4ATDA

Crystal structure of native raucaffricine glucosidase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
501
structure length
469
Chain Sequence
b'DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAUCAFFRICINE-O-BETA-D-GLUCOSIDASE
publication title High Speed X-Ray Analysis of Plant Enzymes at Room Temperature
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 182
structure length 469
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2012-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4atdA00
3I3EA 1V0LA 4J27A 3W37A 4CCEA 3AXXA 1EO7A 2Y4SA 4JFTA 3SCQA 1ISXA 4QP0A 1UD5A 5D4YA 1OGBA 4W5UA 4U2ZA 7TAAA 5A8QA 3QR3A 2XFFA 4ZEPA 5DFAA 1Y7VA 2PWGA 1BAGA 4ZFMA 2PBOA 1VIWA 2DQXA 1R85A 1UD2A 4BA0A 3QHMA 3AIUA 2WCGA 5E09A 3WF0A 1WDSA 3VIPA 3LMYA 3LPFA 3RM9A 3PZVA 3WNPA 3VD5A 1C92A 2EPKX 4CU6A 3FN9A 1HKKA 4HZ6A 2D23A 3SCNA 5C70A 1VFUA 4FLSA 1C90A 5A6KA 1WZMA 1QI5A 2J62A 2W92A 1H0IA 2C8NA 2ZX7A 4YN5A 1QHOA 1V03A 3FW6A 7A3HA 1D2KA 3WDPP 4M56A 5EFDA 1Z32X 5KZ6A 2BFGA 4EKJA 1GORA 2WMIA 1EOKA 2EPOA 1MW0A 3G6MA 1BYCA 1H5VA 1GJWA 2BHUA 4W85A 3D3AA 1V3HA 2WVTA 1JFXA 3CUIA 5I5RA 3WFLA 4D1IA 3VIMA 5ABHA 3PTMA 4S3JA 3K8MA 1UH3A 4JFUA 3WEZA 3VMOA 2CERA 3PZTA 3KWXA 4WIWA 4M80A 1HJUA 5A8MA 3SEPA 2D1ZA 4D6IA 3VOCA 4GZEA 2W67A 3GM8A 1J10A 1ZBVA 2IUZA 3B9AA 3OLGA 4PSRA 1LL6A 2VZUA 2O9PA 3ZR5A 1GVIA 1YHTA 1R8LA 5A8OA 3U5YA 1OIMA 4IPLA 5CPSA 2BY0A 4D71A 1B3ZA 4P8UA 4W8BA 2DSKA 1HVXA 4WSJA 2DT2A 3J7HA 3AS1A 2CETA 1PZ2A 1V3IA 3SUUA 4AZHA 3MUZ1 3W26A 3UCQA 3CZKA 4R5EA 4IPNB 4UOQA 2WK2A 5AYBA 5CQ1A 2PWDA 2XIBA 4HPHA 4DM1A 4MNLA 4PMVA 3POCA 4YHEA 2VVSA 2QMKA 1XH2A 2ZICA 1J0IA 1J0JA 2PWHA 4LXFA 1GQLA 2DGAA 3VIIA 3BAIA 2CKSA 1NWTA 2W61A 1JD7A 2JF7A 3DHPA 3FNDA 3ZR6A 1E4IA 4BZYA 3AOFA 3AIBA 2OWXA 3TTOA 3ARYA 4JAWA 1V3JA 4W8LA 5M5DA 2Y24A 3WNOA 1UA3A 2Y2WA 5E70A 1VEMA 1KWKA 4H41A 4B3LA 4QLJA 1M01A 3MMUA 2Z1SA 1E0XA 1LLOA 1E6NA 3GBEA 1ZBCA 3WN6A 4HMDA 2VNCA 2EPLX 2V3DA 4PUDA 3WDIA 1XYZA 3WD4A 5CLWA 3W28A 4P8VA 2YL6A 3SUVA 2XGBA 3QOMA 3N04A 1CEOA 3AXHA 2CYGA 1BSIA 1A3HA 3VGFA 4CU7A 3BCFA 1TZ7A 4OZOA 2VZVA 3N11A 1CXLA 2ZUMA 1KCLA 4B16A 3B8SA 3MKKA 1XC6A 4N42A 3NYDA 3PZUA 1W91A 2O92A 4M82A 2VZOA 3TA9A 2GUYA 2Y8KA 1E6RA 5JUVA 3MANA 3VIKA 3VM5A 1JAEA 5GNXA 4AZ7A 2G3NA 1KGUA 3RM8A 4P8WA 1V6UA 2G4FA 2OSYA 2PI6A 2UY4A 1EHAA 3AIVA 1OBAA 5ABFB 1DWJM 2QHAA 3TTYA 4Z2IA 2HISA 3U5UA 4CN6A 4UTFA 1OIFA 4MTVA 5HOSA 4AYSA 4AIUA 2YKKA 2D0FA 5HBFA 5BXRA 1JZ7A 5CGTA 4AD4A 3CZ8A 1G0CA 2JFEX 3MUY1 4QLKA 4ACYA 2XG9A 5IDIA 2YBTA 1MVYA 1UR8A 1UWRA 1W9DM 1OD8A 1ZBKA 3DC0A 3CLWA 2FDMA 1JXJA 2VRQA 4KRUA 2QMJA 2VCBA 3ARQA 3W4RA 2Y5EA 4HMCA 3NSNA 1OB0A 1FH9A 1W1PA 2GJRA 1IV8A 5EBAA 5HPOA 2WHMA 3GYCA 3UETA 1PX3A 5EFFA 2VT0A 4YPJA 3A4AA 1UH4A 5FL0A 2J7HA 4EAMA 2A3BA 2FHBA 4A4AA 1GONA 5BXTA 3WMSA 1C91A 2VCCA 2O9RA 4LPCA 3SCUA 4HOXA 4QCFA 1NWSA 4R27A 1W2PA 3BAYA 3ZIZA 3AMKA 3U7VA 3OBAA 3WL0A 1W2VA 1JXKA 4X9YA 2BV9A 2ZUVA 1J9YA 1US2A 1WDQA 4AC1X 5F7UA 1QNPA 1BYDA 5DT5A 1E1EA 1UOKA 2V3GA 2YIHA 3BSGA 4UCFA 3AMGA 4UFIA 2X2YA 1JNDA 2DSWA 2WZIA 3DYPA 1Q6CA 1WPCA 3AXIA 3EMZA 3E1F1 4AIOA 3BAKA 1QOXA 2XWEA 1TA3B 3S6TA 1JG9A 1JDAA 2XVLA 4PRWA 4ATWA 3L2MA 3EDEA 2GK1A 3W25A 4JKKA 2OLHA 1LF1A 1VBUA 2VZTA 3WMBA 3T09A 2DSVA 3GNPA 3F4VA 4PMXA 1IZJA 3UR7A 2EPNA 4BQ4A 3WELA 4UOJA 2PB1A 2YDRA 4MAVA 5A2AA 5FCZA 3NDZA 2QPUA 2BS9A 2EBNA 1KQYA 1ZJAA 2DT3A 1MWOA 2UY3A 2X1IA 1N82A 2GJPA 1M03A 1E6PA 2CKRA 4HOWA 2J7EA 1GCYA 4M29A 4WKFA 1ITXA 1E0WA 5C8BB 3IAQA 4D6FA 1JGIA 3AS2A 5M17A 1PJ9A 3ZJ7A 2A3CA 1ECEA 4HPGA 3K8LA 3CZJA 1A47A 3VKKA 2VX7A 5HDRA 3PZIA 1VB9A 1GHSA 3L4XA 3VIHA 2ESCA 3IK2A 3BMWA 3GNOA 3WD1A 3FHAA 4W88A 2YL5A 1ZB5A 3ALFA 4UNIA 4AEFA 3ZOAA 4MDPA 4CUCA 4PMRA 1MXDA 3AHXA 3N1AA 1NOWA 4AD0A 1Q6FA 5TD4A 2J77A 2E3ZA 4UFKA 1QI3A 1UG6A 1CWYA 2D24A 5CJ5A 1JDDA 1QPKA 3GDBA 4J3VA 2E0PA 4QLLA 1Q4NX 1HL8A 3EBVA 4UQDA 4PCTA 1CXFA 2TAAA 3UG4A 5A1AA 3VU2A 4B9YA 1V02A 3B9DA 5FIPA 1NM9A 1TVPA 3CGTA 1JNEA 2EPMX 2FGLA 5ECUA 5A95A 5I78A 3NJ3A 2XSBA 5IFTA 5LA2A 2QLYA 4XUYA 1AQHA 3F5LA 1BVNP 2CPUA 3CMJA 2WC3A 3SCSA 3AI0A 4ACZA 1AMYA 4UFHA 3WKZA 1WZAA 1PIFA 1UKPA 1NP0A 1XYFA 2XPKA 2QF8A 3TOPA 2EEXA 3CTTA 1W3KA 1U2YA 1NOUA 2W63A 1J0HA 1P6WA 3TTSA 2WW5A 1XH1A 3VDCA 4AD2A 1GW1A 4AZGA 5IHRA 3ALGA 2WZHA 3WH8A 1HX0A 3W82A 1EOMA 3MU7A 3CO4A 2J75A 8A3HA 1BYAA 3BH4A 1RP8A 2WC7A 3AJ7A 1NWUA 4D6GA 5JBFA 1H0GA 1X6LA 2WMIB 2BHZA 4QFUA 3D5HA 1MXGA 1QNQA 2VJXA 1MW2A 1JAKA 3ZSSA 3SCVA 2DPEA 2YOCA 4Y7EA 1JIBA 5DEZA 5GNZA 2AAAA 1ZL1A 2W62A 1G9HA 2XHYA 4CD7A 4W89A 1RPKA 1IZKA 3NUKA 4J28A 4D6HA 1HJVA 1XCWA 1B31A 2J8GA 4TOQA 5D9OA 4UQAA 2BVDA 1LJYA 2F8QA 4NRRA 4UFLA 3OLIA 3SCWA 1C7SA 2WSKA 1LWHA 2QV4A 4CCCA 1VFFA 4ML4A 1B1YA 1BQCA 3AMDA 1JDCA 1QNOA 3AMCA 3PZNA 1UR0A 1BG9A 1FHLA 3SCPA 4KGJA 1XGZA 4J7RA 2ZXAA 4A3HA 1K9FA 4MB3A 5HXMA 4UOZA 3IJ8A 4BCEA 1W1YA 1UHVA 4UFMA 3EDKA 1HJSA 2XGIA 2W5FA 3VGHA 4CU8A 5IFPA 2GJXA 1MQRA 1KXVA 2WZEA 4JHZA 4U2YA 1I1XA 2WVVA 2J7GA 3FHQA 4H04A 3SCRA 2V5DA 4BS0A 2G3JA 4GIAA 1KBKA 4DM2A 4P7NA 2D3NA 3ARVA 1WKYA 3NDYA 