2XGBA

Crystal structure of barley beta-amylase complexed with 2,3- epoxypropyl-alpha-d-glucopyranoside
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
486
structure length
486
Chain Sequence
NVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
total genus 192
structure length 486
sequence length 486
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xgbA00
5DMYA 1U30A 2BY3A 3OIHA 4UTFA 1G0CA 1V08A 3PZTA 1GJWA 1JL8A 2QLYA 5D9OA 1UR8A 3QOKA 1HJUA 3ZJKA 4Z2IA 3ARRA 1V3HA 1ISYA 4D6CA 1W2PA 1DWAM 1CXFA 4M82A 3WF1A 1BG4A 1CECA 1UWTA 3MUZ1 1KXTA 1SFSA 3BMVA 4J3VA 4HMCA 3W24A 3FN9A 2D23A 3ZSTA 1HKJA 1KCLA 3WH9A 4D1JA 4AC1X 4E2OA 3E1F1 3IK2A 3WL1A 1Q6CA 4JCLA 3F5LA 3A3HA 1QVBA 2PF0A 1GOMA 2VI0A 1TCMA 4IUGA 2BNJA 3TOPA 2CETA 2YLLA 1KQZA 1OWQA 1E5NA 1E73M 8CGTA 5HPCA 1KXHA 2WHMA 2X05A 4UQ9A 1G94A 2XWDA 1C90A 1WP6A 3LMYA 1GORA 1DWGM 4TVDA 1B2YA 3WFLA 1UD8A 3G6LA 2X1IA 3N15A 4NI3A 2VMFA 3MS8A 3AMDA 4J3WA 1PZ2A 4WF7A 3WUGA 2OLHA 2VQTA 1XYFA 2VCBA 1C7SA 2UY2A 1QNQA 1WDSA 4AD4A 4LXFA 3AXHA 1HJSA 1JYWA 1HXJA 3QOMA 1KFWA 2CITA 4CN1A 3RIKA 2ZUUA 5M03A 4H2CA 3KL0A 3WUEA 3ARZA 4U31A 4JCMA 1E6ZA 1Z32X 3MMDA 3DC0A 2ZX8A 2ZXBA 1Q6EA 3WFZA 3CLWA 4V27A 2EEXA 3TTYA 2WZEA 2WMIA 2ZUVA 5E6ZA 1JZ5A 1MQPA 1CGUA 1LG1A 1EO7A 2J8FA 2D0HA 4HA3A 5EFDA 2F8QA 1MQQA 4AD2A 3T2PA 5JBFA 1E6SM 2Y24A 3PZQA 3SCWA 4BS0A 3WIJA 3WUBA 3CUIA 4U3AA 2VR4A 3CMGA 4EAMA 3FHQA 1HP4A 1BPLB 1B3WA 3AHXA 1AVAA 1JI2A 2XHYA 4DWSA 3GDBA 2ZWYA 4UQEA 2WMIB 4MNLA 4AEEA 4CD6A 4PYSA 3GH4A 5DEZA 1RD6A 1BG9A 1NH6A 5EB8A 1E56A 1W9DM 2J74A 3WDJA 1C91A 3VDBA 2WBKA 3UEQA 4P7LA 2XTKA 4IPNB 4EKJA 1WZAA 2FDMA 1KCKA 1H1NA 4PUDA 1QI5A 4UZUA 3VD4A 1KR0A 4XX6A 2VQUA 5A94A 2AOSA 1ISVA 3MUAA 2A3EA 4DWSB 4N42A 1OGGA 2CHNA 4TVCA 2ZX7A 2O9TA 4CD7A 5D9PA 2ZX6A 1JYVA 2WK2A 1ISWA 2Y2WA 1G1YA 3GZAA 4P7OA 3WNLA 1V03A 1H49A 3CHFA 1IV8A 4JKLA 2BY2A 2OSYA 4MJ2A 1BLIA 4ACZA 4PMRA 2C7FA 5E6YA 4ZE5A 3RCNA 1E0XA 4Z2GA 3WDRA 2DT1A 2VX4A 4PTMA 2QMKA 3B9DA 2Z1KA 2WLZA 3IAPA 2VX7A 4QLLA 3SUTA 3AFBA 3CGTA 1M7XA 4KRUA 3KEHA 3VINA 3VNZA 5I24A 4MJ4A 1UQZA 3CZLA 4PBGA 3AZTA 4UZSA 1J0IA 4PCTA 2FGZA 4JL2A 4ACZB 3RDKA 4OBSA 2WCSA 5CSUA 1VENA 3ARUA 4B9YA 1B3XA 3ZM8A 1EDQA 1JD9A 1JGIA 3MKKA 4LQ1A 2BXZA 1RH9A 3WH7A 1K9DA 1D3CA 4CGTA 1EDTA 1R7OA 4J3XA 4W85A 3N04A 3VO0A 1EHAA 4WSJA 4TX6A 1FA2A 4UQDA 4W86A 2J79A 1XSKA 4WSKA 1TE1A 2OWXA 1TA3A 3WF4A 2A3HA 3UG5A 1UR0A 1BYCA 5A8OA 4L4OA 1FHDA 4OZOA 1QNPA 1UD3A 6CGTA 2E4TA 4N0RA 1JNDA 2CCRA 3T2OA 1V0KA 1D2KA 3N12A 1V6WA 4AD3A 5CPQA 4LYRA 4W89A 4DUVA 3WEMA 4RL3A 3U57A 4D71A 4H8UA 3SCOA 1UWSA 1UWUA 4U33A 4AZ6A 2XVGA 3CUFA 3I3EA 2WZIA 1L0PA 3B9EA 5IHRA 5ABGA 1A47A 1E55A 1TA3B 3PHAA 2GVYA 3THCA 1BGAA 4YHEA 5D9MA 1R8LA 1JFXA 1OD0A 1W1YA 3CMJA 4AEFA 2WVUA 1EIBA 3G6MA 4BZYA 1JYXA 1UR2A 3WEZA 1KGUA 3CHEA 4GQQA 3AMCA 4CKQA 4GQRA 2YL8A 1F4HA 2D0FA 3A4AA 4IM4A 3VD5A 1CDGA 2CBIA 3DYMA 2W66A 1V02A 2PWDA 2VOTA 3OA5A 4FF5A 1GOWA 4AZHA 1HP5A 5I77A 1BFNA 1KBKA 1TMQA 3IANA 5I5RA 3W28A 1D7FA 4OBRA 5FOOA 5KEZA 4AZ5A 4D72A 2YIHA 1V6UA 5CLWA 3RPMA 2J7FA 1HKKA 2OYLA 2RGMA 1UR1A 4XB3A 1W9PA 4AD0A 1PIGA 1GVIA 3U7BA 1GPFA 2XFYA 3MV11 1GHRA 1E40A 4B16A 3WNMA 1E0VA 3BH4A 1Q4NX 4GO9A 1B0IA 4D6GA 1N82A 4DUXA 1CBGA 4OUEA 2O9OA 2G41A 4DM2A 4TOQA 1CXHA 2AMGA 2MANA 3LPOA 2ZX5A 4XZBA 2X0HA 2WWCA 2OSXA 1ECEA 1W1VA 3FAXA 2W61A 2WSKA 3FNDA 1E3XA 1UYQA 3A47A 4UFHA 2VRKA 1HJQA 1UKPA 2WYSA 2C8NA 1NQ6A 1G9HA 3KWXA 1A3HA 4ATWA 3L4WA 4F9DA 1CTNA 1CGYA 3MUY1 4E8DA 2O9RA 1R87A 1BGGA 3UETA 3VM5A 2W63A 5FKYA 1QI3A 5I23A 3N9KA 5A69A 1LWHA 5LA2A 2HISA 3BLPX 1JYNA 1SMAA 2RGLA 2X8RA 4URIA 3ZT7A 5ABHA 2DQXA 1UHVA 3W38A 1VJSA 2YBTA 2CBJA 2VZUA 1B3YA 4S3KA 1EQCA 6A3HA 4Q22A 1KGXA 1PEZA 3MANA 1C8YA 1M04A 1UD5A 5I79A 4PMYA 2JIWA 5A8MA 2CERA 1TUXA 3W81A 1QBBA 1VFFA 1H2JA 1C7TA 2FHFA 3T0BA 1G5AA 4W7VA 3MMUA 4QLKA 1J12A 3THDA 1I1WA 1HX0A 4GIAA 4LYQA 2BVYA 4KGLA 2BY0A 2YKKA 2W92A 1R7AA 4BQ3A 1QPKA 1FFQA 1MFVA 4M29A 2O9PA 3HMCA 1GOQA 1OIFA 4W5ZA 1ESWA 1GZJA 3D3AA 2ZIDA 5A8NA 2BY1A 1PX4A 3IJ9A 5E0FA 1CXIA 2Y5EA 4PMDA 3VOCA 2F2HA 3EDJA 3N13A 3WMBA 5M17A 1ZBWA 1UR4A 3NUKA 4AZIA 3VD7A 2YDSA 4GI6A 2WC4A 2PWEA 2E9LA 4J3SA 2D0GA 5HOSA 3RM4A 4HMDA 3WBEA 3EMCA 1E4MM 3BXWA 4Z2KA 3ZO9A 4H8VA 1C8XA 1UD6A 3AS3A 2VZSA 2YJQA 3AYSA 3QR3A 1YQ2A 3W0KA 1WDQA 5A6AA 4QCEA 2IXUA 3VIOA 5I6SA 5LA0A 3ZT6A 2CBVA 1FH7A 1B3VA 2OSWA 4ATDA 2J7CA 2VNCA 5AC4A 1LJYA 1TFVA 3BSHA 3CH9A 4M80A 3T0DA 3WKZA 2J78A 3AYRA 4FLOA 2ZX9A 3PBGA 3NDYA 1OGBA 5GNXA 1KBBA 5IXEA 2J7GA 1PZ3A 3GXIA 5M5DA 3QHOA 1VEOA 4PUEA 5HDRA 4PMVA 3NJ3A 4TVUA 2W67A 3EDEA 4AY1A 3SUVA 1OD8A 2WBGA 1V3KA 2XM2A 3W6LA 4UOJA 1J0YA 1EA9C 1JZ2A 1UKTA 1B31A 1ISZA 1C93A 2WSPA 3EDDA 2X0YA 5IHSA 2ZE0A 3VGDA 2JEQA 2DSWA 4W7UA 2XSBA 4GZEA 4BQ5A 5BWFA 3PTQA 4ZE4A 2V3EA 3NYDA 1MW3A 1CGTA 2EPNA 3J7HA 3ZJ7A 3SUSA 1CGXA 1YHTA 3HU7A 1HKMA 2G8ZA 4W93A 4H7VA 1KWKA 1LLOA 4D6DA 1I1XA 2YL9A 4NSBA 4KMQA 3SCSA 3VIHA 3VIIA 3W4RA 1UQYA 1IT0A 1CLVA 1HJXA 1XD1A 2WVSA 3DHPA 5CGTA 4GXPA 1E15A 4OJYA 1CEOA 2XSAA 1VFUA 2F61A 2WVTA 2WMFA 