4HZ6A

Crystal structure of bglb
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
441
structure length
441
Chain Sequence
KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucosidase
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 176
structure length 441
sequence length 441
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz6A00
3OGSA 1UD4A 4PTVA 2WMIA 1NWTA 2J7EA 5HBFA 1G0CA 3L2MA 2GJRA 2XIBA 3O2LA 2BXYA 4QLKA 4X9YA 1XH2A 1W3JA 3CLWA 1IT0A 5JIPA 4B16A 2A3BA 2VO5A 1HKJA 4AD0A 4CD7A 2W91A 1GVIA 3ALGA 2YJQA 4CU6A 3WDRA 4PEEA 1DWHM 3AQUA 5EBAA 3HJEA 1QNSA 3I3BA 4U2ZA 2WYSA 4X0VA 5I2UA 3UR8A 2PI6A 3NUKA 4FF5A 5GNXA 4RE2A 2UY5A 2UY4A 1H41A 2PWHA 2DT0A 1R86A 3QOKA 4AW7A 4HOXA 2WC4A 1H2JA 5FIPA 1H3GA 5M03A 5IXEA 2XVNA 4P8XA 1H5VA 1ISZA 2DSVA 4HA1A 1JXKA 3VIFA 1IZKA 3SURA 2VI0A 4BQ4A 3WY1A 2DSZA 3WEMA 3EDFA 2BFGA 1G94A 4IISA 1XCWA 4C7FA 2EXOA 3BGAA 3CUGA 4JL1A 3BAJA 4JFUA 1MFVA 4XUYA 1E70M 3WBAA 3MSDA 4GINA 1NWSA 2VCCA 2HISA 1NP2A 5GNYA 1E0XA 1CLXA 1KXHA 1J10A 1EDGA 4J7RA 5HPCA 4W8LA 4RE4A 5CGMA 3QGVA 3CZ8A 3HMCA 3W81A 2WHLA 1GQJA 4NI3A 3WDJA 3IK2A 4AD3A 1XCXA 4ACYA 5CG0A 2EPKX 1GOOA 1QI4A 5F7UA 4AIOA 1JZ8A 2VUYA 1W9XA 4OBSA 5D8WA 1Q6CA 1EDQA 1HF6A 1LL4A 3RILA 4OZOA 2YLLA 1EOMA 4CCCA 4TVCA 4ZE4A 1V6WA 2WMJA 3L4VA 3T2PA 4BQ3A 3RM4A 4CN4A 4KH2A 1MXGA 3WFZA 1HJQA 2CBUA 3PTQA 4Z2GA 5BXSA 4U33A 4AD4A 5DT5A 4H2CA 3N13A 1UR0A 1V0LA 2WSKA 5FL0A 3B9EA 4LYRA 3CHDA 3OG2A 1RH9A 1OGBA 1OCQA 4XV0A 3N18A 4Y7EA 1PZ3A 3VD4A 2NT1A 3AMLA 2G8ZA 1HP5A 1E1FA 1TUXA 3MMUA 3VIIA 4GQRA 2WMIB 3CUHA 1U30A 1UH3A 2GFTA 2JF7A 3AXIA 2GSJA 2WKLA 4W87A 3AFBA 2XFYA 4L4OA 1J11A 4W85A 2DDXA 5IHRA 3W82A 1ESWA 2ZICA 3PBGA 2F61A 3MO4A 5A6AA 1UD3A 1GJWA 4AD2A 1H0IA 1KXQA 3B8SA 2XVLA 4F9DA 4PMNA 6A3HA 4J3UA 2W63A 5JBFA 4XZWA 3PZNA 2NW0A 1HT6A 1LWJA 4H41A 4D6CA 4MNLA 3SCPA 3L4WA 4WKFA 3HU7A 2O9PA 2J8FA 1RD6A 4OUEA 3MS8A 4GXPA 2ZUUA 1M53A 2ZUSA 3GXDA 4E8DA 3ZOAA 1GONA 1HX0A 2VRJA 3WKZA 3N12A 3WNMA 4CCDA 1JIBA 1KQYA 3IAQA 4GI9A 2VZOA 3L4TA 1FA2A 3QHMA 2WB5A 4MAZA 3BAXA 4JFSA 4PMDA 2CNCA 1EO7A 1UR4A 2EO7A 1PX3A 1GQIA 2VCBA 2D2OA 2WMFA 2V3GA 3TTYA 1K6AA 1A47A 1JXJA 3AROA 1LJYA 1KXTA 1BGAA 2FH8A 2ZX7A 3DC0A 3PZQA 1DWGM 1EHAA 1XV8A 5CPTA 3D5HA 1E3XA 1VEMA 2VCAA 3WN6A 1XHGA 3AYSA 1JZ6A 3JUGA 3RM9A 1WPCA 1ZL1A 5CQ1A 2PBOA 2GK1A 3LPGA 4NRRA 1B3WA 3VGBA 5C70A 3LMYA 2WNWA 2VX6A 1UD2A 1DWIM 3A4XA 4TX6A 5HPOA 4DWSD 4H8VA 1PAMA 5M17A 1LG1A 2Y8VA 4E4PA 4PUDA 1CZ1A 2WZIA 4PRWA 2DEPA 7A3HA 3ZT7A 4L4PA 1NWRA 4M29A 5CSUA 3VDBA 5CSYA 2MANA 4E8CA 1TA3B 3WSUA 1JF6A 3VMPA 3POCA 4X0NA 3SCRA 3WBEA 1EOKA 3ZT6A 5A6MA 3WF3A 3PZOA 4DWSA 4EK7A 5AYBA 5BCAA 1H0GA 1FHDA 2WPGA 3AS1A 1JD7A 3W4RA 1K9FA 2J7BA 3FY1A 5A2AA 2DSKA 3AMGA 1B3ZA 4NSBA 3TONA 3WENA 1VEOA 1DWAM 2DGAA 5CXPA 1UD8A 1WZKA 1B2YA 5E70A 2VZSA 1QI2A 1WDSA 3VIKA 3K8MA 5JBDA 1OGGA 4J3XA 2BNJA 2PWEA 3OLEA 1HVXA 1WNOA 2VRKA 1CXIA 3CPUA 5E09A 3U5UA 4PMQA 3WF0A 1WKYA 2GJPA 1XSIA 1V3JA 2CERA 1DWJM 3OLGA 7TAAA 3VKKA 4J27A 1R87A 1UR2A 5LA1A 3ARUA 2A3CA 1B9ZA 1HJWA 2BVYA 4HA4A 1E73M 1I1WA 4MB4A 1LQ0A 3GM8A 1UWSA 2WLYA 1H4PA 3IJ9A 4HPHA 2W4XA 3SCOA 5I6SA 1UUQA 3BC9A 3MUIA 2DH2A 4IPLA 3AHXA 1CDGA 1UD6A 1WZLA 1GUVA 2YDQA 4PCSA 4CD8A 3VGGA 4QCFA 3UESA 2V3DA 1UKQA 1BPLB 1NARA 3SCTA 1HIZA 4OBRA 4WSJA 2OSWA 1BYAA 2Q8XA 3THDA 3OZPA 2GK1B 9CGTA 5HDRA 5M3WA 2Z1SA 4WJXA 2JF6A 4M56A 1SR0A 3NSMA 1WDPA 3TTSA 2V38A 1JZ5A 2VMFA 1UQZA 3PZTA 2J7GA 1B3VA 3AMKA 1VFFA 4QCEA 4HTYA 1NH6A 3ARVA 1ODZA 3SCWA 1UWIA 1GOMA 2QLYA 5I77A 3WUFA 3VD7A 3CMGA 2ZX6A 5AC5A 3BMVA 1MFUA 2X0YA 5HOSA 4NF7A 3ARQA 1UYQA 1BGGA 2WWDA 3BMWA 4MADA 1X6LA 2FHBA 3J7HA 1NWUA 1E43A 4P7OA 1W2PA 4J3WA 4TTUA 3WDQA 4AZ7A 3U7BA 4BCEA 1OBAA 4AEEA 4R27A 4FLQA 2QHAA 2YLAA 1JL8A 3S2CA 1HKIA 4A3HA 4HMDA 1JFHA 5JBEA 4DM1A 3IANA 5FOOA 3OGVA 4LX4A 3CMJA 1Q4NX 3SCSA 3N1AA 3WF2A 5I5RA 5A1AA 1R7AA 1US3A 3CH9A 2ZXDA 3FNDA 2YOCA 1E71M 2X0HA 2JEQA 4P7NA 3EDKA 1V3HA 2JE8A 3LPPA 3VMOA 3VX1A 1UKTA 1KXVA 3DYMA 2CETA 2D22A 4M81A 8A3HA 3VINA 3WD0A 5IHSA 5E6YA 3NIYA 3VPLA 7CGTA 5IFPA 1AQHA 2RGMA 3BAYA 1HVQA 3NDZA 1V3KA 4WF7A 3ZIZA 4Z2IA 4D6GA 2WM0A 1TVPA 3WQ4A 1CPUA 3RPMA 2X09A 1E72M 5D9MA 4HZ7A 2VURA 2WAGA 2E3ZA 3AXHA 4HMCA 3WFLA 3SCNA 2WANA 4A4AA 2VX5A 2VVSA 3W38A 1E3ZA 1J12A 2BXZA 1SFSA 2WZEA 5I78A 4GZJA 5JUVA 2D0HA 3UG3A 1JAEA 1EQCA 3ZMRA 5D9PA 1UR9A 3AJ7A 1SMDA 2OWCA 1BSIA 2W92A 4D1IA 5A8OA 2YL8A 1R8LA 1V03A 3PZUA 4BS0A 2CITA 1E5NA 2XVGA 5E0FA 4C7GA 5A2CA 1IZJA 1EHNA 2J25A 1MQPA 8CGTA 4MJ2A 2WSPA 2CHNA 1W3LA 3GBDA 3T08A 1JZ3A 4PSPA 1XC6A 2DIJA 2OLHA 2J7FA 1PJ9A 1V6VA 2WCGA 4W7VA 1J0JA 5A8QA 4XZBA 4U31A 3MU7A 1JYVA 2BY0A 2Y4SA 3UR7A 1V0KA 3THCA 4GQQA 2W62A 5I24A 4FK9A 2XIIA 1B31A 3KEHA 3MKKA 3W6LA 2VZVA 4JZ5A 3BH4A 1VAHA 1HN1A 3SIMA 1QOXA 4CU7A 1UWQA 2WHJA 3WF4A 4MDOA 1PEZA 2W61A 4UR9A 3F5LA 5D4YA 1FH7A 3ZJ6A 2XSAA 2ESCA 1PIGA 2FH6A 3OZOA 3N15A 1OT1A 1C3FA 1V6YA 4WSKA 3L4UA 1QI0A 2VC9A 4D6EA 4PMOA 1HJUA 2JALA 1KGWA 4JL2A 1OSEA 3TP4A 4Z2HA 1J01A 1J9YA 1VRXA 2WC7A 2WHKA 2NSXA 3TOPA 2PWFA 2YA1A 