2XGBA

Crystal structure of barley beta-amylase complexed with 2,3- epoxypropyl-alpha-d-glucopyranoside
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
486
structure length
486
Chain Sequence
NVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 192
structure length 486
sequence length 486
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xgbA00
1UD4A 4QP0A 3GNRA 1CXFA 2CITA 3AXHA 1D7FA 5GNYA 7A3HA 3EDFA 3LPFA 1XRVA 2VQUA 1CGUA 3W37A 2DT3A 1BGAA 1SMDA 2PBOA 5BRQA 1B3VA 4AZ7A 1WNOA 1B90A 4MAVA 3BSHA 1DWJM 5C8BB 5C71A 3GBDA 2FDMA 3RJXA 1W9PA 1PZ3A 1LQ0A 3SCOA 2G8ZA 2CBUA 1QHPA 1A47A 4TVCA 4WKAA 4MAZA 4KMQA 1E71M 2CYGA 3T0AA 2BVYA 2D3LA 3KL3A 1CXEA 2QPUA 1S46A 1CGYA 2YOCA 2WMIB 4C7FA 3ALFA 3CGTA 3RM8A 3ARTA 3GXDA 3WF4A 5FL0A 4UR9A 2JF7A 5KZ6A 2WKLA 3WH8A 2YL8A 3GXFA 2XFRA 3PZMA 2XVPA 4DUXA 1VB9A 4GZEA 5A1AA 3OB8A 1DWHM 1J0IA 1UR4A 1MFVA 1UWTA 1W2VA 4CD8A 4AEFA 3O6AA 4WF7A 2PC8A 2PWDA 3MUY1 4GINA 5I79A 1FHLA 2EBNA 3J7HA 1W32A 3E1F1 1C3FA 3CUJA 4M1RA 5C70A 2UY2A 1EGZA 1ZS2A 4TTGA 1M01A 1FH8A 2FGZA 2D0GA 4D6CA 3VGHA 3EDJA 3WH5A 1TA3A 2GK1A 4AZIA 2NT0A 5CPQA 1C8XA 2XHYA 4EKJA 5HNNA 1UKSA 2E9MA 2DEPA 3DYOA 2X0HA 5KEZA 1JG9A 4WSKA 4QAWA 1OIFA 4ML4A 1C8QA 4QLJA 3IANA 3OGSA 2V3DA 1G1YA 1BYDA 1GORA 4MNMA 3K8KA 2W91A 4U31A 4QCFA 2VUYA 3WL0A 2DQXA 4QDMA 1KWGA 3N9KA 3ALGA 1GJWA 1C91A 3ARZA 1CTNA 2WC4A 4A3HA 3N11A 3QHMA 2J7HA 1YQ2A 4PTWA 1XHGA 5D9MA 4XZWA 5FD0A 1K9TA 1TVPA 3OBAA 2Z1KA 3RIKA 5A6AA 1C93A 3OZPA 2OSWA 1D2KA 1WP6A 2XUCA 5A8OA 1Q6CA 1U30A 4KWUA 4KGLA 1EA9C 4ZE4A 3IJ9A 3MU7A 3MV01 2CIPA 1TFVA 1W3HA 3VIIA 4D6FA 1OT2A 1J9YA 2VZVA 1R85A 4PMYA 4AZ6A 1V6XA 5DF0A 4AZCA 3ZM8A 3M6DA 4MB3A 2W92A 4HU8A 5EFFA 1QI5A 2EPKX 3L4UA 3SCWA 5BYWA 4FLOA 4D6DA 1QBBA 4X0NA 1KCKA 2C7FA 3BAYA 5DT5A 2DSWA 3MV11 1F4HA 1FHDA 4U3CA 4K68A 2OWCA 3ZT7A 4Q7NA 1CWYA 2O9RA 4AXNA 4AD5A 3SCSA 2EPOA 6CGTA 1KR0A 1V6YA 3AIWA 2DH2A 2W63A 2JF6A 3KL0A 5HPOA 1BVZA 2VX6A 4Z2GA 2V3GA 2YJQA 3K1DA 1W1VA 4W85A 1B3ZA 1B31A 1UH4A 3RDKA 1H49A 4NSBA 2WHKA 2UY5A 3HMCA 5I3DA 5HDRA 1V02E 3CBWA 5JBFA 1UZ1A 3BAWA 1PX3A 1NP2A 5ABHA 3VD4A 3O9NA 3VDAA 4J3XA 1HNYA 1BGGA 3VPLA 1PPIA 3BXWA 3UG3A 3WDJA 1EOMA 1C8YA 1E72M 1W1YA 4D72A 1QNRA 4DWSA 1VFFA 2UY4A 2YL9A 9CGTA 3KZSA 4ZFMA 3BSGA 4UZSA 4PTVA 1OSEA 3WMBA 2PBGA 2CEQA 1M7XA 2ZX9A 5GNZA 1Y7VA 4V27A 1VFUA 1QNPA 1X6LA 2QLYA 4YHGA 2CHOA 1NARA 1V3KA 1QI0A 4AD1A 2C8NA 2Z1SA 1E0XA 2J7GA 1X1NA 3I3BA 1B3XA 2VQTA 3GNPA 4AMCA 1EO5A 2V3FA 4RL3A 1HT6A 1UA7A 1W9DM 1HF6A 4DWSC 3CTTA 4OBRA 2JIEA 1QVBA 4C7DA 1ISWA 3VTRA 3ZSSA 1UOKA 1KXHA 4C7GA 2MANA 1NH6A 3CUFA 1PIGA 1B3YA 3L4ZA 2NSXA 1UG6A 1JZ2A 5FL1A 1F4AA 1TZ7A 4JAWA 1W1PA 3W0KA 4HZ6A 4JFSA 3WEOA 1V02A 3EDEA 5DO8A 2JEPA 4CUCA 5A6SA 2BHYA 1V6UA 3W29A 5BROA 3U57A 2VZTA 1KB3A 3S6TA 4BZYA 4U3AA 4H8HA 3OLEA 1CPUA 3ZR6A 2E3ZA 3QOMA 3AS1A 2O9TA 1CGXA 3GBEA 4HA3A 1GHSA 4PUEA 2WM0A 1QW9A 2D1ZA 3DYMA 2V5CA 4FK9A 4P8VA 5IDIA 3SUSA 5BXTA 5CXPA 2DIEA 3CHDA 3TONA 1J0JA 3MUIA 3PZ9A 2X8RA 2DT0A 4D71A 3SUUA 1CYGA 4J27A 1TG7A 4CD7A 3WQ4A 4J7RA 2WC3A 4HOZA 5DEZA 3VGGA 3ZSTA 3WNLA 5M17A 4Z2JA 3AIBA 4URIA 2XIIA 2ZXQA 4W5ZA 3VM7A 2EQDA 4TOQA 4AY1A 3AIEA 1C92A 4PMOA 5E6ZA 3KWXA 3CHFA 3AHXA 3VOCA 1N82A 4NRRA 2EO7A 4BS0A 1E73M 2ESCA 2Y2WA 1HJXA 1US3A 3WF3A 3AZTA 2A3HA 1QW8A 1QI2A 1BVNP 5A2AA 5CG0A 2Y24A 3AICA 5M3WA 3OLIA 1E40A 2DSUA 3B8SA 3ZJKA 1OWQA 1HN1A 2XM2A 2VC9A 4B9YA 1HP4A 4U33A 2WZEA 2J62A 4D6EA 3A47A 4AZGA 3BAIA 2X05A 4B3LA 3VINA 4H41A 3ZO9A 1KXVA 2GSJA 1J11A 4QLKA 1XYZA 3NIYA 3UG5A 2WBGA 3N13A 2BY2A 1J0ZA 3UCQA 2CKRA 3GYCA 3VGDA 2VVSA 1W9XA 5E0FA 1JNDA 4UQ9A 2XG9A 4YN5A 2NW0A 3GH4A 1SYTA 1E1EA 1U33A 1HP5A 1J01A 1E43A 3SCPA 1JFHA 3SUWA 2ZUTA 4H04A 4HP5A 1OCQA 3N18A 1JZ7A 2VTFA 4D6IA 3S2CA 3WD2A 3AS3A 1XCXA 1B0IA 3ZR5A 2BHZA 1OGBA 2JE8A 3B9DA 5LYRA 1I75A 1GCYA 3APGA 1DEDA 1ODUA 1B9ZA 1ESWA 3T2QA 4AC1X 2JEQA 4PEEA 4OIFA 4GI6A 1Q6GA 2EPNA 4MB4A 5D9OA 1BTCA 2CBJA 3M07A 1KGWA 4MTVA 1BG4A 4LYPA 1JIBA 4JKKA 1NM9A 2D0HA 3VD7A 2J7DA 3WD0A 3QR3A 4IPNB 2J78A 5I6SA 4RE2A 3VIJA 1HIZA 3VGEA 1GPFA 2VX7A 1M53A 3WQ8A 1VAHA 5D8ZA 3WBEA 1AQHA 1NWRA 5A8PA 1BG9A 1UD2A 1ISYA 1UHVA 2W5FA 1GOWA 1OD0A 1EIBA 4BQ2A 1QOXA 4CD4A 4CCDA 1UKPA 4PCSA 3ZMRA 2A3BA 1XSKA 1C90A 1CXKA 3VU2A 3I3EA 5A95A 2XIBA 4Z2IA 3KEHA 2ZXDA 4KH2A 1AQMA 1OBAA 3WY1A 4OZOA 4ZXLA 1W91A 3ZJ7A 1LWJA 3NUKA 4PTXA 4B16A 1WDRA 1BLIA 5F7UA 3AHVA 1LF1A 1UR1A 4H2CA 1PBGA 5CLTA 3AHYA 3BLKA 5HPCA 2PI6A 1GOOA 1XH2A 2CBVA 4RE4A 1GVIA 4LYRA 3BC9A 3WL1A 2G3IA 3BMVA 4W88A 3W28A 4L4PA 4U5IA 2XWDA 1EDTA 1WZMA 4F9JA 1W2PA 4MDPA 1TA3B 1KR1A 2GK1B 4UQDA 4UOZA 1JI1A 4UOJA 5LA0A 1HJVA 4AZ5A 3WF0A 1V3JA 2AMGA 4ACZA 2ZX8A 3ZT5A 4UQBA 4X9YA 2PWHA 3VGFA 3U7VA 3VDHA 1JF6A 1CNVA 3AJ7A 4MB1A 4J3UA 4BCEA 3VX0A 3CH9A 3WNKA 2D0FA 3EMQA 1JFXA 3ARRA 1JD9A 3AIRA 4GQRA 3WNMA 1KGUA 4XV0A 1JF5A 1UR8A 3BMWA 1GQLA 4S3KA 4W89A 3SCNA 2XSAA 2ZIDA 1VIWA 3ARSA 4TVUA 1UD6A 4L4OA 2BVTA 1H41A 1OGGA 2W62A 2VNCA 2WMFA 3MUAA 4IPLA 4M81A 3WFLA 2VX5A 1HKIA 4JIEA 1UR0A 2EJ1A 2WMKA 4FLQA 2BY3A 1VFMA 3AMKA 2ZOXA 