1GCYA

High resolution crystal structure of maltotetraose-forming exo-amylase
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
415
Chain Sequence
b'DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCAN 1,4-ALPHA-MALTOTETRAHYDROLASE
publication title Crystallization and structural analysis of intact maltotetraose-forming exo-amylase from Pseudomonas stutzeri.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 145
structure length 415
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 2000-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gcyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gcyA01
4OOZA 2D3LA 2VX6A 2OW7A 3WL1A 1PZ3A 3BVXA 1QVBA 1HP5A 3CZSA 3N13A 1GQJA 2A3CA 1CGTA 3PZ9A 1P6WA 4W84A 5LA2A 4L4OA 1XSJA 3MKKA 3CMJA 2JIEA 3AMDA 1CGWA 4AISA 2OLHA 2QHAA 3WNKA 2FH8A 2DPEA 4WLCA 4UQBA 4FK9A 2EO7A 2Y4SA 4CGTA 4IUGA 4PBGA 3AIQA 3WF3A 2JEQA 5ECUA 1C92A 2WVSA 1LG2A 4N42A 1ZJAA 1C7SA 3HZ3A 2CETA 4XZWA 4AC1X 1G1YA 4K68A 4QP0A 2Y5EA 2XM1A 5I78A 3U5YA 2YOCA 1LG1A 5TD4A 5BXPA 1R34A 3BCDA 2ZX8A 1HJSA 1QI5A 1GONA 3ECQA 4PMZA 4S3KA 4GZEA 1PPIA 1TA3A 1V6VA 4OIFA 3KL0A 2WCAA 4U3CA 1TQTA 2G8ZA 3L4UA 2X0HA 4EKJA 3WQWA 3ALFA 1XSIA 3W24A 5A2BA 1ODZA 1HT6A 2XFYA 2DSVA 1QNSA 2Z1KA 3MUIA 2WZHA 3IANA 2EJ1A 3D3AA 3CUFA 3A4XA 2X05A 1BAGA 2MANA 1W32A 2WC4A 3KZSA 5M3WA 3ZJKA 1UOKA 3NCOA 2UY5A 3PTMA 2XIIA 2O9RA 1DWIM 4FNSA 1XH2A 3QHMA 4XZBA 2WMHA 3ARRA 4M8UA 4P8VA 3SCVA 1WB0A 4DWSD 2BHZA 3ARSA 4TOQA 5LYRA 1E0WA 1JF6A 2J77A 1EH9A 3WMBA 1J0KA 4M81A 2WCSA 1UWQA 5A6BD 3LXCA 1CLVA 1CLXA 5EMYA 2D20A 4A3HA 3VD9A 3UEQA 3RJXA 1DTUA 4P7RA 1QBBA 4M29A 4KWUA 4D6EA 1PX8A 1UKOA 1FOBA 1NOFA 4W89A 1OD0A 3A22A 4AD2A 1UZ1A 4F8XA 2J25A 3WD2A 3ZO9A 1BGAA 1UH3A 1KQZA 3CZKA 2VNCA 3GDBA 2UY4A 2E8YA 4GQRA 1HKKA 2Y8VA 2Y24A 3BVUA 2OWWA 3ZJ7A 1H09A 2EABA 2WAGA 3BMWA 4H8UA 1E6QM 1E6SM 1B0IA 3HN3A 1WDPA 2BV9A 1XH0A 4AZGA 1JAEA 2PWDA 4X0NA 4MB3A 1R75A 4UZUA 3FY1A 1VJSA 5EFFA 3N17A 1UR2A 3SCPA 2IGTA 1PIGA 4OZOA 1XYZA 1GJWA 2AOSA 2DDXA 5GQBA 3AYSA 1LL4A 9CGTA 1X6NA 2VZVA 2FGLA 1US2A 2NT0A 1C90A 4MAZA 3TTYA 3WD4A 3WDHA 3EJTA 2F1BA 2VCAA 5A95A 3T2PA 3VGGA 1ISVA 2WSKA 4Z2KA 1O7AA 3QOMA 5DF0A 3DHUA 4FLRA 4MAVA 3F5KA 3N11A 5IHRA 1WZLA 4DWSB 1VENA 3PZIA 5JUVA 4JKKA 4TTGA 2GJXA 2GJPA 4DM1A 1TMQA 1DWGM 5CQ1A 1H0IA 3A6OA 5A8NA 3ARTA 1E15A 1IZKA 1KGWA 3KLKA 4AW7A 1KWGA 1B3WA 2WMGA 2ZE0A 1D2KA 2G3MA 3D51A 1TVNA 1BHGA 2V3FA 4AZBA 6A3HA 2EBNA 3VMOA 1PIFA 4UQDA 1VF8A 3AICA 3M7SA 1Q6FA 5ABHA 1L8NA 3IJ9A 4X9YA 1E40A 3H54A 3AI0A 2W92A 5A6LA 5JIWA 2FHBA 4W85A 2YKKA 1QNRA 1U30A 1J10A 5CSYA 3QR3A 1BYDA 2DEPA 1ECEA 4WKFA 3N04A 1DWJM 3AXXA 4BQ3A 1QX1A 4HMDA 2VZSA 1KGXA 4X0VA 3VIJA 2VURA 4JKMA 4OUEA 3WNMA 2FE0A 5GNXA 2XN1A 4A3YA 1ZB5A 3MV01 3TA9A 3CZGA 4GQQA 2C7FA 3PZUA 3SCQA 3U57A 3BLPX 4W87A 3RILA 1CEOA 3NDYA 4H8VA 3S2CA 4AZCA 1UR0A 1MQRA 1TVPA 1EHNA 1UD8A 3VD3A 1VEMA 1T0OA 4ACZA 1JG9A 3KE0A 2JE8A 3BAJA 1ZL1A 2CIPA 1C91A 4J3SA 1MFUA 1HIZA 1BTCA 2VRQA 3TTSA 1BYAA 3W38A 3WEZA 3QHOA 1EDGA 1H5VA 4J7RA 4OJYA 4MDOA 1KR1A 1JXJA 1CXEA 2WXDM 4UQAA 1JAKA 4AZ6A 1CXFA 4BS0A 4V27A 3RMEA 4RE4A 4QDMA 1OGGA 5GNYA 4KH2A 2PF0A 1JYWA 1WDQA 4OKDA 3GXPA 2G41A 2X8RA 1VFMA 2XGBA 4JL2A 3AMKA 1ZS2A 1OWQA 3VIOA 2ZXQA 1MQQA 1JFHA 1US3A 2WHLA 1Q6DA 5BXRA 1J0IA 6CGTA 2VR4A 4NZCA 4HOXA 2F7PA 4YPJA 1V3IA 2WHMA 1NH6A 1VFOA 2X0YA 4R5EA 2YDQA 3A4AA 3EDKA 3CBWA 2CBUA 4PMOA 3SURA 3DDGA 4HZ6A 4XUYA 5FL0A 1SR0A 3F5JA 4BZYA 4IISA 2O9OA 3AOFA 1VJZA 4CD5A 1HKIA 5AC5A 1J11A 1E73M 1GORA 2J7GA 3N18A 1EOKA 3VM7A 3TONA 4J3VA 2EPMX 3BVTA 5A2AA 1UWUA 3B9EA 3I3DA 3VVGA 1ISXA 3BAXA 2ZUTA 1CXHA 4D6FA 1UZ4A 1KR0A 1QI4A 3EDEA 3BAKA 4PEEA 2ZXBA 2WKLA 2X09A 5CGMA 4GI9A 4U31A 3HU7A 3VSVA 1QHOA 1EA9C 4AIOA 4HPGA 5A8QA 4AD0A 3AXIA 1E4LA 2GSJA 3EDFA 1W3JA 2J7FA 2DT2A 3WY1A 2QF8A 3GTNA 4LQ1A 3WDRA 3VSTA 5DEZA 1BF2A 4QAWA 4Z2LA 1EDTA 5ABEA 2D73A 2XWEA 4W86A 2WVVA 1E6PA 1LF1A 4IPLA 3VINA 4OBSA 1HKMA 1QW9A 2YFOA 2AAAA 4WF7A 2QMKA 4CU7A 4C7GA 3D50A 1MW0A 2VX5A 5D9PA 2F7OA 2D2OA 1XD0A 2GVYA 4ATWA 3WMSA 2VI0A 1CGXA 3WEMA 4GI8A 2FH6A 3HMCA 4B3LA 1BG9A 3WY2A 1KB3A 1H49A 1B3YA 1K9FA 1W3KA 2YL5A 1R87A 1SMDA 2A3EA 4UR9A 2YJQA 4Z2JA 5GPRA 3T0DA 4CU6A 2JALA 2V5DA 4GO8A 3L4WA 4GZJA 3EJUA 1B3ZA 1PS3A 2BY0A 2PI6A 3PHAA 5D9MA 2X2JA 3VO0A 3AMLA 1OD8A 2J74A 4LX4A 3DX2A 3WF1A 2PWFA 2GDUA 3WDIA 1FH8A 5HPOA 1BVZA 1JNDA 4QFUA 1JDAA 1AQMA 1B30A 2OSYA 1JYNA 2D0FA 3BXWA 3L2LA 4U5KA 1WCGA 3VDAA 4JFTA 3MS8A 1MFVA 3KWXA 4H7VA 3T2QA 3LXAA 1UKQA 1V6WA 3S5ZA 2RGMA 1E71M 5KEZA 4QLLA 1J0HA 4F9JA 1UD2A 2DSUA 4Q7NA 7TAAA 3BAYA 1UR4A 1TG7A 4MNJA 2RGLA 3SUVA 2WHKA 4PTXA 1H0GA 2VTFA 4J28A 2D3NA 3D52A 2XPKA 3DX4A 1FFRA 3GNPA 2WWDA 4C7DA 3GH7A 4MB1A 1W2PA 3OZOA 1QWNA 3UCQA 1HXKA 3CHFA 2VZTA 4HZ7A 3GH5A 5HBFA 1W9PA 1V3HA 4MB5A 1EDQA 4GZIA 4PMDA 1BSIA 4E4PA 4AZ7A 3RJYA 2ZWYA 5A1AA 1KBKA 2OWXA 1HF6A 2EEXA 3WUEA 3ZT5A 3DX3A 5I0DA 1ZBCA 1BFNA 2ZX6A 3VMNA 1D3CA 4AZ5A 1Q6CA 1W91A 2J79A 1UH4A 1ESWA 1F4HA 1BQCA 1C8YA 3VGDA 4NF7A 1C3FA 2IXUA 1G01A 2QPUA 4BQ5A 2VMFA 2PBGA 1JZ3A 1NOWA 3VUPA 3RIKA 4JHZA 