2XGBA

Crystal structure of barley beta-amylase complexed with 2,3- epoxypropyl-alpha-d-glucopyranoside
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
486
structure length
486
Chain Sequence
NVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-AMYLASE
total genus 192
structure length 486
sequence length 486
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xgbA00
3WNMA 1TMQA 1RPKA 1D7FA 1CXIA 3UG4A 4MNKA 2CBJA 1ZJAA 1V3KA 4UFLA 4ZE5A 5ABFB 4ZXOA 1UA7A 1JD7A 1E9LA 3AZSA 4IISA 1G01A 5IFTA 1KCLA 2Y24A 1CNVA 1YQ2A 3AIBA 3GXIA 4JHOA 1JDCA 2IXUA 1UR8A 2XWDA 1JZ2A 2WYSA 4PTWA 5A6SA 3F5JA 3OGRA 4PCSA 1J0ZA 1MW3A 4UTFA 2DEPA 1E40A 2CYGA 3BGAA 2BVYA 1J0KA 1OT2A 1OD8A 2VMFA 3WDPP 1LWHA 1CXLA 4MDOA 3WNLA 3GNPA 4UOJA 1R85A 5AY7A 1IT0A 2ZWZA 1JI1A 3SCSA 1GNXA 7TAAA 3WNNA 4PTXA 3AIUA 1MQPA 4AIOA 1E72M 2W4XA 4XB3A 3PZMA 1JAKA 2J77A 1UR0A 1QNSA 3UETA 2TAAA 1VJZA 2FHCA 2VTFA 3WMCA 3IJ8A 4UOQA 4IM4A 4X0NA 3AMDA 3AROA 1EDTA 2ZX9A 4AZ7A 3OLIA 3SCPA 2C0HA 4J3UA 2DSZA 2GDUA 3MV11 3W82A 1UKQA 1UWSA 3WQWA 4AW7A 3ARPA 4EKJA 1UD3A 5A8MA 4UQDA 4ZENA 4AY1A 1DWIM 1VJSA 4HOXA 4V27A 4MNJA 2GJXB 5E09A 1MYRA 2JIEA 3MU7A 4U31A 4W86A 1PZ2A 1MXGA 1F4HA 3VPLA 1J0JA 1AVAA 3IK2A 5TD4A 3T0BA 1PX4A 4KGJA 3VU2A 5GPRA 1NOFA 4AMCA 4UZUA 3WDQA 3NSXA 4MJ2A 3QOKA 3QHOA 2PWEA 2D0HA 1WO2A 2DSVA 3CHDA 4JFWA 1UWRA 1KXQA 2J7GA 1HIZA 4QFUA 1D3CA 2QPSA 4PMVA 3L4TA 4AZ6A 3L4UA 2D3LA 1QNPA 5EB8A 3SCUA 4M29A 4C7FA 3CMGA 3W27A 1TFVA 3THDA 2J7HA 2JFEX 2D0FA 5IHRA 1UA3A 2Y8KA 5IFPA 2O9TA 3SEPA 2DH2A 3JUGA 3WY1A 2XTKA 1QBBA 3VIHA 3B8SA 2W63A 1UD2A 2FH6A 2J7EA 4DWSA 1CECA 1KXVA 1HF6A 1EIBA 3AS3A 1R8LA 2J7BA 2XVKA 4D6IA 2O9RA 2WVUA 1E55A 1EHAA 3M46A 4LQ1A 1W91A 1W9VA 5D4YA 1JZ8A 1B9ZA 3MMDA 4FF5A 1LJYA 4H8UA 1SMAA 3OZOA 3W6LA 4M8UA 1WZAA 3O9NA 7CGTA 1J12A 3L2LA 4HOZA 1JIBA 3WFZA 1CGTA 2EPNA 1GOMA 1QI5A 4TVCA 1E73M 4FLOA 4U3CA 2ZICA 3VIJA 2BY2A 5D8WA 4ZEPA 5CG0A 4QLLA 4QCEA 5D9NA 3TTYA 5I3DA 1JZ7A 1W9XA 2FHFA 1DWJM 5I6SA 1A47A 4GZJA 4U5KA 1KBKA 1XC6A 4EAMA 2XVGA 3OZPA 5EFFA 2XSBA 2UY3A 4E8CA 1VEMA 2DPEA 1KGXA 4P8VA 2BV9A 4AEFA 1PIFA 4P7QA 4PTVA 3WL1A 4S3JA 3U7VA 3PTKA 5BXRA 5EBAA 4U3AA 1PBGA 5A2CA 1NQ6A 3W29A 5HNNA 1V6XA 3WUBA 3AIRA 2WW5A 2G8ZA 3B9AA 4BQ3A 4CCCA 1ZL1A 3WL0A 3M7SA 1OINA 5BRQA 3A4XA 1CEOA 3SURA 4WSKA 3SCVA 3OA5A 4IPNB 2UY4A 5HPOA 1BVZA 1HVXA 2E0PA 5ABEA 4OBRA 1V6UA 3AOFA 1E6SM 4N42A 3CHEA 3K8MA 1BYAA 1HJWA 1HL9A 2VNCA 3WNPA 2VZOA 3RIKA 3PTMA 3CUGA 1CXFA 1E4LA 1WE5A 4DUVA 1V3IA 1VFFA 4PTMA 3A4WA 2WMKA 3EDKA 4HPGA 2DDXA 4AXNA 4NZCA 4UFJA 3VIGA 5ECUA 2CESA 3VX1A 3K46A 1KWGA 1KCKA 2WMIA 1SR0A 3AHZA 1TE1A 1C7TA 1EXPA 1JL8A 4WF7A 1HVQA 3TTSA 3AICA 3DYOA 4LPCA 4XZWA 1R7OA 1MQRA 1Z32X 1HKIA 1VEPA 3CIVA 2PB1A 2XG9A 3BXWA 2BY3A 4UZSA 4RE3A 3VTRA 3OLGA 2XUCA 1BGAA 4OKDA 3B9EA 2CIPA 4AD5A 2XWEA 1UUQA 1BYBA 4DUXA 3CUJA 5BCAA 1UD4A 2YBTA 5FCZA 4BCEA 3AMKA 2WSKA 4W7VA 4D72A 3EDDA 4D1IA 4KMQA 2OSYA 3AMCA 5BXTA 2WCGA 2YA0A 3EMZA 4GPNA 1E6RA 5GNXA 1OIMA 2VX5A 5A95A 1MFUA 2HVMA 3BAJA 4PMRA 4W5ZA 2OSWA 4HA4A 3MMWA 1JYNA 3U5YA 5IHSA 4Q7NA 2WSPA 4PMNA 1JDAA 2ZOXA 3NCOA 3BCFA 1XV8A 2PF0A 1EA9C 1EQPA 1J0HA 3EDEA 1B1YA 1UZ4A 1OT1A 1UYQA 1WDSA 1KQYA 3CH9A 2WHMA 1E5NA 4DM2A 3GNRA 4F9DA 1JF6A 3N12A 1FFRA 1C90A 4YHEA 4J3WA 2V3GA 2YA2A 3K4AA 2WVTA 1XSJA 1JNEA 5ABHA 2G3JA 4DWSB 1LL4A 1GOOA 4GQRA 4HMEA 1UKOA 1OWQA 3WDRA 3A4AA 3EYPA 1V3MA 2PBOA 4FMVA 1GONA 2VX7A 4ACZB 2VJXA 3GZAA 4UCFA 4PMUA 2V38A 2NW0A 1RP9A 2DGAA 4BZYA 2A3AA 1LG1A 3IAPA 3WH6A 4M1RA 1LG2A 1CYGA 1JF5A 1DHKA 5GNYA 3O6AA 4DM1A 5HOSA 3L4YA 3N11A 1Q6CA 1CLXA 1EH9A 4OBSA 1DEDA 4D6DA 2OYLA 3N15A 4JAWA 3AMLA 1BFNA 3ZJ6A 1V6WA 1WKYA 4URIA 1OGGA 1SFSA 2J79A 3GBEA 3RDKA 1ISYA 1H0GA 3VD7A 2FGLA 1VFOA 1ITXA 2YJQA 3F4VA 2JEQA 3TP4A 4D6EA 1AQHA 4HMCA 4WKAA 3NDZA 3GM8A 4C7DA 5CSUA 1GVIA 1TG7A 3QHMA 3CGTA 2ZXBA 3AJ7A 2J25A 5JIPA 4JL2A 4IPLA 2B31A 4P7NA 4MADA 4B3LA 2CBIA 2PBGA 5M17A 3T2PA 3CTTA 2QF8A 2VX4A 5A6JA 3SUTA 4PMDA 1VENA 4W85A 1GUVA 3POCA 2VQUA 3VO0A 1E0WA 3L2MA 2EJ1A 4PUEA 1UHVA 3CZJA 1KB3A 1J18A 1V0LA 3CZLA 3AZRA 4H2CA 4PMXA 3WDJA 4JKKA 2XFRA 4YPJA 2VL4A 1GW1A 3N18A 5I23A 3FXYA 1VIWA 3TTQA 5I0DA 2OWCA 1WCGA 9CGTA 3L4XA 2UWFA 4P7LA 4S3KA 4ML4A 1QHZA 4GZEA 2WBGA 1US2A 3WF0A 4GI8A 4XV0A 1C7SA 1CGXA 3UEQA 1KXHA 2D22A 3GH4A 4AZCB 4GKLA 3OG2A 2W5FA 4FLRA 4CUCA 1E6PA 4CGTA 6TAAA 1CENA 4QDMA 4GQQA 1V6VA 4P8UA 4ZXLA 3ARXA 3BAKA 4E8DA 2BXYA 2WHKA 4GIAA 4JFVA 1WZMA 2O9OA 1W2PA 1WDQA 1G9HA 5FOOA 4QLKA 4WSJA 3VDAA 3RILA 3U7BA 3ZOAA 2G4FA 2EQDA 3WD4A 4AISA 1GOWA 4HZ6A 1EOMA 2VCCA 1CLVA 1UH2A 1HKMA 2GDVA 4A3HA 1V3LA 4R5EA 1BHGA 2ESCA 3D5HA 1VBUA 2VZSA 3NJ3A 1XCXA 1I1XA 3VUPA 1GQLA 4EE9A 5I5RA 3VDCA 1UQZA 4CU6A 4HP5A 2HISA 1JYWA 1GVYA 2YL5A 4Z2IA 3HJEA 5F7UA 1OGBA 5D8ZA 1KQZA 4M24A 1UD6A 1HN1A 5A6BA 3VGBA 2XM2A 4JFTA 4NI3A 2WM0A 1CGVA 4PN2A 2JF6A 4HZ7A 4LYPA 1GZJA 1NP2A 4CD5A 3OLEA 2DIEA 1OIFA 1WPCA 3BC9A 1KR1A 4OUEA 1XYZA 1EO5A 1JXKA 1B3XA 1B31A 3POHA 3MANA 4UQEA 1UD5A 1K9TA 2YKKA 1FFQA 3FAWA 2VR5A 4H8HA 3K4DA 4MB4A 3AYRA 2OWWA 2CNCA 3NIYA 