4ATDA

Crystal structure of native raucaffricine glucosidase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
501
structure length
469
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAUCAFFRICINE-O-BETA-D-GLUCOSIDASE
publication title High Speed X-Ray Analysis of Plant Enzymes at Room Temperature
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 182
structure length 469
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2012-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4atdA00
1CXKA 1PEZA 3NDYA 1VEMA 1E55A 5C70A 3L4ZA 2DH3A 3A6OA 3SCUA 3VDCA 3ALFA 2RGMA 1BPLB 1Q6FA 4PMRA 4UFLA 4CD8A 3N13A 3SURA 4DWSA 4PEEA 4TTGA 2D3LA 3OZOA 3RIKA 3VNZA 1V02A 3VIMA 1CECA 1UWRA 2D23A 1H1NA 3OLGA 3L4UA 4CGTA 4ZXLA 3I3BA 1W91A 2XG9A 1V3KA 4GIAA 3L4XA 1C3FA 3WDRA 3FHQA 3KL0A 3VUPA 3ECQA 1FP8A 2EPKX 3BMWA 1XYFA 2WWDA 1V3MA 1R87A 1WB0A 1HJSA 4BQ3A 4D6IA 1KBKA 2O92A 4QLLA 1KXHA 4W8LA 2YKKA 1M04A 3G6LA 5D9OA 3AZRA 4J3WA 5GNYA 3WMBA 1JZ5A 2YL6A 1WAWA 4TX8A 4BS0A 4MB4A 4HA4A 2EBNA 2OYLA 3A4WA 1V6UA 4FLOA 2WM0A 1MW2A 4YHGA 1KQYA 7CGTA 1OINA 1ISWA 3IJ8A 6A3HA 2GJXA 3WL0A 2J62A 3VIFA 3W25A 3WQWA 1H2JA 3IAPA 3MUIA 2DT2A 4HZ7A 4UZUA 2WXDM 1G01A 3D5HA 1B1YA 4MJ4A 5ECUA 1C8QA 4WSKA 5A6SA 2ZXBA 3GBDA 5HXMA 1V6YA 5D9PA 2EQDA 1JYXA 3K46A 1UD2A 4ZXOA 1MFVA 4P7OA 4Z2JA 1J10A 1QW8A 3AIUA 3F5JA 2EPNA 2V3DA 4DWSB 4LYRA 3ZJ7A 4ATDA 3RPMA 4MDOA 1XD1A 4KRTA 1W3LA 4D1IA 1CBGA 4W86A 3N18A 4QLJA 1E4IA 2V3GA 2ZXAA 2VCCA 4AEFA 4TVUA 4UOZA 5FKYA 4WSJA 1E6XM 2WMIA 3AXHA 3WKZA 1NP0A 2A3HA 3K1DA 4RL3A 5EBAA 1X1NA 2FH8A 4AMCA 2WB5A 4JFWA 3EDEA 1K9EA 2VUYA 3SCPA 4D6FA 1CGUA 2XGIA 3EDFA 1EDQA 4AYSA 1XYZA 5IDIA 3W53A 5BXPA 1BVZA 4AW7A 2BY3A 3WUBA 1J11A 1EHNA 4W88A 3AFBA 2CHNA 1CGVA 4WKFA 1V6WA 1KB3A 4GQQA 4DUWA 5A2CA 2YA0A 1AMYA 3OGRA 2VQTA 5AC5A 3IJ7A 1Z32X 1MYRA 3ALGA 1J18A 3VIJA 1JNEA 1E6ZA 1ODUA 3WUGA 4QLKA 1QBAA 3BAXA 3NYDA 5CPSA 1W3KA 2GJXB 3BSHA 5JIWA 4R27A 3WNKA 1JG9A 4JZ5A 1NQ6A 3GM8A 2IUZA 3IANA 2WCGA 4IM4A 1MW0A 1U30A 1KBBA 3OBAA 3K8KA 4CU7A 2XM1A 4WKAA 2YDRA 3CUFA 4PBGA 3B8SA 4YHEA 2ZX9A 4DUXA 1LL6A 4UOJA 3PZIA 4E8CA 3DC0A 3ZT6A 2WKGA 1BG9A 3PZVA 1X6LA 3ZSSA 1GPFA 1GW1A 8CGTA 2E9MA 5HNNA 4F79A 4M81A 5DT5A 3CIVA 5M5DA 3K4AA 1OGGA 4CN1A 1BYAA 4OJYA 3WH5A 4BQ4A 2WMIB 5ABGA 1XH2A 3VINA 5EFDA 1MWOA 4NSBA 3WIJA 3EYPA 4TVCA 3ARSA 4HZ6A 4XZWA 2YA2A 1Q4NX 1E15A 5IHSA 1OGSA 3OGVA 4CN4A 3CMJA 1K9FA 3VD4A 1JYWA 2WAGA 4HTYA 2GUYA 2E8YA 4AIOA 3GBEA 1NOFA 2PWEA 1GOWA 2DQXA 2PWFA 3T08A 3UG4A 1CXFA 4H2CA 2D22A 2O9PA 1B31A 1XV8A 4QCFA 3MS8A 1LL7A 3WNPA 4UNIA 4EANA 4PTVA 3SCSA 5ABHA 3A3HA 2X0YA 2GDUA 3ARTA 2ZX5A 2V3EA 2YDQA 4W5UA 1QBBA 4JHOA 4GPNA 8A3HA 5KZ6A 3UCQA 2ZUUA 2ZOXA 2J7CA 3WEOA 3QGVA 5CGTA 4BF7A 4GZIA 3CGTA 1E4NA 3VO0A 1NWRA 4W8AA 1QNSA 1H49A 4Z2LA 1UZ1A 2VR5A 1TR1A 4A3HA 3T0DA 2VVSA 3ARXA 3BH4A 2WMFA 4GKLA 3FAXA 1RP8A 4D6GA 2G4FA 4HMEA 2XVLA 4JCMA 4OKDA 3WD0A 3M46A 2EEXA 5A8NA 1AQMA 3QHNA 3L4TA 2OSWA 3O6AA 3WF0A 1A3HA 4HA1A 1GUVA 4AD3A 1XHGA 2ZIDA 2J7BA 3HJEA 5A8OA 2WMHA 4CVWA 1WDQA 4BCEA 2WWCA 3CHDA 4AZBA 3AIVA 4W7WA 4P7QA 2E3ZA 2PWGA 4AXNA 5A69A 1BG4A 2QV4A 1JZ6A 1HJQA 1B3YA 1UR2A 2CPUA 3AJ7A 3ZQ9A 2WVTA 3BMVA 3RJXA 4NI3A 4JAWA 1CYGA 3AHVA 4UFIA 5GNZA 3T2OA 3PZOA 3GXDA 4ATLA 2W91A 3VD5A 5I77A 2WMKA 3CZJA 4P8VA 1H4PA 4PCSA 2V3FA 3JUGA 5IFTA 1W3HA 4M82A 3AS3A 2IXUA 4P7LA 1CIUA 3CUHA 4PTXA 1U2YA 2J4GA 1W2PA 1LG1A 4NRRA 3WELA 5I23A 1EO7A 2JIEA 3F4VA 3L2MA 3GXFA 4WKHA 2J79A 2E40A 2VZSA 3CUIA 4Z2KA 4JKKA 3MANA 2XSAA 3GNPA 4E4PA 2JEPA 3APGA 4B9YA 3UR8A 4HOXA 3K4DA 2BVDA 3WD4A 3WH8A 5BXSA 2ZUSA 2DSUA 4MPKA 1JYNA 3QOKA 1JZ8A 3NSNA 1JD9A 2WLYA 3WH9A 1HJWA 4J3XA 2UY5A 5E0CA 3VM5A 3PN8A 3F5LA 1VBUA 3UEQA 4AIUA 1B2YA 1GQJA 1V3JA 1J12A 3BGAA 1E1EA 1G9HA 3GNOA 3BXWA 2J78A 5TD4A 1WPCA 3WNNA 2C7FA 3VMPA 1EH9A 1ZJBA 2DT0A 5A8PA 4H7VA 1TVPA 5D4YA 2X1IA 2NT0A 4OOZA 3NIYA 3BCFA 5LA1A 1EQCA 4B15A 4F9JA 1LLOA 4JIEA 4EAMA 2VR4A 2DIJA 2QF8A 2DSKA 5HDRA 1DWHM 3WNOA 1TA3B 1E71M 2DH2A 1WO2A 3WD2A 3WDHA 4NZCA 5EFFA 5M17A 1E40A 4MNLA 1L8NA 2YL8A 4UZSA 3M7SA 1DP0A 4L4OA 5D9MA 3J7HA 4KWUA 2JF6A 4PMUA 3PZGA 1C8XA 1UD3A 2VNCA 2J7FA 1O6IA 1UR0A 2YOCA 2W92A 5FOOA 3AIBA 2YBUA 1DWJM 2PC8A 4P8UA 1UA3A 3AHZA 2FHFA 4M1RA 4URIA 1UWSA 4H8HA 4AWEA 3ZIZA 1AQHA 1QI3A 2BXYA 4IPLA 1ZBCA 4D6CA 3E1F1 4W85A 4HA3A 2XSBA 2J77A 4PYSA 1V0LA 2VL4A 3WQ8A 3II1A 2D0FA 1ITXA 4W7VA 2BY2A 2X05A 3CTTA 4AD1A 1EIBA 5A2BA 1W1PA 1WDSA 3AHTA 2A3CA 3WQVA 3DHUA 2UY3A 1C8YA 2O9RA 3RJYA 3CPUA 1CLVA 2FHBA 4A4AA 2VX7A 3EMQA 7A3HA 4C7DA 3N9KA 4LX4A 2ZWYA 1H09A 4UQAA 3O9NA 4ATWA 1ISVA 2ZUNA 1GQIA 1VF8A 1CGXA 4KGJA 4Z2GA 4QCEA 1PPIA 1HN1A 2V5CA 1NM9A 5DEZA 3WF2A 3U5YA 1UKTA 1US2A 3N04A 4CU6A 2J47A 3S6TA 1V6XA 4HMDA 2XPKA 3AMKA 1H0IA 4ML4A 5FD0A 2AMGA 2BY1A 3RILA 5M03A 3NJ3A 4MNJA 4HOWA 2YBTA 3WSUA 5JIPA 5I78A 1GVYA 2J8GA 1E5JA 4S3JA 1ISYA 1K6AA 4FK9A 1XSIA 2BHYA 1QPKA 4UFKA 2X0HA 3UR7A 2VO5A 1UKSA 4P7RA 1JL8A 1EXPA 4PTWA 1OBAA 1GONA 4M56A 4MNKA 5DF0A 3WY1A 3VTRA 1GORA 3POCA 1G5AA 2F61A 3HMCA 2XIIA 1C93A 1X6NA 1H11A 3LPOA 1KR1A 1EQPA 1WNOA 