1B3YA

Xylanase from penicillium simplicissimum, complex with xylotetraose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
total genus 127
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3yA00
2C8NA 4YHGA 3WL1A 1ZL1A 3GH4A 3RJYA 2ZWZA 4XZWA 2XWDA 5A95A 1E3XA 2ZE0A 1XH0A 1JZ5A 3GNOA 4DM2A 4U33A 3AHZA 1BVNP 5TD4A 2DT2A 2BY3A 1H2JA 1GW1A 2O9RA 3GNPA 5I24A 2J62A 2E8YA 4Y7EA 1VEOA 1BG9A 4JFVA 3AIVA 3MU7A 1E15A 2Y4SA 2YL8A 4IISA 1H1NA 3E1F1 4CN1A 1FH7A 1EDQA 2ZIDA 4IUGA 4M80A 4HZ8A 1XGZA 5A6JA 1W3JA 1OD8A 2WBGA 4JIEA 2BY0A 4W8LA 1JL8A 2E9MA 3UG4A 1MWOA 1PZ2A 1UOKA 3KL5A 1BAGA 3UG3A 1IV8A 1WP6A 2BVTA 5A69A 2PWHA 5A8PA 2CKSA 4HMDA 2DSKA 3LPFA 1MFUA 2YKKA 2PC8A 3BAKA 1JIBA 5A2BA 5DEZA 4H41A 4PMYA 4UFIA 1QNPA 2BS9A 1BLIA 3PTMA 5I0DA 3EYPA 5CPTA 3AXXA 4D72A 3TTYA 4PSRA 3ARQA 2G8ZA 1H4PA 1QW8A 2VURA 3NDZA 4KH2A 5DFAA 1B3WA 2X09A 4GQRA 2WSPA 3ARTA 4CVWA 3AMCA 4RL3A 3L2LA 2WLZA 2E0PA 4AZ7A 4S3JA 1NWUA 1J0HA 4ZFMA 1JF5A 3HMCA 5KEZA 3EDDA 3BAJA 4CD8A 1ODUA 3MMDA 8CGTA 1EH9A 1CXIA 1UWTA 3PTQA 1FFRA 1H09A 3D3AA 3VM5A 4R27A 1UZ4A 4JFUA 4JKMA 2WPGA 2O9TA 1US3A 2D1ZA 4WK9A 1GJWA 5C8BB 2PF0A 1LWHA 3OZPA 1LL6A 2G3JA 1H49A 3AZRA 2HISA 4QAWA 1PZ3A 1VF8A 2CHNA 3VM7A 4DUWA 3AMDA 2E40A 2AAAA 8A3HA 3GXDA 1OT2A 2ZXAA 5BROA 4PMNA 4HMEA 1GOKA 1CEOA 2XTKA 1WKYA 3UERA 1DWFM 5D9NA 2BHUA 2VCCA 2VOTA 1MQPA 2BV9A 4D6FA 1ISZA 2WZIA 3SCWA 3ZR5A 2J47A 5I78A 5E70A 1QHPA 1V0MA 1VEMA 1TR1A 1BTCA 4B16A 1QPKA 4UOZA 3VIIA 2EQDA 4AD5A 3WF3A 4CCEA 4GZJA 4EE9A 3CBWA 4GINA 4Z2LA 2VZVA 3GH5A 4ZEPA 2BXZA 3BMVA 4HA4A 3MV11 1WDQA 1JFXA 3B9EA 1JDCA 3UR8A 3AROA 2XM2A 4Q7NA 5AYIA 3N1AA 2UWFA 4PMRA 4OJYA 3VDBA 4UQDA 1MQQA 3RM9A 2YDRA 1J0JA 2X05A 1HX0A 2FGLA 3GXFA 3IJ8A 3AI0A 3AZSA 2IUZA 4JHOA 3N9KA 1K9FA 1Y7VA 1ZU8A 1CTNA 1H11A 5A3HA 3WNKA 1UWUA 3WH8A 2V3DA 1QI2A 2FHBA 2WVVA 4WLCA 2VQTA 2J7EA 3EDEA 4ZE4A 2WLYA 4RE2A 4CCDA 1J0YA 2PBGA 1B31A 4AXNA 3SCQA 5EMYA 1OIMA 1A47A 1UG6A 1NOUA 1VB9A 3W26A 1UR8A 1UHVA 3BAYA 3CUHA 3VX1A 2PWDA 3THCA 3WF0A 1CIUA 2V38A 3THDA 3VPLA 1UKQA 4MJ2A 1ISWA 3TTQA 1V6UA 1KWGA 4AD3A 5A6BD 3SUVA 1C92A 2PBOA 3WDIA 1W9PA 1OSEA 3WUFA 5DMYA 1NM9A 1GJUA 2IXUA 2W5FA 4WKAA 2G3NA 4S3KA 5JIWA 4UZUA 3ZOAA 1BPLB 4AIUA 3VIFA 4UFJA 1BYDA 1X6NA 3ARPA 1JYVA 4PMUA 1W9XA 1UUQA 2E9LA 2ZUNA 3M6DA 1J0IA 2DSVA 1XH2A 1OGGA 4CD6A 5HOSA 2WKLA 3WY1A 3N18A 3TTOA 5EFDA 4MNKA 1KXHA 3W28A 3ZJ7A 1EOMA 1XC6A 2RGMA 3VVGA 3OLEA 1JXKA 4J3TA 2YBTA 3B8SA 3WQ8A 2C7FA 3VIJA 1WDPA 3EDFA 5A8QA 3CHDA 3W29A 1VFFA 2DT1A 1QBAA 1SMAA 2WB5A 2OWXA 3SCPA 1L8NA 5E9AA 1HF6A 2IXVA 1MVYA 3ALFA 5C71A 5E6ZA 3W53A 1NP2A 1TZ7A 2D2OA 5M3WA 2W91A 2CBUA 3F5JA 4J3WA 5BYWA 3MKKA 1JDDA 2C0HA 1WE5A 2CKRA 3O6AA 1J9YA 3IAPA 1FHLA 1V6WA 3FW6A 4ACYA 3BC9A 3QHOA 5ABHA 1V08A 4Z2IA 1Q6FA 4NF7A 1C7SA 2ZXDA 3F4VA 2CEQA 3WUBA 3F5KA 1GZJA 1EXPA 3OLDA 3AYRA 1M04A 4OBSA 4J3XA 2F8QA 4UOJA 1UQZA 4AZCB 4FF5A 4D6EA 3VOCA 4JCLA 1SMDA 3K46A 2JF6A 5EFFA 1B30A 4OIFA 1VJSA 1BYAA 4P7RA 4D1JA 3BCDA 2ZUVA 4J3UA 3PZMA 2GVYA 3ARUA 2YIHA 2NT1A 4M8UA 3AHTA 1JF6A 1JI1A 3SCRA 4LQ1A 1JD9A 4HA3A 3AS2A 4MTVA 3CZKA 3AICA 4TVUA 2XUCA 5LA1A 3WEMA 3SEPA 1K9EA 3U5YA 4AZBA 1JG9A 2BXYA 5BWFA 3BLPX 3WQ5A 3MANA 2WCAA 2XWEA 3N13A 4UFKA 4IM4A 2PI6A 3EDJA 4QFUA 4CN4A 3CGTA 2Z1SA 1CGYA 1RP8A 3VINA 1G94A 5D9OA 4PRWA 2WAGA 2DDXA 2XGBA 2CHOA 3CH9A 1QNRA 1X1NA 1C93A 3BAWA 3VKKA 2WHJA 1V3MA 4WJXA 3O9NA 1W1PA 3OZOA 1V0LA 2XFYA 2YL9A 2UY5A 9CGTA 4CGTA 3TOPA 1CXHA 1UR0A 1B1YA 3ZT6A 4DWSB 1CXFA 4PMZA 1UD8A 5CSYA 5I79A 4D6JA 3CZJA 3MSDA 4ML4A 3NSNA 4CVUA 4U2YA 5JIPA 5E0FA 3ZQ9A 3CZLA 4W7UA 2FH6A 1C3FA 4U3CA 1Q6DA 1KGXA 3AIRA 4IPLA 3OGSA 1XD1A 3FHQA 4BQ2A 2X0YA 2ZX7A 3DYPA 1CLVA 2X0HA 4AWEA 1XRVA 4V28A 4J7RA 1K9TA 3LPGA 2FHCA 3VD3A 2XGIA 1CWYA 1C7TA 2J25A 3IAQA 4PUEA 2F2HA 3I3BA 3TTSA 4B15A 1GUVA 2WHKA 3T0DA 5BRQA 5JBDA 1NARA 4AYSA 4GKLA 3W0KA 2VZTA 7A3HA 4AZGA 5ABGA 1HL9A 3WH5A 5A8OA 3VDCA 1KBKA 2ESCA 4H04A 4UFLA 2A3BA 2G3MA 1FH8A 1JZ3A 1BSIA 4HOWA 3CUGA 4MAZA 5BXRA 3VIGA 1VJZA 3AS1A 2WW5A 1W2VA 1JZ7A 4NRRA 4MNJA 1PX3A 1EOKA 4B3KA 4LYQA 1C91A 1PIFA 3T0AA 2DT3A 1JD7A 1EQCA 2AOSA 4LGXA 1HIZA 4LYRA 1N82A 3AXHA 4AD1A 4MDPA 2VCAA 3SCVA 2FGZA 1EO7A 1DP0A 4W88A 3WMBA 1W9DM 4J27A 4C7FA 3NSMA 4AZCA 3K4AA 3AHYA 1US2A 4W89A 1CGWA 5BXPA 1G1YA 2VCBA 1E1FA 3UG5A 4MB1A 2WMIB 3IJ9A 2JIWA 4ACZA 4AZ5A 1E4MM 3RDKA 1KXQA 1OD0A 3OGRA 1V3KA 1DWJM 3ZMRA 4OZOA 3VGHA 3VMOA 2XSAA 1EQPA 2VQUA 4URIA 5FIPA 2JEPA 4PMVA 4AISA 2XPKA 1OB0A 2YBUA 5CLWA 3WH6A 5I2UA 2J78A 3PZ9A 1PX8A 3OA5A 3W37A 1ODZA 1E0XA 4TX8A 4JAWA 1GQIA 2ZUWA 4L4PA 3W24A 5A6SA 1VFOA 2EPMX 1KXVA 3ARXA 1EHNA 3KL0A 1E73M 4N0RA 4PBGA 1TCMA 4MB4A 1ITCA 3MMWA 4W5UA 2FDMA 1W1VA 3ARWA 1PPIA 1WB0A 4LPCA 4MB5A 1HJQA 2OWWA 3M7SA 3SCUA 3SUWA 2VVSA 5CGTA 3BAXA 2E9BA 1UYQA 1X6LA 2J77A 5FCZA 1D3CA 5A2AA 4AC1X 1Z32X 5A8NA 1XSKA 4H8HA 3U57A 3CTTA 3GH7A 3WF4A 1HJWA 1E1EA 4JCMA 5I5RA 5LA2A 2O9PA 5CLTA 4JL2A 2TAAA 4YN5A 1G0CA 3ZR6A 3VD5A 4GI6A 4D6DA 3M46A 3VDAA 1MW3A 4DWSA 1G5AA 5D9MA 3GZAA 3W38A 2JF7A 1KGWA 1GVYA 