3WJXA

Wild-type orotidine 5'-monophosphate decarboxylase from m. thermoautotrophicus complexed with 6-amino-ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 85
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wjxA00
4WY0B 5G4WA 1J5TA 3A24A 3E12A 4WX2A 2H90A 2BX7A 4AF0A 4JICA 4ZZ9A 3O6DA 2ZZ3A 2W79A 1KFKA 1TPVA 4IMFA 4GUGA 1P5BA 1W5NA 4UIOA 2E5BA 3LTYA 3TU9A 3L67A 1UJPA 2A0NA 3W7IA 1U83A 1B57A 4UNLA 2F84A 1FBAA 1OX4B 5CZ0A 3DKLA 3V75A 4ZVJA 3MP5A 4KWWA 4GFSA 4MFDA 5T26A 4IX0A 4P2VA 3W86A 3GDMA 1LTDA 3HOJA 3WK1A 3OVRA 2ZRYA 3TFCA 4QQ3A 4XKYB 2ZZ2A 1KV8A 4LUIA 4O52A 3S42A 1GVFA 2VOMA 3PBUA 4HNTA 2FTPA 3B0UX 3MHGA 4LT9A 1RPXA 3DFNA 5HR7A 1OX6A 4MZ8A 1MZHA 1EX5A 3TQKA 4O54A 3NPWA 2Y7GA 1P0NA 3H55A 1MEIA 5CSRA 4WZHA 1NAL1 3C3NA 3B0VC 1A5SA 2VFEA 4EWND 2V2DA 1H7WA 1VHNA 1W1ZA 3LRLA 4MZ1A 1TPFA 3W1PA 3NEVA 1TTIA 2YX0A 2NV2A 1F5ZA 4FXSA 4HSOA 1TPC1 3HGJA 4AEOA 1GOXA 4Z1AA 3WK3A 1VLWA 1VHCA 5K2ZA 3W71A 3B8DA 4C1KA 1F2JA 5HMSA 4LS0A 4LRSA 3BGJA 3HMJG 3STGA 3MW7A 4O50A 2V82A 5LHEA 3PR2A 3NOEA 1S5VA 4ONVA 3QQ1A 1FWNA 2WOQA 3P60A 4JGDA 5I3KA 1TPUA 4IMEA 3WJZA 4FX6M 4O16A 4JTJA 4K8HA 3M7WA 3CU2A 3WK0A 6ALDA 4XTIA 5CGQA 1G7UA 5D02A 2OT1A 4LOCA 4MZYA 4JTHA 4ORMA 1SFLA 3CHVA 4UTHA 3S6DA 4A3UA 3G1AA 3IGSA 1QPQA 2FQIA 1JCLA 4M6PA 1XBZA 3C2FA 3T55A 2A7NA 4O11A 4IMCA 5D2TA 3W22A 3G24A 1A5CA 1TYGA 3LCHA 1THFD 4AVFA 3P84A 5DCBA 3CQ0A 3Q2DA 2C13A 4UTKA 2QAPA 2WSYA 2NLIA 3ABOA 4I9AA 3HGOA 4N9DA 1EP3A 2CLKA 2YSWA 1K8YA 1JR1A 1KFBA 1LBFA 2VC6A 3TMQA 1ZAHA 2Z0IA 2VFIA 3M44A 3OEXA 4TO8A 3ZFHA 1A53A 4WD0A 5D32A 4UFMA 4ICNA 1M5WA 1AW5A 3LOTA 1PIIA 3CEUA 5BNKA 2J9XA 1OVDA 3M1ZA 3NQMA 3TAKA 3G0XA 3QW4B 2QDGA 5LNUA 3RLVA 1BKSA 1M7OA 2GQAA 3OBKA 2PRMA 3BO9A 3QF0A 2DZUA 2NUWA 1LBMA 2BXVA 4IX2A 4UTWC 4RXGA 3U2OA 1JULA 1GG1A 5DXXA 3PSVA 1G4SA 2WO5A 5LGXA 4G1KA 1I45A 2V30A 3L5LA 1JCXA 5AC6A 3MHFA 3EWBX 4OT7A 1KFCA 5EYWA 4FX7A 3W7RA 4AWUA 5AHNA 4FNQA 4ALDA 3N14A 1P1XA 4FXRA 2JKPA 1JJKA 4XZ9A 1LLZA 4TU1A 4M7SA 2ZCGA 2PE4A 4JN6A 2YPIA 3PC0A 4HSNA 1HO1A 1EIXA 1EUNA 3KXQA 1GPWA 1A50A 3W70A 3TSBA 4IXXA 3EX4A 1ICPA 4O0ZA 3TV8A 2ZTKA 2XN1A 3LHYA 3SFKA 3FKRA 4K7VA 4JEQA 4Y8FA 3UWZA 5LGZA 1L9WA 3UZ5A 2H3DA 3R8RA 5C5YA 3F4NA 1TTJA 1G69A 5AOUA 1RQEA 3G1DA 5AC8A 4I7WA 1FDZA 1R30A 1WYIA 1DJQA 2VFHA 3LCGA 1O60A 1W5PA 4JX6A 2FPVA 4DF0A 4NJHA 2H3BA 2YGYA 1UASA 3K30A 3PB2A 1GG0A 1RQBA 4O17A 1T96A 2G5WA 1F76A 1ZY9A 2FJKA 3IVUA 4XBKA 5E93A 2FPYA 3MJYA 4OE7A 4O1BA 3WJYA 4A21A 4ZQRA 1K3UA 3S9YA 1A5BA 1H7PA 3UY8A 2Z6IA 4S2BA 1LRNA 3W7PA 4A22A 4JTFA 1NSJA 3KOFA 5D2WA 5DXYA 5HR6A 3ZR4A 3M0ZA 3NQCA 2DZSA 3T44A 3SGUA 3WJSA 3NDOA 1QMLA 2PURA 3L65A 4FB7A 3W74A 3TJLA 1KW1A 3O8AA 4QAIA 2JBMA 4MYXA 3OIXA 4JYFA 3MP3A 1EA0A 3TK7A 4CNNA 3O15A 2CLHA 1KLYA 1L2UA 2EPHA 2OZ0A 1RR2A 3BG9A 3NNTA 4X22A 3NQFA 4BI6A 1VH7A 3G1YA 3NL3A 1OFOA 1MEWA 4JTGA 4GJ1A 4RR4A 3W3OA 2E6YA 5CZSA 1HTIA 3DKJA 5BOOA 4IPJA 4FIRA 1I2QA 3W7MA 1G4TA 1O95A 1TPH1 5H2ZA 2XFWA 3DXIA 1NEYA 4GE8A 5KINA 4JY8A 1ME8A 3L5AA 2QCDB 3A5FA 3PY2A 2E68A 4JD4A 3NZRA 1AW1A 3NG3A 1ZENA 2E1DA 2QCMA 3P81A 3R13A 1ZAJA 2I9EA 2X30A 4NJJA 3LLDA 4BF9A 4EF8A 1R2TA 2GUUA 2X16A 3A23A 5G2IA 2DJLA 4C1LA 3RFAA 1S5WA 1DJNA 3S5OA 3CB8A 4R7JA 1DV7A 3QFEA 2ZRUA 4Z0SA 4M19A 3KAOA 1MEHA 2NUXA 2H8ZA 4CCDA 3NPXA 2NZLA 1G4EA 3NR0A 1XUZA 4TMBA 1B3OA 3W76A 3PBVA 3W88A 3YPIA 2QJGA 2TPSA 3MI2A 1LBLA 2V8ZA 2NV1A 2P1FA 1LORA 1YYAA 4TMCA 5EMUA 4U28A 5HNRA 4A29A 2O7SA 4BFAA 4NZFA 2ISWA 3EXTA 4MJMA 1GZGA 3DHFA 3BPWA 4K38A 3G22A 1NFBA 1WQ5A 1XFBA 2ABBA 1DQWA 3G3DA 1SR9A 5A8GA 3S5ZA 2NX9A 4K39A 5LHFA 1WBHA 5C2XA 4FNUA 3B06A 2JK2A 4PC8A 2PCQA 4O1AA 4L4LA 3UWUA 1ME7A 4B5NA 4OV4A 3SW6A 4CQ9A 2CW6A 2NXGA 3PUOA 4HPJA 3RLUA 2E6DA 2NXIA 4GXMA 2CLFA 3IVSA 1WA3A 2QF7A 4FNRA 3RF9A 2A7PA 1TJRA 3S1VA 5HULA 4ML9A 1VJIA 3BG3A 3GXPA 5DN1A 3LI0A 4CLMA 2EHHA 3IIVA 3W7OA 4MLRA 1Z48A 1AW2A 3PULA 1SO3A 4NT0A 3F1QA 3NQEA 4RZ6A 1N7KA 3L68A 3GLCA 1ZCOA 2VKZG 1VCGA 3NQ6A 3NYZA 1GJPA 5AB3A 5HWJA 4UFKA 2E6FA 3TSMA 3M41A 3E49A 4K7YA 3GDTA 4YMZA 4Z1DA 1H7NA 1BWLA 1SZFA 3LHZA 4I7UA 2A6LA 1D9EA 3QJAA 2C0AA 3BK0A 2B7NA 4FHAA 2GPTA 4JX4A 3ATZA 5IM51 4O12A 1SPQA 5I3JA 3LXBA 5EL1A 1XM3A 3QRHA 1K02A 1RVGA 4YLWA 1TRIA 4ORIA 3MMTA 3G8RA 2V81A 1YXYA 4LU0A 2W6RA 3G1SA 2DJXA 1WDWA 3QW3A 1H7RA 3IGXA 3C4UA 2PRLA 1WXJA 4KFNA 5EY5A 3EKLA 3STCA 3QSTA 3TQVA 2Y62A 4O28A 1VLIA 3GYEA 2ZA3A 1TRDA 3GKFA 1AL7A 3HB9A 3EWWA 5AFDA 1Q6OA 2I14A 5G1YA 2ISVA 4N6EA 3SSJA 3R5EA 4O1DA 3W1TA 4D2JA 2VENA 1YTKA 4DXVA 4RJEA 5CPMA 4UFIA 3PM6A 3W7HA 5FF7A 3UWYA 4DO4A 5F2MA 2QR6A 1T99A 3H53A 1DHPA 2DP3A 4RX0A 4WXYA 3HG3A 2XN2A 1LCOA 4KFPA 5TIMA 1LOSA 1R47A 5HWNA 3FOKA 2RDWA 4O10A 5K7JA 4NXSA 2RKXA 1PE1A 1YPIA 7TIMA 1W54A 2UV8G 4MY1A 2OCZA 5DBTA 3HQ1A 4Q32A 1OFQA 3L66A 3LRKA 3HBLA 5I3HA 3C2EA 4IMDA 5FESA 4RZ4A 2OMAA 5CPLA 6TIMA 3I68A 5K9DA 4NJGA 3GNNA 2ZYFA 3SI9A 1T0OA 4NU7A 4DBEA 1OK4A 1TPB1 1FCQA 1YDOA 2HS8A 3EEGA 1I2NA 3LV6A 3NAVA 4RCXA 5CZJA 3E96A 3EWZA 3NPVA 5K3VA 1VC4A 4KFOA 1O4UA 2CWNA 4HNVA 3EWXA 