3EDKA 3FW6A 2WYSA 1W9UA 4ZEPA 1HNYA 2G3JA 2WSPA 3WF4A 4PMYA 4XB3A 2V5DA 4WK9A 3WH7A 2ZUMA 2ZE0A 2WPGA 3VX0A 4J3UA 1EDTA 4H04A 3LPGA 5DFAA 4ZE4A 3S2CA 3MSGA 3THCA 3DYOA 1JF6A 1J9YA 1LQ0A 1U33A 1PJ9A 4AD4A 4QDMA 2XIBA 4C7GA 3B9EA 1PZ3A 3BLKA 3AHXA 4ZE5A 1V3HA 1QHOA 2NT1A 1TZ7A 1JDAA 3CHFA 3MMWA 4M29A 4RE4A 4GQRA 1CENA 1WZAA 4N0RA 2WNWA 3VD9A 4DM1A 2VZOA 2OSXA 3CZLA 4W5ZA 3BAYA 4GI9A 3B9DA 3AISA 1KGUA 1E72M 3BSGA 1JNDA 3DHPA 1V3LA 2W61A 4KH2A 4LGXA 1UHVA 1VFUA 2D24A 3ARVA 1KWGA 1D3CA 3VM7A 4H8UA 4PMQA 3AS1A 3RO8A 4M24A 1RH9A 1DWIM 4OOUA 2ZX6A 1VJSA 2VVNA 2VCAA 1ZBKA 3WNMA 2XVPA 4U5IA 3N17A 4TX6A 4YPJA 1ISZA 2G3IA 4XV0A 5A6BD 4EK7A 3GZAA 3PZMA 4PN2A 4U31A 1UH3A 3LPPA 1PX4A 1UQZA 2CKSA 3VNYA 3N15A 3PZTA 1VFOA 3SEPA 4WJXA 2WVUA 3WQ6A 4MAZA 1BYBA 1UZ4A 2FH6A 2BFGA 3SUVA 2RGLA 1UH2A 2Y8KA 3VIGA 2VJXA 3KL3A 5JUVA 1R8LA 1CTNA 1V0KA 5AYBA 3AI0A 4F8XA 2XJ7A 1WE5A 2VX5A 1MQRA 1ODZA 3GNRA 1BQCA 1QI5A 2W63A 1MQPA 3FHAA 3G6MA 5IFPA 1CNVA 2OYMA 2YLAA 1ITCA 5I5RA 1DTUA 5E9AA 5CLWA 4D72A 2WHMA 1B3VA 3IJ9A 2X09A 2YJQA 3W24A 4K68A 2J8FA 5BROA 1P6WA 2E9LA 4Q22A 3PTKA 4OUEA 3VGBA 1R86A 1B30A 3L4WA 2WW5A 3BAJA 3AS2A 3SIMA 5ABEA 1HP5A 3VGFA 5F7UA 5DO8A 1ZL1A 3AROA 4FMVA 5CZKA 4PMDA 3POHA 1E73M 5LA0A 4CD5A 5BYWA 4KGLA 1TMQA 3MKKA 1F4AA 4CD6A 2TAAA 4W87A 1J0KA 4HU8A 2WZEA 1VBRA 1BGAA 2YL5A 2DIEA 3OIHA 3UETA 3WDIA 1QNPA 3WD3A 1JFXA 2DT1A 1KR0A 1IZKA 2NW0A 1QW9A 3FN9A 2WVSA 1GOIA 2CIPA 3UESA 1HKKA 3GH7A 3BLPX 1MXDA 3NUKA 4PTMA 1GOMA 4XX6A 3GYCA 1W9DM 2J25A 3CZEA 3WENA 1UWUA 4WLCA 2WK2A 1L0PA 2PI6A 3MUY1 4U3CA 2JEQA 4D1JA 4PMVA 3ZJ8A 4DWSD 5M3WA 5BWFA 2WZIA 4LYPA 1QI0A 3SCRA 1RP9A 1RPKA 4J3SA 1LWJA 2WMGA 4V28A 5EB8A 2A3AA 2EPLX 1NWSA 1E3ZA 2D1ZA 1CGTA 3W37A 1SYTA 2XGBA 4JHZA 2CKRA 1QNOA 4JFSA 3VKKA 3PZNA 4JL1A 1JZ3A 4HP5A 3L2LA 1MW3A 4N42A 5GNXA 3UG3A 1TUXA 1M01A 1BYDA 5CG0A 3CBWA 5EMYA 1W1YA 4UOQA 2XFRA 3TTSA 2JE8A 2CXGA 3BCDA 4TOQA 4GO8A 2D2OA 1HL9A 2F8QA 1UWTA 2YDSA 2HVMA 3VGGA 4AZ5A 2VT0A 4J28A 5D8WA 2BXZA 1CXHA 3VPLA 4L4PA 2C0HA 3QHOA 2JALA 1E3XA 4U5KA 2VCBA 3ARUA 4GI8A 3AMCA 1LL4A 2JFEX 1IZJA 1QOXA 3B9AA 3SCQA 2W67A 5AYIA 1V0NA 1XRVA 1EDGA 3MMUA 2CBVA 2V38A 6TAAA 2XFYA 1KWKA 2G3MA 4MNMA 4MADA 2OWWA 1HF6A 2JIWA 1HVQA 4AZGA 2CYGA 4UQEA 1AQ0A 2WCSA 2QPUA 2MANA 3ZT7A 5BXRA 1HKMA 2D3NA 4E2OA 2CHOA 2PBOA 1GQKA 2ZX8A 4Z2IA 3WBEA 3AHYA 1HJUA 4WIWA 5CQ1A 1XD0A 2BNJA 4PSRA 1VAHA 2BHZA 3T2PA 1E56A 1J01A 4BZYA 3NDZA 1HKIA 3EMCA 1ESWA 1JDCA 1NH6A 3GTNA 3ZR5A 1TVNA 5IHRA 1XH0A 1CDGA 3U7BA 5HPCA 1FHLA 4U2ZA 4V27A 1BLIA 4AISA 4DUVA 3PZ9A 1OIFA 4LYQA 2Y24A 1TE1A 2VZUA 2B31A 1MQQA 4P7NA 4HOZA 4F9DA 2OWXA 4FLSA 1H3GA 3WF3A 1FH7A 4AD5A 3AXIA 3ZJ6A 3GXMA 3T0AA 3ZOAA 4W7UA 4A3YA 5ABFA 4OIFA 4RE3A 4WF7A 3ARRA 2CCRA 4MJ2A 4UFMA 4D6JA 4UQCA 2CBJA 4CCEA 3OG2A 4H41A 1W9PA 2D20A 4J3VA 4EKJA 4GI6A 3A4AA 3RM9A 2G41A 1VENA 2VX6A 1V3IA 1UWIA 2UY2A 1EA9C 1F4HA 3VD3A 1J0IA 1V0MA 3RM4A 5A6AA 4CU8A 3SUUA 1K9TA 1LWHA 2UY4A 4PSPA 1W9BM 1GNXA 3T2QA 3GDBA 3WQ4A 4GZJA 1SMAA 3FXYA 2VOTA 3WEZA 1V02E 4MB5A 3T09A 3MO4A 3VGDA 1ZB5A 2GJPA 5CJ5A 1KCLA 2YL9A 1GQLA 1XH1A 3WF1A 2VC9A 1NWTA 4JFUA 3U57A 1MW1A 1ZS2A 1B3XA 2EPOA 1VRXA 1B3WA 1C91A 1RD6A 4OBSA 1J0JA 2XM2A 2XWDA 4M8UA 1G94A 3W4RA 4AC1X 3BAWA 1CPUA 1QI2A 1C92A 3ARYA 4AZCA 1MVYA 2CEQA 3UG5A 5KEZA 3SCOA 2OYKA 2CNCA 3CH9A 2VRKA 1JI1A 5CXPA 1OGBA 3PBGA 1G0CA 5LA2A 4B3LA 2AOSA 2YIHA 2BY0A 2XUCA 1R85A 4D71A 4MDPA 2VRJA 1KXQA 1BGGA 3AMLA 1V08A 2Y2WA 1DWFM 1JZ2A 1OIMA 3QHMA 5CGMA 3DYPA 2A3BA 1UR4A 3VMNA 4OZOA 4AEEA 4CVUA 1DWAM 2D0GA 2YLLA 3CHEA 3MV11 2OSYA 1UOKA 3MV01 4IPNB 1H0GA 4UQDA 1C90A 5CSUA 2BV9A 2WHKA 1BVNP 1JD7A 5I3DA 1VJZA 1FFRA 3SCNA 4U3AA 4DM2A 1GZJA 4GINA 1CLXA 1PX3A 4ACZA 4PMXA 2WMJA 2X2YA 2BHUA 1KCKA 1H41A 3N11A 1OM0A 2NSXA 3AMDA 2WHLA 4CKQA 1EO5A 3CZKA 3AIEA 4HU0A 3VIIA 2WHJA 5E6ZA 3T0BA 5CPQA 1PIGA 4XZBA 4P8XA 1GJUA 2ZUVA 3GH5A 1W3JA 1UR8A 2GFTA 3WQ5A 4H8VA 3I3DA 1XCWA 2WKLA 3TTOA 1FFQA 3AICA 5BCAA 1US3A 1FP9A 5A1AA 1XSJA 3WN6A 3W27A 1KFWA 2E8ZA 1Y7VA 1HIZA 3SCVA 4UFHA 4AZCB 2A3EA 2J7EA 4BA0A 2AAAA 4MAVA 4PUEA 3VIKA 4RE2A 1E5NA 2EXOA 3ZJKA 2BVYA 4UR9A 1CEOA 2YA1A 1WZKA 2BS9A 3AIRA 2FGZA 4BQ2A 4AZHA 2W5FA 3L4YA 3L4VA 3MUZ1 5A95A 3HN3A 5CPTA 4OBRA 3SUWA 3W0KA 4EE9A 1HXJA 5BXTA 5CSYA 4UQBA 3W82A 1ZBWA 2XTKA 3RMEA 1SFSA 1XCXA 3ARPA 3FAWA 3WUFA 2DSWA 1ZU8A 3CUGA 2PB1A 3VX1A 1FHDA 5D8ZA 5C71A 1EOMA 1HP4A 2VQUA 1NOUA 1JDDA 4CN6A 1SMDA 3QR3A 2QPSA 1XC6A 5A8MA 3ZM8A 1YQ2A 5DMYA 5LYRA 4W8BA 1VB9A 1UKPA 2ZWZA 2QHAA 3WH6A 4PMNA 3EBVA 4ACZB 1GCYA 3CLWA 1JI2A 1KGXA 3PZQA 1B3ZA 4X9YA 4W93A 4QAWA 3WL1A 2PBGA 4NRSA 3K8LA 3CZGA 3NSXA 2FHCA 2G8ZA 2WC7A 4PMOA 5HBFA 5JBDA 2J74A 1UUQA 3LMYA 1J0YA 1BF2A 4AZ6A 1B9ZA 1TFVA 4GZEA 4ZENA 1GOQA 1BTCA 1V03A 3PTQA 4TUFA 1C7TA 4CCDA 3BAKA 3VGHA 1VFFA 1XSKA 4KRUA 4CUCA 2ZUTA 1Q6GA 2XWEA 1PX8A 3FNDA 3VGEA 2J7HA 1UG6A 1UR1A 3AYRA 4CD4A 2VURA 3AQUA 4B16A 2WSKA 3VILA 3MUAA 3VMOA 3LPFA 3VOCA 1HX0A 2ZXQA 4ACYA 3AYSA 4LQ1A 3CZ8A 1JZ4A 2DSVA 4J3TA 3AZTA 4JL2A 3QOMA 2EJ1A 1WDRA 5CLTA 3WNLA 1NWUA 4GXPA 2G3NA 2C8NA 2Q8XA 3OLIA 5HOSA 