1GCYA

High resolution crystal structure of maltotetraose-forming exo-amylase
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
415
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallization and structural analysis of intact maltotetraose-forming exo-amylase from Pseudomonas stutzeri.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords GLUCAN 1,4-ALPHA-MALTOTETRAHYDROLASE
total genus 145
structure length 415
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 2000-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gcyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gcyA01
4AD5A 1W3JA 1EDTA 1JD9A 1Q6DA 3BVXA 4P7RA 5JIWA 3KL0A 4W84A 1W9DM 2A3HA 3T0AA 4CN6A 4AIOA 1J0KA 1NWTA 1MWOA 1M03A 1XC6A 7A3HA 3ARXA 4A3YA 2X8RA 1EOMA 1QW9A 4FNTA 1NP0A 1VIWA 3CZKA 2XJ7A 1UQYA 3UR7A 4AWEA 1FOBA 3GTNA 3VSVA 4AISA 3MUIA 3WF3A 5I3DA 1HL8A 1HKMA 2DH2A 4AD1A 4ATLA 1PZ3A 1BG4A 4BQ5A 1E9LA 5KEZA 1VJSA 2DIJA 4FNSA 3OZPA 5ABFB 3CBWA 2W62A 4D6IA 3WQ8A 2QPSA 3BAWA 1E6SM 2E8ZA 1E5JA 3T0BA 4PMOA 3WD4A 1JFHA 2Y4SA 5HPOA 2EPMX 3OIHA 3VTRA 1BAGA 1HKJA 2EABA 3K8MA 4X0NA 4W7VA 3A47A 4FLQA 3RM4A 3ZQ9A 3EJPA 1V0LA 4JL1A 3AI0A 3VIOA 3RCNA 7TAAA 1GCYA 3G6MA 4Y7EA 2QMJA 1CZ1A 2VCCA 4ZE4A 2CHOA 2DSKA 1E0XA 1FA2A 1GZJA 3HMCA 3M46A 4AW7A 4ZE5A 3WF1A 1OM0A 1XH1A 1O7DC 1R46A 2Y24A 3M07A 2WVTA 2VX7A 1R85A 5FOOA 4ZXOA 1OD8A 1Z32X 2BFGA 3WQ4A 1GJUA 2FGLA 3KZSA 3LXCA 1W1PA 4D72A 3ZT5A 1HN1A 2WVSA 1GUVA 2PWGA 1ISZA 3VGBA 1NOWA 2DT3A 4DWSD 2VURA 4QAWA 1BYAA 4EANA 2UWFA 3LPOA 1W32A 3PZUA 5IHRA 8A3HA 5LYRA 3WDPP 1V3MA 4UQBA 4DO6A 3TONA 3S5ZA 2VZOA 1HWWA 4GXPA 2XM2A 1QI0A 3QOMA 4QLKA 3DX4A 3NIYA 5GNYA 3APGA 1WDPA 2QLYA 4CD7A 3ZOAA 3EJUA 3VX0A 4QP0A 1E72M 3VSTA 2D0FA 4W89A 1JI1A 3B9EA 4PEEA 4V28A 3AIEA 5E70A 4J3UA 3VGDA 4B9ZA 2DH3A 4IPLA 4N42A 1OGGA 4MNKA 3NDZA 1KFWA 1SFSA 2WKGA 1VEOA 3LRKA 1J12A 1R86A 2D23A 4PUEA 1ZBCA 1HJSA 1CYGA 3WNLA 3W53A 2BV9A 4BZYA 3AROA 5M3WA 2XUCA 1UWRA 3WEZA 1L8NA 5FIPA 2F18A 4AEEA 3IJ7A 3M6DA 2DGAA 4P7OA 2A3EA 3UG3A 2OSXA 1UD4A 4PUDA 4YHEA 2D73A 4J7RA 3ARUA 3J7HA 2X0YA 1NOFA 3CC1A 3AIRA 4ACZA 4FK9A 4TOQA 1B3VA 2OW6A 1TVNA 4PMYA 1UKPA 2DT0A 1MQPA 5A69A 1WDSA 4HOXA 4MTVA 1EQPA 3W25A 4CUCA 2VNCA 1UD8A 3ARSA 4MJ2A 3IJ9A 4WKAA 3WQ6A 3E1F1 3MV01 2OYMA 1JFXA 4QDMA 3AISA 1ISVA 3B9AA 3FAWA 2FH8A 7CGTA 3N04A 5GPRA 5I79A 1EDQA 3VVGA 1CEOA 4IPNB 5AYIA 1RPKA 4ZXLA 4FNPA 3T2OA 4OOZA 2W61A 2EADA 2IXVA 1VRXA 2J8GA 3ZSTA 4XB3A 1UD2A 2JEQA 3W38A 1UWTA 2WK2A 1BSIA 1UD3A 1KGXA 2O92A 3VD9A 5CQ1A 1WDRA 3WY4A 2WHMA 3WQWA 1US2A 2J4GA 1FP9A 2J74A 3M7SA 1MW3A 1D3CA 1ITCA 1JXKA 1MW0A 2D20A 1CXLA 1TR1A 4UFIA 5HXMA 1QOXA 4R27A 1J18A 1W2PA 2CBJA 1QNRA 3PZIA 3ARWA 3OGRA 4HZ6A 1CGVA 2PI6A 2F7PA 3I3DA 1K6AA 3IK2A 4JL2A 1JXJA 4P8UA 4PBGA 4D6FA 5M5DA 6TAAA 3OBAA 2G41A 1JZ7A 3VDBA 2XVKA 5M17A 4EKJA 3K46A 3L4XA 2WMGA 1XGZA 1QI5A 1B90A 1MQQA 2YA1A 4D1JA 1QVBA 2WAGA 3A6OA 2CBUA 1TFVA 1ITXA 1KXTA 1HP5A 1E3ZA 3BAXA 4EK7A 3ZR6A 5EMYA 5F7UA 4M81A 1TA3B 3LPGA 2CCRA 1JYXA 1XV8A 1TMQA 1V6VA 2GUYA 1HF6A 1KBBA 4GZJA 4Z2HA 3CV5A 4LGXA 4PTXA 2XWDA 4MAZA 2D3LA 1YQ2A 2ZUTA 1PAMA 1QPKA 1FHLA 2VR5A 1VFOA 2DQXA 3UERA 5HOSA 3AHVA 2YIHA 1OT2A 2BHUA 2WVVB 3GXFA 1G9HA 4HA3A 1V3LA 1KCKA 5ABEA 2WB5A 1OSEA 4U5IA 4GI6A 1OBAA 1E4LA 3EJTA 3VIFA 3A3HA 4PCTA 4UFLA 3VD5A 1TQSA 1B9ZA 3LPFA 2VX6A 5FL1A 2JFEX 4MNMA 2XYLA 5AY7A 1D7FA 3WY2A 2WVVA 2J79A 1E6NA 4PMRA 5LA2A 5ABGA 5A1AA 3CZGA 4TXEA 1ZBKA 3PZ9A 2CKRA 2EJ1A 3CUFA 4UR9A 3AS2A 4CCEA 2XIIA 3WF0A 1QBBA 1K9EA 4JZ5A 1CECA 3CMJA 4D6DA 3RO8A 1LWHA 3WD0A 2GJPA 3VNYA 2BXZA 4AMCA 3K4AA 1JL8A 3GNOA 5EFDA 1OIFA 3KLLA 1EXPA 4DUVA 1R75A 2WMFA 2CETA 5FD0A 3HG3A 1LJYA 4KGJA 4TUFA 1E0VA 1QI2A 4NXKA 1JF5A 1B3ZA 3F5JA 2WXDM 3VD3A 1PX8A 4AZIA 4TTUA 3H55A 1EHAA 1I1WA 1JZ6A 4WK9A 3O2LA 3WF4A 2XVGA 4GQRA 1DP0A 3PTKA 4PYSA 5E6ZA 2UY5A 5BXPA 1NM9A 2YDRA 1IZKA 1I75A 3VIMA 3VD4A 1GHRA 2EPKX 2WANA 1KTBA 1PEZA 3MKKA 2VZUA 1GVIA 4NI3A 3ALFA 1CENA 4PMUA 3AMGA 1FP8A 3PN8A 5E09A 3TTQA 3L4VA 1A3HA 1KGUA 2BNJA 1V3JA 2VT0A 4ZFMA 3BCDA 2J8FA 2W4XA 2J25A 4CU7A 5E0CA 1V03A 4AZ6A 1HL9A 3LMYA 3TTOA 1JYVA 2J7BA 4IISA 4Q7NA 2X09A 3NSMA 3BVTA 2HISA 4MB3A 1CGYA 2CHNA 5CXPA 1FH9A 3VMOA 3KLKA 4J3XA 4DWSA 5IDIA 3POHA 3WQ5A 1RP8A 3EDJA 3HZ3A 3N13A 4OZOA 2ZX7A 3N11A 3RJXA 4PSRA 2NT1A 1CGUA 4UZSA 1DWIM 3MSDA 3O9NA 3VD7A 4DWSB 1XCWA 2QV4A 3GM8A 3PTMA 4HMDA 4XZBA 1V3HA 1LG2A 1S46A 4HU8A 3WFZA 3T09A 2DEPA 1JAKA 1JZ5A 1DEDA 1PIFA 1NQ6A 3MO4A 3OLIA 4DM2A 3BCFA 3EBVA 4CCCA 1V0NA 1VF8A 2DIEA 1BPLB 4Z2JA 2CESA 2CPUA 1KR0A 1K9DA 2ZIDA 1ZBVA 1WPCA 1O7AA 1SMDA 2WHLA 5IXEA 1ESWA 2VL4A 2J75A 2YKKA 4W8BA 2QMKA 5DMYA 2DSVA 3WMSA 2BVDA 2XG9A 1QBAA 1B1YA 5HBFA 1XRVA 4UNIA 3AIBA 3QHOA 3BLKA 2BY0A 2WKLA 3CHEA 5CGMA 1GOOA 3GNRA 3WEOA 3CHFA 1CDGA 3CZJA 3WNPA 1W3LA 2Y8VA 4L4PA 1B31A 5A8QA 3D51A 4FNUA 2XTKA 3MSGA 1US3A 4TVCA 2NSXA 4E2OA 3KL3A 1B3XA 3AOFA 1W3KA 9CGTA 4MDOA 2J47A 4HOWA 4YHGA 4KWUA 2QF8A 1X1NA 4E8DA 1BYBA 4Q22A 3CZLA 3ZJ8A 3BUIA 5A6JA 5I24A 3BVWA 4HZ7A 3SUTA 4UTFA 2J7EA 1VENA 2WBGA 1W9VA 4UFJA 3B8SA 3W24A 3K8KA 2ZUVA 