1W3LA

Endoglucanase cel5a from bacillus agaradhaerens in complex with cellotri derived-tetrahydrooxazine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title Structural, Thermodynamic, and Kinetic Analyses of Tetrahydrooxazine-Derived Inhibitors Bound to {Beta}-Glucosidases
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 121
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1w3lA00
2DSZA 1DWFM 3I3BA 1QW9A 5A8MA 4DWSA 1DEDA 4ZE5A 1EXPA 4AIUA 1UWUA 4JHZA 3AXHA 5FL0A 3AOFA 5GNXA 2WC4A 1GW1A 1GOQA 5GQBA 4HPGA 3OZPA 4P7QA 3NUKA 2WMIB 2V5DA 2NSXA 4MNJA 1UWIA 2XVNA 3POHA 4OUEA 2EPMX 2O92A 1QI3A 1JZ8A 1UWRA 3GM8A 3WH9A 4AZ5A 3THDA 1HJWA 4BA0A 1CGYA 1FOBA 3BAXA 1NP0A 2CHNA 1W3KA 3AMKA 4D6JA 3AISA 5DT7A 5I5RA 2UY4A 1QNOA 3WEOA 1GOKA 1UUQA 3TA9A 1XSJA 4W7VA 3ARPA 4JKKA 4RL3A 4K68A 1SYTA 4ZFMA 2BVYA 3RMEA 4UQ9A 2GDVA 3WD2A 4UFKA 5CJ5A 4X0NA 2ZXDA 1J11A 3AYRA 1JYWA 4GI8A 2QPUA 4HTYA 3PTMA 2QMJA 1R85A 3MSGA 3I3DA 2OWXA 3HN3A 3IAPA 3SCSA 3D3AA 3RDKA 1KR0A 4U33A 1W91A 5I6SA 5KEZA 1GVIA 3NYDA 5I2UA 4JKMA 1ISWA 1AQMA 1CXFA 3VD3A 2E3ZA 1UHVA 2FH6A 1VFFA 3VMNA 1V3IA 4MDOA 4JFVA 4Z2KA 3VGBA 3AZTA 4B9YA 4M8UA 1B9ZA 3WD4A 1ZB5A 3MUZ1 5TD4A 5FOOA 4FK9A 3W53A 3WF0A 4XB3A 2B31A 4MJ4A 5BXTA 3GH4A 1B3WA 3VIGA 2CIPA 3VIJA 1BGGA 3VD5A 5HPCA 4JFTA 1E6SM 3GH7A 3WH5A 1WCGA 2CBVA 3OG2A 3WUFA 4CN6A 2VRJA 1NM9A 4OZOA 1H0GA 3GNPA 3VGGA 1K9TA 4PN2A 5CGTA 2XPKA 4F9JA 1HF6A 2VZSA 1D2KA 1TA3B 3NSXA 2RGMA 2WC7A 3W29A 1R7OA 1JZ6A 4GZIA 1KGUA 2WAGA 1ESWA 4Z2HA 1XD1A 5I3DA 2VC9A 1OGGA 2BFGA 1B2YA 1V02E 3PZQA 3L4XA 4CN1A 4ZE4A 4AYSA 3MV11 3L4WA 3CUFA 3OGRA 1HT6A 5ECUA 2YKKA 4H8HA 2DPEA 4CN4A 2CBIA 5EFFA 1HP5A 4D1JA 1ZJAA 1EO5A 2J7GA 3ARYA 5A6BD 3AIEA 1QHOA 1E72M 5F7UA 4FLSA 4Z2GA 1FH8A 3ZMRA 1V02A 2ZOXA 3WNMA 2O9PA 1GHRA 2V3EA 3SCPA 1BF2A 1CXHA 4YHGA 3KE0A 3PTQA 3EDKA 1JYNA 3I3EA 1LL6A 1KQZA 1J01A 1ISYA 2BY0A 4D6FA 3N04A 2VO5A 2VCAA 2FGZA 3CIVA 2WVSA 4YPJA 5HDRA 5AYBA 1K9EA 2X8RA 5HXMA 4QFUA 3OZOA 4ACZB 3T0DA 3KWXA 3PTKA 4XUYA 1JG9A 3ZR6A 4PMZA 1PZ3A 4M24A 4RE4A 3AJ7A 1OB0A 3EDDA 1YHTA 3L4UA 4UZUA 1J10A 4J3WA 3VUPA 1D3CA 1TMQA 3ZT5A 1NARA 1VRXA 1US3A 1DP0A 3OLIA 1WPCA 3A4AA 1EQPA 3VOCA 2WHKA 3GYCA 1BYBA 4AISA 1B3XA 4W93A 3WBAA 3VTRA 4DM1A 4NRSA 4PMQA 2F61A 4EAMA 3VD7A 5KZ6A 3L4TA 3WQ5A 3FNDA 4JCLA 4HZ6A 3CPUA 4W85A 1E6QM 3SUUA 4W5UA 2WK2A 2WHJA 3AZRA 4GIAA 5A94A 5CQ1A 1H2JA 2X0HA 1OD0A 4OKDA 2E9LA 3CTTA 5D9PA 3L4VA 1C8QA 5ABHA 5BCAA 1OD8A 3VIFA 2VCBA 1E56A 1JIBA 4M82A 3EDJA 2C7FA 5JUVA 4TVCA 2DT1A 1ECEA 1E15A 2XVKA 2EO7A 1KXVA 4NZCA 3HU7A 2WLYA 5DEZA 2CBUA 5BROA 3WNOA 4IISA 4D6HA 2WHMA 4FLQA 3PZTA 3CBWA 1VIWA 2DSUA 1Z32X 5EBAA 1WDPA 1FP9A 4W7WA 3EMCA 4HA1A 1WP6A 2GJRA 2XVLA 4UTFA 3QHOA 1E4LA 4MJ2A 4TTUA 4WKFA 2YDQA 5BXPA 1HKKA 2WNWA 4GQQA 3RJYA 4Z2LA 1CXIA 1UH2A 3UG4A 4Y7EA 3ZSSA 1M03A 3AMLA 1PX8A 4MB1A 1CWYA 5FIPA 3WUGA 3WD1A 2FHFA 3MUIA 1LQ0A 3CHCA 4HP5A 1H4PA 2WPGA 3CZJA 1BPLB 1B1YA 4UQBA 4QLLA 4PMYA 2YL8A 3N11A 3AIQA 1CXEA 2O9TA 2QV4A 3AIBA 3VNYA 4RE3A 1C7SA 5I0DA 2WVVA 3BSGA 3DC0A 5A6LA 4EANA 4H7VA 4J7RA 3KEHA 3T09A 5IHSA 1G01A 4LYRA 2ZUMA 2W92A 4A4AA 4UQCA 3WDIA 1IZJA 3AFBA 2HVMA 5IXEA 4QCFA 4FLOA 4B3LA 1VFMA 2YBUA 3TP4A 4EKJA 3SCOA 2WVTA 1V0LA 3CLWA 1UYQA 4PTMA 3WMSA 3CO4A 2E8ZA 3B9EA 1UKQA 2GDUA 4PMNA 4UFJA 4A3YA 4RE2A 1E1EA 1C8YA 1XGZA 1BQCA 2VVSA 1HKMA 3ARQA 1HIZA 1E55A 3WNPA 2DDXA 2J7DA 2UY2A 2A3BA 3PN8A 5DO8A 2GUYA 4IPLA 1CXKA 1TUXA 3VIMA 4GO9A 3VIKA 4DM2A 2Y8VA 5BXSA 3GXFA 4CD4A 1JDAA 2D2OA 1GOMA 1YQ2A 4GPNA 2JIWA 3SUWA 1KFWA 4M29A 1CYGA 2W67A 4ZENA 3W81A 4L4OA 1CIUA 4W88A 4OOZA 1VBUA 2XSBA 4A3HA 2OSWA 4JAWA 3W6MA 4CU8A 3NSNA 1V08A 1JYVA 3F4VA 1W9PA 7TAAA 1WZKA 2OSXA 2PWHA 2VR4A 1OCQA 4QCEA 3A6OA 1F4AA 2WKLA 3CZGA 3L2LA 3NDZA 4AD1A 1W3HA 5JBDA 4AC1X 2ZX9A 5CPTA 3BLKA 4J28A 3DYMA 6CGTA 2Z1SA 4P7LA 1FA2A 3A3HA 3WEZA 4TX8A 3LPPA 3ARTA 5IHRA 3BCDA 4M80A 4U5KA 4P7NA 4YN5A 1XCXA 3A4WA 1UR2A 4PUEA 2EXOA 4PSRA 2VX4A 3IANA 4PSPA 4MNKA 3RIKA 2WCSA 1EOMA 4Z2JA 3WF4A 2XUCA 4WKAA 1HP4A 3VDBA 3VGHA 2WB5A 3WUBA 1B90A 3GTNA 4H41A 2E4TA 1JF6A 3BLPX 4GI9A 2J25A 4MB5A 2GFTA 2WLZA 2WC3A 3DHUA 4MDPA 3WNKA 1EOKA 1V6YA 2XVGA 1ZBKA 1V0MA 4D6EA 4JIEA 2ZUUA 4UQEA 3AMGA 1JGIA 8A3HA 2OLHA 3WH6A 3VINA 4V27A 3G6MA 1PBGA 1SR0A 2EEXA 2BS9A 4PTWA 2DGAA 2CHOA 5A2AA 1XRVA 4JL1A 2J8FA 3NSMA 3VD4A 2WW5A 1MW0A 2JF6A 1W9XA 1I1XA 1QPKA 4OBRA 3K1DA 3VIPA 3MMWA 2G3JA 2Y24A 1D7FA 1GONA 1ZBWA 4GI6A 4F66A 3WH8A 2YBTA 1X1NA 4Z2IA 3QOKA 1XYFA 3WNNA 3PZMA 5A8QA 5I23A 1KCLA 2WMJA 2BY1A 4UFIA 4EE9A 5CZKA 3ZQ9A 1GCYA 1HKIA 1PPIA 1CDGA 1W1YA 1CGTA 1BG4A 2OSYA 1E3XA 1VFOA 2EBNA 1M04A 1BYCA 3AI0A 4L4PA 1GOIA 1MVYA 5JBFA 1UR1A 2VZTA 1C91A 1JF5A 4B15A 1L0PA 2ZXAA 4P7RA 3RJXA 3VGEA 5E09A 3RM9A 5BYWA 4WKHA 3MUY1 3TTSA 1KGXA 1PZ2A 2QLYA 5A8NA 2VRKA 3CHEA 4PTXA 1CNVA 1KQYA 3WSUA 1JDCA 4AZIA 1UOKA 1W2VA 4TVUA 4DWSB 2XM1A 2VQTA 1B3YA 1WZAA 3AZSA 4HMDA 5AYIA 3WMBA 1NOFA 5GPRA 1JYXA 1E6NA 1JI2A 1RPKA 4B16A 2VVNA 5FCZA 1CLXA 4PEEA 3CGTA 1E0VA 1Y7VA 3GH5A 3ARUA 3U7BA 4DUWA 2D0HA 1HVQA 1GZJA 