1RPKA 1UWIA 4JHOA 4ACYA 1E6RA 3KL5A 1WZLA 4OKDA 3LPPA 2DIJA 3RM9A 4P8UA 2VX5A 1VBRA 3EBVA 4C7FA 2PB1A 2A3AA 2EPLX 2DSZA 4W8BA 4Z2LA 2BVDA 1MQRA 3T08A 4AWEA 3VDAA 2V5DA 3VGGA 4H04A 3ZJ8A 4RE3A 4M81A 3WQVA 4WJXA 3CZEA 1Q6GA 2D24A 4LGXA 1HF6A 3F5KA 4TTGA 3AHZA 1XH0A 2GDVA 2ZICA 3BSGA 2WW5A 5BXPA 3APGA 1AQHA 2WZHA 3SCUA 1O6IA 3UR8A 3BAIA 3PZVA 3N1AA 3NSXA 1Q6DA 2WKLA 2WANA 1CENA 1KB3A 3SURA 2IXVA 4EANA 3OGRA 3TONA 2OWWA 1BF2A 3AS2A 5A1AA 5I78A 5A6MA 2WKGA 1G01A 2AAAA 1E1FA 4HU0A 4CD8A 1UG6A 2PC8A 2A3BA 1PJ9A 3AI0A 4JFSA 2W91A 3ZQ9A 4YPJA 2OWCA 4P8WA 2DH3A 3AS0A 2VCAA 4ML4A 1HVQA 4CUCA 3HN3A 4MPKA 4UQBA 3ARWA 1E43A 1E1EA 5DO8A 5IFPA 1JF6A 4WKHA 4LX4A 2D20A 3GBEA 3W27A 4PMOA 1H11A 1CGWA 1DTUA 2WVVA 4PMZA 2ZUNA 9CGTA 2YA2A 5LYRA 4XUYA 4V28A 3WNOA 4ZENA 5E70A 3RM8A 1E0WA 2CHOA 3VPLA 3KE0A 3BLKA 5BYWA 1J0JA 1ISXA 3UCQA 1NOFA 3T0AA 2FH8A 3PTKA 4KH2A 2XFFA 2WPGA 5CXPA 1JZ3A 3WBAA 3ARVA 3VD3A 5E09A 1V0LA 3MV01 3W26A 4UQAA 5AYIA 2WMKA 1UD4A 3OGSA 5ABEA 5E9AA 2WVVB 2Y8VA 4WLCA 3WNNA 5A2BA 1BVNP 5D8ZA 4MTVA 4PTXA 4MB4A 3QHNA 1QHPA 4A3YA 1XSIA 1UUQA 4DUWA 2XM1A 1WZKA 4D6EA 1JXKA 1OM0A 3K8LA 1VEPA 5AY7A 2ZUTA 1X1NA 4UFMA 4ATLA 4GINA 3WD3A 4W8LA 2QHAA 2J7BA 1NWTA 1K6AA 1W9XA 3GNRA 3CZKA 3MMWA 1LG2A 2XYLA 1L8NA 3AS1A 1GQLA 3WUFA 1E6NA 1PPIA 5HBFA 3AXXA 3PZUA 2J7EA 4HP5A 1BHGA 4AZ7A 1QNOA 2E8YA 4W88A 3VD9A 5EMYA 4PMNA 3LPFA 3AISA 1CXLA 2CKSA 4HMEA 5GQBA 2WXDM 2GSJA 1OSEA 3VDHA 1V3MA 3SEPA 1XGZA 2XVKA 3AROA 1GOIA 4QAWA 5A3HA 1J0HA 1FHLA 3OLIA 3PZMA 1E6QM 3AIVA 4AXNA 2DDXA 1BSIA 1V6XA 1DHKA 4OOZA 4B3KA 2VUYA 3B9AA 3FHAA 3CPUA 4BQ4A 1JDDA 3AMKA 5DT5A 5D4YA 2YL5A 4PMQA 4AZCA 3WDHA 2EXOA 1EOMA 1UH3A 2VC9A 3VIJA 1UR9A 3RO8A 3AOFA 2E40A 3EDKA 3QGVA 2V38A 4V2XA 3CIVA 4PCSA 2QF8A 3OBAA 2PBOA 3UG4A 4MNMA 1K9TA 3CHDA 1XH2A 3BCFA 4R5EA 1B1YA 1H09A 2E9BA 4JKKA 3L4ZA 3SCVA 3ARXA 4R27A 4JFVA 2J25A 1BAGA 1C92A 1V3JA 2UY4A 2VRQA 1ZBKA 3N18A 5BROA 5D9NA 2V3FA 3RILA 1UH4A 4GZIA 4AZCB 1Y7VA 8A3HA 2E0PA 3SCTA 3OB8A 1HNYA 3WMCA 1XSJA 4AISA 1J18A 4BF7A 3OLDA 5C70A 1E70M 2ZUSA 3AIRA 4JIEA 4GO8A 4U2YA 1NP0A 3ZT5A 3VGFA 4W87A 3IJ7A 3M7SA 1US2A 1FP8A 3DYPA 3SIMA 5A95A 4EK7A 1DWIM 1TZ7A 3ZSSA 5CQ1A 3F4VA 4MAVA 2YLAA 3AMLA 5GNZA 2ZWZA 4XZWA 4LYPA 3AJ7A 3WD0A 5BXTA 2XJ7A 3PZ9A 2D3LA 1UWQA 3IJ8A 4FMVA 3CTTA 1GQJA 3ZJ6A 2X2YA 5A6KA 1UH2A 2JF6A 1DEDA 2NT1A 3L4YA 1HN1A 4UOQA 5D8WA 1V02E 2QV4A 3BMWA 4QFUA 1W2VA 2VL4A 4CVWA 1EGZA 3UR7A 1NWUA 5CZKA 1WPCA 2WAGA 1JAKA 1W3KA 2WB5A 1ITCA 2GK1A 2GFTA 1EDGA 3GH7A 5FD0A 5CGMA 4NZCA 3WY1A 1WKYA 1KGWA 2CKRA 1JZ7A 4MB3A 1CLXA 1ZBVA 3HJEA 1E72M 2CIPA 2C0HA 4JZ5A 2VZOA 1ITXA 4JKMA 4KGJA 4YN5A 2VZVA 1WNOA 3AHTA 3M6DA 1PAMA 3WMSA 2JIEA 1OIMA 3OLEA 3SUUA 2VX6A 3TA9A 3T2QA 2GK1B 3U5UA 3GH5A 2YA0A 4P8XA 3I3BA 5ABFA 3WF3A 1GOOA 1W1PA 3W6MA 5A2CA 1B3ZA 4UNIA 4AW7A 1EOKA 3AXIA 3ECQA 1UWRA 1VF8A 1WO2A 5CJ5A 4PN2A 1MW0A 2QMJA 1KR1A 4UFIA 1VFOA 3WELA 3K8MA 3POHA 3WNKA 3W82A 3W29A 1GJUA 2WCAA 4F9JA 5BXRA 5I2UA 1H0GA 3VX0A 2WC3A 1V3LA 1H41A 4HU8A 5ABFB 1CPUA 1QI4A 3LPGA 2D1ZA 2XPKA 1EQPA 1K9FA 3A4XA 2ZUWA 1FH8A 1V3IA 1R85A 3PZIA 4A3HA 4CD4A 1QHOA 1HL9A 1AMYA 1OT1A 2FH6A 3M07A 4ZFMA 4JHZA 4HA1A 1QHZA 1GUVA 4WKFA 1BVZA 1XYZA 2UY5A 4D6JA 1QNRA 4U2ZA 4PSPA 2CNCA 3U7VA 4GPNA 3MUIA 4U5IA 5A6BD 3CHCA 2V5CA 5BXSA 2WHKA 4MADA 3S2CA 2OYMA 3VX1A 2XGIA 4P7NA 3AIBA 3VGBA 1H3GA 5I0DA 3II1A 3WF2A 2ZXDA 1GVYA 3TTOA 2PI6A 2WMGA 2XIBA 4KRTA 3VMPA 3VIKA 1QW8A 3OLGA 1OBAA 1EO5A 2JF7A 1ODZA 2EJ1A 1S46A 4X9YA 2DT0A 3ALFA 1ZB5A 1WZMA 5DF0A 1JZ4A 3GXDA 1UA7A 2Q8XA 2GUYA 3CO4A 5ECUA 3VILA 2GJXA 4XV0A 4FLRA 1M03A 2EO7A 4DWSC 4TTUA 1DWFM 1HIZA 3CBWA 4EE9A 3VMNA 2EPMX 2WM0A 2BS9A 3AHVA 3L2LA 3BAYA 3L2MA 1GQIA 1NWRA 3NCOA 1JXJA 3T09A 4MNJA 4CCDA 2G3MA 4M8UA 4CU7A 3AIWA 4HOXA 1JIBA 3W37A 4F79A 3FY1A 4L4PA 2DT3A 1TG7A 1E6PA 1W3LA 2DH2A 2J47A 3L4VA 4W84A 4HOZA 3VTRA 3PZNA 4NRRA 4IPLA 4D6IA 3BAKA 2JFEX 2GJXB 4PMXA 4UFLA 3WNPA 7TAAA 4U5KA 1AQ0A 3WH5A 1V0MA 1JDCA 4OIFA 1HVXA 4CCCA 4CU6A 1DWJM 4WK9A 2XVLA 4QP0A 3BGAA 3BAWA 1GQKA 3OZPA 4UFJA 5CPTA 1WE5A 2DEPA 3BAXA 3WENA 4A4AA 3WQ8A 3L4XA 2V3DA 4Z2HA 2BVTA 1MVYA 3F5JA 1W3HA 2ZUMA 3K1DA 1W3JA 2PWGA 4J27A 4JFTA 3QHMA 4J28A 4P8VA 3VKKA 1O7AA 4E8CA 3GNPA 1M53A 3EMQA 3VDCA 1W1TA 1UKQA 3TTSA 1LQ0A 1NM9A 1QOXA 3ARYA 2UWFA 2X09A 1GNXA 1JI1A 3N11A 5F7UA 2YDQA 2XUCA 1JZ6A 1DP0A 3WQ6A 5JBDA 2NT0A 3MSGA 1TR1A 4M24A 3BC9A 1CIUA 3W25A 1NOUA 1ZJBA 4RE4A 1B9ZA 1LL7A 3WDIA 2XWEA 1MW1A 1IZJA 3WD2A 4MDOA 4CCEA 5HPOA 3RJYA 5TD4A 4UCFA 4CVUA 5FL1A 3ZIZA 2YOCA 1MYRA 3DECA 4QDMA 1J0ZA 3O6AA 2E9MA 1E4LA 5CG0A 4HPGA 3WD1A 1LWJA 2GJRA 1CYGA 3S6TA 1U33A 5KZ6A 2VVSA 2XGBA 2DGAA 2J75A 3ZR5A 5EFFA 3OG2A 2W4XA 1RP8A 2JEPA 4HOWA 3NIYA 3SCNA 4AZGA 3PZGA 3VGHA 5FIPA 1AQMA 2DIEA 3AHYA 1JZ8A 3NDZA 1PBGA 1UZ4A 5DFAA 3GTNA 3AQUA 1K9EA 1TVPA 4MB5A 3AIUA 2VZTA 2J4GA 3WQ4A 4P7RA 2ESCA 2PBGA 3NSMA 1GONA 3SCPA 5HXMA 2D22A 1BYDA 4ZEPA 4FK9A 2DSKA 3WF0A 1CWYA 3VU2A 3PZOA 1RP9A 3GYCA 2BHUA 2BHYA 1KXQA 2O92A 3VIFA 1EXPA 4DWSD 1E4NA 1SMDA 4HTYA 3GXFA 2EQDA 1MWOA 3OZOA 3WQ5A 1CGVA 5A2AA 