1B3YA

Xylanase from penicillium simplicissimum, complex with xylotetraose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
total genus 127
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3yA00
1MFUA 5DEZA 3FAWA 5A69A 1CNVA 2B31A 1ZS2A 5A6AA 2PWEA 3L4WA 4HOZA 3AHZA 3CHCA 1UZ4A 3TOPA 4GI6A 1DWHM 2J47A 5E70A 4ZENA 3FNDA 1DP0A 4CN6A 2A3AA 1XGZA 3K8KA 4HTYA 1Q6FA 3W4RA 4LGXA 1TR1A 3L4TA 5DO8A 1C3FA 4WK9A 1HN1A 4N42A 1ISXA 2BVDA 4A3HA 4D1JA 3AS2A 2AAAA 3VIOA 5ABGA 3N18A 3MSDA 1PBGA 1E1FA 1EIBA 1JNDA 3VGFA 1JXKA 2VZTA 2ZX7A 1DEDA 4IUGA 1UOKA 1TCMA 3T0AA 4HU8A 2UWFA 3ARRA 4UQCA 2G41A 4NF7A 2XWEA 2CBIA 3MV01 4CD5A 3PTMA 4E4PA 2E40A 1H1NA 4MNKA 3EDKA 1V3KA 4PMUA 1V6YA 3S6TA 5I23A 1CLXA 1QBAA 4CVUA 1V08A 3PBGA 3WNPA 3LMYA 4XX6A 4AD4A 1NOUA 5AC4A 3TONA 5C71A 2NT0A 2QPSA 4NZCA 1B0IA 5JBEA 4M1RA 3WD0A 4PMZA 5ECUA 2VVNA 3ZO9A 1W3KA 3L2MA 2YDQA 1TVNA 2XWDA 3SUSA 3MU7A 2XJ7A 2G3JA 5A6MA 2WVSA 4A4AA 1UH2A 4H8UA 4P7LA 1V6WA 5A6JA 1S46A 1PX4A 4V27A 2BVYA 1KBBA 3IJ9A 4HMCA 3CHEA 4HZ7A 4GO9A 1NH6A 5EFDA 5A8MA 2J75A 2CBJA 4LX4A 1FHLA 1E4IA 1B9ZA 5I79A 4ML4A 1C90A 4PMYA 1J12A 1WP6A 1QI5A 4X9YA 1NWRA 2J7EA 2Y5EA 4PTVA 4AZBA 1IZKA 1GHRA 1UR1A 1E6QM 3QHMA 4UOZA 3T2OA 2CERA 3AI0A 2XVPA 5FL0A 3L2LA 1CXFA 1A47A 1WCGA 2PWDA 2WVUA 3W53A 3QGVA 2DSKA 3OZPA 1OSEA 1KWGA 4B3KA 4PTWA 1U30A 1C93A 1WKYA 2D3NA 3WQ5A 1M53A 5A8NA 4WF7A 4WIWA 1BYBA 4BQ2A 3AISA 3SCTA 1H49A 1QNQA 2D24A 2ZOXA 1W1TA 4F9JA 3FY1A 1HVQA 3UG3A 3D3AA 5D4YA 4OIFA 1JNEA 1UWTA 3WH8A 5A6BA 1BFNA 1TZ7A 4WLCA 4DM1A 5ABHA 3N13A 3SCWA 3MO4A 3EDFA 3ZOAA 2V38A 4KMQA 3KEHA 2V5DA 5CGTA 4P8WA 4V2XA 1UD3A 2E3ZA 4L4PA 1KXQA 1Q6CA 4S3KA 4MB5A 5A2BA 2X2YA 3MMDA 1AVAA 4UOQA 4X0VA 2VUYA 2EO7A 2ZX8A 3AZTA 1JDCA 2A3CA 4EE9A 1FH7A 1C92A 3CGTA 4JCMA 4W93A 5CPQA 2XVGA 3T0BA 2D1ZA 1W3LA 3T08A 4HA4A 1RP9A 2CHOA 1KXVA 1GQLA 5CPTA 1CIUA 3SIMA 4BS0A 1JI1A 4QLLA 3I3BA 1KBKA 1W1YA 3VX1A 1H11A 2ZE0A 4PCSA 3PTQA 3WQ8A 3PZNA 5HDRA 3CO4A 2VZUA 1CZ1A 1B3VA 1C8QA 1CBGA 3ALFA 3VIKA 1KB3A 3CTTA 1F4HA 4RE3A 3WUEA 1UKOA 2YBUA 3I3EA 4BZYA 4D6EA 1RH9A 1B30A 1H41A 4NRRA 1VB9A 3SCSA 5HPOA 4AD1A 1MVYA 4TVUA 4AWEA 3VDHA 4PYSA 1E4LA 1JF5A 1HKIA 1HXJA 5CGMA 2VURA 1E15A 3VOCA 1QHPA 1TA3A 3GTNA 1H2JA 1R86A 4W8LA 3VMOA 4P7QA 1XC6A 4UFLA 3G6LA 3AIWA 1L8NA 1E1EA 4W8BA 1NP2A 1QHOA 9CGTA 5I77A 3WF3A 1CXEA 4QLKA 2FHCA 1W9VA 2BS9A 1E71M 2EPNA 4M8UA 3WNNA 4QP0A 4HP5A 4MPKA 1V0LA 1H4PA 4DWSB 2V5CA 3WDJA 4HA1A 2DEPA 3HMCA 2DIEA 4CD4A 3WH5A 6CGTA 6TAAA 1VFOA 2F2HA 2WXDM 3ZM8A 4C7DA 1CDGA 2FDMA 3UEQA 3WH9A 4OJYA 3AROA 3KL3A 2XSAA 1DWFM 1M01A 3L4XA 1G9HA 3RILA 1PAMA 1PZ2A 1ZU8A 4W7VA 1KQZA 3ZSTA 3A4XA 4UQ9A 1WPCA 1LG1A 1I1XA 2PWGA 3AHYA 2XG9A 3L4ZA 3MUZ1 4HOWA 4M29A 2WLYA 2Z1KA 1NWUA 1EDTA 3GH4A 4P8UA 4EANA 1OIMA 1UWSA 2WMHA 2JALA 2CITA 4Q22A 3RIKA 1J0ZA 1FFRA 4AZCA 1D3CA 4B16A 1E72M 2V3GA 3MMWA 1OINA 3ZJ8A 1UA7A 2OYKA 1RD6A 4CU8A 1CGYA 1V0NA 2Y8KA 4WSJA 4MJ2A 3BAXA 4AZIA 2J78A 3AJ7A 5M3WA 4PMQA 5EB8A 3CLWA 5BWFA 1AQ0A 3NJ3A 3VU2A 1C7SA 4WKAA 4TXEA 1E6SM 2W66A 1B90A 1VEMA 4R5EA 1BF2A 1JXJA 3WNOA 1EO7A 4PN2A 2UY4A 4YHGA 2WB5A 4W84A 2XFRA 1JF6A 3N04A 4Z2JA 4OOUA 3DYPA 3MUIA 3AIVA 2VQUA 4U2ZA 3WNMA 4XZWA 5FIPA 2DT2A 1GONA 5BXRA 2OWXA 1V3IA 4AEEA 1V6UA 3F5LA 4PTMA 3NIYA 3EDEA 1E3ZA 3K1DA 1BYCA 4CVWA 5D9PA 3WBAA 1HJQA 3AMDA 4WSKA 1EO5A 4ATDA 1PPIA 3OG2A 1HJSA 2WCSA 4QFUA 1WZLA 1X1NA 1W9PA 1XSJA 1US2A 2ZICA 3K8LA 4GO8A 3S2CA 2PB1A 1EH9A 1JYNA 4UFJA 3K46A 3N11A 4Z2GA 1XCWA 4AZ7A 3AYSA 1UUQA 3AZSA 3EMCA 3AS1A 1H5VA 3WEZA 1E55A 1E5JA 2WMGA 4MB1A 1O6IA 1J9YA 3ZJKA 2J8GA 1XHGA 4H8HA 1KQYA 2V3DA 5LYRA 4GI8A 3BLKA 2VL4A 4TTUA 2J79A 7TAAA 3PZGA 3VUPA 4KRTA 1GOOA 1HX0A 2CNCA 3PZMA 5CG0A 5AC5A 3WUFA 2ZXBA 4Z2LA 1V02E 1M04A 4PMXA 3CZKA 4JHZA 4AISA 1VBRA 3DECA 3KWXA 4P7RA 3W0KA 1E4MM 2X05A 1W2PA 4EKJA 1BGAA 4FLRA 5DT5A 2YLAA 2YLLA 5I2UA 5HXMA 2CBUA 4XB3A 1MFVA 1QVBA 5KZ6A 3UG4A 3ARZA 1UR2A 2VX7A 5I24A 1WZKA 1GOKA 3BC9A 3MUY1 1JDDA 4ACZB 5CQ1A 4CD7A 1KXTA 5A6BD 1AQMA 1PEZA 2V3EA 4AD5A 2YL6A 2O92A 1E3XA 4TX8A 2WC7A 1WDPA 3AHVA 4MAZA 5E6YA 2YA2A 1U33A 1EQPA 5C70A 3M6DA 2OSWA 4JFWA 3U5YA 2GSJA 5EMYA 3BAKA 3RM8A 2BXZA 1LJYA 3IK2A 4P7OA 3VIFA 5A6KA 5E0CA 1D2KA 4HMDA 1TFVA 1EGZA 2PBGA 1FH9A 4PMNA 1G5AA 1CYGA 1QNRA 5BCAA 2VX5A 3ARXA 1J0HA 2VRQA 4P7NA 4GINA 2YL8A 4V28A 2VZVA 3TTOA 1CGUA 2VR4A 2GDUA 2CKRA 1MW0A 3FHQA 4AIEA 1GQJA 3OB8A 3ZT5A 1J01A 2XSBA 2C0HA 3N12A 3ZT7A 3PZUA 2D0HA 4H7VA 2FHFA 1GPFA 5CZKA 3RO8A 4KGJA 3AXHA 2VVSA 2ZUVA 3SUVA 3WFZA 4J3UA 3CZ8A 4NSBA 5A8OA 4B9YA 3A47A 5A6LA 3CZEA 3WENA 3PZOA 3CUFA 4OZOA 4PEEA 4QDMA 4UFIA 4UTFA 2GVYA 5GPRA 2PC8A 3MMUA 2J7DA 4D1IA 3HN3A 5M17A 4CCEA 2FH8A 1CLVA 2DDXA 1CWYA 3II1A 1GZJA 4GQRA 3BCDA 4D6DA 3PZ9A 1WB0A 4AW7A 2BY3A 3VGDA 4D6HA 2E9LA 3IJ8A 3SCPA 3B9DA 4UQEA 1GQKA 2EEXA 1V3JA 1VAHA 1U2YA 5HNNA 1HIZA 2JEQA 3WDQA 4M81A 3AMKA 3FAXA 4U3CA 1JZ2A 2D23A 4JL1A 3CHDA 5E09A 3PHAA 5BXTA 3IAQA 2GJRA 2DSVA 2WVVB 3T0DA 1BGGA 3SURA 1PIFA 2CKSA 3FN9A 3APGA 3W81A 5A2CA 3WF1A 1OM0A 4C7FA 2BNJA 1W9XA 