3PJUA

Structure of pseudomonas fluorescence lapd eal domain complexed with c-di-gmp, p6522
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
249
structure length
249
Chain Sequence
QSLVADVGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclic dimeric GMP binding protein
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 86
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjuA00
4HU3A 4AG0A 3PJUA 4RNIA 3GFZA 3HV9A 4FOKA 4F48A 4F3HA 4Y9OA 4Y9MA 3GG0A 3S83A 2BASA 4RNFA 4AFYA 2W27A 3N3TA 4KIEA 4FOJA 4HJFA 2R6OA 3PJXA 3TLQA 3KZPA 5MF5A 4Q6JA 4Y9PA 4FOUA 3HV8A 4J40A 4Y8EA 4Y9NA 5MKGA 3GFYA 4ES4A 3U2EA 3PFMA 4RNHA 4LJ3A 3SY8A 5M1TA 3GG1A 3GFXA 4RNJA 3PJTA 3PJWA 4HU4A 5MKGB 4LYKA
chains in the Genus database with same CATH superfamily
2Y89A 3A64A 1B54A 3IGHX 5HK4A 1TV8A 3WL0A 3TQ0A 4BR1A 2JEQA 4EAYA 2ZUTA 1OFBA 4ZTYA 3MMTA 2PSNA 2CLLA 3IV8A 4XBSA 4YHGA 4RNHA 2B31A 1XYBA 3MI3A 4QQ3A 1SSDA 1VBUA 2OEMA 6XIAA 1Q6RA 4AEOA 1W1A1 1SFJA 2OLSA 3TYZA 3CV6A 2J7BA 2NUYA 3GR7A 4TX8A 4QDMA 4MFDA 3QV6A 3INPA 4I9TA 4CU8A 2BVDA 4C6PA 2NQ9A 4IQJA 1QI5A 1TV5A 1TJRA 3W1NA 2QGYA 1M1BA 1BXBA 3DN5A 4C7GA 2PDJA 3VINA 4W93A 2OGYA 4BQ5A 1J0KA 3T8QA 2YJQA 5AY7A 2VCAA 4UOQA 3WMCA 4IL2A 1ADDA 2E8YA 4DWDA 3QTPA 2Y62A 3S9YA 3LI1A 1VS1A 3EKGA 4EP8C 3GNXA 3OZOA 4PTWA 3IARA 2CZDA 3TKFA 5IM51 1KBJA 1GTHA 2J8GA 3IUIA 3IVSA 1JF6A 4CCDA 1B4KA 1XYAA 4OKDA 3IJ7A 3UZZA 1R8LA 3V1HA 1V6WA 4UBPC 4JXCA 4GZEA 4FB7A 3BURA 3M0XA 3KBNA 1LUCB 3HQOA 3CO4A 2XFFA 1MW0A 5CEWA 3FV9A 3GM8A 2QDHA 4GVGA 3FXGA 2PC8A 1P43A 3KDOA 1KFEA 5D37A 4UIOA 1WZKA 1TPVA 1H2JA 1XS2A 2D73A 2UY3A 1GVYA 2YB4A 3F4NA 4ZB0A 1TSIA 4HU3A 1MW2A 3UWVA 3WLIA 3BH4A 3DHFA 2IPWA 5TAOA 1V6UA 3S9ZA 4YU1A 5MF5A 3S1UA 2ASHA 5LA0A 2AQOA 3BAXA 5FJTA 4WD0A 4WJEA 2Y0FA 4QRNA 2XVGA 3J7HA 3NVDA 2IXVA 4HP5A 2D2GA 3EWDA 4DJDC 3VGDA 2HSAA 2V8ZA 3EKLA 1KCZA 3BWWA 2Q8LA 4O8AA 3UG4A 2OCZA 4QSFA 3QZAA 1ME9A 1PDZA 3TONA 4NZFA 1POJA 3DYOA 1LQAA 1S2TA 1ZENA 1E1CB 1F3EA 4ASTA 4HA3A 4QDPA 2CLKA 1UWTA 3ARQA 1TRIA 1J01A 4MKSA 3IUDA 4W7VA 4W89A 1OD8A 3A47A 1HJXA 4PMUA 1JCXA 1HO1A 2XN1A 4MY8A 3F2DA 1NOWA 1O66A 4JTJA 1NAL1 1IEXA 2Z29A 4JX5A 3U7BA 1SR0A 1NWRA 1ZQ5A 4K38A 2WMGA 2PMQA 2XSBA 5A8QA 3AC0A 5F1UA 1W1YA 1DJXA 1TQXA 2QIWA 3P84A 4MB1A 4OUEA 1HXJA 4DJEC 1UKSA 1KC7A 4PRTA 3O07A 1TUXA 3W1AA 4BKNA 3L4UA 4S2BA 4PMQA 1T8XA 2ZKMX 3OGVA 4HPHA 4L6DA 4D2JA 4MPQA 4V15A 4C1NB 2VL4A 1ZZMA 3SRKA 2WPGA 1W5QA 2Y85A 4JIHA 2DZPA 4RNIA 1ONXA 3LM3A 4O53A 4YNGA 1SO4A 2GWNA 4FALA 1AL7A 5FF4A 4XKMA 1KKOA 1LTDA 2VEIA 3RRXA 4QE1A 4PODA 4G1NA 3TX9A 4ML4A 2XSAA 4ICMA 2NSXA 3GDBA 1HT6A 3GIPA 3FVMA 2WPBA 1EQPA 2QCMA 4MUPA 1OK6A 1FFRA 1G4TA 1C9WA 3SCSA 3M41A 4LRSA 2DJXA 1Q2RA 4GKLA 1QPNA 2W66A 1UUMA 1IWAA 1AZ2A 1T99A 3EOLA 1MEHA 3ZJ7A 3DC8A 2GSJA 4HCHA 1LROA 2O55A 1Q6GA 5A6LA 3LXBA 4WDTA 4X9SA 1NVMA 2DIEA 2VNCA 1Z69A 3EB4A 4IX0A 2BVTA 2DH3A 4IGMA 3AHTA 4EPBC 3QMRA 5IBXC 2TYSA 2OELA 3GRIA 3SGZA 4CNTA 3XISA 2GJPA 4XTIA 1T6MA 4AMCA 4QLKA 1B3YA 4BHYA 4FIQA 3MANA 3GH4A 4ADUA 4DYEA 4B3LA 5EU9A 1KR0A 4AB4A 4R53A 3AUOA 1GUVA 4PBGA 4U5KA 5H8PA 5IRPA 1A5SA 4LAMA 2JGYA 5AYZA 3V35A 3WNMA 4OWGA 2D0FA 2UWFA 1ZL1A 3WUBA 2V2DA 3PPHA 4W85A 3MUIA 4AZCA 2Z24A 3GDKA 3Q4DA 4M5PA 5CJ5A 1ZBVA 2GYIA 3T40A 5LGXA 2JF7A 2JF6A 3NVTA 4X60A 1RP9A 1A5AA 3BQ5A 3O6AA 1G5AA 4Y7EA 2I5IA 3B8SA 1KM6A 3LBOA 3KCJA 3QLDA 2RUSA 1MUMA 2GL5A 5CZKA 3R89A 4PSRA 5BYWA 2DH2A 4M24A 2OWWA 4HN4A 1MXGA 1GOQA 3IUHA 3WQ5A 1B5TA 2QCNA 1BWLA 4KIEA 3E6EA 2PB1A 5A8OA 3OW1A 4GX9A 2Y70A 4P2VA 2Q8XA 1KW1A 4NKCA 2VX4A 2GJXA 3TN3A 1UPPA 2VDGA 2CITA 4JKMA 2IUZA 2ZUVA 4HYRA 1RP8A 1W1B1 1SW7A 2X09A 3TLQA 1EYWA 3I65A 1JGIA 5A2AA 3FAWA 7REQA 3B97A 3KVLA 4EVZA 8XIMA 3WLLA 3OBEA 3EA2A 1MZHA 2D24A 3RGTA 2IMRA 4PUMA 4LRTA 1J2BA 4KWUA 1MNZA 5CPMA 4JDYA 1T5AA 1V3KA 4TTGA 4ZSTA 4LF1A 1I8JA 1FH9A 2OPJA 2QS8A 3QPYA 4HGXA 3U0HA 3KLLA 2VGIA 5EFDA 4DO7A 1GYNA 2PF0A 3KS6A 2HZGA 4UTFA 1E0WA 3QFWA 5CPOA 1A5KC 1LL4A 5JVLA 3COTA 2XH4A 2XHYA 3VD3A 1U2YA 1HKIA 1KKRA 3TFXA 1YE6A 4OECA 3ABQA 2WAGA 3W9ZA 3T4CA 1EEPA 3SR7A 1M01A 1W3NA 5G4HC 3A3WA 4JYEA 3MV11 4H01A 3LMZA 1W17A 1XYFA 2Z2AA 3H4GA 4MNJA 1F07A 4LAUA 2CC0A 1EX1A 1MQRA 3HGJA 5LNSA 1ZJBA 1H62A 4MWAA 5CZTA 1ISZA 4OV9A 1K7EA 2BY3A 2PDQA 4ACYA 4AZ6A 4CD6A 2QULA 4TVCA 2YPIA 2WVVA 1XL9A 2ZZ6A 1BXNA 1FCUA 3QZ6A 4FOUA 3ZJ6A 4GBDA 1SW0A 3NPWA 2FTPA 5CPNA 2F9RA 3S1GA 3ABSA 1WQ5A 1K7XA 2O9RA 4U4MA 1TCMA 1MEIA 2AOSA 3GZAA 3TWBA 3VOHA 4FA3A 3GQYA 4RJEA 2WKJA 3M0HA 1MMFA 4MAZA 4RE4A 8CGTA 3PPGA 3N25A 4XAPA 1XPGA 2BSLA 2DGAA 3EX2A 3TC7A 1DIDA 3LY0A 3WG6A 4O8RA 1R38A 1VB9A 1K8XA 4YLWA 2QR6A 4OVXA 1SQ7A 4Z1YA 3ATZA 4B2DD 3CLMA 1WDSA 4F0MA 2IKIA 4H9VA 1L6FA 4WVXA 3FDKA 4AVFA 1WV2A 1X39A 2Y7DA 2QVNA 3W24A 3RRAA 4O0QA 2NQLA 5C2GA 3UCCA 3S9IA 4ZXOA 5CAKA 3KP0A 3IV3A 4JTQA 4O4VA 1GEQA 3LV6A 3CUGA 1FHLA 1OFRA 2QNEA 2GJNA 4IX2A 5LHEA 2F61A 2XGBA 3ZLFA 2HISA 3R10A 3AXMA 4Q8OA 4WX2A 4PR4A 5HQLA 3BK0A 1XCWA 1JZ6A 2NLIA 5EBUA 5AC5A 3GFYA 2ZOXA 1V0MA 5CZSA 3VZYA 3ZVHA 1Q8AA 3BZGA 3EDFA 2WVUA 4XIMA 1B4EA 1K9DA 