3QH2A

Crystal structure of teni from bacillus subtilis complexed with product cthz-p
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
195
Chain Sequence
SHMELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFGRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMRYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein tenI
publication title A Missing Enzyme in Thiamin Thiazole Biosynthesis: Identification of TenI as a Thiazole Tautomerase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 77
structure length 195
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 5.3.99.10: Thiazole tautomerase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qh2A00
3C56A 3G3DA 3E0IA 2OJPA 5DCBA 1GVFA 3QH2A 2E68A 1EP2A 4YLWA 3KHJA 3NPWA 1Q6QA 3ZFHA 4WJEA 1VR6A 1GT8A 3VNDA 3W83A 1JQXA 3NQMA 5EL1A 4K8HA 3LLDA 1A5BA 2QR6A 1UASA 1D3HA 3O8AA 3UZ5A 4DBEA 3HIJA 2VEIA 3GKAA 3TSMA 5HJLA 3PBWA 3NOEA 1K8YA 3O1NA 3I6RA 3P81A 2JKPA 1ADOA 1PIIA 2YX0A 3EWZA 2ZZ3A 2OT1A 3IIXA 1V5XA 2J88A 3T40A 3KVLA 3E49A 4GWEA 1HO4A 3ABQA 5CPNA 1DHPA 3GYEA 4XKYA 1FWWA 2J27A 4TIMA 3LCGA 1FWRA 4CQAA 3N14A 1FCBA 3W2JA 2RHGA 1YLVA 3UYCA 1QDSA 2D73A 2ISWA 1O5KA 2A1YA 3RFAA 1UUMA 3S8HA 3A23A 3IGUA 2NX3A 3M41A 3GDKA 1IXOA 2CLLA 3PG9A 1VYPX 3W7DA 3ANYA 3EX3A 5TQLA 1VYSX 4LRSA 2WSRA 1QPNA 3QSRA 3W07A 3EKZA 1SO6A 5FESA 2ZCGA 4FXSA 2CLIA 2PRLA 4AF0A 2BX7A 4OWGA 4JIPA 1FX6A 3DFOA 1PHQA 5U7SA 4OV9A 1K7EA 4NT0A 4N9BA 1DVJA 2I14A 3BLEA 3V75A 2ZZ6A 3PG8A 3O6YX 1XM3A 1FWSA 5FEWA 4MUZA 4QNEA 1ME7A 3DAQA 3DHFA 3W71A 3QQ1A 2E5DA 5HMSA 5AB3A 5CPMA 4H6KA 3WK3A 4JICA 1H63A 5DELA 5AHIA 3W7NA 3PBUA 4D2JA 1A5AA 2J9XA 1VC4A 3GZ3A 2ZRUA 5KINA 5LHFA 2Y7EA 2CZFA 3P5YA 5J5DA 1RD5A 3W23A 5D2VA 2OT0A 3QSTA 5KTLA 1XKYA 3GDMA 3LTSA 4K36A 4ZVJA 2J6XA 3NQGA 4N2YA 3W3OA 1K3UA 1DORA 2XN1A 4M6QA 2A7NA 4IJBA 3NVTA 1TJRA 1F7BA 2RFGA 5FEXA 4UNKA 1AK5A 4UTTC 5CPLA 5C2XA 1HL2A 2WJZA 3DH7A 3CLMA 4UFMA 2ISSA 2GJNA 4O17A 2UV8G 4ADUA 2LLEA 2FLIA 3QW3A 4GBUA 1TTQA 4TO8A 2GVGA 3MI3A 2NWSA 3F4NA 4WY0F 3OBKA 3VE9A 2P10A 4WUIA 3B0UX 4AWTA 1K8ZA 3O07A 4K6AA 4RXFA 2QF7A 4JN6A 2B4GA 3MYPA 4FO4A 2CWNA 1F6KA 4JX6A 4YL2A 4NU7A 2GVJA 3CC1A 4LC8A 5CKSA 1TV5A 3WK0A 4UMBA 2F7FA 4UTTA 4RZ5A 3FEMA 3QPZA 2V2DA 5LKYA 4WY0A 5IBXC 2RDUA 3M6YA 1YTKA 1OJXA 1HFBA 1SW0A 5G5IA 5FEZA 1N55A 3AJXA 3W6YA 4O15A 5FF7A 1YTEA 1JVNA 2NUXA 3U8GA 5CZJA 3M0ZA 4K8EA 4NQ1A 4MYAA 3M1ZA 1BWKA 4K7VA 1I45A 1OFPA 2Z6JA 5G4WA 1ZAIA 1BEUA 3HPSA 1GYNA 3BW4A 1WXJA 4IWWA 1TYGA 5K4ZA 2B0MA 2E1DA 1P0NA 2TYSA 4LVFA 5LHEA 1TRDA 7TIMA 3UQNA 3C6CA 3IGSA 1WOAA 1QCWA 1H7WA 3B8DA 2BTMA 3L2IA 3CEPA 2ZA1A 2EGZA 3DENA 3VKJA 1I8JA 3IRDA 5HINA 5AC8A 4A2SA 2V5BA 1GTHA 2H90A 3G0UA 6TIMA 1UBSA 1AG1O 1FQ0A 3OEXA 1SZNA 1KFBA 1P5BA 2NUYA 1UUOA 3NQ6A 2I1OA 3HQ1A 2Y62A 3QYQA 4JTHA 1RQBA 3NQFA 1H1ZA 3G22A 4S2CA 5I3KA 2VFGA 1F6PA 3GAKA 3KVJA 3M16A 1VCGA 4NVTA 2YGYA 4LTSA 3M5XA 5F4XA 1J5TA 3SR7A 3IVTA 2WQPA 3EKLA 1FDZA 1X1OA 1KFCA 3L67A 1VLIA 1Q6OA 3LBMA 3EWUA 3G1SA 3DI0A 3IIOA 4I7WA 2FB3A 5F2MA 1H50A 5DXXA 1GWJA 3LCWA 2C6QA 3W1NA 3S42A 1IIGA 3LXAA 2H8ZA 3L21A 4UR8A 5HUOA 4CCDA 1VYRA 5F4SA 1GJPA 3F03K 5F1UA 3THQA 4A2RA 1YTDA 3L66A 1G67A 2XN2A 2DZSA 2VFDA 4EF9A 3P82A 3IIPA 4MZ8A 3R13A 4FHAA 4UTHA 1KTBA 3N19B 3OVPA 4GRSA 3FJLA 3T44A 3E02A 4J9JA 3LBCA 2QCEA 2YPIA 5DBUA 1MSSA 1VCVA 2DZUA 3TKFA 3DZ1A 1XDLA 2OX1A 3W1PA 5J5RA 1SZEA 3CU2A 4KFPA 2JGQA 3M44A 1YPFA 3LHYA 4LRTA 1UB3A 3IV3A 3PSWA 1X1ZA 5G4EA 2ZBTA 3PY2A 1TIMA 1V7YA 1SPQA 4UTUA 4O16A 1ZAHA 1GOXA 3T4CA 2NV1A 3C2OA 3O05A 3USBA 4AWSA 3GIYA 4DF0A 1GQNA 5HQEA 1THFD 1JRBA 3P5ZA 1HUVA 5LGZA 1KFKA 1EX5A 4EOUA 1KM2A 3DKLA 4I7VA 4UFLA 1FCVA 4R34A 3KX6A 4RLIA 3TH6A 2H8XA 1K02A 2YCEA 3ABRA 4UTIA 4ICNA 1O60A 2A2IA 3L5AA 1LORA 2DZVA 4Y9AA 4Z0JA 3EWXA 1TPUA 4GUGA 2QUUA 3INPA 4FIRA 2WV8A 4W9TA 3LHVA 1IF2A 2Y7DA 3CM4A 2E6DA 3K30A 2ABBA 4ADTA 3EXRA 5F2GA 3FS2A 3MW7A 1ZAJA 2Q3RA 3CTLA 3WK2A 3C0JA 2Y61A 3G1YA 2QCCA 2ZA3A 3PM6A 1HG3A 1W5PA 5HWJA 4ZZ9A 3HGJA 4LC6A 4IX2A 3MHFA 2DZXA 2QCGA 3DGRA 1SR9A 3L9CA 4JIQA 5A8GA 3O15A 4FEZA 1NEYA 1WDWA 2HMCA 4TU1A 3N34A 2HS8A 3G3MA 4LV4A 4R53A 4CNOA 3UXAA 2W6RA 3HGOA 1MEIA 1P4CA 5K9XA 1XBXA 1Y0EA 4MVAA 1LBLA 3LTYA 4O53A 4O19A 4JNMA 4BFAA 5D04C 4JGDA 4UFJA 1X7FA 2G96A 2NV2A 1NVMA 3C2VA 3U6WA 1W56A 3TUUA 2DZPA 1W3IA 3PB0A 1TQXA 3GDTA 5K9DA 4PL1A 5DY3A 4XBKA 1R47A 3EX1A 3HMJG 1MEWA 4NZJA 2CLHA 1LDCA 3VE7A 1CI1A 4RX0A 3W1TA 2Y70A 3KVMA 3R89A 1SFLA 2A0NA 1IGSA 1MO0A 1Q3NA 1B4EA 1FCQA 3CPRA 4M19A 3TR2A 2C18A 4G1KA 1B3OA 5G2HA 3IIZA 1RQEA 3OHIA 4BI6A 5KITA 1DL3A 3P67A 1W5NA 4MYXA 3QW4B 2VELA 4JTUA 3HG2A 5KSWA 4O1CA 4MY1A 2CZ5A 3BW2A 4O4VA 1LZOA 2V82A 5D32A 2VENA 4R7JA 1XL9A 3LHWA 2C1HA 1SZFA 2CLEA 3GK0A 1PE1A 4O0KA 4CLMA 3R5EA 3DFNA 1J4EA 4QQ3A 1G7UA 4NX0A 4H4IA 2DJLA 4RZ4A 5AHLA 4NJJA 3LTPA 5I3HA 1WBJA 1W5OA 3TJXA 8TIMA 3BG9A 5EPDA 4YWIA 4PODA 1LTDA 5EMUA 2NXIA 3RMJA 4K37A 1KA9F 1G6CA 1RR2A 2DZTA 3C4UA 4FNRA 5U4NA 2DJXA 3HB9A 2ATSA 1F05A 4WD0A 2GVLA 2JKAA 1ALDA 1VZWA 1L6WA 1NF0A 2ZA2A 3LV6A 1H51A 1TJPA 5BRBA 3BPWA 1CX9A 3Q37A 3DFSA 