3WJXA

Wild-type orotidine 5'-monophosphate decarboxylase from m. thermoautotrophicus complexed with 6-amino-ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 85
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wjxA00
4UXDA 3W1TA 4N4PA 3VKJA 4UFHA 3W23A 4HN4A 3LTYA 3NQEA 3PVFA 1Q45A 1KM6A 3LXCA 4JTSA 1TPUA 3A24A 4UTLA 3N9RA 4O8RA 3TFXA 1DKWA 2WO5A 4AHQA 1HL2A 3HPZA 2B4GA 2FQIA 4IMFA 2C6QA 4LV4A 4LS1A 1BKSA 1K03A 3LCXA 2RDTA 5KMYA 1W31A 2H90A 1M7PA 4ZL1A 3W7LA 3S1UA 1LRNA 2V82A 3QF0A 3HBLA 4R53A 3W7HA 4Z08A 3P80A 3MWAA 5I3KA 3M1ZA 3L5MA 5K3VA 4LVGA 1MO0A 4AAJA 4JX5A 5F2GA 3QSTA 3YPIA 5G2HA 3EXSA 1H61A 4LV9A 4GUFA 3HQ1A 3C0JA 3W76A 2H8XA 5F2MA 1QR7A 5I3HA 3IVUA 1KM4A 3GXTA 1PIIA 3BVJA 3U2OA 3KVMA 2ISVA 5AHIA 5FF7A 1KFCA 3DFQA 1JJKA 5CPOA 1JQXA 4LNYA 1H1YA 3MP5A 1SZNA 3F03K 1K8XA 4O15A 4Z0SA 1T99A 4MLRA 5D2XA 4ZZ9A 2WSRA 1OK4A 4M6QA 4N9BA 3HGOA 1QPRA 2I9EA 5AYXA 5LNWA 1OYAA 2DZTA 3FJLA 3M0ZA 4GWEA 4WY0B 1DQWA 1EA0A 1G4SA 5HUPA 3W1NA 4LWWA 1OX6A 1LOLA 4PEKA 2P10A 1TV8A 4PH6A 4O1DA 3TJXA 3BK0A 1VJIA 2FB3A 5J5RA 1EWEA 4JTGA 2CZ5A 1LROA 3NG3A 2VFDA 3P5ZA 4IMCA 4N4QA 1XC4A 4B5NA 4H4IA 4MFEA 4NU7A 1CI1A 3NPVA 3WK2A 4I9AA 1K02A 1IXPA 3LHUA 2B7PA 2PRHA 3W7DA 5BOOA 3QZEA 3GDMA 3EWBX 4MPQA 4RR4A 3B03A 1NEYA 3TH6A 3W1AA 4O19A 1TCDA 2WPBA 3UQNA 3TSBA 1WDWA 3NA8A 1FXPA 4EVZA 2J9ZA 3MBFA 2QUUA 3BW4A 3GDTA 2EKCA 1J4EA 1I2RA 3NQ2A 4ICNA 4FNTA 1HO4A 5EYWA 2JKPA 3FFSA 2I14A 2OMAA 2ZZ6A 4O16A 4DPPA 4BK9A 4I7UA 5HR7A 1KFLA 1SO6A 2ZDRA 4LS0A 5I3IA 4O4VA 1DBTA 4K7YA 4H3DA 2HTMA 2CZFA 4N6FA 3EEGA 5IM51 3LTSA 2HS8A 4QM1A 4NNBA 2XN0A 3A9IA 3E49A 1PHWA 1VHCA 1S5VA 3LCWA 3A23A 1YYAA 1V7YA 1A5BA 1N8FA 3GNDA 4K7VA 3NQAA 4O1BA 2Q3RA 2ZA3A 5HULA 3WJYA 2JKEA 4IMDA 5F1VA 1H50A 1OHLA 1D9EA 3CB8A 2QCLA 3BLFA 5DBTA 2ZRUA 1KTCA 4M5PA 3W85A 2ATSA 1LZOA 3EXTA 1FUYA 4OWGA 3SIZA 2FPTA 1VCVA 2CLLA 3FEMA 3IIXA 1GQNA 3M47A 3ZR4A 4LVFA 5FEZA 5K4ZA 1OVDA 7TIMA 3W7IA 3DU0A 4UFLA 2DZPA 3W1XA 1XKYA 1F7BA 3MYPA 3FJ6A 1Q6QA 4FNQA 1MSSA 1K7EA 1VCGA 2A5HA 3W7NA 1OYCA 2ZRVA 2WKJA 3UPBA 1T96A 3DI1A 4AHOA 4DPQA 1FWTA 2AAMA 1VYPX 5H91A 1AK5A 4G1KA 1RVGA 4IX0A 1EP2A 3O6CA 5F1UA 3P67A 5K2ZA 2G95A 1EWDA 2B0MA 3PS7A 1YTDA 2V5LA 3MW7A 1HFBA 3TK7A 1IXOA 1B4KA 2QCDA 1H5YA 4LS2A 3KOFA 5HWJA 3IV3A 5D2TA 2Y70A 4MZ8A 3I7QA 1SU5A 4CNOA 1KM3A 1UUMA 4HNUA 3OVPA 3FA5A 3LBMA 3WJSA 2X30A 4R34A 1RV8A 3LCLA 4IOTA 3STCA 1X7FA 1TPVA 3NM1A 1JUKA 4JIPA 5EBUA 5AHMA 1H7WA 1DL3A 1FDYA 4UTTC 3KXQA 1EP1A 4AHPA 2PC4A 3PC0A 4UTWC 2JGYA 2A7RA 3P5YA 3TIMA 3IVSA 5C6MA 1N55A 2DZVA 4MY9A 1EPXA 5LZLA 3B0PA 3GKAA 1YTEA 4JIQA 3D0CA 1EUAA 3S5ZA 3KAOA 3LHWA 1DHPA 4JDBA 1LRQA 2ISSA 4UCGA 3KVLA 4HNVA 3NEVA 3M9YA 4EIVA 3LCFA 3HPSA 3BLEA 5CGQA 4OT7A 4NZJA 1SZGA 4JTEA 3LGEA 1QCWA 1S5TA 3NPWA 3QSRA 4YL2A 3WK0A 4JTFA 2ZZ1A 2QCEA 5KZDA 3W72A 3MUXA 1Z41A 3WJZA 4ADTA 1ME9A 2J9YA 3R12A 4UTUA 2CLOA 1I8JA 1TPEA 3WFAA 5DN1A 2ZRXA 1OFBA 2DJXA 5CPLA 2ZTKA 4RXFA 4TR9A 3GR8A 2YZRA 3HO8A 1FX6A 1W5PA 4AMAA 4S2BA 4LC8A 4K36A 1C8VA 2DZXA 4AVFA 2YCEA 4M7SA 5BMWA 4LRTA 1T8XA 3G0UA 4GUGA 1XBYA 4ZQMA 3O05A 4JEQA 3BARA 3HGSA 1KLYA 3CWNA 4XBKA 4XUGA 3F4WA 4CCEA 1GTHA 4GFSA 2VFEA 3LERA 4LU0A 2ZTJA 4LC6A 3UWYA 3L68A 3W1UA 4ALDA 2ZQ0A 4RZ6A 4LOCA 2TRSA 3G1VA 5CPNA 2GVJA 2WV8A 2Y7GA 3TAOA 1IGSA 3OA3A 1H51A 4AWUA 4MLJA 4EF8A 2EPHA 3TA6A 1SR9A 3S9YA 1KM5A 2DZUA 5U4NA 1RQHA 1LLZA 2V0TA 1JR1A 1T0OA 4WD0A 4MKNA 3PBYA 4J9JA 3HB9A 3NO5A 4Y6GA 1H60A 4GUIA 3W7MA 3S0CA 4PTNA 5IBXA 2YW3A 3W86A 4MJZA 3BG9A 4BI5A 2A0NA 2PE4A 2Y61A 4IMEA 4Z1CA 4WOQA 1X8FA 3QQ0A 2Y7DA 2X1UA 1AMKA 2BZNA 4WY0A 4FIRA 3N2XA 3IIPA 1C9DA 2XFWA 1JCLA 4EWND 4FNUA 1TREA 2TYSA 5T26A 2ZFAA 3RFAA 2IQTA 3GR7A 4K6AA 2Y62A 3ANYA 2E09A 5FF4A 3SW6A 3S5OA 1VRDA 3C56A 2E1DA 2QCDB 3W71A 2OCZA 1F2JA 1L6SA 1VZWA 4FEZA 1Q6RA 3MYOA 1PHQA 4O18A 3H54A 3LCGA 3VFLA 1FBAA 4JYFA 3SGUA 4PA8A 4UIOA 4CNNA 1WYIA 4DBDA 4O53A 3UD6A 1SO4A 3T7VA 1TRIA 3UPWA 3L0GA 5AHEA 3SR7A 2VFHA 1XCFA 1TYGA 2C19A 1IIGA 4Z0JA 1H62A 3M5VA 3NM3A 2VFFA 2O7SA 1FY6A 3DHFA 3VNDA 1X1ZA 3ZS4A 3WJXA 4NQ1A 4RKAA 3TQVA 1O5KA 1KM0A 4N9EA 2OT1A 4RXGA 2R91A 3P82A 4YMZA 4MYAA 4XBSA 3RK8A 2QF7A 3LV6A 3LX9A 4DO5A 3IGSA 4GUHA 3N9SA 3PY2A 4DF1A 1SPQA 1EX5A 2AGKA 5KZEA 2CLKA 1TIMA 1OFAA 2CW6A 3B05A 1P0KA 1OF6A 3TJLA 1W1ZA 2NV1A 1EB3A 3GNNA 2ZBTA 5CZTA 3LI0A 3EXRA 3G1AA 5KZMA 3CC1A 4C1KA 1I2OA 1XL9A 2YW4A 2TPSA 3NQ8A 3QM3A 4WZHA 4M6PA 4I7WA 5G4EA 4LVAA 3CLMA 4O54A 4YCOA 2GQ9A 3HIJA 4QSHA 2A21A 4JTLA 1KFEA 3BGJA 3EWYA 2Q8ZA 1XUZA 2C15A 1MEWA 3HPXA 4JTIA 2ALDA 4UFMA 2Y89A 4E2DA 2Y6ZA 2NZLA 5D03A 2HS6A 3G1HA 2VFGA 1GVRA 3W9ZA 5EA9A 3L2IA 2NUYA 1A5AA 2YFNA 3SY5A 5DBUA 3Q2DA 1YXYA 3WJWA 1SQ7A 2FJKA 3LCHA 4NNCA 3O63A 1WQ5A 5DY2A 4K8HA 1TB3A 4HNNA 2Q8LA 3KFTA 3KVKA 3GZ3A 3I6RA 2OZ0A 4FNSA 4JYEA 1VYRA 5L9FA 4Q32A 2V8ZA 1G6CA 1XXXA 4DF0A 3S5YA 2YR1A 1LP6A 1RZMA 5D2VA 3LRKA 4LTSA 4MZYA 2V2CA 2XN2A 5K9CA 1THFD 5G1YA 4JN6A 1QDSA 4ZMGA 4CNPA 2VC6A 3QPYA 4ZQRA 1MEIA 3V75A 3B4UA 3NAVA 4OE7A 4QNEA 5K9XA 4UTHA 3RNDA 2NLIA 5G5IA 2E77A 