2XGBA

Crystal structure of barley beta-amylase complexed with 2,3- epoxypropyl-alpha-d-glucopyranoside
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
486
structure length
486
Chain Sequence
NVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 192
structure length 486
sequence length 486
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xgbA00
2X2YA 2YKKA 5DFAA 2WM0A 1NOWA 5ABHA 1TA3A 3MUZ1 4FLRA 3FW6A 3AIVA 2WMIA 1H09A 4M80A 2QPUA 3NUKA 3VMPA 2CEQA 3ARTA 3IAQA 1R8LA 1QNPA 3VDHA 1HIZA 2WANA 1CZ1A 1PZ3A 2VMFA 2YJQA 1C8XA 1E15A 4DM2A 1MWOA 3GXMA 4AZHA 2J75A 1JD7A 3L4WA 3CUIA 2XVPA 4ATLA 1EDTA 1WB0A 2VX7A 4HZ6A 2JALA 1UKOA 1E5NA 1PJ9A 4MTVA 1AQMA 5DMYA 2WB5A 1ECEA 1V03A 4JFUA 2IUZA 5C71A 4IISA 4A4AA 4Z2GA 2VZUA 3SCWA 2EJ1A 1UKQA 2YIHA 3A6OA 5A1AA 2J7CA 2G8ZA 4B9YA 1CGXA 4CVWA 4UFJA 1ZU8A 2BHZA 2VR4A 4GI8A 4PBGA 1QOXA 3K46A 4CVUA 5JIWA 3II1A 1DP0A 3CPUA 4LYPA 5I24A 3GYCA 5D9OA 4N0RA 3FNDA 4YHEA 3ECQA 3OLIA 2WMFA 4QP0A 2VZOA 3SEPA 4KGJA 3VIMA 1EH9A 1RD6A 1UD5A 2YLAA 2E9MA 3NIYA 4NSBA 3U5UA 3WMBA 1ZBKA 2PB1A 1VJZA 3ALFA 2ZOXA 1L8NA 4HZ7A 4QAWA 1V6VA 2DT1A 4JKKA 1Q6CA 1BYDA 3VIIA 4RE3A 4TUFA 4R27A 4JHOA 1NP2A 1TCMA 2F61A 3VOCA 3ZMRA 2ESCA 1UKTA 3GH7A 4LPCA 1BFNA 4E4PA 2W62A 1RH9A 1V3JA 1Y7VA 3AMDA 4NRSA 1J18A 1E73M 3PZMA 1LWHA 3PTKA 1RP9A 1CECA 1C90A 1EXPA 2YOCA 1JZ4A 1GCYA 2CKSA 3A47A 3AMLA 4OJYA 2A3CA 4NZCA 2WWDA 1TG7A 4D6EA 5AYBA 5D8WA 3WF4A 2XYLA 4PUEA 3G6LA 4Z2LA 1QHOA 1G1YA 4BZYA 2YL9A 2O9TA 2W4XA 3WDIA 1OIFA 1CGWA 3RJXA 4QLKA 1C3FA 4UTFA 4GO9A 4HP5A 1CXIA 3WFLA 2J47A 1R87A 4ATWA 2HVMA 3VKKA 4WJXA 3NSMA 3VGGA 3CBWA 4AD3A 1W32A 4CUCA 1QI0A 1V6WA 1WCGA 2FH6A 3S6TA 4UQBA 4AEFA 3BAYA 2GVYA 5M17A 1JG9A 1W9VA 3AFBA 4F8XA 4J3VA 3N18A 5A6BD 1P6WA 4M81A 2DT0A 1VFOA 4CU6A 3A4XA 4H41A 5I0DA 1V6YA 3KZSA 5D9MA 2OWCA 2ZX6A 3WUEA 1BG9A 4CD6A 3GXIA 3UERA 4LYQA 4BF7A 2UY3A 2V3GA 5HPCA 2GJXB 2BV9A 3OLEA 3OGRA 4MNMA 3WEMA 3VGFA 1HX0A 1WZMA 4ZXOA 1QI2A 1TZ7A 2D3LA 3ZM8A 5KZ6A 2PBOA 3ARSA 2MANA 4W89A 3NSNA 4ATDA 3BAKA 3CHDA 5E09A 1K9DA 1UWTA 5D4YA 4OUEA 4OIFA 4D71A 2FHBA 4UNIA 1BSIA 1CPUA 4UZSA 1BAGA 1ISVA 5A8MA 4GIAA 3WNLA 4HPGA 1JYNA 1XC6A 1A47A 1JNDA 4JHZA 2V3DA 5E70A 1E1FA 3WD1A 1WDSA 1ZJBA 3KL0A 3WY1A 2XVNA 5CXPA 4ACZB 4D6CA 3WQ8A 4CKQA 1XYZA 3FAXA 4MB1A 3ZT7A 5A8OA 3ARQA 1KBBA 1K9FA 2QF8A 4PTVA 4W86A 3RDKA 4WKHA 1V08A 3HJEA 1XSKA 3U5YA 3ARVA 1H11A 2DGAA 4H8VA 4BQ3A 2ZX7A 2D0HA 2G41A 4GI9A 1HT6A 2WYSA 1PEZA 4U5IA 3WH8A 3AS0A 1VEPA 1LL7A 3QGVA 1CDGA 1OWQA 1SMDA 3I3DA 4CD4A 4H04A 3RM4A 2WPGA 3PZVA 2VZTA 5EMYA 2EPNA 4UOQA 1ITCA 1V0KA 3MSDA 3SCPA 4D6GA 4P7NA 1W9DM 1C8QA 3MV01 3BC9A 1GOQA 4NRRA 2DT2A 1WKYA 3PHAA 5EB8A 4D72A 2CPUA 2XWDA 1SMAA 1FH8A 2YBTA 2XG9A 3W27A 5C8BB 4XV0A 4WSKA 5A69A 4GI6A 2BY0A 4UR9A 1CXEA 1VJSA 3DYPA 3OLGA 1JFHA 2WBGA 1I1XA 3U7BA 4GKLA 3ZIZA 5I5RA 2ZWYA 1V0NA 4P7OA 3PN8A 1UZ1A 1JD9A 2V5CA 3ZJKA 3LMYA 3KWXA 2ZUNA 1OSEA 1MW2A 1W3HA 5ABGA 3WQ6A 2CCRA 5IHRA 1UYQA 3AIEA 3GBDA 4PMNA 3WENA 2Y4SA 2VX6A 3CIVA 4D1IA 1TFVA 3SCTA 3WF1A 4EKJA 3WD2A 2OYMA 1HKJA 4BQ4A 3L4TA 2DIEA 1HN1A 4N42A 1JXJA 5A6BA 3AHYA 1JI2A 1JYXA 2QPSA 5A8NA 4UFIA 2ZX9A 3CZ8A 4MJ4A 1W3LA 4OOZA 2CXGA 1QNOA 4DUVA 2PWHA 1IV8A 4OKDA 2XIBA 1OM0A 3VX0A 4UQDA 5FD0A 2Z1SA 4PTWA 3CMGA 3U7VA 5A95A 4F9DA 3K8KA 3CMJA 5BYWA 3CUHA 1W9PA 3N9KA 2DDXA 1KGXA 4HMEA 1GQLA 1WZLA 2ZUWA 3D3AA 4JKMA 1VIWA 4MAVA 5E6ZA 2TAAA 4U33A 1E43A 4JL1A 1UR2A 3AXIA 3ARUA 2EPKX 1VF8A 3IJ8A 1FFRA 2EO7A 2WVTA 5D9PA 3EDJA 1UG6A 3SUWA 3SCQA 4W8BA 5CSYA 1RP8A 2JFEX 3PZNA 4M1RA 5CG0A 4YHGA 2RGLA 3K8MA 2NSXA 3CHFA 2A3HA 1UWIA 3OIHA 4S3KA 2VL4A 1JYWA 2F8QA 1D3CA 3F5KA 5HNNA 4LXFA 5CJ5A 4WF7A 3WUBA 4MDPA 3PZ9A 1HP5A 4X0VA 3CO4A 3BLKA 3W29A 3LPGA 1DWIM 1NWRA 1V6XA 2X09A 4C7DA 4BQ5A 4TXEA 1UQZA 4X0NA 3T08A 4Q22A 4DUWA 4FMVA 3N11A 3GM8A 1E4IA 2G3NA 3VD9A 2WAGA 2OWWA 3WUFA 3TTYA 5GQBA 3DYMA 2QLYA 4X9YA 1TUXA 3VD5A 2GUYA 1DHKA 3GTNA 1QHPA 4W8AA 7TAAA 1W91A 4JFTA 1BYAA 2WMHA 3VGEA 3EMZA 2FHFA 4CU8A 4D1JA 3U57A 5I3DA 2J62A 4AIOA 4PMVA 4FK9A 1BPLB 2AMGA 2WXDM 3WQVA 1KGUA 2ZX5A 3AOFA 2BY3A 2E9BA 1UWRA 3AIUA 5A3HA 4MB5A 2WVSA 4J3WA 2E8YA 5FCZA 1J0YA 5DEZA 9CGTA 1KQYA 2ZE0A 2YL5A 2D24A 2Y24A 3WEOA 2JEQA 4TTUA 4ACYA 4JFSA 4UFKA 4EAMA 4UCFA 1ZJAA 2WVVA 2J7HA 1JXKA 3B9EA 1A3HA 4A3HA 3WNNA 3T0AA 4HU8A 2VJXA 1ODUA 2PF0A 2XVKA 1KBKA 1BGAA 1XCXA 3VIOA 1B2YA 1PX8A 3AHZA 1EOKA 3D5HA 4KGLA 1E3XA 5ABEA 1E3ZA 3W37A 2J79A 3RCNA 4GPNA 3CUGA 2CBJA 3M6DA 3VIPA 4DUXA 3PTQA 3MUAA 3RO8A 1H2JA 4RE2A 3WF3A 3L2LA 2J7FA 2VZVA 3SUUA 3QR3A 1XH2A 1ISZA 4DWSD 5BRPA 4AWEA 3VDBA 3CUJA 1HL9A 1NWSA 4PMXA 4TVDA 4FF5A 3MMUA 1HJWA 4MB3A 2CBIA 3F5JA 1N82A 4W7VA 4FLOA 2GFTA 1JZ8A 3VM5A 2G3IA 3AHXA 3L4XA 1Q6GA 3RM9A 4CD8A 3HU7A 2VX5A 3THDA 3SCSA 5M03A 4ML4A 4AYSA 3TOPA 2O9PA 3K4AA 4PN2A 1E71M 3VIGA 5CGMA 1HF6A 1KFWA 2D1ZA 4ZXLA 3B9DA 3WBAA 1E6NA 2WKLA 1E1EA 2WMKA 1B31A 1E56A 2WKGA 2VX4A 1UHVA 3ARRA 2OLHA 4AZCB 5EFFA 3M7SA 1PAMA 1KWGA 1PZ2A 1EDQA 3EMQA 5DF0A 2DH3A 1FHDA 2PWDA 3T09A 2OSWA 3I3BA 3POCA 4AZ7A 1OINA 3WNKA 1GOKA 4UQCA 3AYSA 