2B0MA 3W23A 2Y6ZA 3WK2A 5J5RA 3GXNA 1C9DA 1ICSA 3HGSA 3O6YX 1RV8A 3DAQA 4PFMA 4K36A 4POCA 2DZVA 4O57A 2A2IA 3E02A 1J2WA 5H91A 3FJ6A 2WNNA 4CCEA 2GJNA 3C61A 3LCLA 4LTSA 5G4EA 3TC7A 4PCFA 1YXDA 4AXKA 3W7DA 1TREA 3RK8A 3W72A 3VE9A 2J88A 4IJBA 1QOQA 2FPTA 5HJLA 3UD6A 1ZAIA 2Z6JA 5KTLA 1FCVA 2ZTJA 1GEQA 4H3DA 1Z42A 4H4IA 3TA6A 1OX5A 3BG5A 4Y90A 1TPDA 3DFSA 1H60A 2G96A 1N8FA 3G0SA 4N6FA 3P8IA 1QFEA 4RLIA 1QCWA 4MPQA 4DQWA 1XDLA 4J9JA 3C0JA 1EPXA 2NX3A 5KZDA 3S5NA 2B4GA 3B03A 4OU1A 3GDRA 5FI8A 2J24A 3ABRA 1KTNA 3HGRA 4LVDA 4M6VA 3W7NA 3NXFA 1TV7A 4FF7A 3B04A 1AK5A 3N73A 2HSAA 4LVGA 4TIMA 3M5VA 1FDJA 4YCPA 4NNBA 3LHVA 1P0KA 3TW6A 5K9CA 4MJZA 2HMCA 1GTHA 1MXSA 3PF3A 1LYXA 1XBXA 2YDAA 4HPXA 5K9XA 3W7LA 3O06A 4MY9A 2QCDA 1KBIA 3SR7A 3NM1A 3UWQA 1PV8A 2E6AA 1SSDA 4N2YA 3IGUA 3O1NA 2C19A 3CC1A 4CNOA 1U5JA 4Y96A 4OWGA 4I7VA 2RDTA 3BLIA 3I7SA 3NQ7A 4FO4A 1TTQA 4O19A 3G8EA 1XDMA 4ZQCA 4N9BA 3MHUA 4JY9A 3JR2A 1OFDA 1IIHA 2ZZ6A 1LRTA 1JCNA 3MI3A 1QPOA 1TO3A 4AF0B 3PG9A 5AHEA 5FF3A 2QUUA 1D3HA 3F03K 2GVJA 3CWNA 3UQNA 3TQ0A 1JVNA 5F2LA 5HWMA 1UUMA 3KRUA 3O6CA 3M5ZA 3PBYA 2KZHA 1S5TA 3PVFA 2TRSA 1ZFJA 1YDVA 3W1LA 4BWLC 1H62A 1TCDA 5SWUA 1GVRA 2FDSA 3LXCA 4R33A 1SZNA 3QYQA 4M7TA 4QNEA 3I65A 1X1OA 1GTEA 3CTLA 3BV4A 1NVMA 3PAJA 2Y7FA 2VFGA 3U8GA 4IQLA 2IQTA 4DEFA 4JR5A 3T40A 5G1TA 3FS2A 3B4UA 3EX3A 1YTEA 4FNTA 1SZGA 2GJLA 3RMJA 1H63A 2V0TA 3FKKA 4NX0A 5CPOA 4DPQA 4HNNA 3KVJA 1GVSA 5FF0A 2PC4A 4FEZA 3LCXA 3LRMA 4XKYA 3NVTA 5FEPA 4UTUA 4LV9A 2FB2A 5D33A 5AHFA 3GX9A 1SO5A 1W3IA 1OFAA 3W2KA 5K4ZA 1FXPA 1LOLA 3W7CA 3N34A 3QH2A 2WJZA 5DCDA 2QEZA 3P5YA 5CG7A 5I3IA 4QJ1A 2V5BA 2YYTA 3CM4A 3TNOA 3LERA 3NQVA 3SIZA 1I2OA 2QCHA 3MYPA 4OBTA 1W3TA 3DFQA 3KRSA 1KTCA 4IPIA 1ME9A 4UTTA 1WX0A 3QZEA 2Y70A 2FB3A 3TW7A 1FDYA 3HPXA 1K8XA 4ADSA 2CFFA 2I1OA 1L6SA 3M9YA 2VEMA 2C6QA 4X2RA 4XWUA 4P61A 3N19B 1FCBA 2ZDRA 4LRTA 1J4EA 4N4QA 4W9TA 2Q8ZA 2QJIA 3QMSA 1IIGA 3ABSA 3JRKA 2ZRWA 5BRBA 5FEZA 4ADUA 2CZDA 2YCEA 1KA9F 3SJ3A 3WJXA 3B0PA 3EWUA 1FQ0A 1OJXA 4DBDA 4QSHA 4M6QA 2QCGA 3A22A 2TMDA 3HIJA 1Z41A 4O18A 2RFGA 2BLEA 2YFOA 3L0KA 5CZTA 4Y6GA 1VS1A 5F1VA 1OFBA 1HG3A 3GDKA 3VE7A 1XUUA 4LC8A 1TB3A 1JCMP 1YDNA 1AMKA 3TE9A 4BR1A 3BGGA 3C52A 1CI1A 3NL5A 4DO5A 2GQ9A 2Y85A 1K8ZA 2RDUA 2X1UA 5LKYA 1VYRA 4RKAA 2ZA2A 3Q37A 1BEUA 1DQXA 2CU0A 3IIXA 1W5MA 2FFCA 2GQ8A 1QOPA 3W1AA 2Q3OA 2EAWA 1XC4A 2FIQA 2J6XA 4GC4A 3DFTA 2ZZ7A 5DELA 4UR8A 2Y88A 1YLVA 8TIMA 3S8HA 3S1WA 1LZOA 1OFRA 2ZA1A 1O5KA 1KM4A 2GVGA 3W1QA 5F4XA 3CEPA 3NM3A 1TSIA 3O05A 4Z1CA 1DORA 1H50A 2ISSA 3L21A 1YPFA 3KVLA 1XL9A 4DELA 3LCIA 1LOQA 2JKAA 2O7QA 4PTNA 4AMAA 2NXHA 4N9EA 3GIYA 1ICQA 3S5YA 3P62A 1PVNA 2RHGA 3L2IA 3N3MA 1AL8A 1I4NA 1ZNNA 4QM1A 4CCCA 1QR7A 5D38A 2C18A 3IEBA 2QAFA 4KKXA 1F05A 3SGZA 5G5IA 2ZZ5A 4UC5A 1FWSA 1PS9A 3HO8A 4UR7A 4K37A 1W31A 2WNZA 3THQA 1YXCA 5C55A 1X6UA 3ZWTA 4ZQMA 4GUJA 1OF6A 1KFJA 3C6CA 1FWTA 5C54A 3ATYA 4LVAA 4ZL1A 4UTIA 3FLUA 3GXTA 3A5VA 4QITA 3HG5A 3CLMA 3FA5A 3LTPA 3LCWA 3DHDA 4NZJA 2R8WA 2QCEA 3P74A 3UXDA 2VEIA 4WOQA 1F6PA 4H6KA 4QNWA 1PHWA 3UWVA 2QKFA 3SECA 3QEZA 4Q33A 1Y0EA 2OX1A 1H5YA 5AYZA 3JS3A 3TXZA 4ZQNA 1V7YA 4NUWA 3QC3A 3M47A 5BW6A 3M5YA 1FY6A 4BI7A 5AYXA 2F7FA 3FEMA 1GYNA 3HPSA 3W9ZA 5TQLA 4WJEA 2DZXA 1MSSA 1SW3A 5AN7A 3I7QA 1FX6A 1JUBA 4O53A 4GBUA 4JTKA 4MVAA 2QCNA 2QDHA 3BARA 3DFOA 2JKEA 2BTMA 4UUIA 1OFPA 3NL6A 1FWWA 1H61A 4EIVA 5F4WA 3BW2A 3KVMA 5MHBA 4LY8A 4LW7A 3FIGA 1Q6LA 4JTIA 1IXQA 2QCFA 5KSWA 4LVFA 1H7OA 2WV8A 2YFNA 1OYAA 2ZRZA 3T7VA 3W7JA 2ZZ4A 3R12A 3TIMA 1EP1A 4IXHA 4UFHA 1ZHAA 2BSLA 1I2PA 3INPA 1EWEA 2AGKA 3EX2A 3HG4A 1TJPA 4YXGA 1RQHA 3EXRA 3Q58A 3CIWA 1IGSA 2A5HA 2QCCA 1TMHA 2C3ZA 4ZQPA 4IOTA 1B9BA 4ZMGA 2A7RA 1UB3A 4Y9AA 2ZBTA 3LBCA 2C15A 3W1XA 4LNYA 3U6WA 4AH7A 3NQAA 3FFSA 4JYDA 3NGJA 1P4CA 3GNDA 4UTJA 4WUIA 3W85A 1ZALA 3I7RA 1L6YA 2VFDA 3BVJA 3GDLA 4AAJA 2WPBA 1JQVA 3G1VA 4E38A 1OF8A 1V5XA 2X1RA 5DCEA 4YWIA 3LCFA 1ALDA 2NWRA 3IVTA 1G67A 1B4KA 4O13A 1WAUA 2Y7EA 3LHTA 2QCLA 4O0KA 3RNDA 3W7EA 4EF9A 3G3MA 1WBJA 4WXZA 1W5OA 2A21A 4YL2A 2HS6A 3PBWA 4NNCA 3STEA 2TSYA 1F7BA 3EX1A 3GR7A 1ML1A 1NF7A 2Q3RA 3MO7A 2X2GA 3KVKA 4O4WA 3QMTA 3DFPA 4XUGA 2R94A 1EB3A 5HUOA 3W2UA 4RK8A 5D2VA 1W56A 3C2RA 1R2SA 5AHIA 1K7EA 2DZTA 3NA8A 3QSRA 3GVGA 3P5ZA 3STFA 3KRZA 4Z08A 4NX5A 3HF3A 3LBMA 5EPDA 3ZWSA 2WSRA 4GRSA 2YW4A 1SZEA 1Q45A 3VFLA 4LS1A 3OVQA 5AHMA 2E77A 1C29A 2J27A 4UTLA 1ADOA 1LDCA 1EWDA 3O63A 3W2NA 3W84A 2OT0A 3LHUA 1RD5A 3IV3A 4LC6A 4UTMA 3PWAA 1S3HA 3ELFA 1JRBA 3C2VA 4CQAA 3MP4A 2B7QA 5HQEA 5HUPA 1VPXA 4NVTA 2Z1BA 5F4SA 2V9DA 1K03A 4FNSA 1YADA 2H6RA 3VI2A 4Q4KA 1JQXA 3KFTA 1UUOA 1DOSA 1IXPA 4LS2A 3P61A 2NWSA 2D73A 4FIQA 1GQNA 5DY3A 4AHOA 3BW4A 1VCVA 4PEKA 2Y7DA 2RH9A 2ALDA 5LNRA 5LNWA 3IIPA 1VRDA 1KM5A 2J9ZA 1BTMA 5C6MA 5CSSA 3P7YA 4DF2A 2JGYA 1X1ZA 1SSGA 1KBJA 1NF0A 3PUEA 3DH7A 3UZJA 3IIOA 4E0CA 3TSDA 1YTDA 1DKWA 1OYBA 3NL2A 1WV2A 2HTMA 3TKFA 1KFEA 1QPNA 2GOUA 4OGZA 5EA9A 1XXXA 1K7FA 1F74A 3UYCA 1HUVA 3OA3A 4PODA 3TFXA 1H51A 1KM1A 4O4VA 