3GBEA 3OB8A 3UESA 3OLDA 4Y7EA 3N9KA 3BC9A 4OOUA 4RE2A 4AEFA 1U33A 4D6DA 4B9ZA 3WENA 4HTYA 4ZENA 3E1F1 2BVDA 4AMCA 2W66A 3ARYA 1V08A 4NXSA 5E0FA 3CHEA 1UASA 4JL1A 2ZXAA 2WC3A 2G3IA 5A8OA 4D6JA 3GXDA 1E1EA 3WD3A 4YN5A 1VAHA 5IHSA 3SUWA 1B3XA 5IFTA 4UQEA 1B1YA 1J0YA 4OGZA 3CZEA 2XVKA 1J0ZA 3WNLA 5C71A 3LRMA 4D6GA 2DSZA 1CYGA 5BRPA 1C8QA 4ZXOA 2XIBA 1XV8A 1VIWA 1C8XA 1X1NA 1DWAM 1XH1A 4JAWA 1W9DM 3CGTA 1JYXA 1XCWA 1PBGA 4M24A 2J8FA 5E1QA 4E2OA 1HXJA 4CKQA 3AZTA 2D22A 1LQ0A 1TZ7A 3EJRA 1HJQA 1UR8A 2W61A 2OYKA 2XN0A 5A6SA 1GVIA 3GXNA 3WQ5A 2WMFA 5FKYA 1HKJA 4CD6A 4M56A 1LL6A 1E56A 2EPNA 1I75A 1TFVA 5HXMA 3WEOA 3RM9A 1UG6A 3AS0A 1V3MA 1CNVA 7A3HA 3WF2A 2JF6A 1E1FA 2EQDA 3CC1A 3LRLA 2G3JA 2DQXA 4Z2IA 1MXDA 5IXEA 1IV8A 1UH2A 1UKSA 2CHNA 3BVWA 2ZICA 1QI2A 1R85A 1E6NA 2VX7A 1VEPA 4TVDA 1CZ1A 4UZSA 4TXEA 4M82A 2GJRA 1HJXA 2E9LA 5D9NA 4GPNA 3VDBA 4F9DA 2IUZA 3DYPA 4DWSA 2CEQA 2WC7A 1DWHM 2D0HA 1UUQA 1OGSA 1K6AA 2XFFA 2QPSA 3AYRA 1BYBA 4QLKA 2WM0A 1QW8A 1AMYA 2W63A 1E6XM 2TAAA 5A6BA 3AS2A 3SCUA 3WF4A 3NSNA 3ZJ8A 5I24A 3AIVA 5CJ5A 3VD7A 4GINA 3L4ZA 4W5ZA 4JFVA 1EO7A 2YIHA 2J78A 1M03A 1HP4A 1SFSA 3K8KA 1RH9A 1HL9A 3FAWA 3L4VA 2YL9A 2VQTA 1EQPA 2GK1B 3VDHA 2FHCA 2XVLA 3WH9A 1Q4NX 3TV8A 1A47A 1UA3A 2WWCA 3MU7A 3ARZA 1GW1A 2D23A 5C70A 1KXTA 2BY2A 4CD7A 4AWEA 1OBAA 3ZJ6A 3THCA 3CUJA 4PMNA 1E0VA 1CGVA 5FL1A 1KXHA 1W1VA 3BSHA 3RCNA 1UWRA 2PWGA 1EIBA 1JL8A 2DSKA 4U33A 3VNZA 2WB5A 3T0AA 4W5UA 1J0JA 4A4AA 3SCWA 3PBGA 4ATLA 1JI1A 2CKRA 4YHEA 1E70M 1PZ2A 5DT7A 3SCNA 3VTRA 2ZWZA 1CGUA 4FLSA 1XRVA 2EPLX 1LL7A 2DT0A 1UWTA 1B2YA 1V03A 5JBFA 1GHSA 3WDPP 5HNNA 3EBVA 5M03A 5BROA 4EE9A 3CZLA 1V3KA 3WNOA 4CCEA 1OT2A 1E6ZA 1QHZA 1ODUA 1ZJBA 3HG2A 4HA4A 4MADA 2JIWA 3WN6A 4UTFA 3ZR6A 2WZEA 3AXHA 2CXGA 2X1IA 2WZIA 2F18A 1JD9A 2ZIDA 4JFSA 4HMCA 1MW3A 4PMQA 4KRTA 2XFRA 2YDSA 2PBOA 1R86A 2CCRA 5BCAA 2YFNA 3W6LA 3MSGA 4AYGA 4RE3A 2BY1A 1ISYA 4BA0A 4UQ9A 3B9DA 1QNPA 1ZBKA 2ZUUA 4ZFMA 1NP2A 5AYIA 4IPNB 3OG2A 3WQ8A 1A3HA 4DO6A 3AFBA 3K46A 4W88A 2J7EA 4XV0A 4IM4A 2VC9A 3GH4A 2FHFA 3II1A 3IAQA 3L4YA 2GJXB 4FLQA 5HDRA 3AHXA 2W67A 3ARWA 4B9YA 4H2CA 3QOKA 3FHAA 3DX0A 4J3UA 1KXVA 1W1YA 1KTCA 2O9PA 3OZPA 3UETA 2CBVA 2WMIA 3UG3A 1UR9A 1O6IA 3K4DA 1UWIA 1WNOA 2CBIA 3MV11 3W25A 3CLWA 1OINA 3WQ6A 2BHUA 4W93A 4HZ8A 5IDIA 4PMVA 3GXFA 2ZUMA 2GDVA 4MNLA 3WD0A 3WL0A 3W29A 4XB3A 2VQUA 2ZX9A 2YA2A 1Q6EA 4U3AA 1OIMA 3WD1A 3F4VA 2HISA 1PX3A 4JCLA 1NP0A 4LPCA 3SCSA 1CTNA 3VKKA 3ZSSA 4BQ4A 4D6IA 4D1IA 1MXGA 3VD4A 4C7FA 2F7QA 1XHGA 1FHLA 3EJQA 1I1XA 3A5VA 4AD5A 2VCCA 4KMQA 3BUIA 1KFWA 2EPKX 1CXKA 1GNXA 3BMVA 2WMKA 3VD5A 3AS3A 2J8GA 5A3HA 4AMWA 2WSPA 3TP4A 2WNWA 3POHA 7CGTA 4J27A 1J9YA 2A3AA 3CUHA 2WW5A 2XSAA 3A23A 3WFZA 1V0KA 2J7BA 1QNQA 1GVYA 1CECA 3VGFA 3B9AA 3VNYA 1R47A 3ARXA 4TTUA 3TTOA 2VR5A 4AZIA 2YBTA 2ZX5A 3AHZA 5JBDA 3CIVA 1MW1A 2GUYA 3K8LA 3U7BA 3VIHA 1YHTA 2BFGA 4ZE5A 4DWSC 1OIFA 2EAEA 1RD6A 3UG4A 4V2XA 3F5LA 4KGLA 1W2VA 1NWTA 4PTMA 3MUY1 3MANA 1XGZA 1BGGA 4FNPA 4PMRA 4QCEA 1VRXA 2BVTA 1GOQA 2JF7A 3WSUA 1SYTA 4TX8A 5DT5A 1HJUA 4WIWA 1AQHA 1QI3A 1VB9A 2VVSA 4Z2HA 1GCYA 4MTVA 1DP0A 2D0GA 3ARUA 4FLOA 4HOWA 3WUFA 4UFMA 4U5IA 3T2OA 1KCLA 3VGBA 2OW6A 5ABFB 1FFQA 4URIA 2J75A 3IK2A 4N0RA 2QLYA 2E8ZA 4NI3A 2XVGA 3WDQA 3MMDA 2XGIA 2XJ7A 2O92A 4Z2GA 1J01A 4DO4A 3AHYA 2W4XA 1G5AA 5CXPA 1KGUA 4NZFA 4MNKA 2V3DA 1CBGA 5CZKA 1W3HA 1JNEA 2V3GA 4AZHA 2V38A 1BVNP 3NUKA 2C0HA 3VU2A 2YL8A 2F61A 1E4NA 1VEOA 1HN1A 5A2CA 3AZRA 4UOJA 3VILA 3LPOA 3PZNA 4JCMA 2F7RA 2JEPA 4UFJA 5FCZA 3SCRA 4PCSA 1UYQA 2E9BA 2XN2A 4CN4A 3EJSA 2C8NA 1W9BM 3CO4A 3CUIA 1W3LA 1CWYA 2W62A 3BSGA 1OSEA 2ZUWA 1HVXA 4F79A 4H8HA 2QV4A 1NM9A 3VIIA 1MYRA 1E9LA 3LPPA 4J3WA 3TTQA 4PUEA 3CZNA 1CXLA 1J18A 2UY3A 2UWFA 1WP6A 2XWDA 3LXBA 3EMQA 3MO4A 3CV5A 1H2JA 1BLIA 4P8UA 4P7NA 3VGEA 4PN2A 1QBAA 4KGJA 4PTVA 2VZOA 2NSXA 3NYDA 5EBAA 1GUVA 4FNQA 4HOZA 4BQ2A 4P7QA 1V6UA 1GQKA 3U5UA 4BCEA 4AD1A 1GQIA 3AIBA 2O9TA 3AIRA 1SZNA 1JZ8A 1XCXA 4MNMA 1UKTA 2D24A 2YL6A 3IJ8A 3NIYA 1UD5A 3VDCA 4NZJA 3BH4A 1N82A 1E55A 1YQ2A 2VZUA 4PUDA 2HVMA 3A47A 2J7DA 1JZ6A 4NXKA 2IXVA 3A3HA 5LA0A 1EO5A 1D7FA 2DIEA 5CGTA 3W0KA 3WUBA 2YLAA 5BYWA 2EACA 4DUWA 4AIUA 4PMYA 3S6TA 4QCFA 4AXNA 1HWWA 3S5YA 3APGA 4W7UA 3H53A 1GJUA 1LJYA 4NRSA 3DHPA 2XYLA 2XHYA 1WZKA 3IAPA 5BXTA 3J7HA 1WZAA 3AHTA 1LWJA 3I3EA 3ZIZA 1EHAA 2XVPA 2DT1A 3GXTA 4CUCA 4PYSA 2OYLA 3PZVA 1HL8A 1RPKA 4LYQA 1R46A 3LX9A 2VCBA 2CHOA 1UA7A 5ABGA 5DMYA 3GXMA 1E0XA 2XUCA 1OGBA 3N1AA 2VUYA 3BAWA 2Q8XA 3BAIA 4E8DA 1KQYA 3BUDA 5C8BB 3MMWA 2GFTA 4ZE4A 1B3VA 4FF5A 3KL3A 2PC8A 3PZMA 1X6LA 3K1DA 4FNUA 4P7LA 4UFHA 3ARVA 3VIKA 5AYBA 5JIPA 3LPFA 1CPUA 1JD7A 1R7AA 4ATDA 4UFLA 3OGRA 2PWHA 1NOUA 1E3XA 4F66A 2E3ZA 1Z32X 3U7VA 1QHPA 2OSXA 4PCTA 1JZ7A 3MUZ1 4HMEA 3AIEA 5CSUA 3L4XA 1JZ4A 1UKPA 1E3ZA 1BG4A 3AMGA 4GIAA 2PB1A 3FNDA 3RO8A 3CTTA 3KL5A 1V02E 5A8MA 1H11A 3THDA 3HG5A 2D1ZA 4H04A 3I3BA 1G94A 5E09A 2YA0A 4U2YA 1MW2A 2WPGA 2OWCA 2OYMA 1EOMA 3AMCA 1E5NA 2ZUVA 1R33A 4GO9A 5I2UA 4UQCA 2XTKA 2ZUNA 2B31A 2ZXDA 2J7CA 3QHNA 4PMXA 2FGZA 4RL3A 2CNCA 1FA2A 3EMZA 