4HZ6A

Crystal structure of bglb
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
441
structure length
441
Chain Sequence
b'KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucosidase
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 176
structure length 441
sequence length 441
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz6A00
1OD8A 1B30A 1XSKA 1JNDA 2JE8A 3CZ8A 4GPNA 2X1IA 1HIZA 3OLDA 4DM1A 2VR4A 4IPNB 1HJSA 1LF1A 4ATWA 2NSXA 4C7FA 1NH6A 2D24A 1JZ4A 1WE5A 3CUJA 1KWGA 2WSKA 4X0VA 1MW0A 4WSKA 3VDHA 1XH0A 2V3FA 1X1NA 4D6IA 5D9MA 1HN1A 2ZICA 5CGMA 2G3MA 2Z1SA 1R7OA 4PMXA 3BAIA 4OIFA 4RE3A 3SCWA 1JZ8A 3O2LA 5D8ZA 1M53A 3VIHA 3VVGA 2QLYA 2XPKA 3VIJA 5LA0A 3ALGA 2ZUMA 3OBAA 4AXNA 2G41A 1HNYA 3L4YA 2X05A 1GCYA 3WDHA 1ECEA 2VZOA 1B3XA 3QHNA 1E0WA 3WF2A 2PWHA 2O9PA 3M07A 2YBTA 2WM0A 1LG2A 4KGJA 1M04A 4XUYA 3EDDA 3VX1A 3NSNA 2DT2A 3DYOA 1WDRA 4TX6A 1W1PA 1PBGA 2E9MA 1VFMA 3BMVA 1J12A 4QDMA 5LA1A 3UR8A 4W8AA 1IZJA 1W91A 5JBFA 1I75A 2ZIDA 1X6NA 2BS9A 4UZSA 3RMEA 2D1ZA 4BQ4A 5BYWA 2DH3A 1B90A 3ARRA 1W9PA 4JZ5A 4U2ZA 1UH4A 3SUUA 3VMPA 3WUBA 3THCA 2VI0A 5EFDA 3MMDA 4OBRA 1MWOA 4JCLA 5A8PA 3PTQA 1BG9A 4W7VA 4ACZA 4Q22A 1FFRA 4Z2HA 3KL0A 3A6OA 3GBEA 3W82A 3TTOA 2XVLA 4B9ZA 4Q7NA 3CPUA 1N82A 4Y7EA 3N17A 3UG5A 1GUVA 4PMYA 3AS2A 1KFWA 1OIMA 1US2A 3U7BA 3VIGA 1ODZA 3SUVA 3TA9A 3NDZA 4ZXLA 1GVIA 3ARYA 1BGGA 3GH4A 2CXGA 1JYWA 4J7RA 2YL5A 1CGWA 4FLOA 2GK1B 2OYLA 1W9UA 3OA5A 4JHZA 2O9TA 4PSRA 3L4XA 1V3JA 2EO7A 1CIUA 4J28A 1W1VA 2DSVA 2CHOA 4UCFA 1YQ2A 2Y8KA 5CLWA 3ZT6A 5A6BA 2GFTA 2BHUA 4P8WA 2ZUWA 1HP5A 3ZT5A 1H1NA 3GXMA 4BQ2A 4J27A 3WFLA 3WF0A 1VRXA 1G9HA 1QI3A 4JFUA 2YLAA 1QNOA 1QBBA 1R85A 1UYQA 3AOFA 1UR0A 3AXIA 2XYLA 5M17A 1W9BM 4EE9A 3OLEA 4KH2A 2A3CA 1TZ7A 1HKKA 2WWCA 3L4VA 1RPKA 4MB5A 2YLLA 3GNRA 2JF7A 1QNSA 2XVNA 4U3CA 2DSKA 3AIQA 4XZWA 1WDSA 4F9JA 3AQUA 2OWXA 1U30A 1J11A 2JEQA 3VX0A 2GVYA 1KWKA 1U2YA 2WVTA 3O6AA 2CBJA 2CIPA 5A94A 1UQYA 3G6MA 2W91A 2XG9A 5BXPA 4W88A 2JFEX 1V0LA 3VPLA 2D3LA 2QPUA 3D5HA 2HISA 4M80A 4W8LA 1BPLB 3WSUA 4AD5A 1WO2A 4PTMA 4UTFA 2VCBA 1TR1A 4CVUA 5GQBA 3ARWA 3MUIA 3BXWA 3EMQA 4LXFA 2XM2A 4BQ5A 1L8NA 1KR0A 2PI6A 2J79A 2WBKA 4ATLA 1B2YA 3A4WA 4Z2LA 3AHYA 4B9YA 3WUGA 1CXIA 1PZ3A 2YA1A 2X09A 3GNOA 3GDBA 4HZ8A 2QPSA 3T0AA 3WEMA 3T2QA 4NF7A 1MFUA 1PZ2A 4J3UA 1MXDA 2Y8VA 1KB3A 1E70M 2WAGA 3T2OA 1QNPA 1UWIA 1XRVA 2BXYA 2NT1A 1BF2A 2ZUTA 4D6CA 1F4HA 4NI3A 3UCQA 3UG4A 4MTVA 1VEPA 1VIWA 5JUVA 4MDPA 2XIBA 4U33A 1DWIM 4E2OA 2W61A 3I3EA 4DWSD 3CMJA 3VTRA 1HX0A 3KWXA 1OT2A 1LL4A 1LL6A 4D6EA 2OYMA 5BRPA 1OWQA 1C8YA 5FCZA 1TG7A 1KGWA 3GH7A 4MJ4A 4W8BA 4AZCB 3VGEA 4AIUA 1ITXA 4KMQA 3B9AA 2D20A 3AIRA 4MNJA 2QMKA 4NRSA 1NWTA 3WH9A 3APGA 2YIHA 2DH2A 3GZAA 3WF3A 2J77A 3WH5A 3WUFA 4U31A 4GZIA 1FFQA 4D6JA 3IJ9A 1GOIA 3MUAA 2VT0A 3FXYA 3BAXA 3FHAA 5KEZA 4TTUA 4AIEA 4KRUA 5E9AA 5JBDA 2BFGA 2PBGA 2NW0A 1V0NA 1JZ5A 1OD0A 1EGZA 2UY4A 1DWGM 4CVWA 4PBGA 4UOJA 1VEOA 4AMCA 9CGTA 4URIA 2ZXAA 4XB3A 2J62A 5A8OA 3BCFA 1UG6A 4S3KA 1V08A 1IV8A 3M46A 1EH9A 2EBNA 2G3IA 1E73M 5CGTA 5EFFA 2ZX9A 3PZUA 4A3YA 2DT3A 1PEZA 1BSIA 2E4TA 1BLIA 3SCSA 3UESA 4OJYA 3I3BA 1R87A 1W3KA 2EEXA 1JL8A 1U33A 4R5EA 3DECA 2WB5A 1FHDA 4AD4A 1UWSA 3SURA 3N9KA 3WH7A 1CGUA 3AROA 3ZO9A 1PPIA 1E4IA 2GJRA 1RP8A 2D23A 2FDMA 4KGLA 1WNOA 4AYSA 2G4FA 2C0HA 5FOOA 5JIWA 1CGTA 1J0KA 3AXHA 3WBAA 5I6SA 2XM1A 1W2VA 3PZMA 3W37A 1S46A 4UQ9A 4ZFMA 5M5DA 3PHAA 1V0MA 1J0HA 2EJ1A 2XFFA 4P7OA 2V5DA 2WVSA 2PF0A 2BY1A 2WPGA 1CXFA 1UKPA 1P6WA 2D22A 1QI0A 4Z2KA 4XX6A 1WZMA 3ARQA 1FP8A 3WDRA 4AZ5A 4AISA 1NM9A 3PZGA 3QOMA 1E71M 5GNZA 4F9DA 4MADA 1AQ0A 3AICA 4J3WA 4E8DA 2GSJA 1XHGA 1WZLA 4JKLA 2VRQA 1EOKA 3WD0A 5D9PA 1CWYA 1V3LA 1EA9C 3PZVA 4H04A 1VBUA 2YL8A 4LYPA 1E6PA 4QCFA 3LPFA 2XHYA 3ZR5A 4GZEA 4CD4A 2VRKA 2A3BA 4H8VA 3BLPX 1R86A 4JFWA 2Y4SA 1BG4A 1OGSA 1ISXA 2D0HA 3W6MA 3WN6A 5I24A 4TX8A 1DEDA 2YDRA 3AHVA 5EBAA 2ZUUA 1J0ZA 4AZ7A 4UQCA 1EDQA 2C8NA 2J78A 4UFIA 1BYAA 1HVQA 2E40A 1UD3A 4S3JA 1ZBCA 3BC9A 4UFJA 2EPKX 4JHOA 1E15A 4P7NA 5EB8A 3U7VA 4W93A 2YL9A 2ZWZA 2PWGA 1E72M 4GIAA 2PWFA 2J7BA 5I78A 1XH1A 1JXKA 3W53A 5A3HA 1GHSA 1MFVA 2WC7A 3W4RA 1HKMA 1XGZA 1W9XA 4AZBA 1VEMA 2W4XA 3PTKA 2E9BA 1M7XA 1GW1A 1V3MA 2WC3A 4CUCA 2Y24A 1KXHA 3OB8A 3WY1A 1JGIA 2GJPA 4AC1X 3PZOA 5A8MA 3WNOA 4PN2A 1J18A 2J8GA 3N11A 5E0CA 4WF7A 3AISA 1QPKA 4JL1A 1E43A 3AIEA 3S6TA 5ABHA 5BROA 3SCPA 2ESCA 1UWTA 4YHEA 2ZUSA 3EBVA 2ZXDA 4ZXOA 3AMCA 5GPRA 1A3HA 2QMJA 1E40A 4HPHA 5DEZA 5IDIA 2OSYA 2DSZA 3VDBA 2WW5A 2O92A 1BQCA 1B31A 2W92A 3POHA 1QI2A 4JKKA 3MSGA 1ESWA 1G1YA 4M81A 2WLZA 1ZBVA 4PUDA 3VIFA 3OLGA 2WXDM 2VX7A 3T09A 2CBIA 4CCCA 2BNJA 1FH7A 2WVUA 3TTSA 4F79A 5BCAA 1QW8A 1SMAA 1JDAA 1XD0A 2OSWA 3SCVA 2VZSA 1V6UA 2WCSA 3AIWA 3U5YA 2VZVA 3CHEA 4DWSB 2WNWA 1WDQA 4HOWA 4V2XA 3GNPA 1CZ1A 1VF8A 1EIBA 2CNCA 1OSEA 5FL1A 4BA0A 1J0YA 3AS1A 3N04A 1V6WA 1QNQA 5DFAA 5A6LA 2BY3A 1JDDA 2DDXA 2GDVA 4RE4A 3WKZA 1FH8A 1BYBA 2V38A 4PTWA 3WL1A 4PUEA 1H09A 5A2AA 1CLXA 2CPUA 5ABFB 3DHUA 2XFRA 1BTCA 4J3XA 1KQZA 3WNLA 