1B3YA

Xylanase from penicillium simplicissimum, complex with xylotetraose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
total genus 127
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3yA00
1BYBA 1JYNA 3AOFA 1Q6EA 2CNCA 3GH4A 1UQYA 3PN8A 3N12A 4PMQA 1OSEA 1JYXA 4WKHA 2CBUA 2Y8KA 3VIMA 1KQZA 1B3XA 1BYAA 1H3GA 1KGXA 1UKPA 3KWXA 2W62A 3OZPA 3W53A 1J11A 5AC5A 1VEMA 3RM9A 2E9LA 2WHLA 4TXEA 2WC4A 2CIPA 2ZWYA 1K9EA 1UKOA 4W7WA 1H5VA 4LGXA 1M03A 2WZIA 1OM0A 1XH1A 3MANA 4GO8A 5FL0A 5ABGA 3VGDA 2OYMA 2PWDA 1HJWA 4ZENA 2E8YA 1XRVA 3AROA 1MW3A 1J9YA 2E8ZA 4MNMA 1BG9A 1ODUA 4CGTA 3B9AA 3L4UA 2XHYA 4BA0A 2WMFA 2WMGA 4N42A 1B31A 2ESCA 1BQCA 2YIHA 3VIFA 5A6JA 2DSWA 2GFTA 2IXVA 3RM4A 1OB0A 1LWJA 1QNQA 4JAWA 4AZGA 4A3HA 4MADA 2VX5A 3OGVA 4LXFA 2QPSA 3E1F1 4HMDA 4UNIA 4KRUA 1KFWA 3FHQA 4HZ6A 3O9NA 3BSHA 4QLLA 1MQPA 5A2BA 3GH7A 4DWSA 1VF8A 1V3IA 4AIEA 3SCQA 3GNPA 1UKSA 2OWXA 1HL9A 4UFLA 4KWUA 2VRJA 4QAWA 1EDQA 2XSBA 1F4HA 4AISA 2CHOA 4PMRA 3AS0A 4AWEA 1XGZA 1QI3A 4HA4A 2J7EA 2A3EA 4CN6A 3OG2A 4EK7A 3W27A 3ZJ6A 1ITXA 2BNJA 2YDQA 4XZBA 2J7HA 4JFTA 1QOXA 1EDGA 3F5KA 2VZVA 1EHAA 4KRTA 4AZIA 4AZBA 4PMVA 4UQDA 1Y7VA 2XIIA 2Y8VA 2WAGA 2VCCA 4AD0A 1EA9C 2WVTA 3ARSA 2J4GA 4OBRA 2VQUA 3GXDA 4D72A 1OIMA 2ZXBA 4GZIA 3BMVA 1LL7A 4D6IA 4X0NA 1ISWA 4JFWA 1DWJM 2J25A 2CHNA 2XWDA 1JL8A 1CGTA 3MMUA 4HTYA 1C3FA 5I24A 1NWUA 2GDUA 2GDVA 1TR1A 1V3MA 4H8HA 1M53A 4ACZB 3O6AA 5CSUA 2RGLA 2YKKA 3T0DA 3SCTA 2WWDA 3FW6A 4CU8A 3VO0A 2VZUA 1ISXA 3OLDA 3WNOA 1J0HA 1OT1A 3O2LA 1JZ3A 3CPUA 3ZJ8A 4MTVA 4AZ5A 1V02E 2V3DA 1D3CA 3UESA 3W4RA 3WD2A 1E15A 1OGSA 3RILA 5A8MA 3VMNA 1KXTA 3ARUA 5FOOA 4N0RA 2GK1B 2VRQA 1XHGA 1H0GA 1VFUA 4UQEA 4BZYA 2VX7A 1HP4A 1UR2A 5BCAA 1HJUA 4J7RA 4CKQA 1V0LA 4AZ6A 2FHCA 1HT6A 4J3TA 4M56A 1B3YA 1AQHA 3SCUA 2J7DA 5LA0A 1PX8A 2ZX6A 2ZUTA 1Z32X 3WQWA 3TTYA 3OGSA 3CUHA 3ALFA 2VCAA 2DT0A 2WMIB 1SMDA 4W8LA 2ZUUA 1MWOA 4DWSC 4PEEA 4CD7A 2OYLA 3A6OA 5CGMA 1V08A 3EBVA 3BLPX 5EB8A 5JBEA 2WVVA 3K8KA 3SCRA 2V5DA 5A8QA 1QHZA 1B0IA 1UOKA 3SUWA 5DT5A 1W9VA 3WDRA 1V3KA 1C8XA 4PUDA 3W6LA 3LPPA 4GXPA 1I1WA 2FDMA 1UUQA 1EIBA 1E0VA 1KR0A 4WSJA 3F5JA 3A47A 2WLZA 4E8CA 4KGLA 4J27A 1BGAA 2J74A 1BTCA 4U2YA 4D6EA 4CCEA 4M29A 1HKKA 4HZ7A 1CLVA 1WB0A 2A3BA 3PBGA 3S6TA 2WHJA 4GI8A 4DWSD 1RP8A 2OSYA 4ACYA 4W7UA 2GJRA 1WCGA 4PSPA 1R8LA 3ZJKA 1DEDA 1PX3A 4B3LA 1XD1A 2D0FA 3RJYA 1E71M 4YN5A 2G3NA 2WPGA 3VM7A 3CMGA 4E4PA 4GI6A 4AEFA 4L4OA 3HU7A 3WH6A 1CXIA 1M7XA 4EKJA 2W91A 3AS2A 1TA3A 2O9RA 4OJYA 5DF0A 1JF5A 2O9TA 3CTTA 1EHNA 4WSKA 1MXDA 3LPFA 4W93A 1E5NA 1GOWA 1YQ2A 4D6GA 2YBUA 1WO2A 1VJZA 3KE0A 2PBGA 5A94A 1PBGA 1W9BM 3S2CA 2GJXA 2WANA 3SURA 5IHSA 3SCNA 3BLKA 2D0HA 3VX1A 4GKLA 3QR3A 1HJVA 4U3AA 3W28A 4UCFA 4AZCA 3VDBA 4H41A 3B9DA 4W88A 5D8WA 1WZMA 1EQCA 2XUCA 1PAMA 3WNLA 1U33A 4D71A 5GQBA 1UR8A 1BG4A 3RPMA 1E40A 1VAHA 4HA3A 1KCLA 1E3ZA 2EJ1A 2OSWA 1F4AA 4WLCA 1FFRA 3DYMA 3WNKA 1JIBA 1UA3A 4TX6A 3IJ9A 1CECA 4UOQA 2BY1A 1HJQA 2EEXA 4ATWA 2YA1A 1JZ2A 3AYSA 4AIOA 1D7FA 5CJ5A 5JUVA 5AYBA 1XSJA 1VJSA 1XCXA 3UG5A 3VGFA 3EYPA 2WMJA 3K46A 4ATDA 5EBAA 3WNNA 3UERA 2A3CA 4AEEA 1US2A 3RO8A 3T09A 3W29A 1WDPA 5M3WA 4EANA 4GO9A 1KXQA 1P6WA 2VZTA 3CLWA 2XWEA 3BSGA 4BS0A 2E3ZA 3VU2A 1WKYA 8CGTA 3FAXA 1CZ1A 4FLOA 2PWEA 4QLKA 1UWQA 2DSUA 4LYQA 5C71A 1OWQA 1HVXA 5DEZA 3N04A 4ZXLA 2UY3A 1CXHA 4MNLA 2EO7A 4QCEA 1JGIA 1AVAA 1ISVA 2E4TA 5JBDA 2BVYA 1H09A 3BC9A 5KEZA 2BFGA 1E55A 2XFRA 2CBJA 1JDDA 4P7LA 4GZEA 3QHMA 3POHA 4M24A 5D9NA 2DH2A 1TE1A 2VNCA 1FHLA 1EGZA 1QBBA 3M7SA 5E0FA 5BYWA 1M01A 1Q6DA 3VD5A 2NT0A 1ESWA 1JF6A 1JNEA 4IUGA 3T2PA 3ZT6A 3SCWA 1ZBVA 3QOMA 7A3HA 1SR0A 3WQVA 3VIPA 3CZKA 4MDPA 3OLGA 3OGRA 4PUEA 3N9KA 2BY2A 1CPUA 4DM2A 5A6SA 1JZ8A 4XZWA 1EDTA 3SCPA 4QP0A 3SIMA 1UZ4A 1ECEA 2D20A 7CGTA 2J8GA 3LPGA 4X9YA 2Y24A 4D6DA 2VO5A 4HU0A 1KBKA 3SUVA 1GQLA 2OSXA 4U31A 1JXKA 1FHDA 3W37A 4BQ3A 2ZOXA 3FN9A 3KZSA 1BFNA 2D2OA 3SUUA 3VOCA 4W89A 4B3KA 5A6LA 4DUWA 4AD4A 1WDRA 1J18A 1WP6A 4P7QA 4CD5A 1E1EA 2ZXAA 4ACZA 2OWWA 3W82A 1FFQA 1Q6GA 3UG4A 2FGLA 4ZE5A 3K4AA 4NSBA 1XD0A 2V38A 2QPUA 2V5CA 3MS8A 2Y2WA 3CBWA 4H2CA 1UA7A 2XSAA 1BVNP 3ECQA 1KXVA 3AQUA 3G6LA 2JEQA 2VVSA 2WWCA 5I6SA 2X2YA 4DM1A 2J7CA 3K1DA 5IFTA 5BXRA 2WNWA 3I3BA 3BXWA 1XH0A 2XVKA 1JFXA 4Z2LA 5ABHA 2J79A 1E72M 1NP0A 3AFBA 3IK2A 1UR4A 3L2LA 2EQDA 5I23A 4E2OA 3N17A 1A3HA 1W3HA 3NYDA 1XC6A 2CXGA 3MUAA 5JIPA 2WKGA 3VGBA 3RIKA 3VDAA 1WZAA 2ZX9A 1IT0A 1DHKA 1JI2A 1C93A 2EXOA 3G6MA 2XVNA 4PMNA 1GVYA 3WD0A 3BAIA 4D1IA 2GJPA 2WMIA 3VIKA 1HXJA 1MXGA 4Z2HA 2ZICA 4MB4A 1H0IA 1E3XA 2YL5A 5LYRA 3THCA 1K9DA 1HL8A 2WMKA 3MUY1 5ABFB 4JFUA 4XB3A 2BXZA 5FL1A 3WFZA 1EO7A 2FHFA 1GOQA 2D0GA 2XFFA 3UETA 1PIFA 2WCGA 1UQZA 1W3LA 1WPCA 1SMAA 1AMYA 2DT3A 5ECUA 2FH8A 1I1XA 4AD2A 5CGTA 3WF1A 2NW0A 4OBSA 3II1A 1BPLB 1CLXA 1JYWA 7TAAA 2D3NA 1QI2A 1ITCA 1VEOA 1XV8A 1R87A 2DEPA 2CESA 3WFLA 3D3AA 2YL6A 1MFUA 3LPOA 1QNRA 4MAVA 5D9MA 1JZ5A 3GXFA 1VFFA 5C8BB 3IJ7A 4WF7A 1QNSA 3L4XA 2G3IA 1JD7A 2UY2A 4J28A 3WL0A 1CGYA 3MMDA 2WHMA 