3QH2A

Crystal structure of teni from bacillus subtilis complexed with product cthz-p
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
195
Chain Sequence
b'SHMELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFGRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMRYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein tenI
publication title A Missing Enzyme in Thiamin Thiazole Biosynthesis: Identification of TenI as a Thiazole Tautomerase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 77
structure length 195
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 5.3.99.10: Thiazole tautomerase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qh2A00
4FHAA 5H91A 4EWND 1EUAA 4OU1A 5AHEA 5D04C 2O7QA 5DCBA 2J9XA 4WQ6A 3LCGA 4Q4KA 1XBZA 1GQNA 2QAFA 4QM1A 5BNKA 4O19A 3W71A 1G4SA 3TH6A 2ZZ5A 4PC8A 1H50A 4KFOA 3TNOA 5LNSA 1LRNA 4KFNA 2WO5A 1LCOA 1XXXA 2QEZA 4JTHA 1KBJA 4GC4A 3U8GA 3LX9A 3OVQA 1J2WA 3WJSA 1XL9A 4OV4A 3S5YA 1DORA 2Z6IA 1VHCA 1I2OA 3S6DA 4LOCA 2YCEA 1KM3A 2EGZA 2YYTA 1YXCA 3PBVA 1ME7A 6ALDA 1XI3A 5DBTA 4UTUA 2VFFA 4POCA 1YPFA 2RDTA 3CPRA 2ABAA 2CFFA 2QKFA 3KRSA 4AF0A 3MBFA 1YTEA 4JTFA 3W7IA 1DJQA 4EOUA 4O16A 4O57A 5D32A 4AWUA 4ALDA 2FFCA 2YFOA 2CLHA 3NPWA 3SJ3A 4FNSA 1X8FA 2W0UA 3A5VA 4RKAA 5F1VA 4LVFA 3BW2A 3W2KA 2NX9A 2ZCGA 3P7YA 1OFEA 3BLIA 4HPXA 5DXYA 1U83A 3LI0A 4X3ZA 4YLWA 4GUHA 4XQ6A 3OA3A 4DO4A 3WK3A 2QAPA 4O1AA 4LRSA 3W7MA 1JQVA 4CCEA 5EA9A 3GAYA 3MP4A 3L5LA 4K8EA 3QQ1A 4FO4A 5DY3A 1JCJA 3P5YA 3DBPA 2BXVA 4Z1BA 5BMWA 2ZTJA 1KFBA 4TU1A 1RVGA 5EY5A 3LCIA 4O52A 2NXHA 3BPWA 1IIHA 3IIPA 2CLKA 4UFJA 4MZYA 1OK4A 3B0PA 2QCHA 3B0VC 3CC1A 3L65A 3CLMA 5GVJA 3TX9A 1XDMA 4WD0A 3FOKA 1FWWA 1YXDA 2VC6A 1G67A 1H5YA 2VEMA 3TSMA 4YWIA 3W1RA 4MLRA 2ZA1A 3NL2A 2DZTA 3UY8A 5L6UA 4TMBA 3UXDA 4GJ1A 3RK8A 1W3TA 1HO1A 4LVDA 5AHFA 1DQWA 3O63A 5FEWA 3KVMA 1A5CA 2ZRXA 3DFSA 4MY8A 4Z1DA 1LRQA 1WYIA 4TX9A 4M7TA 2DORA 3M7WA 3L0GA 3CU2A 1YTKA 2O7SA 3HPZA 4TIMA 2C6QA 1QOPA 3R2GA 2J88A 4KWVA 1TRDA 1H7XA 2H90A 2UV8G 2Y7EA 5HUPA 3HIJA 5F4SA 4Q32A 4X2RA 3H53A 5J5DA 2YR1A 1TTJA 4Z1AA 2I14A 3G1YA 3B04A 2NWSA 3VE9A 1CI1A 3TXVA 2YZRA 4ZQCA 1VRDA 3GDKA 1T0OA 1CX9A 3DGRA 4ADSA 3E0IA 3HG4A 4JTUA 2WOQA 2E6DA 3LXBA 4OV9A 4UFIA 1O60A 1YADA 4WY0A 4RZ4A 2FB2A 2GVJA 1TV8A 1PL9A 4OBTA 3OEXA 1VCVA 4JTSA 3OVPA 5HWMA 4FIRA 1FX6A 4XBKA 3M1ZA 3B4UA 4RR4A 1FCBA 5E93A 3EX1A 4HSOA 3A5FA 2BLEA 2V9DA 4JNMA 1I45A 4Z1CA 3HOJA 1C8VA 2ZRUA 3BG9A 4M5PA 2NX1A 3MHUA 3P8JA 3MHFA 1V7YA 4JDYA 4E38A 2JKPA 5HR7A 3PVFA 1RR2A 4NJKA 5FI8A 3C2RA 5CKSA 3HGJA 2BZNA 3E12A 3MP5A 3W7JA 3EWWA 4O12A 4K7YA 4GUFA 4IQLA 1TPUA 2PRHA 4LW7A 4ZL1A 4ZQOA 4X9SA 3FLUA 2C18A 4HNUA 3QC3A 1FXPA 1Q6LA 3O16A 4PL1A 3Q37A 3LLDA 3W2JA 1LOQA 4NJJA 5AHIA 4DPPA 4EIVA 4L4MA 1X6UA 5F2LA 4HKPA 3WK0A 3CWNA 3W9ZA 2A6NA 4OHQA 3NQGA 3Q58A 2QUVA 2YYUA 1OFQA 4LRTA 3HMJG 3EX3A 4LTSA 1HUVA 1H63A 3G0UA 1Q6QA 3W7GA 3W83A 4BI6A 1H1YA 1SO6A 1LBLA 1TQJA 5CGQA 1I8JA 2FPTA 4A2SA 4MY1A 3BW3A 3W73A 1EP2A 2PCQA 1KM1A 1GG1A 4WY0F 2DZVA 5SWUA 3FEMA 4DXVA 3JS3A 1JULA 4GRSA 3EX2A 3NZRA 3NR0A 2ZA2A 3NOEA 4JY9A 2PRMA 3TV8A 3EWUA 3EKZA 1KV5A 3L21A 2NX3A 4AWSA 2LLEA 4FNQA 2XFWA 1KM6A 3RMJA 5I3GA 1H62A 1OYAA 3W1PA 3A23A 4O8RA 1WQ5A 1JUKA 5CZJA 3PULA 1TIMA 3GXTA 4FNUA 3S0CA 4RZ5A 1OX6A 3IIOA 1Z44A 4ZQNA 3W7CA 1FCQA 4MFEA 3ATYA 4TMCA 3MI3A 3KRUA 5D2WA 2ISSA 4AMAA 2WV8A 5BMXA 3EXRA 4CCCA 5KITA 3FKRA 4PL2A 3TAKA 5CG7A 1H7WA 2H6RA 4K37A 2DJLA 3C2EA 4DELA 3WFAA 4XTDA 1R47A 1OFAA 2C0AA 4O53A 5T26A 4M6QA 4BWLC 4FX6M 3LV5A 2VELA 5G4WA 3W84A 3H55A 4MYAA 5AN7A 4J9JA 3LLFA 1SPQA 4GXMA 1Y0EA 1FWSA 4LU0A 1HG3A 1W5NA 3A21A 3SGZA 2QUUA 3V75A 3EX4A 4MY9A 1ZFJA 3MYPA 3NQ7A 2FPVA 3VCRA 4Y90A 2CLEA 1QOQA 2QCFA 3QPZA 4XTIA 2ZRZA 3TQKA 3I7RA 4CQ8A 2RDUA 4OQVA 5I3JA 1G69A 4Y8FA 2J9ZA 5C55A 1VPXA 2YSWA 1KV8A 3PAJA 1FDYA 3LXAA 2A6LA 3NPUA 4JN6A 3TKFA 1JUBA 5C54A 4XUGA 2KZHA 4ML9A 4MPQA 4UFHA 4WXZA 1PHWA 5DCEA 3UPWA 4A29A 3L68A 2RHGA 5EYWA 1WBHA 2E1DA 1G4TA 2ZTKA 4PH6A 1FCUA 1G4PA 1PE1A 4O0ZA 4FB7A 4N9DA 3TJLA 3W2LA 1QMLA 4NXSA 4IPJA 3CM4A 3ZWSA 3B05A 2CU0A 1GVQA 1VLIA 5HNRA 3P8IA 5FEPA 1TPC1 3P60A 3PF3A 4GUJA 3W1UA 1QPOA 3IIXA 2FQIA 3G1FA 3PB0A 5LGZA 4WUIA 3G18A 1DBTA 2ATMA 6TIMA 3CIXA 3N19B 1KM4A 3RFAA 1SZGA 4BF9A 4FNTA 4NZJA 3HGRA 3W7RA 3UD6A 2NLIA 1AG1O 1SZFA 5D38A 1X1OA 2OMAA 2V2HA 3HF3A 4MLJA 2RDWA 3WJXA 3P67A 1GTEA 1EX5A 4M6VA 4PCFA 3S8HA 1XBVA 5AC7A 3W85A 5HUOA 3LBCA 1W5PA 1OK6A 3BW4A 4JICA 5F4WA 4UMAA 5KSWA 1YLVA 4DBEA 2ZZ1A 4LS0A 5K4ZA 3BG5A 3G1VA 3OVRA 4O0KA 3G3DA 4H3DA 1FXQA 4HNNA 4UCGA 1FQ0A 2Y7DA 2J9YA 3FFSA 4LT9A 2Z6JA 3O6YX 1LRTA 4IJBA 4HPJA 4UC5A 1ICSA 3EWZA 3SI9A 1H7PA 4UTTC 4HIBA 3ABRA 4ORMA 3KRZA 2GVGA 4N4PA 4IWWA 3TJXA 5CPNA 3LHWA 3NQFA 3WK2A 1QDSA 3CEPA 4EVZA 5A5WA 1KBIA 2JGQA 1GVRA 1RZMA 5HMSA 2CWNA 2YGYA 4JGDA 1R2RA 1OYBA 2TMDA 1MEWA 3DH7A 4E2BA 3M47A 5DLCA 2DZSA 3FJ6A 4MJZA 3QRHA 2GPTA 2HS8A 4NQ1A 4LY8A 4MIMA 2AAMA 2P0OA 3B0UX 4YMZA 1JVNA 2QUTA 2GJNA 3GX9A 5AOUA 5FF4A 3NM1A 4NX5A 4TR9A 4A21A 3KX6A 4UTHA 1TYGA 2GQ9A 1DKWA 1S5VA 4IMEA 2NXGA 