1UKTA 1GQIA 3ARXA 1H4PA 2WANA 3WUEA 2J8FA 3AYRA 1JNEA 3WH6A 4MNKA 1W3JA 1MVYA 4UTFA 5E0CA 4CU6A 2ZE0A 4WK9A 1GNXA 1UUQA 3U7BA 4AZCB 2ZUUA 1J0HA 2W61A 3TOPA 1JYNA 2WVSA 4H7VA 1LL4A 3UETA 3BAKA 5I78A 2GDVA 2ZXAA 1V0LA 4W7WA 2FHCA 2BNJA 4HZ8A 1K9FA 2ZX6A 4GXPA 2XM1A 1ITCA 7CGTA 2PB1A 2WLZA 4XB3A 1LJYA 2OSYA 1MQQA 3AMDA 2EPLX 4E4PA 2DH3A 1C7SA 1KCLA 3WQVA 3AXXA 2WCSA 1VEPA 2XYLA 4ACYA 4DM1A 3AHTA 1MFUA 1CGTA 1Q4NX 4YHEA 3VMNA 3CUIA 3IJ7A 2WPGA 4UQAA 4GQQA 2G3JA 3W81A 4PMUA 1JDAA 4P8UA 1R7AA 2EXOA 4HMDA 3OGVA 4TXEA 3ECQA 3IAPA 2ZWZA 3CZLA 4HPGA 5CPSA 3FAXA 3PZGA 4R5EA 2J8GA 4JHOA 2QPSA 4DWSB 3NYDA 4TX6A 5BXPA 3VVGA 1EXPA 1CXLA 2VJXA 2ZICA 1SMAA 5D9NA 1NWTA 2YLLA 4JFUA 3VIKA 5FCZA 3RMEA 4Y7EA 1HVQA 4CU8A 5A8QA 3ZQ9A 1GZJA 1JXKA 3WD4A 5CGTA 2VCBA 4H8VA 3CZJA 5EBAA 2XVLA 2WBKA 4HOWA 1WE5A 3MS8A 1OIMA 4MJ2A 2IUZA 2WZHA 3AIUA 1VF8A 4U5KA 1J0KA 2XJ7A 1QI3A 1UD5A 1KBBA 3NDZA 5AY7A 4WIWA 5ABFA 5BCAA 1OT1A 2CHNA 3DECA 3ZIZA 4R27A 1K9DA 3LPGA 4LPCA 1E6SM 3WDIA 4CN4A 4W87A 4M8UA 1FH9A 5A69A 1RH9A 2D22A 5DFAA 3PZVA 1JAKA 4HMCA 3N15A 2C0HA 4LYQA 3WUGA 3T0DA 4M29A 4W7UA 4AZHA 2YDQA 3LPPA 4CGTA 1B2YA 4J3VA 2WYSA 2PWFA 3IK2A 4P7RA 8CGTA 1TCMA 1MW2A 4UFLA 5CGMA 3THCA 3CUGA 1E5JA 5E9AA 4F79A 6TAAA 4JCLA 4A3YA 2VRQA 1AVAA 2DIJA 2A3EA 4GO9A 3AFBA 5D4YA 2DT1A 1E0VA 1KXTA 3FAWA 1E56A 4M82A 4PTMA 1HJSA 3SURA 4GKLA 1I1XA 3CZEA 3T2PA 4CD6A 5CPTA 3EDKA 1BFNA 1E4LA 4UFMA 1QBAA 4MNJA 3W82A 4BQ4A 1KWKA 4AWEA 3KE0A 4AIUA 8A3HA 1V3MA 2WW5A 4JZ5A 1Z32X 4OOUA 4S3JA 1SFSA 4W8LA 4JKLA 3PN8A 4F8XA 1GOMA 2J47A 1V0MA 3ARYA 1E5NA 1DWFM 5A2BA 3A4AA 4W84A 1JZ3A 3OG2A 3VDBA 2CKSA 3AROA 2BFGA 1XSJA 3SCQA 3CZGA 3GH7A 3GNOA 1H11A 1PX4A 2CNCA 3UESA 1UYQA 1CEOA 3VD5A 1BF2A 1WDPA 4ATDA 1CBGA 1UZ4A 3MSGA 3SUVA 3FW6A 4XX6A 1GJUA 1E4NA 1JD7A 3WENA 1GVYA 4WKFA 2WAGA 3WMCA 4LGXA 4PMVA 2YIHA 3GXMA 4WJXA 2VX4A 2CCRA 4JCMA 3CZKA 1ISVA 1E6NA 5HOSA 1O7AA 2J7CA 4WKHA 4M56A 4PN2A 1QNSA 4HOXA 1UR9A 2D2OA 4UFJA 7TAAA 1E1FA 3WNPA 3W26A 5IHSA 4Q22A 1NP0A 3MKKA 4QLLA 3WELA 2WHLA 4JL2A 3FNDA 4UNIA 3N12A 4HMEA 3SCUA 1PAMA 3CZ8A 2WHJA 5DMYA 4CVUA 2VR5A 2J7BA 3TTQA 1E15A 2WXDM 3EYPA 5A6KA 1YHTA 4F66A 2ZX7A 1RP9A 3W6MA 4ZENA 4KRTA 4FF5A 3SCVA 2WMHA 3SCTA 3VMPA 3G6LA 1E4IA 1UWSA 1H2JA 1V3HA 3WSUA 3NCOA 3QHOA 1E3XA 1KQZA 2X09A 1MWOA 3DC0A 3WDQA 1CGVA 4WSJA 2GJRA 3WDHA 2WB5A 3LMYA 3W6LA 4GZIA 3TA9A 5AYIA 2YA0A 1KBKA 3OGRA 2GJPA 1VJZA 2E4TA 3QGVA 1IV8A 1RD6A 4J3SA 4AD3A 1HL9A 1HVXA 3L4WA 3T2OA 4B9ZA 4EAMA 4DUWA 5AC4A 2EPMX 1JXJA 4QFUA 1Q6EA 5HXMA 2GUYA 2Q8XA 1M04A 1E3ZA 3GDBA 2XVKA 2XVNA 4PMRA 5BRPA 3RCNA 3WKZA 3PZTA 3VO0A 1W9BM 4AW7A 1IT0A 3PTKA 1G0CA 2YDRA 3AYSA 4W8AA 1LL6A 5IHRA 2E9LA 2WSPA 3UEQA 1J10A 3T0BA 1VEMA 4GO8A 5ABGA 1EQPA 2NT1A 1MW3A 3TTOA 2J25A 1L8NA 2VURA 1ISZA 4P7NA 2EEXA 1GOKA 4PCTA 2Y8KA 1UKOA 1MQPA 3WF2A 3VM5A 3AI0A 3MUZ1 5CLWA 4UOQA 3WDRA 1UWUA 3CMGA 1WDSA 4ACZB 2Y5EA 1FH7A 3VGBA 3VIOA 1FFRA 5GPRA 1X6NA 1XH0A 1NWSA 4A4AA 3F5LA 1JGIA 3TP4A 2WNWA 3JUGA 4D1IA 3WF1A 4OKDA 4FMVA 1GW1A 3A3HA 4NI3A 1CXIA 3WD1A 5M03A 1NOUA 1XC6A 3MANA 1FA2A 4V28A 1W3KA 3WQ5A 2PWGA 2WVUA 3F5JA 2VOTA 5I5RA 1WAWA 3ARUA 3VD9A 2WVVA 3BH4A 2BXZA 3EBVA 2DGAA 2QMJA 4MJ4A 3BCFA 2FGLA 1QI4A 3U5YA 4BA0A 1SR0A 5D8WA 4PSRA 4AEEA 3CHCA 3PZUA 3CMJA 2OWXA 3CO4A 3PBGA 1QHZA 3M46A 4U2ZA 3VIGA 3EMCA 3WBAA 4AISA 1XGZA 2AAAA 2IXVA 4RE3A 2VMFA 5LA1A 1JZ8A 1V0NA 1KQYA 1V03A 2A3AA 4GZJA 5I23A 2DPEA 3VMOA 4Z2LA 3K4AA 2YLAA 1UD8A 2XFFA 1E70M 2WMJA 3GZAA 1WB0A 2ZUSA 4BQ5A 1DP0A 3DHUA 1Q6DA 3CHEA 3FHAA 1UQYA 5CQ1A 1HKJA 2XWEA 3UR7A 4UFKA 3VX1A 4AD2A 4E8DA 1IZJA 2DSZA 3ZT6A 4JKMA 1O6IA 3B9EA 2WWCA 3AOFA 4NZCA 5A94A 2VZOA 2E9BA 3AMGA 1B30A 4GI8A 3SEPA 3BLPX 1IZKA 2FHBA 2FHFA 2BXYA 1MYRA 3AS0A 1W9VA 1BHGA 2J4GA 2Y8VA 4B3KA 2IXUA 1UA3A 1JDCA 3WH9A 3AQUA 2J7EA 5E09A 3W4RA 1FFQA 4QCEA 4KRUA 4PMQA 2YA1A 1CGWA 2ZUWA 4U2YA 2JALA 3BGAA 4BF7A 3F5KA 4UFIA 1CXHA 2QMKA 4N0RA 1D3CA 3OLDA 3WNNA 3K8LA 4J3TA 1QNOA 4NF7A 1UKQA 2VRJA 1CECA 3N1AA 1EHAA 4OBSA 3UG4A 2F2HA 4CCEA 1R7OA 3EMZA 1LL7A 1FP9A 1ODZA 3AMLA 1OB0A 1DTUA 2J7FA 4HTYA 4EE9A 2W4XA 1VEOA 3FY1A 5M5DA 4EANA 1JZ6A 4E8CA 1ZL1A 1ZJBA 1E55A 3WMSA 1HXJA 2XFYA 3PHAA 1DWAM 3RM9A 2CBIA 2WLYA 1EHNA 1AQ0A 1XH1A 3NSMA 2J77A 3VKKA 2XVGA 1NOFA 1E6ZA 1MXDA 3AMCA 4J28A 5LA2A 2E8YA 4JL1A 3IJ8A 5ABFB 1KGXA 4PMDA 4AYSA 1VBRA 2GJXA 2J74A 1R86A 1FP8A 1I1WA 3PTMA 2VO5A 1P6WA 4PUDA 2GFTA 3PZOA 5JBDA 4E2OA 2XTKA 4PMNA 3W38A 1UR2A 1BYAA 3PZQA 3OIHA 1H09A 1BAGA 4M80A 3WUFA 2X0YA 3FHQA 1JI2A 2D20A 3MMDA 1M03A 1RPKA 1E4MM 1JL8A 1UWRA 4TX8A 2VRKA 5A3HA 4PSPA 1ZB5A 2BY1A 3MMWA 1MW0A 2G4FA 4CD5A 3MSDA 1TVNA 1MW1A 3CLWA 5JIWA 2VVNA 2VI0A 4JFWA 2D23A 2D24A 1RP8A 3W25A 2UY3A 3I3DA 3T08A 1XV8A 2WZIA 1G9HA 1UQZA 5BXSA 3A4WA 2WMIA 5D9PA 5EMYA 2OYKA 3THDA 4D6GA 1JYWA 1H5VA 2E8ZA 3AHZA 1JZ4A 3W27A 3BAJA 4D6JA 3WH7A 1OD8A 1QPKA 2YBUA 1JYXA 3WUBA 1V08A 3UERA 2VCCA 1EDGA 1E9LA 1LG2A 1Q6FA 4UFHA 1DHKA 2BY0A 2ZUMA 5DT7A 2X1IA 3TTSA 1PX8A 2WWDA 1VJSA 5CSYA 2WSKA 3L4VA 1LWHA 5I2UA 3T09A 4W7VA 4J3WA 2BV9A 2XPKA 3ZOAA 4PMXA 2CPUA 