3QH2A

Crystal structure of teni from bacillus subtilis complexed with product cthz-p
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
195
Chain Sequence
SHMELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFGRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMRYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Missing Enzyme in Thiamin Thiazole Biosynthesis: Identification of TenI as a Thiazole Tautomerase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords Regulatory protein tenI
total genus 77
structure length 195
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 5.3.99.10: Thiazole tautomerase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qh2A00
1IXPA 2GJLA 3LDVA 5AC8A 2J6XA 1VCGA 5KSWA 3LCIA 2NUYA 1H50A 4N9BA 2EKCA 1ALDA 1GG1A 4O0KA 4Z08A 1KM5A 3R8RA 4DF0A 4CQ9A 3WK1A 2WKJA 3GKFA 1NVMA 3QSTA 4E0CA 2YX0A 1I2PA 4WX2A 1DQXA 1DJQA 4Y96A 3W85A 2GPTA 1RR2A 2QDGA 1A5AA 4YL2A 3DGRA 2J9YA 1GT8A 1IIHA 1KBIA 5FEPA 1VCVA 1DVJA 3NL3A 3C3NA 4JDYA 3PG9A 4NZJA 5J5RA 1LROA 3EX1A 3RFAA 4QSHA 1HG3A 3BK0A 4Z1AA 5AC7A 2A0NA 1JVNA 4ALDA 3NA8A 5AB3A 3PS7A 2GJNA 3MHFA 3NQGA 1OFBA 1JRCA 3S42A 1OABA 1GG0A 5DXYA 2C15A 2V81A 5CPLA 4LVDA 4X22A 3RU6A 2H90A 3IVTA 3W2UA 1U83A 2WPBA 1SQ7A 4DBDA 1G4SA 5DXXA 1K3UA 2ISSA 1W1ZA 1LORA 3VFLA 2A7PA 1FCVA 1A5SA 1EWDA 4JEQA 2OMAA 2C19A 1PIIA 1ML1A 1QPQA 3G8RA 3NQDA 3IV3A 5EY5A 3DXIA 4RKAA 4UMCA 3CHVA 2ZTKA 3C2VA 4YXGA 5HULA 3TMLA 2TYSA 3CB8A 4RXGA 1I8JA 2Y85A 3RF9A 5DELA 1VYSX 3WJSA 1UCWA 4ORIA 1OK6A 5K9CA 4JIQA 2F7FA 2H8XA 1QAPA 2PRLA 2QUUA 3JRKA 1OG0A 3O15A 4AHQA 4H4IA 2BTMA 4UFKA 1XBYA 3PSVA 4OT7A 3EWWA 2V8ZA 3SSJA 3UNDA 4N9DA 2VFGA 5BRBA 1K8ZA 4WJEA 4AHOA 2G95A 3NQ8A 5AYZA 3PC0A 3M16A 1YLVA 5DY3A 3DFNA 1G7UA 3T78A 3CU2A 1WBJA 5LNVA 2DZPA 4FNQA 1Y0EA 1DV7A 1O94A 1IXOA 3GB6A 1FCQA 4LS2A 3FKKA 4WD0A 2DJLA 3GR7A 1HO1A 3OVRA 3GR8A 1ME7A 2QCCA 3W7GA 4LS1A 2OZ0A 2JKPA 3MYOA 5HWMA 2NX1A 1K7XA 4RK8A 1OFDA 3UWVA 3IVUA 4IMGA 4B5NA 2QJIA 4UTLA 5FEWA 3L0KA 4JICA 1SO4A 2FJKA 3Q58A 4IWWA 4K39A 1KFJA 3T4CA 3W2LA 2WQPA 3KHJA 3PM6A 5AOUA 1H7RA 1OJXA 4FX7A 5LNUA 1L2UA 3ZS4A 3NM1A 3AO0A 2O7QA 2BLEA 1G4EA 1XBZA 2CLFA 4O0ZA 3EWZA 1H1YA 2TRSA 1XM3A 3RK8A 2QAPA 3DFOA 2UV8G 1PS9A 3R5EA 5BMXA 2WO5A 2V0TA 5KINA 4MJZA 2BX7A 1ICSA 4UNKA 1W5MA 5C54A 1WXJA 3P5ZA 1MXSA 5J5DA 4DF1A 3W2KA 1LLZA 3LHWA 1XDMA 4HIBA 1ZFJA 2J88A 4NJJA 1GZGA 3TJXA 4JN6A 1XC4A 3LI1A 1S3HA 4EWND 2WSQA 2QCFA 2HS8A 3W1NA 2CU0A 2F84A 4BI6A 3PG8A 4RV8A 3UZJA 4O15A 4GUFA 1JUKA 1VJIA 5U7SA 3QQ0A 4AMAA 2ATSA 1KTCA 1W3NA 3G1HA 3BW4A 3S9YA 1OX5A 2R14A 1PHQA 1TTIA 3NM3A 5FESA 4MY1A 2NX3A 3HPSA 3PY2A 3EXSA 1XI3A 3GDRA 4DXVA 1HL2A 1SO6A 3STCA 4Y90A 4K36A 1O60A 3S1XA 1JCXA 3G0UA 3W75A 1KFKA 3NQCA 4M19A 4JDBA 1FCBA 4MYXA 4JX5A 4JX4A 1VCFA 2A5HA 3U6WA 3NDOA 2X16A 2C3ZA 4WY0A 1ZNNA 2C13A 3PF3A 4NU7A 1XDLA 1T8XA 4M7SA 3CIXA 4ONVA 4ZVJA 1ZALA 2EAWA 1KM3A 1WX0A 1FWRA 3DHDA 3M6YA 1R47A 4LC8A 4AWUA 4EOUA 1OFRA 3E96A 1GEQA 2A6NA 3PUOA 1K8YA 4JTLA 3LB0A 3C6CA 3L0GA 1TTQA 1K02A 4MFDA 3TXVA 1SW3A 3WFAA 1FDZA 3C2RA 3UPWA 4MLRA 4O1DA 2Y6ZA 4POCA 4TX9A 5LZLA 3HG2A 3CIWA 3MWAA 4HNTA 4UC5A 3BVJA 3M7WA 4YMZA 3UYCA 4O14A 3TKFA 2DU2A 1PCWA 3HMJG 1OX4B 3GDMA 3FYOA 4PTNA 3LHTA 4AWSA 3W7NA 1W5OA 3HQ1A 5U4NA 3MW7A 2ZRXA 5TIMA 3DFQA 3W7CA 3NL5A 4LWWA 4K7VA 3W7IA 3H53A 5G2HA 4TIMA 2ZRUA 2YYTA 2H3DA 2PRMA 6TIMA 1YDVA 2ZA3A 3PULA 3HGOA 3PB0A 5LNSA 1L6SA 5G4WA 3P82A 4N6EA 5FF4A 2P0OA 4O52A 3BV4A 2FIQA 3NVTA 2Y7FA 3IIZA 3W2MA 1F6PA 3NQEA 3QZEA 2X1RA 1LBFA 3MBDA 1I2QA 3JS3A 1H7WA 2Q3RA 2Z6JA 2CLIA 2DP3A 1TCDA 3KVKA 1Z48A 1XBVA 3EX6A 2GUUA 1AW5A 2JKAA 4MY9A 3LCXA 5EBUA 4K8HA 1PHWA 5G1YA 1QNVA 1KTBA 4WY0F 1H5YA 3N3MA 3NZ1A 1YDNA 3G22A 4MZ8A 3R89A 1ZAIA 1VHCA 5F4WA 2ZZ2A 3USBA 1TRDA 1J2WA 3HO8A 3HBLA 1LTDA 5AHEA 3YPIA 1Q45A 3HGSA 1LYXA 1YPIA 4W9TA 4FNRA 3NQ6A 3E49A 3Q2DA 2DORA 3N2MA 1TPWA 1JJKA 1QCWA 5FF3A 5EKYA 5C6MA 3KXQA 4JYEA 3TX9A 1BWLA 2YGYA 3GKAA 2VOMA 3S5YA 1A50A 3TC7A 3HG4A 4HKPA 5DBTA 4O54A 4L4LA 3NQFA 1R30A 3CTLA 1OK4A 5L6UA 3T55A 1KTNA 2Z2UA 3NPWA 2G97A 1NEYA 5DBUA 4IX2A 2ZZ4A 4TO8A 3SI9A 4XTIA 3C2FA 4TU1A 3S8HA 5KZDA 1FX6A 3BG3A 2Q8LA 3UD6A 1TREA 2ZZ5A 3BGJA 4ZL1A 4UCGA 1ZY9A 3E9AA 5CSSA 2B4GA 2FTPA 3MMTA 5HR7A 2OCZA 3SW6A 1V5XA 5D04C 1TV8A 4GC4A 2FQIA 3MUXA 2TMDA 1JUEA 4MY8A 3BLIA 3O63A 5TBOA 4A2RA 1LZOA 3TW6A 3HPZA 2Q8ZA 3L5AA 4LV4A 2A4AA 3PR2A 2Y7EA 4UMAA 4A22A 3A5VA 4ZQMA 3EXRA 3O06A 1T96A 4ADUA 2EHHA 1B3OA 5K9DA 1TPB1 5C2XA 3R13A 3W84A 1GJPA 1E51A 3DZ1A 4M5PA 2GOUA 2CLHA 3BGGA 1TPH1 2I9EA 1NF7A 1X1ZA 2FFCA 2R94A 3W1UA 4KWVA 4NJGA 3ZWSA 3H54A 4BR1A 1UASA 2XN1A 1H1ZA 5K4ZA 1VYRA 1P1XA 4IJBA 4KKXA 1DL3A 4O4WA 5D2WA 4RLIA 2BSLA 2ABAA 3GDKA 2QDHA 3NPVA 3M47A 1OYCA 5A5WA 1M7PA 2YCEA 4AF0A 2ZZ6A 3A22A 5CPNA 4MPQA 3LHYA 5FEZA 4K6AA 1XKYA 3TUUA 4DO5A 1AL7A 4WXYA 1P4CA 3C52A 3N34A 2ZZ3A 3PBVA 4HHPA 2E6DA 1LRTA 4Q33A 2X2GA 3W1QA 5F2MA 4GE8A 1OVDA 5IBXC 3P81A 4FNPA 3F4WA 3W1MA 5D2YA 4IMCA 1PE1A 4QNWA 4CCCA 4NJHA 2NXIA 3ZR4A 2QCHA 3DU0A 4AVFA 1G4PA 4I7WA 4OGZA 2VEKA 4LC6A 5CGQA 1LP6A 4OQVA 2E6YA 