3RLVA 3LHUA 5K9XA 4M6PA 3STCA 1GYLA 1GVSA 4ZMGA 3QH2A 4PEKA 1TPWA 3UWQA 5HR6A 1EP3A 3IIZA 2B7QA 3M41A 4GWEA 3GAKA 2WSQA 3IEBA 3MBDA 2P10A 3P61A 1TJPA 2VFHA 1M6JA 3MUXA 4HT3A 4N02A 1OFPA 3FA5A 3OG3A 4U4MA 2ISWA 1I2QA 5D2YA 3UY7A 1RD5A 1V5XA 2NUWA 1EP1A 1FBAA 2A21A 4WXYA 4LS2A 2E5CA 1KTCA 3A24A 3LB0A 5DBUA 1BTMA 4PA8A 2E6YA 1XDLA 4O4WA 5EL1A 4NJIA 1H7OA 2QF7A 3W7NA 1SSGA 3MI6A 3SSJA 2WSRA 5CZSA 1RPXA 2YPIA 3G1XA 2ZRWA 1EB3A 1JQXA 3W7EA 5K7JA 1TRIA 1FWTA 3IGSA 3KVJA 2QCNA 3CEUA 4PFMA 4QAIA 1BWKA 2IQTA 5KZDA 1U5JA 2H8XA 2C19A 3GDRA 1L2UA 4UUIA 3GB6A 3DXIA 3IIVA 3V1PA 1XFBA 3AJXA 3S1UA 2WJZA 4IUOA 4B5NA 1SO5A 4R34A 4O1BA 1W1ZA 2EKCA 3W7KA 1H61A 4NZFA 2VOMA 2CLFA 2DP3A 2GUUA 1WX0A 1WV2A 3R12A 5BW6A 3ABSA 3T44A 4HSNA 4ZVJA 1W0MA 1NF7A 1HO4A 1A5AA 4NNBA 4UFKA 5D2TA 2HMCA 3D0CA 1XM3A 1R46A 1SUXA 4CNPA 4LVAA 3C2OA 4MOZA 1P1XA 1AMKA 3VFLA 4R33A 1SSDA 2V2DA 1IGSA 3TXZA 1A5BA 1VYSX 3G1AA 3NL5A 3DKLA 4FNRA 4AWTA 2B7NA 4ADUA 2V82A 4UTWA 3KOFA 2QCDB 1IF2A 1SO4A 3NYZA 1UJPA 5G5IA 3LBMA 1I2RA 1YDNA 3EXSA 4NJHA 4JTIA 5I3HA 4K36A 4Z0SA 4HNVA 2NXIA 4IMGA 3E9AA 1F73A 3ELFA 2VFGA 1K8ZA 1YDOA 3NQVA 3O6CA 1J5TA 1TPEA 1TV5A 2EPHA 1KLZA 5EKYA 1LOSA 4XKYA 4IXXA 1VJIA 3DFQA 3EX6A 3P81A 1XBXA 3UWVA 5FF7A 2Y70A 3BLFA 4GUIA 5MHBA 1OX4A 1M5WA 1FY6A 1VCGA 5K3VA 2QCGA 3QM3A 1KFLA 4O17A 2XN1A 4O1DA 4D2JA 3U6WA 5FEZA 4XZ9A 3S5ZA 1HL2A 3LERA 5CZTA 1W5MA 3R89A 1P5BA 3DENA 5AYZA 5LNVA 1ZCOA 2E09A 1QNVA 2Y62A 5EBUA 1H7RA 3TQ0A 4EF9A 1SW0A 1GJPA 4QNEA 2OCZA 3T4CA 3S9YA 2X1UA 4N6EA 1YYAA 1MO0A 4UFLA 3O1NA 3DZ1A 3KHJA 4CNOA 5BRBA 1OFDA 2HTMA 3NXFA 3LDVA 5CSRA 3PM6A 1W3IA 2WNNA 4ZQRA 3PUOA 3DFPA 1DL3A 4FXRA 1QPRA 2Y61A 4NX0A 3NVTA 3SZ8A 4BR1A 4KFPA 5E0KA 2E5DA 2QDGA 2VFEA 3TDFA 3JRKA 2X1RA 4DPQA 2G95A 3NNTA 3NQAA 2CZEA 3ABQA 4JEQA 3ZFHA 1EUNA 1VCFA 1KFJA 4GE8A 1VS1A 3TIMA 3QMRA 3H54A 3OBKA 1OVDA 3KVKA 5LSMA 1QO2A 1LROA 3KXQA 3C61A 1N7KA 4N9CA 3HGSA 1YXYA 2OT0A 4IMCA 3LGEA 2E6AA 3L9CA 4P2VA 2A7NA 3TU9A 2YW3A 3CHVA 3M5VA 3MW7A 3NDOA 1WA3A 3DI1A 4ZZ9A 2ZZ2A 1SU5A 3NG3A 1EWEA 4H4IA 3EEGA 3LM7A 3LTPA 1ML1A 2CLIA 3NQ8A 2QJHA 4NNCA 3GR7A 4WOZA 5F2IA 3KAOA 4I7UA 1OF6A 4NU7A 2R91A 3W1XA 3F03K 4P61A 3GIYA 4XBSA 4OWGA 1YPIA 4JIQA 5G1TA 2A1YA 1E51A 5U4NA 1NFBA 1JCMP 2NUXA 1RV8A 4AXKA 3CTLA 4LUIA 2B0MA 1QAPA 4NT0A 1RQHA 1LLWA 4FF7A 4O50A 4N9BA 4JY8A 3Q2DA 4L4LA 5FF3A 3TROA 4K8HA 3IVUA 2HSAA 3NM3A 2J24A 4UR8A 1ZAIA 3FIGA 2Y88A 3UYCA 1VR6A 4LV9A 3L67A 3DI0A 5D30A 3UPBA 1JJKA 4LVGA 3W23A 1THFD 1TPFA 2V81A 2VXNA 2CW6A 3G1DA 3LRKA 4AHPA 2VFIA 1QPNA 2RH9A 3P62A 2ZZ3A 1BWLA 3PWAA 2H3BA 3M0ZA 5AHLA 1XCFA 1FWRA 4IX2A 5IBXA 4FIQA 4AHOA 3GNNA 3SIZA 3DHFA 2YDAA 1EIXA 2X1SA 1F5ZA 4Q33A 1DJNA 1OFOA 1S3HA 1ADOA 2ZDRA 5CSSA 1F2JA 2PE4A 1JRCA 2XN2A 3NPVA 3R13A 1PS9A 1VYPX 1SO3A 3MI2A 3IVTA 1TSIA 1SZNA 4AH7A 1FDJA 3ANYA 1FCVA 3L0NA 3T78A 1TB3A 4FEZA 4YXGA 1J4EA 4M7SA 1N55A 3TAOA 2C14A 3SFKA 2DU2A 3M9YA 2BTMA 5D09A 1KTNA 1WOBA 5EMUA 1XUUA 1OJXA 5D2XA 4HN4A 3ZR4A 4A3UA 2OX1A 1ALDA 1VC4A 4UXDA 4CNNA 2EHHA 4MJMA 2B7PA 1H51A 1ZNNA 2H3DA 1ZJIA 3VI2A 2X2GA 3LCLA 5CPLA 3P82A 1D3GA 2Y89A 1OYCA 3CQ0A 3B03A 4IX0A 4UTMA 4ZQPA 3QW4B 4JD4A 1O94A 2R8WA 1JCYA 1H60A 1F7BA 2VKZG 4S2BA 3LRLA 3LCFA 3UZ5A 5LNUA 3M5XA 5TIMA 1GVOA 4HNTA 3T55A 5BOOA 4LUJA 3NGJA 4QITA 1XKYA 2FIQA 3TC6A 3UWUA 1F05A 2R14A 4UIOA 1PCKA 2E5BA 3L5MA 3PG9A 2ZA3A 1GT8A 4CCDA 3PSWA 3B8DA 1MZHA 3BV4A 5TBOA 1TCDA 3MWAA 3QYQA 3MJYA 4N2YA 5G2HA 2AQWA 3O15A 1LOLA 1QPQA 4FX7A 2G97A 1T8XA 5CZ0A 3GDTA 4WY0B 1VQTA 2ABBA 1HFBA 1GG0A 4UTIA 2OJPA 2V2CA 5ABTA 4K6AA 3C6CA 4JTKA 5KINA 2WNZA 5G2WA 2V5LA 1WDWA 3HO8A 4AAJA 3QMTA 3W1QA 1AK5A 1GEQA 1JRBA 3N9RA 1AL7A 1K03A 5HWNA 5D2VA 3W74A 3BO9A 3A9IA 2ZZ4A 5U7SA 5LHEA 3QZEA 3QW3A 3W76A 2DJXA 2ATSA 1XBYA 1VH7A 2F7FA 4RX0A 2I9EA 3W22A 3HJZA 3C2FA 3C3NA 1GVFA 3UQNA 1W54A 3RNDA 5LZLA 1LDCA 3THQA 2QCDA 2V5BA 5HINA 2QCLA 1LLZA 1EEPA 3EWXA 5I3KA 3N14A 1W31A 1IXQA 2HS6A 3HG3A 3STFA 3NPXA 3UZJA 4Z0JA 3W1TA 1XUZA 1ZENA 3F4WA 3TR2A 1T96A 4O13A 3I7SA 4PODA 3DFNA 2DZPA 3G1SA 3G8RA 3N34A 1TTPA 2Y6ZA 1A50A 1O4UA 3C4UA 3HPSA 1QFEA 1LBMA 2NZLA 3K30A 4O4VA 4DO6A 1I4NA 5KZEA 3HPXA 4JXCA 3NZ1A 3NL3A 4NNAA 1F6PA 3LHTA 4RJEA 3JR2A 4O54A 4JYFA 4ZQMA 4LC8A 1WAUA 5DXXA 2E68A 1CW2A 2CLMA 3S5NA 1R2SA 2ZRVA 1GPWA 3STGA 1TMHA 3NQCA 4LWWA 3WJWA 2Q8ZA 4DF1A 3W87A 1PHQA 4NJGA 1OG0A 3Q94A 1GYNA 4DF0A 1SFJA 1SQ7A 2C15A 2CLLA 3P74A 3CWOX 3I7QA 2QR6A 1M7PA 4YL2A 1RQEA 1AW2A 1TPVA 3FYOA 5G2IA 1Z42A 3TFCA 3WJYA 3LV6A 2FPYA 5AC8A 2QCCA 5F1UA 4UNLA 1NVMA 3W1MA 1TTIA 3G0SA 3TK7A 2Z2UA 3W1NA 2Y63A 2R94A 1MEIA 1LORA 2WPBA 3N2XA 2P1FA 1DV7A 2CLOA 4UTKA 1B9BA 4IMDA 4NVTA 1BEUA 1VZWA 3MHGA 3PUEA 4RCXA 2PURA 3GK0A 3M5ZA 2C16A 1UB3A 3GYEA 5K4XA 3PR2A 3HG2A 2YX0A 1KM0A 3QQ0A 4JX4A 4I7VA 1NSJA 1KFEA 4HHPA 3NL6A 4IMFA 3R8RA 4JS3A 3LTSA 3W7OA 3PS7A 4O14A 1YDVA 4MFDA 1UBSA 3LCXA 3WK1A 2NV2A 3R5EA 1ZAJA 4K7VA 4LS1A 3TA6A 1JCXA 2ZZ6A 4MZ8A 2Z1BA 5IM51 2Q3OA 3O05A 2Q3RA 3IVSA 1YTDA 2VFDA 5C6MA 3TUUA 4UTWC 3TW7A 2YFNA 4YCOA 3GKAA 1R2TA 3N3MA 2V30A 4QISA 3E49A 2CZFA 4AEOA 4GFSA 3SGUA 1L6WA 3I6RA 