1GCYA

High resolution crystal structure of maltotetraose-forming exo-amylase
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
415
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUCAN 1,4-ALPHA-MALTOTETRAHYDROLASE
publication title Crystallization and structural analysis of intact maltotetraose-forming exo-amylase from Pseudomonas stutzeri.
pubmed doi rcsb
source organism Pseudomonas stutzeri
total genus 145
structure length 415
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 2000-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gcyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gcyA01
3WSUA 1OIMA 4CCDA 3OGRA 1LWHA 3WENA 4K68A 1OIFA 3AIQA 3CTTA 1WNOA 2JEQA 4J3WA 2J47A 4LX4A 3ZO9A 1GOMA 5A6MA 2EPKX 4RE4A 1AVAA 1QHOA 5JIWA 1MFVA 1K9FA 4RE3A 3ARYA 1GONA 5DO8A 3TTQA 1C8YA 5D9MA 4XUYA 4CD5A 2ALWA 2J7DA 2J7CA 3PZUA 4MB5A 4U33A 3POCA 1HKKA 4PTWA 4AYGA 2PB1A 3N04A 2OWCA 1C3FA 3CO4A 5IFTA 4AD5A 2DT2A 2VTFA 1C93A 3W37A 1TCMA 2PI6A 1UD6A 4Z2HA 1JZ6A 1DEDA 3SCPA 3WF0A 5LA0A 1TVPA 2CHOA 5JBDA 3AZTA 3G6MA 1VBUA 3O6AA 4Z2IA 1DTUA 2GK1A 3WQ6A 4FK9A 2F18A 2W92A 2DDXA 4HOXA 4HA3A 4XZBA 1HL8A 2G41A 4D6EA 3U57A 2D1ZA 4W88A 4UZSA 4TTGA 1XYFA 3U5UA 2E0PA 1UA7A 1UH2A 2WVSA 2WCGA 3BMVA 3W26A 1H0IA 3ZOAA 2F61A 1KQZA 2QPSA 4M1RA 3H53A 3PZ9A 4NXSA 5DMYA 3ZT5A 3T2QA 3AXHA 1KXVA 4GO8A 1C7TA 3L4YA 4GPNA 1XV8A 3DYOA 1UD4A 3EDJA 2JFEX 3ARZA 1KWGA 4W84A 3TTYA 3MUAA 5A6JA 5AYBA 2V3EA 1ODZA 2FHCA 4LGXA 3D50A 4JHOA 3NJ3A 2WMIB 1CZ1A 2J74A 3AZRA 4M29A 1QI4A 2EABA 2DSKA 2DSUA 3AICA 1GNXA 2X8RA 2UY3A 3O9NA 2X2IA 4UQDA 4UFMA 3VGDA 2EJ1A 1Q6GA 1Q4NX 2WMFA 2J8GA 4P7NA 4CCCA 1TFVA 3ARSA 3CZEA 2ZX6A 2DPEA 1CDGA 1VFUA 4GI9A 4BZYA 2D24A 3NSXA 1SMAA 1CGVA 3CIVA 5DT7A 2OYLA 2XPKA 1GHSA 1LL7A 1ISWA 4OOUA 5I6SA 1H1NA 4KRUA 3ZT7A 2VZVA 3VO0A 2C7FA 2XFFA 4W8LA 2JF7A 2XHYA 3ZR5A 3W28A 4D6CA 4MAZA 1EQCA 2J62A 1PZ2A 4F9JA 4AEEA 2VZOA 4BQ4A 3CZNA 3AHZA 1UWTA 1G9HA 5FL0A 2ZOXA 1KCKA 2WBGA 3ARVA 2WZIA 1JG9A 3AHVA 1WZMA 4UR9A 3UR7A 1CBGA 1D7FA 1QBBA 3BVVA 3OLDA 4FLOA 4HPGA 1JZ5A 3H55A 3MO4A 1XRVA 2HISA 4Y7EA 4YPJA 4KGLA 3F5JA 1E3XA 1W91A 4F79A 2WZEA 3ECQA 1BGGA 1DWJM 1V6VA 1J0HA 1VB9A 4J3TA 3WEZA 1CXIA 4M24A 5A1AA 5ABFB 4BQ3A 2YJQA 4TVCA 3OLEA 3RPMA 1E1EA 1BAGA 3BLKA 2YIHA 2E3ZA 1TQSA 2DSZA 2UY5A 3GXNA 2FHBA 3NDZA 1V6WA 4AIUA 1BYBA 3PTMA 1HNYA 5M3WA 1K6AA 1OM0A 4JIEA 2EXOA 2V3FA 1PX4A 1E43A 4TXEA 1NH6A 3APGA 5C8BB 1BFNA 3SUVA 1E6RA 2ZIDA 4IPLA 4ZENA 3RILA 2YKKA 5CXPA 3GZAA 3MU7A 1UYQA 3SCQA 4MNKA 1EDTA 2WAGA 1DWAM 1LJYA 2VC9A 2XVPA 4JHZA 1DWFM 4IM4A 3IJ9A 1SFSA 1U33A 1GUVA 3TP4A 2GDUA 3OLIA 2JE8A 3BAXA 2BVDA 1QWUA 3WD2A 4CD8A 3RO8A 1WDRA 1PX3A 3VIOA 2Z1KA 1KR1A 3FW6A 3IJ8A 1JYXA 1UWIA 3WD0A 2D3LA 5D9OA 1TQTA 3WEMA 2CXGA 1GQKA 2VCAA 4HA1A 1V0KA 1JZ2A 3OA5A 2WCSA 4YHEA 4XV0A 4FNSA 1BF2A 2BHZA 2WNWA 4AW7A 1H4PA 3ARTA 3PZOA 2NT0A 4V27A 1H3GA 3B9EA 3T2OA 5HOSA 2ZX9A 4W86A 3AYRA 2OSWA 2VT0A 4GQQA 2D73A 4UZUA 1XHGA 4E8CA 3BC9A 2E9MA 4FNUA 1E6QM 3CPUA 5KZ6A 1BGAA 1H0GA 4NZCA 1JZ3A 2OW7A 3MUY1 4L4PA 5BWFA 2WWCA 5CGTA 1R47A 1PS3A 1KB3A 3FXYA 1E5JA 1Q6DA 4UQCA 1JZ7A 3AZSA 4IPNB 1UR0A 1VJZA 2WHLA 1KQYA 1ISVA 5A3HA 2DIJA 1QBAA 7CGTA 3A5VA 3PHAA 3N12A 1E4IA 2BFGA 2XN2A 4H41A 4ATWA 4PCTA 2WYSA 3EJPA 3EJQA 4EE9A 3AMKA 1FHLA 4CGTA 5CLWA 3EDEA 2OWWA 5A95A 4ZE4A 3MSDA 4NZJA 3OBAA 3W24A 2D0GA 1W9PA 3VIKA 3AIVA 4MAVA 1E56A 4NSBA 1SMDA 4ZXOA 4JFUA 1H49A 1JFHA 1H11A 4EK7A 4X0VA 1UR2A 1R86A 1ZB5A 3CZ8A 3ZM8A 1ECEA 4J3UA 1OCQA 2VQUA 4ZFMA 2YA0A 5GPRA 2DT1A 3DECA 4D72A 4FNQA 3MS8A 3D52A 2GSJA 1OT1A 2YL8A 2ZE0A 4CN6A 1SYTA 5BXPA 4UQEA 4CU6A 3D4ZA 1E0WA 3THDA 1E40A 4AXNA 3VMOA 2CITA 3WKZA 4AZGA 5I5RA 3WDRA 3HG4A 3BAYA 3S2CA 3OG2A 3WF3A 4W8BA 5A2BA 1U2YA 4GI8A 3VM5A 1E4MM 9CGTA 3GBDA 2GDVA 2PF0A 3WY4A 1FP9A 1CWYA 4DWSB 4AZBA 4HZ8A 2QPUA 1UKTA 3CHFA 3ZSSA 5EBAA 3WDPP 4AZ5A 2CYGA 1G01A 4UCFA 5A2AA 3HU7A 3A47A 4UFLA 3IANA 2BVYA 2BHUA 1H09A 3SURA 3T09A 1KCLA 1UWRA 3CZJA 5IHRA 3VIIA 4KH2A 4HU0A 2F1BA 3PTKA 1NP0A 3EMCA 1JNEA 3VGHA 4HMEA 2YOCA 2WKLA 5GQBA 2VI0A 3CMJA 3VX1A 1E71M 2CBVA 1JZ4A 3ALFA 3BCDA 4M81A 1UH4A 1JXKA 4U2YA 1KWKA 3ZJ7A 2WMIA 3CH9A 4PMZA 2NSXA 3NSNA 3QOMA 1QVBA 1FFRA 3AS3A 1TMQA 1CLXA 3T0BA 1J18A 2YA2A 4BQ2A 1R34A 3EMQA 3MV11 3LXCA 1B30A 3KE0A 2JF6A 7TAAA 3JUGA 3CZGA 3BUDA 2QMJA 5DT5A 1JAKA 6TAAA 4LYRA 5GNYA 3IK2A 1QI5A 1B9ZA 2AOSA 1WB0A 1UWQA 2O9RA 4RL3A 1KGXA 2D23A 5BXSA 1MFUA 3HZ3A 1BVZA 5M17A 2VVSA 2DIEA 4J7RA 3HMCA 2EAEA 1UKSA 5I24A 4GXPA 2AMGA 2WW5A 3WY1A 3ZSTA 3AJ7A 1R7AA 2WSPA 2IXVA 4W89A 1WAWA 3B9DA 3GNRA 4FNTA 3QHMA 3CHEA 3WY3A 3D4YA 3N15A 3NUKA 3E1F1 2FGLA 8CGTA 1ZJAA 2BY2A 1EOKA 3UG5A 4M8UA 3L2LA 2ZUMA 3AIBA 4CCEA 1ZL1A 4QFUA 1PIGA 2VR4A 1GOWA 1JF6A 4YN5A 3VD5A 2E8YA 1QOXA 2XWEA 1IT0A 3U5YA 3BVXA 3DYPA 3SIMA 1XSKA 2XIBA 3A21A 3WQ8A 3CUGA 3A22A 3LPOA 1W3JA 2EEXA 2PWDA 1RH9A 4LYPA 3OGSA 1FOBA 4FNRA 2IGTA 1HKIA 1V0LA 4AMCA 1D2KA 1US3A 3SUWA 3AQUA 4CVUA 4GQRA 5IFPA 2W4XA 1I1XA 4TVUA 2XGIA 3OZPA 2XUCA 4JFWA 4LQ1A 2PWEA 3GYCA 1M53A 4DWSC 4DO5A 1MVYA 4KWUA 2CKRA 1FA2A 3KLLA 1XGZA 5ABFA 