3QH2A

Crystal structure of teni from bacillus subtilis complexed with product cthz-p
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
195
Chain Sequence
SHMELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFGRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMRYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Missing Enzyme in Thiamin Thiazole Biosynthesis: Identification of TenI as a Thiazole Tautomerase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords Regulatory protein tenI
total genus 77
structure length 195
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 5.3.99.10: Thiazole tautomerase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qh2A00
4RZ6A 3EX3A 4CCEA 2G97A 4K37A 4PH6A 1KFKA 4Y96A 3DFQA 1GVOA 2GPTA 3G1HA 1F2JA 4HSOA 3LERA 1XCFA 1SW0A 5DCEA 4FHAA 1G69A 3TAKA 4JX5A 2V5BA 2FFCA 3LHVA 4M7TA 1EEPA 1TV8A 1S5VA 4LVBA 3F03K 3LXCA 4R53A 2GOUA 3GXNA 4K39A 4UNLA 3TFXA 1H5YA 1N8FA 3R12A 1RQHA 3W1XA 4UMAA 1D3HA 1THFD 2B7NA 3PBWA 5DBUA 1ZNNA 4GFSA 3W84A 1AW1A 3W6YA 6ALDA 2DJLA 3MP5A 3QYQA 5AHIA 2E6AA 1I2OA 1XKYA 1TTPA 1JCLA 5AN7A 3OHIA 4LW7A 5DXYA 3W7CA 2JGYA 5K4ZA 3N9SA 1SO4A 4H6KA 2X30A 3UWZA 1OK6A 4RK8A 2Y61A 1EUNA 2H90A 4MLJA 2ZRUA 4UTJA 3IV3A 3N34A 1O5XA 1L6SA 3W9ZA 2Z6JA 1VHCA 4WY0A 3VFLA 3EX6A 1W3NA 1XDLA 3BLIA 5AB3A 1GTHA 1W3IA 3SECA 3GNNA 3NXFA 5L6UA 2O7SA 4LRTA 3WK3A 1SW7A 4JTFA 2DU2A 1ONRA 1XBXA 2F7FA 3UY8A 4AWUA 2YZRA 1TB3A 1OFOA 3C2EA 3C56A 4LY8A 3S8HA 1OX4B 3OVPA 1QO2A 3MO7A 1SZNA 2Y7EA 1ZALA 3LHZA 4UUIA 1PL9A 1YADA 3O6CA 5AHNA 1B57A 1TTJA 3S5YA 5KITA 3RU6A 4WQ6A 4UR7A 2B7OA 2E77A 1OFRA 4FF7A 1O60A 3M9YA 3MYOA 4ALDA 1TPUA 1PHQA 1SZFA 2P1FA 3C2VA 1YPIA 3EKZA 4KWWA 1SO5A 2WQPA 4CCCA 5D38A 2CLMA 3C0JA 5D2XA 4NX0A 4PFMA 3PG8A 5EL1A 1YTKA 3EXTA 3H54A 1F7BA 3NQFA 1LYXA 1I2PA 1EP2A 1CX9A 1Z41A 4KFPA 3LCXA 3EXSA 3FYPA 3W1PA 2YW4A 3TXZA 1JVNA 4NZJA 2PURA 2TPSA 3AJXA 4IXXA 5FEWA 3IGUA 5D37A 2A6NA 3G0XA 4WY0B 2RH9A 4O53A 4DO6A 1SUXA 3G8RA 5G2IA 2Z2UA 1J5TA 1VYPX 2OCZA 3AO0A 5U4NA 5KZDA 4IMCA 3ATYA 1KLYA 2NUXA 3QQ0A 3W7GA 1PCKA 5G1TA 1W5OA 1FCBA 4HKPA 3TR2A 1U5JA 4GUHA 2E09A 3TROA 3W7PA 3FYOA 1B4KA 5DELA 1TIMA 3FIGA 5EKYA 2WSRA 1FCUA 4K8HA 4N9DA 5LGXA 1DL3A 2X1SA 2VFFA 2FJKA 3P8IA 1OX4A 3G1DA 4JNMA 3O05A 4FXSA 1PHWA 1KFLA 2E6DA 3WJZA 4ZQPA 3BARA 3VI2A 4WX2A 5K4XA 1XFBA 1FDZA 1W54A 1VYRA 1YDOA 4HT3A 1H51A 1FWNA 1TREA 3B4UA 3W83A 1TTIA 4D2JA 2QCMA 4IOTA 2ZTKA 3LOTA 3DAQA 3NQ2A 3QZEA 3NL6A 1YXYA 1G67A 3CTLA 3W7NA 4R7JA 1G4EA 3HF3A 4GNJA 3C52A 2Y7DA 5J5RA 1F6KA 4CNPA 2RHGA 3TSDA 5F2GA 1Q45A 3W2JA 1GVSA 1OX5A 1LOQA 1K3UA 1LROA 4N9BA 4ZQOA 3WJWA 3W2KA 4GRSA 3QQ1A 1MXSA 1O4UA 1TO3A 1I8JA 3W2UA 3NQAA 4DPQA 3NM3A 2WNZA 1VGAA 2Y70A 1VCFA 3P7YA 7TIMA 1TPH1 3HPZA 2DZVA 2A6LA 4N6FA 3LTYA 3LV5A 3NM1A 4U28A 4AVFA 4L4MA 2WNQA 3DFOA 1AL8A 2E1DA 4TMBA 1WBHA 2J9YA 1NFBA 5AHLA 1R30A 2Z0IA 3DH7A 3HJZA 4Y6GA 3SSJA 4JIPA 3P81A 5I3FA 3ELFA 5H91A 3NNTA 4BI5A 2OX1A 2I14A 4BI6A 3EX1A 2Y88A 1G4TA 1M5WA 1SSGA 1SZEA 1SPQA 5CPNA 3FEMA 5AFDA 3LCFA 2NUYA 1K8ZA 2A21A 1K8YA 4UTIA 5CSRA 3PB0A 3W1QA 1JR1A 4CCDA 3P80A 3DFSA 1F74A 3BW3A 2WOQA 1FX6A 1TPDA 3W1UA 3MUXA 2NV1A 4A21A 4RX0A 3GAKA 3CB8A 4O8RA 5BMXA 2QCNA 2QAPA 4HNTA 3N9RA 2FTPA 1D9EA 2YW3A 2ZTJA 3IVSA 1I45A 4O18A 3SZ8A 4JY8A 4NX5A 2XFWA 3W1LA 1VR6A 2D73A 1TV7A 4FNUA 1SW3A 3LI1A 1KV8A 4A29A 2C1HA 1YLVA 2A4AA 5D33A 4FX7A 4XKYB 3KVLA 1YTDA 2EHHA 4L4LA 3UPBA 1FY6A 2ATSA 2V82A 4GUGA 5FESA 2QJIA 3GZ3A 5AC7A 4O15A 3G8EA 1C9DA 1E51A 1VCVA 1DHPA 3NZ1A 2C14A 3ZR4A 2ZCGA 2WSQA 3GX9A 3DFPA 1W3TA 4JR5A 3I68A 1XUUA 2V30A 2Z1BA 5AYZA 3UWQA 3G24A 4GUJA 3GR8A 4RJEA 5DY3A 1GG1A 4LS0A 4DF1A 2ZRXA 1LDCA 2ABBA 3WJYA 4UTMA 5K7JA 4LWWA 1F6PA 3WJXA 1LBFA 2C6QA 4WJEA 3L68A 1WOBA 6TIMA 2A7PA 1L6WA 1N55A 3NDOA 3TDFA 3PM6A 3NL2A 2Q8LA 2ZRYA 2B4GA 1ALDA 1OF8A 2ISSA 2RDTA 4AHQA 4IX2A 3M5YA 4S2BA 4MYAA 1NSJA 4E38A 1JUEA 1IXNA 3ZWTA 4FO4A 3QRHA 2NX3A 4O57A 3T78A 3C2RA 4IUOA 3G1VA 4NNCA 4C1LA 2OJPA 1T96A 2ATMA 3IGXA 5C2XA 3RFAA 3B0UX 1XL9A 4XKYA 4Z1DA 3W7LA 2ZRWA 1XI3A 4EOUA 1B3OA 2DZUA 2NX1A 3QM3A 2FPYA 1QR7A 4UFMA 3NG3A 3S5NA 3R89A 1Y0EA 4KFNA 5EA9A 1TRDA 3L0NA 3OIXA 1QWGA 2NWRA 2YCEA 2QEZA 1A53A 3MI3A 1QMLA 2JKPA 4UTWA 2FPTA 1FCQA 5EMUA 2VEKA 3GXPA 3L0KA 3MW7A 1FDJA 3W7EA 3TUUA 5CSSA 5BNKA 2B0MA 3CT7A 3M5ZA 3KOFA 3RLVA 5F4WA 1BWKA 5AYYA 4IMFA 1EP3A 2ZA2A 3EXRA 2Y7GA 5H2ZA 1Q6RA 5E0KA 4LUIA 3P5ZA 2PE4A 3N19B 2X2GA 1L6YA 3P5YA 1N7KA 2XN0A 5EBUA 3BLFA 2H3BA 4HPXA 1UBSA 3I7RA 1YPFA 3B06A 4TR9A 1ME8A 1JCYA 1W5QA 1LBLA 4OV4A 3LTPA 4OU1A 1OFQA 2YFOA 1NAL1 1P1XA 2JKEA 1KBJA 3NR0A 3W70A 1WX0A 4CLMA 4FIRA 4DQWA 3NQVA 3W7QA 2J9XA 3TXVA 3B0VC 1JCXA 4JDYA 4O10A 3V75A 5K9CA 2AQWA 1HFBA 3WK1A 2VFGA 4YWIA 1AW5A 3FS2A 1AMKA 1RQEA 1KM4A 4K38A 3NQEA 1OFPA 1W37A 3PBYA 3A24A 1DQWA 4X9SA 3D0CA 1SR9A 3CEPA 1HO1A 3MI2A 3S1VA 1B4EA 1HO4A 3W2LA 1TPFA 3TMLA 1JCJA 3NQ6A 2A1YA 1LRNA 4Q33A 2C16A 1W1ZA 2OT1A 1WV2A 1ZAHA 3TA6A 1KFJA 4IQLA 4LTSA 1ZFJA 3KX6A 4P2VA 3DKJA 3LCHA 2HS6A 4MFDA 2CZDA 1HL2A 4RZ5A 1LCOA 5DXXA 5CZTA 1VRDA 4MJZA 3O06A 4H3DA 3O8AA 