4HZ6A

Crystal structure of bglb
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
441
structure length
441
Chain Sequence
KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Beta-glucosidase
total genus 176
structure length 441
sequence length 441
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz6A00
1CECA 1E5NA 1HKIA 1XH2A 3QHMA 4URIA 2VVNA 3T0BA 1V6YA 3GXFA 1EOMA 3NSNA 4BQ5A 1KWGA 4TX8A 1QI3A 5LA1A 4AZCB 3U5YA 1WO2A 1JD7A 3THDA 4UZSA 4F66A 3IK2A 4U31A 2CBVA 2E0PA 2ZUWA 3WD2A 3BCDA 2JEPA 5D9OA 4GZIA 7TAAA 3WKZA 3W29A 1QNOA 5FD0A 2VVSA 4AW7A 3N15A 3WDPP 3SCTA 2VZUA 2WC4A 1TA3A 4HOWA 1WZAA 3AIQA 4TUFA 1H09A 3K1DA 3WF3A 3VX1A 3AHVA 3VIGA 2QV4A 2D22A 1LF1A 3W53A 1X6NA 2VQUA 3SCVA 2J7HA 2J7EA 3CH9A 1R7AA 3ZJ8A 4JIEA 1BSIA 1PAMA 1JXJA 1WDSA 1E4NA 1PIFA 4UFLA 4WIWA 5E6YA 1R87A 1EDTA 1Q6FA 3RIKA 2XSAA 1C90A 3PZOA 3DYOA 1ISYA 1CGYA 4CU6A 3MSDA 2WVSA 1U33A 3F5LA 5BWFA 1UD5A 2OSYA 4OJYA 4XX6A 3AIVA 5A6LA 3S2CA 1FFQA 1V6XA 1VFMA 2WHKA 3GBEA 3RJXA 3AOFA 4CCDA 2WKLA 4U5KA 5I0DA 2V3FA 1JI1A 1LWHA 4S3KA 3QHNA 3ALGA 3SCQA 2PBGA 5IHSA 2VX6A 2VZOA 1U2YA 3ZT6A 4EAMA 3WDQA 3M07A 1N82A 4H04A 3BLKA 2FH6A 2PBOA 3WF2A 4DUWA 2D3NA 1I1WA 4AC1X 3AJ7A 4YHEA 3OZPA 1J0HA 2A3CA 2J47A 4BZYA 1M7XA 4HA4A 3WQ6A 4HZ6A 3VGGA 1CXLA 3TTSA 3II1A 1HJXA 4IM4A 1I75A 4ATLA 2WK2A 2Y8VA 1MXDA 1QW8A 2J25A 4IISA 2XM1A 3UESA 2CESA 3WF4A 5M03A 4D1JA 3MMUA 2XYLA 4HMCA 1J0YA 2VJXA 4U33A 1TA3B 4P8UA 1GW1A 3WNPA 2W63A 4W89A 1HKJA 4HU8A 3K4DA 5EB8A 1OD8A 1MVYA 4FF5A 5HNNA 3PHAA 1GOQA 3WUFA 5ABGA 1JF5A 4MB5A 4ZFMA 1B30A 1E0WA 1UWSA 4ML4A 1LL4A 2B31A 2QF8A 3CUGA 3QOMA 3TP4A 1R85A 1E6PA 2CHNA 5LA0A 4GINA 4FLQA 4YPJA 3GNRA 3U57A 5CLTA 4AD1A 1UWUA 3PN8A 2VT0A 2OSXA 2F2HA 2GSJA 1BVZA 1OSEA 1W1YA 1TCMA 1V3LA 1E72M 3S6TA 2PC8A 3IAPA 2ZX8A 5CG0A 4QFUA 4CD6A 4MDOA 1V3JA 1MYRA 3UCQA 4L4PA 1BF2A 2BHZA 3B9AA 1E9LA 4D71A 1UHVA 5D9PA 4UQEA 1MQQA 1EH9A 3WUBA 3WMBA 1C8QA 1JYXA 3HN3A 2EPLX 2ZUUA 1DWIM 3CHDA 5FOOA 4PMVA 3W0KA 4OUEA 1PIGA 1WAWA 1UWIA 4DM2A 1EQCA 3OLIA 2JEQA 1HP5A 2Y8KA 1ZB5A 3BCFA 2EXOA 3FXYA 5DMYA 1G94A 3CZLA 3WQWA 3AHXA 1JZ2A 2VX5A 3FNDA 3VIJA 4R27A 3GH5A 6A3HA 2WVUA 2ZE0A 1QPKA 3VDCA 1GNXA 3AIEA 3FHQA 5A8MA 2VRKA 4AD3A 3I3BA 3PZQA 1PEZA 2VCCA 1UWTA 1RD6A 4DWSB 1W9BM 1ZJAA 1J0IA 2E3ZA 3AFBA 4FLRA 1DWGM 2WMIA 3WH6A 4B9YA 3WY1A 1W2VA 2O9OA 4YN5A 4J3UA 1MQPA 3M6DA 2A3AA 2EJ1A 4PMUA 2WSPA 1FOBA 4J3VA 4W8LA 1V0LA 3ARTA 2XGBA 1SMDA 2WHLA 1J12A 3MUAA 5FL0A 3MV11 5GNXA 3VIHA 5D9NA 2C0HA 3O6AA 4WSKA 1UD3A 3BH4A 3ARQA 3CLWA 2PI6A 3IJ7A 2WNWA 4E8DA 2IXVA 1UA7A 1G1YA 3IANA 2X0HA 1CGVA 2DH3A 2WMFA 4MB1A 1EDGA 3POHA 2G3MA 3OLGA 1V03A 5DT5A 1B2YA 2ZX6A 3AMGA 1EGZA 2QMKA 2OLHA 4AIEA 1PPIA 3VGDA 3ARZA 4UFIA 3MKKA 1V3KA 4DWSC 1MW3A 1KQYA 3AMLA 1K9TA 4H7VA 3W6LA 4KMQA 4U3AA 2FHCA 8A3HA 1VENA 4FLOA 4GQQA 1GZJA 5A6SA 1LL7A 1HIZA 3MV01 4P8XA 3NUKA 2GK1B 5GPRA 1E6SM 3UG5A 2J7CA 1P6WA 5EFFA 1OIMA 5D8ZA 4ZE4A 2DEPA 3OGVA 5D8WA 2WBGA 3DECA 4W7WA 3VD3A 3T2OA 1F4HA 2JE8A 2YLLA 3WMCA 4F9JA 1K6AA 2BVYA 5FKYA 5JBFA 1PBGA 3PZTA 3BSHA 3WQ4A 3WD0A 4D6GA 1XYFA 3GXDA 1CBGA 4MNLA 5CZKA 1C91A 3UETA 4HPGA 2VR5A 4DWSD 1BG9A 5M5DA 3AHTA 2PB1A 3K8LA 4ZXOA 1MW2A 4P7RA 2BNJA 1ZBKA 4D6JA 1GORA 1VAHA 4TVCA 3THCA 4H8HA 3ALFA 5A6JA 4JCMA 3BLPX 1GQKA 3KL0A 5BXPA 1IT0A 1UR0A 1EQPA 3WEZA 2ESCA 2X2YA 2WXDM 1K9DA 2W92A 2YDRA 4QCFA 2CBIA 4HP5A 5CGMA 4AZIA 3WDJA 4C7GA 3WNMA 5A69A 3GXMA 1UH2A 4F9DA 2O9PA 2JFEX 3AICA 3CUJA 4EKJA 2BY1A 2DT3A 3VO0A 1CXKA 1JYWA 3VX0A 3IJ9A 1E71M 3NYDA 3CPUA 4NI3A 4KGLA 1H4PA 2J7GA 1H3GA 1OCQA 4MNJA 5BRPA 4PTWA 3BSGA 4D72A 1SFSA 1UR1A 4GI8A 2J62A 2BVDA 3GH4A 4M82A 4WK9A 4B3KA 2WM0A 4UQBA 1UKPA 4UOJA 3UR7A 1JNEA 4LX4A 3BC9A 3OBAA 1BYCA 2HISA 2W5FA 3OZOA 4GPNA 1W1TA 1HJWA 1FH9A 3MMDA 3RCNA 3BAJA 2VL4A 3VTRA 4CD4A 3SUUA 1E43A 4OKDA 3PTQA 1JDCA 1VIWA 2Y4SA 4NZCA 3NJ3A 5TD4A 1GOIA 3SCUA 3VM5A 1VEPA 3RILA 1ESWA 2NT1A 3GBDA 3FW6A 3IAQA 3AXXA 1B1YA 1G0CA 5AC4A 4AD0A 3SUWA 5HBFA 4BS0A 4A4AA 3WEMA 1KBBA 2DSVA 2G3JA 2E9BA 2C7FA 2DSWA 4KRTA 1XC6A 4LQ1A 2ZUMA 4JFWA 4OOUA 3ZT5A 5BROA 3WH9A 1FH8A 5GQBA 4PSRA 1UR8A 5EBAA 1M53A 6CGTA 4GO9A 1UWRA 2XTKA 4S3JA 2VX7A 5GNYA 5CJ5A 5A6BD 5KEZA 1UH3A 2WMHA 3PZIA 2PWGA 4H8UA 5CLWA 1CPUA 4MPKA 4W93A 2G3NA 4PN2A 4WKAA 2XWDA 1S46A 1JYVA 1BTCA 4PTVA 3WNNA 1B3ZA 1NWTA 5BCAA 2CNCA 4A3YA 2VZVA 1NWRA 4MADA 3A3HA 3EDDA 2DPEA 5BRQA 3FHAA 1O7AA 1QNRA 2GDVA 1ZBCA 2PWHA 1J01A 5AC5A 2XHYA 1GOOA 4Z2IA 3LPFA 4QP0A 1Q6EA 2EBNA 3U7BA 1DWFM 4AEEA 3AZSA 4AD5A 1EXPA 3WD4A 1IZKA 1E6XM 4M29A 4RE2A 3CHFA 3W24A 3HU7A 3E1F1 2NW0A 3EYPA 2ZUNA 3VM7A 1C7SA 2V38A 2JF7A 3EDJA 1GUVA 3ZSTA 4UTFA 2ZUTA 2WB5A 1HT6A 4ZE5A 1JFXA 1GQJA 1HL8A 5A8QA 2WBKA 5A6AA 3AZRA 3A4AA 1V08A 3GH7A 4CD8A 1UA3A 4E2OA 4MAZA 1C92A 1FP8A 3K8MA 1ZJBA 1UOKA 1K9EA 1QHOA 2Z1SA 2BFGA 1OT2A 2VQTA 1J11A 3O2LA 3TTOA 1ZBWA 3NCOA 4MB4A 4PTXA 2IUZA 3N1AA 1B3YA 2ZXAA 5C8BB 3L4TA 1A47A 4W8AA 5A8PA 1W9XA 3WFZA 3APGA 3KEHA 3T2PA 3U7VA 2ZX9A 5HPOA 4Z2HA 2VI0A 1W9PA 5BXTA 3QGVA 3QR3A 2PWFA 2WMJA 1E70M 1ZS2A 5A8OA 1HKKA 