2VZSA 3W81A 4A3HA 4OJYA 2BXZA 1FH9A 1GHRA 1BG9A 3BVTA 4NRSA 2O9OA 5CJ5A 2XVKA 2V38A 4JAWA 2YL5A 3AIRA 2PWGA 5I0DA 4CUCA 4H7VA 5BRQA 1VBRA 1TQVA 3VSUA 1E1FA 5CZKA 3IGUA 4JL2A 1FH7A 2VL4A 2FE0A 1H5VA 3B8SA 3GDBA 1HP4A 3CUFA 1MQQA 4TVDA 3EDDA 3RJYA 4E2OA 2J4GA 2YL6A 4FNPA 2UY4A 4NI3A 5FIPA 1B90A 1V08A 5BRPA 1GCYA 1BSIA 1CENA 5E09A 3HJEA 2JALA 3CGTA 1HJUA 3ARWA 1C8QA 2CBJA 2O92A 3PZQA 1QNQA 4WKFA 4OOZA 2A3EA 3FAWA 2E9LA 3PTQA 1LG2A 1ISXA 3AIEA 1R87A 1ISZA 3M7SA 1KBBA 1RPKA 4MPKA 1JNDA 4WLCA 1HJWA 2MANA 4AWEA 5FL1A 4CD7A 4GZJA 5D4YA 4B9YA 4OKDA 4DM1A 2E9BA 3CV5A 4AMXA 1TA3B 1LLOA 2EPLX 2ZXBA 2J8FA 4JKMA 5A8NA 3I3BA 4F8XA 1UWSA 5DEZA 1NWSA 4CU8A 1PJ9A 4H8UA 1JXJA 1TG7A 4NRRA 3MUZ1 1UR9A 4EKJA 1LF1A 3FHAA 1JI2A 4X9YA 2A3HA 2VOTA 1DP0A 2WMGA 3CUJA 3CZLA 5JUVA 3VIPA 5CPSA 3KL5A 5KEZA 1QI0A 1ZU8A 4AZCA 2ZX8A 2ZUVA 2FYVA 4FMVA 1DWGM 1ZBWA 4PBGA 3GH5A 3CHCA 2ZX7A 4IISA 3EJSA 3CC1A 3WMBA 4AZ6A 1PPIA 4BA0A 4P7QA 4HZ7A 3W38A 1UH3A 3GXMA 2PWFA 4OIFA 1J0KA 1QX1A 2F2HA 3A6OA 3N9KA 4HMDA 3K4AA 2O9PA 1IZKA 2WHKA 1HL9A 3WNPA 4URIA 4MJ2A 4BF7A 3A4AA 1CYGA 1G94A 2WC3A 3AHXA 2F8QA 3QOKA 2BVTA 3II1A 1RP9A 2VO5A 4JFSA 4W93A 1FFQA 4GIAA 3T0AA 4PEEA 5A6BD 5CSYA 4N0RA 1EDQA 5EMYA 1W2PA 2VURA 1VEMA 1HN1A 2ZX5A 2CETA 1GPFA 4AZHA 2PBGA 1ITCA 1UR4A 1LL6A 3LRLA 1MXGA 3AHYA 1JYNA 3QHOA 2OSYA 2XN1A 1LQ0A 1C92A 3MMDA 3FHQA 4E8DA 1W9UA 3WNLA 1GOQA 3DYMA 2RGMA 1XSJA 2X2HA 3AHTA 5ABEA 2B31A 1E70M 3WD4A 4P8WA 2XG9A 3VGFA 1M03A 2G4FA 3SUUA 3L4WA 3W29A 4FLQA 4PN2A 3W4RA 1OGBA 5HPCA 3UETA 1V6YA 1PAMA 5A94A 2YLLA 1W3KA 5LYRA 2ZWZA 4HPHA 4HMCA 1CTNA 3PZIA 3TTSA 4P7LA 1MXDA 1DWIM 4S3KA 2D22A 4H8VA 3VMNA 1XD1A 2X0HA 2ZUNA 1W1TA 2ZXAA 1BTCA 3WH7A 3PBGA 1JI1A 1TE1A 3VNYA 5EFFA 1HXJA 3BAIA 3LPPA 1Q6EA 3BAKA 3VM7A 1UUQA 3MI6A 1TZ7A 1P6WA 4DWSA 4MTVA 3EJTA 1E6XM 1GOIA 4F9DA 1ESWA 1UQZA 4U5KA 4BCEA 1ISYA 3VIGA 2VVNA 2CNCA 1TR1A 1QW9A 2ZUTA 3WEOA 4U3AA 3KEHA 2V3DA 1GZJA 1QNSA 3BUPA 2V5DA 4JKLA 2VX5A 2WBKA 2D3NA 3ARXA 3N17A 3EMZA 3WMSA 4DO6A 1BYCA 2YFOA 3HN3A 1BLIA 4PMXA 3PN8A 1LL4A 5I78A 3K8KA 2BY0A 1JDDA 1UR1A 1CXHA 1XCXA 1Q6CA 3DHUA 1K9EA 1W3LA 1E73M 4HU8A 2J78A 1J10A 3SCWA 3L2MA 2WMKA 1FP8A 4CVWA 5I23A 3QR3A 4ZE5A 4ML4A 3L4VA 2WB5A 2J7FA 3BH4A 3L4UA 1UD5A 6A3HA 3ZJ6A 1OD0A 1J0JA 2WPGA 1KTBA 3WQVA 3FN9A 5I2UA 4NZFA 3WD3A 4GZIA 1VENA 3HG2A 3VSVA 2FDMA 1R46A 3AISA 2DGAA 3WH6A 1HJVA 1E6SM 3S6TA 3UG3A 3O2LA 5D8ZA 3N18A 3VNZA 4LYQA 4AZCB 2OSXA 1U30A 4H8HA 1WZLA 3KLKA 1E5NA 2V5CA 2J25A 3NYDA 1QHZA 3BMWA 4ACZB 2QLYA 3CZKA 5DF0A 1MQRA 4TUFA 5BROA 2GJRA 5E6YA 1FH8A 2PC8A 1EDGA 4BQ5A 5M03A 5IDIA 1CXEA 1M7XA 1IZJA 2CHNA 2J75A 2FGZA 1W9DM 1UKOA 3T08A 1BQCA 2F1AA 3WIJA 4R27A 1TQUA 4CN4A 1B3VA 4W87A 4MB4A 4M56A 1G0CA 5E0CA 1WZKA 4AIOA 4P7RA 4UFKA 1HWWA 3ZR6A 1JD7A 1WCGA 1JF5A 3LPGA 4P8VA 4H04A 2D0HA 1T0OA 1HJSA 2A3AA 1MW0A 3NDYA 4MNLA 3WDIA 1RP8A 1OGGA 4XB3A 3CLWA 3ZJKA 4LPCA 4PMRA 1WZAA 4NX0A 3IJ7A 1W9BM 2X0YA 2XFYA 1UZ4A 5BYWA 4OZOA 5ABHA 1KXTA 3HG3A 3LX9A 1J0IA 3GXDA 1O6IA 4E4PA 1BVNP 1WDSA 4Z2GA 5D8WA 3WNOA 3PZGA 2XVGA 4CU7A 2WVTA 1PZ3A 3VX0A 4PMQA 3AMDA 4Z2KA 2A3CA 3WH9A 1KXHA 1JGIA 3F5KA 3EJRA 1WO2A 1B3XA 1HX0A 1EH9A 2WVVB 5GNXA 1TVNA 2DEPA 3CUIA 3BLPX 3GXPA 2IXUA 4UTFA 4PUEA 3OLGA 4UOJA 2DSVA 4DM2A 2WHJA 4QCEA 3TA9A 1NQ6A 2RGLA 1YQ2A 1UA3A 1NWTA 1V02E 5ECUA 1UASA 1E55A 3BSHA 1J12A 1VF8A 4WJXA 1OGSA 4UQBA 1X6LA 4QLLA 4W85A 4IUGA 3VUPA 5A6SA 4HOWA 3IAQA 2ZUUA 2VCBA 4W5ZA 3BLBA 1ITXA 1VJSA 1EO7A 2Y5EA 4AY1A 1MYRA 2OWXA 3VILA 3AOFA 2J7GA 3VD3A 1X1NA 3ZMRA 4Z2JA 3K8MA 1IV8A 1QPKA 1HKJA 2CBIA 3WH5A 4PUDA 1A47A 3W82A 5I3DA 1M04A 2XIIA 4RE2A 2VMFA 3ARRA 3AS1A 2HVMA 3VGBA 1TA3A 5HXMA 2DT3A 4PSPA 3BCFA 3GXFA 4PTMA 1EIBA 1NARA 1UZ1A 1ODUA 3VDHA 2OLHA 2G3IA 1XC6A 3BAWA 4V28A 2CCRA 4AD3A 1QNRA 3MKKA 1F4HA 5CLTA 1G1YA 2VZTA 3M6DA 5AC4A 3UESA 1NP2A 2CERA 1HXKA 3ARPA 2ZXQA 4NXKA 1F4AA 2GUYA 4AEFA 2W66A 1OINA 1DWHM 4MADA 1R85A 3VIHA 4AYSA 2XWDA 2XJ7A 3GNPA 5BCAA 1E15A 3G6LA 1QI3A 3GNOA 4B15A 3OZOA 2DH2A 4DUXA 2CIPA 5CPTA 3WUBA 1HT6A 1NOWA 2XVNA 3MMUA 1W1PA 1L0PA 4B3LA 4PMUA 1JFXA 3KZSA 3VKKA 1E6ZA 4M82A 3M07A 4PTVA 3TTOA 3MV01 2CBUA 3ZJ8A 3PZVA 1CXLA 3TV8A 1W1YA 4Q7NA 1KXQA 5JBFA 2VRQA 4OUEA 1JDAA 4OGZA 3W53A 4A4AA 1V3KA 5A8OA 1V6XA 2BY3A 5CG0A 5A6BA 3AROA 4X0NA 2YBTA 3F4VA 4QDMA 1QNOA 4MDOA 3WN6A 3VIMA 5FCZA 2W63A 3N11A 3WL1A 4WIWA 2WLYA 3AXXA 1JYVA 1QHPA 2FH6A 3WNKA 1ZBKA 4D6FA 3W6MA 3AYSA 2WCAA 1J11A 4YHGA 5AC5A 4D6IA 1WPCA 3LRMA 4UNIA 2JIWA 2BNJA 3CUHA 1ZS2A 1UOKA 2E8ZA 4W7VA 4BS0A 4MB1A 3CZSA 2A3BA 1PBGA 3HG5A 1C91A 5FOOA 4D1IA 4PMOA 1HVQA 1JDCA 4W5UA 1V3MA 4D6HA 4QLKA 2WSKA 1J0YA 2WVUA 1V02A 3KWXA 4HOZA 2VX7A 1EA9C 3RJXA 3BUBA 1CNVA 1I75A 5A69A 3DX3A 3PZTA 2QMKA 3CHDA 1Q6FA 3WUGA 2Y4SA 3VIJA 1TQWA 1AQMA 3GXIA 1JAEA 1US2A 3RMEA 1B3ZA 2YLAA 1CGTA 2J7BA 1E0XA 3GBEA 1B0IA 1CPUA 1VEOA 3K1DA 2YA1A 1YHTA 3DX1A 2W5FA 2EQDA 1RD6A 4JCMA 2VCCA 3H54A 4NF7A 4PMNA 5IXEA 4AIEA 3OB8A 1GQIA 2VRJA 1XH0A 1CECA 3WFZA 1HVXA 5I79A 1PEZA 3QHNA 2BXYA 1OBAA 4B9ZA 3WQ5A 5TD4A 4CN1A 1MW3A 4AC1X 1B3WA 3NIYA 3SCSA 4B16A 2VR5A 5C71A 2XM1A 