3IGUA 1H63A 4GUHA 3B0VC 1DJNA 1FWNA 3TXZA 2CZFA 1OFOA 3KRZA 3NNTA 5SWUA 3MBFA 4UTIA 3EKZA 1S5WA 5LGZA 4HSOA 4O1CA 1TV7A 5C5YA 4QM1A 4JTIA 5EA9A 2J9ZA 3F1QA 5DY2A 4UNLA 4ZMGA 3ABRA 4MYAA 3TDFA 3W7RA 3L65A 3SJ3A 5I3FA 2FDSA 3GZ3A 3PBUA 4UFIA 3UXDA 1YTKA 4FNSA 4NQ1A 3M41A 1KM6A 3W7DA 3LM7A 4JTGA 3PBYA 1W54A 3W6YA 3KOFA 3DAQA 4CQ8A 3B03A 3O05A 4UFHA 3DFSA 2E77A 3C61A 1H51A 1GTEA 1JQXA 3UWZA 4XWUA 3PAJA 3G1AA 3TAOA 1K7EA 2FPYA 3NQAA 3DKLA 1AL8A 1WBHA 2HSAA 1F7BA 3P60A 3QJAA 3BG5A 3I7QA 4JGDA 1ICPA 5HWNA 3R12A 3TU9A 5HR6A 3LRMA 5AYYA 3OIXA 4XBKA 3SY5A 4GFSA 1HUVA 2QR6A 3S1UA 2C18A 2Y7DA 4RZ5A 1DOSA 3TMQA 4O16A 4FXSA 2YW4A 4I9AA 2BZNA 2E5DA 3IIPA 4OHQA 1WDWA 3E0IA 4LRTA 4KFPA 4HSNA 5L9FA 1WAUA 3HG3A 1R2RA 2YSWA 2OJPA 3ANYA 1FBAA 2CLLA 2DZWA 2QAFA 3CC1A 1M5WA 4O11A 2RDUA 2YFNA 4UMBA 5KMYA 3NAVA 2QUVA 2Y61A 1KFCA 2ZDRA 1EUAA 4JTFA 3HGRA 2CFFA 4PL2A 1F74A 4IQLA 3HJZA 3I7RA 3WJWA 4K38A 1QFEA 4O1BA 1VGAA 4O28A 4DELA 4E2DA 2LLEA 5AN7A 1J4EA 3NQVA 3QH2A 2NV2A 1W0MA 3LXAA 3UPBA 1PL9A 4AHPA 1KLZA 1A53A 2PC4A 4OV4A 3MP3A 3ZFHA 2RFGA 3PUEA 4LRSA 3TC6A 1KM0A 4CCEA 5HUOA 4BK9A 3OG3A 1I45A 3EXTA 1TPEA 3DH7A 1VS1A 1VC4A 3GVGA 1GVFA 1MEIA 1I2OA 1WOAA 1EUNA 2JK2A 4LVGA 3N9RA 5AC6A 4AWTA 3TV8A 3CPRA 1OFPA 3W7JA 3C2OA 1BTMA 5I3KA 1QWGA 4WZHA 2CZDA 1TTJA 3OA3A 3TSBA 3CM4A 4IXHA 4LUJA 2QUTA 1TO3A 3LXBA 1R2SA 1DQWA 2R8WA 1PVNA 4LUIA 4Z0JA 2B7QA 2E6FA 4FF7A 2HTMA 3N2XA 4LV9A 4UTJA 5BNKA 2DZUA 3M5VA 2BXVA 2J9XA 2RDWA 1S5VA 2QCDA 5AYXA 2EPHA 3ZWTA 5E93A 4M6PA 1FWTA 1GVOA 3F4NA 4MZ1A 3LI0A 2P1FA 3VKJA 3MHUA 1YTDA 1X6UA 4GUIA 5FF2A 2J24A 4BI7A 5CG7A 1LOQA 3GAYA 4S1FA 4N02A 3OVQA 4IMDA 4M6VA 3C4UA 5LNWA 3G1XA 3V1PA 3W74A 4HPXA 2G96A 4O8RA 1G6CA 3W23A 1EIXA 1I2RA 4HN4A 1MO0A 3DI1A 3GDLA 4JXCA 4MUZA 1MEWA 2EGZA 2E6AA 4O19A 2WSYA 3UY8A 5LNRA 4YLWA 2YPIA 2GQ9A 1D3GA 3C56A 1C29A 5GVJA 2ALDA 4AF0B 1ONRA 2JKEA 2C0AA 1F6KA 3Q94A 1VHNA 5D32A 3JR2A 3ATZA 2YZRA 3STGA 3FIGA 1RQHA 2IQTA 1WQ5A 1T99A 2CW6A 1EP3A 3QF0A 3FEMA 3LGEA 3LLFA 2GQAA 4P61A 4Z1BA 4JYDA 1I2NA 3VNDA 5EPDA 1VRDA 4XBSA 1SO5A 3M5ZA 1CI1A 1FWSA 4UTTA 3GAKA 1TMHA 3WJXA 2GVLA 4JD4A 3O8AA 2V82A 3FLUA 5CZJA 3A24A 1WOBA 3C0JA 3U2OA 1LRQA 3LTPA 3NQMA 2GVGA 1PCKA 3HF3A 5AHIA 1SZEA 2W6RA 1W37A 2VENA 1JCNA 1LCOA 2NZLA 3S5NA 1LBMA 3W1LA 4JTTA 1FXPA 1NAL1 5BOOA 3LHVA 3U8GA 4XKYA 1SZNA 5LHFA 3GNDA 4MIMA 3I7SA 1W56A 5K7JA 5DCBA 3AJXA 3SIZA 1TJRA 3QW4B 3S5OA 2ISVA 3LCHA 5IBXA 1GVQA 4O10A 2Y7GA 3TSDA 3P67A 1TQXA 1V7YA 3WJYA 1BEUA 3G18A 4JTSA 4PFMA 1KFLA 1GYLA 4ZQOA 2ZCGA 2JBMA 1O5KA 3IGSA 4O13A 4PL1A 2YFOA 4FEZA 3BARA 2DJXA 4XTDA 3L66A 1IXQA 5KITA 1BWKA 4IPJA 3L5LA 3P80A 5DCEA 4UFJA 4NXKA 3TJLA 4BI5A 1XXXA 3KRSA 1F5ZA 1KM4A 2VFIA 1GWJA 5D09A 3IIVA 1YADA 1VLIA 5AHNA 1UUMA 1YPFA 4TR9A 1TPDA 1EWEA 2YXGA 4KFOA 1SU5A 1R46A 1DKWA 2E68A 2JGYA 3S1VA 2FPVA 3NEVA 1JULA 2QCNA 2OX1A 4BWLC 3DBPA 2ZFAA 2B7PA 5G2IA 4D2JA 1ZJIA 2NWRA 5I3IA 2G5WA 4S2CA 2VEIA 1JCYA 3NPUA 4DO6A 3DKJA 5F4XA 5AHLA 3B8DA 3TH6A 3PB2A 5ABTA 1SO3A 3A5FA 4LY8A 3RLVA 3MP5A 1K03A 4NT0A 1WV2A 4OE7A 1TQJA 1H60A 2X1UA 2ISWA 3EX3A 3I6RA 4FNUA 4NZFA 2QJHA 4RZ4A 2WNNA 4A21A 3NGJA 1EPXA 3F03K 4GNJA 2QCEA 1B9BA 1VPXA 4S2BA 2RHGA 1IXNA 4FIRA 3W83A 1DORA 1F2JA 2ZTJA 1HFBA 4QIUA 4CLMA 3EX4A 5D37A 3GYEA 4EVZA 1W5QA 2X30A 2CZ5A 5HUPA 3NO5A 3FYPA 1L6WA 2Y89A 3O6YX 4TMBA 4JX6A 4Z1CA 1QPNA 3LCFA 2CLMA 2J27A 5DCDA 4CNPA 2ZZ7A 1SPQA 4LU0A 5D38A 3L67A 1D3HA 3O16A 3LLDA 3Q37A 3BPWA 3M9YA 2E09A 3A21A 3MP4A 5H2ZA 3TAKA 3NR0A 1W5PA 4QAIA 4MLJA 4DBEA 1XBXA 1ZAJA 4NJIA 1RQBA 3MJYA 1F05A 1HTIA 1M7OA 3W1XA 2C14A 4AEOA 2A6LA 5CZSA 1KV5A 5IM51 3DI0A 1RQEA 3IVSA 3TIMA 4M6QA 3GNNA 1Q6LA 3CT7A 2FB2A 4UTKA 3I65A 1TYGA 3CQ0A 3W7MA 2VELA 4Y8FA 5D05A 3BLFA 3SZ8A 3G1FA 1L9WA 3GK0A 4N2YA 1WA3A 3S6DA 3W7PA 1O95A 4FX8A 5FF7A 2C1HA 2GVJA 3C8FA 3LBMA 4Y6GA 3L0NA 1C8VA 1IIGA 2I1OA 4JTKA 3M0ZA 3O1NA 2VXNA 3QPZA 3W88A 3B06A 3G1SA 1TPUA 4JY8A 5FEXA 3FFSA 3NXFA 3T40A 4AB4A 3W7KA 5FI8A 4LVAA 1JRBA 2H6RA 1Z42A 4O18A 4WQ6A 1O5XA 1UUOA 1GTHA 3VE7A 2V9DA 1JUBA 3D0CA 1LOSA 5CPOA 4RXFA 3TQKA 1EP1A 3LCGA 1TRIA 3TFXA 3LV5A 5HJLA 1QMLA 4MOZA 3O07A 4CCDA 3P7YA 4LS0A 1XUZA 1VQTA 4GUGA 5D2XA 3G1YA 4O1AA 1XUUA 5FF0A 1VR6A 3QQ1A 4Q32A 1CX9A 4UXDA 3TW7A 1S5TA 1SFLA 3M44A 1W5NA 2ZRYA 4H6KA 1C9DA 3P8IA 2O7SA 4PODA 3T44A 3P62A 3TQVA 4QNEA 4HNVA 2W0UA 2WJZA 3LHUA 4PCFA 3RLUA 1LDCA 4A3UA 5C55A 4C1LA 3MI3A 1ADOA 4IUOA 3SR7A 4N4QA 3HGJA 3N19B 3N14A 3GIYA 5K9XA 2WV8A 3R2GA 3UWWA 3FJ6A 1TPFA 5CSRA 3L5MA 3QMRA 4DF2A 3GXPA 3VCRA 1RV8A 4IXXA 2VEPA 2XFWA 3KX6A 5F2IA 4Z1DA 4JIPA 4UFLA 3NQ2A 3EWYA 3TR2A 1QDSA 1RZMA 2OT1A 1AW1A 2ZRWA 5F2GA 3BW2A 3KFTA 2W79A 5KZEA 4IGHA 4JTJA 3EB2A 3LTYA 1N7KA 3M5XA 3ABQA 4JNMA 1N55A 3L21A 3WK2A 2GQ8A 3HPXA 4IPIA 3A9IA 3NZRA 1UBSA 4XQ6A 4E2BA 2ZQ0A 1JR1A 4NXSA 1ICQA 4RCXA 5I3GA 5LGXA 3GLCA 1GQNA 1Z41A 4ADSA 1KM1A 3LTSA 4NX5A 1OYBA 3P8JA 2Y62A 4GJ1A 3NPXA 1H7NA 2YYUA 3K30A 5G5IA 4HNNA 3B05A 2HS6A 4YCOA 3FKRA 4HPJA 3KVJA 3TA6A 8TIMA 1BKSA 1ZCOA 3STEA 3BO9A 3PSWA 3UWUA 3SGZA 1ME8A 1RPXA 2Q3OA 3L9CA 3P61A 4U28A 2Y63A 3ATYA 1SFJA 4FXRA 