3GS6A 2WNQA 3AMKA 2ABBA 1UH4A 1KM0A 1FDJA 3CXOA 3CHFA 2QCCA 3W2LA 4TQTA 1QI2A 1ICQA 4I9MA 4E8DA 4GA8A 1PZ1A 1DVJA 2IPGA 3SURA 3ZIZA 4HNCA 1H09A 4GBUA 1B3ZA 2BLEA 3P80A 2IXUA 1IZJA 3MMUA 4ZSUA 4O0ZA 4WZHA 2ZE3A 1JULA 4LANA 2Z1WA 5HJYA 2Y63A 5JH1A 4F8XA 3OP2A 1IXNA 5CC6A 5I3DA 3BE7A 2DIKA 4AZCB 2WZEA 2PWUA 3WDRA 4WY0A 2J7DA 3LV5A 1DIKA 2W27A 1XV8A 5K9DA 3VNLA 2XVNA 4IG2A 3M5ZA 3MCNA 4UFJA 4MKNA 4AXKA 3ENLA 1R6WA 2QCFA 4GFSA 5LKYA 2CHOA 4GI6A 1PUDA 2DV0A 4RE0A 1B30A 3GU1A 5DF0A 1XIHA 3EA1A 2EHHA 2X7VA 3AXIA 1QPKA 1RQEA 4DLMA 4JBRA 3ZZ1A 2H3DA 1H7WA 4JFSA 4AIOA 5TNVA 1MI3A 3GTXA 3TZNA 2D2OA 2GOUA 4H1ZA 3CBWA 3W23A 5I24A 5D4YA 5BU9A 1RPKA 1TRDA 1GW9A 3NQVA 4KT2A 2Z1VA 2QF7A 2Y7FA 2INFA 3E0VA 3AFBA 3B8DA 2BHZA 4ZQOA 3N73A 7REQB 4GNJA 3FA5A 4MJ2A 5FEPA 1E55A 4KEMA 2NXIA 1B90A 4Q22A 3VGFA 3AMLA 1W32A 2DZVA 1ZY9A 2PD9A 3H6OA 4WGHA 1QCWA 4C6EA 2DSWA 3NZRA 2Y1HA 3GW3A 4XIAA 2VHLA 4FS9A 2JIEA 3Q45A 3GFXA 1S3TC 1MDLA 2ACSA 1E6ZA 2VC6A 3GTNA 1O95A 1J5TA 4E2DA 1Q66A 2JKAA 4NZ5A 3KOYA 1JUEA 1M3UA 4LALA 3DG7A 4URIA 5HBFA 1CXLA 3LB0A 2CLEA 5CCZA 2B7NA 4CNNA 3TR2A 5K2ZA 4QJ5B 3STFA 3I4KA 3GZ3A 1UR2A 1FHVA 4AX6A 1FWRA 4U2ZA 4LVBA 3EWBX 3P60A 3DFPA 4Q8WA 3E0IA 4D1JA 4O1BA 3VFCA 1AQMA 2ZX5A 4MG4A 3R7MA 4C6QA 3AMGA 1JXKA 4DJDD 1LRTA 4Q32A 2C16A 3MP4A 1Q6OA 3BLFA 4MWAB 2I7GA 4ICCX 1ZCCA 1IXQA 1H1NA 1XDLA 3Q94A 1R5YA 3SJNA 3MY9A 1YW1A 4XVDA 3MSYA 3E49A 2QAPA 2QQ6A 2WVVB 3THAA 3PAOA 3B0XA 1MW1A 4QIUA 4IP5A 1E9ZB 3ZO9A 5A8PA 5HULA 3TYDA 5A6BA 1JZ5A 3O2LA 5CC5A 3TV8A 4US5A 1LM1A 5EFFA 3A24A 2O4QA 1TO3A 3ANVA 3B05A 2J88A 4I5XA 2PDFA 2JIWA 1WUFA 2DUXA 4K6AA 3VOCA 1ITQA 2YSWA 3RPMA 2Y5EA 2E9BA 2GGGA 1OYAA 3TSBA 3LXCA 5K4XA 4MYAA 4GIRA 2F8QA 2I14A 1BVNP 4L64A 3H4XA 1GKQA 2OQYA 5M5DA 4XTDA 2ABAA 3T09A 3CGTA 1HUVA 2TODA 2VCBA 3W7PA 3UZYA 3S5YA 1QDSA 3KL0A 4FMVA 3UZXA 1K9EA 2RJGA 3JW7A 2AGTA 5DY2A 2V68A 3N3TA 4ERIA 3WBAA 5FJIA 3WLNA 2YZRA 3HOJA 3VKCA 1WYIA 2CLOA 4DJFD 3GW0A 3GHRA 4CQAA 4GABA 3VNJA 3GHTA 3GD6A 3KRBA 1QI3A 4A3RA 3AMCA 1J0YA 1KB3A 3AYRA 1VIZA 4LUSA 2DZBA 2R8WA 3FKRA 3S2JA 3MZ2A 1DKWA 4A4AA 4FLOA 4NIRA 1KGWA 2GOKA 5ABEA 1ITUA 1I6NA 2VUNA 3R1ZA 4MJZA 3PSWA 4WSHA 2P3ZA 4H6EA 3H12A 5E0KA 1UZ1A 5F1VA 3ZVHB 1DIOA 1YEYA 1R3WA 5LIKX 1WXYA 1CXFA 2BXVA 3O06A 4K68A 3LQLA 3S5OA 5F4XA 3WQ6A 5DCDA 4IFKA 1GYMA 4QE4A 4XV0A 1A0EA 2QUUA 4MJ4A 2A6NA 1X96A 2W9MA 3MHGA 1R2RA 2GVEA 4QNEA 1OF8A 3W88A 4NJGA 2YDRA 1E5NA 2OTDA 4E6MA 4FXRA 3QZEA 2FMNA 1PDYA 4JYDA 3CWHA 1WDWA 4BI5A 4TIMA 4IGSA 1NM9A 3HV9A 1VF8A 4GI9A 4O12A 3U2OA 5BNKA 1OSEA 2VRJA 2WKLA 3QPEA 4WY0B 1BQCA 2CNCA 2FZBA 1OGGA 3NTYA 3NQ2A 3M4HA 5D2YA 4I6VA 4IG2B 5LXEA 1JVNA 5D2TA 2VM8A 3UEQA 3F4DA 2VR4A 1VBGA 3CPGA 4OTKA 4O57A 3P14A 1TWDA 3ZLGA 3CC1A 3LGEA 4QS6A 1ME7A 2YCLA 1OCBA 4JTEA 1AODA 4QG8A 3R0DA 2Y7GA 5D2XA 1BQGA 4Y9PA 5KZEA 4MHBA 4PA8A 3BOFA 4UTUA 1BVZA 1LBFA 1V77A 3AICA 1EL3A 5BMXA 2PWEA 1EO5A 2WCAA 5HOSA 1FDZA 1M5WA 1OG0A 3C0QA 1KM3A 2ESCA 4D6JA 3MS8A 2QHAA 4WDWA 3SCNA 5L6UA 4HVXA 4QAIA 3Q2DA 3PK7A 4OBTA 2NT0A 4CN6A 2XIJA 4XAFA 4X22A 4IMFA 3PTKA 3AJ7A 4O1DA 4OIFA 1X8FA 5A8MA 4UNIA 4M80A 3E0FA 5BXPA 1A50A 1BVWA 1VCGA 1JG9A 1IEWA 3P5ZA 1TR1A 2Y4SA 1XBVA 3VNYA 5I23A 2V82A 4AF0A 3E1F1 1OT1A 4QEHA 1EDGA 2Y5JA 1T0OA 1BGAA 1C7SA 5G2HA 5BW6A 1EOKA 2DVXA 2IW0A 5FJPA 1IT8A 2A5HA 1XICA 4NT0A 1XG4A 1JDEA 3BMXA 4JTDA 3LOTA 4HMDA 5AYYA 3U4AA 2V67A 1P6WA 4J3WA 4JGDA 3UFYA 3VDHA 1FWSA 4UOZA 2O92A 3LZ3A 3E5BA 1HVXA 3PSVA 5TQLA 4FNSA 3HURA 4IJRA 2EPOA 4XVEA 5HQMA 3S2CA 1X98A 2QVHA 4Q8QA 3KWXA 2QIIA 4CQDA 4G8TA 3B0YA 2X0YA 3AO0A 1G4SA 1KTCA 1F3XA 1GVSA 4FNRA 3NDZA 4Z1CA 4C1LA 4RZ4A 4J9JA 2D0GA 2DSKA 2X05A 3H24A 4H00A 3QBUA 1K7FA 3WJWA 3G3DA 2Q71A 3MVIA 1W6TA 2BXYA 1QNSA 3AXXA 3BMVA 3SCOA 1B3OA 3W7JA 3BJTA 3MBFA 3H2MA 5LNUA 1BHGA 2HK0A 4IIHA 1TV7A 1KM4A 5C9ZA 1EF3A 4RW5A 5FL0A 5K3VA 1EBGA 5LIUX 1SSGA 3W28A 3KBWA 4IMDA 4S3KA 2NQHA 1IT0A 4K1GA 1D3CA 1U5VA 4QXIA 5SWUA 5C6MA 3IGUA 3RLVA 3V5OA 2VR5A 1EOMA 3E5PA 4DB7A 1RUSA 3LHWA 2WC3A 3JZUA 3WQWA 4BI6A 1TG7A 1R30A 1W8SA 3GO2A 3W84A 1DTUA 1K77A 4POCA 4R3UA 4HNOA 4PRRA 4OT7A 3VPLA 1NFGA 4CQ9A 3VMPA 3D5HA 4BY3A 3WF3A 3BPWA 3L2LA 4QE5A 1V93A 3H2OA 3PR2A 1WX0A 1UOKA 1ZUAX 1HIZA 3WD3A 4DY1A 1UUOA 3PZQA 1RJQA 5AHIA 4RKAA 4LUSB 3UNTA 3DI0A 4Z08A 1S5NA 1EB3A 5D02A 2J8FA 5E6YA 5CGQA 4KERA 3RAOA 3ZSTA 2F7FA 1PZ3A 1JIBA 1FWIC 4N2YA 4G7FA 4BQ3A 1EC9A 3UPWA 3TSDA 4JFWA 3PBWA 3EOSA 1XKYA 4Y90A 2A7NA 1R9XA 1VH7A 1GWJA 1HNYA 5DLCA 3W7HA 1I2RA 4PMNA 4F0SA 5C54A 5HNRA 1GOXA 1EDTA 1UR1A 5A95A 1Y65A 3CPUA 2PLCA 3L0KA 3KFTA 1HJUA 3H7VA 4HZ8A 3UXAA 4FF7A 4IFKB 4NRRA 3JR2A 4NNBA 3AYSA 4ZTXA 3CZKA 2X30A 4EX4A 1W1VA 1NELA 1GOIA 5FD0A 3E2VA 3NPUA 3BSMA 1SW3A 3RR4A 4J28A 1EWEA 4JN7A 1VJSA 1TE1A 3BW4A 1OYBA 1ISXA 1GCYA 1KXTA 1DV7A 3PB2A 1JGMA 2IPFA 3BCFA 4JIQA 4DBWA 4RE3A 4GFIA 3W1QA 3BZJA 2J24A 3SCTA 3MA8A 1REQA 5J5DA 1P7TA 3VK5A 4W4QA 2OZ8A 2BFGA 3A6OA 3AI0A 3O0KA 4Q4QA 3G2GA 4PUUA 4XQ6A 3FHAA 3WNLA 1JDCA 4N02A 1ZBWA 4CCZA 2JFEX 3W7DA 3AHYA 2XH2A 3CL7A 1W31A 1HJQA 5BXSA 1E72M 4JEQA 2WVTA 2C14A 