3QH2A

Crystal structure of teni from bacillus subtilis complexed with product cthz-p
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
195
Chain Sequence
SHMELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFGRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMRYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Regulatory protein tenI
publication title A Missing Enzyme in Thiamin Thiazole Biosynthesis: Identification of TenI as a Thiazole Tautomerase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 77
structure length 195
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 5.3.99.10: Thiazole tautomerase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qh2A00
1FQ0A 1WDWA 4E2BA 1W5NA 4MIMA 3LI1A 4U28A 3NA8A 2RH9A 3P62A 3W74A 1VCGA 1YXYA 3BGGA 3W7JA 1RQEA 3W3OA 3QMSA 3TK7A 3FEMA 3S5YA 2Q3OA 5FEPA 2FIQA 2Q8LA 4JTTA 3T4CA 5F4XA 2NX9A 2ZA2A 3G8EA 3PBYA 5LGXA 4OU1A 4UNKA 4EF8A 3C4UA 3C2EA 5LNWA 4N4QA 1SUXA 3USBA 3C0JA 1YTEA 2QCCA 1JULA 1AW1A 3EX1A 3CB8A 2JGYA 3L0GA 2F7FA 2G5WA 4O19A 3WJXA 1VCFA 1L6YA 3M6YA 1S3HA 4BFAA 3UWYA 3W7EA 5LHFA 3FOKA 1IXNA 1JQXA 2P0OA 4AH7A 4JTSA 1GG1A 1UBSA 1IXQA 5G2WA 5D33A 4UMBA 1I2NA 2GUUA 3B0PA 4M6VA 1U83A 2YFNA 1QWGA 2C19A 3W83A 4HNTA 2TPSA 3E49A 1I2PA 3UY7A 2ISSA 1YLVA 5DELA 4DELA 3DI0A 3DHFA 4W9TA 1XDLA 3WJZA 3P80A 3ZFHA 2HMCA 1LORA 4O11A 3W1AA 3N9SA 3TW6A 4WD0A 1QPQA 1ICPA 1MSSA 1UUOA 2A7NA 4N02A 3R12A 3QPZA 1XBVA 2Z1BA 5G4WA 2V5BA 1YPIA 1O5XA 3W1RA 1GVSA 1O4UA 2FPVA 1KTCA 3Q58A 1LBFA 1YADA 4O1AA 3TSDA 4YCPA 4JY8A 5K9XA 1AL8A 3LI0A 5TIMA 4UFMA 3SGUA 4K36A 3NVTA 3W2JA 2GQ9A 4O17A 1DV7A 4FNSA 1B57A 4LW7A 3HQ1A 3MWAA 3I68A 4GNJA 5KSWA 3UPBA 1N55A 5FF2A 2PC4A 1GJPA 4M6PA 1FCVA 5KINA 2FPTA 2CLHA 1ZY9A 3L0NA 3W1UA 3VI2A 3VKJA 2A1YA 2OX1A 4KFOA 1MXSA 5DY3A 2YSWA 4A29A 2ZRWA 2X1UA 3LCIA 5FEZA 1FWSA 1LBMA 4O12A 3UZJA 5AHFA 1H62A 4H4IA 3S5ZA 3W7OA 1M7OA 4NJKA 3IGUA 1FWWA 4JS3A 1WX0A 4LRTA 1K8ZA 3OG3A 4PH6A 4AB4A 1QDSA 1GZGA 2ZZ3A 3W23A 5CZJA 4XUGA 1H50A 2GVGA 1KBIA 4QM1A 2A5HA 3NQ6A 3LXAA 4UTTC 1XI3A 2VXNA 3P5ZA 1YXCA 2NXHA 4UCGA 3W1LA 3C8FA 5D03A 2ZA3A 3AJXA 4KWVA 2X1SA 1VRDA 5BMWA 4GBUA 1OX5A 3LLFA 2CLFA 1L9WA 4GUHA 4WXZA 1OFQA 3OBKA 3N14A 3INPA 2H8XA 1TPH1 1UB3A 5F1UA 3RK8A 1A5SA 3G0XA 3I7SA 3LHUA 1SR9A 4UTWA 2DJLA 3N2XA 1F05A 4RKAA 4BR1A 5U7SA 1WXJA 4LWWA 3W7IA 3CC1A 3M5YA 1SO6A 3N19B 3LRMA 4Z1AA 4FX6M 4ADUA 4IXXA 1Z44A 1VPXA 4O13A 3CEUA 4ORIA 2EPHA 1Q45A 3W7KA 3M43A 1TPVA 2WSRA 4MY9A 1VCVA 1P1XA 4JIPA 3NZ1A 1THFD 2PRLA 1A53A 1MEWA 4DPQA 2P1FA 3M5XA 4Y96A 3M9YA 3FYOA 1K02A 2CWNA 3W2LA 1YTDA 1FXQA 3GKFA 1TPUA 4GWEA 4XQ6A 3BO9A 2TRSA 1TPFA 1CX9A 4YLWA 5J5DA 1OFPA 2H3DA 4FXRA 3W1XA 1W5PA 4HPXA 3W7NA 3IIVA 4CQ9A 3NQMA 3LX9A 1HL2A 2UV8G 3F4WA 3GDTA 1Z41A 4TR9A 2E6FA 4JYFA 1OFDA 3OHIA 4ZL1A 3R8RA 3BG5A 3A5VA 3ABOA 1I45A 3LHTA 2YCEA 3M16A 1OYBA 1JRCA 3CU2A 3EXTA 3NO5A 4O15A 2VFGA 1W31A 5CZSA 3IGSA 1ME8A 3KVLA 1W0MA 2A7PA 1T0OA 1UCWA 3S5OA 2RFGA 1VYSX 4UFLA 1QR7A 3NAVA 4M7TA 4UR7A 3S5NA 3W2MA 5LNSA 3G1FA 1EIXA 2WV8A 3LHWA 3GDMA 3TXZA 2YR1A 3GAKA 2YDAA 1GTEA 4WUIA 1H51A 3UWWA 1QOQA 1QMLA 3P82A 5I3JA 3SY5A 3W1MA 4LT9A 3IIXA 1MZHA 4KWWA 4FB7A 1LBLA 1ZFJA 5BW6A 3EXRA 2ZFAA 2H3BA 4FX7A 3NL3A 2Z6JA 4JYEA 1LRNA 2YYUA 2RDTA 1SU5A 5TQLA 4PFMA 2J88A 4IMGA 3GX9A 3GYEA 3DZ1A 1V7YA 5FF4A 4NXKA 3TXVA 1EB3A 4WZHA 3NQ7A 2R91A 2E09A 1SSGA 4FF7A 1AL7A 1NF7A 4TU1A 2NV1A 2DZWA 3LV5A 3A24A 1QPNA 3O07A 1VJIA 3QZEA 5LKYA 1DVJA 4KFPA 4WXYA 3C2FA 2CLEA 2V5LA 3ELFA 5C6MA 1NF0A 1YDOA 2NUYA 1LLWA 1TQJA 3BPWA 2DZXA 4DO4A 1NSJA 4WJEA 1JCYA 3EWWA 1TPB1 4LRSA 1S5VA 3LBCA 3O8AA 2ZZ6A 3HPXA 3S42A 4UFHA 1NAL1 3LRLA 2QJGA 2ZRUA 2Y6ZA 2EKCA 3W9ZA 3BG9A 4JY9A 4CCDA 2PRMA 4GRSA 5AB3A 3SSJA 3JR2A 3HG2A 4HNNA 4UXDA 2C16A 1DL3A 1Q3NA 2Y62A 1JJKA 4WY0B 3TJLA 3BVJA 3IVUA 5CKSA 3TMQA 1TYGA 2AGKA 3M0ZA 5F2LA 3HGJA 1EPXA 1SFLA 5HWMA 5H91A 3W2NA 2QCMA 1C8VA 3GIYA 3UXDA 3FFSA 3BLFA 1W8SA 1IIHA 5DBUA 4Z08A 3G1SA 3F4NA 3GR7A 3U6WA 2EF9A 4WOQA 3R5EA 1I4NA 2Y61A 3LV6A 4H3DA 3RNDA 3LBMA 2QUUA 3I7QA 4ALDA 2DJXA 3NQEA 5D2WA 1F6PA 3DU0A 3QSTA 1SO5A 2DP3A 1JR1A 5G4EA 3W76A 4LVGA 3PUEA 2Q3RA 4NZFA 1BWKA 1EP3A 2HTMA 4YXGA 5D2VA 3MBFA 1B4EA 3T40A 4NT0A 3HGRA 1SO3A 5LNUA 4JEQA 4JX5A 3HBLA 2GPTA 2CU0A 4GUFA 5I3FA 1KFCA 2EAWA 2WSQA 2HS6A 1M7PA 4O4WA 4R33A 4TMBA 2O7QA 3DFOA 4MZ1A 3LM7A 3FKRA 3HMJG 3P61A 4RXGA 1H7XA 1ZAHA 1PV8A 2YW3A 3QF0A 1DJNA 2E5CA 3TC6A 4U4MA 4NJGA 3UNDA 4O10A 4FHAA 2RDUA 3DKLA 4OT7A 1GEQA 4OQVA 3L66A 1K03A 4K7YA 3AO0A 3GKAA 4I9AA 4RLIA 3SI9A 5K3VA 3PY2A 1B3OA 2J24A 1GPWA 1KA9F 1F74A 1KLZA 3JS3A 2BWGA 5DCDA 1EWDA 1SZEA 3MP5A 2FB3A 1XXXA 2QJIA 1T8XA 3P5YA 3Q2DA 4RK8A 2BX7A 5CSRA 2NWRA 4AHQA 3ZS4A 4XWUA 4RX0A 4NNCA 2V82A 5EYWA 1SW0A 5HWJA 5AC6A 1EP2A 1SQ7A 3W7RA 1ALDA 2EHHA 3GZ3A 3YPIA 4UR8A 1LOLA 3H53A 2BZNA 3PS7A 3RU6A 4G1KA 5DXYA 5AYXA 2Z2UA 3GR8A 2ISWA 2DZSA 1VQTA 4MZ8A 2V81A 3T78A 2FFCA 3OA3A 3STGA 5I3KA 2G95A 3DENA 1KFEA 1OF8A 1AK5A 2V8ZA 2ZYFA 3LHYA 2GVLA 1SW3A 3G1HA 3CQ0A 1GG0A 5AYYA 2A7RA 3W07A 1ZENA 1Q6RA 2ZTJA 1LRTA 2C3ZA 3W73A 2B0MA 3LTPA 