 1KR1A 4LXFA 4B15A 3GXMA 2UWFA 3FN9A 5HOSA 3N15A 3WFZA 4B3LA 4AZGA 1DEDA 2JIWA 1OB0A 3EDJA 1LWHA 2CHNA 2YA2A 1V3LA 3VIMA 1TE1A 4F8XA 3PZIA 2WW5A 3N13A 3AXHA 3ZQ9A 1MWOA 1PPIA 3A4XA 4ZXOA 1EDGA 3OLGA 2V3FA 2PWEA 4CU7A 4JKMA 1I1WA 1E6SM 4V2XA 3EBVA 4B9ZA 1KWKA 4RE3A 2WMJA 1MW0A 4ML4A 3WH9A 2CERA 3N11A 5E6YA 3AIQA 1KGUA 4K68A 7TAAA 1GHRA 2QHAA 2A3CA 4N0RA 2G4FA 2DEPA 2W91A 1ISZA 3UG3A 3MO4A 3B9EA 1CGXA 1UD3A 3K1DA 3L4TA 1V02E 2DT3A 1PBGA 2VMFA 3RIKA 2O9TA 2J7FA 3PTQA 1V0LA 1KQYA 1CLXA 1GJWA 1HL8A 3CUHA 3CHFA 4M82A 4AZ5A 4U2ZA 5AYBA 4CUCA 2ZUSA 2QV4A 4Y7EA 3MUZ1 1I75A 1TA3A 3VDBA 2X8RA 1JI2A 1W9PA 4YHEA 3WNLA 3PZQA 4AD4A 4PMQA 1PIFA 2UY4A 2E3ZA 3EYPA 3WNPA 2VX5A 1GOOA 3VPLA 1UQYA 3CZGA 5DT7A 4AD0A 2J74A 1E6XM 1JZ7A 1O7AA 5A3HA 2WWCA 5HDRA 2ZUTA 2BS9A 1W2PA 4PYSA 1E9LA 4PTXA 1ZS2A 4MJ4A 2EEXA 5DO8A 2BXYA 2WMIA 4GZEA 2YKKA 3UG4A 2WC3A 3CUJA 3W29A 2X05A 1V6VA 1AQMA 1FA2A 2GUYA 5A8PA 8A3HA 3UERA 1G0CA 4MB3A 2PB1A 2NW0A 1JXJA 2WYSA 5I6SA 2W4XA 3T08A 4MDOA 2WZHA 3PHAA 1NWUA 3AYSA 4P7QA 4EKJA 2ZUMA 2XSBA 3OGRA 1UHVA 2BVYA 3W6MA 4WSJA 3WQ5A 4Z2JA 1BYCA 1XD0A 1WDSA 2CXGA 1L0PA 3AS2A 5EBAA 1EH9A 4M24A 1CGWA 2WKLA 1SMDA 4GO9A 2Z1KA 4D1IA 1QNRA 1CXFA 5A8MA 3VX1A 3WFLA 4J3XA 1US3A 2HISA 3UEQA 3BAWA 4ZE4A 4OBRA 4W86A 2VJXA 2VX4A 3VDAA 3QOMA 3WY1A 1VBRA 2X0HA 3GM8A 1KR0A 1CXHA 5BXRA 2AMGA 2XVLA 2YL6A 3AMCA 2E9BA 5A95A 3WD4A 4U5KA 2QPUA 2ZIDA 3MMWA 1ISXA 1NWRA 1QW8A 5A1AA 1QVBA 1BLIA 1TFVA 4NZCA 5ABFB 1J11A 5JIPA 3QR3A 2J79A 1J18A 4R5EA 4HPGA 5AC4A 5BCAA 1CBGA 3CBWA 1ZBWA 4HOXA 1V3MA 1E72M 1Q4NX 3MS8A 1VF8A 2VO5A 2G3MA 1S46A 3LPFA 4HA1A 4H8UA 2QPSA 1JNEA 5A8QA 1EGZA 4NSBA 3WSUA 2E0PA 3AICA 3DYOA 1AQ0A 4QLLA 1KXQA 1BGGA 1W1YA 1KB3A 3W82A 2Q8XA 2J7DA 2OWXA 3BAIA 2OYLA 3OGVA 3VMNA 1EA9C 1WZMA 4Z2HA 3VGFA 2E9MA 1H11A 5I5RA 1CXEA 5M3WA 4IM4A 2ZUNA 3F4VA 1UD4A 1BFNA 4AXNA 1A47A 1KBKA 3W6LA 1CDGA 1J12A 5BXPA 5AYIA 5A6BA 2YBUA 2D3LA 4J3SA 4LPCA 3GNPA 4TX6A 3ALFA 2JEQA 3NCOA 2ZX8A 5CSYA 3KL3A 1B31A 2AAAA 4W84A 1E6PA 2J77A 4PMDA 1W91A 4GO8A 1GUVA 3OZOA 1JD9A 1GJUA 3QHOA 5DFAA 4W8BA 1NOFA 4S3JA 1OD0A 2XYLA 3AMLA 1E5NA 3PZTA 4OBSA 1M04A 1V6UA 1XSKA 3WKZA 4P8UA 2ZUVA 4NF7A 3WDIA 2J4GA 2CBJA 1E3ZA 4W7UA 3L4UA 1NOWA 3ZJKA 2DIJA 5ABFA 1MW2A 2ZXQA 3BCFA 1EIBA 3UR7A 1K9DA 3B9AA 3LPPA 4KRUA 4PMXA 4P7LA 1C8QA 1E4NA 1QHZA 4H04A 3HN3A 3SUTA 1JZ5A 1FP9A 1VEOA 4FK9A 3DHPA 4D6EA 5CPTA 1FOBA 2GVYA 2XIIA 3WMCA 3K4DA 1UWTA 4PMNA 3I3DA 4CN4A 2VQTA 3NSXA 3FAWA 2D22A 2CHOA 3JUGA 4J3TA 1C7SA 1KWGA 1E15A 1E0XA 1VJZA 2OSXA 2RGMA 1OGBA 4U3CA 2X0YA 3AHYA 1CXIA 2ZX6A 1HJSA 3FXYA 1EO7A 3F5LA 5D4YA 1HVXA 5LYRA 3WH8A 2YL8A 1KBBA 1SFSA 1X6NA 2HVMA 5DF0A 1OBAA 1GZJA 1UKSA 4PRWA 4XZWA 3BAYA 1GOWA 9CGTA 2E9LA 3ZO9A 1KXVA 5A2BA 1H09A 3WBAA 5M5DA 2VT0A 1NWSA 1UR0A 2WSKA 1OINA 1MVYA 1M01A 3RM4A 5D9MA 1B3XA 1UH3A 1DWIM 3GBDA 4GKLA 1V3HA 4DUVA 4LYRA 3SCQA 4PMUA 4HP5A 2Y2WA 2YLAA 3K8KA 5JBEA 1ODZA 3PTKA 4GPNA 4E8DA 4IPNB 4PMYA 3L4ZA 2GJPA 4MADA 2QMJA 1NH6A 2DSVA 2W62A 1MQRA 4WF7A 3WUEA 1VAHA 1KCKA 1BYBA 3CLWA 1VFMA 2BFGA 1J9YA 3AS1A 1HXJA 3SURA 1R86A 1TR1A 1BVZA 1V0MA 5C70A 5D8ZA 3N04A 3CO4A 2NT0A 3U5YA 2ZWYA 3ZR5A 4TXEA 4BQ3A 4ZEPA 3T0BA 4UTFA 4GI9A 3N12A 1EO5A 2J7CA 2G3IA 4HPHA 2D20A 4AZIA 1GHSA 3AZRA 4QLKA 1UWIA 3BXWA 1PIGA 1J0ZA 1E6ZA 4H7VA 1W1TA 7CGTA 1KXHA 1F4HA 4J3WA 2YLLA 2WMHA 2V3GA 4X9YA 3CHCA 4LQ1A 1E6QM 1C91A 4AZCB 4TVUA 4B9YA 1XH0A 1MFUA 3CHEA 5ABEA 1R87A 4QDMA 2WNWA 2JFEX 4UQ9A 1DWAM 2BHUA 2FGLA 5D9NA 5CPSA 4HMEA 2WB5A 7A3HA 1TZ7A 3GXIA 2OLHA 3RJXA 4MNMA 4CN6A 2BHYA 5CJ5A 1SYTA 5C8BB 2VQUA 2BV9A 3BSGA 4GQRA 5E0FA 3EDFA 1XSJA 2J8FA 1NP2A 2G3NA 3L4YA 4AD1A 4WKFA 1GNXA 2VX7A 3ARYA 3WH5A 1QPKA 2DDXA 3NDZA 2XVPA 5IHRA 4F66A 4UQEA 4U31A 3WQ8A 3VGEA 3AZTA 2C7FA 3EDKA 4FF5A 1QW9A 3FHAA 1TA3B 4AEFA 5CG0A 1J0HA 3VDCA 3T0DA 3AIRA 1UYQA 5D9OA 4WSKA 5I3DA 3ALGA 5FL0A 2D24A 4U5IA 3VD5A 1WAWA 1GQLA 2EPOA 5I24A 3PN8A 4XZBA 2F2HA 3ZSSA 2ZX9A 2O9OA 3K46A 3AQUA 3MUY1 1HL9A 2WMIB 3F5KA 3VIJA 3VIKA 2YOCA 3A47A 2DSUA 4N42A 1R85A 4CD5A 4CD6A 2W61A 4AD2A 3VO0A 5FIPA 4J3UA 1GCYA 2VOTA 4M8UA 3SCNA 2CKRA 5LA0A 2WCSA 3K8MA 1QBBA 1XC6A 3BMWA 3AHTA 2D0FA 1C7TA 4AZCA 3VIOA 4M29A 3W0KA 4D6DA 4MNJA 4JCLA 3WDRA 3F5JA 4CGTA 3AXXA 3OGSA 4WLCA 3BSHA 3VD4A 1GOMA 4TUFA 4W8LA 3BGAA 1VRXA 5A6JA 2FHBA 2WHKA 2OYMA 2GJRA 4HU8A 5TD4A 2VRKA 2WHLA 