1B3YA

Xylanase from penicillium simplicissimum, complex with xylotetraose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
total genus 127
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3yA00
1I1WA 1DTUA 2HISA 1J0IA 2ZX9A 2VTFA 4PBGA 2FH6A 4UFLA 3W6MA 4FLOA 4BF7A 1C8YA 1XRVA 1EDTA 3VIHA 4P7OA 1V3IA 3IJ9A 2WAGA 4A3HA 1OCQA 2X2YA 1QVBA 2G3JA 2WLZA 2WWDA 2WANA 3SCVA 1K9FA 5CPTA 1TCMA 3CZGA 4OBRA 1E6NA 4GZJA 1E4NA 1J0YA 2V3FA 1VEOA 3NSMA 4OUEA 1BG4A 3POCA 2YL5A 1FP9A 3GZAA 1WZAA 1EQPA 4JFVA 2WVTA 1W1TA 3VIPA 4TVCA 3VIIA 2WMKA 4U3CA 3VIMA 4ZXOA 1ODZA 4J28A 1KR1A 3W82A 1QPKA 1CXHA 3NSNA 1JF6A 2WMJA 1W3LA 4B3KA 4DWSD 2V38A 3L4XA 1G94A 1FA2A 4LYPA 2YKKA 2DSZA 1UR0A 3WBAA 3N13A 1JZ8A 1CGWA 1LQ0A 2VMFA 4TTUA 1JGIA 3F5JA 1CGTA 4GPNA 1UHVA 3WMSA 2G8ZA 4J3SA 3WUFA 5CZKA 2PWEA 4EK7A 3M46A 4WLCA 2DT3A 1LLOA 4JHZA 1H11A 4HZ6A 3BSGA 4AD3A 3MU7A 2VZUA 4QLLA 1FH8A 2ZX8A 2V5CA 5I24A 1M53A 3WQ5A 3DYOA 1UYQA 5A6AA 5CPQA 2X05A 2E0PA 1WDQA 5AY7A 4AIOA 2OSWA 1JDCA 1TMQA 6CGTA 1MQRA 1HJVA 1OD0A 3GYCA 3VO0A 4BQ3A 2WYSA 2WPGA 1R7AA 4HU8A 4UQDA 4TVUA 3T08A 1JNEA 2VX4A 1NWTA 9CGTA 4W7WA 2DEPA 2XSBA 2VO5A 3K4AA 2WNWA 1RD6A 1UD2A 1W9PA 2CHNA 4PSRA 3W28A 2WK2A 1JD7A 2YL8A 3FHAA 4HPHA 1E6PA 3RILA 1PJ9A 2V5DA 1C3FA 1G01A 3J7HA 3WL0A 4PMDA 3ALFA 3N9KA 4NSBA 2C0HA 5DT7A 3MKKA 1UKTA 4P8UA 3ZM8A 1PEZA 3F5KA 2F8QA 4Q22A 4V27A 1D2KA 3MMWA 1DWFM 3LPPA 2DQXA 3U7VA 4UOZA 2PI6A 4D6IA 1WZLA 1CXEA 2XGBA 1YQ2A 5GNYA 1PZ2A 1GQLA 4H8VA 8CGTA 1GCYA 4W87A 4S3KA 2XFFA 2WVSA 1E6XM 1ISXA 2RGMA 3AS0A 4V28A 1TZ7A 2QPUA 2BVYA 5HOSA 3AIUA 3EDDA 4JFTA 4AMCA 3GH5A 1GOQA 2C8NA 2WBGA 1JZ3A 4IPLA 3CHEA 1NOWA 2F61A 4H8UA 3SCPA 3BLPX 3OIHA 4OBSA 1XYFA 4HP5A 3TP4A 2DH2A 4A4AA 4W93A 2Q8XA 4AYSA 1C7TA 1E6RA 3IJ7A 4PMVA 3GXIA 1ITCA 4W89A 2DDXA 3AXXA 3G6LA 3D3AA 1OGSA 2JFEX 1NWSA 4GZIA 5A6SA 3IANA 3HMCA 1NWUA 1CLVA 5A6LA 1G1YA 3M7SA 2D0FA 2ZIDA 5LA0A 1LL4A 3OLIA 1XD0A 2FGZA 4M81A 4P8WA 3UG3A 3WDRA 1C90A 1CGUA 1VAHA 4HA4A 1XH1A 2VRJA 4TX6A 3ZQ9A 1PBGA 5D8ZA 4J3TA 3BAWA 3W27A 2ZOXA 3W4RA 5A69A 4ACZA 2WKGA 2HVMA 2A3EA 4H8HA 5JIWA 1KGXA 1UD8A 1B31A 3WMBA 3RCNA 4HZ8A 1XCWA 2XGIA 1UKPA 1I75A 2ZICA 3KE0A 3UG5A 3ZJ8A 1B1YA 1NP0A 1YHTA 1E55A 3DYPA 1KGWA 1TVPA 1JYVA 3WNNA 5AC5A 1W1YA 1W1PA 2CNCA 2A3BA 1WKYA 3LMYA 3OGRA 1PIGA 2DH3A 4UFHA 1KCKA 2VZSA 3U7BA 1V02A 3VOCA 3UERA 3AHVA 2Y5EA 2PBOA 4X0VA 4AD2A 1HKIA 1UA3A 4OJYA 2F2HA 2EPOA 4P7RA 1KFWA 3ARTA 4U3AA 4UQBA 4AZCB 4PMRA 1WCGA 1EHNA 5CGMA 4F8XA 1JI1A 4DUVA 3QHOA 3VDAA 3BCDA 4D1IA 3OLGA 6TAAA 2ZXAA 4YPJA 3VMPA 2WVVB 2ZX5A 3UR8A 1LWJA 1DWAM 1V6YA 3BCFA 5E0CA 3L4YA 4JKKA 5F7UA 1W91A 1NM9A 5M3WA 1KBKA 3QR3A 1GOWA 2E9LA 3K8LA 3WD0A 3I3DA 2V3DA 3AYRA 1H1NA 1EIBA 3TTYA 1XD1A 3OGVA 1HNYA 3WF0A 4JHOA 1BPLB 2WMFA 2WZEA 1HVXA 2XWEA 4PN2A 4U5KA 5BROA 1ODUA 4Z2LA 3EBVA 3VILA 2ZXDA 5CLTA 1M01A 3UCQA 1EOKA 2GK1B 3KL0A 3VUPA 2W63A 3WFZA 3TTOA 3NSXA 1U30A 3WD3A 4W8AA 1HJUA 5GNXA 3GNRA 3WH6A 2E40A 5EFFA 3BMWA 5D9NA 4GIAA 4CU8A 3PZQA 3GXFA 3S6TA 1UD4A 1V0LA 1JDDA 1L8NA 5BRQA 1JD9A 3T09A 1XSIA 2YBUA 4AY1A 4PEEA 1UR9A 3AZSA 3FNDA 3AS2A 3BMVA 2J7BA 1WZKA 1XH2A 1WE5A 2YLLA 2WHMA 1DP0A 1E72M 1XGZA 3ARVA 4EAMA 4GI9A 3AMLA 1XYZA 3L4ZA 3N1AA 3BH4A 3NUKA 4AIUA 1MVYA 2XIBA 2FH8A 2J77A 3ARQA 3AIQA 2VVNA 3WUGA 5BXPA 2EBNA 3RM9A 2VC9A 1MXDA 1DWIM 2XHYA 3K1DA 3IAPA 1KB3A 4AEEA 4HMCA 4DWSA 1M03A 1IV8A 3QHMA 1BQCA 2B31A 3CZLA 1FHDA 3WSUA 3OBAA 1KWGA 1IT0A 1EA9C 1DEDA 4ZEPA 1MFVA 3WNMA 4QLJA 4GXPA 3F4VA 1J01A 1E40A 3EMQA 3WUEA 4MTVA 1E5JA 1CEOA 5C8BB 3RJYA 3HJEA 1HJWA 3VNZA 3MV01 1GOKA 1WNOA 1K9DA 1BVNP 4D6GA 4KWUA 3G6MA 1CGVA 3A47A 2X1IA 1UH4A 1NOFA 2X0YA 1QNQA 3BAKA 3MUIA 3OG2A 3ZJKA 3W6LA 1OM0A 2UY2A 3SCSA 1MWOA 4CCDA 2D0GA 4MJ4A 4J3UA 4WSKA 1G5AA 2EJ1A 2VVSA 2G3NA 1CWYA 3HN3A 1WP6A 4AWEA 4K68A 4UR9A 2CHOA 5A94A 1ISVA 3IJ8A 4E2OA 4IUGA 2WC3A 3WQWA 3WD4A 2IUZA 4CD6A 2ZUUA 4JL1A 5FIPA 2BFGA 1ISWA 3AIRA 2D23A 2WKLA 5M03A 2DIJA 2ZUWA 3DHPA 2W62A 1GNXA 1R86A 1CXLA 3CUIA 3PZGA 2J62A 2GJPA 3WH9A 3GH4A 4W86A 1OT1A 3ZMRA 2OYKA 1HKMA 3ARSA 4JZ5A 4V2XA 3WL1A 4AD0A 2BS9A 1GJUA 2WMIB 4D6CA 3UETA 1E1EA 3VGEA 2WZHA 5D9PA 5A6JA 3M07A 2QF8A 2WVUA 4DUXA 3W24A 3VIGA 2VT0A 4BS0A 1V03A 3UR7A 3WEZA 3EDJA 3A3HA 1OIMA 4PCSA 2VR5A 1PIFA 3PHAA 2XYLA 3VTRA 2WC4A 1JAKA 2YBTA 4WK9A 1H5VA 3ECQA 4UQEA 2CKRA 3O9NA 2Y4SA 3QOKA 2J8GA 3WKZA 2VURA 5EBAA 1LWHA 1SFSA 2OWWA 1GQKA 1SR0A 3ZT5A 2UY4A 1ZL1A 2BHZA 1HL8A 2BY3A 2V3EA 3AHXA 1CGXA 1VENA 1US3A 1W9XA 1V3LA 4QCFA 3WFLA 2W92A 3GNPA 1QI5A 2VX5A 4GI8A 3CHCA 1W3HA 3ZIZA 2GK1A 3OGSA 5E9AA 3RJXA 4DWSB 1V0NA 4WKHA 1TA3A 5BXTA 2JIWA 2NT1A 4PTVA 4ZFMA 3EDKA 1VRXA 2J25A 3T2PA 1MYRA 3PBGA 2EO7A 1H41A 1AQ0A 3CUJA 5TD4A 1V6WA 4WJXA 1OGBA 4AZ5A 4CCCA 1Q6CA 1UQYA 2A3AA 1HT6A 3WNPA 1QNPA 2PWGA 1V3MA 5D4YA 2C7FA 6A3HA 3CUHA 5I79A 3WN6A 1HJXA 4Z2JA 3CH9A 5E09A 2DSUA 1K6AA 2ZUSA 1UKSA 3SUTA 3VVGA 2J7DA 3AZRA 2PBGA 1GPFA 4MB1A 1NQ6A 3CMGA 1Y7VA 1OBAA 3WDQA 3VMNA 1J11A 5CGTA 1B2YA 4IISA 3AXHA 4PRWA 5HPOA 4NRRA 4D6EA 2VR4A 3AIVA 4LX4A 4KRUA 