4HZ6A

Crystal structure of bglb
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
441
structure length
441
Chain Sequence
KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-glucosidase
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 176
structure length 441
sequence length 441
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz6A00
4JHOA 2EJ1A 6TAAA 1UR1A 2WMIA 4BF7A 4H8HA 1UG6A 2WVTA 1E43A 1HJQA 4CVWA 3IAQA 3AYSA 3AHYA 3WF0A 4UFLA 2WANA 5BXRA 5CPQA 4AEFA 1TVNA 4UTFA 3U57A 4PMQA 5F7UA 2C7FA 1JYVA 1PX3A 1UWUA 2XFRA 3D3AA 3ZSTA 1ISVA 2BHZA 2DT2A 2Y4SA 3E1F1 3VNZA 4HOZA 1XC6A 4OBSA 2JEQA 3EDJA 1ESWA 2CERA 2YA1A 1HN1A 2VMFA 4EK7A 3THCA 2WCAA 3EDEA 2IUZA 1HJSA 1OWQA 1WZAA 2VZVA 3APGA 1B3VA 3NYDA 1VFOA 2VNCA 2Y5EA 3KL5A 1ZJBA 3ZIZA 1KBBA 4AD2A 1WB0A 4PN2A 2W5FA 2VCCA 3ARZA 2WVVB 3GZAA 3AMDA 4GIAA 3WEOA 4JKLA 2BS9A 5A6MA 1HL8A 2ZUVA 4KMQA 4TTUA 5GQBA 1C3FA 2J7CA 4WJXA 4P7QA 4LQ1A 1PPIA 4FMVA 3MKKA 2ZUWA 2IXVA 4TVUA 1JNEA 5KZ6A 1OGSA 3SCNA 1BPLB 3VX1A 1MQQA 2WZIA 4UQBA 1C8YA 3AMCA 1I75A 3MUIA 1IV8A 4HZ7A 3WBAA 2D0HA 3AHTA 4EE9A 5IFTA 3WD4A 5C71A 1ISYA 4MAZA 3GYCA 1MYRA 4W5UA 4U2YA 3WQWA 2OWXA 2EO7A 1E1FA 5M3WA 1E9LA 1FH7A 1IZJA 1E6ZA 1AQ0A 3WNPA 2VI0A 1QBAA 3TTOA 4A4AA 3BCFA 4J3TA 1CLVA 1CXIA 5IHSA 3AZRA 1OGGA 1AVAA 3ARRA 1UUQA 1VB9A 1QNPA 3FNDA 1D3CA 4QFUA 1YQ2A 3CMGA 1BG9A 1CGWA 3MV01 3IAPA 1E3XA 3AS3A 5A2AA 2X05A 2OLHA 2F61A 4CGTA 5D9PA 4GQQA 2J25A 5CXPA 3AIUA 3DHUA 4B15A 5D8WA 4RE3A 3SCTA 1BGGA 3UETA 1HP4A 1LL4A 2VJXA 4W8LA 1CBGA 1HP5A 2TAAA 3PTQA 3MUY1 1NWRA 1VRXA 2A3AA 4KGJA 3T0BA 4UQAA 1MFUA 2J7DA 3FN9A 3GXFA 3WF4A 2PB1A 1J0KA 1MXDA 3PZMA 2A3BA 3OBAA 5IFPA 3CZEA 1TCMA 2NSXA 3CH9A 1E4IA 5A8MA 3AIEA 3NJ3A 2WZEA 1J0ZA 3FY1A 3WEMA 2D0GA 3CHEA 2ZICA 4ATWA 3AIWA 1JFXA 3HU7A 3W6LA 3B9EA 1GOWA 1H4PA 3RO8A 1WDSA 2G8ZA 4OJYA 1KXTA 1CTNA 4KH2A 5D4YA 4D6JA 5EMYA 1GW1A 4AMCA 7A3HA 1Q6GA 3AHZA 1VEPA 2VQTA 1QPKA 2FGZA 2V5DA 4XB3A 1J10A 1C90A 1VEMA 1GOQA 3KEHA 1XSJA 1XHGA 3CIVA 1ZU8A 3UG4A 4C7GA 2GVYA 4QCEA 3VGFA 2DSZA 2CIPA 2FHCA 3MANA 5D9OA 1H1NA 2X0YA 3BAIA 5A6LA 5FIPA 4IUGA 1WO2A 3K4DA 3W24A 1VFMA 3NUKA 1BYBA 5M03A 4MADA 3BCDA 2QV4A 3FAWA 3ZR6A 1AQHA 1CDGA 1C93A 4KWUA 1V3JA 1E6XM 3AJ7A 2WB5A 1GVYA 1G9HA 1UYQA 1C91A 3A6OA 4NI3A 2O9PA 3DYOA 5I3DA 1KFWA 3ARPA 4V28A 1XH1A 3S2CA 1LWHA 1E0VA 1W9VA 4WF7A 4Z2LA 1HVXA 4ACYA 4FK9A 3VU2A 3ARWA 4ATLA 1WDQA 3THDA 5A6AA 4AIEA 1VENA 4WKFA 4AEEA 2D0FA 4W93A 2VCAA 4CKQA 2VVNA 1XV8A 5CSUA 4FLOA 5BXPA 3WSUA 3AI0A 2BVYA 3T0DA 1QBBA 2CKRA 4LPCA 3BC9A 2ZUSA 3LPFA 4HMCA 4WSJA 5BRPA 1VFFA 3CBWA 3W4RA 4Q7NA 2J77A 3MO4A 4UQDA 4R27A 4BCEA 2BV9A 3AXXA 1ZL1A 2ZUUA 1TR1A 4Z2GA 2GK1A 2W4XA 2Y2WA 1Q4NX 3GM8A 3SEPA 3SCWA 1B0IA 1OT1A 5A1AA 5DT7A 4J3SA 5JBFA 1XD0A 2X2YA 4PTWA 1XRVA 1UA3A 4Q22A 3VILA 1C8QA 3RJXA 3VTRA 5JUVA 1BYAA 3O6AA 2E9LA 1HJWA 1QI2A 3TTYA 4AZBA 1R85A 4UFIA 4P7NA 1EH9A 2J74A 4J3XA 1X6NA 2PI6A 2XYLA 3QHNA 4UFJA 2VT0A 3WD3A 4QCFA 1I1WA 3LPGA 3AYRA 3BXWA 1QI4A 4CD8A 4ZFMA 5I79A 4WKHA 3RPMA 2YDQA 2VR5A 2OYKA 1XH0A 1HL9A 3UESA 2WHKA 3ZO9A 3WF1A 2B31A 4OOUA 4TXEA 1CGYA 4AWEA 1G94A 3WH9A 4Z2KA 1K6AA 2ZWYA 3WNLA 2BNJA 1Y7VA 3GH7A 1HXJA 3IJ8A 1EHAA 3PZIA 1UR4A 1DWJM 1V02A 2V3FA 2F2HA 4KRUA 5JIPA 3VD9A 3U7VA 2JIEA 1W9UA 4D6HA 2DQXA 3LPPA 2J79A 1X6LA 1GOOA 4UOQA 3SCQA 1W1PA 4ACZA 3NIYA 3DYPA 3FXYA 2VC9A 2WKGA 1MW1A 3ZT5A 1NWTA 3DC0A 2UY3A 2WHJA 3M7SA 1LG1A 1QNQA 1VAHA 4AY1A 1UD8A 3VIOA 3SURA 2VUYA 1HJXA 2BXZA 4PEEA 5I24A 2YDSA 2J62A 2Q8XA 3VD5A 2V3EA 3CHDA 1UHVA 4GXPA 3F5KA 2VRKA 1V6UA 1V3HA 1EOKA 1OSEA 2WBKA 2XM2A 4B3LA 2OWCA 1W2VA 3W29A 4AZCB 3N15A 1UA7A 1V03A 1UQZA 3VM5A 3T2QA 6CGTA 5GNYA 3OLIA 1BYDA 3CUJA 3PBGA 2PWDA 3T0AA 3MMDA 1KGWA 2EXOA 1R7OA 3OGRA 3NSMA 1NH6A 1PX8A 3KE0A 4H41A 4U33A 1JZ5A 1QVBA 1XCXA 4X0NA 2CESA 4GZIA 6A3HA 4X9YA 4D6IA 2EPOA 2WMHA 1VF8A 1G0CA 1TG7A 1E6QM 1JYWA 2ZXQA 4MNJA 4ZE5A 1LL6A 1QI5A 2CBUA 3ARUA 1BAGA 5A6SA 1TUXA 3VGBA 3N17A 4OBRA 2X8RA 4H04A 5D8ZA 2BY1A 1OIFA 2ZX6A 3AICA 4DM2A 1MQRA 2J8GA 4YHGA 2W62A 3U5YA 3RM4A 5A2CA 5I77A 1W91A 2CBVA 3WQ6A 3M6DA 4J27A 3ARQA 1FOBA 2GFTA 1WKYA 1KB3A 2UWFA 3TA9A 2VVSA 4AXNA 1MW3A 1NARA 3ZM8A 3UG3A 2XWEA 3BGAA 1KR1A 1LWJA 3WQ8A 2DEPA 2O9TA 2V3DA 1Q6EA 2WVVA 1CIUA 1ZBKA 1JAKA 3AMGA 3WH6A 1TA3B 1G01A 3LPOA 2ZUTA 4AD5A 3VIHA 2XGIA 3HN3A 2CBJA 1CXHA 4BQ4A 3WD1A 2WC4A 2VX4A 3L4WA 2ZWZA 1Q6FA 1DWAM 2DH2A 3SUTA 3VNYA 1WE5A 3AIRA 1WCGA 2YBTA 5KEZA 1CLXA 2JF6A 1Z32X 1CGXA 1JZ4A 4MB4A 4P7RA 1LJYA 3W82A 5I0DA 2CKSA 2ZIDA 5GPRA 4YPJA 3WKZA 2HISA 2YL9A 4F79A 4F8XA 4CUCA 2D23A 3WH5A 3F5LA 3JUGA 3WQ4A 4L4OA 1EIBA 2DDXA 4DWSB 2XFYA 5JBEA 1PIGA 3IANA 5EBAA 4U31A 2DIEA 2FH6A 4R5EA 3WDRA 3DYMA 2YL5A 3ECQA 4D71A 3W6MA 3PZUA 3WQ5A 3A47A 2WMJA 1A47A 1SYTA 2Z1SA 2NT1A 3WL1A 2WCGA 1XCWA 1L8NA 3TP4A 3BMWA 3N13A 1WDRA 4CN4A 3MMUA 4AD4A 1NOUA 2CITA 3OLDA 2V5CA 1DWFM 4H8UA 3VIJA 2FHBA 1H09A 2YDRA 4PMUA 2Y8KA 1JFHA 1KCLA 2GDVA 4WKAA 1E4NA 3I3EA 3ZT6A 4B16A 1SMDA 2XG9A 3L4XA 3GDBA 1Q6CA 3EMZA 2PC8A 2ESCA 3W0KA 1UKTA 1K9TA 1JDAA 5E6YA 4D6GA 4J3VA 