3OZPA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with pugnac
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-acetylglucosaminidase
publication title Active-pocket size differentiating insectile from bacterial chitinolytic beta-N-acetyl-D-hexosaminidases
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase/hydrolase inhibitor
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ozpA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3ozpA01
1QHOA 1V3IA 2J79A 5ABGA 4TOQA 5GNZA 1F4HA 1E9LA 1S46A 3CIVA 1DEDA 1JF6A 1KFWA 4PN2A 1KR0A 1XSIA 3VD5A 1HJWA 1HX0A 4PMXA 2CBIA 3BGAA 5E6ZA 1GZJA 1ODUA 1B3YA 1W3LA 3RILA 3VKKA 4D6HA 2ZUSA 3OZOA 1HJSA 1NWSA 1E6ZA 3OLIA 4QCFA 1UYQA 4LYRA 5EB8A 4AD1A 4D6CA 1UR0A 4A3HA 1J9YA 1Q6EA 1Q6GA 1JFXA 1QI3A 2CKRA 5IHRA 5ABHA 1R85A 2IXVA 4DUWA 3FHAA 4JFTA 1E70M 1TA3A 4WLCA 3SUSA 4J3SA 4UNIA 5KZ6A 3ZM8A 1V6UA 4CU7A 1I75A 2ZUMA 1PBGA 2XFRA 2EPLX 4OJYA 2WB5A 3GZAA 5CZKA 2GDUA 3VD7A 1Y7VA 3W26A 5IXEA 3GH5A 5A2AA 4UFMA 1E43A 2VRKA 2WCGA 3U5UA 1E6SM 1GQIA 4B3LA 1V02A 1JYNA 4AZCB 3MO4A 1E6QM 4HOXA 5FOOA 1R7AA 5JIPA 3AIWA 2CBVA 1CEOA 3NSMA 3PTQA 4ACYA 2YA1A 1VRXA 1WZMA 2EJ1A 1JYWA 2Q8XA 1CENA 2JF7A 1YQ2A 2WBGA 1UKPA 4WIWA 2Y2WA 3ARWA 4TUFA 1DWIM 3LPFA 4OUEA 4KMQA 3M7SA 5HXMA 1GOMA 4UOQA 8CGTA 4U33A 4BZYA 3ZR6A 1FFRA 3F5KA 2W91A 2YOCA 3QR3A 4U5IA 5CPSA 1MXDA 3RJXA 2ZXDA 1JAEA 3II1A 1KQYA 3JUGA 2BXYA 2WSPA 2HISA 4GQQA 2OSYA 1QVBA 3OGVA 4WKAA 1G1YA 1V0KA 1XGZA 1WP6A 4LYQA 3GXMA 2VRQA 4CU8A 2B31A 2E9BA 2ZOXA 1ISZA 4Z2LA 2VO5A 1A3HA 2ZX8A 1IZKA 3EDFA 4HOWA 1OD8A 1UD3A 3VX1A 1JD9A 3WUEA 2G3NA 2XGBA 3NDZA 5D8ZA 3SCUA 1KR1A 2WC4A 4GI9A 3VGDA 5I78A 2F8QA 2WCSA 2D3LA 4HPHA 3FN9A 2J7FA 3DYMA 4OBRA 3PZ9A 1V3KA 4P8WA 1HKMA 2J7HA 2Z1KA 4AD2A 3VNZA 4E4PA 3PZMA 1V3JA 2J7EA 2YBUA 4MAZA 1BLIA 3HMCA 2YA0A 1NARA 3ARPA 4IPLA 4PMZA 2XFFA 2FH6A 1QW9A 3T0BA 3TTOA 3AS0A 2JFEX 2W5FA 4D72A 2XVKA 1VEMA 5CLWA 4IM4A 5I79A 2A3AA 3WMCA 2VR5A 2PWEA 1JXJA 1JG9A 3NCOA 1XCXA 4R27A 2E9MA 4M1RA 1HVXA 1HT6A 1LLOA 4CD4A 4U5KA 1Q6CA 1W2PA 2QMKA 2G3JA 3VMOA 5A69A 1B1YA 3WD2A 2D3NA 5A8NA 1LWJA 1WDRA 5FCZA 1OT1A 2O9PA 4GZJA 1BG4A 5D8WA 1B9ZA 4XX6A 1OB0A 3MV11 4W84A 1SMAA 5FL1A 1CWYA 1CBGA 2YDRA 3WQ8A 4JIEA 4F9JA 4FK9A 2YDQA 5BXTA 3MUAA 2BHUA 2W62A 4FLOA 1BFNA 4TVUA 3O9NA 1V6WA 1WZAA 2VR4A 4BF7A 1UKSA 1HKIA 3AS1A 2F61A 1H5VA 4UOZA 2D23A 3VGEA 1UWSA 2PWFA 2WWCA 2CEQA 3MKKA 2XJ7A 1W9DM 1CNVA 1OIMA 3BSGA 4AZHA 5IDIA 2ESCA 2UY3A 2WBKA 2V38A 4MAVA 2WYSA 4OKDA 2W61A 4HMEA 4QDMA 5A6SA 2VUYA 7A3HA 4CCDA 1XD1A 1IZJA 1GQJA 3FXYA 5BYWA 2BS9A 1X1NA 3K8MA 3WIJA 1C8QA 3OLEA 4CKQA 2BHYA 2V3EA 3FAWA 1MW3A 1QHZA 1KXVA 2WSKA 1PZ2A 1R8LA 4FLRA 3RM4A 5CLTA 3WNLA 3QOMA 2XPKA 3WFZA 1JD7A 2VZVA 1NOUA 4UQAA 1C7TA 3ZJKA 2WC7A 1H11A 3AIRA 3RIKA 1W9UA 1JZ8A 4C91A 1UA3A 2WPGA 4OZOA 1V0LA 2O9RA 1P6WA 2FHFA 4NZCA 4PRWA 1UWTA 2XSAA 4CCCA 2GVYA 1ECEA 2WMJA 2JEQA 3SCOA 3AROA 2ZE0A 5HPOA 3PZGA 1PX4A 3ARQA 1CLVA 1LJYA 3TTYA 3WQ6A 1KGUA 1M53A 2J62A 4J28A 3W28A 1WDQA 1RP9A 4OOZA 2VOTA 5CQ1A 4Z2HA 5HPCA 1JDDA 1ZB5A 1HF6A 3NSXA 5EBAA 2FHCA 1JYXA 3OGSA 3WQ4A 2D22A 1EO7A 4W7UA 3BXWA 1V08A 1OCQA 2DH2A 1KWKA 1WAWA 1DWAM 2W4XA 2Y4SA 4CVUA 1UD6A 4NSBA 1NM9A 3PN8A 3MMWA 2GK1A 1KB3A 4ZFMA 1EXPA 1GOOA 4HA1A 3CGTA 2QHAA 3VGFA 3SCTA 1OGGA 2CHOA 4UFHA 1GOWA 2WVVB 2QPSA 2YIHA 1XSJA 3GM8A 1KWGA 4IISA 2QLYA 2ZUUA 1YHTA 1ZJAA 1BVZA 1WO2A 4F9DA 2DSKA 3BLPX 1M7XA 2PWHA 3GXIA 2WVSA 4GXPA 4BA0A 1QW8A 3QHOA 4U3AA 3B9DA 3VD4A 1V0NA 1H41A 4PSRA 2ZXQA 1KXQA 3VIMA 2XHYA 1HNYA 1JYVA 5DT7A 3W24A 5EFDA 4AZIA 2PB1A 4UQCA 4Q7NA 3WL1A 1J0JA 2UY4A 2XWDA 2OWCA 2OSXA 3N12A 1ZS2A 5JBDA 1H49A 5A1AA 3THCA 2QF8A 3ARTA 3VM5A 4AD3A 4ACZA 1LWHA 1UWRA 5D4YA 3WUBA 4CCEA 4YPJA 3W25A 1HVQA 1VJSA 1CXEA 1XRVA 3OG2A 3SUUA 1VB9A 4PMNA 1E4IA 3UETA 1J01A 2BVTA 2DPEA 3WDIA 1E55A 2JIWA 2OYMA 2DEPA 3UESA 3WUGA 1WZKA 3WD0A 1FH8A 1QOXA 2FH8A 2VCBA 3WMSA 4D6GA 1ISWA 2EPOA 2DT0A 3SUWA 1QNOA 3L4VA 2D0FA 5A2BA 3WNMA 5ABEA 1O7AA 4CGTA 4NRSA 2EBNA 4UFJA 4MB4A 1D2KA 3APGA 4AY1A 3WEOA 4MDPA 1TFVA 3SCNA 4EANA 4PMYA 1MWOA 5A6MA 5GQBA 2XTKA 2BFGA 3HU7A 1OIFA 2WNWA 3BCDA 2FDMA 2WANA 3OGRA 2JE8A 4MB5A 2FGZA 2ZUTA 3FY1A 1ITCA 1J10A 3PZNA 2AMGA 3GYCA 4AYSA 5KEZA 4YN5A 2ZIDA 3AMLA 1JDAA 1VEOA 4W93A 3WENA 