5HPCA 4LXFA 3ZMRA 4FNRA 1FP9A 2WK2A 3NSXA 3K4AA 3VGHA 3WH7A 5A8PA 1CIUA 5FOOA 2WVTA 1ZBWA 1M04A 4TVUA 1TQWA 4Q22A 1GHRA 2XM2A 4P8WA 4MJ4A 1H1NA 4UNIA 1EQCA 5EFDA 2Y8KA 1TQSA 1FHDA 2QMJA 3A24A 4W8BA 4M1RA 4HA3A 1DWFM 5D9OA 3UG5A 4JFWA 4ZXLA 3MSDA 2NT1A 3VIMA 1GZJA 2EADA 4D71A 3D5HA 2GK1A 3WF0A 5EB8A 1GOIA 4XX6A 3W27A 3WY3A 3AHVA 4JZ5A 2WHJA 3BLKA 4B15A 3QGVA 2WLZA 5E70A 1KCKA 1TA3B 2F8QA 4D72A 4WKAA 2VRJA 1G0CA 3OA5A 1V0NA 3H55A 1S46A 3BUPA 3SUUA 3SCOA 2E4TA 1Y7VA 6TAAA 1OM0A 5BRQA 2A3HA 4FMVA 1CGYA 2E40A 4CD4A 3VIGA 4PSRA 4DUVA 2DIJA 1GOMA 3WBAA 3PZTA 4AMXA 2YDRA 3ZOAA 5A69A 4D6CA 1GQLA 1VBUA 3T09A 4CD8A 3BCFA 4PMUA 1WKYA 4H41A 4JKLA 1QNOA 1ITXA 5GNZA 3ZR5A 4PTWA 1R8LA 3RM4A 1ISWA 5BWFA 2VVNA 1JDDA 1XSKA 1IT0A 1JI2A 3SEPA 2X2YA 1TUXA 5I5RA 1J12A 1B90A 4UOZA 1NQ6A 4UOQA 2VO5A 3O2LA 4V28A 3B8SA 1QWUA 3POCA 2V3EA 3AISA 3DC0A 1E72M 3FXYA 1PAMA 1UWSA 1V6YA 1K9DA 4TVCA 3L4TA 2J62A 5FIPA 1JIBA 3GM8A 2E9MA 3ZSTA 2DT3A 1FP8A 1WAWA 5I3DA 4P8XA 3WNPA 3CMGA 3D4YA 1RP9A 3W37A 4U2ZA 1EXPA 2ZX7A 1C93A 1WDRA 4LYRA 3O9NA 4MDPA 5IFPA 1LWHA 3WIJA 1V3LA 2J4GA 2W5FA 1XD1A 3EDJA 3ARQA 2YBUA 3VX1A 3L2MA 4WK9A 1NWSA 3WQVA 1Q6GA 1LLOA 3DYOA 1XYFA 3CPUA 4CN1A 1WO2A 5CLTA 3M6DA 3NJ3A 1HJVA 5CPTA 2CBJA 4CCDA 2J47A 1E5JA 3O6AA 3WKZA 1JFXA 3ZT6A 4KRUA 1W9VA 1W9XA 2VRKA 4B3KA 2ALWA 5FD0A 2WKGA 5DFAA 1M01A 1GOKA 3MUAA 1JDCA 2X2HA 3VOCA 3NSMA 2XVNA 3AIUA 4HU0A 1VFFA 2CYGA 1JGIA 1K9EA 4HPHA 1C7TA 1CENA 1O7DC 3CZ8A 3LMYA 1NARA 1E6RA 1MQPA 3PZQA 5A94A 3BVVA 4DO5A 2UY2A 1V6XA 3WH6A 1AVAA 2EPOA 4JFUA 1HNYA 2VT0A 4EAMA 4NSBA 2VL4A 3SIMA 4LYPA 4WSKA 1H3GA 3GNOA 2BXZA 3W82A 4L4PA 5A6MA 1JF5A 4FNTA 1OCQA 5A6AA 3DDFA 5JBEA 3SCTA 1L0PA 1KWKA 1GOWA 3G6LA 3OGVA 3W4RA 1W1TA 3A21A 1DHKA 3VMPA 4GKLA 2WANA 3EMCA 3SUSA 3OIHA 4D6HA 1UQYA 1UQZA 2BVYA 3PN8A 1GPFA 8CGTA 1ITCA 5E6ZA 4NRRA 3BUQA 3VSUA 4WSJA 2JFEX 4W7WA 3AZSA 5D8WA 1WDSA 3M07A 1BPLB 3ZQ9A 5I77A 3OLGA 5AY7A 5A6JA 1JZ2A 2CKSA 1CXIA 4OBRA 5E9AA 4W7VA 3AJ7A 3PZGA 3MI6A 2DSWA 3GYCA 3RPMA 4R27A 4AZCB 4CVUA 4TUFA 3TOPA 1B9ZA 5I23A 4ACZB 3WELA 1OT1A 3CHDA 3AS1A 2J7HA 5AC4A 4CN6A 3W28A 5ABFA 3W53A 5CLWA 1E4IA 1GOOA 3LRKA 3VM5A 2WMIB 1V0MA 3WNNA 1ISZA 1R7OA 4E8CA 2Z1SA 4J3XA 5F7UA 4BF7A 4J3TA 3EJPA 3DX1A 2A3BA 3VPLA 2NW0A 1UD6A 3MMUA 4AD3A 1TQUA 3ALGA 3NDZA 4ML4A 1UR1A 3OLEA 1U2YA 4AIEA 2VJXA 4MB4A 4M80A 2BS9A 3CUGA 4NX0A 1DEDA 2F1AA 1E4MM 8A3HA 1ZU8A 2XG9A 2WBKA 5E0CA 1NWUA 2Y2WA 5E6YA 1HVQA 3A4WA 4B16A 3PTQA 1HJWA 3KEHA 3W81A 1H41A 5KZ6A 3OBAA 2OSWA 1G9HA 2WCGA 1XC6A 2BHYA 1QOXA 3N12A 2CITA 2VOTA 3GNRA 2YLLA 3DYMA 4GXPA 1PEZA 1NWRA 1PX4A 3ARPA 2PWEA 3WUGA 3G6MA 4WJXA 4W8AA 3K8MA 2WVUA 1H4PA 5D4YA 4HP5A 3W26A 4AD4A 1AQ0A 1TQVA 3PZOA 1KXQA 4CCCA 1WE5A 4WKHA 3CH9A 1JYVA 1TE1A 3AROA 4EK7A 3HG4A 3WY4A 3CHCA 3EYPA 4S3JA 2DGAA 2E0PA 4UCFA 1TR1A 4UFIA 3WH5A 5M5DA 5CG0A 3VIPA 4W8LA 4AEEA 3FHQA 2BNJA 3M46A 3UR8A 1JZ5A 1KTBA 4PRWA 3ZM8A 4QLJA 4P7OA 3FAXA 1MVYA 5D8ZA 3N15A 2F2HA 2FDMA 5CPQA 3WMCA 3GXIA 1QI0A 3JUGA 3EDDA 2WBGA 1K9TA 5CPSA 1ZBVA 4EANA 1E43A 1W1PA 1BYCA 3T0BA 3D4ZA 4LGXA 2ESCA 4GI6A 3BUBA 1SMAA 1V02A 4D1JA 3IJ7A 5BXSA 2W91A 1WPCA 3GBDA 3WBEA 3LPGA 2X2IA 4MPKA 3AQUA 1V0LA 1UD4A 3KLLA 1HX0A 4AY1A 2DH2A 3FN9A 1QPKA 3DECA 2CPUA 1HTYA 1VFUA 1UHVA 1FH9A 1B31A 4ACYA 4ZEPA 2G3NA 2V5CA 4DUXA 2WVVB 5HOSA 1UD3A 4AYSA 2BXYA 3VX0A 2CESA 2CERA 3WDJA 1F4AA 3FW6A 3IGUA 1OB0A 2VX4A 1IZJA 2WMJA 4TX6A 3RDKA 3SUTA 1EGZA 2DH3A 3BLBA 2AMGA 4PSPA 3WH8A 3OLIA 4HU8A 3HJEA 5A6KA 2BY3A 5LA1A 1I1WA 1JXKA 4JHOA 3RM8A 1KBBA 3OGSA 3W6MA 2XSBA 4DM2A 1WZMA 5I6SA 3T08A 3BGAA 3GZAA 4YHGA 2EXOA 1TCMA 3UR7A 3HG3A 4UFKA 1VBRA 2WLYA 1M53A 5M17A 4CU8A 2ZOXA 3PTKA 3WQ4A 3WFLA 4MJ2A 1RP8A 3CZJA 5I79A 2YA1A 2WYSA 4HA1A 5DO8A 3ZT7A 1PJ9A 1W9UA 3UERA 1CDGA 1FH7A 2ZUSA 1MWOA 2G4FA 3AIWA 4CVWA 1V3JA 2FYVA 1M7XA 4JIEA 3VIFA
chains in the Genus database with same CATH superfamily
3H9SD 2ALRA 1IBZA 1NUGA 4WW2F 3R58A 3CC5A 3LHTA 4J6RL 3NM1A 4B3ZA 1ETZA 1LRNA 3MXWH 2Q9OA 4GRWF 2GUOA 4NQEE 1M4KA 5HUPA 4FG2A 5TDPB 2OMTA 3FFDA 1L8PA 3HC0B 5GJTL 2JEQA 3F5WB 2UZXA 1LYQA 2CETA 3VNIA 1G1YA 4HKXB 2UZYA 4B96A 4NP4H 2OMZA 2QJMA 3RTQD 2RD0A 3QC5X 3EF4A 3CVIH 4XAZA 4X7SL 4Z0XA 2VXTH 4HKZB 1FUNA 3B2UD 4UTTC 2VLKE 4QOKE 1OW0C 4FFTA 3HA0A 5ID1A 3MX0A 4CMHB 1XSIA 3VFRA 1QP1A 1N19A 1A14L 3QIWD 3L5HA 3LKSB 3SBWA 4TLUA 3RRAA 4YJZL 5FECA 1T1YB 3E0IA 4WI6A 3KWVA 4MA8H 2WJ5A 3REQB 4HNCA 1IGML 4GY1A 5IW6B 1I6NA 5T3XH 4O2EA 2BS8A 1L4IA 1N2VA 3JV5A 1JPFB 5LGJA 3DUSB 3KRZA 3G3DA 4ANXA 2XTSA 5J11B 2HVBA 2SFPA 4IXXA 4JN1L 2VNCA 5FS5A 4DGWC 4AGQA 2PP0A 4AL8L 1B0IA 2QEZA 3RNDA 1X38A 1Y65A 4AZGA 3MP3A 15C8L 3LTYA 3FY1A 3N50A 3D33A 4DP7X 5DURD 2CC0A 4UUIA 2DDXA 4Z76B 1MJ7H 4MAYC 1OK4A 2BMBA 2ICWB 1US2A 5DZAA 2CHXA 2IALA 2X89A 1PD6A 3DLQR 4DB7A 3W7RA 4M1GH 2XRAL 3DHUA 2DWYA 4JPKL 3EZ4A 3CUXA 2ZXEB 4X5QA 2QT3A 3T0VA 1IMHC 4GC3A 4QRNA 3ABOA 3NPSB 3PPGA 4LLWA 1G0XA 4HBKA 1J6OA 3V5FA 2Q02A 4ODHL 1Q6FA 2AABL 3UDWC 2CR0A 3HOJA 5A6LA 3T8VA 3PQYE 1KXTB 3L3IB 3V2AR 3LS5L 2YAQA 1KGXA 5JH1A 3ZE0F 2VURA 2C3HA 3M17A 3WTUA 2F5BH 5DRCA 