4HZ6A

Crystal structure of bglb
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
441
structure length
441
Chain Sequence
KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucosidase
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 176
structure length 441
sequence length 441
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz6A00
1GQKA 3ARZA 2J4GA 1GHRA 1UHVA 2BXYA 3SCRA 3A47A 1OIFA 2CKRA 3EYPA 2VZSA 1H5VA 3WL1A 1L0PA 3NYDA 5JBEA 1DWGM 2YL8A 4D1JA 3FXYA 1DWHM 2PBOA 4W7VA 1VAHA 2BY0A 1ZS2A 3MSDA 2CYGA 2X8RA 4RE4A 4XB3A 2ZIDA 5FOOA 1WDQA 4CD4A 1UKQA 2D23A 2ZX9A 1NWRA 2WHLA 4HMCA 3UERA 2DEPA 3CUGA 3VUPA 1V6XA 4QCEA 5I79A 1KXQA 3ARQA 3WELA 4PMZA 3VMPA 2PWFA 2J7EA 5I24A 5E9AA 1HIZA 1J0KA 1E6QM 1CDGA 1CLVA 2V3FA 2VRKA 5F7UA 3ZJ6A 2J77A 5DFAA 1H2JA 1E4MM 2E3ZA 2WMGA 1QNQA 2V3GA 5CGTA 3W53A 4TX6A 2FGLA 2VR4A 4PUDA 5AY7A 3ECQA 4D6CA 2YDQA 1EHNA 1ZBVA 4WSJA 5JBFA 3W0KA 1JF6A 3LPGA 4W93A 2EPKX 1J11A 3ARPA 3O2LA 4MAVA 1LLOA 1M01A 4CN1A 1GQJA 4CU7A 5FL1A 4W84A 2ZX7A 4GO9A 3VIGA 2EO7A 1WCGA 4WLCA 2WLZA 4AZ6A 3KL5A 2VCBA 5D9PA 1E0XA 4GO8A 1ISYA 5A6BA 3AYRA 2GVYA 3WQ5A 1YHTA 1MFVA 1PJ9A 4RL3A 2FHBA 4D6FA 2O9PA 5D9OA 1TUXA 2J7HA 3CUHA 4OJYA 3MUIA 1GVIA 1HJUA 3IJ8A 1NH6A 2ZX6A 4RE3A 2J74A 2BFGA 5CSYA 1LWJA 3VIKA 4QLJA 2Z1KA 4KMQA 4M8UA 1Q6CA 1H0IA 4UQCA 5I3DA 4A3YA 1VBUA 3PTKA 5I78A 1H11A 3VILA 1EHAA 2WMKA 1X6LA 2WBGA 5GQBA 4MB3A 3BC9A 1MW3A 4CVUA 1HKIA 5HXMA 2EBNA 3RCNA 1XCXA 4GINA 1KXVA 3TTSA 1B2YA 1E5NA 4HOXA 1NARA 1TR1A 3GXFA 5KZ6A 2XGIA 3WNNA 2PWEA 1EDQA 1QBAA 4J3XA 1FP9A 1WKYA 1CGTA 2C7FA 3AI0A 1GOMA 5KEZA 2F61A 3WY1A 1TZ7A 4J3UA 2O9RA 3VGGA 4P8UA 2DIJA 3ZT5A 2JF7A 3WEZA 1KGWA 2WHMA 4A4AA 3U57A 3SUUA 1CBGA 3BGAA 5CZKA 2D0FA 3VNYA 4M1RA 4PMQA 2PI6A 2YDSA 2J47A 2XFYA 4D6DA 2F2HA 3L4ZA 5IHRA 3AQUA 4JAWA 4NSBA 1B3WA 1US3A 1JDDA 3GTNA 3WD1A 1V02E 4WK9A 4B16A 2WNWA 3CTTA 2NW0A 1AVAA 1UA7A 1NM9A 4M82A 1V3HA 4F8XA 3AIRA 1C8XA 2OWWA 5FIPA 3W29A 1QNPA 3JUGA 1J12A 3L4YA 3MV11 2X0HA 1KR0A 8CGTA 4KWUA 4E4PA 5I2UA 1NOWA 1E0WA 3GBDA 3A4WA 5CLWA 2OYMA 4PMNA 1I75A 1XC6A 2BXZA 1OBAA 4JFSA 3N9KA 4U3AA 2D22A 1WZLA 2RGLA 2ZUWA 4AMCA 1E0VA 1EH9A 2J7CA 1V6YA 3HMCA 1K9TA 5HBFA 3ZJKA 4V27A 4PUEA 4D71A 4PN2A 3VD7A 2WWDA 1W9UA 3W6MA 4J28A 4P7QA 3BH4A 3AS2A 4PTWA 5E6YA 1JDCA 2J8GA 4JKLA 1OT2A 4CU6A 4GKLA 2EPOA 2GJRA 4KRTA 3PTMA 5ECUA 2FH8A 4GZIA 3N17A 2XIIA 4BQ2A 1E6SM 1ZJBA 2DSKA 1ODZA 1W3HA 3GBEA 1C7SA 1JG9A 4KGLA 2UY3A 4U2YA 5EFFA 2CCRA 2NSXA 3ALFA 1BF2A 2RGMA 1CXIA 1OWQA 2E9LA 4MB4A 4PMYA 3AFBA 1X6NA 1VJZA 3L2LA 3WF1A 5C71A 2QLYA 3T2OA 3WDQA 4D72A 2Y8VA 3HU7A 3KE0A 1JAKA 3ZSTA 1G9HA 2DH3A 4AEEA 4BA0A 2G3NA 3PN8A 2ZWYA 1AQHA 3W25A 1NWUA 1BG9A 4GI6A 1V3IA 1UKTA 3WUEA 2WSKA 3PZVA 1LL6A 3AXHA 4Y7EA 2DQXA 4AD5A 1CNVA 2D3LA 3CHEA 1JYXA 1DWJM 1RP9A 3IAQA 3OLGA 1LL7A 2WKGA 3IANA 3E1F1 2X2YA 3BSGA 3J7HA 4YHEA 4MJ4A 2CESA 1KGXA 4AZGA 1MVYA 1EIBA 2XVNA 2YOCA 1W9BM 4OBRA 1UZ1A 1W32A 2VX6A 4GI9A 1E6ZA 5ABEA 1IV8A 2FDMA 4GPNA 3GZAA 2XIBA 2ZUUA 3PZUA 3EMQA 1JZ6A 3OZOA 2BVDA 3DECA 2YJQA 1D2KA 4EAMA 5E0CA 4UNIA 3K1DA 1UKSA 1JZ3A 3A4XA 3AS1A 6CGTA 3NSXA 2WYSA 1E9LA 1YQ2A 2F8QA 2G8ZA 2QPSA 4CD8A 3B8SA 5A8MA 1Q6DA 3QHMA 3WKZA 3M6DA 3CLWA 4PEEA 1MW0A 3ARWA 2CIPA 1KXTA 3TONA 1M04A 2YLAA 3T2QA 4HOZA 5A6JA 1IZKA 3VX1A 4CGTA 4BZYA 4W5UA 4LPCA 4MDPA 1NWTA 1MQQA 5IFPA 4UQAA 1H0GA 1F4HA 4GIAA 4U3CA 5BXRA 1CLXA 1EOKA 4XUYA 4WSKA 1E72M 4P7RA 1UR9A 2BHYA 2JEPA 4OZOA 1JYVA 1NP2A 4DWSD 1EOMA 2VRJA 1E6PA 2WVTA 4PCSA 3CZEA 4CVWA 1V3LA 1GOOA 1JIBA 4KGJA 4W8LA 2XVGA 4FMVA 1XH2A 4OBSA 2VZVA 3MUZ1 2X09A 4D6IA 2EPLX 1K6AA 1BYDA 5DT5A 2WVVB 1C7TA 3S2CA 4TOQA 1H1NA 1UYQA 5LA2A 2HISA 2XHYA 3MSGA 2CNCA 3WD3A 2GJPA 1UWTA 4V2XA 1GVYA 1I1XA 3L2MA 4UR9A 3WH7A 5IHSA 3SUWA 3F5JA 3CHCA 6A3HA 4PMRA 2J8FA 3RJYA 4H8VA 1QI0A 3WFLA 2YDRA 4AXNA 5AYBA 4TVDA 2GJXB 5BXSA 1JZ5A 2WVVA 3RDKA 2QMJA 4IPLA 3WD4A 3CZKA 1JI2A 2PWGA 2YL6A 1R7OA 5CXPA 1W9VA 3CBWA 3ARSA 1WDPA 2V3DA 4M29A 5EBAA 1VFFA 2VC9A 4CCCA 2E8YA 1DHKA 4C7DA 2GJXA 4JFTA 2XTKA 3ZO9A 1Z32X 1MYRA 4ACZB 3FAWA 2G3IA 3ZSSA 4Q7NA 4J27A 2DT2A 4HU8A 3GM8A 3TTQA 4XX6A 1SMAA 1WPCA 3WMCA 1FH8A 4TXEA 1HJSA 3CPUA 1OD0A 3BAIA 1U30A 4UOZA 3A6OA 5HPOA 4X9YA 1KQZA 2XVPA 5E70A 3FAXA 3IJ7A 3VGEA 2YLLA 4MPKA 3W38A 3VIIA 3VKKA 3NDZA 1CGVA 2VCAA 4S3JA 5CG0A 1SYTA 2W62A 2YL5A 4ACZA 3PZOA 2YBUA 2OSXA 2ZXAA 3G6LA 1HJWA 3WF0A 1LWHA 1RH9A 1G01A 3FY1A 3RPMA 3BCFA 4AZCB 1EA9C 1GHSA 4KRUA 2VL4A 2XPKA 3AMCA 3T2PA 1BAGA 2EXOA 3CO4A 1E71M 4Z2JA 4URIA 2EQDA 3ARVA 4M56A 3F5LA 3AJ7A 1VFOA 1TVPA 4GQQA 1ZB5A 3EDDA 1QNRA 1XGZA 1L8NA 4ZENA 3AXXA 2DSUA 5GNXA 3GXIA 1WZKA 3VOCA 3SUVA 2A3AA 4AZCA 1IZJA 1DP0A 4F66A 4PYSA 2WVSA 2V38A 2C8NA 3VMOA 1UUQA 1JF5A 2BVTA 3CZ8A 3OB8A 3S6TA 1GORA 4TVCA 1E73M 1DWAM 1B90A 1KB3A 1NP0A 2BS9A 4UQEA 4WKFA 3A4AA 2WPGA 3AMKA 4HTYA 2V5CA 1D7FA 2WMJA 2V5DA 2XYLA 3K8MA 3B9AA 5A95A 3DYMA 3MMWA 1AMYA 3WD0A 1V6WA 3VTRA 4DUVA 3FW6A 3NDYA 3SCQA 1UQZA 5A2CA 1TCMA 3SEPA 3N11A 1ISZA 1VBRA 4FLOA 2D20A 2D2OA 5EB8A 1Q6EA 2WVUA 3WL0A 1QOXA 2IXVA 2WC4A 