1GCYA

High resolution crystal structure of maltotetraose-forming exo-amylase
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
415
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallization and structural analysis of intact maltotetraose-forming exo-amylase from Pseudomonas stutzeri.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords GLUCAN 1,4-ALPHA-MALTOTETRAHYDROLASE
total genus 145
structure length 415
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 2000-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gcyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gcyA01
1Q6FA 8CGTA 1GOWA 1R75A 3LMYA 3RDKA 3N17A 1DP0A 4W8BA 4S3KA 2WMJA 3A3HA 1WB0A 2DIEA 1NP2A 1XCWA 4J3TA 1OGBA 5D8WA 2BXZA 2DH2A 4KMQA 4F8XA 3WIJA 2XJ7A 2PI6A 2PWDA 3OLGA 4HOWA 4X0NA 4OBSA 2VCAA 4UOZA 2BY2A 4PMOA 1PAMA 4PN2A 3VD9A 3GXFA 1CZ1A 1Z32X 1GPFA 1HJUA 1KFWA 1ISWA 2ZWYA 3GXIA 4CCEA 1HKMA 4IUGA 2WBGA 5JUVA 3D51A 1TUXA 1JYNA 1B3ZA 2TAAA 4AZBA 2WCSA 1JZ5A 4LYRA 5CPTA 1QHOA 1HJVA 2QF8A 3CZGA 2V38A 1GVYA 3W29A 2W66A 2VR5A 2G41A 3DDGA 3D50A 1J0YA 3UG5A 1W9XA 1KGWA 1DTUA 4AIEA 3SCPA 3A6OA 1W2VA 4QDMA 1HT6A 4CN4A 1FH9A 3K8MA 1JZ8A 1KCKA 5AYIA 1J0ZA 4P7RA 4PTMA 4M81A 3GDBA 1EA9C 3DX2A 5AC4A 2UY4A 2A3EA 5A8NA 3WF2A 3POHA 3ZR6A 1UOKA 3CHCA 4XX6A 3SIMA 5BXRA 2WW5A 1V6XA 2BY1A 1W1TA 3BAYA 3CHEA 1VF8A 4OGZA 4PEEA 3NSNA 2YL5A 2J25A 1JD9A 4JAWA 3ARQA 4ACZB 1QBBA 4M80A 2G4FA 3RJXA 4JKKA 1H3GA 2QMJA 3N18A 5BRPA 1CPUA 2PBOA 2XN1A 1GOQA 3CO4A 4AZIA 1V3MA 4DO5A 3WDQA 4PMYA 3WMBA 4CD5A 2YLAA 4PSPA 1MW1A 1CTNA 4YN5A 1UR2A 2B31A 3WN6A 3QOMA 2ZUUA 2XVNA 4D72A 1H49A 3ZQ9A 1SZNA 2CHNA 4TXEA 3K8KA 4HPGA 3ZT5A 5FL0A 3BUBA 2VURA 4LYPA 4MNJA 1TQSA 4E4PA 3HG3A 1UR4A 1UKSA 3MUIA 2X09A 1QHZA 4A4AA 1G94A 4WLCA 5ABFB 3AIBA 3CUGA 4HA3A 3EBVA 1R7OA 1V6YA 1XYFA 3AMLA 3LRMA 3W4RA 1JYVA 2D3LA 4R5EA 1JG9A 3IGUA 2E4TA 2VVSA 1AQHA 5I77A 2VJXA 3T0AA 2VNCA 3LX9A 4HA1A 1EQPA 1L8NA 4DM2A 3VIJA 2RGMA 2OW6A 4FLOA 3UERA 3GXPA 4GO8A 2D23A 2X8RA 4HMDA 5CQ1A 2DH3A 1X6LA 3CZNA 1QNPA 5HPOA 1SMDA 2CESA 2NSXA 1UD5A 2W92A 1LLOA 3IANA 3VNZA 3VDHA 3VIGA 3ALFA 3WQWA 1PZ3A 4UQBA 4W8AA 3W25A 3WBAA 3CPUA 1QI2A 3CC1A 3L4UA 2YBUA 1VRXA 2ZUSA 3AMDA 1UD8A 1LQ0A 1JZ2A 2X2IA 3NYDA 5I3DA 2BFGA 3BSHA 4ACZA 1C7SA 1TFVA 2ZUVA 4FLQA 3DYOA 4NRRA 2GJPA 4GI9A 1JDCA 4MJ4A 4Z2GA 2ESCA 4PYSA 3W26A 3WDJA 3ZMRA 1B3YA 1OB0A 3CZJA 3OBAA 3G6LA 4MNMA 4HOZA 1TQTA 4AD3A 2OYMA 3T2OA 2W67A 2OLHA 2DSKA 2V5DA 4AD1A 3RJYA 2IXVA 2D0FA 3VGFA 1KTBA 5A1AA 1LG2A 3WDPP 1QI3A 2J47A 5DFAA 5C70A 3WUGA 3B8SA 1Y7VA 1UKPA 1E6ZA 3DHPA 2BHUA 4MTVA 1HX0A 3THCA 3WH6A 4HZ8A 3AHVA 4HMEA 1ISVA 1LF1A 1MXGA 4NRSA 3WFLA 1FH8A 1E0WA 5DO8A 4HZ6A 2J78A 4FNUA 4PMZA 4PMNA 3W37A 1A3HA 4KWUA 1JI2A 1BGAA 2DT3A 2CBIA 3WY4A 3AYSA 3QHNA 1CGXA 2YLLA 1O7DC 3BLKA 1E6PA 1VAHA 1HL9A 1PIFA 1UYQA 1QNOA 2E8ZA 1CECA 2JF6A 5HBFA 3SCUA 3WEZA 5TD4A 3VIKA 3VO0A 2WLYA 4IPLA 4OOZA 4LQ1A 4Z2LA 2XM2A 4J3VA 3BAKA 4A3YA 1KXQA 3A21A 3EDKA 5I23A 5A6JA 3RCNA 2VCBA 2ZIDA 4MADA 4W93A 4N42A 4D1IA 1LL4A 4AEEA 4K68A 4KRUA 2ZX5A 7A3HA 4OBRA 3SCVA 4CVUA 2VR4A 1G9HA 1PS3A 3CLWA 4HPHA 1EO5A 2F7PA 2W63A 5CJ5A 3A4XA 4NXKA 5A8QA 2CHOA 3ARVA 1NQ6A 5A6LA 1XV8A 1Q6CA 1JL8A 2WHKA 3ARXA 3H53A 4FNSA 2E9LA 3VGGA 2WWCA 3WD0A 1PX4A 4UFJA 2Z1SA 3UR8A 1J0IA 1X6NA 1K9DA 4ACYA 4U5IA 4WSJA 3CHDA 3RM8A 3VGHA 1W9DM 1J0HA 3BUQA 1H5VA 2G3NA 3DX0A 2XGBA 3AIVA 4RE2A 3SUSA 1XC6A 1GVIA 3WD4A 4AZCB 4DM1A 1WNOA 1DWFM 3DX4A 1HP5A 1GQJA 1VEOA 2GJXB 1KXVA 1UWSA 3GNOA 1UH2A 2F8QA 1JZ3A 1BHGA 1GQLA 2BHZA 2ZICA 3EMCA 5CG0A 4W7UA 2ZXBA 2WKGA 1G01A 3W82A 1D3CA 5ABEA 4ML4A 1E72M 2F7QA 4QLJA 4U31A 1J18A 5A95A 3PBGA 3TV8A 2VQTA 3CUHA 3AZRA 1GCYA 4NI3A 3A47A 1TE1A 2ZX7A 1VEPA 4B3KA 3MO4A 1PX8A 1JF6A 4H8HA 3LPOA 2WZIA 4D6DA 4YHEA 2VX7A 3OGVA 2WNWA 4U2YA 4AZ5A 1E6QM 3WD1A 3QGVA 1EOMA 3FAWA 4ZE4A 3VD4A 3ZJ8A 4P7LA 1O7AA 2XTKA 5FKYA 5CPQA 2F1BA 5HOSA 4XZBA 5C71A 4BA0A 3DECA 1QVBA 1BSIA 1UWIA 3GNPA 3GM8A 2GK1A 1E9LA 1MYRA 2J79A 4CCDA 1BYDA 1OWQA 2UY5A 2WKLA 5E0FA 3WUFA 3K46A 1DWGM 4GQQA 1W91A 3N9KA 1UD6A 4P8VA 2OYLA 2WANA 3FN9A 1VB9A 1HKJA 4JKMA 3AHYA 3VILA 4DWSC 4HTYA 3PTKA 4D6FA 4H2CA 1FP8A 2ZX9A 2E40A 3M6DA 5ECUA 4M82A 2IGTA 2F1AA 7CGTA 2JIWA 3OA5A 1V3LA 5C8BB 4F79A 2ZXDA 5HDRA 3BVTA 1E1EA 1VFMA 1VEMA 2O9PA 1K6AA 3F5KA 2DPEA 3LPGA 4FNRA 1W9VA 2E3ZA 3RILA 4MDPA 1UH4A 1GJWA 2D20A 1X1NA 1IV8A 1C8XA 1GHSA 2VZOA 3T0DA 1UZ1A 2DIJA 5A6AA 1JI1A 2A3AA 3K4AA 3SEPA 2D3NA 1E70M 2CBJA 1EGZA 4C7DA 3VIOA 4TVDA 3UEQA 1JZ4A 3M46A 1XSIA 1HL8A 3S5YA 3WNOA 1TVNA 2VCCA 3UG4A 3ZOAA 4GZEA 4M29A 3GH5A 3AROA 5EB8A 4CN1A 2PWHA 3VDBA 5BXSA 1V3IA 3WH5A 3U57A 3NCOA 2X2YA 5BROA 1FA2A 5I2UA 1TR1A 4RE3A 4BQ3A 1MW0A 1H0GA 3S5ZA 3D4YA 1E6NA 1F4AA 2VTFA 2XG9A 1LL7A 3PZUA 3VD5A 1BYBA 2PWFA 2VUYA 2VZTA 1UZ4A 4OUEA 3GBDA 3SCSA 4YPJA 3CGTA 5DF0A 2XHYA 3WD3A 1NP0A 2EACA 3WELA 3VX0A 3DX3A 3CH9A 1GOIA 1WDSA 4MJ2A 4ATDA 1UD3A 4UQAA 3N1AA 3GZAA 4AISA 4HU8A 1E5NA 2J8FA 1K9TA 3TTYA 1ISXA 4KGJA 1JNDA 5JIWA 1E6SM 3MS8A 5FIPA 4BCEA 1ZB5A 1V6UA 5D4YA 2CCRA 4Q22A 3WDHA 1HF6A 1Q6EA 2NW0A 3ARZA 