5CJ5A 5I6SA 4M82A 2Y4SA 2O9PA 2BY2A 2MANA 3UR7A 1RP8A 5BYWA 3WEOA 2J62A 1WDRA 4Y7EA 4GKLA 4D6CA 2CYGA 2VT0A 3ZSSA 8CGTA 4HA3A 3VD4A 5BXPA 2QV4A 1N82A 2WBGA 3A3HA 5M5DA 1V0KA 3OA5A 4K68A 3OLDA 1EHNA 4AY1A 1J0KA 2WMIA 3ZIZA 3OBAA 3GNOA 4JFVA 1OB0A 4WKFA 1WAWA 5A3HA 1KR0A 4J3XA 1BLIA 2A3HA 1CGXA 1Q4NX 1HP5A 1W9BM 2W5FA 4LPCA 1CXHA 3WDPP 1HJVA 3AIUA 5I0DA 2DH2A 5FD0A 4IPLA 4JFSA 3W38A 2CBVA 1ISWA 1AQHA 3WEMA 3CUIA 1G01A 4F79A 2VOTA 2XHYA 2FGZA 4UQDA 2JEPA 3GYCA 3OZOA 4YN5A 1WE5A 1GW1A 1OCQA 1TMQA 2JF6A 1J11A 4JHOA 1DWJM 3BH4A 1L0PA 3QHNA 1JAEA 5A95A 3CZLA 4P8VA 1MW2A 4BCEA 3GNRA 2NT1A 4DM2A 3TTSA 2VCAA 1QI0A 3CMGA 3EDJA 1KCKA 1H09A 1XD0A 4BF7A 4HZ6A 4JZ5A 2WHMA 1E40A 3NSMA 4J28A 3WELA 2Y2WA 2DIJA 2YKKA 3AXIA 2A3EA 4ZE4A 1I75A 1JDAA 3W28A 2BXYA 1VFMA 3AFBA 4HOXA 2D0GA 2J7BA 1CTNA 3NSXA 1I1WA 1BVZA 4UCFA 2JE8A 4UOJA 1MWOA 1W1PA 3T09A 3K8MA 2VZOA 2O9TA 3WUBA 2OWCA 2O9OA 2AOSA 4AXNA 4GI9A 1NM9A 2RGLA 1ODUA 1KXHA 1UD6A 1Z32X 5A2AA 2FH6A 3VNZA 4FK9A 4FLQA 1TG7A 3ECQA 4Q7NA 2WK2A 1E6NA 3WNLA 2WWCA 4YHEA 3POCA 3U7BA 2QMKA 4ATLA 2XVKA 1OIFA 1FA2A 1OGSA 2E4TA 4TVCA 4UNIA 1M03A 1MXGA 2X09A 5KEZA 2ZUTA 5HOSA 2QPUA 3VILA 2Q8XA 3VNYA 2WAGA 2PF0A 4AIUA 1VBUA 5FL1A 3AOFA 2WVTA 3AIBA 2X8RA 2WLZA 4PBGA 2W67A 4DUVA 2GJPA 4CD6A 1SR0A 2BHYA 3ARQA 4F9DA 5DF0A 3PZVA 1UWUA 2ZUNA 2ZX5A 4GZIA 2WBKA 1XH1A 4W5UA 1VEPA 2VX6A 3EDDA 1C8XA 3F5JA 1UWQA 4UFMA 3AQUA 1E0VA 3NYDA 1QNSA 2XIBA 2F8QA 2VR5A 1V0MA 2YDRA 3ARVA 1NQ6A 1UZ1A 1ITXA 1ZBVA 3UG5A 4RL3A 1FOBA 1HL9A 1UKPA 2DH3A 2VJXA 1OWQA 4UQAA 4LQ1A 5A8QA 1CPUA 1J0IA 3CPUA 1ODZA 3A4WA 4CD8A 4U33A 4KRUA 2EPLX 5ABEA 2D20A 2J25A 2BY1A 1V03A 4W8AA 4ACYA 2YIHA 1KR1A 3IJ7A 2JF7A 3FHAA 4URIA 3M07A 2WSKA 1UKTA 2X0HA 5BRQA 3UERA 4D6IA 3CZGA 4AIOA 2VRJA 3WD2A 4UR9A 2DT1A 2FGLA 4U31A 3VINA 3VKKA 2YL9A 3GM8A 3VVGA 5HBFA 3BLPX 2G3IA 4XV0A 3ZR5A 3CMJA 1QBBA 4W7WA 1BG9A 1GVYA 1VJSA 2C7FA 4D6FA 3PZIA 3WF2A 2BFGA 2D0FA 4HZ8A 8A3HA 1VF8A 5C8BB 2J7HA 3OLEA 1IZJA 1FP9A 2VRKA 1WDSA 4GPNA 3U7VA 1QW8A 3VDBA 4AEFA 2UY5A 4JKLA 5IDIA 1UH3A 4E8CA 4OKDA 1BYAA 3VIIA 3UETA 4WKHA 1UYQA 4MJ4A 2VO5A 2WC3A 1UWIA 3ZR6A 1JZ4A 3ZQ9A 4QLJA 1TA3B 2IXUA 4PCTA 4J3WA 3GXFA 1E70M 5E9AA 3TP4A 2C8NA 1EOKA 2CIPA 1LLOA 2EBNA 1GCYA 5HPCA 4E8DA 1W2VA 4MB4A 2WCGA 2CETA 1BHGA 4CCDA 5TD4A 1E6ZA 1AMYA 3VIPA 2DQXA 3N9KA 3VMNA 2OSYA 4F8XA 2E9MA 4U5IA 2YJQA 4UZSA 3L4YA 1XCXA 1HT6A 3ZJ6A 1IT0A 1QHZA 3OLGA 3F4VA 1GOIA 4JFTA 2WPGA 2QHAA 1XD1A 4LXFA 3KZSA 4MTVA 3AZRA 3ARYA 4EK7A 4Z2IA 1B3WA 1H3GA 2FHBA 2VTFA 3WH6A 1W9DM 4FLOA 3KL0A 3K4DA 3PZQA 3MANA 3QHOA 3ZJ7A 4UQBA 2WYSA 3WSUA 4H04A 3DC0A 3BXWA 1UD2A 4J3SA 1MW3A 3T2PA 3OIHA 2CEQA 2ZUWA 4OOZA 1VFFA 1JL8A 4AD3A 4TOQA 1BG4A 1OGGA 2YA0A 2J8FA 1J10A 1R8LA 1B1YA 2E0PA 1IV8A 2YL5A 1DWAM 4U5KA 3DHUA 3OGRA 3EYPA 5ABFB 1SMAA 1UKQA 4HMEA 3SUUA 3UR8A 2PBOA 2W4XA 3VMPA 2GDVA 1CENA 3LPFA 4PSPA 2ZUSA 3NCOA 5AYIA 4Z2HA 1DWIM 3GH7A 1R87A 3POHA 5GNYA 1LL4A 3MUAA 1KCLA 4BA0A 1JYXA 3WMBA 4QCFA 3BMWA 2IXVA 1QW9A 4AZ5A 3PN8A 2XTKA 1QNPA 1ZBKA 1WDQA 3KL5A 5GQBA 4CGTA 7CGTA 3AMCA 3LPPA 5JUVA 2DT3A 1HVXA 1E56A 2OYLA 4UFKA 3CBWA 4L4OA 2OSXA 2WHKA 2VX4A 3EBVA 3W29A 3K4AA 2EPOA 3RMEA 3VD7A 1DWGM 1UQZA 2X0YA 5M03A 3BSHA 5D9MA 2JIWA 4KH2A 2GJXA 2J4GA 3UCQA 4C7GA 3ARSA 2DSZA 1Y7VA 1ZJBA 3I3DA 3WN6A 4XZBA 3B8SA 4CCCA 3DHPA 3WL0A 3TTYA 1PZ3A 1V3HA 2E8ZA 1XH2A 3PTKA 4FF5A 4KWUA 2WHLA 1KFWA 4JKMA 1VRXA 2VI0A 3VD5A 1DHKA 2VMFA 2WCAA 1BVNP 2DPEA 2G3MA 2ZXQA 2E8YA 1K6AA 5CPSA 2XUCA 2EPKX 1MQPA 2NW0A 2XVLA 3WQ4A 4NI3A 4BQ3A 3IAPA 5JIPA 4CN4A 3BAJA 1G94A 3AMGA 3CUGA 4RE4A 3DYMA 1GHSA 2XYLA 3J7HA 1UA3A 1US3A 1GQIA 3CUJA 1KGUA 3WD1A 1V3LA 3AICA 5E6ZA 3VIJA 1BAGA 4PUEA 4BQ4A 1K9FA 4AMCA 1SYTA 1OGBA 1BYDA 1EQCA 4J7RA 2ZUMA 3GNPA 4B3LA 1BQCA 4RE2A 4J3TA 4TVDA 1WZMA 1SFSA 1FFQA 2GK1A 2WMKA 1K9EA 3RDKA 2J7GA 2VCBA 1PX3A 1SMDA 1C7TA 3CH9A 1UG6A 4F66A 2VQTA 1EA9C 1UR9A 5IHRA 1JZ5A 3M46A 3FW6A 3CIVA 3GXMA 5CSUA 3RJYA 2RGMA 1VENA 1YQ2A 1W9UA 2GUYA 3VX0A 4XUYA 1CXKA 4PMOA 2YBTA 1JD9A 2NSXA 4W88A 5CSYA 7A3HA 2DSWA 2OWWA 1HJXA 3VTRA 3W27A 2QF8A 5DT7A 3N17A 3GXIA 1E0WA 2J77A 4NRSA 1HKMA 1GNXA 1UKSA 1JZ8A 2EXOA 1HL8A 1TE1A 1V02A 1E43A 2BVTA 1XSKA 4AZ6A 1ESWA 1W32A 4M24A 4U3AA 1W1VA 4MDOA 4X0NA 4DUWA 3RCNA 2ZUUA 3WDIA 5D9NA 3WF0A 4CUCA 1E73M 1XYZA 5CLWA 3WL1A 1J0YA 4CU6A 5IXEA 3AMLA 1JD7A 1R85A 4QAWA 3GDBA 5A6SA 1GUVA 4MNMA 1TVPA 4A3YA 1MQQA 3NDYA 3RM9A 3SCVA 1E4NA 2UY3A 3OGVA 1B2YA 2E9BA 4CKQA 1LF1A 4AC1X 1QI4A 1GOWA 1BTCA 2VNCA 4PMDA 1JZ7A 4WJXA 1VEOA 3BSGA 5F7UA 3GXDA 1PJ9A 5LA1A 2WMJA 4W7UA 1MQRA 3MS8A 2J7CA 2WWDA 4B15A 5IHSA 3BAIA 3VIHA 2D3LA 3VGGA 3SUWA 1X6NA 1GOQA 1V6XA 4JL2A 5JBDA 2J74A 2IUZA 4J3VA 3MV11 3N15A 5D8ZA 3CUHA 1GJUA 1LL6A 1QOXA 1WZAA 3ZMRA 4W85A 2J7FA 1ZBWA 4ZXOA 1JFXA 1OD0A 1KGWA 1UR4A 2XFYA 4MNJA 3ALGA 3O6AA 5FOOA 4OBRA 3U57A 4D6JA 3WD4A 1MW1A 1ISYA 4D71A 4B9ZA 2CESA 1D7FA 5CLTA 2XM1A 2WKLA 3TTQA 1NWTA 4MB3A 1LQ0A 1HKKA 1PX8A 2G8ZA 1QPKA 3SCRA 1NOWA 1ECEA 2W63A 2W61A 4ZFMA 4MDPA 2G4FA 3DYOA 5D8WA 2YOCA 1H0GA 2JFEX 3BAYA 