1GCYA

High resolution crystal structure of maltotetraose-forming exo-amylase
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
415
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCAN 1,4-ALPHA-MALTOTETRAHYDROLASE
publication title Crystallization and structural analysis of intact maltotetraose-forming exo-amylase from Pseudomonas stutzeri.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 145
structure length 415
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 2000-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gcyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gcyA01
1EGZA 1MXDA 2EPOA 1PX3A 3VD4A 4AMCA 3WUFA 9CGTA 4ZE4A 3ECQA 3VNYA 3BCDA 3PTMA 2D20A 5LA1A 2WLZA 4AD2A 1AQMA 1QI2A 4NI3A 2WVVB 4WKAA 3WDPP 1FHLA 1PEZA 4MNLA 5IHRA 3F4VA 2JIEA 4W5ZA 3LPPA 3BVVA 1DEDA 3KL5A 1JL8A 4TX6A 2YIHA 5HXMA 2XN1A 2A3BA 4NSBA 3RM4A 1G94A 5BXPA 2UY4A 1UA3A 1FH7A 4F9DA 1Q6DA 2EPMX 3GTNA 1JNDA 3BAKA 3MV11 3RM8A 3A3HA 3AHYA 3F5LA 4HPGA 1TFVA 3LPGA 5C70A 4P8XA 3IJ9A 3ARXA 3THCA 3KL0A 4L4PA 2WZHA 3AS1A 3GBDA 3D3AA 3HG3A 1ZJBA 3ALFA 3WQWA 2WVVA 1E55A 1E72M 2JF6A 2GDUA 1KBKA 1O7DC 2VVNA 2JFEX 3N1AA 5CXPA 3AMKA 4GPNA 1E3XA 3SUTA 3D4ZA 3AMCA 1MW1A 1DP0A 2J74A 4DWSD 4MJ4A 2J4GA 1QNSA 1J0IA 3VDHA 3CV5A 1NP0A 4W5UA 3DX3A 4U3CA 1BYAA 1CGUA 1C90A 1KTCA 1B3ZA 3VGGA 4HOZA 1E40A 3K1DA 3EDFA 3VIOA 4P7LA 1JAKA 2WC4A 1JI1A 4BZYA 1H49A 3WD0A 5A6SA 1R86A 3VIKA 4FMVA 3N11A 4XV0A 2WVTA 4W89A 3N9KA 2DSUA 2PWDA 3VSTA 1NOWA 4EKJA 3AS2A 3ZR6A 3PTKA 5GNXA 1SYTA 1E71M 4AZ5A 5FOOA 1XSJA 4JL1A 2VCAA 3O2LA 1G9HA 4H8UA 1PX8A 1JF5A 1BPLB 1QPKA 3N13A 2WSPA 1HKMA 4LYQA 4DO4A 1JNEA 1E56A 4C7FA 2ZX9A 2QHAA 2WWDA 2YKKA 5EMYA 2IGTA 4OIFA 3RILA 3QOMA 1Z32X 1KB3A 2G8ZA 1E70M 2WBKA 4UFKA 1K9DA 1JXJA 1E15A 4KMQA 2WAGA 2CHOA 1DWHM 3VDBA 4WKFA 1VEOA 1EH9A 1K9EA 3VTRA 2VR5A 2WMJA 2GJRA 3ALGA 1WAWA 4MTVA 2J25A 1E4NA 1WE5A 5AC5A 1LL4A 1MFUA 2VX4A 3PZOA 1QW8A 3WBEA 1ZB5A 1BHGA 3CZJA 3DDGA 1RD6A 3AIUA 3AQUA 1DWAM 3ZJ6A 5IFTA 2JF7A 3WD4A 5E09A 1W1PA 3CZGA 2F2HA 3BLBA 2YFOA 4N0RA 4PTXA 1MW0A 5DFAA 1GOWA 3AHVA 1ZBWA 4JZ5A 4MB3A 2YFNA 3ARRA 4ZEPA 1RPKA 2OSYA 2NT1A 3EDJA 2PWGA 3UESA 1W91A 2A3HA 3OZPA 2EJ1A 3AMLA 1JFHA 3AXIA 4YN5A 1BVZA 3TONA 3W26A 2GFTA 3VNZA 1JDDA 1MW2A 4UOZA 1JYXA 3CUGA 4LPCA 2WBGA 1QNRA 3EJPA 2IXVA 4Z2HA 3BVTA 1KCLA 4M29A 1R33A 1PPIA 1OGBA 3W24A 2WSKA 2WWCA 2D22A 3B9EA 1EO7A 2BXYA 3ZO9A 4FLRA 4PSRA 4GKLA 3SCUA 1Q6GA 3WF1A 1KXVA 1JDCA 1MQRA 5CGMA 4QCEA 1CGYA 4Y7EA 5GQBA 2XM1A 4AEEA 1B3XA 3FHAA 2E3ZA 1KGWA 1E0WA 1V3KA 2J7HA 3CLWA 2V5DA 4ATDA 1GJWA 5I3DA 3WSUA 3T08A 2D0HA 1WDPA 3GXIA 3H55A 2WNWA 1JAEA 2E8YA 5AY7A 3VILA 1CLVA 3VMOA 3VMPA 1UKTA 3CHFA 4MNMA 3W4RA 3MSGA 5FD0A 1CDGA 1GQIA 4QLJA 2PC8A 1IT0A 4H41A 2QLYA 1UYQA 3AMDA 2ZE0A 3W6LA 2DH3A 3VD3A 1QNOA 2X2JA 3MMDA 2GK1B 1R46A 3BMWA 3OGVA 4NX0A 3WY3A 2G3MA 1V02E 2VUYA 3T0BA 2EXOA 2WC3A 1NWRA 2O92A 4FLQA 1M53A 5CLWA 1BYDA 1GW1A 4S3KA 2W4XA 2X2YA 3W28A 4J27A 1OCQA 2DSKA 5A6BD 4HTYA 4XB3A 4FNUA 1UWIA 4CUCA 4D6IA 3NJ3A 2J7CA 3WBAA 1CXEA 4QLKA 4X9YA 3MS8A 3ZR5A 4U5KA 1CXHA 2CEQA 2IXUA 3BAYA 1JD9A 4JL2A 3GYCA 3TTOA 2D3LA 2DT2A 2WHKA 3UERA 4PMXA 2XHYA 1BGAA 1R47A 1QX1A 1JZ3A 2GK1A 5KEZA 2F1AA 2J77A 3WNOA 1ITCA 2EACA 1TQTA 1HXKA 4E4PA 2EADA 1KWKA 1KFWA 5GPRA 4NZJA 1J0YA 5CPSA 3PZMA 3WH5A 4K68A 2ZUWA 2ESCA 3CUJA 2GUYA 1I1WA 3RMEA 1E6XM 4UOJA 2ZXDA 4F8XA 3M07A 3TP4A 4LX4A 1VJZA 1UWUA 2VR4A 3A4WA 5DEZA 4MNKA 1RH9A 4JFSA 4TVUA 1HX0A 4UTFA 4PTVA 1CEOA 5DT7A 2A3CA 2XTKA 3BAJA 2Y24A 3UCQA 1XCXA 1J0HA 4W88A 1XYFA 2BXZA 2WHLA 4AYSA 3GXMA 5DMYA 4PYSA 3AJ7A 2YA0A 1UWSA 4DUVA 3N04A 2WVUA 2W92A 1GONA 3SUWA 1CGXA 2FHCA 4P7OA 4R5EA 5BWFA 1IV8A 4W8BA 2ZX8A 1B31A 2HVMA 1NWSA 3M6DA 1E1EA 2XFYA 3NUKA 3KLLA 3WDJA 5IHSA 1JZ8A 2VC9A 4Z2LA 3LRLA 2J7DA 5FL0A 4A4AA 3SCNA 1MQQA 2D73A 3L4WA 3PZNA 2O9OA 1CXFA 2WC7A 4GIAA 1G5AA 2GJPA 4UFMA 3A23A 4CVUA 1B1YA 4WSKA 3UG3A 3WF3A 1XGZA 1GOIA 4AC1X 1UH2A 5TD4A 4M80A 2DT3A 1E4LA 4FK9A 2J8FA 4OKDA 1FH8A 4OGZA 3AYSA 1WZMA 2MANA 1HJSA 2WKLA 4YPJA 3RM9A 5D9PA 4P7NA 4U5IA 2E9MA 2BHUA 2CKRA 4HZ8A 5A2AA 1XH0A 2J78A 4MADA 2WANA 2CNCA 2FGLA 5FL1A 1PIGA 1WDQA 1G1YA 1OBAA 2ZICA 1UD8A 4DWSA 1AQHA 5HPCA 1KWGA 3HG2A 3RJXA 3BAIA 3SCTA 2Y8VA 3BAXA 3WFLA 1J12A 1HIZA 2WHMA 2V38A 1PIFA 1NWTA 1ODUA 1V0NA 4PN2A 4GZEA 3UG5A 4PMUA 3AYRA 2DPEA 3B9AA 5EFFA 1GHSA 3WH7A 1EHAA 5CLTA 4GO8A 3QHMA 3CTTA 2XYLA 5A8OA 1U30A 5BRQA 4NRSA 2XN2A 2WMGA 1KXQA 3GBEA 2WMFA 2XFFA 5HNNA 1CXLA 4WK9A 3AIEA 4FNPA 4QDMA 3POHA 4W7WA 1BVNP 1QI4A 2YL5A 5EB8A 3GNPA 1UR8A 4U31A 4W8AA 3S2CA 1BQCA 2CETA 4BQ4A 3GH5A 3WUBA 2W67A 3VM5A 2WZIA 3T2PA 2D23A 3WH8A 5JIPA 4BS0A 1UKOA 1UKQA 3BUIA 3BVWA 1JZ4A 3A5VA 3BUQA 5ABFA 4MDPA 1JZ6A 1CLXA 4D71A 3AXXA 4YHEA 2F8QA 1QNQA 3MUY1 1UD6A 4GZJA 1NARA 4UQDA 1V3IA 3VUPA 1C3FA 2PBGA 3AIWA 3ARVA 4JAWA 3GNRA 4MB5A 1QI3A 3D52A 1JYNA 3CIVA 1UD5A 2DEPA 1E1FA 3WNLA 2VX7A 1SFSA 2VRJA 3OIHA 2VRQA 2E9LA 4HA3A 1QNPA 4UFHA 4EK7A 1TMQA 4FLOA 5LA0A 2YLAA 2HISA 5BCAA 3FNDA 2X1IA 4M82A 3HJEA 3L4TA 3NSMA 1NOUA 2CERA 3O9NA 3OB8A 4H2CA 1KQZA 3AS3A 