3AI0A 1LJYA 4JHOA 1PAMA 3MANA 3VM7A 1CIUA 1JXKA 5EFDA 1QI5A 3ARXA 3I3BA 1FH9A 3CPUA 1JZ2A 4HA3A 1E0WA 3ARRA 4HMCA 3WL1A 1DWJM 4KRTA 4XX6A 3CZKA 3WD3A 1AMYA 1NP0A 1MQQA 1FFQA 4P7OA 3VD7A 4F9JA 3TOPA 1UD5A 1UG6A 2XJ7A 3ZM8A 1H0IA 1E4MM 1WDPA 3NSNA 3WNOA 4CCEA 1JAEA 3RMEA 2BNJA 1VFOA 4TOQA 3WH7A 2A3EA 1HJUA 2Y5EA 2QF8A 4M56A 5A69A 1CECA 4M1RA 3TTQA 1V6XA 1GORA 2YDRA 5CZKA 3CUGA 1MW3A 3SCPA 2WZEA 1WP6A 2XVGA 3I3EA 1JDDA 2CYGA 4MPKA 2J62A 2BY2A 3WL0A 1V6WA 2WWDA 1ZB5A 4PTMA 1H0GA 4OKDA 3KEHA 1HJVA 1HIZA 5HBFA 2XG9A 1YHTA 3AJ7A 3CH9A 5FKYA 1Q6FA 3VD9A 3RM9A 4CCDA 3SCWA 2W63A 1K9TA 4ACYA 1B3ZA 1KCLA 3UR8A 1CZ1A 4MNLA 5A6SA 5A94A 3VNZA 5A6BD 1JL8A 2DPEA 1EHNA 1UR8A 1EOKA 4PTVA 1BTCA 1HX0A 3W26A 2B31A 2CNCA 3VIGA 4BA0A 4PMZA 1UWRA 5A6LA 1PJ9A 3GDBA 4HOWA 3DHUA 2PC8A 4UFLA 4CCCA 1KFWA 2X09A 4CD4A 1VENA 3N1AA 2YL9A 5GPRA 1TVPA 1GQIA 4UZUA 3MSDA 1K9FA 2G3JA 2V38A 3CZJA 1CGUA 4MTVA 3OBAA 2VZOA 2XM2A 1UR9A 3WQVA 1PZ3A 3SCSA 2DT0A 2VUYA 3LMYA 4JFWA 1ISWA 3PZMA 2GDUA 3WDHA 1Z32X 5EMYA 4A3YA 1V0KA 4ZFMA 1VJSA 3T0AA 2ZE0A 4KGJA 2WLYA 3PZVA 4A3HA 3ZJ7A 3WD0A 3U57A 1OM0A 3WBEA 4V28A 2WBKA 4WKHA 2VCBA 3ECQA 1JF6A 2BY3A 4CVUA 4HZ6A 4WKAA 2ZICA 3SUSA 1CGTA 4W5UA 3AIWA 2X2YA 2WAGA 3BH4A 4A4AA 1JDAA 1MQPA 1E4LA 1IZKA 3QHMA 3WN6A 1CYGA 4UOQA 3RDKA 5BRPA 4AZBA 5CSUA 2VRJA 3GH5A 3GXFA 1I1XA 4QCFA 1OT1A 4ACZA 4ZE5A 1B90A 4UQDA 2YL5A 2DT1A 1DWFM 2Y8VA 4BCEA 1W3JA 2DGAA 3SCVA 1UKQA 1JZ8A 3K4AA 4KMQA 1J0IA 2BY1A 5CPQA 2DSWA 2VZUA 5D9PA 3IJ9A 2Y8KA 4OZOA 1LG1A 4UQAA 5I23A 3WNNA 3AROA 3SUWA 4Z2LA 2WHMA 4PMOA 2OWCA 3UG5A 1B30A 1F4AA 3ARPA 4PEEA 4AEEA 1W1VA 4FLSA 2MANA 4V27A 2XTKA 1GVIA 4JFSA 4J3VA 3S6TA 3VD3A 5I79A 1P6WA 1UD6A 3ZJ6A 3OLEA 1UZ1A 4UFIA 2VX6A 3TTSA 2WM0A 2YA0A 4AMCA 1W9UA 4Z2KA 2Y24A 1J0JA 1JIBA 3SCUA 4DWSB 3RILA 4TX8A 3VIFA 3T2OA 1GW1A 2J25A 2EBNA 2PBGA 3WDJA 4CKQA 1FFRA 3UCQA 3CUFA 4AIUA 3AHVA 3ZMRA 1SMAA 3IANA 1UWSA 4MB4A 3RO8A 2NT1A 1W3HA 4WIWA 1CLVA 1LL6A 2EPKX 4QLJA 4UCFA 2VZTA 1Q6GA 3N18A 4C7GA 3IJ7A 3J7HA 3L4WA 3MV11 1Y7VA 4D6HA 1W2VA 1C8XA 2IXUA 1IZJA 1JI1A 1QI0A 2XWDA 4MB1A 1R8LA 4Z2IA 4L4PA 3ZIZA 1ZJBA 1BPLB 1DWHM 5M17A 4S3KA 1H1NA 1C8YA 2CESA 3N9KA 2JF7A 1UUQA 1B2YA 2XFRA 1EOMA 2PWGA 3E1F1 4C7FA 3BAJA 2WANA 3CIVA 4GZJA 1XH1A 5F7UA 2GDVA 3D5HA 2XFFA 1KXTA 3SIMA 3W4RA 4CN1A 3G6MA 3IK2A 1ESWA 3WD1A 3ZT5A 1XCWA 2A3AA 3VU2A 4ATDA 2CETA 3ZSTA 3ZOAA 3WF4A 3W27A 2GJXA 1JNDA 1V08A 1CGYA 1ODUA 1C3FA 1OIFA 1K9EA 4AD5A 3ARQA 1JDCA 4ZENA 4HA4A 1XH2A 1G01A 2ZX7A 1E70M 1UOKA 3U7BA 3O2LA 3AXIA 5D8WA 4XB3A 3B8SA 1BG4A 4WJXA 5A6KA 1EXPA 5KEZA 4KWUA 4P8WA 6CGTA 5I78A 4QCEA 2NSXA 1M03A 3HJEA 3VX0A 5BYWA 1V3KA 2J8GA 4JKLA 1NOUA 3ARTA 1RD6A 3B9DA 4DWSA 3GH7A 3ZT6A 1B0IA 1JZ3A 1JFXA 2G8ZA 3QOKA 2PBOA 1V6YA 2QLYA 2C0HA 1JYWA 3L2LA 3WEOA 1BQCA 2FHFA 1H5VA 1IV8A 1LF1A 2D2OA 2XVKA 3VGDA 1G9HA 4PTWA 4ZXLA 4P7NA 1V0NA 1UR2A
chains in the Genus database with same CATH superfamily
4BWLA 1IEXA 4Y9AA 1DTUA 2Y8UA 4JNZA 1JPIA 3QPYA 2ON3A 3O16A 2FMOA 2ZCGA 3CIXA 3OTRA 5EMJA 4O15A 1O12A 2AGTA 1H41A 3FAXA 3T6CA 2AOSA 1B9ZA 8CGTA 3KOYA 3BCJA 3L2MA 4E8CA 2WCGA 3A6OA 3CWOX 5B7ZA 2DSKA 2QMKA 4H8NA 2JKPA 3POHA 3BC9A 2E67A 4FX6M 5F2IA 1IT7A 3EOEA 1WNOA 1KD0A 3CK5A 1CTNA 2WVVB 3PWAA 3E0WA 3VIHA 1BVNP 4HA0A 4MAVA 3W85A 1PX8A 1DHKA 3HJZA 4GMEA 4RPPA 2BB0A 5BU6A 3WO8A 1QNPA 5B7YA 1IGSA 3NURA 4XZNX 1YDYA 1QMLA 2PU1A 3HPFA 2PE4A 4DM2A 3DZ1A 3W7IA 1JCJA 1IWPA 3NQMA 4H1ZA 3DENA 3SN0A 4DPQA 3PG8A 3LU2A 5JBFA 2RHGA 3OZPA 1POKA 1TVNA 1P0KA 3WEMA 4RXGA 3AS3A 1QBAA 1V3JA 1VZWA 3UW6A 4L1XA 4OIFA 1VFFA 3WQ6A 1ZL1A 2G97A 1KM3A 4H9VA 1EPXA 4E4PA 1NDVA 4GUGA 4HQVA 5BRBA 2UY5A 1X98A 3PAJA 4A8IA 2EHHA 4ES4A 1KLYA 2FDMA 1XLCA 5DXXA 4IJBA 2PP1A 3KCLA 1BYDA 4GQGA 2Z24A 4XUYA 3TCSA 2CIPA 4GOAA 1Q2SA 1PCWA 3KE0A 3BK0A 3FHQA 4GWEA 3S42A 2QUUA 5C2GA 5EMUA 5T9BG 1UROA 4H9MA 4MG4A 4B3KA 4DO7A 5ECUA 1JDEA 1TUXA 1ZJAA 3AYTA 2FVMA 3KP0A 3VIPA 4RNJA 2PWDA 1XYZA 1ADSA 4HMDA 2WVVA 1OX5A 2FHCA 4JOMA 2BVTA 3B8UA 4MJ2A 3VKDA 3MDWA 1F2JA 3OVQA 2WJZA 4QFUA 1B3WA 3FGCB 5C54A 4A05A 2EPMX 5LA1A 3CT2A 5HPOA 3B06A 4MVAA 1R2TA 3LX9A 3O0FA 3TN3A 4M81A 2OELA 3H4WA 1OX4A 3F2DA 1HTIA 1VFLA 3W24A 1M65A 1EF3A 1E0VA 4PUWA 3Q65A 4AZHA 3T2QA 3FV9A 2YSWA 4PUDA 3W7OA 5IXEA 3OW1A 1JFHA 4IMFA 3CAQA 3EMZA 5GVJA 3W2KA 1E55A 4RCXA 2E6FA 3SR7A 2HDJA 1B3YA 5GNZA 