4JIEA 3LPOA 1A3HA 4M80A 1K9DA 3WQWA 1E5NA 1KWKA 3ARUA 2ZIDA 4FLSA 5D9OA 1NWSA 2ESCA 4KGLA 5I5RA 1QI3A 2EJ1A 3VDAA 3D5HA 1M7XA 3CHFA 1V3MA 3HU7A 3L4VA 4GXPA 2WZEA 5DFAA 3SCQA 3A4AA 1JZ6A 5A1AA 4W5ZA 2ZXDA 2WSPA 2ZX9A 3NUKA 4IPNB 2XIIA 2EQDA 5BXSA 1XV8A 3AXXA 3GBDA 3PZTA 1UD4A 1HF6A 3WD3A 1ISVA 2JIEA 3AS3A 4DWSC 1LWHA 1NOFA 1Q6GA 4M56A 1WO2A 4DWSD 1F4AA 4W89A 1VFUA 2WANA 3ARTA 2WVVA 4W87A 1XH0A 1OT2A 4ATWA 1ZBCA 1WNOA 3OGSA 1GVIA 4TTGA 4GIAA 4JAWA 4J27A 4U2YA 4AYSA 1B3XA 4H2CA 1UD5A 2PI6A 5LA0A 4AZGA 2UY2A 2CPUA 1R7AA 1E6RA 2WMIB 3AYRA 1P6WA 1UD8A 2OYMA 1K9TA 2D2OA 2WZIA 3BGAA 1J0JA 1BSIA 4D72A 1VIWA 4PMVA 3T2QA 1FP8A 1LL7A 1QI2A 2Y8VA 3EMQA 1KGXA 4PRWA 1C91A 3JUGA 4IISA 4LYRA 5GNZA 2F61A 2W92A 3VIGA 4AZHA 4CU7A 1MXDA 2XGIA 4MADA 2A3BA 3W24A 1JYWA 1C8YA 3GZAA 2DT0A 3AIRA 2CCRA 4PMRA 3ZT6A 4JCLA 2D22A 3A6OA 2BY0A 3W82A 5GNXA 3WY1A 1H0IA 1UHVA 3NSNA 1W91A 5IFPA 1W3HA 1HJWA 3BCFA 4IM4A 1E6PA 3WUGA 4ZE5A 3WQ6A 2XVNA 3W25A 3WQVA 2HISA 2BHZA 3WNKA 4FMVA 2V3FA 3QR3A 4ZEPA 1CGWA 3FXYA 3GH5A 4QCEA 1JG9A 1RPKA 1UWRA 1J18A 1E0XA 1VJZA 4GZEA 1XRVA 3AHXA 1Q6DA 2CXGA 1JYVA 2VZSA 1JFHA 2CHNA 2W62A 3MKKA 2X1IA 1HKJA 3W6LA 2PWFA 4DUXA 3WIJA 1Q6EA 3AIQA 4JFUA 2G3NA 3VDCA 4BQ5A 3THDA 1YHTA 5IFTA 1CGVA 2GFTA 4W86A 2WMFA 1CECA 1E9LA 3M7SA 4H41A 4PTXA 2Z1SA 5LA2A 3L4UA 1ZL1A 5EFFA 4HU0A 3AIEA 2WC4A 1UR0A 4HPHA 5A8PA 2O9RA 1LG2A 3WMCA 4LYQA 4GZJA 2HVMA 2YDSA 1XYFA 5A94A 1EOMA 4P8XA 1CXIA 2XFFA 1HNYA 2DSUA 3OLIA 1EXPA 4AZCB 3O2LA 6A3HA 3VM5A 3VD9A 1TUXA 4E2OA 3VGEA 2YA1A 3VPLA 4LYPA 2W91A 3CZJA 1EHAA 4PUDA 1CXLA 1XSIA 1JZ3A 1ITCA 1OT1A 2XM2A 1B3YA 3VGHA 3WDRA 3KE0A 1G1YA 1ZB5A 3WBEA 2WHJA 2GK1B 1G0CA 5BRPA 2WNWA 3SEPA 2VCCA 4MAVA 3SCOA 4AD0A 2BV9A 3VM7A 2ZX6A 4MNLA 1EDQA 4PSRA 2PWHA 2TAAA 1O7AA 3SCUA 3HJEA 1NARA 3AHTA 5CXPA 3GBEA 3TA9A 3VGBA 4GQQA 1V6VA 3U5UA 3W26A 3VO0A 1HJUA 1HP4A 3WH7A 2ZXAA 4N0RA 3B9AA 4EAMA 2QLYA 1W3JA 2ZWYA 2WKGA 1MYRA 3F5KA 1JI2A 1QNOA 2XPKA 3VD3A 2OLHA 1JGIA 4DWSA 3RJXA 5EBAA 1R7OA 4AD2A 3QOKA 4ZXLA 1B3ZA 3O9NA 4YPJA 3VIMA 5ABFA 3WF4A 5AYBA 1BPLB 1CEOA 5JBFA 1X6LA 3RM4A 1NP0A 5JIWA 5BROA 1GORA 4TX6A 1E6XM 3WFLA 3LPGA 3THCA 3SCNA 4ACZA 3ARPA 3ARWA 3AS0A 2BHUA 3W6MA 3E1F1 1ISZA 3UESA 5AY7A 3BAWA 2GJXB 3B9EA 5FCZA 3EMZA 3WKZA 4OUEA 3BMVA 3WMSA 3NDZA 2XGBA 3MSGA 4CN1A 4UFHA 1UQYA 3SUTA 3IANA 4UZUA 5E0FA 2EPMX 1ZJAA 2WZHA 4TUFA 1UR8A 5FKYA 3QOMA 4S3JA 4D6GA 3RPMA 2AMGA 1OBAA 1EDGA 3WDHA 2DGAA 5I3DA 3W37A 1PIGA 4HPGA 2WM0A 4OBSA 1OD8A 4JKKA 3N1AA 3G6MA 4Z2KA 2WW5A 5I78A 1GOMA 4H8VA 1JAKA 2Y24A 1DTUA 1FH8A 2VC9A 1B31A 1JIBA 1GJWA 1CGTA 1UH4A 1LWJA 4R27A 1FHDA 2QMJA 2ZWZA 5DMYA
chains in the Genus database with same CATH superfamily
1MFUA 3N4FA 3UYIA 3MP5A 2B31A 1QWGA 3CHCA 1KLYA 3OP2A 1UZ4A 3CQHA 4O11A 3LS9A 3F03K 4GI6A 4KETA 3TYDA 3L9CA 4ZENA 2H3BA 1F76A 1R2RA 3FNDA 1LUCA 2VP8A 4CN6A 4QGCA 3VKAA 1CW2A 1Q6FA 4LGXA 3L4TA 5DO8A 4D8AA 2BVDA 1NVMA 4AB4A 4WOZA 3UZXA 5ABGA 2DZVA 4UIOA 1OZQA 5F2IA 3G8RA 3UJFA 4HU8A 4EXBA 2R1LA 3I10A 2ZZ3A 5CZJA 4PULA 3NXLA 4MNKA 1ZAIA 5I23A 1PIIA 3CAKA 4W9TA 3CWOX 4CVUA 3PBGA 3WNPA 3LMYA 4XX6A 4AD4A 5AC4A 5K2ZA 3BICA 4LY4A 3TONA 1Z69A 2DUXA 5HMSA 1QCWA 4NZCA 1B0IA 3UXLA 3MUCA 5JBEA 1YEYA 3WD0A 4PMZA 4AHPA 3ZO9A 3UVIA 1W3KA 5TAOA 4I7WA 3L2MA 2E25A 3MW7A 3T6CA 3I65A 1EP1A 2XJ7A 4BJHA 1M7JA 4B2DA 4FNTA 3BTNA 4C1KA 1W5OA 4LNCA 4V27A 2NX1A 4HZ7A 2Z26A 5A8MA 2Z2AA 4RNJA 5LZLA 3EPMA 4JTGA 3QZEA 2J75A 1PTGA 1MUWA 2CBJA 5CBBA 3CV1A 5G2HA 1FQ0A 1B9ZA 3BURA 4X61A 3S9IA 3W6YA 1FCQA 1KKRA 2J7EA 1XQLA 2P76A 3VZZA 2NV9A 3SSJA 4EAYA 2VDHA 3S46A 3OZPA 3MHGA 1EJRC 3ME3A 3U9IA 1WKYA 2D3NA 4LFYA 1M53A 3RN6A 3T9PA 5C55A 3XISA 4WIWA 4BQ2A 1AH4A 1EX5A 2D24A 1W1TA 2Y70A 3FY1A 4OIFA 3CLMA 4F0KA 2KZHA 3WH8A 5A6BA 1BFNA 1MUMA 1XIDA 2Y5JA 5ABHA 1AZ1A 3N13A 3SCWA 3RG6A 4O50A 2VFGA 4KMQA 2V5DA 4IGNA 2YDAA 4R3UA 5EKYA 4PUJA 4V2XA 1MNZA 3R0DA 4L4PA 4FNSA 4PCPA 4GCXA 4OVXA 2Y8UA 3D3FA 4N6EA 1R3YA 4FZIA 4UTWA 1AVAA 4UOQA 1YLVA 4LAZA 1Q6OA 3LBCA 5LXEA 4I9TA 1FH7A 2XVGA 4PCNA 5FEXA 1W3LA 3OIXA 1OC6A 4HA4A 1Z48A 5AN7A 1X7IA 2R24A 1U1JA 3KCLA 4QHRA 4MFEA 3I3BA 1KBKA 2HK1A 4WEVX 1YIXA 2E6FA 3T7VA 4B4FA 3W2LA 1H7PA 3WQ8A 3PZNA 4RDWA 3TSDA 1CZ1A 4HJFA 5D04C 1C8QA 3HQOA 2YCLA 4LVDA 1EPVA 7XIMA 1KB3A 3N2CA 3I3EA 1WUEA 1B30A 1H41A 5C9RA 3T42A 3CL7A 1J93A 5HJXA 3VDHA 3DERA 3B8UA 1VFLA 3TC6A 3TDFA 3STFA 3F4NA 2PWVA 1ZJIA 3NQMA 3G3DA 4K37A 3GTNA 1EJVC 1JPDX 4W8LA 1XC6A 1TPFA 1WOBA 1E1EA 3UWEA 3LXCA 3FCPA 3WF3A 3GD6A 1CXEA 1JDEA 2FHCA 1OF8A 1W9VA 4Q6JA 2EPNA 1IEXA 3IARA 1SZEA 1U1HA 3H2CA 4BKNA 3CIWA 2YW3A 3G24A 2ATSA 1H4PA 3TTEA 3HMCA 3RK8A 2DZPA 1YRRA 4H2HA 1JUEA 3KL3A 4PCFA 1DWFM 3MTWA 3WJWA 1PZ2A 4OECA 4W7VA 3ZSTA 1VRDA 2VM8A 1TKKA 1R6WA 1ADSA 3LEPA 4MLJA 4LALA 4OBTA 1QNVA 2PWGA 3FS2A 1O5RA 2PE4A 2PDQA 4I7UA 4B5VA 4WHBA 3SN0A 3MUZ1 1C29A 1E9YB 2WLYA 2J6VA 4ZZ9A 4HSNA 4YLWA 4IL0A 1UWSA 1Q66A 2C71A 3B3DA 4UXDA 4Q22A 3BOFA 2EG6A 1A53A 3SGUA 1TPH1 3BW3A 2BG5A 4LS1A 1S5WA 1L6FA 3UWWA 1TTQA 1QJWA 1RD6A 5L9FA 4CU8A 4DO5A 