2JALA 1C93A 2VL4A 4P8XA 3RCNA 2YA0A 2A3HA 1QNRA 2W62A 4N42A 3WDPP 5DT7A 1ZBKA 4GQQA 1V02E 4JFVA 4V28A 2YDSA 3EDFA 2VURA 3OZOA 1JG9A 3ARTA 1K9EA 3AMKA 1QI5A 2AAAA 1H11A 3CZJA 1MQQA 3VGGA 4AD3A 3RIKA 3MU7A 3BMWA 2WMIB 3BAWA 2ZX8A 1UR9A 2J75A 1KGUA 4X0NA 3RILA 3CZGA 5CSYA 2J25A 1Q6EA 2VUYA 1Q6CA 2WMHA 3PZNA 1EHNA 4EK7A 4PEEA 5E0FA 3MV11 2PB1A 1G94A 1KBKA 2YKKA 2PWEA 4CD6A 2BY2A 4P7LA 3AHZA 1H0GA 5FD0A 1LWJA 1C92A 4UR9A 1H41A 3KE0A 3PZIA 2J8FA 3NSXA 1ZU8A 3S2CA 1BGAA 3NYDA 3FW6A 2X2YA 1E4LA 5D4YA 4AD1A 1V0KA 3M6DA 4GINA 2J4GA 3HU7A 1V03A 1FOBA 1VFUA 4GZJA 1ISWA 3NSMA 3RM4A 1JAKA 4OKDA 1KGXA 3A3HA 3EDJA 1BFNA 1E0XA 5A6SA 3WD1A 1UWRA 5A6AA 3BSHA 2F2HA 4PMRA 2J7CA 2XSAA 3TP4A 1W3HA 4CD8A 4MJ2A 4RL3A 1MW1A 3WMCA 1HKIA 4JKMA 4TTGA 3GTNA 2DT1A 4WKHA 5AC4A 3VIMA 4K68A 1EDTA 3RJXA 3A47A 3U5UA 3WQVA 3QOKA 3F5JA 1NP0A 1HF6A 1QHZA 1EXPA 4XZBA 2FGLA 2WVVB 4AZHA 3UEQA 1FA2A 1QW9A 1OGBA 1H49A 2ZOXA 1XSJA 2DQXA 4V27A 2OLHA 3W25A 3VU2A 1GQIA 4QFUA 1CPUA 3CH9A 4J3SA 3JUGA 3SCUA 2VCAA 3N12A 1JIBA 5CXPA 1MQRA 1Q6FA 3IJ7A 3RJYA 1GZJA 1B3VA 4PMUA 4UOZA 2AMGA 4CD5A 1JD7A 1UR2A 3WNKA 1OB0A 5E70A 2XUCA 5HPOA 1UHVA 1C7SA 1KBBA 1TA3B 3SCTA 1VAHA 1JXJA 3IK2A 4HU8A 5F7UA 4NZCA 4A3HA 3W24A 1UA7A 5LA2A 4HPGA 5GNYA 3WUEA 5CJ5A 2WZEA 2WHMA 1K9DA 2MANA 2CBVA 4GXPA 3WD3A 1E1EA 4PSPA 2WMFA 2OWWA 3VMNA 4D1IA 4HMDA 1C3FA 3SCRA 2UY2A 3U57A 3ARUA 1LL7A 4GO9A 5I79A 4DWSC 1VJSA 4B3LA 3GH5A 2X0HA 3II1A 1WPCA 3ZOAA 3GXFA 5A6KA 1ISZA 1CYGA 4M56A 2RGMA 2WMJA 2AOSA 4D6FA 7TAAA 1KR1A 4H2CA 2XJ7A 5EMYA 1TVNA 3ARXA 5E09A 5HPCA 5E6YA 1UKQA 3N13A 4PYSA 1DWFM 3K46A 3WH6A 1V3IA 2EPOA 1ZL1A 2VRJA 2BVYA 2WKGA 4CGTA 3SIMA 4JIEA 3CZKA 3BAYA 1UA3A 4OUEA 1UUQA 3B9EA 1PAMA 2F8QA 1VFFA 2BV9A 1GOQA 3WNNA 1HL9A 3UG3A 4NRRA 3WQ4A 4D72A 2BY0A 3MANA 3VD4A 1FH9A 1UD8A 1PX3A 1E5NA 1CXEA 1RP9A 1E6ZA 3SUTA 1GORA 1GHRA 1CNVA 4BS0A 3T0DA 1EQCA 1JZ3A 1H4PA 1SMDA 2J7DA 2VX6A 3MUZ1 3WBEA 3QHOA 2WK2A 3FHQA 1XYZA 1V6YA 1ISYA 1C7TA 2WZHA 5A69A 1W3JA 2ZUVA 4GO8A 3ZT7A 4W7WA 4FLQA 1GPFA 4D6GA 3K4AA 2ZX5A 1IZKA 2WWDA 2J74A 2YBUA 2G3JA 3VIIA 3ARSA 3AHTA 3VD3A 4W87A 4IISA 1UKOA 2XVKA 5A2CA 1CBGA 1PX8A 1YHTA 3CIVA 3ZSTA 3HN3A 2CERA 4PMDA 4CCEA 1KQYA 2QHAA 3WL0A 1H3GA 1BYDA 4MB4A 3ARZA 3QGVA 1NP2A 4AD0A 4UQBA 2WYSA 2JIWA 2VX5A 1UZ4A 2ZX7A 2BVTA 3K8MA 3THDA 3MSDA 2X8RA 5A6JA 2O9RA 3LPPA 1GJWA 4AD2A 5CQ1A 2O9OA 4UFMA 4X9YA 5CLTA 3MMWA 1NWSA 3K8LA 4TVUA 1ISVA 3CHFA 4W85A 3ZJ8A 2ZE0A 5A95A 2B31A 3LPOA 4HA3A 1JD9A 4W5UA 3VGFA 6A3HA 3CZEA 2XVPA 3N18A 1UKTA 4ACZB 4AY1A 3DHPA 2FH6A 5IHSA 2E8YA 4H7VA 2GK1A 4CN4A 3T2PA 2WC4A 3W81A 2IUZA 3SUSA 3BSGA 4GI9A 4PMVA 3ZJKA 1SR0A 3RDKA 1BAGA 2J7FA 1ZJBA 3AIBA 3AMLA 5A8QA 1KXTA 4W89A 3RM9A 2XSBA 3QR3A 4KRTA 3BGAA 2CESA 2VVNA 3OGSA 1LQ0A 4MPKA 4N0RA 4KWUA 2DSWA 2CKSA 1E4MM 1MW3A 3HJEA 5CG0A 2EQDA 5CPTA 2VQUA 4CU8A 2VZUA 4DUVA 1O6IA 2GUYA 4CN6A 2ZXQA 1D7FA 1E0VA 2WHKA 2V5CA 2WHJA 5CPSA 4Z2GA 3CUFA 1D2KA 1DTUA 3L4UA 4AZIA 2XGIA 4TUFA 3IAQA 1W9DM 1BVZA 1NQ6A 1B1YA 1E6XM 1H5VA 3TOPA 1R7AA 5HXMA 3SEPA 1WAWA 3GXDA 5HOSA 5M3WA 4U5KA 1UR8A 2IXVA 1Q6DA 4YN5A 3F5KA 1BHGA 2DSUA 1PIGA 4LX4A 3UERA 1EQPA 4WLCA 1V02A 3VDAA 4C7DA 1C91A 3VMOA 1EDGA 2FHBA 4QLJA 4TVDA 4UQDA 1CDGA 1UR1A 3WF1A 4GKLA 4BCEA 2VJXA 4U5IA 1QI4A 3OGVA 4F8XA 2Y2WA 4AWEA 1JZ6A 1B3WA 2WHLA 4F66A 4M8UA 2YA2A 4WIWA 2VVSA 4LGXA 3CBWA 1B3ZA 2CCRA 1KCLA 2V3DA 2DT0A 3W26A 4WSJA 3WF4A 1GJUA 4D1JA 2Z1KA 4EKJA 1XYFA 4WKFA 2WZIA 4CU6A 2F61A 3VIKA 2D0FA 1OM0A 4BZYA 1R8LA 2A3AA 4XV0A 1TMQA 4QCEA 2D2OA 3WD4A 3AS0A 5HNNA 4IPLA 1Q6GA 2WKLA 6CGTA 1MVYA 5D8WA 2FGZA 1DHKA 2W63A 3VM7A 3CUIA 3BAJA 2CHNA 1JDCA 3ZJ6A 1GQJA 4AZCA 4DUWA 5BXSA 1KCKA 1AMYA 3AS3A 3AMGA 1UH2A 3NIYA 3FAWA 1UD5A 4L4OA 5I5RA 5IFTA 5A6MA 4CKQA 2ZUNA 4D71A 4U3AA 3GM8A 2ZXBA 4FF5A 1K9FA 1XC6A 2XFYA 4TOQA 4UQEA 2CETA 2BVDA 1E56A 3AFBA 2PC8A 5DT5A 1QHPA 1UD2A 2JF6A 1OGGA 3OGRA 4OOUA 4YHGA 4IUGA 2J7GA 4FLRA 2VX4A 1J0JA 2YDQA 1G0CA 1ZS2A 2VOTA 1UH3A 5M03A 4AEEA 7A3HA 5BXTA 3WIJA 2JEPA 1V6VA 3F4VA 3N15A 3CLWA 3ZM8A 3EMCA 4PMNA 1D3CA 5BXRA 4OZOA 3W28A 3AMDA 3WDJA 2CITA 1QHOA 2WLYA 1JI2A 1GOMA 1C8XA 2OWCA 2E8ZA 1E9LA 4UQAA 4LQ1A 1LWHA 5AYBA 2E9LA 1EHAA 1CGYA 1UQZA 4YPJA 4RE2A 3PZQA 1JF5A 8A3HA 1B3YA 1CGVA 1QBAA 4GI8A 1JI1A 1NOWA 1UD6A 1OIFA 4WK9A 3WELA 2WANA 1US3A 1WZKA 2J47A 1HJVA 3UETA 1GONA 1NARA 1X6LA 3KL5A 5GNXA 1OCQA 5LYRA 2DIJA 1XSIA 3ZR6A 2JIEA 1HT6A 4FK9A 2XWEA 4D6HA 4OBSA 3L2LA 1TE1A 2DEPA 3BAKA 3VGBA 1GOOA 2EPNA 4ML4A 4AW7A 2CEQA 1DP0A 3MUY1 1JFHA 3AJ7A 4OOZA 3MS8A 2NT0A 5ABGA 3W38A 3VIPA 1CEOA 3WQ6A 3RPMA 1GQKA 1W9VA 2A3EA 3SCOA 5I23A 1HJXA 2VO5A 4P8UA 4UFHA 4MB3A 5ECUA 1VBRA 1DWAM 5KZ6A 4MB1A 2DIEA 5BRQA 1K6AA 3WMSA 1G01A 3CMGA 2DPEA 1CENA 5CZKA 1LLOA 1SFSA 1JZ2A 5A6BD 2VR5A 2UY5A 1E6NA 4UFLA 1DWJM 3AZRA 3DYMA 5A2BA 2V3EA 4JFTA 2BHZA 3FAXA 3MKKA 2GJXB 1WKYA 1GVYA 1PX4A 3EDKA 3WENA 1J0IA 2VTFA 1I1XA 1SYTA 3VUPA 2CBUA 1JZ7A 3L4ZA 3TTYA 4TXEA 4J3VA 1MQPA 4ZENA 1RD6A 3VD5A 1K9TA 2CKRA 3VINA 1M01A 1UD4A 3KZSA 1NWUA 2G3NA 4HZ6A 4MNMA 4P8VA 4P7QA 1HL8A 3VNZA 