4OKDA 3PZOA 3OG2A 5FOOA 2J75A 1JD7A 3VDAA 3W28A 4HU0A 1KQZA 1J18A 1QHOA 3QOMA 3WMCA 4QAWA 2W91A 4UFHA 1JXJA 3BAWA 3F4VA 5E9AA 2WMKA 4D6EA 4URIA 3PZVA 4J7RA 4PMRA 1P6WA 3ARYA 3VDCA 1WDPA 1BQCA 4Z2IA 3SCVA 2OSXA 3UG5A 3OZOA 3CHFA 4YHEA 1IZKA 4PMVA 1DWGM 3KZSA 2G41A 3CZKA 2OWWA 5DO8A 4MTVA 3SIMA 5CJ5A 4CU7A 2VRJA 4MJ2A 4CVUA 4QLKA 1Q6DA 4W89A 2D3NA 2GJXB 3VDBA 3MU7A 2J7EA 1US3A 1RP8A 2WMIB 1R87A 1WNOA 2VRQA 3B9DA 3RM8A 1C7SA 2X09A 5BYWA 2EPMX 4JKKA 3MSGA 4F9JA 2A3CA 2WM0A 3WDPP 5M5DA 2WAGA 3AMLA 4JFUA 1C7TA 3GBEA 1H2JA 4AD0A 1B9ZA 4GO9A 1QW8A 2J8FA 3WDJA 2QPSA 2DSWA 2WWDA 3AQUA 1EA9C 1ZS2A 4W7VA 1O6IA 3W38A 1J0YA 2UY4A 4KRTA 3PHAA 2WNWA 5LYRA 2A3HA 3VIGA 1HKIA 4GPNA 4M24A 3B9AA 3ARSA 4TVCA 4IPNB 5FL0A 2VCBA 5DT5A 3WY1A 1HKMA 1W1TA 2YLAA 3OB8A 3VGHA 2WLZA 5A3HA 2NW0A 2J7BA 1UH3A 5A8PA 2DPEA 1GZJA 1X1NA 3KWXA 1UOKA 4TX8A 1U2YA 3SUSA 1DWHM 3ZQ9A 5CGMA 3BH4A 1E6PA 1UWRA 1U30A 4BS0A 2PWFA 1UKPA 3AHXA 3POCA 1NOWA 2VX7A 3EDDA 1OB0A 1RPKA 4H7VA 2UY2A 1QW9A 3K8KA 5AYIA 1QHZA 3MMWA 1UR0A 4PMXA 1JXKA 4GZEA 5C70A 4JL2A 1JDDA 1OINA 2MANA 1BG4A 3U7BA 1FP9A 4TVDA 5A94A 2J4GA 1GQJA 3WUGA 3VIKA 1FFQA 4PUDA 3J7HA 3NSXA 2XIIA 4LX4A 4U3CA 4IISA 1OGBA 4A3YA 3QHOA 4U2ZA 1JF6A 4PUEA 4UR9A 4JIEA 1XD1A 4HA3A 3CUFA 1PZ2A 4AZ6A 1UR2A 2ZXDA 4PYSA 1G1YA 4MNMA 1UWTA 1R8LA 1H49A 4M82A 3RJYA 1DWIM 1K9FA 3SCRA 3NDZA 1E6SM 1EGZA 1AQMA 1VEOA 1JF5A 1O7AA 3PZGA 1ZBCA 4TX6A 3OGVA 4CD6A 4E8DA 1VIWA 2WWCA 4NZCA 2CXGA 4DWSD 4PCTA 1I1XA 4P7OA 1VJSA 1MVYA 3WEZA 2BFGA 3CMJA 1V3LA 4M29A 3S6TA 4OUEA 1E5JA 3WNMA 3WENA 1CECA 2O9OA 1H3GA 3MV11 4W88A 3W27A 1JYXA 2FGLA 1JYNA 2C0HA 2ZX7A 5HPCA 2Z1KA 1DP0A 3U5UA 1ISZA 4BQ3A 1MWOA 4MB1A 2V3GA 5DEZA 2ZUMA 3T2OA 1CGVA 1KXHA 1E15A 1BLIA 1ITXA 3SUWA 4PTXA 3PZ9A 1JD9A 1W32A 3FAXA 3ALFA 2WC3A 1NOFA 3BSGA 1E56A 3SCSA 4NF7A 1NP2A 2ZE0A 3VIPA 3ZJKA 1OM0A 3VIIA 2XVLA 1MFVA 1H11A 2VOTA 4UNIA 1BVNP 3L2LA 3ARVA 3WDHA 1J01A 2D20A 2OYLA 4CCCA 5A6BD 1J0HA 1GCYA 1R86A 3WBEA 2BY2A 5JIWA 2GSJA 1UKOA 1KWKA 2O92A 1RP9A 3GNPA 1EQPA 4DUVA 3EBVA 1SFSA 2YL6A 3QR3A 4M81A 3VGDA 5FKYA 2UY5A 3ZJ6A 1J0IA 1QI3A 4HOWA 3GXMA 1UD3A 1PAMA 4JHZA 2D2OA 1LQ0A 1B3ZA 2VL4A 2EQDA 1C92A 2D1ZA 1LL7A 3IJ9A 4JL1A 4PRWA 3WFLA 3OGSA 2WKLA 2VX5A 4OIFA 3AS1A 1HJVA 1K9EA 3L2MA 4P8VA 3ZR5A 1W3JA 2J7FA 1B30A 1NP0A 5AC4A 5E09A 1CWYA 2CEQA 5CZKA 3AIQA 9CGTA 1A3HA 4JFTA 1BHGA 2PBOA 4M56A 2ZX9A 3BAKA 1ZB5A 2X0HA 3DHPA 4OZOA 4AYSA 4XZWA 1HKJA 3O2LA 3GH5A 1E4LA 2WMGA 2YLLA 3K46A 2CNCA 3VOCA 4HMEA 4UFKA 1GUVA 2RGMA 2CETA 4PMZA 1CENA 2GK1B 4UOZA 5AY7A 5ABFB 5I6SA 3UCQA 3RMEA 3AOFA 2W92A 2VZTA 2CCRA 5CPTA 2VZUA 5BRQA 4W85A 3WH8A 3SCPA 3QOKA 2JFEX 4AW7A 2GJPA 2PWEA 1CPUA 4W84A 3TOPA 1XGZA 3IJ7A 4PMDA 3BSHA 1OD0A 2CHOA 4WLCA 1H41A 5E0FA 1LLOA 3GNOA 4JZ5A 1EO7A 3OZPA 5I23A 2VTFA 3T09A 1U33A 4AIOA 2D22A 2JF7A 1UH4A 2WPGA 3MSDA 4MNLA 3ZJ8A 3CLWA 4D6DA 3BLPX 3AZTA 1VFUA 3A4WA 1E40A 3WELA 5AYBA 4GO8A 3SUVA 2DSKA 3W53A 1UZ4A 1JI2A 3CUGA 2EPLX 2VZOA 1OIMA 3W37A 1HT6A 1NWUA 3RDKA 2J78A 2DT0A 3AIBA 1NM9A 4QLLA 4C7FA 2OSWA 5A95A 4PSPA 4XX6A 3NDYA 5EFFA 3PZNA 4UCFA 1D2KA 4U5IA 1VBUA 2XVGA 2EEXA 1PEZA 4LGXA 4EANA 1ISWA 4P8WA 2XTKA 2QHAA 3MUAA 4P8UA 2WC7A 2VURA 1WZMA 3HJEA 4ACZB 4ZEPA 5DMYA 2XM1A 4IM4A 1LF1A 3G6MA 4AISA 3CTTA 3L4VA 4CU6A 3VGGA 1E3ZA 3GTNA 4CD5A 4TUFA 4S3JA 2G3NA 2RGLA 4XV0A 2ZX5A 2YA0A 4HTYA 2Y24A 3RIKA 4E4PA 2PWGA 2VQUA 1V3KA 4PTMA 1TE1A 3POHA 5AC5A 3I3BA 3VVGA 3VD3A 3K4AA 2VX6A 4B9ZA 4J3WA 1SR0A 1HX0A 1VJZA 3WMSA 1PBGA 4L4PA 5E0CA 1GOMA 4B3KA 4JCMA 3CHCA 1ZBWA 4HPGA 1MW2A 3CZLA 2F8QA 3AIVA 2ZXBA 3BMVA 1BFNA 2HVMA 1UD2A 4UQEA 3W81A 2XVNA 5D9MA 1GPFA 1NWSA 1G5AA 1V3MA 1CGTA 1H0IA 3PTKA 2VR4A 5FL1A 4U5KA 1GQKA 3VMNA 4PMYA 1AMYA 4DUXA 2WMFA 3DECA 1UWSA 2E40A 3TONA 3AMKA 3ARTA 4AD3A 1M01A 4V2XA 2YIHA 3WF3A 1KR0A 3WDQA 8CGTA 2QPUA 2YOCA 2V38A 4J28A 4CD4A 1XYFA 1GJWA 3RM9A 5BWFA 1UKSA 4TTGA 3VMPA 1QNOA 1FP8A 2J47A 1UD5A 3RILA 4HPHA 3WL0A 2G3IA 4OOZA 4CCDA 8A3HA 5HDRA 1J0JA 1OCQA 4DWSC 2EPKX 5DFAA 1JZ7A 2IXUA 1EDGA 5ECUA 1WPCA 1S46A 4BA0A 2YA2A 3EYPA 1CXFA 1CEOA 2CHNA 3GXDA 4EAMA 4MB5A 5IDIA 3VMOA 5D9NA 1ITCA 2XJ7A 1M04A 1V0LA 2WBGA 4MDPA 3L4YA 1HJUA 1KWGA 1LG2A 4LYRA 2XUCA 2XPKA 5HXMA 3AHVA 1KQYA 3PZTA 4ML4A 1KBKA 2C8NA 3CO4A 4ATDA 4GZJA 4HOXA 5IXEA 4W7UA 5CSYA 3AFBA 1QOXA 2YJQA 1FHLA 1OT2A 4DUWA 1JZ3A 3CZJA 3ZMRA 2QMKA 1B2YA 5IHRA 1US2A 4Z2HA 1ODZA 1E70M 4S3KA 4X0VA 3NSNA 1QNRA 4GQRA 1J9YA 2BVDA 2ZUNA 5A8QA 1CGUA 3SCOA 3W26A 1M7XA 1E73M 1V6YA 5HOSA 2X1IA 3A4AA 5A6KA 4JFVA 3WNNA 1CXLA 4NRSA 4WIWA 3VM7A 1VBRA 4W8AA 3CUIA 4JAWA 2JE8A 2BVTA 3N9KA 3D5HA 3A3HA 3WDIA 1H0GA 1KGUA 1EQCA 1CXKA 1XYZA 3VUPA 1BTCA 4PBGA 4QLJA 1B90A 3L4ZA 5M17A 2E9MA 1JI1A 1GNXA 2ZXAA 1WZKA 2FHFA 4P8XA 2WLYA 1ZJAA 4PTVA 3PZQA 4HU8A 4MDOA 1B3XA 3EMCA 2DSVA 4RL3A 4PMNA 4GI6A 4AZIA 3K8MA 4HA4A 1EO5A 3OA5A 1B3YA 2GDUA 4PCSA 4D1JA 5A8OA 2AMGA 5I78A 1TZ7A 1GHRA 3VPLA 1QNSA 3IK2A 4LYQA 2WSPA 7CGTA 2WCSA 3KL3A 5CG0A 1KXQA 4D6FA 1UQYA 1JZ8A 3UERA 5FD0A 1PX4A 1V08A 4QP0A 1L0PA 3T08A 1OD8A 5LA0A 2G3MA 2YL8A 2WZHA 