1W9XA 5CLWA 4EAMA 1JG9A 3VD9A 3WQ6A 4M81A 1LQ0A 1W1YA 2X0YA 3FY1A 3KEHA 3U7VA 3VDHA 2EPKX 3VNYA 4P8XA 1VBRA 1CXKA 4M82A 1G94A 2CKSA 1LF1A 5BXSA 3MSDA 1R85A 1E6PA 4DUVA 1GZJA 1C92A 4U33A 3N1AA 3VGHA 1UWIA 5CLTA 4GPNA 5I3DA 5M17A 1U30A 2C0HA 5HPOA 2DIEA 4HPGA 3NDZA 4HMCA 3CHEA 5GNXA 1AQMA 2WVVB 4EE9A 3PTMA 1DWAM 1GONA 3WH7A 4B9YA 3RM8A 2UWFA 3MKKA 3AIBA 1WZLA 5HXMA 1NOWA 2VUYA 2J7GA 3MV11 3AIRA 1W1VA 2J78A 2QMKA 1B3VA 1CDGA 3DYPA 3OZOA 1FH9A 3NJ3A 1Q6CA 1UR0A 3WEMA 4CVWA 3WDJA 4J3XA 3WELA 1VENA 4HOZA 4W85A 1R7AA 2Y5EA 3VD4A 4PMUA 3VNZA 1UWSA 3AMKA 3OLEA 4GZJA 4ML4A 2YA2A 3VILA 3VIHA 3VM5A 3AI0A 1NQ6A 4PMZA 3T2QA 4JHZA 3WIJA 2VTFA 1V6UA 3FAWA 3WQ5A 4AMCA 5LA2A 3EMZA 1GORA 2DIJA 3M46A 4UZUA 3NSMA 1QBAA 1Q6FA 2Y4SA 1HF6A 1E43A 4OZOA 4URIA 1V0NA 4Y7EA 1WZKA 1QNPA 5AY7A 1JFHA 3BAKA 2V3FA 3AHYA 1E0WA 4S3KA 1W32A 2D1ZA 1GVIA 2CYGA 4PTXA 3EMQA 3EMCA 4TVCA 3CZLA 1NWRA 2DH3A 5CPTA 1E6ZA 4W5UA 1BYCA 4MPKA 1JAKA 1NP2A 3TTOA 1J01A 2W5FA 1HVQA 4UQ9A 5IFPA 3W38A 4CUCA 3AMGA 5CSYA 1GOIA 2VT0A 3L4YA 3ZJ7A 4IPLA 3AHZA 1ISYA 3GBDA 4CCDA 2VJXA 1E56A 5EMYA 3CIVA 5E09A 2HISA 2PWHA 4BCEA 1U2YA 1C8YA 3OB8A 2BY3A 2EBNA 1VBUA 4UOJA 2JF6A 3N13A 3WH9A 5E6YA 3ZO9A 2YOCA 4DUXA 2ZXQA 2VCBA 3AICA 1V6XA 2QLYA 1VFOA 1GQIA 4HA1A 4YPJA 2B31A 2GSJA 1LJYA 4PTVA 1GJUA 4W8AA 3UR8A 1PJ9A 4BQ5A 1FP8A 4V2XA 3K8LA 2X0HA 4Z2KA 3QOKA 3OIHA 4UFMA 3WMCA 2CBVA 1B1YA 4JKMA 3T08A 5A2CA 3W26A 5JBFA 5DO8A 2QHAA 1ZU8A 1C90A 2C8NA 4AC1X 2WVUA 2XVPA 5CQ1A 3WDPP 1OD8A 1TUXA 3VD7A 1FH7A 5IXEA 2QV4A 4WKAA 4YHEA 3B8SA 4ZXOA 3CZGA 2XPKA 2VURA 4H04A 1UD4A 2F2HA 3CGTA 1UD8A 3ARXA 5A6BD 4AW7A 1BGGA 3TTSA 3MO4A 1VIWA 1RD6A 2F61A 2TAAA 1M04A 1CGUA 4BF7A 4PCSA 2VR4A 2CETA 1TFVA 1EOKA 1J0YA 1CXFA 3ARQA 1K6AA 3SEPA 3T2OA 5DT7A 3GTNA 3AIUA 3AZRA 2AMGA 1J12A 3AIVA 2JF7A 3VMPA 1V6WA 1JDAA 1E4IA 3PZIA 2JIEA 2VMFA 3FHAA 3WQ4A 2W61A 8A3HA 5D4YA 4MNJA 1UD3A 1W2PA 5CXPA 1QW9A 1HX0A 3AJ7A 3IAQA 3WF3A 2BY0A 2WBKA 1G0CA 4FLRA 5I5RA 5D9PA 2DDXA 3VVGA 2G8ZA 1W9DM 1OIFA 2ZUNA 3QHOA 1KQYA 2ZUSA 2VVNA 1MFVA 5F7UA 9CGTA 1G1YA 2PBOA 2WW5A 1QHOA 2VOTA 5E70A 4CN1A 1DTUA 3GYCA 1NH6A 2YDRA 1ZBWA 3U7BA 3WN6A 5A95A 3CMJA 3WH5A 2UY4A 2ZX8A 4UQBA 3WBAA 4AD1A 1KWKA 2J7FA 4C7DA 4GIAA 3L4TA 2XGIA 3ZIZA 1MYRA 4H8UA 3HMCA 4WK9A 3ZSSA 2AAAA 1HKIA 1E6SM 3OBAA 5IHRA 4A3YA 5DMYA 3AIQA 5BXTA 4DWSB 1RPKA 3AHVA 4PMDA 4FF5A 3TTQA 3TP4A 2OLHA 4RE4A 3VIJA 2NSXA 1FH8A 1QVBA 4MB1A 2YLAA 2ZUVA 4OUEA 3PZUA 4JCLA 2J75A 1O7AA 1W9UA 4UFHA 4LX4A 1H4PA 1E9LA 1V03A 4U5IA 4U3CA 5A8OA 1UKQA 1MQQA 3L2MA 4PN2A 4D6HA 2G3MA 2EPMX 1JD9A 3SCVA 3D5HA 1J0ZA 4B9ZA 3WENA 1CXEA 2G4FA 1HN1A 4WKFA 1GOMA 3THDA 3L4WA 5CZKA 1NARA 2DPEA 4H8VA 3WF2A 2WBGA 1AQ0A 5DFAA 4ZE4A 2VR5A 2D23A 5BXPA 4M8UA 3ARVA 4W86A 1TVPA 3K8MA 5BROA 3N15A 2CEQA 4NF7A 4P8VA 3WUGA 1ZS2A 1X1NA 2AOSA 3WKZA 5BWFA 2A3AA 4UQCA 4F66A 3VKKA 1SFSA 3ARRA 4OOUA 3J7HA 4U5KA 4NRSA 2DSKA 3CH9A 4KH2A 1C7TA 2QF8A 3W6MA 3VGGA 2DSZA 1H2JA 1OT2A 1PZ3A 3WY1A 1HKJA 2YL9A 1W2VA 5GNYA 1XYFA 3WNPA 1W1TA 4Z2JA 4ZEPA 1L8NA 1MVYA 4IISA 4UFIA 4W84A 3DYOA 4QCFA 5GNZA 3PTQA 1LLOA 4TTUA 3F5LA 3RJXA 3M07A 1RP9A 2XM2A 2VI0A 3T0BA 1FOBA 2BV9A 2J7BA 1VB9A 3PHAA 3WUBA 1E6XM 4D6FA 1KXHA 1G5AA 1PPIA 1GQKA 4CN4A 3W24A 4MJ2A 1C7SA 4WIWA 1E4MM 2PC8A 4GINA 4LYPA 1CBGA 4UFKA 3F4VA 5A6BA 1E0XA 1HP5A 4MNKA 1TCMA 3NIYA 4MB3A 2MANA 4AIUA 2FH6A 3WEZA 1JXJA 2YBTA 1KBBA 1BVZA 1Q4NX 4E8DA 1KCKA 1UWRA 2BVTA 5A6MA 3APGA 1UR1A 1UD2A 1MQRA 1PIGA 1J0IA 3NSNA 4W87A 1KGUA 1X6NA 1J10A 3ARWA 3BAWA 1W9PA 5M03A 1E1FA 3AXIA 4QLJA 4FMVA 1B30A 3KL5A 2QMJA 4XX6A 4AY1A 2WSPA 2ZUWA 2D24A 1NM9A 4R5EA 4MJ4A 2JIWA 1V02A 5M5DA 5HNNA 3HJEA 2J62A 3PZQA 2VZSA 1UYQA 3ZR5A 1IV8A 3AXHA 1FP9A 3WUEA 1CNVA 3EDKA 5HPCA 1ZL1A 1JDCA 2BXYA 5E0CA 1CENA 2BS9A 2ZXDA 1J0JA 1X6LA 1WNOA 3UEQA 4D1JA 2WCSA 3EDFA 2WZEA 2E40A 1ZBCA 3DHUA 2W67A 5C70A 3WF4A 1VFMA 1MW2A 4FLQA 2CITA 2DT1A 1DWFM 1JZ6A 2EPNA 1V6VA 3ARYA 3WDIA 1VRXA 3CHCA 3VTRA 4JL1A 1UKTA 4PMXA 1QW8A 4K68A 3ARTA 3UG3A 4CCCA 2XVGA 5AYIA 2F8QA 3MSGA 5EFFA 3AIWA 2XJ7A 4P7OA 3CUJA 1RH9A 2JALA 3ZM8A 3WUFA 4UOZA 2VZOA 3W0KA 1HIZA 1DWGM 4RL3A 4KMQA 3W25A 3ARPA 2PI6A 2Z1SA 3GNRA 3CZEA 3TONA 5A3HA 2CCRA 2XVLA 1EOMA 3VD3A 1R86A 4TTGA 2ZX7A 2X8RA 5D8ZA 2GJXB 3TOPA 4PMYA 1ODZA 1EXPA 1CGXA 2XM1A 4HP5A 1V3HA 4B15A 5TD4A 1GHSA 4HPHA 1K9FA 3AS3A 3U57A 5EFDA 3PZVA 1TA3B 3AISA 3B9EA 4HZ8A 4AZCB 1GQJA 1V3JA 2JEPA 3FNDA 2XIBA 2J8FA 2WYSA 5I77A 2WK2A 2GUYA 1WDQA 3PTKA 4PYSA 3GNOA 2DT2A 4XV0A 1OD0A 2XG9A 1MW0A 2WZHA 3WMBA 3GM8A 2W66A 3L4ZA 4BQ4A 3RDKA 4D6JA 1GHRA 3NCOA 2JFEX 4MB5A 1ZB5A 1MW1A 4F9JA 3WSUA 4IM4A 1XSKA 3GXMA 5A2AA 4LQ1A 3VIOA 3WH8A 1E6QM 1HNYA 4RE3A 4F79A 1BHGA 2Z1KA 3PZOA 4J3WA 2RGMA 1TMQA 1JZ4A 2YJQA 3AYRA 3N11A 4CD6A 4AD5A 1EH9A 3AZTA 3WD3A 3IAPA 1NWTA 2A3HA 2HVMA 2O92A 4CU6A 4J3VA 3EDEA 2XYLA 3HN3A 6CGTA 1E6RA 2WMHA 3VX0A 4BQ2A 2DQXA 5FIPA 1C8QA 1DP0A 2BVDA 1QI4A 1UG6A 1UH4A 2VX4A 5A1AA 4S3JA 4AZHA 4J3SA 2IUZA 1CXLA 4W5ZA 3AMCA 3AS1A 1PX4A 2OWCA 4GI9A 4CVUA 1L0PA 1WE5A 1ZJBA 4TVDA 2EPLX 3NDYA 