3S6DA 1YDOA 2A4AA 4POCA 4RJEA 1XC4A 4NJIA 4HN4A 3TQKA 1TPEA 2WPBA 5EY5A 1YXYA 2FDSA 4OGZA 4YCPA 1EUAA 2HSAA 3PF3A 2X2GA 1TB3A 1TPC1 3GDLA 1U5JA 3W7GA 4UIOA 4O54A 3B0VC 4TX9A 3DI1A 4MZ1A 1SO5A 3UWUA 3TNOA 1H7PA 3OIXA 1I2QA 3MHGA 3DXIA 4H3DA 4IXHA 5AYXA 3GXNA 2GJLA 2YW4A 1FXQA 3FLUA 3BK0A 2H3DA 3BG5A 1T99A 4JYEA 5D2TA 2EF9A 3TXVA 4HNVA 1EP3A 1OYBA 1QPQA 1W31A 3G18A 5L9FA 3W7LA 1M5WA 5MHBA 4OE7A 4DQWA 3MO7A 2ZZ4A 5I3FA 4AEOA 3W1AA 5I3IA 1SSGA 3JS3A 4MJMA 5EKYA 5ABTA 3R12A 3B03A 3JRKA 2GQ9A 3VCRA 2O7SA 1OFDA 1OHLA 4HT3A 2P1FA 2GUUA 3DU0A 3FJ6A 3OG3A 2R94A 2TSYA 1LOQA 2E6YA 1ME9A 1OX5A 3TC6A 3EWYA 1FUYA 3C2EA 4E2DA 4MLRA 4JTFA 1VRDA 1F2JA 3A9IA 1QNVA 3LOTA 5LNSA 2TMDA 4QITA 3NQCA 1OK6A 1L6SA 4GNJA 3TJLA 3HGRA 1PCKA 1P0KA 4PH6A 3QM3A 4YXGA 3EEGA 4JDYA 1AL7A 4MLJA 4UTKA 3A5VA 1DQWA 3M47A 1QO2A 4RXGA 4WQ6A 1GPWA 1LLWA 1ML1A 3SI9A 4DPQA 3QMSA 5KZMA 2CLMA 4JD4A 5LNWA 3NQ8A 2X1SA 3ABSA 3TFXA 3SGZA 2X1RA 5D2XA 4KWWA 1W3TA 3M5YA 3S1UA 1Q45A 3LM7A 1DQXA 2YR1A 4U4MA 3AO0A 2JBMA 3FA5A 1FDJA 1A53A 3O16A 2W0UA 5D2YA 1NAL1 2ZYFA 4P61A 4MOZA 3CEUA 3L0KA 4FNPA 2C14A 3W7OA 3EB2A 3C2RA 2V30A 3BARA 1AW2A 3MI2A 4DF2A 2O7QA 4HPJA 3W22A 3A5FA 3PBYA 4DO4A 4X3ZA 2E09A 4ONVA 2QCDB 3KXQA 4A3UA 3U2OA 3GXTA 2CW6A 4KFOA 5LSMA 3LGEA 4JR5A 1J2WA 2B7OA 1TTIA 4X2RA 1B9BA 4RR4A 2C0AA 5EA9A 1VGAA 3OA3A 1EPXA 2R14A 3P74A 3PULA 3G1AA 2PRHA 1F73A 1G4TA 1N7KA 2JKEA 2VKZG 1BTMA 4ALDA 5HULA 4ZQOA 4O28A 3W2NA 3DFPA 1U83A 1G4SA 4M5PA 3O06A 1TPVA 1TRIA 3O6CA 1KM4A 4MY9A 1TV7A 3MP5A 2A6LA 1DBTA 4RKAA 1IXNA 1KW1A 3HG5A 4ORMA 4A29A 5KZEA 5KMYA 2QKFA 4IMFA 4EIVA 4K39A 1O94A 2ZTJA 3R2GA 1EA0A 4YCOA 3TCEA 3G24A 3HG3A 4OQVA 4HNNA 5DN1A 3LCFA 3MUXA 2QCNA 2C13A 3MBFA 3IVUA 1I2NA 1K7XA 1OF6A 1T0OA 1TCDA 4LVDA 4WX2A 2VOMA 3TA6A 2XFWA 3G1HA 3W88A 4EF8A 2CZEA 3W76A 3GLCA 2DP3A 3WFAA 4NUWA 4XZ9A 1KTCA 4QISA 2GPTA 5G2IA 1AMKA 1C8VA 1RPXA 1W37A 2E6FA 3LRMA 3PR2A 4JYDA 1D3GA 4N4QA 5D37A 2FIQA 3THAA 3P61A 3QZEA 1WOBA 5SWUA 5DY2A 1GVSA 4E2BA 1KV5A 3HO8A 4RCXA 1XFBA 3S1WA 2P0OA 3IGXA 1EIXA 1YADA 1S5TA 3LRLA 1TSIA 2ZQ0A 4HKPA 4LNYA 2NLIA 1LBFA 6ALDA 3NXFA 2VEMA 3BGGA 1YXCA 3WJYA 1TPFA 2G97A 1W1ZA 3L0NA 4NX5A 4U28A 4UC5A 4O1DA 1K03A 3KRUA 4LVAA 5FF0A 2OCZA 2FPYA 3QFEA 4NJHA 2QAPA 5G2WA 3TDFA 4Z1DA 5D02A 4HHPA 3SW6A 3RLUA 3C52A 4KFNA 2YXGA 3MMTA 2C3ZA 2Y6ZA 3LI1A 1FWNA 4MKNA 4JTIA 1UCWA 3M43A 4E0CA 2RDWA 5D2WA 4L4LA 1KFLA 1ICPA 2G95A 1W3NA 1GVOA 1ZY9A 3HPXA 3DBPA 3SJ3A 3NA8A 1OABA 2E5BA 3NPXA 1TPH1 2QCDA 4PCFA 1R46A 4HSOA 4GFSA 3NYZA 3NQDA 5BW6A 3GNDA 4AAJA 3O63A 3LRKA 3LV5A 1FXPA 5K2ZA 3G0XA 2ISVA 2QCLA 5LNRA 2CLKA 3C8FA 3STCA 3W73A 3NQVA 2EHHA 1VCFA 1PV8A 1XI3A 4ZQNA 2NZLA 3TMLA 3QF0A 1KFEA 2BSLA 1OFRA 1AL8A 3HPZA 5K4XA 3W7CA 4L4MA 1X8FA 2FJKA 3W7PA 2A7RA 3NM1A 3IIVA 2CFFA 4NNBA 3M7WA 2QDGA 4Q32A 1LP6A 5DLCA 5E0KA 3TC7A 1FDYA 5I3JA 2H6RA 4UMCA 3FKKA 1R30A 4OV4A 3PAJA 4LVBA 2B7NA 1JULA 2YFNA 2CU0A 2QJIA 3PUDA 2Q8ZA 4LVGA 4QM1A 4EVZA 3T78A 3KVKA 3B4UA 2FB2A 2X1TA 1QO5A 1HO1A 1SSDA 5AFDA 3LI0A 1OFEA 1XBYA 4TMCA 4MZYA 1ICQA 4N9DA 2VFEA 3S5OA 2QUTA 3W2LA 3GVGA 4IMEA 4M6PA 1P1XA 1UJPA 2C15A 2R8WA 3W74A 1PCWA 2F84A 4NJKA 2E77A 3QJAA 2OMAA 4GC4A 3BO9A 4N6EA 3PVFA 1XCFA 5HR7A 3MBDA 4UFHA 1ZCOA 3A22A 4JXCA 4UTMA 1LM1A 1LOSA 3G8EA 4JTGA 4R33A 1OG0A 2ZZ1A 1G4PA 4JY8A 2YSWA 5D09A 4AH7A 3W7JA 1AW1A 1ONRA 3VFLA 2OZ0A 3MP3A 1W8SA 5FF4A 3MI6A 2W79A 2YW3A 5CSSA 1VS1A 4PFMA 1VJIA 4WXYA 3N2XA 3PC0A 3SECA 3PUOA 3NM3A 3TQVA 2NXHA 3I65A 4FXRA 1Z42A 5D05A 4A22A 1PS9A 2V0TA 4B5NA 3TW7A 2Q8LA 3S1XA 4JTSA 4NJGA 3EXTA 3HOJA 4ZMGA 1Q6RA 2PCQA 5D03A 5TBOA 3W86A 3ATZA 3H55A 1WBHA 4CQ8A 2FQIA 1F74A 3N3MA 1M6JA 3OVRA 3CWNA 2I9EA 1A50A 3B0PA 4N9CA 3EWBX 3UNDA 1EEPA 4Q4KA 4ZQMA 4KWVA 4UTWC 4O14A 4A21A 5K9CA 5TIMA 1K7FA 2NX9A 2WOQA 2ZDRA 1F5ZA 2E5CA 3C61A 1WV2A 3UD6A 4CCCA 3WK1A 1GVQA 5F2LA 3LHZA 2CLOA 1WAUA 4DO6A 1LCOA 3W2KA 4CCEA 4LV9A 4PTNA 4KKXA 3GX9A 1W54A 3N2MA 4OU1A 5D33A 1M7OA 2DORA 2WKJA 3GXPA 1LYXA 4GUFA 2VFFA 1R2SA 3CWOX 4AHOA 5DXYA 3NEVA 2EPHA 4AMAA 1Z48A 4FF7A 4UTWA 3W1RA 4WZHA 1JUKA 1OFAA 5AC7A 4Z1CA 3GR7A 2AQWA 3SGUA 5AHMA 1EB3A 2A85A 3UZJA 2J9YA 4AF0B 2QCHA 4ZQRA 1QMLA 4M7SA 3E96A 3W7IA 5F2IA 2VC6A 3TQ0A 4MFEA 1YYAA 4ADSA 3MP4A 3NO5A 1YXDA 3LHUA 4O11A 3FIGA 5C5YA 4LUIA 4O0ZA 3PUEA 1NSJA 5FF2A 4BF9A 3UY8A 4TR9A 3CB8A 4IGHA 3P84A 2WSYA 1B57A 1VPXA 1YDNA 3TV8A 4LS0A 2GQAA 2YFOA 3A21A 2WNNA 1IIHA 3UWYA 5C55A 3FOKA 3S1VA 1SO4A 4GJ1A 3BVJA 3L5LA 2C19A 4UFKA 3W2UA 5CZTA 5AN7A 4OT7A 3HF3A 5GVJA 1QOQA 4N6FA 3LCLA 2QCFA 4O57A 4O10A 3LX9A 2EAWA 4XQ6A 5CSRA 1TV8A 3T7VA 1KLYA 3TX9A 2FFCA 2NX1A 4RZ6A 1QOPA 3YPIA 4DELA 1ZALA 1SO3A 5AHNA 3NG3A 5LGXA 1B4KA 1XUUA 1JQVA 2Y63A 4LU0A 1C29A 2G5WA 3G1VA 1S5VA 2J24A 4LS1A 4E38A 1TO3A 5K3VA 1XUZA 1SQ7A 1T96A 2Z0IA 1QFEA 3UXDA 3BG3A 1BKSA 4JEQA 3P8IA 1SW7A 3GDRA 1AW5A 2PC4A 4FB7A 4QNWA 3NNTA 5HWNA 2TPSA 1G4EA 3G1DA 4NZFA 2B7PA 4CNPA 2A6NA 3E9AA 4GE8A 4BR1A 4ZL1A 2ZRVA 2Z2UA 4C1LA 1XXXA 2ABAA 2ATMA 2QJGA 3N73A 5CZ0A 3G8RA 1KM1A 2PE4A 3WJZA 3UY7A 3UWVA 4QSHA 3PS7A 4WY0B 4DF1A 1XBZA 4UTJA 2QAFA 1TPWA 1W5QA 