1ISXA 3KEHA 1HVXA 3VDBA 4AD2A 1PIFA 1UQYA 1JXKA 2WBGA 2ESCA 1B90A 1FA2A 3ARZA 1CXIA 4NF7A 3GXIA 5AY7A 5E0FA 3CMGA 2Z1KA 3DECA 4XUYA 5E6YA 3MSDA 3AMGA 5FIPA 2HISA 1JGIA 2OWCA 3TTQA 1E6RA 4TXEA 2BVTA 3VIPA 3EMZA 1QNRA 3OB8A 3SCTA 2QMJA 2QMKA 4FF5A 3VIOA 2E4TA 1Q6CA 3OA5A 2VX4A 1E70M 5C8BB 4CD7A 2J7DA 2J75A 1GOKA 3F5KA 9CGTA 3DYMA 3ZR6A 5A6LA 1UA7A 4AZIA 4JFVA 2OLHA 4D6DA 3WUEA 3AIQA 5A8QA 1UD6A 1J0HA 1WP6A 1ZBVA 2EPMX 3AOFA 4HZ8A 2F2HA 4LXFA 5A3HA 1DWGM 2VMFA 1E6NA 1NARA 4X0NA 2CERA 1K9DA 3A4XA 4Q7NA 3W29A 4D6HA 4S3KA 3VVGA 1W1TA 2WVVA 5A94A 3BAIA 5I2UA 5IXEA 4AY1A 3TONA 2Y8VA 3ZSTA 2FGLA 1TCMA 3MMDA 2JF7A 4X0VA 1VEPA 5D9NA 4ZFMA 1UD5A 2ZXDA 5JBFA 1QI4A 1W1VA 1FOBA 1ECEA 2Y5EA 3VIHA 4PCTA 2X8RA 2O9TA 2XVKA 3AS0A 2XFFA 5I24A 5I0DA 1E6SM 1YHTA 4AZ7A 4B3KA 3VDAA 5FL0A 4HPGA 1GHRA 4YN5A 3M6DA 2CBIA 4JKMA 2WBKA 3W26A 2O9OA 1CWYA 2GSJA 1C7SA 1E6QM 3OZPA 5GQBA 2WLZA 2W4XA 1M03A 1E43A 3PTMA 2E0PA 1GJWA 3NSMA 1JYVA 4B9ZA 2DDXA 1VIWA 1UWQA 3N1AA 3O2LA 2PWHA 1OD0A 3MU7A 1CXEA 1NP2A 4GO9A 3TTYA 5FCZA 3W6MA 1E0VA 3CO4A 1TG7A 4UTFA 1WKYA 7TAAA 2EO7A 2CETA 4QFUA 3IK2A 4JKLA 1D7FA 1UD8A 5BRQA 3CUJA 3KE0A 1E4LA 1UH4A 4FLRA 1IT0A 2WZHA 2Y4SA 2QLYA 1JZ7A 1G1YA 1OB0A 4U2YA 4UFJA 5E70A 5HPOA 3ZT5A 2WVVB 4F66A 3W28A 2CESA 1E0WA 1Q6DA 1PAMA 4AD0A 1VEOA 1BAGA 3SUSA 1OD8A 3WDQA 5I79A 1CXLA 2WC3A 4DWSC 4HMCA 1HT6A 6CGTA 3I3EA 1QHPA 4HPHA 1BYCA 3WBAA 1JAEA 3RDKA 3VU2A 3U7VA 1KGWA 3OLEA 1TA3A 1GVIA 4MTVA 1V6VA 1HKJA 2W66A 3VDHA 3TOPA 1CZ1A 3NCOA 1PZ2A 3WDJA 4PMZA 1ZJAA 5I6SA 1KXTA 4J27A 2J7GA 1HJVA 4Z2HA 2WC4A 4JCLA 4AIEA 1E6PA 4D6EA 1OSEA 3W38A 3W81A 1OT2A 4CCCA 1EGZA 1SR0A 3TA9A 4W89A 2GK1A 2FDMA 1DHKA 1HL8A 1AVAA 2ZICA 1Q6EA 4LPCA 4C7FA 2GJRA 1UYQA 1N82A 1WCGA 1XGZA 3GH4A 1QVBA 1JFHA 3SUTA 2ZX7A 2CITA 5DT7A 3A47A 2DT3A 1E4MM 1R7AA 4MB1A 3WFZA 3AZSA 1LJYA 1W9VA 4M80A 1FH8A 3ARQA 1IV8A 3BC9A 3SCWA 1JF5A 3U5UA 3IAQA 1UR9A 3TP4A 2GVYA 3KWXA 4KMQA 1I75A 2GDVA 1WZLA 4J7RA 4W84A 1LF1A 1JXJA 1S46A 5GPRA 2ZUWA 3KL5A 2DGAA 4U33A 4V2XA 3AXXA 1O7AA 2DSZA 1VFMA 3PHAA 1JAKA 4PUDA 1I1XA 3VD7A 3D3AA 3WFLA 1R7OA 1B0IA 1UKQA 3N12A 1E0XA 5A6KA 5E09A 1MXGA 4IISA 1W32A 1LG2A 1EOKA 2W62A 1BSIA 3ZO9A 5A6BA 1QNQA 3WMCA 3PZUA 3FY1A 1A47A 1M53A 1E1FA 2VI0A 5BRPA 2XHYA 1BHGA 2Z1SA 3THDA 4BQ5A 2UWFA 3HU7A 4QP0A 1I1WA 3OGSA 1W9XA 3WEMA 2IXVA 2PWDA 2VZVA 1DEDA 3M07A 1JIBA 4IUGA 3OLDA 1D2KA 5A6MA 2XVGA 2CBUA 2GK1B 5ABFB 4TVDA 3K8MA 1KQZA 1PBGA 1HJXA 4FLQA 1BFNA 4MB3A 4UCFA 5AC4A 1CGWA 1GHSA 1OCQA 2WCAA 1GOOA 3CHCA 1MFUA 1QHZA 3RM8A 2DPEA 1W2VA 5A2AA 5A6JA 3WD1A 5JBEA 1OWQA 2E9BA 3EDJA 4E8DA 5FL1A 4Y7EA 2DEPA 3ZMRA 1UD4A 2XYLA 3RCNA 2VZTA 1UKOA 1E9LA 1M7XA 1KXVA 2D0HA 4R5EA 3W6LA 4TTUA 1CGYA 4UQ9A 2PF0A 1NOWA 2WANA 3KZSA 3WDPP 2VRQA 3AIWA 1OT1A 1WDPA 3ARWA 4JFTA 4P8WA 1EHAA 1H5VA 3UERA 4PRWA 1FH9A 1J0ZA 2XVNA 3WMSA 2VTFA 1WZMA 3EDDA
chains in the Genus database with same CATH superfamily
4RKAA 5C5YA 1OJXA 1E55A 3DFSA 1SU5A 5HMDA 1BPLB 4A8RA 4PBFA 3KBSA 3GVRA 3LI0A 4DWSA 1YADA 4TTGA 2D3LA 3SJNA 3MYPA 1DQUA 2J9YA 2B7NA 1G4TA 2Z0IA 3G1FA 2D23A 3I6RA 2BDQA 3STFA 1V3KA 4KQNA 3WQFA 2QR6A 3FHQA 3ECQA 3BMWA 2Y7EA 3W84A 2WWDA 1WQ5A 1V3MA 2WQDA 3S5OA 3NQ6A 3LS9A 4HNLA 3PR2A 4FO4A 4L1WA 3TUUA 4QLLA 3E12A 4TO8A 4DF0A 2YKKA 1M04A 5B7YA 1ME8A 1GGOA 1QOPA 3HPSA 5D9OA 2FVKA 5DMNA 4KF1A 1FWNA 2AL2A 4BS0A 1SJDA 3G24A 4AWSA 2EBNA 3GTIA 3VNJA 1U5HA 4FLOA 1YXDA 1MW2A 4NZFA 4YHGA 4PL1A 7CGTA 4JTEA 3QW3A 4JTUA 6A3HA 4QHRA 2GJXA 2IMRA 2J62A 3VIFA 1TIWA 3HM7A 1EEXA 1IGSA 4TMBA 3TW7A 1H2JA 2G95A 3WQWA 4V33A 1WAUA 2DT2A 3A3WA 3D5HA 1G01A 1BKSA 2AQVA 1EYWA 3U2ZA 5D9PA 1YMYA 1UD2A 4ZXOA 4Z2JA 3M0ZA 4FZIA 2V3DA 3QV6A 3V18A 4GUGA 5AHMA 3W7PA 2QCDB 1S1PA 3RPMA 4MDOA 2FQIA 4US5D 3BOXA 4GBUA 1CBGA 3N18A 2VCCA 4DBUA 4TVUA 3GU2A 4UOZA 2P76A 2ACRA 1E6XM 2ABBA 3MVTA 4UTMA 2RDWA 2WMIA 5D02A 3WKZA 1UZHA 4GIRA 5EGRA 3PUOA 5C9ZA 1AD1A 3XISA 2WB5A 4JFWA 3SCPA 4D6FA 4QTGA 3IUHA 2XGIA 3VK5A 3EDFA 1T40A 5C9RA 3GC5A 3IS4A 1DVJA 1CT5A 3SRFA 3P2VA 1EUNA 2BY3A 4QSFA 4RZ6A 1J11A 4C1NA 4WKFA 2CHNA 1SZEA 4C6JA 1GTHA 1XLDA 1AMYA 3OGRA 2VQTA 3XIMA 4QXIA 2TYSA 4QNEA 5HAOA 3ALGA 3VIJA 1JNEA 3S1WA 4G1NA 4QLKA 3TC3A 2PZNA 4KWSA 3UG8A 2QDDA 2I1OA 3NQEA 1Q66A 1CX9A 1MW0A 1Z9AA 1KBBA 2RJHA 4MZ1A 2D2HA 3K8KA 3NZ1A 4XD5A 2XM1A 4WKAA 1DIDA 1IF2A 4ZB0A 4NP7A 4LAUA 1LL6A 4UOJA 3TAOA 4QNWA 3IGSA 4UTTA 1R5YA 1FDZA 4G6CA 1QU4A 4HK5A 3LBCA 1FHVA 1KM1A 4M81A 4K6AA 5DT5A 1LQAA 1IIHA 4HNOA 3EB4A 2NZLA 4H19A 3SGZA 4JNYA 5ABGA 1XH2A 4UR7A 5EFDA 3B04A 3THUA 1SPQA 2OQYA 4HCHA 2YA2A 1DKWA 2QGYA 3TJLA 1OX4B 2DORA 4H6RA 3N19B 4CN4A 3G1DA 2VKZG 3SM0A 4C65A 2PWEA 4IP5A 4Q4KA 3R7MA 5PTDA 3UG4A 2V5JA 2DIKA 2WJZA 3UW6A 4QCFA 3GVWA 4FOKA 1WKFA 4LS2A 5J5RA 4UNIA 4EANA 1N55A 3VE9A 4IIGA 3IGHX 2GDUA 2I56A 1I6NA 1QBBA 8A3HA 1VS1A 2Z2UA 3UCQA 1X1ZA 2ZUUA 1YE6A 2AGTA 1LM1A 3L0GA 2XINA 2QIIA 5CBBA 1E4NA 4L9XA 1NWRA 1O5XA 1ICQA 4QBXA 5BMXA 3NPVA 2VC7A 5BWAA 3T0DA 4N6FA 1GQNA 4GKLA 1LOQA 4D6GA 2G4FA 4HMEA 5MHBA 1LRNA 1JCLA 1KTNA 2EEXA 4KIEA 1F9CA 4PULA 3O6AA 3B4UA 4AD3A 3E96A 1AL7A 2J7BA 