3SECA 2V8ZA 5AYYA 1B57A 3MO7A 2CZDA 4Y9AA 3G3MA 2ZYFA 4ONVA 4JDBA 4UMBA 3TW6A 3W3OA 5K9CA 1ME9A 3LRMA 4QSHA 4O10A 1AW5A 4OGZA 4O11A 1A53A 2W79A 3RLUA 1X7FA 3U2OA 4LNYA 5A8GA 3PSVA 1TQXA 1LTDA 5KMYA 1T99A 3BLEA 3FS2A 1K3UA 2VEKA 7TIMA 4WZHA 4JTTA 3LCHA 3W1LA 1JUEA 2B7OA 3QJAA 1LM1A 5D33A 1VYRA 3ABOA 4ORIA 5K2ZA 3O07A 4I7WA 3DHDA 1KA9F 3DU0A 2OT1A 4WOQA 3VNDA 3W72A 4O18A 4DF2A 2E6FA 4QNWA 5F2MA 1K8XA 3CB8A 1NAL1 1RQBA 1O5KA 1OF8A 1TPH1 4LV4A 3HG5A 4LVBA 4C1LA 4MKNA 3RF9A 3B06A 4MYXA 1B3OA 1QCWA 2QJGA 4FX8A 3GZ3A 1N8FA 1OFBA 1ICQA 3NQ6A 4DBDA 1TO3A 3C0JA 3SY5A 3TFXA 3PBWA 5TQLA 4R53A 3DFTA 1ZHAA 2VEPA 3LHZA 4MUZA 4IPIA 4N6FA 2YXGA 1Z48A 4RLIA 4UTJA 2X30A 4NXKA 1L9WA 4UFMA 4XWUA 3VKJA 4BI7A 1K7FA 4BFAA 3TMLA 1UASA 5L9FA 3GNDA 2E77A 4IXHA 2A2IA 3L0KA 4FXSA 5G1YA 5LGXA 4E2DA 1WXJA 3GVGA 1KLYA 1KTBA 1LZOA 2AGKA 1TTQA 1S5TA 3BGJA 3HBLA 1ZALA 2Y7FA 1AL8A 3HQ1A 4RK8A 3EKLA 2YW4A 3W1AA 1QWGA 3E02A 4KWWA 3P5ZA 5D02A 3W88A 2TYSA 2CZ5A 3QSRA 1W5QA 4S2CA 1O5XA 1IIGA 3KVLA 3BVJA 3THAA 3WJZA 3GKFA 1KFCA 2QDHA 2TPSA 3OHIA 1KM2A 3A22A 3S1XA 3W75A 1SW7A 5KZMA 4YCPA 1K02A 1H7NA 2D73A 3M43A 4IOTA 4G1KA 1ZAHA 3G24A 1SR9A 3SR7A 1JR1A 3GDLA 3LXCA 4EF8A 2PRLA 2DZXA 3BG3A 3W70A 4OT7A 1O95A 1DQXA 4U28A 3N9SA 2ZFAA 1JCLA 3CIWA 2J27A 5I3FA 1LBFA 1UUMA 4N9EA 1S5WA 1H1ZA 4OE7A 5DCDA 5IBXC 2GQAA 4GUGA 3W2NA 1OABA 5D05A 3TCEA 1P0KA 3USBA 1TPB1 3QPYA 1K7EA 1MSSA 4BK9A 4IGHA 5CPOA 1ME8A 5G4EA 3IGXA 4O1CA 3W2UA 3NQ2A 3CT7A 5HJLA 5D03A 3MP3A 1OX5A 2Y7GA 1P4CA 4C1KA 2C13A 3N73A 4UR7A 3C52A 1W3NA 2Z0IA 1MEHA 1KW1A 1DVJA 1ZY9A 1HTIA 3M16A 1TPDA 1LP6A 2FJKA 1M7OA 1XC4A 4JTLA 1GWJA 2PC4A 3S1VA 1TREA 5AHNA 5C2XA 2A7RA 1UCWA 1Q6RA 3QFEA 2J6XA 1VHNA 4A22A 3S42A 1B4EA 4GNJA 1A5SA 5HQEA 3G0XA 4O15A 3C2VA 4DQWA 3NA8A 5LNRA 4AF0B 3UWWA 3O06A 2B4GA 2FTPA 1B4KA 3O8AA 2RKXA 1WOAA 4JYEA 2A4AA 2TRSA 3TE9A 2WNQA 5AB3A 2GJLA 5KTLA 1GOXA 1DOSA 5DN1A 5J5RA 5F2GA 5EPDA 3PUDA 5H2ZA 2NV1A 5CPMA 4JX6A 3W2MA 3P80A 4RXFA 3M5YA 1OHLA 3ZS4A 2JGYA 3LTYA 1D9EA 2WQPA 2VEIA 3TSDA 3EXTA 4AVFA 3DKJA 1OFRA 3HGOA 4WX2A 3PB2A 1VGAA 1Q3NA 3PC0A 1G4EA 3W7LA 3IRDA 2C1HA 3EB2A 2QCMA 3HB9A 1SFLA 4JTJA 5LHFA 1IXNA 2BSLA 4MZ1A 3W6YA 3UNDA 3C8FA 1C9DA 2X1TA 3T40A 3GLCA 1W56A 1K7XA 3QEZA 3UXAA 1TV7A 1QO5A 3M6YA 4W9TA 1PV8A 1D3HA 3FKKA 4XKYB 3GR8A 3TC7A 3W7PA 3BK0A 1EWDA 3UWYA 1F76A 4JTEA 2FDSA 3FJLA 3M44A 3NEVA 4JR5A 3W07A 1OX4B 1SW3A 1L6YA 5LKYA 3LHYA 3DAQA 1AW1A 2ZZ7A 5HULA 4JIPA 3STEA 3BARA 3G1HA 4UNKA 4CQ9A 3P84A 1IXPA 5FEXA 2VENA 1IXOA 4AHQA 3GXPA 1NF0A 2A0NA 2DZUA 2DZWA 2ZRYA 3EWYA 3NQMA 3IGUA 4KKXA 1I2NA 4JX5A 4NUWA 4CQAA 1F74A 3C56A 1P0NA 3DFOA 4S1FA 1MXSA 5DY2A 4DEFA 3L66A 1R30A 4UTLA 1G7UA 2ALDA 1G6CA 4DO5A 2H8ZA 3NQEA 4LC6A 3TQVA 3S1WA 3L5AA 2GVLA 3TSBA 1Z41A 2V0TA 3ZWTA 2QJIA 4JTGA 3INPA 2ZBTA 4RXGA 2WKJA 3N2MA 1Q6OA 3W7DA 1FDZA 3NQDA 1ICPA 3NO5A 5AFDA 3E96A 1PVNA 3I68A 3O6DA 1Q45A 3TMQA 3OIXA 2Y85A 4RZ6A 1NEYA 4MVAA 1BKSA 1KM5A 2WSYA 2JKAA 2FB3A 3UWZA 3MYOA 2EAWA 3F4NA 2JK2A 3NAVA 4K38A 3MMTA 4BWLA 3SW6A 1C29A 1X1ZA 2NUYA 5C5YA 1PCWA 4R7JA 1KFKA 1PIIA 2A5HA 2BX7A 3S5OA 3I65A 1W5OA 1LYXA 1GZGA 5F4XA 4CLMA 4Z08A 4QQ3A 4Y96A 2C3ZA 2A7PA 2G5WA 4ADTA 1ONRA 2W6RA 2RFGA 4WJEA 5E1QA 2QCEA 4JYDA 1VLWA 4ICNA 4X22A 4K39A 3RU6A 2X16A 1EPXA 2XN0A 4QIUA 4Y6GA 2JKEA 5DELA 2G96A 2Q8LA 3T7VA 5K9DA 2JBMA 4AB4A 4N4QA 3LCWA 2GOUA 3ATZA 1L6SA 1K8YA 1G7VA 3AO0A 5HWJA 4RV8A 3QSTA 4UMCA 1W8SA 3LOTA 1TJRA 3QF0A 2EF9A 3GXNA 3W7HA 5FESA 4BI5A 1W37A 3F1QA 1FWNA 1DHPA 5AHMA 4GBUA 1EA0A 3LI1A 3LHVA 4E0CA 2OZ0A 3G8EA 4H6KA 2FLIA 2I1OA 2ZQ0A 2F84A 1I2PA 3L2IA 2GQ8A 3PBYA 3YPIA 4I9AA 5FF0A 3W7QA 1FUYA 3PBUA 5AYXA 2TSYA 4FNPA 1SZEA 2ISVA 8TIMA 5FF2A 3BGGA 3FYPA 4O28A 3VE7A 3W86A 1F6KA 3IV3A 4TO8A 2NWRA 1WBJA 1GTHA 1UUOA 4QJ1A 5I3IA 1QR7A 5LNWA 5D37A 3PY2A 4M19A 2BWGA 4UTTA 3PG8A 2A85A 1JCNA 3G22A 3EWBX 3GDMA 4A2RA 5AC6A 3KFTA 3QMSA 4PTNA
chains in the Genus database with same CATH superfamily
4FHAA 5H91A 1CLVA 1EUAA 1PKYA 4C7GA 2CBUA 1ZJAA 3A9BA 2J9XA 1KB3A 2CPUA 1VD6A 4PRTA 4L80A 4WQ6A 3G5EA 3LCGA 4CD8A 3W26A 3QBUA 4ZB0A 1GQNA 2QAFA 1WXZA 2CITA 2B31A 2C91A 1LRNA 5AC5A 1DJWA 1KBJA 4GC4A 3U8GA 4MB5A 3OLGA 3WQ4A 3MVTA 1XL9A 2PDQA 2OQHA 3S5YA 1MXGA 2Z6IA 4LOCA 2YCEA 2HE5A 4HU4A 2POTA 2VYOA 3QV7A 3PBVA 1H0GA 4JHOA 3W00A 4A8NA 1TA3B 2VFFA 3DN5A 4C5YA 5ABEA 3CPRA 2DQXA 4CKQA 1FWJC 1QT1A 4H9TA 1SJDA 2PBGA 3G77A 4RPPA 1VJSA 3ARSA 3KRSA 1JI1A 5BOEA 1CYGA 3HQPA 1EDTA 4H9MA 3BOFA 2V3EA 3ZLGA 4E3VA 3CMGA 2QJNA 4KIRA 4FP1A 4FNSA 4P5UA 1R6WA 4Q8WA 3I3BA 3VD7A 5IRPA 3AS0A 5F1VA 4LVFA 3W2KA 2NX9A 4E8DA 1EGMA 2SFPA 4TQTA 5DXYA 4XQ6A 2G3NA 5A69A 4TXEA 2VT0A 1JQVA 5A8MA 3A47A 4PUDA 3QR0A 3EDFA 5A8QA 1QUMA 4P7OA 5A6BA 4QHRA 4ENLA 2ZTJA 4TU1A 3LCIA 3T09A 1Y65A 1IIHA 4M8UA 4NRRA 3MY9A 3GY1A 4DHGA 4UFJA 3B8TA 3ITTA 1H2JA 1DJHA 1KXTA 4WD0A 5KZ6A 1B3VA 4UZSA 1YXDA 2VEMA 4YWIA 3W1RA 3WDIA 2VD9A 1D3CA 1WXYA 3PJWA 4IH3A 4ATLA 2REQA 1W3TA 1BSIA 1FOBA 3V0SA 1N2VA 3GNRA 3DFSA 1LRQA 4M7TA 4B5TA 2NQ9A 3CU2A 1BYAA 3P93A 2C6QA 2PPGA 3R2GA 2H90A 2Y7EA 5F4SA 3SCVA 4Q32A 1F61A 1E6NA 