1GCYA

High resolution crystal structure of maltotetraose-forming exo-amylase
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
415
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCAN 1,4-ALPHA-MALTOTETRAHYDROLASE
publication title Crystallization and structural analysis of intact maltotetraose-forming exo-amylase from Pseudomonas stutzeri.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 145
structure length 415
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 2000-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gcyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gcyA01
3WQ5A 3CZEA 1V0MA 2Z1SA 3GTNA 5LA1A 1UZ1A 4U5IA 2EPKX 1W91A 2J25A 3SURA 3VPLA 3B9DA 2YLLA 3AIEA 4XUYA 4ATLA 2BHZA 1BGAA 1W9DM 3WMSA 4W85A 4BQ5A 2VTFA 1CENA 2XM2A 3EYPA 3GXFA 1BGGA 5ABEA 2V5CA 2XWDA 1JG9A 2DT0A 1QHOA 2XN0A 2A3HA 3AS3A 3MO4A 1V3IA 3OBAA 2DGAA 1UR0A 1JAKA 1VFFA 2WLZA 4J3XA 1UWRA 3CV5A 3AIUA 2JFEX 3PBGA 1B3VA 3N15A 1V08A 2XSAA 2YL5A 2ZUWA 4PCTA 2WMFA 2BY3A 4B16A 5JIPA 4GZJA 1UD2A 3ARZA 2J7EA 5CGTA 2DSZA 4MDOA 1E71M 1DWAM 3VGBA 1KTCA 5M17A 4CD8A 3BUQA 4PYSA 2F7PA 1AQ0A 4DWSB 1EDQA 1V02E 1ZBCA 4PMOA 2WNWA 3NUKA 4W5ZA 1CWYA 2XSBA 4QAWA 3WDRA 3KWXA 2FYVA 3BSGA 3N18A 3M46A 1C93A 1HX0A 3PTMA 1CZ1A 4OBRA 3A22A 1K9EA 2V38A 2CETA 5FOOA 4IPNB 3GXNA 1WZAA 4U2ZA 4AIUA 5CGMA 3T2QA 2EADA 5HXMA 3CUIA 1VJSA 4UZUA 2WANA 2GVYA 3VMOA 2VVNA 3GYCA 2NW0A 1T0OA 1JZ4A 3BAWA 4MADA 2WM0A 1VEMA 4C7GA 1J0YA 1JIBA 1Z32X 1W9PA 4JZ5A 3K8KA 2XVPA 5DEZA 4GQQA 1XHGA 1V3HA 3EJRA 3RCNA 1R34A 4HP5A 3AHZA 2QLYA 1NWSA 2DSWA 1UR8A 2QMKA 2J4GA 1QNRA 3BUDA 4ZE4A 3HN3A 5I2UA 3NSXA 3O6AA 1UWSA 2PWGA 2YKKA 4TVUA 2JALA 1GVIA 1JL8A 5ABFB 2NT1A 4HZ7A 4AD2A 1GQIA 3AI0A 3WH8A 4CD7A 2PWDA 3BLPX 1ITXA 4WIWA 5DT7A 3WD0A 2EPMX 4J27A 3SCUA 4CUCA 1X6LA 4NX0A 1MQRA 3A3HA 4WLCA 4XB3A 1E6SM 3EDDA 4D6HA 4HU0A 5A6LA 3HMCA 1ISYA 3WL0A 4BQ2A 2XFYA 3TTYA 2OYMA 5A6BA 2V3DA 1E73M 1S46A 3BVTA 5I6SA 3PZOA 1LWHA 2VZVA 2OW7A 3SUSA 3VIKA 4M80A 5JBEA 4W88A 2X1IA 1ZS2A 2WAGA 3ARXA 2JEQA 4WSKA 2J47A 1PX3A 2QF8A 1AMYA 3AMDA 2EEXA 4W5UA 2UY5A 1BFNA 3IAQA 3D4YA 3OLDA 3H54A 1NARA 2YIHA 2WCSA 1L0PA 3QOKA 1J0KA 2JE8A 3WUBA 4PTXA 3ZT6A 3AISA 3ARYA 3II1A 3ARVA 4UFJA 4W8LA 1W9XA 5A8OA 3SCWA 1EHNA 4P7OA 1W3KA 1ZJAA 2W63A 3I3EA 1BSIA 3BCFA 4U2YA 2WC3A 1EIBA 4UOQA 1UASA 4MB4A 3BH4A 3CZKA 2ALWA 3AYRA 5EFFA 1C7TA 1WAWA 1R33A 1BHGA 4QFUA 1OBAA 1I1XA 5GNZA 4M82A 1FHDA 1X6NA 4P7QA 2XVNA 5A8NA 4P7NA 2YA0A 1E15A 1GQLA 2C8NA 1KQZA 2OSWA 1QVBA 2YFNA 4HZ6A 4EANA 3AIBA 1IV8A 1OT2A 2PB1A 3THDA 2VRQA 4B9YA 1UKPA 4UFKA 4DWSA 2WZHA 2CYGA 4KRTA 1K9TA 1J01A 3LPOA 1E6PA 3TA9A 5A8PA 4J3VA 3IAPA 3F5KA 3VDCA 1GOMA 4CD5A 3FHQA 2NT0A 2MANA 1WDQA 5JBFA 1OB0A 5EFDA 2D2OA 2ZX6A 1EOMA 1H41A 1J0HA 2Q8XA 3MKKA 3JUGA 1MW2A 2YL6A 3I3BA 2G3MA 2PWFA 1CGYA 1WDSA 4HZ8A 3W82A 3OG2A 3OGVA 1R85A 3WH5A 1MFVA 2XFRA 2XG9A 3AZTA 4LX4A 5I5RA 1E1FA 4JHZA 5M3WA 4GZEA 1ESWA 4W8AA 3ARRA 4WSJA 2EPLX 5IHSA 1HT6A 4B9ZA 3MUZ1 2J75A 2PF0A 4CCCA 3RM8A 2PI6A 1HKMA 1KR1A 4L4PA 1SMDA 3ZSSA 2W91A 1HVQA 4K68A 2WKLA 4OOUA 1OT1A 1W3HA 2DIEA 3TOPA 4JFWA 3KLLA 3U5UA 3CUGA 4C7DA 1UYQA 4YHEA 3D51A 5TD4A 4LYQA 3KL0A 4U31A 5GPRA 2WMIB 3SUWA 4KWUA 3HZ3A 1ISZA 1DHKA 2OSXA 3UESA 1JZ2A 1ZBKA 2ZXBA 3QR3A 3VIOA 4N0RA 4TTGA 3L4ZA 3VIGA 4AZGA 4CU8A 3ZMRA 2GJXB 1EDGA 1UH3A 5HNNA 1PS3A 2FH6A 3TTSA 3WDQA 3LX9A 5A6SA 5EMYA 1UUQA 4M1RA 2WK2A 3VIIA 1XC6A 2VZOA 4MAZA 1P6WA 2VZSA 4AC1X 1HJSA 1A47A 4AIEA 3OZPA 2CBVA 3VDHA 3S2CA 5CZKA 3VDAA 1JD7A 1ODZA 3BUIA 1BVNP 1HTYA 1JYNA 4HOXA 2BNJA 2RGLA 1QNPA 2GFTA 3GM8A 1GW1A 4Y7EA 1OM0A 2O9TA 1K6AA 3MSGA 1E43A 1PAMA 1B3YA 1PZ3A 3H55A 1B9ZA 1WZLA 1HJXA 3BAIA 3UR8A 3A4WA 3GBDA 1ISWA 3UR7A 4D6DA 2BVTA 2WVUA 4AIOA 4AZCB 3VUPA 4A4AA 3BAYA 3CPUA 2WVVB 1E6NA 3W38A 4FNUA 2GDUA 3W0KA 3THCA 2BVDA 1Q4NX 1V0NA 2OLHA 1U2YA 3NSNA 4DUWA 1W3JA 4LYRA 4HTYA 1IT0A 1JZ7A 1NOUA 4ZFMA 3DYMA 3AROA 2DEPA 5I78A 1W1VA 2OYLA 3SCNA 5A94A 1XD1A 2OWCA 5CPTA 1C8QA 2B31A 1CBGA 1QNQA 1B2YA 3ZT5A 2BV9A 2XVKA 3TTOA 4D71A 2DSVA 4W87A 4QLJA 1JYWA 3MMDA 1HN1A 2WHKA 1E3XA 3VO0A 1OWQA 1WP6A 3LXBA 1UD5A 2ZUSA 4FNPA 2EPNA 1GOIA 1NWUA 4OJYA 4NZFA 3U5YA 2PWHA 3VSUA 1O6IA 1V3MA 4XZBA 2DIJA 3D5HA 1VFOA 4GPNA 1EXPA 4J3SA 4J3TA 3N13A 1GZJA 4PCSA 5AYIA 3LRMA 3MANA 1CLVA 3BLBA 3OLEA 4CU7A 4GZIA 3GZAA 1C8YA 1DWJM 1PJ9A 1WZMA 1TFVA 2CCRA 2TAAA 7A3HA 1HXKA 3OB8A 2BXZA 3WNNA 4OKDA 3WNKA 2BS9A 1SFSA 5D8ZA 3WD4A 2ZX9A 3WQ4A 2ZE0A 3EJUA 3WNLA 2CKRA 2GK1B 4ZXLA 1EQPA 1E40A 2CBJA 1LLOA 4MB5A 1F4AA 1OD0A 1FFRA 5A1AA 1IZKA 2J62A 3VGFA 1CXLA 2WMIA 3CC1A 3DDGA 4AZ7A 2YBTA 1NOFA 4JFUA 3WD2A 3W26A 1ISXA 1ODUA 2XVGA 3LRLA 1FH7A 5ABGA 4P8VA 1NQ6A 1OIFA 3CH9A 3MI6A 1SYTA 5E1QA 5HPOA 3ALGA 2J77A 4CU6A 3CHCA 1CXHA 3LXCA 1AQMA 2GJXA 1JXJA 1HJQA 2XPKA 3IJ7A 1W9VA 3T2PA 3A24A 3CZNA 2YBUA 2F8QA 4UQBA 4OUEA 3W37A 1NWTA 1E6RA 1UD8A 1UD3A 3AS0A 1J0IA 3ECQA 1V6XA 1VRXA 2BY0A 2E9BA 2DT2A 4KGJA 3CBWA 3T0BA 2D73A 5HPCA 2G3IA 3SCTA 3PZQA 2VQTA 1TQUA 1H1NA 4NF7A 1MW1A 1J11A 1E0WA 5E70A 1XD0A 2W66A 1KBBA 3EMZA 1GUVA 2WC7A 1HWWA 2FHBA 5CG0A 