3ECQA 1EHAA 4JKLA 1UD3A 1W9BM 2CBJA 3AICA 4BS0A 5A69A 3ARRA 2DIEA 1HN1A 4D71A 4TVDA 3MANA 2JEPA 5GNYA 3VPLA 1MXDA 3B9DA 3AHXA 4W84A 5CPSA 1OIFA 4JZ5A 1OSEA 1XSIA 1VENA 4MADA 1WE5A 4D6IA 3F5LA 2D0FA 5M17A 3DYOA 2JF7A 2BNJA 3ZSTA 4S3KA 3MMDA 4LYPA 2VOTA 1XHGA 5AY7A 1NWRA 4LQ1A 2ZX7A 4X0VA 1HJSA 4BF7A 1LJYA 2EPKX 1JAKA 2WWCA 4UR9A 3MKKA 1XH0A 1CZ1A 1G0CA 1CLVA 1H0IA 1UKSA 4URIA 1BHGA 4OIFA 4LPCA 3W26A 1GJUA 2D3LA 5E9AA 2BY3A 2J7BA 2GVYA 3KL5A 3PHAA 4KRUA 3UR8A 1FH7A 3GXMA 4UOJA 3WBEA 2BVTA 4CD5A 1VB9A 1J0JA 5ABFA 3WF2A 1UG6A 4HOXA 1XSKA 4PCTA 4BQ3A 3VVGA 1EGZA 4U5IA 1EIBA 5IFPA 5LA2A 3WFZA 1KR1A 3WQ4A 3HMCA 2XJ7A 3SCQA 4ML4A 1QHPA 5LYRA 5C71A 1WDQA 4KMQA 3ZJ7A 3EDFA 2WZHA 2VTFA 4AEFA 4M56A 7A3HA 2BHYA 1MYRA 3AHYA 3T2OA 4BQ4A 1N82A 3GXDA 5A6KA 4AD3A 4XX6A 2J47A 3N18A 2DIJA 4B9ZA 1B3ZA 1G94A 1XD0A 1H41A 3WL1A 4E8DA 3ZT6A 4GXPA 5A1AA 2CPUA 5DFAA 3M07A 3SEPA 4DUVA 3N17A 1XC6A 2XFRA 2V3FA 5LA1A 1GHSA 1VEMA 1ZBCA 4UOQA 2YIHA 3M6DA 3AS2A 1W9DM 4TTGA 1UD6A 2CCRA 5JBEA 4IUGA 1HXJA 2CESA 2YOCA 3CZ8A 4CVUA 2PC8A 3AMDA 2E8YA 4IPNB 5IFTA 1ZU8A 4U31A 3M46A 1C90A 1E1FA 3RM8A 1CGUA 1M53A 5HNNA 4H8UA 1M7XA 3AHVA 5FD0A 2BV9A 2XG9A 3EMQA 3U7VA 3N9KA 1OGSA 4FLRA 4C7DA 1I75A 1UR9A 3CUGA 1QNRA 5CLTA 1KWKA 2DSKA 1ITXA 1EDTA 2G4FA 2OYMA 1UH3A 5BWFA 1DHKA 1MW1A 3T2PA 3UCQA 4OBSA 4UQAA 1US2A 3UERA 4H2CA 1UH4A 4P8WA 3ZR5A 1DWJM 1FHDA 1J0ZA 1J0YA 3FHQA 1OINA 2VX6A 1NOUA 3SCWA 3PZNA 2WKGA 4CUCA 2PWDA 2BXZA 1Q4NX 1NH6A 3ZIZA 4AW7A 3GNOA 3VGFA 1GQIA 4GQRA 1EDGA 4HMCA 1GQKA 2XIIA 2WMFA 3W6LA 3O6AA 1W1PA 3EMZA 2YL5A 4JCMA 1SMDA 3NIYA 4J27A 1AMYA 4BQ5A 1JD7A 5LA0A 2A3EA 3VO0A 5A6SA 1QNQA 3F5KA 1VEOA 2C0HA 1BG9A 3N1AA 4R27A 3FHAA 3RPMA 3TTOA 4PMDA 2VZUA 1E0WA 4GKLA 4N0RA 1NQ6A 1G1YA 1HJVA 2XTKA 1JNEA 5A6BA 4TUFA 3OIHA 1PJ9A 4W87A 2F8QA 3J7HA 3PZ9A 4D6DA 3WELA 3WDQA 1EDQA 1Q6GA 1E6ZA 3ARXA 1RP8A 2JIEA 1UWTA 1MXGA 4WF7A 4CD8A 3FXYA 3UEQA 2FH8A 2XWEA 4PMOA 4AIOA 3RCNA 1KBBA 3NDYA 2ZX6A 1WO2A 1HL9A 1PX3A 1JI1A 4NI3A 5I78A 1XCWA 3VIHA 1W9VA 4AZCA 3LPGA 3N13A 3UG5A 5AC5A 4V2XA 1OM0A 2ZX8A 3VU2A 1DWIM 4ZXOA 3W27A 3GNRA 1TR1A 2XWDA 1TFVA 2X2YA 2WCGA 1CEOA 2IXVA 5E6YA 1JZ2A 3POCA 3WL0A 3KL0A 2QF8A 1E4NA 4U3AA 2PWFA 1R8LA 3T0AA 2J7EA 3BH4A 2ZIDA 4C7FA 3IJ7A 4PTVA 1QNPA 5I79A 1IV8A 2G3MA 1BAGA 5D4YA 4CU7A 2BXYA 2QPSA 4BCEA 1B30A 1Q6DA 1L8NA 2WXDM 3WD0A 5A3HA 1E70M 3CH9A 4WK9A 1KB3A 3ZT7A 1OIMA 5CLWA 1LWHA 1BYAA 2WZEA 2QHAA 2WMHA 4W86A 1C3FA 2W62A 2W91A 4W8BA 1LLOA 3CZEA 4M81A 1UQYA 4W7UA 2HISA 1UR0A 2WVVB 3VX0A 3MSDA 5EB8A 3N15A 3VKKA 2D22A 1UD5A 1FH9A 2GSJA 4JFUA 4BQ2A 9CGTA 1JL8A 4MAZA 3B8SA 3U5UA 3AIUA 4J3VA 2ZXQA 3W28A 1RD6A 5FKYA 4AZBA 4ZEPA 4TX6A 1E5NA 4HA4A 4DWSD 1CTNA 2VJXA 3WF1A 4MPKA 1VAHA 3WUEA 1B0IA 3BAJA 1JZ5A 1ZL1A 4B3KA 3OLDA 1UA7A 1DWHM 5IDIA 3OLGA 1O7AA 4BZYA 2V3GA 1XV8A 3II1A 1Q6CA 4CD6A 1PIFA 3AS3A 3BC9A 3B9AA 3AQUA 2CNCA 4TOQA 3BMVA 3OLEA 3CHDA 1FFQA 4UNIA 2XVPA 3CUJA 4KGLA 2UY5A 4E8CA 3KZSA 5CSYA 1CENA 2YDSA 2NT0A 2X05A 4C7GA 1E6XM 3SCTA 3MV01 4J3XA 3PZUA 1VFUA 1EA9C 2GK1A 4D72A 2DQXA 4GINA 1ZS2A 2J77A 1FFRA 4NSBA 5A6JA 3K8LA 2NT1A 4MNMA 2CXGA 1ODZA 3T08A 4CD7A 2D23A 3JUGA 1CGXA 3BAIA 3UR7A 2A3CA 1U30A 1A3HA 1VBRA 3MO4A 2E9BA 1V0KA 1E6RA 2DSVA 2CITA 1NOWA 2JFEX 3K8MA 1M01A 3CZKA 1MFVA 3N12A 2ZUWA 1ZJBA 2GJXA 2WMGA 3WDPP 1UKOA 1E71M 2JE8A 3BCFA 4QLKA 3BGAA 1C92A 1H09A 1V3JA 3IAQA 2BHZA 3IJ8A 4KWUA 3A47A 1AQ0A 2J7CA 3TOPA 2Y5EA 3VM5A 1BVZA 3W82A 1UWSA 4HU0A 4WJXA 6A3HA 3SUTA 1G9HA 2YDRA 4H04A 1K6AA 2WWDA 4F8XA 1EH9A 1B3VA 4UFLA 1E73M 4AMCA 2WMIA 4OJYA 1H3GA 3FW6A 1HL8A 1UKTA 2FHBA 2VURA 2VZOA 5D9MA 3AROA 2J75A 2ZUVA 2WM0A 2A3HA 3WMCA 1EQCA 3QOMA 1C8XA 2AMGA 1AVAA 2WYSA 3DECA 1E40A 2XGIA 3GZAA 1E6PA 4CGTA 2WCAA 1BSIA 1QHZA 2YL9A 1GPFA 3GXIA 3WDRA 2BY2A 2ZE0A 1TE1A 1H11A 3BXWA 2WZIA 1BTCA 5A2CA 1KXQA 1X6LA 3WQ8A 3T0BA 3GBDA 3WY1A 4CCCA 2ESCA 3AHTA 3MMUA 4S3JA 4IM4A 1JZ4A 4CU6A 1PIGA 3AS1A 3K8KA 3OBAA 5GNZA 4PRWA 2O9RA 4LGXA 2YL6A 2W63A 3ZM8A 4UZSA 2CEQA 2Z1KA 1R87A 3BAWA 1E4MM 3GDBA 2PBOA 2RGLA 3LPOA 1HNYA 4M1RA 4CVWA 2VT0A 1QI4A 2OWWA 1RP9A 2X1IA 3EYPA 1KGWA 1JFHA 3ZOAA 4KGJA 3CHFA 4QDMA 4EK7A 1BVNP 4QAWA 2VX5A 3ARWA 3APGA 3W38A 1V3HA 3PBGA 4U2YA 4FF5A 1I1WA 2OYLA 4XZWA 2VCCA 5I24A 3VMOA 1UKPA 1WDRA 2WHLA 3PZGA 2VQUA 4WSKA 3SUVA 3ZJ8A 3CUIA 1QVBA 3BSHA 3WDJA 3TTQA 3ARVA 3O2LA 1TA3A 1GORA 2YJQA 3W37A 1MW3A 1MW2A 1WNOA 3VDAA 3LMYA 1E0XA 1V3LA 3GBEA 3IK2A 1UA3A 4HPHA 2XM2A 3DHPA 2CETA 4YHEA 4AY1A 1TZ7A 5CXPA 3ZO9A 2V38A 1J18A 2UWFA 1PAMA 1WZMA 1JNDA 1QW8A 2F2HA 2VZVA 1OBAA 3THCA 4AZ7A 3O9NA 1R7AA 3SCVA 1J12A 3VDCA 2PWGA 3VD9A 2YLAA 3AXXA 1TCMA 3ARSA 3L4ZA 3SURA 4U2ZA 2OWCA 3TONA 2FGLA 2XIBA 3DYPA 3E1F1 1WB0A 5DT5A 1MQQA 1GVYA 4PUDA 1J0HA 2JEQA 2FDMA 2VX7A 4HOZA 5DF0A 1VEPA 1OWQA 5FL1A 3UESA 4R5EA 5EMYA 5A2BA 4PCSA 2DT0A 4AZGA 1IT0A 2A3AA 2DT3A 2Y4SA 3CZLA 4ATLA 4PMXA 3WQVA 1MFUA 1W3LA 4XZBA 3SCNA 3WEMA 4ACZA 3WIJA 1LF1A 4N42A 4D1IA 5CGMA 2J74A 3SIMA 5D9NA 3AIWA 4UCFA 4D6CA 1LWJA 1ISXA 4MNLA 3T2QA 2MANA 1LG2A 1NWSA 2W5FA 3VIIA 3BAYA 5A6MA 2NW0A 