3H53A 2HRWA 4KRZA 4Z1AA 5AKQA 3B04A 2NWSA 1E4NA 2YZRA 2PWVA 2WZTA 3HZ3A 3N04A 1UWQA 1JDEA 2WZEA 4J3VA 5BWAA 3V4BA 4JTUA 2E6DA 2WMHA 5LA0A 2INFA 4W87A 1KNWA 1UUQA 3VGBA 2DIKA 3C86A 4RZ4A 5FJIA 3A3XA 3DIPA 1PL9A 4UQEA 2Z25A 3OEXA 5DMYA 3OVPA 5AYBA 1HZYA 1PO9A 2UWFA 3B4UA 3N4FA 2BS9A 1FCBA 5E93A 4LY4A 2BLEA 4LCSA 3UXIA 1TV4A 5F7UA 2XDFA 4M5PA 3MHUA 3P8JA 4W4QA 4E38A 3C2RA 3EZ4A 4C6MA 3W7JA 3ONBA 4O12A 3VDBA 1FHDA 4GUFA 1J10A 4IQLA 1WPCA 4ZL1A 3K4DA 4X9SA 2C18A 1M1BA 4HNUA 3SSZA 3CO8A 1LF1A 1FXPA 1Q6LA 4HN8A 1W3HA 3PTKA 4L1GA 4B2DD 1NTHA 2OKOA 5F2LA 3NVDA 3CWNA 3WK0A 1LUCB 4YPJA 4OHQA 5M03A 3Q58A 4NSBA 3HMJG 3EX3A 4Z1YA 1HUVA 1H63A 1OT1A 1X7IA 3JZUA 2CNCA 2GDUA 1LBLA 5CGQA 1JDDA 1I8JA 4A2SA 4B3KA 4MY1A 3BW3A 3W73A 2WC7A 3ES7A 2PCQA 4WY0F 2BOEX 4J3XA 2DZVA 2FHBA 4DXVA 3JS3A 1CXEA 3OW1A 3N2OA 3NOEA 3BL3A 3RG6A 4HTBA 1UWUA 2RDXA 1LG1A 3EKZA 1RBOB 3L21A 2OQLA 4AWSA 2PZ0A 1W9UA 1UQYA 3VFCA 4E4FA 1KM6A 2V3FA 1S1RA 1AD1A 5EU9A 1OYAA 3W1PA 3UJ2A 1UR8A 3BZJA 3A23A 4C6DA 1WQ5A 2YCJA 2AKZA 5HMDA 1JUKA 4XZHA 3VC6A 3PULA 4GA8A 4RDZA 1OX6A 3IIOA 5HDRA 2WANA 1Z44A 4ZQNA 3W7CA 1UR2A 2PCEA 3ATYA 3EWDA 4LJ3A 3AXHA 3LS9A 3FKRA 3R10A 1YDYA 1CB2A 3R79A 3WFAA 1V02A 3VAVA 4H9VA 4UNIA 1OFAA 2OPJA 1LWIA 2C0AA 3P3BA 4I8DA 1EC9A 4O53A 4IIBA 4PUWA 4M6QA 3LV5A 5G4WA 5EMLA 3W84A 3LK6A 3ZOAA 2ZWYA 4M81A 4GXMA 3RCNA 2OO6A 3CYJA 3EX4A 4MY9A 3MYPA 2FPVA 4Y90A 1QOQA 5BU9A 1K4HA 1J0KA 3E6EA 3TQKA 3WFZA 2Z1XA 4A6GA 1G69A 1PKMA 4QS6A 5C55A 2YSWA 1KCKA 4MTVA 5HNUA 2R24A 3WUBA 2A6LA 3NPUA 3TKFA 5C54A 2HDJA 2VRJA 2KZHA 2Z26A 4AX6A 4L9XA 4UFHA 1PHWA 1TJ1A 1WBHA 3UNTA 1GOQA 1QK2A 1FCUA 3ISIX 5I3DA 4N9DA 2XH2A 3VGGA 1QMLA 3LQGA 3P8IA 4U5KA 3E38A 3QTPA 3IIXA 4JTCA 4DVOA 1E6PA 3PB0A 3J7HA 3RFAA 4NZJA 4MWAA 1MMFA 1AG1O 1E70M 3HF3A 3BURA 3P67A 1PPIA 1GTEA 4KBXA 4Q8NA 5HXMA 3UJSA 5HUOA 3LBCA 2V67A 1EYEA 1OK6A 2P88A 5F4WA 1YLVA 1UWAA 1Q6CA 4QDPA 3SDOA 4EXAA 5K4ZA 3OVRA 4GY0A 3C5QA 4XAYA 1JI2A 3LPOA 2E9LA 2J9YA 4KEMA 2UY5A 3VIKA 1ICSA 4QS5A 1H7PA 4QXIA 3AHTA 4ORMA 5ABFB 1E6RA 3LHWA 4MKSA 3RXZA 1X98A 1RK5A 1QDSA 1UR4A 5A5WA 1GVRA 1RZMA 4JGDA 1JF6A 2YGYA 1B54A 1OYBA 1R2RA 1DPMA 3DH7A 4E2BA 3M47A 2DZSA 4C6FA 2OGYA 4C6EA 4MJZA 2PDGA 3QRHA 1XD0A 1EHNA 3NCOA 1FHLA 3CB3A 4XUYA 4WF7A 3H23A 2PWGA 4NQ1A 4D9PA 4K68A 2P0OA 2F2KA 4YMZA 4GZIA 2DUZA 1RCQA 2L5HA 2QUTA 3B8WA 4IPPA 5DMLA 1HN1A 2GJNA 3GX9A 4AIEA 1NDZA 1JG9A 3KRBA 1MZRA 3GXIA 3H2NA 3UP8A 2V63A 1VPQA 4JOMA 1GYMA 4LGXA 8XIMA 3TW9A 1O5RA 3LHUA 2O56A 4ZOBA 4IZGA 4ZMGA 2BHUA 4ZTXA 3TYEA 3GFYA 4PEKA 3QYSA 3UWQA 2ONEA 4C6JA 4GWEA 2B7QA 1E5NA 4GI6A 2PDUA 3IEBA 1ZJHA 2YBTA 4HA1A 1TJPA 1OCBA 2PWEA 2VFHA 4QR6A 4DUOA 1VAHA 2ISWA 1B30A 3VIHA 1PWLA 1FBAA 4H8HA 2A21A 1GEHA 2QHAA 3M0MA 2E5CA 3UESA 3LB0A 5DBUA 4PA8A 2HCVA 4IP5A 4NJIA 4E6MA 1H7OA 1IR2A 1XIJA 3SSJA 1CENA 3VD4A 1RPXA 3MWCA 4C7DA 1KCLA 3MZNA 2QDEA 2I56A 3W7EA 4R7WA 5K7JA 3H24A 4NYUA 5DX7A 1XCXA 2IQTA 5C8BB 1HIZA 3BAKA 4HOZA 1S2AA 3GB6A 2A3LA 2Y2WA 3DXIA 1O1ZA 3PZ9A 4M56A 6ENLA 2VGBA 5CC7A 3WY1A 1T8QA 1E71M 3NZGA 3OA5A 4J3SA 3RJXA 2Z7GA 3PZMA 2GVEA 3MU7A 2CLFA 3E2SA 1WV2A 3T44A 1KXVA 3RR1A 4ZVJA 1NOWA 2BDQA 4HD5A 1OZQA 4BEQA 1HO4A 2J75A 3IAPA 3TJ4A 1P1XA 3VFLA 5KEZA 4LAOA 4KGJA 1VYSX 3VA8A 3DKLA 4S3AA 3OZPA 1ADDA 2ZICA 3KOFA 2J7DA 1Q2SA 1V3LA 2ZC8A 3ARXA 3LBMA 3R1ZA 3ITLA 4K36A 2NXIA 4IMGA 5IDIA 1J5TA 1OINA 1MW2A 2O9RA 2XVGA 2VR5A 1LOSA 1XYZA 5FF7A 2Y70A 5MHBA 2J6VA 1FY6A 1VCGA 3LEPA 5CPSA 5K3VA 1KFLA 3W81A 3WLPA 1GONA 4O1DA 2V5DA 3U6WA 4XZ9A 3LA4A 4WK9A 3REQB 1P5BA 1OC7A 2YDQA 1KD0A 1XR2A 4RDVA 4ZA0A 1PSCA 4PMRA 3M7SA 2FTYA 4F0MA 3TQ0A 1H0IA 1SW0A 4HP5A 1GJPA 2VX4A 3T2QA 3WDPP 3S9YA 2OEJA 2X1UA 1Q7MA 3H8AA 1TWSA 3EAUA 4CNOA 2VHLA 4XVEA 5D9OA 3PM6A 5EMJA 1VKFA 4ZQRA 3U7VA 4U31A 3PUOA 3DFPA 3MUCA 1DL3A 3RRAA 2Y61A 1OD0A 3NVTA 2AL1A 1RXOB 2PS2A 4I90A 1GNXA 2E5DA 2VFEA 3JRKA 2G95A 3NNTA 4HZ7A 1HJWA 1XSJA 3NQAA 3KZSA 4W7UA 1EUNA 1KFJA 4GE8A 2XVNA 1BF6A 1KKOA 2OTDA 1JGIA 3VNIA 3KVKA 2FDMA 2OELA 3KXQA 1XPYA 4N9CA 1YXYA 3H6OA 4IMCA 2E6AA 2A7NA 3M5VA 3MW7A 3NDOA 4JCLA 3WF0A 1WA3A 1MQQA 3I4KA 3WENA 2BASA 1U5VA 2ZZ2A 1A0EA 3GG1A 4EPEC 4H4IA 4PSRA 2E67A 3MUAA 3GG8A 3WD3A 2CLIA 3WUEA 4WOZA 2R91A 1OGGA 4L4OA 4PCNA 2W66A 3AIUA 4XBSA 4MSSA 3W38A 1BXBA 3EPMA 1E51A 1E72M 5U4NA 1JCMP 2NUXA 3UJFA 2RGMA 2IKGA 4LUIA 1QAPA 1RQHA 3HMCA 4US6A 4PSPA 4N9BA 4DRSA 3OIHA 5FF3A 4A3YA 2HSAA 3SUTA 5LXEA 1K6WA 2Y88A 4JAWA 2O9OA 4PCTA 3L67A 3DI0A 3A6OA 5D30A 1WDSA 4DO7A 1KGUA 1THFD 4IG2A 2V81A 2VX6A 1Q4WA 4WHBA 3FYYA 2R1PA 2ZZ3A 3P62A 4ZOAA 4YHEA 3PWAA 1XYLA 3LU2A 3M0ZA 2BODX 5IBXA 3FHAA 3F2BA 4FIQA 4LYRA 3GTFA 2PGEA 4AHOA 3GNNA 1L8PA 2NQJA 3CXOA 5T8GA 1QNOA 1EIXA 1W2VA 2X1SA 3CAKA 4CN4A 1OFOA 1S3HA 1ADOA 3WO8A 2G4FA 2PE4A 3FA4A 3UG5A 4HOWA 2DVXA 1R3RA 3M0IA 4ATWA 3DCPA 1IGWA 2IPJA 4PYSA 4WVXA 3T78A 1A3HA 3FNDA 3KBSA 3MT1A 4IPLA 4JTRA 1N55A 4YJ5A 3ARTA 2ZX9A 3M9YA 4C6LA 4L56A 5DMNA 1KTNA 1WOBA 3MC5A 1XUUA 2XVPA 2E9MA 3RM8A 2Q01A 4ES4A 1N8IA 3FN9A 3PP7A 3S6OA 3B0XA 3QR3A 1ALDA 4UQ9A 2PU0A 3LENA 3B9EA 4MJMA 1VPYA 4Q22A 4XSMA 3B9AA 3QHNA 4KF1A 