1GOIA 3IJ8A 2DT2A 3K4DA 3VX0A 1OD8A 4F79A 3CZGA 1W1TA 2A3AA 4UFHA 5M5DA 1YQ2A 2D0FA 2BY3A 1YHTA 1N82A 5KEZA 1TCMA 4CCEA 4A3YA 3WELA 2WLZA 1H09A 1MYRA 4B9ZA 5DFAA 4OKDA 1E6RA 4ML4A 3LPFA 3AOFA 4UQBA 3W26A 4AZHA 1W2VA 5ABEA 4WK9A 3ZJKA 1ITCA 1UZ4A 4CD6A 4HU8A 1HL8A 1HP4A 5LA0A 3CHCA 3D3AA 4AZCA 4D6DA 2CBJA 3DYOA 4JCMA 3WNLA 2VVNA 5I3DA 1LF1A 2WVUA 1OT2A 3SUUA 3T0BA 2GDVA 3KWXA 3MANA 3AHYA 2FDMA 2WC3A 4BQ2A 4TUFA 1C91A 1M03A 2YL5A 5AY7A 2J7HA 5A95A 5ECUA 4P7QA 1KFWA 3WD3A 1QW8A 1E4NA 3ARRA 4UFJA 5I23A 1JGIA 3SUWA 4H04A 4JFWA 1DTUA 1CENA 2D24A 2CESA 3K4AA 3WEOA 3TTOA 3ZSTA 4W89A 4MAVA 3EBVA 4N42A 3VIHA 2WK2A 4HZ6A 3T0AA 1SYTA 5BXRA 2WMGA 3VO0A 4UTFA 1VJSA 3AIUA 3VDHA 3AS3A 1TG7A 3L4YA 1HJSA 1E56A 1PX4A 1J0HA 4FLOA 4GI6A 5CPQA 4TTGA 2OWXA 2C8NA 2EPLX 1CGUA 4F66A 2W5FA 3FHAA 1BYDA 1JDAA 3U7VA 3QHOA 3OB8A 3WD2A 4H8HA 1ZBWA 3GXFA 3CHEA 1TZ7A 3HN3A 1H11A 2BHZA 3VNZA 5DO8A 1WP6A 2J78A 5BXPA 3VGFA 3EMCA 4U5IA 5A6LA 4GO9A 2XYLA 4DUVA 1CIUA 1ISWA 2V3EA 1D7FA 1X1NA 3UETA 4LXFA 3VD5A 2J8GA 1UKOA 1V08A 1KR1A 1ISXA 3WNPA 4UQEA 1WO2A 1QNQA 2AAAA 1EO5A 1CGWA 4HPGA 4AZ6A 1TMQA 1WAWA 3O6AA 1NQ6A 3RDKA 4U3AA 3AMDA 3W0KA 5D9OA 4MTVA 5A8PA 2XM2A 3WD1A 2XPKA 2OYLA 1GNXA 1VEPA 4RL3A 4UFLA 1JYXA 1D3CA 1MW1A 3KL0A 3DECA 1WB0A 1MW3A 3WQVA 2D1ZA 5JIWA 4H7VA 5ABHA 3IJ7A 3GZAA 1C92A 1J0KA 2WZHA 4V28A 4AZCB 3GH7A 4AISA 4QP0A 4UNIA 1LL7A 4AIEA 1E0VA 2BVTA 4J3SA 2CXGA 5DEZA 2QF8A 3G6MA 3AICA 1ISYA 3T0DA 1JNEA 2YL6A 4P7RA 4AYSA 3WMBA 1W1PA 6CGTA 2UY3A 1AMYA 1QW9A 1EIBA 1JI1A 1WZMA 2JIWA 1OM0A 3UG5A 2YL9A 3SCVA 1CTNA 4M80A 1VJZA 2D0GA 3VIMA 1MW2A 4JAWA 3PHAA 4W93A 3VD3A 2CIPA 5EMYA 2E0PA 1EH9A 4CD5A 2J62A 1WZAA 3AYRA 4W84A 2PWDA 3VGDA 2DIEA 3TA9A 2OWWA 3ARXA 1BQCA 4PN2A 4CU8A 3AZRA 1OGSA 4WIWA 4UZSA 1NOFA 2J74A 4M1RA 1UKPA 2JFEX 4UZUA 4BQ5A 3A4AA 4W7UA 4CUCA 1C90A 1VBUA 2C7FA 4BZYA 2G3IA 2WXDM 5CZKA 5GNZA 2X2YA 3WL1A 2BVDA 2JIEA 4YN5A 1R7OA 4DUWA 4EANA 3PTKA 1XD0A 1UWRA 4J28A 4R5EA 2CYGA 4MB1A 4LGXA 4GO8A 1E6SM 1O7AA 5E6ZA 1AVAA 5A3HA 2X05A 2CHOA 5DMYA 3PZMA 3K1DA 1JDDA 1ZJAA 5EFFA 2XJ7A 3GXIA 2VNCA 3AIQA 1UH4A 1K9DA 2G3JA 2CPUA 3LPOA 4J3TA 5D9NA 4AZIA 2PF0A 3OLDA 2XM1A 1QHOA 4AMCA 4LPCA 1BVNP 1WE5A 3VU2A 1DWFM 4AIUA 2OYKA 4ATDA 2YDSA 1FFRA 3UCQA 3OLIA 1XH0A 1CGVA 3FW6A 2OSYA 4UQ9A 4W8AA 4Z2LA 5EFDA 1DHKA 2DSWA 2B31A 1HKKA 2CBVA 4JFTA 1W91A 3NCOA 4QLJA 1FP9A 3GH5A 1JNDA 3EMQA 4AZBA 4ZEPA 1BG4A 2YBUA 1E6QM 4JHOA 3U57A 2VL4A 3KZSA 2E4TA 4PTMA 3FXYA 1XYZA 5A8MA 1XSKA 4UQDA 1JAKA 3POHA 4UQCA 1KCKA 3CZLA 2ZXAA 5I79A 4MB5A 2C0HA 3FAXA 1UG6A 3GYCA 4U5KA 3WL0A 4EE9A 4CVUA 3F4VA 4DWSB 4F8XA 3DHPA 1XGZA 3ZR5A 4PTWA 1OWQA 2GUYA 3NJ3A 3RIKA 2VR5A 2WBKA 3BSGA 3RCNA 1G5AA 4JFVA 4H8UA 1M01A 1KBBA 1UKSA 4JKKA 4ACZA 1G9HA 1G1YA 3RMEA 3GNRA 1EQPA 1TVNA 2V5CA 1WDQA 2IXUA 3W37A 3DHUA 2VX4A 2XHYA 3WQWA 1HL9A 3KL3A 1QHZA 1GHSA 4UFMA 1FP8A 2O9OA 3W24A 3AIEA 2J4GA 2RGLA 2J79A 1H1NA 1FFQA 1VF8A 1MQRA 3GXMA 3B9DA 4AD1A 3EDDA 2A3HA 4AY1A 4D1JA 4U2YA 1C7TA 4AD5A 4ATLA 1ISVA 1V3MA 3RJXA 1B0IA 1IV8A 1QBAA 1OB0A 3AIBA 1OINA 2FHFA 5KZ6A 2Y8KA 1B1YA 5ABGA 3CZJA 4V2XA 1E6ZA 1F4HA 2XVKA 3QOMA 4W7WA 4D6HA 2E8YA 3AS2A 1C8QA 3I3EA 1QNRA 1UR1A 4JHZA 2CCRA 4DWSC 3FN9A 1AQMA 1KQZA 2BV9A 4XX6A 5I0DA 2X1IA 2BY1A 3WNOA 1W9VA 2WVTA 4F9JA 4PMYA 4TVDA 3WQ5A 2XFRA 3OBAA 1E4IA 3PZGA 1CEOA 3FAWA 4AEFA 3BAIA 5HNNA 2XVPA 2BS9A 3CZKA 2XGIA 1RP9A 2OYMA 2ZUVA 3VOCA 1HJVA 1WCGA 1CLVA 3ZR6A 4D6JA 1US2A 3WMCA 2Y5EA 4MNJA 4ATWA 5A6SA 3VVGA 1CXKA 4UFKA 3SUVA 5AC4A 1FH9A 5A69A 1PIFA 2V5DA 2VX7A 3QHNA 2XFFA 3BLKA 2YIHA 1EDTA 3MV11 2VTFA 1J0YA 4KRUA 2ZUMA 2VT0A 4WKHA 1OIFA 1VIWA 1CXHA 2QMKA 4B9YA 3U5YA 1K9EA 1KCLA 3CHFA 5CLWA 3WH5A 3M46A 2YDRA 4Q22A 4EAMA 5BYWA 3VGHA 1DEDA 2CEQA 3EYPA 1CBGA 1NOWA 4LQ1A 2DPEA 1GQLA 2GDUA 1Q6DA 1TE1A 4UOQA 1CYGA 2ZOXA 3PZVA 2AOSA 1E15A 5A6JA 3FHQA 2DQXA 4PMXA 1ZJBA 3ZJ7A 4MNKA 1W3KA 1UWTA 5BROA 1ODUA 1CGXA 4D6IA 1KR0A 5A8NA 5IFTA 4BF7A 2WWCA 1J18A 3AS0A 4GIAA 1LG2A 3VTRA 3WUEA 1F4AA 2WVSA 1UOKA 5FL1A 3CO4A 3MMDA 4E2OA 3BSHA 5D8ZA 1Q6EA 3BCFA 4Z2JA 5E9AA 1KB3A 1OD0A 3VD9A 1NOUA 1E0WA 4LYPA 4PCTA 1QNPA 1W32A 3BXWA 3KE0A 4QAWA 1VFUA 4NRSA 1KGXA 3ALFA 1GOQA 1GPFA 3N9KA 1W1VA 3CBWA 2VZTA 4W86A 3CUJA 3WEZA 3F5JA 1Q6FA 1TR1A 4CD4A 3OA5A 4W5ZA 4QFUA 3ARPA 1SMAA 3EMZA 2ZUTA 5A6KA 4TOQA 4M8UA 1QHPA 4PUEA 1GW1A 4GZIA 4FLSA 5BRPA 4HP5A 4W8BA 4ZFMA 5EB8A 1V02E 3N04A 2EQDA 3VILA 3AHZA 2XWEA 3UEQA 5A94A 1D2KA 3I3DA 1V0NA 4QDMA 2IUZA 2WHMA 1QI3A 3O9NA 1QNOA 1JYWA 5ABFA 3K46A 3AIWA 2F2HA 1J0IA 2PC8A 2ZX8A 2ZXQA 4KRTA 1LWHA 1V02A 3MMWA 3SEPA 1QBBA 4UCFA 5CPSA 3AIVA 1CXFA 1C8XA 1XD1A 2DT1A 4GI8A 2Y2WA 3ARWA 3UG4A 2GVYA 1E4LA 2PWGA 4EKJA 1MXDA 3TTQA 1VFMA 4OIFA 3BAKA 4PMRA 4P7LA 4UOJA 4LYQA 2ZE0A 4QLLA 3VM5A 4PMVA 3CUFA 2FGZA 1V6XA 1U33A 4P8UA 2ZXBA 3APGA 2BHUA 1UWUA 3WQ8A 4YHEA 4HZ8A 4HOWA 1JYNA 1TA3A 3L4ZA 1W9DM 2EPMX 4CGTA 1PZ2A 3E1F1 2XWDA 1B3XA 2QPUA 3W25A 1LL6A 4PBGA 3L2LA 3AISA 3W27A 1CGYA 1ITXA 3VIOA 4MB3A 1MVYA 3MSGA 2D20A 5DF0A 3ARZA 5LA2A 3VNYA 4J3VA 2O92A 4S3KA 1UZ1A 2Y24A 1XRVA 