3PJUA

Structure of pseudomonas fluorescence lapd eal domain complexed with c-di-gmp, p6522
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
249
structure length
249
Chain Sequence
QSLVADVGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Cyclic dimeric GMP binding protein
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 86
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjuA00
2W27A 4KIEA 3GG1A 4Y9NA 4ES4A 3U2EA 4FOJA 5MF5A 3HV9A 4RNJA 3N3TA 2BASA 3S83A 3PJTA 4HU3A 4LJ3A 3SY8A 4HJFA 3GFYA 4Y9MA 4J40A 4RNIA 4LYKA 3PJUA 4AG0A 4RNHA 3GG0A 4F48A 5MKGA 5MKGB 3PJWA 4FOKA 4Y8EA 4Y9PA 4AFYA 4Y9OA 3KZPA 4HU4A 4Q6JA 4RNFA 3PJXA 4F3HA 3HV8A 4FOUA 5M1TA 2R6OA 3GFZA 3PFMA 3GFXA 3TLQA
chains in the Genus database with same CATH superfamily
4OKDA 1UB3A 3FYYA 4FEZA 3G0UA 3WBWA 1UR8A 3T0CA 4ERIA 3VGDA 1Y7VA 2IQDA 2PDGA 1J79A 1C93A 2YCJA 3MV01 5DF0A 5CPQA 3AYSA 4C7GA 3S5OA 1NIUA 4C1NA 1YADA 1GT8A 5A8MA 3OLIA 2UY2A 3NTYA 3DHPA 3H2OA 3MWAA 1SM9A 1VF8A 5KEZA 3IAPA 1VENA 4ZQNA 1EGVA 3R0KA 1ZQ5A 4HU8A 5D09A 3WD3A 3W86A 3MJMA 3CZKA 1HGWA 2IKJA 4GFSA 3UPMA 3H4WA 3T2PA 5CEWA 1DJHA 3PJUA 3FDKA 3LGEA 3MDWA 4XD5A 4B3ZA 4FP1A 4XO7A 3VIIA 4EXBA 2W79A 1XLIA 3NURA 1H7OA 1RUSA 4QE4A 3TW6A 4LUTA 5IRPA 3CUHA 3LS9A 4GRSA 5K9XA 1XKYA 3GC5A 1Q6FA 1PTGA 4S3DA 4XWUA 3CQ0A 3B9AA 1DIEA 1UA3A 3E0IA 5EB8A 3LPGA 1EKOA 3H7RA 4GXPA 1Q6CA 1CCWB 1NM9A 4K2SA 3L12A 2ZIDA 3VVGA 3TYEA 2Y63A 3RO8A 3CASA 4IZGA 2J8FA 2V8ZA 3LXCA 2PDWA 3EX1A 2HBXA 4HSNA 3HBLA 2VZUA 3LCLA 3AO0A 3JRKA 3OQEA 2C0HA 1DWJM 1SMAA 1W5NA 4ZQCA 1I2OA 1UZHA 3W2JA 2XU2A 2JE8A 3H2MA 2GQ8A 2R94A 1JZ4A 4ORIA 4W86A 3A6OA 1UH3A 2PB1A 4LVDA 4UR8A 4EOUA 5AHEA 4UTWA 1FWIC 1ZJAA 4FMVA 3QPZA 5DO8A 2WAGA 2P8CA 4CCDA 2D3NA 3QM3A 3O0KA 2GSEA 3II1A 3ZM8A 3MJYA 1ZCOA 2WPBA 1UP0A 2E0PA 1FDZA 1WCGA 4LBRA 3PFMA 4HSHA 4B2DD 4WGXA 2ZRZA 5C9WA 2X1SA 1QRQA 4UTHA 2WC3A 3CNYA 1ADSA 2V5BA 3AXKA 2WK2A 1HN1A 1OABA 1O6IA 4EXAA 2WMIB 2YXXA 4UQDA 3QZ6A 3RF9A 4D6EA 3LXBA 1ZZMA 2HPMA 1E1FA 4F40A 4MWAD 1F2JA 3CUFA 4PUEA 4IIGA 2X1UA 8TIMA 3BDKA 1Y65A 3LXAA 1KFBA 3WH7A 4R27A 4AD0A 5FF0A 2DU2A 5D03A 4HU0A 1GG0A 4CCEA 5BU9A 3HPXA 5AZ0A 6TIMA 1TWZA 1Z9AA 3INPA 1RLDA 4HNNA 3WK0A 2G3FA 4MYXA 5E6YA 1EJ7L 3W7CA 4ZTXA 3G1DA 2EPKX 2F2KA 1CECA 3VD7A 3PN8A 2C1IA 4Q8NA 3AS1A 5AYXA 3RMJA 3LCHA 4LEQA 3VPLA 5JUVA 2WB5A 3E9AA 3KCLA 3N13A 1VBHA 3PPCA 1DORA 3R25A 4MGGA 2R14A 5FJRA 2B0MA 3TTQA 2INFA 4ZFMA 3CYVA 1XPGA 2XIMA 1XH0A 2DY3A 3WNLA 4DJFA 2A2IA 1F7BA 1TIWA 1F07A 5CSSA 4AD5A 3CUJA 4QTGA 2XYLA 2GQ9A 3SUTA 2Z6IA 4HOWA 1TTQA 3KWSA 3ZWSA 1XX1A 4HMEA 3FHQA 4LVFA 3NL2A 2A3EA 4ZTYA 2VFHA 2AGKA 4N9CA 1BXCA 1XC4A 1XD0A 5KSWA 4EX4A 2HZGA 2WYSA 2XINA 3NO3A 4X2PA 4OVXA 1RV8A 4WVXA 3SCPA 5BXPA 2VURA 3BXWA 4G8TA 4HK7A 3O05A 2CLPA 3DG6A 3FW6A 1ONWA 2DSVA 3PB0A 4RE3A 1YTEA 4D72A 3UVAA 2QVHA 1G7UA 4C6OA 3VOCA 5IBXC 4PTXA 1OD0A 1XLCA 3BQ6A 3LRMA 3ABOA 3VCCA 4XIAA 1DJWA 1TPWA 2BDQA 2PLJA 1YPFA 3W22A 3BLEA 5HMSA 1LROA 3E3HA 2X7WA 1GOOA 1A3XA 2V3FA 1XIFA 3W75A 1F6KA 3SW6A 4E2DA 2GWGA 3UJRA 4HHHA 1KCXA 2WJEA 3UR2A 1DHPA 3GLCA 3FN9A 4S3BA 2J7FA 4FIRA 1S39A 3RRAA 1RAKA 3CTLA 3N17A 1TO3A 2WPGA 4XTDA 3ZO9A 3NGFA 1WDWA 1XH2A 1V6XA 5AHIA 2YOCA 4ADSA 3IJ8A 2GZXA 1SU5A 3W76A 3ARWA 2VC7A 3VABA 3W2KA 1O1HA 5XIAA 1GZ1A 3MMTA 4HIBA 4DIAA 4JTIA 4L9ZA 2RH9A 3GNOA 1W1A1 1LUCA 5LNVA 3TU9A 2X0YA 2NXIA 4IIEA 2HNHA 2VC9A 1JAKA 3WMBA 2Z6JA 1W3TA 2Y85A 4L1WA 1KFJA 2V5CA 2FFIA 3V1HA 4QE1A 3O3RA 1SZRA 3P67A 3UG4A 3I4EA 1XYZA 3PBUA 4S3AA 4XD6A 2RKXA 4LAKA 3CAQA 3C2FA 5LA1A 1PIFA 5AC5A 5FSDC 3N2BA 4KBXA 2PUZA 1IXNA 3FEMA 2OZTA 3PTQA 3STEA 4GCAA 1J0ZA 3T0DA 1HF6A 3ZJKA 2ZQ0A 2DH2A 1IGSA 4I5UA 4Y96A 4CD7A 4W4QA 2OYKA 3DESA 4ACZB 1M68A 1OGBA 5HUPA 1VCGA 3B8TA 1OZQA 4YHGA 1W8GA 3VFLA 2YIHA 4C6NA 2ICSA 3GNDA 2EAWA 3T1GA 1QNRA 5DCEA 1YXCA 1YNYA 2VKZG 3Q65A 1POJA 4O50A 3WLRA 3UWQA 4RZBA 2FZDA 7ENLA 2J62A 5H1WA 8CGTA 4G1NA 1G67A 3CWOX 2OGYA 4US5D 1X7FA 2Q71A 1WPCA 5I5RA 4RKAA 3W70A 2QW5A 1QPKA 1TPVA 5A1AA 1WKFA 4CQAA 4IMAA 1P6BA 1R3YA 4IL2A 3CUZA 5AHLA 3LBMA 2CLFA 1V6WA 3GC2A 3TVAA 2ZBTA 3MBFA 3IWPA 4JQ4A 1L2QA 1R47A 3DHDA 3M0HA 3OBKA 3TN3A 3DFTA 5HMDA 3ANYA 4LNYA 3EOSA 2ZOXA 3MDUA 1X38A 1UHVA 2ZRYA 1V3HA 1ZFJA 3WMCA 3GC4A 4O11A 5CZJA 5I23A 2A5HA 3MI6A 2HEJA 2OGJA 3G1RA 3W1AA 2WZTA 3LPPA 3VI2A 1KBJA 3MBDA 1V3JA 5HR6A 4AUBA 3LHVA 2WHLA 2J9XA 1BXBA 4KFOA 5HANA 1WOAA 3UPWA 3LRLA 3PZMA 1UP3A 3CO8A 5DMYA 3ABRA 1JCTA 4KETA 4OU1A 5AC6A 2X16A 4Y9PA 1M03A 3DERA 3T05A 3LSCA 3LB0A 3G1XA 4GLEA 4GVIA 4JL2A 4K37A 2NWSA 3W72A 3HJZA 3OLGA 3I3EA 4YCPA 3WH5A 5HQEA 1UPPA 2QVNA 3EOEA 4X22A 3IJIA 1MQRA 3E0LA 3ZVIA 2P3EA 4S3JA 1UD2A 5HBFA 3W2MA 1PPIA 2VX4A 4NQ1A 4AISA 3AISA 2OVLA 1JI1A 3V35A 1YNQA 4BQ4A 4Q4PA 3QOMA 3CQJA 3B9EA 2QHAA 5TQLA 5HNNA 3N18A 5HJLA 3KS5A 4A3HA 3VZZA 4MY1A 4WRHA 2CETA 4O19A 3EEGA 2GGHA 4B3LA 3SQSA 4U3AA 1I0BA 5I3JA 3W6YA 1S2CA 4PFHA 5A6JA 2WSRA 3BVJA 3W83A 5I3KA 4NXKA 2ACQA 4D6CA 2YPIA 1XP3A 3CWNA 7ODCA 4MKSA 4HQVA 4MWAC 1ZNNA 4OUIA 2AL1A 4LAUA 1H5VA 3V5FA 2F7FA 3NR0A 5BOEA 1JXJA 3JVAA 