2NQ9A 1E9IA 2PDUA 5A2CA 2GVLA 1VEPA 3SBFA 2XZ9A 5CLWA 2Z6IA 3EMQA 1ZZMA 2Y7FA 2E6DA 3GXNA 2E5DA 1VIZA 2EXOA 4U33A 5CPMA 5I09A 3LBOA 5DMYA 4K8HA 4RJEA 4GJIA 2WMGA 2WSQA 3G1DA 1U30A 2F8QA 5H2ZA 2EJ1A 4FLQA 3SZ8A 4O50A 4W7WA 1UR3M 5C0QA 1KRMA 4GIAA 3UY8A 4Y9NA 1AJZA 1GQKA 3VMPA 4JN7A 4HNTA 4QS5A 5EGRA 3GNXA 2WPBA 3BV4A 4G5DA 3RO6A 3KWXA 3NGJA 2HNHA 3P80A 1PCKA 2QKFA 1OGGA 2WVTA 2WQPA 3C2FA 3M41A 1NFPA 2I7GA 4J5NA 5EYWA 4PSRA 1E6NA 4LS1A 4TTGA 1R3TA 4C6EA 5FL1A 2H90A 2BOFX 3RRAA 4C6QA 1QI3A 3FGCA 3URAA 3I4KA 2GOKA 4CQAA 5FACA 4MKSA 1E71M 1UP3A 1A0EA 4RV8A 3ABSA 5MKGB 5KZ6A 4UR7A 1EPVA 5AVHA 3ARUA 3AUOA 3S1WA 3WNMA 1FCUA 1UJPA 4Q7NA 2O56A 2REQB 4TIMA 1HT6A 1YTEA 2ABBA 1W32A 2X1TA 3VNKA 3UESA 1QI4A 5TF0A 2I9UA 2X7WA 5AY7A 1UOZA 2VL4A 1HGWA 1J0KA 4EVZA 2WK2A 4L5ZA 3FDGA 1FDZA 2W6RA 1M6JA 4IXHA 5E70A 3NO1A 1J6PA 1A5NC 5C9UA 3W1RA 1VEMA 3WG6A 3TNOA 4UTWA 3SQSA 3CQIA 4NNBA 3WIJA 4CQ9A 4BHYA 5E9XA 1XLHA 5CBBA 4PH6A 1JD7A 3B8WA 3QXBA 3QSTA 1XLKA 3NFUA 4J2MA 5CZTA 1B1YA 5BWAA 2ZXBA 4Q8MA 1KGWA 3AZSA 1XBZA 1S1PA 2EG8A 4ATLA 3H55A 4F0MA 4XD3A 4KIEA 3RITA 3TSBA 4GI6A 4A35A 1YDVA 2OWWA 4DJDD 3NYDA 1T0OA 3BDKA 2V5KA 3KRZA 2P0OA 3BLKA 1EJRC 4LOCA 2JGQA 3H2CA 5U4NA 2RDXA 3BW4A 3VINA 5ABHA 4F3HA 3APYA 2DW7A 5MKGA 2ZC8A 3SAZA 1BTMA 1FHDA 2J7EA 2OOFA 1P7TB 3E74A 3HQ1A 3ZLHA 3URNA 4IUOA 4XAPA 3PTDA 2REQA 3MUAA 4JTUA 4O0ZA 1JGIA 1DE5A 1E56A 4HTBA 5CZ0A 4PGLA 4QAWA 2Y4SA 1WZAA 2R1MA 3AAMA 4N4QA 5HXMA 5IFPA 2QDEA 2O9RA 2AQOA 2I5QA 2XVNA 2Z1SA 4HZ7A 5DRCA 3PUOA 1TTJA 4M6VA 2VVSA 1W3IA 1XLIA 2BXZA 2FZ8A 2JEPA 3I7QA 2ATMA 3TTOA 4GQQA 4ZVJA 5EFFA 3WF2A 3TDFA 3GC5A 5AYZA 2WCAA 5C2XA 2VOMA 3TN5A 3PBYA 3IIOA 4O0KA 3EPNA 1YPXA 4XG1A 5FSEC 3BLPX 2WVUA 2QCNA 3I7RA 3SFKA 2OFJA 4IIGA 3EWCA 2E6YA 4Q22A 1LORA 4US5D 1EF2A 1B57A 2RH9A 4PODA 3PBGA 3NM3A 4XUGA 1XICA 1TTIA 1GONA 2GOUA 3N4EA 1RP9A 3NPXA 3L66A 3AMDA 3AIBA 5A8OA 4MWAE 2PTYA 1FHLA 1WE5A 3KX6A 5D02A 3WLLA 1L9WA 2OSWA 1EDQA 3PTMA 3FK4A 4I7VA 3W7CA 3GKAA 4S3EA 4A8RA 4GK8A 2GGEA 2E6AA 4W85A 4MIMA 4C6BA 1SO4A 3BLOA 3WDPP 3M16A 4O54A 5LNVA 4GG9A 3IRSA 3W7DA 2VURA 3E0FA 1ZFJA 1K6AA 4JTLA 4RNFA 3IUHA 4Z1AA 1K03A 2RKXA 3QMSA 4AXKA 2CBVA 4LYQA 2D3NA 3KTXA 1RAKA 3W53A 5KINA 2Z1WA 2YDSA 5MHBA 4MOZA 1XYCA 2P0IA 3THDA 4OQVA 3ABRA 3BUVA 4ORMA 4BF5A 2J47A 4CVWA 3AJXA 5CAKA 3R43A 3LLFA 3UJEA 2BXVA 1X96A 4QXIA 3CTTA 4AD3A 1NFGA 1TJRA 1J0YA 3TJXA 1IQ8A 4ZB2A 1N8IA 3GTNA 2ZXAA 3VA8A 2ZE3A 1TQJA 3AMGA 4PMRA 3GIQA 4HHPA 5JBDA 1HP4A 2F2KA 4AF0B 3U5UA 1WAUA 4GINA 1GTHA 1G5AA 4D71A 4H7ZA 1X8CA 3CGTA 5EKYA 1R3YA 2ZRVA 5E6ZA 3LPOA 2EF9A 3WNKA 1GPFA 4NRSA 3ITLA 3KP1A 1HO1A 1UR4A 2VNCA 4CU8A 3TR2A 1GOIA 2RDWA 3M46A 2G41A 4QX4A 3IEBA 3EKLA 3AMKA 3M7SA 4UFKA 2E25A 3DDMA 3SCTA 3FYYA 3CUIA 2VD8A 4DJEA 4BQ5A 4AAJA 1S5VA 4RE2A 4C6NA 1RD5A 2WM1A 3FKKA 1M7XA 4KWOA 2PRMA 4C6LA 3BTNA 4ATWA 1VR6A 1A53A 3NIYA 1PKMA 1L8NA 4D2JA 3TYDA 1YW1A 3QGVA 3TVAA 1F6PA 4AYSA 3WUFA 3CQKA 1IEQA 3B03A 3SIZA 3NL3A 4B2DD 4B3LA 3H2OA 3EDJA 4KWSA 5FEXA 3UJFA 3PZIA 2WW5A 4O17A 3AXHA 3CQ0A 1NEYA 3A4XA 4ZXOA 5HR6A 3EWYA 2XU2A 4C91A 3S9YA 4NI8A 1WXZA 1B9BA 2WMJA 1GVSA 1MW0A 4LUIA 3VZZA 2CERA 3N11A 4AF0A 3LTSA 5E6YA 1PTGA 2QHAA 4H6EA 3G18A 5AFDA 3IJDA 2UBPC 4S38A 3MO4A 3S1XA 4JDBA 8XIAA 3T40A 5EY5A 1XUUA 3TEVA 2DT3A 1PBGA 1TV4A 4LF1A 2GQ8A 1GJWA 1HL8A 2PD5A 1FDYA 2FB2A 2BVWA 4CUCA 2DZVA 1I75A 1TA3A 4JD4A 3R6IA 1JI2A 1W9PA 3VKBA 3SQMA 4HN4A 1T7LA 1VCVA 1PIFA 2UY4A 3EYPA 3CPGA 3T55A 2VX5A 1GOOA 3TX9A 4I7UA 4YWIA 1OZQA 3IGSA 3FJNA 2NXIA 2ZA1A 3BLLA 2Q8LA 1SZNA 2IPFA 2WWCA 5LNUA 3WLQA 4MPQA 1W2PA 1DJGA 3NOYA 4L6DA 5HQEA 2YB1A 2BXYA 4I5RA 3P0WA 4RDWA 5A8PA 3MT1A 3DN5A 1ML1A 1S2CA 1G0CA 8A3HA 4EXBA 4Q8VA 2PB1A 1JXJA 2Q09A 3IUIA 2P10A 2W4XA 3IGHX 1L6FA 4H6KA 3AYSA 2ZUMA 1PKNA 4LJ3A 1EP1A 1MXSA 4MWAC 3GU1A 4WSJA 2ATSA 3TYCA 1BYCA 1KM5A 1XD0A 1WDSA 5AZ0A 3HOJA 4UNLA 2GQ3A 3G22A 3BL3A 3Q94A 1A3WA 2Z1KA 1QNRA 5A8MA 2Y88A 1X38A 2XINA 3VX1A 3TQKA 4K6AA 1US3A 3E5PA 2WNZA 4OBRA 4W86A 1W31A 4ZZ9A 1TMLA 4NAEB 3CEUA 3QC3A 3TFXA 3BG3A 3EXTA 3V0UA 2E9BA 1NJJA 5A1AA 4KIRA 1XXXA 1EC7A 1J11A 5G4WA 3QZAA 3HV8A 1TPB1 1CBGA 3A4JA 3CL7A 1ZAJA 4R53A 1BQGA 3ITOA 1K7FA 1EGZA 4NSBA 4XZIA 5HK4A 4YTRA 2E0PA 3FA4A 3AICA 3P0XA 4RDZA 1G7UA 3TN6A 4UMBA 1W5MA 3WYZA 1F73A 2Q8XA 4NASA 3OYXA 5CAHA 1R3SA 4XISA 4L65A 3VGFA 2J24A 4KQNA 