4BQ3A 2XVNA 5ECUA 3S5YA 1MYRA 1UD2A 1CGWA 1HJQA 5A8QA 1PAMA 4AIOA 4AZCB 4UFIA 4AZIA 1E4MM 2CIPA 3AROA 2X05A 4FNQA 1V0LA 2FHBA 1HKIA 1DWJM 5E70A 3FAWA 4IUGA 3A6OA 3FXYA 1FH9A 1XCWA 3NSXA 1XRVA 5I2UA 3KEHA 4C7GA 1E4IA 3ZQ9A 1WNOA 4BQ2A 1TQWA 5BROA 3KL3A 2F1BA 1UQYA 4W85A 5JUVA 1NWUA 4QP0A 2VOTA 3ZMRA 4D6DA 2WPGA 2VQTA 4DO6A 3CGTA 3FAXA 2RGMA 4DM2A 4WKHA 3II1A 1JGIA 3BC9A 4JKLA 1MWOA 3HMCA 2Y4SA 1HVQA 1E6RA 1OGGA 1GVYA 1TCMA 2J7GA 3U7BA 1V3LA 5A2CA 5A3HA 1GQJA 3CBWA 3BH4A 3WNNA 4IPNB 3VIMA 4AZCA 4TVCA 4CU7A 4PMDA 1SMAA 5EBAA 2EQDA 4OJYA 5A2BA 4AMWA 3IAPA 2PWHA 2CBVA 1ISWA 5IFPA 2PBOA 2D0GA 4HOWA 4UNIA 5A6LA 1V02A 8A3HA 3DHPA 4Q7NA 5E9AA 1BG4A 4PMNA 3UR8A 1B30A 3G6MA 3K46A 5E0CA 1LL6A 1E3ZA 3DC0A 2QPSA 2ZX7A 4W87A 3NCOA 4PMYA 2ZUTA 3VD9A 5A6AA 2OW7A 3EJQA 4CN6A 4DWSC 2BVTA 5AC4A 1W1YA 5I79A 2JEPA 1B0IA 1WCGA 3MKKA 2CESA 3DX2A 4LGXA 1KXTA 2UWFA 1WKYA 1E0VA 3NYDA 1UD4A 1ZBKA 3A24A 3SCPA 3D50A 1HL8A 5I0DA 1CECA 3MU7A 6A3HA 4QLLA 3SCWA 3PHAA 3TTQA 1D7FA 2X09A 3TV8A 1H0IA 4HU8A 2DGAA 3CZSA 2X8RA 3ZSSA 4JHOA 2W5FA 3LPOA 4TVDA 1B9ZA 2G4FA 3LXCA 1QI0A 1E6QM 1BYCA 2J7BA 1DWGM 3K8MA 3WMBA 2OLHA 3PZIA 5M5DA 4NRRA 3GH4A 1VB9A 3CUFA 1B3WA 4BQ5A 2XUCA 2UY2A 3WH6A 1G01A 3MV01 3J7HA 4LQ1A 2PWEA 4IPLA 1EHNA 4D1JA 5A69A 3H54A 3W82A 1QHPA 1E5NA 3T2QA 1XSIA 3U5YA 4W8LA 1UHVA 3MUAA 4UFLA 4F66A 3GNOA 1JXKA 3EDDA 3IJ8A 1FA2A 1VFUA 1OD8A 4QFUA 4AISA 3K4DA 1UUQA 4HPHA 3AZRA 3ARQA 4HMEA 1KR0A 4H8VA 3QHNA 2VZOA 2GDVA 4J28A 1WDRA 3CZEA 2IUZA 3PZUA 1V0KA 2WXDM 3VU2A 4JFUA 1H3GA 3O6AA 5BXRA 1XH2A 1FHDA 2OYKA 2QF8A 4QCFA 5E1QA 4TUFA 1UR4A 3QR3A 3W81A 4PMVA 4FNSA 1JD7A 4W7VA 3VGFA 4H7VA 2W62A 4KGJA 2NW0A 3FY1A 1E9LA 1TR1A 1C91A 2UY5A 5CG0A 4WF7A 1M04A 1H41A 2VZSA 1R7AA 4P8WA 3GXFA 3L4XA 5BYWA 2CBUA 3JUGA 3SEPA 3RIKA 4J3XA 5JBEA 3D51A 3U7VA 4ML4A 2VCCA 4CKQA 1BF2A 2OYLA 2EBNA 3OG2A 1SZNA 5ABHA 1UZ4A 1TZ7A 1TQVA 4F9JA 3CHCA 1MW3A 2BY1A 2XGIA 3DX0A 2EPLX 3WQ8A 1JDAA 1MVYA 5I6SA 1XSKA 2J7FA 2YJQA 3CZ8A 1H5VA 2VTFA 3PTQA 3A4AA 1QWUA 1WP6A 1BAGA 2NT0A 1V3JA 3KLKA 1W32A 4P8VA 2J62A 4LYRA 1ZL1A 3DHUA 3UG4A 2ZXQA 3WQ4A 1QHZA 1CTNA 2X2HA 3T0AA 3WD1A 2C7FA 3VX1A 1H0GA 3AOFA 1RP9A 3IGUA 4NXSA 1NQ6A 1US2A 1GHRA 2XPKA 2B31A 1B2YA 2EEXA 1PS3A 3L4UA 4E8CA 2XM2A 3WD2A 2ZX5A 4J3SA 3WDQA 1U33A 3OA5A 5CGTA 3OLGA 1AMYA 2YL6A 3S5ZA 1C8XA 1QBAA 3A4XA 2G3JA 5AYBA 1OT2A 3K8LA 3I3EA 1J18A 4CU8A 2EO7A 3KE0A 3VIGA 5HDRA 1MFVA 1V3HA 3MI6A 3AFBA 3ZM8A 4B16A 1JIBA 4W86A 3CZLA 2XWDA 1HTYA 3CZNA 3CUIA 1UG6A 2ALWA 3CHEA 4NZFA 1H09A 1F4AA 2D24A 4AZ7A 3L4ZA 5GNZA 1E43A 1QBBA 4DUXA 3VOCA 1JYVA 1ZU8A 4MPKA 3DYMA 2XG9A 1ZBVA 2XIIA 4CU6A 4B3KA 1ISVA 3ZOAA 1OIMA 4CCCA 1C7TA 2XVKA 3WDRA 1OSEA 4PTMA 2XVLA 1XC6A 3PZQA 4JFVA 1FP8A 4AY1A 4QAWA 1FFQA 5A6KA 2DSVA 3BLKA 4J7RA 4HA1A 3CUHA 1E6PA 5D9MA 5IXEA 4D6HA 2X0YA 2WCGA 1CGVA 1UR0A 3W6MA 4PSPA 4NXKA 4AMXA 3AZSA 4DWSB 2DSWA 1BSIA 3BUBA 7A3HA 1XH1A 4JCMA 3FHQA 3B9DA 4KH2A 4Z2GA 1JZ7A 3LRKA 2BNJA 5JIWA 1R7OA 4ZXLA 5JBDA 4Z2IA 3A47A 1W9PA 3BUDA 2WCSA 1BGGA 1KTBA 4HZ6A 2VZUA 4W93A 3EBVA 3VIJA 4HZ7A 1CXKA 3ZSTA 1LQ0A 4AD3A 1GOMA 1VEMA 2CKSA 3DYOA 4PMRA 2BVDA 5CJ5A 4U3AA 1KGXA 4PUEA 1VFOA 2GVYA 2FDMA 4KRTA 3RDKA 5IDIA 3GXDA 4M56A 1CWYA 2G3IA 1CPUA 1CIUA 3HN3A 3MUIA 4CD7A 3WMSA 2WHJA 1N82A 2CYGA 1XV8A 1W9UA 2ZIDA 3ARPA 4C7DA 1W3JA 1AVAA 4GI6A 4PTWA 5ABFB 1UR2A 5I78A 5D9OA 2XVPA 1HJVA 3UR7A 2OWWA 5BXTA 2X0HA 3W53A 3IAQA 3ZT6A 3AS0A 3AZTA 5CQ1A 3WELA 1E6ZA 4ACZB 1UZ1A 4L4OA 4D6JA 3GXTA 3IANA 1S46A 2BVYA 1UH4A 2GSJA 3L2LA 1BG9A 4U2ZA 1J10A 1W1VA 1GUVA 2RGLA 3LRMA 4AZ6A 2ZOXA 3T09A 2OWXA 4AXNA 1NP2A 2QPUA 2Y5EA 3MANA 4UQEA 1FOBA 4WSJA 4Q22A 3WY4A 1QOXA 3SCQA 3OLIA 2WM0A 4LXFA 4CGTA 3AHZA 3WF0A 2XWEA 1D2KA 2BS9A 2D0FA 5LYRA 3VINA 4NF7A 1UOKA 1UKPA 1JG9A 3KWXA 1UR9A 4J3TA 3WDIA 1M01A 2F18A 2WB5A 3AHTA 5GNYA 5LA2A 2ZUNA 3SURA 3BVUA 4MNJA 4ACZA 3WF4A 1I1XA 3VD7A 2OW6A 1GOOA 2D3NA 3S6TA 4PUDA 1E6NA 1UQZA 1W3LA 5A6JA 5BXSA 4JKKA 1W3HA 2BHYA 2V3FA 4AEFA 3WIJA 4P8UA 1GVIA 3POCA 4FNTA 2VMFA 1E5JA 2WYSA 1HJUA 2EABA 4D72A 3VGHA 3VDCA 4ACYA 3EMZA 2W61A 4A3HA 5A95A 1V6YA 4P7QA 1EDQA 3OLEA 2WLYA 3ZT7A 1EQPA 3ARTA 2BY2A 2V5CA 4CCDA 2OWCA 3BAWA 1OB0A 1EA9C 2WW5A 3WEMA 4CCEA 2JE8A 3VSUA 2V3EA 5E6YA 1GZJA 1EDGA 1HKKA 1VF8A 4EANA 1O6IA 1L0PA 5DT5A 3CH9A 3BGAA 4GXPA 2YL8A 3UEQA 3CPUA 2YLLA 5CSYA 1MXGA 2C8NA 2O9RA 5CPQA 5CSUA 1VFFA 2ZUVA 1R85A 1BYBA 1H4PA 1EIBA 1LF1A 2BHZA 5CZKA 1K9FA 1KCKA 4OOUA 1UASA 2BY3A 3EDKA 5E6ZA 3ZJKA 4H8HA 5A8PA 1ZS2A 3AIQA 5FCZA 4HA4A 2D1ZA 4ATWA 3M7SA 3N15A 1HL9A 1GNXA 3EMCA 3K4AA 3WDHA 4TX8A 2ZWYA 1V6XA 4WIWA 5FKYA 3SIMA 3WL0A 3WUEA 1TA3A 3PBGA 5A8NA 1W2PA 4A3YA 1EXPA 2J79A 1GQLA 3OLDA 3AMGA 3OGRA 2EPNA 2VCBA 3VKKA 2F7PA 3DX4A 4OUEA 1CYGA 2WZEA 4W7UA 1WZKA 4E2OA 4UQAA 4CD6A 2PB1A 3VDAA 3WFZA 4CD4A 6TAAA 1PX4A 4RL3A 4B15A 1C92A 5A1AA 1QI5A 2JEQA 3QGVA 1D3CA 2XSBA 1HJWA 2VX6A 4D6GA 2VURA 1VENA 2WMIB 1AQ0A 1H1NA 3EYPA 4ZFMA 1J9YA 2XIBA 1LWJA 2V3GA 5A8MA 1DWIM 4OBRA 4X0NA 3EJTA 1TG7A 2DH2A 3VGBA 2YBTA 2F7RA 1JFXA 1HXJA 2VRKA 3VSVA 1CZ1A 3W25A 3RPMA 2C0HA 2OSWA 3AISA 5A6BA 1OM0A 