3HN3A 1JNDA 3U57A 1JIBA 1GOWA 1EDGA 1UASA 2ZUMA 1EHNA 3ECQA 1B30A 2EPLX 2XFRA 1OD0A 3SUUA 1VFMA 1E73M 3VDHA 1JG9A 1R47A 2GJXA 3IAQA 2FHCA 1PZ2A 1WZMA 1H5VA 1KB3A 1W3HA 3A4AA 1Q4NX 1UH2A 3WKZA 4NZJA 4HMEA 4X0VA 2VZSA 3EJSA 3BUDA 2D1ZA 1NWSA 2VJXA 4E4PA 2VCBA 3ALGA 2XVLA 3ZT6A 4DWSC 5I2UA 3CZEA 5E0FA 1GHSA 3U5UA 5D9MA 2X2JA 1CXHA 4WSKA 1JD7A 4UOQA 3BAYA 3UG4A 3WH5A 3AFBA 1D2KA 3OLDA 1E70M 4HZ8A 4NF7A 3FNDA 1HVQA 1WZKA 1NOUA 1QX1A 1UQZA 4MADA 2O9RA 4UQ9A 4V2XA 2ZWYA 4JFSA 3AZSA 3DX3A 4NX0A 4GZEA 1UWQA 1V3IA 1GONA 2O9TA 3VILA 3GXIA 1CPUA 3W81A 4JKLA 3WELA 5A6LA 4RE4A 3AXIA 4ATDA 1F4AA 2WCGA 3TOPA 4AD2A 5I78A 1CLVA 3AZRA 1E5NA 3THDA 4PTVA 4BQ3A 4QLLA 2X05A 2UY4A 1V6UA 2WMHA 3SCQA 1UG6A 4RE3A 1KQZA 4GO9A 2WW5A 2BHYA 2XFYA 4GIAA 1EGZA 2WVUA 3T0DA 1UKQA 2TAAA 3L4TA 4OOUA 1XSIA 1UOKA 3SCTA 3TA9A 1MVYA 5I23A 1BYCA 3WH9A 1BG9A 4EE9A 4JFWA 3WH6A 3VOCA 1UHVA 2JALA 4M56A 3MS8A 3AJ7A 4IM4A 4H7VA 3MMWA 3WBAA 3WDJA 3LRMA 4H8VA 3MV11 4ZENA 2VCAA 1TVPA 1UD6A 2PC8A 1UR4A 1AQMA 2F2HA 3WF2A 3QHNA 1FH7A 2OYLA 2J77A 1J0JA 3D3AA 1JAEA 4GKLA 4TVUA 1EO5A 3TTSA 4BA0A 1JI2A 1H0GA 2E4TA 4MDPA 1E56A 2A3CA 3UCQA 5CLWA 1JDDA 5E1QA 4JHOA 4OUEA 4F66A 4AY1A 3EMCA 4FMVA 3FAXA 3AHZA 2PF0A 5D9NA 2A3BA 1ODZA 2E9BA 3AHTA 1UR1A 1HIZA 2WC7A 3DHUA 4NRSA 3AS1A 2OWWA 2XGIA 3WMCA 2FGZA 1UZ4A 1CGXA 3A21A 3WL0A 3WDRA 2WZEA 1PBGA 3HG4A 1XH0A 1W9PA 2VI0A 4B16A 2DT2A 4U31A 3W28A 3N1AA 3POCA 2X2HA 2ZUNA 4K68A 4BCEA 4CD6A 1GQIA 3RIKA 2WC4A 5GNXA 2IGTA 3FY1A 1XYZA 3IGUA 4BQ2A 1BLIA 4HA4A 1GQKA 4PMNA 1CXKA 3VIHA 3GH4A 2V5DA 3W37A 1Q6GA 5HDRA 3CLWA 3F5LA 1W91A 1CXFA 2XWEA 3AS3A 2W92A 3WDIA 2XM1A 5FL0A 3CO4A 2OLHA 1AQ0A 2ZX9A 4P7LA 4D6JA 4HMCA 4ACYA 3WN6A 4P8VA 4PCSA 4TX8A 1QWUA 2WMIA 4F9DA 5A2BA 1LQ0A 1M04A 1E6QM 1G1YA 1HJQA 5A8NA 1TE1A 5AC5A 2G3MA 3FW6A 5BXTA 3BC9A 1FFRA 3DX1A 1NWUA 1V0KA 4A3HA 4CN4A 3CZ8A 3BGAA 4OJYA 2CERA 5EB8A 2G3JA 1V3KA 1WP6A 2WWCA 3CHDA 3BUBA 4JAWA 3T2PA 3GZAA 1XD0A 3CMGA 2VVNA 1UWSA 5E6YA 1UYQA 3VM5A 2W91A 2PWEA 2VOTA 3CUHA 2BY3A 1MXGA 5I5RA 3L4WA 5DT7A 1CNVA 3U7BA 3ZT7A 5BCAA 6A3HA 3CH9A 3I3BA 2HVMA 3BLBA 1E71M 1GW1A 2WSKA 1BQCA 4HPGA 4JFTA 5ECUA 1E43A 2J7GA 4V27A 2ZXQA 1U30A 1TUXA 3L4UA 4B15A 3SUVA 3IANA 2CEQA 1ZL1A 3OLEA 2WC3A 4UQDA 5A6BD 1JZ8A 4NSBA 2V3FA 1KQYA 1TA3A 3RMEA 3SCRA 3BVUA 1DWGM 1DHKA 1LL4A 1GOIA 3AYRA 4UQAA 4NZCA 1YHTA 3AMKA 2XIBA 4B9YA 4D6CA 3GBDA 5D9OA 1UH4A 1QWNA 3LXBA 2WMKA 3VIIA 4ML4A 4D71A 2EQDA 2GK1A 2VTFA 3N17A 2CKSA 2OW7A 5GNZA 1CTNA 2VRJA 4GZIA 3TP4A 1W9UA 2NT0A 2FDMA 2ESCA 1HXKA 4M29A 1C90A 1RH9A 3W27A 1UR8A 2W67A 1EA9C 1E6XM 4QFUA 5DF0A 4WLCA 5D9PA 3AQUA 1WDQA 3A5VA 3L2MA 1HKKA 1QNOA 4GPNA 5A8PA 3PTQA 4WKHA 3KWXA 1ZJAA 1GQLA 1BF2A 4D6GA 4JHZA 2EAEA 1OB0A 4FF5A 3K8LA 3WIJA 4UOJA 3PZOA 2YLAA 3DX0A 3AS0A 1V08A 4JKMA 4JKKA 5CGTA 1C7SA 3AHYA 4OGZA 4AZ7A 3ARYA 3W6LA 1C92A 2GDUA 2ZX6A 3HJEA 1QNSA 4HP5A 1SR0A 3FHQA 5FKYA 3VM7A 3AICA 1ODUA 3ZMRA 3BAIA 3ZJ7A 3VO0A 2XSBA 2MANA 1E1FA 3WD1A 5D4YA 2O9PA 3BMVA 1R87A 1VBUA 1QI4A 1PS3A 1Q6FA 1M7XA 3D5HA 4U3CA 3EDDA 2WBKA 4URIA 2GVYA 3CTTA 3SUSA 2Y2WA 5FCZA 1WNOA 3PZNA 4CU8A 3II1A 4LYQA 2A3AA 4N0RA 2YA0A 3K4DA 1TQTA 1UH3A 4KGLA 1UR2A 4AD4A 5A6SA 5DEZA 1E6ZA 1V6XA 4QLJA 1AQHA 2E40A 1T0OA 1HJUA 2X1IA 2X2YA 5LA0A 1UWIA 4PMDA 2XSAA 3OGSA 1JF6A 1LWJA 1FFQA 3DECA 5HNNA 4CN1A 1CXIA 2VMFA 4P7QA 1GORA 2YOCA 3GXNA 4AIUA 4GQQA 1EH9A 2E9MA 2YDQA 3AIQA 1XSKA 1DWFM 2F61A 1E15A 4MB5A 3DC0A 4WF7A 4NXSA 1DTUA 4AC1X 3L4YA 3N12A 3A23A 3AIVA 1G0CA 2CXGA 3SCNA 3GDBA 2WWDA 3OLGA 3OZOA 4D6EA 1G94A 2ZX5A 4M80A 1EIBA 1R33A 3SURA 4AZBA 5AC4A 1C8YA 3WDHA 3GXMA 4KRUA 4GI9A 5JBDA 3AZTA 2G8ZA 1HX0A 4M1RA 2WZHA 1W9BM 4BS0A 4OKDA 1LLOA 1E55A 1OCQA 1XH2A 2VO5A 3VIJA 3MUY1 3HU7A 5A6MA 1CXEA 4MJ4A 2GJXB 3WSUA 1G5AA 3VUPA 2CITA 2VX4A 3QOKA 1XCXA 3N15A 3MMUA 3WQVA 4LXFA 5I6SA 3U7VA 2FE0A 1OGBA 4Z2GA 1EQCA 3ZR5A 3MU7A 3QR3A 1G01A 3SCVA 4UQEA 2YL6A 5ABHA 4AIEA 3GXPA 3WFLA 2CNCA 1TZ7A 4AZGA 1EO7A 1E6PA 1KBKA 3MUAA 2DSWA 1SMAA 1HJWA 2F1BA 1J0HA 4PTMA 1J0YA 5C70A 3K1DA 1MW1A 1C93A 1SZNA 3SCUA 4AD3A 3NSNA 2AMGA 2XN1A 1KWKA 2FHFA 3ARPA 3BSGA 3SCSA 2VVSA 1HNYA 4P8WA 4GO8A 4LPCA 1N82A 1ZJBA 5C8BB 5EFFA 1LL6A 3D4YA 1QNQA 4DM1A 4Z2KA 1K9FA 1CLXA 2WNWA 1V6WA 4MPKA 2ZE0A 1W1VA 1J10A 3WENA 5IFTA 1VAHA 3GH5A 2XFFA 4H41A 2VRQA 1W9XA 1W2VA 2OSWA 5CJ5A 2XN2A 5DFAA 4HA1A 1KTCA 5CPTA 3VKKA 1ZU8A 1K9TA 2EBNA 3FN9A 5D8WA 4B3LA 1SYTA 2ALWA 3OGVA 4YPJA 2WHKA 2DSZA 1A47A 3WDQA 3RDKA 2QPUA 3GH7A 4PMVA 1NP2A 1NARA 3BSHA 3CZSA 4W87A 2AOSA 2J78A 4NRRA 1KR1A 2WZIA 3NSXA 3ZO9A 4W7WA 1KWGA 1JDAA 2VX5A 3CPUA 4AMXA 3RILA 4X9YA 4BF7A 2GSJA 3GNPA 4KMQA 2EXOA 3W29A 4MB1A 3PHAA 2PBGA 3A24A 4OIFA 1UA3A 3L4ZA 3WH7A 2XVNA 1HJVA 1GVYA 2Y5EA 1LG1A 4P8XA 3CGTA 1C8XA 2EACA 4CD5A 3SCPA 1W1TA 3WL1A 3JUGA 2YBUA 2Z1SA 1JNEA 3H54A 3N18A 1B0IA 2C8NA 3S6TA 3WBEA 5JBFA 3BXWA 3UESA 3BVVA 4PMQA 5EBAA 2V38A 3UETA 3AXXA 3NUKA 1BGGA 2Z1KA 1WZAA 4L4OA 4W93A 3RM8A 1E4MM 3DDGA 4AXNA 1BVNP 2C7FA 1ISYA 4UFMA 4H8UA 1BTCA 4MNJA 3ARZA 5A3HA 3WNKA 3WUEA 3IJ8A 3AMLA 1C91A 1PIGA 4F9JA 1E1EA 1UWUA 3VGGA 2VQTA 