2Y63A 1EZWA 4AHQA 3RG6A 1UD4A 3UXIA 3WLJA 1LROA 3SSZA 2F6KA 1DXIA 4YYFA 1O94A 4LANA 3SN4A 4NIRA 1R47A 3ALFA 2JEQA 5CSYA 4W84A 1E6PA 2J77A 1S2AA 2J6XA 1JGMA 2NQJA 4YWSA 3UA4A 4A3UA 3QC0A 4ROQA 5DFAA 4ZOEA 1RJRA 3GNDA 1NOFA 1OD0A 5EU9A 4NAEA 1VYPX 4H9YA 2PRHA 2FZNA 1V6UA 4Z08A 1CB7B 4P8UA 3C2OA 4NF7A 3R58A 4EACA 3VZXA 1V93A 6PTDA 5HWJA 3RUBL 2ACUA 3V36A 1X7IA 2GDQA 2GYIA 1LZOA 1VGAA 1DV7A 3L4UA 4W7UA 4N4PA 1NOWA 2PTZA 4CEXC 5K9XA 3NYZA 3O05A 1MW2A 2HJPA 2WJDA 3CNYA 4NYYA 4CNTA 1K9DA 4OVXA 1YX1A 2YCKX 1UJQA 3ELFA 4KRUA 3OJGA 3W70A 4QITA 3GAYA 3TC7A 5T8GA 3HN3A 1JZ5A 2BWGA 5C7VA 1VJIA 3E49A 3GW3A 5FF7A 3B8TA 1ZJIA 3WMCA 3AU2A 4GX8A 4A6GA 2NVCA 2OOGA 4PMJA 3SI9A 2B81A 4J3TA 2WJFA 4K8GA 3GU2A 1VJZA 2OSXA 4S3CA 1OGBA 5I3GA 1FWWA 2X0YA 3EX4A 3ABZA 4GXMA 2QZRA 1CXIA 1F5ZA 4UB9A 4DXVA 3F5LA 4TV6A 1HVXA 5D4YA 1EZ2A 1AFSA 3TWBA 1X6NA 3Q37A 5DF0A 2R1PA 1J2WA 2CLIA 2GPTA 4XZWA 4DNMA 1UP2A 1VBHA 3FOKA 3ZO9A 2ZTJA 2P3ZA 4ENLA 3O15A 3W2NA 4LAUA 4JN6A 4DI8A 2W27A 4EWJA 4UTUA 2Y0FA 2C18A 1UH3A 1DWIM 3WBYA 2V68A 3UXAA 3M1ZA 4DUVA 3VOHA 4HP5A 2YLAA 1ZHAA 3CT7A 5DCDA 3K8KA 1NU5A 3GR7A 4LT9A 4Y8FA 5T9CE 3SRDA 1TELA 3CUZA 4PMYA 3XISA 1FWIC 2D69A 3G3MA 1Q7QA 4RW5A 3EB2A 5DLCA 3WUEA 3EPOA 3MI6A 1EXBA 2ZQ0A 2ISSA 1J9YA 3SECA 3AS1A 1HXJA 3HGOA 3DFTA 2NXGA 3PSWA 3I6EA 1K70A 4HVXA 5C70A 5D8ZA 3GZ3A 5AKQA 4C60A 3TNBA 3CO4A 7REQB 2ZWYA 4BQ3A 4LAKA 3C0JA 4GJ1A 2J7CA 3DFYA 4G7EA 2VDGA 3URBA 1GHSA 3AZRA 3MB9A 1S2TA 1OEPA 4QLKA 3KTCA 3GU9A 3PBMA 5AHMA 1PIGA 1J0ZA 1E6ZA 3YPIA 4X63A 4JQ2A 3T1GA 4J3WA 1NQKA 4X2RA 1E6QM 3OIXA 3CQHA 4O4VA 1UUMA 4MGGA 1MFUA 4NZFA 4MUPA 1SGJA 1AK5A 3CHEA 1R87A 4QDMA 2BHUA 2GGHA 5D9NA 7ENLA 4HMEA 3UJ2A 5LHEA 7A3HA 3GHTA 2WKJA 2OLHA 4E2VA 5HMEA 4MNMA 1NAL1 2INEA 4IQJA 5C8BB 1AD1A 3NQCA 1MNZA 4D9PA 5E0FA 3EDFA 3KVJA 5D37A 1VQTA 4XIMA 4AD1A 1I2NA 2W9MA 4R85A 2VX7A 2V82A 1SO5A 3LRLA 2HVOA 5B80A 1A49A 5DXYA 4ECLA 4Q4SA 1IIHA 5M2FX 2V5LA 4AEFA 5CG0A 1LP6A 2QQ6A 5D9OA 2D24A 4JTGA 4NY2A 3XIMA 2QS8A 3G1HA 3E9AA 3RPTA 4DELA 2YCLA 4HNCA 4PRRA 4UNKA 1FHUA 2F2HA 2VD9A 1L2UA 1R3QA 1YMYA 3S1VA 3K46A 1G6CA 2VEPA 1FWAC 1WOAA 1K8YA 4DYJA 7REQA 2OG9A 3A47A 2DSUA 4N42A 5LZLA 1R85A 5AHIA 3T8QA 2C79A 1O95A 4PBFA 4AD2A 2V2HA 3VO0A 2V5BA 4B5SA 2IKGA 4XD4A 4GZ7A 2Y7GA 3B05A 4E8GA 2CKRA 5LA0A 1DVJA 1XC6A 1MEWA 4LEFA 3TZFA 4GIRA 4M29A 3W0KA 4MNJA 2I5GA 4JCLA 4GFIA 2R1NA 4WLCA 3BSHA 1OADA 4RZ6A 3VD4A 1VRXA 3DI0A 4J40A 2Z2AA 5TD4A 2DORA 3MVIA 1H50A 4JHOA 3E96A 3VM7A 3CV1A 1WV2A 3S3GA 1QI5A 3P7YA 4OV9A 4JTKA 3WLNA 3R2GA 1V5XA 4XX6A 5H8MA 1NP0A 1FFQA 3VD7A 3IWPA 1UG6A 1EWEA 4HK6A 4PFMA 1LOSA 4C6IA 1LTDA 2DUZA 4H9UA 1VFOA 2V2DA 3WH7A 1BRLB 3V35A 3RRXA 5HMFA 1OFEA 3R0UA 4M56A 4UWMA 2VC6A 3W6YA 1PZ0A 1H61A 1GOXA 4YNGA 2YDRA 1O60A 1MW3A 3SCPA 1WP6A 2XVGA 4QJ5B 2PZ0A 4R9XA 3DKJA 2ISFA 3O6CA 2CYGA 3MDUA 3UBPC 3NZ1A 1V6WA 3EWDA 2FZBA 1TPVA 1P48A 3CTLA 4FI4A 1A5MC 2QYGA 2QCGA 1HIZA 3UQNA 4GH1A 4WXYA 1EX1A 3CH9A 5FKYA 3VD9A 3PVFA 1XGDA 4CCDA 4DO5A 3T8LA 4N6EA 2I14A 1V51A 4N9EA 4EX4A 4MNLA 5A6SA 5A94A 5A6BD 3G0XA 1FCVA 4C5YA 4GUIA 1UR8A 1XIIA 2BG5A 3S5YA 1HX0A 2ISWA 1FQ0A 4GI4A 3MTWA 3QYQA 4Q8NA 3VIGA 3TU9A 4FB7A 1UWRA 1QJWA 1F9CA 3GDBA 1T5AA 2PC8A 1S2WA 5HULA 4G6CA 3V16A 4ZO9A 1VENA 3N1AA 3SGUA 1BD0A 2C0AA 1KBIA 1I0DA 1L2QA 3W88A 7XIMA 2ZZ4A 5HUOA 3WX7A 2XM2A 1UR9A 1PZ3A 2Z1VA 3TYEA 3SCSA 2DT0A 2VUYA 3QZEA 1GYNA 1DPMA 3WDHA 1OY0A 1WYIA 1ZRQA 1V0KA 1KM0A 3GB6A 3F7JA 2WLYA 3TCEA 3ZJ7A 3EZ4A 3W72A 4OHQA 4YIWA 4GUHA 4MYXA 4WKHA 3QH2A 5T26A 3GUGA 4L1WA 4GBUA 2BY3A 3FSTA 1XFBA 2PDCA 3OBKA 4W5UA 4LUSB 2WAGA 1QU4A 1Q6LA 4F48A 3NPVA 4RPQA 2V6AA 3B8VA 1CYGA 3RDKA 1ZGDA 3GH5A 3MCMA 5ENLA 1I1XA 4QCFA 4ACZA 1B90A 2YL5A 2DT1A 5LIYX 4PUKA 1LUCA 2Y8VA 3VOJA 4H6QA 4I9AA 4GNVA 2GSEA 3W7EA 3M6YA 3LZ3A 1ICSA 2V63A 3K4AA 5HUPA 3LGGA 3RX4A 5CPOA 3ONCA 4OZOA 1LG1A 4JX4A 3OQEA 3UXLA 4S3GA 2WHMA 5C9XA 4XZ9A 3E0LA 4FNPA 4DEFA 1F4AA 4PA8A 1ZP4A 4AEEA 5IBXC 2MANA 2NUXA 4A21A 1W37A 3QQ1A 5LIWX 1RCXB 1GVIA 1B3OA 4JFSA 3I65A 1Q85A 3VD3A 3QSRA 3W22A 1P6WA 4WJEA 3GVWA 1IEWA 4UFIA 3MZ2A 2H9AB 1GWJA 5DANA 1AD4A 3W73A 5KZDA 4ZBCA 4V1YA 1R3RA 3T2OA 1EC9A 1GW1A 3BO9A 1IYXA 1YE6A 1V7AA 3UFYA 2FVLA 3W1QA 2NT1A 1YDOA 3TMQA 2VZTA 1XYAA 1W5NA 2OZ0A 3L4WA 3TW9A 1Y7VA 4FIRA 2G37A 2BOGX 3AWNA 4R7OA 2NWSA 3N2CA 1OYAA 1F3XA 4MB1A 2IKIA 3P60A 1ZJBA 