3PJUA

Structure of pseudomonas fluorescence lapd eal domain complexed with c-di-gmp, p6522
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
249
structure length
249
Chain Sequence
QSLVADVGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclic dimeric GMP binding protein
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 86
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjuA00
3PJWA 4F48A 5M1TA 3KZPA 4Y8EA 4Y9MA 4KIEA 3HV8A 4HJFA 3GFZA 4FOUA 5MKGB 4LJ3A 3PFMA 4Y9NA 3PJXA 4RNIA 4FOJA 3GFXA 4F3HA 4FOKA 4AFYA 2W27A 2R6OA 3S83A 3GG1A 3PJTA 4Q6JA 4HU4A 4J40A 3U2EA 4LYKA 4Y9OA 3PJUA 5MKGA 3GG0A 3GFYA 4Y9PA 2BASA 4HU3A 4RNFA 3HV9A 5MF5A 3SY8A 4ES4A 4RNJA 3N3TA 4RNHA 4AG0A 3TLQA
chains in the Genus database with same CATH superfamily
4O1DA 1FDZA 1VQTA 6XIMA 3B40A 3M16A 3VC5A 3W2UA 3PG9A 3AHTA 1ODUA 1EF3A 1O12A 4K37A 1BYAA 1B3XA 3HU7A 3FDGA 2EPHA 5AC4A 2FHBA 4R7OA 4UTJA 4JNYA 6XIAA 5H8PA 2CFFA 1EZ2A 3UGRA 2CLMA 3IJ7A 3UA4A 3SCUA 4Z08A 3ABZA 3IACA 2XGZA 3BCJA 3F4VA 2BB0A 3LB0A 5AZ0A 3DFNA 2D1ZA 2Z2BA 2O56A 3RM4A 1P6WA 4UC5A 3PB0A 2NX1A 4UQ9A 2OQHA 1SMAA 3IVTA 1HJUA 1G4TA 4JNZA 3N18A 4QE5A 4L4MA 2W5FA 2PLJA 4TV6A 4XTDA 1PTAA 4E3VA 3NQVA 3Q67A 1YQ2A 4EK7A 3ES7A 4JCMA 1XBVA 5I3KA 3REQA 4IUOA 4NZFA 4YVVA 3P67A 3WL0A 2EJ1A 4R5EA 2YYTA 4N9BA 4G9PA 4K8EA 3IJDA 1EO7A 5AHMA 1XYMA 3VCRA 2WQPA 2EG6A 3PK7A 2DT2A 2XIJA 1VYPX 2XSBA 3L12A 3LXAA 2P0OA 3F2CA 4BCEA 5A94A 3W76A 4CCZA 2ZX9A 1VFUA 5E0FA 5E9XA 1E6SM 4LVDA 1ZUAX 1Z42A 4GH3A 3WLJA 3FFSA 4BQ5A 3S2JA 4IGHA 3VDBA 2YJQA 1EUAA 1GZ1A 2V5KA 4W9TA 1DJQA 3TZNA 3C0LA 3URNA 3WBXA 4Q4OA 1PCKA 3DFOA 3GFXA 4Q22A 4C60A 3WJWA 5BZAA 1EL3A 5G1MA 1OIFA 1CWYA 3LSCA 1MXSA 4C7GA 3BE7A 2G4FA 3OODA 4GXMA 3GIPA 5FIPA 1BRLB 4OU1A 3A5VA 5T9CE 3ZS4A 2WSYA 3G1VA 3I6TA 3FK4A 1TTPA 4HK6A 3P62A 4GYPA 2NLYA 3IJ6A 2C0AA 1NDWA 4L5ZA 2P76A 2Q8LA 2P3ZA 3O2LA 5HQLA 4K2SA 4YS1A 3CT7A 4IIBA 3NOYA 1DVJA 3SGZA 4MIMA 4N02A 4FNUA 4Q7BA 2UY3A 4FPSA 2ZRYA 4DRSA 4MG4A 3KVLA 1XBXA 4C6EA 2X09A 3AZSA 2YCEA 4HCHA 1C7SA 1H51A 2ZUVA 2YPIA 1YNPA 3M5VA 1ZNNA 3KXQA 1NSJA 4UR9A 4RNHA 5AOUA 3PS7A 4K1WA 1XPGA 3OEXA 5EMJA 1U5VA 3TR2A 1NP2A 4HT3A 3AJ7A 4WSHA 2EF9A 3PJTA 4YL2A 1DJGA 2YGYA 4QJ3B 1Z6KA 3H23A 3VIFA 1EGMA 1NOWA 4NNAA 3U57A 4DJFD 1AH4A 3UXKA 1TPUA 1MW0A 4FOJA 1BLIA 4GO8A 3OOQA 5C54A 4LYQA 3THUA 2VCBA 2IUZA 5I03A 4D6JA 4AHPA 3EWXA 1G4SA 1XCFA 3UG3A 1K9EA 5I77A 1L6SA 1E3XA 2G3NA 2O9OA 5BCAA 2ZUTA 5U7SA 4UTFA 1CGYA 1TTIA 3EKZA 5BOOA 3EWUA 1ZHAA 2BDQA 3WQVA 2XN2A 2TYSA 1V4YA 2AQVA 4DBUA 4MWAA 4M19A 4QITA 4PMYA 2J74A 3L66A 3CIXA 5T9BG 4AZ5A 1TFVA 2Z4GA 3C0JA 3QQWA 1WBJA 1UA3A 4LY8A 5XIMA 2CBUA 5CJNA 5I3IA 4E8CA 1GYMA 2E1DA 4UCGA 5D32A 1TCDA 3SY8A 1W5NA 3AO0A 4KERA 4W4QA 5CSRA 1ZFJA 5J04A 4GUHA 3MUZ1 2BHYA 2CC0A 4KRUA 4AVOA 5GPRA 3E3HA 1G0CA 4O1EA 3O7UA 5EBUA 3M0IA 3AIVA 3CUHA 5AZ1A 5C9RA 1JCNA 1JZ3A 1XS2A 4LUTB 4DO6A 2G96A 2VFHA 2V2HA 3PBGA 4IMDA 2J24A 4LJ3A 1AW5A 2XGBA 1Z32X 3RR1A 3M4HA 2XH7A 5D9NA 4L7ZA 1XC4A 3LI0A 3ZJ8A 1F3XA 3P80A 3PJUA 1GVIA 3WUGA 2IPJA 1B5TA 5JBDA 4Z2KA 2EHHA 4Q8MA 1R85A 1WKDA 4HA1A 3SJ3A 4DXKA 4UOJA 4GIEA 1OYCA 4KCWA 3NQBA 3RCNA 3VNZA 4JICA 3POHA 1EQPA 2Z2UA 4ROPA 3PAJA 3PN8A 3FVDA 1FWWA 4DJED 5HNUA 3MBFA 4M6QA 4TUFA 1QNSA 4BK9A 1C29A 1ZALA 1Q7ZA 1RUSA 2OSXA 6A3HA 1HX0A 1E1EA 4KH2A 1C7TA 1XIJA 3AWOA 3G1SA 3ZR4A 1VJSA 1UMYA 2CESA 1ICSA 4FIQA 3NPUA 4NX0A 2YX0A 5KZ6A 2ZADA 2BMBA 4F0SA 1VS1A 2O0TA 1OQFA 2SFPA 1AD1A 4ZOBA 2V67A 4HNNA 3V75A 3S5ZA 1IT7A 3WLHA 2CKRA 1F76A 1X6UA 1MEHA 3R7MA 3LPGA 3GNOA 1A5BA 2A3AA 2ISSA 5BXTA 4UFMA 3LUTA 1V0MA 3MVIA 2GQAA 2YXXA 3ATYA 4C6LA 4HMNA 4M24A 2HNEA 2E68A 3EMQA 4B9YA 4ZZ9A 4GA8A 4I7UA 3LNPA 2BZNA 2FZNA 3W2LA 2YBTA 3NXFA 4DO7A 1ZS2A 1AODA 4H9VA 4WY0B 4B16A 4C6CA 4NY2A 4AHQA 8XIAA 1E6QM 3NQ2A 2UV8G 3BMWA 3EGJA 1XGEA 3BAJA 1QATA 1K9FA 1ISXA 4EANA 1SZNA 1H5YA 3TXVA 2Z1WA 4HU4A 2CW6A 4GIAA 4IQEA 3AXXA 3PSVA 2WHKA 1I2OA 3GDBA 1GVQA 2QKFA 4U5KA 2A7PA 2GPTA 4IF2A 1VGAA 2QJHA 3MW7A 3BGGA 2NLIA 1IXOA 2PF8A 1JCLA 1R7OA 1H7XA 1W1YA 3ME3A 2QYGA 3WH6A 2J8TA 2QHAA 5HOSA 3T55A 1VBHA 3SQLA 1RJQA 1QNOA 2FB2A 2YL8A 2F6KA 4LALA 2QR6A 3KOYA 1EXBA 1HL9A 2VUNA 2X16A 4R27A 1VC4A 4OGZA 3UXAA 3S5SA 1KGWA 3I7RA 3WF1A 3AZTA 3MUY1 1DORA 5K7JA 1OYBA 3W24A 2PI6A 5RUBA 2G41A 2ZCGA 2PC4A 3IVUA 1VHNA 1DWGM 1IR2A 2A79A 2Z24A 2WHJA 4JTLA 3L4ZA 5FL0A 3OA5A 4CEUC 2BGSA 5F2GA 3GHTA 3KL0A 3R13A 4GI9A 1LL6A 4QNWA 3WUFA 5IBXA 1F3WA 1WP6A 2GVGA 2WZMA 1V6XA 1CIUA 2E9MA 5K9DA 2YFOA 2WANA 4N4QA 2PDYA 3CPUA 3EYPA 1POKA 1LOLA 1LP6A 1U22A 3LGGA 4DN1A 2C1HA 1S5NA 3QY7A 3L5MA 3L4VA 1TVNA 5EYWA 3E6EA 4KWWA 4V2XA 4LGXA 3E49A 4AF0B 1A5OC 2PBOA 3PR2A 3K4AA 1NWSA 3VKCA 3AISA 1R2RA 3S5OA 2ZX6A 3W07A 3G1FA 1TZZA 3G77A 2XINA 3U6WA 4H7ZA 2NSXA 3EB2A 1OFRA 1VBRA 2D20A 3K30A 3UBPC 2WW5A 3CHFA 3CQIA 3K4DA 4F48A 4FO4A 4GFSA 1V3KA 1SU5A 4ZQNA 4TV5A 4PMXA 1SW0A 3CHDA 4UBPC 5TBOA 3IANA 2WZEA 4E2BA 4XAYA 4URIA 3UWWA 1R86A 1B3VA 4GYPC 5CJ5A 2GVJA 2ZZ3A 2VEKA 5I24A 4BEQA 4TMBA 3UEQA 1WDRA 1W6TA 2HCVA 1HO1A 1TA3B 2WQDA 1Q6FA 1G4PA 3UJFA 3VM7A 