1V0NA 3EMCA 4W85A 4HPGA 5EBAA 1D2KA 3ARYA 2VX4A 4HPHA 4BCEA 1HL8A 3T08A 4GZIA 1QNQA 2PWFA 1ZB5A 2NSXA 1V3JA 1P6WA 1LG2A 1A3HA 2OYKA 4D6GA 4KRUA 5FL0A 2BVYA 2EPKX 4H8UA 3G6MA 3L4WA 2QF8A 2EJ1A 3OG2A 2W62A 1V6YA 1E6QM 1GOWA 4W93A 2CBJA 2JFEX 3VGEA 1AQ0A 2WSKA 4AEFA 2X1IA 3WD4A 2G4FA 1BGGA 1E4NA 1IT0A 1OWQA 2WM0A 1DWIM 4HTYA 1WDRA 2VR5A 1KWKA 6CGTA 2V5DA 3VGGA 3APGA 1AQHA 1CGTA 3L4XA 3U7VA 4H2CA 3UCQA 2YLLA 3UR7A 4W8AA 4ACZB 2D20A 4C7DA 3TP4A 5IHRA 2EPOA 1JYNA 4F66A 3WNOA 4UQBA 3J7HA 3CUJA 1BHGA 3UESA 3KL3A 3NDYA 1RP9A 1ISXA 3ARVA 1W9UA 3K8MA 2ZOXA 1FA2A 1JAKA 3W6LA 3WF1A 4ATDA 1K9DA 3ZJKA 3G6LA 6TAAA 2PWEA 3MUAA 4E8DA 1HKKA 3CLWA 4AD4A 1VEPA 2YDQA 2CETA 3DC0A 4GI9A 2A3EA 1TUXA 1UR4A 2WVTA 1E3ZA 1GHSA 1HJSA 3FAXA 2B31A 1E9LA 1W3KA 2Q8XA 1JNDA 3AMKA 2CITA 3RM8A 4TTUA 3WDQA 3NUKA 3RIKA 3JUGA 3N17A 2D22A 2J79A 1PJ9A 1B90A 3BGAA 2GUYA 1AMYA 2DH2A 3WUEA 3VNZA 3SCTA 3CUIA 3A4AA 4W84A 3KZSA 1JDAA 2QV4A 3OB8A 1L0PA 2WMFA 3T2QA 5HDRA 3WD2A 2F61A 3BCFA 2WHLA 4NI3A 4UOQA 3PZVA 2NW0A 1MXDA 1BYBA 3AFBA 2CESA 2OYMA 1J0ZA 4FLRA 1OM0A 1LQ0A 1ZBCA 2NT0A 5DO8A 1B0IA 4CU8A 1LLOA 2D0GA 3WH9A 2WVUA 2E3ZA 3MV01 1SR0A 3N11A 1PAMA 4D1IA 2XG9A 1E6SM 1VENA 1S46A 2WC3A 4TVCA 1RPKA 1JXJA 1WZAA 3AIUA 3FAWA 4HA1A 2WZHA 1V3IA 5GPRA 2V3EA 1OT1A 3HU7A 1E72M 3SUUA 4BQ3A 3L4VA 2J75A 2WZEA 1HNYA 2CYGA 4MADA 4GZEA 4QCEA 1GOQA 2DPEA 2RGLA 4OOZA 3WUGA 1E5NA 1H5VA 1XCXA 1C90A 4HOZA 5CGMA 5CZKA 5DT5A 3A4WA 3WENA 2VMFA 4WKHA 5ABFB 1ESWA 4GO9A 3WH7A 3ARRA 2XIIA 4WKFA 3AMLA 4BA0A 3RCNA 3BAIA 2DSUA 4P7NA 3LPOA 1HP4A 1JYWA 1K6AA 1F4AA 2DH3A 4W7WA 1UZ1A 3AYSA 1HT6A 4OKDA 2VZUA 2WWDA 4AZIA 2EPNA 3LMYA 1CGVA 3I3DA 2CCRA 4PTVA 5F7UA 3I3EA 2Z1KA 1WZLA 4M1RA 4GPNA 2J7HA 4L4OA 2OYLA 1CBGA 1WCGA 3AS3A 1B9ZA 3AQUA 3MMUA 3NIYA 1QHOA 2WMIA 4Z2KA 3T2PA 1RD6A 4JKLA 5FD0A 1CLXA 1KB3A 4GQQA 1VBRA 3L4YA 3VD9A 3M07A 3VILA 1UD5A 3BXWA 5A2CA 4HP5A 2O92A 1HKMA 1XV8A 4UQAA 3S2CA 5IFTA 4ZE5A 2OSWA 1C8YA 1QHZA 1JZ4A 3TONA 2QLYA 1F4HA 1I75A 1ITXA 2VUYA 4RE3A 1JAEA 3NJ3A 4EKJA 5DT7A 5FOOA 2GDVA 1DHKA 2UY4A 2OSXA 1YHTA 3WDPP 3GTNA 1B3YA 4UFHA 4MNLA 1NOFA 1UD2A 4W8BA 5IXEA 2J7FA 3PN8A 2WVVB 4OBRA 3UEQA 1H0GA 3GXMA 1EIBA 4DM1A 2XVLA 3EMZA 3POHA 3VGFA 2QMKA 3ARSA 1GOMA 5A6MA 2O9OA 3CHFA 4BS0A 1R8LA 5CJ5A 1LJYA 1UKOA 4JFTA 4MPKA 1GPFA 1UKPA 5AY7A 3AHXA 3ZJ6A 2WC4A 5HBFA 1V3HA 5ABFA 2W67A 1FP9A 1TA3A 4QCFA 4OOUA 3VNYA 4LYPA 4A3YA 1H0IA 4TOQA 4F8XA 4H8VA 2WK2A 4JKKA 1NP0A 3SUTA 4EAMA 1VAHA 2VT0A 3AS0A 4W7VA 2UY3A 2W4XA 1VBUA 2XVGA 4J3VA 3AIWA 3RJXA 1OGBA 2OWCA 4BZYA 4NZCA 3ZSSA 3NSXA 2XIBA 1LL4A 3W82A 5KZ6A 4AZ6A 1UD3A 2V3FA 5DF0A 2ZUUA 1CPUA 1CDGA 1KCLA 1W1TA 3PZQA 3QR3A 1B3VA 4PEEA 1CGXA 1J18A 4UTFA 3T0BA 4M24A 3EMQA 4DWSC 5E6YA 1I1WA 4BQ4A 1KGUA 1HN1A 1V03A 3WDHA 4YPJA 4UNIA 4JL1A 1JYXA 3WQVA 2ZX9A 3WELA 1UD4A 2WVSA 4KGLA 4JHZA 2D3NA 3OGVA 1TVNA 1GQKA 3WMSA 1JZ6A 4EK7A 2J7GA 3AHVA 1GCYA 1JZ8A 1UWIA 3K1DA 4Z2HA 1PIGA 1UKTA 2JE8A 1GQLA 4TXEA 3VU2A 2E4TA 3ZO9A 4CD5A 2WHMA 2V3GA 4A3HA 2EXOA 1G01A 3O2LA 1FFQA 3OLIA 4M29A 1CXKA 1VFMA 3CMGA 2YLAA 2YL5A 4PYSA 4CD4A 1ECEA 3AOFA 3KEHA 3WDJA 5BXSA 1GONA 1V0KA 2MANA 5D8WA 4X0NA 1AVAA 1OIFA 1V3LA 4C7GA 1KR0A 1MW0A 1UD6A 3PZTA 2VRKA 1O6IA 1OBAA 4XV0A 1TFVA 2Y5EA 1R86A 1RH9A 1U2YA 5HXMA 1TMQA 1UR1A 3RILA 3FNDA 4DWSD 1MW2A 1UR2A 2GDUA 5BCAA 4E8CA 3PTKA 4TX6A 2W63A 4CU7A 1E6ZA 4J3SA 3F5LA 3MSGA 4U3AA 1VIWA 4MNMA 5D4YA 1R87A 1UQYA 4PTWA 2VJXA 3ALGA 4Q22A 4U31A 3OIHA 4ZXOA 1CECA 3OLGA 2YA1A 1W32A 1E71M 3ARZA 5JBEA 3GBDA 4CKQA 3L4UA 4PUDA 4F9DA 4P7LA 3TA9A 1GHRA 2HVMA 1EA9C 2VI0A 1KBBA 2WMKA 3GYCA 4GXPA 5A6AA 2XYLA 5CPQA 5I6SA 3VIKA 4OUEA 1ZJBA 2WXDM 4DUVA 2ZXQA 3WFZA 3CZ8A 3WQWA 3QHNA 3WFLA 3WDRA 1GOIA 1BGAA 5AC5A 2JEQA 3VDHA 3GBEA 2VX5A 2W92A 3WMCA 3DYOA 4MAVA 1PBGA 2ZICA 1C8QA 3AIQA 4IPNB 5EB8A 1ZBVA 1MYRA 1VFUA 2CIPA 3L4ZA 2GSJA 3K8KA 3DHUA 1TA3B 4W86A 3VUPA 4U5KA 4FLSA 1WPCA 2QPSA 4FMVA 1XHGA 2BY2A 4KGJA 4P7OA 4B9YA 3HN3A 3PZGA 2WANA 2Y2WA 1TE1A 1BG4A 2G41A 3IK2A 2E8ZA 2A3AA 4AEEA 3A3HA 2W66A 1FH9A 2WBKA 5I3DA 2XVPA 2WYSA 3SUSA 1M01A 3ZT7A 1EHAA 1E0VA 2DIEA 2GJXB 2BHZA 4UR9A 1EDTA 2W61A 1GQJA 1FOBA 1WO2A 4AD0A 4WF7A 2J7BA 1M7XA 4ATWA 1QI5A 4PCTA 1E5JA 5JUVA 5CQ1A 3T2OA 2VO5A 3MO4A 5A6KA 3FXYA 5E0CA 1CNVA 3BSHA 1Q6EA 3VIPA 1HKIA 2GFTA 1NOWA 1LWJA 1E56A 1B2YA 1QOXA 2VTFA 1XSIA 1HVXA 4TTGA 1MW1A 3GXIA 4V2XA 1E6PA 3PZNA 2XFFA 3ZJ8A 1OCQA 1UR9A 4HMCA 4XZBA 1MXGA 1UA3A 3L2MA 3DHPA 2WMJA 7TAAA 1KFWA 4ZENA 4TVDA 4D6CA 3RPMA 3AZTA 4AZHA 3ZIZA 3WBAA 1XYFA 2CBVA 2GJPA 1SYTA 1V6XA 1E55A 4GO8A 3RO8A 2GJRA 3AISA 1O7AA 1C8XA 4HU8A 3QGVA 2ZX6A 2PB1A 4M56A 3POCA 1E43A 1W9BM 4QP0A 2AMGA 1GORA 3S6TA 2FH8A 3NYDA 4BQ5A 2Y24A 2VC9A 5D9PA 5ECUA 4AIEA 3N04A 2JALA 3ZM8A 3ZSTA 2DQXA 4CUCA 3AIBA 1GOOA 3WL0A 3ZT5A 3B9AA 1XYZA 4GI8A 1XH1A 1VRXA 5M03A 3CHEA 3W6MA 2DIJA 5IDIA 4FK9A 5C70A 1UWSA 1E4IA 4H7VA 1EO5A 1NQ6A 3MS8A 5ABEA 4DUXA 5CSUA 1BYCA 1QNSA 1CENA 2QMJA 5LA0A 1CXLA 1R7AA 3CUFA 4E4PA 5A8MA 1OGSA 2YA0A 4QLLA 5A6LA 3PBGA 5BRPA 5IFPA 1UH3A 1W9VA 1J12A 3LPPA 