3PJUA

Structure of pseudomonas fluorescence lapd eal domain complexed with c-di-gmp, p6522
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
249
structure length
249
Chain Sequence
QSLVADVGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Cyclic dimeric GMP binding protein
total genus 86
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjuA00
2R6OA 2W27A 4HJFA 4F48A 4Y9PA 4LYKA 3GFYA 4RNFA 3SY8A 4FOKA 4HU3A 5MKGA 3N3TA 5M1TA 4Q6JA 4AG0A 3GFXA 4FOUA 3GG1A 5MF5A 3S83A 4F3HA 3HV8A 4RNIA 3KZPA 2BASA 4Y8EA 4Y9MA 4J40A 4RNJA 4Y9NA 3GG0A 3PJTA 4RNHA 4KIEA 3TLQA 3U2EA 3PJXA 3PFMA 3PJWA 4Y9OA 4HU4A 3HV9A 4ES4A 5MKGB 4LJ3A 3GFZA 3PJUA 4FOJA 4AFYA
chains in the Genus database with same CATH superfamily
3BV4A 2XVKA 1E73M 1QBAA 3MV01 1LOLA 1EDTA 1WB0A 4G7EA 1OGSA 1UA3A 4IL2A 2WB5A 4V1YA 1OX5A 5AC6A 2C6QA 3LCLA 3MKKA 2ZC1A 4GUFA 2ONEA 3LLFA 5JBEA 1J6PA 1E3XA 3AS2A 4E2OA 2J74A 3F1QA 3IJ7A 4DXKA 3W1TA 2WZHA 3CZLA 3OB8A 1G4EA 3TROA 3M64A 1V93A 3UR5A 1H7NA 2XISA 3VABA 3VOHA 3K1GA 1NOUA 4HN8A 4DF0A 1AG1O 1A0CA 3V1HA 2Y6ZA 4E8GA 1WE5A 4JEJA 1IZCA 3ZWSA 1W3IA 1W9UA 1YX1A 3FAXA 3S1WA 1IQ8A 3V5OA 1W9DM 3WNOA 2HJPA 1VH7A 1K6AA 1ADOA 1Q7MA 3E74A 3T0CA 5HWJA 1GOIA 3N1AA 3G1HA 1BSLA 3TJLA 1XYLA 2GJNA 3PNZA 3DIPA 1RCQA 1TA3A 1HP5A 1DJQA 2Q8ZA 5CPSA 1QCWA 1JIBA 3ME3A 2W66A 3G6MA 4MFEA 2WBKA 1TV4A 4N6EA 4G1NA 2TYSA 4MLJA 4MZ8A 1PIGA 3L0KA 3UXAA 5A2CA 2AQVA 4H7ZA 1B9ZA 1RLDA 2EG7A 1I2PA 3RM8A 1U5JA 5DELA 3ITGA 3CIVA 4I5UA 3NSMA 4FXFA 3GNPA 1JNDA 4FR1A 2C15A 1FP9A 1XLLA 3PTMA 3EYPA 2NVDA 2FDSA 3SQSA 5LHFA 2WZMA 5D8WA 3M0IA 1C8XA 2X0HA 4F0MA 3RITA 3T0BA 2QPUA 1RVKA 2EKGA 3CZEA 1WP6A 4O4VA 5LNWA 4NNBA 3RILA 4EE9A 2PDQA 2YGYA 3ARRA 4PR4A 2PCEA 1B30A 4MVAA 3TTOA 3MKCA 3OP2A 5CGMA 2WVSA 1XQKA 4RK8A 2NQJA 3WJWA 3LHWA 3E02A 4WZHA 3PZTA 4IG2A 3FHQA 3BOLA 4PCSA 4BEUA 4XAYA 3QTGA 4YYFA 3E5BA 1OC5A 5C7VA 3GYCA 1AJ2A 4XAGA 3CC1A 1I2QA 2C7FA 4W93A 3II1A 4WD0A 2VFEA 1VFMA 5D2TA 3QJAA 3HPSA 3S9YA 1P7TB 1GZGA 1HKKA 2J66A 1W3JA 1S2TA 3CZGA 2DZTA 2VC6A 4K37A 4J35A 1TREA 2B4GA 3EAUA 1EUAA 3F5JA 4JEQA 4EAMA 1U1HA 3GD6A 2P5NA 3SR7A 5MKGB 2GUUA 3GDBA 2XM2A 4XVEA 1V7YA 5CPQA 1H4PA 3P93A 3TTQA 5LIYX 4ACYA 3TQKA 3SCTA 4PZVA 1J12A 3UG3A 5H91A 3R5EA 3T0AA 3KVLA 1Z41A 2XN1A 3AI0A 3NQ6A 3F2BA 4ZOEA 3KRZA 4PSPA 4JDBA 4FMVA 4WCJA 2WVUA 2KAUC 3JU2A 5EB8A 4MPQA 2C1GA 2FGZA 3SN4A 3MCNA 3Q94A 3O6DA 4AZCB 3PTDA 3UZYA 5M17A 1MWOA 2EJ1A 2ZZ5A 1UIOA 1GQJA 2J7DA 3LERA 3HGRA 4Q6JA 1U5HA 3G24A 2V68A 1EO5A 2VXNA 4EK7A 1AQHA 3PJXA 1ZBKA 1J18A 3ZJKA 4IQLA 2ZRUA 3DXIA 5A2BA 4LB3A 2QDHA 3L5AA 3R58A 4D72A 3I7QA 4YVXA 1NOFA 1OGBA 1W5QA 4LYQA 2E6FA 4JQ3A 4H3DA 3OBKA 2EKCA 1BQGA 2XN0A 4K7YA 3PZVA 3FY1A 3FK4A 4IPNB 4GVIA 3SRFA 4JTLA 2O4QA 4TX6A 1TWIA 2ACQA 1L6SA 5FF7A 3H8AA 2BOGX 1GQKA 2FTYA 3RLVA 5C9WA 1JYVA 5FEPA 5AY7A 3GG7A 4QHRA 3RCYA 2WC7A 2E7FA 3MP4A 5LYRA 1OK6A 2OWWA 1K9EA 1XUUA 2XSXA 1UQYA 2PURA 4DJFC 1TJPA 3W71A 4M81A 1HJXA 1ISVA 3NQGA 2WVVB 3GS6A 4AD3A 3VC6A 1EHNA 4DHGA 4UC5A 1BTCA 1EZWA 4TUFA 2PDIA 1H0IA 5T91A 3PC0A 3K4DA 1NELA 1UD2A 1QT1A 4LJ3A 4WGXA 3ZR5A 2PGEA 5AC4A 5EMUA 4WRHA 4C6JA 2VGIA 3BJFA 4I9TA 2HV5A 4BQ2A 3NWRA 4FR6A 1E9YB 3CL6A 1UD5A 1EEPA 1SMDA 3SUVA 5EFFA 1JPHA 4LCRA 1NDWA 3GNOA 4UFKA 1OVDA 1JCTA 1BTMA 1R30A 3R2GA 4OGZA 3PZ9A 1H3GA 3NGFA 2DW6A 1CTNA 4JYDA 1EFZA 3WQGA 3PP7A 3C2FA 4Y9AA 2GFTA 4DM2A 1MXGA 1XYCA 1DQXA 2Q3OA 2QXWA 3GFZA 3B97A 4Z1BA 4S38A 1PL9A 4ZODA 2E5CA 1K77A 1AZ1A 2BXVA 4AY1A 1JZ6A 2ISWA 1A80A 4PMDA 2RJHA 3BC9A 4C6CA 3DBNA 1NM9A 4QTGA 3NQ7A 2AMGA 4M51A 4C7DA 4I5RA 1EXPA 1K9TA 4D6EA 3U8GA 2OG9A 3MV11 2Z1KA 2FMNA 2V5JA 1KTCA 1THFD 4RDVA 1GGOA 2IQ0A 8TIMA 3JRKA 1C9WA 4HNLA 2GLKA 1L8PA 4WXYA 4DBSA 2WSYA 1X1NA 4NRSA 3A21A 2YIHA 3LCFA 2DZXA 3ICJA 1Q5MA 4GWEA 1HJSA 1X1OA 4C6EA 5XIMA 1GKPA 3LENA 2CW6A 1P0KA 1LWJA 3GXFA 5CC3A 5K4XA 2CNCA 4OE7A 4O8RA 3SN0A 2YBTA 1EQPA 1DBTA 3M5XA 3TYAA 3WFZA 3URQA 1CLXA 2C91A 2YXOA 5JVLA 2QR6A 1KD0A 3EMZA 3SUSA 1FWSA 3GVWA 1E55A 1JDDA 2EPKX 1XFCA 1YXDA 3FEMA 2VWTA 2OX4A 4JTQA 2AQOA 4K39A 3V18A 1TZZA 5CGQA 4LUYA 1KFKA 1FX6A 3KRSA 4GC4A 1Z8AA 3SADA 1O5XA 1XYZA 1JQXA 2V6AA 3MKVA 3RPTA 2GGHA 3OYZA 3TU9A 4AZGA 4WEVX 1OD0A 2KX9A 3VX1A 3IUHA 3LGDA 2B7NA 4RE2A 3PF3A 4P61A 3GUWA 3TMQA 1DP0A 3U0HA 3CASA 4L4PA 4OV9A 1DVJA 4J27A 1TPUA 2IPFA 5AHFA 4H9ZA 4PRWA 4PUEA 4GQGA 2NQLA 1EUNA 3DG6A 2GVYA 4L5ZA 2VZSA 4H4IA 1AH4A 3ECQA 4L64A 5GNYA 2H8XA 3CHVA 5FA5A 4LOCA 3TN4A 3CUZA 3OA5A 5F2GA 1HJUA 3MZNA 1ODZA 1Q13A 5DCEA 3MDUA 3ZQ9A 1GTHA 1HO1A 3A3HA 5A1AA 4NJHA 4PL1A 1H49A 4YTQA 2DY3A 2GK1B 1ZBVA 4MWAA 5HMDA 3C0LA 1R47A 2QW5A 1FWTA 2NXGA 4W8AA 4IP7A 3F4WA 1XICA 4PMQA 4DYEA 4UTLA 3B8UA 1KBKA 2VUYA 4GH1A 1PX8A 5HNRA 5HATA 5G1MA 1FCVA 4XISA 3ZT6A 4I9JA 4ZVJA 3DKLA 1LROA 2HBXA 1KC7A 5A6BD 2WMKA 4OVXA 4A6GA 4Q4RA 4H1ZA 1LDCA 1OFDA 3TOYA 1Q6CA 4JIEA 4ZO7A 1BYCA 1V3MA 3U5YA 3GIYA 3HG5A 3D5HA 4IGHA 4HSOA 2A6NA 4CQBA 4LS1A 5G1YA 4HCDA 1XRTA 3VIHA 2AMXA 2VQUA 3WG6A 3C5QA 2FGBA 3QC0A 4K2SA 2A6LA 5E0CA 1H2JA 3D3FA 4HSHA 2GOUA 3N04A 1I1WA 4IX0A 4ENLA 1EDGA 