1EEPA 3S0CA 1MZHA 5CPMA 1KA9F 1YYAA 4BFAA 3MI2A 2Y88A 2PE4A 3TE9A 5CZ0A 5G1TA 4FHAA 1SZGA 4OV9A 4J9JA 1FWWA 2DZXA 2CLOA 3O6CA 3WK3A 1YXCA 4A29A 1T0OA 4N6FA 4WOZA 2ZA2A 4TMCA 3M5YA 3C2EA 4UR7A 5LKYA 1W31A 3G1DA 3QFEA 3B4UA 3G0XA 1TTPA 3W3OA 4MVAA 3SGUA 3W7QA 2NXHA 4LNYA 3SECA 5CZTA 4PA8A 2VKZG 2Y70A 4JTHA 7TIMA 5EYWA 3LBCA 2A1YA 4MZYA 4ZQRA 5EL1A 1SR9A 3GXNA 3NL6A 2ZZ1A 1OX4A 4FO4A 1UJPA 5AHMA 2P10A 5TQLA 4E38A 1QOPA 1TIMA 1EA0A 3OEXA 5I3HA 1IGSA 4GXMA 1W3TA 1TV5A 1YDOA 1JCMP 2ZRZA 1TSIA 3W73A 1LOLA 5KZMA 4DO4A 3NQ7A 3UWQA 2CZEA 4M7TA 4RX0A 4ADTA 3N73A 4N9CA 5F1UA 2V2CA 1FDJA 4IX0A 1VYPX 2TPSA 3CEPA 4PH6A 5HQEA 3UWYA 1H62A 3T7VA 3G3DA 4BWLA 2NX9A 3BG9A 1ZHAA 1MEHA 3W7OA 1FXQA 1ZENA 2B7NA 1K8XA 1OFAA 4UTHA 3A23A 5D30A 2ZBTA 1P0NA 4IMEA 4UTUA 3QMTA 4JTEA 1P5BA 4R7JA 1J5TA 3TK7A 3NG3A 4CNNA 3I68A 3VE9A 4K7YA 2Z1BA 1OX6A 4UIOA 4UR8A 2ZA1A 3LRKA 2E1DA 3G24A 3LV6A 3THAA 1B57A 1G67A 3UQNA 3IGXA 1GOXA 2A7NA 3QMSA 3QPYA 4NNBA 1XL9A 1QO2A 4CNOA 5A8GA 3LCWA 1SSDA 2E5CA 4UUIA 3LHZA 5D2VA 3NYZA 3KVMA 2I14A 3SFKA 1G69A 3LCLA 4ICNA 2H3BA 2WSRA 2R91A 1X7FA 3TFCA 1H7OA 5AFDA 3M43A 4UTMA 2QCGA 5MHBA 2RKXA 4UTWA 3PWAA 2ZYFA 5E0KA 1Z44A 4X3ZA 5H91A 4JY9A 3NOEA 2YW3A 2WNQA 3UXAA 1EB3A 3GX9A 3P84A 1AG1O 4BF9A 4AAJA 4JTUA 4NJKA 2A85A 3B0UX 4I7UA 4R34A 5HMSA 3IEBA 3KVLA 1VLWA 5G2WA 2V2HA 4XKYB 1LM1A 4N4PA 4FIQA 4FX6M 4KFNA 2NLIA 1JQVA 2QJGA 3FA5A 4HNUA 3EWBX 1W8SA 1AW2A 1B4KA 3PBWA 3W7HA 2FPTA 3H55A 4NUWA 2X1SA 3P5YA 5K3VA 5HINA 1R2TA 4NNCA 4GWEA 1N8FA 1QPRA 2OT0A 3FOKA 3LX9A 2VFEA 4RZ6A 1JCLA 4R33A 3W1TA 3LERA 5LHEA 2DZSA 3QSRA 1KLYA 2ATMA 5G4EA 1YTEA 4YWIA 4LVBA 1CW2A 1JCJA 1TJPA 4DEFA 1KFBA 1U5JA 3DENA 3FJLA 5KTLA 1SSGA 4FB7A 3P74A 3OVPA 2QCLA 4QISA 1O4UA 3QW3A 2RDTA 3W70A 4JYFA 1B4EA 5HWJA 4X2RA 2YDAA 3IIOA 4WXZA 4ORMA 2YR1A 3CWOX 1FDYA 1SW0A 4MKNA 3LRLA 3EKLA 4K8EA 3TSMA 2Z6IA 1VZWA 3W7LA 3KAOA 4G1KA 4DQWA 1ME9A 1DHPA 3W07A 2QF7A 3N9SA 3O6DA 3TNOA 1XCFA 5EMUA 4XUGA 2C16A 4Y9AA 1NSJA 3W22A 3DHFA 4MFEA 4O53A 1L6YA 4WOQA 1TPC1 2PURA 4NNAA 2NUWA 1EP2A 5BMWA 2NXGA 1OF6A 1W3IA 3VI2A 2XN2A 4LTSA 5F2LA 1RVGA 4O17A 4Z0SA 1F76A 3PUDA 1IF2A 5I3JA 2BWGA 3BLEA 2RH9A 1G7VA 4P2VA 2WNZA 1QR7A 4DPQA 5D03A 3V75A 5D33A 5AHFA 3EWUA 3W1RA 1KW1A 1M6JA 2XN0A 3W76A 4LT9A 1AK5A 3TQ0A 4OU1A 5CKSA 4QQ3A 3HIJA 3M1ZA 1HO4A 3ABOA 1Q6OA 2FLIA 2TSYA 3RMJA 4LW7A 1QO5A 2ABBA 1H7XA 5DN1A 2V30A 2A2IA 3QYQA 2DZVA 2B7OA 2EF9A 3EEGA 4ZQNA 3TROA 3S1WA 2QCMA 1KV8A 4OBTA 4O4VA 1X1OA 3ABSA 4H3DA 3IRDA 2QCDB 1Q3NA 2C6QA 2JGQA 3LXCA 4FNTA 3BW3A 2QEZA 1I4NA 1TB3A 4EIVA 4O12A 1G4TA 1UB3A 4NVTA 4WUIA 4AXKA 1Q6QA 5K2ZA 3L2IA 4I7VA 3STFA 4LOCA 1A5BA 3UY7A 2NWSA 2Z0IA 4C1KA 1H7PA 1DBTA 2HMCA 2PCQA 4GBUA 4LVFA 5T26A 5LSMA 1QOQA 1X8FA 3HG5A 3W7EA 3DFTA 4JS3A 2VEMA 1WYIA 1K7FA 1FY6A 1Q6RA 1VH7A 3G1VA 3W9ZA 2DZTA 2X1TA 3MO7A 3HOJA 1SW7A 3B04A 1EX5A 4KWWA 3DFPA 1GYNA 3W71A 3B0PA 3HB9A 4K37A 2VFDA 1FUYA 3GXTA 4HT3A 1H61A 2V5BA 1OF8A 5HNRA 4UTTC 1GPWA 2KZHA 1ZAHA 1TPVA 2AGKA 3QC3A 2AAMA 3MYPA 3CEUA 4R53A 1P0KA 3INPA 1OFQA 1OYAA 4XZ9A 3FS2A 4ZQCA 4IOTA 5K4XA 2CLEA 3EWXA 2ZRVA 4PEKA 3W1AA 1LLWA 1KFEA 4ZZ9A 2NUXA 4GRSA 5D02A 4AH7A 3W2NA 1QPOA 4X9SA 4QITA 3TCEA 3CWNA 4CQAA 4RJEA 3MI6A 3IIXA 3S5ZA 4EF8A 2E5BA 3WJZA 2VC6A 4JR5A 2VFHA 4MJMA 3OHIA 4N9EA 3THQA 3RNDA 4L4MA 5F1VA 5F4SA 4A2SA 2WOQA 4IMFA 4ML9A 2A21A 3G8EA 1RD5A 1SZFA 2D73A 4OWGA 3G0SA 3QM3A 3WK0A 2QKFA 1YXYA 2NV1A 3W87A 4GUJA 1AMKA 4YCPA 4QJ1A 3GDTA 1D9EA 3E12A 1LRNA 2CLKA 1F73A 4DPPA 3QEZA 3MHGA 2B0MA 3NL2A 2FB3A 3KRUA 1NF0A 5D2TA 3W2JA 1OHLA 1NFBA 3W72A 3UZ5A 4U4MA 4WY0B 4EF9A 2VFFA 1OFEA 1YXDA 1SUXA 1FCUA 3QRHA 1KBJA 3OBKA 4O50A 2H8ZA 3ELFA 1THFD 3CLMA 4PC8A 3PVFA 3E02A 4NX0A 2PRHA 1LBLA 4O57A 4Q4KA 1XFBA 4ZQPA 1GVRA 3G3MA 1FQ0A 6ALDA 4UTWC 1PV8A 2AQWA 1KM2A 2V5LA 1GVSA 5BW6A 1MSSA 2V2DA 3W86A 4UFMA 1A5CA 3EX2A 3LOTA 3W1PA 5DLCA 2A7RA 4RR4A 5E1QA 3L68A 2CWNA
chains in the Genus database with same CATH superfamily
2J6XA 1OY0A 5AYBA 3Q45A 4B5WA 1CGWA 3SUSA 1L0PA 3WQVA 2EG7A 4B5XA 3LUTA 3OZYA 1S5NA 2WKJA 3ZOAA 2YX0A 1I2PA 1TVLA 1XIBA 1QK2A 6CGTA 5FSEC 2XU2A 3W29A 2E8YA 3PNUA 3UF9A 5MF5A 2QDGA 1RCXB 3QKEA 3M0KA 1E56A 3VIHA 1NDWA 2AMGA 4E3TA 5FEPA 1XICA 4WK9A 4L80A 2QMJA 2VDGA 1PKNA 3KEHA 3M0MA 4F0RA 5FD0A 3MZ2A 5HMEA 3EAUA 4DX3A 3ICJA 3LSCA 1XX1A 2YA0A 5REQA 5AC7A 2EKGA 4ALDA 3MHFA 2YZ5A 1JRCA 2ZICA 1UC5A 1EBGA 4X60A 1GOOA 5DQPA 4LVDA 1HVQA 5HXMA 1ZL1A 1D7FA 3IVTA 3LEPA 3W2UA 2F2KA 2WPBA 3UPMA 1G1YA 5DXXA 3VC6A 1E3ZA 3TVAA 2ZUTA 3VFLA 2A7PA 1MWOA 1FCVA 1RP8A 1UA3A 3SDOA 4TV6A 5E6YA 3NQDA 1R0MA 1XIEA 4UMCA 2TODA 5IDZA 3TMLA 4XD5A 1G5AA 4RXGA 2Y85A 1VFHA 3RF9A 5DELA 4QX4A 4JIQA 2F7FA 4HPGA 3JRKA 3OU8A 3UZXA 4AHQA 1US3A 2Y2WA 4B5UA 4ZB5A 1XBYA 5BU6A 4H04A 4CQBA 1H2JA 2DZBA 4IGMA 2Z1WA 3EWWA 2O9PA 2V8ZA 3SCNA 3UCDA 1UWUA 2G95A 1CB7B 4FK9A 3PC0A 4DXKA 1DYSA 2HDJA 4P8VA 2XYLA 4CVUA 3CU2A 4NYYA 5LNVA 4FNQA 2V5CA 2VCBA 1XGZA 3KBMA 3DUGA 2DJLA 2PLCA 1BXNA 2XGZA 3H21A 1NIUA 1BRLA 3EDDA 3RUBL 3FJ4A 1TV3A 2NX1A 3H4WA 3PPCA 3T2PA 3K46A 2XPKA 1H11A 1MW0A 2QJIA 4UTLA 1E1CB 2E4TA 