1BF2A 1J11A 2XIIA 3ARRA 2CPUA 5F7UA 4PUDA 3WY2A 1GOKA 1XRVA 5JIPA 1OGGA 4CU8A 2VVNA 1C8YA 4TTGA 1GNXA 3MSGA 4Q7NA 1EIBA 1C92A 1OBAA 1O6IA 5A8OA 1V0NA 4Z2JA 4N0RA 3THDA 3SURA 1WAWA 3NSMA 3VSTA 2FDMA 4IISA 5A94A 3S2CA 3BGAA 1QOXA 2G3MA 1GOOA 2F7RA 3AHTA 4S3JA 1PBGA 5M5DA 5GNXA 4UQCA 2XUCA 1B90A 1OSEA 1XSJA 1FFRA 4ZENA 4NXSA 4FK9A 1UWQA 1QHPA 4Z2KA 1W3LA 4J3UA 3FY1A 3PTQA 2Y4SA 3T09A 4U2ZA 3A24A 4PMUA 3II1A 3AHXA 3AHZA 1T0OA 1G5AA 1HIZA 5IHRA 4DO4A 1FHLA 1CGTA 3CZSA 1OIMA 2CYGA 3BH4A 1V08A 3U7BA 1M04A 1D2KA 4NZJA 2EPNA 2XFYA 3O6AA 1CEOA 5DMYA 1CGYA 3BAJA 2ZX6A 3SUUA 2XVLA 3W53A 2ZUTA 3W27A 4UFIA 1CBGA 1NOUA 1UD2A 4HU0A 5BRQA 4AC1X 1DWIM 1KXTA 1HKKA 4F9JA 4ZEPA 4AZ6A 3AIWA 4GI8A 4JL1A 3KZSA 4D6CA 3ZM8A 4DUWA 2VQUA 1JIBA 3SCQA 3WQ6A 1QX1A 1UR9A 2YL6A 4TUFA 1WDPA 1TVPA 4DUVA 3KWXA 3M07A 4UNIA 4W85A 2OWWA 1BAGA 3ZSSA 4URIA 4W86A 4M56A 4ATWA 2G3JA 4CU6A 1U33A 1KB3A 2EPMX 1AVAA 4MNLA 3AS3A 3BVUA 2ZE0A 4E8DA 4UOJA 5HPCA 4NZCA 1MFVA 3SCNA 3LXAA 2EEXA 1LWHA 3G6MA 1IZKA 1ISZA 2WSPA 3BCFA 3BLPX 3UESA 1IT0A 1C91A 4B16A 3AI0A 3WDIA 3RM9A 3WF4A 1KR1A 3RO8A 3HG2A 1EHNA 4MB1A 1RH9A 1B1YA 4UTFA 1J9YA 1KWGA 1E3ZA 1JF5A 3WQ5A 1V02E 1QI0A 3PZ9A 1FH7A 3ZJ7A 2QPSA 3WY3A 2BV9A 1I1XA 3NSXA 4TX6A 4UZSA 4CGTA 2V3EA 1VIWA 1TQVA 4W5UA 2OSXA 3CZKA 2ZUWA 2PWGA 4AIUA 1R86A 3WNPA 2DQXA 1IZJA 2CITA 1C90A 3L4ZA 1SMAA 4AW7A 1WKYA 4M8UA 4PBGA 4PCSA 3A22A 1W9PA 2OWXA 5BXTA 4J28A 1L0PA 1E40A 5JBDA 5CGTA 4QFUA 3VM5A 4MAVA 3WDRA 1UKTA 4PSRA 1V0KA 1R7AA 2J8GA 2OW7A 1H41A 3VMPA 4BF7A 1AQ0A 5EMYA 2PWEA 2WVTA 3PZIA 2ALWA 2VC9A 4DO6A 4JKLA 2GFTA 1PEZA 2A3HA 5CSYA 1XCXA 2O9TA 2JALA 2FH8A 1LWJA 4U33A 3WNKA 3VIIA 2GSJA 1C7TA 4ATLA 4TTUA 5A2BA 5I0DA 3WH9A 3SCTA 3VVGA 2VT0A 3FNDA 3ZJKA 3H54A 3A4WA 3SCOA 1EDGA 2AAAA 1GUVA 4AZHA 2WM0A 3GBEA 4X9YA 1MQQA 2W61A 3OLDA 1CLXA 1WDRA 4U5KA 3EJUA 5JBFA 1JDAA 3BUPA 1ZBWA 3K8LA 5D9MA 4BQ2A 2D0GA 4ZE5A 3GTNA 2WLZA 4AZGA 3WF1A 1EXPA 1WZMA 3MMDA 1CXKA 2WB5A 3KLKA 4B9YA 1OD8A 3B9AA 1WE5A 3FW6A 1QW9A 2VRKA 6A3HA 1HJXA 3EJRA 2E9MA 1JDDA 4AMXA 2ZOXA 4EK7A 3A5VA 2PBGA 3VOCA 4GI6A 4C7GA 2QHAA 1Q6GA 2D1ZA 1CXLA 1U2YA 4P8WA 3AMKA 1CXFA 5A6MA 1UR1A 4CKQA 2PC8A 3OGRA 1GHRA 4QAWA 3EDDA 1BG4A 3VTRA 3QHMA 2VX6A 1XH1A 3OLIA 3K1DA 4QLKA 3VDAA 5CPSA 2ZXQA 3BC9A 3MMUA 1DWHM 2CETA 1OCQA 2WWDA 2DT2A 1AQMA 1NWUA 3AXHA 4TX8A 4NX0A 1F4HA 2CNCA 1YQ2A 2E8YA 3CIVA 4XUYA 4LPCA 2XWDA 1W3JA 3WSUA 4AXNA 1QW8A 1UA7A 1E55A 5BXPA 3MU7A 3K4DA 1W32A 4H04A 4L4PA 3VSUA 3HG4A 3WMSA 3WKZA 3LXBA 1J01A 3QOKA 5DT7A 3L4XA 3UETA 4F66A 4AZ7A 2FHFA 4NZFA 3WNNA 1VJSA 2DSVA 1SFSA 4OKDA 2X2HA 3TTOA 5EBAA 4MB3A 1CGWA 1CYGA 2A3CA 1HKIA 2V5CA 1TZ7A 5FD0A 1V6VA 1XD1A 4UZUA 4QP0A 2WMIB 3EJPA 4D71A 2XSBA 4JCLA 1JFXA 5LYRA 2WXDM 2YKKA 1CXIA 2XN0A 3MV11 4FLRA 9CGTA 3I3DA 3PZMA 4FMVA 4OOUA 1JXJA 2CXGA 4P8XA 2ZXAA 1UWUA 5LA1A 4U3CA 2WMHA 1ZBVA 1ZBCA 1QI5A 1QNQA 2FE0A 1TA3B 4QLLA 1JZ6A 4CD8A 4C7FA 1Q6DA 2VRJA 1JNEA 3WEMA 1UKOA 1W1YA 3SCWA 3W6LA 3UR7A 5ABHA 4NSBA 3VINA 2GDVA 7TAAA 3ARUA 4XB3A 1BQCA 2NT1A 1FP9A 2FHCA 2ZUNA 4W7WA 4EE9A 1CGUA 2BHYA 5CZKA 1CIUA 1QWUA 3AXIA 4FNQA 2VX4A 4F9DA 3WEOA 5A6BD 3EMZA 2QV4A 5AC5A 2X05A 4Y7EA 4FNTA 2YOCA 1G0CA 4FNPA 4CD6A 3IJ7A 2BNJA 2FGZA 3T0BA 3ZSTA 5E9AA 4AEFA 1M01A 1E0XA 2VI0A 5I6SA 2GK1B 3WQVA 4AD2A 1V0MA 1HJWA 4D6GA 1PZ2A 3QR3A 2E9BA 3EDFA 3TONA 4X0VA 3LRLA 4CN6A 4JHOA 1H09A 1K9EA 4AD5A 3VUPA 8A3HA 2F2HA 3ZR5A 2JIEA 1SYTA 1P6WA 2WZEA 3VGEA 4V2XA 2W91A 1ODZA 3VSVA 1JD7A 4MNKA 4EANA 2BVTA 2Z1KA 1M7XA 3KL3A 6CGTA 4WJXA 3BUDA 3ZIZA 3HG5A 3DX1A 1QWNA 1US3A 3N11A 2V3FA 4W88A 4HA4A 3L2LA 4A3HA 3LXCA 3AICA 5GNYA 2DEPA 1MW2A 5A6KA 2YFOA 5I78A 1UR8A 2VMFA 3WL1A 1EO7A 4GIAA 1ZBKA 1W9UA 4W5ZA 1PIGA 4V28A 1E6RA 3L4VA 4KH2A 3IAPA 1NM9A 5CGMA 2J7FA 1UKQA 3GXMA 2CEQA 4PUEA 2YL8A 4LX4A 1KCLA 2VZSA 5LA2A 1TQUA 4J27A 1E5JA 3D52A 3ARSA 3B9EA 2DDXA 1TMQA 3ZT6A 2BY3A 4JFTA 1GOMA 3L4YA 1KBKA 3AYRA 1I75A 2RGLA 3VM7A 4UQ9A 4TVCA 3DYMA 1ODUA 3IJ8A 3GH7A 1XD0A 5EFDA 1XHGA 3W24A 1R33A 3CUIA 1E43A 3EJSA 2XWEA 3WF3A 2XFFA 2WCAA 5A6BA 3WNLA 1KWKA 1GJUA 1MWOA 1KQZA 1W1PA 4W8LA 3ECQA 2WCGA 1ZL1A 2XGIA 4UCFA 3GNRA 5GPRA 3RM4A 2E0PA 3AS2A 1K9FA 2G8ZA 4MPKA 1NWSA 5GNZA 4KGLA 5M17A 1MXDA 3J7HA 1UQYA 3OIHA 4MB4A 3F4VA 1WP6A 1CXEA 4JL2A 4UQDA 1NWRA 1JYWA 1R87A 3UCQA 2DSUA 3N04A 1HTYA 2WVUA 3BAWA 4PMDA 2WBKA 1PPIA 4D1JA 3ARYA 2WPGA 5FOOA 3LPFA 4AY1A 4J7RA 3T2PA 4E8CA 3HN3A 2J75A 3NJ3A 5ABGA 2XIBA 6TAAA 4PTXA 4D6IA 1B3XA 2XSAA 4R27A 2W62A 1HXKA 3CBWA 3EJTA 2AOSA 5KEZA 1ECEA 4JFWA 4PMXA 4LXFA 2D24A 3NDYA 1HP4A 4B15A 2FH6A 1ZJBA 1ITCA 2WC4A 3VX1A 3IK2A 1HVXA 4MDOA 4D6JA 1E4IA 1DEDA 3PZOA 2F7OA 3WNMA 2BVYA 2QPUA 1EHAA 1FFQA 2X2JA 3W0KA 5FL1A 1PJ9A 1B0IA 2WZHA 3VIFA 4JFSA 1GONA 5E6ZA 2VRQA 1JGIA 2CERA 3O2LA 4DWSA 2XFRA 2F61A 1UWRA 1R46A 1OGSA 1HNYA 1I1WA 3KE0A 3VGDA 1NARA 4CD4A 4HMCA 1H4PA 1E4LA 5A2CA 3F5LA 1BGGA 2VOTA 1V3JA 2GJXA 3LPPA 2WC3A 2CKRA 2Y2WA 5E1QA 3SCRA 4TVUA 1BYCA 1VBRA 5D9OA 3AXXA 1CENA 4PCTA 3ZJ6A 1MQPA 3WMCA 4YHGA 4W84A 5AYBA 2JF7A 4JFVA 2HVMA 5BYWA 3W38A 2D0HA 1JFHA 1B3VA 2G3IA 2O9OA 1ISYA 5FCZA 