1QW9A 2XGBA 2I1OA 5KSWA 5LNRA 4HVXA 4AVNA 4DWSD 3RMJA 3M0YA 5CJNA 1BVWA 1VJIA 3GFYA 5C70A 3D0CA 1IE7C 2VCCA 1QXLA 1SO6A 3HA1A 4PODA 1DJHA 1J0JA 3R8RA 3NQAA 1XH2A 5JMUA 4ICCX 2J78A 5HWMA 1OD8A 2PWEA 3Q65A 3MUIA 3MCMA 2R24A 3JW7A 1FWWA 2G97A 2PDLA 2NWSA 2ZRXA 1EF2A 2YL5A 3AQUA 5A8PA 1JZ8A 3TYDA 5IHRA 1K9DA 3RRAA 2OR2A 4WKAA 4HNCA 4JTKA 4MJMA 2DQWA 1EWEA 2C1IA 4GUIA 5D9PA 3FA5A 4F79A 3THAA 3NAVA 1EOMA 4O13A 4FX8A 1DTNA 1M04A 3JUGA 4FA3A 4QDWA 3GKFA 2CESA 1XR2A 1YTKA 1XLBA 1FFRA 1F61A 3H12A 4QDPA 4WJEA 3VGHA 4MY1A 4BF5A 1VFOA 5I3HA 5BU6A 3VK5A 3CK5A 3LCHA 4QAIA 2C18A 1H61A 1YTDA 3BMXA 4DYKA 3OOQA 1TWZA 1TPFA 5DBUA 1E4MM 1EC9A 4KWOA 1KNWA 4MADA 3MWAA 3S6OA 5EBAA 1DEDA 3KCLA 3WQ4A 3CBWA 1FOBA 1QPQA 1IEXA 3E9AA 3W1PA 3SY1A 3NL3A 3ZLHA 1GW9A 4DX3A 1GG1A 1CZ1A 2CETA 1H0GA 3FW6A 4UTJA 3EA2A 1J2WA 1ZFJA 2PWGA 2TPSA 1JYNA 4QG8A 1ISXA 4RPQA 3I68A 3M47A 3Q2DA 1ML1A 4O18A 3L0GA 1BG4A 2ZVIA 1OF6A 2PMQA 4OWGA 1AJZA 5KETA 3OZOA 1VD6A 4XD3A 2WW5A 5E5CA 2A79A 5BOEA 3TW9A 2VX7A 4E4PA 1W3HA 2WMGA 1V3KA 4HYVA 3P61A 4P5UA 1WXYA 1JCYA 3RM4A 4AC7C 2RJGA 2V67A 2Z00A 2HISA 5DCBA 3MUCA 3S1VA 2R1NA 2FPVA 4O57A 3PS7A 4JTAA 1D8WA 2YZ5A 2PRHA 3ZT7A 2FTPA 3GXPA 3D47A 2GGEA 1X98A 3TN6A 1CWYA 3VGGA 4NUWA 1R7AA 1ZLPA 4IICA 1PJ9A 2ZCGA 3PZMA 2DIJA 3FIGA 1X39A 4MAZA 4PFHA 5K9CA 3T6CA 3W82A 3Q4DA 2VDIA 2OZ3A 2PE4A 1QRQA 3SCPA 4LF2A 3WBXA 4IGMA 3R79A 3C8NA 4FLSA 3VD5A 1GOXA 3H2FA 3ABOA 2EPNA 4U3AA 2YA0A 4FOKA 5FF4A 3OPSA 4PB5A 5A69A 1QPRA 1TJ2A 2CLHA 4K68A 4S3GA 2GDQA 2PDJA 5D2XA 1B3XA 4WJ8A 3VDCA 3WENA 2AL1A 1VAHA 3T44A 1VBGA 4PBGA 1PZ1A 2WVTA 3PBWA 1LL6A 4LUTB 1UP0A 3FSUA 5HPOA 3NQ8A 4O1DA 1KM3A 1GPWA 3W73A 2IQDA 2AGKA 1TSIA 3UF9A 1OFPA 1DV7A 4HB7A 4U33A 1XIIA 4KFPA 1UH4A 3GNNA 1RA5A 3W2NA 5I3GA 4KETA 2Z25A 1JCMP 4E2DA 4RE0A 1RV8A 2QDEA 3WNKA 2F6UA 3KLLA 1TV8A 2G50A 3I6EA 4C6QA 4X9YA 3PTQA 2V9DA 4GG9A 2SFPA 3MA8A 1S1PA 1TJ0A 2E77A 3VIKA 3W7RA 5HQEA 4FHAA 1K7XA 3CQIA 2QJNA 1VC4A 2CU0A 1PYFA 2QAPA 5EKYA 2YFNA 2DV0A 3DZ1A 5FJUA 1DOSA 2G0WA 1W54A 3JZEA 2YR1A 3C0QA 2ACUA 1SO4A 2DVXA 1Q65A 2YBVA 2JALA 3VNKA 3CAKA 1M7PA 2HDJA 3UU0A 2V5CA 2DH2A 1UD3A 1WZKA 3W1UA 2Q01A 3VINA 2X30A 4DUWA 1B2YA 3PZGA 3B06A 3M0LA 4GYFA 2YXGA 3CQHA 3QH2A 1NH6A 2D20A 3VKKA 2PWVA 3SUWA 3UR2A 2PTYA 3ARYA 2BMBA 4M8UA 3G2GA 2GUBA 3C2VA 4AISA 1TMLA 1DYSA 2UWFA 2A1YA 2Y7FA 3O0FA 4MPKA 5CJ5A 2BY2A 3CXOA 3ZJ8A 2O92A 3WK0A 5CG0A 5G5IA 3LMYA 4XIAA 1VYSX 4R7JA 2F6KA 1GOMA 1FWNA 1DXEA 3PK7A 3ITLA 4K1WA 3LPGA 5H6HA 2CIPA 4UMAA 3W26A 3O6YX 1V3JA 5F1VA 1OEPA 1M41A 2ZUNA 2Z24A 1E0VA 2V5KA 3INPA 3MI6A 3M44A 1S46A 1FA2A 2ZVRA 1JJKA 3GDLA 2OWCA 2UY5A 3ATZA 5U4NA 1W9XA 4HPHA 3G0SA 3W2JA 2ZE3A 1I75A 5LHEA 3QY6A 4R34A 2OEKA 4V2XA 4ZTYA 1HVXA 1WYIA 4LCQA 3PNUA 4F3HA 1LOQA 1EPVA 3UEQA 3EPNA 3WD1A 3TNBA 3R0DA 1XBVA 2QYGA 1YRRA 1R8LA 1R3YA 1TPC1 4IMDA 5U7SA 1H62A 5C2GA 2WZTA 3TMLA 3N2TA 4FAMA 3N34A 3OIXA 5G2HA 3VNLA 4ASTA 2O9TA 4IH3A 3B9NA 1XQLA 1IIHA 3SGUA 3K13A 5DEZA 3PAJA 1XPYA 2PC4A 4NJKA 5H8PA 7XIMA 3WLNA 1MUMA 1VGAA 1E1CA 3LG3A 1KM6A 3NQ2A 5M5DA 2NXIA 3GLCA 4AMAA 1CLVA 4IPJA 2WZEA 3F4CA 3H4XA 1PB0A 4PUDA 1G69A 4KERA 3WO8A 1VP5A 1UR0A 3NZPA 3V16A 2ZTJA 3QKZA 3FFSA 3PJWA 2YDQA 1XG4A 3PPHA 1J8VA 2QCEA 2QV5A 2H9AB 5LA0A 1FHVA 3BCDA 4UFHA 3NYZA 2J75A 4B15A 1DE5A 3PSVA 1K8XA 4QE4A 4UQ9A 1GONA 4R7WA 5L6UA 1VS1A 3I7SA 1UP3A 5I3JA 1OT2A 1K03A 2AQWA 2MANA 2QKFA 4HCHA 5HXMA 4RE4A 1EKOA 4K8HA 2Y7GA 1UOZA 4B5NA 4PL2A 1BQCA 4H01A 4X2PA 3KVMA 3CIWA 3LCXA 2VEMA 3WKZA 2BGNE 3CU2A 1ECQA 1R5YA 4E38A 1JYWA 1W17A 4ROPA 3WLKX 2G37A 1A50A 3FNDA 1VB9A 1EBHA 4TOQA 4JQAA 4BS0A 5I3IA 3ZXWA 3WUFA 3WFAA 4LVBA 5IBXA 1M1BA 4D6JA 4D6CA 2UZ9A 3UCCA 4AXNA 4D6HA 5JBDA 2CLOA 2POTA 3PUOA 3LRLA 5CC7A 1XRSA 2A7PA 5LGXA 4AIOA 4C1NB 2ALDA 2P8BA 2REQA 3QGAC 1OCQA 2VUNA 3TFCA 9XIAA 3SO7A 1LT7A 1GUVA 1YPIA 1DTUA 1H1ZA 4Q8OA 3BQ6A 1UC5A 5M3WA 2EF9A 1EC7A 1XH0A 1C29A 1YE4A 4XZMX 3VM7A 3PPCA 2Z29A 1OF8A 5BOFA 3VCNA 5CJMA 1OJXA 4IJRA 3W7NA 2B81A 2AAAA 3R10A 2CHOA 3DEQA 2QCGA 4XZIA 1LG1A 4O8AA 5BXTA 1NIUA 2ZWZA 1PAMA 1XX1A 1P0NA 1PX3A 2BODX 5D09A 3WNLA 3FGCB 3W29A 5IM51 3SJNA 2C13A 1J10A 4PB3A 1TX2A 3W87A 3H54A 4GVHA 1MEWA 3A5VA 1Z9AA 2Y63A 4FLQA 4O1FA 3GYEA 3STPA 1BD0A 4W7WA 2XGIA 1OK4A 3MUAA 3N4AA 3LYEA 3F7JA 4OJYA 5CXPA 4M80A 4X0VA 2J8TA 3ZR4A 1H5VA 1ME7A 4HA3A 2YX0A 4OOUA 5EGRA 1GOQA 2FZBA 2WAGA 3W85A 1T41A 3HJEA 4CEUC 3S46A 4IIBA 4FP1A 1YHTA 2ZZ4A 1RHCA 1UKSA 2ATMA 4DELA 4B5VA 3RUBL 1LLWA 1D3CA 1V6YA 4DN1A 1BVZA 4AXKA 5TNVA 3W83A 3VIJA 3IV8A 5D33A 2Z1XA 3W7JA 2ZX7A 1LBFA 5H8UA 1UR3M 3HTWA 3NM3A 1UIPA 1TWSA 1EL3A 4OFCA 4PB4A 4RV3A 2X1UA 2CZFA 1MQPA 3WLPA 2PB1A 5A8NA 4Q33A 5A8OA 1JPMA 2GJLA 3MVTA 1M3UA 1VYRA 1BLIA 3WJXA 4W87A 1E6ZA 2INZA 1N55A 1ME8A 3GTXA 3NEHA 1OCJA 3BSHA 3ISIX 2DSVA 1AQFA 3U9IA 4P7LA 4Q22A 4O1EA 3DN5A 1W91A 1OFEA 1RPXA 1IWAA 5CC6A 3RFAA 4YWSA 3I3EA 1TTIA 1XGDA 2CKRA 4TVCA 2XFFA 1RR2A 2WNZA 1LWHA 2GZXA 1MW3A 4NI8A 1PTAA 4XBJA 1A47A 4ZR8A 3BAJA 5GQBA 2YXXA 4BQ5A 3OZPA 1TO3A 4YTRA 4NNCA 3TC6A 3LNMA 5DXXA 3RHGA 3LLDA 1MEIA 4WOQA 2VJXA 