4P8VA 2VJXA 2OSXA 3AIRA 2IXVA 1GORA 3PZ9A 5FKYA 2NT0A 1RPKA 1VB9A 1JZ7A 1CNVA 5CGTA 1VFOA 3M6DA 3SUSA 3CTTA 1QVBA 2Z1KA 3NYDA 3WD4A 2VQTA 5AYIA 5IDIA 1KBKA 2J77A 4AXNA 2ZWZA 2ZUNA 1JZ2A 3PN8A 3T2QA 1ZBVA 4KGJA 1V0MA 1V6UA 4CN1A 2PBGA 1KWKA 3ARYA 2E9LA 1JI2A 4UQAA 3MV01 1CWYA 3CUIA 1BFNA 3EDJA 2VRQA 3GBEA 2ZWYA 1E1EA 3WF1A 2O9TA 5CJ5A 3VDAA 4C7DA 1JZ4A 3CIVA 4ZENA 2E9BA 3A3HA 3BCDA 5E0CA 4OOZA 4Z2KA 3T2OA 5ABFB 3WQ6A 4ZXOA 2VZUA 1UHVA 2E40A 3VIPA 4AC1X 3PZIA 1ZBCA 3M7SA 2PB1A 3W53A 1BYBA 1Z32X 2WCAA 1FOBA 1OIMA 4CN6A 3F5KA 1KGUA 3ECQA 1P6WA 4KGLA 3WUGA 2HVMA 3WMSA 3VM7A 1VBRA 4CVWA 3K8KA 1Y7VA 3NSNA 4Q7NA 1HXJA 1E4MM 3AXXA 4V27A 3ZJ8A 3WDPP 2G3MA 2FHCA 3VDCA 2BHYA 3VGEA 2VOTA 3VIJA 3WH8A 1WDRA 4MNMA 1A3HA 1E9LA 1GCYA 3VUPA 3AHTA 3G6LA 4UFIA 3BLPX 4UOZA 2D3LA 1S46A 2E9MA 1NM9A 4DUXA 1JD9A 4P8WA 3II1A 3T09A 3W29A 1HKMA 5DT7A 5HXMA 1FH8A 4ZXLA 2JEPA 4OOUA 1M04A 4GKLA 1MQQA 2XGBA 2WVVA 1O6IA 1R85A 5CLTA 1UH2A 1H49A 4B3KA 4HOZA 2EPOA 3WH9A 2ZX5A 2XTKA 1E6XM 3OGRA 3VIGA 3GH4A 4NZCA 2CKSA 1W3HA 5GPRA 1KWGA 3N17A 2GJXA 4KWUA 1BVZA 4PTXA 2QV4A 2W67A 5C8BB 2WW5A 2YA2A 3MUZ1 2UWFA 2EEXA 5A2BA 1X6NA 2J47A 3CGTA 1L0PA 2CBIA 4PMUA 2ZIDA 1XH1A 2EBNA 1JF5A 3B9AA 3GTNA 1JG9A 2QMJA 3WNKA 1QPKA 2BY2A 1ZS2A 4AWEA 3GNPA 4YPJA 1UA3A 1W9BM 2DH3A 3M07A 1MW0A 2EPNA 1XSJA 1E6PA 1MWOA 1CGTA 1ZBKA 2UY2A 3RO8A 4FMVA 4PSRA 2E8ZA 2WBGA 3MUY1 1J0ZA 1ZU8A 5FD0A 2F8QA 1XYFA 4WLCA 1V3IA 2G3NA 2YBTA 1W9UA 4JIEA 4K68A 4D72A 2CKRA 1GVYA 4CKQA 2DSUA 4HMEA 5C71A 3ARTA 1JFXA 4MDPA 3QR3A 5BXTA 3UERA 1UR8A 1GQKA 5BRQA 5A6BD 4IPNB 1EGZA 3WNNA 3A4WA 4HU0A 3L4XA 1CXLA 2QPSA 2ZUWA 2WMKA 2W66A 1UA7A 1FHLA 1BG9A 2J7CA 3GNOA 4YHGA 2VQUA 1B30A 2WVVB 2YKKA 1I1XA 2A3EA 2J7DA 4D71A 1BHGA 1V3LA 3KL5A 3ZO9A 1C7SA 2WCSA 3CZEA 2D23A 1UD5A 3S6TA 4M82A 4M24A 5A6BA 3EDEA 1E40A 4GZEA 4IM4A 3ZQ9A 1E5JA 4JKMA 1LLOA 1JDCA 1GOKA 2TAAA 1I75A 1B3YA 2DT3A 2G41A 2GJXB 4IUGA 1C93A 4AZGA 3GDBA 1HNYA 3K8LA 3WDIA 1CECA 5TD4A 1U2YA 3ZM8A 1GHRA 1BTCA 3A6OA 3MUAA 2AMGA 4W88A 3VMNA 3AI0A 1ZB5A 3SCQA 3WH6A 1GOWA 2O9RA 3W6MA 4W5UA 3SCUA 3NDYA 4BA0A 2XUCA 4D6FA 1HJXA 3ZSSA 1RP8A 6TAAA 1BF2A 4N0RA 3W28A 2V3FA 1BLIA 4OJYA 4U3CA 4B3LA 3RJYA 2VR4A 5GQBA 4HA3A 1NP0A 4B15A 3AZTA 3WH7A 1E6NA 1BAGA 2FGLA 3ARSA 4FLRA 3A47A 4MPKA 3N11A 1C8YA 1B90A 2X8RA 4TX8A 3NSXA 4GPNA 1W9PA 1W1YA 1K9TA 3ZT5A 1PPIA 3AZSA 1TFVA 1UQYA 1ECEA 4JKLA 3WUBA 2ZX9A 1DP0A 4URIA 5FCZA 4JCLA 1CXEA 1AQ0A 1EXPA 1GZJA 1Q6GA 2XSBA 4DM2A 2WKGA 1G01A 4XB3A 4MJ4A 2EJ1A 3WDHA 1E55A 1PBGA 4PYSA 2WMHA 1L8NA 1EA9C 4TVUA 1M7XA 1BYCA 4RE3A 4ACZB 3AHVA 1GJUA 3OIHA 4KMQA 2J75A 1VENA 4S3JA 3WIJA 1PX8A 4WKAA 2D3NA 5LYRA 3SUTA 3AMCA 5BWFA 2XG9A 2G4FA 3BAWA 4ZE5A 3IAPA 4AZ5A 4TXEA 3DYPA 3RM8A 1QI5A 2YA0A 3PTMA 4PMZA
chains in the Genus database with same CATH superfamily
4PTVA 1NWTA 3L2MA 2GJRA 2XIBA 1K6WA 3TNBA 2P3EA 1EB3A 3RR4A 1W3JA 4FALA 1S38A 4AD0A 2QJJA 3ALGA 3FYOA 3H2MA 4PEEA 3AQUA 3LHZA 4RJEA 4HPJA 4GYKA 4A3QA 3EXSA 2PI6A 1ICQA 2NLIA 2BDQA 3H6OA 2Z1XA 3C6CA 2UY4A 4GIEA 1QTWA 2VELA 4RZ6A 1W1A1 3QPZA 1RA5A 3S46A 5FIPA 1H3GA 3T55A 2AL2A 3U2EA 4HA1A 1JXKA 3N4AA 4AG0A 1ONXA 2GLKA 3ZVHB 3EDFA 3PM6A 4C7FA 2EXOA 3BGAA 4LAUA 2JGQA 4JL1A 3S5ZA 4JFUA 1MFVA 1V77A 3MSDA 1NEYA 3NFUA 1FXQA 5HMSA 1J10A 1EDGA 3QN3A 3LCLA 2PE4A 4I6VA 3WDJA 4DBEA 1U5HA 2EPKX 4K8EA 3CV2A 2VUYA 4B2DD 1Q6CA 3UFYA 4IIHA 4UC5A 1P0EA 1XS2A 4IMDA 2NX9A 4M0XA 2YLLA 1W5OA 4ZE4A 5FJUA 3STGA 2RFGA 1EC8A 3PJXA 4I8YA 1THFD 3WLJA 4GBUA 5F1VA 3HGOA 4EXAA 1UR0A 1V0LA 7ODCA 5FL0A 1DJZA 2FJUB 1OCQA 4XV0A 4PTNA 1XQLA 4NL1A 1KA9F 3L2IA 4B2DA 2GGIA 3W7HA 3W7IA 1E1FA 4HNOA 2V2CA 2WMIB 1UJQA 4UMBA 2GFTA 4KRZA 1UWAA 1T6MA 1TVLA 3KVMA 2GSJA 4JD4A 4W87A 4Y9MA 1Z69A 3AFBA 4YL2A 4QNEA 3EB3A 4E2BA 3O07A 3RX2A 1ESWA 1VBGA 2DVTA 3SSZA 4NKCA 1VJIA 4BJHA 1H0IA 1KXQA 4F9DA 4PMNA 1KLYA 1SW7A 5JBFA 4PMJA 2NW0A 1ZQ5A 1R2RA 1AFSA 4D6CA 3CL7A 3KS6A 1BVWA 3HU7A 2VEFA 2O9PA 2J8FA 1RD6A 4ERIA 1MNZA 3PBYA 1O94A 3FXGA 5LIWX 4RPPA 1DIOA 4L1GA 1HX0A 3NQMA 2PCQA 2PDQA 4CCDA 3FA4A 2ANUA 1XF0A 1KQYA 3IAQA 3N9SA 4I7VA 5H6HA 3KLLA 2YYUA 1GT8A 1A49A 1FA2A 4DIAA 4OECA 3KHJA 3MI6A 7ENLA 2PDWA 3UXDA 4JFSA 1EO7A 1UR4A 3ABRA 1FWCC 2P50A 2D2OA 4UTLA 2OT0A 3AROA 1LJYA 4K38A 2C1IA 2ZX7A 3Q94A 1XV8A 3S5OA 1EJRC 1E3XA 3R94A 5T8GA 3IJQA 2E28A 1WPCA 3BGGA 2YZ5A 1XP3A 5G5IA 3VGBA 4PUJA 1UPPA 2WNWA 3VKJA 2KX9A 3CASA 3OOQA 4O13A 5HPOA 3F2BA 2X30A 4IX0A 4H8VA 4MYAA 4GYPC 4E4PA 5F1UA 3QQ1A 2WZIA 2DEPA 3P7YA 3ZT7A 4L4PA 4IIEA 5HR6A 4JTJA 3W7JA 2MANA 1P6BA 2ZQ0A 4E8CA 2HS8A 3U48A 4IFRA 2CZ5A 4MM1A 2C91A 1I2NA 1QPRA 4GABA 3O0KA 2PTDA 4Z08A 3ZT6A 5A6MA 3WF3A 3WLSA 4IGMA 4EK7A 2OQLA 5AYBA 3WLPA 3ENLA 1H0GA 4LUTB 1ZRQA 4O18A 4ADUA 4PTDA 3W1NA 4I9JA 2WPGA 1G4EA 2R94A 4JHMA 4JTAA 3E3HA 6XIAA 1K9FA 2DZXA 4JNMA 4DZHA 1B3ZA 3TONA 2E68A 3WENA 3M16A 1DWAM 2DGAA 3K5XA 3NO1A 2I56A 1WZKA 1AW1A 1CT5A 3FSUA 3GVWA 4XZ9A 1WDSA 4H9VA 4CQCA 5I3IA 2PLKA 4J3XA 3MSRA 1HVXA 2VRKA 1Q63A 2QUVA 3CPUA 5E09A 4PMQA 1O5KA 2GJPA 3LQLA 3KZPA 1DWJM 3FJLA 1VHCA 4AIBA 2HVOA 