3WJXA

Wild-type orotidine 5'-monophosphate decarboxylase from m. thermoautotrophicus complexed with 6-amino-ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 85
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wjxA00
1PCWA 1HTIA 3B0VC 2V9DA 1OFOA 5D38A 5LNWA 3CEPA 4M6QA 3VE7A 5LNUA 3W3OA 3W1QA 3GKFA 2B4GA 1Y0EA 1DORA 3RNDA 1OYAA 3PM6A 4MZ1A 1OFAA 4I9AA 5K9CA 2LLEA 1IXNA 3TXZA 2C14A 2CZEA 2BLEA 3BW3A 3LCFA 5F1UA 1MZHA 5FESA 3NZ1A 2NLIA 3BW4A 5F4WA 4UTJA 3HGOA 1LTDA 1KFBA 2ZRWA 3NPWA 3FKRA 2GJLA 3QH2A 4PODA 1PCKA 2DZXA 3OHIA 3W86A 3L65A 1HUVA 4RKAA 5E0KA 1QPOA 4DXVA 4NX0A 3BPWA 2ZDRA 1XDMA 2ZZ3A 4JTKA 1WOAA 5FF0A 2YFOA 4ZQCA 1SW0A 1X7FA 4YCPA 2R94A 1M5WA 2A21A 2JK2A 4AHQA 3PAJA 4Y8FA 5CSSA 3HOJA 4KFPA 1LBFA 4EF9A 4JTEA 3IVTA 3H55A 5AB3A 3BG3A 2H8ZA 1IGSA 3C52A 3MBFA 4O11A 3UYCA 1U5JA 3EXSA 4MJMA 3WJYA 4MIMA 3UPBA 3OVRA 1Z44A 5AHIA 2CZDA 1G7VA 1T99A 5AC6A 2FQIA 1H1ZA 1ME7A 4XKYA 1GVFA 3UZ5A 2VENA 3GXPA 2WPBA 2WSQA 4AWUA 4KWWA 4JYFA 2C0AA 5KITA 3NYZA 4H4IA 1VCFA 5SWUA 3QMRA 3I7SA 4PA8A 1YYAA 4RLIA 2H90A 1SFJA 5FEPA 1FWWA 3N14A 4CNNA 1FQ0A 4BI5A 4O4VA 2ZZ1A 1QAPA 3TKFA 3FOKA 5G2WA 4IX2A 2ATMA 1JR1A 3NA8A 3W70A 2WQPA 3HG5A 4MUZA 4HT3A 3LRMA 4BI6A 3G1DA 2V30A 3FJ6A 3WJXA 2QCNA 3O06A 4WD0A 4G1KA 3G3MA 2J9XA 1SPQA 1R47A 2JGYA 3S5YA 3LV6A 3DKLA 2F84A 3W7RA 4GRSA 3IEBA 5U4NA 3NEVA 2FB2A 1A5SA 4BWLC 4BFAA 3MHGA 3W6YA 2A85A 4IOTA 2O7QA 1W5QA 2CFFA 2ZBTA 4IGHA 3TK7A 3OA3A 4UFMA 3UY8A 4JTFA 3W87A 3L21A 4DPQA 1FCBA 3M16A 3W9ZA 4O1BA 5E1QA 1JULA 2PRLA 2Y7FA 3F4NA 2J88A 1FWSA 3G1AA 1GTEA 2YW4A 4XBKA 3NQ7A 2PC4A 4K36A 5LHEA 2Q8ZA 3DXIA 4LS1A 1JUEA 3VNDA 3PBVA 5FEZA 3AJXA 1PHWA 2G5WA 3PF3A 3TC6A 3B06A 5LKYA 3S42A 3O15A 3W84A 2Z1BA 3GDLA 3AO0A 1FUYA 3TQ0A 1VR6A 2P10A 3GIYA 1O60A 2CLHA 2E6FA 3S1VA 4CQAA 3LTSA 3MBDA 4JTIA 5I3HA 4K7VA 3BLEA 1K8ZA 3C2FA 3W1UA 1HO4A 4O28A 3PBYA 1H7WA 1TB3A 4WXYA 4B5NA 5CPLA 4KKXA 3UWVA 4ADSA 5LSMA 2AQWA 3P80A 4UFJA 4XTIA 1VYRA 5AN7A 4A21A 3CIXA 2ISWA 3HQ1A 3W75A 3WK0A 3UXDA 3CQ0A 3W85A 2PE4A 4NNCA 4MKNA 3HJZA 1WAUA 3G1FA 3B0UX 4R53A 2WNNA 1HL2A 4N9EA 5HWJA 2I1OA 3QW4B 1SQ7A 2GJNA 3NL6A 3QRHA 2J9ZA 5DCBA 1EP1A 3IRDA 2WSRA 1TRDA 2NX9A 4PCFA 1B4EA 3W7IA 3TSDA 4UNKA 3NQVA 1X1OA 4J9JA 2VEMA 3V1PA 1WXJA 4O15A 2W79A 3TE9A 1QO5A 2FTPA 3PUDA 1J2WA 2FPVA 3SGUA 1WV2A 1LCOA 5I3JA 2DZUA 1JCNA 3CWNA 2C6QA 4UNLA 1QOQA 2OMAA 2A5HA 5BRBA 1VHNA 3CU2A 1X6UA 3HPXA 2OZ0A 4UR8A 5D2VA 1L6YA 3I6RA 2E1DA 1B57A 2R91A 3NR0A 3GB6A 2BTMA 4GUJA 1KBJA 1GVRA 3NQDA 1IXQA 2H3DA 3EEGA 1A53A 1WBHA 1SZGA 4HIBA 2NV1A 2TYSA 1EEPA 4H6KA 1XUZA 1L6WA 2A7NA 1IXPA 4NJGA 3BW2A 2C15A 4E38A 4N9CA 3IGXA 2QCCA 1FCQA 3KOFA 3NNTA 3VI2A 1G4PA 3EKZA 3ELFA 3LHYA 1TPFA 2ZRVA 3SSJA 5K3VA 1KLYA 1TREA 3QF0A 2X30A 3C56A 1YXCA 1IIGA 4NJJA 4NX5A 1R2SA 4O52A 1NEYA 1GTHA 1VCVA 1LDCA 4O57A 4IUOA 1TPWA 5AYXA 1BWLA 3M43A 3R13A 1ZALA 4RX0A 5KZDA 1QDSA 1YDNA 1O5XA 4FX7A 5CZTA 5MHBA 3MO7A 4FNTA 1I8JA 2QAPA 3EWBX 1XI3A 3NQ6A 3D0CA 5H91A 3CC1A 4K6AA 3VE9A 4UTUA 1F6PA 5BOOA 1JCMP 1W0MA 4FF7A 4UTTA 5G2HA 1RQBA 2GVGA 4HN4A 3W71A 2HMCA 4ORMA 1YDOA 4LVAA 4FHAA 5CZSA 1QPQA 3P67A 1GJPA 3MW7A 1G4TA 1JUKA 1JRCA 3GDRA 1Q45A 3W7GA 3EX3A 3EXRA 4AXKA 1KBIA 1TSIA 4AF0A 3TUUA 3P5YA 3ZS4A 1YPFA 4RXFA 5HMSA 1OFRA 3E12A 3BGGA 1SU5A 3IGSA 2C1HA 1TPUA 4O4WA 3MI6A 1ZENA 5I3GA 2Y6ZA 4IPJA 8TIMA 4QIUA 3W76A 3S6DA 3STGA 1TPH1 3EXTA 2RH9A 4BI7A 1OVDA 2ZCGA 2NX1A 5AHLA 4GUFA 1THFD 3HGRA 3W7JA 1DJQA 4FNUA 1XCFA 3W1NA 4P61A 3KVLA 4JTJA 1OX4A 3C6CA 3OVPA 5TIMA 3BLIA 3M0ZA 3I7QA 4X3ZA 3W2LA 3EWZA 3TU9A 4M6VA 1DJNA 3GNNA 3ATZA 4MFDA 3DH7A 3NGJA 2OX1A 1K8YA 4TMCA 5IBXC 3NVTA 4UFLA 4O0ZA 1XFBA 5TBOA 4K38A 3SY5A 1H60A 2BSLA 4FXRA 1TTPA 1V7YA 5HINA 3C2EA 3IVSA 4Z0SA 3R5EA 5ABTA 4AMAA 4ML9A 3QW3A 1VJIA 4CNPA 3BVJA 2DU2A 3I65A 2RKXA 2FFCA 4NZJA 2CW6A 2Y89A 3P62A 3UWQA 4UTIA 3MP5A 1ALDA 3G1XA 3F1QA 1OK6A 2EKCA 3S9YA 3IIXA 4JR5A 4IXXA 1VPXA 5K7JA 2V5BA 4IMGA 1RVGA 5T26A 1YTKA 1PHQA 4MZ8A 4TR9A 3LV5A 1OFPA 3NOEA 1AW2A 5CPNA 3W7OA 2EF9A 3GLCA 3QPZA 3O07A 2ZZ5A 1GPWA 2FJKA 3NL3A 3QPYA 3O8AA 4POCA 2ZQ0A 3LRLA 1H7RA 5HJLA 5L6UA 6ALDA 3LOTA 1K3UA 1OK4A 5G5IA 3IIVA 3PBUA 1TQXA 1FCUA 5EL1A 3O6DA 3NPXA 2YYUA 2QUTA 4HKPA 4JN6A 2GVJA 3EX1A 3W7HA 3LCHA 1W37A 3FIGA 3U6WA 4N6FA 5DBUA 3NQAA 3W73A 1NF0A 3QEZA 1KM2A 3BARA 3QC3A 4MYAA 1H7OA 3TMQA 1N8FA 2QJHA 2JKPA 4HNVA 2BZNA 2ISVA 5KSWA 4UUIA 2J24A 3EX2A 3Q2DA 1XBZA 3EWWA 4GFSA 4NUWA 5EY5A 4IXHA 3EX4A 1QR7A 1TPC1 3P5ZA 3QSRA 4NXKA 2GQ9A 1QO2A 1LROA 4EF8A 5G2IA 1N7KA 1CX9A 5A5WA 3O6CA 3S8HA 5EPDA 4JICA 3GX9A 2DZTA 2CLEA 5KINA 1GEQA 4CCCA 3WK2A 3Q94A 1F7BA 3BGJA 4U4MA 3SW6A 3OIXA 3L67A 2XFWA 3W7CA 3LCXA 1ONRA 5F2MA 1A5BA 4X22A 2XN1A 6TIMA 5H2ZA 3N3MA 2Q3RA 4EOUA 3W2UA 4OBTA 3W1MA 3VFLA 4JDYA 1SZNA 2YGYA 3W2JA 2OJPA 3W1AA 3CWOX 4A2SA 3K30A 4OQVA 3S1WA 3W07A 4UTWA 1PS9A 1ME8A 3FFSA 5EKYA 1UUOA 4ONVA 2V0TA 4PTNA 1VLIA 3DFQA 2DZSA 3L68A 3RLUA 1EP2A 3LGEA 2Q8LA 3KVMA 3CPRA 4GBUA 1L2UA 3R89A 3UWUA 4UFKA 1SZEA 2HSAA 4NJKA 4R33A 1KFKA 4FNRA 1FWRA 4WUIA 2BXVA 