3EJRA 1XYFA 2EPOA 1CGTA 3BUQA 2CIPA 3EMQA 3OB8A 2DPEA 1HXJA 1BFNA 4J3VA 4U2ZA 1TCMA 1XSJA 4GINA 2G3IA 4JCLA 2EPNA 1CIUA 4M82A 3KEHA 1DWJM 5JBEA 3ARRA 4DO4A 1JGIA 1J11A 2XPKA 4P7NA 3WUBA 4RE2A 4AYSA 3CUJA 5GQBA 4CD8A 4PMZA 3NYDA 1CBGA 4MNLA 1TQWA 3PZVA 1C3FA 1H11A 3AYSA 2CBVA 4H04A 3BAKA 4HTYA 1B3WA 3VGEA 5A95A 1UR0A 1HVXA 4J3WA 2XGBA 1BGAA 1WAWA 2GK1B 2JIEA 1VBRA 4U3AA 3T08A 4XV0A 3WNOA 3MI6A 2BXYA 2F7RA 5BXSA 5A8MA 3ARTA 1JDCA 1MW2A 4Z2IA 1Q6CA 1KXQA 4QCFA 3WMBA 1F4HA 1JZ4A 1UR9A 3AMCA 3THCA 5JUVA 5ABFA 3VIKA 4AYGA 4W7UA 4FLSA 4CVWA 4LX4A 4AZHA 3A4WA 3WUGA 4XX6A 1H4PA 2PWDA 1MFUA 3ZSSA 2YL8A 3KE0A 1IT0A 3CZNA 1DWAM 3BAJA 2BS9A 4W8LA 4M8UA 1VJZA 5BROA 2YL5A 4C7GA 2D3NA 1GQJA 3CUGA 4ZEPA 2ZUUA 2WYSA 5A6BA 1VEPA 3EMZA 1OINA 3PZMA 3EDEA 1GOKA 1OIMA 2FH6A 1V02A 2VZVA 4PSPA 1UKTA 4DO5A 1NWRA 3OA5A 3L2LA 4HU0A 4E8CA 2G3NA 4LYRA 3EJQA 4AMWA 1MXDA 2YFOA 4D1IA 3VINA 1CGWA 3BUPA 1H2JA 1TG7A 4EAMA 2E9LA 3N9KA 2AAAA 4MB4A 4W8AA 4ATWA 4S3JA 2OYKA 4BQ4A 3RPMA 4AZCA 3WD2A 3MUZ1 5I0DA 3FXYA 1R7OA 4H8HA 3PZQA 4A4AA 2W63A 2W66A 4U2YA 1FHDA 1X6LA 1UUQA 4CU6A 2V3GA 1JZ3A 5CSUA 4FNQA 3WY1A 3ZM8A 3DX2A 1IV8A 2BY2A 2UY2A 3PZGA 4F8XA 4DUXA 3QHMA 4CGTA 2ZUWA 4CKQA 2PB1A 2XN0A 1MYRA 4HPHA 4JIEA 2WCAA 5I77A 3MANA 3W4RA 1H3GA 1PPIA 3BLPX 2GFTA 4XUYA 3UG5A 2D0GA 3VGFA 1I1XA 1E6RA 4J28A 2Q8XA 4PTWA 4JCMA 1GOMA 1XHGA 1KXVA 1HKIA 1DWHM 3CHCA 4YN5A 2Y8KA 2CYGA 1AMYA 1B2YA 2E3ZA 3RJYA 1WB0A 5A6AA 1UKSA 1V02E 3ARVA 1KCLA 1QW8A 1KXHA 1R34A 3EDFA 4CD4A 8CGTA 2BHZA 3OG2A 5AYBA 3NCOA 3VX1A 1UZ1A 1ZBWA 3A4XA 4PRWA 3ZJ6A 3GBEA 4M24A 1QHZA 4JFUA 3VMNA 4OBSA 1OT1A 2XHYA 1Y7VA 2VR4A 1R7AA 1QI3A 5JIPA 4J27A 1E3XA 3WH8A 3A22A 6CGTA 1VB9A 4MAVA 2D0HA 1EOKA 1V0MA 2D22A 3SCOA 3VDAA 1MFVA 4LQ1A 4UOZA 1FH8A 3CIVA 1VEMA 2FHBA 1TQVA 2J62A 3AIUA 3CUIA 2NW0A 3EYPA 3IAPA 2CBIA 4J3SA 5BRQA 3NDYA 3SUWA 2WCSA 1BYDA 2J7FA 1J0IA 1HTYA 3B9DA 3S5YA 1RD6A 4LYPA 5BXRA 2VZTA 3LPPA 4D6HA 4H2CA 1XD1A 3KL5A 5A2CA 2VRKA 3DYOA 4UFHA 5D8ZA 3ZJKA 3DHPA 3F4VA 1J01A 3W82A 2YFNA 2BVTA 3I3EA 4RL3A 2IUZA 1V6YA 1UKOA 5DT5A 3H53A 3ARQA 1QNPA 2F7OA 3U5YA 3T2QA 2YDSA 4UQCA 1ZS2A 1R8LA 2OWXA 3HG5A 4W5ZA 3NJ3A 4TX6A 2JF6A 3SCWA 4U33A 1ISXA 3FHAA 1NH6A 2DSUA 4KRTA 2WPGA 2JE8A 3GXTA 3UR8A 3QGVA 2G4FA 4Z2LA 5CG0A 1HP4A 1ECEA 1PJ9A 2OWCA 1O6IA 2PWFA 2EEXA 5A8OA 2V3EA 3HG2A 1U2YA 3PZTA 3GYCA 2VUYA 1KGWA 3DYMA 2ZX8A 1HJXA 5M03A 3S2CA 4JFVA 3D4ZA 3VGHA 1B3YA 1Q6EA 3ZIZA 2E0PA 3VU2A 1GJWA 2OSYA 1BHGA 3LX9A 2J7CA 3VDCA 1OWQA 3G6LA 2BVYA 2V5CA 2O9OA 4UZUA 1W1YA 3AIWA 5IHSA 5KZ6A 1LL7A 3WY3A 5CSYA 2ZXAA 2YA2A 1X6NA 4AZCB 1VFUA 3VMPA 1WKYA 1U33A 2YL9A 2WM0A 1JYWA 2WSPA 4UCFA 5E9AA 2YLLA 4IUGA 4CVUA 4C7DA 1H41A 4F79A 4OBRA 2XVPA 2ZOXA 1H0IA 4W85A 1BVZA 2X0HA 3BH4A 1OGSA 4CCDA 2JF7A 1RP9A 1UA7A 3VSUA 2BY1A 3LRLA 1C8QA 2E8YA 1JZ2A 3DDFA 3W0KA 5A6KA 4W88A 2C0HA 1P6WA 5CPSA 2VC9A 2VQUA 3SIMA 2PBOA 4NZFA 1GOQA 4W5UA 3LXAA 3D52A 1CWYA 4QCEA 1E4NA 5LA1A 4J3TA 5A2AA 3WNMA 5BYWA 1IZJA 4HOZA 2ZICA 2F8QA 4R5EA 3AMDA 4C7FA 4B3KA 3TTYA 2YBTA 1J9YA 1UD5A 1VFFA 4W86A 1GNXA 4ACZB 4WSJA 2J7HA 3WD3A 3AXHA 1PX4A 2F7QA 4AEFA 1QHPA 1MQRA 2PWHA 4PMXA 2X2IA 4UFKA 4PN2A 1WO2A 1M01A 1E4IA 2ZWZA 5HPCA 3WEMA 2D24A 3BMWA 3EDKA 5BRPA 4TTGA 3D50A 4FNRA 2GDVA 3O6AA 5CLTA 3VIGA 2RGMA 4DUWA 1M53A 1WCGA 1AVAA 5CPQA 3W26A 4WJXA 1H09A 4WKFA 4U5KA 5DO8A 1WE5A 1H49A 4KH2A 3PBGA 5A94A 2DDXA 1WZLA 4GI8A 4XZWA 1JYNA 1E0WA 5BWFA 2FYVA 2YJQA 2WHJA 3VPLA 2V3DA 1LF1A 2WLYA 3TV8A 1GPFA 2QHAA 2B31A 2WLZA 1HT6A 2J7DA 2D2OA 1PX3A 3WUFA 2JIWA 3RM9A 1QHOA 2ZUSA 4WIWA 3UEQA 1L0PA 4FLOA 3SEPA 3WNNA 2ZXDA 1C7TA 2IXUA 2WMIB 2JEPA 2W5FA 3MMDA 1ISWA 1J0ZA 2RGLA 3W6MA 1TQUA 5C71A 2GJRA 2UY3A 4S3KA 1E40A 3AHXA 3DYPA 5TD4A 4AD0A 3VNZA 2F1AA 4AZ5A 3VIPA 2DT1A 4TVDA 1ZB5A 2EO7A 2WMJA 5IFPA 4FLRA 3GXDA 2ZXBA 3F5KA 1H1NA 5CZKA
chains in the Genus database with same CATH superfamily
3MRRA 4LOFA 4AD5A 1YMMB 2CZVA 1A4JB 1E4KA 2ZCGA 1RFDH 4LLVB 5JH1A 3QEHB 3R0KA 1OFQA 2YPVL 1ML0A 4HLZG 2UY7A 3HN8A 5DVKA 1Q6DA 2X4NB 2EILB 4L8SC 4P7RA 3MA7A 5IW6A 4EXBA 2A3HA 5KTLA 4F9PA 3T0AA 2VD9A 3FT3A 3CFCL 3HCVB 3WX7A 4KFMA 5GGSA 2OZTA 3KOWA 1Z7AA 4GUCA 3WSQL 3FNKA 1NINA 4OM1L 5SWSB 1RH8A 4NASA 4O8AA 4X22A 2BSTB 1HILB 4ZI8A 1QOPA 3QI9C 4OD3H 2XINA 2JLPA 4AYFA 4DO7A 4E8GA 2V81A 4K73A 3OMZA 3ATAA 2X8RA 1SQMA 1F3XA 1LRQA 4UR8A 4BZ1H 4Y4FC 2IBZX 4Y90A 1NUGA 4FTVB 4FNTA 3WLNA 1NP0A 3RBGA 4R97B 5HYFA 4MVBD 1M71A 4MLJA 5DBTA 3BUYB 4L6HA 1EZSA 3T0CA 2EXWC 1NBZA 2XXFA 1RZPA 3DO7A 1O5PA 2JKXA 1U8OA 2NY3B 4D72A 4WI7A 3SKUD 1VKXA 1IJ9A 1ZVNA 4L23A 4FP8L 3X1BA 3WF3A 1DOSA 1RZGA 1PF3A 4WWNA 4JBRA 4X6EA 3WLPA 2GAZA 2R9RA 5TIMA 5E7BA 3RX2A 4ABWA 2G3ZA 4BQ5A 1QCWA 3SDCD 3WEXA 4ERSH 3I68A 5KEZA 3HGSA 2PPCA 4PP2B 2W9MA 1VJSA 4LDOB 4BH7A 4CADB 1QHQA 2MNWA 4ZD3H 4D6IA 2W62A 4Q0XL 3VOIA 3FJTA 4PJXB 4J8QA 4CNNA 4DETA 3H4GA 1SEQH 4RX4D 3MC5A 1NCCH 1XLJA 2KZ1B 3T0EB 2E8ZA 1E5JA 4JQ4A 3UJ2A 2OMAA 3VG9C 1DE4B 1FFPB 4YZFE 1OKEA 1FLTX 2NQ3A 2DTML 5J1AB 4X7TA 1KN4L 1RJLA 1IKNA 1GGCL 2X9XA 5KOVC 3U2IA 3C5ZC 3OGOE 1ZHAA 2EDMA 2EPMX 3KS6A 3VTRA 4KOCA 