2BNJA 1JZ6A 3PN8A 4F9JA 2G3NA 3ZR6A 4MB3A 3AMGA 3BH4A 3ZMRA 2ZXDA 4MPKA 2Y5EA 1QVBA 2QMKA 2YIHA 4GI9A 2E40A 4NRSA 3ZJ7A 3PTQA 2XGBA 5DO8A 3W37A 1R7AA 2E8ZA 2CBUA 4A3YA 3ARVA 3FAXA 3AS1A 5DEZA 3IJ9A 4B3KA 2XJ7A 1KFWA 4KGLA 3GBDA 1V0MA 2NSXA 1KR0A 3AIVA 4V2XA 3ECQA 2BY1A 5A8QA 4JCLA 4TOQA 4J3VA 1IZJA 4TX8A 4V28A 4ATDA 2CEQA 5A6LA 3ZO9A 2XM1A 4TX6A 2JF7A 5LA0A 5A8NA 3WQ4A 2VZTA 2GFTA 2O9PA 1ISWA 4PSRA 2D23A 3WDHA 4ATLA 3VGHA 1CIUA 1G0CA 5GNZA 4JIEA 1W1PA 1YHTA 3BMWA 4JKLA 3WBEA 1PEZA 4W8BA 1E0VA 2O92A 1W9PA 1E4IA 2X0HA 4W7WA 4CU8A 1W1YA 3CHCA 4W8LA 2CETA 3D3AA 3VDHA 1LLOA 1EDQA 1QW9A 2AMGA 4UOZA 1C3FA 4P8WA 1KBBA 1OM0A 2WPGA 1B3WA 3VX0A 3KWXA 4TVDA 3VD4A 2WHJA 1HKJA 3DECA 3WUEA 5FL1A 1UWIA 1J10A 2WCAA 5CZKA 1M7XA 2XVNA 3CUFA 2VVNA 1QW8A 1QBAA 1BAGA 2D1ZA 1XSIA 4W88A 1D2KA 1W9BM 3VGDA 4U5IA 1SYTA 4J3SA 4LXFA 1M01A 4AZCA 4AZGA 5M5DA 1DTUA 2BHYA 4FLQA 3G6LA 3AIEA 4CKQA 2V5DA 1UKTA 3J7HA 2CITA 1JD9A 4AZHA 4D6CA 5HBFA 3KL5A 3RJYA 2Z1SA 2EO7A 3WFLA 3SCTA 1CXEA 2BFGA 2CHNA 4KWUA 4QP0A 1E6NA 4BQ2A 3ZJ8A 5HXMA 3AFBA 1K9EA 3L4VA 2XHYA 2WWCA 1BSIA 5I24A 3VGEA 2AOSA 2XSAA 1V0NA 2V3FA 2VRKA 2BVDA 1E70M 1KGWA 4BA0A 1UR4A 2ZUNA 3FHAA 2GSJA 4PRWA 4HU0A 1M04A 1G5AA 1VRXA 2VRQA 3N9KA 4EK7A 1V0KA 3ZT6A 4CD7A 3VM5A 4Z2GA 3GNOA 3BCDA 4GINA 1B3ZA 4KH2A 2WBKA 2EPOA 4CVWA 1H4PA 2OSXA 4FLSA 4NRRA 5CGMA 4W5UA 5C70A 3KE0A 1E71M 1E6ZA 2VO5A 1X6NA 1ECEA 1W1TA 3E1F1 4XX6A 3UERA 1ODZA 4WJXA 1H2JA 1GOKA 1V08A 1JZ4A 3QOMA 2WMGA 5BRPA 2WANA 1AMYA 1QHOA 3VD9A 2Q8XA 1UQYA 2PC8A 3VMPA 2GUYA 3EMCA 3WKZA 1HJVA 4E4PA 3GXFA 2ZE0A 3AIWA 3O2LA 3KL3A 1NWUA 1RD6A 3CUIA 3FN9A 1CPUA 1NARA 1WZKA 1K9DA 4OOUA 1MW0A 1VFMA 2X8RA 4ZE4A 4AIUA 2ZX6A 1FHDA 2ZXAA 5C8BB 4QCFA 4WKFA 5A94A 3L4WA 3CHFA 1X1NA 2E9LA 4W8AA 3NDYA 2Y8VA 3UG3A 2FH8A 3DHUA 1U33A 4HPHA 4UFHA 1E1FA 4CVUA 4Z2KA 3VIMA 4BQ4A 4AD0A 3OLDA 1SMDA 3OB8A 2DT3A 1EGZA 1K9FA 3WQ8A 3A3HA 3PZQA 4GXPA 1L8NA 3M07A 4UQAA 5JBEA 1TUXA 1HT6A 4H04A 2YLAA 3IJ7A 2J62A 4K68A 4D1JA 1H5VA 3ARYA 2EPMX 1EOKA 1HL8A 1JFHA 3RM9A 5A3HA 2D0GA 1DWGM 4Z2HA 1W9DM 3MUY1 1QI0A 3N17A 2VQTA 5ABGA 1JI2A 3IAQA 2BXZA 3AXIA 5CLTA 2DSWA 3PZIA 3T2OA 4PCTA 2GJPA 3ALFA 1H49A 1PJ9A 2VCAA 1CGWA 1J11A 3APGA 5AC5A 2DSUA 4DWSD 1H11A 2ZUVA 1UG6A 3SCRA 5CGTA 4MJ4A 1JGIA 1XCWA 1NWRA 3MV01 2BVTA 3FHQA 2J78A 3WQVA 1U30A 4CN6A 2W91A 1I1WA 2J7CA 4TTGA 2F8QA 1CGYA 4MNLA 1MW1A 3VGGA 2WNWA 4KRUA 3HU7A 4AWEA 4UR9A 3CZ8A 3W25A 4ACYA 3ZT7A 1MFVA 3OGVA 1E56A 2E9BA 3U5UA 4WKHA 3WH5A 1KGUA 4U2YA 4A4AA 1G1YA 3WBAA 1AQ0A 2YL8A 4MB5A 2CBVA 2YA1A 4B16A 3ARUA 1I75A 3FNDA 4YN5A 3L4ZA 4AD1A 1E43A 2DH3A 4H8VA 3K1DA 3ALGA 5DT7A 5JIWA 1ISVA 2XIBA 1E0XA 2BY0A 1US3A 2GK1B 4BF7A 1O7AA 3PZTA 1QNRA 2WMIB 1W3HA 3PZUA 4D6JA 1JAEA 3PBGA 1C91A 4AD3A 1C8YA 1CDGA 2WZEA 3UG5A 1MWOA 5A6BD 3N13A 4DUWA 2AAAA 5A69A 1CWYA 3AHVA 1M53A 1ZBKA 4UFIA 2OYKA 3VMNA 1WAWA 1OD0A 1W3KA 1RP8A 5A8PA 3EDFA 3SCNA 4RE4A 2CHOA 1ZB5A 3MS8A 1ZBCA 2ZIDA 1PAMA 4J28A 5EMYA 4UFKA 2E8YA 3VD3A 1VFUA 1W9UA 1WZLA 4WLCA 6A3HA 1NWTA 1W3LA 3QR3A 4D6GA 3SCQA 2WMJA 4CD8A 1H0IA 5M03A 2PI6A 3ARZA 1FH8A 5FKYA 2WXDM 3MUIA 3WD3A 3HMCA 3DC0A 3CBWA 1UR2A 1V6YA 2QLYA 2WCSA 2D2OA 4PEEA 4CU7A 3GXDA 1QNOA 1W32A 3WEMA 3VIOA 3FW6A 5HPCA 4OJYA 3S2CA 1C92A 1G94A 1GQJA 2YL9A 3SCOA 1UR9A 3RO8A 1JNDA 1XH1A 4ATWA 1UOKA 2VZVA 3ARRA 4EANA 2BHZA 2CXGA 2XVLA 5JBFA 4W89A 3BLKA 1WP6A 4PMZA 2VI0A 5E6YA 1B2YA 5KEZA 3VILA 1ITCA 3EMQA 2EPKX 3M6DA 1XGZA 1MXDA 1FOBA 2J74A 5FIPA 2ZX5A 1B90A 3CO4A 4J3TA 1EHNA 1GQKA 4MNMA 2VRJA 3UESA 5JUVA 1BYCA 3ARWA 1UWQA 3VIIA 3WQ6A 1OCQA 1XD1A 1NOWA 2CCRA 4GO8A 1UWUA 1V3HA 1H09A 3ZM8A 1TVPA 5A2AA 2JE8A 1ESWA 3WF3A 3SUWA 3U57A 2V3EA 2E4TA 2BHUA 3NSMA 4RL3A 4PUDA 1V3JA 1VAHA 2X1IA 1FP8A 4M80A 1GJWA 3WD2A 8CGTA 5C71A 1O6IA 1OGSA 5BYWA 3TOPA 3DYMA 2VR4A 5A2BA 5A8OA 1F4AA 1JXJA 3WH7A 3WELA 1TCMA 4TXEA 4B15A 2X05A 2Y4SA 3W6MA 3W28A 4PMQA 4WIWA 2CPUA 4FK9A 1E5JA 1HJXA 1JFXA 1CTNA 3BAWA 3N1AA 3II1A 5I79A 3A47A 4Z2LA 3QHNA 2E9MA 3RMEA 4H41A 3N04A 1CGUA 1J0YA 1HJUA 2DT2A 2WKGA 2BS9A 3MUAA 3S6TA 1IZKA 5FL0A 1GOQA 4PBGA 5I77A 1ODUA 3VIPA 3WN6A 2PWDA 2VOTA 3RJXA 4MDPA 2J75A 2RGLA 2DQXA 3CZKA 4PSPA 2A3EA 3PZGA 1BF2A 1C8XA 1X6LA 1M03A 4AZBA 1V02A 1WDPA 5E0FA 3AQUA 4AEEA 1XHGA 1GQIA 1LWJA 3BAYA 3LPGA 1H41A 5LA1A 3WENA 5A6MA 1J01A 3AYSA 1J0IA 3BSGA 3SUVA 1H1NA 2C8NA 5JBDA 1KXTA 4HA1A 4D6HA 3BAIA 4AC1X 1Q6GA 2MANA 3MSDA 4J3XA 1DP0A 2WKLA 3GYCA 5AYBA 4QLJA 2F2HA 1XH0A 4N0RA 1UKPA 4NSBA 2WHLA 2WLYA 4AZ5A 2QMJA 2X09A 1FH7A 5DF0A 4B9ZA 4H7VA 2FDMA 1E6XM 3UR8A 4PMYA 4X9YA 3SIMA 1ISXA 1BVNP 4F66A 1PPIA 3NUKA 3K8LA 1ISZA 1WB0A 2QPUA 1HP4A 2WB5A 1TVNA 1QOXA 3A6OA 2XPKA 3AS0A 5D9MA 3GH7A 3LMYA 1ZS2A 3LPFA 2X2YA 2WMHA 1GPFA 2GJRA 3CUHA 3ZSTA 1HP5A 1UH3A 4OIFA 4F79A 2VC9A 4IUGA 1MVYA 4D71A 4HMDA 4R27A 4P8XA 1C93A 5M3WA 4Y7EA 2JALA 3ARSA 2WAGA 4JFSA 4CN4A 1JZ5A 5CPSA 3BSHA 1XH2A 1QNQA 4HU8A 4P7RA 3VIKA 2JEPA 5LA2A 2XIIA 3RCNA 3PHAA 3T0AA 2ZUWA 3GXMA 3DYPA 2V5CA 1DWHM 1B3VA 1NM9A 3AI0A 4NF7A 1JYXA 1QHPA 3VNZA 2J8GA 1NH6A 1VF8A 1BG4A 4W7UA 3ZR5A 1XD0A 2D20A 3VVGA 