1G7VA 1Q3NA 2VELA 1K7XA 4MFEA 1XCFA 3UPWA 1EP2A 1LM1A 4UMCA 3N9SA 3MBFA 1HO4A 4NQ1A 1TPWA 2GVLA 4RXFA 1GVQA 2E5CA 3C8FA 4QIUA 2YW3A 4UMAA 5G2HA 3P80A 3N9RA 5I3GA 3TAOA 4X9SA 1I2RA 3HJZA 4E2DA 4IUOA 2VEPA 3W1MA 1JUEA 1VYSX 4XTDA 3UNDA 3E0IA 4DO6A 3H54A 4JIQA 4EVZA 1SW7A 4JTUA 4AHPA 2WNQA 5J5DA 1O94A 2WSQA 3W2LA 4DPPA 1R46A 1XBVA 4UTTC 4PA8A 4AHQA 5LZLA 2DORA 2OJPA 4IMGA 5L6UA 1LP6A 4N02A 1T8XA 3PUDA 4O14A 3PG8A 4OQVA 4UFLA 2A85A 1CX9A 3WFAA 5AC7A 4JX5A 3S1XA 4L4MA 4UNKA 3ZS4A 4PL2A 2V2CA 3W2JA 4K6AA 2C1HA 4JTSA 1X8FA 5F1UA 2QJHA 3SZ8A 3TXVA 1SW0A 4MYAA 4O8RA 3CIXA 1H1ZA 4XQ6A 1JUKA 2NUYA 5KITA 4JTLA 1LRQA 3G18A 4FX8A 1OG0A 1TV5A 3QMRA 4HNUA 3QM3A 5IBXC 3P8JA 3BLFA 1KM3A 2CZFA 3MYOA 3IRDA 1O5XA 2E09A 3W2MA 4KWVA 4A2SA 3W83A 3LV5A 4R34A 2XN0A 3USBA 4EOUA 3V1PA 3WJWA 1HFBA 4CQ8A 3GR8A 1D3GA 4NNAA 2YR1A 3NZ1A 4WQ6A 1HL2A 1IXNA 4N4PA 4ADTA 3LDVA 3L5MA 1FUYA 3DGRA 2EGZA 3GAYA 2YZRA 1VGAA 2Y89A 5EKYA 1W5QA 3LLFA 4WY0A 1VZWA 1DBTA 4JXCA 3A9IA 3BLEA 5DBUA 3LXAA 1X7FA 2FLIA 1F73A 1BWKA 3F4WA 4N9CA 4M5PA 1LROA 2ZFAA 3C56A 1QDSA 4AWTA 2CLOA 2Q8LA 2AQWA 5GVJA 4X3ZA 1TQJA 2DZWA 3TJXA 3DBPA 2G97A 3D0CA 3W1NA 1E51A 2ZRXA 4RV8A 3SY5A 5D37A 2CLLA 5D2YA 3LM7A 4WY0F 5AYYA 3W7GA 3L0NA 4HKPA 5FEXA 3S0CA 5TBOA 3NQGA 4ZQOA 3PS7A 3EXSA 4JIPA 5I3FA 1XI3A 2V2HA 1OK6A 5D03A 5KMYA 2EF9A 1L6WA 4MLJA 4MUZA 1SQ7A 1I8JA 4HHPA 3THAA 3UPBA 3CT7A 3CPRA 3LGEA 1JCJA 1KM2A 2ZQ0A 3TDFA 3L9CA 1PHQA 4E2BA 3G1HA 4BWLA 1OFEA 2V5LA 2CLIA 3KX6A 4DF1A 5DLCA 4BK9A 3T4CA 4GNJA 3GB6A 3FYPA 4QISA 1RZMA 4UMBA 1SUXA 4IGHA 3O07A 1Q6QA 4RZ5A 2Y61A 4JTTA 3S1UA 1GWJA 3T78A 3O16A 3M6YA 2C16A 4HT3A 5HINA 5U7SA 5ABTA 1QO5A 4CNPA 1M7PA 1W37A 5KZMA 1F6KA 3HPZA 2P0OA 4GUIA 3TMLA 3LI1A 4UXDA 5FF2A 2NX1A 3W87A 4LV4A 2J9YA 3B05A 1G6CA 1WOAA 3UXAA 4BI5A 3LHWA 4Z0JA 1LLWA 5F2GA 2Z2UA 3AO0A 2LLEA 1IXOA 4NJIA 1XBYA 2TYSA 2ATSA 3M43A 5F2IA 4WOZA 3M5XA 2BWGA 3DI1A 3GAKA 1VQTA 1TPEA 4JDBA 3GK0A 4Z1BA 5LNSA 3FYOA 1QWGA 3R2GA 1GYLA 1JRCA 1OHLA 3LTSA 4OV9A 3TH6A 1AG1O 3NPUA 3Q94A 2R91A 2X1SA 2A4AA 2A6NA 5CPNA 3EX6A 3VCRA 3OG3A 3PSWA 4NXKA 5BMXA 3EB2A 3W7KA 3TC6A 2BZNA 4UFJA 4UCGA 3OVPA 3ANYA 1MO0A 5KZEA 2YXGA 5FEWA 2AAMA 1SO6A 5E1QA 3CWOX 4JNMA 2ZZ1A 1TIMA 5U4NA 2CLEA 3GZ3A 4LVBA 5D09A 2WQPA 1KTBA 3MI6A 1TTPA 1C8VA 1SFJA 4MOZA 1GVOA 3G1FA 2QUTA 3N2XA 1H7XA 5EBUA 2G95A 2Y63A 5D30A 3QPZA 3DU0A 3FJLA 2CLMA 4AB4A 2W0UA 1Q6RA 2VEKA 2EKCA 5G2WA 3NQ2A 1ONRA 3GKAA 4JTEA 5BMWA 1VR6A 2R14A 3DENA 1EUAA 4GUFA 4PH6A 3PB0A 2PRHA 4PL1A 2E5DA 5K4XA 1A5AA 3UWWA 1QNVA 3VKJA 3HG2A 1FCUA 4JS3A 4GWEA 5IBXA 1PL9A 3G1XA 5LNVA 3TR2A 3W1RA 1GT8A 2X1TA 3BW3A 1R2RA 5D04C 4TR9A 2B7PA 3W07A 1UBSA 4K8EA 4JDYA 2WKJA 1FXQA 4OHQA 5A5WA 4FNPA 1UCWA 3LX9A 4NJKA 1JCYA 3RU6A 1TQXA 4S2CA 3VNDA 2CZEA 1W3NA 1PCKA 2C14A 4O1CA 4MY8A 1SO4A 3MUXA 4HIBA 1B4EA 4GUHA 1M6JA 3I6RA 4TX9A 2CZ5A 1H1YA 3IIZA 2ZRVA 3A21A 3TX9A 1Z44A 2DZPA 5DY2A 3EWYA 5LSMA 1QAPA 3G0UA 2A1YA 4R53A 3N2MA 3KHJA 3DZ1A 2ABAA 3ABQA 1IF2A 3UY7A 2P10A 1QO2A 5D2XA 1OX4A 1VCFA 1XKYA 3W7QA 1TV8A 1KM0A 3DI0A 3MWAA 3TCEA 1OYCA 2B7OA 1G4PA 4IWWA 2DU2A 1W0MA 1WOBA 1VYPX 3TUUA 3QQ0A 3NO5A 4LWWA 3L0GA 3E9AA 4MIMA 2QUVA 3TROA 3EKZA 1N55A 5CKSA 4LUJA 3AJXA 3P82A 4HN4A 3W1UA 3W6YA 1PCWA 2YYUA 3MBDA 2ATMA 1KLZA 1SU5A 3W75A 4O15A 2VFFA 2H8XA 5L9FA 3C2OA 3QPYA 1DVJA 4XBSA 1DL3A 4JYEA 3NQDA 5AHLA 5D05A 1KM6A 3OHIA 1KFLA 1W8SA 5E0KA 5FF4A 1ZJIA 3LB0A 3NQ8A 3P67A 1CW2A 4MKNA 1FWRA 4A2RA 4AWSA 4U4MA 4S1FA 2JGQA 1KV5A 3R89A 4UTWA 2VXNA 4YCOA 3W73A 1EEPA 3M16A 1QPRA 1OABA
chains in the Genus database with same CATH superfamily
4WY0B 4GZIA 1J5TA 5C0QA 3E12A 2YB1A 4QJ3B 1TPVA 1V03A 1VBHA 5LYRA 1P5BA 1UJPA 3KUMA 4HMDA 1FBAA 5CZ0A 4GABA 1W3KA 3BLDA 3MWCA 3W26A 2GDQA 4DHGA 2R1NA 4Q22A 4GFSA 1BVZA 4IX0A 5I77A 3WY1A 3WK1A 3NSNA 3EPOA 3KL3A 1C7TA 2Q09A 1YDYA 2ZZ2A 1NQKA 4LUIA 4OJYA 5JVLA 2DGAA 2FTPA 1RPXA 2A3BA 1E4MM 2OZ8A 5FJJA 1Q7QA 2OU4A 1LLOA 1UPPA 1FP9A 4M0XA 4C60A 4LEQA 4GQQA 4AIEA 5XIMA 1XIMA 2P76A 1EDGA 2WSPA 2XFYA 1A5SA 3RPMA 3CLWA 1VHNA 1W1ZA 3CZGA 3BV7A 3R0KA 2YX0A 1FWBC 4FXSA 4AEOA 1HX0A 3OIHA 1XRFA 2JIWA 3AHXA 1VLWA 2ZWYA 4O0QA 1E4LA 4HYWA 3B8DA 1F2JA 1XYZA 2QPXA 3MW7A 3PR2A 5JH2A 3NOEA 2J7CA 1S5VA 3QQ1A 1FWNA 2WOQA 4C6IA 1QOXA 4CN4A 4GCAA 1ADSA 1BKHA 2VCAA 4JTJA 4LPCA 3CU2A 1QHPA 6ALDA 1XR2A 2PLCA 3TYCA 3KS5A 3AIWA 1CB7B 5D02A 2OT1A 2XTKA 4JTHA 4B3KA 3CHVA 1CIUA 4DLFA 4UQ9A 6XIMA 4M6PA 3T0DA 4O1EA 1XGDA 2G4FA 2OWWA 3G24A 1A5CA 3REQA 1ESWA 3H4XA 1RUSA 1THFD 4MTVA 4AVFA 3COTA 3P84A 4EXBA 4GGHA 2NLIA 3HGOA 2CHRA 4EWJA 2YSWA 1JYNA 4V28A 1XWYA 5HQMA 1TA3B 1N8WA 3CAWA 3M44A 3OEXA 1A53A 1PIGA 3A4XA 1J6PA 3F5JA 4WD0A 2X41A 5D32A 3WF0A 4OECA 2YKKA 1Y5WA 5HPOA 4Q8VA 4W8AA 3NQMA 3M1ZA 3TAKA 1TVNA 4RDWA 3S9ZA 2DT3A 3QW4B 2QDGA 1X6LA 3OBKA 2DZUA 4U2ZA 3WBAA 5LIKX 3FDKA 1XIFA 1EJVC 2CCRA 4G1KA 1JCXA 2J7GA 3CUFA 4H1ZA 1H3GA 1UQYA 3GNOA 4CNSA 2ACQA 4XZ9A 4LYKA 4YPJA 2PWVA 4TU1A 4F9DA 2ZCGA 3RRXA 4FS9A 1TUFA 4JN6A 1EH9A 1E72M 4HSNA 1GORA 4HZ7A 1DWAM 3MV01 1HVQA 2XN1A 2VD8A 