1OGSA 3GXDA 4NRRA 1GUVA 5A1AA 4GI8A 3O9NA 1ZJAA 2GK1B 2W92A 3PZNA 2CBVA 4GZJA 3ALGA 3GNRA 3W82A 4B15A 5DMYA 1Q6GA 3VM7A 5BWFA 3EMCA 3FHQA 2ZICA 1GW1A 1V6VA 3N13A 2ZE0A 1EDTA 4AISA 1B3VA 1MW1A 3WF4A 2W5FA 2GK1A 1MWOA 5HDRA 1M53A 4MNJA 1PBGA 4C7GA 3QOKA 1B3ZA 3AIEA 5TD4A 2JFEX 3CMJA 2D0GA 4IUGA 1W91A 4E2OA 5BYWA 1PX4A 1UR2A 1UD4A 1W1YA 2XWEA 3ZJ7A 1UWIA 2J62A 3WH6A 1J01A 2CBIA 4H8UA 3AISA 1GOQA 1HJVA 3VIPA 3WNMA 2FGZA 3SCPA 1E4IA 3M46A 2J7BA 4UOJA 1WAWA 4MADA 1CTNA 3RIKA 3VIJA 4AC1X 3CGTA 3SCVA 1RPKA 1E40A 1GZJA 1HKKA 1M03A 4EK7A 1HJQA 1VJSA 1KCLA 2XFFA 1V6UA 4FK9A 5A2AA 5LA0A 4FF5A 2VVSA 2ZWZA 2W61A 5GNYA 3SCWA 2XGBA 4CUCA 4AYSA 3GDBA 1GOKA 1JXJA 4HA3A 2PF0A 1BSIA 3G6MA 1LG2A 2XSBA 1UWSA 1ZBKA 3ZR5A 3U5YA 2XG9A 4GQRA 2X0YA 3K46A 4TUFA 9CGTA 1JXKA 4OOZA 2Y4SA 1HKMA 1D3CA 1B9ZA 1QW9A 2UY2A 3VIOA 3LPFA 2WBKA 4AY1A 1AQ0A 1SMDA 1JZ4A 4XV0A 3GNPA 4OOUA 4MB1A 3I3DA 2DGAA 2DIEA 3CZGA 1GQLA 3I3BA 1U2YA 2BHZA 3W4RA 1W2PA 4HA4A 4AIUA 3VD3A 1UD2A 3K8KA 4DM2A 3PZQA 2J75A 2ZXDA 2JF6A 3D3AA 2CKSA 4W8AA 5A8QA 3NSNA 3THDA 2CHOA 1UD3A 1JZ7A 3BAXA 3W81A 3FNDA 1XH0A 1P6WA 4JFWA 3ZQ9A 3RJXA 1TE1A 3CH9A 4JIEA 4WKAA 2WXDM 4PBGA 3VIFA 4HU0A 1UH3A 1UR0A 4FLSA 2JALA 2W66A 4F9DA 1J0ZA 2AMGA 2QHAA 3CUIA 1J0YA 4CKQA 1V0MA 2VZOA 3CHFA 3WF3A 2DPEA 1HJXA 5A94A 1BYAA 1UD5A 3SCSA 1R85A 1TVNA 4D6EA 1HP5A 5A6MA 3OA5A 3IK2A 4AWEA 3WQVA 3WDPP 3L4WA 2WCAA 2EPMX 2WMFA 1BVNP 4CD7A 1MQPA 1W2VA 2XVKA 4UFJA 4P7NA 3TTYA 2CBUA 3AIUA 2G41A 4MJ2A 1E6XM 3CUFA 4IISA 2XVLA 5D8ZA 4MNLA 3T0BA 3PBGA 3WDJA 1HT6A 4E8CA 2ZXQA 2OLHA 2V3EA 2CETA 3VDHA 3CIVA 3WD2A 1UA3A 4ATWA 8A3HA 4LX4A 1SFSA 3MU7A 4ML4A 2JEQA 5FL0A 1UH4A 4PSRA 3WH5A 1JZ8A 1HP4A 1W3JA 1BVZA 3WDIA 2VT0A 1V3KA 1E4NA 3VGFA 1HL8A 3T08A 5DO8A 4AZBA 2D24A 1TMQA 1N82A 2VI0A 3I3EA 4UFHA 1VRXA 4AD3A 4H04A 1H3GA 3KWXA 3TTOA 4H7VA 1QI3A 2XUCA 1ISXA 2O9TA 2OYKA 2HVMA 5JBDA 2BHUA 2VX5A 2O92A 4FLQA 4PSPA 4JKMA 1XSKA 3AZRA 2A3BA 1QNSA 2E9MA 1BFNA 3N12A 2XM2A 3M07A 4MAZA 4TVUA 3GH7A 4J3TA 3VM5A 3ZT7A 1C90A 1UZ4A 4RE2A 3AHYA 3T0AA 2ZUMA 3N18A 1GPFA 2MANA 3WNPA 5A8NA 5FKYA 3BLKA 1VFMA 4WKHA 2WCGA 4D6HA 2GFTA 4OUEA 5I0DA 4R5EA 4J3WA 4X0NA 1QVBA 2YA1A 1K9FA 3AOFA 3VD5A 3WQ6A 1WNOA 4M24A 2WZIA 1R7AA 1CXHA 3ARYA 1C3FA 1GJUA 3WEMA 2DT0A 1WZMA 4B9YA 1SR0A 4TTGA 2Z1SA 1VB9A 4QFUA 1WZAA 3AS0A 1QBBA 4K68A 2FH6A 4UZUA 5D4YA 3II1A 2WHJA 3DHUA 5A6BD 1VEMA 1E4LA 2D3NA 1FP8A 3AZSA 2VRQA 4D6GA 3L4XA 3QHOA 5HNNA 1E43A 1G0CA 3SUTA 3EMZA 3AIBA 5BRPA 3OBAA 2VVNA 4W85A 3OZPA 2A3CA 1QPKA 1UQYA 1OB0A 4NI3A 4U5IA 1B31A 1E5JA 1XSJA 5C8BB 1EXPA 4HOWA 3OGRA 2WZHA 1OSEA 1ZBCA 1BQCA 5E6ZA 1MW2A 2BVYA 5LYRA 4JHOA 3L4UA 1KQYA 3ZT6A 5A2BA 1JFHA 1W1VA 3QOMA 1CIUA 3NSMA 1VF8A 3L4VA 4Z2IA 2OYLA 1HXJA 4KH2A 4AIEA 2XSAA 4H2CA 3VGBA 3RM9A 3RO8A 1UKPA 3MMDA 1BTCA 2EPNA 4TX8A 4DWSC 3LPOA 1V0LA 3VDBA 3WUGA 3WN6A 1HX0A 1R8LA 1X1NA 4W8BA 3BAJA 4JL2A 5BROA 3WUFA 1W9DM 1CGXA 3MUY1 1QHZA 2D1ZA 1HKJA 4JZ5A 5CPQA 4Z2GA 4N0RA 3AIQA 1E6RA 1PX3A 2OSYA 5CLTA 2C0HA 1R87A 2E8ZA 4ZXLA 1HL9A 2VURA 4MNMA 1I1WA 4JCMA 4ZEPA 5M03A 5D8WA 1GOWA 4QDMA 3WNLA 1UR4A 3WNKA 3ARRA 1J10A 2W63A 3MKKA 5HPCA 4R27A 3VGHA 1K9DA 1V02A 3AZTA 1WB0A 4WF7A 2DSVA 1GOIA 4PMUA 3SCOA 4P7OA 3POCA 4B9ZA 1UOKA 1CEOA 2YA0A 2VUYA 2E40A 3ZR6A 3AIVA 4UCFA 3AS3A 1FH7A 1UKOA 4LGXA 4QLLA 3APGA 1V08A 3AXIA 1NOFA 2IUZA 2CPUA 1M7XA 3K4AA 1E1EA 1VENA 1OINA 3PZTA 5I6SA 2J25A 1H41A 4BS0A 4AZIA 1CXLA 1CYGA 1LQ0A 3AHVA 3CHDA 1BGGA 1KBBA 1MFUA 4HZ7A 4QP0A 5DF0A 4BF7A 1LF1A 3WEOA 4HMDA 5EMYA 2CEQA 1S46A 1CGWA 1OM0A 3AMGA 2W91A 3TP4A 5A8OA 2WMHA 2YIHA 1FHLA 4BCEA 5AYIA 1VFUA 1FOBA 4EANA 2VX4A 4ATLA 3PZ9A 2WW5A 4CD6A 4AZ7A 1CECA 3EDJA 1V03A 1JNDA 2DT3A 2PWHA 3THCA 3WBEA 2A3HA 2JIWA 4CN6A 4XZWA 1ITCA 4GXPA 4ZE4A 2E0PA 1WDRA 1G94A 3K8LA 5DT7A 1UD8A 1LJYA 3UEQA 1OIMA 2J7GA 3DYPA 1NOUA 2BY2A 3WQWA 3BLPX 5A6SA 1C8QA 1FH9A 5CSUA 3OLDA 4PMVA 4LXFA 4YN5A 3SCTA 1BYCA 4HA1A 1UD6A 4DUWA 4MB5A 2UY5A 3NJ3A 4X0VA 3WIJA 4AD1A 5GNZA 3MMUA 3OG2A 4F9JA 4QAWA 3M7SA 3VD9A 3SIMA 5ABFB 3POHA 3BMVA 3OLEA 1E3ZA 4OKDA 1PX8A 1UH2A 3W37A 2YKKA 2E4TA 4N42A 3W26A 2PB1A 2XWDA 3VD4A 1XRVA 4U31A 1CZ1A 3O6AA 1FA2A 4W5ZA 5ABFA 1EGZA 1JL8A 1VEOA 3WQ4A 1KWKA 1PPIA 3DC0A 4IM4A 5GPRA 1ZL1A 3VX0A 3CZJA 1W3KA 3EDEA 3N04A 2Y5EA 2XFRA 5JIPA 1K9EA 1WE5A 3WUBA 3T09A 3BCDA 5IXEA 1RD6A 2QF8A 2J79A 1KFWA 3MO4A 2VTFA 5CJ5A 4CCEA 2VOTA 1XH1A 4P8WA 3DHPA 3PTQA 2ZUTA 1C92A 3OGVA 7TAAA 1JNEA 4YHGA 1CENA 2OSWA 2WCSA 2Y24A 1PEZA 1DTUA 2WHKA 2Q8XA 5CPSA 3MUAA 1XYFA 2CERA 3UR7A 1HF6A 4HP5A 1JD7A 4HZ8A 1PAMA 3HN3A 1V0KA 4E8DA 1JDAA 2XJ7A 3W24A 3MV01 4PMDA 2BV9A 3CUJA 2Y2WA 4UQBA 1TA3B 1LL4A 2G3JA 5A6KA 4PMOA 3MS8A 2WM0A 3GXMA 1UG6A 4AZHA 5HOSA 4F79A 3N1AA 5ABHA 3BXWA 4L4OA 1BYBA 4PMXA 3VGDA 3TA9A 3U5UA 4IPNB 3VDAA 2GDUA 2FHFA 3WMSA 2NT0A 3WFZA 3WH8A 1GCYA 1VEPA 3IAPA 1TA3A 3IJ9A 3L4TA 2ZXBA 4CD5A 2QPUA 4AD0A 1CXFA 3OGSA 1O6IA 1UWRA 3UCQA 4JFVA 1UR1A 4W7WA 1CWYA 4MNKA 4DWSB 1ODUA 1QI4A 3W28A 4LYPA 2VNCA 4ZE5A 3A3HA 1PZ2A 4AD2A 4C7FA 5BCAA 2JE8A 4UZSA 1ITXA 4P7LA 5AC5A 2AOSA 