3R6IA 2Y1HA 4YNGA 4PMJA 1UC5A 3TMQA 4N6EA 1MFVA 2VC9A 3P3BA 1KM1A 1ZP3A 4PBEA 2W6RA 1A3HA 3BC9A 3QY6A 1XRTA 2UY5A 1WCGA 4L6DA 4QE1A 3HPFA 5BRPA 1TX2A 3DFYA 1LQ0A 3MP5A 1RXOB 4M6VA 4PUJA 3FHAA 1JYVA 4IMFA 2V5DA 2V82A 1ITXA 3U2OA 4H19A 4JIPA 4PN2A 5IFTA 3NOEA 4JHMA 2GYIA 5D33A 4YN5A 2OYKA 5LNUA 2GK1A 3H7UA 3IS4A 3P93A 4PBGA 3H2EA 4PTXA 2B31A 4IPIA 2DUAA 4GK8A 4LB4A 4MVAA 2I14A 4UB9A 5GJNA 1UKSA 3ARXA 3SRHA 2E6DA 4DY1A 2A0NA 4PC8A 5D9MA 1H62A 1EP1A 3RMEA 3ARPA 4RPPA 2NQ5A 3IIXA 4UOZA 4PTDA 5H1WA 3A3WA 5KINA 1GOOA 4JDBA 5T91A 2CITA 3W85A 3LU2A 3WJSA 3WD3A 3RX2A 4LVFA 3FVMA 1WNOA 4GISA 1OD0A 4AXNA 1GOMA 3A4XA 4P7RA 3B0PA 1XISA 4GC3A 5C6MA 4NAFA 3IJQA 3OLEA 3GW0A 4PEEA 3S2LA 3IGHX 1FCQA 3GH7A 4D9PA 1CXHA 3KTXA 1GG0A 4MWAC 3SBFA 4K8HA 3B8SA 3H70A 4J40A 1UUMA 1QASA 1KFBA 4DUVA 3H24A 4XAFA 2GVYA 2WJEA 2GVLA 4CN1A 3A13A 3W7PA 1UKPA 2NW0A 1LG1A 1PPIA 2JIWA 1B90A 4G1KA 4AZHA 3KRUA 4FALA 3I3DA 2DH3A 2E9LA 4K6AA 1GZGA 2XWDA 1TIMA 3AXHA 1OFOA 1A5UA 1BYCA 3FN9A 1XHGA 5BMWA 3M41A 2Q6ZA 2G50A 3Q65A 2NUYA 4DVOA 2BHZA 1DWAM 3W23A 2HQAA 5AECA 3ZVHB 3QM3A 1P7TB 1XCXA 1ENUA 3CJPA 4JAWA 3IIPA 1KCLA 1FDYA 4LYRA 5D2VA 3G1YA 2CLHA 2J7GA 1XFBA 2WZIA 1NEYA 1X1OA 4S3FA 2FHFA 1X98A 1NELA 2D2GA 4IIDA 4D72A 1Z8AA 3GBDA 1J79A 4TMCA 4IXXA 1AH3A 3UXLA 1RJPA 4UTHA 3QPEA 2ZICA 2CLPA 1ME8A 1HKVA 1KD0A 1A53A 4A21A 2AGTA 3QR1A 4LWWA 1T8XA 6REQB 1ZENA 5FESA 1TV5A 2J9ZA 2BY3A 7REQA 1QUMA 2RH9A 4FNPA 3M0ZA 4RZBA 2PDFA 1JGIA 1TE1A 3NSNA 3N4EA 2HXTA 2IQ0A 3BCDA 1QI5A 1MEWA 3ALFA 3EDKA 1E4NA 1LT8A 3QMTA 3KLKA 1KRCC 4GX9A 4ZOAA 3KDNA 3NVTA 3W3OA 1T0OA 2JF7A 4DF2A 1KWKA 3WNKA 3TAKA 1HJVA 3TVAA 3G1AA 5EB8A 3KBNA 4JHOA 4UTKA 2IMRA 5BRQA 5LNSA 3IV8A 3B8DA 3S8HA 2BVTA 3R94A 3WLOA 3CZGA 4GLEA 3CV7A 4LBSA 5F1VA 2IXUA 4AY7A 1J18A 2ZXDA 1IE7C 1I4NA 1DWJM 4EE9A 1VJZA 3LCLA 4UTLA 3GVRA 2VJXA 1OWQA 3RILA 1QDSA 1FRBA 4GC4A 1HG3A 1XYZA 3C2YA 3K2GA 4KWVA 6CGTA 1GVYA 4QQ3A 2OT0A 4MGGA 2NUWA 4FX8A 3GXIA 5ECUA 1H4PA 2Y2WA 1U1UA 1I60A 3EXRA 4O1FA 4O13A 1EPXA 2R91A 1W3IA 2QPUA 2A7NA 1JAEA 3M6DA 3S5NA 2OOGA 3BSMA 4JKLA 5XINA 3Q45A 1DWFM 1V5XA 4DNHA 5CPNA 1XLAA 3KRZA 4NI3A 1X1NA 3E0VA 4GJ1A 1XXXA 1KBLA 4GYFA 1M04A 1POJA 3NQ8A 1VENA 2OXNA 1I2QA 3M7WA 4C1NA 1MWOA 3OPSA 3EX3A 2JFEX 4QDWA 3MKCA 1PWMA 3W87A 2C1IA 4O4WA 1XUZA 4G1NA 3VOCA 3SFWA 3REQB 3AIWA 3SQMA 4DBEA 2HISA 3QVQA 3QTGA 3ZJKA 3DESA 3S4TA 1RBOB 3ID7A 5ABHA 1BAGA 3SCSA 3MSGA 3MP4A 4ICCX 4O1AA 1GK8A 3NO1A 3VD7A 4AX6A 1NOUA 4ATWA 3ITYA 2VMFA 3APTA 4NZ5A 2OWXA 1J11A 1WZMA 5HMSA 1GZJA 4AXKA 1H49A 1IIGA 4DZIA 1BQGA 4XUGA 2WNNA 3FHQA 1QR7A 4WEVX 1KKOA 3VIJA 3OVQA 5A8OA 3A9IA 4I8DA 3E0LA 3T0DA 1ITUA 1GQNA 1DWHM 4H8NA 1O5XA 1QO5A 4JBRA 4R7JA 3W6MA 1SJBA 4GGBA 8A3HA 1UOZA 3RRXA 2VXNA 3G6MA 5DF0A 1EX1A 3PBYA 2WC7A 4HCLA 4QCFA 1YLVA 2B7NA 4O4VA 2CLLA 3NAVA 2GJPA 2ZX5A 2DVUA 2GSJA 5BXPA 3VUPA 1W9VA 1V0LA 2EQDA 3UZJA 1H7WA 3FJ6A 4I6VA 2R1LA 4KT2A 2WK2A 1XIGA 4WXYA 5HPCA 4WQ6A 4AX7A 1ADDA 2JKPA 3R11A 3MZNA 2WPBA 3OVGA 3SDOA 3B04A 1Y5XA 1W1VA 1S2CA 1W56A 4MKVA 2KZHA 4O1BA 1U1HA 1ZBCA 2Y0FA 2OOFA 3UWUA 1Y5VA 4RV3A 5H8UA 4F9DA 1CW2A 3TR9A 4L4PA 3K4WA 5HQEA 1J93A 3GFZA 1EA9C 5CPTA 2YCKX 3SRKA 1MNZA 4ROQA 3R79A 4TXEA 1VJIA 1X1ZA 3O6YX 1TV4A 1GOXA 3QHMA 1AQMA 1NFPA 3BJFA 1O5QA 3TIMA 5IHRA 3TQVA 3P61A 4ZENA 4XV0A 4HYVA 4G5DA 1W1ZA 2BWGA 1CXEA 2PWEA 3MUCA 3OHIA 2IPFA 3OHMB 2D2JA 4E3TA 2R94A 4EPKA 4D6GA 1NP0A 2A21A 3VM5A 3ANUA 2C16A 3KFTA 4NL1A 2ZDRA 3C8NA 2FDSA 3KUMA 3I10A 1R87A 4XK2A 1J0IA 1M68A 1FHVA 7TAAA 1REQB 1NY1A 4HSNA 2XUCA 3AICA 3BTNA 4IXHA 1GOQA 2GDQA 1FWEC 3AXKA 3BOLA 1WQ5A 2QJMA 1XGZA 1I75A 3DG3A 3CWOX 4Q33A 1Q2SA 4LCSA 4R85A 1JFXA 1LYXA 3L5LA 2CBJA 2F38A 4GI4A 4Q4SA 2XJ7A 4I8YA 3LOTA 4E0CA 3B9EA 4MWAB 5HJXA 2GUBA 1QNPA 2QCNA 5DT5A 3W84A 2W3ZA 3NDOA 2X0HA 5HMFA 3W88A 4ECLA 3GDLA 1VYSX 4JKMA 2C3ZA 5A6BA 5BW6A 4MJMA 4GY1A 3K8MA 3QKZA 1EOKA 1X7FA 4AISA 1XH0A 3S1WA 3PZUA 2DZVA 1EP3A 3PUDA 1Q4NX 4F0HA 2DFAA 1RA5A 4X9SA 4F8XA 1K02A 4OIFA 2YZRA 2AQOA 4XAGA 1H7RA 1ZU8A 2WB5A 3STGA 1JQVA 3S9IA 3ZXWA 1H0IA 4CU7A 4Y90A 2ZDSA 3NO5A 3P82A 1Q7QA 2WSPA 3FSTA 4H9UA 4UOQA 3C3UA 1V6TA 5LHFA 1DJYA 3BJSA 3T8QA 3UF9A 4EXQA 3ARSA 4WKFA 1SZGA 2WCGA 3LX9A 3LGEA 1PJ9A 3S47A 5B7YA 3W0KA 1JYWA 4O12A 5FI8A 4QRNA 2PGEA 4AYGA 5AHFA 4WIWA 3S83A 3N4AA 3C0SA 4E5TA 3GXPA 4PFHA 2YR1A 1ISVA 5AYIA 3SCNA 2YA1A 3AC0A 1YYAA 2XISA 7CGTA 4N4PA 5BU6A 1OZQA 4GJIA 4J28A 5C2CA 4ZA0A 4EIVA 2GWNA 2PD5A 1VP5A 4IICA 1TPC1 1JPDX 3C2OA 1SQ7A 4MUZA 3QLLA 2Y7GA 4B5SA 1E1CA 4MKSA 5CSUA 1XLJA 1EEPA 2V8ZA 5EMMA 2QLYA 4YYFA 4R7WA 3SM0A 1KTBA 1XC6A 2VFEA 4YTSA 3QV8A 4OZOA 4LOCA 2HV5A 3BGAA 4LVGA 2AKZA 5FF3A 4OT7A 4Z1DA 7ENLA 2ESCA 3R58A 4UQAA 5A6LA 1F2JA 3P0WA 3FAWA 1UD8A 4AAJA 4H4IA 1JPHA 3GNXA 1M03A 4WGHA 1IIHA 5MF5A 4QG6A 4ATLA 1LL7A 3G2GA 1XSJA 3W26A 1KXHA 2OCZA 3GZAA 1GG1A 3P7YA 1EO5A 4QLKA 4Q6JA 4WDWA 5HR7A 5HPOA 2OZ0A 4HB7A 3WK2A 1XH1A 2V0TA 3SQSA 3GG8A 4NAEA 2EG7A 3PM6A 5I0DA 1UQYA 3GC5A 3HQNA 5FEPA 2J8GA 4EWJA 1G01A 2PRMA 3I7QA 2X1IA 3GRIA 1CXIA 3AUJA 4GQ0A 1VKFA 4MTVA 5CCZA 4LC8A 1GT8A 