3W2LA 4WKFA 1H7RA 4LAZA 5LNUA 3CO4A 2Y5EA 4LUSB 2BLEA 3R79A 4O0ZA 1OD8A 1G0CA 2QAPA 3CTTA 2W92A 1PS9A 1RAKA 3DCPA 5BMXA 4KQNA 5A8NA 3MUZ1 1BGAA 2OO6A 4UNKA 2HBXA 2C7FA 3P5ZA 3ARSA 4DF1A 2DSVA 3ITVA 3CXOA 3E0LA 1X1NA 3QVQA 3BMXA 3TJXA 1E72M 3CB3A 4AD3A 2J8FA 3EPMA 4E6MA 4EWND 1K1DA 1M41A 4HZMA 3KOYA 5B7ZA 3RJXA 4GKLA 1O5RA 4ZO6A 1JUKA 1XP3A 3S2JA 4KRZA 1W3NA 1DXEA 4ACYA 1TX0A 4ICCX 1Q7ZA 2HROA 3WLQA 5FESA 2GGIA 5HATA 1UH2A 4MY1A 3PTMA 3PY2A 2O56A 3EKGA 5A3HA 4EACA 4Y90A 3UNTA 1DQUA 3WD4A 7ODCA 1XLCA 1KFKA 4EP8C 2GFTA 4JDBA 1JDCA 3QYSA 1WKYA 1FCBA 3PPHA 4DM2A 4JX4A 5CXPA 4HTYA 3VCCA 4YVXA 5IFPA 2E0PA 3GY1A 4HOXA 3MMDA 4B4FA 2OWWA 1BQCA 5BRQA 2ZUSA 2EAWA 1KM3A 5CPSA 1FWRA 4LC8A 2NQ9A 1KB3A 1SM9A 1T6MA 3N4AA 3LB0A 3JVAA 4GLEA 4WSKA 3C2RA 1PXGA 4DWSD 3E2SA 2D0FA 4M1RA 3CYVA 3DN5A 5LZLA 5BOFA 3CIWA 3WNKA 3MWAA 3BVJA 3M7WA 3GHRA 1J10A 3FYOA 4CUCA 4PTNA 3W7NA 3HQ1A 3BUVA 3ZVHA 2Y5JA 3NL5A 4K7VA 3H53A 3DBNA 4TIMA 2ZRUA 3QY8A 6TIMA 3H2OA 3LD5A 4H9YA 4N6EA 4O52A 4NZ5A 1XH2A 4FLQA 1VIWA 1CDGA 2ZXAA 4AY1A 1R3RA 3QZEA 3E0WA 2Q3RA 2Z6JA 3EZ4A 3RO6A 1Z48A 1EDQA 3EX6A 5CC6A 4ZB0A 1ONWA 4C60A 5EBUA 3GU9A 3CZ8A 5G1YA 4WY0F 1H5YA 1RY8A 4KGLA 2PWFA 5D9OA 5JXQA 1VHCA 3USBA 1TX2A 3L12A 5PTDA 1JIBA 5JBEA 3YPIA 4W87A 3IUHA 3BJTA 3WD2A 2DFAA 3VO0A 4KW2A 1CLKA 3E74A 4IG2A 3AMDA 5C6MA 3KXQA 4JYEA 5J8LA 1RCQA 4B90A 3L4XA 4E4FA 3FAWA 3FJNA 1J8VA 3FGCA 3GFYA 3H70A 1R30A 3IS4A 3NPWA 4MNJA 5DBUA 3ISIX 4IX2A 1PTAA 1MRAA 3UWEA 4C6KA 1FX6A 3WUFA 1TREA 3BGJA 4ZL1A 5CSSA 2VDHA 2C1IA 3CYJA 3GU1A 1GQJA 1KGWA 1JUEA 1DIEA 4B16A 3K1DA 1KQYA 4PMJA 1C3FA 2A4AA 4P7QA 3PR2A 2Y7EA 3RX2A 1POJA 3VD5A 2BY1A 2RGMA 2NLYA 4CEXC 4IJCA 4ADUA 1AMYA 1TPB1 3LPPA 4QP0A 3W84A 3VNIA 1GJPA 3SQSA 1E51A 4AEEA 4MMWA 2CLHA 2L5HA 3MCMA 3BGGA 3RITA 1TPH1 4PMVA 1NF7A 1X1ZA 1H41A 4XAPA 1CENA 2Z1KA 2R94A 4BHYA 1XJBA 2WBGA 3I6EA 1P0EA 4NJGA 4BR1A 2XVPA 2YCLB 2XN1A 4Q4QA 3WF3A 4FMVA 5D9NA 1VYRA 1DL3A 3ES7A 4O4WA 4DB7A 3FCPA 3BLDA 4Z2JA 4RPQA 2FDMA 3NPVA 4IUGA 4RE0A 4QDPA 5JH2A 3L4TA 2YCEA 2EG8A 4XO7A 2DT2A 3A22A 4QCEA 4AZGA 4K6AA 1XKYA 1RK6A 4GY1A 2PP1A 1VEOA 1ZTVA 3B8IA 1R9XA 1P4CA 4UOZA 2PDPA 4LFYA 3N34A 2FMNA 4V28A 4S3FA 2BASA 4CD7A 3ITTA 3PZVA 3NZGA 2BXZA 3CV7A 3OG2A 3B8UA 2TAAA 3W1QA 4GE8A 1OVDA 3P81A 1KRBC 1FVPA 4IMCA 1PKMA 4NJHA 4QEHA 2JF7A 4I7WA 2E6YA 3ZJKA 4OTKA 4GIRA 3S2NA 1DJNA 1FWNA 3P3BA 3V3WA 1XIDA 3UJSA 5CBBA 4CU6A 3NNTA 5SWUA 4MUPA 3MKVA 5LGZA 4W8BA 1TV7A 1PZ0A 2PGFA 2J9ZA 3F1QA 3URNA 2FVLA 3MKCA 2DW7A 2XFYA 3GZ3A 4NQ1A 1KM6A 3LM7A 3APTA 2GK1B 5XIAA 2BVDA 4NSBA 4CQ8A 4XV0A 2WSKA 3CO8A 1KR0A 3N2BA 4UFHA 1PYFA 1NOWA 3C61A 4BF5A 4K2SA 3UWZA 1K7EA 2EPKX 2B31A 2J47A 1UC4A 1F7BA 3VOFA 3AIWA 5HWNA 3R12A 3Q67A 2XIBA 2C91A 1HUVA 2QR6A 2GJXB 2I5QA 4XD3A 3ME3A 3WD0A 4O16A 4KRTA 1AD4A 2WVTA 5CPTA 2E5DA 4WKHA 1R87A 1XINA 5H8PA 1FBAA 4A8IA 4O11A 3UFYA 2YFNA 4UMBA 5KMYA 2ZDRA 3NO1A 1E6PA 3U2ZA 1Q4WA 2CFFA 1KCLA 4IQLA 3I7RA 3WJWA 4O1BA 1VGAA 4O28A 4DELA 4GZ7A 2NV2A 2PGWA 4F8XA 1V3KA 4RPPA 3VDCA 1Z32X 1KLZA 2XH4A 3MP3A 3TC6A 1KM0A 1X98A 2X40A 2WW5A 5HUOA 1M01A 4GZIA 3CK5A 4L7ZA 4HOWA 1VS1A 3GVGA 5AC6A 2OYKA 1QNRA 3CPRA 3W7JA 3PANA 1U2YA 3WL0A 1QWGA 3VNJA 3OA3A 3TSBA 1M9HA 1BXBA 1L6GA 1JNEA 3AIQA 4AMCA 4L6OA 1JZ3A 1R2SA 1VKFA 4Z0JA 1DWGM 4FF7A 1T41A 3VZZA 1A5MC 2H9AB 2DZUA 2ACUA 2J9XA 1S5VA 2QCDA 1QTWA 3WUGA 4CD6A 1XIIA 5E93A 3WQOA 4WIWA 1GCYA 4MZ1A 3LI0A 4C6MA 2WHKA 4GYPA 4GUIA 3A3XA 3WEOA 1E6ZA 4BI7A 3MDUA 5CG7A 1LOQA 3GAYA 4S1FA 4N02A 3WH6A 4HPXA 4YYCA 4QXIA 1G6CA 3DESA 1I2RA 3DI1A 2ICSA 3GDLA 3LBOA 4RNJA 4XIAA 2NT1A 2E6AA 1TUXA 4IT1A 3I10A 5LNRA 5CLTA 1E1FA 1G01A 4RE4A 4RDVA 5GVJA 4WDXA 4AZHA 2C0AA 1DWHM 3JR2A 3ATZA 2E1WA 2JQXA 3SBFA 1XRTA 4C6NA 4RDWA 2CW6A 2WANA 1Z3NA 3LLFA 1DJHA 1V6UA 2OFJA 3TYUA 1CI1A 5JUVA 3PZ9A 4L5ZA 3VKDA 5CGMA 1MQRA 4C1NA 3RM9A 3UXIA 4S3KA 3FLUA 1E9ZB 4AZ6A 1WOBA 3U2OA 3DOPA 4CQCA 1PCKA 3NQMA 1EH9A 3T07A 4U5KA 1W37A 2VENA 1JCNA 3PZNA 4KH2A 2OEMA 1W1PA 2ZXBA 4KETA 3U8GA 3GNDA 1J6PA 1R3TA 3NEHA 3ZYZA 4E8CA 2VGGA 4Q8PA 3VIKA 3S5SA 1FWJC 3LCHA 1VBHA 2Y7GA 2VRKA 5BRPA 3WJYA 3HQPA 1BEUA 4US5D 1KFLA 4B2DD 2AGTA 2DIEA 4QRNA 1GVYA 1XFCA 2HCVA 4G6CA 1TWSA 3IUIA 1BWKA 4J35A 3L5LA 3P80A 1L6FA 2E9MA 1XXXA 4FR1A 4ZCWA 5D09A 3IIVA 3CASA 1VLIA 5HJYA 1ITXA 1JGIA 1YPFA 3N12A 4KFOA 1SU5A 1GOQA 3KOWA 4GHRA 1UQYA 3TTSA 4YS1A 3AS2A 3G77A 3FA3A 3NEVA 1JULA 2OX1A 4ROPA 3WQPA 3DBPA 4UQBA 4GIAA 4D2JA 1NQKA 4S2CA 2VEIA 1UW9A 4DO6A 2NV9A 2QXWA 5HNUA 5A6LA 5AHLA 1XCWA 4I5RA 3PB2A 3WO8A 1H3GA 3A5FA 1EHAA 3RLVA 1PX8A 4RZBA 1YNYA 2FHFA 4M8UA 3PP7A 1JPIA 4FNUA 5EMMA 2QJHA 4A21A 1EPXA 4GNJA 3CQIA 4X0VA 4FIRA 3GNPA 2PF8A 3OP2A 5C9RA 2X30A 4JOMA 3NO5A 3MQTA 3U9IA 3NFUA 5FL1A 2J27A 5DCDA 2PWDA 4LU0A 3W00A 5D38A 3MB9A 4JQ3A 3VIPA 2FKPA 4LB3A 5CJMA 1J5SA 2XIMA 3M9YA 1UPPA 3KCLA 3N2TA 4AYGA 3ZJ7A 4MLJA 4LX4A 3QQWA 1ZAJA 3TYAA 4NJIA 2F8QA 3MJYA 1F05A 1M7OA 4QHRA 1JPKA 2Z7KA 4AYSA 3A47A 3II1A 3M07A 5CJNA 2BHYA 5LXXA 1Q6LA 2FB2A 3LZ5A 4IICA 2WYSA 2RAGA 2W3ZA 1EGMA 3IGHX 2BGQA 1MMFA 3S6DA 4JFTA 4FX8A 2C1HA 3REQA 3ZR5A 1A0CA 3KM8A 4F79A 