2J78A 3VNZA 2VZTA 2X05A 4PTXA 1MXGA 4M81A 1J0HA 2EEXA 1W1TA 1UWQA 3ZM8A 3VMNA 4PTVA 3LPPA 1KR1A 3GYCA 4DWSA 2DH2A 2WAGA 1FFRA 1E1FA 5JUVA 1NWSA 2WC7A 3QGVA 5AC4A 1J0JA 3AMLA 5DEZA 4CCDA 4ATDA 1AQMA 1US2A 2CXGA 2ZUVA 1WO2A 2UY4A 3AHZA 2G3MA 3BAYA 5BXPA 1V0NA 4JL1A 2VX7A 1Q6FA 4UFMA 4J3SA 4ZFMA 2FHCA 3ZIZA 3CZLA 2DT1A 3FHAA 2W67A 2GUYA 3OLIA 2VR5A 5CPTA 4HPHA 1V3MA 2NT1A 2VMFA 4TTUA 5D9MA 5JIWA 3AHXA 5EFDA 3W6LA 1ECEA 3VIHA 2YL9A 1E6NA 1C8YA 3AMDA 1W1PA 1BLIA 2ZX5A 3B9DA 5M17A 5M3WA 2WSPA 4UQDA 1VIWA 4U5KA 5I23A 4P8VA 5I77A 1MQRA 4JFUA 1JD9A 4AIOA 2WZEA 3WH9A 4DM1A 3NUKA 1TFVA 4BQ3A 2QV4A 1W9PA 5CGMA 1B3XA 1KGUA 1QW8A 1ESWA 4EKJA 2WB5A 4P8XA 4W87A 1LG1A 1FFQA 1DWFM 3QR3A 4AD4A 1UWUA 4UTFA 4V28A 3KEHA 1PIGA 1JYWA 2X1IA 1XD0A 4LYRA 4XZBA 2PC8A 1HVXA 1B0IA 4UFKA 1A47A 1J9YA 7CGTA 1KCKA 3VDCA 1KXHA 5FD0A 4J7RA 4D6JA 3AROA 1MXDA 2DSZA 2TAAA 4S3KA 2ESCA 4UFIA 4DUXA 4JKKA 4M80A 1TG7A 4UOQA 3NIYA 2GSJA 1EO5A 3B9EA 2ZUSA 4WJXA 2GDVA 5BRQA 7A3HA 1E70M 1H49A 1J18A 3VPLA 2AAAA 5I5RA 1HN1A 2WLYA 4LQ1A 1Y7VA 2VZUA 2CITA 4JHZA 4NZCA 5BXTA 5D9NA 3MANA 3UG3A 4ACYA 4BQ5A 2J7DA 3GH5A 1JYNA 1G1YA 1DWIM 3AHTA 1G5AA 3GH4A 2BY3A 1HNYA 1XCWA 3KZSA 4Q22A 1PZ3A 4J3VA 3VINA 4Z2KA 1OGBA 4YPJA 5CQ1A 1C93A 2WKLA 3UG4A 1BGAA 2YBTA 4HMEA 3ZJ8A 4U33A 1KBKA 3ARTA 2OWCA 1JZ2A 1CXKA 2E9BA 3VIMA 3RM4A 3AICA 2OWXA 3ARXA 1Q4NX 1J0IA 1IT0A 1O7AA 3RMEA 1A3HA 3PZGA 4PTMA 3WDRA 5IFTA 3PZIA 2DDXA 1CGYA 5A6LA 2ZOXA 3PHAA 1CXEA 2BY1A 4QLKA 3FN9A 6TAAA 5FCZA 4UFLA 1GNXA 1GQIA 3WSUA 3T0DA 3F5KA 2CHNA 3RILA 2WANA 1OCQA 5A69A 4LYQA 2PWDA 1XD1A 3GNOA 4NRSA 1EQCA 2G4FA 3WDHA 3WQ8A 1XSIA 4NF7A 1W9XA 1DEDA 4H8HA 3WENA 4BQ4A 3ARUA 1ISVA 1ZBWA 3EBVA 5A3HA 5M5DA 2DSWA 2ZUNA 3BAWA 3UETA 1XYZA 3VVGA 1GJWA 3K4DA 1OD8A 2VQUA 4UQ9A 1WDSA 5E09A 2VCCA 1ZU8A 1U33A 3CMGA 1QHOA 4ZXOA 1BG4A 2EJ1A 3U7BA 5LA1A 3WMBA 4FLRA 1EQPA 3RM8A 1BPLB 3KL0A 2WMIB 2D0HA 2VJXA 5IDIA 2O9OA 2JIEA 2WC3A 3HJEA 4CN4A 1EDGA 1ISWA 1WP6A 4PCTA 3PZMA 2ZX8A 3EDFA 5C70A 3D5HA 1R86A 3UG5A 3AYSA 1JI1A 1QI2A 2IXUA 2BNJA 4L4PA 4W89A 3ZOAA 1OT1A 1RP8A 2WMIA 3SUSA 1C91A 5A8PA 1HVQA 1E15A 1H4PA 1JAEA 4HZ6A 1BHGA 1B1YA 1GONA 3OIHA 3EDKA 3TOPA 3VO0A 3UESA 4CU8A 3F4VA 1JGIA 2CBJA 1E56A 1FHDA 2WK2A 1V3JA 4AW7A 1CGUA 4AEFA 4AZ5A 4Z2HA 4HPGA 4PRWA 3BMWA 4MDOA 3WF2A 1QI5A 3KL3A 4JCLA 3W27A 3NCOA 2XM1A 3WBAA 4W86A 2QMKA 1UR8A 2A3EA 3ZMRA 2VO5A 3BAKA 4WIWA 5A6AA 4W88A 4H41A 4Z2LA 2UWFA 1KWGA 4OIFA 3SCNA 5E0FA 4U2ZA 3U7VA 2J7FA 1XHGA 1QNOA 2PBGA 3WNOA 3LMYA 4B3LA 2B31A 4EE9A 3N15A 1W3LA 4W7UA 3VU2A 1QHPA 3SCUA 4A3HA 1PIFA 5ABGA 4B3KA 1F4AA 4MTVA 1CPUA 2VQTA 1NQ6A 3QHNA 2WWCA 2YA2A 3AIWA 3UR8A 1XV8A 4D1IA 2W4XA 3SURA 1JFXA 1E3XA 1OGGA 1B30A 4GZEA 3DYOA 1EO7A 1B3YA 4QCFA 2Y8KA 1H09A 3BSHA 1E55A
chains in the Genus database with same CATH superfamily
4E5TA 1GQKA 3ARZA 4CEUC 2PLMA 2PGFA 4WRHA 3UNDA 4E4FA 2VWSA 3NQGA 5K9DA 1BVWA 1RJQA 3F2BA 5JBEA 5AZ0A 3TYCA 2PBOA 3IK4A 3MSDA 4FB7A 2CYGA 2X8RA 3E2SA 4KQNA 3CEPA 1ONWA 4Q33A 4A21A 3HZ3A 3ORWA 3RR1A 3DCPA 4HNTA 1B54A 2PP0A 4Q4QA 4HMCA 3UERA 2BOEX 2DEPA 1X8FA 2C1GA 4UTWC 4ZBCA 4ERIA 2HNHA 4MWAC 4QCEA 5JXQA 2Z27A 4NJIA 3WELA 1DXEA 1GWJA 3U48A 3VMPA 3WYZA 2GUUA 2POTA 2BG5A 5E9AA 1HIZA 1J0KA 4GC3A 2QJNA 2V3FA 2Y89A 3LB0A 4GUJA 1GQNA 1H2JA 5T9BG 1E4MM 4WR3A 3I10A 2IPGA 4AF0B 2GVLA 5AYZA 5KZMA 3W53A 2GZXA 2DUAA 1JCXA 3U9IA 4DO4A 5FJJA 3ECQA 4D6CA 1EHNA 3A64A 3W0KA 4JTTA 3LPGA 4W93A 5CJNA 1J11A 3TSMA 3ARPA 1ZZMA 4MAVA 1EZ2A 1LLOA 4CN1A 3FA5A 5FL1A 4NX5A 2OU4A 3S1WA 3M0VA 1QK0A 3P60A 5AHNA 5D9PA 4GO8A 4AIBA 1ISYA 1WBJA 2GVYA 1N7KA 3NM3A 2YPIA 2V2DA 1PJ9A 3FJNA 5HQEA 1I45A 5JMUA 1TUXA 3CUHA 4OJYA 4MLJA 1GZGA 1VZWA 1NH6A 2ZX6A 4MPQA 3GVWA 4BJHA 1TIWA 1TJRA 3NTYA 2J74A 2BFGA 4XZMX 3LRLA 3SFWA 3O16A 1XQLA 2VEIA 4KMQA 4PB3A 4M8UA 4A3YA 2RKXA 4JYDA 1H11A 4IGSA 4LUYA 3VILA 1EHAA 1V77A 4R7JA 1M9HA 4FXFA 5HXMA 3ID7A 1SZNA 1XCXA 4GINA 2I14A 3L0GA 3EOOA 1G4EA 2NQZA 2VDGA 1NARA 5IM51 1WOBA 3VCCA 5KZ6A 3UYIA 3QN3A 2FJUB 4PRTA 2DVXA 2F61A 2Q09A 3COTA 2VP8A 1TZ7A 2O9RA 3W7QA 2DIJA 4NIRA 1XRSA 1XLGA 3WEZA 1XIFA 2BDQA 2ISDA 3NGFA 3U57A 4ZQCA 3TZFA 4EXQA 2ZRWA 4GH3A 3BGAA 5ABTA 4YXGA 1E1CB 2TODA 3VNYA 2PI6A 1OX6A 2CZVA 2YDSA 3H2AA 5HMDA 2XFYA 5F4XA 1RK5A 1DXIA 4GXWA 3AQUA 1R2RA 4JAWA 1B3WA 2DQWA 1JDDA 1XLLA 3GTNA 1W56A 3BOLA 1HGWA 2BP1A 4JTJA 1XFBA 4B16A 5G2IA 4O53A 1MEHA 3UWZA 4IPIA 3PNUA 1S2AA 1AVAA 2ANUA 2QCCA 4PL1A 1UA7A 1XGEA 2F84A 4M82A 4F8XA 3S47A 3WLHA 3ZVHB 5FIPA 1RCQA 1QNPA 3LMZA 3JUGA 7REQA 2X0HA 3UU0A 1KR0A 1B4KA 8CGTA 2PDQA 2J9XA 4E4PA 5I2UA 2TMDA 1NOWA 3IEBA 4G7FA 5CLWA 5JQ9A 3VFCA 1I75A 1XC6A 1OBAA 3S1UA 4FALA 1TQXA 4Q7IA 1LQ2A 4YIWA 1E0VA 2WSQA 1XLAA 4AHOA 1XIJA 2IKJA 4O1FA 4HHHA 1T40A 4NU7A 1FUYA 3BH4A 3T07A 4PTWA 2PDCA 2Z00A 3WG6A 1KW1A 1JDCA 1OT2A 3WQEA 5H8UA 2EPOA 1W5QA 3GIQA 2GJRA 3PTMA 4K8GA 3G1AA 3F03K 2FH8A 4GZIA 1E6SM 1ZJBA 1ODZA 1W3HA 4DUOA 2DVUA 3KLKA 1N55A 5EFFA 2CCRA 2NSXA 1Q8JA 1GYNA 3CLMA 4NQ1A 4MB4A 5D2VA 3S83A 1P48A 1VJZA 3WF1A 1Q6RA 3WDQA 2PCQA 5HJYA 3OEXA 4DBSA 3PUEA 