1QHPA 1C91A 1CEOA 1HJXA 3N18A 3NSXA 2G3JA 2WSKA 2ZIDA 2ZWZA 3MUIA 3OLIA 4P8WA 3TA9A 2JE8A 3VMOA 1IZJA 1GOOA 3WL1A 2WM0A 4JKKA 3AMDA 1QPKA 2WC7A 1TVNA 4WJXA 3ZQ9A 2PWGA 4L4PA 3EDDA 3L4VA 2BHZA 1NOFA 1H41A 2GVYA 3WEOA 4R27A 4HMEA 5ABFA 1UH2A 1H1NA 3POCA 3ZSTA 1UZ1A 4H7VA 3BAYA 3ZT7A 1UR9A 3WMSA 4Z2GA 3VDCA 1E6NA 1IZKA 5GPRA 5ABEA 2ZUMA 3K4DA 3MUZ1 4CD4A 2GK1A 2CKRA 4F8XA 3FXYA 4GQRA 3SUSA 1UD6A 4J3UA 4UQAA 1J0KA 1US3A 1OCQA 5I79A 3U5UA 3ARZA 2ZE0A 3CUFA 3I3EA 4M80A 1E70M 3GDBA 3WD4A 1B3ZA 3PZGA 1B90A 3PZMA 4MDOA 2FGZA 1EO5A 1GOKA 1A47A 2WCAA 4NRRA 4C7FA 1GPFA 2V3GA 1W1PA 3VIIA 1UWTA 4AYSA 2G41A 1R7OA 4UR9A 2X1IA 4OOZA 1XCWA 4PBGA 1JNDA 3UCQA 2WHKA 4U2ZA 2PF0A 3WF0A 3U5YA 1ZBKA 1GJWA 1QI0A 4ATLA 4AXNA 3ZMRA 4B16A 3GZAA 4UTFA 2WXDM 1TG7A 2YLLA 4AZ7A 1W3KA 1UH3A 1GUVA 1CTNA 2VX6A 3BCDA 4HU8A 3EDJA 1E4LA 3BAJA 3MU7A 5CPSA 4MAZA 3WDHA 1I75A 3QHNA 3ZT5A 3T0AA 4LYRA 3GH5A 3AHXA 2WKLA 1B2YA 3W81A 1SYTA 3AIEA 1XH2A 2OYKA 3AMLA 1B3WA 1LL4A 3QGVA 1WDSA 2X09A 1S46A 3A4XA 1YHTA 2J47A 5HOSA 5KZ6A 1BF2A 1WAWA 3WDQA 1CWYA 4PTWA 3SCOA 5CPQA 2NT1A 4JL2A 4JCMA 3LMYA 4NZCA 4JFSA 3PZ9A 1DWHM 2J77A 1KB3A 1JAEA 3JUGA 2XTKA 1QI5A 4FLSA 1BAGA 2VRKA 3AHTA 4W7VA 5BRQA 4PCTA 1N82A 3CHFA 1JYVA 5FD0A 4JHOA 4HOWA 4FK9A 3IJ8A 2PWFA 1GW1A 2CPUA 4UFJA 3PZNA 1G01A 3A3HA 5HDRA 5I2UA 4V28A 5A69A 1CYGA 4Q22A 3VGEA 3WBEA 2O9PA 3BGAA 3UR7A 2X05A 4HOXA 2CERA 4PMOA 1ISZA 2W4XA 2CBIA 1W3JA 5A6AA 2FHBA 2W63A 3AZSA 1H49A 2YDSA 4CU7A 4PTMA 1LG2A 2E9MA 4AD3A 1OINA 1UHVA 3OA5A 2WC3A 4M1RA 3CZJA 1XYZA 1LWHA 3WD1A 5I78A 4OIFA 4PRWA 5A8NA 3GXIA 4P7RA 4D6CA 5BRPA 3PZTA 1E4NA 1KR1A 1QNOA 1LL6A 1E5JA 3RMEA 3ALGA 4TVUA 3VIGA 3CUIA 1K9TA 3SCSA 3RCNA 3WNMA 3BH4A 4PSRA 1V6YA 1BYDA 1H11A 3A4WA 1UD5A 2EPOA 1GNXA 3MV01 4ZFMA 2C7FA 2E9BA 1CGVA 3BCFA 4F9DA 2VL4A 3DECA 6A3HA 1PEZA 4V27A 1V0KA 2XFYA 3DHPA 3VPLA 4P8UA 2VQTA 1TZ7A 1B9ZA 1GCYA 3I3DA 4JZ5A 3M6DA 1BSIA 1O6IA 1NOUA 2YL8A 1V3LA 2E0PA 2WVSA 3A4AA 2V3EA 4Z2IA 1G9HA 4RE2A 2D22A 2DSVA 1OGBA 1JZ7A 2BHYA 3NUKA 5IDIA 1KGWA 4GQQA 3ZR6A 3KL0A 5JIWA 5I0DA 3IANA 3DC0A 2UY5A 4JKLA 1PZ2A 4YHGA 4A4AA 1OGGA 4NI3A 1VEPA 5LA1A 3CO4A 3VUPA 3AXXA 4QFUA 5E9AA 2WLYA 5HBFA 2VC9A 4P7NA 5FKYA 1JI1A 1EQPA 3CZ8A 1W91A 1ZJAA 4OKDA 4X0VA 1E73M 3BAXA 3MMWA 3GBEA 5A8PA 3SUTA 5CG0A 1KWGA 1DWIM 1FA2A 6TAAA 3CHDA 4Q7NA 4TX8A 4W8BA 3CUGA 2PB1A 1XSIA 4JFVA 3VINA 4XUYA 5D9OA 4IPNB 4JIEA 1UWUA 1BLIA 2W92A 4TOQA 4TUFA 3KL3A 5AC4A 2WB5A 2ZX5A 4UZSA 4CD8A 5A6KA 1HJSA 1LG1A 4LPCA 1CIUA 1V0MA 3BMWA 2O9OA 2DGAA 4KGJA 2D3LA 2YA0A 1D2KA 2XGBA 4QDMA 2IXUA 5E6ZA 1OBAA 1HKMA 4C7GA 5FCZA 2Q8XA 3WQ8A 1NWSA 2BHUA 1CGWA 3ZOAA
chains in the Genus database with same CATH superfamily
3TIMA 1IYXA 5DY2A 3AOFA 1A53A 4FP1A 3GH4A 3PN8A 4BFAA 4PMQA 4B5NA 4WKHA 2QS8A 5H8MA 2Y8KA 1IWPA 2NV1A 4HA0A 1KQZA 2H9AA 3DFQA 2W62A 4Q8VA 4NT0A 4S2BA 5AC5A 2QEZA 1AZ1A 1Y5WA 4WDTA 4QE4A 2ZWYA 2I57A 1FCVA 1XH1A 3FSTA 1O1ZA 4S3AA 4GO8A 5FL0A 3VGDA 2E8YA 4LNCA 1X38A 3KLKA 3NYZA 3MPGA 5J8LA 1DQXA 1RALA 2AMXA 1X8CA 1Q63A 4S3FA 2WMFA 4N42A 1B31A 2ESCA 1TTQA 1S2WA 5A6JA 4QE5A 3BICA 4JAWA 2HBVA 5G1TA 1I9CB 4HMDA 2GUBA 4HGXA 3TYDA 2QCGA 4EP8C 3O9NA 2FZ9A 4PCNA 4YIWA 1W56A 3GH7A 2PWVA 4DWSA 3UA3A 4AIEA 3GNPA 3OU8A 4UFLA 2Q3RA 4N6FA 4KWUA 4QAWA 3M0HA 1VCFA 3LMZA 2HPIA 3VOHA 1HG3A 2CHOA 4LVAA 4AWEA 4R85A 1S2CA 1ZALA 2X1TA 5AB3A 2A3EA 4CN6A 1JJKA 4KIRA 2DVXA 4XZBA 3URAA 2A21A 2J7HA 4JFTA 4Y6GA 4FX6M 1T40A 2AL1A 2E1DA 4AZIA 3I7SA 2ISWA 1O5KA 3S6DA 4PMVA 4ZOBA 3N2MA 4RE0A 3BLIA 2CZEA 1FUYA 2WVTA 4OBRA 3WFAA 2VQUA 3RNDA 4Q4OA 4D8LA 1QFEA 4PCFA 4GZIA 3BMVA 2I9UA 1JUKA 1ZP4A 4JFWA 2J25A 3MTWA 2CHNA 1ITUA 4N02A 4X63A 5F2IA 1ICSA 3PC0A 3MMUA 4HTYA 2Y88A 4HBKA 4ACZB 2YKKA 1ADDA 2AL2A 3VO0A 4DQWA 1UCWA 3NAVA 1S5MA 3OLDA 3WNOA 2XH2A 4DZ5A 3HPXA 3O2LA 1PTDA 2GUUA 5TAOA 4NZ1A 3N9SA 4RV3A 2BP1A 4Y9MA 1E0UA 1JCMP 3VMNA 2DW6A 4N0RA 3D3FA 4QQUA 1VFUA 4BZYA 1YX1A 4DI8A 1V93A 3R43A 3GXPA 5D04C 1HP4A 1X97A 3PG9A 3HQ1A 1HJUA 3QC0A 4J7RA 4XVDA 5XIAA 1V0LA 4AZ6A 4J3TA 3IV8A 3RN6A 3BG3A 4CEUC 1TJ0A 4FNQA 1HL2A 3TXZA 1J8VA 3TJ4A 3LYEA 1MDRA 4GC4A 1EZ2A 1SZEA 3TQPA 2Y8UA 2O55A 3VNKA 3PULA 3M6YA 3TJLA 2ZUUA 1M7JA 4DWSC 2OYLA 3A6OA 4I5RA 1LTDA 3PPFA 2VDHA 4TU1A 1WXJA 2NUYA 1Q6LA 4L6HA 1W9VA 3WDRA 1C8XA 3W3OA 2QCCA 3VOIA 1W37A 3CAVA 4TV6A 4NAFA 3HA1A 1UUQA 1PSCA 1Q85A 3T1GA 2X7VA 3F5JA 4KGLA 4HSOA 1BGAA 5I3HA 2Q01A 4U2YA 4CCEA 4HZ7A 1CLVA 4MJZA 4F2BA 3NO5A 3EWWA 2Z00A 4GI8A 4RNHA 1XFBA 5C55A 2OSYA 3E5PA 3IGSA 2BGSA 5L9FA 3OVPA 5IDZA 3H2CA 3GTHA 4PSPA 3ZLGA 2NX9A 3DXIA 1G4TA 1PX3A 2PRLA 4JTRA 3CMGA 3DGBA 1MNZA 3NL2A 4WUIA 3WH6A 3QMRA 3PR2A 2Z6JA 1A5BA 3KS5A 1XW8A 1YXDA 3LPFA 4D6GA 2YBUA 4O1DA 2QDDA 1N8FA 4RDYA 5A94A 1NDZA 3S2CA 1TJPA 2ZYFA 3LDVA 4M6UA 3BLKA 4IIDA 3VX1A 2QIIA 3R79A 2Y6ZA 2RUSA 4YU1A 3I6RA 4DZAA 4F0SA 4BEUA 1R9YA 3GDKA 4WDWA 2NVCA 5IOBA 1A5LC 5GQBA 1ONRA 3RPMA 1VAHA 1AW5A 2EJ1A 5M1TA 4CNTA 1F4AA 4WLCA 4XZIA 4JIHA 1FFRA 3WNKA 1JIBA 4HNUA 3KBVA 3PFMA 1HJQA 3QY7A 4ATWA 1RLDA 2YA1A 3A9BA 5CJ5A 4RUBA 