5A6BD 5BXRA 3GM8A 2OYLA 2QF8A 5GNXA 3M7SA 4BQ3A 2G3NA 3F4VA 1ITXA 3OZOA 4JFVA 1OINA 1V6VA 1PJ9A 1UH2A 1BSIA 1G94A 2TAAA 3WFZA 2XSBA 3NDYA 3AZSA 1ECEA 2YA2A 3L4XA 1BYBA 4M24A 3VILA 4UQCA 3PTQA 2BS9A 1JZ5A 1R87A 1XCWA 5BWFA 4XUYA 4OOZA 1JYVA 5E6YA 3D3AA 3ZJ6A 1FOBA 4OJYA 1XD1A 2D3NA 4MNLA 3L4TA 4GPNA 2V5DA 3N04A 2VR4A 4W8BA 2WVTA 1OM0A 1NWUA 3NSNA 3OA5A 1UWQA 4TTUA 2F8QA 5IFTA 4CCCA 1TR1A 3ARWA 1ZBVA 3WD3A 5FOOA 2X2YA 3QHNA 3AZRA 3N17A 5FIPA 1WO2A 1XSIA 2PWEA 2J79A 3SCRA 3L2MA 2GDUA 3CUHA 2JFEX 2BHUA 4D6HA 5I0DA 4MPKA 1GHRA 4LQ1A 2O92A 5AYBA 2XGIA 1TMQA 4KGJA 1EDQA 1BYCA 4X0VA 2WKGA 5JUVA 3GTNA 3AIQA 2PF0A 2AOSA 5FKYA 2G3MA 5E70A 2O9OA 1HL8A 3AISA 1V0KA 2CERA 1BQCA 2B31A 1NOWA 1R8LA 2OLHA 3HU7A 1WZKA 1E6PA 1CDGA 4DUVA 2ZX5A 3AS2A 1G5AA 1W9UA 2V3EA 1KXQA 1H1NA 4P7LA 1H0IA 1U2YA 1E0WA 2VCAA 2YBTA 1EO7A 2RGMA 3LPOA 1W1TA 5JBEA 1VENA 4CN1A 4P8XA 2WCGA 2OWWA 1V6WA 4HZ7A 1HJWA 5A2CA 2DT2A 4PYSA 3RM4A 3FXYA 3RO8A 4W93A 6A3HA 3II1A 2J75A 3HN3A 4B15A 3WNOA 1UH3A 2OYMA 3DHPA 1B3WA 3NSXA 1EQCA 4UCFA 4P7OA 1J12A 3POCA 1V3IA 3RILA 1H0GA 4OUEA 2VZUA 1ZBWA 4YPJA 1G01A 5A8NA 4DM2A 3VIHA 2CXGA 1QNQA 1WZLA 2JIWA 2OSXA 1CLXA 4W5UA 3POHA 1GOIA 4PBGA 1TUXA 2GVYA 1GQJA 4CVWA 3VIPA 4V2XA 4JHZA 3GXIA 1VRXA 2W66A 2DDXA 4HA4A 2WC7A 4LXFA 3HJEA 4TVDA 3MO4A 2WK2A 1MXGA 3ARPA 3K8MA 3VNYA 1ISXA 3ARQA 3QOKA 4AD4A 4AZBA 1W3LA 1ZU8A 2E40A 3PZNA 4AD0A 5ABEA 3K46A 3DYPA 5EB8A 4NRSA 3CIVA 1EOKA 3A6OA 1DWIM 3WQWA 1MQRA 5IFPA 3UR8A 4HPHA 2RGLA 4AIEA 3L2LA 2CESA 4UQEA 3W24A 1J18A 1V3LA 2ZUNA 2W67A 3VDCA 5A6MA 1BPLB 4CN6A 3NJ3A 2HISA 4H8UA 4MADA 1VBUA 1XD0A 2UWFA 3O2LA 3WIJA 3MMUA 1K6AA 2WHMA 3VIMA 2WVVB 2WCAA 5HBFA 2F61A 4GIAA 1OGSA 2VT0A 2YL6A 4AIOA 1WKYA 3A4XA 3U5UA 1CLVA 1UWIA 4N42A 1US2A 3IAQA 3VD3A 2QV4A 1VFOA 1TE1A 4EK7A 1H3GA 3RPMA 1E6QM 4FLRA 4JFTA 1WCGA 4P7QA 4ZXOA 4ZEPA 1PIFA 2QHAA 1PEZA 5A6JA 5ECUA 4UZUA 1HKMA 5TD4A 4MDOA 3W53A 2DSVA 3VUPA 3AXIA 4IUGA 1J0YA 1CIUA 1CZ1A 2HVMA 3WEZA 2ZUVA 5CJ5A 1NQ6A 4HA1A 1KFWA 4XZBA 5CZKA 2YDSA 1A3HA 3BAXA 5I77A 3AIVA 5IXEA 4WLCA 2BVDA 2CETA 3FN9A 1HX0A 4F9DA 2WMGA 1GONA 1HKKA 1XYFA 4IM4A 1GOQA 3PZIA 2XGBA 1QHOA 4IISA 5I24A 4PRWA 3VIFA 5AC5A 3GH5A 2ZXBA 1ZBCA 1UD3A 1JAEA 4Z2HA 2YKKA 1E6XM 3WEMA 3WQ6A 3ARVA 2O9PA 2Y4SA 2G41A 3VNZA 4CU7A 5CSUA 4CKQA 2A3CA 1GUVA 1B1YA 1C7TA 3L4YA 4ZE5A 1E6RA 4DWSD 1CENA 1LLOA 5A6BA 3TTYA 1WPCA 4TUFA 2FH6A 1PZ2A 3RJYA 1HJUA 3KL5A 3WDPP 4FLSA 4P8WA 2YL5A 2ZWYA 5JIPA 4D1JA 4LX4A 5EFDA 3EDDA 3D5HA 2E0PA 1LG1A 4MB5A 4GI9A 1AMYA 1WZAA 3G6MA 5A6LA 3OLGA 1DWGM 3BCDA 4ATLA 1ZBKA 3SIMA 2FH8A 1EH9A 4PMZA 1ZJAA 5GQBA 4Z2KA 2V38A 3K4DA 4W86A 2VL4A 3WN6A 3CPUA 4ATWA 3ZJ8A 1GQKA 1K9EA 1L0PA 2GJXB 2VZSA 3B9AA 4HU0A 2DSKA 1JDDA 1WDQA 3SUTA 1HJQA 5A8MA
chains in the Genus database with same CATH superfamily
2FZBA 4IFKB 4J35A 1NAL1 5C7HA 3WQPA 4LSBA 2CITA 1M7OA 3AXHA 5GNYA 7A3HA 1GZGA 3S2NA 1CGUA 3W37A 2BG5A 3DKJA 2DT3A 1BGAA 2G50A 4ZQRA 1IWBA 1DWJM 3RJXA 3GD6A 3UNTA 1LQ0A 3SCOA 4I5RA 2G8ZA 1JUKA 1DJHA 1DORA 3FA3A 1T0OA 2CYGA 1T99A 2HSAA 3KL3A 1CXEA 2QPUA 4FXFA 3E96A 5REQA 1R3QA 2YOCA 3RPDA 1Q7ZA 3CGTA 2V9DA 4UUIA 4GUGA 3PJXA 2QDHA 3GXDA 4JGDA 2WKLA 3V35A 2VHLA 3EX1A 3PZMA 4XQ6A 4DUXA 3EA2A 1VB9A 4GZEA 4GD0A 4FF7A 4KETA 3UWZA 1OY0A 3CB3A 4CD8A 4AEFA 3VKCA 2PC8A 3PBUA 5EMLA 2BASA 4M51A 1FHLA 1VCFA 4AB4A 1TIMA 2EBNA 4GFSA 1W32A 5K4XA 4WHBA 3E6EA 3CUJA 4M1RA 2E09A 1HZYA 2AQWA 2ASHA 4N9CA 1M01A 3TQ0A 1U1JA 4HNVA 1R46A 3TEVA 2LLEA 3VGHA 2DZPA 3K1GA 2GK1A 1L8PA 4DF0A 4AZIA 3QBUA 5CPQA 2XHYA 2ALRA 1S5TA 2NSOA 1WBJA 1ME9A 4A6GA 4K3ZA 2OGYA 2HV5A 4C6JA 1TREA 1FWEC 3UWQA 2PDWA 1MUMA 4QLJA 3TN5A 2GUUA 1FKXA 2DZBA 1I0BA 1GORA 4C1LA 4ZVJA 3PSWA 4PRTA 2I16A 4R88A 4QJ4B 4I6VA 4REQA 1YIXA 2PU0A 2ISDA 5KSWA 2A21A 1WYIA 3ARZA 3KLKA 5IBXA 2WC4A 3PNZA 1W5QA 2F6XA 4XZWA 1F5ZA 5FD0A 4R85A 3SBFA 3OBAA 1D8WA 3KAOA 3BDKA 1DJQA 3QRHA 3CEUA 3WLOA 4AG0A 1S2UA 3V4BA 4I9AA 1EA9C 3B8VA 4ZE4A 3IJ9A 3MU7A 1W3HA 3VIIA 3IUDA 5AOUA 3P5ZA 2ZVRA 1J9YA 1TIWA 3N25A 4O1AA 4O17A 1DJWA 2NXHA 4Q7BA 4PB5A 4AZ6A 4AQLA 4S2CA 3SCWA 4D6DA 1KCKA 3TXZA 3UPWA 2RHGA 4N02A 3TAKA 4PUKA 1CX9A 2EG6A 1V4YA 4U3CA 3ZT7A 4Q7NA 2C3ZA 2G5WA 2EPOA 3AIWA 5CZTA 4DPPA 2DH2A 3T9PA 2VX6A 4Z2GA 2V3GA 3OYZA 3Q4DA 1B3ZA 1UH4A 3RDKA 3GDTA 4NSBA 1QJWA 1S3TC 3KTCA 4K2SA 3SSZA 1XPGA 2PDQA 4B4FA 2QXWA 4HNNA 4E2VA 1WV2A 5ABHA 3VD4A 1EX1A 1N2VA 3O9NA 1BGGA 3BXWA 4H9MA 3F1QA 1OFEA 3B97A 4D72A 4RNFA 1LWIA 1K4HA 2A1YA 4NKCA 4GUIA 3BSGA 1BKSA 3WJZA 4PTVA 1VH7A 3ATZA 4FNQA 4QQUA 2PBGA 1GWJA 1L2QA 2CEQA 3LHVA 4AAJA 1X6LA 1QPOA 2CHOA 4NHVA 5H8UA 1QI0A 4LVFA 2Z1SA 3UFYA 3ZXWA 1JCMP 1EO5A 3HQOA 1KA9F 3QFWA 1EWDA 3RF9A 2Z6JA 3B8UA 5D2YA 4IT1A 4POCA 2YX0A 1EPXA 1PIIA 2YYUA 1QVBA 3Q65A 1ISWA 3VTRA 3CV7A 1MO0A 2NSXA 1UG6A 1RJPA 1TZ7A 1W1PA 4HZ6A 3WEOA 3EDEA 5DO8A 4CUCA 5AYZA 3MP4A 2X30A 3MVTA 2VEGA 2YZRA 1A4MA 3W71A 3ITTA 5FJRA 2E7FA 3ZR6A 5CGQA 3N6HA 2E3ZA 2O9TA 4HA3A 1GHSA 2ZVIA 2C1GA 5PTDA 1UP2A 4K6AA 2VFFA 1X98A 3BZJA 1IXQA 2CLHA 3KOXA 1BD0A 1J0JA 2DT0A 1ICSA 3I4EA 4J27A 1MUWA 1TG7A 3QGKC 