1H0IA 4GKLA 4X0VA 1VBUA 1OINA 1XC6A 1PIFA 3AZSA 3CUHA 2CXGA 1XCWA 3K8KA 1LL6A 1B30A 2CYGA 5BRPA 1E6XM 2J7DA 2WNWA 3CUGA 1ZL1A 1LF1A 1B90A 3K46A 2WC7A 2W62A 2BV9A 1MW2A 4UOZA 3L4TA 3SCRA 4MNKA 1XCXA 3M46A 1FP9A 1EHNA 1SYTA 2IUZA 1US3A 4Q7NA 2DPEA 1WDRA 4PEEA 4P7QA 1BYBA 3MSDA 3MU7A 3ALGA 4WIWA 5EBAA 1LL4A 1KQYA 3U5YA 2DSUA 4GI8A 2YDRA 2VURA 1E4IA 4TX8A 2G3IA 2E8ZA 4W5UA 3WDQA 2XVPA 2VO5A 1WB0A 1EH9A 1HT6A 3K4DA 5LA1A 3VVGA 2YL6A 4U3CA 3FAWA 5HNNA 1UOKA 4PTWA 3WSUA 4Y7EA 3TTQA 1H4PA 3D5HA 4CN4A 1FFRA 1MFUA 5FL0A 4Z2JA 4W7WA 5A6SA 2WMJA 4M56A 4MDPA 1V0NA 5BRQA 1HJVA 4HZ7A 4X0NA 2E3ZA 3O2LA 1PX8A 4AIOA 1M01A 1V6YA 4JFUA 4IISA 5C71A 3GBDA 3ARPA 1VAHA 2V3GA 2FHBA 2EPOA 4JL1A 2JE8A 1NWSA 4HPHA 3WN6A 1QI0A 2D3NA 3AMGA 2YA1A 1QNSA 3WEOA 4HZ6A 1ZJAA 1CZ1A 2CBUA 5GPRA 1ZBCA 3UESA 3CZJA 1BTCA 2YBUA 3WDPP 3K4AA 1JAEA 4D6HA 4UQCA 3I3DA 3WL0A 3EDFA 1E9LA 2G3NA 1UKSA 1QW9A 2CPUA 3SUWA 1KWGA 1UZ1A 1OB0A 5AC5A 1CNVA 2QPUA 1J9YA 3CZGA 4B3LA 2XVNA 4YHGA 5JUVA 3DHUA 4C7DA 4MB1A 1XH1A 1XHGA 5I3DA 1JF5A 7CGTA 4GZJA 2PWHA 1HL8A 1FOBA 4HZ8A 1ZU8A 2VJXA 5IFTA 2J77A 1WDPA 3MO4A 1VFMA 3N17A 4J7RA 5CLTA 5A8PA 4H8HA 4J3UA 4C7GA 2PWFA 3ARSA 1V6VA 2Y8KA 5JIWA 1UD2A 4K68A 3GNOA 2ZXQA 3VIPA 1VB9A 4D6FA 3VIGA 1WCGA 4B15A 2Z1SA 2WMHA 3WH8A 5DT7A 5GNYA 1JNEA 1E3ZA 1BQCA 3EYPA 4B9ZA 1J10A 3FXYA 4CD5A 5FCZA 2WHLA 2ZOXA 5AYBA 2VVNA 2G4FA 1E71M 3IAQA 4PTVA 3KL3A 3ZR6A 4TXEA 1JG9A 3ARTA 2DSVA 1ODUA 3SCQA 3PN8A 4FLSA 3A4WA 1F4AA 4UFKA 1JD7A 5A6JA 1J01A 3WH6A 3B8SA 5JIPA 4BCEA 1GCYA 3BCDA 1PX3A 3RMEA 4PSRA 1J11A 3A6OA 1DWHM 1XD0A 2GDUA 1UA3A 7A3HA 1W9VA 3UG3A 3L4UA 5IDIA 1VIWA 1VEMA 4TUFA 2EPKX 3KZSA 4AIEA 2WHJA 3AIEA 1KXVA 1W91A 4UR9A 3WQWA 3VMOA 1SR0A 1CXEA 5A8QA 2VTFA 1JFHA 1BYAA 1X6NA 1MXDA 3POCA 2HVMA 4AD5A 2J7HA 3VNYA 2WCGA 1X6LA 3DYOA 3WD4A 2G3JA 3ZMRA 4DM1A 1I75A 1TVNA 3JUGA 2BFGA 1HJWA 1NP2A 1C8QA 3GXMA 4CU8A 2VT0A 2XFRA 1J0KA 5CSYA 4PRWA 3O9NA 4E4PA 4AZBA 1HKIA 2W5FA 4AMCA 1VRXA 3VM7A 1QBAA 3FW6A 5M3WA 2ZXAA 1NOWA 2JALA 3W53A 4AD1A 2BHZA 4CN6A 2WLYA 4QLJA 3ARQA 2CESA 4AYSA 1ZS2A 3GM8A 3PTMA 4MAZA 1WAWA 3RJXA 2B31A 4W8AA 2J8GA 3OGVA 1GOKA 3AZRA 5BCAA 4F66A 1Q6FA 2DT2A 2WWDA 1FH9A 3BAJA 2FHCA 2BXYA 3VIMA 4HA4A 1XV8A 2GJPA 4FLQA 1QI2A 2XIIA 5CPSA 2D2OA 2VR5A 3VUPA 2NSXA 1C3FA 3AICA 4WKAA 4PMUA 4F8XA 5A6BA 4ZXLA 1UKOA 1MXGA 1W9UA 1OT2A 4NF7A 1CXKA 1W32A 2CEQA 4J3TA 3UERA 4ZXOA 2QPSA 4OOUA 1JDAA 1P6WA 4RE2A 3VGEA 1H5VA 2VCCA 3CZ8A 4BA0A 3EMZA 2XG9A 3AIQA 3NSNA 5A6LA 2J62A 3TP4A 1XRVA 3ZOAA 2A3CA 1GHSA 1U2YA 4M1RA 1GW1A 3CUJA 2TAAA 4QCFA 1R86A 2NW0A 1IZKA 2OYKA 1NARA 1VJZA 4GI9A 6TAAA 2VRJA 4H41A 4BQ2A 5JBEA 2EBNA 4AIUA 5C8BB 4KWUA 4NRSA 4D1IA 2Y4SA 1OGSA 2UY3A 4JFWA 5E0CA 4LPCA 1OCQA 1E5JA 2FGLA 4JAWA 1W9BM 4S3JA
chains in the Genus database with same CATH superfamily
1PWMA 1TCDA 2Z1XA 1PYFA 4UTFA 1G0CA 1V08A 4ZL1A 2QW5A 3CEUA 2QLYA 3SRHA 5D9OA 1UR8A 4C1NB 4GD0A 4Z2IA 1V3HA 5BOEA 3V0TA 1ISYA 3E2VA 1VBHA 2P1FA 3EX6A 1V8EA 3WF1A 2GSEA 1CECA 1A5AA 4O28A 4I5UA 4WQ6A 5M2FX 1UWTA 1KXTA 1WBHA 4J3VA 3B8WA 3OQ8A 3BG3A 1C9DA 5LXXA 4MY8A 3WL1A 3HZ3A 3LN3A 1QPQA 4UBPC 1HZYA 1EZWA 3P14A 2JKAA 5HR7A 3VFCA 1E73M 4K8HA 2QGHA 5HPCA 4BEUA 2BBFA 3OBKA 4XVDA 2WHMA 1G94A 2FPVA 1P0DA 1WP6A 3LMYA 1GORA 4FR1A 1B2YA 3WFLA 1UD8A 3G6LA 1OYCA 2X1IA 3MS8A 1UB3A 4E2BA 3AMDA 3E0LA 4I5XA 3WLNA 4LAZA 2GSHA 2OLHA 3GTFA 3NEHA 1XYFA 1C7SA 3W88A 1LLZA 3H54A 4LXFA 3DKLA 3QOMA 1JYWA 2VUNA 1LT8A 3B40A 1TJ2A 4H2CA 3C0LA 2DUXA 1F3TA 4IUOA 3UZJA 3LNPA 5G4WA 1X1OA 4GY7A 1GTHA 3CLWA 4V27A 2EEXA 3IIPA 1MQPA 1T8XA 2FTYA 3BZJA 5EFDA 9RUBA 4GCXA 1MQQA 3NM3A 4AD2A 1QPRA 3B8DA 3W01A 5JBFA 3SGGA 3THUA 3F4CA 4ZQOA 1A0CA 3WUBA 3S2JA 3W1UA 3KCJA 3PS7A 5T8GA 3CMGA 1I2QA 1B3WA 2E6FA 1AVAA 3JR2A 3QR0A 1LRQA 2XHYA 4ICNA 4XO7A 2QT3A 3H7UA 3GDBA 2WMIB 3W73A 4CNTA 4MKSA 4UNKA 3PJUA 1MUWA 3PTDA 3UPMA 2P10A 5EU9A 3G8EA 1G7UA 1RD6A 1NH6A 1E56A 1W9DM 4HSNA 1ME8A 1NTHA 3BICA 5J04A 1VIZA 4R88A 1C91A 1PL9A 3LHZA 5H1WA 4IPNB 4EKJA 1H1NA 5D38A 2WNNA 3VD4A 2ZA3A 4GQBA 1KV5A 5A94A 5CPNA 1TWIA 3MUAA 2Z4GA 4N42A 4I7VA 3I7QA 4GY1A 3G1VA 5TNVA 1WKFA 2O9TA 3KS5A 7REQA 4NNBA 1OYAA 1G1YA 4E5TA 4P7OA 3CHFA 1P5BA 1IV8A 2OSYA 4MJ2A 1BLIA 4ACZA 1PV8A 1PVNA 3HIJA 5E9XA 5E6YA 1DYSA 1E0XA 3CQIA 2R8WA 1ZCOA 2Z1KA 3RPDA 3G1FA 3E5BA 4L4MA 4QRNA 4QLLA 4WUIA 3TQVA 5BMWA 2RHGA 3SUTA 3AFBA 2Y6ZA 1DJHA 2H9AA 3O1NA 3TC6A 2GUBA 3VXGA 4NT0A 1QO5A 1UWAA 2X16A 2CLFA 3QW4B 3UBPC 3PJWA 5KMYA 4JL2A 2RDXA 1EPVA 3RDKA 4ZO7A 1JDFA 2WJFA 2HRWA 4B9YA 5I3HA 3KVLA 1JD9A 4AHQA 1YW1A 4ICMA 3W7DA 2HK1A 2SFPA 1RH9A 1F73A 1EDTA 4GYKA 4TX6A 4GOAA 4UQDA 4YVXA 4DB7A 1TE1A 3WF4A 5CSSA 3UG5A 1K3UA 3TJ4A 5HQLA 3EB2A 1QNPA 2QAPA 1S5MA 4B2DD 1JGMA 1DIDA 2CCRA 1BF6A 1H51A 1QOPA 1V6WA 4UB9A 4AD3A 5CPQA 1MDLA 3S46A 4DPPA 3EPOA 1UWSA 4U33A 2BB0A 4E3TA 1GEHA 4MWAD 4AX6A 2C79A 1L0PA 4ERAA 2E1WA 5D9MA 3W2MA 3QZAA 5CPLA 2PS2A 5CC5A 2BDQA 4Y9NA 4W4QA 4AEFA 1V5XA 1KFLA 1EIBA 3FOKA 5KZMA 1JYXA 2I14A 1UR2A 3WEZA 3UJEA 3G3DA 3CHEA 4S3DA 3LHYA 4CKQA 3TA6A 2ZZ3A 3A4AA 3TV8A 4MZYA 3GWQA 2CBIA 