3LERA 3NL2A 1N8FA 2TRSA 4LS2A 4LUJA 4IPJA 3BGJA 4NNAA 4C1KA 1GTEA 1H7OA 4MPQA 4OBTA 3MYOA 3EX6A 1H5YA 3UPBA 5H91A 3W1UA 2Y89A 4RV8A 1ZHAA 3KFTA 1L6YA 2Y88A 1DV7A 2ZZ2A 3NQAA 4IMDA 1BWLA 1YPIA 1OX4B 5CGQA 3W7HA 3TK7A 1TPB1 1KM5A 4CNNA 3A24A 1DJNA 3TSBA 3NR0A 3HJZA 3S5NA 4O1BA 4PC8A 1GZGA 3G1XA 3TAOA 1NF7A 4LW7A 1A5CA 1HTIA 5L6UA 3W1LA 1DKWA 1JR1A 3FFSA 3MHUA 1R2TA 1JJKA 5BOOA 4FNUA 4EWND 5FI8A 2X1UA 3I68A 2FPTA 1H60A 1GYLA 3BLFA 3W7MA 4NXKA 3HGSA 4JX4A 4GUHA 4Y90A 3SFKA 2XN0A 2PURA 3TW6A 5E93A 1TQJA 1D9EA 1RQHA 3PWAA 3W87A 1LRQA 4JTJA 3S5ZA 3W84A 2V2HA 1JUEA 4FNQA 3LXBA 4UXDA 1OF8A 3I7SA 4HNTA 2HTMA 3D0CA 1OX6A 1RV8A 3S5YA 2C16A 2VEKA 4K7YA 3IVSA 1VHCA 1H7NA 1GEQA 2QDHA 4JTEA 3T55A 3FYPA 1QAPA 1K8XA 5HR6A 3TMQA 4HIBA 3RK8A 1KBIA 3LDVA 4N02A 5C54A 4AVFA 3QMTA 5I3GA 1KTNA 2Y85A 1G7VA 3W9ZA 3B04A 4Y96A 1ZNNA 3KOFA 3ZWSA 1RVGA 3V1PA 5T26A 2PRMA 1WYIA 3GKFA 3STGA 4JTLA 3QPYA 1QR7A 3LCXA 3RU6A 1H7RA 3RLVA 3WJWA 2R91A 1PL9A 3CIWA 3TU9A 2BZNA 4AHQA 4YMZA 1JCYA 2HS6A 4O52A 1JCJA 4AWUA 5C6MA 2AGKA 3PSVA 3CQ0A 4JYFA 1TTPA 3QMRA 2RKXA 2QCMA 4DPPA 3I7QA 3M5ZA 5F1VA 3LLFA 1C9DA 2YYTA 4Z0SA 3LCIA 4X22A 2WO5A 3UWQA 3UWZA 3QC3A 5BMWA 4UTLA 4AXKA 4DBDA 4XTIA 1TREA 3W2MA 3TAKA 3H53A 3C3NA 4HNUA 3P62A 5AHFA 1WX0A 1ZFJA 3NPUA 5AYYA 3L0GA 1VLWA 1FBAA 4M6VA 4DO5A 4IQLA 2VFIA 1JCNA 1KV8A 1LRTA 4Z08A 2ZRXA 2Y7GA 1IXPA 1MZHA 1H62A 3E12A 1OYAA 3SSJA 2CLFA 2ZRZA 4MY8A 1ICSA 1M7PA 1OX4A 1T8XA 5IBXA 2RDTA 5IM51 2EKCA 4JDBA 2VXNA 3S9YA 3JR2A 5AHEA 2Q3OA 4PA8A 3RF9A 5DBTA 2FTPA 1L9WA 1G69A 2WNZA 2ZZ5A 4O18A 4ML9A 4JY9A 3TXZA 1ME8A 1OK4A 2J9ZA 1WQ5A 2A5HA 3EX2A 3TSDA 3P7YA 1SW3A 2A21A 3MWAA 3Q94A 4IOTA 3ZWTA 4S2BA 3F4WA 2V9DA 2YYUA 2X16A 3M5VA 2Z6IA 5FF3A 3W1QA 2ZTKA 3NQ7A 3IEBA 3G0SA 1FY6A 1OFOA 1XBVA 2B7QA 4PEKA 3L5MA 1PHWA 4UR7A 3W1XA 4HSNA 2WSQA 5CZSA 1GG0A 1I2RA 3NZ1A 5H2ZA 3QEZA 4IPIA 3TIMA 3RNDA 5E1QA 3NPVA 2QJHA 1Z41A 1KFJA 3LCHA 1Z44A 1JCLA 3B05A 2KZHA 3MJYA 5KZDA 5D38A 2JK2A 3WJXA 5DCEA 1JRCA 1SUXA 3DFTA 1R2RA 4I9AA 3NQEA 1E51A 3TFCA 4UUIA 5BMXA 4AB4A 2VFHA 3STFA 3W7QA 5LNVA 3W72A 1JCXA 1WA3A 1QPOA 1A5SA 4S1FA 4TMBA 3W7KA 4WOZA 1JUBA 1H7XA 2BWGA 4IXXA 3P8JA 3W70A 3P60A 2BXVA 5CG7A 3W7RA 3QRHA 1GG1A 3HG4A 1H61A 5BNKA 5F4WA 1KM6A 3EXSA 4DEFA 1OVDA 2GOUA 3NL5A 4OHQA 4UNLA 3P80A 4WOQA 2JGYA 1SU5A 1LRNA 2ZRWA 5HWMA 3GNNA 4BI7A 2ZFAA 3N9RA 3GAYA 4IMGA 4JTKA 3M9YA 3KRZA 3SZ8A 1O4UA 1KBJA 5EBUA 2IQTA 5DCDA 3NL6A 1L2UA 1Q6LA 1QWGA 2VEPA 1LOLA 1W5MA 1S5WA 2H3BA 3OVQA 1RZMA 4XBSA 4BWLC 1VHNA 3NZRA 5AC6A 3CHVA 3Q2DA 2V81A 4Z1BA 4UMAA 4I7UA 3BV4A 4FNSA 4QIUA 4N4PA 3ELFA 3I7RA 5EYWA 4MFDA 3SY5A 4Y6GA 1LBMA 1DJQA 1TPDA 4P2VA 3HBLA 2DZWA 1I2PA 2V8ZA 3H54A 1TMHA 1ZJIA 4XUGA 3C2FA 1EUNA 4WXZA 3G1FA 5LZLA 2YDAA 3CT7A 1W0MA 1I4NA 5G1YA 2NXGA 1OFQA 3F1QA 4BWLA 1SZGA 2ZZ7A 2V5LA 3FYOA 4LT9A 4JS3A 2Z1BA 1XDMA 3NGJA 3B06A 4XTDA 4O12A 3ZS4A 2V2CA 1EWDA 1ZENA 4MJZA 4GUIA 1H1YA 4IX0A 4NNCA 1QPRA 1VH7A 4XKYB 2GQ8A 4QAIA 4IMCA 3R8RA 3NL3A 3TE9A 4CQ9A 3GR8A 3NDOA 2E6AA 3O6DA 1LROA 4RK8A 3UWWA 3W7EA 4GUJA 3L65A 1KM0A 4MIMA 1S3HA 4BI5A 3SIZA 2WNQA 3S0CA 3N9SA 4K38A 5CPOA 2QEZA 3L68A 1GVRA 1YDVA 4Z1AA 3NAVA 1KLZA 1TTJA 2ZRYA 5K7JA 1F76A 1O95A 1OYCA 1VQTA 1FWTA 1CW2A 2RH9A 5AYZA 5A5WA 4AHPA 5G1TA 4ZQPA 2BLEA 4FX6M 5LNUA 2QUVA 3EX4A 3CIXA 1O5XA 5D30A 3GB6A 4FNTA 2FPVA 3NQ2A 1EP1A 4LWWA 1JCMP 2ALDA 3LHTA 4GXMA 1I2OA 1EWEA 3PBVA 4O50A 3W1MA 3DKJA 4LY8A 2Y7FA 3Q58A 3VI2A 4BK9A 5FEPA 4O8RA 3QQ0A 3W85A 4X9SA 2DU2A 3W75A 4ZQCA 4FX8A 4ORIA 4JTTA 4HPXA 1SFJA 4QJ1A 4NXSA 1NFBA 2NWRA 1X6UA 1PVNA 4O1AA 3LXCA 3ATYA 3DFQA 3KAOA 5AOUA 3FKRA 2CZDA 3BW3A 3DHDA 3LB0A 4FIQA 4JX5A 1MXSA 1MEHA 4N9EA 3BLIA 4Y8FA 4FX7A 2YZRA 4O4WA 4UFIA 4DXVA 4O13A 2AAMA 3WJSA 3ZR4A 5HUPA 4UCGA 2NUWA 1OFBA 1LLZA 3KRSA 4XWUA 4PL2A 3PB2A 2A7PA 3ABOA 5HNRA 4IUOA 1FCUA 1KM3A 3STEA 2X30A 4M7TA 1DOSA 1IXQA 3TROA 3EWWA 4LOCA 4Q33A 3UPWA
chains in the Genus database with same CATH superfamily
4ZFCA 3G3DA 2ZVRA 5DCBA 4KEZA 2E68A 3DG7A 4EX4A 3SFWA 3ZFHA 1XYMA 3D5HA 2ISDA 1GT8A 4XAFA 1C91A 3W83A 3CL6A 3NQMA 2XU2A 3T8QA 3ISIX 4H9TA 2GJXB 3TZNA 2CETA 2MANA 2YCLA 3WLJA 4DBEA 1X1NA 3I6RA 2JKPA 3UWEA 1JF6A 2YX0A 3SCQA 2ZUSA 1IZCA 2J88A 1FOBA 3KL5A 4GWEA 1ADDA 3ABQA 1DHPA 5J8LA 2FGBA 4GMEA 1FWRA 1QW9A 3ALGA 3FJ4A 3N14A 3PFMA 4CVWA 5IXEA 1QK2A 1FCBA 1IGWA 1CXKA 3UYCA 1MFUA 2V38A 1QDSA 2ISWA 1O5KA 1ZGDA 4FMVA 1C7SA 3AIBA 2DH2A 2WMHA 3N29A 5CEWA 1UZ4A 3A23A 2NX3A 3QY8A 2WLZA 1VYPX 3THUA 5TQLA 1UOKA 1VYSX 2QW5A 5DT7A 1QPNA 3QSRA 1E56A 1SO6A 4GQ0A 2PRLA 4V15A 3N6HA 2OO0A 4AF0A 2PDLA 3OU8A 4OWGA 1RY0A 1EBHA 4GX9A 2CNCA 1S2UA 1XH1A 1K7EA 4NT0A 1LG2A 1DVJA 1LWIA 1RLDA 3V75A 2ZZ6A 3KTSA 3DERA 3GVQA 3IJ9A 4G2DA 2C0HA 4DZHA 3DHFA 3W71A 4LUTA 1FFQA 5B80A 3B97A 3CAVA 4JICA 2G3JA 5DELA 2VEFA 1S1PA 4V2XA 3WDPP 4B3KA 1R9ZA 1VFHA 9XIMA 5KINA 1TWIA 5J5DA 4CCZA 5HDRA 4ZOAA 1XKYA 1XLAA 3BDKA 4K36A 2J6XA 3NQGA 4XV0A 4P7NA 4M6QA 4DJEC 2BGSA 1TJRA 2OWXA 5LYRA 4UNKA 4UTTC 5CPLA 5C2XA 1HL2A 2WJZA 3QV9A 3BE7A 4H19A 4RL3A 4XIMA 4O17A 2UV8G 2P8CA 4GBUA 2I7GA 3MI3A 5JBFA 3OBKA 4TV5A 