3QH2A 4KQNA 1KCZA 5BOFA 2Y0FA 3MHUA 1X7IA 3L23A 3O6CA 3KLLA 5U4NA 1ODUA 2PBOA 4TV5A 4QJ4B 1UWIA 1SQ7A 1TJRA 2WO5A 1L8PA 4H9YA 4RW5A 3HQ1A 1LP6A 3LSBA 3UZ5A 3CB8A 4GIEA 1ZPTA 3AIQA 2PP0A 3EB2A 3T0AA 5REQB 1A5CA 3KUMA 3W88A 5HUOA 1TFVA 3APYA 3N14A 4EPBC 4YWSA 1NQ6A 4DAIA 3I65A 4C7FA 2ZC1A 4K38A 1LQ0A 1GZGA 4JN7A 4OTKA 4HPNA 3HA1A 3E2QA 3FJNA 3HIJA 4ENLA 4ERGA 3RLVA 2WCSA 1RD6A 4C7DA 4BHYA 1EF2A 2OQLA 2PTDA 3ISIX 4WK9A 4WUIA 4L65A 2WOQA 4MY9A 2CBVA 2V3GA 1EYEA 4BKNA 3W23A 2W91A 3GDBA 1HX0A 4ICNA 4FNPA 2J75A 4AYSA 2HROA 1ZB5A 4LRTA 2E09A 2B7NA 1DP0A 4HOXA 4NAFA 3ARXA 4JDYA 3OLEA 4NSBA 1R30A 2HPIA 1U1JA 2PP3A 5A8GA 3MUAA 3G3DA 3VX1A 4JS3A 1LQAA 5J8LA 2DORA 2WANA 3OQ8A 3VFCA 1PKLA 4DJDA 2VRJA 1FWGC 3NQMA 4B3KA 3F4DA 1HL8A 4WJXA 4NL1A 4KFPA 3E2VA 1DXEA 4MB1A 1E9YB 1XM3A 4WGHA 4KH2A 1TKKA 4HT3A 3LV5A 3OBEA 2A3AA 1ZJIA 3DXIA 3RLGA 2PDLA 3RCMA 1C8XA 4AAJA 3EBVA 4FS9A 4FLRA 4GQQA 4FOJA 5KMYA 2VFIA 2AMXA 4GC3A 1C92A 5A8QA 5K7JA 4Q22A 4EK7A 1TPB1 4F3HA 3SURA 5A69A 3NO1A 4GO9A 2R1NA 4IGSA 3LTPA 4HNOA 3GRIA 4HTBA 2GJXB 4UC5A 3GTXA 4S38A 1UP2A 5KTLA 2H3BA 4GJJA 3N19B 1E51A 2CLIA 3TV8A 1J0IA 1TWIA 3V16A 1XIMA 4HPXA 4G6CA 2IXUA 1TJ1A 3TN6A 2WXDM 4GO8A 2IS7A 6TAAA 3FDGA 4LY8A 2OQYA 1OCQA 4V1XA 4XUGA 1JF5A 2I14A 4HMDA 1CGTA 3QC3A 3SN0A 3OHMB 5CJ5A 2RFGA 3M5VA 2YKKA 7TIMA 3TYBA 2VUYA 2F6XA 2FZ9A 2BODX 2NVDA 3N2CA 3RAOA 1UWUA 2W63A 1Q65A 4I7UA 1XQLA 3V5OA 3U4AA 3VO0A 4HHPA 1JRBA 3QW3A 1GJUA 2E68A 3UD6A 4KCWA 4PB4A 4YTTA 2E28A 3UJFA 1OM0A 1WDPA 3EWWA 3W7OA 4BWLC 1IZKA 3G0XA 1FTXA 2DJLA 3H22A 2VWTA 2TPSA 4DUWA 5KITA 1RHCA 2PA6A 3DAQA 4FI4A 3QC0A 1XLMA 3GR8A 4AWSA 1MNZA 2V63A 3QF0A 1AG1O 2YCKX 1A5OC 4Q8QA 2J7HA 3GBDA 2GFTA 1A5AA 4MLRA 4IUOA 5CKSA 1G4TA 3WL1A 2X2GA 3AYVA 3GG1A 2ZX7A 3O06A 2PDHA 2AGTA 5M03A 2CWXA 3LY0A 2NX3A 5HXMA 1GZJA 4IG2B 2BHUA 2FZBA 1NOUA 2XVPA 3OGVA 4U5KA 4KWUA 2CW6A 5EFDA 3MCMA 2BG5A 4ONVA 3LENA 4UTFA 5G4HC 3KOXA 1QFEA 4IL0A 3MYPA 1Q3NA 4GVGA 1GTHA 1J4EA 4HU4A 4I9MA 1I1XA 3W1NA 4MZ8A 4R53A 3KCOA 5L9FA 4JBRA 4GYPA 3IVSA 3W24A 3RPMA 1E15A 2XFFA 2Y4SA 2OZ3A 4DNMA 2VYOA 4EANA 4U31A 4CD6A 1SO4A 4N6FA 1C9WA 1K9DA 4MF4A 4CNPA 4V33A 3GZ3A 3S1UA 3UJEA 1H49A 3HQPA 2GOKA 4AZ5A 1VGAA 1DOSA 1SVDA 2BVYA 4YVPA 1O5KA 3N04A 4HJFA 4M24A 3VIKA 1T40A 5DCBA 2YA0A 4Q6JA 3FSTA 2HE8A 2F6UA 4L61A 1E70M 1DJNA 5CAKA 1VIZA 4AH7A 1BG9A 4NZCA 2PE4A 2YBUA 1MMFA 1NWUA 1W1ZA 4U4MA 3WLTA 4AZ6A 2C8NA 1TREA 1VFMA 2OZ0A 3TYZA 3UZWA 2KZHA 4RUBA 1A0DA 1B0IA 1SUXA 4L6OA 2BOEX 3WSUA 4HMCA 1OFQA 2G5WA 1CYGA 2ZVRA 1O66A 2VFGA 3O07A 2BHZA 1OGSA 1JULA 2J7GA 5A3HA 3BO9A 3TA6A 3QMSA 4H01A 4IFKB 4IH3A 4Y9AA 2G3MA 2EO7A 3M7SA 2EG6A 3GTNA 3IIXA 3TAOA 1RZMA 1DVJA 2UV8G 4DB7A 5F2IA 2GSJA 3VIJA 4F2TA 1E55A 1G1YA 1EDQA 4JNZA 4YVVA 4OFCA 4DX3A 1TV7A 1JZ5A 1DKWA 1YHTA 4Z08A 1VFOA 3TDFA 3VINA 5CC3A 4Y8EA 3G1VA 8XIAA 2A4AA 4IMDA 4JKKA 2Z1XA 3W7LA 3UNTA 4HVXA 3AS0A 8A3HA 1NP0A 2WV8A 5CZSA 4GOAA 1MRAA 1ONEA 2WBKA 4US6A 3VIOA 1A80A 3A3HA 1KV8A 4LSBA 5FF7A 2C13A 4AEEA 3RR4A 1FA2A 4MDOA 3AHTA 2D2GA 1ADDA 3A3WA 3GYEA 1XCXA 3WQPA 3DIPA 1QXLA 2VRQA 4JPGA 2VR5A 3AYTA 3Q2DA 2GJNA 4S3FA 2IKIA 4F8XA 3A5VA 3IIVA 3W53A 4JHMA 5A6BD 1IR2A 2DP3A 3SZ8A 1N8IA 2ZZ7A 3NGJA 4ZA0A 3C8FA 4HYWA 1GVQA 2OX4A 4UTWC 2MNRA 1ZAJA 5GNYA 2D2OA 2E6AA 3LX9A 4QQUA 5C7HA 2D23A 1V7AA 3HOJA 4PMZA 3JR2A 1FBAA 3S5ZA 4TTUA 1C3FA 4NASA 2OO6A 3QMTA 1UPMB 4WXZA 4NX0A 3DU0A 1UR2A 1GYMA 2KAUC 1JR1A 1TJPA 4QJ3B 3VMNA 4Y6GA 1V5XA 2VR2A 3FIGA 3G5EA 1XBZA 5EYWA 4S3GA 3P80A 2ZXAA 3H24A 3MPGA 2REQA 3F4VA 5LGZA 2E9BA 1O5QA 1AW2A 2VD9A 3WF2A 3K8KA 3S6DA 2G41A 4E2BA 5G4WA 1HVXA 2QF7A 4ATLA 1ADOA 4WD0A 5MF5A 1JYNA 5CLWA 2RUSA 2I9EA 5D05A 1R38A 1EF3A 1W6TA 1QDSA 3M0XA 4K3ZA 3VM5A 2PTWA 4DYKA 3RPDA 1QPOA 1MEIA 1TV3A 3LD5A 4MDPA 4N7QA 2A3LA 1R3WA 3SO7A 4K7VA 4DN1A 2EPOA 4O8RA 3CZGA 4P8VA 1R7OA 1Z32X 4J3VA 2PWFA 1A5LC 3E1F1 4AHQA 4H9XA 4KIEA 2X09A 2FMOA 3VD3A 1DQUA 4DZIA 5C9ZA 1GVEA 4C6BA 3TJ4A 3OGRA 3F2DA 5CBIA 1MFVA 3N2MA 5ENLA 4EKJA 2IUZA 4W5ZA 2G3IA 1K7XA 1W3LA 1TR9A 2PDBA 4JFVA 4DO4A 2OQHA 3FK4A 3PFRA 2VOMA 4DJFC 1K8XA 4KGJA 3FVDA 3UGVA 4NG3A 1K9TA 1AJZA 3ZR4A 4RJEA 1PSCA 4PGLA 3CV1A 1POKA 4H7ZA 3WDPP 1XSIA 3C5QA 1B3WA 3M16A 3FJ6A 2FPTA 1XYMA 2E1WA 1I0DA 1IF2A 1JYVA 1REQA 4F0RA 1E1CA 2TMDA 4WQ6A 4HNVA 3CL8A 2G0WA 2YX0A 4ATDA 4PCTA 3N34A 1KBBA 2I5QA 2QJGA 3DHFA 5C2GA 1QNVA 4PUMA 4Y8FA 1Q45A 1S2UA 3LCFA 2I5IA 4L80A 3SCWA 1XYBA 1EJWC 2EF9A 2PF8A 1PL9A 1KM3A 1XINA 1JQVA 1XLAA 3GTHA 4J3TA 4JCLA 5FCZA 3R94A 2QF8A 5C5YA 2PU1A 3IJ9A 4UB9A 3LHTA 3ZS4A 3PK7A 3K4DA 2MUCA 3ITTA 3F5JA 1HO1A 1HP5A 3T40A 4GA8A 3AALA 3QW4B 4URIA 4XKYA 2D20A 4M6UA 3PR2A 4D6IA 3OVGA 2XFWA 3SGGA 1HTIA 3PS7A 3WH6A 4IJCA 4GQRA 4GY0A 4NVTA 3IJQA 3GG0A 4K8GA 1XJBA 4HNUA 3P74A 4ICCX 3A4XA 3W7JA 1X6LA 5M1TA 1KBIA 3VD9A 1H41A 3OB8A 3WZ0E 1E9LA 3EX2A 4M56A 1RVKA 4J7RA 4WY0B 4OV4A 4A3UA 2GSHA 5DXYA 4CQCA 4ZB0A 4LC6A 1QPQA 3MCNA 3M0KA 1JDFA 3W85A 1LORA 4LX4A 4U28A 4AW7A 4AVNA 2QDEA 3TNBA 1TYGA 1W56A 2P50A 1YX1A 2INZA 2E4TA 1W91A 3C86A 1XYLA 2QCEA 1GKPA 2RGMA 4FSAA 5JH1A 1WBJA 4NZ3A 