5E6YA 1BF2A 2D3LA 7CGTA 4HOXA 4CU6A 4YHEA 5I0DA 1VFOA 3N18A 2VJXA 2OSYA 1X6NA 4KRTA 2ZUTA 4YHGA 1OD8A 2YLAA 1WB0A 1R7OA 5AYIA 4W85A 3L4UA 4FF5A 3N12A 3EDEA 2CETA 1VBUA 1UKQA 3MMDA 3ZT6A 1QI2A 1CXKA 3AOFA 1LF1A 2PC8A 3EYPA 2NW0A 4AW7A 1E5NA 3GH7A 2G3IA 1FOBA 2D3NA 1EO7A 3WDPP 4AISA 4QCEA 1J0KA 1H4PA 1O6IA 1ECEA 2EPMX 3DECA 1OGGA 1JXKA 4ACZB 1D7FA 1VEPA 3WNKA 4CD5A 2WHLA 2YL6A 1C8XA 4AIEA 5A3HA 3GTNA 2Z1KA 4UOJA 5CG0A 5DT5A 1KXHA 1GUVA 3CUFA 1OT2A 4DWSC 4JKMA 4E8CA 1E43A 2J7HA 5HDRA 1DWHM 1CLXA 1TUXA 1HX0A 4A3YA 1TFVA 7TAAA 4CKQA 3KL5A 4XUYA 1JAEA 1KXTA 1KBBA 1UR4A 3WENA 2D0HA 4D6HA 1NOUA 3ZJ6A 1UKOA 1JZ4A 1WZMA 2W61A 4NF7A 2J78A 5CPSA 4AEFA 1PPIA 4F79A 1QHZA 4PMUA 1JZ5A 1JF5A 3AMGA 3SCOA 3SUWA 1W2VA 4GO8A 5DFAA 3VKKA 4H04A 2OWCA 1KXQA 2WHKA 1QNSA 1KR0A 2DIEA 3FXYA 1XCXA 4R5EA 2EXOA 4QP0A 1E0WA 1MQQA 3SCUA 2YJQA 2ZUNA 1C92A 2JEPA 3UESA 2AAAA 2OLHA 4UFJA 4XZWA 4F66A 3ARUA 4MAVA 1H2JA 3A4WA 3KL3A 5A8OA 3SCTA 2IXVA 1HVQA 2J7CA 2XVNA 3OZPA 1UQZA 1B3ZA 2J7EA 2GVYA 4HTYA 4JCMA 1CGYA 1UR2A 3B9EA 3NDZA 2J74A 1SMDA 3O6AA 4MB3A 1BFNA 3MUZ1 3CZKA 4XZBA 5M5DA 4PMYA 5FCZA 2YDSA 3AHYA 3AHTA 2PB1A 1GOMA 2Y2WA 3LPOA 4GO9A 1PZ3A 1FH9A 3AXIA 5E6ZA 5JUVA 3KEHA 4H2CA 4Z2GA 1J0HA 3WF4A 1U2YA 3WDHA 2YL9A 4FLSA 1FFRA 3II1A 4PUEA 2XIIA 4PTXA 5CXPA 2XM1A 3W38A 2X8RA 1LG2A 4AD1A 2GUYA 4AZBA 3SUVA 5CSUA 2OWXA 2GDUA 1HXJA 3W26A 4DM2A 1V02E 2WLYA 3BGAA 4GINA 3NIYA 1MW1A 4P8VA 3BAYA 4QDMA 3FW6A 3SUSA 3VDCA 2G41A 1XSKA 1H49A 5C71A 2ZXBA 2GFTA 2WCSA 5JBDA 3SCQA 4U2ZA 3CGTA 2G4FA 3S2CA 5A6BD 4WIWA 3MUAA 3WQ4A 5I77A 2WVVA 1M04A 4W8LA 4Q7NA 2G3MA 4W8BA 5BYWA 1ZU8A 3K46A 1BVZA 2E3ZA 4OOZA 1I1XA 2VRKA 3N15A 2CBVA 5EFDA 4AZCA 4CVWA 1R87A 4B15A 1VJZA 1BYAA 2BHYA 4LQ1A 4D72A 1BTCA 2VZOA 3VX1A 2WM0A 3CBWA 5ABEA 1GHRA 2CBIA 1KQYA 3AJ7A 1VFFA 4TUFA 1QBAA 1E15A 4YN5A 2VCBA 3ZSSA 2ZWZA 3W81A 4HPGA 2EQDA 4MNMA 3IAQA 1V6VA 2JE8A 4BQ5A 3AROA 4U2YA 1QW8A 4C7FA 4ZXLA 2XVLA 4TX8A 1MQPA 4N42A 5FD0A 4PTWA 4MADA 3SCWA 2XFRA 4ML4A 2BVTA 1J12A 3GM8A 2WSKA 1HKJA 2QMJA 4BQ2A 1UOKA 1B3WA 2CXGA 2VCCA 2VL4A 4PMOA 4W7VA 1FHLA 2QHAA 2EEXA 4IM4A 1W1VA 1H0GA 3PZMA 3L2LA 3RPMA 1LJYA 2XFYA 3A4XA 3SCRA 1B3VA 4GKLA 3T2QA 3WY1A 3RM4A 1EXPA 1BAGA 3CMJA 1CNVA 4M29A 1E73M 3T2OA 4P8XA 4B16A 3BXWA 1US2A 3GNOA 4CVUA 2O92A 4JCLA 5BXSA 3PZUA 3T0AA 5E70A 4HMDA 1GOIA 3L4VA 2QLYA 3GBEA 5DO8A 3PZNA 2FDMA 4OZOA 3VIKA 3BLKA 5ECUA 3RM8A 2JIEA 4ZE4A 2WB5A 1W32A 2O9PA 4CGTA 3FAXA 2BNJA 4LXFA 3WNOA 4MNKA 1UD3A 4OKDA 3AQUA 4CN6A 1C91A 2DSKA 3N17A 1ISYA 1CDGA 1NARA 1UWIA 3TONA 1XH0A 2D1ZA 1KCLA 2J47A 2QPSA 3M6DA 2BHUA 4D6JA 3CHDA 4Z2IA 2XM2A 1UWRA 2ZUVA 1JIBA 2WHJA 1HP4A 4Z2KA 3OZOA 8A3HA 2E8ZA 3WH5A 1ISZA 5GPRA 1C93A 4P7LA 4AZIA 2UY3A 4KGJA 4EKJA 3CZJA 4MB4A 1AQMA 4W5UA 4X0NA 5JIPA 3ZO9A 4HZ7A 2D22A 4D1JA 2D24A 1QNRA 2FHBA 2GJXB 3EMCA 4BQ4A 1JFXA 4AZHA 1ZJBA 1DHKA 2JALA 4JFUA 1TE1A 3AMCA 4MNJA 1CXFA 1P6WA 3DHUA 3A4AA 3CTTA 3N04A 2XWDA 4U33A 1E6ZA 5EB8A 3ALGA 4PYSA 1WDSA 5IHRA 5DF0A 3HU7A 3PZOA 1UG6A 1LL7A 3ARZA 2EPKX 2XVPA 3QGVA 5FKYA 5HNNA 1NH6A 3WIJA 3VGHA 4UQ9A 4M1RA 1JYNA 3CZEA 1H3GA 2FGLA 3VD3A 1HJQA 1MW3A 1E4IA 4UFKA 1OIFA 1J0ZA 3MANA 3AICA 3ZSTA 1GQIA 1VEMA 3GBDA 1BYCA 1R85A 2PWFA 3VX0A 1BHGA 4CUCA 1E3XA 1K9TA 1N82A 2QMKA 1V3JA 1E71M 1UUQA 3VGBA 1H09A 1ITXA 4GQRA 3VU2A 4Z2HA 3PTQA 4CN4A 3T0BA 2XPKA 4TXEA 5I78A 3VD5A 5IHSA 1XSJA 2O9RA 3EDFA 5C70A 1JL8A 4AZ7A 4CU7A 3MMUA 2VCAA 1J18A 3NCOA 1AQHA 5BCAA 1TR1A 4HOWA 1E4LA 3PTKA 3KWXA 3OLEA 2XUCA 1Q6FA 3AMKA 3VIOA 3AIBA 2BY1A 1CENA 1J10A 1Q6DA 2ZUMA 4D6DA 3CUGA 4RE3A 1HP5A 1E1FA 3I3BA 4AD4A 3VDBA 1CIUA 3VD4A 3ARRA 4WSJA 1AVAA 3W53A 3SIMA 4J3XA 1WDRA 5A6MA 1B3YA 4DM1A 5ABFB 2ZX6A 5I5RA 1ZJAA 1UZ1A 4PCTA 1BSIA 4M82A 4XB3A 1V3KA 3VGGA 4PMZA 2JF7A 4JFSA 2E8YA 1WDPA 1F4HA 3AFBA 3K4DA 4RL3A 1LL6A 4HMEA 3FAWA 1UH2A 2PF0A 1QBBA 1RH9A 4AC1X 5CQ1A 5HPCA 4KH2A 3THCA 4JKLA 2YA2A 1GVIA 1MW2A 2FHCA 5M17A 3VNYA 3MV11 1UZ4A 1EDGA 4HA3A 4ATLA 3VM5A 2O9OA 5D9MA 2YOCA 4ATDA 4KMQA 4J27A 1JYWA 2NSXA 2X09A 3W37A 3K8MA 1A3HA 1U33A 3VINA 2IXUA 2WZIA 5HXMA 4NRSA 5LA2A 2WSPA 3UG4A 2CYGA 4X9YA 4CD8A 3SUUA 1OWQA 3WH8A 1W2PA 2UY5A 1W9UA 1JI2A 5CJ5A 2VX7A 3TOPA 5I3DA 1BGGA 4GI6A 4GZEA 4R27A 3AI0A 1QNOA 1JG9A 2ZWYA 1D3CA 5FL1A 2ZXQA 4AD5A 3O2LA 2PWDA 1B3XA 4TOQA 2MANA 5A1AA 5IFTA 4DUWA 5BRPA 4BA0A 2YA1A 3MUY1 3AS1A 4M24A 3VIJA 1NWRA 4PMQA 1NP2A 3VPLA 3WF2A 1E0XA 3EMZA 1CECA 2DPEA 2CEQA 4U5IA 3CPUA 3MO4A 1GZJA 1GQJA 4JIEA 3NJ3A 1C7SA 1VIWA 1TG7A 4MAZA 1EO5A 2DSWA 3OA5A 1GHSA 1VFMA 1CBGA 1W3JA 2W4XA 4Y7EA 1GONA 1KGUA 3RDKA 4MPKA 4F9JA 2VRQA 2CITA 3MS8A 4FK9A 1BYBA 4JAWA 3QOMA 3AIEA 1QHOA 1EHAA 4J3VA 2DSVA 4QLKA 1K9EA 4WKAA 4BZYA 1VB9A 2WW5A 2WCAA 3VM7A 1JFHA 1C8QA 1HF6A 3ZT7A 4B9YA 4HU0A 1OINA 5A2BA 3L4TA 1XHGA 2WMGA 5A6BA 1J9YA 2XSAA 4F9DA 1EH9A 1MFUA 4UNIA 2CERA 1HKKA 1E70M 3DYMA 1LG1A 1E3ZA 1S46A 4IPNB 3WD2A 2X0HA 2WC7A 4LGXA 3T0DA 5A8QA 2ZX7A 1XC6A 3NYDA 3ARPA 2E4TA 1RPKA 5ABGA 1ZBWA 1GJWA 2OYLA 1B9ZA 1CZ1A 2W91A 2EPNA 1WAWA 4L4PA 3TA9A 2CESA 3WEOA 1E6QM 2DT2A 