4LNYA 1FZKB 3LQZB 4W9HC 3T05A 1H3UA 3SDCB 3SY1A 2OVLA 3N4EA 1FRGH 1EEQA 1W5MA 4L8CB 1ZL1A 4JFYB 2J6EL 5L2JA 1MFUA 5E2UH 4PRPB 1XDMA 2OTWB 3N55A 4CSZA 4OQVA 2LGNA 1FPTH 1F11B 3CVHL 5I8EB 2VXSH 4AYFA 3AY4C 4KNSA 1NC2B 2COQA 3WYZA 2V81A 5IMMB 4MJZA 2C18A 4GXUM 2A9BA 4R0LB 4EF3A 1JV5A 3ZTCC 3Q13A 1S7RB 4AGOA 1Q6DA 3GSXA 6CGTA 2D4DA 3GF8A 2XC8A 2GVLA 2A2QT 2IFGA 1SVBA 1VPOH 4DQOH 3TT3L 3EFOA 4F7MB 4BZYA 4IISA 1S9KC 3GQFA 4EI5D 3I7RA 2K7QA 4Q4KA 1EUNA 5JLZB 2R91A 1J11A 1NIFA 4LSRL 1EZVY 2OMXA 4GG6E 4GQGA 2JIXA 4J3VA 2YPKB 5LWYH 1SVCP 2OJEB 5I6XC 2DI7A 4NT6B 1JUFB 4DVOA 1GGIH 4PCKA 4U31A 2PR9A 1BVOA 2R2CA 4JTLA 1OF6A 3QDMB 1FF5A 4E9TA 1K6QL 3MJGX 5CINL 2KUTA 3Q5TA 3IIXA 3WEXA 3THMH 3MA8A 3DGRA 4XVSL 5FO2A 6FABH 1AC0A 4OBSA 2J1YA 3PGDA 1FYTA 1HO4A 1XF0A 1DFBL 1CI3M 2AAAA 3MFGB 2A9CA 5JHAA 4IHBA 1MW0A 4UV4L 4KJPC 4C6JA 1NSNH 3GR8A 4WGWB 1H8LA 2HTLC 4WZHA 3RLVA 3OB0K 3CIXA 3HNSH 2YL5A 1N6VA 1JHTB 4P2QD 1ZTXE 1H6UA 1R19A 3L08A 1QSFA 2FIQA 4D2NA 3WTYA 1QPQA 4LUTA 4TMCA 1S7QA 3WF1A 5K9JH 4YXHL 4F15C 3I75B 5CJQL 3IUHA 2OL3H 1GTHA 2NUTA 4NO0B 1E5YA 5DZLA 4Z7QE 4X5PA 5HMFA 4JFOB 2HVKB 3L2LA 2WZ6A 4H7VA 1L6PA 5HDQL 1UURA 4XZMX 1LVEA 4H0IA 1BRLA 5IW1B 1HILA 1P84J 3B1UA 2DI8A 1MFBL 1SXNA 1MFEL 4ZFZB 5INDA 4GE8A 2PCEA 3WXWH 1RERA 3GC2A 3OKMB 2E68A 5D5MB 2DZPA 3WK2A 2OS7A 4BCZA 2H2PC 1R30A 4AHPA 2OWXA 4ZW5A 3DX3A 4G6KL 1YZZA 4RGOL 3X3FL 5IBLC 2E6YA 4UM9D 1ZFJA 3P74A 4J35A 2WXGA 4RRPM 5CBEB 4YBQD 5KSAB 1VFAB 2VABA 2L0DA 1Q65A 1ZKAA 3RIKA 3ULUC 5DHMC 2HFFA 2IFFH 2AAMA 1TYJA 2G75B 4NJIA 4OOUA 4PJ9A 1RUKL 3CFBA 2ZRWA 2R2HA 1GQNA 4IRSA 4AMCA 1V08A 5A8OA 4PREA 1XL4A 1VRSA 1Q90A 2B39A 4JO5A 3L1OH 3IV3A 4NO2B 4OGZA 5H8PA 3QISA 3L9EA 1I2RA 2XV2A 4D6GA 2IXQB 2N0MA 4IOSD 4WV1A 5IM7B 5D30A 2W0KA 5HGGS 3CAKA 4GY7A 3K81A 4E2OA 3EA3A 5I1IL 1LP9E 3W7KA 5C0BA 4XNQA 4H8WC 3P80A 4TVPE 2OYKA 5JPNA 2GGHA 5A6TC 3BXNB 4M56A 2EPNA 1VRDA 3QHTC 3RM9A 3AS0A 1OWRM 4MD0A 3GB6A 4JFFA 3SDDB 2DQTL 3P0XA 1FVEB 2EQDA 4Z8FH 2PE4A 4JG1H 1TPB1 3TH6A 2ARJQ 3WK1A 5ERWB 1QI2A 3ESUF 3LKRB 2GTWA 5DD6B 1F4YH 1JQXA 3C6LC 3US9A 4M82A 3QZMA 5AYUL 4WJKB 1R3YA 2E86A 4F9DA 4JN2A 2ZBTA 4DWSA 4BWLC 1SW0A 5DZNA 3NGBB 4R6UA 3CAWA 1OAKL 4HIPA 4XP5H 1FTXA 2X5PA 3DN5A 1A6UH 3W71A 1IM3B 2ROXA 3AIVA 4AEOA 1WWWX 1TJMA 2J78A 1HP4A 2H8PB 3UYRL 1HL9A 2BZ7A 2GSMB 3LZLA 4FXLA 5H2ZA 2LU5A 3UIZA 4B9JA 1WC7B 3SY0B 3UBFA 2P1FA 2DY2A 3HI5L 1OBAA 2D03H 3QDGD 3PWVB 2IPTH 1G6RA 2FX7H 1KCXA 4S1SH 2Z4QA 3PBGA 1U8PA 3WL9B 2OOGA 4GUCA 2CKRA 1MUJB 2NQCA 2H32H 1KFKA 3CLFL 1LL7A 1KYFA 3IE4A 1V03A 4R83A 3UMTA 3GNXA 2ALDA 3OU8A 4NQXA 4OJDH 3K80A 3QP3A 1U8MB 3MRCA 2Y1ZA 1WG3A 3BVNB 3TSBA 5DR5H 3SGUA 1R0AL 4PMFA 1YYML 3T0XA 1NL0L 1MW3A 3WFCL 5IQ9B 4U3XA 1P1XA 3MSGA 2XACC 3P93A 1AGFA 2B1OA 3WV0A 4YYCA 5AQ0A 3R5EA 1QNPA 4ZFMA 4RW3A 5AYIA 1V5JA 3P0VH 1FCUA 3K46A 3BIBX 4HN4A 4N2NA 3OC5A 3T3MF 1T22A 3BPCB 4B9YA 3FHAA 1S7VB 4JKPL 2DMGA 1XI3A 2H2PD 3U1SH 1SN5A 2O9PA 4U1GC 4ZCWA 2EG8A 3OZKA 4JM4H 1K2DA 4TULL 4ELMA 1R3VA 3LGDA 4EBQH 3H7VA 1ILSA 4X98A 3W29A 4XB3A 1SPQA 5JHLH 4Z78B 1FNEB 1HYRC 2NXZC 1YUHA 3P1VA 4Z3HA 1MO0A 3L5MA 3VE0A 2EPHA 4KU1A 5MP6H 1BCIA 3UWWA 4M00A 3WKML 5F7DA 3ATFA 2H3KA 2JB5L 4MA7L 2BSSB 4JHUA 1NELA 3WE1A 2VL5B 4C8XA 5E5RB 3POHA 5L8KB 5MHSD 5E4OA 3VCLB 1BWLA 4BF5A 4JY4B 5HD8D 3GINA 2GJ6D 3ZX1A 1MFAL 3VNYA 1GGYA 4GSDL 4AZIA 4AE0A 3AHZA 4XN4A 3AJXA 4DUOA 2DBLL 2XV0A 3MV8E 1IQWH 3R11A 2VLRB 2XIOA 3SGDH 1GHFL 2CLVA 2YXWA 3SRFA 1RZKH 2B9AA 5IROC 1TVDA 4GIYA 3U0PB 4HEPG 4MJ5A 5K39B 4H13C 2JFCA 4TMPA 1UB5B 2GCYB 3A0OA 2PRLA 2VVSA 1KFJA 1GCYA 5FW6A 3NCFB 4Y4KD 1P1VA 4UFMA 4ZQKB 4P4KC 4L80A 1FFQA 4XN7A 4N0FB 4N0RA 1KFBA 2BDNL 3QFGA 4DZ8B 5DD1L 5CXPA 5TE7L 4MMXC 3Q8FA 1I3RA 3BOLA 4WY7H 4FNLH 3IKCB 1B2WH 2AJYH 4H0LC 3LEYH 2YXGA 1R5VB 3VU2A 1BX2B 5A2CA 4GY0A 3BG9A 1V7NL 1Y5XA 1F13A 2HG5A 5D2TA 3RVUC 4CN4A 5CC3A 1RR2A 4ORGB 3WKPA 5D93C 4YCOA 5AYYA 4NRYB 4FOJA 3CU1A 3ARED 3P3BA 3TWBA 4M02A 1KF9B 1KIUA 1H7NA 4P5MA 1GUVA 3GO1H 3LRGA 5IY5B 3ZDZE 1EIXA 5C9WA 2DYPA 3EOAB 2IAND 5HYJA 1FDJA 2NXGA 5IFHL 1W8SA 1AGCB 4I18C 2XYCA 4YHYB 1JF1B 5IHZA 1DBBH 1JRHL 2HPIA 1A9EA 4MQ7A 5E2TL 2JI3A 2O5XH 1FL3B 2CMRH 4YDNA 4AQLA 4R96A 4AIUA 1YTDA 4G7YH 2WXRA 5LQBL 3U6XA 1TZHB 1TRIA 1W8NA 5D04C 2X70A 1A3RL 1TSIA 2QQQA 2R1XA 4G6FB 3WFDH 3O2DA 5BVJA 1RPKA 2X0UA 4BI6A 5EN3A 2CHOA 3ZTJG 1K4CB 3GXMA 4P9HL 3B3DA 3GMLA 3O07A 1G7LA 4QYAA 3WLLA 4Q9QH 2WNKA 3V10A 4XK2A 4Z3GA 4KZEL 3KJ4B 2A74A 5E9DB 1R7AA 4F7TB 2Y2YA 4KK5D 4YK4B 3HB3D 1JZ4A 1M1XA 2NXZD 3QJOA 5B3JF 2QJNA 2CWXA 3R0NA 4AJ0A 1SO3A 3TYZA 4PMXA 3TK7A 4Q6XA 1QFWH 2J1WA 1ETZB 3UZQB 2GUOB 2ZNWA 5I09A 3PRZA 1Q85A 3SHSA 3FFDB 4N22A 2B8OT 1M04A 4Q22A 4MJ4A 3NZHH 3FSWA 2UZXB 5LGHL 4JM2A 5FO8A 3HGOA 2IDQA 2UZYB 4LCCC 4PMEA 4PRRA 2DJMA 4KXDA 3W1LA 5IROD 4YLWA 2ZQ0A 2WHJA 5ALCH 3EX6A 3L17A 4D72A 1R9YA 4MWAB 2C3ZA 3ZTDC 5ID1B 3B2MA 1S46A 2ZOKB 3MX0B 1BZQK 1MNUH 3VFRB 5HPMB 2GB2A 1FWDC 4PG2C 1EBPA 1I8JA 3QMSA 4GK8A 5FECB 3KHDA 2YDRA 3ARFC 1BOGA 1YNKL 2EDQA 1UWXH 5GNZA 3S8GB 4S3CA 4UIOA 3Q65A 1BAFH 4HBQA 4O2EB 4GJTB 5BWFA 2J24A 