3RMEA 3WDQA 3N17A 1E5JA 1B90A 4AIOA 8A3HA 1KCLA 3PZVA 4JCMA 1FP9A 4AWEA 3KEHA 3EBVA 4U2ZA 4U3CA 5JUVA 3THDA 2YBTA 3NDYA 3MU7A 1G01A 3CUFA 4AIUA 2DT3A 2E3ZA 3PBGA 3ZOAA 1HP5A 1C90A 3TTSA 2J78A 3VIOA 4HOZA 3AHVA 3A3HA 1PX3A 3NIYA 4N42A 3WNPA 3PZQA 4CN1A 4ATLA 3F5JA 4X9YA 1MFUA 1XH1A 1A47A 1H09A 3VD9A 4HU8A 1E6PA 1W2VA 3VIPA 3W0KA 1SMDA 3MUZ1 1PPIA 4AC1X 3AJ7A 3CHCA 5LA1A 3W37A 1G5AA 3EDDA 5AYIA 4JCLA 5D9PA 3TP4A 2CHNA 2GJXA 1E4MM 3O2LA 3AZTA 2WKGA 1CTNA 1OSEA 1UR9A 2AOSA 4AZGA 2ZUVA 4AD5A 1QI5A 1C3FA 3MS8A 3CHFA 1BSIA 5LA0A 3L4YA 3RDKA 4MJ2A 2WXDM 2CNCA 2VX5A 4PTXA 4N0RA 3AZRA 5FL0A 1CGWA 1FH9A 1G9HA 3WN6A 1UD5A 2ZXAA 1GW1A 3ZT7A 4DWSA 2G3IA 1UHVA 3GBEA 3WNNA 1HJUA 4HZ7A 1VFUA 1K9TA 1PJ9A 1EH9A 2WZIA 5E6YA 1EDGA 5BWFA 2YLLA 4ZXLA 5E0CA 4PTWA 1TCMA 4GPNA 4AXNA 4JL2A 3AMDA 4W87A 5CSYA 4M81A 1OBAA 3WF3A 3LPGA 2WC3A 2J8FA 4YHEA 2CXGA 4HMDA 5E70A 1H2JA 4KGJA 1E6RA 3T0DA 5IFPA 2XGIA 4P7OA 3NUKA 3CZJA 1TMQA 2J7DA 3DECA 1E72M 2JF6A 4KGLA 3VIIA 3E1F1 3RO8A 4EE9A 5A6AA 7CGTA 3WY1A 2TAAA 1WDPA 1E3XA 1TUXA 1JZ5A 3WDHA 5DEZA 3CPUA 5C71A 1MQQA 1NOFA 4LXFA 3CZ8A 4B9YA 1W3HA 4RL3A 1B0IA 1FA2A 4JFUA 4W5ZA 5DO8A 5GPRA 1VFFA 4W86A 3BSHA 3U7VA 1DWHM 1GORA 2E4TA 3CLWA 3AIUA 1GPFA 3WD3A 1AVAA 3MV01 4V2XA 1QNRA 2VJXA 2CPUA 4BCEA 4UZUA 2PF0A 4GKLA 5GNXA 3BH4A 3ARZA 1B3XA 3EMZA 1XH2A 2YL5A 2QMJA 1HXJA 2OYLA 3ARYA 5ABFA 1J0IA 3M07A 1DP0A 2YKKA 2EPKX 2J7CA 1W9PA 1NWTA 3N9KA 1J0ZA 5A8MA 2NW0A 5AYBA 1DWGM 3SCQA 1J0KA 1Q4NX 4B15A 4AZ5A 1GVIA 1RD6A 2BY2A 2IUZA 2V3FA 4OIFA 3T2PA 4EKJA 4TX6A 2UY2A 4P7RA 4AMCA 1KBBA 2D20A 3RCNA 2XIIA 4Q22A 5HNNA 1BAGA 1OT2A 3LMYA 1UD8A 2WHKA 3PTMA 1JZ4A 3EDEA 3ARUA 1CIUA 3PZTA 2CKSA 2XFYA 2FGLA 4L4PA 1ISXA 2EPMX 3QOKA 1XYFA 2J25A 3TA9A 1H3GA 4W7VA 1QI4A 3WDRA 1DWJM 2VC9A 3O6AA 3AMCA 3B9EA 2PC8A 1BHGA 2X1IA 1K9EA 1V6VA 2E0PA 2RGMA 1EO5A 3ZT6A 1ZU8A 7TAAA 3WD1A 3K8LA 4W85A 1FH7A 3OIHA 3MMUA 1OD0A 3ZIZA 1GHSA 3CUGA 1ISVA 4AEEA 3BAYA 2G8ZA 1UWQA 4J3VA 1ODZA 4AIEA 2JIEA 4XZWA 4GO8A 5A95A 1BYBA 1MW2A 4D6JA 1G0CA 5AC5A 2VX4A 1BQCA 3ALGA 2VI0A 2WKLA 3AMKA 3CMJA 3UG4A 1EIBA 3SCSA 5A8QA 1X6NA 4MNMA 3KE0A 1QPKA 5I6SA 1B3VA 3AXXA 3D3AA 1H1NA 3ARRA 4J27A 2WMIA 2J74A 3AHYA 2VRJA 3VNYA 2VNCA 3AMGA 2D2OA 3IJ7A 1LG2A 3GNRA 2W92A 3AZSA 3NSNA 1LQ0A 4Z2KA 2MANA 1MVYA 5E09A 2XYLA 3UG3A 2WHJA 3TOPA 3KWXA 3FHQA 2J77A 2PI6A 2A3BA 1BTCA 2UWFA 1CDGA 2ZUWA 1VENA 2PWDA 1UKTA 4EAMA 4WKFA 2XVLA 1QNQA 1TA3B 2XM2A 3K4AA 4GZIA 4X0NA 3GXFA 2OYKA 3VUPA 1NQ6A 5CG0A 1WE5A 1PIFA 1QI0A 3L4UA 2DGAA 4C7FA 3EDJA 3VIJA 3ZJ7A 2XVNA 1KXHA 1AMYA 4OBSA 5A6BA 3OLGA 2DIEA 4C7DA 3AHZA 4XB3A 3GNOA 1BYAA 3I3BA 2X09A 2PBOA 1VFMA 2O92A 2CIPA 1UD2A 3OLDA 1OWQA 4Z2GA 1W1YA 2XM1A 4GQRA 4CVWA 3ZO9A 4WSKA 3N1AA 5CSUA 2ZX7A 4PSPA 1K6AA 1QHPA 4H7VA 4NF7A 3WEMA 1B3ZA 4GINA 9CGTA 2GJRA 3SCWA 4JKKA 1RPKA 3EMQA 3CUHA 1VBUA 3NJ3A 2YL9A 1Q6FA 1CYGA 1F4AA 4AZ6A 1E73M 4JKMA 3ARXA 4PUDA 2GUYA 3MUIA 1XHGA 2J7GA 3DYOA 3L4XA 1B31A 3AIBA 1ITXA 5DFAA 2VZOA 3DHUA 1L0PA 4RE3A 4GO9A 2WM0A 4HP5A 4LPCA 5I3DA 4W8BA 3KL0A 3RPMA 1DTUA 2WW5A 1XSKA 4UCFA 1H0IA 4J3UA 5I24A 3BAKA 3BAXA 1E6NA 2G3MA 1MW0A 1C8XA 2E9LA 1QBAA 1IV8A 3A4WA 4ATWA 2GFTA 2C8NA 4B9ZA 5FIPA 3RM8A 4HZ6A 3UCQA 5A3HA 1L8NA 2CITA 2ZX6A 3AFBA 1PEZA 2GDVA 2O9OA 4XZBA 1E4LA 2DSZA 5F7UA 1I1XA 2DH3A 2BY3A 2YA2A 4HTYA 3WD4A 3CHDA 4H04A 4QAWA 1AQMA 2X05A 3WSUA 2Z1SA 1BGGA 1UZ4A 3SEPA 1FHLA 4JZ5A 1BYCA 4PMQA 3W38A 1WDSA 2BY1A 3ALFA 3VIKA 2Y24A 4AZCA 1MXGA 2XG9A 2C7FA 1E15A 3VTRA 2D0HA 3IAQA 4W88A 3AIVA 3VO0A 3SCVA 1PZ3A 1CGTA 4M29A 4H2CA 4PMDA 2QPUA 1CGXA 4UOJA 1MYRA 4PMUA 2DSUA 1CGUA 2WMKA 1TE1A 1E71M 2YLAA 5CPQA 1RP8A 1U33A 1BPLB 3ZJ6A 3VGHA 2QV4A 3GH7A 2VQTA 1KQZA 1B2YA 3DC0A 3VD3A 1XH0A 2WK2A 4J7RA 4UZSA 1W32A 1JI1A 1XC6A 1EDQA 4PMVA 5CGTA 3AYSA 5GNYA 3RM9A 3VM7A 1OGBA 2A3EA 1NWRA 3CZEA 4ZENA 4MDOA 1QNSA 1V02E 1GVYA 1NWUA 4D1JA 3EDKA 3CMGA 3VDAA 3WQ5A 1E40A 3WUFA 3U7BA 1U30A 1E4NA 2J7BA 4GZEA 3AHXA 1W3JA 4ATDA 2V3DA 3W6LA 3OBAA 1U2YA 2VURA 1V6YA 1JL8A 3WBAA 4FF5A 3WFLA 5EFFA 5JBEA 1OINA 4QLJA 1ISYA 4IUGA 4E8DA 3EMCA 2RGLA 4DM2A 5FD0A 1UZ1A 3FNDA 3GNPA 5E0FA 3WH7A 2ZWYA 4HZ8A 3WNOA 3CZLA 4D6DA 5BRQA 4KRTA 1UQYA 1CGYA 2VT0A 4WF7A 5IFTA 2XUCA 5C70A 1PAMA 5A94A 1W9XA 1V3LA 2V5CA 3AHTA 3QHNA 1ZJBA 3ARSA 1EDTA 