2GQ8A 1RR2A 3TIMA 2A0NA 5FF7A 4MYXA 3IVTA 1TPWA 3SR7A 5G1TA 1TREA 3G1VA 3SJ3A 1NEYA 4BI6A 4YMZA 1WBJA 4AF0A 3FJ6A 4DXVA 3QQ0A 1VYPX 1G4SA 1ZNNA 3RMJA 4IMEA 1L6SA 3NL5A 1YXDA 1C9DA 3EWYA 2WQPA 3U2OA 3D0CA 2V2HA 3IIZA 1WOBA 4FNRA 4HT3A 1RVGA 4HIBA 2H6RA 4S1FA 3QW3A 1LOSA 1ONRA 1TJRA 2ZTKA 2WJZA 3CWNA 2YFOA 5CPOA 3SW6A 1ZAIA 5KZEA 1GVRA 3HIJA 3PAJA 2H8ZA 2Y88A 5BRBA 3H55A 3L68A 2X1RA 4O14A 1EX5A 4XTDA 1W37A 1Q6LA 2LLEA 1FWNA 4XKYB 3W7HA 4FXSA 1XFBA 3M44A 1JUKA 5IBXA 1KV8A 1AW2A 3P8JA 4QNWA 3DI1A 3WK2A 3C52A 2KZHA 2V2CA 3G1DA 1W5QA 5AHMA 4ZQNA 2CZ5A 4ZMGA 3UY8A 1ML1A 4GFSA 2QAFA 5F2MA 1J4EA 4GE8A 4AHPA 1OFRA 2X2GA 1GTHA 1M6JA 3MYPA 2C1HA 1FCQA 1PL9A 3B4UA 2QKFA 2Y7FA 5G1YA 3WJWA 3W7PA 4D2JA 4LY8A 4ZQOA 1K7EA 3W87A 3PBUA 4TX9A 3M1ZA 4Q32A 3C3NA 1FY6A 1EWEA 1HO1A 4Y9AA 5K4XA 1IGSA 4JNMA 3VE7A 1G67A 1TTPA 3HG4A 3HJZA 1VLIA 4IX0A 1RPXA 3TMLA 1R2SA 1OFAA 2C0AA 1VHNA 2B7PA 3PB2A 3QEZA 3NZRA 1AMKA 1LYXA 5HNRA 1H7WA 5LGZA 1TV5A 1GVFA 2BTMA 4UTWC 1FDYA 1HFBA 4DBDA 1ZALA 1VH7A 1VS1A 3PR2A 1F7BA 1LOQA 5F4SA 2ATMA 1HO4A 1EUAA 1XBZA 3EWZA 3ABRA 3GXPA 5F2IA 2FLIA 5I3IA 2R8WA 1X7FA 1TTIA 4K37A 3P7YA 3ABSA 3LTYA 3E02A 1C29A 3R13A 4CNOA 5HINA 2C14A 2V0TA 3OVRA 3TV8A 1QFEA 4JD4A 2J27A 3P8IA 2A4AA 1FWRA 4O57A 3F03K 1FCBA 3G1YA 1PCWA 4N6EA 4IMFA 4MUZA 2A2IA 2NXGA 2GQAA 5DN1A 3WK3A 1PS9A 3NQCA 4UTJA 2QUTA 5ABTA 4MPQA 4CNNA 1YTKA 1XC4A 3G22A 2NUWA 6TIMA 4IPIA 4Z1DA 1DKWA 3NPWA 3O6YX 3W72A 3R89A 3PSVA 4QNEA 3ZWTA 3CT7A 3NQFA 3NGJA 4I7VA 3G3MA 1Q6OA 5KMYA 5CGQA 5C5YA 5E93A 4LV9A 3BV4A 2YXGA 3E12A 3UWZA 3MI2A 2TSYA 4A22A 4QISA 1CW2A 3NM3A 3I65A 4BWLA 5AHIA 4CCCA 2E5BA 1P5BA 3KAOA 3LCGA 3UWQA 5D32A 4IUOA 2C15A 3EX4A 3B8DA 4KKXA 1OX4A 4N6FA 5KZDA 3PG8A 3N3MA 1H7RA 3STCA 4JYDA 3TNOA 1JUEA 5I3GA 3W85A 5HMSA 4M5PA 3ZWSA 1OJXA 1AW5A 2QF7A 1J2WA 1H61A 1TQXA 3LXBA 3TFCA 3FS2A 3DFTA 3Q37A 2E68A 4IJBA 3VCRA 3QW4B 5C2XA 1KM5A 1R2TA 3W84A 1O60A 3U8GA 4MFDA 4N9BA 2QCGA 4NUWA 3TAKA 1K7FA 2CLMA 2OMAA 2Z0IA 1H7NA 1A5BA 2J9XA 3M7WA 3BLEA 3QJAA 4LOCA 1VLWA 2QCDA 4N2YA 1LZOA 1RQBA 4RCXA 3RFAA 1TPC1 2Y7DA 1LRQA 2VENA 2NX1A 2D73A 3FIGA 3HF3A 5AC7A 3S1WA 5C54A 3BLIA 3KVKA 1Y0EA 3W22A 1IXPA 1TRIA 3A5FA 3G18A 3MBDA 3NXFA 1HTIA 1KV5A 1X1ZA 1WAUA 4Z0JA 3P84A 4NX5A 4EWND 3KFTA 3HB9A 1YYAA 4Z0SA 1HUVA 4EF9A 2ZZ4A 3TKFA 2F84A 4PC8A 1F2JA 4J9JA 5K4ZA 4FNPA 1K8YA 1F76A 3LCFA 3V1PA 2VELA 4P2VA 2IQTA 1TMHA 2CZFA 2ZZ5A 3W2KA 4X22A 4CQAA 3MI6A 2Y7GA 2ZRXA 1WOAA 3NEVA 4AEOA 5HUOA 3WFAA 4WOZA 4BF9A 6ALDA 3GVGA 1JCNA 4UUIA 1AG1O 3B03A 2AQWA 4DEFA 4NXSA 5LNVA 2VFHA 3O05A 4AWSA 3LGEA 1QO2A 3M47A 1EP1A 3TCEA 1JUBA 1H1ZA 3L5AA 2Y63A 2G97A 4GJ1A 3UD6A 1BKSA 2JKPA 3G0SA 2OZ0A 3S1XA 1F6KA 4CQ8A 1KTNA 4K6AA 1E51A 3DBPA 1P4CA 5EY5A 1PVNA 3RLUA 5C55A 1TSIA 2DZUA 3LCLA 3E9AA 5KZMA 4IOTA 1R47A 2QEZA 1EEPA 4HSNA 2I14A 1KTBA 7TIMA 2X16A 4O28A 2NLIA 4TO8A 2XN2A 4AWUA 5D2XA 5K9CA 1GVQA 3TDFA 5EMUA 3TQVA 3S8HA 5GVJA 4NZJA 3UXAA 3TSMA 2DZTA 2QDHA 5FF0A 1KW1A 3GAYA 1B9BA 1JCJA 3UWUA 4AXKA 1JCMP 3GNDA 3GDLA 8TIMA 2TYSA 3ABQA 4JTEA 3A22A 1R2RA 2VFEA 4C1LA 4DO5A 3IVSA 1I2OA 2B4GA 5D02A 1FWTA 5HQEA 3PBWA 4LNYA 3UQNA 1GOXA 3K30A 4HKPA 4LVDA 4UTIA 3SGZA 2QAPA 4JR5A 3HO8A 1EA0A 4R34A 3BW4A 4LC6A 4JICA 1ZJIA 1OK6A 3L2IA 2NUXA 2WO5A 3GDRA 5FESA 3DFQA 4LS1A 3TQ0A 4ZQCA 2QCLA 1H7PA 3G8RA 3PSWA 1ICSA 1OFBA 3WK0A 3IIPA 3DFSA 4JTUA 1W54A 2Z6IA 1PHQA 1W1ZA 2ABAA 3L65A 3TQKA 1ICQA 1IXOA 3HGSA 2A6LA 2VFFA 1A50A 2E6YA 2DORA 5K7JA 1M5WA 1VR6A 4EOUA 2GJNA 4BI5A 5J5RA 2ZRZA 3LRKA 4RV8A 1F5ZA 4OWGA 4PCFA 4UTUA 3C2RA 4RZ5A 2VEIA 4ZQPA 2FTPA 2ZRYA 3KRSA 3LHZA 1CI1A 4NX0A 1NVMA 3GK0A 3RF9A 3P81A 4JDBA 1VC4A 1ME9A 5D37A 5E1QA 4FX8A 3BARA 4ZZ9A 1XUZA 2WSYA 4N9DA 2TMDA 4RZ4A 3PBVA 2VC6A 1DBTA 4IPJA 5LHEA 2BLEA 4R7JA 2XN0A 3QYQA 1FCUA 4PEKA 3DXIA 1T96A 3IRDA 2DZPA 3CWOX 5AHEA 3TFXA 1DOSA 3P74A 4RXFA 2RDWA 4NU7A 3NPXA 4ZQMA 1XDMA 4A2RA 4LVAA 4GXMA 4JN6A 5LZLA 1OX6A 4K8HA 2CZDA 4IX2A 3EX6A 3TR2A 3TW7A 1SSDA 5E0KA 4ML9A 1XBYA 5HUPA 3W70A 5AOUA 1IIGA 5HWNA 4O54A 1D9EA 2PURA 2CLLA 2RKXA 3I6RA 1Z42A 4WY0F 3W75A 1G4EA 4O1DA 3BK0A 3KX6A 1TB3A 5KTLA 2YZRA 4BK9A 3FYPA 4O1CA 3FJLA 1GYLA 4E2DA 1VYRA 4LUJA 2B7OA 2Q8ZA 3VE9A 3DH7A 5I3HA 1PE1A 3O16A 4LUIA 3TAOA 3EKLA 2CLKA 1VGAA 2A6NA 3EWUA 3KOFA 1OABA 4O1BA 4PODA 3NQAA 4X3ZA 1G4PA 3KHJA 3S9YA 1XBXA 5SWUA 5AHLA 1T99A 4CNPA 4DF2A 4UFJA 2E77A 4LVBA 4YL2A 1DJQA 1GWJA 1N8FA 5EA9A 3L5LA 2I1OA 4K8EA 4ZVJA 1RQHA 1ZHAA 4MY8A 3EKZA 1W3NA 1LTDA 3RLVA 1LLZA 3V75A 3OEXA 3T55A 5DY2A 3GDKA 3NQ8A 5DCEA 1LP6A 3WJSA 3TUUA 4FIRA 1BWLA 4Z1BA 5IBXC 2CZEA 1P0KA 1YDVA 4NJJA 4K39A 3JRKA 2C13A 3HGOA 3LB0A 3CIWA 1TV8A 4O16A 3NL2A 3W71A 4LC8A 1H63A 3LCWA 4IMDA 4FEZA 2Y85A 2ZZ1A 4JXCA 2I9EA 3KVJA 1Z48A 2YW4A 3QMRA 4M19A 2A21A 3M5VA 5FI8A 1W5OA 1KM6A 5DCBA 3PVFA 3KVMA 4HN4A 1DQXA 3L67A 1DHPA 3O63A 3R2GA 1KFJA 5EPDA 1LDCA 4MKNA 4ONVA 3WK1A 2ZCGA 4RZ6A 3B06A 3MI3A 5CG7A 3T44A 1KLYA 4IQLA 3TX9A 2C6QA 1WQ5A 5D2TA 3MP4A 3F1QA 3MP3A 3IV3A 4L4MA 1DQWA 3UPWA 5CPNA 3HOJA 4XBKA 4L4LA 2ZA1A 3QH2A 5MHBA 5L6UA 1OK4A 2NXIA 4JTFA 1VZWA 1KFKA 4BI7A 3CLMA 4JX6A 3W7QA 