5IFPA 3B8SA 3WL1A 2WHLA 3VM7A 3VMPA 4QLKA 1KGWA 1CLXA 3BAXA 3N04A 4NRRA 3WF2A 1QI5A 2WWDA 4BA0A 4EKJA 1HJVA 3AHXA 4NZCA 2WVVA 1NP2A 2G4FA 3GDBA 3WDJA 1QBAA 1BG4A 1EQCA 1TMQA 1CGWA 1FP8A 2ZUUA 4MB1A 1UR9A 5A6AA 2XHYA 3VINA 1PZ2A 3AJ7A 1TR1A 3OLGA 2X0HA 3CO4A 4Z2HA 1UG6A 1HF6A 4H2CA 1CNVA 3AZRA 4BF7A 5LA0A 2WPGA 4UQCA 2W4XA 3DC0A 2D0GA 4AW7A 4TVCA 3BGAA 2NSXA 1NH6A 3DX2A 3MMUA 2FE0A 4UFLA 4CD4A 3PZUA 4EAMA 2X0YA 3WQWA 3ALFA 4ATDA 2F7RA 4PSPA 1V6UA 3WNPA 2GSJA 3ZJ7A 1KBKA 2ZUMA 2WW5A 3EJQA 5CQ1A 1C90A 3E1F1 3N1AA 3SCRA 1MW3A 2QV4A 3RILA 1PPIA 3VGEA 4FLQA 3WMBA 1BF2A 1UWQA 3AMCA 5A6MA 2BY2A 3ARTA 4NXKA 1OGSA 5E09A 4LQ1A 4TX8A 2X05A 3U57A 5AYBA 4AYSA 1O7AA 2ZXQA 4X9YA 1FHLA 2O9OA 4HPHA 3K8MA 4V28A 4LGXA 2A3EA 1FH9A 1R46A 3OZOA 3F5LA 5FD0A 1Q6FA 4M8UA 4FNSA 4ATWA 4TVDA 3VGDA 1ECEA 2A3BA 2WZIA 4UQAA 1PX8A 4MTVA 2WKGA 3FW6A 5E6ZA 1WB0A 4ZXOA 5A6BD 3ZSTA 4A3YA 3BMWA 4X0VA 1UD6A 1D7FA 2FGLA 4Z2LA 1B3WA 1W1YA 4FNRA 3BVUA 4QCEA 3L2MA 3L4WA 1MXGA 4E2OA 1H5VA 2ZUVA 4FNQA 4WKHA 2W5FA 2UY2A 3WQ6A 3WF3A 3CZ8A 3ZJ8A 4DUXA 2AOSA 4AD4A 4AWEA 2YA1A 3WY4A 2JF6A 1BVZA 1B3XA 3WY1A 2ZUNA 2VMFA 1QBBA 1KXTA 4HU8A 1GORA 3A21A 3WH6A 1R86A 2YDSA 3FY1A 1JF5A 2G41A 3OIHA 4PUEA 4WKFA 5KEZA 3F5JA 5C71A 2ZOXA 5DFAA 4W89A 2WSPA 2YJQA 1UH4A 1HP5A 1R75A 3SCOA 4R27A 1JZ3A 1E6XM 1MQQA 1OINA 1CEOA 3A5VA 1TG7A 3RM9A 1BAGA 3B9AA 2J8GA 1E70M 1GOQA 2O9PA 2W61A 1SMAA 2VR4A 4YN5A 4TX6A 1M53A 3W29A 1UR1A 3BUPA 4ZENA 2VJXA 4W8BA 1US2A 1UKOA 4TOQA 3ARUA 4Z2GA 2QMJA 3VD4A 2J7BA 4HMCA 3WFZA 1PIGA 3W4RA 2CESA 2WHJA 4XV0A 5C70A 4CN4A 3AXIA 2CHNA 3HJEA 3LMYA 4D6GA 3WMCA 1TZ7A 1TQVA 2C7FA 2Y4SA 1GHSA 2VRJA 1RP9A 2WHMA 1EA9C 4UOJA 1UA7A 3DX4A 4GI8A 1KR0A 1CECA 1V6YA 2WLYA 1CPUA 3UG4A 1EOKA 2PBOA 1NM9A 2E8YA 4UOZA 1OIMA 1C92A 3WBAA 3W27A 4U33A 2FHFA 5DT5A 3CHDA 2IUZA 3ARQA 1H3GA 3VIFA 1E4IA 2QHAA 3VOCA 2V5DA 4ACYA 4JCLA 3L2LA 3VNZA 3K8LA 2F61A 2XN2A 2XIIA 1DWHM 4PBGA 2BFGA 1SR0A 3G6MA 3WENA 4FNTA 2YOCA 1DP0A 3D4ZA 2BXYA 1QNOA 2D23A 3MMWA 3WDIA 2VQUA 4UR9A 4JAWA 2VURA 3OGSA 2J7GA 5DF0A 4D6JA 1H49A 1VBRA 3AXHA 4CVUA 1HJUA 4D1IA 2X8RA 1LG2A 3AOFA 2DT3A 4TUFA 1GQJA 1TCMA 3SCVA 1TVNA 2PC8A 5CPSA 3FNDA 4JIEA 4QCFA 5GNXA 1G1YA 1JNDA 1J12A 1QW8A 4CKQA 1MXDA 4UCFA 4XZWA 3ZJKA 5IHRA 1GNXA 4PMYA 1PIFA 1R47A 1UQZA 3AS2A 5E9AA 3MV01 4S3JA 2V3GA 4ZEPA 3AS1A 5CLWA 2X2YA 3CUHA 3HG2A 2Y24A 4C7FA 3ZM8A 4RE4A 5LYRA 3UERA 1RD6A 2D20A 4AMCA 3WKZA 2JEPA 5ABFA 3AHYA 3FXYA 1M7XA 3QGVA 1GOOA 3H53A 5I77A 1LQ0A 9CGTA 4GI9A 5HOSA 2OWWA 4MB3A 2WCAA 4OBSA 3M07A 4JFSA 2XGBA 4AZ5A 3UETA 2HVMA 1A3HA 4FF5A 4BS0A 4JL2A 4IM4A 2E9LA 3WUFA 4DM2A 3KZSA 4AZHA 3NDZA 4MAVA 4HOWA 2D24A 3NYDA 2VVSA 4AD0A 4GO9A 1B1YA 3NCOA 5EBAA 1E4LA 4PMXA 1QI0A 1ZB5A 4WF7A 3VDBA 1BYAA 3RO8A 5A6JA 2ZUTA 2JIEA 1XRVA 4DUVA 3NIYA 1FA2A 4RL3A 5HDRA 2A3AA 3WD1A 2VX7A 4AISA 4E4PA 6A3HA 3WSUA 1WNOA 1WO2A 3W25A 1KXVA 3ARPA 1KB3A 2HISA 5FL1A 3RJXA 4UFHA 1RH9A 1B3ZA 1MFUA 2F7OA 2G3JA 2XM1A 4WKAA 4M56A 3AHTA 3WDPP 3WEOA 3GH5A 2V3FA 1XCWA 4U3CA 1QOXA 4WJXA 4BQ3A 3RIKA 3WEMA 3J7HA 1ITCA 1BYBA 5HBFA 1GHRA 3K46A 2Y2WA 5CXPA 3K4DA 4B3KA 2EO7A 1GOKA 1WE5A 3CIVA 3VX1A 3PZTA 4JKMA 2CBUA 3GNPA 1W3LA 2WSKA 1QPKA 4D1JA 4H7VA 2WYSA 3QHNA 5ECUA 2F18A 4DM1A 5BXRA 1C7SA 2UY3A 4X0NA 4NRSA 3GXIA 3FN9A 4W7UA 4MNMA 3ZIZA 2EAEA 2J7CA 2YA2A 2Y5EA 3VIJA 5M5DA 1J0ZA 3BUBA 4HOZA 5AC4A 1PEZA 8CGTA 2GJRA 3VGGA 4ZE5A 3POHA 1CXEA 2F2HA 1HKJA 2J7FA 1OD8A 1MVYA 3BVWA 3POCA 1UH2A 5BROA 3O9NA 1EGZA 2CERA 3GBEA 2XFFA 3O2LA 3NJ3A 4RE2A 3BVXA 5CSYA 1V3KA 1KWKA 3WBEA 5JUVA 4D6IA 1QI2A 1JFHA 4FLRA 4CCEA 4L4OA 1W2PA 4PMQA 4U5KA 3WH9A 3IGUA 1VBUA 4CCDA 3VIHA 3DHPA 4UZSA 4PTWA 3W6MA 1J0JA 5F7UA 4Z2KA 1Y7VA 3EDKA 4P8XA 2YL8A 1HL8A 4URIA 2CIPA 3UG3A 3QOMA 3DECA 3CZLA 1CXKA 2WC4A 2UY4A 4H8VA 1D3CA 4NZJA 1V6VA 1JYXA 4W7WA 5GQBA 1GJUA 2DH3A 4MNKA 1TQSA 4A3HA 1J10A 2VI0A 4V27A 2YFOA 3AZSA 3OLIA 1U30A 1SZNA 1EH9A 3HG4A 2VCCA 1UQYA 1VIWA 2WBGA 3AMLA 4H8UA 4P7LA 3NDYA 5DO8A 3CZJA 4MNJA 3BAKA 1R7OA 2DQXA 1XSIA 1WZKA 4WK9A 4UNIA 1UR2A 5BXPA 1NOWA 3ARSA 4B15A 1XGZA 5D9OA 1H2JA 2VX4A 2QPSA 2WZEA 4FMVA 3A23A 1V02A 2E40A 2WVTA 1JXKA 4M24A 3VTRA 1V6WA 1EO5A 1C8XA 2EBNA 3CMGA 2YLAA 3EDEA 2F1AA 2BY1A 1WPCA 3WF1A 5BWFA 4S3KA 4F66A 2OSYA 3WUEA 5AC5A 3T08A 5AY7A 2UWFA 3N17A 3FAWA 4M81A 3VIPA 2D22A 3KL5A 3WY2A 3LRKA 1CGUA 4J3WA 1C91A 3DX3A 5A3HA 1GCYA 5IDIA 3WY3A 1DWIM 1QW9A 3CZSA 4GKLA 4HA1A 5CSUA 3M7SA 4U3AA 3EJTA 4J3UA 3D50A 2E4TA 2VC9A 3W6LA 1UKQA 1TA3B 4AEFA 5EB8A 1E55A 4AZCA 1HNYA 1ISVA 5A8MA 4F9DA 1QX1A 3VNYA 2AMGA 4QDMA 4W93A 3ZQ9A 1HIZA 1XH0A 1UHVA 1E0XA 4UFMA 1CGTA 1E6QM 3QHMA 5A69A 3WFLA 2XTKA 4GIAA 1LWJA 3CUJA 1JZ8A 1VEPA 1GQKA 3KE0A 1WDPA 4D6EA 7CGTA 3VD5A 5BXSA 3CUFA 5JBDA 4GXPA 1W1TA 5IXEA 1GONA 3T0AA 1Q6GA 4J28A 2DSKA 3GXPA 4HA3A 2EJ1A 2ZIDA 2OW6A 3WNMA 1K9FA 1JZ5A 1IZJA 2CBIA 3MV11 2QPUA 3BLKA 3EMCA 2VUYA 2X2JA 1FFQA 4PRWA 1JDDA 2CXGA 4UTFA 2YDRA 4E8CA 3EJSA 5M03A 2CNCA 1ZL1A 4MJ2A 4UQ9A 3K1DA 3CMJA 3IK2A 5IFTA 3HG5A 5LA2A 4AZIA 2VCAA 2VRKA 1NWRA 3PZMA 1CGVA 4JL1A 3VKKA 3TTQA 5CLTA 4QP0A 5I24A 4AZ6A 2O9RA 4HA4A 