3RU6A 1VFHA 4AHQA 2YDQA 3SN1A 4PE8A 4GQQA 2FPYA 5E0FA 2WW5A 4C6OA 2I56A 1T96A 3H53A 4MSSA 2DQWA 3JU2A 3GR4A 2BB0A 4XZNX 1NTHA 4ERAA 3M5XA 2GDVA 4ZQPA 4A22A 2XFRA 3RLUA 4MLRA 1EPXA 1Z32X 2YCLB 1DHPA 2J79A 2G50A 4QS5A 3F2BA 5AHLA 3DC0A 5GJNA 2WC7A 2YL5A 1FP8A 1ZSXA 1C8VA 4GISA 3W1LA 1XIMA 4UWMA 1AW1A 1OGSA 1UR0A 1OHLA 3M0IA 4XK2A 3U6WA 1QU4A 4R7JA 2VC9A 3NPVA 2HS8A 4K37A 3U4FA 3SUSA 3F1QA 5HANA 1FWCC 2FPVA 1FXQA 1KFCA 3PANA 3VA8A 4YCOA 3R2GA 5EBAA 4ORIA 4YTTA 4C6NA 1W3KA 1GW1A 4B15A 1ZTVA 2VRQA 4KCTA 4O1AA 3SY5A 2OMAA 4QROA 3LCWA 1Y8BA 2ZZ3A 5A3HA 1P0BA 4YCPA 3TWAA 4KWWA 3I6EA 2A2IA 1UH2A 4UQ9A 4MF4A 2WXDM 4AF0B 1XI3A 4FK9A 1EXBA 3M7SA 5KEZA 1OD0A 4ILSA 1XH0A 3BUVA 1DQWA 4S3DA 5REQB 3ORWA 1R85A 2FHFA 1WDDA 4CU7A 3C86A 3AIUA 1O68A 3R6IA 2BG5A 3LX9A 4Z2HA 3FVDA 2H9AB 2CESA 1OCNA 1EBHA 3G0XA 2V5BA 4EK7A 3NZ1A 3DFQA 4LX4A 1EDQA 1ADOA 5EA9A 2X42A 3BC9A 2WZHA 4NZJA 3F4WA 1HQTA 4CD8A 3QHOA 3EOUA 3WLKX 1JPDX 1XPYA 4Q4SA 3GXIA 1BWVA 1J0JA 5I06A 3W6MA 4O1EA 5BU6A 1SJCA 2XZ9A 2XWDA 3TMLA 1UR9A 3GX9A 1QT1A 3BTNA 5JMUA 4HBKA 1JRBA 4W9TA 3DERA 2DVTA 4M7TA 3FSTA 3EBVA 4H9YA 4A6GA 3QR1A 2NWRA 4NYYA 2ZIDA 2WB5A 3SUWA 1E1EA 3P67A 1VQTA 1PEZA 3NOYA 2UBPC 2C0AA 1N82A 4IPIA 3LK6A 3K46A 3NO1A 1YIXA 2R24A 4F79A 4YTRA 2ZXAA 3PJTA 4JIIX 3HU7A 3CEPA 4PZVA 2Z6JA 4Q8MA 2PRHA 1S38A 4C7DA 2J25A 2A1YA 4KESA 4YPJA 3MW7A 1XUZA 2WBKA 2XJ7A 3N15A 3TTSA 4YVVA 2VT0A 4AH7A 4EWJA 5E93A 4JEJA 3SY1A 2BOGX 1E4MM 3H23A 1JZ2A 4F0HA 4C6BA 3KS5A 1N55A 1JL8A 3BLIA 4MB4A 4OUIA 1BG9A 5H2ZA 1W5OA 3CZLA 1UB3A 3DESA 2H90A 1D9EA 3UA4A 4FI4A 1IIGA 3LCFA 4B4HA 4CNUA 3UY8A 4LB3A 3AUJA 2VP8A 4NYUA 1SU5A 3WJYA 2V2CA 1F3TA 4YVPA 1QATA 4O14A 1AFSA 4BQ4A 4X9YA 1XRFA 1LLWA 4O11A 3MZNA 1DWIM 3VDGA 2X1SA 1CDGA 4ZQCA 3KVMA 1TTIA 4Q6XA 3S1XA 2YBUA 3WQPA 3THUA 1RK6A 5HMEA 2ZC1A 3WQOA 1FWHC 3AS0A 4HNLA 4UFLA 2HE5A 1RJPA 3ONBA 3VD5A 5EMJA 4GXMA 4J35A 1TWZA 3B06A 1VBRA 4ZQNA 5BOEA 3CZEA 1AH0A 2CLPA 3MO7A 3G24A 3FJ6A 4EXAA 5CGMA 1OG6A 4H8VA 2HCVA 2INEA 4GO8A 2PDKA 3GKFA 1H0GA 1KA9F 1S2CA 3W82A 3VOGA 2EPHA 4C65A 4PULA 4KFPA 1W9PA 3ES8A 2ZUWA 4JPGA 4FR6A 3EXSA 3B3DA 5FIPA 2QUMA 4WEVX 5A8NA 4N9EA 1H63A 4ZMGA 3VDAA 2HPIA 1JPHA 3W1PA 4L56A 4JOMA 4UUIA 3B9EA 2Z1KA 4F48A 1DPMA 1V3JA 2NV1A 1SJDA 3W00A 1IZKA 3FGCA 4QISA 3KCLA 2ZA3A 4DI9A 2J77A 1EGMA 2A3HA 5LIYX 3VOFA 2OLHA 3UYIA 2G4JA 2IKJA 1EP3A 3CUXA 2XG9A 5CAHA 3MCOA 5ABTA 2OOFA 3L0NA 3VYLA 1Z89A 3L66A 4KEUA 4WSKA 4DNHA 4HZ7A 4LTSA 1TPWA 3M1ZA 1Z48A 1TWSA 3GUGA 4NAEA 1VJZA 1CNVA 3FJLA 2PDXA 2XFYA 1ICSA 1BFNA 2RDTA 3M0LA 4EANA 4DAFA 1X6LA 4Z2JA 1SVDA 4UMCA 2J7FA 4GUIA 3EPOA 3POCA 1BTCA 5D38A 1QJWA 1R7AA 3NSMA 4MVAA 2DIJA 3ZR4A 4LNCA 1VHNA 4P7NA 3WLOA 2FVKA 1RLDA 1GVOA 1W9DM 4M1BA 2G3NA 1JR1A 4O10A 3QY8A 4GYKA 3URAA 1QRQA 1UYQA 1KM1A 4U31A 1J0IA 2F84A 2AAAA 5E9AA 1RVGA 3G1RA 4ACZA 2WMFA 5C2CA 3AIQA 1XLEA 3H8AA 1AQFA 3KVKA 3CHVA 4IMEA 1Q85A 3GVGA 4JQ4A 1NDWA 1RV8A 2BXZA 4Y9NA 2JALA 3CS2A 3VKJA 5HA7A 4GXWA 4RK8A 5J5RA 3G1FA 4DM1A 2L5HA 1PIIA 3W26A 1KTBA 4DXXA 3AZTA 4D9PA 3K8KA 4AFYA 1QHPA 1D2KA 2NZLA 3VNMA 3WNOA 5CGTA 3P93A 4LW7A 1NARA 4JTRA 4UFIA 1HKWA 2UZ9A 3WK2A 1WDPA 3ZOAA 2IKGA 5CZ0A 3OYXA 1R7OA 2E25A 3LHUA 3W0KA 3VIGA 1VC4A 2VVSA 3ZT7A 1A4LA 4I9AA 5LXXA 2FGBA 3E0WA 4J1OA 1QNVA 3MHFA 4LS2A 3TJLA 2VO5A 4RXFA 2HTMA 3TQVA 2DZSA 6A3HA 3B9OA 3MP3A 3EYPA 4LVAA 4DPPA 3OLEA 1AJZA 4H7ZA 4FXFA 3LNMA 3D3FA 3SSZA 3P62A 3VM7A 3SFKA 2O0TA 5A94A 2X1IA 2DW7A 4JNZA 5HMSA 1I60A 3L4YA 2Y8UA 4G2DA 4G6CA 1OIFA 3A4XA 4I7WA 4EXBA 3WELA 3B0PA 3WF2A 2FDSA 3CMFA 3SIZA 3PTQA 2REQA 1RZMA 1CIUA 3OZMA 1J96A 1X38A 3PWIA 3S2NA 2WCGA 3LPFA 1OCQA 4O28A 1D8CA 1FKWA 1JYNA 1TIMA 2D0HA 1JF5A 5AFDA 2GQAA 5K9XA 3VIKA 1FUYA 5DEZA 4M8UA 4Z2GA 4E3TA 1KFBA 4IIBA 3SM0A 2V63A 2XGIA 3I7SA 4OHQA 5A2BA 1YDNA 4M51A 1E6NA 3L12A 3MUXA 5HNNA 2CHNA 4L9XA 1D3GA 4J2MA 2X1RA 4RV8A 3GDMA 4X0NA 2C13A 4WLCA 1RHCA 4LH8A 5BOFA 1J6OA 4PFMA 2G3IA 1U1UA 2I5QA 2YX0A 3QMSA 5IHRA 2HNEA 1R47A 3LSCA 4AWSA 3BGAA 5G1YA 4LUTA 3S5NA 2FH6A 4YYFA 4PEKA 2PZ0A 4RCXA 3AMDA 3VGBA 3TIMA 4LC6A 4XD6A 4D6EA 4HYVA 2YW4A 2JKEA 4PL2A 4DJEA 3A3HA 1KGUA 2R91A 3NL3A 3KL5A 3VX1A 2DU2A 4CEUC 4RXGA 4P7OA 1WA3A 2OSWA 4QAWA 2WHMA 4TOQA 2C1IA 5I00A 1ZFJA 1U5JA 3GBEA 2ZZ2A 5JH2A 1SO3A 3JVAA 4JTSA 1B1YA 2E68A 3AISA 1TCDA 2PWDA 1UWRA 4PBEA 3T2QA 2ZTJA 4C5ZA 2D23A 1ZB5A 1KWKA 3HMJG 1YXCA 2E40A 4V1YA 3KRSA 3BAWA 3U2EA 1EJXC 1Q7MA 3WDQA 1XUUA 5I03A 4A21A 1H3GA 1IV8A 3WQFA 3OZYA 3ARWA 1D8WA 2O56A 3ECQA 1PJ9A 1ZLPA 1I45A 4MB5A 4L5ZA 4DLFA 2YL9A 1YKWA 3HN3A 1GTEA 4CD5A 3MUCA 5DXXA 3UXKA 4ZQMA 5BOOA 3AZRA 3NSXA 3EWYA 2NX9A 3HFYA 3OG3A 1KM2A 2HVNA 3QQWA 4RZ6A 4CVUA 3BOXA 3OO2A 1TMLA 1RVKA 1XC6A 5G5IA 2Z26A 4EAMA 5B80A 4NAEB 2VELA 1C29A 5XIAA 5F4WA 4AY7A 1IEVA 2A3LA 2PWHA 3L5LA 4LC8A 2GGEA 4HN8A 3NM3A 4RLIA 3IIZA 4LCSA 1F5ZA 2CBJA 1PTDA 4GY0A 4XO7A 4I90A 1Q63A 4TTUA 3ITGA 1HFBA 4JTCA 1YTKA 3QEZA 2J75A 4WJXA 5DELA 1NY1A 1WZLA 3U8GA 2A3BA 3W83A 1P0DA 1MQPA 5C9WA 1MW3A 2BV9A 2CKRA 3SUTA 4DBEA 1K8YA 4AZGA 4XZ9A 2GVGA 3W7GA 3EA3A 4O19A 1VFTA 3TMQA 5AB3A 3NEHA 