4KRTA 3QOMA 4JFSA 1JNEA 1D7FA 3W81A 1W1YA 3WN6A 4W87A 3CHCA 3A4XA 3W27A 1J10A 1WDSA 1B3XA 3II1A 1R7OA 4PMXA 3VIHA 1JFHA 1G9HA 4J28A 4BF7A 1TG7A 3GM8A 4P8VA 4FLQA 5GNYA 4JZ5A 1HJUA 1ZBWA 2DEPA 3U5UA 1HXJA 4CD7A 2BHYA 3K8LA 1E0WA 4QDMA 3VO0A 5CXPA 1W91A 1KQZA 3WNMA 2WMHA 1BVZA 1FP8A 4N42A 4F9JA 1LL7A 1J0KA 2D3LA 1KCKA 1XD0A 1W2PA 2VZSA 5GNZA 2CNCA 4PCSA 4U5IA 4R5EA 2D23A 3EDKA 3VGDA 4UQCA 4CCCA 3CO4A 4AD2A 4PTXA 3OBAA 4RE4A 3W4RA 2ZX8A 1GNXA 1U30A 5GQBA 2VX6A 3N12A 4TUFA 2CPUA 1TVPA 3IANA 2ZUSA 1V02A 1KXTA 3CMJA 2CERA 3WNLA 3CZGA 3SIMA 4P8WA 3K4DA 2GK1B 4PN2A 1DWGM 1W3HA 2OLHA 1ZS2A 2WC7A 4A4AA 3WD3A 4E2OA 5I23A 1SFSA 3PHAA 2X8RA 3CIVA 1DWHM 3T09A 4PTMA 4UQEA 1XSJA 2EEXA 4X9YA 3RMEA 1JI2A 1ISVA 1Q4NX 2VZOA 1H41A 1ISYA 4B9ZA 3PZOA 3WF2A 2YOCA 2DT0A 4UZSA 4K68A 2J7DA 1V02E 2Y8VA 1GVIA 2WNWA 4B3LA 3AMGA 2ZUTA 1YQ2A 3SURA 5CG0A 3AXIA 1NWRA 3D5HA 1U33A 3WD1A 1QI4A 1B3ZA 5A1AA 2YDSA 5HPCA 1EGZA 3KE0A 4UQ9A 2A3CA 1WAWA 4HZ6A 4ZXLA 2CBIA 4UFMA 1E4LA 1I1XA 1QNOA 5AC4A 5FKYA 1IZJA 3IJ7A 3FY1A 2DSWA 2BFGA 4MB3A 3B9DA 2J8GA 1BF2A 4QLJA 4D71A 1BQCA 5LYRA 1QBBA 2ZXBA 2VX7A 2VR4A 3WNPA 3VD7A 1R85A 1PX4A 2UY2A 4PMDA 1IZKA 1JGIA 4M81A 1KR1A 2VRQA 2FHFA 1MFVA 2D24A 4YHEA 2PWGA 2X2YA 1EDGA 2XVKA 1DWAM 1QVBA 3DYMA 1E6XM 3MUY1 1CGUA 1QW9A 1Q6GA 2CXGA 2EO7A 3HJEA 3GNRA 2DSZA 2D0FA 4F79A 1J11A 1LF1A 1FHDA 3NCOA 4QLKA 1KQYA 1M53A 2XHYA 4UCFA 4Z2GA 4PMQA 1M03A 2XFRA 2EBNA 1MQRA 3PZIA 4HOXA 5BXTA 1ZJAA 4P8UA 3WKZA 2WWCA 4FLOA 1W3LA 1E6NA 3BLKA 2WCGA 3RM4A 1CXEA 3VMNA 3GDBA 2QPUA 1H3GA 1HKJA 4CU6A 2WMGA 3SCNA 4NRSA 1CYGA 7CGTA 2XJ7A 2ZWYA 3WSUA 1BFNA 4LXFA 5M17A 1E40A 5FL1A 1J01A 3W25A 1HVQA 1UH4A 1Q6CA 5GNXA 3VGBA 3MUIA 1AQMA 1V6VA 2V5CA 2QHAA 4V27A 3WIJA 3WBEA 4PSPA 1ZBKA 3UETA 1UH2A 2GK1A 2XVNA 5HPOA 2VNCA 4XUYA 4WIWA 2VVNA 2DGAA 2XM1A 4ATLA 5HNNA 4D6IA 3PZUA 4HU0A 4X0VA 1LG1A 2J4GA 4GIAA 3A6OA 2Y8KA 3WEZA 4P8XA 3VX0A 4JFWA 3VMPA 5AYBA 3KWXA 2BY1A 3FN9A 4AY1A 5D8ZA 4W5ZA 3CPUA 1UWRA 4PMOA 3WEOA 4MJ4A 1NH6A 4CN6A 2EPLX 2YJQA 3EBVA 2ZX5A 5A6BA 5IHSA 4M82A 1QI3A 4NSBA 1XCWA 3AJ7A 3BSGA 2BVDA 1DTUA 3MUZ1 5A94A 2J8FA 3QHMA 2A3HA 4MDOA 1WZMA 3WQ4A 4AMCA 3DECA 3VTRA 1QI0A 1UA7A 4XX6A 4XB3A 3WNNA 3BMWA 1WZKA 1NWTA 2D0HA 4U2ZA 2YL6A 6A3HA 5CPSA 4D6HA 2WKGA 1E6RA 1NWSA 2J7CA 3N15A 4AIOA 2JIEA 3VIMA 2XSBA 2VRJA 3CZEA 4KMQA 3VIOA 1DEDA 1WNOA 2OSYA 3WQ6A 5E09A 1CZ1A 1UWQA 4LX4A 3AIEA 5M5DA 1HJXA 1HJVA 4WSJA 1OINA 2BNJA 4WSKA 4HZ7A 2G3IA 4KWUA 2J74A 2VL4A 2WCSA 3A47A 3WD0A 4Z2JA 1PEZA 3BH4A 3U7BA 4EANA 1JZ2A 3VD4A 3SCOA 1UKSA 3ECQA 5JBFA 3SCSA 2ZUMA 4AW7A 5I77A 1HP5A 2YA2A 3L4TA 1E70M 2GJXA 3FHAA 3QOKA 4P7QA
chains in the Genus database with same CATH superfamily
1Y5WA 2H3BA 4IWWA 1A49A 1IGWA 2D73A 1O4UA 3NFUA 5HATA 1XH0A 1RJRA 2YDAA 4Q4PA 2D2JA 3GNOA 4O8AA 3ZS4A 3WMLA 5A8GA 3RO6A 2BY3A 3GNPA 1GW1A 3TIMA 5LKYA 1TELA 4Y7EA 2PZNA 2QDGA 1BG9A 1V51A 1ZTVA 5J5RA 2ZVIA 2HK1A 3AIVA 3MU7A 3W70A 1NFGA 4GGBA 3CL6A 2JGYA 2ZIDA 1EDQA 1FDJA 1XGZA 3GVRA 2HNHA 4OHQA 5AECA 2BY0A 1YRRA 3S6OA 3CS2A 4G1NA 4KIEA 4XD4A 5DY3A 2PCEA 1F74A 1IV8A 5F2MA 3AJXA 2BVTA 2YGYA 4LBRA 4LV4A 3ITYA 3F2DA 1WXYA 4WVXA 3LPFA 2YKKA 3QV9A 4EOUA 3WYZA 4JYDA 2VEGA 7TIMA 1T99A 4R7JA 2EGZA 3F4WA 3PTMA 5HWNA 4JTLA 5I0DA 4LS0A 3P3BA 3G0SA 1W5PA 2X1UA 2VURA 3NQFA 1B3WA 4S3FA 4GQRA 2WSPA 2Q01A 2WLZA 2Y7DA 1EB3A 1G4TA 3HMCA 5KEZA 3B4YA 1VCVA 1ODUA 1EH9A 1PKLA 3MB9A 3PTQA 1FFRA 5K3VA 1F6KA 1UZ4A 2D1ZA 4WK9A 3NVTA 3TK7A 2PDWA 1H51A 1LWHA 4IH3A 2C19A 2G3JA 2O4QA 4S3DA 5T9BG 3TYAA 2PZ0A 3EAUA 3KUMA 3GIYA 1EKOA 3QZEA 2E40A 2VFFA 8A3HA 1PS9A 1EJVC 2ZXAA 4HMEA 1G4EA 2VFEA 1PWMA 2XTKA 1WKYA 1DWFM 1MQPA 5E1QA 1OHLA 5EMJA 4K36A 2J47A 1QHPA 3OG3A 1V0MA 4QX4A 4GNJA 1BTCA 3C0SA 3MDWA 1QPKA 4AVFA 3SI9A 2PTDA 3CBWA 2DIKA 4K1WA 2QDDA 3GH5A 3BMVA 3MV11 1JFXA 2IQTA 1JDCA 3LCLA 1AD4A 2INEA 4UQDA 1MQQA 1KTNA 2HWGA 2FGLA 3PJTA 3N9KA 4MY8A 4G8TA 3FLUA 2W9MA 4XD5A 2PDNA 4PUUA 1N8FA 2JQXA 5AZ0A 1B57A 3EA2A 4E2DA 4ZE4A 4DF0A 3T78A 4CCDA 1J0YA 3PPFA 2PBGA 3P84A 4KKXA 2BGNE 5AYYA 3NO3A 1OIMA 1UG6A 1NOUA 4UBPC 3T8LA 3B40A 2V38A 2F6KA 5F2LA 1MDRA 4OT7A 1Q7QA 1ISWA 4GK8A 3W85A 5T26A 5CPOA 1V6UA 4IP5A 3EB4A 1QR7A 2XZ9A 1W9PA 3QQWA 5DMYA 4RDWA 2IXUA 5DXYA 2W5FA 3TJ4A 4O1AA 1L2QA 5L6UA 3STEA 2L5HA 3VIFA 4KEMA 1I2OA 1DPMA 1W9XA 3TWAA 2DSVA 1Z69A 1AW1A 2NQ5A 2WO5A 4J9JA 1FCQA 1PB0A 2HS6A 4DF2A 4N6EA 3WY1A 2OEMA 3G3DA 4NZ5A 4GHRA 1H7PA 1W1B1 2FPTA 1QK2A 5EFDA 1XC4A 4MNKA 3ZJ7A 1EOMA 1XC6A 2RGMA 5EA9A 3VVGA 3EOLA 4MKNA 3NZRA 2XISA 4LV9A 1ICQA 3B8SA 3WQ8A 5LNWA 2F2KA 2REQA 2G50A 4OV4A 1WDPA 1GG1A 3EDFA 4LOCA 4RZBA 1D8CA 3GG1A 2DT1A 4S3GA 1EC8A 2OODA 3C2VA 4Y9OA 3UXIA 4W4QA 3LQGA 3MHUA 1C29A 4PUMA 5GJMA 1TZ7A 3C86A 3EA1A 3W7NA 2W91A 3MKKA 4FNQA 1JDEA 2C0HA 1WE5A 4ZO8A 2CKRA 3O6AA 3A5VA 1JJKA 1FHLA 2Y62A 3WG6A 3GDLA 1RQEA 1GK8A 5ABHA 1DL3A 4IXXA 4C6BA 3H7UA 5AHMA 1X98A 1QJWA 4NF7A 4PTNA 3H8AA 4WGXA 2CZFA 1C7SA 4LUJA 2ACRA 2QCDB 1MRQA 3G1VA 3WUBA 2B7PA 4HK6A 4KEVA 1EXPA 3OLDA 3AYRA 3W6YA 3PSWA 4FNRA 3P14A 4NNCA 4FF5A 