1W56A 2Y7EA 5D37A 3IIZA 2QUVA 2GUUA 2O7QA 2ZRYA 4PCFA 3QH2A 1UASA 3RU6A 3UXAA 4QNWA 3Q94A 3W2NA 4RJEA 2Y7FA 1W5NA 1QFEA 4QQ3A 3G8RA 3NZRA 4HHPA 1JRBA 2VENA 1H7RA 1OFPA 2P0OA 1LYXA 4JY9A 2J27A 3H53A 1VH7A 5AC8A 4BI7A 1XDLA 2DJLA 3MJYA 4GJ1A 1LBMA 1O94A 3L5LA 4O12A 1WX0A 1GPWA 3S1VA 1KTBA 4NJGA 4TIMA 3W70A 1PS9A 3GAYA 4XTDA 5A5WA 3UXDA 2VEPA 4JX6A 4UNLA 1QAPA 2NX3A 1SW7A 2NWSA 1Z42A 2G96A 4IX2A 4PL1A 5DLCA 1LORA 2RDWA 4WJEA 4AH7A 3IRDA 4YXGA 1SFLA 1K8YA 1QWGA 2QCMA 2OX1A 1TMHA 3QJAA 1GTEA 5D2YA 2J24A 3HMJG 3C4UA 3JS3A 5AC7A 3ABOA 3NNTA 2WNNA 1ZJIA 1P4CA 3M5XA 1DJNA 1QOPA 3TC7A 1H7PA 3NQGA 4XZ9A 3ATYA 3TFCA 3VCRA 1NF7A 3LB0A 2CWNA 1VLWA 3PM6A 1Z48A 4PODA 4LW7A 4C1LA 4X22A 1GYLA 3BW2A 3UWQA 3CU2A 3S1WA 5DXXA 1UBSA 2RH9A 5AHLA 5BW6A 3BW3A 1K7FA 1TPH1 4R33A 1W3IA 2ZZ3A 1FCUA 3MI3A 3G1XA 2RDUA 4HKPA 3KHJA 3W7JA 1VPXA 1F73A 3FLUA 3C2OA 4LUIA 4JR5A 3CQ0A 2GPTA 2ZA1A 2TMDA 3NL6A 3QYQA 4MJMA 1P0NA 4IGHA 3TW7A 1FXQA 4RZ5A 2YXGA 5E0KA 3WK3A 3KVJA 4RV8A 4WQ6A 4KWWA 3A5VA 3MBDA 1YPFA 2I1OA 4FNPA 3TMQA 8TIMA 2B7NA 1JUEA 2ZYFA 4L4LA 3W1PA 2A85A 4M7TA 1GYNA 2OJPA 3Q58A 5G1TA 3R2GA 4JICA 5LNUA 3GDLA 4UC5A 3DKJA 3PF3A 4AF0B 1FDJA 3EB2A 1SZEA 3LHYA 3GXNA 3GKFA 4ZQPA 2JGQA 3O06A 1GZGA 1VQTA 5DY3A 4ORIA 3QW3A 3DAQA 4OBTA 4BWLA 5F4WA 5U7SA 1NFBA 4DELA 1O60A 1W5OA 1UUOA 5F4SA 4RZ4A 3BG5A 3M5YA 4OGZA 3CHVA 1TTJA 2CU0A 3LCIA 1FWNA 1ZY9A 3NDOA 3JRKA 1TQJA 3M6YA 5F2LA 3M16A 3OHIA 3TSMA 2H3DA 3BPWA 2YGYA 3L0NA 4AWSA 3IVTA 2FPVA 4NJKA 3Q37A 3ABRA 4D2JA 5F4XA 1A53A 3M7WA 4FXSA 2QJIA 1OFEA 4O0KA 3O07A 2JK2A 1KBJA 1LM1A 5FF0A 1AL8A 2E5CA 1LCOA 3IIVA 3IGXA 5HUOA 3TNOA 3PSWA 4UR8A 3TUUA 3QEZA 4LVBA 1G4PA 4NJJA 3MHFA 1Z44A 2A7PA 2J6XA 3FYPA 1HTIA 2ISWA 1WA3A 4TMBA 2ATMA 3DENA 3PUOA 4ZVJA 1VC4A 3W7OA 5KITA 2QCHA 3EX6A 4TU1A 5MHBA 3NPUA 4WUIA 3EX3A 2D73A 3UNDA 4H6KA 3VI2A 3E02A 2A6NA 5F2IA 4HPXA 1JVNA 3QMRA 2YYTA 1LBFA 4HT3A 3B0UX 1AW1A 2NX9A 5SWUA 1K8ZA 3P62A 2Z6JA 3JR2A 1GJPA 5HQEA 3MI2A 4N02A 4LT9A 5DCBA 2QR6A 4W9TA 4QAIA 5LGXA 1ICQA 1XM3A 5DELA 3LM7A 3W75A 4O10A 1FQ0A 4YLWA 2NXHA 1LBLA 4FF7A 2B7QA 2V2HA 4FX8A 1A50A 3E9AA 1LLWA 5IBXC 2NV2A 3PBUA 4RCXA 3WK1A 2EF9A 3TAKA 2QCGA 3MP4A 1YXCA 2QAFA 2Y85A 1OK6A 4IXHA 4O52A 2Z2UA 2HMCA 1O4UA 2BWGA 1TPWA 1M5WA 1Y0EA 3G24A 4X2RA 1RD5A 4FB7A 3NYZA 3W7QA 2GOUA 4AWTA 2DZSA 2X16A 1S3HA 3O6DA 1YADA 2PRLA 4IMGA 4UMAA 3L67A 1EUNA 1RQBA 2ZRZA 4HSOA 3G0SA 5LGZA 2YDAA 2E5DA 1KM1A 1PCWA 3P84A 3S8HA 1TTIA 4NXKA 4TX9A 4EF9A 2E6YA 1GG0A 3UWWA 4EOUA 3W7EA 2H8ZA 2E6DA 2RHGA 1RR2A 3TDFA 5K4XA 3NOEA 4XTIA 4LVDA 5LNSA 1G4EA 2GQAA 3M43A 1ZHAA 1KBIA 1N7KA 5CZ0A 1A5SA 3HOJA 3TCEA 5LSMA 4E0CA 5EY5A 3DKLA 5AB3A 1B3OA 3H55A 1F76A 1R47A 3I7RA 1H7OA 5HWNA 4ZQOA 3G1DA 4MY1A 3W7RA 2BX7A 1K3UA 2QDGA 2EAWA 5C5YA 3LBCA 2JBMA 5G2IA 4M19A 4DXVA 4FNRA 1B4EA 1M7OA 2RFGA 2ZZ2A 3LV5A 2BXVA 2Q3OA 1R30A 2BTMA 2J9XA 3L21A 3QC3A 3HG3A 1OX4B 4Y96A 2Z6IA 1ONRA 3W74A 2H6RA 3EKLA 4TMCA 4QIUA 4MVAA 1TTQA 2V81A 1WBHA 3NQFA 4LRSA 3ATZA 5K9DA 3NQDA 4GNJA 3B04A 5KINA 4UFJA 3UZJA 3HGRA 4O50A 1FWSA 1XFBA 4IPIA 1DORA 3AO0A 1DQXA 2NWRA 3QW4B 3LHZA 4CQ9A 3E0IA 3NQ6A 1SUXA 3IEBA 3W2LA 1ICSA 4IXXA 1TTPA 3G3DA 1F05A 4XWUA 3C8FA 5FEPA 3GDKA 3B0VC 4LY8A 4NX0A 1Q6OA 3A5FA 2VEKA 5BMXA 1C29A 3PR2A 4MIMA 2A6LA 3W83A 1R2RA 3E96A 2FDSA 2WOQA 3N73A 3N19B 4JTTA 1TO3A 3IGUA 4FO4A 3EWXA 5D05A 3N2MA 3DHDA 3F4NA 2X1TA 1F6PA 5D2WA 2W79A 4BI6A 1BWKA 4NZFA 3SFKA 4O28A 1B57A 1JUBA 2Z0IA 1TV7A 3CPRA 2F84A 2XN1A 2ZRWA 2QCFA 3MO7A 5D33A 1W37A 4CQ8A 1OF8A 4Z1AA 5TBOA 1GWJA 5AYYA 3HG2A 5G2WA 3W2JA 1U5JA 4UUIA 2WNZA 4OU1A 3CTLA 3HJZA 2FLIA 1S5WA 2B7OA 2VEIA 3FKKA 1JULA 1ZALA 2CZDA 3TE9A 4RLIA 3LDVA 4QISA 4BF9A 4IQLA 5TQLA 1L2UA 4DQWA 3TR2A 2WQPA 4FIQA 1YXDA 4E2BA 3EWZA 3T55A 1CW2A 1LOSA 3TMLA 1ZAIA 4A22A 4JTJA 2YSWA 1TPB1 3SECA 1KFKA 3E12A 5ABTA 2DU2A 1TPFA 3PAJA 5K7JA 1A5CA 2FPYA 4AF0A 4I7VA 3R89A 1YLVA 2V30A 3NPXA 1WOAA 4MZ1A 3ZFHA 1VS1A 3LRMA 3KRSA 4Y90A 2CLIA 4DO6A 2V9DA 2WNQA 3PG9A 3NQMA 3FKRA 3INPA 3R8RA 1H63A 3DFTA 3IIOA 1AW5A 3VE7A 4ADUA 3NQCA 1PE1A 3BLIA 2QEZA 2V2DA 1OFRA 5BRBA 3U6WA 3GX9A 2LLEA 1LTDA 2CLFA 3O8AA 3SI9A 5J5DA 1NSJA 3CWOX 1QPOA 2VEMA 4XKYB 4UTJA 4O17A 1MZHA 2ZZ5A 3CIXA 1H1ZA 1B9BA 1VLIA 1GVOA 3CT7A 4U28A 1PV8A 1OX5A 2R8WA 2QAPA 3T40A 4Z1BA 2DORA 3N34A 2GJLA 3ABQA 5C55A 3HGJA 3BGGA 3W07A 1I4NA 4DEFA 1WOBA 5FF2A 4UTKA 4XQ6A 2X1SA 3PB0A 3W1QA 5D09A 4JD4A 4BR1A 4TO8A 3OEXA 4KKXA 3PWAA 3C3NA 3UZ5A 3TW6A 3MMTA 3F1QA 3ZWTA 5HINA 1VYSX 3AJXA 3CEPA 1W8SA 1L9WA 3EWUA 3A22A 1ZNNA 2VXNA 4A21A 2TSYA 4ORMA 5KTLA 2VFIA 3KRZA 1UB3A 1PL9A 1G4TA 5BNKA 3NVTA 1VGAA 1ZCOA 1J2WA 3P8JA 1OFQA 1R2SA 3THQA 2C3ZA 3G8EA 4IJBA 4IWWA 3T44A 1QOQA 3DBPA 3R13A 1IXNA 1AL7A 2PURA 4UMCA 3DFSA 3PULA 1H7NA 1R2TA 5LHEA 4ADSA 3M41A 1ZAHA 2CFFA 2QJHA 4CCDA 1L6WA 4K37A 3N14A 6ALDA 3P7YA 4MY8A 2R14A 1IF2A 1NF0A 3RMJA 1KV8A 3UWUA 1W0MA 5FI8A 4YCPA 3GDRA 3LTPA 3GYEA 2WSYA 1MXSA 3CIWA 2EGZA 5AFDA 1SO5A 2CZEA 3TQ0A 1ZENA 3NL2A 4KFOA 4Z1DA 3G22A 4JS3A 3UY8A 4BWLC 1JCMP 3TC6A 2C0AA 3DH7A 