2QMJA 4U3AA 4H2CA 4XUYA 5E6ZA 1UH2A 2W66A 5CPSA 2WHMA 5BXTA 3A4XA 1B31A 3QHMA 4XZBA 2XSAA 3AXIA 1WAWA 3PN8A 1QI0A 1WZLA 1B1YA 1BGAA 1V6XA 1UR9A 2XGBA 1FH9A 3AROA 3WUEA 4NRRA 3WNKA 4D1IA 2J7GA 2BHUA 1UZ1A 1EDTA 2E8YA 4UOJA 5HBFA 2BY3A 3ZJ7A 1GJUA 2QLYA 2WHLA 3WUFA 1XSIA 2Y8VA 3K8LA 4JCLA 4W5ZA 2CYGA 3UR8A 1TVPA 2A3EA 4MB3A 4GKLA 2XSBA 3VD4A 1BVZA 3L4TA 2OSYA 3N12A 1ECEA 2W67A 3W25A 4F9DA 1MW0A 4N42A 1D7FA 4NSBA 4HZ8A 1RH9A 1XH2A 4ZE4A 5CLTA 1OBAA 4FLSA 4GI9A 3CUHA 3OIHA 2GJRA 2XIBA 3UR7A 4AZ7A 4RE4A 1JG9A 2WSKA 4CU8A 2WK2A 3AXHA 3L4UA 3B8SA 1M53A 1GQLA 3GNRA 1JZ6A 1FHDA 4ZENA 5BXSA 5I2UA 2W61A 4M80A 1ISXA 4TOQA 2XVPA 4K68A 4AD1A 3WFZA 4JFWA 4FF5A 2JEPA 1EDQA 3UEQA 4BQ5A 2XVKA 1RD6A 4AZHA 3WUBA 1CZ1A 1HKKA 3OLEA 4Z2JA 3MS8A 3VKKA 4Y7EA 3BAXA 3LMYA 1UR8A 1FA2A 2BY0A 3ARXA 4MNKA 3BAJA 1GHSA 2VZSA 3EDFA 3RCNA 1CXEA 1UD6A 2WXDM 4ZXLA 5A2BA 1JL8A 3T2PA 1FFRA 5A6JA 4HMDA 3GXIA 3M07A 5ABFA 4BQ2A 1KCKA 2DT1A 3SCUA 1E72M 1KGXA 4AZCA 2EPNA 3FW6A 1V0MA 4IPLA 2ZOXA 2NT0A 1JIBA 4LXFA 3HMCA 3VO0A 4F66A 1GQIA 1HF6A 1MXGA 3N1AA 5LA1A 2E8ZA 3WD0A 5EB8A 1UWQA 1PIFA 4ZXOA 4JKMA 1ZBVA 4W8BA 2WVSA 1K9DA 1EXPA 4UQ9A 4PSRA 4QDMA 2WW5A 1JDCA 4D6CA 4UZUA 1E1EA 1WP6A 2EBNA 3G6LA 3AS0A 1H5VA 4E2OA 3ALGA 1W9XA 4D72A 2JALA 5C8BB 3WNOA 3VDHA 1F4AA 3CZGA 5LA2A 4W86A 1JZ2A 1E0WA 2E3ZA 4FLRA 1FH8A 3GH4A 5HNNA 3MUZ1 3VINA 4C7DA 5A8NA 3WD2A 3EMQA 4M8UA 4BZYA 4WSKA 5CLWA 1KXVA 2BHYA 4LYPA 1PZ3A 1JAEA 2WVUA 4CCEA 1V0KA 4UZSA 2QF8A 4JFSA 2PWHA 1W9PA 4RE2A 5HPOA 2DT3A 3I3DA 1UKQA 4MAVA 1TMQA 5CQ1A 3WF2A 1GONA 1F4HA 2FH8A 2YBUA 4PMOA 3CZ8A 1E6RA 3O9NA 1TA3A 1SMAA 3ZOAA 4AZGA 1E4MM 4HP5A 4UQCA 1DEDA 1TFVA 5FCZA 1HNYA 2WYSA 1BSIA 1XSKA 1W2PA 2J7HA 4WK9A 5BCAA 5I5RA 2E4TA 1YHTA 4M1RA 5ABEA 2ZX8A 3AS2A 3PTMA 3K1DA 4CN1A 3NCOA 2DH3A 1W3KA 2XHYA 3N18A 1W3LA 1GORA 2JIWA 1B3WA 2D3LA 3BLKA 5E70A 2XFFA 5DF0A 2W63A 4GINA 3VGEA 4AIUA 1V6VA 2BXYA 4KGLA 1JNDA 1E55A 4AZ5A 3TTSA 3F5JA 1N82A 4V27A 4DWSA 3WMBA 3CGTA 3OLGA 1CYGA 3CPUA 4W87A 1IT0A 1V6WA 4HA1A 3M46A 4DM1A 5A69A 5BROA 3WH7A 1BF2A 1GOKA 4E8CA 1PJ9A 1E71M 4B9YA 2AOSA 2G4FA 2VO5A 1BYCA 2OYMA 1V3IA 4W7WA 4AC1X 3KL0A 5ABGA 1V02E 4UFMA 3N04A 1W3HA 4MJ4A 1C8XA 4A3HA 4GI8A 3SUUA 3VIMA 3WQVA 2DGAA 5GNXA 3VD7A 5CGTA 4YN5A 4CD7A 1UD4A 3FHQA 2E9BA 1W9DM 5GNZA 1QHPA 2GUYA 2PF0A 1R7AA 2CBIA 1W9BM 1GVIA 1UWIA 3QGVA 3FHAA 3ZSSA 1M03A 1ODUA 1HIZA 2G3JA 1E5NA 7TAAA 1EOMA 2FDMA 3ZT7A 3VX0A 3II1A 1EHNA 2DIJA 3WIJA 1E0XA 1GOIA 1CNVA 5TD4A 1E6NA 2DSUA 4CN6A 5ABHA 1HVQA 1JGIA 3BAYA 2CPUA 4H8VA 3VIFA 1V0NA 3AZSA 4N0RA 1DTUA 5A6BA 2E0PA 2YKKA 1W1YA 4MPKA 4J3UA 1DHKA 3GBDA 4HZ6A 4FLQA 2XWDA 1NQ6A 1J12A 2D24A 2O9RA 5JBDA 2AAAA 1J11A 3AISA 5EFDA 1MQPA 1W1VA 2GJXA 3EDKA 3TTQA 3WN6A 3N11A 4P7LA 2PBGA 4EKJA
chains in the Genus database with same CATH superfamily
4JHOA 4WGHA 3NL2A 2QGYA 3KVJA 3QGKC 3TN3A 1UG6A 1E43A 1HJQA 4CVWA 4PA8A 4FA3A 3C61A 3AYSA 3AHYA 4UFLA 3NO1A 3FIGA 3G0XA 3TJLA 4DVOA 2IS7A 3UVAA 4UTFA 2PD5A 4PMQA 1TV2A 1PX3A 3UXIA 2IQ0A 3E1F1 2CZEA 1XC6A 4C1LA 4CQCA 2B81A 4IQEA 3EDJA 4TV5A 5KMYA 3EOLA 2WV8A 3LBOA 2WCAA 3EDEA 1ITQA 1WZAA 5G1TA 2Z1BA 1B3VA 3AWNA 1FWEC 3TNOA 1IF2A 3IIOA 4UTMA 1Y8BA 4AD2A 4RZ4A 5MKGB 3SI9A 3AMDA 4S3FA 3FV9A 2BS9A 3C8NA 3MWAA 2ZUVA 1C3FA 2J7CA 1OX4B 4FMVA 4EWJA 3KTCA 1OGSA 1NFPA 4PEKA 1C8YA 2OCZA 1FWBC 4US5D 2FGBA 3AHTA 4EE9A 3WD4A 4FS9A 1TO3A 2P8BA 1UJPA 3NOEA 4ILSA 4QJ3B 3NZ1A 1LLZA 4UNKA 1FH7A 2DUXA 3T7VA 1HKWA 2VI0A 4DI8A 4AXKA 3M5ZA 2QW5A 2HJPA 1CXIA 2VHLA 3R89A 2VWSA 5IHSA 1EC7A 2D2JA 4NJKA 1XKJA 2YB4A 1VB9A 3OPSA 3HF3A 5ABTA 3FNDA 1YQ2A 1IE7C 1VIZA 3NZRA 3K2GA 5FF3A 3MV01 3IAPA 1E3XA 1Z9AA 3AS3A 3URBA 2OLHA 4BFAA 1S2UA 2J25A 5CXPA 5AC7A 3DHUA 4DJFC 5D8WA 5LNWA 1LL4A 4WZHA 2FJUB 4QQUA 4C60A 3S46A 2QGHA 2QIWA 4AVNA 3S9IA 3E6EA 4JY8A 3QW4B 4H9ZA 4KGJA 4F4RA 3FN9A 1LBMA 4RPPA 3N4EA 4KKXA 1XIFA 1XBVA 2A3BA 3APTA 3NZQA 1E4IA 2IMRA 2VFHA 1CB7B 1VS1A 1XLHA 5AZ0A 2ZICA 5HMDA 3AIWA 3HU7A 4EXQA 5GVJA 3EGJA 2G8ZA 2IQTA 1VEPA 2V5DA 2GUBA 2F9RA 4XB3A 4XZHA 1MUCA 2CWNA 1P48A 2IPWA 1W1B1 3KEHA 2QCMA 3C2VA 1XHGA 1ZU8A 3SJ3A 3MO7A 1LOQA 1XF0A 4XSLA 3LBCA 3NA8A 3GRIA 4QCEA 1UROA 2CIPA 1Y5WA 5FIPA 4IUGA 1VFMA 3NUKA 1YNYA 2ISDA 3ABRA 5M03A 3NOYA 3BCDA 3ZR6A 3TMQA 4KWUA 1V3JA 2ISWA 3CC1A 1TJ0A 4NI3A 1ZP3A 1BEUA 3TK7A 3DYOA 3HG4A 3EOSA 3MI2A 2Z27A 1I45A 3KBMA 3IVSA 1E0VA 1W9VA 4EPEC 4WF7A 5C7VA 2Y89A 5A6AA 2RDWA 3PAJA 4N9BA 4NY2A 4UNLA 3ZWSA 4ICNA 4S3AA 4KCTA 3NYZA 3IIPA 1P7TA 4NQ1A 2YR1A 4FLOA 1QUMA 1MSSA 5BXPA 3IWPA 4LPCA 4WSJA 5HAOA 1VFFA 1A5SA 1OHLA 4Q7NA 3MO4A 3FDGA 4BCEA 4CCZA 2BV9A 2V0TA 3QR0A 3STEA 1TR1A 1SO5A 4V33A 2Q01A 4P5UA 1ZENA 4GUJA 2YDAA 4ORMA 4IZGA 1G4EA 4RPQA 4CLMA 1IXNA 3C4UA 5EMJA 3M0HA 1XYLA 2CZ5A 2E9LA 2HZGA 1AJ0A 4I8DA 4AZBA 1R85A 4UFIA 5C9RA 1EH9A 2ZRZA 4H00A 2PI6A 1QMLA 2VT0A 3HPSA 4EVZA 3IJIA 3SY8A 1M3UA 3P74A 1QI4A 4CD8A 1RCOB 2AMXA 1XLEA 2JQXA 3FCPA 4GA8A 2A5HA 1OCBA 3ATYA 3T8LA 1X7FA 4BKNA 3ZO9A 4B5TA 5XIMA 1CGYA 2OOFA 1K6AA 2I9UA 1C8VA 1P5BA 3TTEA 1TRDA 3G77A 4HK6A 2CLMA 3RF9A 3MBDA 