2O9RA 2PWVA 4A3HA 3WF4A 3KEHA 4UNKA 4ZOEA 2IXVA 1XD0A 4D6IA 2FH8A 1R6WA 1OY0A 3MTWA 2XFFA 1NWUA 4FNSA 4QGCA 1TB3A 4F79A 4HN4A 2BODX 2Z0IA 3W2KA 1TQXA 1OK6A 1RCXB 3VC6A 1GQLA 1UBSA 4IT1A 3PZGA 3KX6A 1B30A 1PTGA 4A3YA 4ZQCA 4ACYA 1LBFA 1WOBA 4RCXA 1KTCA 1WO2A 8CGTA 1W31A 2C14A 5I6SA 3NZRA 3OQ8A 1WXYA 3HJZA 3VNMA 2REQB 5EKYA 6ENLA 2VD8A 4LAKA 3CTLA 3ZQ9A 4UQDA 3DG7A 3NQ7A 2EO7A 3WENA 1J0HA 1DIKA 3O0KA 3L4XA 3MYOA 4A8RA 1BVNP 4NZ3A 1T99A 3F03K 2V3GA 1B3ZA 3LNMA 3T2OA 3JW7A 4OTKA 3OYXA 2ZVRA 1SGJA 3GNPA 1NDZA 4DJFA 2OLAA 1TIWA 3PFRA 2E8ZA 1WA3A 2VGFA 3N6JA 3BICA 1CECA 1KXQA 1KFCA 1EJXC 4Y96A 3DYMA 3E1F1 4CLMA 3H26A 1M7PA 2HPIA 5AN7A 3RX4A 2O7QA 2X7VA 3UCCA 3B8TA 3KOZA 4FB7A 4HCDA 4O18A 5E09A 1PX8A 2XG9A 2MNRA 4IMCA 2AQWA 3PTKA 3E38A 1ME9A 1MW2A 2ZTKA 1HGWA 1OBAA 3NGFA 1FWTA 1WKEA 4Q7NA 3HPXA 2IKHA 3TTSA 5F4XA 4ZTXA 3MQTA 3W71A 2DZXA 1L6FA 2HWGA 2MANA 3ALGA 1HTIA 3BVJA 3E96A 4ADUA 5A6MA 1K7XA 1SPQA 3VAVA 3UQNA 1Q2RA 3L65A 1EJ7L 3NPXA 2PWHA 4IFOA 4BR1A 4EPBC 4NJKA 1YHTA 2DPEA 2XH2A 5AC7A 5A8QA 4W86A 1JJKA 1W3NA 1KM4A 4REQB 3AXMA 2ZA2A 4DQWA 4XAPA 1J0KA 4HPNA 3VD5A 2E67A 4FX7A 4WK9A 3V1HA 2RDXA 3EEZA 1M7XA 1OHLA 2PTDA 1QMLA 1AL7A 3RJXA 2NT1A 3E5PA 2PU0A 2YOCA 2QCMA 5EY5A 3MS8A 3H21A 3UNDA 3BG9A 1V3HA 1WXZA 5D8ZA 3WLSA 3NZQA 1K6AA 3ES8A 4B92A 3VX1A 3H2FA 3KTCA 4DJEA 3QLDA 4I5UA 2BTMA 1BXBA 3AZRA 5IM51 2VFDA 4HK5A 1KGUA 1F8IA 4TVCA 1G4EA 4ACZB 2PTWA 1L0PA 4FOKA 3R8GA 4YHGA 4GIRA 2JE8A 5CPMA 4H9MA 2WMKA 1AK5A 2QDEA 4JN6A 1HVXA 2FHCA 4C6OA 4DUWA 4Z2LA 4L56A 3BO9A 4W7VA 4OKDA 2DY3A 4C7FA 2E1WA 4NG3A 4G8TA 2BGNE 3G3MA 3HQPA 3WNMA 4PUWA 4P5UA 1OIMA 3PBUA 3LV6A 4ZQMA 1S1PA 3LZ3A 3PZ9A 2A3CA 3VUSA 2NVAA 2CETA 2WLYA 3GHUA 1DJZA 4EF9A 2FTYA 5FSDC 3WBWA 2P8BA 3MO7A 4JFWA 2ACSA 1XLMA 1SO5A 2VR4A 3IIOA 4HSHA 3VNIA 1CPUA 1MQRA 1XRFA 1SUXA 4HYRA 1EF2A 1UW9A 2A85A 4D2JA 2Z1VA 3B8WA 1S2UA 4PCTA 4XZLX 1HJXA 5F1UA 3CMGA 3BLLA 4D1JA 2F8QA 4Q4RA 5FSEC 2X0YA 3HGSA 4JY8A 2QV5A 2PDGA 4AIUA 3SB0A 4LYKA 1EQCA 1FWFC 3LCWA 3QPZA 2YXGA 2XVKA 1VFMA 4LBUA 3LTYA 3WBYA 2VD9A 3K46A 3M5YA 2V68A 3A12A 1PX4A 3IGUA 1MRQA 3SCWA 4NZ4A 1F07A 1M6JA 5E6YA 5B7ZA 4M1BA 1PE1A 4NI8A 4MZYA 1QTWA 5EPDA 4EF8A 3H54A 3LPPA 3MO4A 4QR6A 1JEZA 3D3AA 1UZ1A 3GYEA 3W28A 4Y6GA 4IL2A 3M07A 4GZ7A 4KETA 2OX4A 1NDVA 1T8QA 4RNJA 5SWUA 4MSSA 5AFDA 7REQB 2Z1KA 3VFCA 3KRBA 3Q2DA 5D4YA 4QJ5B 3MJMA 3DKLA 4MM1A 1UWRA 3ITCA 1GCYA 4Y2WA 4H00A 1NM9A 1X97A 2HE8A 1N2VA 1DTUA 1A80A 3RM9A 3DUGA 2YLLA 1WUEA 1QW8A 3FLUA 4H2CA 4J3WA 1RP9A 1EIXA 3LCGA 3KVJA 4LAMA 3KDOA 3TC7A 1TPH1 2ZFAA 1EYWA 5GVJA 3UYCA 4IP5A 3CV1A 1XFCA 1NFGA 1HO4A 3EX2A 4GINA 4X60A 2BHUA 2QJIA 4MNMA 4GRSA 3ZZ1A 1VCVA 4GQBA 4IWWA 4B5XA 1ZAHA 2D23A 4LS2A 4ZO6A 3BLDA 2A7RA 3OZYA 1J0JA 5CBBA 3TWBA 4ZO7A 1UG6A 3PG8A 2IS7A 3KWSA 4QBXA 2WMGA 1ALDA 4UTWA 4XB3A 3DHUA 2R1KA 1N7KA 3ITGA 2FZMA 5LSMA 1MDLA 1BWVA 5U4NA 3UCDA 3KAOA 3JUGA 4Y7EA 4BF7A 3RLUA 3WLMA 5I09A 3UR7A 4C1KA 1U83A 1OCJA 1TMHA 4G7EA 2EPOA 4B4HA 1WE5A 3P6LA 3OGRA 2JKEA 5IHSA 4L9YA 4BI6A 3MV01 4GNKB 4PCPA 4S39A 2IPWA 3VDHA 3UPWA 1CXLA 3DXIA 2HK0A 2KX9A 1GVRA 3L68A 4L80A 4C1NB 3OBEA 4J1OA 5F2MA 1WDWA 5ABGA 3W00A 5DQPA 1R3WA 3HGJA 3BSHA 2Y5JA 3UNTA 1HP4A 5C9ZA 1KW1A 4WDTA 4HU0A 5EFDA 3KS5A 2UWFA 3GU2A 3IJ9A 3IK4A 1Q3NA 1PV8A 2XSAA 4DZAA 4LS1A 3VE7A 3AU6A 1KNWA 1BPLB 3LS9A 4QG9A 5A6AA 2QIIA 4MNKA 2FMOA 2QXWA 2OO0A 2YBVA 5I78A 3KOWA 1RPXA 2HS8A 3U2ZA 4GMEA 3UETA 4EWND 1I1WA 5EU9A 4DM2A 2DU2A 1OGSA 1H2JA 2EEXA 4JNMA 2O4QA 1BVZA 1EWDA 1EC9A 4FNRA 1XICA 3W25A 5A2BA 5HNRA 4JDYA 1DTNA 3TJ4A 4DJFC 2Q01A 4C6JA 3EPNA 1JD9A 3WG6A 3TAOA 3TW9A 4XVDA 3GTIA 3W6LA 4N6FA 1JD7A 2D3LA 4Y8EA 4MJZA 1PVNA 4E4UA 3E2RA 3W29A 1JQXA 1LDCA 3O05A 5AYZA 1ZP4A 2VZUA 2J78A 4H8UA 2PBGA 1VCGA 3GXDA 5GQBA 4B90A 2J25A 1M01A 1Z9AA 3T2PA 1Y65A 1EJVC 3B0XA 4QE4A 1FH8A 4C6PA 4JX4A 1KB3A 1W5MA 4O16A 2UBPC 1D3HA 3T4CA 3PBWA 3V0TA 3HN3A 1VFSA 3TONA 2V3EA 1PIFA 2BFGA 1ICPA 1EDQA 4DJDD 4GYKA 1IR1A 1UC4A 3F5KA 3PBVA 3DFPA 1KRBC 5CPLA 1AJZA 4LCQA 2W79A 1H1ZA 1RZMA 1DHPA 2PDWA 4JTTA 3K1GA 2HZGA 1SJCA 1VF8A 1NWRA 2J9YA 9RUBA 2OFJA 2WNZA 4BS0A 4OVXA 3QMRA 1IXQA 1VFFA 4HPJA 1CENA 3GU9A 2I5QA 4C7DA 3BAXA 3R2GA 5D05A 4BQ3A 1JG9A 3AIQA 5KZEA 2CWNA 1DBTA 2FB3A 3PVFA 2RUSA 3I4KA 1XL9A 2ZUMA 3ITVA 3KVMA 3WIJA 1Q4WA 4NT0A 1LQAA 1IEQA 2DJXA 3LXCA 1IZJA 2RGMA 1O60A 1Y7VA 4J5NA 1XX1A 2EPMX 3OBKA 3R8RA 4A3RA 3B03A 2FZBA 4TR9A 2P53A 4ZMGA 3W74A 2E0PA 4DX3A 1YNQA 4OUIA 4DJEC 1A0DA 3F2DA 1L8NA 1TCMA 3QC0A 2H90A 3B0YA 4H6KA 5FJOA 3WQ8A 2VX5A 4INFA 1EBGA 5CXPA 1FHDA 1R3SA 3AYVA 3C2EA 4HSOA 1OD8A 3N14A 1BVWA 1A5LC 4YTUA 1W9XA 1QPKA 2ODOA 3GTFA 2F61A 1JZ8A 3H7VA 1F73A 3MMUA 1YE6A 4CU6A 3S9YA 3VI2A 2H3DA 1FWBC 5IDIA 1Z3NA 3ABQA 4QAIA 3S1UA 1UZHA 3EMZA 2RJGA 3RMJA 3PJWA 1J0ZA 1C9WA 1R2TA 1JDEA 3S6OA 5I2UA 2DZBA 2Z2AA 4S3BA 1XYFA 3FS2A 4NILA 4I9MA 2G3FA 2BY1A 2JKAA 5LGZA 1O95A 3B8VA 1JUBA 2X1TA 4AIOA 2DT1A 3TV8A 1UWSA 3TQ0A 3TYEA 4AMAA 4J2PA 4LUJA 1UMLA 4LUTA 3MU7A 2FGLA 1KBKA 2C71A 4TTUA 2Q3RA 1WDSA 3W2NA 3KL5A 1SFSA 3GW3A 4MNJA 3BZGA 3SN1A 2WC3A 3WDHA 4ZGYA 