3PN8A 1TVNA 3BAJA 4GQQA 1A47A 2XVGA 1MXGA 1BYDA 1PX4A 3CHFA 4AZ6A 2Y8VA 3WF3A 1Q4NX 2WMIA 4N0RA 3CLWA 3K8KA 3PZ9A 3TTQA 1V6UA 3MSDA 1FFQA 3I3EA 4D71A 4MDPA 3CIVA 3VMOA 3RMEA 1WO2A 1V0KA 1ZBKA 2RGLA 2W67A 4FMVA 3VD7A 2XTKA 2Y8KA 2ZE0A 1R8LA 3W0KA 1UWQA 4MNLA 4PMNA 5FL0A 2Y24A 1EGZA 1GW1A 1QI3A 2WMHA 1W9DM 1VFUA 3B9AA 1H0IA 2XJ7A 2BVDA 4NZCA 1PX8A 3AMDA 1HIZA 1BGAA 1RP9A 3WF1A 2CBJA 1BG9A 3A6OA 1B90A 2YIHA 1EDQA 2VOTA 4P7QA 1UD6A 3BAIA 3WH7A 3VGFA 2W5FA 1GVYA 1V0MA 1IZKA 3TTSA 4PSPA 2GJRA 4W88A 7A3HA 4RE2A 3LPFA 4M56A 1JZ7A 2Z1SA 4UZUA 2YDRA 3SEPA 5HBFA 2AOSA 1G9HA 1SYTA 3RO8A 1X6LA 2EPLX 2GSJA 4UQCA 3VGDA 1GOOA 1XV8A 4CD4A 3PZVA 2V3GA 3WQ6A 1QOXA 5ABHA 5KZ6A 4ACYA 3GXDA 4L4OA 2WWCA 2OSXA 3ARYA 3F5LA 4C7DA 5EMYA 4UFIA 1W9BM 1FP8A 5GNZA 1CYGA 4BCEA 1HN1A 2NT0A 2YDQA 1OSEA 1TA3B 4MDOA 1AMYA 1X1NA 1V3HA 1HL9A 1QW9A 5DEZA 1QI0A 4P7NA 3WMCA 5IDIA 2OYMA 4E4PA 1W3KA 4XV0A 1QI4A 5LA1A 1VJSA 3KZSA 5BXRA 2W66A 1RP8A 2VNCA 3POHA 3VIFA 1ZBVA 2BXZA 4OIFA 1IZJA 2VZVA 3U5YA 1B30A 3W25A 3SURA 2XG9A 3AS3A 4FLQA 1PX3A 1WPCA 2JF6A 1OB0A 5D8WA 3WDJA 3GDBA 1CXIA 1UR1A 2WXDM 3BC9A 5I2UA 2J79A 1DWJM 3CZ8A 5I6SA 5DMYA 3AZTA 2BY0A 2CKSA 4RE4A 2GDVA 1UR8A 4PTMA 5BWFA 2XVKA 1Q6GA 2AMGA 5ABFA 4D6FA 5GQBA 4UFMA 4ZENA 4PUDA 3WUBA 4EE9A 1E4MM 3APGA 5AYBA 4W5ZA 3IK2A 1ZBCA 1UA7A 2ESCA 1ESWA 2TAAA 4NI3A 1BLIA 2E9MA 5A6KA 3RIKA 1KQZA 3BSHA 2WBKA 5IXEA 2PWHA 5JBEA 2VX6A 1Q6EA 4MB5A 5KEZA 3ARWA 1JYXA 3OLDA 4JL2A 3WBEA 4UTFA 5A8PA 2CCRA 4U31A 4H41A 5CLWA 1CTNA 3FN9A 4PMXA 4URIA 4W84A 4OOUA 1E0VA 4AZGA 2D2OA 4JFWA 4TVDA 3WDIA 4HA1A 1UWUA 4UZSA 3WNLA 3WQVA 1VF8A 1KWKA 3BAXA 1G0CA 4J7RA 3GXMA 3AIWA 1JNDA 2QV4A 5CSYA 3PTMA 1DWGM 5JBFA 1MW0A 2BV9A 3L4WA 2A3CA 2VQUA 3THDA 1JXJA 4AXNA 1UWTA 3D5HA 3B8SA 1W9VA 4QAWA 4LYRA 2JEQA 1PAMA 2CIPA 2BY2A 5AC4A 3PZTA 2UWFA 4B3LA 1O7AA 4FLRA 1HJSA 4MJ2A 4LYQA 2DT0A 2VI0A 3FHQA 1QHPA 3SCNA 4WKFA 2J75A 3JUGA 4ZE5A 4EANA 3VD9A 4B9ZA 3MSGA 4H7VA 3FY1A 3OB8A 4XX6A 5A2CA 5LYRA 2D20A 4QFUA 2DT1A 3AYSA 2WCGA 1V08A 1L0PA 1SMAA 3E1F1 4ATWA 2GJXA 5FOOA 1ZB5A 3ARXA 5A8NA 3U57A 5I23A 4HOZA 4M8UA 1B0IA 4UCFA 1F4AA 4UQAA 1ZS2A 1EOMA 5A2AA 3ZR6A 1VBRA 4CCEA 1JDAA 5IFPA 5A8MA 2O9TA 4LPCA 2YA0A 3NDYA 1J0JA 2J7FA 4C7GA 1UWSA 4E8DA 2VZTA 3UEQA 4W7UA 3QHNA 5A95A 1JZ6A 1KXVA 2A3HA 2VQTA 3WD1A 3ZJ7A 1E9LA 2J8FA 4TTGA 3ZOAA 3U5UA 2VUYA 3ZR5A 1FH7A 2DGAA 4UOQA 3WQ8A 4CD7A 4J3WA 1M7XA 1V6XA 2FHFA 1GORA 3CO4A 2J4GA 5D9OA 1CPUA 3AHZA 2BXYA 3VDHA 3PZIA 3AISA 3DC0A 1UH3A 3WEMA 1E56A 1JZ2A 4S3JA 4KGLA 1Z32X 1E6SM 3L2MA 3WELA 2E9BA 4M80A 1UD5A 1EQCA 4WF7A 2J7GA 3N11A 2CPUA 2CBUA 3B9DA 3LPGA 4CN1A 5E0FA 3W29A
chains in the Genus database with same CATH superfamily
3FJ6A 2NQLA 3CV7A 1DTUA 3LV5A 1J0IA 3A5FA 3ITXA 4PBGA 4HZMA 3W6MA 4BF7A 1C8YA 2I9EA 2FIQA 3W1RA 5C7VA 3GHTA 2P88A 1EEXA 3K2GA 3GNNA 1V6TA 5DY2A 4G8TA 1QVBA 2G3JA 4AX7A 1K9FA 4O57A 4E2BA 1E6NA 4GZJA 4Q8OA 1J0YA 1JCLA 3KOYA 2Z24A 2DUXA 1FP9A 3GVVA 4QDWA 4WXZA 1W1TA 4O0ZA 1L6GA 4TVCA 3VIIA 3K5XA 4M6UA 1ODZA 1OABA 4RW3A 4BJHA 1QPKA 3R58A 2WMJA 3JZUA 4G5DA 1W3LA 2X1RA 1WDDA 2DSZA 2NXGA 1JZ8A 3C0LA 4JTHA 4KEZA 3WMSA 2J66A 4MY8A 2RDXA 2YYTA 5CZKA 3WUFA 3TSDA 2V2CA 3W7CA 2GDQA 3M46A 2ZRWA 4WLCA 1HG3A 2VOMA 4JHZA 4HZ6A 3M1ZA 2HXUA 4XZHA 4QJ5B 4JIQA 3NR0A 4DELA 3WQ5A 3DYOA 3U2OA 1LT8A 5HQEA 7XIMA 4I9MA 3MUCA 3EA1A 3LENA 1N8FA 5AY7A 4QX4A 2C6QA 3LERA 2AQVA 1JDCA 4MJZA 1P0NA 1OD0A 1I45A 3L65A 3GYCA 3VO0A 3NL6A 4HU8A 4B91A 3T08A 4HA0A 9CGTA 1RBLA 3LXBA 1Q2RA 1ZRQA 2P1FA 1ZNNA 2V5BA 4ZQOA 4LBRA 1I6NA 1W9PA 3M0VA 2NXIA 4PSRA 2ISSA 4I9AA 4HPHA 1PWLA 3CAQA 3RILA 4IG2A 2V5DA 2OR2A 1G01A 1R0MA 3ORWA 1UOZA 2FPYA 1KLYA 4NSBA 1UC4A 3STFA 4XD4A 4A8LA 5H8UA 3MKKA 1UKTA 2NX3A 3F5KA 3QZEA 1I2QA 4M5PA 2GZXA 3GVQA 5LIXX 2DQXA 1TO3A 4ECLA 1UR3M 1U83A 1L6FA 3LEPA 2XGBA 5TAOA 1JPDX 3ATYA 4W87A 2PDBA 2WVSA 1TQJA 4CNSA 1LP6A 2YFOA 2PD5A 3KOZA 2IW0A 4V28A 2QDGA 5H8PA 4WXYA 2ZVIA 4C6MA 2A85A 4JFTA 1GOQA 1C9DA 1OFQA 2WBGA 1IIHA 2Y62A 5C0QA 3W00A 3BW3A 4TMBA 1FCVA 5CEWA 4DF2A 4K2SA 1Y5XA 5D37A 3OHIA 4H8UA 3BLPX 4BR1A 1DVJA 1XISA 4FIRA 4A4AA 4W93A 2PDYA 2Q8XA 1RQHA 1K6WA 1IEQA 3EX3A 3IJ7A 5D32A 4PMVA 2DDXA 2DZSA 1MXSA 5CZJA 1JQVA 2DVTA 4AUBA 5HQLA 2JFEX 2WOQA 3HMCA 3B06A 1NWUA 1TTQA 1G1YA 1H62A 2FGZA 4LF2A 2J6XA 2R1NA 3WDRA 2I14A 1C90A 1UIOA 2W9MA 1CGUA 1VAHA 3EKLA 3ABOA 4PCFA 1XH1A 3OVGA 3T55A 4OUIA 3ZQ9A 3VKCA 4DQWA 4OV9A 2ZOXA 3R0KA 3C6CA 4ACZA 2WKGA 1SZRA 4NJHA 1OF8A 2WKJA 1UD8A 1B31A 3NQBA 3TXVA 1FHVA 1MSSA 2ALRA 3UG5A 1B1YA 4LY8A 4LVBA 1XIEA 2YR1A 2BTMA 1TVPA 4MHBA 4KFOA 2GL5A 5AC5A 1W1YA 1CT5A 1RR2A 1Q2SA 4E2VA 1J2BA 1DBTA 1PIGA 4A3UA 1KCKA 1RAKA 3TKFA 4EF8A 1HKIA 1QU4A 3ITVA 4OJYA 1S5TA 4HK7A 2EPOA 3TTEA 1LOQA 3NYZA 3H2OA 4U3AA 1FWRA 4UQBA 1XXXA 4K1GA 5LNUA 1WCGA 4N6EA 4F8XA 3VDAA 4MWAE 3V18A 1M6JA 2WVVB 1O5QA 4XD3A 4TO8A 2VGGA 5E0CA 2VC7A 4EPEC 2P0OA 5F7UA 1KBKA 4O1CA 1UROA 3WD0A 2PDUA 3I3DA 2R14A 2CWXA 3F4CA 3BLEA 1XD1A 4O8RA 5FA5A 1SGJA 3WF0A 2G5WA 3LY0A 3AYVA 4XWUA 5IDZA 4MUPA 4FHAA 2WZEA 3R43A 