4OOZA 1VAHA 1XHGA 3ARWA 1BTCA 3CMGA 4S3JA 4TOQA 1PZ3A 1HKJA 5D9NA 2DIEA 4UQCA 2A3EA 3U5UA 3T0DA 1KQYA 3CZKA 2F7QA 2VVSA 1GQKA 4LYPA 1KBBA 3WNKA 1ECEA 1YQ2A 3WQ5A 3VD5A 1C7SA 4UFJA 3MMUA 4ATLA 3BXWA 4EE9A 3ZJ8A 2Z1SA 4Z2KA 5I24A 2Q8XA 3VIPA 3GZAA 1HT6A 1ISYA 2WMIA 4TTGA 4JFWA 2XGBA 3HG4A 5M3WA 2V3DA 2QV4A 5FIPA 3EJSA 3L4YA 2Y8KA 2AAAA 1H11A 2YDRA 4J3UA 1B90A 1R87A 3I3BA 3ARYA 3LPFA 1WDSA 3W27A 2DQXA 1JYWA 1SMDA 2FH8A 1L8NA 4RE2A 3BUPA 3N17A 1EQCA 3AI0A 3VGEA 4E8DA 1C8QA 1HVXA 2OSXA 1M7XA 1EDTA 4KGLA 3DYPA 1V08A 4GQQA 2FE0A 4AWEA 2WMHA 3A22A 5E0FA 2J75A 4Z2JA 4TXEA 4AW7A 2YA2A 4AD1A 1GPFA 1UWRA 2F7OA 2CCRA 1TVPA 2CPUA 3OZOA 1HN1A 1ZJAA 3AICA 2PWFA 2CBJA 3VO0A 1OINA 4HP5A 3FN9A 3WMCA 1VRXA 3AIVA 3H53A 3EJRA 4XZWA 3NSNA 3NDZA 4DM1A 4ZXOA 2J47A 4JCLA 3WQVA 1V6VA 4NZCA 4AYGA 3FW6A 5ABEA 2GJXB 1BLIA 1LG2A 3RO8A 3M46A 4IISA 3PN8A 2DT1A 4RE3A 5KZ6A 4V28A 3RJYA 3VGDA 1B3VA 5D4YA 1QVBA 3T2OA 2FHFA 4U2YA 2ZXBA 1O7AA 3CMJA 1J11A 4PMZA 4AZBA 1A47A 1W9XA 4DUWA 5D8WA 3PZGA 1R8LA 3I3DA 2AOSA 4DO5A 2UY3A 4AZGA 2YOCA 1W9DM 4WLCA 1HF6A 4M81A 4UQ9A 2VX5A 1GORA 1GOKA 1X6NA 4GO9A 4OZOA 2PI6A 2E8ZA 3DECA 1PZ2A 1T0OA 5M03A 5DF0A 4F79A 3OGSA 1KXHA 3F5JA 2GJXA 1HP4A 1WZLA 3SCVA 2VNCA 3BVXA 4URIA 2YDQA 4YHGA 1WB0A 4GINA 4HU0A 3LX9A 1H2JA 5I5RA 1UWQA 3WN6A 3PZ9A 3F5KA 3WL1A 2QMKA 1GOQA 4W84A 2VT0A 3TA9A 3SCSA 4UQBA 1PBGA 1XD1A 1W9BM 1ESWA 1X1NA 3GH7A 2ZX6A 1J01A 2ZWZA 3MSDA 2O9TA 5ABGA 1ODZA 3QOKA 2YA1A 3N18A 2ZUSA 4PRWA 3VVGA 4MB4A 3SUSA 1FFRA 2NSXA 1W1TA 1TVNA 2WK2A 1TQUA 4UZUA 3HZ3A 1B3YA 1TE1A 3W38A 4B9ZA 2WMKA 2XFRA 1J0ZA 4MAVA 3WEOA 2E0PA 1Q4NX 5BRPA 1ISZA 3LXBA 4MB1A 1V03A 2A3AA 2QMJA 5A94A 2BY0A 2EPKX 1I75A 2XN0A 2VJXA 1EOKA 1UWTA 4MJ2A 1V6WA 1ZBCA 2O9PA 1A3HA 5C71A 3APGA 1LWHA 3EMQA 3B8SA 3L2MA 4PBGA 4N42A 3BLPX 1CENA 1HP5A 2JIWA 2W91A 1TQSA 1VBRA 2G41A 2YDSA 2CBIA 6CGTA 4AD4A 3GXNA 1VEPA 5EFDA 1U2YA 3AIRA 3MMWA 1US3A 4V27A 3IK2A 1VIWA 3BSHA 1LLOA 3HU7A 2CXGA 1DWFM 4PMQA 5I77A 3IJ7A 4J3VA 1NH6A 5CPTA 1JZ2A 1XD0A 3RCNA 4D6FA 3ARSA 3G6LA 2X2IA 4MDOA 1E0XA 3WQ6A 4ZENA 2WCAA 5F7UA 1HWWA 2J7EA 2VZTA 4KRUA 3WKZA 3SUUA 5HPOA 4RE4A 4AZHA 1QW9A 3K8KA 4XZBA 1LG1A 3MO4A 1Q6FA 4H04A 4D6EA 1DHKA 7TAAA 4V2XA 4CN4A 1G0CA 1VFMA 4PMOA 2VL4A 3W0KA 3D5HA 2DSZA 2FGZA 2E4TA 2J8GA 4XUYA 1J0KA 1P6WA 1PJ9A 1LJYA 2XJ7A 3ZT5A 4FNRA 2VZVA 2BFGA 2Z1KA 4U33A 1GCYA 4PCTA 5HBFA 3WNPA 4BF7A 2ZUUA 4GZIA 3WD3A 3TTYA 3WENA 3HG5A 3VX0A 4CN1A 2BV9A 1LL7A 1X6LA 1EOMA 4CD5A 5AYIA 1MQPA 1V3MA 4CVWA 4HMCA 1UD3A 3VIIA 5D8ZA 5HOSA 4B3LA 3AXHA 3VPLA 4M8UA 4BA0A 3LMYA 8CGTA 4FLSA 1HNYA 3ZIZA 5C8BB 1HJXA 3MUZ1 2G3NA 1CNVA 3OBAA 5I23A 3BSGA 1K9TA 1UR1A 1R75A 4UR9A 3A21A 4P7RA 2D2OA 4CD8A 4UCFA 3NDYA 2E40A 1JI2A 2EAEA 3WNMA 3ARZA 3NIYA 3WH9A 3SUVA 1CBGA 2AMGA 2CITA 4JKMA 1UA7A 1BFNA 4GI9A 3GXPA 3L4VA 1FP9A 1E73M 3THDA 2VQUA 2DT0A 1NM9A 2VO5A 3N12A 4FF5A 1KGUA 3WY2A 2WKGA 3VIFA 2Y2WA 1W3KA 5DO8A 1ISXA 1OIFA 4D6CA 3EJUA 7CGTA 3W29A 3TOPA 1SR0A 4GI8A 1ITXA 4B9YA 1GJUA 3LXAA 3SCOA 1CXIA 2E9BA 4WJXA 4R27A 1W9VA 2WVSA 4KWUA 1YHTA 3CHDA 1OD0A 4EAMA 2F61A 2XSAA 5A6MA 3WUGA 4M24A 1NOFA 1WPCA 4AD0A 1K6AA 3EDEA 2TAAA 1UH3A 3WY1A 1F4HA 3AHXA 4TTUA 4UOQA 4UZSA 1IZJA 4BCEA 1W2VA 2W63A 2JALA 5M17A 3BMVA 3E1F1 1RP8A 1WO2A 3UETA 4GQRA 3W37A 4AIUA 1TUXA 1XYZA 1Y7VA 1JZ5A 1EO5A 1E6SM 1WZAA 2VI0A 1IZKA 3DX1A 4HMDA 1C8YA 4D1IA 4PEEA 3D4YA 1OGSA 2FH6A 1UKSA 3DDFA 3PZVA 1KR1A 3PZTA 3U57A 1C93A 3VM7A 2PF0A 4J3WA 3TTSA 1CGTA 4MAZA 1OT1A 2XVGA 4ZE5A 1J0JA 4IM4A 2FYVA 3QHOA 5JBFA 1QWNA 3CC1A 1QHOA 3CO4A 4OBSA 3WF2A 4AD5A 3KZSA 3AIBA 1Q6EA 1VJSA 4JFTA 4XX6A 3GM8A 4AIEA 2OYMA 1Q6CA 1VBUA 1OWQA 4JIEA 2DDXA 4PCSA 3WEZA 4JHZA 3ZJ7A 3BCFA 4M1RA 1V6UA 2YBUA 3ARUA 1V0MA 3SCRA 3VMNA 2W66A 3VIHA 4HOXA 1TA3B 4X0VA 3GDBA 2ZUMA 2DIJA 2CHNA 1DTUA 1JF6A 2ZXAA 1M03A 2YL9A 1R34A
chains in the Genus database with same CATH superfamily
3CU7A 4ATTA 4NY2A 4XN9A 5I8CA 3MBED 5ICYB 2HVJA 2LOEA 1DE4B 3NH7L 4GKZA 3LKPB 2VFHA 1YX1A 5I1KH 43C9A 3AY2A 1OAUL 1OIOA 2UY4A 2JJSC 1LBLA 1I8IB 4D9QD 4JGDA 4V2BA 5IEHB 1A4KB 5T1LB 1TVHB 4Y9FA 1H9DA 3BP5A 2YS4A 4XNDA 2N7SA 4YC2C 1D5MA 2C9VA 5DLCA 3GDKA 3DGRA 1A0QL 4RAVA 2WVVA 1E55A 4ZAKB 1Z9PA 1W17A 3SUTA 1AH4A 3GLDA 3TJEL 4KVNL 1JRHL 1A1NA 2X4RB 3CSYA 4XNUH 3CSGA 1NP0A 1DVYA 4X7SL 3MCLL 1C90A 3K1DA 3U3HA 1JAKA 4K5PA 3WD0A 4QRRE 4JFPB 2JWYA 2IS7A 1R3LB 1KKRA 4UTTA 4E9VA 3N11A 4M7TA 1KXQE 4RLIA 3TYGH 1NBYB 3H7LA 2CLZA 3RY6C 1FNGB 2OXNA 3O2LA 1CMOA 1PX8A 3U30B 1M71B 3EOTL 3Q5TA 3M47A 4NAEA 1OD7A 4G7SB 4HEME 3VG9B 2B2XH 5ALCH 5CSBA 2TPSA 3I75B 2NNAA 4HB7A 3QEZA 1KKOA 3HNTH 1K4GA 4H00A 1K4CA 2F74B 2J55A 1T66D 3TCXA 4KKCC 2D7TH 2WZ6A 1NC2B 4L1TA 1UG9A 3AIUA 1UC4A 3ZJ6A 4OCSL 2JF7A 5E09A 1UC5A 3BLBA 1ICQA 3DTDA 4BFFA 4MD0B 3N73A 2BVQB 2ZRYA 3CFEB 4YXGA 4DFIA 3RCMA 5AHLA 1GGOA 2X1RA 5IROD 2WUBL 3GKZA 4IRSD 1JFHA 3Q9QA 3KS0H 2I5YL 5ECJE 3BCJA 1YC8A 5L4MA 1E8XA 5C09E 2OS7A 5E2VL 4QX4A 4RCAA 2MHAA 4RA0C 1L2UA 3BRDA 4G3YL 3EYQD 1G4TA 1GEHA 4PUUA 4E68A 4MCYB 3I6RA 1WDPA 5JUEH 4GIRA 3L8QA 4HN4A 1W5QA 3BZ4B 2J24A 4PJAF 4WJG3 2V2XB 