1C8VA 3WX7A 1HZYA 3O1NA 4REQA 1EL3A 1KRCC 1TPUA 3TN6A 4AZ7A 5HOSA 2YBVA 3HJEA 1Z42A 4ZODA 1GTHA 1E6QM 4XBJA 1JI1A 2XIIA 4IMAA 4KF1A 3L4UA 4MAZA 1TRIA 2HRWA 1JYNA 1V0NA 3O07A 3BURA 5D2XA 2W91A 4NAEA 3G1YA 3NWRA 1XLLA 3HV8A 4ZTYA 3R8HA 5FJUA 2YOCA 2VWTA 4C91A 4FLOA 3IJDA 4DI9A 2CERA 1JDAA 1TE1A 4QNEA 1GNXA 1GPFA 2WJZA 3RLUA 4A3UA 5C55A 1IHIA 3EOEA 4UQCA 1S2UA 1YEYA 3CHEA 3AHYA 3QV9A 3QTGA 4Q7IA 2XGIA 2WV8A 1XYLA 1IZCA 1OG6A 4MSSA 3VIGA 4GYJA 2VEPA 2WNWA 4UFLA 3NQ2A 3EWYA 3TR2A 1QDSA 1AW1A 3AS3A 2BHZA 3KFTA 5KZEA 4JTJA 3EB2A 3TC3A 1US0A 3AUJA 4JNMA 4BCEA 4FOKA 1UMLA 3H12A 4XUYA 4Q22A 4IPIA 4QR6A 3SM0A 3W38A 1YE4A 4XQ6A 4NXSA 1JR1A 1YQ2A 5LGXA 1GHSA 4JTRA 1DXIA 4MHBA 3VGDA 1MW1A 4PSPA 1LUCB 1KM1A 4OKDA 3LTSA 2CKRA 4EAMA 3GHUA 4D6FA 2BVWA 2DDXA 4KEVA 3ECQA 3K30A 4IIFA 4ATWA 2R6OA 1VFFA 3FKRA 3KVJA 3S83A 3ANUA 5J04A 3STEA 3BO9A 3UWUA 1OINA 4QE4A 1RPXA 2Q3OA 3M64A 3L9CA 2A3EA 3ATYA 3GM8A 3S0CA 1QUMA 1I0DA 4IHCA 4CEUC 1RJQA 3GNRA 2Z7GA 2WVVB 1EOKA 2PD9A 4FHAA 1QI0A 3RM8A 3LSBA 4J9JA 5T91A 3BAJA 3WK3A 3O6CA 1YXCA 4PRWA 5BZAA 4TMCA 1CGUA 2RJGA 3M5YA 5LKYA 4LGXA 3QFEA 2ZUUA 3W3OA 1OCJA 3AYRA 3TLQA 4PA8A 2VKZG 3L4VA 2Y70A 3DHPA 3B3DA 4NY2A 4XZIA 3WD3A 1E1EA 3U3HA 1JZ6A 3LBCA 1OC5A 4YIWA 1PB0A 5EL1A 3OLIA 4WSHA 3P6LA 2WC4A 1IWBA 2G3FA 1PZ2A 4UZSA 3NL6A 1NDYA 1UJPA 4W84A 4JQAA 5AHMA 4JTCA 3KW3A 1EA0A 2W67A 3RG6A 4DRSA 5ABHA 1Q63A 4GVFA 3V0UA 4HMDA 4KCVA 3W73A 5KZMA 4A35A 3I3BA 2Z25A 1XLMA 3NQ7A 4DO4A 1WE5A 4M7TA 4ADTA 5F1UA 3V36A 3UWYA 1W9DM 4KPLA 2PWVA 2IKJA 2WLZA 2ZWYA 2NX9A 1S46A 1OFAA 3CAKA 1ZLPA 1PAMA 5F7UA 4JNYA 4K7YA 4UIOA 4UR8A 2ZA1A 4MB5A 3LRKA 4EAYA 4ES4A 3WLHA 4EE9A 4C5YA 3AIEA 1FHUA 3MWCA 5A8GA 3HV9A 3LCWA 4A6GA 5D2VA 4IZGA 2H3BA 3PZGA 1X7FA 4QROA 2OEKA 3T08A 1WCGA 3M43A 4ERGA 4UTMA 1DIDA 1AH4A 2J13A 2EBNA 4RL3A 4X3ZA 5C9UA 1H0GA 2WZIA 4AZCA 2G3MA 1AODA 2PDKA 1NTHA 5CCZA 3AS0A 1QI4A 4RW3A 4JTUA 2J25A 5HMSA 5M1TA 3KBJA 3PNZA 4GCXA 3KVLA 1VLWA 1CNVA 1LM1A 3CGTA 3GW0A 2BVTA 4M56A 4FIQA 4FX6M 2NLIA 4PB3A 2QJGA 3EWBX 1AW2A 3C0QA 3U57A 3PBWA 1NP0A 3H55A 5EMKA 4NUWA 3GDBA 5K3VA 1W3LA 1Z89A 3MT1A 4FS9A 1N8FA 3UZWA 4DXXA 1QJWA 3CAQA 2QV5A 2VFEA 4RZ6A 1GORA 4R33A 1VF8A 5LHEA 2DZSA 3M0XA 2CLPA 1MZRA 4BEUA 1VFLA 3DENA 1TMLA 4GMEA 3OVPA 5DRIA 1QW8A 2RDTA 4JYFA 1B4EA 3ITYA 3TW9A 3IIOA 1Q8JA 2YR1A 1P7TB 4GXWA 4YN5A 3TOPA 1SW0A 1ITQA 1DJZA 4KIEA 1WDDA 2R1LA 3W7LA 3WNLA 2ZXQA 4JKMA 4DQWA 1ME9A 4F2BA 1RHCA 1DHPA 2JEPA 4KCUA 3TNOA 1XCFA 3V1HA 2C16A 4KEMA 1B1YA 1TPC1 2WKGA 4NNAA 2GDVA 3VI2A 3L23A 4N0RA 4TVUA 3W6LA 3V0TA 2Y4SA 3MUY1 4R9XA 1IGWA 5DT7A 2OG9A 2RH9A 3CL8A 4OUEA 4A3RA 5HQLA 1UKQA 1K4HA 4A05A 1E15A 1RPKA 2WC7A 5LA0A 4FLSA 2XN0A 4P8XA 4RNHA 4GCAA 2F6KA 3LMZA 4GISA 3F2BA 1DWFM 4EX4A 3M1ZA 1UD8A 4E5TA 2J7EA 3VIJA 1Q6OA 2J62A 4KEUA 3AHZA 2XGBA 4LW7A 5LIYX 1RLCL 4HTBA 2A2IA 2DZVA 2B7OA 2VYOA 2VQTA 3I3DA 3IRDA 2QCDB 2C6QA 3LXCA 2QEZA 1I4NA 4AFYA 4EIVA 4H19A 1UB3A 4WUIA 1AJ2A 4ASTA 2C0HA 4LOCA 4DVOA 1A5BA 3NSNA 5A2CA 1Y5WA 2PCQA 4GBUA 1Q65A 5BROA 2PLMA 5ECUA 1P6BA 2PD5A 3S3GA 4P8UA 3TTEA 1X8FA 4WJ8A 1K7FA 1A80A 3W9ZA 2DZTA 2X1TA 3EOUA 2W66A 1U30A 1EYWA 2A3HA 4I9MA 3OYZA 1H4PA 1H61A 9XIMA 1XW8A 4R7OA 4EXAA 2J74A 3PBGA 4XZMX 3MYPA 3CEUA 5HJXA 3OGSA 4M0XA 4XZ9A 1BSLA 1K4GA 1A49A 1Q6CA 5BOEA 3GBEA 2X42A 1E0TA 1GUVA 2CBJA 2ZRVA 4AQLA 3JZUA 3K8KA 1QBAA 4GRSA 2XJ7A 4H9TA 1EX1A 4X9SA 3TCEA 1NOUA 4CQAA 2W63A 4GI6A 3KOZA 5FSDC 4IGNA 4EF8A 2VC6A 3THDA 4U2YA 3ZXWA 3OHIA 2Z4GA 1VEPA 3THQA 5F4SA 5F1VA 2WOQA 4U5IA 3FNDA 3G0SA 3Q4DA 2HVNA 2XVNA 3QM3A 4GZEA 2E7FA 1GOKA 3A64A 3UYIA 1UP2A 1UWRA 4HYVA 1ZPTA 4QJ1A 3WF1A 4K8GA 1SVDA 3H24A 3MHGA 3TEVA 4PTXA 2IPWA 3KRUA 3FGCB 1OHLA 4MGGA 1P6CA 3DDMA 4U4MA 4IQEA 3WQ5A 4PYSA 3M0VA 3OBKA 1ZU8A 1THFD 4ZA0A 4AIUA 4NF7A 2PRHA 5H1WA 1E4NA 2OPJA 1OQFA 3TJIA 3G3MA 2BODX 1ZP4A 1GVSA 1SFTA 2FZMA 4GIYA 4AC1X 3SADA 2WMHA 3W81A 5BW6A 4UFMA 2E25A 4ZO8A 5DLCA 3S6TA 3BLOA 2A7RA 3L68A 2G3NA 2GJLA 5AC8A 3VM5A 6XIMA 1VCGA 5KSWA 2OLHA 3UJ2A 1V79A 4N9BA 2EKCA 1M04A 4DF0A 5HQMA 3QSTA 4WX2A 2QDDA 1DJQA 3BXWA 1JNDA 1RR2A 4GZJA 9RUBA 2DVTA 3R1ZA 1OSEA 3GO2A 1EJUC 2J9YA 1GT8A 1E9LA 1KBIA 3Q65A 1CGVA 1M7XA 1NWRA 4NRRA 1K9TA 1CXEA 3A4XA 3NL3A 3C3NA 3PZOA 3TA9A 4NZJA 5TNVA 1LROA 4TXEA 4QSHA 1MNZA 3D6NA 4X61A 1YIXA 4DWSC 4WDTA 3A9BA 3WEMA 1OFBA 3S42A 1GG0A 1XKJA 3POCA 1B3WA 1U83A 5BCAA 4DBDA 2BFGA 2CETA 2ISSA 5AY7A 1H0IA 3AOFA 2AL2B 1A5SA 3SRDA 1EWDA 4JEQA 1O7AA 3BAIA 2C19A 1UWQA 1QPQA 5LIKX 4C6JA 3G8RA 2VR5A 1CLVA 4Q8NA 3IV3A 4GYFA 2CBIA 3UXKA 4YXGA 4QE1A 5HULA 3L4YA 3AWNA 5E09A 2AL1A 3W37A 1SR0A 1I8JA 2FJUB 3WJSA 3WQ8A 4Q4OA 3MZNA 3SCTA 3WMSA 5G4HC 1F3TA 4ORIA 1DIKA 4CD4A 4GQGA 4JHZA 4UQDA 4B5TA 3T9PA 3G6MA 2NVCA 1OG0A 3O15A 3V5OA 3LPFA 3WLKX 4H4IA 1JZ4A 2BTMA 2E8ZA 2VZUA 1KO0A 3SSJA 3FX4A 4US5A 5BRBA 3F7JA 1IT7A 4AHOA 2PWHA 3NQ8A 4Q8MA 5AYZA 4PRRA 4KT2A 5HK4A 1UZDA 2OVLA 3MDWA 5I78A 1B9ZA 3BTNA 3DFNA 1VP5A 6TAAA 2V5KA 2PLKA 1WBJA 1XYZA 1EXBA 1O94A 3ZT5A 1I0BA 2QV4A 1V6TA 1YHTA 4LS2A 3SFWA 2FGBA 4ENLA 3OVRA 4TX6A 1ME7A 1UWAA 4JFWA 4GQBA 3PN8A 4WEVX 4LS1A 2JKPA 3MYOA 