5FKYA 3D52A 5GNYA 2Y8VA 2GK1A 1JDCA 3APGA 3MUAA 3U7VA 3B9EA 2DDXA 1DTUA 4R5EA 1HP4A 2J79A 3PZIA 3VX0A 2CITA 5KZ6A 1B0IA 3NSMA 3GXDA 3VD3A 2D1ZA 1BG9A 4LXFA 1W1PA 4PMNA 1JDAA 1OSEA 2F1BA 2PWEA 3DDFA 1H0IA 1OGBA 3A6OA 1G5AA 4LYPA 4H04A 2VL4A 1JZ6A 1I1WA 1JD9A 2ZXAA 5C8BB 1HKIA 4OGZA 5A6KA 1E4NA 1R87A 4GINA 3PN8A 1YQ2A 4Z2JA 3ZOAA 4B3LA 1E0VA 1G01A 3L4TA 4H8HA 3GNRA 5D9NA 3EMQA 2ZXDA 1KWGA 3ZR5A 1E5NA 2GDVA 3MUIA 4AY1A 2J8FA 5JIWA 3L4VA 1QWUA 4OOZA 3LXAA 1DEDA 1J18A 4MJ4A 1V03A 3GH4A 5FCZA 5BRPA 2YL9A 1V0KA 2O92A 1KXQA 4EE9A 3BSHA 4F79A 3PHAA 4MPKA 1UWIA 1XH1A 1BTCA 4ACZB 2EABA 2W62A 2XGIA 1QHPA 1TA3A 2VNCA 4PSRA 1XYZA 4BZYA 1LG1A 2IXUA 1M01A 4Q7NA 5D9MA 5BRQA 1XH2A 2DH2A 3CLWA 3ZO9A 4BCEA 1JNEA 1EDTA 3AIRA 1FH8A 3TP4A 4LPCA 4P8UA 4JFVA 3BXWA 4HMDA 4PTMA 4DWSD 4OIFA 4PMZA 3AHVA 1V3LA 4JCMA 1K9DA 4J7RA 2ZX5A 3IJ9A 1PBGA 4CD6A 1LJYA 2VZTA 3AIWA 3MU7A 3AQUA 3PZ9A 1DWGM 1VFUA 3VILA 4GQRA 2VT0A 5A2BA 1UKSA 3N11A 1JFXA 3VIMA 3AMKA 3MUY1 1H4PA 1Q6EA 1WCGA 1ZU8A 1GPFA 3VM5A 5BYWA 3MS8A 4BQ4A 4JHOA 4D6FA 2ZICA 1ZBVA 3SUUA 3AICA 2VO5A 1RP8A 1EHAA 2E3ZA 1XSJA 1KGXA 3AYSA 5FIPA 2FGZA 4CN1A 4HPGA 4Z2IA 3IANA 2OWXA 2J7HA 3W81A 1QHZA 2G8ZA 4GO8A 4IPLA 1KFWA 4E8DA 5BCAA 4AMWA 1BQCA 3HG3A 1BYDA 3WNOA 3W28A 1JAEA 2J78A 2DT1A 3AXXA 3AFBA 2E0PA 4F8XA 4AZBA 3CGTA 3N12A 1JI1A 4F9JA 2EACA 3WD3A 1HXJA 1LF1A 3WIJA 3WN6A 5I3DA 1DWFM 8A3HA 2CHOA 4FK9A 4MDPA 3WQ8A 4HMEA 3A47A 1HVXA 1B30A 1AQHA 1ZBWA 2WXDM 1TQTA 1H0GA 1UWUA 1BLIA 3K4AA 2WB5A 4UFIA 5CPQA 5E0FA 1CYGA 3HU7A 3BC9A 1UA3A 2OYKA 2VZUA 2DPEA 2PBGA 4CGTA 1V3JA 3S6TA 3OA5A 1MW0A 1VENA 4JFTA 2XYLA 1CDGA 2CEQA 3LPFA 1H11A 1HL9A 3WF0A 4FLOA 1R7AA 4NSBA 2X2HA 1KCLA 3RPMA 3BMVA 3KL3A 4KMQA 3GH7A 2BHUA 2GUYA 1JYVA 1QI3A 1KTBA 1H09A 5I79A 3UCQA 4D72A 1UKTA 2J7DA 3ZR6A 1I75A 3SIMA 1PX4A 3LPPA 1G9HA 3I3DA 5D8WA 4ACZA 3EDFA 2JF7A 1UZ4A 1VB9A 2WVSA 3LPGA 2V3EA 2WMGA 2XN1A 3SCSA 1J9YA 5A8QA 4TTUA 4Q22A 1TQWA 2WMJA 2GJPA 1E56A 2XIBA 1B90A 4PMDA 3L4XA 1HKKA 2CKSA 1E3ZA 3VSTA 3S5ZA 3DYOA 3MSDA 3RMEA 3DX1A 1CTNA 4V2XA 4DWSC 3DX0A 1U33A 3EBVA 1AVAA 2IGTA 5I0DA 5A95A 2X09A 5A2CA 2WCGA 4AD5A 1FOBA 1G0CA 3AIQA 1MQPA 2Y8KA 4IISA 3W53A 5D4YA 2ZX7A 1VEOA 3IJ8A 2XVLA 2IXVA 2FH8A 7TAAA 2BHYA 3PTKA 1L8NA 2WBKA 3BAJA 1MWOA 1HJWA 4CVWA 2VCBA 3QHOA 3WUGA 2ESCA 4RE3A 2XWEA 4QLLA 1N82A 2X2IA 4JKLA 3BVVA 1E9LA 3A4AA 4UQDA 5A2AA 4YPJA 1XYFA 1WKYA 5E0CA 3GXMA 1LL7A 2EPOA 1Q6DA 2FHCA 1KQYA 1UOKA 1W32A 2VR5A 1JGIA 2DSUA 2AAAA 5DMYA 1QI4A 2CPUA 2YDQA 1W9BM 3SCQA 2JIWA 6TAAA 3WF4A 2D3NA 1R8LA 3D3AA 3CHFA 4YHGA 1KCKA 2WMHA 4MNLA 2ZX8A 1CIUA 1LL6A 4AD3A 1TUXA 4H41A 4PEEA 1LL4A 1BPLB 1GJWA 2W92A 4M29A 3G6LA 3CTTA 2D0HA 3A4XA 3N9KA 3VD7A 4AMXA 1JI2A 4NI3A 3VU2A 2WWCA 3PTQA 4IUGA 1Q6CA 3ZJ6A 4AEEA 2EXOA 3EJPA 2D0FA 1CXFA 1XSKA 1B31A 2XUCA 3CHEA 4KH2A 2VOTA 1E6ZA 3T0DA 3FHAA 4CN6A 1X1NA 4TXEA 3UEQA 3TV8A 1E72M 1CXIA 3GXTA 3ZT7A 1W9UA 3VSVA 3SEPA 1G94A 2VX5A 3FAXA 1W2VA 3L4YA 3KLKA 1TE1A 1VJZA 2J74A 4P7RA 5BXTA 4FLSA 2BVYA 3AIVA 3EDJA 5FL0A 3T09A 1GVYA 1FP9A 2G3NA 4DO5A 4W84A 2Z1KA 4P8WA 1VFMA 5ABHA 3WEZA 1OGGA 3PZGA 3CZGA 3VVGA 4PN2A 2WMKA 4AXNA 3DYPA 1O7DC 3SUTA 4ML4A 5E6YA 2D3LA 2E8ZA 3S5YA 3VGHA 3L4UA 2C0HA 3KEHA 1US3A 4PUDA 3T2OA 3RDKA 3AMGA 1KXHA 1E1EA 1QNSA 3M6DA 1XV8A 1JF6A 3WELA 1F4HA 2FDMA 2VX6A 4JKKA 2ZWZA 4PMRA 1OCQA 3WDHA 4W7VA 3RM4A 4W86A 1D2KA 1RPKA 2XJ7A 3WQVA 3PZVA 1VF8A 3DHUA 4GI6A 1QWNA 4AYGA 4KGLA 4UQEA 1EO7A 4OZOA 3VMNA 1M03A 3OGRA 1UR4A 3RJYA 6CGTA 1TVPA 4KRUA 4N42A 1E4MM 4DO4A 4DO6A 3SCPA 3PZNA 1C3FA 3U7BA 2E9MA 3ARWA 3UG5A 1YHTA 1GOWA 4NXSA 3F4VA 3WH7A 4AD1A 3TONA 1V0LA 1WDRA 3GNOA 2F7QA 4PTVA 5CJ5A 4PMUA 1MYRA 4PMVA 2EQDA 4D6CA 3W24A 3BCDA 1KGUA 1M04A 2W67A 1BYCA 1XCXA 1NP0A 1UD4A 3VD9A 1E5JA 2A3CA 5I23A 1UWTA 2ZWYA 2RGMA 4XX6A 5D9PA 4EK7A 1CGXA 1VAHA 3SUVA 1ZJBA
chains in the Genus database with same CATH superfamily
3MDWA 2C14A 1E0TA 5CEZE 1KPRB 2CZVA 3SJVD 3E0WA 4QRQB 4K15A 1LO4L 1IVTA 4X3ZA 4FQJL 5BZAA 5B22A 1HDMB 2COQA 3TYEA 4I6VA 2XM2A 3KAAA 1Z9OA 4O11A 3MLRL 1BKHA 2DVXA 5AOMA 4HLEA 1SJMA 3T77B 3K6DA 4YC2C 3GNMH 3A6CL 4N1EA 1UWRA 4H5SA 4P5MB 4GIOA 4NFDA 4NQDA 2LU7A 3M17A 2ZKMX 3BDXA 4J4KA 2PP1A 5M17A 3V1HA 4ODVH 2Z2BA 1EDQA 3ES8A 4K7FA 1YMMB 3OQ3B 1E2WA 5DT1H 4UNUA 3VFRA 3U4BH 4OBRA 1CZ1A 3BKMH 2AXJA 3U1PA 3UIYA 2L04A 3VMOA 1T0OA 3C3NA 3N91A 1JZ4A 3VG9B 2R83A 4AQEA 2MQCA 3MV8A 3AHZA 4RBPK 2QR0B 1PFCA 1HHGB 5DRXB 3GIZH 5F1SA 1XF5A 3JWDH 1QNRA 2XWRA 3AI0A 3BLPX 1ITXA 4UMSA 2OZ4H 4IU2B 3TF4A 3U4AA 1X5XA 4DNMA 3EJYD 3BGMB 3O6LH 2VUOA 5I2IB 3QEHA 3A3HA 1NCDL 5TJWK 1XO8A 3KRBA 4JFDD 5DX7A 5CD5D 3OP2A 4BQ2A 3KBNA 3EA1A 3RZCA 5I6SA 3ZR4A 2OW7A 2X2GA 3VXQB 5I8OH 1QYGL 4JE4B 3VU1A 3D39B 4CAGA 3QQ4B 1W0MA 4PRNB 1OM9A 1S4IA 1T40A 2J9ZA 5DMIH 3H54A 5HJ3B 3PPGA 1BF8A 1XCTA 3CD4A 2HXTA 5I17B 3RAOA 5XINA 1WDDA 1U2CA 1F58L 1GYAA 5I18L 1P5VA 4XVOA 3OHXB 2FIRT 3CC5B 4QHNA 4YHYB 2R56L 2CRIA 4UXDA 1DL7H 2W9MA 1EWHA 4U1GC 3KBFA 2XWZA 5C0CB 3IE4A 5I0XA 1GQLA 1WGVA 3QV8A 2Q7AA 4X7TA 2E6AA 5HD8C 3RFAA 3MRNA 4KRTA 1CDUA 2OMVA 2XHNA 3AO0A 1L9PA 4ZSOE 