1HFBA 2HE5A 1B9ZA 4HA4A 2XH7A 3VC5A 2E1DA 3MYOA 3IWPA 3QSTA 2WLYA 1CCWB 1H4PA 4DVOA 4HPHA 4HYWA 2W4XA 1TB3A 3NPWA 3MUIA 4CQ9A 1CDGA 1XI3A 1OYAA 1A4LA 1WZLA 2G50A 1XIIA 4PCSA 4N02A 1H7OA 2V3DA 1UKQA 2VYOA 5AC8A 1NARA 4EX4A 1JGMA 4BI6A 3RPDA 5B7YA 4OBRA 1BD0A 3TJLA 3THDA 5HDRA 2FFCA 1YPIA 3QZ6A 4XZIA 3AC0A 4B5WA 3TYCA 3KOZA 1W1IE 4FIQA 5LZLA 2JF6A 4G2DA 4HN4A 1NFBA 1Z7AA 2WM1A 4NT0A 4K6AA 2VMFA 1UQZA 4GNKB 2WJZA 3GUGA 4YWSA 1W3TA 3PNZA 2ACQA 1NH6A 1M65A 2IQ0A 2PTZA 3CQ0A 4QE1A 4Y9OA 4G56A 3Q37A 4H9XA 5AHFA 2ZX6A 3TA6A 1MDRA 1V8EA 3UD6A 1MFUA 2CW6A 1ZENA 1W17A 2EG6A 1XIDA 1BGGA 1TZZA 3G1SA 3UXKA 4AC7C 1YX1A 3J7HA 4P7OA 1E43A 3VYLA 4HCLA 5FJJA 1NFGA 4YTTA 4R27A 4DJDC 2FMOA 3BMXA 1JL8A 4B5TA 1XLLA 1MUMA 3V4BA 1JFHA 3L0NA 3KOWA 4WQ6A 4LX4A 1IWBA 4REQA 3CWHA 1B4KA 2PP1A 3CH9A 2ZXDA 1E71M 1GZGA 2JEQA 2ZC1A 4RV3A 4P7NA 1XIGA 4C60A 3LPPA 3VX1A 4DHGA 5I3HA 4Q4KA 4Q7IA 3UZJA 8A3HA 1SZNA 3VKAA 4EAYA 1LOQA 3NIYA 1AQHA 1JRCA 4LAZA 2NQHA 4GMEA 3GLCA 8RUCA 1E72M 2D2HA 4QEEA 2VEPA 4ZQOA 2VWTA 3AXHA 3WFLA 4ZOCA 1AD1A 1PKMA 3W38A 5CAKA 4GJIA 1PS9A 5I78A 5JH1A 3S2LA 3UG3A 3AJ7A 5IDZA 3NO5A 3ZR4A 4LBUA 4M51A 1Z44A 1IEIA 4DYEA 2YL8A 4HJFA 4QISA 4JY9A 4ADSA 4BS0A 1EWDA 3ABXA 5A2CA 1T8XA 2GSEA 4U10A 1EHNA 4F0SA 3BV7A 2WSPA 3VZYA 2CHNA 1KNWA 2INZA 1NELA 2QPXA 4GLEA 3W86A 1NF7A 4HN8A 1VRDA 2DIJA 3PSVA 2VDGA 5G1TA 1V6VA 4ICMA 1OFPA 2OEJA 3TN3A 1J0JA 4HCDA 4Q8TA 2CZFA 3I7QA 3PWAA 1RV8A 3KDNA 4GQQA 2W62A 3LHYA 1B31A 3KEHA 1DL3A 4E38A 1RALA 4UBPC 2OXNA 3BH4A 3SIMA 1RLDA 2YXOA 3U0HA 3BOXA 2H6RA 3IIZA 4ML9A 1E1CA 1OFQA 3ZJ6A 3N19B 3LEPA 3G1HA 2ESCA 3M0KA 3A5FA 3CB3A 4I5UA 2FH6A 1Q66A 5KTLA 4IGNA 4PBEA 3N73A 4BF5A 4TU1A 1OT1A 4WSKA 2W6RA 3HG5A 1Q2RA 4PMOA 4B5XA 3MZ2A 2JALA 3BGJA 1B57A 4JL2A 1OSEA 1OFBA 3SFKA 4PB4A 2Z7GA 2BX7A 2PRLA 3TOPA 1GGOA 1ZZMA 2GWNA 2PWFA 4EACA 3SY8A 1K02A 2DT2A 3K4DA 3VX0A 3W7DA 1OD8A 3CZGA 2UV8G 2A3AA 1H61A 5M5DA 1YHTA 1LYXA 4Q4SA 3KBSA 4CCEA 4B9ZA 4FNUA 4O4VA 5DFAA 3LM3A 4ML4A 4UQBA 1PCKA 1PYFA 2O4QA 3TYBA 2J9XA 2QCGA 2ATMA 1UZHA 2GVLA 1G7VA 4CD6A 2IW0A 2PODA 4D6DA 4JCMA 1L2QA 4BI7A 5I3DA 1DIKA 1UASA 3IVTA 2ZFAA 4QS5A 1L6YA 1DXIA 4WDUA 3AHYA 4RZ5A 2GJLA 3AJXA 1NTHA 2POZA 2J7HA 3DDMA 4YCOA 4P7QA 4K36A 3WD3A 4DO5A 1QW8A 3GRIA 1JGIA 2G5WA 4CNOA 4GACA 5IOBA 3P8IA 2YX0A 3WEOA 4W89A 4LS1A 3QFEA 8XIMA 4NZ1A 3O0FA 4KCVA 4MWAD 1VJSA 2VKZG 5LNUA 4IH3A 3B8TA 3AIUA 4FB7A 4LC8A 2PD5A 1PX4A 4MWAE 4GI6A 1OC7A 5HNTA 5A5WA 3I65A 3OB8A 4LRSA 5G1MA 2E5BA 1KC7A 1S5TA 1GVRA 3VNZA 1XGEA 3OU8A 4TX9A 4JTDA 5BXPA 5A6LA 4MWAA 3UWZA 3EX1A 1ISWA 1X1NA 1KO0A 3FOKA 2J8GA 2ZZ2A 1V08A 3CM4A 3NQBA 2QJGA 3KOYA 2AAAA 3W87A 4RXGA 1CGWA 4HPGA 5H8PA 3B0XA 3WLKX 2Y5JA 3GUWA 3RDKA 3WLLA 1W5MA 5DY3A 1KRAC 3WBYA 2XM2A 2DZPA 3U2OA 2OYLA 4GFSA 3P14A 4UFLA 1JYXA 3DECA 4DNMA 1WB0A 4LS2A 2BGSA 3W1LA 5ECVA 4H7VA 3C0SA 3GZAA 2WZHA 4V28A 3A3XA 3PBWA 2Z1BA 1IEVA 3B8IA 1EF2A 4UNIA 3RCYA 4AIEA 5EMKA 5T91A 2YYTA 1JPMA 1LT7A 5DEZA 2E1WA 4DZIA 4H00A 3FEMA 4TMBA 3WMBA 1XDMA 2AQOA 1ZJHA 3TMQA 1QW9A 1JI1A 4EWJA 1EEXA 2PP3A 2BASA 2ONEA 1CTNA 4M80A 3S5SA 2F84A 2D0GA 3H12A 3VIMA 3OHMB 1A5LC 5CPOA 1WV2A 3ZLFA 3HBLA 3ANUA 5EMYA 1UMYA 2E0PA 1LBMA 3AYRA 4M6PA 4W84A 3VGDA 1W6TA 3G0UA 3N2CA 3AZRA 1QXLA 2JFEX 1HZYA 4HQVA 3W22A 4BZYA 5ENLA 2G3IA 5CZKA 4KWSA 3N2XA 3CWNA 1ENUA 2AKMA 1R7OA 5C9RA 3W1XA 3IIPA 3M9YA 3W7PA 2Z6JA 1KFEA 3V75A 2CLIA 4LGXA 5E6ZA 3B8DA 4XZHA 5A3HA 2CLLA 4XKMA 3DU0A 2O4MA 1S2AA 4QG8A 4LY8A 4I9AA 3ORWA 4NJIA 1JDDA 4NZ3A 3TC6A 5EFFA 3GXIA 5AFDA 3R5EA 4M3PA 3N6HA 1JEZA 3AIQA 2G3JA 2OB3A 3LPOA 3NOYA 4J3TA 4WVXA 4AZIA 1FWHC 4AMCA 1BVNP 7REQA 1DOSA 1TV5A 4AIUA 1OK4A 4NAEB 4JYEA 3OLIA 4INFA 1XH0A 3MKVA 3XISA 4AX6A 4CNSA 4UQ9A 4W8AA 3B05A 1S5VA 5EFDA 2P0OA 3EB2A 4IG2B 3WJSA 2B31A 4DJEC 1HKKA 2CBVA 1QMLA 4EWND 1OFRA 3NCOA 3EOSA 4QE5A 1VS1A 4ZFCA 3GH5A 1JNDA 3EMQA 3MI2A 1BG4A 2J13A 4JEQA 3LHWA 1TQJA 3Q4DA 4HSNA 5D2TA 3SGUA 1ZALA 1SZRA 1EPXA 1JJKA 1S3HA 4JQ3A 4RNIA 3QW3A 1KCKA 1Z6KA 4MPQA 4IIFA 3C3UA 2C0HA 2TRSA 3WL0A 3WYZA 5E9XA 4DBUA 1KCXA 3L0KA 2Z7KA 4Q6JA 3R25A 2GUYA 3RIKA 3IV8A 2WBKA 3BSGA 1G7UA 3PBVA 1ZTVA 5D33A 5EMUA 4X63A 1M01A 3M0ZA 4XSMA 4O1BA 2ZZ6A 1TVNA 5GJMA 3DHUA 1KM1A 4NYUA 2XHYA 2KZHA 3FVMA 1O5QA 1TPVA 3RN6A 3VNJA 2RGLA 3EZ4A 2PZ0A 4FX7A 4FIRA 3URNA 2J79A 1H1NA 3GDTA 1HW6A 1VF8A 5PTDA 4UNKA 3EDDA 4AY1A 3LNPA 3G0XA 4NP7A 1C7TA 4IJBA 1TZ9A 1QBAA 1OB0A 1UC4A 2R1NA 5FF2A 1KM0A 1DIEA 1UZDA 2OTDA 2YB4A 2CZDA 2DZSA 3QOMA 3RPTA 4DO6A 3I3EA 1QNRA 3F4WA 2CCRA 2Q8ZA 3FN9A 1PIIA 3NQVA 1P0NA 5I0DA 3S1UA 1A53A 2BY1A 2QUNA 1P1XA 4TVDA 1MO0A 1S2UA 2QUTA 3ERPA 2PAJA 3PZGA 4AEFA 5CH9A 3YPIA 2QT3A 2XVPA 3CZKA 4A2RA 3UCCA 4JTIA 4XZNX 2OYMA 3KBWA 3VOCA 1HJVA 3ZR6A 3RAOA 5IRPA 3T81A 1JDFA 1XKJA 2EKCA 4QJ5B 3WMCA 3KWSA 1RCQA 2XN2A 5LGXA 3CJPA 3QHNA 3BLKA 3MV11 2VTFA 1J0YA 4KRUA 1AG1O 4DXKA 2ZUMA 2RHGA 3OA3A 4IXXA 3APTA 3S1VA 4O28A 3LQGA 7XIMA 1GZ1A 3MMTA 3CHFA 5CLWA 5FESA 2PU0A 4FXSA 4LQ1A 1TE1A 5HMDA 4CNTA 4LEQA 3PZVA 1XLKA 4PUWA 3S9ZA 3GB6A 3WQEA 3PJWA 1E51A 4MG4A 3REQB 1CGXA 