4PI2A 2RB8A 3O3BA 1ONWA 4XMXA 4HQQH 3AWFA 5LGJB 2J20A 5DHXB 5D7JC 2VWEC 2Q09A 3C2EA 1QWUA 3V0WL 1JPDX 3A6CL 4IFRA 4ATTA 2P50A 1TSHA 3HI6H 1P6CA 2AZAA 3BIAX 7ENLA 4XZLX 3AVEA 4UANA 1XD1A 1KCUL 1C5CL 1OAJA 4YWGH 1LLOA 1BYNA 1XGTA 2CZVA 3WGVB 3Q2VA 4LLMA 1FNAA 2IALB 4YJ5A 3S98A 3AG3B 1XQKA 5CD5D 3MRQB 3TEUA 4AY0A 1SZFA 1W9XA 4LU0A 4EXPX 1YPZF 3RU6A 3FF7A 3DI3B 3NSMA 4NQDA 4N6QA 5AOMA 3CZ8A 1Z5HA 1B9BA 2AQQA 5F7WC 2HZHA 4Z7WB 4AEIL 1K6WA 3WUWB 2VL4A 1H3GA 4HXBL 4LLWB 3VAEA 4FX5A 4LLYA 1GYMA 3FUEA 2E25A 4MXWL 3DBXA 4Z7AA 3OVGA 3LEVL 2TRSA 3OIHA 4B7IA 3VTMA 2HXAA 1UQZA 3WNJA 4A3QA 1FY6A 3PPCA 3PAYA 3TF4A 3UMNA 3M17B 3IFNH 4XO9A 2VM8A 4OCYL 4LEXL 4MLSA 3OAUH 2DSWA 2AGTA 1TTIA 1FDYA 3OXSA 3UJTL 2EDOA 4CVUA 3FT0A 5HVFB 3G0SA 4F93B 4WEBH 5L2JB 4IJBA 4XBPA 1UB6A 1QPXA 3W53A 4NQUA 1ISZA 3OAYK 1S2CA 3GG7A 2Y63A 3NMEA 2XTJC 4QXVA 3OC8A 4AIEA 4NN7C 2QQNL 4AYFB 3UAAA 4WW2A 4L3ED 3S3JA 5KZ6A 3LDBC 3ROLB 3AUJA 2DQJH 2QZQA 2FQIA 3GFYA 4EN3C 3MRRA 1N5AB 2OCFD 2AITA 3UNTA 3EFOB 1REQA 1IT7A 3EOLA 3NFUA 5MEND 1WRFA 4XMLH 3LS9A 1NM4A 3EYQC 4WY0F 2OMXB 1BMGA 2XV6B 2X9XA 4LARL 5AUMA 5AWNH 3C8FA 3F83A 4KO9A 1OYAA 3HRZC 3GSWA 5D2NA 1UPPA 4M3JA 5E6ID 35C8H 4YDMA 4PV1C 1ICSA 1X4ZA 5TDOA 1EFZA 2UYLA 3WEXB 3PIQA 3MJ8A 5C7XH 5KVFL 1RD5A 4L1BA 4Q6KA 1M2OA 2R7EA 3ABZA 3DC8A 4E6MA 4MKNA 1G9MC 4HC1H 4P2RA 4HBCH 4GAJL 4PJ7E 3VZZA 4JHOA 4DW2L 1USQA 1A6VL 4I3GA 3STZA 4HPOH 5C0RH 3BGAA 3EF7A 4G11A 4X9SA 2CK0L 2WB1A 3FJNA 1S7QB 1IWPA 3NVQA 4E9XA 4HA1A 2NUTB 4DP8X 5TBOA 1QTYT 2G4FA 3B4UA 3MA9H 5EU7C 1PUDA 4A3UA 1KCVH 5C0QA 1TJRA 4WR3A 4GYJA 4U4BA 4GGHA 1V05A 3AT0A 2EUVA 3R19A 1HILB 4FFYH 2O6PA 3K5RA 1N8OE 5HR6A 3BPOC 4RA3A 5D4HA 1TJ1A 1H6EA 5INDB 4WLCA 3C09C 1LCOA 1AP2B 4KEVA 3FCTA 4AGNA 4PBGA 2ENQA 3RPBA 1KTNA 2VKZG 5CNHA 3F6JA 2WVSA 4N42A 3CN1A 2JTDA 1DSFH 4YL4A 2GGIA 2PPDA 4PVLA 5TD4A 3APTA 2HJFA 5J12B 3WQEA 3KPPB 1D9EA 5HYSG 4U3CA 1JCKA 4F3HA 1KM2A 1D8WA 4X6CF 1RJQA 3NVTA 3U2ZA 4RISL 4Y2DD 1L2QA 3W24A 2YD2A 5I9QB 3ILQD 3D9AH 2G60L 1CCZA 3NA8A 4G6AC 2VABB 2P5WA 4J2PA 3KBFA 2OULB 5JIIA 3D3AA 4YSPA 3A4XA 1QCWA 4AWUA 4FERA 3ZJKA 3O9WD 1K8ZA 4JFZH 3NCOA 4RAVA 3C2YA 4PJ9B 4FNSA 2NY6D 1KSRA 3CFBB 3LDVA 2R2HB 3U6RA 4IRSB 4G80A 1GSKA 3H56A 3CIQA 5CAHA 3EXJA 2DYSB 5AZUA 3K2MC 3WMBA 3BN9C 3G8RA 1KFCA 3G0XA 4OCSL 5EMYA 1X4YA 1DBMH 4WHCA 4TVPL 2BJMH 4JFQA 1UKOA 2PS2A 2FEDC 4OQTA 5EO0B 1EKOA 1TV8A 2DBJA 1E5AA 1HHHB 2E59A 5C0BB 2FLMA 5F1NA 3KPSD 1DLHA 5JPNB 1F61A 1SRDA 4FQJH 2AGJH 1SFTA 4FFZH 4MJIE 4NBYB 4UZUA 3ZKXC 4MD0B 4RZ6A 1PNCA 4JFFB 2OMNA 1T4KA 3SQRA 4IGSA 3KGRA 2NT0A 5E8PB 5HWNA 3KWUA 2XQYA 4DLFA 4M5TA 5LNEA 4JMXA 3HE6B 5GS2H 1VFBA 3NQ7A 3CZFA 5EORL 5IHRA 4OVUA 4DWSB 1HQRB 5KINA 4JHBA 4QE1A 3C08L 1YN6B 2Y5SA 1XMWA 3EH1A 4TTGA 3G77A 2O6EA 4YE0A 1RURH 4MNQB 1E15A 4O0KA 2BIIA 2W65A 2DDQL 5CAKA 4ZPVA 4IOFD 5F2FA 2P8LA 4CNOA 1TWDA 3VMOA 1PIFA 4UQDA 1HEZA 3QFJD 4OD1L 3NDOA 1TTPA 3GE7A 2A5UA 2J3SA 1YEFL 2FB3A 1QX1A 4NWUH 3ZDYF 2I5QA 1G6RB 3CUPA 1TMCB 4QEEA 4WOZA 3UP6A 2Z4QB 3ARGC 2AJXL 1U8PB 4W87A 1IIGA 1J9SA 4H8VA 3S2CA 3KVLA 3G1FA 4Z95L 4XI5D 1UD8A 1LL1A 4UTUA 3SGJC 3BP5A 2KAUC 4HJJL 3JV6A 3FFCD 4O1CA 4NQXB 2KL6A 1BYAA 3W38A 5I1CH 3SGKC 2LLGA 3MRCB 1KIPA 1LOSA 4EN2A 4JLRB 1U8LA 1R2RA 3C60C 3O4LA 4XAYA 1QLFA 4PP2A 4V27A 2KPWA 4GAAA 3FT9A 5LVEA 4BH7A 1IFRA 1T22B 1V3IA 2WHMA 1VFOA 3N40P 1XXFC 1TWIA 5KN5A 3BSZL 2E76C 1K2DB 4PMOA 4YVPA 4NJJA 4ELMB 4DPRA 4FQXD 2P88A 2ACRA 4X98B 1XTMA 1CGSL 3C2AL 1XIDA 3NG3A 1LDPH 4ADIA 1D6VL 3TX9A 1N0XH 1MCCA 5C6TL 4G6AD 3CCHA 4AYID 3W2KA 1YUHB 2AV7A 2ZUTA 3VE0B 3R0DA 2XN9E 2ICCA 2XUWA 1N59A 1W8OA 1F76A 4PEEA 2LTQC 4UQ2A 1DXIA 5KVEH 1IGYA 4H8PA 3MYZA 5F7DB 4KVCH 2QKIA 1SYSA 5GSVA 2PR4H 1QR7A 5K69A 3RWCA 4ZFGL 1FQ9C 4YTSA 3LNDA 5T33L 4NGHL 5IMOA 1OFEA 3A9IA 1NCAL 5J06A 4JRXD 1J8VA 3ZGHA 2H9AA 2DWSA 3D2UD 3VXUA 2QMKA 2YQ3A 3H9HA 1QG3A 2BPBA 2CLVB 2Q5BA 2OODA 4HF5L 4Z7NF 2VI0A 1VHCA 2XG4B 3TYEA 4GI8A 2BINA 1BEUA 1JZIA 5T9BG 2HUHA 3CFJA 5KOVC 2JSFA 1QJWA 3HUJE 3L23A 3PHAA 4QJ5B 1OD8A 4WVXA 4TL4A 2ON3A 1E0UA 5KS9E 3M8OH 4U28A 3D3VA 3WBDA 3UP8A 1FWSA 3OYXA 3WJYA 4KKAD 3KG5A 1JGUH 4PY8I 4XXCC 2BZCA 2RGMA 3GMMA 5KEZA 3ITYA 4WGKA 1J0HA 3QQWA 4ADGA 3W1UA 5T3ZH 1CE6A 5CPMA 2HG5B 3OGOE 4JAMA 2UBPC 3CB8A 2CZ5A 2GW5A 2WWDA 4PWHA 5ICXA 3PY2A 5EH1A 5HBFA 3LCWA 1UJPA 5EDXA 4L0PB 2PCQA 1KIUB 4MB5A 4C6PA 3LCXA 2DZEA 5AG9A 3CLMA 2R59A 4FOKA 2X6UA 1K3UA 2AVFA 4BV1A 2DYPB 2EO9A 2VERN 2A7PA 3QQ0A 4C6EA 1I3GH 1A9EB 1AGEA 2JGYA 3PWGA 4APQB 4YN3A 1E5ZA 1M71B 4JHZA 1V55B 2AZUA 3O8XD 2IH3A 2PEVA 2EDLA 4F20A 3KS0H 3NEEA 3MSYA 4KQ3H 3P54A 4NXSA 3IMBA 4AQOA 3GXDA 3FTSA 3EYOA 3SO5A 3PWJA 3ASOB 3CXHJ 1CDYA 4EIBA 1WSST 3GMLB 1QLRA 2Y36L 1G7LB 1DEEA 4ZTEA 1IAIM 5E1QA 4CKQA 1CVRA 1TZ7A 2JJVA 5J9PB 5DCBA 3LXUX 2A74B 1V93A 3VFUA 4NENB 4ZOAA 4YXKH 5B80A 5EU6D 5E9DE 4FHKA 2NY1C 3S1GA 1M1XB 4Y19E 4JQ4A 3R79A 2ZADA 2D3JA 3UAJA 2CHNA 2NXYB 4BELD 5HGBB 2PGEA 3GS6A 4C4KO 3MBED 1MI5D 3S46A 1RZJH 3HZKA 2NZ9D 2D0HA 1FWGC 2F9RA 25C8L 2W63A 4Y9PA 3T8XA 5E99L 2FCBA 2I1OA 1EEYA 3IJEA 1RH9A 5DJYB 1XBYA 2ZCZA 2XVLA 