1NM9A 3ARUA 1W3KA 1NOFA 3RM8A 4CGTA 1BYAA 3WSUA 4M56A 3WN6A 1W32A 1VEMA 3VD7A 4MTVA 2DGAA 2W4XA 3D3AA 3KL3A 3WDRA 2J7FA 2XSBA 2X05A 1HX0A 2GJPA 2Y24A 1UH4A 1EHAA 1BHGA 1US3A 2ZWZA 5CPTA 2WKGA 1HP4A 3M46A 1KXVA 1WZLA 2OWCA 1C93A 4Z2GA 1JZ6A 3VD4A 3ARWA 2XPKA 1H1NA 4BF7A 4P7OA 5DO8A 3BAXA 4AD4A 2VTFA 4JKKA 3SCRA 5CPSA 2DSZA 2E4TA 2V5CA 1CZ1A 4GZJA 1HKMA 3VNYA 4BQ4A 1GVYA 4CKQA 4FLSA 1U30A 2G8ZA 3J7HA 1L8NA 2GVYA 4PMQA 1G9HA 1E15A 1BYDA 1E4LA 4FMVA 1HXJA 2E9MA 2DSUA 4AZBA 4UZUA 2DDXA 2EPKX 4ACZB 3T2QA 1DTUA 4J3XA 4M81A 2ZXDA 2J75A 1HJSA 1VF8A 1IV8A 1NWSA 1GHSA 3KZSA 4L4OA 2XJ7A 2JALA 1LL6A 3VU2A 1W1VA 1JFHA 2XWEA 1EHNA 2WLYA 2YA2A 5CSYA 3ZJ6A 2CBUA 4ZEPA 1E6QM 1W9DM 3GNPA 3VD5A 3UERA 4HMDA 2DT1A 3AROA 2PWEA 3OLDA 4GI6A 4W84A 2WSKA 3SCSA 2Y5EA 3ZO9A 5HPCA 4U2ZA 2VX4A 4J27A 3W37A 3N11A 1W9UA 5DT7A 2CERA 1WE5A 1M01A 4U5IA 5IFPA 5M17A 4OBRA 5HXMA 2OYLA 2XFFA 1UWQA 1E73M 1H0IA 3LPPA 3BAYA 3VD9A 1XSIA 5BXSA 2IXUA 5M3WA 3OGRA 2WMGA 3EDFA 1R86A 3DHUA 5LA2A 3MSGA 1XCXA 1UG6A 2AMGA 2VRQA 1DWAM 1YQ2A 3QOKA 1YHTA 3WMSA 5I3DA 1NARA 2F8QA 2VNCA 3W27A 3VGBA 3SUSA 3SURA 4Z2LA 1BPLB 1KXQA 5IDIA 1V02A 3KL5A 3VIPA 2RGLA 2V3DA 3I3EA 2XGIA 3ARYA 4JFTA 1KGXA 3K8KA 4NRSA 4Z2JA 1B9ZA 1SMAA 1TMQA 2EQDA 1H11A 2CETA 2WMKA 1LG1A 3VMNA 1ISVA 2NT0A 1NQ6A 5DEZA 2BXYA 3IJ8A 4P7LA 1JZ3A 1QNQA 3L4VA 4HPHA 4JKLA 3WUEA 3WQVA 2YL9A 1KB3A 2DT0A 5A95A 1AVAA 1LJYA 4MJ4A 2WCGA 3PZMA 4LYQA 3LPGA 2VCAA 1ODZA 1OT1A 1BLIA 1XRVA 2CBJA 2VUYA 1O6IA 3F5JA 2YDQA 1B3VA 4IUGA 1PX4A 2YBUA 2D2OA 4TTGA 6TAAA 3OLEA 2D23A 1IZJA 3CIVA 3OB8A 4PUDA 3L4YA 1QOXA 2VC9A 4AYSA 3VIKA 2BHUA 1GOKA 3AMDA 2GK1A 1JZ4A 4JCLA 4CVUA 4WF7A 1KBKA 2YIHA 3ZM8A 1KGUA 2O92A 4HA1A 1HJQA 3L4WA 1W3JA 4LPCA 1MFVA 5JBDA 4JZ5A 1ITCA 2WCAA 1GQIA 4PMOA 3VIIA 1BAGA 5ABFB 3BGAA 1WKYA 4UCFA 1MQRA 3WD1A 3VNZA 2W61A 3ARPA 1KWKA 3VIOA 2QMJA 3RPMA 1JL8A 2EPNA 4MAVA 3F5KA 4PMZA 2OWWA 3WFLA 4EE9A 3ARVA 4H2CA 4GIAA 1NOWA 5E9AA 1JZ7A 5CPQA 3GTNA 1E56A 2E9LA 1CGWA 4V28A 4CD5A 1EIBA 4KWUA 2GJXB 3DYMA 4J7RA 2XUCA 3MUZ1 2ZX7A 4UFMA 1DWHM 4X0VA 4J3WA 3T0AA 4DM1A 1GJWA 1CXFA 1XD0A 1UD8A 1SR0A 4ZENA 2OYMA 4H41A 3POCA 1VB9A 1E55A 2D1ZA 1KR0A 1OD0A 3T0DA 4MJ2A 3O9NA 2QPUA 4Q7NA 2ZOXA 3RO8A 3RM9A 4PMRA 2VRJA 1KQZA 3WH5A 2AOSA 1NOUA 2WAGA 3OG2A 3L4XA 1JIBA 3FAXA 3EMCA 4CUCA 2QPSA 3OGSA 3N04A 3HJEA 2J4GA 2CYGA 4V2XA 1RP9A 1DEDA 1HVQA 1NH6A 3OA5A 1UQYA 4R5EA 1HNYA 1OBAA 1J0KA 4AISA 4M80A 5D4YA 1OGGA 3B8SA 2XM2A 5A1AA 2WHMA 2FH8A 2WZEA 1PX8A 2E8YA 5I2UA 3EDEA 1J0ZA 4D6EA 1LG2A 1AMYA 3AMCA 4CU8A 2W62A 3WF1A 3ARSA 1QI2A 1UD2A 2YL8A 1KR1A 2VR4A 4OIFA 4W5UA 4PRWA 3CUHA 4GQRA 5CQ1A 1WPCA 1XYZA 4BCEA 2YBTA 3PZ9A 3SCPA 3VOCA 2UY4A 2CKRA 4AD2A 1WDPA 1HF6A 2A3EA 1UUQA 2J79A 3CZKA 4NF7A 1L0PA 2D0FA 5I79A 4A3HA 4OBSA 2QHAA 5IXEA 3FY1A 2ZICA 4ACZA 3TTYA 2JIEA 3B9DA 5A3HA 1UZ1A 1Q4NX 4TOQA 2CITA 3ZOAA 3CTTA 3AISA 1J10A 4CN6A 3W28A 4PMNA 3ARXA 1HL9A 2BY0A 1SYTA 4C7FA 5ABHA 2G41A 5FL1A 1JXKA 1MFUA 3WDIA 4UFHA 4WJXA 2WZHA 1H49A 3AS0A 2GJRA 1PZ2A 1C3FA 3W26A 1NWUA 3SUVA 1UYQA 4WKHA 1UKTA 2YLAA 1R7OA 4AXNA 1RH9A 2FGLA 3K4AA 1CENA 1XCWA 1Q6CA 1FP9A 4AZCA 3NSXA 4DWSA 4TVDA 4MNKA 2O9RA 1BYBA 4UOZA 1XH1A 5E70A 4AIUA 5BYWA 5C70A 5JIWA 2DT2A 3ZQ9A 3UR8A 3WNLA 1VRXA 5A6BA 1DP0A 4F8XA 2D3LA 4HU0A 2V5DA 3CUFA 1UKOA 4QDMA 4P8WA 4P7QA 4XB3A 4UQAA 1D7FA 3GNOA 1G01A 1HN1A 1V6UA 4WSJA 1MWOA 1QVBA 2X0YA 1I1XA 3WQ8A 1G5AA 4FK9A 1VBRA 1Q6DA 1E6NA 2J78A 1D3CA 3WNOA 1QNPA 1QHZA 4HZ8A 1UKQA 2D0GA 3VKKA 1E5JA 2Q8XA 4UOQA 1BQCA 3SCNA 1UKSA 3CGTA 3VMPA 3BXWA 3QHOA 1E0XA 1QI4A 1AQHA 3GYCA 2F61A 2BXZA 2O9TA 2BY2A 1MW0A 1H41A 5A94A 1UQZA 2J8FA 1ISWA 4AZ6A 3BAKA 4Z2KA 4UQDA 1UZ4A 4C7DA 1HJVA 5A2AA 2XIIA 3AZTA 2YJQA 2ZX5A 1BG4A 4X9YA 1V0MA 1CXHA 4W7VA 1KGWA 1VFUA 3N13A 1H0GA 4YHGA 2RGMA 2TAAA 3A4XA 4P7NA 3MS8A 2XG9A 2QLYA 1AQ0A 3WUGA 1TVPA 5A6KA 3MUY1 3CHEA 1M04A 3WQ5A 4OZOA 2CCRA 1QI5A 2BVTA 1KFWA 1LLOA 4XV0A 1E0VA 3M7SA 1CDGA 5GNZA 3F4VA 1GOMA 4AEFA 1BFNA 4W8BA 1HVXA 2AAAA 5I6SA 4AY1A 1B0IA 2CXGA 2J77A 4HA3A 3WBAA 1PX3A 2UWFA 3BAWA 5I24A 1JNDA 4JFVA 1TUXA 3L2LA 3WH7A 2ZUSA 4D1IA 2J7DA 1KCKA 3ZIZA 2XVKA 4M24A 4W85A 5I23A 2VZTA 2VOTA 5BXRA 4QLLA 2V3EA 3ZR5A 5F7UA 3PZUA 1A3HA 3AQUA 4AMCA 1TR1A 3W82A 3EBVA 5E0CA 1F4AA 3WENA 2ZUVA 3WF0A 4Q22A 3AXHA 1V3IA 2XVPA 1KXHA 1J0JA 2G3IA 4CVWA 5I77A 3EMZA 1E40A 1BVNP 1TZ7A 2E40A 4RL3A 4D6DA 4J3SA 1ODUA 4UQCA 1EO5A 4U3CA 2VMFA 4JL2A 1C7TA 3N17A 1BGGA 1EDQA 2VCBA 1QBBA 4W87A 4PYSA 5A2CA 2E8ZA 1NP0A 3AS3A 4N42A 1VEOA 1JAEA 1GVIA 3A47A 5JBEA 2DQXA 1V3HA 1OGBA 1CYGA 3VVGA 5FCZA 3AS1A 1WCGA 2GUYA 3EMQA 4HZ7A 2FHBA 3LPOA 4J28A 3RDKA 1ITXA 3MU7A 3UG3A 3WH8A 4AIOA 4XZBA 5IHRA 2Z1KA 1UD6A 3VGHA 3FAWA 3G6MA 1X6LA 1GJUA 2UY2A 4JHOA 1CGXA 3U5UA 4ATDA 1J18A 1WZKA 3MMWA 1ECEA 4WKFA 2GDUA 1C8YA 5CXPA 3NDYA 9CGTA 2OWXA 4IPNB 3K46A 1GQLA 3VPLA 1E3ZA 1JD9A 3WNKA 3SEPA 5IFTA 3WBEA 1CEOA 3CZGA 4LGXA 2CIPA 1R8LA 5ABFA 4MB3A 4AZHA 2BHYA 4D6HA 1B3XA 3VIMA 1JZ8A 1PJ9A 3W25A 3SIMA 1QW9A 3WELA 1Y7VA 4E8CA 1CIUA 2FHFA 5CSUA 1XGZA 1W9VA 2WWDA 1GOWA 3CMGA 