3NCOA 2WM0A 3DX2A 3KL3A 3OIHA 4JFTA 1GW1A 3TOPA 1HF6A 5AYIA 3WH8A 2QF8A 3L4ZA 4MNJA 1R33A 1I1WA 2YDSA 1E72M 3WY2A 2VZUA 4HTYA 4QP0A 3EDKA 4PCSA 4MJ4A 4UQAA 1ZJBA 1HP5A 1QI2A 2Y2WA 3WFLA 3UR8A 3VD7A 1WE5A 2WC4A 4TX6A 4W8AA 4XZWA 3LRKA 2WANA 3EJUA 4MB3A 1VEPA 1V3JA 3S5YA 5CPQA 2W61A 5CSUA 1VAHA 1OB0A 3I3DA 4ACZA 1B2YA 1NM9A 7A3HA 3K46A 1ZBVA 3U7BA 5BXRA 3POHA 3WMCA 3UERA 4U2ZA 3T2PA 2TAAA 2ZICA 5A8QA 1MWOA 2GFTA 4DUWA 4J3SA 2OW6A 3BGAA 1GJUA 2VQTA 2YFNA 3WF4A 3LPFA 4MDPA 4N42A 3ZQ9A 4PMVA 2D20A 4ZXLA 4Z2LA 1NWRA 3WQ4A 4V2XA 1VFFA 2QV4A 3RM8A 1QW8A 2EACA 4JFVA 3WUEA 5F7UA 1K9DA 5A6KA 1TUXA 1CGUA 1GJWA 1JL8A 5LA2A 3ARQA 3GM8A 4WSKA 2NT1A 1EHAA 4J3XA 1KGUA 3VDCA 4GKLA 1K9TA 3L4TA 2NW0A 1EXPA 2VX6A 2EPMX 3RM4A 2WWDA 1DHKA 1UKQA 2VUYA 4J27A 4UOZA 4KMQA 1OSEA 3ARUA 2Y24A 2WVVA 3ZT6A 4U5IA 2E40A 5EFDA 2EO7A 4DO4A 1EGZA 4PRWA 1WP6A 4D71A 2OYMA 1SZNA 2XTKA 2GJXB 1X6NA 1J01A 3AMGA 3TONA 4AD4A 3AFBA 3SCNA 5HPOA 3WDQA 4CKQA 4D6DA 3DC0A 1CXFA 1J0ZA 4UQ9A 2ZXDA 1AQHA 2ESCA 4W7WA 5A8MA 1H41A 2ZUWA 2W91A 2YL9A 2BS9A 3LMYA 1JYWA 5GNZA 1XCWA 4P7OA 1JIBA 4UOQA 4OBRA 4AD2A 2X05A 1OT2A 1UWUA 3RIKA 2G3JA 2YBUA 3BXWA 3OGVA 4B3KA 1W3HA 2G3NA 3I3EA 4JKKA 8A3HA 1KGWA 5AY7A 3SCTA 5HNNA 2UY2A 2XSBA 2J79A 2XFRA 1QWNA 4Q22A 3VSTA 1CLVA 3D51A 3EBVA 3A4XA 3VD4A 4M80A 1AMYA 3A4WA 3MUIA 1NWUA 4QLJA 2XGBA 1UD2A 1XSIA 2CKSA 3SCVA 1V3LA 3K4DA 5LA1A 2PBOA 1NOFA 1UG6A 2VRKA 1CXKA 2GK1B 3AS0A 5HBFA 4AD1A 3FY1A 4H2CA 1XH2A 1JD9A 4U3CA 3W25A 2WKGA 1XYZA 4PSRA 5D9NA 4PMDA 4A3YA 5E0FA 3DHPA 2IUZA 2Z1SA 1UKPA 4MNMA 1W9XA 1GVYA 3LXAA 4TTUA 3BAJA 5HDRA 1NOUA 4HA4A 4GO9A 3DX4A 3WD1A 1EO5A 3PZMA 1Z32X 1E9LA 2WLZA 1GVIA 3ALGA 4F66A 5BXTA 3W6LA 4JZ5A 1C8XA 2W67A 1KFWA 4WK9A 3AS2A 4XX6A 1UHVA 1LWJA 3SUTA 1B31A 3WQWA 1GQJA 1V0MA 4WKAA 1HJQA 2Y8KA 3DX0A 3VDAA 2DH3A 1CIUA 1OWQA 3WNNA 1N82A 2EADA 1V3HA 3UEQA 2DQXA 4AZIA 1B1YA 3LXBA 4UFIA 4R5EA 5CGMA 2WMHA 2JEPA 3BUIA 4ZEPA 2GJPA 2WHMA 4JCLA 3WL0A 3BVUA 4AZ7A 2J7HA 3J7HA 1AQ0A 4L4OA 1W32A 5A2CA 2AAAA 3RM9A 3AMCA 1PX8A 5E6ZA 2CEQA 2YDRA 3VDBA 4FLSA 5EB8A 3VINA 4ACYA 2F7RA 3EDFA 3N1AA 1UR8A 2ZWYA 4AMWA 1E0VA 1R75A 1E6PA 1E6NA 3VU2A 3UCQA 4ATLA 3AXIA 1H2JA 3WUFA 4U31A 1BYDA 3VIFA 1FHDA 3DDGA 2J7EA 4HP5A 4C7FA 4QAWA 3VVGA 3ZIZA 4CD4A 3BVWA 4GZEA 1EQPA 2F7PA 3GTNA 3SUSA 3D5HA 1J9YA 1W9VA 5M5DA 1HJXA 4PMYA 3WBAA 3DDFA 1UD8A 1HTYA 2V3GA 2ZUSA 1VRXA 2D0FA 1C7SA 5CQ1A 4P8UA 1L8NA 2C0HA 3A3HA 2YDQA 4WKHA 3FNDA 4AD0A 1PIFA 1UD3A 2BHYA 3VD9A 3K8LA 1GQLA 1V03A 1V6UA 2X2JA 1Y7VA 1MQPA 4PTXA 1VFMA 4D6GA 1MW2A 4JL1A 2WZHA 1O7DC 5JBEA 5A6AA 3W27A 3WF1A 2JIEA 3WELA 1ZBCA 2WMJA 3SCUA 3VGGA 1V3IA 1EHNA 1CGWA 4EAMA 1LG1A 4DWSD 4J28A 5JIPA 3VMPA 2OYKA 3GXTA 1CGYA 1GOOA 2XVLA 2QHAA 4AISA 2XSAA 3AI0A 3GH7A 1GORA 3CBWA 2XYLA 3A24A 4J3VA 1KR0A 3NSMA 4OBSA 4KGJA 1VFOA 3WF2A 1BPLB 3FAXA 4C7GA 1JZ8A 5C70A 4EANA 1D3CA 2CPUA 4P8XA 3T0DA 2O9TA 4W7UA 1WKYA 2PWHA 4WF7A 4ATDA 3SCOA 1HIZA 2X09A 3VTRA 3VOCA 1O7AA 3BUQA 3D3AA 1A3HA 3RDKA 2F7OA 4UFHA 4C7DA 3N13A 1GOKA 5E9AA 3U7VA 4D6JA 1S46A 1BHGA 3AIWA 3VPLA 1CGXA 4UFJA 3BSGA 1R7OA 4GINA 2G8ZA 2XM2A 2X2YA 2VJXA 4TX8A 4D1JA 3UG4A 3EYPA 3A23A 5E1QA 1WDQA 2C8NA 1BG4A 3WNMA 2VX4A 2FHFA 1M01A 5I77A 1MW1A 4FF5A 3F5LA 2WK2A 2J77A 2WXDM 1G5AA 2WC7A 5D9PA 2XN0A 4LXFA 2FH8A 1XD0A 2DT0A 4QCFA 5FKYA 3QGVA 3W0KA 2EPNA 1E4LA 1WDPA 2Y8VA 1KBKA 2BY1A 6CGTA 1E4NA 5ABGA 2DSWA 2F7QA 2Q8XA 3MSGA 4PYSA 3WDHA 2EBNA 3IAPA 1C90A 1EOMA 3AMLA 4KRTA 2G3MA 3CMGA 1R8LA 3MMWA 3THCA 4HZ6A 1SR0A 5A8PA 3M46A 3GH4A 1OD8A 5IHSA 1W2VA 4FLRA 3RCNA 4S3JA 3WBEA 2GVYA 3S5ZA 3WDJA 2BV9A 1VIWA 5DFAA 2X1IA 2UWFA 1V0NA 1KTCA 1QNPA 3L4XA 3B9AA 2GJXA 2W62A 4GI6A 1B3YA 4TOQA 4CD6A 2CESA 1CEOA 3PZNA 1UQYA 5A6LA 3VGEA 5E70A 3MANA 1HKMA 3SCRA 1BYAA 1W1VA 2E4TA 3SEPA 4WSJA 1XH1A 3KL0A 4DUVA 2VNCA 1E3ZA 5FD0A 2D2OA 2EPOA 3AIUA
chains in the Genus database with same CATH superfamily
1GHFL 3F6LA 3PE9A 2AJZB 3OZLA 4QLWA 5CPNA 3HBGA 2VUNA 4HBKA 3ZO9A 2B4CL 3SRHA 4QT5A 1R30A 4YDZA 2NXZC 3RFZC 3SJVD 5INCB 4YUEH 5D9MA 3FU6A 4LPXA 4PTWA 4BDVB 2F19L 4LVAA 3K74B 2Z8RA 2A7PA 3D3FA 2Q3ZA 3S2JA 1DANT 1MJ7H 1CBVL 5E6IB 4PV9A 1MWAA 4KXDA 1EAQA 5TQ0H 3BTNA 3VI4F 4FA3A 2Q71A 3UBHA 5LQBL 4OI8A 2Y0SA 4RMRA 3FCGA 1RCYA 2EIZB 2BSSB 4FB7A 3S7GA 1P0SE 2MQGA 1YIXA 1IXPA 3HHSB 4HNLA 1OD7A 3O3BB 1T21A 3BP5B 1SY6A 4Y16A 3AICA 1GNXA 3RL2A 3W2MA 1BM7A 3LQGA 4ACTA 2IIJA 3FL7A 2KKQA 1TFVA 3WFEH 3VI3E 1OCNA 3C5ZB 5HDBF 1AACA 2VGFA 2FJSA 1FJ1A 1DQTA 2JKSA 4OTXH 1W1ZA 1UR3M 2DWDA 2YGYA 1P1VA 5CSBA 2KZKA 4W8LA 3ZR5A 2D4FA 1AQKH 4IOSA 4AH7A 3MCMA 1TJHH 5B3NA 1S7WA 4OV5B 1KCKA 4D9LH 4ZODA 2X2GA 4Q4OA 3SM0A 3BQUC 4G6KH 4LS2A 3WE6B 1UGNA 4K5MA 3ZBMA 2H3NA 4DCQB 1BZ7B 3V5DB 1BWWA 4HLEA 5DD5L 4M24A 4PBXA 5K1NA 1T89A 4FFYH 1S1RA 5GZOD 1HK6A 2QSVA 5BW7A 2E3ZA 1TQSA 3QXDB 5F1NB 3VVWA 3KOYA 1ZGLP 1RV8A 4KJPC 1AO7B 2HPMA 4L9XA 4FFZA 5FDYA 2JIXB 1W0WB 2K7QA 1FVEA 2WAGA 4JTRA 4JHZA 3D87B 4YWGL 1H3PH 5ALCH 4IM4A 4MSWA 1XF4A 3KOWA 3VXTA 5JO5B 4O1AA 4S1RH 5HMSA 5I8CA 3WD0A 1UBPC 3PG8A 3PHSA 3DG3A 2VGBA 1A21A 2COQA 4JD4A 3BPNC 3E2QA 4MAYB 