4CD5A 1NM9A 4AIUA 4U2ZA 5BROA 1E6ZA 1UKSA 1V6UA 2CERA 3AICA 3LPFA 3THCA 3T0BA 1H1NA 3QHNA 3RMEA 4PMOA 2J78A 1QNRA 2W92A 4LQ1A 3BAWA 1UR0A 4Z2HA 5CLTA 1C92A 3K1DA 2ZIDA 1R7OA 4PCTA 2DT3A 4CD7A 1OGBA 3EYPA 2XVLA 1H49A 1ZS2A 2XTKA 4XUYA 3FHAA 5CPTA 3E1F1 1O6IA 1VEOA 4MJ2A 4AEEA 1YHTA 4LX4A 1AMYA 3WQ4A 4B3LA 1CBGA 1K9TA 4TVUA 2PWGA 1EA9C 1WP6A 3K4DA 4ZEPA 4TOQA 2VRKA 1BTCA 2W63A 3PZGA 4V2XA 4IPNB 4M82A 3QHMA 1XSIA 2E8ZA 1V02E 5HOSA 3J7HA 4MDOA 3VO0A 2DSWA 4JAWA 1NWUA 4AIEA 1DWJM 3BCFA 2FGLA 1OD8A 7A3HA 1FH9A 3NYDA 1E70M 3SIMA 4Z2IA 2XWEA 4MAZA 2X8RA 2XFYA 1XGZA 2VCAA 2G3MA 3AHTA 3W53A 4CCDA 2D22A 1V02A 1US2A 3WDJA 1B3XA 2QMJA 1WO2A 2BXZA 1KB3A 1WDPA 3VNYA 3WMSA 3AIRA 1JAKA 3EDEA 3FXYA 3CH9A 1W1PA 4AZBA 4R5EA 2GJPA 1J0HA 2J8GA 4CN6A 2OWXA 1PPIA 4D6HA 3GH4A 5FOOA 4HOXA 2YA1A 1UR8A 3WQWA 1GZJA 4W8LA 4PCSA 1W1YA 3ZR6A 4A3YA 1UH2A 3UG3A 4JCLA 1BF2A 3RILA 3L4UA 2VURA 3AZRA 3VIFA 1E4MM 2OSYA 4AD4A 4F79A 2G4FA 2VZSA 1WZAA 5D9NA 3AROA 4J7RA 1OT1A 1IZJA 2FH8A 1TVNA 4DWSA 1XD1A 1E0XA 1E6QM 3T2QA 1JL8A 2X0YA 3BGAA 4WKFA 3CGTA 2JF7A 5GNXA 3TONA 1V0MA 2QHAA 1Q6DA 3UESA 1HVQA 4AMCA 5LA1A 1Q6FA 3QOKA 2DSZA 1F4HA 4GQQA 4MNLA 1BYBA 2D3NA 4PYSA 5EBAA 1W2PA 4NF7A 3BAXA 4PSPA 4HOZA 3AQUA 2J77A 1UD8A 3ARYA 1HJVA 1QI4A 2WVUA 3NSXA 1W2VA 3OG2A 3ZR5A 1FH7A 3ZSSA 1MYRA 4PMQA 5DT7A 4JL2A 1UD6A 4GO8A 2YDQA 2GSJA 4Z2KA 1X6NA 1CENA 5FL0A 3A3HA 1QI3A 4BA0A 4M56A 2XPKA 2GK1B 1G0CA 4PUDA 4GQRA 1NP0A 1ITXA 3DC0A 1FHLA 1LF1A 5CSUA 4WK9A 2C7FA 4EE9A 2D0GA 4QCFA 1KCLA 4KH2A 5IFTA 2PWFA 3TA9A 3W26A 4OBSA 1U2YA 1VFUA 4PSRA 1JZ5A 1XYFA 3OGVA 3WUGA 3N12A 1E55A 1J0JA 4CU7A 1ZBCA 3GNOA 1Q4NX 2ZUTA 4V28A 3N04A 1MW0A 1XSJA 1U33A 2PWEA 3W6LA 4MNJA 1WAWA 5AC5A 1MFVA 3L4ZA 5LYRA 2BVDA 4AZIA 5I23A 1QNSA 5FL1A 1C8YA 1J11A 1HXJA 1JZ3A 1CNVA 1BVZA 2BHYA 4J3TA 1E72M 4IUGA 5CPSA 3WQ5A 1LWJA 6CGTA 2D2OA 2V5DA 1S46A 5IXEA 3DYOA 1BYCA 1UH4A 1HKIA 1UA3A 1UR1A 2XM1A 3M07A 2PC8A 1KXQA 1GOMA 1GQJA 4XX6A 2YDRA 2EQDA 1UUQA 3ARZA 4P8WA 1EHNA 3TTSA 3OB8A 2VNCA 4UOZA 5F7UA 3EDDA 3WIJA 4AY1A 2XJ7A 1TMQA 4QFUA 2WWCA 1E9LA 1JF5A 1VENA 1HVXA 1J12A 5JIPA 1CIUA 2UWFA 3CZLA 3SCNA 5JBEA 2J7DA 1X6LA 2E3ZA 4P7RA 4CCEA 1W9XA 1LL4A 1WDRA 3GNPA 1B30A 1UQYA 1W9BM 1XD0A 1KR0A 1B9ZA 3KEHA 3WNOA 4IPLA 3B9AA 1ISWA 1G94A 1WPCA 5A6LA 2JIWA 5ABFB 4D6JA 3OZOA 2A3AA 2VRQA 6TAAA 1VFFA 4GZJA 1H4PA 4ACZA 5M5DA 1GVIA 1YQ2A 4H8UA 2WLYA 4RE4A 4W5UA 3L2MA 5BXPA 1KQZA 1GJWA 2GDUA 2BY1A 5A2AA 3GXDA 3IJ9A 3MV11 4AZGA 2V3FA 3EDFA 2WCGA 3VD7A 4W5ZA 3TTOA 3W38A 3ZJ7A 4P8XA 3VIKA 1TA3B 1WZKA 4URIA 2CIPA 2WMIB 4EANA 1KXTA 4AD0A 1EOMA 1XCWA 4W85A 4CGTA 3FAWA 1C93A 3N17A 3SUVA 2J74A 1JDDA 4L4PA 3MMDA 1J0ZA 4QCEA 2CESA 2YL6A 2J7BA 2BVTA 2J4GA 5A2BA 1CGUA 3SCRA 1E4NA 2XSAA 4U3AA 1O7AA 1KWKA 1JF6A 2VQUA 2O92A 3ALGA 2WW5A 4J28A 2O9OA 3VILA 2CNCA 5JBFA 4QLJA 2UY4A 1B3VA 3VGBA 2Z1KA 1M03A 1CLVA 3ARWA 1FP8A 1V0LA 1QPKA 2ZXDA 2OYLA 1V3LA 2Y8KA 1WE5A 2W67A 2VOTA 4HMCA 5D8ZA 3FY1A 1C7TA 2WZHA 3IJ7A 3T2PA 5BXRA 1EQCA 3F4VA 3GBEA 2YLLA 3N13A 1KR1A 4H7VA 3NDYA 2AAAA 1EO7A 3HN3A 1HP4A 3WDPP 3G6MA 1E6RA 4QLLA 5A6MA 3RJYA 4TTGA 1OT2A 2GDVA 4P8UA 4ZFMA 5A8PA 5I77A 3CZEA 5A6JA 3ZQ9A 2BFGA 3WKZA 1GVYA 1UD2A 1KGWA 1DWHM 2EBNA 3GZAA 3CHEA 3UCQA 4UQEA 1XHGA 1G01A 1VBRA 1XH1A 1V3IA 4TX6A 4PMUA 4UOJA 4GZEA 1E4LA 3WH6A 2EPMX 4AISA 1IT0A 1QBBA 4WIWA 1MQQA 1ZL1A 1XV8A 1GHSA 1H0GA 6A3HA 3AZTA 1W9UA 3UR8A 1B1YA 1UR9A 3L4YA 1QHZA 2CBUA 4ZENA 4Z2JA 3PZUA 3VMNA 2JF6A 1QNQA 2VCCA 4HA1A 2IXVA 3FHQA 2WSKA 4BS0A 1JZ7A 1PX3A 2YBUA 1VBUA 2OYKA 4UFHA 1E6PA 4W87A 5ECUA 4U3CA 2Y2WA 2C8NA 1GQIA 3BH4A 1NOFA 3LPOA 2NT1A 4J3SA 5AC4A 2QMKA 1G5AA 1GNXA 2J7EA 4E8CA 2WZEA 1HNYA 1VFMA 4B9ZA 4J3UA 1D7FA 2FHCA 3BAIA 3NCOA 4UQ9A 1G9HA 2PBGA 1PIGA 3EBVA 1MQPA 2EPOA 4PTMA 5M3WA 1EO5A 4M29A 3MMWA 5TD4A 2X05A 1HL8A 5A8QA 2EXOA 1FA2A 4PMZA 3VM7A 3RPMA 3UEQA 1R85A 4PMRA 1NH6A 2Y5EA 1W1TA 4ZE5A 3O2LA 4U31A 1AQHA 2CITA 4KRTA 4P8VA 3AI0A 2WC3A 2YDSA 2V3EA 1E6XM 2B31A 4MADA 1NQ6A 3CHCA 2BHUA 2Q8XA 4D6IA 3NDZA 7CGTA 3BSGA 3GNRA 2G3JA 2V38A 4W88A 1EGZA 1FP9A 2ZUVA 3CZJA 5KEZA 3AZSA 3MUIA 1E6SM 3AMCA 5DT5A 1QW8A 3KL3A 1GQKA 1MW1A 4WSJA 3SUSA 3BLPX 2CHOA 2VC9A 4DWSB 2NT0A 1JI1A 1VEMA 4QDMA 1ODZA 5GNZA 3MANA 2ZICA 5GPRA 4OOUA 1BQCA 1I75A 1GPFA 3IANA 1UOKA 3EMCA 4GINA 1LL6A 1DWAM 1JYVA 2IXUA 3SCUA 8CGTA 3WNPA 3JUGA 8A3HA 1D2KA 5IFPA 4TX8A 4KMQA 1ZBWA 3N15A 2ZX8A 1MVYA 1MW3A 3POHA 2WMGA 1UA7A 3ARPA 3AIWA 1EHAA 4V27A 3WL1A 4W7UA 2WC4A 1E0VA 3VX1A 3WFZA 2VTFA 3AIQA 3PBGA 1R7AA 2DPEA 1GUVA 2WZIA 4EK7A 4D6FA 2XM2A 2X0HA 4P7LA 1JDCA 1C91A 4JFWA 4GZIA 4J3XA 1ZBVA 1H3GA 3A4AA 1VAHA 4W7WA 3IAPA 2VCBA 3NJ3A 3ZJ6A 4DWSC 1CGVA 1QVBA 3WDRA 2WCAA 3MKKA 2CKRA 3OLDA 3VMOA 1NOUA 4XB3A 3SURA 2DSKA 2ZWZA 3VINA 2VUYA 3VVGA 3VGDA 2ZXQA 2O9RA 4JCMA 1BHGA 5IHSA 4JKLA 4S3JA 5AYIA 3WF0A 4GXPA 5HBFA 1V3HA 1UWUA 3CZKA 1BG4A 2W5FA 3DHUA 4H8HA 4JIEA 2DEPA 5IDIA 1UR4A 2OSXA 3N1AA 3UR7A 4B16A 4LGXA 2JE8A 3BMWA 3W81A 4AD1A 1HKMA 1M7XA 2WHMA 4D6DA 1CXFA 1M04A 1CGTA 1MFUA 4BQ2A 3KE0A 1SYTA 3VIHA 5LA0A 2A3EA 1GW1A 1U30A 4MPKA 