5HWMA 1C93A 4RK8A 2GGJA 3IVUA 2ZUWA 2QS8A 4B5NA 1YRRA 3L0KA 3VABA 1SO4A 3Q58A 1H49A 4L4PA 5DF0A 2WQPA 2BOEX 5AOUA 1J0YA 3WH5A 1L2UA 3ZS4A 2ZE0A 3NM1A 2DT3A 4DM1A 3EDKA 4D8LA 3JUGA 2CPUA 1HNYA 3PBMA 4YHGA 3BOLA 1H1YA 2IMRA 4JHOA 1L2QA 2WB5A 1XM3A 3RK8A 3DFOA 2WPGA 2UV8G 3EGJA 1OM0A 5DMLA 3VGEA 2FYMA 5KINA 1JPMA 4LH8A 4GQRA 3GTFA 4H7ZA 1I9CB 6ENLA 1ECQA 1W5MA 5C54A 1WXJA 3SY1A 5J5DA 1N2VA 3W2KA 5KZ6A 3QHNA 1LLZA 4W8LA 2VD9A 4HIBA 1ZFJA 3VIFA 3FHAA 1KCXA 1XC4A 4LCSA 1S3HA 7REQB 2QCFA 1E73M 3W1NA 3LPGA 1XSIA 4FF5A 1EJVC 3AALA 1I60A 1QI2A 1Y7VA 1BQGA 2F84A 4BI6A 3RR4A 4RV8A 3UZJA 1BG9A 1VJIA 5U7SA 4AMAA 2OKTA 1C92A 3SUTA 3G1HA 3S9YA 1OX5A 2R14A 3DG7A 1CXLA 4QEEA 3WH7A 2PPGA 2BG5A 2R1MA 4I6KA 2PDMA 3P93A 2PBGA 1P6WA 3HPSA 1XI3A 4DXVA 4Q8WA 2EJ1A 3BLKA 4YTTA 1ISWA 2ZC8A 3RR1A 3S1XA 4GGBA 2V67A 3NCOA 4JX5A 3L2LA 2X16A 2C3ZA 3UR8A 1A3XA 2C13A 2BOFX 3PF3A 3PTDA 1XDLA 5A6KA 3WDQA 1T8XA 4ZVJA 2XTKA 1ZALA 3SUVA 4B5VA 1CXFA 3RMEA 4AWUA 2I57A 4JNZA 1GEQA 3PUOA 1K8YA 1GQKA 3C6CA 1XF0A 2WMJA 3TXVA 3WFAA 3UPWA 4MLRA 3WQCA 1V3IA 4POCA 1IWAA 3HG2A 1E70M 1NDZA 4HNTA 2W62A 2J8GA 3TKFA 3VD3A 4DYJA 3HMJG 1PKLA 5HMDA 1OX4B 4MPKA 5AC5A 1WUFA 1MDLA 4AY7A 1UD2A 3LHTA 1W9UA 4AWSA 4V15A 1IT8A 2VMFA 2WWDA 3TOYA 2IXVA 3N17A 3DFQA 4KWOA 4PTMA 4LWWA 4NHVA 1W9XA 4G7EA 2X7WA 1AQHA 1YBQA 2ZA3A 3GHTA 3A4JA 3HGOA 1L6SA 3P82A 5FF4A 1B3YA 1ZJAA 1S1PA 2Q8XA 3NQEA 4RDZA 1TFVA 2VRJA 3N29A 1Q85A 3B9EA 1I2QA 3JS3A 3SSZA 4M29A 1VB9A 1XBVA 1R8LA 2FVKA 1AW5A 3LCXA 4K8HA 1PHWA 1QNVA 3ITGA 3WNMA 2P50A 3ARXA 3N3MA 2IXUA 9XIAA 4IFKB 1EXPA 1XH1A 4MTVA 3R89A 1ZAIA 3CL6A 2ZZ2A 1JF5A 1OIFA 3VVGA 3HO8A 1WB0A 1H09A 5CLWA 1F4HA 5AHEA 3UA4A 2QF8A 3VKAA 5I24A 1VRXA 1HKWA 5A6MA 3E49A 3NUKA 3TZNA 3BQ5A 1Y65A 1TJ0A 2GJPA 2X7VA 3TX9A 1BWLA 2YGYA 3S5YA 4O1EA 4ZFMA 4HKPA 5DBTA 4CD5A 1GKRA 4O54A 2VQUA 1W9BM 4L4LA 1QNSA 3HA1A 5L6UA 4H7VA 3T55A 3WYZA 1JGMA 4L61A 3VD7A 2G97A 1QW7A 1R3QA 2PP0A 3ARRA 4XTIA 1XLFA 2Q8LA 1CGYA 3D5HA 4Z2LA 4J3TA 2W61A 1E4MM 3KBVA 5HR7A 3SW6A 1TV8A 4ZFCA 4B3ZA 1MFUA 1POKA 3BL3A 3BLIA 1B0IA 2PGEA 4A2RA 3OO2A 3TW6A 1XRFA 3CUHA 3L5AA 1FH8A 4QJ5B 2DT1A 3A5VA 3EXRA 5I07A 2G41A 3BCJA 4H6EA 1T96A 1E0UA 4DJDA 3WBYA 2EHHA 1RJPA 1MUWA 3R13A 4IG2B 1FFRA 3R25A 4M5PA 1DEDA 1QNPA 2XZ9A 3DFYA 4YTUA 4YU1A 3HMCA 3DFHA 3F4VA 5HBFA 5E5CA 3O9NA 3W1UA 3ZWSA 1UASA 1H1ZA 4HA1A 1OADA 4IJBA 4KKXA 4GI9A 5CBIA 3EEZA 2BSLA 3VA8A 3GDKA 2QDHA 3K2GA 2BMBA 2ZZ6A 5CPNA 1V02A 1FKWA 2BHUA 4W5UA 1AL7A 2XVGA 2BXYA 1X39A 4HHPA 1W3JA 3OHMB 1TWDA 2HEJA 3KTCA 7TAAA 1LRTA 3EA1A 2Z28A 5D2YA 4QNWA 3T0TA 1J18A 1KRMA 3VILA 4OGZA 2OOGA 4LC6A 3IGUA 1E40A 1QXLA 1H63A 2OWXA 4GUHA 3RX3A 3TXZA 2Z27A 3UR5A 1F3EA 2E40A 3N6JA 4XB3A 1P7TA 3MBFA 3EKZA 4HSOA 3K13A 5C5YA 1JZ8A 1Q6EA 1XD1A 3GHSA 5DY2A 2WSPA 3ABRA 3VIMA 3TDFA 3L65A 3SJ3A 2FDSA 3PBUA 3PZTA 2JEQA 1KGUA 4RDYA 4JTGA 2IPJA 3PBYA 4HCDA 3W6YA 3KOFA 3DAQA 3IK2A 3O05A 3DFSA 1E6XM 2E77A 1GTEA 2J66A 5CAHA 4XWUA 1W2VA 1U1HA 4OBRA 4I8DA 3MUIA 4OOZA 5HPCA 1E5NA 4H9XA 3SCOA 2HSAA 3R0UA 3P60A 2DEPA 1B2YA 4ZEPA 4QLKA 3BG5A 5A6TC 2PDFA 5HR6A 3LRMA 5AYYA 2CKSA 4DO7A 2OX4A 2RGLA 2EO7A 3NZPA 1TIWA 4RZ5A 1TCMA 2NQZA 1EDGA 1FWAC 2HE5A 3V16A 3FSTA 1YNPA 1WDWA 4OHQA 3W0KA 4HSNA 4JIRA 1H1NA 2YSWA 1OCBA 1XYMA 1N8WA 1Q2RA 1IEXA 1EUAA 1JI2A 1I1XA 4JTFA 3HGRA 2R82A 1F74A 3QY6A 2A3CA 1GW9A 3HJZA 4FPSA 1RJRA 3VDBA 4RW5A 1E6RA 1J4EA 3NQVA 3NOYA 1D3CA 3LXAA 2NVAA 3P2VA 1A53A 2PC4A 4LUTA 2RFGA 3PUEA 3UESA 4CCEA 1FRBA 5XINA 3A13A 1Q6GA 4YTRA 3JZEA 3OG3A 4Z2KA 2VC9A 3AC0A 3EXTA 1TPEA 3DH7A 3GBDA 1VC4A 1GVFA 1WOAA 1EUNA 4PGLA 3N9RA 1OFPA 2FH8A 5I3KA 4WZHA 4D6HA 1D2KA 4S23A 4IXHA 4LUJA 5FCZA 5HNTA 4IL0A 1X8CA 3EA3A 1PZ1A 1PVNA 3BSGA 2B7QA 2ZX9A 4K1WA 4PUKA 3USZA 2HTMA 4UTJA 5BNKA 4KBXA 3THUA 5TF0A 1WKDA 1B3VA 1ZS2A 4JPGA 4NAFB 3WEZA 1JFHA 3GH7A 2BVYA 2EPHA 4NI8A 3WDJA 3B8TA 3QZAA 1J2BA 1NWTA 4M51A 1UKSA 4XSMA 1FWTA 3RPTA 3UJRA 1YTDA 3OB8A 3CT2A 5CSYA 4D6CA 2J24A 2A3AA 2OODA 3UT0A 3UU0A 1XGEA 5LNWA 3C4UA 1EZ2A 3V1PA 3W74A 1X7IA 4ZB2A 1NFPA 2OLSA 4HB7A 3W23A 3N4EA 3VD4A 3ZVIA 4GO8A 1EIXA 1X6NA 2SFPA 4JXCA 1ZP3A 2WSYA 3UY8A 4GABA 5AZ0A 4B5SA 1P0DA 1PX4A 5G1MA 2YPIA 1TVNA 1D3GA 2G4JA 3C56A 4G7FA 2ALDA 3NIYA 2QVHA 2JKEA 3E0FA 3Q94A 1VHNA 1R3SA 3KP1A 3UJEA 4RNFA 2FHCA 3WBXA 2YZRA 1C9WA 1RQHA 2IQTA 1WQ5A 4H8UA 1WXYA 1T99A 3QF0A 1I2NA 3VNDA 2D2GA 5EPDA 2DW6A 3N2CA 4CD8A 4H9VA 3WJXA 4QG6A 1XYAA 2GVLA 1CPUA 5CZJA 3ZLFA 1O66A 3VMNA 1LRQA 3LTPA 1KQZA 3R11A 1LCOA 5FA5A 4JTTA 2FMOA 3H7UA 4J4KA 5IOBA 1M03A 4C6PA 3O2LA 1SZNA 1KR1A 5CZKA 3MS8A 1JAKA 3AJXA 3SIZA 3QW4B 5CG0A 2ISVA 1ZSXA 2YCIX 5FL0A 4O10A 3RXZA 3E5BA 1GYLA 1BYDA 5HAOA 3VGHA 4MDOA 4GO9A 1F9CA 4O13A 4PL1A 5A6JA 2YFOA 3E0VA 4GVIA 4FEZA 3BARA 2DJXA 1ZBCA 3MV01 3WQ4A 1JZ5A 1CB2A 4IPJA 3E2QA 2HWGA 5D9MA 5DCEA 3TJLA 4Z17A 2P76A 2VFIA 3OLDA 3ARVA 1W6TA 3U48A 4TR9A 1AZ1A 1TPDA 4GG9A 3FVMA 5GJPA 1R46A 1DKWA 1T40A 1QATA 3KRBA 4W5ZA 1ZUAX 2HISA 2J7CA 4HU3A 3WKZA 1ZJIA 2NWRA 2QDEA 4V33A 3VDAA 1X97A 4ZSUA 1JCYA 3PJWA 4Y9MA 5I2UA 1TJ2A 3B8DA 1SO3A 3S1GA 4KERA 2ZUVA 1HF6A 2QQ6A 1K03A 