3NEVA 3TTEA 4TX9A 1RCXB 3EXRA 3UJ2A 2QUMA 4R9XA 3D3FA 1PTAA 3WG6A 4URIA 2XIIA 2H90A 3OHIA 4JQ4A 4F0MA 5H6HA 3L7RA 3HJZA 4TOQA 1A5KC 3KWXA 3DAQA 3GKFA 1H62A 2ESCA 5HINA 2POZA 4DJEC 2GL5A 3TN4A 1NFBA 5JH2A 5A2AA 5CG0A 4O10A 6PTDA 1E40A 5FACA 1OWQA 2ZCGA 2XM2A 1PO9A 4D6EA 3A47A 1XUUA 3W23A 3VINA 3BZGA 4M6VA 1XYZA 1R2SA 4UTWA 1A80A 2W6RA 3LCLA 3UG5A 1W3TA 3AU2A 1QWKA 1EX5A 3ID7A 3GYCA 2VVSA 1JNDA 3ITVA 4UQ9A 1SO4A 4LVAA 1SYTA 2NQ9A 1E1EA 3GR7A 1U33A 4KESA 2WV8A 3ITGA 7ENLA 4MWAE 2R6OA 2IKJA 4PUMA 4HP5A 1VYPX 3N18A 1F6KA 5LNVA 3WD2A 2OMAA 2NXGA 1XCXA 3NL2A 4LEQA 4A29A 3ZR5A 2BHZA 5LYRA 4ILSA 1ODUA 3T2QA 2JEQA 1Y5VA 4GI6A 1LTDA 2QCHA 1ZGDA 1BTCA 3ANVA 4H00A 2PDGA 3KRBA 1JCXA 4S3GA 3WD0A 3WLSA 2OQYA 2HZGA 4LB3A 4K36A 1K8YA 3MHFA 3VIJA 3L0GA 5DN1A 2QGHA 3R94A 1THFD 1VAHA 1J79A 5G4HC 3WBEA 5FEPA 1XX1A 5HMFA 2DY3A 1BG9A 2HXUA 5REQB 1ISYA 3AUJA 4W9TA 1GOWA 4MG4A 1BF6A 1EJ7L 3G1FA 1QOXA 3LBMA 4HHMA 4HBKA 4PCSA 5GJNA 4GG9A 1XSKA 1F8MA 3TH6A 4JTTA 3KWSA 5AKQA 1RK5A 4IWWA 2VGIA 3B04A 3WY1A 1LQ2A 1AUSL 1XR2A 1ICQA 4RXFA 3RU6A 1OQFA 2MUCA 2YXXA 4IJBA 4AWSA 1EIXA 3AHVA 4PODA 1LF1A 2ZTJA 4LUTA 1UR1A 1SZGA 4H2CA 1KTBA 2B7OA 2PI6A 1GOOA 1X38A 3BJSA 1GVIA 2VENA 1LBLA 4O18A 2R14A 3R5EA 4HMNA 4L7ZA 2G3IA 3BMVA 1VBHA 4L4PA 3IJ6A 3DOPA 2FIQA 3L5AA 3H4XA 3MWAA 2Q09A 4K8HA 3GG7A 2GK1B 4MY9A 4UOZA 1JI1A 3ZYZA 1HJVA 4HPXA 4YVXA 2AMGA 4UQBA 5K9DA 4RLIA 2FPTA 3GTXA 2FVMA 2CWNA 3TYAA 1YE6A 4PE8A 2FQIA 3VGFA 4WDUA 5KZDA 3R1ZA 3ZLGA 3WNKA 5DCEA 3GC2A 2AL2A 1NF7A 3EMQA 3W2NA 1JFXA 2XDFA 3ARRA 4TQTA 4HD5A 4I9MA 1KGUA 4REQB 5IM51 3APTA 5DRIA 1XLBA 1XS2A 4XKMA 4W89A 3G3DA 4WRHA 3NQMA 2NV2A 4NZFA 2DUZA 3ARSA 1HKWA 1PTGA 1I0DA 1ZJIA 2E67A 4L4OA 3MHGA 1IZCA 1SW3A 2W62A 4PCFA 4M81A 3WFLA 1ADDA 4L9XA 2BY3A 3NQGA 5C0QA 2ZOXA 3G1HA 4A3QA 4Q32A 1FBAA 4I8DA 2J8FA 3AYRA 3L5MA 1YRRA 5E0CA 4CU6A 2GPTA 1J0HA 1JYNA 2WVSA 4H7VA 1AG1O 3UETA 3BAKA 3IPWA 5I78A 4H4IA 4GRSA 1YDOA 4W7WA 2BNJA 1KRBC 1UP0A 3VOGA 3UPBA 1XIGA 1LJYA 1UWAA 2EPLX 1KD0A 4KERA 3A24A 3KXQA 3P74A 4GYFA 1TR9A 5LNRA 3U9IA 4XBKA 3RGTA 3UF9A 4DM1A 1DIDA 1ZALA 5CSSA 2RDUA 1F3TA 5BU9A 1AW1A 3H7RA 2I1OA 4P8UA 4E8GA 1KCXA 3PANA 3GDKA 4JIHA 4M7SA 4HTBA 1OYAA 2XGZA 4NXSA 3GUGA 3CZLA 1N8WA 1GJPA 3OVGA 4ZMGA 3NYZA 4XD4A 1KV8A 3NYDA 4L5ZA 1K4GA 4JNMA 3VVGA 5H8MA 4HHLA 3KZPA 4X22A 5HMEA 5TQLA 1SMAA 3VIKA 1S2WA 4QSFA 4Y7EA 1PKLA 5A8QA 4TIMA 4UMAA 3QPEA 4KIRA 2BZNA 5CKSA 1JXKA 3ZQ9A 2VCBA 6ENLA 2ZC8A 2QVHA 3MS8A 4UTTA 5FJIA 1BXNA 1OIMA 4MJ2A 2IUZA 2WZHA 4V33A 4YTQA 2TSYA 5C2GA 2XJ7A 3MDUA 4L4MA 1QI3A 1KBBA 5I3KA 1JCTA 3I7SA 5BCAA 2G0WA 2XINA 3EOSA 4R27A 2QVNA 2ZE3A 3LPGA 3PG8A 1B4EA 5I7GA 3WDIA 4W87A 3G5EA 5C55A 1OYBA 2HPMA 2G95A 2D22A 5AVNA 3N15A 2HBXA 1G4SA 2Q6ZA 3WQEA 1LOSA 3T8QA 3FSTA 4W7UA 4PR4A 3LPPA 1B2YA 4J3VA 3OZMA 2YZ5A 8CGTA 2BGSA 5CGMA 3CUGA 2PZ0A 1G4TA 1E5JA 4DXKA 1JJKA 4JCLA 4A3YA 1YXDA 2VRQA 4DZIA 2DT1A 1E0VA 1KXTA 3IVUA 1F07A 1I1XA 3T2PA 4MNJA 3W82A 4AWUA 1KWKA 4AWEA 3KE0A 1GOXA 4PEKA 3PN8A 1GOMA 1L9WA 3G24A 1KV5A 1S5WA 2ZA1A 1JZ3A 4JX4A 4D9PA 4O1FA 1IGWA 2O7QA 3LSBA 3GNOA 1H11A 4JTKA 2PZNA 3GSMA 4LV4A 1CEOA 3VD5A 2ZKMX 1BF2A 3IJQA 1WDPA 1W1B1 4ATDA 3MSGA 1QR7A 2OZ3A 3VKBA 2WAGA 3WMCA 3UT0A 3WLLA 1HUVA 1M41A 1OF8A 1TCDA 4KFPA 4I9JA 4DBUA 5HOSA 5D05A 3MCMA 2IMRA 4PN2A 2QF7A 1UR9A 2AKMA 1R6WA 3B8WA 3QQWA 4MKNA 3QV8A 1NP0A 2FVKA 3EX4A 4PCNA 3CQKA 3B9NA 4UNIA 5LNWA 4O1CA 4ECLA 1T40A 1EBGA 5CJMA 2WHJA 3LGGA 3OYXA 2VR5A 2VC5A 2D2GA 2WXDM 5BZAA 3CT2A 4A3UA 3CK5A 1FRBA 4YS1A 1W5PA 3SCVA 3EKGA 4LC6A 4IX2A 2VXNA 3G6LA 1OFRA 1H2JA 3COTA 3CTLA 3WSUA 2YFNA 3GQYA 4HZMA 2F6KA 1KQZA 3DC0A 1CGVA 2R94A 3WDHA 3QV6A 3D46A 2BSLA 4UMBA 3TYDA 3TA9A 2VDGA 5AYIA 2GJPA 1XLCA 3QGVA 4DXVA 4J3SA 1RD6A 4H19A 3A13A 4NL1A 1LLZA 1BWVA 4IPIA 1Z69A 3WK0A 3T2OA 4B9ZA 3VZYA 4E38A 4EAMA 2W27A 4GVHA 2W9MA 3TYCA 3UZWA 2GUYA 4ZL1A 3M0KA 1WDWA 2Q8XA 3GDBA 4ZSTA 5SWUA 2XVKA 5BRPA 3RCNA 2OZTA 3LOTA 4ORIA 4ZB5A 4JTHA 4NYUA 3HG4A 4LUTB 3AYSA 1LL6A 3MJMA 3R2GA 2P0IA 3KTXA 1NDZA 1P6CA 2NLIA 3GO2A 1U1UA 2J25A 5CPLA 4P7NA 1GOKA 2OEKA 1XGDA 3BL3A 4PCTA 2ZZ2A 3WDRA 4GVFA 3W9ZA 4DO4A 4JTCA 3HV9A 1AFSA 1MDRA 3P82A 4A4AA 3F5LA 1JGIA 4MY1A 3NPUA 1FWCC 2WNWA 2AL2B 3NQAA 3H53A 4FMVA 4GJIA 3LXBA 4XIMA 1KM0A 2FTPA 3G1VA 4EXQA 1KNWA 3QZ6A 5LSMA 2RH9A 2YPIA 3VOIA 3WQ5A 4PC8A 3SFKA 1WAWA 1GYLA 1UPMB 4US5D 3TMLA 4MOZA 1XG3A 1Y5XA 3BH4A 3EBVA 3N2BA 2DGAA 1C9DA 3NL6A 2FGLA 3UWVA 4PFMA 1A5CA 5HMDA 4PSRA 3PZUA 1RQBA 2OWXA 3L0KA 4DB7A 3M46A 4U2ZA 3VIGA 4BEUA 1SZEA 3W7OA 2J13A 1TJRA 3TW9A 1E9ZB 2F9RA 5LA1A 1I8JA 1JZ8A 1V0NA 4KCWA 3T07A 2QUTA 3A3WA 3GHRA 4EPDC 4GZJA 2A3AA 3B0PA 3PB0A 4GIRA 3VMOA 4Z2LA 5LNSA 3F03K 3NO1A 3RAOA 2OX4A 2QUVA 1K02A 1DP0A 3DHUA 3CHEA 1XIDA 2VGBA 3VX1A 2I9UA 4E8DA 3ZT6A 2Y0FA 3FVDA 4H01A 4GI8A 2J27A 3SEPA 3GDLA 2HWGA 1ZP4A 1MYRA 4QG8A 4K1WA 2HROA 5EMKA 1BHGA 3INPA 2Y8VA 3QGAC 3UGRA 2QCCA 4Z0JA 3S9ZA 4EIVA 4AY7A 2VELA 3PBVA 3RHGA 3W4RA 3KRUA 4FHAA 1CI1A 1XP3A 4KRUA 4US6A 4LY4A 1VHCA 3B06A 4U2YA 2JALA 4BY3A 4E3VA 3WZ0E 4BF5A 3TNOA 4LUIA 3LK6A 5C7VA 