3WH9A 1UA3A 3NFNA 1Z3RA 3QZPA 3BTNA 3CUJA 1AY1L 1YW1A 4MWAE 4MXQD 1EIBA 2E5CA 4UV7L 4U33A 3UJFA 5FA5A 2ZUYA 4X9HA 4RSVA 2BNUA 3H85A 2UV8G 1NQBA 4OFDA 1BOGB 2GT9B 3MRGA 4I5BA 3TYDA 4H6QA 1H7OA 4BHUA 1NGPH 3WN6A 2YSWA 1B4TA 3ZR6A 4EPEC 3EWUA 3BRGC 1HJBC 3P9LB 1FDZA 1XIGA 3PV6B 4K2SA 3O3BB 2ZIDA 4PMQA 3DSNA 3W6LA 3T42A 1FWEC 3IPFA 4GQZA 3LHWA 5FUZL 1UADC 3GH4A 1KTRL 3IAQA 2MWCA 4N2KA 2GJXB 4Z7VF 1EPVA 5EO1A 3IGHX 5HA7A 4N2DA 1PVNA 3P77A 3RPIA 3KYNA 1I53A 3NTCH 3U4FA 3AAZB 2NLIA 5E8DL 2BHUA 4W93A 3GI9L 2ZUMA 3QXWA 4LLMB 2J88A 4OY9A 2NSMA 1PX3A 3HFFA 2J6VA 1XZ0A 4QR6A 3MLZH 3WJXA 4N9GA 5CILL 3RTQC 1XF4A 3RL1A 3SD2A 1KFWA 4QI3A 3ZPDA 1XSOA 5J6SA 3B2UC 2I9TA 1XW8A 2ZKYA 2WNWA 3UTSA 4QG9A 1FVPA 1QNQA 4UZGA 3QIWC 2Q01A 1UYWH 3B9AA 2ITFA 2BFGA 1LBFA 2HFEA 4K37A 2Z65C 4DZHA 3BL3A 3QJAA 2H9GB 4CQDA 4UTAH 1ANUA 3S1WA 1YMMD 1HJUA 3LNPA 1J7VR 1BDYA 3OXSB 1QABA 4CILA 4LDOB 1FL6B 4DJFD 3RO6A 3E38A 4WTWA 3HFYA 4XBPB 1UB6B 2B1AH 5DEFA 5AVYB 4XAKE 1BEYL 4B9FA 4PYHA 1Q6LA 3MMDA 3IDYB 4V15A 2AJ3A 5C9JA 4NKIH 4HKJB 3VXME 4F4RA 1A0EA 1G9NC 3QXVA 4EIVA 1E4NA 1VEOA 5C54A 2D7TH 4UOJA 4YSSA 5BRZD 2HZGA 3CH1A 2HNEA 2Z31C 5CJOH 3TMLA 1ZIAA 2E9BA 3FMGL 4DH2A 4LVOC 2UWEE 3W0WE 3BSGA 4XVUD 1HVXA 4F79A 1HHKA 2VH5L 2XWDA 2IJ0C 4MPQA 1GOXA 5CD3A 2HH0H 1REQB 4P7NA 4Q58C 5FDWB 4M1BA 1GQKA 5T1LA 1IGJA 1NFBA 2VGIA 2NQLA 5AUMB 4AF0A 4DQAA 2AEWA 1EJTC 3BH4A 3UADA 1S5IH 3GSWB 5KUKA 5IB5B 4WFEE 1E9QB 5D2NB 4KKCD 1G87A 1GPOL 3ECBA 5G5DA 2C26A 5ES4B 1TTRA 3G1RA 2BOBB 1K5WA 4BM7A 1I0BA 4DEPB 3IIOA 5AW9B 3KXQA 1PNDA 2O5YL 4F57H 2UYLB 4OZGA 5GRJH 7ODCA 3T2NL 3PIQB 3MJ8B 5FEWA 2X2UA 5JA8B 4LRNL 1IXNA 2J27A 2R7EB 1KGCE 2OQJA 5JH2A 4P2RB 2O6DA 2HPOA 3B04A 4E8DA 1FSKB 1QUNB 2A73B 3PPHA 1B3VA 1C9DA 2BVQA 5C08D 2WO2B 1BZ7A 4X0KA 1XZWA 4FNUA 4P7LA 2JK5A 4LCWD 5DK0A 3FT4A 1VS1A 1Z0NA 3STZB 4KXAA 2E46A 1KCSL 1CPUA 4Q9BA 3PPEA 4LRSA 4IX2A 3BDKA 1QHPA 5F70A 2VC2L 1T89C 4AQZA 3CTTA 1KENH 3H2FA 4XNYH 2Z2BA 1G94A 4B6ZA 4JFPA 1IAKA 3NIFB 4X8JA 1C5BH 4KWOA 3IWPA 3EH2A 4N2IA 1CU4L 3R7RA 1RZ7H 2XZ7A 4UQCA 1YPZA 3QHNA 2FGZA 4EI5C 3EMZA 1LQBC 1NIAA 2CCLA 2FX9L 3T0WA 2E1WA 3QUZD 1AHMA 1F4WH 1OSYA 5EOQL 4O53A 2OFQA 1NMAL 2BRRL 1ZBWA 2WJZA 3FCTB 4HWUA 3QHFH 3H2PA 2AW2A 3JUZA 1NFKA 3FTYA 3VG9B 2W9DL 1P1ZA 5FAJA 4LCIL 1XLGA 3UG5A 4ZXLA 3TEVA 1AA1B 4P04A 2Z25A 1B4LA 4ABUA 5AZ2L 2HJFB 1II4E 3ZDXF 3EBGA 4TQ8A 2WSYA 5FJJA 1G5GA 3BGFB 4U4MA 4MFHA 4NN5C 3VWJA 1Y6MR 3RHWF 4M5PA 2P5WB 1OZQA 3P5YA 1G7MA 3CT7A 2NWSA 4RDZA 4HWNA 4RAVB 3CQKA 4BWUA 3U6RB 3FZUD 4G80B 2AK1H 4QTHA 3FH8A 2GIXA 5E1GA 4FI8A 1ISWA 3OJGA 4I1PA 4NRZB 3ULUH 1Y18B 2Z31D 3QAQA 3FL7A 4JFQB 3V4VH 3TFKD 1WZ1L 3UC0H 2NY5C 4QHMA 2HLAA 2JI1A 2IBGA 4ERSL 2J72A 3HC3L 4ALAC 5F1NB 5L9DL 1JIBA 4W1TA 4W68A 2K78A 2VR3A 2J5WA 2ZX7A 2A1WH 4DERA 2J4GA 4O58L 3S8HA 4WK9A 1MFDH 4H8WH 1X96A 4FL4C 2AJUH 2JCCA 4JPIA 5GGTH 4RXFA 1W72B 3QXDA 4KV5E 4FXGB 5A40E 2RJMA 3T6CA 3GAKA 3CZFB 3C6CA 3ZYZA 1KM0A 1NFAA 3JWNG 1MQPA 3PZQA 2B7PA 2VN5A 1KRMA 2IDTA 4QRRD 2W65B 2XNAA 4PHXA 4MNQE 5AC8A 3EKCA 4YBQC 2P8LB 5E2VH 4BZ1H 1HEZB 3L7EA 4TLSA 5HGDA 1CFBA 4KKNA 3I6LD 4DN3H 1DQMH 4XB8A 2PTDA 3KXFE 3MVSA 1ITCA 1WYJA 4PWEA 2HWZH 3D85D 4FZ8H 3GDTA 5I77A 5AY7A 1JZ2A 1MIMH 3CHSA 1KW1A 3EPNA 1EP3A 2WD0A 4OQ1A 2V17H 2JKLA 4HXAL 4CN6A 1E4IA 3VM5A 2CHWA 1R7OA 2EUXA 3M1BA 1A5BA 1U8LB 4I48B 3NDZA 4NZ1A 3O4LB 1QLFB 3BE1H 1XGRA 4O13A 1TPC1 1JFQL 1XC6A 5L88H 4K3EH 2BIOA 4Y1AE 2D69A 4W8AA 1TQVA 1E5CA 4OAWA 4RRPG 1FIGH 4L37A 1DDTA 1TE1A 3CHCA 1XXDC 2K6ZA 1D7CA 1DQKA 4UB9A 5M5DA 1XEDA 5D72L 3MBXH 3UR8A 4O00A 5D7KE 4EQ2A 4NAFA 3CCHB 4H40A 2AV7B 2F2HA 4M7LH 2ITCA 1YEHL 4FEMA 4X6CA 5I06A 1QO3B 5ITFA 1I1YA 4UQ2B 1RPXA 5G4EA 1ZHNB 2YAHA 3QI9A 3V5KB 1IGYB 2QKIB 1SYSB 5GSVB 2OMUA 3RWCB 1GVSA 4EI6B 5LZLA 1W5QA 3H2OA 5LCVL 5IMOB 3AQUA 4LSUH 1PYFA 5A2KH 2PKDA 1YXDA 2DH2A 3DAQA 3N85H 3UPMA 1DJNA 2GWGA 1Y8BA 2ZG3A 2DN7A 4XISA 3LQAC 3QEHA 3O6DA 3CB3A 1R5WB 2Z34A 3B0PA 2V4LA 4W9DC 3V95A 1PKYA 4UAOC 1WBYB 3NEXA 1Q66A 1AQKL 1JSYA 4HT3A 4QBXA 3BZEB 4PR5B 3L5WA 1I1WA 1MCJA 4V11A 3P11L 2BP5M 3WKNA 3VKDA 4XPBH 5IVZB 5AB0A 4XN1A 5DYFA 3KD4A 3FCGA 2ANUA 2X4RB 3WFLA 3KYOA 3IK4A 3S1UA 1W9UA 1T5KA 4JPVH 3CYVA 3D3VB 4QGTA 1PZ3A 3BLEA 4Y4FA 3GJFH 2WNXA 3TW6A 2EKCA 2F19L 4YPGB 3N13A 4PJGE 4WDUA 3WLKX 3GMMB 3BZ4A 4PRIA 1CE6B 5GS3A 4JAMB 2JIEA 3C2OA 1NMCC 3EXLA 5ICXB 4D94A 1IC5H 2DQWA 1C92A 4K7PX 3F12A 4Z42C 3H24A 4K68A 4GAYA 1MRDH 1E5BA 4LOFA 4HWBA 2CE6A 1NCDH 3ECQA 4JQXA 1TA3A 4N0UE 3VVWA 4YGAB 4GBUA 1TQTA 5HD8C 2OI9B 4RDWA 1S5WA 4O4YH 4JW3A 3A64A 1ZSHA 1AGEB 3IMWA 3ATBA 1U1UA 3TQKA 4XOBA 4AM0A 2IH3B 4A22A 1GW0A 3N5AA 1T03L 3ZKSD 3B9KD 1WB0A 3CE1A 4P5TA 3ARSA 2X4QA 4AV5A 4B9IA 4IIGA 4JEQA 3EYOB 4RBPH 3LXCA 1ITBB 3C9NA 3AG4B 3PWJB 4Y4KC 2VR2A 1JCJA 5JW3H 1K77A 3KYKH 4D6EA 3JWNH 4W89A 4UOW1 4B2DA 1DEEB 1TYRA 5I6LA 3DESA 2EIBA 3DV4A 2C3WA 4GQRA 5HVGB 1DVXA 5HGAB 3BKJL 4OLVL 4KBPA 3VFUB 2B20A 3TNNA 1JCMP 3ARBB 1IB5A 1UR2A 3OBKA 3C2FA 4TSCH 2AOSA 4Y16D 1NAML 2W95A 5ILTH 3L3KA 4YE4L 2ABAA 3LN9A 2F1BA 4UTLA 3ITGA 3W1MA 3AREC 1KCZA 3PNRB 1F97A 