4U5KA 2ACQA 2PDIA 2ZXDA 4CQAA 2B7QA 1EOKA 4LS2A 1UUMA 5CG7A 3WFZA 3TTOA 3NSXA 4ZTYA 4W8AA 4LUJA 2GWNA 3WH6A 2E40A 2TPSA 3BMWA 4EVZA 3MHUA 3U48A 3DFOA 3WQEA 3MQTA 2Z1XA 1V0LA 1RVGA 2RUSA 1QTWA 1L8NA 5BRQA 3NTYA 2BGQA 3GAYA 5AVHA 1UR9A 4I7UA 1E51A 5H8MA 1MDRA 1WUFA 2VWTA 3BMVA 1FWSA 1WZKA 3OBKA 4JN7A 4JTKA 2PDPA 5D04C 4YTRA 1B9BA 1WE5A 4Y9MA 4ASTA 3SFKA 1FXQA 3H2MA 4IMFA 1ZALA 1A5AA 1PSCA 4HKPA 1ZAIA 1TJRA 1XGZA 2ZADA 4EAMA 4GI9A 3AMLA 1XYZA 4O1DA 3L4ZA 3EX4A 3THAA 5HUPA 3QYQA 3MO7A 3NL3A 4O8AA 2FH8A 3H4GA 4GUFA 1G4TA 2VVNA 1GVQA 2OOGA 3B8TA 4KWWA 3RM9A 4ORIA 1ICQA 2DZWA 1MXDA 2XDFA 1DWIM 3K1DA 1KB3A 4I6KA 4HMCA 7PTDA 1IV8A 1XX1A 4B5TA 2B31A 1TSIA 1CX9A 5F2IA 1IT0A 1EA9C 3WNMA 3VKDA 2G95A 4QLJA 4GXPA 4HHMA 3PUOA 4I8YA 3F4VA 1J01A 4CNPA 4NILA 4E3VA 3LG3A 4RKAA 5C8BB 1YXDA 3NVTA 4O4WA 1PTGA 2ICSA 3VNZA 5T9BG 4L1GA 3K1GA 4GK8A 4KWUA 3L23A 1CGVA 3A47A 2NVCA 2DU2A 1UH4A 1TX2A 3N19B 4BI7A 2J8TA 2DV0A 1POKA 3CAVA 3E2QA 2FQIA 3RNDA 3PAJA 5ENLA 4J3UA 4WSKA 1G5AA 1EC8A 2EJ1A 3W1MA 1UUOA 2G3NA 1MEIA 4IFOA 4N4QA 3BVJA 2BOFX 3GDTA 5AYYA 3NPXA 3FLUA 4YS1A 3IJ8A 4I6VA 2WC3A 2YCLB 4CD6A 2OU4A 4CEXC 3N3TA 1VPYA 2W62A 1U1UA 2IQDA 4DJDD 2BX7A 1R86A 1CXLA 3D0CA 3PZGA 4US5D 1GVSA 1R3RA 4HN8A 3WH9A 4W86A 1OT1A 5LHEA 2OYKA 2BLEA 1QRQA 4AEOA 4V2XA 4AD0A 2OGYA 5T8GA 5EL1A 1T5AA 4JQAA 2QDEA 4INFA 4D6CA 3UETA 1N8WA 1E1EA 5RUBA 4H7ZA 4LSBA 4OECA 2WZHA 4S3EA 5A6JA 1V03A 2CW6A 3ONCA 1YADA 5DX7A 2H90A 2BGNE 3ES8A 2BZNA 1JAKA 2YBTA 1H5VA 5KINA 3ECQA 4UQEA 3RGTA 3QOKA 2POTA 2J8GA 1LYXA 2OFJA 4BWLA 1E9YB 3BGJA 5EBAA 2HS8A 1LWHA 1SFSA 3W2NA 1ZY9A 3BW4A 2OWWA 1SR0A 1H5YA 3ZT5A 2UY4A 1ZL1A 1K8ZA 1HL8A 1UPPA 5AC7A 1V3LA 1LQ2A 4YVXA 3GNPA 2VX5A 1A80A 3WJWA 4GI8A 3CHCA 2Z29A 3QC3A 3T1GA 1ONWA 4QSFA 1Q63A 3QPZA 2JIWA 4ZFMA 5EGRA 3IVUA 3B8WA 3T2PA 2EO7A 1AQ0A 1V6WA 3SQMA 4WJXA 3C2RA 7TIMA 1XFCA 1F6YA 3RF9A 1ZJIA 2A6NA 6A3HA 2C1HA 4AHPA 4HPXA 4Z2JA 2ZUSA 3S1WA 3FYPA 1I2PA 4TIMA 2HVNA 1XBYA 3SUTA 2J7DA 2PBGA 3CQ0A 1SR9A 2OX1A 3W6YA 4AYGA 4PA8A 3VMNA 4DHGA 5I3JA 1B2YA 4IISA 3EXSA 2FYMA 3AXHA 4F2TA 2PD9A 2YB4A 1BXCA 3PBYA 4QEHA 4Z1BA 7CGTA 4CU6A 4YHEA 2V2DA 3T81A 1PHQA 4MWAD 3WLOA 1WB0A 2VGBA 4AHOA 3L4UA 4FEZA 3FGCA 1MUCA 1UKQA 4NAEA 1FXPA 4PUNA 4Y96A 4O18A 4JN8A 2PC8A 2HE5A 1GVEA 3TROA 4L6DA 2VFDA 2C1GA 1TKKA 1A53A 2ZVRA 2NV2A 4ACZB 1P7TA 1AG1O 2P53A 1A0CA 2Z1KA 1Y65A 3KVJA 2PRHA 3GTFA 1KXHA 3LB0A 1OT2A 1XYMA 4ADSA 3E49A 1H7OA 4DWDA 4LCSA 2XINA 4AWSA 1HX0A 1W1ZA 4JTJA 3BGGA 1BRLB 1TFVA 3E2RA 7TAAA 3KL5A 1JAEA 3BE7A 2C0AA 1TPWA 1FQ0A 1KXTA 3GTIA 4LOCA 1F5ZA 4QS6A 5DBUA 3CL6A 3R8RA 3SJ3A 1NJJA 3HG3A 2WSRA 1K4GA 1NOUA 3OEXA 4XAPA 1UKOA 1YBQB 2W61A 3HGRA 1PPIA 4QNWA 1D8WA 1LT7A 2A2IA 1JZ5A 3NXFA 3W1AA 5DFAA 4H04A 1FTXA 3R94A 5T26A 3FXYA 4R5EA 4JNZA 2HMCA 4LCRA 3L7RA 2PUZA 4TX9A 3B9NA 2VFIA 4GH1A 3TFCA 2JEPA 5FJIA 1OFBA 2GJNA 4MAVA 3QV6A 3W74A 1H2JA 3A4WA 3KL3A 1EIXA 5A8OA 2J7CA 4Q8UA 4HSOA 2ACRA 5AFDA 4Q32A 3W22A 4HTYA 4M19A 4QE1A 4K6AA 1WBJA 5LGXA 4DYJA 5M5DA 5CPMA 4WEVX 4ZB0A 3RMJA 1B3OA 4U4MA 2W27A 5HWJA 3BQ5A 3AHYA 5E6ZA 4PC8A 5A8GA 4MWAA 1OG6A 3O6CA 3CUXA 3II1A 4PUEA 2L5HA 2ZC1A 1LG2A 2NV9A 1V4YA 4AZBA 3OTRA 4GZ7A 4J1OA 5CSUA 3HMJG 1HXJA 3PBWA 2VKZG 4KCTA 4LANA 1F3TA 1QUMA 4H4IA 3NIYA 1J6OA 1H49A 2ZXBA 3KM8A 3N2BA 3S2CA 2CLLA 3T0TA 1DHPA 4WCJA 4HNOA 4FA3A 3FYOA 3MUAA 1QOPA 4O52A 2Y1HA 2GLKA 1Q6OA 4W8BA 1ZU8A 2E3ZA 4IP4A 3N15A 2CBVA 1XIJA 4CVWA 1R87A 4B15A 5FJJA 3RR1A 1BYAA 2BHYA 4D72A 1BTCA 4IIDA 2F6KA 3LHTA 2CBIA 2Y5JA 2ABBA 3AJ7A 4IOTA 1XCFA 2GVEA 4YN5A 2BASA 3N4FA 3ZSSA 2ZWZA 1VCVA 4LVGA 4Y9OA 5K3VA 3FKKA 2JE8A 4BQ5A 4O10A 2A7NA 2YSWA 4DNHA 5FD0A 2CU0A 1YTDA 3O15A 2QCNA 4MADA 3G3MA 3SGUA 4O17A 3THQA 4ERIA 5BOEA 1PKYA 1KCZA 2VL4A 4O11A 4W7VA 1FHLA 2ZE3A 5G1TA 3AU2A 1MUWA 1XIHA 3IUIA 4LH8A 1K70A 1YRRA 2GVLA 3ABQA 2AQWA 2XFYA 2D2GA 3A4XA 3P8IA 1B3VA 4GKLA 3T2QA 1QWGA 5T91A 2ZZ2A 1E73M 5HMDA 2Y5SA 3ZS4A 5CBBA 5CBJA 4P8XA 5EMMA 2NVDA 5KETA 4YVPA 1D3GA 3BXWA 1XYLA 2O92A 1KRBC 5EKYA 6ENLA 1F76A 1UPMB 3UWQA 1AQFA 4R9XA 5BXSA 3T0AA 5E70A 3TYCA 3ZVHB 1GOIA 2HNEA 3I7SA 3GBEA 3N2XA 3PZNA 4C6EA 3NZ1A 4OZOA 3STEA 3RM8A 2A79A 2EKCA 5G2HA 1W32A 4DLFA 3FAXA 2BNJA 4HNVA 3VDGA 3H70A 4B5SA 5EY5A 4UMAA 1YNQA 3N17A 5DY3A 3XISA 1JEZA 1UWIA 4I7VA 4R3UA 2DVUA 3HQNA 2HS6A 1KW1A 4KIEA 3VCCA 4M7TA 4D6JA 1ZUAX 5AB3A 2QCFA 2XM2A 3G0UA 3A5VA 3UGVA 2ZUVA 1IEIA 3OZOA 3S6DA 4DVOA 5CGQA 1KRAC 1O68A 4LAMA 3CZJA 3LHUA 1QNVA 2X1TA 1X1ZA 3DN5A 4NQ1A 3IV3A 3EMCA 4IFRA 1VCGA 1ZJBA 1Y5WA 2PDNA 4JFUA 3CU2A 3AMCA 3RPDA 4LAOA 1P6WA 3DHUA 3H8AA 3R5EA 3CTTA 2NLIA 1QMLA 4ZL1A 1J93A 2FVKA 5DCBA 3PZOA 4GQGA 3PJTA 3PM6A 4GYPC 4K8HA 3T0CA 3ARZA 2EPKX 3MVIA 3WIJA 4M1RA 4PUJA 2XH0A 3L5MA 4M6VA 1GZ1A 1SSGA 1EWDA 4AB4A 2YCIX 2Q02A 3UGRA 1EYEA 4MMWA 1H1YA 3Q2DA 1M9HA 3AICA 4US6A 2QCHA 1BYCA 1R85A 4QEEA 4CUCA 4O28A 1V3JA 2DZBA 3U8GA 4XO6A 2NUXA 4Z2HA 3AXMA 3M0LA 1TE6A 1P48A 4CN4A 1OADA 3T0BA 2ZRVA 3U3HA 2P50A 3BLIA 1PDYA 3EDFA 2CZFA 3MMUA 3PFRA 3DFNA 3OYXA 5CH9A 2Q09A 1XGDA 3PTKA 3KWXA 