1EFZA 4WSJA 4C6LA 2V5JA 5SWUA 1MUCA 2RDUA 3MB9A 1AQ0A 4N9CA 2VDIA 3VU2A 3BLIA 4TV6A 1BWKA 1OFPA 3T0CA 4TXEA 1E6SM 1NDWA 1VC4A 4BI5A 3A64A 2W66A 4AIBA 4CQ9A 1P0KA 4A35A 1BF2A 4GYJA 1UW9A 1O5KA 2UY4A 3QW4B 4JNMA 3QTGA 2XFRA 1JF6A 3JZEA 3N04A 4MZ1A 2ABAA 2ASHA 3AIVA 1SO3A 3UA3A 4JICA 2X41A 2GSHA 3H2NA 5FIPA 3VOGA 2WSRA 1GONA 2YB4A 1V3IA 4WDTA 3T8LA 3ITLA 2Z2UA 1E3ZA 3FJNA 1F6PA 5EGRA 1EYWA 1GVOA 1PPIA 4QFUA 3TX9A 1HG3A 1X1NA 3S2LA 1TPEA 1US2A 1WAUA 4GBDA 3K46A 4E5TA 4AZ7A 4LUTA 3WEZA 4KCTA 3MSYA 2B81A 4FNRA 5HNTA 3BCJA 1O6IA 1K8XA 1XHGA 4O15A 1XI3A 1I6NA 4XO7A 2H90A 1OG0A 2W27A 2CLHA 1KQYA 3DC8A 1DTNA 5BOFA 3T1GA 4N4PA 3L0NA 7TAAA 2QUTA 5DCBA 5AC5A 4MUZA 3WUFA 3WX7A 1LORA 4EVZA 4UWMA 3TVAA 1M04A 2B7PA 3UJRA 4ERIA 3CZKA 4JHZA 4RX0A 2OEMA 3AYVA 1XRFA 2QAFA 3M5ZA 3SQMA 3DECA 2PC4A 4XAYA 3S1XA 1E4MM 1BGAA 4FLRA 3BG9A 2CBUA 1IWBA 1MFVA 4PR4A 5KZ6A 2DZXA 2Z0IA 4B2DD 1KKOA 1DIKA 3I4KA 1JPIA 5HUPA 3PAOA 3UZZA 2WZTA 4K8EA 1VHNA 1JDDA 4ACZB 4CD7A 5LGZA 5A6BD 1PEZA 1F3XA 2V3EA 3PVFA 1A3WA 3IIVA 4PRTA 2Z1XA 3G22A 4IH3A 1WBHA 4LSBA 4MAZA 5E6YA 2TPSA 2QR6A 5IBXA 5C70A 1NFGA 2OSWA 3GKAA 3NNTA 5EMYA 3BAKA 3RM8A 5FAJA 3MCOA 1RLDA 1ONEA 3IK2A 4JTDA 3VIFA 5KITA 1D2KA 1EGZA 3DFOA 1CI1A 3ORWA 2ALRA 1MNSA 4BK9A 2Y0FA 4KWSA 3U2OA 1CYGA 5REQB 1EBHA 1QNRA 1S38A 1ZQ5A 5DQPA 3B4UA 3O6CA 3R4IA 3QRHA 1HW6A 1J0HA 1GVSA 3TZFA 1CT5A 4V28A 3JR2A 1EEPA 1CGUA 3ABZA 4ZTYA 3TW6A 4I6KA 1MW0A 5H8PA 2Z25A 2GVGA 4UTTA 1XW8A 5I3FA 3RO8A 4WUIA 2ZUVA 4O18A 2H6RA 3RLGA 3VOJA 4DJEC 3LLDA 4PEEA 4QDMA 1H7OA 2QUUA 2J7DA 3U6WA 3DFPA 3L2IA 4PC8A 5M17A 3H53A 4BI7A 4Q33A 4CCEA 2XH4A 2FJKA 1CLVA 2V2HA 1CWYA 3N9RA 4Z17A 1YBQA 4GQRA 3BCDA 2E7FA 4DJDA 3M0YA 2BY3A 4D6HA 3KM8A 1B5TA 3B9DA 2P50A 1I2QA 7TIMA 3WQEA 1VAHA 2B7NA 2YBVA 3S1GA 4PODA 3U2EA 3C0QA 3WDQA 3AU6A 5HNRA 5H8UA 1UIOA 3FAXA 4LTSA 1MMFA 4HCLA 3L7RA 2GJRA 2WVVB 3SURA 1PIFA 4HNOA 3CQ0A 5CAKA 4Y90A 3WJZA 3W81A 3W7KA 1DPMA 1PKNA 5EA9A 3PBUA 3WF1A 4UTKA 3FGCA 3KRUA 4IMFA 2INEA 2X1UA 1HO4A 1JR1A 3CWHA 3TA6A 4BR1A 1D7KA 4M82A 4GNJA 3ITVA 2MANA 5C9WA 5BYWA 1KM5A 3NQ2A 1F6YA 2J62A 4HSHA 2CYGA 3ZSSA 2XN2A 3SI9A 5JXQA 1OQFA 1E1CB 3NEHA 3RLVA 5M5DA 4ROQA 3ES8A 1TJ2A 4K68A 1EHNA 2FLIA 3GNOA 3NQVA 1ME8A 2J6XA 5LNRA 1Q6LA 4J3XA 1CGXA 3ZLGA 4DPPA 1HP5A 3KDOA 3OQ8A 3FJLA 4V33A 1HJVA 3NDOA 3COTA 2DH2A 4DPQA 3GU1A 3DGBA 3L0KA 3RYSA 3CUIA 4XD4A 1EXBA 3VDGA 4GYPA 3RHGA 3C0SA 2JEPA 3GYCA 1H5YA 3LCXA 2GLKA 3B8VA 1SO6A 3R8RA 3VZXA 4QXIA 2PDCA 1AA1B 3VYLA 1EP2A 1FWDC 3CZLA 4P8VA 1NF0A 5D38A 2NT1A 4DM2A 4RLIA 2POZA 5H8MA 2VCAA 3F2DA 4L1GA 3MJMA 1YXYA 3EDJA 1TV7A 3E74A 4JN7A 1XIBA 4HZ6A 4XAFA 2NZLA 1E40A 2O4QA 4J28A 2A3EA 2PGEA 1F5ZA 3UZWA 1K3UA 3ENLA 3TN3A 1A5UA 2D0GA 4A8NA 2J7BA 3LGDA 3W75A 1BVZA 4XBJA 3LX9A 3RPDA 3K8MA 2IMRA 4AXNA 4GI9A 1ODUA 1UD6A 2RGLA 1KXHA 1EUAA 2PCQA 4DBDA 3WQPA 3UNDA 1UC4A 3CO8A 3OYXA 3ECQA 4HBKA 2RH9A 3E2SA 2NXGA 1RCOB 4YHEA 4IT1A 5DMNA 3B0YA 1FA2A 1XLHA 4B90A 4AWTA 1M03A 3CT7A 4CQDA 3MCMA 3RRAA 3PUDA 5AC8A 2QPUA 5E1QA 3FSTA 1IE7C 5FL1A 4RZ4A 4N9BA 1IEIA 3BZJA 4PBGA 2PDXA 3AALA 5F2MA 2OOGA 1TTJA 4PTDA 2BHYA 5DF0A 5CC5A 2ZX5A 3HGRA 2JKAA 2WBKA 3E0WA 3ITCA 2ZYFA 3LTSA 3BG5A 4MWAA 1VEPA 2VX6A 3VOIA 3EDDA 4GIYA 2BP1A 1QNSA 2XIBA 2F8QA 3REQA 2R8WA 5BWAA 3MWCA 1ME7A 1V0MA 2YDRA 4BFAA 1ZBVA 4EPDC 4M6QA 4O8AA 2DH3A 4WJ8A 2PTXA 5DLCA 4ML9A 4UQAA 5A8QA 1CPUA 1J0IA 5FF0A 4FIQA 2FDSA 2V81A 4U33A 2JQXA 3VAVA 1LLWA 4C6FA 2QJHA 3EA1A 3IJ7A 3OTRA 3C0JA 4URIA 4IQEA 5KINA 2WSKA 4XG1A 5CPNA 2PDNA 2GQAA 4AIOA 3GFZA 3WD2A 4UR9A 3FKKA 3VINA 3B40A 3WBWA 1LDCA 1P5BA 3HTWA 4XV0A 1KBJA 1QBBA 1BG9A 1ZPTA 1IXNA 3W1TA 1GVYA 3QSTA 2C7FA 3TNBA 3PZIA 3WF2A 1VF8A 3QV9A 3AAMA 2J7HA 1IZJA 1FP9A 3EGJA 2VRKA 1OX4B 3LGEA 5IDIA 2R94A 1WXZA 4KFOA 1FXQA 1UYQA 3LB0A 3Q94A 2I1OA 2G5WA 1EA0A 1UWIA 4KCUA 3ZQ9A 1TA3B 4PCTA 1I9CB 2QCEA 1PKMA 3FDGA 4RDZA 3URQA 3U3HA 1O66A 3BK0A 1REQA 1LLOA 4L6DA 2G96A 4E8DA 4MJZA 3H4WA 2WCGA 2CETA 4DZIA 5TD4A 4GUHA 3NQAA 4O0KA 3WK0A 2ZRYA 4MM1A 3N9KA 3K13A 3UVAA 1Q7MA 4A2RA 2E9MA 4U5IA 3F4DA 2YJQA 3L4YA 1XCXA 1LT7A 4GGBA 1IT0A 2A7RA 3MHFA 1QHZA 5EMLA 2PZ0A 2WPGA 4LXFA 3KZSA 5BZAA 1IF2A 4Z2IA 2FHBA 2R14A 3SRHA 3KL0A 3K4DA 3CQKA 3W2MA 3DC0A 4J3SA 4G7EB 1MW3A 5AHFA 3EKLA 4DF0A 1BG4A 2HS8A 4E4UA 1B57A 1OGGA 4DEFA 1J10A 1DIDA 1A3XA 1B1YA 1R8LA 1IV8A 3GNNA 3USZA 3OGRA 1XBVA 2OLAA 5KETA 3ATZA 3RAOA 1TMLA 1SMAA 1UKQA 3LRMA 4I5RA 3IGXA 2PBOA 2P3EA 2GDVA 3DCPA 3LPFA 3IGSA 4HNTA 1HGYA 2C91A 4FA3A 2IXVA 3HPXA 3PN8A 1WDDA 3KL5A 1QNPA 1Q6QA 1Q13A 3MUXA 5FF4A 7CGTA 3IIXA 5GJNA 3UCCA 3CPRA 3V5FA 2EGZA 3LZ5A 3LCFA 3R2GA 3ITXA 2I9UA 2WJZA 3O6YX 2EPOA 1YADA 3RMEA 4AWUA 1Y8BA 3P3BA 4WSHA 2R9RA 1JCXA 4GG9A 4UTLA 5M03A 3UCQA 1M5WA 4QDWA 2GQ9A 1T7LA 2X7WA 4RW3A 5AYXA 3V0UA 3A5VA 4XZBA 1R3TA 4MY9A 4R7WA 3TTYA 2WHLA 4ICMA 2GVJA 1KM3A 2MUCA 1VRXA 4WGXA 3T78A 1VYSX 3VD5A 1DHKA 3QLLA 4JTIA 2DPEA 5FJOA 4TR9A 2E8YA 1XJBA 3WQ4A 4NI3A 3IAPA 4IMCA 5JIPA 3O63A 2NQJA 1T99A 3CUGA 3QLDA 1B54A 4H01A 2XYLA 4EOUA 1UA3A 3CUJA 4UR7A 3WD1A 