4LXFA 2XSAA 1AQHA 3L2MA 5EFDA 1V3KA 5A95A 5ABFB 5HOSA 1CGVA 4H8VA 2YA1A 3K4AA 2PB1A 3PZOA 1OGBA 2CYGA 5I77A 4AD4A 1E43A 2XFFA 1W3JA 1WAWA 2CKRA 1GQLA 5CPQA 3WD3A 1DWAM 2VL4A 3AIVA 3WDHA 4JL2A 2J79A 3QHNA 4WSJA 4P8VA 3VMPA 4E2OA 2W61A 1GJWA 3WH7A 1CECA 1V03A 1HKJA 3CUHA 3TTYA 1K9DA 1BYDA 4ACYA 2EPLX 1W32A 2VR5A 1JD9A 3AHZA 2WVUA 4MTVA 4KRTA 3U5YA 2AOSA 1JDDA 1CGWA 3FN9A 2BHUA 2E9MA 3AS0A 4U3CA 3RO8A 4TXEA 5AC4A 5M3WA 3IJ9A 5JIPA 2J7FA 1WKYA 2YLLA 4NRRA 6TAAA 1H49A 1X6NA 1QNSA 2G3NA 2EJ1A 2ZX5A 3QHMA 5BXRA 1VF8A 1XYZA 5C8BB 4PBGA 1JXKA 1UD8A 3RM4A 4AWEA 3WKZA 2ZWYA 1JFXA 2J78A 1C93A 1FHLA 1F4HA 2J8GA 1UZ1A 1W9UA 4PMUA 2EPOA 4UFMA 5JIWA 3K46A 3WFLA 1GOOA 1ITCA 3FAXA 4MAVA 4OOUA 4J3TA 1J0KA 4PMRA 1JAEA 3WF3A 3K4DA 1J0IA 1MQPA 4W89A 4UOZA 4HMEA 3ALFA 4MB4A 1H1NA 4D6GA 2D0GA 3ARZA 1MQRA 2WSPA 2VMFA 2ZICA 3A4XA 4ZXLA 3U57A 2D24A 1JXJA 4AIEA 5E0FA 2ZWZA 4FMVA 4Q22A 4LX4A 1CBGA 1IZKA 5E70A 2W66A 2EPNA 2OYKA 3F5JA 5HBFA 4J3SA 2D20A 3OB8A 4P8XA 1LL7A 4V28A 4WLCA 5ABGA 2DEPA 4PMVA 1NWTA 2J4GA 1KCKA 3S6TA 1WDSA 1UD4A 3S2CA 3W25A 4AXNA 4GZEA 1UD2A 1EO7A 3SUSA 1HJXA 2Q8XA 1GUVA 1VJSA 4Q7NA 1V6XA 1U33A 2PWEA 1LG1A 3LPFA 1DWGM 2WMKA 4JFSA 1UZ4A 1C7TA 5ABEA 2XHYA 1CPUA 4AD0A 2G8ZA 2PBGA 1PX4A 5BRPA 2IUZA 5HPOA 3QGVA 3FY1A 1TVPA 5CG0A 3VILA 4DUXA 3WNLA 3WN6A 3BMWA 3W4RA 1QI0A 1V6UA 1BFNA 2E0PA 3VIOA 3L4YA 1EHNA 4XV0A 1UQZA 3MUAA 5M03A 1RH9A 1KXTA 4HZ8A 1UWQA 8CGTA 4AZ6A 2W4XA 1QBAA 2CERA 2E40A 1GQJA 2G41A 4AZCB 2WANA 4HA3A 1CXLA 2VI0A 4F9DA 1ISZA 1HJQA 4AEEA 2D3NA 2DT2A 2Y8KA 1B31A 5DMYA 1GNXA 4W8LA 4AD5A 1QOXA 2CKSA 1QI2A 1QBBA 3AXIA 1UR4A 2J7HA 3MU7A 1ODUA 1W1TA 3NJ3A 2V5CA 1A47A 5CSUA 1XH1A 5E0CA 5M5DA 3VM7A 2IXUA 1LL4A 2XYLA 2Y2WA 1Q6EA 1V0NA 4GZJA 2DSWA 2UY3A 3UETA 4WIWA 3WQWA 1BLIA 1K9FA 4DWSC 2V3DA 3WENA 3ZJKA 2PF0A 2VNCA 2WBKA 4F79A 4P8UA 1XH2A 3QR3A 1VJZA 2ZUNA 3G6LA 3SCRA 3SCUA 5A8PA 4CCDA 2FHCA 5D8ZA 2YA0A 3OGVA 4QP0A 1P6WA 2G3IA 3ZJ6A 4HU8A 5A8OA 2X09A 3UG3A 2BVDA 5D9OA 2D1ZA 1FP8A 3VX1A 1G5AA 2XFYA 3NCOA 3OGSA 4ATDA 1BGAA 1V3MA 4W8AA 2ZUTA 1HVXA 1E9LA 1DTUA 3EBVA 4W5ZA 2VUYA 3PZIA 4CKQA 1KXHA 1KBKA 4ATWA 1W1VA 2DH2A 3CMGA 1O6IA 1J9YA 3PZVA 4UFHA 2ZUSA 4UQDA 4J3UA 2AAAA 4AD2A 1JZ7A 2EQDA 3EDEA 1U2YA 3MS8A 3W0KA 4HOWA 1R86A 2JALA 1E3ZA 1GOWA 3VDHA 2XGBA 1OT2A 2GJPA 4KH2A 3FAWA 1NWUA 2QMKA 2VRQA 3VGDA 4GO8A 4NF7A 4P7OA 4AZHA 4LYQA 5C70A 3W24A 1JZ3A 1HJUA 4MB3A 2J62A 3WQ6A 1OT1A 2X0YA 4QLJA 2GK1B 4JFWA 3D5HA 1H5VA 3CMJA 1HX0A 1KWGA 3OA5A 3AMCA 1Q6FA 2C8NA 5E6ZA 2TAAA 4E4PA 4PYSA 1TVNA 1PEZA 1E5JA 2O9OA 1ZBVA 2YA2A 3BAKA 1UR8A 1E4IA 1V6VA 3HJEA 1S46A 1W2PA 5A6AA 5D8WA 1ISVA 2WBGA 1NP2A 1V6WA 3VNZA 3AYSA 1SFSA 3KL3A 4HZ7A 2WSKA 3ALGA 2GJXB 1WZLA 7CGTA 1MWOA 4JHOA 1TG7A 3M7SA 1SMAA 1QI5A 2ZXBA 3AIRA 5BRQA 4X9YA 2DH3A 3RILA 2PI6A 4CCEA
chains in the Genus database with same CATH superfamily
1DWFM 2PU1A 3GLCA 1GQNA 1XYAA 2WC4A 4PGLA 2ZKMX 3H22A 2NV2A 4RDZA 3V0TA 1S2AA 3IIVA 8XIMA 3APTA 4YVPA 5ENLA 3GM8A 1VGAA 3GVQA 3IWPA 1P0BA 1TWSA 4MWAD 2G5WA 2O4MA 4ZB0A 2PRHA 1J93A 1XSJA 2P88A 3ARPA 3GX9A 8XIAA 1JGMA 4K68A 1QK2A 2DV0A 5AHMA 3HTWA 4FX7A 4X0NA 2YCLB 1XIJA 3BQ6A 5GVJA 1H63A 2E09A 3S5NA 1W37A 2V67A 2Z2AA 2QMJA 1H1YA 4MGGA 1WXJA 3IAPA 3LCHA 3TV8A 1VFHA 3NR0A 1QUMA 4U33A 1W91A 5CKSA 5I6SA 5KEZA 1DYSA 2Q71A 1GVIA 3NYDA 4DZHA 1ISWA 3Q37A 1Q6QA 2E3ZA 3K13A 2FH6A 1VFFA 3VMNA 4MDOA 1AODA 3AZTA 3ATZA 3K4WA 1B9ZA 1ZB5A 3STFA 1XLMA 1XR2A 4A35A 2FZBA 4EAYA 1R9YA 5BXTA 1P7TB 1B3WA 4A6GA 1BGGA 3B0YA 4QAIA 3H7RA 2CBVA 2FYMA 3OG2A 3EWBX 2C91A 1NM9A 4OZOA 1L9WA 1K9TA 1DIOA 3PSVA 2XPKA 1O12A 1HF6A 3WJYA 1D2KA 2ZZ5A 1R3QA 2ASHA 4O50A 2CZ5A 3BE7A 2O7SA 3HM7A 1BWVA 3W29A 2X1RA 4N7QA 2WAGA 3KP1A 4QXIA 1O68A 1L6FA 1T7LA 2NV1A 2BFGA 4ZBCA 2HVNA 1V02E 5CZSA 3PZQA 4CN1A 3L4WA 3FK4A 3MPGA 4H8HA 4P2VA 4CN4A 3RLGA 5EFFA 3PVFA 2J7GA 3GHTA 5CZ0A 1D9EA 1E72M 5F7UA 4Z2GA 2PGRA 5FEXA 3HGJA 1IR1A 3SCPA 4B5UA 1QRQA 1JYNA 3I3EA 1YLVA 3DENA 1ECQA 1DJXA 4QSHA 1ISYA 1O5KA 3CQHA 3O0KA 2ZTKA 1A50A 4XIAA 4NAEA 3N2MA 4DJFD 4YPJA 5HDRA 5AYBA 3ANYA 1K9EA 2Y5SA 2CW6A 3H4GA 3TQVA 3OZOA 2I57A 3SN4A 3T0DA 3KWXA 4N6FA 4PMZA 3QV9A 1M9HA 3P7YA 1A0EA 1FWGC 4S3FA 4QQUA 1OB0A 3EDDA 3TYUA 3E9AA 1YBQA 1J10A 1PB0A 4Y9MA 4J3WA 3VUPA 1EYWA 1RQBA 1TMQA 3ZT5A 4HPXA 1NARA 1SFTA 2IPWA 4OFCA 1E0TA 1JR1A 2BXVA 4Y6GA 1B3XA 4DM1A 3GKAA 4C1KA 3WQ5A 2Y89A 3CPUA 4M6UA 4H9XA 5TBOA 2BVWA 1QR7A 2WHJA 1XICA 2WK2A 5I07A 3QYQA 3WLPA 4RUBA 1PSCA 3UU0A 3PB2A 3O7UA 5EU9A 2ALRA 1C8QA 5BCAA 1R2TA 2VCBA 1E56A 2Y0FA 5PTDA 4RK8A 5D33A 4M82A 1ME8A 1KM6A 3VDGA 1O60A 2OEKA 3FS2A 3UVAA 1JUKA 1ONXA 2HPIA 2EO7A 1FWSA 1G4EA 4LV9A 2V30A 1BWLA 3H2FA 3PZTA 1KBIA 1VIWA 4BWLC 2OO0A 4HPJA 3S46A 5D30A 4HA1A 3VUSA 3LZ3A 5BWAA 4A2SA 4K37A 4MJ2A 4KEMA 5BXPA 4N9BA 2E6FA 1F3TA 1PIIA 4KCUA 1PX8A 4MB1A 1LQ0A 4ZA0A 1XRSA 1H4PA 4X9SA 3CZJA 1XINA 3Q58A 1OC7A 4PMYA 2YL8A 3W7IA 3V5OA 4AY7A 3N11A 3AIQA 3GR8A 2KZHA 3T78A 1C7SA 3WJSA 2WVVA 4E0CA 1EIXA 5CPNA 4H7ZA 5A6LA 3ABOA 4H7VA 1DXIA 1UOZA 4PUKA 3KEHA 5IHSA 2W92A 8RUCA 5I3FA 2XGZA 3LQGA 