1ME9A 1LP6A 3EWUA 4LV4A 1NEYA 4AHOA 2NUWA 4QNEA 5KSWA 4IWWA 3CWOX 3IIPA 4Z0SA 4PL2A 3HGRA 4ZQNA 4MKNA 4QSHA 3QSTA 3KVJA 2W6RA 4YLWA 3HMJG 3SJ3A 3FJ6A 1LOLA 4JS3A 2TMDA 4JDBA 4ADUA 3TQ0A 3DXIA 1PV8A 1RR2A 2EF9A 3QJAA 1HG3A 1G6CA 3CHVA 2Y63A 2I9EA 1TQXA 3FLUA 3HOJA 5K2ZA 2QKFA 1H7PA 4MY8A 1TMHA 2TYSA 5CPLA 3W88A 3M0ZA 3S5OA 4DPPA 1RPXA 2H3DA 2ZZ3A 1J4EA 1KM5A 4ZQRA 4JX6A 3U6WA 3W22A 3G1XA 2FLIA 3L0GA 4O1BA 1R46A 3MYPA 1KM0A 2WV8A 1RD5A 4JEQA 4HNVA 1Z48A 4XTIA 3BW4A 3E0IA 1RV8A 1U83A 3GIYA 5FF3A 1GYLA 4CQ8A 4POCA 1GJPA 3F4NA 4XTDA 4WD0A 2QJGA 2ZBTA 2IQTA 3CLMA 4O1CA 5BW6A 1NF0A 4OWGA 2W79A 3QMSA 3PVFA 1K03A 4E0CA 3LCLA 4X22A 1GOXA 4WXYA 4NJGA 4X3ZA 3RK8A 5TBOA 2YX0A 1KTCA 4MZ1A 2QDHA 3RF9A 3NGJA 3OBKA 3SFKA 3UQNA 4K8EA 4GBUA 3TH6A 3GNDA 1KTBA 1P0NA 2ISVA 3H53A 3O1NA 2OT0A 2NX9A 2VELA 3CEUA 2CLLA 1Z44A 1X8FA 4Z1AA 3N73A 4XUGA 3TIMA 3HG5A 1K7XA 1SO6A 3QFEA 2YYTA 4UFIA 3C61A 1IGSA 2RDUA 1ZHAA 3SR7A 3GKFA 4BFAA 4MFEA 4HIBA 4K7VA 3TQVA 3NQ8A 4ZQMA 5C55A 1H63A 4RKAA 1LBMA 2YR1A 4K36A 1GZGA 1WQ5A 2YSWA 4BWLA 3STEA 2A7NA 4LV9A 5GVJA 1FDYA 4NZFA 4XQ6A 3GDRA 1XDMA 3RMJA 4KFOA 1FWRA 3PSVA 5DN1A 1Q3NA 4LT9A 3UNDA 3TV8A 2E6FA 4P61A 3KRUA 4R33A 3EWZA 3G1SA 4O19A 3M41A 1NF7A 4M19A 1VQTA 1GT8A 3N2MA 4FX8A 3PUOA 1B9BA 2HSAA 5TIMA 3EWWA 4AH7A 5CGQA 3MJYA 1P4CA 3ZS4A 4JTSA 2C0AA 5DCBA 5LZLA 4TX9A 2GJLA 1ZAIA 2E5CA 3CIWA 4NVTA 4PC8A 4QNWA 4AF0A 3A9IA 2PC4A 3SGUA 5U7SA 3GDTA 4C1KA 4JIQA 2ZZ7A 4UTTC 3ZWSA 3L67A 1OYAA 1W8SA 4NU7A 1VH7A 1G4SA 4JY9A 1LRTA 1LM1A 3L5LA 5DY2A 1QDSA 5AHFA 4B5NA 2BXVA 1Q6LA 3ABQA 1ICPA 4EF8A 3LCGA 2Y85A 5IBXA 3QC3A 1G7UA 2Q8ZA 1AW2A 5HULA 2DZXA 4LUJA 1QPNA 4CQ9A 4K7YA 3UXDA 2QUTA 4AWSA 5FEXA 5KZMA 4JTUA 1WYIA 2V5LA 5LNVA 3O07A 3W7OA 5FF7A 5HINA 4DBEA 3QMTA 2Z6IA 3GYEA 3A21A 3MWAA 1TPC1 3GKAA 3DFTA 1C8VA 4MLRA 4LS2A 5FEPA 3R2GA 4O11A 3T40A 4UFHA 5CZSA 5DLCA 3IEBA 1FBAA 4Z1BA 4I9AA 1YXDA 4LC8A 1SSDA 2PRMA 5CKSA 2ZZ5A 3I7QA 1LZOA 1T0OA 4BWLC 3I6RA 3W1MA 1QO5A 1QPOA 4NNAA 1TJPA 2VEIA 4LVDA 2OMAA 3KVKA 3W2NA 3QPYA 1KA9F 4Z0JA 3BW2A 4IMGA 5D05A 4NJKA 1A50A 2DZPA 3NPWA 4QAIA 5C5YA 2ZQ0A 3TFCA 3HB9A 4K6AA 5AHEA 1DJNA 1JULA 2CU0A 3SIZA 4ZL1A 3W75A 3PC0A 1GVFA 2R8WA 3IIVA 3MHUA 3LCWA 4O13A 5HUOA 2V2HA 2G95A 1BTMA 1UUMA 2A2IA 3G3DA 3GLCA 3M6YA 1XBYA 3LBMA 1WDWA 2E5BA 3TC6A 1YTEA 2WPBA 3GVGA 1H7XA 1QPQA 2WSYA 3L66A 2R94A 3HIJA 4N4PA 4BF9A 2CW6A 1F76A 2VC6A 3W85A 1R2RA 5A5WA 1S3HA 4Y8FA 5F2IA 5K3VA 4UTWC 3KRZA 3NL5A 3DU0A 1PCWA 4O54A 3STGA 5CG7A 2ISWA 3TQKA 1W31A 3WK2A 3USBA 1W5PA 3W7HA 1FQ0A 4LVGA 1JJKA 4UNKA 2Y6ZA 5T26A 3O16A 4JGDA 3HGOA 1DV7A 3NO5A 2GQ9A 3GK0A 3PBVA 4OBTA 1FUYA 1W5NA 3BG3A 3JR2A 4YMZA 2VEMA 3NA8A 3E12A 5IBXC 3LLDA 4N4QA 3W73A 3TJXA 3JRKA 2QCGA 1MEWA 3GR7A 3UPWA 3CC1A 4H4IA 4JTLA 1VC4A 1PVNA 2PRHA 1TJRA 2ZZ1A 4OHQA 3P60A 3QMRA 3GB6A 4UIOA 2NZLA 3OEXA 3IVUA 5AHMA 3CWNA 4FXRA 2X1RA 2VFEA 2FB3A 3TCEA 3EWBX 1UB3A 3LRMA 1ZENA 5L9FA 4AAJA 1CI1A 3B04A 5DBTA 3C6CA 1TPWA 4A3UA 2XN2A 5HWJA 2CLFA 3PAJA 1CW2A 2YGYA 5LGZA 4LU0A 3L2IA 2YDAA 1ZJIA 3BK0A 4CQAA 5LNRA 5LNWA 3SW6A 4FB7A 1LORA 1OHLA 3P8JA 4O14A 4M6VA 4E2DA 1R2SA 3T7VA 3W71A 2VEPA 4ORMA 3BVJA 4UTUA 2BSLA 4UCGA 4IPJA 3I7SA 4JTIA 2F84A 5D30A 4DF2A 5D2TA 2CLHA 3M5XA 3RNDA 4WZHA 4LOCA 3M16A 2EAWA 1OF6A 3IIXA 2GVGA 3O6DA 2EPHA 4UMBA 4M6PA 4RZ4A 3THAA 5BMWA 2QCDB 2DORA 3T44A 2CZEA 4RCXA 1OYCA 3TAOA 2DJXA 3MP4A 2JK2A 3LDVA 1EP1A 4UFLA 2YYUA 3B03A 3TSMA 1M7OA 4IJBA 2TSYA 3BGJA 3MBDA 1YDNA 2JBMA 5FF2A 3DI0A 2A7RA 5G2WA 2CWNA 1DKWA 4Z08A 2PRLA 2JKAA 3VNDA 5G1YA 1I2NA 1IIHA 2Y89A 3LBCA 3WFAA 3GXTA 1H1YA 1XM3A 1EB3A 4FNRA 2DZTA 5G4EA 3A5FA 3DFNA 1BWLA 1W56A 1AG1O 5FEZA 4ZMGA 1QCWA 3THQA 3L21A 2FQIA 1DJQA 3PSWA 2C3ZA 4OQVA 4LVFA 3LRKA 3N14A 4JTJA 1WBJA 3BV4A 1TPVA 3E02A 3GDKA 4M6QA 2AAMA 3NYZA 3M7WA 1QFEA 2V2DA 4ORIA 3T4CA 1H60A 4NJJA 2ABAA 4JTHA 5I3KA 1D3GA 3LXBA 3EEGA 1K8XA 4DO5A 1XBZA 3C2OA 2NXHA 2BLEA 1IXQA 1RZMA 3UD6A 4FIQA 3QPZA 2GQAA 1VJIA 1VYSX 1UASA 1JQVA 4GE8A 3H55A 3S0CA 4MJMA 4ZQCA 4O16A 3W76A 3ABSA 4Q4KA 1SO3A 4QITA 2WKJA 3P61A 4N2YA 3G22A 1X1OA 3HGSA 3NEVA 1ZCOA 3VE7A 4MUZA 4QJ1A 3VE9A 4UTLA 5I3JA 4KKXA 1W5MA 2VFDA 5D09A 1K7FA 3Q2DA 2W0UA 4NNBA 2ZA3A 3DI1A 3LM7A 3CQ0A 1H61A 2G5WA 3B05A 4FNSA 1YXCA 1QAPA 2GQ8A 4DO4A 3S1UA 1KM3A 2P10A 1GEQA 1QPRA 3N2XA 1S5WA 1T8XA 5LHFA 1EX5A 2QF7A 5KTLA 3IVTA 1EUAA 3EWYA 1L9WA 2B7QA 4XZ9A 3W87A 1AL7A 2VFHA 3NOEA 2ZFAA 1Q6QA 1LLWA 1OFBA 4MY1A 2BWGA 2DP3A 4W9TA 2VXNA 3B0PA 4IMDA 3DGRA 3NAVA 4JYFA 5D03A 3NPXA 3WK0A 1A5AA 3G0SA 3EKLA 2H6RA 3DENA 3U2OA 1T99A 1F5ZA 3PR2A 3EX2A 3ABRA 4IGHA 5LNUA 1HTIA 1JUBA 3TW6A 4BI7A 1JCNA 1J2WA 1I2RA 2EKCA 3HG2A 4O50A 4CNNA 3UWWA 1YYAA 3S1WA 3P62A 1V7YA 5KINA 2C13A 3W1RA 1PE1A 1X6UA 1LLZA 3KXQA 5C6MA 3Q94A 1JQXA 2X1TA 3FKKA 3C4UA 4WXZA 3MBFA 3YPIA 4QM1A 4Z1CA 1K02A 4AMAA 4EVZA 5ABTA 2J24A 1A5CA 3QW3A 2Y62A 3A22A 1ZAJA 5HUPA 2QCLA 5LSMA 4S1FA 3NQGA 3MHGA 1GPWA 4ADTA 4JTKA 3ANYA 3FFSA 2C18A 3LV6A 2AGKA 3W3OA 3R5EA 1SZGA 3W23A 3UWUA 1OG0A 2FPVA 3ZFHA 4HNNA 4JX4A 4GUIA 4GC4A 1IF2A 1ML1A 1GVRA 5TQLA 2H8XA 2ZYFA 4DF0A 3S42A 2I1OA 3HG3A 