1X7IA 4WHBA 4L7ZA 2FH6A 1FDZA 1MSSA 1XLHA 1UWSA 2E28A 4G8TA 3AZRA 4DRSA 2A3LA 4PTMA 1BYAA 4HTBA 4P7NA 5LKYA 1XLIA 4W86A 3GFXA 2YLAA 4O1AA 3TYEA 5K9XA 1T5AA 4RZ4A 2DP3A 3O16A 5IDIA 1VHCA 2HZGA 3WLOA 4MTVA 3VGDA 1I8JA 3CYVA 3A9IA 3GRIA 3GAKA 1E6NA 2O9PA 3M16A 1KFCA 4O54A 3H24A 2XH4A 3E2VA 5EBUA 1OC6A 2CCRA 3VNJA 3L2IA 4ACZB 1PZ0A 1UZDA 1ZCCA 2DZSA 4G1KA 2QZRA 3AYSA 1WAUA 2G3NA 1VFFA 3NSNA 1HGWA 5A3HA 2CLFA 1IXNA 3VOCA 3WD4A 3RX2A 3U6WA 1CGVA 4HNVA 3UJ2A 3IV3A 3NPVA 2GDUA 2O55A 4MDPA 3UR7A 3NXLA 4JY9A 3VKDA 1QOXA 4HGXA 4F48A 5CSYA 1LLZA 4L4LA 1T0OA 4E8CA 3LCGA 4NT0A 3A23A 1OINA 1CW2A 2E6AA 3MSDA 4JYEA 2GVJA 3AHTA 3VNMA 4PTXA 1C7SA 1E4NA 1E5JA 1NDYA 2NXHA 4AQLA 3ARVA 3KZPA 4BF9A 3KLKA 3L2MA 4GKLA 3DAQA 5FAGA 1R0MA 4XB3A 2ZXQA 3CGTA 3FJ4A 2YOCA 4AWEA 1H51A 2Q02A 4Z08A 5D02A 3E2QA 2PZ0A 2CLPA 5M1TA 4FNPA 3B9EA 3IVSA 3AMLA 1B5TA 1F05A 2VFDA 1JCXA 3HURA 3DHPA 4FX6M 1OYCA 3M0HA 4L6DA 3FKRA 3W74A 1TCDA 4JHMA 3TTSA 1FWJC 5HR7A 3BLPX 3SN1A 5E9XA 2VR4A 3RG6A 4H8NA 2XN2A 1J0HA 1GCYA 3THDA 3RDKA 3AXMA 1NWRA 2ZZ7A 3LK6A 3DFHA 1A0DA 3AC0A 1J79A 1V0LA 3DHUA 3VIGA 2IXVA 2V3GA 3HG2A 2ZFAA 5A5WA 1S2CA 2BVTA 4QJ5B 4R27A 3W6YA 1GW1A 3HFYA 1O94A 3VZXA 1NQ6A 4H9YA 2FPTA 2WCGA 3VIOA 3W7DA 2IXUA 4I9MA 1J11A 9CGTA 3O15A 4PULA 1EJWC 3WLTA 1YMYA 3NL6A 5AYYA 4C7FA 1AA1B 4HMDA 3T2OA 3W07A 1MYRA 5E0FA 3SJ3A 2RHGA 3W7GA 1T8QA 4C60A 3I65A 1P0BA 5FJPA 3VD9A 2ATSA 3AXXA 2GOKA 4S3DA 4C5ZA 1XLDA 5G4EA 3GSMA 3UESA 3FYPA 3SCUA 4TXEA 3KCJA 5J5DA 3W1AA 3V7PA 1PKMA 3DFTA 2XIJA 4PH6A 4ADTA 4S1FA 3B8SA 1NFPA 2PCQA 3LTYA 4AFYA 3WL0A 3ZR6A 4ACZA 3DESA 4AUBA 3WBEA 3E0LA 3P7YA 3S5NA 4F0SA 2ZC8A 4P8VA 1TR9A 1IV8A 1HO4A 5AOUA 1NQKA 4HA1A 3WX7A 4FALA 1UD6A 1KFJA 4AW7A 3W01A 1EJSC 1FXQA 4RE3A 3PUGA 1RCXB 5A6TC 4N0RA 1JD9A 1YXCA 4DPPA 1S39A 4E4FA 5G1TA 2JQXA 3GAYA 1N8IA 2Y2WA 3GBDA 3BMWA 3GNXA 4A2SA 5A6MA 3W25A 3HJZA 3T09A 2VCBA 5CG7A 1UG6A 1DIDA 1ZP4A 3PAOA 2E9BA 5C2CA 3QM3A 2GWGA 1G94A 5IDZA 3M46A 3I6TA 3LZ3A 4GYPA 2ADAA 3HQPA 3GR4A 4RX0A 2BTMA 1TIMA 1SPQA 3ELFA 2VRJA 4DYJA 3WJYA 3KBNA 1V6WA 1WDSA 2E9MA 3SCQA 4N6FA 4ICMA 2DFAA 2XWDA 3I3BA 1CB2A 3W4RA 4NQ1A 4L1GA 5D2YA 1LRNA 4IWWA 4PE8A 3GE7A 4GI4A 4WLCA 3AIEA 1XF0A 1IR2A 3E96A 3A47A 4JN6A 3S2MA 1EJVC 3GU9A 1O60A 1E4IA 5BRBA 4LB4A 5DBTA 2ZUSA 4MM1A 1BKSA 1X96A 1MQQA 2FVLA 1ZAJA 4QLJA 4Z2GA 1W2VA 3UD6A 1ODUA 4NZFA 4HYRA 3C4UA 2EXOA 2D0FA 1P6WA 4IP4A 1B4KA 1J0KA 4WKHA 1RY8A 1SYTA 1QAPA 4REQA 1R3RA 3NQEA 3BAIA 3LN3A 4MB5A 4X61A 5CPTA 4HOZA 3B05A 1AZ2A 5I06A 1JVNA 2OEMA 2FHFA 3UGRA 1HL9A 2WMHA 1BRLA 3CUFA 3GXIA 2PDUA 3DG7A 3SIMA 3V0TA 4AEFA 1SJCA 2UBPC 3CHDA 3PFMA 4UQBA 1WDQA 3EWBX 4YVPA 2R1LA 5IFTA 4F2BA 1SM9A 1OCNA 1WX0A 3KE0A 4CCDA 3K4WA 1UB3A 4JFWA 3AHYA 1XGEA 1O7AA 1ZBWA 4C6FA 2IPWA 1OM0A 1ICSA 4LWWA 4KCVA 1F4AA 5DRIA 5B7YA 3NO5A 4FXJA 3OHIA 5FEZA 3SBFA 1RBOB 3G8EA 1OY0A 2Y7EA 3URNA 2CBJA 3JVAA 1O5QA 4OIFA 1QO5A 2HCVA 4Z17A 4QNWA 1E1EA 1EXBA 5CQ1A 3LEPA 1HVQA 4RDWA 3IJDA 4Q8TA 4WQ6A 4E8DA 3HB9A 4PUJA 3C86A 3CV6A 1U5VA 1H5YA 1V77A 5TAOA 1CGYA 3EB3A 1W32A 3YPIA 4ATLA 4RDYA 5EMJA 2D73A 3MMTA 5D8ZA 1PV8A 4UTKA 3MUXA 3P3BA 4GA8A 1K02A 2BBFA 2QULA 3L5MA 3NQDA 1A0EA 1R3SA 1A5AA 4UXDA 3WZ0E 3LPOA 1K7EA 1XCFA 3G1RA 3IACA 5HQMA 3O63A 3GK0A 3WJZA 2X16A 5AHEA 3F4VA 3AYVA 1I2RA 5DXYA 1S5TA 2VURA 4HPJA 5F2IA 4KRZA 2WM1A 4W8LA 2ZUUA 1IEWA 2ABBA 1P4CA 4W85A 4QCFA 4XWUA 3SAZA 2PDMA 1JG9A 4OT7A 4MFDA 1OIFA 3LZ5A 2ZRWA 2OQLA 2VNCA 4WDWA 3TA6A 1NSJA 3NYDA 4MOZA 2IS7A 1QK2A 2FZDA 1Q6OA 1A5CA 4BKNA 3CPGA 2VEKA 2TSYA 3IGUA 3MO4A 2GQAA 1UQZA 4YHEA 4PRRA 1CYGA 1HFBA 3RCNA 2WANA 4MKVA 4QJ1A 1ZGDA 4D1JA 3T40A 3HQNA 4TQTA 4DBDA 2UY4A 2QCDA 5BOOA 1XCXA 3M0JA 4C6KA 1DHPA 4LAKA 4GY1A 1GPFA 1WZMA 3ENLA 1HP4A 1Q6LA 3SCSA 3L5LA 1IWPA 4MG4A 1V0NA 3NGJA 1YIXA 1PZ2A 4LF1A 6TIMA 3B0UX 4QRNA 5ABGA 4Y6GA 2WNQA 1R3WA 3UZZA 2JKAA 4GIAA 2A2IA 4GO9A 4EIVA 2J7BA 3R6IA 3E2SA 5HAOA 1CBGA 2QAFA 3AYTA 4XBKA 1IXPA 3P5ZA 1S5MA 3VD4A 2I57A 4DB7A 1YYAA 2C0HA 5GVJA 4XKYA 1WDRA 3MSRA 3IPWA 1UROA 3B8DA 1KM4A 3WK2A 2DZAA 2J24A 3WUEA 2OVLA 1LL7A 3MO7A 1EO7A 4JQ2A 3HG4A 4B4HA 4PGLA 2GQ3A 3AYRA 2FGLA 5A2AA 1UBPC 3WQOA 1HJQA 4Q8VA 3CYJA 4GNJA 1PBGA 3NQCA 3W1NA 4LVDA 5FESA 2WKJA 1R86A 1SFJA 2J9ZA 3SEPA 1SQ7A 3WEMA 4MY9A 2PD9A 1BF6A 1E1CB 2V38A 1BYBA 3OGSA 3MP3A 1ITQA 4MGGA 1HKVA 2NX9A 4GFSA 4EF9A 4E5TA 3K8KA 4XUGA 3WDJA 2CXEA 2PDGA 4AD5A 3P8IA 4OUEA 3UW6A 1F74A 1JXKA 3WD3A 4Q8NA 2Z28A 3EMQA 2NV2A 3PG8A 1E72M 2OLSA 3BLDA 1GORA 4Q4SA 5JU6A 1ZP3A 4US5A 3M5YA 4JTSA 3M1ZA 1EDQA 1DJIA 4HHMA 4AAJA 1PO9A 3C3NA 2BV9A 4R7OA 5BRPA 4ONVA 2XFRA 1J5SA 4J7RA 3VIMA 2WJFA 3BMVA 3M4HA 1JZ7A 3NXFA 3EX2A 4JHZA 3BO9A 4RXGA 1RSCA 1TE6A 2VL4A 1QFEA 3FYYA 4GIYA 4H9MA 2Z2BA 3V36A 2R94A 4P8UA 2NQ5A 3BAKA 3LPFA 3CMFA 1VCGA 4HU8A 2BHYA 5CSSA 4HD5A 3AROA 3MPGA 2FZNA 3VGFA 3MMDA 3UYCA 5I5RA 2WOQA 1B3WA 4DUVA 2P8CA 4Q4QA 4US5D 2ANUA 5IXEA 3EDDA 1B4EA 3RNDA 2X0YA 1GVQA 2CZEA 3M0VA 1FCQA 4UCFA 4XZHA 1NJJA 2PZNA 4FXSA 2XGZA 4JTIA 1R87A 3TEVA 2JF7A 4XX6A 1A5SA 3NR0A 4HZMA 3MUY1 1WAWA 3LQGA 1VIWA 3AOFA 4V15A 1DE6A 4XSMA 