1P6BA 1XSJA 1VJSA 5EMJA 2DZUA 3VGFA 2WMJA 3K46A 1FWIC 1S5VA 3SM0A 4L4MA 4AEEA 1US2A 3W29A 1WDPA 2RKXA 1TJ1A 1GQNA 1P6WA 3KP0A 4DXKA 3A3XA 3QV7A 3VU2A 3QGAC 2JK2A 2TYSA 1CZ1A 1KV8A 2PWEA 1L2QA 4LUTB 1OWQA 2B7NA 3N04A 3CHVA 5F2GA 2PZNA 1CXHA 4MNLA 4A05A 1LWIA 3LHWA 5FJJA 1AJZA 2EO7A 3LK6A 4JTFA 1AVAA 1OFOA 3G3DA 4JEQA 3IIPA 1MMFA 2X42A 1SSGA 1VP5A 4GZEA 1P0EA 2FTWA 2QDEA 3E5BA 5D9NA 4JY9A 3WBXA 4LEQA 2VNCA 2NX3A 1VS1A 1WOAA 5E0FA 1VD6A 1U5VA 3CJPA 4UNLA 1JCTA 4ROPA 3DG3A 1K8XA 4UCGA 4IQLA 1A4MA 4WJEA 1ZBVA 1SR0A 3LLDA 4H9TA 3UJSA 3V1HA 3OLGA 5F1UA 4IICA 3UR2A 2NQZA 1JZ8A 4QP0A 2D20A 3TV8A 5LGXA 2ZTKA 4X3ZA 3HG2A 2PP1A 3LPGA 1YADA 4X9YA 4HU0A 1KBKA 2J9XA 3YPIA 1GQLA 4U31A 2ZRUA 3F7JA 3NQ8A 3RU8X 3KZSA 3LN3A 1VLIA 1K70A 3KXQA 4NXKA 1OFQA 4IGMA 1WDRA 1J18A 1WP6A 5AN7A 5AYXA 4GFIA 4H1ZA 4L61A 3M41A 2OWWA 1WX0A 4R53A 4ACZA 4C1LA 2QW5A 4ZL1A 3WLOA 1P4CA 1P7TA 2V5CA 2Y2WA 1W31A 4MZ8A 5D2TA 4H2CA 2P8BA 3ID7A 5I6SA 4DM1A 1AQFA 4F0RA 3NXLA 5I3FA 3XIMA 3K1DA 1SR9A 3B8IA 4QJ5B 1J93A 1TWDA 5BXRA 2WNWA 3I3BA 1FWWA 3LEPA 4Z2LA 4YCPA 3GVQA 5F2LA 2OELA 4ZQPA 4CQDA 3REQB 2A6NA 1F6YA 4EPDC 1UR4A 2EQDA 4MMWA 2H3DA 3HGSA 1F2JA 3GFYA 1JPHA 3OA3A 4ASTA 1W3HA 2PSNA 3NPXA 4K8EA 1U1HA 2CXGA 3NYDA 4ZO8A 5JIPA 2WKGA 3PNUA 4UMCA 1TIWA 1TCDA 1JI2A 3O06A 5D05A 1SUXA 1AH0A 1UR3M 3QY8A 3WO8A 4NU7A 2RH9A 4U28A 2ISVA 3WD0A 1YBQA 3CH0A 4I6VA 2PDHA 5A6TC 3QLDA 5DXYA 3STGA 4MB4A 5FACA 6TIMA 4FNRA 5LYRA 4GOAA 2DW7A 4WXYA 1YDOA 3V18A 4Y96A 4JIIX 1GOQA 3UWWA 2XFFA 3DAQA 4DIAA 2VFIA 1UJQA 2AGKA 5DMLA 1UQZA 1SMAA 5HAOA 2DT3A 4WOZA 1EYEA 3P14A 3WF1A 1R3YA 4MUZA 1QMLA 3G0SA 3CWNA 4PUMA 2E6YA 4Z1DA 1VEOA 2Q6ZA 2DEPA 4IFKA 5HA7A 4HPJA 4IIGA 4AFYA 2YGYA 4NAFB 3EX2A 1OYBA 3UGRA 3FEQA 1QNSA 1XLLA 3CNYA 2B81A 4J28A 1NSJA 3KOFA 3TKFA 3W2LA 3WQ6A 1LQ0A 3O0KA 3KEHA 1MNSA 2Z4GA 3N29A 3VFLA 5EYWA 4GG9A 3GIYA 4M82A 5BXSA 1T8XA 3MVIA 3MSDA 2IQTA 3C3NA 1GZJA 3GKFA 3ABOA 2OTDA 1OFDA 5M17A 1U30A 2C0HA 3W1LA 5HPOA 4HPGA 3L68A 3QN3A 1DWAM 5AOUA 1GONA 4HHPA 3JVAA 1WZLA 5K3VA 4WRHA 5HXMA 3ICJA 3MV11 1B3VA 1E51A 1FH9A 3NJ3A 1W3TA 5ABTA 4CVWA 4J3XA 4R7OA 4L9YA 1VENA 3E0IA 4B5UA 4MWAD 3WQEA 2R8WA 4QNWA 2ZRYA 1XIMA 3VILA 2RJGA 4PMZA 3IEBA 4JHZA 3WIJA 2VTFA 3H23A 3NQ6A 4G8TA 3SZ8A 1GORA 4FB7A 5AHFA 3AWOA 2H90A 3M46A 1TUFA 4BI5A 3NQ2A 2Y4SA 1OX4B 1YIXA 4Y7EA 1M9HA 3DHFA 4NNAA 2GJNA 2AAMA 3M0ZA 3KCOA 4GXWA 1NDVA 1YE4A 1XS2A 1P43A 4WY0A 1GVIA 5HANA 4DVOA 4PTXA 4GQGA 3E0FA 3UWVA 3S47A 4TVCA 3I68A 2VC7A 3BZGA 4W5UA 1BYCA 1GG1A 4KERA 1XYBA 4UQ9A 5IFPA 3W38A 4CUCA 4E5TA 2FKPA 1GOIA 2VT0A 4IPLA 3AHZA 3DFSA 3GAYA 5EMYA 1O66A 2HISA 2PWHA 5K7JA 3OB8A 3DIPA 3W7HA 1OZQA 2BLEA 4C6QA 2ZADA 5B7YA 4XD4A 4B5SA 1V6XA 4QJ4B 5FJTA 1H1YA 2VWSA 4YPJA 2B31A 2C1GA 1GJUA 3CEUA 1TELA 5KSWA 4R9XA 3QOKA 3N19B 3OIHA 4UFMA 2CBVA 4GISA 1QPNA 3MWAA 5A2CA 3W26A 4OHQA 3G1XA 1A49A 4Z42C 5JBFA 2QHAA 2HRWA 3GS6A 3WDPP 3E96A 2V2DA 1ZAHA 2VELA 3VD7A 2QXWA 4B4FA 5IXEA 2QV4A 4WKAA 1VFLA 3B8SA 1EC7A 3CL6A 4IJCA 2C13A 3CGTA 1UD8A 4NL1A 4GI4A 2V0TA 3PUGA 3R11A 3MO4A 4JNYA 1XRFA 3NQGA 4PCSA 1SW7A 1TFVA 1Q6QA 1FX6A 3EAUA 3SEPA 3HPFA 3W22A 1XBYA 3VMPA 2JF7A 1V6WA 1POKA 4F0KA 3KRZA 2OCZA 3DFNA 1DE6A 2WNZA 4MNJA 4GE8A 5CXPA 3M47A 1RLCL 5FF3A 2WBKA 5I5RA 2DDXA 3A12A 1ZJIA 4PULA 2VVNA 4GVGA 4ZSUA 1MFVA 1G1YA 2GOUA 3MDWA 4XAYA 1PYFA 4WHBA 3S46A 1DTUA 3KUMA 3SFKA 4DBEA 3JR2A 3CTLA 2YDRA 3FKKA 4LAMA 3CMJA 1VYRA 5HJYA 2AGTA 1KWKA 3L4TA 2E6FA 2XGIA 3BOXA 5K4ZA 1RCQA 3ZIZA 3AU2A 3H2EA 4YVPA 2VFFA 3MP4A 3UNTA 3C2YA 3E2VA 3QH2A 5DMYA 4MYXA 5DCEA 1Q8AA 4LVDA 4FOKA 1XIJA 4N9CA 4DWDA 3L65A 3BK0A 1KFCA 3TP4A 1NELA 4ZOCA 4JIQA 1VR6A 3CQKA 3KOWA 1QVBA 2FLIA 3KCLA 4JCLA 4MIMA 1O7AA 3W7RA 3QEZA 3VK5A 3DH7A 3MVTA 3CWHA 2YSWA 1W8GA 3LCHA 4OUIA 4DUOA 3BDKA 2C1IA 1R46A 1HN1A 3ABZA 4LH8A 1K7FA 3RF9A 4GIYA 3L4WA 1WOBA 5CZKA 4UMBA 4JTSA 3OHMB 3NVTA 2GVLA 5FJIA 1ZFJA 2D23A 5FJUA 1R9XA 2L5HA 4WXZA 1RVKA 3LI1A 5AC7A 3K8MA 1RUSA 3GDLA 4NF7A 1FWEC 4GX8A 1UIPA 1GVEA 2NVDA 3WKZA 1RA0A 4L1XA 1O4UA 4IOTA 3TTEA 3PJXA 3NOYA 3J7HA 3TMQA 1ZAIA 4JIPA 2E25A 1GWJA 5REQA 5GNYA 4GNJA 5HMSA 1L8NA 3L12A 1MVYA 2BZNA 5KITA 1HKVA 4HIBA 2HDJA 1LUCB 3EA1A 3T0BA 1RCXB 1FOBA 2D69A 1VB9A 3TX9A 4H9MA 4LCRA 3RR4A 1PPIA 2AL2B 1EJUC 2OKTA 1E4MM 1CBGA 4UFKA 1DE5A 3LV6A 4I7UA 3Q2DA 3E74A 5MHBA 4GIRA 1R3RA 2YBTA 1OFRA 4JTIA 1KBBA 4KW2A 1BVZA 1XUZA 1UWRA 1P0BA 3IIZA 4AWUA 4LALA 3C2EA 4FXSA 5CGQA 3KLLA 1E1FA 3LS9A 4ES4A 4H6QA 4FMVA 2DIKA 4AY1A 3NQAA 4O17A 2ZUWA 5FJPA 4MJ4A 4V33A 5HNNA 3PZQA 3JW7A 2VZSA 4L7ZA 2XIMA 1IV8A 3AXHA 1FP9A 4PCPA 1Z48A 5C9WA 4HNNA 1CENA 2ZXDA 4HSHA 2G4JA 3IGHX 1X6LA 1WNOA 1V77A 2WCSA 3EDFA 1SM9A 1ZBCA 3QMSA 1MW2A 1V51A 4QNEA 4Q4RA 4AC7C 1RK5A 3KTSA 1S39A 3C0SA 4ICCX 3CHCA 3VTRA 1UKTA 2Y7DA 4K68A 5K2ZA 3GUGA 1JDFA 2H8XA 4L4LA 3PWIA 3NOEA 4A3UA 4J4KA 3DN5A 2PGFA 4NZFA 4H7ZA 1BXBA 5EFFA 2XJ7A 3W7MA 1SZRA 4P7OA 4AB4A 1QXLA 2GGIA 3V5CA 3R7MA 1JR1A 1HIZA 3NEVA 4F2TA 5A3HA 4PL1A 2P1FA 4X2RA 2VXNA 1VQTA 4EVZA 3I6TA 2TPSA 3DBPA 3BE7A 5D8ZA 5XINA 4KWSA 