1GZQB 2F19H 3UVAA 1KM2A 4J4KA 4G7VH 6ENLA 3TJPA 4PJXB 5FO2A 2F58L 3VI3A 3V6FB 1Q9OB 1E6QM 5KZ6A 2WM1A 3NIFB 4WOQA 3T1FA 1KZYA 4I4WB 4K5LA 1MCQA 1CBVH 1R47A 3MBEC 4G6FB 5REQA 2DI8A 4YSOA 2NXHA 5C6TH 5L4MA 1Q6DA 5F1OB 1GOGA 3ROOB 1XTLA 1QR4A 2BNQB 4HJ1A 1MY7A 2WHLA 3VXGA 2HMID 2KUTA 5CIPH 5F3FA 3UO8B 4XHJC 1UG9A 1WS7A 4AQEA 1AR1D 2CO2A 1Q8JA 3SFKA 3MRFB 1SJEB 3GVQA 4NSBA 4RGMB 1SMDA 4JFUA 2X42A 3PYCA 4ADGA 3QORB 3F64A 5BUGA 3T8LA 5DCCA 2VQUA 5DWUL 2X4QA 5IK3A 2CWNA 4R3SA 2FJUB 5KS9E 4HK5A 5ISZD 4CU6A 1Q0YH 3VMOA 3UX9B 3SKOA 1TRDA 3B2VL 5F7DB 4ZMTA 3ABRA 1KXVC 5C0RH 4A8NA 2PF0A 4JAMA 3UWZA 5T5NG 4D9PA 2J1KA 5IF0A 4NZ4A 5H8PA 3TO2B 3C5XA 4IJCA 1A7RH 1JGDA 2BVYA 1PKYA 2O93L 1ZP3A 1DQUA 2AQPA 4HU0A 3TO4D 3NN8B 5D72H 4IYKA 1A6AA 2YOCA 5IHZB 2Z28A 4JY6B 2BSDA 3DJZA 5DD5H 2CLEA 2ZOTA 4LUSB 5JW3L 4TYUA 5DJ2B 4Q52A 1QVBA 1FX6A 1J18A 1R34A 3OMNB 2E75C 4PMEA 2I32A 4LYRA 2OV0A 1MFEL 1KN2H 1Q1JH 3N44B 5LXXA 5BXSA 5DT1H 5I3IA 5EU3B 2OOGA 3TQVA 5LGKA 5AVUB 3KWTA 4YWGH 3N15A 3D4YA 2FBJL 2WXIA 4XZUB 4YHYB 3VD5A 1T1ZA 1QOXA 2YC1B 4RQQA 1RUQL 3WQ8A 2VHLA 1RKRA 1AZVA 4FNRA 3UA4A 2H1XA 1WH0A 5CWSB 1M53A 2F58H 1MVYA 1OAKH 1KXTB 5IESH 1ICQA 3W81A 1OO2A 2WBWB 2VFIA 4B95C 3N3EA 5KS9A 5JLZB 1IR2A 1E1FA 3CUFA 2H5UA 1QRKA 4OQTA 4E2OA 3TZNA 3NJVA 5ISZE 5AHMA 4I9MA 2B0SH 5C9JA 1RBAA 1HJUA 4GRMB 4WDXA 1FVDB 4XWGL 4JDBA 3FO9B 4OOZA 3W71A 3P4NB 3DN5A 3O3RA 2HSIA 3M7SA 4M5YL 3MNWA 4AMAA 1Z5YD 4B2DD 2IF7A 5D4YA 3E2SA 3C2AL 4IMGA 2F74A 2X1OA 2OR2A 3F4NA 4JTCA 2P8MB 4AMXA 2EPLX 2ARJA 4L23A 5DWUH 4NAQA 3S3SA 3WX7A 4S38A 5IR1A 4I0PD 3W83A 4EKJA 2IQAA 5G1TA 2X4UA 3GYEA 2Q6WB 1NAL1 4LDCA 1JWUA 1GS8A 3ARDC 3T44A 3ENEA 1MHEB 3VQ2C 4AYID 3B2VH 4PBGA 4QD2E 1EB3A 1OD9A 1UXWB 3G3LA 4L9YA 3KGTA 3HS9A 1CLCA 1ZWIB 4GH3A 1HGWA 2R14A 2PWFA 2UZXA 2OO6A 3SKNB 2WHKA 3CFJA 1YEEL 2DICA 4Q8TA 4URIA 4KKNA 3VJ6A 1WX0A 5BXFA 4HUXB 4ZOEA 4GT7A 3N2JA 4EPDC 4S1SH 1I1AD 4N0RA 4UDUB 3U48A 4NSKA 4A2RA 5B7YA 4RWYL 1JCMP 1S2UA 1A65A 1G9MC 5JW3H 1VYSX 2CUHA 4MDJA 4LAKA 2OSYA 4E8DA 4YDJA 3KXFB 2V67A 2RGMA 4Y4KC 5IMOA 1RK0A 5ABEA 3L4WA 5DI8B 2EUXA 3M1ZA 1NCHA 1OADA 5DANA 3E8VA 3LQMA 4KKLD 3S1VA 1ZT1A 3WH7A 3BEVA 3EYQC 3KWVA 1CVSC 3CIWA 2DYRB 4W4NA 4GX8A 3CSTA 2C16A 5E5CA 1UB5B 3HTLX 3T3PB 4N8VB 4HZLB 1ISYA 3FKRA 4QCIB 3MRCB 1RUQH 1Z66A 3IVUA 1K70A 1MFDL 3FQYA 2V5DA 3QYSA 1E7VA 4G5AA 5HMFA 4PWJA 5CJXA 4JIRA 3HUJF 5ICXA 1JDDA 2F7IA 1SXSA 3L0GA 3DPDA 3OR7B 3TO4A 3P3BA 4HU8A 5T8IA 2R0WL 1MCSA 4ZE5A 3OKOA 1ZLVK 4MS8D 4Z95L 3EWDA 3ZLGA 3BGGA 3SSZA 6A3HA 4HG4K 4K2SA 5F4XA 1Y18B 1G7VA 3F7VB 2DGAA 1U8IB 3SGKC 1JZJA 5MF5A 3UC0H 3WO3B 3LHZA 2VAAA 4XWGH 3BMWA 4W9FC 4RR4A 5E6YA 4BQ5A 4GUJA 4XCFL 4PJFE 4JYDA 2CHNA 1FHNA 2GZXA 4F9PC 3D6NA 5F7NC 3MV8B 4FQQA 1UKOA 2ACRA 3MRGB 1G0CA 4X2RA 2WIIA 1O5XA 2ADFL 4AIOA 3ZR6A 2GJZA 1QLEH 3BEWB 2OTUB 3CQHA 3NDYA 2QL1A 4Q8BA 2FDSA 3ALPA 4PI2A 2DQHH 4LEEA 2X0YA 5BYWA 4J3OG 4CQ8A 3HG3A 1XF2B 4U1NB 1OSPL 2P5WD 1OW0C 4PREA 3MRPA 2HJLA 4ZOAA 2E5DA 3WG6A 1POKA 3GPSA 3SJ3A 4DM2A 1HZHL 2RGLA 3BJ91 1NWTA 3VFVA 4M5SA 1X3DA 2EDQA 3NCWA 2B7DT 5CEZH 3PTDA 2WINB 1QQDA 1HL4A 4CC4A 3VUPA 1F76A 2ZZ2A 4JFPB 4RWYH 3QRLA 2OWXA 2ZWLT 3AOFA 1KC5L 1OX6A 4QBXA 4D8OA 1A47A 5DJAA 4N8PA 1U36A 1BWMA 4B2DA 4UDTA 1W72L 4L37A 2H1PH 4U6HA 4IBWA 4LVFA 2NXZD 1X39A 3DRQB 6XIMA 4F7TA 4ZBCA 3S4TA 5J5DA 4I0PA 3VTTA 3FUJA 2OU4A 1KIQA 3LTVA 2BWQA 4PTTA 3WTWA 3UEZA 1SPDA 2YD8A 4ANUA 3OZOA 2R2HB 5L8KB 2E77A 2L3BA 1UQSB 3OVRA 1CL7L 4PULA 2R9RA 2LVEA 4M3JA 4WI0B 5KJ4A 4MCYA 4G8FA 4ZMZA 3TTOA 3PZVA 3TK7A 2PYED 4D2JA 4X7CC 3T0CA 3ZVHA 3KW8A 3W53A 2FLBT 4EJ1C 4PWIA 4OCYL 5GHWH 2YD0A 3L5LA 2R0WH 3WYZA 3NEHA 3MVTA 4Z95H 2OR7A 4KV5F 1T4KA 1PL3A 3WNKA 4EVZA 4PRPB 5AC5A 2YXFA 4NRZA 4BH7B 3DBXA 2VMEA 3L9BA 3ZHNA 3MJMA 3HLKA 1MO0A 3P69A 4HTBA 2DIKA 1WAUA 1DQKA 2ZC1A 5FOOA 3IUIA 4UYQA 2P5WE 1QRQA 3TT3L 3G7TA 5CD5C 4K5PA 2BIMA 2Z25A 4HNUA 2X9YA 1HH9A 1SFJA 4OV9A 4XD4A 3P0YH 5GSRB 1KYOJ 4DNMA 5DD0H 2MPVA 2JXMA 3OD3A 4KHTH 3GDRA 2ADFH 2R91A 2W0FA 4NGHL 2QW5A 1OT4A 4QO1B 3PJSA 3FTYA 3EWXA 4UR8A 3KS5A 1C9DA 4MYXA 5DRZA 3BQUD 4HIQA 2G0KA 1OSPH 5EUKA 3IS4A 3QXAB 2HKFH 4JY4B 1PAZA 4OLEA 3EWCA 4WEBL 5E93A 4NRYA 1NKRA 2YAPA 5DJXB 1CDUA 3L4ZA 4LOVA 4MNJA 2OPCA 1F3JB 2YGOA 2VXTL 5A43C 4GJTB 1K5NB 3UR8A 4KJPD 1I3VA 4TKWA 2RTTA 1SFTA 5D2NE 1OB0A 3I3DA 4HJGA 4Z17A 2ZAHA 2YMXL 3T2PA 1OF2A 3MLSH 3TMLA 4J3SA 3GVRA 3WF4A 1OP5K 3MZNA 3RWHB 1XGUB 1KSRA 3GVGA 4BYHA 2PYEE 4NVTA 2C1OB 1QW8A 2EACA 5DHVA 4GJIA 2H45A 4NT6B 3QEQD 3P4OB 4NO5B 2ED7A 3TYFA 4KKPA 1P4CA 4KKAC 4BSWA 1W15A 3UJJL 4K9JA 3BG9A 2QVTA 2D69A 1X96A 5FUZL 3BWZA 4O5LL 1ZHLB 3ARUA 3ZKSD 3CJJA 1L7IL 4U5IA 1M7DA 1OFPA 2OYMA 4XXWA 1FFPB 3WUZA 3L5MA 1ULVA 4K55A 3MBED 2UWEA 1CL7H 3DGGA 3AFBA 4C56B 5E6RB 2OFQA 4NHUB 3TASA 1KLFA 2PCPB 3LMYA 4KZEL 4OCYH 4XHJD 4OBRA 4FQXA 3QLLA 2L7UA 1ES0B 4ORMA 2JELH 3IAGC 2CDFB 2WBJB 8A3HA 3U83A 1JTPA 1UC6A 3OKYA 3DSNA 2UYLB 3SD5A 2QHLA 4Y96A 5H94A 4NO0A 5JW5A 3CTLA 4ENLA 3QA3B 1ZLDA 4GX9A 4F3FA 1H60A 3ESOA 4YL4A 4G5DA 4Q4PA 4DP5X 3S83A 2FJKA 1O5RA 4FEIA 3TT3H 3ZE1F 5I1DB 4NKCA 