3MSGA 3ARQA 1FHLA 1TZ7A 3KZSA 2A3CA 4W84A 6CGTA 2NT0A 3NSNA 1JZ3A 1QI2A 2QV4A 3AHYA 1R86A 3WD1A 4CD4A 1XSKA 4MAZA 3I3EA 4TTUA 2WWDA 3AZTA 3BLPX 4W87A 4AYSA 3T2QA 2J8FA 2GK1A 2VX6A 5KZ6A 1ZU8A 3KEHA 3BAXA 1V03A 1HX0A 2GVYA 4AIEA 2WVVB 1LF1A 5E6ZA 2WMFA 3VIFA 1K6AA 1HJSA 2WZHA 2E3ZA 5D9OA 3ARTA 2VCBA 4TUFA 4HOWA 2NT1A 2ZUUA 1OBAA 1J9YA 3THCA 2D3NA 4CD6A 4CCDA 1CXKA 1HKKA 3WEOA 4P7OA 2WC7A 2G3MA 2Z1KA 4OZOA 1N82A 2V3DA 5CQ1A 3VOCA 3GH5A 3MUZ1 3EBVA 3UCQA 2QHAA 2C7FA 2A3HA 1A3HA 4E2OA 3WNOA 3CPUA 5DT5A 3LPOA 1CZ1A 2CKRA 5CJ5A 3OGSA 2XGIA 4GZIA 5CSYA 1ZBVA 5CLWA 2ZX8A 2EEXA 1BLIA 1Q6DA 3SUUA 2VURA 2G3IA 4LGXA 1AQMA 3F5LA 1E3ZA 3VMOA 3TTOA 5BROA 4J27A 2ZWYA 1MQQA 3ZQ9A 3WIJA 3K8KA 1VB9A 4DWSC 3MKKA 4WK9A 2EXOA 1BYDA 1W3JA 2ZX7A 1UR1A 2CKSA 3CMJA 2OLHA 3WEZA 2WLZA 1NWSA 4OOZA 3AXHA 4LYRA 1PX3A 2VVSA 1GORA 2VUYA 4J7RA 4CN1A 4TVUA 2FGZA 3WSUA 3WF2A 3VM7A 4MTVA 3VKKA 1E3XA 5FD0A 3MMUA 1HJQA 4UQCA 1R87A 3CZGA 4L4OA 2XFFA 4MB1A 2PWGA 3VINA 5BXPA 1U2YA 2G41A 2YDRA 1H3GA 1Y7VA 3PZ9A 1QI3A 2PWHA 1UWTA 3HN3A 3BMVA 3PZNA 3SCWA 3I3BA 1B0IA 2W61A 4UFMA 3RM4A 4W93A 2OYMA 5CPTA 1BG9A 2DT1A 2OWXA 1MW2A 1LL6A 3AIQA 1OB0A 1S46A 4M56A 2UY2A 2WC4A 3AHXA 1Q6EA 3WH9A 4JFUA 3W4RA 1FA2A 1QPKA 3VDBA 3QGVA 1PX8A 3B9DA 3PZOA 2ZXQA 3GTNA 1QI4A 3ZIZA 5E0CA 4M82A 3ZSSA 4JHZA 4AZIA 4C7GA 2YLLA 8A3HA 2X0YA 3DHPA 2YDSA 1OSEA 2WC3A 3WF1A 1W1VA 2WZIA 5E9AA 1Q6FA 3WMBA 3FY1A 3VGFA 1PIGA 4B9YA 3IANA 1FH9A 4UNIA 3WD0A 1KWKA 1B30A 5A6AA 1BPLB 3CZEA 4XUYA 3CLWA 4HA3A 3RM8A 3W0KA 5IDIA 1E6QM 5I78A 2VZUA 3MO4A 4U2ZA 3AS2A 4QAWA 4L4PA 3T08A 7A3HA 3TONA 3T0DA 1EQCA 1TA3B 1HXJA 4HTYA 4X0VA 4BS0A 2J47A 4LX4A 5LYRA 4D6FA 3OBAA 2CERA 4UQ9A 3ZJKA 1GCYA 4Q22A 1HNYA 2J7DA 3RPMA 4PYSA 3NYDA 1JYVA 4AD2A 2UY5A 4KRTA 1GHRA 1E4NA 1CBGA 4JL1A 3TA9A 5IXEA 3W24A 5GQBA 4ZFMA 3PZVA 1LQ0A 2JIWA 3F5KA 4U33A 1RH9A 4Z2JA 2YDQA 2YOCA 1UZ1A 1C8QA 2RGMA 3G6MA 3WMSA 5AC4A 3GDBA 5BWFA 1VBRA 1EDGA 1BQCA 3VNYA 3LPPA 2YBUA 1XYFA 1VEOA 5ABFA 1DWFM 1DWAM 3WF4A 1FP9A 2GJXA 5AYIA 2J4GA 3W53A 1EO7A 4XZBA 1TR1A 1TA3A 1XRVA 2YL6A 3I3DA 4ACZA 2PWFA 2F61A 1W2VA 2W92A 5E70A 2XYLA 1GOIA 3W26A 4M81A 4CCEA 2IUZA 4AD4A 4JCMA 1ZBWA 1BTCA 1WNOA 3WQ5A 3T09A 2D24A 2EBNA 2J7FA 3KL0A 1UH4A 2IXVA 5A1AA 3W81A 3EDJA 1NOUA 3AISA 4UQBA 2WK2A 2DIJA 2ZUMA 5CPQA 3VD5A 5HDRA 1UD8A 1V02E 3AHTA 1IV8A 1E15A 1LL7A 4F8XA 4MAVA 2ZUSA 4RE2A 3AXXA 3WH8A 2A3BA 4PMOA 5DFAA 2DT0A 1E4MM 5A6KA 2ZUTA 1NP0A 2FHBA 3UR7A 5D9PA 1P6WA 1GJUA 5CXPA 3W38A 2W62A 2XVPA 3ZT5A 1CXHA 3SUSA 2DSKA 5DMYA 4GO9A 1BGGA 5EFDA 3OIHA 2W66A 2WVVA 1B3YA 1JG9A 1PZ3A 1GHSA 1ZJBA 4HZ8A 3WUFA 1E1EA 5I2UA 2W67A 2EPLX 3WUGA 4JKMA 1Q4NX 1WDRA 2Y2WA 4YHGA 1JDDA 2XFYA 1UKSA 4GI6A 3WDIA 2VT0A 2WVSA 4JZ5A 4LYQA 4BQ5A 3WNKA 1L0PA 5BXSA
chains in the Genus database with same CATH superfamily
1ECQA 4WX2A 1Q66A 1CXIA 1NEYA 4C6FA 4HTBA 1RK5A 4F0SA 1ZJAA 4GYPC 4IGSA 3SECA 3LI1A 3SQMA 3AZSA 2YFNA 4U28A 5IFTA 5HNUA 1CNVA 1YQ2A 5HMFA 2XWDA 1BWVA 1FDZA 4Y9MA 3W87A 1H7RA 1H7NA 4PCSA 1J0ZA 3FLUA 3QV6A 1Z8AA 3GDRA 4JTJA 1J0KA 4JTHA 4MDOA 1Z48A 2GJLA 4JX5A 2PP3A 4C6KA 2ZWZA 1JI1A 2DJLA 3VFLA 4PTXA 3AALA 2Y89A 2X1SA 4M7SA 1E72M 2W4XA 5T26A 1R3SA 2J77A 3UETA 2VDGA 2TAAA 1VJZA 1R2SA 4IM4A 5CPMA 1JCYA 4RX0A 3T55A 1OYBA 1GW9A 5D02A 2DSZA 3MV11 5I3IA 3GDLA 1F6KA 1YTEA 3M6YA 4O16A 2BBFA 1RALA 1PV8A 3UCDA 1UD3A 3TZFA 1VPYA 3CB3A 4UQDA 4C6OA 3IJ6A 3JVAA 4AY1A 4HOXA 1VJSA 5E09A 3PAJA 2JIEA 4ZSUA 4LVDA 1XG4A 4XKYA 6REQA 5D05A 1XLFA 2QJGA 3KTCA 3W72A 1SZFA 1J0JA 1AVAA 4HHMA 5TD4A 3NQBA 1G4EA 1US0A 2YYTA 5GPRA 4MSSA 4LS2A 3R8GA 1NOFA 2NLIA 4AMCA 4DZHA 3W02A 3MY9A 3QOKA 2O4QA 3P8IA 2B7OA 1WBHA 2J7GA 1D3CA 1ME9A 3ISIX 3A23A 3L4UA 2CZ5A 3E2RA 2KAUC 3H2CA 4M29A 3CMGA 2DQWA 3QF0A 4IL2A 4IICA 3JU2A 2O9TA 1KRAC 2C14A 3I65A 4LVBA 1A5OC 3TFCA 3B8SA 4DI8A 3W9ZA 3B06A 3MCNA 2J7EA 4GYJA 1KXVA 4B5VA 1HF6A 1WKEA 4LAKA 4G7EA 4PZVA 2O9RA 2WVUA 4LQ1A 1W91A 3P82A 3M9YA 1LJYA 1EYWA 4H8UA 4L9ZA 1SMAA 1QAPA 1R3QA 3L7RA 7CGTA 4JIPA 1J12A 1CLKA 1JIBA 4UMAA 3R43A 3B0XA 3U2EA 4FLOA 2OLSA 4AY8A 1I0DA 3STPA 2QDHA 1W8GA 2HK1A 2PP0A 3RRAA 2RKXA 5PTDA 3NFUA 1IWPA 4GY1A 4ZEPA 2JKAA 3PPHA 3A12A 1W9XA 1TWSA 1A47A 1OFQA 1KRMA 4U5KA 4DJDD 3NZQA 1H51A 1M68A 5HMDA 3T8QA 3R2GA 4EAMA 3OZPA 4E8CA 2ZBTA 4LB3A 1WXJA 1VGAA 1V77A 2QCFA 1KGXA 4P8VA 1ONXA 4AEFA 1A50A 3A9IA 3W23A 3U7VA 3KS5A 1BKHA 2RDXA 1V6XA 2X7VA 3AIRA 2WW5A 1W1ZA 3B9AA 4TMBA 4L4MA 3WL0A 3M7SA 1OINA 1E9YB 1CB7B 3DHDA 3NVDA 4OV4A 1A0DA 1SO3A 2DW7A 4BF5A 1MEIA 2BTMA 5ABEA 2X30A 4OBRA 1KFBA 2CZVA 1AH4A 2FTPA 3LCFA 1GWJA 1HJWA 2ISWA 3TMLA 3TW7A 1OX6A 3CV2A 1CXFA 1S2VA 5I3HA 1TMLA 4HZMA 4LAOA 4FA3A 4C6EA 4DUVA 1JCNA 4ZCWA 4PTMA 3W7CA 4DBSA 2PDGA 1EWEA 5G2HA 4JY8A 4MM1A 3U6WA 1XBZA 1TE1A 3TN4A 2NQJA 4WF7A 3TTSA 3AICA 2C19A 3RNDA 2FDSA 4LPCA 1TPEA 3BARA 1Z32X 1TV7A 2ZTKA 2PCQA 2PDNA 5D2XA 5DMNA 3SGGA 4QNEA 4LTSA 4DPQA 2AGTA 4AD5A 2XWEA 4C6BA 2A4AA 3QV9A 5LSMA 2YBTA 5FCZA 4S38A 2PDXA 3PWAA 1R5YA 1TELA 1XWYA 3AMKA 2TYSA 2WCGA 3NXLA 2YA0A 3EMZA 4ZQMA 1E6RA 2Y62A 3S1VA 3EWXA 5K3VA 4MOZA 