1ML1A 3PZIA 1DWJM 2R8WA 1V02A 1RJQA 4BF5A 1RQHA 5JIPA 3VD9A 5D02A 1W9UA 3KLLA 4GNKB 5CAHA 3SCQA 4ACZA 3DYPA 4RW5A 2VC9A 1FTXA 3NQFA 1MW1A 4ZBCA 2BTMA 3ZT5A 1XLIA 4GUFA 2ASHA 5D32A 2GZXA 3VIOA 5CZSA 2TSYA 3FA3A 2VUYA 4PEEA 2GSEA 2Q8XA 5KITA 4M1BA 4C6KA 1BF6A 2GPTA 1V3HA 4NZ1A 3W23A 2XM2A 1SZGA 4JQ2A 4HVXA 1XDMA 1UQZA 3VM5A 3T2QA 3BLIA 3OLIA 4ZB0A 2PWDA 3E0FA 2OGJA 3W1QA 3HQOA 4MHBA 3OGRA 3NSMA 3G3MA 4B3ZA 1NH6A 3KE0A 3G22A 2PDCA 2HE8A 4U33A 3DKJA 1UOZA 3LSBA 2PDMA 2OODA 2CLPA 4X9YA 1F3WA 3L12A 2WMHA 1E6QM 4OE7A 3F2DA 3PK7A 3EB2A 4QE4A 4MY1A 3URAA 3VOJA 4JNYA 4JS3A 2Y61A 5A6SA 3TAKA 2X8RA 2X1UA 5EMUA 4IIBA 1OIFA 4Q6JA 4Y90A 3CV7A 5A2CA 3RM4A 4S2BA 1M68A 3WQ6A 2H90A 3LXCA 3ARQA 2GFTA 1N55A 1VKFA 1XG4A 4X60A 4AUBA 1UC4A 4GMEA 3UG3A 3TQPA 1LWJA 4LAMA 2PDQA 2I5QA 4EAYA 1OYAA 4M6QA 3WH6A 1TA3B 4XVEA 3LPOA 3VOGA 1RPXA 3LHZA 1NY1A 3VIHA 3W83A 1F3EA 4IMEA 1CXHA 1A5NC 4BQ4A 1DV7A 3QVQA 1EWEA 3AXMA 3SUTA 3OG3A 3VNYA 3EA2A 3TW7A 3NDOA 1CLXA 1S3HA 1NJJA 1CGXA 2Q8LA 4CNUA 4DQWA 3TYAA 1HO1A 3KBSA 4EOUA 4ZO9A 1YBQA 4IF2A 3S4TA 4YPJA 2HISA 3CPGA 2YL9A 4PUNA 3LRKA 3F5LA 1THFD 3GE7A 3TN6A 3TCSA 1P6BA 2QNEA 3NNTA 1EIBA 3TW6A 2DDXA 3QMRA 1A49A 4DWSB 4DBWA 2XFYA 3R5EA 4PUKA 1PIGA 4KFOA 4DX3A 3DYMA 3ECQA 1EIXA 3QY7A 3W6MA 3WQ5A 3KRSA 1A47A 4QNWA 5HWJA 1ADOA 3V3WA 3M4HA 2WCGA 2ISSA 2NVAA 1L8NA 3T9PA 4CN4A 3MMUA 2Z29A 3KVMA 4PB4A 3OLDA 4QM1A 2V5CA 1DWFM 5G5IA 1DJQA 3N2CA 4PMUA 3CM4A 3PR2A 4WKAA 1NDYA 3VNDA 4O11A 2XG9A 3UW6A 3NR0A 3T4CA 3V5FA 4BWLC 1L6YA 3REQB 2ESCA 3W0KA 4PFMA 1XPYA 1JPHA 1JDAA 2PDPA 4OKDA 2ZZ7A 4S2CA 3W28A 1KKOA 3BE7A 4OWGA 3WMCA 3GDLA 3QMSA 7ENLA 1KBLA 3CQHA 5E9AA 2WMKA 3KXQA 3UD6A 4J7RA 4PMRA 3R12A 1I4NA 1WDPA 3LHVA 3GG8A 3USZA 2VGIA 4HJWA 3KZSA 3UP8A 2G41A 4L6HA 5CJ5A 4MTVA 4CU7A 3MKVA 1FX6A 3I7SA 3H12A 4ECLA 3BLFA 3MU7A 5BWAA 2G5WA 1Y0EA 2ZZ4A 4TIMA 2VRQA 3TYEA 5KTLA 1JEZA 4HN8A 2X09A 3TLLA 4BHYA 4TX9A 3WDPP 2Y7DA 5M5DA 3AMLA 2C14A 3LGGA 1C7TA 3GBEA 3DERA 4AD0A 4YTRA 3ANUA 4ERIA 4GO9A 5HMEA 2QPSA 4Q4KA 2NSOA 3A24A 3W38A 3IEBA 1J0YA 2QJGA 4KRTA 3PHAA 4IGHA 1XR2A 4YWIA 1XLFA 3CL7A 2A3HA 1HKIA 4GPNA 4XUGA 4Z0SA 4IPNB 3QTPA 3QH2A 5DLCA 5FL0A 3N2XA 5DT5A 4YIWA 3VK5A 3FA4A 3VGHA 4S39A 3CK5A 1VR6A 1O5RA 3P5YA 1R2SA 2XH4A 3KWXA 3TQVA 1UOKA 5KZEA 4TX8A 3SUSA 3S2MA 2VYOA 2P50A 3HQPA 2E6DA 5CGMA 1UWRA 1S39A 1NVMA 1EJVC 3R4IA 3C2YA 1GYNA 1R9ZA 2DQWA 3NO5A 2HXTA 4XO7A 3OYXA 3EDDA 4H7VA 3BURA 2UY2A 4KWVA 1UR0A 4XZMX 4JNMA 4GZEA 1IQ8A 4LUIA 4DBSA 3PWAA 2XIQA 3UWWA 3NPWA 2ON3A 3PBUA 5JH2A 3J7HA 4A3YA 3TN5A 1KCXA 1LT8A 4JIEA 2YCEA 3O06A 3CT7A 5LKYA 1XD1A 1PZ2A 1EEPA 4Q8OA 1KD0A 3F1QA 5LNVA 1H49A 4HJFA 3SCRA 1EJRC 1UC5A 4OT7A 4O1AA 1BTMA 4ZGYA 4AF0A 1R9YA 1EGZA 4AAJA 3VZYA 2VDGA 1JF5A 2YSWA 3UWEA 1HQTA 3NQDA 1D8WA 4F0HA 3B0UX 1VIWA 2WWCA 4RXGA 1I1XA 3FLUA 2FTPA 2NX1A 1V3LA 2PCEA 4M29A 1VPYA 4JTKA 4FP1A 4KF1A 4JIIX 4JGDA 1CECA 5K2ZA 3JR2A 1MEWA 3CXOA 1JYNA 2Z1KA 2DZBA 1KNWA 1DP0A 2PC4A 1ISZA 3FYPA 1MWOA 4IIHA 3JU2A 4IMGA 4H9YA 3S47A 2ZUMA 3VXGA 2DV0A 4AMAA 1OYCA 4N2YA 4Q8VA 2NQLA 1KTNA 3QC3A 1E15A 3SY1A 3I68A 1Z89A 4PTXA 4DO4A 4DELA 2VR2A 4GNJA 2BXVA 1YX1A 3EOEA 1RCXB 1NOFA 1TPWA 1E56A 1NP2A 3KRUA 3VIPA 1NSJA 3VIIA 4H83A 2QV5A 1H11A 4NXSA 3U48A 5MF5A 4C65A 2C16A 3ARVA 4KPLA 3WDHA 1UPPA 4RV8A 4CCCA 3WBEA 4QEEA 3OVPA 5BRBA 3R94A 3L0NA 3BV7A 1E1CB 4DUVA 1SFSA 3LERA 2DZAA 2UY5A 1J0IA 2UBPC 1B3ZA 1LQ0A 3PPGA 2YFNA 1LL7A 3P93A 4JL1A 2NVDA 2DW7A 4L6OA 3OGSA 2KAUC 4G7FA 4JIQA 3OHIA 3ZR5A 1EEXA 3CAVA 1JCNA 1P7TB 3KOXA 3AIQA 3QSTA 4A2SA 2HS6A 2I56A 4JFTA 3UFYA 3OVQA 4BR1A 1ZB5A 4B5UA 3DHPA 2GGEA 1OZQA 2BX7A 3M7WA 2QR6A 4O4WA 2YLLA 1GVSA 3VOCA 3GG0A 4UFKA 1XBZA 3E49A 3W7DA 4Q6XA 4DB7A 3UZ5A 4PFHA 1Q85A 1TV4A 2NXHA 3CV2A 3SECA 4HNUA 4FR1A 1LBFA 3LNPA 3AOFA 4MZYA 1TX0A 2CCRA 1V6TA 3TQKA 3FYOA 5CPTA 4K6AA 1V7YA 3KCOA 4AW7A 4HU4A 1CPUA 6XIMA 4B5NA 3E5PA 1ITUA 4MFEA 4WLCA 2PFHA 5E0FA 2PLCA 3EWUA 2L5HA 4IGMA 4BEUA 4AIOA 2D22A 3SN1A 1IWAA 2NQHA 3IVUA 3DN5A 3B8WA 2GGIA 1ADSA 2QJNA 1SJDA 3R8GA 5H8MA 1O5QA 1GVEA 3SUVA 3B03A 2VOMA 1JI2A 3BQ6A 1MXSA 4IWWA 1OIMA 2GSHA 1LT7A 1NWUA 3AIBA 1M41A 4C7FA 2OSWA 4PSPA 3WJWA 4TMCA 2YZRA 3RRAA 5EFFA 4UCFA 1XYAA 2ZYFA 1U5JA 2Q02A 4J9JA 1I2OA 1VBUA 2XVGA 2EEXA 4JN7A 1ISWA 4P8WA 3OVRA 1T96A 1W6TA 3MUAA 2DW6A 2VURA 3EKGA 4ACZB 4FAMA 4NJGA 1AL8A 1LF1A 4AISA 4FNSA 3TSMA 3GTNA 4TUFA 2OT1A 4S3JA 3SADA 4Z17A 2ZX5A 2YA0A 3LUTA 3HJZA 3H22A 4TV6A 5CKSA 4MY8A 2YXGA 2VQUA 3STFA 3TFCA 1QW7A 1F8MA 4D9PA 3B9NA 1W56A 3RN6A 4B9ZA 3QF0A 5DY2A 3WMSA 2E7FA 1QAPA 3FJLA 4JCMA 4I5RA 1U5HA 2F8QA 3PB2A 3AIVA 4ZO8A 3TAOA 1FKWA 1X1ZA 3H24A 1OF6A 3SRKA 1G4TA 1IEWA 2HS8A 2XVNA 1NWSA 3EAUA 1G5AA 4H9XA 1EL3A 4Q4OA 3FKKA 5KETA 4QG8A 4DUXA 4M3PA 3EEGA 2E40A 3TONA 4XBKA 3C2OA 2V82A 4KERA 2YIHA 3H8AA 3WF3A 2YOCA 1Q6QA 3WX7A 3P67A 4GJ1A 4QE5A 3IGSA 1J93A 1B5TA 4O1FA 1K8CA 4M6PA 3WL0A 2G3IA 1M7PA 4AY8A 4DWSC 4RK8A 2EPKX 4JTTA 2AQOA 2IXUA 3QW3A 4BA0A 1OFBA 4OUIA 3THAA 2PURA 4R33A 1CEOA 3QQ1A 1W5PA 5IDIA 2CLIA 4O12A 4JTAA 2RJHA 3HV9A 3VCRA 3THQA 1LG2A 