4CQDA 1QFEA 3FKKA 3ZR4A 4BA0A 3VKCA 1XIMA 1D3GA 3PN8A 2ZWYA 1AQHA 1DJYA 4MWAB 4DJEA 3HJZA 1NWUA 5I06A 1SSDA 4MVAA 3WUEA 2Z7GA 1YPFA 3QZAA 1EWDA 2PODA 5DRCA 4D8ZA 2E77A 1Y0EA 1CNVA 2D3LA 2FVKA 3CHEA 1JYXA 3LENA 4JOMA 3V4BA 1RP9A 3OLGA 4C6EA 5PTDA 3IANA 1VBGA 4YHEA 4JNMA 1ZY9A 4AZGA 3OQ8A 1MVYA 1EIBA 2YOCA 2E5BA 4LJ3A 4AXKA 2YYUA 2Y62A 3UA4A 4GI9A 4B91A 1E6ZA 5ABEA 2FDMA 3GZAA 1QAPA 4Z17A 2ZUUA 3TX9A 1KFJA 3M41A 1JZ6A 4YL2A 4Z42C 1X1OA 2OZ3A 5HNUA 4PRRA 4UNIA 3UGRA 1UKSA 2HK1A 3CPRA 1YDYA 4ERGA 2JKPA 2VGGA 2QPSA 2INEA 3B8SA 1IXQA 1UP3A 3ITVA 1RBAA 2EG6A 3M6DA 3QY7A 2YXXA 4K39A 3ARWA 3TONA 3H23A 3TOYA 3T2QA 4QNWA 1YMYA 3VX1A 3SW6A 2P0OA 3C2RA 3PNZA 4FHAA 4W5UA 4BZYA 3H7RA 1PHQA 4OHQA 4L4MA 3I65A 4MDPA 1MQQA 1LRQA 1S2UA 1NTHA 2VFDA 1T8XA 4GNVA 4QJ4B 5K9CA 2EGZA 4GIRA 4XUYA 4LT9A 1SO3A 4P7RA 3W84A 4QDPA 4OZOA 3PTDA 3W7IA 4GG9A 4JBRA 3U2ZA 1QCWA 2B7OA 4PCSA 2QDHA 1V3LA 1GOOA 2HXTA 1KTCA 4W8LA 4YYFA 1XH2A 1SJAA 1TUFA 4OBSA 1K3UA 2V9DA 2VZVA 3PPGA 3ZXWA 2EPLX 4O52A 3QLDA 2R14A 5REQB 1BYDA 1C7TA 1WKDA 1H1NA 2Y88A 3LHZA 4J2MA 3GB6A 1H7NA 1GVYA 5LKYA 3SUWA 3F5JA 4L1GA 6A3HA 1RUSA 2QJIA 3B05A 2XSXA 2P76A 3N9SA 3WFLA 3B03A 1Z3NA 3AYVA 3QTPA 4TVDA 5AYBA 1IEQA 1XRFA 4F0RA 3DGRA 1C9DA 1WQ5A 2ICSA 5FESA 2QJJA 3MB9A 2AKMA 4GK8A 1JCYA 4AQLA 5D03A 4MY1A 5CXPA 4A6GA 1VBHA 4OFCA 1WDPA 3NZGA 2V3DA 2Z2BA 1Q6LA 1VFFA 2RDUA 1SM9A 4CCCA 4ICMA 3ZO9A 1Z32X 3FAWA 2G3IA 1AW2A 4J27A 3S9IA 3TROA 6PTDA 4HU8A 3TTQA 3WMCA 1JQXA 3M0MA 4LB3A 1OD0A 1U30A 2PDLA 1NEYA 1JUEA 3BLOA 3C2FA 4S3JA 1KC7A 2W62A 3OPSA 3UXAA 3LNMA 4ACZA 2GGGA 2ZXAA 3E0WA 4FIRA 2WSRA 1GHSA 4KRUA 4WHBA 3T81A 2EXOA 2EQDA 3IUHA 4O14A 3NL6A 1TKKA 4BI7A 4US6A 5D38A 1L8NA 5HWJA 2OOGA 1D3HA 2WV8A 3VOCA 2Z7KA 2HK0A 5FAGA 4JTHA 1OYBA 2X7WA 4K37A 4K7YA 2I9EA 4MKNA 1K4GA 2V38A 3CUXA 4DJEC 1H7XA 1K8ZA 2GJNA 4DJDC 1YIXA 2IMRA 1PXGA 1KB3A 2PTYA 1NAL1 2V5CA 5CGQA 3EX1A 3C0QA 3SGZA 3WD0A 1SO6A 3T40A 3NDYA 3SCQA 2V2CA 4DXXA 2WPBA 1J4EA 1LBMA 1UPPA 2ALDA 2WZTA 2P1FA 1Q6EA 2VR2A 2WVUA 3EB2A 1QOXA 5CPLA 3VNIA 1GUVA 4C6MA 5A1AA 4GI8A 3M44A 1MNSA 3BTNA 4RPPA 5B80A 2CC0A 2W92A 2A0NA 3JZUA 1TWZA 4G7EA 2C14A 4YTQA 1GJPA 3HPAA 3EPOA 3QV6A 2ZICA 1GW1A 1PZ0A 1EDTA 4AISA 5MF5A 4E8GA 2PRLA 2GK1A 2D2JA 3H2MA 2HXUA 4C7GA 2XN0A 4IFOA 1B3ZA 3QOKA 2JFEX 4E38A 3TEVA 4MWAE 3LLFA 3KHJA 2ADAA 1PX4A 4MG4A 2FIQA 1POJA 3PFMA 4HBKA 2ZCGA 1QO5A 2J62A 3WH6A 1J01A 1J6OA 2FZ8A 5BMXA 4F0LA 3STCA 1E4IA 4L80A 1XYAA 1O94A 3ABSA 4R3UA 4Y9OA 4GUGA 3BOXA 5EMKA 2PGRA 1WAWA 3RIKA 3VIJA 1CW2A 4GNKB 1KCZA 3CL8A 5DANA 4F3HA 2FFIA 3Q37A 1Z9AA 1HJQA 4YVXA 2XFFA 4JYEA 2DY3A 2J27A 1V8EA 2ISSA 4XAZA 3PC0A 5BNKA 1XLKA 1LT7A 5LNSA 3SCWA 2WQPA 4V1XA 4AYSA 3KM8A 3GDBA 4DXVA 2J9ZA 1JXJA 2Z6JA 5DMLA 2J8TA 1BSIA 1FCVA 1C8VA 1MEIA 4GUFA 4MZYA 5DY2A 4Q8VA 1TSIA 1JXKA 3PBYA 4NASA 3N34A 1NDZA 3PWGA 4PA8A 1B9ZA 1QW9A 2I7GA 4GC4A 3LPFA 1YEYA 2WBKA 1SMDA 1YE6A 4XV0A 4OOUA 1LYXA 5XIMA 4MB1A 3I3DA 4O13A 3SQMA 1TX2A 1X98A 3EB3A 2BHZA 2PDMA 2QCDA 4J3ZA 1UD2A 2Q8LA 3UGVA 4IP7A 5CJMA 2ZXDA 4IIBA 3ICJA 4W8AA 3NSNA 2Z29A 5FA5A 3ANYA 2HZGA 4PC8A 3B8UA 1FXPA 3FNDA 1P6WA 3GTHA 1JJKA 1ADSA 3LHYA 4X22A 2PZNA 2WXDM 2DW6A 3LX9A 4PBGA 4HU0A 4Q8UA 3IV3A 3HG2A 1UR0A 3OIXA 2JALA 2O7SA 2W66A 4F9DA 4CKQA 3CHFA 1HKVA 1F8MA 1BYAA 4KBXA 3SCSA 1VHCA 4ZSTA 3CJPA 3OA5A 2GSHA 5DLCA 1K70A 2WCAA 2EPMX 1REQA 2IKGA 1BVNP 4CD7A 1MQPA 2XVKA 2B0MA 3IPWA 1UZDA 1UPMB 3OJGA 4MJ2A 3F4DA 4IISA 2XVLA 3IIXA 4GYFA 3WDJA 3VZZA 3TC3A 2OLHA 2PPGA 3VDHA 1UA3A 8A3HA 3VE9A 1JDFA 1KKRA 2CXEA 2OZ0A 3P5ZA 2JEQA 1EC8A 3B3DA 1C29A 2DORA 1BVZA 3ES8A 3WDIA 2VT0A 1T7LA 3VA8A 3BLIA 3PY2A 2PC4A 3GHSA 1TMQA 1H62A 2P53A 2VI0A 3RU6A 4UFHA 1VRXA 1TRIA 3DZ1A 4X9SA 1RJPA 3TTOA 1QI3A 3GFZA 3RN6A 5K3VA 3EOEA 2O9TA 4H8NA 1DIEA 4HIBA 2AL1A 5LIXX 3V1PA 4FLQA 3IVTA 5AC8A 3QFEA 2E9MA 1DIOA 4FIQA 3N12A 5KZDA 3NXLA 3TW7A 3NWRA 4J3TA 1UZ4A 3VE7A 4RE2A 1AUSL 3AHYA 1H7PA 1UOZA 2ZUMA 3N18A 4EF9A 1YDNA 3ATYA 3BLKA 3G22A 3DFNA 1M6JA 2INZA 3OQEA 4HT3A 4QS5A 1YNQA 3RUBL 1V7AA 1LOQA 3WQ6A 6TIMA 1WDWA 1R7AA 2ZC1A 5LHFA 2DT0A 3MQTA 3AAMA 1SR0A 1EEPA 1TTJA 2Z1SA 4QFUA 4XKYB 2HS8A 3M0ZA 3AS0A 2REQA 1MNZA 4C6NA 3V18A 4D6GA 4LVFA 1E43A 3SUTA 1EBGA 6ALDA 5BRPA 3OBAA 2P8CA 3QGAC 5LGZA 3OZPA 1L6WA 2JKEA 3B8WA 2YXOA 4E2DA 2FQIA 4LS1A 2V67A 1XUZA 3BMXA 4IF2A 3QZ6A 1ML1A 2BXVA 5FACA 3OGRA 2WZHA 4AY8A 3H4GA 4Q6XA 4B2DD 4LOCA 1BQCA 2CZFA 1EP3A 1OEPA 5E6ZA 4JICA 2OB3A 1OF6A 1MW2A 2BVYA 5LYRA 3CUZA 4K1GA 2PLCA 1F3WA 3Q94A 5A2BA 1U5JA 2YSWA 1ZENA 1W1VA 3QOMA 3PBVA 3MT1A 1VF8A 1SPQA 3NQ8A 3R0KA 4L7ZA 2ACSA 2FYMA 1GPWA 1HO4A 3VGBA 3RO8A 3UCCA 4G8TA 1UZHA 4IQLA 1UKPA 4NY2A 2RUSA 1BTCA 4DWSC 4AX7A 3ZWSA 1E9IA 3WUGA 3I6EA 3WN6A 3BQ6A 2QF7A 4C6JA 2WQDA 3WJWA 1W9DM 2PRHA 2Z1BA 4JZ5A 1E6RA 1PX3A 5CLTA 3TQVA 3W72A 1KTNA 4GMEA 1JCLA 1R87A 2E8ZA 1JPIA 1HL9A 1ONXA 1QW7A 1A5OC 4R88A 3FLUA 5D8WA 4S3GA 1OCNA 1E51A 4QDMA 3EKZA 3K5XA 4F4RA 1J10A 4DY1A 4QG8A 2E1DA 3MPGA 1ME7A 4ROPA 3FSUA 3M0JA 3GNDA 1R3WA 4CQAA 2RDWA 3S5ZA 4FSAA 1V02A 1NF7A 1WKEA 2DSVA 3SCOA 2OPJA 