3EX4A 5CPOA 5I3HA 3HBLA 4LC6A 2JGQA 2LLEA 3VCRA 2ALDA 1SQ7A 1EPXA 1EIXA 1JRCA 4O52A 1FXPA 4ONVA 5HMSA 3K30A 3LB0A 3OVRA 1SU5A 1FWWA 5D32A 3GDMA 1DBTA 4EWND 2V9DA 1ICSA 3B8DA 1XUZA 3S1XA 4WUIA 1M6JA 4A22A 3FJLA 1OYBA 5DCDA 2GVLA 1QOQA 4UFKA 1O5KA 1SFJA 4HHPA 3CPRA 1MO0A 1AK5A 1LRQA 3GDLA 2CZ5A 2GUUA 1TYGA 3NL3A 2FB2A 3NVTA 1KM6A 3LTSA 3W7KA 5F1VA 4M7SA 4XBKA 3DBPA 5E93A 1GQNA 3PG9A 4DEFA 4O0ZA 3IIZA 3CU2A 1R2TA 5F4XA 4HNUA 1W0MA 3S6DA 2ZRVA 3P84A 2NXGA 2OZ0A 2ZZ2A 2ZDRA 2NXIA 2XN1A 3VKJA 3LHTA 3QSRA 3IIOA 3DHDA 4GWEA 5HWNA 4N9EA 5G4WA 3V1PA 4YCPA 5D04C 1KM1A 3BPWA 4TMCA 3E9AA 4RXGA 4IX0A 3LRLA 3I65A 5HJLA 4TU1A 1RVGA 2YPIA 1H7OA 2CZFA 1BEUA 3G1YA 4AHPA 1DORA 3LHUA 1ICQA 4JTGA 3W1AA 4NT0A 4IPIA 4WOZA 4NJIA 1XC4A 1H7NA 3LHYA 1R47A 5BRBA 1KFEA 4LRSA 1M7PA 3FKRA 3UYCA 3W7MA 4PEKA 1TV5A 3O6YX 3NPVA 3W1TA 1VPXA 1JRBA 3G0UA 3W2MA 4FX6M 2Q3RA 4RLIA 4AB4A 5AYXA 4O17A 4AXKA 5SWUA 4I7UA 2R91A 1FXQA 1Q6OA 2WJZA 4GUFA 4J9JA 4ZVJA 2VKZG 3Q37A 1UUOA 4KWVA 2Y7FA 1HUVA 2E6YA 5KMYA 3P74A 5G2HA 3PBUA 3KFTA 2J6XA 1TPB1 5D2WA 1IIGA 1KTNA 4WOQA 4TIMA 3F1QA 3E96A 4UXDA 4RXFA 2QJHA 1JUKA 4NXSA 3TX9A 2E5DA 5FF4A 4ZZ9A 4U4MA 4DELA 4EF9A 3STFA 4OE7A 3MHFA 3G1AA 3M43A 5EY5A 3KAOA 3BGGA 3STCA 1ADOA 5AOUA 3L65A 3LLFA 4G1KA 5D2YA 1MEHA 4OT7A 4QIUA 3PY2A 2VFIA 3PS7A 3W72A 4UFJA 1KW1A 3PUEA 5EYWA 3G18A 1XXXA 4JYDA 4YCOA 4ICNA 3HQ1A 1PIIA 1LOSA 4JYEA 5I3GA 2J9ZA 1G4PA 1OVDA 1LTDA 3SGZA 3BG5A 4HPJA 1TPEA 1I2QA 1RQBA 5I3IA 4I7VA 5F1UA 1H1ZA 4PODA 2BTMA 4PCFA 4MZYA 4DXVA 3G1FA 3L5AA 1GVQA 1VZWA 3TJLA 2BZNA 2X1UA 1K7EA 2RKXA 1JCMP 4LS1A 2J88A 4CNOA 1FWTA 5CPMA 2VOMA 4I7WA 1MSSA 4FNPA 1H62A 3W7JA 5AC8A 2CLOA 4N02A 3UXAA 1UJPA 2E68A 3NZRA 5IM51 2A0NA 2YXGA 3KVMA 3T55A 1G7VA 1WA3A 3S9YA 2PCQA 5MHBA 4YL2A 3M1ZA 4WY0F 4E2BA 3DKLA 3SY5A 4X2RA 4JTEA 3TNOA 8TIMA 2QDGA 4EIVA 2QR6A 2GVJA 4JD4A 4PA8A 3DHFA 3G3MA 1S5TA 5FF0A 2KZHA 3A23A 5K9DA 5C54A 4MOZA 5EPDA 3W7IA 2NV2A 4UMCA 2WO5A 2CLKA 5D02A 4JTTA 4UTTA 1P0KA 3LHWA 2X16A 4GXMA 2VENA 4NJHA 4S2CA 5HR6A 1FWSA 3OA3A 4FNTA 3QH2A 2QCDA 3TMQA 1BKSA 5K9XA 1IXPA 2C19A 1Z42A 3IGSA 1WXJA 3PF3A 4GJ1A 1F05A 1OABA 1OFDA 1DQXA 3BG9A 3W7RA 5HNRA 3DZ1A 5LHEA 1FCVA 3S5ZA 1KM2A 3KHJA 3M47A 3P67A 3WJSA 3L5MA 2NWSA 3BLEA 4IXHA 2QUVA 1DVJA 4Y90A 4AF0B 2ZRZA 3EWXA 1GTEA 3MMTA 4XWUA 1EA0A 2QCCA 3GAYA 1OJXA 1H7RA 4FNQA 1DOSA 1ZY9A 1VLIA 4MZ8A 2EGZA 2FIQA 2A5HA 1NVMA 3LX9A 3M5VA 5J5DA 2J27A 1EWEA 4Q32A 1XBVA 4JICA 5LKYA 5HWMA 1IXOA 4N9CA 1OK4A 1KV5A 1QNVA 3O63A 3FA5A 3TC7A 4MY9A 3LGEA 1V5XA 3C2FA 4PTNA 4BK9A 3NPUA 3PWAA 3TKFA 3OVQA 1X7FA 4A2SA 5HR7A 2DZSA 5E1QA 5G5IA 3UY7A 1O95A 1P5BA 3SI9A 3NQDA 4PL1A 1GG0A 4NQ1A 3PUDA 1ME7A 3F4WA 4UR8A 4AEOA 1C29A 4O28A 1KBIA 4O1DA 2HMCA 4MYXA 1A5BA 4O4WA 5CZJA 4DBDA 4A2RA 2NLIA 1H50A 1GYNA 3L9CA 4O1AA 5FI8A 2V0TA 2ZA1A 4XBSA 2A85A 5BOOA 3LI0A 3QEZA 2CLEA 4ADSA 2UV8G 4FEZA 1PS9A 3W1NA 4TO8A 4BR1A 2CLIA 1H7WA 4RR4A 5KZEA 3TSBA 3TU9A 4N6EA 2G96A 3UWYA 3A5VA 1OFEA 4RV8A 2H8ZA 3MP3A 5F2LA 2QCEA 3HO8A 4YXGA 2QCFA 4MVAA 1UCWA 2P0OA 3E49A 5AC6A 3TE9A 3UZJA 3M44A 5D2VA 1KFCA 3P82A 4OV9A 1SFLA 4UTKA 3W86A 4R34A 1GWJA 2Q3OA 2QCHA 3MI6A 4NXKA 1TTQA 2DZWA 3IRDA 4LVAA 3CM4A 4QISA 2FDSA 3CIXA 3W74A 1QOPA 2YFNA 3Q58A 2B7PA 5HQEA 3RLUA 1YDVA 2QUUA 1OX6A 3OG3A 1EWDA 4JXCA 3QF0A 4Y9AA 3ATZA 3PB2A 2ZZ4A 1TSIA 4IMEA 4QQ3A 5CZ0A 4UC5A 2CFFA 2C15A 2WNNA 3LXAA 3ABOA 1TRIA 3LCIA 4NUWA 4AWTA 1VHNA 3UWVA 1VCGA 4JN6A 3NQCA 5F2MA 4O0KA 1L2UA 2RFGA 1I4NA 3R13A 2RDWA 3BO9A 4HSNA 3FOKA 1TQJA 1WAUA 3TK7A 5F4SA 3U8GA 2GJNA 1MZHA 4HN4A 1KLZA 1F73A 1OFAA 3HPSA 2QAFA 4O4VA 5A8GA 4OGZA 3QW4B 3JS3A 1A5SA 3N3MA 4MPQA 2V8ZA 3NQMA 3HPXA 3O15A 2R14A 2ZZ6A 5LNSA 3INPA 2HS8A 4ML9A 3NQ7A 3HG4A 3C3NA 1WOAA 1X1ZA 3TW7A 3W07A 2BX7A 1KFBA 4MIMA 3R8RA 3C8FA 4LNYA 1TCDA 1O94A 2HTMA 4M5PA 3UZ5A 3PULA 1MEIA 3KRSA 3EB2A 4O12A 2V2CA 3W7DA 3HGJA 4UTHA 2TRSA 2O7QA 2V81A 1VLWA 1VS1A
chains in the Genus database with same CATH superfamily
4CCEA 1GVOA 4MB3A 2GPTA 1F2JA 2ZX7A 2XFFA 3LERA 2PWDA 1SW0A 1D3CA 3R6IA 1G69A 3VXGA 1YX1A 3R43A 4DB7A 2HXTA 3ENLA 1UR1A 4ROQA 4M7TA 1EEPA 3E74A 4LVBA 3F03K 2BODX 4WF7A 2DZAA 1HVQA 3GXNA 5E09A 3H23A 4CD6A 2B7NA 1E1CA 2VL4A 2A79A 4PUMA 2OFJA 2VX5A 2DJLA 3MP5A 1UOZA 4S3JA 4HZ8A 5AHIA 4PMXA 3DOPA 3USZA 1JCLA 3W7CA 3SBFA 4B15A 3QLLA 4PUUA 1PB0A 1NY1A 5BOFA 2Y61A 9CGTA 1EUNA 4MLJA 2W91A 2J75A 2ZE0A 2D1ZA 1O5XA 3SCNA 4C6IA 3B9NA 1GVYA 4WY0A 1NP2A 4RPPA 4W7WA 3EX6A 4A8IA 5AB3A 3KP0A 5CC5A 4GIAA 1W3IA 3SECA 5FOOA 2O7SA 3WK3A 3VD9A 3PJXA 1CTNA 3N11A 4U3CA 3SN4A 1TB3A 1ISVA 4EXBA 1OX4B 1HVXA 1QO2A 4AVOA 3LHZA 4UUIA 4OFCA 3C2YA 1A4LA 4JFUA 3RJYA 1TTJA 1VRXA 1MXDA 5KITA 1NQKA 3N18A 4UR7A 2E77A 1OFRA 3AC0A 3MYOA 4ZTYA 3KBNA 3CL8A 4C5ZA 4KWWA 1V3IA 2WQPA 5D38A 3B40A 4EPEC 3C0JA 4KF1A 2PDJA 4GQGA 5H8PA 3NQFA 1LYXA 1I2PA 4CKQA 1HQTA 3RGTA 2YW4A 3NSXA 3WF0A 4U31A 2PURA 3NJ3A 4JQ2A 3T1GA 3VNLA 1R3RA 4IXXA 1MW0A 1PWLA 1R87A 3EDKA 5M17A 5FEWA 3BLOA 1WO2A 3CHFA 1KCLA 5D37A 1SR0A 1O66A 4A05A 1SJCA 1B90A 1SUXA 2BB0A 5KZDA 3AI0A 1LG1A 4DNHA 2VZSA 1MFUA 3AJ7A 4IIHA 1FCBA 3EPMA 