4JIRA 3K1GA 1EL3A 3MTWA 2G5WA 3M0HA 3MJMA 2V0TA 1FWGC 2VYOA 1OQFA 4DI8A 2GL5A 4AZBA 1AW5A 2V2CA 4LU0A 2E3ZA 4A3RA 1K7FA 2XH2A 4RK8A 1JZ6A 2GYIA 5A5WA 3H24A 5EY5A 3BMVA 2QKFA 3RJXA 1DBTA 3W7EA 2PDGA 4UFIA 2CZ5A 4DJFC 4FEZA 5I77A 4KFPA 1HW6A 1SJAA 1H4PA 4PCSA 3JUGA 4EXAA 4KW2A 3ITVA 4M82A 4NVTA 2NV9A 4P7LA 1JPKA 1CIUA 2P53A 4LBRA 4CQAA 3VUSA 1OADA 2J4GA 4GRSA 2IQTA 4NRRA 4LFYA 5I23A 2VEGA 3B8UA 4RE0A 2JIEA 1EWEA 2MNRA 3F4VA 3L2MA 2J79A 3FGCB 3UYIA 1TJ2A 4ZB2A 4JKKA 3KBJA 3MANA 1OHLA 3ITGA 4MJZA 3UR8A 4HOXA 3S4TA 4DVOA 1DPMA 4ZTYA 2B4GA 2X7VA 5BXSA 2DSUA 3QOKA 3NSNA 2BGNE 1JD9A 2WLYA 3WH9A 4EF8A 3F4WA 3KFTA 2W27A 4JTRA 3W7GA 4DBEA 4JDBA 3MCOA 4PODA 4M51A 4NXSA 4AIUA 5LIYX 1XDLA 3ANVA 2E1WA 3F2BA 4YIWA 3DU0A 3EX6A 3BXWA 2J78A 1WPCA 1A3WA 2OO0A 1EH9A 1ZJBA 2C1GA 1AH3A 4XZHA 5D4YA 3QW4B 2X1IA 2NT0A 5CZ0A 3R8HA 5LA1A 1NVMA 2DIJA 4PUMA 2QF8A 3QTGA 4XKMA 5HDRA 5LIUX 2GPTA 3UNDA 4GZ7A 4A21A 1TA3B 3DN5A 3HV8A 4J4KA 3VOFA 1TWDA 3MMTA 4NZCA 5M17A 4XKYA 1PDZA 4MNLA 1WXJA 1DP0A 5DY2A 4P2VA 3URQA 3OYZA 1V93A 4RXGA 2OTDA 1A5CA 5CZSA 1DQWA 5ECVA 2OLAA 1UR0A 2PC8A 3KLLA 4K2SA 1UA3A 3AYTA 4ZOAA 4AWEA 4IPLA 4D6CA 3E1F1 4W85A 3EWZA 1F6YA 2OVLA 3IJIA 3MVIA 1S5MA 2KAUC 1TTJA 3QR1A 1F74A 3WQ8A 5C7HA 1ITXA 1AZ2A 5LZLA 2OOGA 2PU0A 3CTTA 4AD1A 2HPMA 1WDSA 2R91A 1A0CA 2UY3A 3ELFA 2O9RA 3W7NA 5I7GA 2PPGA 3TTEA 3CPUA 3TIMA 2VX7A 3ITXA 4UQAA 4ML9A 4AX6A 3W7KA 1B57A 2D69A 1ZCOA 2PDPA 4MFDA 3P0WA 4HHLA 4KGJA 4QE1A 2EKGA 3G3MA 1Q8JA 1HN1A 2V5CA 3KWSA 4WX2A 2PU1A 2BOGX 2FYMA 3U5YA 5FSEC 4QAIA 2RDXA 4UTTC 1WDDA 2ISWA 5FSDC 2J47A 4MKSA 1IXOA 4HMDA 3HFTA 3O7UA 3W2MA 2PDWA 3GDMA 2YBTA 5JIPA 5I78A 1T6MA 1BRLB 2PWUA 1K6AA 4RXFA 4I8YA 4XO6A 4L9YA 4GBDA 3C0LA 3S2JA 1EIXA 3UR7A 1P6BA 4P7RA 1EXPA 2POZA 4Z1AA 1OBAA 4F0SA 4LVDA 1A80A 1BXNA 4MNKA 3C2VA 3VTRA 1G5AA 2E6FA 2F61A 3HMCA 2XIIA 4G8TA 3LPOA 1PB0A 1ZP4A 1Z89A 4KCWA 3EDKA 2XIMA 4MJMA 2ZZ1A 3M5YA 3FW6A 4I9TA 4KFNA 4RDYA 4MLRA 3A12A 3ZS4A 1OC6A 2WSPA 5G2HA 4LSBA 1XR2A 3WH7A 3TSDA 4LYKA 4LVFA 1NDVA 1TB3A 1UCWA 3QRHA 4KCUA 2PF8A 2PTDA 4GXWA 3DYOA 5D30A 3IVTA 1LQ0A 1PJ9A 2OGJA 4QDMA 4JY9A 4C7GA 3BJSA 1UP2A 3AHXA 3IWPA 1RBLA 3P6LA 5KITA 2NT1A 1JEZA 3IV3A 3CHFA 3MMWA 3CU2A 4F0MA 4GQRA 1CENA 2ISFA 3PPCA 2VZOA 3CZLA 4W5ZA 1WV2A 1EJTC 3B9DA 4S39A 3URBA 1VPQA 4Q4SA 4H83A 3H2NA 2ZTKA 3DHPA 1V3LA 4ZQPA 1VFUA 3PK7A 3CQIA 3AS1A 3GO2A 4J2MA 4LBSA 1DWIM 1T0OA 1Z42A 2V69A 3UVAA 3KLKA 3WNMA 4RPQA 2ALRA 2G3IA 2Q01A 5A6BD 3GZAA 3PZMA 5AVNA 4F40A 1PX4A 4HJFA 2YR1A 1VLIA 3PZTA 1VFOA 5J8LA 1F3XA 1NDYA 3NQFA 2FH6A 3ERPA 2RGLA 1UH2A 4S3FA 1GG1A 3KL3A 3GU9A 3URAA 1R46A 2JBMA 4I90A 1XLFA 2VX5A 2OLSA 3FHAA 1A4MA 2W63A 2OYMA 2YLAA 1MNSA 4JBRA 4KWWA 3AUJA 5I5RA 3N25A 1B3VA 4KFOA 4R53A 5BROA 3HJZA 4Q22A 3UBPC 3PTKA 2R1MA 5CPOA 3R0DA 3L4WA 2WW5A 4JNZA 3DAQA 1X1OA 3OG3A 5ABEA 3KVKA 4FXJA 3S3GA 5DO8A 1ZL1A 3BARA 4HKPA 2NUWA 4PGLA 1XDJA 3VXGA 1SGJA 1VBRA 2YL5A 3OIHA 3WDIA 1QNPA 1LQ2A 3HPAA 1OFEA 2NW0A 1QW9A 4MM1A 1SO4A 2QAPA 4LF1A 3UESA 2NLIA 3GH7A 3C8NA 4XX6A 2DP3A 2CLPA 5G5IA 4XZLX 1SW3A 4KESA 3S6OA 3WENA 1VCFA 1UWUA 2WK2A 1L0PA 1FCBA 1CI1A 3DFNA 4U3CA 4WDTA 1IWBA 4PMVA 4DWSD 2CFFA 1FWCC 1P1XA 1OCBA 5M3WA 4IH3A 4YTUA 5HA7A 4BI7A 3SCRA 4DO5A 4DI9A 4J3SA 5BOFA 4GYPA 1KLZA 2EPLX 1R9XA 3R0KA 1TO3A 2JKEA 1TV2A 1REQB 2XGBA 3MZ2A 5I3IA 4JHZA 1HKWA 5F4XA 2Y0FA 3IGXA 4X2PA 4JL1A 1JZ3A 4HP5A 1K70A 3L2LA 1YPFA 1ALDA 4RW5A 2E7FA 2VDGA 3WBWA 1GWJA 4FS9A 1QWKA 5HULA 3MP4A 2W79A 3IJ6A 2R1PA 1XBZA 3TTSA 2JE8A 1KV5A 3BCDA 4TOQA 4GO8A 3TN6A 3HG2A 3GHUA 1H5YA 4C6CA 1TPH1 1TTQA 3H2EA 5D8WA 1OY0A 1TWIA 2A79A 4PRTA 4PFMA 1UJQA 4DXKA 3RAOA 3QHOA 1E3XA 9RUBA 4GI8A 3IIOA 2G96A 5AHFA 1V0NA 3UJ2A 4EWJA 3MMUA 1P0KA 3S1GA 2ZRUA 4MNMA 2GWNA 1XRFA 1HF6A 1GYNA 3C2FA 3R89A 3RGTA 4Q6JA 4O0QA 4H9VA 1AQ0A 5FJOA 3ZT7A 3W6YA 2Y8UA 2OT0A 4N9DA 1TJPA 2GQ3A 2WZTA 3FA3A 2PBOA 1A0EA 2ZX8A 4Z2IA 3WBEA 1FQ0A 3ITLA 4FX6M 4WIWA 3BG9A 4BEUA 1KM5A 5TQLA 3CAWA 1OVDA 2J66A 1KM3A 4LUSA 3FKRA 4HSNA 1E56A 3DFHA 3NDZA 3EMCA 1ESWA 3N2XA 3LXCA 3GTNA 4Q8PA 2RH9A 5IHRA 1XH0A 2DVUA 4HHPA 3W7OA 2HNEA 3FSUA 3PZ9A 4GUHA 4RLIA 1OIFA 4LYQA 1DYSA 1TE1A 2VZUA 5K4XA 3W85A 4R7WA 2OPJA 4AD5A 5D04C 4GKTA 1HTIA 5T91A 3AXIA 1XISA 3I10A 2ATSA 4A3YA 2XN2A 4OIFA 3I68A 4O12A 4RE3A 1Q65A 3LXBA 2CCRA 3LHWA 3GY1A 4LT9A 4JQ3A 1UB3A 2CBJA 3C52A 3QKZA 4CCEA 3CAVA 1WBHA 2CLHA 3F4CA 4EKJA 2HNHA 4GI6A 1VPYA 1KKRA 3GTFA 1XLBA 2VX6A 2CLLA 2Z7GA 3VD3A 1IYXA 3UA3A 5A6AA 3SUUA 3SADA 1VCGA 2PTZA 1LWHA 1JPDX 1S2WA 1WX0A 3GDBA 2VOTA 4N4PA 2HQAA 5D03A 1ZB5A 3VNLA 5CJ5A 3M0VA 4E5TA 3QVQA 1FWIC 3MP3A 4NQ1A 1IHIA 3WF1A 4R88A 3V3WA 1K8ZA 4MOZA 3W73A 2EPOA 1TV4A 2E67A 4LAOA 1C91A 1EGMA 4AWUA 1QK0A 3F4DA 1G94A 3W4RA 3BAWA 2PSNA 4C6EA 3V1HA 4HNCA 1MVYA 2VD8A 2NQJA 3EGJA 4JTSA 1WBJA 2VRKA 5CXPA 2G4JA 4ZL1A 1G0CA 1RV8A 3CLMA 3LLDA 1PTDA 3S83A 4B3LA 2AOSA 1H7XA 2XUCA 1R85A 5C0QA 1O95A 3PFRA 1BGGA 4V1XA 1V08A 1P4CA 3SN0A 5CGMA 3T42A 3DHDA 3AAMA 1EC7A 1DWAM 5JMUA 3PUDA 4IPNB 1W3NA 1H0GA 2OQLA 4YYFA 4PBEA 3WLNA 3L2IA 5I3DA 3BLIA 2VEKA 1FFRA 1GK8A 4IIHA 3GU1A 3E0IA 