5EMUA 4GGHA 2VM8A 4WF7A 4GBUA 2QCDA 4FA3A 2QUNA 2AQVA 1TRDA 4NNAA 4U33A 1P7TB 5FKYA 2PD9A 2Q3OA 1S5MA 1PHWA 3XINA 1WQ5A 4MPKA 4KESA 4MWAB 4BF7A 4BF9A 3AMGA 5AECA 4LUSA 1EO5A 2YL6A 4JIHA 1GKQA 4O54A 4QHRA 1NJJA 1PZ3A 2OWXA 2JEQA 3FJ4A 5EKYA 5H91A 1W2VA 2X40A 4WDUA 3G2GA 3BW2A 2V67A 3AWOA 4ORMA 5T9BG 2NUWA 3UYCA 5TAOA 4XK2A 3T4WA 3MKCA 1M53A 4K6AA 3TONA 2QPUA 4IX2A 2PAJA 3H23A 2ZICA 3AIEA 3UA4A 4Y9MA 3RGTA 3WQ6A 5H8MA 3GWQA 5HPCA 2VNCA 2Z2UA 4W7UA 1BRLA 2BLEA 1K8CA 3EKZA 2DPEA 1MUCA 3NPWA 4M6PA 4JR5A 3WDHA 2UZ9A 3AHVA 2V68A 2ZCGA 1CW2A 4ZODA 3BAJA 5FJPA 4JFTA 3QPEA 3C52A 1MW3A 1CLVA 3NQCA 2ABAA 4Y9OA 5D9MA 4DBDA 1O5RA 2HK1A 3E2SA 2H6RA 4WOZA 3ZR5A 2V2HA 1JCMP 3CTTA 3VKDA 1ITCA 1TVLA 1VZWA 3B4UA 1HL2A 2QJIA 1F3XA 1H50A 3OLDA 4PUKA 3RM4A 2QIWA 1KFKA 2GOUA 3W1PA 3GVGA 4QX4A 3TMQA 2AQOA 1O4UA 2PURA 2NSXA 2YCLA 3TQPA 1ITUA 3H2NA 5DELA 1B3OA 2XH2A 4GHRA 4DLMA 1P43A 3EKLA 3BL3A 3W29A 5CZTA 4LF1A 4E5TA 1F6YA 2GYIA 3CIXA 1YDOA 2J7DA 2AKZA 1YBQA 5BZAA 1BTMA 3ITLA 4U3CA 2DZSA 1PDYA 1UR4A 1M7XA 1ZUAX 4GIYA 4ZE4A 1KLZA 3PG8A 4GH1A 2Y8UA 4U10A 5FJTA 4PUUA 1IEQA 2Z1SA 5FL1A 4P7OA 2C91A 5BWFA 3KOYA 4KERA 3HN3A 1NELA 2Z7GA 2NQ5A 1DYSA 4GABA 1FDYA 1OINA 2FZ8A 1HT6A 5G1MA 1OQFA 3HG3A 5D37A 1W9XA 1GOWA 4CU6A 3H8AA 1A3HA 1E4NA 1Y8BA 5C54A 4EVZA 3H26A 3HGSA 4AY8A 1ISWA 3LUTA 4RV3A 5G4EA 3WDIA 3B0UX 4MMWA 2WQPA 3CWHA 4FO4A 3TQVA 4AQLA 2PDYA 3VGFA 1ONRA 1V7YA 1H1NA 3N9RA 4GBDA 1K1DA 2PDNA 3U57A 1FP8A 1J10A 2TSYA 4D6HA 4E3VA 3GX9A 4TIMA 1JRCA 4GY1A 5HJXA 2A21A 4AX7A 1WE5A 2ALDA 3M44A 3CUIA 4MJZA 4X61A 3BLDA 4RE0A 1EWEA 3GY1A 3QEZA 1FFQA 1OYCA 4LCQA 3OIHA 5C71A 1RR2A 3PBYA 2E25A 1H51A 1US3A 2ZUTA 4IFRA 3L67A 4FK9A 1JCLA 2CIPA 2V69A 3IIOA 1MEHA 3EA2A 4QG8A 1CGWA 3THCA 3BLPX 3P60A 1ZBKA 2QQ6A 3U6WA 4IGMA 2QR6A 1G0CA 3CK5A 4P2VA 3WUBA 1KTNA 4AY1A 5F1VA 1MQPA 5DEZA 4DBUA 2RDWA 3CEUA 4J3SA 1XRTA 2WSPA 3TSMA 2WNWA 3CXOA 4NIRA 4IQJA 4OGZA 3LA4A 3FV9A 5AVNA 4A2SA 3BQ5A 3MZNA 4JAWA 1A5BA 4HJWA 4B92A 1XLKA 3OEXA 2DSWA 2FTPA 4I8YA 2JKEA 4NRRA 3BE7A 2FKPA 4NAEB 2YL5A 4PMXA 2ZFAA 4F48A 3FAWA 2NXHA 1FWFC 2Y88A 1RH9A 3CZJA 4MUPA 2PRLA 1W3JA 3E96A 4HA1A 3T55A 3WEZA 1KLYA 5BXTA 3G6LA 4Z0JA 4UMCA 1G01A 1VJIA 5D32A 1E9IA 3H7UA 1DXFA 4HK6A 4J3ZA 3KS6A 1DE6A 1UIOA 1VEOA 2E6YA 4RDWA 3PUEA 3MMWA 1C90A 2JK2A 2FPYA 2GK1B 2F38A 2PCQA 5I3IA 1R2SA 5AFDA 1NDWA 2Q02A 4XTIA 4CU7A 2ATMA 1I1WA 4UR9A 2ZWYA 4WIWA 3L4XA 4RX0A 3STCA 2XGZA 4L56A 5F7UA 1N82A 5BCAA 3USBA 5ABGA 4UIOA 4ZOAA 3M0ZA 2J13A 2ZUUA 1E0TA 1VLWA 3NEVA 3G1AA 3DZ1A 4RXGA 3WLNA 1AL8A 4KT2A 1Y5XA 1H62A 3TIMA 3DYMA 5ABEA 3TJXA 4H8HA 3H7VA 1GVIA 4I9JA 1H4PA 1RBAA 4JEQA 3QTGA 4PTWA 5FACA 3IPWA 1W1IE 1Z3NA 3E0FA 4BEQA 4W87A 3REQB 1I8JA 2VWSA 3T78A 3S5NA 3UWZA 2XVKA 4RE2A 3CM4A 1NEYA 4QEEA 1CTNA 4GI8A 3W73A 4HZMA 3GH7A 1MUWA 2ALRA 3AXXA 2WVUA 3ZQ9A 2WJFA 2VFEA 4ZQOA 4UCGA 3QXBA 1XLBA 1OIMA 1UWAA 3DKLA 3NPVA 1UUOA 4LB3A 4HB7A 2WVVB 1NWRA 1U33A 2QNEA 4O17A 1FWDC 3UXLA 4ALDA 5CPMA 1TPC1 3W1MA 4C1NB 1YMYA 2EKGA 4G7FA 4RPPA 4KIRA 3GG8A 4N02A 1ZP3A 4XZIA 5CG7A 3AZSA 3TC7A 5MKGB 5F2GA 4CGTA 4N9EA 3AS3A 4MSSA 1XIDA 2YBTA 1U30A 3PZTA 2PU0A 2PTXA 3P6LA 1FKWA 3EMZA 4H8VA 2VDIA 1XISA 1TV4A 2XH7A 1FWWA 1TWSA 1YDYA 1GYLA 4FHAA 3D5HA 2ZX6A 4J1OA 5FI8A 4EXQA 3TN5A 1EBHA 3IK4A 2JIWA 1XIHA 3HPZA 3APGA 3GFZA 1PXGA 1E3XA 4JNYA 5CGTA 2WJDA 3PNUA 4Z1YA 1EQCA 1ZJHA 3Q45A 4D2JA 2GUYA 4DXKA 4GQGA 3ITYA 3M0MA 1WYIA 2VEIA 1DE5A 3GNPA 5AB3A 1OK4A 2XDFA 1XI3A 1A0EA 3ANVA 4GMEA 3UR8A 1C7SA 7PTDA 4UFLA 1LYXA 5FJIA 4JYEA 1BTCA 3O6AA 4I9AA 3H54A 3W74A 1WDSA 3H2AA 3NL5A 2DZTA 5FF3A 5LNRA 3PAOA 2PDKA 3GIPA 4H83A 4YLWA 3UR7A 2QJHA 1D2KA 1Q4NX 3QR0A 4QS5A 2XIQA 3AOFA 3VDBA 1VBRA 3W1XA 3AXIA 1J6PA 2FDMA 1D7KA 1FH9A 2HMCA 1U83A 4H9MA 4MLJA 3BW3A 1ITQA 3QGVA 4DYEA 4AD1A 2G4FA 3IIPA 3LLXA 3SCTA 4M8UA 4G1KA 4A3RA 2XFRA 4Z2HA 3CUGA 4XBSA 4AG0A 1Q8AA 4ASTA 1V8EA 5LIYX 1X97A 4I7WA 1OEPA 3G6MA 3TLLA 1XLGA 1IXOA 5BNKA 1PE1A 4UMBA 3DFQA 5BXRA 1O68A 2WVSA 3NQDA 4D6DA 5HULA 4A3QA 1B1YA 4O1CA 3MSGA 5FF4A 3CAKA 1TVNA 3GH4A 4EPDC 3K8LA 4OQVA 4AEFA 4S23A 3UG5A 1U5JA 1OWQA 3VCNA 2FB2A 1B3XA 2XPKA 4OBTA 5IFTA 1HGYA 3ALFA 3TYUA 2V81A 1YPIA 4WSKA 3VOJA 4HZ7A 2Z27A 4GYPC 3UWWA 3ARYA 1LOLA 1RBOB 4YTRA 2HSAA 4YYFA 4IJBA 5HMFA 1DXIA 3SGZA 1K7FA 3W4RA 1GQLA 2NUYA 3CIWA 1XC6A 1OBAA 3TC3A 1UD6A 3QY8A 3RITA 4AXNA 2ONEA 4ROQA 4TXEA 3GXTA 2V3EA 2ZDSA 2FTYA 4JX5A 3L7RA 3AXHA 1LL4A 3S83A 3ALGA 5EY5A 3TQ0A 1U1HA 5FJUA 3GE7A 2RHGA 1J01A 3AMDA 1HJWA 3N2OA 3ARZA 3E0VA 3F4NA 4X9YA 4BCEA 1R3RA 3AU6A 3RCYA 4KWWA 4MPQA 1KKRA 5BMWA 3HMJG 4B5NA 3FOKA 4GWEA 2ZZ2A 4P8UA 4HCLA 4WKAA 5BXSA 2Z1VA 2GVLA 5E0CA 1JUBA 3OW1A 5HATA 1QT1A 1WXJA 3FKKA 1ECQA 5FAGA 1R85A 3DFOA 1A53A 4PMDA 4E8CA 1U5HA 1V93A 2Y7EA 2IPGA 1OFDA 4M19A 2ACSA 2LLEA 5DRIA 1FRBA 3C3UA 1EHAA 4GX8A 4NILA 1UD8A 1WZLA 2DT1A 4S2CA 3B3DA 1JPMA 4J27A 2BXZA 2WW5A 3GVVA 4GD0A 3UCCA 4XB3A 1VAHA 4E2OA 3BG9A 1VIWA 1CGYA 4JCMA 9CGTA 1Z42A 1B3VA 3C2EA 3HU7A 2D2JA 2X2YA 4S39A 1DWHM 3CT7A 4PEEA 4AZ7A 3C2RA 3BMXA 3OYZA 1VB9A 3OYXA 2Z00A 3IARA 4ZXOA 1GQKA 1FCQA 