1ZTVA 5G4EA 1KTBA 2RDUA 1OABA 1Q8AA 3FJ6A 4LUSA 1GYMA 1RCQA 3N9KA 4GLEA 3NL6A 1EOMA 4DBWA 2P5NA 3E1F1 2CLOA 3PPFA 4PB4A 3INPA 4HZMA 3BJTA 3A21A 5FEZA 3ZWSA 3EX6A 3STEA 3SY5A 3W4RA 5LIXX 2CETA 4ZOAA 3GHRA 1SJAA 3ZOAA 2WNQA 3U8GA 4QE5A 1N8WA 4H4IA 1XWYA 2FVKA 1S3HA 1KO0A 4KFNA 1C3FA 2ZZ6A 1XIMA 4O12A 1OCBA 1K9EA 4AD5A 1JJKA 1JDCA 3M43A 2ZX7A 2VENA 4GY7A 2R8WA 3AXIA 4DJDC 5D8WA 1J79A 4QAIA 2R94A 3CV6A 3H4GA 3LHYA 4V1XA 2Z0IA 1T40A 1SW3A 1I8JA 2VWSA 4LY4A 1VPQA 3GG7A 3S5NA 2J8GA 2H9AA 4E2DA 5FA5A 2NX1A 1XDLA 1PO9A 4JIIX 1AW2A 3KRSA 3B9DA 4LVFA 2VGBA 3W75A 3GH7A 1PHQA 1JFXA 4R88A 5FJPA 4AUBA 1V6YA 2QLYA 3N2XA 1JYWA 3VOFA 3NZRA 2J66A 2BGNE 2ZC1A 3VGDA 3CEPA 4CQBA 4JTQA 1U5JA 1V0NA 1B5TA 1UR2A 9RUBA 2Y5JA 2PLJA 3WQGA 5F2MA 3B97A 1MI3A 4EXQA 1PYMA 2IUZA 3UYCA 1RY0A 2PI6A 3GHUA 4DZAA 5FD0A 4F2TA 3HIJA 1GVRA 4Q4OA 5D04C 1QK2A 4NI3A 4A29A 4RXFA 3TH6A 3SY8A 1QPQA 4Y90A 1AQFA 5CPLA 3IAQA 3N6JA 1JAKA 1SW0A 3R12A 3O6AA 3TP4A 3LCLA 3NQ8A 3LBCA 1S5TA 2CEQA 4OGZA 2WZMA 4MDPA 1H7OA 5REQB 2J7BA 1LG2A 2ZX5A 1WKEA 2PUZA 3KLLA 3TQ0A 1FH8A 3LY0A 3MO7A 1KFLA 2VGGA 4RUBA 1G4EA 3L0GA 1W54A 4LNYA 5IM51 2GVGA 3VI2A 1H49A 1VHNA 3JRKA 5KZMA 4HPJA 3KM8A 3A24A 3KOXA 4WUIA 5BMXA 2YA1A 4LVGA 4NYUA 2J75A 4ZQMA 4US5A 1K02A 2NXHA 3EOSA 1VFTA 2HTMA 3DG3A 3RCNA 1VLWA 3BJSA 1ZBVA 4PL2A 3LB0A 5CCZA 3QVQA 5D2VA 3T4WA 2BLEA 2XIQA 1JPMA 3AWOA 3HQOA 3TOYA 4PTNA 2KAUC 3UETA 3M6DA 3TKFA 3PZGA 5IHSA 1TV3A 1Z42A 3NPWA 1QRQA 4QG9A 1XIJA 1UWUA 3RAOA 1UKTA 2QJGA 4GNJA 2W79A 1XDJA 3RCYA 1VLIA 1LM1A 1AJ2A 4PUUA 5IFTA 5FOOA 5C55A 4J1OA 1XIGA 4M7SA 3L7RA 3TC3A 4I6KA 1K3UA 5FF4A 2PWFA 3PANA 3OG2A 1WX0A 4KFPA 1LL4A 1LWJA 1FDJA 1SZGA 3DYPA 1SR0A 3D46A 5GJMA 1MFVA 1SSGA 3SUVA 2QR6A 4HU0A 3W81A 1F8MA 1OWQA 1V8EA 5H8PA 4GYPA 2ZDRA 1BWVA 1E51A 2O92A 1BGAA 3ITTA 3GAKA 3WLIA 3EKGA 5A2AA 5CLTA 3R89A 4QDPA 2RGLA 5JIWA 3OB8A 1MSSA 2YCJA 3M0VA 4V15A 3CHDA 3U4AA 2W66A 1NDZA 5I06A 3UR2A 1NTHA 2B7PA 1WQ5A 1JRBA 3TONA 4URIA 5D2TA 1DIKA 3LI1A 3LDVA 4CD8A 4NAFB 3DERA 1AQHA 1W1PA 3AXKA 1X1NA 2QUNA 4FMVA 4HB7A 5E9AA 3HA1A 4WX2A 4DF1A 4WY0A 3LM3A 3GWQA 4JKKA 1PSCA 4JX5A 1GPWA 2QAPA 3MQTA 4GXPA 1NWTA 3N3TA 1J5TA 1H1YA 1W0MA 2ALRA 4UFJA 3THAA 3BMXA 3D3AA 3S9ZA 4PBGA 1TPUA 1H7WA 3MYOA 4I9TA 2XISA 3MMUA 3T81A 1U33A 1G1YA 2F61A 3OEXA 1LBLA 3GTIA 4GI8A 1M9HA 2Y62A 4LCSA 3MI3A 3R25A 4WDWA 2D23A 3SM0A 3BMVA 4OWGA 1XI3A 1JG9A 3AIVA 5E09A 4BQ2A 3HG5A 1DHPA 1LRQA 4MZ8A 1TB3A 4JL1A 3QTGA 3W2JA 4CD7A 4C6KA 3IV8A 4PL1A 2A79A 4FP1A 3C2VA 3WLRA 3AOFA 3IJQA 4DJFA 3PJXA 2TRSA 3PBUA 3IACA 4ZQOA 4BF9A 3U3HA 3MHFA 4FNTA 1UB3A 3RU8X 2ZVRA 5K2ZA 4GUFA 4M6QA 1VFUA 1FWGC 3C2RA 2WZIA 5HPCA 1XIFA 1UWQA 3LERA 3QY6A 4NAFA 2R9RA 3OIHA 2OQLA 1E5JA 4IP5A 3H7UA 1U22A 2NVDA 1H63A 4L4MA 3VOCA 1JCYA 3DGRA 4JEQA 2DSZA 1QFEA 2XM1A 3NA8A 1ENUA 1Q66A 3VKKA 2G5WA 4F0LA 3BAXA 3BICA 2OT1A 4GC4A 3VDGA 5AC7A 3E2SA 4GISA 2OLSA 2PDGA 3W28A 3T7VA 4JL2A 4O8RA 3GFXA 3Q58A 5I7GA 1HN1A 5EB8A 2NSOA 3PFMA 4AWEA 1UA3A 3GTXA 4ZCWA 1TPFA 1MRQA 4D72A 5LHFA 4EPDC 3GC2A 4XO6A 1D8WA 1P5BA 2Y85A 3WH6A 4ZQRA 4OJYA 1Z48A 4PSPA 5DEZA 2VC9A 2GJXB 3ES8A 4HCLA 1CGVA 4BS0A 2VCAA 1H4PA 2QGYA 3BLIA 2P8CA 4MF4A 3N17A 4J7RA 3NQBA 1REQB 3KW3A 2VZSA 3T0TA 1YQ2A 2E77A 3GE7A 3BOFA 1ZNNA 2OEJA 2QF7A 4LYPA 2HK0A 1OFDA 3OOQA 3G1AA 3VNMA 3CMJA 1HGYA 1F6YA 2XPKA 1CNVA 1M53A 2TSYA 3M47A 3PPGA 4DUWA 1ME8A 4GH3A 3NQEA 1NQ6A 4C1NA 4O1FA 3EEGA 4QSHA 2CBIA 3EWZA 3R0DA 3QEZA 2IKHA 4B5NA 6TAAA 3CZLA 1EUAA 4HMNA 1F74A 2XGBA 4GVFA 1XD1A 2CZEA 3BV7A 1LQ2A 1D3HA 2CITA 4K7VA 2Y89A 1J01A 1TTPA 5XIAA 3MY9A 5J04A 4M5PA 1OSEA 3KBMA 5JUVA 1Y5WA 2ABAA 1E1EA 3V4BA 2Q3OA 4TMCA 1G67A 4AC1X 1LCOA 2CKSA 1OFAA 3WQWA 2ZUWA 5EA9A 2GUUA 2XSXA 2JE8A 4GGHA 4FXRA 1XF0A 4IUGA 4ZOCA 3WQFA 1XHGA 3VNLA 5J5RA 1MYRA 4K3ZA 1I6NA 4PCSA 3WLTA 1QAPA 2FZMA 4N9CA 3SCRA 1UH2A 1ICQA 4UTTC 3APGA 3IVUA 1HJXA 3VILA 4MY9A 1Q4WA 1K4GA 3QHNA 2XIBA 4JZ5A 3RYSA 1FWFC 5CGTA 1OG0A 1REQA 1IEIA 4PUEA 1TWWA 2NUYA 4QG6A 1W9BM 1R6WA 1UKOA 4IJCA 2I16A 5D03A 4XVEA 4DWSC 2QIWA 4F2BA 1GZ1A 3MV01 2VELA 2A5HA 4OFCA 4F0KA 2OGJA 4L80A 4I8YA 2DQXA 2ZRXA 3CC1A 2EO7A 1KV5A 4Z42C 4BEQA 3F4WA 1P0EA 2NV9A 1HJQA 3NSMA 1JZ6A 1O6IA 1M1BA 4US6A 4DBSA 2AAMA 1PEZA 3L4VA 4RDVA 1N82A 1XFCA 3STGA 1AUSL 3GX9A 4D6GA 3S2JA 4KEUA 4YPJA 4HIBA 1OF6A 5HANA 1ONWA 1PL9A 4D6FA 2IXVA 2WZTA 2PEVA 