4D6EA 2F38A 3UZWA 3ES7A 4OU1A 4QSHA 4DXVA 3FGCB 3W1UA 5XIAA 4PGLA 1BYAA 4LF2A 5DCEA 2HXUA 1A5MC 1Q6LA 2GVYA 3DENA 4OTKA 2NT1A 1EWEA 1U1HA 3S9ZA 1JF6A 3GYEA 4C6QA 4H9MA 4MTVA 5A6TC 3AICA 4TVUA 2XUCA 5LA1A 4P2VA 4MWAC 3WEMA 2DJXA 3U5YA 4AZBA 2BXYA 3BLPX 3CV1A 3CPRA 3PBWA 1GYNA 2QCNA 3EDJA 1AW5A 2Z1SA 1I8JA 1QK0A 3RG6A 2CZVA 5JU6A 1M65A 3CL8A 1G94A 5D9OA 3QFWA 2XIMA 4M6QA 2DDXA 1AH0A 3OZOA 4ZL1A 2YL9A 2UY5A 9CGTA 3S0CA 4CGTA 6REQB 3STGA 1CXHA 4O4VA 3W88A 1CXFA 1LLZA 4XZ9A 4PMZA 3R89A 3N9RA 6ALDA 5I79A 4D6JA 1TSIA 2OLAA 4JTIA 1PWLA 1MEIA 3V1PA 3UXAA 4U2YA 4GH3A 1X6UA 5E93A 5F1UA 4RXFA 5I3JA 5K4ZA 3NQAA 4LFYA 3W74A 3AIRA 4QDWA 1XD1A 5HJXA 2XH2A 4KPLA 5DY2A 3FSUA 3VCNA 2YW4A 1FWGC 1XRVA 3LOTA 4XUGA 3L5LA 4V28A 4IPJA 3LPGA 2NVAA 1A5SA 1A5AA 4J3ZA 2ZRZA 4TU1A 2XGIA 3UVAA 1C7TA 2Z24A 2OU4A 4P61A 3I3BA 3TTSA 2G97A 1GUVA 2POZA 2YW3A 5F4SA 3RCMA 2AKMA 1TPB1 3GNDA 1MXSA 4GKLA 4ZOAA 7A3HA 5C2CA 4PCNA 2NVCA 1ZLPA 4CLMA 1XIDA 1KBKA 2ESCA 4H04A 3V0SA 2A3BA 4UUIA 1OVDA 4NAFB 1M68A 1YDYA 1XKJA 1IIGA 1H7NA 7REQB 5I03A 4XVDA 3VIGA 4FEZA 3AS1A 2WW5A 4XISA 1JZ7A 1P7TB 1IXPA 4MNJA 4ZGYA 4LYQA 1C91A 2GOKA 4IQJA 1TWZA 3V1HA 1HGWA 2IKGA 4UTJA 1TPC1 4PFMA 4IX2A 1SZGA 4MDPA 3MBDA 1V8EA 1AJZA 5GJNA 2GVEA 4HN4A 3K4AA 3AHYA 4W89A 3V0UA 3IV3A 4FP1A 2VCBA 3UG5A 4MB1A 4ZQPA 3IJQA 2JIWA 4ACZA 8XIMA 2BASA 2C1HA 1E4MM 1IXQA 2GL5A 5HMDA 3R43A 2TYSA 3FJ4A 2W27A 3FGCA 2BXVA 3W7EA 4DELA 4OZOA 1K8CA 2I14A 4AF0A 2Z0IA 4RZ4A 3TZFA 1RJPA 4URIA 1OABA 3LI1A 3CYJA 2J13A 1ZFJA 4PUKA 3SSJA 3MPGA 5C2XA 4EPDC 1OFQA 3RU6A 3W37A 4TX8A 4JAWA 1E0TA 3W24A 3PJUA 1OCBA 1YNQA 3KL0A 4MB4A 2FDMA 4H01A 3ARWA 1O94A 4H9XA 4KF1A 2OWWA 3BAXA 4G5DA 1UYQA 5FEZA 4B92A 5FCZA 1AUSL 5CSSA 3CTTA 3FEQA 3P0XA 1HJWA 4I8DA 5CLTA 3L68A 4JL2A 3UXLA 4YN5A 2V5JA 4GXMA 3FYOA 4D6DA 3M46A 2V67A 4DWSA 3GZAA 2VYOA 3IACA 1R2TA 5FSDC 4I3GA 3W38A 2R9RA 4Z0JA 2DUAA 1S39A 1GVYA 5G4EA 1V0NA 5F2GA 3EMCA 3FIGA 3NQGA 1XBVA 4W85A 5EBAA 4HPHA 5FJIA 1V3JA 4G9PA 1IWBA 3HF3A 1IE7C 1A3HA 4GG9A 2OYKA 3EKGA 3BCJA 3LRKA 4H8UA 3L4WA 5BRBA 1E6QM 1HQTA 1C9DA 3CC1A 1SW3A 3IVTA 2CBJA 1AQ0A 5BU9A 2X1IA 3OPSA 1IT0A 2WM0A 1JCMP 1QDSA 3UJFA 2V5DA 3VGGA 3XINA 3L4XA 3CHVA 1XPYA 4BF5A 4C6MA 2YLLA 2J66A 4ACZB 2D20A 4C7DA 2PWVA 1TV7A 3TP4A 2EPOA 5JQ9A 4NZ1A 1OX4A 4OVXA 3P82A 3GXTA 4UQBA 3CUJA 3MQTA 1RP9A 3K8MA 2YZRA 4ATDA 3QPZA 3ZJKA 6TAAA 3BJSA 3CLWA 4AD4A 1CI1A 4QIUA 2V0TA 1VEPA 4DJFD 1L9WA 3PAOA 2YB1A 3T9PA 4K7YA 2XDFA 4GCXA 1GHSA 1PHWA 4ZQMA 2GWGA 1HJSA 2B31A 2OELA 1W3KA 1DJHA 3T1GA 1KM5A 4B5WA 3WDQA 1WOBA 3N17A 2D22A 2ISDA 1PJ9A 3BMXA 3VNZA 3CUIA 3A4AA 1IF2A 4W84A 1W8GA 5DN1A 4AX7A 4C1NA 1L0PA 2F61A 4F4RA 3GTXA 3G1SA 3PZVA 1EL3A 2Z6IA 1XM3A 3UA3A 3AFBA 3OU8A 1J0ZA 4LUTA 1ZBCA 1W0MA 4CU8A 1LLOA 5RUBA 3R6IA 3N11A 1E6SM 4IMCA 1IGSA 3R2GA 4LBUA 1RPKA 3U3HA 2V6AA 3M0HA 3PUOA 3CAWA 1MEHA 1P0KA 1E72M 3WJSA 3W2MA 3L4VA 3O6DA 1SUXA 3FCPA 2CYGA 4XZIA 5D2TA 1WDWA 1SO6A 4QCEA 1GOQA 4MG4A 3TJXA 4OOZA 3WUGA 5DT5A 2YXGA 3WENA 4GO9A 3AMLA 4BA0A 1I0DA 3LPOA 3W7GA 1G6CA 1UZ1A 1FVPA 3TYCA 2DZBA 3QXBA 2ZBTA 3HV9A 1TJ1A 4M1RA 4I7WA 4LVDA 1VHNA 2J7HA 5FJPA 1CBGA 4JNZA 3NIYA 2WMIA 1CLXA 3NQMA 3QY7A 3BWWA 5C9ZA 1VBRA 3M6YA 4DZIA 2RUSA 4HP5A 1NTHA 2O92A 2OT0A 3P93A 1F73A 3S2CA 5I3IA 2QIWA 2OSWA 1C8YA 4UMCA 4UTMA 1F4HA 4G2DA 1M7OA 5AHNA 5U4NA 4QNWA 1Q8AA 1SQ7A 1ITXA 2VUYA 3IPWA 1EJWC 4J1OA 4X63A 1S3TC 4EKJA 1NEYA 2QZRA 2GDVA 1R3SA 2OSXA 4DRSA 3S2LA 2FVMA 3O8AA 1J6OA 3GTNA 1B3YA 1F3WA 4NJHA 2NSOA 2NXHA 2J7FA 3UEQA 2WVVB 1JUEA 4OBRA 1IWAA 4GKTA 3A12A 5H8MA 2YBVA 1A3WA 3KZPA 4I5RA 1GOMA 3ATZA 4N9BA 4PCFA 3PFMA 2O9OA 5A6MA 4MPKA 1DXEA 3DC8A 3ZJ6A 4DO4A 5ABFA 2W67A 3ABOA 4FR6A 1TA3A 3W84A 1K8XA 3N2CA 3QKEA 4J4KA 3CWOX 3AS0A 3E9AA 4ZB2A 1J8VA 2W4XA 5FESA 2XVGA 4NY2A 3RJXA 3E5BA 1OGBA 4BZYA 2PRHA 1RD5A 3ZSSA 1D3GA 3KRBA 4M1BA 3H4WA 2NX9A 5KZ6A 4HCHA 3TQ0A 5G2HA 3PZQA 4AHQA 1B3VA 4A6GA 3PG9A 5DQPA 4M24A 3VNMA 2X41A 1N8IA 7XIMA 1O68A 4IZGA 4YPJA 3HQ1A 4PULA 3BLFA 1UD4A 3DKLA 3PPCA 2FTWA 4XTDA 3OGVA 3LK6A 1P5BA 3HPAA 1UBPC 3M44A 3TR2A 4JIRA 1XIBA 3KCOA 4EK7A 2DV0A 4E8GA 2J7GA 5DMLA 1UWIA 3TUUA 3DFTA 3A23A 1W8SA 3N4EA 1LBMA 1EEPA 1UKTA 1GQLA 1PHQA 2E4TA 3WQCA 3ZO9A 3ZLFA 2V3GA 3PAJA 4A3HA 3O2LA 1VFMA 9XIAA 3RCYA 3TJIA 2YL5A 3TSBA 1Q8JA 3KEHA 4HU4A 4NKCA 1V0KA 2GQAA 2C91A 4X0NA 1GJPA 1V3LA 1UPMB 3KVJA 1UD6A 1QRQA 2VC6A 4YCPA 2E68A 3LEPA 1K1DA 1TFVA 2Y5EA 1S2UA 1U2YA 1P4CA 3W1PA 4H4IA 1TMQA 1UR1A 1I2PA 3FNDA 2P88A 3GR7A 1UR2A 3I10A 1X7IA 3NQEA 3PTKA 1E6ZA 3F5LA 3MSGA 3QPEA 3WLHA 1K8YA 5D4YA 2Z7GA 1H7OA 4A8NA 4Q22A 1DXFA 5F4XA 3VFLA 3OIHA 4ZXOA 3PFRA 5LXXA 3H2AA 1W32A 4FXFA 3VNJA 3GHUA 4HHPA 4RNJA 3KBMA 5JBEA 1R5YA 2NUWA 4P7LA 3UZYA 3N2TA 1FWCC 4ZR8A 4UTIA 4GYPC 2VFHA 5I6SA 1QPNA 4HHMA 2WXDM 1NF0A 3W7IA 1NDWA 3WQWA 1T0OA 1BGAA 1UC4A 2P8CA 2OR2A 2RFGA 4JQ4A 4H6EA 2B7OA 1FWEC 2HBVA 1FRBA 4W9TA 2VWSA 1MYRA 1VFUA 5DLCA 4DX3A 1XUUA 2IS7A 3DHUA 1TA3B 5IM51 3M5XA 4FLSA 4HCLA 2DZSA 1OC5A 2YB4A 1H61A 4LY4A 3PZGA 2H8ZA 1P6BA 4ZQNA 1S1PA 2ZDSA 2JK2A 