9RUBA 1BIIA 3GI8H 3NRFA 3L7EB 5B38B 4Y2DD 5A3ID 4QRPE 1O68A 4KOBA 2PDCA 4G2AA 2IEPA 2GG1A 4JQ1A 3MA9L 1S7VA 1TV8A 3H4HA 1YN6B 5LGHH 2H5UA 3RCNA 3M1BB 1TZGL 3FYOA 2HX7A 4TVSa 2QMJA 3QEQD 2BGQA 1L9PA 4WEMB 4YSDA 4GACA 4JK0D 4KERA 4LPYA 3AWNA 4MDRA 3T2NL 2VDML 4MMZA 4OLVH 5EWIH 3CQHA 1FPTL 2XIDA 4MYAA 1XFPA 3HMCA 3M46A 1OG6A 4W84A 5FA5A 4HJIA 2BVEA 1XH1A 3QEGH 4OZHB 4J6RH 3FS9A 1PKOA 1UPPA 1D9KA 2PNDA 5DT1L 1LUCB 4QISA 2DQFA 4NZDA 4KRPC 4NEHB 3WFEH 4L3EE 2Z2AA 2HRPH 4XAWH 3U6RA 4K1WA 1BJ8A 3W7HA 1NVMA 1KIPA 1YNKH 1UROA 3WQ4A 1INDH 5CSZA 1JZIA 1QSFA 1L9WA 4JTDA 3WJJC 1W1PA 2QVFB 4LAQL 3QPQD 3ZWSA 2WVSA 4KZCA 4OZFA 4WJ5B 1GUVA 1EXUA 2PWGA 3MJ9A 1S39A 3IFOB 3QORC 4QAMB 4XCFH 2VGFA 5FI8A 4DWSD 1XDTT 3N6HA 1SZEA 2BSRB 1W32A 4ONHA 1XBZA 3PZUA 1W72B 5F72S 8A3HA 5LYRA 3F7YA 3OGCA 1V3MA 2ZA3A 4I3GA 4DO6A 3BSZA 3TONA 4Q3MA 1WDWA 2X42A 1HWWA 2A77H 4Y5XA 5G5DA 1QI0A 3GK8L 4AQEB 4QLKA 2IKHA 3FL7A 3KLHC 3CXHK 4RAVB 3NVQA 2Z31C 3QBUA 2O6CA 2R2EA 5L6YH 4L0ZA 4AQ1B 2QLYA 1T4WA 1A4MA 1WDPA 2V2WB 2DQJH 4XPHL 5DZPA 3VI3A 2ZKMX 4WWKC 1JCMP 2A3TA 3VX0A 3O2DA 2UUDH 3H26A 2KYIA 1U95A 2R2CA 5DSCB 1N6VA 1E72M 1L8PA 4NT0A 3FO1B 2P80A 3CSYB 5AYUL 4PEEA 3GJFK 4YXKH 5IMOB 4V28A 5GRJL 2VRAA 3QNYB 2V7NB 4PJ5B 2WXRA 4J3UA 4B9ZA 2CLRA 4Z7VB 5G2NA 3O9WD 2V69A 5KITA 5CO1A 1PV8A 3MT1A 3IJ6A 4MSWA 1IGJB 3LMJH 4LFHD 1PNDA 2PS2A 2JKTM 4WEBH 3ITXA 3NDZA 1TO3A 3BWSA 1P5UC 2P47B 1ZT4A 2JBMA 3IU3A 3TMQA 5H37A 1ZT1B 2J8UB 4AGPA 4PUKA 3O3AB 3DTXA 1R3JA 2IFFH 3HAEG 5FWQA 1KM6A 3W2NA 2ZTBA 4AYMC 1HJSA 1HXYB 2MCPL 3JZEA 2GK0A 3UXDA 3OIXA 5F9OL 1I31A 4TNVF 3WNLA 3MCMA 4NQUA 4PWJA 3OKDA 1E4WH 3REWA 3AROA 4CAGA 1RUKL 4GEIA 4KKCD 4G72B 2I27N 1FWEC 4I1NB 4TVPE 3DUHA 5FIPA 2B4CC 2O4QA 1ITUA 2DGAA 5DHXB 2F1EA 3SODB 4WTZA 3V4VA 4KV5E 3EPNA 1P0BA 1HHIA 3FHEA 3PUCA 1MHCB 1NAMB 3ARUA 3QIBB 5D93B 4IOFC 1I7RA 3PABA 1ADSA 2X0YA 3DTXB 4OLVL 5EWIL 2EYSA 5AZ2L 5LWYL 3T2NH 4FULA 5ILTL 4AC7C 1RAKA 4TOQA 4FZ8H 5ITBL 3VUAA 4RDZA 2RAMA 2VDKH 2EUXA 2OW6A 3ZJAA 2YEVB 5C0CB 5CBBA 3UZQB 3G0XA 2IDCA 1WDSA 2XTJE 4Q7DA 2Z65C 3Q8BA 4IU3B 4HOXA 4QWWD 1OCCB 4QXWA 5FO2A 3R7QA 1CLYH 4LF3B 1D5ZB 4MTVA 5CZTA 1LYQA 1EQPA 1G9EA 4CQ9A 1MFDH 1JK9B 2ZRZA 2VNCA 3Q2DA 3ARSA 3U9PH 3CL7A 4GY1A 2A6JA 1AY1H 4UNUA 5FW6A 4FABH 3WQ6A 3BUTA 2VFFA 4LALA 1T5XA 1TE6A 5I19L 1B0WA 1JWUA 2QDWA 3RX8A 4ZOBA 5AG8A 2ZUYA 4RRPG 4NZ4A 3STPA 5FSDC 3B9AA 5BXFA 1CB2A 2A9AA 3QUMA 2FH8A 7CGTA 4WVXA 1QTYT 3N04A 5F7AA 2WWKO 5JQ6L 1W0MA 1GC1L 2GFBB 5I79A 1S7WB 4J39A 3US9A 3FUDA 5DD5L 3GVVA 4Q4SA 4E0RA 4NDMA 1F5ZA 3Q43A 2IC2A 1ERNA 2KUTA 4HIEA 3GEFA 5F3HB 5KZMA 1SJXA 2NY4D 3LQZB 4FFZL 3PWAA 4X4ZA 3KVQA 1JERA 3FU3A 2X4PA 5EO0B 3CFDA 1R3IL 3V6BR 2IDSA 2Y7QA 4ZXLA 4FFYL 4OOZA 5DMGD 1X6UA 2XG5B 1OP3K 3TVMD 1L6ZA 4J23A 2A1YA 1FZOB 5D5ME 3GSNL 1WKFA 5D7EA 2WZMA 4HJGA 1TJ2A 5IQOA 2A74B 1J93A 3K30A 1G7QB 1UB5B 3GLAA 5IFJB 2I9UA 2JEQA 4Q58C 1KYDA 5GGRY 1UWTA 1M7OA 2ICCA 2N1KA 1MRFH 5IB5B 2QULA 3FU8A 2RJHA 1K03A 3QQ1A 5HULA 1ZLVH 5GZOD 2Y2TA 2BX5A 2A7RA 4MD4B 4TYUA 3VD2A 2OVLA 3E5BA 1AGCB 1NDGA 1WDRA 3HNSH 4U0QB 5CQ1A 5ITFA 3SDDA 2DDQH 2JSFA 1RJZA 3HKZA 3I75A 4NZUH 1I7ZA 1YEIH 4WVRA 3AADB 4BZ1L 1AXTL 2C9QA 3D25A 4ETYA 5EIIA 1FP9A 4UANA 2PW2A 1RPXA 3B9KB 2WZTA 1KB9J 2PO6D 2ENSA 1DQIA 2ZJSH 2BODX 4RWYH 4BWTA 1JWSB 1YE6A 1JXKA 3DHDA 1RIVH 3W7IA 2P1YA 3NQBA 4OECA 3BLIA 1UQSB 2DMBA 2BZDA 2IGFL 2L04A 3D8MA 1MAML 3HHRB 6PAZA 5HXMA 2XZAL 3VOHA 3LNDA 1OHLA 2EC8A 1BVKB 4OVVA 4JX0A 5LAXA 3O8XB 2XYBA 3W9EB 4X2PA 5C2GA 1RCXB 1QFWL 3RWIA 2OSLA 3H2WA 3CJPA 4EXQA 4Y5YC 1XIMA 3GU9A 5C92A 3MJMA 3H9YA 1HIMH 1KOAA 4XBEH 1WFMA 3BI9X 5DQDL 5E5MA 1Q90A 3TZVA 3CV6A 4Z0JA 1PKNA 2RCSH 3EHBD 3QJFA 3RWHA 1UVQA 2PW1B 3PG2A 1CGVA 4MJID 5LBGA 5TE6L 4DGUA 2V8ZA 4N28A 4MQTB 4IU2A 4F7TA 3SN4A 3FO9A 3KCLA 3RP1A 4BFBD 1DJSA 1BLNA 1JPTL 1JGLL 2V2XB 3LKOB 4PJCF 2O4EA 3WO4B 3BZJA 3S5LA 3DG3A 4K37A 3OXSB 2CZEA 2RH0A 4L4VB 2DQHH 2H47C 1JZ7A 3FDKA 3VDBA 4IS6B 3U30B 3HQNA 1ECYA 4LLYB 1XIWB 2WO4A 1P2CA 5DRNA 4DQOL 4FQJH 1F9CA 1Q94B 2NXZB 2OSLB 3MLZH 5TQ2L 1T8QA 1H9VA 3IPEA 2OMZA 3K46A 1AP2B 3WLLA 3HQPA 3LTSA 4C1NA 1KLFB 1THFD 1XGYH 4TULH 1B90A 3EWUA 3V6FA 1MQQA 1R0MA 3ECBA 3S36L 2WAGA 5D96C 1RURH 5CGYD 1LVEA 5HDQL 2CBUA 4BQ9A 1L7IH 3RIFK 4R2GD 1R0AH 1CURA 3CU2A 3UGEA 4QSFA 3VJ6A 4EK7A 4EN3C 4PC8A 5EMYA 2AP2A 1EQWA 1MQKL 3TEXA 5IJVB 1TWDA 2RDWA 4AVOA 5I8EB 3JZYA 5F7UA 3QCVL 3QXAB 1TA3B 2CO3A 1T6BX 2H1PH 2PYFA 4H1LA 3OKOB 3MROB 4OJDH 3LPGA 5FYKD 4YGVB 1RQHA 3G1VA 3N2CA 3DMMC 4GBXA 1XV8A 1U8CB 1TMQA 2AJXL 2CZDA 1JPFB 3ZUNC 4H88L 5FUZH 1D6EB 2WYIA 2XTLA 4F2TA 2KC0A 1KBBA 4TSBH 2ABBA 4I7VA 4MF4A 6XIMA 2XWDA 2A9NH 1VBGA 5SWQB 4WCYL 2EIZA 4JMXA 3E38A 4R9HA 3HE6B 3M8OH 1JHTA 1ZA6A 5FYKH 1Q9WA 1CDBA 1E4XL 5IW1A 5MEOB 3PWLA 4TS6A 2LTQC 1MAKA 2AMUA 4RMQA 3WG7B 4NAEA 3SRFA 3IK4A 2BNJA 1MLCA 4UIKH 2VMCA 2GW5A 3CXHJ 3UERA 5IOKA 2X1SA 4OY9A 4Y4HB 4HCDA 1OT2A 1JPFA 2BHUA 4JDEA 5I8KL 1G9HA 4AGMA 1WXJA 1V3LA 1M9WA 5ABEA 3H2CA 2TSYA 4CSTA 1IC0A 1OSEA 1U4FA 3IGAA 5D9SB 3G3DA 5SWQA 3AREB 3GNPA 4PRAB 3FSVA 2D4FA 4FGMA 3S1GA 3C8KA 3R58A 