5J5DA 1OJXA 4IMAA 4PMVA 4KFNA 5E0CA 2ZUSA 4H7CA 2A6LA 4LF1A 5E6ZA 3O6AA 4X0NA 3MHGA 1SFTA 3PTMA 2YCJA 1I0BA 5REQA 4HOWA 4L4OA 5DX7A 4WOQA 4KWOA 4ZQPA 2XIMA 1R9XA 1SFLA 3VGEA 1A3XA 3R0DA 5HMEA 2X1RA 2IKGA 1W1PA 5C55A 3SIZA 2ZOXA 4AFYA 2PGRA 2VO5A 1TRIA 4OBSA 4PTMA 3U5UA 1SJDA 3VU2A 5EMYA 3V3WA 3W2MA 3L0KA 2WLZA 2BOFX 2Y7FA 1E1CB 4UMBA 3M5ZA 3WDPP 3MMDA 1O68A 3F2BA 2VCAA 1G69A 4L65A 2DT3A 3QZAA 4Q3MA 4Z2HA 3LXBA 4RW3A 1RCOB 4PB4A 1OFQA 1W9DM 3HZ3A 5FEWA 2WJZA 2NXHA 3WLPA 2PCQA 4XWUA 1WB0A 4RK8A 4ZL1A 4HP5A 1WZLA 1FY6A 3IAQA 2VTFA 2PS2A 1XQLA 3VIPA 4CNNA 4PTNA 2BLEA 4X2RA 4RE0A 3NQAA 3MB9A 3U2EA 4BJHA 2YA2A 4XZHA 2ZKMX 4WJXA 3SAZA 1K7EA 2TPSA 2WSKA 3O9NA 4YJ5A 4H01A 3MC5A 1PKMA 3VD3A 2POZA 1NTHA 2WWDA 3JR2A 3AMLA 4WY0A 2VP8A 4NX5A 3K1DA 4BHYA 3TOYA 1A47A 1OC7A 1W5OA 2WOQA 4RNFA 3MUXA 3MANA 2WZTA 4GYJA 2FJUB 2JBMA 4DLFA 5JBFA 2WBGA 3R12A 3WSUA 1DXEA 4GX8A 4HOXA 3CU2A 1QOXA 1XG4A 4DPQA 1HKJA 3JZEA 4K68A 4A8LA 1G7VA 3G24A 3CK5A 4H7VA 1V3JA 1MUWA 4A8NA 3EOEA 4MB4A 2NXIA 1Q6EA 3B8UA 2ACRA 4B9ZA 4NJGA 2IQTA 3MKKA 2GQ8A 4JTRA 3RLHA 1QFEA 3IRSA 1K8YA 3S6DA 3VGDA 3KE0A 4KCUA 4JYFA 1DL3A 1IV8A 3O6DA 3LPFA 2A3EA 1OC5A 1ZB5A 3BLIA 3W22A 4HMCA 4WY0F 4DB7A 1ONXA 3Q94A 1BTCA 5D04C 1SVDA 1GQJA 3U3HA 1XYCA 4D1IA 4HPHA 4JTQA 3PZMA 1ECEA 4ZBCA 1TMQA 3GXNA 1OZMA 3ARUA 4JD4A 1IGSA 4AUBA 3EOOA 5CZKA 1S5MA 3WNPA 1WV2A 1D9EA 5D38A 4GQQA 4C6FA 4YIWA 1UWIA 1EGVA 1V08A 3MMWA 4BKNA 3EA2A 3GC2A 2OO6A 2WJFA 4XZ9A 2Z28A 3CAVA 3ZWSA 1O94A 4H9YA 4XZBA 5TF0A 5D03A 1XLGA 4RZ6A 3H2NA 1S5WA 1UP0A 4B4FA 1T41A 1XSKA 4L4LA 1LWJA 1ZGDA 1SM9A 3MCMA 3OG2A 4AF0A 3AUOA 1JXJA 4J9JA 2PODA 4MUPA 3B05A 1ZLPA 1CLVA 4LB3A 4P7NA 2QPXA 1F6PA 4W5ZA 2GOUA 3RLGA 1OSEA 1QNVA 4HTYA 4NKCA 1PCWA 1UWUA 3NDYA 1EC8A 2C6QA 4UTMA 2D69A 4U10A 4JTSA 1AW1A 4CQAA 4AH7A 3AMKA 2EJAA 1O5KA 1B1YA 1SW7A 4NASA 4K1GA 3E0WA 4OV4A 1BKSA 1RP8A 1V02E 1L6GA 3ISIX 1GJPA 3L0NA 4JX6A 2W62A 3IIZA 4KESA 2PP1A 2I1OA 3MBDA 1XRSA 1TA3A 1VEMA 1FWDC 2GSEA 3L4YA 1ME7A 2OMAA 4M56A 1TR1A 4YYCA 1VD6A 5M3WA 3MUIA 1UIOA 1JDAA 2QDGA 3DG6A 3FA3A 3IRDA 3P60A 4I3GA 3SN0A 5HA7A 3EDEA 4GY0A 4AB4A 1LZOA 2GGHA 4Q8VA 2PC8A 1DV7A 3ARRA 1W0MA 1UR1A 3DU0A 5G4EA 1FX6A 2VCCA 3LCHA 1S39A 7A3HA 3WLRA 3TC6A 1QCWA 1H11A 5CAKA 4Q8PA 4EX4A 1QHPA 4XBKA 4L9XA 5DBUA 5M5DA 4MYXA 2QIWA 5I3DA 5HWJA 1TRDA 3ZSTA 2INEA 5E93A 4S3AA 4H9ZA 1YBQA 1KBBA 1Q63A 3AMGA 1R5YA 2XN0A 2ZRVA 4IJCA 4DM1A 5AYBA 4AZ6A 2Y8VA 4P8VA 1GNXA 2QCHA 1JXKA 4Q4PA 3AFBA 4X61A 1ESWA 4A3QA 1DJNA 3ARZA 3VCNA 1E0WA 3VOJA 4DF0A 4I90A 1PS9A 4V15A 3UZ5A 1MVYA 1HUVA 3QW3A 4BA0A 3PZOA 2BY2A 4CCDA 3WQWA 3DI1A 4QS6A 4KRZA 4C6DA 3GKFA 5A6TC 1JCMP 1RLCL 2YDAA 2GVEA 4J3SA 3B9OA 1F74A 3CB3A 4GABA 4HIBA 2CZDA 1H1YA 1NQKA 3LI1A 1DJIA 5LYRA 2QEZA 5G4WA 1GGOA 4CQBA 2PDKA 3STCA 3PNZA 2W66A 1XLLA 4C6IA 5F4WA 1BTMA 3BXWA 3VNDA 5C5YA 3EB4A 5DMMA 3CLMA 2FVKA 1W1IE 2CZ5A 2L5HA 2Z26A 1H41A 1WZKA 3H4XA 2QJGA 1S2AA 3DHFA 4PBFA 3DI0A 4GVHA 3LTPA 2HMCA 3LG3A 5E70A 3THCA 6PTDA 3ZO9A 2GGEA 3ZYZA 4HZ8A 4NSBA 1P7TA 2QCLA 3WN6A 2OODA 1RSCA 2G97A 3PANA 3WQDA 4Q6XA 3DEQA 1ZSXA 1MO0A 1KCKA 4LRTA 3L2MA 3W7NA 2DGAA 1R3RA 1OYAA 3PPCA 3WF0A 3PSWA 5D02A 4H6EA 1FWJC 3V1PA 3HPAA 5K4ZA 4PSRA 2ZUUA 2DSKA 3PNUA 4ZXOA 2PLCA 3WLLA 1EDTA 1HVQA 2PUZA 1U5JA 4C65A 4Z1YA 3TN5A 3KM8A 1RQHA 4XTIA 1TR9A 4D71A 4AVFA 1YTKA 4F3HA 4ZR8A 1B4KA 3FEMA 4GZIA 1R9ZA 5FF7A 1E0TA 4F9JA 1JUKA 3XISA 4NXKA 5HMDA 3QF0A 4G56A 2D2OA 1RA0A 3IAPA 4XUYA 1KM3A 2NX9A 1VLIA 3QTPA 5DO8A 4RL3A 3U4FA 3ZWTA 2ZE0A 4OBTA 5A6BD 3CAWA 3TE9A 1CYGA 4LNYA 3TMLA 1N8FA 1ZJAA 4ZE4A 3VKDA 4FR1A 3O63A 4PH6A 1AQHA 1PZ2A 4B3ZA 2QZRA 4WLCA 5CZTA 1QI2A 4HHHA 3EMCA 5CG0A 4G7EB 2WVUA 4V1XA 5BOFA 3LLDA 3RK8A 1DXIA 1HJQA 1S5VA 2VWTA 5CQ1A 1GQKA 3LHUA 4FR6A 3UR2A 2TMDA 1XIFA 4DI8A 4IGNA 4LPCA 3S46A 4ILSA 4AEOA 4LBRA 4C6QA 4B3KA 1QW7A 1FKXA 3F5LA 3F7JA 3DFQA 4F0KA 1DPMA 3EZ4A 3BJTA 4S3JA 3GYCA 1QWGA 2FPVA 2QF7A 3W7DA 2DQWA 1HZYA 4H8VA 4V28A 3RIKA 3KBWA 4CCCA 2TODA 1E4LA 2QULA 1RD6A 1BSLA 5LXXA 5CLWA 1JF6A 3EOUA 4L1GA 1KBJA 2AOSA 2DVTA 2VGGA 3T78A 1GOKA 3DFHA 2HXUA 3QHOA 3SCPA 4NZCA 1DOSA 3B8IA 2P1FA 3DKJA 1MI3A 5CPSA 3GVWA 3T4WA 2ON3A 3MKVA 3WQEA 1CLXA 1R9YA 3CQKA 3U2CA 1ZAIA 5EBAA 4O50A 4F40A 3OIXA 2Y5EA 5MKGB 3USBA 4XBSA 3BG5A 3VNLA 5DMYA 4BI5A 2E5CA 4FNTA 2OKOA 4RE2A 3HPSA 4MNLA 3WELA 2VQUA 3F4WA 3WK1A 3LBMA 4IIEA 2HK1A 4HD5A 3IARA 2OVLA 9XIAA 1H50A 3HGRA 1JCXA 4W8LA 1K3UA 5FAJA 3OW1A 5H6HA 3TNBA 3A24A 4ZQOA 3N17A 3ARTA 3N9RA 3WK0A 4YCPA 2VEIA 3DFTA 2NQHA 3VPLA 1V6WA 1Q6QA 3DC0A 4Q7IA 3SGGA 1H09A 1XGDA 4Q8QA 1VRXA 1R3TA 3EPOA 3NM3A 3GIYA 4BWLA 2VDGA 1QRQA 4JFSA 3BCFA 2BVYA 5DFAA 3LENA 1DWIM 4WJ8A 3TN4A 4IP7A 1ZJHA 4F0LA 3TX9A 2PGFA 3VOFA 3U0HA 1M41A 3CPRA 3W1XA 5DCDA 3UFYA 3QZEA 2FVLA 3FYPA 4US5A 2HNHA 4HNUA 2VRQA 5HJLA 2OT1A 1KFLA 2DSVA 5A69A 2I9EA 1ITQA 3I6RA 1RBLA 1XDMA 4XD4A 4ZE5A 5FF2A 1BXCA 4IFRA 3M0HA 2EGZA 2NXGA 4I5XA 2Q09A 1F8MA 4CNSA 1OFPA 4K3ZA 1E4IA 3UWYA 2ATSA 5GJMA 2ZBTA 3GLCA 2QCEA 2FPTA 3T07A 3VIHA 1MUCA 4XVEA 2EG8A 2ATMA 3IIVA 5DXYA 2R82A 1TV3A 1JZ7A 3RN6A 2FJKA 