1W32A 3CAQA 4HKPA 4GUHA 3W7PA 3FYOA 1B4KA 2XIMA 5G4HC 2DT1A 2WSRA 4YN5A 4N9DA 1TWZA 1W1YA 3P8IA 2DW7A 5BZAA 1OC6A 4TX6A 4U2YA 1UZ1A 4PRTA 2VX4A 1LF1A 3BARA 1WDRA 5DMLA 1B30A 4HT3A 4K68A 1H51A 1FWNA 2P5NA 3CAVA 3DFHA 4GQ0A 2E25A 2D2JA 2QCMA 4YJ5A 3LOTA 4WKAA 1P0EA 3VOGA 3NQ2A 4Y9PA 3C0LA 3NL6A 1YXYA 1G67A 2GZXA 2ZXAA 3MS8A 3KDNA 3MMDA 3V5FA 3W7NA 4AQLA 4R7JA 5FA5A 1E3ZA 1P0DA 3NWRA 3VGDA 4XZIA 3C52A 4MJ2A 2VNCA 3TSDA 1ADDA 4G6CA 3PZTA 1GVSA 4GZ7A 5JIPA 3KHDA 3WJWA 6REQB 3CYJA 3QQ1A 4CCZA 1AH0A 1TO3A 4MDPA 4NYYA 3NQAA 4EK7A 4ICMA 4MUPA 4GXPA 2Y70A 4KGLA 1VKFA 2CEQA 3B9OA 1DJIA 4L64A 4LYPA 3AWNA 4N6FA 3WF4A 3NM1A 3KL3A 3DFOA 1WBHA 1R30A 1IZCA 3OA5A 3A6OA 3SO7A 4M56A 2PS2A 4PMVA 5I3FA 1YQ2A 2CESA 1PTAA 7REQB 1PKYA 1M5WA 1SSGA 4XUYA 4L9ZA 3KOXA 1QK2A 3W1QA 1WDQA 2SFPA 1PKNA 3P80A 1OC5A 3P6LA 4H83A 3S3GA 4GIEA 1F74A 1ZSXA 3BW3A 1TPDA 1LJYA 2NV1A 4QCFA 3LZ5A 1SFSA 5FAGA 3B9EA 1QBBA 1TR1A 2QIIA 3FHQA 2G41A 2CXEA 1QI0A 4JY8A 1RK5A 4NX5A 3SCVA 1SW3A 1DHKA 2J79A 5CCZA 3CMGA 4Q6JA 4A29A 3WBAA 3WQ8A 2JEQA 2HRWA 3UETA 4HYWA 2QGYA 1CWYA 2EHHA 2IQ0A 1UA7A 1C9DA 4P7RA 1DHPA 2Y1HA 5CSYA 2C14A 3VIOA 4D6GA 2XPKA 1W3TA 3I68A 2Z1BA 2V30A 2WZHA 3UWQA 3G24A 4F0LA 3GR8A 5DY3A 2BY0A 3SUUA 4W5UA 2DH2A 4LBRA 1LDCA 4DXKA 1QNRA 1W9XA 2O92A 1BQCA 2C6QA 1NDZA 4F8XA 4WJEA 2Y5JA 1WOBA 4HOWA 1JDAA 2A7PA 3P0XA 5HQLA 1N55A 2OEMA 1V6WA 3COTA 1JPKA 1HJUA 1YPXA 4AIOA 3UCQA 2RDTA 3ARWA 5IFPA 4NILA 1UZHA 4JKMA 5EU9A 4FO4A 2O55A 1JYVA 1ZP4A 2WB5A 2G3FA 1TA3B 3T78A 3S46A 1UMYA 4KRUA 3C2RA 4NNCA 3G1VA 2OJPA 5C2XA 3IGXA 4I9TA 2PPGA 3W7LA 4AZ5A 1XI3A 3URBA 1B3OA 1GHRA 1FH9A 2DZUA 2NX1A 1QR7A 3QM3A 3S5NA 3EA3A 5IXEA 2NWRA 3OB8A 4S38A 4W4QA 2QEZA 3W25A 3MI3A 2JKPA 1EX1A 3ORWA 4XB3A 4DWSD 1GVIA 3TUUA 1FDJA 3BURA 1BFNA 1H5VA 4PCPA 3VIIA 1E15A 1EP3A 5CAKA 1I0BA 2Z28A 3A3HA 4U10A 3P5ZA 3ZR6A 2X2GA 1L6YA 3SCOA 5EBUA 3WN6A 2H3BA 1F3EA 4HU0A 3TN3A 9XIMA 4UOJA 2NQZA 1LBLA 3N9KA 1E6QM 5KETA 1P1XA 2JKEA 4HJWA 4H1ZA 3WELA 4M29A 3E5BA 1WX0A 3OP2A 4DQWA 3F7JA 1QNOA 3NQVA 3ARXA 4MKSA 3GWQA 1TG7A 3QVQA 3TLQA 1X97A 2OTDA 1E6XM 2AQWA 1GJUA 3MY9A 1VPYA 4F0RA 2VFGA 1AW5A 1V51A 1HXJA 1PO9A 4AZ7A 4ZB2A 4XAFA 2NQ9A 4PRRA 4EXQA 3NQEA 1OFPA 1EJ7L 1EIBA 3UXKA 1DQWA 2JQXA 3N12A 4GO8A 1DWIM 3EOOA 3UP8A 2VCCA 3MI2A 3R58A 1HJVA 1HO4A 4EP8C 3TMLA 1ZGDA 2AMXA 4D6HA 1Y5XA 1AVAA 3ARTA 4IMAA 2PWFA 1ZAHA 3TA6A 1X8CA 3DKJA 1ECQA 1DXEA 2HS6A 2W61A 3PZ9A 5XIMA 1W9PA 5EMYA 4BZYA 1VP5A 5DXXA 5CZTA 2VGIA 1M01A 4MJZA 1O68A 5BWFA 4X60A 2NUWA 1B2YA 2UY2A 2X0YA 1KB3A 3IIPA 1JZ2A 3HFYA 1DQUA 3NZPA 3PFRA 3P0WA 1VFFA 4U2ZA 4DUOA 2W6RA 3R0UA 4YLWA 4JS3A 2TMDA 4ADUA 3DXIA 1RR2A 1BF6A 4AYGA 1HG3A 3QPEA 4J4KA 1R5YA 1V4YA 2QKFA 3TTOA 4DZHA 2X42A 4MY8A 3W88A 4P8VA 4DPPA 3TZFA 4M51A 3BQ5A 4DI8A 1VFTA 1KM5A 2Y8VA 4JX6A 3U6WA 3W22A 2FLIA 3S2MA 3EMZA 1R46A 3MYPA 1KM0A 2WV8A 3E2QA 4ZE5A 5BRPA 3E0IA 1RV8A 2WYSA 1DXIA 4CQ8A 4XZNX 4POCA 1WUFA 3PN8A 4XTDA 3CLMA 4O1CA 1NF0A 1Q6GA 2W79A 4BA0A 1K03A 2OO0A 4TTGA 3T09A 2IPWA 5E70A 1R3VA 3CQIA 4Z2HA 2YX0A 1KTCA 4MZ1A 3T0CA 3NGJA 1Q6EA 3SFKA 3UQNA 5D9NA 2J7CA 3TH6A 2ISVA 2E9LA 4L9XA 3WG6A 4IGNA 4PCNA 2VELA 4ZBCA 1RBOB 2OXNA 3N73A 1H3GA 1K7XA 1IGSA 3QN3A 2E67A 4BFAA 4HOZA 4M24A 3TQVA 3NQ8A 4ZQMA 1O7AA 1FWIC 2W67A 3MO4A 2V6AA 3W0KA 4RKAA 4K36A 1NH6A 1WQ5A 1SJAA 3BANA 4LV9A 2HDJA 2XH0A 1K9FA 3KW3A 4NI3A 3OBEA 3GDRA 4MG4A 3STPA 3VZZA 5DN1A 1QASA 2E6FA 4P61A 4WGXA 1VD6A 3GD6A 1UR2A 1LT7A 4B16A 1NF7A 2HSAA 4FR1A 1ZQ5A 5CGQA 4MNMA 4MWAB 1OCNA 4HYVA 4JTSA 5LZLA 2GJLA 3CIWA 1R9YA 3GNXA 4QNWA 2AQOA 4AF0A 5ABFA 1EJVC 3QGVA 5U7SA 3JUGA 4IJRA 1OGSA 2R1PA 4C1KA 2J74A 4QJ3B 3BCFA 1W8SA 4YYCA 3WLHA 4AFYA 4S3CA 4GCAA 2WVVB 5DY2A 4B5NA 1XICA 3NGFA 2PA6A 4IGSA 3CV2A 1X6LA 4EF8A 3E0LA 1G7UA 2Q8ZA 1AW2A 1D2KA 3HTWA 1NWRA 3H7UA 1QPNA 4PSRA 2ZICA 4K7YA 4PUKA 4JTCA 1IR2A 4F2UA 1WYIA 2FHFA 2V5LA 3GH4A 5BROA 4LAKA 3VC6A 1PKLA 3F2CA 1I9CB 3W7OA 5HINA 3CK5A 4DJEC 1Z8AA 1JYWA 3QMTA 2EJAA 1I0DA 1F4AA 3A21A 1TPC1 3GKAA 3DFTA 4DRSA 4X0VA 3WIJA 4H00A 2FZNA 1OCJA 1PZ2A 1TX0A 4Z1BA 4I9AA 4LC8A 1Q7MA 3AIQA 4QHRA 1LZOA 2ZIDA 1T0OA 1G1YA 1CIUA 1QPOA 3FJNA 1IHIA 1SMDA 3ZZ1A 4HOXA 4LVDA 1RLCL 1FTXA 1J79A 5D05A 1AODA 2DZPA 1EJWC 2YDSA 3TC3A 4LYQA 6XIMA 1JF5A 2ZQ0A 3SCTA 4IQJA 2XSXA 4TQTA 4ACZA 5D9MA 5HMDA 2HK1A 3TZNA 4H04A 3MHUA 3LCWA 2G95A 2R1MA 4MNLA 3G3DA 3TC6A 1H7XA 1QPQA 2WSYA 3HIJA 4HZ7A 4AD2A 1XYFA 1P1MA 2CW6A 1S5MA 1ITXA 3G6MA 3W85A 2DIEA 1OQFA 1W3JA 1PCWA 4H2HA 2ISWA 2OELA 1D7KA 3WK2A 3DN5A 3H2OA 1W5PA 2H9AA 3MB9A 4TUFA 3GBEA 3MUY1 5T26A 1FH8A 1JZ6A 3NO5A 2GQ9A 4QEEA 3GK0A 5ENLA 4B3LA 1GQIA 4OBTA 2CWXA 2QGHA 3BG3A 2ZVRA 3V18A 2QV5A 3LLDA 3MSYA 3W73A 2E9BA 2QCGA 2WC3A 3GR7A 5CC6A 4X63A 2ZWZA 2J62A 2ZZ1A 1XG3A 1KGXA 2NZLA 3OEXA 1XLLA 5AHMA 3IUHA 4E8DA 1ZENA 2P8CA 1W1PA 1J10A 1W9VA 5DBTA 3C6CA 5G1MA 4K1WA 3RU8X 4DLMA 1LQAA 1FOBA 1CW2A 4LU0A 2BOEX 3L2IA 2W9MA 2YDAA 5LNWA 1EKOA 2X0HA 4JQ4A 2HNEA 2X8RA 3P8JA 4E2DA 1CXIA 1R2SA 3CQHA 2IKHA 4KRTA 3TNBA 2PGEA 3I7SA 2F84A 4PSPA 1Y8BA 2ZUNA 3B3DA 4XV0A 3QLDA 3B4YA 4XD3A 3J7HA 3MCMA 1OF6A 3IIXA 3O6DA 3VABA 