5HWNA 3N29A 1IZJA 3U4FA 1VFMA 2QCMA 3REQA 1J5TA 1QPOA 5F2LA 3PG8A 2WVTA 2YBVA 1YDNA 3UXIA 3CO4A 4FXFA 4A3YA 3VNIA 1BQCA 4QDPA 3ARQA 1XFCA 3CU2A 2DDXA 4UTHA 4TV6A 3BW3A 3DG7A 2PRMA 1R5YA 3VIMA 5G1TA 3VIKA 2OFJA 4QEHA 3GXFA 4KCWA 1KC7A 4GX8A 2JIWA 3UFYA 5TQLA 3UGRA 4OV9A 4FEZA 1VR6A 2W67A 4ZENA 2GVGA 4PTDA 1CIUA 5AHIA 5FI8A 2VYOA 4AG0A 3W23A 4A2RA 4PBEA 2WZMA 1JYVA 5AHLA 2GGJA 4EACA 3TQ0A 2OSXA 2VR4A 4GX9A 1OCQA 5JMUA 5DLCA 2YCIX 3NDZA 5JBDA 4QISA 3H70A 3W1LA 4HNCA 6CGTA 4O1DA 3WEZA 1Q7ZA 2FIQA 4TX8A 2PE4A 3ARTA 4M80A 2INFA 4BF5A 3IEBA 4ALDA 4ORMA 3I6EA 1BVWA 3ITXA 2ISSA 2H3DA 2EXOA 4C1NA 4Y8FA 4PSPA 4ZO7A 1R38A 3BG5A 1X7FA 1EOMA 3TC7A 5LNWA 2XUCA 4WKAA 3LRLA 3ID7A 2GWGA 3PP7A 4GUHA 3VDBA 3N6HA 2WM1A 2XINA 3T9PA 3SQMA 1XWYA 3BLPX 2J25A 3L0KA 2Z2UA 4HJWA 2WC3A 1AG1O 3SQSA 4R88A 3QMRA 2XVGA 4Z1CA 1ZBKA 4I8DA 3C5QA 4RKAA 4D6EA 4UQEA 1TJ0A 5HR6A 3AMGA 3HQ1A 3G6MA 3PG9A 1TRIA 8TIMA 3NOEA 4JL1A 4LALA 3LHWA 2UZ9A 3KBNA 1FCQA 2WW5A 1MW0A 4CNSA 4MVAA 4I5UA 1VP5A 2QCDB 4RR4A 1DV7A 3NQVA 3GVVA 3PUEA 1GONA 1ZBWA 2IPGA 4P61A 3I10A 3I4KA 3V1PA 5EY5A 4MYXA 1RSCA 2GGEA 2BY1A 4IHCA 4RNJA 1HKVA 4LUTB 3ZQ9A 2YDAA 1CDGA 3I6TA 1E3XA 3F03K 4KS0A 3TW7A 3W07A 4K1WA 4H9ZA 2PGWA 3AI0A 1MVYA 4LCRA 3T07A 3DFPA 5JBFA 4B15A 1X8CA 4EXQA 2ZXAA 3ZYZA 3HQNA 3RJXA 4IJBA 4Q8UA 3RM9A 1KM3A 4J2MA 4JQ4A 3IK4A 4PTXA 3ELFA 4JS3A 4JN6A 4YTTA 3VFCA 3S8HA 4EPBC 4TVUA 2WJEA 1Q65A 2VQTA 1B3YA 2H6RA 3WMBA 2CZEA 2I5IA 1JYXA 1S39A 1EBGA 3UCDA 2A3LA 2PDLA 3BPWA 3FYYA 1Y7VA 1AL7A 4DUWA 1H1ZA 5FSEC 1EHAA 4XZIA 3AICA 2V9DA 4BS0A 2I7GA 1G6CA 4D71A 1W3IA 4NIRA 3H7VA 5GNYA 7REQA 4PA8A 3AHXA 4W84A 3GB6A 1Q2SA 1FDJA 1VENA 3ME3A 1WE5A 3F5LA 1EBHA 3DYOA 2JF7A 4QG6A 4GA8A 4ADTA 2AQVA 1G67A 1XHGA 4DF0A 2Z6IA 4R7WA 4X0VA 2WWCA 1XH0A 3ZXWA 4L4MA 3S1XA 1G0CA 1AD4A 2QAPA 2NVCA 4OIFA 4JHMA 1BRLA 3R5EA 2QDDA 3FDKA 3UR8A 3O15A 1TTPA 3WBEA 2W0UA 1US0A 4F2BA 4PCTA 1EIBA 1XBXA 2GGGA 3KRBA 3W7LA 4QEEA 3HMCA 1LWIA 3OVQA 3OBEA 3SCQA 3KXQA 3WK2A 1UB3A 5C71A 3D0CA 1OHLA 3QGAC 2WZHA 1NDYA 4AEFA 1AJZA 2BX7A 3T2OA 1N82A 1ONRA 3GXDA 4AD3A 4XX6A 1DIEA 1FTXA 1NFPA 4BR1A 5DMMA 2VDGA 4J2PA 4IMEA 1XD0A 3P6LA 1H41A 3KBSA 2NQJA 3WL1A 1REQA 4GXPA 2CLMA 1K3UA 3LDVA 2JQXA 3M07A 4DUVA 2BGNE 3GC2A 5LA1A 3OHMB 1VEMA 4UOQA 2YIHA 1IXOA 1QPRA 1UD6A 4XZMX 5HQEA 4IUGA 3GRIA 1OX6A 1CI1A 1XUUA 4CVUA 2PC8A 4LB4A 2CXEA 1NF7A 2E8YA 1ZP3A 2E5CA 4NQ1A 4PC8A 1ZUAX 4WY0F 4LS2A 3HO8A 5BNKA 3RM8A 1DQUA 1UMYA 3W7EA 5HMSA 3FGCA 3IARA 1UR9A 1XIBA 1JPIA 3FA5A 2V0TA 3NXLA 5CLTA 1KWKA 3MWCA 2OYMA 1UH3A 3KBWA 2Z4GA 4OBSA 2F6XA 2A1YA 1TPDA 5CC3A 1QCWA 3RUBL 1IE7C 4A3QA 1MRAA 2W6RA 3UERA 4P8WA 4DBSA 2HK1A 1I8JA 3B03A 3TMQA 1TV3A 3TCEA 3C0LA 3S1VA 5HANA 2XIQA 4NJGA 3VKBA 4O8AA 2BXZA 1NH6A 5GJMA 3ZIZA 2DZBA 1PWMA 3DCPA 2XIIA 4R7JA 1VS1A 2OTDA 3LLDA 1P1XA 2XH0A 4J27A 4AF0B 1OFDA 4DJED 3TCSA 3PPGA 1QNQA 2C0HA 4R27A 3RPMA 4JX4A 4YWIA 3SSJA 3TTOA 4DXXA 2PTWA 2W27A 3PNZA 4H9MA 1QT1A 3EAUA 5A6BA 3GS6A 4TUFA 1PJ9A 2QYGA 3WDQA 1KFLA 2BP1A 2JIEA 2DZAA 4JTJA 3R7MA 4TIMA 4WF7A 4FIQA 1RLCL 1A4LA 3NTYA 2OQHA 3MSYA 3RCNA 2OJPA 5TF0A 1EJTC 1KFEA 5C9RA 3GIPA 2P50A 5I78A 1XCWA 1MUWA 2YXXA 4AZCA 1V7YA 3LPGA 4S23A 3UG5A 1G4TA 2ZFAA 4PCFA 4E4UA 1OM0A 2ZX8A 3LEPA 3VU2A 4H9VA 4ZXOA 3GNRA 1RY0A 2XWDA 1TFVA 3JS3A 4LVDA 4NNAA 2WCGA 3TN6A 3POCA 2QF8A 3EOLA 4U3AA 4FO4A 1R8LA 2XIOA 1E1CA 1AH3A 3T0AA 4C7FA 5KZDA 4PTVA 1JEZA 4R9OA 4BI6A 5LHFA 1YW1A 3NURA 3W7GA 2WXDM 3VNLA 2QUMA 1IEWA 4XVEA 4BI5A 1MRQA 1R46A 1LWHA 4WCJA 3VZXA 1BYAA 3S47A 2PTDA 2QHAA 4XAPA 2FJUB 2PZNA 4NX0A 4W86A 5DCEA 1C3FA 2W91A 4W8BA 1KW1A 4EP8C 2HISA 3DFOA 1EXBA 2G97A 4E6MA 3VKKA 3RX3A 3LHZA 2AGTA 4MAZA 3BG3A 4J3VA 1JPDX 3W28A 4K36A 1VHCA 3CWHA 3P60A 4LUIA 2VJXA 1KTCA 3EWYA 2VFFA 3NM1A 3BW2A 2ZDRA 1J8VA 5F4WA 1A80A 1PV8A 6XIAA 3UJRA 1JZ5A 1ZL1A 1IT8A 1DWHM 3W76A 3WLKX 3OLGA 1O7AA 3NOYA 3PR2A 4CD6A 3TQKA 5EPDA 3MA8A 3T4CA 3U2OA 3BC9A 3B9AA 1MNSA 4TOQA 2XZ9A 4ZZ9A 2CLIA 1FFQA 4UNIA 2XVPA 1YDYA 4KGLA 1S5MA 4GXWA 4E8CA 2HS8A 4CNOA 4IL2A 3H12A 1EA9C 4YLWA 1I2NA 2QCHA 2J77A 1TV7A 3TKFA 4JTAA 1H7XA 2NT1A 2CXGA 3TROA 4IG2B 1SO6A 1SZNA 2PS2A 1V0KA 3G8RA 2DSVA 4JNYA 3S3GA 2JFEX 3VZYA 3CZKA 1M01A 5BRBA 4Y90A 1MFVA 4HT3A 1F8IA 3N12A 5LZLA 3EXSA 4WQ6A 3A3XA 3L68A 2G50A 3WLIA 1C92A 3BOLA 1V3JA 1MSSA 2FZ9A 4KWUA 3A47A 1AQ0A 2Y5EA 3LQLA 4HCLA 2V8ZA 4PB5A 2HJPA 4O1EA 1YADA 3NPXA 1KNWA 3SUTA 3TNOA 1EEXA 4F8XA 4WD0A 3LZ5A 4Q7BA 2ACRA 4W9TA 1H3GA 1GEHA 4HVXA 1UKTA 2VZOA 1PL9A 2J75A 3CWNA 4S2BA 4G6CA 3WMCA 1C8XA 2AMGA 3N73A 1AVAA 3O63A 3LV5A 4Q7IA 5L6UA 4CGTA 3F7JA 3ZLFA 2J66A 1BSIA 1QHZA 2Z00A 3G1DA 3GXIA 5DMLA 3WDRA 2ZE0A 1TE1A 5CEWA 3BXWA 2WZIA 3TEVA 1BSLA 4PUMA 3UY7A 3TE9A 3WQ8A 3A5FA 4CCCA 3ANVA 3AHTA 1JZ4A 1PIGA 3GHRA 3L12A 3DFQA 4C6IA 4Q4SA 2Y7EA 4ML9A 4O57A 5CCZA 1TREA 3BAWA 2XH4A 4GACA 4AAJA 3GDBA 4NJHA 4BJHA 2PBOA 2RGLA 3UJSA 1KA9F 1OG0A 2RDWA 1ZQ5A 3WX7A 4KEUA 5EKYA 1RPXA 3CHFA 4HKPA 1FY6A 1RCXB 4GD0A 3CLMA 2VX5A 4NAFA 4G56A 4Z1BA 3P3BA 1TPVA 1YIXA 2G4JA 1TPB1 5LNUA 4QG8A 3TNBA 4XZWA 1EPXA 5REQA 3VMOA 