1RCOB 4JEQA 4PBGA 2YCLA 4URIA 4JBRA 3VINA 2BMBA 2E8ZA 3CL6A 1G69A 1OSEA 4HOZA 1QK2A 2OO6A 1RQEA 3TWBA 1DJQA 2VFHA 3LCGA 1O60A 1XPYA 1K8CA 2YBTA 1T96A 1ZY9A 1A0CA 2FJKA 4J3TA 4XBKA 5E93A 3CNYA 1GW9A 4PCSA 3MJYA 4ICCX 1Q85A 1H7PA 1VJZA 1NSJA 4CEUC 8XIMA 4D8AA 4UBPC 5D2WA 2GSHA 1R5YA 1S46A 5LA0A 1QMLA 3L65A 1XYBA 1KW1A 4DZ5A 3UJEA 1VKFA 4JYFA 1EA0A 3O15A 4MKSA 2OZ0A 5AY7A 3TJ4A 4V2XA 1QW8A 3WD2A 4BI6A 3UESA 1GVIA 4H41A 3AU2A 3DX5A 4AZCA 3KL0A 4PTMA 3ENLA 1EDQA 2RGLA 3WH5A 2E6YA 5CZSA 1HTIA 3DKJA 2E8YA 3FNDA 3GNRA 2WWCA 4ZO8A 3AU6A 4LF2A 1FA2A 1PTDA 4ZOEA 1G4TA 4RV3A 2FVMA 1BQCA 2YDQA 4JY8A 1ME8A 4YIWA 3MVIA 4K1WA 2QCDB 3A5FA 2QMKA 2HROA 3VYLA 1IZKA 2QCMA 3P81A 1W1A1 3ARVA 2H9AB 4NJJA 2Z1VA 3MSRA 3LLDA 4B15A 1IT0A 3OLGA 5G2IA 1YMYA 3RFAA 3S5OA 1H09A 3CB8A 3T0CA 3UG5A 1EJSC 4Q4PA 3VXGA 2X2YA 4Z0SA 4CN6A 4CCDA 3KOXA 4G7EB 3W76A 2QJGA 2DZAA 1LORA 3UGVA 4TMCA 4U28A 5CCZA 1UD2A 4BFAA 1YBQA 2PP3A 2ISWA 5I2UA 4Q8TA 2ASHA 4MJMA 1GZGA 3VKBA 2BB0A 2BY0A 4K38A 1S39A 1EQCA 1W2VA 3SRFA 1QXLA 4K39A 1CNVA 2W3ZA 4FOJA 5CAHA 1GW1A 1ZJHA 5FAGA 2PCQA 4O1AA 4NI3A 4OV4A 2OODA 2CW6A 4IIFA 4HPJA 4JFVA 2E6DA 4U3AA 1OM0A 3IVSA 1WA3A 4JL2A 2W66A 3H7RA 3H2NA 3N6JA 5HULA 1YX1A 1WB0A 2WHMA 2ZUNA 4MLRA 3WBYA 4NT0A 3NQEA 1N7KA 2I5GA 3I4KA 3GLCA 4C6DA 5A6SA 2VKZG 3LZ5A 2QPUA 4PUMA 2IQ0A 1XLFA 3AOFA 3H2FA 4NILA 5IHRA 4Z1DA 1WXYA 3VDHA 1VENA 2BXYA 3IK2A 1JGIA 3UW6A 3QJAA 1EBHA 2BOGX 5A8PA 1J9YA 4CKQA 2GPTA 3CPGA 3HZ3A 3UJFA 1YNYA 4O12A 1SPQA 5DT7A 3LU2A 2ZWZA 3ALFA 2AOSA 1NWRA 1TUXA 5E9XA 3MMTA 1LWIA 3G8RA 4LU0A 1DEDA 2DJXA 1WDWA 1RP8A 2Z7GA 1LQAA 4YS1A 4F66A 3M0HA 3STCA 2AL2B 4QDPA 1VLIA 3A12A 3HB9A 3EWWA 3TOYA 3KCOA 1AMYA 3WQDA 4GNVA 4E4PA 4GQRA 1DIDA 1AFSA 5BCAA 4K68A 3MUY1 5A1AA 1MDRA 4RJEA 3RPTA 1E5NA 3HQNA 5CLWA 4JTQA 3UWYA 1HKWA 3LMZA 3UXLA 1Q4WA 1KRBC 2DP3A 1R6WA 4KFPA 1LCOA 4C6BA 4PSPA 3MUIA 1GHSA 5HWNA 2WC4A 3FOKA 5I3DA 2VRJA 1XISA 3N3TA 7TIMA 4PB3A 3LLXA 2PMQA 1WKFA 3VZZA 3IARA 2PDHA 2NLYA 5TNVA 1U5VA 2DSUA 2YJQA 5CPLA 2XIBA 3WNNA 3E0LA 1CCWB 6REQB 2NW0A 1TPB1 2XGIA 1W2PA 2Z1SA 2WJDA 2XSBA 3LV6A 3NAVA 2NSXA 5K3VA 5C2CA 1V02A 3M0XA 3OZOA 1V77A 2IUZA 3XINA 2B0MA 4LUTB 3W23A 2Y6ZA 3GXNA 4AZBA 1RV8A 1HZYA 2A2IA 3CXOA 3VUSA 3AISA 3C61A 4LTSA 2VO5A 3APGA 4XAGA 4PCFA 1U1HA 1S1PA 4JIIX 3VE9A 3URQA 3N15A 3CUIA 5ECUA 1QOQA 1QHZA 3CV7A 5KTLA 5FACA 4PCPA 3VU2A 2FGZA 1TPDA 1H60A 3G0SA 3P8IA 2VMFA 2QIIA 1XDLA 3C0JA 1TWDA 1QW7A 1CXEA 2PS2A 3ZJ8A 5KZDA 3S5NA 3B03A 4HK6A 4KS0A 5FI8A 3HGRA 4M6VA 1ISVA 3NXFA 3PJTA 4IJCA 1S2CA 3KRBA 4TIMA 1SGJA 3GXMA 4YCPA 3LHVA 1P0KA 1XLLA 3AIUA 3DG3A 3TW6A 5K9CA 2QT3A 5I02A 3B9OA 3WL0A 4HPXA 4H7ZA 4MY9A 3NM1A 1PV8A 2E6AA 1SSDA 3CBWA 4N2YA 3O1NA 2J75A 2RDTA 1EX1A 1LT8A 3KL5A 3M6DA 1XLJA 2IKGA 3R7MA 2DT1A 3N4AA 5A6MA 1UIOA 2H9AA 2PZ0A 2ZZ6A 3LD5A 1RAKA 1LRTA 4PFHA 2G8ZA 3OLDA 3CZLA 1TO3A 1RH9A 1NARA 5AHEA 1HKMA 3UXKA 2A3AA 2QUUA 1S5NA 1D3HA 1UIPA 4RZBA 4GZEA 1OZQA 3UQNA 3TQ0A 1BYCA 1XDJA 2R1KA 1SFTA 1S5TA 3PVFA 2AQVA 5A2CA 4DM1A 3W1LA 2XIQA 2ACRA 4A8NA 3S83A 3GFZA 3DHPA 4S3KA 1XIGA 3OLEA 2JFEX 3FAXA 3P14A 1GTEA 1FHUA 3BV4A 3S4TA 1PB0A 2PDBA 4ENLA 3UPMA 3VNKA 2IQTA 3VGDA 3H2MA 5CGMA 5HXMA 3FS2A 3B4UA 1LUCA 3FHQA 3U3HA 4E6MA 2QZRA 1E15A 3GC5A 3T0TA 4Q7BA 5CPOA 1BD0A 4ZFMA 3SN4A 3ZLGA 1V6XA 2PC4A 4US6A 5CC3A 5CQ1A 3AXHA 5FEPA 2XH0A 4UTUA 3WF2A 3GX9A 2O9TA 1W3IA 3VKKA 1FXPA 4PMRA 3W7CA 2WJZA 5FKYA 3P5YA 4GXPA 1KWGA 3AQUA 1KC7A 2V5BA 4XZLX 2WZMA 3LERA 5DRCA 3PJWA 3SIZA 1QJWA 3MYPA 2BY1A 4OBTA 1W3TA 3VNMA 3KRSA 3WLMA 3L2LA 3AXKA 5LA2A 2YCLB 2I1OA 4YHGA 3WUEA 1L6SA 3ITVA 4XWUA 3RJYA 1FCBA 2ZDRA 2PDFA 4XD3A 4N4QA 3ABSA 4JNYA 1RP9A 2YCEA 4NAFA 3F2BA 3B0PA 2WHLA 2CBVA 3PZTA 4HCHA 3W82A 4O18A 4QG8A 4XSLA 2NVCA 2PDMA 1VS1A 4Q4SA 2Q02A 3FK4A 3VE7A 4LC8A 3TE9A 4PRTA 1OCNA 1MWOA 2GQ9A 2Y85A 1VYRA 1TCMA 2ZA2A 4RKAA 2CU0A 1DQXA 1B9ZA 3KCJA 1W5MA 1NTHA 1QOPA 2Q3OA 2EAWA 2J6XA 2ZOXA 1V08A 3DFTA 3T9PA 1BRLB 3A47A 1CLKA 3EA3A 4UQCA 3D46A 4BEQA 8TIMA 6ENLA 5JBDA 3S1WA 4ASTA 1OFRA 1TELA 2ZUUA 3W1QA 4B5VA 4PCTA 3FN9A 4OKDA 1PBGA 1H50A 2AAAA 1XL9A 3LCIA 1LOQA 3WMCA 3FYYA 4RDYA 1L8PA 3LA4A 2JKAA 4PTNA 4AMAA 2NXHA 4DNHA 5A6JA 1V0MA 1ICQA 3T42A 2F2KA 3S5YA 3AMCA 2RHGA 2VRQA 2O9OA 3LN3A 4MWAD 3R94A 3KBWA 5D38A 4BF5A 2C18A 3G6MA 5MKGA 4KKXA 4LGXA 2GGGA 1E9IA 2BHYA 3GVRA 2YXOA 2ZZ5A 4GY1A 3GO2A 1AJ0A 1B90A 2JF6A 2YCKX 3I6EA 1PS9A 3B0YA 1W31A 4HU3A 2YCJA 3N1AA 4DO7A 3THDA 2VEFA 5C55A 1X6UA 4ZQMA 1OF6A 4L1WA 3VTRA 1Q2SA 2PTZA 3ATYA 4ZE4A 3C0LA 1EXPA 3AIRA 3W53A 3A5VA 3OGSA 3W4RA 2FHBA 4RPPA 3FA5A 1X38A 3LTPA 4NZJA 2FHCA 2C79A 4GIRA 3W28A 4AZHA 2Q8XA 2R8WA 4IQDA 3URBA 5FL0A 1F6PA 4H6KA 2DSZA 1GQIA 3DOPA 2HE5A 4Q33A 4D9PA 4AZ7A 2PBGA 2VVNA 3QC3A 3H24A 5XIAA 5HMEA 2GGHA 3FEMA 1GYNA 2YXXA 5TQLA 4PYSA 1SW3A 3TZNA 1QUMA 3HPFA 2A79A 4IFOA 2QYGA 3ANUA 2QCNA 4LB3A 2XVNA 3BARA 3M64A 2V38A 1FWWA 3RUBL 1H61A 5F4WA 5M1TA 4GACA 2ZKMX 3KVMA 5MHBA 1K77A 1KCLA 4NRRA 5AKQA 5KSWA 1H7OA 4OVXA 1QI4A 4PUNA 1EP1A 1XICA 1G1YA 1ZHAA 1I2PA 5C8BB 1TJPA 3IRSA 2VQTA 