1E4NA 3GYCA 3T0BA 5I2UA 3MMUA 4HA1A 4BQ3A 4JFSA 1E3XA 3T08A 3WQWA 4PTXA 1A47A 2ZX6A 2UWFA 3CGTA 8CGTA 4JCMA 4HA4A 2WCGA 2Q8XA 4W5ZA 1Z32X 1C90A 3NCOA 3FNDA 1CXLA 4C7GA 1GNXA 1OT1A 2WCAA 2FHFA 3NUKA 3SCQA 5IHRA 3LMYA 1E5JA 3WD2A 1HXJA 3OG2A 3RM8A 1VJZA 5C70A 5D9OA 3ARVA 1G5AA 4W84A 3WFZA 4H41A 1F4AA 1L0PA 1LJYA 4M29A 1OINA 3WNPA 2PWDA 3J7HA 5E6ZA 3WEOA 1EOMA 4MAVA 2W66A 1EO5A 4ZEPA 4QLLA 3SUWA 3IANA 3UR7A 2WMGA 5HDRA 4AEFA 4CCDA 2YL6A 3VGHA 3BH4A 2EPMX 1JYNA 2J7EA 3KEHA 3VIOA 1E1FA 1C8QA 1XD1A 3N1AA 3BLKA 3OLIA 4CU7A 2RGLA 3D3AA 2VMFA 2GDUA 3PTMA 4HOXA 1HVXA 2XWDA 3B9DA 3K8KA 1JAEA 3WQ8A 1V6XA 1W32A 1XCXA 1MYRA 3O9NA 2ZWYA 3GBDA 2WMKA 6TAAA 1XCWA 2XGBA 5AYIA 4DWSA 1QOXA 1J01A 4UNIA 1W1TA 4UFKA 1E6SM 3VKKA 3VD9A 5DMYA 3EDEA 4M1RA 2XVGA 3AI0A 2G8ZA 4W86A 4DM2A 1WB0A 5IFPA 1TVPA 4PRWA 3AYRA 4FMVA 5ABFA 3A4XA 3B8SA 3OZPA 1QVBA 1AQHA 1UZ1A 1I1WA 3L4WA 3VOCA 4HMEA 3WMBA 3ALFA 1VB9A 4WJXA 1Y7VA 3E1F1 4DUXA 4NSBA 4PCTA 3WEZA 3L2MA 3SCNA 5A1AA 2D3NA 4B3KA 2X0YA 1JNEA 1HP4A 2YOCA 3FY1A 2CYGA 3DYPA 1EO7A 4L4PA 5I77A 4H8UA 3VO0A 4LYRA 2D0GA 2OSXA 2W67A 1ODUA 3AIUA 2EXOA 2WMIA 4QAWA 1WCGA 1JYXA 4EAMA 1UOKA 3ZIZA 4ZE5A 1LG1A 2EPLX 1NOFA 3AZSA 3K1DA 4HU0A 2VCCA 3CZLA 4QLKA 1JYVA 2VNCA 1NOUA 2VC9A 3WDIA 4D6DA 2FHCA 3K4DA 1BVNP 2V3GA 4HMCA 4PTVA 3RO8A 1W3LA 2HVMA 4GQRA 3VD7A 4TVCA 3PZ9A 3CTTA 1MXGA 1KXQA 3EYPA 3CUHA 3DC0A 4UZUA 3PBGA 1ITCA 2UY3A 3W0KA 3LPGA 4QP0A 1JF6A 1HJWA 1XH2A 2YJQA 1HJUA 3VM5A 5CPQA 2FH8A 1VENA 3AIVA 5A8NA 1UWUA 4JL2A 1CGXA 1AVAA 2BHYA 2VZTA 3ZQ9A 1B0IA 2W5FA 4B15A 3VILA 5FIPA 3W27A 3CUGA 4P7RA 5CSUA 3W6LA 1ZBWA 3MO4A 3CO4A 3WDQA 5FL0A 3HMCA 5HBFA 4BF7A 2QV4A 1J9YA 3MV01 1O7AA 4M24A 3TONA 1XV8A 5IXEA 4PCSA 3BCDA 1MW2A 1OBAA 1TUXA 1CXKA 5D9NA 1GQLA 2VQTA 3PN8A 2J7HA 4J3TA 3CHCA 1CTNA 1HKJA 3NDYA 4B16A 2GJXA 2WVVA 5I0DA 3EMZA 3WQ5A 2E3ZA 1ZB5A 1V3KA 3A4AA 3OIHA 5JBEA 3ZMRA 1WZAA 5ABEA 3WNMA 4MNKA 3VNYA 1CLVA 4AIOA 2C7FA 1TCMA 4HTYA 4ATDA 7CGTA 3TTQA 4MDOA 3ZSSA 4HP5A 2WBGA 4Z2IA 4W7UA 4UOQA 1IT0A 1CECA 1VFOA 5JIPA 3AXXA 3WH8A 1H2JA 2WSPA 1ZJAA 1Q4NX 1UR4A 4Z2JA 4HZ7A 4E4PA 1TA3A 5AY7A 4IM4A 1HJQA 1NWRA 3PZTA 1KXVA 4H8HA 3AHXA 1W2PA 5I3DA 3POCA 1GOWA 2TAAA 4PMQA 4PMOA 1AQMA 2E0PA 2QF8A 5C8BB 5FKYA 1CXHA 4CD7A 4LYQA 1B9ZA 3ARPA 1E6QM 1GOKA 3KL3A 1J10A 3W29A 3ECQA 3VGDA 1FHLA 5DF0A 1RH9A 1BYCA 1WDPA 5DO8A 3I3DA 3IAPA 4AZGA 1E55A 1FP9A 1V3HA 4U2YA 3ZJ7A 2XIIA 3G6LA 3AYSA 4JAWA 3NJ3A 3GXIA 1PIFA 4E8CA 4HOZA 4A4AA 4EANA 1UWQA 2IXUA 4M82A 2BXZA 4WKAA 5BWFA 4FLSA 5C71A 1W1YA 2PBOA 1H0IA 2XTKA 3IJ8A 4ACYA 4R27A 5TD4A 1PJ9A 1E6RA 1WP6A 1UKSA 3AZTA 3FN9A 4AZ6A 4MNLA 3L4TA 3VDCA 3CHDA 3F5LA 1DWHM 4ZE4A 3QHMA 4LPCA 1JFXA 5AC5A 2Y5EA 4MAZA 3M7SA 4PMZA 1TFVA 4GI6A 2OYKA 1E3ZA 2DGAA 1M03A 4CN1A
chains in the Genus database with same CATH superfamily
2FZBA 3KRSA 4JHMA 5FEXA 4O1DA 1JNDA 3MVTA 3NQEA 2ZE3A 4R9XA 4DM1A 2VR4A 4CQ8A 1LF1A 5CPNA 1NH6A 1TJ0A 1FCVA 3VOHA 4WQ6A 3DDMA 3QZAA 3LCFA 6XIAA 5DMMA 5D9MA 1R2TA 1HN1A 2Z1SA 4OIFA 3BLLA 5B7YA 5D8ZA 1M53A 1JCMP 3GLCA 3VIHA 3UXIA 2Z1BA 3S4TA 2INZA 4DUOA 3O07A 1HNYA 3B0PA 1LUCA 5LNWA 2HV5A 1V77A 5KINA 3MI2A 4ZO9A 2O9PA 2WM0A 4EIVA 1LG2A 3WLSA 2EG7A 1VQTA 4XUYA 1F07A 1OQFA 3U3HA 1ZJIA 1Y8BA 1PBGA 4GCXA 1EX5A 4O0ZA 3U2EA 3LOTA 5JBFA 1I75A 4B4FA 1XIIA 2HE5A 3KM8A 2D1ZA 4GLEA 2GLKA 1W9PA 3SUUA 3WUBA 3EWXA 3RR1A 2QIWA 3MMDA 3TCSA 3VYLA 3KVLA 5TAOA 3EOEA 3BURA 2BASA 2PD5A 1FFRA 3BOFA 4ERGA 3TTOA 4F0RA 1WXYA 3L12A 3MJYA 1EEPA 4XTIA 4Q7NA 3G1VA 4Y7EA 3P2VA 3U7BA 4PB4A 4Q4KA 2PRHA 3NDZA 4JTEA 4OU1A 3LENA 1FHUA 3FV9A 1BGGA 3GH4A 4IPJA 1EPVA 3VE9A 3RFAA 3THQA 1US0A 1TTPA 3DG6A 3MQTA 4NZ1A 4JHZA 3L4XA 1V3JA 2IMRA 1REQB 4J28A 1W1VA 3FA3A 2GVGA 2J9XA 4PODA 5CLWA 3ZT6A 4P8WA 4E2VA 4PULA 3WFLA 4O0QA 1VRXA 4OQVA 1V93A 1QI3A 2V68A 1KFBA 4K37A 4DZAA 3VZXA 1QO5A 3RLVA 4AWTA 3KFTA 1QBBA 4LCRA 4Q4QA 4LVAA 1D3GA 3AOFA 3IVSA 3NEVA 2XYLA 3OLEA 3CYVA 1R3TA 5CZSA 3KXQA 3N2TA 1OG6A 3SO7A 2XVNA 2PDMA 4U3CA 2DSKA 2RUSA 2CW6A 3SGZA 1J11A 2GVYA 1KWKA 2WVTA 5LNSA 1JUKA 3SRKA 3G6MA 3M0YA 1LRQA 2JFEX 1V0LA 3VPLA 2D3LA 2QPUA 2VEFA 4AWUA 4QE1A 4M80A 4W8LA 3EX1A 4AD5A 3CAWA 4IJRA 4HCDA 4PTMA 4MF4A 5DELA 5GQBA 3ARWA 4EX4A 2QVNA 3W86A 3EMQA 4BQ5A 3FA4A 1MEHA 4Q8QA 4MFDA 4FF7A 3TR9A 4B9YA 3S2NA 1GKQA 2MNRA 3GNOA 2QPSA 1GVOA 5EU9A 1VGAA 4J3UA 3TEVA 2Y8VA 4E38A 1DE5A 1KB3A 4O57A 1E70M 2DV0A 2PGRA 3KLLA 1VYRA 1XRVA 2BXYA 3KBWA 4Q8MA 1F4HA 2ZBTA 1A5SA 1KBIA 3GW3A 3UG4A 3BTNA 4KESA 5TQLA 2J6VA 3NWRA 4BF9A 2R1NA 3MUCA 1SGJA 3GNXA 1HUVA 1TPB1 2W61A 4KCVA 3UZXA 3AU6A 3VTRA 2DUZA 3MHFA 4DI8A 3PNZA 3R10A 1LL6A 4C6KA 1FWBC 3LS9A 1OWQA 4MJZA 3TJ4A 4G9PA 3B9AA 2D20A 3HTWA 1L2QA 1NWTA 1WUEA 1K1DA 3IIPA 2DH2A 1LRTA 3GZAA 3UVIA 4GYPA 3IGUA 4DEFA 2X16A 2E25A 3IJ9A 4NHVA 1D7KA 3QTGA 4X63A 2TRSA 3P0XA 4KRUA 4C91A 1F61A 5AB3A 2NW0A 1JZ5A 1EGZA 2UY4A 1ZCOA 4B5XA 1DWGM 4CVWA 3IEBA 1VEOA 3BLFA 4GRSA 2R8WA 3KVKA 5DBTA 4HHMA 3BV7A 3FGCA 4XB3A 4XZLX 2HNHA 5A8OA 1UG6A 5AVNA 1IV8A 3M46A 3ABXA 1XI3A 1EH9A 3P14A 5DCBA 5CGTA 3PZUA 1BSIA 3UWUA 4L9XA 