3ATYA 1AMKA 3HB9A 3HGJA 1H7XA 4DEFA 2ZRXA 4JTGA 1LLZA 3E02A 1RPXA 4BWLA 3ZFHA 4CNOA 4OWGA 1JCJA 3UQNA 4HPJA 1TQJA 1UJPA 4ZQNA 4UMBA 3FA5A 2CLOA 4JX6A 4MY1A 3FYPA 1KA9F 3L5AA 1D9EA 1RD5A 5CG7A 5HQEA 4OV4A 1TMHA 4BR1A 1LOQA 3PB2A 4GE8A 1VCGA 1YPIA 1VZWA 4JTHA 3V75A 1G4SA 1NFBA 3SI9A 1ICSA 3GZ3A 1KM3A 2E6DA 4FB7A 1H62A 5D2XA 1JCYA 3KRUA 4O12A 3GKAA 2GQ8A 4C1LA 5HUOA 1P1XA 2ZA3A 4LC6A 1T8XA 4Y90A 3A5FA 3QJAA 1XUUA 4DQWA 1OF6A 2B7PA 1R46A 4NNAA 1OABA 4JY8A 4K8HA 5DCEA 2IQTA 3DI0A 3SR7A 4LNYA 4FO4A 1GZGA 3OEXA 1FBAA 1Z48A 1W3IA 3G1YA 4PC8A 2CLMA 3OG3A 1IIHA 3CB8A 2A1YA 1SZFA 2J6XA 3VCRA 3W74A 2JKEA 3TFXA 1ADOA 2CZFA 3HPSA 4JEQA 4FNSA 4N2YA 1KM6A 1CW2A 3TJXA 4UTLA 4DBEA 2JGQA 4LS0A 4CQ9A 3INPA 4K37A 1TO3A 4UTMA 1P0NA 3NM3A 1OJXA 1YXDA 2WNZA 1N55A 1P0KA 1ZY9A 4HHPA 3W7EA 4JS3A 3TCEA 4JX4A 2Z6IA 4QJ1A 2QEZA 3UD6A 1IF2A 3W7KA 1I2PA 3TH6A 1G4EA 5G4EA 4DO5A 5F2LA 2RDTA 1ZJIA 3G0SA 3QYQA 4HNUA 1QFEA 2DORA 1F2JA 1O4UA 3RU6A 1F05A 1V5XA 1MEHA 2UV8G 2NV2A 4QM1A 4YMZA 3Q37A 4S2CA 3NPUA 1TJRA 2QCFA 3B05A 4XKYB 1Q6OA 5K2ZA 3LDVA 1TPVA 1SO4A 3IIZA 2CWNA 1OX5A 4UFHA 4AAJA 3O16A 3CHVA 4AB4A 1I2NA 2HS8A 1ICQA 3W22A 1L6SA 3NQ2A 4WJEA 5D32A 1OFDA 5BW6A 3CIWA 1Q3NA 3HG4A 1LRNA 3P7YA 3DI1A 4JYEA 2VKZG 3M41A 3GDTA 5D30A 4DO6A 4FEZA 3TSMA 1ZAIA 2ZZ6A 1VHCA 5HULA 3ABRA 1OYBA 3CM4A 2TRSA 4WX2A 1QNVA 3LX9A 1GVSA 3BK0A 1WA3A 4PL1A 2YDAA 1K7XA 1QPRA 3IIPA 3W7PA 4LVFA 1B9BA 2A0NA 3HMJG 3M6YA 4GC4A 4QITA 2TPSA 2XN0A 3O63A 3SJ3A 3TFCA 4O50A 3PSWA 3KHJA 5K9XA 2AGKA 2OCZA 3TW7A 1H61A 2FDSA 4X2RA 3PB0A 3MP3A 3NXFA 3I68A 1EWEA 2I14A 1RV8A 4TU1A 3THAA 4O16A 5AYYA 3M9YA 3HG3A 3T55A 4Q4KA 1AW1A 4Q33A 3G1HA 2A2IA 3C0JA 4O17A 2ZRYA 3I7RA 4BK9A 3GK0A 1LOLA 1JCXA 4O14A 2Y7GA 3USBA 2B7QA 4HNTA 3M1ZA 3NQGA 3NO5A 3SECA 4LY8A 3ZWSA 3NG3A 5AC8A 1O5KA 2YXGA 4DF1A 4NQ1A 1OX6A 3GR8A 3H53A 3WJSA 1Z41A 4HSOA 3TIMA 2I9EA 2ZZ2A 4O1DA 1MEWA 2A7RA 4AHOA 5TQLA 3JS3A 4FX8A 3DHFA 1W56A 2X2GA 4Z1CA 3UY7A 2E09A 4NZFA 4QNEA 2CU0A 2WJZA 4JX5A 4R34A 4O10A 1KTCA 4WY0A 1YADA 3QMTA 2NXHA 2NWSA 2OT0A 2YPIA 3QQ0A 4S2BA 5LZLA 2ZTJA 4YXGA 4MLRA 4QQ3A 2EPHA 1RR2A 3A5VA 1VGAA 1SUXA 4NJHA 3W1LA 4ICNA 3GYEA 3R12A 4RXGA 4A22A 4W9TA 4O1CA 3GAKA 5IBXA 5A8GA 2W6RA 4JXCA 2TSYA 1RZMA 3SGZA 2QF7A 3MI3A 1BEUA 1DQXA 3WFAA 3W1PA 3W1TA 4Y6GA 3TAKA 1H50A 3TV8A 2TMDA 4AVFA 3L2IA 5DXXA 5CPMA 1Z42A 1YTEA 4HPXA 4AEOA 2ZZ7A 4QISA 4L4LA 5K9DA 2P0OA 1GVOA 2Y70A 4ADUA 1QOPA 4LU0A 2X16A 2G96A 3LTYA 3O05A 3C4UA 4LOCA 1G7UA 4N9BA 3N2MA 1OFEA 3GNDA 3TXVA 1XC4A 1FWNA 3NL2A 2YW3A 5I3FA 1VC4A 3LXAA 4TIMA 2X1UA 5AHEA 4MY8A 1DQWA 3LERA 1F5ZA 5HNRA 5DCDA 2DJXA 3F4WA 2OT1A 2B7NA 3LRKA 4QAIA 2QCDA 2FB3A 5CZ0A 3FLUA 3GAYA 4GJ1A 4ZQMA 2JKAA 4YLWA 1I45A 3T7VA 1DOSA 1W5OA 4EIVA 4Z1AA 3NL5A 1LBLA 3G18A 4CLMA 3LCIA 1VYSX 3PVFA 4A3UA 1W3NA 1XDLA 2X1TA 2NUWA 3LM7A 3LHTA 1NAL1 4EVZA 3TNOA 4LC8A 2E5CA 3HGSA 2E6YA 1KTBA 1QCWA 1W1ZA 4DBDA 1K03A 5DELA 2A7PA 1SO6A 4Z08A 1ZFJA 1KM1A 4AWTA 3TJLA 2GQAA 3IGUA 1OF8A 1Q6LA 2QJGA 3EB2A 4AHPA 2ZA1A 3FS2A 4CCDA 4ALDA 1GVQA 4UR7A 3MYPA 1SSGA 1L9WA 3PC0A 2CLFA 2YR1A 4WOQA 4AF0B 3SFKA 1AK5A 4N4PA 1P5BA 1PV8A 2CZ5A 1LP6A 3MYOA 1LYXA 5F2IA 3SIZA 5CSRA 4RZ5A 2QUVA 3C8FA 3G24A 1XM3A 3PBWA 2YX0A 3WJWA 2ZRZA 4XWUA 1OHLA 3T40A 3NQCA 3OBKA 1TCDA 3KRZA 4KFNA 3ZWTA 1OG0A 4NVTA 3T4CA 1S5WA 3MP4A 3FJLA 1UBSA 4WQ6A 5C54A 2WOQA 3E0IA 3JRKA 1MXSA 5HR7A 3HIJA 4OV9A 4A2RA 3UNDA 1OX4B 1FDYA 4O53A 4MY9A 4ZZ9A 3S0CA 5EMUA 5FEXA 4TO8A 1LRTA 4GUIA 4N6EA 1LM1A 2Y85A 4Z1BA 4WOZA 1MEIA 1H5YA 3M47A 4O0KA 4QSHA 3NPVA 3L0GA 2AAMA 1M7PA 2C16A 2DJLA 5GVJA 3HBLA 3BO9A 1JVNA 1BWKA 3EX6A 5J5DA 2DZPA 3IV3A 3G1SA 5C5YA 4OGZA 4RK8A 3MHFA 1TPEA 1UASA 3LLFA 4LVGA 2YFNA 4LRSA 1C29A 4WY0F 3B8DA 5EYWA 3SZ8A 1R30A 1D3HA 2E6AA 4I7WA 2HS6A 4XBSA 1QPNA 3JR2A 2HTMA 1H51A 1GOXA 1VRDA 2Y7EA 1M6JA 5F4SA 4E2DA 4I7VA 4BF9A 3B0PA 3S1XA 4O18A 1YDVA 5FEWA 2EAWA 4DO4A 3P84A 4GXMA 1UUMA 5CGQA 2PCQA 4KWVA 3S1UA 1X8FA 1C9DA 2ISSA 3HPZA 4UTHA 1ZCOA 2EGZA 1GQNA 1W54A 1VLWA 1F74A 4XUGA 2PRMA 1LOSA 3DKJA 4TX9A 4OT7A 2X1SA 1UB3A 1C8VA 4EWND 2QJIA 5DY2A 3E49A 3M5YA 4LS2A 5HWNA 1ZNNA 1VYPX 1DL3A 3G1VA 4JTTA 4YL2A 1E51A 5FI8A 5LGXA 1FXQA 3P74A 5D05A 3TA6A 3W23A 3KRSA 4M7TA 5EBUA 4NJIA 2ABAA 3U8GA 4IWWA 1H63A 1XL9A 4H3DA 4LV9A 2VC6A 2PRHA 3MWAA 1GWJA 3TX9A 2BWGA 3W1RA 4LVDA 1TJPA 2NXIA 2FPTA 5KMYA 3NAVA 2V2HA 4S1FA 3UXAA 3W83A 2VFHA 1TRIA 3PG8A 3A22A 3ABQA 2A4AA 4FX6M 4LTSA 3LB0A 1F6KA 1DKWA 3DGRA 1FDZA 1EX5A 1W5NA 5D03A 3Q58A 4JY9A 3DFTA 3MJYA 3QQ1A 2CLIA 4E0CA 3DZ1A 4XQ6A 3DFSA 2NWRA 1UCWA 3DENA 1OFQA 3TR2A 1IXOA 1EWDA 4LRTA 1QWGA 3P8IA 4Z1DA 2WO5A 3QSTA 1FCVA 2WSYA 4JIQA 3TW6A 5D02A 3L5LA 3M5VA 5C55A 5FF3A 3ABSA 4O19A 3EWXA 1TTQA 3FKKA 3QFEA 5LNVA 3W88A 2QCGA 5D2WA 5D37A 4Y96A 2H8XA 1X1ZA 2ATSA 5KTLA 3GXTA 2FIQA 2QCHA 3EWYA 4U28A 2GOUA 3DU0A 3PR2A 1GG0A 4JTSA 1Q6RA 3UZJA 1FY6A 4DF2A 4NT0A 5DBTA 3UPWA 4A29A 1KM0A 2VEKA 4JTUA 1PL9A 2C18A 2O7SA 3RK8A 2YZRA 1DVJA 2QDHA 4MZYA 1TPDA 3HO8A 3R8RA 3LCWA 4RCXA 3DAQA 2RDWA 4JTLA 2VXNA 2ZYFA 4MVAA 