4NF7A 4J3TA 1UKQA 2XIQA 4RNHA 1CECA 1KM6A 2I14A 3UG4A 2F2HA 4CCEA 1ME7A 3CC1A 4OGZA 3BGGA 1GVEA 1A5SA 3DIPA 1OB0A 1UBSA 4HTYA 3EAUA 2RDWA 3NAVA 3FY1A 4WY0A 2VFHA 4EANA 1ZJBA 1E55A 3TROA 4HCHA 3WMSA 2CBIA 3EOLA 4PFHA 4PL1A 3L21A 1EHNA 1NEYA 1SSGA 2J77A 3VKKA 5DANA 2BOFX 1U5VA 3S5ZA 1YTKA 1E6ZA 2OT0A 4CNSA 3PBMA 4K8GA 3OW1A 3WLRA 3UJEA 3ATYA 4AYSA 2GJXA 4GGHA 2NWSA 3TQKA 2WSRA 3G8RA 2PFHA 1V5XA 3O15A 2GZXA 3PTMA 4DAIA 3NPWA 5JBDA 1ZFJA 3N2OA 3HBLA 1BYAA 3IWPA 3WUFA 2X0YA 3FHQA 4DBWA 2AMXA 2VD8A 3UCCA 2BOEX 4WY0F 2EF9A 4G8TA 1UWRA 1W54A 3LLDA 1Z44A 5A5WA 2ZFAA 4OHQA 3RG6A 4RUBA 4JEQA 2Z25A 3MO7A 4KEMA 4MIMA 2VI0A 4X2PA 3QY7A 3T08A 4WGXA 1UQZA 3A4WA 3B8DA 2HXTA 2QQ6A 2OYKA 4D6GA 4PUWA 1JZ4A 5DQPA 3T42A 2Z6IA 3LENA 3BAJA 3WH7A 3TZFA 1OD8A 1QPKA 2YBUA 1OZMA 3LN3A 3M0VA 1S39A 5MF5A 3UERA 2VCCA 3WLQA 1LG2A 1DHKA 1UIPA 1F6YA 4LCQA 4IP7A 1TTPA 3O3RA 1PX8A 5D38A 1QFEA 2R8WA 2C79A 1SJAA 1N8IA 3L4VA 1UOZA 3EWCA 5T91A 2CPUA 5A6BD 1PTDA 2VGFA 3H24A 3M7SA 2G3NA 3F4VA 1ITXA 3MKVA 1BQGA 3RX3A 4RKAA 1TWDA 1S1PA 4HKPA 2TAAA 2VM8A 4DJFD 3KOFA 4MYXA 1NF0A 3PB2A 4M7TA 4BR1A 2PCEA 1BYBA 3PTDA 2OXNA 3HA1A 4XUYA 1A5OC 3AYTA 3ZR4A 4OJYA 3N04A 4RXGA 2VR4A 2QZRA 1OM0A 3HO8A 1GEQA 3MVIA 1NWUA 3NSNA 3OA5A 5D02A 4XZHA 3GAYA 5IFTA 3IRDA 3B0VC 4C6QA 3LRLA 4OFCA 4IIHA 4GFIA 2ATSA 2X2YA 2I17A 3N17A 5TNVA 1WO2A 5K9XA 4O8RA 1FWDC 3L2MA 3CUHA 1H7PA 1KTCA 4D6HA 2O92A 2C6QA 4UTLA 5AYBA 4US5A 4KGJA 5HJLA 3NZRA 4JIRA 3PFRA 5CG7A 2PF0A 3ANUA 2G3MA 3HFTA 2WM1A 1HL8A 1H7NA 1KM1A 3AISA 2NX1A 1V0KA 2I5GA 1BQCA 1AZ2A 3R25A 4Q4PA 4UTUA 1TMLA 1QXLA 2OLHA 4MUPA 4RV3A 1WZKA 1F6PA 1E6PA 3PY2A 3TFCA 3SY8A 3AS2A 2IKIA 1XICA 4P7LA 4B5SA 4QR6A 4CN1A 4IPJA 2F84A 1HJWA 4H3DA 2A85A 1FWAC 2C1IA 4EWND 4IGSA 2DV0A 3KDNA 6A3HA 3ABOA 2YCJA 4B15A 1SZNA 4AEOA 1AH3A 4FEZA 1DL3A 3WNOA 1FY6A 2Y89A 1V93A 1Q7MA 2CZ5A 1DXIA 3NSXA 3M43A 1VPXA 3W1TA 5BW6A 1GVRA 4FZIA 3U3HA 2W0UA 2Z27A 4OUEA 1AJ0A 2X1RA 3I6RA 3HZ3A 1JRCA 4KT2A 5A8NA 4L1GA 1G69A 2NQHA 4I5XA 2NUXA 4QNWA 5HWMA 1EJVC 4ZFCA 4PBGA 2GVYA 4F0RA 3Q2DA 2OFJA 3GXIA 1VRXA 3F4WA 5IRPA 1FWFC 3PFMA 3EOEA 3MO4A 1TJ1A 3Q58A 2TRSA 1MXGA 3H21A 3I4KA 5CSRA 1GG0A 3ARPA 4UC5A 3VNYA 1XLAA 3ISIX 1ISXA 4AX6A 4AD4A 1O1ZA 3K46A 5DX7A 5HNRA 2OCZA 5TBOA 1VP5A 3A6OA 1DWIM 2XFWA 2PRHA 2IPWA 2QCDA 4LVBA 2RGLA 2CESA 3W24A 2ZUNA 1VYRA 4Q8MA 1BPLB 2GWNA 3CUZA 5CEWA 4UCGA 2OU4A 1NIUA 1VCGA 3UVIA 4RDVA 1AQFA 4JTRA 1LORA 3MMUA 5A8GA 3W70A 5DY2A 1W3IA 2F61A 3W84A 3A9BA 4NAFA 5FAJA 3KCJA 1O60A 1SO3A 1WKYA 4FNPA 2WNQA 2QV4A 4EK7A 4KFNA 1H3GA 3B8TA 1E6QM 4FLRA 1RBAA 2J6VA 4HSOA 2QHAA 3TXVA 4DY1A 4A8LA 3ZWTA 3LX9A 4JN7A 4C6DA 1GPWA 3LDVA 1MI3A 3VUPA 2V67A 1XKYA 3TC6A 2YW4A 1AH0A 4GUFA 1B9BA 5I77A 4DF1A 4UNKA 4DO7A 3D0CA 4F2BA 3E12A 1GOQA 3PZIA 3USBA 2XGBA 1G67A 5FEXA 2WNZA 2IW0A 4HK6A 5HUOA 4KEUA 2ZA2A 4Q7IA 1UD3A 4UTIA 1QNVA 6REQA 1H61A 2ADAA 2G41A 4E2DA 4UTKA 3VNZA 5CSUA 4L65A 3T40A 1JVNA 4RE0A 2A3CA 4CKQA 1GVOA 2X2GA 2H6RA 4OBTA 2W3ZA 4ZE5A 3HMJG 1CW2A 4DWSD 1CENA 4QDWA 3KVMA 5A6BA 1LUCA 5G1YA 4H7ZA 4TUFA 1L6GA 1PZ2A 3RJYA 3KL5A 2YL5A 3S1WA 2YB4A 5L6UA 3RN6A 5T26A 4X2RA 4MB5A 3G6MA 4BKNA 4WY0B 1DWGM 1XIIA 3WX7A 3BCDA 2I56A 3CIXA 1UR3M 4PMZA 4RK8A 1IQ8A 1Z3NA 1YW1A 3VDGA 3K4DA 5J8LA 3MI2A 3R8GA 2PF8A 2CU0A 3M0JA 2FJKA 3CPUA 4ATWA 1HGYA 2PCQA 1L6WA 1A0CA 1VFLA 4XO6A 2P1FA 3AXKA 3I6EA 4Y90A 2PDHA 4O53A 2GJXB 4IJRA 4HU0A 1ZNNA 1IXNA 3SUTA 4PCPA 1A4LA 4QP0A 4DBEA 4QTGA 1ZZMA 1ZAIA 3ELFA 3G3MA 4MWAC 3EDFA 3SDOA 1Q85A 4GH3A 2PBOA 1I2NA 3CL6A 1B90A 1ITUA 4IZGA 4ZO6A 3GBDA 3UPMA 1W9PA 3URQA 5DMLA 2BX7A 3O05A 3W01A 4ZO9A 1W5OA 4KMQA 3WLPA 4DHGA 1E71M 2H8ZA 2D3LA 1QU4A 4FR1A 5XIAA 4C7FA 3UR5A 4Y9OA 2PDBA 2OG9A 4HU4A 3CT7A 3H12A 4C5ZA 1H5YA 1Z6KA 4RDZA 5G2IA 3FDGA 2PEVA 1RALA 4YLWA 3TLQA 1UWTA 1AJZA 1W2VA 2VD9A 4KWWA 4B5NA 4GINA 4YU1A 3KUMA 3DUGA 4QAIA 3E1F1 4TR9A 5AVHA 5AZ0A 3KOYA 3UG8A 2GUBA 3RR1A 3QY6A 4UR8A 5AHMA 5DBTA 3MZ2A 4LH8A 1W31A 3QQ0A 1TA3A 5E5CA 3KBSA 2NT0A 2QAPA 1C8XA 4EKJA 1UKSA 2UV8G 4XTDA 5CZSA 2X0HA 5KEZA 4NJKA 4QAWA 3WLIA 1OIFA 3QKEA 3W1MA 4NX0A 1C8QA 3IANA 3R4IA 1RZMA 4BHYA 2V3DA 5M2FX 1EFZA 1H1ZA 4EPBC 5AECA 4U31A 2VUYA 4IPPA 4QDMA 1GJWA 1C91A 1CTNA 4BI6A 1DXEA 4LAKA 2ONEA 3N6JA 4PTWA 5D9MA 3RUBL 3KDOA 3ABZA 2HS8A 1GK8A 1C93A 5A6AA 3SQMA 1VR6A 3B40A 3OZPA 1ALDA 3W7RA 2XUCA 3GNDA 3GTFA 5A8OA 2PTZA 1TFVA 1IHIA 2Z1BA 4DJDC 2IPGA 2VZVA 1I9CB 1QW7A 1JULA 1VBJA 3E9AA 1R85A 5IBXC 5DF0A 1T7LA 4AZCA 3DU0A 3ZM8A 2J9XA 1RCOB 2CC0A 1V7AA 3MI3A 2D2HA 4ENLA 1R3RA 5EFFA 4Q8OA 5BYWA 2VYOA 1FDZA 1P7TA 1QPRA 5AC6A 1FVPA 3PUGA 4X0NA 1XRSA 1FCBA 3LXCA 3HB9A 3ONBA 3T78A 4WSHA 2DSWA 3RPTA 3NQFA 3PSVA 3STGA 3FYYA 1F4HA 4S3AA 5C9UA 2OWCA 1RD5A 3G8EA 4LF1A 3WJWA 4AD5A 3L65A 1V6YA 2YXGA 3KL0A 2DORA 2OEJA 3K1DA 1B31A 2QS8A 4JD4A 2INEA 1BXBA 2F2KA 4GX9A 4H83A 1V6TA 2PE4A 3CV6A 3VPLA 1PPIA 4JBRA 3UG3A 2V81A 3FKKA 1EC7A 1CLKA 4HK5A 1YDYA 3G1XA 1E72M 1W1YA 3HPZA 4DWSA 1VFFA 2UY4A 1Z42A 5F2GA 4GY0A 5BOEA 1OSEA 2V6AA 1FUYA 4WDXA 1DXFA 4MVAA 1F7BA 1M7XA 3LQGA 5GNZA 3N2CA 4AHOA 1LBMA 4V27A 