1L0PA 3WH5A 3KL5A 3UG4A 1OD0A 3GXFA 1VRXA 3WL0A 3LPPA 3AXHA 1J01A 1CWYA 3BCDA 4AZCA 4CCCA 3VIJA 5HXMA 2XGBA 2WK2A 3CUFA 1UKPA 3L4VA 2AOSA 5I78A 2XHYA 1UD3A 4AD2A 2BS9A 5EFDA 3GH5A 2EPLX 1HJQA 1X1NA 2E40A 2PI6A 2WBKA 3AHVA 3UETA 3BAJA 3VUPA 1JAEA 4AZ5A 1GJUA 1JZ6A 3PZTA 5LA2A 2UY5A 3VPLA 3AMKA 3WDQA 3MUY1 4HA4A 1UWQA 2D0FA 1JFXA 2W91A 4E8DA 3RM8A 1CXLA 4WLCA 1F4AA 2XUCA 1K6AA 4L4OA 1GOIA 2C0HA 2WHJA 4KWUA 4PEEA 3T0DA 4UFMA 3WBEA 3TTQA 2VI0A 4UQAA 3SUTA 1V3KA 3WD4A 1RPKA 1CXHA 2EEXA 2WMJA 3DECA 1DWFM 1UWSA 2VVSA 2VO5A 3WSUA 3WMCA 2WCSA 3VTRA 2D23A 2HISA 2QV4A 4HOWA 5FIPA 3WH9A 2CHNA 4UZUA 3VGHA 4JFVA 1BGGA 3BXWA 4B3KA 1EDGA 2VVNA 4AXNA 3MU7A 4ZE4A 1OIMA 2DSUA 5A6KA 3S2CA 5E9AA 3W6MA 3ARXA 1SFSA 5C70A 4TVCA 3VU2A 2YA2A 1OCQA 1E40A 2X1IA 3B8SA 2XVGA 1B3ZA 5A6SA 2A3BA 2WLZA 3DHPA 3SCVA 1NWTA 3I3EA 3O6AA 1CLXA 2J25A 1GOWA 2ZUMA 2JEPA 4AC1X 5GNYA 3SCOA 2XSBA 2DSVA 2WHLA 2XGIA 1WNOA 4PRWA 1BVNP 3VD4A 1EIBA 1TVPA 2VQTA 4HA3A 3CLWA 1LJYA 3W0KA 1CYGA 3AYRA 1CXKA 5I79A 2E4TA 3WNMA 1UD4A 2BXYA 1LG2A 3WD3A 3QOMA 4C7FA 4XZWA 1M53A 1XRVA 4H2CA 4DM1A 3GDBA 4HPHA 3W24A 1CGYA 1HJXA 2CETA 4JZ5A 1SR0A 1M01A 1J10A 2GJXA 4AW7A 1GONA 5E0FA 3AJ7A 1FOBA 1B3WA 4HU0A 1US3A 1OB0A 1TE1A 3ZSTA 1C7SA 2F2HA 1JGIA 5CZKA 1AQ0A 3WN6A 1VB9A 3MO4A 1Z32X 5HDRA 2E0PA 1PX4A 4OBRA 4M24A 4NI3A 4MB4A 1OGSA 1HKKA 4PTXA 5BCAA 1KCKA 5FKYA 4F66A 1CTNA 5BWFA 1JNEA 3OZPA 1GHRA 1CEOA 2E9LA 4K68A 3A4WA 1W3JA 1BLIA 5DO8A 1I1WA 1J0IA 3MS8A 4P7QA 1XH0A 2DIJA 4FLQA 4W84A 2VR5A 2CYGA 1W3KA 2XFRA 1AVAA 1ISXA 2WVVB 3AISA 3PZOA 3ZT6A 5E6YA 1JZ2A 4HMDA 2W61A 3CZGA 4Y7EA 3PZQA 3UG5A 3VD3A 4UFLA 1OGGA 3O9NA 4YPJA 4U2YA 1H41A 3W82A 5I6SA 1B90A 3TP4A 2GK1A 2RGMA 4AZ6A 4YN5A 2NW0A 4CN1A 1LQ0A 4U5KA 2J7GA 1V3MA 5A6AA 1KXVA 3ZT5A 2ZUSA 1QI5A 2FDMA 2UY2A 1GOOA 1FFQA 1KXHA 5BXSA 3VNZA 3QHOA 2WC7A 3WD0A 4KRUA 1E0WA 2CBVA 3WF2A 1JDAA 4PMYA 2XIIA 3K8LA 3AS3A 5HPOA 1LG1A 5BRQA 4HZ8A 5A2CA 5CQ1A 3ZJ8A 2W66A 1DWGM 1MQRA 1TR1A 1HJUA 4OZOA 1ZB5A 2BNJA 2DQXA 3CTTA 5CPQA 4MNKA 3FN9A 4WKAA 1H0IA 3AMGA 4B15A 2DH2A 3AS1A 4XZBA 2VRJA 3APGA 2ZXBA 1QBAA 4BCEA 1ESWA 1PIFA 1OBAA 2ZUUA 2YA0A 5BXTA 5AY7A 1EQPA 1DTUA 1R86A 2ZXAA 2YL8A 3WH7A 1H5VA 4C7GA 1NARA 3EDKA 1LLOA 2XFFA 4J27A 4F9JA 4AD5A 2BVYA 3WDHA 2JIEA 2D20A 1IZKA 1J0KA 3BMVA 4E2OA 5CGTA 3WELA 5CLWA 5JBDA 2BY2A 4FLSA 1UZ4A 1MXGA 4HTYA 3ZO9A 5JUVA 4PMDA 2FGZA 3W28A 1Q6EA 1GORA 3RIKA 2VT0A 4Q7NA 1HJSA 3PZIA 3OGSA 3VDAA 1J9YA 3OA5A 3IK2A 3W4RA 1W1VA 4IM4A 3ZOAA 1UH3A 1B3YA 1E5JA 3VDCA 3T2OA 1QW9A 3F5LA 3W25A 3AXXA 2WNWA 5A94A 5ABFA 4W93A 1B0IA 3AS2A 5I2UA 3M46A 2WSPA 3OBAA 1ISYA 5E0CA 3PTMA 1K9EA 3AIBA 4LYRA 1MXDA 2GJRA 2WHKA 1WDQA 2Y8VA 2J8FA 1JIBA 4CN4A 1PBGA 3BSHA 1DEDA 4RL3A 3HMCA 3MSGA 3WEZA 4M8UA
chains in the Genus database with same CATH superfamily
2YKKA 3QFWA 3WQFA 4GY1A 2R8WA 5DMLA 3OBEA 1FCBA 4FLRA 3FW6A 1H09A 1QNVA 2XN2A 2O56A 2CEQA 1K77A 3IAQA 3BGJA 1QNPA 3VDHA 4O4VA 1EZWA 4AWTA 2WANA 3BQ5A 2O55A 3ITXA 2QS8A 2PS2A 2QCDB 1VFLA 4NNCA 3GXMA 2J75A 3L4WA 3ME3A 3GXTA 4ATLA 3ONBA 5CSSA 2VX7A 2JALA 4ROQA 4DWDA 2ZZ6A 3Q65A 2WQPA 2PZNA 5I02A 4FIQA 3PBYA 4NG3A 1ECEA 1V03A 3G0XA 4JFUA 4ZCWA 5C71A 4IISA 3VABA 4A4AA 4JIQA 3W7DA 2BXVA 3T44A 3TEVA 2EJ1A 1XIMA 4O18A 1EX1A 4K2SA 3D0CA 1GW9A 4B9YA 2QAPA 4UFJA 3GC2A 1CI1A 4UXDA 1V79A 1OHLA 3II1A 1DP0A 3CPUA 3N2TA 2FVMA 2RKXA 4MKSA 1P0NA 1V77A 3SEPA 4KGJA 3ABOA 3VIMA 4N2YA 1O5RA 1DJNA 1KBLA 1L8PA 4JEJA 2A3LA 1ZBKA 1VJZA 4GIYA 2Z0IA 3ALFA 3IJDA 4C5YA 4A29A 3A64A 4TUFA 1QOQA 3CPRA 2PU0A 3NQGA 4LPCA 1IZCA 1TPEA 2YR1A 2HBXA 3D47A 2W62A 3MC5A 4NRSA 4CNTA 1OX4B 2GGEA 1LWHA 1RP9A 1EP3A 2E09A 7ODCA 5T8GA 3GW0A 3MP4A 2GGIA 3AMLA 3B0YA 5D30A 1XWYA 3CEPA 4DJDA 4QE1A 4NZCA 1RK6A 3WF4A 4Z2LA 2YL9A 3SRDA 2W4XA 2A6NA 4RPQA 5MKGA 1OIFA 5BU9A 1CGWA 2X1SA 4UTFA 4NZ4A 4NY2A 3WFLA 4ATWA 3VKKA 4EPBC 1HGYA 3Q67A 3CBWA 1W8GA 1X1ZA 4AD3A 4CUCA 1V6WA 3GG1A 4R3UA 4UQBA 1YXYA 3BG5A 4YCOA 2GVYA 4NZ1A 3I68A 1KRCC 1CCWB 1JG9A 1W9VA 3WLPA 1XQLA 3N2XA 3TJIA 2VDGA 4H19A 3SN4A 1NVMA 4LY4A 5CG7A 2Q8ZA 1V6YA 3KZSA 2JKEA 2ZX6A 3SO7A 4CD6A 3MJYA 1CW2A 4LYQA 1JQVA 1K8YA 3BW3A 1W3TA 2UY3A 4WR3A 1GTHA 4QISA 4NVTA 3DESA 3QKZA 4TMCA 1WZMA 3TV8A 1YXDA 2X16A 3EA2A 3ARSA 3P5YA 3NSNA 4LAMA 3SR7A 3BAKA 1QCWA 4YL2A 5HUOA 1GEHA 1ZTVA 1K7XA 1J8VA 1P7TB 4D71A 4UNIA 3EX6A 2F6UA 4ICMA 1ISVA 1T96A 5I3HA 3WNLA 3UPMA 2QCMA 1EJVC 4QQ3A 1JNDA 4JHZA 1XIJA 1R9YA 1E1FA 1JPMA 3KL0A 5KTLA 1GYNA 1W6TA 3HGOA 4D6CA 4I5XA 2GUUA 1XYZA 4Q8TA 5F4XA 1NAL1 1GKRA 1LROA 1U1HA 2QUVA 3ARQA 1K9FA 4RZ6A 4W86A 2R94A 4M6QA 2OTDA 4LCSA 3ARVA 3WZ0E 5MHBA 3AC0A 3QC0A 4H9UA 5HANA 4BQ3A 1OK4A 3G1AA 3TR9A 1KC7A 1W1ZA 3AO0A 4J5NA 4KWVA 4JS3A 2I7GA 5F2LA 3R25A 1XX1A 4HN8A 3QGVA 3RPDA 1OWQA 4CD4A 4H04A 3PZVA 3LQLA 1O5QA 2BB0A 3L0KA 1ITCA 1SR9A 3Q37A 3WX7A 3UWVA 3MSDA 3MKVA 3MV01 3BC9A 3Q4DA 4I9AA 4NRRA 3PHAA 4B90A 2RJGA 2E6FA 4GNVA 1REQB 5GJPA 3F7JA 2C19A 1XLEA 4WSKA 3L0NA 3LV6A 2BY0A 1ME9A 3N19B 4PB3A 1Q2RA 3DYPA 4L1WA 3URBA 2WBGA 5I5RA 4GKLA 3K13A 2HK0A 5JQ9A 5EMMA 1UZ1A 1JD9A 2BOEX 3JU2A 1DQUA 