3QM3A 1BKSA 3N9SA 1TIMA 1HG3A 3R2GA 4UTWC 5HR6A 2G95A 1R2RA 2V82A 3IIOA 4AH7A 3ZR4A 4LV4A 4O13A 1EB3A 3OVQA 1EA0A 3P82A 4N9DA 2W0UA 1WOBA 1MSSA 2J9YA 2NZLA 2QUUA 4CCEA 1AW5A 4ZQPA 2VOMA 1A5AA 1J5TA 3LXBA 3LCLA 4M19A 1VH7A 1HFBA 3L5MA 4JGDA 4JYDA 1SW3A 5L9FA 1EUNA 3MMTA 3TQKA 3P61A 3KX6A 4NNBA 4CQ8A 1DBTA 4WXZA 1G67A 1TV8A 5D2TA 3E9AA 5D09A 3O6YX 4OHQA 1XXXA 1SR9A 5AOUA 2C19A 4FNQA 3RMJA 5E93A 3W7LA 5KZMA 5LNRA 1DHPA 1W3TA 2ZZ4A 2ZFAA 5HUPA 5LGZA 5J5RA 1XBVA 4LVBA 1A5CA 2H3BA 3N2XA 1SW7A 3PUOA 3STFA 5CZJA 4M7SA 2ALDA 2GUUA 4RZ6A 1PVNA 3ABOA 3NDOA 3W1XA 4O1AA 1LORA 1KFLA 1JCLA 3C2VA 3HF3A 5FF4A 5EA9A 2YYTA 3UWZA 2Z6JA 4PH6A 1W31A 3T44A 4IMFA 2Y62A 3G8RA 4JD4A 4D2JA 4DPPA 2Y63A 2QCLA 5DLCA 4I7UA 3U2OA 1G69A 3W2NA 1LLWA 5BMWA 1AL8A 2D73A 3NQFA 2WV8A 5C6MA 3L0KA 3KFTA 2V8ZA 3A9IA 5IM51 3N9RA 4IMCA 3G0XA 2F7FA 3MHUA 3W7QA 3B03A 1S3HA 3GDKA 2KZHA 2V2DA 2ABBA 3TSBA 1KM5A 1S5TA 1NF7A 1QMLA 1H7NA 1SSDA 3YPIA 3NQEA 1ICPA 3C2RA 3PY2A 4IJBA 2E77A 3PULA 4RJEA 1W5PA 3W7MA 2ZRUA 3B4UA 5K4ZA 1FWTA 4NXSA 4Y9AA 1JJKA 3QMSA 1HO1A 3E96A 4IMEA 1ML1A 3C3NA 3A23A 1O94A 3PS7A 3WK1A 1A50A 1PIIA 1KM4A 5D33A 4IX0A 3DFOA 3M44A 4UCGA 3BG5A 1VQTA 3G8EA 3LTPA 2NUYA 1KFCA 5G4WA 1LZOA 3KVJA 4IPIA 3C61A 3STCA 3LCGA 3THQA 4LUIA 4DF0A 1SO3A 4ZVJA 4R7JA 1K7FA 1ZAJA 1I4NA 1ME9A 3DHDA 3WK3A 1D3GA 1KV8A 3LHVA 3UWWA 2YCEA 2PURA 1WYIA 3TQVA 2Y7DA 5HWMA 2R14A 1WQ5A 3G0UA 4P2VA 7TIMA 4YWIA 2QR6A 5FF7A 1TTIA 1F76A 3W7NA 1TTJA 3TDFA 3W2MA 4OE7A 3W7DA 5CKSA 3KVKA 4K39A 3UWYA 4HNNA 4MPQA 3NM1A 2Y61A 3DFPA 4UXDA 1I2OA 3TROA 4C1KA 1F73A 2A6NA 2NX3A 3M5XA 1TPB1 1AG1O 1JRBA 3F03K 1EPXA 1XBYA 4DELA 5I3IA 3LI1A 3BLFA 4RR4A 4WZHA 2VEPA 4O8RA 2CLLA 3LBCA 2VFDA 2H6RA 2Q3OA 5KZEA 3EKLA 3M7WA 4IMDA 1EP3A 3L66A 1H1YA 1J4EA 4FIRA 1XKYA 4WY0B 4AWSA 1I2QA 3MI2A 4JNMA 1P4CA 1EUAA 1O95A 1WDWA 4RV8A 1S5VA 2J27A 1LRQA 3NZRA 4QNWA 2QCEA 3S5ZA 3CEUA 2WNQA 2NUXA 5LNSA 2NXGA 2V81A 3NQMA 3LLDA 1B3OA 4UTKA 5BMXA 2BX7A 5D04C 1T0OA 4UIOA 5AHNA 1TV5A 1GG1A 3RF9A 2R8WA 2A6LA 3RFAA 1RQHA 4MFEA 3QZEA 4LT9A 4GUHA 3CTLA 4K8EA 3S5NA 1WBJA 3CLMA 3PSVA 5DN1A 1OYCA 3S5OA 2YSWA 4GWEA 3A21A 2ZTKA 1H7PA 2CLKA 1K02A 4ZQRA 2C3ZA 2VFEA 3W2KA 4LUJA 3N34A 3O1NA 3TAOA 3P81A 3FYOA 3GDMA 2Z2UA 2VFGA 4ZL1A 4O54A 4KFOA 3STEA 1GYLA 2QCMA 2QDGA 1PE1A 3KXQA 3L9CA 2RHGA 2VFFA 5F1VA 3LHZA 1AL7A 4LW7A 3CT7A 1EIXA 3TMLA 2V5LA 3BG9A 4PFMA 1GT8A 4FIQA 5K4XA 4UFIA 2QKFA 4IQLA 1W5MA 1KLZA 1GYNA 2DP3A 1M7OA 1NSJA 1JUBA 3BV4A 3G3DA 1CI1A 3G22A 5G1TA 2GPTA 1YTDA 1KTNA 1WX0A 5CPOA 2VELA 4XZ9A 3TC7A 1T96A 2X1RA 5C2XA 3IVUA 1YXYA 4UTTC 3MUXA 1FXPA 2QCDB 4FXSA 4Q32A 2DZWA 1TYGA 4JIPA 4LWWA 4N4QA 3P8JA 1B4KA 4UMAA 3NQ8A 1BTMA 4K7YA 3EWUA 1DV7A 3DBPA 1I2RA 2E5DA 4OU1A 2E68A 4GUGA 3DFNA 4MYXA 2QAFA 3KAOA 1W8SA 1YLVA 1K7EA 4M5PA 4NU7A 2GVLA 1SO5A 5G1YA 1U83A 3M5ZA 1KW1A 1R2TA 1NVMA 1JQVA 4YCOA 1MO0A 5I3KA 5DY3A 5AHFA 3LHWA 2Y88A 5AC7A 3PUEA 4MOZA 3N73A 1OFBA 4TMBA 1JQXA 3HG2A 4XTDA 3N19B 5AHMA 3GVGA 3WJZA 2E5BA 4E2BA 4PEKA 4UMCA 5AFDA 2FLIA 2WKJA 3GXNA 2RDUA 3PG9A 4GNJA 2V2CA 4ZMGA 4X9SA 2FPYA 3T78A 3PWAA 5F2GA 1Q6QA 1ZHAA 3LHUA 2JBMA 3A24A 3B04A 3W72A 1KFJA 1LBMA 2XN2A 1ZAHA 4FNPA 1K8XA 4PL2A 3ANYA 3H54A 4ZQOA 2EHHA 1XBXA 5D2YA 3P60A 3GR7A 5DXYA 1KFEA 2Z0IA 2ZA2A 1SFLA 3RLVA 2DZVA 2VEIA 3LXCA 4N02A 4M6PA 5BNKA 1VS1A 4JDBA 5F4XA 4ORIA 3C2OA 4ADTA 2B0MA 3VKJA 5LHFA 2B7OA 1RQEA 2G97A 2P1FA 4L4MA 1FX6A 1FDJA 4Z0JA 5AYZA 3FEMA 2RFGA 4RZ4A 1TV7A 4MLJA 1G6CA 2C13A 3LBMA 5U7SA 3L0NA 4UC5A 4MJZA 4HSNA 2VFIA 1KV5A 5FF2A 3LI0A
chains in the Genus database with same CATH superfamily
5CQ1A 1RA0A 1XLLA 4KWUA 5D38A 5LNWA 3VIJA 4M6QA 4X61A 3VE7A 3W1QA 3CUFA 4Q6JA 1L6FA 1BPLB 2AKZA 1DORA 1J6PA 3GVQA 4I90A 2PSNA 3TP4A 1OFAA 4Z2HA 4I9AA 1RAKA 3ENLA 2C14A 2BLEA 4YVVA 1U5HA 1EF2A 1SMDA 4RW3A 4AG0A 3BW4A 4AD3A 1LTDA 1KFBA 3GS6A 3FKRA 2GJLA 4HVXA 3PZIA 4PODA 2DZXA 1W1B1 1J0IA 3L65A 1H41A 1JXJA 2VD9A 3PAOA 4NX0A 4V15A 1FHVA 2ZDRA 3B8WA 2WLYA 2YFOA 4AIOA 4YCPA 4LEFA 3PPCA 1KD0A 3EKGA 4NZ5A 4DXXA 2QULA 1UWTA 5CC7A 4TUFA 2WPGA 4P7QA 4JTEA 5HAOA 5I00A 3H55A 4DNMA 2O9PA 3VD4A 3NZQA 1IGSA 3C52A 4BEUA 2ZX6A 2DEPA 3QY6A 3CPGA 2WHMA 1Z44A 5IOBA 3CJPA 1G7VA 2FQIA 4S3GA 1H1ZA 1VPQA 5C0QA 1Y5VA 4AISA 4U5KA 2DT3A 2WPBA 2W63A 2WSQA 3AMDA 3DC0A 1IT7A 1V6UA 3PFMA 4R7WA 2CBIA 2BGSA 3QMRA 1YYAA 2H90A 1SFJA 1MXGA 2J13A 2INEA 4L6DA 1K4HA 4O4VA 2ZZ1A 1QAPA 3AZSA 1PWLA 3LZ5A 4QE1A 4CQBA 2BG5A 2PFHA 3KZSA 2WQPA 3HG5A 3AU2A 4HU4A 3G1DA 3WJXA 1W3LA 2J74A 2QCNA 2INFA 2JGYA 3WELA 2X2YA 3DKLA 1XQKA 1VFUA 3UJ2A 3IEBA 1GCYA 4CGTA 1J2BA 2R1MA 4BFAA 2OSYA 1R38A 1SJCA 3K13A 2O7QA 2VQUA 2ZDSA 2CFFA 2UY4A 4HZ8A 4IGHA 3V7PA 1VEMA 3WO8A 2OODA 5JXQA 4GIRA 1MUWA 3UY8A 1PTAA 4DPQA 1FCBA 3W9ZA 3PTDA 1E56A 3AS3A 1JULA 3IUHA 1TELA 4YTTA 1PYFA 3CV6A 1AQHA 3V36A 3PN8A 3AJXA 1PHWA 3T8LA 3GH4A 3DECA 3O15A 3GDLA 1ZBKA 3AO0A 4JL1A 3P6LA 1FUYA 3TQ0A 1KBKA 2P10A 2B81A 1XRTA 3URQA 4JTIA 3BLEA 4WDUA 1K8ZA 1ZGDA 2EPNA 1R7AA 2E9MA 2XINA 5EBAA 1JGMA 4LB3A 1OCQA 4GI6A 1KXHA 1UH3A 1GJWA 