2E9BA 3GXMA 2PF0A 2CESA 4C7DA 1DHKA 5EB8A 3WL1A 4M8UA 3LPGA 2G3MA 1KGWA 2YL8A 3APGA 1Q6EA 1LL4A 2BHYA 3GBDA 1QI0A 3BAJA 1W9VA 1E6XM 1QBAA 1PX8A 2CBJA 4QCEA 1SFSA 3DHUA 5BWFA 3VD9A 2WWDA 3VPLA 1J18A 3ECQA 1I75A 2CBVA 2YBUA 4DWSA 1R86A 1UD6A 1VJSA 4PSPA 1SR0A 3OA5A 1ISVA 3EMCA 1B3XA 4AIEA 5A8NA 4CN1A 1TMQA 1OINA 1WNOA 3A4WA 4B3KA 2VX6A 2ZUTA 2WMKA 4MNMA 2J7BA 3EMQA 1UA7A 4DUVA 3RJXA 2A3EA 3ZJ6A 4MB5A 4RL3A 2OSXA 4AZCA 3EDJA 1B90A 4CGTA 2VMFA 2A3HA 3ZT7A 3WMCA 4GZIA 1J12A 1CIUA 1EDTA 5M3WA 3F5KA 2OYKA 1JZ6A 1O7AA 5I0DA 4J3TA 4RE2A 5I77A 5HNNA 3WNLA 1G5AA 2DDXA 2WHKA 3O2LA 4MJ2A 4TX8A 2QPSA 1B0IA 1UWSA 4ZE5A 3CBWA 2ZWZA 5ABGA 3RCNA 3FAWA 3IJ9A 3WQ8A 3WQ5A 3NIYA 1TCMA 3BSHA 3W53A 2D20A 1E6SM 2BY2A 3OZPA 1CGWA 4JZ5A 1C93A 3FXYA 2WPGA 5CSUA 1CZ1A 2BY1A 1J01A 4RE3A 5BYWA 1UWIA 4LYPA 4K68A 4GI9A 5IHSA 3BC9A 2J47A 9CGTA 3VILA 1W32A 1WZKA 2XVGA 2HVMA 1V3LA 1HJQA 1VBRA 3KL5A 3BAXA 3ARZA 4PYSA 1UWQA 4DWSC 3ZT5A 2ZIDA 4ZENA 1PAMA 3MUAA 2ZUWA 1GOKA 4UZUA 2V3FA 4P8XA 1K9EA 5E6YA 1V08A 3W6MA 2PC8A 8CGTA 2ZWYA 5CPTA 3DECA 1MFUA 1C7TA 1CYGA 3WDHA 4NRSA 1UKQA 1UH2A 3AHTA 3N12A 2WMFA 1GOOA 3PZQA 5GPRA 1ZS2A 2VZSA 4PCSA 5CG0A 4Z2LA 1VF8A 2ZUSA 1HIZA 2WNWA 4TVDA 4PMUA 2ZXDA 1UQZA 3VM7A 3PZOA 4Z2KA 3MSGA 2GDVA 2ZX6A 3K4DA 4KGLA 1E43A 2VQTA 3WF3A 1BPLB 2X0HA 5JBDA 2JIWA 4GXPA 1QHPA 1DWIM 1EHNA 1E1FA 2WVUA 1B9ZA 4QDMA 1BG4A 4F66A 3L4TA 1R7AA 4N0RA 1CTNA 3EYPA 1VEPA 6TAAA 4PUEA 1KQZA 4V2XA 5EMYA 3MV11 4W7WA 2F2HA 4GQQA 1HP4A 2CHOA 1PIGA 1ZJBA 3AHYA 3BAWA 4F79A 4U5KA 2GK1B 3WENA 3VX1A 2XFYA 1WE5A 3WFZA 1E72M 1UZ4A 2XVNA 1JZ4A 1VRXA 1UYQA 1W3LA 1EIBA 4W84A 3SCOA 2WHJA 1JL8A 2V5CA 3WD3A 3VIOA 3GH7A 2OYMA 3AICA 4UFJA 4OUEA 3VD7A 4Z2JA 4OKDA 2DH2A 1E3ZA 1WDRA 1JD9A 3UG5A 1NARA 1UWUA 1ISYA 1TE1A 4KRTA 3AYRA 2EO7A 2WYSA 2WLYA 3AIRA 4AD3A 5BCAA 1C8XA 1CXHA 3RILA 1VEOA 2E8ZA 1TUXA 4Z2HA 4JCMA 3VDBA 2D0GA 4PMNA 4JKLA 2VX5A 1C8YA 1FH7A 6CGTA 4JL2A 1MFVA 3IJ7A 2OWCA 1GOMA 3DYMA 2XTKA 3VUPA 3KL3A 1BTCA 1E56A 4S3KA 3VDHA 1AQMA 4BQ2A 4GQRA 4C7FA 1JZ3A 3CH9A 2NSXA 3ZMRA 3O6AA 2VQUA 1GPFA 4PMQA 1W9PA 1QNRA 5A6BD 4HTYA 4CKQA 3FY1A 5I23A 1GUVA 1HJWA 1KBBA 2CIPA 1CGTA 2DSZA 2OWWA 4J3XA 5A8PA 5DF0A 3HU7A 4DUWA 3L4UA 2V3EA 1XHGA 3AZRA 5AC5A 3AROA 4FLRA 3HMCA 3SCTA 1H11A 4PBGA 4Z2GA 4PEEA 2JIEA 2CBUA 3EDDA 2YDSA 4ZE4A 2UWFA 2XVKA 2VUYA 5BXPA 4PMZA 2CHNA 3BXWA 1JZ8A 2ZXBA 4AZIA 2VVNA 1KB3A 3VIGA 3WF1A 4ACZB 3W24A 1L8NA 4XV0A 2VR4A 3VIFA 4P7OA 4B9ZA 1O6IA 3AS3A 3THDA 1BYBA 4MB1A 1WZLA 3CPUA 3QGVA 5FD0A 1GQIA 5D9MA 2OSWA 2YLAA 1VENA 1U33A 2EQDA 4AEEA 1J0ZA 3PTQA 4WF7A 4LX4A 3N15A 1TG7A 3U7BA 5A3HA 4E4PA 4Q22A 1V3MA 3VGEA 4TTGA 6A3HA 4TXEA 3SUTA 3W27A 3VNZA 3AIWA 1SMAA 4J3WA 2WMGA 3VINA 1E6ZA 4EK7A 3WQVA 5C71A 1V0MA 3GZAA 4MAZA 1FFQA 4D72A 1E4LA 3GXFA 3VIJA 4BQ3A 1OT1A 2J78A 3QHOA 4WK9A 1GVYA 1KR0A 1BLIA 2VO5A 1OD0A 2VTFA 4TVUA 2G3IA 4U33A 4W7VA 1DWGM 3EDFA 3BMVA 4JHOA 4U3AA 1S46A 1CGYA 2RGLA 1E71M 4OJYA 3OGRA 2FHFA 3WNNA 5A6JA 1PZ3A 3I3BA 2G8ZA 1HVQA 3L4ZA 4W8AA 4FK9A 4UQCA 3QHNA 1HXJA 2D3LA 2GFTA 1EH9A 3UERA 2ZUUA 3S2CA 2WMHA 1F4HA 3WDJA 2GJXB 4IM4A 1NP2A 2DEPA 1QBBA 2EJ1A 2WVVB 2WC4A 5ABEA 4OBSA 2YA2A 1B2YA 1GQKA 1C8QA 4LYRA 1HKIA 3UEQA 4WJXA 3VNYA 1BFNA 3GXIA 2WBKA 3T2OA 5A6SA 1WCGA 4CD5A 1KFWA 1CLXA 4HMEA 4HZ7A 2VRJA 5BRPA 3WUEA 2UY2A 2XSAA 2C0HA 4JKMA 1E3XA 4UR9A 4UQ9A 2BXYA 3HJEA 2CCRA 3U57A 5DO8A 4AISA 2DT1A 4MDOA 3N9KA 1UD4A 2XWDA 1WB0A 2VURA 4JCLA 3B9EA 2J4GA 3VGBA 4DWSB 2J25A 4XZBA 1ZU8A 5D9NA 2XVPA 2YA1A 3UG3A 1JZ2A 1B30A 1E0VA 4D6CA 2CITA 2VCAA 1BF2A 3SURA 5A94A 2E4TA 2W91A 3JUGA 5A6BA 2G41A 3CZLA 1JYNA 1B3VA 3OIHA 1DWAM 4TX6A 2XFRA 2DH3A 2W4XA 5E9AA 1M7XA 1FHDA 3GTNA 3WQ4A 1E55A 1X1NA 3GH4A 4J3UA 3CZGA 4AZCB 4HP5A 3L4YA 2WCSA 1W9UA 4P7RA 4CCDA 5E0FA 4GPNA 4IUGA 1ZBWA 1E4MM 1HL9A 2C7FA 3AFBA 1CXKA 1JYWA 2ZUNA 2DIJA 5FKYA 3UESA 3VVGA 2ZX9A 3T0BA 1MW3A 3HN3A 4B15A 1XD0A 1OT2A 1ITCA 1HP5A 4NF7A 3AHVA 1KXQA 1H49A 2JF6A 3BGAA 3PTKA 1HT6A 5A2CA 3A3HA 3K46A 3ARTA 3I3DA 1CECA 5CLTA 1EQPA 1XH0A 3AQUA 1RP9A 4M81A 1V02E 2DIEA 1RH9A 3NCOA 5LA1A 1E70M 2E40A 1TVNA 2J7CA 4DUXA 4KMQA 2ZX5A 3ARUA 4V27A 2WBGA 2GDUA 3VD4A 3ZJ8A 2BVYA 3CIVA 2IXVA 4HOZA 1SYTA 2WM0A 1WAWA 3CHFA 4H8VA 4URIA 3VD3A 4GO8A 4YHGA 4AZ6A 1FP9A 5CSYA 4FLQA 2WLZA 3VTRA 4UQBA 1W9BM 4RE4A 3W6LA 3SUSA 3OLEA 3N13A 3ARWA 5AC4A 3WF4A 1GHRA 1KCKA 4AZBA 2WB5A 3K1DA 2YLLA 1E9LA 1UD3A 1EDQA 4CN4A 4JIEA 2D0HA 2E9LA 1QW9A 5AY7A 2VL4A 5CXPA 4C7GA 1H09A 4E8CA 4W93A 3WNKA 1GOQA 3L4VA 2AMGA 4MNJA 1GJUA 1Q6DA 4LQ1A 5A6AA 2RGMA 5DT7A 5JBEA 1PX4A 3ZQ9A 4HA3A 3PZ9A 1M53A 1XSKA 1UR1A 4HA4A 4KWUA 4WKHA 4OOUA 2BVTA 1Q6GA 1V6VA 2DT0A 3N17A 1G01A 3WBEA 5KEZA 5D8ZA 3WH5A 1QVBA 2FH8A 3GNRA 3W29A 1R87A 2J79A 4AMCA 1VAHA 1ODUA 3WIJA 3ZT6A 2VX4A 3RPMA 1H2JA 2WCAA 3NSXA 5I3DA 3T0DA 3VGDA 4JFWA 3PHAA 4XX6A 4F9DA 2XYLA 2WWCA 4UZSA 1E73M 2FH6A 4W7UA 4W86A 1W9XA 3CUJA 2JE8A 5I79A 3A6OA 4AZ5A 1J11A 3CHDA 2WSPA 3FAXA 3VMNA 4AW7A 4BF7A 2UY5A 3OB8A 1LG1A 4CD8A 3T2PA 3TP4A 3OGSA 4E2OA 1HJXA 2PBGA 3BLPX 3AZTA 1EGZA 1E6QM 1UWTA 1QI2A 2JALA 4A3YA 3RJYA 4CVWA 1CXIA 2VR5A 