1XLGA 4HCHA 4JYEA 2O7QA 1R87A 5A5WA 4HA0A 4O11A 3TYCA 1ZPTA 4JIRA 4X2RA 1CGUA 2FGBA 4S3BA 4LEFA 1TJRA 3HQPA 4Q4MA 4AYSA 2C0HA 4YXGA 5JIWA 1AW5A 3CXOA 4R85A 5HJXA 3ONBA 3UZZA 4F2UA 1S46A 4ZFMA 3E49A 1V0MA 3HPFA 3QYSA 2CWNA 2V5DA 2PF0A 1CXFA 3GFXA 1NAL1 3QH2A 1FVPA 1JUEA 1QI0A 1R46A 3E2SA 4Z2KA 1FHVA 3HPZA 1EWDA 4IQEA 1ALDA 4WOQA 3PZGA 3QOMA 4GD0A 4MADA 1AQ0A 3AICA 4RV8A 4E8DA 4JKLA 4DJDD 2ZZ3A 3RLGA 4NZFA 5D9PA 1VBUA 3R0UA 1E6PA 3MPGA 4CD4A 1WXJA 3G0SA 4DYEA 2XH0A 2ONEA 4MYAA 4JFWA 2Y4SA 2FFIA 3TNBA 2D0HA 1UMYA 2RFGA 1S5WA 3B97A 1DEDA 3UXAA 4DY1A 4GXMA 2HK0A 2LLEA 3NVTA 6TIMA 2FZNA 4KFNA 4E2DA 1UD3A 4S3JA 1ZBCA 3LBMA 3QN3A 5F4WA 3L0KA 1UC5A 4JIPA 5J04A 4UFJA 2EPKX 1E15A 3U7VA 4W93A 2Y62A 4ALDA 4Y6GA 1J4EA 3DU0A 1E72M 3PBYA 4J2MA 5I78A 2OTDA 3W53A 3GTHA 2JQXA 4XZ9A 1MFVA 3N4AA 3W4RA 1JEZA 1XGZA 4LS1A 1NDWA 4AZBA 1Y0EA 3EX6A 1MO0A 1GW1A 3T7VA 2QF7A 1V3MA 4CUCA 1JGIA 1JPMA 4WY0B 1ZAJA 1GK8A 1L6SA 3VKBA 1QPKA 3HZ3A 4JICA 3HQ1A 3FOKA 3M5ZA 3AIEA 3VZYA 3S6TA 4XSMA 4LVDA 2VWTA 5C7VA 3CB3A 1QAPA 2ZUSA 4HKPA 3UFYA 2ZXDA 4ZXOA 4Q4PA 4J35A 4WJ8A 5HNRA 3AMCA 5DEZA 3IVTA 4K36A 3LLDA 4G7EA 5FJIA 2WW5A 3MHUA 2O92A 3NQMA 3A9IA 1I0DA 4RR4A 3H2NA 1A0DA 1G1YA 4W4QA 4M81A 3VIFA 2WXDM 1OCNA 3W87A 3C2EA 1WYIA 3LHVA 1ONWA 3WQEA 4CCCA 2H3DA 3TTSA 2QUNA 1P48A 3U4AA 1A53A 4RZ5A 4F0MA 1W5MA 4K7YA 3W73A 1SMAA 5BU9A 1ZAIA 3GVGA 4R7WA 3EA1A 2WCSA 4NNCA 2FIQA 1F2JA 2VZVA 4R33A 1WKDA 3ELFA 1UUOA 1WDQA 4HOWA 1VFSA 1OSEA 5FL1A 3GFZA 3AS1A 3BOXA 1WBHA 1V6WA 4NAEB 3BCJA 1AW2A 5DFAA 2DDXA 3TQ0A 1FH8A 2CZVA 4PUEA 1VYSX 1PKLA 5ABFB 3DHUA 4REQA 4MKNA 3K30A 4C6QA 2XFRA 3QF0A 4NVTA 1KQZA 5EA9A 2JALA 2Y70A 3AWOA 3RCNA 2OU4A 3FYOA 5C6MA 4Y8FA 3DESA 2J66A 3G5EA 4N42A 5DT7A 4GQQA 3C0QA 2VWSA 4JFVA 3EDFA 3QFEA 2VURA 4DJED 3CWHA 2R94A 4LUSA 2HJPA 3AMKA 3ARTA 5EMMA 1Q2SA 3TK7A 4A8RA 1LBMA 4XZHA 4EVZA 1YPFA 5DBUA 5D2YA 3RIKA 3MU7A 3BAWA 4IHCA 1FCBA 3CZGA 1A5AA 1Q6EA 3EAUA 1Q6CA 1VC4A 1R2RA 1K7XA 3VKCA 2E5BA 4TX9A 5DQPA 2PB1A 1FWDC 3GR7A 1DHPA 1VBGA 3AHZA 5FD0A 3UXKA 1LWJA 1TELA 4UR9A 1T8QA 1XFBA 5AZ1A 2J8FA 5D02A 4I3GA 1K3UA 3CQJA 2GWGA 3TUUA 1H62A 1JR1A 2X2YA 3FW6A 3GR8A 3PPGA 5D4YA 4DBEA 3L5AA 4C5YA 3CPGA 1V03A 4FNUA 4GZJA 4XIAA 2ACSA 4H1ZA 3WQGA 1ISWA 3RM4A 1KGXA 1E0XA 4DYJA 4ZB0A 2P8BA 2RDUA 5A6SA 3AYTA 1SJDA 4PMRA 1OZQA 5G4EA 4PUKA 1W3HA 4CD8A 1MW1A 3WMCA 3GKAA 4WKHA 1VPYA 4K68A 3U5UA 3A47A 1R3SA 3WQVA 3RX2A 2V5JA 2OCZA 1XIGA 4AZHA 3NG3A 4IMGA 1S5MA 3IK4A 1FA2A 1QW9A 5C0QA 1TKKA 2VGBA 2HK1A 2ZOXA 1XSJA 4V27A 3CEPA 1H51A 3S1VA 5CEWA 1JVNA 1GQIA 4QFUA 4J3SA 5C2CA 2A7RA 2X41A 3PBWA 3JUGA 4C6IA 1AQFA 3VFLA 3NL2A 1RQEA 3C2FA 1H1YA 1ADOA 3IJ7A 2FPTA 2OJPA 1EA0A 2D2JA 3T9PA 4CD5A 4JTJA 3EWBX 1OB0A 5HPOA 5DLCA 4C6MA 2FTPA 1KM1A 4HNOA 2X1SA 2J8TA 2PTYA 3HV9A 1QOQA 3KRUA 4GKTA 4RDZA 3KCOA 4EACA 2Z7GA 5KSWA 4LC8A 5CJ5A 3R1ZA 4PTNA 3W71A 4PSPA 2J27A 2WMFA 4Y9AA 1QFEA 1NSJA 2OT0A 2OWWA 4AHOA 4ZBCA 3QGAC 3DHFA 5E1QA 4DRSA 5AHNA 3W3OA 5I79A 2OKTA 1P1XA 1JCJA 2Z1VA 3GG1A 4NYUA 3BJSA 2PU1A 2P53A 2RGMA 2Y61A 7TAAA 4ROQA 3E0LA 2R14A 3LDVA 5KMYA 3WO8A 5E09A 5HPCA 5E6YA 1I0BA 4B5TA 1S3HA 1FWTA 2IPWA 3S9IA 3N34A 2EPOA 4QE5A 4CGTA 4OUEA 4O52A 3W1RA 3UNTA 1GG0A 1JQVA 3Q65A 3WNNA 1HL9A 2OX1A 4JDBA 2NX9A 3HJZA 2I1OA 3WQ4A 1FH9A 4KWWA 3SSZA 3IS4A 4E2BA 1CXEA 1KTCA 4CEXC 4BS0A 1MMFA 1EQCA 1MNZA 5JMUA 4GABA 4UTTA 2G5WA 1F8MA 1SMDA 2QDGA 3ZWSA 1XYZA 1ISYA 3GD6A 1W3JA 3I6TA 3LHUA 4XAFA 3ZT7A 4HSNA 2Y5JA 4FLQA 2DW6A 2QAFA 3K4AA 4DO7A 1U1UA 3NR0A 4QE4A 3G1SA 3GE7A 4FX7A 3S2JA 3ARSA 3W2NA 1YNPA 1T0OA 1LUCB 1QUMA 2BODX 4OT7A 1FXPA 4AHQA 1YHTA 4CQCA 2NV2A 3CIVA 1QO2A 3HN3A 3N9SA 4PMDA 1SSGA 4CCEA 5I07A 2EJAA 1BYDA 5D33A 1TJ1A 3M9YA 4S2BA 5BMWA 3S5OA 1NU5A 3STGA 4PR4A 2BVTA 3O0KA 3KS5A 2O9RA 1GJWA 2FTWA 2Y7DA 5CQ1A 1JCYA 2O9OA 5D03A 1NWSA 4TVUA 3TR2A 4IMFA 4ES4A 3TN4A 1ISVA 4IXHA 2F7FA 2QKFA 4DZHA 2ZE0A 5A95A 3N25A 5I3FA 2QCNA 1JCXA 2AQVA 1UKTA 3UCDA 3DHPA 2GK1A 4CN4A 2IUZA 1LROA 3ABRA 1KFLA 5F2GA 2QNEA 1I4NA 4QSFA 3V7PA 4GI9A 2FKPA 2A5HA 1BAGA 4NKCA 1ZJBA 3ZVIA 1V5XA 3EEGA 4W89A 3QR3A 1DJXA 3BGAA 5EMUA 2VVNA 2OZ3A 4D8ZA 4N0RA 2HSAA 3TW9A 4E3VA 4V33A 1E4MM 1MW3A 3HJEA 2NQZA 3TKFA 3QSRA 4QR6A 3W1NA 2PCEA 2ZXQA 3B8DA 4KT2A 1TQXA 2NX1A 2WHKA 3LUTA 5CPSA 1D2KA 2XGIA 4FX8A 3IAQA 2PDWA 1W9DM 1NQ6A 4O16A 4M1BA 1LT7A 2PDQA 5I3IA 3TOPA 1I2OA 1R7AA 4HGXA 3L21A 5LNVA 2H8XA 3GXDA 4U5KA 3R8RA 1UR8A 2BP1A 4YN5A 2DSUA 1PIGA 4LAMA 4LX4A 3UERA 4RUBA 1GGOA 2PTXA 1R3WA 2FHBA 4TVDA 1KKRA 3LXBA 1UR1A 3BICA 4UR8A 1KBJA 3IUHA 4U5IA 3V3WA 3OGVA 4AWEA 2WHLA 4F66A 2ODOA 4M8UA 3QMRA 2YA2A 3M7WA 1ADDA 4LGXA 3TXZA 1XQKA 2HCVA 1DJYA 1KCLA 1ZQ5A 2V3DA 4IL0A 5AHIA 4IP7A 1SO3A 3G1YA 2WZIA 2F61A 3VIKA 1ICPA 1FWCC 3G8RA 4HYVA 4IPLA 4HD5A 2WKLA 6CGTA 2DJLA 4LAKA 2YB1A 2Z24A 3PTDA 3CUIA 4K6AA 2CHNA 4A22A 2SFPA 3RAOA 3ZJ6A 1TJ2A 2OKOA 1GQJA 4AB4A 4HSHA 1GVRA 4GACA 2HBXA 2PDLA 1R3QA 3WQOA 1SQ7A 5C55A 1UH2A 3NIYA 4IIGA 2P0IA 2KZHA 3SRDA 1O5XA 2DFAA 3TH6A 4GFSA 4FF5A 1K9FA 2XFYA 1OFEA 2PLJA 5LNRA 4QITA 3M6YA 2PC8A 2GYIA 5DT5A 