1GOXA 2ABAA 4NUWA 3TROA 3QQ1A 3W7CA 3K30A 3DXIA 1UJPA 3W84A 1GVQA 5AHFA 1GG1A 4K38A 5G4WA 3GXPA 2DZWA 1QPNA 2RKXA 3M44A 3C2VA 3M5ZA 3L66A 1JCXA 3UWVA 3W7PA 3BO9A 3ABSA 1HG3A 2A4AA 4IPJA 3C2EA 1O95A 3LHTA 1DJQA 3W88A 2A2IA 2QJGA 3TXVA 3PUDA 3LLFA 3W2KA 1QO5A 2NX1A 3GVGA 5CKSA 3VE9A 1WXJA 2YPIA 1XDMA 2QCCA 2C1HA 3LHVA 3P61A 4HSNA 1V5XA 1WAUA 1W3NA 5D04C 3I7SA 3P60A 4GUJA 2NUWA 1TQXA 1YDOA 4ZQCA 3TQKA 1TJRA 2BLEA 3TKFA 1LDCA 4FHAA 4JXCA 2C14A 4Q4KA 2ZA2A 4X9SA 3L0KA 4IUOA 3QMSA 3MHUA 1GVSA 4QITA 1XBZA 1GVFA 3OBKA 2A1YA 4P61A 3PG8A 3T4CA 1ICPA 1OFOA 3QRHA 5CPMA 5C2XA 1KV5A 1L6YA 4O13A 1SO3A 5A8GA 4JTUA 3N3MA 1KM2A 5HWMA 1TPDA 1FCBA 2YFOA 1VR6A 2FTPA 4ZQNA 5I3FA 2QCNA 3SJ3A 3C6CA 2BSLA 2EHHA 1KTNA 5EPDA 1TRDA 4BFAA 2AQWA 1QNVA 1UCWA 1D3GA 2QKFA 2NXIA 2H3BA 4A3UA 1OX4A 1JRCA 1YDVA 5FEXA 1I45A 4AB4A 5DCDA 3G1SA 3KRUA 1XUUA 3C2RA 1OG0A 3TV8A 3W73A 5AYZA 4UFKA 1TSIA 4Y8FA 1I2NA 2GVLA 3P8IA 1SSGA 3W6YA 4QJ1A 4OV4A 3ZWSA 3W87A 4ONVA 1E51A 2Z1BA 3DGRA 4U4MA 1KW1A 1YDNA 4HIBA 2GVGA 5CSRA 3W7GA 3L65A 2F7FA 1ALDA 4NNAA 4O1AA 1PCKA 3CM4A 2CLHA 4YWIA 1HUVA 3MP3A 4S1FA 3G3MA 2PCQA 1JQVA 4PFMA 5LNRA 5EMUA 3UWZA 5FESA 1MEHA 1TPC1 3DI0A 2X2GA 4WXYA 4N2YA 2G97A 3RLVA 3PUEA 1OFDA 4O11A 5I3GA 3PBWA 1CX9A 1JCJA 4Y9AA 4JTHA 5EKYA 2ABBA 2CLEA 1FCQA 4FXRA 1ZAJA 3THAA 1W3TA 5H2ZA 3NGJA 6TIMA 4NT0A 1JCYA 3SZ8A 3BV4A 3W7KA 4P2VA 2YYUA 5CG7A 4O57A 1ME7A 3GAKA 3OVQA 3O6YX 4WY0F 3G18A 2DP3A 4FX7A 1G7VA 3W3OA 1EEPA 4GC4A 4N9DA 4NVTA 5EL1A 1BEUA 3DZ1A 5AOUA 3SSJA 1F6KA 4UNKA 1X6UA 3A21A 4POCA 1SZFA 5FEWA 4DO4A 3OIXA 3HG5A 3EX2A 1JCNA 3G0XA 2E68A 1I2PA 2Y88A 1KLZA 4AXKA 4ML9A 1Q6LA 2VOMA 3W2MA 3S1XA 4HNTA 3B06A 1DOSA 4UTIA 1P1XA 1SW3A 4A2RA 5HMSA 2P1FA 3NXFA 3EWWA 3PB2A 5CZJA 1DV7A 1U83A 2GJNA 3R5EA 4OQVA 4LUJA 4PC8A 3P74A 3TSDA 3LI1A 3NZ1A 2E6FA 1D3HA 4JGDA 5FF3A 4UMBA 3TX9A 2KZHA 1KFJA 4Q33A 2QUTA 4N6EA 4K8EA 5D32A 1M6JA 4RK8A 4JTKA 1ZFJA 5KSWA 3HF3A 3NR0A 2G5WA 4MUZA 4R7JA 1K7XA 1BWLA 2FFCA 4E38A 1NAL1 2FB2A 3L9CA 1O5XA 4RX0A 5AHNA 1ML1A 2C16A 4NX5A 3B8DA 4NJHA 4CQAA 5HJLA 3GIYA 4UR7A 1P5BA 3FOKA 3I65A 2UV8G 4O0ZA 3BG3A 2ZZ7A 3GLCA 4PL2A 4XKYA 2E6AA 2PRMA 5D02A 1GEQA 4M6VA 5I3JA 4FX6M 1G67A 5CZSA 3C61A 2WJZA 1RQEA 3OG3A 5DXYA 4L4MA 4NXSA 4O4WA 3STGA 2CLMA 2Y63A 4GE8A 1LOQA 3L5AA 1OABA 1BTMA 3NQVA 1F5ZA 2ZCGA 3KX6A 4UTTA 5HR6A 4UTWA 1ME8A 3QMTA 3FYOA 4S2CA 3LXBA 1XBVA 2R94A 1TJPA 1G69A 3LLDA 1OJXA 1RPXA 1X1OA 1OYBA 3QPZA 3O15A 4CLMA 4MOZA 2NXGA 3C52A 4GBUA 5GVJA 1TV5A 3UYCA 5D38A 3GK0A 3EKZA 3PSVA 3OVRA 3RLUA 3U8GA 1W5QA 2C13A 3MI6A 3O16A 3LXAA 3ELFA 3SGZA 3FS2A 3W1LA 1IXQA 4MYXA 1EP3A 1VCFA 1NVMA 3TU9A 3QFEA 4OV9A 4A2SA 2WSQA 1QPQA 1WV2A 1I2QA 4DF2A 4WX2A 4A29A 3DFOA 4K39A 1W5MA 4WXZA 3W1MA 3MHGA 3EX4A 3NL5A 4AEOA 5TIMA 5DCEA 3USBA 2GQ8A 2A7NA 3DFPA 1KA9F 3STFA 1FCVA 1YTKA 5HNRA 2FIQA 4GRSA 4JDYA 1DVJA 3GB6A 1SSDA 4GXMA 3NQ7A 2V5BA 1EIXA 4N9CA 3PBVA 4JX4A 4JYDA 4HPJA 3TXZA 1GT8A 1FWRA 5CSSA 3W2UA 3CEUA 1Q3NA 4KFNA 5E93A 3STEA 1SFJA 2OT0A 3LRLA 4X3ZA 3DFNA 2J88A 3S42A 4DBEA 2JKAA 1ADOA 5L6UA 5E1QA 5LNVA 5LHFA 1F74A 5C54A 3S5NA 4WOZA 1W54A 3G1FA 1FWWA 1AG1O 1FDZA 4KWVA 3S6DA 1KFBA 2C18A 5LKYA 4JY8A 3UY7A 1XI3A 1H7XA 1WBJA 1G7UA 4NJIA 2NUXA 4MFDA 4O1CA 3RF9A 3V1PA 1AW2A 3C2FA 3HG4A 4UFIA 4KFPA 2HSAA 3W22A 4JNMA 3W1RA 3NL3A 4O14A 2QDHA 1HO1A 1QO2A 3I68A 3EX1A 3LOTA 4CCCA 4OHQA 5D30A 2W0UA 2YX0A 1J5TA 1IIHA 2X1RA 3O1NA 3FIGA 1SW0A 2VELA 3G1YA 3T78A 2E5BA 2W6RA 1PVNA 3P81A 1LRTA 2ZZ4A 1XBXA 1VHNA 5AC6A 1YPIA 1QMLA 1R46A 5AN7A 2VKZG 4UTMA
chains in the Genus database with same CATH superfamily
2GJXB 1F07A 4NZ3A 2D1ZA 3LTYA 3PBMA 3PVFA 4YPJA 1HJWA 4L1XA 1KM6A 4JTSA 4XKMA 2CLPA 3A24A 3HTWA 3TFXA 4AHQA 2WVVB 1HL2A 4S3GA 4H9ZA 1Z7AA 1SJAA 2B4GA 3TYDA 4U3AA 2OQLA 2PGRA 3LGDA 2PUZA 3LCXA 4LAKA 1T5AA 4IG2B 3V18A 1W8GA 2H90A 4C5YA 1IZKA 4NSBA 4D6IA 1CYGA 3TCSA 1DWGM 4HOWA 3QF0A 3GNRA 3HBLA 2WLYA 4Z08A 3MWAA 4H9XA 1Y5WA 4FA3A 4AX6A 5F2GA 3YPIA 1YNYA 4LV9A 4GUFA 4QP0A 1KBLA 4G7EB 1RLCL 1FWEC 5F2MA 1QR7A 5I3HA 3GXTA 2WNWA 3URAA 1PIIA 3KVMA 3L7RA 1KFCA 3DFQA 3T42A 3WLLA 1V0LA 4DWSD 3J7HA 4LNYA 1XLFA 3MP5A 4C6DA 2WSRA 1XF0A 4M6QA 2HE8A 1U1HA 5LNWA 5AYXA 4GWEA 4D6FA 1G4SA 5FJRA 2PDNA 3W1NA 1TMLA 3V4BA 4OUEA 2L5HA 5IFPA 3CASA 5EMJA 3WLIA 4M24A 3SRHA 3TJXA 4WHBA 4JTGA 4JL1A 1MQQA 3THDA 3HU7A 4IMCA 4B5NA 4IL0A 4YS1A 1AH0A 1OC6A 1QHZA 4DN1A 1EYEA 4UCFA 2XVNA 3TZNA 1E72M 3RXZA 1CXIA 4TX8A 1JCTA 3TYCA 4MPQA 5GNYA 4RR4A 1TCDA 2WPBA 3H7VA 3ZSSA 1MQPA 1FXPA 1QNRA 1HKWA 3BW4A 3CHFA 4DYJA 1J4EA 2ZXBA 1X1NA 4ICNA 1J0KA 5EYWA 3FFSA 2OMAA 3BAIA 4DPPA 4IIGA 5B7ZA 5HR7A 2F38A 3QHNA 4CQCA 1B1YA 3TYUA 2WHLA 4LS0A 5I3IA 1HQTA 1IEIA 4K7YA 4H3DA 2CZFA 4QM1A 4FXJA 3N25A 2XN0A 3VVGA 1ZLPA 1YYAA 1V7YA 2FVKA 3GNDA 3UJEA 4K7VA 2BVTA 3UCQA 2J7BA 3KOZA 2PWGA 4QXIA 5F1VA 5GPRA 4G8TA 1RVKA 2QCLA 2PTDA 5DBTA 2ZRUA 2OWCA 1LQ2A 3W85A 3PUGA 1LZOA 3EXTA 4A8LA 1FUYA 4DO7A 1XRSA 1X7IA 3M47A 1EFZA 2R1MA 1OVDA 3N18A 2PGFA 3W7IA 4UFLA 1XIHA 1ITQA 1XKYA 1K7EA 1VJSA 3SCQA 1L0PA 3V0TA 