2OB3A 1XLFA 4MWAD 3QGAC 4S38A 3VI2A 2QDGA 4J3UA 1K1DA 4ACZB 1TPH1 2WJEA 2DORA 3FNDA 2VWSA 5GQBA 2AQWA 4LVGA 3TTYA 1Y5VA 3TP4A 4MADA 3WQ8A 3AJXA 4AD5A 4DIAA 2Y24A 5I5RA 4BI7A 5HXMA 5EKYA 2J74A 4XO6A 7TAAA 3S8HA 3WY1A 3SRHA 4JHOA 3T8LA 4X2RA 3CYVA 5HPOA 1ALDA 1P1MA 4ZB2A 3ARPA 4UR8A 1UWQA 2V2HA 5FF0A 1JPKA 4D72A 1PWLA 4IT1A 1W0MA 2CHRA 5RUBA 5HQEA 1J10A 5BRQA 3N29A 3MSGA 1DWJM 3N9RA 1ZRQA 1YRRA 3B04A 1TMQA 1ISWA 2FZNA 1E0VA 2E5CA 4HSOA 4RNJA 3FS2A 3UP8A 5HWNA 3T42A 3IWPA 3HBLA 1J18A 2ZTKA 4F3HA 2RJHA 4W7UA 5KMYA 4HNNA 4XKYA 1BRLA 2P10A 1TPFA 2GK1A 4A35A 1IWPA 3BLDA 4MZ8A 2UY5A 1LT8A 1VFOA 2WCSA 4YTUA 1XP3A 4EOUA 1K02A 2WQPA 2C7FA 1H1YA 4FLRA 4RW3A 3TOYA 4DM2A 4GUFA 2J27A 1VRXA 5FF2A 2REQB 4KWVA 1A4MA 3PN8A 3O63A 2J6XA 3LLXA 1EGZA 4JKKA 1OC6A 3EMZA 4HPNA 3T7VA 5C8BB 1M9HA 1OX6A 1OB0A 3SIMA 2D20A 1XLBA 4H9TA 2OFJA 4B91A 3VGEA 4RUBA 3C0SA 4X63A 4NQ1A 1L6YA 3SY8A 3WUFA 1L8PA 2O7QA 4XBKA 3V5FA 1RD5A 3QOMA 2OO6A 3PPCA 4OV4A 3K8LA 3DG3A 3WD4A 3WSUA 3DDMA 3S1VA 1P0NA 3VIPA 4WR3A 5ABFA 2HWGA 1PX3A 2V3GA 3NSNA 3TDFA 5A6MA 3AALA 5AHMA 2GSHA 3U2ZA 1H61A 2BY0A 1WKDA 4LUTB 1WAUA 3UY7A 1QVBA 4AWUA 4GK8A 4JQAA 2XINA 3UPMA 3BO9A 1XRVA 1UD2A 3RN6A 5C5YA 4KETA 1XIBA 2W61A 1QOQA 1EP2A 1UUQA 3QV7A 3IAQA 1M7JA 1XH1A 1RR2A 3AS1A 1K70A 2Y8KA 4ZOCA 3PBUA 2B7QA 3ZR6A 3AXKA 5E09A 1WZAA 3MJYA 2DP3A 1HO4A 2FFIA 3A9BA 4DN1A 3NQMA 4E4UA 2J78A 2VX5A 4YYCA 3N17A 4AWTA 5AVHA 3P8IA 1R3YA 2JKPA 4WHBA 3KOFA 1U83A 2DT2A 3SN0A 2PDWA 4HA4A 2W3ZA 2P50A 2QEZA 4Q8UA 2GQ8A 4S23A 1KCXA 2WJFA 3EB2A 1LQ2A 3NOEA 2W67A 3ZVIA 1C90A 1JI2A 3OHIA 3ARRA 3OJGA 3CTTA 2WNWA 3FCPA 3PZNA 1XIDA 1V79A 4UMAA 3WMSA 1QPQA 5EL1A 3QW3A 3GY1A 4O15A 2V5LA 2EO7A 3PTDA 1UASA 3GNOA 1V3MA 3NQDA 4MZYA 3PTMA 3V4BA 2BDQA 2WOQA 1AMYA 5HWMA 4WKHA 2F6XA 4PTXA 2P1FA 3BCDA 4FR1A 5E1QA 1LZOA 1H51A 3HG5A 4H19A 2EQDA 3QPZA 1PWMA 3L65A 3UR8A 1B57A 1UD5A 4HZMA 3UCDA 4E2BA 4JHMA 1WP6A 4XD4A 2B0MA 3LSBA 1DXEA 2BOFX 4A29A 3WEOA 4D8ZA 3VKDA 4AU0A 2Z4GA 3PUOA 2H6RA 2IQ0A 3W07A 2F2HA 2QDDA 4P8VA 4Q8NA 3HPZA 3UWUA 2VC5A 4IIFA 4OOUA 1LT7A 1OZMA 1WOAA 1E9LA 4MMWA 3W25A 1YTEA 8TIMA 3UJ2A 2ZZ5A 1VLWA 3CAVA 3GG0A 3PULA 4H6RA 1W3IA 2RH9A 3T07A 1I0DA 1ZP4A 3W7MA 4J40A 2OX1A 1PCWA 3W7KA 3N6HA 2E3ZA 3DFHA 3E38A 3VVGA 1K03A 5ABGA 2OQHA 3PAJA 3S5ZA 1OFQA 7ODCA 4E38A 1OFAA 1QASA 3PBVA 1FDYA 4EE9A 3TYCA 3N14A 5F4SA 3N4EA 3O1NA 4US5D 2ZC8A 1JYVA 1ECQA 1K6AA 1F4AA 4LJ3A 4JL1A 2Q01A 1OIMA 5ABHA 2PBOA 1GQJA 1ZJHA 3VE9A 4KRZA 3WBEA 7ENLA 1E0TA 3NCOA 3NQEA 1P1XA 7A3HA 1XIGA 3NNTA 4D6DA 1O5RA 3M9YA 3O15A 2NUXA 4LBSA 1BTMA 1KRMA 1F74A 1Q2SA 3L0GA 1UR3M 1XFBA 1XW8A 4W5ZA 2PU1A 1FH8A 1GHSA 2FMOA 2W91A 1B2YA 3W1RA 2BASA 3O6YX 2ALDA 2Y61A 1GQIA 4AD1A 2OO0A 1GT8A 1WAWA 1KV5A 3CO8A 3MHUA 3K8MA 3FJNA 1ODZA 3UJRA 1G7VA 3VUSA 2WHJA 5H91A 4NJKA 1GKRA 4XG1A 1BRLB 4XKYB 3CHCA 3FHQA 2GK1B 3AU6A 4UFKA 1BYCA 3L67A 2NXHA 5LNWA 4H6QA 3WH9A 1TB3A 3AROA 3GG7A 1IXOA 3KZPA 2ISDA 2CWXA 1XSKA 5CBIA 4V27A 4GIYA 1G4PA 4HD5A 1IGSA 1TJ0A 3EB3A 3HG4A 1X97A 1PE1A 1PTGA 2OKTA 1F76A 4DUVA 1ZP3A 4IUOA 1ZPTA 3IACA 1KXHA 1UP0A 3UGVA 1E6PA 4KMQA 3M0KA 2PBGA 3LTSA 1O1HA 1JI1A 2RGLA 3LDVA 1JYXA 2OT0A 3WYZA 1NOUA 4RPPA 4UCFA 4CVWA 2ZYFA 1ZGDA 1R3VA 3M0MA 3T0CA 4AYSA 1OABA 2ZXQA 2VFIA 3GXPA 4UTTA 4M7SA 3S2MA 5CPTA 5I09A 2BWGA 3GC4A 3LRMA 4IIGA 3IJDA 3AIVA 3FFSA 4PTVA 1JCMP 5ABFB 1EWDA 2QAFA 3PZ9A 4KBXA 4UQDA 1DWAM 1LG2A 1G69A 3WQDA 3NAVA 2D2JA 4H3DA 3C8NA 4GVFA 2V5KA 2YKKA 3LNPA 5E6ZA 4BF5A 4UTWA 2WZIA 1C8YA 3K1GA 3G8RA 4UFMA 5AYIA 4F2UA 3WD0A 3GXMA 4HU8A 3C6CA 3V75A 2XSXA 2TAAA 3WLPA 3O6CA 4A8NA 2ONEA 2X16A 4QJ1A 1XJBA 2OZ3A 4QGCA 4ZGYA 4TUFA 3CL6A 3FKKA 2DSUA 4UTIA 1VFSA 1R3TA 1TPDA 2QW5A 4JTFA 5AKQA 4B5NA 2NVCA 3C5QA 4BK9A 4R7OA 3QXBA 4NAFA 3WLRA 3WZ0E 4DELA 1NEYA 2VOMA 4WXYA 1QBAA 3T0AA 3M64A 3T44A 3VGGA 2NLYA 1I2OA 1RLCL 1Q6LA 5HMDA 4ORMA 1KQYA 3FYOA 2YLAA 4FX7A 3M5VA 2NUWA 3LHYA 3M07A 2JK2A 1IR1A 3AHVA 1YXDA 4WK9A 3OVGA 3MDWA 3TYBA 3ARTA 4R27A 3UW6A 3W74A 4B2DA 4DRSA 1RSCA 4REQA 2OYKA 3F4VA 4IPPA 1XX1A 2OLAA 2PP0A 3G18A 2J13A 3PNZA 3O16A 2RDWA 1J5SA 4E0CA 1FX6A 2EG8A 3NDOA 2QPUA 2O9PA 4IHCA 2ISFA 3T2OA 4GKTA 1JAEA 4FNPA 1JJKA 1NF0A 2CPUA 2V9DA 2ZRYA 3WN6A 1NFPA 4EXQA 5D09A 3VU2A 2Y6ZA 4DUOA 2HPMA 2VDIA 1O4UA 4GJJA 3V0SA 2F38A 3H2EA 5CPSA 3VABA 2YYUA 4B3ZA 1W56A 4QCFA 4U10A 3CV7A 1F8IA 4L9ZA 1WDRA 2DQXA 2E1WA 5D2WA 3SADA 2Z1SA 4U28A 4KEVA 3QH2A 2OWCA 4C91A 1OCJA 1NDZA 4G1KA 5D9NA 1XG3A 1TZ7A 2C0HA 4GGHA 4W84A 3FK4A 3E2RA 3GDTA 1H7OA 5D33A 1EO7A 4K2SA 3EX4A 2Z1BA 1VYSX 2WJZA 3IIPA 3QYSA 3PM6A 4IXXA 2ZRZA 4PMZA 1JQXA 2PDPA 4JQ3A 1DOSA 4MOZA 3CPRA 3SRFA 3N34A 3FN9A 1R3SA 1NU5A 3TOPA 1TJ1A 3W29A 4ZCWA 4KWSA 1J6PA 1UOZA 4AQLA 3ARUA 1SO6A 1LWIA 1UCWA 2PGFA 1XYMA 4IFOA 4N4QA 4N0RA 4RL3A 1M68A 3W1UA 1V3LA 3QKEA 5FESA 4LPCA 3WCZA 4OFCA 1AJ2A 5D04C 1Q6CA 3OBKA 1AA1B 4EIVA 2C71A 4BFAA 2YL8A 4TVDA 2A7RA 3N4AA 1MYRA 4HPJA 1TWIA 3QV9A 2HS6A 1UJQA 4FNQA 5DRCA 3TTEA 1TVPA 4GNVA 1E73M 4X2PA 1RQBA 3WEZA 4LY8A 4P7LA 2PTXA 4P8WA 2QCHA 1KR1A 3C0JA 3I68A 1QI4A 2G3JA 3EDDA 1GOWA 3NIYA 3PUDA 