1UD2A 4H7CA 3WYZA 3OGRA 4OOUA 1XIMA 4GK8A 2J7GA 1J0JA 1XLLA 1UH3A 3T4CA 5M03A 3RUBL 7A3HA 5BXTA 3QC3A 1V6VA 3F4VA 1XINA 3O6CA 1GTEA 3EA2A 4OZOA 3W28A 2PU0A 3IVUA 4K1GA 3AMDA 3C8FA 1JI2A 2OZ0A 1GOMA 1PO9A 4QS6A 2E8ZA 2GSHA 1VKFA 1UASA 1RJPA 1SW0A 1LWHA 3VNJA 4DELA 1LP6A 4XAGA 2E9LA 1PHQA 3CPRA 3BG9A 4RE2A 1XIDA 1CGVA 2A6LA 2Y63A 3UPMA 1OIFA 4WK9A 3WELA 3K2GA 1FWAC 1YDYA 1US3A 4K39A 3FGCB 3UETA 4KQNA 3BL3A 3KTXA 4B5NA 4IQDA 2JIEA 4FK9A 3MJMA 3UCCA 4JBRA 2KX9A 3VGBA 1F76A 4JTLA 1V7YA 1TZ9A 1JFHA 4DNMA 3MS8A 2OQLA 4MWAC 4IJCA 2IQTA 2V5LA 3DEQA 4G2DA 2BG5A 4UFHA 5FSDC 4MB3A 1VBRA 1AL8A 1YEYA 4MB1A 2BGNE 1V8EA 5HR7A 3C0JA 4DLMA 3ABSA 4IP4A 4XAYA 2DPEA 2BDQA 3BK0A 1LLOA 1JZ2A 5A6BD 2VR5A 4S23A 2ZA2A 4F0KA 3AZRA 3DYMA 1Q85A 1FRBA 3MKKA 2FZDA 4ZODA 3OW1A 3DX5A 2ZDRA 3WLTA 1PX4A 3EDKA 3WENA 4M6VA 3ZVHA 2CBUA 1JZ7A 4A2SA 3BWWA 3TTYA 4TXEA 1GVQA 5CSSA 4J3VA 1MQPA 3RO6A 4B5VA 4NI8A 1IF2A 5KTLA 3W7HA 4L64A 3VINA 5DXYA 1TQJA 2G3NA 4GGBA 1WUFA 3I65A 1E4NA 3URBA 5LXEA 5I2UA 4CEUC 3ANYA 4MSSA 1A50A 2ZQ0A 4LB3A 4ZQCA 4MKVA 1SO4A 1EJ7L 2PTZA 4O18A 4TV6A 2GGIA 5JQ9A 1C90A 1OYBA 4XKMA 1J2BA 2WCAA 4MLRA 2FHFA 3WD2A 1XC4A 3RM8A 1VJZA 1L6YA 5C70A 4E4FA 4W84A 4KEUA 3WFZA 1L0PA 5MF5A 1OINA 2WQDA 3J7HA 2Q6ZA 2CFFA 4JTAA 3W76A 4MAVA 5G1MA 1EO5A 4ZEPA 4QLLA 3C6CA 3QY7A 2D2HA 2V67A 3SUWA 3IANA 3UR7A 1NEYA 2ZYFA 5FEPA 4UNKA 5FF2A 4S3DA 1E1FA 1C8QA 3STCA 3VIOA 2YCKX 3OLIA 3BLKA 3ITVA 2PODA 3AXMA 4PUMA 2XIMA 3QKEA 3LGDA 1M7JA 4DVOA 1O94A 1JAEA 4XD4A 4Y96A 3UJ2A 5CC5A 3O9NA 4GYPC 4G7EB 1K8YA 1DOSA 1GEQA 4X22A 5AYIA 1TO3A 4JPGA 1KFJA 1GYNA 2G8ZA 5TF0A 2X0SA 3MBDA 2GL5A 4JEQA 4DM2A 1TVPA 4PRWA 2A6NA 2B7QA 2FB2A 3B8SA 3DN5A 4AYGA 4S3AA 3WMBA 2VEMA 3VNDA 2EHHA 2I9EA 4L6DA 3E1F1 1EKOA 1ZP3A 4NSBA 4D8AA 1XS2A 4FEZA 3V5FA 3L2MA 4PBFA 2D3NA 3LERA 2Q71A 2PDUA 1Q65A 5J8LA 4LVFA 1HP4A 2Q3OA 4R34A 2CYGA 4V15A 4L4PA 4LYRA 4JTFA 4QJ3B 2G4JA 5EGRA 5HA7A 2EXOA 4REQB 3KOZA 4CNOA 2GQ3A 3R94A 4EAMA 1UOKA 5T26A 1LG1A 5CGQA 1NOFA 1SZGA 1VBHA 3AZSA 3R5EA 2WOQA 4IIFA 3H70A 2VNCA 2Y88A 4WGHA 4D6DA 2FHCA 4HMCA 2PPGA 1YX1A 4GQRA 3GW0A 2YZRA 3M44A 4UZUA 5U7SA 1ITCA 2ISWA 2HS6A 4HIBA 3WLNA 1N8IA 1VENA 2FQIA 4INFA 4JL2A 4ZA0A 1EC7A 1AVAA 4LUIA 3VILA 5FIPA 3PB0A 3W27A 3CUXA 4C5ZA 1X6UA 4P7RA 1UPPA 2XZ9A 1F7BA 2DZTA 2NQ9A 3MO4A 4AVOA 7TIMA 3HMCA 1EJRC 2WPBA 1W6TA 4PC8A 1GT8A 1J9YA 1O7AA 4M24A 1IEWA 4PCSA 1MW2A 1CXKA 3B3DA 1GQLA 4JS3A 4WX2A 3A23A 2VQTA 1XRSA 4K2SA 3BLDA 3NDYA 1KC7A 2OQHA 4DWDA 4RXFA 5JBEA 7REQA 1T99A 2BOEX 3WNMA 2PF8A 5FJUA 1Z42A 4AIOA 4HTYA 2FTYA 5HMSA 3TTQA 4HP5A 4WGXA 2HPMA 2C15A 1VFOA 5F2LA 5D05A 1H2JA 4QJ5B 3R4IA 3N2BA 4Z2JA 1OF8A 4HZ7A 1JDFA 4E4PA 1GOXA 5AY7A 5T9CE 1FTXA 3V5CA 3QY8A 1Z69A 1M7PA 5BZAA 2IKHA 2TAAA 2XINA 2E0PA 5FKYA 1Z9AA 2NXIA 4LYQA 1F6YA 2TPSA 4OE7A 1A5CA 1J10A 3ECQA 3M0XA 2PDPA 3UWYA 1W3TA 3I3DA 2PTWA 3IAPA 4AZGA 1E55A 1V3HA 1XL9A 1Q7MA 3AYSA 4BI6A 1ZALA 3QV6A 4HT3A 4E8CA 5H1WA 4PL1A 1UWQA 2BXZA 2C16A 1L9WA 3C52A 2PTDA 4NT0A 3NPXA 4MZ8A 2QCGA 1PJ9A 3R8HA 4JXCA 1E6RA 1K70A 1WP6A 3AZTA 3FN9A 4MNLA 4L6OA 5EL1A 4ZE4A 2Y5EA 4MAZA 4PCPA 1BTMA 2QJNA 4XWUA 4PMZA 4GI6A 1PS9A 1ZUAX 2PGWA 4WD0A 4UCGA 1IWBA 3GG0A 1XSKA 2I5GA 4XKYB 4N6FA 3CLMA 4DO6A 1HIZA 4ATWA 4UTLA 1WE5A 4LCSA 3FJ6A 2WSKA 1XLJA 2C1HA 1F73A 3MWAA 4S3EA 1W37A 3PWGA 2YYUA 4WZHA 4D6IA 4JR5A 3P5ZA 3NOEA 5CGMA 1JPDX 5JXQA 1R7OA 4PRTA 4RZ4A 3SCWA 1JZ8A 3UW6A 3TAOA 3VIJA 3LG3A 2B81A 1TX0A 4I7WA 4Q7IA 4FSAA 3L4YA 1GCYA 1A5UA 2VZOA 2TMDA 4JIIX 1J6OA 1B3XA 3OQ8A 5CZTA 2H90A 3TYZA 3QHNA 4IIEA 2ZRXA 3WF2A 2DJXA 2PWHA 5K2ZA 5L6UA 4FIRA 5XINA 3VA8A 4KGJA 4XD5A 4C1NA 4K8HA 5BOFA 3DYOA 3L67A 4TX6A 1W1PA 1XXXA 2QGYA 4NASA 3A13A 3Q67A 5LGXA 1FY6A 5LA1A 3UR8A 5AKQA 2ZIDA 1X6NA 4UZSA 3RMEA 5K3VA 3EXTA 3RMJA 4OV9A 3ZLHA 4U2ZA 1Z6KA 1TSIA 5HINA 3WLIA 1BD0A 2O4MA 1IEXA 3W1PA 2VI0A 3EWDA 3W74A 1OFQA 4JCLA 3UPBA 4JNYA 1YDVA 4ACZA 4GNKB 5CBJA 2PE4A 3KL0A 4AEOA 2XVLA 5XIAA 1TWSA 4LVGA 2YGYA 1N82A 2ZZ2A 4LT9A 3N17A 1ONXA 1GUVA 1UP2A 1EB3A 1B3OA 3AS2A 3QLLA 3HFYA 3EXSA 3UG5A 1GVEA 1ODZA 2EPHA 3ZR4A 3A3WA 3TA9A 5C9UA 1IWAA 3USBA 2OEMA 3W9ZA 4FI4A 4NU7A 1GVIA 1OX6A 1X38A 4B3ZA 3ARYA 3DFNA 1JYWA 3V0UA 2DZPA 5C9WA 4J7RA 2YL5A 4WCJA 1AFSA 4PMJA 1CGWA 4FLOA 2GK1B 4LOCA 2WSRA 1FQ0A 3NQ2A 3OA5A 5I06A 1YIXA 4KRZA 3EKLA 2EO7A 2YXGA 2V81A 2Y8KA 2BHUA 1C9DA 4QNWA 1DJHA 2ZUWA 4H2HA 3ZT5A 1H1NA 3CAQA 4BQ2A 5AC6A 2QYGA 1G9HA 3T81A 5LSMA 3WFAA 4P61A 4QJ1A 3W02A 3E12A 2PP1A 3GHRA 1LBFA 9XIAA 4PZVA 3AXIA 2X1UA 4JQ3A 3CJPA 3ZXWA 1HKKA 2WWCA 1SJCA 1R5YA 4XIMA 2JF7A 4H8NA 3B8TA 2A79A 2YB4A 3VCRA 3P81A 4HNVA 5ENLA 2TODA 5JVLA 3T78A 4HPNA 3NQ7A 2O56A 4MY1A 2CBJA 1N8FA 3H12A 2CIPA 1IXNA 1UQYA 3DG3A 2W91A 1JPIA 5BXPA 3HGSA 3DG7A 2HISA 3P67A 2UV8G 2E6YA 3WSUA 1CW2A 3H6OA 2E67A 4UTFA 3T40A 4IG2A 1TR1A 4CNNA 3BXWA 5FF4A 4UTUA 3GDMA 4QTGA 3M0JA 1B2YA 3AHYA 3WUGA 1CXIA 2H3BA 2X09A 3S1XA 3HIJA 2EF9A 1GVFA 4EAYA 3T2QA 3GR4A 4NF7A 3STFA 2ZTJA 3ANVA 1Q63A 2WAGA 3WLJA 4UTTC 1QNPA 2JKPA 3WLPA 3LU2A 3TC7A 2ZUTA 1YNQA 2WSQA 4MTVA 3WK3A 1VEPA 