4O0KA 3BW2A 4O4VA 2ZRVA 3MW7A 3Q94A 1G6CA 3PM6A 1OF6A 4AWTA 2QDGA 2WOQA 4E0CA 2CW6A 4S2BA 2J6XA 2V2DA 3MMTA 2O7SA 3PUDA 2OJPA 3CTLA 5BMXA 4Y8FA 1DORA 1RZMA 1LM1A 1OFEA 1SZGA 4AHOA 5D09A 5FEWA 3PWAA 4UMAA 1WA3A 5HR6A 1K7XA 4Y90A 2FJKA 1OG0A 5EBUA 3PB0A 3C2OA 3CM4A 3L9CA 3T7VA 4QSHA 3BGJA 2FQIA 3O06A 2ISVA 4AF0B 4QITA 3STFA 1W5MA 3TSBA 1MO0A 4JTJA 2E1DA 2FB2A 3W86A 4ADSA 3W7DA 4PTNA 1O95A 4H6KA 1UASA 2WNZA 3NQ2A 3NQDA 1X8FA 2CLIA 1HG3A 2W79A 1TO3A 3A21A 1GT8A 2VEKA 3UWVA 1K3UA 4FNQA 1TPEA 3QMTA 4GUIA 2OT0A 5A8GA 1KBJA 3LDVA 4JX4A 3UYCA 3ATYA 1D3GA 1Q6QA 2P10A 2VFDA 3KXQA 1MEIA 1P0NA 3NQGA 4UFIA 3C56A 2VFIA 4DBEA 3DAQA 1UUMA 4BWLC 5D2YA 3G24A 3QRHA 2G96A 2E6DA 4R53A 2NV2A 3TROA 5BNKA 5FEXA 2GVJA 4NJHA 1A5CA 2Y89A 3TJXA 3VFLA 1R46A 4WX2A 2VOMA 3BG3A 1H1YA 2XFWA 2FPYA 3E0IA 4OHQA 4NJIA 1SPQA 4UFKA 3IEBA 1K8XA 4NNAA 1SZNA 1TV7A 4OE7A 3W1NA 3ANYA 4PL2A 1FX6A 1XUUA 3E96A 3H54A 4OV4A 1WYIA 4GC4A 2DU2A 3EXSA 4X2RA 4YCOA 3W6YA 4Y6GA 1ZAJA 2X1TA 4UC5A 5CZ0A 3HG3A 1O94A 3EX2A 4MJMA 3MUXA 3S1VA 4UTHA 4B5NA 1TPDA 1B4KA 3W7LA 4MZYA 3GLCA 3LTSA 4IMCA 2X30A 4JIQA 3NOEA 2ALDA 3DFPA 3C61A 5G2IA 4UTTA 4UTLA 5D04C 3N9RA 4A21A 1SZFA 4M7SA 3C6CA 3LCXA 4EVZA 5AC8A 5K9DA 4DQWA 3LCHA 4K7VA 4Z1CA 3QPYA 1LCOA 1G69A 5F1VA 5F2GA 4JTIA 3LHVA 4O8RA 2WPBA 3G3DA 3P67A 2GJLA 3BW3A 4N9EA 4Q33A 4QAIA 2ZZ7A 2CLOA 3KRZA 3M41A 2VKZG 2QCHA 5HR7A 3NG3A 1N7KA 1MEHA 4MLJA 3EX3A 3MHGA 4O52A 1G7VA 1I8JA 5D38A 1TCDA 4O18A 4FNUA 2VEMA 4MFEA 1GQNA 4NVTA 3GXTA 2Y7EA 2QCNA 1D3HA 4TIMA 5F4WA 4ZQRA 5AYZA 4YWIA 1I2QA 1JQVA 3B04A 3G1XA 4OV9A 3W7CA 5LNRA 3MHUA 2CFFA 1H60A 1GVOA 1FBAA 4HNUA 1OYAA 1U5JA 2NWSA 1QO5A 1SO4A 2R14A 4DF1A 3GXNA 2YX0A 4HSOA 4I7WA 4WY0A 2WNNA 3NNTA 4MOZA 4HNVA 3DFNA 4HHPA 1JCLA 1H5YA 5CPMA 1JCXA 3L0KA 3IGXA 3OIXA 5HULA 3EWXA 4E38A 4I7UA 2GOUA 2ZQ0A 2YPIA 3G1AA 5CSSA 1GYNA 2W0UA 1X1OA 1PHWA 3N73A 3NL6A 2YYTA 1PCKA 4N9CA 1TTQA 4KFNA 4EIVA 3B0VC 1ADOA 3PUOA 2HSAA 2ZZ2A 3B0UX 1QPOA 4ORMA 1LROA 3VNDA 1EUNA 3W88A 1NFBA 3L21A 4MVAA 2YGYA 2W6RA 3NPUA 3TA6A 2ABBA 5CPLA 2PCQA 1QPRA 1H7OA 1O5KA 2BSLA 3PF3A 4GUGA 2E6AA 5D30A 3W1QA 4DO6A 3S0CA 1YPFA 3ZR4A 3IIOA 1OX4B 3ATZA 1VHCA 2NX3A 4LS0A 3QC3A 5AFDA 3SZ8A 3I7RA 3UZ5A 3DKJA 3QQ1A 4JTKA 1TRDA 4LTSA 4JTLA 3STEA 4CLMA 4MJZA 3O6DA 1W3TA 5G2HA 3TE9A 4RJEA 3EWBX 4ICNA 1WV2A 4JTHA 5H2ZA 2ZBTA 1WBHA 3A9IA 5IM51 3THAA 5L9FA 1S5TA 4JTGA 5AN7A 3FA5A 1FUYA 1XM3A 3OVPA 1QCWA 5TBOA 3P60A 1L6WA 4UTKA 1TJPA 4C1KA 3QM3A 4WQ6A 2VEPA 2QCDB 1V5XA 5CZTA 4OBTA 1KFLA 5DLCA 1G4TA 3CPRA 4GUJA 1OYCA 2JGQA 1YDNA 3DHDA 1KM1A 4LVFA 2PRHA 4M6QA 4S2CA 2FDSA 2QUVA 3QFEA 4RR4A 3SFKA 4LV4A 4MYAA 3EEGA 2QCFA 4X9SA 3A23A 4NNBA 3GB6A 3MJYA 4IXHA 1QNVA 1L2UA 3O15A 1XL9A 3HPZA 4A2SA 4NQ1A 3PG9A 4LU0A 5KITA 4QIUA 4XBSA 5DXXA 1KM2A 3CHVA 3N2MA 1W56A 5K2ZA 5DBTA 1FDZA 3PC0A 3W2UA 3NQVA 1KM0A 3NR0A 2WKJA 2ZDRA 2Y70A 3LOTA 3LERA 1ZCOA 1SFJA 2QJHA 3SIZA 1R30A 4QJ1A 3TC7A 3EB2A 3N34A 5G5IA 3HG5A 5D05A 1XCFA 4OGZA 2V30A 3M5ZA 4UNLA 2XN1A 1FXPA 1KM4A 1QOPA 1XKYA 3TH6A 3OVQA 2AAMA 3MHFA 4DPPA 3NPVA 1SW7A 2NZLA 1G7UA 3NYZA 1IF2A 3MO7A 4O50A 3FLUA 3W7GA 2DZVA 2RHGA 4XZ9A 4JGDA 2A85A 2R94A 4PA8A 3MYOA 2PE4A 3W7MA 1QAPA 1OFOA 4K38A 2H90A 1OVDA 3DGRA 4MLRA 1OHLA 4MY1A 1JVNA 5FF3A 4PL1A 3THQA 2J9ZA 2JBMA 2B7QA 3C2VA 1S5WA 3HPSA 1F73A 1TTJA 3GNNA 2OT1A 2JK2A 1BTMA 4UTMA 4O53A 4AAJA 3QSRA 3B05A 1KM3A 5T26A 4POCA 3LLDA 2WNQA 1W3IA 3KRUA 5A5WA 1KFBA 5LSMA 3FKKA 1PIIA 5U4NA 2JKAA 3TU9A 1ME7A 5HJLA 3WJYA 2BXVA 3W1PA 2JKEA 4HPJA 4LS2A 2B7NA 4UMCA 3S1UA 2ATSA 4IWWA 4AMAA 3O6CA 2V9DA 1X6UA 4XKYA 1I2RA 4P61A 4QQ3A 1RD5A 2J9YA 1JRBA 3S6DA 3LXCA 4XTIA 4JDYA 4Q4KA 5EL1A 3G0UA 4A3UA 2QR6A 3L5MA 4FNTA 4IGHA 4N4PA 4ADTA 1J5TA 3NDOA 3W1TA 2E5DA 4FIQA 2QCEA 2HS8A 5AHNA 3CEPA 4AVFA 2EGZA 5BOOA 3O1NA 1RV8A 4TMCA 4DF0A 1TIMA 1BEUA 1UJPA 4CCEA 3NM1A 3PULA 4O0ZA 2OCZA 3SECA 4UIOA 3CIXA 2C18A 5EKYA 1FDJA 1A5AA 4FO4A
chains in the Genus database with same CATH superfamily
1FQ0A 4E2BA 3LI1A 1V0LA 1RY0A 2IPGA 3NA8A 4F0KA 2YXOA 1VCGA 3VD4A 2D22A 3MCNA 3ZVIA 3UJEA 1RQEA 3BAIA 4XD3A 3FEMA 4JTTA 5F4XA 1FHVA 5CZKA 2NX9A 3PBYA 3BUVA 3TLQA 1NDZA 3SCUA 1JZ8A 5A3HA 1SUXA 3CHCA 3C0JA 3SRFA 1L0PA 4DZAA 2QCCA 2DDXA 3L0GA 4P7LA 2F7FA 4L61A 1JXJA 1JF6A 4JFVA 3M6YA 4BFAA 2X09A 3UWYA 3LNMA 3ARRA 5DFAA 3APTA 4AY8A 1WNOA 2P0OA 5DMNA 4NKCA 5D33A 2D0FA 2GUUA 1U83A 1QWGA 3U3HA 4DIAA 3W83A 4JHOA 1I2PA 1LQ0A 3GG0A 3UCQA 5DELA 1JL8A 3UZXA 3UG3A 2QMJA 4HNOA 4KT2A 4LUSB 1LORA 2Y8UA 2Z1XA 3AYSA 4O11A 1ECEA 3W1AA 3SQMA 1E6SM 3TW6A 1EF3A 1QPQA 4KWSA 4IPNB 1EHAA 1RJRA 4LYKA 1YMYA 3Q45A 4YVPA 1O5XA 4J3XA 3W1RA 4GYJA 2CCRA 3Q58A 3ITXA 5C8BB 3KOYA 2G4FA 4UOQA 5TIMA 5IOBA 4UFMA 1RPKA 3EOLA 3BOXA 1LG2A 3MSRA 3NVTA 4G8TA 1KKRA 2OU4A 4O17A 3AU2A 3QHNA 5KSWA 3UPBA 4CD7A 5FF2A 1CLXA 1GJPA 5KINA 2FPTA 3IK4A 3W1UA 4FLOA 1FH8A 4W5ZA 3CMJA 2G8ZA 2YSWA 3I3BA 3TN6A 3R79A 2ZRWA 3AYTA 3S5ZA 4V2XA 1B31A 1WX0A 4B5UA 3QKZA 1K8ZA 4PH6A 4AB4A 4K3ZA 2WZMA 1GZGA 2OODA 1GKQA 5CZJA 3W23A 5AY7A 4UNIA 4XUGA 1S46A 2WB5A 5HATA 4AMCA 1H50A 2GVGA 1SGJA 3CGTA 2A5HA 1VFSA 1XI3A 3KS6A 