3MU7A 4DPQA 2V5DA 3MKKA 1EC9A 5T9BG 3MCNA 1TR9A 1AK5A 5F1UA 5K2ZA 1F3WA 4MF4A 1RJPA 1EWDA 1GQLA 1KXTA 2B0MA 1YTDA 3RM9A 3S46A 5M5DA 1UJQA 3MW7A 2ACQA 4B5SA 5IHSA 1KB3A 1HFBA 5HMEA 3ONBA 1EF3A 1IXOA 3CT2A 1M1BA 2VC5A 1H5YA 1BVNP 3XINA 3SN4A 5D2TA 1B5TA 3I7QA 1SU5A 4UQ9A 2WM0A 2IXUA 1W9UA 4CNOA 1KM3A 1UUMA 3OVPA 2DQWA 4QG6A 1C8XA 2CHNA 4R34A 3DDMA 1X7FA 4RUBA 1TPVA 2IPJA 4D9PA 2CETA 3QHMA 1EP1A 1XINA 2FZMA 3TIMA 4Q8PA 3IVSA 5C6MA 1W3JA 1V3HA 1S46A 3DFYA 3ARWA 1YTEA 3UG5A 3HN3A 3D0CA 1ECEA 2SFPA 4XO6A 4HK6A 1ONEA 1DHPA 4XAZA 4JQ2A 3IJIA 4LB4A 1HKMA 5ABGA 3GXIA 3NEVA 3HPSA 3BLEA 2V69A 4KWSA 4HNOA 5CGQA 4NZJA 3NXLA 2VEGA 2C0HA 2XSXA 3BV7A 3LGEA 1QCWA 3QSRA 4J2PA 4GVGA 1WAWA 2ZZ1A 5KZDA 4US5D 1ME9A 2J7DA 3WLRA 4UTUA 3USZA 3WFAA 1OFBA 2DJXA 2ZTKA 4TR9A 3GR8A 1FX6A 1NOWA 1QNSA 3N04A 2Y2WA 1IWPA 3D47A 4GVHA 1GZ1A 3CMFA 1UH3A 3B8SA 4LRTA 1T8XA 4YNGA 2WBGA 4JEQA 4O1EA 1GONA 3HGSA 3CWNA 2OODA 1B90A 4CCEA 3WNKA 3AU6A 1DE6A 2OGYA 3LYEA 2NSOA 4G7FA 3S2JA 3L68A 3JVAA 4RZ6A 4LOCA 4W88A 1UQYA 4CN6A 4ZENA 3VAVA 3TAOA 3LQGA 4MLJA 2EPHA 4FOJA 4AIOA 3S9YA 1KM5A 2GSHA 1XLCA 1LLZA 3N4EA 3EDEA 1TV3A 1T0OA 1QNPA 1OCQA 5ECUA 3IJQA 1HL9A 1VFOA 4J9JA 4GC3A 1S2TA 3CYJA 2VT0A 3KZSA 4PMVA 4PTNA 2YW3A 3W86A 3EMQA 4MJZA 4PTDA 5AC4A 2Y61A 4Z1CA 4WOQA 1X8FA 4WJXA 4H2HA 3PZIA 2X1UA 1FH9A 1AMKA 4XUYA 3IRSA 1C9DA 4R9OA 4FNUA 2TYSA 2QDDA 3CMJA 4HU3A 4Z2GA 3RFAA 4BHYA 3SRDA 1KGUA 3ANYA 3OZYA 2J6VA 4B5VA 1VRDA 1F3TA 2OCZA 1F2JA 4OJYA 3MYOA 1PHQA 4O18A 3H54A 4WRHA 3VFLA 2OSYA 4J3ZA 4EAMA 4J35A 4RE3A 4PA8A 4UIOA 4Z42C 1KCLA 5HA7A 4WCJA 3SR7A 1UPMB 1TYGA 3FV9A 5HNTA 1IIGA 4PMYA 3M5VA 2CKSA 1EIBA 4L4OA 1FY6A 3DHFA 3I3DA 4RNIA 2PA6A 1KM0A 3BQ6A 1BTCA 3GXDA 4N9EA 1XRVA 2OT1A 3T2QA 1DJWA 1YBQA 4J5NA 3RK8A 2QF7A 3OOQA 2Z00A 4ES4A 5JVLA 3N9SA 3L2LA 4DF1A 1TVPA 2DSWA 2AGKA 3LPGA 1FFRA 1W1ZA 3V5CA 2GGEA 3PZNA 3UA4A 4IPNB 4P5UA 3GNNA 4PBEA 2ZBTA 5KZMA 3CC1A 1I2OA 3NQ8A 2V3GA 1O12A 1CB2A 3TVAA 4LVAA 3CLMA 4O54A 4WSKA 1UD4A 4QSHA 4GZJA 5DMYA 3BGJA 3EWYA 1Q4WA 4KCWA 1TX0A 3HPXA 4JTIA 3TTEA 2G3IA 1XYMA 5FJPA 1R38A 1GVRA 3W9ZA 1L8PA 2NUYA 1SQ7A 2Y5EA 1WQ5A 4W8LA 4QJ4B 4LCRA 1ZL1A 3GVWA 3UP8A 4Q8VA 3WUGA 3GNXA 5A95A 2I16A 4FNSA 2O55A 4H19A 5AVHA 2NQLA 3WF0A 4JIRA 5I24A 2GGGA 4DF0A 3I6TA 3GC4A 8XIAA 3QVQA 5I23A 2XTKA 1QDSA 3WLNA 2FZDA 3E38A 2F2KA 4XAGA 3QPYA 1XQKA 1M68A 3V75A 3DOPA 2WAGA 8A3HA 3P14A 4LF1A 4GGHA 4P8UA 4UTHA 3TONA 2GUUA 2JIEA 1UWRA 2J74A 3ZVHA 3Q94A 5HATA 3RPTA 2Z29A 1OFPA 2XIQA 3JU2A 2J27A 3H53A 5AC8A 3MUIA 3LSCA 1RY8A 4BI7A 4MADA 4QQUA 4ZSTA 1WX0A 1KCXA 3WLSA 3A3HA 4DVOA 4NJGA 4RV3A 3W70A 4MNMA 5A5WA 4JKLA 1R7OA 4HJFA 3PAOA 2NWSA 1EXBA 1YMYA 1NOFA 2HK0A 3BLKA 4D6GA 3C86A 4WJEA 5CPQA 4AH7A 3IRDA 4S3AA 2WCGA 1QWGA 2QCMA 4L1GA 1SMAA 3N3TA 2OX1A 1BGAA 2VGIA 1C93A 1IE7C 3QJAA 5HMDA 1RD6A 3JS3A 5AC7A 4PBFA 1EJVC 1P4CA 2MANA 1DJNA 1LUCA 1H7PA 2BOGX 3NQGA 2QF8A 1EPVA 2VX7A 3B9OA 5DQPA 4C1LA 3EA2A 1GYLA 4GA8A 1VFFA 3VIIA 5DXXA 2G4JA 2YDSA 3BW3A 1UWQA 1QNOA 1S5NA 2Z27A 1F8IA 3SQMA 1XLBA 2BY1A 3MI3A 3VGDA 4C6IA 3R43A 3R4IA 3C2OA 3T0DA 4CNTA 2A3HA 3UEQA 3C8NA 1YBQB 4REQA 5C9ZA 2OLAA 2TMDA 3CUJA 3QYQA 1GOMA 4MJMA 3TW7A 1OGBA 3ZYZA 4OTKA 5E0KA 2FHFA 4J40A 4HMEA 1E6NA 3A5VA 4FNPA 9RUBA 2ZXDA 3ARRA 1P1MA 3GVRA 4GABA 1T6MA 4L4LA 4ZR8A 3W1PA 1YX1A 1V6UA 2BBFA 4AZ7A 4R5EA 1KRBC 3ZLGA 3CAWA 1Q63A 3POCA 3GDLA 4RNHA 1TKKA 4UC5A 4AWEA 3MDUA 3EB2A 3WKZA 1PPIA 1I0BA 2EPOA 4GCAA 3DAQA 4PULA 2BNJA 1NFBA 4RZ4A 3FJ4A 4UOJA 4OGZA 3LCIA 1ZY9A 4LUSA 5KEZA 3VOFA 3I4KA 4H83A 5F2LA 3M16A 3OHIA 2H3DA 4FLSA 2DSVA 2YL9A 4NJKA 4MHBA 1R0MA 5F4XA 4FXSA 4IQEA 4AYGA 1AL8A 1LCOA 2IPGA 3IGXA 1O1ZA 1G0CA 2PTZA 4UQDA 5FJJA 1G4PA 3ID7A 4HN8A 1S2VA 1BWVA 2A7PA 4Q8OA 3FYPA 4GI4A 2ATMA 3DENA 2OYKA 2F2HA 3CZEA 1FH8A 3UJSA 3WDIA 3EX3A 2D73A 4DM1A 3DC8A 5F2IA 1GORA 2PDPA 2WPGA 1LBFA 4HT3A 2E0PA 2Y8KA 2NX9A 5M03A 5SWUA 1K8ZA 4HPNA 1FFQA 1YNPA 1E5JA 1XR2A 3JR2A 5CBJA 4N02A 2GDVA 2QR6A 1R3TA 5LGXA 3LBOA 1GKPA 3MZ2A 3W75A 3L4XA 4GQQA 1GGOA 3F4CA 2HVOA 3IACA 2V2HA 2OLHA 4FX8A 5MKGB 4L9YA 4J2MA 1GJUA 5DT5A 2NV2A 1OZQA 4RCXA 3TAKA 2QAFA 1EJTC 4TUFA 3S2MA 5JH2A 5E0CA 5B7YA 1O4UA 4L1WA 1OINA 5CH9A 5A94A 3QY6A 2Z7GA 3IANA 1M5WA 3EWDA 1GVYA 1RD5A 3TQPA 2VCAA 3VMNA 2GJPA 3NYZA 3W7QA 4XZWA 2E7FA 2X16A 1PXGA 1QATA 1RQBA 2ZRZA 3GQYA 4MB1A 4YTRA 4S23A 3IPWA 4H04A 4CVWA 1CXHA 3B9EA 3M0YA 4DBWA 4TX9A 4PMXA 4GINA 1C9WA 2DVXA 1XH1A 5CBBA 4WKFA 3B4YA 3UCDA 1QI5A 2RHGA 5FA5A 4U3CA 2VI0A 5LNSA 4CKQA 1BG9A 1ZHAA 1V0NA 3HOJA 3WQGA 4PUDA 3TN3A 1B3OA 2GDQA 1GQJA 1F76A 1JZ5A 3I7RA 1H7OA 1RY0A 4X0VA 3AIEA 6CGTA 4XD4A 5F7UA 3E3HA 3G1DA 3PFMA 3W7RA 2BX7A 2QDGA 3CLWA 2EAWA 1HKJA 4GLEA 5C5YA 4CNSA 3LD5A 3IS4A 2XFRA 1M9HA 1B4EA 3HJEA 1R30A 1FHLA 3L21A 1BG4A 1A3WA 3FEQA 3WLKX 1NDWA 1TJ2A 3EKLA 4QIUA 1B54A 1HJQA 3NQFA 3T09A 4LRSA 3NQDA 4HA0A 2PU0A 1F4AA 4O50A 3KUMA 4HZ6A 5CG0A 1P7TA 4IPIA 3V7PA 1B31A 2BG5A 1DQXA 3H2MA 2NLYA 3NQ6A 4PFHA 1SUXA 3W2LA 3SAZA 4PUNA 5FSDC 2QJMA 4XWUA 1ISYA 1W3HA 2NT1A 3BTNA 2QULA 5C9RA 4MM1A 