5A2CA 1JZ2A 2ZX9A 3LPOA 4W89A 4DUVA 4R5EA 5I0DA 1B3WA 3VDCA 4QLKA 4L4OA 1XD0A 3NYDA 4JFWA 3W81A 5LA2A 1D3CA 3WQVA 5BXPA 1J18A 2FHBA 2VZTA 1EQCA 4Z2IA 2WMFA 4WK9A 4HPGA 1EOMA 3VMNA 1UR4A 3VIGA 5I77A 3KL5A 2X0YA 2DSVA 4P7NA 3W29A 1O6IA 3I3DA 1EQPA 2V5DA 1UR2A 2OWXA 4FLQA 1UQZA 4JHOA 4UQEA 2BHZA 1VAHA 3ZSTA 5A8PA 5AC4A 1KBKA 3CUIA 3WF0A 2F2HA 6TAAA 3BCFA 1EGZA 4MPKA 4MTVA 1QI2A 5A8OA 3AYRA 4RE4A 3D5HA 4M24A 3DYPA 3ZJ8A 3WF1A 4OOUA 1MQPA 2WVUA 1UWUA 4S3KA 2HVMA 4MADA 2ZWZA 5HDRA 1JGIA 3AS3A 2W63A 2CCRA 4MJ4A 4E2OA 3WL0A 2J47A 4A4AA 1GCYA 3SUTA 4ML4A 3ECQA 2CYGA 2EPNA 4CUCA 2GK1B 3VOCA 1ZL1A 4D71A 1OM0A 2E8ZA 3I3EA 3HJEA 5LYRA 4D6EA 2G41A 1EA9C 1GJWA 3CO4A 4HU0A 2WVTA 4XV0A 1BF2A 3UG5A 4CD5A 1MFVA 4YHGA 4KH2A 1HKKA 1ZBWA 1FOBA 3WH8A 4BQ4A 3UEQA 3CHEA 3VGBA 1HJVA 4JL1A 3VVGA 4AEFA 1C7SA 4C90A 3VIHA 5HOSA 2VCAA 3A6OA 5DT5A 4U2YA 1TVPA 4UQBA 4TTGA 1W3KA 1M01A 1W91A 3GXDA 2Y8VA 4QCEA 4C7GA 1DHKA 3TONA 1V3MA 2UY5A 3M46A 3OZPA 2BV9A 1W1PA 4X0VA 1E3ZA 1GOQA 4H8UA 2JEPA 1UUQA 4MB3A 2VZUA 1JF5A 4DUXA 4GI6A 5I2UA 1VIWA 2ZUNA 2ZICA 3AS2A 3WH6A 1E6XM 1HJQA 4DWSD 4QLLA 3BAJA 3AISA 1E56A 1NH6A 1EHAA 3SUVA 3MMDA 5E9AA 5C8BB 1SR0A 4ACZB 1E0XA 2YL8A 3T2QA 4AW7A 1J12A 1X6LA 4A3YA 1TR1A 2CBUA 4ZE5A 3PTKA 4GI8A 1BG9A 4UTFA 1DWFM 1UA7A 1JDCA 1HL9A 1SFSA 2X0HA 1GONA 1UR8A 3PZIA 3EYPA 3F4VA 3GTNA 3WMBA 1I1WA 1GNXA 3L2LA 2ZXBA 1E1FA 2X2YA 3KZSA 4PMOA 1HP4A 3AI0A 1WCGA 1M03A 5AY7A 2CESA 4CN4A 4HA4A 2WLZA 1XCWA 3WELA 4P7LA 2XVPA 1J11A 4M56A 4EK7A 3IAPA 3L4WA 2BVDA 3A4XA 1RH9A 4W8AA 1GQLA 2O9TA 2WVVA 2EXOA 4P7QA 2VQUA 1QNPA 3VILA 3FAXA 2XSBA 1M04A 2Y8KA 5A6KA 3CUJA 3VGGA 3W4RA 3QHMA 3S6TA 4HA3A 1JNEA 1WZLA 1W1VA 4PMRA 1GUVA 1CLXA 1VF8A 3T09A 4JFVA 1J0YA 3TTQA 3WF4A 1HN1A 2DSWA 4ZXOA 4AISA 1W9VA 3G6LA 1JZ7A 1CGVA 4RE2A 3AIQA 1D7FA 2E8YA 4MB1A 1V3HA 4CD7A 5JBFA 3J7HA 4J3WA 3BAIA 1GOIA 1JZ3A 2A3CA 4PCTA 2PWGA 4MNKA 5BXSA 1GHRA 1UKQA 3K8KA 2VZSA 4PTVA 4LX4A 3CTTA 4QFUA 2VVSA 4JFSA 1UH4A 1BYDA 1VBRA 2EEXA 1US3A 3VX0A 1LG1A 1CXLA 5D9NA 6A3HA 4B3KA 2J4GA 3B8SA 1ZBKA 1VFOA 2Y5EA 5A6LA 4AZ7A 1IT0A 4JAWA 3K4DA 2GJXB 2XWEA 2J75A 2VCCA 2VL4A 2XVGA 5CJ5A 1HL8A 1MQRA 4DWSC 1HIZA 1GJUA 6CGTA 5BXRA 3W27A 4BQ5A 4PEEA 3UR7A 1FHDA 3OB8A 4HMCA 2AAAA 5CXPA 2BNJA 4W5UA 1LL6A 2CBJA 4TXEA 1US2A 3ARVA 3B9AA 1ZBCA 1NOWA 4DWSB 4LYPA 2GJPA 4BS0A 1UH2A 3L4ZA 5CGMA 1E0VA 1FP8A 1BGAA 4ZEPA 1KGWA 3VPLA 1E1EA 3W53A 5I5RA 1V03A 1AQHA 5D9OA 1SYTA 1XYZA 4TVDA 2WHMA 5I23A 3POCA 3LPPA 4MNLA 4F8XA 5JIWA 5BCAA 1CXFA 4D1IA 3VDBA 4FMVA 4F66A 3WF2A 1UWIA 4UFLA 1ESWA 1C92A 1UH3A 2YL6A 1JI2A 3W82A 4XUYA 3T2OA 4MNJA 4Y7EA 1C8YA 1LL7A 3VDHA 1R86A 2E40A 1TG7A 5M5DA 3ZMRA 3VIFA 3MUY1 2VX7A 1MW1A 2DQXA 5M17A 1HKJA 3KL3A 1LL4A 1N82A 1FFQA 4WJXA 4F79A 1UKOA 3AXIA 2NT1A 2VVNA 5BROA 3IK2A 5DF0A 3PZUA 4WSJA 2GSJA 3OA5A 5EMYA 5TD4A 2VMFA 1Q6DA 2CERA 3K46A 3AXHA 3GDBA 1UG6A 4AZBA 4URIA 4H8VA 2W66A 2D1ZA 1NP0A 4JKLA 2WHLA 1JIBA 4BQ2A 4PBGA 1W9BM 5A6BD 4H8HA 2EQDA 3VMPA 2D24A 1JXKA 3PHAA 4UFIA 3U5YA 4UFKA 3SCPA 1AQ0A 4PTMA 5ABFB 3CZGA 3A4AA 3W6MA 1B30A 5ECUA 1WB0A 1C91A 1VJZA 1G94A 3T0AA 4ZE4A 2BVYA 1K9DA 4K68A 1C93A 3ZR5A 4JHZA 4S3JA 2NSXA 2WMHA 3CH9A 1CXHA 3BMVA 3UERA 4LQ1A 3WDPP 3WQWA 2XIBA 3N13A 1JFHA 3AQUA 2YDSA 1EOKA 1Z32X 3POHA 5A6JA 3VINA 4UR9A 1V0MA 3PZOA 1CPUA 1WNOA 1ZBVA 4M80A 3IJ9A 4B16A 2W67A 4AD0A 5D9MA 3CBWA 4TX8A 3A47A 4J3TA 1OGSA 4UQDA 5M3WA 1R87A 3L4TA 1R7OA 4W7WA 3FW6A 3WKZA 3MSGA 1PX8A 3SCRA 2WCAA 1VEPA 1UD4A 1EHNA 4PYSA 4W8LA 3MSDA 3DHPA 3WH5A 1TZ7A 3IJ8A 4LGXA 1H4PA 2BXZA 1E5NA 3GBDA 4P8UA 5CPTA 3QGVA 3AICA 1LF1A 1WPCA 5M03A 3GH4A 1KXTA 3SIMA 3T08A 3BAWA 1UOKA 2NT0A 2WAGA 1PIGA 3HN3A 2VX6A 1GOKA 1W1TA 2D0GA 2V3GA 3N11A 3MANA 4CU6A 3L2MA 1GQKA 2J8GA 4QP0A 3RJYA 3BC9A 2OLHA 4NRRA 4M8UA 3ZT5A 5IHSA 4AD4A 4P8VA 3VU2A 3AIEA 1H0GA 2WWDA 1E0WA 2DDXA 2IXUA 1QBBA 1JAKA 2WMIB 1WKYA 2OWWA 2WZEA 2CETA 1KCKA 2DIJA 3N04A 3F5LA 1BVNP 3K1DA 4BQ3A 5DMYA 1CXIA 4IPNB 4WKHA 4CN6A 4D6FA 1NP2A 4H41A 4J3XA 2PBGA 4V27A 4P8XA 4TTUA 4UQ9A 2WMGA 4KRUA 1CZ1A 4KWUA 4FLSA 2OSWA 3WEZA 4U31A 1KGXA 3UR8A 5FKYA 3WBEA 3BMWA 3S2CA 2EO7A 5BRPA 2DT1A 4CD8A 2A3HA 4DM1A 3BLKA 4M82A 4CD6A 2JALA 2VTFA 2WLYA 2WZHA 3IANA 4NI3A 3SURA 1UR1A 3G6MA 3U57A 1V6XA 5HBFA 1TVNA 4PUEA 3WDJA 1HJXA 4PCSA 2ZX5A 1XV8A 3AOFA 2BY0A 4TVCA 4D6IA 3M6DA 2G4FA 4Z2JA 2YJQA 1JZ6A 3CZKA 2X8RA 3ZQ9A 3N18A 1CECA 2C0HA 4GIAA 1CXKA 3WNKA 1J0HA 4E8CA 4V28A 1JNDA 3N15A 3WH9A 3ZSSA 2DT2A 1K9FA