3VE9A 3B0UX 4AWTA 1K8ZA 2X7WA 5CJNA 4RXFA 1MUMA 3ZJKA 1F6KA 3G6MA 4YL2A 4NU7A 2HBXA 2DSUA 3NIYA 3UG3A 3QPZA 4XISA 5LKYA 2J25A 4WY0A 3GO2A 4I8YA 1GKQA 5FL0A 4HZ6A 5HPCA 1SW0A 3AJXA 4BEQA 1ZJHA 1ZQ5A 2Z24A 3I3DA 1U1HA 4IIBA 4AFYA 4PMVA 5DEZA 4I8DA 1UKPA 3M0ZA 1D8WA 4NQ1A 4OBSA 2Z26A 4GLEA 1BWKA 4EPBC 4XD3A 1H2JA 4ENLA 1UR2A 1BXNA 4RE4A 3IGSA 3UERA 1Z9AA 1H7WA 4DYKA 3B8DA 3VKJA 4A2SA 3NO1A 1KKOA 1UBSA 3OEXA 1SZNA 1KFBA 3TN3A 1A5UA 4GABA 1BQGA 3WQOA 1UD2A 2XSBA 3K2GA 3I3EA 3B8IA 4L6OA 3G22A 1XYBA 3PZVA 5I3KA 5I23A 1F6PA 3GAKA 3LSBA 3M16A 4NVTA 3EOOA 1O12A 2YGYA 4LTSA 5F4XA 2BDQA 2BHYA 3L4YA 3NEHA 1DEDA 1Q6OA 1F3TA 2E3ZA 3WLIA 3G1SA 4Q4OA 3EOLA 1MWOA 1E6SM 4Q7BA 3S42A 5REQB 4JFUA 3GHRA 4UR8A 3L21A 1T41A 4F79A 1GJPA 3F03K 1YTDA 4GY0A 1G67A 2VFDA 4Q4QA 3R0KA 1CGYA 1KTBA 2HROA 3KCLA 3OO2A 2VURA 5G1MA 4J9JA 1BVZA 3UJRA 2D23A 3PJXA 2QCEA 2QQ6A 4ERAA 3ITCA 2XVLA 3DZ1A 4XVEA 5J5RA 2WZMA 1HKWA 3NSMA 1S2TA 3M44A 3EOUA 1YPFA 3E6EA 2FZBA 3RN6A 1US3A 1X1ZA 5G4EA 4NL1A 1VEOA 1V7YA 4UTUA 3T07A 2YZ5A 5CH9A 1M53A 1GOXA 2BVYA 4P8VA 4AWSA 5T8GA 3CYVA 4W7VA 4DF0A 3HQNA 5BXRA 1JRBA 3P5ZA 1QBAA 4EOUA 1KM2A 1B3VA 3CJPA 4I7VA 1FCVA 4R34A 3KX6A 3RO8A 2H8XA 4YYCA 1JPKA 2CKRA 5C9WA 1O60A 1LORA 1QT1A 3A3XA 5FSDC 4Y9AA 4Z0JA 1NJJA 3BLOA 1TPUA 5CC7A 4DBUA 3WNLA 2A3AA 2WV8A 2AKMA 2WVVA 1IF2A 3UVIA 2GWNA 2E6DA 5JIWA 2ABBA 4ADTA 3TWAA 4GJIA 1ZAJA 2Q3RA 3WENA 3AIEA 2QCCA 1W5PA 1W2PA 3WQGA 3WL0A 2F38A 3TWBA 1WDWA 2GWGA 1MNZA 1S2CA 2HMCA 4S3DA 4TU1A 4NZ3A 2VYOA 3N34A 5JBEA 1UZDA 2HS8A 4R53A 4CNOA 2R1NA 2AQOA 3HGOA 3ZVIA 1XBXA 4G6CA 1R3SA 4JNMA 4BFAA 2VGFA 3R4IA 2W5FA 3SCOA 2G96A 3F2CA 1YNPA 1W56A 2AGTA 1GPFA 2X40A 4PMYA 3EX1A 5MKGB 1GZJA 1CT5A 2OYKA 1R38A 4PTXA 5FOOA 3R89A 4L80A 1B4EA 4Z2KA 2TODA 4ECLA 1V79A 3ALFA 3VGBA 1B3OA 4EXAA 4HMNA 1L8NA 1E9LA 3P67A 5FA5A 3RX4A 1E5JA 1IYXA 3HG2A 3ZM8A 3ZIZA 3TCSA 2OQLA 2P8BA 2GDVA 3CK5A 3BW2A 5D32A 4R7JA 1EYWA 4OUEA 3PZGA 2F9RA 4WSJA 3RMEA 3N3TA 1J4EA 2IW0A 1ISYA 4GQRA 1V0KA 1WDQA 4H4IA 4RZ4A 5AHLA 4NJJA 4CD7A 1WBJA 1XLLA 2VZSA 1XC6A 1W8GA 4PODA 4I3GA 5J04A 5EMUA 2BNJA 4ZO9A 1TE6A 1RR2A 4KW2A 3UJEA 2DDXA 2O92A 3HB9A 1Q66A 2ATSA 2JE8A 1NWTA 4RZBA 4WSHA 4HNLA 2GVLA 3ZVHB 1FKWA 1TJPA 3MMWA 3BPWA 2DZBA 4F2TA 3DFSA 4UTFA 1YDOA 3CMJA 4NI8A 3D6NA 1MRAA 1TPEA 2WPBA 5EY5A 3H2EA 1YXYA 4F8XA 2C71A 3CMFA 1VFSA 2HSAA 2X2GA 1TB3A 2OGJA 3WH8A 3DI1A 3GIPA 2ON3A 4IGSA 3OIXA 4TXEA 5CSUA 1I2QA 3MHGA 1GUVA 3WBEA 3GXNA 1XSJA 3FLUA 4G56A 2D20A 4KGJA 4JYEA 3EA2A 3N17A 5D2TA 3TXVA 1FRBA 3AYVA 4YVPA 3G18A 1DTUA 3IPWA 5MHBA 3M0XA 2PF8A 1KQYA 3W1AA 1WZKA 2ZUTA 4EKJA 1KCXA 1NDYA 1JFHA 5EKYA 4BQ3A 1T7LA 2GK1B 4J1OA 5ABTA 2O7SA 3QTGA 1D8CA 1OHLA 4C60A 1WKYA 1IWBA 2PD5A 1BHGA 3HMCA 3PNZA 1UD6A 3DU0A 3CNYA 2R94A 5AY7A 2E6YA 4ZB2A 2WZIA 3O3RA 4EPDC 1PPIA 3MUZ1 3TC6A 2HE5A 1FUYA 3ZSSA 4DZ5A 3UESA 1JAEA 3BSGA 2Y5EA 1QHZA 3AOFA 3NQCA 4GNJA 4PH6A 3EEGA 4DO7A 4L9XA 3A9BA 3A5VA 4MWAE 4C6NA 1GPWA 3BL3A 4H6QA 4DPQA 4JD4A 3NQ8A 2X1SA 3CZKA 3CUJA 3TFXA 3SGZA 5M17A 1BKHA 4W5ZA 1IWPA 3P14A 1DXFA 4V1YA 3AO0A 3FA5A 2WM0A 2X42A 4D6FA 3O16A 2DPEA 4J27A 4AIUA 1V8EA 3OVGA 3W02A 5CJ5A 3EB2A 4AD3A 4GKTA 2V30A 4Q4RA 3BARA 3SUVA 2YBTA 1XLFA 4E8DA 3TP4A 4EANA 3QN3A 3VGFA 1OWQA 3WEMA 1GOKA 5AZ0A 1ELSA 3QTPA 4PCSA 3AU6A 1XPGA 4E3TA 3R94A 3FVDA 4GYFA 4ACYA 4X2RA 1UWIA 4LF2A 4U31A 3OA3A 3A64A 4UR9A 2R14A 4D6CA 3P74A 3AHTA 3G1AA 5CLTA 3USZA 1OGBA 1S2AA 3VDAA 5HULA 4ZQOA 1UWTA 4F9DA 1HJUA 1G4SA 5FJIA 3VZYA 2BOEX 3JUGA 3L4TA 4X0NA 1TRIA 1A5KC 2VP8A 3MP5A 4R3UA 4B5WA 1XLGA 4D72A 3UZZA 3HQOA 5CBIA 5HQLA 4H2HA 3V16A 3VDGA 3A4XA 3DGBA 4K39A 1GCYA 1O94A 2VVSA 3R2GA 1BGAA 3R1ZA 4MDPA 3VZZA 4RPPA 1XR2A 3QKZA 2YL5A 4IFKA 1PBGA 3MC5A 1I2NA 4DNHA 1HT6A 1V0NA 3CTTA 5FJUA 4EF8A 4I9TA 2WHLA 3K8LA 1OSEA 3ZJ6A 1KTCA 3W82A 1EZWA 4XAZA 3GFXA 5D9OA 1W37A 3H7VA 3E5BA 3JU2A 4XAYA 4PUWA 3ZO9A 3R0DA 3BJTA 1LG1A 1SZRA 3QZEA 5SWUA 2ZWYA 5DY2A 1KV5A 4RCXA 5CC6A 4L7ZA 1EIXA 1YADA 4RE3A 1SVDA 1RY8A 2ODOA 3LRLA 1TSIA 2C1GA 4LNYA 1QASA 4BF7A 3NXFA 3UR2A 1A49A 3ITYA 3VABA 2G97A 3RITA 3IS4A 3VGDA 4GGBA 4U28A 4UC5A 2ACUA 3EA3A 3ES8A 1VF8A 4LVAA 2VNCA 3QFEA 4P5UA 4GJJA 2QAPA 5G2WA 3TDFA 5D02A 4HHPA 4IJRA 1XLCA 2E9MA 1E4NA 1EC9A 2PAJA 2C3ZA 2Y6ZA 1ZUAX 3UEQA 1UCWA 4E0CA 1W9VA 5D2WA 1ICPA 1EJXC 4LXFA 1JG9A 1W3NA 4IM4A 1GVOA 1ZY9A 1HGYA 2HRWA 4KWUA 1JGMA 3DBPA 2OU4A 3NA8A 3ITOA 4YIWA 1V3KA 2QCDA 4PCFA 3AXHA 4RDZA 2J7EA 3NYZA 1QK0A 2KX9A 3LRKA 3ARRA 3TN6A 2QNEA 3APGA 2CXEA 3BLLA 1EHNA 3SM0A 3G0XA 2ISVA 5LNRA 3STCA 3W73A 3KOXA 4TV6A 4EXQA 3WD0A 3DG6A 4GI4A 4C6CA 4NAFB 4PMNA 2NZLA 1M01A 3DFYA 2BSLA 5A2AA 1EQCA 4L4MA 3FSTA 4KIRA 1M04A 3ZT5A 3M7WA 4PGLA 1XIJA 4HTBA 5DLCA 5E0KA 3GG7A 5I3JA 4UMCA 1A4MA 1R30A 3V35A 1NH6A 3AZSA 4LVBA 3S2NA 3AJ7A 2YFNA 2CU0A 3CL7A 3WQCA 3AHVA 4LVGA 4HPHA 3KVKA 8A3HA 2X1TA 2ALRA 3LI0A 1OFEA 1Y5WA 3T0AA 5EMJA 1F3WA 4N9DA 3F4VA 4IMEA 2BG5A 3K4AA 3DIPA 4GK8A 2XVKA 2HE8A 3W74A 4GISA 4NJKA 4ZTXA 3FAWA 3PVFA 2XIIA 3MBDA 3T42A 1HXJA 1ITCA 1DYSA 4HSHA 3ABXA 5I79A 1IR1A 2ZUVA 2AL2A 1DJXA 5CPQA 3ZZ1A 5HPOA 1KBLA 2PI6A 1UC5A 4OIFA 