3DYMA 1FDZA 1V02A 2VOTA 3GAYA 4FF5A 3PB2A 3T40A 4LS1A 3THQA 2PZ0A 1TV4A 5D2XA 3MBFA 2YIHA 3XIMA 1V6UA 1RPXA 1XLFA 3LHUA 1JULA 5G1TA 3TFCA 3KP1A 1IEQA 5FEZA 1L2UA 1S2UA 1C8VA 3UWQA 1Y5XA 1GHRA 5I02A 1E40A 1A5BA 4QG8A 3WNMA 5DLCA 1P0NA 4RX0A 1J2BA 1M7PA 1Q4NX 1B0IA 3L5MA 3O0FA 1N82A 4RDWA 3EKLA 3W7CA 1XKJA 3GDLA 1RY0A 4H1ZA 3LGGA 4OUEA 5G2IA 4TOQA 3LBOA 3CHVA 2MANA 3P0WA 3GUWA 4NZFA 1ECEA 5I03A 1W1VA 4AC7C 3VC5A 1UYQA 3WLOA 4FZIA 3B9OA 3GFYA 3IPWA 1SPQA 2PDLA 4WVXA 3F2DA 1DJNA 3IJIA 1RHCA 1A3HA 5CJMA 3L4WA 1CTNA 4DLMA 2VGIA 3EXSA 4JTLA 3MP4A 4E8DA 5I3GA 3LRMA 1DPMA 1AH0A 1XLKA 1QK2A 3LHVA 2A7PA 2CU0A 3QYSA 1XRSA 3PPCA 2C6QA 2PWVA 3L67A 4AY8A 4RZ6A 4GQ0A 2G3FA 2HISA 1FHVA 1SMAA 2RGLA 2X8RA 4L6OA 2D73A 1TPEA 1HKVA 2YBTA 3T8QA 1EQCA 6A3HA 2ZTKA 3KUMA 4X63A 1GG0A 3WQCA 1HGWA 1M04A 3ME3A 1XI3A 5E93A 2FHFA 2RUSA 3BJSA 4W7VA 4QLKA 1J12A 4K2SA 4KGLA 2PTDA 3VNLA 2BY0A 4DO5A 4O50A 4C6QA 2CLKA 5K9XA 1FFQA 1Q2RA 1IXOA 1MO0A 1QOQA 4Q8WA 1DJIA 2NXGA 4N9CA 2POZA 2PGRA 5C2GA 1WXYA 3VOCA 2OT0A 2R1LA 3SIZA 3TDFA 1WV2A 1KO0A 1UR4A 4GWEA 1Z6KA 4IFKA 2FIQA 3G5EA 2PWEA 4J3SA 4A8NA 1V93A 2GQAA 3M9YA 4O4VA 3EMCA 1M7OA 3ZO9A 1U83A 1C8XA 3WLPA 2C3ZA 3QR3A 3W0KA 1WDQA 4DF2A 4CEXC 4O8AA 5LA0A 1TPH1 3QGKC 1LJYA 3SY5A 4HHLA 2ZX9A 3PBGA 4MVAA 2PEVA 3GD6A 1RCXB 1OGBA 3P2VA 3M5YA 4Y8FA 4ORIA 3GXIA 1XS2A 5M5DA 1VEOA 4PUEA 3R8RA 3NJ3A 4TVUA 4WY0F 3EDEA 4CNUA 1EP1A 2XH0A 5CC3A 2WBGA 4JXCA 3MHUA 1UKTA 4JTTA 4LS0A 3M4HA 2WO5A 4IJBA 1C93A 3S1VA 1M3UA 2X0YA 3RUBL 2ZE0A 3M5XA 1TB3A 4GZEA 4BQ5A 2OVLA 2NWRA 4QDWA 3QMRA 3WJWA 3NYDA 1CGTA 2A3LA 2FZBA 1CGXA 4H2HA 3WLQA 4RCXA 1TPC1 1W0MA 4H7VA 1KWKA 2WNQA 4IGSA 4XAZA 5H8PA 1R3WA 3E49A 4S39A 5FJTA 1XLHA 2NSOA 5C6MA 1CLVA 1HJXA 3T05A 1E15A 4WY0B 3DFSA 1RBAA 4TIMA 1CEOA 4X22A 2XSAA 4PB5A 2WVTA 4L80A 3T44A 1E6RA 1XYMA 1A5OC 4FX8A 3KL5A 4R3UA 1KM5A 4O1EA 1XL9A 2DIJA 4P8UA 4OUIA 4FA3A 2VX5A 3O07A 3N9SA 3EBVA 4C7FA 4GNVA 4AWEA 3GDTA 4H04A 3VDGA 4EVZA 4AMAA 4HHPA 4M81A 1Z7AA 1IXQA 3KLKA 4WJXA 3RXZA 5GJMA 3G3MA 1J8VA 3AHZA 4QJ3B 1XH0A 3BSGA 3LB0A 1Q4WA 3WK0A 3FSTA 1UOZA 1EEXA 2WZHA 3SCUA 4S3FA 4OFCA 4M6PA 3UR8A 1ICSA 3S47A 3PZVA 3N2TA 4A3RA 2OO0A 1Q6DA 3NSXA 4HVXA 4F0RA 3HM7A 2G5WA 4B5UA 3IK4A 5HATA 2X7WA 3T0CA 2RFGA 4EANA 2YBVA 4FX6M 3EKZA 5A1AA 2AAAA 1G01A 5LKYA 3MZNA 2W91A 4C1LA 3LERA 4O15A 1NELA 3AS0A 3BLOA 2VCAA 3QKZA 4ZZ9A 4CUCA 1KNWA 6XIAA 1OFBA 2P0IA 3UJRA 1KBJA 3W27A 1H11A 1CGWA 5AHIA 2WVVA 4JHMA 3GIYA 9CGTA 3IWPA 3IUIA 2HSAA 2P53A 5LYRA 4IQLA 4V28A 4QE4A 4DZ5A 1RUSA 2PDCA 1J93A 1O12A 1E0WA 4HN8A 4RPPA 2QXWA 2DZUA 1AW1A 3QQ1A 5BYWA 3SQLA 1FCQA 3UCQA 1PTGA 3PTKA 3E0FA 4CQDA 1VPQA 2YCEA 5CXPA 4Z08A 2Y7EA 3A13A 5E09A 1V0LA 3MV01 2FJUB 2YYUA 5J8LA 4Q8TA 1OG6A 4WLCA 3WNNA 5A2BA 3OQEA 4Y96A 2Q02A 4PTXA 2PU0A 1YTKA 1GJPA 4WXYA 1SUXA 2XM1A 1OM0A 3W1MA 1VFSA 2ZUTA 4KWSA 1TJPA 5KZEA 3WD3A 4BI7A 3GNRA 1BXNA 2ZRXA 2PTYA 3GZ3A 3MMWA 3TWBA 1ZRQA 3MVTA 1L8NA 3LCHA 1GQLA 1OVDA 2PDNA 2W9MA 2PDXA 5FJIA 1QNOA 4W88A 2WPBA 2IPGA 1CXLA 4RJEA 1M68A 3BTNA 2ODOA 3B0PA 3B8UA 3CQHA 1XGZA 1EWEA 4LVDA 4E4FA 1JPIA 5H2ZA 3TQKA 4GVFA 1V6XA 4BHYA 1DHKA 5ENLA 2VUYA 3S3GA 3RX2A 3B9AA 3FHAA 4BQ4A 1PS9A 4N4PA 5C7HA 2DP3A 3AMKA 5DT5A 4PMQA 4EPBC 1UZHA 3S83A 1KCZA 2IQ0A 4D9PA 3W87A 3PUDA 4H9TA 3V5OA 3OBAA 2BGNE 4UTWA 4MWAB 2CZFA 5MF5A 2PC4A 3L4ZA 4YTTA 1C92A 5I3KA 4ZB5A 3BZGA 3UWEA 2F38A 3RILA 1UH4A 3S5ZA 4WD0A 4GZIA 4L1XA 5EKYA 1IEVA 3E0WA 3W1NA 4Y2WA 1KM3A 3WMCA 5CC7A 1XSJA 1YTDA 4PFHA 1YBQB 4ZO6A 1Z69A 1E70M 4JIEA 4QSFA 1KFJA 3VOFA 6PTDA 3URBA 4ZQNA 4XZMX 3EWXA 1XLAA 3CWNA 3A5FA 2ZRUA 3N6JA 3V0UA 4EK7A 3NZRA 2F2KA 5LNUA 4J4KA 3F2BA 5G4EA 4L6DA 3W85A 3WD0A 2HWGA 4ROPA 2FZMA 2D3LA 2YCIX 4PUMA 3UD6A 1OX5A 4HNVA 3LG3A 5A6KA 3TQPA 2NT1A 3KVMA 3RCMA 3VKDA 1JUBA 1S3HA 1V6TA 1GVFA 1QK0A 2DZPA 3BMWA 4QFUA 2VKZG 2RKXA 3H4XA 1EGZA 1S2CA 3I10A 1WPCA 2WAGA 4ICCX 2WB5A 1ITCA 2OZ0A 4GGHA 4V33A 2GFTA 3E3HA 4JQ3A 2Y85A 1NFBA 2ZA1A 3G1DA 5TIMA 2Q09A 1MNZA 3HGSA 5LGZA 3L7RA 3A24A 4MB3A 3HJEA 1WDDA 3QKEA 4JZ5A 1XBXA 4KGJA 3DFHA 4IMEA 2I9EA 4GFSA 4JEJA 3W70A 4YN5A 5LHEA 2VZVA 1KRBC 1I9CB 1PAMA 3VK5A 3TA9A 2YYTA 3VCRA 4B4FA 3U5UA 1HKWA 3D3FA 4GUHA 3RGTA 3WF3A 4QS6A 5A2CA 2ZZ7A 3QY6A 1DJZA 4JICA 4AW7A 1EOKA 4E38A 3ECQA 1WO2A 2CC0A 4PN2A 1KKOA 1TV8A 1MW0A 1TV2A 2PA6A 3WELA 5C9XA 3V16A 2ANUA 5XIAA 4PFMA 1ADSA 1SSDA 2P3EA 4XVEA 2WCAA 5I2UA 1Q3NA 4GUIA 1THFD 3VX0A 1FWTA 4ZGYA 1VPXA 1QI4A 3LPGA 3N4EA 3UWUA 2XPKA 3ZWSA 2NUWA 3A4XA 3JZEA 3OZYA 5FJOA 1FH8A 3VKAA 3SI9A 4DWDA 2J66A 4CD4A 1QHOA 2IPWA 2V9DA 3FCPA 3FEMA 2I9UA 4GC4A 4WKFA 1XYZA 3NO5A 1QNRA 2WM1A 4PSPA 3U7VA 4GX8A 4B5SA 1HO1A 3GLCA 5A6BD 3CHCA 2OT1A 1TPB1 4IP5A 4L65A 2V5CA 2WHKA 2J8TA 1EFZA 1KM6A 3S2CA 2OYMA 3TAOA 3IARA 4KKXA 5I0DA 3II1A 3VNMA 1H7RA 1UC4A 2XIBA 4HCLA 3VMPA 2ZZ2A 1QW8A 4IFKB 1EO5A 2YCKX 2JF7A 1I2RA 3B0XA 3ALFA 3KDOA 3LBMA 1JZ4A 4NYUA 3DFYA 3GXDA 5EPDA 3GUGA 5ECUA 4FLRA 1YPXA 3C5QA 3UNDA 1ME9A 4M6VA 3BARA 3ABZA 4K7VA 2JKPA 4EE9A 2BGSA 2EPMX 3AHVA 4FNQA 1H50A 5LIXX 4O11A 5BOOA 1NWRA 3NCOA 1JXJA 3UXIA 2HNEA 