4QG9A 5D2XA 1KCKA 1H41A 3N11A 1OM0A 1OYAA 3MUCA 4JYEA 1DJQA 2WHLA 4V1YA 3ZLHA 1EO5A 1ADDA 5AC7A 4GY1A 3NZRA 1K4GA 5CPQA 3VC6A 2ZKMX 3LBMA 4XZBA 5JU6A 3NOEA 1W5QA 1GJUA 1DJGA 3BICA 3GH5A 5G4EA 1UR8A 4CEUC 4ZQRA 2WKLA 4XG1A 3V0UA 1FFQA 3ATZA 3KBMA 2F7FA 1EA0A 3EEZA 1R2RA 3OVPA 3W3OA 4AHQA 3SCVA 4FAMA 4AZCB 1R6WA 5JXQA 4GNKB 3VIKA 1S2UA 2HBVA 3LQLA 4MYAA 4M6UA 4DY1A 1A5SA 1WZKA 2W5FA 3E0WA 5C2CA 3UYCA 3MUZ1 4FI4A 5A95A 4AC7C 1W56A 3CYVA 2I5GA 3W0KA 3B8VA 1KTBA 5BXTA 1ZBWA 3G1VA 3RMEA 3FAWA 3CUGA 2R82A 4C1KA 4IF2A 4YVPA 3TWAA 1FHDA 5D8ZA 1EOMA 1HP4A 2QUVA 4E3TA 5A8MA 3HQPA 5DMYA 5XINA 1XIFA 4W8BA 3KRSA 1UKPA 4AB4A 3GR4A 1EC9A 4ASTA 4AXKA 2YZRA 3CLWA 1KGXA 4X9YA 1SUXA 4W93A 1KCZA 2GSEA 1KFKA 3MI3A 4JTHA 4YJ5A 3CZGA 4S38A 1XP3A 3OP2A 3W72A 3VFLA 2FHCA 3O8AA 4PMOA 4WOZA 3H7UA 1QK2A 3LMYA 1EB3A 4Y8EA 1BF2A 4E0CA 1RCQA 3NGJA 3QLLA 3IIPA 1R3WA 2CLMA 1TPDA 4GJJA 1BTCA 2HMCA 1FWSA 2F38A 1XSKA 4J3ZA 2VGBA 1Q6GA 5BOOA 5AHNA 4GQBA 1SFLA 5LGXA 3MPGA 4KCTA 3K2GA 3VGEA 1UR1A 4L61A 3ID7A 4JN8A 4XWUA 2XU2A 3WJWA 3LHYA 2PEVA 4B16A 2WSKA 3FVDA 3VILA 4PCFA 3VMOA 3LPFA 1HX0A 2ZXQA 2Z24A 4ACYA 3AYSA 4X9SA 1ONXA 4JQ2A 3CZ8A 3SRDA 1MRQA 1ZSXA 3VKAA 1CB2A 1SW0A 1XUZA 3AZTA 3NEVA 1ELSA 4AVNA 1LORA 3GIQA 2G3NA 5HOSA 4K3ZA 1ISXA 4CLMA 3KEHA 1KV8A 3SQMA 4GY0A 1JXKA 2WBGA 2ESCA 3QTPA 2ZZ4A 4HGXA 1KD0A 1H1ZA 1FA2A 3A5FA 4JDYA 3QF0A 3PNZA 4DF1A 3GVVA 3WLTA 4NX5A 3W2JA 1EJVC 1ZCCA 4XUYA 5E6YA 4FNUA 3SN4A 2QJJA 4K36A 1ZRQA 5FIPA 1X7IA 4Z1CA 3S1UA 3G2GA 3UZXA 2FPTA 2YX0A 3VIPA 2FFCA 2HCVA 4Q8WA 4M7SA 4EVZA 4Y9NA 4FF5A 2BX7A 1J8VA 3IIXA 2VX4A 2E77A 2GWGA 1F8MA 5C8BB 2J7DA 2J75A 4DBDA 3F5KA 1RSCA 3WX7A 5A8QA 1UD6A 1WP6A 3SY8A 1E6NA 3DFPA 3W29A 4D6HA 1Q6LA 2VFEA 3PANA 3LMZA 3W2KA 1FKWA 4G7EA 2Y8VA 4DO4A 2FGLA 4OTKA 1TCMA 4YTTA 3MMDA 2JF7A 2QUMA 3HQNA 3U8GA 3WBXA 1AD4A 4R3UA 3SY1A 2ZXDA 1TJ1A 3H8AA 3VIHA 1YPXA 2F6UA 3GIPA 2QCFA 3MZNA 1TPC1 5I24A 5I0DA 4IFRA 4AZ7A 2GLKA 1TTPA 3VDAA 4GGHA 1YDOA 1X8FA 1NQKA 1R9YA 2BBFA 2B7OA 3FA5A 4LALA 2OX1A 2FJUB 1E6QM 3M1ZA 1T5AA 2W4XA 4UTLA 8RUCA 3M0LA 1E43A 4MUPA 1XF0A 3ME3A 3PTMA 3VNMA 3FGCA 5DRIA 4A29A 5AC8A 1Z6KA 4LC8A 2X1RA 2XIOA 3JU2A 3APTA 1XYBA 4A8LA 2DDXA 4IX0A 5HQLA 1BWLA 3CAKA 3W6MA 4HT3A 1E0VA 4LC6A 4XZMX 7TAAA 4QFUA 2CETA 3IK2A 1JPMA 1D7FA 1XBYA 1LBFA 5FF0A 2NXHA 3KX6A 2NX3A 4PCPA 2Q8ZA 3TW6A 3KE0A 1E4LA 4FLRA 5EKYA 1DXIA 1US0A 2VR2A 4INFA 2QLYA 1UC4A 3GKFA 3H54A 5AN7A 4ERIA 3UT0A 3ITOA 3RPDA 2WVVB 3S5SA 4J35A 1SSDA 3OEXA 1KM6A 4ECLA 1YX1A 1E0WA 1JCXA 4WY0B 4HPJA 4I6VA 4LJ3A 1VEOA 4AD0A 4B5VA 1OD8A 4CNUA 3THQA 1CXLA 2WC3A 2ASHA 1S39A 3WJSA 4HPHA 4QIUA 1O1HA 1FY6A 2A85A 2F9RA 3KDOA 3U7VA 3S46A 2XH7A 1JCMP 1TA3A 1V6VA 2W66A 3VDHA 3NCOA 3C0SA 2VGIA 1YDNA 3P60A 4PMZA 1ZJAA 1KXTA 4IFOA 2WC4A 5DXYA 3FDKA 1RVKA 4YL2A 2HBXA 4MZYA 2PFHA 3GSMA 5BNKA 1JULA 3UJRA 3T05A 4H6KA 1SR0A 4AQLA 1HL8A 1AVAA 3A5VA 1EX5A 2PCQA 3GH4A 1ONEA 3CH0A 3SAZA 1EP2A 4O15A 4LCRA 3WJYA 2CITA 5DT7A 3H2MA 1E4MM 2IKHA 1QO2A 1RA5A 1FH8A 1OZQA 3ONCA 1S2AA 5BOEA 3IGUA 4KMQA 3WQDA 3BZJA 3GC2A 4W84A 1LF1A 1DJZA 4JX5A 3G0XA 1NIUA 3KL5A 4XTDA 2PLJA 3O0FA 2A6LA 1O7AA 1JAKA 1BWVA 1K6WA 3PS7A 3E49A 4JQ1A 1R7OA 2IKGA 4RUBA 3SZ8A 4O14A 2BP1A 1RXOB 1LG2A 2PZ0A 3P93A 3N4EA 4K1GA 4IPIA 5D2WA 4MLJA 2VI0A 2FPYA 3TDFA 3LM7A 5MF5A 5LHEA 3UY8A 3OGSA 3FA4A 1EJWC 3WK3A 2PWDA 3N3TA 1DEDA 1JIBA 2QCEA 4IUGA 1LUCA 3OLDA 4EAYA 1D2KA 3P3BA 2CBUA 1DJIA 3PUEA 3G0SA 2BSLA 3K8MA 3ABRA 1WXYA 3HG4A 4JIIX 1LZOA 1S38A 4TIMA 3P80A 3LD5A 4UCFA 3SRHA 1CGWA 4ZOBA 1GHSA 3QKEA 2WCAA 1MFUA 5IM51 2R94A 4DB7A 2DPEA 5A6JA 3WD1A 4WGHA 5JQ9A 3I7QA 4ADTA 1RLCL 4YWIA 2VC6A 6ALDA 1R3SA 1FWHC 2BZNA 1M7XA 2CLIA 4GUIA 3LRKA 4MF4A 4UQ9A 1NOWA 4PC8A 4GG9A 1OT1A 4P8WA 5DX7A 1EHAA 3BW3A 3DIPA 3WJZA 1AG1O 1Z44A 3LLFA 2CWXA 3EDDA 3MHGA 4FP1A 3U2EA 3MBFA 4HPXA 4JOMA 2QDEA 3L4ZA 4OBTA 3A6OA 3SCUA 3VC5A 1KTCA 3TC7A 4CD8A 1QTWA 3N13A 1JJKA 2DZVA 5HUPA 3RIKA 3VNZA 1V02A 1XC4A 3TYDA 3UY7A 3A9BA 4JTLA 1H1NA 1SJBA 3L4UA 4ZXLA 3LNMA 1W91A 2XG9A 2V30A 4GIAA 3G1XA 3L4XA 3WDRA 1FP8A 1UMLA 3E2RA 3TN4A 1R87A 3NO3A 1KC7A 1YRRA 1A5NC 1HJSA 4D6IA 2KX9A 1KBKA 4NNCA 4W8LA 1QJWA 1IR2A 5I09A 3G6LA 2D2JA 1TIMA 4J3WA 4BJHA 2YL6A 4TX8A 4AYGA 3UZWA 4IUOA 4GUFA 5AYZA 3A4WA 1OFBA 4XO7A 1MEIA 5CCZA 4GC4A 4S3EA 3R25A 3EWXA 3M4HA 4PB4A 1GYMA 2E6AA 3A3XA 1IWAA 3N6JA 3G1RA 3BOLA 3HZ3A 5KMYA 4IFKB 3IAPA 3MSYA 1PO9A 3IUDA 2WXDM 3FKKA 4WSKA 5HR6A 3H7RA 2CLFA 3GBDA 1F05A 2Z27A 3TSBA 3CQJA 1Y0EA 3K46A 3L21A 4JTGA 4P7OA 1QW8A 3AIUA 4W9TA 4DWSB 4LV4A 4LYRA 3GNNA 3H6OA 4ATDA 3W86A 4DPQA 1XQKA 2ACQA 5KSWA 3LQGA 3DH7A 5FF4A 1QAPA 4AEFA 3R58A 5TIMA 4XQ6A 5FKYA 2C14A 2QF7A 3GDTA 5F2LA 3AXHA 1F2JA 4F0RA 2I5QA 1LYXA 4IGNA 4RL3A 5EBAA 3PC0A 2VUYA 1CGUA 1XFCA 2CXEA 4AYSA 3OO2A 1XYZA 2HJPA 5IDIA 3TOYA 1YXCA 4HN8A 4W88A 1EHNA 2AL2B 1V6WA 3M9YA 4GQQA 2YA0A 3P74A 4WEVX 2WO5A 5AC5A 3IJ7A 1KA9F 2RHGA 5CZTA 3PUGA 1J18A 2J9ZA 1E6ZA 1W0MA 1ODUA 1NAL1 3WUGA 1Q2RA 2QT3A 4HBKA 3FLUA 5CPSA 1W3KA 2GJXB 3BSHA 5JIWA 4R27A 3NL3A 1XXXA 4QX4A 3VNDA 1JG9A 3GM8A 4L6OA 3IANA 2WCGA 4WDXA 3RX3A 