3VOJA 3KWXA 3LGEA 2VVNA 1R9YA 2QGYA 4Q3MA 2Y8KA 1V3LA 1PVNA 2JGYA 4JTTA 3T4WA 4KCUA 1XSKA 1KW1A 1V6TA 4UZUA 4CQ8A 5ABEA 3GG1A 3U5UA 3WF4A 4C6PA 4A3HA 1NWSA 3QQ1A 3O1NA 5LSMA 3BGAA 2Y61A 3F03K 4K3ZA 1WZLA 2F7FA 4L56A 1PE1A 4ZO9A 3EWCA 3O06A 1A4LA 1LUCA 1MDRA 2XSAA 4ERGA 3IIPA 4UMBA 1WDDA 3GTHA 3C2YA 5FD0A 6CGTA 2QF8A 3SCRA 4KFOA 3Q58A 3LSCA 2D2HA 3ERPA 4NKCA 3G18A 2PDXA 4S3KA 4ZENA 1UD4A 3B4UA 3SB0A 3OBAA 1Q6DA 1P43A 1N2VA 2NSXA 4N9BA 1CPUA 3LGGA 4QG9A 3UVAA 1ISWA 1WCGA 1KB3A 4O0ZA 4V27A 4TIMA 3BWWA 2YZRA 3T0DA 3KVKA 1BWVA 4EP8C 3PBVA 3TTEA 4GC3A 2WHMA 3QC3A 5KZ6A 1Q6EA 1PTDA 4W7VA 3STFA 1JUBA 3N18A 1VFUA 2J77A 3NQMA 4C91A 1XI3A 1UBSA 2CXGA 3APYA 1TMHA 1W3KA 4TR9A 3AXKA 4N9DA 4EACA 1KWGA 1ITUA 1KLZA 4IIGA 2Z27A 3EOLA 3QMRA 3TUUA 2B7OA 1CEOA 4XAPA 1AW5A 2I7GA 3LY0A 2TAAA 3NL2A 1QNSA 2PP3A 3SUUA 5AB3A 1GK8A 4IPPA 3K46A 1XJBA 3VE7A 4YCOA 3EOUA 4Z2KA 1YDOA 3AMGA 4RCXA 4DJEC 3DFQA 3UXKA 4MNJA 5A6LA 3WQCA 2QCHA 4GI8A 4XKYB 2WSQA 2V2CA 1OX4B 4DAFA 5DRCA 3S5ZA 1M68A 4QCEA 3L68A 3G5EA 4XAZA 3W7QA 3QQWA 2VC9A 2OELA 1F8MA 2DJLA 2OWXA 4CUCA 2WYSA 3RLUA 3H55A 3MWCA 1RK5A 4JNZA 4EKJA 1W56A 3PBYA 4AEOA 2VYOA 4Z0JA 3CHFA 4I5XA 4MWAE 1B31A 4JYFA 3OG2A 4OECA 3DGRA 2G8ZA 2FIQA 4LANA 1ADDA 4CD6A 1HL8A 1REQB 2PF0A 3N25A 1HNYA 4AIBA 3LM7A 1OZQA 3GR7A 4B5TA 1JDFA 1AJ0A 1GNXA 1R85A 1DWAM 1XRFA 2W6RA 1R3VA 2CITA 3U48A 4AD4A 2CZDA 5B80A 1XXXA 2ACSA 4NILA 4A35A 1ZL1A 3B0XA 4ZSTA 4U4MA 3H21A 2QVHA 1T99A 3RXZA 1VLWA 1CXHA 4S3BA 4H6EA 4HPNA 1XYAA 2IPGA 1OFOA 1W5PA 3VA8A 1TPWA 3NG3A 2WNWA 4G2DA 1ME9A 3W3OA 4YN5A 3N4EA 5HJYA 3HPAA 3O2LA 1WV2A 4M7TA 1VENA 3CV2A 3M0ZA 2IUZA 3E2RA 5E0KA 1E6SM 1EEXA 5JH1A 3RO8A 2E0PA 3IUDA 3T0TA 3UA3A 3M6YA 3VYLA 2WCAA 1JCJA 4JTGA 1XIGA 4IQEA 1E71M 3CAQA 5EFDA 2W91A 1Z6KA 3WDIA 2JIEA 3NDYA 1PIFA 3AISA 4HQVA 4H6KA 1H60A 3TZFA 1IXOA 4Z2LA 3ZVHB 4OBTA 1VBJA 1TZ9A 4WDTA 1O1ZA 1KV5A 1QASA 2IKIA 4NIRA 1KKRA 5XIAA 4M6UA 4BFAA 1YNQA 2Y8UA 3LD5A 2WHLA 1WA3A 4A8RA 2YBUA 1G5AA 3MANA 5LNVA 3UPWA 1QUMA 3QSRA 4D8ZA 1F3XA 2Y62A 1TV5A 4ADUA 1M53A 1N82A 5I3FA 1CCWB 3MHGA 1PKYA 4O12A 3OODA 5KINA 5K2ZA 3IK2A 4U2YA 1A5BA 5HMEA 3WQFA 1LOSA 3IGXA 5LZLA 2J9YA 4RJEA 5LA2A 3MHUA 1M6JA 2PGRA 3H2OA 4XO6A 3TZNA 3UA4A 5KZDA 3E0FA 5D4YA 1MFVA 5DMYA 3MVIA 3XINA 4PTWA 4H9UA 3ANYA 4AHQA 4JN7A 3O05A 4LSBA 3UG8A 3KS6A 1WZAA 2ZRZA 1GYNA 1FVPA 3HIJA 2QPXA 5I78A 2QVNA 2A3EA 3W9ZA 2FB2A 1KLYA 1RAKA 3KP0A 3L9CA 1BG9A 4TU1A 5AKQA 2FTWA 1OQFA 1G4SA 3LHUA 4FNUA 2Z1WA 3BLFA 3DKJA 4U5KA 4I6VA 1ZALA 4Q7BA 4U3CA 3PZUA 3OO2A 1B3ZA 8RUCA 3TW7A 2C1HA 4JTHA 3MMUA 4NAFA 3RR4A 4S39A 4Z42C 1UC4A 4FPSA 4O17A 3WQVA 4L4OA 2OFJA 1WPCA 5TF0A 2FH8A 2YDRA 1D8CA 1W9VA 3UWYA 4WOZA 5A8GA 3MJYA 3TYBA 2QMKA 2YL9A 3W2UA 1KR0A 2RDUA 4GI6A 1U2YA 3J7HA 1E51A 5FJOA 3EXRA 4H19A 4TVDA 2WVVA 1JZ5A 1UWUA 1YTEA 4CU7A 2V3FA 4AMCA 3VAVA 3N17A 3G3MA 2WQPA 3A9BA 4DIAA 3WD0A 2PP1A 3NZ1A 1FWCC 1X7FA 4W5ZA 4AIUA 3KHDA 1G4PA 1TUXA 1PCWA 1XIEA 1RUSA 3COTA 3NZQA 4XVDA 3ZWTA 2PDPA 2B7PA 1G7VA 2BX7A 5F2LA 3MI2A 5C9UA 1PKNA 3TC7A 2NLIA 3WDHA 1UKOA 2BGQA 1PZ3A 1KM1A 3FX4A 3HGOA 4IQJA 1V3IA 3VXGA 3QZ6A 3TONA 3ANVA 1VF8A 8XIMA 3NO3A 4ZOAA 1G4TA 3RN6A 5TQLA 4F0RA 5CZKA 4XSLA 4EX4A 1L8NA 1E4LA 4ZE4A 1BWLA 1ONRA 4RZ5A 2FVKA 5I00A 4M24A 4BWLA 3B9OA 4AYSA 2I5QA 3PUDA 2A3CA 3WLLA 3CWNA 4UNLA 1TWDA 4LVGA 3MYOA 4A05A 1ZENA 1JNEA 3VD7A 2XVLA 1MNZA 2NUWA 3RM9A 1F6PA 1HKMA 5BXPA 4Q6XA 2PA6A 3MSYA 4GLEA 3FDKA 1W5OA 3GVVA 3LTPA 2BVWA 4PUKA 1J4EA 4ZCWA 4J3SA 4DWDA 2FZMA 1JI1A 1KM5A 3LM3A 4BHYA 1Q63A 3URBA 3H4GA 3QPZA 5FF2A 5I7GA 3REQA 4HNUA 3ABQA 4GABA 4FF5A 2VX5A 6ENLA 3F2DA 1MXSA 2W62A 2OSYA 5F7UA 1LRQA 1W1IE 3ONBA 2W3ZA 2HS8A 2ICSA 1K8ZA 3FHAA 3VD3A 3W88A 6PTDA 3M5VA 4YNGA 1ICQA 3AZSA 4Q7IA 5JH2A 1I0DA 4Q8WA 1HKWA 3AZTA 1KKOA 1Z7AA 1P7TA 4O11A 5HOSA 4DAIA 3DUGA 1BF2A 3EB4A 2NLYA 3UERA 1WDPA 3U2ZA 1T8XA 3EWWA 1B0IA 5GJPA 3AFBA 4FIQA 4GZIA 1JQVA 2FJUB 4BJHA 1ZZMA 4EWJA 1GYMA 1DORA 1D2KA 3EBVA 3VKAA 4TTGA 2FQIA 3GHUA 3IJ9A 4L80A 3TQPA 1XWYA 4DJDC 1JDAA 2G3MA 2Y5JA 1W37A 1EOKA 1IEVA 1OIMA 4WX2A 1W1YA 2HEJA 4IJBA 4OZOA 3VZYA 2NSOA 2VZTA 1GTEA 3W37A 2OT1A 3ZLGA 1DJXA 2ISSA 3M0MA 3U2EA 1CXIA 3WN6A 3IVUA 3NEVA 3L4YA 4C6IA 1AODA 1Y0EA 4E0CA 1KWKA 2NT1A 2QPSA 4RKAA 1XIHA 2NUYA 4A3UA 3EWZA 3BCJA 1AL8A 1PUDA 1FDJA 4MZYA 3N14A 3KTCA 3SDOA 3DI0A 5G4WA 1S5WA 4XTIA 2BWGA 3NDOA 2XINA 3PBMA 2AAMA 4LC8A 4M7SA 4CNTA 1E9LA 4O28A 5DMLA 1HN1A 3ES8A 5DT5A 5D30A 1OFBA 3PPFA 1DJYA 5AHIA 1OBAA 1G6CA 1RH9A 1KBLA 2VRQA 2DGAA 5AFDA 4AVOA 3QQ0A 1AW1A 4GVFA 4JXCA 4ZOBA 1TA3B 1MW0A 2PD5A 1VBRA 1V6UA 4BR1A 2D0GA 4DNMA 4FX7A 2WKGA 5CH9A 1J0IA 4K1GA 1VIZA 2XU2A 4PCNA 1KBIA 1TX0A 1YQ2A 5AYZA 1SZRA 2WSKA 1DWHM 4MWAB 1PKLA 2OB3A 3L4UA 1V8EA 2CZVA 1XLJA 4GCAA 3RK8A 5F4SA 1QBBA 3NO1A 1V5XA 3RU8X 3MBDA 3R89A 2OZ0A 3GQYA 4UZSA 1WKEA 3HV8A 3K2GA 5BMWA 1WUFA 2XIMA 2NZLA 4EVZA 1C3FA 1LLOA 1E5NA 5EMKA 2GJXA 4LUJA 3LSBA 3S1XA 2DVUA 1OHLA 2WK2A 2OGJA 3CT7A 4F66A 4U2ZA 2Y89A 4ATDA 1AUSL 4JNYA 3W72A 3ZSTA 4L61A 4BA0A 3P81A 3WIJA 3W75A 4NZ4A 3T05A 3F5LA 2ODOA 1S5VA 3PG9A 