1W5OA 3FA3A 3FJNA 5BOEA 1VYPX 2X1TA 2QR6A 1XI3A 4WSKA 1VFLA 2VEPA 3CUIA 4WSHA 4DJDA 3ATYA 1FWDC 1O1ZA 3PFMA 3CS2A 3ARVA 2B7PA 4PB4A 2ZZ4A 1WOBA 1C9WA 1MW3A 1VC4A 3E2RA 2CLEA 2V6AA 1SJDA 2QJJA 4RDYA 1R0MA 1V3LA 3WBYA 3SDOA 4GIRA 3W2KA 6TIMA 2CETA 4L9YA 1RJQA 2POTA 2QUNA 1J18A 2IPJA 1PO9A 3EOOA 2WKJA 4CCZA 3MT1A 4AZ7A 3THCA 3O9NA 3KAOA 5AN7A 2YSWA 4CLMA 3VDCA 1EZ2A 4LC8A 1G69A 1VYSX 1RK5A 3E1F1 1H7NA 5FF0A 4FP1A 2CZVA 4M6PA 3KLKA 3EB2A 2OGJA 3QV6A 4K8GA 2VX7A 2WZTA 5DF0A 1VEPA 3KM8A 5A2BA 1EC7A 2A85A 2DT0A 4AZGA 4ATLA 4J9JA 3T40A 1W3LA 2VGIA 4UMCA 4ACZA 3WEMA 3WMLA 4D1IA 3S2JA 2J74A 1Q8AA 2V5BA 4JYFA 1I0DA 1ZAHA 3ABRA 2R8WA 2GWNA 1XGEA 1NWSA 4Q8VA 3LCIA 2NW0A 2X40A 5L9FA 1AQHA 2HSAA 5A95A 5ABFB 1CGVA 2YA1A 3DGBA 3MVIA 3H2AA 4ZVJA 3QZAA 3PUGA 5I77A 4AD4A 3JR2A 1E43A 4FNPA 2O56A 3M0IA 3GDLA 1W3JA 3NXFA 1GWJA 1BXNA 2C18A 2VL4A 4O1FA 1VFSA 4K7YA 3MJMA 3FDGA 1B4KA 4P8VA 1ITUA 4XD3A 4E2OA 1YMYA 4R33A 3WH7A 1CECA 4HYWA 1DVJA 1K9DA 3M41A 1W32A 4HQVA 2VWTA 2VR5A 1KV5A 1TTIA 2R14A 1SPQA 2Z27A 4EWND 2ACQA 2E9MA 3AS0A 1U22A 2C71A 2WQPA 4YYFA 2J7FA 4RX0A 2YLLA 1KM0A 4HHPA 3HG5A 3E0FA 4PE8A 3QHMA 3MHUA 1FWFC 1V93A 3TWBA 3W1QA 4PTNA 1UD8A 4UTWA 3W85A 2YB1A 3SAZA 4WDXA 1ZALA 1BWKA 1RCQA 3N4AA 4LVGA 2EPOA 1I2RA 3FLUA 3QY6A 3V36A 4UMBA 3L0GA 1GOOA 3OQ8A 4OOUA 4J3TA 2ZCGA 1J0KA 3ERPA 4PMRA 3WF3A 4N4PA 1MQPA 3A13A 4W89A 3N3TA 4UOZA 5B7ZA 1UW9A 3DESA 4MY9A 4MB4A 2D0GA 4ZQCA 2QCGA 4A8RA 3A4XA 1JXJA 4AIEA 5E0FA 3B9OA 1R3TA 1MI3A 4Q22A 1DL3A 3BK0A 4LSBA 2PLKA 1RR2A 2OYKA 3FYOA 5XIAA 5HBFA 5D37A 3OB8A 4P8XA 4ZQPA 3MDWA 3WFAA 2OOGA 4ADSA 4D8LA 3TC3A 1NWTA 2J4GA 3PC0A 3S6TA 1KM4A 2FZMA 1F3WA 4O0QA 3HQOA 2FDSA 1UD2A 4Q3MA 1TPEA 1OCJA 2H3BA 4RZ6A 4C6EA 3MUCA 3GDTA 4Q7NA 1V6XA 2VEMA 3LV6A 3ZLGA 1LG1A 3M0HA 3LPFA 3M43A 1DWGM 4EPKA 2WMKA 3NZGA 4JFSA 1K7FA 3UYCA 3MJYA 2XHYA 1CPUA 3CIXA 5EMLA 3ITCA 1WQ5A 2C3ZA 5CG0A 2FZNA 3HPAA 4ZODA 3WN6A 3TDFA 2ICSA 3ZVIA 1UQZA 4GJ1A 3PPHA 3WCZA 5M03A 1KXTA 3H2OA 4AZ6A 2NQHA 4WUIA 3RYSA 2WNNA 4B90A 2E40A 4V15A 1JJKA 2G41A 1XG3A 2DJXA 4ZSTA 1SO3A 1XLJA 3JZUA 4LB3A 2HE8A 4DNMA 2VI0A 1C9DA 4I5XA 1ISZA 3ZVHB 1POJA 4F0MA 2Y7FA 2DT2A 3WZ0E 5DMYA 3EX3A 1ZRQA 1QI2A 1UBPC 1AQFA 2J7HA 3V1HA 4QX4A 2V5CA 4LUYA 1XH1A 5E0CA 2OELA 2TRSA 1LL4A 1YTDA 4IJCA 1ZSXA 1XLDA 2Y63A 5GJPA 4WIWA 3WQWA 2I9UA 3BOFA 1K9FA 4DWSC 2V3DA 2X42A 3KZPA 3ZJKA 1SQ7A 4KT2A 2D2GA 2WBKA 1IXPA 3CQJA 1HGYA 3GIYA 1VPYA 1Y5WA 4CCDA 3OGVA 2ZVRA 3SI9A 3GVWA 3ZJ6A 2NWSA 2GPTA 4IQLA 3OTRA 2F6KA 1VPQA 3E2SA 3M6YA 5CC6A 5FJJA 1S38A 1LOQA 3VX1A 5AYXA 4RE0A 4X3ZA 3FYPA 4IFKB 1X1OA 3OGSA 1A5AA 1V3MA 1DTUA 4UTJA 4XK2A 3JZEA 3UF9A 2VWSA 7ODCA 1KXHA 5LNSA 1KBKA 2PGEA 4G9PA 3PS7A 3KVJA 4UFHA 4FR1A 4LCQA 1JCJA 4J3UA 4AD2A 5KZMA 2R1NA 3URBA 1U2YA 4DUOA 3NAVA 1F61A 2BGSA 3THQA 1GOWA 4WDUA 3PUOA 1K8ZA 1RV8A 1EP2A 4AZHA 1T41A 5C70A 1YX1A 1PKMA 4IPIA 2YCKX 3UXKA 4MB3A 2J62A 3WQ6A 2A7NA 4JOMA 3SR7A 2VFEA 2GK1B 4H6QA 4LUJA 1FCVA 3AYVA 1KWGA 1DXFA 1IXNA 1PHQA 3NQGA 3OZMA 1PEZA 3KTCA 3CV2A 3TSBA 3BAKA 1MEHA 5T9BG 1E4IA 4N9CA 4ZO6A 1W2PA 3IJQA 5D8WA 1ISVA 2VP8A 2IKJA 3KL3A 4HYVA 2WSKA 2GJXB 3HA1A 4UBPC 4AVOA 1S2VA 1YRRA 1SMAA 3UCCA 2QULA 3NL5A 2ZXBA 4X9YA 4Y9OA 2DH3A 1S5WA 3I3BA 4PODA 5A8MA 4PUUA 1DEDA 1EXPA 1Y5VA 2HBXA 3TK7A 1UWUA 3HMJG 3AXHA 4B2DD 5FL0A 5J8LA 3EPMA 5GQBA 2AL2A 3G0SA 3OZPA 4KIEA 3N3MA 2NSXA 3S5YA 4JXCA 1XM3A 3POHA 2EPMX 4L6DA 2O92A 4OUEA 1JZ8A 1GVFA 4AZ5A 2ISDA 1K70A 1GGOA 3BAXA 2CHNA 1H51A 3VXGA 3W7DA 1KFJA 1S2TA 3VOIA 5DT7A 3VCRA 1SO5A 4UC5A 5LKYA 4L1XA 4O1BA 1LZOA 1W31A 1MUMA 1OFQA 4RLIA 2XDFA 2GVJA 3A24A 4DAIA 1DIDA 2GDVA 3WD2A 4UFKA 3FJLA 2VFHA 3S42A 4OT7A 2PDNA 1D3GA 4GI8A 1UPPA 4C6KA 2OR2A 4HTYA 1P1MA 4Z0SA 2Y85A 4KERA 3I3DA 3KLLA 4N9EA 5LIYX 1QK0A 3M5YA 5B80A 3STGA 4UTTA 3PWGA 2W79A 3V4BA 3Q65A 5I2UA 1AW1A 1CXFA 2W9MA 4J40A 1UHVA 1V3IA 3BJSA 4JFVA 4Z2KA 4B9YA 4M8UA 2HNEA 5FOOA 3CQIA 5K7JA 3URAA 1UJQA 4MJ4A 4YMZA 3GH4A 4NL1A 2Z1BA 3VIJA 4YS1A 2I56A 1EP3A 3P84A 3VZZA 3WUFA 1H0GA 4RZBA 5TIMA 3VGGA 3DKLA 2Z25A 4PN2A 1AL8A 3DAQA 4KBXA 1L6SA 3IS4A 4N2YA 3U4AA 4NT0A 3LCXA 3ONCA 2WC7A 1NFGA 4RNIA 1N7KA 1FQ0A 1YPFA 1XD1A 3PWIA 5MHBA 4AYSA 3OGRA 1FUYA 3UR2A 1HT6A 5ECUA 2YKKA 3WQOA 2CBIA 4JIPA 4D1JA 1WUEA 1EO5A 1EC8A 3AIEA 1SJCA 3HQPA 4MZ1A 4FLSA 2FZDA 3ZMRA 1LCOA 2JGYA 3WNMA 4O1CA 4O28A 4HBKA 2YFNA 2VR2A 1PVNA 1CXHA 4NNCA 4YHGA 3PBUA 3VKCA 3WYZA 3PTQA 3L7RA 2A7RA 3WJZA 1Z7AA 1KQZA 4JIQA 1J01A 1W54A 1KFCA 3GU2A 3W1AA 4D6FA 4AWUA 3C2RA 2E28A 2NXGA 1JDEA 1ADSA 1RJPA 4FSAA 2WVSA 5EGRA 4ERGA 4JY9A 4F0HA 5HXMA 4QFUA 4S3BA 1TV2A 3MBFA 1OYBA 3PTKA 3B3DA 1ICQA 4GC3A 4YNGA 2TSYA 4RE4A 1TUFA 2Q02A 4GYPC 4LH8A 2VD8A 3LUTA 1US3A 1XLBA 3OLIA 1EQPA 3VOCA 2WHKA 1BYBA 4ZGYA 4AISA 5MKGA 4W93A 4Y96A 2C79A 2QQ6A 1VQTA 3GAKA 4JCLA 1TJRA 2BBFA 5CPOA 4E38A 1R9ZA 4W5UA 2ZRYA 4PUWA 4GIAA 5CQ1A 1W56A 3T0TA 1F05A 5HNRA 1QW7A 3LN3A 2XZ7A 3CTTA 2Z1XA 5D9PA 3SGUA 4WXZA 3BLIA 3TJLA 1OD8A 4HTBA 4FOJA 4S3AA 1JIBA 3RRXA 1W1IE 4TVCA 5DRIA 1YXYA 1TTJA 4AX7A 2OEJA 3HU7A 5DEZA 2CBUA 1XW8A 4Q4MA 3C2FA 