1FA2A 3AYRA 2YDSA 3N18A 3GDBA 1EA9C 1OWQA 1AQMA 2YL5A 2EPOA 4GKLA 3AMKA 1V0KA 1Q6GA 3BAIA 1WZMA 4KRUA 1Z32X 4NRRA 4CCEA 4JFUA 5ABEA 2XVGA 1XSKA 1TE1A 1FHLA 3A4WA 1WDRA 3NDZA 3PTKA 1E4MM 5DF0A 2G4FA 4GXPA 1JGIA 1QHPA 2XFRA 1ZBVA 3WL1A 2JF6A 3WDHA 2D0HA 4IPLA 1GHRA 3D5HA 1CLXA 1E1FA 1RP8A 2WPGA 4UFJA 2VURA 3VGEA 3L4ZA 4QAWA 4QLJA 4W5ZA 1E3XA 4B16A 2HVMA 2YOCA 1W1PA 1CGUA 2BY3A 1KCLA 4HOZA 3VDBA 4GZEA 3W4RA 1OINA 3VINA 2J8GA 4CD7A 3TTQA 4W88A 2J74A 2WHJA 4W86A 3NIYA 4BQ2A 2CKSA 3WIJA 2BV9A 3WL0A 7A3HA 1EO7A 3PZVA 4OOZA 3N9KA 1UR4A 1V02E 5E09A 4BA0A 4Y7EA 2CHOA 2MANA 4QCEA 7CGTA 3MANA 2YL6A 1J9YA 4E4PA 1XHGA 3AXIA 2WCSA 1CLVA 2CEQA 4LYRA 4ZXLA 1V0NA 3MUIA 4M1RA 1ZL1A 2GFTA 2NSXA 4JAWA 3W81A 2DSKA 4BQ3A 4TVUA 4DUXA 2Y2WA 3VGFA 2ZXBA 4PCSA 1XV8A 2EO7A 3TA9A 5AY7A 1C8XA 3LMYA 2DH2A 3UEQA 1XD1A 4B3LA 2WVTA 1XH0A 2C8NA 1JAKA 1VBUA 3AHYA 4PSPA 3JUGA 1QI0A 2DIJA 2FGZA 1JYNA 2DIEA 4MNMA 1XSJA 5E0FA 2OSWA 4D6IA 5I5RA 2ZWYA 4JL1A 2WC3A 4RE3A 1WNOA 1E6RA 3VUPA 2ZXQA 3VMOA 2W66A 1JZ5A 4GO8A 1D2KA 3B9EA 1CNVA 5JIPA 3PTMA 4PMYA 5A6MA 2WMIB 3AHZA 3KWXA 4W7UA 4HOXA 2VZSA 2WANA 3AS2A 1TVNA 2VO5A 1GONA 2D20A 3AIWA 1H5VA 2OYKA 3AIBA 1TG7A 3SCOA 1ISXA 1OIFA 3CUIA 5DFAA 1US2A 4KH2A 2A3BA 1VJSA 4CU7A 5I78A 3CZJA 4AZGA 5JUVA 4N0RA 1FH7A 2V3GA 1DHKA 1W3LA 3DYPA 4PUEA 5ECUA 3ZR6A 1VFOA 1JG9A 5A2BA 1V6VA 1WP6A 3PZGA 3T08A 4NSBA 4AZ5A 1B3WA 2XIBA 1DWJM 3WD3A 2EEXA 1UD4A 1WB0A 4PMDA 2YKKA 1JF6A 1OGSA 4EANA 1QBAA 5E6ZA 4J3TA 4XUYA 4ATWA 3AYSA 2WVVA 2CPUA 5D9MA 1LWJA 4UNIA 3CBWA 4TTUA 3ARRA 4UR9A 5EFDA 4CN1A 3MO4A 3T09A 3CZEA 3ZSSA 2EPMX 2PWDA 4D6CA 1QNSA 4UFKA 3NSMA 4P8VA 2WYSA 3RJYA 2GJXA 4B9ZA 2W67A 1CTNA 1MW1A 2XVLA 3ZJKA 1FHDA 2A3HA 4F79A 1M03A 3TOPA 5CGTA 1RPKA 1H2JA 3AI0A 2PF0A 1FFRA 3GZAA 4HMEA 1GPFA 4M8UA 3SUTA 3I3DA 1E1EA 3AIRA 3TONA 3PZNA 1ISZA 3GM8A 3CO4A 3PBGA 3L2MA 3VIFA 3SCWA 3GXIA 4LXFA 4RE4A 3BMWA 1E4IA 1EOKA 1JDDA 1KXTA 3G6LA 1UR9A 2WWCA 3WEOA 2X8RA 2XFYA 4PMXA 4PTMA 3ZT7A 4U2YA 1LQ0A 3BMVA 4AZ7A 2JIWA 3L4UA 5KZ6A 1NP2A 1V6WA 3W6MA 4X0NA 1PZ3A 1TFVA 2WLZA 3FN9A 1HJUA 1B90A 3CHCA 1CXEA 2YA0A 3UG4A 3ZMRA 4WLCA 4QLKA 3CZ8A 5EMYA 2YA1A 4H8VA 1OB0A 4JHZA 1OM0A 1W2PA 4MDPA 4TX6A 3VDAA 3W38A 1X1NA 3VILA 1BGAA 1VJZA 1W91A 4LYPA 2WZIA 5AYBA 2UY5A 1ZU8A 4ACYA 4EK7A 1CXIA 1WDQA 4JFSA 4TXEA 4B15A 5AYIA 4V27A 2WW5A 5FIPA 1MXGA 1CGTA 2FDMA 2ZIDA 4KGJA 3ECQA 4JKMA 2X09A 4PBGA 3RM4A 4UQ9A 2WVVB 2BS9A 2UY3A 1VFFA 2WC7A 3HMCA 1E6ZA 2J7BA 3CMJA 2D24A 1K9FA 4HTYA 1GCYA 5LYRA 3RMEA 3DHPA 1W3HA 3DC0A 8CGTA 1UR2A 1JI2A 4GI9A 5HOSA 3AIUA 4PCTA 1JDAA 1CWYA 4CCCA 2XVNA 3A6OA 3EDKA 4PEEA 1V3MA 4D6FA 3OIHA 4CN4A 3VDHA 5HDRA 2X1IA 4DUVA 5C71A 3N12A 2W91A 4AWEA 4K68A 3ZJ7A 3KE0A 1B31A 5A8NA 4XZWA
chains in the Genus database with same CATH superfamily
3NQ7A 3T07A 3UNTA 4AG0A 3S5ZA 4URIA 4IJRA 3GFYA 4BQ5A 3BICA 1QI3A 2BMBA 4XUGA 3U5YA 2FKPA 2FZBA 3AO0A 2BODX 4MZ8A 3SSJA 3THDA 3HV8A 1EB3A 2FZMA 3IK2A 3WJZA 3GG7A 4WDXA 1RV8A 4GZIA 3PAOA 2VVSA 3N15A 3WDPP 2AL2B 4QITA 1TA3A 4RDWA 2VEPA 1EX1A 3GUGA 3UWZA 3WF3A 3OVQA 4A35A 3B0UX 4X63A 1H62A 1TWWA 2VQUA 3SCVA 3W53A 3CH9A 1R7AA 3B04A 3P93A 4JTHA 3LXCA 1BWLA 1PAMA 4G8TA 3WLTA 4UFLA 1Q85A 1R87A 4GJ1A 2O7QA 4H00A 5JH1A 1UIOA 3DXIA 3RIKA 3PZOA 1SW0A 1R9YA 3F5LA 4NNBA 1P48A 4HHLA 1TV3A 5MHBA 2Y89A 2C1IA 3S2CA 4GUFA 1FFQA 1VFMA 3GBEA 5AZ0A 4U5KA 2E5BA 4GIRA 3SN0A 1QT1A 3W07A 4GZ7A 4J9JA 3ALGA 5FJPA 5IHSA 3NPUA 5U7SA 4IMCA 2VZOA 3U48A 1O94A 3LRLA 1E1CA 1UUOA 4D8ZA 3MUXA 4JTQA 4UTJA 3RLGA 2VWSA 3PPHA 2FH6A 4DUWA 1MXSA 3IJLA 4ZGYA 3NWRA 2Y7GA 4DNMA 3CUXA 4HA4A 2J6VA 1LYXA 3YPIA 3VGGA 3ITVA 2QDEA 1NY1A 2PRLA 2DW7A 3GYEA 4IM4A 3I68A 4XKMA 4ATLA 4GFIA 1RSCA 1MXDA 4ZA0A 1QOPA 2Z1XA 2J25A 1MSSA 2J8TA 3UESA 2CESA 3B0PA 3P6LA 1J0YA 2VJXA 3ZLHA 2W63A 2OCZA 3OBKA 1TV8A 3K4DA 4GIEA 1R0MA 3SR7A 4FF5A 4FZIA 4I9TA 3PHAA 5HNNA 4CNTA 3UD6A 3TWAA 1I6NA 1R3TA 4MB5A 2Z2BA 4E3VA 1B30A 1UWSA 3H2NA 3CUGA 3QOMA 2HTMA 4MY8A 5LA0A 4GINA 2OQHA 4FLQA 1RBLA 3DX5A 4H6QA 3LNPA 5CLTA 4AD1A 2QKFA 3DU0A 1OSEA 2NQHA 1JDFA 2HRWA 3QPZA 2PD9A 3HPFA 1SZFA 1YE6A 3IAPA 2PDQA 1UP0A 2AQOA 5FSEC 5CG0A 4L4PA 2BHZA 1K4GA 3RPTA 1NAL1 4IQJA 1M7PA 1EH9A 3WMBA 3EEZA 1BXBA 1QWGA 3W2LA 3TJXA 1GVQA 3KBVA 2ZUUA 4O1DA 3CHDA 3ZWTA 1ITQA 4FP1A 3VZZA 3PPGA 1FKXA 3LG3A 1WAWA 1UWIA 5CC5A 6REQB 2VENA 2PS2A 1XFBA 4A2SA 3M6YA 3M16A 4NHVA 5KETA 1VR6A 3MKCA 3UF9A 3TTEA 5DMYA 1G94A 3MO7A 3CZLA 3WQWA 2EKCA 2P0OA 5F1UA 1FWBC 3LI0A 1PKMA 2QVNA 5G2IA 5H8UA 3FNDA 3N6QA 3OP2A 6A3HA 3VDCA 1GNXA 1OHLA 2O55A 3FHQA 1UASA 5FEZA 1Q5MA 1UWTA 3W74A 1KFKA 1J0IA 4QSHA 4FLRA 1F3WA 1IQ8A 3TLQA 4J3UA 3EKZA 5LNUA 4PMUA 4FX6M 4JOMA 1T8XA 3OVRA 4LH8A 1LLWA 3MVIA 5FJTA 3ZWSA 1TPVA 1WUEA 4J3VA 4IGHA 5AVHA 1IIGA 2WHLA 5FL0A 4CQAA 4UTTA 1PVNA 1F07A 1QW7A 3DI1A 1F9CA 1BRLB 1D7KA 1J5SA 3GK0A 1UA7A 2Y6ZA 4ML9A 1G1YA 1ZALA 1V79A 2PDHA 2DH3A 2WMFA 3WFAA 4IXXA 4PODA 2G3MA 3OLGA 5DT5A 4FXSA 2ZX6A 4QDPA 4CQ8A 4G2DA 2OLHA 5AHFA 1PPIA 3ARZA 4M19A 3QC3A 1KQYA 3S5NA 1EEXA 4X60A 3ZXWA 3GC5A 1K9TA 1WYIA 4KMQA 4OTKA 