5BU6A 2QCDB 3DH7A 2QLYA 2G96A 3W75A 4HYVA 4XZLX 4AD1A 3DHDA 2J7GA 1X1NA 3I3BA 3IGXA 4MZ8A 1FWHC 4DI8A 4RL3A 1V79A 3V5OA 5CC3A 1L2UA 4PGLA 4AXKA 4NVTA 4YWSA 2JIEA 1EL3A 3SQLA 2MANA 3GFYA 2YBVA 4NAFB 4MYAA 2YCIX 3UZXA 4JAWA 3PPCA 2BWGA 4DYJA 1V02A 2WPBA 2JEPA 4GBDA 1V6UA 3E5PA 1L6YA 3TNBA 1KB3A 4U3AA 1EJWC 3R12A 3OLEA 4IP4A 3QOMA 1S1RA 1QTWA 3GTIA 4Q4SA 1WOBA 3E2VA 1W5MA 4DBSA 1MEHA 2V5CA 3NQVA 4ERAA 4P8VA 1DJZA 4YIWA 5IDIA 3SUSA 4HYRA 1UASA 3DC8A 4A35A 3CHDA 3W2MA 3MUIA 4O12A 4AVOA 3C56A 1DV7A 1NVMA 3FIGA 1A5BA 1TVLA 4NI8A 3WQ4A 4J7RA 5DEZA 3VGGA 3LBOA 3M4HA 3B8IA 3BVJA 3QN3A 3WNLA 3RLGA 2GYIA 2ICSA 4JR5A 1XQLA 4LRTA 2ZXQA 1Q2SA 3VM7A 3HGSA 2E25A 2OODA 6REQB 3AIEA 1N82A 4MF4A 1XIJA 2EO7A 4G5DA 4NU7A 3QMSA 5CBJA 3WF3A 1QK2A 1LUCB 3OLIA 2A0NA 2DSUA 3B8SA 4LALA 3ZJKA 1HN1A 4B9YA 2OGJA 3CO8A 1HP4A 2ON3A 2WZEA 4FXJA 4M6UA 2HE5A 4IH3A 4AZGA 1ZQ5A 3MB9A 4GYPA 3L0NA 4ASTA 4NZ1A 2JKPA 3NIYA 1DIKA 2WBGA 1FKWA 3KS5A 4MLJA 5DLCA 3LRKA 3YPIA 4IL0A 1W9XA 5E0FA 2QT3A 3BQ5A 4YN5A 3GH4A 1N7KA 3U8GA 3H2FA 3SCPA 1X6UA 3SUWA 1LOLA 1JZ7A 4D6IA 3N14A 3N9SA 3TU9A 3C8FA 3V1HA 4UTWC 4PUNA 1DEDA 3C2YA 1B9ZA 1ESWA 2B7NA 1M1BA 1M7PA 3PUOA 2EPNA 3OPSA 4MB4A 3GW3A 3WQFA 5BMXA 2PD9A 3M07A 1TWIA 4GY7A 3MTWA 4MKSA 1NM9A 4QJ3B 2D0HA 2OQHA 2J7DA 4L64A 1A5LC 4Q4RA 1AL7A 5FA5A 2KZHA 1YPXA 4CQ8A 1GTEA 4IMEA 4NJJA 3VGEA 3HPSA 1BWLA 3F2CA 5BOOA 3WQ8A 5A8PA 1EJRC 3RFAA 2RFGA 4IP5A 4TMBA 1UHVA 3QJAA 1R38A 2A6NA 5FEZA 1TPH1 1OD0A 5CBIA 4F2TA 4Q3MA 1JCJA 4XAYA 4GNVA 3NL5A 2VEIA 4QRNA 1GG1A 5A95A 1HO1A 3FV9A 2XIBA 1OBAA 1WX0A 4F48A 3NM1A 4ZXLA 1W91A 3ZJ7A 1LWJA 3K2GA 4JY9A 3NUKA 3GB6A 3QVQA 4JNZA 1PBGA 4XAZA 3FDKA 3LD5A 4RE4A 4LYRA 4XAPA 3G1DA 3BC9A 3C0JA 3WL1A 3B9OA 3FX4A 5D2WA 3NQ8A 1SZFA 3P84A 4F9JA 3NURA 1W2PA 4MDPA 1TA3B 4UQDA 1LDCA 4EAYA 3OJGA 5LA0A 1LLWA 1JCNA 1O1HA 1R3TA 3V1PA 4X9YA 3SFWA 4FA3A 1UPPA 1YYAA 3M6YA 4JXCA 3MDWA 4XTIA 5FSDC 3VX0A 3W7NA 3O16A 4DJED 4L6OA 4HSHA 2E77A 3VK5A 3FYOA 1A5NC 5EMMA 1JF5A 3BMWA 4QG6A 1H7WA 3HV8A 1RLDA 4S38A 3TVAA 4TVUA 2I5QA 4DYKA 4XZ9A 2C18A 3PM6A 4O28A 2VNCA 5I3IA 2V82A 3ONCA 2X7WA 4JIEA 4X9SA 1UR0A 2PWUA 4FLQA 4FXRA 1VFMA 3AMKA 3P60A 3I7RA 1ONRA 3ARXA 1OX5A 1H4PA 3LCFA 3XISA 2O4QA 1WDDA 4A8IA 4UTFA 4WK9A 1GNXA 1UUQA 3U7BA 2WZMA 4AZCB 3HFYA 3TW7A 2P8BA 1IR1A 2PP3A 4N9EA 4DEFA 1F3XA 2GDVA 4Q8UA 2QCEA 4NQ1A 5AYYA 1P7TB 1V0LA 3E0LA 1IYXA 4E5TA 2GQAA 3SW6A 1Q13A 5HQMA 2WLZA 3KP1A 1F61A 1MQQA 3AMDA 4E4PA 1C7SA 2D2JA 3C3UA 1XM3A 2G97A 3AXXA 3CQIA 2WCSA 3CPRA 3KBMA 4IIEA 4ACYA 4I90A 2B81A 4UQAA 1UMLA 3CWOX 4GQQA 1JDFA 4DX3A 1AD1A 4LTSA 4TXEA 2NVDA 2HEJA 5TIMA 1J4EA 3IAPA 4HPGA 4JIPA 4LNCA 4R5EA 1LCOA 2VFEA 4FIQA 4DWSB 4TX6A 5BXPA 1A5MC 3EB3A 3S1VA 1ZRQA 4WOQA 4F0HA 1XYAA 1OFPA 3VOFA 5D9NA 5H91A 1VPQA 5FCZA 3RMEA 2Z24A 1HVQA 4JX5A 1PWMA 1GZJA 3Q94A 3CZJA 5C2CA 4HOWA 3NOEA 1PUDA 1DJYA 3TYEA 3P67A 1B3OA 4FS9A 1J0KA 4B5TA 3S47A 1PKYA 3F4NA 3NDZA 3W7EA 2B0MA 4PUUA 4XZIA 1OT1A 4DZ5A 1EZ2A 2CHNA 2C16A 3DECA 2DJXA 3LSCA 4FOKA 1K9DA 1E6SM 2INZA 4GUJA 1FH9A 4O1DA 1RH9A 3GG1A 1NU5A 1JAKA 4HMCA 1UJQA 5ENLA 4UTTC 1DQUA 3TCEA 1YPFA 3QC3A 1W8GA 3MHUA 1EZWA 2FKPA 2HRWA 2YDQA 4CGTA 1XDLA 4HIBA 3NL3A 2PWFA 3IK2A 1M5WA 4GHRA 1MW2A 3THCA 1JDEA 3PJWA 1C8VA 5E9AA 1X1ZA 3C52A 6TAAA 3GYEA 4JN6A 3A64A 2A3EA 3C86A 4JY8A 3FAWA 4QGCA 4O0KA 3WYZA 3ZLHA 4PTMA 1HJSA 4CD6A 1BFNA 2VC7A 4BQ4A 2P10A 4XAFA 3TR2A 4AIUA 2Y63A 1LRNA 1Z32X 5G5IA 2A3LA 1SFSA 3TCSA 4W8LA 4LBUA 4FNSA 2PDLA 3GNXA 3A23A 2CHRA 2J47A 1V0MA 3ARYA 5CPNA 1PZ0A 3A4AA 2Y7EA 4HN4A 3AROA 1RA5A 3SCQA 3TYBA 4N2YA 1PX4A 3SR7A 1UYQA 2FB3A 2OO6A 1S2VA 3HPFA 4IICA 1CBGA 3SUVA 3RR4A 3FW6A 3O63A 1E4NA 1JD7A 3ABRA 3GY1A 4GQ0A 4NIRA 4KIEA 4PMVA 3PAJA 2IQDA 2VDHA 4ZTYA 3CZKA 1I2PA 1F74A 5CZ0A 3VE7A 4JTLA 2J7CA 1BSLA 1IEWA 3SJ3A 3TSMA 3GVQA 5IHSA 4Q22A 1QDSA 3PK7A 3MKKA 4L56A 2QCFA 1SVDA 3N12A 4IUOA 2GVGA 3PPGA 2QGYA 3CZ8A 3GU1A 1PS9A 2E1WA 5I03A 1IF2A 4YVVA 3M0ZA 4A22A 5CC5A 3EYPA 4FOJA 4B5UA 4Z1CA 2AQVA 4ZENA 4FF5A 1OG6A 2WMHA 3SCTA 1OABA 1E4IA 5AN7A 4HSNA 2ZRWA 1E3XA 3FFSA 4A8RA 2NQ5A 4WR3A 2X09A 1MWOA 3FJ6A 4XUGA 1NFGA 1H1YA 3FKRA 1DBTA 3QMTA 3C0QA 2H3DA 3R11A 3M7WA 3EZ4A 3T05A 3SRHA 3BJTA 1HL9A 5EU9A 2EKCA 3SADA 1FCUA 3RK8A 1E0UA 2FLIA 2HDJA 3UA3A 3C3NA 2ISFA 3VCNA 1A53A 4DUWA 1BXCA 1UBPC 1OZQA 1Q6EA 3VA8A 4I8YA 3VFLA 1E3ZA 3P0WA 5K3VA 2A7NA 4JTJA 3VO0A 4AW7A 1VHNA 1M65A 3FA4A 1U22A 3UY8A 1J5SA 3DDMA 3ZVHA 2E9LA 3UEQA 1J10A 2Z7KA 3T0BA 1EQPA 2NT1A 4KW2A 3EWUA 3CASA 4N4PA 3UQNA 3T0CA 5FJOA 3ABXA 1SW0A 4F4RA 2EEXA 4OT7A 4C6OA 2R1KA 1MQPA 3B3DA 1FDJA 3MUZ1 1FDYA 4UOQA 1ZY9A 3L2IA 3PC0A 3WLTA 3GVGA 1J2BA 2FZDA 3VGBA 3VIOA 1JPHA 1XH0A 3NO3A 4BJHA 3SRFA 2PTDA 3TP4A 2HS6A 1U5JA 3WF1A 3A3HA 4S3FA 2DQWA 3I10A 1CXIA 3WD1A 1I2QA 1DVJA 1Q4WA 3MANA 1TQXA 4HGXA 1ZTVA 4LRSA 1W3KA 4MLRA 5H1WA 4E2BA 2PDIA 3ARUA 4O0QA 1YPIA 4WJ8A 3VD9A 2WVVA 3DN5A 1KLYA 2QMJA 4DYEA 4MJ4A 2OLSA 4JYEA 3DZ1A 1REQA 3OU8A 3PUEA 1TPWA 3U5YA 4CNPA 4AEEA 2C0AA 3FEMA 3CO4A 3PBGA 3H7UA 1FWGC 1XGZA 2IXVA 2OVLA 4RE3A 3TKFA 3HF3A 1R9XA 2R82A 1KQYA 