1HP5A 1O5QA 2X41A 4FHAA 4PUDA 3MMDA 1F4HA 3B40A 3EEZA 3WH7A 4E8CA 4JAWA 5AHEA 3WNKA 3ZWSA 1G1YA 5TD4A 3TN4A 2OOGA 2I17A 4KGLA 4AHPA 4Q7NA 5FEWA 1VIWA 3CB8A 4C5YA 3B8WA 3W38A 2PRMA 2DT3A 4ALDA 5BXTA 3B8TA 1SJBA 3KM8A 4D8LA 3WLHA 2QUVA 3RK8A 4HA0A 4WGXA 3VMOA 3IIVA 3CQIA 3W76A 2CZVA 5HINA 3DX5A 4AZBA 1OINA 5DBTA 5D9OA 2ISWA 4FLQA 4AIUA 2Z27A 1CZ1A 4PMXA 1PB0A 1Q13A 2QV4A 1QAPA 3SZ8A 3MUZ1 4KGJA 3RILA 3BLEA 1UQYA 3UR5A 3TE9A 1GOKA 2WSKA 4IFRA 1PAMA 1D7KA 2C18A 3BXWA 3EDJA 1UH3A 4LYPA 1TE6A 4R7WA 1D7FA 4Y8FA 1AL8A 1P0KA 5G2IA 1NDYA 3W02A 1HL9A 4DF2A 5F7UA 1E4LA 3GG8A 4J3XA 3WDJA 2J47A 5C2XA 4AIEA 3AIWA 3VD7A 2VEMA 4U3CA 3TW6A 4JHZA 1GKPA 4GLEA 1TYGA 3NWRA 1V6TA 5LIXX 3RG6A 4DYJA 4BQ2A 1KRBC 1Z8AA 4J3VA 3RPDA 2J6VA 4M0XA 2D2HA 2QYGA 3S0CA 1UD6A 2V30A 3WL1A 4DF1A 4KCUA 3OLIA 3DOPA 3G1DA 3EXRA 1G7UA 3TCSA 2BVWA 1KNWA 4KPLA 2FTWA 1KCLA 2GUUA 2X1UA 1J8VA 4ATDA 2VEKA 3R43A 4XD5A 4PTNA 1PXGA 2PWVA 4NAFB 2I9UA 3D46A 3C2YA 3R0UA 2EPMX 1M7PA 3CJPA 3CAWA 4O0KA 1XBZA 3CUIA 2YYTA 1E71M 1UKOA 2WMKA 1R3RA 3W53A 3W2KA 3GNDA 1CXHA 3WKZA 3WNNA 1TZZA 4PRWA 3S4TA 3RCNA 2BHYA 4XAZA 3B4YA 1GQLA 3Q67A 3LLDA 1CGVA 4O1CA 3VM5A 4Z0JA 3R12A 4N6FA 2GUBA 4DJFA 5LGZA 3WDIA 1HKKA 1XBYA 3I10A 2X0SA 4BEUA 4JQ2A 2WM1A 2WC4A 1EGVA 3TVAA 3AIRA 2JBMA 5FJJA 4MAVA 1IQ8A 2O9OA 3CUJA 4W5UA 1E5JA 4K3ZA 1I1WA 3R0KA 3U9IA 4FP1A 4OBSA 2VX7A 3WBWA 1F8MA 3GU9A 1UPMB 3WK1A 2PTDA 4GZ7A 5GVJA 1KRCC 4C90A 3RMJA 3FA3A 3UZ5A 4TV5A 2VMFA 4NJIA 4XUYA 5TF0A 3SGUA 4AHOA 1VKFA 3KXQA 2ZVRA 5E70A 2C91A 4GYPA 1A49A 2DJLA 1TVLA 5DBUA 4ZXLA 5HJLA 1F6PA 5BXRA 3OVRA 4QP0A 4KFNA 2FGZA 3OTRA 3VKKA 4NUWA 3WMBA 3LBCA 1A5LC 3MC5A 4ROPA 1UP3A 1XGDA 3DYPA 3UR2A 4AMAA 3PWAA 1V0NA 5K9CA 1XSJA 3WD1A 5D8ZA 1EJRC 1UD4A 4HSNA 3P2VA 5FSDC 2C1GA 1GZGA 4X0VA 2BODX 1A0CA 4M3PA 1VGAA 1M6JA 1V7AA 1HF6A 1X8CA 2NXGA 3AU2A 3SO7A 3R8RA 1TV2A 4A3UA 2VGBA 4UTJA 2ZZ1A 4HCDA 4MWAE 5JIWA 3KP1A 2PEVA 5E5CA 1OJXA 4JR5A 2FZ8A 3U57A 1KM5A 1CLXA 1WBJA 1JRCA 2P5NA 3H2FA 4AZ5A 1P6CA 2MANA 3TXZA 2V6AA 1L8NA 3GXTA 2ADAA 1KBKA 3KW3A 1QNQA 1GOOA 4JFUA 2A21A 2I1OA 5LA1A 3ES7A 1VHCA 1UKQA 1EP1A 1DJWA 2WZMA 1OQFA 3A13A 3I7QA 4JCMA 3TQKA 3W2UA 1VP5A 5T9CE 1NOFA 4MGGA 5IXEA 3DHUA 2OZTA 3M6YA 2ZWZA 5AYXA 1SM9A 4R5EA 3MVTA 4C6JA 3ZLHA 3MJMA 3DG6A 4IQLA 3BARA 1YMYA 4S3AA 3GNPA 3W6YA 4GVHA 3AYVA 3W7IA 5IDZA 3BG5A 3UG5A 5D05A 4UNKA 3ZXWA 1TTPA 2OX4A 2BTMA 1A3XA 5CC3A 3NQGA 2Z25A 4UXDA 1EIBA 5BWAA 1W1TA 1DWFM 2PFHA 1WUEA 4RE2A 5HJXA 4BCEA 4IMCA 3WO8A 2VDHA 4M6QA 1RBLA 3R11A 4QQUA 1JNDA 2VZTA 5DMLA 1X6UA 1BWKA 1F7BA 3NO3A 5DMNA 1YLVA 3BLOA 4WUIA 4L65A 1OFOA 1GZ1A 4QR6A 4ZBCA 4IPNB 1XDMA 4AVNA 3IVTA 2VGFA 4AVOA 1TR9A 4CD4A 3MYOA 2VR2A 1U1HA 3WQEA 3DFNA 1H0IA 1CGUA 4LV4A 5I7GA 4AC1X 4AY8A 3S3GA 2R9RA 4AZHA 3KOZA 2W63A 3A3XA 2VXNA 4C6DA 8RUCA 5A6JA 3HPSA 4QITA 4DUWA 2PCQA 4QLLA 5AC8A 3T0DA 2LLEA 2NX1A 4H8HA 3DGRA 1OT2A 1KFWA 5IOBA 3U48A 4E2VA 2PGWA 1UIOA 3LG3A 2ZUMA 4PUEA 1FWGC 3GH7A 4S1FA 3BANA 1ODUA 3N1AA 1ZAHA 3SCWA 1DE6A 1B9ZA 2BNJA 2CU0A 3M47A 2ZDSA 2A3CA 2EBNA 2YZ5A 3CIXA 5FEZA 2P0IA 5AZ0A 5JIPA 3MUY1 3B0UX 3ZT5A 4Y2WA 2X2YA 3F5KA 3N4FA 4ENLA 4LCQA 1EA9C 2D1ZA 4AIBA 4H8NA 5DCEA 4XZBA 4PBFA 4DNMA 2PRLA 2XTKA 4DBDA 4PMVA 1E56A 1F2JA 1GVIA 4EF8A 1Z6KA 3UR7A 4IGNA 3CUZA 1UD3A 3PF3A 1W9VA 3R79A 4IXHA 1NQ6A 4B5UA 3SJ3A 1K6WA 3LGGA 3UWQA 3OODA 5D9MA 1VFMA 1AVAA 3HQPA 4UQAA 1QHZA 1QNRA 2PDMA 2YIHA 3CMJA 3LM7A 4J3TA 4CNOA 5HMFA 2PTZA 1JCNA 4B5VA 1CGTA 3KDNA 4WCJA 3W72A 1JFXA 1EQCA 4ATLA 2W6RA 3DGBA 3HG2A 4PH6A 2YXXA 5I2UA 4B4FA 5EY5A 3V18A 2FLIA 4LUYA 4DO4A 1XBXA 4Z1BA 2NSOA 4MFEA 1UWUA 3DIPA 3LERA 4HHHA 1Z41A 1O94A 4BF9A 5LSMA 2GGHA 5I78A 4JY8A 1JFHA 2JE8A 4C6KA 2QZRA 1UG6A 1F73A 1G67A 1VR6A 4FNUA 2F6UA 1SO5A 3GDRA 1H50A 3T6CA 2GJXB 4M81A 4N9CA 2CIPA 3R58A 4S39A 4LOCA 3AHXA 2PZNA 3CEUA 3H2AA 2FJKA 4W88A 1FWDC 2Z7GA 1HL8A 4LT9A 3JRKA 3CWOX 3IS4A 5I3JA 5CXPA 4B92A 4U5IA 2J7GA 2HE8A 1WNOA 3OA3A 3ZMRA 1QFEA 2D3LA 3M7WA 4Q8PA 5A6TC 4UQBA 4LY4A 4E8GA 3DFTA 4F9JA 2VEGA 2ZRWA 2B4GA 2F6KA 3CQKA 1H5VA 1QTWA 2EPKX 3W01A 1W1ZA 4JKLA 1LRNA 1EHAA 1BYAA 4I8DA 3WNPA 1KD0A 4L61A 1LUCA 3PZOA 4GY7A 1JD7A 3OU8A 1KLZA 3PZIA 2WVSA 4F0RA 3DEQA 4AEFA 2AL1A 4DZIA 4S3EA 5AC4A 5B7ZA 3STGA 4Y9MA 2OSYA 2Q8ZA 4B5SA 1LWHA 4R88A 1HKVA 4FX8A 3QGVA 5JQ9A 3RHGA 2BVYA 4MB3A 4Q3MA 4J4KA 2PCEA 2VD9A 4UTTC 4IP4A 4D1IA 3MDUA 2R1MA 5G2WA 3W7QA 1DHKA 3M16A 2PPGA 2YA1A 5IDIA 3FX4A 1DWHM 1EHNA 1WZMA 3B8IA 4S2CA 3M43A 4V33A 2C3ZA 3ITXA 3PG9A 1V0KA 4IJBA 1HKJA 5FCZA 2OSXA 1P48A 1U22A 4I8YA 4GHRA 4GYFA 4UTWC 3IJLA 3CMGA 3VMNA 2GLKA 3PZTA 5AC6A 2XVLA 1FCQA 3FYYA 3L21A 3W81A 1KFJA 1IR2A 3WMLA 4K7YA 4KS0A 4PFHA 1M7OA 3M0JA 3MWAA 3N9SA 4OE7A 2XH7A 9XIAA 4FEZA 2XH0A 3SECA 4K8EA 2VX6A 1XC4A 3TTQA 3M46A 3NXLA 2VQTA 3W22A 3IK2A 4TMBA 3SI9A 4LAZA 1DJZA 4DJED 4DXVA 1EXPA 6TAAA 3ALFA 3C61A 3MV01 2E6DA 3VXGA 4A8LA 3NZQA 3UF9A 1YNPA 3GYEA 2CLFA 3GNNA 3UCQA 3NL6A 5A69A 1LCOA 3RIKA 5MHBA 3NQ6A 1J4EA 1HGWA 3QJAA 4UOJA 3QSRA 4U3AA 3GWQA 4L4OA 4NF7A 1LDCA 4M6VA 4NZ3A 4CQCA 1P0EA 3WFAA 4GVIA 4NX5A 1PSCA 4ZVJA 