2O9RA 3TP4A 4GO9A 5IDIA 2J7CA 3DYPA 1CNVA 4AZCA 3VMNA 3EMQA 3EJQA 3OZOA 1KBBA 2Y5EA 2J7EA 4H8VA 1US2A 2WAGA 2VZUA 2WHMA 3L4WA 5E0CA 3WBEA 5HXMA 4EKJA 2D22A 3CZEA 2XPKA 3ZT7A 1J10A 2A3BA 3QHOA 2EADA 2QLYA 5GQBA 3W81A 3D5HA 2Q8XA 4EAMA 5DT5A 3AIQA 1CWYA 1VFFA 1QI4A 5I24A 5CLTA 1NOFA 5EFFA 5IFPA 3SUWA 3HJEA 2OSYA 2DT0A 3WY1A 2BXYA 3BVXA 1W3KA 3CUJA 1WZAA 1W2PA 4LYQA 2QMKA 1JAEA 4JHZA 2W5FA 3AFBA 3AZSA 1WO2A 1HJSA 2WC7A 3AS1A 2WVSA 1SR0A 2YDSA 4ZXOA 2FYVA 1NWTA 2C0HA 5A3HA 4Z2HA 1S46A 1BG9A 3DHUA 2JFEX 1OD0A 2GDUA 1E15A 1UG6A 4JZ5A 2VX5A 2JE8A 1JAKA 3W6MA 2V3GA 4JIEA 2EPLX 3FHAA 1MFUA 1KR0A 1LJYA 2OYKA 4JFUA 1TQWA 4IPNB 4WKAA 1QNRA 2WHLA 2WVVB 3APGA 2EQDA 1NH6A 3DC0A 3IAQA 1HVQA 2CBUA 3VMOA 4E2OA 1PX3A 4CD7A 3U7VA 3N12A 3GH4A 3WD2A 1UUQA 2J62A 3GXDA 1LG1A 1G1YA 1UA3A 3AZTA 4ZXLA 1B31A 1V0LA 1TG7A 2C7FA 1KGUA 1ZS2A 2MANA 1B9ZA 2BS9A 4TOQA 3OLEA 1BYAA 3WF0A 3VDCA 4JCMA 1BLIA 1H2JA 4BQ4A 3TTSA 4FF5A 3SUTA 4WKFA 2D73A 1V6WA 2CBVA 1OINA 1DWJM 2WHJA 1E1FA 3S6TA 1B2YA 1JZ7A 2XN2A 4NF7A 2XVKA 3BAIA 5I79A 2CKSA 3WUEA 2YL9A 3IJ9A 3VPLA 1BFNA 4OIFA 1KTCA 4BZYA 1V3HA 2VZVA 3WH8A 3AIUA 1DHKA 1QNSA 1E4NA 5I5RA 3D4ZA 5CLWA 1VBUA 4CVWA 3A4AA 3FHQA 4PRWA 3VD3A 1W3HA 1V03A 4AMWA 3OZPA 2J7GA 1C8QA 3AMGA 3EDJA 5A8PA 2VL4A 3NIYA 4D6HA 4J3WA 2NT0A 2YA1A 1R8LA 1BTCA 2CIPA 1MW3A 3AJ7A 1VFOA 1OM0A 5HNNA 1WPCA 4GXPA 3PZVA 1MQRA 1UQZA 2IUZA 2PB1A 3T08A 4GQRA 3U5UA 2GUYA 1D7FA 1E6XM 1EOKA 2YBTA 4UOQA 3CMGA 4AMCA 3CTTA 4XZWA 4CU7A 2WVVA 4V27A 1UR0A 4LGXA 4P8UA 1EDQA 4MAZA 2J7DA 4UFKA 2X0YA 1OT1A 3W28A 5IXEA 1C3FA 3MMWA 1UD4A 1VFUA 4DWSB 2YDRA 3MKKA 2J7BA 4UFMA 3I3EA 2Y24A 3AIEA 3BVWA 1W9BM 5E70A 1V02A 4PMVA 3WQ4A 1RD6A 2EXOA 2F18A 3DDFA 5D9PA 1YHTA 2BVDA 3MANA 1FOBA 2YIHA 3BVVA 2EABA 3CZ8A 1CDGA 2WMKA 5E6YA 4BQ5A 1U30A 3ARTA 3T2QA 2WYSA 1Q4NX 3ALGA 4M24A 3WH7A 1WZKA 3L2MA 3GYCA 4GZIA 4U3AA 4B3LA 1E4MM 1EDTA 2YDQA 1GORA 1J12A 5IHSA 4WSKA 4AYGA 2YA2A 1KXHA 3CZLA 4P7NA 2VO5A 2HISA 2ZX8A 1N82A 2V3DA 1OIFA 4L4OA 3VD7A 2EJ1A 1FHDA 3F5JA 2WMIA 3WFZA 3WUBA 3AIRA 4AD4A 1HWWA 1B30A 3D3AA 4WIWA 2XVGA 1H0IA 4GZJA 1RP8A 1XH2A 3VIPA 3TOPA 3POCA 4XV0A 4RE4A 4H7VA 3PHAA 4GKLA 2FGLA 2ZWZA 3EDEA 1GW1A 1QBAA 2WSKA 1LL6A 1VJZA 3FAXA 3L4TA 3KL5A 4UFLA 3VNYA 3AS0A 2J4GA 4AWEA 1WDQA 1GZJA 4QCFA 5A8MA 5IFTA 4GINA 3AISA 4AD0A 1V3KA 2WK2A 3GXTA 1GQIA 4PMRA 1JYXA 2YA0A 1JXKA 1CGVA 1J0KA 3BMVA 1RP9A 1CLVA 5CXPA 1XYZA 3AOFA 3NDZA 3VU2A 4GPNA 2PF0A 1UWTA 2EO7A 3KLLA 1H1NA 4RL3A 5A69A 4QCEA 3AQUA 3PTMA 1E73M 3VIMA 3BUIA 1QPKA 1UH3A 3RIKA 4PTWA 5M03A 3VGBA 4WKHA 4W89A 2JEQA 3N13A 3RPMA 4AYSA 3VIHA 3VKKA 4OJYA 3SUVA 1AMYA 2X1IA 2J7HA 5AY7A 5A6SA 1TA3A 5M3WA 2DSZA 4W87A 2WMGA 4D6EA 3LRKA 3HMCA 3I3BA 5LA0A 3TTQA 4H8UA 3N15A 3CMJA 1VENA 1UHVA 1WZLA 1KGXA 3MI6A 4AIOA 2YFNA 1H11A 3UG3A 4P7OA 1HXJA 2DSWA 4UFHA 5DEZA 3BSGA 3CUFA 3OGSA 3M7SA 1ZU8A 1WCGA 2GVYA 3H55A 1TCMA 2WMFA 2EPKX 2J74A 1R85A 1E71M 1HN1A 2EPOA 4KRTA 2EBNA 4PTVA 2GJRA 1C93A 2ZUMA 2XM1A 1BVZA 2W4XA 3WL0A 3EYPA 3PZQA 4UQEA 2DGAA 3BAXA 4UR9A 3PZNA 3ZO9A 2J77A 2EAEA 3PZGA 3PN8A 3PZTA 4W7VA 1M53A 3ARPA 1CXHA 1EQCA 3BMWA 1XGZA 2Y8VA 1BPLB 5KZ6A 4P7QA 4B9ZA 2OWCA 4ZFMA 1UASA 3KL0A 2X0HA 2JEPA 3OB8A 1R34A 3CHFA 3B9DA 4DWSD 3NUKA 2Y8KA 3OG2A 4WK9A 4M1RA 1OT2A 4HP5A 2D2OA 3RMEA 1GQKA 5CSUA 1ZJAA 2FHBA 1ESWA 1E0VA 1BVNP 3WQ8A 3FXYA 1A47A 2C8NA 3A23A 1W1VA 5E09A 5BCAA 3AMCA 3MSDA 4J3SA 4PMQA 3BXWA 2YJQA 2BY0A 2UY2A 2UWFA 3HZ3A 1M03A 3E1F1 2XVPA 1NOWA 1KQYA 3O9NA 5ABFA 1R47A 1XH0A 4Z2IA 5JBEA 3U5YA 4CCCA 2OSWA 2IXUA 5D9NA 4BS0A 3BCDA 2UY3A 5BWFA 4H41A 4FLSA 1DWAM 1HJQA 4DUXA 1B3WA 2XYLA 3MUZ1 3BLBA 2DT1A 3GXNA 1MVYA 4HZ7A 3TA9A 3WENA 1E56A 3MV01 4MB5A 1XSKA 2AMGA 4WF7A 1EH9A 1J0JA 2O92A 4J3XA 3CV5A 4IM4A 3MUY1 4HOXA 4CUCA 5A2AA 5D8ZA 1ITXA 1E3XA 3MUAA 4OZOA 1RPKA 3JUGA 3ARWA 3HU7A 3KEHA
chains in the Genus database with same CATH superfamily
3TN6A 4I1PA 3N2MA 1KENL 4L9LA 2H9AA 1Q6FA 3C2RA 4RLIA 2GUBA 1PB0A 2CDGB 5EU7C 3BLDA 1X5AA 1I9JH 3RDKA 2ZWNA 1EWEA 1VS1A 4AZ8B 1JZEA 4X6DB 4GQ9H 1DP0A 4W8BA 4HETA 4F2UA 3T9WA 4M4RB 1H9VA 3AGWA 5DFWH 3GIYA 5F2FA 1GGIL 4IGSA 4A35A 1OFPA 3STEA 1QQDA 1W0VB 1KB9J 1D5MB 4XMTA 1BVWA 2R0WH 4NKDB 1XG3A 3BEWA 2GGIA 5J89A 2TRSA 1ICTA 1BQKA 3MNWB 4NP4L 1KLFB 5DRZA 5EU6E 4BH7B 1HE7A 4X7CC 3WIHH 5IESL 3V79C 4HB7A 2PWDA 2UVEA 3OLGA 3BW9B 4X0NA 3O3AA 4Y9BA 4HOWA 5KSUB 1IGWA 3N3TA 4PRHB 4EPEC 1FDZA 4YWSA 4UOZA 4FYRA 1IQWL 4PMOA 1PAMA 4PN2A 4J3OH 1XLMA 1Z32X 4MQTB 4LKCB 1HJUA 5JQ6L 3NQIA 4BZ2A 4IFKA 1UB3A 1MRFL 3GXIA 3TV3H 4GYJA 5C55A 5K2ZA 2YEVB 2IOMA 2PDHA 3V6BR 3RVWC 5LQBL 1FG9C 1EEZB 4IUGA 2BVOB 2ICEA 1IEAA 1JV2A 2B59B 4I8DA 5D4QA 1TUXA 1ZOXA 1GC1L 1MEXH 2JELH 2F8OA 4TVPD 5D72L 1B3ZA 2ITDB 4X5WB 4IP5A 4AZBA 1A6WL 2OL3B 2YD8A 2DVUA 5ANMB 1BD2A 4D3CH 4DB7A 3FA5A 4PA8A 4J8RB 2OMUA 4LYRA 1RJLA 4WI7A 4ZW5A 5E9NA 2QF8A 3QORB 3CZGA 2QVHA 3WUWB 3BQUA 4AKPA 5C0NC 5K9JH 3GF8A 2LABA 3CBKB 1NFDE 4HAGA 4TOYL 4W6WB 4XPGH 5F3FA 2ATPA 1DE5A 1RCQA 3DV4A 2W66A 3DDGA 3D50A 1WV2A 1KT2B 2FJHB 1GGUA 3K80A 3UG5A 2P4AB 5JW4M 2DQEL 4QJ3B 4ICWA 1F5WA 1E9OB 5C97A 