5SWSD 2YZ5A 2DVXA 2AJYH 4GQ9L 5KN5A 3OJ2C 3S34L 1Q4WA 3ARFB 4L1GA 5JYMA 5D2NA 2X4TA 1O12A 3CBKB 4A3YA 3FUKA 2VE6A 5K9OB 4ZUTB 4NGHH 4ZQOA 4O51A 3X12B 3NZGA 1EO5A 2AQ3A 1K7EA 3PZMA 5H2BB 2WLZA 9RUBA 4Q9CA 4O15A 3RB5A 4W9KC 4GMEA 4WK9A 4R7OA 5HGBB 4R90L 1THCA 1HJQA 2Q5BA 5DJYB 3B8IA 1QO3A 2I7OA 4QOKB 4Z7QF 5DZNA 4Z7NB 4J23A 4WEBH 1J2BA 3IETA 3TZVB 1XT5A 1BF6A 3BUIA 4JCLA 3QFGA 1O5PA 2VXTH 3D85B 4AK2A 2Y23A 1W32A 4O52A 4M8QB 1EWDA 1PZDA 4KVPA 4U1HA 2HCVA 1KJ3H 2CO6B 4ZTPL 2YPLB 3MLTA 4GLRI 3DRTA 2J7EA 1E8XA 2YMXH 3I6EA 4DKFH 5I0YA 1DVQA 4NI8A 5DK0B 5CC3A 1U95A 1GYWA 3VFNB 1DCLA 2QSTA 4HEME 1U8MB 1OE1A 5H91A 1U9KA 3X1BA 3EZ8A 4JL1A 3Q94A 2OMYA 2IO5A 2DMCA 1S38A 3TIEA 1U8JA 4WO4B 3BQUA 3FUIA 4MXQC 5FUZH 4AXWB 4XSMA 1BJ1J 1OGTB 1L7IH 4F0RA 2IS7A 5FDWB 4RAUA 3SDDB 4C7GA 3X11B 2FZ3A 1PZSA 4Y16C 1C9WA 2PWHA 5KZDA 5EWIL 5E9AA 4KZEH 4E4FA 1AK5A 4PB5A 3JT0A 2VW7A 4KH9A 5KZCB 1WBJA 2IALA 1BG4A 4L9LB 5AL8A 2XZCH 4H3DA 1B0GB 1NCWH 4YTRA 1CFBA 3HZVB 3VA2C 3F85A 4WUUD 4EDWH 3P30L 1HO1A 3FZUC 1HHHB 3RLHA 4P3DA 4IIEA 4WGXA 1THAA 1RIHL 3QQXA 1J8HE 2X0UA 2QCCA 3EGXA 2ZZ6A 1BRLB 1EEQA 4LAJH 1NFIA 1C8PA 4YJ5A 4MYWB 1LOLA 5C0JA 3ARDD 3M46A 3NXFA 1OD8A 3FYYA 2DZAA 4LANA 3VCRA 3T55A 3PP4L 4FO4A 1T89C 3KPPA 4GI6A 1F8TH 1XO8A 3O45B 5BW7C 4UANA 2EVIA 1I1FB 1BYAA 1V7MH 4I9AA 4DUVA 3FOLB 3UBXI 3UGXA 3HHRB 5BQ7B 1KRAC 1OV8A 2DLTA 3TW9A 1K4HA 5DO8A 3D0VA 4U3HA 4Q8VA 4CD5A 3BUYA 3U9WA 2OXGA 4PUBH 1YMMD 4QTIL 5T33L 2EKCA 5TGBB 4Y4KD 5FW6A 1W8NA 4HWEL 1ETZA 3MJ7B 2EDNA 3W7RA 2OELA 4GRLB 3TAKA 1V7YA 3PREA 4ZTPH 1WITA 2XZZA 3SB3A 2W92A 1YN6B 2ZG2A 4CLMA 4LL9A 4OGXL 3A4DA 4JE4B 3EYQD 1L9MA 1MCOL 5J11C 2WJDA 5H37H 4O18A 4AT6B 3ID7A 4X7EC 5B1JA 3O07A 35C8L 1KXVA 4YFLF 3KBWA 3SPCA 3DYOA 4F33A 3GIYA 4AX7A 3GJFB 3ZMEA 1YBQA 3CDCA 1EJFA 1GY2A 5E7BA 2CSPA 4A2FA 2D7TL 4NN6C 1FG9C 4UFMA 2PTTB 1M56B 1J8HA 3T6ZA 4L9DA 4HAKA 1BFOA 4I8DA 4GI9A 3IWPA 1S7XB 4R7NA 3Q8CA 1RIVL 3VXNB 2EO9A 3LV3B 4NUGL 4PCKA 4PJ5B 5DT7A 2OMWA 1A6WH 4G7FA 2HKHL 1DSYA 3QMTA 1MCPL 3RL1A 5B7EA 2G3FA 5EWIH 1K2DA 3ZXAC 3INPA 1JZFA 5DMIH 1S7QB 8FABB 1H5BA 2DVUA 1JDEA 5DZJA 3FTSA 1XC4A 3QFJD 3QI9B 5IOPA 2HPOA 4AEHL 4B27A 4NX5A 1GGBL 5KZEA 3H55A 1U5HA 1CJYA 4BGLA 1XGYL 1XGRB 1RIHH 3J27A 4NCC1 1Z0MA 3VZXA 5CSZB 1A1MA 3O8XC 4PJGB 1E1EA 3V36A 4C60A 2YIHA 4PRRA 2PP3A 4PB0H 3L6FA 4XMWA 4F2TA 2R1MA 3GMLB 3PP4H 3K2UL 4LGPB 1UYWL 2K45A 2UVEA 1ESOA 4MG4A 4RMVA 2GUOA 2GY5A 1GK8A 5KITA 4RGNC 3IDNB 8XIAA 1REIA 5D4QA 2CNYA 2AW2A 2Z31A 4HB7A 2FPYA 1UYQA 4RA0C 3CD4A 4LKCA 2VC9A 4IHOA 1PBYA 2GDUA 3G77A 1MWAB 3C6LA 1IAIL 1W8OA 1BFSA 3RU8L 1KIPA 1OIOA 3MI2A 4OT7A 3VKJA 4C1LA 5ESQB 5EEZA 3TN4A 2AC0A 5BS0D 3DHDA 1XR2A 3AQYA 5KTEL 4TL4A 3VFUA 4YHEA 4XV0A 4XRCA 5F7KC 2NT0A 4HWEH 4KROC 4IU3A 4KETA 1T21B 5C0IA 2WMPB 1JXDA 4JY5L 1BGAA 2OW7A 3U6XA 4NKMA 1XF5A 3NJJA 3CNYA 4Y4HB 3HPXA 5FI8A 3LB0A 1XGEA 1P5VB 4OGXH 3D69A 4PJDF 1R2RA 3HA0A 1MCOH 4ABUA 5EBWB 2R1KA 35C8H 5DVNA 2DWDB 4Z18A 1E4IA 5D7EA 1CX9A 1VSCA 4HYVA 1X5KA 2CM6A 2OYPA 1XDJA 1BXUA 1DLFH 2O30A 2VOMA 4UWQB 3W7QA 1TNMA 1E56A 2D7TH 3AY2A 4F8TA 4K4KA 1FGVH 2H3NB 5FGCE 4WVRA 1Z7JA 3HLAA 4NZUL 1OCRB 2P24A 4ANXA 5TIMA 4A2MA 1OT1A 1RIVH 2YL8A 1Q9WB 2IPKB 3THDA 1GXEA 1KUMA 4IFKB 3QC6X 2Y7QB 3WJYA 1MCPH 3TJIA 4WI7A 1ONXA 4MDIA 3NCJL 3VM5A 2C3XA 3WY4A 3U2OA 3DVGB 4H0IA 1F6PA 4LCSA 2Y89A 5CD5D 3MP5A 1CLZL 3GHPA 3O6ML 2DWTA 2GTZA 1HHKB 4Q6IA 5DWPA 5EEUA 1DJYA 4AEHH 1NCGA 3W5MA 1GAFH 1GGBH 1QOQA 1TWSA 4XCYA 1JZ4A 2NV2A 4BF5A 1JXKA 3KPSD 4LHQB 1ZXQA 3LEPA 4ALAC 1NGQL 3QOMA 2AQOA 5AVWB 2J73A 3L3HA 2J8UE 1P0KA 3US0A 4XXDB 4POYA 2H47C 5FF2A 1S7VA 2D31A 2C9XA 2O9RA 1ECZA 3EJZC 1MFUA 4WHCA 4EOWL 1AG1O 2EZ0C 5CZXC 1M7OA 2XZAH 3T1GA 4GIRA 1ND0B 4UYPA 3O6CA 3AJ7A 5IBUG 2H26A 4S0TD 1ZVHA 3H9YA 1IAIH 4GY4A 3SGKA 4M8UA 1BF5A 1JF6A 1KTDA 4GW5B 3SZ6A 1H6FA 4L05A 5E9NA 2N0KA 4HFUL 1M1BA 5KTEH 2OX1A 2XOTA 5IFPA 2CBMA 4LS1A 3UTTB 1QTYT 3EUDA 4DO5A 1BQLL 2IADA 3VXSA 4JY5H 5CPLA 2H1LM 4G8GD 3BVTA 4BXVA 3HMXA 4NFBA 1D5XA 5HYQB 2F7FA 2R7EB 1KPRB 4KKAD 5CJXC 4R3SB 3UJEA 4C1NA 2UY4A 3BPCA 3SJVB 1TCRA 1IL1A 3B4UA 5CMAB 1Z0NA 1OW0A 1GCYA 3BOXA 3HVNA 4AYFA 1F6KA 4WAFA 5E8NA 2KZBA 1X7SA 1Z6KA 3WOVA 4IL2A 1ZTXL 1AH4A 3QPKA 1IC4L 1OZQA 1ISZA 4FULA 1KBBA 1B9BA 4ZFOB 4ESKA 1WFJA 4JIQA 1X9RA 4B9YA 1J5DA 1WGOA 2YOAA 3WNIA 2XA8H 4NAMA 2X12A 2IQ0A 5GGQL 1JGDB 1PJ9A 4NJHA 3WTTA 3GSNL 5HGHB 1JXJA 5DTFB 1S8DA 1EJTC 2V69A 4NZUH 5IIEB 5GGTA 2MCAA 4NZ5A 3RX5A 3KPSE 3UZJA 2J8UA 4OFPA 1KOAA 2VXVH 4RBPH 5EO1B 3DSFL 3WBWA 3NCJH 2EVGA 3GXMA 4OIFA 4DAIA 2RHEA 3K4AA 2OBGA 1A02N 2A6DA 3N9RA 1QSZA 3FA4A 3O6MH 4MJ2A 3MJ9H 5A3IC 1RZ7L 4PV8B 1RP9A 3CQKA 1H8OA 4BKNA 2Y7MA 2I27N 4F5CA 5FGSA 2VITB 2PO6C 4AE0A 5EUOA 4RDYA 2V7HA 3NVTA 1A7OL 1I1CA 3UTQA 4QRFA 1ZDSA 4DF1A 4R5VA 3RG6A 2OZTA 3ZW3A 2Y7GA 4WI8A 5E03A 3HBPA 4Z1BA 4IQJA 1UC4A 4AC7C 5HPCA 4Y2OA 2FYYA 5JHLA 4RW3A 1DVUA 4AY8A 5LYRA 5DMLA 4LAOA 4HMCA 3BW4A 4Y2LA 4G8GE 3PZIA 3TSMA 2CBOA 4AF0A 2P9RA 4NS0A 5KS9B 1OYCA 4YDMA 5FO8B 4GXUN 1YYLH 3STLB 1B3JA 3NO5A 4UWMA 3VNDA 4DKTA 9XIMA 5EU4B 4LDEB 5IROA 1ZGDA 