5TF0A 4K8GA 3QC0A 3OBAA 1JDFA 4X63A 1LT8A 1TRDA 1A5LC 3ORWA 2YDRA 3CUFA 3HGSA 3B8SA 1DXEA 4YHEA 4DUXA 3PZIA 3QPZA 1D3HA 2RFGA 3DC0A 3W7QA 3APYA 4KBXA 1RALA 4DWDA 3M41A 1TQJA 5HATA 1BG9A 1GPFA 2E9MA 4F79A 1XIDA 1W8GA 3CIVA 3K4AA 1OGGA 1TX0A 1L6FA 1BYAA 2NQ5A 4ALDA 4UTUA 3SSJA 4BQ4A 2WMIB 1SQ7A 2Z00A 3GKAA 3B3DA 3WIJA 4TVCA 5H6HA 2NVAA 3ARSA 1O1ZA 1Q4NX 3TR2A 1W5OA 3W07A 2GUYA 2ZDSA 2XGZA 1EKOA 1UZDA 2HPIA 4C1NB 4EF9A 1GOWA 2PWFA 4N4QA 3T08A 1E1CB 2O9PA 2BXVA 3CQ0A 3KRBA 2OEJA 3N3MA 3GZ3A 1LBLA 3HV9A 4PTVA 3SCSA 1BWKA 2ZX5A 2V3EA 4W5UA 4GPNA 5KZ6A 5I3JA 2V9DA 3TN5A 2J7CA 2VD9A 3QGVA 5CGTA 4AVOA 3RCYA 1QPQA 4B91A 2X1TA 2O7SA 5FESA 4H6QA 4ZO9A 2HK0A 2VR5A 4A3HA 1XLHA 2W0UA 3BLFA 1ZGDA 4DIAA 3ARXA 1N7KA 3LHTA 3INPA 1YNPA 3LM3A 5CC5A 3PPFA 4OKDA 4YWSA 5A8NA 3FJNA 3STPA 3C6CA 3DOPA 3AYVA 3HJEA 5KZEA 2WMHA 4EXQA 3KBNA 2DVTA 4EIVA 3E38A 1O12A 4XUGA 3TLQA 4UNLA 2C19A 4C6QA 5I3HA 3R8GA 3LA4A 3CHDA 1FWRA 4F48A 1BG4A 1HJQA 1R38A 2QNEA 1S2TA 3A9IA 4CNPA 3FIGA 1KBLA 5K9CA 1VFLA 1RA0A 4DPPA 5GNZA 1HGWA 3T2OA 3GXDA 3VD5A 3AUOA 3H70A 4RCXA 5FJTA 4KPLA 4P8VA 2V3FA 2XZ7A 1W3HA 4WD0A 2ZC1A 3VZZA 3AS3A 3LRLA 1AW2A 3N9RA 2YCLA 4PTXA 1LG1A 5HANA 4H7CA 4I5RA 1ZPTA 1ENUA 2ZZ6A 5CZJA 3GXFA 3BQ6A 1TPEA 1JUKA 4WKHA 4FALA 2E40A 3CUIA 1SZRA 4NZ3A 3QH2A 1XBXA 4Z2KA 3UWUA 3GNPA 2JEPA 3APGA 4O17A 4ILSA 4DN1A 3TR9A 2V68A 3WD4A 3WH8A 3T8LA 2QJNA 2C1IA 1GJPA 3VM5A 3PN8A 1L9WA 4MUZA 1VPXA 4DXVA 1VBUA 1OK6A 4QM1A 2A3LA 1OF6A 5DCBA 1GQJA 4FF7A 2AKZA 4K38A 4IQEA 2QQ6A 4GA8A 4YYCA 5TD4A 5HMSA 2C7FA 3VMPA 2DT0A 5A8PA 4Q4RA 4Y9OA 5DMLA 1KRMA 1RPXA 3NIYA 3BCFA 4I6KA 1JVNA 1E9IA 1EQCA 4F9JA 2H9AA 4GNVA 2VR4A 2P10A 3F4NA 2DSKA 4RX0A 1C8VA 4JEJA 1JUBA 2FTYA 3WNOA 3VDGA 1E71M 1MZRA 1WO2A 4NYUA 4M1BA 1L8NA 3CL6A 3UD6A 4EOUA 3TU9A 5D9MA 3J7HA 4Z17A 4KWUA 3V35A 4YTRA 2P50A 2AQOA 5EU9A 4WCJA 2OGYA 3THAA 3T1GA 5AB3A 3C61A 2J7FA 1IEVA 5C9XA 4FA3A 1OFRA 2W92A 2YXGA 2YOCA 4GH3A 4OV9A 3S5NA 3AIBA 1QR7A 1I0DA 3FV9A 4PA8A 1SO3A 3AHZA 3MY9A 1OZMA 4URIA 3NEHA 3B0UX 2Z4GA 3GXTA 1AQHA 1QI3A 2BXYA 3IARA 4HA3A 1PIIA 2GGHA 5G1MA 4I9JA 4RDVA 5LIXX 1ONRA 2VL4A 3R5EA 4IIDA 3II1A 3BANA 3G22A 3RN6A 4W7VA 1UUOA 1AK5A 1EIBA 5A2BA 1W1PA 3L68A 4GCXA 1KBIA 3BOFA 4L5ZA 3NZGA 2PCEA 2ZZ5A 2CLEA 4QJ5B 2DZPA 4MSSA 1S5VA 3EMQA 7A3HA 1R3TA 3N9KA 4LX4A 2ZWYA 4IL2A 3KS6A 1ISVA 2ZUNA 1X39A 3GG0A 1DHPA 4PB3A 4Z2GA 3GTHA 1PPIA 1V7AA 1NM9A 7REQA 2PS2A 2XDFA 2R8WA 4QDWA 3ZZ1A 3T4CA 3QC3A 4BI6A 3Q94A 1QASA 3AMKA 1Q3NA 1H0IA 5FD0A 4GI4A 4IMEA 4IHCA 2BY1A 4XKYB 3RILA 4MNJA 2J9XA 2QEZA 4HOWA 5K9XA 1GVYA 1TJ0A 2YCJA 1XSIA 1K03A 4LCSA 1QPKA 3C2OA 3KP1A 3EKLA 3TJIA 3A22A 4PTWA 4AVFA 3C2EA 3L12A 1GORA 3DX5A 3U0HA 1RLDA 2PP0A 3BW4A 1H11A 3WQCA 3M0JA 3KVMA 2WYSA 4PH6A 1POKA 4ZEPA 2PDBA 1HNYA 4V15A 2G37A 4XB3A 4QJ3B 2ZE0A 4L80A 4JQAA 1BXBA 1RBAA 3KXQA 3HPFA 4J3UA 4HCLA 1XG3A 4NZ1A 2ZVRA 3ZYZA 3MSGA 4PRRA 1JF6A 4NJJA 1J9YA 4LVBA 1U33A 2C79A 3B9EA 1PZ3A 3BLKA 2ISDA 4IICA 1V3HA 5HNTA 3NZPA 5CBIA 4XBJA 4M29A 2EHHA 3F7JA 2FZ8A 3ATYA 4GVIA 2OSXA 3TK7A 3S2MA 4LAZA 3BAYA 2G0WA 4GI9A 3FCPA 1KGUA 3DERA 4JN7A 3BSGA 4MY9A 3BL3A 4KH2A 4LGXA 4POCA 3B0YA 3KRUA 2A0NA 3S47A 5HMFA 4M24A 1RH9A 1VJSA 2VCAA 2EF9A 3PJWA 4Q6XA 2OB3A 3EPNA 3BGGA 3KHDA 3N17A 1H50A 3GHTA 2B81A 4ZQCA 4PN2A 1I8JA 3M16A 4U31A 2X40A 1UH3A 3N15A 3V5FA 2PTYA 1F3EA 2JKAA 3WQ6A 3R12A 3SUVA 2BFGA 1VD6A 3TZNA 2YSWA 4Q7IA 1ONWA 2VJXA 5JUVA 1R8LA 1CTNA 4EPBC 1RK6A 5AYBA 3AI0A 1WE5A 1ODZA 4UCGA 1IXQA 5IFPA 1YBQA 4NJIA 3UR2A 2OELA 2WHMA 3GUWA 2X09A 3IJ9A 2ZTJA 3GVQA 4DYKA 3GYEA 4KEZA 1UIPA 2E9LA 1YDYA 2BASA 2DVXA 3TYAA 1M1BA 4QJ1A 4FXFA 1GKQA 3N73A 4YTQA 5F7UA 3UZJA 3AROA 1XKJA 3BCJA 3POHA 1E73M 1RHCA 5LA0A 4OU1A 4A8NA 5BYWA 5H1WA 3CEPA 1XS2A 2WNZA 3QPYA 5HINA 3L23A 1X6UA 4QISA 2DT1A 1KR0A 5K4ZA 1TMLA 1VFSA 4TX9A 3FN9A 2WVSA 4CQBA 2AKMA 5F2IA 3QYSA 3IJLA 1MXDA 4DXXA 2Z25A 4JEQA 1PKNA 3QMRA 3PBVA 3CZEA 3G77A 4IP4A 1BTMA 1FWEC 2IPJA 4WLCA 2PI6A 4ZBCA 2JEQA 3N2OA 3KVLA 5T8GA 3IV8A 1M9HA 3ZJ8A 1KRCC 1XRSA 2OT1A 1HO1A 5HQMA 3TQPA 2H3DA 3CIXA 4WSHA 5HWMA 2QCGA 1LROA 1RP9A 5HK4A 3ZVHA 1LWJA 2WMGA 3AU2A 2A3AA 1FCQA 2VEFA 4WY0A 5CG7A 1TELA 3W37A 1S2CA 1SYTA 3LDVA 2GVJA 2GZXA 1QNOA 4LBUA 2NQHA 3VKKA 4Q4QA 7PTDA 3RLUA 3BG3A 3WQOA 1SFTA 1XIGA 4H9YA 1BYDA 3VZXA 1V4YA 3CBWA 3KS5A 4B5SA 4EACA 1QO5A 1W1YA 2AL1A 5LXXA 2XFRA 3SDOA 6REQA 4IG2A 4OECA 2O0TA 1IR1A 2CXGA 1HL9A 3IPWA 1Z41A 4EP8C 1LBMA 2QJIA 2VT0A 4C6KA 4LS1A 1W1B1 1P7TA 3NM3A 3UA4A 1H7OA 1M68A 2YCKX 3NQ7A 4U5KA 2VCBA 3ARUA 3K5XA 3TCSA 2V8ZA 2WZMA 1QOXA 3B9AA 4JR5A 2TODA 5AYIA 3LN3A 3ANUA 1SM9A 1XDMA 4H01A 1QNVA 2F84A 2CBVA 1ZY9A 2V38A 3FYPA 1L6GA 1KWKA 4GLEA 3U4AA 5EYWA 2OWWA 1Q6QA 4CQ9A 2GVEA 3CUXA 1HVQA 3AWNA 3R11A 1K7XA 3LGDA 1ZLPA 1TKKA 2J6XA 4UQEA 3NVTA 3MKCA 5KZMA 5BXRA 1GQKA 3PAOA 1HJUA 2PDMA 4Z42C 5DBUA 5CQ1A 5HUOA 4LF2A 1VAHA 3GRIA 4AAJA 1J01A 4JNMA 1UC5A 2E25A 1ITQA 1UMYA 3MW7A 3R13A 5CEWA 1FHLA 4U2ZA 3MJYA 3DGBA 3GWQA 3IVSA 4J1OA 1ZAIA 3DZ1A 4P7NA 1K7EA 3P0XA 2Z7KA 3ABXA 2VXNA 5SWUA 4FLSA 3WF3A 1FH7A 3GG1A 1KM4A 2GGEA 4ZSTA 1GVEA 4FB7A 