4XBMA 5ALCL 1TPXB 1ID5I 3VI4A 2W65B 3A3HA 5D6DC 3U0PB 5I8CB 5ABDE 5J0BA 1W5OA 2R14A 3EB3A 1IKOP 5TJWK 4GSDH 1RA0A 3B8UA 2JFEX 4KRNA 1XPGA 2ADIB 2XKNA 2BWGA 1VF5C 3TQ0A 1CFSA 2JXMB 3NSDA 4FXLA 2DQUH 5AY7A 2ZOKA 3D30A 3WY2A 4MJZA 4JN7A 5D7JB 1KBPA 1B4JH 1CYWA 2R23B 3LKRA 1E6NA 3QO0A 4LAJH 2QJIA 5DMJB 4DPPA 4B5XA 4KTDL 3T05A 5I66A 1YADA 3PZ9A 3EKCA 3QJOA 1S5MA 1S3TC 5DHMC 15C8L 2Q20A 3IARA 5F93C 3TO4B 3MACH 4Z7NE 1BZ9B 2R1PA 2PTTB 4O5LL 4QY8A 1ZCOA 2AL2A 4P3CH 2APSA 3CWNA 1K9EA 1CECA 1FVEB 5HK4A 3PLYA 3D05A 5KMYA 4KK8D 4OU1A 2PZ0A 5XIAA 3LGGA 4D6DA 4RR4A 4WK4B 5DZAA 1ZXQA 2IQAA 3DVGA 2KZHA 3RO8A 4DQWA 3QKZA 3L17A 1B4JL 4RUBA 4BDVB 2KHAA 1E9QA 3WD0A 3ELQA 4Q6IA 1QFOA 2PTVA 3VNYA 4ZUSB 4ENED 1VKFA 2EDDA 2C7UB 3CK0L 4NJJA 4N6RB 3D12B 3MJ9L 3WE6A 3G5WA 1JL8A 3GNOA 4ERIA 3FT4A 3VFLA 2ERJC 1VYRA 3KLLA 3QUHA 4NIYE 4DUVA 5IM7A 2NDGA 3ABGA 2WSDA 2WWMD 4Q6KA 1LT8A 3CQKA 4NQCD 4KAQL 1HTIA 5C3IA 1FAIH 2CETA 2WMFA 5I0WA 5FUOL 5DD5H 1HL2A 2V6HA 3GMOB 5HHNB 4OFPA 3PY2A 2FEJA 5I28A 1PVHA 3HG3A 3O4LA 3VACA 2HJKB 2VW7A 3DX7B 5EZJA 2Y6ZA 1NLBH 1QI2A 1JF5A 3KRSA 1K6QH 4OZ4A 1IC5L 3VD3A 2CQVA 1QXLA 1QT1A 3O2DH 3F5JA 2FYYA 5AZ1A 4NQXA 4GA8A 1HCZA 3RA7L 1XXXA 4GGBA 4LBEA 2Y6TE 1FVPA 3WF4A 2AGJH 5K93A 4G7YL 4WQOA 5FXCH 5CD5D 1YPIA 2GVJA 4NN6C 5DRIA 1MKFA 1IL1B 5E6ZA 3VTMA 2XG4A 1XMWA 3R2GA 4LVEA 4XAKE 1E8XA 1Z9OA 2BOBA 2JB5H 1I75A 2TSBA 1AD9A 3C56A 4K8HA 3SDCC 3IIXA 2WQUA 4AG4H 1F0LA 4Z1BA 3VWKB 3W7KA 4HPYH 3SGEH 5I2IB 5BRZE 3GMRB 4PCFA 3U1SH 1KTBA 5LWYH 2HN7B 1JPIA 1M7IB 4ZUTB 5GRXG 3CXOA 4HJ0C 3BP5B 1L6SA 3TKFA 1CENA 3AMGA 4BFAA 2L8AA 1IT9H 4LSRL 5SWZD 2W5PA 1TKKA 1A3HA 1YUHB 3IWPA 3PUUA 5T3ZH 1R0AL 4Q4PA 1K2DB 3ES6B 2R29L 3WLTA 1V3JA 1R5VA 2HMID 4OT1L 3OAYK 4PJAF 1Z7JA 3AY4A 5TDNA 5CEZE 3ESOA 3DUSB 4HZAA 4P0DA 5CEYB 4OCLC 3ZTCC 2FQEA 3F04A 4AGLA 1XGYL 4YOKA 4AOFA 4YSAA 1FH2A 5BNXD 2J8FA 3NABH 4F33A 4FG6D 5HATA 5E2VH 1K8DB 2XC8A 1IXNA 2XU9A 1PG7X 4X42A 4XRCA 3UJEA 2PWVA 2JJSA 5E0CA 4AZ6A 1AQFA 2FKPA 3MLXH 1KPVB 2V9QA 3QG6A 1KJ3H 1U36A 1FYTD 4FQPA 4IISA 3PHQA 4MQSB 3O6ML 5I74C 4LSQL 3X13B 3NQFA 3QDJA 4MB3A 5HGBA 1E9IA 2JELH 4ZQMA 4OAWB 5E2TH 3QEQE 1CK0H 5CXPA 4PGBB 5F3FA 5J13B 3MCYA 1JTPA 4B9JA 2BOCB 2H2SC 4DAGH 3CC5A 5TDNB 3VMOA 2HNHA 2NY2C 3MV7D 4H1LG 1N64H 2R8WA 4JNYA 3AACA 1JDEA 2Z2UA 2H9AB 4M7ZC 4Z7WE 4F20A 4JR5A 4XZLX 4JFOB 1KULA 3L3KB 3WQ5A 4L1SA 3O6CA 3HZ3A 3EDJA 4MMXB 4M48H 5HDOA 4F2FA 1BVWA 4JYDA 1PHWA 4LOVA 4OZOA 3LCXA 2R69A 1PCWA 3D39D 3QUZA 5TK2A 5D7IA 2WXMA 4X6FA 5EG6C 1B6UA 2D9CA 1KBJA 4PJ8D 3TBVB 1NAL1 1KD0A 2XV0A 2PCFA 4A2LA 1RUQL 4OI9A 3US1A 3FVMA 4KROD 5I16A 2RQEA 5D1QC 4J5VA 3E0FA 5T33H 4GPVA 4IIQC 3CN4A 3H8NA 4NZUL 1BM3L 3K91A 5D05A 5I3GA 5H8DA 4XO3A 4HMDA 1GGBL 1JZHA 5LSMA 1F02I 1YNTF 4WUUE 3PUDA 4HU8A 5EOTA 1C08A 1KJ2L 2PDWA 2ZKYA 3LEYH 2XCMC 3Q65A 2Y7NA 4JFQB 5KS9E 5CJQH 1AR1B 2DEPA 3BSZH 4L3AA 4GQZA 5DEFA 4A1RA 1JAKA 3TA6A 1C5BH 4A2SA 3DXIA 4IMKA 1DEDA 4FR6A 1PIFA 1YECL 3B5GA 1E9PA 3ZDXF 5JXEA 2V5SA 5IBXA 2HUHA 4A2GA 5HANA 4QQ3A 5KZ6A 3BUYA 3OLIA 3G1XA 1MH5B 3C5ZA 1FWSA 1EUAA 3C2AL 3EBVA 2LABA 2BSBA 3WXVL 1KIUA 4DOHE 2ZOLB 1T21A 3WL1A 4ZW8A 3HUJF 4HAFA 2DN7A 2WXQA 1LDSA 5FYJH 1D7KA 5BMXA 1AYOA 5MKGB 4AQ1A 2O7QA 4QEEA 2E7DA 2ZIDA 1J9CT 3VI4E 4RCXA 1UZHA 1SMDA 2F5BL 3B7UX 3CX2A 2X2UA 3D1MC 3PHOA 4JY6B 4K3HA 4TUOB 4R88A 4AUBA 3STGA 2J9YA 3ARFD 4JKWA 1P84J 4XVTL 2QMKA 4R6UA 4W8BA 5CJOH 5DMYA 1WAAA 4P46A 2DSVA 2D31B 2PE4A 2V0TA 4J2PA 5I7GA 3APCA 1I53A 3HN5A 3RUGA 2GEQA 2G95A 2BVDA 3FSWA 5CCKL 2ITEA 5H2ZA 3V5HA 3HJZA 4BEUA 2QSCL 3QRFM 3QSTA 4QY8B 5JUEH 5KZCD 5C0IB 2WY3B 5HHME 3HPLB 4DJFD 3PV7A 4XMUA 4UTLA 2AXGA 2BY0A 1H1ZA 5JDSB 1RKRA 1W1IE 5F2IA 1WHOA 3V4UH 2H3KA 3F6LA 1KUMA 3L48A 3WEOA 2VITB 3CHFA 2VDLH 1CDGA 3QR2A 2CHDA 3CZJA 1VLWA 2MH4A 2P80D 3GBNH 5GIRB 4DVBA 1JXFA 3KYOA 2Y8VA 3SGUA 3HEIB 1USQA 1A6VL 3IU4L 2ZYSA 4KO6A 1B31A 1Q3NA 2VJ0A 1XR2A 4LBSA 1WCBA 4G80A 3BO8B 4ZSTA 5E2WH 3G1AA 4XOBA 3SZ6A 5KZDA 2IKGA 1A53A 2UX6A 4AQ8A 4ZXBD 3R8BB 4KO7A 5FPIA 1H3PL 3F03K 1IBHA 3SDAD 4E2OA 1RI8A 3M41A 3E74A 5D2LA 1I7RB 3PABB 9CGTA 4K8RH 3WS3B 3LENA 4HUXB 1TVLA 4MDOA 5IJDC 1I9IL 4RGNC 2DFAA 1RVFL 4U3XA 2J9XA 4W9EC 5G2IA 1S9WB 5J4MA 4E8DA 5LGXA 3EOTH 1ZHNA 2DQTH 1QA9B 3HB3C 2INFA 1YPXA 2NR6C 2YRLA 3HC0B 1NMAL 3BUIA 5I24A 4UTFA 1K4CB 4R3SB 4Y19A 1JGDB 2J7EA 2VDOL 3GUTA 1XMEB 4MWFA 1XBDA 4QTIH 3G5XB 3E1ZA 1T80A 3K6FA 1CYXA 4NO0A 3W24A 1JJKA 3QYQA 4K6AA 2QV2A 3AM8C 1OK6A 3FS2A 1IJNA 3NG3A 4C6MA 1W56A 2FX8L 2BS8A 3U57A 1FO0B 3COOA 3H2EA 1EDGA 4LVDA 3BT0A 1PSCA 3DV4A 1GTNA 3SD2A 3WN5A 2ZUMA 4YCPA 1EHNA 4AVHA 4Z3GA 1EV2E 2R4SL 3AWGA 2XFRA 3WLWC 2WLIB 2P46B 4HU4A 5MEPB 3TBWA 3SYAA 1N55A 3QKEA 1E73M 2XKUA 3LHPH 4JDTH 3HW7A 3NDYE 3X3FH 1EJOH 3FQYA 3OSVA 2HLAB 3DV6A 2V2DA 3QZEA 4QDPA 1R47A 1H1YA 3UJSA 4BK8A 3V7PA 1NAKL 2J5LB 2ZC8A 4MWFB 1L0QA 5C0FB 2VE6B 4GYBA 4HX1A 1KB3A 3L3HA 2J2ZA 2YR3A 3T4AB 3AISA 3C87A 4V1XA 5U7SA 1KENL 5C0BB 1AFSA 3WI9A 1UH2A 3SN0A 2BSSA 1I2RA 4HMEA 5SWUA 2VZSA 3IGLA 4M5YH 3BUDA 2D1ZA 1HHJA 1U8MB 5HHVL 4M6OH 1M71B 4OCSH 3HRZA 3QJAA 4FQCL 