3HBLA 4U3AA 3G1XA 4M5PA 1KTJA 3PWNA 4BQ9A 3EMZA 5DHYA 4W9TA 3K8KA 3IGAB 3LKRB 3PGCB 5F7WC 1IIHA 4YHLL 5I23A 2JH2A 1KTBA 5KG9A 1XZ0A 5IR1B 2WYTA 3NL3A 4P5SA 4HFWA 4MXQD 3MRRA 1KCXA 1GPOL 4IU2A 4L4JA 2HVJA 4P8QA 3F4DA 5F88A 2H8ZA 3AG1B 4Z7VF 5E5UB 4YVPA 4QNWA 4XN1A 1IC4H 2QLYA 1P6CA 3VG9C 1LOSA 1ONWA 3O2DH 1JZDC 4Y16D 1A5AA 3CFJB 4X7SH 4PBFA 2VEGA 2PRHA 2C9SA 3VJ6B 1KT2B 5JOPD 1IGSA 2XIDA 2P8LA 4M56A 4HIXL 5GGQH 3PJLA 4Y88A 3GSNH 4RBPK 5KYWA 3ZQXA 3P5ZA 1G6CA 5EPDA 2V33A 4EE2A 3B7UX 1FPTL 4KO9A 1DE4B 5ABHA 5EOQH 2JI2A 1WKEA 4XB8A 3RI5F 3FZUD 1QZNA 3DSFH 2ZCZA 3HR5A 2V0TA 2PCQA 4YDJB 1MG2C 3ITYA 1EZ2A 4AENA 3MUCA 3WH9A 4DX3A 1JGIA 4G8GA 4PRDA 3FQRB 4UOJA 2PDMA 1NQ6A 3NSFA 4J6RL 4H88L 4GYJA 3EEZA 3SIZA 2PDHA 3TH6A 3HFYA 2H6OA 1ILUA 5F0JB 5ISZB 2QADC 1ZT1B 4X6BB 2ZT9C 2MH4A 5E5MA 4D8AA 2FX9L 4ZX3A 3KPNB 4LCUB 3VD3A 1RJYA 4HD9A 4DK6A 3IWUA 6PAZA 4GNVA 2A85A 4WDTA 4LV4A 3VUSA 5SX4H 2NQZA 5EYWA 2JQMA 2EILB 1NMAH 4NT0A 1PWLA 4V28A 4RFEA 3TO4B 2J55A 5AC4A 1P1XA 4KWOA 3C8KB 4OLWL 4ZMLA 1UJ3A 1SHWA 1GJIA 2YN3A 4UQ2B 5BCAA 3BZDA 3LAFA 4LCWA 2PSNA 2EDJA 1WXJA 4Z7UE 2V2WB 1D5BA 1CFNA 5KVGL 2VAAB 1KBVA 2Q3OA 4K8HA 2CBUA 1E5AA 1OCCB 5G5IA 4OUEA 3RJDA 2GG1A 4JY9A 3V95A 4O0ZA 5A8OA 3RZCA 5AW1B 5JOPE 4YHLH 2C1PB 2A4ZA 2WQDA 1L6WA 1O9ZA 4RETB 4JB9H 5AZ1A 1M2VB 4YHGA 1QPPA 4HX1B 5I9QB 2XKSA 1ZS2A 4ZQRA 1UOKA 3B97A 1N6QL 1PBGA 4FQXC 4PUNA 3QG7L 3MRPB 2ATMA 4RKAA 1COBA 3ZDXF 4B0MB 3RWIB 4UZGA 1BVLB 5L2JA 2WXFA 5KVMC 2YLAA 4DQOL 5JIQA 3FT3B 2QGCA 4RH4A 4NAFA 3EH2A 1V4YA 1I45A 3NL5A 1HVXA 5I79A 1PEZA 5EZOL 5D2NC 5LJYH 4JEQA 4AC1X 4N2LA 1MZHA 1EJ6A 1GZ1A 2PGEA 3C86A 2NOYA 3O8XD 4H8WC 2E5CA 1FWJC 4U6HB 5F7LB 2XXMB 4R96B 1R33A 4EAEA 2YDSA 3KPMA 2IDQA 3QR2A 4J6RH 2BVPA 1S7UA 4F7TB 1BP3B 4XNYL 2Y7FA 4I0PB 2Y2WA 4N28A 4P5RA 2REQA 3SDYL 1N3NA 4RGND 4Z7UA 1ZT7A 2FX9H 4O19A 2FT8A 1NIEA 3NZ1A 3KCPB 4EZJA 3I02A 2FVLA 3K0WA 3GX9A 1PFOA 3V5HB 3GUTA 4E0RA 4PJFB 2EDDA 1F1GA 1MNZA 4MCYB 3ABSA 3MJGX 2IH1A 4ENEC 4JFVA 4HK0A 4PEKA 3GIVB 3RHWK 1I1AB 1V7NL 4OJEH 1QSFE 1Q2RA 2VR9A 5C2CA 4WWKA 3F04A 3ARQA 2M83A 3ESUF 4O2CA 2OL3B 1EXPA 4YHPA 3ILDA 4KROD 2A0NA 2YXOA 2VUYA 4FOUA 3MUGA 5D03A 2VC2L 4KY2A 4PRWA 4Z7OB 5F4SA 3AAZB 1X6NA 1PV8A 4O02B 4GOAA 1M3JA 1OOAA 1XICA 3W1ZA 4H9UA 4JTSA 1DVJA 3QGKC 2ESCA 2C9UA 1T3FB 2VYRE 2MOVA 3IMTA 3KAAA 2JXMB 2XYBA 3MXWL 3TLRA 4NHCL 2B39A 4G2AA 5I66B 2NWRA 3PWAA 3NFSL 4AIZA 4RESB 1FA4A 3JZ7A 1O68A 4E5XA 4DQWA 1UD2A 1XGPB 5GJTH 3V0TA 4YSCA 2PBOA 5BZXA 2YW4A 2DLHA 4N9DA 4PJHF 3H9ZA 2F6AA 3ITXA 1GHFH 3VE7A 4JTLA 4FERA 2CRYA 3N40F 3D18B 1IBDA 4KQ0A 1EHLL 4HCFA 2B4CH 3MWAA 4DQOH 2ONEA 4FF7A 4L0ZA 2NYYC 3BAJA 4Q32A 5LHFA 3NCYS 4RGNE 2DUZA 4GO9A 4HJGB 4U1KA 3LHAA 3ML8A 1CT8A 3H2MA 4NLHA 3ESMA 3NRQA 5EZOH 2YZ8A 2WAQA 4FKEA 1U8OB 1K8XA 3ULAB 4M1CC 4HZAA 5H4YA 2C9VA 1IXOA 4G83A 1Q6LA 4ZUUB 1QSFA 3INOA 4IOTA 3MCKA 3UP6A 5ICUA 1P2CA 4DNHA 4P4KA 4XNYH 4D8PB 5E6ZA 3K5XA 3LB6C 2OZ4A 5LQBH 3IN2A 1EERB 1RCOB 1SQ7A 3VXRE 2ZWYA 3EJZD 1PU0A 5KYUA 1RU9L 4ATLA 2BS8A 4I9XA 1Q0XL 3WUFA 3OSKA 4OAWB 1NCTA 3WO8A 2EZ0D 5CZXD 2P5WB 4B5NA 2WOBA 1M7DB 3FPXA 3BVWA 2FL5B 3CIQA 5B39A 1IEHA 3DGGB 4QAMB 1FN4B 3WBAA 2BWIA 4I5BB 2WQVA 4LRSA 1C7SA 2AKRA 2MOQA 2PCYA 1F8IA 3L9RA 3SN6N 1V7NH 2Z3FA 3EZJB 3IU3B 3PHQB 1G4RA 2B77A 3U1SL 1V3IA 5B1JC 1QUNB 3KYOA 3DSNB 5AQ0A 5EMMA 3GH7A 2VC2H 5JW5B 4IMAA 3O8XA 1EMTL 1GSKA 3VTAA 5I6LA 5E8OB 1WKFA 1KCSL 2NXZB 4XBSA 1D8WA 4ATDA 2GHWB 3RFZB 1C12B 3EFFB 1R3SA 3RF9A 2DW5A 5E24E 5C6MA 5KAQF 4LOUC 3BKML 4UFJA 3RVUC 5GJPA 4GG9A 3LKOB 3UG4A 3VZYA 3EOEA 5BOOA 4HH8A 3MXWH 5I77A 4O51B 2OMXB 3C8DA 3NFSH 2G95A 5B3SB 1ZJIA 4BK9A 2PYEB 1I82A 1H5BC 1XFPA 2RDUA 3QULA 1E0TA 4JTJA 1RVGA 3QTGA 2YMTA 4N2YA 4OV4A 1C90A 1EOMA 2Y06L 1AQDB 2WSYA 4NOBA 4LQFL 1FZJB 2ADGB 3IETB 4OUIA 3KHDA 2XZ7A 4LVHC 2CR6A 4FLRA 3VXRA 3E3QE 4S3JA 1YY8B 1EHLH 5DFAA 2UWFA 2PS2A 4HKBA 4UTCA 3HIZA 4Y9CA 5JW4Q 4U1HB 1L0XA 2XQ0A 3M17A 1UQYA 5TAOA 3FCBA 4F8QA 3L0KA 5A3ID 5CEXA 4PP2B 3L13A 4JZOB 4LBSA 4OVXA 3CO8A 3QWRA 2RFXA 4A68A 1JNHB 4WW2C 4I3GA 3V7AE 3W85A 2PO6D 3E8UL 3B4YA 3TEUA 4U0RC 2Z31C 1TPXC 3LSCA 3B7SA 1MJJB 2DQGL 4RDQF 3K81A 3MR9A 2J7DA 1N2RA 3V4PA 3BLLA 3ZDZE 3C6LC 3QE5A 1C3FA 3A0OA 4Y8EA 3FBQA 2B8OT 2A6LA 5EBGA 3UPBA 5FYKU 1Q0XH 5ENWA 3O6AA 4I85A 4RVBA 1ZQ5A 4IQLA 4US6A 4TLKA 2GJNA 4HA3A 1JPSL 3L17A 3IBOA 3TH2T 2YZ1A 3MI3A 5DMYA 3ZT5A 3T2QA 2ZG3A 4IG2B 2UXFA 3IE4A 1QWGA 1XV8A 4Q89A 7REQA 1YMYA 1UOZA 3IKCA 2ZAIA 4TQHA 2J74A 3U1SH 4UF7C 1JHKL 3VGDA 2J8GA 1MDLA 4YGAB 1I53A 2DPEA 4TUJA 4TRPL 3UBXA 4PCPA 1SQ2N 5FA3B 4B4FA 3MBDA 3IFOB 3P73A 1SDDA 3JWDL 1ONQA 3C87A 3QEQB 1KCSH 3FX4A 1NFIB 5IHBA 1H1NA 3HMJG 4X6CF 1VACA 1OZUA 4U10A 3BPNB 4O9HL 4RZCA 2V7NB 5EKYA 3BKMH 2W88A 3APDA 4EF8A 3MO1A 4AEEA 2EKGA 3NDYE 2Y3AA 4YDLC 4RMBA 4GP5B 3QY8A 3PAOA 4Z3HA 4NBYB 3MBEB 4GXUM 3F84A 1MFEH 5TFSL 4UQ3B 1U3JA 1U8LA 4FOKA 4CSZA 4DPAX 3V79C 2Z92A 4ZMQA 2DJXA 3OLEA 4U49A 4FQ2L 4XC1L 1BM3L 3BP7B 4Q6IC 2I7SA 2Y06H 3VNLA 3M16A 2XQYA 3ULUL 4LQFH 1FY6A 3W22A 3RGTA 2W07B 4I6VA 2J43A 4F7MA 2VDPB 1K6AA 4OV6F 2FBJH 1U91A 4JIEA 5IP4A 