2PDJA 2GK1B 1SM9A 1GQJA 1V02A 1ZUAX 2OSYA 4XTDA 1HKMA 1OK6A 4GABA 4JTFA 2R1KA 2EPLX 2QJJA 3NUKA 3VUSA 3R4IA 1J10A 1OQFA 3ZJ8A 3M4HA 3H2AA 4JTSA 1VB9A 1DP0A 5EMLA 3CWNA 4R3UA 4IIEA 2F38A 1V03A 1ZAHA 1NM9A 4K1WA 5J5DA 4IPPA 4OT7A 1MUMA 1J93A 4G1NA 4W88A 2CPUA 1A80A 5BRQA 1YXCA 5HJLA 4IF2A 4X61A 3RJYA 3ITYA 1XYLA 5BXTA 1EHAA 3MWAA 5C71A 4NVTA 1EGMA 3RPMA 1IXOA 3LCFA 3FKRA 4YN5A 4LH8A 2OYKA 3PK7A 4D6IA 2CHRA 2YPIA 2A7RA 2WC7A 5FJJA 1KQZA 4FOKA 2A3BA 4O1DA 3EB4A 4QEHA 2YFNA 1VBUA 3M44A 4IPLA 2HROA 1MW1A 1Z89A 2WBGA 1ONRA 2X1UA 2YIHA 3BWWA 4GYFA 1CT5A 2X2GA 3H70A 4P61A 4LB3A 2OTDA 1BAGA 1JF5A 2QULA 3BURA 4W7VA 3ZXWA 4RL3A 3QLDA 1ITCA 3W71A 4TVCA 1DXEA 3WMBA 3FY1A 3GZAA 4W5ZA 1DJWA 1ECEA 6REQA 2GK1A 3LTYA 4UTLA 3SUUA 1MEHA 3KL5A 2OKOA 2P50A 3GYCA 3PSVA 2GGIA 3EMCA 2IKJA 4E6MA 5I2UA 4AEOA 3MBFA 4U3AA 4ADSA 1VRDA 4BI5A 1JQVA 3LCGA 4WK9A 4DX3A 1UASA 1GK8A 1L6WA 1P0BA 3O9NA 3V5FA 2HE8A 3OBEA 1US2A 1YRRA 3WJXA 1D3CA 1DJQA 4QRNA 4UQBA 3MZNA 5FESA 3EWWA 4FXJA 3FN9A 3WFZA 1EP2A 1DEDA 2JIWA 4M6UA 4KCUA 1S2UA 2A6LA 4F8XA 1TUFA 1A50A 3PS7A 3N13A 3ZQ9A 1PPIA 5IOBA 1KCZA 4AYGA 1CX9A 3VNDA 3P81A 2PWEA 1E6SM 3OP2A 2F9RA 2DP3A 4HJFA 8XIMA 1DJXA 1B4EA 1KWKA 4RE3A 3W84A 3PULA 4ML4A 4NZ5A 1KGUA 4K68A 3GS6A 2B4GA 4XD6A 1QT1A 3FJ4A 4N0RA 4EAYA 2DEPA 2W91A 4MWAD 3IIZA 2Z1BA 3B9EA 1ZP3A 3LN3A 2FB3A 1UD3A 2ZFAA 5C6MA 4A8LA 1XYMA 4YTTA 3TJLA 3S46A 1BEUA 1VPXA 3M0MA 4AWSA 4NU7A 5I3IA 2RUSA 3PTQA 4S2BA 1FWRA 4NNCA 2D2JA 4M82A 4HN8A 3JW7A 1YPFA 3G1FA 4U2ZA 2YBVA 4DO6A 1WXYA 2OX1A 2ZUSA 2QV4A 3W7GA 3CAVA 4Y7EA 2OPJA 3VOIA 1QTWA 4AD4A 1MRAA 3GFZA 3VPLA 1UQYA 3CZGA 1I0BA 2VFFA 3PF3A 2J74A 4QISA 3NQDA 4H00A 3JZUA 1XCFA 4PFHA 3FEMA 1O7AA 2BS9A 4PYSA 3CQJA 2V81A 1FX6A 4O1BA 2YKKA 4EF9A 3UG4A 2X05A 1V6VA 2GUYA 2XH2A 2FFIA 5HJYA 1O4UA 3HFTA 5I6SA 3T08A 2WZHA 2H8XA 3KLKA 1NWUA 1XRTA 4JTAA 4P7QA 4K39A 4PZVA 1XBYA 5JMUA 4L56A 1UHVA 4Z2JA 4LS0A 5HINA 4JNYA 1AH4A 4ASTA 2CXGA 4ZQNA 3AS2A 3H4XA 2DZXA 2E5CA 5TAOA 4M24A 2QCMA 1C9DA 1KC7A 3C61A 1N55A 3L23A 4J3XA 4CEUC 1N2VA 3VFCA 3UEQA 3GK0A 4Y2WA 1DYSA 2DZWA 3BAWA 4ZE4A 1OHLA 2VJXA 3IARA 3W7KA 3WY1A 3TQPA 3NWRA 1I9CB 1K8XA 5BXRA 1UWAA 2AMGA 2XFWA 5A95A 4U5KA 3DEQA 2QPUA 1QW8A 1FWTA 3L68A 1TFVA 1HFBA 5ABFB 5A5WA 2J79A 1UMLA 4AC7C 1J18A 4LYKA 4FX8A 3KBNA 3NGFA 3GR4A 1Q7MA 1ZBWA 3CBWA 3DFOA 4PE8A 4NQ1A 2VO5A 4XZHA 5I00A 1S46A 4HA1A 4H8UA 2QPSA 1JNEA 3KHJA 5A8QA 3WSUA 3PY2A 3COTA 4QLLA 3MA8A 1BGGA 1W1YA 1KB3A 1BWKA 2XH7A 4QM1A 5AN7A 4R7WA 4KERA 2NWRA 3BAIA 4IGMA 1WZMA 3SSJA 4JN8A 1VCFA 4HCDA 1CXEA 3F4VA 4B91A 4AXNA 1KBKA 1MNSA 3W6LA 1CDGA 1J12A 5A6BA 5IDZA 1SUXA 5AHLA 3E02A 2VFGA 1GEQA 5DY2A 3NCOA 2ZX8A 4B92A 1GVEA 3E2VA 4J4KA 1W91A 4XQ6A 5D33A 3NEVA 2PWVA 1ZQ5A 4OTKA 2OCZA 4WGXA 3CO8A 3MP4A 5DX7A 4NNAA 3TXVA 3RLGA 2XYLA 1WDDA 1KKRA 3AMLA 2J8TA 3TW7A 1R3VA 4DBEA 4IMDA 3V3WA 3Q2DA 1XSKA 2ZUVA 1E0TA 2J4GA 3UG8A 3P74A 4HNLA 4HYWA 4KPLA 1YIXA 5D05A 2RJGA 2CLKA 1ITQA 2X30A 5ABFA 1TZ9A 2C16A 4YTQA 2C1IA 5G2IA 3BCFA 1KBLA 1W8SA 1KBJA 3B9AA 2G95A 4P7LA 4GIEA 3WK1A 2WOQA 1H7RA 2CLPA 1FP9A 3HMJG 3FA5A 4FK9A 4FSAA 2NV2A 1IXNA 3EB3A 1FOBA 5A6TC 2XIIA 3ANYA 1UC5A 3BGJA 4TMBA 3P14A 2VQTA 3NSXA 5LNWA 1XINA 4HHLA 1S38A 1Z7AA 1UP0A 4HNOA 4Z0JA 3WJYA 4ZMGA 2NQ5A 1TV2A 2RGMA 3D0CA 5LGZA 3GG0A 2ISDA 5LYRA 3S2NA 2HXUA 3WQOA 1W17A 3NR0A 1GZJA 3BAYA 1TV7A 1DJNA 5A2BA 5K9CA 3M5ZA 1H09A 4OU1A 4GX9A 4A3RA 5H1WA 1GG1A 1XYBA 2Z2BA 1NWSA 3S5SA 2WSKA 1MVYA 1M01A 5D9MA 2A4AA 3UWVA 4XZMX 4Q4RA 3GBDA 4O57A 2X40A 3MCNA 3W7PA 1GJPA 4H01A 1V3HA 2KZHA 4IP4A 3TW6A 4LYRA 3DHFA 1JCLA 5AOUA 1ODZA 1OCNA 3PTKA 4E8DA 3L4ZA 3GDLA 3G1XA 2FMNA 4IT1A 4MADA 1V4YA 2W62A 2UZ9A 3HBLA 3UZWA 4PRTA 1TR1A 1R86A 4ERAA 1LYXA 5AYYA 1V0MA 5BW6A 1JEZA 2QCCA 3ITXA 3ZR5A 1F6KA 2PAJA 2GSHA 4GI9A 2I1OA 2BODX 2Y7EA 3LENA 1XDMA 4AZIA 4B3ZA 4REQB 2E5BA 3P5YA 4B5TA 3QM3A 3N2MA 1FVPA 1F4HA 3N19B 1M7OA 5F1UA 5GJNA 1C91A 4AZCB 1XLFA 4AX6A 1DIDA 5HMDA 1VPYA 1DE6A 2A7PA 2VFIA 4POCA 4UQ9A 2YCEA 2FGLA 2Z1XA 2Q01A 3BZGA 1TZ7A 4S3FA 3RJXA 2QVNA 1U83A 1SYTA 4IP7A 1PKYA 3TLQA 1BXNA 2VEIA 1XSJA 1I2RA 3R5EA 3TSMA 3L4YA 1W56A 5CZSA 3R10A 3O07A 4HPNA 3F03K 2W3ZA 4MHBA 3LRKA 4YXGA 4DO4A 1QPKA 2DV0A 2V30A 5C9RA 1FWBC 2XVPA 5IHRA 3WQ8A 2C7FA 1RALA 2H3BA 3ABOA 3WLSA 1TO3A 1J5SA 1JCXA 3T0CA 5ECVA 1J0HA 1A5BA 4LFYA 1UYQA 3BSMA 1TV8A 5SWUA 