4EPDC 3UEQA 3CIWA 2Z4GA 3ARWA 3QLDA 3NO1A 3QV8A 2XZ9A 4L4PA 2GJXB 1QBBA 4LNYA 3NQAA 4EPEC 1ZALA 3MVTA 3GDLA 4J27A 2CPUA 3VIGA 1IEVA 3IGHX 1OC7A 4PB4A 4GI4A 3LCFA 1ALDA 4DNMA 2GVYA 1IEIA 1B4KA 4GXWA 1WAUA 2QCLA 3ORWA 4EF9A 5IFPA 3G3MA 3OBEA 1W5OA 4EE9A 3N04A 3H2EA 4YL2A 4NNCA 2TSYA 1F7BA 3NVDA 1SFSA 4B16A 1POKA 1TV3A 3EX1A 3Q65A 2I9UA 3GR7A 2FVKA 3F2CA 1UR4A 1S3TC 1LF1A 1DE5A 1EB3A 3VD7A 5HUOA 3VX1A 1OBAA 1FKXA 1TG7A 3RU8X 2PWHA 3KRZA 4D8LA 5EPDA 5GNYA 2YW4A 1Q45A 3VFLA 3OVQA 5AHMA 4GOAA 2DSWA 4I9TA 4R7OA 2BFGA 3BURA 3TN4A 5BXPA 3OZYA 2UY5A 2VEGA 3IV3A 2NSOA 1JPDX 4LAOA 1S3HA 3ELFA 3PUGA 4M6UA 2VL4A 3C2VA 3B0XA 2AKMA 2JE8A 3MSDA 3PPFA 3WYZA 3R8GA 1V3KA 2V9DA 2UY2A 1K03A 1VBJA 4FNSA 3R79A 5HNTA 2EPLX 4GJIA 2DUXA 3KFTA 1TWIA 1EHNA 1DOSA 1IXPA 2PDXA 1ZJAA 3WLNA 2NWSA 3BW4A 5CBJA 1VCVA 1FWIC 3TTQA 2Y7DA 3VGHA 2RH9A 1FWAC 2E0PA 3MC5A 3IIPA 1KM5A 1WDRA 1PSCA 4HZMA 2OKOA 1XRSA 1IGWA 3P7YA 1VFFA 1KBJA 3PUEA 4HNOA 3DH7A 3RX3A 3NL2A 3LPFA 4REQA 1WV2A 2HTMA 2OWXA 1BHGA 1QPNA 4OGZA 1YBQB 3IUHA 1FWCC 4ACZA 1H51A 5H6HA 1LM1A 4JNZA 4LBUA 3PZVA 1VB9A 3MBFA 5I78A 1TPWA 3SQLA 2E5CA 2YW3A 4LAMA 3TYZA 4OTKA 3PZ9A 4DAFA 2VEPA 5BYWA 1JUEA 1VYSX 4Q7IA 4JKMA 3UNDA 2O9RA 4W4QA 4JIQA 3RLGA 1SW7A 4NAEB 4AHPA 1M3UA 5J5DA 1VBGA 4M1RA 4UTTC 2Z29A 4IIBA 2ZXDA 4PA8A 2PB1A 4XZWA 2DORA 4PUWA 4AHQA 3U9IA 1GOIA 1DQUA 3L4ZA 4O14A 4OQVA 3S2JA 3RYSA 4RW3A 3WQ5A 4JX5A 3T07A 4ZFCA 4L4MA 2J7HA 3ZYZA 4PRRA 4PMXA 4K6AA 2C1HA 4R9XA 5FOOA 2CWXA 1VEOA 2QJHA 4RW5A 3U2CA 3WDRA 1UC5A 3BTNA 2V63A 2RUSA 3CIXA 1S2UA 1JGMA 1B2YA 3FAWA 2X7WA 5JXQA 1DXFA 2WVTA 5C70A 4C6EA 3LNPA 3P8JA 4XVEA 2FYMA 4AXNA 3D6NA 3GFXA 4A2SA 4R34A 2P0IA 3AWOA 3TONA 3VOIA 1HFBA 4CQ8A 3B4YA 3H2CA 4YVXA 3SRDA 3SCVA 1XIDA 3VKCA 2YR1A 3K8LA 4X0NA 3NZ1A 4IIEA 1OD0A 3AFBA 3TOPA 2VT0A 3RITA 3FEQA 4JQ4A 4N4PA 1IXNA 3L5MA 3DGRA 1I9CB 3GAYA 2YZRA 5EKYA 4S3GA 4XD4A 1W5QA 4IFKB 4JXCA 4U3CA 5DBUA 3LXAA 4XAYA 4X2PA 1CGYA 1BWKA 2HCVA 3F4WA 4M5PA 5B7YA 2F6KA 1YRRA 3C56A 3RCMA 5TF0A 3OYXA 2AQWA 4P5UA 1UC4A 1TQJA 2KAUC 2DZWA 3DBPA 3OA5A 1H4PA 1E51A 3SY5A 2W67A 4JIHA 4GLEA 2CLLA 1DJWA 5JMUA 5D2YA 3LM7A 4HYVA 5AYYA 3ARZA 4N0RA 5C7HA 5FEXA 2Z25A 3L4YA 1ZS2A 1OG6A 1XI3A 2D3LA 5JIWA 5KMYA 2EF9A 3C86A 3DYOA 4YU1A 3WLPA 4KRTA 5A8NA 4MUZA 1XG3A 4KEUA 3FSUA 3A13A 3S5SA 2QS8A 3AYTA 5DMMA 2GK1B 1KM2A 2ZQ0A 3L9CA 3G1HA 4BWLA 2A3EA 5D9NA 4L80A 2CLIA 4AYGA 4DF1A 3MUAA 1EOKA 3V0UA 3BJFA 4GNJA 3GB6A 4A35A 4QISA 5BOFA 4E2OA 4KCUA 1XPGA 1EPVA 1KR0A 1UR3M 2FZNA 2J4GA 2C8NA 3VD5A 3GXFA 1A5MC 3STPA 3CS2A 1Q6QA 5FJTA 4JTTA 3S1UA 3T78A 4YVVA 3UZYA 3O16A 2C16A 3EMCA 1GOQA 1QO5A 2BGNE 3UVAA 5HPCA 4CNPA 4FF5A 3VNJA 1A5OC 3CGTA 1WP6A 4JHOA 4ZR8A 1CWYA 1PZ2A 1HXJA 3RDKA 4GQBA 4DWSA 5KETA 2HNEA 5FCZA 4OOUA 3VNIA 2PTYA 4B5UA 3AO0A 5GJNA 3RJXA 2V5KA 2A3CA 3M43A 3E0FA 1VQTA 1TPEA 2EG8A 5LNSA 1OHLA 2JEPA 1FH9A 2VZTA 2PDWA 4H8VA 1WDQA 1ZLPA 2R91A 2X1SA 2V3GA 4QCEA 3EBVA 3QYSA 1J11A 5JH1A 3VCRA 1Z3NA 4Y8EA 4QLJA 3OG3A 3RMEA 1LQ2A 1CXHA 3NSMA 5TD4A 2BZNA 2FHFA 1E6SM 1KCXA 2OXNA 1U33A 3ANYA 1MO0A 2ISDA 1SO6A 3E6EA 2BODX 1HT6A 5U4NA 1WXZA 4LVBA 5D09A 1EIBA 1KTBA 1TTPA 2CERA 4GO9A 4CD5A 1C8VA 5AZ0A 4HN8A 1GVEA 2QUTA 4L65A 2ON3A 1PPIA 5EGRA 3AHVA 3KZPA 1MFUA 2OFJA 2VEKA 5G2WA 1ONRA 3KE0A 3VPLA 2CYGA 4KRZA 4JTEA 2R14A 1EUAA 4GUFA 4PH6A 2E5DA 3ID7A 4G5DA 3H7UA 4WDWA 5IBXA 1PL9A 2FTYA 4C5ZA 1W3JA 3I3DA 4RDZA 3BW3A 4GQ0A 1NDWA 5ABEA 5D04C 2RJGA 2VGFA 4D6DA 4QFUA 4U10A 2VHLA 2WHKA 4K8EA 5ABFA 4JDYA 2WKJA 2WHJA 2E28A 1J0YA 4XO7A 3LX9A 2YLLA 4Q8PA 3T2PA 1TQXA 3NO3A 3SQMA 1W3NA 1Q8JA 2C14A 4MY8A 2WMIA 4WCJA 4CQCA 1PZ1A 1B4EA 1BVWA 4GVGA 1SZRA 2DZPA 5DY2A 3G0UA 4HD5A 2A1YA 4WSJA 1KRMA 1RBAA 2E9MA 3TYBA 1HQTA 3UY7A 5D2XA 1GKPA 1VCFA 3MS8A 1W1YA 1TV8A 1KM0A 1ZSXA 1ZBVA 3H4GA 4NASA 1OYCA 3ES8A 3QQ0A 1G5AA 3NO5A 2XJ7A 4Z2KA 2E9LA 3CT2A 4GG9A 4MIMA 3RXZA 3TROA 2PU1A 1N55A 2PDPA 5CKSA 1EDTA 3AJXA 3VGGA 3B8IA 3W1UA 3PPHA 1PCWA 3W6YA 4Y9OA 5HMDA 5L9FA 3QPYA 2WLZA 5D05A 2O55A 4IISA 5E0KA 4IP4A 3R11A 1J0JA 1CW2A 3P67A 5AECA 1GVYA 4GFIA 5D9MA 4S1FA 5H8UA 3M0IA 4JAWA 4YCOA 1EEPA 2ZVRA 3IACA 4LT9A 3A24A 4WX2A 2H90A 1DYSA 2BX7A 4H6QA 1WAWA 4MB5A 4GUGA 2WCAA 1K6AA 3QR3A 1QI2A 1EJWC 3LTYA 2W92A 1YIXA 1F07A 5CZKA 3AMDA 1B57A 1EFZA 1OX4B 2CBUA 3DKLA 3V75A 2IKIA 4ZVJA 5HATA 1VFMA 1O5QA 3M0MA 4E3TA 1QU4A 4G56A 1AJZA 4P2VA 1QWKA 3GG1A 3W86A 2F6UA 5HANA 2ZRYA 3HFTA 4QQ3A 1KV8A 2F2HA 5DEZA 3QGVA 1GVFA 3PBUA 1V93A 4QROA 2C91A 4K8GA 1VRXA 4O54A 3JU2A 3O6AA 1P0NA 4KEZA 3FGCA 1KNWA 1MEIA 2OLAA 3K2GA 1NAL1 3FV9A 4QRNA 3BC9A 4NP7A 3POHA 4MZ1A 3W1PA 4Z2GA 1TTIA 4N42A 1UR1A 4PMJA 3HGJA 2OQYA 1GOXA 4Z1AA 2EPNA 3DN5A 3WK3A 1VHCA 2YBVA 2CBIA 5GNZA 4C1KA 4LRSA 3KS6A 4O50A 5LHEA 4M1BA 3P60A 4JGDA 1CGXA 3PZIA 1W9BM 5C9ZA 3K1DA 3WJZA 4O16A 3P6LA 3WLJA 3M7WA 2NQHA 1V0NA 3IJ6A 1WZKA 4XTIA 1DJYA 1E3XA 1GQLA 3S6DA 3UA4A 4D6EA 2BVYA 1XBZA 4MAZA 2A7NA 2Y8UA 3A4WA 3ME3A 5D2TA 4E4FA 3VGBA 3LCHA 2G50A 3CUXA 1UWAA 2IPFA 3TYEA 2R1LA 5DCBA 2HVMA 3Q2DA 4L1XA 1EF2A 1P7TA 2PDQA 2WSYA 