2BVDA 3S2NA 1FWAC 4DI8A 4JIRA 1VYRA 2ISWA 3HQ1A 2OR2A 3UXDA 3H2EA 3W85A 1QT1A 5ABFA 4MKNA 3HJZA 3OGVA 4R53A 2WNNA 3AIQA 2O9RA 4RE0A 1FWDC 3NL6A 2J9ZA 1EP1A 3IRDA 5CPSA 3EYPA 4H9XA 3W7IA 4PTVA 1B3YA 3S1GA 2BY2A 1WXJA 2PTDA 4O15A 1TVLA 3RDKA 2E9BA 4MADA 4CD5A 3MMUA 3SGUA 2DZUA 3K2GA 1HKMA 5M5DA 1ZCCA 1X8CA 4UNLA 1QOQA 1V3JA 2A5HA 1O7AA 1EHNA 1VHNA 2ZIDA 1H0GA 1X6UA 4PUNA 3CNYA 3IRSA 3I6RA 2E1DA 4Q8VA 5HMEA 3W37A 3GB6A 1KBJA 1EFZA 2PDKA 3MKKA 1FRBA 3RILA 1DWGM 2NV1A 2WSPA 4IGMA 3CQIA 3SJNA 1EEPA 1UR3M 2A7NA 4B91A 4XKMA 4NJGA 1QHOA 4OVXA 2C15A 1DXFA 2QCCA 4V1XA 3NNTA 3VI2A 2A3BA 1N8IA 3SSJA 3CHCA 2UBPC 1J93A 2WWCA 1UD3A 1AMYA 1E72M 1YXCA 1KKOA 1R2SA 3VIFA 4DBSA 1PBGA 4HBKA 4WGHA 3FXGA 5AYXA 3M43A 2HBXA 4P7OA 3VOFA 5MHBA 1V3IA 4FNTA 1ECQA 3EWBX 2DT1A 3UCQA 5C9UA 4UTUA 1F6PA 2Z4GA 1W0MA 4QS6A 3SADA 4AVNA 1XIIA 3CTTA 5G2HA 4XO7A 3QFWA 4FLQA 4IIDA 1QHZA 3GNXA 1E4NA 3T0BA 3I3DA 4ORMA 3P67A 1EC9A 3PPFA 1GJPA 3MT1A 1JRCA 1YDYA 3GDRA 3IV8A 3WQOA 1EXPA 1SU5A 3BLLA 1ZENA 2V63A 3K8KA 8TIMA 2QVNA 3NTYA 2RH9A 1HJSA 3C86A 2FZMA 3SCRA 4GUFA 4DY1A 4B92A 3W7JA 1DJQA 4JTQA 4FNUA 1XCFA 4Q8UA 1XH0A 3TYEA 3TJ4A 3KTCA 3W1NA 4JTJA 1OX4A 3N6JA 3BLIA 3I7QA 4IJCA 1HXJA 3I4KA 4M6VA 4D8AA 3ATZA 3ZOAA 3ZT7A 4PCSA 1GORA 1K8YA 3NVTA 1LJYA 1EJXC 3LM3A 2QJMA 1Z9AA 2FZDA 3XISA 2Y5SA 1WCGA 4Z0SA 1VAHA 2R24A 1K9TA 3BZJA 4AMAA 3CZ8A 4ZSTA 2HZGA 3I65A 4B2DD 2Y89A 1R9YA 1AH4A 4RE3A 1CDGA 1R3QA 1KWKA 3G1XA 3F1QA 1OK6A 1XLEA 3OVGA 4QSFA 2G4JA 4GY0A 3BOFA 1QK0A 4IMGA 1NWSA 1Z89A 1CBGA 1P6BA 1YTKA 2J62A 3LV5A 1OFPA 2ZOXA 1AW2A 5CPNA 2EF9A 1GW9A 1JD9A 3IJQA 1AH0A 3KOZA 1GPWA 3UXIA 2FJKA 3QPYA 3O8AA 4KH2A 2ZQ0A 1H7RA 5HJLA 1QXLA 3LOTA 4PGLA 5E9AA 1K3UA 4D9PA 3PBUA 4ZODA 1TQXA 4YYCA 4J7RA 4JN6A 2GVJA 2YBUA 4D8ZA 1M01A 1W37A 3NOYA 5DBUA 2BHYA 1LQ0A 3BARA 3CO8A 4MYAA 2PGEA 3KDOA 1N8FA 2BZNA 3EX2A 1XBZA 4LALA 1JF6A 4IXHA 1XCWA 1TPC1 3C5QA 1CWYA 3RR4A 2GQ9A 1QO2A 1LROA 1OC7A 1N7KA 1CX9A 1XCXA 4W8BA 1ITQA 3CGTA 2O56A 3O6CA 3S8HA 5EPDA 2P8BA 2XGBA 4UWMA 1F7BA 2FMNA 2GSHA 1Q2SA 4XVDA 4U4MA 3UU0A 3L67A 3W7CA 2DIKA 5F2MA 1ECEA 3EDKA 2BV9A 1BXCA 1FH8A 3COTA 2XN1A 2VT0A 3DX5A 6TIMA 4AIEA 4K3ZA 3PK7A 4PUUA 2OO0A 1GKPA 1NDZA 3W2JA 4Q22A 2OJPA 1YNYA 3W1AA 1XH2A 1Y5XA 2Q71A 3REQB 4A2SA 1UHVA 4OQVA 1KR0A 4GI9A 4YN5A 2VX6A 4PTNA 1TG7A 3AI0A 3UETA 3DFQA 3L68A 5BROA 3OLIA 4GK8A 1FWJC 3R89A 5JIPA 3PJXA 1P43A 2HSAA 1LLOA 3DHPA 3ATYA 2V68A 3HGJA 2ZRXA 3UXKA 4AZCA 3P0WA 3ZFHA 2DSVA 1PZ1A 4CNOA 4HPJA 1TQJA 1H2JA 1OD0A 4UMBA 1PZ2A 4JX6A 4ATDA 5CG7A 3FK4A 3DYPA 1SJDA 1GZJA 3VNMA 1K1DA 1VCGA 4JTHA 3V75A 3CZKA 4NIRA 3SI9A 3GNPA 3QR3A 4PMDA 5REQA 4FB7A 1H62A 3T08A 5GJPA 1ADSA 3U4AA 3LI0A 2HXUA 2ZA3A 4HA0A 4LC6A 1GW1A 1T8XA 4Y90A 4AEFA 4V27A 1XUUA 3LPFA 1JZ3A 1OF6A 2B7PA 4H8NA 4NNAA 2Z1XA 6REQB 1EBHA 4JY8A 5DCEA 2IPJA 4S3CA 3RMEA 2HPMA 1RH9A 1Z48A 4PC8A 4EACA 2CLMA 3RO8A 4AQLA 3AZRA 2A1YA 1N2VA 3ITXA 3K1GA 3W74A 1UW9A 3LUTA 1ADOA 4JEQA 1XDJA 3BXWA 3AROA 4DBEA 5E70A 4K37A 4QDPA 1P0NA 1YXDA 3SO7A 3W7EA 4JS3A 1R6WA 2GZXA 3VMOA 1RPKA 1I2PA 1EJSC 2J75A 4DZHA 2PDIA 1OIMA 3TH6A 4DO5A 4NKCA 3TTEA 1PIGA 1EC8A 3QYQA 2DORA 3WNNA 4C91A 1XRVA 5E5CA 4C6NA 1F05A 4P7NA 4YMZA 4S2CA 1TJRA 4XKYB 4ZA0A 2FVKA 4LUTB 1OX5A 4KESA 4UFHA 4G7EB 2HS8A 1CXLA 1OFDA 3CIWA 2GYIA 3HG4A 4ZO8A 1LRNA 4AVOA 2G37A 4JYEA 1OBAA 2PLJA 4WR3A 2Y8KA 4FEZA 2PDJA 5HJXA 4JCLA 3ABRA 3WCZA 2TRSA 3BK0A 3U48A 1QPRA 2C71A 3IIPA 3CK5A 4F8XA 1QOXA 4LVFA 3VIIA 4U10A 2HK1A 1M1BA 2A0NA 4GLEA 3F4CA 4QITA 3ZSTA 2XN0A 3SJ3A 3PTQA 4O50A 1J01A 1HX0A 1V03A 5CJNA 3WMCA 4X2RA 3QR1A 1Q4WA 4L64A 4XAYA 3THAA 1TWWA 3C0SA 2DGAA 1IEQA 5C8BB 4HSHA 4X60A 4QHRA 1VEOA 2P76A 4A35A 3ISIX 3I7RA 4BK9A 4RPQA 5JUVA 3WH8A 2EPLX 4IIHA 2Z26A 1LQ2A 3SECA 3MCNA 5AY7A 3OGRA 1Q13A 4GNKB 3GH7A 3N4FA 3ZWSA 3NG3A 2YXGA 5CH9A 4NQ1A 1BF2A 3WJSA 4DX3A 4HSOA 4O1DA 5I78A 3NEHA 2A7RA 4RUBA 3JS3A 4TVDA 2VR4A 2RJHA 1W56A 1TVPA 2E09A 2VOTA 2G0WA 2VZUA 3PZOA 4YNGA 2PI6A 4PUMA 2NQ5A 2F8QA 4AYGA 2J7FA 4XBJA 5FL0A 1M53A 3H2OA 2XIQA 5CJ5A 4QQ3A 1EJTC 5A2BA 1UD4A 1RK6A 4X63A 1VGAA 4TTUA 2CHRA 1FWHC 2ZX7A 3R12A 3HZ3A 4A22A 4BY3A 3ITOA 4QJ5B 4JZ5A 4KQNA 4RV3A 4QP0A 2TSYA 1GQKA 3W1PA 2GGHA 3VCCA 2D24A 4S23A 4Q8OA 1ODZA 2TMDA 5G4HC 3V4BA 4Z2GA 3RGTA 3L2IA 5DXXA 1Z42A 4HPXA 4BS0A 3VMPA 2ZZ7A 4H6EA 4L4LA 3CZEA 2P0OA 4ZXOA 3L12A 5AC5A 3LTYA 4AEEA 4S3JA 1PX4A 1WXZA 2P8CA 1Q6EA 3GNDA 3RXZA 3LLXA 3GU1A 2V5JA 1NOFA 3SRKA 3LXAA 5HANA 2X1UA 5CC3A 1DQWA 1OT2A 3LD5A 5HNRA 3F4WA 3VUPA 4TX6A 2QCDA 1BVZA 4GJ1A 1JDDA 1HGYA 4YLWA 1EJUC 2ACUA 4KBXA 1DOSA 4HU0A 3SIMA 1LBLA 2I57A 3G18A 4CLMA 2YJQA 4OUEA 3LCIA 1VYSX 3WNPA 4WKHA 1F3WA 2ZVRA 1Y7VA 1W3NA 3T2QA 2YXOA 4IIFA 2J7BA 4LGXA 1MRQA 2FHBA 3T1GA 5BU6A 3ZIZA 3HGSA 1GKQA 1GVYA 4IG2B 4RDWA 1OIFA 1NIUA 4HA4A 2VEFA 1SO6A 3T4WA 1D8WA 3ZLHA 2FZ9A 3IGUA 3WMBA 1Q6LA 4CNTA 3Q65A 1DPMA 4J2MA 3BMXA 4CCDA 2ZA1A 1JPMA 2PWEA 3MYPA 5DMMA 3ALFA 2HWGA 4R3UA 3MS8A 2BY3A 2NQLA 3KDNA 4QS5A 1J0HA 4N4PA 1P5BA 2PEVA 7ENLA 2NQJA 5F2IA 1I6NA 1MMFA 5CSRA 1EDTA 4W89A 