3WJXA

Wild-type orotidine 5'-monophosphate decarboxylase from m. thermoautotrophicus complexed with 6-amino-ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 85
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wjxA00
3O6YX 2YZRA 3GDLA 1I2PA 1EB3A 2XN1A 4OHQA 2XN0A 2ABAA 3TQVA 4EF9A 3ZWSA 3M41A 1OG0A 3GVGA 4HSOA 4KWVA 4RXFA 4ZMGA 1OK6A 3STGA 3W1MA 4MY9A 3RF9A 1HO4A 4MJMA 1R2SA 5AC6A 2YPIA 4YLWA 4MPQA 2QJGA 4A3UA 1RQBA 3Q2DA 1Q3NA 3W7CA 3HQ1A 3TW7A 1TPFA 1L6YA 2JKEA 2FPTA 2PC4A 3W2LA 1R30A 3TFXA 3TC6A 2YFOA 2G5WA 4JNMA 4M7TA 2V2CA 2TMDA 3EWXA 4LT9A 2YXGA 3STEA 4AMAA 2PCQA 4FB7A 3W2MA 5DELA 5DN1A 1U83A 2ZA3A 4O1BA 3TQ0A 1ZAIA 3P60A 1H7OA 4CQ9A 1KBIA 3CM4A 3DENA 3G0SA 4ZQOA 2ISSA 1KM6A 4ADTA 3SW6A 4IX2A 2YDAA 4BR1A 2ZQ0A 2OZ0A 3NQ7A 4HKPA 4MYAA 3DKLA 4O4VA 1SZNA 3P62A 4PH6A 2HSAA 4K37A 5DBTA 4UTJA 3ATYA 3KHJA 4NU7A 3F03K 4HPXA 3UXDA 3L0GA 1LRQA 2V5BA 1ZJIA 1LOLA 5SWUA 3BPWA 2C6QA 1ME7A 3NQDA 3T4CA 2C15A 5FEZA 3NQFA 1W54A 4LS0A 5DCEA 2NWSA 2V2HA 1C9DA 3S5OA 3STCA 3B03A 4O8RA 2WNZA 5LNRA 3I6RA 4R7JA 2ZZ2A 1ZHAA 2OCZA 1WOBA 2E6YA 5CZJA 4A21A 3W71A 2RKXA 1B4KA 2FFCA 3L66A 3H54A 5CSSA 4ZZ9A 1OVDA 5HWMA 3EXSA 2B7PA 4WY0B 1G4TA 5CZSA 2ZRYA 3M43A 3SSJA 3GKFA 4OQVA 2WQPA 1VRDA 3UWVA 4LS2A 5C54A 1KFLA 3CC1A 3C0JA 4TIMA 2Y7DA 2CLKA 2Z6IA 4LOCA 1W8SA 3VI2A 4UMCA 4CCEA 1KFCA 4O57A 3W1PA 1XUUA 5EMUA 1ICPA 3NQGA 3V75A 3HIJA 4OU1A 4LVGA 3S0CA 1VCVA 1SU5A 4UTTA 4IMCA 5CPOA 3R8RA 3M44A 4MZYA 4QAIA 5D09A 5I3IA 4LUIA 2C19A 1CW2A 2YCEA 2QEZA 1KV8A 3NGJA 4L4MA 1VCFA 3ABSA 3P84A 4LS1A 5AHNA 1I2OA 1WA3A 3M5YA 3S1XA 4UTHA 1FWTA 1SW7A 4JX6A 2R94A 3E12A 4DXVA 3WFAA 4CQ8A 5HWNA 4RR4A 3PB2A 3UPWA 3FLUA 4WOQA 1OFPA 3QMSA 3W1NA 1JJKA 5AHFA 4BK9A 2DZSA 3IV3A 3NZ1A 3HO8A 3O6CA 3GYEA 1H61A 4WJEA 1FDJA 1QPRA 1KM0A 3P80A 1AL8A 1KM5A 3IVTA 4NNBA 1NF7A 4LRSA 1JUEA 3EX6A 5CPNA 1EWEA 3FIGA 3LRLA 4EF8A 2CU0A 1FWWA 4L4LA 3R5EA 3W7PA 2J27A 1H1YA 4OGZA 2Q8LA 4U4MA 5HMSA 3LTYA 3GB6A 1OX5A 1ZENA 5D33A 3TNOA 3B4UA 3C61A 4DO5A 2QCCA 4ONVA 5KMYA 3KX6A 3LHVA 1WYIA 1GG1A 2VFIA 3LCLA 5F4SA 2PRMA 2WSRA 3VCRA 4I7WA 4IPJA 1H51A 2E6DA 4OE7A 3MHUA 3W1AA 1TPEA 2Q3RA 2WV8A 4JIPA 4AF0B 1WAUA 4NJHA 1Z44A 4UFMA 5I3GA 2VEKA 1O60A 4R53A 1XFBA 1XL9A 2E77A 4O1DA 4DO6A 1H63A 3H53A 4Y8FA 4JX4A 5TQLA 5D2XA 4ZQNA 1TIMA 5D37A 3N34A 5D38A 1Z48A 1ZFJA 3N19B 5I3FA 1X7FA 1THFD 2V82A 3EKZA 5CG7A 3NQVA 2ZTJA 3ZS4A 1D9EA 3W1TA 1TV7A 3JRKA 3F1QA 2UV8G 2VFDA 4O53A 3WJXA 4QQ3A 2OT1A 4UNKA 3M0ZA 4O0ZA 1EP2A 1ML1A 4JDYA 2KZHA 3MYOA 1AK5A 3P82A 1IXQA 3N9RA 2OX1A 5HQEA 1WBJA 3GZ3A 3DFOA 3G3MA 4N9CA 2BZNA 3G3DA 3LGEA 4XKYB 2GPTA 2FLIA 3LLFA 1VQTA 1H60A 4JS3A 3V1PA 4N2YA 3MBDA 3FOKA 4NVTA 1UUOA 3QM3A 5U4NA 4AXKA 4GUHA 4PL1A 5D05A 1TYGA 4X9SA 3CEUA 4P61A 3G24A 2NWRA 2CLFA 2Z2UA 3MO7A 1RQEA 1FY6A 3U2OA 2B7QA 1MXSA 1VPXA 1XDLA 2V81A 3E02A 3NNTA 5I3JA 1OF6A 3QPZA 1W1ZA 1DVJA 3TFCA 4GXMA 1HL2A 1L6WA 1O94A 1WOAA 3O15A 2W6RA 4ZQRA 1OX6A 1F05A 3G8EA 4N4QA 3C6CA 1IF2A 4O1CA 1L2UA 1ME9A 1NAL1 4R34A 3MW7A 2Y61A 1GEQA 1JR1A 3SGZA 1G4EA 3NPUA 3TUUA 1W5QA 3U6WA 2P0OA 3W2NA 1I4NA 5DBUA 2CZFA 2OMAA 4LVAA 2C3ZA 5AB3A 3NPVA 1DORA 2X1TA 3NDOA 4XBKA 4K7VA 5HUOA 3FKRA 4BI6A 3NA8A 1N55A 3MMTA 5FF2A 3FJLA 1EUAA 4NX5A 1SW3A 1AW1A 3DFSA 3QC3A 2VELA 3EWYA 4FNTA 1TRDA 1WV2A 2J24A 4Z1DA 3W73A 5C55A 1S5VA 4LU0A 1EP3A 3LRMA 3W83A 3S5YA 1K7XA 3DH7A 3GAYA 2YW3A 1B9BA 2GVJA 2WJZA 4Z1AA 1OFRA 2NV1A 4Z08A 2X30A 1GZGA 4JTLA 3MHGA 2ATMA 4LC8A 3DU0A 1L9WA 4PFMA 5AHLA 2CLEA 1FCQA 2E5BA 3LXCA 3OVQA 5LNWA 4DBEA 2JGYA 3LCWA 1KM3A 1LRTA 1TSIA 3RU6A 4ORMA 4X2RA 1GVFA 4ICNA 2EGZA 2GQAA 3W7DA 4IJBA 1TPH1 1JVNA 4EVZA 2G95A 2Y7GA 5HUPA 1BEUA 5LGZA 4WOZA 3NZRA 1L6SA 3UWYA 2EAWA 1JCYA 4FO4A 3RK8A 5LNVA 2ZDRA 3P74A 5FESA 2GJLA 4JDBA 1QOPA 3S5ZA 3CWOX 3PVFA 5BMWA 4AHQA 3M9YA 4JTTA 4DF2A 1YPFA 3UWWA 3QSTA 3MP5A 4PEKA 3TDFA 1ALDA 5DY2A 3IGUA 1I2NA 2J9YA 4H4IA 5HJLA 1B3OA 5HNRA 1F74A 4RZ5A 5E93A 1IIGA 2Q3OA 2VEPA 2A85A 2E68A 4G1KA 1V7YA 1T96A 1JCNA 4CQAA 1JCLA 4LNYA 5CZTA 4CNPA 3IVSA 3WK0A 1E51A 4O15A 4QSHA 1OFDA 3GX9A 3UY7A 1H62A 3FYPA 3EX4A 1FQ0A 4JTFA 3TMLA 3G1FA 5LSMA 3FJ6A 3GNDA 2HS6A 3NEVA 2FIQA 2C13A 2ZFAA 4UFHA 5LGXA 1ADOA 4MUZA 1K03A 4TR9A 1DL3A 4N4PA 4ORIA 1MZHA 5KINA 5LNSA 3BW4A 1K8ZA 3LDVA 1U5JA 3C4UA 3GNNA 1LDCA 4FEZA 4JGDA 3G0UA 4M6QA 3UYCA 4RKAA 4UCGA 4CLMA 3OIXA 5F1UA 4GC4A 2BX7A 4OWGA 3S8HA 5G1TA 4IXXA 3W2UA 3TKFA 1PHQA 1KW1A 1VHCA 2TRSA 2VFHA 3B8DA 2JGQA 4XZ9A 2BWGA 1EUNA 1GT8A 3LBMA 3KRZA 1ZY9A 4XQ6A 1OYCA 1GOXA 4A2SA 4AHOA 3EKLA 3TSMA 3PWAA 3W72A 3TROA 3QZEA 3SFKA 3LERA 3QRHA 3ANYA 2IQTA 3G1DA 4K6AA 4AEOA 3MUXA 1TQXA 3PUEA 2H6RA 2YFNA 3C56A 1W3TA 1Q6QA 2NXGA 2QUTA 3LHZA 1R47A 1EWDA 4HIBA 3KVKA 3SY5A 4E38A 2JKPA 2TPSA 3W7KA 1EEPA 3NG3A 2YYTA 3PULA 3T44A 1DQWA 3LI0A 1TTIA 1JULA 3Q94A 3E96A 1UJPA 3TAOA 1GYLA 3LCHA 1TPC1 2V5LA 4RJEA 5HINA 3NM1A 2A5HA 1XCFA 4NUWA 1SSDA 5TIMA 1SPQA 1G7UA 1P0NA 3GR7A 1JCXA 2ABBA 1KTCA 4DELA 2VOMA 3DHDA 4IXHA 2YW4A 4AB4A 2DJXA 3LOTA 4ALDA 4BFAA 3BLIA 2CLOA 2F7FA 1S5TA 2CWNA 2YGYA 