4AF0A 1VIWA 4ADUA 5JUVA 1XRTA 3XISA 2QW5A 4U33A 3LEPA 4P5UA 3EWZA 3TFXA 3HFTA 4OGZA 1EPXA 3I3EA 4DWSD 2DZSA 3FS2A 4XZIA 1HX0A 3KWXA 4G5DA 3Q94A 2GJLA 1OT2A 2OLAA 4D6EA 3LN3A 5FCZA 4MJ4A 4W8BA 4XVEA 1DQXA 3VGEA 4KS0A 3E02A 1THFD 3CMFA 2OGYA 1XLKA 3TMLA 5F2IA 5H91A 3I10A 2B4GA 3BMXA 3WH9A 4UTHA 2R91A 3PG8A 4ZMGA 5B80A 1RA5A 3WUFA 2BB0A 4DJFC 1P4CA 4MMWA 1GOIA 3PK7A 3F2CA 3FXYA 1AZ2A 3FHAA 5KEZA 2O55A 4XK2A 4FXJA 3ITGA 1Q13A 1V0NA 4GQ0A 3QVQA 3UZ5A 4QBXA 3U2CA 4WDTA 4RNIA 2Y1HA 4AMCA 4XBSA 1I9CB 2OOGA 2ZXAA 4MZ1A 1TV2A 3R7MA 2EBNA 2ZX9A 2E4TA 3TN6A 1BLIA 3UESA 4NXSA 3PSVA 2EEXA 1IT7A 1OFOA 3OHMB 2WB5A 4POCA 3SURA 1HKVA 3PUOA 3WH7A 5TIMA 1XW8A 1Q5MA 2GWNA 2GJRA 1RP8A 1V4YA 3EOSA 3MZNA 2D23A 4XO6A 4FALA 2FDMA 1WNOA 4DHGA 1CGTA 1OFDA 3WBAA 3LTSA 1XRFA 2XM1A 4ENLA 1DPMA 1DJGA 2PC4A 3W37A 2Z2AA 3UJFA 3M64A 3RITA 5M5DA 1RK5A 3RYSA 4PUWA 1ZHAA 2FJKA 1UKPA 1P6WA 1YADA 4Y9PA 1P6CA 2ACUA 2D22A 1RLCL 1XLCA 2PDBA 1DIDA 3ARQA 3WDRA 4ADSA 4AISA 2INEA 5C7HA 4Q4SA 5GNZA 2QAPA 4UMCA 4GJIA 4EP8C 1HQTA 1AODA 1VPQA 2I16A 5HMDA 5H8MA 4A05A 1V3LA 4JN7A 4LYPA 4QCFA 1L8PA 1TMLA 4MFEA 4E5TA 3CH0A 2VRKA 4N9DA 3BLPX 3NDOA 1BG4A 1OGSA 2ATSA 1ISXA 3WN6A 4TX8A 3QC0A 4PCNA 3H23A 3E0IA 4AZ7A 1EDQA 2J78A 3EXRA 4LV4A 1BYAA 1A3WA 2E40A 4XD6A 3ZVHB 1PDZA 4JHOA 3NO1A 1K7FA 2YL9A 1M1BA 5E5CA 4GIAA 5BRBA 2PWFA 3W1TA 2J7BA 1XH1A 1ICQA 1JXKA 3ITXA 2CZ5A 1KRMA 1S5TA 1IZCA 2WC7A 1HKMA 3I7SA 1VEMA 3LB0A 3URQA 2ISFA 4V1XA 3C61A 4Q8PA 1LOLA 1OY0A 3RRXA 1KM2A 2WC3A 5K9XA 2RH9A 3OB8A 3WLOA 1WA3A 2C71A 4AC1X 3WNOA 1B9BA 3OZMA 1I2QA 4HSOA 5G2IA 1Q6RA 2QV5A 3N11A 4IFKA 4I5RA 4WXYA 4GBDA 3AXKA 3AISA 1LLZA 1Y5VA 4HTBA 4YTQA 2ZA3A 1M65A 1QTWA 5ABHA 2XIJA 2VHLA 3TC6A 4IX0A 1PUDA 2QXWA 4JTGA 3MA8A 2ESCA 1S39A 3NPWA 1TRIA 4YHEA 2G50A 3W1AA 1Q2RA 4BHYA 3H4XA 4IL2A 4GI4A 3OO2A 4HN4A 2A85A 2OSYA 2FPVA 1YXDA 3BOLA 1P7TA 2FDSA 1BQCA 1YE6A 1QI2A 1RPXA 1RK6A 3PF3A 2V9DA 3B0VC 4JKKA 3MSGA 3FX4A 4GQGA 1RD5A 3Q37A 2F38A 4XAZA 3SRFA 3OVRA 1GKPA 3SI9A 2VX7A 3MC5A 2NV9A 1SFLA 1XG4A 1KNWA 3L68A 4O4VA 3LZ5A 4Z1YA 3LGEA 4KBXA 4NJJA 4QQUA 5ABTA 4H6QA 1JDAA 3SCVA 3AIWA 1OVDA 3GXTA 3UWQA 3CHEA 3FA5A 4V2XA 1VF8A 1EIBA 2CNCA 5K9DA 2PZNA 1J0YA 5RUBA 2D2GA 3BJTA 5A6LA 2BY3A 1JDDA 2GDVA 4RE4A 2DZAA 1BYBA 2V38A 4PTWA 3WL1A 1BTCA 3VCCA 3MB9A 4R7OA 2F2KA 4NYYA 3RPDA 4K1WA 4JY9A 1QNRA 2W62A 3WDPP 4XO7A 1ADSA 4V28A 2WQPA 2A4AA 3BGGA 2AAAA 1H11A 1QCWA 1FXQA 3W00A 3KOYA 3NXLA 2ZX8A 2HXTA 1UR9A 2J75A 4I9MA 1GYMA 5CSYA 2J25A 2WNQA 5LIKX 3ES8A 3PZNA 2J13A 1EHNA 2FJUB 4EK7A 3QGKC 2PP3A 1Q8AA 4E3TA 3MV11 1KBKA 3A3XA 2YKKA 4LAOA 1DIEA 3N6JA 1H41A 3KE0A 4NNBA 3W2UA 3S2CA 3PUDA 1BGAA 1IR2A 5CZ0A 4HMNA 4ZQNA 3C4UA 4C6FA 4O10A 2BSLA 3PJWA 6ALDA 2ZVIA 1VFUA 5D2XA 3CM4A 2ZZ6A 2PCQA 4OKDA 1LTDA 3GY1A 3K4WA 1BFNA 1EJWC 2NUWA 5E0KA 2OO0A 4QXIA 2F2HA 3UXDA 4HPJA 3SFWA 1A5MC 2XSAA 3TP4A 4A29A 3U9IA 1W56A 5HQLA 1WKFA 2FVLA 4E6MA 2NSOA 1PYFA 3VIMA 4LB4A 1EDTA 1EXPA 1EJTC 3KBNA 3LZ3A 2FGLA 5CBIA 1RHCA 3OVPA 3TSMA 3UEQA 5G4HC 1H49A 1FWNA 7REQB 1K03A 3W25A 5BW6A 3NPVA 2VR2A 1O5KA 1TV7A 3ZYZA 3H7VA 4RDWA 2WM1A 1JIBA 1MQRA 1YDNA 3W2JA 3BPWA 4LU0A 3NQAA 4UOZA 1YKWA 1SUXA 3WNKA 2UBPC 2JKEA 4GY1A 1UHVA 3L65A 1C7SA 3S0CA 3K5XA 2NX3A 3A12A 3IK2A 4HU8A 3NOYA 1K77A 1K8CA 1PL9A 1XX1A 1UA7A 4DIAA 5FACA 3N4FA 1ZFJA 5EPDA 2CBVA 1E1EA 1NVMA 4GY7A 2AAMA 1Q4WA 4ONVA 4IP5A 5EBUA 4GO9A 1VJSA 4OHQA 2X0HA 1Z41A 4CQ9A 1AD4A 4L1WA 1X7FA 5A6KA 4EWJA 5HUPA 3RU6A 2AOSA 3SAZA 4D6FA 2Z26A 2XJ7A 4LRSA 2I14A 3FEQA 5LHEA 3G0XA 3N13A 2QJMA 3ES7A 2R82A 3W7CA 1DWFM 1NF7A 3T55A 3B06A 3K46A 4X2PA 1I2NA 1D8CA 4LJ3A 3MDUA 2CLPA 1EYWA 3PBMA 3SIMA 3QFWA 1UA3A 4CQBA 1BQGA 1UUQA 3B9EA 1RJQA 4G6CA 2F8QA 3THUA 1GOQA 2Z25A 3UG3A 3OVQA 2BY0A 3VD4A 1FCUA 5IOBA 4IMAA 2OO6A 1UD8A 1PTGA 3W1MA 1RP9A 1E6ZA 4IGMA 2JKAA 1GHRA 4HK6A 1CB2A 3TIMA 5K4XA 3MUZ1 4XQ6A 2WKJA 1GPWA 1C7TA 3R12A 2JGYA 4C6BA 2G3FA 4GO8A 4I5XA 4DBSA 1GPFA 1UROA 2Q8ZA 4KCWA 3UPWA 2ZX5A 2WWDA 2YBUA 4LAUA 1VBJA 1H61A 2F84A 3AHTA 3VD3A 4IISA 2XVKA 2Q3RA 4GHRA 3APYA 1WDDA 1S2UA 3F4DA 4ZZ9A 2IPJA 4HU3A 2GUUA 4GOAA 4O14A 2CERA 5CSRA 4C1NB 2QHAA 3WL0A 3W70A 4MB4A 3N2CA 3QGVA 2GJNA 1UZ4A 4NP7A 2ZX7A 5A6JA 2ZC8A 4GYKA 3MCOA 1UBSA 5PTDA 4KETA 3WJYA 3MMWA 4IZGA 4NAFA 3K8LA 5D04C 3UWEA 1AK5A 3TNOA 4W85A 4EF9A 4DJDC 5K9CA 3NL5A 3W83A 4PUNA 3ZJ8A 2VKZG 2BMBA 1AH0A 1P0NA 3LPOA 1U22A 4HA3A 2FLIA 2QUTA 4W5UA 3REQA 3G1DA 1T40A 4ACZB 1VJIA 1LZOA 5IHSA 3LCGA 2E8YA 1Q45A 1DQWA 4L4LA 4LS2A 4IT1A 2FZMA 3EX2A 2P8CA 2J7FA 4I9TA 1OJXA 5I3KA 3BJFA 4KRTA 2R24A 1E51A 3EWUA 1PZ1A 1PB0A 4KWUA 1ITQA 4F2TA 1O1HA 2CKSA 1IYXA 1LOSA 3GO2A 4WSHA 3FJNA 3M5VA 5B7ZA 2W6RA 2VQUA 4M3PA 2BVWA 1F9CA 4RZBA 4LH8A 1J96A 4TO8A 2WHJA 3W1UA 4AZIA 2B0MA 4IPIA 4TUFA 2ATMA 5AC8A 2DIKA 3UGVA 4YYCA 1B1YA 3L5MA 3TQVA 3VC6A 4QGCA 4M51A 3H54A 3SEPA 5KITA 1XWYA 4JX5A 5CC6A 3VNIA 2WNZA 5HOSA 4P2VA 3TYEA 3KZPA 1ZRQA 1V02A 1XQLA 4FR1A 3URNA 1EDGA 2RJHA 4UQDA 4GKLA 4BCEA 3N2OA 2Y2WA 1XBVA 2Z2UA 1OC5A 4M7SA 3CBWA 4GNJA 3GIQA 3S6OA 4RK8A 1OHLA 2GQ8A 3LMZA 2DT0A 