3T40A 3NQCA 1YMYA 1TCDA 1LF1A 1UBSA 3EMQA 2JIWA 4AZHA 3HIJA 1E6ZA 4FXFA 3U57A 3KWXA 1JZ7A 3MZNA 1XRFA 4F0KA 1Z7AA 2Y4SA 1CPUA 4TO8A 1Q7QA 1LM1A 2V3FA 3AFBA 2A3CA 3M47A 5FAJA 1ONXA 1KBBA 1QK2A 3WEMA 1ITXA 2DJLA 3N9KA 3HBLA 3EPNA 1NOUA 3SUVA 3OHMB 3G1SA 5C5YA 2X40A 3ZXWA 1PKNA 3LLFA 2YFNA 3UW6A 4A4AA 1C29A 2VX7A 4MPKA 2E6AA 1L0PA 4GG9A 1DIEA 4UQBA 5E0FA 2HS6A 5D8ZA 1QPNA 3TYAA 2IPGA 3P0XA 1H51A 1O1ZA 2JF6A 3ITVA 1KFWA 2NLYA 1VRDA 1M6JA 1OD8A 4NI3A 3GU9A 3FVDA 3TN6A 6PTDA 1OEPA 5FEWA 4DO4A 1NH6A 4KWVA 1C9DA 3VABA 1H5VA 4R5EA 3OTRA 2CKRA 3QC0A 3EB3A 1W54A 4DYKA 2NQZA 4C5YA 4KW2A 3QHMA 3S4TA 3QHOA 1UB3A 2IKJA 3WYZA 3ARPA 3IANA 3E49A 1UZ4A 4LF2A 1K70A 4LS2A 3GTNA 5FJUA 5GNYA 3N18A 1ZNNA 4I9MA 3G1VA 2EBNA 3WQ5A 3IUIA 1JGIA 1ZBWA 1PXGA 1FXQA 5D05A 3N2BA 3W23A 5EBUA 4Z2JA 3CZJA 1FH7A 1J10A 3MVIA 4QDWA 1J11A 2D3NA 3U8GA 3BOLA 1XL9A 1MYRA 4LV9A 2V5CA 4IIGA 1TX2A 2BODX 3FV9A 2VC6A 1RHCA 2PRHA 4D6DA 3BMWA 4FI4A 2BWGA 2PF8A 3EDEA 5KMYA 1OWQA 4WKFA 2OYMA 3W83A 3BV7A 3B9AA 3PG8A 2PPGA 1DKWA 1O66A 1XW8A 4B5TA 2FJUB 3MJYA 5JQ9A 1NFPA 5XINA 3VKKA 1MZRA 4XQ6A 3CPUA 1M65A 3TR2A 1IXOA 4LRTA 2SFPA 3P8IA 5H8UA 2ZXQA 4QJ3B 1BVNP 3L5LA 3M5VA 2QHAA 5C55A 5FF3A 2VQTA 3ABSA 3EWXA 3KBJA 1LWHA 2XFFA 4Y96A 4CD6A 4CNUA 5KTLA 4Y9PA 3UFYA 2GOUA 3DU0A 1IEXA 4FR1A 5HNUA 1JDAA 1C93A 3M0LA 1FY6A 3BE7A 1BKHA 1GQLA 3UPWA 4AW7A 4H9VA 1NDYA 1ZPTA 4GYPC 2WZIA 1PL9A 1WUEA 2IQ0A 3R8RA 4RCXA 1OY0A 4HPHA 4JTLA 1X6NA 4NSBA 1IE7C 1UD8A 5XIMA 4UTWC 5HR6A 3L4YA 4H83A 4JHOA 4AZ6A 1WZMA 3R79A 4G7FA 3OIHA 4LV4A 3K4AA 3BICA 2VGIA 3F2CA 1EA0A 3P82A 4ZO7A 2ZICA 1MSSA 2E7FA 3CQKA 1XYFA 2J9YA 2QUUA 4GHRA 2QV5A 3OZOA 3A12A 5GPRA 1AW5A 4ZQPA 2EPKX 2EG7A 1J5TA 3LCLA 4NY2A 2OYKA 4JYDA 2QW5A 3MMTA 1OCNA 3RU8X 4NNBA 4GIAA 4GC3A 2I16A 1G67A 3E9AA 3NGFA 5TF0A 3RMJA 4GH1A 4RNHA 1PX8A 5E93A 4GX8A 5LNRA 3M0IA 5CAKA 1W3TA 4M51A 5HUPA 5IHSA 3LBOA 4LVBA 2H3BA 7A3HA 1SW7A 4R7OA 1PVNA 4GIEA 4OECA 1KFLA 2MNRA 2Z6JA 1TE1A 4PH6A 3UESA 1VFLA 2ALRA 3UCCA 1T8QA 1KXQA 1F8MA 2O0TA 2YL8A 5LIUX 2Y63A 2ZVIA 1LLWA 1W9XA 2D73A 2HNEA 3NQFA 5F7UA 2WV8A 1Q6DA 2I56A 3IK4A 4LAUA 1RY0A 3M07A 3N9RA 2F7FA 4J5NA 3MHUA 1UC5A 4Q7IA 1S3HA 2FH8A 2YOCA 3QOMA 4GVFA 1QMLA 1SSDA 1P48A 3C2RA 3CZGA 1XYAA 1C92A 2E77A 3EOSA 1W5PA 3PULA 2ZUNA 4WCJA 2YA2A 1HL8A 1GOOA 1XD0A 4NXSA 2OFJA 1JD7A 2HV5A 1HO1A 2WWDA 3UWEA 4HHHA 3JU2A 4HPNA 3A23A 1O94A 3PS7A 3WLQA 1KM4A 2J8GA 3GXIA 1EPVA 3MDWA 3DFOA 2VC7A 1PKMA 4UCGA 1VQTA 1E73M 3G8EA 2NUYA 4IPIA 3C61A 3STCA 2ZX9A 4EXBA 2KAUC 1EGMA 4DF0A 1CENA 3QKZA 4KRUA 4R7JA 3LGDA 2VDGA 1XIFA 1KV8A 3LHVA 3UWWA 1P0DA 4ASTA 4WDWA 2HE8A 2R14A 1NY1A 3RO6A 2BY0A 5A95A 4P8UA 4P2VA 1E0TA 4YU1A 5A6BA 3NO3A 4HK6A 2EEXA 2FDMA 4OE7A 3W7DA 1ADDA 2OU4A 4HNNA 5I23A 4US5A 4KERA 3NM1A 2Y61A 5HJYA 3DFPA 1I2OA 1CEOA 1F73A 1DWJM 3UEQA 1TVNA 2NX3A 1TPB1 4L1GA 4YTQA 4UZSA 2WLZA 4RR4A 2NVDA 1HIZA 4GISA 1RP9A 4F66A 2CLLA 1KCXA 2VFDA 3S2LA 2H6RA 3KCJA 3EGJA 2Z7GA 2ICSA 3UJSA 3M7WA 4IMDA 3PP7A 4WY0B 2XGZA 2WHJA 4JNMA 3B9EA 1H3GA 1IGWA 2NXGA 3WD1A 3NQMA 4E5TA 1ONEA 3LLDA 1RY8A 3WQEA 4EPEC 1TV3A 1TV5A 3DG7A 4MFEA 3R0KA 4AX6A 4DN1A 4LT9A 4K8EA 3PSVA 5A6LA 4YTRA 4GWEA 4MF4A 2MUCA 2NSXA 4ZQRA 2C3ZA 2PZ0A 1GVIA 1RD6A 3FYOA 2FFIA 1FWFC 4EXQA 1C90A 5JBEA 4KFOA 3G1RA 1XLFA 1V6TA 1GYLA 3KXQA 3SCUA 5LIKX 3DDMA 3TTOA 4G56A 3WQDA 1GT8A 1ZBVA 2QKFA 4XSLA 3EA3A 1KLZA 3MUAA 1GYNA 4H8UA 1DE6A 1M7OA 1NSJA 1JUBA 3G3DA 1GVEA 3QLDA 3RYSA 1MQPA 2VO5A 5G1TA 1KTNA 1WX0A 4UQDA 1XWYA 3VD7A 1VBGA 1UYQA 5C2XA 5EMJA 4UTTC 3THCA 4Q32A 4GX9A 5EFDA 4M56A 2WHKA 4N4QA 3AXIA 5C9WA 1B4KA 3NQ8A 1BTMA 1DV7A 1VJSA 1I2RA 2E5DA 2QGYA 2E68A 2QAFA 3KAOA 1C8XA 1P1MA 1SO5A 1XIEA 4PCPA 3RCNA 4M80A 4MWAE 3PPGA 4ZTXA 2B31A 3LHWA 1LG1A 1P0BA 1QNOA 4TMBA 2D0HA 2NT0A 2YCLB 3GVGA 3WF0A 2P0IA 3WJZA 2E5BA 4E2BA 1J0ZA 1R3YA 3CV1A 3ZJ7A 2FLIA 2CPUA 1FP8A 3SQLA 4J4KA 5LXEA 3RM9A 2FPYA 3T78A 3PWAA 3PANA 3M0YA 5IHRA 4ACZB 4O8AA 2PDBA 3RRAA 3REQA 3WX7A 3W72A 3JVAA 1KFJA 1LBMA 2XN2A 1ZAHA 2DVXA 1J0YA 1MUMA 4C5ZA 3KS6A 3ANYA 3CMGA 3WD2A 4WVXA 3CUZA 4W8AA 4PUKA 2Z0IA 2ZA2A 3E2QA 1DJZA 4J3WA 2DZVA 3LXCA 2DV0A 4LAMA 4M6PA 3WFZA 3FXYA 4JPGA 1JEZA 3C2OA 4F2BA 2Z2BA 3VTRA 4G1NA 4AD2A 2B0MA 5LHFA 3GD6A 2VUNA 2G97A 4HPGA 1ZU8A 1FX6A 4J3SA 2AOSA 4C6JA 1PAMA 3W28A 1ZP3A 5U7SA 3GTIA 1DJXA 3UBPC 2HEJA 3ZSSA 3VDGA 1KV5A 5FF2A 1A47A 2V6AA 4XZLX 2ISFA 3GKFA 1XGDA 4XD5A 5JVLA 4QE5A 2HCVA 4D1IA 3VIMA 1Q65A 3WN6A 3OYXA 3HQNA 2PDCA 1FOBA 2LLEA 2WCGA 1MZHA 3VIPA 5FESA 4JFSA 2OOGA 2NLIA 3HGOA 2Y5EA 3NPWA 3VDCA 1O68A 3OW1A 3QH2A 4IMAA 4CVWA 3SN4A 4PMQA 1K4GA 4DXVA 4I9TA 2J4GA 3B9DA 2ZZ3A 3RIKA 2VC5A 4F0LA 5FF0A 3FGCB 1SW0A 2R94A 3N4AA 1M5WA 1HVXA 2JK2A 3PAJA 2Z7KA 3HOJA 1POKA 5D8WA 4BQ2A 3OLEA 3CHDA 3KW3A 3BG3A 4O11A 2IMRA 4MGGA 1U5JA 4MTVA 4MJMA 3T0AA 4MIMA 4P8VA 3OVRA 4W5UA 5AHIA 3ARVA 2PDWA 5AC6A 1KQYA 4XKYA 4GVGA 3ARZA 3SY8A 4LUTA 3GXPA 2PDLA 4AWUA 3DGBA 4KWWA 2DIJA 1VCFA 4PA8A 4RLIA 1V6VA 4W8LA 4Q6XA 1FQ0A 2ZXAA 5G2WA 1JAEA 2ATMA 3OBAA 3AYRA 4HT3A 4MUZA 3T0TA 2YKKA 2J9XA 4TV6A 