1FP8A 2CYGA 4ILSA 3DC0A 3OG3A 5IRPA 5SWUA 3DYPA 4IJCA 4L6OA 3ZMRA 4E3TA 1ONXA 4ICNA 1GHSA 5LNUA 1V6VA 4JFUA 1A53A 3CT2A 3VDAA 2G96A 4WDXA 1TPVA 3STGA 3QZEA 3GNRA 4AZCA 5K3VA 2HTMA 3KTSA 5D03A 4JTFA 3WNPA 3L4TA 1Q4NX 2RDWA 3NZRA 2OYKA 3UJRA 1ZY9A 4QIUA 4CLMA 4KW2A 2BDQA 2ZZ2A 4UTIA 1SZEA 4ZZ9A 4MB3A 5BXRA 3KVJA 2IKJA 2P88A 5I09A 2WMJA 2CLEA 4W8BA 5FEWA 3AXIA 2E5DA 1UR8A 2R82A 2QJMA 3NOYA 2HXUA 4NAEA 3S0CA 4HPGA 3UVIA 3QY7A 4QGCA 4OQVA 2WM0A 3LDVA 1NTHA 2PLKA 3UGVA 3MHFA 3ABXA 3LS9A 1VCVA 3GHTA 5BWFA 3BDKA 3QKEA 1F9CA 5FKYA 4EANA 2WC3A 2VZOA 1BYDA 3ZOAA 1UWIA 2X7WA 4GPNA 4NNAA 4HHHA 2MUCA 3CWHA 3TYUA 2D23A 4NY2A 1BGGA 1WXJA 4BQ4A 1Q6GA 3Q45A 3ZSSA 4JIHA 1JULA 3U3HA 1VBUA 3CZ8A 1L0PA 1Z42A 1UPMB 4DO4A 1SW7A 3QF0A 2H90A 1Z44A 1V02E 2W63A 5T9BG 1AQMA 5C5YA 3EOEA 5JUVA 3G77A 3ITTA 4IF2A 2OYMA 1C9DA 1QW8A 3AUOA 3MB9A 4DZ5A 3P84A 2VDGA 5AZ1A 3RMEA 3S2CA 3IUIA 4RPPA 3C61A 1OC7A 5J8LA 1TKKA 5KITA 3PSWA 3SGZA 3DYOA 3BAWA 3W7MA 1QR7A 3IIXA 4B5SA 1P5BA 4DF1A 4HU0A 3ES7A 4KRTA 3AWOA 1O4UA 1E6QM 3TK7A 3WSUA 1WKDA 3TTYA 2ZQ0A 3LBOA 4H41A 4HBKA 1BRLB 4IFKB 4CGTA 4K36A 3RF9A 3UZXA 3A13A 1JUEA 3PUEA 4IMFA 3LNPA 2JEQA 2FHCA 4H04A 4DBEA 1A5KC 4B5XA 5J04A 2G95A 5E6ZA 4Q4PA 1IGWA 3AIUA 4MUPA 4XKMA 4YJ5A 4H9XA 1KGUA 3OZMA 1XUZA 1US3A 4L1XA 1GEQA 5FF0A 1BFNA 4LV9A 4UTFA 3N6HA 3DDMA 3OW1A 4JQ1A 4Y7EA 2HK0A 3FSTA 4U5IA 3H2MA 4XD6A 2J25A 5AC5A 1AVAA 1KRAC 1XD1A 4AF0B 4H83A 3WH7A 4XZNX 4GJJA 4DBUA 2ZUMA 2PC8A 5BW6A 3AU2A 4UQCA 3C0SA 1ZUAX 5C9XA 4LAZA 1HTIA 1YEYA 3H2CA 1F5ZA 2Z2AA 3RJYA 1Z69A 3VNDA 3W7EA 2WWCA 1RA0A 4M5PA 3SCNA 2ZZ3A 4WXZA 3TDFA 3WMSA 5DY3A 3UWZA 2P1FA 2WO5A 5FJIA 5E70A 4LVFA 1UH3A 3E12A 1DWGM 2WJDA 3LMZA 1FY6A 1MUCA 1KGWA 1GT8A 3DG3A 2EO7A 3THQA 3QXBA 3S47A 2EPOA 5CCZA 1AH3A 2ZIDA 3S2LA 5AECA 3OZYA 4PEEA 1RXOB 1U1UA 3KUMA 4DBWA 2PWFA 3WDQA 3LX9A 2Y5SA 3UZJA 5CKSA 2BHUA 1CB7B 2BASA 3BGJA 3CL8A 4PEKA 3N3MA 4LEQA 4UNKA 3SUTA 1AMKA 1JUKA 2PTDA 4H9VA 4HHPA 1TV2A 1VFLA 2VC7A 4UOJA 5DX7A 1TJ1A 2E4TA 4K8GA 2ASHA 8XIAA 4XZWA 1XLGA 1S38A 2XWEA 1L6WA 1AW2A 2ZX5A 3W1XA 4GMEA 1EX5A 4MNKA 5LA1A 2PGWA 1ZB5A 1AQ0A 2Y88A 3ATYA 3FV9A 4XK2A 4ZMGA 4GNVA 1NFGA 1Q8JA 4GOAA 2JKPA 1X6UA 1DWFM 4QSFA 5CBIA 4Y9PA 2O56A 1A5UA 3W28A 4C65A 3APTA 3AAMA 2V5BA 1TMQA 2E8YA 3QHOA 2PFHA 4TV5A 4AH7A 1S2VA 1H7WA 3LQLA 1PS9A 4IQDA 1K3UA 4F2UA 4GXMA 1WOAA 2J7GA 1HF6A 3BZJA 5A8MA 5CPNA 2HXTA 3WLRA 2YYUA 3RPMA 1O6IA 2CFFA 1W1B1 3LBCA 4HZ7A 3N2XA 1W9BM 3W2LA 1E0TA 3TP4A 4S3CA 4N02A 3DCPA 4P2VA 3SFKA 1POKA 2VC5A 3WF2A 2Q6ZA 3PWIA 4X22A 4FXRA 3HU7A 2BY0A 1UJQA 2YL8A 2ZUWA 3LTSA 2ZA2A 4LU0A 3GW3A 3IIVA 3G0UA 5DF0A 4IUGA 2RDXA 3CUXA 2DSUA 3GU2A 3KW3A 3S1UA 2E9LA 2VTFA 3VOGA 3STCA 4KPLA 1O12A 3UG4A 1FKXA 1P1MA 3ABRA 3FJLA 3W7KA 1RPKA 1PX4A 3QR3A 3TXZA 4IPLA 2X8RA 4QS6A 4BZYA 4XD4A 3QW3A 4WF7A 2A3AA 3E0IA 2OO6A 4GJIA 2W27A 3SSZA 3HPXA 2F38A 1DKWA 3GC4A 4EPBC 1C8YA 4A3QA 2UY2A 4LS2A 4KGLA 1A3XA 3A22A 2OEJA 2JIWA 1V3HA 4AX6A 3T81A 2P10A 2XHYA 1YNPA 4S3JA 4JKMA 2X2GA 2O9OA 4LW7A 1IZKA 3NA8A 3DHDA 2E6DA 1UCWA 4O1BA 1V4YA 2NT0A 2BXZA 3CH9A 5AVHA 3BXWA 3UPMA 3ID7A 3U7BA 1KCXA 3GDRA 2H6RA 3A4XA 3TVAA 5BRQA 1A5OC 3AALA 3VFLA 1VEPA 3QV7A 1POJA 4CD8A 2E8ZA 3MBFA 3M07A 1TPB1 1NVMA 3UWVA 1SR9A 3FXGA 4FLOA 4E2VA 4UFMA 2OZ8A 4AY7A 2NV1A 4DLFA 1TVPA 1OYAA 3NURA 4C1NA 4EOUA 4F0LA 3NQVA 3NM1A 3ITOA 2WCSA 2QIIA 2QCLA 1CIUA 2ZA1A 1XG3A 2PI6A 4E6MA 1QNPA 4JY8A 4IZGA 2RAGA 3L65A 5CBJA 3DBPA 2Z2UA 1YNYA 3QR0A 3L4VA 1VKFA 3KAOA 2GPTA 3N2BA 4CVWA 3GXDA 5A6SA 1AH0A 2BVYA 3AJXA 4FZIA 4I7WA 3TWBA 4Z2JA 1V08A 4PUUA 2DORA 1MW1A 1ZAIA 4GACA 2CLKA 2Z7KA 5LXEA 1K4GA 1UH2A 1MXDA 1W8GA 4DF2A 1CDGA 7A3HA 4O10A 3ZVIA 4BEQA 2A4AA 3BJTA 1P48A 2YSWA 4CD4A 3F5KA 4ZB5A 2XH2A 3P80A 3AHVA 5AHLA 5GPRA 3S4TA 4DNHA 1OX4A 4C6OA 3L21A 1K4HA 1OB0A 1SO3A 3PZOA 4HMCA 3HPZA 1QTWA 5A94A 1JFHA 3IRDA 4GGBA 2I9UA 4UTTA 3TX9A 4CNSA 5H1WA 3BW2A 1DIKA 1YKWA 1I60A 3WEOA 3CIXA 4PMYA 4RNJA 2VDHA 2VRKA 1P6CA 1TTJA 3RX3A 2XTKA 4RV8A 4AWSA 4B5WA 3NPUA 4QG6A 4JCLA 2WQDA 3W7OA 3SSJA 4QR6A 3W7PA 2HRWA 3UXDA 5D9NA 1NWUA 3UR8A 3FCPA 4MJZA 5A6BA 3W53A 3W27A 2R1KA 4J2PA 3HF3A 4GINA 5GJNA 2BB0A 4PYSA 4I7UA 3IVTA 4L4MA 4I9AA 1V02A 4F9DA 1UA7A 7CGTA 1DXIA 1EJTC 1GZJA 4Y8FA 1WBHA 1J9YA 3M0XA 3THUA 4YYCA 4L6HA 1RBLA 7REQB 5LIUX 1H7XA 4PMRA 2GQ9A 4F4RA 7TIMA 1QI3A 3QV8A 5AHMA 3WLQA 4HA0A 3BGGA 3APGA 4PMVA 2DUXA 4WDUA 4NI3A 2INEA 3WCZA 3MY9A 4EF8A 3EDJA 2BY3A 1CX9A 4MYAA 1AD4A 2XJ7A 4JHOA 2PEVA 3LPPA 5FL1A 4NG3A 2W92A 5AZ0A 3OVQA 4W89A 2TODA 2VEFA 3GZAA 5ECVA 3K5XA 5HR6A 1DJZA 4QS5A 1UYQA 4D9PA 4YTTA 1DQUA 3O3RA 3NPWA 3AHZA 3IAQA 3B8VA 4J4KA 3W23A 3TFXA 4NU7A 3LB0A 4XTDA 3WUBA 2GGJA 4AZIA 2WSPA 1WO2A 1EJ7L 2CZ5A 3H23A 2QJJA 3ABSA 3ZM8A 1NP2A 3P6LA 1JGIA 4M6PA 2DT2A 2F8QA 1N7KA 3M43A 3DFYA 1HG3A 1XFBA 1ONWA 3VI2A 4QM1A 2Z1SA 3RRXA 1XSIA 1W5NA 2VWSA 2E09A 2ABAA 3CWOX 1QHZA 1M5WA 2QT3A 3LBMA 3E6EA 4D6DA 4L65A 3TYZA 3DYMA 3MT1A 2EHHA 2UV8G 1H63A 4OU1A 3V0SA 2VELA 1VFHA 4I7VA 1AK5A 1JPDX 3NOEA 2X40A 3OLDA 4WGHA 2POZA 4P8WA 4ES4A 2J4GA 4UQDA 2ZRYA 3L0NA 4N4QA 