1LLOA 2WJZA 3H55A 3CB3A 3S2CA 2BY3A 2H8XA 1H7RA 4HHLA 4PMYA 1AH0A 4H2CA 4D8AA 1VP5A 4L6HA 1AH4A 1JUEA 2CLKA 3BK0A 1S3TC 5GNXA 1BD0A 2F6KA 2Q6ZA 2VJXA 2YFOA 6REQA 2YCIX 3MI3A 4R9OA 3AMLA 3IJDA 1SPQA 1TE1A 3RX4A 2CEQA 1JZ2A 2ZUWA 3LM7A 3DHUA 3TZFA 1VCVA 3ABXA 1XUUA 4LJ3A 2ZC8A 1LOQA 4GIAA 1DTUA 2J6XA 1A47A 4FIQA 2UWFA 2NUXA 2QPSA 2GDQA 1T41A 3VNKA 2PLMA 3I10A 2OG9A 5HK4A 3W07A 3BUVA 2ZUMA 4GGBA 3ZR6A 2DZPA 1ONXA 2RJHA 2NVAA 1UBSA 3CT2A 5I79A 4Z17A 3W1QA 3SRHA 1YKWA 2D73A 3NQFA 3WLJA 1ZJBA 3KL5A 4AYGA 1Z6KA 1S2VA 4J5NA 1ZGDA 1B2YA 3GW3A 1ENUA 1Q2RA 4QSHA 1OYAA 1CPUA 3R1ZA 1JZ6A 3B8VA 3L4WA 4JQ3A 4J35A 4RNFA 5EBUA 5HQMA 5D2TA 1AMYA 1Q6GA 1AK5A 1H0GA 3ABSA 3WUFA 1ZTVA 1F4AA 1Q7ZA 1XDJA 4JIIX 4EE9A 4TX6A 2BGQA 1XBYA 5LIKX 3TTOA 4B90A 3GIQA 4FF7A 1EJTC 4IISA 5DY2A 1RA0A 5C70A 3SUVA 1AW1A 1PCWA 2R24A 5CZ0A 5FF2A 1W37A 2OYMA 3TW7A 4A4AA 1GK8A 4Y9NA 3N25A 3C61A 3A4JA 2BV9A 3FY1A 3VKAA 3BGJA 2J8TA 6XIAA 2D1ZA 1YEYA 1YYAA 3CPUA 1EEXA 2DZUA 4FLQA 1UZDA 4H6QA 2NQ9A 2J27A 2OKOA 2E6FA 3K13A 1WO2A 2FJKA 3GG7A 3UU0A 1R46A 3IVUA 1E0XA 5DX7A 4QGCA 4E8GA 1CGUA 1VFHA 1O12A 3E12A 3SIZA 3B0YA 1JZ8A 3NOYA 2WZIA 1GVFA 3BLIA 1X1OA 3TP4A 1ZBCA 4E3TA 4UWMA 5C2XA 2CHRA 5M3WA 3PAJA 1PX8A 5D2VA 1W3NA 2BVWA 3VM7A 2QKFA 1DWAM 2B4GA 4YL2A 3HFYA 1M65A 1GWJA 1TIMA 4RNJA 4AIUA 3IV3A 5CAHA 3BJSA 3QYSA 4NJJA 4CQ9A 3D47A 3WD0A 4AZBA 5KZDA 1R3SA 4LYKA 3HMCA 4XQ6A 4GUHA 3KZPA 3A4AA 3FKRA 1OF6A 5I3FA 3K30A 3SB0A 1OFOA 4LOCA 1RCXB 3QR1A 2J25A 2OOFA 3U2CA 3FS2A 3V7PA 4LAOA 1TZ7A 1GHSA 2XIJA 1FDJA 1G69A 2DT0A 2DZWA 1Q6RA 2YW3A 2QDDA 4K39A 3DFHA 2WM1A 4AWTA 4C6CA 1W1B1 3DDMA 4Q8UA 3B8IA 4M81A 2YFNA 4YTQA 2HJPA 2XWEA 3SCVA 4PRTA 4H9VA 4XUYA 3QV7A 3M0YA 4GI4A 2EKCA 3PZ9A 1FXPA 3GDTA 3QHNA 3BLLA 4S3EA 5D9OA 3P5YA 1G7VA 3N15A 2FDSA 3TW9A 3S1VA 1GQNA 5T8GA 4BF5A 2P3ZA 4BEUA 1OCBA 2DVTA 3RLHA 2DZXA 3SFKA 2DSKA 3BPWA 5DMMA 6XIMA 1E6ZA 4ZOCA 4B5SA 1BSLA 2XUCA 3ANUA 1LWIA 3WBYA 4CU8A 2PLCA 2I17A 2A1YA 4BA0A 5RUBA 3ONCA 2DGAA 5EFFA 3LGGA 1UMYA 2PWEA 1MDLA 1VH7A 3W9ZA 4DI8A 3R6IA 1GHRA 1D9EA 3PTMA 3WIJA 4J4KA 2VHLA 3VGHA 2W5FA 5DN1A 1PJ9A 4H7VA 2W62A 4JIEA 4IWWA 5C7VA 3TX9A 3N4EA 4X0NA 2NLIA 1HIZA 1XG4A 4NZJA 3C0QA 4K1GA 3S5YA 4N0RA 3W7QA 2E9MA 5EMLA 1B54A 3QYQA 2J66A 3W81A 2FLIA 1GW9A 1SW7A 2VCCA 4CLMA 1EUNA 5IM51 4GNKB 3MY9A 1UD5A 8XIMA 1XLDA 3E02A 1SFSA 4Q7IA 1EX5A 3FX4A 2FPVA 3UNDA 5LIXX 1VEPA 1TTIA 3AHZA 4CN4A 7CGTA 5H8PA 1XUZA 1F61A 2OLAA 1WZMA 1ZBVA 3QSTA 1HKWA 3DUGA 1R8LA 3KRZA 5CPTA 1AD1A 4JTHA 1BYAA 4P5UA 3C3NA 2ZZ5A 4FOKA 4G56A 1OFEA 4EP8C 1GTEA 4GNVA 3LI0A 5HA7A 1Z8AA 2XJ7A 4HCHA 3V18A 4TVDA 3G1HA 1C9DA 2FHFA 4R5EA 3B40A 4N42A 3U5YA 3L2LA 4JTAA 4LV9A 4V15A 3SRDA 3VDAA 4CNUA 4TUFA 1K9EA 1UUQA 2G8ZA 1PKYA 3QV9A 1QI2A 3K5XA 1FHDA 2DW7A 2EG7A 3WELA 1HL9A 1ELSA 4IP7A 1RY0A 5I2UA 3PSWA 3GH5A 3DFSA 1S2WA 4XAZA 1BF6A 3C4UA 3S4TA 2VEMA 5DCDA 3PANA 3ZSSA 3V0UA 1JZ7A 1SJDA 2DFAA 3RU6A 2FJUB 3LMZA 4QDWA 1IT8A 2XVLA 4NAFB 3PZNA 1ZLPA 4TMBA 2VO5A 1PIIA 1YTDA 1ME7A 4ZO8A 3NQAA 1P6CA 5CSYA 2QT3A 3WBEA 3EX4A 3NM3A 1XSKA 4JY9A 3WQOA 3DOPA 2BXVA 3UWVA 4FXJA 1QK2A 1F3EA 1S3HA 4L9YA 3B0PA 2IPJA 4AD3A 2WNZA 2YJQA 4R7JA 1HJVA 3A47A 1U1UA 4IFOA 2VVNA 2F84A 2FGLA 3CC1A 1RCOB 4FNTA 2QPXA 2FQIA 3B03A 1E6QM 3U7BA 1FWCC 2V38A 4IOTA 2WZEA 5GQBA 4PRWA 3B8DA 1WZAA 4Q4MA 1S1RA 3PZGA 3UPBA 4HPJA 2QLYA 4JTTA 1E71M 2O9OA 2CLMA 4RDZA 4OBRA 2NV9A 3WENA 3BG3A 5BRPA 1FCVA 5LA2A 2Y6ZA 3IUIA 3RFAA 2QCNA 1M1BA 3SQMA 1ICQA 3WLKX 5CBJA 3VKCA 4K1WA 3T08A 1F9CA 1UQYA 4XSLA 4DBWA 5ABFA 1Q13A 4PEKA 3O16A 2ABBA 1AQFA 4UQCA 4B9ZA 2OEJA 3U8GA 2JKAA 1VFUA 1JPKA 4F9JA 1TPEA 2PSNA 4QDMA 2ZWZA 4A8NA 2ZYFA 2V2DA 2Z24A 1JDCA 1PUDA 5CBBA 1CI1A 3DI1A 2NLYA 1HZYA 3RJXA 3PZQA 4KGLA 3P82A 4FF5A 3IGXA 4CVWA 3GQYA 2BGNE 3H4XA 4E4PA 4JOMA 3RLUA 1LG1A 3GZAA 2PDIA 2BY1A 1J0HA 5LNSA 3OGSA 4BI5A 5LHEA 4GJ1A 2NSOA 4FR6A 3OODA 1JCNA 1WX0A 2B7QA 3OOQA 4BI6A 4L1GA 4DQWA 1QO2A 2R8WA 3AWNA 5C9RA 3O0FA 3MP3A 4UTIA 3ELFA 3M6DA 1UROA 1UKOA 3NDYA 3O9NA 3WBAA 3RILA 3KTXA 1RK5A 4CQDA 4DVOA 2CKRA 3V1PA 1FKXA 1Q2SA 3EOLA 3M47A 1J93A 3BZGA 1KM2A 5I3DA 2J78A 1X1ZA 3WJXA 4OHQA 1ZS2A 1OC5A 1TTPA 2VVSA 3SR7A 4IXHA 3BAIA 1JDAA 4C6JA 1AFSA 3C0SA 1AQ0A 5KZMA 5CGQA 2D0GA 1IT0A 4POCA 1XSJA 3OG2A 2JALA 4DJEA 3R11A 4FXRA 4C60A 3S6OA 4ZBCA 5LHFA 2ZZ4A 3CV6A 4N2YA 2VOTA 3WG6A 3EDEA 4PTVA 1UMLA 4BJHA 4ZOBA 3ZOAA 1A4MA 2SFPA 1P5BA 2CBJA 1GVSA 1BWLA 4IG2A 2HV5A 3WK3A 4W7WA 4PZVA 3MW7A 3RN6A 3R4IA 4FXSA 3DI0A 4AZCA 3P8IA 2CBUA 1JGMA 1IIGA 1KFLA 2J88A 1RALA 2DVUA 3T07A 1HKJA 3SCSA 4RNHA 2JEPA 4WCJA 5D2WA 3P14A 1VC4A 3CAVA 5IDIA 3PPGA 3SECA 4KRZA 4S2BA 1UJQA 1XIEA 4H8UA 4DWSD 1CT5A 3RCNA 2DUZA 4NJGA 1BG4A 3RJYA 1UH2A 3OA5A 3LCXA 2O56A 4H6RA 3E5BA 3FYOA 4HNLA 3SRKA 4EPEC 4NU7A 2Z25A 4IPJA 2IMRA 4NJIA 1MW2A 3ARVA 1EA9C 3HM7A 4Q7BA 2FZMA 3UG8A 1NDYA 1E6NA 2BY2A 3ZMRA 1R3VA 1WKYA 5J04A 5E9AA 1ZSXA 3EX6A 3KWXA 4W85A 4LS1A 4LQ1A 1KQYA 1VHCA 2O0TA 1LBMA 2G97A 1ISZA 1EL3A 4PCNA 2Y8KA 1MXGA 2QZRA 3F5KA 3L4TA 5TD4A 3DYPA 3IRDA 4B5VA 4G7EA 4YHEA 3L21A 4O1EA 1KRCC 2PDCA 1IWAA 2YBVA 