4O4VA 4C6FA 3KOYA 1M7OA 5KETA 3ZFHA 1ZENA 3QMTA 2AGKA 2C71A 2ZZ3A 4XD6A 2D20A 2CHRA 3H4GA 4JYDA 4DNHA 1M6JA 5C2GA 3S2LA 3USBA 1NFGA 3W71A 5E5CA 2P8CA 2V5KA 1V3IA 1UWIA 1V77A 4K7YA 4ORMA 1J0IA 3RM4A 2BLEA 3TKFA 1LWIA 4DZIA 3BE7A 3GW3A 2YGYA 3N2CA 3EWWA 3EX2A 3S5ZA 3CWHA 1ZJHA 1V02E 4ZVJA 3MO4A 3MB9A 3QPEA 2ZCGA 4OFCA 3UWEA 5BW6A 1GZGA 3KZPA 1GQLA 5AHEA 4WUIA 4JTCA 2VC9A 3QY8A 1NWTA 3RR1A 1Q7ZA 2IQ0A 1ZS2A 3KTSA 2QXWA 5XIAA 4IMGA 4OT7A 4LUSB 1B3WA 4GY7A 1RD6A 4HK6A 2P8BA 1J0JA 2XM2A 5A8GA 2B0MA 2XWDA 1TX2A 4XD3A 2QUUA 1D8WA 4M8UA 5D05A 3GTXA 2P3EA 2PGRA 1P1MA 3T07A 4MG4A 5LNSA 2H90A 2ONEA 1S1RA 4QGCA 4C6IA 3SCOA 1O94A 4AY8A 3CH9A 3B4YA 1JI1A 3OYXA 2NXGA 2D73A 3USZA 1SSGA 4M7TA 3P81A 4QDPA 3O06A 3O16A 3K13A 4A2RA 3NA8A 2Y2WA 1F5ZA 2QUTA 4AEEA 3VMNA 4OZOA 2X1SA 2D0GA 3MV11 1XYCA 3SY5A 2OMAA 3NQCA 5CSUA 1BVNP 3PSVA 4U3AA 5REQA 1PX3A 4WJEA 2PDHA 4IFKA 4HTBA 2H8ZA 3H2AA 3VCCA 4CKQA 3CZKA 3LI1A 1XM3A 3VIIA 2XIQA 2ON3A 2X16A 4MWAA 3O63A 1V79A 4CQCA 2ZUVA 3C4UA 5FEWA 5T26A 4WXZA 1AJ0A 1JRCA 3I3DA 1A3XA 1OG6A 1XCWA 3OBKA 1RBOB 1A5AA 5BCAA 3QZEA 2WPBA 2A5HA 5A1AA 1XSJA 3WN6A 2ZRZA 1KFWA 1Y7VA 1S2VA 3MBDA 2J7EA 4MAVA 4PUEA 1G7UA 2X0SA 1W1ZA 4RE2A 1H60A 4UR9A 2OKOA 4ROQA 4XD4A 4AZHA 1OFQA 3L4YA 5I02A 2I9UA 1ZFJA 2ALDA 3HN3A 4I9MA 4OBRA 3B03A 2WV8A 4EE9A 2JKPA 2VOMA 1MEHA 5CSYA 2R1LA 3REQB 2OZ8A 1XW8A 3KOWA 3WUFA 4C1LA 2PB1A 3VX1A 5DRCA 5C71A 2VQUA 3GUGA 3W76A 2ISSA 1XC6A 5LYRA 1VB9A 2QIWA 3RMJA 3WH6A 4PMNA 3EBVA 1TV8A 3AU6A 1VBJA 1YKWA 1TV7A 3PZQA 1NELA 4LB4A 5EA9A 1VBGA 2EG6A 4QAWA 1VFTA 2PBGA 4RZ4A 4GHRA 4NNAA 1TPFA 5HBFA 5RUBA 5JBDA 3SRKA 4LANA 1H7PA 1K3UA 4AZ6A 2INZA 2P88A 1TFVA 4GZEA 5CSSA 3GC4A 2IKIA 2O55A 1B3OA 4CCDA 4TUFA 1C7TA 4C6NA 3H21A 3R94A 2TMDA 3HFYA 3WLJA 5H8PA 5BRBA 1PX8A 3FNDA 4L7ZA 3UVIA 5HJYA 3TZFA 2R24A 2QDGA 3R43A 4CD4A 4GE8A 4RW3A 4NUWA 3EX4A 3TYCA 3WLMA 4BF5A 3VKJA 3BV4A 3MUAA 3VOCA 1ICPA 3N9SA 1JZ4A 4J3TA 3SO7A 3MCNA 2C0AA 2X1UA 4HYRA 3E2VA 3FVMA 4WOQA 4F0KA 3TMQA 3G1AA 3WNLA 1RJPA 1DE5A 3OLIA 1E1CA 2ACSA 1PYFA 4IIEA 4RDZA 1B90A 1RVGA 4IOTA 4KWVA 3KM8A 1ITUA 3P8IA 5E0FA 3DCPA 4UBPC 2HS6A 4GVGA 3NPUA 1VKFA 1E9YB 1JGIA 3W1QA 1DIOA 1E6RA 2Z1XA 2O4MA 4L56A 2BVTA 4TXEA 1MUWA 1QNRA 2QMKA 2TSYA 3BLEA 5IBXA 4OWGA 2ZVIA 4KIRA 4Y90A 3DYMA 5A6LA 1UA7A 1VZWA 2PAJA 3AIQA 4GISA 2GSHA 4FR6A 2GVLA 4HZ8A 2EPMX 3AOFA 2VEPA 4LXFA 1DWGM 2VMFA 5LGZA 4X0NA 3W1RA 3A4XA 1U5VA 5I00A 4NT0A 1FWDC 3EB2A 4S3KA 2I5IA 2I9EA 2POTA 4NXKA 1J6PA 3BAIA 2Z26A 3GNXA 1BEUA 1L6WA 1DJHA 1VEPA 4X60A 1P43A 1EC8A 2V81A 2YCEA 4KEMA 3OZYA 3BJTA 3UWQA 2YBVA 5JBFA 2Z6IA 4L4MA 3RXZA 1OYBA 3EKZA 4PCTA 1R3YA 3AS0A 3DKLA 2V67A 3R8RA 4YN5A 1EF2A 4DLFA 4ERGA 4LUJA 4N7QA 5DY3A 4HMNA 5KZDA 1C7SA 3OZPA 1PKYA 1M03A 3RF9A 4F0LA 4J5NA 4I9AA 3TXVA 3DENA 4YS1A 4A22A 4O10A 4UTJA 3FOKA 3RX4A 3N1AA 2FB2A 1TG7A 2C91A 2NSOA 4UTFA 1WKYA 3OODA 3VZYA 1YNYA 1UH4A 1FXQA 4JYFA 2Q6ZA 2Y4SA 1G1YA 1OB0A 1RD5A 1TPVA 3G1HA 3GR7A 4MVAA 3D46A 4DJDD 1BQGA 4UFJA 5E70A 4MWAC 4X2RA 4B5WA 3LUTA 4G7EB 3SUSA 1BAGA 2E1DA 2V2HA 2PDCA 5I79A 1TMHA 4DWSC 4HMCA 1LOSA 1HT6A 3I3EA 2UV8G 2A7NA 1OG0A 4JXCA 2DJXA 2V63A 3WBAA 3RDKA 3ZXWA 2ZC8A 3VU2A 4EPDC 5EMKA 3OLEA 4MTVA 2Z6JA 4MMWA 3TOPA 3WDJA 5I6SA 5EMMA 2J7GA 2WSQA 3GHRA 2F2KA 3LHZA 3OZMA 1E6PA 4D6EA 1QW7A 3L66A 2GQ9A 3JZUA 3UJSA 3TYUA 2DW6A 4LUTA 2GK1A 1DHKA 1A4LA 4WVXA 1EJRC 1Q6EA 1HQTA 1WCGA 3GFZA 2FZDA 2R14A 1QVBA 4LW7A 4JTIA 4N02A 2C3ZA 1JUEA 4GNJA 1GEHA 4WGXA 4M80A 5F2MA 2E68A 2Q02A 1OFOA 4R33A 2I16A 3Q58A 1JF5A 3U5UA 3WLPA 4BWLA 4GVFA 1I75A 2GDVA 3S9YA 1JXJA 3LCLA 4RZBA 4BEQA 4JTQA 2ZUWA 2DGAA 1J5SA 3Q4DA 3AXXA 4B2DA 2KZHA 4O8RA 2DSZA 1PTAA 3EA2A 4N9EA 2E5BA 3TAKA 1UKQA 1PXGA 2XISA 3LCXA 3W22A 2H3BA 2YYTA 5A6KA 3UPWA 4OVXA 2L5HA 4IISA 1W32A 1EOKA 1QNQA 3QY6A 3DXIA 1A47A 4BHYA 4S2BA 1Q4WA 2Z1SA 3V7PA 3THDA 2Z28A 3HU7A 4FOUA 4RNFA 1I1WA 3ES7A 3WEMA 2FZNA 3M07A 3EA3A 1Y8BA 1QMLA 2XVGA 4ZOEA 1KQZA 1HJXA 2FTWA 3EPMA 3H7VA 1SZNA 4N9BA 4MB3A 1E51A 2BOEX 1OCQA 3GHSA 3LSCA 1O68A 3RM8A 1FXPA 1TV5A 4D8LA 3DG3A 3GDRA 2ANUA 2A21A 3EDJA 3PSWA 4E8DA 5FL1A 3LV6A 3SECA 2V6AA 2XYLA 4TQTA 4F0HA 5CH9A 4O11A 1W17A 1E9LA 4DO7A 1KXVA 2D0HA 4TTUA 1F76A 2PF0A 5AHIA 1X7FA 3KZSA 1KCXA 3AIWA 1DJYA 3ARWA 3QY7A 4HU4A 4NNBA 3B9OA 1FH9A 1J0ZA 4LEQA 1ZTVA 4C90A 2VTFA 4K39A 3O6YX 1CXKA 2DUXA 1PEZA 3PWGA 1LLWA 1VEMA 1QXLA 5C70A 3W1AA 3NL5A 3CNYA 2DH3A 3VDCA 1FWBC 2RGMA 1W54A 4BK9A 1ZJIA 1Q6FA 1S5TA 1XYLA 3SURA 4PEEA 5FACA 4IJCA 3W7CA 3VIMA 1CECA 1UWRA 3OLGA 2ZRVA 4RPPA 3MA8A 4CNNA 1X96A 3QSRA 4Q4PA 1C3FA 1LUCB 4HIBA 1SO6A 2J8TA 3ONBA 1BKHA 4BQ3A 3CV2A 3A64A 3RFAA 3W01A 1DL3A 3C56A 1KXHA 3KCLA 4QEEA 3WJXA 1TPWA 1FDYA 5D2YA 2NQZA 1GPWA 2QGHA 3DFOA 3AZRA 1XUUA 5GNYA 1JZ5A 1DORA 1OX6A 4ZCWA 3LENA 4MB4A 5F1VA 1DIKA 4AU0A 5D2VA 1V6UA 1J4EA 4R9OA 3U2CA 1AW1A 1KQYA 3LCWA 3IJ8A 3F03K 2PTXA 3WL0A 3GX9A 5H8MA 1DTNA 2NV2A 1NDZA 1UBSA 5HJXA 3I4EA 3N34A 5AOUA 1F3TA 4HZ7A 1QPNA 3EOLA 4GK8A 2ZXBA 3VNIA 3QGAC 4P5UA 2E09A 3T40A 3W9ZA 3COTA 2EQDA 2CWNA 4WZHA 2X7WA 3WLLA 3W88A 3VCRA 3TYEA 4O1EA 4A3UA 2EPNA 2FVMA 