5C9UA 2H3DA 4BF7A 3AS0A 2L5HA 1EJTC 1LORA 4UIOA 1UOKA 1TX0A 3CO4A 4XSLA 2A21A 3MMDA 4AVFA 5CZSA 1SO3A 4Y96A 4OGZA 3V1HA 1AW5A 1KB3A 1JPHA 2CLEA 4HHMA 1E0WA 3TCEA 4LYPA 4Z1DA 1QNPA 3CS2A 1W5PA 3BXWA 4QAWA 1VFUA 1KGXA 1GOQA 3HQPA 1GPFA 4KQNA 3BV4A 1FHUA 2A6LA 1LOSA 2HDJA 4PCPA 4Q4RA 3WEZA 4ZGYA 1EC9A 4DBSA 1Q6FA 2RJGA 1WAUA 4HSOA 1TO3A 1XDJA 1VIZA 4IP7A 3KHDA 5F2MA 2BWGA 5BU6A 4HHPA 3DFSA 5KZDA 1WYIA 3NL2A 5BRPA 5EB8A 3W01A 4DF0A 3AHZA 4S2BA 2IPFA 5H91A 4QDMA 2WHMA 1QI3A 1ZNNA 4MZYA 4G7EA 2E6YA 1SW0A 4ICNA 3KM8A 1J0IA 3U6WA 3STPA 2PC8A 1RCXB 3MMWA 3SEPA 4PRRA 5CPSA 1OX5A 3AIVA 2QCLA 3EPMA 2OCZA 1F3WA 3FJ6A 1R9XA 4OIFA 3BAKA 1YRRA 4UOJA 4LYQA 2QGYA 3KCLA 4QLLA 3AYTA 4UMAA 2FLIA 4B3ZA 3W02A 2O56A 3NGJA 4IMAA 3EPNA 4PUMA 1V6XA 5CZTA 4PUUA 1F6KA 4JDBA 1UWUA 4IFKB 3WQ8A 4YHEA 4NU7A 1JYNA 2FZDA 1R30A 2EPMX 4AWSA 4RZ4A 3E1F1 3L7RA 4NQ1A 1Y0EA 2ZZ7A 3W25A 1LL6A 4PBGA 1E9YB 3QV8A 1EJ7L 3TQ0A 2ZZ1A 3OIXA 4J3VA 3V36A 4M19A 2Y24A 2QW5A 1GORA 4GJJA 2NT0A 4CQAA 1JZ7A 1VFOA 3M6DA 1NSJA 3CTTA 3CUXA 4HCHA 4C6CA 1QVBA 2Q3OA 3N2BA 3OG3A 1OQFA 5M2FX 2GGEA 2VOMA 5K9DA 1M6JA 3TNOA 1JZ2A 2RDXA 4IFOA 2XH0A 1JI2A 1LTDA 1BFNA 1RVGA 1SFJA 4L80A 1O1HA 3WF1A 4CEXC 4JS3A 5I09A 3A3HA 1UIPA 5E0CA 4KEMA 1PWMA 5ABFB 2ZTJA 3H70A 3NTYA 3QM3A 1PV8A 3FDKA 3SB0A 3E5BA 1P5BA 2QUUA 1D7KA 4OVXA 4GX9A 3W70A 2JKAA 3RG6A 4WXZA 4QJ3B 2XIMA 1VH7A 4XK2A 4Z1BA 1NQKA 2FDSA 2Y7FA 2WCAA 1FOBA 4CN6A 1KGUA 5KMYA 3WUGA 3GR8A 3P84A 2J6VA 2HBXA 1Y7VA 2QVNA 3WLTA 1HXJA 3WX7A 4XTDA 3ZJ8A 4V27A 2OGJA 2G3MA 1XIBA 2NX3A 2ZRYA 3QYQA 3OODA 3AUOA 4IP5A 3PJTA 2VHLA 2QCDB 1S46A 2E9MA 2YCIX 3R7MA 4P8WA 2HEJA 3W29A 4MY9A 3TFXA 5EYWA 4RLIA 5HXMA 1RK5A 1FH8A 4KETA 1O6IA 1R85A 5CLTA 3SO7A 3LGDA 1H49A 4X9SA 5G4HC 4HOZA 4ORMA 4S3GA 1S2CA 2ADAA 4AVNA 1QRQA 4IL0A 3N3MA 1E6XM 4UTHA 3P81A 3HQOA 2J88A 4C65A 5G2IA 4C6BA 4C5YA 4LCSA 3LGEA 3TN6A 4GC4A 3VIGA 2GUBA 2CKSA 3UZXA 1KWGA 4I90A 3LTSA 1XIEA 2YA2A 1M7PA 4TO8A 3LX9A 3HB9A 1JCJA 2UWFA 1KD0A 2F7FA 2J47A 1L0PA 3PF3A 3IIOA 1I2OA 1XYMA 3TJIA 4HHHA 3DFNA 2UZ9A 1JF5A 4HYRA 3GTNA 2QDDA 3MHUA 3UWQA 2ZA2A 4ICCX 2BY2A 3W6YA 4AWEA 3GNPA 4YPJA 3C86A 1IXQA 4UTTA 3UZZA 3KS5A 1EP2A 2CLKA 4DPPA 3JZUA 4LNYA 5BOEA 4N9BA 3MUY1 4O15A 2F8QA 1V3IA 3EKGA 4RNJA 1W9UA 3S2NA 3M5VA 4K68A 3KBMA 3NVTA 3BJFA 3CHVA 1SZEA 1KM5A 5CSRA 1JR1A 2YR1A 4MDPA 5BXTA 2ZZ4A 3MKCA 3TWAA 3R6IA 1YNPA 4CLMA 3WNNA 3L4XA 3TYUA 1XBXA 3QC0A 3ZZ1A 3O06A 1CXLA 4HNCA 2ZUWA 4GY0A 4K3ZA 1OX6A 4KEZA 1A5AA 2Y6ZA 3SJNA 1BG9A 1TV8A 3GKFA 3H24A 3BSMA 3O6CA 1RHCA 2WVVB 2YKKA 2V68A 1PE1A 3EWUA 3WG6A 1BHGA 3GAYA 1P0DA 3QPEA 1XFCA 3LLDA 2REQB 3LBOA 1C7SA 1YPFA 1UD5A 4GHRA 4M82A 4YVVA 4GZEA 3ABQA 1PWLA 3ZQ9A 3ES8A 1LLOA 1JDCA 5BW6A 2A7PA 3TXVA 4IUGA 4J4KA 1R3TA 4JTKA 1ZGDA 3PPHA 1GHRA 3MUAA 1FCUA 2XZ7A 3OZYA 4W88A 3AI0A 5HUPA 1ZB5A 2FZ9A 3UZYA 4W5UA 3SCUA 4BA0A 3LK6A 1EFZA 3ZSSA 2V3FA 4ROQA 3IPWA 1BLIA 2IKGA 4OJYA 1UPMB 2PC4A 3RJYA 1NP0A 4B15A 3GU2A 3WH7A 1TWIA 5D2VA 2FGLA 4YVXA 3ISIX 4MF4A 2X8RA 2GDQA 4AWUA 4IHCA 4DUOA 2PA6A 1W9PA 2PDPA 5TF0A 4QTGA 3AZSA 4ZZ9A 1UQYA 3M0JA 3HGRA 4IF2A 1FCBA 4JCLA 1CXEA 5BWAA 1GZJA 3Q45A 3TYZA 4GVHA 3QXBA 1G01A 2PGFA 5DRCA 3WDHA 1E55A 1PBGA 2WMHA 3W7LA 1KRMA 5CPMA 1BYCA 1U1UA 4RE3A 4O1CA 3CWOX 4G9PA 4ACZB 3G18A 4FPSA 3WJWA 3CQIA 3TSMA 3OIHA 3MBFA 2VEIA 2D3NA 3M43A 1W8SA 3GW0A 1YXDA 1AODA 3UXLA 4K7YA 3PTMA 1UD4A 2D2GA 2WMIA 4LF2A 1Q8JA 3O2LA 2HV5A 4X9YA 1XH2A 3CLWA 2CLHA 1DIDA 5JIPA 1H50A 4DXVA 2A3BA 4HD5A 1HO4A 4CD7A 2WJFA 1GVIA 2GGHA 4LAKA 1SJDA 2PTWA 4L1XA 4Q4MA 1DWHM 3OYZA 4L4MA 3I3BA 4X0VA 5I06A 3FK4A 5IBXC 1I0DA 2QEZA 3H2AA 1TIMA 1YIXA 3LY0A 1HGYA 2PDUA 5TAOA 1XBZA 3QOKA 3USZA 1KKOA 4ZSTA 2PRHA 3CT7A 4WY0B 4P8XA 4V1YA 3EWCA 3S6OA 1DQXA 3VIFA 4KT2A 2VI0A 3P5ZA 4BQ4A 3WEMA 4O1FA 4IISA 1XCWA 4O0KA 2V0TA 3BAJA 4RW3A 1NWSA 4X60A 4N4PA 5GNYA 1NP2A 1CLXA 1KXHA 4JX5A 5HPCA 5CGMA 3QGVA 4JQ2A 3VNKA 2WHLA 5CG0A 1IIGA 3TC7A 1XXXA 1QI4A 4AIOA 3TSDA 3G1XA 1VBJA 4UWMA 4ZO7A 5MKGA 3W1AA 3CU2A 3G1AA 1LL4A 4H01A 1R3RA 3GC2A 2YCKX 4TVCA 1UP0A 1V6WA 4IMCA 3L4VA 4BQ3A 3RM4A 2PDLA 3QMTA 4CN4A 3WFZA 1LZOA 4BK9A 4HKPA 1W8GA 3NQCA 2A7RA 3OG2A 1F61A 3GXNA 4XD3A 3NDOA 5I07A 1NJJA 1PZ3A 2BLEA 1OCBA 3C2VA 3SFWA 2G8ZA 3TCSA 4K2SA 1ONWA 4GQRA 3CUHA 1UH3A 3V5FA 4UMCA 2ATSA 3GIPA 1PCWA 1J11A 4JTQA 3W1RA 1R3VA 4W85A 3W82A 3TW6A 3PUDA 3MO4A 5A6TC 4I7WA 3MCNA 5C7HA 1XLJA 1GJWA 3DGBA 1UIOA 3W1MA 2GJNA 4AX7A 3GC4A 5J04A 2BXVA 3BLDA 4CQBA 1QWGA 3SCPA 3JVAA 1W1B1 1NDVA 1RD5A 1VQTA 2HXTA 4OUEA 3HQ1A 4NAFB 1H1YA 3MS8A 3QJAA 4MLRA 1IXOA 4GXPA 4Q7BA 2C6QA 2ZUSA 3GXDA 3ZOAA 2VRJA 1UOZA 1ZAHA 2R1KA 4UTJA 2VZOA 3C56A 3L4TA 1ELSA 3QHMA 4C6OA 4IICA 2R1MA 5DN1A 3N4FA 5CZ0A 2EO7A 1PX3A 2ZRUA 1VPXA 4B92A 1DKWA 3KTCA 5DMMA 2XH4A 1JXJA 4H83A 4FOKA 1UBSA 1KXTA 3DC0A 4MUPA 4HYVA 3PZQA 4EIVA 2H9AB 5CPTA 4XG1A 4L65A 3KLKA 2VCAA 3WN6A 1X38A 4WEVX 3RM9A 1ZL1A 2ACUA 5CQ1A 2PDXA 2YSWA 3FV9A 4MFDA 1A3XA 2ZRWA 4U4MA 5C70A 3LXCA 1T5AA 1AL7A 1R46A 3LMYA 1WBHA 3O6DA 4GH1A 4ZA0A 2J66A 4FAMA 2BODX 3KBVA 1MEHA 3I7RA 4DWSD 2FVLA 4Y9PA 