4QSHA 2GPTA 5KSWA 4H7VA 3W87A 1ZCOA 5I07A 1R3QA 4UR9A 3R94A 1EIXA 3BGGA 4HK6A 1CYGA 3LTPA 4K8HA 2CZ5A 1RJRA 2IPJA 4B5XA 3HGRA 4FPSA 3SEPA 3TAOA 1UW9A 4HNUA 1CI1A 1TPB1 3WUEA 1EUNA 3TNOA 1FHDA 1A5UA 4C6FA 3RX3A 4P61A 4AYGA 3E9AA 1DP0A 1QW9A 3EWUA 4TXEA 3L68A 3TCEA 3H54A 4DAIA 3SAZA 2GUYA 4BS0A 3QY6A 2V69A 4QLJA 1SMAA 1KXVA 3ARZA 2DVUA 3KTSA 3OYZA 4IJCA 3PZMA 4PC8A 3PPFA 2NQ5A 2HDJA 3RCYA 4ZOBA 1ISVA 4HSHA 3APTA 4MY1A 4A2SA 2R1KA 4RDZA 2WV8A 1HJVA 3UVIA 3VNIA 2DT1A 3RXZA 4O16A 4ERGA 4ZOAA 2A79A 3LENA 2A6LA 3AXHA 3TFCA 3FXYA 3GHUA 2VGGA 3F4CA 3ZJ8A 1RXOB 3KCOA 4Z1DA 1RD6A 1UJPA 4F0KA 2FZMA 3W1TA 1JPIA 2JGQA 3KOWA 4DZHA 3CIWA 3MB9A 1EC7A 1DBTA 2XISA 3VIFA 2CETA 4MNKA 1IXPA 3FDGA 2TSYA 5LHFA 1QK0A 3GIYA 1XLDA 2ACUA 1AH3A 4RR4A 5I3IA 1HZYA 3IIXA 2Z0IA 1UA7A 3UD6A 3W7EA 2WHLA 1X7FA 3W73A 3AWNA 3H55A 1E6XM 1PKNA 4Q6JA 5KTLA 1EJUC 2HEJA 1R2TA 3SCRA 3GYCA 1QNPA 2PP1A 3NGFA 4RDVA 5CSSA 2POZA 1MVYA 2CFFA 3BDKA 5CKSA 1XLLA 4TV6A 2AMGA 3HFTA 1NP0A 4L7ZA 1XINA 1Z3NA 3THCA 1OBAA 1I1XA 3VUPA 3D0CA 2VFEA 3LTYA 2FVMA 1YHTA 3BCJA 3RX2A 4C6LA 1UKTA 1DL3A 3P61A 3GSMA 1OADA 4A05A 5HPCA 5FJOA 3CZ8A 1ZALA 1UBSA 2R1PA 4HJWA 1DJIA 1E43A 2V81A 4G7EA 3WIJA 2VWTA 4E2OA 1AD4A 4KFOA 1L6WA 3WBYA 1H7PA 2ZX9A 4K1WA 4HJFA 4NL1A 2XVPA 4Y9AA 3ZQ9A 2XWEA 3N19B 1LJYA 3EWCA 2VCCA 3NYDA 4DBSA 4HU4A 2GZXA 1S1PA 4GD0A 4CKQA 2OG9A 4GZJA 2DZWA 2YCJA 5C0QA 1QK2A 4FX6M 2BHUA 4QM1A 3W7CA 4CLMA 3KBJA 3SDOA 3RUBL 1RQHA 5I0DA 1RBAA 4INFA 5K4ZA 1RH9A 3TJXA 2V0TA 4YS1A 4GH1A 3CQ0A 2YOCA 3N04A 1PBGA 3HA1A 2NT1A 3SUVA 1OZQA 1BF2A 4IF2A 3VIIA 1H7NA 4ATWA 3KE0A 4HMEA 3M0VA 2VQUA 4GC4A 3A5FA 4V2XA 3MSDA 1E70M 1S5MA 5ECVA 4ICNA 4QTGA 1G0CA 1FWWA 1Z7AA 2C6QA 4YIWA 3LN3A 4LVDA 4JIEA 1CXKA 4ROQA 3H2CA 4EACA 2ZA1A 3KWSA 1CXIA 3UWZA 1W1PA 3KOXA 4UCGA 4ZENA 5CLTA 1T40A 1TA3A 3S47A 4PMDA 2NVDA 3TU9A 3L4TA 4PCNA 4XBJA 4C6MA 2PP3A 4L1WA 1Q5MA 4LF2A 1XQKA 4IMGA 9CGTA 1EJWC 1M03A 3VD9A 3CM4A 4PN2A 2PWGA 3BV7A 3UWEA 2ZX7A 2D3NA 2FKPA 3L23A 1GGOA 4LXFA 5B7YA 5JBEA 3LCIA 4GX8A 2Z2BA 3BICA 3CASA 2H3BA 3KHJA 3L9CA 4H9UA 4IQDA 1GVQA 1LBMA 5I3FA 4HCLA 4LUIA 2WK2A 5HUPA 3QYQA 3CT2A 5U7SA 4DJFC 1PIGA 4DZ5A 4Z1AA 3A9IA 3NUKA 4Q4RA 1A5NC 3WQCA 4L4PA 2A7PA 1ZAIA 3PP7A 4FIRA 1XIEA 3O05A 4WKFA 3MO4A 1K4GA 3HG3A 4UTMA 1C8XA 5E0CA 3PS7A 5C7HA 4LEFA 3VFLA 3QQ0A 1NQKA 2J7EA 2E9LA 3EDEA 2GVLA 4JN8A 1VJIA 3AHZA 4LUJA 3W71A 2GVYA 3L2IA 1VYRA 4C6IA 3SCQA 1SFSA 1AQHA 4GYPC 3W7RA 2CLHA 3EX6A 3ABOA 2HVMA 3DU0A 1SMDA 1U5HA 3UESA 1VPXA 3ITYA 3IRSA 1W3LA 4XZHA 2EKCA 2PLMA 1XGZA 4AX7A 3N3MA 1K9FA 3TN6A 3LRKA 1C7TA 4HTBA 2Y8VA 3O9NA 4NU7A 4MLJA 3UJEA 1R46A 3V0UA 4GACA 5CZJA 1UC4A 2KX9A 3EOOA 4HIBA 3NZGA 1UQZA 2BOEX 4LCRA 2QCEA 2CWNA 1UMLA 3P5YA 3QTGA 2QCDA 1RA0A 5D8WA 2D22A 2AKMA 1UHVA 2QCGA 3THDA 2WQDA 4DO5A 5DT7A 1XISA 4M56A 1A0DA 4L4MA 3WUGA 1W37A 3LS9A 1QI0A 2XM2A 4L1GA 3GVQA 1BSIA 3AYTA 3EZ4A 3S42A 4GE8A 3W27A 1EPVA 4YJ5A 5HR7A 4DZAA 1FH7A 3WK0A 4RZBA 5TIMA 3UJFA 4F0LA 1J0HA 3HPXA 3C52A 3GU2A 5FL1A 3F03K 2WZTA 1ZAJA 1Q65A 1DIEA 4ECLA 3H7UA 5F2GA 3MBDA 3G1HA 2VYOA 3HQNA 5DMMA 4Q8VA 4UTHA 4KEZA 3QN3A 4HNVA 3VAVA 4BA0A 1ISYA 3VNDA 4LU0A 5HNTA 3KAOA 3C0LA 3MMWA 3E74A 4XZLX 5G4WA 1V5XA 2PUZA 3VC6A 1PKLA 1DE5A 3A5VA 3HPFA 1CECA 2XIIA 1TIWA 5JBDA 3RYSA 2PDUA 4QFUA 5AOUA 1E9YB 2VD8A 4G7EB 5CJMA 4GUHA 4JYFA 3CTLA 1BGGA 1EA0A 1P4CA 4N9DA 3TJIA 3S6TA 3EMCA 1UZHA 1VENA 4JZ5A 4FAMA 4DWSA 4WXZA 5K7JA 1E4NA 4AD0A 4Q7IA 4UQEA 1SFTA 3QF0A 3QR3A 1B3WA 2V5CA 1E3XA 3V7PA 4Z17A 4R9OA 4R34A 3DI1A 2NV2A 5BWFA 4GIAA 1VFUA 3ABRA 7CGTA 2POTA 3CK5A 3MUAA 4FF5A 1WB0A 3B0VC 1IT7A 3AIBA 3TYAA 3E96A 3ITVA 1VFLA 1MXSA 2XUCA 1US2A 4L9YA 2Q6ZA 1EFZA 1YDOA 3L5AA 3BLPX 2BP1A 1ZBKA 3WDPP 3OLGA 4B3KA 4GOAA 1CEOA 5DY3A 4MDPA 5A8GA 5CPLA 4PYSA 5A6AA 1VBHA 1AQ0A 5DXYA 3PWGA 4GUGA 1RAKA 3NQBA 5F2MA 4ADSA 4NP7A 4NI3A 3PHAA 3IAPA 5LA2A 3W6LA 3SN4A 1R2SA 2WSYA 4XB3A 3BG3A 3GKAA 4A2RA 3W2MA 4BWLC 2V5JA 2WJDA 1BEUA 1GHRA 1A5OC 2CCRA 3NA8A 4F2TA 3GVVA 4IIDA 4O13A 1V02E 3DHDA 1MXDA 1TA3B 2OYLA 3MQTA 1F05A 2ISSA 1UR4A 4GQBA 2X0HA 2XYLA 1SR9A 1AW5A 1DJHA 2I5GA 3NQCA 2OZ0A 1QWGA 3PJXA 1B31A 1PYMA 4B9YA 1YPXA 3JZEA 1X1NA 2PLJA 1VAHA 2WSPA 3KRUA 3FLUA 1AG1O 3GR8A 5T26A 1LLZA 1F9CA 2WBGA 3E12A 5C71A 4CN1A 3QMTA 3OOQA 3QRHA 1A3WA 5ENLA 1Z42A 3C2OA 1PX4A 4CCCA 3USZA 5HUOA 3M0ZA 3IRDA 1OFPA 3W86A 3QGKC 3OQEA 5CC7A 4DHGA 1XIFA 3PJUA 2QGHA 3QQ1A 3I3EA 2OEKA 2IQTA 1VEPA 3L7RA 5D32A 3RLHA 3KUMA 5CG0A 4UFHA 5JXQA 3NM1A 2VJXA 3SQSA 3JUGA 2EG7A 1L6SA 4ZO8A 3HGSA 5T91A 3LZ5A 2MUCA 1UIPA 4LWWA 3WLSA 5ECUA 3U2CA 3N2TA 5FJUA 3VKBA 1GZJA 2X1TA 1Y5XA 2DEPA 1K4HA 3ZYZA 4G9PA 3OGSA 1UC5A 1FOBA 5IHSA 2PDGA 3VTRA 3VE7A 1JUBA 3P8JA 1WXZA 1C8QA 5D2VA 4AEEA 3C2EA 1L0PA 2CZEA 3S1WA 3IPWA 1REQB 4MKVA 1P7TB 3SB0A 5FI8A 3PG8A 3AS3A 1C91A 3CUHA 5FSEC 2I57A 4HHMA 4PCFA 4LYQA 1IWBA 3TTOA 4OZOA 1VLIA 3DAQA 4QEEA 6ALDA 2ZUUA 4PCTA 3OVQA 5GJMA 2CLIA 4P7QA 3L4VA 2FIQA 2QCDB 3I4EA 2WKGA 1E1FA 2RFGA 1E51A 2ATSA 1EZWA 3IJ9A 1AJ0A 4LEQA 1BPLB 3UBPC 1LOLA 3URBA 2HROA 2J66A 2PGEA 3ALGA 2XIMA 1KWGA 2RAGA 4LSBA 