5JIWA 3WH6A 1KWGA 3M7SA 3M07A 4F9JA 2MANA 3OLDA 4TUFA 3RDKA 3A4XA 3WEMA 4Q7NA 2J7FA 3KE0A 2WKLA 1HKJA 1GNXA 1MYRA 1W1VA 3ARXA 1E15A 4LGXA 1VFMA 4IISA 2WKGA 4H2CA 5A6LA 1FFRA 3IAPA 1D7FA 5I2UA 1JI2A 3CHEA 2WAGA 1FOBA 1R7OA 5BRQA 1CXEA 4GI8A 2AOSA 7CGTA 4MPKA 3ZSTA 1XSIA 1JFHA 4FF5A 3UR8A 1UD8A 1ISWA 1QHZA 2V38A 4CD4A 3N18A 2E8YA 2WXDM 5I6SA 2NT1A 4H8UA 3AMLA 1JYVA 1HKMA 1PPIA 3LPPA 3VGGA 3PZMA 1V0KA 1CGUA 4U3CA 3AYSA 1C3FA 2GSJA 4GKLA 3O9NA 2X09A 3BLKA 2VRKA 1JYXA 1XSJA 5GNYA 1G1YA 3MO4A 3AISA 3WQWA 4W87A 1KGXA 5A69A 1AVAA 5E0CA 4TTUA 3WD2A 4MADA 4ZXOA 1NQ6A 4D1JA 4GINA 5LA0A 1JF6A 4GZJA 3K4AA 4PTMA 3ZJKA 4LYQA 2FGZA 2X0YA 3MSDA 1E40A 2DSUA 3DYOA 3VDAA 1V6XA 1DEDA 1GZJA 1V6WA 1PEZA 2WANA 2WVSA 3K8KA 1KXTA 5DMYA 1NOFA 4PMYA 3WBAA 3T08A 1KR1A 3G6LA 3MV01 2VC9A 1DWFM 1SMDA 4HU0A 1H3GA 2F61A 4X0VA 4H7VA 2WMJA 1LL7A 1FP8A 5CZKA 5GQBA 2OYLA 2YA0A 2CNCA 1K6AA 3VX0A 1JI1A 1B3WA 2YDQA 4KH2A 5FL1A 3GXDA 2B31A 3SUWA 4EANA 5HPCA 1EA9C 1K9TA 3RMEA 2EXOA 1HF6A 1JF5A 4M24A 2ZE0A 2XIIA 1VJZA 4V28A 3CUHA 1LWJA 1D3CA 1E4NA 3VO0A 1DTUA 1GOWA 2BY3A 4AD1A 2XM1A 1JZ5A 4M1RA 2A3AA 1HNYA 5M03A 3T2QA 5BXSA 2GVYA 1L0PA 4JFSA 2VOTA 4HA1A 1WO2A 1X6NA 4BQ5A 1CENA 1E5NA 2FHCA 3VMPA 3W81A 4AD5A 1QW8A 3W0KA 1RD6A 2X05A 3WY1A 2XJ7A 3WUBA 3WD0A 1FH8A 3THCA 3WDQA 1CNVA 1BGGA 4PTVA 2Y8VA 2J74A 3II1A 1B3YA 1MW1A 4PN2A 3F5JA 1W3HA 3W38A 3AZSA 5ABFA 3MMDA 4OIFA 1UR4A 4AXNA 1UKOA 3MS8A 4HZ8A 3WQ6A 3CZEA 1EQCA 1PBGA 4WSKA 3OZOA 5D9PA 4GI6A 4H8HA 5CPQA 1ISZA 2XM2A 3AIEA 5BROA 1VFOA 1G94A 4NZCA 1XD1A 3CMGA 1EXPA 1CGXA 3WSUA 3TONA 1UUQA 1OGGA 2Q8XA 1DWHM 4GO9A 3TTQA 1J0YA 2JEPA 3PBGA 2YL9A 2D22A 1U30A 4HU8A 3A47A 3WNMA 2O9TA 4CD6A 1GQJA 4XZWA 3T0AA 1OM0A 1BGAA 1CDGA 3WUFA 3RO8A 3GH5A 1US3A 5A6MA 1OSEA 1UR9A 3NSMA 3KZSA 3WH9A 1KXHA 4ATLA 5CGMA 3CHCA 1M04A 2NT0A 2PWEA 5A2BA 1W3JA 3IANA 5LYRA 1I1WA 1H4PA 3M6DA 2W66A 2J8FA 1HN1A 1QNSA 1NWRA 3QOKA 1WDPA 1V3KA 4D6JA 3L4WA 3SIMA 3WF2A 2XUCA 4PTXA 3AIQA 1XRVA 5FOOA 4JL1A 4W5ZA 3AS0A 3PN8A 1CPUA 2O9OA 4DWSD 1IT0A 1CLVA 3KL0A 2CEQA 1F4AA 4WKAA 2BNJA 1OGSA 3RIKA 1BVZA 4UQEA 2IXUA 1H41A 1CBGA 3PZGA 5AYIA 2VI0A 1BHGA 2ZX8A 1V0NA 1YQ2A 5D8WA 4L4PA 1EDGA 3ARSA 1TA3A 5I24A 1UR2A 3ARPA 2WHLA 4JFVA 4FMVA 1EO5A 4D6EA 3BCDA 4AY1A 3L2LA 1FA2A 4OOZA 1LQ0A 2CBIA 5JIPA 2BXZA 3CUFA 4U5IA 4FLOA 1LG2A 2Z1KA 4WLCA 4PTWA 2PWFA 3POHA 3WDRA 3ZO9A 4F8XA 1TFVA 1AQ0A 1UKSA 3M46A 2ZOXA 3WH7A 2JEQA 3MUIA 3OG2A 3WUGA 3MMWA 2ZXQA 1E5JA 2J7DA 4NI3A 4OBRA 4MB4A 4ZXLA 3RM4A 4MJ4A 4EE9A 1UQYA 3CUGA 4U31A 1ESWA 1MQQA 4L4OA 4P7LA 3ARRA 3OGVA 4NSBA 1XCXA 1GOIA 2E9MA 2D2OA 1H1NA 1TR1A 5IXEA 4AWEA 4PMOA 3KEHA 1QI4A 4P7QA 2CXGA 4CVUA 4X0NA 1UZ1A 3AHZA 1V6YA 2NW0A 3ZM8A 4D6DA 1MQPA 1J0KA 3LPOA 4PMDA 1CGVA 1OCQA 2X8RA 1K9DA 4E8DA 4ATDA 5E6ZA 4TVCA 1DP0A 3WEOA 4XB3A 1W1TA 4QAWA 1UKTA 1WP6A 1OWQA 2YJQA 1XV8A 4J3SA 4MNKA 1ODZA 1NH6A
chains in the Genus database with same CATH superfamily
1TX0A 3MSRA 4J27A 1VCFA 2YB4A 1EBHA 4AWTA 4HPJA 1OYAA 4DBEA 4XTDA 3RFAA 3SCQA 3TN4A 1A0CA 1X96A 4KCUA 3EWBX 3WG6A 1IF2A 5A8QA 4XD6A 2XFFA 3USZA 4ZEPA 5DFAA 3FGCA 3K30A 2PWGA 5FACA 4I9JA 1TTQA 1K6WA 1UD2A 3QHMA 2WCGA 3A5VA 1DV7A 3WF0A 1WDSA 5MKGA 4HJWA 3F4WA 3U2ZA 4NG3A 3WNPA 1DBTA 4ZB5A 4H9VA 3VD5A 4LSBA 5AHEA 4GCAA 5F2IA 4DB7A 5C70A 1VFUA 2XIOA 2D2GA 3KXQA 1A80A 1JPMA 2VGIA 1XYBA 4ZO8A 5EL1A 3MMTA 5A6KA 4GISA 4KESA 4LANA 2ZDRA 4LY4A 3GNDA 2C8NA 3T0TA 4KIRA 2ZX7A 3OZMA 1KM5A 2A2IA 1GGOA 1QHOA 1V03A 3WDPP 4UCGA 4M56A 4RKAA 1Z32X 3GXNA 3TN6A 4B90A 1PKLA 5KZ6A 1QK0A 4EKJA 1EOKA 3DEQA 3LNMA 2BHUA 3BLDA 3GVQA 4TU1A 4I5UA 1BXNA 1Q8JA 5ABHA 4S3JA 4NASA 2R91A 1UH3A 4JFUA 1MZHA 2FTPA 1TTJA 3PBMA 1HJUA 3NZPA 4D6IA 4GZEA 3STGA 1XLCA 2W67A 4L1GA 2D73A 4DYJA 3GM8A 2PAJA 2CFFA 6TIMA 1ZBVA 5CC3A 4MUZA 3OLGA 3UWQA 5B7ZA 1R8LA 1ADSA 4IWWA 3U5YA 1OIMA 2DW6A 5FF3A 4D71A 3VKBA 1B3ZA 4P8UA 1HVXA 4KPLA 2D2JA 1WOAA 3QY8A 1DJIA 4OECA 1PZ2A 1XLEA 1XX1A 2R9RA 2X2GA 3W26A 4A8LA 1F76A 2WZTA 4IPNB 2YCIX 3FYOA 5CBJA 2XIBA 3O05A 2R82A 3IGHX 4HPHA 2WSQA 2PDCA 4Y9AA 1F3XA 3POCA 4YHEA 2INFA 3PPHA 3T78A 1WXYA 3T42A 4QNEA 3MVTA 3UBPC 3W7JA 4DJFD 1Q7QA 1JD7A 2JF7A 2V5BA 1DIOA 3WJXA 5HQMA 2VGFA 3DDMA 5G4HC 3ZR6A 4ZGYA 4W4QA 1NFPA 3M4HA 5C5YA 4MWAC 3ARYA 1V3JA 4W8LA 3C2YA 4LB4A 3G1YA 3P7YA 1J4EA 1VEMA 2XN0A 1JQVA 4BJHA 4Q4QA 3HV8A 3BOLA 3F1QA 1OX6A 4PB3A 3WN6A 2VNCA 1TQJA 2V3DA 1KFCA 3WDIA 2ATMA 1JPIA 2VDHA 4P8VA 2YL6A 2XGBA 1X6UA 1LYXA 1CEOA 3AXHA 2CYGA 2PDNA 1SO3A 1U1UA 3BCFA 3LDVA 3ATZA 1DIEA 2ZUMA 4B16A 3MKKA 1XC6A 3IIPA 4N42A 1IXQA 1LBMA 1VYRA 3QQ1A 2O92A 3EXTA 3MUXA 4S3DA 5JUVA 2FMNA 3DHFA 4NXSA 4B5WA 3G1RA 3GY1A 1D8CA 3RM8A 1M6JA 4JQ4A 1FDYA 2AQVA 1EHAA 4GWEA 1OBAA 3NM1A 3QZ6A 1D7KA 3BPWA 4Z2IA 3TYEA 1A3XA 4GYPA 4CLMA 1OIFA 3CK5A 3N25A 1V7YA 3URBA 4AYSA 1IXNA 4Q8NA 1TPH1 4UMAA 3GE7A 5BXRA 1U5JA 4GIYA 2FZ9A 2F7FA 2PSNA 4JIQA 2XG9A 2QCHA 5IDIA 1AH4A 9RUBA 2YBTA 3BSMA 3V5CA 1W9DM 5AOUA 2EF9A 3SJNA 1EX1A 4P61A 2ZDSA 4KRUA 4IQEA 3W4RA 2R14A 1QO5A 1OB0A 2GJRA 3IJDA 5EBAA 3AXKA 3KTXA 1OYBA 5EFFA 2VT0A 3A4AA 5FL0A 3FJ4A 3ISIX 1QO2A 3LS9A 