1S39A 3SCWA 1GJUA 4AEFA 4YU1A 3FK4A 3QW4B 2ADAA 3WQ5A 2R1NA 3NO3A 2EPOA 4HNTA 5G1MA 5BOOA 2PWFA 2OSWA 3WH9A 3NGJA 5BRQA 2TAAA 1QASA 2JE8A 2YL9A 4LFYA 2FTWA 3FGCA 2E5BA 3PG9A 2ZA3A 4XAFA 2FFIA 4CCDA 3B8DA 4IIDA 3CK5A 1TCDA 5TBOA 1ZZMA 1HQTA 3MJYA 4Z2LA 1UMYA 1MI3A 1QPQA 1T8XA 3DFYA 3GDTA 4WY0B 1XQLA 1XG3A 1GG0A 1OM0A 2ISFA 5AVNA 2IS7A 4AAJA 3ECQA 2ANUA 3W74A 3ZT5A 5C9WA 2B81A 2ZZ4A 3A9IA 5LHEA 3QZEA 4DJEC 5I0DA 4ACYA 4D72A 5A6BD 4HZMA 1TZZA 3GBDA 1R7OA 3S3GA 5HINA 3R7MA 3B0YA 2CCRA 4LUYA 3N14A 3H2AA 4NZ3A 1JZ3A 1V6WA 3N2CA 5EMYA 3STFA 4B5UA 3TP4A 3UZJA 3W1TA 1FKXA 3ZJ7A 2HEJA 2RAGA 1MW1A 3DHPA 1NOFA 3UERA 3PZIA 3N34A 2NQZA 4W85A 5HBFA 1U30A 1QI5A 1W1TA 1QFEA 2E40A 1UP0A 3WIJA 4AEEA 2WJEA 1G0CA 5KZEA 1U33A 2I16A 1FH8A 4FF5A 1C7SA 3D3FA 2V5JA 4JQ1A 4O54A 4KIEA 2YOCA 4LC8A 1AQFA 2QPSA 2W67A 3STGA 5GPRA 3R0DA 4A35A 2XISA 4NJGA 1OG0A 3ITOA 4M51A 2O9PA 1HJUA 5EFFA 1V08A 1S2TA 4WKFA 2CLLA 3P74A 3APGA 5REQA 5HJXA 4OECA 2QR6A 1M7PA 3K8LA 3O0KA 1TPVA 1BGGA 4C1NB 1UKPA 4MF4A 2W3ZA 2GGGA 3CQIA 1NVMA 2Q02A 4RE3A 4PMVA 4YIWA 5JH2A 2R94A 4RL3A 2WCAA 1VBJA 3CBWA 1DV7A 1ITUA 1EIBA 4UTKA 4S3KA 4IMDA 3A13A 7TAAA 3MHGA 3PUEA 1HKKA 3PPGA 5CLTA 2PURA 3PFMA 2CERA 4C7FA 3M5ZA 2VCBA 2C16A 3WD4A 3GYEA 3E2RA 3HG2A 4CN6A 2D1ZA 2I5QA 4IMFA 3R8RA 4JS3A 3W7OA 1M03A 4O14A 4F0SA 3WDQA 2IPFA 1ADSA 1I75A 2NV2A 3DESA 3QV9A 3VOIA 1ZAJA 4K7VA 2ZZ6A 4MZ8A 2Z1BA 2XG9A 3NSXA 1XRTA 1YTDA 4Q8UA 4FLOA 4PUJA 4GBDA 1VIZA 2WKLA 1UH2A 3TW7A 2YFNA 2ODOA 3SB0A 4QISA 1UR9A 4GFSA 4CEXC 2O55A 3OBAA 4DZIA 1B57A 2P53A 4AWEA 2CZDA 4X0NA 2VUNA 4UMBA 3W3OA 1L8NA 1ME9A 2V3DA 1AJ0A 4AU0A 3GRIA 4Q8OA 4IICA 4QSHA 1LQAA 5A94A 1UQZA 1XLFA 2C1IA 1M41A 3AOFA 2VZUA 3QZAA 4NI8A 1FVPA 3EWCA 1W91A 3DYMA 4DN1A 4C91A 3PSVA 1OD8A 1VFHA 1LTDA 3BLEA 3FS2A 1RSCA 1CXKA 5EMKA 3W1LA 3O0FA 4GZJA 3GSMA 4KWSA 3EMCA 4ORIA 3QVQA 5K2ZA 4JKMA 4J3ZA 2PD9A 4XISA 1KA9F 3PZUA 1WDRA 3VNDA 4O18A 4NKCA 4DF2A 4WDWA 4QNWA 5F2MA 1K8XA 1RQBA 1OF8A 1GCYA 4C1LA 1UKTA 4MYXA 3VTRA 4GO9A 2QJGA 4DIAA 4GINA 1OWQA 3CQJA 3QLLA 1OFBA 3V16A 3TFXA 1IWAA 4R53A 3VNMA 1LL6A 2VEPA 4MUZA 4N6FA 1W2PA 2YXGA 3GVVA 1R9ZA 4DJDC 4NXKA 4S38A 5I03A 2P50A 1O5QA 4ZR8A 2J62A 2WJDA 2Y1HA 3TMLA 1F9CA 3GNDA 1MXDA 3AI0A 1UWRA 3HPAA 4Q8TA 1CXFA 4WR3A 1O1HA 1HKMA 4DZHA 3KZPA 3I3EA 1V6YA 3HBLA 1ZALA 2Y7FA 3GM8A 4RK8A 3ABZA 3EKLA 2YW4A 1QWGA 2WMIA 4F8XA 1PZ3A 2HNHA 1JNDA 4YNGA 4H6QA 3QSRA 1EF3A 1AQMA 4R3UA 3U4AA 2OG9A 1RBAA 2QDHA 1H49A 1WE5A 3OHIA 3A22A 4MWAD 3HU7A 5KZMA 2FZBA 1K02A 1GOIA 4IOTA 4D8ZA 1U1UA 3LXCA 1TMLA 3W70A 2KX9A 4CCZA 4LUTB 2X09A 2OYLA 3WLNA 1DQXA 4U28A 2VUYA 4F0RA 1JCLA 3BSHA 4OE7A 2GQAA 3KCJA 3W2NA 5CC3A 2OXNA 4MJ2A 1ZTVA 4IGHA 2ICSA 3BZGA 2P3ZA 1ME8A 2BGSA 3W01A 2IXVA 2X7WA 3H2MA 3GHUA 1HJQA 1OX5A 2WWDA 2FGLA 2BVYA 3SCRA 3C52A 3IS4A 1V4YA 1ZY9A 5LXXA 3CMJA 3UFYA 2P5NA 4DAFA 2PDCA 3CL7A 1LP6A 2FJKA 4KQNA 1LT8A 1GWJA 4FALA 2A7RA 2PB1A 4A22A 3ID7A 4HOXA 2EG6A 1R7AA 4GGBA 1A5SA 5A3HA 1XLCA 2Z7KA 4ZXLA 5HQEA 2ZX8A 3V5OA 1X96A 3NA8A 3MV11 1E6QM 2A4AA 4E3TA 1UD8A 1BXNA 4EANA 4INFA 3WD2A 1NWUA 4F9DA 5MKGB 5EPDA 1VENA 4J3UA 2NV1A 3VUPA 3AXKA 5XIAA 4JX6A 4PMUA 3M0LA 3TYBA 1D9EA 5I2UA 3EXTA 4AVFA 3PJUA 2E3ZA 1RY0A 3PC0A 4D8LA 4WIWA 1EZ2A 3LGDA 1JL8A 1V3KA 3IPWA 4PB3A 4UZUA 2QCMA 2X8RA 2CXEA 3OO2A 1SFLA 2HPMA 1RP9A 1IXNA 2BSLA 3RX2A 3W6YA 5CSYA 3C8NA 2X05A 3T40A 1EBHA 2XGIA 1W56A 1FWGC 2H9AB 4W9TA 1CTNA 1D3HA 8XIAA 3FKKA 3TC7A 3W7PA 3UWYA 1JPDX 4JTEA 2FDSA 5CBIA 3FJLA 2G3JA 3GTIA 4HNOA 1EXBA 3VD9A 3W07A 1GHSA 5A2CA 3R43A 2ZZ7A 4CQ9A 4AZBA 3UXKA 1IXOA 4AHQA 4CD4A 2DZUA 3NQMA 3IGUA 4KKXA 3ZM8A 4JX5A 1P0NA 3DFOA 4IUGA 2D0HA 2OEKA 3ARUA 2ALDA 3I4EA 4WRHA 3TQVA 2I17A 4QAWA 2GVLA 4O1EA 1SMDA 1Z41A 1F4AA 3VIOA 3GE7A 3KDOA 4PBFA 1ZL1A 2QJIA 3INPA 3U3HA 3MUZ1 2WKJA 3MB9A 1Q6OA 1FDZA 1MQRA 1ICPA 5AFDA 1PVNA 2ZDSA 1Q45A 3SUSA 2QIIA 2WSYA 1KM5A 2JKAA 1FTXA 2JK2A 2PLMA 4K38A 1UJQA 3WD0A 3WQPA 3WLJA 1TG7A 3WZ0E 3UETA 3AXIA 1RD6A 4R7JA 4DLFA 7PTDA 3QC0A 4D1JA 2A5HA 2EKGA 3S5OA 4L65A 3I65A 5C2CA 2ZIDA 4Z08A 3Q67A 1EXPA 3KHDA 2A7PA 4MAZA 2G5WA 1ZBWA 1ONRA 3WMSA 2RFGA 4GYPA 4DNMA 4WJEA 1CLXA 3WQEA 3SQSA 4P8XA 1VLWA 4QDMA 3CGTA 3RU6A 2X16A 4GQQA 3AROA 4QIUA 3TYZA 4Y6GA 1U5HA 3AZSA 2Q8LA 3K2GA 2DT3A 6XIMA 1MRQA 1EH9A 4DYEA 1FWIC 5GNYA 3OPSA 5HWJA 2Y4SA 4RV8A 4IFKB 3QSTA 1QNRA 1QXLA 3QF0A 1V8EA 3GXNA 1L6FA 2FZ8A 4Q4MA 3T4WA 3W7HA 3CYVA 1EJ7L 4S23A 4BF5A 4BI5A 1T40A 1UH3A 3GTHA 4PUEA 3AFBA 3LHVA 3V1HA 3MV01 4Z2KA 1EF2A 4E0CA 3L7RA 3OLIA 2I1OA 4J40A 4DI9A 1HKWA 2GQ8A 3WDJA 4AFYA 4Z42C 4R27A 1Q13A 3YPIA 1JFXA 2FJUB 3PBUA 3F2DA 3KLLA 4CVUA 3R11A 1P7TB 1BVZA 1CGXA 3L4WA 4TO8A 4DX3A 5I3IA 1WZLA 2E9BA 3POCA 1ODUA 3AIVA 1QI4A 4HA0A 5D37A 2BWGA 1W9PA 3NSMA 3PG8A 3KLKA 3A4WA 3G22A 3P0XA 1V6XA 4TX6A 3P6LA 1XH2A 2WMFA 3R8HA 1CGWA 3L2MA 5MF5A 1UZ1A 1TFVA 3VABA 3F4DA 2W63A 3DEQA 5AHEA 1EA9C 1EBGA 1DIDA 2F8QA 3VIGA 2V6AA 3AICA 5BNKA 4O19A 3HQOA 3TH6A 2ZZ5A 2PA6A 4YWSA 6TAAA 5LNSA 2ISDA 2WO5A 1EFZA 1XXXA 2QEZA 4JTHA 1J2WA 4OV4A 1LWJA 4CNSA 3CZEA 1C92A 7REQA 1HGWA 1IEWA 3PPCA 1KM3A 2EGZA 2YYTA 4REQA 