1UOKA 2VUYA 3ZR6A 5EPDA 3AS3A 2QIIA 1QATA 3APGA 1V08A 3ITXA 1NOFA 1T6MA 2AQVA 4DN1A 2IUZA 3K4AA 1OINA 3VC6A 5C0QA 4JTKA 1U5HA 2PA6A 4RDYA 4O4WA 2XZ9A 4IL0A 5FAJA 4AZIA 4C6DA 3GIPA 3MA8A 1MFUA 2CLOA 1S2WA 4IX0A 3LM3A 2XDFA 3TDFA 3N14A 5CSSA 4JN7A 4J1OA 2ALRA 1VFUA 4ZQRA 3PZ9A 2NVAA 1WOAA 3CO8A 4AZ7A 1V03A 3WBEA 2A3HA 3BWWA 4GI4A 1UB3A 3KOZA 2CLMA 1ITCA 4R53A 4ZE4A 1FDZA 3K8LA 5AHFA 1TE6A 3UY8A 5CZ0A 2I57A 5LIWX 2ZRZA 5J5RA 3UEQA 4DO6A 3DYPA 3NO3A 1GKQA 3B4UA 3LD5A 3TAOA 3BLPX 1K4HA 5CSUA 1YNYA 3P3BA 4PMVA 4US5A 5ECVA 4YN5A 3SCTA 4DUWA 2GGEA 3KP1A 3WMLA 3GTFA 3RLVA 2HEJA 4GFIA 3FYOA 2UY5A 3NJ3A 4AD1A 4F9JA 1UP2A 3QYSA 3PM6A 4PH6A 1XBXA 3OLEA 3C61A 3L68A 4I6VA 3EA1A 2E4TA 1A49A 2PB1A 4RNJA 4UNLA 4W5ZA 1DKWA 5ABFA 4CCZA 4DELA 2Z2AA 1KWKA 1PPIA 2RDXA 1UASA 4IM4A 3VX0A 1ZL1A 4GD0A 5CSRA 3WLTA 2Y5EA 1HFBA 1Z48A 5JIPA 1IF2A 3C2OA 2VD9A 3QY6A 2QF8A 1TB3A 3F4CA 3AXMA 4ZB2A 2VTFA 4XK2A 5CJ5A 1WX0A 4P8WA 5LZLA 3OGVA 2GDQA 7TAAA 3C86A 4FXSA 1IWPA 1KKOA 2WHKA 4O1AA 1EA0A 2Q8XA 2ABBA 4Z1YA 4JHMA 2CERA 1SO5A 3LV5A 3UR7A 1L2QA 3QVQA 4NAFA 4FNRA 1JD7A 1Q85A 4LH8A 4AVOA 3W24A 2B4GA 4PMDA 3FKRA 4YVPA 4NNAA 4BEUA 2F6UA 4PMOA 4AAJA 1RAKA 3GXMA 5GJNA 4GCAA 1BYBA 3MW7A 3NNTA 4PMXA 3DENA 2HPIA 3OBKA 4XZLX 3U4AA 2X42A 2GDUA 3R89A 1NJJA 1FVPA 3UT0A 3V36A 3IAPA 1FWBC 3XIMA 3W7MA 3L4TA 2ZXBA 2QPUA 4AD0A 2BX7A 3LBMA 1V51A 1UWRA 3UCQA 3L2IA 4JFVA 1UR1A 3UCDA 1Q4WA 4IMCA 4DWSB 4J35A 4ZE5A 4XVEA 3A3HA 3CB8A 3NXFA 3KBMA 3ZVIA 3G1FA 2VZTA 1E9ZB 1F73A 1QK2A 4M81A 3DFSA 2Y85A 1YBQB 3LPPA 1NY1A 4KWSA 1WXJA 4TU1A 1E1FA 1NWSA 5CPOA 2PTZA 1SZRA 4CCDA 1AQMA 1PUDA 3GZ3A 2UY4A 3VOJA 1TPUA 3BAYA 4JL1A 4UFMA 4J3SA 3GVGA 4ZFMA 4JPGA 3ZIZA 3CZLA 1QT1A 3W7CA 3FHAA 1RBLA 3OLIA 3KAOA 1V3MA 2VMFA 5D9MA 3T42A 1GVSA 4IFKA 2OMAA 4CNTA 4NZFA 2QT3A 4H9UA 3TYEA 2J24A 5M1TA 1ECEA 3AO0A 3PB2A 4C90A 1JR1A 3FJ6A 3KHDA 3IUIA 3C2EA 2ZX5A 3O0KA 3E5PA 4HNVA 4XAYA 4QXIA 1DTNA 1VIWA 5I23A 1P7TA 4QJ5B 3BARA 2VHLA 3WH9A 1TFVA 4HSNA 3MTWA 2NV9A 1B3XA 1KGUA 1ESWA 3D46A 4EKJA 2ON3A 1F6KA 4W87A 1LG1A 2CFFA 1DWFM 5C7VA 1JYWA 3ITCA 1O5QA 3UXKA 2PC8A 4NYUA 3CQIA 3L23A 1ZPTA 5FF0A 1OYCA 4J7RA 3AROA 1H7OA 2XIMA 1CLKA 1TV3A 3KCJA 3B0PA 4RZ4A 4OWGA 3HV9A 3LCHA 4Z08A 1XI3A 3NIYA 3B9EA 4WJXA 5EGRA 5BRQA 7A3HA 3LHWA 3M0IA 3W75A 3VPLA 4OV9A 2AAAA 4E0CA 2PDGA 1HN1A 1Y7VA 2VZUA 4ZA0A 1M1BA 2F2KA 3O07A 3MANA 1IQ8A 4L64A 1KM4A 5LNRA 3RGTA 1RCXB 4I9JA 1YPXA 2G95A 2C3ZA 1JPDX 4P61A 4DJFA 3VZXA 3VINA 3VOIA 4GXMA 3QV8A 3P84A 4XG1A 4UBPC 3B0VC 2VUNA 3ZJ8A 1KBKA 1JZ2A 2QZRA 2QUMA 1OFDA 3EWYA 4JR5A 1CXKA 2HWGA 3AC0A 5E0KA 2Z6IA 2R1MA 3KWSA 2OWXA 1BKSA 3GY1A 4KT2A 2ZA3A 5IFTA 1CGYA 5A6LA 3PHAA 2QEZA 1Q8AA 1WUFA 4LCRA 1YDOA 3F4NA 5BMWA 2EKCA 4REQB 4LEQA 1GQIA 3WSUA 3T0DA 1MZRA 1U1UA 3L67A 4LYQA 1XD1A 4QIUA 4EF8A 3TJXA 3WDHA 1EQCA 4L56A 4EPEC 1QRQA 4GOAA 5G1TA 1H7WA 3HA1A 3BAWA 3QQ1A 1ALDA 1JUKA 1RVKA 1PCKA 3K4DA 3XINA 4GX8A 1NDYA 2E5DA 5E09A 3GTXA 1U33A 2A2IA 3SECA 2IQDA 1MI3A 1EF2A 3SJ3A 3UW6A 1VR6A 4O18A 5CPMA 4AHQA 1XR2A 3HFTA 3ES7A 1DL3A 3TU9A 3MKCA 5TQLA 4JGDA 1K02A 3EDFA 4LAKA 2XISA 3W07A 5C70A 1SVDA 1R86A 1VCGA 1F6YA 1AH0A 3BPWA 1Y5VA 3A23A 1XIIA 3E96A 4NJJA 1OT1A 3HGJA 3E0LA 1HVQA 4HA0A 4F40A 1B3OA 4HZ6A 4Q4SA 4QE4A 1BHGA 3QY8A 3ITLA 3OIHA 3EDKA 3VO0A 3UESA 3EWUA 4JTCA 2KAUC 3OO2A 4X2PA 1E56A 1CGUA 1L6GA 1VYPX 4AZ5A 4BR1A 5BZAA 3WF2A 2Z1VA 1F05A 3KL3A 1NELA 4IIHA 4DYEA 3IIZA 3KS6A 2BGSA 2QCLA 4W86A 4CQBA 2Q8ZA 4I8DA 3O6CA 4H41A 4OIFA 5E0FA 3U7VA 4NG3A 4PEKA 3WNOA 3LMYA 4KS0A 4JTFA 4A8NA 1R9ZA 3VU2A 4OT7A 1QHPA 1H1ZA 1HUVA 3TXVA 3USBA 4HSOA 4B3KA 3WJZA 1A3XA 2BBFA 2WWCA 2YXGA 1E3XA 3QR1A 4PBEA 3I4KA 4KW2A 2CWXA 4GZEA 4S2CA 1B3YA 2Y8KA 3BSHA 3FEQA 3RG6A 2J4GA 1XX1A 2ISWA 1GHRA 3KXQA 4IOTA 3EKGA 4B92A 3VKJA 2CKRA 2NUYA 3WL1A 3LRKA 1DWGM 4D1JA 5G4WA 3VZYA 1OX5A 3OYZA 3LZ3A 4IXHA 1ZS2A 1ADOA 1OC6A 3KRZA 1EIXA 4RE4A 4XB3A 1TREA 1WDQA 2X1UA 3MDWA 3I7RA 3GFXA 3QPZA 3MJMA 4AFYA 3ABZA 1I2RA 3GC2A 3SI9A 3LGEA 4ICCX 4WOZA 4JIRA 3NPWA 4IP5A 5HNTA 1PO9A 3ARQA 2J7EA 3SAZA 1E6QM 2PWVA 1CLVA 4DPQA 3T44A 4JIIX 1RVGA 2E3ZA 4MUZA 3LA4A 2WMGA 1QNQA 4O57A 2TSYA 5HULA 2V3GA 1R3SA 3UPBA 1JEZA 5CGTA 1VYSX 1B5TA 3W71A 2VD8A 4TX6A 3S2NA 2QUVA 3EA2A 4PUDA 4LNYA 2OVLA 1GKRA 4WSJA 4B4FA 2OX4A 1JF6A 1QWGA 4NAEA 3L12A 3LQLA 1UWAA 5AB3A 3A9IA 4KFOA 3CH0A 3I4EA 4JX6A 1RQHA 2PZ0A 4CU7A 2VDIA 2ZX7A 3TYZA 2UBPC 3VIGA 2HE8A 3UR5A 3LDVA 4N02A 1WCGA 4ECLA 5JH1A 4ZB5A 3R8HA 5A8GA 4NYYA 3KL5A 2GGHA 2V8ZA 4LY4A 1A4MA 1E0XA 3LCLA 5AN7A 5A6BA 5K4XA 4L9ZA 2Z0IA 3DUGA 4D6FA 1VJIA 1FWNA 2J7HA 3QMTA 1L6FA 1OFQA 1XKJA 4GWEA 1NVMA 4EPDC 3T55A 3ZZ1A 2XH4A 4G1NA 5HQMA 1HZYA 2ATSA 4WY0B 3RU8X 3GDMA 3E49A 4YWSA 5RUBA 3VIKA 4QLJA 1Q2SA 3E2VA 3R79A 3QW4B 4KEUA 4CQCA 4RNIA 4RZ5A 4JQAA 2Y8UA 2W0UA 5TF0A 1FDYA 1Q5MA 1X6LA 2WBGA 3BC9A 4CVUA 1XLBA 2EBNA 1I2OA 1BD0A 5EMLA 4WX2A 3TTSA 1X1ZA 3VKAA 1JRCA 1E5NA 3DERA 2HQAA 1EDQA 3CPGA 3IGXA 4L6OA 4FX6M 1CGTA 3CAWA 2C7FA 3HV8A 2NWRA 2ZDSA 5I02A 3H2EA 4J3UA 5MKGB 2FB2A 1EZWA 4ZZ9A 2JF7A 3KRUA 3GK0A 1KNWA 3MI3A 1CBGA 