2CCRA 5E9XA 4JNYA 4P2VA 3U0HA 1TELA 3AIEA 3WK0A 3A5VA 4S3CA 2ZZ2A 2ZA2A 3HV8A 2Z1VA 1VYSX 5AVHA 2WJZA 3WF1A 3WD2A 4XD4A 1GGOA 5I3GA 3A9IA 3GAYA 3DC8A 3KDOA 2VOMA 1XLMA 2GSEA 2HV5A 2CXGA 2PRMA 2XIBA 4UQDA 3ZXWA 4HNUA 3CMGA 4S1FA 2GGHA 4DF1A 1DJXA 3LLFA 3K8KA 4B5NA 3CUHA 3N9KA 1L9WA 1ZRQA 5K4ZA 1KFBA 1R3YA 1ZY9A 3APYA 2TAAA 4NYUA 2QDDA 4YNGA 5FJUA 4HPXA 1K02A 3PBMA 3IV3A 5D9PA 5GVJA 3W07A 7TIMA 1SO3A 4O28A 1R30A 3G1FA 3G3DA 3CL7A 3IVTA 3B9NA 3LM3A 3SCQA 4YTSA 3CL6A 2PD5A 3PAOA 3KHJA 2NSXA 3TMQA 3LGGA 1JYWA 5K7JA 5JH2A 3CV1A 3G1SA 2DJXA 1KKOA 2NUXA 2G50A 1HP5A 4X0VA 4C1KA 4UTIA 1S2CA 1W5OA 1IF2A 2OZ8A 4HNLA 3SECA 2V5JA 2X09A 4TXEA 3LLDA 1G7VA 3DI1A 4Q22A 1VCGA 1E4IA 3KHDA 3VD9A 2VFHA 3TTYA 2Y5JA 4R7WA 3DYMA 2QLYA 4KPLA 2ISFA 1TJPA 2IPWA 3W88A 3IIXA 2QDGA 3BUVA 3TSDA 7TAAA 4ZO7A 3EXRA 2WMHA 2ZRXA 3VGEA 2FYMA 4D8ZA 2FHFA 1MUCA 3MVIA 4UR8A 3M44A 1XIEA 2V81A 3U57A 1IIHA 1JUEA 4YYFA 4AF0B 5KINA 5E1QA 1JRBA 2VKZG 4QJ1A 1PKMA 3LRMA 2VEGA 2BY3A 2DORA 4OQVA 3JR2A 2NQJA 4J3WA 5FCZA 2V67A 3DOPA 2INZA 1EKOA 3IJIA 1EF2A 4JDYA 1KQYA 5D2VA 3TYAA 4W9TA 2D24A 3GKAA 1NFPA 1FBAA 2R1LA 3L5LA 4UFKA 4EAMA 1PKYA 2WVVA 1ZP3A 1JXKA 3GK0A 1A3HA 2I9UA 1PIIA 4LW7A 3BLOA 1PX8A 2P53A 3D5HA 4YIWA 4CNSA 5ABEA 4US5A 3W37A 2JKPA 4BWLA 2CLOA 5EA9A 2EF9A 1XIHA 2A5HA 3RO8A 4RE2A 3L2LA 2J7FA 2VZVA 3SUUA 1ISZA 4AWEA 3VDBA 4QDPA 1HJWA 4MB3A 1J96A 1GG0A 1I4NA 3STCA 4H1ZA 3LCHA 4YCPA 1JZ8A 3VM5A 3AHXA 2NVDA 3RM9A 4CD8A 3UD6A 3HU7A 3THDA 4GQGA 1EUNA 4XZIA 3PUGA 3UWUA 3UXAA 8TIMA 3RX3A 5DXXA 1QWGA 3CQIA 1KFWA 1KTCA 2D1ZA 3MBDA 3WBAA 3V7PA 2PGEA 3TYBA 1AUSL 1E1EA 3MP3A 1UHVA 3UCDA 3QFEA 4A22A 4AZCB 3M7SA 3EMQA 1HO1A 3T09A 2ZVRA 3EPMA 3WNKA 2CLLA 3TFCA 1SSDA 3GHUA 4AIUA 5BROA 2MUCA 1UKSA 2BLEA 5C9WA 2PP1A 1H1NA 3MUCA 4Q8OA 2ACRA 1XXXA 1UR0A 2Z24A 1B5TA 4HHHA 3LCFA 3OA3A 3WQDA 1OGBA 1H49A 1PTDA 4JY8A 2Y8UA 3H4GA 4XUYA 3FHAA 3E1F1 2HXTA 2PLCA 1Z8AA 3FGCA 2RDXA 1XKJA 3F4CA 1POKA 1K9TA 3K4DA 1FUYA 4E38A 2W63A 3CEUA 4IMGA 4V2XA 4NZ5A 2E8ZA 2C13A 1V02E 9XIAA 2VEPA 1QATA 3IARA 4MDOA 2DSWA 3GG8A 1NWUA 4JTTA 3BJSA 4AIEA 4FX8A 4QRNA 5K9DA 3NYDA 4JTQA 1E70M 1SW0A 4RPPA 2XFYA 3AHTA 2PDLA 4CCDA 1UASA 2GL5A 5HMFA 1V02A 1L6GA 1F9CA 2E68A 2QCEA 4GX8A 3S8HA 1K7FA 2QMJA 1WO2A 3KBSA 3I6EA 1UP0A 5D09A 1JAKA 3SY1A 5CCZA 4AZBA 5HJYA 1W1IE 2OWXA 4D6HA 5HWMA 1RCXB 1A0EA 3WQWA 4PCSA 1W1YA 5EBUA 3IJQA 3SGZA 1ENUA 3UG3A 4JCLA 4L6DA 2G4JA 3AZRA 3LK6A 5ENLA 3VIFA 1DPMA 4AD4A 3KUMA 1YE6A 4Q4KA 3AROA 4B5TA 1OT1A 2ZRZA 3VZXA 3S1XA 1RBAA 4AU0A 3NURA 1Q6QA 2PDNA 3NGFA 3FDKA 4WKFA 3LG3A 3GG7A 3EWBX 4O1BA 3EX4A 1LM1A 3O05A 4LEFA 1HVQA 4AMCA 1Q6FA 1F4HA 3E0IA 4JPGA 4MNLA 1BYBA 4HOZA 4ZO8A 2J77A 3ARYA 2NLIA 3OBKA 5FJPA 3H2NA 3NSXA 3QPZA 3C2VA 4UTWA 3KAOA 2IMRA 2VWSA 4AWSA 1ZCCA 3ZR5A 4Q4RA 3GHSA 1MYRA 4PMQA 3RXZA 4PGLA 1R46A 3CV2A 4GY0A 1I0DA 1LLWA 4GNJA 5U7SA 2YDQA 2GSJA 3TQVA 3S5ZA 1BRLB 3LBMA 3LTPA 1YPIA 1X6NA 5FSDC 3FVMA 1QI3A 4FF7A 2XPKA 3SQMA 2PDHA 4GQRA 1ITXA 4GOAA 1LF1A 1PYMA 3OVQA 4DAFA 3W22A 3ABZA 4ZZ9A 3CTLA 5HR6A 1U5VA 4WK9A 4JYEA 1UCWA 4QS5A 4IFKA 2D0GA 3PY2A 4QCFA 4QG8A 3TC3A 4KH2A 3WBYA 3AUOA 5EKYA 1W5NA 3S9YA 1XIIA 1VFUA 1KM1A 1L2UA 1PDYA 1JZ5A 1R9XA 3WUGA 4DN1A 4DXVA 3IIZA 1E55A 3GNOA 3KTSA 2A6LA 4V28A 5E0KA 1XSJA 1U33A 1LOLA 1WAWA 4K8EA 2VGBA 4JX6A 3HMJG 5LYRA 1YE4A 4Y9AA 5I23A 1QNSA 4JIRA 1AJ2A 5FL1A 3A4JA 5DN1A 2CFFA 4KEUA 4EPEC 1HXJA 1JZ3A 3AWNA 1BVZA 4Q4SA 1E72M 2QZRA 6CGTA 5DBTA 1S46A 5IXEA 3RCYA 3DYOA 4J3ZA 4RLIA 1UR1A 4HK5A 4R33A 1EL3A 3W7KA 4Z1DA 1GOMA 5GJNA 1GQJA 3SRHA 3W1MA 2AQVA 2YDRA 1H51A 1FWFC 2AQOA 1EHNA 4KCTA 2CXEA 3ZLHA 4ZO9A 1XPYA 4GC4A 3EDDA 1ELSA 3E5PA 2XJ7A 1TV2A 1ZHAA 3PUEA 5G2WA 3LHZA 1TCDA 3QPEA 3M0IA 3R58A 1J12A 1B9BA 4HIBA 2J7DA 1X6LA 5LIYX 4P7RA 1LL4A 3W1LA 3QY7A 3W7GA 3IUIA 1WUEA 2XIJA 1UQYA 1W9BM 1XD0A 2H90A 4Q7BA 3KEHA 4KESA 2VC7A 1JGMA 1ZCOA 5A6LA 1A4MA 2JIWA 1XFBA 2A3AA 6TAAA 4GZJA 1H4PA 1GVIA 3F2BA 1YQ2A 4AVNA 1K1DA 3QV8A 1DIKA 1SW7A 3KLLA 2TMDA 4BEUA 4HBKA 4FO4A 1EJ7L 3L2MA 1V8EA 1KQZA 2BY1A 3GXDA 3GVQA 4YYCA 3EDFA 3TTOA 3LXBA 2A4AA 3UGRA 2TPSA 1TA3B 2Y5SA 4HCHA 4EANA 4AD0A 1ONRA 3ITLA 4W85A 4L4PA 1J0ZA 2ZRUA 2YL6A 2BVTA 4IP7A 4MWAE 1UIPA 1JF6A 2GJNA 4LALA 3VFCA 4KWWA 1JDFA 3QSTA 4WXZA 3QGKC 3VILA 2HNEA 5AYYA 3AXMA 4UIOA 5D2TA 3DXIA 4AWUA 3EAUA 1PTGA 2BMBA 2Z1KA 2ZKMX 3L9CA 3MI2A 4V33A 4IQLA 1V0LA 2ZXDA 2OYLA 3R94A 5D8ZA 4JN7A 1EQCA 3MVTA 2AAAA 4DXXA 1QPRA 2G0WA 5A6MA 4TTGA 1OT2A 3CZEA 1LDCA 2C1HA 3B9OA 1P0BA 1W5MA 2BFGA 2VD9A 3WLSA 1GVYA 1O94A 3VCNA 1VCVA 1EYWA 1UD2A 5JMUA 3VNDA 1KGWA 4UQEA 5T26A 2NV1A 1V3IA 4TX6A 4PMUA 3WH6A 3UVAA 3BG3A 4I7UA 1VPXA 1ZL1A 1JEZA 1XV8A 3GW3A 2FTPA 3W01A 4ZSTA 3E2QA 3L4YA 3PZUA 3QF0A 3GU1A 3VMNA 2VCCA 1QNQA 3NQ6A 2IXVA 1L6YA 1PX3A 2VGGA 2YBUA 1VBUA 1CB2A 3LYEA 4O0KA 4IMEA 5J04A 4U3CA 3LCLA 2C8NA 4HMNA 1AD4A 3FVDA 1E9YB 5I3KA 1G5AA 1MEHA 3OQEA 4E8CA 2E7FA 1HNYA 4B9ZA 3NCOA 3UXLA 4EIVA 3T1GA 3T6CA 1TMLA 4OV9A 3E02A 1PIGA 1GQNA 4XZ9A 1MQPA 3LNPA 1TIMA 3B05A 4AG0A 4Z17A 1EO5A 5M3WA 5DRCA 1UZHA 1LQAA 3HIJA 4BK9A 1TE6A 4NI8A 