2Q7YB 1ET7A 1LO3L 3BOFA 3OVPA 3SUVA 4BA8A 3US1A 4QE5A 2VD9A 2SODB 4NC1E 2YKKA 4P07A 2NVDA 3HTWA 4IBZA 2E59A 2J88L 1TSRA 4AEOA 4J5VA 5SWSB 2AGJL 1F5WA 5SWUA 2ZSVB 4ZXBA 2QADD 3E8UH 3ZTNL 3O41A 4TQ8A 1TQTA 1AG6A 1MF2L 1K8CA 2DQGH 4B3VA 3TU6A 1L3WA 3FTGA 3WLJA 2HJKA 3OA5A 2EDMA 4V27A 1TQCB 1EZSA 1YBQB 1NPNA 3BJLA 5INDA 4GQQA 3DUSA 3BC9A 4AGQA 1OFAA 4NZCA 3GUGA 3VYNA 2R2EA 3SRDA 4M5YH 2EYSB 3TIDA 1A4CA 5E1HB 2IWFA 3TX4A 4NUJA 2L0DA 4PJCB 2BOGX 3C2AH 3IDMB 4R7NB 4JFYB 4CDGC 3BH9A 5AENA 3LZNA 2OB3A 1HKFA 4NZRL 2R1YA 5ESAA 5AW4B 1KKRA 5GRJL 4CGTA 4OLXL 2X4SA 3W24A 3OBAA 1W9PA 1RUML 2X70B 1TMLA 1JHKH 3RX8A 1N68A 1XAUA 2PO6A 4NKDA 3PB2A 3LRSB 4I5XA 1A22B 1YEEH 2B7OA 2WKOF 4QGYA 4GO6B 3RHWF 3SKMA 4R0LA 1BWVA 4RUBA 1SYTA 5G2WA 1A1MB 2Y63A 4PM1A 2QCEA 4ZMWA 2I56A 1JV2A 2R82A 1X5LA 4FQXD 4FAMA 4ZSOA 3LTSA 2NQHA 43CAB 3FYEB 2WZPD 1CE6A 3Q45A 1M05B 2Y07L 1JGLL 4Z7AA 1F56A 3VFPA 2Q02A 4NO0D 2HE8A 4JVUA 2CDEB 5TQ2L 5JTWA 2BZNA 4RNRA 3CIXA 3ASWA 3CZJA 5D2LF 4F2EA 4HMEA 4Z3FA 1RK1A 3R4RA 2TSYA 3MRBA 3ALFA 1FHGA 4M81A 1YRKA 4XC1H 2WMIA 4ETYA 1DSWA 2LFEA 1UCWA 4WY7L 1TVHA 2GFBB 3VFUB 3M1BA 4KX9A 1LO3H 3PIQB 2D23A 4P4RB 4LP8A 5JHDD 1GKOA 4WUUB 1TTUA 2XTSA 5C55A 1OPGL 5MEPB 4XMVA 3OG4B 4M6AA 4UMBA 1MFDH 4NERA 2EAEA 4YHML 4J2QA 2IBGA 4RNJA 5I24A 1NFGA 2IXVA 1WAWA 2O5YL 1RUAL 2AGJH 1XWVA 4QHMB 4JN7A 4GKNB 3ARDB 3ZTNH 3L2LA 4NQSA 3UJRA 1EYEA 4UXDA 1MF2H 4CRPA 3G1HA 3U82B 4L0PB 4KMLB 2YPVL 2AI0L 1TF4A 3QRHA 3LEVL 2FYMA 2XGIA 3BVNA 4JFWA 2PWEA 2IMRA 4ENED 2A6IB 3QN3A 5ABFA 5J04A 3MXVL 2X87A 4OJYA 1W3NA 1GHRA 5IROC 4C57C 2UWEE 4XCFH 4LLVA 4AFYA 3U4EA 3WLBA 2I69A 2Q3RA 1QUMA 2X53A 1YMMB 4Y4KB 1QNQA 5K5YA 1QTWA 2JI1A 4UC5A 2X1QA 1KYUA 1ISXA 5GRJH 5DLML 4AKQA 1DEEA 5C2GA 5DZOA 3MSPA 1RUMH 1B4JL 2MNUA 4YDVB 9XIAA 3W7KA 2EVFA 4IRSC 4AJYV 5C2BL 3MSYA 1K02A 1TG7A 3DGDA 2W27A 1HZHH 3WSQL 4FFVC 3JWOC 3KYAA 3FHAA 3RX7A 4CVZB 1GVQA 5JUVA 3AVEA 1WIUA 3IXTA 5CPSA 4DZ8A 5KEZA 3T4CA 1KACB 4IDJL 4AZCA 5EMJA 5ENLA 3CC1A 1M7IB 3LPWA 4ZUSB 2CJSA 1KC5H 2BINA 1YNTA 1AXIB 5JHDE 1F11B 1DJQA 3R06A 3ZPDA 4KY1L 2Y07H 1JGLH 3RCMA 2HK1A 2EO1A 4NQVA 3WJXA 4M43L 2VO5A 3M6YA 1W72H 3I84A 4NC2B 4PEEA 5J8OA 2BWGA 4N2BA 1M9WA 2OMAA 3G6JA 4PJAF 2NYYD 4HGXA 1LL6A 2R2BA 1SF3A 2J21A 3GMQA 4ELKB 2NY2C 1LQ0A 4X5WA 2R1WB 4WY7H 4M62L 4M1CD 2YW3A 3QFJB 2OQJB 3CE1A 5EIIA 3EGDA 1OPGH 2X0VA 4HPHA 4I3RL 4YHMH 4OT1L 2FNBA 1FWWA 5CKGA 2ZUNA 2OULB 4Y6GA 3UA3A 1R24B 3LB6D 6ALDA 1RUAH 3VXQA 2Q3AA 4FG6C 1MVFA 1E6XM 3LMZA 5I6MA 1LILA 1P7KB 2PTYA 4C55A 4LGSB 2WZPA 4NZTL 5C0FB 4ELDA 3FU8A 4MA7L 4C6EA 2AI0H 3LEVH 1UJ3C 3L48A 3E12A 3F7YA 4HALA 5LAXA 5ES4B 2IFGA 1CXHA 1K9EA 1Q90A 1U41A 2PYFA 1PVHA 2PR9A 5I16B 1BIHA 4K73A 4ELMF 3L2MA 1VJIA 3GHTA 2DZEA 4ZTXA 4J2MA 4QX4A 3OKMB 4RX0A 4XNZC 1AGEB 1YC7A 1P0DA 3FN9A 1S8DB 3VXUE 4GZIA 3QNXA 4EDXB 2GGGA 3RZCC 5BS0B 1HJVA 3N18A 1LP6A 4F8PA 3AXLB 5JHDA 3DXAD 1WZLA 2B59B 5G2IA 5L8JB 2I5IA 3TR2A 2DJ4A 4YMPA 2X1PA 1KTRL 2HXAA 1IZJA 4QYOA 3EFOA 1F3WA 4N6EA 1J8HD 1EXUB 3UGUA 1B4JH 1KDJA 3DUUB 3C2EA 4R27A 4O57A 4LOUD 3RVUD 4CQAA 4BZ1A 2YD3A 3ES7A 4X4ZA 4ANVA 1T0OA 3PL6C 2A4CA 1OJXA 4IGMA 4A63A 3WDIA 1O6SB 1RJRA 3BWAA 3NQGA 1D7DA 1TLKA 2VSCA 4IDJH 3LX9A 2ALAA 5J6HA 4GAYA 3RRAA 4Y8AA 1HX0A 2DEPA 2EAWA 2EICA 4KY1H 4Y2OB 4GIEA 1V02E 1AG0A 4W81A 4RDBA 3REWA 4Q9RL 4HS6B 3UZVA 4MZ2A 1JNNL 1PYFA 4EI5C 5CJNA 3GBLA 1V55B 1Z41A 5A2KH 3QJOA 4RGOL 3W82A 5KUMA 1J87A 3UJJH 5DRNA 2VH5L 4PSPA 5DQ9B 4M62H 1NMCC 4O5LH 2J7LA 3PWNB 4G9FD 5AVVB 2Z31D 3JS3A 1ME9A 1DBJL 1F4HA 3IDIA 4F0MA 1BV8A 2QVFB 3VXUA 1JGUL 4CNSA 4IGNA 4ZG1A 3C6LD 1NBQA 3BFQG 3KPSB 2W66A 1JGVL 3ZE2E 4JQ2A 1AKJB 1M9HA 4H40A 4WWKC 2CIPA 2HVJB 3LDVA 3G1VA 4HIPA 1OAUL 3HE6A 4LALA 1L0PA 4NZTH 3DXAE 3K13A 1E6ZA 2OGYA 4JFDA 4MA7H 2Q76B 3TYZA 5KYYA 3CUPA 4Z77A 3IMWA 3WEXA 2H2SC 5A5WA 2XNAA 3W39A 4HW6A 4O17A 1MI3A 3SQBB 2P8LB 1Z3NA 4GQ9H 4ONOA 3QQ4B 4GQBA 3VFSA 3BIAX 3AYSA 4J3ZA 2GSGB 3S34H 3I10A 3OKEB 3QC0A 3QLDA 5HVWA 5EU9A 4FTVE 1RI8A 3CSGA 4IKKA 4XNQB 3GRGA 2VLLB 4QDGA 3X13A 3JTTA 5D4JA 1V02A 4Q4EA 4WTZA 3RJXA 3BUBA 4G8GB 4V15A 2JF1A 5A69A 3F8UB 1JR1A 3CHDA 4R90H 3L7EB 2WLKA 5DFTA 2XY1A 3L9CA 4HK3N 1CGTA 2J7BA 3QIWB 1U8KA 1YUHA 3JV4A 4QHKI 1EEPA 4OR1A 2DZSA 4U1IB 1A9VA 4E9LA 5D9SA 3FB5A 3KL3A 1A25A 3BESR 1I6NA 4G9FE 1OVDA 3TFKC 5J1TC 2CHWA 5LNUA 2QF8A 4H9MA 1Z9AA 4AHQA 4MJ4A 3T6VA 5JH1A 2V5RA 2WC4A 1J48A 4Q9RH 3LRKA 5E0QA 3TN5A 4NYUA 3S5YA 4JFQA 4AK1A 1HJCA 1EBHA 1QPOA 3HG0A 3DXAA 1MCJA 5D7JA 4RGOH 4P4KC 2NUWA 2GFTA 3RI5K 5JZ7C 4G1EB 3PFRA 2VH5H 4U6XB 4PMVA 4FA7B 4AITA 1NWRA 1R3WA 3VRIB 2QV4A 1MREL 2QV5A 2VXUL 4HIIA 1L6YA 1DBJH 1OARL 1MG3C 4PH6A 1REQA 1L6XA 1JGUH 1K9TA 2Y5QA 2N4IA 1L0YA 1UVQA 4FTVA 2NUTA 2WLIA 2EPMX 4S3EA 4L6DA 5D37A 1JGVH 3TC9A 2NNRA 1ZHKA 3P7YA 1R19A 2J71A 4PBWD 1ECYA 2X0SA 1OAUH 3SGJC 4S1FA 2XWBA 2WN3A 1A6VL 5CKSA 4N20A 5ITFB 2ADIB 3P30H 1KBWA 3VXSD 1A3RL 5K93A 4P05A 1AH0A 4XMKL 3IUDA 2J8OA 2BBFA 2P0OA 4L18A 3RIKA 3W7DA 3OGVA 3B56A 3WEBA 4QT5B 4FQHA 4KUCD 4NAFB 4UAOC 1E8WA 4PLKC 4HJUA 4RXFA 5GZNC 5DEFA 3MSRA 4WW2A 3SBWA 2Z91A 4G9FA 