1G4PA 2ANUA 3GC2A 4KMQA 4MWAA 2DV0A 1JYXA 4MWAD 5D09A 4W86A 3JW7A 2ZUNA 4H41A 2OZ0A 3MP3A 1W8SA 1PZ0A 3CH0A 4LAUA 4N42A 1X7IA 4LYKA 4B5XA 1MNSA 4PFMA 2G3NA 2PB1A 2HVMA 3SECA 3PUOA 1RJRA 1C90A 5AVNA 5CGTA 3SAZA 4B5VA 5CC3A 1Z42A 1C3FA 4LEFA 4A22A 4A8LA 3CZJA 1KQZA 4H8UA 3WH7A 4ZSTA 5DANA 2VQTA 2VX5A 2Q8LA 1S3TC 4NJGA 3HOJA 1Q6RA 2PCQA 5JVLA 4XD4A 2WJEA 3N3MA 4GIAA 1M6JA 3H2NA 5JH2A 1A50A 1EEPA 2BXYA 3QLDA 1X97A 4KWVA 4UTWC 4O14A 2REQB 4A21A 3VNZA 3NZGA 3WLKX 2NQ9A 5FAGA 3BUVA 3C61A 1MXGA 4LUSB 4CCCA 1GVQA 3ZJ7A 3LHZA 2CLOA 4DO6A 2IQ0A 3MS8A 4OVXA 5HA7A 2PDCA 4XVDA 3N4AA 3FHAA 1HP4A 3WUFA 2XHYA 3E0VA 2WKJA 4GUFA 4K3ZA 4JHOA 1CLXA 1W1YA 4AMAA 1WPCA 4L56A 1JUKA 1OFAA 3PPCA 3WUBA 2WNWA 3SGUA 4AD1A 3H4XA 4HCHA 3KCJA 4KETA 2ONEA 1KBBA 3GYCA 5T9CE 2A85A 5H6HA 5F2IA 1YYAA 4GYJA 3FIGA 1PXGA 5ENLA 4TR9A 3LG3A 4HK7A 1W3JA 2WSYA 5DMLA 4PMXA 2EG6A 4CU6A 8XIAA 3H22A 3PPGA 2POZA 5C55A 3S1VA 3EGJA 3BVJA 3W2UA 3URAA 3GTXA 1UZHA 1ZP3A 4O57A 2EPNA 2E40A 4AD2A 3R7MA 1TR9A 1IE7C 2W27A 3WY1A 3T7VA 1M7XA 3FV9A 1PJ9A 3TX9A 4GFIA 7TAAA 4AD4A 5AHNA 1UR3M 1FWDC 1TA3B 4IIHA 3GW3A 2Y63A 4H2CA 2OB3A 2I5QA 1S5VA 2J24A 3AC0A 4E38A 1DJZA 4PRRA 1I75A 1TO3A 3BAKA 1HL9A 1NDVA 2GLKA 1YBQA 1BKSA 1KGWA 1AD1A 1SW7A 3Q45A 4FB7A 3CV7A 4KPLA 4QNWA 1K1DA 3G1DA 4BR1A 2PTXA 4JQAA 2UZ9A 3N73A 1KM1A 3WJZA 1IEWA 3UY7A 3UWVA 4JTCA 3KW3A 2A3CA 1PIFA 4DF1A 4R27A 1XBZA 3KDOA 1OBAA 2QAFA 4HGXA 1W5QA 1ZP4A 1HGWA 2TRSA 1JPMA 2QMJA 3BGJA 3DECA 1H7OA 1XLEA 4MPQA 1ENUA 5KETA 1RUSA 2FZDA 3LUTA 4CN4A 4GYPA 2PBGA 3W1UA 2ZUUA 3T6CA 4MNMA 3KFTA 4QJ5B 3FHQA 3HQPA 4ACZA 1PTDA 3NDZA 4JAWA 3TK7A 5A6BA 1AFSA 5A6BD 4CNNA 3A24A 4XZMX 3TSBA 1CLVA 4NZ4A 5DRCA 3S5NA 4PC8A 2X0YA 1GZGA 3OZMA 1TWZA 2RDXA 1RAKA 1U5VA 4JFSA 1XSIA 4TUFA 3PZOA 2WC3A 3MHUA 3V3WA 3SUSA 1J0YA 4EWND 5FI8A 3WQEA 4QDMA 1GYLA 3BLFA 1XGZA 2INFA 4NXKA 3HGSA 4S3JA 1XLDA 4W85A 3B3DA 3POCA 2Z2BA 3TW6A 1TQJA 3ZLGA 3CWHA 1RK5A 4JTJA 3W84A 2V2HA 3LXBA 3TOPA 1FWEC 3WMCA 4AYSA 4FLRA 2DVXA 2VDIA 3RM9A 4LX4A 3FXGA 4K7YA 3TJIA 2QDHA 2Z28A 4JTEA 1PSCA 1QAPA 4QE4A 4JQ3A 3V5FA 5I3DA 3TMQA 1KBIA 4N02A 2E1WA 1VRXA 1LL4A 3P0WA 5I3GA 2Y85A 4B91A 4D8LA 4CU8A 3ZWSA 4MNKA 1D3CA 3M07A 5B7ZA 1IZKA 2PRMA 3KBJA 1V6YA 3GKFA 4NASA 4JN7A 2XVNA 3VGHA 5IDZA 2PEVA 4DJFA 3WKZA 4DJFD 4YMZA 2HS6A 3VD5A 3AIUA 4HYRA 4W93A 4AWUA 3HM7A 1XS2A 1G9HA 1A0EA 1T40A 3WNPA 4DWSD 1W9XA 5F1VA 3CZLA 3M5ZA 4MM1A 2XG9A 4OECA 4Z0SA 5I07A 2WO5A 4F2BA 2BS9A 4IPNB 4AXKA 4PUNA 2YJQA 4HK5A 1TREA 2VR4A 2V63A 1AVAA 3P62A 2A3HA 3AICA 3FDKA 3L0GA 3B8SA 3PN8A 1TIWA 3PTMA 4DO5A 3SCPA 3TTOA 3WEOA 1K6WA 2B81A 4AZBA 4F0MA 4G7EB 1J12A 1OX4A 2EKCA 2VXNA 4XZBA 1YNYA 3JR2A 3S9YA 3UZXA 1LUCA 5A6SA 1MMFA 1N8WA 5EFFA 2FTPA 3FNDA 4PUKA 2ZZ5A 4O18A 5FD0A 3TXZA 1ME8A 3W6LA 3EX2A 2W3ZA 4IOTA 4JTAA 1WE5A 2QMKA 2V9DA 2YYUA 5DQPA 2Z6IA 5FF3A 4AEFA 3HV9A 2BV9A 2HBVA 3IEBA 8RUCA 3FGCB 3G0SA 3UW6A 1OFOA 5HJXA 1EYEA 1W1IE 4XUYA 3W1XA 5C2GA 4HSNA 2WSQA 1I2RA 5HANA 4Y8EA 3HJEA 2ZICA 5H2ZA 2EJAA 3RNDA 3GHUA 2QJHA 1CGUA 3MJYA 5LIKX 5KZDA 5D38A 3WG6A 1EJ7L 1R2RA 4I9AA 1D7KA 3S6TA 3STFA 3W7QA 1E1EA 4JQ2A 3VC6A 1AJ0A 1CDGA 2XH2A 4RPQA 1PKLA 1E9ZB 1GHRA 3W70A 5FJRA 2BXVA 2R1LA 3QRHA 3HG4A 1H61A 1UROA 2BXZA 1QNPA 2FVKA 5TF0A 1OVDA 4FI4A 4RNFA 4HD5A 2EPOA 3DHPA 3PUGA 3URNA 3PBGA 2J7BA 1EJUC 3GNNA 3VOHA 2WVUA 2WAGA 5A8NA 4JTKA 3IUDA 2DUZA 4IIGA 3KRZA 4F4RA 1KBJA 5EBUA 1JI1A 3KDNA 1Q6LA 4QHRA 4DAIA 4DWDA 1LOLA 1RZMA 3B8TA 3NVDA 5AC6A 3CHVA 2V81A 4I7UA 3APTA 2VMFA 4QIUA 2PDJA 3ELFA 3NGFA 4K2SA 4ZSUA 4FALA 2UBPC 4HA4A 2E0PA 5EYWA 1Q85A 4MFDA 3S4TA 1HL8A 2YB4A 1J0IA 2V8ZA 3H54A 1YRRA 1TMHA 3F5JA 4FR1A 1I0BA 1EUNA 4TVUA 3MJMA 1UMYA 4AYGA 2YDAA 2E7FA 4DUWA 2NXGA 3V0TA 1C8XA 1PKMA 2Q01A 1P6CA 2ZZ7A 4IF2A 2V5LA 3FYOA 5A6KA 4UQAA 3H12A 4G7FA 3NGJA 4J3SA 3B06A 5HK4A 1HJSA 1BWVA 3VCCA 2VOTA 5A2BA 4Q8PA 3MZ2A 4NI3A 4QAIA 1JYVA 1A0DA 3M6DA 3R8RA 4JFTA 1C9WA 3I3BA 2E25A 1LROA 3M0JA 3W7EA 3L65A 2PWEA 2HXTA 1NP2A 2QF8A 1TVPA 3SIZA 4L1XA 3JVAA 1Q6DA 3DUGA 2XUCA 1GVRA 1BXCA 1TTJA 3TN4A 3H7UA 1CW2A 5G1TA 2PLJA 2BLEA 4CD4A 2QUVA 4FR6A 9RUBA 3CIXA 2FHBA 2FPVA 1EP1A 4LWWA 2DQWA 2FJUB 3DKJA 4KEUA 3K1DA 4GHRA 2Y7FA 3AXXA 1R87A 5FEPA 2Z7GA 4U2YA 1JEZA 2V6AA 1HQTA 3SRFA 4HPXA 4NXSA 1CNVA 3SCUA 2NWRA 1X6UA 1ZCCA 3DFQA 4DIAA 1NQKA 5AOUA 1WXYA 3BW3A 3MV11 1VBRA 4FIQA 5IOBA 3U9IA 4CQDA 3IUHA 1TZ9A 3DESA 4DRSA 2WCSA 4N9EA 6REQA 4FX7A 1NDZA 2FMOA 3U5YA 4O13A 2AAMA 3GFYA 4NRSA 2G4FA 1HKIA 3QV6A 4LCQA 2OFJA 3VO0A 1UKSA 2YA1A 4XWUA 2Z1SA 3T0BA 4IFRA 1KM3A 2OKOA 4GH1A 2X30A 3U0HA 5GJNA 3REQB 1DOSA 1R85A 1TELA 3GZAA 1VBHA 3OIHA 1EKOA 4F0RA 3BGAA 2OJPA 1GVFA 3CUZA 3QH2A 1XIIA 2ZC1A 4HPNA 3O0KA 1EP2A 1ONWA 3NPWA 4YLWA 3O2LA 2Z1WA 3KCOA 3VNDA 4UQDA 2VC7A 3QBUA 4UZSA 5EL1A 4HN8A 3LLDA 3LPPA 3WNNA 2QR6A 1E0VA 4F0HA 5A6MA 2O56A 4PYSA 1D3HA 3C3UA 5JBDA 3O8AA 3UZ5A 4CD8A 3GKAA 1PX3A 5HJLA 3PBWA 2Y4SA 2D3LA 4XZHA 3O1NA 2ZDSA 2WSKA 3EWZA 1XV8A 2OT1A 3IIXA 1V5XA 4ATLA 1HO4A 3GYEA 1FWWA 2J27A 3UZYA 4WSKA 2FTYA 2RHGA 2GL5A 3A4AA 1RSCA 3HFYA 2A1YA 3UG4A 1WO2A 3IGUA 4P8XA 3QY7A 3GDKA 1IXOA 