3DBPA 3H55A 1Y0EA 1LCOA 2NZLA 2GQ9A 4HN4A 3W75A 2ZZ7A 3W3OA 1TO3A 1BWKA 1YPIA 1VYRA 4OBTA 2E6AA 3DHFA 5HR6A 1LRNA 1KM4A 3LXAA 1X6UA 1RR2A 1BTMA 5BW6A 2H3BA 4S1FA 3ZWTA 1SFJA 3C8FA 3DFQA 4O16A 3W7LA 2FJKA 1O4UA 1G69A 2CZDA 4Y96A 4JN6A 3FEMA 1A5SA 3S1UA 2ZZ4A 3THAA 4C1KA 5G1YA 1HO1A 4YL2A 1T99A 1XUZA 3MI2A 3N3MA 1OFQA 4JTGA 3TE9A 6ALDA 4FHAA 3L21A 4C1LA 2Y88A 2PE4A 1DHPA 4A2RA 3OHIA 3CB8A 4MFEA 2ZA2A 2OT0A 2C1HA 5EY5A 5FEWA 4CNNA 1H50A 2QJHA 3B04A 3K30A 3HGJA 3W07A 1XBXA 3R13A 4IOTA 3IIXA 4W9TA 1GTEA 3KXQA 2LLEA 5U7SA 2Z1BA 2PURA 3B0VC 5K7JA 2A7PA 3C3NA 3UWQA 3W84A 3GXPA 2GVLA 2RH9A 1MEHA 4N6FA 3LV6A 3PG8A 3G8RA 1PIIA 3B05A 2VKZG 4RX0A 3TCEA 3BG5A 3GDTA 1SO5A 5CSRA 1OF8A 3WK3A 3W88A 3W87A 3DI0A 4BWLA 4DEFA 3G1YA 4AH7A 2QCMA 4UR7A 4BWLC 2ZRWA 1ICQA 3L0KA 3GDRA 2CFFA 4PODA 3PBWA 4Q32A 2EF9A 5EPDA 4R33A 1J5TA 2JBMA 1KFEA 3KAOA 3P67A 4BF9A 3C2VA 5L9FA 2C16A 4KFPA 5D2VA 1N7KA 3LHUA 3W7OA 1W5MA 4YXGA 3QQ0A 2Y89A 1FX6A 4RV8A 1G4PA 2DZWA 3QW4B 4WY0A 2RDUA 1D3GA 2A2IA 3L67A 1KFJA 3HG5A 6TIMA 1OFEA 2CW6A 5FF3A 1TJPA 3UY8A 3C52A 3N2MA 1SSGA 5KSWA 3G0XA 2QCHA 5F4WA 2YSWA 3LV5A 1F5ZA 3EWWA 3I7SA 1OHLA 1X1OA 3GIYA 4IMGA 3NPWA 3PBUA 4YMZA 3HJZA 3I65A 2RDWA 2J9XA 5FF4A 1BKSA 2B4GA 3NQAA 1F6KA 3L65A 1IXPA 3RNDA 4JTKA 2R8WA 3W70A 3M5VA 2VC6A 2W0UA 1QMLA 2C18A 2O7SA 4GNJA 1VHNA 4DBDA 3HG3A 4HNTA 3NXFA 3BG3A 3EXRA 3IGXA 1VR6A 3N14A 5BMXA 1X1ZA 1G4SA 4MKNA 1YXCA 4PCFA 5IM51 1M5WA 1QDSA 4O14A 4QNEA 5D02A 2Y70A 3A21A 2TSYA 3W7JA 3W85A 1YXDA 3DGRA 2JKAA 2BSLA 3G1XA 4IMDA 5C5YA 5H2ZA 3BVJA 4JIQA 2NXHA 3RLVA 1VJIA 5FF0A 3R2GA 3VKJA 3I68A 1W3IA 3N73A 3BW3A 5D03A 4UTLA 3NAVA 4UFKA 3KVJA 5CPMA 3EWZA 3HGRA 1MEIA 3UZ5A 1H7RA 4JTEA 5K9XA 3LBCA 2B7OA 3PC0A 1EPXA 1AG1O 1LROA 1GVRA 4LVFA 1DJQA 5H91A 2WNNA 5K9DA 1VH7A 1BWLA 3IRDA 3LHYA 3M5ZA 1SUXA 3M47A 1CI1A 2E5DA 2NX1A 4K8HA 4JX5A 4H6KA 5AHMA 5GVJA 2G97A 1RQHA 4GE8A 1FCBA 4MY8A 4DPPA 4O4WA 4FIRA 1R46A 2V30A 3NL3A 3L5AA 1VLWA 4IWWA 3BARA 1PV8A 4FXSA 2Z6JA 3M7WA 2Y6ZA 1TMHA 2X2GA 4UFJA 3QYQA 1HUVA 5EBUA 3IEBA 2QUUA 2ZCGA 4JTUA 2NUWA 3S5NA 1SZEA 1OFAA 2HMCA 4JEQA 1TPDA 2VFFA 3IVUA 4FX7A 4Z1CA 4AAJA 2DJLA 4QJ1A 4NZJA 1XKYA 2O7QA 3W2KA 2ZRZA 1TPB1 1KTNA 3MJYA 4K7YA 5HWJA 2GQ8A 4AWSA 1B57A 3BGGA 5MHBA 3SJ3A 4K8EA 1PCWA 3WJSA 4QITA 4JY8A 1V5XA 1XXXA 1H7WA 3HGSA 4JR5A 3UXAA 3PUDA 2EKCA 5D32A 5AC8A 1K8XA 1AW2A 3BW2A 1B4EA 5AN7A 3FFSA 4H3DA 1FDYA 1HG3A 3UD6A 3NL5A 1QPNA 3SECA 3A5FA 2V8ZA 3NL2A 5AYZA 4WUIA 1KV5A 4IQLA 5K2ZA 2CLIA 4KFOA 1FWRA 1W5NA 4Q33A 1HFBA 4AVFA 4TMCA 2Y62A 3W1LA 1S5WA 1PL9A 1DBTA 1OYBA 4XWUA 4LTSA 3TJLA 3MI6A 1RPXA 4I7VA 4GBUA 3FYOA 3N9SA 1G67A 1ME8A 3UWUA 3QQ1A 3DFTA 2ZA1A 1YYAA 5BRBA 5BOOA 2W79A 4TO8A 4CNOA 3C2FA 5T26A 2QCDB 4LRTA 3O1NA 1W37A 3I7QA 2I1OA 3W7MA 2A6LA 3QSRA 3O06A 2A6NA 2VENA 4HNNA 5CGQA 3PY2A 4LW7A 1LOQA 2R14A 1VYSX 2CZEA 5HULA 4O17A 3GXNA 4RZ4A 3AO0A 1JRCA 2WPBA 3MWAA 3O6DA 1KA9F 2GOUA 1KLZA 1TRIA 1TTQA 1H5YA 3D0CA 1W5PA 4M19A 4DQWA 1AL7A 4Z0JA 2YYUA 2TYSA 2DZXA 3TA6A 3TX9A 1AW5A 8TIMA 2DZPA 5G5IA 3T7VA 5KITA 2D73A 2FQIA 2QF7A 1Q6LA 1FCUA 3IIVA 2DZTA 5D04C 4FX8A 2WO5A 3HG4A 4NZFA 2GJNA 5LKYA 4QNWA 1SZGA 1A50A 1J2WA 1TB3A 4XTIA 3LCFA 3QPYA 1OX4A 4PC8A 3F4WA 4J9JA 1RV8A 3A24A 3W7QA 3QF0A 3NL6A 4M7SA 3P8JA 4KWWA 4WXZA 1JQVA 1JQXA 4NJJA 3USBA 3HF3A 4FIQA 4UTIA 3TJXA 4X22A 1X8FA 4UTMA 4PTNA 1ZAHA 1P4CA 4M6VA 1TV8A 1J4EA 1F73A 1PVNA 4M5PA 2NX3A 4ZL1A 1GVOA 4FNSA 4PA8A 4UMBA 3KOFA 1SO6A 4M6PA 1H1ZA 2VEIA 3W6YA 2X1UA 2H3DA 3LM7A 4WY0F 1TCDA 5K3VA 3MP3A 2RFGA 1YTDA 4O28A 1JUBA 1FXPA 3EX2A 3T40A 1ICSA 3O16A 1VCGA 4NX0A 2A4AA 1LYXA 4JY9A 2A1YA 1JCMP 2X1SA 1QPOA 3EEGA 3MHFA 3PG9A 1ZAJA 4K36A 1QFEA 3CPRA 1LP6A 2RHGA 3HPSA 3CEPA 1TQJA 4JTIA 4UXDA 4X3ZA 1G7VA 1T0OA 3UQNA 5C6MA 1IXNA 3GAKA 2NUYA 2CLMA 1GVQA 1FUYA 3NQ6A 1TPUA 4WZHA 5D30A 1WXJA 3Q58A 1G6CA 1K7FA 3A9IA 4LUJA 3W7IA 4ML9A 4HHPA 2ZRVA 3M5XA 2QAPA 3L2IA 1P5BA 5BNKA 4Y6GA 2FB2A 5F1VA 5E0KA 4P2VA 3NM3A 4MJZA 4IUOA 1LBMA 1YXYA 4GRSA 3I7RA 1IIHA 3HG2A 3T55A 1AMKA 3W76A 1S3HA 4RLIA 3DZ1A 1RZMA 2J9ZA 3B06A 3W1QA 2PRLA 3KRUA 4MLJA 5CZ0A 2Y63A 1SFLA 3S1VA 2QUVA 3VE7A 4I9AA 1WBHA 3O63A 2QDHA 2YR1A 4XTDA 3DI1A 4O10A 1I45A 1WDWA 1XBYA 3OBKA 1QR7A 2A21A 2Y7FA 3B0UX 3EX3A 1QO2A 4WQ6A 1WX0A 2AQWA 4LVDA 3BLEA 3UNDA 2ALDA 2DORA 3PSVA 4GWEA 2OJPA 1I8JA 4A29A 1SR9A 5IBXA 3GDKA 2B0MA 1GTHA 1EIXA 4EWND 5IBXC 3LTPA 2P1FA 1DQXA 1VLIA 4KKXA 1W0MA 5J5DA 3NQ2A 1A53A 3P61A 3LTSA 3LRKA 1XI3A 4O18A 1KFBA 3TH6A 4QISA 3CLMA 1ZNNA 3QMRA 3A23A 3PF3A 1UCWA 5DLCA 3O8AA 2J88A 4UIOA 1M6JA 5DXXA 4UR8A 3W23A 3M6YA 7TIMA 2VEMA 1OABA 4GUIA 3B0PA 4EIVA 3BV4A 4K38A 1LOSA 3W74A 1TPWA 2E09A 3KVMA 4S2CA 2V9DA 1F6PA 1Q6RA 4XUGA 3G22A 4N9DA 2AGKA 4JTSA 5FEXA 4QM1A 3S6DA 1QO5A 3NQCA 4ADSA 5G2HA 4E2DA 5LHEA 2V2DA 4HNUA 3NQEA 1IXOA 4E2BA 4ZQMA 3SGUA 3QEZA 1QWGA 5AYYA 3UPBA 3OVPA 3TV8A 1DJNA 4EOUA 4O50A 3M16A 3HOJA 3FA5A 3NPXA 4JYEA 1P0KA 4O13A 1YADA 1I2QA 3DFNA 1UUMA 2CLHA 2Y85A 5G2IA 1A5AA 4GJ1A 5TBOA 3FKKA 1LORA 1LLZA 3ZR4A 1NVMA 3EX1A 5G4EA 4JD4A 