7XIMA 5EMKA 1KGUA 1E0VA 1EHAA 1JR1A 1P0DA 1US3A 2VC6A 4GIEA 3U7VA 3TMQA 2Z0IA 2VUNA 2VFIA 4UFMA 1M5WA 3WLTA 2GOKA 2FZ9A 1CLVA 4PSRA 2G3NA 1PIIA 5BNKA 1XRVA 1OVDA 3LENA 3VOJA 1M7OA 3BO9A 4A4AA 3QF0A 1REQA 1L6GA 3WQEA 2BXVA 4H9UA 4IX2A 4YYFA 1JULA 4NYYA 1W1B1 2P3ZA 4XUYA 1C8YA 1GG1A 3PSVA 2P88A 1I45A 3L5LA 3MHFA 1RSCA 3EWBX 4OT7A 5EYWA 4FX7A 1YEYA 1F4AA 1XLDA 1K4GA 2CHOA 5A8OA 1E9ZB 1A3XA 2NVAA 1X8CA 4MPKA 3CHDA 2YPIA 2XVPA 2Y0FA 4IGMA 4AIUA 1GPWA 1A50A 1UWQA 3TSBA 3AZRA 4IXXA 3SCQA 3PBMA 4FLOA 1P1MA 4GI9A 4J4KA 2ZTKA 3CQHA 1WKYA 1E9YB 3FKRA 4Y8FA 3QTPA 4V33A 3TYUA 2QULA 5E70A 3SQSA 5AOUA 2IPWA 3G1DA 3LGDA 4I7WA 1E0UA 3BCFA 4H2CA 1I0BA 2V3DA 4REQB 4NJHA 2YGYA 1UASA 2ZIDA 3PB2A 1RQBA 4BCEA 1DTUA 1F76A 1W1IE 4HNLA 2HPIA 2V5JA 4KETA 4CU8A 3PFRA 3S6OA 1WUEA 2Z6IA 2HJPA 5DXYA 3ZR4A 3M0ZA 3NQCA 3U2ZA 3WJSA 2PURA 3W74A 3TJLA 2CETA 4MYXA 3OYZA 3OIXA 4B5WA 4XB3A 2F9RA 4ZSUA 4CNNA 3QBUA 4ML4A 2X09A 2EPHA 3SSZA 3SCTA 4JQAA 4KRUA 2PEVA 4MNKA 3GVWA 4FR6A 4HU8A 3PWGA 1MW1A 3W3OA 3E2VA 2GUYA 3TTYA 4IPJA 3KM8A 2ODOA 3AWNA 3F7JA 1BAGA 2W9MA 1FOBA 1DWGM 2VDGA 1S5MA 2E4TA 1FHVA 1UYQA 1VD6A 1UW9A 1TPH1 7REQA 3JUGA 3DXIA 1NEYA 1KCKA 2BVDA 3U4FA 4GE8A 3UZZA 1RVKA 3ZO9A 3L5AA 4YTTA 3PY2A 1PO9A 2E68A 3T09A 3MZNA 1BQGA 4WIWA 5AZ1A 3L2MA 4MWAC 4PB5A 4QEEA 1ZAJA 1ZGDA 2X30A 1GOOA 3UVIA 3ZLHA 1R2TA 2GUUA 2X16A 3T2QA 1GKQA 3PNUA 4H19A 4W5UA 5IHSA 1JF6A 1DV7A 1YE4A 4J3UA 4KWOA 1FWJC 4Q4RA 1E0WA 1EYWA 4I8DA 2VVSA 1E55A 2NZLA 1XUZA 4TMBA 4U5KA 3KOZA 4LSBA 2D0GA 3MI2A 1P0BA 3FX4A 1VJSA 2V8ZA 3ARPA 3TTOA 1CGUA 1ISZA 4Z17A 1YYAA 3FJNA 4Q8UA 5HNRA 3VZYA 2O7SA 5FSDC 3T0BA 3E3HA 3EXTA 1J79A 3DHFA 1HJVA 3BPWA 4NZ4A 1ITUA 1XFBA 2ABBA 1DQWA 3G3DA 3S5ZA 2VR2A 1DWHM 4D6CA 5LHFA 5CBIA 2POZA 1BF2A 5AC4A 4M29A 4FNUA 2AL2A 1DWJM 2RJHA 4UNIA 3SUVA 4CQ9A 1TMLA 1UMYA 3DC8A 2NXIA 4GKTA 2QF7A 4C1NB 2A7PA 2B31A 1TJRA 3S1VA 4ML9A 3EEZA 5DN1A 3GVQA 3LI0A 1NJJA 3SJNA 1VFOA 3L12A 1Z48A 5M5DA 3T8QA 3GD6A 3F1QA 4UTFA 1UJQA 4ROQA 1ZCOA 1VCGA 1RD6A 4HHMA 4LH8A 4UFKA 3KWXA 3S2CA 3P93A 4K7YA 3UYIA 1BWLA 2P53A 4TX6A 1X96A 1V3JA 3LHZA 4D6JA 4BQ5A 1XLBA 1VFLA 1E1CB 2BOFX 4AD2A 1OWQA 3HA1A 1BXNA 4S38A 1JL8A 1UR9A 3GU9A 1PZ3A 1JI1A 4PUEA 5I09A 3QY6A 5I3JA 1GZ1A 1Z6KA 3WNOA 5EL1A 7ENLA 1XM3A 1RVGA 2J7FA 2UBPC 3GSMA 1TWZA 4QG9A 3QW3A 1H7RA 4ZENA 4KFNA 4L56A 2Y62A 2OOFA 4O28A 1AL7A 5AFDA 1Q6OA 4FOUA 5G1YA 4N6EA 4BF7A 3SSJA 3R5EA 2OLHA 3W1TA 3UZWA 3WCZA 5A6BD 3D3FA 1R38A 1YTKA 3LY0A 2OGYA 4DXVA 3OTRA 5CPMA 2ZC8A 4V1YA 5A8QA 3PM6A 3GW0A 3BOFA 4HHLA 2DVTA 3OO2A 4LCRA 4DO4A 2ONEA 5F2MA 2QR6A 3H53A 5ENLA 1NOUA 5HNNA 3R8HA 3KTXA 1LOSA 1R47A 1V6YA 3WQCA 1PDZA 3OW1A 2I16A 4O10A 2WNWA 3VKAA 2RKXA 2GZXA 5AYBA 4B2DD 1JD9A 4MY1A 3QTGA 1TX0A 1W1VA 4OFCA 1TZ7A 4Q32A 1OFQA 3L66A 4IMDA 1JFHA 3K4DA 2OMAA 4JIEA 3I68A 2PAJA 2ZYFA 3SI9A 1T0OA 2DQXA 4NU7A 1A5UA 4B90A 1VFUA 1YDOA 1PXGA 2WM0A 1I2NA 4AQLA 4WK9A 3M46A 5CZJA 3E96A 3EWZA 3G5EA 1AH0A 4KGJA 4NSBA 3EWXA 1C9DA 3BH4A 2HVOA 2NV9A 2ANUA 2DZVA 1E3ZA 5H91A 3E02A 3I3BA 4MNMA 2PDJA 3FJ6A 2WNNA 3GH7A 3TLLA 2E7FA 3E0WA 1LWHA 2D2OA 7CGTA 5JBEA 3AYSA 2J88A 3IAQA 2FPTA 4JTAA 4QE1A 3SCWA 1FCVA 4CD7A 4IP7A 2E67A 5CPTA 3FA4A 1Z42A 3GZAA 5HA7A 1TJ0A 4H4IA 4B5SA 3EPNA 3BG5A 1E56A 2Y8VA 4J35A 4PUKA 4M24A 4KBXA 4N6FA 3IAPA 4E8DA 1HJWA 4RLIA 4DQWA 4J9JA 2BNJA 2QGHA 1D3CA 2B4GA 1XH0A 2J24A 3ABRA 4KH2A 4LVDA 3ZSSA 3MPGA 3WH8A 3B04A 3N73A 2HSAA 3FVMA 2X0YA 4LVGA 2QUMA 4RE0A 5HQLA 3SCSA 3CAKA 3WO8A 3PF3A 5EB8A 3O06A 3WN6A 3KW3A 1EJXC 2YA1A 1P6CA 3IGUA 3GNPA 2C19A 4CNOA 3BLIA 1Q4NX 1MXGA 3ICJA 5CC6A 2WVVB 1QTWA 4DJFD 2CNCA 1I1WA 5J8LA 2HBXA 4Q3MA 3BAKA 4N9BA 3MHUA 4XZHA 4JY9A 2ZX5A 1EC8A 3CIVA 3MI3A 5REQB 2PC8A 3N6HA 3F03K 2GVJA 1L6FA 1UUMA 3O6CA 5CLTA 3PBYA 1A0DA 3O7UA 2BY3A 3HURA 3KP0A 4BWLC 1H62A 4IZGA 1QPKA 4AWEA 3NZPA 4C6LA 1TCDA 3QHOA 1GVRA 4MHBA 2FDSA 1GHRA 4R33A 1XP3A 1SZNA 3QYQA 7TAAA 1X1OA 1AQMA 4Y7EA 3PAJA 3UXIA 3BOLA 1JZ5A 4YWSA 2V3FA 1D2KA 1TFVA 4DJED 4D1IA 4JR5A 3T40A 3WBEA 4FNTA 5I0DA 5BRQA 1H63A 1C7SA 2V0TA 2DSVA 4NX0A 4HNNA 1MRQA 3KVJA 4J28A 2Y8KA 2AGTA 1J2BA 4LF1A 1OADA 3LCXA 3LRMA 3Q4DA 4DJFC 1SO5A 1OFAA 3CASA 2DQWA 5K4ZA 4G9PA 4DYJA 3VNZA 1WDSA 3TNOA 3DG7A 2G4JA 3AICA 1I2OA 2QCHA 4H6EA 3DESA 2FTWA 1T40A 3E2RA 3M0VA 1DJXA 1KTCA 3WLHA 1GEHA 4UTTA 1W3HA 1WX0A 2FB3A 1BSLA 3TW7A 1M1BA 1FDYA 3HPXA 2CFFA 1V6TA 2VEMA 4X2RA 1XYMA 4P61A 1IQ8A 2VR5A 2ZUWA 1J4EA 3CUJA 3GXIA 2Q8ZA 5KZ6A 3KBVA 3UR5A 2VGIA 3GNXA 3GUWA 3JRKA 3AIVA 4ADUA 5BRBA 1D7KA 2WJFA 2CZDA 3ARSA 3WJXA 1KXQA 3EWUA 1FQ0A 1K6WA 1OJXA 2VM8A 3MUCA 1XC6A 1EJUC 1JEZA 3AS0A 2TMDA 4ZE5A 3HIJA 4CVWA 2RFGA 1NDZA 3H2AA 3SUUA 4UWMA 3L0KA 4W86A 1D8WA 1CGVA 1UWRA 4XIAA 3PTKA 1ODZA 3C2YA 3GDKA 3LBOA 4BR1A 2VC7A 4O8AA 5LKYA 1QNSA 3UJRA 4H9YA 1BEUA 5A69A 2FFCA 2GQ8A 1JDEA 2DFAA 2PLKA 3W1AA 1XC4A 3J7HA 4ZA0A 5CEWA 2AL1A 2ZZ7A 2VP8A 3OJGA 3S8HA 3W02A 2HPMA 4UQBA 1LZOA 2ZA1A 3LSCA 5CC7A 1W91A 1KM4A 2GVGA 2XFFA 4ZGYA 5F4XA 3NM3A 1WNOA 2BOEX 4Y9NA 4AYSA 2GUBA 1H11A 3L21A 1GZJA 3KVLA 7REQB 4NZCA 1D8CA 