2ACRA 4HA4A 3T40A 3U5YA 2OZ8A 4JN7A 2WSPA 4JIQA 2ZOXA 4A8NA 4NAEA 4E2DA 1XM3A 3EDEA 4MKVA 3IUHA 1ZPTA 5FSEC 3LGGA 3GXPA 1XLBA 3P8JA 4HNLA 5CKSA 3W1UA 2WHMA 3O3RA 2DUZA 1NTHA 2ZC8A 5F4XA 5FEWA 1JF6A 1B54A 1BRLB 3N12A 4WY0A 4IF2A 1PS9A 4J3WA 1JGMA 4ENLA 1HUVA 2YA2A 3K4AA 3I4EA 4PBEA 1LL4A 4XBKA 3TMQA 1VBGA 3CT7A 4FOUA 4ML9A 4IFKA 1CB2A 1OWQA 1W56A 2VFEA 3T44A 1JEZA 4PCNA 2VX7A 2VJXA 4GKTA 4C6DA 3SBFA 4PMUA 4HB7A 1XKYA 4BZYA 1LG1A 4HSHA 1P0DA 3PUDA 1I2OA 4LVGA 2OO6A 3M0HA 3F4NA 2XU2A 1Q6CA 4OBSA 2Z29A 5CJNA 2Z2BA 3HPSA 4S3FA 4JAWA 3W2UA 1XIMA 1TIWA 4IQDA 3WLKX 1BFNA 2P8BA 4KWOA 4JIRA 4YTTA 4ZB2A 4D6EA 2V2HA 3P62A 4JQAA 4LY8A 4DVOA 5T8GA 4QBXA 4AU0A 3QHMA 3CGTA 3QPEA 2ZXBA 4JTSA 3AJ7A 1ITUA 2ZZ3A 2B31A 3PY2A 2FTWA 4I5RA 4NI8A 2PLJA 3EOEA 5M17A 3T2PA 2QF8A 4DN1A 2VX4A 5A6JA 2WOQA 3SUTA 1FXPA 1LRQA 1VENA 1TO3A 4H6KA 1GUVA 2PDIA 5LHFA 3FS2A 4YWIA 3BICA 5AC6A 1KB3A 2W79A 4QG9A 3WQGA 4PMXA 3WDJA 3U9IA 3BLDA 3RG6A 1YNYA 1PZ1A 3GX9A 4YPJA 4ERIA 4GBUA 3N18A 4ICNA 3SQLA 3QW4B 2OQLA 1VIWA 4DF2A 1OFEA 2DJXA 3B05A 4BF9A 1OX4A 4P7LA 3DESA 4OV9A 4ML4A 1L2UA 3WF0A 3W70A 4KWSA 3LXAA 1VKFA 4HSNA 3S6DA 1FY6A 2PPGA 1P6CA 3F4WA 3B8TA 2W5FA 1GOXA 4JNYA 2XN2A 4GQQA 2HXUA 1V6VA 4ZXLA 3BAKA 4E8DA 3BG9A 4S3EA 5LIWX 1V79A 1F3XA 3BOFA 4QDPA 4WSJA 7PTDA 3U7BA 4IGNA 4XD4A 4DJFC 3BJTA 1NFBA 1M1BA 4A3HA 1ZY9A 1ZNNA 3QZAA 3D5HA 1MEWA 2VZSA 1P0EA 1OYCA 1QU4A 4J1OA 4EE9A 1QK0A 5I5RA 3R25A 2PZ0A 1YADA 4XKMA 4L4LA 4HP5A 1ZALA 5JU6A 2HXTA 2QIWA 5HAOA 1R47A 3HPZA 2KX9A 4O15A 3F1QA 5F2MA 2BODX 2JF6A 4DQWA 1LLWA 4CD5A 2P3EA 3CLMA 3BC9A 1FWIC 2PDMA 3E38A 1XYZA 3MANA 4DYEA 1QWGA 1UD5A 2YPIA 1FFQA 3UJ2A 3E0LA 3FAWA 3MCMA 2VR5A 1XLGA 2OLAA 3GY1A 3KRSA 3AYRA 2OWWA 2BNJA 4Z08A 5DRCA 3GZ3A 4F9JA 2G3NA 5LZLA 3AMGA 4I7UA 1QVBA 4AFYA 2QMKA 3CUZA 3IARA 2P50A 4XG1A 2E1DA 1VFTA 4NY2A 1OABA 3PTQA 1F8MA 2HS8A 3LBMA 1FRBA 1R7AA 2E8ZA 3S5ZA 3UVIA 3MDUA 3IJ9A 4U10A 3U8GA 2ZDRA 3TU9A 4PBFA 1PXGA 3ANYA 1V0MA 4TOQA 4FX7A 2KZHA 4TX8A 4ADTA 3GS6A 3LCGA 3UJFA 4K38A 1Z44A 2CEQA 3LOTA 3ZO9A 4EWND 1X38A 4JTIA 1AUSL 4HU4A 4YCOA 2OEMA 1NJJA 2O9PA 2XSXA 1JUKA 3FEMA 4QEEA 2A3LA 3PPFA 4S3GA 1YHTA 3BMWA 3WLHA 3VOGA 1KKOA 3FSUA 2O92A 1OFAA 1XUUA 1E4IA 3L21A 4PRTA 5XINA 3RMJA 2IQTA 4PULA 1LLOA 1LP6A 1XX1A 2AMGA 4UOZA 1UP0A 3ITLA 3IEBA 3INPA 1KBBA 4DLFA 2PDLA 4S3DA 4TVDA 3VD4A 1HKJA 3RXZA 4ZQNA 3DECA 3WUEA 5CZKA 1YE6A 2GJNA 1M7XA 2QAFA 3RITA 2F2KA 2RDUA 4U5IA 3TX9A 2J6XA 4J3SA 5EU9A 3QC3A 3FXGA 1EXBA 1JPKA 1KM1A 2EG6A 4HQVA 5M5DA 2R1MA 3CQIA 3AIEA 1BSLA 4DWDA 1UKTA 1JQVA 3J7HA 1JD9A 3DEQA 1XIHA 5HBFA 3HFYA 3KL5A 2Z1SA 4L5ZA 3PSVA 3LZ3A 4O0QA 1W5PA 4ZOAA 4H9VA 4KWUA 2OB3A 2RJGA 3M4HA 4QP0A 4M51A 3HPXA 3NL3A 5FJTA 3R12A 3G5EA 1GVFA 5E5CA 2QZRA 4J5NA 5FEPA 4Q4OA 1KLYA 2AOSA 3LMZA 4HT3A 1ZJIA 1E70M 3GG8A 1W1A1 2QS8A 2GSJA 3GU1A 3GIQA 1M04A 2ADAA 3N9KA 4EK7A 4Z2GA 3GNOA 4GINA 1B3ZA 3DBNA 4FO4A 2GUUA 2FVMA 2GQ9A 3KE0A 2R14A 3E1F1 3UERA 4WJXA 1GOKA 2VFIA 1AMYA 1QHOA 2D2GA 3LHZA 3W07A 2RDTA 3H4WA 3LLFA 4M0XA 1HJVA 3W1XA 2ZE0A 3HPAA 4DXXA 4Q8MA 4MY9A 1S1PA 2WNQA 2WKJA 1J2BA 4OOUA 1MW0A 3V5CA 2X8RA 1V51A 2ZX6A 1FHDA 4S1FA 4DELA 3MZNA 2VDHA 2F7FA 3H7UA 3UXKA 3NDYA 4ZMGA 2V5KA 2R91A 2FH8A 3P6LA 1U33A 3P0WA 4IL0A 4BQ4A 4AD0A 4Z0SA 1SMDA 1DBTA 2W27A 1EGZA 3WQ8A 3PZQA 3T07A 1L8NA 2XN1A 1ELSA 3PP7A 4BI6A 4PFHA 3TLQA 1T99A 4PB3A 3KOYA 4RE0A 1AA1B 4DJFD 5C54A 2J62A 4K68A 4LAZA 2EPMX 3JZEA 4RDWA 5REQB 3W1TA 4YYCA 4G1KA 2D0GA 1DWGM 1W9DM 1GTEA 3N17A 2VQTA 1EJRC 4LAUA 5ABGA 4IQJA 4HPJA 4X61A 2HVNA 2DSWA 1W3NA 4YIWA 2O7QA 4AVOA 1XLDA 3O0FA 5C9WA 2AL2B 3TYAA 2Q71A 3FJNA 2DSUA 2ZUVA 1UG6A 2F6UA 3TIMA 1JGIA 1XCWA 1XLKA 1NWRA 3MV01 3FHQA 4LH8A 5G4EA 3E96A 4QXIA 4CN6A 1UR3M 2ALDA 2W91A 2F8QA 1CGYA 4MKNA 2PDJA 1MW1A 1EKOA 2PF8A 3ZT7A 3WYZA 3OQ8A 3XISA 3U5UA 4BK9A 1KGUA 2XZ9A 2XH0A 1DJQA 1IEXA 4E2VA 2I56A 1KV5A 3CPGA 4GQ0A 4B16A 3ARUA 5K4ZA 2CWXA 3VNDA 2VM8A 3FNDA 4IGHA 1E43A 4H8VA 3EZ4A 5DT7A 2BY0A 1I2RA 4LC8A 2GK1B 3EXTA 3PZTA 1MZHA 1WOAA 3GNXA 3P61A 4IQLA 3PZUA 1C91A 1K77A 1C8YA 3VOJA 2ZZ6A 3W7LA 2WZEA 3GR7A 7ODCA 5D38A 1DQWA 2PDFA 3HGOA 3VNMA 4UTMA 1LBFA 5EBUA 3BL3A 3AHVA 1M53A 1ZBKA 1XFBA 1OD0A 2GGIA 4L1WA 4HBKA 3EDFA 4IIFA 1VR6A 3O8AA 1AH3A 1RV8A 3IJLA 4UFKA 3VD3A 3I4KA 3HGRA 2PURA 3UG8A 2Z27A 1NWTA 4D6GA 2ZZ4A 4CD8A 5M03A 4XZHA 3P7YA 1ZZMA 1FH8A 4ECLA 5HATA 3QV7A 4XO6A 3V16A 3DC0A 3CBWA 1DE5A 3OVQA 3SI9A 3VZXA 2WCSA 3GXDA 4O4VA 3WEMA 3FW6A 4PUNA 3TCSA 3IIVA 1JNDA 3EA2A 4A6GA 3KBJA 3DAQA 4D8AA 3LU2A 1F9CA 4S3BA 1DPMA 1TE6A 2PTWA 4FIQA 4W89A 4PMZA 4O52A 2Z2AA 3MCOA 3VKBA 3MVIA 1J4EA 1MXDA 1XLMA 2J74A 4B5TA 2QJHA 1B90A 4MG4A 3XIMA 3CUXA 3CO4A 3OIXA 2NX3A 3VOFA 3F03K 3GAYA 3EKZA 4MNMA 2VRJA 3UESA 1QPQA 2RAGA 1IHIA 4OVXA 3BLFA 2QIIA 3KVLA 3H7RA 2BASA 3H8AA 3LS9A 3W7GA 1W1B1 4XD5A 3QQ1A 1NOWA 2V0TA 4Y9OA 1H09A 2AQVA 4Q33A 5CH9A 2BOGX 2JE8A 5BU9A 3WF3A 1B57A 2E4TA 3BV4A 2BHUA 3GU9A 3ITYA 3NSMA 4QNWA 4RL3A 4PUDA 4RW5A 3EX6A 1T40A 1GJWA 2P88A 1ZQ5A 3QXBA 1W0MA 3R13A 3KS6A 1IR2A 1GYMA 2PGRA 1O6IA 1PUDA 4DJDA 1F4AA 3H12A 3R79A 