3G18A 2J6XA 3E49A 3RFAA 1GJPA 1VZWA 5I3HA 3WJYA 3HBLA 3KRSA 3OA3A 3QW3A 3HGOA 5G2WA 3WK2A 1YDNA 2AAMA 3HPZA 3EWBX 3ABQA 5EKYA 3CU2A 2DP3A 4UNLA 3INPA 4MFDA 3S42A 4O52A 2X1RA 5EL1A 2VFEA 1GPWA 3P5ZA 5F4XA 4GUFA 1RVGA 2ZZ6A 2QCLA 5I3KA 2E1DA 1TREA 1GWJA 1Q6OA 3W7HA 3TXVA 4MZ8A 3P5YA 5KZEA 4TX9A 3PM6A 1KM2A 3Q37A 2HS8A 1D3HA 5KZDA 4IX0A 1SW0A 3TR2A 3PB0A 5F2LA 2EHHA 5CPLA 4Z0SA 1JCJA 4HPJA 5CKSA 1I2RA 3NQMA 4AWTA 2H8ZA 3W86A 3QMTA 1M7PA 4UTTC 4NQ1A 2VXNA 3GKAA 1MSSA 2BXVA 3DFPA 3R12A 4Z1BA 3R89A 3UWZA 1PCKA 4Y90A 1OK4A 4UTWA 3EB2A 3ZFHA 1W31A 1M7OA 2A7NA 3QJAA 3W1UA 5LNUA 4UTWC 3AJXA 1N8FA 1EX5A 1W3NA 2QKFA 3S1WA 3DKJA 1K7EA 3GR8A 3SR7A 3VNDA 4BI7A 1OJXA 4JYFA 1Z42A 2ZZ3A 3L5MA 2H8XA 1MEWA 3PSWA 5FEPA 1PS9A 2ZZ1A 4O54A 1Q45A 3P7YA 4NJIA 4YCPA 1H7XA 4AWUA 1A5CA 3W2JA 1QPQA 2C0AA 3W9ZA 2BTMA 5DCDA 1UB3A 3MYPA 3NO5A 2GUUA 1YDVA 1YTKA 3S9YA 5FI8A 3BG9A 3GLCA 1O5KA 2DZVA 3MI3A 3TW6A 4O19A 4RCXA 1H7PA 1K8YA 5KTLA 1TPVA 5D2TA 5D2YA 4O12A 2FTPA 4DPQA 3L9CA 1QCWA 2ATSA 3G1SA 3PUOA 1NFBA 2GVGA 1Z41A 3UZJA 1FCVA 1NEYA 3ELFA 4RXGA 2ZYFA 1P1XA 4OV4A 4POCA 1K3UA 3NQ8A 5G4WA 2I9EA 2QCNA 5AHIA 3BGJA 1PE1A 4U28A 1KTBA 1O5XA 4UTUA 4DF1A 4GFSA 1EA0A 1FWNA 1F76A 5HR7A 5LHFA 3CIXA 1H7NA 4LY8A 3PAJA 5DY3A 3L5LA 1OFBA 3TIMA 2YX0A 3ABOA 2E6FA 5A5WA 1PHWA 3RLUA 3EXTA 4WD0A 4K39A 3TC7A 4UUIA 1C29A 1XBZA 1R2TA 1YDOA 4AF0A 3TMQA 4UC5A 2QCFA 1QNVA 2QDGA 3LHWA 2ZZ5A 1GYNA 2R91A 4NJGA 2DZUA 1NF0A 3T78A 3TSBA 1VGAA 3LCIA 4ZQPA 4OT7A 1TTJA 3LX9A 5K9CA 3C2EA 4JICA 3ABRA 4IGHA 2CZ5A 3GK0A 5K4XA 2HTMA 4ZQCA 1UBSA 1WQ5A 4I7UA 4XBSA 5K4ZA 2NV2A 3PR2A 5DCBA 1ZALA 3KVLA 4DF0A 4ZVJA 3P81A 3G1HA 4JTHA 3LB0A 2X16A 4MZ1A 2FPYA 4UMAA 2G96A 4JTJA 4Y9AA 3GXTA 2V0TA 4WXYA 4LV4A 3OEXA 3JS3A 1R2RA 4XKYA 5AHEA 3M1ZA 4N02A 4NJKA 1MO0A 1F2JA 4LWWA 3PBVA 3W7NA 3L68A 3IIOA 3LI1A 3YPIA 1JUKA 5J5RA 1LTDA 4O0KA 2RDTA 1FDZA 1DOSA 5A8GA 2XFWA 3TXZA 1SZFA 2F84A 3VE9A 2BLEA 3THQA 1EP1A 2FPVA 2ZTKA 3HB9A 3W1XA 4B5NA 4O1AA 5KZMA 3C2RA 3TSDA 1SO4A 1TJRA 3SI9A 3BLFA 4D2JA 3DAQA 2FDSA 3NOEA 4BI5A 1OX4B 4LC6A 1TV5A 4FNPA 4A22A 4N9BA 3OVRA 3IGSA 4TU1A 2ZBTA 3IIPA 2ISWA 1C8VA 1VC4A 4RZ6A 4DO4A 3QH2A 4QIUA 1A5BA 1KBJA 4FF7A 3MP4A 1XM3A 3W1RA 2P10A 3LXBA 3C2OA 3E9AA 2QCDA 1T8XA 1O95A 3FS2A 1FWSA 2Y7EA 3MBFA 3STFA 3RMJA 4O11A 3W7GA 3DXIA 1W56A 2Q8ZA 1YLVA 2NX9A 5AFDA 3BO9A 1ONRA 3A22A 4ADUA 5LZLA 1RD5A 3CQ0A 3E0IA 4LVBA 3IIZA 4FNQA 2QJIA 4E0CA 3WJZA 3F4NA 3HMJG 4CCDA 2PRHA 3O07A 4CCCA 3P8IA 3VFLA 2XN2A 1IGSA 5F2IA 5E1QA 2ISVA 1GQNA 1FBAA 4AHPA 3QFEA 2EPHA 3CWNA 4YCOA 3OG3A 1OFOA 4FXRA 1ZCOA 2I14A 2VFGA 2FB3A 4HSNA 3TQKA 3LHTA 4WX2A 2WSYA 5L6UA 3ATZA 4FNUA 4GUJA 1HTIA 3W7RA 1LZOA 3WK1A 5C2XA 3LCXA 1W5OA 1YTEA 4UTKA 4NNCA 4PL2A 1SQ7A 5F2GA 2WKJA 3TU9A 4MOZA 3KFTA 5EYWA 1NSJA 1LBLA 1QAPA 3W7EA 4N9EA 3WJWA 2E5CA 1VYPX 3TK7A 1FXQA 4JXCA 4MVAA 4NXSA 2JK2A 3U8GA 2B7NA 1DKWA 2C14A 3EWUA 1LLWA 2Z0IA 3G1VA 4TMBA 5AOUA 3N2XA 1XDMA 4NNAA 3BK0A 5FF7A 4UFLA 2QAFA 2WSQA 5ABTA 4UFIA 3A5VA 2NUXA 2H90A 3LCGA 4FNRA 3W22A 3SIZA 1SO3A 1TTPA 2DU2A 1DV7A 3TAKA 3PBYA 4MYXA 2CLLA 3SZ8A 4IPIA 4RK8A 2NXIA 3CT7A 2ZRXA 5DXYA 5D2WA 4MIMA 1LBFA 4NXKA 4IMFA 1UASA 2A0NA 3NR0A 1CX9A 1OYAA 1JRBA 1K02A 2NLIA 3LLDA 2QCEA 4NT0A 5AC7A 1LM1A 5EA9A 3JR2A 4FX6M 4IMEA 4HNVA 1KM1A 1QOQA 2QCGA 4OV9A 1KLYA 1GVSA 4Q4KA 3G1AA 3O05A 3CHVA 1GG0A 1F7BA 4LV9A 1KFKA 3CIWA 4YWIA 2WOQA 3PS7A 4GUGA 5AYXA 3NVTA 2ZRUA 3CTLA 3GDMA 1VS1A 4KFNA 4S2BA 4JYDA 5F2MA 3L0NA 4HT3A 1XC4A 4N6EA 3NYZA 1XBVA 2A7RA 4MLRA 4MY1A 3HPXA 2WNQA 2QR6A
chains in the Genus database with same CATH superfamily
2HVMA 2VUNA 1EB3A 2J75A 2PDMA 2DT2A 2F6KA 3ZWSA 3M41A 3GVGA 4HSOA 3PBGA 1ZJAA 1J01A 2HNHA 3RF9A 2Z1SA 4MJMA 1R2SA 1DQUA 3S4TA 5AC6A 4E8DA 2IQ0A 4INFA 2QJGA 1RQBA 1ZBCA 3TW7A 4ASTA 2R82A 1TPFA 1L6YA 2JKEA 3VYLA 4B9YA 1RALA 3W2LA 1OG6A 2OLSA 3TC6A 2YFOA 3T4WA 5B80A 4NSBA 2OZ3A 2G3MA 2V2CA 5BRPA 1XHGA 4C6EA 3WLOA 4LT9A 4PSRA 4AMAA 1ZB5A 4FB7A 1TZ9A 3DCPA 1OQFA 1JPDX 1ZAIA 1H7OA 1KBIA 4FR1A 5ECUA 2IXVA 4ZODA 3FDGA 3MJMA 1AFSA 3APYA 3KL5A 2OZ0A 3NQ7A 3DKLA 3PP7A 4PH6A 4K37A 3TJIA 1ITQA 3DN5A 5DBTA 1WZKA 4UTJA 3H6OA 3M0MA 2PLCA 1LRQA 2WANA 1GCYA 1U5VA 2Y1HA 3N2BA 1DIDA 2C6QA 1ME7A 4J7RA 4AZCA 3OODA 5FEZA 1VP5A 1W54A 3OO2A 4B92A 2CITA 3N6HA 4AYSA 4HPGA 4HMEA 4DYJA 1ZHAA 4Y8EA 3SCRA 2Z24A 2E6YA 4JCLA 5CZJA 1X1NA 4H8VA 1FWGC 1WKDA 1QT1A 2XIMA 4C6BA 4S3DA 2UY2A 1E6RA 5KZ6A 2DPEA 3R0DA 3L66A 3H54A 3EXSA 3F7JA 2YA1A 3WLQA 3GD6A 1ISWA 2WQPA 1VRDA 9XIAA 4LS2A 1D3CA 5AKQA 3CC1A 3RX3A 2BVTA 4AEEA 2DSUA 4TIMA 2G3FA 1FWIC 4J2PA 4S3JA 4UMCA 3W1PA 3TR9A 1KC7A 5I24A 1GEHA 4P7RA 4KEMA 5I3IA 4H8UA 2MNRA 4LUIA 2RDXA 1Z9AA 1CW2A 3K5XA 4PUEA 2D22A 5FJTA 4KPLA 2CXGA 4UTHA 1SW7A 4HA1A 4MNKA 4RR4A 3PB2A 1O5RA 3QMSA 1JJKA 2DZSA 5IDIA 1QNPA 4MAVA 1NQKA 3UESA 1UIPA 1FDJA 1XLLA 1J10A 2GSEA 1GW1A 3TYCA 1KM5A 3IVTA 4LRSA 2CWXA 4GVIA 1TJ1A 1LT7A 1R87A 2W27A 3T9PA 4DJFD 1EJRC 4JIEA 3WBYA 2J27A 1H1YA 2Q8LA 2BHYA 2DEPA 3KL0A 5HMSA 1BWVA 2PDFA 3I3BA 1M68A 2QCCA 3M46A 2V3FA 1GG1A 