4JIIX 1XG4A 2C15A 5HMEA 1BAGA 1BYDA 1EQCA 1VFSA 4V1YA 5EU9A 4TVDA 5AC7A 1DJXA 2FTPA 2O55A 2GK1A 2WMKA 2QDGA 3L5MA 3RR4A 5FSDC 1RD5A 4HMNA 1PX3A 1C7TA 3BOLA 3ITGA 3GDTA 1NAL1 1UR9A 3QPEA 2I16A 3P84A 1ZUAX 4MKSA 4DAIA 3M46A 3GXMA 1US0A 1WKDA 3IUHA 5LNUA 3T40A 1W9UA 4ZR8A 3W7MA 4I5UA 1CXKA 4L6OA 1GG0A 3DFSA 2A5HA 1XIGA 1FWJC 1JD9A 1IQ8A 4W88A 3N2OA 4X3ZA 2DSWA 5CSYA 4Q8MA 1VBJA 4ORIA 3GXIA 1QW7A 2NV2A 1HKMA 3OPSA 1JZ8A 2EXOA 3RCMA 3C8FA 3NPUA 1E43A 4PBEA 4MDOA 4X0NA 3DXIA 3RCNA 2ZUUA 3CMFA 3S5YA 4CQ8A 5K9CA 5CG7A 4CUCA 4XKYB 1XYZA 3WL1A 1ZGDA 3NM1A 5I3IA 4AX6A 1V7YA 4C6OA 4AYGA 1TYGA 1XQKA 3RM9A 1RQBA 1DJGA 1JCLA 1KFBA 1FDZA 4AC1X 4KEVA 1EC7A 2CLKA 4DBSA 1UASA 1GOWA 1S2WA 4JTKA 4Q6XA 3T81A 3OHIA 3WLNA 1KFKA 2PDIA 4IICA 1JZ7A 4JQAA 2Y85A 1SJAA 3QFEA 4EIVA 4BEQA 1GOXA 3HGJA 5LA1A 1V7AA 1LBMA 1MQRA 1XYLA 4S3BA 5F4WA 4KWOA 4AY7A 3NPXA 4GFSA 1GOQA 1GK8A 1I60A 3N15A 3MV11 5D8ZA 3MPGA 5BOEA 1GJUA 1LL6A 1QOXA 3ZMRA 1ZBWA 4K3ZA 5FF3A 1RA5A 3ABSA 1JFXA 1MEHA 2QVNA 1OD0A 2BTMA 2HE5A 3LOTA 1XC4A 4NZ1A 2C0AA 2FQIA 5FOOA 3URAA 3U57A 4D6JA 5G1MA 3WD4A 2OB3A 1VR6A 3IGHX 3PJWA 1D7FA 2DIKA 3EA3A 3EWZA 1OCBA 4LOCA 3BANA 4GY1A 1HKKA 1PX8A 4E38A 2G8ZA 3NM3A 1QPKA 5DRIA 1ECEA 3N2BA 1OFOA 1FX6A 1KTCA 1M1BA 3BDKA 5DBUA 2YOCA 1NDYA 5FEPA 3BAYA 4JIEA 1TV8A 1T96A 1KFCA 3LPOA 2F38A 3NZ1A 1VFHA 1E5NA 1BRLA 5TQLA 1ZP3A 3FIGA 2X16A 4IOTA 4WR3A 3THQA 5I5RA 3RUBL 1AW2A 3M0MA 3SCQA 5A1AA 2INFA 4PGLA 4ZMGA 3KW3A 2Y5SA 2DV0A 4LVGA 4XAGA 5KZEA 2EQDA 4DJFA 4S3CA 4BF5A 2C13A 3PZTA 3EPOA 1LOQA 1HF6A 3WD3A 3H2FA 5DCDA 4DWSC 1LWHA 4J5NA 1Q6GA 3HPZA 4XD6A 2IW0A 3R12A 5HWJA 1FTXA 4O52A 4F0SA 4LUSB 4AHQA 1VFUA 1R3QA 2WKJA 3BV4A 4K8GA 2WANA 4W87A 3GAKA 4LV9A 1ICSA 6XIMA 1ZBCA 1WNOA 3F2BA 2DJXA 3UGRA 2FYMA 1GVIA 4IIBA 1EIXA 4U2YA 1FRBA 1HGWA 1KA9F 5LA0A 2RKXA 1U5JA 2CPUA 1E6RA 2WMIB 3AYRA 1DJQA 1UD8A 2D2OA 3T2QA 1FP8A 4A21A 2ON3A 1YNYA 1KGXA 4GH1A 4I8YA 2GPTA 3JUGA 3QQ1A 2I7GA 2VGGA 4LYRA 3GVQA 1WUFA 3V1PA 4Q8QA 1SJDA 1UPPA 2W92A 4H9UA 3VIGA 2P1FA 1NJJA 5KTLA 2HROA 3GZAA 3E0IA 3AUJA 3AIRA 5TF0A 4O53A 4JCLA 1F3TA 2E5BA 1K7XA 1XPGA 3W82A 3M44A 1H0IA 3ES7A 1JUKA 3WLHA 1RJQA 1XLCA 3W2KA 4H7CA 4AC7C 4IM4A 4H9XA 5B7ZA 2XVNA 2D73A 1QAPA 3V4BA 2VEMA 3QR3A 4ZEPA 3GH5A 4YIWA 4MG4A 1JG9A 2GGEA 3P2VA 1RPKA 1E0XA 4B5NA 1XRVA 3AHXA 1Q6DA 2CXGA 1JYVA 3R10A 2VZSA 1JFHA 4KQNA 2CHNA 1HKJA 4MPQA 2OQHA 4XD5A 4M6PA 4JXCA 5LNSA 5HINA 5AVNA 3OVQA 4A29A 2WMFA 2C1GA 4GYPC 5D03A 3M7SA 2VEGA 1BD0A 4H41A 1EF3A 1G6CA 2PPGA 5CSSA 3EA2A 1T0OA 4NHVA 1GYLA 5EFFA 3WJXA 3AIEA 1XG3A 3PB0A 2O9RA 5CGQA 4X60A 4LYQA 5E0KA 3VK5A 5CC3A 2QULA 1SZNA 1WKFA 3ITTA 1RBOB 4E2OA 4CEXC 2W91A 1Q5MA 2QCLA 4PUMA 3S5ZA 5BOOA 3HJZA 2QGHA 3KE0A 4MWAD 1ZB5A 1OFDA 2WHJA 1VPQA 3VKJA 1QFEA 3L0GA 3SEPA 3SCOA 4MYXA 3VM7A 2FPYA 4ZOAA 1WOAA 1NARA 4UCGA 3GBEA 3LNPA 3W83A 1X8CA 3E6EA 4ONVA 1V6VA 3U5UA 3W26A 1HP4A 3WCZA 5EPDA 2ZXAA 2V8ZA 4N0RA 4HNNA 3VC6A 4UB9A 3FFSA 2QLYA 1W3JA 2ZWYA 2YCKX 3GXTA 4XO6A 4DVOA 4LUSA 1W37A 2OLHA 1JGIA 5HQMA 3RJXA 1R7OA 3R13A 3OVPA 3LHZA 4AD2A 3SRKA 5AHMA 5AFDA 4ZXLA 1ZAJA 1B3ZA 3H23A 4FB7A 1DHPA 4OGZA 2FTYA 1Q8JA 3TFXA 4O57A 3VABA 5BROA 4WRHA 1GORA 4J1OA 4TX6A 3GRIA 1E6XM 1WKEA 4JQ4A 3HPAA 3WLSA 3M0XA 3W6MA 4DJDC 4GKTA 2IKIA 4Z08A 1OHLA 3BAWA 5FCZA 3WKZA 4OUEA 1BRLB 5EY5A 3W1PA 4QX4A 4DIAA 1W3IA 3FA3A 2HPMA 1GKQA 3IANA 4XZLX 4JX4A 2BOFX 4TUFA 1UR8A 2AMGA 3WDHA 3ZXWA 3V1HA 2DORA 5G2IA 1VCFA 2WM0A 2P10A 3VNIA 4UC5A 3P7YA 4LC8A 5C6MA 4Z2KA 4H8VA 1XLKA 3BE7A 1B31A 4BEUA 3ATYA 3INPA 2BDQA 3E9AA 4ICNA 2OG9A 5DMYA 2HDJA 3EX6A 2E6AA 1ZS2A 1LTDA 2PWEA 3UWQA 1DJYA 4I3GA 3F2CA 3BG3A 4PH6A 1KCZA 1DWHM 5E70A 3H54A 2A3AA 4YYCA 3GG1A 1P0EA 3VC5A 3M0ZA 3LXAA 1HN1A 5CEWA 4N42A 3TJLA 4D8ZA 3AS2A 3PG8A 1IHIA 3W1QA 3CWNA 2JBMA 4NJKA 4NU7A 5F2GA 1Q45A 3N18A 1JNDA 1VGAA 1KM0A 4O14A 2ISDA 1UOKA 1TCMA 3T0AA 4DYJA 4IMAA 5GVJA 1DJZA 4FNUA 3ARRA 4UQCA 2G41A 3MV01 2E40A 1H1NA 2YGYA 3EDKA 3S6TA 2V82A 1QBAA 5FF2A 2FVLA 3HZ3A 4L9XA 5C71A 2QPSA 2NWRA 4X9SA 2OTDA 2WV8A 3H12A 4JS3A 3VKBA 3O06A 5ECUA 4X2PA 1Q6RA 4C1NA 4POCA 1TO3A 3LMZA 4ZQCA 4IL2A 2VEKA 4XTIA 2DZWA 3NZGA 2WVSA 4MZYA 4HYVA 1UH2A 5I3JA 2R6OA 3GVVA 4P7LA 1W1A1 2CHRA 3HFTA 3R6IA 3SBFA 3MCNA 4LUIA 3V3WA 2QJJA 1TVLA 3CHEA 4GO9A 1NH6A 5C9UA 5CC6A 4KEZA 4HYRA 1FHLA 1YE6A 3AU2A 2P5NA 1E4IA 4YTTA 4ML4A 1P0DA 1YNPA 1WP6A 3H2MA 4X9YA 1NWRA 2Y5EA 5EMKA 4PTVA 3QHMA 2CERA 3B8IA 1RK6A 5FL0A 3L2LA 1WCGA 1A47A 2PWDA 3SFKA 4R7JA 1OK6A 4DO6A 3IRDA 3MQTA 3QGVA 3HG5A 2DSKA 1OSEA 4B3KA 4PTWA 1U30A 1S5MA 3WQ5A 5A8NA 2OQYA 1D3GA 1H49A 1QNQA 2ZOXA 1AMKA 4HQVA 2VEPA 3D3AA 3W7JA 3FVDA 3NL6A 1J96A 1E0UA 1JNEA 3A3WA 1UWTA 4UTWC 1P6BA 1NEYA 3MO4A 4P8WA 4L9ZA 1GTEA 5K9DA 1CX9A 3H22A 1JCYA 1UD3A 1KXQA 2X2YA 1H7XA 1DIOA 4NJGA 4X0VA 2ZADA 3GVGA 2ZZ5A 3E38A 4XK2A 2WNZA 5D2YA 4CQAA 5CPTA 1GQLA 2QJMA 1Z3NA 1CIUA 3SIMA 1XIIA 4LBUA 1H11A 2ZE0A 4L61A 2DJLA 2HV5A 4PCSA 5ENLA 3CV6A 1K77A 1AW1A 1B3VA 4XAPA 3ALFA 4YVVA 1TPWA 3RCYA 3HURA 3CTTA 3WUEA 5JH1A 4D6EA 1RH9A 2YZRA 3LBMA 3IV8A 