chains in the Genus database with same CATH superfamily
5ABGA 3UJRA 1F4HA 3Q65A 4KCTA 3CIVA 1YDNA 3VOGA 2ISDA 3EX2A 1NJJA 3QJAA 2JK2A 3VD5A 3OYXA 4TU1A 4PMXA 3IGHX 2OODA 4E4UA 4NNAA 1XLDA 3O6CA 1B3YA 1W3LA 3DU0A 1FWWA 4GY0A 4UBPC 4GVGA 3OZOA 3L0GA 3F4WA 1XGDA 3P7YA 4DJFD 1UYQA 5DBTA 2XH2A 3WLMA 3WJYA 3STFA 1J9YA 1XBZA 3KOXA 2OT1A 1EWEA 1FHUA 1JFXA 4FA3A 3VCRA 4F3HA 3FHAA 2ZDSA 1QU4A 1TA3A 2X42A 3EKLA 4V15A 3VDGA 4AY7A 3FGCB 5KZ6A 2V2DA 4QISA 1B4KA 3PWAA 1PBGA 1ZQ5A 5EPDA 4KPLA 5CZKA 5T8GA 3PP7A 4LC6A 5IXEA 2UZ9A 2XU2A 3DFQA 3WCZA 1DKWA 2BOFX 4B3LA 3MO4A 5EL1A 1MEWA 3AC0A 1EP2A 3GKAA 1AFSA 3UXLA 3NQFA 3UWWA 1VHCA 4ZO8A 4JNMA 3S8HA 3MUXA 3N6JA 4CNSA 2Q8XA 1RSCA 5KZDA 4XO6A 4WDWA 4HA0A 4AHPA 1L6WA 7REQB 1TWZA 2WBGA 1UKPA 4WIWA 5E93A 6ALDA 2Y2WA 2A2IA 2PDGA 5KITA 1XQLA 4BZYA 3BCJA 5EJ1B 3K5XA 3SDOA 4U28A 4LT9A 4ZSTA 3F5KA 3TWBA 2POZA 2YOCA 3UJFA 3QH2A 3QYQA 4B4HA 5CPSA 3THAA 1MXDA 3AU2A 3RJXA 3BOXA 3E5BA 4ZMGA 1QR7A 3JUGA 4WVXA 2WSPA 2HBVA 1QVBA 1G1YA 4IFKA 1XGZA 2KAUC 1RJQA 3IUIA 3OPSA 4KFPA 2RJHA 2VRQA 2QAFA 2QPXA 1IQ8A 3TWAA 1V4YA 4PFMA 2E9BA 2ZOXA 1ISZA 2VO5A 1JUEA 4MUZA 3EDFA 4HOWA 1OD8A 1UD3A 1ZGDA 4Q4KA 3BLFA 3NDZA 3W2LA 3GVGA 3VGDA 2WC4A 2WCSA 3LB0A 1FX6A 2D3LA 4HPHA 3LU2A 4J1OA 4J5NA 2ZA2A 3R7MA 4UTUA 3DDMA 1WXYA 2Z1KA 4PGLA 1X38A 3SQLA 3XIMA 4RNFA 5BW6A 2J7EA 2FIQA 3PF3A 1TJ0A 1EPXA 1TRDA 4YU1A 1QW9A 2RJGA 5BNKA 2CZFA 4IM4A 4DJDC 2YCLB 4P5UA 2A3AA 5FF2A 4M1BA 1IE7C 2Z4GA 1TUFA 4U4MA 4R27A 2FMOA 1KM4A 3F7JA 4QR6A 1RLCL 1BKSA 3F1QA 1FWEC 3QC3A 5A8NA 3NQ2A 2QCCA 1LWJA 4DY1A 1OT1A 3QLLA 5LNRA 4GZJA 1BG4A 5D8WA 5HWMA 2QCMA 3E02A 3O0FA 2G95A 1UJQA 4Q8MA 1YXCA 1SSGA 3V1PA 1CWYA 1Q6RA 2YCJA 3TMQA 4ERIA 3ITCA 1CBGA 1XIJA 2CZVA 4JIEA 5L9FA 2YDQA 5BXTA 2E67A 2RHGA 2W62A 3GXTA 5F2GA 3EGJA 3O9NA 4ZB2A 2RFGA 3MB9A 2HXUA 4UOZA 3CQJA 5CSRA 1AD1A 3HQ1A 3WBYA 2WWCA 4KFNA 5CZJA 1RLDA 1W9DM 4IX2A 1CNVA 3BSGA 3VNIA 4AZHA 5IDIA 5LHFA 1FXPA 3MO7A 3M0VA 5FSDC 3MWAA 2R82A 1QOQA 2R24A 4MUPA 2I5IA 3VABA 4QDMA 4FB7A 4L1WA 5A5WA 2X40A 3E2VA 4ONVA 7A3HA 1XD1A 1AJ0A 3FXYA 3VKDA 5DN1A 3K8MA 4LCSA 3OLEA 2FPTA 4CKQA 1PTGA 4A8NA 2BHYA 2X1RA 3RLGA 4FX8A 2WSKA 3QFEA 4ORIA 3WNLA 1JD7A 2WC7A 1CX9A 1G69A 1H11A 3AIRA 2BGQA 1AJZA 2WPGA 5EMLA 1SGJA 4Y6GA 3NZRA 1G7VA 3UNTA 3VI2A 3TW7A 4N02A 3MDUA 3AROA 3PZGA 2VXNA 2Y7GA 3ARQA 2QVNA 2DJLA 3QZ6A 3TTYA 4HYRA 1UMYA 3LHYA 3P62A 2ZC8A 2J62A 4J28A 2VOTA 5CQ1A 4Z2HA 4ZOBA 5HPCA 4KIEA 1O4UA 1GVQA 3NPXA 3M43A 5CPMA 2PWVA 3OGSA 4ZQRA 2V8ZA 3BXWA 1GQNA 3DN5A 1OCQA 4F0KA 2DH2A 1DWAM 4PL1A 1P7TA 1KFEA 2Y4SA 1UD6A 4NSBA 3VNKA 3MMWA 1AH0A 1KB3A 1QXLA 1X98A 2GUBA 1DOSA 4O1DA 3H4GA 2R6OA 4DAFA 1FWCC 3SCTA 1EJWC 1GOWA 2GGJA 3IIXA 2YIHA 3EPNA 2Q8LA 2I9EA 2ZUUA 1YHTA 2VFIA 2GOUA 4F9DA 2DSKA 4YTSA 1SO4A 3NL3A 2WVSA 2CU0A 4GXPA 1QW8A 4BA0A 4L1GA 3C5QA 4U3AA 2PDJA 3LUTA 5BWAA 3FJ4A 4PSRA 3S46A 2XHYA 1HNYA 4D8ZA 3DFSA 5DRCA 4TMCA 4Q7NA 3USBA 2OSXA 5JMUA 5A1AA 1VFSA 4ACZA 1UWRA 4FXJA 2A4AA 2QF7A 2NVDA 4NNBA 3W70A 3W1MA 4I9JA 4PMNA 3W1AA 5C9UA 5C54A 2DPEA 3WDIA 2ABBA 2V2HA 1O94A 3LLXA 3M44A 4N2YA 1WZKA 4RZBA 1FH8A 1MMFA 4XKYB 2VCBA 4J40A 3WLIA 3WMSA 4IUOA 4ZOCA 4E3VA 5T9CE 4KS0A 1YPIA 5A2BA 4NRSA 1YNYA 2EBNA 2XFWA 1XLMA 4AY1A 1K70A 3H2OA 4MDPA 4YWIA 1PWMA 4EANA 1U1JA 4HYVA 4C1NA 4PMYA 3IJLA 5GQBA 2XTKA 2QDEA 3HU7A 2DP3A 2WNWA 4US6A 4MB5A 2DQWA 2FGZA 3WJSA 2ZUTA 3AU6A 1TYGA 4QNWA 2AMGA 3GYCA 3I68A 4AYSA 1S5VA 5KEZA 4YN5A 4W93A 5H8MA 1B90A 8A3HA 3CV7A 3FLUA 2QCNA 2OTDA 1KC7A 3EBVA 2ON3A 1W5QA 4IXHA 4ZVJA 3THDA 2EKCA 5F1UA 3GW3A 3MU7A 1G01A 3CUFA 4AIUA 3ZOAA 4PB4A 3TTSA 3P61A 5K7JA 3WNPA 1H7XA 2PTYA 1SZGA 4X9YA 1A47A 2DW6A 3GC4A 4PTDA 2VEFA 1H62A 2VUNA 3MUZ1 1LBLA 4FI4A 4AC1X 1DJHA 7TIMA 1G5AA 4DPQA 5D9PA 4DO5A 3TP4A 4OV4A 1T8QA 2GJXA 1E4MM 3O2LA 3I7SA 4O0KA 3NYZA 1KCZA 5AVNA 3G1VA 1OSEA 1UR9A 4XTIA 1QI5A 3PAOA 3MS8A 2BGNE 4A8LA 5F2IA 5MKGB 3RDKA 1K77A 1XG4A 1EXBA 1R2RA 1OK4A 3AZRA 2REQB 1GW1A 3ZT7A 2G3IA 3NQVA 1UHVA 2AAMA 1DHPA 1E51A 4AU0A 3P80A 3EWXA 3GG1A 2KX9A 1PJ9A 2TSYA 2PLKA 2XGZA 4LALA 2GPTA 4DBUA 1VIZA 5BWFA 2H3BA 4PTWA 