2VFIA 3VCRA 1XD0A 4IPJA 3B9AA 1Q6GA 3W1AA 2YBTA 2Q3RA 3TN6A 4FMVA 4P7LA 1WAUA 4NJHA 1Z44A 4UFMA 5I3GA 2BVYA 4PRWA 4R53A 3CV7A 4Q8MA 4HNLA 1E6NA 2PDKA 2G0WA 3BSHA 4O1DA 4DO6A 2XIOA 1FH9A 1A80A 1JPIA 4F2UA 5D38A 3T0TA 1Z48A 1IHIA 5I3FA 3WQCA 1THFD 2BBFA 3H4XA 4R85A 2V82A 4LCQA 4J28A 5F7UA 1D9EA 3TW9A 4B5XA 4H2CA 3W1TA 1XLFA 1TV7A 1BRLB 2O0TA 3DYOA 3JU2A 2R1PA 2OT1A 4O0ZA 3VD5A 2VX6A 4JDYA 1IZKA 2KZHA 1RHCA 3AYRA 3BDKA 2XIIA 2HDJA 2DUAA 1HL9A 5A6KA 3II1A 1LL4A 2XM1A 3MTWA 3V5CA 3G3DA 4AU0A 4XKYB 3LLFA 1E55A 1H60A 1PYFA 3MBDA 1UUOA 3CZJA 4QE5A 4RDYA 5U4NA 2VVNA 4AXKA 2YDRA 4LBRA 4GUHA 1LQ0A 4EWJA 2F2HA 3L2MA 3USZA 2E9LA 4M29A 2H9AA 5D05A 1TYGA 3R0UA 5XINA 2V81A 1KBBA 3NNTA 5HATA 3E2SA 1DVJA 1F6YA 3TFCA 1HL2A 4H41A 2W6RA 4LBSA 4N4QA 2CXEA 1IF2A 1L2UA 4H6QA 4JL1A 3MW7A 2Y61A 4WKAA 1GEQA 3MVIA 3CPUA 3SGZA 3TUUA 4K2SA 2V3DA 1HGWA 4XX6A 4HSHA 4AVOA 2QHAA 3U57A 5CPSA 5AECA 2CZFA 3BLPX 4X0NA 1LL7A 3AYVA 2OFJA 2O55A 5FF2A 4H7VA 3A12A 3FJLA 1SW3A 2XJ7A 1TRDA 1WV2A 4AYGA 1I1WA 1EP3A 2Z27A 2Y24A 2ZVRA 3S5YA 1E0WA 4R7WA 4CEUC 4XZBA 3GH4A 4IICA 1QBAA 1MQPA 1OC7A 4LC8A 4GLEA 2PDGA 4PFMA 1XG4A 4PBFA 1FCQA 1FFRA 3LGDA 1VFLA 2RJHA 3OVQA 1FHDA 5LNWA 2JGYA 4ZB0A 2NQZA 3VKAA 1EZ2A 3RU6A 3TZNA 4PUUA 4IJBA 1AJ2A 1TPH1 1FHUA 2DDXA 1BEUA 5LGZA 3NDZA 3CS2A 3NZRA 1HQTA 3ZXWA 2PD9A 3EOSA 2A3HA 2GJLA 3S5ZA 4AIBA 1J0IA 3UWWA 1EHNA 3QSTA 1MVYA 3TA9A 3FSUA 5DY2A 4OBSA 4H4IA 5HJLA 4TXEA 4OOUA 4ROQA 4JIHA 1UKPA 2WVSA 2Q3OA 5I02A 1M9HA 4J2MA 2VEPA 4IG2A 4JFUA 4MB5A 4H7ZA 4S3BA 5A2AA 4CNPA 1OB0A 4XO6A 1E51A 1RCOB 1UPMB 1HJQA 1PKLA 4QG8A 1M41A 2D3NA 1LUCA 3FEQA 3G1FA 4QS5A 1LQAA 1E5JA 2GSHA 2ZFAA 4Q8UA 4M3PA 4PSPA 1WDPA 1ADOA 1XYFA 1XW8A 5DO8A 4AUBA 5KINA 3D46A 3GNNA 3IJDA 3UYCA 4UCGA 2BX7A 3VNMA 3CGTA 3S8HA 3W2UA 1KCXA 1PHQA 1MFUA 5B7YA 3ARXA 1DXEA 4XZ9A 3T81A 1EKOA 3EDJA 3T2OA 1S1PA 4MUPA 2R1MA 1OWQA 1F07A 1XD1A 1ZZMA 1GOXA 1XLMA 4AZ7A 1UOKA 1V0LA 3SFKA 2WJDA 1V6UA 4XVEA 1OSEA 2V63A 1RP9A 3Q4DA 1W3TA 1Q6QA 3SQMA 1EXPA 4HIBA 3MSYA 3KVKA 3BLKA 5CC5A 1GONA 2TPSA 4IP4A 2AKZA 3H70A 4H8NA 4GXWA 2VHLA 7CGTA 3SUVA 2CNCA 2D3LA 1EFZA 1S2AA 4MADA 4RJEA 5HINA 2A5HA 4NUWA 1LQ2A 3WMSA 1SPQA 3MCNA 5C9RA 3N3TA 1XIEA 4PB5A 1VPYA 3BICA 3BV7A 4DELA 3CBWA 4AZ6A 2YW4A 1V4YA 4HOWA 2DJXA 1VD6A 2D1ZA 5DT5A 4Q6JA 4ALDA 1JYXA 1SR0A 3QVQA 2CLOA 2YGYA 1OADA 4XSMA 1TJ0A 2FVKA 3S2MA 2PFHA 2PDJA 1LCOA 2NZLA 3GC2A 3WD4A 2ZZ7A 2DZAA 2VZVA 1XLDA 4ERAA 2QVHA 1DXIA 1IEQA 2E6AA 3O0FA 3PTQA 1PZ0A 3DHFA 2E4TA 4PEEA 3AMDA 4QROA 4B9ZA 4GQGA 5KETA 3LGGA 3ZWTA 3VUPA 4O16A 3I10A 1E43A 4IFRA 4C1KA 5G1YA 4YL2A 1OFQA 6ALDA 3OB8A 1ZS2A 3OHIA 3A4AA 1PUDA 4AX7A 2OEKA 1H50A 4CNNA 4JTQA 2PDIA 3H2OA 3K30A 3HGJA 2X42A 3FN9A 3KXQA 3RYSA 3EOOA 3B0VC 1E6SM 3K4AA 2A7PA 4JFVA 3LV6A 4MM1A 1PIIA 2VKZG 3SAZA 3TCEA 3BG5A 1XSIA 1SO5A 4LAKA 3WK3A 4K68A 4Z2IA 3GUGA 2J25A 1Q13A 4BWLA 2QCMA 4LPCA 3C2YA 4BWLC 1ICQA 5ABFA 2Z1XA 1CXFA 1XYLA 4Z2KA 3E3HA 4Q32A 2EF9A 2AL2A 2E1WA 3FSTA 1XLEA 3SQLA 3DERA 3AHVA 2ZUUA 1OGBA 2C16A 1UD5A 1I60A 4KFPA 5D2VA 4OTKA 1UQZA 1G4PA 4WY0A 3S3GA 1V0NA 1D3GA 2A2IA 4KEVA 1OFEA 3SSZA 1PX3A 4HZ8A 4WRHA 4IL2A 5KSWA 3IAPA 2YSWA 5F4WA 1F5ZA 2IQDA 3UXLA 3GIYA 3OGRA 2D0FA 3PBUA 4HNCA 3LN3A 2QPXA 2ACRA 1O7AA 3VMNA 4I5UA 1IXPA 2EPMX 1W9BM 3LM3A 4MDOA 5MKGA 2O7SA 2GJXA 4GNJA 3VDBA 3DBNA 3NXFA 3BG3A 2VDGA 3EXRA 1RCXB 1V3LA 4JKKA 4PCFA 1YXCA 2RGMA 1M5WA 3F2CA 4QNEA 4O14A 5A8PA 3AS2A 4L6OA 3W7JA 3POCA 3DGRA 3G1XA 4IMDA 4FOJA 3MKKA 3BMWA 1VJIA 5HK4A 3LMYA 3I68A 3V0TA 1UIOA 3DHUA 5D03A 4AY8A 3UZ5A 3T42A 5JXQA 3TYBA 1XLJA 3PC0A 4QTGA 3EWDA 1CCWB 4E3TA 4LVFA 1DJQA 1VH7A 3OLEA 3LHYA 3M5ZA 3QGVA 2VZTA 4H6KA 4AXNA 4REQB 1RQHA 2O9TA 4MY8A 4DPPA 4O4WA 3QQWA 2WMIA 2V30A 3L5AA 4B5UA 1JI2A 1VLWA 3A4WA 4PMQA 2Z6JA 4QSFA 3M7WA 3UCCA 4U5IA 3WD2A 3QYQA 1HUVA 1ZL1A 2QUUA 3ABXA 3S5NA 1SZEA 2JALA 3E38A 1U30A 1REQB 1XKYA 1MW2A 2PWDA 3MJYA 3STPA 4YVPA 3WF0A 1ONXA 3DG7A 3C86A 1PAMA 4ZA0A 3FAXA 3SJ3A 2PWHA 3WJSA 4JY8A 3WF3A 4CD7A 5FJJA 3IJ9A 4RW3A 1QI3A 4JR5A 5AC8A 4JAWA 1B4EA 3FFSA 3BAYA 4A05A 1MQRA 1T8QA 3NL5A 3NL2A 3P93A 4WUIA 4IQLA 2XIQA 2PLMA 2VO5A 2CLIA 3UT0A 4KFOA 4TMCA 2V5DA 1KXHA 4WLCA 4H8HA 1DBTA 1OYBA 3KBVA 1BYDA 4I9TA 4GA8A 1R8LA 4OVXA 4HU4A 1RPXA 1S39A 2E67A 2VGBA 2GGGA 3GS6A 3JZEA 3VGGA 3T0CA 1TKKA 2W79A 3C2FA 3O1NA 1W37A 4K3ZA 2GGIA 4FLSA 3W7MA 2A6LA 1G1YA 3KUMA 3QSRA 1PTAA 3VUSA 4LW7A 1JRCA 2WPBA 4ZSTA 3MWAA 1E6PA 3O6DA 2GOUA 1TRIA 1TTQA 1YE4A 2VR2A 3OGSA 3D0CA 4PRRA 3VOIA 4M19A 4DQWA 1AL7A 2VD9A 1AVAA 2TYSA 2DZXA 4E2OA 3MB9A 5IXEA 4AW7A 5KITA 2X8RA 1JZ5A 2QF7A 3DEQA 5D04C 2PGEA 1U1HA 5LKYA 4UZSA 4QNWA 2HPMA 1J2WA 2VC7A 3AS1A 3T0BA 3LCFA 2W63A 3F4WA 2YL8A 1RV8A 1VFFA 4YTTA 3QOKA 3WL1A 3EPNA 3W7QA 5J04A 1EJVC 4B5TA 4E4UA 4KWWA 4WXZA 3HF3A 4FIQA 4UTIA 4DN1A 1X8FA 6TAAA 1F3TA 1E5NA 1P4CA 5BRQA 1J4EA 1HJUA 3HTWA 2ZWYA 3AOFA 3FXGA 2DIKA 4FNSA 2PF0A 1SO6A 1H1ZA 4OIFA 5FL1A 2VEIA 2YZ5A 3LM7A 3BE7A 3N4EA 3GNRA 1E4IA 2W67A 3LQGA 2CESA 2NQHA 3EX2A 2VP8A 3T40A 1E4MM 5GJNA 2A4AA 2E7FA 3H21A 2VJXA 