3A5FA 1UWIA 3PR2A 1YNQA 2A6LA 3C5QA 2MNRA 2X0YA 1UBPC 3BAKA 4JEJA 1KRAC 3E96A 1WKEA 2HQAA 4DXKA 1WKYA 5C9UA 1UW9A 4PTWA 3UZZA 5A6LA 3N2MA 4GJIA 3T8QA 5D2WA 2XISA 4FOKA 2YL8A 3WF1A 3K4AA 4FXFA 1V3MA 3H2AA 3OZPA 4X9YA 4JIEA 5FL0A 4QE5A 3TA9A 2XN1A 3CUXA 2R1PA 2ZRWA 4NZCA 3VCNA 5E6YA 1W37A 1C90A 4PCPA 3LGGA 4M0XA 4B5XA 4FSAA 4AEEA 2B7OA 3MTWA 1DEDA 2DVUA 2VEIA 4YIWA 4GFIA 4CU6A 3F5KA 2PP1A 4QISA 1BQCA 3Q67A 3TR2A 1C7SA 1YXDA 4UOQA 1PYMA 3K8LA 3T55A 3KOYA 3WUFA 5CEWA 3TMLA 2VGBA 5ABTA 5BXRA 2DU2A 1HJVA 5AYIA 2OOGA 1A5CA 4GIEA 3SCNA 3T8LA 1J79A 1K9TA 3NPXA 1OT1A 4Z2IA 3VO0A 1J6OA 4NG3A 1H63A 3VE7A 3ZLHA 3NQCA 3WLOA 2QEZA 3VGGA 1OFRA 1QHPA 2ZIDA 1LTDA 3FXYA 3SI9A 3CWOX 2VUNA 2F8QA 5A6JA 2VEMA 4XKYB 2GWGA 3QZ6A 4FI4A 4H2CA 2P8CA 1MZHA 2ZZ5A 5EFDA 1XYZA 2FTWA 1XIGA 2ACSA 1JEZA 3GW3A 1OX5A 2R8WA 3AS3A 1RCXB 1WDQA 2DORA 2X2YA 1KCKA 4LAUA 4Q8MA 3BGGA 1UG6A 5FF2A 4YVVA 4UTKA 3W1QA 2YB4A 4H8UA 3C3NA 1UH4A 3UZ5A 3MMTA 1UA3A 3NOYA 4AZGA 4GIRA 1PKNA 4FZIA 1L9WA 5BWFA 3EWUA 2ZICA 1ZNNA 2VXNA 1HN1A 5GJMA 1PL9A 1G4TA 1EQPA 1W1A1 2FZ8A 1ZCOA 1OFQA 1UUQA 4XG1A 3AUJA 3VUSA 3R13A 1AL7A 4ATWA 2PURA 3DFSA 4ERIA 5LHEA 4L9ZA 5DFAA 2OXNA 5EMKA 1L6WA 1P7TB 4R9XA 4DZ5A 1IF2A 3EWCA 4E2VA 1XYBA 4DBUA 3TYAA 1M01A 1UKSA 1XLEA 2WKLA 5AFDA 1SO5A 2CZEA 3BE7A 3T1GA 1K6AA 3PN8A 2C0AA 2IS7A 3DH7A 1IEWA 1GOXA 4IP7A 5FACA 3D3FA 3TROA 5PTDA 3SUVA 1UJPA 1GVQA 1E9ZB 1CXEA 3VA8A 1DTUA 3GXPA 2DZWA 3SN1A 3W88A 2QJGA 3PUDA 3LLFA 3A47A 2PC8A 4QLJA 1EDTA 2BXYA 1UC4A 2QCCA 2WVUA 4GQRA 1VBUA 4HSNA 4PUWA 1M3UA 3CGTA 2IPFA 4EPEC 1SFTA 3TKFA 1LDCA 2C14A 5H6HA 3OBAA 4JTCA 3UETA 4QITA 1XBZA 1GVFA 3GHUA 2WJEA 1B3ZA 1G01A 4AZHA 3THUA 2V68A 1KBBA 5CPMA 1MXGA 4G5DA 1JF6A 3GRIA 3CHCA 2Q01A 1KM2A 3VZYA 5B80A 1LWIA 1SYTA 2G3FA 2YFOA 3GG8A 5H8UA 2EHHA 3WFZA 1H09A 2AQWA 1QNVA 1ISXA 3ZT7A 2NXIA 1U5VA 4Q7IA 1OX4A 3WF4A 1E0WA 1YDVA 1I45A 5DCDA 3C2RA 2C79A 1U1JA 4E4UA 3SGGA 1Y7VA 3WNNA 2GVLA 1SSGA 1QPKA 3BWWA 4Y9PA 2Z1BA 4NI3A 1HNYA 4NZ4A 2UY2A 1VAHA 1KW1A 3RR4A 5HOSA 1HJSA 4HIBA 5CSRA 1WXZA 4H6RA 2F7FA 1ALDA 1CECA 3WMCA 4O1AA 3LK6A 1JDCA 1V93A 1CZ1A 5HNUA 4FOUA 3SM0A 2PCQA 1JQVA 3AS1A 3P6LA 4W7UA 5H8MA 3LMZA 5E70A 3QXBA 5KZ6A 1UZDA 4N2YA 2PAJA 2INZA 5A6KA 1QK2A 4LCQA 1XPGA 4JTHA 5EKYA 3F5LA 3THAA 1I1WA 4NT0A 3LA4A 4PMNA 3BV4A 3OGRA 2D22A 2F61A 2YYUA 3QR0A 4AZIA 2V3EA 3DG6A 4O57A 3CAQA 1ME7A 3GAKA 5C8BB 2VP8A 2Y1HA 4QDWA 3UXKA 1G7VA 4NVTA 1MMFA 3DZ1A 2VVSA 5AOUA 4UNKA 5I3DA 1QASA 1M04A 4EPBC 1G9HA 2I5GA 2C8NA 3HG5A 2WBKA 1RHCA 2E68A 1I2PA 5EFFA 4ML9A 5EMMA 3VNMA 4HNTA 3M0JA 3POHA 2P1FA 1CEOA 3KWXA 3QR3A 2GJNA 1SVDA 4J3SA 1V6WA 1D3HA 3VZXA 5FF3A 4UMBA 3CZ8A 3ES8A 4Q7NA 1JG9A 3M0HA 2VZTA 3H7UA 4RK8A 1ZFJA 1H2JA 3RJXA 3NR0A 4R7JA 1K7XA 1R7AA 1AQMA 4JTAA 4JAWA 2FZ9A 4W5ZA 3VD5A 4I90A 2HROA 4RX0A 3PZGA 2C16A 1RJRA 4F2BA 3B8DA 4NJHA 4CQAA 1U5HA 4IFKB 5HJLA 1JZ4A 3GIYA 1P5BA 1YQ2A 1KGWA 3GLCA 4PL2A 3BURA 5D02A 1XV8A 4U5KA 5I3JA 3GY1A 1WKFA 2PP0A 1MXDA 2WJZA 1RQEA 1AVAA 3OLEA 3RCMA 5DXYA 4L4MA 4NXSA 4O4WA 2DT3A 3K13A 4ZB5A 1X96A 1XLDA 1F5ZA 3FAXA 2FH8A 4D6HA 1TWZA 3ONCA 5C70A 4AIUA 3VILA 1ME8A 4KS0A 4KEZA 3VD4A 6XIAA 1R85A 1W1PA 2AGTA 3EEZA 1TJPA 1YRRA 3QYSA 1OJXA 1QRQA 4GYPC 4CLMA 4S3FA 4NAEA 2HVNA 3CO4A 3C52A 2OPJA 4QCEA 2VWSA 1ZP3A 2BVDA 2GJRA 1W5QA 3U8GA 3MI6A 3T05A 1N2VA 1IXQA 4UB9A 2JF7A 2WANA 1NVMA 4ZXOA 7A3HA 4OV9A 3T2PA 1HP5A 1QPQA 4ZODA 3AIWA 3VKBA 1W5MA 4WXZA 3KW3A 3MHGA 2GK1A 3HV9A 5TIMA 5DCEA 1H11A 3STFA 2QPXA 1FCVA 1PZ0A 5BXTA 4M51A 3U9IA 1IYXA 4JDYA 4GRSA 2YA0A 2VDHA 3GB6A 4GXMA 3NQ7A 1UIPA 1FWGC 4IPPA 4E8DA 2OVLA 2VRQA 1JGIA 1TG7A 1Z6KA 5CSSA 1BKHA 3CEUA 1Q3NA 1PBGA 2QJJA 3MKCA 3VU2A 1SFJA 3DFNA 2DZBA 4N0RA 2EBNA 2JKAA 1ADOA 5E1QA 4GKTA 3T2OA 1F74A 1TMQA 1G1YA 1AG1O 4XAFA 4ZB0A 1WXYA 2C18A 3ZO9A 3OZOA 1F9CA 1OD0A 4HA1A 3L4TA 2NUXA 3NCOA 1ZB5A 3C2FA 3G5EA 1GW9A 3W22A 4D8LA 3W1RA 4A3HA 3NL3A 4O14A 1DP0A 3I68A 3EX1A 3ARVA 4CCCA 3CNYA 1J5TA 2P76A 3WD3A 2HRWA 1S1PA 2ZE0A 3NSXA 1HVQA 4H6EA 1SW0A 1EBGA 1VBGA 1UKOA 2W6RA 3HA1A 1P0DA 5AC6A 1ODUA 2NQ9A 3TTOA 2VWTA 2VKZG 1ZJIA 1OD8A 4UXDA 2GVEA 3ZSTA 3VKJA 4UFHA 4HN4A 4C7DA 4PGLA 3VNLA 3NQEA 1PDZA 1UWUA 1E0TA 1NARA 1DKWA 5FKYA 3W24A 5CPSA 2WO5A 9CGTA 2WKGA 4GI9A 1EC8A 2FQIA 4IMFA 2XVKA 3PZMA 2O0TA 3CUGA 3W25A 2PDYA 4R85A 3CS2A 2DW6A 1B3VA 3ZLFA 1EC7A 3S1UA 1GQKA 1LRNA 2V82A 4EE9A 3SQLA 1WNOA 4R53A 4D6CA 3W7HA 4A8RA 1O7AA 3P80A 1J2BA 5I3KA 3TW9A 3EOSA 3GNPA 4H6QA 4AAJA 4NF7A 3QSTA 3P93A 4ILSA 3K5XA 5G2HA 3EXSA 1L8NA 1WE5A 3WDPP 3B97A 2PPGA 4INFA 1XLMA 4MB4A 3W76A 4NAEB 4AUBA 2VCCA 2VX6A 3MT1A 2XG9A 1HGWA 5AHIA 3C0LA 4RDYA 1UZ4A 1QW9A 2W91A 1JQXA 1H1YA 1SZNA 5D2XA 3R25A 5I79A 1NJJA 2WZTA 3F2DA 3ORWA 4N9BA 1G94A 3HGOA 1QPRA 2I9EA 1OYAA 2DZTA 2QV4A 4WY0B 1DQWA 4QR6A 3STPA 2YXXA 5HUPA 1R5YA 3DYPA 1TUFA 2BY2A 4LWWA 1OX6A 1O66A 3FY1A 1PKMA 4PH6A 3H8AA 3WLPA 4LH8A 2FB3A 2HJPA 1XYCA 5E09A 3PNZA 2UBPC 4AIEA 4N4QA 1XC4A 5REQB 3FGCA 5JIPA 3BJTA 4NU7A 1CI1A 3WK2A 4I9AA 2GUBA 4V27A 4CEUC 1Q7MA 3LHUA 3TEVA 3V16A 1PZ1A 2B7PA 5BOOA 