4LUSB 4O1EA 5DT7A 2QMJA 4M6PA 4RZ4A 3THAA 2QCDB 2DORA 3T44A 1C8YA 1OYCA 4NASA 3TAOA 2DJXA 3UCCA 2JK2A 1XF0A 1M7OA 3QOMA 5T8GA 3UZWA 4HA4A 2PZNA 3GQYA 4JBRA 5E0FA 3CV7A 3MBDA 3H70A 1MWOA 2GK1A 4LCRA 2A7RA 5CXPA 2CWNA 1VFSA 4Q4PA 1JFXA 3VNDA 1VPQA 5G1YA 4W7UA 1IIHA 1ZJHA 3LBCA 2BGNE 1XCXA 1H1YA 1XM3A 5BXTA 4R85A 5CSUA 4OQVA 1DJQA 2D24A 4LVFA 2AOSA 2PODA 3VILA 1K9DA 3E02A 1Y5WA 3GDKA 1W1A1 4QLJA 1V3JA 3NYZA 3C8NA 4PE8A 4L1XA 1H60A 4L7ZA 1C3FA 3EYPA 3DHUA 3EEGA 4DO5A 3KTCA 1BYCA 1YE4A 3LY0A 1VJIA 3V36A 3H55A 3S0CA 4PTVA 4DM1A 3ABSA 3L7RA 3GM8A 2UY5A 2VO5A 1ZCOA 3ABZA 4UTLA 3V0TA 4QEHA 4MM1A 3PAOA 2CBIA 2I57A 1S46A 1K7FA 3N15A 4GQRA 1X6NA 1XIMA 3CQ0A 3IRSA 4FNSA 3KE0A 4DO4A 4JTQA 3S1UA 1H0IA 3SQLA 3UXIA 5LHFA 4PUNA 5KTLA 3BTNA 1JZ5A 4CD5A 5E9XA 3EWYA 1L9WA 2B7QA 3RRAA 5GPRA 3UERA 3UPMA 1Q6QA 5REQB 2OGJA 4MY1A 1RP8A 1RA5A 3XINA 4PEEA 1XD0A 4FA3A 2ZE3A 3B0PA 1SM9A 4IMDA 1B1YA 5D03A 4HTYA 5D8ZA 2W63A 3WK0A 3IJ7A 3U48A 1A5AA 3G0SA 3EKLA 5CJNA 2YCIX 4IIFA 4YPJA 1CB7B 1T99A 4GGHA 1F5ZA 1CGWA 3T05A 1XC6A 3PR2A 4IGHA 1UR4A 1B5TA 3TW6A 1I2RA 2GLKA 1XRSA 3HG2A 4O50A 3DYMA 4XSLA 4XK2A 3S1WA 1E71M 3EDDA 1U1JA 2XGIA 2D0FA 3W1RA 2DQWA 1RCQA 1JQXA 4H2CA 3VINA 4HU8A 4B5TA 1UMLA 1NOUA 3C4UA 4WXZA 4QM1A 2OLSA 3PWIA 3CZ8A 3K8LA 2F6XA 2BOGX 5DX7A 3NUKA 2YL8A 4HNLA 2ACUA 3VMOA 1HKIA 4HA1A 1OB0A 1ZCCA 3W23A 2PDCA 3UWUA 4HNNA 4JX4A 4D8ZA 1PKMA 5TQLA 1TV4A 3EX4A 4RDYA 2WVTA 2JGQA 3AICA 1L6GA 1EBHA 3VM5A 4ZOBA 1J0KA 4DVOA 1J9YA 1JD9A 1JRCA 4O52A 5JUVA 3IAPA 4Q3MA 1FXPA 4ONVA 4PTMA 3WMSA 3K30A 3OVRA 1XINA 4TV5A 2IMRA 3GDMA 4B90A 1ICSA 3B8DA 4JNZA 4IIEA 1EJUC 2CCRA 4S3GA 3FJLA 3WLQA 3SCUA 1ECEA 2J6VA 5HA7A 1UOKA 1O5KA 1I1XA 1IT8A 4FMVA 4HHPA 5FSEC 1WCGA 3PPCA 2QUNA 2CZ5A 2GUUA 1TYGA 4QX4A 3NL3A 3H4XA 2AL1A 1XQKA 1GQNA 3PG9A 3SY8A 4C6LA 4GO9A 1JXJA 2VHLA 4J2PA 1RPKA 1W0MA 2ZRVA 2BY3A 2ZDRA 3E0VA 4JTRA 4CN6A 3QSRA 3IIOA 4KT2A 3AWOA 4LEFA 4LAOA 5G4WA 5FIPA 1KM1A 4BS0A 3E9AA 3LM3A 5A2BA 2QJJA 1UIOA 3MCNA 3I65A 4C1NB 2GDUA 1FWAC 5AC5A 2CZFA 1A3WA 2VURA 3LHUA 4NT0A 1BHGA 5TAOA 1H7NA 2YOCA 3ES7A 3BMWA 1GPFA 1REQA 3W7MA 1IZKA 4PEKA 4HPHA 4CVWA 1MQQA 3UZYA 3B9AA 1E0UA 1GHSA 1CPUA 3NYDA 4AB4A 5AYXA 1Q4NX 1VBJA 3KS5A 4JL1A 1UPPA 4AXKA 3OYZA 4JN8A 2OG9A 3BUVA 4LXFA 4ZVJA 3Q37A 1UUOA 5KMYA 1TA3A 1L8NA 4X0NA 5G2HA 1E4MM 2ZVIA 1WP6A 1SMAA 2ZC1A 4E8CA 2J6XA 4KMQA 1KTNA 3AS2A 2FHCA 3F1QA 1W2PA 3M0HA 3AU6A 1JUKA 3CMFA 5A8OA 3KLLA 4FLSA 5FF4A 3VOCA 4U4MA 4DELA 1EOKA 3W4RA 3QV7A 4OE7A 3K1DA 3K4DA 3URNA 3BLDA 1BYBA 4GJIA 3XISA 7XIMA 1CBGA 4GI6A 5AOUA 5D2YA 4OT7A 4QIUA 3PS7A 4FOJA 3L23A 4WIWA 1KFWA 4UFJA 5CC7A 2PDNA 4JQ1A 3UF9A 4ICNA 1IT0A 2BVTA 1PIIA 4JYEA 2J9ZA 3OO2A 1OVDA 2GGEA 3ZLHA 1F3WA 1BG9A 4HPJA 1RQBA 4AZGA 3NZQA 1NWTA 3TYAA 1P48A 5F1UA 1H1ZA 2WPGA 3K2GA 4IQEA 3EA1A 4DXVA 3G1FA 3SSZA 3ES8A 2V5JA 2RKXA 3N1AA 4LS1A 5CPMA 2J7HA 1EZ2A 2V67A 4CGTA 1HZYA 3H4WA 4D72A 1RCXB 1WPCA 4H9MA 2QHAA 3W7JA 4N02A 4D6FA 2E68A 1XFCA 3AUJA 5IM51 2A0NA 4FALA 5EFFA 3S9YA 1JPMA 1H11A 4YL2A 1XKJA 1XGZA 1W3LA 2BVDA 1P7TA 3TNOA 2ONEA 4EIVA 4XZHA 3K4WA 3DHFA 3A23A 1YNYA 3G77A 3URAA 1P0KA 1E43A 4S2CA 5HR6A 3WUBA 3TMQA 1IWAA 1B3ZA 5GJMA 5E5CA 1PTDA 1WXJA 2E4TA 4BCEA 5HNRA 3DZ1A 1O5RA 4FZIA 1KM2A 4WCJA 1E1FA 4RNIA 2HCVA 2ZRZA 3ZO9A 1GTEA 1V6TA 2QCCA 1OCQA 4Z2GA 1DOSA 1ZY9A 3U3HA 3AOFA 5FJOA 2XJ7A 2A3LA 5I5RA 5J5DA 1GOKA 2XSBA 4IG2A 1EBGA 4GVIA 2JF7A 4N9CA 4R27A 4DNMA 1V6YA 2Z7GA 2EEXA 1AH3A 3U9IA 4HK5A 3IANA 3CUJA 3C2FA 1BYAA 1U33A 4UCFA 3HPAA 2J8TA 3NPUA 2ACRA 2CXGA 4BEQA 1R7AA 3TKFA 4UQBA 4V1XA 5HR7A 5E1QA 3UY7A 1V3LA 3NQDA 4HSHA 1GG0A 3RCNA 1KBIA 3VDAA 4KIRA 1A5BA 4GK8A 2OR2A 2NVAA 4DBDA 3KWXA 4PULA 2PDKA 3L9CA 1C7SA 3VMPA 1KWKA 3QR0A 3T8QA 4HTBA 3UR8A 4GI4A 1UKPA 3WL0A 1GW1A 1Q8JA 2C91A 2CLEA 1WZKA 3QEZA 3VGBA 3WKZA 4TO8A 5E0CA 4BQ5A 2CLIA 7ENLA 5JIWA 4RR4A 3TSBA 3AZTA 1QRQA 1YW1A 1NFGA 4XG1A 3WEOA 1OWQA 3MP3A 3ID7A 3F5LA 1IT7A 3HO8A 4YXGA 4MVAA 2P0OA 3TOYA 4HB7A 2F9RA 2XH7A 3TE9A 1ISZA 1Q85A 3GU9A 3A4XA 4OV9A 4UTKA 3W86A 4PB4A 3GHTA 2Q3OA 4JTDA 1MVYA 3UU0A 4AZHA 4W7VA 1FHDA 4XZBA 3IRDA 2FFIA 4QISA 2YFNA 2QUMA 3NCOA 3FGCB 2QUUA 1OX6A 1EWDA 3KCJA 1GONA 3ATZA 3PB2A 1VBUA 2ZZ4A 2C71A 3PZNA 3GS6A 1TSIA 2C15A 3K8KA 4UZSA 3H4GA 4AWTA 2XFRA 2WAGA 4GYJA 4JN6A 1A49A 4CD8A 4MWAA 1L2UA 2RFGA 5IOBA 3I6TA 4J28A 2VZUA 2DQXA 5ABFB 1E1CB 3FOKA 3PNUA 2JALA 5F4SA 3V35A 4B5UA 3U8GA 5DMMA 1E6PA 1E6ZA 1H41A 2O9OA 1EHAA 3CH0A 3HPSA 2QAFA 3GIQA 3QW4B 3CMJA 1A5SA 1Z6KA 4D6JA 3AXIA 4H41A 2D3NA 2D69A 1BVZA 1GCYA 2R14A 3BJTA 4ZFCA 1T7LA 3WF2A 3HG4A 4AD1A 3C3NA 1X1ZA 3TW7A 1GJWA 1WXZA 1UPMB 1BG4A 3H2EA 3LENA 1O94A 3WDJA 1V93A 1UP2A 1MEIA 3KRSA 1V08A 3HGJA 1ZU8A 1F07A 4PR4A 1VLWA 1VS1A 2QNEA 1C8XA 4PH6A 3DFQA 4HPNA 3P93A 4HSOA 3WNNA 3GTFA 3RIKA 1FP8A 3S9IA 1GQKA 3WQGA 4CEXC 2J7DA 3VGGA 4A4AA 3E5PA 4UNLA 1H5YA 4US5A 4INFA 1THFD 4MNKA 5DBUA 4FSAA 3SN0A 3O0KA 1JNDA 1XYCA 1EQCA 3Q4DA 1B31A 3QYQA 4C6FA 3WLKX 2E6AA 1I2OA 3KBJA 4LW7A 4AYSA 4XIAA 1SO4A 2X30A 3UWZA 4RK8A 2H90A 1TV2A 1I75A 3IJQA 3CJPA 3W9ZA 2VZTA 3T0DA 5IHSA 3VFLA 4EACA 4U5KA 4MAZA 3A3WA 