3ANUA 4Z1BA 2FHBA 1GONA 3WMSA 4WEVX 5ENLA 2PTDA 2VCCA 2ZRUA 3SCUA 4HOXA 4HKPA 4XISA 3QY6A 1OJXA 1W2PA 2HCVA 1FWEC 3U48A 3DXIA 3U7VA 1OC7A 4X9YA 1J9YA 4AC1X 3E2QA 3E0WA 1TIWA 1KFBA 1JULA 5DT5A 1O5KA 3BSGA 4UCFA 1TZ9A 4UFIA 3TLLA 2X2YA 1JNDA 2YCKX 3IVSA 2KZHA 3UR5A 4ZODA 3CPGA 1RQBA 4RNJA 4LOCA 4GRSA 3QV8A 2QF7A 2Y7GA 1TA3B 2F38A 4ZQCA 1JPKA 1OFAA 3GSMA 1SQ7A 2Z6IA 3W25A 2OLHA 3NPVA 5FJUA 1F3WA 1VBUA 1DVJA 3TUUA 1XPGA 2DSVA 3H2FA 4JIPA 3GNPA 3F4VA 4PMXA 4AU0A 2Z2UA 3A9IA 2YZ5A 4BQ4A 4UOJA 1F3TA 2YDRA 3FA3A 1TPDA 1R6WA 5A2AA 1Y5VA 3T40A 2UY3A 1UOZA 2RKXA 4B5VA 3B8TA 1E6PA 3WLRA 4KBXA 3QVQA 4C91A 4HD5A 2J7EA 3GTXA 4WKFA 1HO1A 1UZHA 3LMZA 2PGEA 3THAA 4X61A 3Q2DA 3PPGA 3B3DA 6ALDA 2JBMA 3MHFA 1QRQA 3WLTA 1VLWA 4HPGA 4YL2A 3CZJA 1A47A 4HHPA 4GLEA 1YW1A 4QBXA 4JNZA 1FKWA 3K1GA 5DMNA 3CQJA 1GHSA 4Y9OA 1P7TA 1ZCCA 3MQTA 3WD1A 1AL7A 3ALFA 3LGDA 3TJ4A 2RFGA 1PTDA 3VDGA 4MDPA 5KETA 4DPPA 4N9CA 2R1KA 3LTYA 4E3TA 1RBAA 2E5DA 4AD0A 2F6KA 3QW4B 1L2QA 1ZSXA 1RA0A 5T26A 3R94A 2YR1A 4UTIA 3PSWA 2AKMA 2TAAA 3UG4A 1BWKA 1K8ZA 2TRSA 5G2IA 2EPMX 2F6UA 1PE1A 2FZNA 4I6KA 3V5FA 3CPRA 2DU2A 2Z1BA 4XO7A 2XSBA 5IFTA 4NAEA 3JZUA 2R24A 1VP5A 3SCSA 3AI0A 4ACZA 3QLLA 4UFHA 2NSOA 3DKLA 1EXBA 4W9TA 1ZALA 4WY0A 1U2YA 4GJ1A 4Z1CA 2OT0A 1IWAA 3N6HA 1P6WA 2AQOA 2WJDA 3B03A 4O1DA 1PKNA 3TTSA 4NYUA 1XH1A 4AD2A 4IPIA 4IX2A 3H21A 4LVAA 1Z3NA 1BYAA 3G8RA 4JX4A 1RD5A 1XIEA 1RJPA 3AJ7A 4D6GA 2WMIB 3R12A 4QFUA 5DQPA 1JAKA 2OVLA 2W0UA 4LBRA 4YLWA 4R33A 1NIUA 4UTTA 2VFFA 1L2UA 2W62A 3DCPA 3DI1A 1FXQA 2OEMA 4QRNA 4UQAA 4AVOA 1LJYA 3PFMA 1C7SA 3SADA 3LU2A 4ML4A 2FZBA 3Q58A 1BQCA 3CQ0A 1ICPA 4QS6A 3GTHA 5HXMA 1K9FA 4UOZA 4BCEA 1W1YA 2PLJA 3DIPA 4XZLX 4HQVA 4Z0SA 3TMLA 1PWMA 4CU8A 1E9ZB 4O28A 2GVEA 1MQRA 2P8BA 4EP8C 2WZEA 4X3ZA 3GXTA 4GVIA 4H04A 3HQ1A 3SCRA 2GQAA 4GIAA 1WKYA 2E9BA 1DHKA 1R46A 5EB8A 4UR8A 1ONEA 1YXCA 4POCA 4O16A 2PEVA 3M0LA 3S6DA 1LUCB 5C55A 1Q6EA 1LL4A 1QI0A 1REQB 3HB9A 1E6XM 3O63A 5D37A 4PUMA 3O1NA 2QUTA 4XAPA 1MZRA 1J18A 1I75A 1EEXA 3QPYA 1UCWA 1R86A 1UD6A 4PSPA 5D2WA 1B4EA 4ZOCA 3YPIA 1SFLA 1ISVA 3ERPA 1B3XA 4AIEA 4CN1A 1XKJA 3W85A 3IPWA 4B3KA 2ZUTA 5CEWA 1QWKA 4QR6A 3S9IA 2VKZG 1PL9A 4G56A 3RJXA 5AVNA 3S47A 2OKTA 3NZ1A 4RL3A 2W27A 4AZCA 2F2KA 2VMFA 1CIUA 3F5KA 1O7AA 4M3PA 3R8GA 3UJEA 4J4KA 3WNLA 1G5AA 1MUMA 2DDXA 2BODX 3INPA 2WV8A 3C2OA 4ZE5A 1XR2A 2Q02A 5AYZA 1IT7A 2V82A 3FAWA 3S2JA 3WQ8A 1TPWA 4X60A 3BSHA 1KTCA 1CGWA 4A29A 3KVMA 4IIHA 2NX1A 3TAOA 3GTFA 5DCEA 4C6QA 3WMLA 5IHSA 3BC9A 2J47A 2BTMA 4K1GA 2CLMA 3B4UA 1WZKA 2OT1A 2WNNA 2D2HA 2IQTA 4B5XA 5C7VA 1HJQA 2NUYA 3D3FA 3BAXA 3MCNA 4PYSA 4ZTXA 3TYDA 4DWSC 3ZT5A 4ZENA 1M68A 3UZYA 2BMBA 2DV0A 4C6PA 3HGRA 1K9EA 1V08A 1OQFA 4NNAA 8CGTA 1TIMA 3DECA 3L7RA 1NFGA 2R6OA 3OBEA 3IACA 3S5OA 5CZ0A 3C4UA 2QJHA 3C3UA 3UXKA 1K77A 4R7JA 3BJTA 3WLJA 4AG0A 3L23A 3LHUA 3BJFA 2WKJA 3N9RA 2C71A 1F74A 2FIQA 3VCNA 3WQOA 2O0TA 3OW1A 5CGQA 1J2WA 2ZXDA 4MJMA 3TZFA 1TPVA 5HNUA 3S46A 1VLIA 4K36A 2GDVA 2ZX6A 3K4DA 3NYZA 3TN3A 4M6QA 1Q6LA 4LUSB 3CL6A 1S2CA 1SFJA 3LOTA 5GJPA 3L0GA 4QDMA 4F66A 3L4TA 3N4EA 4QEEA 1CTNA 1VEPA 4PR4A 3WQDA 3G0SA 4RNFA 3LHTA 3L0NA 3B8UA 5L6UA 3GB6A 1KQZA 5EMYA 3TA6A 3MV11 4W7WA 2F2HA 2OQLA 3LUTA 4L9ZA 3BURA 2HSAA 4HYVA 4ALDA 3KVJA 6REQA 3PNZA 3S5ZA 4F79A 3N4FA 3EPOA 4FNUA 4U5KA 2GK1B 1O60A 4MPQA 3HGOA 5D03A 2B7QA 1E72M 5EBUA 3EX6A 5LIWX 1JZ4A 3LN3A 1WKFA 1W3LA 2OX1A 4QSHA 1YYAA 4LS1A 3TX9A 1JL8A 2V5CA 1TWSA 1VZWA 1KRCC 4MYXA 3A12A 2ZZ2A 5T91A 3RXZA 1UWUA 2ISFA 1TUFA 1VEOA 4XUGA 3MUCA 3VDBA 2DZXA 4IMGA 4JKLA 3JZEA 3KOXA 4A22A 4JDYA 1MFVA 3IJ7A 2O56A 2OWCA 5BOFA 4EXAA 3VUPA 2AAMA 1YNQA 1DJXA 5AC6A 5AECA 4DXXA 3PBUA 3W71A 2VOMA 1JZ3A 1CX9A 2VQUA 2PDQA 2Y61A 3CS2A 1YDVA 1XPYA 1QTWA 4C6IA 1E0UA 5A6BD 1GUVA 1HJWA 3V4BA 1IYXA 1S5VA 3QF0A 3L4UA 1S2TA 4N6FA 3AZRA 4DBWA 3A21A 5AC5A 3AROA 4ML9A 5C2XA 3UGVA 4MKSA 1XP3A 4GVHA 2Z28A 2CBUA 3W70A 3EDDA 1R3SA 4ZE4A 5BXPA 3O6YX 1OCJA 3FJNA 1P4CA 2R94A 4EXQA 2DUZA 5CBBA 2VM8A 2ZXBA 4L1WA 3SZ8A 4AZIA 5IM51 1R3YA 4QE4A 4XV0A 3DZ1A 3N2CA 3THDA 3S6OA 1GZGA 1OF8A 2PLCA 2A85A 4PH6A 3CPUA 2NVCA 4IG2B 4X2RA 4O4VA 3H6OA 3OVRA 5DY2A 4O19A 1XRTA 3LM7A 3LHYA 1J79A 1J0ZA 1KV8A 4PMJA 3SO7A 1Q8AA 2RHGA 5KSWA 3VGEA 2PRMA 3G1XA 4E5TA 6A3HA 3W27A 4O0ZA 3VNZA 4J3WA 1W5NA 3VINA 1UBPC 1DE5A 1U5HA 1VQTA 4MAZA 4D72A 3W7PA 3LHZA 1TPFA 1XBVA 4RW3A 2X1SA 2ZA3A 3HFYA 1CT5A 4DJFC 2J78A 1ELSA 1Q6QA 4C6FA 4IZGA 4TVUA 4AC7C 3C52A 3QMTA 3NR0A 4LF2A 2XN2A 4U3AA 1S46A 1CGYA 1EUNA 2HV5A 3C6CA 4XK2A 5I09A 4AWUA 1E71M 5TF0A 3W1QA 3PTDA 1PZ3A 2G8ZA 3GG7A 4FK9A 1JGMA 1EH9A 1W5PA 3S2CA 1F4HA 2XN1A 3BW2A 2ZRYA 3OQEA 5C9XA 2DEPA 2WC4A 2Y88A 3IGXA 1K7XA 1B2YA 1IHIA 1PHQA 1Z9AA 3GXIA 4XKYA 4KEZA 3APYA 4UTHA 3MO7A 4CD5A 3MDUA 4X22A 1TV3A 1EC7A 1S3TC 4UQ9A 2BXYA 1YKWA 4M0XA 2CCRA 3U57A 4UR7A 4ADTA 3XISA 2VD8A 3MW7A 6ENLA 3LLFA 1XIDA 3N9KA 3JW7A 2XWDA 3GX9A 4IFKA 1J6OA 1M9HA 3EA2A 4R7WA 3ZS4A 4XZBA 1ZU8A 2XVPA 3UG3A 1JZ2A 2C18A 1E0VA 4D6CA 3EA1A 2CITA 1GKQA 5A94A 4NUWA 3V5OA 2V2HA 3DFNA 2BGQA 3OIHA 1DWAM 1LBLA 5E9AA 4Y8FA 4J3UA 3ABRA 