4MKNA 4KCTA 2HX7A 2PLKA 5FJTA 4H9TA 5D1XE 1MNSA 3FKUS 2WQXA 1CXKA 1R5VA 2OQHA 1U3YA 1KCZA 1HINL 4PV9B 3W3BA 2Y3NA 3LRGA 4DF2A 2OXHA 4KZ0A 1SW0A 3DHPA 1IE7C 1L6SA 4WJG3 3DBSA 3MPGA 5IJBC 1UM5L 4C6IA 1N3NB 1NGYA 4OZIE 4QTIH 5T33H 3HC4L 1UHVA 1B31A 4KFNA 4Y16B 1TQJA 3OVQA 3RL2B 2ALDA 1DIKA 1QU4A 5HR7A 3AU1A 3CT7A 1ZK9A 3W1TA 3ATAA 1TDQA 3I9AA 4JFHE 1DQVA 4OUOA 4NL1A 4ZEPA 5LGJA 1FJ1B 4QYAA 1WAAE 4WFGE 3VINA 4ACYA 2YAHA 2WO5A 3P2TA 2N56A 3FCTA 4O2CB 4MLIA 4C6BA 1RZ8A 1XYLA 3ZIZA 1S7WB 5E8PA 1ZA6A 1HTYA 3NFPA 1V51A 4RV3A 3VXSE 2VXUH 1PIFA 2EXSA 2XN9A 3LEYL 4FFWC 3IV3A 3OKNA 4NUGH 2FLRT 2IDCA 2GSEA 1VR6A 4EAYA 2HKHH 3WF1A 2CAKA 1ZBCA 3MV9D 5FB8A 1KYAA 3ZHKA 2B9BA 3RLUA 4PP1C 4I9WD 4OD1L 2HFTA 1DVFC 3P8IA 4G72B 5IROD 3M88A 5D1XA 5I30L 3A9BA 5AW6B 1A7QL 5CPMA 2UXTA 1BEXA 1A6VH 3CEPA 1E5ZA 1FVEB 3ZHLA 4WF7A 1XGYH 1UXSA 3ELAT 2QUNA 3QKZA 4MSWB 1XF4B 3WGUB 4C7DA 3MV7A 4I87A 4XMKH 3VXTB 1S46A 2YS4A 3TUUA 2C3HA 2NCMA 3A6CL 2VEIA 2POTA 4TX8A 5I8CB 4OZIA 3QS2A 3E3QC 2ZP9A 4BI7A 1DQWA 1ZZMA 1X4YA 3K2UH 1S2CA 1UYWH 4U1KB 1WDWA 2FH8A 1XD0A 3G0UA 1CT8B 2PN5A 4IRSD 4WX2A 3VI3B 5J11B 1YG9A 1VF5C 4EPSA 2UY6A 2DSWA 4WO0A 4FFVD 4GUIA 3T1FB 3QZEA 4HK3J 3BQ5A 1I9JL 5F7HA 3THCA 1WAAA 5A8PA 4YZFE 4MKSA 2P5EA 3WJSA 5REQB 2C1HA 2LW3A 1CB2A 3RU8H 1P2CB 2X1IA 3LNFA 4F5CE 3O2WL 4UV4L 1TVLA 5EUOE 4NN6B 1TNNA 1UM5H 1KBIA 4K6AA 4AQEB 1LP9F 3TQKA 5FOJA 3GAYA 4DK5A 3QHZL 2IQDA 1BOGA 3DCPA 1LWHA 2PRMA 4K68A 2VISA 2QNEA 4NP9A 2OQLA 2EPKX 4IHBA 1IMHC 2NY2D 4XBJA 2X4QB 3S35L 5IK3B 4XUYA 2V2TA 3TEVA 1H3XA 2YR1A 4AYGA 3CUZA 4ZXBC 5AB3A 4FOJA 1EBAA 3MV9E 3DX9A 2OMNA 1MHPL 2OMVA 4AD5A 3E38A 3SKOB 3ZMNA 1DEDA 4I9WE 2CHOA 3WLNA 1VBUA 1DIDA 2YAMA 4JAMB 1EDHA 3U57A 4DN1A 3TBVA 3T05A 3Q58A 3ZRCC 4TTGA 5IF0B 2CE6A 3W11C 1XGTA 1R9FA 1F90L 4FG6D 2F61A 5G4EA 2HNHA 4DLFA 5AZUA 4GO8A 1AZBA 2ZUQC 4FL4C 2KDGA 3LEYH 2UZ9A 4GPNA 1QRND 1A6AB 5HWJA 1GYVA 3TTYA 4UIOA 3TCSA 1ODZA 3NJ3A 4M29A 1QI4A 4YSPA 3SY5A 4LCWD 4OD1H 2WMFA 4PY7A 3QY6A 2E9WA 4OJDH 3ANYA 3T6XA 4HUVA 1L8PA 4ETQA 5I30H 1CLZH 4XPBL 1NINA 4I5RA 1MPAL 2N7BA 1GG0A 1ISWA 5LHEA 2EDXA 3RZCD 2NNCA 4GD0A 4B9CA 3VB9A 3W28A 2Q1EA 1UBSA 4KROB 4EEEA 2R29A 4R0LC 2VZOA 1NGQH 4HKBB 3EX2A 3CZNA 5FS5A 1T1ZB 3AHZA 4NY2A 3KPQA 4KK5C 1L2QA 3ARVA 4RQQB 1XRVA 1HE7A 3KCOA 1RLDA 1XYMA 4F79A 4NC1C 3WKQA 3UAAA 1DWJM 4DEPC 1V6VA 4WUKL 3IMUA 4EOWH 3WNJA 4TVCA 3Q65A 3PL6D 4CA4A 2ACSA 4JDTL 3BLKA 1KPUA 2UY5A 1I9JH 3LNEA 1VBGA 4YXGA 2Z7YA 4AIUA 3MV9A 1YNKL 5CKAA 4BF9A 3B2XA 1IIKA 1H9VA 2ROXA 4CMMA 3O2WH 1INDL 4UV4H 5C9JB 3S3BB 4N2EA 1IGJA 4HFUH 1TJ2A 2ICEC 2PTXA 4YLQT 3TA6A 5LWYL 3QHZH 4DI8A 3MNWB 3O16A 1BQLH 1NCBL 2F74B 4EI5D 3VRJA 2ARJB 1UWIA 4NQQA 1YPIA 4F8NA 3DOPA 2GC4C 2XY2A 4CMHC 1QEWA 1QRNE 1OY3B 3S1GA 3PP7A 2IQAB 4MLRA 2UXGA 1P7HL 2X4UB 4AW7A 3PZOA 4KJWC 3IJYA 1JWUB 3IKCB 3IM1A 3FQ4A 2CHRA 4XMPL 3D07A 4TUKL 1X44A 4IRSA 4LCWE 1ZTXH 2GIXA 1H0GA 2ZKYA 3BVDB 4HULB 1KRBC 5DUJA 2UZXB 4XBPA 4S0HA 1WXYA 1E8ZA 3UBXB 1SYVA 1H3UA 3VUAA 1NQBA 5BXFB 2H8XA 4HA0A 1UR0A 1F90H 4H1ZA 1ONQB 4LPYA 3ZL2A 1W0VA 2JTDA 3QQDA 5K9XA 2N7SA 4WWKD 3E2RA 4NSKB 1MDRA 2QLVB 4IT1A 5M94B 2F2KA 4JX4A 3RBSA 4MD4A 3FQWA 5LBSL 4EQ2A 4MDJB 1AR1B 4XR8C 1OAXL 3G5WA 4LHJB 4KQ4L 2H2SD 4UT6A 2DLGA 4N25A 1R86A 4J3UA 5IMOB 4FJYA 1RK0B 1GVOA 1G7UA 4XPBH 4PCNA 1RZ7H 1TPVA 4PUKA 2JKXA 1Y1DA 4N0CC 1PQZA 4YO0A 3P62A 4XKMA 2R24A 2YCEA 3BEVB 2BSRA 2BC4A 3G1DA 3KBPA 1A7OH 3TFXA 4M6ML 4UCGA 2KQMA 3STEA 3IJDA 1JQVA 4DT2A 1ZJHA 5A8GA 2DEYX 2FQIA 2CYGA 1EQWA 5EEXA 4JIHA 3T09A 5DN1A 2V0AA 1UWRA 4KH2A 5ICXB 4WUKH 2CBVA 1QRNA 5I74C 1TIMA 3O41B 3OKOB 4ODTL 4V11A 3E3HA 2A38A 2J44A 3CAWA 3VNKA 5FW7A 4P3CL 7TAAA 4H6EA 1MCFA 1YNKH 3FOMA 5D2VA 4IBUA 3LLFA 1UWQA 4RK8A 4ADTA 3TFKD 5CNHA 1KIRA 1ZSXA 4J7RA 2NZ9C 4GXPA 1R7AA 4B5ZA 2R2EB 5LWYH 2Y61A 4KKXA 3V1PA 3TIDB 3QDAA 1JCYA 1U2HA 4NUJB 1QSFD 3GI8L 5D5MA 4OLUL 1W80A 4FQQB 3AIBA 2OA9A 4KOCA 5BV7C 2QS8A 1PIGA 4HWBA 4TPRL 3N6QA 4YN5A 2WIIB 3BH9B 3PANA 4W6XB 3SIMA 5LDSA 1CLKA 2GJZB 4P4KD 5ESAB 4GSXA 5JZ7D 2H2PC 2IGTA 3T9PA 3AQUA 1GPOH 3MVSA 1K4CA 2X4SB 4XVUC 1T7YA 4TUKH 1LDCA 4HHHA 4PREB 3H7BA 1G67A 2HJLB 1OP9A 4YXHL 4H7VA 3PL6A 4IMLA 5CZKA 1FH7A 3H4XA 1R3IL 2XV0A 2XV2A 3VFVB 3SKMB 1YTEA 3EOTL 2LABA 4HIXH 3QJZA 1QQDB 1OQXA 4AYBA 1K7FA 2X1XR 3LENA 4ZFFA 4NDMA 3WGVB 4EIVA 3MYJA 1BYOA 1XDMA 3PTQA 1SO4A 1FPTH 1Y07A 1KJ2L 2KQNA 2AQSA 4YL9A 4HC1L 5M2FX 5DJAB 2YBRA 3LNIA 3Q5OA 5E0KA 4UDTB 5E08L 3LGDA 5A8NA 2GVJA 2XU2A 1X9QA 4L37B 2MRYA 1UWSA 4EI5A 4ODVL 3M0XA 1EVTC 3SQMA 4GIYA 5AZ2L 2OCCB 4PLKD 4H88H 2D7OA 5J56B 5IHHA 3HI1A 4GKSA 5GZND 1A5FL 2Z8WC 3MNZA 2ZRXA 4MCMA 1KIQB 2RDXA 3D39E 4PTTB 4YBHA 2VWSA 4NBZB 2QDWA 1TVHB 1FNGA 3CMOL 2B15A 4MA8L 1UADC 3UYIA 3UO1L 1J0KA 4GPVA 3M1BB 3IARA 2CRIA 1PNCA 3IJLA 3V2AR 4YSEA 4K37A 1B9KA 5IQ9A 5D7IF 4G8FB 2VDKB 4DRSA 3T0AA 5DGRA 2JB6A 3S1WA 4JMNA 4B5VA 3ZVHB 2VURA 3TJHC 1CFQA 5I73C 4P2VA 1XGDA 1IAMA 3P8JA 5FPIA 3NO1A 3N73A 1JVOA 4ODTH 1JK9A 3QHOA 1U5VA 3VXRD 2BLFA 3DI0A 1T4KB 4OLWH 5DXWA 3DG6A 4A22A 2BCMA 2E7LA 4NRZB 2FEEI 3DBXB 3WD4A 2GGEA 3VTMA 4XBGA