3Q2NA 2OQJA 5E08H 5I09A 3LDBC 3K8MA 4WKZB 5DT1H 4X3ZA 1WCBA 4L8BA 4R3SB 3PPCA 5AYIA 1WUZA 5HI4C 3FCPA 1XUZA 5B21A 2QSCH 5C0CE 3GMNB 2PD5A 4M81A 4WOZA 1EA9C 1EYEA 3D2UB 4D0CB 4HJ1A 4NRZB 3NRFA 1LEIA 4P5RA 1YLVA 1Z9PA 2WTPA 2I5QA 4HXAH 3NQAA 4G7EB 3VFSB 4R9HA 3D3VE 3QKEA 1ZHKB 1XCFA 2BS8A 1X5XA 3PWPB 4FXGC 5B4MD 3KOZA 1R2RA 3N14A 1MAMH 1YNLH 2G4GA 5DEFB 4GA8A 4M5ZH 1M71A 1NEPA 1W8OA 2IADB 4HS3A 4XXWC 4XCFH 3LDBB 4ZFZA 3SKNB 4F27A 4JDTH 1JPHA 2AXJA 3U46B 5HHPB 3GR4A 1NEZA 5LNSA 4DW2H 1JNHA 2FYYA 4LB3A 2DBLL 4UBDC 5LCVH 3MACH 1TCRA 5JHBA 2BY1A 5ILTH 2OP4H 3MJYA 3BAYA 4XPAH 1VF8A 4OGZA 1ZP3A 5CSRA 3NSNA 3BQUD 2HYMA 3NL6A 2QW5A 1JD9A 2YGYA 4JAWA 1S8DB 1XLHA 1QBBA 5FJJA 4FXLA 5FFLA 3AXMA 1KV7A 1OTUD 4FQXC 4O1FA 4AC7C 3F7RA 1R3IH 4PP2A 5HDBB 1M5WA 4IZGA 3WQCA 2J5WA 4X6CB 2G4FA 2NY6B 4JGDA 4LU5H 2WQVA 3NACL 3L5XH 1EZ2A 2QMJA 4S0HA 3P77A 2WIIB 2IQ9H 3NZHH 2O4MA 2PBOA 5ESAA 4BWTA 2CBMA 3IVKA 1YE4A 2B4CL 1KCVL 2FEJA 3L12A 5EOQH 2RAGA 4TMBA 4KK6C 2XTJE 4DO5A 1AUSL 4P4RA 4AKQA 3W2UA 3WDQA 4F2TA 3P67A 3DV6B 1I7TA 1OXYA 2XZAL 5E99L 3TQPA 1YBQA 4DVBB 2HP4A 2AQ2A 5DMLA 2ADFL 1NCTA 3OGOE 2VKWA 5IVXB 2V37A 2XZCH 1UZDA 3GC3A 1NFAA 2NX1A 5BOPA 4ANKA 5DRZB 4BH7A 4YN5A 4R33A 1T89A 4QG8A 4BEUA 2ICWB 2PPCA 4N2CA 4B3VA 2N3JA 1BOGB 5HBBA 2Q2LA 2RJMA 3RX9A 1UBPC 1D5MA 4JFFD 2D4FA 4PJFF 4AG4H 1F0LA 2GSHA 2WJEA 3D6NA 3EAUA 5HY9B 1H49A 3C60A 4NNXA 2BIHA 2OQYA 3ZQ9A 2VR7A 3FU9A 3WTWA 1SZNA 2YGQA 1KB5H 3RZWA 3ARDD 1TXKA 4TXEA 3U2IA 3KDMA 3K8KA 4Y9EA 4HPGA 2AEPH 1N59A 3RLUA 5FL0A 1O6TA 3BUBA 2AJZB 1OK4A 3ITGA 4LYPA 2F53B 3W1MA 3O6CA 4KWSA 3TXAA 4CW1B 1MHPH 3HG3A 3KYKL 3V0WH 4XWOD 5HGHA 1FWBC 2FZ3A 1I0BA 5JH2A 3T2NH 4MCZB 1RZGB 2G9KA 2Y36L 4XD4A 2Y2YA 1QHZA 4QHNA 1RIVH 4TSCH 1TJPA 3K72A 3KZ8A 4K37A 3IF1A 4WLCA 2DZTA 4TMPA 3MRNB 1ZVNA 2DQMA 3MV9B 3AIBA 5D2LF 4AVIA 3CUGA 3MVSA 1CBJA 3QMSA 3HBZA 1J86A 3MA9L 1MZZA 3DX7B 3ISYA 1V6YA 4K3JL 3AMLA 3LKPB 3W4RA 1JYVA 1JPFA 1T6VN 5I19H 3E8VA 3QSKB 2NLYA 1MI5A 1WZ1L 1JG9A 2VIRB 3INUL 4GVFA 3M0IA 3STCA 1J2BA 4KQ4H 1GPOH 5ENLA 1G1CA 2I5YL 3IGUA 4NQCE 1I9JL 1SRDA 1UYWH 3TJPA 2VJXA 3L3JA 2VB5A 2XQYK 4ERIA 3MUUA 4NENB 4HXAL 4BY3A 1N3NA 1SVZA 2HVBA 3PL6A 9PCYA 1EQPA 3B9KC 5AKTA 1JCLA 1L8NA 4JDBA 2L3BA 3IN2A 4MWFB 2UBPC 3L0GA 3QC6X 3L21A 5GJMA 4WO0A 4LQFL 3ZKMD 2O6DA 2RGMA 3QI9A 1QFOA 3UERA 1JUFB 1G0DA 2ICWA 4JFPA 5G4NA 1GVRA 2PO6B 4P2QD 2FWLB 1XIIA 3BH9B 4GY7A 2COQA 1OD7A 3UA4A 1I7TB 5M7QA 1RMFH 5AW9B 5FEZA 4Y2DA 2GSGA 5C07E 3VNZA 5BOZG 2GYIA 2BWDA 3HNVH 4U6HA 4PBFA 2E1DA 5DLMH 4HEPA 3W25A 1DBML 3QR2A 2GL5A 1MKFA 3HI5L 4XBSA 5EO1A 5EMMA 1I1AB 1FNSH 1TV2A 2QPEB 3Q1EA 4N28A 3BWSA 4I5RA 4QGCA 5LDUA 4KDTA 1NAKL 2DWYA 2OMXB 4TNFA 5D38A 1XKYA 3SGEI 4Y9NA 2Z7YA 2ZQKA 1VBJA 5I3DA 2W27A 4Q7IA 1TFVA 3KVPA 3TN0D 4AITA 4GKNA 4B9KC 4DEUA 4QXUH 4R97B 5LG6A 4MJIE 2N0MA 2R1YB 1SJHA 3EO0B 4N68A 2XWJB 4OFYD 1LT7A 4BA8A 4HUWB 3W7LA 3OAWA 3ZMRA 3WDJA 3W26A 1NCOA 4MY8A 1TSIA 3S9YA 4MAYC 2OVLA 1CL7L 5ECGA 2Z1PA 3HLAB 3OBAA 3QIWA 1VFAA 4ZPTA 3EPMA 2HXUA 2DLFL 3TEXA 5FEPA 5H35A 1XCTB 1QFWH 4HCLA 1IL1B 4G1MA 2ISDA 2Z1BA 4NC1C 3S6CA 3SYCA 1FKWA 2APFA 1W5PA 1XGPB 4HWZA 3T2OA 2UXVA 4LASL 2OLHA 3N25A 1RV6X 3G6DL 1TWWA 2X6BA 1BVOA 4AD1A 3QDGB 2IXVA 2FFIA 2A9MH 5J12B 1MRCH 3DUSA 4L37B 2YPIA 1KTBA 3O9WD 4YDNA 3WLOA 2R4RH 4KTEL 1RUAH 1ZT1B 1ONEA 1FVDA 2D31B 1XKJA 4J2MA 4TQTA 3CVIH 5JXAL 3VRLF 4TUOB 5DFAA 3LQAH 1AGDB 4KKCC 3B8SA 5E4OA 4IGNA 1UKPA 3MA8A 4HGWB 2X87A 3OWRA 3TT1H 2W07B 4JDZA 4RMWA 3THCA 3W07A 1RIHH 4ABVA 1KLFA 3RXZA 4PRIB 1N0LA 5AKSA 1F41A 4HMEA 3QJAA 2YRPA 2YD7A 5DD5L 3IS0X 1ISVA 4L9LC 4M7ZC 4GUQA 3TNOA 3LB6D 2PE4A 2OZ0A 3TF7C 2ZA1A 1EJ7L 4BK9A 2GHZA 1A02N 2IALA 2VDKB 4NQXA 4OFKA 4A04A 3HMWL 1FH8A 1E0WA 3MI2A 2PW1B 3LKRB 3NIGB 1S2VA 4HZ6A 2PYEA 2J78A 1OB1A 1P7KA 4PMNA 2X1WL 2QIWA 2HN7A 4Y89A 3W2NA 4KMTL 4EF8A 3RF9A 2PMQA 3FTZA 1A3HA 4YYCA 1BGAA 3FCSB 2PDKA 3RTLA 4L9LB 4M7ZB 5C0BD 1KBLA 4FXJA 1E8XA 2O72A 4IEFB 1O1ZA 4YL9A 4UIKH 1B4KA 1XXDC 2EKGA 3QHZL 3UXIA 4LVGA 3AYSA 1CGXA 3UIZA 3JWDH 4GKSB 1A6TB 4GG6A 4FSAA 1F8TH 1O7DC 3EWZA 3V4PA 4LV4A 1TQBC 5LA2A 4O53A 2DIKA 1IKNC 3NSYA 1HL9A 4DP7X 1HHJA 3L5AA 2FJSA 2QDGA 1QNOA 4ERAA 1NGQL 2C1PB 3KGRA 4M6UA 1ZAIA 3TFKD 4KPLA 2DZEA 5TD4A 4KIEA 2EIDA 4WGKA 1KJMA 1AZ1A 2EZ0D 4QOKE 5D71L 2APVA 5D96B 2WLYA 2EDLA 5DMJB 4IPLA 3UPAA 3H2EA 4RPQA 4LQ1A 2I5IA 3TCTA 2V81A 3NSCA 1QFUH 5BRZE 5MP6L 2XM2A 4US5A 1BJ1J 1BWWA 4JTEA 3BAKA 4BM7A 3COOA 2NXGA 4GG6E 4KI5C 5E0QA 3P2TA 2WXOA 2Z64C 3IGKA 4XBPB 1F7BA 1MDLA 2QKSA 2ZIDA 1PYWA 3JTTA 4G8AC 2N1KA 4K68A 3CB8A 1KKOA 2PDFA 2IWEA 4JFDD 1Q9WB 1Z0NA 1F58L 3EEZA 4OBRA 4QHMB 2PTYA 1GZPA 4BE5A 4JK0D 5C0BA 2C19A 2NCMA 2RHEA 4Z7OF 2BSDA 2NWRA 5D7JB 1PS3A 1ZDSA 3CLWA 4XSLA 2VYOA 1EO5A 5IBUG 3ANYA 5C0CB 2IPGA 1KDJA 3MLXL 3LTVA 4JFYA 2B39A 4X8CA 5LBGA 5I19L 4LUTA 3ARVA 3FT4A 5SV3A 1F4WH 3GMPA 4PW4A 1CLKA 1NQ6A 4KQ4L 3O6DA 4IRZH 2BP0A 1A50A 1GEQA 3MRDB 2ZOWA 1X9QA 1NCGA 4KTGA 4KERA 4QHRA 1VYRA 4R7XA 5CSZB 2XKSA 3VGGA 2EXSA 2E9LA 4XXDA 2OX1A 4UFJA 1YEEH 1VKXA 4TMCA 1NFIB 3P74A 1L6YA 5L8JB 4MCYB 4K4KA 4FABH 