2D0FA 5HMEA 1SJDA 5G1YA 2DV0A 4LAOA 1BF6A 2DUXA 3L4ZA 2BODX 3GUGA 4WXZA 1EX1A 4UNKA 3TJLA 1V02E 4WK9A 2QVHA 2WNWA 4R85A 4N4PA 4BY3A 4GISA 4NNBA 1NM9A 1V3HA 3AIRA 1H7RA 4H7ZA 4NXKA 7ODCA 4KCVA 3L4YA 1QDSA 1DJQA 2V5BA 2A7NA 4PR4A 1XW8A 4KWUA 4HD5A 3U2CA 4B3ZA 3GVRA 1DQUA 3A4WA 3FVMA 4RXGA 2OYMA 3BZJA 4PMNA 1F2JA 4QSHA 2ASHA 3G18A 4JFSA 1OG6A 3N9KA 5BWAA 4BWLC 3W70A 3AWOA 2ZUWA 2UV8G 2J7CA 1V6YA 5FJIA 3P61A 1SGJA 1DBTA 1EB3A 1GGOA 4D71A 3W1NA 1XUUA 3VD7A 2Z25A 5EBUA 3MSYA 4P7QA 5K9XA 3R11A 3AS2A 1W8GA 2VWTA 5E6YA 3EGJA 3LYEA 1OJXA 2J8GA 4JKLA 3TUUA 3T8QA 2OQHA 4KRTA 5ECUA 1MDRA 4O10A 5J04A 1KFCA 1C7SA 2NX1A 4KGLA 2ZBTA 3KUMA 3TNBA 1BF2A 4F0KA 5TAOA 2VGFA 3RR4A 3A12A 1LLWA 1HG3A 2VELA 4PMYA 5C71A 2OO0A 2PDKA 2Y8VA 3PJXA 3PUDA 2DH3A 1E9YB 1ONRA 1W6TA 1BG9A 1V3IA 3DAQA 4DO7A 2WSKA 3PZVA 2O55A 3G1VA 3WQCA 4FZIA 3TLQA 1DWJM 4HN4A 3IAQA 1GK8A 4F2UA 1LL7A 1P0DA 2DU2A 3IRSA 3PG8A 2X2YA 1X8CA 3J7HA 2CESA 3M0HA 3B9NA 2X1RA 3GHRA 1YX1A 1XS2A 2OQYA 4ORMA 4LYKA 4C5YA 1W9BM 3W83A 4OBRA 1W32A 2NWSA 3LSCA 4NUWA 4K36A 4RW3A 1IV8A 2VENA 5GJMA 3TR9A 1Z8AA 1FWEC 3TW6A 2BVDA 3PULA 4LY8A 4M6PA 5E0CA 1P6CA 1L6YA 3K1DA 1JZ3A 3A4XA 3AS1A 4A35A 1FCUA 3NSXA 3BGJA 4B5TA 1LOSA 2F8QA 4CD8A 5A8MA 1Q6DA 3NGJA 2FMNA 4XO6A 3BJSA 4LAZA 1KXTA 3FOKA 2YLAA 3AALA 4PTNA 5BRBA 4B4HA 3WLMA 1W1ZA 1NWTA 3IUDA 4WDUA 1TTPA 3IJDA 4WDTA 2YCKX 3HPXA 2PFHA 3HG5A 1EOKA 1SW0A 2PDWA 3DFQA 4R7WA 3TIMA 1E72M 4UTUA 2JEPA 4N9EA 2VXNA 4IG2A 1SQ7A 3T4WA 1VD6A 3LU2A 5AVNA 1NP2A 4DWSD 1EOMA 3CWNA 5B7ZA 3LK6A 5BU6A 2WVTA 3RX2A 2H90A 4CVWA 2H8XA 4KGJA 2X09A 4D6IA 1K6AA 4QG6A 2VC5A 2YB4A 3W3OA 5DT5A 2WVVB 2YZ5A 2NQ5A 3S2CA 1SZFA 2Q6ZA 5LA2A 2OJPA 3BG3A 2R1KA 3NZRA 3WD3A 2GJPA 1UWTA 2YCLB 4V2XA 1I1XA 4PMRA 4FNQA 2J8FA 4H8VA 1MSSA 1I9CB 1X97A 3EZ4A 5BXSA 4OGZA 3P93A 4RNHA 4LVAA 3W2UA 2QMJA 4IPLA 4K8HA 1J93A 3CZKA 4K2SA 2PWGA 1M68A 1W9VA 3VCRA 3V35A 3FYYA 3DFPA 2HV5A 5T26A 1DHKA 2GJXA 2XTKA 3MJYA 3ZSSA 1ADDA 3N3TA 1XCFA 3PWAA 4J4KA 2DT2A 4H4IA 2DZXA 1SMAA 1WPCA 2Q02A 4KCTA 1HJSA 1ZCOA 4MYAA 1JCTA 5DBTA 3ZLFA 3JVAA 2XVPA 5E70A 2X1TA 4AVFA 2AMXA 1EFZA 3VNKA 2YLLA 4MPKA 3W38A 4DXKA 1HQTA 1ME8A 3VKKA 1CGVA 1AL8A 9XIMA 4PB4A 8RUCA 3LG3A 1IIHA 2R1PA 1LWHA 1RH9A 4AZCB 2XGZA 1EEXA 2VL4A 3E2RA 1L6SA 3WBXA 3KVJA 3G77A 1BAGA 1ICQA 2O4QA 3PJWA 3CO4A 1E71M 4Z2JA 4URIA 4EP8C 4M56A 3F5LA 2PDFA 3AJ7A 3H2CA 2W6RA 3E0IA 4UC5A 1VFOA 1TVPA 2NLIA 4Q8WA 5HQLA 2E6YA 4ASTA 2DSUA 3GXIA 1WZKA 1WYIA 3LM7A 4GQBA 3FSTA 4MJMA 4GACA 4F66A 1YE4A 1CB2A 2D2GA 4BI5A 4IICA 4O16A 3OB8A 3I7QA 4TVCA 1E73M 1DWAM 2PLKA 4OU1A 3AMKA 1EYWA 4UMAA 4HTYA 1H63A 2QGYA 2V5DA 3K8MA 5A95A 1H50A 3DYMA 3WLSA 4OQVA 3KOWA 1UQZA 3G1SA 4PUMA 3N11A 1VBRA 2D20A 4A2RA 4N4QA 2WC4A 5IBXC 1GEQA 1OGSA 3P0WA 2WO5A 1NSJA 2PDJA 3LNPA 1TTQA 3O9NA 3VCNA 2RHGA 1Q7ZA 2X0SA 4I7UA 1RLDA 3NDOA 1ZTVA 2IPFA 4DRSA 3GR8A 1FWWA 3IARA 3EMCA 3GG8A 3OHIA 3W2NA 1B3VA 2C19A 4LEFA 4W4QA 4B5SA 3LXCA 4X2RA 2DUZA 1TR9A 3KTSA 5TD4A 2EF9A 2D0GA 2CLPA 1KM6A 5A6TC 2AL2A 5BYWA 4CLMA 4DBWA 1S5VA 3HURA 3GLCA 1UR2A 3NQ7A 2PGEA 3ZJ7A 5BW6A 3N9RA 3M7WA 2CBIA 4H8UA 1ICSA 3AISA 1E0UA 2Z1XA 3WNMA 1OFRA 2JQXA 2TPSA 3STFA 4CQ9A 3M46A 1X39A 3UWWA 1PYMA 4UOJA 3GIYA 3R10A 4Y9AA 1ZAIA 1Z7AA 3NQBA 2Z4GA 2VFHA 1PKNA 3KCLA 4EK7A 1VJSA 3N6HA 1KCLA 2NV1A 3U0HA 5D04C 2JK2A 4ZB0A 1CI1A 4FK9A 4FF5A 2VVSA 2ZWZA 2GJLA 2W61A 2OELA 3BGGA 2R1NA 1EGVA 2VC6A 3STGA 3H22A 3BLFA 2PF0A 3TQKA 4AB4A 3VAVA 2XSBA 2Y70A 4GQRA 4TUFA 2ZZ2A 3DBPA 4OOZA 1X6UA 4FS9A 5FF4A 1HKMA 1GT8A 5HUOA 3VIOA 1PIIA 2E6FA 3E74A 1OFPA 3APTA 2DGAA 2DIEA 2IS7A 4INFA 3ZYZA 1DORA 3H70A 3BCJA 1GQLA 1U2YA 1TV2A 2A6NA 2C79A 1V4YA 4HA4A 1QO2A 3PBWA 4LUJA 2WJFA 3GSMA 2CKSA 1X96A 4UMBA 2O7QA 1JZ7A 4YVVA 3BAXA 1XH0A 2B81A 4DX3A 4PUNA 3RJXA 1TE1A 4E4UA 4JIEA 3PAJA 3DXIA 1TV5A 1L9WA 3GTIA 4DI9A 5JH2A 2I5GA 4IZGA 1I8JA 2AMGA 4ILSA 3CUIA 3IJQA 2Y5JA 1R9XA 1V0MA 2VZOA 2ZC8A 4MGGA 3SRHA 4HNCA 4LCSA 3T05A 2DPEA 3UWEA 2A3LA 4ICNA 5A6MA 3NL2A 4AWEA 3WDPP 3TMLA 3B0UX 3QBUA 3LQGA 3BJFA 1RHCA 3OVGA 3TFCA 1KM2A 1Z41A 2VEFA 3OZYA 1KM3A 4I5UA 4OVXA 1HT6A 5D09A 2ZXQA 3KOXA 3N4AA 2V3EA 2CETA 3CIVA 3WD2A 2G4JA 5FEZA 1SFSA 1A80A 4ML4A 1XC4A 3SDOA 1EP1A 1XIDA 5FL0A 3WH5A 4B5XA 4M7SA 1HP4A 5G2HA 3OTRA 1E4NA 3VGFA 1SZGA 5DO8A 3USZA 3F2DA 1R2SA 2BSLA 3GHUA 3GE7A 1N82A 3KBVA 5FJPA 1T99A 4J40A 4H04A 1H3GA 4DBDA 4HMNA 1UBSA 3KWXA 3BV7A 3P0XA 5LHEA 3RPDA 2ZYFA 5BU9A 3WJXA 3ZS4A 3R8RA 5HK4A 4H6QA 1RV8A 2VX5A 4X63A 2P8BA 2O92A 8TIMA 2OZTA 4JKMA 3VXGA 1XSKA 3THQA 1QNSA 5I3FA 1VPYA 1BFNA 3M07A 4RZ6A 3P6LA 4GGHA 4MAZA 1KA9F 4TVUA 4GLEA 2OX1A 1DXFA 1WV2A 1WKFA 2MNRA 1TJ0A 4JTQA 2R91A 1GPFA 4DWDA 3S8HA 5XINA 2ZZ6A 3ANVA 3QKEA 4IIFA 1TWSA 3TCSA 1VLWA 3R7MA 2ZKMX 3AOFA 4M6QA 4XZNX 1VFHA 2JKAA 3ARYA 1C3FA 1GJUA 3KBWA 3O63A 4B9YA 1Z6KA 3CEUA 2OEJA 4XO7A 3HM7A 1GEHA 1KM1A 2DP3A 3V3WA 3DHUA 1VEMA 2D3NA 4RK8A 3DIPA 3EOUA 3QHOA 3FDKA 3W86A 4V33A 2VVNA 4W85A 2A3CA 4GYPA 4LRSA 1OB0A 1OX4A 3RYSA 3FGCA 3FEMA 3QJAA 2QCMA 4JQ4A 4U5IA 4AU0A 1FWRA 4WSHA 5C8BB 1R46A 2ZTJA 2VFGA 2BMBA 