4JY9A 1OK4A 1EEXA 4MWAE 2ZWYA 5C2GA 2INFA 2XFWA 3TW7A 1E4MM 2GUYA 1R38A 1P0BA 3OLDA 5LA1A 4IPLA 3GG0A 1REQA 2WKLA 2NV2A 3H4WA 5K9CA 3TJIA 4JTFA 1Q6GA 2R9RA 2FIQA 4DELA 1HN1A 1FKWA 2GUUA 5CLTA 2A6NA 3VZXA 4DLMA 5DRCA 1E6PA 1QO2A 3M5XA 2FFIA 3HG5A 2QUMA 4EXAA 3ZT6A 3HJEA 1V6VA 1RK5A 2QVHA 3MCOA 1ML1A 2CLIA 5C2XA 2QCDB 2PD9A 3BMVA 3BLEA 1A5MC 1E6XM 4K39A 4AIEA 1U2YA 1UUOA 3ELFA 4DO4A 3CM4A 3TDFA 3C61A 3VKJA 1O1ZA 4JTUA 3V0UA 3T0AA 1KM0A 1FWRA 4HTBA 3W27A 1NARA 5AC8A 1TV8A 3R1ZA 1WAUA 1O6IA 2PZ0A 5TD4A 1Q7MA 5AY7A 1E70M 4DPPA 3G5EA 4UMCA 4X63A 1IEVA 3B4UA 3N73A 2PRHA 2PLKA 3QV9A 2OX1A 3CQHA 3SCTA 4HA0A 4UFIA 4FXFA 1KRAC 3ONBA 1F5ZA 2X41A 3LRMA 3GNNA 3TFCA 1SW3A 1WZAA 1UHVA 2D73A 4HMEA 3BW3A 1J0YA 5DRIA 3PY2A 2J62A 5REQB 3W1MA 4NU7A 5J5RA 1UQZA 5BMXA 4A05A 3FKRA 1SZEA 3ONCA 1CXFA 1UKTA 3CL6A 1PXGA 4PMZA 3W1NA 3T0TA 4LQ1A 3LN3A 2V5BA 4NJIA 1T7LA 3J7HA 3EDJA 3G6LA 2OYMA 3UD6A 5F7UA 5CC7A 1ZQ5A 2IQDA 1W37A 4KMQA 2ISWA 1TZ7A 1TWIA 3MWAA 3WZ0E 1P6BA 1EP2A 1V0KA 1W9BM 3HG3A 2J7EA 1V93A 5GNYA 2ZWZA 2DIEA 1DIEA 1VR6A 1SYTA 5LIUX 4TVUA 5BXSA 3A21A 3GTNA 4FI4A 4XKMA 4M6PA 5FD0A 1EHNA 4WSKA 4U5IA 2YKKA 2PDHA 3SRFA 5A8NA 3QGVA 1Z41A 4OHQA 4RE4A 5AB3A 4WKHA 1W5QA 1PTDA 1VPYA 4CQ8A 4XQ6A 4J3UA 3WQCA 5LHEA 1A5SA 1EWEA 1R8LA 5JIWA 3W83A 2RDWA 1VAHA 1LRQA 3EXSA 3I3BA 1XLFA 2CPUA 4IGMA 3AJXA 1A50A 1DP0A 1PYFA 4JFUA 4WHBA 3BDKA 2AMGA 1XRVA 4NUWA 4N0RA 4ICNA 4GQRA 3H22A 1Q6RA 3SUWA 2F7FA 1YADA 2X7WA 1X8FA 3H55A 4ML9A 1TWZA 3W82A 2QUNA 3AS2A 3DH7A 4GXPA 4RKAA 1WDDA 3EWBX 3ABXA 4DJDA 1RH9A 1E0UA 4GFIA 3L2LA 4PMNA 4UTIA 2R1NA 3VIGA 2H8XA 4PMRA 4H1ZA 5CSSA 5LIYX 1CNVA 5IRPA 5KZDA 4HNTA 2YL5A 2X40A 4RNIA 2NWRA 3TTEA 2G5WA 4F0RA 5HXMA 1WKFA 1S1RA 3CBWA 4KEUA 1GW1A 4PTVA 3B9DA 4DEFA 3FA5A 5FAGA 3P74A 5CJMA 3W7KA 3STPA 1M1BA 3NEHA 1WOAA 1XF0A 3W7QA 1US3A 3G8EA 3F4CA 3AU2A 3CH0A 4IH3A 2GGJA 4W88A 3UYIA 1GPFA 1P43A 1GWJA 1TV2A 2QAPA 4M29A 3BAWA 2OG9A 3G1HA 2FTWA 1D8WA 1TVLA 2REQA 1NJJA 1R30A 4FF5A 3KZSA 4GBUA 3P84A 4S3EA 4HVXA 1IT8A 2X1SA 2ZXQA 1NAL1 1GVEA 1RVGA 4AWEA 1ZCCA 2YFNA 2ZZ4A 2CIPA 2V81A 2XFYA 3PWIA 2HDJA 2PURA 3RX3A 4GH1A 1ITCA 3GDMA 1R0MA 1EJWC 3NPWA 4LEQA 4EP8C 4MDPA 3ZVIA 5BRBA 1ECQA 3W1UA 4PSPA 3UG5A 2GDUA 4AEFA 1F4HA 3Q4DA 4FNQA 1RVKA 2NZLA 4FIRA 1DIOA 1P5BA 3WQ4A 3GNRA 2WHMA 1XSIA 1OG6A 3VYLA 4N42A 4RDYA 4JHZA 1IF2A 3VIIA 1QT1A 4IIGA 5CH9A 3WY1A 2NV9A 2HS6A 1D7FA 5AYXA 4YWSA 1TUFA 2WWCA 1XLDA 3W38A 3VK5A 1KQZA 2ZRWA 3TP4A 5E0KA 1DQXA 3ZOAA 3V18A 5E1QA 1W3LA 4WCJA 1W3TA 2ZX7A 3AHZA 3VX0A 4XZMX 3ZR5A 3KZPA 3W73A 1PDZA 5H91A 1TPDA 4DYKA 3YPIA 1Q6LA 1S46A 3VNKA 1TZ9A 3RGTA 4H41A 4ZB5A 4BWLC 1SR9A 3GWQA 3VZZA 3NUKA 3BAIA 1OC6A 1MDRA 1J5SA 3PZVA 3OB8A 3WL1A 1NFBA 1T40A 1UIPA 3V0SA 1SMDA 1EHAA 4REQA 2BSLA 4ALDA 2X1UA 2WYSA 2RDTA 4IPPA 3UVIA 4OBRA 4PRRA 3HG2A 1ISYA 4ZFCA 3E12A 3W1TA 4NXSA 1U33A 3TLQA 3I7SA 1VFOA 2PE4A 2PDQA 1R47A 4WRHA 4ADTA 4J35A 3LHWA 4WZHA 4GVGA 2C8NA 1CB2A 4HNOA 1XYAA 1C90A 1F9CA 4U3CA 4Z1CA 2YCLA 1AZ2A 4DI9A 1MZHA 2BX7A 4Z2IA 1ZY9A 4ENLA 2CU0A 1UR2A 2XH0A 3KP0A 3POCA 1J01A 3SRDA 3WQ5A 2PDUA 1B9ZA 1YBQB 2VZSA 1EOMA 3WD1A 4ACZA 1B0IA 3AIRA 4XG1A 2NWSA 4WJEA 2H3BA 1UD6A 3HIJA 3ZR6A 4HGXA 3BLOA 1KO0A 4DWDA 2YB1A 1I9CB 1BQCA 2EKGA 3NQFA 1BEUA 1SSGA 1P0NA 1XUUA 3IJLA 3FYOA 3CC1A 3VGBA 1MEIA 2QUUA 4XKYA 1JUEA 5A8MA 1E0VA 4NF7A 1B3WA 3C8FA 3S9ZA 1KV8A 2D24A 2GGIA 3WF2A 4HYWA 3R89A 2CLKA 4N9CA 4AU0A 4UFJA 3TC3A 5JU6A 3VNYA 4HNCA 3GBEA 5JMUA 1GOIA 2OJPA 1DIDA 4MB1A 4BEUA 1QPQA 3JVAA 3S2CA 2F84A 2WM0A 2WKJA 3I6EA 4RXGA 1OCNA 1CTNA 4UCFA 4L6OA 3UP8A 3RDKA 4PMUA 3VOHA 1EX5A 1FWSA 3TYCA 6TIMA 1XIDA 4FLSA 3NR0A 1B9BA 4AD4A 3W81A 5JH2A 2NUXA 3UZXA 5A1AA 2V5JA 4ZFMA 1Y5WA 3ITXA 3CNYA 3RHGA 5ABTA 3CEPA 2IKJA 1NOFA 4LC6A 1QBBA 5JIPA 3E74A 3OBAA 4JKKA 4E2OA 3FV9A 2V63A 1I1XA 3G1RA 3RNDA 4OOZA 1QPNA 1K1DA 1TTQA 2CLFA 4F4RA 4CD5A 3LM7A 3U5YA 1GYNA 3W75A 2R24A 2W4XA 3GAKA 2A3HA 3M0MA 2FKPA 3PF3A 4D8ZA 1LT7A 3K13A 4A4AA 4DAFA 3L4TA 3LLXA 3N29A 4PL2A 4H3DA 4S3GA 1C8QA 3CWNA 1VIZA 4WDXA 3S2NA 3CHVA 1MQQA 1W2PA 2FZ8A 4HZ6A 3EX4A 3AIUA 4FK9A 1Z48A 3T42A 4PR4A 9XIMA 3W7LA 1IXNA 4Z2GA 4A2SA 3P5ZA 3WK3A 2AL2B 1E56A 2VYOA 5LIWX 1XJBA 2ADAA 1VLWA 1HFBA 4MLJA 1TG7A 2OELA 3CB8A 3UJRA 1YDYA 3HV8A 3NCOA 3A9BA 2ZRZA 1ZBVA 3VINA 1X7IA 2ASHA 4FHAA 3L9CA 1JPMA 3CAKA 4R9XA 1UR4A 3WD2A 4WXZA 3L4UA 4TX9A 4HK7A 4IHCA 1XLIA 2ABBA 3W7EA 3BURA 1ISZA 1XDLA 1PDYA 4XO7A 1XI3A 4KKXA 2WMIB 4KWUA 4KRTA 4FZIA 3DHDA 3WCZA 1UASA 2VFGA 3HM7A 5G4HC 2G37A 4HA3A 3M43A 2BOEX 6TAAA 3KCLA 3QQ0A 1L2QA 1CCWB 1XH2A 4KWSA 3R5EA 1MZRA 2WVVA 3WBEA 3NYDA 4IMGA 2QW5A 3PTQA 1I0DA 3DC8A 3K8KA 3C56A 3EDDA 1PIIA 4U31A 1UZ4A 4RDZA 4K7YA 4D8AA 1GVSA 1ZBKA 2J7HA 1PYMA 2DZSA 4JXCA 3MI2A 1GYLA 3ZLGA 1X39A 3W4RA 4DJDC 2WV8A 5GNZA 4PUNA 3KBMA 4NZJA 3QBUA 2I57A 2J66A 3QYQA 4NQ1A 4NZ1A 2RKXA 5JH1A 3DBPA 1FWIC 1P6CA 3EKLA 1RR2A 1GTHA 1S2TA 1W17A 3FX4A 1I2RA 3CZEA 3B06A 1HL2A 1QI4A 1P0EA 1HNYA 3PUEA 1LOSA 2V30A 1Q6OA 3MY9A 2CCRA 3M47A 3P81A 3CQ0A 4LU0A 1MMFA 2XZ7A 3A47A 3VOIA 4J27A 3SURA 3ZT7A 4K38A 4JEJA 2I9UA 