2O7SA 1V03A 3ICJA 3NQCA 9RUBA 2PRMA 2P0OA 3ZS4A 2X16A 3UW6A 2WNNA 3GZAA 4C6CA 5FI8A 4Q33A 2ZUSA 3LGEA 1EGMA 1Q6DA 3FHAA 2EG7A 1UQYA 5CQ1A 3CAQA 3U2CA 4C6MA 4AD2A 1IZJA 3LB0A 3WK1A 4NZCA 2HVNA 1KO0A 4DO6A 1IZKA 2FHBA 3HM7A 4ES4A 2BXYA 3VZXA 2BXVA 1VFTA 2RKXA 1Q6RA 4LAOA 1JDCA 4JN8A 3AQUA 5E09A 2WQPA 1FFQA 4QCEA 2NUWA 3E0IA 4YTUA 1YNPA 4PMQA 4KKXA 1CGWA 1B4KA 4MSSA 4XD5A 2X1UA 4BF7A 3F5KA 8RUCA 3E2SA 2GVJA 4UFIA 4N0RA 3G18A 4JTFA 1J6PA 3K8LA 3VNIA 1EHAA 1O94A 1RV8A 1R7OA 1LL7A 4S3EA 4WX2A 4O1BA 3BG9A 1ODZA 1DTUA 2CLEA 2CLPA 1Z7AA 2W4XA 1RCQA 1VS1A 3TIMA 4E8CA 3PHAA 1DWAM 3RM9A 4JHMA 4JIIX 2Q01A 1AQ0A 3LG3A 4YL2A 3NSMA 1XWYA 2OZ8A 2XVGA 3DG6A 3SJNA 4NX5A 2NQZA 3HG5A 1ONEA 4AYGA 5LA2A 4RZ5A 4NYYA 2QCLA 3IJ8A 1VBRA 1R86A 1FP8A 4AU0A 4HYWA 5F4SA 1XIBA 3ZWSA 2J88A 3PZQA 1JI2A 2D20A 1Q5MA 3N29A 4LVGA 1RPKA 1E4MM 1JL8A 1FHVA 4XSLA 2QAFA 1PYFA 5I3FA 1WXYA 5A3HA 4PSPA 4DZHA 2BY1A 3MSDA 1TVNA 2XIMA 3QYQA 5I3JA 3CLWA 2VVNA 3NVDA 5LIYX 4O4WA 1S2AA 2NXIA 3W25A 3HGRA 2PDMA 2UY3A 3I3DA 2WZIA 2VP8A 3TC7A 3R6IA 4KCUA 3W1LA 5D9PA 5EMYA 3THDA 1V51A 3AHZA 4G7EA 5H2ZA 4LV9A 2Z1VA 3IACA 1V08A 2OX1A 3XIMA 1EDGA 4ZO7A 3LM7A 2ZUMA 2VKZG 4DLMA 3N2MA 3TTSA 4BFAA 4O1EA 4YTRA 3EPMA 1OG0A 3UWYA 1DQXA 4J3WA 2BV9A 4N6FA 3ZOAA 4GNKB 2GJNA 2GQ3A 1P5BA 1M9HA 2QF8A 5GNXA 3OZOA 1OINA 1V6VA 2V69A 1KFBA 2VEMA 1OJXA 4Y9MA 3ZLFA 1NFPA 2Z26A 1MRAA 3GX9A 4Y8FA 1NDWA 3NDYA 1IWPA 2YA2A 3VILA 2BS9A 3TR9A 4HNLA 4GQBA 2Q3OA 1R87A 1XCWA 5BWFA 3CB8A 1EWEA 3D3AA 1TV3A 1JUBA 3TE9A 4HT3A 2P50A 4GPNA 3QY8A 3KRZA 3IUHA 1Q3NA 4W8BA 3UR2A 5G1TA 2Y7GA 1LQAA 2FFIA 1FWSA 2DU2A 4TTUA 4CCCA 2ZYFA 3S3GA 1ZBVA 2Z4GA 4IIFA 3QHNA 3MPGA 4WJEA 5FIPA 2GSEA 2PWEA 4RJEA 1A5AA 4EVZA 1YDVA 4Z1BA 4MPKA 1T5AA 4HHPA 4BI5A 1EDQA 2E6YA 2WKGA 2INFA 3R0KA 4Q4MA 3GXNA 3S6DA 3TJXA 3QLDA 3GVWA 5AC7A 1S5NA 1X7IA 1KBJA 1EP1A 2C14A 2B31A 4FR6A 1R8LA 3JS3A 3IUIA 3H7VA 4FXSA 3IEBA 1K7EA 2J9YA 1EC8A 1TMHA 1AL8A 4ZA0A 1H1NA 4X63A 1EO7A 4LVDA 2OELA 1Z9AA 2Z2AA 3LPOA 4OUIA 3BV4A 3CQJA 1VENA 1O95A 4WXZA 1RBLA 2CZEA 4CQDA 4QISA 1XYMA 2IKGA 3PBYA 4PYSA 2HCVA 3FXYA 1ZAHA 3HN3A 4QDPA 3H70A 5D2XA 2OYMA 3L68A 1EQCA 3B4YA 4UCFA 1D3GA 1PDZA 1XRTA 2QCNA 3VC5A 2ACUA 4BF9A 4YPJA 3BANA 4HPJA 1UMYA 4MFEA 3VIHA 5E9XA 1KRAC 1XUZA 1WZLA 2VDIA 3ZVHB 3KP0A 2OSXA 1F3EA 3POHA 1YXCA 2PGWA 3PS7A 4JHZA 5JH1A 2C1HA 2W66A 1P0EA 4TVDA 3EEZA 2WK2A 4LANA 1PZ1A 2CLOA 1VBGA 3K8MA 3IJIA 1XLDA 2HE8A 3GRIA 5C5YA 3ARQA 3VNJA 2OZ0A 4YXGA 1W3LA 1PE1A 2E40A 4J4KA 5ABEA 4S2BA 3NWRA 3DYPA 5U7SA 3V36A 4NRSA 2ZRUA 3UR8A 3NQEA 3DFOA 2NZLA 4HPHA 3W22A 1V3LA 3DKLA 3G0XA 3GU2A 1HFBA 2Y70A 4H9YA 4K7VA 3USZA 4CN6A 3KBNA 4XD3A 4A2RA 3F7JA 4QJ5B 2HISA 3A9IA 2IQTA 3BCJA 3NPVA 1VBUA 1D3HA 1XD0A 2WJDA 1MZRA 3W1QA 2Y7DA 3VIMA 2WVVB 5HBFA 3NVTA 4C6LA 3KBJA 3OP2A 1REQB 4Y9NA 1JPMA 2TPSA 4UBPC 1US2A 3IS4A 1H7XA 4DLFA 3VD3A 1VFOA 2QW5A 4CNOA 3LHZA 1WCGA 1A0EA 4P7QA 1PIFA 3EOUA 1YLVA 4UZUA 1HKMA 3A4JA 2DZWA 5TD4A 3MW7A 4MDOA 3W53A 2OB3A 1J2WA 4Q4QA 2E5BA 2OLAA 3WEZA 4L6DA 4WQ6A 1NQ6A 4C6FA 4DF2A 1LM1A 2BVWA 4XZBA 2YDSA 1X97A 1XLKA 3VNMA 5E1QA 4F9DA 2WMGA 2X1SA 1SFLA 5DRCA 1GONA 4IM4A 4UTJA 3KFTA 5LIXX 3MP5A 3IIXA 3VIFA 1HL2A 3GH5A 4RX0A 1ZBCA 3NZQA 1K6WA 3URAA 1JAEA 4Z2HA 4Y9PA 1E6XM 4IMGA 4Q8QA 3GR4A 1J6OA 3IRSA 3WEMA 2I5IA 3H8AA 2Y4SA 1SW7A 1HGWA 4Q8WA 3DXIA 4CU7A 3CEPA 1GUVA 1B1YA 1KFCA 1E6RA 3W2KA 1LLOA 4DZAA 3G0UA 1WPCA 2DZXA 2FH6A 4LUSA 1HJUA 1U1HA 1QRQA 4ONVA 3L5LA 1LG1A 3CYVA 4ZBCA 4A05A 1WZAA 2C15A 3SGZA 3OLGA 4K38A 3N2TA 4ATLA 1ZBKA 1EH9A 3GNNA 1RR2A 1OFDA 3PVFA 1P0BA 3QV7A 1P1MA 3H2AA 1P6BA 3CL8A 3ZJ8A 1K9EA 5DXYA 5CZJA 3B9AA 1H51A 1WDQA 5A8MA 3NG3A 3VKDA 1UD4A 1TPDA 3GW0A 1CXFA 2GGEA 3S5SA 1XRVA 4GH1A 2VQUA 1KCZA 4FP1A 4INFA 3DG3A 4CNTA 1SMDA 4YYCA 3V18A 2DFAA 1WNOA 4MAVA 3BSHA 4ROQA 4H9ZA 1QASA 1DHPA 1TJ0A 4RNIA 3URBA 2ISWA 3TAOA 3EKZA 4Y9AA 5C6MA 4TVCA 1A3WA 3T0AA 4F3HA 2BVYA 1W8SA 5IDZA 5HR7A 1CGYA 3GXTA 1EKOA 3L23A 4A3RA 4LBRA 4JTIA 4J2MA 4PUJA 3ALFA 2DW7A 1Z48A 4G7EB 3ARTA 5CPMA 5FL0A 2JF7A 4QS5A 5KZ6A 2YL8A 2XFRA 4L6HA 2XVPA 3UZJA 1DQWA 3EPNA 2ZA3A 1DWHM 3OB8A 1UR4A 4YTTA 4ZTXA 3DCPA 3O6AA 2PWDA 4CCZA 3MUY1 1O5RA 1PXGA 3V16A 3J7HA 1KM5A 3OZYA 1C3FA 4QS6A 2CW6A 4FX6M 1US0A 3FK4A 2FGZA 3V7PA 3TN6A 2D0GA 4D6CA 1OEPA 4UB9A 3L9CA 2V5JA 3BTNA 3WH5A 4IXHA 1WXZA 1QO5A 3AUOA 3BK0A 2XIJA 1PDYA 1I60A 2DEPA 1JG9A 5DCDA 4ML4A 1ZCCA 3OGSA 1G1YA 1RUSA 1K8ZA 1PV8A 1UC5A 3LV6A 1E9IA 3K8KA 2W91A 3W86A 1W17A 2J24A 1KWGA 4J2PA 3EEGA 4LAMA 1MUCA 1PSCA 3GDMA 3BLEA 2B7QA 4MJMA 1XHGA 1MNSA 1XJBA 4AMAA 4GYKA 3S8HA 1K9TA 3SY1A 1OX6A 1Z89A 4RW3A 4MKVA 4ZOCA 1XI3A 1D2KA 3A21A 1Q6CA 1SFJA 5E0KA 4U4MA 3M5YA 4KGLA 3QZAA 3MV01 2CIPA 5DY3A 3TWBA 4LF2A 4HJFA 4KWOA 4AUBA 1JEZA 4QE5A 3G1YA 2VR2A 4GX8A 1TWZA 3M6DA 3QW3A 3P7YA 4M6PA 2W92A 3CXOA 1QI5A 2EPKX 3L4UA 3REQA 4FLOA 4ZQNA 3T0TA 1QBBA 2C7FA 2WJFA 3LBCA 4O11A 3BAYA 4PB3A 4NJIA 1F9CA 1K03A 3KOWA 2OEMA 3MYPA 4MWAD 3MV11 3GHSA 4K68A 1XBYA 1RSCA 1CWYA 2O9RA 3CNYA 3BGJA 3ZZ1A 6CGTA 1KR0A 3IIOA 2OO0A 4Z1YA 2JF6A 1BVZA 1RVKA 5GJPA 3M0XA 