1Q6FA 3AMKA 3UW6A 1KV8A 1L6YA 2C19A 1PVNA 4CNNA 1EP1A 3RCMA 1Q6DA 1G6CA 1HP5A 1H61A 5C5YA 1OX4A 4AD4A 3UZJA 3VD4A 4FF7A 3TN4A 3MTWA 4WSJA 1J5SA 1XC4A 3SIMA 4AWUA 1UP2A 3MCMA 4GY1A 5I5RA 1Q7MA 1XLAA 2V5LA 3PWGA 4IXXA 2IPJA 4POCA 4DJFD 1BWVA 3UJEA 3G5EA 2VENA 3DESA 4OU1A 4KKXA 3MSYA 2D69A 3P5YA 3QY6A 3BV4A 5B80A 1RH9A 3P8JA 3HB9A 4HCLA 2CLOA 4KH2A 5I3HA 1YLVA 1GVIA 3VNYA 4A8RA 1LQAA 1ME7A 1UZ4A 2ZA2A 4ATLA 1F7BA 5D9MA 4A22A 2YOCA 3LSCA 2X0SA 1DJZA 3EGJA 3FJ4A 3M44A 3VINA 3QZAA 1YYAA 3UG4A 5HMEA 1U5JA 4CD8A 1OWQA 2OZ0A 3B0PA 1IE7C 4C1NA 1XI3A 1TPFA 4XAFA 1BGGA 3P60A 3AI0A 3O0FA 3RX3A 3W86A 4AD5A 1KTCA 3NO1A 4DO4A 2IPFA 4ZQPA 5C9UA 1B3XA 3IGHX 4N4PA 2WJDA 4PCPA 5BRPA 5KTLA 5F2GA 1FWDC 3BANA 1NP2A 3EMZA 4A3QA 2PP3A 4U5IA 5AHMA 3CPUA 3TNOA 1LCOA 3A9IA 4KEMA 3MHFA 1GZJA 2QCDB 2JGQA 1VIWA 2DSWA 1VFMA 4XZMX 3ZVIA 2C13A 1YDOA 4DJFC 1EP3A 5FF2A 3RDKA 1Z3NA 2CITA 3MS8A 3W7NA 3AIEA 3PUDA 1QHOA 4H6RA 4QLKA 4B9YA 1L8PA 3ANVA 5A2BA 3L4TA 3C2OA 2Z25A 3VZZA 5A6BA 2D73A 4L6OA 3R10A 2EPHA 4KRZA 4F9DA 1MFUA 1ZHAA 1EX5A 4UNIA 3DYMA 2ZRXA 3WD2A 4IPNB 1JVNA 5GVJA 2X41A 1EYWA 4O4VA 1XC6A 3NYDA 2IPGA 3ARPA 4JTFA 1RPKA 5ABGA 1ZBWA 1RBOB 4PR4A 4O1AA 4BKNA 3BUVA 1GJWA 2OYLA 1PKLA 2WNZA 2INFA 1E6QM 4BY3A 5PTDA 4GQQA 1QO5A 2XVGA 1F2JA 1MXGA 3PP7A 4DBSA 2PODA 1FDZA 4YVVA 4RZ4A 1GVFA 4N0RA 3WLNA 1GYLA 1S2CA 3MSDA 1FFQA 3NQAA 3I3EA 1L6SA 3CT7A 3W3OA 4D71A 3LGEA 1OC5A 3CIVA 1XS2A 5IBXA 4ZOCA 2W67A 5DCDA 2XTKA 3NVDA 1DJGA 3W0KA 2A21A 1KM4A 1AD4A 4PMNA 5C9WA 2Y24A 3MI6A 1GW1A 1QI3A 4LAUA 2Z27A 5LSMA 4Y2WA 1VKFA 2H3DA 5C2CA 2I7GA 1G7VA 3EB2A 4NZCA 3AMDA 4UNKA 3V36A 2B7PA 1TREA 1RV8A 1HIZA 4E3TA 4Q4OA 1BGAA 4GIRA 3VCRA 5I3IA 2VOTA 5EA9A 2XN1A 2KAUC 5A5WA 3WH7A 2C71A 3TCEA 1BF6A 1RCXB 7REQB 3GVRA 2ISVA 1S3HA 4PSPA 3LQLA 2GJRA 4UNLA 7A3HA 4NZ4A 2PURA 2QUVA 5BW6A 2O55A 5HBFA 1AUSL 1F61A 3O06A 1GOOA 5AKQA 1Q5MA 2V3GA 1QOXA 5KZ6A 1K03A 1Q6RA 4XSLA 4K8GA 3TW7A 3QC0A 1W9BM 4WRHA 3R4IA 1XQLA 1FWWA 3IIXA 4UC5A 5A6TC 1OSEA 4MDOA 3UU0A 3OYZA 4JR5A 4S3FA 1QI4A 5AN7A 5LA1A 1VJSA 5BXRA 1IZJA 3SY5A 2Q3RA 1W5NA 3SURA 4NI8A 3AS3A 4FLQA 1GOXA 1PX3A 1Q8JA 2O56A 4S38A 5D8WA 3V16A 4Q8NA 4ZGYA 3FSTA 1UR1A 5FI8A 2WXDM 5I2UA 5F4SA 2OGJA 4B2DA 3GHRA 2J88A 4C5YA 2GDVA 3KRZA 2XVKA 1UBPC 3P7YA 3G3DA 2NQJA 5ABFA 4D6FA 1H7RA 3KTXA 4AG0A 7REQA 4PUDA 4W5ZA 4HYRA 4JBRA 4NI3A 1SU5A 1R3VA 1KQZA 1A5MC 2ALDA 1MO0A 2PWHA 1TPUA 3PTDA 3T44A 4YL2A 1PL9A 4CQCA 1NDZA 3TDFA 1XDJA 5I03A 2CCRA 1CTNA 3FN9A 1GPWA 3R1ZA 4URIA 3CQKA 3P82A 4F2BA 1Q45A 4OOUA 1E0UA 1S2WA 3WDIA 4TVDA 4C65A 2R1PA 4GQBA 5D38A 1WKFA 4J7RA 3GXMA 2E5BA 2HK1A 2PDWA 5JBFA 4NHVA 1WOBA 2A3CA 1BXBA 4AXNA 1XICA 3D5HA 1EPVA 3B8SA 2XN0A 3EWZA 4QAWA 5G2IA 4Y8FA 5AC4A 4PB3A 3PJWA 5REQB 1IR2A 3QGAC 4LYQA 2DT0A 5G4WA 5D02A 3FHQA 3IRSA 1B4EA 3E0VA 3T40A 1ZCOA 2FTWA 1GKRA 1TELA 2F9RA 4ZE5A 3F03K 3JUGA 3P14A 3OB8A 4XX6A 3WX7A 5A2CA 2D20A 4WX2A 2D2JA 3TX9A 3IPWA 4RUBA 3UXLA 1XPGA 4FXFA 1EX1A 2PTXA 3LGGA 2QW5A 5TIMA 4Q8MA 3MW7A 1ZB5A 3U57A 1ZQ5A 4LTSA 2ACUA 1SO3A 1TR9A 4M8UA 4UQAA 4N02A 4ZO7A 5A2AA 3DG7A 2XIQA 2YW4A 4IMDA 3Q58A 4KFNA 1B54A 1DOSA 4ZQMA 3QSRA 4LV4A 2VZTA 4XG1A 5A95A 3E38A 2A3HA 2VQTA 2FFCA 1E9LA 3LXCA 1FWNA 4H9UA 3VNIA 3ZR5A 5AVNA 4CD7A 4GYPA 4J3WA 1RJRA 1AW5A 3HTWA 2CLFA 2R94A 3ID7A 3TH6A 3W7IA 1ALDA 3AUOA 2GGJA 1KLZA 4IT1A 4A6GA 4JX6A 4GYFA 2X40A 3WELA 2QR6A 2DJLA 4IL2A 3DX5A 3CXOA 1EQCA 4DN1A 3N11A 2CPUA 1XDLA 3PPHA 3KOWA 3EOLA 1I1WA 4UFLA 1JPHA 3EWUA 3VE7A 4UTMA 3GNDA 1EDTA 3CQJA 3TNBA 3VIHA 4P7OA 1R6WA 3REQA 3IJ9A 3OOQA 2PFHA 1EJTC 3SCVA 2O4QA 5CPTA 1K3UA 4E0CA 2V3FA 4PL2A 1XYBA 4OUEA 3POCA 1WZAA 1EQPA 4JFVA 1TWSA 2WVTA 3ISIX 1I2NA 3UXKA 3WLTA 2NZLA 2D2HA 3VIMA 3UNDA 1JDEA 1TMLA 1JUKA 3HGSA 4NJIA 3NSNA 1XLIA 5M1TA 5FF0A 4B3KA 2V38A 4LYPA 3R2GA 1LQ0A 4TTUA 4ONVA 3DH7A 1GYNA 4BK9A 5LIWX 1UHVA 1X39A 1TYGA 4J3SA 1PHWA 1W37A 1ZZMA 3W07A 2OG9A 4IQEA 4TQTA 1OCBA 5FJPA 4HD5A 3HG4A 2PLCA 4HJWA 1FH8A 2V5CA 5I24A 5A6AA 4KBXA 5CPQA 2Q01A 5LNVA 3VI2A 3GFYA 1W1A1 3RRXA 3CASA 1K7XA 6CGTA 3U2CA 1SJDA 4DBDA 1DTNA 2WYSA 1R7AA 3U4AA 2F2KA 1TV7A 3T05A 1JNEA 4WSHA 4IF2A 3NWRA 3EOEA 4W7WA 2XSBA 3M5VA 2PA6A 1RD6A 1TPB1 1WKEA 5FEZA 3AYTA 4ORMA 1NF7A 1QASA 2GUBA 3OQEA 4YNGA 4XBJA 2A5HA 3FHAA 1E6PA 1PJ9A 4IFKB 1C3FA 1IWBA 3RR4A 3ALFA 6TIMA 1XLEA 2C0HA 5DT7A 4OVXA 4P8UA 4IMCA 4E38A 1F3XA 4V27A 1GVRA 2V9DA 3PVFA 4IG2B 4M51A 1R38A 4UOZA 2PI6A 1P4CA 4W4QA 4M6QA 1WZLA 3H24A 4MWAC 5DRCA 2NLYA 1CXEA 1EZ2A 2R24A 1L2UA 1YQ2A 4IIBA 1PZ2A 1GEHA 5I3FA 4H8VA 4ADUA 1W8GA 1T41A 4S3KA 2XFFA 3WJSA 1E6XM 3GFZA 3KBMA 3AS0A 1TZ7A 2BVYA 4Q7BA 5HOSA 1BEUA 4Q3MA 3MZNA 5LGZA 1P0EA 4ZFCA 2H8XA 2A7PA 5FF4A 4GVFA 4IPLA 1OG0A 3K4WA 3L5AA 4JTAA 2O7SA 4XD5A 1O5RA 4I3GA 1UB3A 3KHJA 2QIIA 1JR1A 4MYAA 1XYFA 4H8NA 2DH2A 3FXGA 1IXOA 2Y70A 4S23A 2V8ZA 4IL0A 3ZVHA 3ZWSA 4Z1YA 4W89A 1DE6A 4FX8A 3KAOA 4QNEA 4J9JA 4UMBA 1IZCA 4GZIA 4PBEA 1KRCC 5A6LA 3HF3A 2ZIDA 1JCXA 3NL5A 4DJDC 4M81A 3W23A 3BJFA 3TQ0A 3R12A 3UG3A 3VNJA 1YNPA 4UTIA 1FKXA 1JCJA 3V5FA 3UZWA 3V75A 