5A8NA 3N13A 3K5XA 3LV6A 4M6UA 1LUCB 2F84A 2W67A 3NEVA 3OOQA 1A5SA 1E9LA 5JBDA 1AFSA 2WC4A 2A85A 4LYKA 1W5QA 2ZBTA 3TK7A 4BEQA 3OA3A 4E4PA 1EX1A 2OX4A 4FA3A 3VINA 2Y7FA 2J88A 5AVNA 1GTEA 2YW4A 3NQ7A 3DXIA 5FEZA 1WKFA 2DUAA 5LKYA 1D3CA 4IQEA 2XGIA 1VR6A 1CXKA 3GIYA 4LY4A 1O60A 4PMVA 2W9MA 4LYRA 4C7GA 1RBOB 3MBDA 3H7RA 4K7VA 3B40A 5LIXX 1RSCA 3W1UA 1HO4A 2ZXBA 1KXVA 4B5NA 1XKJA 3E5PA 3LPGA 3EPMA 4UCFA 3UWVA 1NP0A 4ADSA 3SRHA 5LSMA 4QTGA 4UFJA 1XC6A 3PWIA 1I75A 3RHGA 1QHPA 2PGWA 4A21A 4MHBA 3CQ0A 3W24A 3DBNA 3W26A 1DWAM 2PE4A 4NNCA 3VKDA 2PD9A 1XHGA 3E38A 4HYRA 1VFSA 3B0UX 2DVTA 3VOIA 3GFYA 4N9EA 5HWJA 3VD5A 3TLQA 3ZMRA 1US2A 5TAOA 4I5RA 3VZZA 1E6NA 1R0MA 2PAJA 5HK4A 3S3GA 4HA1A 2Y2WA 1X1OA 1XLMA 4Q8TA 2BHUA 3TE9A 4PMZA 2FTPA 4FOJA 1ZZMA 2AL1A 1WV2A 4S3BA 2ZKMX 5I3JA 4HZ6A 2INZA 1JCNA 3T2OA 2C6QA 2OMAA 4JQ4A 4A3QA 2X8RA 2OZ0A 3HPXA 4LFYA 4UR8A 4C6BA 4R9XA 2OB3A 3T6CA 4CN4A 4L6OA 2Z24A 3CUIA 1B57A 1V79A 1W9PA 3MANA 1O5QA 4GUJA 3TONA 3NQDA 1RCXB 4GGBA 3EEGA 5A6BD 4ZCWA 2AGTA 4HIBA 4H6KA 1L6WA 4TVUA 1IEIA 4AY8A 3WUBA 1W17A 3EA1A 3KOFA 1G4PA 3EKZA 2ZRVA 5FAGA 5K3VA 1DWHM 1M03A 2ZUTA 3NUKA 3VKCA 2X30A 4NX5A 3CUJA 1Q7MA 1LDCA 4O57A 4IUOA 3MCOA 4L6HA 3DYOA 1XIGA 5KZDA 3WF1A 3PNZA 4FX7A 4H6RA 1XI3A 5H91A 3D0CA 1KQZA 2NSOA 1ITCA 4K6AA 3VE9A 1EJRC 4FF7A 1J96A 4UTTA 4GIYA 1Q66A 4HHMA 2PD5A 4B4HA 2GVGA 4HN4A 3RPDA 1UZHA 4IG2A 1W1IE 3ERPA 4LCSA 3R0UA 4FHAA 2Z27A 5CZSA 1OM0A 4K8GA 1A80A 3RJXA 2VJXA 1X96A 3MO4A 4HCHA 1Q45A 3CQJA 3W7GA 1IZCA 2FZ8A 1XLCA 2W4XA 4I6VA 4C7FA 4GYKA 4QLLA 1LT8A 5HMSA 4IUGA 5MKGB 3SBFA 4O4WA 1ZUAX 5T8GA 4IPJA 3STGA 1TPH1 3EXTA 1OVDA 1TA3B 1F8IA 4H2HA 2FGZA 4CNSA 5AHLA 4Q3MA 1JNDA 2QIWA 1VBHA 3I3BA 2YA0A 4B4FA 1XG4A 4UR9A 1QW8A 4X3ZA 3APYA 3EWZA 2Z1WA 3NGJA 5AZ1A 4ZBCA 4NHVA 3A6OA 3MKVA 3ZJ8A 1XFBA 1H60A 1DJGA 1Z6KA 4K1GA 4CEXC 3C2EA 2QJNA 3UVIA 2GJXB 4ATLA 3R5EA 3U4FA 2CIPA 3WLRA 2HK0A 5ABTA 1CNVA 1CXHA 1XYBA 2DU2A 4F3HA 3VO0A 3UWQA 3P62A 3RX3A 4C6KA 3MP5A 3IIXA 2V3GA 2OZ3A 2BY1A 4IXXA 2V5BA 3VCNA 2X41A 1XLKA 1ELSA 3W7OA 2VTFA 2XPKA 5XIAA 2ZZ5A 2W92A 3WL1A 3LRLA 3U7VA 3GTXA 3WQ8A 2I9UA 5G5IA 3DYMA 4I3GA 2WKGA 1BTCA 3PWGA 2XSAA 3A64A 3NPXA 2YYUA 2QUTA 3W7HA 3LCHA 3FIGA 1C8YA 3GBDA 2XVLA 3TNBA 3QEZA 3DIPA 3APTA 2WYSA 4CD4A 1KRCC 1H7OA 2JQXA 3SRFA 3TMQA 1B0IA 3E0WA 3BDKA 1S5NA 5KSWA 2G3JA 1AQFA 1P0EA 2WM0A 4W4QA 4DZIA 4Q7BA 5FOOA 3JW7A 4NXKA 3UR7A 4BKNA 3D47A 7REQB 1LL4A 4XZMX 2CBJA 2GSEA 3FA4A 1UR8A 3AZTA 3GX9A 3ZT5A 4YJ5A 3RLHA 3WDPP 5KINA 3WK2A 3BZGA 1UD6A 3ZVHA 3BGJA 4KEMA 2PTZA 3B4YA 3L4TA 4QAWA 2JFEX 3QY8A 5GNXA 4GQBA 4AZ5A 4X22A 4J3VA 4W87A 4EOUA 2QQ6A 3HU7A 3VFLA 5LIYX 2YGYA 3TYCA 3W4RA 1FWIC 4WEVX 3CWOX 3S47A 4JFVA 3ZO9A 3FCPA 2XSXA 2ACRA 5A2CA 1XSIA 1ODUA 3FFSA 1UUOA 4ONVA 4DIAA 3RLUA 1EP2A 3NURA 2Q8LA 4H00A 3UWUA 1E1FA 5DF0A 4LQ1A 1KFKA 2DDXA 3K1DA 3AWOA 1B3ZA 4BF5A 1H7XA 1K9FA 4JTGA 1RPXA 4X2PA 1J8VA 1YE4A 2XH4A 3H23A 3B0XA 1JCJA 4ZQNA 1X6LA 3WLJA 3FA5A 1FVPA 2G3FA 5HQEA 4F9JA 1TX0A 3WQPA 3UG4A 3WLIA 2JEPA 1YPIA 1EOKA 3TZNA 1VZWA 4QDMA 4NAFB 3SUWA 1E15A 5ABHA 3ZR6A 3CUHA 3H4GA 5G1MA 5FD0A 5D2XA 3AWNA 2EKGA 3G77A 3KRUA 4O12A 3OJGA 4C1LA 5HUOA 4W7WA 4MKSA 1XSJA 1QPKA 1ZJAA 4PR4A 4FZIA 1OABA 1WDPA 4K8HA 4MSSA 2QPXA 4JFWA 4EPKA 2IQTA 1GZGA 1CGVA 3G1YA 1UG6A 1W3IA 4AFYA 1V02E 1NFGA 4IL0A 2AMGA 3CB8A 2OEKA 2XDFA 3G5EA 1SZFA 1O12A 4B3ZA 3WD0A 2PWFA 1KM6A 4E2VA 4UTLA 3HTWA 4LS0A 4DJEA 3INPA 4UTMA 1OJXA 4KMQA 4HHPA 3TCEA 1AZ2A 2Z6IA 3VNZA 2VVSA 3KBVA 4QRNA 3L4UA 2RDTA 3G0SA 3ZLFA 1E6XM 3I6EA 1EZWA 2REQA 4US6A 2EPMX 1MEHA 5A8MA 2NV2A 1OGBA 4QM1A 5LXXA 2VRJA 5A6KA 1UMYA 2NVAA 3IIZA 2CWNA 3IAQA 3SB0A 1CLXA 3O16A 2CWXA 3VGGA 1BYAA 3NQ2A 4CCZA 5BW6A 4LUSB 1MNSA 2VKZG 3GDTA 3O6AA 3TEVA 3QTPA 3ITTA 1V6YA 4DO6A 1ZAIA 2VR2A 2ZZ6A 2VDHA 2JIEA 2ZC1A 1A0EA 4XD4A 1UA7A 3URAA 4WX2A 1QNVA 2C8NA 1GVSA 1WA3A 4FMVA 2YDAA 1S2AA 5M17A 3HMJG 1PTDA 2NT1A 1TWZA 4MWAD 4HGXA 3UYIA 3TFCA 5CPQA 2PS2A 3TW7A 3DG3A 2J79A 1TR1A 2CCRA 2OEJA 4KWSA 3VKAA 1RV8A 4IF2A 3M9YA 4JN8A 3H22A 1RLCL 1AW1A 3KM8A 3RUBL 4OOZA 4Q33A 4KRTA 5A2AA 3QV9A 1A3XA 3SCSA 2ZRYA 4WDXA 3VOJA 4QFUA 3T8QA 4M3PA 2B7QA 2X09A 3FHAA 1VBRA 2V3EA 4UQCA 4PSPA 3W27A 2YL6A 4RE4A 5AC8A 4AIUA 1OX6A 1E3XA 3H53A 3ANVA 3EMZA 3MMDA 3N3TA 3GW0A 1WAWA 2QGHA 2OVLA 4YPJA 5HQMA 1R87A 5EMMA 2X2GA 4JTAA 4NZFA 2CU0A 4QROA 4JX5A 1W1PA 4CU7A 4WY0A 3QMTA 4IFKA 1XV8A 2OT0A 2YPIA 3QQ0A 5LZLA 4A8LA 2ZTJA 1UH4A 3VVGA 4K2SA 3VD9A 2YB1A 4YHEA 4MAVA 4E4FA 4D6IA 3VAVA 4AY7A 5J04A 3B8TA 2QPUA 4PTWA 2IXUA 3GYEA 1SMAA 2QYGA 3I4EA 3WENA 4D6EA 2W6RA 3T9PA 4IGSA 3CAKA 2WCSA 3O0KA 1DQXA 1MRAA 1XLHA 4OBRA 3A3WA 5A6TC 4AVFA 2ZX8A 1DE5A 3PJUA 4BZYA 1YTEA 4AEOA 4QISA 1GVOA 3KL0A 4KIRA 3MUY1 2OQYA 8RUCA 4Q7NA 3C4UA 2GGIA 4LOCA 3WH5A 3TQPA 1G7UA 4GI8A 3N2MA 4KETA 4B5UA 2BS9A 3GC2A 1FWNA 3KBNA 3K4DA 4TIMA 1RUSA 4Y8EA 1F5ZA 3WEOA 1BGGA 4Q4OA 2OT1A 3E0VA 3LRKA 1FWGC 4QAIA 5CZ0A 3IWPA 4ZQMA 3VNIA 4C6OA 1I45A 3T7VA 1K8CA 4PCTA 1VRXA 4EIVA 3NL5A 5ENLA 1GYMA 1O5RA 1OINA 4F48A 5E6YA 4PYSA 2VD8A 