3TUUA 3VCNA 3RDKA 1A47A 2WO5A 4KW2A 4B9ZA 2R1LA 3WENA 4WKAA 3KX6A 4RX0A 2E0PA 3CQHA 1CBGA 2X8RA 4XAYA 3F5JA 2P53A 3RR1A 3S6DA 1RCXB 1NWSA 3I7RA 2BZNA 2O7SA 3I3BA 1DYSA 2W92A 3B8VA 2VFHA 4GCXA 3TR9A 1YXYA 1FY6A 2YB1A 2GQ3A 1FKXA 1VFFA 3FEMA 4GPNA 1FWTA 5A1AA 3WF4A 3G22A 3TNBA 1XGEA 4M82A 4C6CA 5CLWA 4ES4A 3OIXA 3FIGA 3ANYA 4HK7A 3V0TA 1ZNNA 2EXOA 3L4XA 2EAWA 1SGJA 4DUXA 2WHKA 5GNYA 3S83A 4UTLA 2ZE0A 1UA3A 3BLKA 3PZVA 1O6IA 1OWQA 4DYKA 1UWAA 1JCLA 1MNSA 1XLHA 1GVRA 2H8XA 1EJVC 4MNMA 9XIMA 3QVQA 4JS3A 4RPQA 4CNPA 4TU1A 4RZ5A 3CLWA 4DWSB 1DTNA 1TPUA 3OA5A 5HNUA 4NSBA 1US3A 2Z6IA 1X1ZA 1FFQA 4ZZ9A 3ARSA 3W70A 4KIRA 1ELSA 4Z2IA 1QO5A 1GQKA 4NX0A 4HPXA 3UA3A 1CTNA 1O12A 5EMKA 3K13A 1TQJA 3K4DA 2VC7A 2E4TA 3WQVA 4DI8A 1CGXA 4ZFCA 3TLLA 4LYRA 1MUCA 3T2PA 4NNCA 1PKYA 5HATA 1AZ1A 1TREA 1MWOA 3C2VA 2NX3A 3S6OA 1NJJA 3PBGA 4I9JA 1VBJA 5H6HA 1OFDA 4ZE4A 2E5DA 4GXPA 5KINA 1VPQA 2AKZA 2OODA 4W86A 5CSUA 2BGNE 3DENA 3HV8A 3CT7A 4AD4A 1XWYA 1G9HA 3CH0A 4PMJA 2E6YA 1N7KA 1PHQA 4EPDC 1VCVA 4M19A 2ISVA 3IVUA 3B9NA 3F2CA 1EYEA 3NG3A 1GG1A 4IP7A 2PS2A 2J8TA 1XD1A 3T4WA 3B9AA 1XLJA 2VI0A 3PNUA 1XM3A 1HJWA 1AMKA 1DWGM 2D69A 3T81A 3REQA 4GC3A 3QY7A 1FWEC 2XZ7A 2GJRA 2IS7A 1RK5A 3TYEA 1SYTA 1J12A 4ZOEA 4C7FA 4JTAA 1ITXA 3KBMA 2F2KA 3CIVA 4CQBA 4DVOA 2Q3RA 3B03A 4KKXA 2GDQA 5CSYA 1PO9A 3R13A 2YFNA 2XIBA 4XUGA 4JDBA 1PHWA 3XIMA 5HAOA 3L4ZA 2ZDRA 3EOEA 1XKJA 3PFRA 4XSMA 1VYPX 3ZWTA 3BLLA 3RF9A 3SGGA 2WYSA 4U2YA 2WWDA 4WIWA 1FXPA 4X3ZA 1U1JA 1MRQA 3IJ6A 4O50A 1NWTA 3LQGA 3GBDA 3DH7A 3M44A 1GYLA 3UXLA 1UZ4A 2YW3A 3I3DA 5C7VA 3ZS4A 3QM3A 1DQUA 3BAIA 3MKKA 3WDHA 4JTGA 2RGMA 4DPQA 2VFFA 2YCKX 3CV2A 2PA6A 4W87A 3GIQA 3ELFA 2ZA2A 4N6EA 1W9UA 2QJHA 4HHLA 4XWUA 3WQ4A 1G4EA 2YXOA 4ZA0A 2CLMA 5DT5A 1LF1A 5I3HA 1CXEA 5MKGA 3LLFA 1I75A 3FAXA 3L5MA 2YR1A 3V1PA 4KCVA 6REQA 3T78A 4Q8TA 5DANA 3SCPA 5DFAA 1IIHA 1EKOA 3BW3A 4JTHA 4L6OA 2OEJA 3TAKA 4I7UA 5A6KA 2ACQA 4G56A 1PL9A 3RX4A 4IUGA 1VEOA 3GTHA 3KEHA 2OQLA 1SJAA 2G4FA 2OJPA 3AOFA 2ODOA 3FGCB 1BAGA 5I02A 1LL6A 3EGJA 1HW6A 1N2VA 2E6FA 1A5CA 4G5DA 1IGWA 3RFAA 3MYPA 3EWWA 5KITA 1NSJA 5DCBA 1JAKA 5FEXA 1S2UA 1C93A 5KZMA 3K5XA 5AHNA 2XIOA 3EKZA 4XD3A 4A8IA 1Q4NX 2HXTA 4GCAA 1JCYA 3NXFA 1JUKA 3LHTA 1YNYA 4AISA 1MFVA 3NL2A 3W7LA 1HN1A 5GNZA 3G1VA 3KL3A 1GNXA 4J5NA 1MEWA 1IE7C 1MFUA 5CSRA 4P8UA 2C79A 4M1RA 3A21A 3CHEA 1KQZA 4KRTA 2PDCA 4LAKA 4H83A 3NPXA 2YDAA 1MSSA 1WOBA 2E8ZA 5FOOA 3MI6A 2W5FA 3DECA 5DMYA 2ZXDA 3PC0A 1KV8A 4GQGA 4J27A 3KRZA 1ADSA 3JS3A 4MPKA 3QOKA 1N8WA 3N6JA 3STEA 4QNWA 4D8AA 2X40A 8A3HA 1RALA 3ITLA 2VZUA 3LRLA 1YPIA 3N2CA 1OF6A 1PKMA 4QG9A 3GE7A 4NG3A 1TELA 4OBRA 5I77A 3UPBA 4GI8A 3N13A 2CKSA 4I5UA 5M17A 4C1KA 1V0LA 3UGRA 3KBVA 4GH3A 3UWYA 2WWCA 2A0NA 3DKJA 3ICJA 4D6GA 4XISA 2AL2A 5E9XA 4GG9A 5EPDA 3EX1A 3RM9A 3U3HA 1WBHA 2IQDA 2G3FA 4Q4OA 2YGYA 2ZXBA 3W85A 1F6YA 3XINA 3EPNA 1PZ0A 4D71A 3TXVA 3IEBA 3BJSA 3UYCA 3K4WA 4KCWA 3WJZA 1WKYA 1JZ3A 4RDYA 5FACA 3W7OA 1S2VA 2Z28A 2VVNA 3LU2A 1IZCA 5REQA 1TWWA 3BJFA 1EEXA 2FQIA 1I2PA 3UZJA 1UBPC 4YWSA 2PF8A 3RM4A 1ME8A 2OVLA 2H9AA 4H04A 3SCUA 2OR2A 2R6OA 3C4UA 1DJGA 4DF0A 1XLKA 1POKA 1W2VA 1KCKA 5EMUA 3E2QA 3Q65A 1XLGA 4PB3A 3NYZA 3T08A 4CN4A 3RPTA 2VZVA 1TUFA 1XD0A 1NF7A 1V4YA 1RY8A 1JQVA 2G3MA 1JZ4A 1W2PA 3EDKA 2RKXA 4YTQA 4CGTA 1W1IE 2FB3A 2A85A 1V8EA 1B3VA 4IIEA 1SPQA 4CD7A 2EJ1A 3QC0A 1LOSA 4ZEPA 4GNKB 5CQ1A 3NQ8A 4AXNA 2PGRA 2A3AA 4IQEA 1Q6DA 1KGXA 1Q6EA 1A53A 1J93A 3F5LA 1QW8A 3REQB 1YBQA 3VIHA 3S2LA 4JTUA 3SUUA 2Y88A 1O60A 2WNZA 3E2SA 3CYJA 2BBFA 3APGA 2R82A 3QKZA 5BRBA 3R4IA 4PUNA 1V6VA 1X1OA 4HPGA 2G0WA 3VIJA 4AY1A 1B9BA 2AAMA 3WX7A 3EX3A 1LQ0A 1FP9A 4IZGA 1FWNA 3V3WA 2BMBA 3AIEA 2XGZA 4FLSA 4L4LA 4WDUA 4W8BA 5D9PA 2C8NA 1E4IA 3U7VA 2WMIA 1MZRA 1TKKA 2J7HA 5CBBA 1EX5A 4Z2KA 5A5WA 1V51A 5EMYA 2GVJA 1JCTA 4Q4MA 2Z7KA 3WFZA 1TVNA 2V3DA 1NIUA 4X61A 5DN1A 2G37A 4K7VA 3TSMA 5M2FX 1UROA 1O7AA 4D6IA 4KQNA 1FHUA 2PTYA 3ZT6A 4H4IA 3QLLA 3H70A 2PURA 2R1NA 5DQPA 4GJ1A 3ERPA 2XPKA 4IPJA 3TZFA 1TFVA 3BSHA 1XF0A 1BKSA 5MKGB 1LOQA 1OM0A 4JX4A 1XSIA 6REQB 4NRSA 3TYUA 1W3HA 1ZJAA 2HRWA 2OU4A 4ZO7A 4Q7BA 5AC7A 2DZTA 4Q4PA 1XLAA 1XRSA 1LWJA 3A23A 3EXTA 4OGZA 1WDQA 1A3HA 1OY0A 3ABZA 1NP2A 2QJNA 1J0ZA 2Q3OA 2A4AA 3CAQA 1D3HA 4BZYA 2YA2A 3G6MA 4GGBA 5HR6A 1LP6A 2EG6A 1E0XA 1R9YA 3N2OA 3M5YA 1US0A 1Z44A 5JBFA 1R87A 4HTYA 1XDJA 3Q58A 4O4WA 1Q8JA 5C55A 1S3HA 3VZXA 4JNMA 4DWSC 4WDXA 2QLYA 1E0UA 3APYA 3EWXA 2QF8A 1ECEA 3AS2A 4L1XA 4HOZA 3FY1A 3MSRA 1KRAC 2C15A 3HPAA 3C2FA 1BKHA 5GPRA 1PCKA 2TPSA 4BJHA 4I7VA 2CZFA 2B7PA 2NV9A 4QDWA 1QWKA 2PDLA 3VZZA 3G8EA 4GWEA 4HMNA 3TN5A 3RO6A 4QX4A 4K8GA 2BGSA 1FCBA 4ML9A 2QPSA 1SUXA 4FOKA 4R9XA 2PD5A 1QOXA 1NWUA 3CAKA 3PBMA 3ARYA 4UZSA 4H6KA 1O5XA 1K3UA 1FQ0A 2NWSA 2YA0A 2VRKA 3GH5A 2JEPA 7PTDA 3WK3A 1UKPA 3OIHA 4WSJA 4H2CA 5G1TA 2J7CA 1JPMA 4MWAC 1QW7A 3VIOA 5A6BD 3QFEA 1HJSA 4H9XA 3VGHA 2XIQA 4EPEC 1DXFA 4Q33A 1GG0A 1C3FA 3ONCA 4YHEA 4YMZA 2AL2B 3LCXA 3HGOA 4RDWA 3HZ3A 4HYWA 1CB7B 3PBYA 3IJIA 4XAGA 4TX6A 4A3YA 1LLOA 2WMHA 1HVQA 3GXDA 1UR8A 3KLKA 