2WAGA 4OE7A 1XDJA 3TCSA 4KIRA 2D3LA 4RZ4A 2WNNA 3LENA 3NGJA 4XZHA 5JU6A 2RHGA 2WMIB 3C0SA 1DORA 1F2JA 2O4MA 2ZTJA 1HFBA 4E8DA 5I5RA 3EX4A 5D37A 1VD6A 3SGGA 2CZ5A 2DIKA 1AH3A 1R86A 5C7HA 5FKYA 3FYPA 4ZE4A 1QPNA 3LCFA 2DPEA 2PLJA 2ZZ7A 1SPQA 3CMFA 1VJZA 1TR1A 4GK8A 3L67A 2PCEA 4KWUA 3GC5A 4XZNX 3CUFA 3A21A 5H2ZA 3TAKA 3SCVA 1Q6FA 1JPDX 2NW0A 4QAIA 4DBEA 4IM4A 2PZ0A 2EG6A 1X96A 3W1XA 3VINA 2C14A 3N6QA 4L1GA 2A6LA 3VOHA 1ZGDA 4HU0A 3CT7A 2EEXA 2WWCA 1JYXA 4MB1A 1ELSA 5ABEA 2YKKA 2VELA 5D05A 1BF2A 3G1FA 5I77A 4N2YA 1WA3A 4ZENA 5FF7A 1IT0A 3C8FA 3LBMA 5HPOA 1IR2A 3OPSA 3M0ZA 3NQBA 3W88A 3B06A 3N18A 1E71M 3SRKA 3QKZA 3NXFA 3VOIA 3TN4A 2J78A 2YBUA 3VX0A 1HGWA 4XG1A 1UWIA 4WQ6A 3L4WA 1JUBA 4CN6A 1LOSA 5CPOA 4F0LA 3TQKA 1EP1A 1N82A 5I3DA 3AZRA 3TFXA 3W25A 4AC7C 3LV5A 1HIZA 4E4UA 4MOZA 4CCDA 4LS0A 5D8WA 1WKFA 1FHLA 1WDQA 4LF2A 4G7EB 1XUUA 2WZHA 3CUXA 5DMNA 3BJFA 3VZXA 1XGDA 3DGBA 3W27A 3TW7A 4JTAA 4DBSA 1UBPC 2PMQA 1S5TA 2OWCA 3AXXA 1SFLA 2BY3A 3M44A 4MWAE 2OR2A 3BZGA 3FA4A 3P62A 3DC0A 2W0UA 2D2JA 1UR2A 5GPRA 4C1LA 4IUOA 3SR7A 4N4QA 1A3WA 4H9UA 3GIYA 2Z26A 3UWWA 3A4WA 3FJ6A 1TPFA 4IIEA 2Z1SA 3QMRA 4DJFA 3KX6A 1KWGA 5IXEA 1DWIM 3APGA 1E0XA 2OSYA 3HZ3A 5F2GA 2ZRWA 4ZXLA 1QNQA 4Q8TA 1BGGA 1GVEA 1QI5A 1RD6A 2I16A 1N7KA 1LQAA 3MA8A 1EO5A 1PZ3A 2OQLA 2PTWA 3WK2A 4EKJA 2I7GA 3HPXA 3A9IA 4U3CA 1TA3A 3RIKA 3SN1A 4NILA 1UBSA 1V08A 1BG4A 3QHOA 1WZAA 2WBKA 4F9JA 5B7YA 3GS6A 1Q7MA 3FAXA 3P8JA 2CXEA 4S3DA 3UW6A 1C7SA 1ZBKA 5G5IA 3RILA 4KCTA 4ZR8A 1BKSA 1ZCOA 1HP4A 5CH9A 4LAUA 3PSWA 3HU7A 4KGJA 3P61A 1EYEA 1SFJA 4FXRA 1EEPA 2WM0A 1KA9F 1ONXA 3MI2A 2Z29A 4IF2A 2D3NA 5HNNA 2CHOA 4GIEA 1A5OC 3ZSTA 1SZGA 4OV9A 2DZXA 2HVOA 1KFWA 1KBKA 4DJEC 4N6FA 4TX8A 1L8PA 4XX6A 2W4XA 3C2EA 4QBXA 1V6WA 5HDRA 3ZZ1A 3G0XA 4MVAA 3SGUA 4HVXA 3QGKC 2DUXA 3SECA 1TELA 4DBUA 1UOKA 4JTHA 3CH9A 5EYWA 1VBJA 1J93A 5M03A 4YWSA 4MZYA 4ZQRA 3GXNA 4JFUA 1OX4A 4J5NA 3VGFA 4OIFA 2P10A 5TQLA 1QOPA 1TIMA 4XKMA 5I3HA 4D8AA 3MUAA 1IGSA 3WLRA 1W3TA 4ERAA 3MSDA 2VEFA 4JTDA 3GNXA 8CGTA 2XZ7A 3AZTA 4TTUA 5M17A 3LZ3A 4RX0A 3KBSA 4LYKA 3QOKA 4N9CA 4PMXA 3U2EA 3T81A 4B4HA 1FDJA 4IX0A 3CEPA 5BWFA 5HQEA 3MMUA 2AAAA 4IP7A 4UQAA 1TZ7A 3RN6A 2P0IA 4BWLA 3CJPA 3BG9A 1UQZA 1FXQA 3UCQA 2GUBA 1K8XA 4WKAA 4UTHA 2ZBTA 5E6ZA 4IMEA 1DTUA 3E38A 3OW1A 1P5BA 3EB3A 4R7JA 3TK7A 3NG3A 3VE9A 1J0KA 3RDKA 2Z1BA 2VZVA 1C8XA 3G24A 4I90A 3LV6A 3IRSA 1R7OA 1PSCA 3UQNA 3T8LA 4JCMA 4PUEA 2XSBA 3OZMA 1GOXA 2A7NA 3QMSA 1LWIA 4Q4RA 3CPUA 1JDDA 3GC2A 2E5CA 4PBEA 3LHZA 2V3DA 3S46A 2INZA 3LCLA 5IFTA 1EPVA 3DEQA 3TFCA 3WLIA 3WQWA 3VK5A 4HMNA 5I79A 3S9IA 3GG0A 3GH4A 1E3XA 5H91A 2GSJA 1EB3A 1XLBA 2EJAA 1EC7A 5GQBA 4J3WA 3RLGA 1W32A 1GYMA 3IEBA 1EJSC 5EFDA 4Q3MA 3AQUA 4XKYB 2DQWA 2PDJA 2FZNA 4DJEA 1JQVA 4CVWA 2PGRA 1ISYA 1SZRA 1B4KA 2QMKA 3R0DA 2FPTA 3F4DA 4H9MA 3XINA 1KKOA 4NNCA 3M7SA 2GUYA 2OT0A 4GINA 1E5JA 4QGCA 2VZSA 4UBPC 2FGZA 3W1TA 3B9AA 3AYVA 1NDVA 5G4EA 1YTEA 4YWIA 2D2OA 4LVBA 1Q2SA 1QU4A 1TMQA 2J77A 1FH7A 4DEFA 5KTLA 1SSGA 3UETA 3ALFA 4ML4A 4H2HA 1EJ7L 5EMLA 4H6RA 2WMGA 3LK6A 4BS0A 1HJUA 2OQYA 5I00A 5ABFB 3W70A 5HWJA 1UR3M 1W91A 4PMUA 4WXZA 3CWOX 3KTSA 5A94A 4X0NA 3LRLA 5ECVA 4K8EA 3L4ZA 2Z6IA 3QR3A 4G1KA 2BGNE 3GH5A 3WDHA 1XHGA 1EO7A 4W8AA 5EMUA 4O53A 1L6YA 2PDIA 4AVOA 4UOJA 3ZIZA 3TYCA 4WOQA 2PURA 1EP2A 5BMWA 4IH3A 2E67A 4IP5A 2XN2A 1HXJA 3WDPP 1F76A 2D0HA 3PUDA 5I3JA 3BLEA 1G7VA 3CNYA 3H23A 4J27A 3PTQA 4P2VA 1F8IA 2XFRA 4C7DA 3OTRA 1DHKA 5AHFA 2V3GA 3FXGA 3W1RA 1JYVA 2YLLA 1EFZA 5A2AA 2F61A 3FV9A 2DSUA 1LL4A 3TQ0A 4W4QA 4DWDA 1XPGA 1HO4A 3ABOA 3REQB 5AKQA 2FLIA 2TSYA 4HK6A 4CN1A 3ZT6A 3WQEA 3VTRA 2ABBA 1C8QA 1E0WA 4JCLA 3WBAA 4HGXA 3EDJA 1B3XA 3EEGA 4ZQNA 1N8IA 4M1BA 3S1WA 1X1OA 4H3DA 2V5JA 4YTQA 2PDBA 3WDIA 1G4TA 3QV6A 3AJ7A 1LG1A 2CNCA 4WR3A 2OQHA 2D2HA 3MUCA 1R5YA 4I7VA 3NVDA 3STFA 8XIMA 3QZ6A 2DV0A 3UGVA 4CNSA 1ITCA 2FZDA 3H2AA 5FAJA 3FVDA 4NG3A 4LVFA 3SB0A 5T26A 1OIMA 1QOQA 3HG5A 3C3UA 1XYBA 4HHMA 1XLHA 1WYIA 1VH7A 3G1VA 3B04A 4KWWA 1RUSA 1G9HA 3DFPA 4GVHA 4CQDA 1XLKA 2VFDA 1P43A 2PWEA 3DECA 1GPWA 3H2CA 2CESA 3LU2A 3WF0A 5BXSA 2AGKA 1XR2A 3SURA 1P0KA 1OFQA 1OYAA 1A3HA 3B8VA 3LA4A 1V3HA 3GE7A 2CLEA 3EWXA 1HJWA 3F4CA 3W1AA 1LLWA 2ANUA 3AI0A 4ZZ9A 4JIEA 3SN0A 1W3HA 3RAOA 4XAYA 1W1TA 3K4WA 4AZIA 4QITA 1XG3A 1AUSL 1ESWA 3BLLA 4G5DA 3N1AA 4GBDA 2UY4A 3SQLA 4HHHA 3WBEA 3WJZA 3AS1A 1BLIA 5I09A 2VFHA 3F2DA 3QFWA 3H4XA 3RNDA 4A2SA 1UP0A 4IMFA 3G8EA 1RD5A 2D73A 1E4IA 1XWYA 3CUIA 3D47A 1ZZMA 4DUWA 3D46A 2GL5A 3AXIA 1AMKA 1YX1A 4PBFA 3E12A 4NZ4A 4RV3A 4WDUA 3OZOA 4Q8VA 4GA8A 2B0MA 3SJNA 1NF0A 3AMLA 3VFCA 4PCNA 3W2JA 2V68A 4PE8A 4MNKA 3AHTA 3UZ5A 2XWEA 1YXDA 2D24A 4MWAB 5C9WA 1JXKA 4NX0A 3ONBA 4Q4KA 6ALDA 1F3XA 2DH3A 4UTWC 1PV8A 2AQWA 3WELA 4GC3A 1MSSA 2PTZA 4YHEA 1SGJA 1A5CA 3EX2A 1EGVA 1EDTA 3W1PA 4Y7EA 4RR4A 5E1QA 2CWNA 3CPGA 1QT1A 3LDVA 2OGJA 4IFRA 4ILSA 1JFXA 1WDRA 4OBSA 2IPGA 2NUYA 1AQMA 2JALA 2DH2A 1TWWA 4HP5A 1TJ1A 1ALDA 4O0KA 1KM5A 4J2PA 2C71A 1NVMA 4E0CA 3BJSA 3VUPA 1NY1A 2A3LA 1W1YA 3KCJA 3VNYA 1UR1A 2GPTA 3B40A 2P8BA 1MRQA 3QLLA 4F66A 4G8TA 