3P5ZA 1R9YA 2O56A 1J6OA 4UCGA 3TYEA 3W1LA 3C8FA 3CAWA 4KCVA 5D4YA 4FS9A 2J4GA 3NZQA 4AVOA 1VBUA 1VRDA 4I5UA 4EE9A 1OX5A 4HMEA 4CD8A 1OFQA 3N14A 2H8XA 5F1UA 1OD0A 4F0MA 3QGAC 5I5RA 3I7SA 2VQUA 1F05A 3QOMA 4RKAA 4BR1A 1R3RA 1BHGA 1ONEA 3CUJA 2DH2A 1JZ7A 3M5YA 2Q8XA 3N19B 1ZZMA 3VIFA 2ZUVA 4FX6M 1C8YA 4ORIA 3M43A 5B7ZA 1IV8A 4BQ3A 1LL4A 4JIPA 3NZ1A 1R86A 4H8VA 2E28A 6XIMA 2P1FA 1CGYA 3WDHA 1YTDA 2V67A 1TPUA 4XQ6A 3TWAA 3BO9A 1XV8A 3EGJA 2GSJA 1CX9A 1K4GA 3LQGA 3R1ZA 2RJHA 4FXRA 2ZUTA 1W5PA 2PGEA 4GX9A 3H4XA 1SJBA 2IPFA 2JIWA 5D8ZA 1NTHA 2A3LA 3F4WA 3BQ6A 3TYCA 3R8RA 1OB0A 1N8IA 1P7TA 3M16A 4W7VA 4GY1A 2VFGA 1W31A 1RAKA 3SQLA 2A7PA 2V6AA 1QR7A 4UQAA 4UR7A 3FEQA 5LNSA 3LHWA 2ZWYA 3PTDA 1QOQA 5CG0A 4KIEA 3W1MA 3IIXA 4KWWA 3TWBA 4GIRA 1DTNA 2H3BA 3LUTA 3AZRA 2Z6JA 5CBBA 2G3MA 2YYUA 2FGLA 1SU5A 4NZ3A 4PFMA 3R8HA 3GYEA 2FH8A 1VRXA 2BV9A 3OB8A 4IT1A 2ZDSA 3SEPA 5F7UA 2INFA 2BXZA 1SSGA 4FF7A 4HSHA 6TAAA 3UCDA 3WG6A 1ZPTA 3A24A 4XO6A 4W89A 3WH6A 1AA1B 5D9MA 5HBFA 1ZBCA 4WXYA 4NAEA 3W53A 1NIUA 4CVWA 4M1BA 1PJ9A 1FOBA 2VT0A 1A3WA 5T91A 5C6MA 1PZ3A 3C0LA 2FJUB 2JEPA 4LCQA 4PCPA 3KS5A 4Q8QA 4MWAD 5ABEA 4Q4OA 1QI5A 2YCJA 4PCTA 3GVQA 1CCWB 1XIMA 5TD4A 2DZXA 4XD5A 2J7FA 4DO4A 1BYAA 4M3PA 1NSJA 2WWDA 4BF7A 1JCYA 4IPPA 2REQB 1GQJA 1TPB1 1BVNP 4XISA 3O8AA 4IFKA 3S42A 1WZMA 4E8CA 1NAL1 1QVBA 2QJGA 2ZRUA 4C6EA 3BG9A 4CCDA 2PRMA 3L2LA 4ZXLA 3S2LA 3SSJA 3OW1A 3BOLA 3JR2A 4GNKB 1HKIA 5DF0A 4Q8MA 1JCTA 3L4TA 1GPFA 2C16A 2D24A 4MG4A 5JUVA 1IEVA 2JQXA 1E0TA 2D2GA 5CKSA 1XLJA 1IGWA 2AGKA 2Z28A 3HGJA 1S2UA 1RHCA 1EYWA 2PD9A 2DIJA 3WDJA 4HU4A 3NTYA 2ZADA 1AH3A 4WOQA 3RIKA 4MWAC 4H3DA 1TWZA 2DT1A 4RDWA 2DJXA 1IHIA 4W5UA 2DP3A 5G4EA 4ZFMA 4K8GA 2AL1A 1E71M 3WBYA 3O6AA 3E0FA 1XIGA 1EP3A 3BJSA 2HTMA 4YXGA 4WVXA 1PKMA 1PZ1A 3VDCA 1Z3NA 2YLAA 3HGRA 4B16A 5LNUA 4GUFA 3UVIA 3N11A 2OSYA 2WSQA 1ELSA 2HS6A 5GNZA 3SCOA 4TMBA 2OB3A 3DFOA 1GVEA 4G6CA 3SN4A 3HMJG 1LF1A 1ZAHA 2E5CA 1WKEA 4NJGA 1VFOA 4OT7A 2IUZA 2PF0A 5AYBA 1K03A 3LY0A 3T4WA 4QFUA 1HQTA 1B3OA 1GPWA 1OZQA 2BWGA 4AXNA 1TMLA 2DFAA 2NQJA 2QJIA 2G50A 1DTUA 1JZ6A 3Q2DA 2FKPA 4OECA 5BWFA 1CWYA 3VGFA 4XWUA 1XD1A 4A05A 4IFRA 2XIIA 4DZIA 2CZVA 3MDWA 2TAAA 1ALDA 2YDRA 3NYDA 3YPIA 1K1DA 1S38A 1EC7A 2DW7A 3RU6A 4G1KA 1TVPA 2ISWA 2BHUA 2VHLA 1KR0A 2DQXA 3H2OA 3OA3A 1Q7MA 4RZBA 3MWCA 5I3KA 2G95A 3D47A 1KFEA 1AK5A 1V6UA 3AUJA 2GVLA 3PN8A 1GG0A 4WCJA 2WSKA 1N82A 2Y8VA 3LK6A 3E3HA 2B0MA 2A0NA 4KETA 2OLAA 5FF7A 3R58A 1TPWA 2OWWA 5DANA 1RVKA 4AZ5A 3G1VA 2WVUA 2A3AA 2WMIA 1BGGA 3WLOA 2AQVA 2XVPA 4W7UA 3FJ6A 4WIWA 3IJQA 1RBOB 4Q4PA 4ZB0A 1FWFC 4P8UA 3E1F1 1ZNNA 5AYIA 1GZ1A 2ZC8A 4L4OA 2GOKA 1V3JA 4I9MA 4JQAA 1BLIA 4S3BA 4PUDA 1R8LA 1WOBA 4OUEA 1BG4A 4HT3A 4J1OA 3KL3A 1RVGA 5JIPA 3PWGA 4DXKA 1SFTA 4IIDA 1V02A 3CWNA 2YFOA 5CPOA 4NG3A 3MCOA 5KZEA 1ZBVA 1GVRA 2SFPA 3AYVA 3OBEA 3N3TA 2BOGX 2L5HA 1DXFA 3CHEA 3N15A 2HZGA 1K6AA 3H55A 2VCCA 1GKRA 2X1RA 1W37A 3DG6A 4C90A 7A3HA 3FDGA 4L6OA 1FWNA 1UH2A 4XKYB 2DSWA 1XFBA 1EXBA 4PMXA 2XIQA 1BAGA 4QNWA 1Q66A 4QAWA 1V3MA 2CZ5A 2AOSA 4ZMGA 3UY8A 3A12A 1ML1A 3WDRA 2QAFA 3MA8A 4GE8A 1M6JA 1W6TA 2X1IA 2Y7FA 5G1YA 3WJWA 4LYRA 1K7EA 1XCXA 2UY5A 4EKJA 1U33A 4GNVA 3M1ZA 3C3NA 1OT1A 2HE5A 1H09A 5K4XA 1IGSA 4JNMA 1WXYA 1TTPA 4KRTA 3OGVA 5DMYA 1M1BA 7TAAA 1JGMA 3H24A 4LEQA 4X61A 1NELA 1MNSA 4W93A 3PJUA 1GQKA 8CGTA 1MW3A 3L7RA 1LYXA 2Y4SA 3RCYA 1GVFA 2BTMA 4XZBA 1ZALA 3RLGA 3PR2A 3CQIA 2VYOA 1EUAA 3EWZA 1ADSA 1VENA 1Y65A 5F2IA 2FLIA 4F4RA 3QFWA 1QBAA 1QNOA 4K37A 3BAYA 5KEZA 4LXFA 3E5PA 4P5UA 3LTYA 4U5IA 3T6CA 2BDQA 2V0TA 2V38A 2D0GA 3VZYA 1J5SA 2J27A 1A5LC 1FWRA 4O57A 1FCBA 2UY3A 1R87A 3L4VA 3QKEA 4N6EA 2NT1A 4AZCA 2A2IA 2Z2AA 1UWRA 4UQCA 3WMBA 4MWAE 3S46A 1G1YA 1A4MA 2NUWA 3SCNA 1UWUA 3AROA 3BMWA 4L6HA 3CUIA 3NPWA 4IUGA 4F79A 3PSVA 4MM1A 2KAUC 3CT7A 2OQLA 2WCAA 3WUEA 3LMZA 1W17A 3VD5A 2Y0FA 3MI2A 2TSYA 1X6NA 1CW2A 4BWLA 1JNDA 2E5BA 3KAOA 2OQYA 3SN0A 4IUOA 3U0HA 4JQ2A 1OX4A 1R3TA 5KZDA 3PG8A 1UWTA 1GOKA 1A5NC 3QBUA 1JUEA 5I3GA 1H0IA 2QW5A 5HMSA 4M5PA 4M0XA 5MKGA 3ZWSA 3GTHA 4ZO6A 3TFCA 3FS2A 3Q37A 3KLLA 5C2XA 2VDGA 1ZQ5A 3IAPA 4MFDA 2QCGA 4RE2A 1HXJA 2CLMA 4HZ6A 1D8WA 4HZ8A 1LWJA 2J9XA 1DJYA 4M29A 3N4AA 2QCDA 5JBFA 3RFAA 1TPC1 1LRQA 5BROA 3D5HA 1JNEA 2D73A 1TZZA 3FIGA 5AC7A 3S1WA 3BLIA 1Y0EA 3OP2A 3W22A 4W84A 2NVAA 3WF4A 3A5FA 5H6HA 2PA6A 1KV5A 3ZSTA 1CZ1A 5E6YA 2PMQA 4QROA 1OC5A 2YB1A 3HB9A 2POTA 1BFNA 2BY0A 4S23A 4MADA 4FPSA 4QCEA 4H8NA 3SY1A 2OKTA 1CNVA 4WJ8A 1TMHA 3ITOA 2Z27A 2CZFA 1M7JA 4X22A 3UA3A 4CQAA 2DSKA 4E4PA 1EL3A 5FJTA 1S2VA 6ALDA 1JCNA 3NDZA 4IJCA 3B03A 2AQWA 4F0HA 1FP8A 1V51A 4JKKA 1RCOB 2VFHA 4CU8A 1XIHA 4NRSA 3LGEA 4KEZA 1JDDA 1E0VA 1QO2A 1V8EA 4Z1YA 3TCEA 1JUBA 3ZLGA 4R27A 4B4HA 1BWVA 1B1YA 2G97A 4K1GA 3HQPA 3AZSA 4GJ1A 2EPLX 4QP0A 2OZ0A 4AD4A 1AFSA 1I0DA 1FH9A 2F2HA 1KRCC 1LJYA 1DWGM 4H00A 2QGHA 3RLUA 1F61A 1TSIA 5IHRA 2QDDA 4C1NB 1BRLB 2QEZA 4A8NA 1ISXA 2I14A 1W3KA 1BYCA 1QK2A 1G01A 1YQ2A 4OZOA 4LQ1A 1IZKA 1GVQA 4NAFA 1LWIA 3TYZA 5GVJA 1D8CA 1EOKA 3P0XA 3WQGA 2QDHA 4YTTA 3AOFA 3GAYA 1B9BA 2PB1A 1JCJA 