3BAXA 1EXPA 1YDNA 4ATWA 2GUBA 1BQGA 1LRNA 2W92A 1ZBWA 1VBGA 2PI6A 4PBEA 1U22A 1KGWA 2ZVIA 3QHMA 4Q4OA 2OT0A 1B57A 3I7SA 5CZKA 1H1YA 4MZ1A 3FHAA 3AICA 1LQ2A 2CITA 2V82A 2YB4A 4IIFA 3OA3A 4Z0SA 3RUBL 3VILA 3LRKA 1GORA 4QNEA 1W0MA 4MFEA 5K3VA 4D1IA 4QSFA 3N2TA 4QRNA 3LHZA 3W7NA 5HAOA 5IBXA 5I06A 3IUHA 3SN4A 1QAPA 1NTHA 1R3TA 4R7OA 3GHTA 1EOMA 2O55A 1V3MA 4RZ5A 4FNRA 3G1YA 4O0QA 3QHOA 4JTDA 1B9BA 2X42A 2BX7A 1PEZA 4PE8A 1UKQA 3EXTA 2R1KA 2V0TA 5I3HA 1PDZA 1T5AA 1R9ZA 4DRSA 4C5ZA 4GK8A 1YE6A 5HOSA 4YMZA 3VIGA 1ZU8A 3PPFA 3F4CA 1US2A 4GI6A 3CQKA 3URAA 1FWJC 4FX7A 4IT1A 4LB4A 3BV4A 4LUIA 3QVQA 4XO6A 1MI3A 1LTDA 4FOUA 4YTUA 1JZ3A 2CESA 3MP4A 4F2BA 2XFYA 4H19A 3HV9A 1TPFA 1JAEA 3HFTA 3SIMA 4CD8A 3E6EA 3FGCB 1DJXA 3S2NA 3M5ZA 2OB3A 1PX3A 3GW0A 3VXGA 2ZTKA 2REQB 4N9BA 3M07A 3DC0A 2XM1A 4I6KA 2QUMA 2VEGA 2WZMA 4C6FA 5M5DA 5E09A 4C6KA 1BXNA 4UQEA 2BB0A 1F4HA 4R7WA 2J9YA 4E2VA 1E0WA 4PSPA 3LYEA 1V3KA 1M9HA 1Z69A 1Q66A 4PTNA 1P0DA 3C0JA 3UW6A 4LNCA 3N2XA 2V6AA 4P7LA 4HP5A 4OWGA 5A8PA 3U4FA 2PGRA 4I90A 4F0LA 4M0XA 3DEQA 4O12A 4WR3A 1XGZA 7XIMA 1XF0A 2W61A 7REQA 3IJ6A 5FEZA 3KBJA 2IPFA 5D8ZA 5K4ZA 5CC5A 1IXPA 5C6MA 1XRSA 3A21A 3ARRA 1VHNA 3IGHX 3ID7A 2OSYA 3LZ5A 4JQ2A 4B15A 1JD7A 2Y5EA 2WMJA 1PKNA 2ZZ3A 3G22A 2AL2A 2E5DA 1TX0A 3T6CA 3C8NA 1RSCA 4M7SA 3O7UA 3BC9A 1ISVA 2NVCA 4P8WA 3KVJA 4NI8A 4JTLA 1VKFA 5DBUA 4PA8A 4LVGA 2ZADA 4TOQA 3E38A 4NI3A 1BKHA 3ZIZA 1BGGA 1VQTA 3W2UA 2WC7A 3B8WA 3SEPA 1XQKA 3UYIA 1XCWA 2R1LA 3TJIA 3EWCA 3UESA 3MV11 3UVIA 5JQ9A 4MB4A 1REQB 1E1CB 2PDFA 3PZUA 3ENLA 1Q6EA 2UY4A 3VC6A 1JNEA 1XCFA 4PUDA 3GKFA 4O4WA 2YLLA 4CNOA 5HQLA 4Q32A 2X1TA 4NJKA 1RLCL 1I45A 3LNMA 3LHYA 3SFWA 4QROA 1PIGA 2WLZA 4B5XA 3AS2A 4K7YA 4F9DA 4LV4A 3P61A 5I78A 3BARA 3TFCA 2RDTA 2C18A 4B5UA 1SJAA 4IXXA 2YDAA 3MI2A 4PL1A 1NOWA 1UOKA 3M6YA 3ZLGA 2AKMA 1IEVA 4XD3A 4TV6A 4XKYB 4GE8A 4DEFA 1TELA 5JBEA 3NWRA 3GBEA 3GM8A 3SN1A 1WUEA 1RJPA 1AJ0A 3WF3A 3NSXA 5FEXA 1E3ZA 4C6LA 5K2ZA 2VRKA 1BYBA 3DFPA 3WD1A 1JPHA 4AMAA 4XG1A 4MM1A 3QQ1A 2YYUA 1JDDA 1XRFA 4YJ5A 4D8ZA 3F2CA 2HS8A 1V3IA 3B9NA 3NFUA 2PGFA 5E6ZA 1LWJA 1A50A 1QVBA 3HJEA 4M6QA 4OOUA 4PFMA 4XAFA 1UBPC 3M0VA 1K4HA 3STFA 2IXVA 3RDKA 3IRSA 3WBXA 1UZ4A 3KHDA 3R7MA 1LL6A 3U3HA 3VCRA 4B2DA 2QCDB 4LC8A 4LU0A 1NARA 1TCMA 2A7PA 3MVTA 1J12A 1B5TA 3EPMA 1JGIA 3EX3A 2GVEA 1DJYA 3JW7A 4AVFA 1PKMA 3GUGA 4LUSB 3PHAA 3CEPA 4Z1DA 3VNDA 2FZNA 2QCLA 1KM1A 2VDGA 4RXFA 3W6MA 1GOQA 5D02A 2CFFA 1P7TA 1JI2A 3B06A 3WF0A 1VFSA 2CBIA 4MWAA 3GXDA 1OX6A 1QCWA 3IACA 3BCJA 3LCIA 4EAMA 1X1NA 3W71A 4Q8TA 4KEUA 2A3HA 2JKPA 1EB3A 4GUJA 2G3JA 1QOQA 4GZ7A 4DWSC 3NVTA 4LFYA 4IMGA 3VZYA 1W8SA 4EWND 1TZ9A 1EHNA 3IV8A 3NIYA 4XSMA 1TX2A 4YPJA 3LNPA 1BRLB 4JTJA 1Z41A 3T9PA 4NJHA 2DH3A 4ZQRA 4C91A 2CLOA 2QAFA 3IJLA 1KXQA 2ZKMX 2VCAA 3Q58A 4IPLA 4AEOA 3WEOA 2ZXQA 4AD2A 4JIRA 2IPWA 2JGYA 4LBSA 2IW0A 4W5UA 1RPXA 3V0SA 1QNOA 1GGOA 3GFYA 3AMKA 3GTIA 4O1DA 3G1SA 3GU1A 2PDJA 2XGBA 1WOBA 4IUGA 5TNVA 1UQZA 2HXTA 4KS0A 4YCOA 2YCLB 1R9YA 4Y90A 1EP2A 3TR2A 2VQTA 1CDGA 1P0KA 1OSEA 4CCCA 2WHJA 4H04A 3QGKC 1NDVA 1S38A 1W5OA 1OFAA 3CH0A 1BLIA 1D3GA 3UZXA 2QDGA 5TIMA 5JXQA 1V6VA 4QLKA 3NNTA 3RMEA 1SYTA 1XYFA 4LCSA 4A6GA 2PC8A 3C2OA 3FEQA 4UFHA 2VFDA 4ZOEA 4ZB5A 1YBQB 1YRRA 3JZUA 2QCGA 2YZRA 1CLKA 1BGAA 3VUSA 1J18A 1BVNP 3KE0A 4UOJA 5BMXA 3DYOA 2E7FA 3MWCA 1Q6QA 3AIUA 4IMFA 1H0IA 4QCEA 2OKTA 4O1AA 1SGJA 4UQ9A 5FEPA 3W82A 4A22A 3PUDA 2A7NA 3P5ZA 2XSXA 4IIHA 3WY1A 4UNIA 3K4WA 1W1PA 1EZ2A 3MUZ1 4PBGA 1N7KA 1G4PA 5M17A 3VOHA 4OIFA 1E6RA 3UETA 4HMNA 3CU2A 4L1XA 1UJPA 5CXPA 1HUVA 2OFJA 5DT7A 4XV0A 3VKBA 4AC7C 4RLIA 2BBFA 2Y7FA 2C1GA 1SZNA 3CZLA 1KWKA 3B0XA 5LNWA 3E49A 4FPSA 1NWTA 4GH3A 3I6TA 2VZSA 2ZRWA 4FNQA 5I24A 5F2LA 4DJFD 1DQWA 2OEMA 3AIWA 5I7GA 3W7RA 3PJWA 3PZOA 1XKJA 4G2DA 5H2ZA 1H11A 3R58A 4UUIA 3BURA 1JVNA 4UTLA 4H9UA 3WK2A 4JTCA 4PCSA 4IQEA 3ERPA 1OK6A 3B8SA 3TFXA 2ZTJA 2G95A 4UXDA 1AMKA 1UD4A 3L5MA 5A6TC 2PLKA 4QLJA 4QEHA 3KM8A 4BQ5A 1HXJA 1W9PA 4KCVA 1UKPA 1EPXA 4O53A 4MJ4A 5JMUA 3ABZA 1G5AA 1SFLA 4QG6A 4V2XA 3W37A 3DH7A 1V0LA 1C8VA 3JZEA 3ME3A 3E74A 5BW6A 2FVMA 3SJ3A 5BU6A 3ZYZA 3KBSA 5EMJA 1EA0A 3TYCA 5DT5A 1C7TA 1JF6A 5AY7A 3WEMA 4NZ5A 2DUAA 2ODOA 1EP1A 4RV8A 5A2AA 1ALDA 3ZT7A 5JU6A 1BYDA 3WQ5A 1P1XA 4I3GA 3HV8A 1E6SM 1AJ2A 1EDGA 1X39A 4BY3A 2D3LA 4O14A 3WDRA 4Q4KA 1KWGA 2FGBA 4W8AA 4NAEA 4O15A 3S1XA 1UCWA 2INEA 4Q7NA 1EH9A 2O9RA 1NDZA 1TUXA 5D8WA 3EA1A 3I4KA 1OYBA 4YU1A 2WQDA 1TWWA 3UXAA 3CV2A 3BCDA 1E9ZB 1W3IA 1D8CA 1WDRA 4MY8A 2QGHA 3GXFA 3I7QA 4HNTA 3S9IA 2Q8XA 4DELA 1L2UA 4CEUC 2OELA 1KW1A 4US5A 1ZL1A 3AUOA 3CL6A 1MSSA 4UQAA 1WA3A 3M43A 4U2ZA 1RPKA 1EGZA 3NEHA 3WDQA 4AWUA 4QBXA 2RDXA 4AVOA 3TH6A 1UWQA 1OFBA 4YWIA 2YDSA 3GXMA 3I3BA 2YDQA 3M5XA 2BHYA 3COTA 4YIWA 1WDQA 3HG4A 5T9CE 3TCEA 1RP9A 3LM3A 4PMOA 3EA3A 3FFSA 3S3GA 1KGXA 1OFPA 3PM6A 1SJCA 3MKKA 2OSXA 5A6KA 2Y61A 2W27A 4ES4A 4GKLA 4FZIA 1Q7MA 4GJIA 1EEPA 3JS3A 2YA2A 3NDZA 4OUEA 3LG3A 1KTCA 4XIMA 3BMWA 1M01A 2GGJA 3KL3A 3HQNA 2WNQA 5FEWA 3N4AA 2QV5A 1M41A 3HGRA 1QBAA 1JD9A 2QDHA 3C2VA 4IPIA 