4W85A 1R3WA 2RAGA 4O54A 3TWAA 1GVFA 3M0LA 2PTYA 2UY5A 4LB4A 4ZQPA 5I3DA 5HDRA 3SB0A 5JBFA 4Q4OA 4JYFA 1PX3A 3B0YA 1IE7C 1NP2A 3ZVIA 4RZ6A 4KEZA 4J3XA 3MWCA 1UB3A 3OODA 3DFSA 2FMNA 3S2LA 1C8YA 3SN4A 1QNRA 3P0XA 3MBFA 2YL9A 3KZSA 4O14A 1W3NA 2GGGA 4UZSA 4LY8A 3WMBA 2Y6ZA 1R9ZA 3E0WA 3WLNA 1Y7VA 1NQKA 4P5UA 4JPGA 3WBYA 3GC5A 1NARA 3RX4A 3TW6A 3UY7A 3EPOA 1IGSA 2C8NA 1E0XA 4GIYA 2KAUC 4AMCA 1WA3A 4IQEA 1HT6A 2FPYA 1HF6A 1SM9A 4DWSC 5AB3A 4IFOA 3CTTA 5FSEC 2FMOA 3UZZA 4C7DA 3ZSSA 1NH6A 4XK2A 4GLEA 2DP3A 1B3YA 3L4ZA 1JZ2A 1F4AA 1QOPA 2V8ZA 5A6SA 5F2LA 3W29A 3U57A 2V63A 2VZTA 3OBKA 1GYNA 4H8HA 3BLFA 1CPUA 4G1KA 4KWSA 3ITYA 3AS1A 3GBEA 4PUEA 2PMQA 2WM0A 1JCLA 3KRSA 1QW9A 2GDQA 4JTEA 4KWVA 2TMDA 5LHEA 5BXTA 1Q45A 3MUXA 2DIEA 3MCNA 3PNUA 3G2GA 3PZ9A 3V0TA 1RQEA 4ORMA 4MUZA 4CD7A 4HOZA 2PTWA 2NQLA 4NZ3A 1NTHA 3ZSTA 1TQJA 4I5UA 4XVEA 1ZP3A 5M17A 4W5ZA 5FAGA 4DJDD 1XXXA 3W2UA 2EQDA 3OQ8A 1Q66A 3APYA 4QE1A 3H4WA 4AY1A 1Y5WA 4PMOA 3CHFA 3AHXA 4HNOA 3CQHA 4BS0A 3FYPA 1DIOA 1E73M 2Y2WA 1HJXA 5C9RA 2A3HA 1QI2A 3H54A 1BVNP 5M3WA 2YDAA 6XIAA 3M5ZA 3MT1A 4LUSB 3TYUA 1LZOA 4U33A 3BE7A 2J62A 2EJAA 4HQVA 4B3LA 4H41A 3SRDA 1KXVA 1PCKA 1A50A 1JPDX 3PAOA 1J11A 1GKRA 1TE6A 5D2VA 4IIDA 3OBEA 3PF3A 3R89A 1J0ZA 1YBQA 3DGRA 3IIZA 2CKRA 3QKZA 3VGDA 1XBZA 3CV2A 2XG9A 1DE5A 3LHWA 5EBUA 1J01A 4M0XA 1JFHA 2ZUTA 4B92A 2VTFA 3H55A 4JDYA 1VJIA 4P61A 3B9DA 3STCA 1IXOA 3BW3A 3APGA 4HJWA 4PULA 4AC1X 3TA6A 4PEEA 4OIFA 3BSMA 5D9OA 2QJNA 1XYBA 3GUWA 3RLUA 2C13A 1KGWA 3HTWA 4MTVA 4OECA 1OHLA 3TK7A 3LEPA 3QR3A 1JRBA 4JOMA 2HTMA 2PDJA 2J78A 9XIMA 1RHCA 2ANUA 4RE2A 3VNKA 3CJPA 4JYDA 4AX7A 2VX7A 3EB2A 1AQHA 3C4UA 1NWRA 2QUUA 3DGBA 4EOUA 4GY1A 1UD2A 3NDOA 1VKFA 1R9YA 4Q6JA 3NA8A 3C5QA 4CCDA 1UKPA 3ZMRA 2A3BA 3VU2A 3I3EA 4Z2IA 4LS2A 1AQMA 4HHHA 4MWAA 3WQDA 3W1RA 3LCXA 4OZOA 4UMCA 5K4ZA 1EA0A 3OVRA 2Z28A 4Y2WA 4OWGA 1BLIA 5F7UA 1P43A 2GVEA 5EPDA 4HU3A 4J3ZA 3VNLA 5CLTA 3AHYA 3ME3A 5HPCA 1XH2A 3EKLA 3U4FA 3QTPA 3PJUA 4HPNA 1TV8A 2DZSA 3W28A 1AW2A 3IGSA 3BARA 4HNUA 1N55A 2ZQ0A 1KR1A 4U28A 2OR2A 4HB7A 4UOJA 1ICPA 4AZ5A 3S46A 1GQNA 4EF8A 2QJHA 3MBDA 3GFXA 2PWHA 3VDHA 1JF6A 4I9TA 4ZB2A 3AJ7A 3BURA 3VOHA 4J3UA 3CH9A 3W1NA 3I7QA 4JIQA 2D0FA 1JQVA 4N4QA 2YCEA 3NQ6A 1FHUA 4KPLA 3AIRA 4G56A 4YVPA 1E51A 1NJJA 1PHWA 4S3KA 1K8CA 2J9ZA 1TSIA 2YW3A 2ZZ5A 2VEKA 2ZIDA 1SJCA 1W37A 2PGFA 3T44A 1T96A 3BG3A 1W56A 5HUPA 1DJNA 3EWYA 2NUYA 5I00A 2BVTA 3CQ0A 4GJ1A 3JW7A 1OGGA 1XDMA 4IPLA 2VX5A 1HKIA 3M9YA 2YCKX 3HG3A 4HA0A 1XIHA 4UTHA 3QQ1A 1UKTA 1GQIA 3A12A 2WANA 3WUEA 2FJUB 3STEA 4DO5A 3TC3A 3XINA 1JNEA 5HATA 1W3JA 1MVYA 3MY9A 1L6SA 2X42A 2ZUUA 5D09A 2W61A 3JZUA 3TOPA 3UXAA 2DVTA 2ZXAA 3REQB 2Q02A 1G6CA 2FHCA 1S2TA 3AWNA 6ALDA 2C71A 4K37A 1FWNA 4GXPA 2XM1A 7CGTA 2PB1A 4TO8A 5HAOA 2OSYA 3O8AA 2DH3A 3TSDA 4NP7A 1Y65A 3C2FA 3WQVA 1VEPA 5HWJA 3MCOA 3AHTA 4FPSA 1CGTA 3KVKA 1Q4NX 3W1UA 4YHEA 2OKOA 3VMNA 4BWLA 3HQPA 4PMUA 1R7AA 4DJDA 1UCWA 2EXOA 4HMDA 4FNRA 3ECQA 1ZJHA 1OK4A 4A2SA 4H6KA 3KBWA 5CPSA 4PA8A 3FAXA 4OTKA 5E93A 2QPSA 4L4LA 1EXPA 2Y62A 2XIOA 1ONXA 2VJXA 2ZICA 4R7OA 2XH0A 3GHTA 3W7DA 2ZDSA 3UWWA 1EBHA 3LI1A 3A5VA 1F05A 4K39A 1CB7B 4CU8A 1XINA 3WD4A 5CGTA 4IMAA 5EBAA 2XVLA 2WBKA 3UJFA 1WE5A 5G2HA 3CM4A 4PMJA 2ZTKA 1MNZA 3P5YA 4I7UA 2QDDA 5FF3A 2FFCA 1VF8A 4GVGA 4HNCA 4XIAA 3W76A 4WIWA 2DIKA 1QK0A 1Q6OA 3SIZA 1K8XA 5FJTA 3UYIA 2QKFA 4NNBA 3RYSA 1GZ1A 1BVWA 1HKVA 4ADUA 5KZMA 3BLLA 2BOGX 5CCZA 2NX3A 3PZVA 3AAMA 1S5VA 3NQBA 3UD6A 2C0HA 4LYQA 5JU6A 2QPXA 2ZZ7A 2G37A 3WUGA 4F2UA 4LJ3A 4EF9A 4AZHA 3WLHA 2WYSA 3L12A 1TCMA 1QMLA 3LCIA 4XZNX 3AYVA 4ZODA 1X1OA 5K9CA 1JQXA 2Z00A 2H8XA 1R5YA 1KC7A 3AFBA 4XSMA 5D4YA 1E56A 4M82A 5BNKA 3CZEA 5CPTA 3N73A 8A3HA 1V3MA 2WW5A 2V5LA 3R8HA 1OC7A 4S3JA 5L9FA 5LIUX 3ORWA 2BTMA 4GNJA 4XKYA 2JKEA 1F3WA 5A2BA 5FF4A 2A79A 3VDBA 2GVLA 2BODX 2BFGA 1XYLA 1XSJA 3CZGA 3EX3A 4CQAA 1RQHA 3GH7A 5AYXA 4ZQCA 3KLLA 4ZOEA 1JUEA 3S5NA 3UESA 4IGMA 1A3XA 1XLEA 2TODA 3FA5A 1XIFA 1V8EA 1AA1B 3B0XA 3W1XA 3WENA 4WKFA 2DJLA 1GVSA 1H7RA 4GYJA 4YWIA 1O4UA 2YIHA 4PTNA 4B3ZA 2YCLA 2R9RA 4WJXA 2VX4A 2CCRA 1YBQB 1ISVA 4PBFA 1QATA 3T1GA 4WKHA 1QNSA 1IIGA 2XN0A 3W7QA 3T7VA 3LZ3A 5J5RA 3WLJA 3WNPA 2E6FA 1LROA 3LXAA 3GFZA 4HMEA 3SCUA 1PAMA 5EMJA 2ZZ3A 1KM2A 2ACSA 1C29A 2JGYA 1OFOA 1R47A 2J7BA 1LYXA 3GS6A 3CAKA 3UXDA 8XIAA 3W02A 2CLKA 4C6IA 3G1AA 1POKA 1UWSA 2R1PA 4WGHA 1Q8AA 1RA0A 2H9AA 3VC6A 1MDLA 3NCOA 3QHOA 4Q8VA 4FNUA 4AWTA 4O15A 1WBHA 1T6MA 3WDQA 2GOKA 4WSJA 4GXMA 2E68A 2GJRA 1UUMA 2WB5A 3W6LA 4GZIA 1VJZA 2X0SA 3FJ4A 3O0KA 2WJEA 3ITXA 4GVIA 3VKAA 3WQOA 1XQKA 1HVXA 2VWTA 4MPQA 3F2BA 3L4WA 3G1SA 4NXKA 5AC4A 1JXJA 2J66A 4MWAB 3ZFHA 2HK0A 2DZTA 5D2TA 1M04A 3LM3A 3TMQA 3H2NA 2XVNA 4PMRA 2A7PA 2Z1XA 1OX4A 2Z2UA 4KCTA 3G77A 4LNYA 2QYGA 3NNTA 3CL7A 5C9ZA 1SFTA 2YDRA 4W8AA 4JNYA 4EPKA 2WSPA 3LNPA 3TX9A 3U2OA 4AVFA 5ABGA 1MW3A 3TTOA 3TN3A 5J5DA 3GR8A 1FQ0A 3JVAA 2IPFA 2Y1HA 2FVLA 2VURA 7REQA 4NJGA 4JTDA 2Y8KA 1UKOA 2OOFA 3AWOA 5CLWA 5D03A 2ZC1A 3T8LA 4O8AA 3CMGA 1WDSA 4Z17A 1ITQA 3U4AA 4Z1DA 2Y5EA 1FH7A