1ODZA 4ZO9A 5C6MA 2HVOA 4MJMA 1V3HA 4UXDA 1AG1O 3S5NA 2XN1A 1PS9A 4D8ZA 3GC5A 1UASA 4MGGA 1ZTVA 1GQJA 1V3JA 3W71A 3NQEA 3FNDA 4JN8A 2J8FA 4M6VA 3R10A 4FALA 3OODA 4LRSA 3RAOA 2GJLA 3W9ZA 3SFWA 3ISIX 1KM4A 1VPYA 3HG5A 4XV0A 1OD0A 1DJHA 4Q7IA 3HQOA 4H8NA 3MBDA 4M0XA 3RDKA 1GHRA 1M68A 3NCOA 2JFEX 4MB5A 4S3EA 3O63A 3CYVA 1MW1A 1H62A 4PUJA 4L6DA 4ALDA 3UZ5A 3AJXA 3GU2A 3BVJA 1XX1A 3VIOA 1FWBC 2PD5A 1XIGA 3V75A 1XIEA 4RE3A 3V16A 3BURA 2YJQA 2XIOA 4EXQA 1M65A 3NURA 5LGZA 3T4CA 4L1GA 3AZTA 2OEMA 3IAPA 4KS0A 2BG5A 1RQEA 4RK8A 1XQLA 2XYLA 3QZAA 6CGTA 4XWUA 1GKPA 1XR2A 2WMHA 3VX0A 3N6QA 1DP0A 2BVDA 1UG6A 2VX4A 5I3KA 4H2HA 4J3SA 4A2RA 4NYYA 1LZOA 4NZ3A 3MWCA 1LRNA 4JPGA 1PX4A 3EWBX 2J27A 4GI9A 1TQJA 3GK0A 4Z0SA 1E1CB 4TVDA 3TE9A 2EPLX 1QHPA 2XZ7A 1M3UA 2Y70A 4UB9A 1KRBC 4GHRA 2ZWZA 2E1WA 5TIMA 3VMOA 4XVEA 1KKRA 4X9SA 4K2SA 2P10A 1GOOA 3N4AA 4JKKA 1QPKA 1A5OC 3LSBA 3VOFA 3L4VA 3EDDA 1JRCA 1LBFA 4L5ZA 3WEOA 3GO2A 3H2NA 3ZSTA 4CQAA 1PDYA 4H7VA 4MZYA 1UR9A 1I0DA 4Z2GA 1E6NA 3NGJA 5C0QA 4IMAA 4BJHA 2ZZ3A 2ZUMA 4AY7A 3XISA 4Q4SA 1LOLA 1R2SA 1PCKA 3LHZA 4J3UA 1J0KA 4GA8A 1OCQA 3U5UA 1PKMA 3ARZA 3CUFA 3VNJA 4M80A 3SGGA 1T6MA 3FJ4A 1B90A 3PZMA 1TMHA 3UXDA 3MHFA 2FGZA 1A47A 3P7YA 2V3GA 3VIIA 1UWTA 4AYSA 4RW3A 5HMDA 2IQ0A 3A5FA 4MFEA 1KM0A 3RU6A 3U5YA 4WSHA 3H7UA 1JPKA 4ATLA 1RZMA 1T0OA 4HTBA 3GZAA 1QW7A 3WLSA 4US5D 1XWYA 3HQNA 2P50A 1UH3A 3O15A 3TN6A 1GUVA 1AODA 1CTNA 4F40A 4MLJA 3EDJA 2E5CA 4LUSB 1E4LA 5H8PA 3WDHA 3QHNA 2PE4A 3A13A 3GH5A 3N6HA 4KKXA 1TWIA 3R2GA 3W81A 3LHVA 3FA3A 1SYTA 3WLMA 2NWSA 3LHYA 4M3PA 4ZGYA 1WDWA 3PAOA 1S2TA 2R91A 2CC0A 1UPPA 1B3WA 3MZNA 3QMTA 1E1CA 5HOSA 2INEA 3QR0A 3SCOA 3SR7A 4JCMA 2ZE3A 3TWBA 3PZ9A 1DWHM 4LS0A 3JUGA 5JXQA 2VUNA 3TYEA 1QPRA 4FLSA 3T78A 2KZHA 1TVLA 2RAGA 3F03K 3CL7A 1SU5A 1IXPA 2PDCA 3EX3A 2XZ9A 1NFGA 4ZZ9A 4HOWA 4C1NA 2CPUA 1G01A 1YBQB 5HDRA 5A69A 1CYGA 4Q22A 2GGEA 3OHIA 2BOGX 2YW3A 1YTEA 2CERA 2V2HA 4PMOA 3B8VA 2CBIA 5A6AA 1IXQA 4G7EB 3WLJA 4TV5A 1EGVA 4FXFA 3W7OA 3HJZA 1TTIA 3T55A 2E9MA 4HQVA 4REQA 1UHVA 4N4PA 2FDSA 1SO4A 4M1RA 1LWHA 1OFPA 3W2KA 2ATMA 2QVNA 1F5ZA 3RMEA 3VIGA 3GTXA 1OC5A 1RBOB 4HNTA 3WNMA 3CT7A 1H11A 3CB3A 3GU1A 3N73A 4ZFMA 1CGVA 2WZTA 4F9DA 2VL4A 3ZYZA 1PEZA 2CWNA 4L80A 2XFYA 4HNOA 4S2CA 3VPLA 2VQTA 5I7GA 4QIUA 1B9ZA 3TWAA 1GCYA 2YPIA 4W4QA 1NOUA 2YL8A 4OTKA 3B0YA 4Q8OA 2D22A 2DSVA 3ATYA 4KQNA 1FDZA 3WJWA 4YCOA 3KL0A 1QO2A 3VE7A 5JIWA 2QVHA 4QDWA 2XH4A 2QGYA 2UY5A 4Q7BA 4NI3A 1E9ZB 1G4SA 1VEPA 4J2MA 2POTA 3T6CA 4G9PA 3P8JA 5GJNA 3VZXA 4QFUA 1SZNA 2EG7A 2VC9A 3MYPA 5JH2A 1JI1A 3CZ8A 4OKDA 1ZJAA 5AHNA 4QAIA 1LOQA 1E73M 3BAXA 3G0XA 3GE7A 3E0VA 5BZAA 2YX0A 2QCDB 3C56A 4TX8A 4Q7NA 4W8BA 2XSXA 2PB1A 3CUGA 3UZYA 2V5LA 4FOUA 4JFVA 4IPNB 4JIEA 3MDUA 5SWUA 1BLIA 4TOQA 1ME7A 5DCDA 5AC4A 2ZX5A 4UZSA 4CD8A 3VC5A 3EB3A 1LG1A 4LPCA 1XYAA 4EIVA 1CIUA 1V0MA 2O9OA 2D3LA 4KGJA 1D2KA 4Q8NA 4YL2A 2R24A 1OBAA 1XLIA 4AVNA 1Q6RA 2HNEA 4K37A 3WLTA 5CSSA 1ICQA 1HGWA 4L9ZA 2BVWA 3U2ZA 1BYBA 1LRTA 1UW9A 1Q6EA 4NYUA 2CNCA 5T26A 4JTCA 1Z9AA 3TYBA 5I3GA 5DCBA 4LC8A 3N12A 1YE6A 3NZRA 1OSEA 1JYXA 2CBUA 3VIMA 2VOMA 4MFDA 1UKPA 2PDNA 3KWXA 4JTEA 1J11A 3RM9A 2EF9A 2BWGA 4TXEA 7XIMA 1K9EA 4IGNA 1X1OA 1H5VA 3IUDA 4JYFA 3V3WA 1M03A 3W86A 4JTLA 3BOFA 1RJPA 5REQB 4ZENA 2QZRA 1MW3A 5G4EA 4MNMA 1BG9A 4CGTA 5D02A 2WMGA 4QRNA 5BOFA 3HIJA 1PCWA 3LBMA 1U22A 1BQCA 4JYDA 1Q7QA 3KTXA 3RM4A 1OB0A 1LWJA 2HMCA 1A5MC 1T5AA 4KEUA 4A3HA 2VX5A 4LXFA 2F6KA 4JD4A 2QPSA 3E1F1 4OE7A 3GDTA 5EGRA 1UPMB 1FCUA 4QLLA 4B5VA 3P80A 2Y7EA 4R88A 1NTHA 1VF8A 3E02A 2OQLA 4JNZA 1REQB 2OWXA 1HL9A 4XAGA 2HPMA 2VRJA 1NAL1 2XSBA 3EPNA 1PV8A 3EEGA 1QI3A 3DDMA 1ONWA 3LQGA 4JEJA 3WLHA 1X7IA 4EK7A 3ZJ6A 1M6JA 2BNJA 4DI9A 3GR8A 3GHRA 4JICA 4QROA 1RD5A 3P67A 4KRTA 4DJEA 5EY5A 1GEQA 1XGDA 4UQDA 1Y7VA 3TROA 1A5NC 2XIIA 2QCHA 2Y8VA 3HPSA 3UWYA 4DF1A 3ARSA 1OIMA 4IQJA 2ZXBA 1LL7A 5U4NA 3EWCA 2DZAA 4D6IA 1ISWA 1UP3A 1DWJM 1EJ7L 5DBTA 2ON3A 1JUEA 1S5TA 3W1AA 2WM1A 4DZIA 4MVAA 1GG0A 5GJPA 5I24A 2GDUA 3QRHA 1MRAA 4C60A 5CSUA 2WJDA 1NFPA 3EX4A 3H53A 3WLPA 4QG6A 1ISXA 3H12A 3CPUA 4LT9A 4MTVA 2NQLA 1V02E 1D3CA 3UESA 1E15A 3RILA 3ELFA 3F4WA 3LOTA 4P5UA 2VEKA 2GK1B 3PM6A 3ABXA 1PHWA 4J2PA 4UQEA 1TPUA 2OU4A 2VX7A 2DZTA 3SBFA 3STEA 3QV6A 2FHCA 4M56A 2INZA 2FZ8A 1B3YA 2ZRVA 3SCUA 5LA0A 2UV8G 1H7WA 3UXKA 2ZX6A 1RY0A 3TTYA 2J9YA 2OO0A 3CUHA 1YPXA 2VCAA 3LY0A 2PEVA 2DT0A 3JU2A 2J13A 1JCJA 2WMIB 4GACA 3GG7A 4KWWA 1DJWA 3QLLA 1LORA 1O5RA 1MWOA 2PCEA 1XJBA 2PZ0A 2FGBA 3I4KA 2VM8A 4A2SA 2W27A 1EJTC 3SCRA 3VCCA 4Z1BA 5A8QA 1QHZA 1B0IA 1UOKA 3SUWA 1XFCA 2VYOA 3W6LA 3LPPA 2OZ8A 2CZDA 3M0YA 4FEZA 1Q2RA 2FDMA 2QV5A 3IVSA 1EIBA 4US6A 4WSJA 5LNRA 1FWFC 4NP7A 3A47A 3C2FA 1MZHA 1DKWA 4DAIA 1BTCA 4IXHA 2F9RA 3ZVHB 3PBGA 5C9UA 2J88A 4I7VA 4QG9A 2YZ5A 1TJ2A 2QJHA 1WCGA 1G6CA 1DEDA 3ZZ1A 1XD1A 4O1CA 1E71M 1KLZA 4BWLC 1W17A 2ALRA 3B8TA 1GZGA 3S5ZA 2W79A 4AEFA 3RLVA 3KHJA 4F4RA 1W6TA 1M7XA 4EKJA 1OYAA 2W91A 5DLCA 2GVGA 1GZ1A 3AS2A 2O9RA 1KLYA 2O9TA 4F3HA 3G24A 4WSKA 