2XPKA 1KQYA 1F3TA 1KBKA 1GVOA 5DRIA 4ATDA 4GRSA 2BBFA 3FX4A 2YJQA 1FHLA 4RZ5A 1PVNA 4DUWA 1SGJA 3P60A 1B2YA 1US2A 1FWNA 2F6UA 5DBTA 4S3KA 4LU0A 1P1MA 4YCPA 1W3IA 1J9YA 2BVDA 1H61A 3KVLA 1V6YA 3ZVHA 2X1IA 4UUIA 1YBQB 3WNNA 1CXLA 4NRSA 1PE1A 2YCJA 1VBRA 5F1UA 3S5NA 1ZLPA 3CUIA 4JAWA 4NASA 3CAQA 5B7YA 3WDIA 1CXKA 6TIMA 1A3XA 1U1JA 4QLJA 2BMBA 3L4ZA 5M17A 3W1MA 4L4MA 5DCDA 4NZJA 4JTCA 4C6CA 2ZXAA 4UC5A 1WZKA 1TB3A 4P8XA 2WLYA 1QT1A 3VI2A 3G1YA 3N2MA 4ORIA 3QQWA 4HU8A 4NYUA 3P7YA 4R7OA 3SN4A 2ZTJA 2XSXA 2PSNA 5DRCA 1S2CA 1ZNNA 3DBNA 1QNSA 3IK2A 4IP4A 4LS0A 2XZ7A 4XD5A 1RQEA 4GGHA 4RW3A 5C2CA 3KL3A 4A8NA 1PDYA 1Q6OA 6ALDA 2GQ8A 4O1DA 1V08A 2NWRA 1L0PA 3N19B 1QNVA 2PLJA 2Z25A 5H6HA 2XH0A 3LG3A 2X42A 4DYEA 5BXTA 2Y70A 1PSCA 3TEVA 1VGAA 1QI0A 3FEMA 3QQ0A 3YPIA 2QCGA 1BXNA 1SQ7A 4Y9AA 3TVAA 3S9YA 2Y85A 4NRRA 2Z2UA 3H4WA 4S1FA 3WNKA 4UR8A 2GYIA 1YDVA 1RBAA 1M7OA 4N6FA 3WUFA 3G1DA 5DELA 4Q7IA 2OOGA 3UY7A 1A50A 2Y8VA 4JCLA 3CH0A 3WLNA 4GKLA 1BVZA 2OSYA 4XVDA 4NSBA 1DORA 3C3UA 1XH2A 2IPJA 1BWLA 1AJZA 4FLSA 5J5RA 3QEZA 3CUHA 4DBUA 2WSKA 4CU8A 3L4UA 5FAJA 1XLJA 4LRTA 1JZ6A 3M9YA 2W61A 4M80A 4K68A 2I7GA 2WSYA 4AD1A 4MZ1A 1L2UA 3P8IA 1S5MA 4JFWA 1TJ2A 2PDFA 4HBKA 3B0PA 2PDJA 4BQ5A 4F0SA 4R53A 2XVKA 4AZHA 2IPFA 1OQFA 2C1GA 3OLEA 1QTWA 3EWWA 1EX1A 3GHUA 3VKKA 1Q8AA 4IX0A 3BAXA 1UR8A 1X1OA 2AQVA 3IARA 4ES4A 1KV8A 4GH1A 3EWBX 4OFCA 1CXEA 1KRBC 4ADUA 3M07A 2FTWA 4BQ2A 4E5TA 2J66A 3WLHA 4X2RA 3RLUA 1QK0A 3M0XA 3PM6A 4AZCA 3FW6A 5GJNA 4IPLA 3LM7A 5I06A 1JIBA 3Q58A 1VBJA 4MUPA 5CPOA 1VLIA 4F66A 1GQIA 1MXGA 5TIMA 1B57A 5LA1A 3QMTA 4ZOAA 1A0CA 5EB8A 1RBOB 4FHAA 1XRFA 4YMZA 4W8BA 1TKKA 4GY0A 2WVSA 1K9DA 1EXPA 4RV3A 4B91A 4PSRA 2CLEA 2BODX 4AF0B 3UCCA 4IQJA 4O57A 3W7LA 3ALGA 5ECVA 4DO6A 2AQWA 3AO0A 3T0CA 1F74A 5AHEA 3TIMA 4LB4A 3CZGA 3IVTA 4KS0A 1XISA 2G96A 2QVNA 3MUZ1 3WJXA 4C7DA 1QPOA 3WD2A 5A8NA 3EB3A 4FNPA 2ZC8A 1PYMA 2I17A 5J5DA 4XKMA 2WVUA 1J96A 3N2TA 1W5OA 1VPQA 3I3DA 1PO9A 2RKXA 3WF2A 4OQVA 2XZ9A 4PMOA 1HUVA 4QR6A 4KFNA 4ZQOA 1FCUA 4GNVA 3O6DA 1TFVA 1JRCA 5PTDA 2YW3A 1BSIA 1W2PA 1XX1A 1Z41A 1TPDA 2FVMA 4Y9NA 5C9ZA 1YHTA 2AKZA 2CZVA 4M1RA 4QROA 3ZS4A 4F0RA 3WQEA 2ZRXA 3K1DA 3JW7A 3LGEA 1MEHA 1GORA 1XLDA 3ZXWA 4UMBA 2CC0A 3N9RA 4RJEA 4GINA 3P3BA 3VGEA 2BXYA 2R1PA 3CAWA 3MA8A 4DZHA 3F5JA 1N82A 3S2NA 5HQEA 4V27A 4JOMA 3QM3A 3WMBA 4AHOA 3CPUA 1V6WA 3T0TA 1WBJA 3M46A 4DJED 1SSGA 3U0HA 2Z4GA 4RCXA 4R85A 3OZYA 2AOSA 2G4FA 1BYCA 1I8JA 3W7HA 4W7WA 4AC1X 3PSWA 4K8EA 1GWJA 2VENA 1V02E 4I8YA 4TMBA 3N04A 2Y7FA 1F3XA 4MJ4A 1C8XA 4M51A 4I7UA 3WQVA 4LH8A 1XDLA 2O4MA 1QPRA 4LVBA 2GUYA 4PCFA 1RZMA 2CBIA 4L80A 1VCGA 1W9BM 3GX9A 3UGVA 1M03A 2HVOA 4K1GA 4HSOA 1P1XA 4PTDA 3N2OA 3II1A 2DIJA 1CNVA 3QZAA 4R9OA 3M6YA 1WXJA 2A7NA 3WLSA 1IEVA 4H8VA 3VIFA 1FWGC 1T7LA 3AZSA 4GX8A 4KQNA 1EKOA 4Y8EA 1TPB1 4XAZA 3GBDA 3L0GA 2QXWA 3TROA 1MNSA 1UUMA 2AAAA 1J11A 3SW6A 3NPXA 3WBWA 1W1VA 2GJXA 3EDKA 4B4HA 1QJWA 4H8HA 1EZWA 2WVTA 3CV6A 1F6YA 1BRLB 3WJZA 2WNNA 3TKFA 3WQOA 1BKSA 3ID7A 4LANA 3HIJA 3W7OA 2WANA 3RRXA 5IDZA 5BXRA 4AEFA 3DFYA 1UWUA 3D3AA 3ZSTA 3QKZA 2BHZA 4DLMA 2Y4SA 4UR7A 1C29A 4L56A 3V5CA 2Z26A 5M2FX 4UTJA 2C0AA 4UTLA 4OBSA 1PHWA 3URNA 2VMFA 3THCA 1HJSA 1R46A 2VZVA 2QDDA 1W8GA 3SJNA 3EWCA 2VP8A 3BG3A 1S1RA 2VNCA 3KL5A 3PPFA 2FZNA 2W5FA 3UGRA 3UR5A 2VCCA 3NQVA 2E1DA 4I5UA 3WEOA 5A6MA 3W1RA 3VA8A 4ZFCA 2GJLA 1EJ7L 4NG3A 4Q8WA 4M6VA 4J35A 3MKKA 4O54A 4MWAD 1A0DA 4TVUA 1C9WA 1JNEA 4LUTA 4R34A 3SCNA 1BPLB 1K7EA 3AMCA 3ZR4A 3W6YA 1I75A 3MUIA 1IV8A 4H1ZA 4YL2A 2G0WA 2Z24A 2PU1A 4XBSA 2B7PA 5C71A 3BOLA 4CNTA 3GYCA 1MYRA 4QDPA 2P76A 3ITVA 5EPDA 2YFOA 1GOXA 2NQ5A 1O60A 2PDNA 2J8TA 5M3WA 1LCOA 4XD3A 1E9LA 1IZJA 1AQ0A 2VEGA 3HG5A 4KIEA 3TTOA 4LVAA 3AZRA 3WK0A 1AVAA 1S5VA 3ARRA 4LF2A 1UUQA 2R6OA 3DFHA 2GVEA 4GD0A 1BG9A 1V77A 3HG3A 2F61A 2RHGA 4A6GA 4GQQA 3DFTA 1KLYA 1Y65A 2BGQA 3N29A 3N6HA 4B15A 3EX3A 1PV8A 2PP3A 3UETA 4W8LA 3ICJA 2QCCA 3BPWA 3ITTA 5CEWA 4O17A 2TAAA 1EJTC 3H7VA 4H9MA 4MLJA 3TJIA 2WJZA 4LCRA 2O7SA 4UQAA 5U7SA 1MFUA 3GXFA 1I2PA 1D3HA 3SSZA 3TYZA 1J0KA 1QCWA 3HPFA 4HT3A 1XLBA 3OBAA 4HNNA 1TCMA 3CH9A 3M16A 5A8MA 3UWZA 2KX9A 3NJ3A 4GISA 1UW9A 3DEQA 2A0NA 2D0GA 3WEMA 3H4GA 2QUTA 2H9AA 2FLIA 3RO8A 1H4PA 3GFXA 4FXJA 2Z1WA 3BW3A 1YPXA 1CTNA 5D4YA 5I02A 5EMYA 1M1BA 2Y6ZA 4B92A 4RZBA 7A3HA 3DX5A 2C1IA 3AHZA 1QPKA 1T5AA 2FGZA 5D03A 1RY8A 1GOQA 4NJHA 1NAL1 1H1ZA 5FJOA 2V5JA 3CIVA 3ZVHB 4WDXA 3UG4A 3TWBA 3P6LA 3D0CA 2G3FA 1PTAA 4WEVX 3VNLA 3BANA 4Q8MA 3W71A 3TUUA 1H1NA 2X30A 1WO2A 3K4DA 3W24A 4GBUA 2ZFAA 4MIMA 3OU8A 1BYBA 3UJRA 2QV4A 3FAWA 4RDYA 1CDGA 4DJDA 3AJ7A 2WB5A 4X61A 2DVTA 1EJUC 3HZ3A 1UYQA 3RPTA 3V36A 3A6OA 2O9PA 4L6DA 5I3DA 4V28A 3U3HA 3S2CA 1LWHA 1Z3NA 1GKPA 2PUZA 4GJIA 5HK4A 4ATLA 3LA4A 1WDQA 1VENA 3LHYA 4WKFA 4AEEA 5HMFA 4FZIA 4W93A 1M9HA 4CKQA 3R79A 2HXUA 1K8YA 3MI6A 5CBIA 3LX9A 2WM1A 5CBJA 1ENUA 3R13A 1IIHA 3AI0A 3WSUA 4PCPA 2BVYA 2CKRA 1XIMA 4NUWA 3LPFA 2ZUSA 3PULA 1BXBA 6XIAA 4HMCA 4DBDA 3KLKA 3CBWA 3W4RA 2VC5A 4IJCA 5CZ0A 2ZUUA 2I14A 2PZNA 5XIAA 