5C9WA 2H2PC 4O2CB 1FIEA 2FDSA 1D5RA 2HEJA 3FQ1A 5DD1H 5LO7A 3X1EA 3CZEA 2CLFA 1SO6A 3WQPA 5DJCB 1WBZA 2N59A 1GHSA 1ZGDA 3S3DB 4APQD 3TO2B 1H3VA 3BWUC 5C08B 3GIVA 4B27A 1SW7A 1WBXB 3FTVA 4GH1A 3NESA 5JW3L 4N4YB 2ZOTA 1OFPA 4TQEH 4J6RL 1F4YH 1Y0LA 1YYLL 3UG4A 2DU2A 3AFBA 4KI5C 1NIDA 3OLDA 3HRZC 4DVRL 2QQ6A 1ES0B 4XO8A 3BVNB 2VDMH 4MOZA 1W3TA 4KWSA 1M2VA 1WZKA 4NQDE 4JOMA 1EAJA 4K3JL 4MADA 3AT9A 3C3NA 2Z1VA 2CHXA 5CLZA 2O9RA 2QLVB 5A7EA 4WY7H 4IWWA 3DVNA 4V2XA 2NY1B 2JMRA 5B7FA 5BV7C 5HYSA 5LZLA 2XQ0A 1LP9E 3AZSA 1EXHA 3G1SA 4NILA 4YR6B 4GZEA 5HI5C 5KG9A 4PGZA 1UWQA 2O9TA 4L1XA 1R30A 3TJLA 4TMPA 4ELME 1RK1A 2ZF8A 1CPUA 1NDMB 3L1EA 2DQ6A 3W81A 5CFHA 2VDPB 4G8FB 1DVQA 5L2KD 3WELA 5CBEB 1XL9A 2VDHA 3LQGA 5JIDA 3O6FC 5G4EA 5FO7B 2QSCH 4DPRA 1BXVA 3VFPB 5DJ2B 2OFJA 5GGTA 2DMGA 1VYPX 3KOYA 2NY6D 2WP3O 4H9TA 3F12B 1UZGA 4D9QE 3AZRA 4H20L 2XT1B 4N5ED 4HCRA 4N2YA 5GRZA 4MAUH 4G7EA 5A5WA 3AQYA 4YR6A 4X8GA 1ZLUH 4DJFC 3SCQA 3CU1A 3WHE1 5L7XL 1UG6A 1HU8A 3RE0A 1E9OB 5DD6A 1MLBA 2OGJA 4RE3A 4JZOA 5IMMB 3HZKA 1Q9LA 4ABQA 1HW6A 4WZHA 4ZTXA 4BBWA 3TIDB 3PP4L 4MXWH 5DO2D 2D2GA 1JPSL 2J21A 1KQZA 5KJ7E 2WW5A 5F3HA 4YH6A 3VYPA 1FDYA 1NL0L 3ANVA 4HYVA 3ZYIA 2R24A 43C9A 3IF1A 1EGZA 4UTWC 2WVUA 5D7KE 1GC1C 4KRLB 5KINA 1RZJC 1UKQA 1PZBA 32C2A 3VFNA 5C3LD 2YCLB 1IC7H 5F7FA 2ZOWA 3P8IA 4FQ1L 4F80A 4JHWH 5DUPH 5IJBC 3V35A 4KNQA 1SFHA 5I23A 3WH9A 1H3XA 2F54B 4GJ1A 4JKPL 4KY1L 1NC4A 5F96H 3FSAA 4GS7B 3VOCA 4OD3L 1WYJA 3P0YL 4PFHA 4RKAA 2ARJQ 3EWCA 2PO6C 3GHEH 2VFGA 2EDFA 5HI3D 3BEWA 5JPMB 4AAJA 2OMXB 1HESA 2JJTA 1I9RL 1HEZB 1T89C 1UGNA 1WEJL 4MD4A 4OFYA 4Y2DC 5INCA 5GXBB 1JWMA 2NXIA 5JR1L 4A6YB 3WBAA 1RXLA 4HKXB 4K3DH 3M0HA 2VQ4A 3LRMA 1G6RB 2E7BA 3Q2LA 3ZE1B 1G4SA 1HAUA 1A02N 2PC8A 5AW0B 1AQMA 4EKXA 5JORB 2NX9A 3G0SA 3DPDA 1TXKA 4NKDA 1PQZB 3QFJB 4RWHA 3P3TA 3UTTE 3RCMA 3HS8A 1IEXA 1DVJA 5CILH 2Q5BA 1J0JA 4LVOB 4TLSA 1TPWA 4ZW3A 4PJDF 5D33A 1EYWA 1JI2A 2PR4L 3QUMH 3VQ1C 5CZSA 2BOLA 2E4TA 2YC1A 5C8JA 1L2QA 2O5ZL 1BF5A 4WX2A 5CLWA 3VDGA 3PC0A 4LV4A 2G60L 3C60C 3ZXWA 4M4PA 4NP9A 4AY1A 1JPGB 4M43L 3UXIA 3MP3A 2WTOA 5J9PA 3S8WA 1BD2A 3NZHL 4M0XA 3W70A 2CRYA 2I5IA 2RKXA 5HQMA 2VABA 2V9TA 1QR1B 1Z5LB 2FLIA 5FB8B 3L9CA 5FM5O 5KVFE 5BZDB 1SM3H 2CLKA 3QLDA 3E8UL 4PTDA 4S3FA 2FGWH 3QVAA 4PVNA 2BP8A 4HZMA 3G5ZA 1ZVSB 3D6GA 4ZFFB 1QSZA 3CYJA 2E9BA 4Y2WA 3C5ZD 3MFFA 5T1LB 5HD8D 4B0MB 5C0GB 3P3SA 1OGPA 2J4GA 2OQLA 1FL3B 3FN0H 3DHUA 3Q9QA 1K4CA 3GT6A 3NFNA 4NRSA 2VLRE 1BXUA 2CMRL 3UWWA 4ADSA 4MWAB 1HCYA 3AS1A 1YHPA 4CC0A 2AL2B 1MJ8L 4MA8H 1NWPA 1LOQA 4JPKH 3NH7L 1FNFA 4UILH 1J2BA 4NQDB 3CLFL 3GZQA 4G7VL 2WZEA 4LPXA 4MNQD 2IANE 4M93C 3DJSA 1F41A 3QIUC 2MPVA 5FHBH 1C9WA 1ZP3A 3CAVA 3PULA 3CX5J 2VI0A 2HT3D 4JO5A 4K71C 3UVAA 4GLRH 1Z44A 2DT2A 4G1MA 4NC0B 5KJRL 1Z9PA 4CQCA 2UZIH 3N1AA 3VXUA 4YU1A 2PGRA 2HLAA 2XZZA 3CFJB 3QNFA 4D8ZA 3BG5A 1OB1B 2FRGP 2Z91B 3FUHA 3GMQB 4P5TC 1MSSA 4BCEA 4Y9PA 3GGWA 3GSNA 3P73A 4DZ8B 1GQIA 5GNXA 3EW3B 1XQLA 5TFSL 5DJYA 5DS8A 2LLGA 3EA2A 3WKQA 2UBPC 4W9ZA 4U10A 4BQ2A 2BSRA 4Z0BL 4QRTB 1EANA 4Z7VF 5DHEA 2PPEA 1GT8A 5AAMC 4PMNA 1CGSL 1ACYH 3K2UH 1NUNB 4WKZA 3TVMA 5BQ7A 3UGUA 2GPZA 1NFDE 5C0BE 1X7FA 5I9QC 3GH4A 4DN4H 4PBXA 2CCLA 2V5DA 4ZFZB 4N7QA 1KLGB 5K39A 4XB8A 3CLWA 3UTTA 4AWJC 4DP9X 3R7RA 1S4IA 4RBPH 1KTJA 2C3VB 2HUEA 4HETA 4F0KA 4OCXL 1EA0A 4ZOAA 5D71L 3GGWB 3P73B 4DZ8A 5B3NA 2OXNA 3RK8A 3KEDA 3VG0H 4BZ2L 4QE1A 3GZOA 2O5ZH 3GMNA 2ZX9A 1Y0LB 2PPGA 3MYJB 3ZYZA 2I69A 3CSGA 3QNXB 2I26N 4D6JA 1IE4A 3SBWA 4YDJA 4ACYA 3MRQB 3GXUB 2CGRL 4HFUH 1AE6L 3N1MC 4IRJA 2H3DA 4Z3JA 4P8VA 4S3GA 3VC5A 2ZUQC 3GYEA 3D39E 3QQWA 1TJIL 1QWUA 4GRWH 4KVNH 4HHGA 4TNEA 2R2BA 5FIEA 4GIPD 3MJ9H 2XA3A 4MAYA 5F1KC 5D1XE 1Q6LA 1FWCC 3RB7A 4K94L 4JREB 1G1YA 1YAZA 3VFOB 5B4MC 2OX5A 1QPOA 3TVAA 1U3HC 1TE1A 3X14B 4XC3H 1W6TA 1F3JA 1QJWA 2O6PA 4Y8DC 3WQCA 4WHTA 4FC3E 5T3XE 4KFZC 4OZIE 3OPSA 1Z9AA 2LQRA 3GS4A 3ZHKA 1RL1A 2D9QB 2WIMA 3ME0A 1HQ4B 1NWUA 4DLMA 2Q8BL 3BLLA 3JZUA 4CN4A 4GS7C 4OZHF 2ICEB 4OJYA 2HTLD 3AT8A 1YPZA 3MRPB 3VSQA 3WNIA 2G3JA 2NXGA 4WDXA 1V3KA 4ASTA 3H2NA 3GS7A 1AZBA 3CHDA 3MRNB 4RPQA 1GVQA 1XGEA 3QORB 5E5MB 2NDFA 3ZTDC 3HE7D 4YUEL 5EFIA 4PGBA 5J6HA 3BLFA 2C4FU 3PPGA 5E6YA 3IETA 1EF3A 4F8OA 1WXYA 2VOTA 1ONQA 3KAAA 1W54A 1MXGA 2GSGA 5I5RA 4M48L 4X4YB 3KJ4B 1SU5A 3U7BA 4PBVC 4U4MA 2VLKB 3EYUH 3L95A 2PXYB 4KUZH 5B4MD 3L2NA 5HHMB 4AZ8A 3NYKA 3ZKSD 4NZTH 1E71M 1G7LA 1GW1A 4NP7A 1UT2A 4HPGA 4A22A 4IH3A 4OFYD 2CLLA 4F0SA 1LGVA 1PJWA 1CN4A 4G8IA 2D2JA 5BO1H 3VFWB 4EDWH 3TH6A 4AQZA 5AWNH 3CEUA 1TZ8A 2Q8AH 3VXSE 2EXYD 1UXWA 1V54B 3ROOB 3NFPA 4WJEA 4B15A 3HLKA 4NZ3A 3SUVA 2CEQA 3GVRA 4NPYA 5DHYB 3D0LB 5G1TA 4XKYB 3D18B 2BDQA 5I5MA 2V3FA 3QJUB 1X39A 5EOTB 4JIIX 3MMEB 3CFQA 3QXAA 1ZA3B 3FQUB 3RVXD 4QD2E 1TA3A 4ZQKA 3RMEA 4XR8C 1PCXA 1DWGM 5CSSA 1YTKA 1FA4A 3CEPA 1TQBC 2Y7QB 2FZ3B 2RB8A 4YFDB 1AD9B 2YOAA 4L37A 2G96A 4W9GC 5GGRB 1YMMA 4O57A 3T81A 1RULH 3MCKB 1UH4A 4L4JA 1MCOH 2H1PL 3VIIA 5IRPA 1B2WL 4G7VH 3O16A 1M7IA 4ZUTA 4FXGC 5MEOA 1NBVH 5DEGB 4GMTL 2Z35A 1QNZL 3B6SB 3MKVA 2CKSA 1W16A 1CTNA 