3TSDA 3A5FA 3S5SA 4URIA 1V0KA 3VIPA 4POCA 7ODCA 1E0UA 3U7VA 3SCVA 3IS4A 2AOSA 1NWTA 4UCGA 3BLKA 3BE7A 1Q6FA 1Q45A 1RJPA 3IANA 4XD5A 2PLCA 3LXBA 4LBSA 2WXDM 1FH8A 4IM4A 1F7BA 2I9EA 5CZJA 4Y9MA 2QJIA 2GVGA 1RD5A 3JS3A 5GJMA 2G4FA 1FWEC 1ZPTA 3LCIA 5HQLA 5EY5A 1XCWA 3R12A 4MWAD 3N6JA 4R88A 5HUPA 1RD6A 1FCBA 3FKKA 4TX8A 1IGSA 4DJDA 4QISA 1JYXA 1US2A 3T42A 1SZFA 1BVNP 2GJXB 1G7UA 4YPJA 2DT0A 1OG0A 1VFTA 1BGAA 3H7VA 1V03A 1Z3NA 1FBAA 3HQ1A 3PPGA 4EPEC 1GVFA 3G3DA 3PB2A 4JX5A 4F2TA 3GUGA 3CUIA 1B3OA 1MDLA 5LXXA 1YW1A 3BLIA 2G41A 3POHA 2OKOA 3W84A 2C19A 2A3HA 2IQTA 1C93A 3W70A 3RJXA 1D3GA 3BLLA 2X0SA 4EXAA 3STEA 4IX2A 4RUBA 1ZBCA 4LYRA 3RR1A 1V7AA 2ZX9A 4NYYA 3S3GA 2DSWA 4MB1A 5G2WA 3LV6A 4K8EA 4NSBA 2ZWYA 5CZTA 3V1PA 4MIMA 3N9SA 4JTRA 2XYLA 2PU1A 3IJLA 1E9ZB 3UWWA 2VVSA 3D46A 4B2DD 3G6LA 3VDBA 4GYKA 4FNQA 4D2JA 2FLIA 1I4NA 1XW8A 3TJXA 5FOOA 3TQVA 4LXFA 2B0MA 5C2XA 1W3LA 1PTGA 3ARQA 3CUHA 4O50A 1JL8A 3C2RA 3NTYA 3SY5A 3AIVA 5HNUA 3UCDA 3PZIA 1GWJA 3KBSA 2GJPA 2R1MA 3DOPA 4IIHA 4B5UA 4V28A 1ZS2A 1OWQA 2XSBA 3P62A 1P0EA 1UKPA 3EDEA 2XUCA 3H4WA 4CU6A 2QCDB 3OJGA 4ATWA 1JGMA 4HNTA 3T55A 3QBUA 3B40A 1DIEA 1E3ZA 1PDYA 2YL6A 3ABZA 2EQDA 2NW0A 3TR9A 4UTWA 4UTTC 3KCOA 3HV9A 3S9ZA 3EX1A 5ECUA 1JRBA 1VPQA 3WH5A 2QUMA 2QHAA 3QLDA 5HWNA 2V2DA 4LT9A 2PBGA 3QSTA 3M0KA 4IFKA 4HKPA 2OO0A 3WLHA 1DJNA 2NQ9A 2DDXA 2AL2A 1UP2A 2R9RA 2C79A 4PRTA 1TVLA 1L6YA 3D3AA 1HXJA 3ZT5A 2DZPA 2F6XA 4D8AA 2ZOXA 4LUSB 4DLMA 3CB3A 2Y8VA 2BY1A 2INFA 1Q6QA 3HPFA 4XUYA 2XPKA 2XVGA 4FI4A 5D38A 1GVIA 3E0WA 4GNKB 4J40A 1GKRA 2Y24A 3L67A 5HDRA 1G9HA 4CKQA 3HO8A 2OMAA 3DI1A 4P8XA 3GH4A 1OX6A 2J6XA 2XZ7A 1KBJA 4E3VA 1Q2SA 3CQ0A 4NZCA 3W7LA 5F4XA 3RYSA 3PHAA 1TE1A 3LRKA 5HK4A 1KCZA 1DJWA 1F6KA 2QCCA 1N8WA 4ROQA 3R94A 2DZBA 2Z6JA 4HYWA 1KQZA 4LPCA 1FRBA 4JBRA 2P53A 1XYMA 3KM8A 3T7VA 2BVDA 4IMAA 5LGZA 3NSXA 2F2KA 3B3DA 1HJVA 2QUNA 4RW3A 3B0PA 2WJEA 6REQB 3B9DA 1FHDA 2J7FA 3C2OA 1HQTA 2QLYA 4PMJA 3AO0A 2HQAA 3KOWA 1Y5XA 1M01A 3GIPA 4LAUA 4ZB2A 3KOFA 1KV8A 5TIMA 4ZFMA 3QOMA 1PIIA 5HNTA 2VD9A 4N2YA 2ZDRA 4I3GA 3WQ6A 2W9MA 3V3WA 4QE5A 2PBOA 1F4HA 1L6GA 4DY1A 3PWGA 1IEQA 4YLWA 4KGJA 3L7RA 5CZ0A 1DIOA 4KCTA 4N9EA 2CBIA 2DJXA 3T2QA 5AYBA 4GQRA 4IP5A 4LX4A 1XPGA 1LWIA 4ORMA 3D6NA 3EX3A 4KKXA 1ZHAA 5DANA 1KTBA 3CMJA 5AYXA 5HJXA 3N29A 4LNCA 3BSGA 5T8GA 1RP8A 4XIMA 4S2BA 3GW0A 4QXIA 4IUOA 3GC2A 4JTEA 5FJJA 1RQBA 4OKDA 3H6OA 3U2CA 4Z1CA 1LL4A 3MMWA 2IW0A 4HT3A 2DIEA 1MNSA 2P3EA 3VO0A 1SFTA 1QNOA 3SW6A 2QGHA 4C1LA 2YCKX 3KS5A 4RZBA 4ZXLA 1QI2A 3GDKA 4X3ZA 1RJQA 3E1F1 5I07A 4GIRA 3VDHA 2PLMA 3E5PA 2DU2A 4GZJA 2DIKA 4CD5A 3QYQA 2WPBA 4IL0A 4AZ5A 3BV7A 1FWAC 4Q8PA 4A2RA 1UWAA 3VM5A 2J47A 3VUSA 1UD8A 3FS2A 1KFEA 1CLKA 2FDMA 2Q71A 3N4FA 3BOFA 3W22A 2GYIA 2WMIB 3NNTA 1GOWA 4AD0A 4CD7A 3GG0A 3SGGA 3URAA 4PUNA 2VD8A 1NF0A 1RY0A 4GD0A 3W0KA 4OV4A 3ARZA 4J3ZA 3N9KA 1A4MA 3NZGA 2HE5A 3WF3A 4BI7A 2ZBTA 3EEGA 2OKTA 3LV5A 1R2SA 3UNDA 3T8QA 1I6NA 2KZHA 2OODA 3B8WA 1UWTA 4W4QA 3WD2A 4OUIA 5ABHA 3OLIA 2YDSA 1DHKA 3FA4A 4B2DA 1XDMA 1UMLA 5ABFB 4YTSA 2XVPA 3P5YA 6XIAA 3KBMA 3TJIA 1H41A 2J7EA 1ISZA 2F2HA 3GY1A 1SSGA 1ZJHA 5DFAA 5K7JA 3VMNA 2CHRA 1EH9A 3TH6A 3IGSA 3NFUA 1Y5WA 4DJFD 1GVYA 4KEZA 3VPLA 2W5FA 1VPYA 3NIYA 4DXXA 1KXHA 4LFYA 4DPQA 5I02A 2QUVA 4FNTA 2BOEX 4QBXA 3S8HA 1OFAA 2OSWA 4XO7A 3TN5A 3LHZA 4P7OA 1NAL1 2VOTA 3GTNA 1KR1A 4J3TA 3R25A 1L2UA 9XIMA 1KO0A 4C6BA 2QEZA 1SFLA 2OSXA 3G1XA 4QJ3B 4K7VA 1NDVA 1Z89A 2E40A 5LIXX 4GUGA 3NVTA 2VOMA 3AS0A 4MKNA 1SFSA 3GVQA 3MTWA 3VKBA 3AMCA 1HJWA 1VPXA 3ITXA 3USBA 1ZRQA 3EWYA 1QPKA 4AC1X 5KTLA 1XRVA 2PRMA 1J5TA 3JR2A 2GSHA 3DC8A 1Q3NA 1E0XA 4XBSA 1X6NA 4GI9A 5IFPA 1F2JA 2Z4GA 5D9MA 4TO8A 3WLJA 3UZ5A 4ADSA 3ZO9A 2L5HA 1SJBA 5E93A 1A5NC 1UZ1A 3QHNA 2VI0A 4RNIA 1PHWA 4O52A 3WMBA 2EBNA 3NDZA 2QCFA 3BK0A 4JTDA 4NRRA 4J2MA 1Q7QA 1F3TA 3Q67A 5F4WA 3ZS4A 4IIDA 4IG2B 5I0DA 2Y5EA 1EIBA 3CPRA 3IIZA 4IIFA 4ML4A 1UOKA 2P50A 3G1SA 2XH0A 4PMOA 1TTPA 3CZJA 3V4BA 4LAOA 4PA8A 1W1VA 4Y9NA 5CPMA 2CLMA 2PU0A 2PTZA 3TSMA 3MYPA 4KWVA 1BXCA 4Q8UA 3MP5A 2NX1A 2ACRA 2QCNA 3G22A 1W6TA 3SQMA 3Q37A 4X0NA 2Z1BA 1C92A 4KFNA 5H2ZA 2DSZA 3A3WA 4ZL1A 2QF7A 3FVMA 4JIRA 3AIWA 4NZ5A 4Z1DA 1LTDA 1YBQB 1F3EA 4HHLA 2E6YA 4KCWA 4Q8QA 3PN8A 2CKSA 3VGEA 5FI8A 1JDCA 4YTUA 2R1PA 1EA9C 4J28A 4BF7A 3H22A 5C8BB 3VCRA 1ENUA 3BH4A 4DJFA 2HVOA 3UXLA 3DHFA 1CI1A 3GXMA 1PSCA 3TA9A 4KIRA 1LCOA 4RNHA 1CGTA 3QFEA 3TKFA 2O9RA 1XLCA 4TX9A 3I4KA 3PULA 4KBXA 5IHSA 3OGRA 3FJNA 3R7MA 4B3LA 1E6RA 3POCA 1EZ2A 2HS6A 5A6KA 2DUAA 3ITYA 1QHOA 4ZSUA 1L2QA 4NYUA 2P0OA 5HPCA 4UUIA 4PBEA 4O14A 2VHLA 1QU4A 3VU2A 5G2IA 4NVTA 4ZO8A 3UNTA 1EA0A 3AIBA 2FMOA 2RH9A 2YA2A 4HZ6A 5C55A 2C71A 3K4AA 2BOFX 1VJSA 3IRSA 5AHNA 3SCOA 5HULA 3WQEA 4V1XA 2A21A 3M9YA 1PEZA 5KZEA 4KEMA 2HBVA 1W1TA 4M82A 1XIDA 3V35A 2RFGA 2QDDA 2DT1A 4HPXA 4MLRA 1K8CA 1OT1A 4JL1A 4H6QA 2VKZG 2FYMA 3CHEA 4LC6A 3U4AA 1HZYA 1M9HA 4AVFA 2Z26A 3C52A 1DWIM 3CLWA 3I6RA 1EF3A 4KIEA 3FVDA 4N7QA 4FK9A 3G8RA 2ZYFA 3UETA 4YCPA 1F3WA 3LI1A 3WH9A 1JXJA 4H8UA 2QMJA 3QV9A 1AMYA 1TVNA 