5KETA 3QZEA 3GDMA 3BGAA 1NEYA 2X05A 2P0IA 3TSBA 5C2GA 1YE6A 5BCAA 3TJ4A 4HB7A 3BH4A 4RNJA 2J9ZA 3MBFA 2QUUA 3CZKA 2EKCA 3S83A 3U48A 5I2UA 1I2RA 1W2VA 1BVWA 2DZAA 4FNTA 4C6JA 1HO4A 2JKPA 4ZSUA 2I14A 2ZZ6A 4KWOA 3MVTA 3WQCA 7TAAA 1AJZA 1TZ9A 4WDTA 1SO6A 4J7RA 3THCA 2B31A 1YW1A 3MVIA 4O4VA 4QJ5B 2HTMA 3EEGA 1AMYA 3LTSA 2HS8A 4NNBA 3NZPA 3C0SA 1S5VA 2CBVA 3LCWA 4PRWA 2AMXA 2PTWA 1BAGA 1N8FA 3PPFA 3BJFA 1AH3A 4UQBA 4JTQA 1E56A 2O56A 5HULA 2JKEA 2WWDA 1D9EA 1Z32X 1D7FA 4U5IA 1VFTA 4OWGA 5D8WA 3SIZA 1MWOA 2A3CA 1VCVA 3IIXA 1K9DA 2R1KA 3AOFA 3UR2A 3ZR4A 1P6CA 3VXGA 1HW6A 3N29A 3WQ8A 1GHRA 4S38A 7TIMA 2HVMA 1KXQA 2OO6A 3W1XA 3BDKA 3MYPA 3FJ6A 1IEXA 1SZRA 1SJBA 1BFNA 1Q6QA 4TXEA 3W7NA 1OYCA 2P3EA 2WKJA 3UPBA 4K1GA 3DI1A 4AHOA 4B16A 2V5KA 3UW6A 4C6OA 2BS9A 1V6TA 2AAMA 2OEJA 5H91A 3W82A 3O6CA 3WQWA 1V03A 2CITA 2VRJA 2REQB 1R3SA 3E5PA 5HXMA 4LX4A 3PK7A 3FVDA 4RDWA 3TK7A 2QCDA 3H2FA 3WEMA 3TWBA 2XGIA 3PZOA 1BQGA 4P7LA 4HNUA 4WF7A 1KKOA 3WJSA 4AVNA 2YKKA 1RV8A 2CHOA 1LL7A 1WDSA 3BAJA 2FGBA 3P2VA 3NM1A 3HM7A 5EBUA 1DXIA 2WW5A 5AHMA 4LNCA 1H7WA 2A3AA 2V63A 1DL3A 4EPDC 1YKWA 3UJRA 4DJFC 2W62A 3PC0A 4QAWA 5ECVA 3I10A 4Y9OA 4MY9A 1EPXA 4ZE5A 5LZLA 3B0PA 3GKAA 3AIBA 3DGBA 4KERA 3S2LA 4EPKA 2YZ5A 4LJ3A 5A8NA 1XLLA 5CBIA 3RGTA 1LRQA 4UCGA 1TZZA 3KVLA 3M9YA 3LCFA 4UR9A 3WNPA 3OJGA 4GNVA 4AZCA 4GX8A 4Y9NA 1S5TA 3CWHA 4IIDA 4J28A 3EA3A 1TVNA 1XIBA 3ANVA 1GKRA 4JTFA 4OFCA 2V3DA 3MUXA 1Z41A 3WJZA 4ADTA 2J9YA 3OTRA 3R12A 2CLOA 4CVUA 2ZRXA 2E25A 4RXFA 2HPIA 2QXWA 4PEEA 2ZE3A 3AC0A 1C3FA 4NRSA 4K36A 1C8VA 2DZXA 4AVFA 4Z2HA 2YCEA 1XBYA 4ZQMA 3BARA 1W1B1 1Y5VA 1PKYA 3P0XA 2YCLA 2VFEA 4GFSA 1A5UA 5IFTA 1DHKA 3OPSA 4LC6A 3UWYA 3T07A 3GVQA 1VF8A 3GXMA 3W1UA 2ZQ0A 2PP3A 5CPNA 1E9IA 5CJMA 2GVJA 4HZ7A 5AZ1A 2WK2A 3OA3A 2DZUA 3S6TA 5U4NA 2FFIA 3DCPA 1BLIA 3ARTA 4JHZA 4LF2A 3IAQA 3WEZA 2R1NA 5A2BA 2V0TA 1JR1A 1XP3A 1S2WA 3NO5A 3BLOA 3FHAA 3VKDA 2OSXA 1QOXA 1VP5A 4GUIA 1VFHA 2WMFA 1OBAA 3NQBA 3DBNA 1M41A 3BMVA 4BI5A 2A0NA 2J4GA 2PE4A 4TTGA 2OX4A 5CC7A 1ZZMA 4DXXA 2Y7DA 5CGTA 2YA2A 2BZNA 3RLGA 1WUEA 3IIPA 4YHEA 5T26A 3FW6A 1BYCA 2WLZA 2WC4A 1B9ZA 3QV7A 3FDGA 3GR7A 3LMYA 5TAOA 1GQIA 3D46A 3W71A 2QCDB 1EHAA 2WYSA 3W29A 4GY0A 2Y0FA 4FEZA 4CU7A 2VNCA 1DJGA 1UMLA 3LCGA 4FK9A 4FR6A 3BC9A 4GO9A 3CAKA 2J7CA 4CNNA 3H26A 4DBDA 3UD6A 1SO4A 5AZ0A 3PZ9A 3UPWA 3L0GA 1FH7A 1XCFA 2J7EA 2VUYA 2BOEX 1H62A 4MWAC 3CAVA 2O7SA 1X1ZA 3B3DA 4XVDA 4EP8C 3LPOA 3TQVA 3UXIA 4ZO9A 5AKQA 1GOQA 3W38A 1S5MA 4DO5A 4QTGA 4LYRA 1GW1A 2AL2A 1N8WA 3PY2A 3WF3A 1SPQA 1EX5A 3T9PA 4KRZA 3B05A 2E3ZA 4GACA 3V0SA 3BQ5A 1BF2A 1FVPA 4D6EA 1V6VA 2ESCA 4XZBA 1PZ2A 4I5UA 4C1KA 1XL9A 3QM3A 2VC7A 2XYLA 4PTVA 4M6PA 2RJGA 1EKOA 3DG3A 2FJUB 3WQEA 4AQLA 2GQ9A 2A21A 2Q8ZA 4UFMA 1J96A 2Y89A 1XJBA 2QDEA 5IDIA 2VFGA 3U5UA 1WDPA 4F4RA 3ICJA 3SY5A 3WJWA 3B8UA 3WYZA 3AHVA 3LCHA 4NNCA 3O63A 4K8HA 2Q8LA 1R3RA 1KBKA 3KVKA 1B3XA 2WHKA 1L2QA 5BU6A 3I6RA 1PAMA 5DMMA 2D69A 3F2CA 1VYRA 4IJCA 5L9FA 4QHRA 3S5YA 1NWUA 1RZMA 5D2VA 3BLPX 4LTSA 2E1WA 2WZIA 2XN2A 2YLAA 1THFD 5K9CA 4DZAA 5G1YA 4JN6A 1AJ0A 4YVPA 3PBGA 4CNPA 3ARUA 3QOMA 4FLOA 2QNEA 3CXOA 1MEIA 1DE5A 3B4UA 3RNDA 2NLIA 1W56A 2Y7EA 5D37A 3DESA 3IIZA 2QUVA 1P0EA 1B0IA 1ONWA 3QH2A 5ABEA 3ISIX 1IEQA 1XH0A 5FD0A 1CGXA 3RU6A 3BSMA 1W5NA 3BLDA 4HHPA 1JRBA 1JYXA 2VENA 4IH3A 2P53A 2DJLA 2PDQA 3MJYA 4OKDA 1JZ8A 1O94A 4O12A 4V28A 2EG8A 4OECA 1IQ8A 1KTBA 2ONEA 4TIMA 3GAYA 3UXDA 2RUSA 3VTRA 2X7VA 2WMHA 4JX6A 1QAPA 1SW7A 3VNYA 1GOOA 2CESA 1TWSA 4ZOEA 4JOMA 1K8YA 1VEMA 1E40A 3AIQA 2OQHA 4GYJA 2BY0A 1JNDA 1VFUA 1MNZA 4H8HA 1GTEA 2J24A 3HMJG 2G3MA 3MS8A 2WNNA 3IUDA 1QOPA 3TC7A 4XZ9A 4DJEC 4Z1YA 3VKCA 2YOCA 2CWNA 2WWCA 1VLWA 4C6EA 3DN5A 1GOWA 4ZGYA 4I9TA 3S1WA 3PFRA 5AHLA 2ODOA 3AICA 2X40A 1HF6A 1UD8A 3A6OA 3R1ZA 4KRTA 1FCUA 5CZKA 4HKPA 2RDUA 3GBEA 3KHJA 3W7JA 1F73A 5JBFA 1OIMA 4KIRA 5D9OA 3E2QA 3CQ0A 1EJWC 2W67A 1UR2A 2GPTA 2AL2B 3LENA 1P6BA 4UBPC 1E73M 1F3XA 4Q6JA 4DB7A 1P0NA 1WKDA 3BJSA 2QUMA 2YXGA 3WK3A 1XG3A 4RV8A 4WQ6A 4L61A 3QKZA 3U5YA 4P8WA 3E5BA 3WX7A 3UGRA 3IARA 1CB7B 1KGXA 2HV5A 3VDBA 4MDOA 4V1YA 4W5UA 3GS6A 3M0VA 3Q58A 5G1TA 4AD1A 1FWIC 2V6AA 3GD6A 3DKJA 3AMLA 1XIJA 4Y2WA 3O2LA 1A80A 4MMWA 5HJYA 2YCJA 2JGQA 3O06A 5DY3A 1E4IA 1UR0A 3QW3A 4OBTA 2ZC1A 4DELA 1POKA 3S47A 4JFUA 3QGVA 2BY3A 3H4WA 1TTJA 4DUXA 2J78A 1IT8A 2QPUA 2YDRA 4KGJA 4HHHA 2QVNA 2VR4A 1TQJA 3M6YA 3ZZ1A 5C7VA 3TSMA 2YGYA 3CUIA 1IZCA 3Q37A 4WLCA 3EMZA 3M7WA 4QS5A 1OFEA 3WQDA 1KBJA 5FF0A 1ISWA 2E5CA 3A3WA 3H24A 2Z7KA 3TNOA 3I3EA 3AMCA 4BZYA 1O5RA 2OEKA 5HMFA 2E4TA 4H9MA 2ISWA 1Q6GA 4ZEPA 4PMOA 1YDYA 4EANA 3UVIA 2QCHA 3HURA 3VD7A 5JQ9A 3B9DA 4TU1A 1CCWB 2J77A 4HMNA 1J18A 3VNZA 3VDCA 3CIVA 4H6KA 3RX2A 1BRLB 4F66A 4HPXA 3VUPA 2PB1A 3LS9A 4WKAA 2XINA 1O5QA 2CIPA 2PDUA 1JZ6A 5A6SA 3UG8A 1GJPA 5HQEA 2VHLA 3OW1A 3MI2A 4ZOBA 4IGMA 2ZUUA 3SUSA 2WB5A 4W9TA 1XM3A 5DELA 1W3KA 1FQ0A 2NXHA 3SUTA 1LBLA 1R9ZA 1EOMA 3MWCA 2B7QA 1XIMA 1B3WA 2AKZA 1NU5A 1A50A 1PUDA 3E9AA 5IBXC 2WJFA 4YVXA 2Y85A 1OK6A 4IXHA 