3GIYA 5A6KA 4BHYA 3P62A 1PVNA 2ZADA 3L2IA 4D1JA 1I4NA 3WSUA 2VZSA 4CCCA 1CEOA 3IEBA 3WFLA 2QAFA 1F05A 1DPMA 1XSKA 5BXRA 5G5IA 3E2QA 4UC5A 3WQ6A 1HJSA 5JIPA 2W62A 3CB3A 1FH8A 4TXEA 3NURA 4AD3A 2NQLA 1L0PA 4GH1A 1KFJA 3SN1A 1FWTA 4LVAA 3K1GA 2X05A 4L6HA 3AUOA 3JVAA 1AZ1A 4QITA 5DX7A 3CLMA 3T4WA 1LUCB 4W8BA 3WLLA 3TA9A 4QS6A 4I5XA 4WOQA 4D6GA 3T2OA 4WJXA 3SECA 3QEZA 1Y0EA 2O92A 1H5YA 4GIAA 4ZQNA 1V7YA 3WUFA 4UOZA 3M5YA 3PTQA 5AYXA 4MDOA 1M01A 4YNGA 1EL3A 4JFUA 3W9ZA 2DZXA 1MSSA 5AN7A 5LIXX 5A2BA 1FX6A 1JUBA 2PWFA 4GBUA 2WBGA 4MVAA 3GHTA 2QDHA 1TR1A 2JKEA 2BTMA 4UUIA 3XISA 4TTGA 4NZ1A 4WR3A 3UG4A 4BQ4A 2XSXA 4H83A 3WQGA 3I6TA 4LW7A 3FIGA 4S3AA 1UWTA 4LVFA 4Z1YA 2YFNA 1OYAA 1XX1A 2OYLA 2ZZ4A 3R12A 4CEXC 5ABFB 1E6QM 2QDEA 3INPA 5A2AA 3BAYA 4AY8A 2AGKA 3HG4A 2WC7A 1RQHA 5D4YA 2JEQA 3U4AA 2WMFA 5D9OA 3SN0A 3C0QA 3ARYA 1T8QA 3VDAA 1TMHA 3WD3A 4ZQPA 3ZXWA 4ZMGA 2FFIA 5HJYA 4FXJA 1TKKA 4Y9AA 2ZBTA 3BSGA 1JXJA 2C15A 3VOCA 3W1XA 4JYDA 3NGJA 3GNDA 2OVLA 4AAJA 2WPBA 1CLXA 1JQVA 3L4WA 3WQ4A 1O66A 1UR8A 3PAOA 2X1RA 1JDDA 1TWWA 3ZVHB 2NWRA 3IVTA 3IJLA 3LHTA 2Y7EA 3W7EA 4IPNB 4B4FA 1EZ2A 4W7WA 2PDCA 3STEA 3V1HA 1KXHA 4GNKB 4G2DA 3ERPA 1ZQ5A 3H7VA 4HTYA 3GHSA 1U1JA 2VX4A 4ZO9A 2OGJA 5AHIA 1W9DM 2DZTA 3NA8A 3QSRA 3P5ZA 4AIOA 2Z26A 2XISA 4DB7A 2WBKA 4NX5A 4PULA 3WD0A 3WZ0E 3CWHA 4B3LA 2WWDA 3LSBA 5H8PA 2E77A 2J27A 3IJIA 3TLQA 4E3VA 4MGGA 5C7VA 1XYAA 4XISA 3W2NA 1F8IA 3W84A 3LHUA 3R4IA 1RD5A 3PWAA 5CPQA 1RA5A 4J3XA 1ZBWA 1JRBA 4ATWA 4CQAA 3BAWA 2ZX7A 1G9HA 1S1RA 1BLIA 5HQEA 4OBSA 2Z1BA 4XKMA 1IEXA 2H6RA 4QR6A 2R6OA 1JQXA 1XSJA 2XH4A 4LS2A 3ARQA 2D73A 1GQNA 3TR9A 4P7QA 3ZIZA 4AHOA 4GI6A 3NZQA 3VIPA 1BGGA 3VILA 5LNWA 2OQLA 2VJXA 1VRDA 1X7IA 1BPLB 5CSSA 1RY8A 3GE7A 2DH3A 3CV6A 4ERIA 1I60A 3OQ8A 1SSGA 4PUUA 3IIOA 2VQUA 3SUSA 3TSDA 4E0CA 2YL9A 1DKWA 2MNRA 1OIMA 5GJMA 1KFEA 2IW0A 2GOUA 5EA9A 2HBVA 1J8VA 3AMGA 1G01A 1KM1A 2XH7A 4P8VA 4O4VA 3BE7A 1G7VA 3CHFA 4J3ZA 1XCFA 3UPWA 1EP2A 3NZGA 1EQPA 3N9SA 1HO4A 2GVLA 4UMAA 3C8FA 3B97A 3P80A 1B3VA 3N9RA 3W00A 5I3GA 2P5NA 2J25A 4ZBCA 1I2RA 3HJZA 1V7AA 4E2DA 1EOMA 4ZXOA 3BCJA 3W1MA 4HHHA 1XV8A 2PF0A 1UZDA 4PR4A 4XBJA 3D47A 1H41A 2WNQA 3HN3A 1O94A 2WSQA 3GM8A 2DZBA 4EX4A 1LP6A 1HW6A 4N02A 3WQ8A 1T8XA 4CD6A 3CV2A 2A85A 1CX9A 3WFAA 5CAKA 1HKVA 3ZJKA 3ZS4A 4WRHA 4P7LA 5C9XA 1X8FA 5CJNA 1LL4A 2ADAA 4AD5A 1SW0A 4J3VA 1U1UA 4O8RA 1ZL1A 4A3RA 4B3ZA 1GPFA 2YCIX 3CUZA 1CYGA 4JZ5A 4Q7NA 3CL7A 4M80A 4XQ6A 1PDYA 5KITA 4JTLA 4IG2B 3SM0A 1LRQA 3G18A 3THCA 1RLCL 1TV5A 4HNUA 2INFA 1UKPA 3WQFA 2WZEA 3MYOA 3RCYA 1MRAA 1O5XA 2GGEA 3H26A 3KBNA 3VD3A 3EGJA 3W83A 4KCWA 1O6IA 4C6OA 3W38A 2XN0A 3USBA 2WK2A 4H8HA 4ZTYA 3R0DA 3B9NA 1OC6A 3LPPA 4H00A 5AC5A 1FUYA 2IMRA 2EGZA 4S3DA 1V0KA 1F4HA 2GYIA 4BY3A 3LLFA 2V6AA 4WY0A 4FPSA 1OQFA 3A9IA 4L4OA 3VDBA 4QJ5B 3GR4A 1X7FA 3ZJ6A 2FLIA 1JF5A 1F73A 4N9CA 2ACUA 1N8IA 2PA6A 1LROA 3FSTA 1QDSA 5CG0A 1M9HA 2G0WA 3N2OA 2QJJA 3TJXA 2INZA 1R3QA 3W1NA 3VCCA 2ZRXA 1POJA 2HISA 3UG8A 2R1PA 3S0CA 4F2UA 4HYRA 4XZMX 4ZQOA 3PS7A 5D03A 4QS5A 1FWHC 1L6WA 4MLJA 1XLKA 2PCEA 3SRHA 4EXQA 3THAA 3CT7A 3APTA 5ABGA 8RUCA 4D72A 3EKGA 2DUAA 3PZUA 1Q2RA 1JCJA 4BEUA 3TDFA 4E2BA 3DYMA 4B2DA 3AHZA 2V5LA 5HJXA 2O4MA 2W27A 5DLCA 4UCFA 3T4CA 2QPSA 2G3IA 1W6TA 4UMBA 4IGHA 4DXXA 4KIEA 2P50A 1B31A 4W85A 4XAZA 5IXEA 3GVVA 1GWJA 3WIJA 1UD8A 3URNA 5HINA 3A3XA 2Z24A 3WG6A 5I7GA 1W37A 5KZMA 1F6KA 1QT1A 3HPZA 5CH9A 3TMLA 2YB4A 2G3MA 1Z7AA 3N2BA 3WF3A 2NX1A 2PBOA 4GX9A 3TVAA 2W4XA 3B8TA 4LV4A 1R3WA 3PTDA 4AUBA 3WH9A 3B05A 3V5FA 1WOAA 3N25A 4BI5A 1IR2A 1RBOB 1BXCA 1IYXA 2BP1A 3V4BA 4PBEA 5HAOA 1MZRA 1IXOA 1PEZA 1ZRQA 5EMJA 4WOZA 3U5YA 2QF8A 2Y1HA 3M5XA 1N82A 5GNXA 3FYOA 4LAUA 2ZC1A 4JTCA 1JRCA 4ATLA 2PD9A 5A94A 1XGEA 5HOSA 3OGRA 2J66A 2A6NA 2D1ZA 2PWEA 4HPHA 4L64A 5CPNA 3EX6A 4ZTXA 1Z69A 1XW8A 3W7KA 4JN7A 4UFJA 3OVPA 3ARXA 3CWOX 4H9ZA 2ZZ1A 3GZ3A 3MI6A 4DZIA 4B92A 1GVOA 3UCQA 4GY7A 1WDDA 2EJ1A 3N2XA 4RUBA 2QV4A 3TP4A 4QJ4B 5IRPA 2CLMA 2G41A 4GYJA 4AB4A 1Q6RA 4GA8A 4PMQA 4GK8A 3NQ2A 3GKAA 3MJMA 5BMWA 1VR6A 4DJFA 1PZ0A 4BJHA 1UP2A 3MTWA 5K4XA 1OINA 1BG4A 4QQUA 3AUJA 4GWEA 1ZJBA 4BA0A 2HV5A 3G1XA 3WNPA 2J7EA 1GT8A 4PUDA 1R2RA 4ERAA 2B7PA 3N12A 4MAVA 5IFTA 3UCDA 3OZPA 2WC3A 2BXZA 4LBSA 5A5WA 3QOMA 3BL3A 5I06A 1UCWA 1JCYA 4S2CA 3ES7A 1K70A 3WENA 3W0KA 3DIPA 1SO4A 2WZHA 1GOKA 4AZGA 4C6CA 2GJPA 4EAMA 2ZRVA 1Z44A 3CZJA 1OCJA 4RNJA 1M53A 1C91A 1A5NC 4R53A 1ZBKA 3ZR6A 1E0XA 5DT5A 3DZ1A 2P10A 1OX4A 3BLOA 5D8ZA 1R9YA 4LUSB 3NDZA 4XSMA 3TCEA 1DJGA 4IWWA 3CAVA 3N4FA 3BMWA 3E9AA 2QUVA 2J8FA 3EKZA 1ITQA 5FD0A 2ATMA 1KLZA 4O15A 3L4UA 2H8XA 2BG5A 4XBSA 1DVJA 1OEPA 1DL3A 1Q7MA 4I9JA 4RNIA 1EJRC 4C7FA 1KM6A 1GCYA 1V79A 5B80A 2OG9A 3LB0A 4ICMA 4IPLA 1EXBA 1J0ZA 1AZ2A 3BANA 1ECQA 1FWRA 4A2RA 3CQJA 4U4MA 4CU6A 4KEMA 3UU0A 5DMLA 4UTWA 2Z28A 4HMEA 2C0HA 3ECQA 5JUVA 3M16A 4OOZA 1FKWA 4XO6A 4ZCWA 4LX4A 1YHTA 2BY2A 4AF0A 5FIPA 4RE4A 1HKKA 3O6DA 3QKEA 1C93A 2ZZ3A 1NH6A 1KFKA 3VM7A 6CGTA 1DXEA 4F0LA 4UIOA 4B91A 1MNSA 1UKTA 3B8UA 3TU9A 