4G6FB 5FYKD 4O58H 2I60H 4G9FD 3QXDB 3GSXA 4KRLB 2INEA 3UBHA 2X2JA 4D9RE 3PFMA 2JK5B 1KIUB 1N6UA 4LHUD 3ZHFA 2O0TA 2DQIH 2WC3A 2ZA1A 1IAIH 3A4DA 1GW1A 2C18A 4AGLA 4Y4KA 3E9TA 4FYRA 3CDZB 2DSKA 1V55B 1KLZA 3LM7A 5C08A 3WKQA 4LPXA 3W7DA 5DD5H 1ITQA 4D0CB 1ZLWK 1PZSA 4PAZA 1I9EA 3V2AR 5D7LA 3ANUA 3DO4A 3GW3A 1QX1A 2MH4A 4CCZA 2O61A 1F1AA 4UTAL 4XZ9A 5FYKL 1RCOB 5E03A 3GYRA 4UTBL 3WEXB 4WEEA 1SO4A 2GUYA 5E1AA 3RMEA 2UV8G 4F8XA 1ZRQA 4LX4A 1AG1O 1VJZA 2OQLA 1UWUA 3C2OA 4H8NA 4HIHA 2NZLA 5FYLH 4XPHH 5E6IA 2YAPA 1I7RB 3MC5A 2NUTB 2EG7A 2WVUA 3EO1A 4YH6A 2FHCA 3B83A 3HQNA 4J3OF 2ICEC 7REQA 1ZLEA 4RQQB 2VKWA 2YR3A 2PKDA 4WOZA 3B8WA 4DP8X 4N2NA 2WJ7A 1AGBB 2VC9A 2WIMA 4WWKB 1YMYA 2X38A 1PHWA 4HKBB 3FB7A 1J79A 3IDNB 4UFMA 4KTGA 5I17B 4JJ5A 4PS4L 5CJQL 2IV9A 3UG3A 1M57B 4PRPA 3UAEA 4O11A 4W68A 2ZRZA 3C8HA 4MAUH 4LRIA 1DQXA 1DXFA 4R7DA 1NGXB 3C2RA 3P73B 1TPFA 2EVHA 4GJJA 5DK0B 4FI4A 5A2AA 2EG8A 5FL1A 3GD6A 1YEGL 2ZICA 2UUDH 1UD8A 3N3EA 1KWGA 4FOJA 4FFVC 2YD4A 4KU1A 2FO1A 1J12A 5EOQH 3EA1A 4WI6A 1GHSA 1MJJA 1MVUB 4MVAA 3GMRA 4JY6A 2JI3A 4GA8A 1OLLA 5DHVA 4OV6F 5BRQA 3WLNA 4NO2A 2PS2A 1JGLL 2F08A 2J7LA 4WI8A 4Q8OA 3LN5B 1HNFA 3GSNA 2GDQA 1J5OL 1TKKA 3CIWA 5HGBB 2M2DA 3CH8A 4PFEA 3KXFB 5I73C 4P3DB 3DH7A 3A9BA 4D9LH 2A6IB 4GXUN 2H3XC 4MNQE 5ID0A 2IOMA 3VXRA 4JAWA 4EPBC 2NY6B 4R6UA 3GNRA 3T44A 3KPOB 4OFCA 3QARA 5DVNA 2Q10A 3SQLA 4JQIH 5HGDB 3G3DA 4XMKL 4FLOA 4DZAA 2X1IA 2BFVH 3GXUB 5KVFH 5C0FB 3FCPA 3O05A 3A67L 4WTXA 3OB8A 5AYXA 4LU5L 1K5NA 5C2GA 3DROB 1TJ0A 1KJ3H 4F2MB 4G8EA 2NY3B 4BUHA 5CHNB 4I8DA 3ATDA 5A8QA 4WVXA 1GC1L 4UFIA 2VDOB 4F2BA 1XYLA 4U1JA 4KJYA 4IU2A 2BTMA 4M1GL 2YN5A 3WUWG 1MEIA 4LCIL 5ESAB 1PIIA 3BJTA 3FT4B 1G7MA 2V33A 3JTTA 2VOTA 1MFDL 3ES6A 3LD8C 3PS6A 2GJ6B 4U4BA 1TEFA 3KPLA 5B4MC 3N4FA 4YFDB 4N85A 1E8ZA 1FFNB 1P4LB 2YSTA 4RMSA 2EH8H 1CICC 1SMAA 4L7ZA 3UP6A 2G97A 1ZJHA 1S7UA 1KTKE 4XZNX 3MRIA 3DESA 2PBOA 1WOAA 3FUFA 4EIZC 4R9XA 5D7JA 4NO5B 3EYFA 2YWYA 2ZX7A 5HP5A 3QP3A 3P54A 4AQ1A 2JEPA 3SE9L 5FDWB 4HUVA 4RFNC 5IKCA 4RWYL 3F7PC 5IUSA 3QFDA 2VXVH 1KBJA 2VWTA 1CFQA 3S97C 5BRZB 6A3HA 1Q66A 1SHMA 3SCWA 5HVHC 4XNZC 1D8CA 3TV8A 3CZSA 3NOEA 3ZSSA 3NFPA 2BP8B 4TVDA 5F3BB 4DZBB 1LEIB 3VI3A 4JZJA 4IS6A 5I66A 1JR1A 2NCMA 4UR7A 3S1WA 4S2SB 1UHVA 1YMMA 2Y1VA 1KN4L 5H8UA 3NSJA 1F8MA 2RH9A 4K9EL 2BIOA 2H8PB 2E28A 5HJGA 2BG5A 5C0IB 1NGWB 2CCVA 2V63A 4LMQE 2EC9U 4RESB 1KG0A 2P3YA 4PVLA 1CDJA 3BWSA 1WH0A 2ADFL 2PDWA 4XP4L 2FQEA 4OZ4A 4P8WA 5C2BL 1PKLA 2DDQH 5CPOA 2VGGA 3U7VA 3B7YA 2EBNA 3F64A 3L1FA 1UZ4A 3GVWA 4HX1A 1JBJA 2H0FA 3WEAA 2FB4L 1TYGA 3CVIH 1QUPA 1U8LA 4K23H 4NYLB 1XDJA 3HUJA 1HYRC 5TF0A 1QWUA 3LEVL 1NQKA 2CJUL 4PQXA 1HHGB 3CHSA 5EDXA 1RR2A 3DFTA 3E2HB 4R85A 4J4PC 4Y1AD 3DTUB 2DAVA 3V5HA 2LAAA 4I18B 3V4PA 4FADA 3OA5A 4FOKA 4GVHA 4N3TA 4AW4A 5IOKA 2PO6C 1XIWD 3SE6A 3SQSA 5BS0E 4ANVA 2PPAA 1T99A 4P2RB 5JLZA 2HWZH 1CC3A 1KYDA 3KPNA 1A6AB 5I16A 4L9ZA 3L4ZA 3UJEA 1TPB1 2W88A 4HSOA 1F6AB 5IMLB 3HPFA 3C2SA 4HNLA 1S7QB 4JIHA 1ILUA 5LBSA 2IQ9H 2O6CA 4QAWA 5D7SH 3F7VB 5AOIA 1DTNA 2VXTL 2YOAA 2ROXA 4AMXA 3AZSA 1QO5A 5D37A 1DFBL 1BSIA 5IUCA 2FGBA 2LAGB 1TQXA 3B9DA 5HMEA 3LRKA 3RZCD 1VZHA 2OMZB 4BWTA 3LD5A 4OAWB 2H3DA 3RLHA 1AZNA 5D96B 3IXAB 4QHNA 4D3CL 3B9KA 2O6PA 3V4VH 1CIUA 2JGYA 2FPYA 1O1HA 2X1TA 5IP4A 1RY7B 2PPEA 2V17L 2PDMA 4HIXL 1YE4A 3HM7A 1K8ZA 3VRJB 1KJVA 2MNJB 3QWOB 1OGAE 4L4JA 3WAJA 3MJMA 3NQKA 2XVPA 4J2PA 3UR7A 3URNA 3CK0H 4XSLA 5C9JB 3GXTA 4YSRA 2IDTA 3JWNE 3MLYL 2OMVA 3QZPA 5REQB 3O81A 3QV7A 4GW4B 1GUVA 4PBWD 4RISH 5DJDB 4YLWA 4IH3A 4KFZC 4UQEA 4O50A 3W7IA 4IK7A 3WY4A 1PL3A 2VMJA 3OLIA 4I3RL 3QUKA 1D2KA 1UKPA 4H20H 3WGUB 1KTLB 4Q7DA 3ORJA 2SEBB 2DY3A 3HRZC 1ZUAX 2GTWA 1T8XA 3NZPA 5EMMA 1IAKA 1POKA 4N0YL 1W1A1 3VXOA 2V5KA 2F8OA 4QDWA 1U8HB 4IG2A 4ZJ9A 1A5NC 2WYSA 3F5WB 1ZLUH 1OP4A 3F4NA 1AW2A 3GG0A 4ACTA 2FT8A 3ARTA 2V5CA 3C2AL 3NSYA 3D05A 3PP4H 4WW2F 4WUKL 3WEMA 1MQKL 1V54B 5HJDA 2MOGA 4M19A 3FX4A 2C8NA 5DO2C 2FLBT 1D9EA 2YD5A 2BHZA 4F48A 2IAMB 2VGBA 4LLDA 4OOUA 5BJTB 3FO0H 1MWAB 1AZBA 4H8HA 1L6YA 3QQ4A 1LO5B 2F54B 2QUNA 5DQPA 4OCLC 3F58L 4HIIA 3S9DB 2EYRA 1YRRA 3OX8B 5EMJA 1ZGLM 2HPTA 2VDPB 3HAEH 3DPBB 4WDIA 3T07A 2VCBA 3DX4A 3RGVB 1CYGA 4ZO9A 2I7SA 1P7TB 4KTEH 4YDVB 2GC4C 4QHMB 2XSBA 2I5IA 5E4EB 3G1HA 4OCNC 5DUPL 3QCVH 3ECBA 2FLIA 1PKQB 3RPIB 3U2ZA 3V1PA 3VGBA 1JZGA 2YZ1A 4IICA 1HGYA 3UTQA 2CKBL 5IEHA 3W71A 2PUQT 2UY6B 1TVHA 3LYRA 1A6WL 4K7PL 3ARWA 1XHGA 1MCPL 1HQ4B 4S3JA 2ALAA 2J8UF 5D9NA 1VFBB 1CLYL 4M5PA 1NBZB 1FYTB 5KVGL 2XFWA 4ZAKA 5T5FA 1C7SA 4FYSA 3UH8A 5I24A 2Y85A 3VIPA 4NZDA 3ARGA 4B91A 1HNGA 3L4YA 3F2CA 2YDRA 3NCYS 3I3BA 3GIYA 1R3LA 3WYZA 1PWMA 1P4BL 1CX9A 1NBVH 4J35A 1U8NB 3VI3F 1EDTA 3DYPA 5EC2A 4GQQA 2FE0A 1NBYA 2J6EA 5GISH 1VCAA 1GZHA 5JNYA 3AT8A 1RUPH 4JDTL 1HN1A 2HLFD 1BEYH 2UX6A 5G5IA 4EI0A 4DVOA 3HMXA 4IOFC 4XE5B 3D07A 4NJGA 5FJOA 5A16A 5E8DH 1N8IA 5SX4H 4PJAB 5IT2L 4N86A 5KZ6A 2YD9A 4U1MA 3LB0A 3S3PA 5D9SB 3W74A 2ZA3A 3U0TA 2P80D 3MJ8B 3V4BA 5KBLA 2WUCL 3T40A 4X9HA 2PI6A 4MD0A 2IF7A 1SFTA 1U8QA 1UMYA 4EI5B 2YD3A 5DELA 3MNDA 