4AD0A 4MB4A 1JEZA 4YL2A 1E55A 3DGRA 1DJWA 3UCCA 1AH0A 3OODA 3F5JA 3O6AA 1VCVA 1DVJA 4JDYA 2MNRA 3PG9A 4AX7A 5J5RA 2QZRA 3EX1A 3BK0A 4H8VA 4Z1AA 2A0NA 3EDFA 3PS7A 1IYXA 4L4OA 4XSLA 1EOMA 3U7VA 1LF1A 5DXYA 4Q4PA 3SRHA 1CXIA 1UPMB 1A5UA 1CEOA 4HJWA 4IPNB 3ZLHA 1SQ7A 1R3YA 1K3UA 1W1ZA 3MCNA 4NP7A 2DVUA 5D4YA 1V7AA 4HMCA 2GDQA 4US6A 1ML1A 1HN1A 3ZJ6A 2JFEX 4F9DA 3UG3A 2WHLA 3N04A 3DXIA 1XIMA 4RKAA 1KBBA 3CHVA 2E28A 2ZTKA 3ITCA 1U1JA 3S2LA 2HPMA 1IQ8A 1ZJHA 2CHRA 2P8CA 2TYSA 3CB8A 1XRSA 3BAWA 2QLYA 3WH8A 1B90A 1VYSX 4NRSA 3VCNA 1UCWA 3N25A 3TWBA 1OK6A 4M80A 4W93A 5KETA 4XAZA 4QG9A 2H8XA 2PRLA 4X63A 2QUUA 3BDKA 1A5LC 1FFQA 1Q4NX 3CQHA 4GNVA 1R3WA 1PPIA 3WN6A 2VFGA 3WCZA 1K8ZA 5FJPA 3WZ0E 3VKBA 2D1ZA 4HZ7A 3W28A 4EK7A 4ZTXA 2YLAA 3T78A 4E2OA 2J6VA 3CH0A 2DZPA 1DV7A 2YA1A 1IXOA 3K4DA 3WL1A 3U5UA 1FCQA 3FKKA 2GSHA 1HO1A 4S3EA 3GR8A 3WENA 4MWAA 2QCCA 2OZ0A 1WP6A 1TV2A 4EWJA 1J6OA 6A3HA 1K7XA 4WHBA 3CS2A 1PTDA 1OFDA 2ACQA 2UBPC 2BNJA 1KGXA 2VX7A 4IMGA 3W4RA 1CCWB 2FJKA 2WKLA 1NOFA 1M68A 4MB3A 2PDCA 3KHJA 4DUXA 6REQB 3VGGA 4PUMA 4FX7A 3H22A 1W9VA 2V69A 1YMYA 2O7QA 5I23A 1FHDA 1G4EA 1XBZA 3TYZA 2CLFA 2QT3A 4JHMA 3EWZA 2G3JA 2P53A 3MKKA 4PR4A 1V3LA 5BWAA 1V6VA 5M5DA 4C6QA 5I02A 2V0TA 2PDXA 3AIRA 1TZZA 1KXQA 2BX7A 4MJZA 1ICSA 2VL4A 4PMNA 3URBA 2PDUA 2PP3A 3OOQA 4XO6A 1QOXA 1XDMA 2ZC1A 4UZUA 4NJJA 4JFSA 1BFNA 3GNOA 1TWIA 3WBWA 1LT7A 2R9RA 4H01A 1EJWC 2VDIA 2CU0A 4O15A 4GUFA 1J0JA 1KTCA 1IWPA 3DHUA 4AZCB 2ZWZA 1AFSA 2JIWA 4WF7A 2OELA 2RUSA 3GU2A 3EXSA 1HL2A 1RLDA 3STCA 4B91A 3RYSA 3W75A 4M19A 3GFZA 4MYXA 2O92A 1E4LA 1ZCCA 1VCFA 4FA3A 3U6WA 4WY0A 1Z9AA 3BICA 1NM9A 1O12A 4Z1YA 2J8TA 3URAA 1LT8A 4PTWA 1J01A 4YJ5A 1U5HA 3SAZA 1QHZA 3VXGA 1VBUA 3DHDA 3M6YA 3VNKA 1R47A 3AWOA 3T42A 3E96A 3L0GA 5AYIA 1K6WA 4PUUA 4MFDA 1SW3A 3CZJA 1FDZA 2J7BA 2Y6ZA 3OLEA 2VX5A 1OT1A 4UC5A 3UYCA 2INFA 3G1RA 3SIMA 5JBDA 1IZJA 3SQMA 1J11A 1RH9A 1OZMA 4NASA 4EXBA 2GOKA 3WQFA 2DSKA 2ZRXA 5E0FA 5TIMA 1R9ZA 3ES8A 4L6DA 3KS5A 3FY1A 3W7CA 2WJDA 3ZQ9A 1VENA 1LWJA 2F9RA 2H3DA 2PRMA 1YDVA 1FWFC 1YKWA 4IIHA 4F0SA 1AQ0A 3MO4A 3BV4A 5FJJA 3VKCA 1D7KA 3GC4A 3NVTA 3UVIA 3SCWA 2Y7FA 4CU8A 1P1MA 4MAVA 2PWGA 3EA2A 4OZOA 3OGVA 3MBDA 2CLIA 5LXEA 1FWHC 1I6NA 2DP3A 3KVKA 3RGTA 3AYTA 1VFMA 2Y0FA 4D71A 3LG3A 3EWDA 2CYGA 2JKAA 4MY9A 4V1XA 3H26A 4L1XA 3EOOA 2GQ3A 2YCJA 4P7RA 1HKJA 3SCPA 3S9ZA 4B3LA 3CV1A 1TRDA 1FA2A 3LQGA 2BV9A 4C6LA 2OZ3A 3HBLA 1O1HA 3HGSA 1OCQA 1LYXA 3CHFA 3A6OA 5E9AA 4W9TA 1Z6KA 4FNRA 4GFIA 4TVDA 2CC0A 3NQ6A 3TR9A 3Q2DA 2DORA 1TPWA 1JJKA 3QLDA 4IIGA 4AEFA 4KRUA 4J3VA 3GVRA 3AHXA 3GKAA 1UR0A 3I4KA 1A50A 7CGTA 3HG4A 2OO0A 2OZTA 3WQDA 1OC6A 2Y24A 1FWCC 3KWXA 1A5KC 1KTNA 1KXHA 3MPGA 4I9JA 3R6IA 3RCMA 1NEYA 4C90A 4BF7A 4UWMA 2HNEA 3AU6A 3URQA 3C2FA 5KZDA 4H9ZA 1TZ9A 3BG3A 4AIOA 4D6GA 2D23A 1RSCA 2ZZ5A 4UCGA 1ZY9A 3E9AA 2B4GA 1CGTA 2FTPA 3MMTA 4UCFA 5EU9A 5D04C 4GC4A 1KRAC 2TMDA 1V6YA 4S39A 2BY0A 4Y2WA 1LZOA 4BKNA 3LNMA 2VCAA 2FH6A 4JN7A 1R3VA 1V3JA 4M81A 3AU2A 3WLJA 4AW7A 3AUOA 1U1UA 1GKQA 3UGRA 3NO3A 5K9DA 1BKHA 1EF3A 2WZMA 5DEZA 1XH0A 3DZ1A 1PJ9A 2GOUA 1SMAA 3PWGA 2I9EA 3GUWA 4KWVA 1UROA 2DZAA 3IAPA 3H54A 3VU2A 3GTIA 5K4ZA 1P1XA 1OEPA 2IW0A 4PUNA 4KCWA 1KXTA 4H41A 4RLIA 4V1YA 4JQ1A 3RRXA 2ABAA 2WK2A 4D6IA 4ICMA 3UG5A 2X41A 3AISA 1XD0A 5A5WA 1M7PA 1HKVA 1WDPA 2WLYA 3BH4A 4AF0A 3UA3A 3LHYA 2F6XA 2WZEA 4DO5A 3PZMA 3P0XA 3C52A 2ZZ3A 2XH2A 1WKEA 3PFRA 3CMJA 3PJUA 2HE8A 5IBXC 3DERA 4A4AA 3F4WA 3W1MA 3WMLA 1UUQA 1PE1A 4CCCA 2NXIA 3ZR4A 2AKZA 4DYEA 4AIEA 4OJYA 1G4PA 3IJ6A 3RJYA 5CGQA 5ABGA 4B15A 1DPMA 3B0VC 4JZ5A 4B2DA 2CZFA 4S3AA 5GJMA 2FZBA 3NXLA 1W9PA 4UTIA 1S5WA 3WNPA 3CV2A 4O1CA 4TTGA 4JTIA 5EA9A 1CBGA 4UNLA 4ZMGA 4NZ1A 4GD0A 3QPEA 3W7RA 3UG8A 1VFUA 5I3FA 3ZR6A 4UFIA 3UXDA 3M41A 1HX0A 4QAWA 4LUYA 2JIEA 1B30A 3SRFA 4DJED 2CCRA 2AKMA 1UZHA 1K70A 1H51A 1FP8A 6REQA 3G1AA 3BMVA 4DZ5A 3M0YA 3TZFA 1OC7A 2GGEA 1HGYA 3DKLA 3V4BA 1WBHA 4EANA 3KBNA 1MQPA 1JAEA 3I7QA 4JGDA 1ICPA 1ZBVA 3FDGA 1P0BA 4W7UA 3W01A 4J3UA 4XBKA 1BYCA 3S1UA 2C18A 2Y7DA 4PCTA 3TTOA 3KL5A 1L8NA 2Q02A 3QHMA 3L2MA 2WC3A 4C7GA 3T0CA 3BAXA 3WLLA 3E0IA 1W17A 4KFPA 1WAUA 3HG3A 3HQNA 3H2EA 2OJPA 4Q4SA 1GGOA 2QAFA 2DZWA 1M5WA 2WVVA 9CGTA 4MWAC 2Y61A 3CUGA 2VR2A 1DE5A 3PZIA 4Y9OA 4K3ZA 1HL8A 4XZBA 2Z00A 4K38A 2H9AA 1QFEA 1S2CA 2G50A 4E2DA 2DT0A 3I3EA 2LLEA 5JVLA 2QW5A 1T8QA 1W0MA 2ISDA 1PL9A 4OV4A 3KZSA 3R8GA 4QTGA 4QJ4B 3EOSA 3GXDA 3IJIA 4U10A 1Y5VA 5DO8A 3UJFA 4XVEA 4U31A 1MEIA 1I2OA 2JK2A 4LVGA 3TV8A 1SFSA 5C7VA 3HURA 1BTMA 1TTJA 4LBRA 2PWUA 1JPHA 2X0HA 1UYQA 1DQWA 2R8WA 4LUIA 1NP2A 4LV9A 3M5VA 2RDXA 2ACSA 1I1WA 5KEZA 4S38A 3AIBA 4C7FA 1V51A 1YPXA 5AYXA 4QE5A 3IJ8A 5H8UA 2Y8VA 1K6AA 4M6PA 1KWKA 2VWSA 3F4NA 5A6BD 3WF4A 1PUDA 2P1FA 3VKJA 3LN3A 3B9NA 4LJ3A 2PDYA 1X6UA 1MFVA 1ISVA 2ACRA 4H8NA 4I8YA 1DJXA 4M6VA 3G1XA 3DG3A 3HFYA 3LQLA 1UWTA 1JZ7A 3B0YA 3THCA 4O8RA 2D0GA 1O6IA 4HN4A 3FYYA 1MO0A 4MUZA 4D1IA 1XIHA 3PPGA 1IZKA 3AYSA 1C29A 3G5EA 2IKIA 4AF0B 3QV8A 2P3EA 1CWYA 4A3QA 3E1F1 4HU4A 3STGA 3FIGA 2Y8UA 1EP3A 3FEMA 3LGEA 4Z1BA 1ISXA 3R4IA 3RCYA 2OYLA