3FFSA 1PBGA 5D8ZA 4ROQA 5A69A 2J9YA 4FNQA 4Z17A 4H8HA 5JIWA 1KGXA 2J6VA 1MUMA 3DFHA 4S2CA 2WV8A 4GVIA 1H50A 3WMBA 2DZPA 2ZFAA 3CQHA 1XCWA 2XGIA 1I75A 3E3HA 3IWPA 2E6YA 1NP0A 3RLHA 3GDMA 4MJMA 4HSHA 2NXHA 1GK8A 1KCXA 2IKGA 3LMYA 3OGRA 1DL3A 3TSBA 4UFHA 2P10A 1V02A 3VOCA 3AHVA 2Y5EA 4AD2A 1KM5A 1KNWA 2F2HA 3LD5A 2Y61A 4P7RA 4DJED 1VCFA 3ARTA 2ZZ3A 4A2RA 1FCBA 2YX0A 1BRLA 2PPGA 3QHOA 4XKYB 3UD6A 6TAAA 4AC7C 4YPJA 3VMPA 2ZX5A 3UR8A 4JDYA 2V0TA 4Q4KA 1YEYA 5HANA 2ZC8A 4CQDA 5TQLA 2Y85A 2POZA 3L4YA 4JKKA 5M3WA 1XG3A 3ZLHA 3QR3A 1GOWA 2XIOA 3E2SA 3K8LA 3WLHA 1J4EA 1H1NA 3GG1A 5DANA 4IQLA 1EIBA 1XBXA 1S2AA 3OGVA 1HNYA 3RPTA 2I1OA 4MY1A 3PPGA 4FXSA 2XWEA 1YPXA 5BROA 3VFCA 1CW2A 1J6PA 4P2VA 1M3UA 5CLTA 4C91A 4LYKA 4BHYA 3VUPA 3B04A 3GNRA 1YBQA 5FEPA 2NQ5A 1RPXA 5EPDA 3D6NA 3PZQA 1R3SA 3S6TA 2Y0FA 2RDTA 4DXVA 4UTTC 3UWYA 3IJDA 3KTCA 5H6HA 4LRTA 1AK5A 4RZ6A 4FOKA 3FNDA 2HBVA 3O1NA 3C52A 1OY0A 4U10A 3UJFA 1TTIA 4H6KA 4AH7A 1A50A 4PE8A 1DP0A 1E72M 4EAYA 3CUZA 1HTIA 5C55A 5EMUA 1OX5A 1GW9A 4IZGA 4AIUA 1MVYA 2XIBA 4ZQNA 3E02A 2CC0A 3ARQA 1Z89A 3WUGA 3U2ZA 5BXPA 2OQHA 3TV8A 1XBVA 2PRMA 4DWSA 1GTEA 1NDVA 4HHLA 2Z4GA 5CPOA 3O05A 3I6TA 3TJIA 1MFVA 3W76A 3WQFA 1W3IA 4HTBA 1Z44A 3RO6A 3TA6A 2FZDA 2QGHA 5BOOA 2C15A 1KFCA 5G4EA 1E5JA 1TV4A 3IUDA 3DFYA 1S2TA 1K9DA 3SN0A 1BVNP 1E0TA 2HNHA 3F7JA 2X0YA 1QNQA 3IJIA 3DGRA 3CT2A 4H83A 1OM0A 1S5WA 3SCSA 1PZ1A 3T7VA 4Q8VA 4DBWA 1IEWA 1CWYA 4GA8A 2OZTA 3TE9A 3I4EA 4AWEA 1TZ9A 4UR9A 4CCZA 1SJCA 5D03A 5A94A 3PB2A 1ISVA 2X42A 2Q8ZA 1M65A 4NAFA 3WD4A 1FRBA 2HXTA 2IUZA 4IJCA 4HU3A 5FIPA 4LC6A 2DIJA 3DHPA 1PYFA 5ABTA 3CUIA 2J62A 2MNRA 3P62A 3DFTA 3ZMRA 1P0KA 3SGGA 2VDHA 3WL1A 1GJUA 2WMIB 2QCDA 4YJ5A 3TVAA 4V1XA 3EX2A 1F9CA 1RA0A 4IP5A 3CLMA 1WXZA 3UR7A 4DBUA 3EDJA 4PEKA 3CO8A 1ADOA 2I16A 4WDTA 3Q45A 5E93A 3LHZA 3PHAA 2XYLA 2GPTA 2WC4A 1SFLA 4WK9A 4LUTA 2CKRA 3S6OA 2Y4SA 3I6EA 2VURA 1FCUA 1UP0A 4HCDA 4MGGA 1GQKA 3CAWA 5T9CE 3G0XA 3MY9A 1CGXA 3DUGA 4QCFA 1T8QA 3HQPA 3BDKA 4N7QA 3SZ8A 1GYMA 5DBTA 4H00A 5E9AA 4DWSB 3BZGA 1IIGA 1Q8AA 3T8QA 4JTSA 4AAJA 3VXGA 1XUZA 1VRXA 2UZ9A 2J25A 3PBGA 3QPYA 5D09A 3LRLA 2PDKA 1TX0A 1V93A 4HNCA 3QJAA 2A3AA 2RAGA 3PC0A 1HT6A 2XN2A 3WNPA 5BMXA 4REQB 1V3MA 4YIWA 3CUHA 1RZMA 3CH9A 1K6AA 2DZTA 3PSVA 3HV8A 3N4EA 3G1HA 1JPMA 4FX7A 5MHBA 1Y7VA 4MIMA 2QJMA 5CGTA 3G24A 1WX0A 3OW1A 4PRWA 3RITA 3E0LA 4D6EA 1BF2A 2B7OA 3S5OA 5D33A 3TAKA 3CB8A 1VFOA 4DEFA 3OPSA 4YWSA 1X6NA 4CLMA 1JCTA 2OQLA 3EWWA 5AYIA 1VHCA 1X6UA 3CEPA 4FF5A 2CETA 4Y90A 4JNMA 5HNTA 2J9XA 3CAKA 1B57A 3M0YA 3AOFA 2NX9A 3BLOA 3EYPA 2IKIA 2NW0A 4AW7A 3GH7A 5CC3A 4AISA 3UF9A 4QCEA 4RXGA 3S1XA 4RR4A 4PTNA 2EPMX 2UBPC 1A0DA 1KRMA 2E09A 1YDYA 3QQWA 2PTYA 4BI5A 2DFAA 2QIWA 2YL6A 5A3HA 3GXTA 2HK0A 1YPIA 4UOJA 1JJKA 5DT5A 4LC8A 3C56A 2YFNA 3CUFA 3FKRA 3N4AA 2TSYA 4JTIA 3S9IA 1AH0A 4AVNA 3IIPA 1XINA 1G4EA 5HDRA 4YXGA 4XZ9A 4XK2A 3B4YA 4MUZA 3ERPA 4BFAA 4XUYA 2GWGA 1O5XA 4QQUA 4PUUA 4ICMA 1NFBA 2D0HA 3KLKA 4D6HA 3ZJ6A 4IH3A 4NZFA 1P6BA 3PANA 1JZ4A 3TQVA 5CPSA 1S3TC 2Z00A 1SZFA 2DQWA 3SUWA 4EXQA 3VKKA 3PPCA 3B40A 2OWCA 1R5YA 3L66A 1KXQA 4GJJA 2WHKA 4NJGA 4RNFA 3HIJA 1XCXA 4PL1A 4MLJA 4N6FA 4QP0A 4DB7A 3KCOA 6REQA 1MQQA 4QG8A 1VD6A 4L56A 3SCUA 3JVAA 4GX8A 2ZUNA 3IGSA 4GOAA 3UESA 2OLHA 4F66A 5FAJA 4LJ3A 4HU4A 3ARUA 4DO7A 2QS8A 1HVQA 2PDLA 5FF7A 3QM3A 1UQZA 3I6RA 2GVYA 3V7PA 4WOQA 3EWCA 3KX6A 5F4XA 4QS5A 4QXIA 2PF8A 5AHEA 3NDZA 2J74A 3BJTA 3ITLA 3MUZ1 2GYIA 2FFIA 3TC7A 2TODA 4RDZA 1V7AA 4C1KA 2YDSA 4QM1A 5F2MA 3AXIA 5JUVA 1XYCA 2I17A 4PGLA 3RU6A 3WF4A 4TV5A 2XIIA 2XM1A 3W38A 3TMLA 4AD1A 3WCZA 1VYPX 3CTLA 2V68A 3RCYA 3PBUA 4JGDA 3PUGA 4X63A 4HGXA 2YCJA 3WLRA 3W26A 1V02E 1SZGA 5EMKA 4E4FA 4RLIA 5HWMA 1OC6A 3BAYA 4QDMA 3FW6A 1SO5A 2XISA 2G41A 5C71A 2WCSA 1QPRA 4U2ZA 1PKNA 5DXYA 3GK0A 4JIHA 3AUJA 2PC4A 4WIWA 3WQ4A 1R30A 2WVVA 4Q8TA 4W8LA 1MRAA 3P3BA 4Q7NA 3U6WA 2G3MA 4LY4A 1C29A 4E4UA 1ZPTA 4O54A 2VRKA 3RRAA 5BOFA 1VGAA 3HGOA 1JUBA 1TPH1 1KBLA 3SY8A 5ABEA 5BZAA 1EA0A 4TUFA 9RUBA 3W7JA 2VCBA 3W81A 3BICA 4HPGA 1OFRA 5HR7A 3SY1A 2PCQA 2QDHA 2Q8LA 3TK7A 3LDVA 4JTDA 3TXZA 2DY3A 3C2YA 4HNLA 4C7FA 5DQPA 4ZXLA 3D3FA 2XVLA 3BLDA 4TX8A 1MQPA 1KV5A 4NZ3A 2XFRA 4RDVA 1YDNA 1EB3A 4ML4A 2BXVA 2A4AA 3DEQA 1HKJA 2QMJA 4L5ZA 4F0HA 4J2PA 3QH2A 2VCCA 3QR0A 4PMOA 3P0XA 2QHAA 1VFTA 3LU2A 1W1VA 3NO3A 3SM0A 3RPMA 1DXFA 3WY1A 4GUHA 4I5UA 1EXPA 4WY0A 3S1UA 3MI3A 3W2LA 4LF1A 3GXNA 3GYEA 3VABA 3KDOA 2HWGA 3GNOA 4CVUA 5LNWA 2CLMA 4TU1A 3AALA 3L67A 2H9AA 2ZRUA 1Q6QA 2BBFA 2GUUA 3L4VA 5DO8A 4OHQA 4UTWA 3V5CA 1HGWA 1GZGA 1S5VA 4H9VA 8RUCA 5ECUA 2JIEA 4HK6A 1A4MA 2WB5A 3W71A 3ZLFA 3WNOA 1W5OA 3AQUA 4CN6A 1TJ0A 5BWAA 1S1PA 2V5JA 1CDGA 1NARA 1E1CB 1OFAA 2D1ZA 4ZSUA 4LRSA 1XIIA 1KM1A 4HNTA 2BHUA 3B0YA 2OX4A 3QMTA 4Z2IA 3VKBA 3EXTA 1CB7B 5I00A 2WHJA 1BXNA 2P3ZA 8A3HA 1X8CA 1YDVA 3TYBA 4H9TA 3HOJA 1ISZA 4AIBA 3Q37A 3OVQA 4L64A 3GDLA 5HNUA 1C93A 3ABRA 5HAOA 4R9OA 4AZIA 2UY3A 3M6YA 4EKJA 2VEFA 4GACA 2OQYA 3IVTA 2CLHA 1BSLA 4W5UA 2OOFA 3CWNA 4X0NA 3ZO9A 