2OMYB 3SCVA 4W9DC 2YCLA 1DUZA 2XNAA 3X14A 1H2JA 5JORB 4IMLA 3HUJF 2BDQA 4MLRA 1RVGA 4ZW3A 3WMPA 4OLWH 1BCIA 4S3BA 1X1NA 1EPVA 43CAA 4AWUA 1INEH 2IANB 4XOEA 4MB4A 3QJQB 1TZAA 3QJVB 3ITCA 2OXGB 3LNIA 1O5XA 4F33B 4I0PD 3GD1C 3O2WH 1W72A 1WD9A 3QHTC 4R8WH 1U2HA 1AGCB 4KC3B 3VA2C 2ZOKA 4HIJA 2AITA 2AJXH 5E94A 1UYWH 5MENE 3L2MA 2UWEE 1MPAL 5T33L 1J93A 4AJYV 2BOCB 9PCYA 5LNVA 1VEPA 4PIBA 3AIRA 1KIUA 5FF7A 4DZIA 1PTZA 4F9PA 1SO6A 3OKNB 1YNLH 4JY5H 3LDBB 2PCYA 4RDBA 3TEZA 1RSYA 3G6LA 3CDZA 1IO4C 2RA1A 4AG4H 2VZTA 3HS0C 1S9WA 4LAQL 4E9XA 4A7QA 3T4YB 3BXNB 4MZIA 2QVFB 2PE4A 2ANUA 3T8VA 3MO7A 4KJPD 1VFMA 5LAXA 3QPXL 1A9EB 5GJTL 3W39B 4XUYA 2Y8UA 2XGZA 4FNRA 3WEXA 4R3UA 3CC5B 1N8FA 1UWFA 1SXNA 3L5IA 1FUYA 2O30A 4BY3A 1EGVA 2NTFB 3TTYA 4GPVA 1S1PA 1LMIA 2PDKA 3CDGA 4L1SA 3VTMA 1H8SA 3P02A 3S5OA 4DN4L 4R0LB 2EP6A 2E40A 4BKLB 3UXIA 3I6SA 3WNMA 4HHWA 3ATZA 3WN5B 3RGTA 1AFVH 4Q6KA 1KTRL 2PNDA 4GI9A 3B2VL 2GJNA 5FGCE 1FP9A 2WBWB 1E73M 4BV1A 2MUCA 2JKJA 3V0TA 1AGBA 4O18A 4GBXD 4N9DA 5F7FA 1ISXA 3EJUA 4HKBA 3AU6A 4JG9A 3FSVA 3RGHA 4XKYB 1HC1A 2WVSA 4US5A 3DKJA 1B0RA 1OD0A 1T03L 4TQEL 4OZFG 5A6MA 1TLKA 2GTZA 2ESVE 4TTUA 1B88A 1IZJA 4XPTH 5DK0A 3V0WH 1R5IB 4GQRA 3KYOB 3LNPA 5K1JA 3O3EA 2MRYA 5ADPL 2W0FA 3PUUA 4QUOA 4ZMTA 5GRXG 4AI7A 1KR1A 1MJ7H 3PZTA 2AF2A 5CEYA 1L6PA 2HVJB 3INUH 4OCWL 1IAIM 4QXUH 3GM8A 1UBSA 1FY6A 5LNRA 4DI8A 5KVEL 3Q8FA 5SWQA 4QG8A 4R4FH 4NQED 3E38A 4QCIA 2EJAA 3DO7A 5CCGE 1XWVA 1FXPA 1XLEA 1DHPA 3ECQA 3VNYA 1D5MB 3D30A 3ZMEA 2A6IA 4RAVB 2WVVB 1BD0A 2CZEA 3PYCA 4FA3A 3GMPA 1A1NB 1Q72L 3KPOA 3CSYB 4QNPE 3LH8A 1N6VA 3WLQA 1UROA 2XN1A 1IE5A 5D4IA 5BXPA 4HXAL 5HGDA 1NVMA 2FWLB 4NN7B 2XSKA 3S2NA 1TFVA 1DLFL 1BFVL 3AS1A 5I5JA 4F2MA 4PRAA 4DB7A 2GDUA 2CLZB 2VVNA 1W54A 1XGYL 2O5XL 3O3AA 3QRLA 4H88H 3TE9A 1J9CT 1XWYA 3VDHA 3VB8A 2NY0D 4NAEB 3MVSA 1KTCA 1B3ZA 3QV9A 3MKGA 3EIFA 3GEWB 4N5UA 1E5UI 5IEKA 1H49A 1M5WA 3MSPA 1I8LC 5ESAA 3LKNB 3BX7C 1UOZA 1O6VA 2F9BT 2YUZA 1KPVA 3FPXA 3FT4A 2NNAB 5GGQL 5KW9L 3MNZA 3ZPDA 1K4CB 4CC1A 4J12A 1E9IA 3VW3L 2QSTA 5FOOA 2Q3OA 2ZOLA 3OKYA 4UXDA 1QTYT 2R39A 2X28A 3WIHH 1WUFA 4N4YB 3UC2A 2QCMA 1E70M 5I71B 4XZLX 2NX5D 5HI4D 4GXVL 3MY9A 1QLEH 4UTCA 3DK2A 1G7QA 4LEOA 4UNUA 4UIOA 4FQLL 4NO5A 1E4NA 3LBCA 1ZA3A 1KCUL 4MUPA 3O6FC 4K7PX 3E5BA 2BW4A 1JZHA 4DP6X 3QN3A 2MHAB 3T0EE 2L7UA 4ANXA 4MRCA 1TCDA 1YKWA 5BRZA 3SDAC 1C9DA 2YFNA 3F62A 5AAMC 1AQDA 3NG5A 3P30L 1EJXC 2BP8A 1BVZA 3IPFA 1QPOA 3WJSA 2Q6WA 1FP5A 4OV5A 1MW2A 1CD9B 2WBGA 1ACXA 4DPCX 3EJPA 2A6DA 1PPIA 5DJAA 2WSKA 3OKOA 5DHEA 4KNTA 4GAFB 1E5BA 1H5BC 1CB7B 1CGYA 3OVQA 5CLYA 4KMLB 4ETYA 2OI9B 1HE7A 2GQ9A 5L6YL 4NJJA 1GS7A 2H8PA 4A7SA 5C08B 1OGAA 4PI2A 2QUMA 3LDVA 1I8JA 1UOVA 4POZC 3V7MA 5D7LB 3GUTA 3JWDH 3PHSA 4PJGA 2O61B 2F53D 1GVSA 4H9ZA 4FLQA 2QIWA 2XZCL 2EXWC 5E1AB 3BSZL 1OCQA 4CUCA 4FNUA 3UYPB 4D6IA 2J7CA 4B5XA 3F01A 5AENA 3MS8A 1KGCE 2HWGA 1CXHA 4TSAL 3OZLA 4W6WB 4LALA 5DBUA 4JL2A 4J2MA 3S3DB 5E6IB 5L0QB 4GSRA 4U1GC 4AY0A 1XFBA 1ID2A 4UV7H 3UERA 1VDGA 2HRPH 4FB7A 1FG9C 1I8KA 4KKPA 2F1AA 3EO1B 1Z41A 3KPPA 2RAMA 1HHGA 1Y6NR 2EADA 2ALRA 4NZJA 5FFLA 2CGYA 3WJJA 2G2PA 4ZW6A 1T21A 4QGTA 1TITA 2VR4A 4MZ2A 2VQ1A 1WFNA 4XNMA 1VLWA 3D0AA 3FB7B 3RG1C 3JWDC 1NIAA 4JJ5B 3V0JA 4PRHD 1I1AB 4PRPB 2OZ4L 5ITBL 2C0AA 3RPTA 2VR3A 2XY1A 4JDVB 1PW3A 3TZVA 3SGDI 2FEEL 4YHML 3ZDXE 3KP1A 4E9TA 4W8BA 3D2TA 2QFPA 3THAA 1XCQA 1AXTH 3C5ZA 2VLRD 1WUNT 5SX5K 4KXZH 3PWAA 4GC4A 1YEHH 2CUHA 3T3PE 3HNSL 1G5AA 2EO9A 1MJJB 1B1YA 3NPUA 1GOIA 1WA3A 3GMRB 4JY6B 5IMLA 4H7ZA 2AJZA 5DHVB 3GC4A 4IZGA 3TH2T 1TTGA 4KJWC 3G0XA 5KZMA 1DJSA 2I32A 2IOOA 1S7QA 4GSDH 1QEWA 2WCPA 1TQJA 4K1GA 3G18A 4NLAA 1N0XH 3EUUA 3OWEA 4JGUA 1TZZA 3SCMC 4U7MA 3GSNB 4GP8B 4A2HA 3WFEL 3KYAA 4Q32A 3B8VA 4MJID 3N2JA 4TNGA 4X9FA 2PGWA 1DVSA 3CV7A 2WHMA 2EHHA 1UZHA 4OZGE 3AYRA 4FQ1H 2OMZA 1KPUB 3COTA 4S23A 3KTXA 2ON3A 3VXRB 1GK8A 5ERWA 4WK9A 4RH4A 2DUAA 5IQNA 3CE1A 4EXPX 4BQ4A 4TPRH 1X5HA 3KHJA 4X6DE 1HG3A 1CFNA 3VM5A 4R88A 5EU6E 2KDYA 4J6IA 1ZRUA 2I56A 4WW2B 3PRZA 3V7AG 4NL1A 2J5LB 3A5VA 4TUKL 1K5NB 4WRLA 2HB0A 2ZOUA 1A3LH 4G8EB 4HWBH 1JPTH 2R14A 4YHOH 1OGTA 3PV6A 1DN0A 3CIVA 5FGSA 3VFMB 4U1JB 4E0CA 4GW4A 4KJYB 3MBWA 4AUBA 1JJKA 3A6CH 4BDVA 5LA0A 2IBZY 3KZ8A 4L5FE 3TJHD 3CLFL 3ES6B 2VDNL 5D1ZC 2I17A 1JNHB 2R0LH 1EK3A 3N06B 1KQZA 4JREB 3L12A 3KPLB 4ECNA 3MKCA 1ZTXE 4FZ8H 4OFIA 3QUYD 3FKRA 1BZ7A 4LSBA 3MQIA 4HU2A 3AROA 3ATBA 1IBGH 4FNQA 4FTVA 4ICWA 3MRIB 1FH9A 1GOFA 5F2MA 3TN6A 5JHLL 1SVCP 4C6DA 1YYLH 1SFJA 1VBHA 1H19A 5D7JB 4HS3A 3UCRA 3EYUL 3EYFB 2PLJA 1QR1A 4DO6A 3L3DA 3OPSA 3IWVA 3NL2A 4WKHA 2J8UB 4LRNH 5IQ7H 4FG6C 1HVQA 3FQRA 1XL9A 2J7GA 4HUVB 4I8YA 4YWIA 3M88A 5IKCB 1ZAJA 1HKLL 5U7SA 4DGUA 4F2FA 3X13A 2FQIA 1CFQB 5L7XL 1TTCA 4P05A 3QJZA 3TC6A 5BJTA 3QWNA 3FUHA 5DMNA 3DBSA 5E9AA 4LSTH 3QTPA 2FVNA 1LO5A 1PCXA 1HJBC 1YPFA 1MQ8A 3QDME 4I90A 1N5YH 3NFPB 4LL9A 1DBAH 3RPKA 4DWSC 4DW2H 3VI3B 4YE4L 2OSLA 1N7KA 4JZJB 4IS6B 5I66B 2P53A 2YPLB 3KPRD 2LFEA 4X9IA 5F6HI 3V5CA 3SCPA 1P7TA 1YMMB 4YDVA 5KSAC 4YEFA 3L23A 3MU7A 3VGAC 4HVXA 4GUJA 1ZZMA 4LVGA 