3WH7A 3WELA 1F3TA 3LUTA 2UZ9A 3OEXA 3PUEA 7XIMA 3VZZA 4PCFA 3W28A 1JDFA 1R2RA 4FS9A 1JFXA 2Z7KA 4MWAD 1UIPA 1W1IE 3C2OA 5CBIA 3II1A 2XINA 2O7SA 1OY0A 1CGUA 1PHWA 1J0YA 1DQXA 4MVAA 2BS9A 3MUAA 4HJFA 1XIFA 3TN5A 1IZKA 2X1UA 4ZO8A 3SR7A 3E0WA 3MDWA 3R0UA 2AKZA 1IE7C 2FMOA 3MYOA 1W8SA 4PFMA 4PSPA 1FDYA 1X6LA 3C52A 2DUXA 4AZBA 3H2OA 5E0FA 4Q8OA 2GVLA 2XIMA 1GQIA 4RXGA 1I2NA 2ATMA 4CQ8A 5A6MA 2VENA 4WJ8A 5CG7A 1P4CA 3BSGA 4ZL1A 1EWDA 3UZYA 3KXQA 2HQAA 2ZFAA 3GQYA 3OU8A 3CYJA 3VOIA 4IT1A 1DP0A 3GYCA 5AYBA 2HPMA 4CQBA 2PMQA 5E1QA 3TFXA 3S1XA 1FH7A 1N7KA 1TREA 4TMCA 3UR8A 4ZA0A 2HTMA 3SIMA 1ISXA 1YPXA 1FWTA 2X16A 3GG1A 1PPIA 2QGHA 4LUTB 3K8LA 1ISZA 3ITOA 1LBLA 1HP4A 5I3JA 5CJMA 3RO6A 1Z3NA 3LMYA 4HPNA 4GG9A 3STEA 4PEKA 2YR1A 2MUCA 4R27A 1FWGC 3P60A 4C5YA 4NZ5A 2JALA 1PVNA 5CBBA 3FGCB 2GYIA 4GX9A 4JY9A 4H9UA 4JTTA 4XD6A 1NSJA 4LVFA 1XH2A 3QLDA 2JEPA 1LM1A 4YS1A 3MI6A 3KOZA 3PHAA 5AYXA 2ZUWA 3GXMA 1TTIA 4MFEA 1VD6A 2F9RA 2HROA 4Y90A 3QFWA 2DZVA 1CCWB 1DXFA 2J8GA 1BF6A 4FR1A 3H22A 3FX4A 3G24A 3M1ZA 3KZSA 2A3CA 4M19A 3W7MA 6CGTA 1KFCA 1SGJA 5JVLA 4CD4A 3WD1A 4TTUA 2XZ7A 3TCEA 1H7XA 3BLPX 1ICQA 3ES7A 3TDFA 3NR0A 9XIMA 1VBJA 3TC3A 1F74A 3BAXA 1HJSA 1EJ7L 1XL9A 5D9OA 3NL6A 3LG3A 2VCBA 4TUFA 2ZZ7A 2ZUUA 1OBAA 5AFDA 1FWAC 5LNSA 4CD6A 4ORMA 3FCPA 1SZGA 4ASTA 3WEOA 3RRXA 2G3MA 2I57A 4IJRA 1WAUA 5HNTA 4AWSA 5I3KA 4L64A 1GK8A 3L23A 4ONVA 1HG3A 2TPSA 4LC6A 1K7XA 1UBPC 3LHYA 1GEHA 2PDQA 4E2OA 4YTQA 4I7WA 1RXOB 3OGSA 1O66A 2J88A 2X1RA 3S1UA 4NHVA 1QTWA 3DFYA 1Q6DA 4X63A 4LGXA 3SB0A 2J13A 1E3ZA 5L6UA 3TTOA 5BROA 2QJIA 4J27A 3ZQ9A 2VUNA 1J5SA 4FIRA 4GYFA 2Q8LA 4JTDA 3Q67A 4BKNA 1VB9A 2EXOA 1UOZA 2PRHA 1NU5A 3BJFA 3WEZA 2WLZA 5D03A 4OOZA 2WJEA 4WGHA 3CS2A 4O8AA 4OU1A 1GORA 1O68A 3W7IA 3WSUA 4RZ6A 2WJZA 3VM7A 5L9FA 4KPLA 2VD9A 3DI1A 4H01A 1R87A 2A6LA 4L4OA 1XLHA 4MB1A 3DG6A 2EGZA 5HINA 1VPQA 4IFRA 1H3GA 5G2IA 3PZ9A 2GLKA 1F2JA 3BLEA 5KSWA 1XG3A 2Y85A 3UPMA 1X97A 3I3BA 2G4JA 2W61A 4H6RA 1BG9A 4MY1A 1LL6A 4IWWA 3ICJA 2ZRUA 1S46A 2UY2A 1Q6EA 3AAMA 4WY0F 4EXQA 4JTFA 2QCLA 1XXXA 1FA2A 1LDCA 3W4RA 1QNVA 4IIGA 4FEZA 2Z1BA 5K4XA 3H4GA 3VNKA 4OWGA 4IMAA 3ZIZA 5HJXA 4M82A 4C7GA 2ZA3A 1F6YA 2YDSA 1A5BA 3WF1A 3FVDA 5HMEA 4Q4RA 1Q6FA 3H2EA 4ZOEA 3VYLA 3WMBA 4IP5A 3VGFA 1FH9A 3W1NA 3WD0A 1MXSA 5REQA 5A6AA 4UTLA 1UIOA 4XUYA 1XLLA 3CLWA 4XIMA 4Z1CA 4US5D 2IS7A 4H3DA 2GQ3A 3NQ7A 3T08A 7A3HA 3CWNA 3TONA 3DU0A 2DORA 1NFPA 3T0DA 1TA3B 3HZ3A 4BS0A 3P80A 2IKHA 2QT3A 3S1WA 1RBOB 3ZJKA 3UXAA 1HNYA 3SN4A 2TODA 1XIGA 4PYSA 4AD2A 2UY5A 4KRTA 1E4NA 4DJED 5IXEA 2OO0A 1LQ0A 1TTJA 4CCZA 4Q8PA 2V8ZA 5CZJA 2RGMA 4MF4A 3WMSA 5AC4A 2PDPA 3GDBA 3PFRA 4O8RA 1XLEA 2YBUA 5I07A 1VEOA 2ZVIA 4A05A 4YU1A 4XAGA 3GW0A 2Y7DA 4ZQRA 1TR1A 2QPXA 3I3DA 4ACZA 1U5HA 3W26A 1YDYA 3B8VA 2W0UA 3LB0A 2IUZA 1ZBWA 4C90A 1BTCA 1WNOA 2D73A 3GE7A 3KL0A 3FYYA 5A1AA 1HL2A 2BWGA 2WK2A 1XR2A 3GFXA 5CPQA 3EOOA 1Y5XA 4NUWA 3A13A 1V02E 3B4YA 3LN3A 1TVLA 1AH0A 1G7VA 2DW6A 1O60A 3AXXA 3LCWA 2A3BA 3W1PA 3M64A 1SQ7A 3MJYA 4ICMA 5DFAA 2DT0A 1Z41A 2FJUB 3R8HA 3SIZA 4AHPA 1NP0A 3UR7A 1LLZA 1LOLA 1N8FA 2C1GA 3LCIA 3TVAA 1Q45A 3CL8A 3G3MA 1JRCA 2FB3A 3C4UA 2NVAA 3OIHA 1RLCL 1JG9A 5TNVA 1ZJBA 1TB3A 1KTCA 2EPLX 3WUGA 4JKMA 2Y2WA 3DFQA 4YHGA 4N9BA 4GI6A 3L0GA 3WDIA 4WRHA 2WVSA 4JZ5A 4MLRA 4BQ5A 2E09A 4XVEA 3N3MA 3WNMA 1QPOA 3MSRA 1XPGA 2CBJA 1V3KA 3GSMA 1UA7A 3VXGA 4HNUA 1E9LA 3NQCA 4IISA 3CV1A 1KCLA 5JXQA 5HA7A 5JMUA 4AVNA 3W1AA 2ON3A 5T9BG 3W2KA 1DJNA 1BKSA 3YPIA 3IIXA 3OGRA 1V7YA 5B7ZA 1PCKA 2VWTA 1ZGDA 5LXXA 2YSWA 2Z1XA 1OT2A 1OD8A 2VMFA 3WDPP 3ITXA 3TQVA 2OOGA 4UOJA 3EB3A 2NXGA 1S2TA 2E1WA 4Z0JA 1OADA 1S2CA 3KRZA 3WNNA 3KCJA 4Q8WA 1R3YA 1X1OA 1DJGA 1TX0A 5GJMA 4XB3A 1DIEA 3PZMA 4R88A 1UR0A 3S9YA 1JCLA 2FHCA 3QMRA 4I9AA 3TKFA 4UOQA 2OR2A 1XBXA 4AZ7A 5BNKA 3CXOA 2GDUA 3W82A 1YXCA 3WQWA 1ZSXA 3LRLA 3TV8A 2DZXA 4EKJA 4JX4A 2EKGA 5AYYA 4ZENA 3U4AA 5FEZA 1DWIM 4NXKA 2F6KA 2E77A 1V5XA 3TAKA 3MU7A 4U31A 4H1ZA 4W86A 5KZEA 2OMAA 3TSDA 3T4WA 1H62A 3IK2A 3T0BA 1JULA 4KGJA 3LRKA 1LZOA 3LX9A 3IWPA 5AHEA 4AAJA 5LXEA 5H8MA 1YDOA 3NSXA 2PTZA 3QHOA 1KTBA 1KFLA 3HG4A 2DSVA 4ROPA 5JH1A 3WMLA 4QFUA 4PMVA 3L4TA 4ORIA 3TYUA 1I2PA 4LSBA 1QNPA 3N4AA 3C2VA 4B5SA 5T9CE 3SCUA 1BXCA 1PIIA 2GQ8A 1TFVA 3IIZA 3THDA 3GVGA 2J7HA 2AL1A 2NSOA 4B5UA 5IHRA 4D9PA 2DH2A 2IPGA 1W5QA 3S9ZA 2W63A 3LV5A 5C7VA 1U83A 4DWSA 2JKEA 1CECA 3TJIA 1I9CB 1E55A 1L2QA 3G1AA 1W9VA 5D4YA 1JZ8A 4FF5A 3OZYA 4GH1A 1K7EA 4M8UA 1WZAA 1FWFC 2C18A 2H6RA 1NFGA 1AODA 3VNLA 3M5YA 3WFZA 2Y0FA 1CGTA 1QI5A 4F0MA 4Y6GA 1E73M 4ADUA 3GVRA 2CLFA 2ZICA 3VIJA 1DJIA 1RQEA 2REQA 2XISA 5CG0A 4C60A 1X8CA 5I3DA 1JZ7A 1Y5WA 5C9UA 1JUEA 2FHFA 2W3ZA 3IRSA 1KBKA 3T6CA 4DYJA 2XVGA 2Y88A 2PDCA 3DFTA 2UY3A 1FCVA 3ZWTA 3JW7A 1ZRQA 1XP3A 1HKWA 4IPPA 3IUDA 4H7ZA 2IPJA 4HIBA 2IKJA 1PKYA 4P7QA 3TN3A 4LCQA 3WL1A 3C0SA 3AUJA 3T78A 1PBGA 3W29A 4N4QA 3IGUA 2NWSA 1KTNA 1QASA 4H7CA 1POJA 4CCCA 4WDUA 5BRQA 1ZCOA 1XRFA 3GNNA 1WA3A 1Y8BA 4GJJA 3TZNA 2HS6A 4IPNB 1Q6QA 1PKMA 3V5FA 1XRTA 3Q4DA 2XH7A 4F2UA 3W7KA 2QDGA 3AOFA 1O5KA 