4Q8OA 1ONRA 2Y8VA 4LUJA 2PLMA 1DXEA 4KEUA 4PUDA 7A3HA 1UJPA 3WJZA 4S3AA 3VDBA 5CSYA 3VKDA 1FTXA 5FF4A 5LNSA 1TA3B 2QUMA 4F48A 3GG0A 3WBEA 3O63A 1EOKA 5FEXA 3W1UA 2BTMA 3L21A 4DWSA 4RPQA 2OPJA 3T4WA 1FHDA 2QXWA 3GTIA 3AS1A 3FGCA 1JD7A 1TX2A 4V1XA 3W4RA 3FY1A 2DSKA 3AMGA 1ADOA 4NSBA 3SY5A 1POJA 5FJRA 1A5KC 5CG7A 1QI2A 5MF5A 3E12A 3VIKA 1VR6A 3OLEA 1WNOA 4R7OA 3C2RA 1NFPA 3MW7A 3U5UA 3EWDA 1V3JA 3BLOA 5E93A 7TAAA 3VKKA 1GTEA 3M1ZA 1UR2A 2FFIA 3ARUA 1MZRA 4O16A 1HJWA 2TMDA 2EJAA 3VCNA 2NQZA 1QDSA 3MJMA 3LUTA 3IJ9A 2F9RA 4S39A 3SCOA 2PD9A 5I6SA 1OFDA 4MHBA 1EZWA 2VDIA 3GVQA 3TUUA 4CD8A 1PXGA 3DFQA 3P62A 2POTA 5LXXA 4XUGA 3SCTA 1HIZA 2ABAA 2Q8XA 5I03A 4Q6XA 1L6FA 3C2EA 4C1NB 3QH2A 1JUEA 4GC3A 1O60A 5E1QA 3B8WA 3N29A 1SR0A 1WDPA 3H21A 1K77A 3TTSA 2DV0A 3NQ8A 1X98A 5RUBA 2WZMA 1ZPTA 2Z24A 1VFFA 4MZ1A 1X6UA 4HGXA 3SCWA 4TV6A 4C6JA 3PJUA 3L5LA 5T26A 5CPNA 4JXCA 4O53A 2WV8A 2HNEA 3P74A 1FQ0A 3BMVA 4HNTA 5HOSA 4O0ZA 1AH4A 3ARQA 1UYQA 3BMWA 2BGQA 3ATYA 3LTYA 4QGCA 1DBTA 4TTUA 1XFBA 4AZ7A 3U7BA 4BCEA 3ME3A 2VDHA 1CI1A 1OG6A 3S2CA 1F3TA 3R43A 1OZQA 4A3HA 4HMDA 3BARA 4DM1A 3IANA 5FOOA 3OGVA 1R0MA 1Q4NX 3JZEA 1M41A 1S5WA 4UXDA 5K7JA 5I5RA 4GA8A 3FNDA 4LU0A 3B8VA 2YZRA 3HV8A 1Z42A 4OE7A 1V3HA 3MTWA 1EKOA 3DYMA 3QFWA 4ZCWA 3WD0A 7CGTA 5IFPA 1RSCA 3BAYA 1HVQA 1TMLA 2WM0A 1TVPA 3WQ4A 2PCEA 4DO4A 1CPUA 2OR2A 1YNQA 4FNRA 5AHIA 2WAGA 4HMCA 3FKRA 3S5YA 1K70A 4A4AA 3EGJA 1E3ZA 3QF0A 1J12A 4AVOA 1VCFA 1NU5A 5JUVA 4IMEA 2D0HA 1MSSA 2HTMA 3ZMRA 3DAQA 4GQ0A 3ZVIA 2OWCA 4X2RA 4D1IA 2G4JA 3P8JA 4GUFA 5A8OA 4KW2A 6ALDA 3F1QA 3GR4A 4K39A 5AN7A 2ZZ3A 3AWNA 3W3OA 4ONVA 1KW1A 4I9TA 4C7GA 5K4ZA 1IZJA 3O6YX 2J25A 1MQPA 1VPYA 1PKLA 5K9XA 2XDFA 4F3HA 1EJXC 1W3LA 4PB5A 1WA3A 2MNRA 2VFFA 1JZ3A 3RMJA 1XIFA 1YADA 4JTLA 4PSPA 1XC6A 3T0CA 4ALDA 2J7FA 5EBUA 2CLMA 3G3DA 2R6OA 3KCOA 5A8QA 5HWJA 3GYEA 2H8ZA 4XZBA 3G5EA 1JYVA 1GVOA 2YCJA 5I24A 4O10A 3EA3A 2PGRA 2HRWA 1Z41A 3THUA 4AF0B 4IXHA 3R1ZA 3FSTA 5CSSA 1HN1A 1Z89A 3G3MA 4CU7A 1EX5A 1FKXA 5TNVA 2IPGA 1PEZA 1KTBA 1IWPA 3F5LA 5D2YA 3G1VA 5D4YA 3OO2A 1QASA 2G3FA 2XSAA 1PIGA 3H2CA 2C3ZA 2PWVA 1KRCC 3PPGA 3N15A 1V6YA 4XAFA 1QI0A 2VC9A 4D6EA 3MP3A 3PAOA 4PUKA 2NLYA 1EJUC 4ZQNA 1J01A 2E25A 1J9YA 2WC7A 2YA1A 1H51A 5LIKX 4D8AA 3LRMA 1W1TA 4G1KA 4JDYA 3R8RA 2G0WA 4S1FA 2Q71A 2C15A 3WELA 1MYRA 4OKDA 2A0NA 1OX4B 1XLGA 3LPFA 3VNMA 1IEQA 5LXEA 1OFOA 5D09A 4PFHA 3B40A 4HPXA 1FHVA 2ZVRA 5ABEA 1JPKA 1T8QA 1K8ZA 3ZJKA 4HU8A 4DF1A 3MWCA 3E9AA 3CIWA 5LA0A 1ICPA 3D3AA 1XIHA 3WNLA 1Q65A 1OT2A 4O0QA 2EG7A 4BF9A 5J8LA 3T0BA 3MANA 3NA8A 2FDMA 2WC3A 5LIYX 3MA8A 1IEXA 1EJSC 2YL5A 5H8MA 5ECUA 2P8BA 4Z0SA 2IKJA 5AKQA 2EPHA 3ARRA 4HIBA 4H04A 3W2NA 1DTUA 2D24A 2CESA 2HMCA 4UB9A 3K2GA 1UR3M 2IQTA 2DZWA 3EBVA 3VIHA 2WK2A 3C2OA 3UF9A 1SYTA 3STFA 5BU9A 5BXRA 3H23A 3VO0A 1GVSA 1E0TA 3KRUA 1RBAA 3AS3A 1TG7A 3L4YA 4TR9A 4DF2A 4C6IA 1HJSA 3M0IA 2OWXA 1UB3A 3FA5A 1FRBA 2FPVA 2W5FA 3UBPC 3U7VA 2C1HA 3C0QA 2PDIA 3GWQA 3WK3A 1YE4A 4H8HA 5CBBA 4P5UA 3CHEA 5AOUA 5DO8A 1WP6A 2JKEA 1RJPA 1QOPA 1K4HA 3OVGA 2V82A 4GO9A 3PS7A 4N2YA 1CIUA 1J6OA 2A2IA 2AL2B 3H4XA 1TJ2A 2YGYA 3IVSA 3V5OA 2F38A 4K8GA 1UKOA 2V2HA 1IE7C 1ISXA 3B4YA 1WO2A 1QNQA 1BWLA 5HQLA 3GHUA 3NQDA 4H6KA 4AZ6A 4CNUA 4MSSA 3EX6A 3FJNA 3W75A 1IYXA 3T44A 4U3AA 3LD5A 3W0KA 2VWSA 3TXZA 4YXGA 4MJZA 3BO9A 4OT7A 1OVDA 1SJBA 3NGFA 4NAEA 5DCDA 1D3CA 1EP3A 3WQVA 4LVGA 4DZAA 3IJ7A 3IIVA 1C92A 4IG2A 2QJNA 1JCXA 2PUZA 3B4UA 4KCUA 2BVTA 4J3SA 4QRNA 3G6MA 3AICA 3T0DA 1JNEA 4K1WA 2DIKA 4WGHA 3LLXA 1AMYA 4WSHA 1EIBA 3LTPA 3S47A 4K7VA 1OM0A 3THQA 3SCVA 3HGSA 1MW2A 1TRIA 5FJIA 3MP4A 3W85A 4W93A 2CIPA 1EH9A 2CC0A 2J62A 2E7FA 3L9CA 3PY2A 4CU8A 3PVFA 4WIWA 4WJ8A 5AHMA 1IR1A 2J74A 3IUHA 4W7UA 5AZ0A 1PZ0A 1F3XA 1VBUA 1P7TA 1BWVA 2WXDM 1Y65A 2BVDA 2AGTA 2C71A 4DUWA 3PTKA 3H54A 2R82A 3G77A 1XD0A 1ZHAA 3E6EA 3RXZA 1NY1A 1DV7A 2OMAA 2PS2A 1E6SM 1O7AA 2Z2AA 4JTUA 1A50A 1CW2A 5DMYA 8XIAA 3PZMA 1S5NA 3UQNA 3R0DA 1KM4A 1ML1A 3T6CA 1LDCA 1VYRA 4GH3A 3P61A 3OLDA 2QDGA 3ABZA 1Q6OA 4RV8A 5M1TA 3MCMA 1DWFM 3ITYA 2PTYA 1LOLA 2YDSA 3KBNA 1AJ0A 4JGDA 4O1AA 1DHPA 3BZGA 2DSWA 2QNEA 4ZB2A 5HNRA 4GE8A 3S1GA 4AZBA 1XDLA 2YBUA 2X1RA 1I4NA 5EA9A 5H1WA 2E4TA 3CV1A 2P10A 3B0UX 3HPZA 4OUIA 2OZ0A 1R2TA 4FZIA 4JR5A 2QULA 1EL3A 4UQCA 3CZLA 4J3ZA 3C52A 2O7QA 2RDTA 1F9CA 2VC7A 1XYBA 5C2GA 4JNZA 3ABSA 1GJPA 1BWKA 3XINA 4CVUA 4XVDA 3F4VA 3S4TA 4PTWA 1WXZA 1RZMA 1S1RA 3A9IA 3COTA 2VR5A 3CO8A 4NUWA 3RCNA 3S1WA 1G5AA 4JFVA 3TAOA 1YXYA 5HJYA 1G9HA 2DZBA 1G1YA 2VEMA 3OVQA 2VX4A 3GO2A 1HL9A 3KL3A 4UFMA 1KKRA 1LROA 4GIYA 2O9OA 3W24A 3W73A 4IPJA 4XBKA 1LCOA 1ZP3A 1S2TA 4DAIA 1FFQA 1OABA 1KTCA 3TYAA 3GXMA 3DESA 4AD1A 1QPQA 2A3HA 4U2YA 1LUCA 3ANVA 4YYFA 2XISA 2Y8KA 3EKZA 5K4XA 2E5DA 4V2XA 3LCWA 3RO6A 1OYBA 4W7WA 4D6HA 1X96A 1UR1A 4JYFA 1ME8A 4PEKA 1NAL1 3UYCA 1AQMA 3FYYA 1WQ5A 2WPBA 2X1IA 1TJ0A 2B81A 3WNOA 4ASTA 4GIRA 2GUUA 2Z27A 2FTPA 1P0KA 5HJLA 4L4LA 3FJ4A 2VP8A 2B4GA 1PHWA 1OCNA 3BAIA 3LGGA 5JXQA 1RP9A 1CLVA 4D6JA 1WKEA 2DZAA 5DXXA 3W1TA 1YPXA 3DX5A 