1YE4A 2PDNA 4QSFA 1J2WA 5XIAA 1B4EA 4Q8UA 2HROA 3W7GA 4ATDA 4RDVA 4LXFA 4KGLA 3E9AA 1FDJA 4E8GA 3MCNA 4PMQA 1FP8A 4KPLA 5BWFA 5IBXC 4O15A 4HZ7A 1AL8A 3KBVA 5AC6A 2QGYA 3NYZA 3TJLA 3TLLA 3LGDA 4MY9A 4NVTA 5E5CA 4LVBA 3HO8A 4K36A 4UMAA 3SEPA 4CUCA 2HPMA 1H3GA 3M7SA 3NSMA 2WSQA 5JQ9A 3G0SA 4CN6A 3AMDA 3WH8A 1AG1O 4QROA 3ZLFA 4NIRA 3QC3A 4E38A 2XIOA 3EWYA 4XZNX 4GOAA 2XVLA 4U3AA 1L8PA 7TIMA 5LNVA 3SUSA 1TJ1A 3IUIA 4O52A 2R6OA 3E2SA 5BOEA 2JF6A 3EA1A 3NQDA 3PZTA 1JF5A 3RM8A 5F2IA 1BF6A 3KTSA 4GE8A 3N13A 2ZZ5A 1VHCA 3R43A 3T44A 2VT0A 4LAUA 5GNXA 2J77A 3W1PA 3BANA 3A4AA 3PZNA 3TTQA 3O07A 4XZIA 3FXGA 3M0VA 3TQKA 3FCPA 4BFAA 2VR5A 1GORA 1AA1B 4IQDA 4LW7A 1YPIA 4JIHA 2J6XA 3TNOA 5H2ZA 4A35A 3LBOA 1DQUA 3VABA 1BWKA 1VEPA 1TELA 2O4MA 4J3ZA 3FJLA 1DEDA 1OX6A 4IJBA 1J9YA 4QX4A 3ARVA 4YVPA 1C3FA 4O10A 4CD7A 2V3DA 3TJXA 3W2JA 1IGWA 5HDRA 2NQLA 3AXIA 5C7HA 4EKJA 1YDNA 3V16A 3ECQA 1E9LA 4MMWA 2CLEA 2GQ9A 3IK2A 3NPVA 1V79A 3H2MA 5CPQA 4NNCA 4HHMA 4JIIX 2YBUA 3WMLA 1FA2A 1CDGA 4D8LA 2Q02A 1OX4B 2Y62A 3G3DA 2PTZA 3CASA 5G2IA 1H5VA 3B0VC 1LUCA 1UA7A 4E8DA 1HJSA 5LXEA 1QOPA 1Y8BA 2G3IA 1WPCA 2D22A 3HV9A 2XSXA 3W86A 8TIMA 3OU8A 5EFFA 5D8WA 4GUIA 1W3JA 1TVPA 1J5TA 1IEIA 1OCBA 3LERA 2Z1SA 3VIOA 7PTDA 3APYA 2YW4A 1KLYA 1LLWA 3LD5A 2WAGA 1GJUA 1J12A 1OFAA 3SCRA 4YTRA 3NO3A 4WD0A 1V3LA 2RFGA 1Q5MA 3EX6A 4GI6A 1AQ0A 1UH2A 2W27A 2XPKA 3RJYA 3I3EA 4IISA 4OECA 2ISVA 4PYSA 4RDWA 1T96A 2ISDA 2EPNA 2HBVA 4B5NA 3L2IA 3V5CA 4ORMA 4GUJA 1WXJA 2VM8A 4LT9A 1M5WA 4YXGA 3BPWA 1UUQA 4S3KA 5K3VA 4Q8OA 1NF7A 5IFPA 4X22A 1AUSL 4M80A 1W3KA 2RJHA 3NQCA 3PC0A 3NZPA 2DZUA 2DEPA 4W89A 3WH9A 5CGQA 2JK2A 5I3GA 3CIVA 2FVMA 2BOGX 2BVWA 3TCEA 3GUGA 5LA2A 1RCQA 3DHPA 3QFWA 3DN5A 5DT7A 3CUIA 1H61A 4PB3A 5LKYA 3WYZA 4AD3A 1JAKA 1M53A 1K4GA 1X38A 4Q8WA 3M9YA 3VKAA 3HMJG 1Q8JA 1G1YA 1FWNA 1KKRA 4JCLA 2P8CA 3KW3A 4AMCA 4I9TA 2OZTA 1ZRQA 3P8JA 4IQLA 3SI9A 4P8WA 3S1VA 2PP3A 3IEBA 3EPMA 4FF7A 3URQA 4S23A 1BKHA 2J88A 2G0WA 1BGGA 3E0IA 4E4FA 2DZPA 3VMPA 3N9KA 2TSYA 3PTDA 1XDJA 1RAKA 2O55A 3WQ6A 3WFZA 1VFHA 5D9PA 4DBWA 3CQJA 3ITOA 1WX0A 3IGXA 4HHPA 1IZCA 4Z2JA 1T6MA 5AHLA 3RO8A 1PEZA 4M5PA 1HKIA 2VUYA 1HT6A 3B9NA 1JDCA 3N25A 1QXLA 3LHYA 3QZ6A 4MYAA 2HEJA 5TQLA 1OVDA 5HNNA 2FDMA 5A6KA 3IPWA 4HKPA 4KQNA 2D3NA 4JTAA 3HA1A 2NVDA 3WMSA 5HUPA 3AALA 3VNJA 4UR8A 4LV4A 2D0FA 1YTEA 3UG4A 3BL3A 3NL5A 4V33A 4W7UA 4Z1BA 2GSHA 3T6CA 4B91A 3W1QA 3TXZA 3ITTA 3QXBA 2MUCA 2F6UA 5A2CA 4C6BA 3U4AA 3ZLHA 2VGIA 4MFDA 1KGXA 3DZ1A 8RUCA 1GTEA 3WQOA 1HW6A 4CQDA 3V5FA 3TN3A 2P50A 3W6YA 3L0GA 2R8WA 3CYJA 1UH4A 5FOOA 2EPLX 1MNSA 1TWWA 3M64A 1G67A 1CI1A 2P0IA 3SUVA 2P88A 1XWYA 4YLWA 2OZ8A 4Q8NA 3NQ6A 4QFUA 4PRWA 1JCTA 4FS9A 3SFKA 3GG1A 3TYDA 3GG7A 3BLPX 3HFTA 2W61A 4UQCA 2QMKA 2WZHA 3UG8A 4BI7A 4XSMA 5KITA 1QHOA 3GHRA 4PODA 1GONA 4ORIA 1VRDA 4R9OA 4IIHA 4IPJA 4IM4A 4X2PA 5CGMA 3SO7A 3CZJA 3XINA 4UTTA 4RZ5A 3WFLA 1XLKA 4GUGA 2ZX8A 4JR5A 1HJWA 3ARQA 5EMUA 4GVIA 3RUBL 2CKSA 3S5YA 1US2A 4D6DA 4G2DA 1B31A 4MY8A 3KOFA 4BQ2A 1S38A 2V38A 4BY3A 1DE5A 3W7OA 3PHAA 4JX5A 2GLKA 2W9MA 1E9ZB 1CGUA 2A3BA 2J79A 4LUYA 4W8BA 1KR1A 3SY5A 1GKRA 3UWZA 1EGZA 3UWVA 3WLKX 1HGYA 2C0HA 1F3EA 3T08A 1HF6A 1LBLA 5KZMA 4UUIA 5D2WA 4IPNB 1TJRA 3RLVA 4RLIA 1UR9A 2OSYA 3LTSA 5I5RA 1YTDA 4OJYA 1ZAJA 3CPGA 1I45A 2HSAA 3PAOA 1VB9A 3VDGA 2FMNA 3E02A 4E2VA 3CS2A 2DW6A 4A3UA 1KLZA 3P8IA 1JNEA 1DE6A 3B3DA 1I2PA 3N2MA 4S1FA 3VIKA 1K8CA 1RPKA 3WBAA 2BS9A 2RGLA 3GAYA 1BG4A 3FIGA 1H7PA 2W91A 5HANA 4ZSUA 2WSRA 2QUVA 3ZM8A 2PDJA 4MFEA 2NT0A 3OG3A 3RRAA 5BU9A 4JN8A 3NQEA 1B54A 3L7RA 4DWSD 2VURA 3VD9A 3EX1A 1AZ1A 3URAA 1SFJA 2QS8A 1K4HA 3DGRA 4V1YA 3APGA 4AZCA 4N9DA 1J6PA 5E9AA 4Y9PA 1ZL1A 2ZXAA 4KEVA 4GZJA 4IL0A 1EBHA 4K8GA 3UXIA 5C7VA 1RY0A 3EWZA 5G2WA 4W5UA 1K7FA 2J7DA 2VX7A 2F9RA 2YCLB 5CGTA 1E55A 2ZUWA 2O92A 4CGTA 4QLJA 4YCOA 3P14A 1L6YA 4P2VA 2OKTA 3IVSA 2QVNA 3AS1A 1TPVA 2J7FA 2TRSA 2XIQA 3IUDA 1QBAA 1R7AA 4QP0A 2VC5A 4NP7A 2VRKA 4ZODA 3RFAA 4X9YA 4FMVA 5CSYA 2INZA 3WF3A 1DHKA 2VEMA 2YB4A 3SZ8A 4M3PA 4QDPA 1TO3A 2BY0A 4LV9A 4O53A 1B3OA 3O16A 1GKQA 1K9DA 5DELA 2B4GA 3C4UA 1KCZA 1Q6CA 1O66A 2DDXA 3VDCA 4XKYB 4AZBA 2FFCA 1HKWA 4HA4A 4NHVA 3M46A 4D6HA 1M65A 2GWGA 4DF1A 4GGHA 3N12A 2UZ9A 2EAWA 2J75A 4ES4A 1XR2A 1G5AA 1WYIA 1IQ8A 5DLCA 2X2YA 4JIQA 2Z00A 5D2YA 3BG3A 4JTIA 3HOJA 2CERA 1EJRC 2X2GA 3A6OA 3AS0A 4KCTA 2AKMA 3COTA 2P3EA 3RITA 4WSJA 2CWXA 1IEXA 2WJDA 3MHUA 3N3TA 4QLLA 4W87A 3GD6A 1KM5A 1J96A 3UR8A 4US5D 3MZ2A 3CL7A 3DYPA 5FJPA 3ZFHA 3VOGA 2Y88A 4C6KA 3CAQA 4HMDA 2LLEA 2JIEA 1E40A 1UD4A 2DT0A 4IUGA 4GWEA 1OFEA 2IPGA 4WKAA 4P8XA 5BROA 5BXRA 3WDRA 4LEFA 5J8LA 1O1HA 1D3CA 1HQTA 2Y7EA 4ZTYA 1KC7A 1TPWA 3GHSA 4ZVJA 4XBJA 5L6UA 1YX1A 1W8GA 4O8AA 1JCYA 4EVZA 4ZOCA 4QXIA 4ZO9A 3ARWA 1SJAA 1FBAA 3V5OA 3QYSA 5DCBA 1WAWA 3L23A 4Y9AA 2ZE3A 3T0BA 2H8ZA 1THFD 4DYJA 4JOMA 4F66A 1YNYA 3TZFA 1H7NA 1OINA 1H63A 4M51A 2VHLA 1AVAA 3AAMA 4L9ZA 4UFHA 5KTLA 3HF3A 1XPYA 1R2SA 4C90A 2H9AA 3P5YA 4G7FA 1W8SA 2PDLA 3D47A 3UT0A 4ZEPA 3RPTA 1A5AA 3L5AA 4JQAA 3IGSA 1YPFA 3T2QA 1GEQA 2ISFA 