1Z7AA 1ME7A 1Z32X 4TUFA 4XAPA 1XI3A 4RE0A 5DBTA 1VBHA 1HP4A 3DGBA 3FHQA 4GISA 4POCA 1TZ7A 4XD6A 3L2LA 4QG6A 3W7IA 1DJQA 4AWUA 4ALDA 2YFOA 1Q66A 3NPWA 3SJ3A 1F6YA 3RPTA 4G6CA 3D6NA 3SUVA 3CHDA 4Y9MA 3P7YA 4ZOCA 5FACA 1OFEA 4AISA 1B3YA 1U83A 4NZCA 4X3ZA 4YLWA 5GJNA 4F2UA 2MNRA 4FXFA 5EA9A 3V5FA 3MP4A 1XIGA 4K8EA 1NDYA 5DY3A 1JCJA 5JBFA 3DBPA 2BXVA 2G50A 4ICCX 5BMWA 2WMJA 4NAFA 1EJWC 4JL2A 4GGHA 3VO0A 4XAGA 1OK4A 3B0PA 2QCHA 3L65A 1UPMB 3CLMA 2VD8A 3OP2A 4TTUA 5CPQA 1BTCA 1FWWA 3BLPX 3VMPA 3DHUA 4MLRA 2ZA1A 5A6KA 2OOGA 3NL2A 2DZTA 4HMDA 1S3TC 5L6UA 4GJ1A 3RK8A 1CECA 1CLKA 1HXJA 5AHFA 1TWIA 1UIPA 3GIQA 3RUBL 1A5CA 2BB0A 4I9JA 3L0GA 3V36A 3HPZA 4X2PA 1V51A 4TIMA 4QJ3B 2J88A 4KWVA 5HUPA 3HPFA 4X2RA 1FWDC 5J5DA 3CUXA 1R8LA 1XKJA 4LANA 3FW6A 4KWOA 1HX0A 1DHKA 1AJZA 3VE9A 5EGRA 3CWHA 3TXVA 2AMXA 5JXQA 1T0OA 1KR0A 1RA0A 3ICJA 4ADSA 3E0IA 1E6SM 2G4JA 2G37A 2EBNA 4GQGA 3MKKA 4C6PA 1EPVA 3NGFA 1YADA 2R9RA 2YCKX 1TV8A 2R1KA 4JQ2A 4OBTA 3U2CA 4FIRA 1FX6A 4XBKA 2WMKA 4RR4A 1C93A 4GZEA 4W89A 3EX1A 3BDKA 2V9DA 1ECEA 1P48A 4JNMA 1I45A 4AC1X 1E0TA 1ISZA 2ZXQA 2NX1A 2DZBA 3JW7A 5HOSA 4JPGA 4IGSA 1NQKA 2BY3A 2Y24A 5J8LA 3HGJA 3E12A 3UGVA 1OT2A 4RUBA 3EWWA 1YBQB 4K7YA 2XSXA 4H7VA 1NIUA 3W25A 5AZ0A 3S4TA 1IZKA 4EWJA 3EMZA 4FOJA 3O16A 4PL1A 1TELA 1S38A 1LOQA 2OLAA 3OVGA 2AOSA 4MMWA 4DPPA 3L12A 4EIVA 2WSPA 3W9ZA 1Y5WA 4XZMX 3NQGA 5C7HA 3VNLA 1VEMA 3APYA 4CEUC 3VGEA 3W7GA 4BI6A 4HSHA 1TQJA 1UH4A 2FPTA 4Q6XA 2QNEA 4U10A 1QI3A 3WLLA 2VGGA 1QBBA 3ARZA 3T42A 1JULA 3PANA 3NZRA 1H11A 2ZA2A 4S3JA 3VX0A 2PRMA 1HW6A 1JXKA 3TV8A 4IHCA 2OGJA 2CHNA 3EWUA 3QGKC 2DDXA 2BHZA 5FD0A 1UZDA 1XFCA 3TYDA 3RMJA 5I3GA 1LJYA 4GVIA 4IP7A 5CEWA 1LLOA 3WBWA 2ZE0A 1QK0A 4H7CA 5CZJA 5A2AA 4QJ5B 4L4PA 1FCQA 4NZ5A 4AVNA 5LA2A 4J4KA 3VOHA 4AMAA 4X9YA 4B5XA 4CCCA 1E5JA 4I9TA 4YVPA 5KITA 4PL2A 1AODA 3UCCA 5CG7A 2XFYA 4RNHA 3L4VA 4K37A 9CGTA 3U2EA 3C2EA 4J2PA 4LCRA 4CD7A 2DVTA 1G1YA 5D4YA 1KGWA 5T26A 3ZVIA 4BWLC 4FX6M 2VELA 3CUHA 3VCCA 5IDZA 4MYAA 4HZ8A 1EJUC 2D23A 3AZRA 5AN7A 3T2PA 3LLFA 2XZ9A 1ZU8A 3A21A 3ARQA 2QUUA 1XIMA 3UZXA 1IHIA 3NQ7A 3IJ7A 3LLXA 2QCFA 3BE7A 2ZRZA 4NZ1A 4CQ8A 3F5KA 2RDUA 3OHMB 2CIPA 4OQVA 5I3JA 5I77A 2J9ZA 1AZ1A 1KV8A 4AZ5A 4U3CA 3WLHA 1BFNA 4JN6A 4XUGA 1R9YA 5HANA 3KWSA 2XU2A 4WXZA 5DCEA 2RHGA 2CBJA 4EE9A 2ZTKA 1XLKA 1PAMA 4PH6A 1G4PA 4O0ZA 4V2XA 4FB7A 3FJNA 3QY6A 1JNEA 3W2LA 4NXSA 3ZWSA 1DE6A 3VNZA 3B05A 3AUOA 1GVQA 5HNRA 4L7ZA 3MSDA 5FEPA 1O7AA 3AIQA 3T8QA 3E1F1 3TVAA 2FQIA 4AG0A 3G1FA 2EG8A 3G18A 4MADA 2ATMA 4NAEA 3WUGA 1KM4A 2HBXA 1SZGA 4BF9A 4FNTA 4AX7A 2WKGA 3HGRA 3CUZA 4K2SA 1PDYA 2OMAA 1WDDA 4S3CA 4AZ7A 4C6NA 4UR9A 4PCFA 1BLIA 5AC7A 4JKLA 3WQOA 3BLLA 3D46A 6REQA 3BW4A 4JICA 5TD4A 4MHBA 2WCGA 3WF2A 4GKTA 3G1VA 3G3DA 4H01A 1FXQA 4DZ5A 4US5A 4MNLA 1ZPTA 4UCGA 5FAJA 1L0PA 2Y7DA 4FLQA 3WQWA 3VIJA 4F0HA 4OBRA 3FFSA 2WK2A 4LT9A 3O6YX 1R0MA 4CQDA 4UC5A 4M1RA 3MS8A 4LALA 1KXQA 2PZNA 3NDZA 3IAQA 5CPNA 4IG2B 1TJ0A 3AYSA 3CASA 2WHKA 3WK2A 1NJJA 3GUGA 2X0SA 5HMSA 4JIHA 3WEZA 3FAXA 1MEWA 4GCXA 4Z2HA 1JFHA 5C7VA 4HYVA 1GQJA 3BUVA 3QOMA 3CZJA 1YEYA 3B4YA 1MQPA 1ONWA 2EPLX 3D47A 4U33A 2F2HA 1IWPA 2J25A 3KX6A 1TYGA 1DKWA 5H8PA 3NQBA 3THDA 2WWCA 3S2JA 5I78A 3STCA 1GYLA 4K1WA 3QH2A 4AC7C 4DWSA 3K8KA 4IF2A 3M64A 3WQVA 2WSQA 1QVBA 2ZXAA 3I10A 1NWTA 2Y8KA 4YTTA 4U4MA 1I2QA 1RD5A 2NUWA 2HZGA 3AZTA 4PR4A 4WXYA 4D6FA 1GKPA 3A24A 1I9CB 2E6YA 1XDLA 1FWEC 5EL1A 4Q8VA 2QF7A 4GNKB 2WSRA 4Y7EA 3V5CA 1JQXA 1BRLA 1WKEA 2W92A 3KVJA 4PFMA 4C60A 3W27A 3FCPA 5KZDA 3WNKA 1VRXA 2H8XA 2CBVA 3TYUA 2C19A 1CCWB 1L2UA 3GFZA 1CPUA 4UUIA 1K4GA 1RHCA 3B8SA 5T91A 3IIVA 3SY1A 3AJXA 3S1UA 2WJZA 4B5NA 3N4AA 4FZIA 1Q7QA 5J04A 3M6DA 3DOPA 4C90A 4C6KA 2IUZA 3BLOA 2XIJA 2GUUA 2YL6A 4KS0A 5BW6A 3GBEA 1W3LA 1PB0A 1JEZA 2HMCA 2VCAA 1R46A 2AMGA 1SUXA 1FWFC 1WDPA 3IJ9A 3N12A 1HVQA 3L4XA 4R33A 4HZ6A 2PTYA 3AU6A 2Z1SA 4NIRA 3SM0A 4ADUA 4UTWA 3T6CA 2O4MA 2YBVA 1IF2A 3RN6A 1I2RA 3CQKA 4KERA 5I3HA 4Z0SA 1MFVA 1F73A 2EJ1A 2VFGA 1K8ZA 2WBKA 4HHMA 1YDOA 3O6CA 5JVLA 1JD9A 1IZJA 1IE7C 2EPHA 5FJOA 1XGEA 4PFHA 3UG4A 3DFQA 2VCCA 3VDGA 2ZKMX 1XBXA 4NG3A 4GUIA 4A3RA 1Q6DA 1CEOA 4O17A 4QBXA 3WBAA 4D2JA 1ITQA 5FEZA 1CXLA 2C71A 2YDSA 5AYZA 3WF1A 2E09A 1BYBA 4EF9A 5ENLA 4QNEA 2OCZA 3VZZA 3EEZA 3TTSA 3U7BA 2ON3A 4N6EA 1YYAA 4GX9A 2DSKA 4CQBA 4FMVA 2WZIA 1MUWA 2KAUC 1J0JA 4B90A 5CSRA 3URQA 4GO8A 4YS1A 3PFRA 2NVDA 4NX0A 3SZ8A 4BR1A 2ZADA 1UD6A 1S5NA 4KFPA 5E0KA 4X0VA 3RR4A 4R9XA 2X1RA 5GNZA 3BQ5A 3KL5A 4JEQA 4M29A 4QG9A 1MW0A 1QO2A 2Z2BA 1RJQA 2PDJA 3C61A 1UYQA 3SCQA 2WSKA 4LF2A 4WDXA 3LGEA 1J0YA 2HQAA 3VIMA 2EPMX 1TE6A 3UU0A 3MJMA 3NG3A 3EDKA 3LTPA 1D8CA 1ESWA 3A3WA 2PF8A 1AH3A 3VM5A 3KAOA 1FH7A 2NV9A 3W1XA 2VX7A 4P61A 4ROQA 2GDQA 2ZVRA 4OWGA 5G1TA 3S2NA 2A1YA 1ELSA 4H9XA 3THCA 2P0IA 3CTLA 1NP2A 4MDPA 4NT0A 1Y5XA 4O50A 2YB1A 4GI9A 2PDNA 2F6XA 3DC0A 3BCFA 4BQ2A 3QFWA 3NM3A 4W93A 3DX5A 1ZAIA 2QVHA 1VR6A 1F8MA 3SADA 1XYFA 1JJKA 5XINA 2POZA 3BV7A 1HL9A 3WNPA 1A0CA 3IK2A 1KGXA 1CB7B 3LRKA 5CJ5A 1OIMA 4AHPA 3Q4DA 2VFIA 1PZ1A 1KKRA 4PCPA 1BWLA 3PZGA 1FWRA 1LL4A 