5XINA 4TVUA 3W7OA 4PYSA 5TIMA 3ZS4A 3GS6A 4XVEA 3VCCA 3QC0A 1EP3A 3VOCA 3JRKA 1QHPA 4M7SA 4EXQA 1SUXA 1OJXA 1KV5A 1OCNA 1ADOA 3CC1A 4X63A 3VMOA 4P7QA 4HNCA 1HO1A 2Y7FA 3AIWA 1L8NA 2VFIA 1QHOA 1RPXA 2B4GA 3GQYA 1GKRA 2AMXA 4M8UA 2F6XA 1LOSA 4HP5A 4HU3A 1V0LA 2AAMA 2ZDRA 4HA1A 2O7SA 4CD4A 2ZCGA 6TAAA 3W1AA 1IEWA 3RX3A 5D02A 2QUNA 2FDMA 4GUIA 1O4UA 4R53A 4YVPA 1RQHA 2WNQA 2XSAA 4KIRA 3O0KA 4RDYA 2G37A 1M01A 3N4EA 3RILA 2I9EA 1PAMA 2YSWA 4Z1CA 1ZU8A 1S5VA 1KQZA 3BW2A 1TQJA 4LAKA 1VYPX 3VA8A 2DVUA 1IR2A 4J35A 5CPLA 3UG8A 1QWKA 4IMGA 2PODA 4GCAA 2Z1KA 3JZUA 3GH4A 1MXSA 1P43A 1FFRA 1YNQA 4X22A 4B16A 5EMJA 1TJ1A 3STPA 1VPXA 1FWIC 5B7YA 5J5RA 3ZJ8A 4NILA 4Q4QA 2NUYA 2ZFAA 3GW3A 5AHNA 2FIQA 1ICQA 3LERA 3BAXA 1EGMA 4AZIA 2J78A 3KLKA 5M3WA 3PNZA 3NJ3A 2CXEA 4K2SA 2EAWA 3S4TA 3W7QA 2YFNA 3UT0A 1B90A 1UP0A 3MC5A 2OXNA 4R5EA 4S2BA 1V79A 4PN2A 1BWLA 4G2DA 4H9ZA 1SZFA 1BKHA 6ENLA 3DYPA 4P2VA 1POKA 4ZO6A 1TB3A 2DZBA 3MUIA 5REQA 1OC7A 2VQUA 4U2ZA 3WNMA 4XZWA 9RUBA 1ML1A 2DT2A 1IXPA 3PK7A 4MY8A 3P14A 3QGKC 3VFCA 3EDEA 4CVWA 1K7EA 4QQUA 1OYBA 4A8IA 3WK2A 4G1NA 2WCSA 1W9PA 2QW5A 1J6PA 3A9BA 3EPNA 4GO8A 5FEZA 1OY0A 1JYNA 4IG2A 4Z2GA 1TV3A 1UPMB 1I4NA 1E5JA 2DVTA 2WMGA 4WJEA 2PUZA 3LHVA 2BB0A 1EF2A 3LCHA 4LRTA 2V2DA 5T8GA 3C52A 3JW7A 2HVNA 4GI8A 3N34A 4JR5A 5J04A 3E0VA 3MWAA 1DJIA 1UROA 3D6NA 4OU1A 3RRXA 5FJIA 3N2XA 3PZGA 3VUPA 1NTHA 4RW5A 1HX0A 2CNCA 3PZMA 3G1HA 4FEZA 4R88A 1VIZA 4P7RA 4MUPA 2YYTA 3V75A 4AUBA 2A79A 4EKJA 3NQDA 3JS3A 1ONRA 2WQPA 3IEBA 1A5KC 2YLAA 4F0MA 2YLLA 3BQ6A 4NYYA 5I2UA 5HXMA 4NNAA 4XB3A 1G67A 1VHCA 3ARZA 4WDUA 3IJIA 4PUWA 3QMTA 4I6VA 1WZKA 2V30A 5CQ1A 1VD6A 4B4HA 1AQMA 1PDZA 1PTDA 2YL6A 3H6OA 2O92A 1SQ7A 1FWAC 4K1WA 5A6TC 1E3XA 1F05A 4GFIA 2H9AA 1WDPA 3AHVA 4NJIA 3BO9A 2YA2A 1U33A 2VUNA 2EKCA 5AZ0A 1XLGA 3QV8A 4PFHA 2BXZA 1S2TA 1EJWC 2YXXA 3KX6A 3FEMA 4P7OA 3KHDA 3P82A 3G0XA 3KAOA 4I9JA 1TFVA 3O05A 2PBGA 2P8CA 4JDBA 1G5AA 1TWZA 4MZ8A 1OZMA 4QROA 2X0SA 2Z6IA 3CYVA 4UTUA 2VRQA 1KRAC 2XGZA 1L2UA 1RALA 2ZC1A 3KCJA 3NO5A 4KFPA 2CKRA 5T9BG 2VD8A 4AIEA 3V5OA 1RHCA 1GVRA 1XYCA 1J01A 3HPFA 3N12A 2RDWA 3G18A 3PZUA 3ZT7A 6REQB 3O0FA 2FHFA 2O7QA 5CZKA 3S2MA 3AXHA 4Q8WA 2VVSA 1A49A 4RE0A 4NSBA 2DY3A 3K1GA 3WENA 3PZOA 3CUFA 5U7SA 4UTFA 3WBYA 3RPTA 2PC8A 4ERAA 4YVXA 7REQB 6REQA 1DYSA 2DDXA 3S9ZA 2ZRWA 4JPGA 3II1A 4LEQA 2NUXA 1YDNA 1WQ5A 2VC5A 5FF7A 3EOUA 3PZ9A 3VGDA 2E9LA 3B97A 4GY0A 4IMDA 3UNTA 4UQEA 1GQKA 3W2JA 5DANA 4ECLA 1XYBA 3UXKA 4M81A 5BU9A 3AMKA 4JEJA 4JL1A 5E09A 3PHAA 4WZHA 1QU4A 4R34A 2DSVA 3IWPA 3T0DA 1BGGA 4IFRA 3QTPA 4E0CA 4O1EA 1FVPA 3LNMA 5HWMA 4OTKA 3G0SA 1HL2A 3OODA 1KM2A 4PEKA 4LAMA 5A2CA 1A0CA 3NFUA 4AY8A 1OM0A 4C7FA 1JQXA 1XYAA 1AH3A 4XIMA 5CJ5A 1RJRA 4GXWA 3FKRA 1DJWA 1NF7A 3IJQA 1Q2SA 3EX4A 3KOWA 2AKMA 3TK7A 1I45A 4F2UA 4MWAC 1WDRA 3TEVA 4GKLA 4D6CA 3EWBX 4OQVA 3OA3A 3VD4A 3FDKA 2DZSA 2QV4A 4UTJA 2WBGA 2V6AA 3R0UA 4IQLA 4KWVA 3MI3A 4HNUA 3OA5A 3HGOA 3B04A 4HNVA 1J0KA 2ONEA 3OBAA 3LENA 4JFVA 2PDHA 4WKFA 3S2JA 2IQTA 1BLIA 2A3HA 1Q4NX 1TTPA 4QJ4B 3B0VC 3TNOA 1B3OA 4O4VA 2BSLA 3N3MA 3AIUA 1J5SA 3TWAA 1TV4A 1GYMA 2CBVA 1ISWA 1AQHA 3KOYA 3IIPA 2VOTA 2XHYA 5D2XA 3P80A 3SO7A 4MSSA 1WE5A 4CNUA 3IIZA 5HUOA 2ZVIA 4L4MA 1GW1A 1OCQA 3KBNA 3RR1A 1J11A 3C2YA 3UQNA 2VDGA 4GK8A 3MMTA 9XIAA 3MDWA 3TTSA 5C9ZA 2FTWA 1UOZA 1QI0A 4KS0A 2C1HA 4RUBA 1H09A 1YKWA 3LQLA 4BF7A 4IP4A 3WELA 3W7DA 1TJ0A 3AXIA 3DG7A 3CEUA 2RDXA 4IG2B 3MT1A 1JDAA 4DBWA 3W28A 4ZVJA 1ZCCA 4JNYA 2Y63A 4JTTA 1L6GA 3NSXA 4Q4RA 2CW6A 2QCGA 4GA8A 1W1PA 3WUBA 2VZOA 2O9TA 1PDYA 3KVKA 3ABOA 1NM9A 1TRIA 4RDVA 4FK9A 1TG7A 5CZ0A 4MOZA 4Q7NA 4NAFB 1E6NA 1YDYA 3H24A 3CU2A 3GAYA 2QMKA 4ATLA 1EL3A 1OGSA 4TVCA 3HV9A 2X09A 5HOSA 3MHUA 2Q8XA 2WAGA 2GWNA 1VYRA 3NWRA 3BJSA 4ZODA 4ZO9A 4NZ3A 2WVTA 3AIBA 2WLZA 3FYPA 4A22A 2W67A 1J2WA 1SR0A 4M51A 2HK0A 1UWUA 2ZUNA 2Z7KA 4O4WA 4GZIA 1WX0A 1XH1A 4W5UA 3A3XA 3PB2A 1UWQA 1WDWA 1XLBA 1RR2A 1VQTA 2HNEA 3CPGA 1ZRQA 2PLCA 3ARVA 3HQPA 3WLKX 1FOBA 5F4XA 2LLEA 2VJXA 4H6EA 4E4FA 2H8ZA 3GC4A 1G4SA 2ZRUA 2EPLX 1X38A 3BGJA 5AB3A 1O68A 6XIAA 1JRBA 1JRCA 1QATA 1IXOA 2V5LA 2YIHA 3IUDA 3FHAA 2PDGA 1MRQA 3M07A 1SJCA 2NQZA 1FKXA 4WD0A 3W7PA 4IZGA 3NOYA 2OGJA 2DT1A 3GX9A 2VC6A 1KRMA 2FGLA 3VVGA 4GX9A 3ID7A 5G4EA 5HBFA 2W3ZA 1ONXA 2G3IA 2V67A 1TRDA 4ZO8A 1UCWA 4QIUA 4D6FA 4DNHA 4KKXA 2BFGA 3EWCA 4HZ8A 5L6UA 2QPXA 4KF1A 4N2YA 4AEFA 2UY5A 3GUGA 4OKDA 4NX5A 3CB8A 3NVDA 1VCVA 2ZA3A 3ITOA 3ZR6A 1RUSA 1XLIA 4Y9PA 3CASA 4GZ7A 4J3WA 3NPVA 1O95A 3USBA 5E9XA 1XP3A 1EOKA 2EBNA 5XIAA 1A5LC 3RX2A 4GUGA 1W2VA 4LCSA 3W1UA 5HA7A 3DHFA 3VIPA 3VMNA 2Z24A 2QCNA 3BVJA 3P60A 3GFYA 4DJDD 3W70A 4UZSA 4JFTA 2PA6A 2WQDA 4MTVA 2PF8A 3AZRA 3FLUA 3ARYA 2X7VA 3WH6A 1W9DM 2FFCA 4FLOA 4RR4A 3R8GA 2BBFA 3GUWA 3Q58A 3NURA 4UQBA 3WSUA 1IEVA 4RPQA 1FWGC 4LVAA 5FAGA 2QZRA 2G97A 4ZL1A 4OOZA 1LLZA 1VFFA 1JL8A 2VD9A 1P1XA 1XICA 3NO3A 1RA0A 4D2JA 1WV2A 2E0PA 2YL5A 4WXZA 3GG8A 4YXGA 3EWYA 4GC3A 2O4MA 4IXXA 4KESA 3KVLA 4HMEA 4ZQNA 3LDVA 1LCOA 4GGHA 1EWEA 2W4XA 1L9WA 