3R58A 4W93A 1ZAJA 1QFEA 3CPRA 5HXMA 4YHGA 2HV5A 1TQJA 4PMXA 4X3ZA 1IXNA 4W85A 3G77A 1TWWA 4GK8A 2QYGA 3B8TA 1QI2A 1TPUA 5JVLA 3WN6A 4WZHA 3UR2A 2OKOA 3Q58A 1JGIA 2WYSA 1LG1A 1SFTA 1VBRA 1LJYA 4HHPA 3U5YA 6XIAA 4GCXA 1GGOA 4QG6A 3UW6A 1VFSA 3W82A 3EPOA 2DVUA 3KBSA 4IJCA 3EEZA 1J79A 4MJZA 4JHZA 1LBMA 4GRSA 1IIHA 3W76A 5BYWA 1RZMA 3LPOA 2BXYA 1UD8A 3KRUA 5CZ0A 2Y63A 1JZ2A 1V0MA 2YR1A 5FJUA 1EJ7L 1XBYA 1QR7A 1UKTA 3E5PA 1XYZA 1ZGDA 1O12A 4RPPA 1ZTVA 4LVDA 3B8UA 2ALDA 4GWEA 2HCVA 1RK5A 1I8JA 1SR9A 4LYQA 3O9NA 5DRIA 1F9CA 4UNIA 3H2MA 1EIXA 3OGVA 4ILSA 1UD2A 2WLYA 4P5UA 2HJPA 1VLIA 4KKXA 2BNJA 1A53A 2D2GA 4QLLA 3LTSA 3LRKA 1C92A 4EXBA 3H2EA 2X41A 1AZ2A 4GABA 1WB0A 1BFNA 3QHMA 5DLCA 3MMWA 4G8TA 4D6HA 4UIOA 4LEQA 3M6YA 4U10A 3ZMRA 2VEMA 5BWAA 4GUIA 4N0RA 1UH4A 3W74A 1TPWA 3COTA 4EE9A 1SYTA 2GQ3A 3G22A 1KQYA 1YE6A 3NWRA 5TNVA 3PZUA 4ADSA 4LGXA 4E2DA 5LHEA 4HNUA 2FGLA 4D1IA 2GZXA 4NHVA 1KR1A 2PZ0A 1AZ1A 4JHOA 2QMJA 2KX9A 2O9PA 2YB1A 4E4FA 3AMLA 1GNXA 5AYYA 3OVPA 4Y7EA 3M16A 1OIMA 1UR0A 4B3ZA 3AU6A 5JQ9A 3FA5A 1BQGA 1YADA 3DFNA 1NDWA 1JFHA 1UWIA 3FKKA 1LORA 1C3FA 2MANA 1Q6FA 3HURA 4L80A 3U2EA 4I8YA 3EPMA 5I3HA 1F3WA 1B0IA 3KRSA 3QR0A 1DWIM 1LWJA 5G2WA 3WK2A 3WX7A 3LPGA 3EWBX 4J3SA 3WLNA 2W61A 1ISVA 1OD0A 3LS9A 3KS5A 3INPA 1XIHA 1HX0A 3IK4A 3VAVA 4DLFA 3CAKA 3DFYA 4GUFA 1V79A 4EXAA 3WDPP 5I3KA 2W91A 3EA1A 5E09A 4V33A 1GWJA 3NGFA 3TXVA 5KZEA 1JPHA 4TX9A 3UU0A 1OY0A 2HS8A 1XRTA 4RZBA 4K1WA 3TR2A 3P3BA 2X7WA 3V18A 4C65A 4ZTXA 1VFMA 3PAOA 5F2LA 4Z0SA 5CPLA 1JCJA 4HPJA 3AIRA 1GQJA 5CKSA 5LIXX 3ANVA 3FX4A 4UTTC 2QZRA 5CH9A 1W9XA 3OU8A 3ITGA 2J7FA 5RUBA 4Z1BA 2O4QA 4WDTA 6PTDA 5D4YA 3T2QA 3UWZA 1R7AA 3DC8A 1TV4A 4AISA 4UTWA 5BOFA 1W31A 5I23A 1C8QA 1M7OA 3QJAA 5DEZA 2BXZA 5LNUA 4UTWC 3AALA 1W3NA 1XV8A 3DKJA 3ZVIA 1K7EA 3VNDA 4BI7A 1TVNA 1B3WA 4J35A 2OO0A 8A3HA 1Z42A 1CDGA 4GY0A 1NU5A 2R1NA 1PS9A 4ZOBA 1L0PA 4O54A 1Q45A 3W01A 2I57A 3V5OA 4XD6A 5TD4A 3MT1A 1VF8A 4U33A 1UB3A 4H6EA 3W6LA 3ES8A 2HROA 1YDVA 3N2TA 3VILA 3F4VA 5FI8A 2Z1KA 3VTRA 3DYMA 3AXXA 4W8LA 2VVSA 4S38A 5HQLA 3GLCA 1O5KA 1U1UA 4O19A 1C8XA 1ZLPA 3KEHA 3WDQA 4DWSC 1T5AA 3L9CA 3VPLA 1QCWA 1BYCA 3AFBA 4I5RA 3PUOA 3SCVA 5CBIA 3PNZA 2WJEA 3FHAA 3WDRA 4DB7A 2BVWA 1FCVA 5M5DA 4POCA 2DH2A 2POTA 2O92A 1Z89A 1PE1A 4U28A 1KTBA 2D20A 4UTUA 4GFSA 1EA0A 4TVUA 1QUMA 3SCSA 3TIMA 2FH6A 3VX1A 2VR4A 3ABOA 5A5WA 2NVDA 1NTHA 4WD0A 1E9IA 3TC7A 3SCOA 1C29A 4QJ5B 4ICMA 3SN1A 1YMYA 3RR1A 2J78A 1YDOA 4AF0A 2X40A 2QCFA 1QNVA 1N8WA 1ZBKA 2ZZ5A 4PMDA 3M0JA 1NF0A 3QOMA 1UD4A 4EPEC 4WGXA 4XAFA 4I9JA 5XIMA 3WLMA 4ZQPA 4OECA 3LX9A 5K9CA 5JU6A 2J8FA 2JF6A 4V27A 3NO3A 4ZBCA 5EMLA 3KVLA 2YB4A 3P81A 4JTHA 2P5NA 4L1GA 3MY9A 2ZX7A 1KR0A 1EC9A 3GXTA 4KIEA 2V0TA 1EA9C 4KETA 2I17A 4WXYA 1G01A 3M4HA 5AHEA 3C0LA 1F61A 5IFTA 4V1YA 3ARYA 1F2JA 4EACA 2BOGX 4S3EA 4AZHA 3M7SA 3LI1A 3GU1A 1PIGA 5M03A 2VTFA 1IT7A 3MV11 1JD7A 5J5RA 3HZ3A 3N6QA 4O0KA 4HPHA 2RDTA 4D1JA 4J3TA 1DOSA 3BMXA 4C6FA 4HP5A 1C9WA 3TXZA 1SZFA 4Z17A 2F84A 2BLEA 1OT2A 4ZR8A 5AZ1A 2WSPA 4O1AA 3AMKA 3H12A 2AMXA 1JXJA 3C2RA 3EBVA 4UQCA 1CXHA 1PDYA 1TJRA 4D2JA 4F66A 4LC6A 3HA1A 3PZMA 3V35A 4ZEPA 4N9BA 3UG4A 4TU1A 2CZVA 3VKKA 1C8VA 4CN4A 3BAJA 4QHRA 3OOQA 4RZ6A 1A49A 3QH2A 4QIUA 4GD0A 4TX6A 3RAOA 1BVNP 3MP4A 1XM3A 3W1RA 1W3LA 4IHCA 4LCRA 1RP8A 2Z4GA 1M1BA 4O1EA 2YIHA 4XG1A 1YLVA 2NX9A 5AFDA 5LZLA 3GVVA 1XR2A 1DWAM 4EPBC 2ZUSA 1US2A 3CQ0A 5HMDA 1K9FA 3ARSA 4W84A 4FNQA 2QJIA 1FHLA 2YXXA 3EDFA 3IS4A 4CCCA 2VGFA 5D8WA 4C6LA 3KLKA 3VFLA 2XN2A 1YX1A 2DQWA 1IGSA 2ISVA 1W1A1 2EPHA 1XC6A 2D2JA 3CWNA 3SURA 3EWCA 1OFOA 1EGZA 1GOMA 1XH0A 2I14A 5JMUA 2XU2A 2WSYA 3RM4A 1U33A 4RL3A 4QEEA 3W7RA 1GW9A 4UTKA 1SQ7A 3TU9A 3E1F1 2ZC8A 4XK2A 4Q6XA 1RA5A 4YTUA 3IARA 4RW5A 1LBLA 3KP0A 4FI4A 3ITLA 4LCSA 3VIJA 1FXQA 4DO7A 2QPSA 1VIZA 5CG0A 3AUJA 2VRJA 3GXIA 2JK2A 3U8GA 4DUOA 5BXSA 4ZENA 3CV1A 1B31A 2Z0IA 4TMBA 4NNAA 4E5TA 1ODZA 5E9AA 4HYRA 1EDTA 2QAFA 5ABTA 3GE7A 3A5VA 3BMVA 2NUXA 3LCGA 4FNRA 4OBRA 3CT2A 3W22A 3UZWA 1J12A 3BAKA 3TAKA 3PBYA 2OVLA 1UG6A 2A0NA 3NR0A 1IE7C 2NLIA 5AC7A 3GR4A 1GVSA 4JPGA 1KB3A 1KCZA 2Z25A 4HK7A 1J18A 4YWIA 2WOQA 4GUGA 4UQ9A 4XAGA 3NVTA 4HJWA 1XC4A 2D24A 2WVTA 3WFZA 3AU2A 3GTIA 4UQAA 1WO2A 3IWPA 3SRHA 1M53A 3KTXA 1EDGA 2OSWA 2YCLA 3U9IA 2XN1A 1V3HA 1DJYA 2XN0A 4Q4RA 1ZU8A 3W1MA 3OYZA 1HO4A 3KCOA 4MNMA 4A6GA 4CN6A 4DJDD 5DFAA 1K9DA 4A3UA 3Q2DA 3W7CA 1QPKA 1TWZA 3KM8A 4RNFA 4IL0A 2FPTA 4AD1A 4GVFA 4P8VA 1R30A 4QCEA 1TX2A 3GQYA 1B30A 5HQMA 4M7TA 2YXGA 1CXKA 3AYSA 3UZXA 5BOEA 4L65A 5DELA 1FOBA 1W17A 5CPTA 4WIWA 4RDWA 3CM4A 4H9MA 3G0SA 4I8DA 2C91A 3EOUA 3EZ4A 4ADTA 3ZIZA 3U48A 4HCHA 4IX2A 4BR1A 1NARA 2ZQ0A 4HKPA 4I6KA 3P62A 4LFYA 2HSAA 4KRTA 5TF0A 2O56A 3BLDA 4TVCA 5B7ZA 3SB0A 1Z7AA 3ATYA 3UXDA 5IOBA 2V5BA 2ZUNA 4F0LA 3RM9A 3NQDA 2PBOA 3T4CA 2C15A 2CKSA 1JPKA 4LS0A 5DCEA 2NWSA 4R27A 4PUWA 1UYQA 2V2HA 1C9DA 3S5OA 3STCA 2AL2B 4QBXA 2WNZA 2XH0A 4URIA 5LYRA 1WOBA 3GG8A 4A8IA 5ABGA 4A21A 1BLIA 3KLLA 1E1CA 3DDMA 1KXQA 5CSSA 5HWMA 2NQ9A 1BSIA 2B7PA 