3L23A 1VC4A 5A6SA 4MNJA 3VVGA 1CXKA 1OF8A 4UFKA 1FH9A 5A69A 1PIFA 5SWUA 4KIEA 4PA8A 2VX7A 4KEVA 1SO5A 4KWOA 1YXCA 3EOEA 1OIFA 1VIWA 2QMKA 1J2WA 5CC3A 3ZYZA 1K9EA 3QRHA 1R6WA 2ISSA 3M46A 2YDRA 5BYWA 3FX4A 3VGHA 1DEDA 1NOWA 2DPEA 3BPWA 1GQLA 3STEA 3CH0A 3BVJA 3CAQA 4KBXA 4WHBA 5A6JA 4PMXA 3SRFA 1SZFA 4C6PA 4EP8C 1ZJBA 4MNKA 1JCNA 4DZ5A 1UWTA 4DPQA 4C5ZA 2RDUA 1J18A 3WUEA 1PUDA 1TR9A 1RJQA 2WVSA 1JPIA 1FX6A 4X22A 4E2OA 4Q3MA 5D8ZA 4YYCA 1Q6EA 3W7RA 5HK4A 3H2NA 4GX8A 4REQB 2R8WA 3C4UA 5HUOA 4JIRA 2FZNA 1MZHA 4H9TA 5G1YA 3GHSA 1HTIA 4WY0F 4S3FA 3T40A 3KE0A 2W3ZA 1EZ2A 3P0XA 4L6HA 4IL2A 1KCZA 1VP5A 4NRSA 1B3OA 4WOQA 3GDLA 1W1VA 2LLEA 2PDBA 2PSNA 4F0RA 3F5JA 1H7WA 4W5ZA 4ZB5A 1I2RA 1L9WA 4A3RA 4NXKA 4TQTA 3PNUA 4AXKA 1QHPA 4PUEA 2PZNA 3AWOA 4GYPA 4ZVJA 4Y8EA 1FWBC 4UCGA 4W8BA 1XLDA 1O5XA 2EQDA 3VILA 4N7QA 1ZY9A 1LLWA 2OLAA 5FAGA 1VKFA 5ABFA 3K46A 2CWXA 5HANA 4S38A 1WDDA 2ZX8A 2ZXQA 3CYJA 4KRTA 3P3BA 4UCFA 3SBFA 5BMXA 1CXFA 1XD1A 4UUIA 4GI8A 3TX9A 4HT3A 3UG4A 4E8GA 2PWGA 1GTHA 1MXDA 3W74A 2ISVA 4PMRA 2OEMA 3FKKA 4B4HA 2VC5A 1UMLA 3PFRA 3CV6A 2YCLA 1A5NC 4PMVA 3I4EA 1RY8A 4RK8A 3UWYA 3VK5A 3BANA 3IGHX 1VCGA 2XN0A 3MJYA 2ZXBA 3APGA 3E5PA 4H9YA 1RR2A 1RQHA 3LDVA 1XC4A 4G1NA 4RDWA 4HZ8A 5AVHA 1XR2A 2TODA 3WJXA 2EKGA 3L2LA 3W27A 1CGYA 2HS6A 2V30A 1S2VA 3VIOA 4QQUA 4R9XA 3L12A 1HO1A 4ECLA 1UZ1A 2VJXA 2OSXA 3PANA 3AIRA 1AA1B 5DANA 3WK2A 5FKYA 2WNNA 5FJOA 3MWAA 4NJHA 2Z1KA 4IMFA 3H2OA 2VQTA 5IDIA 2OG9A 2J77A 4AXNA 1WDWA 1XLCA 3PN8A 4GUHA 4KGJA 4J2MA 2PBGA 1FWNA 2PRMA 4RE0A 1W56A 3EDJA 1W54A 2JK2A 1FDZA 3CT2A 2GGJA 2O9TA 3OTRA 4EPDC 1XICA 3VDAA 4LBSA 2PFHA 3CIVA 4ZENA 2E9BA 3IVUA 4F0KA 3NQ6A 2AAMA 4GG9A 4DJDD 2VZUA 5C9XA 1UHVA 3TLLA 1O5RA 3L5AA 4QJ4B 3VIPA 3PSWA 5DBTA 1ZBCA 1H7NA 3GHRA 3TN5A 4GUJA 2PB1A 3QY8A 1VYSX 4US5D 1X8CA 4E4UA 1P6WA 3HJZA 5FI8A 1ZAIA 3F4NA 3VM7A 1R3WA 1VBRA 4DJDA 4CVWA 1JUKA 3NSNA 3PAJA 1N55A 1XGDA 3F4CA 3SSJA 4UNLA 4L9XA 3Q58A 3S6DA 1F74A 2A3LA 4US5A 3AYVA 2TYSA 1GCYA 2VC6A 4HSHA 2DP3A 3VUPA 3TKFA 3MY9A 3OVRA 1PL9A 1C9DA 4UOZA 1QW7A 3S0CA 4RZBA 2I9EA 4PFMA 5A8GA 4DUXA 3T09A 4DRSA 5DBUA 3GNDA 1UP2A 2JEPA 4QSHA 4O11A 1M04A 4MWAB 4O50A 3OBEA 1MQQA 2WVVA 2VR2A 1N8IA 1NDYA 1MNSA 3WH9A 5HQMA 2REQA 2G37A 4QDPA 3TU9A 1W31A 1NF0A 4JIQA 3OGRA 3VFLA 4LVDA 4GRSA 1W3HA 5GPRA 2D2JA 3SQMA 3NM3A 4KWUA 4PTXA 3W7CA 5C8BB 5DCBA 4Z1CA 4RCXA 5A2BA 3EEGA 3CGTA 3R8GA 4JOMA 4WGXA 2ZIDA 3GZ3A 1NDZA 1Q13A 4JQ4A 5REQA 2EBNA 1DXFA 3SN4A 3CLMA 3DFTA 2PDFA 4R85A 3WNKA 1SQ7A 4RNFA 4DLFA 3LOTA 4XWUA 2GVJA 3M07A 4QHRA 1MW0A 3BOLA 1MWOA 3RO8A 1TPFA 3UNTA 3UXIA 3GSMA 2ZCGA 2WBGA 1J0ZA 3WJYA 1ZU8A 5FD0A 5TQLA 2CKRA 1GVYA 2DSUA 4IIBA 3MUCA 1MEIA 3STCA 5D38A 1ZLPA 1TPEA 5DLCA 1DYSA 3KOXA 3ATZA 1JFXA 5F2GA 4B5UA 3RLVA 4CNPA 2VD8A 1UR8A 5BRQA 3VE9A 1OFAA 3L67A 1IR2A 1EGZA 4S23A 4HU0A 3B9NA 1XLMA 1BF6A 5FA5A 2QPSA 3GDKA 4DB7A 2W66A 5DELA 5G2WA 1FHLA 1SVDA 3QTGA 1HG3A 3GNOA 3R2GA 4XZLX 1B30A 3IUDA 4AB4A 2J7DA 3KP1A 4FR1A 1GYLA 3MP5A 3PP7A 4D71A 3LBMA 4E3TA 2P3ZA 2ALDA 4LT9A 1H60A 1K3UA 3S6TA 3KOFA 1E5JA 4JKMA 2TAAA 2BBFA 3AALA 1B3YA 4L9ZA 2DT3A 2GJXB 5I3KA 7REQB 3OW1A 3SIZA 4AZGA 3BE7A 4ZO9A 1TTJA 3K8LA 3WDIA 2PF8A 3ZM8A 1BTCA 3IIXA 4GGHA 3M5YA 4H9UA 3I7SA 1CX9A 2XUCA 4D6FA 3LHVA 6TAAA 3ZFHA 4N0RA 3SJ3A 1M9HA 2Q8LA 3DHFA 3F4DA 7PTDA 1TTPA 3CAVA 5DMNA 1M1BA 2C0AA 5FEPA 3O15A 2QIIA 4K8HA 2VR4A 3S83A 4HA3A 2PLJA 1DJYA 1R47A 1IXNA 4G7FA 3ARSA 5FJTA 3N11A 4LY4A 3CEPA 1K8YA 3NSXA 3W72A 3ZT5A 1POKA 1U1HA 1PPIA 3IV3A 2QF7A 4JKLA 1DP0A 3CK5A 3R0UA 5FCZA 2J8TA 3TSBA 1EXPA 3M41A 1AZ1A 3GG7A 3GKAA 4MJ4A 1SUXA 1ME7A 5LNRA 3BLLA 4IOTA 4A29A 1H63A 1GJUA 1VENA 4S3JA 3WIJA 1PX8A 1ONEA 4WKAA 4IGSA 3DCPA 4L56A 3CQJA 4ZE5A 3V0SA 3MT1A 1MMFA 3Q2DA 3DYPA 3EA1A 4PMZA 5DXYA 1S3TC 1G0CA 1T41A 3RX4A 3W2KA 1ZJIA 3U4AA 4MGGA 1EF3A 3SRHA 4Q8NA 1IT0A 3AXMA 4B16A 3B06A 2BP1A 2VO5A 1HKJA 4AYGA 4IZGA 3FLUA 3MDWA 2YJQA 3WDRA 2V2DA 2ZVIA 3PB2A 5EBAA 3V18A 1QNSA 3T05A 4R33A 4D2JA 2OZ8A 5CJNA 5I2UA 1FWWA 2FTWA 4FF5A 4NG3A 3ID7A 4FX6M 4RE2A 2OQHA 1DJWA 1R86A 4KWVA 3DENA 3URQA 4GY1A 4HNUA 5M03A 4NNCA 2CHRA 3TVAA 1IZKA 1X8FA 3SURA 3LSCA 3W2MA 1K7EA 3WY1A 4BWLC 2DSZA 2ZRXA 3G1DA 3UPBA 2P53A 3E49A 1PDYA 3WBAA 5C2CA 4GINA 1XRFA 4CNNA 2VGBA 1T0OA 2XIQA 3M5XA 4J7RA 3LA4A 3HMCA 3W81A 1GQJA 3ITGA 4AD3A 9RUBA 1GOOA 1F76A 4AY8A 5TIMA 3EXTA 4IJCA 2H9AA 5F7UA 1MUCA 4OBSA 4ZOAA 2QS8A 1X39A 1A3WA 1EDQA 2D69A 4QITA 4WCJA 4OZOA 3S42A 3TEVA 4MJMA 1XIMA 2WMJA 3T2PA 3A22A 2B7PA 4KH2A 3B0YA 2UBPC 2CBUA 3PTQA 4Z2GA 5CZJA 2Z26A 5DT5A 4H2CA 4Q33A 1VLIA 3MHFA 3LRLA 4Q4PA 3RRAA 1FWEC 1RH9A 2DZVA 5AYYA 2XIOA 3HG3A 2VFIA 1BQGA 3GY1A 1HP5A 5EKYA 4AU0A 5EPDA 3BG9A 3VIIA 2H3BA 4DJED 1R9YA 4UTWC 3UXAA 4UTUA 2JF7A 1JVNA 3AXIA 4OV4A 3PK7A 3IJLA 1ZSXA 3R12A 3D3FA 3GIYA 3N34A 1Q3NA 3E0FA 3PBGA 2BG5A 3W84A 2F61A 2A79A 5A6AA 4LB3A 2Y63A 4AD2A 3NL5A 2VFDA 3MBDA 2XVLA 4DJEA 2W63A 2OOFA 4YLWA 2HE8A 5F4SA 1HT6A 3M6YA 4H41A 1SO4A 2DZTA 3L4WA 3VUSA 4WKFA 4POCA 1EX1A 5XIAA 2ZUUA 3WKZA 1JIBA 3CXOA 2IQDA 4LSBA 3LBCA 1TUFA 