3GH5A 1V3HA 1PTGA 2QIIA 3GDLA 3GNDA 2TYSA 3ABQA 2VFEA 1I2OA 3EAUA 2B4GA 5D02A 5HQEA 2VX4A 3P0WA 3SGZA 3MVIA 3M0YA 2XG9A 3HO8A 4G2DA 3BW4A 1BPLB 4LC6A 1P0DA 4LUTA 1NDYA 1XG4A 2BHZA 5CJMA 2NUXA 2WO5A 4PMDA 3N2CA 3DFQA 4LS1A 3TQ0A 2QF8A 1ICSA 4JTUA 1AQHA 1UP3A 1WDRA 1PHQA 1W1ZA 2PWDA 2ABAA 3L65A 1ICQA 1IXOA 4XK2A 3GFYA 2WC4A 4C6NA 1MI3A 1GOWA 2ZRZA 4LJ3A 3R6IA 1FWJC 3W25A 3C2RA 2ZRYA 1CI1A 4NX0A 3RX3A 3VVGA 4E2OA 1PBGA 4JDBA 3QV6A 1LG1A 3MCMA 1D7FA 3O0FA 3MMUA 3GSMA 4R85A 2WSYA 4N9DA 2VC6A 2Y2WA 4E4UA 4H2HA 2IXVA 3IUIA 4IQEA 5ABFB 4V1YA 1T96A 2AGTA 3HV9A 1DQUA 2RDWA 1D7KA 5LZLA 4J3UA 4K8HA 3HU7A 1XC6A 5C9ZA 3EX6A 2EG8A 3TR2A 3M0IA 3W70A 1OEPA 3R43A 1HKJA 4QLJA 4S3JA 2CLLA 3T08A 2RKXA 1M01A 2WHMA 4E2VA 4O1DA 2ZXDA 3VK5A 2GGHA 4S3AA 4LY4A 2YZRA 3QHOA 1WZLA 3WNLA 2WKLA 4IICA 3VOFA 3GC2A 1VPQA 3VE9A 3DH7A 4HCLA 3VDAA 4QCFA 1E1FA 2A3EA 3GUWA 3O16A 3DIPA 2CLKA 1VGAA 4O1BA 3WLRA 2G3IA 3S9YA 1XBXA 1KCZA 4ACYA 3M0VA 4GY0A 5SWUA 3MV01 5AHLA 4C6QA 1V4YA 2Z7KA 1XRVA 1EHNA 4HNLA 1KBKA 2V5JA 4Z42C 1K9TA 1E6RA 3BTNA 2XIMA 2DY3A 5LXXA 2GJRA 1LTDA 3AI0A 3V75A 4CD6A 5LIXX 5HJXA 2B31A 3GDKA 1CB2A 1V0KA 4IP4A 2DUZA 5IXEA 1R0MA 1P0KA 3TZNA 2PGFA 2C13A 3HGOA 3LB0A 2WC3A 3NL2A 3A3HA 5CLTA 3W71A 3NDYA 2AQOA 1POKA 2Y85A 1GQIA 5BXSA 5FI8A 2HQAA 2PZ0A 1PXGA 2WVVB 2Z2BA 4HBKA 4PUWA 1DYSA 4ONVA 3WQVA 4BCEA 1TVNA 4HMCA 2Z25A 3B06A 5A94A 4Q6XA 3B8WA 3MI3A 4B92A 4HP5A 3BSHA 3T44A 1KLYA 4PRWA 4DYJA 2FVKA 3N6JA 3MP4A 4C6OA 3THDA 4L4MA 2HVOA 2QNEA 1L8PA 3QY7A 3WQDA 4L4LA 5MHBA 3S9ZA 5BWAA 1B9ZA 4JTFA 1UOKA 3CLMA 3AHTA 3EA2A 3VMOA 2OXNA 3MW7A 4J3WA 3AALA 3COTA 3PM6A 2VGFA 3PUDA 2OJPA 3CTLA 4WF7A 5BMXA 4ZBCA 1OBAA 1XH2A 1J0YA 4IIEA 1J12A 5D09A 3H26A 3H2NA 3KBSA 3PWAA 3V1HA 1WA3A 2X7VA 2FJKA 5TF0A 3PB0A 3L9CA 2DSVA 4QSHA 1FKWA 4HA3A 1O95A 3D3AA 1H2JA 3WH7A 3MS8A 1DJGA 4L5ZA 4Q8UA 2OKOA 3NQDA 4U10A 2J8GA 3FA3A 4L56A 4MNKA 5I06A 1K3UA 3EA3A 2KX9A 3VMPA 1KBJA 4IHCA 4JX4A 4EPDC 2P10A 2VFDA 3KXQA 2FVMA 4FXFA 1MEIA 3NQGA 1UUMA 4BWLC 2PU1A 2E6DA 1VFTA 4F40A 4ZB2A 2NV2A 4PTWA 2GVJA 5JU6A 3S2NA 3TJXA 1R46A 1TELA 2XFWA 2FPYA 3WNKA 3CZ8A 3IEBA 3E0LA 1KO0A 2DQWA 2ZX6A 7ODCA 3IS4A 1SZNA 1UZHA 1LWHA 3E6EA 4PL2A 4E6MA 1XGDA 4OV4A 1NOWA 2EEXA 2R1NA 4GC4A 3EXSA 4X2RA 1P6CA 5FACA 5B7YA 4XAFA 4IJRA 3SCTA 1O94A 3EOUA 4MB3A 3MUXA 3S1VA 4B5NA 1B4KA 2FHFA 1MRAA 2J25A 2PWFA 2OTDA 3FK4A 5G2IA 5EMMA 5D04C 2E25A 3AMCA 4E5TA 4M7SA 3C6CA 3SCVA 4NI3A 1IYXA 3VD7A 1H5VA 4ACZB 1JI2A 4HPNA 4KH2A 4Z1CA 3QPYA 1HX0A 1NU5A 1Y5WA 4LANA 1LCOA 2GJXB 2BGQA 3LHVA 4HMNA 1NWTA 3G3DA 1SM9A 3KTSA 4QAIA 1Q6CA 2CLOA 2PBGA 2OSWA 3FAXA 3M41A 2VKZG 3NO1A 2E4TA 3URBA 1MEHA 3GS6A 4XZLX 3BICA 3REQB 4O52A 1G7VA 2WLYA 5D38A 1XICA 4H2CA 2C8NA 3LBOA 1XFCA 2QCNA 4DX3A 1BD0A 4HJWA 1AJZA 5AYZA 1I2QA 3W7CA 1UKTA 3WQPA 3WH5A 3ENLA 7REQB 3OGSA 5IDZA 5D9OA 2WNNA 3NNTA 4AZ7A 1UZ4A 4KEUA 3XISA 3DFNA 1H5YA 1CLVA 2PWHA 1VJSA 3EWXA 3GTFA 2FFIA 2WK2A 2GDQA 1K77A 3W6LA 1O1HA 1V02E 1IT8A 3N2TA 3BCFA 4LBUA 3UA4A 1UBPC 1ADOA 2G37A 2WXDM 1E43A 1NQ6A 2ZZ2A 3OZMA 1SFSA 1NFBA 3EBVA 4A8RA 2V63A 3CL6A 1A5UA 2YKKA 5CPLA 3ZMRA 1H7OA 3WQ5A 1CGWA 3IGHX 4GUGA 3W1QA 4DO6A 4XAPA 3K4AA 4XB3A 4EK7A 4MSSA 2HXTA 2V5DA 5AFDA 3SZ8A 4C6LA 3UZ5A 3DKJA 3QQ1A 4Z2IA 2QPSA 3RCNA 1R38A 1BYBA 1XLBA 4WK9A 3STEA 5C9WA 2WM1A 3ARWA 1W3TA 4RJEA 2FMOA 4BKNA 2ZBTA 1WBHA 3UPMA 4H6EA 1R3QA 1TWDA 1CENA 1PX3A 2V5CA 5AN7A 1FUYA 1LL6A 1MDLA 5TBOA 1TJPA 3GNXA 3RDKA 2CHNA 1MQPA 4YTQA 2W61A 2XJ7A 5A6LA 6CGTA 3VNMA 4OBTA 1G4TA 3CPRA 1OYCA 3S2JA 2JGQA 4GVHA 1KM1A 4LVFA 2VGIA 4M24A 3VM7A 3GNRA 3AXMA 4RR4A 2V3DA 3A23A 3MJYA 3BDKA 1L2UA 3O15A 4AWEA 4IP7A 3HPZA 4DXXA 3V3WA 1T41A 4LU0A 4R9OA 4XBSA 3GFXA 2E9LA 3KZPA 3ORWA 1TFVA 3TZFA 4W87A 2HK1A 4GFIA 4Z2JA 4U5KA 4PCNA 3CO8A 1CIUA 1X1NA 1W32A 1GKPA 1XCFA 1E55A 1EXPA 4IH3A 2I5QA 4UNLA 3PTKA 2XZ9A 1F8MA 1KM4A 3LA4A 4AEEA 3K8KA 1EGVA 4QEEA 4E4FA 3OOQA 2VWTA 1SW7A 1E15A 5XIAA 1Z9AA 1T8QA 3NYZA 4GH3A 4O50A 1PX4A 1VFUA 4C6JA 4JGDA 2OEMA 4KPLA 3VKAA 4PA8A 2CITA 2YIHA 1OVDA 3KBJA 1A0DA 3AWOA 4MLRA 2WM0A 2YA0A 1OHLA 3R11A 3R7MA 2JBMA 2B7QA 3C2VA 1W2PA 3KL5A 1VEPA 2JK2A 1U5HA 2BHYA 4UR9A 1JEZA 3ARYA 2XFYA 1SMAA 3WBXA 1W3IA 3AU6A 3KRUA 3W81A 2OX4A 1PIIA 4DAFA 4TXEA 4AD5A 1ME7A 1TG7A 2FZBA 4NL1A 2JKEA 4U2YA 4HPJA 3BMVA 4AISA 4IWWA 4J3TA 3O6CA 5C2GA 2V9DA 1X6UA 4XKYA 1I2RA 2E0PA 3OVGA 3ZQ9A 3UG5A 1RD5A 2ZX5A 2PPGA 4GY7A 4IGHA 3UR7A 4XO7A 1K9FA 2E5DA 4FIQA 1TX2A 1PWLA 3MPGA 3GXMA 3U2EA 2EGZA 3DFYA 5BOOA 4NZ1A 4LAMA 1UD5A 3ARUA 3N9KA 1WUEA 4H7VA 3WY1A 1QWKA 1BEUA 3NM1A 1TCMA 3CIXA 3TYDA 3L4XA 2C18A 1QATA 1E9IA 1E4LA 2BNJA 1CDGA 3MB9A 4MIMA 3EOOA 3SY8A 2RH9A 1OGSA 3OLEA 4OBSA 1YXYA 4JIIX 3S5YA 3MUIA 2Q3OA 4GG9A 4EPEC 3GQYA 4IGSA 4F2TA 2PBOA 1E9ZB 4UNKA 4MWAB 5M2FX 3C4UA 3C2EA 4W4QA 3WLPA 5JXQA 2PTWA 2QVHA 3CQKA 1JULA 1AW1A 3EX1A 2JGYA 3GVWA 3PK7A 1P6WA 2G5WA 4YVVA 1W91A 2X2YA 3SDOA 3WJXA 2G4JA 2QULA 2D20A 3VNZA 1S3HA 3N1AA 3P3BA 4KRZA 3WLIA 1XQLA 5LHFA 3FOKA 2R9RA 2YZ5A 3WUBA 1GG1A 2VD8A 3FNDA 1W8GA 4PB4A 1Q13A 4YYFA 3KLKA 4M6VA 2NLYA 3LGGA 4HNTA 3UY7A 4MB4A 3L4YA 1XIBA 3PJXA 