4PMRA 2XN1A 4GBDA 4O11A 2NX3A 4KRTA 2FJKA 3DFOA 2PRLA 2WC3A 4NL1A 4OFCA 1E0TA 1TX2A 4UNLA 2Q8XA 2OEMA 2E1WA 4YVVA 3QVQA 3DFSA 4R53A 2G3JA 4W88A 1FP9A 2F84A 1A5CA 3PTDA 1VGAA 4NHVA 2ZUVA 5KEZA 5FF0A 3AMCA 2Y62A 3IIVA 2ZE3A 4QJ3B 4LAOA 3UWYA 3UXDA 1JULA 1W5QA 1SUXA 3M5YA 4PUMA 2F38A 1VEMA 3RITA 4QDMA 3MANA 4PRRA 4HD5A 7REQB 1BQCA 4B5XA 3H70A 4H3DA 1I75A 3BV7A 3IANA 4O0ZA 4FA3A 3BV4A 5EGRA 3WLRA 1JYVA 1F7BA 2IXUA 1Q6RA 3HG5A 3SCUA 3JUGA 1H7WA 3OIXA 3TN6A 1ZBWA 2ZX8A 4U4MA 2GVGA 3K5XA 3W84A 3MDWA 3QZEA 3U6WA 1UA7A 3MWAA 3AIWA 4HCLA 5K3VA 2WC4A 3TW7A 3V0UA 1E0VA 3WFZA 3RK8A 2VTFA 1HKVA 4PUNA 3V5FA 2NUWA 3QPYA 4P7LA 1QK2A 5I3IA 1EEPA 1VAHA 4IMCA 3QR0A 3IAPA 4W7WA 4RW3A 2PDQA 1S1RA 2Z28A 2RUSA 1QVBA 3R5EA 3EWUA 3VMOA 1BXBA 2VUYA 3QYQA 3RLUA 3IVUA 1ZZMA 1JCTA 1T7LA 5IHSA 5AYIA 4GBUA 2QCDA 1V3HA 4MYXA 1UWUA 4JIHA 4F2UA 1BG4A 5F4SA 4H8HA 2CLIA 5IDIA 3N1AA 3UR7A 4LGXA 4HNTA 1WUFA 3ANYA 2ISWA 3LHUA 1JVNA 4YXGA 3VIHA 3URAA 1U30A 2YW4A 1L0PA 5CZSA 5JVLA 2PGFA 1KNWA 3B04A 4UTHA 2QJMA 3WL0A 2DZXA 5FA5A 2FVLA 4NIRA 4E8GA 1YRRA 2ZA3A 3SQSA 1CWYA 2CWXA 1NU5A 3UA4A 2C91A 2XGBA 2WK2A 3CUFA 1UKPA 3S1GA 4AD2A 1OYAA 3PFRA 1KRAC 3VE7A 4Y9OA 2EPLX 1X1NA 2AKMA 3UETA 3PZTA 3AMKA 4RW5A 4G1KA 1UWQA 4WLCA 3W1TA 4HU4A 1RCOB 1K6AA 1MZHA 4PMJA 1QDSA 3MYPA 1AH0A 2CC0A 1W31A 3RUBL 5DCDA 1Z9AA 3PM6A 3TTQA 4ZGYA 5DY2A 4ZL1A 1OFRA 1V3KA 3Q58A 4XD6A 4AXKA 1CXHA 4JQ3A 1M5WA 2WMJA 4S39A 1FWGC 4XD5A 1DWFM 1YDYA 1OX4A 4I9MA 2VVSA 4EXBA 4PCPA 3VTRA 4GZ7A 3ITTA 1XLIA 3M47A 3PFMA 2ASHA 1A5BA 4JQ4A 2QJHA 3C2YA 2QW5A 3WH9A 4JFVA 1BGGA 5TNVA 5BMXA 2Q71A 5G2IA 1OG6A 1YNPA 4H9TA 1RAKA 3R4IA 4G56A 3N29A 3VU2A 1O68A 4E6MA 3DHPA 3SCVA 3WYZA 3CU2A 3WJXA 4RZ4A 5GNYA 4IPJA 2XSBA 2XGIA 1XLLA 1WNOA 2A7NA 1Q4WA 4NNBA 1TVPA 1LJYA 2E6YA 2BXYA 2WM1A 3RGTA 4Y9PA 4DBUA 3MCMA 1TX0A 1KW1A 1XRVA 3HQNA 3PJXA 4Y6GA 1TUFA 1XUUA 2C6QA 2DW6A 4HPHA 3TOYA 4LH8A 1RV8A 1SR0A 3ATZA 4AW7A 4ZR8A 4C65A 5H2ZA 4FAMA 1FOBA 4Y90A 4PE8A 1OB0A 2PODA 2F2HA 1LCOA 3WN6A 1VB9A 1ICQA 3MO4A 2E0PA 1MUMA 4H7CA 4HGXA 5HINA 1ICPA 4AAJA 1TV4A 3U2EA 2OOGA 2XH4A 4M24A 5C2GA 4MB4A 1HKKA 1I2QA 2BDQA 4B3ZA 5BCAA 1JNEA 1RJQA 3C0LA 3OZPA 1ADDA 2GOKA 3G77A 5AHLA 2EHHA 1QPQA 3A4WA 4JTUA 4BEQA 1I1WA 1KBJA 4P7QA 1XH0A 4FLQA 5BW6A 1W3KA 3PZOA 1BTMA 5E6YA 3PUDA 3TMLA 4Y7EA 1YXCA 4JTCA 4UFLA 1OGGA 4L64A 1ZUAX 3V16A 4N9DA 4Q4PA 3PC0A 3TP4A 2GK1A 2IKIA 1FKWA 4GLEA 3LZ3A 1V3MA 4IG2B 4CQBA 3CT7A 3IEBA 2GQ8A 3T05A 1TMHA 3T4WA 2FDMA 5FJRA 1AH4A 1DJYA 1GOOA 1KXHA 4HQVA 3QHOA 2WC7A 4B91A 2CBVA 3IGHX 3NG3A 1PB0A 2ACUA 4GUIA 4XSLA 4S38A 1SJBA 1JDAA 3N3MA 3R8HA 4M0XA 4JDBA 2QUMA 3WLNA 5HPOA 1Q85A 3MZNA 3HG2A 2V0TA 1HFBA 3THQA 2VUNA 2V68A 4DIAA 1DWGM 4IL2A 2WSQA 4IZGA 4OZOA 2ISDA 4ZODA 1REQA 2BNJA 4GK8A 5CPQA 2FPVA 4XKMA 4G7EA 3AMGA 5AFDA 2VRJA 1K8ZA 1OBAA 1UMYA 4GUHA 5BXTA 3MYOA 5AY7A 3NWRA 3WH7A 5D05A 4FX6M 3EDKA 4O13A 1UOZA 2XFFA 3KRUA 1ADSA 4LNCA 3DFYA 1DORA 1A5OC 4OE7A 4FHAA 5JBDA 4RKAA 4XISA 2Q8LA 4XZMX 4PMDA 3W28A 1GORA 1F6PA 2VT0A 4Q7NA 1HJSA 2PA6A 3OU8A 3PZIA 4MMWA 4I6KA 1JPIA 3GIYA 3WQCA 1QRQA 3W00A 4FEZA 5CC6A 3NQVA 1QW9A 3P0WA 1KFJA 4FNQA 1VH7A 2WNWA 5I2UA 3M46A 2WSPA 3SY5A 3OHMB 4XSMA 3JZUA 5E0CA 3PTMA 3N2BA 1DV7A 3PJTA 1W3IA 4WJ8A 2Y8VA 4JICA 4LT9A 2PWVA 2F6KA 4CQAA 2W9MA 4LOCA 3STPA 1DEDA 4RL3A 4M7SA 3MSGA 3AU6A 2QIWA 2FTYA 5DFAA 1NOWA 2DVXA 4ICNA 2QF7A 3IUDA 4IX0A 3TYZA 2CZ5A 3AIVA 3VMPA 4FS9A 4XO6A 3TZNA 5DQPA 4FXJA 3P84A 3EA1A 1FY6A 1X38A 1IGSA 4QG6A 4AMAA 2EG7A 1C8XA 4MHBA 3QKEA 1N55A 5DX7A 1TO3A 2FJUB 2VEIA 1JD7A 2DZBA 2J24A 3E2VA 1K8CA 2XVPA 2O4QA 1EDTA 4HZ6A 3SM0A 3CC1A 3BMXA 2PP0A 1PJ9A 3SQLA 5DMYA 2WB5A 1V6TA 4Z1BA 3QMTA 4MKNA 1K6WA 1TTQA 4L65A 3SCWA 1RVKA 1UKQA 2YIHA 4Z42C 3A6OA 4IXXA 1M6JA 3IWPA 3NA8A 1ZAIA 1CGXA 1D3HA 4HTBA 4WZHA 2VR4A 3NM3A 4PBGA 2OODA 3C2EA 4MY9A 5D32A 5JIWA 1KLYA 5D9OA 3OLIA 3HTWA 3CH0A 5IM51 2Z1XA 1TQXA 4DAIA 1JPKA 4NSBA 2I16A 2YXOA 2P88A 3WMBA 3HPXA 4H9VA 2H3BA 2DT1A 3IV8A 1Q6CA 3NR0A 1H7PA 3VIIA 3WLKX 4JY9A 3W23A 2NXGA 3ZMRA 3BZGA 2ESCA 3A22A 1BFNA 2IQTA 4QJ4B 3V36A 2H6RA 2E6AA 1PYFA 1Y7VA 1E73M 6XIAA 3W1NA 3NZQA 1C90A 2YOCA 4NT0A 1JZ4A 4O53A 4C6LA 4I9TA 2Y6ZA 1A5MC 2A3CA 4UTMA 4JQ2A 3QJAA 4D6EA 5D8WA 2XYLA 4PUEA 1G1YA 3EPNA 1YTEA 3GVRA 2C3ZA 3JS3A 3WDIA 4HP5A 5HJLA 3CUXA 1R87A 5AZ1A 3NSMA 3BG9A 3XISA 2B4GA 1W32A 3VNLA 3LRKA 1XRFA 4CCZA 3S6TA 1FQ0A 2YX0A 3IK4A 3M0VA 2AKZA 3H2MA 4Z0JA 3SI9A 3QW4B 3AFBA 1ICSA 1MSSA 5A6BD 5C0QA 1BF6A 3FV9A 4Q8UA 1VFOA 3VE9A 5SWUA 5I0DA 2YSWA 2VGFA 4LV9A 1IEWA 3TZFA 2PE4A 4BF7A 4QM1A 3EX3A 3PPGA 2GJXB 3U9IA 3OGRA 4MNMA 5DCEA 4ZOEA 3VGFA 3RFAA 4HA0A 4IMDA 2HZGA 1TZ7A 4X9SA 2OX1A 3ZM8A 2PBOA 1Q3NA 5FF4A 1R3SA 1K9DA 3FSUA 5GJMA 4GXWA 2YBVA 3A24A 2FHBA 3TU9A 5F2IA 1BSIA 4C6CA 3QGAC 1BAGA 3DKJA 4N9EA 3TN4A 4LAZA 4GIAA 3AYVA 1XC6A 2CU0A 1SO5A 2V3DA 4HU3A 3NZGA 1WDSA 3H26A 4G5DA 4F2TA 4GC3A 3UPWA 4CKQA 1XL9A 3V0TA 5C5YA 2BASA 4JX5A 3R0UA 3NOEA 1LBMA 3H54A 4GQ0A 1KBBA 2WJDA 2NQ9A 4NAEB 4PTVA 3RDKA 3E5BA 3HJEA 5CSRA 3V5CA 3GE7A 5HQLA 2DGAA 2NX1A 3UZYA 2ZX7A 5EYWA 4GI9A 