4IRZA 4F92B 4A8LA 3GH4A 1GZPB 1KG0B 3MV01 3J7HA 3DIPA 3KR3H 25C8H 1XF4A 2CRMA 2C13A 2KZBA 4OZ4B 1INDH 3W1MA 3SPIA 1X5XA 5LNUA 1KCBA 1HZKA 2FYYA 1UUQA 4BELD 1G7VA 3ITYA 4IGSA 4HX1B 1OAJA 2WZPD 1U8LB 3O6AA 3O6MH 3NJNA 1FNSH 1FHDA 5CZ0A 4RNJA 4IMCA 3QS3A 3HUJB 1I3GH 4W7VA 1WUZA 4PPTA 3BJLA 4S1QH 4LSPH 3ZBMA 5BPPA 2EPHA 3SEPA 5ANMA 3FUJA 4OT7A 3KMDA 4XOAA 1YNQA 4CKQA 4UBDD 2VDLH 1S9YB 3GO1H 3ZGIA 3D4CA 1RURL 1E8WA 3V4PB 3P74A 3GTFA 4YHKL 1ZXKA 1JPGA 3LTVA 4J5NA 1HSAA 3FONB 3RITA 4XCCL 1I1YA 5DD1H 5CP3H 4PJGF 4KEMA 4ERSH 4JW3A 2C7FA 1JNLL 4GVFA 2RJMA 3KPNB 5B1KA 5I16B 4EI5A 2DQCH 1NEZA 5JMUA 3WD2A 2NNRA 3TYZA 2L3BA 4LHQB 1PY4A 3S5ZA 2XIDA 1HIMH 1NU5A 2WAHA 3ECVA 3QXUA 3S1UA 4ZNEE 3G6AA 1HTYA 3CZNA 2KPWA 1UG6A 1TETL 1QNZH 2CPCA 5AVRB 3DC8A 3KRZA 4FXSA 3E2VA 1O0VA 5GZNA 4OECA 1RY8A 3N2BA 5KJRL 1JYVA 1NLBL 4KFPA 2YCKX 4P8QA 1OIMA 1VYPX 5J4MA 3RHGA 5A6KA 4UF7C 3CQPA 3EAKA 2BOCA 4PSPA 3VA8A 4LH8A 3MBFA 1IRAY 4M7KH 4LCWD 2FUTA 4MS8D 3UA3A 1I1FB 4W9EC 5AWNH 5FUCE 1KJVB 1GOHA 2VEIA 4GRLC 2QLVB 1U22A 1CXKA 1YEDA 1GOMA 2OMVB 4S11A 4QLWA 3T4YA 3LS4L 1VFOA 4TUJA 2PTXA 4WUUE 2VM4A 4HD9A 2A83A 2WXHA 1BVWA 1YUHB 4A2SA 1ZWIA 2YAMA 3QA3B 1A9EA 3DJSA 2HYMA 2O93L 1XI3A 5CFHA 5EFIB 1SQ2N 4WEBH 1QFWI 3U7WL 2NUXA 1TFPA 3PL6D 1F6FB 2HT2C 1RK7A 3C56A 5CSGA 2NTFA 1LDPL 4NHCH 2CHRA 2GTWB 1KJ2B 9XIAA 1IAKB 1XR2A 2IWGA 3OR6B 2VAAA 4N9GA 4XX1G 4LOVA 4ISVA 3KDNA 2OJEB 3WN5A 1J8VA 3MJWA 4M6OL 4R96A 1OHLA 4AYMC 3KWXA 3AHTA 2B7DT 2K78A 5CZXC 2ZUNA 5DMGD 3BVUA 4NWUL 3UX9B 2HXUA 2D3NA 2NQ9A 3BPWA 4J3OG 2WV3A 4LLDB 1X9QA 2N56A 2WXNA 1M9SA 2VERN 3DUSA 4AQOA 3NCCB 4UT9L 1V8EA 2EYRB 5DWUL 3BKJL 3MA9H 2PGFA 4HXBL 4KK9D 3V0FA 1U3JA 2V3EA 1L0PA 1AG0A 4WDIB 4GXPA 5I1AA 1FWAC 1OLZA 1UP3A 2C9SA 2WJZA 1VFFA 2IH1A 2PCFA 4LP5A 5FCZA 1B2WH 3ECBB 2C1HA 4DYEA 3UTTD 1EFZA 5J6HA 2OJZH 2V5TA 4XWOC 3CK5A 4E2DA 5FKYA 4G5AA 1H6TA 2CBPA 3B9OA 3UTQB 2Y7GA 2FPVA 3OQ8A 1DJZA 4PUBL 2CDGA 2BASA 3BW2A 2YSSA 3AY4A 5E9NA 1IE7C 3EFDH 2WBJC 3ABGA 2CR0A 4I1PA 3ALXA 5A8MA 3ARGB 1Z6KA 5EUOE 2IKGA 1UFGA 4WDTA 1W8NA 3T2LA 5C3IA 2C0HA 3KPSA 5B3NA 1VAHA 1U21A 1XRSA 3HI6H 3N14A 1QKZH 3JWOH 5EC2B 1XYBA 2BIQA 3DFHA 2BWIA 5BQDA 5JNYB 4Q74A 2X89D 1MRCL 4LVDA 2XGBA 4F8QA 3RVUD 1CDBA 1IE4A 2AXGA 5A16B 4U0RC 1R38A 1HYSC 4IBSA 3US1A 3W27A 3LKNA 1W0VA 3FDWA 4KRPD 5TF1L 2O7SA 4U1MB 2KYIA 4RGNE 2YBGA 4JFDE 3RLGA 3U0TB 1B4LA 2PP7A 3P7YA 4G9PA 2VWEE 3KAOA 3EYSL 4Y6GA 1LK3L 2J27A 3CFNA 3S35H 1U8QB 2J6XA 2DEWX 1IWPA 4A35A 2HSIA 3KGSA 3M6YA 4TOYL 2YCLB 1DUZB 3QY8A 2XNAB 2A2IA 4F8LA 3X14B 4ORZC 4OQTA 4IMLB 3DX5A 5DURD 4D0BA 3EXRA 2X41A 4AZBA 1NCDH 4DUWA 3KM2A 4HBCH 4R26H 43CAB 2FKPA 2V30A 3I3DA 2QEZA 4WI9A 3OAZH 1H7XA 1A7OL 4H4NA 3SECA 5I74B 3C0QA 4LKCA 4PP2A 1IBYA 2GK2A 1FUNA 5M03A 1W72B 1PYWA 3OOQA 4F3HA 2MQGA 4ZX3A 2ZOKB 3O9WA 4HIJB 4DRSA 5E94B 5AVXB 1C12A 1GOQA 5AW8B 1OARH 4MNQB 4GY7A 3PB0A 4E4UA 4DN3H 1Y07A 1EIXA 4KAQH 4L80A 1MELA 1YEYA 4UTKA 1FDJA 3N18A 5HK4A 1G9ML 3DN5A 1OAZH 4X6DA 1CDYA 1TE1A 1MEHA 2DLFL 2W6RA 4PCYA 4MB1A 4LS0A 2QMJA 3UZ5A 3UDWC 3MBDA 1VGEL 1S9WB 2RIKA 4V1DE 2ZAIA 1GZQA 5KYXA 1Q7MA 4Z7VA 4AD4A 1JK9B 5LAXB 4XD4A 5BZDB 4DZ8B 1LLOA 5LGYA 3SN4A 3LHPL 4YDLC 2C3HA 1EJUC 4FXKB 1E0XA 3WQ6A 1L6SA 5CKAA 1X9UA 1MFCL 3UYPA 2X9XA 3BQUB 3WNJA 1I31A 4KBXA 1I8MA 2QJDA 3CDGB 2I1OA 4FKKA 4IKNA 1TIWA 3KHQA 4P61A 2VL4A 4QNPF 3IM1A 1J0KA 4KTYA 2E75C 4G83A 3NIDE 5C7XH 2Y22A 3V4UL 1N7ML 2APTA 4Q89A 1GCYA 3DFNA 2ZUUA 4DLMA 1QSFD 2ZZ2A 1A3RL 4B9PA 3MP3A 2R6OA 1XLCA 3TYEA 3P3TA 5D8ZA 1XJBA 2YXFA 5GGVH 2ZCKL 2XHNA 1I1AA 1B0RB 4JDVA 1MCJA 5AVNA 2GTZB 1FQ9C 1R9ZA 2VXSH 2NNFA 2Z35A 1W56A 4Z3TA 3GLCA 3RKPA 4LGSB 1UB3A 2C71A 2GZXA 2OMTA 1TJIL 3O3EB 3WY2A 4AGQA 5F93C 4AYEC 2DTML 1OIFA 3HOJA 2W0FB 3W29A 4JPIA 1CI5A 3CN0A 3GIPA 1E2ZA 1MREH 1AH0A 2UV3A 5CEYB 1X9RA 3IGLA 4L3ED 4ENLA 4O5LH 4M7LH 1G0XA 4BCEA 4QD2E 5SWQB 1G43A 1RV8A 4JVUA 4QCIB 3MHUA 2P5PA 2F8IA 3DO7B 2FAUA 3CHRA 1OGSA 4L4TE 3U57A 1KPUA 1L9RA 1NDWA 4MAZA 5LCVA 3S1GA 3TN4A 1BQLL 3GMPB 1P84K 4Q8VA 1SOXA 3WEZA 3EJZD 1PY9A 3WIIH 3VIHA 5HI3D 2ZXAA 1H50A 1IM9D 1R34A 4Q6JA 2YQGA 4WW2A 5I5MA 1G1KA 4XKMA 1XGDA 2JIXB 2AL2B 4X5WA 1JFQL 3T8QA 4PRAB 5K4ZA 5IHHA 4EN3C 1Q1JL 1P5BA 1VACB 2Z0BA 2VLKA 2NQCA 3O3AB 1JL8A 4KKRA 3UD6A 4QQ3A 3VFMA 2PP0A 2W94A 2PCPB 1YA5A 3VXGA 2FEJA 4JKPL 5IEKB 5JHDA 5F70A 4JPVH 4LZKA 3SM0A 2C16A 1TWZA 1KPVB 2X0UA 3MNZB 3ZKXB 1VPXA 1JNHA 2C4XA 2CH8A 5I6XC 3HG3A 1DE5A 1J96A 5CXPA 3WCYA 3D4ZA 1TZIA 4LCYB 4DWSD 2ZOLB 2IG2L 5BS0B 4U3CA 4HOZA 1GR7A 2V8ZA 3L7FA 3UPBA 4BZYA 2OK0L 5J06A 3F84A 5KSAD 3IV3A 2WVTA 1G7QB 4LEOB 3SYOA 1ZA3B 3IBEA 5TFSH 3MXWH 4QOKE 5D1QC 2J8UA 3VD0A 3NCJH 1G9HA 2RDUA 4P49A 3MJYA 1E56A 1TUFA 2OTPA 1A0DA 1E15A 2EXSA 3ULAB 2H8ZA 1AQDB 2NY4C 4OT1L 1VEOA 1OE3A 5XIMA 3UL4A 2GJRA 3QYMA 3ALGA 3HI5H 3EWZA 4ICCX 3GIZH 5A3IC 2Q6WB 1S39A 3TNMA 4OV5B 3OP2A 3FK3A 5K5YA 1ZLDA 4M61A 3L2IA 4B0MM 4RK8A 3KVPA 1FGNL 2A6DB 5J11B 5DJAB 5DJ2B 3OKOB 3QCTL 1WEJH 2YPLA 3U7YH 3ZDXF 3O06A 1GOWA 1JJUA 1TXKA 2DMBA 1NGYA 1GWJA 3LSOB 3SO5A 3UGUA 1JHTA 2YC1A 2ACQA 1OGAB 4YN5A 3WQFA 1J88A 