4MNJA 4CCDA 4UTMA 3W2NA 2OQLA 4M8UA 1JJKA 1IR1A 4GI4A 2R9RA 5C2XA 3S2MA 4S3AA 2J47A 4O18A 3VTRA 7TAAA 1AQ0A 2KZHA 2ZCGA 3ERPA 3WH5A 1V0MA 4IG2A 2Y61A 4PMJA 4CU6A 4YJ5A 1E0TA 4Z1BA 4PCNA 3E0IA 4H9MA 2XVLA 4GRSA 4HU4A 3WENA 4A29A 2HQAA 2VP8A 3F5JA 1W3JA 2PWGA 4P8VA 1O7AA 4E8CA 3G8RA 1TR9A 4BF9A 3JVAA 2I5GA 2ALDA 3NZQA 3VDCA 5LNSA 2A4AA 3MI2A 4WDUA 1LQ0A 3MT1A 5FJRA 4DJED 1NM9A 4C6JA 1QOXA 2UWFA 3D0CA 2BGQA 3Q94A 3V5CA 3STGA 3SN1A 1FXQA 1DP0A 5AVHA 2XISA 3FKKA 4M24A 3W25A 4F0HA 3BOFA 1NOUA 1ZJBA 1B9ZA 5D04C 1LL7A 3TLQA 1QU4A 1IZJA 5CKSA 4K1WA 1TREA 4M5PA 5HPOA 4UCFA 5FL1A 3ZIZA 1QPNA 4HPXA 5JH2A 1PKNA 4IQDA 2E9MA 3L2IA 3UP8A 1E4LA 3WD1A 3TKFA 3S6TA 1Y5VA 5HAOA 5KZ6A 1IWBA 4LVFA 1SSGA 3ELFA 2J75A 3KFTA 3NWRA 2FB2A 2QUNA 4HOWA 3NIYA 4AZGA 1JCYA 2GYIA 4J2PA 2DIEA 3AHYA 4IMGA 3NDZA 2XFWA 1S2AA 1UZ4A 4UMCA 5DFAA 6ENLA 3AQUA 1K9EA 1SJDA 3DFPA 1XKYA 4OQVA 3RR4A 4JX5A 4EWND 5DMLA 1GW9A 1W37A 4S3CA 5CBIA 3MI6A 4H9XA 2PBGA 4HPJA 5HXMA 2D22A 4C6CA 3WF0A 3KXQA 2ZYFA 3M7WA 1RP9A 3GYCA 4GYFA 3DENA 1YE6A 3CU2A 3VIFA 1J79A 1E4NA 4HTYA 3GXFA 3QQWA 4JX4A 4UR8A 4RDYA 3OZOA 3WQ5A 1CGVA 1BRLA 2V0TA 3P67A 3OPSA 3K8KA 1ZPTA 3M0JA 3CUGA 1ZL1A 1FWDC 1IIGA 3K46A 1FKWA 2BV9A 3T8LA 1MW2A 4UOZA 3NQGA 3QFEA 5DQPA 1EHNA 1SYTA 2IUZA 4ZSUA 3UXLA 3MW7A 1VBGA 4Q7NA 1XYCA 4FOJA 5CBBA 5EBAA 3VZYA 1LL4A 2PP3A 2GGHA 3W7NA 5HULA 1I0BA 5DRCA 1A5NC 2YDRA 4K38A 1XLJA 3EA1A 4O16A 2RJHA 4UIOA 4N9BA 3E2SA 1R5YA 1EL3A 3UWWA 3TH6A 2YL6A 3DDMA 4GABA 4U3CA 3T0TA 4QITA 3WSUA 4XIAA 3TTQA 4DI9A 4HNCA 1H4PA 3D5HA 2E6YA 4CN4A 3MUCA 1FFRA 2G4JA 1EF3A 1WOBA 2A85A 3WK1A 5DX7A 4DRSA 4X0NA 3S1XA 3IS4A 4JFUA 4IISA 3ZLHA 3GBDA 3ARPA 1VAHA 2FHBA 2EPOA 4JL1A 2V5LA 2JE8A 4GHRA 5CZ0A 1JQVA 2HS6A 2I1OA 2D3NA 2VDHA 3TN3A 1AUSL 1U1UA 3ZLGA 1CZ1A 4L9YA 3R2GA 1ZFJA 3CZJA 3WLSA 1Y65A 1MDRA 2G3NA 1FBAA 1QW9A 2CPUA 2TSYA 4BY3A 3NQAA 1CNVA 2BODX 1DQWA 4MWAE 3ZVHA 5JUVA 3MVIA 4Q6JA 1JF5A 1HL8A 3GYEA 3V75A 4DLFA 5KITA 1UC5A 4HZ8A 1Q6LA 1ZU8A 3E02A 2VJXA 2J77A 4DYEA 4DJFD 3N17A 3AC0A 1Q5MA 2DZVA 2PWFA 4BI6A 3ARSA 3W1QA 2PZNA 2OOGA 2J24A 4NJIA 1CT5A 1M1BA 4Q8VA 2VFIA 2ZXQA 1VB9A 6ALDA 4Q6XA 1HUVA 5LNRA 3ES8A 4KFNA 1K4HA 1EUAA 5DT7A 1C9WA 4HK7A 1BQCA 4B9ZA 2PDYA 2ZOXA 2AQWA 2VVNA 2G4FA 2PMQA 3IAQA 3IIXA 1BWLA 1JG9A 4AFYA 5D33A 1AL7A 4IPPA 4FLSA 4UFKA 5A6JA 4O57A 2VC7A 3KTCA 3S5SA 3IUDA 4RDVA 2FVMA 1OC5A 5HUOA 3BCDA 1PX3A 1EX5A 2CLEA 3LRLA 4PSRA 3V4BA 2PGEA 4Q4KA 4QR6A 1DV7A 3R13A 3MJYA 1W9VA 3UG3A 2A7NA 3FVDA 3L4UA 4QJ5B 4LBRA 3KZSA 3SFWA 4AIEA 2WHJA 3BANA 3WQWA 5BRBA 2QVNA 1L6WA 1SR0A 2FJKA 2VTFA 1BYAA 1I2PA 4H19A 3VNYA 2WCGA 5HA7A 1ZAJA 1I75A 2HTMA 3K4WA 4HQVA 2VT0A 2XFRA 4CQAA 5B7YA 4H3DA 5HWMA 4AZBA 2ADAA 3RLGA 4L56A 4Q8PA 2IKIA 4ZOAA 3VM7A 4GUJA 2ZXAA 4XZNX 2BHZA 4KCTA 3TYCA 2CESA 3GM8A 3A22A 4WEVX 4MMWA 2PP1A 1XGDA 3RJXA 2J8GA 1TJRA 1EUNA 3AZRA 5BCAA 4DBSA 3R79A 1FWBC 2BXYA 3W1AA 4C6EA 1JUEA 2GJPA 1Q2SA 2DQWA 2D2OA 3VUPA 4UTTA 1K7EA 2QUMA 3TSDA 4ZXLA 2Q8LA 1OT2A 1CXKA 1BSLA 3VZZA 2OGJA 2QPSA 5KTLA 1P6WA 1RQBA 2Z25A 3AWNA 4G7EA 4JTIA 2EPHA 3LCLA 2OU4A 3CZ8A 4BA0A 3EMZA 2Z0IA 3TP4A 4MLRA 5F1UA 2NLIA 3R94A 4PBEA 1GW1A 2QCMA 1E1CA 3L23A 4XWUA 4H41A 4BQ2A 1ENUA 2EBNA 3BGJA 2X2GA 4S2CA 4PCFA 4LH8A 3GXPA 4J2MA 3ITGA 1KBIA 3B97A 3SADA 2VD8A 3GVGA 4Q4MA 4O52A 1XDMA 5DMYA 2O7QA 5KZDA 1LP6A 3W7EA 2VDGA 4QDPA 4MZ8A 3V36A 4K8EA 1FUYA 2JQXA 1W2PA 1SFJA 4AY7A 2QCLA 3M6YA 2QUTA 3ZR4A 1WYIA 1POKA 4FS9A 1SFSA 3BMVA 3W24A 5A6TC 1XFCA 3ZSTA 3LXBA 3W1PA 3WH9A 4E2OA 1RBLA 1LLWA 2Q3OA 4JCLA 1QVBA 2PF0A 3C3NA 3QC3A 1TCMA 2BNJA 2QCEA 3EPNA 2PDGA 3Q4DA 2YLLA 1KQZA 1E5NA 4M51A 1SZGA 5FSEC 4GIRA 2FGBA 2BOEX 4UQ9A 3GR7A 1C90A 1XYAA 4MYXA 4XK2A 4TVDA 3LCGA 3CAQA 3N15A 4NI3A 4GC3A 5EYWA 3L0GA 1PZ2A 1EJRC 1I4NA 3OVRA 3WLLA 1QNQA 1GK8A 1WDSA 3N2XA 5D37A 4AD4A 4TMBA 3PSWA 1O60A 1ITQA 4KETA 1HXJA 3UZWA 2CITA 3NZGA 4JCMA 4WGXA 1NFPA 1NAL1 1Z32X 4K7YA 2ZX8A 1OJXA 1Q6EA 1YTEA 1YE4A 1NFGA 4C6OA 3TMQA 5E6ZA 1SM9A 5FJPA 1LG1A 1X8CA 3MWAA 2F8QA 1XLBA 4KEMA 3O3RA 1F74A 1TQXA 2TPSA 1Z42A 3WIJA 3CUIA 4K37A 1G4TA 4Z1CA 4B3ZA 3LSBA 3P60A 3FHQA 4EAMA 1O5QA 1BPLB 1V4YA 1KTNA 4DWSA 4POCA 1QASA 3W84A 1TWSA 3ABRA 2ZWYA 1XLDA 1RJPA 1SQ7A 1SZEA 1NF0A 1EIXA 3GDMA 3G22A 4ECLA 4RZBA 4LCQA 4MNLA 1W5OA 4AEEA 3CPGA 4UTWC 2Y63A 5DEZA 1BG9A 4IX0A 3DHFA 1I0DA 1XF0A 3BW4A 4AQLA 4KF1A 5FEXA 2WBKA 3UEQA 4P7LA 4YLWA 1FWHC 2XTKA 4I9AA 1HGYA 1KCKA 4U10A 1QI5A 4XX6A 3TN5A 4FPSA 1EJUC 4EAYA 2CHNA 2ZZ5A 4HMNA 2ZX7A 4CD7A 3F7JA 3E74A 5EBUA 4M6QA 1D9EA 3STEA 3TROA 2Y2WA 3U0HA 3RHGA 3I6TA 2HXTA 5E5CA 3PBWA 3BV4A 4O1CA 4I5RA 1W1IE 2Y89A 2VX4A 2PAJA 3A23A 3DN5A 3CL7A 2CWXA 7XIMA 3IAPA 2G0WA 2VX7A 5D2WA 3CGTA 1OYBA 1MMFA 1T40A 4KRUA 3U9IA 2W3ZA 4RW3A 3VINA 3DAQA 2EKGA 5I24A 4MJ4A 3W7IA 4PBGA 3AZTA 3RN6A 3H21A 5FF2A 5H8MA 1W8GA 2ABBA 1K8CA 4PCTA 2ISVA 1O1ZA 3CUZA 3PUOA 3MO7A 4FOKA 2WCSA 1EEPA 1H7WA 5CSUA 3ARUA 1GT8A 3MCMA 1QNVA 1EDQA 3UR5A 4U4MA 3GTIA 2CLOA 3MKKA 4LQ1A 2BXZA 1IEXA 5CZJA 3GG1A 1OX4A 1D3CA 3I6RA 3BWWA 1EHAA 4WSJA 4W86A 1DIKA 5AHNA 4XSMA 1TA3A 1BYCA 5A8OA 