5C9WA 3WLQA 1ICSA 1W3LA 4KRTA 3I6TA 2E5CA 2V3GA 2ZXAA 4RZ5A 4H3DA 4WSJA 1R30A 3VKCA 3M5VA 3W23A 1XIJA 1QWGA 1NP0A 2A3HA 4MY8A 3LCGA 4KWOA 2FH8A 2YXOA 3E9AA 3RRAA 3EDEA 1K9EA 3FYOA 3PBMA 1TCDA 1FVPA 5IDZA 3G1YA 3LG3A 4JS3A 4JX4A 3GFXA 3W53A 1WOAA 4AW7A 2NLYA 3NR0A 1ZQ5A 3AFBA 5DLCA 1MNZA 1KB3A 4DUWA 5A2CA 3RK8A 3I4KA 2CZVA 1Z32X 2PWVA 2GGGA 4Q4OA 3V4BA 3KHJA 1QBAA 3FJ4A 3BAXA 3N6QA 2GGJA 2QAFA 2PDKA 2PGEA 3WQEA 4PUUA 3PBUA 3R2GA 1KKOA 1VYPX 1G6CA 2OO6A 2IUZA 4IM4A 3MI6A 4Z0SA 4IPJA 1UJPA 1HGYA 4CU7A 1OYCA 5CBJA 1ZALA 4PBGA 1XCFA 3WBYA 3NYZA 3MP5A 2VFDA 4B4FA 3PAJA 1E9ZB 3BO9A 3ZT6A 3QBUA 2WKGA 1GVFA 3PZVA 4PUWA 5DCEA 3ZSSA 8CGTA 4G2DA 1J79A 5HNNA 3IK4A 1GVSA 5MKGA 5M5DA 3LCHA 4Q32A 4CN1A 2OZTA 4MWAD 3VINA 1VFHA 1MWOA 4NSBA 1FWAC 3EYPA 4OQVA 4HZ6A 1PCKA 4XZWA 1LLZA 5IHSA 4HSOA 1OGSA 3IRDA 3CB3A 4LV9A 4TR9A 3CMJA 3NTYA 1K9FA 3VD4A 5FI8A 1JYWA 2WAGA 3UR5A 4HTYA 2E8YA 4H9ZA 4AIOA 1NOFA 4DO6A 1R0MA 1KBJA 2QUNA 5KTLA 1CXFA 2D22A 4QQUA 1XV8A 3GAKA 3LXAA 1NFBA 1VH7A 4LAMA 4H1ZA 3FEQA 1EP1A 4H9UA 1GVOA 5H91A 5ABHA 5I03A 3A3HA 2X0YA 4F3HA 3ARTA 1Q8AA 2YDQA 4O1FA 3W7RA 3N2TA 5FF3A 1EBHA 3WEOA 1AJZA 2Y6ZA 4BF7A 4GZIA 3CGTA 3UGRA 3QV7A 3VO0A 3WLOA 3PG9A 1QNSA 2O4QA 1KM0A 1TR1A 3EA1A 2VVSA 3BH4A 1PTGA 5GVJA 2ACUA 1XLCA 3WK1A 1RP8A 4IPPA 3TYBA 5AYXA 4JCMA 1A53A 3WD0A 4GJIA 4NG3A 1AQMA 4DZAA 3QHNA 4GACA 4I5UA 3WF0A 1A3HA 4HJWA 1XHGA 5FJJA 5A8OA 1D7KA 4EXBA 2OX4A 4CNTA 4CVWA 2AQWA 1WDQA 1Z48A 3E2QA 1R9ZA 1Z69A 1GKRA 3AIVA 3CPGA 4P7QA 4C91A 3O3RA 4M6PA 2QV4A 3M0IA 1UR2A 1VHCA 1MZHA 3ZQ9A 1TPUA 3Q37A 1GW9A 4JAWA 4GH1A 3S42A 2EAWA 3PZOA 4QSHA 1ZNNA 5FEZA 2WMKA 3CZJA 3Q65A 3EOUA 3GAYA 2VDIA 5IFTA 4Y9AA 1YPIA 1RK5A 3Q45A 1Q7MA 2P5NA 3BTNA 4UMBA 1L2QA 3CUHA 1U2YA 3V16A 2GUBA 3LEPA 4U4MA 3WO8A 4F2UA 1EO7A 3PJUA 4O4WA 3WK0A 2DU2A 2F6XA 3L0KA 2VZSA 2Y7GA 1J96A 4FPSA 3B0XA 4B9YA 3K4DA 4QEHA 2GDQA 3ITTA 1MI3A 1U83A 3TEVA 3K30A 5FAGA 2E28A 2OXNA 1HJWA 3AALA 1KFEA 2UY5A 4JQ4A 5CAKA 4TV5A 4XSLA 3UEQA 1TYGA 1IWPA 1B2YA 3QXBA 4MYXA 1G69A 3B97A 1E1EA 1G9HA 1KW1A 4LH8A 2HXUA 3GNOA 3BUVA 4MWAE 3MHFA 3LV5A 3DEQA 3P14A 3RCMA 3Q2DA 4H7VA 1XLJA 2NWSA 3FDGA 5AKQA 4Y6GA 4JIEA 4EAMA 3I6EA 4KRZA 4ZOCA 3VKDA 3NQ2A 3UGVA 3IIZA 4IQJA 3EXRA 4UIOA 2DH2A 3HQ1A 1R3VA 3WQPA 3STEA 4MZ8A 1GZ1A 3WDHA 2QW5A 4O1BA 1E40A 4REQA 2YL8A 1NF0A 4UZSA 3M7SA 1T41A 2YCLB 4L4OA 3IUIA 4PMUA 4A2SA 1F61A 3WQGA 3T7VA 2VNCA 1O6IA 3D0CA 1MXSA 5FOOA 1FUYA 4S3BA 3W1UA 3GNDA 3FS2A 4DUOA 2FHFA 4KS0A 3CWOX 4H8HA 3ZIZA 4YVXA 1KFLA 4AWTA 1R3RA 4O18A 2XSBA 2CU0A 4FOJA 2J77A 4GGBA 2QJMA 1V0LA 1Q6RA 2D0FA 3REQA 1Q2SA 2ODOA 5LNWA 3CUZA 2X05A 2R1KA 4N9CA 4IP7A 2A3CA 3DHUA 3C2YA 3W7IA 3RJYA 3QJAA 3EX1A 1CLVA 2FHBA 4A4AA 3KCOA 1JQVA 4C7DA 3GVGA 1B9BA 3O9NA 3ZR4A 4YVVA 1TZZA 1Y5VA 1AMKA 4GC3A 2H9AB 5DEZA 3VNKA 2WQPA 3GDKA 1R3QA 2FVLA 4GQ0A 1TJRA 4NY2A 3DI0A 1DV7A 1FKXA 2XPKA 4DJFA 2FKPA 4TU1A 3NJ3A 4L9ZA 3WSUA 3HOJA 4GYJA 2G50A 4LNCA 2J8GA 1ISYA 2BHYA 3WLIA 1UUMA 4L6HA 2Q09A 1FHUA 1GT8A 2X0HA 1J6OA 4UFKA 3M0YA 2VO5A 1JL8A 3LSBA 3PJTA 4M56A 1SR9A 4C6LA 3QQWA 5U4NA 3V1PA 1I4NA 4XIAA 4GYPC 1LCOA 4QE5A 1EQPA 2PE4A 3GXNA 5BMWA 1EJSC 2GOKA 3QFWA 2X41A 4KT2A 2XN0A 2V5DA 4WK9A 2VEIA 3VX0A 1KRBC 1MSSA 1EDTA 1EJ7L 1BSLA 3L7RA 4H04A 4ZFCA 4ZE4A 2GGIA 3TYZA 3UNTA 4X61A 4AD4A 4NJKA 2XIBA 4H6EA 4UMCA 3B06A 2HV5A 1QHOA 4DRSA 3BLDA 4D8ZA 1WZAA 4NJHA 3OVGA 4O13A 4N0RA 1R2SA 2WNWA 5DELA 4DM1A 4IT1A 4EPEC 5D38A 1F8IA 3WFAA 2CW6A 1E72M 2WSRA 3DDMA 4PR4A 7REQB 2YXXA 4FX7A 1JNDA 4QR6A 1XBVA 4S23A 3CS2A 3O1NA 2W61A 4LY8A 1UHVA 4ZTXA 5F2GA 3ARVA 3H2OA 4WRHA 4K1WA 5E9XA 1A5KC 4LWWA 4B2DD 3RO8A 2QCNA 4WY0F 3HF3A 2ZX6A 4EPKA 2VVNA 2ICSA 2GJNA 5GJPA 2XVPA 6XIMA 3W7HA 2YB1A 2R9RA 1QPOA 4TX6A 5D37A 4YPJA 2QZRA 4EK7A 4HHHA 1UBPC 3LNPA 3VE7A 3E0VA 3MKVA 2XSXA 1ZP3A 1NU5A 4HN4A 2CKSA 4DBSA 5FA5A 3SEPA 4WJXA 3UJEA 3RUBL 1BYBA 2DQWA 2Y8KA 3VIGA 1QCWA 1V0KA 4F8XA 3A4JA 3AXMA 1BQCA 1QI5A 1MQPA 3G6MA 2Y88A 2ZE3A 4D72A 1KLYA 4N2YA 3W24A 4K68A 2PDXA 1P6WA 4OUEA 1TTIA 4DYJA 1B30A 3TFXA 3BAJA 3AS2A 4Q3MA 3VGFA 1ADSA 4WDUA 3NO5A 1YIXA 4XAFA 4HZMA 4PMDA 3TVAA 5D09A 4E4FA 4KGLA 1TMQA 1F4AA 4CD6A 1XYAA 4HU8A 1J0KA 2WZEA 1BGAA 1N8WA 2DIEA 3UETA 4NAFA 3WD3A 3NAVA 1JFXA 2NVCA 1IZKA 4LRTA 2YPIA 1Z7AA 2CIPA 2IQDA 1A49A 3NDOA 1HKKA 3NL6A 4XAYA 3BLPX 4PTMA 4BR1A 3E5BA 1GOMA 3TSMA 3NWRA 1W9DM 3XINA 3R0UA 5CPLA 5T9CE 4I7WA 4FNRA 9XIMA 1OCJA 3NPWA 5FF7A 5FJRA 3MC5A 5BWFA 3LHVA 2WZIA 4LYPA 4NZ5A 1RPKA 2WNQA 3GS6A 5EB8A 2X2GA 2QCCA 3OA3A 1M3UA 1C9WA 1E3ZA 2GJLA 2DZWA 1IXPA 1VBHA 1CGTA 2QJHA 1O5KA 1YBQB 3E3HA 4RJEA 3GDLA 1DJXA 4JFSA 2YFOA 3GG8A 1N2VA 1MW3A 3UG3A 3MI2A 1TUXA 1M01A 2QULA 3VI2A 3SFWA 1G4EA 1WUEA 2HE5A 4L1XA 4E6MA 2IKJA 1V8EA 2B7PA 3IIVA 3S1XA 3ABOA 3CJPA 2D2OA 3F2CA 2YDSA 4XISA 2AMXA 4AZ5A 4FXRA 4PEKA 4J28A 4JHMA 1CXHA 3VPLA 1PHWA 5C54A 2PGFA 4HYWA 2JALA 4A6GA 1RUSA 3MDWA 2R6OA 1UP3A 1H7RA 3AMCA 1LL4A 4O54A 3TV8A 3PBWA 3SCQA 2UZ9A 1DJWA 4JX6A 4W4QA 3STCA 3CL7A 1HFBA 5GJNA 1J5TA 1EDGA 6TAAA 3CV1A 2XFYA 2G3MA 2Z2AA 4MADA 4H2HA 4I7UA 4AZGA 2CYGA 3SB0A 3O6DA 2QPUA 2MANA