4WY0B 5CZSA 1CB7B 2ZRYA 4XIAA 3M43A 5JH2A 1PBGA 4OQVA 3UWVA 1KRAC 4UOQA 1IR1A 1SGJA 1UWQA 3C0QA 2HVOA 1XGEA 4EPKA 4Z1YA 2NW0A 1W8SA 4GQQA 3IUHA 4AFYA 3VI2A 4EKJA 4O57A 5EMUA 1XUUA 5M1TA 3V75A 1GPFA 4LVGA 2BGSA 4I90A 1B90A 4B4FA 2Y8UA 3LEPA 3MUAA 1XIBA 3XINA 5E0CA 3GTXA 2GJXB 3BZJA 1AMYA 2C19A 1CXEA 3NGJA 2A3AA 4G7EA 1UC4A 1I2OA 2IPFA 3M5YA 4W5UA 3SY1A 1FWTA 2R94A 1BVWA 3TWAA 2PZNA 5HWNA 4ES4A 3W1NA 1US0A 1R9ZA 4GBDA 3AJ7A 4WSKA 1IWBA 1XCXA 4WJEA 3PPCA 3PZQA 1AL8A 4NNBA 1ZP4A 1NF7A 5H8UA 2W9MA 4CUCA 3FIGA 3LRLA 3UBPC 3BLOA 1M04A 4L4LA 2XH4A 2PTZA 3W38A 4OGZA 1HKVA 5HMFA 1XIGA 4W4QA 4PRTA 2I9UA 3LTYA 1ISZA 3H4WA 1A5KC 3GB6A 1ZENA 3C61A 5KMYA 3AC0A 3KX6A 1T6MA 1W1B1 4FA3A 2VC5A 4ATWA 1A5NC 3LZ5A 5F4SA 5REQA 4LB3A 1CLKA 5C9UA 4HZMA 3VIOA 1W32A 5HAOA 1TPEA 3PJTA 4R88A 5BWFA 4JIPA 3AISA 3FV9A 3H24A 2QPUA 2VURA 3V5FA 3KBWA 4WDWA 4IIFA 3H53A 5TQLA 1TIMA 5D37A 3E0VA 1ZPTA 3N34A 1ZFJA 1W2PA 2PDHA 1YIXA 2XVNA 1X7FA 1VEPA 4GQ0A 3EKZA 4Q3MA 5T9BG 1WAWA 1R3RA 3ZS4A 4PMOA 1Q4WA 3QXBA 2J7CA 2UV8G 2VFDA 4O53A 3WJXA 2J7BA 2VGGA 4UNKA 1EP2A 2BV9A 4Q22A 1AK5A 1J93A 2QIIA 3P82A 3CIVA 4A3HA 1MW0A 1IXQA 4BS0A 5ABEA 1MZRA 3FNDA 4JTDA 1WBJA 3DFOA 2BZNA 1CXLA 4XAZA 2FLIA 1VQTA 4N2YA 2OYLA 1UJQA 2PBGA 1CT5A 4PL1A 4HA3A 1J6PA 3GH7A 3W6MA 4X9SA 4P61A 2Z2UA 3WBEA 4DHGA 3OIHA 3E02A 3L2LA 1CBGA 1HZYA 4PE8A 3QPZA 1W1IE 4HJFA 4ACZA 1W1ZA 2HWGA 3BLLA 4JKMA 4QR6A 1XP3A 3E2VA 1JEZA 1F05A 3G8EA 3H2AA 5JBDA 2A3EA 2PP0A 1R38A 1JR1A 3QC0A 2PTDA 3GHUA 1W5QA 2P0OA 5BROA 7TAAA 5DBUA 3GXMA 3SRKA 1O6IA 3S5SA 1JPMA 5AB3A 1DORA 4I9MA 1VFTA 4XBKA 4CD4A 4K7VA 1N55A 4DJFA 3MMTA 3DFSA 3QC3A 3T0DA 3GZAA 4FNTA 3I4EA 4DJFC 3G2GA 3MPGA 5C55A 1R3QA 4LU0A 2VEGA 2XINA 3LRMA 1GQLA 4LJ3A 1K7XA 2X2YA 2YW3A 4AEFA 4UQEA 3WD1A 4Z1AA 4HOXA 4JEJA 3PPGA 4AZBA 2X30A 1V77A 2ATMA 1H0GA 5AHLA 3ZR5A 2VQTA 2E5BA 3W28A 1TVPA 5CC6A 4CNUA 4DBEA 3D3AA 4ATLA 3LCWA 2QJNA 3UGRA 2GDVA 4ORMA 1GVFA 4ICNA 1F4HA 4RE4A 1TIWA 3VXGA 1W9UA 2G95A 5HDRA 5BU9A 4P7OA 1W3HA 3MVTA 3CHFA 2EPLX 1L6SA 4JHMA 3UWYA 3VNZA 4RUBA 4C7GA 2ZDRA 3QFWA 3UYIA 2C7FA 4NP7A 1QOPA 3CWOX 1IT8A 4JTTA 1YPFA 3MP5A 4WGHA 4D6DA 4PCTA 2VCAA 5I79A 5CBJA 3SUSA 4JQ2A 3PZNA 4IFKB 1F74A 2VRQA 1KNWA 1IIGA 3SUUA 3I4KA 3VGHA 2A85A 2G4JA 4HA0A 1E0UA 1DWFM 3F5JA 1JCNA 3N17A 1YBQB 1Q4NX 2PODA 3IVSA 3WK0A 4JTAA 1OFDA 4IQDA 3RUBL 3GX9A 3UY7A 1H62A 2ANUA 1F4AA 1MDRA 4JTFA 4JFSA 3CAWA 3TMLA 5LSMA 3FJ6A 4MWAD 4P7QA 1ZSXA 2HS6A 4Q8OA 1HIZA 4UFHA 4MUZA 4F9DA 3TCSA 5AYBA 5LNSA 4KQNA 3WMCA 3LDVA 5AC5A 3BURA 4JQ1A 4FEZA 4D72A 1EBHA 3OIXA 5F1UA 2J8TA 4RPQA 1E6QM 1J0KA 4G2DA 4Q8NA 2TRSA 2JEPA 4X61A 4Z2GA 3SCWA 3HM7A 2BWGA 4GIEA 1YQ2A 3N29A 4Q8QA 4ZOAA 1V0KA 1ZY9A 3KRZA 2WCAA 4XQ6A 1OYCA 4A2SA 2PDQA 1GQIA 4QFUA 1OCJA 4M51A 1VFOA 3QZEA 3LERA 1KWGA 2IQTA 4AEOA 4K6AA 3W26A 4WSJA 1TQXA 3C56A 2NXGA 2QUTA 3LHZA 4CU7A 1R47A 3SY5A 5CPQA 2WVVA 1P7TB 5G4HC 3T44A 3LI0A 3Q94A 1UJPA 4W7WA 5HNNA 4AC1X 3LCHA 4KWUA 4KMQA 1R3YA 3AIVA 3NM1A 1SSDA 4IT1A 5C7VA 2WHMA 4HCDA 3NQBA 1JCXA 2ABBA 3CNYA 1NH6A 3DG6A 3B9NA 2GUBA 1WDQA 1XLIA 4F2TA 3BLIA 2UZ9A 2F7FA 3DBPA 1S5TA 3H55A 1X6LA 3SBFA 4RNHA 2QULA 4HN4A 3W75A 4KW2A 2XZ9A 3RGTA 2VEFA 1VYRA 1W9DM 2XPKA 1FH8A 3AZRA 4C6MA 1UD3A 2PAJA 1NFPA 3LXAA 2IMRA 1MMFA 1RR2A 1HVXA 3WIJA 1BTMA 4AQLA 4ZCWA 3DFQA 4O0QA 1SFSA 1NOWA 2DVTA 1O66A 1Q6DA 1G94A 2JF7A 3N3MA 3TE9A 2F61A 3L21A 2DIEA 1TWDA 1DHPA 4US5A 1XPGA 3EB4A 4MFEA 3F4CA 2P0IA 3VMOA 2C1HA 5EY5A 4ZSUA 1XBXA 3ZR6A 5T9CE 4IOTA 3IIXA 1OZQA 1GTEA 2V3GA 4FR6A 2Z1BA 4HCLA 1SVDA 2D2HA 2FHFA 2WCGA 5GNZA 3TQPA 3C3NA 3UWQA 4WDXA 1XIMA 1J6OA 2VUYA 4N6FA 1HW6A 4YHEA 3PG8A 1S46A 1SMAA 3GDTA 4GYKA 2XH2A 3LPPA 3W88A 3BANA 3W87A 3DI0A 3ES7A 4DEFA 2J13A 1XGZA 2ZRWA 1FKXA 3L0KA 3GDRA 3CUHA 4PODA 3G6LA 3EMCA 1TE1A 3KAOA 4BF9A 3B8WA 4LUSA 5L9FA 2AQOA 4PMUA 1VAHA 3UP8A 3LHUA 1NJJA 1W5MA 3QN3A 3QQ0A 4O8AA 4RV8A 2DZWA 3TLQA 3T08A 3SRFA 4KGLA 4E4PA 3CPGA 2CW6A 1HP5A 3F2DA 3UY8A 3TTOA 2QCHA 3Q45A 3LV5A 3N2OA 3K8MA 4ZFMA 3EWWA 1P48A 1Y65A 2XVLA 4YMZA 3HJZA 4M80A 2UY5A 3ZT7A 1P0DA 3RNDA 1UP2A 4BJHA 1T41A 5EMMA 4DWSB 2W0UA 1QMLA 3K13A 3VGFA 1VHNA 1RBAA 1PKMA 1VR6A 3BAIA 3N14A 1X1ZA 5A2CA 4PMNA 4A8NA 3SCUA 2TSYA 5C5YA 2C1IA 1B5TA 5H2ZA 3BVJA 4JIQA 2NXHA 3ITXA 5FF0A 2QGHA 3R2GA 4W88A 1P1MA 4Q4SA 1UKOA 3GG1A 4F0HA 1PZ3A 4UTLA 2Z29A 3KVJA 1J2BA 4GH1A 4JTEA 3URBA 2PU0A 3SFWA 1DWGM 3FCPA 1QHPA 1GORA 1GVRA 5H91A 1C93A 4B5WA 3EAUA 1FWAC 4F0RA 3WQ8A 4K8HA 4WF7A 3KCJA 5GVJA 3P2VA 4YS1A 1A3HA 4C6DA 3CH0A 5D8ZA 3GY1A 1R46A 1MW1A 3S2CA 2QV5A 3BARA 2CBVA 2Y6ZA 2W4XA 4UFJA 1VJZA 1X7IA 4Q8TA 4JTUA 1Y5VA 2NUWA 5HPCA 4AZGA 4JEQA 1TPDA 3NCOA 2VFFA 4FX7A 4AAJA 4J5NA 1XLKA 4QJ1A 4IUGA 2O7QA 2PF8A 3MUZ1 2ZRZA 4K7YA 1XRVA 4AWSA 3BGGA 5I00A 3URQA 1IEXA 4KIRA 4QITA 4A8LA 1E6ZA 3PUDA 5M2FX 5AN7A 2V3EA 1ZP3A 1WXZA 1JDCA 4NASA 1QPNA 3ARRA 3SECA 2V8ZA 5AYZA 3WH7A 3CUJA 2J66A 3AMGA 3GBDA 2P3EA 1HFBA 4F4RA 4XWUA 1CB2A 3VKBA 4GIAA 4I7VA 3FYOA 2IS7A 1G67A 4S3AA 2EXOA 4QJ3B 4YNGA 3SUTA 1GYMA 5BRBA 1JNEA 3PZOA 4TO8A 2DGAA 