1R3WA 3D6NA 4WY0B 3FV9A 5CZSA 4G9PA 4Y2WA 3K8MA 1BYAA 4FXFA 3CPRA 3UR5A 2VZOA 3LBOA 2FVLA 3CUGA 2YZRA 1VFFA 5FACA 3EDKA 1SJBA 5J8LA 4AXNA 1OX4B 5ECUA 3K46A 5D2YA 4F48A 1KCKA 1SR0A 5HULA 4F0KA 1JRBA 1HVQA 1BRLA 3NZ1A 4YJ5A 1MQRA 1OCBA 4YVXA 3PTDA 1H60A 1ZFJA 2D2HA 4RE3A 5T91A 1QK2A 3Q45A 3KTSA 2GGJA 4G1NA 1C9WA 3NVTA 5CC5A 2PDBA 1TCDA 2GGEA 2J27A 1VQTA 3W74A 2HNEA 4D1IA 4XK2A 1GVQA 5LIYX 4KIEA 4LUSB 1YDVA 2NQLA 1QO2A 1OIMA 4B90A 2HVMA 3BAJA 3BE7A 3N34A 4PMRA 2OSWA 3NQEA 3ITGA 4Q7NA 4PMNA 5IRPA 4ZB5A 3Q37A 3W7HA 3NCOA 1SFJA 2GUBA 1EQPA 1G69A 1RA0A 1J0HA 3C2FA 4IIBA 3ERPA 1OT1A 4ZZ9A 4G2DA 4Q6JA 1I60A 1KQYA 3PNZA 4NNBA 4ILSA 3OQEA 3CH9A 1ME7A 1OVDA 3KBVA 4S3CA 2YCKX 4KCUA 4F9DA 1KV8A 3PB0A 1PYFA 1C90A 3ENLA 3EXRA 4HKPA 4YL2A 2WVTA 1JNEA 2YXGA 2VD8A 3ABOA 1CI1A 1ML1A 2ZE3A 3A4AA 2OXNA 3EYPA 3CB8A 1V3MA 3BGJA 3FDGA 1GONA 4ACZB 3CV7A 4QE1A 1PTAA 3GZAA 2NW0A 2V38A 2ACQA 4NZ4A 1RP9A 2INZA 4JXCA 3TYBA 3IAPA 4HU3A 3VFCA 5TF0A 4QS6A 3P14A 5A8GA 3W01A 1JF5A 3O6AA 4Y9PA 1MNSA 3K1GA 1EA0A 3TOYA 4DAIA 3KCOA 1EH9A 4BY3A 4D6DA 3ABRA 2NUWA 3KBNA 2OYLA 1JCMP 1TPUA 2DFAA 3MO7A 1KFJA 3ZJ6A 4V33A 4QSHA 4DNMA 3VD7A 2PU0A 2FGLA 4DXVA 1ITXA 3F4VA 3UNDA 4HMCA 3NDZA 1TG7A 3M0YA 1PDZA 3PPCA 3BOLA 4B92A 2WNNA 4JL2A 2E6DA 2R94A 4P7NA 4GQGA 2PLKA 3IVUA 3N6HA 4MFDA 4N7QA 5E0KA 4PMDA 5A5WA 2WJDA 4LF1A 1DIDA 3VDGA 3UF9A 2EJ1A 3CZJA 3GUGA 4LWWA 4UBPC 2XFRA 4QISA 1VHCA 3GDMA 4NNAA 4NJJA 1GW1A 3AWOA 3R11A 2OT0A 1DHPA 1PCWA 4IJCA 4C6IA 3BLLA 3QMSA 4WR3A 1DQUA 3CIXA 9CGTA 3O05A 2UWFA 3UWZA 3OHMB 4Q8UA 1MNZA 2Q02A 4GZEA 1US2A 2BOFX 2EKCA 4O50A 4XV0A 2QKFA 3UEQA 3HBLA 5D33A 4O14A 2XN0A 3USZA 4B5XA 4AZCB 4GKLA 2VGGA 1E6PA 5C7HA 5D09A 1CENA 4P8UA 4XKYB 3R89A 1EUAA 3RF9A 2P0IA 4J3ZA 3HGJA 1G9HA 5H8PA 2QGYA 3RILA 3ZOAA 2G4FA 1TV2A 2PRMA 1GOWA 3QGAC 1VPXA 3SN1A 3V18A 4WDXA 2VCCA 1UH2A 1XFCA 2ESCA 3NJ3A 3WG6A 1TRDA 1GQLA 1XYCA 3WZ0E 3IIOA 4J2PA 4LUJA 1JYWA 1BWKA 3G1SA 2YL5A 2CLIA 4R7JA 4DLMA 4H9TA 3HJEA 5F7UA 1A80A 1Q8JA 4DIAA 1HN1A 3VGBA 2XM2A 4QG6A 1F3EA 5HWNA 4PN2A 2OELA 4KEUA 4RR4A 4O17A 3S5SA 1QDSA 3SN0A 1KR1A 4IX2A 5HWMA 4LY4A 1QWKA 3POHA 1B31A 4KCWA 3BV7A 2YKKA 2AL2A 4JPGA 4MWAB 4H8HA 1H1YA 3DFHA 3NIYA 3RLUA 1JZ6A 3PG8A 4LAMA 3ZR6A 3MP5A 3BH4A 2ZXDA 4MPKA 2Y5EA 3TNBA 5HUOA 2PWVA 4GI9A 2INEA 3ZJ7A 1EIXA 4FZIA 4A3QA 5DO8A 2PODA 3W37A 5BMXA 2CBUA 2QJJA 3WLTA 5EY5A 3FAXA 5DEZA 4B3KA 2XJ7A 2NSXA 1PWLA 1KR0A 3AIVA 3TTEA 2BY1A 5A8QA 4JCLA 4ADSA 4GUHA 1SSDA 1IZJA 2Z00A 4Q4QA 3ZXWA 3EB4A 2QUNA 4POCA 1VS1A 4V28A 4QGCA 1XYBA 2BGQA 4ATDA 3WBWA 4I8DA 4LT9A 3R1ZA 5LNRA 1R9YA 2TSYA 4TX6A 3I68A 3N2OA 1U22A 1T8QA 1UCWA 4JTEA 4X3ZA 3WQ4A 2VZTA 2I9UA 1W6TA 2P10A 3S8HA 4PSRA 4L7ZA 1G67A 2DUAA 3GIYA 4ATLA 3DG7A 3S3GA 3VGHA 5KETA 2QJNA 1G0CA 1XQKA 1KBLA 4UTJA 3CAKA 2BG5A 1UUOA 3I6EA 2E67A 2X0HA 4DXKA 4CQCA 4I3GA 3DX5A 1XLCA 3GHTA 3D3AA 4NVTA 1DOSA 1EDQA 4LW7A 2NUXA 1OM0A 1K03A 1B3WA 1WOBA 5MHBA 3C8NA 1ALDA 4UTTA 2WV8A 3JZUA 2XVNA 1QW8A 5JH2A 3N3TA 2D1ZA 1LCOA 2GVEA 1SYTA 4PTNA 4BHYA 1FUYA 3TW6A 4NIRA 5FI8A 4K36A 3LI0A 3IPWA 1RJPA 1AL7A 2CLMA 2E7FA 3QY8A 3G1DA 1IF2A 4IG2B 3A5VA 1IYXA 3ABXA 4PUUA 3IIPA 4GBDA 3S2JA 1E6NA 3ZJ8A 1K9EA 3JRKA 5C9XA 4NAFB 2XHYA 4AIBA 2WWCA 1BSIA 3VGEA 4HPXA 2DZPA 4TV5A 2V3FA 1TPFA 1EP2A 3QY6A 4BA0A 5FF3A 2ZUNA 4J4KA 1G5AA 2QCDB 1VRXA 2FZ8A 2VRQA 3ZT6A 3SGUA 3LLDA 3BCDA 4K6AA 2BVWA 2EPOA 2IW0A 2OT1A 2Y7EA 1H4PA 3WLNA 2DZAA 4FLSA 1KBIA 4W5UA 1B9BA 2VO5A 1WUEA 1W1TA 4XX6A 4FNUA 3MTWA 4TX9A 4ZQPA 3LEPA 4FXSA 1E9ZB 2FKPA 4QJ4B 1UPPA 4C1KA 2R9RA 2QCGA 2I5QA 2GGHA 5AVNA 3NPXA 3BW2A 4UMBA 1VYSX 3KL3A 3GU2A 4KS0A 4H00A 2G5WA 1CPUA 1P7TA 1WZKA 3C3UA 1TWDA 3BUVA 2QCCA 4BEUA 2ACSA 4ZOCA 4ZE4A 2HEJA 4DBUA 3SSJA 1C8VA 2I5IA 4GUGA 4BFAA 3CAQA 3CHFA 2E9LA 4W8AA 3S2MA 3TYCA 3S46A 3UG3A 3N6QA 3DHUA 3CNYA 1F07A 2V82A 4UFHA 1E1FA 1KM0A 3OLDA 1UASA 1FWBC 2DIKA 4GXPA 4CNUA 2PGWA 3M07A 4LFYA 3OYXA 1EGVA 2Z7GA 1HT6A 2YLAA 3IJ7A 3W73A 4GOAA 1H5VA 1T8XA 1YMYA 3ARYA 4PH6A 4EPEC 1D9EA 1A4LA 1KNWA 5A3HA 3SJ3A 4Z2HA 5HJLA 3WJWA 3MUY1 2F6XA 4QIUA 3DXIA 3O15A 4A22A 3OG3A 1O5RA 2NX9A 3IAQA 3AXIA 5CLTA 1HGWA 2ISVA 4PODA 2GJPA 1M7JA 3BG3A 4OE7A 3G3DA 4E4FA 3GUWA 5DANA 3PBWA 4M6QA 5CGTA 3TC6A 1FCQA 2GWGA 3DKLA 3VABA 1A4MA 3R94A 4G6CA 6REQB 4RPQA 4MNLA 4XBSA 2C0AA 5BOOA 2QQ6A 3VGGA 4Z42C 1S2WA 3RYSA 3TXZA 3HU7A 4AWEA 2ZADA 2QUTA 3K13A 1MFVA 1JCJA 1F8IA 2EJAA 4F4RA 3QVQA 1E56A 1SVDA 2Z28A 3GHUA 2G97A 3H2AA 2WNZA 3NM3A 4A4AA 1G1YA 5AHLA 5HWJA 3WBAA 4P61A 2CBVA 2J8TA 3N9SA 6XIMA 3GAKA 2R82A 4IMEA 3L68A 3I7RA 1IEWA 3K1DA 1F7BA 1MEHA 5KINA 2YZ5A 1XISA 5CC3A 1YXDA 4C1NA 4UC5A 1US3A 4UTTC 2E6FA 1O7AA 1W3HA 1AJ2A 4D6JA 1XIIA 3SY5A 1N8WA 4R7WA 3RFAA 1CDGA 3GYEA 3SFWA 1V4YA 5A6BD 3N13A 2OVLA 2AAAA 1IWBA 3LGEA 1H5YA 1U1HA 3N4FA 3RU6A 1CWYA 2OYKA 2EG8A 2PC4A 4DO4A 4R9OA 2YXOA 1W3KA 1MZRA 1RP8A 5A8PA 3BZGA 3MJMA 5FJOA 4RE4A 3RLVA 2ZIDA 1PAMA 4IIDA 1W9UA 3KVKA 1WZLA 3W76A 1W3LA 1H0IA 4PUWA 2PI6A 4XZIA 3W00A 5FKYA 2WXDM 4JX6A 3MUIA 3PULA 3WD3A 3HMCA 3M0ZA 1UR2A 1ITQA 2YGYA 4UIOA 4PEEA 2D2OA 4G56A 3S83A 