5BROA 4IISA 1F6PA 1YEYA 1FWJC 2WHMA 2GLKA 2BASA 2DSUA 2ZRXA 3C0SA 3TJ4A 2NQ5A 2BLEA 3UW6A 1WP6A 4UTFA 3SW6A 3PULA 3MTWA 1S3HA 1P43A 4Q33A 1HKKA 4QROA 4Z2LA 1CXIA 3W75A 4Y7EA 3ZSSA 3MO7A 1XKYA 4REQA 3AMLA 5JVLA 2HV5A 2IW0A 3TOYA 2E67A 2PDPA 2A2IA 3NQAA 4MJZA 2PC4A 3LMZA 1TR9A 4R53A 4LY8A 1SJBA 4C6OA 3IIZA 1CXEA 2QV4A 2GUUA 3STEA 3VNYA 3KTXA 3DZ1A 5I0DA 3BSGA 4OU1A 4EANA 3MMTA 2X41A 1RBAA 4XD6A 1AW2A 1WKDA 5IXEA 4FLOA 4WX2A 3BTNA 3GW0A 4LS0A 4LOCA 4NZFA 5MF5A 4C6CA 3SIZA 1V0LA 1UYQA 3F4DA 2GQ9A 3B9EA 1UKQA 2QF7A 4KW2A 4UFJA 4L4LA 1XGZA 2VVSA 4V33A 1HKMA 2PLCA 3NQ6A 2CHRA 2J7DA 3TVAA 1GVRA 3FOKA 3N4FA 3GG1A 2A3BA 2GUYA 4IPLA 4NJJA 4DM2A 2Y8VA 2A5HA 4JTCA 1JDAA 1GOMA 3KFTA 1KFWA 1K4GA 3VI2A 1WV2A 4W88A 2E1WA 3C86A 2AQOA 5G4WA 3T4WA 4OOZA 2FPYA 1VBUA 3DN5A 4A3HA 4AX6A 4CU8A 1R3VA 3NSNA 3F4VA 3WLNA 4NI8A 5D32A 3WQDA 4IIHA 7TAAA 1WZKA 1GVSA 1Z3NA 3A6OA 4JICA 4AC1X 3DYMA 3VOFA 5EYWA 2IQ0A 3BWWA 4LAUA 1QO5A 4PH6A 3BCDA 2HTMA 1XJBA 3SJNA 4DO7A 1XCXA 2YZ5A 1UR2A 3A4WA 4A3UA 2B4GA 4Z1DA 1XIGA 3DI1A 3B0VC 2VX4A 3PM6A 1AA1B 4EPEC 4MNKA 2WCSA 4GY7A 4HU3A 3CXOA 3CL6A 4GLEA 5BU6A 3VGHA 1RBLA 1B90A 4FXRA 3GTNA 2E4TA 3QPZA 1JF6A 2DUZA 3NQ2A 4MB5A 4O19A 3DHUA 4MDPA 1EOKA 3O3RA 5B7YA 4GCAA 3HGRA 1TPFA 1F7BA 2OLHA 4V27A 3W01A 2DGAA 4I9TA 2CHOA 5U4NA 4PULA 4FXSA 4YCPA 2OMAA 2CLPA 2J8FA 9RUBA 3DFTA 4Q8MA 5EA9A 4PMJA 1T40A 4P5UA 2JF6A 1OJXA 3F4WA 1I1XA 1QPKA 3VIPA 4EVZA 4AVFA 1Q6RA 1WOAA 3G1SA 2G3JA 1A3WA 2Y24A 1H61A 1D7FA 5D05A 4GI6A 1A49A 2YBTA 3QOKA 2ALDA 1LLZA 3GUWA 3W7KA 3PZMA 2IQDA 5A8QA 1J5SA 1XLHA 3F4NA 1KCLA 5CZKA 3IPWA 1K8XA 2QGYA 1PPIA 4GUJA 1W1YA 1TZZA 1BG4A 1PE1A 3UNTA 1V4YA 3QV8A 5U7SA 1GOIA 1SZGA 1LUCB 3NQFA 2FFIA 3RLHA 1CX9A 2OZ0A 5AHEA 2F2KA 4P7RA 2G95A 3VGEA 3R8HA 5BYWA 5DXXA 2VRKA 3CHEA 3VCNA 3XISA 3DBNA 3WSUA 4AZIA 3OVPA 4KWWA 1W2VA 2DUAA 2QJIA 1L6GA 4DWSB 3NO1A 4YJ5A 3IACA 1ZLPA 4GHRA 4WOQA 5AYIA 4F40A 4FF7A 1E6NA 1JI2A 1RPKA 4B16A 1YXCA 4HNTA 5DXYA 3TFXA 4PEEA 5FCZA 5IBXC 4WVXA 1Y0EA 3ECQA 3L5AA 4C6DA 1UD3A 3QTGA 2CBJA 2E6YA 5A69A 2ISWA 1E9IA 1KTBA 3QJAA 3PBMA 3B9DA 4C65A 5CPSA 1SUXA 1BF6A 4KRZA 2FLIA 2E25A 2R91A 2E6AA 3TYBA 3W7NA 3R89A 4S3KA 3MMDA 3LERA 2VOTA 4J5NA 3BLFA 1NWRA 2ZX7A 4CNTA 4GI4A 1LJYA 2BMBA 3CNYA 3GFYA 5FACA 1XLGA 4K6AA 1YNPA 5FAJA 2RDUA 1CLVA 1AJ0A 1TPWA 4N4QA 2QXWA 4HIBA 2AKMA 3KCLA 2R1MA 1GJUA 1Q7QA 3NO5A 2BY3A 3R12A 1EWEA 3IV3A 1VD6A 4L5ZA 3MUXA 1NF0A 3GD6A 3K5XA 3URNA 2FB3A 3TJXA 3WF2A 1UG6A 1OX5A 3TXZA 1XSKA 3B40A 4LT9A 1DKWA 5IFPA 1JCLA 3CTLA 3ZWTA 4Q32A 4QQ3A 3UXDA 3KVMA 3AWNA 2TMDA 1GG1A 4H8NA 4ZTXA 3DOPA 1RY8A 1QHPA 2I16A 4CQAA 1WDQA 1VHNA 4KMQA 3EDFA 4O53A 4K39A 5CSRA 3DIPA 3AHYA 7A3HA 4QSFA 4GY0A 4DPPA 1NSJA 3MBDA 1GOXA 2J47A 3B8DA 5AHFA 3N18A 3NDOA 4U4MA 2DIJA 2NV9A 3GSMA 1EKOA 1HZYA 1B3ZA 4MWAA 1G94A 3PBVA 1R9XA 2CPUA 4X2PA 5DFAA 3CUXA 3LYEA 1XC6A 6ALDA 3RPTA 1GHSA 3IVTA 3EWUA 3RGTA 5HA7A 3UNDA 4R9XA 4ERAA 1HXJA 5H6HA 3L67A 4L56A 2XN2A 1ICSA 2NVAA 4Z17A 4S3CA 3KS6A 5IFTA 1ZU8A 3PFRA 4QITA 1H5YA 4IIDA 1YE4A 1W3NA 4H8UA 4WDWA 3RU6A 2WOQA 5FD0A 4C7DA 4JBRA 2BOGX 1W5MA 1QNRA 3V75A 2G4FA 2HNHA 2P8CA 3E5BA 2YW4A 3W02A 4NZ1A 4H2CA 4F2UA 1NFBA 1F9CA 4E8GA 2V5KA 1J0YA 5HUOA 1OINA 2P3EA 1E9YB 3PAOA 4GVHA 3NQMA 2WKGA 1UIPA 4CUCA 2PDBA 3CUZA 2PWDA 1H7PA 4AW7A 2IS7A 4DZAA 5C55A 1GQKA 4LVBA 5AECA 1KD0A 2I5QA 3FEMA 2QVNA 3W86A 1PZ0A 2EG7A 4BQ5A 5LA0A 1D3HA 1S2CA 4EF9A 3F5KA 3H26A 3BL3A 5F4XA 3WQEA 5FF3A 5C2GA 2VZUA 1IEVA 3GTXA 3KBMA 3WG6A 3MCMA 2XTKA 3O8AA 3SY8A 4GGHA 3A21A 4DBWA 3PZ9A 1Q6GA 2E5BA 2HWGA 1E6ZA 3ARXA 3UZ5A 1UWTA 1W1B1 1AFSA 4CD8A 3UEQA 1MO0A 2XWEA 4PMOA 1KBBA 4IZGA 5G2HA 4MY8A 1W17A 1HL9A 3LTPA 3N34A 1EUNA 3VIHA 1W9VA 4IMDA 3N13A 4XKMA 4IXXA 5AC5A 4NZ3A 4V2XA 4X22A 5LIUX 2QDGA 4DJFA 4KESA 1TR1A 3TIMA 3LSCA 2IXVA 5E6YA 3I65A 3WL0A 1JRCA 3C56A 3MDUA 2C1GA 3VNDA 3NQ7A 3CASA 3UA4A 5D2XA 3UD6A 3ONBA 1SU5A 3ITGA 1IV8A 2P0IA 3OG3A 5D4YA 4O8RA 4ECLA 3S1WA 5C7VA 4E3TA 1Q6DA 3GTIA 3WD0A 4WK9A 2VUNA 4CQCA 2J27A 1FWAC 3QR0A 5LIKX 1Q2RA 5EMKA 3T44A 2NWRA 4QNEA 4IMGA 3H2EA 3MYOA 1LLOA 3CZEA 4FNQA 3CK5A 1K8YA 4F0LA 5EB8A 1WYIA 3QFWA 1FH9A 3BGJA 9CGTA 1RZMA 1KCZA 2YCJA 3K30A 2ZXQA 1RD6A 4IIEA 5FKYA 4S38A 4AZBA 2WJFA 4TX6A 2C13A 4DWSD 2Q8ZA 4FS9A 4HGXA 3WF1A 3WLOA 5LIWX 4LYKA 2P0OA 3PANA 4ZSUA 4BZYA 3KHJA 4AHPA 1XV8A 1K6WA 1ALDA 3WLHA 1KRMA 4X2RA 5LSMA 1YPIA 5C9ZA 1XYBA 2CNCA 1X38A 2ZA1A 4C6FA 3CUJA 6REQA 5C6MA 3S6OA 4AU0A 1CENA 4Q8OA 2ZZ7A 4R34A 2EHHA 3UPMA 5E1QA 1KM5A 1VYRA 4FNSA 1VFUA 3PSWA 4J35A 4GKTA 1PCWA 1ZS2A 1XYLA 3GNDA 4NSBA 3IIXA 4ES4A 3W22A 1ODZA 5AYZA 3T08A 4CD7A 2D23A 1CGXA 4RZ5A 1VBRA 4LF2A 2CITA 3CT7A 1VLWA 4G7EB 2QJGA 3C3UA 1XLIA 4GRSA 3Q94A 4UNKA 2ZUWA 2WMGA 4MFDA 1XBZA 2NQZA 3RK8A 2JE8A 4JTTA 2PDJA 3BGAA 2FTWA 3P0XA 4Q4PA 3AWOA 2J7CA 1MZHA 3TOPA 1IHIA 5DBUA 3VM5A 4JTRA 1TELA 2GQ8A 4WJXA 4YIWA 2ZDSA 3GE7A 4H19A 6A3HA 4IP4A 4UXDA 3KP0A 5FJOA 5F2GA 1RBOB 1EH9A 1B3VA 4UFLA 1THFD 1E9ZB 3GTHA 3FW6A 4F4RA 4L1GA 1TWWA 3AROA 2ZUVA 4XQ6A 2WM0A 2A3HA 1KTNA 3P61A 2WYSA 3DECA 1E40A 3GZAA 1V8EA 