1MYRA 4CNOA 4F0KA 2I1OA 2A6NA 1A0DA 4HNNA 4D6CA 3PY2A 2R14A 5HULA 2B31A 3AO0A 1EX1A 5DMLA 3WQOA 5CGMA 1KA9F 1TVLA 5E5CA 4D6IA 2W3ZA 5C8BB 4Z0JA 2YYUA 1UR1A 1AW5A 1PZ2A 2V67A 1QHOA 3T7VA 2SFPA 1GOQA 1WPCA 4FX8A 2ZKMX 5BXTA 3CL8A 4Z42C 4LB4A 1Q7MA 1E9LA 1A50A 4XTIA 4L1XA 1H4PA 5FL0A 4PC8A 1R9XA 3GXFA 3A24A 1Q2SA 3QF0A 4QDPA 4GCAA 3EDDA 1Y5WA 3BOXA 1JQVA 4GINA 1HF6A 3TJXA 4UTMA 2I5IA 4B90A 3T07A 1TV8A 1F73A 1PVNA 1S2WA 5EMKA 3UVIA 4YN5A 1GVOA 1QI5A 1VBJA 1VKFA 4M6PA 4LUYA 4G56A 1TWSA 2BY0A 3UR5A 4JCMA 2FVMA 3W6YA 3MP3A 2I5QA 1J0JA 1YTDA 4ZXOA 1WKYA 1ICSA 2A1YA 2UY3A 1JCMP 2X1SA 3REQA 3T2PA 2V68A 4K36A 3URAA 1PEZA 3HPSA 3IANA 3OTRA 4GZJA 5C6MA 5AYIA 4GC3A 3OW1A 1MXDA 2NUYA 2CLMA 2RGLA 1BD0A 1H09A 2B81A 3R8GA 5D30A 1WXJA 1M01A 2FZMA 4KEUA 1GVYA 1G6CA 4LUJA 1Q6EA 3W7IA 3WENA 3B97A 1R7OA 3M5XA 4C5ZA 3UJFA 2QAPA 4HZ6A 4LUTA 3L2IA 4GNVA 3SO7A 1WUEA 1QATA 5E0KA 2VNCA 4G7FA 5T91A 1YXYA 1HKKA 2NVCA 1AMKA 1XSKA 1S3HA 2XDFA 3CYVA 4XAPA 4M56A 3DZ1A 4U2YA 3PPHA 3B06A 4PULA 3W1QA 2ASHA 2PRLA 4MKSA 2YA2A 4MF4A 4NYYA 3OYXA 2WHJA 3WNOA 3KZPA 2QDHA 4GMEA 3ZSSA 4X60A 1CENA 3E5BA 3D5HA 1H2JA 2Y7FA 3B0UX 2CEQA 3EX3A 2HBVA 5FIPA 1NM9A 2INFA 2FFIA 4XAYA 4ZE5A 3CZLA 4A29A 1S2UA 5IBXA 3GDKA 2B0MA 3IJ7A 3S1GA 1RY0A 5IBXC 4EP8C 2Q01A 1IZCA 2TODA 2DVXA 5CXPA 1WZAA 3NQ2A 1XI3A 2ZUTA 1KFBA 3TH6A 1LL6A 4QISA 5A95A 3A23A 3VOCA 9CGTA 4TX8A 3DGBA 3O8AA 4XV0A 3H23A 5DXXA 2NSOA 3WQGA 2E09A 5E70A 4DYEA 5HOSA 1UR3M 4XUGA 1MDLA 5FEXA 3EMZA 1KRCC 4G5DA 1QO5A 3B8VA 4HNOA 2Q71A 4Y9OA 1LWHA 4IPNB 3KOYA 3TP4A 3NQEA 3NO1A 2R24A 1V7AA 4PBGA 3NUKA 4RE0A 5I09A 3FK4A 4L4PA 4H6RA 4O50A 4GGHA 3CH9A 4LX4A 5DANA 3WF2A 3HPFA 4O13A 1GUVA 2CLHA 4U5KA 5G2IA 4XSLA 1FWCC 5TBOA 1Q63A 4GJ1A 2ACQA 4GI8A 2J7HA 4QGCA 8CGTA 4CQCA 3EX1A 5G4EA 4JD4A 3RFAA 4DBSA 1OCBA 1GJPA 1VZWA 5FA5A 2OO6A 4D6FA 1GOKA 3HBLA 5H8MA 1W91A 1QNSA 3HGOA 4UBPC 2YJQA 5DT7A 1FWHC 3KBMA 3HPZA 4M8UA 2WKGA 3RCMA 3CU2A 1XRSA 2DP3A 2A79A 4UNLA 4MFDA 2VM8A 3GUWA 5LXEA 3GVQA 5EL1A 3P0WA 3O7UA 1FVPA 5LA2A 3P5ZA 1QU4A 1RVGA 1Q6CA 3ERPA 2J62A 3GNPA 4Q8PA 4JOMA 2IXUA 2G37A 3WBXA 3PM6A 1XRFA 3BSMA 4U3AA 3MUCA 4FXFA 1D3HA 5KZDA 3BCFA 4IX0A 3WNKA 1SW0A 2DW7A 1S2CA 3PB0A 1H41A 1QBBA 3ORWA 4JKLA 4HOZA 2EHHA 2O4MA 3NQMA 4AWTA 3MUIA 3CHDA 1POKA 3PZIA 3GKAA 1MSSA 3DFPA 4AD4A 2QUMA 4LANA 3OVGA 2NSXA 3R89A 3ALGA 4M81A 3ANUA 3VC5A 3AROA 1EX5A 3ICJA 3S1WA 2G3IA 4Q8VA 2NVAA 4C6PA 4JYFA 2Q6ZA 4XVDA 2MUCA 2ZZ3A 3QLLA 3TOPA 3L5MA 3M6DA 1XISA 4GXPA 1QTWA 3PSWA 3RXZA 2V69A 3P7YA 3CZGA 4YCPA 1H7XA 4AWUA 2Z2AA 1A5CA 3W2JA 1PYMA 4GX8A 3HJEA 3NO5A 4V15A 1CGTA 1WE5A 3LZ3A 3SM0A 2OB3A 4R7OA 3IK2A 5HMEA 4QJ4B 6ENLA 4HGXA 5XIAA 3MI3A 3PJUA 4ZO6A 2DSWA 4RCXA 4JQAA 4O12A 1R86A 3H4GA 3N12A 3ZZ1A 2XGIA 2ATSA 7A3HA 3G1SA 3GVRA 4L5ZA 4IZGA 1Z41A 1RH9A 4RXGA 1P1XA 2XSXA 4ENLA 3GC4A 4JBRA 4UTFA 5G4WA 4CN1A 2I9EA 1M65A 5AHIA 3UEQA 2PC8A 3BGJA 4DIAA 2Y8KA 2PMQA 2DZBA 1FWNA 4C6NA 3CIXA 4LY8A 1OFBA 2YX0A 3U7BA 2I56A 1PHWA 4WKFA 4K39A 4UUIA 1XBZA 4WEVX 3TMQA 2PDBA 1UR9A 1GYNA 3MZNA 2PWVA 4RNIA 1V8EA 3T78A 3WMLA 3TSBA 3WQPA 4D8AA 3GG7A 3LNPA 2HK0A 3C2EA 4ACZB 2YL5A 3GK0A 5K4XA 1MUCA 1T40A 4CQBA 4I7UA 2NV2A 1BRLA 4L56A 3MCMA 4ZVJA 3THCA 4YTSA 5DX7A 2FPYA 2G96A 4WDUA 1PX4A 2W5FA 4C7FA 4US6A 4UCFA 4XKYA 3WH6A 5CSYA 4D6JA 5M17A 2YCKX 2HISA 1MO0A 3PBVA 4XD3A 3ID7A 3IIOA 3QR3A 4R9XA 3MSDA 1TMQA 1RVKA 1OC6A 1JUKA 3CJPA 2V5CA 3WF4A 3N15A 5CJNA 2G3NA 3M07A 3T09A 4BZYA 1X97A 5CAKA 2FPVA 3G6MA 3U7VA 2NT1A 3MSGA 2FHCA 2JE8A 5KZMA 2RJGA 1Z6KA 1SO4A 1UH2A 2WAGA 4CU6A 2EPOA 3BLFA 7REQB 3DAQA 2PP3A 3L4UA 1OX4B 3L12A 1TV5A 4BCEA 4FNPA 1XG3A 4WJXA 1OBAA 1E9YB 1TX0A 1ISYA 3IIPA 2DQXA 3VGEA 4MAZA 3A3HA 1TWIA 1KBJA 4QP0A 4X9YA 3LXBA 2Q09A 4S3KA 1QW7A 3STFA 3RMJA 4S23A 4ADUA 1RD5A 3QTPA 5GJMA 3NFUA 3A6OA 1L8NA 3IIZA 4IM4A 4E0CA 4FXJA 1HP4A 4ROPA 4H1ZA 4CCDA 3DECA 1IR2A 3M0XA 3T0AA 4DNHA 2V5KA 2VOTA 4KF1A 3HU7A 2PUZA 4FXRA 4IGSA 2WZEA 2FB3A 4JQ3A 4HSNA 4DXXA 4WX2A 5BCAA 1HKJA 3ATZA 4FNUA 3UXIA 4GO8A 1LZOA 3WK1A 3DESA 1W3KA 4RNJA 1TA3B 2WKJA 2IUZA 1UP0A 4LYRA 4NRRA 4Q7BA 2E40A 1VPQA 4LBUA 2TAAA 5EYWA 3PBMA 3QHOA 3W7EA 4WJ8A 1KCKA 3WJWA 3CQKA 3FJNA 3MUY1 3SCNA 2GOKA 4EX4A 4JXCA 5CCZA 4H7CA 4US5D 2PB1A 1DKWA 1U2YA 3EWUA 3AS0A 3RPMA 1CLXA 3N2XA 1MFVA 2ONEA 3QGKC 2WNWA 3N6JA 1CPUA 5A6JA 4L4OA 4GHRA 4YTQA 1E71M 3AS3A 2WHLA 4MYXA 2CLLA 2DY3A 4IPIA 4RK8A 2NXIA 3CT7A 5FAGA 4MIMA 3W37A 3UNTA 4IMFA 5AVHA 1CX9A 4F2BA 1JRBA 4B16A 1K02A 4IISA 5JBEA 2HXUA 1VBUA 4DUWA 4Q4KA 4DZIA 4OJYA 1G0CA 1C7TA 3QY6A 2QMKA 2R1KA 4Q4OA 3VVGA 1UZ1A 3RX2A 1EYWA 1VS1A 4KFNA 1E73M 1R85A 4PTMA 3SIMA 3CHEA 1ENUA 4DBUA 1RD6A 1RLDA 2OYMA 3GRIA 2QR6A 3OQ8A 3UZZA 4HBKA 1KO0A 2YZRA 1I2PA 3WNPA 3CQHA 2ABAA 1R0MA 3TQVA 5A3HA 1XH1A 3MMDA 4KWVA 4RXFA 4ZMGA 3STGA 3CUZA 3A3WA 4A3RA 3GTFA 3NSNA 5TAOA 2XYLA 1ITXA 4N7QA 3D47A 4MPQA 2ON3A 1XLCA 1KWKA 3CL6A 1I75A 4A3YA 3AXIA 3W4RA 4AD5A 1B3ZA 2OWWA 2QXWA 1TUXA 1F8MA 4YVXA 2TMDA 3EWXA 1ZBWA 3HFTA 3VNYA 2PCQA 3IUIA 3W2MA 2ZA3A 3H22A 4O1BA 3TQ0A 4ML4A 3BOLA 