1GKRA 2QUMA 3EX3A 4WCJA 4QRNA 1NOWA 3TYDA 5FESA 2ZCGA 4DUOA 3BLPX 3E2SA 4ERGA 3WH9A 1W1VA 1PYFA 3H24A 2BX7A 1ODUA 3RRXA 1QW7A 2VC5A 2ZXBA 3C5QA 3OYXA 1FX6A 4L9YA 1AJZA 1AD4A 3HV8A 3BQ6A 4N9BA 3CHCA 5ABFA 4REQB 2ZIDA 1YDYA 3PG8A 3O6YX 4DBSA 5E0CA 5FEWA 3AS2A 4MUZA 4QNEA 3DAQA 5AB3A 1HKJA 4V28A 4TTGA 3RDKA 3UG8A 5AHIA 4W88A 4D2JA 4LEQA 1NM9A 4PSPA 3S3GA 2J7DA 1K4GA 1R3RA 3R25A 1W2VA 5LHFA 2Y7EA 2CZFA 1RD5A 3W23A 1IT8A 3GSMA 5KTLA 4ZVJA 4N2YA 3W3OA 1B90A 3VMOA 1UR1A 2XN1A 2A7NA 4IJBA 3CAWA 2C8NA 3VD9A 1YHTA 3QGAC 5BCAA 2GJNA 5LIWX 4ADUA 1EC7A 4DXXA 2FLIA 3IV8A 4G5DA 1JXKA 4TO8A 2GVGA 3C2YA 2JIEA 4JNZA 1K77A 2RJGA 2P10A 4PTVA 4LSBA 1RK6A 4FO4A 1GOMA 4GGHA 4DJEA 3SQSA 4DJED 4H7CA 4DHGA 1XP3A 2V68A 5I00A 1QI5A 5CKSA 1EJRC 4UMBA 3ERPA 4UTTA 2PTDA 3U5UA 2VWSA 4O0QA 3NOYA 2RDUA 2JQXA 7ENLA 3SY1A 2W91A 3TR9A 5G5IA 1N55A 5DRIA 4IP5A 3AMGA 1YTEA 2FZ9A 2WVVB 3SUUA 1UP2A 1U33A 3IACA 4K7VA 4PTMA 1I45A 3R8GA 2Z6JA 1ZAIA 1BEUA 3HPSA 1GYNA 2PLKA 3UJ2A 5K4ZA 5DF0A 2E1DA 2J66A 2TYSA 2XGIA 3F7JA 3GU1A 1WOAA 1IT0A 2BTMA 1B1YA 3E74A 3DENA 1QHOA 4AD0A 3SCTA 3Q65A 2J7CA 3G0UA 1KD0A 2FZNA 1AG1O 1UUOA 3CZGA 3G77A 3HQ1A 1UOZA 1UPMB 2Y62A 1VJZA 1PIGA 1OZMA 5AC4A 1H1ZA 4WR3A 1VKFA 4AMCA 3CUHA 1X6LA 3KVJA 4G1NA 4TVDA 4JKMA 3W24A 1V0MA 4NAEA 1PKYA 1J5TA 4XX6A 5E5CA 1SFSA 2WQPA 5JU6A 1X1OA 3QPEA 3LBMA 3DI0A 3IIOA 2FB3A 1VAHA 1ZB5A 2WKGA 1WB0A 4WLCA 1GWJA 1CEOA 2BHUA 2C6QA 1IIGA 4GXWA 4EPEC 3HZ3A 2H8ZA 3PJWA 1VYRA 5F4SA 3THQA 5F1UA 1FA2A 4A2RA 2NQLA 3L66A 2XN2A 4U10A 4EF9A 3P82A 1E6NA 4E6MA 3R13A 1NDWA 4UTHA 3N19B 3CXOA 4DI8A 4KH2A 3E02A 3F4DA 1XDLA 3DC0A 4GINA 2OX1A 4DN1A 3W1PA 4QDPA 2JF7A 4ZGYA 2JGQA 3MSGA 1CXLA 4QS5A 2C1IA 3IV3A 2ZBTA 4GZJA 4X63A 1PTAA 1VFOA 4O16A 1ZAHA 1V6WA 3T4CA 4ERIA 1GQNA 5HQEA 1THFD 3CZEA 1E0UA 1W32A 1EX5A 4DNMA 2PDPA 4R9OA 3ENLA 2CEQA 1K02A 1PX8A 2YCEA 1H0GA 1A80A 3NZQA 1QWKA 7REQB 4Q6XA 3DFHA 2QUUA 4D1IA 3D3FA 2VI0A 1UD5A 3LHVA 4H04A 3K30A 2VL4A 1IQ8A 3WK2A 1O66A 4HZ7A 4PUDA 2ZA3A 3PM6A 4AVOA 3VNMA 2QCGA 1SR9A 1BRLA 4JIQA 5A8GA 3O15A 1NEYA 2W92A 2QDEA 5BWFA 5DMYA 4MAZA 2GGEA 4LV4A 1JCTA 4D9PA 2DUXA 4A3YA 5K9XA 1JDDA 3LTYA 2BY1A 2DVTA 4PB3A 2WHMA 4M81A 3T0TA 4TX6A 4WJ8A 2D2JA 4JL1A 1FHVA 1EDGA 1NVMA 3U6WA 7ODCA 2DZPA 2Z00A 5CAKA 3PB0A 1R86A 1KGUA 1RA5A 4Q22A 3ZT7A 3HMJG 5TD4A 5CBJA 4YTRA 4HU0A 1MEWA 4OOUA 1CI1A 3T0CA 4P7QA 3H2MA 4I6KA 2QIIA 3KVMA 2NT0A 1IGSA 2IPGA 3VPLA 3E0LA 1OC6A 4G1KA 4AIOA 3IIZA 1PZ2A 4IP7A 1W5NA 2IUZA 3CHDA 3NZPA 3R43A 4CN6A 3KWSA 4O4VA 1LZOA 2V82A 5XIAA 2VENA 1XL9A 1BF6A 2C1HA 3L4ZA 1SZFA 2CLEA 3H21A 1KKRA 4O0KA 5EB8A 4CLMA 4JKKA 2AMXA 3MUCA 2DJLA 2CZVA 1LQ2A 2ZXDA 3LTPA 1SFTA 3TJXA 1NP0A 5LXEA 8TIMA 1PKNA 2HEJA 2IXVA 5ECUA 4YWIA 3A4JA 1LTDA 4RUBA 3WBXA 2AKZA 2VCAA 3WQ4A 2G50A 4K37A 1OD0A 4BQ4A 1JNEA 4C6MA 4ZBCA 4RNIA 1VZWA 3CHFA 1V6XA 1KR0A 3I6EA 1RHCA 1DWAM 3LNMA 1CX9A 3Q37A 2J78A 3S6DA 1OCNA 2A4AA 4PMUA 1B9ZA 1XISA 1I1WA 1KR1A 2PGFA 4E8GA 4EAMA 3BMWA 3EPNA 4CD6A 4Y7EA 2Q71A 4N7QA 4MB4A 4O54A 3MUIA 2V5DA 1SO5A 4YYFA 1WZMA 1XX1A 1W9PA 5AYXA 1NWSA 4DAFA 1FXQA 3M0KA 3BG5A 1N82A 2EF9A 1Q4WA 3FVMA 5HBFA 3QVQA 3UNTA 3N9KA 3K8MA 3PJUA 3VILA 4DQWA 1GHSA 5CG0A 1S2VA 3CAKA 3UXLA 2OLSA 1SSGA 4GG9A 4GZ7A 4IFKB 4LAMA 4MJMA 3PHAA 1TZ7A 2VCBA 3OLDA 4JHMA 5EMMA 3KZPA 2CLPA 3HPFA 1QXLA 2OPJA 4XO7A 1V02E 1R0MA 1ZL1A 1WCGA 2VJXA 3EWYA 4RE0A 4MLRA 4JTFA 1VRDA 1Z69A 5M03A 1XYAA 3A9IA 4QLLA 5LNSA 2TMDA 2X0HA 4QITA 4B92A 3TJLA 6XIMA 2VVNA 4WKFA 4MLJA 3M47A 3VMPA 3MQTA 1LLWA 2DFAA 1IZJA 3CPUA 5JMUA 3M0LA 3QMSA 1CGVA 5LNWA 4DX3A 3DHUA 4QE5A 5CXPA 2V3FA 4KWWA 4LYQA 1Q45A 2QVNA 1DQXA 2VGIA 3PTKA 2HNEA 2YR1A 2JBMA 4U4MA 1QTWA 3RR4A 2DT3A 1NAL1 4QXIA 3L0KA 3VYLA 3W7OA 3C2RA 2O7QA 4BS0A 2PTYA 4DO4A 3VX1A 2QCDB 3KXQA 3PZUA 2CW6A 4KFOA 4US6A 3BZJA 2B7OA 1ECQA 1GONA 2D0HA 1O5QA 4Y9PA 2G3FA 1G4TA 1RJPA 1BTMA 3VIOA 1FHUA 1W6TA 4O28A 3W2NA 1QU4A 1U83A 3MWCA 4M5PA 2Q6ZA 4AU0A 1KM4A 1ZBVA 3EOEA 3LN3A 3M4HA 4TQTA 1KW1A 3NFUA 3RG6A 3GG1A 3VIKA 3MUY1 3IGHX 4A29A 1A3XA 4HZ8A 2QKFA 1YX1A 2ZVIA 4EIVA 3N2CA 2DIJA 1V93A 4HQVA 3TCEA 4OQVA 5CBBA 2VRKA 5DN1A 4Y9NA 3LCFA 2C13A 3MBFA 3IVUA 1K7XA 1OF6A 4M82A 4LVDA 2X1IA 4WX2A 3KBSA 3SCRA 2NV9A 3TA6A 1X6NA 2XFWA 3W88A 3CASA 3S83A 2DP3A 4B3ZA 3KEHA 3WFAA 4A35A 4NUWA 4DJDC 4QISA 3GVVA 4YNGA 5EFDA 1C8VA 1RPXA 2IPFA 3M64A 2AL2B 2Y2WA 1D3GA 4MSSA 2CHNA 2FIQA 2PWUA 4MWAB 1GVSA 4LPCA 1S5TA 5A6JA 3QZ6A 4C5ZA 3N4FA 4HKPA 3T2PA 2ZX7A 4B9YA 6ALDA 3OBEA 1Z32X 1UBPC 2G0WA 4O1DA 1BYAA 2OCZA 3T2OA 4F2UA 3NJ3A 2DW6A 3SW6A 3KOWA 3C52A 2YXGA 1J96A 3LI1A 3W38A 3TTEA 2Y0FA 4XB3A 1AMYA 2G95A 4M51A 3HPXA 1I9CB 1TPH1 3LLXA 3OB8A 1E9YB 3UP8A 3QV7A 4P8WA 3WLPA 4OUIA 5BW6A 4AAJA 3O63A 3LMYA 3GHSA 4K1WA 4BY3A 5K2ZA 2QCLA 3C8FA 5A8OA 1FWHC 2EHHA 4E4UA 3COTA 3AISA 3TTYA 1VCFA 2DEPA 3QF0A 4J28A 1IEXA 4W8LA 3HPZA 3AALA 2YA2A 1X8FA 1JYNA 1J01A 1ZTVA 3CPGA 3NM1A 1SGJA 3IIVA 1LP6A 3FKKA 5LA1A 2PDQA 4KERA 1VFLA 3BTNA 3SO7A 4JKLA 2HPIA 5TAOA 4M29A 1B54A 1S5NA 4QM1A 3FN9A 4EVZA 4P7OA 5I78A 3T78A 1QO5A 2JALA 1HO1A 2CBVA 2JIWA 3RCYA 2YKKA 2XJ7A 1OB0A 4TMCA 1V3IA 4MZYA 