2VEFA 3UW6A 3DENA 1YQ2A 3FS2A 1IE7C 2Y85A 4LF2A 3M16A 4E38A 1J5TA 3QFWA 3SURA 4KT2A 2VDGA 6REQB 2D0HA 3DU0A 3GNNA 4O19A 3VDBA 1WZMA 3OVGA 4C6KA 4IMCA 2OKOA 2XUCA 1PAMA 1XLMA 4K38A 4QG8A 1UR8A 1BG4A 2DQWA 1E40A 1KCLA 1QPOA 3H55A 3L67A 1Y0EA 3DYMA 1UA3A 4RPQA 2BY1A 3N3MA 3ZXWA 2G96A 3H2MA 4IIBA 1M7OA 1S3HA 1O1HA 1XQKA 1EF2A 1AD4A 4ATDA 3LXBA 4NZJA 4WGHA 3KBSA 2HNHA 1U83A 4EANA 5M3WA 4EACA 3CLWA 1Z8AA 2XWEA 2XIQA 4BS0A 1F76A 1WKYA 3FAXA 1H60A 3HGRA 4QLKA 2DSUA 3UJEA 3IACA 1U1JA 3KDOA 3BJTA 1JGIA 3CL8A 4U4MA 1ISVA 2WSQA 2E4TA 2CXEA 1N8WA 2BFGA 2B4GA 4B3ZA 2OLAA 3POHA 4M24A 3LNMA 1TE1A 1FHLA 2Z28A 3N2CA 4E0CA 4BWLA 3PB0A 2D2GA 3NR0A 1LDCA 1M01A 5BYWA 5MKGB 3LCXA 3RRAA 4NXSA 1JF6A 1JNEA 3ZT6A 5MF5A 1XL9A 4H4IA 2ABBA 4ORIA 5AHIA 2VGGA 1VYSX 3OGRA 2NQ9A 3L0KA 3QZEA 5CC3A 2PCQA 2Y63A 3TEVA 2I1OA 3GDMA 3SCPA 1K6WA 5LIXX 1UZ4A 4XZLX 4MHBA 1M1BA 1PL9A 1UC5A 3L7RA 4D6DA 3MJMA 2EPHA 1A5CA 1S2UA 1P0NA 1CLKA 3W37A 4HHLA 1OJXA 3UG8A 3SQMA 2D2OA 3SUUA 3IVUA 3VOCA 4B3KA 1MXSA 4OU1A 5DANA 3EOUA 4L1WA 4AD4A 1OF6A 3G22A 5JH1A 4ZA0A 1YRRA 1FWHC 3LNPA 5KTLA 1LQAA 1KKOA 4WR3A 3GX9A 3W82A 5BU6A 5GJMA 2IQDA 4ZE5A 3BARA 2V38A 4FX7A 1QT1A 3OW1A 3CBWA 4E2VA 4C5ZA 1JCNA 3ECQA 3AQUA 1QR7A 4C91A 2WWCA 1QOQA 1CI1A 4YYCA 2ZC1A 1RK6A 1SSDA 5IFTA 1XIFA 2PDKA 3RMJA 3PS7A 4O11A 2XVKA 3B9OA 2PP0A 3RX3A 1IIGA 1VPXA 1E72M 5T91A 1NP0A 3AFBA 1DV7A 3IK2A 2B0MA 4NX5A 2UZ9A 1A3HA 3A9IA 2QJNA 1T99A 3VCNA 4GMEA 8XIAA 3RIKA 3NL6A 2ZX9A 1GVOA 1IT0A 2A7NA 1C93A 3G3MA 2EXOA 4HU3A 2FIQA 4ZCWA 5BOEA 1Q3NA 3QPZA 4D1IA 2WMIA 1GEHA 4O18A 3GKAA 3P5ZA 3SRKA 1NDWA 3MA8A 4Z2HA 3TW9A 3B05A 2ZICA 1XRSA 2QAPA 1IIHA 5CSRA 3MUY1 1QO5A 3VZYA 4H6EA 3E3HA 4JFUA 1FTXA 1HZYA 3QPYA 3SN1A 4O1AA 3UFYA 2WCGA 4GK8A 1W3LA 4AHQA 4UR8A 2OG9A 1W5NA 4AD2A 5CGTA 2PUZA 4DRSA 1YNYA 4GUIA 2NW0A 2YXXA 1BPLB 2PF8A 3MYOA 3GTIA 2FQIA 4HN8A 3VOJA 3N4FA 7TAAA 4KWOA 1XV8A 2A7PA 3W1PA 1R87A 4G2DA 3ERPA 4Z1CA 5CZSA 2J8TA 1QNRA 4LUSA 2TODA 1VFFA 5C8BB 3CV2A 3WLRA 2G3IA 3LZ3A 3MMDA 1W9XA 4EAMA 1JG9A 3DERA 3CQHA 4YJ5A 1W1YA 4JN7A 4WD0A 4UTTC 3FY1A 5CBBA 3KRUA 2VEIA 2A7RA 2YB1A 3VDHA 2EPKX 1TZZA 4GVIA 4NY2A 1CXKA 1LF1A 4GYPA 1I8JA 4Q4MA 1R85A 3EZ4A 2PURA 5LXXA 3H26A 3HGOA 1HTIA 3S5OA 5CLTA 3OTRA 3NZQA 4LY8A 2DIEA 4HMCA 1F3XA 3CHEA 4EXBA 1O94A 5GNXA 4EE9A 3PBMA 1KRAC 3EX6A 4Y9NA 4B9YA 2V30A 4HB7A 1JDEA 4J40A 2I9EA 3DKLA 3TLQA 2ICSA 3VKCA 4LF1A 2KX9A 3HBLA 3GIPA 4FSAA 1W1VA 3DYPA 5IBXA 1J6PA 2PTWA 3BQ5A 1RVGA 1TQXA 3QGKC 1J5SA 3VXGA 4W85A 3SAZA 3R1ZA 3AMKA 3FSUA 1NQ6A 3T2QA 2IMRA 4UUIA 3CLMA 3W7EA 1SQ7A 4YVVA 3WQ5A 3EXRA 2VFGA 1XINA 5L6UA 1Z42A 1O5XA 1EL3A 4BI7A 5DQPA 2PTYA 4IP4A 1DQWA 1HF6A 3NFUA 2G95A 4URIA 4X61A 1VFHA 5AY7A 4QX4A 1E0WA 4IF2A 1EP1A 4JQ2A 4PL2A 4S3KA 4O13A 2VC6A 3W1UA 5D38A 3EMQA 3EB4A 1OCJA 1X7FA 4QE1A 3EMCA 3TAKA 2DH3A 4R7JA 3QJAA 4PBEA 5CSYA 3CIWA 3T44A 4YTTA 3ZJ7A 3G1RA 4H9YA 3GBDA 3ZWTA 5I02A 4DBWA 3S2LA 1UJPA 4Z1YA 4X60A 3SQSA 1EJSC 4EWJA 3ITYA 1VBUA 4RCXA 5EA9A 4LB3A 4CNUA 2G5WA 2JF6A 4DBSA 3N13A 5E6YA 3RR1A 2YOCA 1YMYA 4DUXA 4QS6A 2ZXQA 2VCBA 3VKJA 5G4WA 3Q58A 1Q4WA 3E2RA 5C7VA 3D6NA 9RUBA 5C2GA 2PDJA 4W8AA 1PJ9A 4BQ5A 1FRBA 1WKFA 1FP8A 4Z2KA 3A4JA 1BWKA 1K03A 4C6BA 2ZZ1A 1DIDA 3WMCA 3P82A 1B1YA 1Z44A 2E77A 4JKMA 3T08A 3VKDA 1RCOB 2G97A 3P62A 5DO8A 1KM3A 1YYAA 2AQOA 1OD8A 2VWTA 3U6WA 1MEWA 1YKWA 4G6CA 2VHLA 3EA2A 2XPKA 3USBA 4H04A 4JX6A 1AMKA 3MKCA 5A6BD 2C6QA 2Z1WA 1VIWA 1QASA 1OHLA 4XKYB 3P74A 4C6DA 1EOKA 3ARQA 1XIDA 3UP8A 2ZVRA 3T2OA 3AIUA 4IL0A 2BGNE 3AZRA 2AMGA 3L5MA 3AIVA 1E4IA 1DHPA 1DXFA 1CW2A 2O0TA 4QJ1A 3NQ7A 4OFCA 2YBVA 1TV7A 7PTDA 1ADOA 3UXIA 1G0CA 2ZFAA 3VVGA 1W9DM 4O8AA 2YZRA 5F7UA 9CGTA 2WW5A 1XLDA 2NV9A 2VOTA 4CN1A 1EX5A 4I9TA 5F4WA 1K77A 1ZBWA 3U7BA 2WJFA 4XK2A 2UY4A 4UQBA 3WBAA 4ENLA 3WQGA 3ITOA 1UZDA 4GRSA 1MYRA 3HMCA 4RPPA 4WK9A 1YW1A 1TSIA 1HKIA 2RHGA 4Y9PA 4CQBA 2Z29A 5FF7A 4A3YA 3AIQA 1RPKA 4NX0A 4IG2B 1GOXA 3P0WA 3TTQA 1XYCA 1TIMA 2ISFA 4UC5A 1KFJA 2FPYA 3WBYA 4RE4A 4GQ0A 1R38A 1T96A 1VCVA 4MB1A 2VENA 4OUEA 2PDBA 2ZUVA 3ZS4A 4D8AA 3I10A 1V03A 1DQUA 3COTA 5A8OA 3NPWA 1UKQA 4PN2A 2G3MA 3IJLA 2EPMX 4B9ZA 3W1TA 4H9UA 4LSBA 3WENA 2G4FA 4AH7A 3SY1A 4XD5A 3QZ6A 4BKNA 1GOMA 5DRCA 2QF7A 4XKMA 3USZA 2IPGA 2WBGA 5DFAA 4PEKA 5K9DA 3S5YA 4M8UA 3GIQA 2CHRA 1L6FA 1TVPA 2SFPA 4R3UA 4DNHA 4WX2A 3LQLA 1ZQ5A 2GQ3A 4N9BA 3WUGA 1SJBA 4GY7A 1ZS2A 4PH6A 1S3TC 1X1NA 1KTCA 2A3AA 5EMUA 1F7BA 4F66A 2PDGA 1IXOA 3ARRA 2OGJA 4JQ3A 2EAWA 2E5DA 4Q33A 3UZXA 1XRTA 3E0LA 2DSKA 3V5FA 2F84A 1LQ2A 1C7TA 2VGFA 5HULA 5I03A 1ZJHA 3VA8A 1HKJA 4JX5A 1W2VA 1UUMA 1Z6KA 4XAPA 4ZEPA 4ZB2A 4IISA 5CPNA 2C16A 4QCFA 5GNZA 3NQBA 3U2EA 1LLOA 1M41A 5G2IA 3F5LA 3RJXA 4DYKA 3M07A 2G50A 1TZ9A 2J7BA 4D2JA 1KXHA 4CN4A 1SGJA 4E2BA 4MJ2A 1C7SA 4LYPA 4H9XA 2HZGA 2DJLA 1JCLA 2I5GA 1HP5A 3NIYA 3FJ6A 2W0UA 2MANA 4AIUA 2FH6A 3WEZA 2ZA1A 1MUMA 3O8AA 1Q4NX 5HQEA 4E8DA 1DJXA 3APGA 3SB0A 1MQRA 4GBUA 3NVDA 4JYEA 1S5WA 4W87A 4IPIA 1X6NA 3AC0A 3S9IA 1HQTA 3H54A 7ENLA 7REQB 3GW0A 3KL5A 2QMJA 2J9ZA 1H7PA 1T41A 