5HPCA 2NWRA 4OJYA 1C92A 1G94A 3CWOX 4UTIA 1V93A 3CU2A 4UCGA 1GYLA 4MMWA 4ATWA 1YLVA 1Z69A 3G1VA 3H2NA 2CXGA 3V1PA 4ZBCA 3IGSA 1VIZA 3UXIA 4H4IA 2RHGA 3UP8A 5HNRA 3EMQA 3M6DA 4ZO9A 3STCA 2Q09A 4KETA 1GQNA 5FIPA 1ZAHA 2ZX5A 4B2DA 4WDWA 1FWJC 4J3TA 2PLMA 3MHUA 4AX6A 3ARWA 1F61A 2DP3A 3VIIA 3WQ6A 2DZWA 3PWGA 4GO8A 5MKGB 4AG0A 4DZ5A 3UZXA 1V3JA 4TQTA 1LUCA 4CNSA 2X1IA 3ZLGA 1T5AA 3NTYA 2ZYFA 4M80A 4Z1YA 3HA1A 5EYWA 2A79A 1OGSA 5BYWA 3TOPA 4HK6A 3EWWA 4TXEA 4B15A 2YBVA 2PD9A 4XSMA 3B8WA 2Y4SA 3W6MA 2E5DA 1B4KA 3IRDA 4Y8EA 3QW3A 4PMQA 4WIWA 4IHCA 3OBKA 2VGIA 4L9YA 3MI2A 1TYGA 2PWUA 3Q2DA 4S2BA 3N1AA 5HQLA 2E9MA 3WLQA 1OK4A 1J79A 1HJUA 2DT2A 1J5TA 2ZRXA 3S6TA 2Y5JA 1N2VA 1A5MC 3R0DA 3KBSA 3TJ4A 2AQWA 3RR1A 1ODUA 3WN6A 4DJFA 2VOTA 3PG9A 4MDPA 2J75A 1UJQA 2RGLA 4PRRA 3CZKA 3M0VA 3WQDA 3A64A 1TJ1A 3M0IA 1C8XA 3H53A 2NLYA 3FGCA 1UWAA 1WDPA 3AQUA 4AEEA 1QXLA 1XHGA 3N29A 1I4NA 3BAYA 3LPGA 1JCTA 1G4SA 1EJWC 3AYSA 3QH2A 2BXVA 4AYGA 4DBEA 1H1NA 3APTA 5CSSA 3ZWSA 4AC1X 3MSDA 5AVHA 2ZRYA 2Z6IA 4J3XA 2WKLA 2F2HA 5DCBA 4V15A 2UV8G 2WHLA 2WLYA 3PBYA 2QMJA 4FNQA 1VHNA 3H24A 1PKNA 4H7VA 2CLOA 4PMYA 4X9YA 2AMXA 1BVNP 4F66A 4RNFA 2V2DA 1UZDA 4EPKA 3OP2A 2YCIX 5FJJA 1YEYA 3IVSA 3EWYA 3NPUA 4QHRA 2C16A 3KVMA 3G0UA 1GPFA 3CUHA 4RW3A 4OIFA 1UH3A 4F79A 4DI9A 3EOSA 3GLCA 2OEJA 3UYCA 7REQB 1C93A 4Y7EA 4NG3A 3ARSA 2WAGA 4L65A 4JFSA 4ZVJA 4B91A 4Q4MA 4EACA 4IP4A 2FIQA 1SO5A 3W7DA 5CPSA 4CNPA 3LTYA 1EJUC 5LA2A 4A8RA 1K3UA 1L6SA 3ZZ1A 3RCNA 3T0AA 3RPTA 1K8YA 4DF1A 4IG2A 3NOYA 4WXZA 3PM6A 3M16A 5FJPA 2HNHA 4U4MA 1AJZA 3H70A 1BG4A 4OUIA 3ZR5A 1EP3A 1C9DA 2D20A 4D2JA 3K4WA 3VVGA 3MSGA 4MZ1A 4ALDA 7REQA 3ONCA 4NQ1A 1P1MA 1XRSA 4OFCA 1D3HA 2GSHA 4QJ1A 3NSNA 1JZ3A 4JYDA 1IXNA 4PUJA 4XO7A 4UTWA 4FNTA 4XAPA 4PC8A 1XSKA 4MAZA 3I3EA 3TWAA 1ZAIA 5U7SA 4UTUA 3AZTA 4CQ9A 5J5DA 3T2QA 2J8FA 3A9BA 3UD6A 1S5TA 3QMTA 2GK1A 5C9ZA 3L2IA 2OCZA 2VC7A 2VX6A 5KZ6A 1ZU8A 3T81A 1Q7MA 2OODA 3KEHA 2CLHA 2WVVB 1LF1A 2Q3OA 2WMFA 3S6OA 3SY1A 4IZGA 4WDTA 3DBPA 1ICPA 3ARTA 3SGZA 2NQZA 2VFDA 4B5NA 1AW5A 3HQ1A 3R6IA 4LCRA 3CV6A 1EEXA 2SFPA 3VA8A 3CO8A 2PSNA 1HKKA 3OYZA 4P7OA 1I6NA 2WC7A 4RXFA 4KKXA 4LB4A 4X2PA 2J9YA 2Z1KA 1RD5A 3G2GA 1N82A 2V3DA 3URQA 3EBVA 1VLWA 3TYZA 4C6QA 2OKOA 1O12A 3DENA 1UP3A 7TIMA 1YBQA 4C6PA 5DT5A 3LPOA 2CKRA 1QOQA 3GKFA 5CJ5A 1WYIA 1IGWA 2A0NA 2QCNA 5CSYA 1HTIA 1ZBVA 2ZX8A 3E3HA 5DY2A 3BOXA 3W1RA 1BLIA 5FJIA 3BW3A 1PO9A 1AQMA 3CC1A 3N2XA 3EA1A 2VXNA 4N9CA 5F4SA 4NZFA 4JGDA 1MQQA 3BLIA 3MKKA 1BYDA 5G1YA 2V5LA 3CJPA 3GD6A 1AK5A 5CPNA 1RVKA 1NWSA 3AXHA 2LLEA 4ZO7A 1D8CA 2PE4A 2VUYA 3LM7A 2ZRWA 1B3OA 4CN1A 4TVUA 1FXQA 1PKLA 2AAMA 3WF2A 4MTVA 1UW9A 1E3XA 5FD0A 3ME3A 2DZSA 1QT1A 3W7JA 2DU2A 4UTHA 3TN6A 1OC7A 3CZGA 2NXHA 4FF7A 3UQNA 3VINA 3CM4A 5BXPA 1U2YA 4FB7A 3BJSA 2YDRA 1Y7VA 3RU8X 1S2AA 2PWHA 1YKWA 4B4FA 1RY0A 3PZNA 3VAVA 5M2FX 1H7PA 4UFMA 3MC5A 4EF9A 2OYMA 3CAWA 4HHPA 2DT1A 2VEKA 1EZWA 2FTYA 4I5XA 3KAOA 1LOSA 1J6PA 4M56A 2WC4A 1R0MA 4KQNA 3CQ0A 3UA3A 4JFUA 2B7PA 3VDBA 2BDQA 1QI4A 3EKGA 3W7QA 4MGGA 4JHZA 8A3HA 2DV0A 4X2RA 3E2SA 3BANA 2WZIA 2NV9A 4ES4A 1QW7A 1SUXA 3COTA 5FF4A 1OFBA 4JQ1A 3KHDA 4QE4A 4HA3A 3QSTA 4O54A 4JD4A 2VZUA 3MO4A 4OGZA 4XZLX 5LGZA 1DIOA 3H7VA 3I10A 1EQCA 1X39A 2EAWA 3VI2A 2OQYA 5EA9A 4X0VA 2J47A 2CERA 4O19A 2HV5A 5CAHA 5FESA 2PA6A 1K8XA 4A8IA 3RPMA 4DJEC 5I3FA 1JYVA 1KD0A 1CBGA 4JL1A 3FYPA 4GZ7A 4GMEA 1UMYA 4NXSA 1GG0A 3G0SA 3W24A 4ZFMA 4O1DA 4Z2JA 2YDQA 2YOCA 1EC8A 5HR6A 3A21A 3K5XA 1E51A 5DY3A 3BVJA 2RJHA 3WF4A 3SAZA 2X1TA 1XRVA 5BU6A 3W7RA 2F61A 5FEXA 3S4TA 2XYLA 2NZLA 3XINA 5C6MA 2QR6A 3QTPA 2HZGA 3UYIA 4OBTA 1Z89A 4MUZA 2VFGA 1X1ZA 2NV1A 3WQ5A 3DZ1A 1K4HA 2EBNA 3CL6A 2IXVA 3EDJA 5LNWA 3QKZA 4JDBA 1K1DA 2DIJA 4O53A 4KFPA 1DVJA 3VD5A 5HDRA 4AWUA 5EL1A 3Q65A 1TZ9A 3U2OA 3WJZA 1IXPA 4LUYA 4RV3A 1V7AA 2ZUSA 3WH8A 3GXNA 4PMOA 1M3UA 3DHFA 5CAKA 5A6KA 1Q6RA 2ZUTA 2REQB 3KW3A 1TPDA 1O5QA 1P6WA 4O28A 4E3VA 4HJWA 3QN3A 1R46A 3OODA 2XVPA 1CXHA 2GOUA 3E2VA 4UTWC 1IR1A 1BGGA 2EF9A 3GKAA 4MUPA 2X0SA 1W5MA 1GHSA 4HZ8A 4QG8A 3WUFA 1TPH1 4Q4KA 4V1YA 4N9EA 4OTKA 4UR8A 2C71A 1JPMA 1JDDA 2XFYA 2VT0A 4LYQA 5H1WA 2IMRA 3O6CA 1L0PA 3SRHA 5BXSA 2R1NA 2A7NA 3UG4A 2GOKA 1ADDA 1OF8A 3CEPA 4UFLA 4ZE5A 2ZTJA 2PDWA 1QMLA 3IJQA 1KM5A 4IPJA 4K7VA 3GXIA 3AIBA 4HCDA 1ADOA 3RCMA 1UR8A 3TK7A 1JZ2A 4PTWA 2AQOA 5A6SA 3F5JA 1MW3A 4O1FA 2Z6JA 3KP1A 4OQVA 1GZGA 2VGBA 2BVYA 3D47A 3LERA 3TROA 1GG1A 3CK5A 3WNLA 3WQPA 3WK1A 2YDAA 4UUIA 1R85A 5AY7A 1GNXA 7TAAA 1GTHA 3AIUA 4CNOA 1MQPA 4S2CA 4IQEA 1NAL1 5ECVA 1JAKA 5D37A 5DELA 4FNPA 2VTFA 3WMCA 3QKEA 3IJ8A 4X0NA 2ICSA 3ANUA 3SCPA 4J3UA 2VEIA 1MSSA 1S39A 3WLMA 3ARPA 3OA3A 4CQAA 4F0RA 1AMKA 4AHQA 3UWQA 1GYNA 1MYRA 4JIHA 3IACA 3USBA 1MXGA 4GYPA 1F4HA 2V9DA 3S5YA 3GDKA 5AC7A 1PX4A 2VOMA 4UZUA 1XUZA 3WDQA 2GGGA 4LCSA 2A2IA 3V3WA 2D0HA 1WO2A 4Z1BA 2RH9A 5BOEA 5B80A 3GC2A 3EA3A 1HIZA 2JQXA 2QPSA 3LSCA 3UJEA 3UZZA 4AZ6A 3M0MA 4N6FA 4PL1A 4PR4A 5EB8A 3UGVA 2ZKMX 4C7FA 1IXQA 1M5WA 3TR9A 1UA3A 4YVPA 2EPHA 4IIEA 3DFSA 3SEPA 1NQKA 3S5NA 3WY1A 1SFTA 