2GK1A 1VH7A 1VD6A 5E1QA 1Q4NX 5H8PA 1L9WA 1B0IA 2BOEX 1OT1A 1UBSA 4KEMA 3B8IA 5DT7A 4J3SA 4XAPA 4WHBA 2X2YA 1XQKA 4LS1A 1KRAC 4QJ1A 4Z1DA 3TSBA 3ABZA 1Q8JA 1D8CA 3QY8A 3VTRA 5JUVA 3O6AA 3WLRA 1I60A 3LHTA 4W4QA 5I3GA 3NL3A 5J8LA 4RZ6A 4J3XA 5BZAA 1X6NA 4K37A 3QHNA 3ENLA 4QCFA 1I1WA 3LPGA 4HNTA 4ZFMA 2OT0A 4H9TA 3RPMA 2YDQA 1MNZA 1KLZA 3F4CA 5C9WA 2I9EA 1G6CA 3DG3A 1MUMA 1XLKA 3WH9A 2ZWYA 2J6VA 1OF8A 1OG6A 1P6CA 5CPNA 3GU2A 3GH7A 2HVNA 3TC6A 1EHAA 4POCA 2PDWA 1HW6A 1SU5A 4INFA 2F2HA 3B0VC 4KRUA 1KM5A 2JIEA 4C6FA 4WRHA 2J79A 4DXVA 3FJ4A 1QRQA 3R0UA 2PTWA 3ZLFA 5CSRA 3GSMA 4NAEA 2WKGA 3XIMA 3I4KA 4YXGA 1JUKA 1QPNA 1NWTA 1VBGA 2UY3A 3M7SA 3UYCA 1LG1A 3N73A 1VAHA 4AY1A 4GFSA 5HUPA 1ZP4A 2BXZA 4JPGA 1UZDA 2J62A 2VC7A 3B40A 3VD5A 2V3EA 3A3XA 1BD0A 2WPBA 4GXPA 3F5KA 5KZDA 1V6UA 1OSEA 4ZB5A 4IQDA 4B3LA 2OWCA 3N34A 3E38A 4AZCB 4IXXA 4JY9A 6CGTA 3PBGA 1BYDA 3CUJA 2NUWA 4YLWA 5IOBA 3T0AA 5T26A 1PX8A 2IKGA 4I5XA 4JDYA 2CLFA 1QVBA 4XD4A 1J6OA 5AYXA 2GVGA 3T1GA 4KWSA 1JCXA 1US0A 4QBXA 2EPOA 2WKJA 3MPGA 1UJQA 1G0CA 1JYWA 2W27A 4ZE5A 1LL6A 2GQ3A 4G1NA 1GEQA 2CBUA 3ARUA 7XIMA 4HYRA 4I9AA 3GR7A 3TE9A 3VGBA 4OBRA 3VE7A 3MW7A 4ROQA 4QRNA 4A3QA 1FXPA 5EBUA 1V79A 2ZX6A 3EPOA 1YRRA 1T6MA 1MQRA 2W62A 1JPKA 5FJUA 1S5WA 5FJTA 3HQNA 4PR4A 1WKYA 1KB3A 3P2VA 5BU6A 4Z0JA 3VKAA 4YTUA 3ZM8A 1FUYA 3SGZA 3LV6A 2DEPA 1K4GA 1OX4A 5IM51 5AOUA 1I2NA 1R9XA 2PDGA 2XGIA 3HN3A 1KRCC 2WC4A 2VX4A 3L4WA 1IIGA 1NEYA 1WCGA 5KEZA 2DU2A 5LNRA 1JZ4A 4P7RA 3P14A 3F2CA 4IL2A 5I0DA 2ZIDA 3KX6A 3WKZA 2X0SA 3WH5A 1OX5A 1KTCA 2PDYA 1ELSA 1G7UA 1LLWA 2CLKA 3JUGA 1FDYA 4L4OA 2DZVA 5JBEA 4LV4A 3IANA 4FOUA 4U31A 1YIXA 1DE5A 2FH6A 3GAYA 4R5EA 5C2GA 4WXYA 2YL5A 3S5SA 3AU2A 2E5CA 1OFDA 1RCQA 3C0SA 3GC4A 3A47A 4UIOA 2GUUA 3C5QA 4O1CA 1VHNA 3BMXA 3TP4A 1QU4A 3V18A 1W5MA 1Q66A 2F7FA 1R47A 4H8UA 2VFGA 1OFRA 1K8ZA 2HNEA 1H09A 2YDRA 3S6DA 4NVTA 1Q3NA 1JFHA 3LY0A 3ZT6A 3DHDA 2GGGA 4B16A 3L4XA 3A23A 3GDBA 2J9XA 1Q6CA 3EMZA 1XLGA 2FIQA 4C90A 4WDTA 2PC8A 4AIBA 3M43A 1WDWA 3PZOA 3OG2A 2J75A 1JD7A 1K7FA 1IEXA 3PPHA 2JBMA 5G4HC 1L6SA 1JXJA 4AQLA 2SFPA 1RD5A 4D6EA 1TIMA 2GQ9A 3M0IA 4LEQA 3C56A 3UZZA 2PLMA 5T9CE 3SCVA 4N02A 2OSXA 3ABSA 4BI6A 3UG5A 4YHEA 1F76A 3CZKA 5DO8A 2VD8A 2VRJA 4CVUA 4W89A 3B05A 2D3NA 2GJXB 5AHLA 4WJEA 1VFTA 2J7EA 2H3DA 1WNOA 1W3TA 2XFWA 4DZ5A 1PIIA 5BYWA 3C0JA 5C9XA 1R3WA 4K36A 1H7RA 2ACQA 4C6EA 4O19A 1P0DA 4GVGA 1EA9C 4W7VA 1O6IA 3MUCA 3LU2A 2ZRWA 3RK8A 4AWTA 5LYRA 3CYJA 3D3FA 4M24A 2FPYA 3VOHA 2G4JA 3GDRA 2VCBA 1HKMA 1W1TA 4FX7A 3T6CA 2J7BA 1KBIA 3W07A 4E2BA 1Q5MA 3I7RA 3MCNA 3G3DA 1XQLA 3M44A 4BY3A 1U2YA 4KEZA 2QULA 4JTUA 3BH4A 3ONBA 4I6KA 4BS0A 1UKPA 1Q7ZA 3POCA 4ROPA 1O5XA 4UTWA 2VX7A 3RR4A 4NNAA 1IT7A 4JYEA 2E28A 1OFOA 4LUTB 4PGLA 5CZTA 4DYJA 2E25A 4JL2A 1JDDA 3U7BA 4DHGA 1U22A 2X41A 5A94A 1XINA 3WUGA 2BOFX 3OZMA 3W7QA 1EF3A 1FFQA 4E0CA 3GXNA 3NSXA 1Q7QA 4HHHA 4LX4A 4BEQA 4GYKA 4U3CA 5DMMA 4PUEA 2GWGA 4HA3A 3CUFA 2C3ZA 4AZ6A 1UR2A 1RVGA 3UG8A 3OP2A 4MY9A 3EX4A 1UWTA 1R8LA 3OO2A 2ACUA 4M82A 4KFPA 5AHMA 3RJYA 3KS5A 3I4EA 2V6AA 3R2GA 3T8QA 2PWUA 4JTEA 1K9FA 2GWNA 1E6SM 2PODA 1VLWA 1VEOA 1V93A 3S9ZA 1ZBCA 4FNTA 2JGYA 1SJBA 4IIEA 1JVNA 4Y8FA 3A5VA 1ONWA 1NDWA 2CXGA 1VJSA 3WEZA 4GHRA 1YDNA 3IJ6A 3WENA 2FZMA 3CNYA 5G1MA 4I7VA 1AK5A 4W88A 4US5A 1JYXA 2FGLA 1Q65A 2ZX7A 2IKIA 1TWWA 4AWSA 1TJRA 1X38A 4BQ3A 2V3GA 1OX6A 3KAOA 5CGQA 4Y9MA 2H9AB 1SW7A 3FOKA 5K4XA 1TUFA 2P3ZA 5F1VA 4H6EA 1UIOA 3FAXA 3DZ1A 4GVIA 4WXZA 1XWYA 4NF7A 3DAQA 2XIOA 3ATZA 2XVLA 4HNOA 1H51A 1MFVA 2VOTA 1OZMA 3ME3A 1OEPA 1LRTA 5LIWX 4UNIA 3N6JA 3L2LA 2ZDRA 4XO6A 1VPXA 4OECA 3L5AA 5A6BD 3CU2A 1GCYA 2BY2A 3G1XA 2FKPA 5JIWA 2O92A 4MJMA 4N6EA 1EQPA 3EBVA 1AW2A 4ZQPA 3CWOX 4NAFA 5FKYA 3GLCA 1DTNA 1KV5A 4DXKA 2VDHA 2J13A 4GQ0A 3UU0A 1UD3A 4JHZA 2D2OA 3MP3A 1VFLA 3S1VA 2VL4A 2FFIA 1RQBA 1IXPA 4XAFA 3IJ9A 4PRWA 1GYLA 3WFLA 6ENLA 3NQGA 4FEZA 1JULA 3OYZA 2INFA 3AC0A 1RSCA 1CW2A 4Z1CA 1K9EA 3O0FA 3L2MA 3V1PA 3ABQA 1I9CB 4C6LA 1OY0A 5HR7A 4K38A 2DUZA 3S1UA 2CEQA 4KT2A 1T40A 2PLKA 2ALDA 2ABAA 4HSHA 3VNMA 1G7VA 1K7XA 9CGTA 3W7NA 2HWGA 3P80A 2ZX9A 4Q33A 3BAKA 2VEFA 4AYSA 4XZWA 5FSEC 2ALRA 3O2LA 2CW6A 3K46A 4HMEA 1FHVA 2RGMA 2V81A 1CENA 2GK1B 4C6DA 5I6SA 1RK5A 1PWLA 1XYCA 3UCQA 1DJWA 3NQ7A 3ITYA 2GOKA 4E3VA 4FNUA 3WBXA 3HGOA 3U6WA 5BRQA 3WH8A 1NF0A 4Q8UA 4LUJA 3O16A 4W84A 1FY6A 3TOPA 4HNVA 3EX6A 4PMDA 1ME7A 1OD0A 4LAOA 3W7IA 2CHOA 1T0OA 4JZ5A 5I23A 2V9DA 3L0KA 2FMOA 2ZZ1A 4HIBA 2WPGA 3ZJ8A 2NVCA 4RE0A 3BARA 1X6UA 1YKWA 4PMJA 4D6DA 1EB3A 4QITA 2OPJA 4KRZA 4IICA 1N7KA 1EZ2A 2BOGX 3H7UA 2FZ8A 1B4EA 1XIDA 2VGFA 1LM1A 5F4SA 3WYZA 4IT1A 5I3JA 3W53A 1RLCL 3IJDA 2VZOA 3R43A 3W37A 1HT6A 1S2AA 3RDKA 2J78A 3T07A 1NM9A 4QLLA 4GG9A 1W3NA 4XX6A 4EF8A 3NDYA 1NDVA 2PEVA 2OO0A 4NIRA 1SZNA 4X9SA 2RAGA 4XD6A 4AHQA 2FPVA 3TA6A 3CQKA 4JX4A 2XTKA 3H2MA 2QDEA 2QHAA 4LY4A 2WC7A 2XM1A 4IM4A 3G6MA 1IXQA 4JX5A 4NAEB 4DPQA 3VGGA 3CEPA 3VFLA 2W79A 4CD5A 2ZA2A 1DXEA 5AYZA 4REQA 2X16A 3NEHA 4NJIA 4OHQA 4HTYA 4Q8TA 5C9UA 3K30A 3RIKA 3CL6A 4FIRA 