1P0KA 4R5EA 2E7FA 5M5DA 2NXGA 3TZFA 4NZ5A 2WJZA 3ZR4A 3PUDA 1NFBA 3EDKA 2IKHA 5TF0A 3DFYA 3F4CA 3BCJA 2CLEA 1J0JA 3QBUA 1OEPA 3UEQA 4D1JA 2Y1HA 4YXGA 1EF3A 3DHUA 4KWVA 4A8RA 1LROA 3S1UA 4FLQA 1RY8A 2CITA 4B5TA 1DWFM 1M5WA 4BR1A 2EPNA 3EOSA 4XSMA 1VRXA 2Q8ZA 4IGSA 4ZTXA 2ZZ4A 3H22A 4GUHA 1H7RA 4DO6A 2XVGA 3GG1A 4QS5A 3B97A 2E67A 1OK6A 4ZVJA 1H61A 1RH9A 2JALA 3WUFA 1TPH1 3LTSA 3W25A 4LY4A 2R9RA 3QTGA 3ZVIA 3TONA 2CCRA 2XVLA 1R86A 1W8SA 3WX7A 3HM7A 3KVLA 2ODOA 3SN0A 1UUOA 3KWSA 2YB4A 2I14A 3R25A 3QYSA 4LBSA 1EXPA 1XYMA 4YYFA 4HP5A 4H7CA 2O56A 3CWOX 4JY8A 3G1DA 3PZVA 1MEIA 4EPBC 3B9EA 1KD0A 1UB3A 4ZQNA 5D33A 7TIMA 2XIBA 2WYSA 5LNUA 3B3DA 4DJFD 3LBOA 5I3JA 4FPSA 4PYSA 5LNSA 2DT2A 3K1GA 1BXNA 2XG9A 4MPQA 2WZHA 1GGOA 3WMBA 3L4ZA 1QDSA 2Q3OA 3IPWA 3PB2A 2FZBA 2I5IA 1JCXA 2YXOA 3C2RA 4A8LA 4P2VA 3T40A 2D2JA 4ROQA 2PS2A 3APYA 4K8HA 3WH8A 4F79A 2OO6A 1TWWA 2RGMA 4LNYA 2PFHA 1JZ4A 2ZRWA 2R1PA 4AD5A 4B5WA 1EH9A 4PE8A 3BQ6A 4RXFA 3WD3A 3SIZA 2A3HA 3VFCA 4CU6A 4J3VA 1HW6A 5FAGA 1E6RA 3SGZA 4BQ2A 5FIPA 1NIUA 1J2WA 1QWGA 1YTKA 3KS6A 1KM6A 1ZGDA 4W5ZA 3AS1A 1N7KA 4CVUA 1ENUA 3I6EA 4XKYA 2E6DA 4I8YA 2KAUC 1HJXA 4JIRA 3OLIA 4P8WA 1P0DA 3TA9A 1UOZA 3EX1A 1I0BA 1IZJA 3WL1A 3RYSA 2PTDA 3N34A 3FLUA 3AMDA 4S3DA 3A24A 4JNMA 3L9CA 3KHDA 4I7WA 2PWGA 2BHZA 1RV8A 2GVYA 3S9YA 1DPMA 1LT7A 3JZEA 5ABFA 2BTMA 2V2CA 2PU1A 1ZENA 3B8DA 4POCA 1E9YB 3POCA 2ZDSA 4H01A 1UZ1A 2INFA 3LSCA 5GPRA 4AX7A 3PJWA 4LV4A 3BWWA 3RCMA 4CD4A 2CKRA 3FXYA 3S1GA 3SUSA 1X96A 3H24A 3GHTA 3I3EA 1F3EA 1AJ0A 3GDBA 3WD4A 3GZ3A 1XLKA 3R4IA 4YWSA 4KPLA 1GOKA 2WCAA 3IRSA 4DXVA 4S39A 3M5ZA 1R7OA 5CC5A 2X1IA 2QUVA 1XCWA 5KMYA 1WYIA 4J1OA 3PVFA 4LVGA 1EPVA 4PTDA 1QUMA 4MY8A 4LUIA 3RG6A 3BGJA 3UPWA 1QI0A 4AXNA 3ZMRA 4E8GA 2WXDM 1TG7A 4DJDA 2QYGA 1FXQA 4AZ7A 5K9CA 3HPZA 4KEMA 3BCDA 3GVRA 4ZR8A 5CPSA 3QYQA 2Z2UA 3NWRA 1IGWA 1I75A 3ZT5A 3G1YA 4JS3A 4LYRA 1N55A 2XH0A 2WKLA 3W2JA 4IT1A 5DMNA 4Z08A 4OV9A 3AIEA 3KOXA 2OYKA 2XISA 3KX6A 4I90A 3M0VA 2IKIA 1WDSA 3WQPA 3A4XA 3DGRA 2J47A 3IK4A 5KZ6A 1BF2A 5CPQA 4JL2A 2HTMA 5D37A 2VRKA 4K1WA 3AHTA 4W7VA 1TPC1 5BRQA 4PCTA 3W1XA 2NXHA 3EWYA 1I2RA 3QM3A 5FD0A 3PSWA 2WPBA 2V68A 4FK9A 3KTCA 2HWGA 3N25A 4V28A 3C8FA 2XIJA 2HROA 2VEGA 3C4UA 4G7FA 3WBEA 3T05A 3U4AA 3BGAA 2XN2A 1FVPA 2X05A 3RK8A 1EPXA 4HOXA 4REQB 4JTUA 1ISZA 4O57A 4G5DA 3BW3A 1MSSA 2FHBA 3QC3A 3RITA 1FWAC 1ONEA 1XC4A 2W63A 3B4UA 1LG2A 3QFEA 1OINA 3HPAA 1QATA 3OYXA 3O0FA 1S38A 5LIYX 3N9RA 5F4SA 1W1ZA 1XYZA 3N2OA 1XKJA 4HSNA 3U2OA 1IZCA 2ZA3A 2CLFA 3B9NA 3PZTA 1QNOA 1E5JA 3LHUA 4Z0JA 3ALGA 4TVUA 1K9TA 4IX0A 1AZ2A 3RCNA 3BH4A 4HVXA 1V6YA 3M7WA 3DX5A 2C7FA 1V6TA 3GHSA 2RDWA 3GFXA 3H4WA 4UTLA 3DECA 3UPBA 4GD0A 2Z7KA 4JDBA 4V27A 4OGZA 3DHPA 1I2OA 4FR1A 1NY1A 4ILSA 3GTFA 1VH7A 3TJXA 4DJFA 5CG7A 2A4AA 3NA8A 4HK5A 3PBVA 4AXKA 3CV7A 1SFTA 3H6OA 4H6KA 3K4WA 2D73A 4KBXA 3UU0A 2V3EA 4Z2IA 4RE2A 1R6WA 3IWPA 1JZ7A 3NUKA 3FIGA 3BW2A 1ME9A 5IDIA 4HJFA 1H5YA 1P5BA 4FI4A 4GYJA 3DC0A 4KETA 4GH1A 4YHGA 1PZ2A 4QHRA 1ECQA 3VUPA 1FWCC 1D9EA 2BASA 1PZ0A 1ZZMA 1EQPA 1QJWA 3R8HA 4K8GA 1MUCA 3IUIA 4IG2A 2CFFA 3M4HA 3TMLA 2PA6A 5CG0A 2H8ZA 3IRDA 2BB0A 2P8CA 4AF0A 3W74A 3U4FA 6TAAA 4K7YA 4LU0A 2GQ9A 2P0IA 3KM8A 2CLMA 1HO1A 2V81A 4AHPA 1EWDA 3ANYA 5FEPA 1DIOA 1KBLA 1K8CA 3OIXA 4TUFA 3U2CA 2R14A 5LIWX 3APTA 4JTGA 1BXCA 3GHUA 3UQNA 2Z6IA 1DORA 2PC4A 1JPDX 2XGBA 4NJGA 2Q8XA 3WQ8A 3UYCA 3TVAA 2BHUA 1JUBA 1QNVA 3PBWA 3PJTA 2PLKA 1JYNA 3L66A 1OCBA 3DCPA 5JU6A 4AIBA 4JTAA 3UF9A 3EWZA 3S2JA 1LCOA 1F74A 3IJ6A 1BYAA 3BSMA 3W53A 1VEMA 3EWXA 4GJJA 2E9LA 1TO3A 2Y62A 2WC4A 1UKOA 4W7WA 1MO0A 4LGXA 2JBMA 3TZNA 1OM0A 1EXBA 4AYGA 3SRHA 4XZMX 2OYMA 4KEZA 1HJWA 2CW6A 3AROA 4DO5A 2E6AA 1J9YA 2V63A 3ABRA 2PRMA 3L4UA 3TQ0A 4AMAA 3ONCA 3QTPA 3MI6A 4O53A 2QUNA 5EL1A 3VIFA 4LUTA 2O4MA 2GFTA 2IXVA 1ZY9A 3P5YA 4ADUA 1QNQA 1VJIA 3OGVA 4X2PA 1VC4A 3R13A 3STCA 2FB2A 3O16A 5D2XA 4KRUA 1KFWA 3U8GA 3FHQA 5BRBA 4LUYA 3BSHA 4XTIA 1D8CA 1MQPA 2C19A 4JGDA 5A2BA 1JVNA 3UXLA 4GUJA 3SCQA 4JDYA 1UKSA 3ITCA 2GVEA 5HNRA 2ISDA 2QJMA 1B54A 3AALA 2WSRA 1IEXA 3G1AA 1PWLA 1EDQA 4AISA 4PMRA 3FYOA 1XGZA 4MKVA 4HA4A 2CU0A 3OG2A 2WNQA 2C15A 3W27A 1ITXA 2XDFA 2YDQA 3QF0A 3QXBA 2QULA 6XIAA 2OQYA 1QOXA 4A3QA 3F5KA 3MCMA 3UNDA 1EHAA 4L65A 4TIMA 1FDYA 4AZBA 4A22A 3Q4DA 3O6DA 3W6YA 1QK0A 2OEJA 1B4KA 2DV0A 4AD0A 1EA9C 3FXGA 3M5XA 2J4GA 3TLLA 2H6RA 3WLIA 3GXDA 4Q8WA 1R3VA 4D72A 4NJIA 3RFAA 1KTBA 1AUSL 1UBPC 4X0NA 4HK7A 2OT0A 2XWDA 3TJIA 1CGTA 1SJCA 3C6CA 1NWUA 2FFIA 4J35A 1LUCA 1V3MA 4K36A 1EGMA 1VLWA 2OR2A 3P8IA 3HV9A 3SCTA 6ALDA 3FW6A 3W1MA 2XINA 4CU8A 2VZUA 4JQ1A 3GVGA 3IS4A 4MWAC 1J0HA 3UCCA 2X41A 1OT1A 1XP3A 1JZ3A 3TYCA 2O7SA 1S2VA 1YPFA 1KBIA 3R8RA 3WD2A 1OGSA 2OOFA 4H83A 3Q45A 3KFTA 1KXTA 3B0PA 5FOOA 1VZWA 2VRQA 1J6OA 1OX6A 1UR2A 2VFEA 3UJRA 1CT5A 5CH9A 1AQHA 4O1BA 1H7NA 4WCJA 4WDXA 4FA3A 1PX8A 1G4PA 2JGQA 2QCNA 4HK6A 4QGCA 3WQWA 4UTIA 4PB3A 2ACSA 3AAMA 3OGSA 2QUMA 4O52A 3IVTA 1TPWA 1TX2A 4H9ZA 3QPEA 3AUJA 1SMDA 2I17A 2GLKA 4P61A 3RUBL 4ML9A 1W5OA 1BEUA 