1R9ZA 4LRTA 3GUGA 3BLLA 2CPUA 3T0TA 1ONRA 3ZQ9A 3UY8A 1CXLA 2YXOA 4HA0A 1P7TB 2YZRA 5FJUA 3C2EA 3C56A 5JQ9A 1JI2A 4UQCA 4H9UA 2YBTA 4FI4A 2DGAA 4RW5A 3O6CA 3QBUA 4G1NA 5AHNA 4DAIA 4WQ6A 2F2HA 4FF7A 1O60A 3C2VA 2BGSA 3FHAA 3H2MA 4YYFA 3VUSA 1F7BA 3HJEA 1EP2A 1CX9A 4KFPA 3EXSA 1ZL1A 3W1PA 3SEPA 1JVNA 4NZJA 1PZ3A 1VIWA 2CZVA 3AJXA 1WKDA 1DE6A 4AG0A 3FNDA 1JZ8A 1O12A 3RRXA 3VGHA 3G0XA 3W01A 2VEFA 4EPDC 2Z2UA 4IMCA 1QK0A 2PDLA 3AZSA 3QQ0A 4ILSA 2PBOA 2WBKA 2F8QA 3TROA 5BCAA 1E9ZB 5DELA 1TIMA 3FIGA 5EKYA 4J3ZA 1FCUA 3TEVA 2BP1A 3TONA 1IR1A 1B3YA 4RUBA 1UWIA 3HFTA 4JOMA 3IGHX 3O05A 4FXSA 3MMWA 2DSUA 5CH9A 1FRBA 1Z7AA 3SUTA 4LUSA 1KFLA 4FOUA 1W54A 5C7HA 1E5NA 3UGRA 1MDRA 1XYBA 4LGXA 2ZTKA 4LX4A 1EZWA 2XFYA 3DAQA 4TX8A 3QZEA 4DWDA 1XYZA 1NDWA 3CZEA 1W9DM 4HHMA 3PTKA 2NV9A 4QLKA 3HF3A 2DVTA 5J5RA 1DIDA 1F6KA 2RHGA 1EDGA 3GTIA 1LOQA 1K3UA 3IK2A 1EGZA 2DDXA 4S3BA 3F2BA 1W3KA 1I8JA 1KGWA 5C0QA 4PRWA 4KPLA 1PZ0A 3NM3A 2OZ8A 4PBFA 2ZX5A 1V0LA 2OLHA 1XH2A 2FH8A 3BLKA 3KOZA 2XG9A 3MKKA 3GG7A 4US5D 5A6LA 2A6LA 4DIAA 1CZ1A 3OLDA 3OTRA 2D20A 2AMGA 4KQNA 4GH3A 2J9YA 1NFBA 3VOJA 1P0BA 3NNTA 1B54A 2YL6A 3IARA 2RGMA 1SZEA 1SPQA 3FEMA 4Z2KA 3B8TA 1XRVA 3BQ6A 5CSRA 3PB0A 4CCDA 2VZOA 2B31A 4GYPA 4OZOA 1XGDA 2WOQA 2BHUA 2FZDA 5FKYA 2POTA 4HNTA 3N9RA 2NVCA 2FTPA 3TYDA 2DV0A 1FWCC 2ZTJA 1I45A 1R3QA 3IJ6A 3KTXA 3VZXA 4YVPA 3N2BA 3WLRA 5REQA 3VNKA 3R4IA 1YLVA 5D33A 4LUYA 2PI6A 2OO6A 4FX7A 4AY8A 3KVLA 4XAGA 1KCXA 1YTDA 4L4LA 1FY6A 3PHAA 2GJXB 5FESA 1ZP3A 3WENA 3WD0A 1UZ4A 4O15A 3EDEA 3GX9A 1KC7A 2FYMA 1XUUA 1W3HA 1AD1A 1N82A 1UWTA 4GUJA 4Y9NA 1LWJA 2IS7A 3IV8A 2UBPC 2O9TA 1TVPA 4HGXA 4NZ3A 4LS0A 3WJYA 5T9CE 3N6QA 4UTMA 2GSJA 1LBFA 1O1HA 2X09A 2P76A 3GG1A 6TIMA 3ITTA 3SFWA 4I5RA 4XZWA 1L6WA 3LBOA 3K5XA 1KXVA 3ZJ8A 3TDFA 3PM6A 3NL2A 2F38A 1WKYA 3U57A 2B4GA 1RJQA 3NDZA 1JGIA 4Q8OA 2ISSA 3UJ2A 1YDYA 4QLLA 1A5UA 4XZLX 4E38A 1JUEA 1HKKA 3D47A 1U30A 4C1LA 1T96A 3VPLA 4KCUA 1XL9A 4WDXA 4EOUA 5FSDC 2FPYA 3NG3A 3R89A 3LUTA 1Y0EA 4KFNA 1OBAA 1TRDA 3L0NA 2OLAA 2WW5A 3UNTA 4QG9A 5BXPA 2YCEA 1A53A 1YHTA 1AA1B 3ABXA 4UTWA 3EZ4A 5AZ0A 3CGTA 4J3VA 1Y7VA 1KWGA 3MW7A 4S3AA 3B8WA 5BNKA 4JCMA 3CT7A 3RLVA 2ADAA 1B3VA 2ZA2A 3MWCA 2V3FA 3EXRA 5HXMA 4HD5A 3TCSA 4ZOCA 4IQDA 3WH7A 2XN0A 4KEZA 1UBSA 4OV4A 1C92A 2YFOA 2VJXA 1RSCA 1KBJA 3CAWA 3NR0A 2KAUC 3GG0A 3W70A 2BV9A 4FIRA 1EGVA 1UKOA 4AU0A 3W7QA 1V02E 3WQEA 4MB5A 3TXVA 4L61A 2NLYA 4G7FA 2KX9A 3UZXA 3WK1A 5D9PA 2TAAA 2GGIA 1YE6A 3FYYA 4JIRA 1AMKA 1RQEA 4K38A 5FJJA 1W37A 1J2BA 5CPQA 4WSHA 1T41A 1SR9A 1HO1A 2Q09A 2X40A 1EJTC 1B4EA 4WJXA 5M1TA 1TPFA 3UA4A 4JN7A 5CBBA 1JCJA 2A1YA 4Q33A 4PN2A 1W1ZA 5JH1A 1E0XA 5HMFA 5C70A 1WV2A 5LXXA 1HJWA 4LTSA 3KX6A 4P2VA 4QJ4B 1REQB 3OZMA 2E8ZA 3BMVA 3QYSA 4Q8QA 4P7LA 2PU0A 3O06A 4H3DA 3O8AA 3OQ8A 1LP6A 2YA0A 1NEYA 3DHPA 3ZXWA 3T4WA 3HURA 1MMFA 3OLIA 3HGRA 4HNOA 3FAWA 3SJ3A 4IIDA 3PZIA 1R3WA 3TQ0A 2FZMA 3ALGA 3IS4A 3VOIA 1W9UA 2O56A 2BASA 5ECVA 3CHVA 4L6DA 2I9EA 1TQXA 3VD5A 3N3TA 3FLUA 1PDYA 1BQGA 3CZGA 2TYSA 1HJQA 1RPXA 4K1GA 4W87A 4C6QA 3AS1A 2INEA 1BGAA 2REQB 4QS5A 3REQB 3G1XA 4IL2A 3L0GA 4O1BA 2G3MA 1RD5A 1AQHA 4GNKB 2FHBA 1MNSA 4XAPA 4RE4A 3FN9A 1GYLA 5HANA 3LGDA 5FJRA 4DZAA 3GC4A 4CU7A 3L4ZA 1JFHA 1E56A 4X22A 4WXYA 4P7OA 4NJGA 4X3ZA 2V69A 3QGAC 3GNDA 1FVPA 1KTBA 1P0NA 4CD7A 1K9EA 3H53A 4DBSA 3CEUA 1Z44A 1UJQA 2CBVA 2W27A 3ANVA 3TIMA 3HG5A 1A80A 1SO6A 3QFEA 2YYTA 4XD5A 2RDUA 1ZHAA 3SR7A 1UP3A 1G9HA 3V5CA 3GKFA 4MWAC 4HQVA 4HIBA 2PDYA 3C0SA 4AZBA 1UR8A 5A6MA 1HIZA 1GZGA 4GX8A 2YSWA 4BWLA 3STEA 5JBFA 5M3WA 4PUJA 1Q6FA 1Q2SA 2X05A 2WMJA 3N2CA 3TN5A 3LU2A 1F3XA 4GOAA 3TVAA 1Q3NA 3PPFA 3O7UA 3LGGA 3KRUA 1HL9A 4R33A 4HZMA 1TV3A 2ISDA 4BHYA 5M03A 3RM8A 1CXEA 4L80A 1GT8A 3WBEA 1VFOA 3EWWA 4AH7A 3GVRA 1YNPA 3ZS4A 2C0AA 5DCBA 4O8AA 3GFYA 4GPNA 3ITXA 4NVTA 4QG6A 3N4AA 3UG5A 2FTYA 5A69A 2PGFA 2ZUSA 3AAMA 1R9XA 4UB9A 4UTTC 2VWTA 4NU7A 1VH7A 4UBPC 1G4SA 4ACZB 1LG2A 4YTQA 3NOYA 2R1NA 4QE5A 1AH4A 1E6SM 1EGMA 3LCGA 3QC3A 3TTQA 1TWWA 5HULA 2DZXA 4LUJA 3CQJA 3NVDA 1X98A 3KS6A 4CQ9A 4NAFA 4J7RA 4AWSA 4V15A 3FDGA 5FEXA 5KZMA 3M0VA 2J47A 1OGBA 2HVMA 3O07A 1VJZA 2PWHA 4DBEA 2Z6IA 4ZB0A 2VCAA 1V79A 1RAKA 3CV6A 4B9YA 2PGRA 2G37A 4LS2A 5A8NA 2CHNA 3T40A 3H7VA 5CZSA 3IEBA 1AD4A 1WDPA 1YXDA 1SSDA 4IP4A 2ZZ5A 5AECA 3BOXA 4ZCWA 1OT1A 3RCMA 4IIBA 3V4BA 2VEIA 4XISA 5C9WA 1CGTA 5A95A 2OMAA 3KVKA 5GNZA 5XINA 3QPYA 1T6MA 3BW2A 2HZGA 3AXXA 4NJKA 5T91A 4W8AA 1J96A 3VVGA 4QAIA 1W1VA 3MVTA 1S2WA 4WLCA 3TFCA 3HB9A 4K6AA 1DJNA 4QS6A 1JULA 4HZ6A 4H9ZA 3L12A 4Q4SA 1O6IA 4J1OA 3SRHA 1DIEA 3MSGA 3M6YA 1WDWA 3LMYA 1V6XA 3CIVA 4K3ZA 2QF8A 2R94A 4N4PA 2D2GA 4Q4OA 3UVAA 1R2RA 3GC5A 3HZ3A 3ZJKA 4D71A 4Y8FA 3WD1A 1BF2A 5I02A 1KRAC 2MNRA 1KCKA 5K3VA 4IFKA 3NL5A 4V33A 3FGCA 1FHVA 2J7GA 3A12A 4RE3A 3B8VA 3LG3A 2CC0A 4JFTA 3QR3A 3OODA 1TMLA 3WQFA 3O9NA 3AALA 4UQ9A 3IPWA 2PTXA 4AIBA 3AXMA 4L6HA 1FA2A 5IDZA 1FUYA 3JR2A 9RUBA 3S83A 4H8VA 2VEMA 4TVDA 3BOLA 4PMNA 2OB3A 3CC1A 1JL8A 1VC4A 1PVNA 4G8TA 3P60A 4OHQA 1XSKA 3R94A 2VRJA 3CWNA 2X1RA 3RXZA 2VFEA 2R1KA 3TCEA 1LL4A 