3W26A 4WSJA 3DI1A 3GUWA 1X1ZA 2Z27A 4IG2B 3PPFA 2EG6A 3QV9A 2YCJA 3LM3A 1QXLA 3TZFA 1OM0A 4BZYA 4RKAA 3KHJA 1VHNA 2VC7A 4ICNA 2W9MA 3WD4A 1T6MA 1EBGA 1Q6GA 4FB7A 1ICSA 3JU2A 3ICJA 3S5NA 3IJ6A 3VM7A 3FJ4A 4DAIA 4FOKA 5KZDA 4ZL1A 4AZCA 3DXIA 4DUWA 1EWEA 4AF0B 1KCKA 1A5OC 4DLFA 3ITCA 3AMGA 3OBEA 2W3ZA 5IFTA 5A6MA 1F8IA 4KERA 4DJEC 3LV5A 2NZLA 3GM8A 2ZXBA 3P82A 3W2KA 3SADA 3UZYA 2ZFAA 2CETA 4Q33A 3S47A 5CPLA 1PTDA 5D2WA 5AC7A 1OGGA 5F1VA 3VE7A 1FUYA 4IUGA 5F2MA 4FLRA 4UTMA 3QY6A 4AEEA 1YW1A 2JEPA 1RY0A 4DX3A 4CNSA 2J6XA 3C2OA 4E0CA 1RALA 1LORA 3EMCA 1TTJA 4DPQA 3BVJA 4HQVA 3WDJA 3TXVA 4NL1A 1QT1A 1RQBA 3SGGA 3S9YA 1QPRA 1E9LA 1C8VA 1VFTA 4E4UA 1SW3A 2NV1A 1CGYA 1UQZA 3PZQA 1JF5A 1JI1A 5CH9A 2WANA 2J47A 3GB6A 3GK0A 3BW4A 1GONA 1NARA 1X6LA 4JTQA 5GNXA 2DIJA 3R79A 4Y90A 4ZGYA 4JOMA 2XWEA 3P74A 3DBNA 1TE1A 4JQ4A 3BAKA 5AHEA 3IGSA 2QDEA 3KVMA 4OOZA 3Q58A 3CQIA 5ABGA 3W38A 1LLWA 1O4UA 1W9VA 1UWAA 2A3EA 2VOMA 1HJXA 1DWAM 1PKYA 3E38A 1F3XA 3H21A 5G2HA 3WMSA 1G01A 2QUMA 4H9VA 1KRCC 2DZBA 4D9PA 3T6CA 1S1RA 4A21A 4UFLA 3R8GA 1XYBA 2PP0A 4GGHA 2YCLA 4EPKA 3PC0A 4UC5A 4JFTA 5DXXA 4OTKA 2BHZA 4LEQA 1XR2A 4O15A 1GVYA 5FA5A 1J0IA 1EJUC 1XUZA 4MWAA 3CV6A 1VFHA 5IDZA 2ASHA 3LM7A 1RD6A 4US5A 2PDNA 3E0FA 1XLIA 2VEIA 5C9RA 4D8LA 5IBXA 4P8VA 1QOPA 4DO4A 3GYCA 3T0BA 3MMUA 5HANA 4FNQA 4S3FA 3RU8X 3TZNA 5C5YA 1E3XA 1W1IE 1PDYA 3LGGA 4RNJA 4ECLA 3LLFA 4QJ4B 3NVDA 3COTA 1DL3A 3JZEA 3WK1A 3E96A 1EL3A 3LK6A 5DMLA 4W5ZA 1IE7C 1TV4A 1RY8A 1Z32X 4AIBA 4C7GA 2AQOA 5TNVA 3NUKA 5FI8A 3SCQA 5IHRA 1LQAA 3KBMA 3RG6A 3CU2A 5D9OA 1G5AA 2PGEA 2XFWA 3ZFHA 1DJNA 3N6HA 4H41A 4I7VA 1F4AA 4DNHA 2PGFA 1TTQA 3LCHA 3VOJA 4JTRA 5FAJA 1MDRA 5E6ZA 1KLYA 4O1CA 5ECVA 1EJVC 5IM51 1D9EA 4IFKB 4YLWA 1W3NA 2WMGA 4CCDA 1AW1A 3QR1A 3CL6A 1RCQA 4QG9A 3KEHA 3KRBA 4CU7A 5KZMA 3R0DA 5C2GA 3H7RA 3FDKA 2OG9A 1OFAA 2X30A 2GDUA 3B40A 3PTMA 3QRHA 3N3TA 2QCEA 3B9DA 3WQ8A 3I7QA 1FWWA 1MYRA 2ZWYA 2PURA 1HG3A 1P7TB 2WMKA 1XCWA 4DWSA 1QOXA 1W3IA 4JN8A 2F9RA 3W7MA 4UNIA 4AG0A 4UFKA 1B4KA 5JH2A 1WB0A 5IFPA 3B05A 1RCXB 3LXAA 3P62A 4HJWA 4DB7A 3OZPA 1QVBA 1SZFA 1AQHA 1EGVA 1HGWA 3L4WA 1G4TA 3HM7A 3OHIA 3LA4A 1I2PA 3WEZA 1DXIA 3URAA 5A1AA 2PLKA 1SJBA 4LUYA 1JNEA 3QTPA 8TIMA 1MRQA 3O1NA 3ATZA 2NXGA 3FY1A 4LFYA 5I77A 4GZ7A 5H6HA 4LALA 2ZZ7A 3C8NA 2W27A 1ZGDA 3WZ0E 4XVDA 1EJXC 5DRIA 2BTMA 3EWWA 1JYXA 4ZE5A 4B4HA 2EPLX 3UXLA 1QNVA 1WQ5A 2W79A 5HAOA 1JYVA 2VGIA 1NOUA 4CCZA 3K4DA 3SRHA 4PTVA 1XYMA 4X60A 1OF6A 3VD7A 1Q8JA 3VUSA 3EYPA 1E9ZB 3PBGA 1TWIA 2UY3A 4GY0A 4FOUA 4L7ZA 1JF6A 2Q09A 1TJPA 5CPQA 3MO7A 4UMAA 2VZTA 3TJXA 1IHIA 1R3YA 1B0IA 4B15A 3CUGA 1IEVA 3VNKA 3H22A 4I8YA 4K7VA 5CSUA 1GWJA 1IEIA 3BE7A 3R58A 3JVAA 1EZ2A 3WDQA 5FL0A 1GZ1A 3KBJA 2QV4A 3MUXA 3UVAA 4XTDA 5G5IA 3QMSA 2YX0A 1XV8A 5IXEA 5DANA 1MUCA 1OBAA 4YCOA 4DZIA 4H83A 3UWZA 5CBBA 1SZNA 1W54A 3FSUA 3HO8A 4DI9A 3GNNA 2PEVA 1E1CA 1QR7A 3M0MA 4NX5A 3R13A 1ZB5A 4KIEA 3MSYA 1TWZA 5FJPA 5DN1A 2PDKA 3LSCA 3SN0A 4M5PA 3V1PA 2GSEA 3MBFA 2IS7A 3SQLA 3S2LA 1JCLA 3WH8A 1XIFA 2FFCA 3OOQA 4Z08A 3DCPA 1MUWA 1UR4A 2YCEA 1TA3A 3ERPA 3NO5A 4IF2A 1HJQA 3GXNA 4H8HA 2NXHA 3AHXA 3BW2A 1GOWA 2HEJA 3F4NA 3GAKA 1B9ZA 4LNCA 3ARPA 3GIPA 4H9UA 3UY7A 3W29A 4JTSA 1NFBA 1FHLA 4AQLA 1QK0A 1WDPA 2POZA 4U2YA 3ZJ7A 3H53A 4Q6XA 1QU4A 5EMLA 1JGMA 3NJ3A 3GXIA 1ME9A 1XM3A 1M6JA 1N55A 4NJGA 3VOFA 2BOFX 4M82A 4C1LA 4FLSA 3NNTA 1W1YA 1H0IA 5AN7A 2XTKA 5HK4A 4GUHA 2GOKA 4O53A 4H19A 3QPZA 4US6A 4AZ6A 5CJMA 3VDCA 1DWHM 3QHMA 1SSDA 3ZWTA 1AJ2A 4N2YA 3A5FA 4DAFA 1ONEA 3T0CA 4B5UA 1MEIA 2AKMA 4FNPA 5LZLA 1AL7A 1M5WA 1NY1A 1EC9A 4GPNA 1ZENA 1SZEA 1HJSA 2NSXA 3PUEA 4GA8A 2D24A 1JZ4A 2BLEA 1KRAC 3CUJA 4Z0SA 4LV9A 4HB7A 2AGTA 2QQ6A 1RLDA 3UZJA 1MW0A 3NL3A 1XH0A 4RW5A 5TBOA 3NQDA 3KAOA 1XICA 4KPLA 3O2LA 3VVGA 1A5BA 4TV5A 3O63A 3OBAA 4AXNA 2ISDA 3WDHA 2CZFA 1H7XA 1YRRA 2W0UA 1XBYA 2PDGA 1AZ1A 5M1TA 3M07A 1YLVA 4N4PA 3P93A 1BRLA 4GYJA 3EDDA 4HYRA 2HQAA 3G1HA 3R2GA 4EPBC 4J9JA 3ABZA 2E9MA 4AH7A 4AMAA 1VFMA 3DOPA 2AMXA 3M0ZA 2DY3A 2VUNA 4QDMA 5HR6A 4AAJA 2PFHA 3QW3A 3W23A 1W91A 3E0WA 1XIBA 3RR4A 4LANA 2BS9A 4BQ4A 3GZ3A 1BSLA 2DH3A 3B0UX 2J9YA 4IGHA 3THCA 2VDHA 3EB2A 3JW7A 4OBRA 1OYCA 2QULA 3PTQA 1BG9A 3M0KA 4I8DA 4Z2HA 3B0YA 3W82A 2H9AB 4NAFB 3CPUA 1S2AA 4JTCA 3V36A 4PMYA 5GJPA 1X8FA 1OIMA 1US2A 4DYKA 3VIGA 1J79A 4L4MA 4HNUA 3SUVA 4KFPA 3ABQA 4ZXLA 1EF3A 3REQB 2YW3A 1QJWA 3AYVA 2Y5SA 1AUSL 5CZJA 1YPXA 3K1GA 2OYLA 5U4NA 1W9UA 1W8SA 3D0CA 3E2QA 1EBHA 2AGKA 4QNEA 1PSCA 4PSRA 4Q8WA 1CIUA 3HG2A 3ITYA 2A7NA 4PFHA 4XUGA 3GHSA 4XAPA 2DSVA 5LIWX 2CHOA 4UCFA 3RLHA 4A8IA 1YQ2A 3PFMA 4KWVA 1VS1A 4M0XA 2VFGA 2YZ5A 3MYOA 2Z4GA 4QX4A 1HP5A 3GXMA 1X98A 4Z1DA 3N2MA 5E93A 3KOWA 1JPKA 3I6RA 4MVAA 3V0SA 1QNOA 3BSMA 1UR0A 3B04A 1KCZA 4EE9A 4GJ1A 2A3CA 1WX0A 3LCWA 3KOFA 5D38A 3NPUA 5FF0A 4Q6JA 3LTPA 4LC6A 1V51A 4XZWA 1RJRA 2Z0IA 3DAQA 2OWXA 4RW3A 3VX0A 2JEQA 3C3NA 1U2YA 4XD3A 2VDIA 3P0WA 3S5ZA 3SJNA 2XG9A 3PPCA 3NXFA 1S1PA 3VZZA 2NVDA 1XLBA 1S2TA 3M5XA 3OQEA 2VFIA 2IPFA 3R11A 3KRZA 1H7NA 2XH4A 4LXFA 2XM2A 1KR0A 