1N2VA 2ZUSA 4G6CA 4U4MA 4HYWA 4Z2HA 2HTMA 3GH7A 3POHA 1LL4A 1AK5A 4BA0A 1BF6A 3WMBA 5M1TA 2VFHA 3BMWA 1XX1A 3YPIA 5H91A 4JQ2A 1YPFA 3C2VA 1WDQA 4CGTA 3SRFA 1A5AA 4QE4A 2DT3A 1HVXA 4FXRA 3PS7A 3CBWA 2J66A 3SB0A 3FYOA 3KWSA 2WHKA 3TC3A 3EKZA 1R3WA 1QRQA 3LXBA 3B0PA 5FJUA 1UQZA 3WYZA 3GSMA 2C3ZA 3BSHA 2J4GA 4IIGA 4LS0A 2OGYA 4A3QA 1FWRA 2OODA 1ZJBA 3SY8A 3WQGA 1GWJA 3WN6A 3B8SA 1SFJA 4CCCA 4HU4A 3PANA 3WL0A 4IUOA 1XH2A 3H26A 4FF5A 4LUJA 1VJIA 4LF2A 5HWNA 1KFWA 3CH0A 1SW0A 2E09A 1RLCL 3DOPA 3PWIA 4JDYA 1DL3A 3L12A 2ZXQA 2NQ9A 1K6AA 1RY8A 4Q4PA 5CPSA 2XUCA 3C3NA 5I3GA 3AJXA 5E93A 1FWTA 1F73A 4Z1BA 4BF9A 3LHYA 3BAJA 3ZVHB 1DXFA 1GHSA 2HXTA 3J7HA 5LIXX 4KFNA 4J2MA 3TFCA 2PRHA 4J4KA 1A4LA 1K9FA 4AMCA 1X98A 3PSVA 1OGBA 1DE5A 2IPGA 4J7RA 4E6MA 4IIEA 2VFEA 3A23A 1EYEA 4J3TA 3UW6A 1FFQA 3RMJA 1K9EA 5G2WA 1LBLA 2OX4A 1YXDA 3CJPA 3BJFA 3CH9A 1UG6A 4C6DA 3WBXA 5KZMA 4F66A 1EA9C 4RPPA 5IHRA 2OELA 2L5HA 2PGFA 2NWSA 3RU8X 4JTQA 1T8QA 2PMQA 5CSUA 1DE6A 4YWSA 2RJHA 1VH7A 3VX0A 5KMYA 3OHMB 4XUYA 3QSRA 3C4UA 3ANVA 3CL6A 3TAKA 1AL8A 4WY0A 4OE7A 1GPWA 1XLMA 4MMWA 7A3HA 2OWWA 1HJXA 2BWGA 3KBJA 3VTRA 5DT7A 1BKSA 1Q7ZA 3N17A 3QQWA 3PUGA 2J77A 1WYIA 4E2DA 3EX1A 1GNXA 2GQ3A 3HB9A 1UKSA 1IEQA 1HL8A 3NZRA 3PC0A 1XSKA 4AZ6A 4U3AA 3W1RA 1TZ9A 3S0CA 3W1LA 4G7FA 2Q02A 2WPBA 5D9NA 3BARA 1KTBA 3WZ0E 3MZ2A 5J5DA 3GWQA 3VNLA 3AMLA 1JD7A 2ZE3A 4C65A 3HIJA 1YYAA 4QAWA 3M64A 3FXGA 4QQ3A 3R8HA 1ME9A 4CQBA 4HT3A 4A3YA 3MA8A 2A85A 3SCVA 1E4NA 2UY3A 1TPDA 4CKQA 2WSQA 3TLLA 1DVJA 1ICPA 3GNDA 2VNCA 4HPNA 5F7UA 1MZHA 3B4YA 4YTRA 5LKYA 2WMJA 3Q65A 2WWDA 5IHSA 3VIHA 1X6NA 1V6XA 4JL2A 2J74A 4J3VA 5HJLA 3CUHA 2ZZ6A 1A5BA 3NQCA 4W85A 2GJLA 2J7FA 2PGRA 4ZXOA 4RV3A 5AYYA 1UR4A 2XFYA 3I6EA 4M7TA 4XZ9A 3HBLA 4MNJA 2O0TA 4BHYA 3EX2A 4B9ZA 2CESA 3NL5A 2WKLA 2AGKA 4G8TA 4CCZA 4MB3A 5CBIA 5K7JA 4H7ZA 3SCRA 2W63A 2W61A 3EOEA 4MDPA 2XIOA 1PE1A 3O6DA 3QY7A 3W2NA 2JFEX 2XH7A 1M68A 5TBOA 1JVNA 3H21A 1T5AA 3WQWA 3UPMA 5F4SA 4FLSA 3LCIA 1NWSA 2ESCA 3TYAA 4F0HA 4PBFA 3PPCA 3W7EA 2EJ1A 1M7XA 3SZ8A 1MDLA 3SGZA 1UUOA 4GXPA 2WZEA 4O28A 1JZ6A 3FJ6A 3I7QA 3IVSA 2WSPA 2IKGA 2PD5A 4Y9MA 4S3FA 3KBWA 3RFAA 4IPNB 2XIIA 5CZTA 5BXSA 4LAUA 4M19A 3DZ1A 3GBDA 4OV9A 2BXVA 3AS3A 3IV3A 1FCBA 1WO2A 4S39A 2IKJA 3C2OA 2YPIA 1F4AA 3N6HA 2XZ9A 3AXMA 4ZB5A 3M1ZA 5DN1A 3ARTA 2GDQA 4HN4A 2IPJA 4ATWA 1F6KA 1I0DA 2WOQA 4US6A 2I5GA 3OW1A 4J27A 4RKAA 4EF9A 3IJLA 4AYSA 1NIUA 3TWBA 3M7WA 3CAWA 4AZGA 5CKSA 5H1WA 2OYMA 4ZB0A 2BLEA 3TXVA 1J0JA 1BSIA 4PMVA 1C8VA 1LL7A 3G1YA 4F40A 4PRWA 3LZ3A 1DORA 3IGUA 3DKJA 4YTUA 2GVEA 3U4FA 1TWDA 3MZNA 5I09A 3ZR4A 1S2UA 3QMSA 1C8YA 1XLLA 3SAZA 2GQ8A 3QKEA 2PRMA 2CCRA 3ZT6A 3TN6A 2QT3A 3KRSA 3I7RA 2CC0A 5GNXA 3WY1A 3KS5A 3TYCA 3DENA 1W91A 2OJPA 1HJWA 2QUVA 3CXOA 4JBRA 1E6PA 3TJIA 3WUGA 3HGSA 2Z7GA 2BHZA 4WY0F 4FMVA 3B0UX 4B5UA 1XYMA 4QCEA 3S3GA 1F8MA 1UWRA 4GZEA 2H3DA 3PBVA 2VEFA 1HKVA 4MKVA 1W8GA 2X1IA 3CS2A 1YPXA 1PWMA 1I2RA 2PWFA 3WIJA 2F9RA 5D2TA 4JFUA 7ODCA 1SO5A 3ABXA 1KNWA 3THDA 3M0IA 5A8GA 3KFTA 1RVGA 4R33A 4PTXA 2Z1SA 1JPKA 5LA2A 3PJUA 3RGTA 2PP0A 1ZL1A 1LT8A 2HVOA 4YCOA 2WC4A 3RXZA 2A2IA 4NJHA 1B4EA 7ENLA 4GZJA 4GI4A 1GZ1A 2HVMA 1A5SA 5A94A 3C2FA 1OFQA 3D47A 2ACSA 1XIEA 2XFFA 1RY0A 3M6YA 6A3HA 3VM5A 1FY6A 4REQB 2GYIA 1TPB1 4QS6A 3KLLA 3PUOA 3VPLA 3QC3A 2D2GA 1EHAA 4QAIA 1XSIA 1JZ3A 1OT1A 1B3YA 3WDRA 2QQ6A 4PUUA 4XZNX 4ADUA 2V9DA 3SR7A 3B8DA 4ZSTA 3W73A 1GT8A 5BRPA 4PB4A 5HR7A 2VCCA 2HXUA 3IK4A 4AD0A 2BV9A 1TPC1 2HMCA 3NEVA 4LYKA 3HJEA 2PTYA 2AL2A 4A05A 2QCDA 5CXPA 3TA9A 4I9MA 1DV7A 3AO0A 3WH7A 4Y9AA 1NDVA 4OWGA 4EAMA 1MO0A 2YCEA 1MYRA 3F5KA 3VD3A 2CLIA 4QEHA 5EBAA 4H4IA 3LM3A 1F07A 2CZDA 4X2RA 4WDXA 2QS8A 3O9NA 4YPJA 3VIMA 5AYBA 3R7MA 2QV5A 3Q37A 1X6LA 3RM4A 5DY2A 1RQEA 3LU2A 4GD0A 4CNNA 4IMEA 2EG7A 3HV8A 3WFLA 3THCA 3ARPA 3UJ2A 4FAMA 4QITA 3E1F1 3C86A 5XIMA 3Q4DA 5AY7A 1J5TA 1V6TA 4NXKA 2GJXB 3G8EA 4ALDA 4YMZA 1WBJA 4GUFA 3BMVA 4DZ5A 2YYUA 4CN1A 1S1RA 3GU2A 2PP3A 1UQYA 4R85A 4UZUA 1P6CA 2FJUB 4S3JA 4D6GA 3RPMA 4TMCA 4JQ1A 4C6JA 1EDGA 3UJEA 3PPFA 5I3DA 4L4LA 3W37A 3UXIA 1Q85A 2DU2A 1OD8A 4JKKA 3N1AA 3G6MA 2P0OA 2WW5A 1JAKA 3QPZA 1F61A 1DTUA 3WMLA 1XWYA 1UH4A 4ENLA 3LI0A 3IIOA 3FAWA 4ORMA 1CNVA 1ONWA 4HOZA 1FXPA 2F84A 1ZLPA 4JTFA 4GOAA 2Y61A 2RFGA 2J47A 4C1NB 1H50A 5RUBA 4GX8A 1DP0A 4HTYA 3NZQA 3KOXA 3GTHA 5CCZA 4A3HA 1R30A 3BPWA 3NO1A 3VCRA 3W7RA 1R0MA 1DJHA 4YJ5A 3BMXA 3H8AA 1E1FA 1ALDA 5HQEA 3C61A 4GQ0A 2VZTA 5HNUA 2ZX7A 3P8JA 1DQXA 1KLZA 2Y7GA 1J2BA 4IUGA 4H6KA 1E9IA 1EX1A 2J24A 1LP6A 3DBPA 3LN3A 8RUCA 2XWEA 2CBIA 3KBMA 4E4PA 3IPWA 1V3KA 4PMUA 1SGJA 3EOLA 3ONBA 2XH2A 1JPMA 3UA4A 1P7TB 1OG6A 2FZBA 1LROA 1TJRA 3UZ5A 2NT0A 1OFAA 3DI0A 1N8FA 2TRSA 1R38A 2VVNA 1YW1A 3G2GA 3PJTA 2BMBA 2Q8LA 4O19A 2YDQA 4ES4A 4JTAA 3ZWTA 5M2FX 5DMLA 3G1DA 8TIMA 2G3JA 4A4AA 5C2GA 4V1XA 1ZTVA 1F2JA 4R9OA 1K8ZA 3QQ0A 4NKCA 3QM3A 1IGWA 2BVYA 5C5YA 2HNHA 4IGSA 2QXWA 4TX9A 4IJRA 1C90A 1J12A 3KTXA 4KEMA 5LNVA 4NUWA 1R9ZA 1IZKA 1W6TA 2JKEA 1E6QM 4UOZA 3DFTA 3RITA 3FSUA 3TE9A 1UMLA 