2NT0A 2GOKA 3MUIA 5L9FA 1NARA 4HJFA 3VD7A 4F0KA 4A3UA 3AMGA 4AZIA 2YGYA 4WJ8A 4F79A 5I07A 3GXMA 3BK0A 1S2VA 3SW6A 4FB7A 4TOQA 1C91A 4O14A 4M6VA 3T7VA 1PX4A 3W71A 4ORMA 3ONBA 3BVJA 4UTUA 1TCMA 4UCGA 4JTIA 5D30A 1M53A 1Z3NA 2CLHA 3F4DA 3KBVA 4GFIA 5CBIA 2ZX8A 1O5QA 3F5KA 2EAWA 3IUDA 1XYAA 4ZGYA 1E3XA 1QTWA 2EKGA 2GVGA 3BXWA 4KW2A 4UMBA 5BMWA 1M03A 4DWSC 1E73M 1QI4A 1MW3A 3LDVA 4ICCX 1LT8A 1EP1A 4UFLA 1E0VA 2YYUA 3B03A 1F6YA 3MANA 3E2VA 1ODZA 3GNOA 4IJBA 4KH2A 1TX2A 2TSYA 3BGJA 3MMUA 4CN1A 2VC9A 5IRPA 5A6BD 1EOMA 3QKEA 5A94A 3AMLA 3F4CA 4KCVA 3JZEA 1XIEA 1DKWA 2VD9A 2QDDA 3DYOA 4GQQA 3WF3A 3CZLA 2CHOA 4C60A 1I2NA 2W66A 2Z1SA 1BRLB 4FNRA 2QULA 1H09A 5G4EA 3DFNA 2XWDA 1UWQA 1W56A 4ZMGA 4ZO9A 3WUGA 1XG4A 3D6NA 3PSWA 3MKCA 1V8EA 3LRKA 3FXYA 1WBJA 5CBJA 1TUFA 4LBUA 3ZSTA 1QWKA 2VVNA 3EB4A 4TTUA 4B92A 3W82A 3M7WA 4F40A 2WMIB 4PFHA 1QFEA 2V2DA 4KRZA 2INZA 5I3KA 1D3GA 1EF2A 2NXHA 1IXQA 3VGFA 1FWEC 4FIQA 4HK7A 1D8CA 5A6SA 2AKMA 2VRKA 1UASA 3D5HA 5I09A 4MJMA 4F66A 4DZ5A 4O16A 4NI8A 4M80A 4Q4KA 3W76A 4QITA 2DSZA 1BD0A 3H12A 4RE2A 1OG6A 3LEPA 4KWUA 3FW6A 3KWSA 3KBMA 3VE9A 4KKXA 3Q2DA 1VBRA 3DI1A 4AC7C 4GZJA 5I77A 4B5VA 1ISYA 1QNPA 1WDSA 1YXCA 1QAPA 2GQ8A 3ARZA 1KM3A 1XWYA 1K9TA 5FD0A 1QPRA 3EPNA 1MZRA 3EAUA 1F9CA 3PUGA 5EFDA 3W87A 3G5EA 4NIRA 1UC4A 4JKKA 5BXRA 4DYKA 4F0SA 1HW6A 3H21A 3UJRA 3BAKA 3VIMA 4S3FA 3B8IA 5JBEA 4YTUA 1UWSA 3WUEA 4JYFA 1OD0A 3N04A 3R8GA 1TJ0A 3VCCA 2C7FA 2H6RA 2XHYA 3R1ZA 1QW9A 2AKZA 3EX2A 2YLAA 4QJ5B 5LNUA 2PEVA 2OWXA 4NAEB 1HTIA 3H8AA 1JUBA 3E3HA 3WH5A 1GQJA 2EKCA 3VNYA 3VKDA 3UR5A 1RHCA 2I5QA 2ZUMA 3FAXA 3W6MA 5FACA 5KINA 1PE1A 5C6MA 2HROA 3LPGA 3FKKA 4A8RA 1E70M 3MBFA 1NIUA 4PUEA 4JTAA 2EG8A 2ANUA 2PDPA 2Z27A 4E6MA 1SJBA 3HN3A 5IHRA 3WF1A 3QW3A 2Y62A 3A22A 1ZAJA 1QT1A 5HUPA 2QCLA 3VKBA 4S1FA 4KEMA 3NQGA 1GPWA 4ADTA 2ZUTA 3ANYA 4LAMA 2C18A 2EPKX 4DN1A 3BSGA 1J11A 1US2A 1SZGA 2FVKA 4LCQA 2HJPA 3OLGA 4GC4A 1IF2A 1ML1A 1GVRA 5HPOA 2H8XA 4FAMA 3S42A 1OY0A 4PMYA 3T8LA 2Z1WA 2Y5EA 5I3HA 4C6NA 4WVXA 3KM8A 2ALDA 3E6EA 3GO2A 1M68A 3SM0A 1S39A 1B0IA 2PTDA 2J13A 1SU5A 5T9BG 1J93A 2EXOA 1WNOA 4Q8TA 4J3XA 2FKPA 2V9DA 4XZMX 1K6WA 3PBMA 3S1XA 1M6JA 4A22A 2Z24A 1QOQA 3PWGA 2WJDA 1KGUA 4LBSA 4H8NA 1MO0A 3CUXA 1VBHA 4D6IA 3UG8A 3RYSA 1FWJC 3LPOA 2FB2A 1KM6A 2R9RA 1NOWA 3LTSA 1GQLA 3QV8A 3DBPA 3DUGA 2EPLX 1CGUA 1UUQA 4ATDA 4O0ZA 4AISA 1SYTA 3IIZA 3GDBA 3MDWA 1JF6A 3CU2A 1R2TA 3CZJA 3R8HA 4D9PA 5I78A 3I3DA 1IGWA 3VK5A 1A5MC 3QGKC 4L1GA 4H9VA 3WBYA 1XLFA 2XN1A 3OQEA 1M7XA 2P0IA 2PP0A 2GJXA 1H2JA 1MUCA 1VBGA 2PFHA 3V1PA 3D3FA 3S47A 3BPWA 4RXGA 4PMUA 2DW6A 3VKCA 1A0EA 2PCEA 1RVGA 4ERGA 3D3AA 1J0YA 4GNVA 4IPIA 5I7GA 1FKXA 2E7FA 3IJIA 2BMBA 5CG0A 2OOGA 3LHYA 2OQYA 1UD4A 1R47A 1EA9C 2OOFA 3QXBA 5BRBA 1KFEA 3UYCA 1M7PA 3FKRA 2GQ3A 1TV5A 1UD6A 3TYEA 1A0CA 2G0WA 3APYA 3O6YX 2ZUUA 3SAZA 3WQCA 2WXDM 3V3WA 2V38A 3W2MA 3IJ8A 1XCWA 2Q3RA 5C71A 3MC5A 2CIPA 3EDFA 1FHLA 3HA1A 3PJUA 1H49A 4I7UA 2PZ0A 5EGRA 3AFBA 3TOPA 2FMNA 1BRLA 2Y7FA 4AY1A 1HUVA 2E6YA 3K1GA 2ISFA 3H2CA 4W89A 1ITCA 1CXFA 1IIGA 2V3GA 5A8MA 3E96A 4IP5A 2XH2A 1JGMA 4C90A 4NKCA 1XQLA 2E3ZA 3TX9A 1CXKA 1S2AA 2OGYA 4DJFD 3MHFA 4Z2JA 3THDA 3CWHA 4C6DA 3M43A 1G01A 1EHNA 2VOTA 3ARUA 5H1WA 1XW8A 3LZ3A 1KW1A 5C9ZA 4OOZA 5EYWA 3G18A 1RK6A 3RM4A 1W1IE 4YCOA 1KXHA 4ASTA 1TWDA 5DRCA 1RCOB 1LOSA 3UA3A 1MRAA 4LUTA 4BF7A 1LTDA 3SGZA 2UY4A 1YBQA 3PFMA 3UYIA 1TPEA 2C1IA 3GU1A 4PODA 4A35A 4GJJA 2DSWA 4Q8MA 3T2QA 3L5AA 1GVQA 1KR1A 4GVGA 3WZ0E 1XX1A 1US0A 1JCMP 2J88A 5HATA 2IXVA 3WEZA 1FWTA 4CNOA 1XIJA 3KP1A 4GABA 2VTFA 2BVYA 4IG2B 4LB4A 1H62A 3MQTA 4DJED 4FP1A 5AC8A 4GD0A 1YRRA 2UY3A 1UJPA 2CYGA 3QV9A 2YXGA 2QLYA 1WA3A 2VR5A 3TR9A 1HNYA 3TWBA 3M1ZA 4E2BA 3DKLA 4JTEA 2HE8A 8TIMA 4KBXA 2X7VA 2GVJA 4JD4A 3S2LA 2BXYA 3SRDA 2J7FA 3G3MA 3GSMA 5K9DA 4G2DA 4PGLA 4JTTA 4PUDA 3NEHA 5HQMA 4GXMA 2WZIA 1QNQA 4ECLA 5K9XA 2C19A 5D4YA 3IGSA 1RD6A 4GJ1A 1XLEA 1UKSA 1C9WA 2ZX9A 3BG9A 3AMKA 1FCVA 3ZVHB 3P67A 3VX1A 3WJSA 3GU2A 3L5MA 2QUVA 4Y90A 2D3LA 2OZTA 3V0UA 3N25A 2QW5A 1EA0A 5LYRA 1KXQA 1RY8A 1H7RA 4ZO8A 4NL1A 3IK4A 2NVDA 1NJJA 2EGZA 2FIQA 1Z69A 2A5HA 6XIAA 4NSBA 1NVMA 4M6UA 3M5VA 4Q32A 5A1AA 4JICA 3ZIZA 3U4AA 5HWMA 2GJPA 1IXOA 1KV5A 2GJRA 3QZ6A 1LWHA 3LGEA 1V5XA 3W81A 4F9JA 2NW0A 2PTWA 3GHRA 4UR9A 3PWAA 4WDUA 3WDPP 4LEQA 4ZEPA 2DZSA 4AVNA 2REQA 3T6CA 1P5BA 4DO7A 2WVSA 5DMYA 1EF3A 4Z1YA 2D0GA 3F4WA 4UR8A 4AEOA 3L4UA 5CZJA 1CGYA 1N8IA 2DUAA 2NLIA 1H50A 3PPHA 3ARSA 2WKLA 4RDWA 5FI8A 2V0TA 2ZA1A 3WLSA 3BGAA 4R7WA 3MT1A 2A85A 2XIBA 5BOOA 3LI0A 4ADSA 1UR0A 4FEZA 1PS9A 3TYCA 3W1NA 1H7WA 4GZEA 3RM9A 2IPJA 2G96A 3UWYA 4DJEA 3ALFA 2QCEA 3E2RA 2QCFA 2QJNA 5J8LA 4Q8UA 3M44A 1KFCA 3GH5A 3P82A 3RLHA 1SFLA 3MCOA 1GWJA 1XLMA 2WHKA 3EB3A 3MI6A 4NXKA 1GZJA 3EOLA 3B97A 2DZWA 8XIMA 1K77A 3CM4A 1XIHA 5C9UA 3CIXA 3Q58A 2B7PA 4V27A 1EJXC 3RLUA 1GZ1A 1YDVA 4PYSA 3GVVA 4Q7BA 4JXCA 3QF0A 4Y9AA 3VD3A 1BGGA 4D1JA 1TRIA 3LCIA 1HX0A 1TZZA 1VHNA 3UWVA 1KBKA 3DC0A 3VKAA 2ASHA 1GOIA 1Q63A 4O0KA 5F2MA 3ITCA 3M0KA 2WVUA 1T40A 4I8YA 1XLKA 3GNRA 1WAUA 3VZYA 3CNYA 2GJNA 4ROPA 