4NZ1A 1KR1A 2UY3A 5TBOA 1YE4A 3GVRA 3MTWA 3I6RA 4DBEA 3LN3A 4REQA 5HMEA 3GSMA 1KQZA 1ESWA 3NXFA 4UR7A 3WKZA 5CG0A 2Y7DA 1DIKA 3W27A 3LOTA 5CC6A 4MUZA 4GZEA 4Z1CA 2O9PA 3PG9A 3TKFA 4X3ZA 2QUVA 4JXCA 4GZJA 3PVFA 2HVMA 4ECLA 4PUNA 1AL7A 4PMQA 2PWHA 2AAMA 1W5PA 4B5TA 1B9ZA 1SSGA 1TPUA 3WLPA 4O10A 2D22A 2WKGA 2GL5A 1K70A 1AA1B 3GDMA 2WVVA 2DIKA 1DWFM 2Y1HA 4CQ8A 3DCPA 2DT3A 2Z1KA 4IICA 1FX6A 3ITVA 3GU2A 3W0KA 1SW3A 2W0UA 1KRMA 3KP0A 4I8DA 3SY8A 5I03A 5MKGA 6ENLA 3QV8A 1GPWA 2PPGA 3AXMA 1UIPA 1CGVA 2V2CA 4QIUA 4E38A 2X30A 1U5VA 1XFBA 3VIMA 4HCDA 1W1TA 3QRHA 2XN1A 3P0XA 4R88A 4AC1X 2FH8A 4IP4A 2A79A 4KRTA 4JFSA 3JU2A 5CPLA 1Y5WA 2Z4GA 3UT0A 2NZLA 4MWAE 1PVNA 3EWYA 2XGIA 1TA3A 4ML9A 1EBGA 5HWMA 2A6LA 4QG9A 2PD5A 1C8YA 1XS2A 3UWYA 3EEZA 4E4UA 4E0CA 4KRUA 3HGJA 4TO8A 2A85A 4PYSA 3K8MA 4HPHA 3WQEA 4ML4A 1XYAA 1CXIA 2PRHA 3RR1A 2R1MA 5GJNA 4FNUA 4ZVJA 3MYOA 3RNDA 4LH8A 2C14A 5G2HA 1LT8A 1QI3A 4C90A 1QNPA 1F3WA 1Z7AA 4JTRA 2W67A 4H4IA 4JQAA 4WKHA 3I6EA 4QLLA 3AAMA 4QP0A 4L4MA 2X41A 1DBTA 2GUUA 1PO9A 1M7PA 3LGDA 4TX9A 1P4CA 2HVNA 4DYJA 3NQEA 1TMLA 4UNLA 2X8RA 2NX1A 4DJEC 4S3CA 3RM8A 2YR1A 4PSRA 3MUY1 3VNLA 4GYFA 1AZ1A 1RA5A 5DRCA 3EWUA 3SSZA 2QCMA 1CX9A 2HE5A 2WSKA 5HINA 1Q4WA 3EMCA 4FLOA 5I02A 5U7SA 1DJQA 4KWOA 2E40A 3N6HA 3BW4A 1YQ2A 3T2QA 4K8EA 4GQBA 2QJMA 2PWDA 2DVXA 1GOMA 2Q09A 1MVYA 4O4VA 2YXOA 2OX1A 5D4YA 3IAQA 1AH3A 2GVJA 4Z2IA 5EMYA 4RDVA 3EDDA 5KZEA 1IWPA 1ISXA 1TMHA 4ZO9A 7A3HA 3KP1A 3M0IA 3K1GA 2QUUA 2VC5A 2Z0IA 3PJXA 1I60A 5K9CA 3BAWA 3CQHA 3SUWA 2GGEA 1JDEA 5AYZA 3W2LA 1VS1A 1FHLA 3GTFA 4GG9A 3HGOA 3GR7A 3PPHA 1D3HA 3Q94A 4PTMA 4L9XA 2P10A 2WSQA 4H7CA 3BANA 4NX5A 1MWOA 2HBVA 2XSAA 5HWJA 1J8VA 1AW5A 3F1QA 3A5FA 3LMYA 3GO2A 3A12A 3IUDA 3WJSA 3ZT5A 2OR2A 3GDKA 5XINA 2OZ8A 4PBFA 3RX2A 1L6SA 5EGRA 3R5EA 1MEWA 2QULA 1DWGM 5GNZA 3S2LA 3BLFA 3UWUA 4ADTA 4ZSTA 3LK6A 4DZHA 3M41A 1TQJA 3WQDA 4DZ5A 1GW1A 3URNA 3EWBX 1EDTA 2OPJA 2WMGA 2ZA3A 9XIAA 2A3CA 5HDRA 4A8RA 3L4UA 3RXZA 4A35A 2EPNA 3VKJA 3GIYA 1J0KA 2J6VA 2PGWA 5GVJA 4CVUA 1FWHC 3A22A 2YLAA 4J2MA 2YZ5A 1LBFA 2ISSA 5FL0A 1V79A 3ZLHA 1F74A 5JVLA 2WZHA 3NJ3A 3ONBA 4ADUA 2P1FA 3MANA 4KW2A 1OADA 1FFRA 2A6NA 2QJNA 2E1DA 3M5YA 3ZJ8A 1DEDA 3Q67A 4CN1A 4LYPA 5FAJA 4A8LA 1IZCA 3PB2A 1QPRA 3G8EA 3BMVA 4WDWA 4DJDD 5ECUA 3VDGA 4WDTA 4F4RA 2CHOA 2L5HA 2DQWA 3EWDA 1LBLA 3E0WA 1YNPA 4H00A 5D33A 4HGXA 2D2HA 5I09A 3KXQA 4V28A 1L8NA 4ZE5A 2P8BA 2BP1A 3S1WA 1GG1A 1P0NA 5T26A 2PGEA 2CPUA 2VEKA 1G94A 6REQB 1JCXA 4AZGA 2ANUA 3BLKA 1GUVA 5HNTA 3AZRA 3ARUA 4H9ZA 3VZXA 3LHWA 1QI0A 1GJWA 2XVNA 4GUFA 4GNJA 1WP6A 1HKKA 3XISA 1QNQA 2CNCA 2PDQA 3THQA 3LI1A 3M7WA 1FWSA 4KWSA 3MUCA 1ZP4A 2JQXA 5CJNA 4Z1AA 5AYIA 1CXLA 3CGTA 2FB3A 2QEZA 1O7AA 1F5ZA 2WKLA 1JL8A 2YYTA 1H60A 1XDMA 1DL3A 3QMRA 2YA1A 2YL8A 1V3LA 3SI9A 4K8HA 3TXZA 2H8ZA 1MW0A 5F4SA 2ZZ6A 3DBPA 3WH9A 1G4SA 3L4VA 2OU4A 2WMHA 3WF1A 3NPXA 3W7GA 4TQTA 3SCOA 3UJSA 3WJWA 4JNMA 1KB3A 3CPRA 2D0FA 4N4QA 5C0QA 1HW6A 2ZX9A 1EC9A 2VGFA 1ICPA 3CLMA 4DWSB 1XYCA 3UP8A 4L7ZA 1TMQA 4GINA 3SGUA 2VUNA 3L9CA 1UR9A 3GYCA 3S1GA 3V36A 5AHMA 3B04A 1ISYA 1UZ1A 1GJPA 3MHGA 4MVAA 1PZ0A 3CHDA 3UWEA 4YN5A 2J79A 2XIBA 3LTSA 1NFBA 4CEXC 4Q8WA 1E0VA 3L0NA 1RQHA 2GPTA 2RDUA 3MVIA 3H12A 5B7YA 3R8RA 3IS4A 1GPFA 3BAYA 2VZTA 2WWCA 1HVQA 1YPXA 1TV8A 3N4FA 3MA8A 1C91A 3EOUA 2G3NA 3B9OA 3FCPA 5LIWX 3KTSA 1O94A 3NOEA 5CJMA 4BK9A 4X60A 3W6LA 1GOKA 4Z2LA 1VEMA 1EO7A 4XVEA 3THUA 5E9XA 3W1TA 4JN6A 3UG3A 5E1QA 2Q8ZA 3VTRA 1SR0A 2VTFA 4M7TA 4KEZA 4ZL1A 3CS2A 1BKSA 1AZ2A 2OXNA 4OBSA 4QJ5B 3K2GA 5A8OA 1IHIA 3QOKA 4BI7A 4B9YA 1FWBC 1K77A 2OSWA 1LJYA 4MNMA 3ZLFA 4ZXLA 2PC4A 4JEJA 3T8LA 3KOWA 1B3YA 3UEQA 2CCRA 1PWLA 1EC7A 2XN0A 3DGRA 3O6DA 2X1RA 3LQGA 1S46A 4V27A 1DHKA 1NF0A 1FUYA 1OVDA 1RBLA 3T81A 3CHCA 3OU8A 1VPXA 4XAGA 4GACA 1UKTA 3HPAA 1KXVA 1S5TA 3NYDA 2X1IA 3QPYA 4DF0A 1B30A 4K36A 2R91A 3ATZA 3AHYA 3NSMA 1L6YA 3I7RA 3VGGA 2FVKA 2Y89A 4S3KA 3NSNA 1MXSA 4TMCA 3TR9A 4C6EA 2J9ZA 3W7DA 4J3XA 3R0DA 4M51A 5IHSA 1VD6A 3ITGA 3EZ4A 3WD2A 3GDLA 2CZFA 1TVPA 5EPDA 4JY8A 3NL3A 3FA3A 4W8BA 4R9XA 1OT2A 3LLDA 3NM1A 4DPQA 4IJRA 4P7RA 1P1MA 4LF2A 5I3GA 3HPSA 1O5XA 1W5MA 3RO6A 3D0CA 3ZVHA 5JIPA 4HK5A 1F6PA 2DW6A 3T7VA 2PEVA 2EJ1A 3TWAA 5ECVA 1JIBA 4I5RA 1OD8A 1M3UA 5A6BA 4R34A 2E67A 1HKIA 4DM1A 5AYBA 5CSUA 2WMFA 3TYAA 2DDXA 3T42A 3M1ZA 4LRSA 2PBGA 4GI9A 2H9AA 1EOKA 2OCZA 3HO8A 3TXVA 5FESA 3EB4A 5A95A 4NXSA 2FMNA 1H63A 5D30A 1YDVA 3RHGA 4QNWA 3G77A 1MRQA 2HQAA 1HJXA 1IEWA 4DWDA 1QW8A 3S5SA 1UC4A 4F0MA 5B7ZA 2FVLA 5A6LA 3GD6A 1I9CB 1MFUA 5E5CA 4LY4A 4M5PA 4Q8OA 1QK0A 3SCQA 3GXNA 4JTGA 2V5KA 2Y70A 1LWHA 1KXHA 3A9BA 3S9ZA 1X8CA 2E6DA 3B4YA 3TE9A 3VNMA 4JL1A 1D7FA 3H6OA 1ZY9A 1OT1A 3MS8A 5SWUA 1CB2A 4GFIA 5DQPA 4IPNB 4PCFA 3VOFA 4HD5A 2ON3A 3VE7A 2O4MA 3W7IA 2P88A 4YYCA 2I7GA 1OG0A 4O1FA 1XIIA 3VGBA 3GKAA 1Q5MA 5IOBA 2MANA 4LAZA 1SR9A 4HPGA 4D1JA 3QKEA 3VMOA 4AB4A 1PX4A 1XICA 2I57A 4QDPA 4X0VA 4AWEA 3R43A 1UC5A 1R5YA 1FCBA 3WQVA 4QAWA 2BOFX 1OG6A 1J2WA 4NZFA 1H09A 1KD0A 1OF8A 3WLIA 2HWGA 2XIIA 2PTZA 4GXMA 4C6DA 5DFAA 1Q6LA 