1OP4A 4Q8NA 4A7VA 3WD5L 5BRZA 3DXAB 5K39B 1BPVA 1U3HA 4LKCA 2X9YA 2V5RA 2CLMA 4R33A 3K6NA 4CD5A 4G43A 3B9KB 3U2OA 1WDQA 1KCUH 1OZMA 4OGYL 3P4LA 3TWBA 3VXME 4WEMB 2HROA 5FX3A 4JHZA 1K4CB 4FO4A 1J5HA 3HV9A 1SMDA 1TZIB 3FFOA 3NO1A 3VNJA 2F74A 2WKLA 4MJ5B 3VKAA 4JYFA 4JCWA 2VR9A 3GBML 2W0FB 5DFTA 1NFDE 2YBGA 3DNKA 2ZBTA 3V4PH 1WOBA 3JWDC 5KBPA 1KFGA 2R0KH 2JCCB 1Q7MA 1JZ2A 3PJSB 3QJUB 3U9UA 5MHSD 3KH3A 5HHQB 4H1ZA 3IJSA 4CU8A 3NZ8B 2ATKA 1UUQA 2J8UE 3B5GA 1CE6A 5CN3A 3VI4E 4HVXA 3DO4A 4DP6X 5C0EA 1XGYL 2CBVA 5CZKA 1BVNP 8FABA 5BVPH 4E68A 4GI4A 3V0GA 2Y2TA 3OKKA 5DJDB 1MI5E 1D9EA 2P8BA 1XLLA 3G1RA 2RFGA 5L88H 5FCUH 5J6HA 2R59A 1QPNA 1OTSC 5FB8B 3UJIL 3WLRA 1X39A 1IBBA 3W83A 5A94A 7REQB 4N2NA 2PCYA 4L4TE 1CBGA 3HB3B 2XVKA 4D71A 1NQBA 3UC2A 5EBLA 4K3EL 3H9SD 3ZZSA 3OYZA 3FUNA 5BQ7B 1UD5A 3OJ2C 1IEIA 4NZFA 2W3ZA 4HEMA 1YN7B 3RWJB 4GPNA 2XWJB 4C5ZA 4TUJA 3HZMB 4GZIA 5D96C 1BREA 3AY2A 1CLYH 2TRYA 2A83A 3WE6B 1LE5A 2BS9A 2WQAA 2DQCH 5AHLA 4N8CH 4MKTA 3FTUA 1CXLA 2RJHA 4Z6AT 4AJWA 2R94A 1Z44A 3TE9A 5HMSA 4KHXL 2XY2A 1N8WA 4QDWA 4N9GB 1A1NB 3KPOB 3ARBB 2IG2H 4UQBA 1TSIA 1PBYA 1Q0XH 4L6OA 2BY0A 2E9BA 2KBGA 4UANA 3P2VA 2R9HC 3PZQA 1IFRA 3CHQA 5FYJE 2DWTA 3PNWB 4EJ1C 3G5WA 3GRWH 2V2WA 5FJIA 1ORSB 1XPGA 5JW4Q 4NJGA 4LDCA 5CINL 3RX8A 4BZ2L 2WHLA 1ZXKA 3F7JA 3S3PA 1ZOXA 4X4MA 1ZK5A 2WPBA 3K6FA 3FQ4A 1JWSB 5JW5A 1HJVA 1ADQH 3AABA 2O5NA 1BG4A 1S7WA 4W9LC 1FP8A 5F7NC 2PRLA 4YCOA 1TR1A 1BFOA 4Z7OB 5JHLH 4YDJA 3DUUB 2NW3B 1YMYA 1KCVH 4XCNB 2LW3A 4TVCA 1A7BA 1NH6A 3ERXA 1EBHA 1FF5A 3U0PA 2PCFA 1MUWA 3VWJB 1PG7W 4UMGA 1IBFA 3FTSA 5CQ1A 2UV3A 2JKAA 4FLQA 3OVGA 1H3TA 4MYWB 3APYA 1VFAA 3TCTA 4TX8A 1O7AA 4WO4C 2V81A 4Q9RL 5AVQB 3TIMA 5HHNB 2R82A 2VDPH 3QUYB 4ATWA 1SPQA 1ECEA 3IIPA 5HHXL 5A6BD 1J1PH 4MCZA 5D04C 3C6SB 1UD6A 1KV7A 3HQ1A 1REQA 1YEGL 5JZ7C 1J1OH 4FYQA 2YPKA 1ZCOA 4YHLL 4UTAA 3BEWB 3QUXB 4NN7C 4Q8OA 5DVMA 3EO0A 2RDXA 4CVZA 2E1DA 4D8PA 3TW9A 4AWEA 5AW7B 3R43A 1OW0A 2IPTL 1G5GA 3DENA 1EL3A 3WEBA 4HMNA 2NY1B 3VABA 4XP6H 3WK1A 1EZLA 3FN3A 1TPH1 3OIHA 5IR1B 4PC8A 3VJ6A 3UTOA 2OCCB 3V0WH 3D3VA 4LHJB 5A7BA 4ZUUB 3WAJA 3AZUA 2DV0A 4RNJA 3CPLB 1IQ8A 1I31A 4X6CE 4G9PA 4S11A 2Y62A 1BMWA 1AR1D 4ZMQA 2C9QA 3LQAL 3QRLA 2WHJA 1ADDA 1GOFA 4CN4A 1MWAL 3KOZA 4NP9A 3CWOX 2JH2A 4X5XA 5LDSA 4HISA 1UC6A 4C59B 3CXHK 4BQCA 1CECA 2YW3A 1FFTB 5AHFA 1F6KA 2DPKA 1OIMA 3HC0A 5HYSB 4B53A 4C6CA 2E6YA 4HJJH 4AYBA 3GQFA 3NIDF 3NABH 1WBXB 1E27A 5GSVA 3VXUB 3BJTA 3MOAL 3N41F 1ZLWK 1Z7JA 5ECVA 3CN2A 2VQUA 3GLAA 3L12A 3HRZB 5DF0A 2J7GA 4ICMA 4XHJC 2IQ9H 3RP1A 5F8RC 3AOFA 3ZRSA 2UZYB 5K9XA 3V9FA 5DRIA 4FTVE 4G9DA 1KBPA 1GGIH 4S3DA 5BOPA 2GVJA 1RD6A 2C9SA 4GYJA 1X9RA 4AX7A 1FVDA 4ZFZB 2RACA 3BVNA 5EF3A 1TPB1 2ZRVA 5HOSA 3N3MA 5EEWA 2WCAA 4OBSA 5C7XH 3L5WB 3WSQH 2EDJA 2IOMA 5BOOA 4E3TA 1RZ8B 5IM7A 4DP5X 2WXLA 4JS3A 1FBIL 4MAVA 3Q67A 3NG5A 4GY4A 3KHDA 5D2LA 1RUQL 4MMZA 3G1HA 2BZNA 2H2SD 1V8HA 3WXVH 2AXFA 3QNZA 1W72H 1KN4H 4LAQH 4PG2C 4HIJB 3NIYA 4IRZL 4FIRA 3VI3A 1X9QA 4B3VA 4N6EA 3V7AE 4ORGB 1BBJB 1M57B 1HAUA 3G0XA 4LEQA 4X9GA 5E6IC 1PKMA 2R6OA 3ECUA 4MD4A 3IRDA 2HRPH 4P2AA 1EMTH 1BZ7B 1NOLA 1Q9KB 7PCYA 2X1PA 3N3TA 4PRDA 4PGJA 2CLEA 5H35A 3Q6GL 3V4LA 4Z7AA 4GO6B 1YDNA 2NX1A 2OMXB 1OTUC 4QE5A 4FKKA 1JPGB 4XE5B 2NQZA 3UO8B 1LO5B 4HIHA 1IM3A 4RCXA 3NSDA 9XIAA 1FNEB 2E9JA 1OL0A 1BEYH 4NM8H 5BROA 1EGZA 2DWEA 3O2LA 4PJCA 2A1WH 4RQQB 4EN3D 4D0BA 4PMQA 1PLCA 5HHOE 2F38A 2YARA 3OKMA 3VIHA 2BK8A 4B6ZA 3V8OA 3D85A 3UZVB 1X5ZA 3EDKA 5DQJB 3S37L 1TREA 4PJEF 4JJHA 2D2HA 4X8JA 1FH5L 3KYNB 1AQDB 4F2FA 2WC4A 3CBKB 3TLRA 4W9TA 2YD3A 4P48A 1KCBA 2AF2A 1KV3A 4G9FE 2YZ8A 5AYUL 1P84J 4XTDA 3NFPB 4U1MB 1J10A 3H3BC 1O6TA 4MXQC 3APFA 2A73A 4ECLA 5GJSL 4DP8X 4NZ4A 1GZHA 4JO5A 1GJIA 1J8HA 4ZMVA 1H9DA 2Z93A 5IVZB 2HJLA 4PJ7E 3C09C 3NG3A 1CLCA 2GOKA 4WWKA 1H2JA 1PS9A 2E40A 3O2WH 4H9MA 1C8XA 2DI8A 5DJ0B 4KEZA 1NUNB 1EJUC 4IXHA 5D7JB 5IB1A 1HCFX 1TJ2A 3EFDL 1ZLDA 3GC4A 4F66A 2GQAA 4L4VE 4Y16A 1IGML 1U8MA 1PGRB 1I3RA 1XGDA 5IDIA 2EKSB 1OGAA 4GKLA 2EEFA 4XB7A 3W11D 2X7WA 5CBEA 2APVA 3HUJA 2JKSA 1XAUA 4RA0C 4XAZA 1C9DA 4NIYE 3MYJA 4RDBA 5C8JB 5A8MA 3NJXA 4HFWA 4WU5B 1HIZA 3A5FA 1RFDH 4ADIA 3R4RA 3BDKA 2R29L 2VM9A 4JFED 3BV7A 3N1FC 4QJ4B 3D2UB 3G3LA 3WHE1 1X38A 4J28A 3ITTA 4AWSA 4G7EA 4KKXA 1IZJA 3BLKA 3DLQR 1EEXA 3NIGB 3VXSD 2INEA 3NSYA 4UQ9A 3HNSH 1MJ8L 1AO7D 3HS0C 4JZNA 2VRKA 4Z95H 4JL1A 1MJJA 3FUDA 3MV7D 1GZGA 3FFDB 3SDYL 5FKYA 2C3HA 4DSYA 3B9EA 2ACUA 3U4EA 3SDAD 1DTUA 1HKLL 2GK0B 3IRPX 2J79A 2OZNA 4POYA 4BH8B 2Y5SA 1P0NA 4JBSA 5FAJA 1XUZA 1U5VA 1UZDA 3IFPB 5LBSL 4LYPA 1JD9A 3M43A 3M44A 4NQCE 2A9DA 3NYZA 3TO4B 1QABA 1X5JA 3GVGA 1ZLPA 2NV1A 5LLIC 2GDVA 3CSTA 1TEFA 3AG1B 4AY1A 3WLMA 3P4NA 2ERJC 3QSTA 5KYWA 4HZLB 4DZAA 3DHJA 4JG1H 4L8DA 4XISA 4G8IA 4YZFE 1IIKA 1T5WA 4BQBA 2VXQH 1R3LA 1IKFL 4AY8A 4H4IA 2ARJQ 2BVPB 3CLWA 4TQ8A 4JFOB 4YLCA 3L3OB 4CNIA 4WV1C 1Z5LA 1CYWA 3C75A 1XDJA 3VXRB 2IALA 4WWNA 1K9DA 4PFHA 3NQ7A 4GQGA 3MTWA 3TJEH 1MZHA 2ZCHH 2EILB 1LNUB 1VFUA 2VT0A 8TIMA 1KACB 1EC8A 3MUY1 2PPDA 3EAKA 1JVOA 3OVRA 2ADJA 3PUGA 1T1WA 