2VX4A 3AIEA 2QCCA 2XN1A 1DKWA 3QOMA 3C0QA 4GO9A 3UR5A 3UESA 4L1WA 5KSWA 4E4PA 4U33A 1NDYA 4QAWA 1XBZA 3OZMA 3C52A 1A49A 2YXOA 3KOXA 4M0XA 4GQGA 1NVMA 2A5HA 3LK6A 5FJJA 4A8IA 1OX5A 1O7AA 4J3XA 1CT5A 3SIMA 1FH7A 4IFKA 1V77A 3R25A 3CUXA 3N2CA 3MPGA 4FEZA 3KHJA 3BW4A 2E4TA 3GR7A 3U48A 1QI0A 4CD4A 5L9FA 1FP9A 3G1DA 1KXVA 3WX7A 1A5NC 4PRTA 1A0CA 1G6CA 4AEEA 3N04A 1PBGA 2WVVB 1QWKA 3WLTA 2NQZA 3MHFA 5G1TA 4UWMA 5FCZA 1UH3A 3OP2A 3QMSA 5FF4A 2QMJA 3VDAA 3GY1A 4WVXA 5CC5A 2PPGA 1D2KA 3OTRA 4CNUA 1FHLA 2CXGA 3QHNA 4ICMA 1X8CA 3PZIA 1A3WA 2HVMA 3AHYA 1KM2A 2X42A 1N8WA 1WKYA 5HJYA 2ACUA 4LYPA 4F2BA 3SCVA 1I2NA 2BP1A 3KCOA 3PJXA 3VILA 4HOZA 1A4LA 2BNJA 1TTJA 4O0KA 3B0UX 3NURA 1RV8A 3KBSA 4PE8A 1XLCA 1LROA 3O15A 4QQUA 3OVPA 2GGGA 4DUOA 3S0CA 3NDZA 4CNTA 2FQIA 2UY2A 5JUVA 2VC7A 3L4WA 4P61A 3QOKA 3TA9A 1ICQA 4IG2B 3E2QA 4PB5A 3VCCA 3OYZA 3DBNA 3EWDA 3BQ6A 2PU1A 4KF1A 4PUUA 1UD5A 2X05A 3VGFA 4MADA 4M1RA 4BZYA 3NIYA 1JL8A 3NFUA 3U7BA 3W53A 3NZGA 1EPVA 1FCBA 1C93A 4KW2A 4YU1A 5M17A 5FJIA 3DX5A 1D8CA 1YDOA 5KEZA 2DIKA 2XIBA 1AMYA 5MKGA 4A22A 1FQ0A 1E0XA 4UTTC 3CO4A 4UQEA 1VBJA 4ERAA 2YL9A 3TFXA 1YKWA 3W7RA 3RU6A 3IWPA 1UP3A 2BGQA 2DSWA 2G3MA 4FXJA 1V7YA 3O8AA 4MAZA 3EEGA 3QJAA 2V6AA 4AWSA 1QPOA 3ZIZA 1XM3A 3HFYA 3N6QA 4MB3A 4A29A 4XX6A 2ICSA 2OTDA 4QG8A 4EAMA 5GJPA 7XIMA 5B80A 2QAFA 4FLOA 4KFPA 4MZ1A 1ISWA 2W92A 1JYNA 1UYQA 1E6RA 2WM1A 2WNQA 4AC1X 4RZ4A 4GBDA 4QEEA 3RO6A 1TMLA 2F2KA 4LUIA 2NSOA 3VGGA 3MI3A 4QISA 3R0UA 4IX2A 1ONRA 2WVSA 4CCEA 1YW1A 1RD5A 3T8LA 1ONEA 5HBFA 3GDRA 5DANA 1OGGA 1U30A 3H2OA 3LYEA 2WC4A 3L21A 4ML4A 3NQMA 1NF0A 1WDPA 4QIUA 4OQVA 4N9EA 3CIWA 4OV9A 2ZRUA 3ICJA 3UZZA 2XTKA 3LQLA 2Y63A 2FTPA 4G6CA 1VZWA 3ORWA 3LHVA 4MPKA 2YDQA 1LCOA 2I5IA 5DN1A 3PFMA 3F5JA 2QPSA 3FOKA 2OWCA 4UZSA 3VMNA 3BW2A 1HKMA 3NZ1A 3VE9A 1OADA 3CLWA 4KGJA 3FGCA 4D6CA 4K7VA 1ZJIA 4WOZA 4MJ2A 2B7OA 4DBDA 4J4KA 2PEVA 3EKGA 3NQGA 4GACA 5FEXA 1XW8A 3WJXA 3WNOA 1W5PA 3TH6A 3RPDA 2AGKA 2ZIDA 4JTCA 4TIMA 4F2TA 1B57A 1SO4A 4LFYA 3C3NA 3LEPA 4RV8A 2WKGA 5AHNA 5FEZA 3CYVA 1AMKA 4B3LA 3GR4A 4AC7C 1VYRA 2XVGA 3NL3A 2WXDM 3W1RA 3AWNA 1DYSA 3BH4A 2CBVA 4B5UA 1M9HA 2QNEA 1GJWA 1IWPA 3DECA 2V5LA 1CXKA 3UERA 1JGMA 3VKBA 4ERIA 1RHCA 1TPB1 4PUDA 5HUOA 1MQPA 3W01A 5M2FX 1M7JA 3EOSA 1LUCB 1ODZA 4LRSA 3ITLA 3S1GA 3MSDA 1S2WA 3VXGA 1UPMB 3A3HA 3WQGA 2VZTA 4TVDA 1YEYA 1G9HA 2QCDA 2DUXA 1C92A 3EB3A 1JYXA 2Z1XA 3WLNA 1NWTA 1JZ6A 1E9IA 2VNCA 3QGAC 4JTDA 3TYAA 1FXPA 4PCSA 4CEXC 4Z42C 1LORA 2OU4A 1SSDA 2O9TA 1YXDA 1H0GA 1OEPA 3GXFA 2J6VA 3LRLA 4CQ9A 1GEHA 3GDKA 1ZZMA 4R33A 1X6LA 4S2BA 1OM0A 2CEQA 2ZC8A 3BQ5A 3N2OA 4PGLA 4FXSA 4QJ4B 1UR0A 2I7GA 4H9TA 3RR4A 1VH7A 4PL1A 3W7CA 1XKJA 3GVGA 4LTSA 2ZTJA 2RAGA 3N4FA 4S3DA 4CNOA 1PIGA 3C2FA 3AYRA 4QDMA 3VO0A 1VBUA 1WDQA 1M7OA 3MP3A 3NTYA 1PB0A 1ZPTA 3N15A 4ZCWA 1Z89A 4HN8A 3M0XA 3M6YA 2XYLA 4Q8TA 1FVPA 2VVNA 2BASA 1GVFA 3H7RA 4MB5A 4PUKA 3MV11 3LY0A 2ZXBA 4JTGA 4DHGA 4AZGA 2YA0A 1CZ1A 3T40A 3DAQA 3GSMA 2PRLA 1KFJA 4JIRA 4CQCA 4HBKA 1PHQA 4O0ZA 1KFKA 2CLOA 1OFBA 3QV6A 4FAMA 1C91A 3WUEA 1UOKA 4PFMA 4IOTA 2VENA 3V36A 3SSZA 4KCVA 1TJPA 2J7CA 1KFEA 4W8AA 3KCJA 1XYBA 2PA6A 2PDPA 4XIMA 4RUBA 4O57A 3QRHA 5HR6A 3UJSA 1BFNA 5I00A 2W63A 1AW2A 1V6UA 5EMLA 3BSGA 4B2DD 5DXXA 1PUDA 3ABOA 3HTWA 3S1XA 4YVXA 2E25A 2VDIA 5LNRA 3BUVA 5K4XA 2YCIX 3QEZA 3D46A 3N2BA 1ONWA 2Y61A 3DENA 1FCUA 1XIIA 5JBEA 3FY1A 3AMCA 4FOUA 1U1JA 5I02A 1KV5A 1FHUA 4M7TA 3E0FA 4UTWC 2PDMA 1K6WA 2DH2A 3PPFA 3Q37A 1TREA 2PTYA 1QK0A 4O14A 2NQJA 1OABA 3CV6A 5AHEA 3STFA 1X6NA 2OLHA 2JGYA 2YW3A 5BWAA 3FYYA 2QT3A 3W72A 3SCQA 2PWUA 4YMZA 1CLKA 1GUVA 1QI3A 4FA3A 2QCFA 1PX3A 2ZZ6A 1US0A 4JN7A 3FKKA 4AW7A 3GR8A 2FZ9A 4CKQA 5HWMA 1GKPA 1YXYA 3USZA 1BSIA 1RALA 1FFRA 3WDJA 3VFLA 3TEVA 3WQFA 2F6XA 1UR8A 1FWHC 1OT2A 1XLBA 2OEMA 3T7VA 3LQGA 5D2XA 4GIYA 1IXPA 1BYBA 4AIBA 3TW6A 1K03A 1R3YA 2OR2A 4RXFA 4E2DA 3A5FA 1XCWA 4L61A 1J10A 4IZGA 3II1A 1E72M 2CHOA 5TNVA 1L9WA 2Y5SA 1QU4A 1MUMA 3KRSA 3EBVA 1FWAC 2O9PA 5HAOA 1JDFA 2J7BA 2D0GA 2X0SA 3BV7A 4NRSA 1SO3A 4HHLA 4RE3A 3CZ8A 4LUSA 3OA3A 4IGSA 2XFRA 2VKZG 2P10A 4HJWA 2Z1BA 3KWXA 5C8BB 2DZTA 2QF8A 2DUZA 1CB7B 1DJWA 4PA8A 3LPOA 1ZJBA 4UFLA 3FSUA 5FJRA 4B5TA 5CAHA 1SZFA 3THQA 4AHOA 4HQVA 3MI6A 1W54A 2ALRA 3AYTA 3DFSA 1T5AA 3UPMA 2Z27A 3R10A 4XD6A 1EJSC 5FF0A 4KIEA 4LNCA 4JGDA 4IX0A 3WNLA 2Y4SA 4KBXA 1JCJA 3SW6A 4DAIA 1W9UA 2HVNA 2BXZA 3LMZA 4ONVA 1VPQA 1OF8A 1YDVA 4XIAA 2ANUA 4Q4KA 5C71A 1IWAA 5I7GA 3R8HA 1NH6A 4ASTA 1CGTA 2NX3A 1KTNA 3PWGA 3V7PA 2ZZ1A 1EDGA 4EACA 3CUJA 5HQMA 2VRJA 4HU8A 4MDOA 5FACA 3T09A 2UY4A 4J3VA 4QM1A 3G0XA 1IYXA 3SECA 3VVGA 3GKAA 3TN6A 1B2YA 1A0EA 3CT2A 2E5BA 4UNLA 3N34A 2EXOA 2BV9A 2YIHA 3BMXA 4AZCB 4ZXLA 3WMCA 5HWNA 2POTA 2NVCA 3RAOA 3B97A 4MKNA 2OB3A 4P7LA 5C9UA 2Y89A 5CZJA 3TOPA 4L6HA 4L1XA 4A6GA 3WKZA 3CV2A 2DJLA 3R4IA 3GH4A 1ADOA 5A3HA 4XD3A 2JEPA 5IDZA 2Z25A 3DGBA 1QK2A 4QTGA 3ARYA 4Y8FA 2GQ3A 3TCSA 3OJGA 2JALA 3TYZA 2PB1A 3H6OA 3KS6A 1MFUA 3LV5A 2V5CA 4O54A 1BGAA 1BF2A 3BOFA 1UB3A 1UBPC 1AQFA 4JYEA 2QV4A 3C5QA 3WLIA 1G94A 3ANYA 