3WOVA 5J9PB 3FB5A 1YEDA 4XVSL 2PUQT 1PBYA 2X7WA 3ES7A 4I6VA 2ZG1A 5I30H 4NCDA 4G2DA 4POCA 3SGKC 4QHKJ 3MO1A 4N1EA 2Y7EA 4LHUD 4JO2L 4AQOA 4GRLA 5J12C 2AABL 3FH5A 3OKKB 3N85L 4GQ9H 4JPWH 4ODWB 1A9VA 3W27A 2AQ3A 4QG8A 1E6XM 4QFUA 1EGJH 1E0TA 3NPVA 3NBNA 5DUML 1DJNA 2OR9L 3PUGA 1Q0XH 5DI8A 4EXPX 2DLIA 2J1ZA 4JY5L 4N2NA 3VQ2C 1ZNNA 1RJLB 1U8QB 3AW5A 4A2DA 2AXGB 1U2HA 1AO7A 3MRLB 3RL1A 3URQA 4K5LA 4OFIA 5A8PA 2CG9X 3T04D 5G55A 2DD8L 3KWXA 4ZTYA 2X40A 4TNVK 1GYVA 1GQLA 4UTKA 3W85A 4C57C 4LF1A 4IK7A 3KYOB 4YO0A 1LLWA 3CIQA 2J8UF 3P9LA 4JHZA 3T4YB 1NC4D 1OB0A 1XYCA 2I7GA 1XLMA 4LC8A 4YVNA 1FBAA 2BVOA 2WYZA 4GB9A 5DMGC 5T26A 3WIJA 3O2WL 4OCWL 2OZ4A 4D8PB 2BNUB 1FUNA 5B7MA 2ODIA 4UTAA 2AV1A 4Y16C 1IC4H 5JR1H 1GOFA 2R1WA 4N24A 4F2MA 3AS0A 3C6EA 3HC2A 3I9GL 3OZMA 4IF2A 4CNUA 4HKZB 3U7AA 3HGOA 3VXUE 4PJXF 3VA8A 1KYFA 3G0UA 4HSNA 4MA1C 3AHYA 4MMYB 3ULSB 2I5YH 3DA0A 4BFJA 2CW6A 2ADYA 4JFHD 1NMAH 1GGUA 1PZ5B 1TYRA 2QZRA 5JTWA 4ELMF 4I77L 2I60L 1MJ7L 3UBXG 1X96A 1WBYA 1SYSA 3FU9A 3CVIL 1NEZA 3MLTB 1YQVL 1J1PH 1HJCA 1IFHL 3VM7A 4D8PA 4FFWD 2DYRB 1P9MA 2P8LB 3QSRA 1NIFA 1EMTL 1FC2D 2CRZA 4URKA 3QUYB 3EOSA 4KKXA 1UCBL 3DK0A 3M5VA 3MGOA 4FSAA 4PJEA 2XU2A 2HQAA 1E7UA 4LCYB 3OAUH 4LYRA 3C5SB 1PKQB 3A3YB 3O4LB 4QRNA 4IXHA 5D4YA 1DBKL 3RFZB 5JXEC 1O0VA 1YDNA 4AQEA 1WC7B 3K74B 1BF6A 2ROXA 4Z1CA 2WBXA 3H3BC 1NQKA 4PU2A 4K8RC 3QY7A 2AJUL 3VG9B 3BPOB 3QMSA 1CCZA 3IN0A 4LOUD 3R0NA 5C0AD 2H8XA 5CAKA 2WBKA 3FK3A 4WFHD 2FLBT 2HH0H 1XLIA 1QLFA 2XV3A 1MXSA 4B41A 3A5FA 4HYWA 3D69A 2VEIA 1RJYB 3QQ4B 5FCZA 2E6FA 3BZDA 4LCRA 5HI4C 5IEKB 3PGCB 3KCPB 4O2CA 3LQAC 5IG7B 1KELH 3KLQA 3U2CA 3II1A 4PI0A 2ZYFA 3W01A 4DYKA 4UTBL 2JKEA 2G9HA 4N0RA 3D48R 2YA0A 3IDXH 2NR6A 1TJGH 4AJYV 1UW9A 2VAAA 2I57A 3GVQA 4WGWB 3MUHL 3RHWF 1I7TA 3H0TA 3ESUF 4TSBL 1MRDH 1X5JA 5I71B 1SR9A 3T40A 3M0KA 3NZUA 5ILTH 3CCHB 4DZAA 1CJYA 1AKJA 3AM8A 1G43A 3LKRB 4H5SB 3V2AR 3VXMA 3PXHA 1HJUA 3NXFA 3MRJB 4NSKB 2B20A 5CGQA 5LA0A 1Q66A 2XHNA 3SE9L 5FEBA 4PMDA 4ANVA 4M6VA 5ENWA 4RGND 3DECA 2NY0B 4O2EB 4YJZL 3V9EA 4HK6A 4MNHA 4PTNA 4PY7B 1ZTXL 1YEHL 1TG7A 4X0KA 2DZPA 1GORA 5C0EA 3QTPA 2R2HB 1XIIA 2FFCA 1FFNB 4KIRA 1HQRA 1O60A 3GXNA 3EJYC 4PLNC 1EH9A 4Z7WF 4JX4A 2ICSA 1E27A 1IGSA 3TN3A 3MRKA 4XNMB 1BX2A 1G7UA 2H8ZA 2YDQA 4Q8UA 4MB5A 3W2DL 1DWFM 1MF2H 1MMFA 4KO5A 5JW5A 1E28B 1JF1A 1DTUA 1H51A 4K5NA 5T33L 3O3RA 5CN2A 4ODVH 4AE1A 4LDEB 3L4YA 4GYPC 3LXUX 3TIEA 3HC3L 3SCMA 3C08H 2NX3A 2AFNA 1G0CA 3V5KB 3AIVA 4LF2A 3GDBA 4L9YA 4JGMA 3Q6GL 4ZMYA 1HGYA 3JT0A 4HIQA 3I7QA 1TKWA 3CD4A 3FB7A 1ASQA 4NFBA 4E9QA 3OZOA 2ANUA 3W7CA 4D6EA 4LLUA 4RE0A 2ZX5A 3KPRD 1W2KT 3K0YA 4KNUA 4TVPL 1R33A 4RFOL 4V1DE 4KK8C 4WWKB 3RVTC 2BVUA 1MFBL 3ORWA 2NQ5A 1Z3GH 3U2OA 4ICXA 4QJ1A 1JUFA 1O7VA 2DLFH 3NP3A 2PRMA 4N2EA 1BMZA 4DKDC 4DHLA 3XINA 2X28A 3T8LA 1E55A 1OCQA 1OD9A 2JKAA 4DESA 2IJ0C 3BVJA 3VIJA 2WNZA 2I1OA 2XLLA 3ZDXE 2QGDA 5TE7H 1R6WA 6ALDA 1QBLL 1F8TH 3B04A 3UGRA 3NQDA 2X9ZA 1SY6L 2A1WH 4J2XA 1RIVL 1QOQA 2PTYA 3DFNA 4Q33A 1NIEA 4IMLA 1WK0A 4L2LA 4FG2A 2VXNA 1WA1X 2QZQA 3HUJE 1S2VA 3OZYA 1KLUB 3N15A 1DIEA 1ADQL 4NB7A 4MKSA 2J20A 2IALA 4JRYD 1A5KC 5I6SA 4NQEB 1BAFL 1OGBA 3EWWA 4RZ6A 4KVPA 2FTYA 4F57L 3WLIA 3QR3A 1G01A 3X2QB 2Y7GA 3MA7B 2Q87A 3OF6D 4UQEA 5DLML 1CFNB 4LUYA 8TIMA 1XF3B 2PAJA 2D4DA 1XI3A 4Z7OF 1UZ6E 1F8IA 1PHQA 4I0PD 1E5BA 4X7TB 4XO6A 1EO7A 3MCG1 3S37X 1G7IB 4PTUB 3TQKA 2ALRA 1SMAA 4NUPA 3L7EA 3SYPA 3ZTJG 5B38A 1NUDA 5C2CA 1SZFA 4PWIA 3VB8A 3NCCB 5C70A 3K1DA 1PO9A 3HZMA 5E7FA 3EAKA 5LNVA 3W9EA 3TYAA 8XIMA 1J9RA 4HOMA 2DM2A 4MQXC 1P1VA 4P5TD 1TJ1A 4F0HA 1TMCB 3W1LA 4X80L 1T66D 3R06A 4FR1A 2E59A 2XN1A 1UJ3B 2EDWA 3P4NB 4L4VE 4GYFA 2MQ3A 2FHFA 2OZNA 4XHJD 3PPEA 5I1JH 4Y9FA 4N9BA 4E9WA 5FJTA 1HNYA 3L23A 4UXDA 1OX6A 4DPQA 1WCQA 4LPCA 4LPVA 2GWNA 4JM2D 4LIQH 5JPMC 2FQGA 1ALDA 3JBG7 3ZQWA 4LLDA 2OT1A 5EFFA 2ADJA 2IAAC 3CFTA 4PP2A 1UC5A 4KPLA 4XSLA 5IVZA 1QNQA 4IGBB 4IDJL 4XD5A 1ZUAX 5HHOE 1K72A 2A6LA 4DM1A 3TFCA 5JHDB 1FUYA 1EFQA 4FXKB 2HS8A 2I07A 2DRUA 3M17B 2ZE0A 3DIFA 1YEKH 2C3WA 1EJTC 4JRXD 3QV7A 4MMWA 4ZCWA 3LH2H 3JW7A 1C16B 2ENJA 3WENA 5IBUB 4OV5B 4O0KA 4JO3L 2XWBB 1S5VA 5D04C 4X6FB 2VRQA 3F3HA 3ECBB 4L7ZA 4P4RA 3OWRA 2NW2B 2IPGA 4KWWA 1W9XA 1WITA 3QUXD 4NU7A 1BXAA 1U8LA 3KWVA 1R19A 3P9MA 4M62H 1OF8A 1PYWA 3KPRA 2B59A 4CSZA 3T3MF 5I1GH 3N1PC 3NEOA 2W9LA 3MNWB 3NJIA 4EI0A 1AH1A 5CPTA 5FYJD 4K39A 1ZU8A 1NCBH 2EVHA 3T78A 4QGTA 2I5GA 3TU9A 4W9TA 4US5A 2BWIA 2QTEA 3GJEA 1JGDA 4FYQA 2Q3OA 3KRUA 1DJYA 1P43A 1A47A 4WOQA 5CP3A 5G1YA 3OKMA 3MRIA 4I9WE 2QVNA 1BWVA 2CO7B 1BQHB 2QPUA 3DRQB 4TV3A 1N5YH 4H01A 3RDKA 2EEFA 3BWUF 3PV6A 1VPXA 2VDQB 3MCLL 5DJ6A 1BM3H 4P2QD 4UINH 3CVCA 2FYMA 5I0VA 2EKSB 4JHBA 2JTYA 3BSHA 4BQCA 3LNMA 1FY6A 3SDDC 3CZSA 1A6WL 4QYAA 4N9GB 3ZS4A 5D2NB 2KDYA 1O94A 2AJYH 3RGBA 3CT7A 1CWVA 1RZFH 1TT6A 2PODA 4DZIA 3QRBA 5BRBA 5C0JA 4BSVB 1DVFA 2B1HH 2J88L 4IJTA 2MWCA 1OPOA 4JRFA 4W6WB 4XVUC 3RNQA 1HEZA 4L3ED 5IJVA 2AGKA 3RITA 4H9MA 5LKNA 1R3HB 1R3WA 2A99A 2PYFB 1JNLL 3DX6B 4JBSA 4Y5VB 4TOYH 2GSJA 4HUWA 4KMQA 4RDQG 4TPRL 3OKMB 2YPVH 