2J88A 5IBXC 3BDKA 1XFBA 4IICA 1SZEA 3NL6A 2W66A 3DU0A 2VUNA 2NQJA 2XVPA 2H9AB 1M01A 4HD5A 2O7QA 3ZXWA 2DIEA 4K3ZA 1EZWA 2GJXB 3DFYA 1TMLA 1GQJA 1FOBA 2A0NA 1WO2A 4WF7A 3TFCA 1QI5A 2QCMA 3A5FA 5JUVA 3B05A 2Y1HA 1AK5A 3C4UA 3T2OA 2XN1A 5E0CA 3GVGA 1CNVA 4NAEB 3TYUA 3OA3A 3O05A 3WQGA 2Z7KA 1HKIA 3OP2A 1E56A 1EC7A 3GE7A 1QOXA 1YYAA 1ZJIA 3UT0A 4WQ6A 1AW2A 3BTNA 3FVDA 1E6PA 3PZNA 1OCQA 3R11A 2E25A 1UR9A 3M0XA 1F3EA 1UA3A 4CCZA 3DHPA 4D9PA 3NZ1A 4ZENA 3EXRA 3W1RA 2W6RA 4EXQA 3IJLA 4KFOA 4ORIA 5BMWA 2GJRA 2YSWA 2BZNA 3QGVA 8RUCA 2NQ9A 1IT8A 2AMGA 1NFPA 3NYDA 3TYDA 3HGRA 1Q13A 4XK2A 3EB3A 1HG3A 3ID7A 1IEVA 2V5BA 4KCTA 2YX0A 3STPA 3B9AA 3ZT5A 3C0JA 3O16A 1VRXA 4PRRA 1MZHA 1V5XA 2XGZA 3W6MA 4HNTA 4DPPA 5IDIA 4FK9A 4QG6A 4AY8A 2ZRWA 1KRBC 2NZLA 2ZYFA 5CSUA 1H62A 5D2YA 4YTTA 4FHAA 1R7AA 4KFPA 4O17A 3CV7A 1OGSA 2YA0A 4QQUA 1OCNA 3L9CA 2CU0A 1XW8A 2PFHA 1W5OA 4EPBC 1S2CA 3W23A 2VFIA 3HOJA 3C2EA 4KRZA 3QOMA 4HPJA 1W1YA 1R2RA 1VBHA 3W27A 1IYXA 3CM4A 1P1XA 3S3GA 4QJ4B 4Y9AA 4AY7A 1BWVA 4JX6A 3NVDA 2GGJA 3M9YA 1O60A 4JZ5A 1HJUA 2XINA 4GJ1A 2B81A 1VD6A 3H2MA 4MY9A 4F0RA 1UJQA 2PDYA 1HO4A 3W1MA 4ECLA 2FGBA 2QNEA 4N42A 4F9JA 2D3LA 1KCKA 3RITA 2YFOA 2VZSA 3ZVHA 2D23A 3VGDA 4AD2A 2E28A 3MVTA 1GNXA 1U30A 4WHBA 1TVPA 4KWWA 4HK5A 1PYMA 1KXTA 4GUHA 2NWRA 3K4WA 1SVDA 1FWFC 4I5XA 3K4DA 1M7PA 3M0JA 4LEQA 3O0KA 4PN2A 1DOSA 4IG2B 4EF8A 1ZS2A 1WUEA 4MIMA 3V16A 2RJHA 3NZPA 2X8RA 2WNNA 2DQWA 3CIVA 3T09A 4IMFA 1Q4NX 1H41A 2OJPA 1ISYA 4JTCA 3M43A 3IJIA 3PZOA 1HZYA 3Q94A 5K9DA 5HAOA 3DHFA 4ZB0A 2Y8VA 3DFHA 2DZWA 2WNWA 4PBFA 1KM1A 3CAVA 1YQ2A 5CG0A 2P1FA 1NWRA 1VC4A 1FKWA 5DX7A 4O0ZA 1XIFA 1TWDA 5HPCA 4ZXLA 4ES4A 3F4DA 3MJYA 4LANA 4GGHA 1I1XA 2VC7A 1IZJA 1HL2A 3W76A 3FY1A 3A4JA 1TTIA 2DSWA 1KM6A 2J8GA 7ODCA 1XGEA 1Q66A 3C0QA 3PWIA 2WM1A 5LYRA 2VX7A 1PX4A 1JGIA 1AJ2A 2FHFA 4NYUA 1MFVA 2D24A 2DZUA 4GOAA 3UY7A 2X16A 2FZNA 2QUTA 2EO7A 3HJEA 2DSZA 2AL1A 4F79A 3WK2A 4HSNA 1SJCA 3MUXA 1KQYA 1WQ5A 4YMZA 3N3TA 4PUNA 5I3FA 4HNLA 3PZIA 3NDOA 3UFYA 1H7RA 4FLOA 1W3LA 1E6NA 4BR1A 1JPKA 1CXEA 4DZAA 4MUZA 5XINA 2PGEA 4UTWA 4OWGA 4HCDA 1BFNA 3R0KA 3GNXA 3W25A 1OYBA 5CG7A 1Q6CA 3VGBA 1JRCA 3R8HA 1UWAA 5FF0A 1NFBA 1V77A 2NX1A 3KLKA 1ZBKA 4JQ3A 4MGGA 3DFSA 2XZ7A 3HA1A 1W17A 3NQVA 5D02A 1TWIA 2XM1A 5JH2A 3PZUA 4HU0A 1LOQA 5EMUA 4JTKA 4P8XA 3QR0A 5JVLA 2KAUC 4IMDA 4AH7A 2C1GA 4L4MA 4IIDA 2EKCA 1PE1A 3CPUA 4YVPA 4DXXA 3QF0A 3GDKA 3I4KA 3WEOA 1UP3A 4LNCA 3N6HA 2YJQA 3EBVA 3UU0A 4H83A 4D2JA 4M82A 1QI3A 1FWIC 3CYVA 3W7RA 2QIIA 1OZQA 2BVDA 1RK5A 4LJ3A 1DTUA 2CWXA 5A94A 1WZMA 2O0TA 6XIAA 2YPIA 4IFOA 4XB3A 3FA4A 2HXTA 4H9UA 1IZCA 2J7CA 3VKCA 4XG1A 2XSBA 3CZEA 3L0KA 2RHGA 3VIOA 1X97A 1DEDA 2NUXA 2Y85A 3GW3A 1TKKA 1ZUAX 3AIEA 1GVEA 1HJXA 1UR3M 4J2MA 2X40A 3MZNA 1EYWA 1HJVA 4A3RA 3UZZA 4WSJA 2PTWA 2QGHA 2VFGA 5K4XA 2EG8A 1G67A 2WCSA 3TQPA 2OMAA 1UZHA 1PDYA 1ME9A 3U7BA 5C2GA 3VD4A 3LGDA 2ZUMA 1RAKA 3NURA 5EBUA 1MUCA 1HP5A 3S5ZA 1E70M 2GJXA 3UYCA 3FHAA 4WX2A 3QOKA 4P7QA 2C8NA 4YHGA 1XIJA 4JICA 5I02A 3RJYA 4Q8WA 1E3XA 4FF7A 3QBUA 4L9ZA 3T0TA 4EWJA 5TD4A 2DT2A 4MWAD 2O9RA 5I24A 2J62A 2P5NA 2E8YA 4AHPA 3UPMA 2BB0A 4Z17A 2PDUA 1E15A 2QCDA 2YL8A 4IISA 1G4SA 2EHHA 4YVVA 4CN1A 2QT3A 3U2CA 1W3JA 1OD8A 4MVAA 2ZADA 3MKCA 3UG4A 2E9MA 3P2VA 1UOKA 3KL5A 2G3FA 5A69A 4LUSA 5A8PA 4JBRA 1HKVA 3W02A 3UZXA 3OZMA 3BAKA 2YXOA 4HN8A 1S5MA 4GH1A 1UMLA 3E3HA 2Z00A 3SRDA 4V15A 1EJ7L 2A5HA 3V36A 3LHZA 4D72A 5DFAA 4N6FA 2X09A 3CASA 3BLOA 3UGVA 5LNUA 4LYKA 2P3EA 3L2LA 1Q2SA 4ERGA 4RDZA 1JF5A 3BAJA 3TKFA 4CD8A 1FHVA 3EOUA 3W75A 4P5UA 1UWTA 3I68A 3BOFA 3K30A 3D3AA 2WPGA 2O9TA 1XDMA 1US3A 1UIPA 4K38A 3DI0A 4DIAA 3G8RA 5C8BB 1G69A 3HFTA 1H49A 3AZRA 2VXNA 1DE5A 1VF8A 4DJDA 3OYXA 4DUWA 3AMDA 4GWEA 3GXDA 1BWKA 4PMNA 3UNDA 2BTMA 1FWHC 4ML9A 2BHUA 2VCCA 3C3NA 4IPPA 4IG2A 1ISZA 2WZIA 3SCWA 3ZR5A 3WQPA 5I78A 3T81A 4ENLA 4UOZA 1TV8A 4A3QA 3WF3A 4GZJA 3V7PA 1LCOA 2GVGA 3CQJA 1G7VA 4IQDA 1MMFA 2BXZA 1ZAHA 2VDIA 4DJED 1LYXA 3DAQA 3B9EA 2PDJA 3WLSA 5FJOA 3VDBA 4Q4KA 3G0UA 4D8LA 1HX0A 4XBJA 1VZWA 4MWAA 4JHOA 3MMTA 3O07A 1ZU8A 3W7MA 3LXBA 4YS1A 4H9YA 2B7QA 3VOFA 3HPZA 5CC7A 3LNPA 1UWUA 2QUUA 2X42A 3WH8A 4ERIA 1QI2A 2FTPA 4JTTA 3W3OA 1T6MA 2VQTA 3GZ3A 2R94A 2BX7A 2HQAA 2HVNA 5HMEA 4AXNA 2QDHA 5EMYA 3ZR4A 1Z3NA 1A47A 3CB3A 3RLGA 1DYSA 3KWSA 3BAYA 2B4GA 3VX1A 2PWDA 3QZ6A 3THCA 4DZHA 1CIUA 3S5OA 3THDA 3KAOA 1L6GA 1UKQA 3B97A 1R3TA 5CJNA 1WOAA 1F05A 1W1IE 4DBDA 5A6BD 1XBZA 4XAYA 4K39A 4HPXA 3NL2A 4PCPA 4BFAA 1JYVA 2Z1VA 1UUQA 4ZO9A 1L6YA 2A79A 1J0IA 5GVJA 4R9XA 3T44A 5I09A 2BOFX 3B0UX 2JBMA 3VC5A 1KXHA 2V5LA 4QEHA 3AAMA 3FVMA 1ME8A 3B8DA 3VIJA 4GQ0A 1FDYA 1S38A 1Q63A 1VBGA 1KRMA 3R1ZA 2PMQA 3S2NA 2QJHA 4GNKB 2DVXA 2HE8A 2IXVA 1L6WA 3ALFA 3KDOA 3W53A 3NYZA 5FF7A 3UBPC 2VR2A 2D2OA 4V33A 5M3WA 4J3WA 5C7VA 2AGKA 5BYWA 1IR2A 2HMCA 1TPWA 1A4LA 3Q45A 3OVGA 1V6WA 1BKSA 5AOUA 3FW6A 3BSMA 4ACYA 3BC9A 4Z2IA 4RDVA 1Q6FA 4O10A 4UTLA 1ZNNA 3MCNA 5CC5A 2CEQA 3O6CA 3F5KA 3PPHA 1EA0A 2HPIA 1H5YA 3MT1A 4O16A 4UOJA 1UQZA 4AZCB 