4JFWA 1RK5A 2HJPA 3HZ3A 5A6KA 2QQ6A 3OG2A 4FOUA 4DHGA 3WJZA 2XDFA 4BF5A 1YW1A 4DUXA 5RUBA 3N9SA 3I4EA 3QVQA 2J7GA 4A3YA 1ZS2A 1UUOA 2A7NA 3R12A 3GHSA 3AS2A 3PP7A 1TA3B 3IUHA 1YPIA 2Z1VA 3W28A 3F5KA 1OSEA 1GVSA 1O4UA 3K4DA 3TSDA 4GMEA 4JY8A 5K9XA 5E0CA 1AH4A 4K36A 5A8NA 3W2JA 3T8LA 4PFHA 4AIOA 4LW7A 3HQ1A 3FVDA 3I68A 3D6NA 3S5SA 3VX1A 3RU8X 1XSKA 1ZY9A 4H7CA 3L0NA 3VGBA 2P88A 3VI2A 2HE8A 4KFOA 1MXSA 1S2CA 5DY3A 1ADDA 4A29A 1FHDA 4CNUA 5HAOA 4RNFA 1FWSA 1EDTA 2E1WA 3ABXA 1LBMA 2GL5A 2JF7A 2NQHA 1M7OA 4NJKA 3W26A 3IGUA 3ONBA 1FWWA 2D69A 3E5BA 4JS3A 4QEHA 1KWKA 4JTRA 4ZB5A 4MMWA 4E3TA 2CETA 4A6GA 4ICCX 2J77A 2OSXA 1UJQA 3MSDA 1WCGA 2G3NA 5HPCA 2VM8A 2VXNA 4G5DA 1BXBA 4TVCA 1YXCA 1TUXA 2PDCA 3FCPA 3KTXA 3AJXA 3I3DA 3M0JA 3QLLA 3CZKA 4KWVA 5H8PA 4Q6JA 3QC0A 4DM2A 5D9PA 3INPA 9XIAA 2CIPA 4XBJA 1YE4A 4Q8VA 4ATLA 1JPDX 2IS7A 1E1CB 5U7SA 4LWWA 3W7IA 3CC1A 4RW3A 4HZMA 5LA1A 1EJTC 1UWSA 1W1TA 3B8VA 1GOOA 1VPXA 4H8UA 4O13A 3CEUA 4QGCA 5LA0A 3W7KA 3VDBA 1TPVA 2WSRA 3VINA 3U48A 4NILA 3WQ8A 3CV1A 1THFD 2PRLA 1A53A 1MEWA 4DPQA 2ZIDA 4I9JA 2FGBA 4Y96A 3AHXA 4C5ZA 4RDVA 2CWNA 3W2LA 3GKFA 4GWEA 4GI9A 4YLWA 3OQEA 3W1XA 1IEXA 4YJ5A 1FP9A 4XAYA 5JH2A 1XHGA 3NQBA 4O0QA 4X0VA 3WLTA 3TVAA 4EPBC 3GHUA 3W82A 3GDTA 1Z41A 4KS0A 4FZIA 4JYFA 4ZL1A 3CUFA 4BQ4A 4OOUA 1I45A 3PZIA 5BU9A 1JRCA 1VKFA 2O55A 1BRLA 3EXTA 5E5CA 1UZ1A 1ME8A 4PN2A 1W0MA 4UFLA 2O92A 2ZICA 1M53A 3POCA 3GUGA 1MWOA 2FZMA 1EIXA 2WV8A 3I4KA 1EIBA 3GDMA 3TXZA 4UZUA 3KOWA 3UWWA 3SCPA 4HA0A 1AQFA 3DHPA 4LT9A 3D46A 4FLSA 1MZHA 4FB7A 1W1YA 3WBAA 3AZTA 3ZLHA 3ES8A 1Q7ZA 2ACQA 2RDTA 2QIWA 1HKMA 5TQLA 3VIIA 4M56A 2GDVA 1CGXA 5FF4A 1V0NA 1EB3A 3MUY1 4ERIA 6XIAA 2PDYA 3V7PA 2QVNA 2IQDA 1QPNA 1ZJAA 3O07A 3FVMA 5LKYA 1DVJA 4KFPA 5FOOA 2YB4A 1DIDA 1SVDA 3VKCA 1DHKA 2BVYA 3O2LA 3N04A 5DO8A 3OYZA 2NUYA 2WZTA 2X0SA 4IGNA 3W0KA 4CQCA 1F6YA 2GGEA 4PCSA 1XYFA 2YCLB 4LRSA 1S5VA 1KCXA 3CBWA 2ZZ6A 1NP2A 5ABFA 1WB0A 2P53A 3HPXA 1YNPA 2WVSA 2Y6ZA 3GU2A 5CEWA 1BG9A 4D6DA 2WMFA 4JY9A 4W85A 2O9OA 2DH3A 1W3LA 3HG2A 1FTXA 3R10A 1EGMA 2I7GA 1X98A 1CGUA 1Q3NA 2CWXA 3GM8A 3N4EA 1NFGA 1M04A 4ZE4A 1JJKA 1E56A 1ZLPA 4WKHA 3TJLA 4JNZA 3SAZA 1EPXA 5HWMA 4RNIA 5H91A 3W2NA 1C8VA 3M0HA 3IJLA 4I5XA 3FFSA 3UXDA 3POHA 5A6BA 2WCGA 5DBUA 5FJIA 1IWAA 5LIYX 2ZUWA 4Z08A 4DWSA 3G1SA 1S2AA 3PFMA 3U6WA 3A64A 1QNRA 1JGIA 2F61A 1I4NA 2Y61A 3R5EA 3VIMA 4B5XA 1UD8A 1HF6A 3DECA 3I7QA 3NQEA 3R8GA 4PRRA 3QSTA 1SO5A 3H4WA 4J4KA 2O4QA 1JR1A 2I56A 1XR2A 3OLDA 4LVGA 3PUEA 1UA3A 1HZYA 3GO2A 4NZFA 2PDBA 1KXTA 1MUWA 5GJPA 3QGVA 4LPCA 3C2YA 5D2VA 1XJBA 3OYXA 3MBFA 1B4EA 1NY1A 4MUPA 4W8BA 3VO0A 5DT7A 4JEQA 4D8AA 3GZAA 2GPTA 3ID7A 3HV8A 4DBSA 3W4RA 1KFCA 4Q8TA 1GEHA 1YKWA 2O7QA 3MV11 2Y5JA 3FKRA 5EMYA 2YW3A 3F4CA 3WLJA 3ITVA 3T0DA 4U4MA 1ITCA 3WNPA 3UNDA 2FHBA 3CH0A 3VDGA 3DKLA 9XIMA 2GVYA 3PTQA 3SN1A 1V93A 2I9UA 2J24A 3W29A 3DDMA 4F9DA 5J8LA 1KA9F 2BGNE 5BRQA 4M1RA 4GI6A 1EWDA 2WVVA 1ZGDA 3PFRA 4PUMA 5BYWA 3ZSSA 1VF8A 3FY1A 2BB0A 1E1EA 2BX7A 5CSRA 2NWRA 3C3UA 4YU1A 4AHQA 3ZS4A 4RX0A 2V82A 1WKDA 3FJNA 5AC6A 4RE4A 1EFZA 2EHHA 2OLSA 1ZP3A 3APYA 4UR8A 3H53A 2BZNA 1J9YA 2WMGA 2Z2UA 4QDPA 1VQTA 4MZ8A 2Q71A 4MJ2A 2OVLA 5HOSA 2WZHA 2ANUA 4ZOEA 1TMQA 2ZYFA 1SW3A 3U4FA 3OLIA 5A2AA 4H9XA 3W07A 1XLCA 1Q6RA 4GQ0A 2C3ZA 2HBVA 3W73A 3LTPA 2GQ8A 4B9YA 3RITA 2QGYA 4BI6A 4JL2A 3ZO9A 4F48A 3QQ0A 1VYPX 2WJEA 1G4SA 1J18A 2NVDA 3N29A 2O9TA 3MY9A 4IMEA 1L6SA 5C70A 3SUSA 1XIEA 4L1WA 1EZWA 2R6OA 3FDKA 2YXXA 4PB5A 1QHOA 4HIBA 4S1FA 4UWMA 3RJXA 4JHZA 1ONRA 2ZTKA 1ITQA 3WMSA 3SW6A 2ADAA 4LALA 4GZIA 4DJEA 2YCIX 2JALA 2YL5A 4IM4A 3L68A 4XTDA 4Q4RA 4GISA 4JPGA 1OCNA 2QJNA 4ZXOA 4J3ZA 5A8MA 1VIZA 3E0WA 1KV8A 1AW2A 3P8JA 3DI1A 1JIBA 2KZHA 1JZ4A 2V2CA 3G1DA 5AHMA 2PDNA 2XIBA 4IIBA 1RCQA 1HNYA 2WHJA 4HHMA 2X2GA 1GVYA 2J47A 1TV2A 2IXUA 1PL9A 4OKDA 4ZCWA 1J6PA 3W7PA 4ZQOA 4B5WA 2ZVRA 3PBUA 1JAEA 4FXJA 3STPA 1EWEA 2A3BA 3M0LA 4LBRA 3VE7A 4HMDA 1TE6A 3HG4A 3WIJA 1AODA 5EMKA 1O5QA 2Z24A 2WMIB 1RPXA 3UZWA 4QRNA 4PR4A 4ACZA 1Q7QA 1R2SA 2C0AA 3HN3A 1VHNA 1EKOA 2B7PA 3PB2A 2GJXA 3NZRA 2ISDA 3DHUA 1NOUA 4XV0A 5HNRA 3MKCA 1H7WA 3NZPA 4Y7EA 5LGZA 3BLKA 3PJWA 4HYRA 4DBDA 1VH7A 1VS1A 1LOQA 2XISA 3WLHA 3AXIA 4RDZA 4C65A 2XHYA 3GD6A 4HOXA 5HINA 3VUPA 2HPIA 3TV8A 4WGXA 5FD0A 1QFEA 4JD4A 3WUGA 3F03K 2D2OA 7REQA 4LX4A 3U7VA 2E40A 3DOPA 4GVFA 4MDPA 4QS5A 4Z17A 2NXGA 4DNMA 2GQAA 4XD6A 5DN1A 3WK3A 3WEZA 5ABTA 5AECA 3VKKA 4MPQA 4MKVA 1YTKA 4AX7A 4GVIA 4D6GA 4Z1DA 1E6QM 3RUBL 7ENLA 3O6YX 4JKMA 5REQA 3UJFA 3H6OA 3N2OA 3NGJA 3G3MA 5CGQA 1HIZA 5C5YA 5E93A 4CGTA 2FH6A 2INZA 4CUCA 3BV4A 3G5EA 3E12A 3WQ4A 3ZXWA 5ECVA 3I65A 4UCFA 3DGBA 5A6TC 5AHIA 4HK7A 4MPKA 1P5BA 2PSNA 3EX4A 4KKXA 1H41A 4N6FA 3N3MA 1DE5A 3STCA 3G6LA 1QASA 4WLCA 3SIMA 5AZ1A 1HL9A 3VM5A 1ITXA 4IJBA 4CU6A 4WDUA 2G3JA 1IWPA 1KRMA 1WE5A 5A95A 1MXDA 4N9BA 1JD9A 4NUWA 4ZFCA 2P76A 5CC7A 3VMNA 3M7WA 3BLEA 2NW0A 1EDGA 1XG3A 1UIPA 4M82A 4MAZA 4RCXA 1RH9A 8RUCA 4A35A 2NQ5A 2Y5EA 1XLMA 1FWEC 3HF3A 5C54A 5A6BD 1KGXA 2PDXA 1IXPA 4CNTA 2VX6A 4DWSD 3TQPA 2WANA 1WAUA 4A8IA 1AH0A 4AZCB 1XPGA 