2QFRA 1TNNA 1OE1A 1LRTA 3IIZA 4OV9A 3T9PA 4DHLA 4U5IA 1YMHB 2FL5A 4W9EC 3MAWA 4X4XB 4GXUN 4R88A 2DYPA 3BUQA 1W9DM 1FNGA 5EEUA 3IGSA 4W4OA 1OTSC 1VLIA 2OKOA 1E5CA 3DX0A 4RAUB 4O10A 1JE6A 3SUSA 3LTYA 4AMKL 3ZZQA 2K3HA 1E0OB 1G7HB 4XPHL 4PJIE 3UTTE 3DH7A 2UXFA 5D2NB 4PG2A 1WNOA 5BMWA 3V9FA 1HP5A 1KXVA 4M62L 1UWSA 2HT2C 4IP4A 1WAEA 1GOHA 2Z9TA 1JZ3A 1JXGA 4YCPA 1D5XA 1GQLA 1KJMB 2ZICA 2FAUA 2WKGA 1G01A 5LWYH 1D3CA 3FJLA 1E72M 1AO7B 2F7QA 1GPWA 2B9AA 1CD9B 2DZUA 4QLJA 2D9CA 1ZTXH 1J18A 3PL6C 4U31A 5KYWA 5H8PA 1FHGA 3PBGA 3EXRA 3WBXA 1HL4A 1B0RB 3WNJA 5J6HB 1A1OA 5EEWA 1WX0A 2E77A 2PP1A 2I14A 3NPSC 1VEPA 4B3KA 2L7EA 2EH7L 4LCWA 1YN7B 1KLGB 1BZOA 1NANI 4EOWL 1HKFA 5ICZA 1NMBL 4IEFA 3IFPB 1N8OE 4F20A 5C9ZA 3RNQA 4E3TA 1E27A 4YHEA 1S3HA 2VX7A 3WHE1 1BAFH 5GGTL 3F05A 3CQHA 4HWEH 2NX5E 1E6QM 3ZKXB 2XIOA 3N43F 5TNVA 1BZ8A 3FAWA 5EO9B 3ZYOA 4G70B 5DMGD 1ETZA 3EJYD 3FTSA 1PQZA 1O7AA 1TO3A 2XTKA 3BDXA 5CPQA 1XYMA 3B34A 4Z7WE 2FBRA 4JO2H 4LBAA 2MCAA 3ZDYB 4DTGL 2MNRA 5HOSA 2XT1B 4BV1A 3AABA 4HQQH 5LAXA 4QCEA 4F3FB 2H6OA 3ZUCA 5C71A 1JPDX 3TWYA 5I1HH 3D46A 1V8HA 3RI5K 3L1GA 1UWIA 3GNPA 3RAJL 1OKEA 4R7VA 3VE9A 3W70A 2OP4L 1E7VA 2OM5A 3EW3B 4YZWA 3SW6A 1OTUC 2DY2A 4OZHB 2PLTA 2PP7A 4ZPVA 3DOHA 5T33L 4Q58C 4X5PA 2OV0A 3C2AH 2UY5A 2WB1A 3K46A 1RA5A 2GAZA 4GQQA 1W91A 4DAGH 2XU2A 1UD6A 1N18A 4BWUA 4F24A 1IBHA 4ZUVB 3TYCA 1M6OB 4HGKC 2EYTA 4MWAB 2OYLA 4HWUA 2WANA 3TWBA 4LP5A 2IDCA 3QAZC 2R1WA 4MJ5B 4AC2A 1NDZA 3O6YX 1VB9A 2VH5H 3MOBL 3E0VA 2JKJA 2K78A 4HCGA 1GQNA 4QTHA 3F5WB 3L5XL 5G4HC 3FFCB 3NJXA 4KNSA 4PS4L 3FQRB 2R69H 4MA1C 4OD3L 4TM9A 3FVDA 5F44A 1S7UB 1EL3A 5MKGB 2ZNWA 3W0WA 3PJSB 3C87A 5D1QD 3DOPA 4PGDA 4JS3A 1FP8A 4YXLH 1M9SA 4O2FB 1PXGA 2IPTL 3JWOC 3M6DA 5EOTB 1V7YA 5ECUA 3DK0A 4M82A 3MRDA 3LJ3A 4OQTL 3CHPA 4DK5A 1KYUA 2JIWA 4G5ZH 3L2IA 2OFQA 3UCDA 5C8BB 1TQCB 1A5AA 4EDXA 2VD9A 3STZB 2WTOA 4GYPC 1WRFA 2FTWA 1D7BA 5AHIA 3UAFA 5I1DA 3KTXA 5I17B 1SEBA 2FQFA 2X4OA 4XAKD 4WOQA 1AGDA 3LPGA 1A1OB 2XGZA 2WV3A 3V35A 2F9RA 3QIWC 4ZQKB 4F9PA 4QRBA 1ZIBA 4NQSB 1M1BA 1JPST 1OF6A 2GQHA 3EF7A 2DP3A 3D1MC 4ZSTA 3TIDA 1I9EA 4YE0A 3M0YA 4LEXL 1BVLB 2CIIB 3SBPA 2D20A 2TSYA 5CILL 1Q9WA 3ZHKA 4LNRA 2YCIX 3QN3A 2VZOA 3QQXA 5MEPA 3T0DA 2EDOA 3B03A 1TFPA 3SODB 5AW5B 1T0NB 1IL1A 1NCCH 4G1MB 5FA3B 3N0AA 3ZTJH 5BQ7A 5HJDA 2AZAA 2YCEA 2D3VA 3GB7A 4FULA 3O6FA 3N3EA 5IB1A 1KFKA 1RVFL 2D3NA 2DMGA 1U9KA 2EDMA 1M7IA 1I7RA 2ED9A 3EYOA 3QQ9C 4QRRB 2CBJA 4TVDA 3UEQA 1BM3H 1VGKA 3ZPDA 3M46A 1JZ4A 3CSTA 3UVAA 4C6KA 1KYOK 5CJXA 3RFZB 5AC7A 1AD0A 5CEYB 4PJEB 5D1QB 4YXHH 2ZT9C 4FXTA 4KJWC 3RDTB 4BR1A 4DPAX 4XRCA 3ZOAA 1P7HL 2ZCZA 3A9IA 1MCEA 1NFIA 3SDYH 3VFNB 5SX4I 3T4AB 5FO8A 1RQHA 1DIKA 1BV8A 2X7WA 3M0VA 4CN1A 2PCFA 3I6KA 2L4OA 5KJRH 4ASTA 2BRQA 3KXFD 3P11H 1P6CA 1F73A 4Z7VF 5JPNA 1FCQA 3VDBA 1AGEA 3RVTD 3NO3A 1G7QB 1V3IA 1RCYA 3KVLA 2LGNA 4IIHA 5BXSA 1N7MH 3W85A 4L23A 4DBWA 2WQDA 2MQ3A 4GW5A 3VB9A 3TCSA 3R58A 5DZAA 2GSGB 3AUWB 5GHWH 4ZMQA 5LHDA 2CLHA 4I7ZC 4UT9H 2WP3O 1WBZA 3QQ3A 3W75A 4Y2OB 3DVNA 1SFHA 3U2EA 4TLTA 1KEML 5F7MC 3U7YH 5K9KA 4OZIE 3ZRSA 2C9VA 2PWFA 4YO0B 3VOJA 4MAYB 5C2GA 4MNQE 1S7QA 2VYRE 4XN5A 1UZ4A 5JIMA 1IC0A 1VZHA 2HJKB 2NX5D 4XAWH 3FYIB 4K0OA 2FJFA 3VFOB 1GY1A 2F9BT 4LAUA 5DF0A 3VXMA 5IJKC 2G60L 1OGTA 3WD3A 2NDFA 4N4YB 3HZKA 3R1GL 4QRRD 1XR9A 3U4KA 3QNXA 4BZ1A 4F7CB 2BGNE 2OX4A 3A4FA 4MMWA 4NAFB 4PHZA 1X96A 4Q89A 1JRHH 2H8XA 1E4JA 2EACA 1KTLA 4ZJ9A 1W3IA 5LZLA 4GRWF 2NTFB 3FTWA 4HCRH 4RCAA 3CH9A 4ODBD 1YX1A 4KEZA 4JO1H 4YTSA 4ICCX 3P2DA 1A5UA 1DL3A 4N6QA 4UQ3A 1LORA 1QOPA 4MJ2A 5CCKH 2C13A 3CV2A 1CF8H 2OKMA 5LGYA 4ZMPA 1DQIA 1DQDH 4POZD 2FSEA 3VTTA 4UUIA 3ORJA 3C2VA 1K9TA 9XIMA 3LKRA 1Z5HA 1XRTA 3IDYB 1ILUA 1ZVYA 2RGSA 2CGRH 3SGKA 3OYZA 5CPNA 3BKYH 1NLDH 1E6SM 3MS8A 5E03A 2NY2D 4S3FA 3HMXH 3KYKH 3GSNL 3Q5TA 2AJXL 4OCWL 3V0WL 2CALA 3VH8A 1V6UA 1ZB5A 2BX7A 3T4WA 1QUNA 1HF6A 1EJOL 2CA4A 1VD6A 3ARZA 4BSVB 3ARRA 1JR1A 5T3XH 4G9DB 3D4GA 2Z8SA 5F7UA 1EGVA 3C52A 3O06A 4PUDA 5I1AA 1J05A 1RSFA 4PGEA 3BT2H 4BCYA 1AH1A 3KWTA 4XN9A 4AUUA 3W7DA 4O51B 3GU9A 4JPIA 3KLHC 2X6MA 5CD3B 3T6QC 1A4CA 4HW6A 1JK9A 4KVCH 1ONQB 2EINB 3EZ8A 4NFCA 1IJ9A 3MV7B 4N2EA 5ALBL 5GISH 2AC0A 2DJLA 2QHRL 4O0KA 3C5JB 3ZL2A 4XP6H 3LCIA 5IVXA 5KYYA 1YYLL 2A6DA 3WKMH 2AV7A 3CN0A 5EOQL 4UM8A 5HHOE 1O6IA 5GGRY 3UZEA 4OZ4A 2OTDA 3H2WA 3NZGA 2VXQH 3THDA 2CZEA 1CR9L 4HWEL 1DQKA 1RLWA 5D7HA 4R96A 1WAWA 4LUSB 1C5BL 3UTOA 3X3FL 5L6UA 3SURA 5A94A 3S2CA 1JMXA 1Z44A 1E27B 1X4ZA 3PWUA 3QE5A 3E3HA 1BX2B 4RXFA 1FDLH 4PS4H 3QCUH 2QJIA 1JGDA 4ECLA 2F7RA 1KFCA 2XWTA 4PREB 1PBGA 2TPSA 3QG6A 4QRSA 2VE6A 1SY6A 1FWGC 2XUCA 4OD2B 3TZVB 1OSEA 1WAAF 3CUZA 4HUNB 3EJJX 2BH0A 1Z41A 1FFRA 1AQFA 4NXSA 4Z2KA 3C2AL 1GA2A 4HPYH 3GI8H 3PABA 3KVDD 3CSGA 3PTQA 3EOAA 3T09A 4PH6A 3P3SA 3BURA 1LYXA 2IDSA 5MEQA 3QM3A 1QYGL 3BN9C 3WQEA 3IS1X 4PRHE 3II1A 1UUNA 3AHXA 3V52H 4ODTH 1PWMA 3CYJA 3NGJA 1VCBC 3K6SA 2GJJA 2W9EL 5B7EA 1C5CH 3BWWA 4JREB 2D2GA 4GFTB 3RGVC 3MV7D 1XXFC 4N8PA 1QBML 2EIMB 2NRDA 3P73B 4IHOA 4YAQB 2VN6A 2FB3A 2GDQA 2Q71A 3N1FC 3HQOA 