2V5BA 3P2VA 4F2TA 3NURA 4AUBA 4RUBA 2FH6A 4KEVA 1EIBA 3AS3A 1R8LA 3FVMA 5JQ9A 4D6IA 1PB0A 2X41A 4H83A 4IJBA 4JQ3A 3MMDA 3G1FA 4WCJA 2WO5A 3OZOA 2HJPA 3W6LA 1ZTVA 1O5XA 3L2LA 4O11A 3R4IA 4HOZA 3GTHA 3C0QA 1V8EA 4LYKA 3NGJA 4KFOA 4O57A 4B4HA 2G95A 3ABQA 4Q8TA 4U3CA 2BGSA 3HURA 2BY2A 4LNCA 2MNRA 5D8WA 4QLLA 3W1MA 1NDVA 1EP1A 3N4EA 4JS3A 5I6SA 2DVTA 1WUFA 1C29A 3VCRA 4CNTA 1YDNA 5EFFA 1VEMA 2DPEA 2WZMA 1PIFA 3C5QA 4B5WA 4S3JA 3PTKA 5BXRA 2GZXA 3HGSA 2NVDA 5HNNA 1YTKA 2G8ZA 5AZ1A 4BQ3A 3SDOA 2ZA2A 2VKZG 3NQ8A 3A4XA 3PBVA 3S9IA 4WSKA 2ZZ5A 1BVZA 1HVXA 2E0PA 1XLIA 1GKPA 2ABBA 1E6SM 3STGA 1E0UA 2V81A 3O16A 3W71A 4N42A 4FI4A 4GUFA 3RIKA 3PTMA 3QZ6A 2P3ZA 1QJWA 4HMNA 1WE5A 3L5LA 1M41A 1DKWA 2WMKA 4ZB0A 5KMYA 4NZCA 4WXYA 4I7VA 3VIGA 2FFCA 2CESA 1Y5VA 4YWSA 2Z24A 1C7TA 8RUCA 3GR4A 3QQ0A 4XZWA 1A3XA 5RUBA 3PJWA 1MO0A 5LGXA 3M5VA 2PB1A 2XG9A 3BXWA 2BY3A 4N9DA 3E9AA 3OLGA 1BGAA 5EMKA 2Q3RA 3DGBA 3B9EA 5FA5A 1UUQA 3B4UA 1BYBA 1LBMA 4DUXA 3CUJA 4Q8NA 1MRQA 2G37A 4BCEA 2IKIA 1SPQA 2WSKA 3EDDA 1A0EA 3AMCA 2QVHA 1EF2A 4GPNA 5GNXA 1QR7A 2I7GA 4JTAA 5A95A 1SW3A 1MFUA 1QPRA 4GUIA 1IQ8A 5GJPA 1CW2A 2QVNA 3KOXA 3MMWA 1JYNA 2BP1A 2O4MA 5SWUA 4F3HA 3V5OA 1XV8A 2PF0A 4DAFA 1A5KC 1EA9C 2QUMA 6TIMA 1KM2A 3GW3A 1UZ4A 4XISA 1UYQA 1WDSA 3QJAA 2E28A 3G22A 4DM2A 1TTQA 2OEKA 2QNEA 3UBPC 3NZGA 4PL2A 1FFRA 4YHEA 3UGRA 2IPWA 1OQFA 4XZ9A 1TJPA 4O13A 1XSJA 1D8WA 3ZLFA 1K8ZA 2G3JA 5B7YA 2HRWA 3ES8A 1SJCA 4JBRA 4GQRA 2C1HA 3MZ2A 3WDRA 3NZRA 4FMVA 3EAUA 1OFDA 2QUUA 2J6VA 2ALRA 4UCFA 4LJ3A 2P8CA 2A3AA 3VZYA 1LG2A 1YNQA 4E8GA 4H2HA 1DHKA 5GNYA 4DM1A 3W2MA 3L4YA 2CWNA 3N11A 1CLXA 6ENLA 3GG0A 1DEDA 3W2NA 3UVAA 1TIMA 4HVXA 4YNGA 5TBOA 3ZS4A 3EX4A 1F05A 4LRTA 1OGGA 3PUGA 1ISYA 2NQ5A 3D46A 5MKGA 1VFOA 2YJQA 2JEQA 3TP4A 3GM8A 3O63A 4C7DA 1VZWA 1GVIA 2I1OA 2WQDA 4MHBA 4GNVA 3CQKA 1MUMA 1BXBA 4LALA 1W17A 3S1GA 4L61A 4BWLA 5JIPA 1UJPA 3NYZA 1B4EA 4R53A 3HTWA 3JS3A 2PBGA 3UZWA 3QLLA 3B04A 3NQ6A 3CTTA 4QTGA 3AU6A 1KM3A 4PB4A 3FJ6A 1KA9F 4W85A 1UC5A 4UNKA 1LT7A 3POCA 3VO0A 1E0WA 4LRSA 1ZP4A 4PUEA 1I45A 1UHVA 1EFZA 2C15A 1V0LA 3CZLA 4FALA 5AHMA 3HV8A 5G4HC 3E12A 4MZ8A 5I23A 4FOKA 3FXYA 3TTQA 5FSDC 2XIJA 2OWCA 1WCGA 4IXXA 3H2MA 5F1UA 3W85A 2PCEA 4B2DD 2WBGA 1OX5A 4C6NA 6PTDA 1H7WA 2VEGA 5F2GA 1C7SA 1W5OA 4LS0A 4JR5A 3K30A 1DJXA 1KXHA 2W6RA 2JK2A 2QCDA 4QSFA 4CUCA 5E9XA 3W86A 6TAAA 1G4PA 4KIRA 2WHKA 4GIAA 3CEUA 4JFVA 3OW1A 4H8NA 1YNPA 1WZMA 2O9OA 1WDQA 4JIIX 5FOOA 1H1ZA 1RLDA 3NQAA 4QLKA 4ZOBA 3F2BA 4QITA 5IDZA 1R30A 4HZ6A 4E6MA 3L5AA 2OZ0A 2HCVA 1HKMA 1BXNA 1LRTA 3DFPA 1BHGA 1EL3A 1VBUA 4GJIA 4O0KA 1TPB1 3VUPA 4MYXA 5LIUX 3ORWA 4ZO6A 3LENA 4GABA 1UQZA 1P6BA 2E25A 1YIXA 3WO8A 2FLIA 1RSCA 4H9ZA 1VP5A 1W3TA 1VLIA 3AC0A 4M24A 2R1PA 5AECA 3A4JA 3QR0A 3G1HA 2E6AA 2VWSA 4JFTA 1S3HA 4DO7A 2YFOA 1CGVA 4HZ7A 3IGXA 4REQB 1NP2A 3W2JA 4CLMA 2DIEA 1OIFA 3LCXA 4F0LA 1WPCA 4OUEA 4GJ1A 1EO5A 1B3XA 3B8IA 4L80A 3EWCA 1XGEA 2YYUA 1K9TA 2WSYA 2HSAA 4MIMA 3E0IA 3K4DA 4MB4A 3QSRA 2CNCA 3PN8A 4HK7A 4MB3A 1Q2RA 4X9SA 1GKQA 2OJPA 3TSBA 2YIHA 1QO5A 4Q8QA 4NRSA 3THQA 2B4GA 2FZNA 1VCGA 3AXMA 3QQWA 2YCJA 3I7QA 1O1HA 3KP0A 2J9ZA 4A3YA 3ARVA 3UR2A 1L6FA 1KFWA 1KW1A 5CC7A 2L5HA 3GBDA 1FWWA 4QAIA 4C6JA 1XIEA 2H3BA 3BDKA 2NXIA 4JNMA 1Q2SA 1H63A 3T1GA 1RQBA 2C3ZA 3E5PA 5A6LA 2XM1A 3PR2A 2Y61A 3KLLA 2JF7A 4ERGA 5A8NA 1XC4A 3C3NA 1Q6OA 4GD0A 3DCPA 3WDHA 4L9XA 1OFOA 5I06A 5GNZA 4JIEA 5J5RA 4M3PA 4PA8A 1E0VA 4BI5A 4HYVA 3D0CA 4EF8A 4W7WA 4CU8A 2Z0IA 1H7OA 1W1YA 3A3XA 1XDMA 4W8LA 3TH6A 2CETA 2BMBA 3VDHA 3TYEA 3CH0A 1A0CA 1C3FA 4US5A 4RNJA 2WHJA 4Q8VA 3U2ZA 5FL1A 1UWIA 3REQB 1A5CA 3PANA 5DRIA 5I02A 1A5SA 3CUFA 3NOEA 3TE9A 1QBAA 2HE5A 4G5DA 3F2DA 1XSIA 2P5NA 1D2KA 2XIOA 3VGDA 4XQ6A 3BCJA 1NVMA 4LXFA 1EPVA 1RBLA 4BR1A 1M01A 2CZDA 2CLKA 4TO8A 1DTUA 2BHYA 4GY0A 2Z1WA 4AZHA 4D6CA 3RJYA 3N2MA 1OZQA 3B8DA 2CHNA 4QR6A 4BQ2A 1PDYA 3L4VA 1U5JA 2RDWA 5HK4A 4MLJA 1VRDA 5I24A 4UTKA 1JQXA 1V0NA 1TV5A 3AJXA 2V68A 4BWLC 4EXAA 2BVDA 4LNYA 1KGWA 2A1YA 1S5MA 1N8IA 3PPGA 3C6CA 3QYSA 4EPBC 2HVOA 3UW6A 4KH2A 2WBKA 4XIAA 3IS4A 2O0TA 2OSXA 4JTGA 4NRRA 3WK3A 1RUSA 2G3FA 1E6ZA 1XYMA 1ECEA 3S2NA 3LDVA 1IZCA 3BMXA 3NO5A 3M0XA 1V08A 1JZ4A 4PTDA 3QOMA 2WMGA 3FA3A 5BRPA 2C13A 2WANA 4HNCA 3NDOA 3MUCA 2FB2A 2PC8A 3VMPA 2FJKA 4Y96A 3GHSA 2GUYA 4IFOA 3WKZA 1EEPA 2Q6ZA 4E4PA 4F40A 2FVKA 4WVXA 1OHLA 3O2LA 5BWAA 1NWUA 1RD6A 3IV3A 1P0BA 4F2BA 2VYOA 1Z7AA 1VFMA 3U4FA 4AIUA 1TJ2A 4L6HA 1OK6A 4KBXA 2ZXAA 1CT5A 4WKFA 2V30A 5A94A 3L4WA 4R3UA 1X1NA 2Y8VA 4JQ2A 4MWAA 3V7PA 3GK0A 3I6TA 3B9NA 2WSRA 1U1JA 4LOCA 3UY8A 4EIVA 3OB8A 1K9FA 3A3HA 3HG2A 5JBEA 4HK5A 1O94A 3PC0A 1TUXA 4LU0A 4H04A 3UY7A 1YYAA 4H9YA 8XIMA 1VBHA 1XINA 1HL8A 1JFHA 3RM9A 1XBVA 2POZA 1QI0A 1PE1A 3N73A 1M6JA 4GVGA 1XLAA 3PZIA 3DKJA 1JPIA 1H49A 4DJDC 1J11A 1X7FA 4HYWA 5LIKX 5AC5A 4DWSD 1H11A 3KDOA 3WLLA 3SCRA 4O0ZA 3ZVHA 4MJ4A 2BVTA 3AXKA 1IT7A 4WUIA 5AKQA 4XZMX 4TTGA 2J7CA 4C1NB 5C9RA 1EUNA 4MYAA 2WNWA 3W25A 4ACYA 3OGVA 4I9JA 2E9BA 2V69A 7ENLA 4XVDA 1FBAA 3UWWA 5BMWA 1S2UA 1AQ0A 3QPZA 3UA4A 4MB5A 2YA1A