3OEXA 1GYLA 2YW3A 1HGYA 4CNOA 3PB0A 4LH8A 2WMFA 1E6PA 4LEFA 1QHPA 2D69A 3EA3A 4WVXA 4YMZA 1W1ZA 1J96A 1F6YA 3CB8A 4HU4A 3HN3A 3P82A 4Y90A 2VFIA 2V3EA 3NUKA 3KDOA 4JPGA 3WLSA 2C16A 4ALDA 3WQWA 4BQ3A 3VDGA 2OCZA 1RZMA 2WC4A 5EMLA 3TC3A 1XD0A 2HPMA 4MHBA 1GEHA 2HK1A 2G5WA 2O7QA 4GISA 2HROA 5HBFA 3DENA 3C3UA 1CXLA 1V6XA 2OQYA 2YJQA 2OZTA 2PGFA 6TAAA 2VT0A 3VKCA 2OOGA 4AB4A 1IYXA 3GNDA 8CGTA 1M7JA 5MKGA 1W1PA 2Z6IA 3UY7A 2OGYA 4FO4A 5HJLA 1NARA 2GSEA 3W6LA 4XQ6A 3BW4A 3WUGA 4GRSA 1VCFA 1KRMA 1SMAA 3IGHX 3QRHA 4HU3A 1SJAA 1RQEA 1A49A 4V33A 1CECA 1SW3A 4E4UA 3U4FA 1VEMA 7ENLA 4DZHA 3REQB 4EPDC 4IOTA 3CUGA 3M7WA 3WMLA 3VGBA 5I23A 3WJSA 1JD7A 2QUTA 4XZLX 1EGZA 3EA1A 2GJRA 2PRLA 1R9XA 4KESA 1O1HA 3EWUA 1TRIA 4J3VA 4ZE5A 2VEPA 2VP8A 3CTLA 2HVNA 5TBOA 4JFTA 2BHZA 5DMMA 2CBVA 2CEQA 4W88A 3KL0A 3MU7A 4BY3A 1R46A 4LALA 2J9XA 3QTPA 4K38A 3W6MA 5D37A 3KDNA 3WL1A 2VR2A 4PSRA 3B4YA 3PJUA 3ONCA 3PBGA 3MDWA 1L9WA 2X1RA 4C6LA 3W7CA 5EMMA 3R43A 3LLXA 3RX4A 4GUHA 4D6IA 3QN3A 1W0MA 4CN4A 3T8LA 2YLLA 1MUWA 4JFVA 1Z48A 4QDMA 3DX5A 2GQ8A 2DPEA 2WHKA 3DH7A 5ENLA 1FKWA 1XC4A 3H70A 4M6VA 5AN7A 4FNRA 5G4HC 1UUOA 1RBAA 3OLEA 4O53A 4GGHA 3DFPA 4GVGA 3KP1A 1QW7A 1BXNA 1LQAA 3WQ5A 7PTDA 1FDYA 3EXTA 3M7SA 3RU6A 4PUMA 1VYPX 1X97A 1E56A 2DZUA 4UFJA 2OTDA 1WNOA 3PANA 1KCLA 3CS2A 1ZSXA 5E09A 4LAMA 1JR1A 4WUIA 2NWRA 1R3QA 2D2JA 5E6YA 1X8CA 2GGIA 1K7FA 4PMNA 4LS0A 4FLRA 4JS3A 3CPUA 5LIWX 2X42A 4R53A 3WQ8A 1B54A 4CN6A 1SUXA 1FTXA 2J7HA 5L9FA 2ZA3A 4Y2WA 1RALA 4ZO6A 1XLFA 3QMSA 2XDFA 2DH3A 2YCEA 1O95A 4RXFA 3IK4A 2A7RA 5E1QA 4CEXC 4DWSA 1RJRA 3GTFA 2XIQA 4TTUA 1TV3A 4CVUA 3MZ2A 1P6BA 1W2PA 1XKJA 4XV0A 2FJKA 2H8ZA 1TQXA 1T6MA 2YA1A 5I6SA 1O5RA 3R1ZA 2CERA 1E6XM 3ARPA 5BMXA 2NUXA 4X63A 3SY8A 1C91A 1ZCOA 3QFWA 5CLTA 5C0QA 1XLAA 4GCXA 4YHGA 4JOMA 1DXFA 5D05A 2R14A 6XIMA 2X7VA 4O0KA 4UR7A 5M03A 1VLIA 2BFGA 5E9AA 5I3KA 1Y5VA 1VRXA 5PTDA 4MZ1A 1YE6A 3KZSA 2J62A 4ZQCA 2HNEA 2FB3A 2X1SA 4XZBA 4L1WA 1MI3A 2JE8A 4DO6A 5C7HA 4J3UA 2V63A 3VTRA 1P0DA 3C8FA 2HNHA 1XBYA 2XIIA 3RO6A 4ECLA 4ZXOA 4LRTA 3CAWA 3WLIA 3L23A 4IFOA 3QZAA 1RP9A 2BZNA 2OXNA 3HG3A 1XH1A 3LCWA 1A3WA 4LBUA 3WQPA 2ALRA 3GWQA 2X2YA 2ZE0A 3CV1A 2HVMA 4CQDA 3IARA 3IJIA 4G9PA 3LI0A 4UQAA 4H7CA 4GX9A 3F2CA 3PY2A 1EPXA 4LYKA 3WBWA 1ZJAA 4DM1A 5I2UA 1FWBC 5A6JA 2XM1A 2NQZA 3BPWA 1HW6A 3IIOA 3EKZA 4M56A 4ZTXA 1C7TA 4DI9A 5REQA 4B92A 2RKXA 4GBDA 4RW5A 3O8AA 4JZ5A 4QEEA 4HJFA 3GO2A 1XDJA 3W81A 3W1LA 3W24A 4D6GA 3ARUA 3TNOA 3S83A 2V5LA 2PDWA 2VX4A 5T26A 2D0HA 5D2WA 1XGZA 2PLJA 4F0HA 3ARXA 4RDZA 5A6AA 1PCKA 3FAWA 4B91A 2G3JA 4UWMA 3WY1A 4OHQA 1K1DA 1XISA 5BWAA 3CUJA 2BS9A 1ZNNA 1B9BA 2NVAA 4R5EA 4F0KA 2F61A 1PWLA 3AIRA 4JL2A 1UR2A 4H6RA 1ELSA 1JI2A 4AG0A 1M7XA 2ZTKA 2DZVA 4JDYA 4H9TA 1FWHC 2E25A 3A64A 1ICPA 4MNLA 4IMCA 2XZ9A 4CCZA 1IHIA 1SU5A 2W67A 1FH9A 1U83A 1ZAHA 5BCAA 3CTTA 4GZ7A 3OLGA 1EWDA 4KWUA 2GGGA 3S6TA 1H1NA 3W86A 2I14A 4E2BA 5DLCA 2ZX6A 4MDOA 2HWGA 4W84A 3EEZA 1MZRA 4FB7A 3HMCA 4QROA 1OFRA 3G1AA 3WF0A 5C54A 1E1FA 1TRDA 3UT0A 4HN4A 3KBVA 4ZQRA 1KFWA 3MQTA 1UUQA 2CWXA 4KH2A 3EPOA 3SECA 4YS1A 4L9YA 2Q3RA 4DZAA 4PFMA 3H2NA 2QS8A 1KA9F 3GDTA 4HNOA 2H3BA 1O68A 3K30A 4DWSC 1IXQA 1M65A 3EGJA 1XV8A 3OQ8A 3CO8A 1XHGA 2GL5A 3P14A 3R8GA 2W79A 1I2NA 4AWUA 4US6A 4QAWA 5BYWA 2W61A 4MYXA 2DT3A 1H50A 4JTJA 2VZVA 4NJJA 2QQ6A 3RCMA 1IEIA 5A95A 3VFCA 1MRQA 1GQIA 3IAPA 1AL7A 4D71A 3ZYZA 3H53A 3WQDA 1R9ZA 2BG5A 4R85A 2J88A 1T96A 3O9NA 4QP0A 2ZADA 4Y9OA 1GQNA 3LOTA 1QWGA 3B0YA 2X1IA 3VNZA 4KS0A 5DMNA 1YXYA 1VQTA 4Q32A 2XFYA 4QNEA 4W5UA 3OA3A 2NV9A 4GH3A 3DFSA 3I4EA 3AHXA 3CM4A 1LF1A 3B03A 4AZBA 4J3WA 1MEHA 3BG3A 1V79A 3N15A 1QO2A 3GR8A 3N2OA 4GXPA 3CL7A 2FFCA 1DL3A 4MUZA 1FHLA 1BAGA 3BCFA 3TR2A 3FJ6A 3KEHA 1TYGA 1XS2A 4JGDA 3VILA 3B04A 1JRCA 5HNNA 2ZKMX 1XLKA 3MCOA 1US0A 2J8FA 4JAWA 3GU1A 1W8SA 3SCWA 3GVRA 3PTKA 3EX4A 2DEPA 4WY0F 2R6OA 4AU0A 1N8FA 2VZUA 4TVUA 3EZ4A 1QPOA 3PR2A 4N4PA 1J01A 3BICA 4M3PA 2VGGA 1WBJA 2X05A 2VR5A 4QITA 3MI3A 3BANA 3QPEA 1UKQA 2OU4A 1I0BA 1S3HA 5JIPA 1LT8A 5FSEC 4GY7A 3UJFA 2D3LA 4YIWA 5I3DA 1QI4A 3WNMA 4Y8EA 1WXZA 4JTCA 2WNNA 4Z1YA 3QPYA 5A8QA 1UMYA 4UIOA 2A3BA 3S6DA 4DZIA 5F1UA 3UJSA 3BARA 3ALGA 4IT1A 4AX7A 4WSJA 2FKPA 1PYMA 1HT6A 2PODA 3EX6A 1XDLA 4IMEA 4UTWC 3MSGA 1WKYA 1EJRC 2F84A 3FXYA 1TPH1 3A4AA 3WNNA 1H11A 1EB3A 1CNVA 1IWBA 3N73A 3CO4A 3WELA 3JZUA 3KTXA 1D7FA 4QX4A 1YPXA 1MRAA 1R2TA 1GJUA 1FUYA 2YCJA 4NXKA 1GHRA 2LLEA 4JNMA 2GVLA 3ARWA 1H7PA 2Q8XA 4GFIA 2GSJA 5C71A 2CPUA 1YBQA 2WHJA 1ITCA 1LQ2A 2EPMX 4ZQPA 2CHNA 1EYWA 1NEYA 1Q8AA 4IMGA 5AYIA 3EKGA 3TV8A 4OBRA 3UFYA 4P7RA 2Q8LA 1S2WA 3FN9A 2WLZA 4ZFCA 2ISVA 1QJWA 1TJRA 4B9ZA 4NZ3A 4HK5A 2WSRA 1W31A 1HL2A 3RGTA 1KRCC 2YFOA 2J6VA 5FJRA 3W1RA 1GKQA 1NOWA 2PDKA 4JIPA 1Y65A 2CC0A 3LUTA 4QLKA 1R2RA 1J0YA 1SZGA 2R8WA 2OT0A 1Q7ZA 4GZEA 4DJEA 3WF1A 3R13A 4BWLC 3ALFA 3GXTA 3VE9A 3ZJ6A 4HK6A 2QJGA 4B3KA 3RLGA 2IPJA 4FSAA 2IKHA 4FOUA 2J8GA 4JICA 2C0AA 2J27A 4PN2A 7REQA 1QPNA 1QWKA 1WQ5A 5I03A 1UR4A 3M6DA 3PWAA 4GQBA 3O0KA 4DVOA 3GDMA 3TAOA 3CJPA 1LRTA 4ERAA 