4DO5A 1H63A 4JN8A 4I7VA 3AU2A 1SMDA 3R12A 3DXIA 2FPYA 5EFFA 1B30A 4WR3A 1F6YA 4D1JA 2VEIA 3BCDA 2ZUVA 3FA3A 3TFXA 3PZMA 1ME7A 2AQWA 2DU2A 2KX9A 2YIHA 1EJTC 3GFZA 2ZRYA 1BRLB 3LHTA 1JI1A 1TV4A 3SCRA 1EX1A 1DIOA 1JD9A 1KFCA 4AXKA 3AS2A 3FSTA 3SEPA 4DUOA 2NLYA 1A5CA 3E2QA 3WQ5A 3H2NA 3H6OA 4IM4A 2PI6A 5HWJA 4ZA0A 3RU8X 4QFUA 2F6XA 2WSRA 3UQNA 2DZPA 1OFBA 4F2BA 3H7VA 3VKJA 4PRWA 4OE7A 1QWGA 2CHOA 2IW0A 1QNRA 4UIOA 1X1NA 4O50A 1C93A 5CC3A 4B5VA 2WHJA 3SGZA 4WJXA 5EMMA 4ROQA 4WJ8A 2GWNA 2XFYA 3LN3A 3LHWA 2VEMA 1SJDA 4IGNA 1BKHA 4DWSB 1A53A 2X0SA 5CSYA 4HPNA 3CZJA 3MSDA 1KFBA 3VOJA 3M0KA 3BVJA 3TVAA 4CVUA 3ZQ9A 3CZLA 3NPVA 3HJZA 4Q7IA 2ZZ3A 3OGSA 2V63A 1JR1A 3FHQA 4PC8A 1RSCA 3N25A 1L6SA 3NZQA 5IDZA 4TMCA 2Z27A 3H26A 1CB7B 2X0HA 2OZ3A 3OBEA 5PTDA 4AWEA 4B5XA 4A22A 1NDZA 5FJUA 1K9TA 3F03K 2XN0A 5CZSA 2FHCA 3VD3A 3IAQA 2Z2AA 4N9EA 4Z1DA 3S83A 4LVGA 2F2HA 4JTGA 4L80A 3WLQA 3TQVA 2HJPA 3C2RA 3NXLA 4DLMA 3KDNA 5DANA 5JBDA 3W0KA 2Z28A 2VZTA 4AZGA 2OXNA 5ABGA 2H6RA 3KVLA 1DXIA 1FH8A 1JZ3A 4HOWA 4L1XA 1DJWA 2BG5A 1R9ZA 4ALDA 3LZ3A 1O5XA 5BXRA 3OVRA 3I6RA 1WV2A 3G1RA 3UJRA 1PX3A 2PPGA 2DUXA 2ZRVA 5D37A 3N19B 3CU2A 3DIPA 4JYEA 3T0AA 4BEQA 4LGXA 4A8IA 1TX0A 3KOYA 1B4KA 4Q8TA 5LSMA 2PODA 3TYBA 5LNRA 2ZZ2A 5LGZA 3UWEA 4B3ZA 4WZHA 1DP0A 5D2XA 1I9CB 3WMBA 4LS1A 4C7FA 3NSMA 4AZCA 1RA0A 3GNNA 4IFKA 5BXPA 9XIMA 3V5CA 2RJGA 4UTUA 5AN7A 3D46A 3PB2A 2AMXA 3SM0A 1Z44A 4AZ5A 1X8CA 3RDKA 1KXQA 4WGHA 3NQ7A 3WK1A 3AXMA 4ZTXA 1A5OC 3GC2A 3PBVA 4I9JA 3S1VA 4HSOA 3ZMRA 1J2WA 2G37A 2I56A 3LG3A 4O53A 2VQUA 4Q4OA 2JEPA 4PMVA 3Q58A 2PDHA 2YBUA 3F4NA 4B5SA 5CLWA 2VGBA 5I2UA 3NQDA 3SW6A 1XWYA 1ML1A 4MLRA 1Y5XA 3U2ZA 1IEWA 1GTEA 2PEVA 4N7QA 1ITCA 1POKA 3MWCA 4W5UA 5G4WA 3M7SA 3W1NA 4B4FA 2H3DA 2E9BA 3L0NA 1JDFA 3TZNA 4AQLA 3UCDA 1OG0A 1D3CA 4AC1X 1XLJA 3U57A 5T91A 3H2EA 4D8ZA 4JCMA 5CKSA 4JQAA 3N2OA 4QQ3A 3M0MA 2O9PA 1XLBA 1G0CA 2I1OA 4QNEA 3K5XA 1S2TA 1G5AA 5D9MA 4B5UA 3PWAA 2JF7A 1HTIA 2BGQA 3WK3A 4LW7A 1BQGA 5AC8A 3ARYA 1UB3A 1QNQA 5I07A 2YCLB 4GNVA 1P6WA 4MSSA 1EYEA 3AWOA 2XH0A 3I65A 4D6GA 1XLMA 4RKAA 2BVYA 3PUEA 4LWWA 2EJ1A 4A21A 4NNBA 3OG2A 4WOZA 1PKYA 5U7SA 3NGFA 1Z6KA 1YXYA 1OK4A 2ISSA 4DAFA 3WD4A 1BGGA 1FQ0A 3GVQA 5KZEA 2IPJA 4HIBA 6XIMA 3NZGA 4HU3A 1KWKA 2ZA1A 1ENUA 4FOKA 4H2CA 1UIOA 1D7KA 3LCGA 4W8AA 3UJEA 1EP2A 5CZTA 3AYVA 1T7LA 3WNOA 3NA8A 4RNIA 4PR4A 4H3DA 3UESA 4GY0A 3FYPA 4LUYA 3EB2A 1JAKA 3LB0A 3TSDA 1K9DA 4XZHA 3G6LA 2PWEA 4IT1A 1QWKA 3FYYA 4DVOA 4MZ8A 4XO6A 6REQA 4GMEA 2CETA 4WSHA 4WDXA 3DC0A 3FKKA 2A3EA 1GT8A 1YDNA 1LZOA 4I5UA 3GC4A 3EX6A 3VCCA 3DG6A 2NXGA 3FAXA 1E9LA 1JNDA 3LSBA 2CZ5A 3IRSA 3S6DA 3U6WA 3QGKC 3TV8A 1DIEA 1HGYA 1AMYA 4O28A 4QJ3B 1EP1A 3RXZA 5LIYX 3KZSA 3STFA 2QV4A 2OKOA 4UTHA 2WMFA 3LCWA 3MWAA 1S5WA 3T2QA 2WHLA 4NI3A 2DVTA 2OYMA 4FLRA 4JTAA 4XD6A 4JIIX 1LQ0A 2WVUA 2E3ZA 3MV01 4PB5A 4QR6A 3KRUA 4D1IA 3U48A 4IMGA 1VENA 1M9HA 3AIUA 1FWNA 1YE4A 1SU5A 5GPRA 1OT1A 3SUUA 4BQ3A 1ADSA 4GZEA 4YTRA 1MNSA 3H24A 3HQNA 2J9YA 3QTGA 4HSHA 1XCXA 3EWXA 1C90A 4HOZA 5CZKA 4PB3A 2VMFA 3W1TA 3C2OA 4MWAE 3B0XA 1EX5A 2DSUA 4P7NA 3E96A 1K6AA 1F4AA 3M4HA 5KITA 3DG7A 2WWDA 4AZIA 2EPNA 4S3CA 3HG3A 4Q6XA 4PTVA 4Y9PA 2Q3RA 4NG3A 3H55A 2J6XA 1OF6A 3CAQA 1Z89A 4HBKA 4AU0A 1B9ZA 3AQUA 3T2PA 5FD0A 2WSYA 1REQA 4GQQA 4DXKA 2EKGA 2H90A 2A6LA 3M07A 3U2OA 3BXWA 1XLDA 5A2CA 4IL0A 4UQAA 5IFTA 5AYZA 3SJNA 1LROA 2BWGA 1JZ4A 3TONA 2QLYA 3KP1A 3RYSA 4PA8A 1P6CA 4GYPA 4LUTB 1K3UA 2XN2A 1JAEA 4LRSA 4LSBA 1XIEA 2UBPC 2DZTA 1U22A 3MP4A 3HG5A 1TJ2A 3M5ZA 3TE9A 4XBSA 2RDWA 2OQLA 3W7JA 3W2KA 4MNLA 2WNZA 4W8BA 5IXEA 3EXSA 2PD9A 2GGGA 3TLLA 4AC7C 1H0GA 4KIRA 2XVLA 1H60A 2Q8LA 3EMZA 2QMKA 1K70A 4XSLA 4BS0A 3U4AA 1R8LA 1R46A 1GPFA 3FKRA 5C9RA 2WC4A 3G1DA 3K2GA 4L6HA 3HB9A 1EUAA 1SR9A 5EMKA 4NZFA 4E4UA 2A1YA 4QCFA 4OBTA 4RZ5A 5HULA 4EF9A 3OO2A 4F8XA 1NDYA 2WK2A 4FXSA 3SUTA 3EX4A 4EAMA 5MKGB 2F7FA 3HBLA 4IGMA 2CXEA 1YEYA 3LD5A 4GC3A 4ZVJA 3GU9A 5FJJA 3B8VA 3O0FA 4H2HA 1OFEA 2XIBA 3HTWA 1IWPA 1LRQA 4AZ6A 2C79A 1UD3A 2Y70A 5K9CA 4S38A 1CPUA 1CDGA 1W1TA 4RZ6A 4UTFA 3QMSA 3EX1A 3EMQA 1EBHA 3BW4A 3EOOA 4RK8A 5E6YA 4DWSC 1I1WA 3BZJA 1RBOB 4JL1A 1JYXA 4O18A 4KERA 4E6MA 2YCIX 3VFCA 5HK4A 3T55A 5AHFA 4KGLA 4YU1A 3DKJA 4JHZA 2D3NA 3BARA 1MRAA 1TVNA 1DV7A 1EBGA 2GQ8A 1JZ6A 1T8QA 1V7AA 3AHVA 1LWIA 4PL1A 1JZ8A 2HBXA 4Z2HA 2PD5A 1FWBC 4KEZA 3MDUA 2RDTA 1OFDA 4TXEA 4GLEA 3VU2A 4AIBA 4CD5A 1G01A 1FFQA 3OLIA 1CXKA 3CMGA 3LCFA 4PYSA 2UZ9A 1ECEA 1XG3A 4ZO6A 2OOFA 3TW9A 5I7GA 1VH7A 5BXSA 4F48A 2HSAA 1M3UA 2QCCA 4MFDA 3TWBA 4FNSA 1MW0A 4KW2A 3PZTA 3CWHA 1K4HA 2A6NA 1OBAA 4XV0A 3NQCA 3O15A 1RH9A 5HXMA 4UMBA 4DWSD 1XUZA 3QV6A 4QSFA 1Q2RA 4E8CA 4TX6A 4CU7A 4DLFA 3WJWA 4QG9A 4ONVA 4EX4A 4U3AA 4TMBA 4QRNA 1R87A 2QYGA 1XGDA 1N2VA 4PTWA 4QM1A 4B90A 4U31A 2PGRA 2B0MA 4GUFA 3OLGA 3WQOA 4I7UA 3TQKA 4GBDA 4XO7A 4RW3A 3GBDA 3L4UA 3O6YX 3S4TA 1GHRA 2HVMA 1KBBA 4BI5A 3IUDA 1DJZA 2XYLA 4ICNA 5EL1A 4OUEA 3XISA 3RLUA 2ZA3A 4XAZA 2ZXQA 1VCFA 5HNRA 3QM3A 1QATA 5AC5A 4NIRA 4A2RA 1VPQA 2OQHA 