5DF0A 4FQ1H 1MOEA 3V79C 4MAVA 4XNXL 3HZKB 3EHBD 3N2MA 3QDJA 5G4NA 5IESH 3R8BB 3E2HC 3LH8A 2JKAA 2W9LA 3D51A 5AEAA 1EEYB 4YLQT 2WPBA 1NC4A 2PCXA 3MLPA 3KHJA 3FYEB 3UD6A 1DBTA 4OZIF 3SSGA 3QCTL 4KHXH 3NFNB 1BYDA 1ECEA 3N04A 1MN4A 3FLUA 4ZZFA 3WNMA 2XIQA 4A3YA 3DFNA 4R90L 3KLHD 3V0DA 2I5GA 3BLPX 3L7RA 2D7PA 4FQHB 5L0QB 2BNUB 2ZOWA 2VLJE 1HC1A 4AZCA 1MQRA 3CFMA 3NXFA 5GZNA 5IG7A 1JXDA 2HSIA 2OCZA 1ZAGA 3G5ZA 3U7WH 3RWEA 4NJ9L 3TTSA 3MRGB 2A6JA 5AHLA 3ABRA 2KPNA 4I5BB 3NRFA 4UILL 1CXEA 3QG7H 3DSNB 3SOBL 1ET8A 4HYWA 4KK5C 2W9EH 3HB3C 1Z3GL 3DJSA 3AC0A 5LNSA 4JRLA 2DM2A 2XJKA 5DWUH 4JFDD 2WHLA 1D5MA 1NFDA 5D96C 4KTDH 1AZ2A 2QUNA 4ZSOE 3SPHA 3IVKA 3KYNB 2VM3A 4BGLA 2O9OA 3V5CA 3AOFA 4LAOA 1T20A 3N18A 4JDTL 3SODB 3O06A 2MCG1 4LLUA 3BPNC 3BVTA 4IMDA 1XZ0B 4GP8B 3WTTA 1BQGA 1LQ2A 1BXCA 3EDEA 4N9GB 5GGQH 4IHCA 1XF4B 5A8QA 1M42A 2AQOA 2B7NA 3SDAA 4QDPA 2Y6TE 2P5NA 2KI6A 4K1WA 3GTNA 4O02A 2J8UE 5DEZA 4S3GA 4B92A 1B3IA 1UJ3C 5JIHA 2AK4E 4ZTXA 3CL7A 5GRZA 3VINA 4PJIE 4LK4A 1RXOB 2VX5A 2AQRA 3UJRA 3P9WB 1CGXA 5LDUA 3QWOA 4GHRA 3L95B 5AHMA 2XX1A 6ENLA 3A3WA 5D7HA 43C9A 2J1XA 1BQ5A 5DEFB 1FH8A 1SEQL 3SRDA 3PLYA 2NZLA 3CHOA 1F7BA 4MVBD 5C9JB 4JYFA 1OAQL 2J73A 2ISVA 5DJAB 2ZCGA 4PN6A 1EJSC 4RGNE 3V7MA 3CH1B 4BFFA 1P5UA 2CKBA 3OW1A 4GUFA 2VXUL 4MBRA 5DK3A 1VIZA 3C6EA 4M9OA 2D3NA 4G7RB 4FAAB 5CZRA 4CKVX 3MI3A 3USZA 3KRUA 4BXVA 5CD5C 3DI1A 1FFRA 3LIZL 2Z0IA 2BODX 1AQFA 1DYZA 1K7EA 1X5ZA 2G3FA 3RDTD 3QWNA 1L6WA 3QS2A 5CD3B 4DGIL 3W9ZA 3UR5A 1YQVH 3W22A 4IUOA 3GR4A 1A5FL 1IGJB 3T1WA 3B8VA 4GJJA 3VMNA 3MLSL 1A3LH 3H21A 4HIHA 3IXTA 3VXRD 4PUBL 4UTKA 2PBGA 4WDXA 2VQ4A 1PY0A 4BZ2A 4LGSB 4WUUE 2PW1A 4K8HA 3RUGF 1E6OL 2ZPKL 2Q8AL 1ADSA 1OLLA 3ZLGA 1EX0A 1QRNE 2BVDA 2VW6A 4W81A 1T6VN 4OZGB 3FK4A 1R4XA 5E08H 3Q48A 1K8DB 2ZKXA 3SO3C 5DVOA 3L9BA 1XGEA 3V4UH 3G5XA 5H8DA 1PDKA 3MRIA 1CYGA 4KI5F 4TR9A 4ZXOA 2XIBA 1ECQA 1UWXK 4ZFOL 4R97C 3KP1A 4ZQNA 3JWOL 2WXPA 4AWSA 2BVQB 1BZ7B 4X0KB 3CC5B 3EJRA 5GRUH 2JK5B 1UR8A 3FT4B 1PMYA 3WQ5A 1SOSA 3GK8H 1PL9A 3QXUA 3WEOA 3D69A 1CFVH 1V3MA 1OEZW 1OARL 1P4LA 2OMTB 2YGQA 5F7EH 1AUSL 4RZ4A 1E1FA 2B59A 2P24A 1PE1A 3RFZA 1UH2A 3F2LA 2OMZB 4JFPB 1IAKB 1E6NA 4Q4RA 4LCVA 1AHWA 4JQ1A 2VR7A 4C4KT 4DTGL 4Z0XB 1ZHAA 2A6LA 2P80A 4NNPH 4TO8A 1ADDA 4N24A 1DO6A 3KCPA 1MRQA 4IBQA 4QRTA 3O2VH 4MZYA 3SZKC 3QSKB 1AODA 2R1KA 1GZGA 1P1ZB 1S2TA 3PYCA 3K8KA 1R6VA 1XF3A 1CF8L 1MWAH 2VQTA 1PKLA 3EWYA 4PJCF 5E6IC 2Z1XA 3VOFA 2C1HA 3TE9A 4ZO6A 1PCWA 3MJ9H 4PV8A 3Q1SL 1QATA 1E0VA 5AW5B 3VWJB 4KFNA 1RU9L 3LI0A 1JL8A 5KVGE 4UT6L 4US5D 1WAUA 1OC6A 4OM0L 1FLRL 3I6RA 4W9CC 1G7MB 2IVFC 3ZYJA 3C61A 4YLBA 1YIXA 1XRVA 4M8RA 4O5LL 3G9VA 1B2YA 2QCFA 2IBBA 3TIEA 3OKOA 4S10A 4QTHB 4MADA 1YHPA 4UTFA 1D3HA 3GZ3A 1E50A 4GKOA 5DQPA 4NZTL 1BBDL 3W9DA 2XWZA 2CD0A 3WLNA 4E41D 5GGSY 4JTFA 3R1GL 1RZ8A 4D8AA 4ODBD 3LTVA 3G1VA 1A4CA 2HPTA 4K71C 4X7CC 5HDRA 2YCKX 5C0JA 4C55A 2A0NA 1SQMA 3V1HA 5IFAL 2CBVA 3MHUA 1I9EA 3MLYL 1WKEA 4F0LA 2CBIA 3MV11 3QDHA 5E8NA 4HOMA 3A67H 3EZ8A 4JB9L 3N6QA 2P43B 4XT1C 1TB3A 4JPIB 2JCCB 3VABA 3F4VA 2RDTA 3QXDB 1UPMB 2OGJA 3ZSSA 1H5BA 2HBXA 3FQWA 4M7KL 2HRWA 1XUZA 4KMQA 1OYBA 1WA1X 3L7FA 5J7CC 1DQIA 4PGJA 5FW8A 1IVLA 3BW2A 3V35A 4Y2DC 5H8MA 3SQLA 1MQKL 4OJEH 3ILQC 1GVYA 3L7EB 3WJLC 1Z9NA 4ZX6A 3W7HA 1NCNA 5HGDB 3TTOA 3DG3A 3O9WC 4PRPE 4JREB 4DYEA 1KEMH 2NY6C 3GBNL 2VR8A 4L1DA 4DKDC 4RX4A 1UROA 4ZE5A 1OIFA 3CSFA 1S8DA 5GGVL 1Q6QA 4XKMA 3MANA 1ID5I 2XWJA 2OAAA 1VRXA 1OAYL 5L8LB 3XINA 4PJ5A 2QHRH 3FUFA 4R7NA 3SKJH 1JV5B 2BFVH 3JVAA 4PGEA 5DFWH 1OCNA 3GSXB 4HOWA 4W9FC 2C9QA 1SY6A 2QUVA 3N14A 4WJ5A 4LB3A 3WDQA 5D1ZA 1G4PA 4KDTA 2TRYA 1J01A 4PRHA 3AHYA 3M1BB 3ZTJH 2W4XA 1G5AA 4AQ1A 2XINA 1GW6A 2JIXB 5KTEL 1XGRB 2RH9A 2INEA 4AC4A 4EXBA 5TK2A 3IPWA 3PBWA 1BWKA 2Z91A 2JKXA 4D8ZA 5U7SA 2YS4A 3RAOA 1AD0A 3TJ4A 3MO4A 2HKFL 3QDME 2W79A 4FNQA 1LO2H 3U5UA 3SYPA 2WO5A 4IOFC 4LIQE 1OIOA 3PGDB 1FYTB 1UM6L 1HKLL 2ITCB 1ZTXL 4JO1H 5CF3A 3V4PL 5ITFB 2I9LA 1I1YB 1S3KL 3WUBA 3ITCA 3SJVD 4C6FA 4PLNC 2OMUB 2FX8L 3S6TA 3DTDA 1LO3H 2VERA 1QSFB 2NX3A 3QJFA 4LUTB 3BDBA 3ZIZA 5ITBL 3SFKA 4CUCA 4NPJA 3QEHB 1EGVA 1FHGA 2OMAA 4XI5C 5I1HH 2ETWA 1Q0YH 2ATKA 1IO4C 3K74B 2CGRL 4ZW6A 4K5PA 1BRLB 1W5OA 3L5WB 5AYQA 1XUUA 4UFHA 2R24A 3LD8B 4DKFH 4KT2A 2A99A 1W1A1 3Q58A 5KJRL 1QSED 1L9SA 4Q7BA 2GABA 4PJBF 1W0VA 1T7XA 2NDFA 4XTRD 3ZTNH 1ND0A 5IDZA 2GK2A 5D5ME 4P2AA 1J1PH 4BINA 4JFED 5F9OH 4Y4FB 1ZT4A 1MCEA 3GUGA 2A0LC 4AG4H 1XFPA 4FQXC 3BZ4B 2PYED 1KRAC 4PRIB 3I50L 4RJEA 2ZZ7A 4ISVA 2OZ4L 5A8GA 3IS0X 2HFFB 1Z9LA 1UUNA 1XDJA 3F12B 4MKMA 4UAHA 4W8BA 3SAZA 1W3IA 4M3PA 2HN7A 4WFHE 4PREB 2VJ0A 5F89A 3BLKA 2WLZA 1TA3B 4LAKA 3K6OA 3SY8A 5IB4A 4MNGA 4G8GA 4WV1B 2VDLL 5FYKH 3SUUA 3TJPA 3TVMA 2K6YA 3HAEA 5FYJD 4YHKH 4XNQB 4AM0B 5ECGA 3ZW3A 1BWMA 3H2WA 1WD8A 2O30A 5H37G 4P5TB 4F0HA 2XWRA 1XCFA 5FEPA 1ZANH 5ELIA 2NSQA 4U6TA 5FYLE 2BNRD 3C9NB 3M0LA 2VVNA 3PR2A 2ADIA 1KBLA 4BQ6A 1IT0A 1JI2A 3K6SA 3HKFA 4B5ZA 5I5RA 3O2LA 2GTWB 3M0JA 3LRSA 5TH2A 1E72M 1Y0EA 3DV4B 3RU8L 3TN0D 1XAUA 4JN2B 4HCGA 5ID0A 1UOVA 4KKAC 3CFEA 3TURA 1RMFL 