2Q8ZA 1CXFA 3TIMA 3H2AA 2WVUA 2ZBTA 3HM7A 1V93A 3N6QA 1J79A 3W53A 2EJAA 3QZ6A 1G7VA 1C93A 3LLXA 5H6HA 2PTZA 5LXXA 3CAVA 2VR2A 3TYUA 4IP5A 2VYOA 2EKGA 3SCTA 4F9JA 2POTA 3SIZA 5LSMA 3UG3A 2VENA 5I7GA 1DXIA 2BX7A 3TSMA 3G1RA 1FWHC 3OG3A 5BRBA 4YTSA 3P5ZA 1SM9A 4DM1A 1MI3A 4HA0A 2V38A 3KEHA 4W4QA 5AC6A 2PDPA 1VCGA 4QG8A 1XFCA 3E3HA 5A2BA 1VLWA 4Z1AA 2CLMA 1GTHA 4JTRA 3W00A 1TWIA 2A3CA 4EE9A 2XIJA 3CGTA 3N25A 4W93A 2QVHA 3T0BA 2DQWA 2D1ZA 3CQJA 1OC5A 2GGGA 4F2TA 1RP9A 2CHOA 1KXVA 1TPVA 4GWEA 3STEA 1JI1A 4QLLA 4OT7A 3P67A 3VX1A 4GQGA 3PTQA 3BZGA 3N19B 4DNMA 5D2WA 5HDRA 1UJQA 4TU1A 1P0NA 2CLPA 1L6WA 2REQB 1E9ZB 1RBLA 2VZUA 2W79A 3EOSA 1GQNA 1QOQA 4ZTXA 1CBGA 4AEOA 3VIKA 3V0SA 4RE3A 2JGYA 1UR3M 2X1RA 5F2LA 4C5YA 4H6QA 1EEXA 4Y2WA 3SCSA 3VOHA 4AD1A 4AWEA 4PB3A 1E4LA 1JF5A 1HXJA 4GXMA 5CGMA 1K4HA 2VURA 4B5SA 3C5QA 3GDMA 2VGBA 1NU5A 3UXAA 1TA3A 2BASA 3ISIX 3UZYA 4RCXA 2QCFA 3G6LA 2P53A 4L5ZA 5EMMA 3R25A 4W8BA 9CGTA 4BWLA 4QLKA 4JYEA 2ACUA 3E49A 1Q7QA 2E28A 1E71M 3APYA 4QP0A 3SRDA 4LBSA 2DEPA 4AU0A 2DIEA 4C6KA 1W1B1 1GGOA 3WH5A 6CGTA 2NX3A 5U4NA 2C16A 1PHQA 2F2HA 3ELFA 3TYZA 2WXDM 3ZM8A 4C7DA 4XVDA 2FZ8A 3WH9A 3AROA 1CB7B 4F48A 3UY7A 1KM1A 2PDMA 5KZDA 3R89A 2BVWA 2J9YA 1AG1O 1WPCA 1LG1A 1O1HA 1I1XA 1YE4A 4FR1A 2XG9A 4P5UA 3W02A 4M29A 4AAJA 4LUYA 2G0WA 1JCJA 1NWUA 1S2VA 3EAUA 1EDTA 3VNDA 1JPHA 1OIMA 2JALA 3RIKA 3GXNA 1MRAA 1W5PA 5GJMA 4J2PA 4GVFA 1H63A 1J0ZA 3JVAA 1D3CA 4H9TA 1V8EA 4S3AA 1FDJA 4PTNA 2GZXA 2OZTA 1BEUA 1OINA 4FX8A 4IQDA 3W71A 1UA7A 4ZB2A 2OYKA 4I5XA 3KDNA 1Y5WA 1JGMA 4MYAA 1CGYA 4HJWA 3GTIA 2Y8KA 2RHGA 3T0TA 4MJ2A 2DVXA 3G1FA 4ADSA 1OK4A 5EB8A 1XM3A 5BWFA 4O17A 2ADAA 1F3EA 1C7SA 4Y9NA 4WKAA 3W2UA 1VEMA 4CNTA 2Y88A 3UPBA 1P7TA 2ZDSA 1JXJA 3RX4A 3WNOA 1EO7A 2ZA2A 4W84A 1S39A 3L68A 1JEZA 2HCVA 2VHLA 3W9ZA 4GIEA 4Z2JA 1LZOA 4OOUA 3LCLA 1N7KA 5AKQA 2G95A 4A8RA 2YR1A 4LF1A 4JYFA 3NTYA 2OWXA 4AEEA 4NNBA 3F5LA 4PTMA 2IQDA 3WFAA 2PDUA 3K1DA 1BYCA 2ZTKA 3WLRA 3WQCA 3UFYA 2CZ5A 2ISWA 1Q63A 3M16A 4WSKA 3N14A 4E8GA 1PKLA 3OG2A 4IJBA 5IOBA 3GO2A 4JY9A 3S8HA 1S1PA 3K8LA 3S2CA 2PB1A 3N11A 3QGAC 2WNNA 1IR1A 1XCWA 4QEEA 1KTNA 3AZSA 3EMCA 3AS1A 2C1IA 1H5VA 1E55A 4MB1A 2J9ZA 3N9SA 5AECA 3EOOA 2A6NA 3K5XA 2CLFA 2V3DA 5LYRA 5HQLA 1KBLA 1O12A 4FOUA 2NSOA 4WCJA 4B5TA 2J79A 1UP3A 3QR1A 4DI8A 4KRTA 2PTDA 2Z29A 4O13A 1RZMA 3LHWA 1V02E 4JIQA 1XDMA 4KCVA 3W7NA 4PMXA 3LHTA 1BXCA 1U5VA 4AISA 3VNKA 3KWXA 3QXBA 5HK4A 4UTMA 2A7NA 5I02A 1JCNA 4Y6GA 1QVBA 1QPOA 3W3OA 1KFLA 1E1CA 1UR2A 2VX7A 5BW6A 5I24A 4HHMA 3TW9A 3BC9A 3MUY1 2FMOA 2D2HA 1KXTA 2Q09A 5AHIA 3QMRA 1XDLA 4QG6A 2GL5A 1OX6A 4AD5A 1BSLA 2YFOA 2G4JA 1I8JA 4L64A 1TPUA 2WC7A 5JQ9A 3EB2A 4ZGYA 1MEWA 4C6NA 1P0BA 3RLUA 2NVDA 1EQPA 2VFFA 4RNHA 3H70A 9XIMA 2E67A 2GSJA 3AUOA 3CAQA 2ZC8A 4HZMA 4WQ6A 2I5IA 1PXGA 3QY6A 3NGJA 4HMDA 4Q8PA 4PMNA 2QCDB 2AL2B 2IPFA 4GBUA 4US5A 5BCAA 1Z9AA 1PZ0A 2CZVA 1XUUA 3ARXA 3GVRA 3QYQA 2Z00A 1GKPA 2YL8A 3CUZA 3CT2A 4Q32A 3I6TA 2VZVA 1F8IA 3TTOA 1SFTA 3M0HA 4MVAA 4M3PA 1MEIA 2VR4A 2GDUA 4FXFA 3FHQA 1AUSL 4FX6M 1YBQB 3OB8A 3ZT5A 4KCWA 1PHWA 4C6PA 2D0HA 4DQWA 4KGJA 1SU5A 3SUVA 1PTAA 3E0LA 4J3UA 3U2CA 5A8OA 1IWPA 1UC5A 2EPHA 4KW2A 4ZQOA 3NG3A 5A6LA 3CZEA 1TX0A 2PFHA 2PWUA 3GW0A 4UFIA 4D9PA 5GPRA 3DUGA 3D0CA 4FIRA 2FH8A 3DG3A 4EP8C 2GGHA 2B7OA 2PU0A 1QMLA 1GZJA 4N02A 4JTEA 5CPMA 4AXKA 4D6DA 2CLEA 2CZFA 4AW7A 4L9YA 1YDOA 1W17A 2WZMA 1V3JA 4G5DA 1U2YA 4IX0A 3SDOA 4HNLA 5HNNA 2JEQA 4IHCA 4U3CA 1JZ2A 1VP5A 2HBXA 4Q7IA 5BXTA 1XBZA 3GK0A 3IAQA 1I2PA 3V0TA 2ACRA 2CKSA 3TR2A 3FN9A 1CCWB 5DCEA 3TCEA 2X30A 3MKVA 1GW9A 3NOEA 3EB3A 4BY3A 2BNJA 4G9PA 3VNJA 4DJFC 1W9XA 3E5PA 3S1UA 2PCEA 3N73A 3WK3A 3LTPA 1R3SA 5I6SA 4IFKB 2Z6JA 2Y4SA 2BY2A 3UR7A 3WEOA 1W8SA 4Y7EA 3B0XA 1TX2A 4U28A 2VT0A 3GHTA 3LHUA 8CGTA 4IXHA 3UJSA 5ECVA 1N82A 3S47A 1V0KA 3OLDA 2OO6A 3P74A 1G7UA 5HANA 4AY1A 3ZIZA 1OB0A 2A21A 3A5FA 4ZA0A 4JX5A 1WAWA 3UF9A 1E0TA 1KR0A 2IS7A 4NL1A 3H7UA 1W9BM 2QDHA 3ITYA 4YNGA 3WDPP 2FB3A 3PM6A 4LCRA 1IYXA 5I0DA 5FD0A 1A80A 4JFSA 1YX1A 1PL9A 3WEMA 1G01A 4F79A 4UMBA 1TV5A 4NJJA 5LIYX 5C7HA 4UQDA 4C90A 3OZOA 5IBXC 1QO2A 3W84A 3EXTA 1TMQA 2JF6A 3URNA 2SFPA 4JHOA 1UJPA 1DWJM 5ABTA 1L0PA 3QHNA 1JAEA 5A95A 3TH6A 2AKZA 3GNRA 4MIMA 3N2MA 1A5MC 5G1TA 2IQ0A 3CMGA 5IDZA 2ZKMX 1PCWA 1AODA 3FA4A 1KFJA 2WHMA 4JZ5A 2YKKA 4LCQA 4IF2A 1T6MA 4LUTB 4M6UA 4ZE4A 3F4WA 3BLEA 1VFMA 3AFBA 3R5EA 4HOXA 4FSAA 1CTNA 1I1WA 4UCFA 3PPGA 4UOJA 4IGMA 3UD6A 3T09A 4MJMA 2X1SA 2OWCA 2O9OA 5A2AA 1Z32X 5MF5A 3VNZA 4JYDA 3KBSA 2WK2A 1F74A 3WNLA 3E2RA 2REQA 3POCA 2XVKA 1GYNA 2RDTA 1MXGA 2C19A 4MGGA 3N4AA 3TJXA 2ZUTA 5KEZA 1B4KA 4RNIA 3VNYA 1E51A 2FB2A 4AIUA 3AOFA 3RF9A 3P8IA 4NVTA 2X8RA 4NZJA 2GJPA 4CD6A 4O1BA 1AD4A 2VEIA 3ARQA 5MHBA 4ZOBA 4DX3A 4U10A 2Q3OA 1G4PA 1I2OA 4HIBA 1FKWA 3S83A 3R1ZA 1C8XA 4UFMA 3AQUA 1E0VA 3G77A 1KCXA 3VCNA 1EKOA 3EKGA 1FWSA 1NQ6A 1UZ1A 3FA5A 1ITXA 4IPJA 1Z41A 3UG5A 4RL3A 2BZNA 1OWQA 1O94A 4LQ1A 3T4WA 3CPUA 3LLFA 1ODZA 4AVOA 4A8LA 4CD8A 4KRUA 1XDJA 3PF3A 5BMWA 2J25A 4HHHA