3B05A 1A50A 2JGQA 6CGTA 2VFFA 3D46A 4JTUA 2V69A 4RNHA 4C6NA 1N55A 4NYYA 5T26A 5HQMA 2O0TA 3OJGA 4DHGA 3UA3A 4DUVA 4QS5A 4D71A 4H8UA 3SCOA 1GOXA 1ZAHA 3CUFA 3I3EA 4A3UA 3B9EA 5IHRA 3CT2A 5ABGA 5C9UA 4G9PA 4ZCWA 8RUCA 4IPIA 4TR9A 1KFBA 4LBUA 1OD0A 2INFA 3EOOA 3WZ0E 2HE8A 2YCLA 4S38A 3TWAA 5I3FA 3TJXA 1BQGA 3OYXA 1LWIA 2Z2AA 5HMSA 3MYPA 1SGJA 1IEIA 4IF2A 2PWDA 4FOUA 4AZHA 2O4MA 4Q4SA 1HP5A 3C86A 1RK6A 4CLMA 1KBKA 5I77A 4H7CA 1AA1B 1POJA 3INPA 4PL2A 2Y1HA 1D7FA 3T1GA 3W28A 5I5RA 1XXXA 4OBRA 3P93A 4LUSB 1GVSA 4D72A 1E9YB 2BG5A 2A0NA 1W8SA 2YW3A 2OYLA 2A5HA 4LVAA 4XB3A 4YVPA 1W9PA 1LUCA 1PIGA 1GVIA 1KM2A 3U7BA 3MV11 4YWSA 4WXZA 5L9FA 4RNIA 3R43A 3BH4A 5EA9A 4RZ4A 2OEMA 4UCGA 3GC4A 1RA5A 1MRQA 4X9SA 5B7ZA 4DUXA 2O9OA 2AMGA 1QCWA 3KRBA 4Q8QA 2BZNA 2OZ8A 3QPEA 1PKLA 3FAXA 2W61A 1VH7A 4REQB 3A47A 4UFHA 1T6MA 3LMZA 3QJAA 4DBEA 2C8NA 3EZ4A 1DJWA 4B5TA 1A3WA 3EXTA 3GC5A 4GZ7A 3KWXA 4F9DA 5HUPA 1CGYA 3MUY1 1PIIA 1G69A 1BGGA 5AN7A 4LY4A 3L65A 4P5UA 5FKYA 2GWNA 1QI3A 5I23A 3KCOA 3GU9A 4NAFB 4I8YA 1LWHA 5LA2A 3BLPX 1TZZA 2XIQA 2DQXA 4Z0SA 2QCDB 1AW5A 2CBJA 3S5YA 2VZUA 4PB3A 1B3YA 4S3KA 1XLCA 4MFEA 1KGXA 3MANA 4BJHA 3T4CA 3H53A 3H4WA 3OOQA 3MTWA 2CERA 1TUXA 4W9TA 3W81A 1H2JA 3MKCA 1XIEA 2CLLA 3DFTA 1FKXA 2NZLA 2VELA 1GKPA 2BVYA 3T7VA 4BI5A 3EEGA 3HMCA 1GOQA 5F2GA 3RR1A 1GZJA 4H9VA 4JTEA 3IJ9A 1CXIA 2Y5EA 4BKNA 4G5DA 3WCZA 3HB9A 4KWWA 2YSWA 3S0CA 3T6CA 1XIMA 3BSMA 2R91A 4GI6A 4OV9A 2X40A 2D0GA 2HJPA 4HMDA 1TIMA 1A4LA 2OPJA 4Z2KA 4H8VA 5LIKX 3AYSA 4AWTA 3GNNA 3B0YA 4ZVJA 4TU1A 1AODA 2IXUA 4LS2A 4FNSA 3ZT6A 3DG7A 3TLLA 1FH7A 4I9TA 4ATDA 1TFVA 4M80A 4D8ZA 4Z17A 2OTDA 3WKZA 2J78A 4G1KA 3ENLA 4XD4A 2X42A 5G5IA 2B7OA 4LV9A 2INEA 3DFNA 3W02A 2W67A 3GXTA 3SDOA 1OD8A 3SUVA 1V3KA 1WKDA 4PRTA 1ISZA 2IMRA 3KTSA 4OTKA 1PCKA 3QZ6A 3EDDA 3OBEA 4Q8OA 2DSWA 4IX2A 3UF9A 1GQNA 3QBUA 4IT1A 3WO8A 2QYGA 3PTQA 4ZE4A 2V3EA 1SO5A 2EPNA 4GY0A 1YHTA 3HU7A 5LIYX 4W93A 1ZCCA 3ONCA 1LLOA 4D6DA 3PM6A 1I1XA 4RV3A 2YL9A 3RRXA 1TVLA 4AXKA 1JQXA 1CI1A 1LQAA 1ITUA 2DIKA 3TW9A 2OODA 2QEZA 1PDYA 3E6EA 3MQTA 1K7FA 3CQJA 3AXKA 4JHOA 4ACYA 1V7YA 1WZLA 4OKDA 3LPPA 3RM9A 3H2NA 3SRDA 3P84A 1VBRA 3URAA 4K1GA 3U2OA 2A3AA 3PSVA 5T9BG 3MHGA 2QDDA 4ONVA 3KLLA 3XINA 3NAVA 4GG9A 4RE3A 6XIMA 3IRDA 3K13A 1Q6GA 5CBJA 2D24A 4LGXA 3FJ4A 5K2ZA 1HF6A 3NZ1A 4TTGA 4NL1A 5H6HA 2ZICA 1AL8A 2NX1A 1TO3A 1UIPA 3UGVA 2WW5A 1XYLA 3APGA 1B9BA 1R30A 5D2TA 1US0A 4Q8MA 3R0UA 3SY1A 1JPKA 3WLJA 2WANA 3HOJA 1CENA 3SURA 3DZ1A 3C52A 3OGRA 1BF2A 3GTXA 4E6MA 2AQOA 4YVVA 2VWTA 2PD5A 4S2BA 5A6MA 2PDWA 2WKGA 4CD8A 1UG6A 2A3BA 4JFSA 4LCSA 2OWCA 1NJJA 3UR2A 1TRDA 2R1MA 3HN3A 1GVRA 4XZ9A 4ENLA 3HPSA 3M0XA 4LX4A 1KM0A 1TWZA 2ZUNA 2YA2A 2VFEA 2AKZA 3VPLA 2IW0A 3DG3A 3H55A 2FH8A 1LOQA 1LRTA 2XFFA 2WPGA 4MUZA 3ARVA 3B8IA 3VD3A 1TPWA 2ZA2A 1F05A 1IWPA 1F6KA 2A1YA 4UQAA 5AYIA 4XIMA 1GKRA 1DVJA 1A49A 1UD4A 3OGSA 5ABEA 3NVTA 4XBSA 2FFIA 2QJGA 1RJRA 4JTQA 3QHNA 3ABSA 4MZ1A 3M0VA 1UUQA 1KLZA 4FX7A 1JXKA 3K8LA 1VEPA 4I3GA 2R24A 4L9XA 3HO8A 5I7GA 1NDYA 1X1NA 2A6NA 3E96A 1F9CA 4IGMA 3NOYA 2ISFA 4DO4A 1DE6A 1D3HA 1O4UA 1VS1A 3CZKA 1LG2A 2XYLA 1H1ZA 3H23A 3AXXA 4DXKA 3FEQA 2OXNA 4HNLA 2OZ3A 1O66A 2XIOA 1XGEA 1PYMA 2DZTA 4ML9A 3F2CA 5JXQA 4DYJA 2Y88A 3IEBA 5EMYA 4PMNA 2ZVRA 3LPFA 1KKRA 4N9EA 1XIHA 1QR7A 2CKSA 3Q45A 5GQBA 3UWVA 1KFKA 2XZ7A 1V3MA 3LUTA 3TU9A 1JEZA 1Q13A 2XVKA 3AROA 3KOZA 5T9CE 3MYOA 4Y9AA 3PZMA 3BURA 2C1GA 4R9XA 4BFAA 1UP0A 1L8PA 4HKPA 3WJZA 4OOZA 4B3KA 3PJXA 3NQ7A 1SJBA 4NU7A 1JDDA 3VOJA 4EF9A 2E7FA 3GR8A 5H8UA 1EOMA 2GZXA 2PODA 4JDBA 1VHCA 3PC0A 2E40A 6REQA 1Z8AA 4JYFA 1JCTA 1KRCC 2IKHA 5DCEA 3BCFA 1T8QA 5K4ZA 3PUGA 3ARXA 3R89A 2VFHA 4JFVA 3SCVA 2J25A 3L21A 2UY4A 7PTDA 1OFPA 2P76A 4KCWA 3R8HA 4LUTB 2V3FA 3BW2A 2NXIA 4UTTC 1MUMA 2WQDA 4AZCB 1XCFA 1Y7VA 1SW0A 3SCTA 2R1PA 1HNYA 1VYRA 3M5VA 3OLDA 1PHQA 3P8JA 3B9NA 4GKTA 2YXXA 3LLXA 4PTDA 1NP0A 4BK9A 2QVHA 1AH4A 3NVDA 4GIYA 2PDQA 1O95A 3HA1A 2OX4A 3VGFA 3IJ7A 4IFRA 2AL2A 4KW2A 4D8AA 3SIMA 4NKCA 5A95A 3GVRA 2YCLB 3T42A 5CQ1A 2E6AA 3F4VA 1R3RA 2IQTA 3EA3A 4AB4A 3PPFA 2VDIA 2YLAA 5GNZA 2NQ5A 4ASTA 4GH1A 4LYPA 3AJ7A 2TYSA 4KBXA 1EPXA 2XJ7A 2CZVA 4HK5A 3VI2A 2NV2A 4KEVA 1NVMA 3ZJ6A 2X2YA 2X30A 3LGEA 4HYVA 1XLMA 1DEDA 4RV8A 3CXOA 3W7QA 2QV4A 3S9ZA 2VL4A 3UR7A 5CZKA 1W3KA 2I56A 2GK1A 1DKWA 3PPHA 4AIBA 3GH7A 3REQA 4QX4A 4XQ6A 5CGMA 4NZCA 3WY1A 1GG1A 3IVUA 2YZ5A 1WKYA 4GJJA 1KGWA 1JZ7A 1ZBVA 1Q6RA 3GDRA 5TQLA 2CIPA 2QJNA 1ITXA 5G2WA 4JKMA 5MKGB 4JNMA 4C91A 3NL3A 2GVGA 4E8GA 1D8WA 5D02A 4EXAA 3AHTA 3WMSA 2JIEA 4XKYA 4HJFA 2VX6A 4LAMA 1E51A 2WSQA 1GZGA 1TQJA 3EOLA 1KC7A 1FX6A 4ZA0A 2CW6A 3G1HA 3PAOA 2QPXA 3CQ0A 1B3ZA 3EPMA 3LXAA 1SZRA 4UNIA 1S3TC 1PTDA 3PF3A 3AXIA 4RNJA 1OCBA 4JD4A 1KR1A 3M44A 3E9AA 3K8MA 3PBVA 5PTDA 3WNKA 1TWWA 3L0NA 4H6QA 3UG8A 3QR1A 2UZ9A 3EWCA 4LRSA 3RF9A 5ABFB 1CPUA 3AJXA 1DBTA 4JY9A 2Z1BA 3B03A 1JVNA 4AWSA 3H24A 2ATSA 3CLMA 1AMYA 2FH6A 3M07A 4ZFMA 1QHZA 1GUVA 4D6JA 3HPXA 1TTJA 2Q6ZA 3LD5A 3QPYA 2Q01A 1F61A 1QT1A 1XISA 4H6KA 4U5IA 1LQ2A 4YU1A 3PWAA 4F2UA 1RQEA 