1DJGA 2YL9A 1GPFA 1U1HA 2H8XA 1M1BA 1JPKA 2DFAA 4O52A 1GVQA 3VK5A 1R47A 3T42A 3C61A 4MLJA 2GVLA 3BLLA 1ZJIA 1SSDA 3GAYA 5LXEA 1QFEA 5TAOA 2YCLA 3WLLA 5C0QA 1Y65A 4S3JA 4IM4A 4MOZA 3AS1A 1SM9A 1PDZA 3SRHA 4DBUA 4DNHA 1QU4A 2YL6A 2DZPA 3SZ8A 3HG2A 3CL7A 3R58A 4FX6M 1WA3A 3QEZA 1SW7A 4UZSA 1R87A 2REQB 4M6QA 5AZ0A 4FALA 3VCCA 3LPOA 1HNYA 4CVWA 1B54A 2VT0A 2E68A 2OWWA 3BO9A 4CNUA 1H7WA 4JTDA 4KGJA 4YVVA 3OIXA 4QDMA 5XINA 4EX4A 1IIHA 3APGA 1V3HA 4H6RA 3PBGA 4JYEA 2D73A 1I1WA 2P53A 1P7TA 2OYLA 3BSMA 2Y8UA 4IGSA 1GZ1A 3DEQA 1UKPA 4ICMA 2WHLA 2O55A 2NLIA 1I60A 2A6NA 3TN4A 2WSYA 2JGQA 4EIVA 3WDJA 3DHDA 3O2LA 1GORA 2DW6A 3W37A 1OABA 4GOAA 1WNOA 1XLFA 4LJ3A 2C16A 2CU0A 4HPHA 2AQWA 3D46A 4YTRA 4OBTA 3BG9A 4XZHA 2V38A 3B8IA 3UT0A 3N19B 1PAMA 2EGZA 5H1WA 1JNDA 2F2HA 2INEA 5AKQA 4DI8A 3GG8A 3IIOA 4OWGA 2DJLA 3MI3A 4KCTA 3VD9A 1TB3A 3NPWA 3M0MA 3L4ZA 1ZAIA 2GSEA 2XIBA 3RU8X 3QV7A 1PXGA 3C6CA 1FVPA 2VC5A 1MQQA 4PUDA 4TR9A 1VBHA 3MP3A 1DHPA 4M0XA 1JVNA 3H6OA 4HOZA 1KV8A 1CCWB 1OWQA 4Z0JA 4WJ8A 1XXXA 3QY7A 1TVLA 4HNNA 3UESA 4R5EA 5EMYA 3TSDA 4PCSA 1LLWA 1XISA 1KM1A 1QWKA 3CZLA 2Y4SA 2GQAA 5EMJA 4PMXA 2XH2A 5H91A 3WQVA 2HXTA 1MFUA 2HQAA 3WIJA 5CGMA 4PFHA 3P80A 4KWVA 4NG3A 4IPPA 3SIMA 5D9NA 3AIWA 4IH3A 3L5MA 3CWOX 2V5JA 1WKFA 1F76A 3VC5A 5D03A 4LXFA 3TFCA 2XIJA 3IV8A 2XSAA 1M7OA 4O13A 3L2MA 5D2WA 5EFDA 4O1AA 5HOSA 2INZA 4H8VA 2IKIA 3K4AA 5EMMA 4JEQA 4Z1YA 3QN3A 4G7FA 5IBXA 4XBKA 3GKFA 1XQLA 1HO4A 4FB7A 5DY2A 3W73A 4GIYA 2VGGA 2XFFA 2J9XA 5HNUA 1TRDA 4HHMA 1WAWA 4O18A 1GQLA 3WLMA 4J1OA 2GQ3A 1ONWA 3WDHA 1YDVA 2X7WA 5HULA 4WSJA 4Y9NA 3B0PA 4GBDA 1GJWA 3GU9A 4EXAA 3I68A 3GW3A 1HKJA 3SRDA 5FF2A 3AALA 4UTKA 1JD9A 3AHZA 4MTVA 1AZ1A 4KRTA 3OP2A 2AOSA 3U5YA 1JDDA 3V5FA 4QGCA 4HNVA 1DE6A 2HMCA 2E6DA 4TXEA 1OK4A 2PAJA 3XINA 1RJRA 4GCXA 4WY0B 5T26A 3R8RA 1H49A 4NXSA 3LCGA 3W7OA 4RDVA 2PA6A 1VF8A 1XYZA 2P3ZA 3IUDA 2Z2BA 4M3PA 1JXKA 2V2CA 4EPDC 4GJJA 1C93A 3E6EA 3V0UA 1UZ1A 4PMUA 4H9YA 4H01A 4MYAA 5GJNA 4CQ9A 1IQ8A 3ES7A 2QVHA 4UFMA 2VC7A 3WFLA 4H7CA 4O17A 3W71A 1XC4A 3LTSA 1MEIA 5BW6A 1PTAA 4GVGA 3ARZA 3NO3A 2WSPA 2A79A 3HPXA 4UR7A 3E74A 4ZCWA 4ZXLA 2D24A 1TPH1 1OC5A 4NY2A 4PBFA 2PDUA 3QSTA 1CBGA 2W66A 2EPNA 1JCMP 1NAL1 1T0OA 2V5LA 1H7RA 4M19A 1VCVA 4V28A 1EF2A 3HFTA 5HWJA 4D8ZA 1KCKA 3N2TA 1UD4A 3INPA 3GXTA 2R1LA 1EO7A 1HJXA 5HUPA 1LRTA 3CJPA 3T55A 3FXGA 2X16A 1GUVA 1VJSA 3CQKA 4XZNX 1Z41A 1U33A 5I3IA 1VFTA 4QM1A 4IX0A 4JNZA 4FOUA 1M7PA 4IICA 4TO8A 5ABEA 3FKRA 4AD0A 2G8ZA 5DY3A 4IXHA 3TYDA 2IUZA 4PUJA 3VOHA 3QGVA 1JUEA 3VILA 3WNLA 4ZOCA 1V6UA 1BFNA 2E0PA 1W3TA 3U2EA 3G2GA 5CJNA 1EPVA 1T6MA 1UWQA 2QV5A 3TN5A 1TJ1A 1J6OA 4G1KA 3VNKA 2ADAA 1DQXA 3TX9A 4AEEA 4GQGA 1B31A 1GNXA 4W8LA 2CKSA 3O16A 2Q3OA 1QBBA 2OOFA 3AXIA 3QQ1A 1HUVA 4AVNA 2QW5A 1ODUA 1W1TA 3MC5A 4US5D 5FA5A 3WBXA 1XUZA 5CSUA 3TZNA 4QJ3B 3W6YA 4F0KA 4DYKA 3B9NA 1Q6EA 1V0NA 2NX1A 4GZJA 3AU6A 1IXQA 4ZO9A 3RITA 1BLIA 3VKJA 1FDZA 4I6VA 3LGDA 2FZ8A 2PF0A 4DJEA 1AH4A 2VNCA 4P8UA 3QR3A 1VJZA 1X6UA 4GJIA 3G6LA 3SCRA 2QZRA 5A8PA 5I3JA 5D8ZA 4QR6A 4HU8A 4LVAA 4H1ZA 3HOJA 3UG3A 3G77A 3PNUA 2OZ3A 5I02A 2BVDA 3CIWA 2PSNA 3E0VA 4F48A 2XFYA 3M0LA 4ATDA 4W8AA 1E9LA 1Q45A 4W5ZA 2VUYA 3LXAA 1EJUC 4CKQA 4NUWA 2GOKA 4CNNA 2DH2A 3C4UA 2NUWA 1J9YA 3PZVA 1UP0A 3C2EA 2XSXA 4HK7A 4HOWA 1R86A 4XTDA 3TW9A 2QCDA 4YL2A 2XGBA 1OT2A 3LCWA 3FAWA 3KBVA 3WQCA 3KVLA 3LY0A 2VRQA 3MCNA 4P7OA 3M0ZA 1NTHA 5D09A 3N9SA 3W24A 1SFLA 1OFOA 4RW5A 1ZP4A 2ZRZA 4KFPA 1OT1A 4QLJA 4LBRA 1AMKA 3A3WA 1HFBA 4LUTA 1JCYA 4JR5A 3WK1A 2C19A 1Q6FA 5E6ZA 5AHNA 1GZGA 4E4PA 2WNZA 3P5ZA 3ORWA 1R3YA 1GK8A 2YA2A 1R3RA 4CQDA 1I45A 5DN1A 1V6VA 1S46A 3C2OA 1SZEA 4NYUA 3NZPA 2OB3A 3RR4A 4LAZA 3UWYA 4HZ7A 3ALGA 3PK7A 1WZLA 3W2NA 3M7SA 3P8JA 2VFDA 1QI5A 4JTSA 2PDXA 3RILA 2CEQA 4CCEA 2DSZA 2PP1A 3AYTA 3EWXA 1DIKA 4JQ2A 3NZQA 1XYCA 4Q6XA 4XUGA 4ZE5A 5E9XA 4AIUA 1RVKA 2VGBA 2R24A 3KX6A 2B7QA 3AOFA 3NEHA 5GNXA 1GKRA 3ABZA 1GW1A 3S6DA 4HPGA 3RLUA 4P7QA 4QDWA 2WMIB 3SBFA 4MNJA 1UWIA 1IGWA 4PCPA 3U2CA 3WH9A 1YPXA 2RDTA 4DLFA 4ZOEA 3LLFA 1CGYA 1NP0A 2NQLA 4AUBA 1SJAA 4D6JA 3DFHA 2ZA3A 5I5RA 3SSZA 4QG9A 2UY4A 2VGFA 1UUQA 3TA9A 3LOTA 4W7VA 4IIBA 4AY8A 3LRKA 2YPIA 2VM8A 2BVYA 3F1QA 4YXGA 5CJ5A 4U10A 1JULA 2ZXDA 1J11A 1JYWA 4LF1A 1ITQA 1TJPA 3RO6A 2GUBA 3A22A 1NIUA 2AAMA 2OZTA 1NQKA 3MSGA 3RFAA 4FOKA 1E0UA 4K38A 3SCSA 3D3AA 1KR0A 3QQWA 2EKCA 5KZEA 3UR5A 2ODOA 3QVQA 1AQMA 3VNJA 3SJ3A 4HCDA 4PEKA 5HQMA 1Q66A 2PP0A 4PCNA 3P5YA 4AMAA 2X7VA 3YPIA 3MUZ1 5TD4A 1A5SA 2NZLA 4FK9A 3W53A 4XB3A 5DRCA 1ZZMA 2CIPA 5HPCA 3H24A 4CQ8A 5AVNA 3WH5A 4JQAA 4GFIA 4CN6A 2VRJA 2A7PA 3GNPA 1VCGA 2QUTA 4HK5A 4ZMGA 1G4SA 3V7PA 4F9JA 2VZSA 3W7HA 1TA3B 2O7QA 4LUSB 2Z1VA 3W84A 2RGMA 2AKZA 3Q4DA 1JZ6A 4GZIA 3KOFA 5I3DA 3UZJA 2Z0IA 3L4XA 4ZE4A 1NY1A 1U83A 2RKXA 3RAOA 3CUFA 3EKGA 3HPSA 1WXZA 1U1UA 4PB3A 2DPEA 1ZJAA 3ARYA 3QZ6A 3ICJA 3G3MA 1QHOA 2OLSA 1Y8BA 2FPVA 4JDBA 1FH8A 3EEZA 5LNRA 2BB0A 2O9PA 1GHRA 2V3EA 5BU9A 2D2JA 1SZFA 4DO5A 1BF2A 4QE4A 3CB3A 1L2QA 3N2BA 3EDKA 3MP5A 1K1DA 2BGQA 2RDXA 2Z26A 