5I3DA 3ALGA 5CSRA 3VD5A 3U9IA 3K13A 2EPOA 1CI1A 2YGYA 5FSDC 4QJ1A 5F4WA 4XZBA 1F3EA 2YFOA 3DG6A 1TWSA 2ZX9A 1GGOA 4O8AA 3IJIA 1NFBA 1P6CA 4LUYA 1O5KA 1XIBA 3AQUA 2WMIB 3F5KA 3VIKA 2YOCA 3W1PA 1JR1A 4PCFA 4WEVX 2MUCA 2OZ8A 2PSNA 4CD6A 4REQA 1WBHA 1GCYA 4M8UA 3R11A 2F6XA 1QBBA 5BOFA 4RKAA 4OE7A 3BMWA 3AHTA 4AZCA 4D6DA 2J27A 3WDRA 4IG2B 3AXXA 3OGSA 4UTIA 1GOMA 4LAMA 5HATA 1FWDC 3BGAA 3SJ3A 1ZALA 3TTEA 2QJIA 1Q13A 4U28A 2WHKA 2GJRA 3OODA 3GDTA 4E38A 4GBDA 3MANA 1PYFA 1JXKA 5EFDA 1V77A 3I3BA 2HWGA 4G56A 5F2LA 3ARRA 1XKYA 4JDYA 4KCWA 1DWJM 1TKKA 3CZKA 3WD3A 1DKWA 4A22A 1IIGA 4L4LA 3ZM8A 1E4MM 4O16A 1XIEA 3ZVHB 3Q45A 3CS2A 3RMEA 3G24A 2QPXA 1HJUA 2QF8A 1R9XA 4N9BA 2PODA 2R24A 1V6XA 1GORA 3CAWA 2GGGA 3W1LA 4UXDA 1KM6A 2B7QA 1ZAIA 4S3DA 4MPKA 3KRBA 3NTYA 2J62A 5D30A 1TJPA 4GKTA 4TU1A 3M9YA 1HJVA 4QBXA 5HBFA 4QNWA 2P3EA 4WSHA 4G7FA 1OF8A 1B3ZA 3VNZA 1EOKA 3I4EA 3W26A 3TYZA 2B31A 2CNCA 3L5MA 4BA0A 3ID7A 1K7EA 2VC5A 4IG2A 4HOWA 1PIIA 4NXSA 3W1XA 3STPA 1R5YA 3F4DA 2X09A 2RAGA 1EYEA 1FKWA 5GPRA 3W7NA 1GQIA 3MSDA 1K9FA 4TR9A 1FCBA 1SQ7A 3W1TA 2V38A 2PCEA 2C71A 5G2HA 2FPYA 3T4CA 3LMYA 4ERIA 3GDMA 3NQ2A 1W5OA 1PWLA 1OFRA 1Z32X 5EMYA 3IV3A 4A3YA 4ZFMA 1VJSA 2PDXA 4ZGYA 4KGJA 1XL9A 4A3HA 1Q7ZA 3WD0A 4FZIA 4LRTA 2JKAA 3T78A 3GR8A 4YCOA 3ZVHA 2VCBA 4LUTB 2ZADA 3LCXA 1JF6A 4CVUA 5AC8A 1OCJA 3TJ4A 1CGTA 1TWDA 1H7XA 2X2YA 4MY1A 2XGZA 3BH4A 2CFFA 3G0UA 4S3AA 4IZGA 1F61A 3P8IA 4A4AA 4GXWA 4QEEA 2PZNA 3R79A 3QHMA 1E1CB 4UOQA 2V69A 1VKFA 4ZFCA 1GZGA 4UQDA 4CNOA 2OXNA 4AU0A 3UZXA 2INFA 3S6DA 3SCVA 4KMQA 2BY1A 2VZUA 5D9PA 3IJ9A 5FJIA 2YYUA 2Y8KA 4UQAA 3WLMA 3WNNA 1UBSA 2GWNA 1M5WA 3UG5A 3PAOA 1FTXA 5AHEA 3B0YA 3HPZA 4J3VA 3PUDA 4NT0A 3CH0A 3DFPA 5AECA 1RY8A 3ZJ6A 3OLEA 1EFZA 3CAKA 5FF0A 2VX6A 3PP7A 3SGGA 3LCIA 1F05A 1J0JA 3F2CA 1IZCA 3IRDA 4JTHA 2PBGA 4H3DA 3WDJA 4XAGA 3UCQA 2HMCA 1XRFA 2GJLA 1UWSA 2WSYA 4MB4A 1W3HA 2PMQA 1DIOA 3LLXA 3N6QA 1C29A 3LXBA 1AL7A 4H7CA 3WJWA 1CW2A 1D9EA 3MV11 2C91A 1K8CA 3A64A 4S3BA 4D6HA 4NJGA 5HR7A 2V67A 2XWDA 4Z2IA 1DOSA 4L4PA 3ZIZA 1BPLB 4S3KA 2CESA 3GHSA 3VC6A 1B2YA 3ONBA 3PB0A 2Q8ZA 4HKPA 2SFPA 3ERPA 1E1CA 3LEPA 3NXFA 4GD0A 3U2OA 2ADAA 2RFGA 3D5HA 4YVXA 3SIMA 3GUWA 2FPVA 3IK2A 1ESWA 1U5HA 1XCWA 2A3AA 3VU2A 1JDFA 4ROPA 1Q3NA 3KOFA 2DVUA 3VYLA 1JNDA 4JTDA 1XLMA 3CYVA 2VEKA 4KEVA 5TQLA 3HPXA 1VS1A 3FA3A 4Q4QA 1E70M 1UOKA 3CM4A 3U7BA 2FZ9A 1X39A 4WJXA 5KEZA 3TQVA 1ADOA 3NZQA 1TPH1 2CLEA 1A4LA 4ZR8A 4QCEA 2NSXA 4ZA0A 1M03A 5TNVA 1XS2A 5BYWA 4HHHA 1V3KA 2ISVA 4JKLA 2NZLA 2QCFA 3GIPA 3DAQA 3ARTA 2ASHA 2G8ZA 3QOKA 4GY0A 1RQBA 2OODA 2PBOA 3WEOA 1BQCA 2FHFA 1LF1A 2D2OA 2XVKA 3IUDA 2G0WA 2C1HA 7ODCA 2VGFA 1NDYA 4TV5A 1P7TA 2FJKA 1FRBA 3NQGA 1MXGA 3P84A 1ZBKA 1C90A 2WPGA 3K2GA 4OECA 4MY8A 2HQAA 1A5UA 4DRSA 1W9DM 4F2UA 4IMEA 3QV8A 1R46A 2GFTA 3SW6A 4DIAA 3EDEA 4AY1A 1FP8A 1R7OA 3B8DA 3HZ3A 1EEXA 3JVAA 3HPAA 4R9OA 2AGKA 1WUEA 4DHGA 4UC5A 4YL2A 2IS7A 4DNHA 2WHJA 3W76A 3K8LA 2EKGA 3B0XA 4HD5A 2QJNA 1QNQA 2E1WA 2BVDA 3WF3A 4CCZA 3S47A 1LL7A 1D3GA 4RK8A 3PZUA 1XYFA 1TJ1A 1SSDA 2IPJA 3TFCA 3UU0A 3LHWA 4GY1A 2CCRA 3M5VA 5DMNA 3BJFA 1R30A 4TTUA 5I3HA 4ZSTA 3PZ9A 3GVGA 1RLCL 1YNPA 5BWFA 3GQYA 4BR1A 3AISA 1LDCA 4B5WA 2VYOA 4W9TA 2XGIA 1AVAA 4YVVA 3RR1A 2XSAA 4Z1YA 4PUMA 2QCEA 2BMBA 3L9CA 4QE4A 5JVLA 1ZLPA 3M64A 4H8HA 5HAOA 4C6OA 4IGSA 2MNRA 2X16A 4FLRA 4MMWA 1E1FA 3WF0A 4GZIA 4JBRA 2R91A 1PX4A 5G1TA 4DXXA 1OCQA 4D6CA 3AIEA 1HP5A 2BBFA 4G2DA 2PA6A 2NX3A 4JNMA 1TPWA 2VEFA 3VTRA 2PS2A 2DY3A 1FY6A 1JPHA 2O7SA 4XBSA 5U7SA 3C0SA 3A9BA 1UR1A 6ALDA 3FJLA 2E68A 3CASA 3SGZA 4J3ZA 4S39A 2V0TA 2FGZA 4L6OA 3T44A 4PUJA 1PXGA 1WDQA 3EGJA 5CGQA 5CH9A 1OD8A 2INZA 1Z6KA 3LPGA 3GNRA 1RHCA 2HS6A 2PDQA 3S2CA 1W9XA 4P8XA 4U4MA 4EE9A 4ERGA 2KX9A 4QS6A 4U10A 2D0HA 4C6CA 2QCHA 2BHZA 1XSIA 5BROA 3BGGA 3WMSA 4HSNA 1AODA 1Q2RA 4MWAB 3WLOA 2WXDM 3RXZA 1GTEA 2HPIA 2VVNA 3HMCA 4ZB5A 4ILSA 1N7KA 3LG3A 1K7XA 3ZR6A 5JU6A 4RR4A 2WLZA 4EAMA 3ZLFA 3SADA 4JFVA 2P88A 2R82A 4FPSA 3OZYA 4GJJA 2VTFA 4L7ZA 4WJ8A 2AMXA 2UY3A 1UKPA 1DQXA 3UY7A 4JR5A 5GQBA 3NJ3A 4JFUA 3LZ5A 5CGMA 3KVMA 4MLJA 2J6VA 3F4CA 2HPMA 4IHCA 4WZHA 4Q8PA 2O9PA 5DCBA 4LX4A 4LRSA 3SO7A 3K1GA 4UFMA 2BGQA 3OVRA 1TSIA 3D3FA 4PMVA 1LLWA 5DY3A 4UUIA 4XAYA 4GQBA 4Z1BA 2YXOA 2HCVA 2YXGA 4CNNA 4D6JA 1QASA 1O5QA 1ELSA 5FEWA 3A3WA 1UD8A 3WBXA 5A6MA 3AIUA 