1ICQA 3RAOA 4US5A 4US5D 3AI0A 1Y5VA 4W4QA 1UWRA 5H8UA 3GVGA 4M6PA 1UJPA 3W25A 2R8WA 5C7HA 2F84A 2WZTA 2E77A 3IAPA 1VP5A 1TJ1A 4AZCB 1LLOA 1POKA 2W67A 5XINA 4PN2A 3A22A 1C93A 3GC5A 4UTMA 1P6BA 3T1GA 1LM1A 1LOSA 3G8EA 4NZCA 2PFHA 2H9AB 1PO9A 2BFGA 3U2ZA 1FH8A 4AH7A 3S9IA 4NP7A 2P53A 1F9CA 3VNJA 1US0A 4H7VA 3BANA 2CBJA 4IPPA 3AQUA 2F2KA 4UBPC 1W1A1 3CBWA 5CSSA 1VS1A 2UY5A 2WVSA 3EDEA 2VWTA 4WXYA 4JPGA 3RLHA 4R5EA 2XFFA 4R7OA 2PODA 3W37A 4FXRA 1R3WA 1AH4A 4J3TA 3T08A 1O1HA 4XK2A 1UW9A 4DYEA 3GE7A 1YBQB 1QNOA 1MVYA 3I4KA 1ONXA 3HN3A 5A6TC 1WBHA 2FQIA 4QP0A 5IFTA 2E9BA 3OVRA 4DXKA 3CWNA 3LPOA 4H9ZA 1KB3A 4I6VA 1CYGA 4ZQMA 2G8ZA 1O7AA 3VM7A 1K7FA 5GPRA 3AHZA 1WV2A 1P7TB 4M3PA 5JH1A 4EACA 2J7GA 4M1RA 1F4AA 3S1GA 3WD4A 1XLIA 3QFWA 4L64A 4CCEA 5REQA 3A3HA 3AROA 4PTNA 3BCJA 3CO4A 1W54A 4OU1A 4B5TA 1M7OA 2DORA 1LYXA 2EJ1A 3SRKA 4C6LA 4LY4A 3NEVA 2XGZA 1OCBA 2PDKA 4UTWA 1XH0A 3W0KA 4PUUA 3W1RA 1UG6A 1XLKA 4H8VA 2AQWA 2VEGA 4ACZB 3R79A 1EB3A 2J4GA 2J9YA 2WJFA 1QMLA 4M7SA 1DP0A 2OSXA 1UPPA 2BVTA 4J4KA 4O11A 4UZUA 3CL8A 3ME3A 1NSJA 1CPUA 4R85A 4BF9A 1JYWA 4U33A 3UCDA 3UY8A 2CESA 3CB8A 3EMQA 3U57A 4AC7C 1VPXA 3CB3A 3FAXA 2X8RA 4KCUA 1FHDA 1TV4A 3FOKA 1SO4A 4BCEA 4GJ1A 2C19A 4FA3A 2MUCA 3EWCA 4Q6JA 4OT7A 1VFUA 1I0DA 3VA8A 3BJSA 1ZJBA 3DYOA 2R1PA 4XQ6A 3WD1A 2WMGA 2CC0A 1QBBA 3AFBA 4RZ6A 1QOPA 4IQEA 2GOKA 4ICMA 1VEMA 1VB9A 2ACSA 1WUFA 4LU0A 2OO6A 1XLHA 1TG7A 4LANA 1TKKA 2J74A 4AZIA 1B3XA 4LS1A 3CHEA 2OLHA 1VJSA 1MXDA 1XUZA 4S3KA 1NOFA 4UQEA 4GQBA 4D6HA 2Z0IA 1SYTA 3UXDA 2X09A 2WVTA 1AW5A 4R9XA 4FLQA 3R8HA 2XVPA 3IRSA 3NNTA 5HWNA 1Q6GA 2B7PA 2QJMA 1ZU8A 3E9AA 4ZL1A 4RNJA 3B9NA 2Z2UA 4C1LA 1XXXA 4S3CA 3WBYA 4QSHA 2GVEA 4PFHA 4KWOA 3PS7A 1EJSC 4UTJA 3ES7A 4GIRA 4KWSA 4HVXA 4LUJA 1BGGA 1E0WA 3WSUA 3VXGA 4NNAA 3GNXA 1GTEA 3N12A 4ZOEA 1E3XA 1H5VA 4D6DA 3LPFA 2I16A 4AW7A 2O4QA 4QGCA 3ARVA 5H91A 1MQQA 3WD2A 2ZXQA 4PTWA 3QR3A 2FYMA 3NQAA 1X38A 1OX4B 2BP1A 2HVNA 4YVVA 4J35A 5CGQA 3W7HA 1TPB1 4Q4PA 2YXOA 4S3GA 1VFTA 3VKBA 3GUGA 2PTZA 3G1XA 2J8TA 4NILA 1DIDA 1NF7A 2OG9A 1QOXA 4LW7A 3W1LA 1DKWA 1S38A 3FFSA 1JJKA 2YCKX 5BOOA 4FNUA 3TYBA 2X1UA 5HOSA 2FPTA 3BWWA 1MW0A 1MUWA 4ZB0A 3EA1A 1R9YA 3SFKA 2ACRA 2XN0A 2PURA 1J0JA 2FZ8A 2XIMA 4DVOA 4MPKA 4UXDA 4QCEA 1EO7A 4C90A 5G4HC 4YWSA 3V5CA 1RV8A 1JPHA 3M0MA 1PB0A 1VHCA 1TFVA 5E9XA 1ISXA 3JZUA 2OOGA 3Q67A 7XIMA 3ARZA 3PNUA 5HR6A 4PUEA 4Q7IA 3IJ8A 4LBUA 3BSMA 1KXTA 4AVFA 1G7VA 4Z2JA 3OGRA 1XFCA 4Y96A 1ZNNA 1X98A 3KOFA 4OOZA 4RDYA 4Q3MA 2QVHA 3QPYA 1JL8A 2PDFA 1BXBA 1JPDX 1JZ3A 1QJWA 3TU9A 3XINA 1Q7QA 3OPSA 4O52A 2J77A 1IEVA 1PTGA 5C6MA 2VC9A 1GVEA 3CQ0A 4G8TA 1A5LC 3GXIA 3I7QA 3LLFA 1RVKA 5M3WA 3LQGA 1EF2A 2UWFA 4HA0A 4LNCA 3W2MA 1B30A 4F9JA 3C3NA 4UOQA 4MNLA 1CWYA 1WX0A 1ZFJA 2XIJA 4Y2WA 3MB9A 4M6VA 4S3EA 3BOLA 4HMEA 1JCNA 2D3NA 1MZHA 3WDRA 2NSOA 4J3WA 3SSJA 2Y1HA 1UH4A 2D24A 1M7PA 3M46A 1WZLA 4KCVA 5I5RA 5IBXA 2RDTA 4E2VA 3IJ6A 2IKIA 5AHEA 4ZTYA 3WIJA 2Q3OA 2WJDA 2WWDA 3QC0A 4DI9A 4HMCA 1RH9A 3CT2A 1UWSA 5DBTA 1MDRA 1K70A 3ITLA 3PJTA 1R6WA 3PZQA 4Z42C 4ML9A 4XD5A 1OK4A 2NW0A 3UG5A 1WQ5A 2A5HA 3MKVA 3A12A 3STPA 1ITXA 4M0XA 2A21A 3MWAA 1ZS2A 1VBUA 3K1GA 2PDHA 5A95A 1IT7A 3SDOA 1XHGA 2YBUA 4QE1A 3RLGA 1WDDA 3L4XA 3TYCA 2VO5A 3AMCA 1XBVA 1ONEA 2OYMA 1GK8A 2CERA 4BA0A 1GG0A 4O8AA 3FXYA 3GNOA 4IPIA 3TIMA 2ZUMA 1KXVA 1OT1A 1AQ0A 4LB3A 1Z41A 2HDJA 1Z44A 1JCLA 2P3EA 1H49A 2KZHA 1NY1A 3WJXA 4L4PA 3DFTA 4ZODA 1HIZA 3GXFA 2GSEA 3ZR6A 3NQEA 4MWAC 4JEJA 3TFCA 4LCRA 5BMXA 4AB4A 2HJPA 4Q8OA 1JCXA 3VGGA 2D1ZA 2VR5A 1W1TA 1A5SA 4PCNA 3L7RA 1H7XA 3ZOAA 3VINA 3H6OA 4RV3A 5CG7A 4DB7A 3W7RA 1GG1A 1J18A 2XH7A 5A94A 4DEFA 3RX2A 2GOUA 3LA4A 3NL5A 1E72M 4UNLA 4AY7A 3S9ZA 3VOIA 4M6UA 4UQCA 2ZRWA 3W81A 2NVCA 2IXUA 6REQB 2Z1XA 4PTDA 2VX4A 2ZFAA 4J7RA 1C92A 1SJBA 3N9RA 4IMGA 4BEUA 4HHLA 5HMFA 2IQTA 2YL8A 1L2UA 1HVQA 4PE8A 6PTDA 4B5UA 2VEPA 2WMFA 2H3BA 4C6PA 4BWLC 2GVYA 1JI2A 3CGTA 4Z1BA 2BVWA 3N13A 3RU8X 4AZ7A 1XRFA 3AS3A 3I7RA 2B31A 4E5TA 2QJNA 2VQUA 2QXWA 4C6DA 1YNQA 3F5KA 3SY5A 1LBMA 1DJQA 1EBGA 4P2VA 3HBLA 1I2PA 2DSKA 2PWFA 4FK9A 4KT2A 1EJWC 3OW1A 2R6OA 2TAAA 2PWVA 1I4NA 4FLOA 5G1YA 1BSLA 1C7TA 3PZMA 1QHPA 3ARPA 4CN1A 3MCOA 2R1KA 1XDMA 1GW1A 2ZE3A 1EWDA 1TX0A 4QEHA 2W9MA 5DT5A 4JFWA 1JF5A 3THDA 4UWMA 3EMZA 4HU8A 2CBUA 3NL3A 3TE9A 4NAFA 1GOOA 2E6AA 3SBFA 1DIEA 1KM0A 4FXFA 4PSRA 1F07A 1A5OC 3T05A 4MKVA 5CPOA 3L68A 1XD0A 3KBMA 4Z1AA 1YE6A 3MTWA 2D0FA 1Z8AA 2ZRYA 1F76A 2MNRA 1FWTA 5A5WA 5AYZA 4AHPA 1X96A 4TTUA 1XKJA 1O5XA 1ECEA 1WUEA 4GVIA 3GB6A 5AVHA 4FNTA 1I2OA 2I5GA 3H26A 3W1MA 5ABFB 2PWHA 4MB1A 4HOWA 3Q58A 3TYZA 3ORWA 3QQ0A 3TC3A 5ABGA 4X9SA 2DU2A 3W75A 2V3EA 3AUOA 1OINA 3C0SA 1SFJA 1NFBA 3QKEA 2P5NA 3GTNA 1PVNA 3WNOA 4JCMA 3LENA 1UUQA 3ATYA 3I6TA 4GZIA 3FKRA 2Z25A 3KUMA 1UR9A 3DHDA 1JPIA 1EX1A 3LB0A 1MXSA 2GQ3A 4F66A 3R11A 1CXEA 2ZKMX 2YZRA 1IEQA 4YHGA 3MO4A 1WP6A 1RJQA 3ZR4A 3IANA 1YMYA 1VBJA 4S38A 1DJYA 4QJ3B 2RJHA 3KWXA 5FJJA 1I6NA 3WEZA 2J75A 1XICA 3STEA 3G1RA 1QUMA 3U3HA 4A4AA 3EWWA 4LOCA 1S1RA 2BHZA 3M0HA 3C56A 4QLJA 3E0IA 5H1WA 1XLBA 2VZUA 3KOZA 