3SIZA 1XGDA 4DUVA 4EAYA 1KRBC 3KOZA 2QPUA 1ZUAX 3ALGA 4KPLA 4D6GA 2XN2A 4OFCA 3R13A 1PTDA 3AYVA 1SO3A 2G3IA 3IVTA 4JNYA 1DIOA 1XIDA 1TSIA 1JZ6A 2PDHA 4AH7A 5M2FX 3ANYA 2R6OA 3IACA 1FCVA 4DAIA 1TB3A 1HL8A 1PYFA 1XLAA 3D3AA 3TAOA 2C14A 3SFKA 4BY3A 3VNYA 3BAIA 4LCQA 5EMUA 1OJXA 2G41A 1K9DA 5CZKA 3ZR4A 4A3UA 2OX1A 4H2HA 5A8OA 4FA3A 1VC4A 2B7PA 1A4LA 3L4UA 3V3WA 3VI2A 2X2GA 4MPKA 3CAWA 1R9XA 4NRSA 4MWAC 3GW0A 2QLYA 1JCTA 3B03A 2GK1B 3WYZA 1MFUA 5LYRA 1JCYA 4R85A 3HFTA 1F7BA 4S2BA 3BCDA 3LRLA 1GZ1A 4XO7A 3LCFA 3UZ5A 2HVNA 2QGHA 2Z24A 3UYIA 1GVOA 3N17A 4LUJA 4QITA 3OZOA 5HMFA 4J5NA 1UD2A 1F05A 4P8VA 1E4IA 3KBMA 3IJ6A 4JTQA 1TA3A 1GT8A 2BY0A 3BV4A 4OJYA 3EOUA 3QYQA 1AVAA 1Q5MA 2OX4A 4RZBA 4FX7A 3RM4A 3ARWA 1OC6A 4H8UA 1VQTA 1HFBA 4B5VA 2V2CA 4NP7A 4K6AA 4JTKA 1XLIA 2WVSA 1E15A 2Z27A 2WNZA 2D3NA 5G2WA 4YTSA 3W1QA 1AK5A 1GEQA 2FYMA 1JRBA 2CKRA 1TZ9A 1K03A 1DIKA 2J47A 2X0HA 5U7SA 2JIEA 3QW3A 3W76A 2FGZA 3ZLHA 5T9CE 5I79A 1EJXC 5HQMA 3AMGA 5LZLA 1CZ1A 2QCDA 3S2CA 1EX1A 5D9PA 1WB0A 1ODZA 1P1MA 1ONEA 1LLZA 4PUNA 1PXGA 4F79A 1XUZA 1T96A 1XYAA 5AVHA 5I23A 5FSDC 3FEQA 3UZWA 4EPBC 3DFNA 2PDLA 3G8RA 1MUMA 2Y6ZA 1O4UA 3EKGA 2XUCA 4C65A 3ZJ8A 4O4VA 7CGTA 3NZ1A 4NNAA 1F6PA 3LHTA 4L5ZA 1XJBA 1J12A 2A3HA 1LT7A 4ZQMA 1WAUA 5DXXA 2E68A 1R2SA 2ZRVA 3CT2A 2OR2A 1PKNA 1L6GA 4L1XA 4LEQA 3NQCA 4LWWA 3EDJA 4DF1A 2HV5A 1R3YA 1JDFA 1KCZA 3U9IA 3S9IA 4DF0A 1SQ7A 2C15A 1IEIA 3AHXA 4CN1A 4JEJA 3RM9A 1AW2A 5G2IA 4HU8A 1SJAA 3RYSA 3TFCA 3WJYA 3LV6A 3TWAA 4UNLA 3W1MA 4AZ6A 4GZ7A 3W53A 3G0SA 3GHTA 2Z2UA 1XD1A 3EA2A 2IKHA 1HJVA 1XPGA 1FP9A 3DG3A 4NVTA 4RCXA 2FZNA 3O2LA 3BICA 4F0LA 5K4XA 2R1MA 3SAZA 2YX0A 1W6TA 1QHPA 1UWSA 4R88A 3BJFA 3XINA 4LBSA 1KFEA 2DQWA 3QOKA 5AZ1A 3VZYA 2HK1A 1XYCA 3BMWA 4GXPA 4FPSA 3SQMA 1UBSA 3WK1A 1V3HA 4LS1A 4TVCA 3NDYA 4ILSA 4PMOA 4MB3A 4MG4A 4GVFA 2Q3OA 4LAUA 2PWHA 3IVSA 3IUIA 2ZX6A 5C6MA 3OODA 3TUUA 2ZOXA 1E1EA 1V0NA 1LUCA 2GDVA 3GKAA 4PTMA 3WBXA 1UKQA 3E49A 2FMNA 1BSLA 2DW6A 1Z6KA 2Z00A 2QUMA 1XX1A 4XV0A 3LRMA 3MA8A 1GZJA 3CPGA 2YLLA 1XC6A 1YRRA 1A53A 3B8IA 4OUIA 3GW3A 1X7FA 1ZJBA 3II1A 5FKYA 3PWIA 5KMYA 3S5SA 3GVRA 4B9ZA 3ZIZA 4QRNA 4NI3A 1W9XA 3E74A 3OOQA 4HCLA 2VEKA 4XIMA 4H8VA 2GUYA 3VMOA 4JTTA 2X7VA 3LCHA 1DTNA 4IQDA 5DO8A 2VWSA 3DG7A 2CC0A 3ABOA 4I7WA 3DHDA 3DU0A 1REQB 2QULA 2X2YA 5JIPA 4WOQA 3W6MA 1ISXA 5FL1A 3VPLA 1UWTA 3SQLA 2J7BA 4QLLA 3HG5A 4LVBA 1OG6A 5JIWA 4MKNA 4AD1A 4DZAA 1YKWA 1QCWA 3CQHA 3N13A 4FX8A 1WZAA 1N8FA 4C6IA 2JIWA 2DFAA 3BAJA 3TN3A 4GNVA 1QNSA 1ZHAA 5CQ1A 4PMDA 3R0UA 4ZEPA 4UFMA 4XWUA 1H09A 5AYIA 1U1HA 4TVDA 4I5RA 2ASHA 1UASA 5L9FA 2E77A 4IXHA 2C8NA 4GIYA 5G1YA 1VFUA 1E4LA 1X97A 1TJ2A 3MO4A 1J96A 3FY1A 1AZ2A 2DW7A 3GC5A 1TTQA 1XDJA 4GLEA 3BGJA 2OEMA 4P7LA 1AL8A 3LYEA 2DH2A 5HK4A 3ZJKA 3ZYZA 1W9DM 3E02A 2IQ0A 1WKFA 1NDVA 2CZ5A 3W29A 1W5QA 1IIGA 1G9HA 4F2BA 3TONA 1XH1A 3KBJA 3SIMA 2IKIA 1KFCA 3OJGA 5TF0A 2TPSA 1NU5A 4J3TA 3UF9A 4YCPA 1SR0A 2D73A 4IIGA 1X8CA 3ANVA 1UP3A 3QZ6A 4QDWA 3GDLA 3BG3A 2WHMA 4J28A 3ZMRA 8CGTA 1XHGA 2VNCA 3CIWA 5I3FA 1LBFA 4HJFA 1J01A 1UKOA 1HKJA 5ABGA 1W1VA 3LUTA 1S5WA 5DCDA 2Q71A 5IBXC 4US5D 1P0KA 3CPUA 5CPOA 2PDKA 2WYSA 3IGXA 1A5OC 3CT7A 1MYRA 5HJLA 1FHVA 3MP3A 1A5MC 1P4CA 2FVLA 4CU8A 3GG0A 4GK8A 4UR7A 1JPKA 1ZP3A 2Z0IA 1MEHA 3ANUA 5PTDA 3RGTA 2PP0A 1QI2A 3T81A 1M04A 3M16A 5EBAA 3VINA 1TV2A 6XIAA 5HPCA 3P0WA 5ABFA 1UCWA 4QP0A 1EOKA 1FHUA 3QPEA 3BWWA 1HKIA 3S42A 1B4EA 1IV8A 2C0HA 3EOOA 4GXWA 2Z29A 4FSAA 1P0BA 2QGYA 2ZUTA 4D6CA 2XGBA 4GJJA 2A3AA 3C2VA 3LSCA 3ZLFA 4HK5A 2FTPA 1B4KA 3O8AA 2RKXA 1WOAA 4L9ZA 4GYFA 1UG6A 3TE9A 2D2OA 3WDHA 3S47A 2BMBA 3MSRA 4FI4A 1B1YA 3PUDA 2NSOA 4DNHA 1E43A 1PDZA 3P80A 4MAVA 1J6OA 3M5YA 4L61A 4DWSD 2DGAA 4JFSA 4KGLA 2PC8A 3DKJA 3VKBA 5BXPA 1VGAA 1Q3NA 1G4EA 1XIBA 1JZ4A 3IRDA 2C1HA 4WKAA 3EB2A 4QGCA 1V6VA 3G6LA 5LHFA 2Y0FA 1XLEA 4MZ1A 3UNDA 1C9DA 2W27A 2CKSA 2ZVIA 4JTAA 3M6YA 1CT5A 1PV8A 1W1YA 4XKYB 1R5YA 3S2MA 2J66A 3CUGA 3WL0A 4JR5A 1OX4B 1TVPA 2MUCA 2ZX5A 1NDWA 1AW1A 4JIPA 3PZVA 1C8XA 3QR1A 3P84A 3C3UA 3QGAC 4F3HA 2VENA 1V79A 3GXPA 3H22A 3EWYA 4WEVX 1I2NA 3SFWA 2HNEA 2YIHA 3C56A 4AY8A 2ZWZA 3EPOA 3BGAA 1R30A 3L66A 1G7UA 4QJ4B 1G6CA 4DO5A 4YTQA 3NQEA 1HT6A 3N18A 3S1WA 5I06A 2DIJA 3GC2A 2DIEA 3AWNA 1K1DA 4I5XA 5H8MA 3SCOA 2ZBTA 1J0IA 4RXGA 3W7DA 2ZUSA 4H19A 3NO5A 4E4PA 3NFUA 3BAYA 4H2CA 1GVEA 4HTYA 3I68A 3COTA 3O6DA 3A3HA 3VVGA 3OIXA 1JZ8A 3ITVA 3MYOA 2EAWA 3F4NA 3W37A 3D5HA 3MMDA 2OLSA 1DTUA 3MMTA 4IFOA 1C29A 1EEXA 1X1ZA 5C5YA 3MKCA 3UR2A 1DEDA 1KFKA 1UR0A 3B8VA 1XSKA 3ERPA 1ISYA 1GZGA 3M46A 5F4XA 8RUCA 3FVMA 2V69A 4ADTA 1NELA 2W6RA 5E1QA 2IMRA 5HJYA 4JYDA 3N1AA 3VGFA 2PDFA 4K39A 1PEZA 4LSBA 1V0KA 1UHVA 4HA3A 2XN0A 4D1IA 3IJQA 3NJ3A 2OB3A 2CXGA 2YBUA 3GXFA 5K9DA 1XIHA 1V3IA 1K8YA 3AUJA 4Q4QA 3UGRA 1IT7A 3AO0A 4IIFA 5GJPA 1WNOA 2QXWA 3GWQA 2W9MA 2EF9A 2JQXA 3GHRA 3REQA 1US0A 5FESA 2FH8A 2INZA 1A3WA 3TA9A 1DHPA 2I9UA 4GBUA 3OTRA 3LI1A 4BQ4A 4GH1A 2OZ0A 3G8EA 4H6KA 3WUFA 4L6OA 3RHGA 3L2IA 3S83A 1SZRA 2GL5A 4I9AA 3ZSTA 5FF0A 1SMAA 4J2MA 5AYXA 2TSYA 4LYKA 4PMJA 4FNPA 3CZGA 1A4MA 