1VP5A 3DYOA 4JIQA 2ZICA 1C8QA 3LHYA 3AIQA 4IPNB 3KVKA 1P0BA 2J24A 1U1JA 4U5KA 3S1WA 1WPCA 2QPSA 4UNKA 4KT2A 4FMVA 1XHGA 3HN3A 1YDOA 4B5TA 4XWUA 2WANA 2Y2WA 1TE1A 2G41A 3VDGA 3TR9A 2E8ZA 3Q65A 1XYAA 4GXWA 4AEEA 4M7TA 2PDCA 1S1RA 3BQ5A 2WBKA 4YXGA 4CEXC 3IRDA 1FX6A 1EHAA 1E0VA 4HQVA 3AUOA 2DZXA 4UR9A 3RNDA 4AD0A 1OC7A 1M7XA 5FEPA 3ZWSA 1EJUC 5EYWA 3B0YA 4CNTA 3FXYA 4G56A 1SJAA 3C61A 2OPJA 1Y65A 3N6QA 1LWJA 4IJBA 2IQDA 2VTFA 3TJLA 1XSIA 2Z1WA 5D32A 2V2HA 3CH0A 3PBYA 4TTGA 1OC6A 3ABRA 3GXIA 2XFFA 1E1CB 3UWYA 3HPFA 3AC0A 4XZBA 4GABA 1PV8A 1UC5A 4O1FA 3L2MA 3PUGA 7TAAA 4TVDA 1C8VA 2FFCA 3RPMA 2QF7A 2VWTA 4AZHA 1K02A 3WBAA 3TA6A 1XYFA 1SYTA 1XBYA 4K8HA 1YNYA 5CAKA 3ORWA 2PCQA 2PB1A 1E43A 2DZAA 4QP0A 3S6TA 3B9OA 4BQ5A 3CEPA 4NAEA 5BW6A 1GOOA 4DJEC 3GHTA 3WFAA 1D9EA 5DELA 2FJKA 1XYZA 4GI8A 1XH1A 2J6VA 1W3TA 3LDVA 3SN0A 3FJNA 3CHEA 1TQXA 2Y61A 3GG7A 2AKZA 1R0MA 1M41A 4IIBA 5C70A 3MP3A 1E4IA 3DBNA 3MW7A 4H7VA 1FCUA 1EO5A 3THQA 3H2CA 5AHLA 5ABEA 3NPWA 3IS4A 3THUA 1BYCA 1CENA 5DBTA 1X7FA 5LA0A 1WYIA 3GB6A 4PTDA 2DW7A 1PXGA 4E4PA 5A8MA 4RPQA 3NPXA 4Q8UA 5BRPA 5HQMA 1ZP3A 1YW1A 1UH3A 4O1BA 2JKAA 3LPPA 4NJKA 4JFSA 1JNEA 3W81A 3B8IA 3LY0A 5G1MA 2OFJA 3II1A 1R7OA 4WDUA 3VIHA 1JFHA 4S23A 1PSCA 1KLZA 1OY0A 1G9HA 4WY0A 3GM8A 5HA7A 4FLQA 3APTA 2OT1A 1US0A 2QR6A 1ZBWA 2DEPA 2ACQA 1QOPA 3K8LA 1E0WA 4QDMA 2OKTA 3VO0A 3BURA 1KBJA 5LHEA 1BVZA 4NYYA 1J0KA 1XD0A 1YE6A 1W2PA 4R7OA 2E6DA 1NSJA 2CNCA 3C56A 1YIXA 4G6CA 4R5EA 3EDKA 3N4AA 3CO4A 3G3MA 4PTXA 3NQ2A 4TQTA 4RE4A 3W4RA 3IIXA 3ICJA 4ZBCA 2DFAA 2OB3A 4C6DA 1R3WA 4AWTA 3N12A 3RR4A 3W87A 2CPUA 1ADOA 2ZUSA 1P0EA 3BLIA 2CERA 3E0LA 3CZGA 1I2NA 3GY1A 2VGIA 5BMXA 1F6PA 3G2GA 3PNZA 1W3HA 4DJDD 3UGRA 3DGBA 2WC7A 1B54A 3MA8A 5I23A 1UP2A 1SFSA 3LM3A 5EY5A 2DUZA 3VZXA 4X9YA 1JI2A 1KV8A 5KZDA 3NO1A 3QR1A 1S2VA 1PO9A 3PM6A 2YOCA 2DT0A 4UZSA 5MKGA 4EVZA 1NJJA 2ZRUA 2TMDA 3O1NA 4GYFA 4MFEA 1RY0A 3SURA 3AXIA 1DJNA 3SSZA 3WLNA 3WD1A 4GVGA 1QI4A 2JGQA 1EGZA 3LGGA 4O8RA 2CBIA 1SZNA 1PKMA 1TCDA 3IJ7A 3WBWA 3S5YA 3QW4B 4H9ZA 1BD0A 3B9DA 1BF2A 4RPPA 4QLJA 4QDPA 2Y7FA 3ITLA 4D71A 1BQCA 4GUGA 3VD7A 1JULA 3N2BA 2UY2A 1YXDA 3AU6A 2SFPA 3OQ8A 4PUJA 1KR1A 1BRLA 2PWGA 2X2YA 2FB3A 3IVSA 2HPMA 1QVBA 3DYMA 3GXPA 1E6XM 3PJXA 3QV8A 1CGUA 4HGXA 1QW9A 1Q6GA 3GNRA 1NAL1 3JZUA 1LF1A 3DFNA 3NCOA 3EPOA 2XHYA 3S1GA 3ANVA 3BLDA 1M03A 4JN7A 4LAZA 3W73A 2WJEA 1EZ2A 2WWCA 1JCJA 2I57A 3S5SA 4NU7A 4K8EA 3RM4A 1YPFA 3NG3A 3GDBA 3V35A 3KBSA 4A35A 4RCXA 4JOMA 1H3GA 1ZALA 1Q4WA 4CU6A 1IEIA 3UJ2A 1ZCOA 3EEGA 3T40A 2QCGA 4LXFA 5M17A 5FL1A 1J01A 4LEFA 1HVQA 5T8GA 2Z2BA 1OG6A 3MUIA 1LOLA 1AQMA 1V6VA 4DJEA 2IKIA 2A85A 5EPDA 3WIJA 1WKFA 4HNOA 3DI1A 1EC9A 4FSAA 5HPOA 4XUYA 4WIWA 4IUOA 5FAJA 5HNNA 4D6IA 1UUMA 3H70A 4X0VA 2J4GA 1UP0A 1TVLA 2FLIA 3A6OA 3VX0A 4JFWA 1ZENA 4KCUA 1BVWA 2HK0A 1UWRA 4PMOA 5HMFA 5G1TA 5DMNA 4CN6A 5KINA 4Q7BA 4O15A 3DZ1A 1W3NA 3DEQA 3AJ7A 4H7CA 3G22A 1U83A 5CPLA 1LT7A 3HGSA 3MUZ1 1VKFA 3QHMA 4NX5A 3VTRA 4H9VA 4LRTA 4XX6A 3CUZA 1YTKA 1WZKA 2D0HA 4U2ZA 4C90A 2YL6A 2FYMA 3CAKA 4ZTYA 2GZXA 1TIMA 4D6HA 1E6RA 3KBNA 4KMQA 3BPWA 2ACUA 2OSYA 2GGEA 4N02A 3TW6A 2EG7A 3KOFA 4ZO7A 1CZ1A 3SJ3A 3PUDA 2GOUA 3GWQA 4ZOBA 3OW1A 1LTDA 4G7FA 4H1ZA 1U1UA 3N29A 3HQOA 4XBKA 3FEMA 4WSKA 1TPUA 3RLVA 1XR2A 2J74A 3A47A 3WD0A 3BH4A 4GVHA 5JXQA 5BNKA 3ECQA 4FNTA 3M0LA 3SCSA 3Q67A 3LX9A 4JEJA 3C3UA 1ZPTA 1WKEA 1KW1A 4NUWA 5MHBA 3WL1A 1ZL1A 3GH4A 2G0WA 4XZWA 4N2YA 2OOGA 3NOEA 1W54A 4MYXA 2GVJA 4U33A 1BVNP 1V7YA 4JTQA 4GJIA 3E2VA 4KETA 1FXPA 4EPKA 4JFVA 3IGUA 4ZSTA 3R7MA 2PF8A 1G4PA 3SR7A 1H1NA 3E1F1 4IUGA 3W83A 4L1WA 3SIZA 1QW7A 4GUJA 4L5ZA 3EGJA 4G7EB 4JIEA 5TQLA 4W8LA 2ISFA 3LTYA 4L7ZA 4HA0A 1BAGA 1WP6A 4JDYA 2CKSA 1GVFA 4BWLC 3GHSA 3FJ6A 4HMDA 1AZ1A 2FQIA 4FNPA 1JIBA 5DEZA 2ABBA 4E3TA 4PMYA 4K2SA 1W56A 2BS9A 1BLIA 4JPGA 1L6FA 1WXJA 4TO8A 5CPTA 3M16A 3AXXA 2DJLA 2PLKA 3TTYA 3ARQA 2G8ZA 3TDFA 3AWNA 2NX3A 4IX0A 3ARTA 2E0PA 4S3JA 3IGSA 3WLKX 4F3HA 1J0HA 4ZFMA 3EDDA 3IV8A 2DP3A 3E2RA 4BY3A 2VEKA 3HG2A 1CXIA 1SO5A 1A80A 3FDGA 1VFLA 4LVFA 2XH7A 4QE4A 1A5LC 3CQKA 4JKMA 1AL8A 4XKYA 2R82A 1DORA 4O0QA 1RVGA 1GJWA 4PL2A 2GUUA 2PF0A 3OZPA 1LL6A 3VKBA 2HISA 3ME3A 1PZ3A 3B4UA 3VM7A 5KZMA 1VYSX 3DFPA 5BROA 3GW0A 3HG4A 1GOKA 4IJRA 3IGHX 3UERA 4CNPA 5D9NA 2VDGA 2FMNA 2BV9A 3W7CA 4D6FA 1QO5A 1A5NC 2ZVRA 3RRAA 5E70A 3UWQA 3EWBX 3PG8A 1GKPA 1VEMA 3WBXA 5AVNA 3W7OA 3ZLGA 4JTFA 3GU2A 4EE9A 1IXNA 4YTQA 4GINA 3KP0A 4NJJA 2VZVA 4ZEPA 4L61A 4HA4A 4JEQA 3ITCA 5HNTA 3UR8A 2HEJA 3AROA 4Q7NA 5AYIA 3N1AA 2UWFA 4PMRA 4OJYA 4POCA 3R58A 3W7HA 1N8WA 3RM9A 2YDRA 8XIAA 3P74A 5FJTA 1TPDA 3AI0A 5LIUX 3AZSA 4H19A 1K9FA 1Y7VA 1PKNA 3TN5A 4Y96A 1CTNA 3TC6A 3WNKA 4MJZA 3GQYA 3HURA 1LOSA 3T42A 5LNVA 4WXZA 2WVVA 2PDGA 3B3DA 4HK7A 1TIWA 4DYKA 4JQ2A 3EDEA 3KBJA 4C5ZA 4Q8OA 1XL9A 3SY1A 2QVHA 2OX4A 1B31A 2XFWA 1VPYA 1UR8A 2FTYA 1UHVA 4I90A 3CUHA 1DIKA 1TTQA 4OUIA 4DBUA 1GYLA 4Q8PA 3L21A 3G1XA 3LNMA 4Q8QA 4GY7A 3GKFA 3TTQA 2ZZ6A 1KWGA 3ABSA 4MWAB 3M0VA 3WDIA 2PBOA 4UTTA 3G1YA 3LTSA 