1WA3A 2B7QA 4G2DA 4FOUA 2LLEA 5FSEC 4X60A 2HSAA 5FJRA 4JHOA 3L4UA 3WK1A 1KQYA 3ZT6A 1VP5A 1VFSA 3A5FA 4JIQA 5CC6A 4Z2IA 4KH2A 3N2XA 2XSAA 4X3ZA 2ZE3A 2NX3A 3PPFA 4ZQMA 3MMDA 2OT0A 2PMQA 4DIAA 1VHNA 3VDBA 1TWIA 3QM3A 2EPHA 1R8LA 1X1NA 3BAJA 4JL2A 3VKDA 5BROA 4RDZA 4PUUA 4FP1A 3KW3A 4HU3A 3OBEA 2OSYA 3V16A 2C0HA 2NUWA 2V6AA 4V1YA 3EWXA 1I1WA 4ZEPA 3KDOA 3IACA 2NZLA 4A05A 5J5DA 4LV9A 3ARRA 2QS8A 1DE5A 1F3EA 3MKKA 2QQ6A 4LUTB 3OP2A 4R27A 4Z1CA 1O12A 2OZ8A 3VGHA 1DJXA 4AMAA 1KLZA 1K9DA 2QCGA 2KX9A 4IUOA 2VGIA 3BLDA 3W2MA 3NFUA 3POCA 2X30A 4B9ZA 3O1NA 1G7VA 2RFGA 4LAMA 2YA0A 3AIVA 4E2VA 1FH7A 3AXIA 4JXCA 4HPXA 1VENA 2J25A 4Q7BA 2NXIA 1IEIA 1ZCCA 4BS0A 1CXLA 1LQ0A 3AHVA 1KBIA 2P10A 5DF0A 5BOEA 1DVJA 5AVHA 4MZ8A 5C9UA 5EMYA 4LBRA 4O15A 1MZHA 1F74A 1CGWA 3AMGA 3NQVA 3TP4A 2YIHA 1QPOA 5AYIA 1F3TA 4DZHA 3DFYA 5FJUA 3DG7A 1EJWC 3ANUA 4CD6A 1DJGA 3S9YA 3TYDA 3THCA 5C55A 1GVQA 4XAFA 3GW3A 4CN6A 2QVNA 4WCJA 4RLIA 4GXPA 4OV4A 5C9XA 5BOOA 4LFYA 4F0SA 4Q8NA 1LJYA 1OIMA 2J7GA 4IQDA 3WQWA 3M0XA 1LCOA 4XUGA 1BXBA 2R24A 3OLDA 2NQHA 4LXFA 4HA1A 4I90A 4N6EA 1GYLA 5HMFA 1ZNNA 4X0VA 3HQ1A 2E67A 5LNVA 3M7SA 3VD9A 3ITYA 3W7JA 1UCWA 3W7LA 3Q67A 3NURA 4HYRA 1UH2A 4EXAA 3W37A 3QV9A 2KZHA 3VNMA 4I5XA 2XWDA 1UP0A 3VD4A 4ONVA 1FHVA 4G56A 3OYXA 3C8FA 1YYAA 4JTRA 3EWDA 4WJEA 4Y6GA 3B06A 3KBSA 3LTSA 2C1HA 3DC0A 3TK7A 1W3KA 3EDEA 1LM1A 2YGYA 1A5AA 1KO0A 2XFRA 3W00A 2HDJA 1V5XA 2FJKA 3AJXA 3DHDA 2J79A 3A3XA 4AH7A 1GVOA 3KTCA 1XH1A 2GWGA 4V15A 2FTPA 4FF7A 5EL1A 3K2GA 4YHGA 1CENA 1PKLA 2WCSA 3MHUA 2I9UA 1XXXA 3IGUA 1MUCA 1VQTA 3H2FA 3T7VA 3LCIA 3QYQA 3GAYA 1BWVA 3GKFA 1HF6A 4HP5A 4Q6JA 1LT8A 1PAMA 4C1NA 3L0NA 1JDAA 4K38A 1RZMA 3RX4A 2BV9A 3CUJA 4UTTC 1CCWB 2Y2WA 1TA3B 1SJCA 4IXXA 3MS8A 1UG6A 5HOSA 3B0XA 4F79A 5C2XA 3N1AA 3BXWA 4L61A 3VGDA 1YNPA 5C9ZA 3GYEA 3TA9A 2FTWA 1PZ1A 2HVNA 2FHFA 1LBLA 2G97A 2NT0A 3WFZA 1DJZA 2Z26A 3QPEA 3EKLA 3R6IA 4CD5A 1P0BA 3OGSA 1R3TA 4XBKA 3LEPA 3AXKA 4W7WA 1CWYA 3UYCA 8XIMA 3N29A 2VNCA 5ENLA 1K7XA 5AC5A 1DHPA 3BVJA 3MWCA 4DYJA 4H9TA 3B40A 4ZOEA 3PFRA 3VMNA 1TPDA 4GQGA 2DH2A 2WAGA 4B5WA 2Q3OA 4IGNA 2ZUVA 4NKCA 4XBSA 3S2LA 4BEQA 5BXPA 1V0NA 3RLHA 2VX7A 3UXIA 3T1GA 5U4NA 2F6XA 3BV4A 2ZZ5A 1PHWA 4DPPA 4O19A 1RCOB 3NOEA 5CPTA 4LUSB 1OQFA 3P14A 2NT1A 3S5YA 3WK0A 2GQ3A 3AHXA 1I4NA 3B97A 3VIHA 4LRTA 1FWTA 3WQGA 3S4TA 2ACUA 4NX0A 5I77A 1MQRA 3O6DA 1JD9A 5FSDC 4AIOA 3R43A 2WZEA 4DM1A 3NUKA 2E68A 1W3IA 3C3NA 3UBPC 2GPTA 2R6OA 3MCNA 2WB5A 3MMTA 5CC5A 1PS9A 2AQOA 2HE5A 3S1GA 2X1IA 4LVBA 4NI8A 6REQB 4XSMA 1BWLA 1HVXA 4AEOA 1R0MA 1R6WA 2V5KA 2V69A 7CGTA 2BVWA 3NZ1A 4GBUA 1G4SA 3UD6A 2H3DA 4DUXA 3QQ0A 3SIZA 1FWJC 3QC3A 1TG7A 4ZO7A 2C13A 3W88A 2GDVA 4ORIA 1XL9A 3PPCA 2RH9A 1H49A 1J18A 4JTEA 3CQJA 4JQ1A 5D9NA 1F6PA 3SN1A 4EPBC 2B7NA 2GQ8A 2IPWA 2J7DA 4ENLA 4S3DA 1DWIM 3IJ6A 3AHTA 1S5MA 3UWQA 2BY3A 4IQEA 7XIMA 4TO8A 3QF0A 1PZ3A 1ICPA 1DE6A 2NVCA 3WJSA 3S3GA 4Z2KA 1G4TA 3S5SA 2WKLA 3UG4A 1XDLA 4WEVX 1ZSXA 2OWCA 4RJEA 3V5FA 2E9BA 2OEKA 3AICA 5AC6A 3ARXA 1P1XA 3R5EA 1IT0A 1O7AA 3MBFA 3O0FA 1A3HA 3PZGA 1IR2A 1BXCA 4QDWA 3G0UA 4UFLA 4GYJA 4GH1A 3NYZA 3UJSA 2WANA 3W2JA 5A69A 2J13A 3C2YA 3L5LA 4RX0A 3GNOA 4NRSA 2G4FA 3EXSA 3O8AA 5FEWA 3DBNA 3REQA 1XSIA 4GQ0A 1W9XA 4ZO8A 3WENA 1ISVA 5A3HA 5M5DA 1XYZA 3VVGA 4YTRA 3PK7A 4KFNA 1IEWA 1SW7A 3DDMA 2VQUA 3PJTA 1A5NC 3STPA 1KLYA 4MM1A 2VCCA 3BURA 2A4AA 3CMGA 2I56A 4G5DA 4ZXOA 1BG4A 1ECQA 2EJ1A 5D02A 3U7BA 5LA1A 3IIVA 2OG9A 3RCMA 1EQPA 3TR2A 3V1HA 3RM8A 2QR6A 4FR1A 1BPLB 2PD5A 5IRPA 3KL0A 2J9YA 4PBFA 2JIEA 2WC3A 4ZO6A 1ISWA 1CB7B 2FLIA 5G1MA 4M6VA 3CAVA 2ZTKA 4UTJA 3UG5A 4I9TA 1JI1A 2ZDRA 1PV8A 1TQJA 2WNZA 1TV4A 3LCXA 3EOSA 5HWNA 4L4PA 1WAUA 3VYLA 1VIZA 1RP8A 2WMIA 2QCEA 4FNPA 2IPJA 4P5UA 1QASA 1E15A 4IPJA 3HQNA 1HKWA 1GONA 3WLKX 4ROQA 3TOPA 4HQVA 1N8WA 2POZA 4ZL1A 2CBJA 3MCMA 1PB0A 3LLDA 4Z2HA 3P80A 3BMWA 4MDOA 4UTHA 4DAIA 1QI5A 5T8GA 2ODOA 3WBAA 1BRLB 5H8PA 2GVGA 1TIMA 1UR8A 2A3EA 4JY9A 3MKVA 4IMGA 3BAKA 3MVIA 4WGXA 3TE9A 5A6AA 4W88A 4Z2LA 7ENLA 2WSYA 1A5CA 4S1FA 2J7FA 2H9AB 2PRMA 3EX6A 2CZDA 2H8ZA 4B3LA 2PGWA 3OODA 4W7UA 2CWNA 3SCUA 4A3HA 1PIFA 4NJGA 3W01A 2Y6ZA 4GZ7A 4XQ6A 1CPUA 3QHNA 5CCZA 2YA2A 3UR8A 1XV8A 3PANA 4D1IA 2PU1A 3LXAA 1QPQA 3P2VA 4ALDA 1O1ZA 4EVZA 3VNJA 1I0DA 3FCPA 1OK6A 3W7PA 3O06A 2BXYA 3SCRA 1OIFA 1W1A1 3EYPA 2VZSA 2I16A 5CZJA 1L0PA 3C8NA 2YL8A 4C6BA 1DWHM 4W7VA 1SZEA 1VAHA 1FX6A 3UP8A 3UG8A 3MZNA 1O4UA 1JUBA 1W3NA 5AHEA 2AAMA 3KBNA 2ZIDA 5FOOA 1W0MA 4AUBA 4UTLA 5I00A 2D23A 2ZX9A 1NWRA 4YTTA 3SO7A 3CUGA 5CAKA 1F9CA 3MUCA 2A21A 2MUCA 2NLYA 3GX9A 3VUPA 1AD4A 1SUXA 2GQAA 3RMJA 1U5VA 1KXQA 4PMZA 1TPEA 3MDUA 5G4HC 1UMYA 1IZCA 3O7UA 2RAGA 3NQDA 5F7UA 3WQOA 3ZJ6A 5DFAA 4KIRA 2AGKA 4HNNA 2DW7A 5HANA 2GL5A 4JS3A 2QNEA 3JRKA 2FGLA 4JTSA 2VR4A 4DZIA 5AY7A 3QH2A 3QXBA 1EJRC 1ZBVA 2RJHA 1IR1A 3A22A 5D05A 3EB4A 3LRMA 3O2LA 1TMLA 2FZ9A 4AF0A 1M01A 4HN8A 1Z44A 4GO9A 2EO7A 4JY8A 3NL5A 5HUPA 2QW5A 1QXLA 2WLZA 1Q7QA 4PCNA 5C6MA 5FJTA 3AYRA 2PAJA 2QGHA 3WQ5A 1YHTA 1YPIA 3TKFA 3TCEA 3PF3A 2FHBA 4H83A 