3H21A 2CLMA 4S3DA 1HT6A 3N2CA 4MY8A 2WYSA 4Y9MA 4U5IA 3RLVA 3AS0A 2DZSA 3F1QA 4XBKA 2VHLA 3I3DA 3RM4A 3GO2A 2EPNA 4UOQA 3V75A 4UC5A 3SCPA 4D6GA 1W9DM 2D2JA 5EB8A 2XWDA 2I5GA 4W4QA 2XG9A 3KP0A 2Y1HA 3W27A 1PCKA 1JCLA 1LLZA 4XV0A 6REQB 5AHFA 2JKAA 1BWVA 4WGHA 1CXEA 2PDPA 3GB6A 1JFHA 1I1XA 1IXPA 4GKTA 3C8FA 2ZWYA 5CBJA 1Z89A 5CBIA 2V5CA 2PGRA 1TJ2A 3KWXA 3GR7A 5TF0A 1OSEA 1MW2A 1W3HA 1UWAA 2ZZ4A 1UYQA 3VXGA 3GBDA 3LHVA 3IRSA 1PKNA 1DIOA 2G3FA 3W70A 2YPIA 3IVSA 1G4TA 4D1IA 1TFVA 3SCTA 4EKJA 3TQKA 1X1OA 2OYMA 1HKJA 2I9EA 3M6YA 4WDTA 2BBFA 5DMMA 1HN1A 3QRHA 2AL1A 2V30A 2QPSA 1TPWA 2VFEA 1OEPA 4UFIA 3KOFA 3BL3A 3CZ8A 3T9PA 3BJFA 4MJ4A 3AU2A 3N4FA 4AHOA 1W3LA 4EWJA 5KITA 4PEKA 3S1UA 4DUVA 2PWHA 4D2JA 3KXQA 3REQB 4WCJA 4F9DA 4AB4A 4REQB 3W73A 4OTKA 1F73A 5XINA 2DDXA 1KGXA 4AX6A 1IEIA 4RNJA 3NAVA 2ZUWA 4Y96A 4MAVA 4C6PA 1E43A 4MUPA 4O10A 1VR6A 2PDCA 3AXIA 3ARUA 2EPKX 5IOBA 1VF8A 1A5UA 3ERPA 4R7OA 3KLKA 4S3EA 5AZ0A 2J66A 5K4XA 3SUWA 4XKYB 5CSYA 4DYKA 3A3WA 2JFEX 3PZNA 5CG0A 3K8MA 3CHFA 3OIHA 2FB2A 1MEIA 4WDWA 2VGIA 1YPFA 4MDPA 3PZ9A 2QCNA 3CO4A 2Q01A 4ZTXA 3LPGA 3NFUA 1DWIM 3FS2A 4C5ZA 4BQ5A 4LC6A 1UQZA 4X0NA 3THUA 3N11A 4XAZA 3GM8A 4NAFB 2OWWA 3DH7A 3M0XA 2P3ZA 2R91A 1M41A 1OCJA 1TUXA 5FEXA 1F8IA 4W8AA 1BWKA 3S5YA 5HNRA 3KTCA 1X8CA 2H9AB 1MZRA 1M68A 2G96A 1RY8A 9XIMA 2FZDA 1BPLB 4FK9A 3RO6A 2AMGA 4JEQA 3UF9A 3OO2A 3SJ3A 3AOFA 4MZ1A 5D38A 2WJFA 2E9BA 1EPVA 2WVSA 1AODA 5C9ZA 1VIZA 1VYPX 2WNQA 1J0YA 3VKAA 4PL2A 3WEOA 3MJMA 1UJQA 4UCFA 2IKHA 4GACA 3B9EA 4EPDC 1RBLA 2XN0A 4IH3A 2YYUA 4A6GA 2PF0A 2XVKA 1KBKA 3AWOA 1ONWA 3GFXA 4IXHA 2WOQA 1BGAA 1T5AA 5H91A 3W86A 1E3XA 1E3ZA 1R2SA 5CJMA 3CUGA 3VIPA 1KKRA 2AMXA 4UB9A 4CLMA 3MUAA 2DZAA 1H2JA 3WF3A 4FNRA 3QR3A 1QPOA 4NX0A 3QLLA 1GPWA 1TREA 6ALDA 3ES8A 3KZPA 1NWSA 4KS0A 4TVDA 4FNUA 3MMUA 3H2AA 4W7VA 3C2OA 1EEXA 4IJCA 3L4XA 3QLDA 1Q6GA 4KCVA 2ZZ1A 4FOKA 2GJLA 4R34A 3NQBA 3SIZA 1P0EA 1EJTC 2W27A 4Q6JA 3TOPA 5T91A 2O9PA 3B8WA 4PN2A 3HM7A 5CGMA 1G4SA 1PXGA 2R9RA 4H83A 3THAA 1WA3A 1TPC1 1TTIA 3IUHA 3NQDA 2DZUA 1EJWC 1EFZA 4HYWA 2OLHA 1DJZA 3H7UA 5IBXC 3CIXA 3W76A 1KWGA 2PWDA 4PBFA 4P5UA 4Y8FA 3STFA 3KX6A 1KRBC 2AGTA 3POCA 1FKXA 1OC7A 4JXCA 4UQCA 4S3AA 4V1YA 1EGVA 1SJDA 5ABTA 1V6UA 3AICA 1K03A 3BOFA 4LAKA 3T0TA 3T0BA 1UP3A 5F1UA 5AC7A 5TQLA 3O3RA 4LQ1A 1N2VA 2W92A 3F03K 1C92A 1R7OA 4YU1A 5KZMA 1Q63A 1LUCA 2IQ0A 5C9XA 1A5NC 4RNHA 1FHVA 2BODX 1ZS2A 3SBFA 4JQ1A 2BVWA 5CPTA 4XTIA 3O16A 1R0MA 1VEOA 4AEEA 3MCNA 1YHTA 4IICA 1AMYA 4O1AA 2Z00A 4TVUA 1BTCA 4J2MA 3PZGA 4MJZA 3V5OA 5LXXA 4IPNB 4M82A 3ZLGA 1F6KA 3J7HA 3SDOA 4GQBA 3RRXA 2FGLA 1OD8A 3WQPA 1FH9A 3L21A 4GUGA 1OJXA 3S1WA 4Z2IA 2XWEA 2X8RA 1X98A 1XGZA 2VCAA 4QQUA 2D22A 4QS6A 3HGRA 3QY8A 1M3UA 3FLUA 2P3EA 3G1RA 3WDJA 4H00A 4JTRA 3KWSA 4K1WA 1XYBA 5FEZA 3EDEA 3FXYA 4BF5A 4FZIA 3QYSA 3W7JA 5LHFA 4R5EA 4U28A 2J8GA 2VC6A 1PPIA 1IEQA 1IWBA 4YLWA 1W5PA 3FYYA 2PDUA 4A3YA 4O17A 3B0XA 4PCFA 4AH7A 1TWZA 2VURA 4C1NB 4XZLX 3VI2A 4IIGA 2OSYA 4F79A 3RX2A 2VZSA 3SGGA 3WG6A 2HVOA 5D9NA 3H7RA 1XD1A 1E6QM 2GVLA 3CWHA 3GKFA 4INFA 3W85A 3LX9A 4LVAA 1TPB1 2HQAA 3CGTA 5DXYA 5GNXA 1GOXA 2C16A 1UBPC 1RD5A 1Q6DA 3VNJA 3UESA 3PWIA 1CLKA 4F3HA 4LUTB 3G8RA 3ZZ1A 1XP3A 1EP2A 2A7RA 4WRHA 1AW5A 4NF7A 3BAXA 2D2HA 3O6YX 3B97A 1QI4A 2PLMA 2X7WA 3GNNA 1M9HA 1FH7A 3ZSSA 4L80A 4KRZA 5DT7A 4LBSA 2I17A 1VPYA 4GO8A 4LEQA 4A2RA 1CENA 3KS5A 1XCFA 3CQKA 4PUDA 1W37A 1NQKA 4S2CA 2ON3A 3DC0A 3NDOA 4OUIA 3W7LA 1YMYA 2YYTA 3HB9A 4BJHA 3K1GA 4EE9A 1VHNA 1KCLA 4UTTC 3TIMA 4WJEA 1UZDA 2CW6A 3W26A 3K4WA 4OBSA 1HG3A 1C9DA 1S5WA 1XI3A 3FKKA 5HWNA 4CU7A 3B0UX 2ZUTA 2HE5A 4FXRA 1MRAA 1O66A 2PWEA 2PCEA 4MNJA 3L4ZA 2Q02A 2Y7EA 5HMDA 1IWPA 3L66A 2C1GA 1TJ0A 3WQ5A 2OEJA 4WXYA 2G5WA 3S0CA 2Q6ZA 5LNSA 3B0VC 1HKIA 1AW1A 4RDVA 1UA3A 2XM1A 3M07A 4RZBA 4XX6A 1HW6A 3NO3A 2EQDA 1AA1B 2WZTA 3ARZA 8RUCA 4C91A 2QKFA 3UR5A 4EAYA 5F7UA 3OVGA 1FWTA 1S3TC 2YDAA 2QJJA 2HTMA 1HVXA 4MGGA 3WFAA 1CIUA 5JIPA 2YB1A 2UWFA 3SCNA 5JBEA 4CCEA 2X41A 4WHBA 3GNPA 4F0SA 3W7QA 1EP1A 1Y5XA 4XAPA 4KF1A 3WNOA 1QPNA 3GU9A 3TYDA 1OF8A 1FWBC 4D6JA 3BCJA 4C6FA 4YVPA 4ACZA 1EIXA 2YXGA 4NZJA 3ABSA 2W6RA 5BXPA 3EWDA 1HGWA 3BGGA 1MXSA 3HFTA 2V3FA 3VD7A 4UTJA 4W5ZA 1YKWA 5XIAA 3ZJ7A 3AALA 4P8XA 2FPTA 3VIKA 1KM6A 3NPUA 1WZKA 2CLPA 4NNAA 3M1ZA 2GVJA 2PMQA 2A0NA 1FWHC 1HO4A 3TJLA 3N17A 1JDDA 3GZ3A 3P6LA 1FWIC 4QCEA 1H1YA 2CESA 3KTXA 3W2JA 3KVLA 4Q3MA 5D03A 1CGUA 1ITUA 3SCRA 2ABAA 2XSAA 3EKZA 4Q6XA 3G5EA 5AVNA 2WW5A 3AYTA 2O9OA 2DUXA 5JBFA 4JTIA 4QLJA 1B3VA 2NQZA 3OJGA 3QQ1A 1CLVA 2DZTA 2X1TA 4YTTA 1OK6A 2PTWA 3CV6A 1JPHA 1THFD 2W67A 4HMCA 3FY1A 1C7TA 3T2PA 4K1GA 4PUKA 3GBEA 2YLLA 3N13A 1VBGA 3NDYA 2Y85A 4TQTA 1IGWA 2E5DA 1AH3A 3LCIA 1XYCA 1EO7A 1VFHA 4QG9A 2GDVA 5I77A 5A6JA 3Q94A 3DBNA 3WKZA 1ONEA 1XF0A 5EMLA 1DWHM 3GZAA 4QR6A 3UCQA 1VBRA 1XH1A 4MY1A 1E4LA 3OTRA 4AISA 2DUZA 4HN4A 1AMKA 4WIWA 2TRSA 3CB8A 1EXBA 6A3HA 1YBQB 4FNTA 3FX4A 1UR9A 1QHZA 2QR6A 2CBUA 2TODA 1UUMA 4L4LA 2XGZA 2O7SA 3WQEA 4Z1AA 3FHQA 2WSKA 2GWGA 3UU0A 1RQHA 4GVFA 1E6PA 4RK8A 5REQA 