3M9YA 4D6GA 3CLWA 2NQZA 1V02A 1L9WA 1UWTA 2VP8A 3MO4A 3H70A 3HPFA 4MZYA 4UNKA 2GDVA 1QU4A 4DY1A 2J74A 2V5DA 4PUJA 3WNOA 2BMBA 1BQCA 5HWNA 4MIMA 2AQWA 4KCUA 4QE5A 4ZQMA 3AJ7A 4AIOA 4AF0B 1M6JA 4X9SA 1EUAA 1QASA 3HQOA 1EQPA 3B05A 4IX0A 3QBUA 2GVGA 3SCRA 3TOYA 1IV8A 2DEPA 4Z2JA 4GCXA 1HJUA 3HG5A 1A3WA 3KFTA 2Z2AA 2CXGA 4PULA 4X2RA 5CSRA 5CCZA 1TQXA 4JDBA 1QO5A 2DJXA 3EPOA 2V30A 3WMSA 3VAVA 4EF8A 4U2YA 4DJDC 1PCKA 3J7HA 2OMAA 3SAZA 5C2CA 1D3CA 3UCQA 4B5WA 1XGDA 5D9PA 1XLHA 3STGA 1KGUA 1RQEA 3WLQA 3KZSA 3ES8A 1TV2A 2VZVA 4O13A 1E1EA 1MYRA 4LEFA 4BR1A 5AHNA 4JX6A 4JIQA 1QW9A 1Q8JA 1EZWA 3O6YX 2D69A 1OX4A 1VYRA 2BZNA 1Q63A 3UY7A 2CZEA 2FYMA 2XH0A 4UFIA 2QAPA 5MHBA 1UKSA 2QIIA 4UMAA 1NVMA 2ZZ1A 3FSUA 5ABFB 4DPPA 5TF0A 4L4PA 1KCLA 3G18A 4GVHA 1A5UA 3ZXWA 1KV5A 4Q8MA 2VX6A 3FA5A 4AMCA 4OOZA 4WJEA 4W9TA 1PYFA 3ARQA 4P8XA 4KWVA 3L0GA 3VDCA 5E0FA 2CC0A 1XIJA 1CGXA 1E6PA 3EOOA 4XAPA 2PDXA 3W01A 4JX4A 2CZVA 3UY8A 4UOZA 1R6WA 2PRMA 4W7VA 1DPMA 3N3TA 4DNHA 5E70A 1YW1A 4C6PA 2FTWA 4QXIA 4UBPC 3WF4A 1MUMA 5D04C 3W28A 4DUXA 1V6YA 2EG8A 1WAUA 3V5CA 4LUTB 3BSHA 2EBNA 1TB3A 5LXXA 1X8FA 1XGEA 1WUFA 1OHLA 1D8WA 1W9BM 3KRSA 3W25A 2E8YA 4HTYA 4I9TA 2KX9A 3NPUA 3TYDA 1GQIA 3MT1A 2W9MA 3N9SA 4ZMGA 4OECA 3G0SA 4NF7A 5CGMA 3KDOA 1IZJA 2C16A 1A49A 3TMLA 4F0SA 3WL0A 1EGMA 1UWRA 3KRBA 4IMEA 2CXEA 2I9UA 2ZRUA 2CWNA 1H7NA 4IGNA 2ZX8A 5D2YA 4N9DA 3W84A 1EJSC 2QUTA 1TG7A 2W66A 4NNCA 3TAKA 3EGJA 4MNKA 1B3ZA 4NYYA 4PR4A 3SSJA 4GUIA 1PV8A 2OWCA 1DJIA 5BYWA 2V5LA 3BG5A 3RPTA 3KVLA 4MADA 3CZ8A 3A23A 5HNUA 4M82A 4XAYA 1DJGA 2ZXBA 1XFCA 4RK8A 4Q6XA 1QWKA 2DZVA 4ZO6A 4BZYA 1T0OA 3VGEA 1EFZA 2Z28A 1OGGA 1MXDA 3DGBA 4CD4A 1CIUA 4AZCB 1AQHA 3TQKA 1TJ2A 4ZB2A 3WNPA 4K68A 1LF1A 4O28A 4D8LA 3ES7A 4O0KA 1GVOA 1ICSA 2CLLA 4RZ6A 3OIXA 3QTPA 2HTMA 4CCZA 2QCFA 1DV7A 2C3ZA 3KW3A 2WMIA 4XKMA 1V03A 3AI0A 3THAA 4AD4A 3O15A 3AZTA 2J47A 1E5JA 3PBMA 2BY0A 3A3XA 4MKVA 3LPFA 1RK6A 1WKDA 1OY0A 4UZSA 2P0OA 1DWIM 5G1TA 2PZ0A 1H5YA 3GR4A 1FQ0A 3PC0A 2QV4A 3V3WA 1HKMA 5BWAA 1GOXA 3C0LA 1EPVA 2B7OA 1CNVA 3LBOA 3QFWA 2NWRA 3W00A 1AQMA 3A4WA 3EKGA 3CHEA 2ISWA 1VJZA 3ZSTA 4J3WA 1RD5A 2BSLA 3LEPA 3T44A 4IIBA 3URQA 1CBGA 4G7EB 4L4LA 4JFUA 2Z7KA 1WXZA 1WNOA 3WFAA 3WJYA 3R8GA 3ZT6A 3IK2A 4EAYA 1GNXA 3TA9A 1IGWA 4PH6A 1FWNA 5EBAA 5G5IA 3AIRA 1NQKA 3S46A 4C6IA 3QV6A 5F2MA 3KAOA 4IGHA 1KKOA 2ISFA 2HDJA 3TUUA 1DQXA 3A24A 5J5RA 2PODA 3NZQA 2X7VA 4CD5A 1CXFA 3GHRA 1KM5A 5XIMA 3P7YA 4G9PA 2WNNA 5IXEA 1XLJA 1J5TA 3IEBA 3VA8A 3FXYA 3ABQA 4O8AA 4ZQPA 5FJJA 4TX8A 2O92A 3VE9A 3TTYA 1KRBC 3EDFA 3TSBA 4DLFA 3MO7A 4P7QA 3URBA 1ME8A 5AYYA 1IT7A 2E5CA 2NT0A 1FH7A 6PTDA 5D38A 4UZUA 1Z48A 3SCUA 5G2IA 3BOLA 2B31A 3LTYA 2Y5JA 4JGDA 3NZRA 2GGGA 3ARSA 1YXYA 3ATYA 3UFYA 3PBVA 2QCHA 4PC8A 1GVRA 4GXWA 4H1ZA 3T4CA 3WO8A 3I3DA 3S6TA 4F2UA 5GJMA 1AUSL 5I77A 2XN2A 3KBNA 2FHCA 4DF2A 3R8HA 4HNCA 1QI5A 5BOOA 2EGZA 1OC7A 1A5MC 1YIXA 1TPH1 3PY2A 3NZGA 3R79A 2ASHA 4HZ8A 3N1AA 1F3TA 3CMJA 1V0KA 4MAVA 1IIHA 1R2RA 3KLKA 1CXHA 3H2CA 3EMQA 5K9DA 1LRQA 1I2RA 3GVWA 2C1HA 4TVCA 3WLLA 4MB5A 4O0ZA 3DG7A 1GVYA 3WH8A 5C9UA 4KFNA 3HURA 4ICMA 5CPNA 3RRXA 2BVDA 3GAKA 1RCQA 1LUCB 1V02E 3MZ2A 3BSGA 3TTEA 1VPYA 4PTDA 2CKSA 2YSWA 4ILSA 3H2FA 1MQQA 2C15A 1FXQA 1CZ1A 4IP5A 3U48A 4S1FA 3MU7A 2NQHA 1Q85A 1K02A 3NA8A 5F1UA 1Y0EA 5FOOA 2ZA2A 3W7KA 3V4BA 3MSRA 3AYRA 3GXPA 1MDRA 4QM1A 3FGCA 4HA3A 2C19A 1UH4A 3PTKA 1ZHAA 3KTCA 3PP7A 4J28A 3RG6A 2CYGA 3ITCA 1AD4A 1P6WA 4R33A 4ACYA 4DO6A 2ADAA 2Z1BA 1S5VA 3T2OA 2XZ7A 1TE6A 4E4FA 3MMUA 4O16A 1QHPA 2WWDA 1NY1A 4JYFA 3L4YA 3M46A 2ZXDA 3N11A 1VBUA 4L4OA 7REQB 3LBCA 3WFZA 1K03A 1HJQA 3S42A 1FOBA 1JYXA 3B0VC 5F4XA 3WUGA 2ZUNA 1W5QA 2F2HA 2D0HA 2FH6A 1VYSX 1J6OA 5JBFA 2AL2B 3OP2A 5DANA 3L5AA 3S47A 3TZNA 3K4AA 2VD8A 4D6JA 1JG9A 4LVAA 4ACZA 3AU2A 3JUGA 3O63A 3RK8A 2I1OA 4I7VA 4XX6A 3W3OA 2PWUA 3EWXA 3L68A 5HPOA 2TAAA 3WUEA 4NT0A 5AHFA 1W1VA 4HN4A 4W93A 4D9PA 5IDZA 2IQTA 4N6EA 1JNDA 3EAUA 4LW7A 1P0BA 1N8WA 1A5KC 4TTGA 3CJPA 4GYKA 3C56A 1KFEA 4MTVA 3WYZA 1WKEA 3QY7A 4JKMA 4UTMA 4W84A 2E3ZA 1HO4A 4RW3A 3DBNA 5E0KA 3VU2A 1QHZA 1TSIA 4QJ1A 4IMCA 4WJ8A 3N3MA 3UXDA 2IKHA 3R89A 3QQWA 2WHKA 3U2EA 4P7NA 1JQXA 5ABHA 1H1ZA 2F8QA 3IIZA 3POCA 4XVDA 3NQBA 1IR1A 3CBWA 3QZEA 2A0NA 1J2BA 3NQGA 4NRSA 1UUMA 1AODA 4IM4A 4RDYA 1QPNA 3XIMA 2OO0A 1CEOA 2A7RA 2XIOA 4EPKA 2CERA 3WQCA 1N2VA 3AQUA 1FP9A 3UXKA 3BTNA 5C8BB 3B9DA 3KX6A 1E73M 4GYJA 1DIOA 1E72M 5KZ6A 1MW1A 1J11A 3Q37A 4A05A 2HCVA 4WY0F 1VFFA 5DLCA 3VNJA 1JJKA 1XWYA 3CV7A 3D3AA 3WDJA 1EIBA 1M5WA 4AIBA 3IJ7A 4DHGA 1QNSA 5JBDA 2TODA 3BAKA 2O4QA 3NQ6A 3OZMA 5FD0A 3VOGA 2QCCA 3W02A 3L65A 1SZGA 4INFA 5EMKA 1BAGA 2VCBA 2GGIA 4KCTA 3F5LA 1KM0A 2GVYA 1MO0A 3BLOA 2BS9A 3LV6A 1BEUA 2EHHA 4Y2WA 1QI4A 3P62A 3BGAA 1BSIA 3U2OA 1FWTA 3OBAA 4UTTA 3PZIA 4LS2A 2VDHA 4XISA 5HNRA 4P61A 5A6SA 2QGYA 1QOXA 3GNXA 4R85A 4Z2KA 1GQJA 3H21A 2DIEA 2VGGA 3W1UA 1XRVA 5LYRA 2VMFA 4F0HA 3L2IA 1BYCA 1ZCCA 3GNRA 2Z2BA 1L0PA 4IF2A 1HKVA 3K1DA 2GQAA 1TR1A 1V4YA 2X05A 3NYZA 1J5SA 3LLFA 3M4HA 2EQDA 4GX9A 5L6UA 2YDRA 3CO4A 1CENA 