5EMLA 4DO6A 2ZRUA 2INZA 3MWCA 4YN5A 3VIMA 3POHA 3ZJKA 3MU7A 1H5YA 3ARXA 3UT0A 1CGYA 1CX9A 4M29A 3HJZA 3Q37A 3I6TA 1I0BA 1VD6A 4MTVA 4FZIA 3EAUA 1P5BA 4LGXA 1KTNA 3C8FA 3ISIX 5I3GA 4J2PA 2GJLA 4Z0SA 1IEIA 1S2WA 1M41A 2Y2WA 4ZO6A 2FB2A 4PMOA 3EWZA 4GIEA 4LQ1A 1UP2A 4PSPA 4HOWA 1PX8A 1T41A 1TPC1 2WMJA 2P3EA 4DQWA 3TK7A 3TA6A 4EF9A 1H1ZA 2Z00A 4ZL1A 4H41A 4LBRA 4NZ4A 1ONWA 1W3JA 2GQ9A 3IIOA 1SZEA 3LHVA 5FF7A 2RHGA 1V6YA 4HT3A 3W7NA 3M0YA 3G3MA 4XZMX 3VKAA 4Y8EA 1HX0A 1DEDA 1XH2A 1J9YA 2VOTA 1G01A 1YBQB 2VURA 3IJ8A 4HHPA 1EC8A 2GWGA 3ATYA 3BQ6A 3B8UA 3C3NA 2EGZA 3P0XA 3DFSA 3K2GA 3LCGA 1H7XA 5CPQA 1DQXA 2OWXA 4PCSA 3RO8A 2FHCA 4MM1A 3TJ4A 2BX7A 1R86A 4H7CA 2PDYA 4NXSA 3OLDA 5T8GA 5J04A 3QC3A 1XYCA 3GC5A 1AK5A 3UG3A 4HB7A 3GFZA 2NW0A 4LS0A 4Y9OA 2RDXA 3GTFA 3CB3A 3YPIA 4E5TA 3R8HA 2E28A 2WMIB 2QMKA 1S5VA 1YE4A 3LCHA 3P3BA 3RNDA 1FWAC 2CBVA 1VEMA 1FCVA 4LB4A 3DZ1A 4YL2A 3T0BA 4V28A 3EPMA 3QW4B 4O1FA 3QSTA 2A3EA 2WANA 4P7RA 3RU8X 1CWYA 4W7WA 3PUGA 2PTWA 3A4WA 2KZHA 4V1XA 1ML1A 4IM4A 1V02A 5CG7A 2Z2UA 2YCEA 1CENA 2QJIA 1JXJA 3MCMA 1I4NA 3SQLA 4F66A 4IL0A 3H2NA 4EKJA 4KRUA 2PC4A 2PDBA 1OK4A 3VNZA 1AD1A 1AUSL 5A6SA 1GJPA 1IF2A 1LL7A 3WH6A 1E6RA 4WJ8A 1MQQA 3SBFA 4PEEA 4O18A 2YLLA 3IGSA 3DBPA 1SZFA 2EJAA 3OG2A 1NDVA 1ZU8A 2FPTA 3KTCA 3AQUA 1VZWA 4GUJA 4IICA 5H8UA 3USBA 2NQJA 3GAYA 3O8AA 1FA2A 2E67A 3D3AA 1PZ2A 1OVDA 3BG9A 3DXIA 3OEXA 3O7UA 2J9XA 2OXNA 1OYCA 2PLKA 2ACRA 3N2MA 3RM8A 3PZUA 1QHOA 4N4PA 2XU2A 1K9TA 2QXWA 3N2BA 1X6NA 3K4AA 1YYAA 2XN2A 2EF9A 2GGJA 3P81A 1S2AA 3RCMA 3ITTA 2Y5SA 1R9ZA 2DDXA 1GPFA 5PTDA 4GQ0A 4MIMA 2FJUB 1W8GA 1L9WA 3N2XA 3SSJA 3WBXA 3V16A 1XLIA 1XIIA 1KFKA 1XIJA 4KWOA 4IGHA 3ITCA 1MRAA 4WQ6A 1FWBC 3AAMA 3S46A 4JFVA 5M03A 2GFTA 2PODA 3MT1A 1DJNA 3MKCA 1W9XA 2VEPA 4FOJA 1E6QM 3KTXA 4LAOA 1E6SM 1M53A 5I79A 3ZR5A 3T1GA 2YL6A 3CQJA 4ZFMA 4F40A 5TBOA 3BSGA 1U30A 5G4EA 4UC5A 1XCXA 3CHDA 5CBJA 4WY0F 2Z1XA 2WLYA 4TX9A 2FH8A 4I6KA 2UY4A 3NURA 1QXLA 2P8BA 3N18A 5I6SA 4B90A 2PWFA 3O0FA 4YVXA 2E09A 3UNDA 1Q4WA 1TX2A 3GC2A 3HIJA 5AZ1A 3L2MA 4KF1A 3HTWA 1G94A 4B5TA 1E9IA 3LA4A 3BMWA 3W1MA 3UU0A 3VCRA 1KXQA 2XM1A 3WLJA 3QV8A 4LVFA 1W9BM 1WCGA 1C92A 3NO5A 3WH8A 2IKHA 4NZCA 3HF3A 4M6PA 3H22A 1T8QA 3UVAA 3VD4A 1LYXA 3N9KA 5A2CA 3URQA 2HJPA 3DFYA 1OC5A 4AW7A 2V38A 3FOKA 1RA5A 1MUWA 2FFCA 1J79A 6XIMA 1GPWA 1GVEA 5IFTA 3BGJA 1A5BA 1UWIA 3BL3A 2MNRA 4GJIA 4TVUA 3VDCA 1J2WA 3VILA 1HGYA 4YTSA 3WQGA 3F7JA 4OOZA 5LYRA 4Z2LA 5C9RA 1I2QA 1JEZA 1XHGA 3UWWA 2YBTA 2PAJA 2XVKA 2C1HA 5HWJA 5LIWX 4JICA 2QT3A 4CUCA 2FGLA 1V6XA 3C56A 4JNYA 3RJYA 2ZCGA 1PPIA 3OBAA 4L80A 1JZ7A 3CH9A 3UQNA 3LYEA 4HOXA 2VZOA 4N7QA 4O54A 4AD2A 1Y0EA 3WF0A 3BAJA 2B81A 3KVJA 5EYWA 4HNTA 4Y6GA 3TW9A 1LRQA 5XINA 2AQVA 1FRBA 1PTAA 3STPA 1M04A 2HV5A 1V7YA 4NJJA 4AZ7A 3WFLA 1OX4A 1YPFA 3H21A 3UERA 4H9MA 2G96A 3W4RA 5L9FA 2ZZ7A 4GQRA 1A80A 4E4FA 4LFYA 2YCIX 4L6HA 2QPXA 5GNXA 1ZBCA 2DSVA 2GSEA 2ZUNA 5FF3A 5BROA 3SFWA 3G1AA 3BAYA 3CWNA 1RCOB 2PE4A 3C3UA 2ZVIA 3V5CA 5KZDA 1YX1A 5DX7A 4IOTA 3MKVA 3HMCA 4CU6A 1X7IA 3GG1A 1TV4A 8XIAA 1CLVA 4NVTA 1Q6QA 1P6BA 4O52A 3FYPA 4LV9A 2Y7EA 4TO8A 2VUYA 1YDYA 1L2UA 1E3ZA 2OGJA 4JTKA 4DJDA 2ZBTA 2EEXA 1TPEA 4XSLA 4C60A 3ZSSA 2X2GA 1PS9A 1VPYA 3W37A 3VDBA 4F9DA 1UD8A 5H1WA 3GTIA 4PB4A 4IWWA 1UZDA 2DZAA 1QNOA 5F2LA 2P76A 3TEVA 4GO9A 4CCEA 5I3KA 3VX0A 4GINA 2YDSA 4GMEA 3T0TA 2HBVA 3ME3A 5LNRA 2J4GA 3DBNA 1WE5A 1GVFA 4N9BA 2ZX6A 2V5DA 4I5RA 2DUZA 3P0WA 1K8CA 4P8XA 4MYXA 2Q09A 1SZRA 2PDNA 2O4MA 3PB0A 2GGIA 4U33A 1H11A 4DBUA 2O9TA 4PMYA 2P88A 3WD2A 1HG3A 1RCQA 2VFDA 5GJPA 1BSLA 3TROA 3EEGA 3HB9A 2QJMA 2DW6A 3BVJA 2JQXA 2BY2A 3U5YA 1CW2A 1I9CB 4AUBA 3HQ1A 5LNVA 1F3WA 4E3VA 4WOZA 4W8LA 3P74A 4HZ6A 5KZ6A 1JDDA 3H4WA 1THFD 4DXKA 2CERA 5AVNA 2ALRA 3PY2A 3P6LA 1MDRA 1Y7VA 5FJRA 4REQB 2ZRVA 1XLMA 3ZM8A 4J7RA 4LNYA 1ZS2A 2XFWA 3HM7A 4Z42C 4Y96A 2G8ZA 3SW6A 3QR0A 1EF2A 1XYZA 2E77A 4EWND 4UZUA 1HTIA 1V3HA 4PTMA 1GJUA 3GXFA 3LEPA 2NQZA 1Q6FA 1ENUA 4HMCA 1XRTA 2EKGA 1O1ZA 3T55A 2HXUA 2PDIA 1EJ7L 2XN0A 3GUWA 3OPSA 2G41A 2QUNA 3I6RA 1KBIA 3GDLA 5EMMA 2H8ZA 4N42A 5XIMA 1W5PA 1G6CA 1JNEA 4JTLA 4M6UA 4D6FA 2QKFA 4NHVA 4DWSD 7XIMA 2YXGA 4WRHA 4YXGA 4JD4A 1PIFA 3DHPA 4PUJA 3LBMA 1XXXA 3C2RA 2DFAA 3LCLA 4Q4KA 6TIMA 2QJJA 1BXCA 2FYMA 2HBXA 1BD0A 1RY0A 4R33A 1RPXA 4BEQA 1QPRA 1BLIA 5IBXA 3P7YA 4E4PA 1ZHAA 3GLCA 3OB8A 4IMAA 5BCAA 1QR7A 4O17A 3WLMA 1SZGA 3MI2A 3WJXA 1JDAA 1GQNA 3NGJA 4LYKA 3FA4A 4JN6A 1OGBA 5EB8A 1S5TA 3CL8A 3P82A 3URNA 3TW7A 1JZ8A 1HKMA 2HQAA 4GRSA 3QHNA 2E7FA 2W62A 3H26A 3AWOA 2ZRXA 1IEQA 3UXIA 1FVPA 3HO8A 4K36A 5BRPA 1YADA 3LXAA 3RLGA 1UWSA 3D47A 1CT5A 1YTDA 4BF7A 4S3GA 5H8MA 2C19A 2FHBA 1FWFC 1HL2A 2CYGA 2FZ9A 1Z9AA 2E5BA 4NZ1A 1T7LA 3LPOA 2OT1A 3LGDA 4NNAA 1W5MA 3QHMA 5FAJA 3LI0A 2VEFA 3TC3A 3NDYA 4HU0A 4AD3A 1BYDA 2VZSA 2DY3A 1TTJA 4TR9A 3G0SA 2WNNA 4A8RA 2BS9A 4H8UA 4QJ4B 2NVAA 4HQVA 4PGLA 1EJSC 1GK8A 4H2HA 3PJWA 3PUEA 4JIRA 3W75A 3GB6A 2RDUA 3PZGA 3WLTA 1WKEA 4NI8A 6ENLA 3OGRA 4JFTA 3M6DA 1IYXA 3G1XA 5IFPA 2DPEA 3OVPA 4UB9A 2ATMA 5DO8A 4AWEA 1HP4A