3U7BA 1POJA 4GKOA 4ESKA 2DTMH 3IU3A 4X2RA 3V0TA 3HE6C 4QKTA 1EMTH 3KLSA 1KBPA 3O6AA 1R3WA 3MLYL 2HVNA 1ONRA 2Y5TA 4MWFA 2X6VA 5DMYA 1ES0B 4IFKB 1C5DB 1I1YA 5T1DL 1FIGL 1G6RL 3AWOA 4MJZA 1KJ2A 1I2QA 3ITXA 4LSVL 4Y1AB 3MUGA 2AQNA 4JREC 5ICXA 2ZUTA 4FADA 1YEIH 1B4EA 1XIWB 4KY1H 4RZ6A 2J1XA 1ANUA 3O3AB 1CBGA 1ACCA 1NOUA 1SU5A 3BH9A 5BU6A 4QRUA 3RR4A 5FUZH 5BRQA 1WTGT 4P9HL 1HKKA 3A9BA 1QNVA 4HC1H 1A5FH 5HGBA 3V6OC 1MCKA 3FPXA 3VCLB 3K0YA 1KPRB 4P2QB 4LFHD 1IM9D 3LIZA 5CZVL 2RDTA 4GI8A 3OV6A 1I82A 4JL1A 2FIKA 3PUCA 3NM3A 4PB4A 3GI8L 3BP6A 1FAKT 5ID0B 1DKWA 4D8PA 4HCFA 4DJMA 1I2NA 2K6ZA 2Q3ZA 5ECVA 2VFIA 3UFIA 4JQIH 4NASA 3SI9A 1F58H 4YDIH 2X70B 5F0JB 3ZVVA 3M17A 4XNMB 2YL6A 3SKJL 4FA8A 2Z4QA 4PJFE 4TUFA 4WQOA 2R82A 3D3VD 3EIFA 4HU4A 4RIRB 1U93A 1EXUB 1E5AA 1F3RB 3DO3A 1IAOB 2JLLA 4EN2A 5C9JB 1R3TA 1BAGA 1QRNA 3WNIA 1OQFA 2ISVA 2XYCA 4URIA 4W86A 4CU6A 3V4LA 1JDEA 1SOKA 1AVAA 4U3HA 3REQA 4MNLA 3R0KA 1C9SA 3KJ4B 5KZCD 4DKTA 4KQ3L 1IBFA 4HT1H 2ZE0A 1FFNA 3VI4A 4DJDA 1YEKH 3TYGL 5HWNA 2PCEA 3DO4A 1GKRA 4AOFA 2E75C 2EEXA 1LWHA 4YSPA 2HDJA 1HHJB 2EC9T 2ZZ3A 4AG4L 1TTRA 2FZ8A 1JNHB 2XSXA 3W1ZA 4DVBA 3EXTA 4M6OH 4MDJA 4M19A 4XIMA 1CB4A 2HJPA 2KZHA 2YAHA 2K70A 4DAIA 1MF2H 1PSKL 3L3IB 5AOMA 4X6CE 4WR3A 3RM9A 3WF4A 3HG2A 4L4VD 4UTFA 3SE4C 2JKRM 5I73B 3U1SH 2JKSA 1EC7A 1E3ZA 1JF5A 1JWSA 4JPSA 1TFHA 3T8XB 5XIAA 2X4TA 4OCMC 3NQFA 1OWRM 3W2DH 3QAZB 4U05A 4HKPA 4S3EA 2R1XA 1QRND 2VJ8A 4TX6A 3LNPA 3LXUX 3CCHA 3WHXB 3ZTNH 1JP5A 1KELL 3FJ4A 1TQVA 4Y2DC 1DFBL 4ZOBA 1U83A 3NA4A 1YCSA 3E1ZA 5T8GA 3RLSA 5D1QA 3UAJC 4ES4A 2I24N 3KHOA 1MSPA 3SQBA 3H2PA 3ZBMA 3JVGC 3VKJA 1AC6A 4YIQA 3O2WL 4L4VA 2CLEA 4QNPF 5AL0A 3WUWG 1TTIA 3SJNA 2WQWA 3CPGA 1A4KB 2CZNA 4NP9A 3KRBA 4LCRA 3RU6A 3BJLA 3I6GB 4Y1AA 2CW6A 5C0DA 1IZJA 4E2VA 4EUPA 4NUPA 3KBFA 3G6JB 4HBQA 3DLQR 2NXZC 1I8LA 3U4EB 2QEJA 4GQ0A 1GG0A 3GBNL 3MLRL 4NIKB 3CEUA 1YN6B 3UJRA 5H4YA 3MJ8B 5DELA 1F9CA 2NX5A 2GBTA 5IVOA 4FZ8L 3ATBA 4LOUD 1H1ZA 2OWXA 2Q6ZA 2PDNA 3P4OB 1YY9C 1OD9A 1X7FA 1H8NA 3W1XA 1WBJA 2D9QB 2OMNA 2FBJL 5CGTA 5CR1A 2GJLA 3HGSA 4C91A 3W23A 3H70A 4FNLL 3VM5A 1MMFA 2CO1A 1JCKA 4Y4FD 1U4EA 4CGUB 3UMNA 1KBJA 1UKTA 4PSRA 1V0KA 4XZHA 1BYPA 3EKLA 1D6VH 1CZ8H 3N29A 5SX5K 4NQCB 4LLWA 4ICXA 3VYPA 1DVXA 3V7AG 1AQ0A 2AEWA 3S96A 3JT0A 3NTYA 4DO6A 3GRGA 2PR4L 4WI4A 1CJYA 1UGKA 1TTUA 4Z0SA 1IBZA 3NJHA 2FJGA 1TQXA 2O6CA 3OSVA 2EDXA 2WYZA 5CSYA 1BBJB 2XV6B 1M3IA 3FO2A 1KRMA 4ZMGA 4DYKA 1HEHC 1NCJA 4Z7OB 2DS4A 1IGIL 4AHQA 1G7PB 1LLAA 4AHPA 3RDTC 4U33A 3SO7A 3O0RL 3VIIA 2EKCA 2GSJA 1K4DB 3NEOA 3L9YA 5A2BA 4FIQA 4TTUA 1T04A 1CYXA 4U6HB 3ARDC 4PL1A 4LVAA 4QY8A 4X7SL 5C07B 3WHXA 2A6LA 2QT3A 3F58H 3VJ6B 5HATA 4E42B 1KYOJ 1LZOA 4L3EE 1W72B 4RPPA 3HNTH 2Z0BA 2BPBA 4G9FD 4JFEE 3DU0A 3THAA 2OULB 1AHMA 4P2AA 3KNBB 3T3ME 4AZHA 2WM0A 1MQQA 4J23A 5TH2B 2J6VA 3GK0A 3GO2A 4YU1A 4EWND 2IDTA 3NP4A 4A8NA 5K69A 4GRLD 3QEHA 2D7NA 5A16B 3G9VA 3W86A 4M4RA 5JBFA 3PHSA 4BHUI 2H3KA 1YG9A 3PL6B 3VSQA 1J5HA 2AL2A 2CLIA 2X10A 1J5IA 3KWWB 3W9DB 3C4UA 3WHE0 3F62A 4BQ2A 2D0GA 3P1VA 3GTNA 4F37F 2KHAA 3CYVA 3WF1A 3EGDB 2BVUA 5DXXA 5DMMA 2HT2D 2E46A 2X4UA 4XAGA 5HMFA 4MXVE 2WB5A 1BOYA 4ODVL 3ZL4L 1DO5A 4B9YA 3FSUA 3QCVH 3IJQA 4PYHA 3RLGA 1RZJC 4U3XA 3DFNA 4XVEA 2BSBA 1N6UA 2VRKA 3S98A 4X83A 4D2JA 3ZDWA 2NQ9A 4MLIA 5HP5A 3BPCA 3MNVA 3JYCA 3O2WH 4K3HA 5BOJA 3TBYB 2VGIA 3H3PH 3LEXA 1XB3A 1EFQA 3ZE2F 2BP1A 3PJUA 3S34L 3Q43A 3DN5A 4IP7A 1CDCA 4GUCA 5DMIH 4G6FD 4GI6A 3P60A 3HE7A 3N5AA 3NCFB 3SECA 1U3ZA 3FONB 2D1ZA 1W8NA 2BOBA 3AU6A 4HZ1A 1UR1A 3TA3A 3PDDA 4NN5B 3WLWD 2JXMA 4J1UA 2DD8H 3QJVB 2QL1A 4KROD 5ESVB 1GHRA 4QAWA 3VI3E 4G8EB 2ID5A 3LI1A 4HZAA 4OTXH 4RISH 1M7DA 1TTGA 4IOSA 4RSYA 2VX6A 4QE5A 2XY1A 4KFMA 2F19H 2GKIA 2DWEA 5EIQA 2HMID 3K1DA 4I2XA 4UDUA 1FL3B 5CPSA 2AK4D 4K7FB 3VI4E 1A0QL 2F84A 3EOUA 3BC9A 2H3BA 2JGYA 1T6MA 5KTEH 5LIYX 1QATA 4Z7WF 1FIEA 3O05A 2PDCA 3EA1A 3PAYA 1M05A 4M6OL 4ZUTA 5E5MB 5HDQL 3QPKA 2WWDA 3WIFA 2DQCL 3VI3A 3AXHA 1GTFA 1XBDA 5DQDL 4RDQF 4IU2B 4NX0A 3MC0A 3C6SB 4XI5D 1T96A 3DOSB 3GSRB 2CNCA 1TVLA 1N55A 2IKHA 4OBTA 3FA4A 1YQ2A 2E6FA 2EDWA 3HGRA 3GHBL 3QUXA 4A4AA 4FZIA 3DHDA 1AW1A 3CIVA 5AVNA 3KPLB 3CBRA 3P0YL 1QSEB 2W9MA 4O8RA 3PWJA 4GSDL 4YNYB 1F3JB 4KJYB 3DXAD 2ICSA 4JTQA 4AVHA 4FP1A 4LRTA 4XD3A 3DPDA 1UA7A 4PJBE 2CJTA 3OEXA 4LOCA 4MHBA 2Q87A 5EO0A 1EF2A 2OEKA 1UWGH 4I77H 1W32A 5JHLH 2WPBA 1QD0A 1QLFA 1T2QL 1Z3RA 1XGTB 3K81A 2Q7NA 4PJGF 3QDAA 4MNQD 2QJHA 3HG4A 2DZAA 3WKZA 1MFEL 1J01A 3QOKA 5DJ6B 4LFHG 4IXHA 3VFLA 1UMLA 3K74B 4OGYH 2O6PA 4M48L 5DD1H 5KUKA 3T65B 3ULUD 3O6FB 5IB1B 4LGSB 5FW8A 4O15A 3PUUA 1NICA 4A2DA 4AZ7A 1OJXA 1SFSA 2CPCA 3SDAC 4R7JA 2YQ3A 3BFQG 5ALCH 3LMZA 1CGWA 4G3YH 4UNTA 2OZ4A 5J0BA 2NY5L 4F91B 4XC3H 4PREA 1IB5A 5DLML 3ZX1A 2BNUA 5FOBB 1V6VA 3KGUA 4JY4A 3ATYA 4UZUA 4QP0A 2CSPA 2X5PA 1IGML 2HLAB 2VMCA 2AKZA 2E9JA 4RNIA 4EI0A 4F7KA 1TV4A 4APXA 3W1UA 2HPTA 5JHDA 5EPMB 2C34A 1X5FA 1VPYA 4H8WH 3O8XD 4LCWE 2XSBA 3MP5A 4K7YA 1HILA 3AWGA 3TXZA 2XICA 4ERGA 1ODAA 4F8TA 4UT9A 5EEXA 1DDHA 4E5XG 2Q8AL 1KGIA 3P0VL 5HVWA 1TZZA 2BOBB 