1SVDA 1U22A 3PNZA 4UWMA 3VX1A 2XGIA 3LZ5A 1R6WA 1C29A 3AIBA 5L6UA 3VGBA 5BZAA 1YEYA 1Z44A 2ZXDA 5HJYA 3HBLA 3TTOA 2PI6A 2WMGA 5LNVA 3SAZA 3G24A 2E67A 3OLGA 1OBAA 3R10A 1BD0A 1J2WA 2IKJA 4DF0A 4X9YA 2YXGA 1WZMA 1K70A 5DF0A 4DBUA 5C9RA 1G4SA 5FF3A 2GUYA 3VILA 2GJXA 3HG2A 1I2OA 1M03A 1OQFA 4DWSC 1UJQA 3TCEA 1FY6A 3LEPA 3APTA 4D8LA 1GQIA 1AFSA 2G3MA 4GVIA 1FHUA 3FK4A 5DELA 4BR1A 3ORWA 3HPAA 2DT3A 4DNHA 4W84A 3L4VA 3PZNA 3BAKA 3KOYA 4UFLA 3DBNA 3IV3A 5AOUA 1LT7A 2REQA 4OIFA 3NPXA 1HVXA 4CCCA 3MSRA 1FCVA 1LORA 3OVQA 4C6DA 4GE8A 3PG9A 3O7UA 3BGAA 3BAWA 4JIRA 4UFJA 1KA9F 1A5SA 1WE5A 3R8GA 5LNWA 3IIZA 4B91A 1QRQA 3RNDA 3L4XA 4Z2HA 1MVYA 2VR2A 2ZUMA 4JFTA 3CWOX 4FNTA 2PGFA 4PGLA 3VKKA 1EZ2A 2BLEA 2DZAA 3DGBA 4C1KA 3FIGA 3UXAA 1T96A 1VCVA 1W1TA 3S5OA 1UKQA 4L1WA 3TVAA 3HTWA 1YNYA 1KCXA 2X09A 2AL1A 4Q3MA 1W54A 4FIQA 1JI1A 3N11A 5AC7A 2V67A 4LV4A 5LGXA 5F7UA 2V68A 3OHIA 1JZ6A 1DE5A 3LS9A 5ABTA 1N8WA 1YKWA 3NQ6A 3LU2A 3BC9A 1W6TA 1ZGDA 3R7MA 1OCNA 3MDWA 2FVKA 2XWEA 3USZA 1MW1A 4MDOA 1TTIA 4CVUA 3DECA 4QDMA 3TYDA 1YNPA 3KHJA 5DY3A 3TC7A 4N02A 4OV4A 1P43A 1TPFA 2GJRA 2OG9A 1UP2A 5ECVA 1GEQA 5DMMA 2AGKA 4CNPA 3I7RA 2XINA 1EA0A 3TQ0A 1GVQA 2W4XA 1RP8A 1IQ8A 3VGHA 4IXHA 5FIPA 3PR2A 2H8ZA 1AG1O 2J9XA 3GTNA 1S2WA 5FF4A 3MCOA 4F3HA 4MB5A 2J4GA 3WQ4A 5K4XA 3QZEA 1P1MA 4P7RA 2ESCA 4RPQA 5EMKA 3T9PA 5C55A 4ZR8A 1DTNA 1BYDA 4FK9A 4HIBA 2DSKA 3E0VA 4HA0A 3WQPA 4IFOA 4PUWA 3BOXA 3GAKA 1TYGA 1ZUAX 3GO2A 3PZOA 4LUIA 3VU2A 1UUOA 1UBPC 3VCCA 3QY8A 4DO7A 1EXPA 1SMDA 1MRAA 4XD3A 2CLPA 4JIIX 3MJMA 4KIRA 3EAUA 3FJ6A 1H0IA 4X0VA 1OINA 1H63A 3WQOA 4O0ZA 4B5NA 2CXGA 2GDQA 3UU0A 2CYGA 5BRPA 2J7DA 5D30A 1BWVA 3GY1A 3LY0A 1P7TA 1EP2A 4CNSA 2BXVA 3NL6A 4MNKA 3M46A 2GVEA 1A4MA 1ZQ5A 4OGZA 1US3A 1MZHA 2YW4A 4P7QA 1BYBA 3MU7A 3ALGA 1KQYA 3U5YA 4DELA 2DSUA 2H3BA 3ZYZA 2V82A 4X2PA 4TX8A 2G3IA 2E8ZA 3URNA 2OLSA 1HT6A 3Q2DA 2C1IA 3K4DA 4S3GA 3TE9A 3VVGA 1X7FA 3FAWA 2YR1A 1K1DA 5REQB 5FEPA 4LALA 4KEZA 4O14A 1H7OA 4A6GA 3LV5A 1SZNA 4NUWA 3NZPA 1IF2A 5FJJA 4AIOA 1Q7MA 1U1HA 1M01A 5XINA 5C71A 3CUXA 2ZDSA 4DXVA 2V3GA 5DBTA 4I9MA 3ATYA 3KP0A 1NWSA 3LTPA 4NJGA 4UTJA 2ACRA 1FWWA 2YA1A 3N4AA 3WEOA 2BVWA 4GBDA 1ZJAA 5C7VA 4UTIA 5GPRA 3SZ8A 3UESA 4Y9PA 3WDPP 3K4AA 1JRBA 1B54A 4D6HA 4UQCA 3WL0A 3AUOA 1UKSA 1KWGA 1UZ1A 3W86A 4B3LA 4ZSTA 1XLIA 3DHUA 1XH1A 4O0QA 1JUKA 3W1RA 4X3ZA 1REQB 1WDPA 3OG3A 2A2IA 1VQTA 1QWGA 3P81A 2I7GA 3DI0A 1Q63A 3MI3A 2R82A 2DZXA 2Y8KA 3UCCA 1EC8A 3DFOA 4LF1A 2CZDA 3AALA 1RQHA 3HGOA 2E09A 2WMHA 3SBFA 1JNEA 1E3ZA 3VKJA 3FXYA 4CD5A 5FCZA 1A53A 3G1RA 1E71M 4PTVA 3ZR6A 3KL3A 3RLVA 1N8FA 2DSVA 2C1HA 3LCXA 1KD0A 3UGRA 5JIPA 4BCEA 4NASA 4CNNA 3TXZA 3A6OA 3S4TA 3GTHA 2GDUA 4A3QA 7A3HA 5IDIA 2EPKX 2J6XA 3AIEA 2BOFX 1W91A 4UR9A 3S2LA 3VMOA 3WX7A 4EPEC 3LDVA 2HVMA 3KBSA 3P0XA 5CH9A 5AVNA 3LXCA 2G3JA 3VOGA 3ZMRA 1TVNA 3JUGA 4HB7A 5AZ1A 3MB9A 3VCNA 2H90A 1C8QA 2Z26A 3GXMA 4C5YA 4HHMA 5DCBA 1J0KA 5CSYA 3GS6A 1GKQA 4KWOA 3EWUA 3BJTA 4AMCA 1RD5A 3VNIA 1FRBA 5G2HA 3LLDA 1QBAA 3LK6A 2JALA 4L1GA 1IIHA 1QTWA 4M3PA 1YDYA 4QLJA 3ARQA 3PTMA 3JS3A 1OC6A 1WAWA 2ACUA 2DT2A 2DZWA 2BSLA 3HG5A 3QF0A 4S3BA 1MI3A 3VIMA 3W7PA 1XV8A 3TYBA 4BWLA 2L5HA 2NSXA 4AVNA 1J4EA 4NZ3A 4JTCA 3NXLA 2NQHA 1W9UA 3PUEA 5K3VA 5J5DA 4LSBA 4XAPA 1X8FA 3HMJG 2DORA 4YMZA 4NG3A 4J3TA 4L5ZA 4R33A 1JDAA 3PJTA 1H5VA 1G67A 3NSNA 2XG9A 5A6LA 4GLEA 1XRVA 4JS3A 1GHSA 3GNXA 1DJXA 1TV3A 1R3VA 1G7VA 3W7JA 1OFDA 2Q8ZA 1VP5A 2E1DA 4Y8EA 3H12A 1I45A 1EGMA 8TIMA 2GGEA 1EYWA 6TAAA 4C1NA 4IZGA 4AIUA 3BW3A 1VYSX 3S6OA 3LNMA 2Y4SA 1OGSA 3P6LA 2F7FA 4LPCA 3KRSA 2ATMA 2DVXA 1MZRA 4GIEA 1VLWA 4S3JA 5CAHA 3BCJA 1U30A 4H01A 4LB3A 4O53A 3OIHA 1XW8A 1WAUA 4YTSA 1GJWA 3ID7A 3WFAA 3ISIX 4DNMA 2YZRA 4IIFA 4HCHA 2ZKMX 4OU1A 2D2HA 3WG6A 2HROA 3ARRA 1JR1A 3LBCA 1DWAM 4PRRA 3C0QA 4LUJA 3KBVA 4N6FA 2B7PA 1UW9A 4A2SA 2Y62A 5FI8A 4NX0A 7TIMA 4B90A 3MUZ1 4KT2A 1SO3A 1UUMA 4JTJA 3S5NA 3PFRA 3W2JA 1H7XA 1HKJA 1J5TA 1F6YA 4AC1X 3H26A 2ZFAA 4LYKA 3OODA 1R2TA 1LROA 3A3HA 2GUUA 1GOMA 1LOLA 4LAOA 2VI0A 4LANA 1XJBA 4IUGA 3TOPA 2CETA 4GNJA 1CX9A 3TK7A 4UTKA 1KXHA 3WMLA 4TX9A 3LQGA 2GGGA 5D09A 3U3HA 2XWDA 4KESA 4XO6A 4JTKA 1J5SA 4Y90A 1H1YA 1P0BA 1B4EA 3UCDA 1DXEA 4J3WA 1OX6A 3U4FA 1UROA 4WF7A 3WUGA 2VQTA 1DJYA 2UY2A 2IKGA 1YYAA 5HMFA 2ONEA 2WZMA 2X1SA 3H2FA 1HTIA 3V0SA 1HJSA 3HQ1A 3UY7A 4IP4A 3E2QA 5M03A 2VOMA 2RDWA 3IGHX 3KL0A 4GBUA 1R47A 4U31A 4EACA 2Q3RA 1NEYA 1OFEA 3MMDA 3L66A 3DC0A 5A8GA 1XFBA 2ZXBA 3BOLA 3WFZA 2VEKA 3TTYA 4Q8UA 3GFZA 2XH4A 1VLIA 2WMIA 2ZUVA 2F6KA 2J88A 4G56A 1ZHAA 1EO7A 2D0HA 2VENA 2PDFA 3M0KA 3NURA 4JY8A 1E6SM 2Y24A 3PZQA 3K2GA 1PXGA 3M0HA 3GIPA 3R0KA 4RUBA 1UMYA 2VR4A 3W7HA 4AX7A 4JX6A 5FACA 1AD4A 3AHXA 2VC6A 5AZ0A 3QFWA 1LZOA 1RCOB 4GA8A 2V6AA 1XDLA 5D03A 2VC5A 3SB0A 1Q45A 4Z0JA 4CD6A 4O17A 2QULA 3SSJA 4QHRA 3STFA 3WDJA 3CYVA 3C2EA 4MGGA 1AJZA 4DYKA 1OZQA 1LRNA 4AYGA 2HNHA 2VQUA 5K9DA 4KFPA 2AOSA 1ISVA 2A3EA 2E28A 4MJMA 1KTBA 3URQA 2ZX6A 1JYVA 3NR0A 4PODA 4FNPA 3S2NA 3QSRA 1QATA 3JRKA 2PDBA 3CB8A 3M16A 3N3MA 4JQ4A 4JKLA 5AC6A 4WGHA 