1TCMA 5HJLA 1VQTA 1VRDA 3NEHA 4JL2A 5FJJA 4M81A 2OPJA 4GCXA 2OJPA 2J8FA 3HF3A 4TR9A 5E70A 2GSHA 3S2MA 4HCLA 1GVOA 3CZJA 2HJPA 4ICMA 9XIAA 3ITXA 3VIIA 1QO2A 1SFTA 1XLEA 3SB0A 1DE6A 1KFCA 3UZZA 2QDDA 3IV3A 3PWIA 3VKBA 2TAAA 4GI4A 1E3XA 3RX4A 3WDHA 1M7JA 1DBTA 4NJKA 1VCGA 4Y8EA 3TU9A 1QUMA 1SU5A 1VYRA 4LXFA 4B9YA 2YYUA 1W3HA 1B0IA 3G0SA 4W5ZA 4XD5A 2R1MA 1VFFA 2V81A 3U7VA 1GORA 3NZPA 4GJJA 4KEUA 1YDYA 4ZQPA 3HGJA 2OR2A 3MV01 3OHMB 3ICJA 4DNMA 1QNRA 3H2FA 2CPUA 3W76A 4AYGA 4JPGA 3BW2A 4Y9PA 3N73A 3T0TA 1FCQA 3LHZA 3WLQA 2OYLA 3ZLHA 2YGYA 5BZAA 3M07A 1DP0A 3M0JA 2YKKA 2AQOA 2J7CA 1W9PA 2YXOA 3KM8A 1UPMB 3N9KA 1J0ZA 2VFHA 2NW0A 3V35A 1LROA 1YEYA 1DWGM 2PDLA 3DBPA 4B15A 1XINA 3CASA 5D32A 3T2PA 4EKJA 1KTCA 2ZRZA 4P7RA 3UT0A 1KBBA 4IZGA 3G77A 3GDMA 1UD8A 2WHKA 3W7IA 3EDEA 1EBGA 3BOFA 1RK5A 3WLLA 3MP5A 1LRNA 4C6OA 2EPMX 3QOKA 4O8RA 1UOZA 3TA9A 4ZGYA 4W7VA 1H60A 1DWJM 3CT2A 4JN8A 1Q4WA 2Y7EA 4EVZA 2F2KA 2RGMA 5FSEC 3ZT6A 1ZU8A 3WD1A 1GVRA 4JQ4A 1R3WA 3K8LA 1Z48A 2OCZA 3ID7A 4W85A 3GE7A 3OIHA 1NDWA 3W2NA 5HMSA 3DOPA 3CUGA 2EAWA 2YB1A 3WYZA 1F74A 4XZWA 5C7VA 3UY8A 2V9DA 3CMFA 5A95A 3S6OA 2DW7A 1MW2A 5DANA 4C6BA 1UZHA 3UG4A 3S42A 1ZP4A 2QUNA 1F05A 4J27A 2DUAA 1GPWA 2NVAA 2D2OA 3Q94A 3IJ7A 1VPXA 3GG7A 4L6DA 3ITTA 3N2BA 3KWXA 3EB4A 4RK8A 1AW1A 1LQ2A 4S3GA 4DEFA 3MVTA 2ZUWA 1P43A 5D04C 2PGRA 4FXRA 3CIXA 2VR2A 1MUMA 1MEHA 1QNQA 2WQDA 1N8FA 1QI0A 3GHTA 4C6QA 2DGAA 3EDJA 3G1YA 5BRBA 3ZJ7A 1C8VA 1AMYA 5J04A 2X1SA 4ZO6A 4GFIA 4IJBA 2C91A 2IPGA 2X09A 3SY1A 3WBXA 1Z3NA 1YPFA 1Q7QA 4NZ1A 4HPNA 5CJNA 1LOLA 3WZ0E 2VELA 3HPFA 2XM1A 1WDWA 3LZ3A 3B97A 4CVWA 1VCVA 1TX2A 4KWVA 1K6AA 4H7VA 1OCJA 2PGEA 3QLDA 4GINA 3CUXA 4JX5A 9CGTA 2GJRA 4B3ZA 1DJYA 3RPDA 4JIHA 1HL2A 5LGXA 4FOUA 2Y89A 4CNOA 1P1XA 4AVFA 4GNVA 3TJLA 3PJTA 2GUYA 1XHGA 3KLKA 3CEPA 3L4XA 4QJ3B 1A4MA 5FESA 4LS0A 1R46A 1NVMA 2E1DA 3LN3A 3MKVA 4XIMA 4LUTA 3CL6A 4ZB5A 3BLOA 3KL0A 2WW5A 1NF0A 4UCFA 3BAKA 2NZLA 3CB3A 4JQAA 1VZWA 3I7QA 3TTEA 2YBVA 3A4WA 2C8NA 4B9ZA 3DFNA 3RM8A 4HZ6A 3AFBA 3G0UA 2O9OA 2DSZA 4ZA0A 5C9WA 5LXEA 2BY3A 5LHEA 1A5NC 4JN6A 3ATZA 3CHDA 4H04A 2TYSA 2X05A 1BGGA 1UZ4A 3M0LA 2OU4A 3MWCA 4MG4A 4PMQA 3W38A 5AHLA 2FQIA 2XG9A 2PE4A 4IP5A 1E9ZB 1CGTA 3APYA 3KUMA 4L80A 3W23A 4OECA 1R30A 2DSUA 2AQVA 4N4QA 2YLAA 4MKSA 4C6IA 1RP8A 3DZ1A 2VQTA 2Z27A 3DC0A 3VD3A 3GTXA 3GC2A 1XH0A 2WK2A 4B5UA 3CH0A 1W32A 2KZHA 4PMVA 1TTJA 3AYSA 5GNYA 1KKRA 1KLYA 2IW0A 2V5BA 3VM7A 1NWRA 2X2GA 5F4WA 3M0KA 4ZZ9A 3KOWA 1ONWA 4NJHA 1KV5A 4AG0A 3VDAA 1LBFA 1TO3A 3R0DA 3WUFA 1RY8A 4YS1A 3CB8A 1U30A 3BL3A 3L5LA 4ATDA 2V3DA 3OBAA 3M7WA 2E6AA 3NL5A 4Q6XA 1A5AA 1EKOA 1LZOA 3ITYA 3WK3A 3W84A 1QTWA 3ANUA 4UTWC 3BURA 2X1TA 2PP3A 4LUIA 1TRIA 5CH9A 1B57A 2DUXA 3FNDA 3GNPA 1POKA 5T9BG 3UD6A 4Q4PA 3TXZA 2OKTA 4PODA 4LAOA 5C70A 3R5EA 5AHFA 5LNVA 3HGRA 3R58A 1ZJBA 5A2CA 4G56A 1IIGA 3LERA 5XINA 2ZX9A 4V1YA 1UMLA 5AYYA 5ENLA 3URBA 4MZ8A 3GFXA 5C9RA 3R8HA 1B3WA 1XD0A 1GKPA 1ZALA 5LA2A 4NX0A 4K38A 1D3CA 2CZDA 1LUCB 4DVOA 4YWSA 2VZTA 1TMLA 4FSAA 4RJEA 2YZRA 5LIKX 1IEIA 1UR4A 3DFHA 1EP3A 2X0YA 4DJDA 3LD5A 3KS5A 3H53A 5EMMA 3ZR4A 4WDXA 3RAOA 4ZCWA 3GFYA 3ZSTA 4BI5A 3XINA 1FXQA 4KEVA 2F2HA 2ZRWA 2C14A 4QG9A 1QI2A 1XLFA 4JGDA 5A8OA 3AYRA 1PKNA 4Q32A 1H1YA 3NO5A 5MHBA 3VKCA 4WY0B 1MQPA 2WVUA 1A50A 1QFEA 3W6YA 4DO7A 2Z00A 3AS3A 5B7ZA 2W63A 3SI9A 3SJNA 4E2OA 4A4AA 1YNPA 3MYOA 4GOAA 2GK1B 4TO8A 5LKYA 1IT7A 4CNPA 4DWDA 2NLIA 4JY8A 2YX0A 1CLKA 4D6EA 2NVCA 2SFPA 1GJWA 2WVTA 2I9UA 3UG5A 1MFVA 4KH2A 4DUOA 2XN0A 3CHEA 5DELA 3U9IA 4AEFA 3KDNA 3PTDA 5HOSA 5DT5A 1XISA 2GQ8A 4KIRA 2P76A 4UQBA 1W91A 3EWDA 3TROA 1K4GA 1ME7A 4QCEA 4C7GA 4L6OA 1DHKA 4F0RA 4I8YA 1VFHA 3OZPA 3Q67A 1CW2A 2V69A 4FIQA 4RZ5A 4N9EA 3UWYA 4KRZA 3AS2A 4QLLA 1MUCA 3BAJA 3B9OA 4HK7A 1EHAA 1W3NA 3MMDA 5E9AA 2O0TA 4GNKB 1PHQA 1Q8AA 2YL8A 4UUIA 3OBKA 5REQB 1X6LA 3S1UA 4LY4A 3QR1A 3KBJA 5ECVA 3W74A 1BG9A 4UTFA 1H7NA 3AUOA 3BLIA 4ICNA 3UR2A 3FXGA 3WJWA 2XN2A 4S3AA 1UR8A 1IWPA 3G24A 5FJTA 4LVAA 3GTNA 3WLTA 4Z42C 3WMBA 1IIHA 1EPVA 1R3VA 3MMTA 3MW7A 1Z69A 3DC8A 1F7BA 3QV6A 3NTYA 3WELA 1GTEA 2XVPA 3MSRA 1IR2A 1JQVA 1Q63A 4EK7A 1TTPA 2BVDA 1ECQA 1P0NA 2IQTA 4W8AA 1YX1A 2WVVA 4DN1A 2EGZA 4P7QA 2VQUA 1QNPA 3EA3A 2OQLA 2YB4A 5D03A 2XSBA 4WD0A 4NI8A 5A6KA 