4DF1A 1QPRA 3KOYA 2BGSA 4P7RA 4RNHA 3DGRA 1V93A 4GPNA 3IJQA 1ZBWA 1IEIA 1E4MM 1HL9A 2CLOA 3SJ3A 1JYWA 2DIJA 4DJDC 3UY7A 2QCGA 4LY8A 4B15A 1ITCA 1XGDA 3H2CA 3QY7A 3FYPA 2ISVA 3BGAA 1VFHA 3PTKA 2MNRA 4CQCA 2ZADA 5I3IA 2GL5A 3I3DA 4AB4A 5CLTA 1ZLPA 4LUYA 4LAKA 1EQPA 4JQAA 4LUTB 3NL3A 1VJIA 3NCOA 1FWAC 5LA1A 3ANVA 1Q85A 1ALDA 1OFOA 3R0DA 3W87A 4OTKA 2G37A 4EPBC 4CQAA 3AJXA 4HOZA 1SYTA 2AGTA 4KFPA 1IGSA 3CHFA 4H8VA 4LTSA 4YHGA 1FP9A 4ADSA 1EP3A 3KBMA 1RVGA 4WGHA 5FF7A 3B97A 2PPGA 4JIEA 1QOPA 2QJJA 3R43A 1QW9A 4J40A 3S1WA 2QJNA 2VL4A 1N8WA 4C1KA 4C7GA 1H09A 4W93A 3XIMA 3SQLA 4L4LA 1ZHAA 4MWAA 2NV1A 3KBWA 3L4VA 4MNJA 2OU4A 3QKEA 5LNUA 4QSFA 1YE6A 1XINA 2C16A 4I7UA 4YTUA 5JBEA 1PX4A 4QNWA 4ZMGA 3PZ9A 1PV8A 1XSKA 4HA4A 3V1PA 3MP5A 5I02A 2BVTA 3VFLA 3H54A 1V6VA 1O94A 3N17A 1OX4B 1FCQA 4FXRA 5D8ZA 3MJMA 4O50A 3GNRA 2FH8A 4B5UA 2QVHA 1KFEA 3ZT6A 1Q6RA 1O12A 1H2JA 3ONBA 4Q4SA 2ZRXA 2H3BA 2XYLA 1E73M 2FH6A 3OTRA 4AZ5A 3CHDA 1AJZA 3FAXA 3E6EA 1TWDA 3LCLA 4GQGA 2BSLA 4A3QA 4RV3A 2C15A 4KERA 3TP4A 4E2OA 4XZNX 3TSDA 4V33A 1GK8A 4LRTA 1QI2A 3PS7A 5KZMA 3R4IA 1EJ7L 1CXIA 4H01A 3WH6A 2GVLA 3M07A 3VA8A 4TUFA 3PAJA 1OFBA 5DCDA 3G18A 4Q6JA 1GNXA 1VKFA 1R2SA 3TNOA 3S42A 1D7FA 3BW4A 3T0CA 1JI2A 1FOBA 1US0A 4YYCA 5D38A 7CGTA 4L6DA 3NQGA 3UR8A 1ISWA 4CD4A 3AXMA 3N18A 3UY8A 5G2HA 4KRZA 1QMLA 3B4YA 3AMLA 3I7RA 4IMAA 1TZZA 3LXCA 4LV4A 4O13A 3KWSA 1PVNA 3LM3A 3O15A 1Q4WA 5T9BG 3ABOA 3VGGA 4LC8A 1CGUA 2ACQA 2YXGA 1LQAA 2VD9A 3O9NA 4XAGA 1O5XA 4L64A 4G9PA 1UB3A 1G1YA 3MO4A 3LGGA 2YPIA 3VE7A 3JVAA 5A69A 1UR3M 4JTKA 1Q7MA 4TTUA 3WD2A 4B4HA 4C6KA 3S1XA 4QXIA 1SZFA 1ITUA 1SFTA 4ZSTA 3QMRA 1YBQB 1JF6A 4GZJA 4LYQA 4MHBA 4UB9A 2DSUA 3S1UA 1V6XA 3NOEA 1X97A 1TX2A 3QMSA 1V6WA 1NQKA 2QR6A 2WANA 2JQXA 2ZVRA 1KXTA 4JYEA 4CQ9A 5DBUA 3WLKX 4PMYA 3B0UX 4GBUA 1IEWA 3T08A 3EPNA 2VC9A 1A5NC 3F2BA 4HU0A 1D3HA 5HK4A 2BGNE 4X0VA 1ZY9A 2WMJA 3CWOX 1OX5A 3TYAA 4JIRA 3UWZA 2YA0A 2CNCA 2YDQA 2LLEA 1XDLA 1WKDA 4EANA 2C19A 3R1ZA 3FLUA 5D2XA 1XYCA 3E3HA 4EPKA 5FEZA 5GJMA 1BD0A 1JF5A 3CQHA 4M24A 4V28A 1E4NA 4LEQA 1AG1O 4LS2A 2XM1A 1RK6A 3GC2A 2A3AA 2XDFA 4QJ4B 3DFSA 1G4TA 2GVYA 3TMQA 2YXXA 4JFSA 4WDXA 2QPXA 3TW9A 3T7VA 1NTHA 1QK2A 4UXDA 2PUZA 4E6MA 3VMPA 1FXPA 3W81A 2OOFA 3W9ZA 4AD5A 3GAYA 1RD6A 4J2PA 1AD1A 2XJ7A 4NL1A 4NP7A 3EGJA 4K7VA 2GQ8A 4FPSA 1FCVA 2CZDA 1PTAA 3RLGA 4Q4RA 4FNQA 2Y8VA 2ONEA 3NQMA 3DFQA 3AZSA 3MMDA 1UR4A 4AXNA 1V77A 2NWRA 3DGBA 2P88A 3UXDA 4CEXC 4WSKA 1P1MA 3OZOA 5D9PA 4GI6A 4J5NA 2ISDA 4IP7A 5CPQA 1LLZA 2GLKA 2XGZA 1HO4A 1PO9A 1UP0A 1VFOA 3UWUA 3EXRA 3CMGA 1EF3A 1CGXA 3NWRA 2Q8XA 1DWHM 3I4KA 5B80A 4ES4A 3CHVA 1U30A 1F8MA 3URAA 4Q8PA 4S38A 1UASA 4QG9A 3SB0A 5E5CA 4UTWA 2GGJA 4AUBA 1GQJA 3T0AA 4HSHA 1CDGA 3LY0A 3WUFA 3CTLA 4S3BA 3NO3A 1US3A 5KITA 1OSEA 3ME3A 5A5WA 5CGMA 3TLQA 3V36A 4CCZA 1I1WA 1V6TA 2W66A 3DHDA 1W17A 5HWMA 2HVOA 2FPVA 3CC1A 4CNTA 1WDPA 4QAIA 4QG6A 4PTXA 5AHMA 2YFNA 4M5PA 3FKKA 1LTDA 3TJIA 1ZP4A 1CPUA 3GZ3A 3PR2A 1CLVA 1OGSA 4DQWA 1BVZA 1MDRA 1RQHA 3PZGA 2PLKA 1M7PA 1V0NA 1G67A 1S5TA 3ARSA 1TA3A 2QUVA 4I8YA 1S2UA 4JEJA 2V5JA 3R0KA 3EEGA 3LCIA 4OOZA 1LQ0A 2CBIA 4GCXA 1FQ0A 3WK0A 3FGCB 3W1LA 1A5BA 3EX4A 4WLCA 3POHA 5G1TA 4F8XA 2RH9A 2ZOXA 1TSIA 4MY9A 4J9JA 2NQ9A 3NPUA 2PDHA 1VBHA 2POTA 4BI7A 1O95A 1XC4A 1SU5A 4U31A 3A3XA 1S2AA 3GWQA 3OGVA 4NSBA 3HQNA 4S3CA 5G1YA 3NAVA 4MFEA 4FHAA 4CVUA 5FSEC 2PCQA 3MJYA 5DX7A 2NW0A 4A6GA 1LOSA 2X8RA 4E8DA 3AUOA 5E6ZA 3TU9A 1I4NA 3I6TA 1DJZA 1W1TA 3E0VA 4QAWA 1O5QA 1HL2A 1C9DA 1XV8A 4J3SA 4MNKA 3PP7A 1V0LA 8XIMA 3W37A 4AEOA 4HIBA 3TQVA 4JFTA 1LWIA 4QP0A 2X7VA 5D4YA 4Z1AA 4U2ZA 7TAAA 1KC7A 3SRKA 4PL1A 5E0KA 1NU5A 1SR9A 3GVRA 4LS0A 4PCPA 1CI1A 4V15A 1GVOA 2PBOA 2DQXA 4Y96A 1R85A 3GKFA 4BA0A 4PL2A 2HMCA 1H50A 3URQA 2PE4A 3CU2A 4MZ8A 3W7GA 2POZA 1KLYA 4UBPC 3LPFA 3S0CA 1C92A 3FN9A 1HKKA 3ITTA 3IS4A 2D23A 1MDLA 1C90A 4BF9A 1OFDA 4DYEA 2J62A 1H0IA 1S38A 3CL7A 1TV4A 1TJ1A 3MHUA 4Q3MA 3NQ2A 4YN5A 2YW3A 1NDVA 3CT2A 5EFDA 1R2TA 1WA3A 2BFGA 4A35A 3EZ4A 2WMIA 1XBXA 3C0QA 3W2JA 3G6MA 1BYCA 3QSTA 1QPNA 1EA0A 1GJWA 5AHLA 4PUKA 4IMCA 5PTDA 2WVTA 3CUIA 5I5RA 3EWDA 3WFLA 4LEFA 5H1WA 3RYSA 3PTMA 1NELA 4R7OA 3F4DA 3WEZA 1JR1A 2R1MA 2FFIA 1A53A 4L6HA 1KFJA 3KWXA 5A8MA 1IR1A 1N55A 3UW6A 4E2DA 2Z1WA 3P5ZA 5J8LA 2IUZA 1GYLA 1LL6A 3ZR5A 1L9WA 5A8OA 4IPLA 3E02A 1ME8A 4NQ1A 3QV9A 3HG2A 1JQXA 2DSKA 3S9ZA 1PTGA 2DT2A 3KOZA 3DBNA 2CETA 2VFEA 1V3IA 3RX3A 3CZKA 2WK2A 3A22A 5AYBA 5HJYA 2XIMA 3NQCA 2PWDA 4MSSA 4WJEA 4MNLA 2SFPA 5DN1A 5AYXA 2QMKA 3DESA 1LUCA 2ZICA 2PWHA 1GQLA 2DGAA 3BZGA 1REQA 3OIXA 5AZ0A 2W61A 4AYGA 4YIWA 3FNDA 3U2EA 2ZTJA 4REQB 4J1OA 3TQKA 4BZYA 8RUCA 1A4MA 1KWKA 1UA3A 5E70A 4G7EB 1JUBA 3GDTA 2FVKA 2HNHA 3MMUA 4Q32A 4C1NA 1E0XA 1LLOA 3PUOA 3A64A 1Q45A 1E6NA 3GBEA 1X98A 1AW5A 4JR5A 1XRFA 3W7MA 2I9EA 2EPLX 3IVTA 4PUDA 3R0UA 3JRKA 1GOXA 4QS5A 2IMRA 3PULA 3VGFA 3BQ5A 1TZ7A 4MWAE 2VZVA 4B92A 2Y1HA 1CXLA 2EHHA 1W91A 1VD6A 1UC4A 3W84A 4HVXA 3KRBA 3U0HA 1EKOA 4JHMA 3DERA 3NGJA 4AZ7A 3WLQA 2OSYA 2E77A 3O07A 3G1DA 1IR2A 1B3OA 3AIVA 4YWIA 2QT3A 3NQVA 5FJRA 2QCFA 