4NYYA 8TIMA 3R94A 1F6KA 2DEPA 3IV3A 5I5RA 1WBJA 4GQ0A 1FFRA 2WC4A 3N2BA 1E56A 4L9YA 1QR7A 4W8AA 1XINA 3E0WA 2GWNA 4M19A 1A3XA 3VXGA 4UTTA 2YA0A 7XIMA 1JF5A 3U57A 2P76A 5E9XA 3EWBX 3GDMA 4W88A 2D3LA 3CMFA 1EGVA 4EWND 2HJPA 2IXUA 3IUHA 5DCBA 2GWGA 5FAGA 4P8UA 2JFEX 1OQFA 2ZC1A 4Q4KA 5I00A 2QPXA 4KCUA 2X42A 1YE6A 4QM1A 3H26A 3UWEA 3TNOA 1JDCA 5D8ZA 1DYSA 1CNVA 1LCOA 4K1GA 2WW5A 5C0QA 3OVQA 3WJSA 1DORA 4XD4A 3S6DA 2OQYA 2V38A 2PDBA 1R3TA 3C0LA 1W17A 1E55A 1EQPA 1DXFA 4XVDA 3WDRA 3CUFA 3RDKA 3QKZA 1OSEA 4HA4A 2VP8A 2CFFA 3GZAA 1EDGA 4AF0A 4JTFA 4RW5A 4BS0A 5D32A 2FFCA 3WLKX 1X8FA 2W0UA 4RKAA 4HPHA 2XJ7A 4GJIA 3BW2A 2DT0A 2OSYA 1N8WA 3T05A 3LN3A 3LI0A 4DO4A 3WK3A 2XH0A 2QAPA 4O1AA 3W7MA 1T6MA 1K9EA 4KEUA 4RW3A 3VOCA 1EL3A 1P6BA 2HWGA 2QJJA 4FO4A 4Z1BA 1KFBA 4IL0A 4PULA 1RVGA 3BMVA 5EY5A 4O52A 1RUSA 3IIPA 3QKEA 2CLKA 4MZYA 1US3A 3TX9A 4DUXA 2BVDA 3FOKA 1O68A 4OUEA 1G67A 1GORA 3TSMA 1SFTA 3GTXA 1HKVA 3UY8A 4Y2WA 1GKRA 4TMBA 3E5BA 3OLDA 3KM8A 3PNUA 3WX7A 1Q6GA 3O63A 3GNOA 3OYZA 1E0XA 2ZRXA 3F5JA 4MY8A 1WYIA 2NT0A 3M7WA 2WM1A 1YTKA 2VVSA 2O7SA 2YCLB 1QOPA 1DJZA 1H7XA 1TRDA 2YR1A 1TTJA 2XM2A 3W24A 4Z2JA 1CI1A 4PUMA 5CC6A 4AY1A 3GDKA 4UQCA 4PE8A 4HU0A 2OWCA 5DANA 1CX9A 1HGYA 3DGRA 3HG4A 2WOQA 3UJEA 3V0UA 4AQLA 2A79A 3LMYA 4KT2A 2QYGA 4OV9A 2P8CA 4WY0A 4PZVA 1DJIA 1H5VA 2HXUA 4PB4A 3KS6A 3MCOA 1WO2A 3PNZA 1TUXA 5C9UA 2XPKA 3GO2A 4PTVA 3WSUA 1E1CB 4HSOA 3NUKA 3GVWA 3ME3A 4JHMA 1LQ0A 2GVYA 4Z1CA 1NM9A 3HOJA 1C8VA 2ZRUA 3NZPA 3BG9A 1I0BA 1M01A 4JDYA 3LD5A 4NJKA 4ZO7A 1W1A1 1GOWA 5CKSA 2BZNA 3WNOA 3MP5A 3SUUA 2VX5A 3KCOA 5BZAA 1TPUA 2PRHA 4LW7A 4ZQOA 5M5DA 2I5IA 4B91A 1EDQA 5DF0A 4Q8QA 5LIUX 3Q37A 3LLDA 1GQLA 4DJFA 1XG4A 4L4MA 1X6UA 4YYCA 3G1RA 4HKPA 4QTGA 2A6NA 5JH1A 1XLLA 2QUVA 2YYUA 1J18A 1OFQA 5I7GA 4LRTA 4LTSA 3TN6A 3G0UA 3WQFA 3W83A 1K8CA 2RJGA 4DYKA 1H1YA 1B90A 1B0IA 5E6YA 4AZCB 2ACQA 4GHRA 4QLKA 1GG1A 3FEMA 3EMQA 3CL8A 3HV9A 3ENLA 3EX2A 4V1XA 4JY9A 5E0CA 3QV8A 1KV5A 4XSLA 5BCAA 2LLEA 4AMCA 4C1NA 4LB3A 4Q6JA 3KP0A 1F07A 1MUCA 3EOLA 4I5UA 3M0YA 3HURA 3U5YA 1LWHA 1BVWA 2VQUA 3RLHA 1TIMA 4FNUA 2PODA 3S0CA 2OZ3A 2WVVA 3B8UA 1LL7A 1WZKA 4UWMA 3CH9A 3RRXA 5CXPA 3GYCA 3K8MA 5CGMA 4MFEA 2QV5A 4TMCA 3KRUA 5D2WA 1V0MA 2PTWA 2WV8A 5BMXA 2BV9A 5E0FA 3TAKA 3I3DA 2CBIA 2J4GA 2BHYA 4DELA 2FH6A 2ACSA 4WSJA 3K4AA 1DXEA 4P7QA 4OVXA 3KE0A 4J9JA 1EJTC 1SPQA 1B31A 3RCYA 3ZZ1A 4LU0A 1W5NA 3SGZA 2FHCA 3V75A 3VGHA 2VR4A 1ZFJA 2CLEA 3S2LA 4XTIA 5CG0A 3MZ2A 4KRTA 4GYPC 4YHGA 4Y8FA 2VL4A 3AIWA 5M1TA 1RH9A 1U2YA 3TTEA 1H4PA 3N29A 3FVDA 1XISA 1JUBA 5ECVA 3EGJA 4DWDA 4ML9A 3M4HA 3UPWA 4A29A 3GXMA 3L68A 3N11A 5EYWA 4RV3A 1YPXA 4AD3A 1PE1A 4A3QA 1P0DA 3UR7A 4C5ZA 1MRAA 4F4RA 3WBEA 3TJLA 5FOOA 2CU0A 1E6XM 7A3HA 5H1WA 3JUGA 3GD6A 1YMYA 4GUJA 2WB5A 3ARYA 1QPOA 2VRQA 4YVVA 3URBA 5LGZA 4WUIA 1DBTA 3SEPA 1W32A 6TIMA 3CIXA 5ECUA 3UD6A 1V6TA 2NLIA 4AY7A 3UJRA 1SZFA 4LQ1A 5D38A 1X1OA 2V2HA 2RDWA 4HK7A 4M6VA 3ARPA 1XBVA 3W85A 3K1DA 4W7WA 3KCLA 2XTKA 5CGTA 4UMAA 5KSWA 2DSZA 4DBEA 1SYTA 3BG5A 3B40A 4O0KA 1TMQA 4HNNA 4JKKA 1E1FA 3TTQA 4CD5A 4Z17A 3GFXA 3VCNA 2D20A 1WKDA 1Z9AA 2WZMA 3TLLA 1LRTA 3QXBA 4HPJA 4HU3A 2GFTA 4ZOEA 4IIEA 4MUPA 4UOQA 3CHCA 5I09A 1P43A 1T7LA 3B97A 4N4PA 3HJEA 3NQFA 1AD4A 4MNMA 3CEPA 4QG8A 1EOMA 1Q8AA 5BXSA 1W1IE 2TMDA 1VBUA 3IANA 3VILA 4JHZA 5DLCA 3TCSA 5HPOA 3FJ6A 4ACZB 5A6MA 4B4FA 2HS8A 2WXDM 4B5SA 1YNPA 3B9NA 4HCHA 1VBRA 1ZBKA 3CUJA 4LB4A 4MIMA 2AAMA 1BF2A 3B0UX 3VKCA 4IFRA 4GIAA 5BOFA 2D2GA 2VGIA 1IYXA 3EOEA 1JVNA 5B7ZA 1TR9A 5AOUA 5FF4A 3NM1A 4NX5A 4TR9A 4A21A 4ZFMA 4M1BA 3PZQA 5G4HC 4GYKA 2JALA 4ERGA 3VKAA 3T1GA 2NXGA 1S46A 4LXFA 5K9XA 1CDGA 4M6PA 1EJSC 1UROA 1VFMA 2F9RA 2XH7A 3TLQA 1C8YA 1EP3A 3A12A 3IIZA 3OZMA 2OSXA 4LUTA 3ES8A 3GAKA 1DWAM 2VEFA 3FAWA 2OFJA 2BNJA 4YTUA 2P10A 4OOUA 4N02A 1BKHA 1OFPA 3OG3A 1R3WA 2ZUUA 4H1ZA 5D2YA 4ATDA 1O6IA 3AMDA 5AECA 1EP1A 4H6EA 4LS2A 2X40A 3H21A 4U2ZA 1E40A 2PLJA 5CJMA 1BTMA 2VR2A 2RGLA 4DLMA 4BQ3A 3VD3A 2ACRA 1PUDA 3ARRA 4IT1A 3W7NA 3MI6A 2ZRWA 5LIYX 3IJ8A 3FX4A 3PPHA 2OZ8A 1FWTA 4K3ZA 1OC5A 3CEUA 1BWKA 4LUSB 1XV8A 4GIEA 4BZYA 4D6DA 1XW8A 1GPFA 1EKOA 1XFBA 4HBKA 4R34A 4KMQA 1W1ZA 3RPMA 5A6TC 2PMQA 2EKCA 3WEMA 2WQDA 3PBMA 2VOMA 1H41A 2DP3A 4QE1A 1E0VA 1B3ZA 1WX0A 3ABSA 4N42A 4HSNA 5MKGA 1F3WA 4G7EB 3IWPA 1NF7A 4UFKA 4ZODA 2MANA 2O4QA 3C2OA 3PZTA 4H7ZA 1IGSA 1D7KA 3NL5A 3G1AA 2B7NA 1KRMA 2XVKA 2V82A 3VOGA 3KW3A 3T0DA 2QCDB 4S3EA 1SO4A 3NYZA 1XGZA 5G5IA 1YDNA 1VJZA 3IK4A 4HNVA 4EK7A 1C7TA 1ZS2A 4NY2A 3ELFA 1KCXA 2AQVA 2E0PA 4YYFA 2E8ZA 3EA1A 3NQVA 2J7CA 4EPKA 2EXOA 4HNLA 1KBLA 2H9AA 1DQUA 1TPEA 5CSUA 3UR5A 3MTWA 4IXXA 1VJIA 2XFRA 3EX6A 3P81A 3TR9A 1M5WA 4H9ZA 2QCGA 3N3TA 4AYSA 2QW5A 2XN1A 2PTZA 4CNTA 1Y5VA 3S5ZA 4G5DA 3WH7A 3LERA 1Q6EA 4PBEA 3WLOA 1W5MA 4HB7A 4QX4A 4HPGA 1QNVA 3PTMA 5EBUA 4HHHA 5C9ZA 3QLDA 2F6UA 4GG9A 3KEHA 4V15A 3STPA 1MO0A 1NFPA 3O1NA 2X0YA 3KHJA 5BRBA 1UR3M 3RX4A 3NXFA 3LDVA 3VNJA 5A8PA 2WNNA 3VDHA 1MW3A 4FXRA 1QPRA 1U22A 3SCUA 4NILA 3QY7A 3ZXWA 2WNWA 4UTFA 2PDXA 3T0CA 3VU2A 4DPQA 1VEOA 3TQPA 3TOPA 2CZEA 4KEZA 1M7JA