3CUJA 1Q8JA 3S6TA 1JNEA 1GUVA 4GRSA 3T09A 3KBWA 1HN1A 3CAQA 4AISA 3G6LA 3I65A 3HMJG 4MKNA 2FB3A 4RE2A 2VD8A 2FTPA 3GB6A 1Z7AA 3EWYA 5JBFA 4CQ8A 3F4DA 1RA5A 4X22A 1JZ3A 2C1IA 1BWVA 2A3CA 3STEA 1GHRA 3K8KA 2VZSA 3PS7A 3PNUA 1SJBA 1LOQA 1KRAC 1VBRA 2B4GA 4O0ZA 2RUSA 4B3KA 1NIUA 2Y5EA 1IT0A 2DVTA 5T26A 1CI1A 4PUKA 4IQDA 1MQRA 4DWSC 1QWGA 5BXRA 3FDKA 4AF0B 4MHBA 4BQ5A 1FHDA 4HMCA 5CXPA 1DIEA 1LL6A 3S3GA 1IEXA 1ZBCA 2X30A 3H26A 1DV7A 1M65A 1UH2A 3ITVA 5HMDA 4Q8QA 2ACSA 1E0VA 4NAFA 4IG2B 3LBMA 2QCFA 1DE5A 3W7DA 5I5RA 1V03A 3PPFA 3W7PA 1SYTA 1XYZA 3WLNA 2F6XA 1YIXA 5CBIA 3VDBA 4MYXA 5EMJA 1C92A 4RZ6A 3RR4A 2PMQA 1JI2A 5DMNA 3H6OA 1LORA 1GEHA 1HFBA 3GDKA 4MNJA 4Y7EA 2VC7A 2EG7A 3W7RA 3IWPA 2DVXA 5M5DA 3VIFA 3TC3A 1ZLPA 1OFDA 2VX7A 4H01A 1A0EA 1H7OA 1HKVA 3PK7A 5M17A 3WQDA 3AXIA 2VVNA 3SBFA 3IK2A 3RG6A 1MO0A 5DF0A 3OA5A 2J6XA 5EMYA 6REQA 2A7PA 1VBGA 1S3TC 1GKQA 2OQYA 5FJUA 1YYAA 2CERA 3VFCA 1FWSA 2XZ7A 3THUA 4GX9A 2MUCA 3TXVA 4ROQA 2W66A 4UTHA 4O28A 4L56A 4PBGA 5A6BD 4H8HA 2ZRVA 4MWAA 1F6YA 1KM6A 2EQDA 3MZNA 3W1UA 3TYBA 3SCPA 4XAGA 4PTMA 2CLLA 3CZGA 1J79A 4G7EB 3ABQA 4GYFA 3W83A 1C91A 3T0AA 1K9DA 3A5FA 1C93A 2QGYA 2WMHA 2IKGA 1X7FA 4LQ1A 1DXFA 3WDPP 2R8WA 4S2CA 5K3VA 3NZGA 1MDRA 3EA2A 1Z32X 4IL2A 3TK7A 1WNOA 4M80A 1A53A 5I02A 1D3HA 3VK5A 1REQA 2PDQA 4B16A 4M6VA 4AD0A 5D9MA 3CBWA 3E74A 1OGSA 2PTDA 1B5TA 2GYIA 1R87A 1R7OA 4ORMA 3RRAA 1XLLA 3LRMA 4O52A 3B40A 3MSGA 3V7PA 1PX8A 1DQWA 3EOSA 5G2WA 3RX2A 3TX9A 2VGIA 2RDUA 5D02A 2GJLA 4S1FA 4MWAD 4HBKA 3TR2A 3M0MA 4ZO9A 3HFTA 3RHGA 4GYPA 4LGXA 4LY8A 3MA8A 3QGVA 1AUSL 4PULA 1WPCA 3SIMA 2A79A 4C6EA 3LI1A 3MZ2A 4MM1A 4PUJA 3WLSA 1PIGA 2VX6A 1GOKA 3WLHA 4LYKA 4M6PA 3LI0A 1U5JA 4GYJA 3U2EA 5IHSA 3L21A 4E8GA 4GISA 3NQAA 1ZRQA 2DDXA 2WMIB 1TQXA 1XLAA 2E77A 1KCKA 4HHHA 2DIJA 1OCBA 1XDMA 3DHFA 1MZHA 1RBAA 2O55A 3VKJA 4WKHA 4H41A 3GR8A 4P8XA 2C1HA 3UJSA 4LAMA 3UP8A 4NILA 1E1CB 3WBEA 3NNTA 3ABOA 4L6HA 4CD8A 3TUUA 4M82A 4A05A 3KVMA 4RDYA 1NTHA 3H7RA 3U2ZA 1W1B1 4FNRA 3AXKA 4PUEA 4QEEA 1HJXA 2Z2AA 1XV8A 5SWUA 3QPZA 4Z2JA 4KCUA 3TA6A 4AEOA 2PTXA 1OABA 3ERPA 1E0UA 3C2EA 5H91A 3L0NA 1YNQA 4N4PA 4E8CA 2W79A 3INPA 3N15A 3WH9A 3JS3A 1ZY9A 3ZSSA 2GGIA 1K9FA 1SW7A 1QHOA 1V3IA 5K4ZA 3M6YA 2DIKA 1XRFA 5GNZA 1S46A 1HQTA 1DEDA 3G3DA 2PS2A 3QGKC 1KFWA 4PN2A 1U1UA 1KR0A 1BWLA 4Z08A 1TX0A 4Q8NA 1ZAJA 1IWBA 2CBIA 4R3UA 3CWHA 3W01A 1W5NA 3V36A 3QM3A 1AJ2A 1HJSA 4XD6A 3UWVA 4QCFA 3L0KA 1BQGA 3QMRA 4JNYA 5EB8A 4D6CA 3UW6A 4IICA 5DCDA 5CPNA 1EJSC 4GD0A 5IHRA 1Q6GA 1QI3A 5ABHA 3GAYA 2CLHA 4TX9A 4WR3A 4F2TA 3CXOA 3SUSA 1E70M 4WLCA 5G2HA 4J2PA 4ERGA 4UNIA 4N9CA 2ZUMA 2XFRA 2EPLX 2FZMA 4OJYA 2HK1A 2HBXA 4HZMA 1XCFA 4AQLA 1FDYA 5A2AA 2FB2A 1GQIA 2FZBA 3MVIA 2YDAA 3B03A 4EXQA 1KBLA 2JKAA 3B8WA 4MY8A 4JTQA 5JIPA 2ZCGA 1RHCA 4ACYA 2CBVA 2OT0A 2YA1A 3W3OA 1WZMA 1CENA 2JF7A 1XIGA 1UP3A 3B4UA 1YTEA 4PB5A 2PUZA 3RGTA 1PTAA 3ARWA 3QV8A 4FX6M 4TV5A 3LPFA 5HXMA 4HCDA 1XDJA 4K36A 1R0MA 3ZR6A 1FFRA 2J9XA 3QPEA 2W91A 4C6KA 3P82A 1IHIA 4LOCA 5CZTA 1W5PA 3GZ3A 4FR6A 4YVVA 3RCYA 1JAEA 1HZYA 2AGTA 1KQYA 1EYWA 2OSYA 3GC5A 2NX3A 1WP6A 5JH2A 4GK8A 4LYQA 1XIEA 2VEGA 2PRHA 3OO2A 2DZAA 1KM0A 4Z2LA 1A3HA 2ZX8A 4IIFA 3NQGA 1JD9A 3WUEA 2G3NA 5D8ZA 3SCUA 4P00B 1YADA 5I78A 4Q8WA 3P8JA 4B91A 2D73A 1QPRA 2Y8UA 4Q3MA 2Y62A 3WQGA 4OBRA 1Q2RA 1XLHA 1VKFA 4QNEA 4P8WA 4DJFC 3M0HA 5AYZA 4MVAA 4E4PA 1V3JA 2ALRA 1FDZA 3PJWA 3C4UA 2YA0A 3WBWA 1NARA 3ARPA 4K3ZA 2FH6A 3T0BA 1EF2A 1YTDA 3CWNA 3OHIA 2XVKA 1VEMA 4DF1A 1S2VA 3WMCA 2PWEA 1JXJA 3NCOA 2O56A 4MMWA 4M1RA 3REQA 3GW0A 3NG3A 5E1QA 3DAQA 2A21A 2JKEA 3PWGA 2QMKA 5A69A 4LSBA 1P6CA 3V1HA 4ZOAA 2QIWA 3QZEA 3P6LA 1DVJA 4JQ3A 3H2NA 3N2XA 1Q85A 2X7WA 1QRQA 4TV6A 3VA8A 2NSOA 5FL1A 4X3ZA 3G1RA 4IMAA 3VUSA 1PHWA 4REQA 2Y1HA 3L5AA 1BFNA 1KBIA 4TVUA 1V6WA 4GIEA 2W3ZA 3LXBA 4BF7A 1YKWA 2I14A 1TCDA 2D23A 1DXIA 1J6PA 4YVPA 1R9ZA 1Y8BA 2BP1A 4B5XA 3MKKA 2Z6JA 2QCDB 1O60A 2ESCA 5AC7A 1IXQA 3BLLA 4MAVA 2VDHA 4OKDA 3SY5A 4DBWA 2W61A 4HMEA 3TLLA 3R0KA 5A6SA 2VUYA 1YBQB 4E3TA 2A85A 1IZJA 1X1NA 4O17A 1KM3A 3O7UA 4ROPA 4HPJA 3RITA 1W56A 1CB2A 2WQPA 3FAWA 3UXKA 1UUOA 1R8LA 3M16A 3OW1A 1VJIA 3QSTA 5CLTA 4PMJA 3QOMA 2XPKA 4LAZA 4JIIX 2VZVA 4RCXA 4UQAA 4IQEA 3FKKA 1T40A 4GQ0A 1UA3A 2ZFAA 3EX3A 1XYBA 