1TTQA 3NOYA 5A5WA 6XIMA 4FLOA 3I7SA 3PPFA 4H9UA 1LL7A 1HIZA 5KINA 4P8XA 2E68A 2ZZ3A 2GK1B 1Q7MA 2J7CA 5BU9A 4HCLA 1VBGA 4C6PA 1QTWA 5D8ZA 4R7WA 4ZE4A 4NAFA 4CQCA 3OGVA 3CS2A 5F1VA 5D8WA 3VD3A 1HZYA 4YMZA 3PBUA 3R43A 4HJWA 3NQ2A 3QBUA 4CEXC 1MDRA 3BSHA 3NFUA 2YXXA 4BKNA 1YTEA 3BLLA 4MGGA 4O57A 4PGLA 4GIYA 4HPGA 1BG9A 1ME9A 2PB1A 4ZXOA 1MW2A 5K7JA 3DHDA 2ZADA 4R9XA 3LSBA 4WJ8A 4C1NA 1F76A 4D2JA 2FVMA 5A8GA 3ONBA 3A5FA 3WK0A 1EQPA 2QJIA 3GRIA 1RUSA 2X2YA 4B91A 2CBIA 1KFEA 3C0SA 3UWEA 3UZ5A 4F9DA 4F0SA 4EKJA 1YW1A 1S1RA 2Z28A 4LAUA 3N9SA 2D2GA 3VK5A 3H2FA 3IJ9A 1GG0A 3NYDA 2INFA 1H3GA 4MNJA 3LQLA 1I9CB 3BSGA 3I10A 4D72A 3BGJA 2YGYA 1XLIA 4M82A 1UKPA 2GGEA 4UOJA 3NQBA 3I6TA 4MKNA 3MKVA 3BC9A 1OX4A 1Z89A 3NR0A 4B4FA 4DJFC 3P80A 4K39A 1FH9A 3RCNA 1PKNA 3KUMA 2C19A 4JTTA 2PU1A 5BWAA 3GVWA 1EWDA 1IE7C 1X1OA 3W3OA 1H7OA 3C0LA 2FJKA 5TD4A 2PDFA 5AC4A 4BS0A 4A4AA 3NQ6A 1ZTVA 2DSVA 3WLSA 2A1YA 1FWDC 4ZOBA 2CLHA 2C7FA 1YLVA 2HNEA 5BROA 1FCUA 4ZO6A 3UWUA 4YL2A 3ITXA 4QHRA 1XRFA 3PM6A 2VX7A 2PD5A 3M5XA 2WMHA 3UWQA 2PWGA 5TIMA 1TVLA 3TC7A 5KSWA 4IMGA 3APYA 1TSIA 2PRHA 2HV5A 3WNNA 4C60A 3CYJA 3W7HA 5BCAA 4KT2A 3LXAA 2VZVA 4X9SA 7PTDA 1A53A 3HM7A 3EDDA 3FHAA 1O7AA 3P67A 3NVTA 1QNRA 2PWHA 1J01A 4QP0A 4RZ5A 3NL6A 4OBTA 4IG2A 2EBNA 4L1WA 5C55A 1DWFM 2NQ5A 1GKQA 3AYVA 1PIIA 3TMLA 3N2BA 3CHFA 4H7CA 3HU7A 1UBPC 1YIXA 2NW0A 2E6YA 3USBA 1UJPA 3EDJA 4RK8A 4AQLA 2Z6JA 3MT1A 1EX5A 3UR5A 4LF2A 4UTFA 4O13A 4GACA 4JYFA 4K8EA 4KFPA 2PDJA 4CQDA 5JH2A 2C16A 5IDZA 3GU1A 4KFOA 4JICA 4H9ZA 2A7NA 2ZDRA 1Z8AA 3O0KA 4OHQA 1ADOA 1ZBWA 4PTXA 3NPXA 3VKDA 4XAZA 4IP7A 2V69A 3APGA 2YFOA 3GNNA 3T2PA 1MUWA 1YNYA 3H24A 1V7YA 5AZ1A 4L4MA 2WMJA 1HKKA 4ZOCA 3RGTA 4FIRA 1ZCOA 3RM8A 1BYAA 3WSUA 1ZAJA 1W32A 1Q13A 1EJVC 1X96A 3WDRA 2J7FA 4Q33A 3NTYA 3IS4A 2YR1A 4YVPA 4QJ5B 1WZLA 2OWCA 1BD0A 3LBMA 4UC5A 3LN3A 3TNBA 1IR2A 2A3LA 4P7OA 2V5BA 1PTGA 2CU0A 3L0KA 4JKKA 3SCRA 2E4TA 3UT0A 4O50A 4GZJA 1GVYA 3BOFA 4HPXA 3FYPA 3EAUA 3J7HA 2GVYA 1OEPA 2FB2A 2VHLA 4PUWA 3KVJA 1JRCA 1E4LA 4FMVA 2AMXA 2DP3A 2IPJA 2WNQA 2CLEA 4KIRA 2QGYA 3U8GA 4JN6A 3L21A 3T2QA 1DTUA 1HJSA 1VF8A 1IV8A 4Y9MA 5FJUA 3W7OA 1NWSA 3OVPA 3S42A 2UZ9A 1GHSA 5EMUA 2NV1A 4L4OA 3L68A 1MO0A 1W1VA 3R10A 2WLYA 1JQXA 5CJMA 5T8GA 3BLFA 3DN5A 3ZJ6A 1E6QM 1W9DM 3VD5A 4HMDA 2DT1A 1DL3A 1DE5A 1EP3A 3WBWA 1F05A 2QJGA 2VX4A 2ZQ0A 1XGEA 1VH7A 3W37A 4FR6A 4C1LA 2EHHA 4Z1CA 1O95A 2G0WA 4UTIA 2PDNA 4S1FA 4ICMA 4DRSA 3NQVA 1UWQA 1E73M 3H54A 4EWND 5T9BG 2EG6A 3GTIA 1RALA 2IXUA 2PP0A 3H26A 3OGRA 3BLDA 3DHUA 1RQBA 4R34A 2VRQA 3FSTA 5DY3A 4M6PA 3LRMA 3UZYA 1FWNA 1W8SA 4MZ1A 1K4HA 3URQA 1M41A 1U1UA 1XG4A 2ZTKA 3A21A 2BASA 3KWSA 3URNA 3IIPA 1XLEA 4NRSA 1B9ZA 2A7PA 1TMQA 3O6CA 2CETA 2BOGX 1TJ1A 3H55A 1ISVA 4FXFA 4I5RA 5FAJA 4YVVA 4X3ZA 1NQ6A 1EIXA 1R9XA 4Q8PA 1QNQA 3L4VA 3WUEA 1OABA 2HXTA 5I7GA 3C61A 4LC8A 3JVAA 2OKOA 3CQHA 2WCGA 4MJ4A 5B7YA 1QFEA 2VCAA 1DTNA 4NXSA 5JVLA 2ZZ1A 1B3VA 2YBUA 4GQBA 3N25A 4TTGA 3UP8A 3OLEA 6TAAA 3W7NA 3OB8A 4NAFB 1NF0A 4PUDA 3CV7A 3LHVA 5REQB 1GOKA 5HAOA 4NY2A 1N8FA 4IJCA 2GK1A 3UJSA 4DZ5A 4JCLA 4CVUA 4WF7A 1F6YA 4LVAA 3WBYA 4C90A 4HA1A 1HJQA 1ZNNA 3L4WA 3OU8A 1W3JA 3ZR4A 3NQMA 4LPCA 5JBDA 3G8EA 4ZBCA 1ITCA 4ZQMA 5TF0A 3EWWA 4PMOA 5ABFB 2FPVA 4UCFA 1MQRA 3LCLA 3TYDA 4FI4A 4OQVA 1DJNA 3E2RA 1GYLA 1KWKA 2QMJA 4JEQA 3H8AA 4UTWA 4ZMGA 4EXAA 4M7TA 3CWNA 3GTNA 3GIPA 2FFIA 3FVMA 1W54A 1EIBA 3NQEA 4KWUA 1O1HA 3R4IA 4ZOAA 4I90A 4JQ1A 1M7OA 3TJIA 5LGXA 3QLLA 4HKPA 1GJWA 1CXFA 3AUOA 1H1YA 1P7TB 4XVEA 2OQYA 2D1ZA 1UUMA 2AKMA 3O63A 4GFSA 5CBIA 1QK2A 1OD0A 1P7TA 2QPUA 5A6TC 1A80A 3FSUA 2HXUA 3RO8A 2AGTA 3MI6A 2VRJA 2QF7A 3WH5A 3KBWA 3OG2A 1XBYA 4PUUA 3N04A 2PDCA 3HJEA 3EWUA 1XKJA 1HNYA 2WJFA 4H6KA 4NNAA 4WJEA 1PV8A 4M80A 5D4YA 2BLEA 1XDMA 2WHMA 1JVNA 2I17A 4AY8A 5I2UA 2E8YA 4DJDA 1J0ZA 3R94A 1ZAIA 5JXQA 1O12A 5CPOA 2GL5A 1TIWA 3LHYA 2I5GA 4O11A 4PFMA 1KR1A 2NUWA 1RJPA 4OIFA 4GQRA 5C2GA 3S6DA 3ZVIA 4BCEA 3S0CA 5EBUA 3L67A 5LZLA 3VOCA 2UY4A 1CW2A 1PWMA 3IPWA 1WBJA 1HF6A 3UVAA 1XBVA 3CZKA 2INZA 2BDQA 4A3HA 1KBIA 4L65A 4DLMA 4ACZA 5G5IA 2QJMA 3ZOAA 1TPEA 1HL9A 1J2WA 1JXKA 1FWAC 1DQWA 1H49A 4HJFA 1H63A 2PZ0A 5LXEA 5EMLA 4I9JA 4ZO8A 3M5ZA 2BX7A 1RH9A 2FGLA 4Y9AA 3V1HA 1RQEA 3K2GA 4JN8A 3VC6A 4EOUA 3W23A 4TVDA 1HO4A 2O9RA 1BYBA 4UOZA 3KZPA 2XINA 3AUJA 1OC6A 3UR8A 3WNLA 1TV4A 3LSCA 4AX7A 3TH6A 3NM3A 4P8WA 4P7QA 1TWIA 4XB3A 4KIEA 4JYEA 4RZ6A 1HN1A 4US5D 3CQ0A 4N9DA 1DIOA 3VYLA 5C7VA 1D3CA 3WNOA 4WOZA 4F0KA 2Q8XA 1UKSA 1YBQA 1PDZA 5RUBA 5HANA 1E0XA 4A6GA 4IJBA 1AQHA 3PWGA 5HNUA 2BY2A 1MUCA 5A94A 4MFEA 1ISWA 1NDWA 3TJLA 4FA3A 4AZ6A 4UQDA 1HJVA 5A2AA 3WQPA 3R0UA 3HQ1A 1BG4A 1XPGA 2HK0A 3KVLA 1V0MA 3VC5A 1DJYA 4R7JA 1VFUA 4QE5A 2QJJA 2RGMA 1Q6QA 4E2DA 3FYOA 3NURA 1AQ0A 1POJA 5A6KA 3CHEA 4WDWA 4OZOA 3H7VA 3DFPA 2BVTA 3QQ0A 1X98A 1PKYA 2C18A 5GNZA 3F4VA 1S3HA 4XZMX 5XINA 2ZZ6A 2CXGA 3RXZA 3WBAA 2PDLA 4JTAA 5I02A 2QIIA 3TA6A 3RF9A 3B4UA 1ZY9A 1PHQA 4PTNA 1YPIA 1KCKA 5M1TA 4XD3A 4M24A 4Z42C 2V3EA 3PZUA 1FTXA 3W1AA 3NXLA 2IPFA 