3TONA 3T0WA 3DVIA 4DGWC 4YBLC 2H2SD 3LCIA 1GZPA 1S9VA 4Z2HA 4L0ZA 4UANA 3EZJB 4NNPL 4JHWL 3ZO9A 3GUTB 3DSFL 4PJGB 2VDKB 1JDCA 1XINA 3SN0A 5CGMA 3BWUC 4P5MB 2W0LA 2CZDA 5DMJB 1SN0A 4ZZFA 4NU7A 8RUCA 4CW1A 2PZ0A 4RMRA 4RV8A 1KCVH 4PM1A 1GEQA 3TROA 4Z0BL 5FD0A 3I6GA 4OZGF 2ZG3A 3GI9L 4P5RA 4QG6A 2CBQA 3PQYE 3MMDA 2X10A 3LN4A 1I8KB 1MEXL 1NIUA 3KPPB 3MUJA 1VHPA 2XFGB 4FLHA 4X6DF 1EJOL 1OGPA 1T21B 4AM0A 4HTYA 1CLZH 1S9YA 2VQ1B 3MRHA 5I03A 4XNMB 4KDWA 5KZEA 3DI3B 4Y4HD 1UWAA 2GCYB 4K8EA 3VWJD 5DQJA 5ICXA 1R47A 1B54A 3TZVB 4Z7VF 4P2QE 2POTA 3FONA 4YQXL 4HH8A 3CUJA 3F2BA 1HILA 1XCQB 2XZ7A 3ULUH 3C5ZB 3G5YA 1BZOA 3NQ6A 2GI0A 4A2LA 5CR1A 1ADOA 4JFSA 1ME7A 4C54A 5JW5A 4MBRA 3TBWA 2V0TA 3AITA 5D6DA 2AJZB 3VE9A 3QW3A 1XYFA 3B04A 4BFIB 3QRGL 1WAPA 2YA0A 1QEWB 1X7QA 4DUVA 1KTNA 1MCOL 1L6ZA 2CLMA 2HFGH 4DVRH 4WI5A 2FBRA 3L9RB 1YY9C 4M3JA 3MT1A 4XWGL 3OMNB 2KT6A 3QC5X 2J7DA 4QMEA 5TQ0H 2B1AL 4O52A 2I69A 3A23A 4WSKA 4LLMA 5M2FX 4HVBA 4RAHA 1UH2A 1OCOB 5ERWB 1W6TA 5D9PA 4F8NA 4U5IA 1FL3B 1FORL 1CFNB 4MADA 5L88H 1RJPA 3RJXA 5EYWA 5EUOA 4FOMA 1D9KA 1V0NA 4PN2A 4QRRA 4Y9NA 1I1FA 3ALPA 3FEMA 3FBKA 1GPOL 1AO7D 4I5RA 4OM0H 1JMZA 5CLTA 5JYMA 2XYLA 1M41A 1KXQA 5JXAH 5EEXA 5BNKA 3FS9A 2JELL 4KRNA 4KDVA 1OGTB 1QI4A 1DN0B 3PV6B 2YL5A 4FFZA 1IF2A 5HYJD 3GTHA 5BOOA 4GXWA 3AAMA 1S2AA 1A6UL 3MBWB 1YUHA 1TENA 3LHZA 1NCJA 4HEMA 4BDVB 4XNXL 5DK2A 3QY6A 3QA3A 3QJHA 1REIA 1NIEA 3L4CA 1UKOA 3KVJA 4Q9BA 5EFIA 1E65A 5FFGA 3MROA 1JZ6A 4BK9A 3G08A 3WU1A 5LN8A 2NY5H 5BW7C 4B9CA 3ARVA 2FWSA 1U3HA 4C56E 3TBSA 1KJ2A 1BZ7B 1RIUH 4FTVB 3H2EA 1E1FA 3WNLA 4KKAC 3KPQA 2E9LA 5I82A 5EIIB 3OR6A 2YLAA 3S34L 2WYZA 5T3ZD 4HS3B 2OJEA 2CERA 2FLMA 2VUOA 1QR1B 1E90A 3L3DB 4H0HB 3DDMA 5JIKA 3CXOA 4XWOD 4XB7A 4Q8WA 2YK1L 3FQRB 3I9IA 1HJQA 5BVJA 1LBFA 1SF5A 4PTTA 4LSRL 5C09A 3X13B 5I1JL 5FEBA 5JYLA 4OWGA 4Q4EA 5AAPA 4HGKC 3IPWA 2HVNA 3G04A 5J0BA 4HW6A 4QKTA 1UQYA 4ZUTB 4D6DA 2PRMA 3S6CA 1F05A 4I77H 4C90A 2OSLB 2LLNA 1OGGA 2IPGA 2ZWKA 3WNNA 4AZCA 5T3ZL 1GOGA 1SBSH 5JHAA 4KKBC 3SDOA 1FTXA 2P8CA 4NB7A 2GQAA 4HNNA 3DOIA 1B6DA 3LV6A 2BNRE 1MFBL 4HK3J 5C9XA 5FCUL 4TRPL 3OM3B 5AC4A 1QUNA 3FTVA 2V9RA 4UTWC 4XP9H 4ZQKA 4V1DA 1SYSB 1XRTA 3T6ZA 2PR4H 4AMKL 2BMKA 3NYDA 3GYEA 1XF4B 1ZBKA 4LDOB 4LAUA 1R17A 2FYYB 4N87A 3VJ6B 4KKCD 5AVHA 2X8RA 4G2AA 5J12C 4JHOA 5K1VA 2GUOA 3E96A 3WMBA 3ZUCA 1PY0A 1B4TA 4UOW1 4EPSA 3TEWA 1PDZA 2EEFA 5A7EA 5I1KL 4UAOB 4XBGB 1Z5HA 4S2BA 4K39A 5ANMB 1T2QH 4JIRA 5FGCB 1TX2A 1MCWW 4PGCA 2VDMB 4CSZA 5TDNA 1ZJIA 3OAUL 4XNUL 1JPGB 3ASOB 1HSAB 1LOQA 1Y5WA 5F44A 1I1YB 4F0RA 3AYTA 4LRSA 2OYLA 1X39A 1MRFH 2DQMA 1MW3A 5FOBA 2BY1A 1FZOA 1TDQA 1YSOA 5LJYH 3TYGL 1NEZB 2YXWA 4UC5A 1XX9C 3BWAA 3OBEA 4PP1C 3RIFK 3UZJA 5DXXA 2NQDA 2V5RA 3KLKA 2B2XL 5ALCL 3F03K 3G6AB 4LYRA 3MRGA 3OKDA 4AF0A 2ZXQA 3SE8L 2J6VA 3HNTL 1A7NH 4LSVL 1Y8BA 2C3ZA 2ABBA 1PS3A 3L4UA 2D7TL 3MJ9H 4TNVK 4DAIA 4GY4A 1AZVA 2WQRA 4KQNA 4MNQA 2NY2B 3CHVA 2MOVA 1ACYH 2V81A 5A40E 1MFVA 3W1RA 4IBVA 2XWDA 3AUWB 3OGCA 3JTSA 5AKSA 3SHSA 5E9DE 2YD8A 3D12B 1RZPA 4WWPA 3CCHB 4HWNA 4HJUA 1F4AA 5IVZA 1ZBVA 4CU6A 3EH3B 1ISVA 3BAEH 1YEDB 4JFVA 4XP6H 4AY1A 3AUOA 1E6PA 2X4TB 4TUJB 3T2NH 5JUEL 2A83B 3UABA 1JK9A 3K7UA 1ZWIB 1MFAL 1T7XA 3FCSB 3O7UA 4C65A 5HYSB 4IIQC 4RKAA 1ZVSA 5BZDA 2X4NA 4DZ8A 2I9LA 4O58L 2I60L 1JZ7A 4K3JH 1W9PA 1NJJA 2J8OA 1BXXA 2ODOA 4FXKA 2VZUA 1QWGA 3BQUA 2VIRA 3GTIA 2HP4A 1F3DH 2DQIL 4XH2B 2F15A 5FYLD 2CKSA 4OZHE 4FFVD 3BKYH 1IAIL 2DJXA 4XMPH 1Q6RA 3G24A 2DQWA 5EEWA 3AQZA 3T8XA 2YPVL 4R34A 4APQA 3Q45A 2VAAB 4N9GB 3D85D 5DD5L 1WT5C 1FWGC 4ISVB 1T0PB 5EUOF 1BPVA 4R96B 4U6TA 1TSHA 4WY0A 4N6EA 3NESA 5KYYA 3ARDA 3TU9A 4FQXA 3WELA 4Q2ZA 2DQ6A 4QOKA 5DJCA 2BVYA 1UH4A 1S3HA 2ZFAA 2F7IA 3BP7A 4AZ6A 3M0HA 1X6UA 3DUSB 3CB3A 2YBVA 1ANUA 3MANA 1WUEA 4JN8A 3NJGA 1M05A 4L4MA 4P23B 4CGTA 5FYLL 1UR9A 5LA2A 2YSWA 1ZCOA 2KS0A 1HE8A 1TPVA 3UTSE 5I1AB 4ZMAT 3PHQA 3NCXA 3B05A 4PUDA 2Z8WC 2IH1B 2PCFB 4CDHA 5A2JH 5CSZA 3CFMA 4KDTC 4FNTA 3L5JA 1IKNC 5T1KD 1HJUA 4TVPH 5J6HB 3Q4DA 3OLEA 2WLYA 1K02A 3NJIA 4Q4PA 2OR9H 1ICTA 2DJMA 1F8TL 3FH5A 4EOWL 2QGBA 4MAUL 3UEQA 1TQCC 4P48A 4B9IA 5D2XA 3SPHA 1U6AL 1PKYA 2BW5A 3U9PL 4NDMB 2CDGB 4HEPA 2Z64C 4JN6A 2YSSB 5IMMA 1W5MA 3G22A 1GGIH 4A8IA 4TNWF 5B4MD 4NRYA 3O41A 5DD0H 3ZGHA 3SJ3A 3PDGA 3QQWA 1CICD 4A3YA 2BVPA 5JQIB 3NEXA 3KPSB 1KZQA 2VZ1A 3EAUA 1E30A 5DR5H 2JIXA 1XBYA 3AUJA 2AL2A 1KNOA 1GZGA 3D2UD 2OQYA 1ACZA 2E4FA 1VACA 3P9LB 1ILSA 4QJ4B 3DG7A 2VDGA 1QRKA 5HYIA 1WFIA 1FO0A 1LHZA 2HRLA 5CSSA 3B7TA 4D9LL 1XC4A 1AOHA 2PCPA 1OQXA 4KI5C 3BI9X 2AXGB 4LGPB 2OSWA 2W9LA 1W0VB 5F1NA 2QVTA 3ASNB 1OK4A 4JFHD 3B9VA 5FK9A 4KKQA 4JZNB 3UO1H 3U5UA 2VVSA 4JQIL 4HLZH 3B0YA 4F7KA 1M6UA 5L4JA 4EE9A 4LCYA 3ZDXB 3QIUB 2BFVL 5KVFL 4PWEA 4TTGA 5BS0A 3FEQA 3S9IA 3F7QA 2R69A 1KJ3L 3EJSA 1H11A 3E6FA 1R87A 2APSA 4CQ9A 2EH7H 4JKWA 2WO2B 4HEPG 2VAJA 4D0BB 1O1ZA 4JTSA 4GD0A 1OP9A 1PJWA 2C3XA 3K6IA 3STFA 2E9GA 3FA5A 4PJXE 1LLZA 3DXAD 2PGRA 4LKCB 4NO3A 4PP2B 5HATA 5JOPD 1QYGL 3NIDF 2VEKA 2KC0A 3WQVA 4YSAA 1PYWB 4L5ZA 5CPNA 2Y36H 5KBMA 1SGJA 2Z4TA 3O9WB 