3CK0H 3MV11 3QQDB 3VWJD 3QDMA 5KS9F 3M4HA 4DLMA 3ULSA 4LT9A 9CGTA 1RQBA 2Z34A 1SJBA 1JXJA 2H90A 2CXGA 1P7KB 4C60A 3BGFC 2ZXAA 4Q52A 3S42A 3SQMA 2Y7QA 1UWUA 1IIKA 3IE9A 1U5JA 2FATL 2E7MA 2XV0A 4LSTL 4TQIA 3K30A 1XB6A 1U8JB 1RZFL 2NNCA 4PV1C 5CP3H 3TNMB 5GS1B 5KVDH 5K93A 1ZBVA 2BP3A 1QI5A 1X5MA 3IRCA 4M48H 3AU1B 2WYTA 3B83A 1BIIB 4WFFE 5DD1L 1Q0EA 4ZZKA 1QNQA 4E4UA 1MCPL 1HK6A 5I1LB 4AWJC 4DJDC 2Q20A 1SLWA 3U30B 1TX0A 2WXQA 4JNZA 2CKBL 2P8LB 2AQQA 4JJHA 4IXXA 4PR4A 3RUBL 1F42A 4QPEA 4PWGA 1BWLA 1OPGH 3VH8B 3CJJA 1R9ZA 1S5IH 1M41A 1O6VA 2GAZB 5C7XL 1W1YA 3SCWA 4Q9RL 1YUHB 4CVZB 5D2LE 3WXVL 4B5VA 3BWUF 3N2JA 1BZ7B 5KVEL 4RWYH 2GDVA 3AXLB 4Y4KC 1BQCA 1DJNA 2YR1A 4JEQA 1AO7A 4ZK8A 3TX9A 4N2FA 3SRFA 1FP9A 3C6LC 1Q90A 4W7WA 2NNAA 3DNKA 1CGUA 1E2VA 3BZDA 1CIUA 1A7QL 5FOBA 1Q72H 4QM1A 5F96H 3KYNA 2AQSA 3Q01A 4UINH 2A85A 2CDEB 1E2WA 2GK0B 5H94A 1E6OH 2VX4A 2H32A 3RY4A 4IGBC 3WEOA 2VLME 2CM5A 5JR1L 5AC5A 3WQOA 5DQDH 5D2YA 2EXTA 1JPSH 1P6AB 1P6FA 3II2A 4YDMA 1L9RA 3I6LE 3ARGB 3TPUA 1XF2A 1VHCA 1YPZA 4GXVL 4UILL 4H9VA 4FNPA 4JM0A 3AT8A 3IJ7A 3PXHA 4F9PC 3ZSTA 4O02L 5E9AA 4LS2A 2X4PB 4D8OA 1KENH 5EWIH 3LNIA 3KWSA 3WQVA 2DYPB 4AD2A 5GSRB 4N9EA 3F7VA 3CVBA 3OKNA 2HVOA 4JPWL 5I8CA 2O93L 4LS1A 2NX5B 5E9DA 4D6GA 1T2QH 2RALA 3S1GA 5GJTH 1PZ2A 4IHBA 2R2EA 4LSVH 4GRWE 4R90H 1JHKH 4UOW1 2BBFA 1EDHA 1SOXA 1QRQA 2XPGA 2G2RA 3HQ1A 1MFCH 4XNYH 1T7LA 2GWNA 5DJDB 3PBUA 3U9PL 1P84J 1OHQA 3QFGA 1CDYA 1P84K 4NM8H 3W7IA 3SZ6A 1O0VA 5CKSA 3PWNA 3RJDA 1M4KA 1E28A 4KJPC 4EPBC 3FYYA 3QJOA 4JEJA 4AD5A 4EOWH 2PTZA 4LJ3A 1BXXA 1JN6B 1MG3C 3V5DA 3A4EA 1IE7C 1SYTA 3M8OL 5LXXA 4G3YL 4ONHB 2GQ9A 3O0FA 4V2XA 5I6NA 2BVWA 3VSVA 5FSEC 1JD7A 3DEQA 1ADOA 1LOQA 2VW6A 2Z1KA 3DBSA 1TWIA 1WIPA 1JWMB 2XKNB 4QXWA 2E5CA 1AIZA 1JWSB 3BLLA 5LKYA 3PPSA 3LEVH 2X3CA 3BUDA 3BG3A 4EO5A 1EERB 1TQBB 1QWNA 1JZGA 4NX5A 2VLKE 2W5PA 2V3FA 5BS0E 4YUEH 1IC7L 1DJYA 4GP4B 3P30L 4KRPD 4Y8DC 3FOMB 3M7FB 1YMMA 5KVGH 5D70L 3AICA 5GNYA 4C6LA 1FWFC 1KLUA 5BOOA 3HC0B 2YFOA 1RXLA 3CHSA 4NBXB 2VUOA 4OLUH 2DORA 3FULA 1AQDB 3L3KA 1EO7A 3SE9H 1VSCA 3UO8B 3QDJE 1Q8AA 1W9UA 4ELMB 4B9PA 3GW3A 1CD1B 4KKLD 3IAPA 1NM9A 1YEDA 5CGMA 5D7LA 4JZJB 1UKQA 2NLIA 2W88A 3OKOA 1X5ZA 4NFBA 2YL8A 4PUEA 4L5ZA 1LO0H 3WTXA 4DXVA 2ZKHL 5I17A 2ON3A 2W0UA 1E5JA 4O5LL 1ZVHA 2XWZA 1ESOA 3ARSA 3D52A 1TMQA 3U4BH 1O4UA 1FZKA 5KYXA 1SZGA 5HGHB 2DDXA 4WDWA 4GH7B 5IUSA 3ITOA 3MRRA 3ZT6A 1F3WA 1KW1A 4JFTA 1Q5MA 3R89A 3KYMA 2Z25A 3SGUA 3QUML 2HN7B 3LEXB 1YC8A 1W6WA 1XZ0B 2ISSA 1KBKA 1OGAE 1SBBA 3IMUA 3MTRA 4D9QE 3EXJA 1TWSA 2FO4B 1ZLPA 1NCAH 1QO5A 2GQ8A 2RR3A 1X3DA 4O0ZA 3RPTA 2FDBP 3SGJC 3QEHB 1HU8A 1UOWA 5DRIA 5IMOB 3IJ8A 3GH7A 43C9A 2FZBA 4YBQD 4I8YA 3TROA 4AAJA 5INCA 4BQCA 1A5KC 2JGQA 1KBVA 1YDPB 4X80L 5AVWB 3LHYA 3U2ZA 3CUIA 3QF0A 4Q8QA 2WD0A 3W24A 2XETA 3EYSL 1S1RA 4N8CH 5EUOB 3STBA 1T83C 3W1NA 1A4AA 1BZDA 4A8RA 1BECA 5HHNB 1T03L 3NDZE 4I48A 1RJQA 4ZOEA 5GJTL 1J8RA 2ZG2A 2P7TA 3CN2A 2F15A 4ADJA 3QMTA 4K5NA 2ZRWA 3STPA 3WLKX 4XWGL 1YNYA 1KWKA 1FA4A 3QR0A 4Q4PA 4WW2C 3X11B 5T5NF 1KQZA 3ARBD 3QORD 3UGVA 3QORC 1OTTD 1A2YA 4HK6A 5KBDA 1W1PA 4K1GA 1FWCC 2QSVA 4MJ6A 4Y19D 4JFZL 5FJIA 1W72A 1OM3L 4N22A 2ISWA 4PW9A 3SFKA 5AZ2H 3BLOA 2H6PB 5DR5H 2IQTA 4JQ2A 4UCFA 2A6JA 4PGCB 3KW8A 4U1NB 3RM4A 3KJ4C 2I07B 1LJMA 5E2TL 4M3JA 4LSBA 4MPKA 4UMAA 3L6FA 3J7HA 1GSMA 3L17A 3LIZH 2JI2A 4GAAA 2J8UE 1TNMA 4ETQB 3FO1A 4MB4A 1A1NA 5K39A 5TQLA 4PV8B 4A2MA 1CDHA 2B5IB 4JL2A 4UQDA 2BFVL 1Q0YH 2H3NA 5EZOL 3UCQA 5F72S 2DQTL 3CVCA 3NXFA 1LWRA 4IQEA 5DVOA 2WVUA 1ZT1A 3RIFK 3OAYK 3CT7A 1HINL 1A6PA 2QVIA 3GJFA 2WKOF 4NLAA 5FGSA 4C83B 1BJ1H 5DCDA 3NZRA 2WPGA 1JRHI 4BSWB 5DTFB 4Y4FC 3ZKXC 5FF6A 3BRDA 1LE5A 2P3EA 1BX2A 3PP4H 1S7SA 4S39A 1QSEE 4J7RA 4AY1A 1UGNA 1IGFH 3JS3A 2HA1A 1NIAA 3HN3A 4Z7VE 3ZYZA 4CC1A 2VDQH 4BZ1L 3LKQB 5TDPA 3VQ1C 3QBUA 4H44C 2OO0A 1X38A 2XIBA 4NQDE 4P5MA 1A7PH 2CIKA 2WMPB 2E7FA 1IKFH 3NJGA 3TFCA 4R27A 1A9EA 3N1QC 1LOLA 2CLKA 2B81A 1SGKA 2SFPA 3NFSH 5B3JF 1JRHL 1GVFA 2V7HA 1TTPA 1LL6A 1YTEA 5B7YA 5KG9B 1ECEA 4RNHA 4PFEA 4US6A 3DX9A 3L7EB 5A2KH 2MNUA 3MLPA 3P69A 3VC6A 3QPZA 4FG4A 4WSGA 4GKNB 3NL5A 2NUTA 3WX7A 4DCQA 4RRPA 4UDTA 5EBLB 4E68A 1ZJBA 1ITCA 3L2NA 2EVFA 4MCNA 3VUAA 2KLRA 2DPKA 3GS4A 4P2OD 5IW1B 3UJ2A 3IU4L 3SDCA 1DEDA 3O2DH 3VH8G 5IQOA 1ICSA 3BHBB 3C08H 4NQEE 3GDMA 4L4VB 1FYHB 5F9JA 2VWSA 3HC4H 3TJ4A 2P8MB 1EEUA 2CU9A 1A80A 3DKHA 4NNAA 5FL1A 2C18A 3C2OA 1VFBB 1Z7AA 4KQNA 4ZXLA 2INEA 3ZE0E 1GONA 3G1SA 3GTVA 2O56A 4DWSA 5AVYB 3NFUA 4RJEA 3RL2A 2XFRA 4HAKA 2X1UA 1HNYA 4HXBH 1DE6A 5DCCA 3IE4A 5E00B 3VGDA 2FZNA 3BKCL 2H41A 3G6JF 3S7GA 4B41A 4MJID 2EECA 4FXKA 5BUGA 3U0PA 2WXKA 3FU6A 2DZBA 4GXWA 4AX7A 5FK9A 4AKOA 3A67H 3F5LA 2WWOA 3C6LA 1Q0XH 2MHAB 2G37A 1SXBA 3WJXA 3QWOB 4JPQA 4A6GA 1T5WB 4RMSA 3WS3A 1ZAHA 4H8PA 4OLYL 3WQPA 1CICD 2X4QA 1VHNA 3O3EB 2QSCL 2CO6B 5G4WA 4OD3H 2HJFB 3L3GB 3DCPA 4YK4B 1OAUL 2QCNA 4F58L 1TPUA 3C60D 4LTSA 4B2DA 1FO0H 5JLZA 2XRAH 4MZYA 4KXCA 4AJ0A 2YCKX 3WMCA 3QLDA 3V18A 4M43H 4DSYA 4YHGA 3W7PA 2FD6H 3FU3A 4FP8L 5AYBA 1Z6JT 4NKMB 2OTWB 1S7XA 