1IWAA 1BD0A 1NDVA 4F0KA 2VD9A 4X2RA 3G24A 5E5CA 4G9PA 1RSCA 4F2TA 4AWTA 7ENLA 2PDHA 2OELA 2FHCA 2ISDA 1A5OC 2PRLA 1MFUA 4KRUA 4HSOA 3BCDA 4IIFA 2E5DA 1VPYA 2WC3A 1KO0A 2XH0A 4XZLX 4EF9A 2E6YA 2Z1VA 4LYQA 2BDQA 4GXWA 4F9DA 2E6DA 2I56A 5IOBA 1RR2A 2X7WA 5XIMA 3MO4A 5IHRA 3CL8A 1U33A 1E0UA 1E3ZA 3BOLA 1F3EA 4JTRA 1A5SA 3CK5A 1UD6A 5I06A 5E0FA 5EY5A 3DKLA 3KE0A 4LYPA 3H55A 1R47A 3BUVA 1AUSL 3CUHA 5HK4A 3CV1A 2ZUWA 4AX7A 2EPMX 3GDBA 4YTUA 3N11A 2P3ZA 3FHQA 5G2IA 1UPPA 4M19A 1M7XA 1XLIA 1U30A 1EH9A 1EJSC 4FNRA 4Q4QA 4MB3A 1M7OA 2PWUA 2RFGA 3LV5A 4DWSB 2Q3OA 2J9XA 2QS8A 3GZAA 3WZ0E 2YBUA 5DRIA 1DIDA 1AZ2A 3QC3A 2Q02A 4IT1A 4XSMA 2H6RA 2JEQA 1ZJBA 4MVAA 5JH1A 1J9YA 4IPLA 4HMDA 5KINA 2Z25A 1FWDC 4UFJA 1F8MA 4JIHA 1FWSA 1MW2A 4ENLA 1DORA 1UWTA 4W85A 1E4LA 3QW4B 4BQ5A 1ZS2A 3IEBA 1AZ1A 4IXXA 4GQGA 3G3DA 3TN6A 1UOZA 4WDWA 1DJIA 2G50A 4C6FA 5FEPA 1Q8JA 3GDKA 3B0VC 1Q6OA 2XJ7A 4P7OA 1E1FA 2VM8A 1UWSA 3EMCA 4M1BA 4H9TA 1RPKA 4JN7A 2CERA 3ITOA 2WMKA 3TTSA 3WH5A 3N73A 4MKVA 3N19B 4JTTA 1TO3A 3IGUA 5D05A 5A6BA 1EEXA 3AYVA 3KCOA 1V77A 4QEHA 4BI6A 1XLKA 4K68A 3KM8A 2J47A 2FHBA 5C2CA 5CSYA 2Z0IA 1LG1A 2GUYA 3VNKA 3AAMA 3AQUA 4L7ZA 3N6JA 2F84A 5HQLA 2PF0A 3TZFA 3TYEA 1OF8A 5TBOA 5C7HA 1GWJA 4MJ2A 5AYYA 2XIJA 3HG2A 1U5JA 4UUIA 3HJZA 1XYLA 4KCUA 2DFAA 4GHRA 4GYPA 3APTA 1ZALA 3LDVA 1GUVA 3O0KA 3RM8A 3SCWA 2WQPA 4FIQA 3R6IA 3M46A 3TYZA 4N42A 1LOSA 4RW5A 2HK1A 3HQNA 1ZAIA 4A22A 1TPB1 3E12A 1GEHA 1OSEA 1V0KA 1TPFA 4AF0A 4I7VA 4AY7A 3R89A 3D6NA 4O8AA 2WNQA 3NQMA 3VCCA 3FKRA 3INPA 1H0GA 3DFTA 3VGFA 2G41A 1PE1A 3BLIA 3CH0A 2DY3A 2V2DA 4Y9MA 5BRBA 3GX9A 2LLEA 2CLFA 3CQJA 1QPOA 3R10A 2XM2A 3WIJA 1VLIA 1W1TA 2AKMA 1MUCA 2QAPA 3VABA 4AZ6A 4GPNA 3T40A 4KIEA 1VBHA 4MTVA 4DEFA 1WOBA 4H01A 4BS0A 5D09A 4BR1A 1RBLA 3ABXA 5GJNA 4F3HA 3WENA 3MUZ1 3H70A 2D23A 1W8SA 4Z17A 3NGFA 3A22A 3VNJA 1XIDA 2TSYA 3GU9A 2F9RA 3RPMA 4UQCA 3L4VA 3VMOA 5BNKA 3T0BA 2V5JA 1D8CA 4JQ1A 3P8JA 2IMRA 4IJBA 1QOQA 1RK5A 3ZQ9A 1P0BA 4UMCA 1H7NA 4DJDC 2Y4SA 2CFFA 1D3CA 4K37A 3VDGA 3L4WA 4AVOA 4K1WA 3N14A 4H9VA 4MB5A 7CGTA 3HQOA 1NF0A 2OZTA 2FH6A 3SCUA 4H9YA 3UWUA 2RGMA 3KLKA 4MAVA 4HGXA 3LTPA 2A3LA 3GYEA 3VMPA 4IFRA 3SRFA 3CV6A 4Z1DA 2PDMA 3UY8A 4BWLC 2YXOA 4LUTB 4G1NA 2X0SA 3HZ3A 4F48A 1KCZA 5CLWA 3WLHA 3VDAA 2VRKA 3QQ1A 3DXIA 3W84A 5AHFA 2TODA 1GG1A 4DAIA 3M44A 3C2VA 3M5ZA 3L66A 3UWVA 3W7PA 1GVEA 1FHDA 1LF1A 3ABSA 2A4AA 2IXVA 3C2EA 1OCBA 1O95A 4XIAA 3TXVA 1QO5A 2XM1A 2ZADA 1WXJA 2NQZA 3WH6A 1XDMA 2O9RA 3OYXA 3H12A 3NEHA 3KOXA 4GMEA 1W3NA 3SDOA 3GHTA 5D04C 1EQCA 3P60A 2DT0A 2NUWA 3RITA 3ABZA 4ZQCA 4C6CA 2A3BA 5FOOA 2QYGA 2BLEA 1XLGA 3SIMA 4Q4KA 1S2CA 1KC7A 3EOUA 4X9SA 2VCBA 2G0WA 4IUOA 3CUZA 2YIHA 3VIJA 3CHDA 3OBKA 2A1YA 2DSUA 4JFTA 4P61A 5C2XA 1O6IA 4JTUA 3SRKA 2F6UA 4B5UA 4GH1A 2IW0A 3SURA 4FF5A 3VZZA 2FTPA 4ZQNA 2D2JA 2QCNA 4KWUA 1DWHM 3DIPA 5EPDA 1UCWA 1R3QA 1D3GA 3PPGA 2H3BA 1JRCA 5FEXA 2Q6ZA 2YB1A 3LQLA 4AB4A 3G1SA 2BB0A 3KRUA 4NHVA 2QT3A 3PZTA 4ROQA 3WQ5A 5A8PA 1OG0A 2RJHA 4ZXLA 1X8CA 4JBRA 3TV8A 3W73A 4ZFCA 1TSIA 1REQA 4QJ1A 1MRQA 4OV4A 1VIZA 3VOJA 4IUGA 1YDNA 2VQTA 4DRSA 1UH2A 3EBVA 3QV8A 4MG4A 1R6WA 3II1A 3UF9A 1PCKA 2C91A 5BZAA 4DHGA 3AFBA 2ISFA 1ZGDA 1FHVA 3MP3A 3IWPA 2CHRA 1KWKA 2BGNE 3M07A 3B9AA 1DYSA 4IM4A 1XSKA 5EMUA 4ZCWA 4PYSA 3XISA 2YL6A 1AQHA 2G97A 3RLVA 1MW0A 2UY5A 1RK6A 3PUEA 3RMEA 1EX1A 4P7QA 1OFDA 4O11A 2D0HA 1CX9A 3AIUA 2P50A 3AROA 1WZAA 4LANA 2PWVA 1JD9A 1EZWA 2C7FA 1JCYA 4M6UA 3W7KA 1HIZA 4P2VA 5HDRA 1RALA 3WNMA 1C8YA 1XRFA 5D4YA 1R9YA 4QBXA 3OVQA 3TP4A 2DP3A 4FX7A 4UQAA 3BZGA 2GLKA 3QBUA 2DV0A 1CLKA 3S3GA 4POCA 1NOUA 2VL4A 3EX2A 1JCNA 4LGXA 2Y88A 4HP5A 2X09A 2WZHA 3DERA 2QLYA 3S1XA 3G6LA 1P1XA 4EK7A 1XLHA 5HMSA 4F0SA 5M2FX 3PB2A 4NAFA 4PRRA 4OQVA 1XD1A 5DRCA 3NZ1A 2E6FA 1QI3A 4JGDA 1V7AA 4WGHA 3TX9A 1W1VA 4MSSA 3ARXA 2F6XA 4Q33A 2QUTA 4PBGA 3W0KA 4N6EA 2ZUTA 4K8EA 5D32A 5LA0A 2J7HA 1SR0A 3BXWA 3HF3A 4OVXA 3H7RA 2G5WA 4H1ZA 1JF5A 3O7UA 1RP8A 5I02A 2DVTA 4M3PA 1FWJC 1NAL1 2ON3A 3AJ7A 4PMDA 3DFHA 5AHNA 3CHEA 3N2BA 4NX5A 3RO8A 4XD5A 3OIHA 3N4FA 4KPLA 3FOKA 2UV8G 1WPCA 5A6BD 1UMYA 2ZZ7A 1M53A 3R58A 1JPKA 2PRMA 1Q6FA 4FX6M 3C61A 3AIVA 2E40A 2EPLX 3WD0A 3ITVA 3KBJA 1LOQA 1BTMA 3ARQA 1TIWA 1VEOA 2XGZA 1N82A 4HCHA 1UP3A 3KX6A 4YYCA 3SSZA 4DJFA 3FN9A 1XIIA 1XS2A 5I7GA 1AD1A 3QMTA 2RGLA 3FYOA 5AECA 3V5FA 3LXBA 1HL8A 4GK8A 3PTKA 5EGRA 4ATDA 3RCNA 1OYBA 3OO2A 1CNVA 3IJ7A 4MOZA 1ZU8A 1ZRQA 5GVJA 4L9XA 3UYCA 3ZJKA 1REQB 3PSVA 3O0FA 3ELFA 1TE6A 3FS2A 2H9AA 1JNEA 3CZGA 1ONXA 3QFEA 4A2SA 1WV2A 2O9TA 4NYYA 1E9LA 4WX2A 4A29A 4LAOA 1ZBVA 1C92A 3NL5A 1NM9A 5CXPA 1JZ3A 2ZVRA 3A4JA 4P7RA 1SSDA 1C8QA 1CTNA 4E8GA 1R86A 2I5IA 1EDGA 4HTYA 1V6XA 4B4FA 4JX4A 3F4VA 3WH7A 4HPJA 3TXZA 3W2UA 4BQ2A 2EPNA 4Q8WA 3LG3A 4X3ZA 4XV0A 3FXGA 3NJ3A 2J88A 4DBEA 5L6UA 4JTDA 5LNVA 1OADA 3DUGA 1VJZA 5C54A 4AFYA 3G1FA 4EXAA 1X39A 4NY2A 1FDZA 4QFUA 3SY1A 1Y5XA 2PDCA 3SN0A 3WLJA 4GI8A 4O0QA 3DG7A 4B91A 1WBJA 1CPUA 5XINA 1ZQ5A 3F7JA 4NJIA 2QPSA 3V1PA 2WJDA 1UC5A 1Q5MA 1FKXA 2HSAA 