3W83A 4H83A 3PC0A 3F2CA 1FDJA 3ANVA 1PZ0A 3GTXA 1VFLA 2XVPA 1J0JA 3B03A 1I45A 4CVWA 3O8AA 3P0WA 4FNTA 3OHMB 1BVNP 4A29A 4LNYA 4RL3A 4YJ5A 4GYKA 4UTTC 3QJAA 3BWWA 2ISWA 3FYYA 3GVGA 3M64A 2VFDA 4W87A 4LNCA 4N42A 4JDYA 1JAEA 1GVIA 3TLLA 2FDSA 4DZHA 1PSCA 5JBEA 2DQXA 1ZLPA 1OGBA 3W7LA 3VVGA 2PPGA 3Q94A 3IJ6A 3LPOA 3U2EA 4GG9A 1ITXA 3UG3A 3QSTA 4AIOA 5KITA 2Z1KA 2E1DA 3GKFA 3UVIA 3IK4A 1A5MC 1U1JA 3S47A 2H9AB 1F74A 4UUIA 4JHOA 4EPEC 4Q4SA 2R1MA 4ATDA 4AAJA 2CWNA 1A5OC 1K7FA 1WZKA 3T40A 3LGDA 1RA5A 1C8YA 4JXCA 4PULA 3S5OA 5AECA 9CGTA 1W5PA 3ABXA 1Y65A 1ML1A 1WKFA 5G1TA 5EA9A 1TUFA 1JD9A 1JEZA 4I6VA 5F4WA 1KRMA 5KTLA 2H6RA 4Q4OA 1OX6A 4PCPA 4LGXA 3FA5A 2CIPA 1R8LA 5ABFA 4MB3A 4AZHA 4PTDA 3VIMA 4Y90A 3G77A 3SIMA 3QQ1A 3QMTA 1CIUA 2NVDA 2FHFA 1XGZA 3HA1A 3AYRA 1EA9C 1RJQA 2Y8UA 4FO4A 3AMKA 1V0KA 2Z24A 5REQA 1XLDA 3PJXA 1Z32X 1NJJA 1V77A 3DENA 5E93A 4CCEA 4F4RA 1XSKA 4H1ZA 4FS9A 3KFTA 3A4WA 3PTKA 5EL1A 4DHGA 4HNCA 5JQ9A 4GXPA 1JGIA 4FR1A 1H5YA 3QC0A 3S2MA 4AB4A 3NZRA 3WL1A 4IPLA 2VDGA 4UTUA 4TV5A 1RP8A 5HWMA 5HUPA 4INFA 3DFOA 1YADA 2OZ8A 3L12A 4QLJA 3M1ZA 5EKYA 2HVMA 4IMEA 1KCLA 4HOZA 2PU0A 3W4RA 3T8QA 2J74A 5TBOA 3G1FA 2CKSA 3WL0A 3M0IA 3RK8A 4MHBA 2OFJA 3OW1A 1UROA 2IPGA 3ZZ1A 1NIUA 2PLKA 2ONEA 2CHOA 4LY4A 4QNWA 2MANA 7CGTA 3MANA 3HG3A 3VOFA 3O1NA 1GZGA 2CLLA 4L7ZA 3ATYA 4C6OA 4XTIA 2FZ8A 1AJ0A 1V0NA 2OGYA 4M1RA 1ZL1A 1ZZMA 2GFTA 1XV8A 2YCKX 3G8RA 1KLZA 4LW7A 3EA2A 3MA8A 4DN1A 5HMFA 2C8NA 1W37A 3EB2A 2W79A 3DAQA 4EX4A 3JUGA 4L64A 2E09A 1JYNA 1DJIA 4U4MA 1G4EA 4XO6A 1ZP3A 2DIEA 2PMQA 1XIJA 1XSJA 5E0FA 2OSWA 3LHUA 3EZ4A 5DQPA 3C86A 4RE3A 1VGAA 4PUJA 1S2CA 1IT8A 1JZ5A 3M0HA 5JIPA 5A6MA 2WMIB 3KWXA 2VZSA 2WANA 3I4KA 3VABA 2VO5A 1GONA 2D20A 4YCPA 1RK5A 2OYKA 2R94A 3W7GA 3AIBA 2XIOA 3I6EA 3CUIA 3TROA 2YB1A 5AC7A 4PZVA 4KH2A 4HGXA 3P82A 3PTDA 3TR9A 1K3UA 3CZJA 4H6EA 5G4HC 4XQ6A 4YTTA 5CKSA 4IIEA 3G2GA 3RLVA 2E1WA 1W3LA 2RAGA 3HPXA 4PBFA 1KKOA 3CT2A 5A2BA 4YLWA 5LIWX 1WP6A 1B3WA 1TTJA 2B7NA 4TX9A 3WD3A 5C2CA 2EEXA 1UD4A 1QAPA 4PMDA 3GR8A 2FQIA 4A8RA 3CNYA 1LUCB 2WM1A 3KBMA 2WVVA 2QEZA 2CPUA 1R38A 3CBWA 2PURA 1WUFA 2VEIA 2A2IA 4XBKA 1YDNA 3FIGA 1QNSA 3HGRA 4UFKA 4NYYA 3R6IA 2WYSA 3RJYA 3GW3A 3OG3A 4JD4A 1YKWA 3N19B 1BXCA 1D3GA 2IKHA 2AAMA 2XVLA 4NJGA 2DZBA 4IIBA 1M03A 3MUCA 3GO2A 2VDHA 1RPKA 4E6MA 3B0VC 3GZAA 3VIFA 4RE4A 3W6YA 2AL1A 5C9WA 2YZRA 2I9UA 2FLIA 2NSOA 3IEBA 1E4IA 1EOKA 4DI8A 1KXTA 3LV5A 3KCOA 1LOSA 2WQPA 2X8RA 4PMXA 4U2YA 3SO7A 4Z1YA 4AZ7A 3GFXA 2JIWA 3L4UA 5KZ6A 4X0NA 4OV9A 4PMJA 1JCMP 1Q6RA 3UG4A 4WLCA 1MNZA 3WCZA 5EMYA 1W2PA 2E25A 4MWAE 3RLUA 4IP5A 3VDAA 3W38A 2POZA 2R91A 3UXIA 2NUYA 3VILA 1BGAA 4KF1A 2PCEA 1VJZA 3PG8A 1W91A 1QPOA 1CXIA 1WDQA 4B15A 4GI4A 1KC7A 1OG0A 2WW5A 1CB7B 1CGTA 1B57A 3ECQA 4DXKA 2X09A 1M6JA 2HROA 2WVVB 3KHDA 2UY3A 3C52A 1VFFA 2WC7A 2J7BA 3CMJA 2F6KA 1K9FA 5IM51 3RMEA 4BEUA 1W3HA 4H9MA 1UR2A 1JI2A 2BGSA 1SJCA 1UMYA 2B7OA 3A9BA 2A79A 1H1ZA 3IRDA 3EDKA 2EAWA 1ZP4A 3VDHA 1X1ZA 3N2CA 1FVPA 2IS7A 2W91A 5AB3A 1XFCA 4K68A 3PFRA 1B31A 3VCNA 1ENUA 3NG3A 5CCZA 1XRSA 4IMAA 4LUSB 3NO3A 3P8JA 2Z00A 5FA5A 3HGOA 1Q6OA 3IVSA 2CLPA 2VVNA 3NSNA 1A3WA 3I65A 2CFFA 1WO2A 3HFTA 2P1FA 4DNHA 4FXRA 3OZMA 1F73A 4U31A 1AW5A 2CBVA 2ZUWA 3UNDA 3BCDA 1KTBA 2JEPA 3M43A 2TYSA 3WKZA 3ES8A 3R12A 3W29A 1QNOA 2ADAA 5HATA 5C9UA 1M65A 4EAYA 3HO8A 3RR1A 4O12A 3BJTA 3W7KA 8XIMA 1K77A 1WZAA 4ZSUA 3PSWA 2QT3A 3O15A 1Z44A 3VIGA 2QV4A 2CZDA 1LF1A 4NASA 4L80A 2J7EA 2VXNA 2V6AA 4J2PA 1FKWA 4LAMA 1JXJA 1PWLA 4JNZA 2P53A 5E6YA 3VNKA 1EDTA 3LERA 4F0HA 3GIYA 2XSAA 1C90A 3EWYA 4CNUA 3HMJG 2QCDB 1ME7A 3MSDA 3DUGA 2YCLA 2HS8A 3NM1A 1E1CB 4OJYA 4XX6A 5A6LA 3R79A 3RJXA 4GH3A 3W71A 1QO2A 4DWDA 4UBPC 1H7XA 4ERAA 5I0DA 1F6PA 3W7PA 3GTHA 1P6BA 3MJMA 4RCXA 3SCQA 3SRDA 3KOXA 4S38A 2R82A 3N4AA 1EJRC 3ZT6A 2GPTA 3WDQA 1N82A 2ATSA 2DVTA 2CZFA 5C5YA 4JIIX 3BLKA 4AHQA 3WF2A 2D3NA 3ABZA 4AC1X 5I00A 4ECLA 2XSXA 1J0HA 5AN7A 5XIMA 3WQ6A 4HZ6A 2BGQA 1S2TA 4NU7A 1PCKA 1SW7A 3ZLGA 3BQ6A 1Q3NA 4I5XA 1I75A 2WK2A 3UJRA 1KCXA 4IISA 1BTMA 4N6FA 4Z17A 3WZ0E 5M03A 3H4WA 3HIJA 4AHPA 4U33A 1TA3B 4GC4A 4EXQA 1GW1A 2NLIA 3NZGA 4O16A 1XGDA 4W89A 4S3CA 3HG5A 4HU8A 4TU1A 1BSLA 1OD8A 1PXGA 3SRFA 1GOQA 3NQAA 4I7WA 5ABGA 1P1XA 4ICCX 1JF5A 3RX4A 4PRTA 2QF8A 1PTDA 4KEZA 1YXYA 3QGAC 4JTLA 1R85A 4LY8A 3C3UA 1EJTC 3U57A 3PN8A 2Y5JA 3BZJA 4JHMA 2F2HA 1UMLA 3D6NA 4J2MA 4GBDA 2VD8A 3JR2A 1KFCA 2PC8A 1I2OA 2TSYA 5K4XA 1J79A 4QFUA 4CD6A 1V3JA 3BZGA 3G1YA 1E9LA 2WZMA 4D71A 5J8LA 1UHVA 5D9PA 4NZJA 1Y8BA 5FJIA 3W2JA 4ZO9A 2VFFA 1ICSA 4JNMA 2EPLX 1IEVA 1R30A 3ELFA 1DWIM 4DPQA 1S2VA 3M7WA 4XAYA 5FJJA 5FOOA 5EMKA 3O7UA 4BFAA 3W0KA 4JNYA 4OUEA 4G1KA 4DM2A 1EQCA 3OLIA 1MNSA 2X7WA 2NXHA 1ZRQA 4H3DA 4REQA 1ZB5A 4ZQCA 4C1NB 4OGZA 4E4UA 2ZBTA 1ZCCA 4N6EA 5IOBA 3ID7A 3P0XA 4XZLX 5BOEA 1L6SA 3AHXA 3HTWA 1JZ2A 5AOUA 4Q8TA 4GUJA 5D32A 3VIJA 1SFJA 1FBAA 2PAJA 4KEVA 3C2YA 2WVUA 1TE6A 5DCDA 2VRKA 3DESA 3I3BA 2O7SA 1PEZA 2VCCA 3QEZA 4DWSB 1ZJAA 2W0UA 2REQA 4MLRA 3NGFA 4Y8EA 2ISSA 4B9YA 4ZSTA 3L65A 3IV3A 