1MCOL 2C9XA 2WO2B 1KCUL 4AQEB 2HVMA 3DDMA 1WUEA 4Q6IC 3RWHA 4V1DE 1EFZA 3U7WL 4HGXA 2E9GA 1TMCB 1DIOA 1SSGA 2O9OA 1TU2B 4JRXE 3MWCA 4QHLB 5KS9E 1UATA 4UNKA 4Y9MA 2Q86B 2A9CA 4X7TA 1UPMB 4UMCA 4DWDA 3MRJA 1VYSX 4HJWA 4X4ZA 4FCAA 3IFLH 4Y6GA 4G7YL 2ENSA 1EHXA 4URTB 4L4TD 3S3DB 4UB0L 4NNCA 5FX3A 4AZCA 4HUVA 4OF7A 3EMQA 2IAMD 4G8GD 2V2TA 5KINA 4ZX3A 3NDOA 3OZOA 1KBBA 1P1ZB 5ACLA 1CB7B 1QEXA 4ISVB 3NSDA 3TJHD 4R53A 1ZVSB 2HT3C 2J7EA 2Z91B 3T6ZA 1O9WA 4H8VA 4JTHA 3IJYB 4H88L 2P8PA 1ZHBA 1SHMA 5TE7L 3LNEA 5E5CA 2B7NA 1TTJA 3MYJA 2VDPH 2XV3A 3MRPA 3WBEA 2R0KL 4EZKA 3RL2B 1NC2A 4UMSA 5CNHA 7FABL 5H2ZA 5L2KA 5IHZB 1UZ8B 5KETA 3PV7A 3GMQB 3ULVC 3QHOA 5I6XC 3H7BB 3PLYA 5C9JA 1G6CA 3L3HB 4XP6L 2HJLB 1RZFH 1MOEA 2FK9A 3KS0J 2FTPA 2GVEA 2PFHA 1SW0A 4DGVL 3L95A 4DEPB 4JYEA 3JT2A 5D72H 4H3DA 5J5EA 3JWDL 1A9VA 2AQOA 3Q45A 4LMQI 3ATZA 3UL4A 4ZMLA 3AIQA 3OPSA 5DT5A 4H1LB 1CWYA 4WFEE 1M65A 5C7VA 1SFJA 1QI4A 3GMRB 1YMYA 2ZYHA 1BGXH 3PP3K 4WI2A 4DCQB 1S5MA 3CQIA 1NOFA 2EIZB 3GSMA 3OBKA 3QO0B 1T5XA 2OOGA 4JTAA 1WQVT 2W79A 1OP5H 4XHQA 2FPTA 1R3KB 1MCFA 2DKUA 4N25A 4S1QH 1DN0A 3QMRA 1CBVL 2N01B 4JFDE 4B9IA 4GUFA 3KPOA 4UMGA 1FJ1A 1HZHH 1L4IA 3QA3B 3W57A 3IDIA 1AIFB 4LCCA 3TN0A 5ERWA 3PF3A 4EQ2A 1PKMA 5FF7A 4WHYH 4ZD3L 4AL8H 2A77H 2FBOJ 1EEYB 3QG7H 5F7BA 1FCUA 3W71A 3W0WE 2NZIA 2VXQL 1EX5A 3N41B 4PJHE 5CU9A 3QPEA 3X3GH 4ZW3A 3OHIA 5BRBA 1YNKL 3L1EA 4PWFA 4AZGA 3O4OC 5A3HA 3QHFH 3QJTB 4ZGYA 3EHBB 2PA6A 4PRID 1K8CA 3AUJA 1WSST 2GTZA 4HCRL 2B77A 4XZ4A 3MQTA 4A22A 1JCTA 1J9CT 1OD0A 2NY3D 4L61A 4Q74A 1RBOB 5D4HA 1E15A 2FVMA 1FWXA 5LNDA 4XZMX 2V7NA 2HBVA 2I9LB 4ZW8A 5T1KB 1J05B 3EA2A 3DI2B 4TQHA 3HZYB 4F5CE 2FQIA 1QASA 1JPGB 3HLKA 5AB2A 3L48A 4LGPB 5DHDA 2D7QA 2EP6A 4DNLA 1JK8B 3W6MA 2OZ4H 3FHAA 5JW4R 3W1QA 4AVOA 3CVHA 4OCWH 4OCSH 4KZDH 3M0XA 1GW6A 5G2IA 3ZXAC 5EBUA 1S3KL 5IFJA 4E41D 5EY5A 4N9CA 3TN3A 1PKQE 4JGJA 3B5TA 5CP7B 1J8HE 2EQDA 2QVTA 5C09A 3APGA 4Q6IA 4PRTA 2XWBB 1NH6A 3DC0A 1EPFA 3KYMB 3TC6A 4CEUC 5I1CL 1KCSL 3IAQA 1WOBA 4QSFA 3QI9C 5D93C 3U48A 2OKTA 4BFIA 2V4LA 1N7ML 3BGMA 4IGHA 3CX5K 3FTGB 1MCJA 1SJEA 5DURB 3S3CB 1TZAA 4B50A 5HYSA 3TZVC 4I9XA 1TPH1 3W88A 4JZJC 4MXWL 3X12A 4MWAA 2UZIL 1UZ8A 1A7NL 3T4YB 5EHFA 2TYSA 4ZX6A 1HH9B 3LHAA 3NJVA 1PKQA 4XWOC 2YBGA 3VFTB 2AQ1A 2B1OA 3CHXA 3L9BA 3G5VB 5T3ZD 5HYFA 4MFDA 5EMKA 1VCGA 4JDEA 4L3CB 4FTVB 2OMZA 4GS7B 1HO1A 3W7HA 1TG7A 2X0VA 4M5PA 1WBYA 5AYQA 1PHWA 3EJYC 1B9ZA 1AE6H 2ERJB 4P5KA 4ZQTA 5KVMC 3RZCD 3Q37A 4CSTA 1BRLB 3SYAA 3U0TA 2REQA 1TENA 3WE6B 3WF0A 4HPXA 4JCMA 1BLIA 4D94A 1UXLA 5DVNA 1H2JA 3GFXA 1R5YA 1ZGLP 5D1XD 4IRZA 5EO9A 4IMCA 4UTJA 4NZRL 3OQ8A 4ELKB 4P04A 2NY1D 4WKFA 1NDGA 2XHNA 2OMVA 4DY1A 1V6WA 4KFOA 5D37A 1FNLA 3NOYA 3MO1A 4C58B 3CAKA 1E1FA 3S6TA 1B2YA 1JZ7A 5KSAB 5DDHB 1ETB1 5GZOC 1U8CB 3TEUA 4UT6L 1I3GH 3G22A 1BZ9B 4WCYL 2A21A 2MTAA 4K5LA 4FG6D 1TF4A 3GQYA 4LAQH 4QDGA 5I16B 1R19A 4TNVF 4GXVH 4UILH 5IWLA 3SDCD 3VXME 5L9DH 4YSTA 5LBSA 4WW2B 1W17A 2CKSA 4RGNE 4Y19A 5D9SA 5F89A 2PYED 1WZ1H 3INUH 2YL9A 5TAOA 3R1GH 2A7BA 4ZUUA 3C9NA 3T3MB 4DQOH 3LCGA 6XIAA 2PGEA 4NKOB 5HVHB 5F7EL 4NCC2 4LARL 3LB6C 4A66A 3KLHD 1O1HA 4K39A 4NQDB 1EZSA 4JFYB 2P5WA 3RGVA 3LN3A 4CSPA 4AY0A 1BM3L 2X4QB 4S2SA 4ZFOL 3LEYL 2XXFA 2HCZX 5IBTH 1M7JA 5JHLA 1IAIM 4NZTL 1E4NA 1AY1H 2JQXA 3D8MA 1UWEH 2PPGA 4UTAA 1QTYT 4ZB2A 4BD4A 3FCTA 5CLWA 1VBUA 1T6WA 1IUZA 1Y6NR 3A4AA 3CMOL 2X41A 3FHQA 4LSSL 4CMHC 1L9MA 2V7HB 1GYWA 3C5ZA 2QCFA 2OPCA 1HFBA 1M3UA 2EG8A 1YPZB 1PFOA 1IYXA 3DIDA 3KPSA 1LTDA 1CVRA 1U8LB 4X98B 1KBIA 3V6ZA 1EC8A 1G7UA 1KTNA 2J7GA 5CZVH 3AMGA 3EDJA 3T81A 2ACRA 4W4OC 3HZVA 2H32B 2EIEA 5FKAB 1CFTB 2NT0A 4PJ7E 4D6HA 5M2FX 1R8LA 3DO7A 3NPSB 1BTCA 2B4CC 3SKMA 3MHGA 4WEEA 4E4FA 1OHLA 5D1XC 3SDCB 3I6KB 5HNNA 4ZT1A 1RIVL 1R30A 2AQRA 2E86A 1PLGL 4A3RA 4UDTB 2YPVH 3B6SB 3BZGA 4G71B 1JCJA 1VH7A 1UQZA 3MCLH 4L0ZA 1KM4A 1Q9OB 5I73C 1QFHA 3T08A 3RDTA 2IUZA 1OK6A 3USBA 1P7TA 3N85H 1IWAA 2WNZA 2WLKA 3ICJA 2AK4E 4YGVB 3U5UA 3O3RA 4KZEL 5B1JA 1D7FA 1DVFA 5HYJE 3T8QA 4I18B 4UV4L 3F85A 4Q97A 1Q66A 3CMGA 2YBTA 3G77A 5D2LA 4UMBA 3V5FA 3CUPB 3M7WA 4LSRL 5MI0B 3KTCA 3LN5A 4CU7A 2APXA 2WVVA 4I3RL 4BI7A 1SM3H 2V17H 4L9DA 4TVPE 5ISZE 2RD0A 3TMLA 4LGXA 1EHLL 4P8UA 3CL8A 2MQGA 1IU1A 1GG1A 1PG7X 3U82B 1CFVH 1AJ2A 3WJSA 3DAQA 1FHNA 1OT1A 5IXEA 4XMVA 2QGDA 2E6YA 1RUPL 1X7IA 3MHUA 4RMBA 1KM0A 1TLMA 3QWQB 4DJED 5JORA 1KF9B 1AZZC 4GUIA 5DJXA 4KI1A 4U6YA 3SDDC 1AH0A 3H4FA 4KK5D 4PJBB 5F1OB 1U8PB 5IMKA 4YSDA 3C6LD 3Q1SL 1KPUB 3MDJA 3S3PA 5FESA 2XWCA 4E36A 3I3EA 4DVOA 3HNVL 1KA9F 5EUOA 4OZHA 1UACL 5JIIA 3ULVF 2PKDA 1QKZH 2QJDA 4Z7VA 1OFRA 3AIEA 3NJLA 1EUNA 4PMVA 3CB3A 4M6NH 4Z7UA 3QEUA 4NDMA 1RSCA 1QOQA 4LEEA 2CA3A 4PRDB 3LV3A 1KJ3L 3DDFA 2VEKA 2DLEA 3KBVA 4MUZA 5D9PA 4O2FA 2Y0FA 2VC2B 1MHPL 4EZLA 1IC5L 2BVDA 5CSBA 3MANA 1Z89A 3PBVA 1YRRA 3QFWA 1V54B 3SO5A 3WGVB 4K7PH 2FMOA 1SJCA 6ALDA 1CK0L 2IALB 1MIEL 2Y7LA 4NQXB 1KD0A 4D9LL 1XXXA 1A2YB 3HFFA 5DZPA 4QROA 2WOBA 1P5UA 3QHTC 4OSUH 1SGJA 4KRMB 2PLCA 2WZ0A 2XX0A 2BZDA 3MRRB 4QBXA 3HG1D 3X11A 1D5XB 4TQEL 3CZ8A 1ND0B 2A9AA