3KWWB 3IMSA 3SQRA 4LHUD 1XTMA 3B5HA 2F5AL 5CJQH 4W9CC 1ZLSH 5D1QA 4X6DE 3CL6A 2EHHA 4UZGA 3DOIA 3W81A 4XD6A 3GXUB 4IPLA 4ZOAA 2BOCA 1CTOA 4AV4A 2R69A 2PC4A 1JERA 2I9LA 4RZ6A 2YJLA 2GVEA 3WD3A 4L8SC 2QUNA 3WIJA 4IIHA 2R1KA 5JPMB 1AANA 3C5ZB 4H0IA 1LUCA 4R97C 1SFDA 2GQHA 4DGUA 2DU2A 1I2NA 3EA3A 3JVGC 1AJZA 2NXGA 4Q56A 3L9RA 3I50L 2GK2A 4KQ0A 5CEXA 2XT1B 4BKTC 4JPIA 1QTPA 3QIBC 2CBPA 1A4JB 1ERNA 4UV7L 3TA4D 4H9UA 2I5YL 3EPMA 2CEQA 1GKOA 1OV8A 4Z3IA 1GGBH 3TYFA 4MD5A 3FU3A 4TPRH 1DN2A 1DIKA 4GG9A 4ZUSB 1PX4A 3LPPA 4JIHA 1IAKA 4E9VA 4U1KB 3DI3B 4D2JA 1QHQA 3LY6A 5IK3A 3Q1EA 5IB5B 1OCJA 3HNTL 4WWID 1OCCB 4FQXC 1JE6A 2E7CA 3QISA 5DS2A 3S83A 4PJ8A 3NPWA 1FVCA 5EZPA 3NJKA 2G75A 3QG6A 2XVLA 2UXTA 1YUHA 4E42A 4GVFA 1MQKH 1UUMA 1H6FA 2GPZA 4ZZKA 3HR6A 2VLJE 2CUHA 3CN1A 5CZJA 3TN0B 4MCNA 3KVQA 5ILTL 5C0AA 5K9QG 2CPUA 3PAYA 1IHIA 4DEFA 1U8NB 3VNMA 3IDGA 4Q7BA 2HJKB 3TBSA 5C0JA 1LL4A 2D0HA 2J24A 3UCDA 2DZTA 4R5VA 3STZB 3VKBA 3LGEA 4GBUA 4WDTA 4NZ5A 1MVFA 4RV3A 3O4OC 1UM4L 3DVFA 4U6HA 5FK9A 1BD2D 3VFOA 4W84A 3HV8A 4IGSA 4N2YA 3NJHA 3UYPB 4IX2A 2J55A 3CCHA 4I9JA 5A8GA 2LAAA 2IIJA 4GXWA 1WTGT 4O54A 2QGDA 3QEUA 4YHIB 2XH2A 4Y9BA 4O02L 1W1A1 2DKMA 4PUDA 3RDKA 3AMGA 3I9GL 5GJMA 1QNSA 1EFXB 3TEYA 1JF6A 1OFAA 4F57H 1BX2A 1ZZMA 2D69A 2LAGB 2XTJB 2CKBA 5JHAA 4B91A 4XODA 4YDKH 1RLWA 1RPUA 5HI4D 4NP7A 2QHRL 1JXFA 1X44A 3VMNA 5I1JH 4GUQA 5I1DA 5T3ZD 1UR4A 1E5YA 3VB9A 4YFLF 1WBYA 4TR9A 5JIIA 1MDRA 4MAYD 4M3HA 4EVNA 2H47C 4ERGA 1MHHB 4M7ZB 4ZW8A 3KX6A 1R1CA 2B39A 4FMKA 4BA8A 3F7QA 4Y1AD 3ARFC 4PMUA 4ZRGA 3QDGB 2DORA 4QIUA 3AQZA 2RAGA 1CDYA 4OZGB 2IDUA 1LORA 5ICYB 1OK4A 2E6JA 1U22A 4KCUA 1C1EL 2Z35B 1MIML 2FT6A 2WV3A 4KIRA 1QFWL 4HN4A 3TH4T 1SHSA 4DERA 4S0SD 2Z31A 4W6YB 3VFWA 1R5VA 4HUXB 2VTFA 1WHPA 2E7DA 3O3AA 1BGGA 4JN6A 1FPTL 4KKQA 3ARGD 5KZEA 4QAIA 1DLHA 3AS3A 3PJTA 1V3IA 1FWGC 4S2BA 1VH7A 2TYSA 2A38A 3AIUA 3WNIA 3RU6A 4PCTA 3P3UA 2QR6A 1ZT4B 1CFQA 4IIBA 1RUMH 5GRWA 4BWUA 1MUJB 4CVXA 1UJ3A 1JPSH 1V7YA 1TZHB 1FHVA 1SLXA 5E99H 2YD6A 1SLWA 3KVPA 4K73A 4OD2B 2EYTB 5FOOA 1YNLL 1CI1A 4KMTL 3GXNA 1GKEA 5I5IA 3OPUA 4AQ1A 2X4QB 3EZ4A 3GJFA 3HG1B 2VVNA 1LQAA 3PGFL 3KVDD 3I9PA 3U9IA 1CQYA 4J1UB 2FIKB 2YEZB 1HHKA 4QG6A 2H3NA 2OVLA 3QNYB 4K6AA 4XCFH 5EO1A 1N67A 3CEUA 2I85A 4LEOB 1NAKH 3PWIA 5IOKA 3P7YA 3JZ7A 4OZHE 3C6LB 4G6ML 5KAQF 5KVFE 1NCBH 2Z91A 5G2NA 4UM9B 3HCVB 4MJID 5IV2B 3A4JA 5ACMA 1LWHA 1NQKA 2Q7YA 3WKPA 5L6YH 1BYNA 2J47A 1GY1A 4X61A 5DMGC 5DJ8B 2BNUA 5E8PA 3BZDA 2G97A 1JZIA 3OR7B 4FXLA 3GSXA 1FWFC 1REIA 4P4RB 4G6CA 2WYZA 3GF8A 4AEOA 1ZGLP 2W5PA 3SCWA 2QCGA 4LSBA 4PL2A 1YEIH 4R4FH 2WC3A 3FVDA 1U8KA 1LK2A 5D5MB 3W87A 4BD4A 5EFFA 1WAWA 2AQVA 1OARL 1BLNA 1TSRA 2NY3C 4QGTA 5GS0C 3MBEB 1WFIA 4DWSA 2WZHA 3ESVF 2QS8A 4HKBA 4JGUA 3SDDD 2P8MB 4IBQA 4YSDA 5EY5A 3O45B 4FQJH 3MRBA 3QUMA 3MLRH 5EFDA 4OTXL 2CR0A 4B5ZA 3I10A 2PWFA 1G9EA 4NNCA 3RFZB 4G80A 4WDUA 2P43B 4F3FA 3WLOA 3RVUC 3UYRL 2PO6B 3KNBB 5EZLA 5E4EB 3LA4A 1M7IB 2P88A 2X4SA 3MNZA 4WNQB 1INDL 2CZDA 4E4UA 1HVQA 5B1CA 5I3FA 4ONFH 1XG3A 3D51A 1UXLA 2Q8ZA 3FONA 1Q9LB 4KWUA 3RWCB 1O5XA 3F12A 4Q6YA 2VKWA 2K8MA 1F6FB 3D69A 2Q0ZX 3KLAB 1AK5A 4TTGA 3PXJA 3UAJD 3UTTE 4AZGA 4G3YH 4PR5B 3FQYA 1I2RA 1ZIAA 3U79A 3WQCA 3H3PL 1IE5A 4FOJA 4J3OG 5KTLA 5JUEL 1SN2A 4V1DE 5C7ZA 1CLKA 2NQ5A 3HO8A 4F2ME 1JQVA 4ABVA 4Q4MA 3RWGA 3PWPB 3LG3A 5F2GA 1SM9A 4HOXA 1NCDH 4RISL 2AJ3A 1DJZA 4IHBA 3MBDA 5ESAB 1SJHB 3MSGA 1GR7A 5ID1A 2QL1A 4MNQA 1HJXA 5BNXD 1EUUA 2DTML 2J6WA 4XAKE 3CQPA 1QYGH 2XH0A 4RBPH 3BAYA 3C60A 4XTIA 3UJTH 1MEIA 1V0NA 1CFBA 4ONGL 1RZFL 3R1GL 1Q94A 3FB8A 3DYMA 1JDEA 3MLYH 1EEQA 3PUCA 2H41A 1O7SA 1EJ7L 3GU2A 5F70A 3IGLA 4RGNE 3DFPA 1FDLL 3DERA 3U36A 2DIKA 5LUMA 2GKIA 1V3MA 5GGTL 5C08D 4JQ1A 3MUJA 2VDMB 3GIPA 1N7ML 2WV8A 1Q9OB 1CLVA 2O93L 3OLEA 3AXLB 3MNWB 3DX9A 3BW9A 1PJ9A 4N2OA 1WZMA 3MV9B 2XZQL 5BVJA 4FXJA 4OLWL 7A3HA 3OB8A 4RGMC 5D8ZA 4Y2DC 1DE5A 1BWKA 1VCBC 3KPPB 4D0CB 3PP7A 3WD5H 4C60A 4Y19E 4M02A 5GRJL 5IFHL 5FV1L 3W26A 1ISXA 1MF2L 4GIRA 3DSNA 2QDDA 1A9EA 4EAEA 1QEXA 1R30A 2J77A 3B03A 3TQPA 1E9IA 4EBQL 5DYOB 4P5KB 1Z5HA 4PJDF 4PJAF 3GGWA 2EVHA 1RZGB 1ITUA 3OAYH 2HKFL 2Z24A 5I66A 1MEWA 1JXGA 2A3LA 4IRSB 3MYPA 4U1IA 3LAFA 4AC2A 5CG0A 1JWMB 2J88L 1H7PA 4X4ZA 1AKJD 5AOZA 5E8NB 2PYEE 4Q9BA 3FBKA 2VC2H 1OFBA 1ZE3C 1M9WA 3Q8EA 3ZE2B 2GBTA 1PZ2A 3L3DA 2BVQA 5DVLA 2QHLA 5K93A 4JPGA 2W4XA 3FQ2A 1UMYA 1XGYH 4PCNA 5I1HL 3FO1A 4XC1L 1MCWW 3FCUB 4RGOL 7ENLA 1PSKH 4QXGL 1C90A 2HE8A 4GX8A 2QV4A 3TZVC 4JQIA 1FZKA 5KSWA 4WK2B 1EEZA 5I5JA 3VFMB 3H3KA 1VLWA 2CW6A 1OSPH 3T7VA 2LFEA 4LQ1A 3L3IB 4GVGA 4XN5A 4TMCA 1DVFA 3BGGA 4M0XA 1IEXA 4MQ7A 3OF6D 2WN2A 3L3KB 3S3JA 2P5PA 4DESA 5DXXA 3ML9A 4FNSA 3HMWL 3U0TB 1EHXA 3BZ5A 5F7KC 5T1LD 1XICA 1BP3B 3MRMB 5DJCA 3H9HA 1N59B 4A2LA 3PDGA 2POZA 2OMZB 3QAQA 3UWWA 2GC4C 1J5IA 2DQHH 3QNXA 3O6KL 3KBEA 3R0MA 3VNDA 3G3DA 3NOYA 3RVVD 3WF3A 3KWSA 1ZA3B 5AOJA 1DSWA 3WY1A 4NQVB 1UP2A 1INQB 4HU8A 4FR6A 3T0ED 1Z42A 1VA9A 4AGNA 3ZXAC 4RFEA 1KNOB 1EQWA 3SPHA 4AU0A 2UXGA 1KELL 3D5OF 2P28B 1JZ3A 4FZ8L 3IFNH 1TG7A 2GTQA 1LRQA 3MNDA 