3OQEA 3C2YA 5HNUA 1JQVA 3ELFA 3WUFA 1XJBA 5EU9A 1OX5A 4Z1AA 5JIWA 3CPGA 2A3LA 3IJDA 1BYDA 1XKYA 3TC3A 3ARPA 5C9WA 4PMUA 1AH3A 3W07A 4DB7A 2E9LA 2ZUNA 1KFKA 2E6YA 3THAA 5J04A 1OGGA 4M19A 2HTMA 3GTFA 4AF0B 1SW0A 5HOSA 2VEFA 3N18A 2EF9A 3TNOA 1LORA 3OLEA 4J3TA 3VOIA 3A3XA 3R8GA 2V68A 3SN4A 2UV8G 3G5EA 4Q6JA 2HRWA 3CHDA 3W29A 2YXXA 1QBAA 4OGZA 1SMAA 2WB5A 3L2IA 1L8NA 3APYA 2OG9A 3SY5A 1F9CA 1EGMA 1VFSA 1MVYA 5C71A 3TMLA 3DUGA 5E6ZA 1NP2A 2WV8A 4NVTA 4US5A 1WBJA 3ONCA 1AL7A 1PYFA 5FAGA 3F5JA 1IEQA 2QCEA 3NXFA 3CQIA 3CB8A 4M6UA 1J9YA 2HDJA 1H1YA 3FX4A 5HQLA 3LRLA 4PUWA 5LHFA 3MHFA 3BLEA 4Z1BA 4O0KA 3MYPA 3F4VA 3PB0A 2DORA 1KLYA 1XINA 1GZJA 3F1QA 3LZ5A 3STCA 4CNNA 1VLWA 1M04A 4OBSA 1EWDA 1HFBA 3CT2A 4J3XA 4DBWA 2F8QA 1BXCA 3VOCA 4JCLA 4IFKB 3L0GA 2JF6A 4MUPA 4OIFA 1OFRA 3RGTA 3W72A 1Q7ZA 3ANUA 2INZA 3NL3A 3LTPA 4Y6GA 1TREA 4LB4A 1GKQA 1BWLA 1UMYA 3ARUA 4NT0A 3BLLA 3UWUA 1QO2A 3LXCA 1ZY9A 4X2PA 3N14A 4LQ1A 3LENA 4AWSA 4AG0A 2P8BA 3M1ZA 3VKDA 4HNCA 3I7RA 4Y8FA 1QTWA 1JG9A 6TIMA 5BWFA 4BEUA 2WCAA 4O4WA 3N13A 4UFKA 1NIUA 4IXHA 3A21A 4CN4A 2A2IA 2P3ZA 3CGTA 3ITXA 1XIMA 2IPWA 2VGFA 4KCVA 3VINA 4AHOA 1VS1A 3CH9A 1T41A 2PTXA 3PULA 4JY9A 4GD0A 3VKKA 3L7RA 4U10A 1E9ZB 3LRMA 2PTZA 4AUBA 4L64A 1V0LA 1BEUA 1FWRA 2Q6ZA 5CZJA 4R85A 6PTDA 4Z1CA 3CQ0A 4HHLA 2GVLA 3A64A 3KVMA 5G1YA 3D47A 5H2ZA 3B8UA 2NVDA 3NSNA 1H7XA 5CBJA 1JPIA 4IIHA 1C3FA 4U3CA 4R3UA 4R9OA 3Q37A 3UR2A 4HT3A 4IPLA 4BQ2A 2X0YA 4MJMA 4HNNA 2POTA 3CXOA 2R6OA 4GFSA 1JPMA 2PRMA 3PANA 4QAIA 4Q4MA 2Z29A 4CQ8A 3C8NA 1PTAA 3M5YA 4B15A 3OHIA 2CLHA 3T0DA 3KOXA 5BRQA 1NF7A 1R9XA 1QMLA 1NARA 1CW2A 1HL9A 2E6AA 3NWRA 3CV6A 2BLEA 2G3MA 5F4WA 3S1XA 2H8XA 3VOGA 3ERPA 2PC4A 3UXDA 5HR6A 1XYCA 4QTGA 1DE6A 1YADA 4NRRA 1EOKA 4B3KA 2CLOA 1PIFA 1NVMA 1EQCA 1QCWA 1HIZA 4LYRA 3EWWA 3LYEA 1N82A 3AXHA 2QJIA 5FEWA 1S2WA 3V4BA 1GQNA 4KWOA 1JVNA 3SCVA 1XLLA 2FGZA 4GFIA 3DH7A 4LCQA 1SZFA 4W88A 1W9DM 1XIIA 1G1YA 1RK6A 3NEHA 1KC7A 2V2CA 3GIQA 3QW3A 4JTHA 4HJFA 2IKHA 1OD0A 3OGRA 1REQB 4FO4A 1V3KA 3CMFA 4RUBA 4JQ1A 1DWJM 3KBVA 3CQHA 3VGHA 2AQVA 4YJ5A 3OOQA 1RHCA 2XSAA 6ENLA 1XLKA 5FIPA 1I2RA 3Q2DA 2CLIA 3I6TA 4AISA 4JD4A 4PODA 4DJDC 3U4FA 4F0SA 5IRPA 1LRNA 3PZ9A 1PX8A 3P61A 3OA5A 3W2JA 2OZ0A 4X61A 3L5MA 3TYEA 3W1LA 4MF4A 3MI3A 3S9YA 3M0YA 1E0XA 1GQIA 4JN6A 2ZKMX 1V93A 1FY6A 3DX5A 1OCJA 1E73M 4PBGA 1TCMA 4HYWA 1NU5A 5C9XA 1X38A 3DBPA 1GGOA 4E4FA 3UF9A 4F0LA 2O55A 4S2CA 3SBFA 1W1VA 3P67A 1HJQA 3BL3A 4QG8A 5AVHA 4E0CA 4PEKA 3SCUA 2ADAA 5CGTA 3RF9A 1SPQA 3EA3A 5A2AA 3S2JA 5A8NA 3SFKA 2O7SA 3WF4A 1HUVA 4FX8A 2QJNA 5LA2A 1ITQA 2TAAA 4IOTA 3LBCA 4Y2WA 3VD5A 4GI6A 1K7XA 4PH6A 1NQKA 4GX8A 3NM3A 1F8IA 3BW2A 2R14A 3WK0A 4FOJA 3UG8A 4ADUA 3QY8A 5FF3A 1DKWA 1TPFA 1SM9A 5F1VA 3EKZA 1D2KA 2I17A 2VX4A 2ISVA 1LUCA 1HL8A 1MI3A 2I5QA 2W3ZA 1ONEA 3T08A 3U0HA 4GZIA 2NSXA 3C0LA 4KESA 4XZLX 3F4CA 4F0MA 1RBAA 1J5SA 1UBSA 4N9DA 1XYBA 3IGXA 3G6MA 3UWWA 3KCLA 3UZ5A 2W62A 2JFEX 3MVIA 2PLJA 1OWQA 1D3HA 1DWIM 3KOWA 4HTYA 1WDRA 1ZRQA 3GR8A 2VR5A 4F2TA 6CGTA 3GO2A 1XQKA 3APGA 1AQHA 1CGTA 4EXAA 3UCQA 4C6JA 3BG5A 5CPMA 3A24A 2FZBA 3KRSA 3QYSA 5IHRA 3M64A 4F66A 3O3RA 4L6OA 3J7HA 3P62A 1BHGA 3NDYA 1ISXA 3ARVA 4NXSA 1W9UA 2Q09A 1FA2A 3KTXA 3MUAA 1HKKA 4INFA 3H22A 4WCJA 3HIJA 3W1XA 4CQCA 1IQ8A 1RUSA 1DJYA 3P5ZA 4GI9A 1Q7MA 1TUXA 1V79A 1KV5A 3W1QA 3OTRA 2E6FA 2QVNA 1ZAIA 3QVQA 3V75A 4K1GA 2Q8XA 1ZJHA 2OZ8A 3MYOA 2CITA 3GG0A 4NZJA 4TTUA 3RM8A 3NUKA 5CBBA 3OVPA 3RIKA 3JUGA 3O06A 2J79A 3T05A 1B90A 3BGAA 2D2HA 2HS8A 4H6RA 2GUYA 3NNTA 2DH2A 3SCTA 3WLPA 3W71A 4QJ5B 3CT7A 3OB8A 5BZAA 2PURA 4XIAA 4NHVA 4UOQA 4NQ1A 2NW0A 2ZC8A 1UCWA 2YYTA 3WLRA 1QAPA 1OM0A 2BMBA 3NPUA 4UR7A 4KFNA 5DO8A 2VP8A 1B0IA 2ALRA 3WH9A 3ITOA 2BOEX 1SR0A 1PAMA 1RR2A 1XBXA 2XG9A 5AC7A 4BWLA 1S46A 2WC3A 4TVCA 1F7BA 2QCHA 3WLJA 3HV8A 7REQA 1RPXA 1CB2A 4HA1A 4AX6A 3DGRA 3HU7A 4KWVA 4EXBA 5HJLA 4GISA 4PMJA 2CLMA 2E77A 2WZEA 4N4PA 4WJEA 5DBUA 3TXZA 4NNAA 1HNYA 3MSYA 5C54A 3H21A 4AMAA 4XQ6A 3PC0A 3KBWA 1TWSA 4AB4A 3A22A 5CGMA 2OQYA 3R4IA 3A4WA 4WKHA 4X9SA 2XIIA 4WKFA 4QROA 1QASA 3T7VA 3LQLA 3RCNA 3BAIA 1J6PA 1HP4A 3NEVA 3AYSA 4QE5A 1HT6A 4OKDA 2VZUA 4B4HA 4GACA 1JCLA 1CGVA 2C71A 3I3DA 5F7UA 5D30A 3I3EA 4RE0A 8TIMA 1WZLA 4N9CA 3GC5A 4C91A 1YTDA 4GI4A 4GPNA 4ERAA 3ATYA 4L4OA 4R34A 3AS3A 1Q85A 4Z2KA 1RD6A 4JKLA 4A3UA 1KB3A 3KOZA 4EP8C 1GKRA 3N73A 5D09A 1UD5A 3LCXA 1HKMA 3ZZ1A 1XISA 3KTCA 4E2BA 4ZE5A 4DHGA 3RN6A 1QHZA 4DQWA 2VKZG 3KS5A 5DCBA 1I75A 2PAJA 4J2PA 4Z1YA 3E0VA 4JHMA 1XLGA 4DZ5A 1NELA 3NJ3A 2AGTA 4DNHA 5DT7A 2ATMA 2UY4A 3PVFA 3ISIX 1QUMA 3WDPP 4KWSA 3EKLA 1NOFA 1O5KA 3CO8A 3PN8A 4IP4A 4UCGA 3GXMA 1PCWA 1EIBA 1S5NA 3POHA 3VGFA 3ARSA 2QULA 3R0UA 5CJ5A 3R13A 1UKPA 5AY7A 5K9XA 2OZTA 2E1WA 1AODA 5HBFA 1PDZA 4UXDA 4QXIA 4LAMA 4YL2A 2FJUB 2PU0A 2YCJA 2BGSA 3I7SA 3SECA 3C2FA 4OOUA 1QXLA 3VNYA 4LYPA 3BGJA 1H0IA 2VDHA 2WJDA 4GIEA 3VC6A 3B04A 3C52A 3MUCA 4ASTA 1VBUA 4GRSA 1O12A 3AIWA 1ELSA 2HV5A 4LC6A 1AZ2A 4NZCA 3LLDA 3NSXA 3PBUA 1LL4A 3W82A 2PP1A 3TROA 2V3FA 1OADA