2QULA 3P67A 3M7WA 5DRIA 3L2IA 1GQIA 4IG2A 3FSTA 1NOFA 2TSYA 3LPOA 1F3XA 5D2XA 3LERA 3B8UA 2R24A 3M0HA 2DZWA 4EF8A 1FWRA 5HUPA 2EPOA 4PTMA 2QUTA 4DZHA 4X2PA 5BU6A 4M29A 2X05A 2OG9A 4L9ZA 1WQ5A 3RPMA 3EB3A 4GCXA 5KZEA 2VDIA 2G37A 2CITA 2HS6A 2NWSA 3TE9A 3EWYA 2YDSA 4O50A 1LBLA 4GVGA 1NQ6A 1VS1A 2OT1A 3HF3A 4XK2A 3P60A 4D6IA 5CZTA 3BSGA 1IYXA 1OCBA 2Z2UA 2MNRA 3EWCA 3AZSA 1E6SM 5LNVA 9RUBA 3IPWA 4MKVA 4OHQA 5FF2A 5TBOA 3BLPX 1ZALA 1VCFA 2CHOA 4GH3A 2RDTA 1PHQA 2NT0A 1JI1A 1U5JA 3TDFA 4ZFCA 3S5OA 2FFIA 3TROA 1C8VA 2W0UA 4S3FA 3EMCA 1LL6A 3KBVA 4KFNA 1GEQA 5F4WA 3GC5A 1IEVA 3BW4A 4D9PA 4K37A 1F05A 1G67A 3N15A 4I6VA 2ZDRA 1MVYA 1MW3A 3DZ1A 4NJGA 4IGSA 3V35A 1FWAC 1EHAA 1IEXA 2AL2A 4V27A 3WL1A 4W7UA 4KCWA 1R7AA 2DPEA 1WBJA 2WZIA 4D6FA 3EOUA 3VCCA 5L9FA 1XQKA 4HSHA 4DJFD 4EACA 4GZIA 2VCBA 3NJ3A 3ZJ6A 1E0UA 1CGVA 4EOUA 2WCAA 3TWBA 4IQDA 3UWWA 2HS8A 3OZMA 1EB3A 1NOUA 3SURA 3P2VA 3VINA 3VVGA 4BFAA 3KOXA 3VGDA 2ZXQA 2O9RA 1RY0A 4JCMA 3W1RA 2NZLA 1JCNA 4FPSA 4HHMA 2W5FA 3CHVA 3DHUA 1UR4A 1XBXA 1JQXA 4PC8A 4HNCA 3DIPA 5CH9A 3W81A 2QCFA 1M7XA 3I10A 2C0AA 1KM4A 3MQTA 3KE0A 1S2TA 2A3EA 1RXOB 3T42A 3WH5A 3KL5A 1ME8A 3W7IA 1O1HA 3BCDA 3B8VA 4DJED 3L4VA 1BWLA 2FPYA 4WY0A 3FJ6A 4GCAA 5EFDA 3U2ZA 4O14A 3AHVA 2PI6A 2WBKA 1O5XA 3VUPA 2V5BA 2OQYA 4EPKA 2UY5A 3WDQA 3LGDA 2INFA 2D0FA 2ODOA 4E8DA 4AVFA 1CXLA 3RYSA 4L4OA 2WHJA 4EXAA 3LI1A 1XPGA 4XVEA 3T0DA 2QJIA 4UFMA 5DMNA 3HGSA 3OEXA 1GVFA 1RPKA 2EEXA 3CAQA 1LOSA 5PTDA 3W1QA 3W1XA 2VEKA 1R3TA 4ML9A 3WSUA 1DIEA 4MWAD 3NZ1A 1F3WA 3TW9A 4HOWA 3LSCA 3N73A 5FF3A 1RQEA 4R85A 3MHGA 3GTFA 5HA7A 1GWJA 3TKFA 1Q45A 1EDGA 2E5CA 4FR6A 1G4EA 4AXNA 3P0XA 2DSUA 3S2CA 1EUAA 3NEHA 4EX4A 1MO0A 3PG8A 3HGJA 2PAJA 2XH2A 1S3HA 4FI4A 3CXOA 2YA2A 4J1OA 1B3ZA 5A6SA 5M1TA 1NWTA 3NYZA 4YMZA 1XYMA 2J25A 2ZUMA 2DZVA 2KZHA 1B3OA 3P14A 1IT8A 8XIAA 1L6SA 1N8IA 3TYEA 2BZNA 3GR4A 3E0WA 5C2XA 1BVNP 3VD4A 1O5KA 2PZ0A 1XIDA 1P4CA 3CLWA 3W87A 3VK5A 4QROA 4DQWA 4KEMA 1Q5MA 2OR2A 1UD4A 3QOMA 4C7FA 4CEXC 4LANA 1V7YA 4H2CA 2BWGA 5HMSA 4A2SA 1U5HA 4JZ5A 2PTDA 1OABA 5FJIA 2EPHA 4K36A 1J10A 2GJXA 3WCZA 1TZ9A 4B5WA 1A49A 1TPVA 5E0FA 1R2TA 1B3WA 4DZIA 2ZTKA 3PR2A 3R89A 3R7MA 1OZMA 2OQHA 5CZKA 1F3TA 1RZMA 4FNSA 3MZ2A 4F0HA 1SFTA 3QQ0A 1ZJHA 3C8NA 3GDKA 4PTXA 5FKYA 3GIQA 3B4UA 3TFXA 4JNMA 4IMAA 1IE7C 2BGNE 2V6AA 1J0IA 3IS4A 3MS8A 2DIJA 4ROPA 4H9MA 5I03A 3DU0A 1ISXA 2G95A 2WVVB 3AISA 3CLMA 3TYUA 3G0SA 3UZXA 5AC8A 1JZ2A 4HMDA 1GVEA 3CZGA 1P6BA 3FA4A 3UG5A 3E9AA 1H41A 1RBOB 4CNOA 5I6SA 3QTPA 4Q4QA 4NAEA 1B90A 4AZ6A 3HPAA 4YN5A 4U5KA 1Q6LA 1X6UA 3EB4A 4LU0A 1KXVA 5A6AA 4ZA0A 3IRDA 3EOEA 5M2FX 3WLTA 2UY2A 1PTAA 2OU4A 1P43A 4KRUA 1E0WA 1NEYA 3H2FA 5BOFA 4PMYA 3NQ7A 2XIIA 2GUBA 1AW2A 4MLJA 4LB4A 1T6MA 2Z25A 3AS3A 4CQ9A 4HNOA 3A12A 5CQ1A 3ZJ8A 3VUSA 2DFAA 1DXIA 1MQRA 1TR1A 1HJUA 3S2LA 1ZB5A 2DQXA 4LUIA 4NU7A 1IR2A 5T9BG 3HA1A 3T7VA 4WKAA 3QY6A 4XQ6A 4LY8A 4PRTA 1Q7MA 1PIFA 2ZUUA 4XUGA 4JHMA 1EQPA 1VZWA 4E0CA 2ZXAA 1H5VA 4AHQA 5J8LA 1NARA 1LLOA 4AD5A 2CWNA 3MHUA 3HOJA 4E2OA 3KBMA 3C61A 4Y2WA 3VAVA 2NWRA 1WXJA 4ENLA 4HTYA 4JTEA 4C6EA 2FGZA 3TR2A 1ZLPA 1J9YA 4J4KA 1C29A 1UH3A 4QGCA 1B3YA 3VDCA 4QSHA 3REQA 3W25A 3LRLA 5JXQA 5ABFA 3USZA 4W93A 1FVPA 4REQA 1ISYA 1LTDA 1K9EA 3AIBA 1MXDA 4YWSA 3NL6A 2WHKA 1WDQA 4AUBA 2REQA 1G4PA 3RMJA 1VFSA 3NQ8A 4M5PA 2J8FA 4Z1CA 1JIBA 4LFYA 4CN4A 2E6DA 2F6XA 3BSHA 2WZMA 4PB4A 1M7JA 3O2LA 1Q8AA 4M8UA 2X2YA 3DBPA 4L4MA 2VP8A 4LJ3A 5ABHA 3HO8A 1Z7AA 2WMIA 4M6PA 4M80A 1PKLA 2QPUA 3P80A 1W1B1 2BP1A 3ARTA 1CB7B 1U83A 1K8XA 1K3UA 1HIZA 3C0JA 2J9XA 2WKJA 1PZ3A 4NX5A 4TX9A 1UR3M 2VMFA 3QSRA 1EPXA 1M1BA 4I5RA 4DM2A 3D46A 3CUIA 1BXNA 1GVQA 3E3HA 4R7JA 1O60A 5H6HA 1V4YA 3LN3A 3R0DA 3ANUA 4Z2GA 4AIBA 3G3MA 1IXOA 2PP3A 5A1AA 2J7CA 3V1HA 4WX2A 3UGVA 4DXKA 4DO4A 4Q4MA 3MUXA 1ZU8A 2H8ZA 4GI8A 3DDMA 1QOXA 2XIOA 4H6EA 1GYMA 2BTMA 5I24A 3W7MA 3FNDA 3ECQA 3HFYA 1MDRA 2WMFA 5BNKA 3O07A 2DUAA 3N9SA 1G7UA 3UNTA 2E9MA 2ZTJA 2I5IA 3NIYA 3P93A 3U5UA 2PB1A 2ZOXA 1L8NA 4HZ7A 1V6VA 3CUZA 4JKKA 3LLXA 2JGYA 1BYDA 4RE3A 1A3XA 1F2JA 2PRHA 4JHOA 1NP2A 3PPFA 4Q7IA 1UKTA 3GH7A 2X0SA 4N6EA 3LD5A 4E4PA 2YGYA 4OBTA 1RH9A 1V3JA 4WEVX 4OWGA 1J18A 3PZMA 5AHIA 4RXGA 4C6IA 4S2BA 1CECA 2YW3A 3PG9A 4L5ZA 2WPBA 1LP6A 2Y7GA 5IBXA 1PWLA 3M16A 1Q7ZA 3BZJA 3NL3A 4OJYA 4TR9A 3ZYZA 5AYBA 3G6LA 2CLEA 4UUIA 4BZYA 4IFKB 2O9TA 1E51A 1XLAA 4GO9A 1CXIA 3A5FA 2HVMA 4H6RA 2HRWA 1RPXA 3WJYA 5HJXA 4KERA 1U1UA 3WJWA 1TR9A 2CLHA 4PULA 5M17A 3E38A 4J3VA 4XBSA 4FALA 1XINA 3GUGA 1P6WA 2FMNA 2QCCA 1BSLA 2DT0A 4CU6A 3A4XA 1DTNA 1L6WA 1WKDA 3V4BA 3WUEA 1MNZA 4RXFA 3GU2A 4G2DA 3GXIA 3UERA 1TKKA 2QXWA 2BV9A 3FK4A 3OLEA 3WEMA 1HX0A 4ZB2A 3CAKA 4PODA 4QITA 2Y89A 1QI2A 5KZ6A 2DQWA 3OPSA 2MANA 3NOYA 4W89A 3N14A 4ATDA 1VLIA 3CHDA 1YLVA 5D02A 2QIIA 4JBRA 4OUEA 4OIFA 3FIGA 2C14A 1RK5A 2I57A 1SZEA 2R1PA 2RHGA 3R79A 4QEHA 1L2QA 1YPXA 4BHYA 5A8MA 2GGJA 1ITQA 1H62A 4HPGA 1JYNA 1A47A 1E1CB 3OZYA 5E70A 3NQAA 3C2FA 3OVPA 2WJEA 3M0KA 3RR1A 3WY1A 1YX1A 2Q3RA 2ISVA 1TSIA 3WQ8A 5BWAA 2XDFA 1JJKA 4MB1A 4LVGA 5A8OA 