5KUKA 1UR1A 5D1XB 1XI3A 4Z2GA 4MF4A 5T91A 1IXOA 2YZ1A 4XV0A 3VVVA 3AXIA 1ETB1 4G71B 3IVKA 4PRAB 3DX4A 1KFJA 4MNHB 4FG6C 1C92A 3SE4A 2YCEA 3I2CH 3VQMA 4Y4FD 3F2DA 3LNEA 4HWZB 4B7IA 3CDCA 4BZ2H 1E5AA 1U8OB 2YOCA 2JQXA 5EH1A 3CVHA 1VKXB 3NYKA 3GY1A 5LXXA 3TC7A 4CSPA 3ULUD 3TBVA 3R89A 1IBZA 3NSFA 1EFZA 3PF3A 4TU1A 3AB0B 1PQZA 1WAAF 2I9TB 5JLZB 4XP5H 5IVXF 1YPXA 2HT3D 1IM9D 4UTBL 1CN4A 4WGXA 1QRKA 5D9SB 2I60L 3KAOA 4AE0A 2Y24A 5JA8B 1UG9A 4HBCL 5BZDA 4Q52A 3PJXA 1SHXA 3UERA 1KTRL 3TVMD 1R3VA 3NM3A 4ICNA 3FXYA 4Q2ZA 5TBOA 5T3XE 5BWAA 2H0FA 2V0AA 5G5IA 5HGAB 3TO2B 4R2GB 1PZ0A 2GY7B 1E30A 2XGBA 2HLFC 2XA3A 4BHUI 3QYCA 1CCZA 4DM2A 3QDJA 5I1GH 2Z3FA 3RPDA 4ICWA 1AS6A 3AGVA 1KC5L 3BT0A 4QQUA 4MDJB 3RO8A 3GSWA 4IGBA 3BKCL 1D9KB 3HIJA 3WD1A 2VX7A 1J2BA 2GSIB 2OM5A 3IU3B 3W25A 1X5LA 2YD9A 1RH9A 3LS9A 5ISZE 1OFEA 3QXAB 5G1TA 4WJXA 4YHLH 4DQOL 4XI5C 3RIKA 2LTQB 4MY8A 5BNKA 1T5KA 4YJZL 2J56A 4KK5D 3EGJA 2VDKB 4HJ0C 1RJZA 3M0ZA 2BSRB 2IPTH 2ITCA 1E28B 4F15B 5CPLA 4PRIB 2Q09A 5B7ZA 1QLRA 5ABDE 3P3YA 4H7CA 4NO0B 4NAMA 5AOLA 3TROA 1A5BA 1J0ZA 2YPVA 4UTWC 1ILSA 4ZE5A 2OV0A 1HKJA 3STBA 3KS6A 5A5WA 1NDMA 1OD8A 3G18A 3HBQA 4U1NB 1UZHA 3G6JB 3SGKA 4G8FA 1OWRM 2ZZ2A 3V5HA 4QXUL 3L1OL 1V3KA 4FLRA 4L4OA 5D72L 4LYKA 1QKZL 1MWAH 1TU2A 4OZIB 3FIGA 1N10A 3IKCB 2ZUYA 4HHHA 1SYVB 2Y9RT 5F7UA 4Z2KA 4Z1CA 2CIPA 3SN6N 2O0TA 5IHLB 1A9VA 4DP4X 3T8LA 3QDMB 1MFDL 1JYXA 2WTRB 4FRWA 3K1KC 3ILEA 1EJTC 1FL5B 2GQ3A 3G1FA 1I1YB 5F4WA 4K5LA 3HQNA 1GVEA 2WBGA 3L5MA 3T3MB 4EXQA 2WBJD 3CZJA 2WNZA 1WZKA 4GSDH 2ZRWA 5TQ2H 4ZJ9A 4CMHB 4JAMA 4IPPA 2WVTA 1BVKB 1GYUA 4TMPA 3MBXL 2YLAA 1CURA 1TV8A 2HUHA 4RMVA 2PD9A 3KL5A 3UJJL 3DWTA 2Y5JA 2WXRA 1C91A 3GC2A 4NNXA 1UFGA 2C71A 2WXGA 3M7SA 1KJ2L 1KIPB 4YSAA 2CUAA 1T0NB 4AH2B 4BUHA 3GRIA 4AEFA 3UFYA 3DUSB 4LL1A 2PZNA 2YUVA 5E2WL 1XR2A 3LD8B 4Y5YB 4MDIB 2VQ4A 3BQUD 3QUZB 3T0WA 2R27A 1A5CA 3ZGHA 3N42B 5ICZA 1NGZB 3UG8A 1NJ9A 4GXFA 1W1TA 4R8WH 5IFJA 1Q6GA 4QSHA 2OELA 1KKRA 4ZMZA 4TTDC 4GKZB 3RTQA 1XAKA 2PN5A 1ZHLB 2AEQL 4XWOC 5FYKL 2OL3L 3LN4A 3O15A 3RKPA 3L0KA 1WLHA 2OK0L 1S8DB 2IO5A 2OTPA 3Q6GH 2FO4A 1HKFA 3B6SA 1PLAA 5CLTA 3RGVC 4FX6M 1MCDA 3VCRA 3LQAC 2CGRL 1AQFA 2QAFA 3GMMB 5HI5D 1CTMA 3NSMA 2H32B 3IDYC 1JDAA 1V51A 3DDFA 3T65A 1VD6A 1KULA 2YD4A 4U10A 1R87A 1F74A 4GHRA 2OO0A 4PULA 4ZMWA 4FG2A 3KBMA 2XG5B 4JRYA 2J1ZA 5IHHA 3MLWL 2NTFB 2VDOH 5CC5A 4S1SL 1JK9B 5KANG 3S37H 4URKA 1L0XA 3VYNA 3PPCA 1JMXA 4OOZA 3LXAA 1FH5H 1GPOH 4Y9CA 5JNYB 1KB9J 4UINL 1GMEA 3Q65A 3SKMA 4QRPE 5AYUH 2XGIA 1F3JA 2E7MA 4GYPA 2RIKA 2ZYIA 3E9TA 4XPGL 1TV3A 4BZYA 5GJSH 5MENA 2KX9A 4XO3A 3H6OA 2VCOA 1PLGL 4JFVA 3WJLA 3BXWA 2KZWA 2E9IA 4OIFA 2V4LA 3FFCA 3LNIA 4J7RA 1A53A 1YMMD 4JFFB 3FOLB 3RKDC 4JFXB 1EGMA 1RZJL 1Q6EA 3TNOA 2FIQA 2G2RA 4R4BB 3ISYA 2BIHA 2BSED 3F6IA 1KGXA 1NY1A 1AQ8A 4PLJC 2B2XH 4XR8C 3R0NA 4Z2IA 2X4NA 3LQMA 4GO8A 5BCAA 1L2QA 2PDJA 3AFBA 3QWQB 1KZQA 1ZVSA 2WD0A 3DHFA 2WLNA 3AYTA 3SE6A 4L8BB 5I76B 4MLJA 4H8PA 2EC8A 4RWYL 2R29H 3NXFA 3OG6B 1SJVA 4P3CL 4HPJA 1MIEH 2FMOA 1TQTA 1FCGA 1MZZA 1BLIA 3OAYK 1NFGA 1FI8C 4M48L 3BP4B 3BIAX 1AP2B 3D39D 4YXLH 3LD5A 3NDOA 2DPEA 2PBGA 1V3JA 3E5BA 1U3YA 2Y25A 1XLEA 2KAUC 4RA3A 5ERWA 3MFFB 3VNIA 3TASA 3MY9A 2E5EA 1UKTA 3F04A 1A6WL 1S2AA 3N6YA 2DI9A 3ZKMD 1EBPA 1H61A 1SVDA 1EPVA 1ZWIA 5I6OA 3NEVA 2RFXB 4XVTL 5LBSH 5C0CD 5MERA 3W7MA 4QROA 2Q3ZA 1D5MA 3DX1A 1S7VB 3EBVA 1UWXK 4DP2X 1JPFB 4OU3A 1NANH 1FOBA 1G0CA 1T89A 3US1A 5D4YA 3DXAD 4AQAA 3GSMA 7TAAA 2DJSA 2FUQA 3B9KD 2ESCA 3VFUB 1N82A 2B81A 4LLMA 1VRDA 4PD4K 2ASHA 3A4AA 6FABL 4CBZA 1QLFA 3CQHA 1MFCH 1PY0A 4N2CA 4MLIA 4GKNB 3Q48A 4WFGD 1ZJIA 3BUTA 4YHGA 1RQEA 4MNLA 4F7PA 5I73B 1W0VB 4PRBB 1SRDA 4I5XA 1BPLB 2VEPA 3MAWA 3TYBA 3HAEH 4L48A 5KS9A 1F0LA 4MASA 1R5YA 1XSKA 2LGNA 1JHTA 2XUCA 1SQ2N 1KM1A 3O3RA 4I88A 3E2SA 4ZZ9A 3IPWA 3IV8A 3MJMA 1VJZA 1OHLA 2F5AH 3SKUD 3Q01A 2Z1KA 4P8WA 3B2XA 3CH0A 4H5SB 4PN2A 4NQDB 3TFCA 1XL4A 3M17B 4ML4A 1ROWA 3FB5A 3WLWC 1P9MC 4AJ0A 1E1EA 5DD5L 1FWWA 1UXMA 3VFRB 4I7VA 2BX5A 3I50H 4UQEA 3RJDA 3KPSE 3GDLA 6CGTA 2PTXA 2W1NA 4YH6A 3L95A 1LO2L 5B80A 4AQEB 5D1ZC 3MV8B 1I8AA 4TV3A 3SGEI 3UG5A 1XF5B 5GJTH 3FJTA 4M3JA 3HB3D 2P3EA 5D38A 3BVDB 2VMDA 4IIZA 5BRBA 1CLZH 4TNEA 3QEHB 2A6NA 4NO5B 4C54A 5G1MA 3WMLA 1X7TA 3HNTH 3RWIA 4LCWB 3RZCB 2BRQA 3GTNA 3H8NA 1ECQA 2ZZ6A 2HZHA 5DSCB 2DEYX 1XCTB 1QFHA 5KG9A 1F13A 1CENA 1X7SA 4YSEA 1QLEH 2DWDA 2XWDA 4WIQA 4R9OA 1P5VB 1JEZA 1M9HA 3ARBD 3OBAA 5ILTH 3FSAA 4LDOB 2WZTA 4QHNB 3HBZA 5L2JA 4AM0B 3TBWA 5HR7A 1B3VA 2YL5A 5JIPA 5I71C 3N14A 1O60A 2ADAA 1TNNA 3BUQA 1SSGA 4Z7UE 2Z0UA 1AQ0A 2D7QA 1ID2A 2OMVB 1ZP4A 2F54E 3SZ8A 3VYLA 3WDRA 4C6JA 3IYLW 5BRZB 2CO2A 4IPNB 1U3HB 3S8FB 4LKCB 3SE8H 3LJ3A 4G43B 1VF5C 5LN8A 3GMPA 1M71A 1UM4H 2RB8A 1DQJB 2WM0A 1JIBA 2XVPA 3SSJA 5K5YA 3RCNA 4RAVB 2YBRA 1S7QA 2YZRA 2P42B 3C9NA 3M86A 4P9HL 1CD9B 3O6AA 1UWSA 1H3VA 3UNDA 1GVIA 1PTGA 3VXMA 1E2VA 5E5LA 4GUHA 5CCKH 4FKEA 3VWJD 3I9GH 3QO1A 4K8RD 4HU0A 2F74B 3QJRB 1JGLH 2OYMA 3SUSA 1MCIA 3AUOA 2QHRH 2VW6A 3P73A 3L9EA 2XQBL 3U9UB 4W5UA 4XOCA 3IJSB 4QO1A 4GSXA 5I0VA 