2WB5A 3EX4A 2DVXA 1J2BA 1S39A 4G7EB 3T0TA 2CNCA 4LVAA 2R9RA 2CWNA 3LN3A 1YEYA 2WMFA 1A47A 2OZ3A 4K1GA 3HGJA 1BGAA 1EHAA 1Q4WA 1MDLA 2YDAA 3D5HA 3F2DA 1JZ6A 2WSQA 1XHGA 3AYSA 3D6NA 3NAVA 3LLFA 2PBOA 3NEVA 4IX2A 4C1NA 3KRBA 4H6QA 2VX6A 4LV9A 1EYEA 1UD2A 4Q32A 1DWIM 1TPUA 4PRWA 1CZ1A 3DG6A 3GFZA 1NWRA 4M29A 5HNUA 2XINA 1JF6A 3R10A 4DY1A 3NVDA 3MHGA 3DI0A 3POCA 5U4NA 1Q7MA 1TCDA 3FIGA 1JRBA 4I6KA 3C61A 1XYCA 3E38A 3WQDA 4XKYB 1BXCA 4FNSA 3QVQA 4JIPA 2G97A 3NPUA 3PG9A 3NQEA 2GOKA 3NPXA 2J7BA 5A2AA 3UJRA 5DMLA 2DW6A 4F0LA 4LCRA 4A35A 4JBRA 5CXPA 1OADA 1B2YA 5E70A 2VZSA 3M0XA 2PP0A 1H7PA 3UWVA 4DEFA 3INPA 3NEHA 1OGGA 4JQ1A 3SW6A 5U7SA 1CXIA 3WF0A 3TROA 3W00A 1V79A 2CERA 3UYIA 1MRAA 2DFAA 3VI2A 3SAZA 1R87A 2J9YA 5LA1A 3A3WA 3TLQA 4DN1A 1KM3A 1IGSA 1MRQA 1E73M 3N6JA 4MB4A 1LQ0A 3ELFA 4NJJA 4YIWA 1ME9A 1QO2A 4ZTYA 3SZ8A 2A1YA 1UD6A 2RAGA 1SSGA 2C13A 4QCFA 3RUBL 4ZO6A 5K3VA 4XVEA 2OSWA 2FVKA 3OZPA 2GK1B 4PRTA 4XISA 9CGTA 5LIXX 5G4WA 4FO4A 2QIWA 3HV9A 6REQB 1A5OC 2Z1SA 4LUSA 3P67A 1XUUA 3UA4A 4ERGA 3ONCA 4M56A 3NSMA 2VM8A 4A8LA 3TMLA 2FB3A 2V38A 1JZ5A 3RHGA 1B3VA 1WOBA 1DJNA 2PWUA 3E96A 3O3RA 2ON3A 3N2TA 4QCEA 5JQ9A 4HTYA 3ARVA 4US6A 1G67A 1GVQA 3MVIA 3WZ0E 1TV7A 2QLYA 2WNQA 5I77A 3URAA 1FWGC 5KITA 3CMGA 1FBAA 1SO6A 1KM2A 4J35A 2J9ZA 3IGSA 2A85A 3UG8A 4NF7A 4LOCA 1R3SA 3PPCA 6TIMA 3ITXA 2WWDA 3RR1A 4MADA 1YDOA 1X6LA 4QJ1A 3LCXA 4M5PA 2W9MA 4J3WA 4B4FA 2I5IA 2FZ8A 3WDQA 5FSEC 1UC5A 4AEEA 2Y62A 1SW3A 1YNYA 3UP8A 5D05A 4KCWA 1HKIA 1TMHA 4EF8A 5JBEA 1OC5A 1DJHA 3NQFA 3NQAA 4HZMA 4C1KA 3CMJA 3N1AA 3WF2A 4UR8A 1R7AA 1US3A 5EY5A 3RRXA 2YOCA 4GQGA 2X0HA 3QZAA 3EDKA 2GL5A 5LIUX 4O8RA 1UKTA 5DY2A 4MZ8A 4M81A 5KZMA 1L2UA 1TTQA 2NV2A 3MCOA 2GWGA 2RGMA 2E6AA 4NVTA 4A8NA 3NDZA 1F3EA 3TAKA 1V3KA 1XM3A 4WF7A 4Z2IA 4D6GA 3B03A 3WQGA 3DIPA 2I1OA 5D9MA 4HZ7A 5AYZA 2NQ5A 1REQB 2WANA 1OX4A 2VVSA 4JNYA 1D8WA 4LJ3A 3NWRA 2OX4A 4F0MA 1SFSA 2WZEA 1LRNA 4RX0A 1JAEA 2NQ9A 1KLZA 1EQCA 1WKFA 5D9PA 1UR9A 1XRSA 1SMDA 2QAPA 4XD5A 3LCGA 3UWEA 3TZNA 4ES4A 1R8LA 2C1GA 2P0IA 1M68A 4IQEA 3PZUA 3RU8X 5L6UA 1XW8A 4GOAA 1RQEA 2CITA 3QPYA 5E0FA 4O1DA 1I2PA 1R3QA 1VZWA 3ABOA 3PC0A 3T08A 3EWXA 1DE5A 1YBQA 1UBPC 5IM51 4WD0A 2WCGA 1PJ9A 4KFNA 3UA3A 2QV5A 2QAFA 3MZNA 3QTPA 4U31A 3IUIA 3MU7A 2DQWA 2BY0A 4NZ5A 3UR7A 3THCA 4FK9A 2XIIA 2Z6IA 1RBOB 3D0CA 3MKKA 4HU3A 3W6LA 4YTSA 2VZVA 4JZ5A 3C3NA 3P60A 3H7UA 4NZ4A 2WQPA 1VAHA 3O05A 1QOXA 1UWQA 2WHJA 3WF4A 3NR0A 4MDOA 2W61A 3KVLA 3BW4A 1FH7A 2FTYA 3HPSA 5LHFA 1F05A 3TYDA 3OZOA 1AD4A 3NZRA 4JTRA 4H7ZA 1C3FA 1Q6RA 1HJUA 3QR0A 1KGWA 2B7QA 3H4GA 4Z2HA 2H90A 3DFHA 1IGWA 1VRXA 2WHKA 1R3YA 3W88A 1K1DA 3G24A 1Q6LA 2NX1A 3QZEA 1XJBA 3V0TA 4DAFA 3IGUA 1D3HA 1YQ2A 2D0FA 4EPEC 5KEZA 4YTQA 4XO7A 1NVMA 4HK6A 4DJFC 1H09A 4GUIA 2V5BA 1E6RA 5CEWA 3DG7A 3LNMA 3G1FA 3MVTA 2QCMA 3W26A 4C6EA 3LXBA 2VGFA 1W2VA 3BW2A 2HROA 4GVFA 4WK9A 2XIJA 2ZBTA 5C0QA 1QT1A 2PURA 1LT8A 2D73A 1HP4A 1PB0A 3HTWA 3V0UA 3WMLA 3CHCA 2CBJA 4DI9A 2VVNA 4K37A 1XKYA 3TJXA 1H1ZA 3LCHA 2WVUA 5LHEA 4C6QA 3LCFA 4XO6A 4BQ2A 3NZGA 4EOUA 1C91A 5AY7A 3JR2A 3EOOA 2HZGA 3CNYA 3I68A 1FWFC 2HNHA 4UFJA 2OEKA 5I23A 3SUWA 3DZ1A 4FEZA 4BFAA 2VEGA 3TTOA 4MAVA 4N42A 4HNNA 2EGZA 4HZ6A 5HAOA 2J24A 2Y8UA 3FCPA 2WMGA 1FKWA 4Q8PA 4UTFA 5C9WA 2EAWA 1QJWA 2BSLA 3GW3A 2ZDRA 2YW4A 1BRLA 2OODA 1J0HA 1DORA 4FLOA 5DQPA 2WSRA 4TTGA 2C8NA 3AU6A 1CGUA 4I5XA 3WLRA 1AH0A 1YYAA 3KDOA 1JDAA 3DKLA 5FF0A 1QO5A 2W27A 2Y5SA 1ZBWA 3GXFA 1TZ7A 3HN3A 4QR6A 3TW9A 2ODOA 3EMCA 4U5IA 5EU9A 5LSMA 4LTSA 4NY2A 4R7WA 2XYLA 4DUVA 4HMNA 2V3EA 2WO5A 3UETA 4LXFA 1QK2A 4P61A 4YTRA 4ZODA 1KR1A 1IT8A 3WNPA 4UQEA 3R11A 5D03A 2Y7DA 1QK0A 1TMQA 3IJ6A 1OF6A 4MKSA 1W5NA 4Z17A 5AHEA 3AMDA 2BOEX 3B8UA 5CC6A 4O4WA 2WKJA 1J79A 3SADA 3WD1A 2ZDSA 2O0TA 2XPKA 4MYXA 4WDTA 1GNXA 1VEPA 3GC5A 3K30A 4N9DA 1MW1A 3KL0A 4WOZA 1O4UA 2D1ZA 4MVAA 1J0KA 4AZCB 5MKGB 3V7PA 2YPIA 4AISA 4XIAA 1F73A 2WNZA 4QEHA 2QF8A 3KVKA 4XZMX 1ISYA 4ZQMA 3L65A 3CPGA 4B5NA 4AYSA 1W1PA 6CGTA 3NYZA 2UY3A 1YDVA 4FOUA 1WZMA 2JIWA 3UG5A 1XCFA 3HO8A 3VCRA 1TV4A 5DRIA 4JAWA 1GYNA 3PHAA 3NL3A 1XRTA 2FVMA 4LALA 3NZQA 3GTFA 3CMFA 4CD5A 1WZAA 1L6WA 4JN7A 2PWDA 2J27A 3TA9A 2NV9A 2P88A 3ARXA 1B54A 3R58A 2X1SA 3ZWSA 4ZSUA 1OGSA 4PUNA 1XYLA 1NOFA 4IIDA 3QQWA 1UKPA 4UZUA 4BQ5A 1AUSL 2QZRA 4CUCA 3NNTA 1I6NA 2R1LA 1FWIC 2C7FA 5GNZA 4ZB0A 5EMJA 3WLOA 4YN5A 1T40A 4ZMGA 4EANA 1Q7QA 3BJTA 1UWRA 2FMNA 2A4AA 4IQLA 3KW3A 4R5EA 4MB1A 4GD0A 4GO8A 2Z0IA 3BLIA 1AVAA 2VEKA 2QJMA 4J2PA 4H6RA 2CHOA 2GOUA 2V6AA 4NHVA 1ZJAA 5I02A 1KFCA 3W7QA 2JGYA 2VNCA 4E6MA 3W23A 3RCMA 3KFTA 4QS6A 5D9NA 4GVGA 3P0WA 2PF0A 2XM1A 4LPCA 1FCQA 3VU2A 3ZS4A 4GI4A 2BOGX 2DJLA 4ATDA 4LS0A 1PYMA 1FFRA 3UCQA 4PL1A 1CGVA 3FW6A 2OSYA 4Z2LA 3H2EA 1DHKA 3QV6A 1OC6A 2JBMA 4QLJA 1J5SA 1FP9A 3O1NA 2FGBA 4GYJA 3CUZA 3QLLA 3A12A 4F4RA 1R5YA 1E6QM 3PBMA 1XBYA 3EAUA 3U57A 3F7JA 3KZSA 1OZMA 3MO7A 4AMAA 5CC7A 1XSKA 4UQDA 4X61A 1JAKA 2Z1VA 2ZTKA 4AUBA 1K03A 1O68A 1P43A 3LI1A 3GTHA 2HQAA 4MB5A 4AEOA 3FAXA 4PC8A 5AC7A 4U5KA 4LYKA 4B91A 4XBSA <