1V3KA 4DN1A 2C91A 4KETA 4PTMA 1TE1A 3I3BA 2F6XA 3VVGA 3VD3A 3K4AA 4MYXA 4IG2B 4IHCA 3VC6A 1I6NA 2PTYA 4B3KA 3CHCA 1XCFA 4HPGA 4R7WA 1MW2A 4DY1A 3CZLA 5HNRA 3ORWA 3R11A 2QCNA 2ZXBA 2H6RA 7PTDA 3H55A 5D9MA 3V7PA 1GPFA 1TE6A 1CGTA 2A7PA 4ENLA 1U1HA 4OGZA 3T05A 1EFZA 4MG4A 3QBUA 3H2NA 1AMYA 3DECA 1PKNA 1NQKA 4DBEA 3ARTA 2G37A 4ZOEA 4V2XA 3LDVA 1KR0A 3WDQA 4DNMA 1XM3A 3SDOA 3G24A 3RM9A 5BWFA 1PWMA 3HGRA 2B0MA 1FP8A 1XIEA 3CO8A 1D9EA 5CPMA 4GXWA 3KBNA 3MQTA 1E0UA 3N25A 4XK2A 3WCZA 1X98A 1QATA 1EDGA 1WPCA 4MMWA 4KIRA 1CXFA 4B2DD 3TNBA 4HCLA 1M04A 3GNXA 2WBGA 2YXXA 3JZEA 2OO6A 1HJUA 1TQJA 1KWGA 4IMCA 3TYBA 3U2ZA 5HXMA 3AHVA 4O14A 1HL2A 4LVFA 2HBVA 4PUMA 4HPJA 3CO4A 4HOXA 4S23A 1Z44A 2ATSA 3AFBA 3U2CA 5BNKA 1QOXA 1X8CA 1RJPA 3CZJA 3NAVA 2QMKA 5I03A 5IHRA 3ITCA 3KP1A 1ODZA 4X0VA 1UB3A 1QNRA 3UZXA 4FR6A 4IQLA 2E6AA 2J88A 2ZUNA 4A3RA 4BF9A 5A8QA 3W26A 1M7XA 3S1XA 1E73M 3DH7A 1SZFA 4JFVA 4IIFA 3VM7A 2QJMA 1ZJHA 3GUGA 4LF1A 2PPGA 3U4AA 3LSCA 4JN8A 3FGCA 3D5HA 4ERAA 3V75A 3IGXA 1KGUA 5EL1A 1DXIA 1XYZA 2PP1A 4WDUA 3R8HA 5REQA 1W1IE 1ADDA 4RNHA 4PL2A 3LGDA 4XAGA 4PTVA 4MDOA 1B3XA 2YYUA 1A0EA 2DSVA 4RL3A 4PMNA 4UTHA 4AZIA 1K1DA 3ZLGA 3W76A 1RY0A 3OA5A 2GDUA 4PCSA 1N8FA 3T81A 1SVDA 5A8OA 3P61A 4GVHA 1TZ7A 1GHRA 3VPLA 3KBJA 1YTDA 1A5OC 4IMDA 4LYQA 3F03K 3GKFA 7CGTA 4ONVA 1EBGA 2WCSA 2TODA 5D2VA 3HV8A 5I07A 5CG0A 3WLIA 1JZ8A 5D2TA 4QEHA 4IPJA 4QP0A 4AY7A 3T08A 2G3MA 2NV1A 2YL8A 3COTA 3W87A 2QMJA 4H2CA 4ZZ9A 1PKMA 5EMMA 5E6ZA 1UH2A 2W66A 3O0KA 3PC0A 1B31A 3QHMA 1QWKA 3PN8A 1JRBA 2OKTA 3BG9A 1B1YA 3EWZA 2ZZ5A 4U4MA 1G4PA 1SO3A 4JQAA 2IQDA 4XTIA 3W70A 1ZCOA 3VKDA 4D1IA 2J7GA 2BHUA 2HQAA 5HBFA 3C86A 3ZJ7A 1KFKA 3B8VA 1KFCA 2FZ9A 1AG1O 2WHLA 5FEXA 3MHGA 4LVDA 4EF9A 4Q4QA 3GVQA 4W5ZA 2PDBA 4I3GA 3UR8A 2R24A 3LI0A 1K70A 2OZTA 3SBFA 3N6QA 1S5TA 1P0KA 3KCLA 3VD4A 4E4FA 4FIQA 1ECEA 3GW3A 1E1CA 2QIIA 4N42A 4NX5A 2B7OA 4HZ8A 4J40A 2DZSA 1PYFA 3O6CA 4ZE4A 1RHCA 4HCDA 1OBAA 4YTTA 3UR7A 1JG9A 3KVKA 2X7WA 2WSRA 3RR1A 4P2VA 4L65A 5FJJA 2Y7GA 3B8SA 1M53A 1X8FA 1MRQA 5F4XA 1ONRA 3GNRA 3P8JA 5HULA 1Q13A 3TXVA 3TZFA 2XVPA 1Q6LA 3W84A 3DESA 1EDQA 5LZLA 1ZAHA 2R1NA 1HKKA 4Z2JA 4GI4A 1DOSA 3BJTA 3W2JA 3R0KA 1LBLA 3S2LA 3NM1A 4Y7EA 2DP3A 4JX6A 1FA2A 2BY0A 3QV9A 2YCKX 5TF0A 4MNKA 2HSAA 2VZSA 1NTHA 4DO7A 3T44A 1OG0A 1QPQA 2WXDM 3UT0A 1AW1A 1JL8A 1XG3A 1FFRA 3GXIA 4HGXA 4DO5A 5K3VA 3W1PA 3C6CA 5D2XA 1KCKA 2HMCA 4MF4A 1MI3A 2VEMA 2CLOA 3STGA 5I3FA 2AL2A 3C0LA 2FB2A 4O15A 4PCNA 1U1UA 4N9CA 3VO0A 4FXRA 2VFFA 2J27A 3LLXA 1QXLA 1KBJA 4H9VA 1CI1A 4FF7A 3UNDA 3G1VA 1FWRA 3DFSA 1PCKA 4V1XA 1TV8A 4QX4A 4UQ9A 4ZL1A 1XIHA 1JDCA 2VUNA 4Y9PA 1YTEA 4LY8A 3W86A 5CBBA 4YYFA 4DJFD 3CUZA 3HA1A 1I0DA 1W9XA 3S5OA 1JGMA 2GQAA 2QYGA 4W86A 1E0WA 4FLRA 2NX3A 2ZA1A 4QG6A 4WSKA 2BHYA 1Q2RA 5RUBA 1JAEA 1U5VA 3NQBA 3DFNA 3R7MA 3NXLA 1O95A 2OQHA 3GNDA 4DJDC 4UZSA 3M41A 4LAZA 3B9OA 4WX2A 4ZR8A 4YVXA 1DIOA 4GKTA 1AD1A 1E6RA 1GTEA 2E6FA 3O9NA 1P4CA 1GZGA 1MRAA 4FX6M 3ZLHA 4OV9A 3ZOAA 4AZGA 1E4MM 1RAKA 3GR8A 5DMLA 2QUVA 3BGJA 1IEQA 2DVUA 4EXBA 3BVJA 1VYSX 5BCAA 1F73A 2RDXA 2X1TA 4DZAA 2E4TA 4MYAA 1XJBA 4JTLA 4K39A 3PTMA 4CN1A 1IXOA 4JTGA 5LGZA 2XHYA 1W3LA 1HO4A 2JIWA 1B3WA 5F2LA 3VNJA 2QT3A 4LEFA 3UXKA 1OFAA 1POKA 2XFFA 1YXDA 1AMKA 2AKMA 4WJ8A 3SFWA 4AIUA 3NQ8A 1A53A 3L68A 2OVLA 4LW7A 1E55A 1ZQ5A 5C55A 3KRBA 3TW9A 3L7RA 3M0KA 2A3LA 2HCVA 2PCQA 1D7KA 3OLGA 2QCFA 3RLGA 2C71A 4HA1A 4NAFB 4HQVA 2BSLA 2GGJA 4G8TA 4IP5A 3BL3A 1SFJA 2DZXA 4C6MA 1UWAA 1LOLA 3KL0A 2CWXA 4B4FA 1ZAJA 2LLEA 2DY3A 3CIXA 2ACSA 4DZIA 3SUUA 4MJZA 3LBMA 4DXXA 3LTYA 4KWOA 1REQA 1SUXA 1OCJA 1R7AA 1FVPA 5LIYX 4WSHA 2YYTA 1GVIA 3GC5A 3FHAA 1E5NA 3ABXA 2QVHA 1OFEA 1EHNA 3SQLA 3WIJA 1E0XA 5TD4A 5AHFA 9RUBA 4Q4PA 3WLMA 3TV8A 3BAYA 3HPXA 4CNSA 1ZUAX 1V4YA 4N0RA 1DJGA 3FK4A 2E0PA 4GYPA 4AC7C 1W1YA 1DHKA 3BZGA 4XBJA 1XLCA 1K3UA 3PTDA 1NQ6A 5EFDA 3RLHA 3WLJA 3W9ZA 3TTQA 2HEJA 3E12A 4UTTA 6TAAA 4GY7A 4BF7A 1MUWA 2FVKA 3NQMA 3H54A 4IUOA 3NZGA 4JTIA 3CPRA 3WF0A 4O53A 1X7IA 3DI1A 1S2TA 4W9TA 3GNNA 4N4QA 1JCYA 3QTGA 1JYVA 1TPH1 3EWYA 1ISVA 4LT9A 1H5YA 4JTJA 4HOZA 2R91A 2JEQA 2NXIA 4PUJA 1FCBA 3EZ4A 1ESWA 1HN1A 2ZDSA 4EK7A 1A4LA 4ASTA 2NLIA 4IPPA 1ZJBA 3ZIZA 1WB0A 4PN2A 2HPIA 3BJSA 1BQGA 4C1NA 3GZAA 2WVVB 3PANA 5HATA 4GIAA 2CLHA 3TYDA 1HL8A 5CCZA 4KMQA 5GQBA 4K7VA 4REQB 2VWTA 4P7QA 4WJXA 4LQ1A 4ZMGA 4S3EA 2PDIA 1PPIA 2ZUWA 5CAKA 3QV8A 4CQ9A 5HJLA 3EX1A 1CX9A 3VX1A 1UPMB 1W1A1 5AC6A 2WZIA 4UQBA 7TIMA 5E5CA 4HZ7A 1FCQA 3WBAA 2ADAA 5IFTA 4XISA 4W5UA 4U2YA 1RV8A 4TQTA 1K6WA 1TCDA 3WQWA 2GVJA 2EO7A 1VFHA 2FZDA 4FNRA 3WNPA 4CQ8A 1QBAA 4A4AA 3BCFA 3N4FA 3SIZA 3SSJA 3KHJA 4J3TA 4UB9A 1W31A 1OGGA 4KEUA 1R3VA 2HDJA 2DJXA 4B5VA 4PB3A 4PTNA 1QNPA 4HHLA 3GC2A 3P82A 4XZLX 3RFAA 3RX2A 4PULA 2X05A 4ZCWA 3G1AA 4CGTA 1JPMA 5D9PA 1ME9A 4S38A 3QPYA 3CB3A 3P62A 6REQA 1WKEA 5EY5A 4RE3A 1HP4A 2VJXA 3EB4A 1CBGA 1XDJA 2WNQA 4WQ6A 3A64A 4J4KA 4AFYA 3IS4A 2Q3OA 2H3BA 4LTSA 3WF4A 3O07A 2PB1A 2QZRA 3GFYA 3HQ1A 3L67A 5D04C 2EKGA 5IFPA 2DFAA 2NSXA 5I3IA 5AHNA 3AIEA 2WZEA 