4O4WA 4E38A 1MQPA 1XRTA 3KLKA 1G7VA 2DZUA 2WSPA 4GXWA 3WJWA 1GPWA 2X2GA 4WSKA 1RVGA 1UD3A 1W8GA 4XWUA 3CLWA 2PSNA 2PDXA 2IXVA 3ZVHA 1IXQA 1W5MA 1IGSA 3T9PA 3IANA 2X0HA 1QU4A 3L23A 3ONCA 2FVLA 1B2YA 1SUXA 3AMGA 5EGRA 1G4SA 2QMKA 3LHTA 2PTZA 1VBHA 2PDPA 3B0YA 1KD0A 3GW0A 3A64A 4H7VA 1OCJA 4MWAD 1VLWA 4IH3A 1H7PA 4FB7A 1SM9A 3I6RA 4L1GA 4L9XA 3M5VA 4KQNA 5A6SA 5DCEA 3NUKA 1E6SM 1YYAA 4JTIA 3H6OA 2DEPA 3GXTA 2Q71A 1JJKA 1F4HA 1H51A 3WMCA 4DBWA 1K6AA 5FKYA 1S2AA 3GG0A 5JBFA 1KM2A 3PZTA 2GQ9A 1A49A 1CBGA 5K9XA 2I5IA 1FWRA 1C91A 1QATA 1IR1A 4RW3A 2GWGA 4O28A 2E6AA 2PA6A 5GJPA 1TJ0A 4KETA 5SWUA 4MYXA 4LB4A 4TVCA 4ONVA 3THCA 4JCMA 3BLPX 4YTSA 1GQKA 3RO6A 1IT0A 3NYZA 3WEZA 3KOZA 1K9DA 3CLMA 4QCFA 1N55A 3UY8A 4C5ZA 1DVJA 3ITCA 4LBRA 4C7GA 5A69A 3NZPA 4OV4A 2TODA 1F7BA 5LNSA 1VHCA 1U5HA 2Z25A 3CUJA 3LTYA 3TOYA 3VNIA 1W1A1 2DT3A 3OQEA 3VO0A 2PDBA 1O5QA 2D69A 3SJNA 3CPUA 4KGLA 1EL3A 1OC7A 3P74A 1GTEA 2J7GA 2OVLA 1OCQA 5BRPA 4PTWA 3ITYA 2Z27A 2LLEA 4P2VA 2YYUA 3GU9A 4MMWA 1VPYA 4B3KA 2WM0A 3UR7A 2V67A 3BLIA 3VKAA 4PUMA 1PB0A 4XSLA 2GGHA 3UZZA 4GPNA 2OODA 5CBJA 4TMCA 5J5DA 3VTRA 3RCYA 3SUUA 3TZFA 1JDCA 1VIWA 3K1GA 2QCLA 3DI0A 4NZCA 1VEPA 4GABA 1ESWA 4WOQA 3DBNA 1MMFA 2NT1A 3FW6A 1XICA 1P0DA 3ERPA 1B1YA 1G0CA 3SUWA 2Q01A 3CB8A 5HQLA 3TQKA 1LT8A 3CV2A 1R3RA 2VFEA 3PB2A 2QAFA 3BG9A 2RDTA 3OTRA 4F0LA 1C9DA 1YDYA 2G3JA 2WO5A 1EF3A 2E9BA 3CPRA 4V15A 3DFYA 4KRTA 1XC6A 1LTDA 5CPLA 3W1QA 4B2DD 1TX0A 1WBHA 1EWEA 4C6FA 1R6WA 3E5PA 3WH9A 3W2KA 2ZZ4A 2R1NA 3W2UA 1DIDA 1M53A 4GO9A 3S5SA 4DJFD 1MRAA 3BV7A 4LUYA 3N3MA 4S3JA 5A6BD 3BJSA 5KEZA 1UH3A 4DYEA 3IJIA 4W93A 1FWGC 4LOCA 3GVVA 3LY0A 1S46A 4XK2A 2IKJA 1NWTA 2CNCA 3R0KA 4A3YA 3KRUA 3A3HA 3GDLA 5BRQA 1ZBCA 3MI3A 3G1DA 3FKRA 3AZSA 4AD5A 1EXPA 3W70A 1EJSC 1W6TA 3LM7A 3WD4A 1A5BA 1E6XM 3W24A 3E1F1 3CM4A 4UMCA 2V38A 3W1MA 4ERGA 1GUVA 1E9ZB 1S38A 1ZGDA 2D2HA 4W4QA 1WAUA 2HVNA 1JCYA 2FTPA 3GDKA 4B2DA 1XBZA 1HL8A 4Q6JA 3OOQA 1EC8A 3V3WA 4CCZA 4NT0A 2VOMA 5HJXA 2ZA1A 1V08A 2ZDSA 3GH7A 4CD8A 1FWHC 1TV7A 3GAKA 2B7PA 3K8MA 1G69A 3KVMA 1E9IA 3VOIA 1ALDA 2BFGA 1XF0A 1OT2A 2VQTA 1J11A 5G2WA 3O2LA 1A50A 2B0MA 3TTOA 3W84A 2YSWA 3SN4A 3NCOA 3N1AA 1M3UA 1B3YA 5TAOA 1VD6A 5C8BB 2XIQA 1W9XA 3KEHA 4N9EA 4LUIA 3T4CA 1W3IA 2FPYA 4AYGA 3UYCA 5BXTA 3QGVA 4E3TA 2PWFA 3W87A 2TPSA 1EJ7L 1NM9A 1AW1A 3ARUA 3PPCA 1W3KA 3LCWA 4AMAA 1PE1A 4QG9A 1VEMA 1U5VA 2EPHA 3NQCA 4BJHA 2JGYA 3INPA 3GLCA 4DVOA 3CYVA 3TSBA 4REQB 3MCNA 1EZWA 1FX6A 1EHAA 1BHGA 4LANA 3M46A 3Q45A 1JGMA 1VRDA 4O1CA 3VD4A 3R7MA 2XPKA 1H1NA 4HSNA 5DO8A 4AD4A 2VTFA 4NYUA 2DSZA 4O1BA 1HKMA 4CKQA 2YFNA 2HPMA 4J5NA 2VEFA 1I0DA 3LLDA 3TU9A 1FWEC 1KM3A 1L8NA 2JBMA 3DZ1A 5C2XA 1E15A 1BYDA 1S5NA 1FQ0A 4X2PA 1HXJA 1X8FA 3S9ZA 1FWIC 1OF6A 3WJSA 2DSUA 3LV6A 3TC6A 4UZUA 3CAVA 2DZSA 4J3XA 3LZ5A 4G1NA 1XLFA 4DQWA 3SBFA 1XINA 2JALA 3VU2A 1XXXA 3E9AA 4IFKA 2BOEX 3REQA 2Z7KA 1NDVA 3GNPA 3UERA 3LQGA 5BU6A 4F2UA 3G1XA 3S3GA 1L8PA 3QN3A 1Q66A 3T05A 3WG6A 2WSKA 4Z0SA 3BQ5A 3WLRA 3W01A 2Y5EA 3ZO9A 3VFCA 2YDAA 5HPCA 4U2ZA 4XO7A 2FTWA 3N11A 1DIKA 1M01A 2PWUA 2HMCA 1L2UA 4JTKA 1K7XA 4MWAA 5HXMA 4NX0A 3LPPA 3LTPA 1QMLA 3BAYA 5C9RA 5BXSA 3UCCA 2GVGA 2XZ7A 5LA2A 2ZA3A 2ZC8A 3NOEA 3QOKA 2ZVRA 4DJFA 1B5TA 3MP5A 5I3DA 1XUUA 2DZXA 1JPKA 3SURA 4Z2LA 3KBSA 3E74A 3I7QA 3B06A 4I3GA 4JQAA 1RZMA 5F2GA 3SQMA 3PULA 3KL5A 1NEYA 2F9RA 2B81A 3ARYA 4MF4A 2R6OA 5CSSA 4ENLA 1IYXA 1KGXA 4L4LA 2CLOA 3UGVA 4Z2JA 3IIZA 3QV9A 1H11A 3MHFA 1QNVA 4DPPA 1AA1B 3IJ8A 3UZXA 3MSRA 4NX5A 2QCDA 2ALDA 1JPHA 5L6UA 1P5BA 3V1PA 1JRBA 1W17A 4RNFA 2DT0A 2BSLA 5A95A 3LPGA 5FEPA 1ODZA 1OT1A 1KRAC 1RBOB 2VUYA 1O6IA 2VGIA 2YDQA 4GVFA 4US6A 1PX4A 2D2OA 3TYCA 1I2PA 1L6GA 2D23A 2VD9A 1IZJA 1U22A 3CIVA 3L4YA 4LU0A 1FWWA 3VIKA 1WX0A 2XIMA 2L5HA 2FTYA 3ZM8A 1KGUA 3GHUA 4C65A 4B5TA 3KDNA 4IX0A 1QXLA 1NFBA 1MFVA 4BF5A 1OK6A 4JZ5A 2WCAA 7ODCA 4Y9NA 1VPQA 1GQIA 3E12A 3BGAA 4Q6XA 2HK1A 5DBTA 3WD1A 4WGHA 5I3KA 3VNZA 2W61A 3ARPA 3GXPA 4Q8NA 4R85A 1DQXA 3MI2A 3WFLA 2OWWA 3F4CA 3WLHA 4PRRA 4YWSA 2QXWA 2OEKA 5CPQA 3S1VA 1P0NA 1QOQA 2NVAA 1EUNA 4CD5A 4JTJA 1SO6A 4O1EA 3QPEA 2GJXB 2GSHA 3DYMA 3MUZ1 1LQ2A 4UFMA 4X61A 1LROA 2FJUB 2RJHA 4JTFA 3DOPA 4J3WA 5I3FA 3WLQA 1UD8A 3L9CA 1QASA 2Z1BA 4EWJA 1I4NA 5FF3A 5CPNA 1WKEA 1VFSA 4NG3A 3C2OA 2KX9A 1US0A 3U2ZA 3T0DA 4MJ2A 2OTDA 2X1TA 1JCJA 4O8AA 2Q3OA 4MKSA 1KLYA 1DBTA 1NOUA 4DO6A 2WAGA 4FNRA 4C6DA 1GWJA 2QPSA 3OGSA 5T26A 3M0LA 2J4GA 1SSGA 2OT0A 2G37A 1ITUA 1MZRA 3MPGA 4V2XA 3GC2A 4LFYA 1M5WA 3O6YX 8RUCA 1OGGA 3G24A 5A1AA 2FH8A 4R7OA 3DFSA 4GX9A 1PX8A 4HB7A 4IGSA 1HKWA 1TJPA 3KCLA 2PC4A 2ALRA 3AMCA 4CU8A 3SY8A 1Z6KA 4AF0A 3WF1A 3ARSA 5C9XA 2OO6A 1UD2A 3WJYA 2RKXA 4HNOA 1NTHA 2VR4A 3EPNA 4PRWA 2H90A 3BCJA 1XYZA 3CWHA 3FKKA 2XN0A 1ME8A 3PZ9A 3E0LA 2CKRA 3PAJA 2A3EA 1UUQA 4HA0A 2OEMA 1XIHA 2FMNA 3V16A 2PODA 1L0PA 5I79A 2Y88A 4Y2WA 2QHAA 5IXEA 3FY1A 2ZICA 3TTYA 2QULA 3FJ6A 3IRSA 1OADA 1Q4NX 2DVUA 4RW5A 5CZTA 1J10A 3N4EA 3KP1A 2I5QA 3TWBA 2BY0A 3SGUA 4YYFA 5ABHA 3LHWA 3WDIA 4WSHA 4WJXA 2OLSA 3KHJA 