1DJYA 1V08A 3EBVA 3BLPX 5EB8A 4E4UA 2WVVA 3W7JA 2VDIA 4YS1A 1V3KA 2GZXA 4PR4A 4GXPA 3KZPA 3M5VA 2VR2A 1E9IA 1HO4A 3NZPA 2NVAA 1ME8A 2A1YA 3HQPA 5CC6A 1OQFA 2WLZA 4J27A 3OVQA 3H7VA 4D6EA 3WK2A 3DFTA 4M29A 2OX1A 1WB0A 2CWXA 2YXGA 4FXRA 1TV4A 1ZCCA 2ACUA 1FCBA 2CZFA 1V4YA 1RP8A 3VKBA 1S5NA 4C6CA 2GJRA 1R8LA 5PTDA 1K7XA 2D0FA 4GJIA 4YN5A 2G3NA 1A80A 4XBSA 5DXXA 4E4PA 4GI6A 3HU7A 5AECA 1BQGA 1CXIA 4ERAA 2VFHA 2WQPA 1PB0A 3B8UA 1XLCA 4XQ6A 3WLQA 3WG6A 5C5YA 4W93A 1E5NA 1VJZA 3KE0A 3PP7A 2ONEA 1W9BM 4Q3MA 3KW3A 3BO9A 3HF3A 3JRKA 2G37A 3KRSA 5LNVA 4GKLA 3C3UA 3R8GA 4XAZA 1JRBA 3S83A 4UCFA 4WOQA 3SJ3A 4H41A 2JKEA 3SADA 4W88A 5CPMA 5D8WA 2YR1A 1F3TA 5DRIA 1OVDA 4ZOAA 3WNLA 1U33A 4LC6A 2R1KA 3PFRA 4HA3A 3B0XA 3TN3A 1E3ZA 3GQYA 3MUXA 1GVSA 1NEYA 5LXEA 5D30A 2V8ZA 2OX4A 3KBMA 4Q8QA 4PODA 1XLGA 4C6OA 1RBLA 1L8PA 1JZ2A 1IGSA 3EPMA 3AYSA 4AIOA 1A5UA 5JUVA 1S2AA 3EYPA 3LXCA 3WNNA 1MEHA 3O7UA 3URBA 1AD1A 2A3CA 3PPGA 3T09A 3QY6A 4UTKA 2ZQ0A 4GO9A 4QEHA 1TRDA 4LVBA 2E3ZA 3K13A 2GVJA 4FLOA 4N9EA 1UWQA 4XZHA 3INPA 4LYQA 1AJ2A 5C71A 4MKSA 1HVXA 3CUZA 3E2QA 1DOSA 2XFWA 4QCEA 2P88A 2NQ5A 4L64A 2CZ5A 3WK0A 5FEWA 2BVYA 4A21A 5KEZA 3IIXA 2VKZG 1E55A 4FOJA 2XFRA 2CBJA 4P7LA 4LEFA 3RX4A 3KCJA 1BWVA 1I4NA 1EGZA 5DMMA 3M7SA 1Q6DA 3VD5A 3LCGA 5KZDA 2BOFX 3KRBA 4DJEC 1TE6A 4NAEB 3T2PA 4CNNA 8TIMA 3M5YA 3SCWA 3WQVA 3VIPA 1PKYA 4MDPA 1OABA 1TV8A 5A6SA 2BY2A 4CLMA 3CK5A 5EMMA 3EOOA 4NILA 4XZWA 1EDTA 3CAWA 1EFZA 2Q8LA 3LI0A 4MKNA 1ECEA 1W5PA 2Y24A 5K4XA 2VO5A 3I7QA 1W1A1 2OZ0A 1S1RA 3IARA 1EC8A 2WJEA 2XN0A 1JXKA 4BQ3A 2ZOXA 3FN9A 2Y5SA 5BU9A 1XI3A 3BL3A 4AY8A 5A6LA 4DJDC 4P7QA 4CD5A 5BWAA 5FSDC 3SRFA 1V8EA 1E1EA 4X22A 3RLUA 3UCDA 4TMCA 1Q6GA 1KNWA 3HG3A 3GUWA 3UG4A 4LW7A 2FGLA 4XIAA 1PZ1A 1OCNA 3K4AA 1XD0A 2YCLB 3MS8A 3TC7A 5D2YA 2VGBA 2YYTA 1BVNP 1KXVA 3VDGA 2X16A 2JEQA 2X2YA 1VPQA 5LHFA 5AZ1A 4WEVX 3KVMA 3BXWA 1XH0A 5ABHA 2J79A 3TNOA 4QITA 3H4XA 1XISA 4RDVA 4IFOA 5LNWA 3L2LA 2B7OA 4E2OA 4C6FA 2D2HA 3MUAA 3VGBA 4EWND 3KOYA 2PDMA 1F61A 2IPJA 3G6MA 2EJAA 4PMNA 1GVYA 3CB8A 3BAIA 2V6AA 1KFBA 4JTQA 3VIKA 4C1NB 3Q65A 1FWSA 5GVJA 1Z7AA 4PFMA 2VD8A 3BOLA 2OXNA 3LZ5A 1H0IA 2FJKA 2YL5A 3THCA 3W84A 4US5A 2WMKA 5ABFB 4PGLA 4YTUA 1BF6A 2O7QA 1W1IE 1EO7A 2EG6A 2P3EA 2D0GA 4ZQOA 3UETA 4IHCA 1PIFA 1SO3A 1AMYA 2FVLA 2QR6A 1I1XA 3MMTA 1A5AA 1O12A 2XU2A 3P0XA 4JX4A 3CV6A 5M2FX 1JYWA 2D3NA 4HCDA 5T8GA 4G56A 4C6IA 5AHEA 3LHTA 3D3AA 2YL6A 5CZJA 1MFUA 3LPOA 5C2CA 4IIHA 5D9MA 3IJ7A 1TYGA 4IWWA 3W88A 3WL0A 4C6LA 4RZ4A 4UMAA 4CEXC 1XPGA 4Y2WA 4M81A 4GGBA 3IUHA 3C8NA 4HPXA 1ZP3A 3WZ0E 3U7VA 3F4NA 2FVKA 4P8XA 1JQVA 1VBRA 4LVFA 1J2BA 3TA6A 1BWLA 1E6PA 3EGJA 4DUVA 1C92A 4U33A 3N1AA 3VGHA 4JTJA 1H51A 4KRZA 1WKDA 3NDZA 2I56A 1POJA 4FX8A 1P48A 1AQMA 2WVVB 1ZRQA 4WJ8A 3RM8A 2Z0IA 2UWFA 4PMJA 3ORWA 3GFZA 4LBUA 1IWBA 2NLIA 2J7GA 2YCIX 2C79A 1AL7A 3AIRA 2J78A 3EKGA 4DXXA 1JGMA 3ITGA 1Q6CA 3WDJA 1J96A 3LU2A 2QDHA 3WELA 4HOZA 1NJJA 1R7AA 2Y5EA 4PMUA 1UWSA 4GZJA 1H7XA 1IEWA 4IQEA 1ZUAX 3C86A 3VM5A 3AI0A 1DTNA 2R1LA 3OO2A 2CLOA 4HYWA 4RDWA 1VYPX 5LA2A 3EMZA 2GWNA 3LA4A 4XIMA 1AA1B 3NSMA 2ZZ2A 1SJDA 3M64A 1QBAA 3T8QA 2V67A 3LRLA 4F0MA 3C0LA 3NDOA 1QNPA 1JFHA 3BAKA 4Q6JA 2A2IA 3O07A 1UBSA 2QCDA 5I06A 3GC4A 1W32A 4FNSA 2D1ZA 3T42A 1XF0A 1IR1A 4KIEA 5U7SA 1NWRA 3U9IA 1E6ZA 4XD3A 4MPKA 4OQVA 2FPTA 1MZRA 1XKYA 3MCNA 4I6KA 3AXKA 3A21A 1HVQA 4WQ6A 4KCVA 4TO8A 3AMGA 4MY9A 3L4YA 3PUOA 1XLAA 1ISYA 3WJZA 4PUNA 1E56A 1UC4A 1EYWA 2OMAA 3B06A 3P61A 3T81A 3MC5A 3UZJA 4FXJA 2BY3A 1HKWA 3TQVA 1Y65A 4UOJA 2FZMA 3GC2A 5D2VA 2E28A 3WH9A 5EBUA 4ZFCA 1KV5A 3ZO9A 2QJJA 2HEJA 3GAKA 4ONVA 4EPEC 3EEZA 1GQIA 2REQB 2GSJA 5HK4A 4PB5A 4C90A 5CBIA 3S9ZA 4V2XA 1PTAA 3K8LA 4PUKA 1F73A 3G0UA 1DXEA 5AYYA 4MM1A 3P60A 3NEHA 2X2GA 5AC6A 4FZIA 4ZQMA 3T4WA 3ABSA 3UZZA 2HSAA 3LUTA 3NXFA 3V0UA 4DO7A 3G1HA 2C8NA 2XVPA 1KRMA 1PUDA 2YYUA 3M1ZA 1G7UA 2J6VA 3M0LA 3QKZA 4J3ZA 4YHEA 1H1ZA 2C71A 4ZXOA 3CZGA 4GX9A 2VURA 1EC9A 3V36A 1FWDC 1I2NA 3ARXA 5ENLA 3PK7A 1THFD 3M44A 4AW7A 1OZMA 3TTSA 2F61A 1X39A 1TTPA 1CGUA 3FFSA 3GNXA 4UWMA 1R3WA 4BF7A 5CZ0A 3CO8A 3H4GA 5E93A 2PGRA 1J0YA 5DT7A 3GTNA 3HV8A 3FYPA 3CIXA 5CZTA 4ERIA 3DI0A 3W7LA 4UTJA 4RX0A 4CNPA 3ZFHA 1P6CA 8A3HA 1W2PA 1QW9A 1HX0A 2PPGA 3IAQA 1P7TB 3WF3A 3A5VA 1XCFA 2HK1A 1KFEA 2BY0A 3BLOA 1EB3A 1EP3A 3S5SA 3BJFA 1OIFA 2ZUNA 5C9XA 1KQYA 4IH3A 3EA3A 2PBOA 1QHOA 5D2WA 2OQHA 1QWKA 4M6PA 3GYCA 3GU9A 3W1NA 1A0EA 3JS3A 3R5EA 3LGEA 2R1NA 5HWJA 2H9AB 1PKLA 2J7FA 4MG4A 2DU2A 4ZBCA 2NQHA 3ZSSA 3TSBA 3BLEA 3OBAA 5DX7A 1XIIA 2RFGA 4LTSA 5BXTA 3CT2A 3LV5A 3CEPA 4DWSB 1Z89A 4KFOA 4PMDA 4C5YA 3NZGA 5DBUA 5CKSA 2OLHA 3LM7A 5HQLA 1R2RA 2C0AA 3LLFA 1KA9F 4RR4A 3STFA 4GNKB 2J75A 1W9UA 4UFHA 4LX4A 1F8IA 1E9LA 1A5SA 1SFLA 4O50A 1MQQA 3FK4A 3L2MA 4D6HA 1K3UA 2DZPA 1HUVA 3A64A 1GVRA 3ONBA 2YFNA 1J0ZA 3E0WA 1XYLA 2ADAA 3DI1A 1NARA 4H8VA 3DC8A 3W02A 4B92A 1US0A 2HE5A 1MDLA 4ZE4A 1OYCA 4FIRA 4FNUA 1RXOB 3ARVA 1NU5A 4W86A 2FTYA 5HQMA 1Q7ZA 2RDTA 3BLLA 3RX2A 2CEQA 4P8VA 4LS1A 3D46A 5HWMA