2X1TA 2PDGA 3LHTA 1IT8A 2YIHA 1C8QA 2X1IA 3SRDA 2GK1B 2E6YA 1JG9A 2A7PA 4E8GA 1OQFA 4Z08A 4KCVA 1KM1A 4AWTA 2YCLA 1OF8A 1OSEA 2QJGA 3D3FA 3QY7A 3EB2A 3FS2A 4ALDA 2CLFA 2OEMA 2POZA 5AVHA 4KEZA 1AK5A 4F0SA 2VUYA 1DTNA 3MYOA 1LP6A 4ACZA 2HXTA 1QBAA 1DIOA 3SIZA 3VNJA 1DHKA 1XM3A 3N29A 2YX0A 4HQVA 4H7VA 4JEJA 3RPTA 4J35A 1OHLA 3OBKA 4C6DA 3ZWTA 2DSKA 1OG0A 4D6CA 3T4CA 2HVNA 3RG6A 4W84A 4WQ6A 3MV11 4HU3A 1TJ2A 2PDXA 3R1ZA 4GOAA 1EA9C 4Z17A 3UNDA 4ZGYA 3CAWA 5IFPA 4AC1X 4O53A 3IGHX 3LENA 3S0CA 2VRKA 1X98A 2Z00A 3KL5A 3C3UA 4Z1BA 4WOZA 1MEIA 5FSDC 1H5YA 4O0KA 4J40A 4V1YA 1W2VA 2VC9A 3QV6A 1ZJBA 2YDSA 4LXFA 3UA3A 4LANA 1W8GA 1XSKA 1AJZA 5A8QA 4GINA 3EX6A 5FJRA 1V93A 4RK8A 1W3KA 1IEWA 2FMOA 4LRSA 1R30A 1D3HA 2DY3A 1ESWA 4H9YA 2TODA 3FX4A 2HTMA 3PHAA 2Y7EA 2Z2AA 2JALA 1WUFA 8XIMA 1TUFA 4O18A 4QG9A 5I2UA 3KBMA 1NU5A 3BAYA 1UUMA 5CGQA 3AUOA 4MNLA 3S1UA 1X8FA 2W3ZA 1VFMA 2J7DA 1EDQA 1ZCOA 1C91A 3EEZA 3XINA 2BOEX 2VEGA 5CAHA 4PEEA 2J25A 1MQQA 1LOSA 3DKJA 1JZ4A 1UOKA 5IRPA 4OT7A 4NF7A 4H7CA 3NZGA 2QJIA 5DY2A 5FJJA 1HP4A 7ODCA 3FGCA 3H12A 1OT1A 1VYPX 5AYBA 3VX1A 2J7HA 4EP8C 4JTTA 3LN3A 2W27A 1E51A 1VPYA 1S46A 1ZQ5A 3TA6A 4MDPA 4M7TA 1E5JA 4NJIA 4PMJA 3R10A 4ERIA 3THDA 1EF3A 3WQFA 3MWAA 2WSKA 3TX9A 3E3HA 3NAVA 1JZ5A 3EA2A 3N12A 3UXAA 2DZBA 5BWAA 2YCIX 2A4AA 4LTSA 2PP0A 1CGXA 3LB0A 4BF7A 4JKMA 3DGRA 1XICA 9XIAA 4YYFA 1W9UA 3ALGA 3CZLA 3UERA 1EX5A 1W5NA 4WK9A 3DFTA 2CLIA 2WAGA 4DUVA 3F5JA 1OFQA 2CITA 3OQ8A 2BHZA 3PZVA 4Z1DA 1WE5A 2WSYA 3TW6A 3JZEA 4HZMA 4GO8A 5BRQA 2VZOA 2R1PA 3FKKA 1K77A 5LNVA 1HKJA 1XIDA 1LUCA 5D2WA 2NV9A 1P7TB 1QATA 2FIQA 1JI1A 1AZ1A 3AIRA 4U28A 4OUIA 4RNJA 2C1GA 3PR2A 1GG0A 2QPSA 4JTSA 5CJMA 1Q6RA 1GGOA 3UZJA 1JYWA 4DF2A 3DG6A 4A29A 4F0RA 1BG4A 2ZUMA 4GCAA 1Q85A 1KM0A 2VEKA 3WQ6A 2WC3A 3GNOA 4NAEB 2XVPA 4MZYA 1BRLB 4JQ2A 3HO8A 3DAQA 4Y2WA 2VXNA 1EQCA 1BKSA 1UWRA 3MUCA 1R3SA 3BAIA 2G95A 3CL7A 3AHVA 4AH7A 4O13A 1EB3A 4N9DA 2PWUA 1WOBA 3B0YA 3QGVA 4CCEA 2NZLA 4X0NA 2VDIA 2VOMA 2ZUVA 2G3IA 4M19A 3IS4A 5BXSA 1HFBA 4KGJA 3SY1A 4JAWA 1NDWA 5E0CA 1B3WA 1EUNA 4WGXA 4S3DA 4CQ8A 5KZ6A 1DBTA 2OLAA 1TV8A 4GQGA 3D5HA 4AD0A 3QKEA 3MSDA 2VX5A 3BLKA 3W25A 1WZAA 4EANA 5KZMA 1DHPA 1DIKA 3WNOA 2ZZ4A 1E3ZA 1EDGA 1R3TA 1XBVA 4GXWA 2BB0A 1U1UA 4M7SA 2ALDA 3NDOA 1V7AA 1GKRA 1A5KC 3C2VA 5FF4A 3UWZA 1VFOA 3KEHA 2QUNA 2XIMA 1KR1A 2Y62A 3VMNA 4JD4A 4D2JA 3L23A 4DPPA 2QCLA 5I02A 4I7UA 3U2OA 3GG0A 2XU2A 5BMWA 3XIMA 1KGUA 1NM9A 5BCAA 1POJA 4IT1A 3GO2A 3VNYA 3AYVA 4GVIA 4Z2KA 4XIAA 1IT0A 1MDRA 5BYWA 2R1LA 2CHOA 1NWTA 3B03A 3EOEA 2BXZA 4GMEA 2ACSA 3TSBA 1S5TA 4JTCA 3R7MA 1WO2A 2YCKX 2QDDA 4TX8A 4RJEA 1E4MM 3OG2A 1FWTA 1PZ0A 3EWDA 1F3EA 4DAIA 1EC7A 2EJ1A 4YTUA 2WVTA 2JEQA 1CCWB 4XV0A 1MNZA 1NOWA 1US3A 2XISA 4H8VA 4C90A 1Z69A 4IX0A 4U3AA 4PRWA 2QMKA 1FWBC 4EWJA 4GQ0A 3CXOA 4LUIA 1SO3A 4ZVJA 1H4PA 1K7FA 4KWOA 1I4NA 3ECQA 4CVUA 2OWXA 1XISA 1JPDX 4AX7A 3TQVA 5BXRA 1KGWA 5HWMA 2ACQA 2R1KA 3G0UA 4N7QA 4B5XA 1F76A 1ZS2A 3W2MA 5D9PA 3KVKA 3UWYA 3S2JA 3T09A 1UOZA 2RJGA 2D2HA 3BQ5A 1WNOA 3TROA 4C1KA 3M0VA 1TA3A 4NYYA 3UP8A 4C1NB 1IWBA 5BWFA 5CG0A 4JIEA 1R3RA 1TR9A 3WLSA 3GVWA 5D9NA 4NILA 1SJAA 3FJNA 3TTYA 1EPXA 1XBYA 3ARRA 3PTKA 2PF0A 1EKOA 4O8RA 4L1XA 3CIVA 1XH1A 3WF2A 3E2SA 3TOPA 5KZEA 3TZFA 1H1YA 4DWSB 4FIRA 4X0VA 3C0LA 1BF6A 2ZE0A 4EX4A 1I2QA 2VM8A 3MI2A 1EUAA 2HVMA 4HCLA 4QEHA 2J27A 4QNWA 4EAYA 5LNSA 1XIHA 3CASA 5BMXA 2GJXA 5D04C 4QQUA 3UZYA 2Z1SA 2GGEA 3C8NA 1PUDA 3H26A 3VU2A 4C6QA 2IXVA 5A8OA 3R58A 1OZMA 1W1YA 4GUHA 1WBJA 3CLMA 1K9DA 1F07A 3S5OA 3ARXA 2YSWA 2BVWA 2ZTKA 1H7PA 2NW0A 3S5SA 2W91A 2VFEA 3TAOA 2AQOA 3GDBA 1DWIM 3S2MA 4J3ZA 3GDMA 2Z2UA 2GJRA 2Y8UA 4YHGA 2QCMA 5TNVA 4IP5A 3CAVA 2RHGA 3L2MA 4UOJA 5F1VA 1AL7A 3CT7A 3AICA 5K4XA 4ZR8A 4PRRA 1BAGA 4IQDA 2PU1A 3SM0A 4XZHA 2CC0A 4XISA 5EB8A 1S5MA 2AQVA 1U1JA 4AD4A 3ITLA 3BJFA 2PCEA 1UKTA 3W81A 3V35A 3F4VA 2VELA 4XZ9A 3TC7A 1E55A 4CQDA 3L4ZA 4IH3A 3MUXA 1NJJA 1FXPA 3WSUA 4FXSA 4JHMA 1XYMA 5DRCA 3RX4A 3LPOA 2DZWA 1TYGA 4Q4MA 4JIPA 2OLHA 5DT7A 3NSNA 4LWWA 4IJRA 3P8JA 4UMAA 1BXBA 1EH9A 1NQ6A 1GOMA 5HPOA 4HNOA 3DBPA 2RAGA 3ARWA 4GUGA 1YLVA 2VZVA 1K7EA 4I8YA 3SQMA 4EE9A 1W9DM 7REQA 5D9MA 5GNZA 3M5ZA 1Q63A 1NVMA 3DC8A 1UWSA 3BLPX 3F7JA 3LMYA 2FZBA 2OG9A 5AC7A 3WH7A 3CWHA 4HTYA 4A6GA 5I07A 2YDQA 1B9ZA 2D0FA 4PUDA 2WKJA 3EOLA 3TTQA 2RDUA 4GNJA 2V2CA 4ZMGA 3W0KA 4LBSA 4PBEA 3AS2A 4BQ5A 5F2GA 1Q6QA 1ZHAA 1K8XA 5PTDA 4WHBA 1U5VA 2EHHA 1GK8A 1WKEA 1FH9A 3GR7A 3MV01 1KFEA 1Q5MA 2VGGA 4OJYA 1SFLA 3RLVA 2AKMA 2D20A 3P2VA 4YIWA 4PMUA 5JH2A 4KCWA 5EFFA 4ADTA 3VKJA 1TMLA 3GSMA 3KLKA 1FDJA 2J6VA 4J3TA 5BXTA 3OU8A 3IARA 1TV7A 4MLJA 3L4XA 2QZRA 2C13A 3L0NA 4UC5A 3ZQ9A 3ARYA 3ARTA 4NAFA 2CHNA 3U9IA 3IJ6A 3GC4A 1PCWA 1HTIA 1MDLA 4Q8PA 2V9DA 3CEPA 5LNUA 3W3OA 1HP5A 3K8LA 1BD0A 3V5OA 1Y0EA 1OYAA 4INFA 1E1CB 3G6MA 1QTWA 3F5KA 4MZ1A 5K9CA 3N1AA 1RCQA 1IXNA 3TXZA 1GQJA 5CGTA 2XM2A 3D3AA 3LCFA 5F1UA 2ADAA 3NZ1A 4UZUA 1NARA 3GC5A 4UTJA 4ZB2A 2YA1A 4M24A 1C7SA 1PCKA 3W86A 5D4YA 1HUVA 2Q6ZA 1QPOA 4LBUA 