1V0LA 2B7PA 2FHFA 3VOHA 4QHRA 3SQMA 3IGUA 4PRWA 1UWTA 4CCCA 4XVEA 1ECEA 3L12A 2WMJA 4YIWA 1OX6A 5HPOA 1PX4A 1DIOA 1CLVA 3WQ6A 2HPIA 1LCOA 3RNDA 1WDQA 2E6YA 1RP9A 4RLIA 4OOZA 5EMKA 3S5OA 3K4WA 2REQA 1C9DA 3NSXA 5J5RA 4Z17A 4IGSA 3WQ4A 2D22A 1EO7A 3I6EA 4OV9A 1W54A 1V93A 1G4SA 1KWKA 5T91A 1S2AA 4AB4A 4GBDA 1AZ1A 2VP8A 3NVTA 3W1RA 1O5XA 3NL6A 1EXPA 5EU9A 4HA1A 2QHAA 1AH3A 2CHOA 2QPSA 3GM8A 1KWGA 3MBDA 3LCHA 2FFIA 2VEKA 1ZJAA 2Z7KA 2H9AB 1M1BA 4A29A 2Z28A 3QHOA 1K6WA 3RLHA 5HQMA 4IMDA 3L23A 3B9DA 2IPFA 3VD4A 1V0NA 5FACA 2HROA 3GUGA 4IGMA 3VIMA 1X8CA 3HURA 1JYVA 4EPDC 3EXTA 4JHMA 2ZC1A 3W24A 5EFDA 1JCXA 2PB1A 1S5TA 1ICPA 4UQCA 3GS6A 3WL1A 3S1XA 4C1KA 3N6HA 1ZS2A 3O6DA 1H49A 2QF8A 3ARTA 1EFZA 4AD3A 4FNQA 5D4YA 3WUBA 4YPJA 1KCXA 3UWQA 2VFDA 4Z1YA 1VJSA 1CXEA 1XRVA 1VB9A 3G1HA 1UP2A 2YPIA 4NZ3A 1J5TA 2JIWA 2OYMA 2DEPA 3T55A 3WUGA 4LB4A 3WD0A 3LSBA 3OEXA 2P50A 1H5YA 2WO5A 3VXGA 1ISWA 2EPOA 3CNYA 1QNOA 4PR4A 2D0FA 1KKOA 5I00A 1L9WA 5KMYA 4HT3A 4N9BA 4UFJA 1JGMA 2P53A 4MB4A 4MFEA 3APGA 4HQVA 1TFVA 3H7UA 3HQPA 4POCA 1FUYA 4UB9A 1MWOA 4GE8A 3F2DA 3A9IA 3ENLA 1QW7A 4L1XA 1OIFA 3B06A 2H90A 3BCDA 2WANA 3NPUA 3FY1A 1ITCA 1GG0A 1J10A 3LZ5A 3PZNA 4UTTA 4GWEA 3VCCA 4XO7A 3AMLA 1JDAA 4LAKA 4ZQNA 3WENA 3RMEA 3WDQA 1K02A 1FP9A 4K39A 3U6WA 4AWEA 3RLVA 1PCWA 1PCKA 3KEHA 2A7RA 3QQ1A 4GQBA 4JR5A 4LBRA 5LNSA 4U2ZA 3TYAA 4O13A 4JEQA 4M7TA 5JUVA 2YBTA 3E0FA 3IRSA 3QMTA 1Y0EA 2DT3A 1LLZA 3PBGA 1XG3A 1C90A 3AHVA 2NXIA 1EJVC 4N42A 2HS6A 1JCYA 4Z0SA 4R7WA 1SJCA 1DJWA 1JPDX 1MFUA 1T99A 2I7GA 3BQ5A 3JVAA 4HU8A 5BMWA 1W2VA 1RV8A 3W0KA 1SMDA 3C8NA 1PPIA 4XWUA 3CHCA 2A0NA 4XZNX 5AYIA 4JCLA 2A6NA 1XRTA 3ITLA 2YXXA 4KKXA 4JTUA 4S3BA 1T8XA 2WKGA 2AOSA 1KFJA 4AZGA 3CHFA 1BSIA 1FWFC 3GXPA 1H50A 1O5QA 1YRRA 2CNCA 3IJIA 1SW3A 2DZXA 5DY2A 5AC8A 1CGWA 1G9HA 4I5RA 5HULA 2ZXAA 4DWSA 3GBEA 3KOZA 5I06A 1ZENA 2VD9A 1OZQA 3P81A 3HOJA 3N2CA 3RPTA 2W9MA 3ES8A 3EWCA 2RDTA 2DZUA 5E0CA 1M7PA 4GPNA 4AXNA 4W87A 2C79A 3QY8A 4FPSA 3WF3A 2AL2B 4LBSA 4YHEA 2CXGA 2PDWA 4IPJA 4PBEA 4KGJA 3T0DA 1KM2A 2XGIA 3WLPA 2Y5SA 3NUKA 1TMQA 4EIVA 2BTMA 3DECA 3NEVA 5D37A 2JF6A 4R88A 3E1F1 4R85A 1KNWA 3SFWA 4EAYA 4Z1CA 3RO8A 4GC3A 4EE9A 1P0EA 1OVDA 1J4EA 4NQ1A 7CGTA 1VYPX 2JKPA 3U3HA 3W7OA 3KWSA 1JVNA 1JZ5A 4RW3A 1ADOA 2ACQA 5DEZA 4I8DA 3CPUA 1J2BA 5AHNA 1NFGA 3H4XA 3W71A 4M0XA 4DPPA 4CQ9A 3D46A 2O4MA 3LNPA 3T8LA 1GG1A 4ENLA 4RL3A 5DO8A 3OBEA 4W86A 1VPQA 3CIWA 1DWHM 2E4TA 2ISFA 2CWNA 3AIUA 3AALA 1GPFA 1OEPA 3PG8A 1IGWA 5EIYB 3UG8A 4Z0JA 2VJXA 1FQ0A 2PF0A 4GKLA 1VCFA 3ARZA 5BU6A 2NQLA 3W1LA 3D0CA 2YL5A 2QMJA 1HXJA 3ARYA 5ABFA 4EF9A 5D2TA 1TV5A 3LXAA 4NIRA 1TPVA 3M41A 4XD4A 3W73A 2HMCA 3MJYA 1QPOA 1BD0A 1UWAA 1XYCA 3R2GA 5A8MA 3W7JA 5AYBA 3SCQA 1BRLA 1WA3A 2IUZA 3HM7A 4OIFA 4TX6A 2UY2A 1MDLA 4HSOA 5CBBA 4AMCA 2V5KA 2D20A 3RCNA 2XIIA 5HNNA 1BAGA 1OT2A 4HTBA 3UGRA 2BLEA 3ARUA 1CIUA 3PZTA 2BX7A 2FGLA 4G5DA 4L4PA 1OADA 3KCOA 3G1DA 2V67A 1KFKA 3PPGA 4F0LA 1A0CA 4MJMA 1F76A 3GTFA 1I2OA 1U83A 3C52A 1OD0A 3ZIZA 3BAYA 4J3VA 1ODZA 2INEA 1GZGA 5I07A 1OYAA 1M68A 4O1BA 1BYBA 3T7VA 4AX7A 5AC5A 4QROA 1BQCA 4PUWA 4AXKA 2VI0A 2WKLA 5BOEA 3CMJA 3SCSA 2ZTKA 3ATYA 4XAFA 3QEZA 4A35A 1QPKA 3USZA 5HK4A 1KM5A 4B5SA 3D3AA 2IS7A 5KSWA 1A5UA 2V2CA 2VRJA 3G2GA 3AMGA 1AL8A 3H2EA 1LG2A 3GNRA 4WEVX 1LQ0A 2TODA 3PNZA 4Z2KA 1MVYA 3DX5A 5E09A 1VC4A 2XYLA 3UG3A 3W86A 4KEMA 2PI6A 3V75A 3W07A 4QG8A 4NG3A 4FNTA 5C0QA 1SZNA 2J6VA 2Z25A 2HK0A 4DI8A 4QJ1A 1Q3NA 1Z41A 4NNCA 3T81A 5K4XA 1TA3B 3NXFA 3Q4DA 1FWTA 1Z6KA 1WE5A 2PLCA 3HG4A 4H2HA 4GH1A 4ILSA 1EUAA 3PSVA 2OGYA 1JPKA 2E1WA 4QEHA 1AQFA 2FVMA 1TZZA 1VFMA 1GVEA 3LHWA 1UD2A 4A3RA 4M3PA 2NQJA 4Z2GA 2PP0A 1UJPA 1M5WA 1JQXA 1R9YA 4KCWA 4ZODA 3ZO9A 3T44A 1L6GA 3N1AA 1T5AA 5CSUA 2ZX7A 1B3ZA 1XIMA 2PPGA 1Q6OA 5C5YA 3EMQA 3CUHA 3SN4A 3PULA 3NQEA 4KWOA 1F4AA 1E73M 3ARXA 3EWWA 2VWTA 3ZVHA 3EPOA 4US5D 4BK9A 3H22A 4D8LA 1ITXA 4RV8A 1QJWA 1ZTVA 2VZOA 1WUEA 3KBVA 4FIRA 4HP5A 4LPCA 5I3DA 1XSKA 1KRCC 4IFKB 5I24A 3BAXA 2QXWA 3JRKA 3GUWA 5FJPA 1I0BA 4XAPA 1OYCA 5I03A 1RCQA 2O7SA 5A3HA 4DLMA 3UQNA 2ZX6A 5C2GA 2GDVA 1U1HA 5TIMA 2PRMA 1I1XA 4HTYA 4UTLA 8TIMA 3LTSA 4JS3A 2X41A 2NV9A 3IVTA 1VGAA 4QAWA 5JQ9A 2Z1SA 3DFYA 3JR2A 3V0SA 2DZBA 2VC6A 3BSMA 3G8EA 4LRSA 2HPMA 3ALFA 