5EMMA 3NDYA 5CC3A 3FXGA 3WEZA 3W37A 1THFD 3CMFA 1WKDA 2HEJA 3S6OA 1YBQB 2Z7GA 1SO3A 1W1B1 1RA0A 1R3WA 1V3IA 4WDTA 4DUXA 5FEPA 3GXTA 1AH0A 1XR2A 3O1NA 1ZSXA 4HOZA 4Q3MA 2A3HA 1TTQA 2ACQA 2IW0A 4H41A 1FXQA 3URQA 4N2YA 1ZENA 3TYAA 4C7DA 3M0IA 4OUIA 2ZXDA 1TJ2A 1TG7A 1VCGA 1YKWA 1G4PA 3NXLA 1XV8A 4LEQA 4MWAA 4Y9MA 2NV1A 2WNNA 4JAWA 2YBTA 3O6YX 4YTUA 2XHYA 1HF6A 4DZHA 2GLKA 4Q32A 2ZA3A 1E73M 1RXOB 2V8ZA 3WELA 3H7VA 4K2SA 3U2CA 3GH4A 3CL6A 1VIWA 4Q8UA 4M3PA 1ZJHA 3II1A 5D38A 2Z25A 1X1OA 4QP0A 3LD5A 3HQNA 1OIMA 1HNYA 2C19A 2IPWA 3W23A 1LRNA 2OX4A 2QDDA 5TBOA 1JZ4A 2H8ZA 2JF6A 3LSCA 1T41A 2J9YA 1IEVA 5DT5A 3QPEA 3WBWA 1YE4A 1I2OA 5BOOA 5KITA 3ARWA 4HSOA 5IRPA 4I5UA 1KFEA 1L6YA 4E0CA 2YYTA 4MNKA 2PU0A 1GYLA 4AZ6A 1QPNA 4IISA 1Q63A 4YTSA 5BU9A 2DVTA 5E0CA 2UV8G 4XVDA 3UWEA 3OVGA 4IH3A 1YBQA 3M7WA 2HBVA 2J13A 1RK5A 5IDIA 1GOKA 4DWSD 5G1YA 1J96A 4L1GA 1BHGA 1EJ7L 3BANA 3H22A 3OA5A 4FHAA 1QHPA 5D2XA 4RNHA 1FH7A 3OZMA 3GVQA 1CWYA 1UC4A 4HBKA 3FDKA 1B3VA 1PE1A 5A8NA 1CENA 1QR7A 3KBSA 1FKXA 1FWCC 4M80A 3EX3A 1A4MA 5I0DA 2YJQA 1NVMA 3FVDA 2A1YA 3MBDA 2VDIA 2YR1A 2LLEA 2V3DA 4UQCA 1ZU8A 3EEZA 4FLOA 2EQDA 3VGGA 3WENA 1WKYA 4P7RA 5E1QA 1YADA 1DXFA 4KH2A 1Y8BA 4UOJA 4H9TA 4K1GA 1KFKA 4XV0A 2ZUUA 3A4WA 4LY8A 3EA1A 1QHOA 3MUXA 3ZFHA 2OZ3A 2ZA2A 5E0KA 1EB3A 2PLCA 1EJUC 2E4TA 2V5CA 3GNNA 4NJHA 3K4WA 5D09A 1HJWA 4AIOA 4GVGA 3N73A 3MSGA 4MSSA 5CBIA 5FCZA 4XTIA 1BYAA 3WUGA 1C93A 2CLFA 2GQ9A 2F7FA 5LIKX 4BZYA 4O1CA 2J7HA 2C8NA 2Q02A 4HTYA 1GVYA 4F4RA 4R33A 4GVIA 1Q6CA 3C8NA 2XN2A 2YDQA 2PCQA 3DU0A 1S3TC 1MMFA 3GRIA 2GSJA 2C15A 4BWLC 4D1JA 4DN1A 3LXAA 4XAFA 1E40A 3PM6A 1HG3A 4AVOA 3RU6A 1E43A 1Y65A 4RLIA 2FDSA 1HVQA 3H6OA 2DQWA 2VZVA 3HB9A 2ZKMX 1JUEA 4AISA 2FH6A 5FI8A 3A3XA 1BKSA 1TWZA 2E8YA 4V33A 3E2QA 3KBJA 2P76A 3C3NA 2J78A 1LOQA 1E6RA 1QO2A 5LSMA 1YNQA 1HKWA 3LQGA 2YDAA 5G2WA 3QR1A 3JS3A 3TA9A 1NY1A 4IX2A 3KFTA 1BSIA 4HT3A 4HNNA 4OUEA 5F4XA 4HU3A 4NJJA 4RNIA 4CLMA 3V18A 3EAUA 3E12A 3OHIA 5FJRA 1LBFA 5HNTA 4MFEA 4FNRA 1J2BA 3WFAA 3PZOA 2FJUB 2PC4A 1AW5A 2HK1A 1TWIA 1TYGA 1LLOA 1ZPTA 4C6MA 2BTMA 1HKIA 1VC4A 4UFHA 3UVIA 3S2MA 2I56A 4Q4PA 2VI0A 1JYVA 1ECQA 3P5ZA 3MMDA 4YHGA 1OX4B 2TAAA 2E1DA 5AC6A 1IXPA 2JIEA 2PWHA 4AWUA 4JIEA 3VGBA 1OC5A 4L4OA 2DZAA 3QKZA 2CXEA 3AALA 4JYEA 3PC0A 3WK0A 1EX5A 3NL5A 3E0IA 2XUCA 1YEYA 5M03A 3MKVA 1R7AA 5J8LA 1Q6DA 4AY8A 3KS6A 2DH2A 3KHDA 1ZY9A 1XPYA 5I3JA 4UNIA 3B40A 1UQZA 1SFTA 3BLFA 2VR5A 4Z1DA 3U7VA 4BY3A 1UCWA 1P4CA 2Y70A 3VNYA 1ME9A 2ZWZA 2ZZ7A 2A0NA 2VRQA 5K4ZA 4J35A 2JALA 1QNVA 1CEOA 1EEPA 1Z44A 3TN4A 1D7KA 3DECA 5CEWA 4GQ0A 1KR1A 1RPXA 5DBUA 5G4HC 1GVOA 2YW3A 4LXFA 4B15A 3WK2A 2I9EA 2UWFA 5HOSA 1RA5A 4AZGA 1LWHA 2CHNA 1V3LA 1TE1A 4O18A 5PTDA 1POJA 4E3TA 5DMMA 1XX1A 1WBJA 2ZVIA 3ENLA 3LBMA 1KW1A 3C6CA 1C8VA 2V3FA 1GQNA 1YXYA 4JKMA 3B4UA 3LMZA 4V2XA 3DBNA 3EBVA 5KTLA 3WH9A 4L9XA 3R0KA 3SRKA 7TAAA 1GHRA 2A3CA 1XJBA 3STFA 1KLZA 3L21A 2G4FA 4M0XA 1ISZA 3UG3A 1VP5A 5FJTA 1G4TA 4HCHA 1CGXA 3DHDA 5I02A 6XIMA 4IX0A 3L4TA 2PDHA 3U6WA 2JK2A 3DBPA 4GGBA 2V9DA 3RIKA 4QIUA 1H62A 2J7FA 3PJUA 3WQEA 3QYSA 3SJNA 1KQYA 2BGSA 2G96A 1SZRA 5LXXA 3CUHA 3CHFA 4AZ5A 4KWWA 5AYBA 3KBVA 3NZPA 4HJWA 3LM7A 4GFSA 2Z7KA 3VDBA 2P8BA 4YHEA 3PZQA 3GTFA 4AMAA 1MUWA 3HGJA 3MCOA 4IL0A 4LALA 2PPGA 1ZCCA 2E3ZA 4IQEA 1A5AA 1XRSA 4INFA 3TWAA 2OMAA 2EJAA 5DT7A 1VH7A 3NAVA 3NOEA 5A3HA 5HDRA 2ZUTA 1XLBA 3N9RA 1ZS2A 4MJ4A 5DO8A 4GZEA 2DZPA 3CUJA 3W29A 4AY7A 1LWIA 1PDYA 1F7BA 2VEGA 1K6WA 3V1HA 3UERA 4MB3A 4PR4A 1AZ1A 2NW0A 1RBLA 1RSCA 3OO2A 3GKFA 5HQLA 4FNUA 3QBUA 2RDTA 3L12A 3R8RA 2XSBA 3NQVA 3JR2A 3OGRA 2A85A 4EWND 3UGVA 3W6MA 3WQ5A 1AMKA 3RPDA 1GKQA 1L0PA 1TX0A 4TQTA 1EH9A 3DX5A 4IJRA 4QHRA 4GO9A 5F2GA 4ADTA 4BI7A 1O1ZA 3GFYA 1FCQA 4RW3A 4JS3A 2HISA 2Y6ZA 3L2IA 4QJ3B 1Y5VA 2VX4A 3EX2A 3BW2A 3VDAA 3QOMA 1VBRA 3GM8A 1SZFA 1KR0A 3WQPA 2CZFA 1CXHA 3DFQA 5CJNA 2PWUA 1VBJA 2XVLA 4H2HA 1XISA 2YL6A 1KFCA 3WLHA 3AMCA 3HO8A 8TIMA 3ZZ1A 2JQXA 2ZTKA 2ZIDA 1ADDA 3MMWA 4PUNA 1NWRA 3RLHA 4UTWC 1AZ2A 3TXZA 1BLIA 4NZCA 2D2GA 2HZGA 4C1KA 5I03A 4HPGA 4ZO7A 3LCHA 1R2SA 2QDGA 1BRLA 3QFWA 3MC5A 4HOXA 1IT8A 1OZMA 2Z4GA 1V3MA 3UWYA 2VC7A 2XN1A 3EWUA 3MMTA 1Q4NX 3MS8A 1VF8A 3W74A 3PUEA 1QK0A 3KRUA 3WLPA 2A2IA 2FTPA 4Q4MA 1M7PA 3DYOA 4NHVA 1RZMA 1KXQA 3THQA 4DB7A 3W82A 3RR4A 1HW6A 2OYLA 3OGVA 3VMNA 1Q8JA