4WIWA 3WDQA 1FKWA 2WCAA 3BPWA 2WBKA 3DN5A 2Q02A 1ITUA 1WOAA 4JQAA 4C6EA 1X7FA 3B8SA 1WB0A 1R9ZA 2PU0A 4Y8FA 2A3EA 4XUYA 2BP1A 4KFPA 1LBFA 4JTRA 4EF9A 1IZKA 1ZB5A 2GDVA 3M0XA 4RZBA 3GUGA 5AB3A 2H8ZA 3MBFA 3WJYA 1GNXA 1UP2A 3DCPA 4J3XA 3B9NA 2CEQA 1GVFA 3UZ5A 3PBGA 1W1A1 1MW2A 1BSLA 1CB7B 4DLFA 4JYFA 2E1WA 1UPPA 3NYZA 5KETA 5SWUA 3I7SA 3LS9A 4LUSA 1X1NA 3MPGA 5FEPA 3RPMA 1FWWA 3N14A 5ECVA 4CNNA 3MWCA 3TKFA 1PDYA 5CPTA 2HDJA 3NA8A 5C2CA 1ZTVA 3MB9A 1IWAA 4BI6A 4YTSA 2V30A 2E9LA 4WD0A 4E3TA 2PBOA 4G1KA 3ANUA 1S3TC 1SPQA 5EMKA 5EMLA 4BCEA 3W7RA 4M0XA 3MTWA 4B9ZA 3IUDA 3AISA 4KEUA 3RCMA 1DQUA 3MHGA 1YEYA 1VF8A 4OTKA 4IOTA 5CBIA 1JZ6A 5J8LA 2QT3A 1W32A 4PBGA 3QTGA 2XH7A 3Q67A 4WSJA 4UFMA 1YKWA 3QZ6A 3CH0A 1YPXA 1QJWA 3N25A 3M16A 4I5UA 3ZJKA 5E1QA 1HVQA 3WLMA 4MKVA 3G1AA 1FWSA 1ISXA 2OGYA 2PC4A 3AUJA 4K36A 2Q8ZA 4LS1A 1JUEA 3PBVA 2G5WA 3LQLA 1YNPA 5BZAA 2JE8A 4PULA 3S42A 4H9MA 2CLHA 4ENLA 4IIBA 4ZSUA 3T07A 3S1VA 3LTSA 4Y9MA 3ME3A 4O28A 1H7WA 3M0KA 3QQWA 5CPLA 4KKXA 3SCWA 3AXXA 4HOZA 4XTIA 1GONA 5AN7A 3W75A 4KGLA 4U31A 2X0SA 4DNHA 1HL2A 3QW4B 1CZ1A 2GJNA 3QRHA 2ISDA 3GNRA 2WSRA 4L4PA 4PTXA 3VIKA 2OELA 3TSDA 4KT2A 4UNKA 3NQVA 1U30A 1B30A 4J9JA 3V1PA 4PFHA 2W79A 3MZ2A 1QO5A 1J2WA 1LCOA 1QW7A 3CWNA 2HPIA 3UG5A 3CU2A 5D2VA 6CGTA 4ICMA 1S2UA 4G6CA 1L6YA 2BTMA 1GVRA 2H3DA 1RP8A 1SZGA 3WEZA 4AC7C 2WQDA 3KTSA 3SURA 2TYSA 1XUZA 1IXPA 3BW2A 4E38A 4ZENA 4N9CA 3H7VA 3T0DA 1FCQA 1SFSA 2ZX5A 4H1ZA 3LHYA 2VL4A 3U2CA 4M82A 1VB9A 1KLYA 1TREA 3V0SA 4XD6A 3CHEA 1BG9A 1KWGA 1IIGA 4B5WA 1QU4A 4JNYA 1QI0A 1EOMA 4O52A 1VCVA 5A1AA 4M29A 1DTUA 1EGVA 1BWLA 3SCNA 2ZADA 1ZALA 1QDSA 2W61A 1YDNA 4DXKA 2A3AA 5CZTA 2CBUA 2DPEA 1FHUA 1UH2A 1WKYA 1G01A 3CC1A 2IS7A 1E0VA 3CO4A 2XFRA 5C70A 2PDFA 1VFFA 2G3MA 2DW7A 4LAZA 3PJTA 1Z8AA 1YDOA 4LVAA 4HOWA 4E4UA 2D69A 4UQ9A 1UD2A 1P6WA 1GHRA 1F4HA 1TZ9A 3RJYA 1UIPA 4AXKA 4J1OA 4RL3A 5EGRA 1AUSL 1KBIA 1MWOA 1TSIA 3SDOA 4RXFA 1OFRA 4JQ1A 3E12A 3BGGA 3IGSA 3UZWA 1D7FA 2C1HA 3ONBA 3MI6A 4C7DA 2Y6ZA 1QI2A 4URIA 2J7EA 4QIUA 4ZB0A 3S6DA 3ITYA 3KL3A 4BI7A 1A4LA 2ZCGA 2NX1A 1HL9A 4DWSC 2PTXA 3WY1A 3WIJA 1V51A 1TV4A 1E43A 3B3DA 1CT5A 4P61A 3IJ7A 5CBBA 4P8XA 3C6CA 2DT0A 3NSXA 2E25A 1B3VA 4HK7A 5FJOA 3WBEA 3W2LA 4O1EA 4ROPA 3TU9A 3V3WA 4UB9A 1UC4A 2UY3A 1UZ1A 1RJRA 4MFDA 2VVNA 2BBFA 3MY9A 2ONEA 5IBXC 1MW3A 4UFLA 5EU9A 5TBOA 4K38A 4ZFMA 3WUEA 4AZBA 2BSLA 4FXRA 2VWTA 1TTPA 3V0TA 2GUBA 4JBRA 5HINA 2XZ9A 3IVSA 4FAMA 2XH2A 3SCTA 1WXYA 3A3HA 3ABXA 1KB3A 2YB4A 2J47A 1D2KA 3QW3A 3O0FA 4CNPA 2BDQA 2Q09A 4PBFA 2RKXA 2FFCA 2CW6A 1W3JA 2OQHA 4ECLA 4S3FA 2Y1HA 3NFUA 3AC0A 4B5VA 1VPXA 1YRRA 3F5LA 1S1RA 1M7JA 1PHQA 4TR9A 1UR4A 1QNPA 5H8MA 3QHNA 3QPZA 3QVQA 4RE2A 1E40A 3R43A 2E0PA 3NL3A 4POCA 4UBPC 5L6UA 3DFYA 2V5KA 1OK4A 3F2BA 3IIVA 2YL5A 1G1YA 1UD5A 1TWDA 3EX1A 1KO0A 3U6WA 3LYEA 1D8CA 4Y9OA 4F4RA 3NQAA 3CB3A 3CS2A 3W73A 1RK5A 3GU2A 2BVTA 1R3VA 4ERGA 3AIBA 4HNVA 4FPSA 3Q2DA 3EWWA 4GFSA 5EY5A 4ZXLA 3EX4A 5ECUA 3FHQA 3QSRA 4AMCA 4NRSA 4MDOA 4EF8A 5A5WA 3CHFA 4JICA 2DZTA 3POHA 3VGDA 4A8IA 1GEQA 4CCCA 1XX1A 3Q94A 3MC5A 2P3EA 3VOHA 1W9BM 3SW6A 2XFWA 4HMNA 5I24A 2HE5A 3WLTA 4OBTA 3W1MA 4JDYA 1E0XA 1SZNA 1NWRA 3KWSA 4ZOBA 3M0HA 2W62A 4IPLA 1J79A 5EKYA 4BHYA 1P7TA 4DYJA 2DZSA 4S3KA 3MMWA 4GZEA 1TZ7A 3KVMA 3A4XA 4GBUA 5A94A 4UFKA 4CD7A 3QOKA 4NJKA 4R33A 1JDFA 2ODOA 2DUZA 4WUIA 4MUPA 2FTWA 2BXVA 2Z29A 3HB9A 3U2EA 5FSEC 5B7YA 4DEFA 3FY1A 4DJFC 2WMJA 4NAEA 1BRLA 1MI3A 7PTDA 1BHGA 4HMDA 3FYPA 1KA9F 2HROA 3L5AA 1D9EA 1E4LA 3U7BA 4OV4A 1TMHA 1K6AA 4BR1A 4CU6A 3PB2A 4GE8A 5HATA 4H7ZA 4C6CA 3AMLA 1NFBA 4LSBA 2OZTA 3TC3A 4JN7A 1QRQA 3HFYA 2E6DA 3VC6A 4GD0A 4IZGA 1P1XA 4LH8A 3QJAA 1HJWA 1HW6A 1E9ZB 2D2OA 5FL1A 4GQRA 4LNYA 1V0MA 3AXHA 5I5RA 3OEXA 3KUMA 5A6AA 3AALA 1IIHA 4S39A 2J6XA 3VCRA 1YX1A 2JKEA 1HQTA 2CZFA 2O4QA 2XM1A 4FNSA 1EIBA 1CW2A 2FHCA 2JGQA 1BQGA 4CQ9A 1TZZA 1VEPA 4HHLA 3NM3A 3VIHA 2WNZA 4JTDA 1HF6A 1N55A 1UKOA 2OSWA 3WD4A 3CL8A 3UD6A 3W7KA 4FF5A 1TWSA 3A47A 3ONCA 4GZJA 3EBVA 3BOXA 1G4EA 5G4EA 3PFRA 1PIFA 2FGBA 2DT2A 1HJVA 1RCOB 1F2JA 3ZYZA 1V5XA 3Q4DA 3VZYA 2PDYA 2UV8G 3KHDA 2GWGA 5CZKA 1ZRQA 3NQBA 5I7GA 2OYLA 3NPUA 3B05A 4C6LA 1Q6OA 3UR2A 1TPVA 1AJ0A 1SO4A 1MW1A 3TA9A 4AAJA 4AB4A 3AJ7A 1UR9A 1I2NA 4ZOCA 4IPPA 3W22A 1L6SA 4EPDC 1EEXA 2NVCA 3EB4A 4WJEA 2OOFA 5H6HA 3FEQA 4OOUA 3TN4A 1RVKA 3M41A 4PRTA 3WDHA 1CGWA 2EG8A 6TAAA 1E1EA 2VZTA 1VHCA 5HULA 1M68A 4AUBA 3CM4A 3WFLA 2JF7A 2X0YA 3LX9A 1K7XA 3W7PA 5A69A 3S2CA 4FALA 3F2DA 1XLAA 2PLCA 4GKLA 3AHZA 1XLDA 3R94A 4IM4A 3WQVA 3AIEA 3KHJA 5K9XA 2AGKA 2OCZA 1S2WA 4ZO6A 7TAAA 5FA5A 1H61A 2FDSA 4P7LA 3PB0A 2IKHA 3MP3A 4ZO9A 4Z2IA 3I68A 3WKZA 4O16A 5AYYA 2QV4A 2ANUA 3PZGA 4Q4KA 4DB7A 2P5NA 3G1HA 4TXEA 1EL3A 4MM1A 3K4WA 4O17A 1SR0A 4J2PA 1XIBA 3H2FA 4O14A 2WXDM 3ZLGA 2CXEA 4HNTA 2XVKA 3M1ZA 5D9OA 4Q8NA 1ISZA 4NP7A 1Q8AA 4C1NA 3UXLA 4HJFA 1J9YA 3OA5A 4HB7A 3IACA 4DF1A 5M2FX 4XG1A 3OZYA 1Z41A 4W93A 3TIMA 2I9EA 3TLLA 4ML4A 3SEPA 4QJ4B 3QR0A 4AHOA 3DHUA 7XIMA 2E28A 4FX8A 1JAKA 4Z1CA 1DXIA 2WJZA