1PIIA 1XF4A 4GIRA 3VKBA 4PV9A 4NJGA 3KG5A 3WO3B 2P8MB 1U8KB 2X6UA 4NN7C 4PW9A 1A7RH 1OAYL 4PWHA 3IIVA 5IESH 3A24A 1S5WA 1IEQA 3VXSD 2VSCA 1JJUA 2AQVA 1UA3A 3NK4A 1E8WA 4WK0B 4YNYA 4JB9H 5EKYA 4ZFCA 3O6MH 4JQIH 4NNXA 2AEWA 4CQDA 1OZQA 2HMCA 2EACA 5EU7C 3M0LA 3V4VB 4A35A 4CD5A 3WS6C 3U0HA 5FLVA 3KYNB 1SFDA 1ZWIB 4FQQB 5E4AA 4CVXB 1J5HA 1MCEA 1IILE 2A6KB 2YBUA 4B7LA 1SQ7A 5KYYA 1JNEA 3UYPA 3BZ4B 5IQ9B 3PWGA 1B0IA 1Q0YL 3UYRH 2OOFA 5GISL 5FC9A 4MVBC 5FJJA 3U6WA 5K9JH 4UV4L 3WBEA 4KI5F 1FYHB 5IMOA 3GRBA 1R38A 5T1JA 3VH8B 4I4WB 4HBCH 4Y4KB 4W9CC 3LQLA 1T1YA 4U3SB 3RY6A 5TE4H 4M8VA 3RVXC 3EUUA 4NNXB 1VP5A 1D5BA 1BEXA 3NUKA 4LHUA 3AXXA 1GGIL 3MZGB 4DNHA 3P14A 1NMCC 1WZAA 2Z1KA 4L4OA 1QR7A 2JCCE 4K15A 2WKOF 4EMZA 2ED8A 4AXNA 1BVNP 1A6UL 2BIOA 5AAWA 4UFMA 6ENLA 3LPWA 5DJAA 4H8UA 3GJFA 4XOAA 3EPMA 3P54A 4QXTA 4MNJA 2OQJB 3WNKA 2O7SA 1LBMA 3IJ8A 4PJFE 3FTGA 5HYSG 1ZVHA 4GKNA 2XDHA 4UDUA 5FGBC 4ZQPA 3SRHA 5ETUB 4Z3HA 1PIGA 1W0VB 1MOEA 2J8UE 3CDZA 3RIAF 1RPUA 4F9JA 1N7ML 3VGGA 3FGCA 4FOKA 3RHGA 2C9AA 2AK4A 4AM0Q 5E5CA 4LIQE 3S1VA 2WB1A 4WRLA 2DL9A 4GG6B 5F7NC 2XDFA 3NMEA 1MZYA 2X4PB 3WYRA 3B03A 4Z7VE 4ZPVA 2CIPA 1C29A 1C12A 4G7EB 3EMQA 1REIA 4EN3B 3ULVF 1K6QL 3L6FB 1SN0A 2EYSB 2RQ8A 3QJRB 5HJDA 4XXDB 2ESVA 5K1JA 3T6XA 5MP6H 2ZADA 3EX1A 1BFNA 3TF7C 2WXPA 3OMAB 1BP3B 3U9IA 1IEAA 1ZTMA 3NFUA 1P5BA 5CBAA 4YSSA 3HBPA 1IWAA 1FBIL 2AJVH 2I16A 5H35B 4W9KC 4CQ8A 3CSFA 3ABSA 5JBEA 1GAFH 4DO4A 4NZTL 1J11A 1G69A 5C7HA 1FDLH 2CXEA 4NHUA 3MVIA 4CD8A 1MJJA 4TPRH 4U1LA 2FZ3A 4ZTEA 2ZFAA 3ANYA 1LQBC 4MNLA 4XWGL 5I1EH 2FPTA 1TQWA 1HUVA 1B3IA 2J88H 5KBLA 4ZTPL 1O6SA 3TAKA 1L3NA 3BAKA 1DN2A 5LGJA 5LNRA 2XPYA 1S9VB 3KXFA 4XPBL 4BI5A 3THAA 4X98B 1UR0A 2NCEA 2FSEA 4PS7A 3KCJA 1PXGA 1MO0A 5K9XA 2Z35B 3B6SA 4U3AA 1TENA 4O51B 4XPGH 3BANA 4H9ZA 5MHSD 1PZUB 3MI6A 4JZNB 1K7EA 5H2BB 2XXMB 1DE4A 2BXYA 2P7TA 3N40F 5DRZA 5ANMB 3ITLA 2YCIX 5A8MA 3L1FA 1SRDA 1MW2A 2BP0B 3B06A 1MCWM 1F4HA 2I5YL 1GZPB 4OZHE 1KCBA 3P4MB 4NQEE 1E90A 1TIWA 1EHLL 5B39G 5H94A 4XC3L 3VIKA 2F53D 3B7YA 4FLSA 1A6AB 4HJGB 4KQ3L 4W7UA 1IGTB 3RPKA 4CVWA 3A4WA 2HN7A 3T77A 3V0JA 4C4KO 2CDFA 4ZW5A 1BYOA 1U6AL 1XR8A 5ISZE 1FQ9C 2Z1XA 1QASA 3C09B 3D0VA 4GRMA 3CYVA 3GNNA 5KAQF 4JTCA 2WZAA 4GH3A 4X9BA 2PCPB 5AYQA 1JPGA 5DANA 1INQA 2R0WL 1MFUA 3ZSSA 5AHEA 1IEHA 4HNVA 2X70A 3KE0A 4MHHG 5AD0A 1IT0A 5E0KA 4TSAL 3JYCA 2A79A 3BV7A 3BAJA 1YEKL 3NEHA 1VJZA 5BROA 5AVRB 5T5FA 3N42B 3L3DA 3LI0A 3CUGA 4C60A 1ZEAL 4MZ1A 3L9EA 4IDJH 3MCOA 3PWUB 5D71H 1W3NA 1SN2A 3L45A 3PWNA 1UB6B 5A6BA 2EUZA 5IHHA 4EOWL 4FXRA 3V18A 2FH6A 1P1ZA 2WGXA 1AY1L 3NCYP 4PSPA 2QADC 4NYLA 4IBSA 5DHVB 3ZN6A 3EWBX 4NQ1A 3L2LA 1IIHA 1WYIA 5SWSD 3AU0A 3EGXA 3FFOA 4P61A 5HWMA 1O7SA 1Z69A 3AC0A 3R12A 5IB4A 2YPKB 4G8IB 5BOZG 4LSPL 5FYKL 2FEDD 3ARGC 3A64A 4E8CA 2B08A 4H8WL 2P10A 4HT3A 5F0MB 4IQJA 1U3YA 1MXDA 1A6TB 4IBLT 4KX7A 4Y1AD 4HUUB 2CLPA 3STFA 2V2XA 1BREA 2YHGA 3C5JA 1OSPL 1LO4L 2FWLB 1WBYB 2MCMA 1XWVA 3G1RA 4WDWA 1CGWA 3ULUL 4HULB 5CJ8A 3BT2L 2HZGA 1TU2B 4ZB0A 1FWHC 2E9LA 3N9KA 1QYGH 2ZPKL 3FBKA 4FFWC 1E30A 5AVUB 3E6HA 4JJ5A 1A7OH 2FJGA 3I6KB 4I18C 5F1IA 3BYTA 4JFFB 2HSIA 4AZCA 3FO0H 2EYTA 5AVQB 3QEHA 3UQNA 2PP9A 1R9ZA 4FTVE 4OFCA 2XNAA 3ETTA 4QJ5B 3FJ4A 3S36H 4YDIL 2VN6A 1A7NL 3PWPB 3MW7A 3IMUA 4BFKA 3UYRL 5KVGL 5DMMA 5DUBB 1DJWA 2YGNA 3FC8A 3AY4C 3PZQA 4Z7QB 2BTMA 3C5JB 3N2XA 5SWSE 4PEKA 1FJ1A 1MFCL 4DP8X 2W63A 1A7BA 1NC2A 4JANA 4UCGA 5DJ8A 1SUJA 3N43F 4CU6A 1X38A 3IU3B 3C0JA 1RUSA 5CSUA 4EOWH 3MS8A 3F84A 3I6KA 4KXCA 3WY1A 5I1KL 5I73B 3EXLA 2DZBA 3FQWA 3DX2A 4F8XA 4DUXA 3MC0A 4JQIL 5D7JA 3LKPA 2AVGA 2V82A 4GRLB 4FZIA 4ANWA 3QY6A 3X12B 3SGJA 2P3YA 2ZUWA 2CLHA 1NCDL 3OR6B 1X97A 2BGNE 4Y2DB 4HPHA 5C0RH 5JIIA 4YDVA 4AE0A 4Y4KA 1H3GA 1PPIA 1X7IA 3N40P 2V17L 1PE1A 4XUYA 2BSED 1ZDSA 2P48B 2BP1A 1NC2B 1BMGA 4JANB 4LSSL 1LO5A 1POKA 3VGFA 3T1WA 4NWTL 4RIRB 3D6NA 2ZZ4A 3MZNA 4CNTA 3L5JA 3QYMA 1K70A 1E6RA 1H8OA 1X44A 2IDFA 3CSTA 3O81A 4P2CG 4B95C 4N8VA 3TXAA 4BDVA 5E08L 4FERA 3O4LE 5DC4B 1L6WA 2AJYL 1HF6A 2BB0A 5J5DA 3ZIYA 3P9LB 3T4YA 3IDMB 5C6TL 1B57A 3FA3A 3FEQA 2Y8KA 4YN5A 4GSQA 4IM8A 3CXDH 1KM1A 2ITDA 4YWSA 5FECB 1FL3A 3BDXA 4KHXL 3ABLB 1F74A 1AMYA 4TLUA 3BW4A 4NENB 2BIPA 4J3BA 3HI6L 3T3PB 3RJYA 5CSRA 5H91A 3FQXB 2EUWA 1KCSH 1O9WA 4LAQH 1WB0A 3U2ZA 1UCWA 4Y16A 3BE1H 4DN3H 5AC7A 1KCLA 1PD1A 2GVEA 4BINA 4ODUB 4JKNA 3M0IA 4S3DA 1B0GA 2BHZA 3BHBB 4LLMA 2LAGB 1VPOH 2Y7FA 1MHHA 3MLRL 3OG2A 4KMTH 1MIEH 3EUDA 2TYSA 1U8IA 4YS4A 4AG0A 3VKJA 3NGBB 4PRWA 2CZ5A 5I15L 4UYQA 2ODOA 3EA1A 5CEWA 2WMPA 1NPJA 3FOMB 3O9WA 4QHUA 4S0TD 3VXUB 3TYFB 3DHFA 4AL8C 1AHWC 1LEGB 1FH5H 2A38A 3GSWA 4M24A 4AZ8B 1ADWA 4CDGC 4U1IB 3VMNA 2QR6A 4Q4QA 2PDNA 5BU6A 4OBSA 2XG4B 3HI5H 3QQDA 2WLLB 4Q89A 1W6LA 1OT1A 5FYLD 4NAFB 5GJPA 4R4ND 3T0TA 5K59E 4MHBA 1R7AA 4UF7C 5LXXA 4QF1B 2CK0H 4LSUH 3H9SB 3JS3A 1QI3A 3LH9A 4J27A 4F3HA 1E3XA 1UZ8B 3AITA 6CGTA 5HHPA 4KXZI 4X98A 5BVPH 2B1OA 2D0HA 3N9GH 5AVTB 4Y4FB 1DXEA 1EOKA 1V0MA 3STEA 3AAMA 1MQ8A 4MFHA 3CIVA 2PD9A 1VEMA 1GRWA 1TQVA 2WHVA 3GSWB 5EA0H 4ZBCA 2R0ZH 3I4KA 3QVQA