1OFAA 4O4VA 4OGZA 1JZ7A 3JS3A 2GWNA 1D8WA 5F7UA 3N3MA 2V8ZA 1UD8A 1CECA 1EH9A 4KEVA 3NQ7A 4PCTA 2EG7A 2J4GA 3W07A 4DUXA 1M3UA 4DJFC 1KFBA 4MIMA 4M5PA 2HTMA 3PULA 1MQPA 2Q02A 3EB2A 4XO6A 4HCHA 1UA3A 1FKWA 3G1HA 3VM7A 1KNWA 3RCYA 4FF5A 1NOFA 2J7EA 5DCEA 4FHAA 3WMCA 4JX5A 4ZA0A 3WDIA 3LHVA 1V3MA 3WLJA 3MVIA 3LXCA 4R53A 2GOUA 4K39A 3TFXA 2GWGA 5MF5A 1JDFA 3A64A 4AD4A 1N8FA 3R12A 1RQHA 3W1XA 1E1EA 1D3HA 3ZM8A 2IW0A 4K2SA 4ATLA 3PBWA 3RUBL 4H7CA 4GFSA 3W84A 1AW1A 1E4IA 2HVOA 2X1IA 1NM9A 6ALDA 4JHOA 2XINA 3CTTA 2XZ9A 1XKYA 4IM4A 5AN7A 4A3HA 3CUZA 3OHIA 3PTQA 1GOQA 5K4ZA 3XIMA 4H6KA 1DEDA 1YNQA 1OK6A 2PLMA 3MV11 4URIA 5DMNA 4UTJA 4WEVX 4HPGA 3GVQA 1V3HA 4J35A 3ECQA 3Q65A 1M04A 3N34A 4YU1A 4R7OA 2WMFA 1QW8A 3P2VA 1W3NA 1XDLA 3TJ4A 1VFMA 3OLEA 1SW7A 4G7EB 3VNMA 4JTFA 4JZ5A 2ALRA 3AQUA 2DU2A 3G6LA 2GVYA 4NY2A 1OFOA 3VKKA 2DEPA 4XIMA 3LK6A 4JNYA 3LQLA 4QR6A 3NXLA 1ZALA 1ZBCA 2A3AA 1PL9A 2G3NA 1YADA 1KQZA 1B57A 4O0QA 3RU6A 5KEZA 3CL7A 3RR4A 4H6RA 3M9YA 4JQ3A 3B0XA 4ALDA 2EPNA 2P1FA 1UC5A 1YPIA 3EKZA 5A8PA 5CPSA 3ZVHA 1CT5A 1ZS2A 2CLMA 4NX0A 3PG8A 4C6OA 3ERPA 4O1FA 1YTKA 3H54A 2I56A 1OC7A 2Z00A 4ZODA 3MA8A 2EPOA 3FYPA 1H1NA 1BYDA 3VMNA 3VNZA 3M0MA 3FX4A 6A3HA 3IGUA 3TN4A 4A8NA 2FZBA 2RH9A 3KOYA 5DEZA 1ZTVA 5C9RA 1J5TA 1VYPX 2GYIA 4LH8A 5U4NA 5ABHA 1JD7A 1KLYA 2NUXA 3EGJA 5PTDA 1PCKA 3L2LA 5G1TA 3TLLA 3TR2A 1U5JA 2R82A 1MW1A 4XD6A 3BAYA 4AD0A 3P3BA 2UWFA 3R11A 4R9XA 4PMDA 2VFFA 1TELA 2ZDSA 4GC3A 1CGVA 2FVLA 1PHWA 1WZAA 1FWFC 3H22A 4IFRA 2XIJA 4C6KA 3DGBA 2E6DA 4ZQPA 3VI2A 4WX2A 3NIYA 1V03A 5K4XA 1YDOA 3EWCA 3B4UA 3W83A 3U2ZA 2VMFA 3ZVIA 3KZPA 2PDMA 5CC3A 3KBSA 5JVLA 3DESA 4W93A 3DG6A 3R25A 3CTLA 4YNGA 3LNPA 1G4EA 2WJFA 4J27A 4CNPA 5F2GA 3POHA 3W2JA 1OX5A 1LROA 4JL2A 4N9BA 4GXWA 4GRSA 3H24A 1MXSA 1O4UA 4H9XA 1E9IA 3TTEA 1XP3A 3W2UA 5BYWA 2V3EA 2XH4A 3N4EA 4LPCA 2WNZA 1VGAA 1E55A 4DBWA 2YXXA 1DJXA 4GISA 3BSMA 1U1HA 1GVEA 3L4WA 2D2OA 1IEXA 7TIMA 1TPH1 4EPBC 2DZVA 3LTYA 2VP8A 3LV5A 4AVFA 1N2VA 2WNQA 3I4EA 4GQBA 1AL8A 3AYVA 4TMBA 4ZENA 1HN1A 2HNHA 3HJZA 5A6TC 3SSJA 4JIPA 3P81A 2Z7KA 3ELFA 5H91A 4BI5A 1V0NA 3EX1A 2Y88A 1G4TA 5AFDA 1X1NA 2NUYA 2A21A 1OD8A 3B8UA 4UTIA 1IWBA 3GG8A 2FGBA 1R86A 2VWSA 1CLVA 1FX6A 3W1UA 2I9UA 3KUMA 4RX0A 1OT2A 1W9BM 3CB8A 5BMXA 2BS9A 4KEUA 1RLDA 5AVHA 1D9EA 1KXTA 2Z26A 1DWFM 3IVSA 1KD0A 3SURA 4PMZA 3H2NA 5XIAA 3W1LA 2D73A 1TV7A 3LI1A 5A6KA 1KV8A 2C1HA 3DG3A 4DHGA 2PD9A 2P8BA 2DY3A 2ATSA 2V82A 4GUGA 4CN4A 1ZUAX 2QJIA 3GZ3A 4GA8A 5AC7A 3G8EA 5MKGB 1E51A 2NQHA 1VCVA 3TP4A 4KIEA 1US3A 2W4XA 3OBAA 3ZR4A 2RGLA 1WUEA 2WSQA 3AIWA 1GK8A 4JR5A 5AYZA 4FXFA 3PZQA 1J6OA 1Q7ZA 3QFWA 3BV7A 4JFWA 4RJEA 1GG1A 4IH3A 1DTUA 2ZRXA 2ZXDA 3BMXA 4LWWA 1F6PA 3WJXA 3AS3A 3L2MA 3QOKA 3EBVA 1XISA 3NDOA 2ZRYA 3I3EA 4Q4QA 2XWEA 1OF8A 4IX2A 3M5YA 5B80A 1NSJA 4NZ5A 3RPMA 3QRHA 4WR3A 3UESA 4IUOA 2A3HA 2XZ7A 3M6DA 3RFAA 2XGZA 4XKYA 4I9JA 4I3GA 3W6LA 5EA9A 3AXHA 1K1DA 4QXIA 1QMLA 1FCQA 1OEPA 3GXPA 3L0KA 4L1WA 5EMUA 1XIDA 3T0BA 3EKGA 3KOFA 1BKHA 5F4WA 1BWKA 5AYYA 4IMFA 5JH2A 4H6EA 4X2PA 1Q65A 2Y7GA 4MNJA 3UW6A 2HXUA 2O0TA 2G4FA 2OKTA 3N19B 3QHNA 1EJRC 4P8XA 3P5YA 4DWSB 3BLFA 2WMKA 4HPXA 3I7RA 4FR6A 4TR9A 1ME8A 4FPSA 1U22A 1JCYA 1FWHC 4WKFA 3VD4A 1JPDX 3T08A 5LIKX 3W38A 3LTPA 3MKVA 1Q13A 4OU1A 1NAL1 2WHJA 2PU1A 4NYUA 1S1RA 2X7WA 4NP7A 2Z2BA 2J9XA 3B0VC 5HBFA 3B8SA 1JCXA 3V75A 5K9CA 2RJHA 2WLZA 3CV1A 5CAHA 1HFBA 2R24A 3FEQA 1EDQA 1T8QA 1LL6A 2XISA 3FS2A 2XUCA 3HQNA 4DJDA 1ZRQA 5CJMA 3BAIA 1UD3A 3VNJA 3CEPA 2OSWA 1RALA 1V0MA 3GTHA 4BF5A 2POZA 1QI5A 4Z2IA 1XHGA 3UXLA 3NQ6A 2C16A 1TR9A 4QQUA 4HN8A 2OT1A 3CHEA 3GW3A 2YCKX 1XH0A 4IQLA 1ZFJA 3LCHA 3LSCA 2CZDA 4GIYA 3PK7A 4E4PA 3FA3A 1LCOA 2HISA 1MDLA 1VRDA 2O9RA 1QJWA 1CDGA 3EWUA 2EJ1A 4LV4A 2QVHA 2OYKA 4ZSUA 5KSWA 3BAWA 3SADA 4Z0SA 4PL2A 3QV6A 2W5FA 4ZQNA 3VU2A 4QSHA 3HMJG 3FV9A 4J2MA 2EQDA 2XDFA 4JDBA 4ZSTA 4YVVA 3H2AA 3WY1A 1PV8A 2Z4GA 1CEOA 2EF9A 3QJAA 4AXNA 2W62A 3AYSA 2PWGA 4AIEA 5DO8A 2Y63A 4E4FA 3FJ4A 2RJGA 2ZXQA 4RV3A 1CYGA 1ZBWA 3C0QA 3HOJA 5K2ZA 4MB4A 1ONEA 2PDBA 3S5OA 2ZZ3A 3V16A 4B91A 4G9PA 4E5TA 2C8NA 1QHOA 4HNVA 1PWMA 4RL3A 4XTIA 3LSBA 3BW4A 1U83A 2G3JA 5FF3A 1X39A 4GCXA 2A3EA 1PX3A 1GJPA 3F4NA 4HHHA 1QW7A 4WD0A 2QJGA 1QUMA 2ZBTA 2IQTA 4ENLA 4OWGA 1XD1A 4E0CA 3N2TA 1YBQB 4AIUA 3LCLA 4X61A 5C2GA 1FFRA 1E0TA 3RK8A 1OSEA 5HAOA 5TBOA 3IJ9A 4MJ4A 2O4MA 2VDIA 5E6YA 4K8EA 5HDRA 4GBUA 3UBPC 1QHZA 4DLFA 3O1NA 2OT0A 4DZIA 3W27A 8A3HA 2NX9A 3H6OA 3ITLA 2JEPA 3QHMA 4EXAA 1X8FA 4Z1AA 3A3XA 4J3UA 4FLOA 3C61A 2FGLA 4MFEA 1ZLPA 4BQ3A 5HPCA 5C55A 2F61A 3RO8A 1H63A 1ITUA 1LBMA 2YR1A 2XVGA 3G2GA 2A3CA 2QS8A 3ZT5A 5GVJA 4NZFA 4XQ6A 1W2VA 3RMJA 2P3ZA 2IXUA 4LB3A 4C6PA 1FWRA 4PMRA 3UNDA 4LT9A 5FJIA 3TV8A 4LNCA 1TE1A 5FJTA 3SUWA 1S2TA 1FH7A 3M41A 3KL5A 3PUOA 4FX8A 1J0JA 1B9BA 3LQGA 3CPGA 3EMCA 3MJYA 2PP1A 3VA8A 4DY1A 5C2CA 4TX9A 3LYEA 4AZ6A 3A9IA 2PC4A 3WQDA 1ZZMA 2VCBA 3WYZA 4JIQA 2DT0A 3ZWSA 1CCWB 2DVXA 3L67A 1OYAA 1W17A 2WCAA 2VI0A 1NDVA 1VJSA 1O1ZA 1LRTA 1QI2A 3L5LA 7ODCA 3IWPA 3HV8A 3AMCA 4UWMA 3UFYA 3UXDA 4TVCA 1VFLA 3BLPX 3QTGA 1PEZA