4RLIA 4BK9A 3WFLA 3L2LA 4FIRA 3ZZ1A 2W4XA 3VUPA 4IGSA 4FOJA 2A5HA 1JZ3A 3C6CA 3UWUA 2XIBA 2RUSA 1NY1A 2D2GA 2PF8A 1FWFC 2GWNA 1KXTA 4LUIA 1OFQA 4NF7A 1ZJIA 5HANA 1GVRA 1MMFA 2VO5A 2ZZ1A 3O6AA 1WOBA 2PWHA 1KBBA 2ZZ6A 1IT7A 1E40A 3VNYA 1S1RA 5EU9A 2YCLA 4KT2A 2P3ZA 3MW7A 3P67A 5FAJA 2GDVA 3WBAA 4NXSA 4FNSA 3GBEA 3R8HA 4JR5A 3CZKA 3TCEA 1UASA 3K1DA 3VCCA 4C6MA 1SSDA 4M19A 3NL5A 2EPLX 1P1XA 2OYLA 5BXSA 3PJTA 4Q8MA 1NP0A 1XM3A 2OLHA 1Q2RA 1MQRA 3T07A 3F4NA 4GQQA 1F76A 4B4FA 4CNUA 4RNFA 3FYOA 3KRUA 2Y70A 5BU9A 2PSNA 4TV6A 3OYXA 1S2AA 1EX1A 1GJWA 3O07A 3OBEA 3VVGA 2VCAA 3WYZA 3N2MA 3L4XA 1TV7A 3H2EA 1R6WA 5CPLA 1CXEA 4ZBCA 4I90A 3S1GA 5D32A 1Y8BA 4R9XA 3U2OA 1BEUA 2DUZA 3TN3A 3TE9A 1VR6A 5MHBA 5ABTA 3BSMA 1UR9A 2QCMA 3L12A 5GNZA 3H7UA 4NJGA 3V0UA 1MW2A 1E9IA 4KWWA 3WEZA 2ESCA 4UOZA 1IF2A 3LU2A 2G4JA 3S2NA 3EXSA 3ARSA 4ZA0A 4U28A 3EWDA 5D2VA 1H7OA 3S42A 4AZ7A 4AHOA 4HMNA 1DQWA 1O66A 4MY8A 2WPGA 3A6OA 2GK1A 4JQ4A 1EHAA 3WDRA 3GH7A 3S5YA 1XP3A 5HA7A 1ESWA 3W7HA 1Y7VA 2EPHA 4XAFA 1PPIA 3K8MA 4H8VA 1U22A 4PCFA 4U10A 3LXCA 2JEPA 4A22A 2XVNA 5K4ZA 1I9CB 3OHMB 1TELA 2EG8A 3AS3A 5TD4A 1CXKA 4WIWA 1GQLA 1E15A 1TWWA 3XIMA 1QVBA 1RLCL 3SQLA 1D7KA 3WDPP 1OG6A 2WBGA 1SR0A 1RCOB 3QLLA 3QGVA 1X6LA 2V0TA 1QK0A 2J79A 2D1ZA 3MC5A 3V5CA 1IR1A 4UTHA 2I17A 4TMBA 5CGTA 1ZTVA 5C9RA 2J7CA 4L9ZA 4P7QA 1C8QA 4A4AA 4NL1A 2B7QA 4X2RA 4IXXA 3VOIA 5KEZA 3KRBA 4IFRA 4EXQA 4UMCA 1CT5A 3BAXA 4I8DA 4MJ4A 4DUXA 2V81A 5CSUA 1JCLA 4RR4A 3B9AA 2TMDA 3FA3A 2IMRA 3W2KA 2Y1HA 1K8YA 1TPEA 2WKLA 3UP8A 3M41A 2QJHA 4UQEA 4GXWA 3L4WA 5REQB 1YPFA 4D8LA 4MWAC 1LZOA 3ORWA 1TR1A 1X1ZA 3WMCA 4MJ2A 3WH6A 2JKEA 5DCDA 1KFLA 3ZIZA 1O5KA 3W2MA 1GVSA 3UG5A 3PZQA 3A4WA 1ZJBA 4QSHA 5AVNA 3TCSA 4NAEB 1KXQA 5FJTA 3MJMA 3HBLA 3GB6A 3B8IA 1QNRA 7TAAA 5C6MA 3A4JA 1LJYA 4ZEPA 4X60A 1WUEA 5HMSA 1PWMA 1XIMA 2I16A 4H8HA 2QUUA 1C90A 3GKAA 4CU8A 3GXNA 1OADA 1Q4WA 5GNXA 1GOOA 1B1YA 3EB2A 1S2UA 1IT8A 1PXGA 2OOFA 4Z2IA 4L9XA 9RUBA 1JAEA 2ZXAA 5JQ9A 4LQ1A 3AU6A 3O6CA 1W9PA 4AD2A 4HOXA 3QMTA 2VQTA 4HA4A 2ZXDA 2FZ9A 3EMCA 3IEBA 1MZHA 4OBSA 3RAOA 4D1IA 1JFXA 3W02A 1CGUA 3E38A 2P76A 4C1KA 4C7GA 1JCNA 3T08A 3F4DA 2PWUA 2DW7A 3EDKA 4YXGA 4S3EA 4A29A 1MVYA 1TTQA 1E43A 3FOKA 4J9JA 3BG9A 3WBYA 2PWDA 2XH7A 1EYEA 4NHVA 1EBGA 2P0IA 1YDYA 1GOKA 4WY0A 3T78A 4Z1AA 2BNJA 3QR1A 2CLLA 1XIFA 1XINA 2AKMA 3TQ0A 2F9RA 1ADSA 3VNIA 4KRUA 2OX1A 1YDNA 2YPIA 2C8NA 1GVOA 1FHUA 3EOOA 4AY8A 2FZ8A 3T1GA 1J93A 1YADA 2BGSA 4A21A 2Y85A 2FHBA 3LXAA 2E5BA 1HIZA 4YWIA 4KMQA 1XKYA 2YB1A 3QOKA 4AF0A 1W3NA 3N19B 3KHJA 3KX6A 4CCCA 1K70A 4ZQNA 3GHRA 1JPKA 2H3DA 3MS8A 2H9AA 1VZWA 4I8YA 4UOQA 4JN8A 4O4WA 4LYPA 4BCEA 4M0XA 2VM8A 4S3AA 1WKFA 3GM8A 3UZWA 1TG7A 2JFEX 3P2VA 4Z2HA 4GQ0A 2VFFA 3P0XA 1AD1A 4GIEA 4CQCA 4WKFA 5DN1A 4QE1A 4YVVA 3EKLA 4H7VA 3BAYA 1SW0A 4J3XA 2ISFA 4GO8A 1E0WA 4LCSA 4PMUA 1D9EA 4JX4A 3WK1A 3T4CA 1SJDA 3BG5A 1XYFA 2V3DA 5IOBA 1KM2A 4A3RA 1QOPA 3CHCA 4NX0A 1QOQA 2WJZA 3P60A 3UCQA 1UUMA 1B57A 4GYPC 4Q4KA 4LRSA 2Z1VA 1EP3A 2HSAA 4WSHA 2PDYA 2YKKA 4M6QA 1EQCA 3OVRA 3EDFA 5DT7A 4JKKA 1EIXA 4C5YA 2RDTA 3UBPC 1J6OA 1UR1A 4C6DA 3ZVHA 1UPPA 1EJXC 3DU0A 5DO8A 2OPJA 3PM6A 3R0UA 2XG9A 3ITCA 3LHVA 4AWTA 1LUCB 3KXQA 3CMGA 3G1DA 1F07A 3BLOA 1FCUA 4KEUA 4JKLA 4N42A 3R4IA 3SRDA 1G67A 2BP1A 3O7UA 4QFUA 4A8IA 4IGNA 1AFSA 4Z0SA 2Z0IA 4O15A 4J1OA 2PP0A 2CWNA 4WR3A 4WK9A 1QNVA 4UNIA 1LBLA 1S5NA 3TAKA 1A5LC 3W76A 1PDZA 3FGCA 3SI9A 1J0ZA 5CPOA 4BI5A 4QLLA 4F40A 5KZMA 1ZQ5A 2CBUA 3E49A 3A12A 5FF3A 2X09A 2GUYA 3OQEA 1QMLA 2IKGA 4LUSA 5K9DA 2ZUTA 4UFLA 1EGMA 4MB4A 2VEIA 4QEHA 3N3TA 3MUZ1 1KM0A 3BUVA 4M29A 4CN1A 3B8TA 4G6CA 4RL3A 2AL2B 5CZSA 2DZWA 4M1RA 4IHCA 1K6WA 4EXBA 3ZLFA 2D22A 1YLVA 4HSNA 1RQHA 2A0NA 4XZ9A 5I77A 3TW6A 3KL3A 1SVDA 1F73A 3N2CA 2ZRVA 5ABFA 1VHNA 4O1CA 3AS1A 2ZX8A 5MF5A 1KGXA 3QEZA 1V0MA 2VGBA 1GVEA 2PDNA 3BURA 3UWQA 3OU8A 4HP5A 1JAKA 2WWDA 2PAJA 4GBUA 3GH5A 3HGJA 5EPDA 2X41A 1NF7A 3N13A 2VX6A 4MAVA 1XYBA 1LYXA 3RLHA 1FFQA 5AC8A 3KBWA 2YW4A 3C0JA 3NVDA 1CGXA 1FWGC 4HJWA 3BTNA 1NDZA 3EOSA 2XIOA 3CNYA 3S5OA 3QV6A 5DQPA 1UWRA 3HOJA 4U31A 4LTSA 2E1DA 4DUOA 3DFOA 3TWAA 5FCZA 1CXFA 1W1A1 4HIBA 1T40A 4HOWA 5CBBA 1SZNA 3QGKC 3HMJG 1FWIC 2E67A 4FF7A 4ZQOA 4OTKA 4MF4A 1HX0A 1I45A 3BQ5A 3TSBA 1UZHA 5HUOA 1Z32X 3AJ7A 4GJ1A 3WLMA 2EAWA 2O4MA 2B31A 2E1WA 2AKZA 3BW3A 3UWEA 3AIQA 1UZ4A 5HINA 1FWDC 4WY0B 1OABA 3K8LA 2QNEA 3P74A 1YDVA 4XG1A 3A24A 2E68A 3NQFA 1TZ7A 4HMEA 3ARTA 2VENA 3W1MA 1X38A 4LVAA 2NVCA 3BL3A 2VFGA 2OQHA 4PMXA 1KRBC 5FIPA 4GK8A 4AHPA 1G0CA 4DXVA 4PC8A 2NX3A 4KEVA 4ZOCA 4KF1A 2XFWA 1QNQA 2EGZA 5FEXA 3SRKA 3SURA 3H7RA 2YCLB 5HMFA 4JTUA 3TOPA 2I5GA 4G7EB 3BOXA 3OIHA 4O19A 1TB3A 2VFHA 3G1VA 4PCTA 3V75A 4A8LA 1QATA 4HK7A 3N11A 3L66A 4GX8A 2C3ZA 4B16A 2FFIA 4JX6A 3UQNA 1Q66A 1W5MA 1R38A 3EWXA 4GHRA 3U57A 4AIEA 2J13A 1CGWA 5JIWA 3NCOA 3G0XA 4UR8A 3I7RA 4PUWA 4DQWA 1T7LA 1EC8A 4WSKA 5BROA 1V51A 4K6AA 3GHSA 1U30A 1S3TC 2PUZA 5BZAA 4MNMA 4PTVA 1WDWA 5CAKA 4DI8A 3AUJA 3KOXA 3SM0A 3GX9A 3C56A 2EEXA 2G3IA 3GTIA 1TUFA 3TYCA 3PZNA 1KCKA 4JIIX