3GQYA 2ATKB 3QUYD 3WUBA 3AISA 4S1DD 3II1A 4W4NA 1CE6B 4ZQKB 3QORC 4F0HA 3Q2WA 3LKOA 5C0EB 2QQKL 1GKPA 1OZTG 3H2PA 2EIMB 3CZKA 5FHBH 1KCRL 3MGOA 3BH9B 8FABB 3FT4B 2WBWB 1BHGA 3VI4A 3QUXD 5AAMA 2XVNA 4IFRA 2BW5A 4GRWH 3UWZA 3OKKB 4ASTA 3Q2DA 1AYRA 4HBKA 2PB1A 4AVFA 2NY1D 1QFWH 4XZIA 4M7SA 5J6HB 3VFTA 2A9NL 4LAZA 2QSCL 5FI8A 2WZPD 4PWGA 3FU8A 1GOMA 3NEHA 5ACLA 2C1GA 5HVHC 3VC5A 4L65A 4KJWD 5K1NA 2GUOA 1VFSA 4X7FC 2P0IA 4ORIA 1KCZA 2AEPL 3CS2A 2A5UA 2HE5A 3DMMC 5EBLB 3GDTA 1MW2A 1L6YA 4W4OC 1T80A 1O6SA 2AV7A 1M05A 1MFVA 1BFTA 4TUJB 1E4KC 1UROA 4N0YL 2JQAA 2A83B 1LE5B 4L4PA 4JJ5A 1Q6RA 5HDOA 2N7AA 2EO9A 3NH7L 2DIEA 3AXMA 4P5TD 3BICA 5HJGA 4RW3A 1OM3L 3HZ3A 2H4EA 1PDZA 2P8CA 4HUVA 2DD8L 3CSBA 3S8GB 3VXPA 4L9LA 4XBGA 2X1XR 4WZHA 3T4AA 5FYLD 1WITA 3KXFA 4XAPA 1R3IL 2NV2A 3FGCB 2FZBA 4QTGA 3X3GH 4GY1A 4AC1X 5JQ9A 5EG6C 1JYNA 2BCKB 2BNJA 2D8KA 4G6MH 3CSYA 1Y5WA 2V2WB 4I1NB 4FA3A 3O8XB 4M00A 2J57A 3BLFA 3GBDA 2V2HA 1PCKA 5KVEL 3WIAA 3VD0A 1L9QA 1S5IH 5IZ7A 5JW5B 1EPXA 1S7WB 3UABA 2BRRL 2V5SA 4HH9A 2KQNA 3BWSA 3U1QA 4LS2A 4CC1A 1W1VA 4YDJB 5I09A 2O6EA 1QNQA 2B7NA 3ATEA 3DAQA 5TPWH 3VO0A 3U0PB 4IZGA 4IUOA 1NWUA 5DJZA 3TXZA 4XBSA 3EH5B 3O6YX 4U49A 1OARH 5JHBA 4PCSA 1RUAL 1IGSA 1DV7A 2CCRA 3G77A 2IKHA 1SFSA 1UM5L 2ZX9A 1NEYA 1VFAB 2YXMA 4PP1D 4DZHA 4GNJA 1IZKA 2X4TA 2XZAL 4LRTA 2DM3A 3VGFA 4ZX5A 3CC1A 1MJUL 1UCBL 2YBTA 4G8EA 3CL8A 1U8LA 5K4ZA 2I14A 2R0LL 4N20A 1P2CA 1WWWX 3TU9A 4OTXH 4MCZB 4FYRA 3UY7A 1W9VA 1WF5A 1REQB 4FQQA 4Q3MA 2DKUA 5IROA 4LPWA 5A3IC 2N7BA 2YPKB 2BGNE 1WICA 3UBXI 1VRXA 3UYRH 1NL0L 4CVZB 5KVGL 4UQ3A 4D8PB 1MW1A 3UZZA 3L5XL 1EB3A 4J2PA 5E70A 1U6AH 1B0WA 1OF0A 5F71A 2ID5A 1TV7A 3F7YA 2A0LC 1E9PB 4TX9A 3GT6A 4KKNA 3VJ6B 2ZKHL 3D3VB 1NP2A 3WDJA 4Z1BA 3C3UA 2ED6A 4F9LA 1CS6A 3CO4A 3H3PH 4YDLC 5F7EH 5BPPA 3HM7A 3FEMA 1VZGA 2BSCA 4G42B 1JZEA 5I7GA 5ADOH 3BT2L 4Y9PA 5CEWA 1R5IA 5JOPD 1UZ8A 1O95A 1W3NA 4X5XB 4I89A 2VENA 1ADWA 5D7JD 3ALPA 2EZ0D 2J21A 2JTYA 1YY9C 3HC0B 3W9DA 4FXGA 3N43B 2YGYA 3EPNA 1E27B 3HFTA 1EK3A 2FK9A 5J6SA 1TZ8A 2G5WA 2DTMH 3VXOA 2A7PA 5KZMA 1KW1A 1VFHA 4E5TA 1FHLA 4ONGH 4V28A 1RZFH 3R1GH 3PXHA 4PUUA 4M1CC 3EX1A 2DLHA 3RVXD 1WB0A 1KM2A 3WJYA 4G9DB 3D2UD 5EHFA 2ODHA 5CIPA 2J6EL 1FDLH 1TTBA 2Z00A 4OB5H 4FTVA 4IKJA 3BVUA 3W57A 4JPKL 5GGTH 1FVDB 1RMFL 3BVNB 2A99A 3FQ1A 2YEVB 3QR2A 4MWAA 2IAMC 1AXTL 2AOSA 3D05A 4OLWH 2YA1A 3RR1A 4E0CA 1VADA 3E02A 4KQ4L 4NU7A 5IM7B 4OGAD 4HSHA 2DQJL 4ERIA 4PGBA 3ZE0B 4QLWA 5D2LB 5C71A 2ENYA 2WXHA 5IFHH 2F8IA 1NDGA 2AXFB 3K5RA 3QNZB 2EXWD 5BOFA 1MF2H 4LB3A 5EFIA 2KLSA 4QRAA 4NKDA 2O9PA 4OLUL 1VFTA 3VI3B 3H2NA 5AZ1A 2C34A 4QRNA 4BFGA 4M93B 4TOQA 4O1BA 1MCHA 2PABA 1ZJHA 5HY9A 3TO4D 2AP2A 1XLHA 4MRBA 4MD4B 4M7LT 3QEGL 1KJ3L 2OYPA 2GFBA 3WBAA 4ILDA 4FQ1L 4PRDB 3CXHJ 5H35B 2IWEA 2G3XA 1WUEA 2EEAA 1EVUA 2X89D 3O05A 4RNHA 5DEFA 3QZWG 1NJJA 2X41A 4HIHB 1IM3B 3AXHA 3N0PB 2VDLB 3PPEA 4GRWF 1BWMA 4XBPB 5E9DE 4X2UA 2DWEB 4N2GA 4JKNA 3P2TA 5HJLA 3HI5H 1SN5A 1CZ8L 1QW8A 3R8RA 1DQMH 3ZJKA 2Y6SC 1KENH 1N70A 4ZUTA 4D0BB 3FA3A 3VXRD 5CLWA 3OKMB 4OF5A 2V33A 2D20A 3D85B 1HU8A 4RGOH 4HALA 2Z0IA 2RDUA 1M7XA 3NP4A 2NXZC 2YSTA 1I7TA 3NEXA 1H3WM 3DRQA 3X1GA 1I2PA 1OX6A 1TQBB 3Q58A 4AZ5A 1N5AA 4N6QA 1L9OA 4DJDC 4P2RE 3L08A 4G9FA 2A73B 1QI0A 1OGTA 2J44A 4P49A 4Q4SA 4D9QD 5FUZL 1J8HB 4DUVA 3FDGA 1FA2A 2DRUA 2Z93B 3QQ0A 2HJLB 3C5ZD 4AISA 4WWKB 3QC3A 1WO2A 4NVTA 3LKQA 1KB3A 3RJXA 3A3WA 1D2PA 3MJ9L 1P7TA 3N9GL 1X98A 1N0LA 1CLOL 4PJ7A 5CG7A 4FQ2L 5IB1B 4BQ3A 3O6KH 4XMXA 1ITCA 1GHRA 2KZ1B 1XQ4A 4Y16B 5I74B 4WY0A 1U8MB 3AG3B 2QFRA 4XH2A 1F3WA 1I3RB 1GL4B 4LLDA 1QPKA 1XYMA 4D1JA 2CCVA 3ZMEA 2K0RA 1OGAB 4NC2B 1EJXC 4MXWH 2E6FA 5CBEB 1E8YA 3HUJB 2VKZG 1TVHA 3FN9A 4MLSA 3ZKXC 4R5XA 3MYJB 1URIA 2YRPA 4NYLA 3VIJA 1RI8A 4HFWB 1KELH 1XSOA 1QATA 4FZ8H 1JV5A 1KYOJ 1CICC 1CXEA 1WDWA 4LMQI 4UNKA 3KVLA 2V9QA 1MHPH 5D7HA 1OFPA 3DIPA 1XYLA 2NZIA 5HAOA 3O9NA 4MA8L 4M4RA 3NJ3A 1A3LL 5C9ZA 1TCRA 5KYXA 4QGCA 3BN3B 2RUSA 4PB4A 4G7EB 2DMCA 5C6WH 2K4WA 4LCUA 1Y7VA 2P5EE 2V5TA 3DO7A 3SRFA 4JZNB 2ZPKH 5IEKB 1P7BA 1MJJB 2E75C 4N2LA 4DI9A 1NICA 3TN0D 3HKZA 5GQBA 3U4EB 2MHAA 1GJUA 5C2BL 4BUQA 2EDNA 5FOBA 4UTKA 3CFCH 3U8GA 4UTJA 4AENA 5EULV 1GH7A 2BH0A 3F7PC 2N59A 4D8OA 4UTBH 5D9OA 1Q90A 4LCIH 3W22A 4FMVA 1V02A 1S2CA 4OIIL 1SDYA 2BPBA 4HBCH 2EBNA 4BWLC 5DHXB 2VGGA 2BZCA 3Q2VA 3P4NB 5KYWB 3RLUA 1DXIA 3N17A 4A8LA 1A14L 3DBNA 2VERA 1AG0A 1UADC 4E9YA 2WO5A 3S5SA 4G8IB 1T5WB 3ARDC 5F93C 3B2UC 1DQIA 2WQVA 1VJIA 3UEZA 3NR0A 1KC5H 3W71A 1XZ0A 2ENJA 1F73A 2OA9A 1UR3M 1DVXA 4ODBD 1Z5LB 1QA9A 3CUJA 1GQKA 3EA2A 4D6EA 1ZSHA 4F58L 2IALB 2P9RA 5GVJA 1H6TA 5K9JL 2XTJD 1V7MH 1T1XA 1CB4A 3TBYA 1VPOL 3UVIA 2EJ1A 1NAMA 3A6BH 4DQOH 3WNMA 3N34A 1SMOA 2ADJB 4ZFOL 5GRUH 5GS0H 1T1WB 4F37F 4IFKA 1IAIL 1M7UA 3RMJA 4PJGE 4E8CA 1XJBA 2YR3A 2RJMA 4Z5RB 2CNCA 5IW6B 3MZ2A 2IFGA 1AH0A 1YW1A 3EOUA 5D1QB 1OYBA 1K7EA 1JZDC 4GLEA 4XK2A 4KESA 2O9RA 2BOCB 2Y8VA 2VFFA 3SYQA 1KTLA 3V0UA 1IQWL 2YD2A 2VLLA 3QDGD 4UUIA 2P47B 1T2XA 4WKXA 5FO8A 1LUCB 4WI5A 4QXUH 3T8VA 2RR3A 3MXVH 4OGZA 5D72H 3L9RB 3V5CA 