5JIPA 3IACA 9XIAA 3WK3A 4BQ4A 2J24A 4AZHA 2GSHA 2NUWA 4XBSA 1TE1A 5E9XA 3A4AA 1RJPA 2ISFA 1E6ZA 1TUFA 5EB8A 4WGXA 4PYSA 3VA8A 3O63A 3HURA 1HKWA 4ZBCA 5DF0A 5K9XA 3TYAA 3QFWA 2WJZA 1NH6A 4FX6M 4NKCA 4UQ9A 5KZMA 4S1FA 1UWAA 2EAWA 1Q7ZA 3NQMA 1DJIA 2FGLA 3LCXA 3VD3A 1HJQA 3W1XA 1MW3A 1E4IA 4UFKA 5TNVA 4AWTA 3KLLA 3MANA 4JXCA 3ZSTA 4HHHA 2REQB 3GVGA 2PWFA 3VX0A 5E5CA 1BHGA 2FZMA 1E71M 1UUQA 3VGBA 4O14A 1R3WA 4GQRA 3VU2A 1OF6A 3TLQA 3FGCB 4TXEA 3MP5A 5IHSA 1DQXA 2O9RA 3PAOA 3SN4A 3QVQA 4AZ7A 4E8GA 5AZ0A 4WJEA 2NQ9A 4RV8A 1RALA 3M5YA 1J18A 1W0MA 1WBHA 4LBUA 5BCAA 1TR1A 1U1JA 5I7GA 1TPEA 4HOWA 4ICCX 3URAA 2DJXA 1KO0A 1O1HA 3VIOA 1TRDA 2Z28A 4JTUA 3QFEA 3KUMA 4GY7A 2RJHA 3E5BA 3S46A 4D6DA 1X7FA 3VDBA 4LWWA 3E12A 4KS0A 3TIMA 1CIUA 2F7FA 4GC4A 1OZMA 3ARRA 4IMAA 5FEWA 3MBFA 1Z8AA 1AVAA 4G56A 3O0KA 4O50A 1B3YA 5ABFB 4B90A 1XIMA 1M7JA 2ZX6A 1ZJAA 4MZ1A 2ZZ7A 4GBUA 1BSIA 1ICPA 4M82A 1V3KA 2Z6JA 4JFSA 2E8YA 2E67A 3DBNA 1WDPA 1F4HA 3AFBA 5I06A 3K4DA 3ME3A 4HMEA 4S2BA 5CQ1A 5HPCA 1XLJA 4JKLA 3FEQA 1MW2A 5MKGB 1PS9A 3LV6A 4NAEB 4HA3A 1W54A 4MFDA 3W02A 4OTKA 4D8AA 2NSXA 2X09A 3W37A 1A3HA 4QHRA 4RE0A 5LA2A 2WSPA 2QYGA 4X9YA 3SUUA 3MHGA 1BWKA 3WH8A 2UY5A 3IJQA 2VX7A 3A13A 3G8RA 4UR8A 2E6AA 2JK2A 4R27A 3M0MA 4MZYA 3H26A 3BURA 2GQ9A 3TR2A 2ZXQA 3QYSA 3O2LA 2PWDA 5A1AA 3ZR4A 4NYUA 1H1ZA 3MI2A 1ONXA 1UJQA 1ZJHA 4JTCA 1A5CA 4BA0A 4XIAA 2WNNA 3M9YA 4M24A 4FOJA 3V0TA 2VC5A 4PMQA 2WZTA 3VPLA 2YYUA 1CECA 2DPEA 3SQSA 3QR1A 3MO4A 5KSWA 1GQJA 4JIEA 3DBPA 1C7SA 1TG7A 4MAZA 1GHSA 1R2RA 5J8LA 5EMLA 1W3JA 1RJQA 4NVTA 1KGUA 3RAOA 3WFAA 4F9JA 4FK9A 4JAWA 2YDAA 4L9XA 3QOMA 3MDUA 1EHAA 7ENLA 1UW9A 2WCAA 3VM7A 1HF6A 2CZDA 1OINA 3F2BA 1YTKA 3MSRA 5AHFA 5KZEA 1J9YA 1KFEA 1OZQA 4Q7IA 1PE1A 5AHIA 2WC7A 3GZ3A 4LGXA 5A8QA 3SRHA 2OEJA 2E4TA 5G5IA 3TMQA 2WSYA 1FY6A 3BCJA 5AECA 2EGZA 3QY7A 1XDMA 1WYIA 4K38A 5J5RA 4NZJA 5HMFA 2EPNA 4C60A 4L4PA 3TA9A 4C6NA 2CZ5A 2OT0A 4R88A 4GUGA 3BOXA 1Q4NX 2QULA 4J4KA 3DI0A 2WMIA 6PTDA 4KERA 4R7WA 3CLWA 3NNTA 1UCWA 3PZ9A 4HHPA 4X60A 5D2XA 1RLCL 2P3EA 4PUKA 3VMOA 3GHSA 1ONEA 4IPJA 1V0KA 1ZBKA 3GIQA 2WJFA 3WBWA 4QE4A 3VKJA 4QR6A 1NIUA 5FL0A 4DXKA 1NFPA 2PDMA 5U7SA 2WMHA 1CLKA 1AZ1A 1CB2A 3FX4A 1FWEC 1XLFA 2LLEA 3HQOA 1PX8A 5CZTA 2PE4A 3JU2A 1FDYA 3URQA 3GDKA 1QCWA 3W83A 3A6OA 3WF1A 2J27A 1EDQA 4IIHA 4Z0JA 3H2CA 2VUNA 2OO0A 2BB0A 3T4CA 3VGFA 1EF3A 1GVYA 3TTSA 3LCIA 3ZLGA 1QPNA 4QJ3B 4W88A 1Q13A 3VOGA 3LPFA 3M0KA 1DXIA 3FOKA 4YCOA 3UY7A 1SYTA 3RO8A 1SZNA 4PULA 2EPLX 4MOZA 4CD4A 3A64A 3EA2A 3QGKC 3G1AA 4ACYA 5C2GA 5H91A 1G67A 3F5LA 5EMYA 4UFIA 5GNZA 4D9PA 1M41A 4K3ZA 3URNA 1TA3B 3IIOA 1X1NA 2R6OA 3I10A 4XVDA 1QI0A 3FA3A 2RKXA 1PTAA 4GGBA 4E4PA 3M47A 4XV0A 3QMRA 2W66A 4HPJA 1F07A 3LYEA 3YPIA 1ZBVA 4OIFA 3U5YA 1B30A 1ZAJA 2EG8A 4Z1CA 1WPCA 2JF6A 1OB0A 3M0IA 5EMJA 2VFFA 2J79A 5DMYA 3AZTA 2BY0A 2V81A 3D47A 1UR8A 3FVMA 1Q6GA 3IK4A 3URBA 2AMGA 1SFTA 4ZENA 2Z1BA 1XL9A 3KS5A 3ITOA 1SO4A 2UV8G 1VH7A 3DHFA 3WUBA 1E4MM 5AYBA 3D46A 3V3WA 1R2TA 3W7GA 2YPIA 3IK2A 2YW3A 3EOOA 3SIZA 2ESCA 2TAAA 3V0SA 4P5UA 1TRIA 3R8GA 1OYBA 3RIKA 2Y7DA 1XLLA 2E1DA 3CS2A 5IXEA 3C3NA 5JBEA 2VX6A 3ARWA 3W7QA 5L9FA 3OLDA 4PFMA 1SW7A 4A21A 1O4UA 3WBEA 4GH3A 4UTFA 1W3NA 3GWQA 5CLWA 4ZVJA 1EC9A 1JUEA 3GD6A 4AZGA 3TC6A 4IX2A 2R8WA 4OBTA 3TQKA 2D2OA 4AF0A 4HA1A 1UWUA 3WNLA 1VF8A 4QITA 4B5XA 3T6CA 3O6DA 2R91A 2HE8A 3AIWA 4V15A 2QV4A 4O1EA 2ZCGA 1DWGM 1TCDA 4L1WA 3L4WA 2B7NA 1UWTA 3C3UA 1VFLA 1W9VA 3IARA 5FJTA 3NURA 4UUIA 3UVIA 4C5ZA 1PAMA 3PZTA 1RXOB 1GT8A 3P6LA 1GVOA 3IVSA 1DJQA 5DMLA 4MJ2A 1D3HA 2E5DA 4QRNA 3BV7A 2VELA 3SCNA 3N73A 1WA3A 4WKFA 2V6AA 1L2QA 1RSCA 1T7LA 1EJUC 3VD9A 3E0FA 4H7VA 1US0A 1OCJA 4GFIA 4QFUA 1W1IE 2WCGA 1V08A 1L0PA 4JS3A 1A0EA 3E1F1 3NL2A 1JRBA 5B7ZA 1S5MA 3UQNA 2GJXA 3HPSA 4BWLC 3MYPA 4HOZA 3DOPA 2FZ8A 4GUJA 4UCFA 3NEHA 3R89A 3PULA 1ZS2A 4GQ0A 2C16A 2ANUA 1K7FA 4DX3A 5IFPA 5A8MA 2O9TA 3GY1A 3G8EA 3HZ3A 4FNPA 3XINA 1O1ZA 1LM1A 4Q4MA 2WJEA 4Q6JA 4C7GA 1KA9F 4K8EA 2IPWA 2FJKA 1DE5A 1KXVA 3ZJ7A 1AJ0A 3SN1A 3U5UA 3PB0A 3CYJA 4E2DA 5K2ZA 2DGAA 4NJJA 3C86A 1R47A 3H2AA 3AHZA 6ALDA 1TJ1A 3V5OA 3UR2A 3PZIA 1IGWA 3AISA 4GUIA 1UH3A 1IT7A 1FHUA 4XKYA 1E6SM 5AHLA 2E9BA 1AFSA 4LBSA 4LALA 1UD5A 4WF7A 1XLGA 2CBUA 3VKAA 3USZA 3LCHA 4F40A 4H3DA 4CN1A 5E0FA 4L1XA 2BOGX 3W29A 2ACSA 2HISA 1OFOA 4JYFA 4W9TA 3IGUA 1TB3A 1W56A 4N2YA 5AYZA 5J04A 3VNMA 1QDSA 3GXPA 2R1MA 2FZNA 3VOJA 4UTKA 3PJUA 1LRTA 3OJGA 2WAGA 1JCMP 1OCQA 3PR2A 2WWDA 2R82A 3QQ1A 1ZP4A 3GU1A 3ATZA 3CZGA 4GLEA 3NM3A 1BD0A 4ZODA 1E4NA 4G1KA 2XZ9A 1VEOA 1BG4A 3HGJA 1U1HA 2YL5A 3GS6A 3H55A 4AQLA 1GTHA 4H9MA 4S3AA 1ITQA 4J28A 1KR1A 3W82A 1RBAA 3MYOA 5HQMA 4GMEA 1EJSC 1WQ5A 3BMXA 3L4XA 4CQBA 2YKKA 2B81A 1UR0A 3N13A 2XH2A 1CGWA 2VMFA 4GI4A 2V2HA 1JGIA 2G4JA 1M1BA 2VYOA 3W9ZA 4LNCA 4RCXA 3M0XA 4GPNA 3HFTA 2G8ZA 1P5BA 1HW6A 2PWEA 2VEPA 3WO8A 1DJHA 4UMCA 2PRLA 1S5NA 1LLZA 5BU6A 4NNCA 4AD3A 3WJXA 4X61A 3UWUA 1YPFA 2VZUA 1UJPA 3FS2A 2ZX8A 5CSRA 1R9XA 3VZXA 5JXQA 5LXXA 3THUA 3MA8A 4WDXA 2QCGA 3UZZA 1UYQA 