1GQLA 4ZB5A 5C8BB 1Q6QA 3KS6A 4Z2GA 3QQWA 2GUBA 4K8HA 4V1XA 3DDMA 4AD5A 4GKLA 1UD4A 4J3XA 2DT2A 5A6LA 1UR8A 1AH0A 1H41A 3WLTA 2VEIA 4ATWA 1Q7ZA 3TSMA 2REQA 3NOEA 3IJ7A 1DXEA 1PIIA 2ZZ3A 3FYYA 4LUSA 4BZYA 3B0YA 2PCEA 1REQA 5CPNA 2PSNA 4XKYA 2G4JA 4GC3A 4BJHA 1KXQA 3LCGA 3ITTA 4CEUC 3GTHA 3W2JA 5HATA 1GJWA 1XWYA 1UR4A 3RFAA 4AWEA 1YQ2A 4A05A 3S8HA 3M41A 3WQPA 2DSVA 3W7DA 3ZMRA 4WJXA 1A47A 3W07A 3EKZA 1XRTA 4FXSA 3A13A 3V5OA 4MB5A 4E2OA 3G2GA 3WLQA 2O0TA 1JD7A 2YL9A 4JIPA 5E6YA 3DFOA 3VTRA 1PHQA 5BXPA 3SCWA 4OV9A 1QNQA 5T9BG 4RW3A 3BJFA 4NY2A 3K4WA 2I14A 3BLEA 1EL3A 4HPGA 4LH8A 3WQ6A 2PUZA 2PWDA 4FAMA 1KRMA 1EO5A 3P6LA 3GH5A 1H1NA 1JDCA 4L5ZA 3MSDA 4M80A 4V27A 2YCIX 4H6KA 3WK3A 3UXIA 1H63A 3WCZA 3BURA 3PBUA 2I57A 1A0CA 1A5AA 1R8LA 2J9XA 1KNWA 3K13A 1Q2RA 1EH9A 4WIWA 3SRDA 3P5YA 4W5UA 4H1ZA 3EBVA 1VBGA 5D2VA 2OT0A 2J6VA 3GDMA 1EXBA 4C1NB 2V5JA 3V0SA 1TA3A 4W87A 1V3MA 3H2FA 2OZ8A 1K3UA 1U2YA 4H00A 3P2VA 2OSYA 2Q8XA 3ONBA 4XIAA 3NVTA 4UOJA 1UKTA 1F7BA 5HXMA 1VPYA 5FEXA 4BQ5A 4HHHA 3OG2A 3WQ8A 1BG4A 3CLWA 4PMRA 4UFMA 5EMYA 3T9PA 1LQAA 2VGBA 6CGTA 2LLEA 4WY0F 4PRTA 4HNCA 1HJXA 4E4FA 5C9UA 5M1TA 1HVXA 1CECA 2CHRA 2A3LA 2CWNA 5ECVA 2GVJA 1PDZA 2QT3A 2WWCA 3AYSA 1TV5A 4D71A 3WK0A 5I02A 5D8ZA 4RZ5A 2V2DA 4IL0A 4QQUA 1YTKA 4DYJA 1R9XA 2KAUC 3W6YA 3WQVA 2F6XA 1XYZA 4J3UA 4O15A 3U7VA 1JVNA 4GOAA 3UETA 2NUXA 5CZJA 4MYAA 3M1ZA 1RCXB 3BAJA 1K9TA 3VK5A 1Y5XA 3BW4A 4L1WA 1WDRA 1TYGA 2B0MA 2VDHA 4WKAA 4ZCWA 2X41A 1BRLB 2OWWA 3W4RA 7TIMA 3UQNA 3ARQA 4PZVA 1W1B1 4LUYA 4X61A 3L2IA 2ZA1A 2EGZA 5IRPA 5HINA 3GDBA 1JZ2A 2V5BA 1GTHA 1UWQA 2H90A 6TIMA 2W4XA 1OM0A 2NUYA 4DLFA 3B0XA 1OQFA 4JTHA 4QG8A 1DJIA 3NQFA 4IIDA 4S2CA 1NFGA 1UA3A 3GNPA 4GO9A 2VFGA 2QV4A 4PB4A 5CCZA 1UZ1A 3QGKC 3SR7A 3IVTA 1FDZA 1KFCA 3R6IA 4HMDA 1VLIA 2W66A 3NUKA 3VNIA 4Z1YA 1JZ8A 1RCOB 3LCWA 5HNNA 3V0UA 4CCDA 3LD5A 2DZSA 4JFVA 3IIPA 4MZ8A 1F3EA 3OVPA 4GRSA 1PYMA 4XZNX 3LBCA 1US2A 2HISA 2EXOA 4JCLA 3TKFA 5I0DA 1SZEA 5BRQA 3CU2A 4KFPA 2OELA 3LHYA 4LRTA 4F0SA 9XIAA 1TIMA 1SPQA 2P50A 1UJQA 1AJ2A 3L2MA 4NSBA 1J8VA 2Z29A 3DBNA 3GIYA 4XBJA 2J47A 3S47A 1XDJA 2W63A 2XISA 2E8YA 3E38A 4RLIA 5BYWA 3TH6A 6ENLA 4A3HA 4UTIA 3ARSA 4ICNA 3L5AA 3WF0A 3OHMB 2DZVA 3R10A 1VIWA 4PCPA 3EWXA 3INPA 4FIRA 4W9TA 5GNYA 2VRQA 3H7RA 3EXRA 4B90A 3FS2A 3URBA 1WNOA 4MADA 3CTLA 4NG3A 2ZC8A 3C0JA 4HCDA 3RX3A 3WBWA 3G1YA 2OGYA 3UA3A 4CNSA 5HWJA 3HGJA 4LC6A 4ROQA 4IX2A 3MHFA 3DGRA 3L9CA 4IPLA 3TLQA 3RCMA 5KZ6A 3OLGA 1H09A 4UCFA 2V3GA 5BRPA 3L4WA 4C91A 5LIXX 3KLLA 2Z4GA 2EG8A 1TZZA 2W6RA 1P4CA 1E43A 4MDOA 1LBLA 1MQPA 4EAYA 4LFYA 4AG0A 1XYLA 2J8GA 2ZXAA 3V7PA 4O19A 1ZJAA 5D04C 8CGTA 4J2PA 4UFJA 1X7FA 1M03A 2NV2A 4L61A 3D3AA 3TUUA 3IWPA 1KRCC 1W3IA 1TQXA 1JAKA 4PL1A 5DY3A 4XBKA 3N15A 4AX6A 4NZJA 1LDCA 3VE7A 2O55A 1CXHA 3FGCA 2Y70A 2AQVA 4YHEA 2GSHA 1H0IA 5D9PA 3VUPA 2A0NA 3RUBL 2EPKX 1FCQA 2HVOA 4M19A 3GHTA 4H6EA 1ISWA 5KITA 1DL3A 1RLCL 3QW4B 4JTUA 2FHFA 1ZZMA 4O1CA 4MY1A 3CUIA 2F6UA 3VU2A 4Q8NA 2QV5A 3FSUA 1RALA 1RCQA 2CHOA 2ZUWA 3GK0A 4B5SA 1HJWA 4B4HA 1G7UA 3PZNA 1Y7VA 3U7BA 5I3HA 2ISFA 3BG9A 5EPDA 4K1GA 1FWJC 3KP0A 1C8QA 5DFAA 3RMJA 1G6CA 5U4NA 2DZTA 3C4UA 2DJXA 4JTQA 3UR8A 4L4OA 4AUBA 2I56A 3OQ8A 3GG8A 1ALDA 1CZ1A 2ZA2A 1ISVA 3LV6A 1H51A 4KQNA 1UR0A 4Z17A 4GACA 4RJEA 1XC4A 4H9UA 1R5YA 2FDSA 4YCPA 3C0QA 1J79A 1Q63A 1EUAA 2BY0A 3D47A 4IJCA 3S2CA 4IIEA 1JNDA 3DG3A 3B0VC 2DGAA 3RCNA 3TNOA 1H7PA 2WANA 4W7UA 2PLMA 3KOYA 4H3DA 4IXHA 2QPSA 1PX4A 2GJLA 2YW4A 1HKKA 4C7DA 5BOEA 1QPQA 1OYBA 1W31A 5L9FA 4Q8MA 4QG9A 2PA6A 4IG2A 3MO7A 5I3FA 4Q4MA 4AEOA 4GBDA 3AIWA 4LYPA 4BKNA 3D46A 1Z89A 2XIOA 3R12A 1P0BA 3JRKA 2GQ9A 3WFZA 1OFDA 3UJSA 3ANVA 4HT3A 3UGRA 5I03A 2P1FA 3BV7A 1ESWA 3GBDA 3PP7A 3VAVA 1JIBA 1ODZA 2GUUA 3FJ6A 3OG3A 3ZQ9A 3WDJA 2TSYA 1LOQA 1ME9A 1OX5A 4B4FA 1AQMA 2BODX 3UYIA 3QHOA 5M5DA 3C2EA 4E2DA 3BOXA 1L8PA 2W61A 1QNVA 3NYDA 1DHKA 2Z1VA 1EDTA 3QM3A 4YXGA 2FTWA 4JDYA 4ATDA 4UTKA 5I09A 2WMIA 3A3WA 3BSHA 1QO2A 4FS9A 4WQ6A 3WNKA 3EZ4A 2CLMA 2C79A 3ABSA 1XIHA 2PDUA 5A2CA 5D2XA 1W3TA 4W89A 1UP3A 3M5YA 1FDJA 1GOQA 1A53A 2W0UA 2X7VA 1OGSA 1S5MA 2YL6A 3AZTA 4FNPA 4PBFA 3N6JA 2C14A 2CWXA 1E4MM 3LZ5A 1EOKA 1AW2A 1TJ2A 3MI2A 2OEKA 3W22A 3A5FA 3PBYA 4PBEA 4C6JA 3E0FA 4A3UA 3PZIA 3U2OA 5LSMA 4Q8QA 4H9YA 9CGTA 3BMVA 1J2WA 2WZHA 1RBLA 4KGLA 1E6QM 5EA9A 2HK1A 5TNVA 2I9UA 2DSWA 1VGAA 3LU2A 5A69A 1V6UA 1TUFA 4K8GA 3PULA 5CQ1A 3MCNA 3LEPA 2DIEA 1F73A 2JKEA 3KLKA 2VKZG 4ALDA 1V4YA 3DFPA 3GG0A 3VD4A 1K9DA 1TPVA 5BROA 2AL1A 1V77A 1V3LA 4M24A 3REQA 2DY3A 3WLHA 2NQJA 1SJAA 1A5MC 1IXNA 5C7VA 3HG5A 1PAMA 1KWGA 5KZEA 2ZTJA 4LCSA 1EA0A 2OZTA 2NLYA 3G24A 4LYRA 2JFEX 3WUEA 2QCNA 1T0OA 1TCDA 2D0GA 4IGNA 1KFWA 4KRUA 4HOZA 3G1HA 3VMNA 4UOZA 5G2IA 1Q2SA 4ZE5A 1AMKA 4DM2A 2E6FA 3LRMA 3PR2A 2DSZA 3WD3A 4N4QA 3THAA 3P61A 1WOBA 2DT1A 3BH4A 4X60A 1MFVA 4WDUA 4DWSA 4E2BA 3S46A 3HO8A 3S1WA 2P0OA 3IGXA 3MV01 2HK0A 2ZQ0A 2NLIA 3ARWA 3VIIA 3BGGA 2C7FA 3WJYA 1TPFA 2WC7A 3L0NA 1W1ZA 1XLJA 4CKQA 4NX5A 3N1AA 4DJDA 4DJDD 2D2OA 3ARTA 3KRUA 5FF0A 2DUAA 5FSEC 4GPNA 3UZWA 2IKGA 4QLKA 1VIZA 2NQHA