2YW3A 2GJRA 1C3FA 1OFAA 1NWUA 3SUVA 3IUIA 3G0UA 4OFCA 1R7OA 1YMYA 4IF2A 3K4AA 3Q2DA 1GVOA 3P2VA 3M44A 3A3WA 5HWJA 1DJWA 3SGGA 3QVQA 3JU2A 5E70A 5BYWA 1VZWA 4XAGA 4F8XA 2D3LA 2E6FA 3VKBA 4QDMA 1NELA 3LOTA 4C6BA 4UQAA 4DI9A 1SO5A 2ZRUA 3GNOA 3H4GA 3HB9A 3OODA 1DKWA 4HK6A 4HK7A 2GSEA 1QVBA 1G5AA 2G5WA 3GC4A 4FK9A 1VBRA 1Q6DA 4QJ1A 1TMHA 1JCXA 4BWLC 1UKQA 1GK8A 1E5JA 3SCNA 3TX9A 3B3DA 3BXWA 3GHSA 3QHOA 4GNVA 1QI4A 4RNHA 1V5XA 5I3JA 4K6AA 2BXZA 1QK0A 2B7QA 1H41A 5FAGA 3KX6A 3DFHA 2C1HA 4JPGA 1SR9A 2VEMA 4TO8A 3BAKA 4C7DA 2G50A 1S5VA 1NDZA 1VYRA 3AZTA 2YJQA 2ZX5A 5H1WA 2OO0A 3N13A 4JQ4A 1OZQA 4YHGA 3SW6A 5D37A 3N34A 3C2EA 3A4XA 4P7NA 4QE1A 2Y85A 4E8GA 3N73A 2XG9A 2QLYA 1ZPTA 1XLAA 3RMJA 4AVOA 3PANA 3NO1A 4AU0A 3H12A 4WXYA 1QI5A 2DUZA 1LLOA 1K1DA 1XLHA 1CDGA 4LJ3A 4OECA 5GVJA 1BFNA 3IGSA 4MSSA 1K8ZA 3IJQA 4W8BA 1HVXA 1RBAA 2AAAA 5I6SA 4PCNA 4Y6GA 3EGJA 3PFMA 4HA3A 1B0IA 2VGGA 1PX3A 4KESA 4ADUA 3L2LA 5D2TA 2X0SA 2IKIA 3WH7A 4AX6A 5KZDA 3VKJA 4UWMA 2PF8A 2XVKA 4MYAA 3ORWA 1RD5A 2VZTA 4DBEA 4TIMA 4O15A 3RR4A 3QZ6A 4AMCA 3W82A 2PE4A 2ZUVA 1OFDA 3WF0A 1H60A 5BNKA 2P88A 2G3IA 2E28A 2PZNA 3HURA 1VKFA 2RUSA 3EMZA 1E40A 1L6YA 2YCIX 4NZ4A 3MBFA 4J3SA 4UQCA 5D09A 4U3CA 2C3ZA 2VMFA 3JW7A 1CX9A 1BGGA 2VCBA 1QBBA 5A2CA 5CZ0A 2WV8A 3AS3A 3F4NA 4HMNA 1A5SA 1D9EA 1XM3A 3JS3A 1CYGA 3C0QA 3AS1A 1WCGA 2GQ8A 5AYYA 3MU7A 1YEYA 4UTHA 1T99A 5T9CE 1UD6A 3DG7A 2ZKMX 4H8NA 3MMTA 1RVKA 2ACRA 1KNWA 3FAWA 3NDOA 1X6LA 4KERA 2UY2A 2A6NA 5BW6A 1SO3A 2CXEA 3VCCA 2QCEA 4RV8A 5I06A 3MMWA 1ECEA 4WKFA 1IHIA 1ZJHA 3NDYA 4ZQRA 2OWXA 4S3EA 4IGMA 3TFXA 1XLCA 4AVFA 3OHIA 1QUMA 4Y96A 3SEPA 3VZXA 2ZA2A 1B4KA 1TZZA 1CEOA 2QVHA 1P6CA 1DJXA 1GTHA 3W25A 4DJDC 1Y7VA 4E8CA 4H2HA 2R14A 1OQFA 1PYFA 3SI9A 1H7WA 1JUEA 2YDSA 1OWQA 3DG3A 3GUWA 1AQMA 2WOQA 4GXMA 2EPOA 4NKCA 2OX1A 1EBGA 3BAIA 2OKTA 4KRUA 1R47A 4NRRA 2VC6A 4XZ9A 1FHLA 1WDRA 3NDZA 5E9XA 5KZMA 1QCWA 5FACA 1A4MA 4LUJA 1CCWB 4HCDA 2XFRA 1ZBVA 2D0HA 3T0CA 3MBDA 1BVWA 2VURA 3LLXA 4LVFA 3L5MA 2QJHA 5AYXA 4K37A 1FWTA 3GX9A 2PRMA 1JCNA 3P60A 3WX7A 3W1RA 4B16A 2YOCA 1EYWA 4FNSA 1UR3M 1CGUA 3CV1A 4M6QA 4QIUA 4W88A 3IV8A 4W86A 3NIYA 3TCEA 3W7MA 4BQ2A 7A3HA 3WBXA 2FZNA 5E09A 1SO4A 1V02E 4IL0A 1Y5XA 2Z26A 3EWDA 4BA0A 5D33A 2VFHA 1FRBA 1UB3A 3LCGA 1EBHA 1IIHA 3HFYA 1XHGA 3CAWA 3AXIA 1XQLA 3L2IA 4UTWC 2WCSA 3G0SA 5H8PA 4ZXLA 2NSXA 3GDTA 2DSKA 1YPFA 3QM3A 4GUHA 1OYCA 2Y2WA 1F8IA 1TJRA 2ZXBA 3LYEA 1ZHAA 3TA9A 5DX7A 1C8XA 1XD1A 4IFRA 1JAKA 3CWOX 2B4GA 4PSPA 3S2NA 5D03A 4BWLA 2DIJA 3T81A 4FNUA 4O19A 3ABOA 4BK9A 3SM0A 4CQBA 1JPMA 4QEEA 3F4WA 2CLKA 3U6WA 2ZWYA 3W2MA 4JL1A 2WC3A 3NZ1A 1Q63A 4O52A 1ADSA 3UCDA 1Z3NA 4KWSA 5IBXC 2W66A 3THAA 4GO8A 2CZ5A 3ICJA 1CNVA 1EGMA 3PTMA 4HOXA 1CT5A 1DJHA 3AS2A 1TVNA 1S3TC 3AIWA 3K4WA 3R1ZA 1ISXA 3MVTA 5LNVA 4GQGA 5DFAA 1A5NC 1US2A 4WVXA 4GVIA 5I78A 5JUVA 1EP1A 2NUXA 4AH7A 2OLAA 1EGVA 5ECUA 2FVKA 3ZR6A 4IICA 4HU3A 5H2ZA 4H6RA 3S8HA 1DWJM 4K7VA 4DO5A 1VIZA 1QBAA 5E6ZA 4J3TA 4XUYA 4ATWA 1EZ2A 1OZMA 2OJPA 5F4XA 2GVLA 4WY0A 5D9MA 1LWJA 3K30A 1NFGA 4UR9A 2RDUA 2P3ZA 4NNCA 3E2VA 3CZEA 4B5XA 4Q4QA 4MJZA 4UNLA 4P8VA 3QRHA 1OG6A 1M9HA 3T8LA 3QYSA 2W67A 1CTNA 3F2DA 2R1LA 2Y70A 3APTA 3WJXA 4F79A 4Q3MA 4NXKA 3W7CA 2H8ZA 1H2JA 3LBCA 3WK1A 1FFRA 4HMEA 3SUTA 4M8UA 1LQAA 3TONA 4B90A 4DBUA 3PBGA 3L2MA 3SCWA 3STFA 4LXFA 1GVEA 3BMWA 3KRSA 4EF9A 1X7FA 2NQLA 3MW7A 1JDDA 3G1SA 3G6LA 1UR9A 3IIXA 4DYJA 2E7FA 2GYIA 1E9YB 5DRCA 1FDYA 2EKGA 2VC7A 4I5UA 2XFYA 3ZT7A 1O5RA 3BMVA 4A3RA 1NP2A 1V6WA 3W6MA 4E0CA 3FN9A 4FX7A 3CHCA 2VUNA 1CXEA 4HVXA 3ZMRA 2QW5A 4QLKA 4H8VA 3JRKA 1OB0A 3HQOA 4W9TA 1WOAA 1UIPA 3T44A 3XISA 4IMDA 4PB4A 1GOXA 4QG6A 2DZAA 1LWIA 4RKAA 2WZIA 5AYBA 4K1WA 4ACYA 3VE7A 1MXGA 5HMDA 3BTNA 5K2ZA 4DEFA 1XIFA 4QAIA 5FF2A 3RM4A 5CPMA 1AJZA 1F5ZA 4WY0B 2C0AA 2XN1A 3EB4A 3CMFA 2HCVA 1E6ZA 3MTWA 3DHPA 4PB3A 5DN1A 2OG9A 4S23A 5CC3A 4KWOA 1JDAA 1CWYA 4CCCA 2XVNA 4QEHA 2Z2AA 5G1MA 4CN4A 2DV0A 1F3EA 2ZZ5A 3RITA 1F3TA 3EKGA 2HDJA 2C79A 1W56A 3KE0A 4HBKA 1DXEA 4ZFCA 5A8NA 3W9ZA 1BWVA 2X1SA 1TKKA 2YPIA 3H2MA 3MP4A 2EJAA 1GJPA 1CECA 1XH2A 2G96A 5D2WA 4JTDA 1T40A 1EOMA 1KWGA 4TX8A 4AVNA 2WJEA 5LA1A 2XN2A 5XIAA 3GG8A 4B3ZA 1JD7A 4ICNA 4UZSA 4M6UA 1IZCA 1X6UA 3L5AA 3WD2A 8TIMA 7TAAA 4LC6A 1KFLA 2DZPA 2X30A 1XDJA 4AW7A 3AALA 1A0CA 2VZUA 3EOLA 2WC4A 1H09A 3K1DA 3AHVA 3VNLA 4PB5A 2V2CA 2J7HA 4KCTA 5BMWA 3VOHA 3ZJ8A 1BSIA 1WDSA 3P84A 3KTCA 4FEZA 3TIMA 1PIFA 3N2MA 3ABRA 3MJYA 4JIHA 1Q6FA 1RLDA 2A0NA 1AUSL 1VYPX 3P81A 1AD1A 3PG9A 4CU6A 2BTMA 2WVSA 3QF0A 1U33A 4N9BA 5DY2A 4LS2A 1UD5A 2OSYA 1TX2A 3AIVA 2Z29A 5HK4A 1V6XA 2IQTA 4NILA 3AOFA 4CCDA 3T4WA 4WDUA 2V2HA 4PUNA 3CU2A 2GWNA 2V3FA 4FOKA 2Y1HA 3NL5A 1LWHA 4S3KA 3QHNA 3EX2A 1W1B1 2VX6A 2DORA 1TWZA 1OFBA 3EOSA 1Y5VA 1SZEA 2UBPC 2WNNA 2PBOA 5EU9A 3WLNA 2I7GA 4B92A 4G7EB 3AJ7A 4YHEA 1TMLA 3OZPA 3V5OA 1M7XA 6PTDA 3SGZA 4RPPA 1G4PA 3FGCB 1CXLA 4NL1A 4U10A 4IMFA 4F0MA 1XISA 4FOUA 1HJXA 2XH7A 2OR2A 3W73A 1QW8A 4GY0A 1D8CA 3WF4A 2HS6A 6REQA 3O06A 4HMCA 3V7PA 3WNPA 1TQJA 1HKJA 3WLJA 