1J0ZA 3FY1A 3TN4A 3GG1A 5DANA 4KCVA 3MKCA 1KM6A 1Z6KA 4ATWA 5DQPA 4A8LA 1JFXA 3W6LA 3B9EA 2Q3RA 4OJYA 1KXTA 5H1WA 4D6JA 3GHTA 4GVFA 3OA3A 3OTRA 4AMCA 5L9FA 2VQTA 4XTDA 3WQCA 4JQ3A 2CZFA 1J10A 1VEMA 4M7TA 3C3NA 4ZO7A 1XSJA 3NGFA 1GVRA 3KDNA 3KS6A 4C7GA 3E02A 3E2QA 2AGKA 2GVYA 2AL1A 3MANA 2X0YA 5A6LA 3FGCB 3T78A 1YLVA 5FF2A 3LTSA 1WX0A 4S3BA 4U28A 1XFCA 1C93A 5REQB 3O3RA 3H6OA 1G9HA 2PGEA 2C1HA 3HMJG 5BOFA 2H8ZA 4IH3A 3MMTA 3MB9A 2GJNA 4K2SA 4IJBA 3F7JA 4QIUA 1XH1A 4D8LA 3GVWA 4PBEA 3MTWA 4FK9A 3ARWA 5JH1A 2QJHA 4FSAA 3THDA 3MJMA 3Q37A 2OJPA 4AIEA 3OEXA 4PUWA 2D0FA 3UJSA 4KEVA 3VOFA 4NKCA 1KM2A 1WXYA 1XC4A 4HTBA 1KFLA 5CSUA 4H19A 3H2CA 4RNIA 1F07A 4A21A 3BOXA 4H7CA 1V8EA 4Q7BA 3IJQA 1QBBA 3V4BA 4B5SA 2Y5SA 1RUSA 5IBXA 4GIYA 2OFJA 4L1GA 2PRMA 4R27A 5G4WA 3AXXA 3USBA 4Z2GA 1JCMP 2W4XA 4G56A 4BI5A 3SCWA 5C7HA 4FXFA 1ICPA 5A1AA 3K13A 3SGGA 4QG9A 5DCBA 3GS6A 3E96A 4CQBA 1UP2A 2PE4A 3D6NA 4J1OA 1XD0A 5JVLA 2OZ8A 1EC8A 3TYCA 3STCA 1XRVA 5D2YA 3VILA 4JDBA 3MZNA 3SR7A 2E6YA 1W17A 3RJXA 2DUAA 1GQNA 4UTWC 3MHFA 5HJXA 1YEYA 1BYAA 1HJWA 4LALA 1QI2A 3FA5A 4AHPA 4P7NA 2ZVRA 1RALA 3WD3A 3GVGA 4CNOA 1Q45A 3AYRA 3BXWA 5JXQA 2PU0A 4O8RA 1FBAA 2OZ0A 2VR5A 1XH0A 1HL9A 3UESA 2JKEA 5E9XA 2EG8A 2YBVA 4CEUC 3V1HA 5DXYA 3WF1A 2B31A 4OOUA 1GKQA 2R14A 1G94A 5FI8A 4C6JA 4WDWA 4Z2KA 4GUIA 5T8GA 3MUXA 3LTPA 1Y7VA 1HXJA 3IJ8A 1UR4A 3TC3A 3R0DA 5D33A 1XLAA 4HK7A 4KCWA 4AX7A 3ITLA 4D6HA 2DQXA 3LPPA 1X6LA 4UOQA 4GX9A 2NQ9A 3JRKA 3NIYA 4GCXA 2RJGA 3IRSA 1EP3A 3LCFA 4JHMA 4GC4A 1LROA 2WHJA 3SZ8A 3IK4A 1QNQA 4O50A 1DVJA 2FZBA 3BGGA 1UD8A 3F2BA 2IKHA 3SURA 1HJXA 2OLSA 1A3WA 3Q67A 1WDDA 5I24A 2YDSA 1GK8A 4OTKA 2JKPA 3CHDA 1UHVA 1YYAA 2ZA3A 5B7ZA 1KC7A 2VRKA 3MYOA 4ZVJA 2HBXA 3ZVIA 1J2WA 4LNYA 3W29A 3B06A 3N15A 2AL2B 1FRBA 4LV9A 5GNYA 3QYSA 4PBFA 1KGWA 2EXOA 1GW9A 1H7OA 1QDSA 3GR4A 2XH2A 3EPNA 3UVIA 1TZ9A 4H41A 4ML9A 1KM3A 1XCXA 3IIVA 1BRLA 1LZOA 1DQWA 4GZIA 4LUSA 3LZ3A 4F2TA 3LLDA 1TQXA 1VF8A 4YJ5A 2Z7KA 3R1ZA 1TG7A 3IV3A 2ZXQA 3QFEA 1R3YA 1QI5A 1BAGA 3VDGA 1OYBA 1ZJIA 1TUXA 3LLFA 2BY1A 1H60A 3AICA 5D2WA 3AXKA 2E77A 4ZODA 2J8GA 4YHGA 3U5YA 1W91A 2CBVA 3M6DA 3A9BA 2POTA 3N3MA 2I1OA 2WSQA 1PKLA 4AXNA 2VVSA 1MW3A 1NARA 2XWEA 3BGAA 5CC5A 4TU1A 1KR1A 3B4YA 2V3DA 1Q6EA 1CIUA 1ZBKA 4DAIA 3EWXA 1G01A 3JS3A 1L8PA 1OC5A 3FJNA 2ZUTA 4AD5A 2YW4A 5C2XA 1NIUA 1MZHA 1MDLA 3WD1A 4UXDA 2X7VA 2A85A 1TELA 1UR3M 3Q65A 1N8IA 1DWAM 2DH2A 1YADA 3SM0A 2I57A 1AA1B 2YBTA 4IFOA 1Z32X 4MB4A 3UR2A 3W82A 2OB3A 4ZTYA 2CKSA 2Y5JA 1NELA 2A7RA 4MVAA 3UWQA 1RJRA 3MT1A 3G1HA 1ZZMA 2XU2A 1GTHA 4QJ5B 1EGVA 5EBAA 2DIEA 3TC7A 4LAUA 2XN2A 5EMLA 3BTNA 2ZZ3A 3WDRA 4HYWA 4LUYA 3PZUA 2A1YA 2WMJA 4UWMA 3G0SA 2NT1A 1F6KA 3WL1A 3NPVA 1XCWA 2OEMA 3BMWA 3WLPA 1GT8A 3E0IA 1NOUA 1R3TA 2ZKMX 3WQGA 4A8IA 3VIJA 3QYQA 3UJEA 2ZZ2A 2Y8KA 1KCLA 3DIPA 3I3EA 2NWSA 3KW3A 2NUXA 1REQB 3VYLA 4EWND 5I3HA 2F38A 3KOZA 5CZJA 1PTDA 1UKTA 3B8UA 1K9TA 4FALA 1OC7A 4D6GA 4JTDA 1W8SA 4FO4A 3LD5A 3VDAA 4HU0A 3W7GA 1KQZA 1VZWA 1QHOA 2W91A 3BAWA 1UP3A 4Q4SA 2WZTA 4O8AA 1VQTA 4URIA 2PGWA 3EOOA 1M65A 3FYYA 2BG5A 3VDCA 2VEKA 3ABOA 3EPMA 1BQCA 4Z2IA 3UZJA 3OZOA 3CHFA 3CYVA 1WBHA 4PMVA 1DWGM 1XPGA 1BKHA 2OWWA 3QFWA 4DJEA 4ZA0A 4MJ2A 2YXOA 3MBFA 4GYFA 1US3A 1RP8A 1R87A 4GIRA 5DXXA 3QKEA 3B9DA 4JKKA 4F9JA 3N4AA 1MDRA 1PHQA 4JFUA 1R3QA 4UTKA 1B9ZA 3B3DA 3ONCA 1QW8A 9XIMA 3WDJA 3WJYA 2DSWA 2P88A 3GYEA 3AQUA 4C6OA 3ERPA 1ZS2A 3A21A 3SAZA 1P0EA 2VXNA 2Z1VA 1XYBA 1D3GA 2WNWA 3RX4A 3IUDA 1WUEA 3B9AA 4TVCA 3WY1A 1KA9F 5A3HA 1UH3A 3XINA 3UQNA 1GZJA 2OEJA 1X1NA 2GGHA 5FACA 3GAKA 4O52A 1DWHM 2P10A 4C1NB 4F0LA 1I2RA 1Q6RA 3NL5A 3U2EA 3AHXA 3R25A 3VABA 4K8HA 1DL3A 1OB0A 3K8KA 3JVAA 1QHZA 3MMWA 3EX2A 4PMXA 1DQUA 3HGJA 3PFRA 1BG4A 4TVDA 3I6TA 2J4GA 1GQJA 1LRNA 1A4MA 3NQCA 3QR1A 4Z1BA 4IISA 1OGBA 2BGSA 3QHOA 1JF6A 4XWUA 4O28A 4LFYA 3IACA 1IYXA 2ZXDA 2Y1HA 4PL1A 4IGNA 3OBKA 1G1YA 3KUMA 3NWRA 2D2GA 4V1YA 1IT8A 3E2RA 5LXEA 2R94A 3GB6A 3T40A 2Z6JA 3CMFA 1B4KA 4DRSA 4C91A 1O7AA 6REQB 3B0YA 5EU9A 1ZPTA 4DWSD 4PCTA 1FQ0A 3BOFA 4N9DA 3UA3A 4P7OA 3LOTA 3PBVA 4MPQA 2BFGA 3CMJA 4MWAA 3S6TA 1R38A 3L65A 4US6A 3WNMA 2OXNA 3MV11 5CSSA 3W27A 5HPCA 1EYWA 4LJ3A 1AUSL 3U5UA 3F4WA 3UPBA 4QAIA 3GXPA 4P61A 1SO6A 5DEZA 4BJHA 3T2OA 1CGVA 4L1XA 3S8HA 1NFGA 1KXHA 3OBEA 4TO8A 1BLIA 1R30A 3PZ9A 1PS9A 2D69A 4AEOA 1JD9A 1W32A 2REQA 2XINA 3ALFA 4E38A 2WC3A 2QAPA 2ZRUA 3TFXA 3MJYA 2ZE0A 4L64A 4PC8A 4H01A 4ZSUA 1AZ1A 1F5ZA 3LRMA 1G69A 2FMNA 1BVNP 3CQ0A 3S6OA 1XGEA 1M5WA 1UP0A 3A3WA 4YNGA 1GG0A 1TTJA 5SWUA 4XZNX 4CNNA 1UKOA 1KWKA 3LM3A 1ZALA 4AU0A 3VGDA 1G4SA 3DOPA 3WLTA 3ZJ6A 1QI3A 4IP7A 3CQIA 1KCZA 4NZ3A 1XICA 2D1ZA 5EGRA 2HK1A 3C8FA 2QAFA 3DFPA 2ZADA 1E51A 4HK5A 2HV5A 4XQ6A 2QQ6A 2WKLA 4OIFA 4ZO6A 3AS1A 1HJVA 4MM1A 4P8VA 1DIEA 1QWGA 1W3JA 1YDOA 2EGZA 2J7FA 1B30A 4I90A 5LIUX 4KWWA 3K1GA 1SFLA 5E09A 1CWYA 3C2RA 5CZKA 2PDXA 4GACA 1BHGA 3C52A 1KKRA 3QZ6A 3O1NA 4M56A 3EXRA 3GDMA 3O6YX 4OZOA 4C5ZA 1PL9A 4H7ZA 1HKJA 2XN0A 4IFRA 1VC4A 3LMZA 5KINA 2P0IA 4WR3A 2Y62A 4RDVA 1GGOA 4UOZA