2W3ZA 2PDGA 1PYMA 1VLIA 4G2DA 1W1B1 4AIOA 4S3DA 2OSWA 1TMQA 1FWAC 2OB3A 1MQRA 4WQ6A 3G2GA 3S5NA 2WPGA 3DERA 4TVUA 2PDJA 3BW2A 3KP0A 2B4GA 3NQ8A 2VX4A 1NWTA 1KFKA 1E1CA 1J8VA 4WHBA 5LXEA 1SW3A 1VHNA 1D8CA 3H22A 2WNWA 4B5NA 3EZ4A 1UD2A 3R25A 1VP5A 2CHNA 3KDNA 2A6LA 3W28A 2WK2A 1JD7A 5K9DA 1AL7A 4AHQA 4EIVA 3L0GA 1Q66A 4QISA 3J7HA 3UJRA 3GRIA 3WL0A 1R3YA 4NASA 1NDWA 3OA3A 2WZMA 1PEZA 2F8QA 1WXYA 1VR6A 3G77A 3L9CA 1D2KA 4RX0A 4LS1A 1VPXA 5IM51 3DFSA 3A24A 4O0QA 4QE5A 1DWFM 3LPPA 2PDQA 3U7VA 3OZYA 2CLIA 4IGMA 4IP7A 3V35A 4OGZA 3QQ0A 2X30A 3QLLA 1XW8A 4NX0A 3KZPA 3TW6A 3EKGA 8CGTA 4X9SA 3WQPA 3OQ8A 1ISXA 2RGMA 4H1ZA 3H4XA 4QDPA 3F4NA 3AIUA 3EDDA 4AMCA 1R3TA 5FEXA 3LRKA 2C8NA 3O6YX 3CWOX 3F1QA 1JZ3A 4DY1A 5FJOA 3CHEA 1XG4A 4UTLA 3WLMA 2F61A 3SCPA 4DZ5A 4OBSA 2H6RA 4HP5A 3S5YA 4LUSA 4ENLA 4AYSA 2WM1A 1C7TA 3SAZA 3NZRA 4H9XA 3RX4A 3GXIA 4L80A 1PDZA 3AXXA 1HZYA 1TPDA 4GYJA 4S39A 3D3AA 4H9YA 3IANA 3W7DA 2D0FA 4FNUA 3VOIA 2FJUB 1LL4A 4HNNA 3ZXWA 1XD0A 2VP8A 4HA4A 2VRJA 3MP4A 1YNYA 2FZ9A 4TX6A 5REQA 3UP8A 1DYSA 2IMRA 4J3TA 3E2VA 3BAWA 3W27A 3NOEA 5BRBA 3ANUA 4C6CA 2QJHA 3N6QA 1QXLA 1DPMA 4DJEC 3W2KA 3KBJA 2PS2A 2ZICA 3KE0A 4IGSA 1TWWA 4LB3A 3M5XA 5CSSA 1YHTA 3DYPA 1KGWA 4M1BA 3C5QA 3WNNA 4AF0B 2BG5A 3FA5A 1HKVA 1I9CB 1W1PA 2A3BA 1WKYA 3U2EA 3KBWA 2VEMA 3PK7A 2DH3A 1EJVC 2HZGA 3GO2A 3NQ2A 3AC0A 3UERA 4XVEA 4PUMA 5FSEC 2VD8A 4NUWA 2YBVA 3EPMA 1ADDA 4Q4QA 1NTHA 4PMRA 1XR2A 3G1VA 4NX5A 1DIDA 1JI1A 1OK4A 3BCDA 2FMOA 3OLGA 4XISA 4FR1A 4Q4PA 4PUWA 4A35A 1LWJA 2BVWA 4RXFA 1C9WA 1DWAM 1V6YA 4I90A 4C6JA 1W91A 1NM9A 5FF3A 4X2RA 1EGVA 5H1WA 2V3DA 3AYRA 3O16A 3TTYA 3E6EA 4GVHA 4WZHA 2DUAA 3GKFA 2PDXA 1BPLB 2WMFA 3SO7A 1EJRC 3IUHA 3G1FA 3P5ZA 4Z2LA 3VILA 2INEA 1M01A 2W0UA 1VLWA 1QK0A 3TZFA 4B3ZA 3TUUA 3KL0A 1U5VA 3DZ1A 3N2TA 4XAZA 1U30A 3ZWTA 2PLJA 4YYFA 4GABA 2ZA3A 3L2IA 1E9IA 1VS1A 3GNXA 2Y63A 5D9NA 2DZAA 4EACA 3GXFA 1UD4A 2PGRA 2PGWA 1JD9A 2YBUA 3B8VA 1FWGC 3G1XA 4N9BA 1LUCB 1X97A 2GSEA 1NDYA 1P0DA 1AZ2A 2J7BA 3EX6A 4GG9A 2FLIA 1EPXA 2YLLA 5HINA 2BODX 2QZRA 1F6PA 3TEVA 4X3ZA 2A1YA 2P0IA 2GJLA 3MP3A 2PCEA 3UWEA 5M2FX 3FJNA 3NUKA 1EUNA 3NAVA 3SSZA 3MB9A 1F8IA 4B92A 1H51A 2J77A 3AIQA 5BNKA 1TIWA 4KEUA 2EBNA 3B4UA 2VC9A 4AEEA 4C6LA 3QHMA 1BQCA 1RQBA 3T8LA 3CZLA 3WSUA 3RUBL 1EKOA 4MG4A 3W7HA 3ENLA 4ZTXA 1REQB 2QVNA 4F0MA 4OT7A 3EMQA 4KCUA 3WUEA 5HJYA 3HJEA 1HJWA 3EOSA 3BQ6A 2G3FA 2ZQ0A 4FALA 1Q65A 3JZEA 4D6GA 3G6MA 5F2LA 4GRSA 1GG0A 1BKHA 4XTIA 4YCPA 3N9SA 5FJUA 1NOFA 4JOMA 3XIMA 3MUIA 3WJZA 3ZJKA 4EXAA 1ZFJA 2ZZ5A 1MWOA 5E1QA 2D0GA 3KXQA 3W72A 3L21A 1SPQA 3AWNA 4GIEA 4DPPA 1LBLA 1WP6A 4NYYA 3GW3A 1ZGDA 3RYSA 1BQGA 4MSSA 4HSNA 4WY0F 2FMNA 3CEUA 5FSDC 1TV5A 1JRCA 2WQPA 2DW7A 3WQWA 2E28A 1XFBA 3T4WA 5JQ9A 4I7WA 2DP3A 1ISWA 3AIRA 2D23A 3QF0A 3UCDA 3OO2A 3CNYA 1GNXA 2GJPA 2WO5A 3GAKA 3GH4A 5CCZA 1A5BA 1KM3A 2EKGA 2BS9A 3B05A 5KMYA 1FX6A 4I5RA 3VGEA 3RHGA 4KWVA 2QF8A 4R7JA 3WJYA 3VIGA 2VT0A 5D05A 3A3HA 4NJKA 4DIAA 2E6FA 4HCHA 3A21A 1VYRA 1XYAA 3VTRA 2GOUA 4DNMA 1P6CA 1SFJA 3STPA 3DKJA 3PWAA 3DFQA 1N2VA 4D2JA 1W5QA 2C14A 2BHZA 4JTTA 5D2VA 5DMNA 3CV2A 2V3EA 3AHXA 1JGMA 3VYLA 1US3A 3WFLA 4HBKA 4NU7A 1UMLA 1W3HA 3MWAA 3ZIZA 4JQ2A 1V0NA 1TA3A 5AC8A 5IBXC 1AJ2A 3EDKA 3C8FA 1TJPA 2WPBA 1MYRA 4R34A 1H41A 3CUJA 1PCKA 1IXQA 1OGBA 2QUNA 3ABXA 3W1NA 4CCCA 1XRTA 4WUIA 3UPMA 3IJLA 2VWSA 2QAPA 2PWGA 4B5VA 4C6IA 2FTPA 5I79A 2X1UA 3WN6A 1HJXA 1PKMA 4L7ZA 5E09A 2DSUA 1AODA 3UBPC 3IIVA 4UTJA 3I7RA 3MKVA 3TCSA 4DZAA 4HYWA 4Z0SA 4JHMA 1UKSA 2X2GA 3VVGA 4C6PA 3AZRA 1GPFA 4JDBA 1IQ8A 1NQ6A 3CMGA 3UWWA 3WDQA 1J11A 4GFSA 2GGHA 4NRRA 1RHCA 3AIVA 2P8CA 1YMYA 4IIFA 2D3LA 4PRTA 1EJWC 4HOXA 5XINA 2Z1WA 3TAOA 4UTTA 3N18A 2RJGA 2OSYA 1ENUA 2ZUTA 1OD8A 2YLAA 3UZYA 4PH6A 3LI1A 4K36A 1R7OA 4W85A 5XIAA 3N12A 1M7OA 3H21A 4DZIA 3MMDA 3ZT6A 1QI2A 3BSMA 5K7JA 1LF1A 2Z2UA 5AOUA 3EEZA 2A0NA 2G3IA 2A7RA 2YZ5A 3WDPP 1EO7A 1KM6A 1J0KA 3FSUA 3SRKA 1O6IA 4KFPA 3LXAA 3NOYA 1OGGA 1JXKA 1D7FA 1YXYA 3MDWA 3NG3A 1VEPA 3V1HA 2VEKA 2WHLA 1C8XA 4AIEA 3R13A 2QVHA 2XH4A 2CWNA 1IT8A 3GTNA 3GSMA 1GUVA 1P1MA 1X96A 4JKMA 4C6DA 4NNAA 2R1KA 3TYEA 1H7PA 4A3YA 4DF0A 2C91A 5HJLA 2GGGA 4CKQA 3PJXA 3UWVA 3ITCA 2PDCA 4QG6A 3E9AA 3GUGA 4IPPA 4DJEA 3A4JA 3AJXA 1KBBA 5EBUA 1UR4A 2JBMA 3UYIA 1HO1A 2WNQA 2BOEX 1RY0A 1ONRA 1WZMA 4NF7A 3BTNA 2Y7FA 1A5UA 4AEFA 1QHZA 1DIOA 3LA4A 1JF5A 3AMGA 3EPNA 3SCOA 1W2VA 1OYCA 5G1MA 4US5A 4ZOAA 4A2SA 1QNSA 3LMZA 4H01A 5AZ1A 2VGIA 2XGZA 5MKGA 3RN6A 1FWIC 2WQDA 3UJSA 4YTTA 3JRKA 1C92A 1V8EA 4ZOBA 1JQXA 2VDIA 1MEHA 3S2JA 2P76A 4XSMA 2YZRA 4XZWA 4F0RA 3QBUA 5LHFA 1U5HA 3SCTA 4RK8A 3MBDA 1F8MA 4FS9A 2XVNA 3G1SA 1B3ZA 2ODOA 3ES7A 2TMDA 1DJWA 2AGKA 1CGYA 3MZ2A 4O1FA 3WLSA 1SMDA 2VDGA 3O6AA 4MB3A 4XZBA 4PMYA 2ZKMX 1CI1A 2XFWA 1EJ7L 1PZ0A 4GWEA 4XIMA 2PB1A 1GOMA 2Y2WA 1NELA 3LPOA 3N6JA 2R1LA 4GO9A 1T99A 3SBFA 1FVPA 3ITYA 1U2YA 4J35A 4CQ8A 3MJMA 3LGDA 1FFRA 1WV2A 2YCEA 2QNEA 2AQOA 1QATA 3LBOA 1I0BA 5CXPA 4KIRA 3OHMB 1XM3A 2V82A 1JDFA 5H2ZA 5J5DA 3SUVA 2I57A 2GDUA 2E25A