2J79A 3IUDA 4ATLA 3MP4A 3N9RA 3DFYA 1VH7A 4Z2LA 3A4WA 1ZZMA 1PZ3A 2BX7A 3GDBA 4EPEC 4HZ8A 2E6FA 4CQDA 4O1AA 1TWWA 1MFUA 1PZ2A 3KP1A 1MXDA 1IWPA 3KDOA 4M6PA 1P0EA 1PKNA 3T2OA 5FF3A 2NT1A 5CPOA 2OR2A 4A3UA 3GHUA 4XKYA 2ISVA 1V6TA 2XIBA 1DKWA 1TPVA 3LNPA 2P10A 1DWIM 1VYPX 1ZJHA 1RBAA 4JX4A 4H9XA 2TSYA 4JY8A 4MKSA 1LL4A 4X9SA 3TC3A 3LD5A 2OYMA 1WV2A 4RDVA 3FIGA 3C2RA 3DIPA 3BARA 5G1YA 1TG7A 3GH7A 1S2CA 4AZCB 4ZR8A 1UBPC 3S5SA 1ITXA 2P88A 4J5NA 2Z7KA 3QV7A 3S5YA 2YBVA 3UD6A 5HJYA 4U10A 5AHLA 3AIRA 3ZLFA 4B2DA 4MNJA 4NRSA 2E1DA 2YIHA 3NGFA 3UT0A 2J77A 3WH5A 1F6PA 1FFQA 4D6JA 3DUGA 2ZCGA 4PB5A 5XIMA 2VT0A 3BAXA 1ITUA 2BFGA 2PBGA 3SIZA 1OD0A 3STPA 4I9JA 4LSBA 3UY8A 5HWMA 4URIA 1TCDA 4IMDA 2J62A 3BCFA 3PWAA 4S3KA 1V08A 5JU6A 3O15A 2G3IA 1E73M 1PEZA 1OG0A 4OJYA 4J1OA 4YMZA 1O5QA 1JL8A 1U33A 4R5EA 4EF8A 3DECA 4H6RA 4MM1A 4AD4A 1XLAA 1UWSA 3JS3A 4DJFA 3P3BA 3ZO9A 4B5WA 1PPIA 1E4IA 4FAMA 1VPXA 3VAVA 5FOOA 1P0DA 5I6SA 2HMCA 3FVDA 3MW7A 1W2VA 4DF2A 5D09A 1FWGC 5CAHA 4DPPA 2EJ1A 2XFFA 3NGJA 4RE0A 3D47A 1Z89A 3LY0A 3EOUA 1SU5A 1Q6OA 3LXCA 3SFKA 4UB9A 1WZMA 4ZQRA 5GJMA 4ZB5A 3NZPA 1A0EA 3F7JA 3PANA 4QM1A 4J3WA 3TN5A 2GSJA 1WZLA 2VRQA 3RCMA 1OABA 3PP7A 4B92A 1DBTA 1EOKA 3CWOX 3C5QA 4FHAA 4H04A 2YL8A 3A64A 2WJFA 4F40A 1NJJA 4PGLA 2XHYA 3ZR5A 4GZEA 3GU9A 3LI1A 2OMAA 1PIIA 1O60A 2HDJA 6ENLA 1R86A 3FFSA 3P84A 3TDFA 3VNMA 4QISA 2YCLB 1GZGA 2YDRA 3NZQA 4ZFCA 3AHVA 5DY3A 5EBAA 4C65A 1J0ZA 4Z1BA 4UQCA 4UFIA 2DW7A 1HVQA 2WJEA 4JIHA 3B9NA 4MWAB 1QK2A 3GTIA 3BC9A 3MI3A 1W17A 5EY5A 3GKFA 3L0NA 3W85A 1POJA 2ZWZA 4NJKA 2PWGA 3TQPA 4GJJA 3L66A 5BOEA 1JUBA 2NVAA 5A3HA 5C2XA 3W7GA 2PAJA 2ZDSA 4I9AA 4MUZA 3BLEA 3HGOA 3HGJA 2VFDA 1YE4A 1KA9F 2CLHA 5CG7A 2PLMA 1KXHA 3WY1A 1JCNA 3GVQA 2GJPA 2R1KA 5FEWA 4PN2A 1IQ8A 2VM8A 1YTKA 5E0CA 1XBXA 4FA3A 3PULA 5DMNA 3MKCA 1A80A 3EB3A 1FDJA 1E43A 2XSXA 3LCLA 2CLOA 3GG8A 4K3ZA 3E74A 1HFBA 5BROA 3SCPA 1YNYA 1UWTA 3PJXA 1EYEA 3CASA 4KW2A 3KS6A 2FVKA 3ANUA 3CYJA 3H24A 2ALDA 5GPRA 4HPHA 2DVUA 5IDIA 3EGJA 4O1BA 2QJHA 2WJDA 3IGXA 3VDBA 4AXKA 4OWGA 2QJGA 1B31A 2XDFA 3W7PA 4WEVX 4C6CA 5AFDA 2HBVA 2V6AA 1ESWA 2B7OA 3B8UA 3RXZA 2REQA 4JDYA 1VLWA 4FXRA 4DXKA 3OLGA 4NZJA 3B03A 1QASA 2CHRA 1SVDA 1F74A 2QPXA 2WVUA 5BMXA 3SR7A 5BCAA 5F1UA 2BZNA 1QW8A 1XD0A 3GDTA 3KX6A 2CLEA 4DWSB 2WNWA 1G67A 4H00A 4JEJA 4GIYA 4GC3A 1H1ZA 1QNQA 3IIOA 2QCFA 3KLKA 1H09A 5A2AA 1CLXA 1QDSA 2CPUA 3C2YA 1O5RA 3IIVA 3C86A 5D2VA 3WNLA 4P8XA 2OOFA 3VOGA 2YA0A 5CAKA 2V69A 1TX2A 3OTRA 5LIXX 5LNUA 2E1WA 1ZBKA 4K8EA 3O16A 2YDSA 4BF5A 5LIYX 3W88A 1MQQA 3VGGA 3SW6A 4N9BA 3G24A 1UC4A 3H2AA 3S2MA 1KGUA 1OADA 4KCTA 4Q8UA 3RILA 1U1JA 1KO0A 1KD0A 2VGGA 3SB0A 4FNRA 3Q2DA 5E0FA 1XCFA 3S1GA 3OG3A 1G94A 3CQ0A 4LWWA 2PWEA 2BY2A 4P7LA 1ZY9A 1UZHA 1H0GA 1FWJC 5K7JA 1XKJA 3PZIA 3ORWA 4IIDA 3PR2A 5E9XA 3NYDA 1E4LA 1B54A 4YCPA 4IX2A 1G4EA 3HU7A 2J4GA 4GINA 3VKDA 3NSMA 3TTEA 3E0VA 4HN8A 1MNSA 4G1NA 3PUGA 1CB7B 1DORA 5IBXC 3L9CA 5LHFA 3JR2A 4MJ2A 4RL3A 3B8WA 1ME7A 1R3RA 1HKIA 4TTGA 3GTNA 2DT1A 4AC7C 1DXEA 3RJXA 3CB8A 5FAGA 3BO9A 3QOKA 2GGHA 3F5JA 2MUCA 3AAMA 2P50A 3IRDA 4IWWA 4DXVA 4BK9A 1E1CB 3CV1A 3QKZA 4ZO8A 3QBUA 4AVFA 4PCFA 3UJRA 4Z1CA 4GIEA 1OGBA 4ZO6A 5HMEA 2IKJA 2YFOA 2DQXA 3T44A 4OFCA 3VU2A 2X2GA 3UYIA 3V18A 4LBSA 3LQLA 1XJBA 4CNTA 2PDHA 2VCAA 3N12A 5I00A 3L5LA 1QW7A 3IRSA 1GZJA 4O50A 1SFJA 2XUCA 4LTSA 3TYDA 1LT8A 1DV7A 1KBBA 1PE1A 4QSHA 2Z28A 1TA3B 3SCTA 3EKZA 1VAHA 3V4BA 5F7UA 4JNZA 1Y5XA 4A3HA 1MXSA 2DU2A 4HPGA 3DKLA 1LBLA 4RJEA 3WUEA 5G2WA 2WHMA 1K9DA 3GYEA 2NQHA 3VMNA 1S2WA 4D1IA 4HMDA 3W07A 2UY2A 3ARUA 1TPUA 2P5NA 4DWSC 3VC5A 3GH5A 1XLDA 1G4SA 5C9ZA 1WPCA 4UWMA 3ZOAA 3GXFA 1ISZA 1CYGA 4ZVJA 3AALA 4DZ5A 4L1GA 2WMJA 3S3GA 1YDOA 1IXPA 3L7RA 1XG3A 5FF7A 1EP3A 1TREA 1TVNA 4ZOBA 8XIMA 5LIUX 4OECA 3MZ2A 2QCMA 1BXNA 5MKGA 2IKGA 4Z17A 5CC7A 4PYSA 3TMQA 2BVYA 4JIEA 3CZKA 3W22A 1DYSA 3U6WA 1TPWA 1LQ2A 2ZC1A 1VFFA 1AD1A 4NRRA 2WV8A 3LHWA 3MANA 1AH4A 3LHTA 4TMCA 9XIMA 4B5SA 1GQNA 1NIUA 3GVVA 3ITOA 5EMJA 4ORMA 1PX3A 3W7OA 1E5NA 3SUTA 3U2OA 2RHGA 3IV8A 3UJEA 1T5AA 3NQGA 4IFOA 1JZ3A 4Q8OA 2VX6A 5T91A 3QHOA 2PUZA 2WK2A 5HULA 1KKOA 3FHQA 3NQBA 1BEUA 3WJWA 4BJHA 5A69A 3CL8A 4XZMX 3Q4DA 3KBVA 1CCWB 3E5PA 3NL6A 3GC4A 4ASTA 2QCHA 3OJGA 1WOBA 1IZKA 4OV4A 4X61A 1AG1O 1T7LA 2G3JA 4IMCA 3MTWA 3MYPA 4RV3A 5LKYA 4W87A 1UKOA 1S5NA 2H8ZA 1PX8A 3G1AA 1FWRA 1XPYA 3ZSTA 1KFEA 3B8VA 2GGJA 4ERIA 1HKWA 4DBUA 1H3GA 1BRLB 4AD0A 2WYSA 4NJIA 4O1EA 4UNLA 3CHVA 3CWNA 4G1KA 3K8MA 4BEUA 3MSDA 4GUIA 4RDYA 3LPPA 4PA8A 4AD2A 1X96A 5CLTA 1OC6A 1EZWA 3LSBA 1TV5A 3CHFA 3I68A 4LF2A 2ABAA 3BZGA 4YS1A 4Q8NA 4Q3MA 3GDKA 3E3HA 5REQA 3VGFA 6A3HA 1TUFA 3O0FA 3UR5A 3E2RA 3N18A 4AY1A 2FH6A 4H7VA 4I7UA 2WC4A 3W81A 3RK8A 4AVNA 4BI7A 1XLHA 4LUTA 3UNDA 2YPIA 3C0SA 3UJSA 4O12A 4I5UA 4PMVA 3ZJKA 3PG9A 4BY3A 1PXGA 3HQNA 4NQ1A 1KV8A 1G7VA 2XU2A 1KXTA 1LM1A 3RM9A 3W1XA 3LLXA 3HF3A 1L6FA 1OZMA 3DENA 2ICSA 2CESA 3OGSA 1SFTA 1LQ0A 3RX3A 4DJDA 1POKA 1V79A 2DSWA 1NFGA 3LHZA 3TLLA 1Q6QA 4WJEA 3GTFA 3CIXA 5CPTA 4PEKA 4DN1A 1KW1A