3VIGA 4JNMA 1WZMA 2QDHA 1HO1A 4IICA 1RLDA 2XU2A 1ZJHA 4OHQA 5D30A 2YX0A 2X1RA 5LIKX 1K1DA 5J8LA 3GH4A 3TR9A 5MF5A 3U7BA 4Y7EA 1VENA 1LL4A 3T78A 2HNEA 3VM5A 4XZHA 1GOKA 3HPFA 1QMLA 4QX4A 1J0HA 4UTMA 4N4PA 4M81A 2J8TA 4HBKA 2DT2A 3W23A 3PTMA 4EXBA 3LXCA 1XKJA 4BA0A 4UTLA 4U10A 4H8NA 2RAGA 2PWFA 2W92A 4O8RA 4R88A 5T9CE 1ESWA 1D7KA 2VZSA 4LS1A 1BKSA 3GUGA 3N17A 5KMYA 4HU8A 2WVSA 1BXCA 4MWAA 3B8TA 4F79A 2XVPA 4PRTA 3ARYA 4IMAA 1DXEA 1IWBA 1E15A 1NY1A 4RDVA 3L5MA 2OKTA 4LVGA 4IZGA 2HEJA 2PZNA 1NP0A 1H61A 3EPMA 3UR5A 4Q4RA 3ZIZA 3C0JA 3NO1A 2H8XA 1BPLB 3N2CA 3FK4A 3IVUA 4JL2A 2PLCA 2NSXA 5FF7A 3OP2A 3H23A 4PE8A 1JJKA 1UR8A 1J93A 3OGSA 3F03K 1K8XA 3UFYA 3EOEA 4O15A 4Z0SA 1T99A 1OK4A 2D20A 3ALFA 4DI9A 2ZX7A 4X2PA 1E6SM 3FJLA 4D71A 3TN4A 5HBFA 4MGGA 1DJYA 5DMLA 1EA0A 4EKJA 3GIQA 5I6SA 2DIEA 1WDRA 1W9VA 1K8CA 1LOLA 2BHZA 2P10A 1TV8A 4O1DA 3IJDA 4MDPA 1VJIA 3WBXA 3PZUA 5J5RA 4GISA 1EWEA 2CZ5A 1LROA 3NG3A 2J8GA 3MUCA 1Q7ZA 4L5ZA 1GOIA 4DYEA 1K02A 1P48A 5M3WA 2R24A 3W7DA 3WL1A 3A9BA 4B3LA 4NYUA 4JQ3A 4O19A 4GVIA 2EJ1A 4D1JA 3OGVA 5IDZA 4EVZA 5DT7A 3NQ2A 3RM4A 1RA0A 2YJQA 1AQ0A 4QROA 4BK9A 2PCEA 1FTXA 1KFLA 2ZDRA 2VO5A 1DBTA 3UWEA 3D5HA 3OQ8A 4N6FA 5IM51 2GGJA 3A9IA 1K77A 5FJOA 3E49A 4GIAA 3A23A 4LAMA 4DM2A 2FVMA 3U0HA 2HBVA 3AMGA 3NQAA 1CGWA 4O1BA 7XIMA 1WZLA 2QMJA 2Y24A 3BICA 1A5MC 1XDJA 2BHUA 1J0YA 3CB8A 1V79A 2YA1A 2EEXA 5AC5A 4M5PA 3WL0A 1HGYA 3PJWA 3ZR5A 1DWAM 1JDFA 2XVLA 1GQNA 2DIKA 3GHSA 3GVVA 3KOWA 3BCFA 4DJEA 5I77A 5FEZA 5K4ZA 2KAUC 3N6QA 4IHCA 2DZPA 1PTDA 4E4FA 1SJDA 1F7BA 3L12A 4FNQA 2ZRVA 4MUPA 3MQTA 3M0KA 4NASA 3EA1A 4BEUA 4JPGA 3WH8A 1FWTA 2PTYA 2W63A 4ATLA 4EAYA 4ACYA 5BU9A 4G1KA 1RVGA 1XIEA 1EP2A 3GUWA 1NWSA 2G95A 7REQA 3PS7A 3MDWA 3S2NA 1H1NA 2EXOA 1FRBA 4OUIA 3KBVA 1B4KA 2J13A 1E43A 3SFWA 3FDKA 5HWJA 3IV3A 1EF2A 1NDYA 4HCDA 4W7VA 4J4KA 4C6KA 2Y70A 4MZ8A 4OBSA 2QIWA 3AISA 3ZVHB 2XIBA 4DJFD 4WGXA 3LBMA 1CLVA 2X30A 4J3VA 1A5NC 3HPAA 3LCLA 3MMWA 1S39A 1M03A 4JIPA 1JUKA 3M0XA 1FDYA 4UTTC 6XIMA 5LXEA 1QUMA 2PC4A 4UTWC 2JGYA 5AYBA 2A7RA 1UOKA 1FWFC 2AQOA 1N55A 2XVGA 4S3KA 4PSPA 3WD4A 2IKGA 2ZKMX 4JIQA 1EUAA 3NFUA 3LHWA 1B30A 4JDBA 1XYAA 2PDWA 1LUCB 1JXJA 4HNVA 3F4DA 4EIVA 2EO7A 1FKWA 1RXOB 1X6LA 4OT7A 1SZGA 1ITUA 1W91A 2Z4GA 1EGZA 5AY7A 4YL2A 4X61A 4RNFA 3OZMA 1OCJA 2QCEA 3W72A 2GJXA 3GBDA 4B5TA 5DN1A 5CPLA 3NO3A 5I0DA 1QW8A 2QW5A 2VR2A 3KL5A 2CXGA 1V02A 1FWCC 2DUZA 1W5PA 4REQB 1Q6CA 3W81A 4AMAA 1Q2SA 2PTXA 3VIKA 4D8ZA 1FOBA 4NRRA 2WVVA 4M7SA 4B92A 2DEPA 3MY9A 4GUGA 4WSJA 4E3VA 3E2VA 3WQPA 1GNXA 3VIFA 2QGHA 3BOXA 4IG2A 4XUGA 3F4WA 1GTHA 4US6A 2OU4A 1UA7A 3VPLA 1R87A 4Q4MA 3M0MA 4AG0A 1OY0A 3CV2A 3PNUA 2PEVA 2TRSA 5FSEC 1UQZA 2WV8A 3U4AA 1IGSA 3OODA 5CC6A 3GSMA 3EOOA 3C3UA 4FALA 1A3XA 4J27A 4J3XA 3GH7A 4G7EA 3U57A 3KBNA 3PBYA 3PPCA 4LEFA 1KR0A 5DX7A 3HB9A 1XICA 3OYZA 1H60A 1PJ9A 3S0CA 2OYMA 1GJWA 3P0WA 5IBXA 4PTMA 3BG9A 2HXUA 3E0VA 2J66A 3UERA 3V1HA 3BCJA 1XFCA 4LUSB 1SMDA 2ZOXA 4UOZA 3EYPA 4Q8QA 4JN8A 4FIRA 1X97A 2XFWA 3BAXA 1TREA 4IGNA 1TZ7A 4OZOA 2IQTA 2WM1A 2WZEA 2Z26A 4K6AA 2Y62A 3CV7A 5FF4A 2E09A 3O9NA 4CUCA 3S5OA 4RL3A 3C56A 2ZUNA 1PX4A 1EJ7L 1L6SA 1XH2A 4QE4A 4G56A 1E3XA 1TFVA 1FBAA 2Q71A 1Q7QA 1JYNA 4BF5A 4D6DA 2IPWA 1WYIA 4O53A 1MW1A 1NDZA 1TRIA 1C7TA 4AD0A 1TV4A 4PUJA 2C19A 4Z0JA 1FA2A 3NM3A 3VNDA 2PBOA 4NQ1A 3UXLA 4UWMA 5DANA 2CNCA 2R91A 4YMZA 4XBSA 3GU2A 1WUFA 4B5WA 4JKKA 5CAHA 4P8XA 4QG8A 5KZEA 3VD3A 3CZLA 2CLKA 1TIMA 1P0KA 2V5CA 2FZNA 1OF6A 1XSJA 2DPEA 1HP4A 1Y8BA 2Z1KA 2XFYA 4OIFA 2ZX5A 3URNA 5CZTA 3LI0A 3EXRA 3N13A 4S39A 3HFYA 4JQAA 2YW4A 4KEMA 2TPSA 4WZHA 4B9ZA 4GI6A 1BSIA 4B3KA 3B0YA 4YCOA 3HIJA 4JTLA 4CD7A 1XUZA 2FGLA 1MEWA 2ALDA 4E2DA 2Y6ZA 2NZLA 5D03A 2HS6A 3G1HA 4W86A 4ZFMA 5EA9A 3L2IA 1OIFA 2YFNA 2EG6A 1QVBA 2EPKX 5DBUA 3UA3A 4L65A 3NUKA 1YXYA 2FJKA 4AY8A 1TB3A 4HNNA 1Q13A 1CGUA 2PWDA 2GOKA 4JYEA 4B3ZA 4E5TA 3BLLA 4HVXA 2V8ZA 1G6CA 1XXXA 2DUAA 4FLQA 3HFTA 2WMGA 4V33A 3LRKA 4MZYA 6TAAA 5G1MA 4ZMGA 5EB8A 3UZWA 2IQ0A 4ZQRA 4AY1A 4K8GA 1XRTA 2I57A 1TELA 2WMJA 3MV11 3GM8A 4TVUA 4R3UA 4QNEA 2E77A 4E3TA 4HYVA 3V0UA 3VIPA 4BEQA 3T0CA 2O7QA 4PCFA 4WDXA 3VFCA 2J75A 5FJUA 4AD2A 2WXDM 1H5VA 1UASA 1UP0A 3UXAA 4QNWA 4RJEA 3WN6A 4QDMA 4QQ3A 3U7VA 3NZRA 3CUFA 2GDUA 4Q4SA 1H7RA 1EBHA 2P0OA 3V3WA 1LYXA 1T41A 2QHAA 4S3BA 2JALA 4PCTA 2W61A 4GJ1A 1LBMA 3L5LA 2GL5A 3QV6A 3S1VA 4XTDA 1WZKA 5TD4A 4S3JA 2VEPA 2NX3A 1Z42A 1EL3A 3RHGA 5D9NA 1OC5A 4DJED 2RDWA 3REQA 3B40A 3ARPA 1QNQA 1NWRA 5D9PA 3OLIA 3M0IA 3KDNA 1JD7A 2E9MA 5D2YA 3ABOA 3NNTA 1QK0A 5JBDA 3M5XA 2W9MA 5M1TA 3TFCA 4KW2A 4V1XA 1Z48A 4PODA 4X22A 1ADSA 3BW2A 5LIWX 1K6WA 3CU2A 3NDYA 1UBSA 2RH9A 2FDMA 3PZQA 3WDHA 5BW6A 1K7FA 4XD3A 4GVFA 4R33A 4RZBA 1W3IA 4TTUA 4GNKB 4A8NA 5C0QA 1UD2A 3G1XA 1OZMA 1VPXA 3FLUA 4JR5A 3URBA 2UY3A 4LEQA 4IQJA 3EDKA 3SCTA 2FVLA 1K4HA 3AXXA 1PDYA 4F2UA 5DO8A 1FXQA 4RZ5A 4JIIX 3MV01 2E9BA 3BL3A 4GQ0A 4HZ8A 1JPIA 3MBDA 3BANA 3BZJA 4ACZA 1YPFA 2I1OA 3LEPA 3TMQA 5T8GA 4DJDA 1E1CA 4C7GA 3NIYA 3GTXA 8TIMA 2ZYFA 3SEPA 2R6OA