3LI1A 4DPQA 2HISA 4MTVA 5HOSA 3VE9A 5T8GA 1EJSC 1HW6A 1Q13A 3HPZA 2YKKA 2D0FA 2KX9A 4JEQA 4AD4A 5HJXA 4UTMA 2JFEX 4QLKA 6XIAA 3RGTA 4JTRA 1PCWA 2FDMA 3EWWA 3BWWA 1JXJA 1OABA 2I16A 3S1GA 4ZCWA 3QTGA 2QMJA 4ZO9A 3ITXA 3L12A 2Y5EA 1F61A 4O17A 4JTJA 1E0TA 1W1PA 1IV8A 4CQ8A 3PPCA 3GYCA 3HQOA 4XSMA 2J7HA 3C61A 3SY8A 5BXTA 3IEBA 2YBVA 4LPCA 4FNTA 5CG7A 3STCA 1XIHA 1Y5XA 2NXHA 3OBAA 1Q6OA 3WL0A 1FCBA 1W2VA 4JQ1A 1JXKA 2ZUVA 4PE8A 3MZNA 2HBXA 1G4SA 1I0DA 3A4JA 2PP0A 2V3GA 4IHCA 3WBYA 3MP4A 2DSWA 1XYMA 1WPCA 2YCEA 3AXIA 3VZYA 3E1F1 1D8WA 1FWDC 1P0BA 3TYBA 1JDAA 4ATWA 1Z44A 2GK1A 2G5WA 5G2WA 3GR4A 2VZTA 3G3DA 4I3GA 4PBEA 1R9ZA 3H24A 2FTWA 3WQGA 1YDOA 4JTGA 3NL6A 3IUDA 3WELA 1IIHA 3UCDA 2PB1A 2PDGA 3DFPA 4GUHA 2PP1A 3H4GA 3NDZA 3O3RA 3IRDA 2EBNA 2GZXA 2QPUA 2DT3A 1MWOA 4DYKA 4JS3A 2BZNA 4K1WA 2CZFA 2GJPA 2P0OA 1F6PA 4KFOA 3TYCA 2ZZ3A 1GCYA 1SGJA 1ITXA 4BY3A 3GDMA 3H7VA 2HDJA 5C8BB 3EX1A 3IAQA 4D6FA 1JGIA 1H63A 3AS2A 5M17A 3K8LA 3MCMA 3PZIA 5F2LA 1S1PA 4G1KA 3VIHA 3G1FA 2ABAA 1KA9F 1R3WA 4NNCA 4IT1A 3GNOA 2Y8UA 4W88A 4YVXA 1ZB5A 4UNIA 1KD0A 3ZOAA 1FDZA 3AHXA 3N1AA 3PB2A 1IIGA 3SN1A 5EA9A 1Q6FA 1WUEA 4UFKA 3UR2A 4GUIA 5CJ5A 4J3VA 4QDWA 2Z25A 1FWWA 2UBPC 2C1GA 2FJKA 4QLLA 2OFJA 1Q4NX 4UQDA 3P84A 1CXFA 3NPWA 3H53A 4B9YA 1V02A 2PU0A 3B9DA 5FIPA 4E8GA 2YW4A 1NM9A 4CQDA 1HUVA 3CGTA 1R2RA 2FGLA 4IJCA 5ECUA 4YU1A 5A95A 4QG8A 1DXIA 3BG3A 1UMYA 2NLIA 4DJDA 3LCHA 4F0SA 2QLYA 4XUYA 1BVNP 3EWUA 2WC3A 3MWAA 2DVUA 3OQ8A 3IVUA 4O1FA 2XINA 5CC5A 1WZAA 2P3ZA 3L66A 1PIFA 1UKPA 2XH4A 5ABTA 3WYZA 2QF8A 3TOPA 2H3DA 4GHRA 4IG2A 3AWNA 5B7YA 4YCOA 3NQ8A 3HMJG 3WK1A 1VBGA 4XD4A 4O15A 2WW5A 2WZHA 1F2JA 3NO1A 1EOMA 3MU7A 2ZZ7A 3CO4A 2GWNA 3PWIA 1H0GA 2BHZA 2FFCA 3E0FA 3D5HA 4GY7A 3L65A 3GTIA 3WX7A 4O53A 4OGZA 3ZSSA 3IIVA 1TMLA 1JIBA 5DEZA 2FZDA 3VAVA 4QJ3B 2AAAA 2PGFA 1CCWB 4CD7A 1IZKA 3NUKA 4J28A 1IXPA 3IWPA 4TOQA 3RAOA 2QCEA 4NRRA 1KFKA 2PRLA 2WSKA 1LWHA 1OFRA 2QV4A 1B1YA 2GVGA 3EOUA 4FF7A 2QDEA 1QNOA 3AMCA 3IRSA 4DWDA 1R0MA 1UR0A 1FHLA 4KGJA 2ZXAA 3L5LA 4HN4A 4YYFA 4H9ZA 1ENUA 4O1AA 1LZOA 4S3GA 5FF4A 2W5FA 2ATSA 1UBSA 4NJGA 2FLIA 1KXVA 1HG3A 2A4AA 1EFZA 2J7GA 2V5DA 2G3JA 1ZUAX 3S2LA 4MJZA 4P7NA 2D3NA 3ENLA 3ARVA 2NZLA 3C0LA 3LXAA 2PF0A 2CESA 3PANA 5JQ9A 2ZRZA 5D04C 2Z1VA 3APGA 2XU2A 2YFOA 2V2CA 2ZTKA 2BHYA 4DNMA 2FB2A 1B57A 1W9VA 3EWZA 3WQPA 2RDUA 1PX8A 3N2XA 2Y7DA 3ITYA 1AJ0A 4ZO7A 3DHUA 1JCXA 3W7NA 5BWFA 1SUXA 2GSHA 1OC6A 1VJSA 1SR0A 3OA5A 1EJVC 4YNGA 3RF9A 1QW7A 4O54A 3KW3A 3EWYA 1TMQA 3UYIA 1VHCA 3PUEA 4MNMA 2J7BA 3EMQA 1H60A 1Z69A 2A3EA 4MB5A 1A5CA 4H4IA 3GIQA 3RLUA 1IT8A 4RPQA 2OSXA 1B90A 3EDJA 2A3HA 5BRBA 1J12A 5TIMA 3VI2A 1JZ6A 1AZ1A 5I0DA 4JICA 1EWDA 1DJNA 5HNNA 4LBUA 2WHKA 3BG9A 4Z1YA 1TTIA 2Z2AA 2QPSA 1B0IA 1UWSA 1HZYA 2YDAA 4QDPA 3LX9A 2F9RA 4F0MA 2VELA 3NIYA 1CW2A 9XIAA 4GQ0A 2OXNA 3VNDA 1EGVA 4DZAA 3C2FA 1C93A 2WPGA 5CSUA 5LXEA 2ODOA 2A6LA 4IP5A 1J01A 4RE3A 2UV8G 1Q5MA 1UWIA 4LUTA 4JTSA 1I0BA 1TPEA 1B9BA 3UCCA 1JJKA 2XVGA 2FVLA 3UWWA 1EYEA 3KL5A 1P0KA 4H1ZA 1IEVA 3DG6A 2ZIDA 2ZUWA 2V3FA 5EMMA 1VS1A 2PC8A 1DQWA 1T96A 1C7TA 2OQYA 4IIBA 4NRSA 1UKQA 2ZCGA 5D2TA 3M5XA 3N12A 5HMDA 1EJRC 3CAWA 3TC7A 2G3FA 2WPBA 1ZS2A 1ZQ5A 4GBDA 3H2NA 4S3FA 3DOPA 5DRCA 3M0ZA 2OODA 4HNTA 1HIZA 2OX4A 4FZIA 3HBLA 3OYXA 2NQJA 1WV2A 2QDGA 3BLOA 3BV4A 3ZVIA 2ZZ1A 3T1GA 3PZOA 3MSGA 4WR3A 1NSJA 1VYSX 4FR6A 3WF3A 3V18A 5EMJA 2X0HA 3R5EA 2QUUA 2JIWA 3KRUA 4WCJA 1OX4A 1QHPA 1XRSA 1EHNA 3F03K 4INFA 1R7AA 2Y85A 4GK8A 5CZTA 3LQGA 3LD5A 6TAAA 2P53A 4LVDA 4AMAA 5BWAA 2CHOA 1PIGA 5IOBA 1NFBA 2DVXA 1MRQA 2DFAA 2R1LA 2W3ZA 4FAMA 1R3QA 3WENA 3TJXA 5F4WA 3W22A 3GR7A 5H6HA 3B8DA 1QR7A 3UGRA 1PDYA 5DANA 3SCOA 4E4UA 2WHJA 5CH9A 1VRDA 3QC3A 4N9DA 3VIOA 3GH7A 3LENA 4Z42C 1I2QA 5HAOA 2VC7A 1H7RA 5JH1A 3ZWTA 3DUGA 2BOEX 2I7GA 3V35A 1E3ZA 3UG5A 2VC6A 4UIOA 2HNEA 1FKXA 2V2DA 1TE1A 2EO7A 5BCAA 1CXHA 3RILA 1TUXA 2ANUA 3EOSA 4PMNA 5AFDA 4GJJA 6CGTA 4GX8A 1RSCA 3KOFA 3OHMB 4S3KA 4IJBA 3CASA 2Y70A 4BQ2A 3VOGA 3B9NA 1T6MA 4C7FA 2NSXA 3HG3A 2FTYA 3VNJA 1GPFA 2AL1A 2V30A 2PDBA 1QNRA 4HTYA 1XLLA 1XICA 2CIPA 2DSZA 4J3XA 4MIMA 4DUWA 3G3MA 1YBQA 2ZRVA 2QKFA 3HMCA 3PBWA 4GUGA 2C79A 4ROPA 3MWCA 5H8PA 4PEEA 4HGXA 3KLKA 2YDSA 1QASA 1K8YA 2VUYA 4PMZA 4K8HA 2OB3A 1JZ8A 5FESA 1RJQA 4S39A 5CC6A 1A5LC 4TV6A 2VR4A 3VIFA 3WZ0E 4P7OA 1JDFA 4B9ZA 1M65A 1O6IA 3AS3A 1BYBA 4HMNA 4MB1A 4XKYB 3C2RA 1UWAA 3PFRA 5D9MA 3UPBA 3MP3A 3OO2A 4JNMA 1U33A 2EQDA 3TV8A 3LGEA 4GJIA 5JVLA 2Q09A 2JKAA 3N15A 4HHHA 3KUMA 2E6AA 1V3MA 1AL8A 3CIWA 5DXXA 4UNKA 4TXEA 2PS2A 1JCMP 1IEXA 3O0KA 1FFQA 2OO0A 1HFBA 3FK4A 4JN7A 1EIXA 3VIJA 2GUBA 1SVDA 5G1MA 5BZAA 3BGGA 4G7FA 3UNTA 1WBHA 2YSWA 3FSTA 4JIHA 4A8RA 1GVYA 1S5NA 1SO5A 1OD0A 2VTFA 4U33A 4W7VA 4Q33A 3PBVA 2G96A 3BMVA 4JHOA 3CXOA 2AKZA 3WNNA 5A6JA 2V69A 1YPFA 1Y0EA 2IKJA 2PP3A 1HXJA 2OOGA 2PGWA 4E3VA 2NV9A 8TIMA 2ZUUA 4H9XA 1NP2A 4XIAA 1QBBA 3LTPA 4IGHA 5XIAA 2WVVB 5ABEA 3VKJA 4OBSA 4WXYA 3BO9A 3LRLA 3UEQA 4WJXA 2HJPA 1NF0A 3KBSA 2WBKA 2X16A 4JN8A 4DO5A 1F8IA 3M1ZA 4ZZ9A 4HZ7A 4HMEA 2Q8LA 2UY2A 2C0HA 4C5YA 4H7CA 