4OZGB 4C1KA 2EH8L 1ZV9A 4HH9A 1B3VA 1C12B 3T2OA 5T5NF 1U36A 3CMJA 5HULA 4UM9B 2FRGP 1VS1A 2V6AA 3RA7H 5DJ2A 3NGFA 1VKXA 4X6DB 1P4UA 3KPTA 5EPMA 5J04A 2EXTA 2J8HA 1KXHA 3LSOA 3H85A 3KLDA 3BKMH 1DIOA 1ZY9A 2ZXGA 1E4XI 2VXVL 4XOBA 1K03A 5C0AD 4J4PD 2VT0A 2FSEB 1ESWA 1GZQB 3GH7A 5KYXB 4YMPA 4LKXB 4Z7VB 3W76A 2YGOA 2NSXA 4MDIA 4BF9A 1NL0H 2BNQD 4Q8MA 4M7SA 3MRKB 3W38A 4MAVA 3WEOA 1UOWA 2PO6D 4O02A 3BOXA 4P5MA 2Z31C 1R0MA 5G4MA 1UWTA 1DVFA 1A3HA 2XU9A 4F7TA 1I8MB 1OX6A 5C0BD 4PBGA 3QDHA 3QPKA 3HCVB 4W4OA 3FOMA 3MLVH 2YDSA 3SN1A 4WTWA 2EKCA 4FR1A 5FF4A 4FG2A 1FWSA 3K0YA 3H6OA 3VFRA 1NKRA 1CWVA 5E5CA 4ZTYA 4BSWA 3TF7C 1O12A 2WKOF 3IGKA 4GMTH 2KI6A 4HJIA 4XZBA 2GCYA 3PNZA 2DDQL 1Q6FA 4K5MA 1DHKA 3AU2A 2VN5A 3E1ZA 2GJJA 4L1GA 2Y1HA 4WK0B 2Z35B 4K23L 1PJ9A 3SY6A 4FFWC 3TR2A 1NC4D 3VH8A 2AJSL 2G96A 2EKSA 1MHEB 4LNVA 1ECZA 1IEIA 4ZMLA 1A3ZA 3QQXA 5I00A 4MWAC 2VLLA 2OMTB 1E5YA 4R2GB 3KOXA 1R0AH 3W7QA 1FWEC 5GJPA 1EX0A 5HWMA 4H7CA 4JPIB 3KFTA 5CU5A 1OFOA 3TTEA 3NYKA 3KJ6H 2DI7A 4BFIA 4S3CA 1R75A 4M6QA 4MJJA 1IGIH 2C5DC 4CNUA 4NO0A 3ARZA 1ZLVH 5T3XE 2WN2A 3DA0A 4JKMA 1UA7A 4DP9X 3L9RA 2UBPC 4IFRA 4F7CA 1NM9A 3IDYB 1EQWA 2K1MA 4IDJH 2WKGA 4WY0F 3PP7A 3NQAA 4DERA 1BFOA 4R7JA 2CLRA 4B50A 3L5XH 2B4CH 1IX2A 4MKMA 1MHPH 1DBMH 4R27A 2Y61A 1YHTA 2E6DA 1NGQL 4AX3A 2NXHA 2TAAA 5INCB 4Y88A 1FL3A 3FJNA 3RWFA 2A4AA 4NP9A 4YPGA 5HHVH 2WSDA 2MTPA 2IQ9L 1KB9J 5CN2A 2VI0A 1LROA 4I7WA 1C8YA 1POJA 3LCGA 4D1IA 2CHZA 3GR8A 2OZ0A 5D7SL 4MA1B 4X5WB 3BLOA 4NEHB 3NMEA 4UTHA 2E68A 2XVGA 2VLKB 2FATH 4BZ1A 3WL9B 3CO4A 4S1RH 4KQ3H 1Q6CA 2DDXA 1JCJA 3ETSA 3ILDA 2DRUA 2O55A 2YBUA 1NDVA 3LHTA 3K13A 5DO2D 3PY2A 3QORC 5JHDB 1C16A 2HN7B 4EI6A 3LS9A 1EO8L 2IWKA 2YCJA 1UIOA 1WBHA 4CSPA 4ZE4A 3PTMA 2XDFA 3MPCA 1QI2A 3L5WA 3WDPP 2FTWA 2PYEE 1TZIB 4OQ1A 3JVGA 1M1XB 3S46A 3CVHA 4F9DA 1TTIA 1Q6DA 3Q0HA 3L7RA 3L7FB 3CK0L 5EIIA 2D9QB 4CBPA 1KC5H 1FBIH 1QSED 2C1GA 3NPZB 3X2QB 4G6MH 3KL0A 1QWHA 5HHXH 3IRCA 2CLKA 1ETZA 2NXYC 3MLUL 1Y18B 5IGXH 3AMCA 4XNBA 3GHRA 2CHXA 5EF2A 4JFYA 5GRJH 1EPFA 2IV8A 2Y1ZA 2QGYA 1E0TA 1TF4A 4H20L 2XTJC 4N4QA 3FA3A 4QTFA 3KCJA 3LM3A 4M8RA 4U6XA 4FMVA 3LCHA 3PAUA 4ZUTA 1TYRA 5K1NA 3M0ZA 4AQ8A 3TNMB 1FG2B 4M61B 2AV7B 5MENA 2Z26A 2JKIS 1EC9A 1SNRA 2VEFA 2UWEA 1BPLB 4FEIA 3B5TA 1UM6H 4DCQA 4B5ZA 3VXMD 2YKKA 4OIFA 5E9DA 2G8ZA 1NGYB 2VFIA 2JJTC 1K9DA 3G0UA 2LTQB 3ZRCC 1F18A 1DWHM 1Z9AA 4YX2H 4QHPA 1J6PA 1JHTB 2YC1B 2VR6A 2WWKT 1GTHA 1MFUA 3PZOA 4IOFD 4Z1PA 4ZFOA 1QJWA 3FO0L 1EYEA 1S9VB 4RPQA 5L2JA 1RU9H 4MASA 1SYSA 4BZ2A 2LU7A 3HC0A 4GIOA 3FB6A 4ENEC 3AHVA 1D5IH 2DW7A 1UM4H 1E4JA 2F2KA 4NGHH 2F5BH 4ZEPA 3H2WA 2OSYA 2ZZ3A 4CW1B 3VJ6A 3P0WA 3RRAA 2GFBA 3CFDA 4LVAA 4YE0A 2FX7H 3I6GB 1EJTC 4M29A 3QCVL 2YPKA 2DWEB 3WS6A 3LN4B 4GKLA 3TU6A 4XBGA 2X1UA 4PP1D 3S2JA 1P9MA 4E9QA 4PHZA 3LHUA 3FHAA 2GW5A 1T7ZA 4AM0B 2D0HA 3LEXA 1PTDA 5AY7A 3NVTA 1DVJA 3MRHB 1CDGA 4F0SA 1AD4A 1I85C 3MI2A 2N1TE 2GQ8A 5DQJB 5ICXB 3R0DA 1QLFA 3QDJD 2ZAHA 1Q6LA 4KHXH 3ZTEA 5EKYA 4GYPA 3W28A 1HILB 2ESVA 1NBVL 3G5YB 4US6A 1O5PA 3MA7A 2QADB 3PPSA 2IXUA 2KDGA 5JW5B 1ICSA 4JQ4A 3TBWB 5EOCH 3TAOA 4PW3A 1BEYL 1ML0A 4JM4H 1X7QB 4R33A 4LIQH 3FUDA 3LNFA 4P2AA 5D38A 3LVTA 1MSSA 3PBUA 5E8DL 3TWCH 4MTMA 3U0WL 2AZUA 1C08A 4ZMZA 2V5SA 3HEIB 3BT2H 4GUGA 3SBWA 1HX0A 1CEOA 4FI6A 4LLMB 2Y24A 2HAZA 2HRWA 4AYSA 3LQGA 4JTDA 2ZPKH 4R5EA 1WG3A 1S7XB 4L3AA 4LBAA 1CIDA 2B1HH 4YHIB 2ZC1A 4LNCA 1E1EA 2OT0A 3CCHA 5EUOB 3KW7A 1D9KB 1IQWH 4QRRB 4OLWL 2ENSA 4WVRA 4IHBA 4PJ7E 4HKJA 4RMUA 1LP9E 1XGZA 3OJMB 1E4LA 4OKDA 5I8EA 3OB0H 2WO5A 4M7JL 1C1EH 3MCOA 3O2WL 3SSJA 2X4TA 4QXVA 4BI5A 4XAFA 4R8WL 5F9DC 1PIGA 2OAAA 3FCSA 3JYCA 2Q86A 2AJXL 3B37A 1NEZG 5DK2B 1UYWL 5E24E 3QJHB 5HYSA 3URQA 2QPDB 4Q6IC 3MROB 4LSQH 4PMUA 2DPEA 3L3GB 1SXZA 2E6QA 4O8RA 5G1TA 3G08B 3A5FA 4JM2A 1EXBA 4RGNB 3BICA 5HNNA 3BK0A 4FNPA 1U3HB 1J5IA 1OPOA 5J6SA 4XHJC 4XH2A 3TBSB 4YL2A 1MCNA 3VNMA 4JRXD 1IGYB 4IW4C 3KPQB 1XFCA 4WI2A 5D05A 5FUOH 2NNXA 4AG4L 3CH1A 4PB4A 3BUIA 4XVUC 2NX9A 3SGKC 2AKZA 5CIPA 1MFEH 2YAFA 4GZJA 1VF5C 3VUPA 1C3FA 1BQHB 3ZTCC 1JPFA 5BVJB 4AX6A 3H4WA 4NUWA 4PTTB 1AQFA 5C09B 2OGJA 4LDLB 4PJXA 3O15A 3CQHA 3T0EA 1MCWM 1G7HB 3NAVA 3G04B 1HZLA 4QRSA 2DMHA 2X1WL 4P23A 3NCWA 5KBPA 4MLJA 4JO2H 1JGEA 2XVNA 1XQKA 4S38A 2LLEA 4BF5A 1KYOK 4UYQA 4BQBA 5CO1A 1PAMA 4GAGL 4AZCB 2WW8A 1AFVL 2HVOA 3EADA 4FD0A 5HYSG 4DQOH 3FXYA 5I7GA 1NBCA 2EE6A 1QAPA 4U1IA 3HNVH 5D55A 3KL3A 6ALDA 5KBDA 3ZMRA 4DF9A 2VQTA 4QAMB 3FAXA 2L0DA 1QUNB 4WXZA 4ZQKB 1J9TA 4V1DB 3LGEA 5BO0D 2BMKB 2IIJA 3V0WL 4RDZA 2QR6A 4NDMA 5IFPA 4WXYA 3IMUA 2WWOA 4M6AA 4PL1A 2CMRL 3MV9E 4LTSA 4MZ3A 1JUBA 3G6MA 4FX5A 3FU7B 3H1ZA 2GUOB 3JZUA 2ZG2A 4ONGH 2ILLA 1B0IA 4QXUL 4QRAA 4MCNA 1O68A 4QM1A 4ELDA 1XB3A 4R4FL 2UWEF 1HL8A 3P9LA 3S0PA 5CINH 3FJ4A 3W1LA 4U6YA 3QYCA 1PSKH 2EINB 2YB1A 3NIDB 3O6FD 3TLRA 2BODX 2W5FA 3LPOA 3ARBC 2E5CA 5EEVA 2IOIA 4NOBA 4PGCB 4FHBD 3C3UA 4ANUA 1DCEA 3SDAD 1Q2RA 5TDNB 5GGTA 1S5TA 4JZNA 4D1JA 2B5IC 4DN1A 3UMNA 1O6SA 2Q20A 3SN6N 3BPNB 3IJ8A 1EFXA 3DUUA 3QIUA 4WJ5A 3PANA 1ULVA 4H8VA 3V9CA 4EDWH 4FA6A