3FJNA 4GG9A 2RDUA 2E9BA 1Q65A 4WGXA 1F6YA 2Y70A 4Y9OA 1HXJA 4OE7A 3GFYA 3KBJA 8XIMA 3ZJ7A 2JGQA 4F0MA 1XQKA 2GZXA 3LCFA 3MDUA 5IXEA 2FLIA 3TSDA 1CGWA 1W1A1 1OCQA 4TO8A 1RLDA 2AMXA 5HK4A 1G7UA 1F6KA 3FW6A 3H53A 2QGHA 3N1AA 3GM8A 4MJ4A 2OZ3A 4GCXA 3P0XA 4JQ3A 4J2MA 1FWGC 3C2RA 1ELSA 1V3MA 4H8HA 2DSZA 1DJHA 4LF2A 3PPHA 1W91A 2I16A 2FGZA 4M81A 3UJ2A 4LANA 4BF9A 3QFEA 4XAZA 5CC6A 3PUOA 4O17A 4MPQA 1QAPA 1IHIA 3V4BA 1E43A 2CZEA 2XZ9A 1D7KA 4RPQA 2WHLA 3MSYA 3UZWA 2ZC1A 5HNTA 4KEZA 3M44A 3WDQA 1W3HA 1GQIA 3P2VA 3UZYA 2R14A 2IKIA 3UJEA 3H2AA 2YLAA 3NSXA 4B15A 4RX0A 2PF0A 2OGJA 2EPKX 2VQTA 3WDIA 5A5WA 3W7MA 3K8LA 4ZQRA 2Q3OA 3CUFA 1LRNA 3GU1A 3CXOA 4QHRA 2EBNA 2VFIA 4DXVA 3QY8A 1GHSA 1YPXA 1KCXA 2H9AB 4H6QA 4CVWA 2ZA3A 1LWIA 4NRRA 1K9TA 4Z0SA 3HBLA 2PZNA 3CGTA 3MSRA 2VFFA 4GPNA 1LLOA 3HGOA 2GJLA 1FXQA 2GK1B 1X96A 4C5YA 1OGBA 2ABAA 5ABFA 4W84A 3C2VA 1L2UA 2E5DA 4I9AA 2AL2A 5C0QA 1JI2A 1UKQA 4JTJA 2E6YA 3KVKA 2DVXA 3F4DA 3LCXA 4JTEA 4D6FA 3WFAA 3BOXA 4BQ4A 2VEPA 1TJ0A 2VOMA 4JFVA 2CHRA 3C6CA 4ADSA 1PKLA 5FL1A 3W1LA 1E73M 2E3ZA 2OPJA 3CMJA 4GNVA 2VZVA 1FWCC 4IMEA 4DYEA 1E5NA 2FYMA 3SGUA 4IFKB 1IZKA 2WBKA 3KP1A 3CUGA 3OO2A 1KQYA 3LHZA 4U4MA 4NAFB 1XIHA 5DMNA 2VEGA 3SUUA 2VGBA 2WMIA 5I3FA 3PB2A 2ALDA 2GJNA 5LZLA 3T0CA 3N11A 1NU5A 3BAYA 1V0NA 3TA6A 4X0VA 4U28A 3G0UA 5D2TA 1EKOA 3WLQA 1VIWA 2RHGA 4FX6M 1JPKA 4GXWA 3FJ4A 5A6SA 1Z44A 3IJIA 2GJXA 1HIZA 3N6HA 4ERGA 3VIMA 5I3JA 1UWQA 3EOLA 2P5NA 3LDVA 5KMYA 2AAAA 3BLFA 3QR3A 3FXYA 3L67A 4TTGA 5CBJA 4DIAA 3BK0A 4XISA 5DMLA 4MLRA 2VI0A 4PEKA 2VELA 4WR3A 3MJYA 1PZ1A 3ZSSA 4GY7A 5AVHA 4DWSA 3A23A 3CWHA 2R1PA 2J13A 4LSBA 4JTKA 2ZQ0A 2JEQA 4R53A 4AD2A 4C91A 1XLEA 4LY4A 4DXXA 3H2CA 3TYBA 1GPWA 1XIBA 5DCEA 5TIMA 3BV4A 3RCMA 1F05A 4RJEA 1TX0A 5ECVA 1S3HA 2C18A 3GUWA 1Q45A 1FOBA 2W0UA 3U7VA 3UY7A 2V9DA 3RG6A 3CHEA 1JZ4A 5ENLA 3VD4A 5A2AA 3W7JA 4PCNA 2PGWA 4UXDA 3HURA 3GXMA 2IW0A 2PDBA 3F4NA 4CN4A 4MWAD 4UZUA 2XVNA 2YL6A 3TYUA 1UJPA 4TQTA 2OWWA 4NJJA 2PSNA 3BZJA 2D2HA 4O11A 3OQEA 2ACQA 3WD4A 1OG0A 5KETA 3GTXA 3UWQA 3CO8A 1PL9A 3TROA 2HTMA 4C1LA 4TX8A 1DXFA 4UFKA 2C19A 2VC6A 4M8UA 3H4GA 4J3TA 3W7HA 1AD4A 3W02A 4AYSA 3GVVA 1P1XA 5DBTA 1E9YB 3M1ZA 1F7BA 1EJTC 1Q13A 3PBMA 3CTTA 4DUXA 3A4WA 3N9SA 3BARA 3GVQA 3O1NA 4I9JA 4I7WA 2OYLA 1QVBA 1QNRA 5M1TA 1O5RA 4JZ5A 1UPPA 2E28A 4PZVA 4B5WA 2X8RA 1TSIA 5PTDA 2I56A 4QCEA 3WO8A 2OEJA 3D6NA 4C6MA 4ZSTA 2GFTA 2Z7GA 4FXRA 4GKTA 4AG0A 2CZFA 2BG5A 3FGCB 1JR1A 1OT1A 2WNWA 1F61A 1JIBA 4YHEA 1K77A 1YXCA 2C15A 3NNTA 1XIMA 2ONEA 5H8MA 2VWSA 3WEMA 4FP1A 4YWIA 3MT1A 1J6OA 1E71M 2YDRA 3TK7A 4AZIA 3LA4A 1KM6A 1AJ2A 2C79A 3EWWA 1JULA 4LX4A 1W1TA 1ZBWA 1LWHA 2WVTA 1DJXA 1QW9A 1XYLA 1TWDA 1GHRA 1UCWA 1LG2A 3OGVA 3UWEA 3RYSA 4IJRA 5CG7A 4C6NA 1JZ5A 1XKYA 2B7QA 3QSRA 1VEOA 4X3ZA 1NIUA 1VCFA 4JIEA 2GOKA 4ZB0A 1XIEA 4WX2A 4J7RA 1V03A 6ALDA 1OX4A 3KL3A 3GO2A 4W7WA 1AJ0A 1MXDA 1TE6A 1DQWA 1UKOA 2XWEA 3FAXA 2WMHA 3ERPA 1TJ2A 3MA8A 1CEOA 4QSHA 4GNJA 4P8UA 1V51A 3NWRA 1J4EA 2GDVA 5I23A 4XD5A 2PWDA 4P7OA 3N19B 3THAA 4MY1A 2WMFA 1OF6A 4MHBA 3OZOA 1L6WA 4NYUA 2E7FA 3K5XA 2XGIA 2Z6JA 1JVNA 3IJ8A 3VA8A 3GTHA 1JZ2A 4OUEA 2V3FA 1V3IA 3V35A 3EWCA 2PMQA 3SUTA 3G22A 5DY3A 4WF7A 5I06A 2WCSA 1BRLA 3WEZA 2XHYA 5CKSA 3M0JA 5HULA 2PDXA 4JPGA 3TUUA 4O19A 3N3MA 4OWGA 1JRBA 2CHNA 5LGXA 1PAMA 1H7OA 2ZZ2A 3DERA 5CC3A 2G3JA 2B81A 4GHRA 3GC4A 2ZZ7A 1TYGA 4H6RA 1N8IA 4QNEA 2DIJA 1A5KC 5C9WA 2OSWA 1KFWA 2Y6ZA 1Q8AA 3ABRA 4POCA 3I68A 3S3GA 2BXYA 2BXVA 1EFZA 3IV3A 1UP2A 3TU9A 3CEUA 3VTRA 2R1MA 1I6NA 1MW3A 4EPDC 1JDDA 1P0KA 3NL6A 4H2HA 5TAOA 4MZ8A 3QN3A 2E8YA 5F4SA 7ODCA 3T05A 1LOQA 3CZKA 1EB3A 1P1MA 4UIOA 4EXBA 2F2HA 2XU2A 3UA3A 1ZTVA 2E6AA 1BYDA 1SR0A 4FLQA 2AAMA 4MF4A 1MRAA 1MSSA 1YIXA 1M3UA 3A3XA 3WEOA 2XVPA 2YZ5A 2QQ6A 4M6UA 2C91A 3XIMA 1YMYA 4UNIA 4MAVA 4KIRA 1KWGA 2DP3A 2PP0A 1C8YA 2X30A 1I8JA 3ENLA 3O3RA 1PKYA 5G5IA 3SR7A 1CX9A 3A22A 4FSAA 3TWAA 4Y9NA 1VFLA 1CGXA 3LMYA 1KBIA 1P0DA 3WH5A 1BD0A 1UWTA 4UTUA 1E3ZA 3VMOA 2EKCA 2J27A 2J4GA 4YTQA 5LIXX 4TX6A 1ZCOA 4S38A 1S2VA 4C5ZA 3NVDA 3CHCA 2A1YA 4JEQA 2Y24A 1QOQA 5AYYA 2V2CA 3INPA 2QJJA 1EXPA 3TTYA 3OIHA 1AH0A 1E6ZA 2E77A 3LSBA 4M7SA 5EMKA 4Y9MA 1W1B1 2CZVA 3C86A 3M0LA 4IQJA 3QSTA 3QW4B 3AQUA 2VX6A 5EGRA 3HPZA 1UJQA 5A6JA 4JFTA 3JRKA 3JU2A 3NG3A 3KHDA 3AHVA 4I6KA 3DCPA 2G95A 2GL5A 1RQEA 3AHXA 4QJ1A 3DOPA 3QKEA 5K9XA 4Q4QA 2G8ZA 3TKFA 3UPBA 5A8PA 3W70A 3S2MA 3DYOA 3GZ3A 3PUGA 4DNMA 5JVLA 2Q8ZA 3SADA 3DIPA 3LRKA 3BWWA 2QJNA 3IUHA 1PZ0A 5D09A 4UR7A 1KR0A 2HRWA 1PHWA 1SO6A 3AI0A 2Y8UA 3CZLA 2XH4A 1B3YA 2Q71A 2FGBA 3O0FA 3NM1A 5D30A 2DV0A 3W7IA 5DY2A 5K2ZA 3WNNA 4DO5A 4GVFA 4RR4A 4CNPA 1IEWA 4AVNA 2BBFA 3ZJ6A 4GUFA 1EJUC 1N82A 4DWSC 4PULA 4GCAA 1RQBA 1K8XA 3WMBA 4AWUA 4WUIA 1R46A 2W67A 3LBCA 5LIKX 4HJFA 4PTWA 2WCAA 2OGYA 2YDSA 4H83A 3OZPA 3STEA 1CGVA 3D5HA 1FH9A 4Q32A 3BLKA 3W37A 1A5CA 4LUSB 4EPEC 5AKQA 3PPGA 1JPIA 3T81A 1TUXA 4RW5A 3BAKA 2VVSA 4Z1AA 3NGJA 1P4CA 2FZDA 3GS6A 2PWFA 4DBSA 1GOWA 3CH9A 4LCRA 3U8GA 4AY8A 4EOUA 4UQBA 5FJUA 4AD0A 4O8RA 4M82A 4DZHA 1TV7A 3UXDA