2WSYA 3LBMA 5LNSA 1XUZA 4HJFA 3RPTA 1QFEA 4XQ6A 3C86A 3G1HA 5DO8A 1P6CA 1UD4A 2XH2A 4JCLA 3TC6A 3B9EA 3UXIA 3VGBA 1JRBA 1M5WA 2OZ8A 3ABQA 3W72A 2QDDA 4LCSA 2J25A 1OFQA 1I8JA 2CXEA 4NVTA 1GG0A 1ZP3A 3E96A 2VCAA 3MDWA 3SURA 2E4TA 1WQ5A 4NZFA 5A6BA 2G41A 4TX6A 2BOFX 2DH3A 3M0MA 1M7XA 3GH4A 1R5YA 4HP5A 4NILA 2A6NA 4JTAA 4NZ1A 3WLOA 1PKYA 2QGHA 4JTHA 1Z41A 2C7FA 3AFBA 2EKGA 3C56A 5EMKA 3VFCA 2Z2BA 5LXXA 5FKYA 5FEPA 2KAUC 5F4XA 3QZAA 3UESA 2EKCA 3ANYA 2VEGA 7REQB 4NF7A 3VOFA 1H49A 3ZR4A 3PAOA 3KRSA 1HT6A 5A2CA 1W54A 2GGIA 3K46A 3WQCA 3W1UA 3DENA 4Y2WA 1BXCA 3QR0A 1V02E 1EYWA 3ORWA 1E70M 3IJIA 4LCRA 4NX5A 1XJBA 2J7CA 3GNNA 3H70A 4OBTA 4V27A 2WBGA 3ZJ8A 1FWJC 5K2ZA 2IXVA 4XKMA 3VNLA 4U10A 3QXBA 5CSYA 4FLQA 3VTRA 1RVKA 3W6LA 4R34A 1U22A 4M6PA 1WYIA 3T81A 5HUPA 2Q3OA 5EPDA 2C3ZA 1T41A 3TW7A 2YLLA 2EG6A 1OEPA 3W07A 1AZ2A 1EDQA 2RDXA 4WZHA 3V3WA 2DUAA 2ZBTA 4KWOA 3TC3A 3RX4A 1UIPA 1DXFA 4TV5A 1P43A 2RGMA 5DT7A 1AD4A 2VDIA 1ML1A 3S8HA 3VZXA 1GT8A 1QVBA 1AW2A 3W29A 3KLLA 1VAHA 3K2GA 1ODUA 1ZJHA 2VX4A 3RPMA 5FJIA 3VZZA 3QEZA 2PDLA 4R53A 3VGDA 4GI4A 2E67A 1EL3A 2DJLA 2WJEA 3V0SA 5I79A 1J11A 2WSPA 4BF7A 4RPPA 2BLEA 3TSBA 2Z26A 1KBLA 1LG1A 3N6QA 4BEUA 4CD8A 2I56A 5JMUA 2PBGA 3BLPX 3TQPA 2RUSA 2J9XA 4DJEA 1KM1A 5JIWA 1KWGA 1TJRA 4WDTA 3VABA 2A1YA 4IP4A 3RDKA 3UPWA 3VKAA 5HMEA 3WEMA 2C1IA 3OVGA 3S9YA 1XLAA 2XIJA 4LC6A 1I2PA 3B9OA 3ARXA 2E6DA 4GOAA 1VFMA 4O52A 4H2CA 3V0UA 4JX5A 2WAGA 1R7OA 1CXEA 4GI8A 5EMLA 5DY3A 3ZSTA 4QJ5B 4LUJA 3CB3A 4BHYA 2NX9A 2YYTA 1JFHA 4XZ9A 4FF5A 2GWGA 1UD8A 4RV8A 1PB0A 2V38A 4AQLA 3S3GA 5I6SA 2NT1A 3SN4A 1BRLB 4AIBA 2C0AA 3LB0A 5K4XA 1PPIA 2X1TA 1BQGA 4ROQA 3IJ6A 4U3CA 3AYSA 3GXPA 1C3FA 1Q2RA 2VHLA 2GSJA 4HCLA 3BLKA 3BOXA 3T8QA 3LCFA 2VRKA 4M7TA 1JYXA 1B54A 5GNYA 5D32A 3LCGA 3DBPA 1BSLA 3SQSA 3UQNA 4H83A 3GUWA 5ECVA 4EACA 1H1YA 1NQ6A 4GINA 4O0KA 2EPHA 5LA0A 4PTMA 3K4AA 3ZJKA 3GVWA 5FJTA 3DYOA 5AN7A 3RITA 3R11A 5FJPA 1PEZA 1OF6A 4G1NA 2WQDA 3AYVA 3OVQA 3WBAA 5I3KA 4PB5A 4I5RA 4RJEA 1DWFM 1J93A 1SMDA 2YXOA 4GE8A 4REQA 3VNMA 3SY1A 3FCPA 1FP8A 5CZKA 1ZAHA 2NLYA 3BL3A 4G7EA 1A0EA 1JI1A 4KH2A 5DLCA 3KRZA 3GXDA 4DJDD 2B31A 3L67A 4LVBA 5HPCA 3WJYA 1EA9C 3RCMA 4P5UA 3SY5A 3RMEA 1TV7A 2HXTA 1H1ZA 1HF6A 4HCHA 2XIIA 1VJZA 1F6YA 2WJFA 3VO0A 2BY3A 4M1RA 1I2RA 3GFXA 1AW1A 1HNYA 1I2NA 1QOQA 3T2QA 2CLHA 4L65A 3Q45A 3AALA 2QZRA 1QNVA 3QGKC 2P8CA 1CENA 5KMYA 4I7VA 2EAWA 4X9SA 5I3HA 1MSSA 3THCA 5C9UA 4PTVA 3GIPA 1JEZA 2INEA 1SSGA 1OYCA 3VXGA 1W3HA 3OBKA 3W38A 3ICJA 3N4AA 4E0CA 1EX5A 1VC4A 2VEIA 3CZEA 1X1OA 5LGXA 4H8HA 4G6CA 3AIEA 4PCNA 1RR2A 3W75A 1G94A 4TIMA 1A3WA 3WSUA 1ONXA 1U5VA 4OT7A 3TTQA 4N02A 5U7SA 1RV8A 3WLMA 3PY2A 4F0HA 1TQXA 3OEXA 1XLFA 1IWBA 3WNMA 2PDXA 1OM0A 1BGAA 3RO8A 4C5ZA 3KBJA 4JN6A 1XKYA 3M5VA 3STEA 3NSMA 4IFOA 4IOTA 3WH9A 1KXHA 3CHCA 1RXOB 1A5UA 3MTWA 1OK4A 5A2BA 1W3JA 3IANA 5LYRA 4HU3A 2J8FA 1HN1A 4F0LA 1NWRA 1WBJA 2VGGA 3TR9A 3W02A 1V3KA 2H8ZA 4WJ8A 3U6WA 3SIMA 2XUCA 4DF0A 2JGYA 1TB3A 1T0OA 1XIBA 4JL1A 2ZQ0A 3VNKA 3NQ7A 4GG9A 3S2NA 2Z29A 2PD9A 2PDKA 1IT0A 3KL0A 2CEQA 2HQAA 2BNJA 2O4QA 4UQEA 5FAGA 3L0KA 2IXUA 4DIAA 3OPSA 3IGSA 2VI0A 5J5DA 1BHGA 2ZX8A 4HB7A 4R3UA 3GU1A 5D02A 1JRCA 1EDGA 3IV3A 1UR2A 1W1A1 3TQ0A 2D69A 5G4EA 2WHLA 4FMVA 4KEUA 1OG0A 4FSAA 3P6LA 4IIGA 4L4MA 5FI8A 4GGHA 2BXZA 3UZ5A 4U5IA 5FJJA 1XLJA 4KW2A 2PWFA 3UA4A 1DE6A 3WDRA 1R30A 3K4WA 3MZ2A 3UA3A 1X38A 1UKSA 1AQ0A 4HN8A 2JEQA 3MUIA 2OTDA 5AZ1A 3A23A 4UTWC 2HPIA 3OG2A 1DHPA 3WUGA 3ZYZA 5K3VA 3H2AA 1XWYA 4EE9A 3KDNA 1X8FA 4L4OA 3ARRA 2E9MA 1DJQA 3PG9A 5D2YA 5IXEA 2IKHA 3H8AA 4P7QA 2CXGA 1TV5A 2A0NA 3ZM8A 3CV6A 1WDDA 4D6DA 3LPOA 4US5A 3P80A 1OCQA 3VK5A 4YWSA 4ATDA 5LHEA 4FALA 1DP0A 4K3ZA 3H2OA 1S2VA 2EGZA 4N6EA 1DORA 4XB3A 4JTEA 3W3OA 2YJQA 1RHCA 3G77A 1ODZA 1XW8A 3ONCA 2H90A 4K2SA 1E1CB 4CCEA 2Y4SA 1ISXA 4IIDA 3WJSA 1FWRA 2QGYA 4C90A 4DI9A 5DRIA 2E25A 1RQEA 4Q8QA 1O1HA 2PURA 2QULA 2ZA2A 3PNUA 1EPVA 4N7QA 5LIXX 4PZVA 1VIWA 1HKVA 5I03A 1XIFA 3SGUA 5E09A 3N34A 4GYKA 2V8ZA 5BU9A 2FZMA 3VIPA 3LMYA 3T4WA 4JY8A 2EPKX 3DFTA 4CU6A 3SCNA 1XCFA 3U2CA 4RCXA 2Y7EA 5CPMA 3TWBA 1QI5A 2ADAA 4UMCA 1TPB1 4XBJA 3GFYA 4MGGA 3FW6A 7A3HA 4GC4A 4ZB0A 3LTSA 1ZENA 4XTIA 2REQB 4S1FA 1PS9A 4HPXA 3FEMA 2RJGA 3KBVA 2EPOA 1MW0A 5AHNA 2Q71A 4W85A 1R38A 4C6MA 2GOUA 1JFXA 3UXLA 3W86A 2I1OA 1L6FA 2NQ5A 3BGJA 3ZVHB 4C1NB 4F4RA 3K8MA 1FHVA 3WQEA 2FJUB 3VMOA 2CERA 3PZTA 3AO0A 3SEPA 2JGQA 3BTNA 3W1AA 3KVKA 4CNSA 1HTIA 1J10A 3LK6A 4A21A 1MEHA 3U3HA 4XAYA 2VZUA 1DOSA 3E2SA 1TELA 2BY0A 1WUFA 3OYZA 4YJ5A 2HK1A 2PA6A 4W8BA 4L61A 4WSJA 1OHLA 3J7HA 4MLRA 3OA3A 1RLDA 4WRHA 3SUUA 3MUZ1 1C8VA 4R5EA 4UOQA 1I6NA 3NVTA 1GW9A 1YDYA 3P82A 3OZYA 3OODA 1TRDA 4UTJA 5K4ZA 3W2UA 3T6CA 3KX6A 5EGRA 4DM1A 4JD4A 3QV6A 3E2VA 2BBFA 4G5DA 1M3UA 1ZJIA 4GUFA 2VVSA 1XH2A 4NXKA 1LOQA 1J0JA 4LXFA 3QPEA 1XLHA 3VOIA 3NQFA 1XLGA 3ID7A 1DKWA 4MVAA 4QROA 2NXGA 4OFCA 4UUIA 2J66A 2OWXA 2A5HA 3AIBA 3E2RA 3NTYA 3F2CA 3P67A 1W1B1 2Y24A 3WNOA 4H41A 4B3LA 4DZ5A 4QLJA 3CEUA 2NQZA 4KCWA 3HM7A 1M01A 4BFAA 1XLBA 2Z1SA 4WX2A 4F2TA 3NOYA 4ICCX 5AYYA 