3P60A 3TNBA 4CVUA 3DENA 4ZQOA 1N2VA 1FWBC 2ISSA 3WUBA 4P8UA 4NAFB 1N8IA 2YDAA 4ICCX 2J79A 1SZNA 3VKDA 2INZA 1PZ1A 3M0IA 3KHJA 4NU7A 3F03K 3UCQA 3L0GA 2P8BA 4DAIA 5SWUA 4TQTA 3RILA 3NQFA 3TC3A 3RM8A 3GWQA 5BZAA 5FJRA 3B03A 4O8RA 4X2PA 4MPKA 1R3SA 2X1IA 3W71A 2P76A 1B4KA 5I06A 3S46A 4ZZ9A 1OVDA 1EJSC 1KXTA 2BY3A 1B1YA 3TTQA 4LSBA 1HJVA 2BG5A 1IEWA 3GKFA 2CERA 5A8QA 3OBAA 2WC7A 5C54A 3WFLA 1UP3A 1KFLA 2FZDA 3TYAA 3CZKA 2WMFA 3WH5A 3TOYA 1H5VA 3N2CA 2WM0A 2PDYA 1D7FA 1WZMA 2OQYA 3WD3A 4YTRA 1YKWA 4CCEA 1KFCA 1JGMA 3NZGA 1ICPA 3NQGA 1QVBA 4B2DA 2CBUA 3S0CA 4KRZA 1VCVA 1SU5A 3CMGA 5CPOA 4BA0A 3M44A 4MZYA 3JVAA 2Q8XA 5EFDA 4QAIA 2OEJA 3CWHA 5DRCA 4AIOA 1J0HA 5D09A 5I78A 1QI4A 1TMLA 1Z3NA 2YCEA 2QEZA 5CEWA 1KV8A 5LXXA 1VCFA 5C7HA 1AH4A 3ABSA 3P84A 5D9PA 3WSUA 1BSLA 3JW7A 3SRDA 2OU4A 4JX6A 2REQB 3VIFA 3E12A 4C6JA 2BS9A 2WMGA 3AICA 3FAWA 3E0LA 3MCOA 2I16A 4CVWA 1OFPA 3E74A 4I6VA 4BK9A 5FJPA 4MGGA 3GYEA 2OG9A 3H2FA 1AH0A 4DJDA 1KM0A 3P80A 1B3XA 4GYFA 4DJDC 1SJDA 3BUVA 1AQMA 1JUEA 4GISA 4CNTA 2J7DA 4EF8A 1YNYA 1P6WA 2CU0A 3RLGA 3R5EA 3W7PA 4GFIA 2EBNA 2QJJA 2GVYA 1BPLB 4U4MA 3TTEA 2GGHA 2DW6A 3B4UA 5D9NA 4DO5A 4ONVA 3QZ6A 1WYIA 3GHRA 3LCLA 2WSRA 3R11A 4I7WA 3UG8A 3TZFA 1VB9A 1H51A 2E6DA 2PDLA 3PWGA 3MHUA 1V6VA 3THUA 2WV8A 2QGYA 2ZC1A 4I5XA 1F8IA 2VEKA 1O60A 1ONWA 1H0IA 2NLYA 2GK1A 3FA4A 1J0ZA 4U3CA 3K1GA 3R1ZA 4ZQNA 1YRRA 4HZ7A 4OKDA 4TTGA 4J3UA 2EKGA 1P6CA 1XX1A 3NQVA 2ZTJA 4H9UA 4M6UA 4HTYA 1DHKA 2OSXA 2FVLA 2OLHA 2X7VA 4QQ3A 3M0ZA 1XQLA 1ML1A 3MYOA 3ZVHA 3AI0A 1UUQA 2P50A 1TJ2A 3GZ3A 2W66A 4XZWA 4N9CA 2XGZA 1XS2A 1DIKA 2QVNA 3L4ZA 4PB3A 1EQCA 1UKQA 2GPTA 3ALFA 3VZXA 5A6LA 4JS3A 4NVTA 3FOKA 1GKPA 3LY0A 3A9BA 4GOAA 1EO5A 1P0BA 4PMJA 3TYZA 2DSVA 1REQA 2OSYA 1TZZA 4TV6A 3CEUA 2WHKA 1RQEA 1FY6A 3U2OA 3QY8A 3ARVA 1VPXA 1XDLA 1JI1A 1RLCL 2YDQA 2PEVA 3CUIA 5AVNA 4PBEA 3TN5A 2PLJA 4GXMA 1HJSA 1EJWC 1WOAA 3S47A 3VGBA 3O15A 4ZQRA 1OX6A 1JXKA 4X63A 5FKYA 2WJFA 4B15A 3EB3A 1ZJHA 3RJXA 3MV01 1EJUC 2XVGA 1G4EA 3U6WA 1Z69A 3VZYA 1ECQA 1I4NA 1TG7A 1ZRQA 2OMAA 1EOMA 2C3ZA 1I9CB 4H9ZA 3NPVA 2ACUA 2NQJA 1W2VA 2A3BA 1IQ8A 3FKRA 1KBLA 1RJPA 5C9ZA 2XH7A 4C6IA 3S9ZA 1EUAA 4NX5A 4AC7C 4Z1DA 4DI8A 1S5VA 3AWNA 1Q85A 3W83A 4TV5A 1RSCA 3GAYA 3AIUA 3HPAA 3IACA 4Z08A 1GZGA 4JTLA 1TCMA 1EO7A 3DU0A 2Z7KA 3VD3A 2V6AA 3QV9A 1YDYA 4LAMA 3WYZA 3LXCA 3WQFA 3CL7A 2A3CA 1PB0A 1KM3A 1TSIA 2EGZA 2GQAA 4PCNA 7XIMA 3BTNA 2Y7GA 5HUPA 4WOZA 3VNJA 3REQB 1F3EA 1B3VA 4KCUA 4LNCA 3ONBA 1JCYA 4FO4A 3RK8A 5FESA 1UWSA 4MNJA 4JDBA 3PVFA 2ZXAA 1XYAA 4AHQA 3M9YA 4DF2A 3OA5A 4FSAA 5I3DA 4Y9NA 3TDFA 1ALDA 3C8NA 3S6OA 3K46A 3PTDA 2XSAA 2XVPA 2Y8VA 4LAOA 4RZ5A 5E93A 3W81A 1TFVA 1Z8AA 3BQ6A 1DXFA 1T96A 3K8LA 4PMZA 4CQAA 4PUMA 5CZTA 4NI8A 1N82A 2FJUB 1DE5A 4O15A 4LAUA 3DYPA 4HMCA 3NYDA 2V5JA 1FQ0A 1FA2A 4G6CA 3GNDA 1FWEC 2WWCA 2FIQA 1PIFA 3PWIA 4XZLX 2AGTA 4V28A 4TR9A 3IJLA 4ORIA 1MZHA 1FWJC 4DM1A 1K8ZA 1NWSA 1WKFA 1LDCA 3G0UA 4M6QA 4CLMA 2QUNA 5C9XA 1DJXA 1JNDA 4GC4A 1X98A 4OWGA 2P88A 3ARUA 1BHGA 5FOOA 1RK6A 3RO6A 4D6EA 1KW1A 1VHCA 1SJCA 3CZEA 2VFHA 3B8DA 2JGQA 3IJQA 3CO8A 1XSJA 1EUNA 1GT8A 4F9JA 3BJTA 3BZGA 3B0YA 4AHOA 3K2GA 3EKLA 3PWAA 5CGTA 3G1DA 3MUXA 3PUEA 2YL9A 2YFNA 4U2ZA 4NZ4A 3QLDA 4E38A 1AJ0A 4NAEA 1DIEA 2XGBA 2J74A 3NG3A 2YYTA 3C0SA 3PULA 1DQWA 1MQQA 3VA8A 1JCTA 4IIGA 3E96A 1GYLA 1TPC1 4DLMA 1XCFA 4QS6A 3OZPA 2JIEA 1G7UA 1P0NA 3GR7A 3VDAA 2VOMA 4RE3A 1A3WA 4LYPA 3WQDA 2D23A 3NEHA 5LIUX 4H01A 4YVVA 3MANA 1Y0EA 3GG0A 2IPJA 2PTXA 2GQ9A 5CZKA 1TO3A 4JFTA 2F6UA 5JUVA 1YPIA 4L9YA 3WQ6A 3RX4A 5C70A 3H7RA 3NOYA 2IPGA 3BWWA 2E9BA 2OTDA 1VBGA 4E6MA 3SADA 5FACA 3OZMA 4IJRA 1W1PA 4KGJA 4AZCB 4CD5A 3GM8A 2H3BA 4S1FA 1JDDA 3C8FA 3W7LA 3FJ4A 1O4UA 1G69A 4Y96A 4WHBA 4JN6A 3FEMA 1A5SA 3S1UA 4JFWA 2CIPA 4PMRA 4MMWA 4DZ5A 1HO1A 2GVEA 1A4LA 1T99A 1XUZA 4L7ZA 3SN4A 2QDDA 3SQSA 4JTGA 3PZVA 1KGUA 1XYBA 4YIWA 2YA0A 4A2RA 3HQOA 3FXYA 1BQCA 3CB8A 3F2BA 2OT0A 4HVXA 4F48A 3O2LA 3W07A 4MWAA 3R13A 3RR4A 4W9TA 3BQ5A 4MB3A 4MWAC 4WVXA 2A3LA 2WCSA 2PURA 1HXJA 3PZ9A 5K7JA 8XIAA 3W84A 5FSEC 2RH9A 1MEHA 3W25A 5C2CA 3G8RA 3B05A 3W29A 2ISFA 3N9KA 4HK5A 2OR2A 5CSRA 1OF8A 2HVNA 3G1YA 1UD6A 4IIBA 4UR7A 2OX4A 3LD5A 1WDSA 2DV0A 3NZQA 3QY7A 4F40A 1H1NA 3U5UA 4R33A 2JBMA 2J47A 3P67A 3MKCA 3W7OA 4RE2A 1E0XA 2XISA 3VFCA 4WR3A 3C5QA 2HNEA 2RDUA 5CQ1A 2Y5SA 2WC3A 5FF3A 1U5HA 5A94A 1AH3A 3C52A 3N2MA 3I7SA 1OHLA 1X1OA 2QLYA 2WMKA 4IMGA 2BFGA 3SCPA 1XH2A 2B4GA 3ZLHA 3R10A 2CHOA 4GZ7A 1F6KA 1X38A 4GJIA 4JTKA 2R8WA 1R9YA 2YCIX 4L6HA 3M5VA 4KWOA 1ITUA 4DUXA 4DBDA 1PTGA 4HNTA 5T8GA 1EH9A 3S83A 3IGXA 1JZ8A 3T1GA 5BMXA 4NY2A 1QNQA 1G4SA 4MKNA 2NT0A 1K4GA 5IM51 1QDSA 1NDYA 2Y70A 3W00A 4PTXA 1YXDA 4JTCA 2BSLA 3QR1A 1RCQA 2J6VA 2PDPA 1XPYA 1VBHA 1W3IA 2E8ZA 3BW3A 2F8QA 1BXBA 1VIWA 4UFKA 5CAHA 5CPMA 3EWZA 3HGRA 4LXFA 1H7RA 1EDQA 4GI9A 4A3QA 3KTCA 2B7OA 2JFEX 1EPXA 1AG1O 4IQEA 5JBFA 4HB7A 4BHYA 5LA0A 1BG4A 3B9DA 2D69A 1OM0A 2WNNA 1UWTA 1BWLA 3IRDA 2WBKA 1SUXA 3M47A 4Q4PA 3WO8A 1SJAA 2NX1A 5AHMA 4KWSA 5FJOA 2WKLA