3BLLA 2HISA 3KFTA 1XRFA 2PWVA 1C9WA 1YYAA 3AISA 1HUVA 3R94A 4L65A 4EF9A 1GHRA 1EF2A 3CZGA 5K4ZA 4HNCA 1K8YA 2Z00A 1W3JA 1F76A 2ACSA 2VELA 4P2VA 5FA5A 2ZZ5A 1V7AA 3MI6A 1J01A 2QUMA 2ZRXA 3NEVA 4AEOA 3WFAA 1W1IE 3OU8A 4JOMA 1AG1O 4DEFA 3CO4A 1E73M 3M47A 1H1ZA 3LPPA 4B2DA 1Z32X 3L5AA 3TOYA 2Y63A 3NURA 2PFHA 4BHYA 2DEPA 1BKSA 5CH9A 1EQCA 4DWSC 5MKGB 2VZSA 2E8ZA 4HHLA 3DBPA 1E4MM 5EFDA 3M64A 3LCLA 2BVDA 5KZMA 4IOTA 1R47A 4HSNA 2EG6A 5B80A 4JFTA 4NSBA 2PUZA 3NVDA 1VBJA 3GYCA 2XN2A 1KXVA 4AWUA 1RXOB 3TDFA 5EMUA 3S8HA 4E8GA 2DW6A 2PWEA 3THUA 2PU0A 3UXAA 1GW9A 3NUKA 4AXKA 4HU0A 1BXNA 4JTEA 1RSCA 1R2RA 4ZSUA 4AUBA 4LNYA 3WF3A 4LSBA 1VFHA 1CEOA 2QAPA 3A4AA 4JR5A 3RGTA 5C9XA 1ZJIA 2BXYA 2Q09A 4ZE5A 1OK6A 1M03A 3B3DA 1TIWA 1R7AA 1YIXA 3GDRA 2X40A 4ZQCA 1H7PA 3G8RA 3IIPA 1W54A 3LYEA 3CL8A 4HGXA 5K7JA 4EOUA 4BI5A 4UQEA 4H9TA 3V5OA 5FJPA 3ONCA 5TAOA 3AS0A 1F5ZA 3VAVA 4GA8A 4RZ5A 2VEIA 4ZQPA 2FTPA 2PGWA 3KRSA 2XFFA 4QHRA 3RF9A 1A5OC 3P81A 4AYGA 1VC4A 2D3NA 3DUGA 5D37A 1FH7A 1RA0A 4FX8A 3AS1A 3BARA 8A3HA 2TMDA 1DBTA 4IPJA 5LHEA 2BLEA 3LN3A 3SQSA 4R7JA 2W4XA 2ZX8A 3TFXA 5AHEA 1DOSA 4RXFA 4F2BA 4ZQMA 3NPXA 3CUZA 1XDMA 4A2RA 3QQWA 3VOCA 4JN6A 1P48A 3KBVA 2FTWA 4AEFA 2CZDA 1R85A 4LYPA 1OQFA 5E0KA 8XIAA 2Z29A 4ML9A 2E9BA 5HUPA 3PZGA 4I6VA 4JAWA 4O54A 1D9EA 2Z1KA 2CNCA 2OOFA 3I6RA 3UERA 1XD0A 2GSHA 1XQKA 1O6IA 4BK9A 3UBPC 1B3WA 4O1CA 3GHTA 1IZJA 3GU1A 2B7OA 2QZRA 3MMDA 3EOSA 5I3HA 1MDRA 4LUIA 1T7LA 2A6NA 2JFEX 1FWDC 4X3ZA 4CU7A 5E09A 2YBTA 2PDMA 1D3CA 2IKIA 3WO8A 1T99A 1AQ0A 4DF2A 4GD0A 4M51A 4UFJA 3WNMA 3N18A 5I78A 1GWJA 2HNEA 2XFRA 4K8EA 1TA3A 1C7SA 3A4XA 3QTPA 3RLVA 4HOWA 1GVIA 1DJZA 3KOZA 4ZODA 3OEXA 1ONWA 5A6JA 3T55A 3B97A 1LP6A 2Z4GA 3VIGA 3TUUA 4FIRA 4Z1BA 3GIPA 1F4HA 4NP7A 2PCEA 4GVGA 1K8CA 3H2EA 3JRKA 4O16A 1FWBC 3WD4A 4LC8A 1UR8A 4HTYA 1H63A 1QW7A 3LCWA 1DIOA 4FEZA 2XH2A 3AAMA 1TZ9A 2PP3A 3QMRA 2A21A 3TCSA 3PVFA 3U5UA 3KVMA 1NP0A 1DQXA 3L67A 2PTZA 3R2GA 1KFJA 1GNXA 4GXWA 3UFYA 4A3QA 3O0KA 2GQ3A 2ZCGA 1MQQA 2CHOA 1F3XA 3ARQA 3BXWA 4PULA 2C6QA 3MJMA 3F1QA 2E8YA 3WF2A 1M68A 3WLLA 2FGZA 1E0UA 3QH2A 1ZU8A 2WHLA 5L6UA 3CAQA 3M4HA 4D6HA 1KFKA 3W7QA 4US5D 2EJ1A 1PTAA 4EXAA 1G0CA 3VOIA 1G6CA 4AWTA 5E6ZA 3NIYA 2CW6A 3BAXA 1E1CA 4ZOCA 2V2DA 4AIEA 4QBXA 1HKWA 1LM1A 3MANA 4GOAA 4JN7A 5CPQA 5FJOA 4OUIA 1PX8A 5EBUA 2OLHA 3CM4A 2PI6A 1V08A 4QITA 3STFA 1MO0A 4JTJA 4N0RA 3W86A 3W7DA 2OFJA 3SCRA 2WNZA 4TX6A 4ECLA 3UP8A 3SJNA 2EXOA 1CT5A 2CLIA 3WH9A 4N7QA 2Z1WA 4TV6A 1BVZA 3PZ9A 3VU2A 4DI8A 3SB0A 1NWRA 4YTSA 2RGMA 3QMTA 3JW7A 2OT0A 3HQOA 1TR9A 3UYCA 4LBSA 1Q6QA 3EWDA 2ASHA 3TNBA 1YHTA 3UW6A 1WXZA 2BOFX 3BSMA 1W9DM 2XIOA 5D2YA 3G24A 5CQ1A 1A0CA 2Z1SA 3TROA 5BNKA 5FEXA 4NJHA 3EB4A 2IPJA 5CCZA 1H1YA 4FLQA 4X9YA 2CESA 2BY3A 4UFKA 4IIHA 1E40A 4NNAA 2DUAA 4EWJA 3W1NA 3TW9A 5DQPA 4K68A 4EX4A 5G1MA 3QN3A 5GNXA 1XUUA 2PDFA 3E96A 3CYVA 1WYIA 4IF2A 1G5AA 4L1GA 2DU2A 1PIFA 4X63A 1UP0A 4Y6GA 2UZ9A 3G1RA 1GOIA 5CZ0A 3EDKA 4U2ZA 4C6KA 3S3GA 3W7LA 4KCUA 4MZYA 3LTSA 4IMCA 2X30A 4JIQA 3NOEA 5D9NA 2ALDA 2I16A 2HWGA 3DFPA 2HV5A 4PMYA 4B2DD 4NHVA 4UTTA 4GZJA 2UY4A 4KF1A 3PZTA 2VD9A 4LF1A 3UZYA 5K9DA 4K7VA 1G69A 4ZOBA 5I09A 3KP0A 1QK0A 2WPBA 3K2GA 1RD6A 3KE0A 4BEQA 4H9MA 3GVRA 3PBMA 3E2VA 3KRZA 2QCHA 3FXGA 5HR7A 3NG3A 2YCLA 3EX3A 3W02A 3AIRA 4YTRA 4FNUA 1GQNA 2PLJA 4ZQRA 4Q4MA 4WHBA 3QV7A 4YWIA 1JQVA 1V03A 3B04A 5A8PA 2F9RA 4GI8A 2VDHA 4HNUA 1U5JA 5I77A 2X0HA 4JCLA 3AXKA 2V5KA 1JCLA 1Z69A 2P5NA 2OGYA 3IGXA 2VRJA 1IQ8A 4ZOAA 3NWRA 3O9NA 3VXGA 1SJAA 5CSSA 1GYNA 1R3VA 2RUSA 1X97A 2W0UA 1B2YA 1PHWA 3NL6A 4YN5A 1KRAC 1CBGA 4RUBA 1OCJA 2EG7A 2BY2A 1P0BA 2HSAA 3DC0A 3B0UX 1QPOA 1W9BM 3F2CA 4MVAA 2YGYA 3NPUA 2ABBA 3ZT6A 3PANA 5I0DA 1V6VA 1E70M 2OZ8A 4JIHA 1UD6A 3PF3A 3S0CA 2WC7A 3KCJA 3IIOA 4GH1A 2Y24A 1CPUA 1OINA 3QC3A 4GZ7A 3I7RA 5HMDA 2VR4A 3BWWA 3WKZA 3CT2A 1O12A 4JTKA 1TRDA 4LTSA 4PUEA 6A3HA 2X7WA 3SCWA 2ZX7A 3ZJ6A 3H8AA 3GC5A 3EWBX 1WV2A 3Q4DA 5H2ZA 2YL6A 3THAA 1S5TA 1VBGA 1L6WA 1OWQA 2E67A 2PF8A 3U2CA 1PTDA 4JFUA 2VEPA 4DO7A 5CZTA 3CLWA 1KFLA 5DLCA 4HA4A 2PWUA 3B8UA 5GJNA 3DYMA 2PRHA 4S2CA 1GORA 2VC5A 4F0LA 3SFKA 4LV4A 3EEGA 3TYAA 2J8FA 4NNBA 4IXHA 1QNVA 1XL9A 1EQPA 1EZ2A 3OJGA 3WEMA 5DXXA 1KM2A 3TYBA 3N2MA 5K2ZA 4OFCA 3R4IA 5DBTA 4D1JA 5C71A 4TVDA 2WKJA 3ANVA 2Y70A 4JL1A 4NI8A 4Y2WA 1EA9C 4Q7BA 1R30A 4QJ1A 3TC7A 3N34A 1MVYA 3HG5A 3CASA 1G9HA 2YLLA 3GR4A 4OGZA 4Z2GA 1E0WA 4QR6A 4HQVA 1PB0A 3C86A 5DRCA 1BSIA 2XN1A 4GIYA 1QOPA 4S3CA 3TH6A 3OVQA 2AAMA 2R1KA 4EAMA 1Y5XA 3VNYA 4PUJA 2NZLA 1G7UA 4R5EA 1QHZA 3MO7A 4AY7A 1UR4A 4HCHA 4W7WA 1OC6A 2WMJA 4XZ9A 2EPKX 5JBEA 2R94A 4B5VA 3AXXA 5A2CA 4ENLA 3VILA 4LB4A 3W7MA 1VJZA 3TTYA 3EMZA 1TJ2A 1F3EA 1T6MA 1SR0A 3PPFA 4MY1A 1JVNA 1QHPA 4Q8PA 4F8XA 1S3TC 2OPJA 2YJQA 1TTJA 3AHVA 4KEVA 1BTMA 1GQLA 4O1EA 4UTMA 4PTXA 3NGFA 3QSRA 4DM1A 4EANA 3M07A 1KM3A 3LLDA 2WNQA 1DWIM 5A5WA 3PJTA 3T8QA 1AUSL 3LPFA 2ZXQA 2BXVA 4LS2A 1NM9A 2B7NA 2G41A 3DG7A 1GW1A 2J62A 2ODOA 2J9YA 1JRBA 3LXCA 3M0KA 2RGLA 3C0SA 5EL1A 3G0UA 1HGWA 1L6FA 2QR6A 4FNTA 2OWXA 1JF5A 1XDJA 2ZWZA 5DMLA 4JQ3A 5BU6A 