4AFYA 2P53A 4LWWA 3R10A 4PCPA 3M64A 1F8IA 3R0UA 4LXFA 3WCZA 3V75A 4AY7A 3POHA 1NH6A 1FWEC 4C6QA 1WZKA 4B4FA 2H3DA 6A3HA 1BHGA 3CQIA 3VMPA 2G4JA 4ZCWA 2I5GA 3CZEA 5D9NA 2DUXA 2C7FA 4LCRA 2XG9A 1W9UA 3HB9A 1LLWA 3N73A 2QMKA 5REQA 3KDNA 4PB3A 3H53A 3CPGA 3UBPC 2JF7A 2X0SA 3BWWA 4MJMA 3DX5A 1BFNA 2DIJA 2OYLA 3BZJA 2Y62A 1XG3A 4TVUA 3QLLA 4DM2A 2WLYA 3NUKA 2P0IA 1ECEA 1HG3A 3QFEA 3KOFA 4WDXA 3MSYA 4H6KA 3NCOA 1I2PA 2WVTA 1BF2A 3KHJA 1TTJA 4L5ZA 2VX5A 4C1LA 3BCFA 1K8ZA 2HXUA 2QMJA 1T8QA 5IFPA 5EU9A 1VR6A 3WD4A 1WXYA 5T91A 1R9XA 2BXYA 3LDVA 2ZX5A 3BV7A 1PB0A 3WQWA 4HA4A 2DZAA 2GJRA 1Z44A 1UD3A 3N6QA 4UTJA 1HNYA 1IEIA 3T8QA 2C71A 1LG2A 1RQBA 2V3DA 3GHUA 4IQDA 4A2RA 3F4WA 3TCSA 5FIPA 3QLDA 2PDMA 1WAWA 4GUGA 4EACA 2O7QA 4UOQA 1FWAC 1Q6OA 4LGXA 3S2MA 4CKQA 1SW0A 2GJLA 3TNOA 1W3HA 4JTSA 1UA7A 1LDCA 2R6OA 1W9VA 1GEQA 4E6MA 2HNEA 4ZSUA 2ZA1A 3W7MA 1TZZA 4JTQA 5A5WA 1GKRA 4HN8A 3SQLA 3QZAA 1EJRC 1VYPX 1TCDA 3MMDA 1ODZA 1BWVA 2B7PA 2FIQA 4LUYA 3OJGA 1OZMA 2QJJA 4WKFA 3EXSA 1T96A 4UTKA 3DECA 5LXEA 1PHQA 1W3KA 3KRUA 8RUCA 3CUXA 3FXGA 1I2NA 2E5BA 3VIPA 2H90A 1K6AA 2VEPA 3CMFA 1T6MA 1JFXA 4WZHA 1CB7B 3U5UA 3VKKA 1RP8A 1J9YA 4NHVA 2CZ5A 1F76A 2D24A 4UFJA 1H3GA 2OWWA 4LUJA 5BROA 1QUMA 2RAGA 3AMCA 3R12A 1TPDA 3NZ1A 5A6MA 4JHOA 1JFHA 1I2QA 4KMQA 2WCGA 2GJXA 3STPA 5DMLA 4I6VA 3EDJA 3IANA 4AU0A 1L6WA 4F0KA 3PBWA 1W31A 3ICJA 4OT7A 1SO5A 5CLTA 1DJZA 2VR4A 1RJRA 1A0CA 4CNTA 4W8LA 5EA9A 1US0A 2Z29A 4FB7A 1YTKA 3F03K 5DY3A 5FA5A 3WLOA 2YB1A 1KM6A 3PWIA 3W26A 3P81A 1V0MA 1UW9A 1H61A 4O1BA 3SJNA 4FLSA 3G3MA 3LCWA 1TUFA 1VFLA 1XV8A 2ZE3A 4NNBA 2VL4A 4NYUA 1N8FA 1Q6DA 3MCOA 4JTFA 2VI0A 3NL6A 4Q8PA 3VD5A 1YXDA 5AZ1A 3SRFA 3TK7A 4AIEA 3VIFA 4IPPA 3W7EA 4RE4A 2Q3RA 4EIVA 4JD4A 2XM2A 4OE7A 2BTMA 3I68A 1VBJA 1XLEA 2HRWA 5AKQA 1NOFA 1OIFA 3MP5A 3IVTA 5A2CA 1G9HA 1PAMA 3ITXA 4PRRA 3P84A 1FY6A 4JN8A 1G6CA 5K4XA 3G8RA 1QWGA 3P3BA 2WCAA 3MC5A 3DFNA 1BVZA 1QW7A 3NVDA 3WMLA 2DV0A 4GISA 3A13A 5C55A 4H9TA 2VFFA 3VNIA 5FSEC 1JYWA 1H7WA 5EMMA 1RVGA 4FX6M 4BQ3A 4M6VA 1WDDA 3HTWA 3N6JA 4Q3MA 2HS6A 3PBGA 2PFHA 4FAMA 4JYDA 1PWMA 2HISA 2Y2WA 3VDHA 3PUOA 1IWBA 2EEXA 1QATA 1XDLA 1R7AA 1XBVA 1T99A 3DKJA 3ARPA 3U0HA 3NQ7A 5DXXA 5A8NA 1NAL1 4YS1A 4TU1A 3WQ4A 4RNIA 1L6FA 3U2ZA 1CXKA 3O1NA 4A21A 2BWGA 4YTSA 1OC6A 1VLIA 3NQ2A 3FLUA 4YNGA 4OV9A 3MHFA 2NT1A 3GAYA 4NKCA 4YXGA 4DO7A 2G37A 3LQLA 3TROA 1NFGA 3SUUA 2ZUSA 4LS0A 3E5PA 1NU5A 3P2VA 2ACUA 2OTDA 3PWAA 4XZLX 3BSMA 1PYMA 3KCJA 4RPQA 3L2MA 1S1PA 2W4XA 1UR0A 1SJBA 4MKNA 3KL0A 1C8QA 5A94A 2XHYA 2NQLA 1XH1A 1W17A 1R87A 3SCNA 3AFBA 4DF1A 3LCGA 3CHVA 4HYRA 4REQB 1MZRA 3UJ2A 3MQTA 5CQ1A 1RXOB 3PNZA 3D46A 1TWDA 1VRDA 1K6WA 3ZJ7A 1UYQA 1J0JA 3AIVA 2DSUA 2VENA 1KFCA 4JQ1A 1GONA 1KO0A 4NZ4A 1LRTA 4ROPA 5C9XA 1JPDX 4MB3A 4PB5A 4HOZA 3A64A 3UGRA 3P0WA 4CNSA 3TEVA 1E4IA 1OB0A 4MHBA 3T09A 2E8ZA 3UCDA 1OFRA 4D71A 2CLHA 5GPRA 3BOXA 4WEVX 4DUVA 1NSJA 1UR1A 2QYGA 2F9RA 4CUCA 4LALA 3WLHA 1U2YA 4QCFA 1S2TA 6ALDA 3F7JA 4DO5A 3LERA 2EJAA 3ECQA 5CH9A 3OZPA 3SBFA 1H2JA 1PBGA 2GDUA 4C5YA 1A5NC 1K8YA 2PWVA 4GPNA 4H2HA 3CL7A 3VNYA 3F2BA 3KVKA 1LZOA 3FJLA 2BGSA 1W32A 4IFKA 2B81A 2FFCA 1V0NA 1RJQA 1VPQA 1TA3B 3W1LA 5A6AA 1W54A 3HF3A 2ZRXA 2F61A 2PTYA 6CGTA 4CN6A 2VZOA 3MKVA 1GEHA 4GZIA 3SADA 5AC8A 4W88A 3WX7A 5H8UA 4GC4A 3KBWA 3WNNA 1B31A 2Z1WA 1JCYA 1T8XA 2PDUA 4B4HA 3M0LA 3UZZA 1HQTA 4PODA 2Y5SA 4UQBA 4KF1A 4QFUA 1PTDA 2OLSA 2WSYA 2C6QA 1VFTA 4Z42C 4WSJA 4DUOA 3AUJA 4PMVA 1IQ8A 5A2BA 2P76A 1I4NA 4FALA 1FVPA 4A8IA 4DXVA 4WHBA 3NZPA 4H6EA 3RIKA 3QGAC 5KINA 1Q7QA 1FH8A 1EJUC 1H7XA 4HA0A 1EWDA 1EJVC 2VC6A 3NXLA 2R1PA 2A3BA 4M29A 3L4ZA 4LPCA 4WOQA 3R13A 1UOZA 3B8UA 4ZENA 2EXOA 5JIWA 2OOGA 1KRAC 3OO2A 5EL1A 3BJFA 3KEHA 1ZRQA 2E77A 3YPIA 1R2TA 2BVTA 2CZDA 2VGIA 1ZENA 3BH4A 1A5SA 2XH4A 3LPOA 3MB9A 2NV2A 3U7VA 1X6NA 4M1BA 2AOSA 1PS9A 3QR3A 3THDA 4KEVA 4MJ2A 1IEXA 4MG4A 4DZAA 1FHUA 4PMJA 3L66A 3DG3A 3OVPA 1HFBA 1M7OA 3OTRA 2Y7GA 2GLKA 4QITA 3CH9A 4GY7A 1SZFA 1H7PA 1O95A 1VJSA 2XWDA 2YXGA 4G5DA 4UTUA 4AZHA 1KA9F 2VEFA 2NXGA 2PP1A 2J8GA 1QBBA 2JIEA 5PTDA 3TTSA 5H6HA 5LKYA 4RZ4A 3GB6A 2J77A 4XZBA 4PMNA 2J4GA 1BWKA 2J7CA 4C65A 3KBMA 1HP4A 4V1YA 5AN7A 3TOPA 5G1YA 4L64A 1KC7A 2BNJA 5DMNA 2GQ3A 1ITXA 2JF6A 4XZHA 3OVQA 4HKPA 1DTNA 1LCOA 4DI9A 2CU0A 4WXYA 2PDPA 3R2GA 3S2JA 4Q4SA 3PSVA 1XHGA 2OT1A 1A4LA 2DSZA 1EC8A 1FHVA 1PZ2A 3UERA 3G24A 1XIGA 2Z26A 1WB0A 2DZBA 1SO3A 2XSBA 2NQJA 4O57A 5E93A 4HU3A 2R9RA 1GYNA 5D2XA 1Z89A 1E4LA 1QTWA 3NG3A 2I56A 1UG6A 3UR5A 5M2FX 3O2LA 3USZA 1QHOA 3FNDA 2RGLA 4E8DA 3DFYA 4FX8A 3NQVA 2YCEA 3VX0A 4Y7EA 2FHBA 1LLZA 2TRSA 2OEKA 1GOIA 1PTAA 3AJXA 1E43A 3MUIA 4IQLA 4NY2A 3T0TA 1CLXA 2V9DA 1SZEA 5I6SA 1P48A 3EXRA 4ERAA 3QY6A 1OCJA 4I5XA 3VUPA 1FCUA 2PZNA 2JFEX 5I00A 3U9IA 4UFKA 3SDOA 4TR9A 4HHMA 5JH2A 3WLMA 1TJ0A 1V6TA 3OPSA 4UFMA 1M04A 3W2NA 4Q4RA 3GNNA 1XLLA 3PF3A 4M80A 3UQNA 1IE7C 4BFAA 3DC8A 1HJSA 2YGYA 3FAXA 4XBJA 4MYAA 1XR2A 4AZIA 4LANA 1JCJA 1SMDA 2DT2A 1UR3M 1VCFA 2ACRA 1KR0A 3EWZA 3CMGA 4PL2A 4W89A 2Q8LA 1G4EA 4C1KA 1R0MA 3T0BA 4J9JA 3A9IA 2IQ0A