3GRIA 1ZBCA 4HMDA 4D2JA 3CUXA 3MA8A 1XYZA 4QM1A 4ERAA 3D47A 1B5TA 3SUVA 5MHBA 3QOMA 3N04A 1A3HA 5C2GA 4TR9A 4CU7A 3GKAA 2TSYA 4OZOA 3N11A 2F84A 3B8SA 1H51A 5CJNA 1PUDA 3PZUA 4M82A 2VZOA 3BZJA 2P10A 4C6NA 4QE1A 3IV8A 5KZDA 3VIKA 1JAEA 5GNXA 2G3NA 1KGUA 2G4FA 1NF7A 4KETA 4DO6A 3AYTA 2PI6A 4HK7A 4AX7A 2IPGA 1ADDA 4PGLA 7PTDA 1DWJM 2QHAA 1LCOA 3QFWA 4IJRA 1XYLA 4LCQA 4AXKA 2L5HA 3U5UA 4CN6A 4UTFA 3B0VC 1K4HA 3FS2A 4TO8A 5HBFA 4DY1A 3SRHA 1JZ7A 4FI4A 2O55A 1GPWA 3BCJA 3CZ8A 4LAMA 3QR1A 3MUY1 2V68A 3N73A 1UR8A 1UWRA 1OD8A 4ORMA 3W7LA 1ICQA 1ZTVA 3CLWA 3TOYA 1SZRA 4ZTYA 1FY6A 4Q8TA 2VRQA 2VCBA 3ARQA 5D30A 3QBUA 3O0FA 3PB0A 4HMCA 2VC5A 1FH9A 5EKYA 3QC0A 5HPOA 3NXFA 2WHMA 3LHWA 5C54A 3NPXA 1TYGA 1POJA 1WXJA 4O12A 5LIUX 5AKQA 3UT0A 2A3BA 4A4AA 4IICA 3W7HA 1F5ZA 3BVJA 3KS6A 2O9RA 4MFDA 4QCFA 1NWSA 3RR1A 1TRIA 1U83A 3ZIZA 2H8XA 3GC4A 2AL2B 2BV9A 2DZSA 3EOEA 2BG5A 1ZNNA 4K37A 3THUA 1BYDA 4WD0A 4ORIA 1ZGDA 3LI0A 3AMGA 2QS8A 1MUCA 1NDWA 2IPFA 1Q6CA 3TR2A 1ZAIA 3STPA 1Z48A 3BAKA 2I5IA 2HK0A 4MOZA 2XVLA 4PRWA 1BWVA 3L2MA 1SSDA 2CLLA 3WO8A 4JKKA 1LF1A 3URNA 3S1VA 4NT0A 3WMBA 3T09A 1O66A 4BI6A 1UP2A 1RCQA 3E0LA 3M7WA 3DG7A 1JPDX 3FYYA 1OZMA 5HMFA 4MAVA 3F4NA 4C6EA 5FCZA 2BS9A 1KQYA 1ZJAA 3W7QA 3KCLA 3OU8A 1M03A 3QW3A 4O8RA 3EKGA 3M64A 1K8XA 1G69A 2CKRA 2E5BA 4HOWA 5XIMA 6PTDA 4M29A 2R1NA 2W79A 4QHRA 1ONRA 3QSRA 4XAFA 4IGMA 4WSHA 3QYSA 4TMCA 2C13A 2Q01A 1TKKA 2QCCA 1OY0A 1EP1A 1XLKA 1PJ9A 2A3CA 1ECEA 5REQB 4GYFA 4DAIA 3VKKA 2VX7A 4ZOEA 3TVAA 3TNBA 2JK2A 3GU9A 3RPDA 1EC8A 3BMWA 4MZYA 4XWUA 2PWVA 4PB4A 2W6RA 4YTRA 4CUCA 4PMRA 3NXLA 3CV7A 4L6OA 5TD4A 4N2YA 2D24A 1JDDA 3M0XA 1QPKA 2E0PA 2UZ9A 1GYMA 1FRBA 3UJSA 3UD6A 4EPEC 3VU2A 4V1YA 3B0XA 1K8CA 1TVPA 1M1BA 4LAZA 5I78A 2ZE3A 3NJ3A 1W1IE 4NYYA 5LA2A 1AQHA 3CMJA 1GVSA 2VFHA 2FPYA 2Q3RA 3SFWA 3WKZA 3NZRA 4IL2A 2XPKA 1H5YA 3PBYA 1XXXA 3M5ZA 3W83A 1THFD 1TWIA 2EEXA 1BKHA 3D6NA 4PUJA 4QE5A 3U8GA 1KM2A 1KBJA 1S3HA 4OUIA 1EF2A 4ZO6A 1I60A 2HS8A 2J27A 4AZGA 5IHRA 5CBIA 1HX0A 3W82A 4O4WA 4NJHA 2J75A 8A3HA 3G0XA 3MVIA 3BH4A 1RP8A 1R3TA 1NWUA 5IBXC 1H7XA 2AQWA 4QQUA 1X6LA 2DZBA 4OV9A 1T8XA 1MXGA 1QNQA 2VJXA 4DJED 3SCVA 2DPEA 2XH0A 1XQLA 3H2EA 1S2WA 5GNZA 1D9EA 2HVNA 3GR8A 1KNWA 1W0MA 2XHYA 3W73A 4AHQA 1RPKA 4D6HA 3S83A 3DC8A 5D9OA 2BVDA 4HYWA 4GACA 3MKVA 2EG8A 2CLIA 3SCWA 2MUCA 3MYPA 4FOKA 3ITCA 1S5MA 4RZ6A 2XZ9A 3M41A 5C9ZA 1W5MA 2QJIA 1JDCA 1TV8A 3UYCA 4L9XA 3PZNA 1RCXB 1KKRA 3BICA 4G8TA 1BG9A 1UUMA 1XGZA 4A8IA 4JTIA 4DBSA 2P50A 3CV2A 3TIMA 3VC6A 2CLKA 3IJ8A 3H7RA 5EY5A 4WGXA 4GIRA 2XGIA 1EEPA 5IRPA 3VGHA 4EOUA 3PPFA 4JHZA 1I1XA 2WVVA 3TCSA 2B7NA 2FB3A 3FHQA 3DH7A 4BS0A 1BTMA 1VH7A 4M6VA 3IGUA 1GVEA 3N9SA 3GW3A 3UG8A 1PCKA 3GXMA 4C7DA 2B7PA 4IPPA 2J88A 1S39A 4M8UA 3LPGA 1UZDA 2PDPA 1RAKA 3GDRA 2QJGA 5BMWA 1V79A 3Q37A 3G22A 2E1WA 1X1ZA 1FWCC 3JR2A 1LP6A 2V0TA 1L6GA 3VPLA 1VBJA 3ECQA 2CBVA 2YBUA 3VCRA 3HURA 1YXDA 3LZ5A 1XS2A 4GXWA 4JTCA 2ZYFA 5A8NA 4RDVA 1FCUA 1OINA 4AY8A 2GYIA 2VEKA 2WMKA 1UA7A 4DUVA 3G1VA 2HE5A 3NNTA 4XIMA 3P8IA 4CGTA 2I5GA 3WMCA 3ZT7A 4GZIA 4GNVA 5M3WA 1MO0A 4J3TA 4RE2A 1J5SA 3W1XA 3BQ6A 5I77A 4MZ1A 3SSJA 4HZMA 4MJ2A 1NDYA 1LRTA 3CBWA 4OHQA 3RCNA 7REQA 3WQ5A 4L1XA 2D20A 5CSRA 2BY2A 3OZPA 1IE7C 4EXBA 4GGBA 4JZ5A 3FXYA 1CZ1A 4YTTA 2BY1A 4IFRA 5I00A 1GKRA 4QQ3A 4GI9A 5FF2A 1DYSA 4H9YA 1JUKA 9CGTA 3VILA 1W32A 4MUPA 3RLVA 4Q8WA 3W74A 1W3TA 2HVMA 2Z7GA 1VBRA 2OCZA 4AVNA 4UC5A 1K7FA 4DLFA 3W1TA 3ABZA 1PAMA 3R25A 4HSNA 5C7HA 1U1HA 4UZUA 4P8XA 5E6YA 3W6MA 4H00A 4GVGA 3P2VA 3G2GA 1MFUA 4RNIA 4O8AA 2ZZ5A 1UH2A 4PEKA 1XLIA 3G1AA 3LXBA 5AVHA 1QAPA 5GPRA 3F7JA 2VZSA 4PCSA 1W3NA 4Z2LA 4XZMX 2ZUSA 2WNWA 1GEHA 4UTUA 1AK5A 1ADOA 3NZQA 4EAYA 2G95A 4KGLA 1E43A 3C2VA 5DMMA 3W76A 2Z24A 5GJNA 4HT3A 2QV5A 1ZRQA 5JBDA 4HBKA 4GXPA 3TSMA 3ABXA 4IIEA 1E1FA 3NGFA 4ZB2A 3BLFA 4OQVA 1EGMA 4DZHA 4N0RA 3WK3A 1TVLA 3RNDA 2YYUA 1X8CA 3FDGA 1L6SA 5AC8A 4EPDC 5K9XA 4C6CA 3C0JA 1ZJBA 3AHYA 3GQYA 4HNVA 3R2GA 4H2HA 3JU2A 3LSCA 2X41A 3VX1A 1VIZA 3LEPA 1WE5A 3WFZA 4AY7A 2XVNA 3P81A 3TN5A 1UYQA 3CM4A 3NZGA 1EIBA 1YE4A 1IXOA 4ZOAA 3WD3A 2OYMA 2QJMA 4Z2JA 4OKDA 2DH2A 1WDRA 1ISYA 3GW0A 4KRTA 3AYRA 1T99A 2WLYA 3AIRA 4PFHA 4AD3A 1C8XA 2ZZ6A 3FJ6A 5C9RA 3B8WA 5AB3A 2D0GA 3WLLA 3SGZA 2DIKA 4ASTA 3GG8A 3IUHA 3D46A 1C8YA 1FH7A 4L7ZA 3O16A 3UXAA 1BRLA 1Y8BA 2J6XA 3BG5A 3DYMA 2XTKA 4Q4OA 4WOZA 3PSVA 1E56A 1E9IA 2XH7A 4H7ZA 1AQMA 3ZMRA 3O6AA 4HNCA 5CZJA 3UP8A 4US5D 1W9PA 3R6IA 3LSBA 2NQHA 4CKQA 3LBOA 3FY1A 5I23A 3P93A 1EPXA 4AH7A 2PDWA 3HU7A 4XG1A 3O8AA 1P1XA 1JCTA 1GTHA 3MBFA 3PJXA 5LNWA 4PBGA 4LRSA 4H9UA 2UWFA 2XVKA 1QDSA 3HGSA 4NJKA 4C6JA 4C65A 1K03A 5DCBA 1DQUA 1OVDA 1KB3A 3VIGA 3FJLA 4FNPA 3WF1A 3W24A 3KP1A 1A5SA 1J5TA 3M0YA 4PA8A 2WJZA 1TPC1 4AHPA 3KCOA 3CMFA 2CWNA 5FD0A 4S23A 1GQIA 1W3IA 1XL9A 2OSWA 1RA5A 1OFEA 4AEEA 3VC5A 4F3HA 5H2ZA 3PTQA 1EC9A 4LX4A 4HNLA 1TG7A 2E1DA 5A3HA 1EB3A 4E4PA 5BU6A 3B40A 2YB1A 3CH0A 4Z0JA 1RPXA 3B06A 5FAJA 1SMAA 4FS9A 3SECA 4DUOA 3WJWA 3L9CA 3GZAA 1E4LA 1GYNA 4KEVA 3QGAC 3GUGA 2DVTA 3RU8X 1OT1A 2Y62A 1VFLA 2V9DA 2DP3A 5D09A