1J5TA 4ZQMA 4NKCA 1TPH1 3UG8A 2NXHA 1WAUA 2QF8A 3RPTA 1AG1O 4WKHA 1V08A 4DJFC 1XSKA 4EP8C 5RUBA 3O6CA 4IIDA 2E1DA 2D0HA 3QV7A 4HPJA 4XIMA 4K6AA 1VEPA 4F4RA 1GT8A 3LENA 5HK4A 3DG3A 1FWNA 1WKFA 1CDGA 3UJEA 2VZTA 2WQDA 3BSMA 2GQAA 1V0KA 3WBWA 3LEPA 4P7NA 4N6FA 1C8QA 4IQEA 1GOQA 3LXCA 5LIKX 1WKYA 2JQXA 4D72A 2CPUA 4HYVA 5H8PA 1SMAA 2GOUA 4Q8QA 1FH8A 3E2SA 3UYCA 1OCNA 4MWAB 1IXNA 3UYIA 5C8BB 2ZZ5A 4MPQA 4GI6A 4PTDA 1SZNA 1VPQA 2R14A 5TIMA 4L9YA 3I6TA 3M43A 3OLGA 1T41A 2P5NA 2XFWA 4OV4A 3VOFA 4DJEC 2ZUNA 5ABGA 4UTTA 5IHRA 4GY7A 4EF9A 1UC4A 2X7VA 4MZYA 4G8TA 4IIFA 4UCGA 2A2IA 6ENLA 2Y4SA 4IHCA 2FZMA 3S5NA 3UR2A 1DVJA 1PHWA 4KEVA 4BQ4A 3QH2A 3EXTA 2DIEA 3GDMA 2P10A 4N42A 2ADAA 5A6BA 4N9BA 3TK7A 4TV5A 4J35A 3P8IA 3GVGA 1QNOA 4M1BA 1IV8A 1DXEA 3BLLA 4OKDA 1OM0A 3VX0A 2Z1SA 4HJWA 4PTWA 4DYJA 3VFLA 3U7VA 3KVMA 3TTEA 5A95A 4MWAC 2GWNA 1R2RA 1HL2A 4A3QA 4XD3A 5LNWA 2EG8A 3VKCA 4I3GA 2CLKA 3LCGA 5BYWA 4DO7A 1SM9A 3LI0A 4HMEA 4WVXA 2VFFA 3TA6A 2DU2A 5E6ZA 3DERA 4JL1A 4MSSA 4ICCX 2OQLA 2CZEA 2FZNA 4ZSUA 3IJ8A 4JOMA 3DG7A 2DIKA 1FFRA 5G1TA 4DRSA 2PDIA 3PAJA 3EDJA 3PJUA 4W8BA 1QWKA 2NX9A 4IIHA 4M1RA 1OF6A 4YHGA 2A3HA 1UWIA 4S3KA 2VL4A 4GUFA 2Z6IA 2ZC1A 1D3CA 3F5KA 5HNNA 1QR7A 4A35A 3WUBA 4WF7A 4C6JA 3L0GA 5EY5A 2HCVA 1DBTA 1V93A 3BOLA 3BLKA 1NWRA 4Q8PA 3VKJA 5E93A 3LGEA 4LUJA 3T08A 4DUWA 4HYRA 3STEA 3ONCA 3TC7A 4J9JA 1I60A 1I9CB 2PDGA 5HULA 4OECA 1QK0A 4GISA 3S83A 3GTNA 1QHPA 4GJJA 1W91A 1XBYA 5G5IA 2OCZA 1BYAA 1YNYA 3RAOA 4UTKA 2HXUA 5FAJA 2C18A 3FYPA 3UJFA 4IF2A 4ADUA 2EG6A 4GFIA 2J62A 4AIOA 3YPIA 1YDOA 3VOHA 2WXDM 4MZ8A 1OFAA 1TWDA 5A3HA 4MB5A 2YFOA 2FDSA 4DLMA 2E8YA 1TPFA 5DEZA 3UWZA 9CGTA 4QJ5B 3BICA 1HUVA 4NYYA 2Y24A 3NQEA 4FB7A 1RLDA 4TTUA 4AVOA 4JFSA 2FFCA 2PGWA 1LT8A 4PUJA 1XLKA 3UZWA 1S1PA 3WNNA 4LBRA 1EA0A 4HU8A 5FEPA 2VJXA 1ODUA 2ZCGA 2ANUA 2QVNA 1NSJA 2ICSA 3D6NA 3OW1A 1TRDA 1QXLA 4YTRA 3VIOA 4X2RA 1ZPTA 4JR5A 1EOKA 1W1A1 4KGLA 3GD6A 1J2BA 4ADSA 2J79A 3M6DA 4DUXA 3PTQA 3DFQA 2RDWA 1Z44A 2PDWA 3XIMA 1XG4A 3SZ8A 4DWSD 5BRPA 3CUJA 4O1DA 1RJRA 3H12A 4DI9A 2CBIA 3KW3A 1N82A 4O1EA 1VD6A 3TJ4A 1OFOA 2D73A 3U2OA 3TJXA 3I4KA 2G3IA 2NLYA 3W7RA 1DL3A 3L12A 5M03A 2ZFAA 1XS2A 4U10A 4YVXA 3MW7A 4DELA 2BSLA 4E4UA 1NFGA 2Z6JA 4UWMA 2XIQA 3M5ZA 1SU5A 3DENA 3ITVA 1SFJA 1HF6A 4JX4A 1NDWA 2CZDA 3B9DA 1E6NA 2WKLA 3TAOA 2QGHA 1OYCA 3BANA 3I7RA 2Y0FA 1B31A 1XG3A 1E56A 2VX4A 3W71A 2OGYA 5EFFA 1PAMA 1EDQA 5DF0A 2ABBA 3O0KA 1XBZA 1GKPA 2DH3A 4Z0SA 3CMFA 2OSWA 4AZ7A 1OINA 2F7FA 1GOKA 1RR2A 1RLCL 3A3XA 4CD5A 4QNWA 1LRQA 2B7QA 1XC4A 4S3BA 1XLFA 1EC9A 4JTDA 2QUUA 1E6ZA 3H2EA 3QHNA 4PMOA 3CT2A 2J78A 2PF8A 3E12A 1YBQA 1QNRA 4DO6A 2ONEA 2JBMA 3BAWA 1V7AA 4Z2HA 3K1DA 3UBPC 2ZIDA 1ZP4A 3PPHA 1KFCA 1VP5A 2XVLA 4A8RA 3MSYA 3BARA 1GVRA 4A21A 1O6IA 4X60A 4LX4A 3WQ4A 3GUWA 4B3LA 3C86A 3VDGA 1CBGA 3PANA 1EA9C 4TOQA 2VRKA 3F4WA 4M19A 1XSIA 3C52A 2E5BA 5HOSA 3VO0A 4LUSA 3BCFA 2DVUA 4LVFA 2Y88A 3SFKA 1B54A 4CNNA 1MUWA 3EA3A 3GY1A 2DW7A 2PC4A 2ZA1A 3W53A 2G3MA 5DBUA 1US2A 3PJWA 3KOWA 1B3XA 3FEMA 1ME7A 5CPLA 2BXZA 4TIMA 1KB3A 1WDPA 3VNYA 3AIRA 1I6NA 3MTWA 5D37A 1W1PA 4OGZA 3VA8A 1E9ZB 1J0HA 5I07A 3OHIA 3IJLA 3F4DA 3W1UA 4HOXA 4FP1A 2YA1A 4IMFA 1UR8A 5EPDA 5CAHA 1H50A 4W8LA 2PWUA 4C6QA 5JH1A 3HQ1A 1UH2A 3NQFA 4ZQPA 1XR2A 1BF2A 1E4MM 3LS9A 1WV2A 2PDFA 2G4FA 2PFHA 4ZOBA 2Y7DA 5G1MA 1TVNA 5LSMA 1E0XA 3T2QA 1KM5A 1JL8A 2X0YA 1VFTA 3BGAA 4RZ5A 3GS6A 3TONA 1VKFA 1V0MA 2QHAA 2QYGA 3PULA 5FEWA 3P3BA 4ZQRA 1W0MA 2VENA 5KMYA 7ENLA 5LA1A 4IP4A 3W9ZA 2A7PA 5K2ZA 3GRIA 2DSZA 2NV2A 5EBAA 1W2PA 4US6A 2ZRYA 4PSPA 1SZGA 4C6NA 4KFOA 3V0SA 1P1XA 3NPWA 5LHEA 1UD8A 1W54A 1RQBA 3PSVA 4HJFA 5IRPA 1YIXA 1XYAA 3A21A 3OG2A 3WJSA 2UBPC 4JL2A 1RVGA 4I9JA 4GFSA 3CO8A 5FL0A 4G1NA 1O1ZA 3A3HA 1XLHA 3GTIA 4M56A 4BA0A 2GK1B 5FI8A 1R9ZA 5CZ0A 4B2DD 2QJNA 3IGSA 5CSUA 2IKJA 1A5KC 2RAGA 2C7FA 3VOIA 1ML1A 3I65A 1R38A 5IFTA 3G18A 1X97A 1Y0EA 2NVCA 2PWFA 3G1DA 5IDZA 1U2YA 4PSRA 4XZHA 1QO5A 3MB9A 3OGVA 1OG0A 1YYAA 1Q4NX 4C90A 4O54A 2PLJA 3BLIA 3OYXA 2IKGA 4FNPA 5AC5A 2BVDA 4UR7A 1KM2A 4AZIA 3GVVA 3N4AA 2W3ZA 3T40A 5HQMA 3RRAA 4F48A 4G7EB 1XGDA 2J9ZA 1MNSA 3T4CA 4J3TA 4IUGA 5CPSA 5FJTA 4H2HA 1LWJA 2D2OA 2QEZA 1FHUA 5I3FA 1UH4A 3UY8A 1A80A 2VWTA 3BLEA 4O8AA 2PC8A 2FZBA 1ZAHA 3N6HA 1JUBA 3KCJA 2XISA 3GFZA 3TTSA 4A8IA 2HEJA 3C6CA 2WO5A 3GC4A 3E2RA 3IACA 2X30A 4K8HA 1TMQA 1FCQA 2WWCA 1JUKA 3DKLA 3CYJA 1E9LA 3KOZA 4LNYA 1P7TA 4B4FA 5FAGA 3CZLA 3GDTA 4KIRA 2E3ZA 1AJZA 3DFPA 3CASA 3B0PA 1B30A 2Z7KA 1KR0A 4ZB0A 2Y61A 4PH6A 1B9ZA 4IPLA 4BF9A 4JYFA 3B9AA 1G94A 1Q6OA 1Q66A 3LBOA 4ERIA 2VRQA 1DJWA 4D8AA 4X63A 1Z41A 2YFNA 3A13A 4W5UA 3GXNA 1XLGA 4KCUA 5D2WA 2PDJA 1KTBA 2X1RA 2NSOA 1TJRA 5A2AA 3IJ9A 4LVDA 4AZGA 2E28A 4S23A 2INEA 2RJHA 4UTLA 1RHCA 3C5QA 5G1YA 1G6CA 4KKXA 1AL7A 1KXTA 1EOMA 5K9CA 3GSMA 4CGTA 2I1OA 3MHFA 1C93A 3SUVA 2J7BA 3WLHA 2J4GA 5A2BA 5CEWA 4U3AA 1O7AA 1WOAA 5LXEA 3LOTA 2ZQ0A 4NZ3A 1KM3A 3ALGA 1S5TA 3CWNA 3JW7A 1K4HA 1FCUA 3EKGA 1S39A 3WMLA 4O4WA 3ABQA 4IJRA 5HR7A 4AC7C 4ZMGA 2V63A 4KQNA 3LHTA 3C2RA 5BXRA