1Q3NA 2BY0A 1L6WA 3E3HA 4NYYA 4HN4A 3W1NA 1NDWA 3WLRA 2FGZA 3CIVA 3SRFA 3RRAA 4O0KA 2CC0A 2F84A 4IX2A 2Z29A 4C5YA 4KPLA 3ZR6A 1FWIC 5FEWA 4TX9A 5CJMA 1D3CA 4LNYA 3LM7A 2QPXA 2BWGA 3DC8A 3APYA 3A4AA 3GYCA 4AF0A 3WBAA 3VTRA 7TIMA 3VD7A 5KZ6A 1FWTA 3T7VA 1UC5A 2QUVA 4UMAA 4W85A 3AZRA 5A94A 4I9JA 2P10A 2X0HA 4HK6A 2GSHA 1SO4A 2PD9A 3PJUA 4OKDA 3W7CA 2E9LA 3AU2A 1TMLA 3C0QA 5ABHA 3V16A 3VIFA 1X1ZA 4JX5A 4GYJA 2Q09A 3WQGA 3CC1A 1UCWA 4IQEA 3NPUA 2Z1WA 3EDJA 3G3DA 1FXPA 5JUVA 3OA3A 2DT1A 1E15A 2J88A 4NZCA 3GDRA 3WNOA 4HNUA 4JGDA 3IJLA 2FVMA 5EBAA 4B5XA 1Z32X 4W7WA 3EMCA 3RX2A 4DWDA 2GJRA 4IIFA 3QHOA 2RJGA 1E4LA 2FQIA 4TTUA 1ADOA 2J9ZA 2WNWA 3CV7A 3RJYA 3BDKA 3UG4A 3G1FA 3ZS4A 4DXVA 1CWYA 5FIPA 3WUGA 4RXGA 3WD1A 3MUIA 4WEVX 4B5TA 3DDMA 4UQBA 4QLLA 2DZXA 3ZFHA 1W8SA 2O9TA 3AIBA 2HXUA 4RE3A 1QMLA 4DF1A 1GVEA 5HQLA 1A5MC 4C60A 1YKWA 3LD5A 3T09A 1G01A 3W1XA 1XIHA 1JQVA 2ONEA 3WDIA 1XKJA 2HVMA 3A64A 4B3LA 3CEUA 2YBUA 3TP4A 4EKJA 3SCOA 1S3TC 2OU4A 1JRBA 3CLWA 4X61A 3NVDA 4IL0A 3AC0A 3WMSA 1AW5A 2E8ZA 4XG1A 3H4XA 4PMNA 5LGXA 1OQFA 1C8YA 1EJRC 3EX2A 4I3GA 2D69A 1E55A 3WNPA 1EJWC 2WV8A 3KBJA 3P67A 4L6OA 3I7QA 3PN8A 3UWUA 3CAWA 4O4VA 2DVXA 4GO9A 3EZ4A 3RR1A 4RPQA 5BXSA 3M16A 4CD4A 4KQNA 3EOSA 3AJXA 2D2OA 4UNLA 5HJYA 3SUWA 1UWAA 3UXLA 5FJTA 2RUSA 3KRUA 1TV4A 4I6KA 3MZ2A 5SWUA 3UP8A 4XO6A 2OSWA 3N2CA 4JAWA 2PZ0A 1KKRA 2TODA 3QMSA 4Q8WA 4A8IA 4RNFA 4Z08A 1MDRA 1UBSA 3I7SA 1FWNA 2EG6A 2XFWA 4IG2A 3T81A 2CZDA 2Y7DA 1GYMA 3BICA 4BWLA 4OVXA 5HATA 1F4AA 2QGHA 2EKGA 2ZX9A 5CPTA 3DXIA 1Z8AA 3CAKA 3ENLA 3A3HA 4P7LA 3O1NA 1Q4WA 3G1VA 4HNOA 3RN6A 1L8PA 5IHRA 4U5KA 2FTPA 1DTNA 2QDHA 3LK6A 2PTXA 4ROQA 3G0UA 4ERIA 4Z2JA 4J3ZA 3OQEA 5LXXA 1R3WA 4DELA 1LORA 1XDMA 4CEXC 3IGUA 3LRMA 2WB5A 1O4UA 2E77A 3WUBA 2QJHA 4H41A 4S3EA 3NL2A 1PTGA 4RDWA 4WXYA 3TW6A 2JK2A 2GFTA 3WNKA 1V6YA 1Z48A 4DZIA 1WBHA 3EEGA 1S5NA 5J5DA 1V0MA 4DBDA 1XCFA 4JIEA 2ZUUA 3K1GA 4LANA 3WH6A 5G5IA 2H9AB 4BY3A 1G7UA 1SR0A 2J9YA 2EEXA 1U5VA 2BS9A 2SFPA 1LRNA 2DUXA 2WQDA 2H8ZA 3GNNA 4FHAA 5LHEA 1WAUA 1XDLA 3BLOA 3W00A 4YCOA 1W9XA 2GGHA 3GZ3A 4I7UA 4M1BA 1GTEA 3MMWA 2HBVA 3H23A 3B97A 1ME9A 4I90A 2PCEA 5KITA 1DJQA 1IZCA 4OECA 3WH8A 3PJWA 4Z2IA 5K9XA 3T8LA 1R30A 1HL2A 1IWPA 1NEYA 1VIZA 1IIGA 3EWZA 3WNNA 1IF2A 3BARA 5I23A 1IR2A 2C1IA 4K7VA 1FKXA 2C0AA 4JTGA 3RXZA 1HKIA 1TQXA 4IIGA 2OSYA 1UZHA 1SZRA 1ONEA 4LAMA 1VFOA 2EBNA 1M04A 4L4PA 1QAPA 4IT1A 1IEQA 3QH2A 4GC4A 1JDFA 3DI0A 1P0EA 1FRBA 4LY4A 1L0PA 3VFLA 3R79A 3LTYA 3TYZA 5E09A 3TC6A 3QXBA 4WKHA 2R6OA 2IMRA 7PTDA 3SQLA 4HB7A 4X60A 4LCSA 5HAOA 1QPNA 3ITTA 1KQYA 4YVXA 5F4SA 3OZYA 3S9IA 4MM1A 1UOKA 2X30A 4MKNA 5A8GA 2R94A 3QQ0A 3C8FA 3NEVA 3VKAA 1EL3A 1WZAA 3AZSA 3IRSA 4HMDA 1NOFA 1XBVA 2NXHA 1CLXA 2IQTA 1K77A 1E0VA 3DHFA 2V63A 2JKEA 3ARUA 3GH5A 3BMXA 3U7BA 4XD4A 3R4IA 1GZJA 2JBMA 3N6QA 4JKLA 3FJ4A 1W9BM 4JTEA 3W87A 3WJWA 1HN1A 3SB0A 1DPMA 4TVDA 4LS1A 3MANA 3PF3A 2JEPA 1ZFJA 3E38A 3R6IA 1MXDA 1OIFA 5JXQA 3KCOA 2Y6ZA 3TA6A 1XSIA 4MADA 4D6IA 1DE5A 5FJPA 4XAGA 2QEZA 4LYPA 2Y61A 3R25A 5AY7A 3LU2A 3GR7A 5CBBA 1H62A 5E93A 3V0SA 4HPNA 5I00A 1JAKA 4UR9A 1QTWA 4J4KA 4ADUA 1CZ1A 2F38A 4IUOA 1UKSA 4URIA 1BHGA 4AEOA 2OPJA 4LPCA 4DLMA 4B5VA 3LNPA 3NZRA 5E9AA 2GVYA 3KL5A 1HO1A 3PHAA 4KRUA 1FH7A 3GXMA 4WRHA 3GTFA 1DQWA 3MKVA 2BVTA 4CD5A 1VB9A 3G1XA 1J0JA 5ABFA 4MFEA 4DYEA 2J6VA 1MMFA 2OT0A 4U5IA 3K2GA 4O54A 4IPJA 5D2VA 5LA2A 3WFZA 1OX4A 3M0XA 1KR1A 4XTIA 4B2DA 3H21A 4ML4A 1XPYA 3BURA 3P74A 4MWAE 3ZJ7A 3LG3A 3ES8A 1P0NA 1BTMA 2VTFA 2BHYA 1MYRA 3QYSA 4IGHA 3W72A 5A5WA 2FB2A 5A6KA 4GY1A 5I7GA 3B8TA 3VOGA 4B9ZA 1A4MA 1M41A 1XF0A 4QE5A 1XG4A 4E8DA 5H2ZA 3ZT6A 4GUFA 3QRHA 3GFXA 2OG9A 5HNTA 4EOUA 2V3FA 4DQWA 1ZBCA 4XAZA 3E02A 3M6DA 3AS2A 4TTGA 1AH0A 3VYLA 5JBEA 2YOCA 3A12A 4Q6JA 1W0MA 3ABQA 2V68A 2EJAA 1J2BA 3HF3A 1RCOB 3M46A 1C90A 3E49A 3MI6A 1CGUA 5HNNA 4G1NA 3AHVA 2BV9A 2XG9A 1SFJA 3M9YA 3EMQA 2QAFA 3U7VA 1OGSA 4FLRA 3BLDA 2DSKA 1EDTA 2HE5A 2XH7A 5FJIA 1EYEA 3BGGA 2PURA 5BWFA 1MW1A 1K7XA 3GXNA 4NAEB 3ZWSA 1US2A 1HKWA 1O5RA 1XLCA 3ZR5A 4B4HA 1DWJM 3TN3A 1FHDA 3KDOA 1QXLA 3FHQA 3W1TA 2PD5A 3VE7A 3PZNA 1YTEA 1ZPTA 1UIOA 1I2PA 1YBQB 3E2QA 4IWWA 1G7VA 2CLLA 3T0CA 3GNOA 1GQIA 4GQRA 4L61A 4HMCA 2YX0A 3O6AA 2FVKA 1W1PA 1GVOA 2YL5A 4JCMA 3NIYA 1JD7A 2A3EA 3VO0A 2FMNA 4LNCA 3BJFA 3CHVA 3N1AA 1BG9A 4HSHA 3FHAA 2MNRA 2DZVA 4PMDA 3IIPA 4GKLA 4N0RA 1XRFA 2YZRA 1NQ6A 3E12A 1O5XA 1HJVA 2B81A 1JNEA 4O16A 3HZ3A 3TXVA 4AHOA 2F8QA 4UR8A 4LBUA 1OFPA 1DJYA 4BEUA 2DU2A 1XLLA 1MXGA 3LXCA 3B8WA 3NDYA 3L9CA 1WO2A 5C5YA 4HCHA 3S1UA 3E0IA 1JI1A 4S3DA 2A4AA 2WSRA 3S83A 1KRCC 1ADDA 3RHGA 4A22A 4YTSA 4OGZA 4NU7A 3ZVHA 2HROA 4GXMA 3EB4A 4FX8A 1DWIM 3W27A 2CLHA 1GKPA 4Q8TA 4FI4A 4POCA 4Y9AA 4O0ZA 4HSOA 1EGMA 1CT5A 1JZ2A 1O1HA 2PWFA 1K03A 1ZCOA 3PY2A 3UZWA 4NZ4A 5BMWA 1OEPA 2ZIDA 3IJ7A 3G1HA 3UPWA 3DH7A 2VFIA 1QNPA 5I79A 2G3MA 4CU7A 1GG0A 1B30A 2X1SA 1L8NA 1RHCA 3LM3A 1TSIA 3CH9A 1P5BA 3ZT7A 1LBFA 1BEUA 2A21A 3ITVA 3W7RA 3WO8A 2WMHA 1Z6KA 1B9BA 2W62A 3LHYA 4M81A 3GNXA 1UQYA 1UUOA 4W7UA 3R43A