1ETJA 5DEJA 2MQGA 4LAUA 3NZ1A 3TNNB 1J5TA 4KROB 3CJPA 4NPKA 3KM1A 2EC9T 4KVNH 2WJDA 3H4FA 5FOJA 3LHZA 2XKSA 3KW8A 2W0LA 1EGJA 3S3SA 3P0WA 2OX5A 5CPTA 5M94B 3KPQA 4BK5A 4QQ3A 3WLWD 3MUAA 3TJXA 2NQ5A 3EYUL 1C7TA 3HS0A 3VUSA 5LNWA 3QNYA 3WE6A 5FGSA 1AVAA 2VT0A 1YE4A 4PD4K 1TJ0A 5AHNA 3CM4A 3LH2L 3O2WL 5A6MA 3H2NA 3M5ZA 1NC4B 1FE8L 3KBPA 3E8UH 1MDTA 3IJSA 3O8XC 2M8XA 4D0DA 1DJSA 3RUBL 3F7PC 4JQ3A 4RMWA 1DJQA 4ECNA 2X4OA 2FVKA 1R24A 4BDVA 3AZSA 1AGFB 3NOYA 5GRVK 4Q4PA 3OLGA 4WTQA 1FGVH 3T78A 4QHLA 3UTQA 4M9PA 3NR0A 1PU0A 3E0VA 4AZCB 1N4XL 2HFGL 5IG7B 1EJ7L 1J48A 1RUAL 3G5ZB 2BSLA 4L8DA 3FU5A 3HMWH 3QPEA 3MJ7A 1RJYA 5E2WL 2A6JB 3QYSA 2DQGH 1LILA 3DIFA 1GOOA 2A0LD 3LRKA 4DAIA 5BMFL 3DX1A 2A3BA 3QO0A 2FZ3A 3N44B 2ZXWB 1CLZH 5DVPA 1SXZA 4J4PA 2J4WL 4WRHA 4IJ3C 8A3HA 4RCXA 4TUJA 4NL1A 4DZAA 3K6IA 3NG5A 3QQNA 2EECA 4Q7IA 1TJPA 3N12A 3I6GA 2PP8A 5KJ4A 1D5MB 1NFDB 2C1PA 1GVQA 5D2YA 4DN1A 3MBEC 5FM4A 3PZOA 2VGBA 5B8CA 1PS9A 3IVKB 2FB4H 2NZ9C 2HRPL 3OKYA 1K4HA 7TIMA 1IM9D 2PLKA 4R3SA 1LM1A 2B7QA 1T20B 3LZFL 1NCIA 2CJ3A 4DPBX 5HHVH 4YBLB 5B7EA 4XAGA 4LLUB 1MQ8A 1KTBA 1ZVSA 5DC9B 3IIZA 5HSFA 1X97A 3KUMA 3VRLE 5D70L 2BLFA 1ZBVA 2VLRE 3O7UA 2OKMA 3DJTA 4C5YA 3T0BA 3D4ZA 4LGXA 1XLBA 3C0QA 3MZNA 2ATAA 4MJ5B 1VLXA 1PG7H 1HFBA 1SMAA 4QM1A 4A8LA 1OAUL 3CSPA 1KD0A 4NUGH 5JUEL 1GVEA 1KC5H 4MXQC 4O02B 2F6AA 3U0HA 1X7FA 2HLEB 1O9ZA 2X9ZA 1FH9A 4XXWC 3TZVD 4EOWH 4BFRA 5FJUA 3VNKA 4ORZC 3B8DA 5IVOA 5XIMA 2ZVRA 1NIUA 1I3RB 4ROPA 2BZDA 1WT5A 3QWOB 3OLIA 4PE8A 4E5XG 1U95A 2EKGA 4EVNA 3PGCA 2QPFA 1V5XA 3LMJH 1EPXA 4XMPH 3U7AA 3HG3A 5BV7C 4C56A 3F58H 2C16A 4MJ2A 2YA1A 1PJ9A 5I3HA 2ZUSA 4MS6A 2WYZA 4L9ZA 2FJGA 4P5MB 4DGVH 2EZ0D 4LUSA 2FYVA 4YSRA 1ZV5A 2OW7A 2FQEA 1A8ZA 3G3LA 4WSHA 1W5NA 2RDUA 1KYUA 5HYJB 5DJCA 1S39A 2ZCKL 3VFGL 1P5UB 2CKBB 5DHEA 1P1MA 5IHZB 2QCGA 2IG2H 2ADAA 5F96L 4PB0H 5C09D 5ABDE 2RQEA 4MQ7B 4PGCA 4IMKC 4B9CA 4HSNA 3E74A 5ETUA 4R96B 4OCNC 3WF3A 1MF2H 1A3XA 3U30C 2B7DT 2CA4A 1G6VK 1FXPA 2PLTA 2X70B 2F84A 2DICA 3ZQXA 2QT6A 2R1XB 5HWJA 3S47A 4OZIA 5BVJB 4S3KA 3KL0A 2QQKH 2EDFA 1N3NA 3EUUA 1I8LC 3VNJA 4DZIA 4GX8A 2OL3A 3WS3A 5AW8B 3FFSA 1GZ1A 2PW1B 3FS2A 5CBJA 2CCVA 3PFUA 1WDWA 4AYMC 3DX7A 4O14A 3AB0C 4M43H 2NX1A 1X9QA 3TF7C 3OP2A 2CNYA 2NY4D 5DJ8A 4S3AA 5J5RA 5I0ZA 3IUIA 1PDKB 4HCRH 3MRIB 1QBBA 2PTVA 4DJFC 1JRHI 5L4IA 1IEIA 3I7SA 4G83A 2WTRA 2VDQH 3TYFA 1U5HA 5F4WA 2L7UA 2PLMA 1LUCA 4RZKA 3D69B 1BQHA 4ZTPL 1P4LB 4CQ9A 2VEMA 2B5IC 4GXFA 4OLEA 1KEGL 2IAMA 2B59B 4JM2B 2P24B 3RFZB 1B4JH 1NDYA 5FO8B 2FGLA 4XSLA 4ANUA 4AUBA 4XVUC 3RITA 1Q2SA 5KANI 4NFCA 3T2PA 1AHWB 3L1EA 2IH8A 3FTVA 1O7AA 5D6DC 4ODVL 4JO4H 1S7TA 2R69L 3KCPB 4YDKH 4JE4B 1ZJIA 4N2MA 4QRTB 2G0LA 4M6VA 3ARTA 3P14A 3MY9A 1TVNA 1TEGA 1XF3B 3O6FA 4KKCC 4WSGA 1GPWA 3EOTH 1POKA 4AK2A 1RCXB 4YHLH 3O6CA 2X87A 1CVSC 1OO2A 4F9PC 4PV8B 5B1JA 1I4FA 4FQ2H 3PABA 4GWEA 3VIJA 3RHWK 4EPKA 2EICA 1YEDA 2ZAHA 5FLVA 5DD5H 3EFDH 3U57A 1CEOA 1M5WA 1YDVA 3O6LH 2NUXA 4TNEA 1SOQA 3RAJH 2CIPA 1C91A 1V7MH 1HIZA 1NGYA 3OKOB 3ULVD 2EVFA 4ZS7L 3MVIA 3BJ91 4JE0A 3CDYA 2PDFA 2MNJB 1XGTB 1XP3A 4AZ6A 3P3UA 2CDGA 5L4JA 4BFEA 1A7PH 3RMEA 2C9SA 4DCQA 2CGYA 1MLBA 4QDMA 4RE4A 1IE4A 3TC9A 2G41A 5I1AA 4JHMA 4QSHA 4S1FA 3OQ3B 1IAIH 2LOEA 4NQDB 1WYIA 2QJJA 4DPQA 4NZCA 3UTPD 5C0JB 2BWGA 3D0AA 1ROWA 2NY5H 1XBXA 1XFBA 4PY8J 4Z7WE 1F73A 2ZAGA 3QUZC 5E9NA 4LLYB 2VUOA 1HKIA 2DIKA 3CHXA 4CSPA 3DBXB 1MIEL 4EDWH 3TONA 3UW6A 4MQXD 4XVOA 1H5BB 3BAXA 2H32A 3FQWB 3V0AC 5EOCL 1QI4A 2ZXBA 1U8OA 4GS7C 4AEHL 3IDJA 4OLUH 3L7FB 3WOVA 5JVLA 1NCWL 2FZMA 3WJZA 4ZYKA 2HX7A 3M7FB 3RUGA 1FDLL 1LT7A 3KR3H 3NXLA 3ALWA 1NIBA 3MC0A 3TROA 1WIPA 1WGOA 3ITTA 2VZ3A 1G1KA 5G55A 3HB9A 2WZTA 4XO7A 1EDTA 4KPHL 4XPTH 1NKRA 3M43A 4CU7A 2WN3A 1JCVA 3FZUC 1O60A 1S8DB 2TSYA 2DTML 4B0MM 3WSQH 4XCCL 2IOMA 2XWJB 2ZOTA 4XCNA 4MGGA 1BG9A 4WW2B 1H49A 1K9FA 4A2EA 3BLOA 4M7JH 4O8RA 4R7NB 3T0DA 1DKWA 4JTRA 3TFKC 4IDJH 4GRWB 1TVLA 2BY0A 5JHLA 3L2NA 3W88A 1RUPH 1WJ3A 2W27A 3SE3A 4AGLA 2PWFA 3MRRB 4GEJA 1U1JA 4WJ5B 1JDAA 4PRHB 3DFTA 2H1PL 4AQ1B 2GDQA 4FF7A 3ET9F 4HPNA 2HROA 1LK3L 3FO1A 1V6WA 2KDGA 3CLEL 4QRUA 4TOYL 2Z91B 5BS0D 5F44A 3V0SA 1CICD 4DBUA 5B38G 1QPRA 3AU2A 1AD0B 3FB7A 4LIQL 5TDOB 1U6AH 4A6YH 3D1MC 1F90L 4Z5RA 4I3RL 2RCSL 4JANA 4PJCA 5I6PA 3IT8D 1QYGL 3LCFA 1ZBCA 3PWNA 4EKXA 2XSXA 4P46C 5D4QA 3BW9A 3IRCA 4FCAA 4Q8TA 1N12A 5REQA 2PO6A 3QT2A 1FYTE 1QMUA 3GWQA 3VGDA 2I9LB 1UM5H 1IL1A 5EWIH 4M48H 1A1OA 2VMFA 1NOWA 5B21A 2Y25A 5J3HD 1KV5A 4BFIA 1TG8A 4ODTL 4J2MA 3ARYA 2IDSA 1QSFE 3BO8A 3NCBB 1TJIL 3EGDA 3L12A 3OG4B 5JOPD 3I9AA 1TX2A 1MHEA 4MSWA 4DGYH 4UQEA 2VITA 1P7QD 3CZEA 5C71A 5E8EA 4KZDH 4DP9X 1P0NA 3BCJA 2D31A 2ADFL 1C8QA 4WFGD 1GOFA 4UBDD 4EOUA 2JJUA 3KHQA 2J56A 2FTPA 3A6BH 3AZTA 5EBMA 2YGPA 3S48A 3OQEA 5AVQB 3LQAH 3W2UA 2HBVA 5A2JH 3GXNA 1L5GA 4CD6A 4R33A 2VGGA 4IICA 3KPRD 1A7RL 1FP5A 1TOXA 1SLVA 5KSWA 4BSJA 3OPZL 3FRPG 1F9CA 5H4YA 2BMKA 1XLFA 1YLVA 2JF6A 2IQAA 2CXKA 4GNVA 2OP4H 4HNTA 3GS0A 1W0VB 3CHPA 3EYVA 1ND0B 3Q9PA 5TQLA 1OQOA 1A6PA 2D7MA 1XIWA 4H0HB 1I60A 3ZYIA 4UZSA 4JTDA 3B2VH