3L67A 2A0NA 3W7IA 3QKZA 1HJQA 1RCXB 1B1YA 1R8LA 4DVOA 4IIGA 3AS2A 4QXIA 1LTDA 3HOJA 3OVRA 4DRSA 4U5IA 3QR1A 3S42A 1BRLA 3KBSA 1EJTC 5HR7A 2PDGA 2PD5A 1MZHA 2QIWA 4H7VA 3TQKA 4DJDA 4NF7A 5A6LA 4WEVX 1B30A 2Y7GA 2HDJA 3A4JA 2VFEA 1BGAA 1XFCA 2V2DA 3LRLA 1JYVA 1Z89A 1TPFA 1TE1A 4Q8OA 4CQBA 3H23A 4HU4A 1F5ZA 4HSOA 1NWTA 1TPC1 4XX6A 1R86A 5HMSA 4LS0A 4U33A 3IWPA 3STGA 2EPKX 2V82A 3MV11 3RGTA 1GJWA 4NAFB 4DM2A 4FX6M 3JZEA 5I6SA 3WK0A 1VFHA 3DDMA 4GKLA 5CGQA 4CUCA 4HGXA 1SFLA 4ZOAA 2POTA 3IGSA 3ZVHA 2FQIA 1AQFA 1JCLA 2VR4A 2I5QA 3C2FA 3T55A 2V5CA 2J7DA 4GD0A 4IMCA 1MUCA 3KOYA 2CHNA 3IPWA 1W9XA 3WNMA 4FOKA 3EOOA 2C13A 2QAPA 3ABOA 3ZT5A 4N9DA 3CK5A 1WPCA 1EP3A 2OEJA 5E6ZA 2CLKA 3CTTA 1K8YA 1KFBA 3TTEA 1LBFA 1U5HA 3VKDA 2WJEA 3ZFHA 3CQIA 4S3JA 4HBKA 3Q45A 4ICNA 3USZA 4UQAA 1K9TA 2J9XA 4DZAA 2XZ7A 2CITA 4HA1A 3WMLA 3RLVA 4AVNA 1BKSA 3GU1A 2NUWA 4LEFA 1LBMA 4NZ5A 4I8YA 3TQPA 3VNLA 5CSUA 3U2OA 1G4SA 2WO5A 5LGXA 3ITGA 2V30A 3VD4A 1KFCA 1PX3A 5AHNA 1OCBA 4ALDA 2VGBA 3QVQA 3LYEA 1XG4A 4XVDA 1UH3A 4MWAA 4M7SA 4AX7A 2PE4A 3RHGA 3PC0A 1HO1A 1EIXA 1RCQA 1EUNA 2ZE3A 3KXQA 3UFYA 1R3YA 4UZUA 4O0ZA 3TN3A 3F4VA 2IXVA 5JBFA 3MKVA 3LHYA 3SFKA 5C71A 1YKWA 4MM1A 3ITCA 5LGZA 1L9WA 3R8RA 2VOTA 3VMPA 3F4NA 3PK7A 1Q66A 2VZOA 2VDIA 3UETA 1AH3A 4GZJA 1FDZA 2PGRA 4AZ6A 2GGJA 3HU7A 2H3BA 3QFWA 3K30A 2G5WA 3IVUA 3XIMA 3GFYA 3WJYA 4A21A 2D0FA 1K3UA 4GCXA 3S9YA 2IKHA 4TVCA 3W7PA 4A22A 4ZB5A 1UD6A 1TVPA 4ERGA 2DZSA 4W93A 3SGUA 1VFSA 3EDFA 3HMCA 4QAIA 2WM1A 1UD5A 3P3BA 3MP3A 5CXPA 2CLHA 1L2UA 2ZUVA 1A4MA 4AW7A 3R58A 3NQFA 3AXMA 1OCQA 4EXAA 3NL3A 3S9IA 4B5TA 4JTGA 1CXLA 1B3WA 4GJ1A 4RR4A 3WLRA 3HV8A 3PZOA 2R82A 1HKJA 1UPMB 5BOOA 4S3EA 2HWGA 3PFMA 1I2QA 4YTSA 4PEEA 1NU5A 4K1GA 3W7MA 3S2LA 1B0IA 2ESCA 2VX6A 1G0CA 5KINA 1F3XA 2EKGA 4DBWA 4A3YA 1H0IA 4JD4A 4DAIA 1ZENA 3R13A 1ONXA 4OUIA 4IPPA 3URAA 1JD7A 2I7GA 2OELA 2DJLA 5H8MA 4C1LA 1S5WA 2E40A 1DJNA 1W32A 2EQDA 4AC1X 1K9EA 3GC4A 3QFEA 4ZB0A 1S2WA 3C0SA 1MEHA 2H8ZA 2DIJA 2HXTA 5MKGB 1HGYA 4PMOA 4JOMA 3DFHA 1B3OA 1QNRA 3W88A 3YPIA 4YVPA 4IUGA 3A4AA 2NV1A 1T7LA 1O5RA 3JZUA 4A29A 1KGXA 3SB0A 2GDUA 2DT2A 2DIKA 1O7AA 3C8NA 3VK5A 5JU6A 4ZEPA 1WQ5A 5A8GA 3QR0A 1A3WA 4Q8MA 3VOFA 2JK2A 4MNJA 1KXTA 3PPCA 3UWUA 1ME7A 4B5NA 3SW6A 4IMAA 1JZ8A 2NXGA 3PUOA 2C1IA 3RLUA 2P3EA 4GXMA 2CLFA 4FNRA 3RF9A 4F48A 1CXKA 3MA8A 1XIEA 2XM1A 4MJ2A 1VJIA 3BG3A 3GHRA 4A6GA 3BAXA 1FWFC 1DIOA 3RAOA 1GQJA 3W7OA 2VI0A 4HU0A 3ZR5A 1SO3A 2XGZA 2P8BA 4QX4A 4RZ6A 4LJ3A 3DECA 3VFCA 4GZ7A 3NQ6A 3NYZA 1GJPA 5HWJA 4Y2WA 3TSMA 3M41A 3U57A 2NQ9A 4YMZA 3CH9A 4R7WA 2I5IA 1H7NA 2C7FA 3PZMA 2DV0A 3CUHA 4DJDD 1WZAA 2JQXA 4I7UA 3SRKA 3FVDA 2VNCA 4LB4A 4Q4QA 1D9EA 2C0AA 3GTFA 2YA2A 3RM9A 1ZU8A 2B7NA 2F6XA 4FHAA 3I10A 4JX4A 4E2VA 2QUNA 5IM51 4H9XA 3VGFA 4WGXA 1IHIA 3B8WA 1OIFA 3LXBA 1KBKA 1S2VA 1XGZA 1VEMA 3QRHA 4YLWA 1TRIA 4ORIA 1B3XA 1RK5A 2MANA 4KT2A 3T05A 2WKGA 2V81A 3BCDA 2W6RA 2OKTA 2UWFA 3WLKX 3C4UA 4JFWA 2PRLA 4WVXA 3TQVA 3VIJA 1UBPC 3GYEA 2ZA3A 3GKFA 3WEZA 2FMNA 3QY8A 2WCGA 3BGAA 4O1DA 4FLRA 1UA3A 2PTXA 2X0SA 3TN6A 4FI4A 1UD4A 3NXLA 4HP5A 5FF7A 4ZXLA 3LG3A 4FMVA 1XLGA 4RX0A 4WXYA 3HG3A 2XN2A 1XD0A 1MMFA 4IQJA 5TIMA 3MQTA 4L61A 4O1FA 4DXKA 2XM2A 4NXSA 3OVGA 1PE1A 1XD1A 1YPIA 1W54A 3MY9A 2P8CA 4CNUA 4C5YA 5DBTA 4DWSC 4AISA 4F0MA 5I3HA 3C2EA 4NJGA 5FJPA 4DBEA 6XIAA 2DDXA 4RCXA 3NPVA 1VC4A 3SCPA 1GYMA 3WK2A 3QPEA 5J5RA 1ICSA 3HGSA 3O6YX 3DAQA 2BHUA 4PFMA 4GISA 3WF4A 3L4TA 3MO4A 3TC3A 2HZGA 3ZM8A 5G4EA 4Q4OA 2XVLA 1YXDA 4AXKA 3W7DA 4TQTA 3W72A 2W91A 4UOQA 1LG2A 1E6ZA 3RO8A 3WDPP 1WKEA 4QDMA 2J62A 3UD6A 1ZAIA 2NT1A 2ZTJA 3F5KA 1MXDA 2BGQA 1GEQA 2ZXAA 3IJ9A 2WVVA 3IANA 3SCRA 3TA6A 2QHAA 3VABA 2DEPA 3DFSA 2G96A 1I1XA 4PN2A 3IJQA 3SO7A 1PWLA 1QCWA 4MPQA 4H9MA 1ZCCA 4AZCB 1Q65A 1Q6DA 1FTXA 3NCOA 1KTNA 2E25A 3LEPA 4FF7A 3KDNA 3MKKA 4AU0A 4M3PA 1FDJA 2WMIB 4LALA 2VC5A 2Y2WA 3I4EA 1T6MA 3PTMA 4MJZA 2HMCA 2XFRA 1GTHA 1MXSA 1LYXA 2YDAA 3W7LA 4F0SA 5RUBA 2QCDA 3SR7A 4KPLA 3AHTA 3VX0A 2J74A 1US2A 4KMQA 1EC7A 3VIIA 2XPKA 1U5JA 4OWGA 4HCDA 1GOMA 3VM5A 3I7SA 3NQ7A 4FO4A 4O19A 1TTQA 1R3SA 4FP1A 5EMMA 4IL2A 1P0EA 5DMNA 4ZQCA 2FZMA 3WQOA 3T8LA 4OBRA 3JR2A 1LWJA 5T9BG 3RCNA 1LJYA 4AF0B 5FF3A 3WEOA 3VIMA 3N2CA 2DUZA 5CPSA 3WLIA 1JVNA 5F2LA 5PTDA 2KZHA 2TRSA 1YDVA 4HJWA 3DEQA 3GH5A 3LK6A 3KLLA 4H01A 3WLOA 4M7TA 4QNEA 4HOWA 1HNYA 3CTLA 3KTCA 3NDYA 1OD8A 5AVNA 4R27A 1CXIA 4DEFA 4AD0A 5LXXA 1FWEC 1V02E 2D20A 1HN1A 3EX3A 4W89A 4HPGA 4HB7A 8A3HA 1SZGA 3VIHA 4QE4A 3RMJA 4MB3A 3FKKA 2FKPA 5BRPA 4E4UA 4DPQA 5H1WA 3MZ2A 1GVSA 4Q8QA 5FF0A 1EZWA 4DZHA 4XKYA 4QG6A 3EAUA 4AEEA 4C1NA 4LV9A 2FB2A 5AHFA 2DVXA 4V27A 1W17A 2X42A 3QH2A 5DCDA 2PLMA 2QEZA 3ABXA 5CG7A 5I3IA 2JF7A 4QJ1A 2NVDA 2XG9A 1XCXA 3WL1A 3W25A 2YYTA 3KZSA 3OHMB 1KBBA 3LPOA 2UY3A 1R7OA 4NYUA 2YBUA 2F61A 1XLIA 3AMKA 1WE5A 1RJPA 3DFQA 3M0YA 1OGBA 4KW2A 4IPIA 2EPMX 3FJ4A 3VC5A 1O1ZA 3GDBA 4ADSA 1K8XA 3AIQA 3SCUA 2C6QA 3V16A 1CDGA 4LRTA 4H6RA 4W9TA 2QJIA 1IIGA 4MB1A 3EZ4A 2ZRWA 1BXBA 3HJEA 4GYPC 9XIMA 1CTNA 4QSH