1UUQA 1PPIA 3GNOA 1U30A 2QCEA 1EEXA 3CEPA 3UEQA 4HU8A 1E0XA 1EJWC 2J13A 1TIMA 4TOQA 2VEFA 1PYFA 1OCBA 4O0ZA 2WBKA 2ZUNA 3SECA 4UIOA 5EKYA 2IKJA 1A5AA 1WDWA 3BAWA 4B9ZA 5GJMA 5HQMA 3V4BA 1QUMA 3ZT7A 3P62A 1A5MC 4S3GA 1XYCA 4PBFA 5H8UA 3TK7A 2OEKA 1XW8A 5FEPA 3A4JA 3T4CA 1KD0A 4FAMA 4OU1A 4EF8A 3KCOA 4HK5A 5LNWA 4N4QA 4D6IA 4B5TA 2VRQA 3BH4A 1YTEA 1EJ7L 3LG3A 1KB3A 1BSLA 2E7FA 1NWSA 1C3FA 3W38A 4GCXA 3H2MA 1L6YA 1MUMA 4PGLA 1KBBA 5I6SA 4PUKA 3W7EA 2OZTA 4JTSA 1A80A 1UBSA 5MF5A 4I8DA 1JD7A 1ZB5A 3PPHA 4YPJA 3CZLA 4UMBA 5FKYA 1DP0A 2PZNA 2PWGA 3GXDA 1B3VA 2VUYA 5HDRA 1PDZA 4MDOA 4B4FA 5AKQA 3L4WA 3E49A 1KCLA 3GY1A 4WDXA 1YLVA 4WKAA 3KDNA 5I23A 4KQNA 3DHFA 3FV9A 1MW0A 3P80A 3ZFHA 2HMCA 4WD0A 2PDQA 3KTCA 3KEHA 3EDJA 5FJRA 3QPZA 1XBVA 2Z1BA 3MC5A 1KTCA 4MB1A 4YCPA 4KBXA 1WUFA 2DGAA 3LPGA 4IMAA 1D2KA 1A3XA 2ZX9A 1AL8A 1J11A 3SGUA 2GQ9A 4D6JA 3SCQA 3MWAA 1CXKA 1UH3A 1N55A 2PC4A 4M6PA 1CLKA 1FCVA 2CLHA 3VKJA 3T2OA 2A1YA 2OX1A 1XLAA 4GJJA 1Z8AA 3UG8A 2X1UA 1BYDA 4OOZA 3RILA 3UZJA 3OGRA 4P7RA 1H62A 4H4IA 4ZA0A 3W7OA 4ZO8A 2EO7A 4FA3A 1S5NA 1MZRA 5A69A 2W5FA 4HD5A 1XRTA 5E9AA 3HMCA 1IR2A 1J0KA 2J7HA 1WDPA 2VZUA 1Q65A 4QM1A 3RPDA 4D1IA 3NQ6A 2VI0A 4UTTC 3VIJA 3V5FA 3H23A 3VFCA 4DLFA 1ENUA 4FK9A 3WSUA 3KBWA 4WEVX 2X1SA 1KR1A 2BG5A 5BMWA 3LLFA 1FRBA 4L64A 1WDSA 4GUHA 3OBKA 1TPH1 3RK8A 3RM8A 3BJFA 4AD0A 3VTRA 1SR9A 4YS1A 3E2QA 4UTWA 1XF0A 2DJLA 2YDSA 5EB8A 2DV0A 1WXJA 1VAHA 1SO6A 4AD3A 4CN1A 5FIPA 3LRMA 4CQDA 4IL2A 4ADUA 1Z44A 4C6MA 1E6ZA 1Q45A 3IJ8A 3II1A 5M17A 4MY9A 1RY8A 2BASA 1VCVA 1P1XA 3EDEA 1HKVA 2JF6A 3AHZA 3EMQA 1HJUA 4JIRA 2XSAA 3M9YA 3FYOA 1IT0A 1K02A 8XIMA 3U7BA 1UMYA 3GFZA 2AL2A 5J5DA 2H3DA 4C6PA 1EJSC 1DJIA 4ES4A 1DIEA 3B8TA 1MW1A 1UQZA 3IIVA 1TWSA 1J96A 3NQMA 3LX9A 1HL2A 3WQCA 1EJRC 4DUWA 4TR9A 2E6FA 2GUYA 3PAOA 1J0IA 3LHTA 3ABOA 4LFYA 1Z7AA 3CU2A 2WYSA 4FOKA 5CZSA 4O8AA 3BLPX 1T0OA 4H9UA 2RFGA 4G56A 3NAVA 4OTKA 3PHAA 3QY8A 2QYGA 2J6VA 1H3GA 1WPCA 4M7TA 1K9DA 2X42A 4O1FA 3W2MA 4Q8OA 2P0IA 3G1FA 3AC0A 4FMVA 5I3DA 2YDAA 4WUIA 3ZVHB 4KGJA 9CGTA 1QMLA 3P82A 2OQHA 5AVHA 2UWFA 3TTSA 1PSCA 4QLLA 4V15A 3CMFA 4FX7A 2PTDA 4IG2A 3SUUA 1Q4NX 1LRNA 1RCXB 4UQBA 1G94A 1RA5A 3K5XA 1HW6A 3GH7A 3DZ1A 3MT1A 1V7YA 4WZHA 3CV2A 5C9UA 3NQ7A 2R91A 2E09A 2XGZA 4TU1A 2XVLA 1AD4A 3B8IA 3RMEA 4D8ZA 3QZEA 2YBUA 1QI2A 3RXZA 2CLEA 2HROA 4ZSTA 3ELFA 1YDOA 2ZE3A 2DSUA 4DI9A 4Q7NA 3EWWA 3W27A 4ERAA 1FWAC 2YDQA 4FP1A 1WO2A 3WBEA 5DRIA 3CMGA 3N13A 3UXLA 3W9ZA 4QQUA 4GRSA 3WN6A 3RN6A 3SM0A 3AIBA 3T09A 3C8NA 2XSXA 4HNNA 1REQA 5A1AA 3U5YA 2Y62A 2YCKX 4WY0B 3VYLA 3IVUA 5LIKX 3TMQA 3M0ZA 3XINA 4ERGA 3F2BA 3SRKA 3GIYA 4L1XA 4J35A 4C7GA 3RRXA 3KWSA 2R1PA 4J28A 1IIHA 1TZ7A 3PPGA 1OG6A 3F4NA 1FFRA 2EF9A 1LQAA 4QS6A 3UJSA 1XLFA 3LV6A 3RNDA 3K8MA 2PDHA 3LBMA 3EDDA 3MKKA 1EBGA 3UT0A 2G0WA 4ALDA 1KNWA 1F6PA 3DU0A 5CBIA 1VFMA 4QJ4B 3W76A 3T0AA 4BQ5A 2Q3RA 3B40A 2HXUA 6ENLA 4NIRA 4NT0A 1SO3A 4YVXA 2POZA 4JX5A 4F66A 2CU0A 1GYMA 4O4WA 1RP9A 1TV3A 2VNCA 3OQ8A 4MZ1A 4J5NA 3P61A 3EEZA 1H7XA 2ZKMX 3QF0A 3CPUA 3E38A 3N4FA 4QX4A 3TC6A 4Y8EA 1US3A 4O10A 3KHDA 3WLQA 2ZC1A 3WQFA 4WR3A 4K7YA 3AO0A 3GKAA 4I9AA 4RLIA 4V28A 2D1ZA 4GABA 4LAZA 2VZOA 3VCCA 1E3XA 4QE5A 1KLZA 3U57A 1UIOA 5CPSA 3WF1A 1AQMA 3AS3A 3OODA 2FZDA 3BLDA 3IV8A 4DJFD 5CSYA 4RK8A 1Q6GA 3CNYA 5EYWA 1SW0A 5HWJA 3N6HA 1S2TA 3W7RA 4CKQA 3T07A 4UQ9A 2QPUA 1RJQA 1A47A 3BMXA 1TVLA 1LOLA 4DWSB 1HJVA 3PS7A 1GK8A 3VC5A 5AYXA 3GR8A 2DZSA 2G3FA 3T78A 2I5IA 2FYMA 2FFCA 4FR6A 3PUGA 1BXCA 2CKRA 3DENA 4CD4A 3DFHA 2I5GA 3GRIA 3AIQA 2J7DA 4XIMA 2UY2A 4EXBA 3K8LA 1RR2A 3OBAA 4HCDA 3SR7A 5G1TA 1C90A 3SJ3A 1NEYA 4JCMA 1B90A 3VGHA 4YMZA 2VQTA 2HK0A 1J0ZA 4DJFC 4AZBA 1XLHA 3FAWA 5JQ9A 3OIHA 1ODZA 2PEVA 3RMJA 2O4MA 2P3EA 5CXPA 2QJMA 2W67A 1E6PA 1Q6DA 1C9DA 1XLGA 3EWYA 2WQPA 1F3WA 4M81A 3IIZA 1QNQA 1FVPA 3ITCA 4DYEA 1XKJA 1US0A 1TJRA 2WJZA 4DVOA 3MZNA 1ZAIA 3HIJA 2WJDA 2H8ZA 4QDWA 5XIMA 1XLDA 3TP4A 2Y88A 1B3XA 1C91A 4O14A 1EX5A 3MUAA 1CXIA 1W9PA 3VZXA 3SO7A 1RUSA 5G4HC 3W7HA 1JUKA 1XYLA 3JZEA 4JKLA 3C52A 3JZUA 4H04A 5FAGA 1W5QA 2FTYA 1XRSA 2MNRA 4H9VA 4URIA 2D2JA 3WL0A 3UR2A 4DJDA 3OLGA 4GFSA 1ZJBA 1JZ5A 1OFRA 3TTEA 2VWSA 4BQ2A 1X38A 4F2UA 3TA9A 4D2JA 4LY8A 1PYMA 3LPOA 2ZOXA 4Y9AA 1HO1A 1QI3A 5FAJA 3LENA 4C6IA 5IDIA 4EACA 4Q4QA 4H9ZA 1UPPA 4MNLA 4GLEA 1VLIA 3PWIA 4IFOA 3WQ6A 1L8NA 5I2UA 3TMLA 2CEQA 1EGZA 4X2PA 3BCDA 4I8YA 1OFAA 1ISYA 4Z2HA 1YNQA 1AMKA 3KZSA 2NV9A 3LZ5A 4UTWC 1XSIA 4EP8C 4LUYA 1FDYA 1HFBA 3DESA 1U1HA 2XTKA 1F7BA 5F4SA 1HO4A 1XBZA 1H49A 2VUNA 3ABRA 5I3IA 3UNTA 1MNZA 4HB7A 2X41A 3ABSA 2OYKA 1C29A 2XH7A 3R13A 4D72A 1F9CA 4BEUA 2V3GA 3OVRA 4JTQA 2O0TA 4CEUC 1EBHA 2A4AA 2PDUA 3P8IA 1Q4WA 1T40A 3M46A 1PCWA 1KKOA 4MUZA 3H22A 1PS9A 4UTJA 4OVXA 2QUTA 3P93A 4ML4A 3WD0A 4AZHA 1OT2A 3EZ4A 2CXGA 4JN8A 1F8IA 6TIMA 1UQYA 1UR2A 3VOGA 2B81A 1TE1A 4ZR8A 1XYBA 3W72A 3CUXA 3RR1A 3R89A 4QNEA 3ZWTA 4I7VA 5KMYA 5M3WA 3Q67A 3AIWA 4CQBA 2YXGA 3UWZA 1S5MA 2XINA 5BZAA 2CXEA 4JTAA 4DBUA 4CCCA 3CHFA 3TYUA 3LCGA 1QTWA 5D32A 2C15A 2V3FA 3B8DA 1H7RA 1RK6A 4JYDA 2QJJA 3TNOA 3V36A 3WNOA