4PMRA 3RCNA 4Z2GA 3WDRA 1BEUA 2QMKA 3B9DA 3H2MA 4IIBA 2GJNA 1SJAA 4WRHA 5CZSA 1UR3M 1X39A 4O54A 4KQNA 7REQB 5FA5A 1M6JA 1K8XA 4CQCA 5LZLA 2FFCA 1M7XA 3MBDA 2PCEA 1JCNA 3VNZA 1UQZA 3QLDA 2XGZA 4UZSA 1J0IA 3MSYA 3Q37A 1P7TB 2YFOA 5E1QA 3NO3A 4ACZB 2C13A 4YIWA 3TUUA 4Q32A 2KAUC 2NV1A 3RK8A 2DFAA 1B3XA 3R11A 4J9JA 1K02A 2VFGA 1XICA 3WH7A 1K9DA 1H5YA 4GVHA 2FTWA 4CGTA 3I4KA 5U7SA 4W85A 3N04A 3VO0A 1P0EA 2H9AB 1FA2A 2J79A 4PA8A 4NHVA 3TTEA 1WXZA 1XSKA 3GHTA 4WSKA 2OWXA 3G1YA 1XBVA 2A3HA 8XIAA 4R7JA 1BXCA 4XAYA 1VFLA 1UD3A 4MHBA 2E5CA 4FNUA 4N0RA 1JNDA 4DEFA 4MSSA 2RJGA 2CLHA 4AF0A 1D2KA 3N12A 3R0DA 1N2VA 4W89A 4F48A 3C2RA 3QRHA 3FV9A 4US5A 1UWUA 3AU6A 1GVOA 1A47A 2V81A 2GWGA 3PHAA 2GVYA 1TTPA 4B5WA 1JFXA 1EYEA 2OO6A 3LQLA 2OELA 5DRIA 2VEMA 2WVUA 2YXOA 3C2YA 4QSHA 1M5WA 1M65A 3QM3A 2NWSA 4GQQA 2HMCA 3BLDA 1F4HA 2D0FA 4J35A 4IM4A 1CDGA 5LSMA 4JPGA 3OA5A 3A4JA 4Z1AA 2EG6A 2OB3A 1ECQA 2TMDA 4IL0A 2HVNA 3EEZA 3S42A 2BOGX 4XZLX 5FOOA 5KEZA 4AZ5A 3TIMA 5CLWA 3ITCA 3RPMA 4UUIA 2RGMA 1UR1A 4JGDA 2YB1A 4MG4A 3YPIA 2VGFA 1YADA 3CO8A 2JK2A 3WLRA 2NQ9A 1W1B1 4B16A 3BVJA 4F4RA 1VRDA 2F6XA 3VUSA 3SR7A 1A80A 1R9ZA 1N8IA 2WJZA 4XAFA 1PWLA 4DM2A 2G41A 4NZ5A 3LPOA 1LBFA 1SR9A 1F3EA 2ZX5A 3O6YX 3COTA 4QTGA 2X0HA 2WWCA 1OFOA 2OSXA 1XUZA 2WSKA 1ZLPA 3MWCA 4HK6A 1E3XA 2V2DA 2HPMA 3ZLFA 2VRKA 3DGRA 2PLJA 5AHFA 3N6QA 1HJQA 3WQGA 4EWJA 3CB3A 1S38A 2WYSA 3UQNA 1NQ6A 2B4GA 3R6IA 4DX3A 4MY9A 4PZVA 3PBMA 3W71A 1R87A 3DERA 2PF8A 2PPGA 3UETA 3VM5A 2W63A 4NAEA 4JQ2A 4KCVA 4WX2A 3GHRA 3N9KA 3N6HA 1DXIA 4WJEA 3PBUA 1JYNA 3ZT7A 3W38A 4HT3A 3NO1A 1VJSA 3FFSA 1KFEA 1Q66A 4JTGA 4XBKA 4JR5A 1PEZA 2PE4A 1C8YA 1EJTC 3QN3A 5I79A 4PMYA 2JIWA 3GW3A 3UXDA 1R38A 1QBBA 1VFFA 4C6MA 3PWGA 3AWOA 3EOSA 5I09A 1W5MA 1PKMA 3IGUA 3G1SA 4KFOA 4JYDA 1AW2A 2YKKA 2W92A 3GC2A 1R7AA 3H8AA 4BQ3A 2BASA 2PDHA 4JTAA 2VHLA 5AB3A 1MFVA 4M29A 1LBLA 1NSJA 5AKQA 1DQUA 1LDCA 1MXSA 4IJRA 1XIGA 2I57A 3EX2A 3W1XA 5HMEA 1ESWA 3D3AA 5A8NA 2ZIDA 2BY1A 1PX4A 4XZHA 4CCZA 1LCOA 4PMDA 3CNYA 3NQFA 4F40A 2F2HA 3EDJA 3N13A 3WMBA 3NUKA 2ACQA 2YDSA 1F3WA 2WC4A 2E9LA 5HOSA 3B4YA 3DEQA 1KM4A 3NQ2A 1E4MM 3BXWA 1H62A 3DXIA 4V15A 3O8AA 1UD6A 2VZSA 2YJQA 2Z2BA 1YQ2A 4HZMA 3W2KA 3TXVA 5A6AA 2HZGA 4QCEA 2RH9A 3IJ6A 4MUPA 3QYQA 1B3VA 1LOSA 5HNUA 4ZOBA 5AC4A 1WDWA 2YX0A 3BSHA 3CH9A 3T0DA 3ZWTA 1RR2A 4FLOA 3NDYA 1WBJA 4WDWA 5GNXA 1K6WA 1UPPA 1KBBA 4IPJA 5IXEA 1PZ3A 3HF3A 4PEKA 4JN7A 1XIBA 4KERA 1GTEA 1B5TA 1EX1A 3EWWA 3HQPA 4QM1A 4ZOEA 3GVWA 4LNYA 4AY1A 3HFTA 2VYOA 1J0YA 3UZZA 1EA9C 1ZY9A 4M1BA 1JZ2A 3ICJA 1B31A 3I6EA 1GYMA 3SM0A 2QNEA 3W7RA 2WSPA 3AXMA 3VGDA 2JEQA 3FKRA 1F2JA 4WY0A 4W7UA 4RNFA 1HW6A 5BWFA 3WJXA 1RVKA 2WKJA 1MW3A 4AVOA 3ZJ7A 1DIEA 3SUSA 5I06A 1O1HA 5AYXA 3NL5A 1F6PA 1HKMA 5FAGA 3TSBA 2GQ9A 5DXXA 3W9ZA 4NSBA 4KMQA 2D69A 1QXLA 4YTQA 3SCSA 3VIHA 3VIIA 3W4RA 3H2CA 1IHIA 1XD1A 2WVSA 3D47A 2V5JA 1F8MA 4FF7A 3FJNA 1VFUA 3SGUA 2F61A 2Y8UA 1FDJA 4O1FA 4KCUA 4O8RA 4QG9A 1VJIA 2P50A 3FXGA 3ZS4A 4R34A 4F0SA 2QF7A 3TN6A 2FYMA 3A64A 3ANYA 2DSZA 4I7WA 4H6RA 4Z2LA 4YNGA 3LM7A 3GSMA 2R6OA 3VDAA 2V5DA 2R14A 3VGGA 3ZJ8A 3BGGA 1I6NA 2WQPA 3F5KA 3RX3A 5GJNA 1N7KA 3OYZA 2Z27A 3N25A 1PSCA 4XAGA 2V63A 1W3TA 1VGAA 4LC6A 4PBFA 1ZSXA 3BAIA 3FSUA 1U5JA 1EJ7L 2WKLA 3UVIA 3RU8X 4LAUA 1KB3A 4NVTA 1Z41A 2IXVA 5K7JA 4LOCA 5J5RA 3NPUA 3TONA 4Z1DA 3AS2A 2FZDA 4E4UA 4V1YA 5I78A 1IXPA 4GUGA 1E1FA 4WSHA 2FB3A 1PJ9A 5EMUA 2NVCA 3AI0A 3NL2A 2DVUA 3ZQ9A 2HV5A 4DVOA 2W79A 3RRAA 3F4NA 4ML4A 1HVQA 3LTSA 3MZ2A 4MPKA 2POTA 1E1EA 3E5PA 3B4UA 4F0LA 3ITVA 1JF6A 4QG6A 2D20A 1K77A 3GBEA 4PMOA 1DTUA 2Z1WA 2FDSA 4PMZA 4XTDA 4TV6A 1VZWA 1R3QA 5FF0A 3SGZA 2XN1A 2CHOA 3MMTA 3VNKA 4QIUA 2AKMA 3N9RA 5IDZA 1NOFA 3KZPA 3B0VC 2PDMA 3DI1A 1BKHA 1JZ3A 1IGWA 3LM3A 4DJDA 3FS2A 3WBAA 1V79A 1PDZA 4I9JA 4OWGA 3RFAA 4UC5A 4LUYA 4LB4A 3DCPA 2A7RA 3W26A 2WVVB 2Y8VA 4MM1A 1BVNP 4AEOA 4MTVA 3LX9A 4Q4QA 5BMXA 3M0LA 2WSRA 4A3YA 2DZBA 3V18A 3BJFA 3W1LA 4G8TA 1OABA 3CS2A 3VE7A 4UFMA 4ATLA 1EGVA 1F8IA 3N2MA 4DJDD 5DMNA 3W74A 3GW0A 1K6AA 1W9XA 3CV1A 4JIHA 1ALDA 4IXXA 3GXNA 3W3OA 2YFNA 2X1UA 3KM8A 3L5LA 3ONBA 4IQJA 1E6NA 5HBFA 3RPTA 3PZUA 2ACSA 2PSNA 1Z3NA 1FDYA 4B2DA 2J7EA 2ICSA 3NYZA 2E8YA 1ICPA 3VD9A 3THAA 1KRMA 4HMEA 2GSJA 3VYLA 4PUNA 3GG8A 4QNEA 2PFHA 1PTAA 3SEPA 4HD5A 1GOIA 4QAWA 5A3HA 4MWAA 2J9YA 2PUZA 3TFXA 5FSDC 3AIVA 5KINA 1Q8JA 3A12A 1I8JA 3B3DA 2F9RA 1V7AA 2ZADA 5HQEA 2NQLA 3CPUA 3NQVA 5D4YA 2YL5A 1ADOA 2EXOA 4V1XA 1CW2A 3CH0A 4YTUA 3ANVA 2PURA 2ZVIA 4Q4OA 1YBQA 2VC9A 3V5FA 1UR9A 3AOFA 3EDKA 4ROQA 2V38A 3IJQA 3CIVA 1AH3A 2QF8A 1HL2A 1FCBA 4MNMA 1K9TA 4DO6A 4ZO8A 3UPWA 1XH2A 5EL1A 3GKFA 2A21A 8XIMA 1BAGA 1V3JA 2O7SA 3GDKA 3N18A 5BROA 4BWLC 5D9NA 1FCUA 1V51A 3LTYA 4AF0B 3KWSA 1L9WA 4MFDA 8A3HA 2E0PA 3UNTA 4HSOA 3GNDA 3OB8A 4EXQA 4OECA 4AISA 4BF7A 3M0IA 3SN4A 3VOHA 2ZUSA 1JPDX 3AIRA 4GO8A 3PVFA 3KCLA 2PDPA 3EXRA 1W56A 3M7SA 3DYPA 3SQMA 4G6CA 2W27A 3RYSA 3DX5A 1TZ7A 3ZSSA 3SY8A 1P4CA 4MAVA 3CK5A 3H2AA 5JVLA 1OFRA 4AVFA 1A5UA 3IJ8A 3MY9A 5GJPA 4FMVA 3CTTA 1GQJA 1YPIA 1D3GA