3GDMA 4O54A 3W7EA 3CB3A 4C6MA 4JTCA 1EP2A 4LS1A 3BV4A 3WUFA 2F6UA 2FMOA 2XFWA 1KM4A 3AJXA 4ZFMA 1E0WA 1OFPA 4LAOA 2B31A 3R13A 1RA0A 2CHNA 1GQNA 3EWXA 4JS3A 3WO8A 4NVTA 2ANUA 2O0TA 5H91A 2VT0A 4IWWA 3TQ0A 1BVZA 3ANUA 1W1YA 3H2AA 3EWBX 3AYTA 1E72M 3S6TA 5CEWA 3SADA 2NLYA 1B9BA 4MDOA 2VM8A 1MYRA 5MKGA 3UCQA 1KO0A 1Q45A 4S3BA 4UQEA 1MQQA 1FDZA 1ELSA 2PDIA 3W7JA 5H6HA 1B3OA 2BGNE 3GD6A 4NIRA 3HN3A 3LZ3A 1LRTA 4O10A 1PZ1A 1LOLA 3G3DA 1PIGA 3GS6A 5IBXA 3BMXA 2JEQA 3CEUA 5F2LA 3M0MA 4S39A 3BCFA 4U28A 3PB0A 4IUOA 1OCNA 2EXOA 3FXYA 1WXYA 2CZEA 1AFSA 2ZZ7A 1J4EA 2XZ9A 3RX2A 3E5BA 1OYAA 5AYZA 3UGRA 2VX5A 2HE5A 4G7EA 4IQEA 4I6KA 2ZE0A 1IWBA 2QZRA 3HPSA 1A4LA 1SFLA 1P1MA 2UV8G 1BQGA 3PZQA 3BLOA 1UPPA 1RD6A 5CGQA 3AFBA 4A21A 1DWGM 3WH6A 1BWKA 2QDHA 1FY6A 2O9OA 4YN5A 1F3XA 4JY8A 3M6DA 3I7RA 4LEFA 4Z0JA 3F4DA 3ITGA 1FOBA 3SRHA 1TPWA 1V0LA 3UR2A 1SMDA 3C2FA 4MLJA 4N02A 5GNXA 3GZ3A 1KFBA 4G6CA 5D9NA 3O6AA 3VIHA 3LS9A 3BH4A 1KM0A 3VNDA 4OUIA 2PI6A 3N2XA 2WNWA 1JR1A 3O07A 2PDYA 1EDGA 4FNQA 4LBUA 5G2HA 1V03A 5AHLA 2PDWA 4O4VA 3ZVHB 1EGZA 1LM1A 5K3VA 3MCMA 2WJDA 1TYGA 3VGDA 2ZRVA 4UFIA 2OOFA 3U4FA 3MKKA 1V3KA 4WEVX 4WGXA 3TYEA 4GY7A 3W6LA 3W1LA 4U3AA 3TE9A 2FHCA 1SQ7A 8A3HA 5CZSA 2PTDA 1GZJA 5HQEA 1AZ1A 2I16A 5I09A 4R33A 3MV01 1LUCA 3QMSA 3QTPA 1UOZA 3WMLA 3KOFA 4HU4A 4LT9A 3WQGA 4GVGA 4C5YA 2REQB 4HD5A 3DECA 4W7WA 3T2OA 3PK7A 1L9WA 2J13A 2YLLA 4H01A 4F9JA 2BVYA 1VFTA 4KEMA 4LRSA 3MWCA 4S2BA 1GYNA 2DFAA 1PBGA 1RY0A 3WQ4A 3DIPA 4Q8QA 1XYFA 2OZTA 3GXDA 3UETA 2VR5A 4DWSD 1Q7ZA 5M5DA 3WQEA 3HPAA 3H53A 4UTLA 1SZNA 2DU2A 1POKA 4D6JA 3RNDA 3CPGA 4K8GA 2J27A 4Q4PA 3ALFA 4R53A 3KL0A 5BXPA 2QGHA 3QV8A 3C3NA 4TR9A 3W72A 2YDRA 4V1YA 3FFSA 4HP5A 1L6FA 5CGMA 1H7RA 1JPIA 3WDJA 3WNMA 1UH2A 1LZOA 2JFEX 3AICA 3GB6A 1ONRA 1CXKA 5CG7A 1E71M 3T55A 4NI3A 4LSBA 1OFQA 1H4PA 1OVDA 4YTQA 4K1GA 1REQB 4M7SA 2QDDA 5HJLA 3BE7A 2G4JA 4GYPC 1UR1A 3RAOA 8XIAA 2Z1VA 3MSYA 1LBLA 3W75A 2NQ9A 1LRQA 1RQHA 4O1FA 4LX4A 4JIRA 3OBAA 3VCRA 3M0JA 4K38A 2HISA 1GKRA 2I57A 2W5FA 3OZOA 3T1GA 1W1TA 1HJWA 3ITOA 3MMDA 3PJUA 1TPB1 3B8DA 4LTSA 3A13A 4BF9A 4CD4A 4IG2B 2PWVA 3RFAA 4HNTA 4OKDA 2CHRA 2Y4SA 2ZRXA 1XIEA 3QZEA 1R9ZA 3NJ3A 3CT7A 3VM5A 3SCUA 4RR4A 3RILA 3AXXA 5D05A 3WK3A 5HBFA 4DO4A 2RH9A 3WEMA 4P61A 1T41A 2DSWA 1J8VA 2ZUMA 4JFWA 2Q6ZA 3RRXA 3GFZA 2O4QA 3EB3A 3KM8A 3P61A 5GQBA 4PSRA 4E2BA 4PFHA 4AWTA 4MKVA 6CGTA 4GVHA 1UWRA 4ZTYA 4F2BA 4FAMA 4S2CA 5GNYA 4GBUA 5HQMA 2PDKA 3W00A 2I1OA 4WKAA 2XWDA 2DUXA 4QG8A 2P3EA 3P5YA 7REQA 3M47A 1JYVA 1BTCA 3UXLA 1XBXA 1B3ZA 3FX4A 3L66A 4ZCWA 3EX1A 2Y7EA 3GTFA 3LNMA 1NWRA 4ROPA 2DZTA 4MADA 5B7ZA 3B8VA 2DPEA 2GDVA 1IEQA 4Q8MA 5AC5A 1PDYA 4Z2IA 3GSMA 6XIAA 5AHMA 3L5LA 3TVAA 3RG6A 3RLHA 3V0TA 1TZ9A 4XIMA 3MQTA 5MF5A 1IZKA 3CUZA 4FPSA 4M29A 1FCBA 4RE2A 4UR7A 3GAYA 7TIMA 4MPQA 3UPWA 3KAOA 5DRIA 2OMAA 3IUDA 3VM7A 4L56A 1S5WA 2JF7A 3FK4A 2PEVA 4B5NA 5I3HA 1HW6A 1XR2A 4QR6A 2DUAA 5K9CA 4ZE5A 2BB0A 2ZFAA 4CQ9A 3UWWA 5HWNA 4M6VA 1GQJA 3TUUA 1R3QA 3T42A 2VFIA 3OIXA 4I7VA 2WBKA 2H8XA 3AZRA 2NZLA 4BI6A 1C92A 3LDVA 1FP8A 3CQIA 3THUA 4DJED 1ZJBA 1UOKA 3R58A 1V93A 2GZXA 1W5NA 1K9EA 2Z1SA 5F2MA 3ZLFA 3WLKX 1O60A 4TQTA 2VGBA 1SZRA 1ICQA 2IUZA 2NXIA 4GJIA 2ABAA 1A47A 2PP3A 1XYBA 4GE8A 4DIAA 3STPA 5HPOA 3SSZA 4Z2HA 2CLIA 4DYKA 1ZS2A 5BRBA 3G0XA 5A8OA 1SSDA 1NOFA 4CGTA 2GJLA 4M56A 4QNEA 3VD7A 3RCMA 2FIQA 5EY5A 4MTVA 3IARA 2ACUA 3D3AA 3KL3A 4WR3A 3UU0A 1JUKA 1ZJIA 1UC5A 2GJPA 2Y24A 1UH4A 2J88A 1HQTA 3QW4B 3BW3A 1US3A 2ZWZA 5CPTA 2WKGA 3E6EA 1HP4A 1IGWA 4LVDA 5FJRA 3E0VA 3C5QA 1T96A 1GG1A 3BLEA 1YX1A 5H8MA 4BR1A 3ARWA 4FALA 4YTRA 1XIIA 1XJBA 3BAXA 3TW7A 3IUHA 1M1BA 3R0DA 3AWNA 4WXZA 3VNYA 2ZC1A 4FLSA 2G8ZA 4CNNA 2NVCA 4PMQA 1AW2A 1S5MA 1QR7A 2D2JA 4Q8OA 4AEOA 4AZBA 2DDXA 2EPKX 5FEXA 4AWSA 2XH0A 4BY3A 2ZXDA 3AXMA 3C56A 2Y63A 4YXGA 1LL6A 1GZ1A 2ZE3A 4L5ZA 1JFHA 1PUDA 2YA2A 3TW6A 3F03K 3REQB 1WKDA 2DZVA 4GI6A 3DKJA 2V9DA 3QV7A 4N4QA 2E6DA 3TN6A 4J27A 3MCOA 4XD6A 1W9UA 5DT7A 2CERA 1WE5A 2PLJA 1LORA 3GR7A 2XFFA 2QCFA 3QQWA 3PBYA 1LBMA 5D2VA 4QISA 3MSGA 1UG6A 4JYDA 2AMGA 1ONEA 1DWAM 1YQ2A 5J5RA 3PWIA 1R2SA 4ES4A 4QJ4B 4OE7A 2F8QA 2VNCA 3VGBA 1KV5A 4I7UA 5DCBA 3OO2A 1BPLB 3E2QA 5IDIA 4DAFA 2QAPA 1XLKA 5F2IA 3TXZA 4DF1A 4IIFA 1ZUAX 2R9RA 3P7YA 3RUBL 3H7UA 5ENLA 4JFTA 2D73A 1SMAA 3FV9A 2OT1A 2WMKA 4Q4KA 1LG1A 3R11A 3NQFA 3LTSA 4XBJA 3WK2A 4AIBA 4HPHA 2QUUA 4JKLA 1OF8A 4RX0A 2NX1A 3WQVA 1UZDA 2XISA 1UP2A 4K36A 1AVAA 4N7QA 4FHAA 3F5JA 3RHGA 1OX5A 3UFYA 4GGHA 3VUSA 4AYSA 1QOXA 2VC9A 3STGA 4JQ2A 5DMNA 3AMDA 5K9DA 3HV9A 5FEWA 3WYZA 2OPJA 5BMXA 3V5CA 1XQKA 3FDKA 5U4NA 4XTDA 1V8EA 3OEXA 1QWKA 2HSAA 3W76A 2R24A 4C6KA 1ONXA 1JCLA 3TQVA 3ISIX 4LS0A 4A8LA 1WDWA 3B4YA 3CL8A 3S2LA 3URBA 2EPNA 4BI5A 4EE9A 5D2XA 4OT7A 2RHGA 2H3BA 1EFZA 5E9AA 3B97A 4WCJA 3CQKA 2E9LA 1CGWA 4V28A 1J6OA 3TYZA 3SIZA 4JIQA 1PKLA 1DWHM 1K8YA 4POCA 5HULA 3FEMA 4YS1A 1C8VA 3O16A 3T0AA 4DM1A 3BJFA 4DO7A 4JIPA 3SQSA 1XD0A 2VGFA 4CLMA 2OYMA 3VNJA 2C13A 3POCA 4NI8A 5CAKA 4GKTA 3CL6A 3VFLA 1P0BA 2HBVA 3O9NA 4Q7NA