3SY5A 3W7RA 2AKZA 4XTDA 5HATA 1GVIA 3QR0A 4C6IA 4LCQA 1HJUA 4G1KA 4JN6A 3TN4A 2Q3RA 4RE3A 4QJ1A 1W5OA 2Z1KA 3GVQA 1VBUA 4B2DA 1IE7C 3B0YA 5I78A 3LGGA 3HPZA 4IIDA 4MF4A 4F2BA 3UY7A 3BDKA 3N6JA 4IHCA 5LXEA 5GQBA 3TN6A 1MW3A 2YDAA 1HKIA 2I5IA 2E6DA 2NSOA 1KXVA 3E2QA 1B2YA 2PU0A 2WJDA 4HOXA 1EPVA 3N2OA 3GXFA 2XGIA 1QBAA 4J3XA 1NFPA 3WK2A 1EJ7L 1GOMA 3TA6A 3F7JA 5KEZA 3CWHA 3CU2A 3M43A 3WY1A 3ZT5A 4P8UA 3W1QA 4UMCA 4JN8A 4MYXA 4ZSUA 3R94A 1TTIA 2WHMA 4EACA 4XD6A 3MY9A 4EOUA 3GAKA 3T78A 4HSHA 4M1RA 4PMQA 4C6OA 2R1LA 4QISA 1U1JA 3H7UA 3NEHA 2VC7A 3UZXA 3W2LA 2F2HA 2Y7GA 3R0DA 1US3A 7REQB 1QJWA 3ZFHA 5I09A 3KX6A 3R8GA 1E1CA 2ZVRA 1DJIA 2NW0A 2BZNA 3RX3A 1XISA 3B8IA 2X41A 4MUPA 3V75A 3W29A 1J12A 4DHGA 4GNJA 4XD4A 2WNQA 4F2TA 1TYGA 3LTPA 4Q4RA 1E0WA 1NQKA 4NJHA 3M5XA 4EX4A 1S2VA 1LLZA 2HJPA 2EG8A 4JTUA 1OG0A 1EP2A 5I07A 3ZVHA 2BXZA 1EJVC 4GY7A 2D22A 1WZLA 3C2VA 4H01A 3UJRA 4E3VA 3N4EA 3WLLA 4LV4A 2XH0A 3HMCA 1K9TA 3ZJKA 1TPH1 2Y5SA 4V27A 3C4UA 4PUEA 4M6UA 2WWDA 1W9UA 4JDBA 3W6MA 3E5BA 2WZMA 4RDVA 1NF0A 3OVRA 3W02A 3QW3A 5D2TA 1T8QA 4GKLA 3BW4A 4IWWA 4KIEA 3NQAA 2XIIA 4HGXA 4BQ2A 2DSKA 4K6AA 1Q63A 4O17A 5HAOA 2UY3A 2ZVIA 1EUNA 1DQWA 1RSCA 4QHRA 3U2OA 3UWVA 3ALFA 1AH3A 1KD0A 3AFBA 1X6NA 1W1B1 1QTWA 2F9RA 3DN5A 1RK6A 2QLYA 2E09A 3T2OA 4D72A 1XDMA 3HU7A 3KE0A 3ZSTA 1G9HA 3LLXA 4AEEA 3H2OA 2G3NA 1XIHA 1OFOA 2CLHA 4GI6A 1A50A 2EJAA 3M0KA 2PF8A 5G4EA 1UKTA 3ERPA 3GO2A 3TN3A 1LL6A 4HCHA 2GVEA 1D9EA 2DQXA 4AD5A 4UTWA 3SGGA 3NQMA 2XU2A 1AQFA 4MWAA 3WQPA 2E28A 4MZ1A 3KOYA 3N19B 1BQGA 3BSGA 2WM1A 1KGXA 3GXNA 2XVNA 2J66A 5HINA 3W87A 2WNNA 5I3GA 4GPNA 3T0CA 2GSEA 4FEZA 5D2YA 3PZUA 3R1ZA 3OZOA 4N6FA 2ZRUA 5H8MA 4EAMA 3HPFA 4BF9A 1NFGA 3TNOA 4A22A 2VFFA 2W27A 3CV1A 1WXYA 2WYSA 1E9LA 3BQ5A 2G8ZA 1FWCC 2OXNA 3QHMA 3FDGA 1O5KA 2X40A 1MW0A 2CIPA 4I9AA 3URBA 5HWMA 1OF8A 4LWWA 1IZKA 1LROA 3KCOA 4LPCA 5IFPA 3H54A 3Q65A 1F4HA 4GIAA 5BXRA 1UR9A 2BHYA 3UJ2A 2QKFA 3GWQA 1LP6A 5BOFA 1JYVA 4QS6A 5D30A 3BZGA 1YXDA 3TV8A 3HBLA 5K7JA 4Y9MA 2XVGA 3MUZ1 1LBFA 4ZQOA 2QJMA 5FJOA 2XN1A 4Q4KA 2ABAA 3M16A 1FBAA 2HISA 3H26A 1RR2A 3MSGA 2CNCA 3EEZA 4H2HA 3L2MA 4GVGA 4TIMA 4UR9A 5IHSA 5D2WA 1DOSA 3LI0A 2CLKA 1B57A 1WUEA 3BUVA 4AXNA 1K1DA 5REQA 5EMMA 3W85A 1H60A 2Y7FA 5HJLA 3DESA 3WD4A 1JI2A 4H1ZA 2YL6A 1R7OA 4LS2A 4OE7A 3CBWA 3UPMA 4JTLA 3QEZA 5EBAA 2NQLA 3HG4A 5DCBA 4XD5A 4JFTA 4R9OA 4HJFA 1MYRA 4ACZB 2BASA 3HOJA 5C7HA 1TV7A 5KETA 3GM8A 3TQPA 4XX6A 2C16A 3M5VA 1FH8A 3CPUA 3LY0A 4X9YA 1KQZA 3FAXA 3VGEA 1G7UA 3EX4A 2VCAA 5CG0A 2Z24A 1SYTA 3WBYA 2YYTA 3GQYA 2YL5A 5FEPA 3THUA 4RE0A 2OSXA 3G6LA 1G01A 3RRXA 3FY1A 3BCFA 1EA9C 3CB3A 2XPKA 3T2PA 1ELSA 3KS5A 1UC5A 5CBIA 4GQQA 1EJXC 1ZB5A 2ISVA 3EDDA 1XGZA 2NVDA 1ONEA 4ZENA 3HMJG 5GNXA 4QTGA 3SUVA 1IZJA 2VOMA 5AC7A 7PTDA 2F7FA 1JF5A 3CZ8A 5U7SA 1NP0A 4XAGA 2WPGA 3ITGA 2A1YA 4YTSA 4O1CA 5C54A 2D69A 3B9AA 2A6LA 3MMWA 4FAMA 1AMYA 1V6WA 3VTRA 4DUVA 3FW6A 1KRAC 4G7EB 3U2EA 4R33A 2V30A 2D2OA 3WLIA 1UUOA 1XM3A 3GXDA 4NRRA 3BW2A 2XINA 3HGOA 3QLLA 2DZUA 1P4CA 3ABOA 3HQPA 4MWAD 2GK1B 3UZWA 4GUIA 3MC5A 3ALGA 3QMRA 4YLWA 2E25A 1PTGA 1Q6GA 3E0VA 2FPVA 3O15A 3C52A 3FHQA 4GCXA 1V6VA 2VFIA 3N13A 3QZEA 3G8EA 2W5FA 2YBVA 1KCXA 4MNJA 3AIEA 4GKTA 3MWAA 2HTMA 3M64A 4UR8A 3LBOA 1EC9A 3V0TA 3BW3A 4IUGA 1W91A 2IKIA 2G0WA 4E2OA 1LUCA 3E6EA 4Q4MA 4O8RA 1W5MA 1S39A 3RCYA 3UA3A 1UD4A 3WLRA 5LSMA 1W1YA 2XWEA 4C5ZA 3BICA 1FCBA 2FMOA 1HTIA 1GOQA 4RUBA 5CC3A 4QNEA 4H7CA 3TH6A 3NZPA 3VIPA 1ZUAX 3SCPA 3EWCA 1SSGA 4MADA 4AC1X 3LV6A 3SCVA 2VGBA 1W54A 1B9BA 1SR9A 3ABRA 3G1DA 1V6UA 3H21A 3MYOA 1A5UA 5GNYA 3G0XA 2XGBA 3RITA 5I3IA 3VABA 3C0JA 4IJRA 1NDVA 1ITUA 1R3RA 1PYFA 4MLRA 4WDWA 1ZBKA 3ZR5A 3W1TA 1ZAHA 3S42A 5AYYA 3GKAA 1KRBC 2QCDB 9CGTA 2Y4SA 2ZRVA 3WCZA 1D3CA 3UFYA 2ZZ4A 2UY2A 4AY1A 1JZ4A 3LCFA 2PLJA 3DFHA 1H1YA 2PDBA 3GNPA 3GU1A 3CZGA 3UJFA 4DEFA 1EC7A 3I3BA 4XZIA 3LXBA 3M4HA 3W4RA 1W2PA 4AIUA 3VD3A 5EU9A 1XG3A 4NNCA 1PTDA 3EAUA 1RD5A 4DM2A 3PZQA 4FA3A 2JF6A 3D3AA 4S3EA 1AW1A 4HNUA 3THDA 3Q2DA 4TMCA 4H9XA 4DB7A 3ZQ9A 1H5YA 3CH9A 4WKAA 3LS9A 4QEHA 4LANA 1EYEA 3VIFA 1KBLA 1REQB 1PE1A 1UH3A 2NX9A 2XIJA 1L8PA 2C18A 5JVLA 4LC8A 2QHAA 1UW9A 1IYXA 1HJXA 4JNZA 1GG1A 2FPTA 1R85A 2BLEA 1TWDA 1HP5A 3IK2A 3WQVA 2QCNA 3QPYA 3DKJA 1VBJA 2G96A 4UFJA 4P7NA 4A8LA 2CBUA 2FPYA 1GOXA 4LW7A 5D8ZA 4HPJA 4MNLA 4Y9NA 4L5ZA 5DELA 4E8CA 1OFBA 4IGHA 3LSBA 3QTGA 4MMWA 3D0CA 4HK5A 5CKSA 3MU7A 4IMAA 1A5SA 1AD1A 4PSRA 3ABQA 4UIOA 2JGYA 1PWMA 1SU5A 3UPWA 1S5NA 1HL8A 3T08A 3TC6A 4AZBA 3NG3A 4TV6A 3GXTA 3I3EA 4EWJA 4N7QA 3PPHA 4WY0F 1TPFA 4Q8OA 1ISXA 2NXHA 4HHMA 3CXOA 3O05A 2OYKA 1VH7A 2HVMA 1ZJHA 3OVPA 1CT5A 2QPXA 1PVNA 4ZVJA 4PSPA 3AZRA 2A3BA 3N2CA 3DEQA 1DQXA 4EXBA 2XM2A 4ZOCA 3BG5A 4AX6A 3SRKA 3NOYA 2YW4A 3GH7A 3VM5A 3ZT7A 1C90A 4XD3A 2A79A 4DJDA 3T6CA 3T0AA 2PWUA 3WNPA 5FKYA 1VFMA 2REQB 4KERA 4WKHA 4D6HA 3W22A 3KP0A 5DBUA 4R5EA 5I0DA 1AW5A 4J3WA 4X0NA 3JZEA 3KVMA 4D2JA 2WZIA 4UWMA 2E6AA 3WEMA 2OR2A 4YWIA 1PL9A 1K7EA 4I6KA 3SRDA 3WQDA 3UWUA 4Q8TA 4UZUA 1QBBA 4K68A 3II1A 2WHJA <