1YIXA 3PN8A 4JPIB 4PY8J 3MUGA 3V75A 1KWGA 3ZR5A 3CFEA 4DN3L 1GPWA 4WI4A 1I82A 4U3XA 3W0WD 3W5NA 2J8FA 1CD0A 4RFNC 1OO2A 3TYFB 4FA6A 2XSKA 1DEDA 4MD5B 3HHRB 1UP0A 3QIUA 3BPNB 1V05A 1MFDH 4OLVL 1NU5A 1TJRA 3HN8A 3MA9H 5CU5A 1IAKB 3KBJA 2NOYA 2VNCA 2O5XL 5DR5L 4IKIA 3W7NA 5IK3B 4S0TD 5JQIB 5J13B 3IJLA 4JRWA 1JNEA 2IMRA 4YGVA 3UBGA 4LPCA 4AQOA 1B0RB 4ZO7A 4WW2A 3IJ9A 4PJ8B 1FVCB 2G75B 5A2BA 1UKSA 3V10A 1YUHB 1EGJL 4E42B 4PJAE 3R4IA 5C09A 4HWBA 1ZBVA 3L7EA 4RPPA 3SO3B 4EWND 3ABLB 1AS7A 2VLJA 5GISH 1KJ2H 5C0FA 3FTGA 4FPSA 5C0AB 4XNXH 4XNUH 4L3CA 1RJQA 2QVTA 2XUWA 3U7WL 2E0PA 5FGSA 3PPFA 4B3EA 4BJHA 3IDGB 1VGEL 2ADIA 4UR8A 3C6LD 1HYSD 3TBSB 5C0JB 4UM9D 3LNGA 3NTCL 4P07A 5CPQA 1LP9F 3HKFA 3TH2T 2IXQA 3Q8BA 1LO4H 4CGTA 5REQA 3M9YA 1VENA 2LABA 2OMUA 5FYKH 4GK8A 1CDGA 2FT7A 4U6HB 5FK9B 2JGYA 4PVNA 4BXSV 2OK0H 1KCLA 3PHOB 1QI3A 5EU3A 3A6CH 4UT6A 1AG6A 3CCHB 4F37K 2Z26A 5T5FL 2G9KA 3QEUB 3WLPA 3PB0A 1SVBA 4DPBX 1BX2B 3W56A 4Q22A 5FO2A 1JFQL 2VM4A 1AGCA 2CKSA 3MBED 5ECGA 1YPZA 2E86A 4HCGA 2NNCA 5EOTA 5ID0A 2P8PA 5I1DB 3WGUB 3QZWA 1EP3A 2Y06L 1W5PA 4BZ1A 4EVNB 4ZVJA 4L4MA 5FM5O 4JFHD 4UINH 3R12A 4X5PA 1ZE3H 3UWVA 4UT9A 5E0CA 4ZBJA 5CSZA 5GZOA 1UOKA 2XN9E 1OADA 1SBSL 4XPGH 1FDZA 3FO2A 2YDQA 4WI0A 1HH9A 1KRCC 1MQ8A 2PO6D 3VYPA 1R8LA 3TW7A 1XRTA 3DBSA 3DIDA 1LL6A 3J8F7 1P69B 2V9UA 2W92A 3IGAA 1Q6CA 2WQ8A 4PI2A 1P5BA 3EJPA 1GYNA 3MMEA 1A5FL 5I8CB 1TPUA 2Z31B 5EF1A 4JK0D 4ZK8A 2VOMA 3VFWB 1R5VB 4XP9L 5K3VA 3SEPA 3N25A 5DBUA 3CK5A 3O3AB 4MA1C 2QXWA 1F58H 1TIMA 2R1LA 1DLHB 5I18H 1VFMA 1V27A 3O7UA 2B7QA 3I65A 2LLLA 2HVJA 1EHKB 2R56H 6ALDA 4NC1C 3G6AA 3SUTA 1UOWA 2DQUL 2Y6ZA 3PWPD 2X3AA 4DW2L 4C55A 4WAFA 5AALA 1NSNL 5E2TL 1RR2A 4CVXB 1UJ3B 1T96A 3WQVA 1A5LC 4CQDA 1HI6B 3DOHA 1VF8A 4P5RA 1WAAE 5IVXE 5JW4N 4JRXA 4ZX3A 2FBJL 3S35X 4AQ1B 4O2EA 3GJFB 4Y1SA 1G0XA 1NDYA 3N1QC 4HS8L 4I90A 1HHKB 1BYOA 4OGYH 2H3NB 1NLBL 5EO1B 1J48A 4A38A 4DPPA 4KC3B 2DW7A 1P4IL 3H2OA 4KNTA 5LIUX 1X4ZA 3O2VL 3BCDA 2UYLA 3TIEA 5FO9A 4BXVA 1KGUA 4RDQG 1XCXA 3LMJL 2Z91B 3OQRA 2WN3A 3MV9D 2A3CA 3ROLA 4OZHA 2DTSA 4GBXA 1VAHA 4PS3A 3IDJA 1RURL 3GBMH 2Q7YB 3CX2A 3BPOC 2H3BA 2O4MA 4BSVA 3EYFA 4RESB 3LS5L 2BNUB 1X96A 5E8PB 4KKZA 4FFVD 3GSXB 2PU0A 3FQUA 4X60A 1TQXA 1ZENA 2K4AA 2R24A 2XN0A 2G96A 5F2FA 1JULA 5D2VA 4WVRA 1UR0A 4AY0A 1U8KB 3CVDA 3CV5A 3BGFC 2WZAA 3BSZA 2J5LC 2QVKA 1Y07A 1BLNB 1UWXH 1KLFA 4JMNA 3WX7A 1RZJC 4GUCA 2OJPA 5JIQA 1CCWB 2DSZA 1PZAA 1KTCA 4CD8A 1XUUA 4PYSA 1UWGL 4IRSD 2HMID 3ATFA 3QQ9C 4DWSB 4HKBB 1CWYA 1Q1PA 4PUWA 4MKMA 5A2IH 3NPSC 1CL7I 4OFYA 3MRBB 3UJIH 3QUMB 1IIIA 2NW0A 4PRHB 5IMOA 1QFEA 4C7GA 4JZ5A 4NILA 4K3EH 5CJXA 2VWEC 3TCSA 3BH8B 3HN3A 4F3FB 2EC9U 5J9PA 3WH8A 1RJYB 3I6EA 3S4SG 3ESMA 5E94B 2X4SB 3MNZB 3ZYOA 4QRTA 5DD5H 4LBAA 1BEXA 1ISYA 1E3FA 3B0PA 5HDQL 4AYFA 1TQCC 1IC0A 4ACPA 6PAZA 3VIKA 3E0GA 3F12B 5CM1A 4KHXH 5B1JA 4GEJA 3BFWA 4DHGA 3SIZA 3ZKQD 2QVFB 2X0SA 2DMHA 2JJVA 1LO2H 3SKOA 3W7PA 2ENQA 4PJFF 1US0A 2NPLX 3NJFA 4U2YA 2WJ7A 3RWGB 4R0LA 1H3UA 1R3HA 4EXPX 4G82A 2FTAA 4TSCL 2PR9A 4JKWA 1ONXA 2AJ3B 5GNZA 2OMWB 3C2SA 3FSZA 3TBCA 3FO9A 4XPHL 1T7LA 1GG1A 1OF2A 5CINH 2OSWA 4MNQB 2QPFA 2MFNA 2MOVA 5CGBA 4UFKA 4Q7DA 3C60B 1LTXA 3TA9A 1XIGA 4H6RA 5A8PA 1UUOA 3ZYIA 3WMPA 1FIEA 3FB8B 3IF1A 3DX8A 3AUVA 4LAOA 5CKSA 1BJMA 3IIVA 2ACQA 1M1BA 3FHQA 1T0MA 4A7GF 2N1KA 2GITB 4U6YA 3SE3C 3B97A 5AZEL 4WTZG 2GJZA 5AL8A 3WLJA 2GQ8A 5D1XD 3EYQD 3U36B 4UDTA 4JGMA 2ROYA 1Z9SA 3W82A 2X1QA 5EMLA 5IHBA 5GZND 3DX9B 1ESWA 3LS4L 4U3SA 5F1UA 3BW9B 3MC0A 5BVJB 2XIQA 3GC5A 1XCFA 1UVQA 2NX9A 5TDOB 4RDYA 4C58B 2ICSA 1OT1A 3TN6A 4Q9RH 3SRHA 2WB7A 2J3SA 1OPOA 4Y19A 5HHXH 3DSNB 1A9EB 3T55A 5C7VA 3W7DA 3V0SA 3W2UA 1EDGA 2OJZL 3A9IA 4N6FA 3BOVA 1YEGH 2X1TA 4CSTA 1HAWA 5AYQA 1LM8V 2VN3A 3GGWB 4PGCA 4HK3J 1P6WA 3X11B 3Q44A 1V7NL 1A47A 4MZIA 3MRLA 2PRMA 1NEPA 2F0CA 2WZMA 4PMFA 1KMGA 3AXKA 4E41E 1T20A 5AB9A 1MPAL 5F0LB 4U1IB 1B3YA 1RCXB 4R2GD 3PAOA 2R51A 4MDRA 1QPXA 3QJAA 4R96A 3L3DB 1YUKB 3PGDA 3WJXA 5GGQL 2VITB 1G6RA 1A6UL 2BVQB 1XD1A 4WDIA 1D9KD 3LQAH 2DSVA 3W7HA 5G4WA 2QQKH 2OG9A 35C8L 5D6DC 3FO1B 1XIIA 2XV2A 3U5YA 2F6UA 4GG6F 1W56A 5DS1A 1HXKA 1FZKB 1XLCA 2ZAHA 1EEZB 3MOAH 3WQ4A 5TF1L 4ZXLA 1ODAA 3JWNC 1E40A 4PRID 1DVFB 4KU1A 1T03L 1ES0A 4MQ7B 1TDQA 2A9NH 2QSCH 4NO0D 3RJQB 5DK2A 4HNNA 1PZCA 3K30A 1OIFA 3MI6A 3QRGL 1SYTA 5KBLA 4HT3A 1FIGL 5DJCB 2AEPH 3MLXL 1NUFA 3H9HB 2I26N 4QHKJ 3UIZA 1RV8A 1T04A 3TZFA 3WEAA 1H9VA 3QNXB 2FLMA 2J20A 2XA8L 2R9RA 4PWHA 3CFJA 3LH8A 3CN0A 3QRHA 3FKKA 2JMRA 3C56A 2K6WA 1ACZA 4K3GA 5GXBB 1T66D 4LKXB 1FBIH 4UYPA 3KTXA 3APCA 4RFEB 3VM7A 2VC6A 3QDMD 1RUQH 3FT1A 1OM3H 1WIUA 1QI5A 4P9HC 3KM8A 3RY6C 3B5TA 3W6YA 1S5MA 4GCXA 4IRZH 4QRFA 2DW5A 4JO4L 2HRHA 4ADTA 3CV2A 3QZMA 5HSFA 1HF6A 2QGCA 1R3IH 3RA7L 5J06A 5LA0A 4UQCA 2NSXA 3IVKB 5LCVL 4IQJA 1N68A 3DESA 4HNTA 3I68A 4PSPA 2ZXWB 2ZUMA 5CPMA 3KVJA 1KY6A 1NIBA 1G0YR 1YRRA 4FL4B 3GVVA 1EBAA 2BY2A 2OXNA 2EEBA 1T6VN 3UR2A 5I3KA 3CVHB 2X4RA 5F9JA 4CQAA 4R7JA 2HRLA 5IF0A 1WD8A 4PLKC 3GUGA 3TBVB 3BFQG 3ULVL 3MJWA 1Q6FA 4JO1L 1KTNA 2KMWA 3QUZD 4EACA