1TV3A 4AZCA 1MXGA 3V5FA 2C7FA 3AYVA 4W88A 3AIVA 1VBHA 4HJFA 3KRSA 3CYJA 4H2CA 3NQMA 4E4FA 1RVGA 4S2BA 4YTQA 3DKLA 3I6RA 4PMUA 3DGRA 1CGUA 4PUNA 4ASTA 1QCWA 1TE1A 1TTQA 4JX6A 3GU2A 3CAVA 1KQZA 4HIBA 4LV9A 3HPAA 3MSYA 4QITA 2OMAA 4J7RA 3AXMA 2XIOA 1OGBA 2A3EA 1I2RA 3PM6A 1VFTA 4IMEA 4MY1A 4ZENA 1GVYA 3EXSA 3LSCA 4AWTA 3WQ5A 1R3QA 3W1NA 4P02B 2DZSA 5C55A 3SRKA 4TQTA 1NY1A 5CPOA 3E0LA 3W6LA 1U2YA 1V6YA 2HVNA 3WBAA 3NA8A 4JDYA 3WFLA 4PBFA 4QLJA 2GUUA 4JICA 1K1DA 4E8DA 1S2WA 1V51A 3CT7A 2R91A 5FD0A 4YYCA 5I7GA 1O12A 4FS9A 1TR9A 5E0FA 5EBUA 4WQ6A 3WNOA 4H6RA 4D6DA 1GVSA 4IP7A 5BRQA 2XIMA 5IFTA 2XUCA 5A94A 2V5CA 2VFFA 3FDGA 3UZXA 2OLAA 3DUGA 1JZ2A 2C13A 4DZIA 3PC0A 4JTKA 1PDZA 3P14A 3SZ8A 1OG6A 4E2BA 4XG1A 1JEZA 5I0DA 3DEQA 4QLKA 3D47A 1UB3A 4IXXA 4DJFA 3W81A 3GKFA 2FHBA 3DESA 1Q2SA 1QK2A 1EQCA 2WZTA 3W1QA 3CLMA 2WMFA 5AC6A 4WK9A 4HPGA 3N9RA 1EZ2A 3TN5A 3TFXA 3RRXA 2PURA 3VMNA 5HNUA 3VIGA 4OU1A 4S3DA 3PB0A 4AFYA 2DSVA 2WKJA 4P7NA 3LV6A 1O6IA 1TB3A 3OVGA 4FLQA 3MI2A 1RQHA 3ZYZA 4M19A 2NUYA 3W7NA 3O07A 3WF0A 6TAAA 3BCFA 1EGZA 1S3HA 4MPKA 4DJED 3GHUA 1YXDA 4RE4A 5I3KA 1QNVA 4M24A 2QS8A 1TWDA 3BTNA 2CLMA 5HDRA 1JGIA 2GLKA 4MKVA 2J47A 2R1NA 5A8GA 2QDHA 1P7TB 1CB7B 2CYGA 3O05A 2EPNA 4CUCA 4UCGA 1EJRC 2DU2A 1OM0A 3IJQA 2E8ZA 4ADUA 2VDGA 5LYRA 2G41A 4LEQA 1EA9C 4NJIA 4XV0A 1BF2A 4BQ4A 4WZHA 4TIMA 1WUFA 3VGBA 1HJVA 1C7SA 3FEQA 5H6HA 3VIHA 4PRRA 5DMMA 3A6OA 3T8QA 5I3FA 3WMLA 3S9YA 3P8IA 4OHQA 1PL9A 3IS4A 3PPHA 1QK0A 1RQBA 5HA7A 1W3KA 1M01A 3GXDA 3TW9A 1XYMA 4BF5A 3TONA 1V3MA 1LLWA 2UY5A 1WKFA 1LBMA 1R9XA 1W1PA 2BV9A 3ZWSA 2E68A 2QUUA 4INFA 4MB3A 2VZUA 1VIWA 4E38A 2ZICA 2OEMA 1E6XM 3AISA 1E56A 1EWDA 1TJRA 3M1ZA 5C8BB 2FVKA 4KEZA 2PTZA 5FA5A 4ACZB 1E0XA 1I0DA 4LB3A 3N2TA 3T2QA 3FCPA 3W2MA 5KETA 2GGHA 3AYTA 4LBUA 4XD3A 3L66A 2CBUA 4GI8A 5KINA 1JDCA 1VLWA 3C2OA 1HL9A 3GTIA 1SFSA 5EJZB 1GONA 1QT1A 1B9BA 5CAHA 1XLKA 3HTWA 4WX2A 4B90A 1I1WA 5HNTA 1GNXA 3UWUA 4ZSUA 1ZCCA 3UFYA 3KZSA 1HP4A 3HO8A 4C1NB 4HA4A 3RX3A 3A5VA 2WLZA 1XCWA 4GHRA 1X7IA 2I5GA 3WQEA 3IAPA 1RK6A 2I56A 5U4NA 3KZPA 5CSSA 1GQLA 4YTTA 5DQPA 4FEZA 1M04A 5F2MA 3N2MA 4H9XA 4F2BA 3ZWTA 3W4RA 5K9DA 1W1VA 1CLXA 3C56A 1QAPA 4JFVA 4NU7A 1J0YA 3WF4A 2ATSA 3BLEA 2DSWA 4NXSA 1U22A 2Y0FA 2VDIA 1W9VA 2DZTA 1D7FA 4GUFA 1IEQA 1VS1A 2WSYA 3DFPA 3J7HA 2JBMA 1NFBA 5I3IA 2PTWA 2B7NA 1GOIA 1HUVA 2F84A 1I2QA 3PR2A 4X9SA 5ABTA 5LIYX 4PTVA 4LX4A 4QFUA 3GRIA 2VVSA 3THQA 2Q8ZA 4JFSA 1BYDA 2EG6A 3VX0A 3LRLA 5DY3A 4WHBA 1R3RA 2NQ5A 2J4GA 1J2WA 2HEJA 3B8SA 4AZ7A 5BU9A 3O06A 4JAWA 1XFCA 3K4DA 5LXXA 2GJXB 1E9IA 3W85A 2J75A 2XVGA 3QBUA 5CJ5A 4AAJA 4H9YA 2HCVA 1HIZA 1GJUA 4QS6A 4NY2A 4NZ4A 4LC8A 3OB8A 3P93A 4QS5A 3MTWA 2BNJA 4W5UA 3B9AA 1XLGA 4JY9A 5CGMA 2ICSA 3F4NA 1BGAA 3AJXA 3P60A 1KGWA 3VPLA 1LOSA 1E1EA 1KM1A 2PGFA 5HJYA 1G4EA 3VOFA 2ZZ6A 4WGXA 2EKGA 4RDZA 2BG5A 2QULA 4MNLA 4F8XA 3FA3A 4FMVA 1IXNA 3WF2A 3KVKA 1ESWA 1YE6A 3EX6A 4W9TA 2R1PA 1WKDA 3UZYA 2XIQA 2YL6A 5BOFA 3M5YA 5B80A 3R10A 4KWWA 1RY0A 4B4FA 1MZRA 3T2OA 5HATA 3BJSA 5FF3A 4GQGA 3MYPA 3HGSA 3DH7A 3NOEA 1O5KA 4K6AA 3GHRA 1MW1A 4WDUA 1XYAA 1HKJA 3HG3A 1LL4A 1PXGA 1FFQA 4I9AA 1UKOA 5BROA 2J9YA 3OA3A 4JTIA 1A5BA 5TD4A 1GTHA 2VMFA 1TIMA 4LRTA 3F2CA 4HNOA 4GMEA 3QRHA 2NX9A 4IP4A 3CC1A 2BB0A 1OX4A 1Z44A 4URIA 4H8VA 3N34A 2D1ZA 4IMCA 3ZZ1A 3GVWA 2FPYA 3QTPA 3L68A 3G18A 2ACRA 4EWND 3RU8X 1FDJA 5ECUA 4LCQA 3UU0A 4K68A 3E49A 3ZR5A 2EG8A 3UA3A 3E5PA 5TQLA 3UERA 5IBXA 1ITQA 4Q7IA 4NKCA 3EEGA 3W1PA 1EOKA 4CNNA 4S3FA 5A6JA 3BG5A 1CPUA 1XBVA 4I3GA 3IJ9A 4FO4A 3A47A 1LTDA 1L6YA 5XIMA 4UWMA 3KVJA 1V7YA 3L4TA 3SADA 1RALA 1S38A 4W7WA 2INZA 2QZRA 4WY0F 2PU1A 3SCRA 2WCAA 3LBOA 1K8XA 4XSMA 1SPQA 1UD4A 4GA8A 2QGHA 1ICSA 2QUMA 5MF5A 1TZ7A 3EXRA 3SGGA 1E5NA 5K9XA 3GBDA 3T0CA 1AK5A 3VNJA 2AL1A 4P8UA 3NVDA 1EC8A 3L67A 3GH4A 4NASA 1WXZA 3HPZA 3W7HA 3EX4A 3LYEA 4DXXA 2R1LA 2D0GA 4CU6A 3L2MA 3TKFA 2H8XA 2J8GA 4QP0A 3GIQA 4WSHA 3GSMA 2WOQA 4DF0A 1QBBA 1JAKA 2OLSA 4IPIA 2P0OA 2OWWA 4PTNA 4IWWA 3U2CA 4X60A 1XI3A 3C2FA 3LHVA 3LRKA 3F4CA 3R4IA 4CQCA 4CNTA 1OK6A 3YPIA 4LVGA 5DMYA 4QQ3A 4UQ9A 3R12A 1AH4A 3M0YA 2P0IA 3GNXA 4NP7A 3QF0A 4FLSA 2OSWA 4U31A 4AX6A 3NQ6A 1KGXA 3G1XA 2YW4A 3BMWA 2OX4A 5D38A 2DT1A 2A3HA 4L65A 3BLKA 1XKJA 2VTFA 3IANA 4DYJA 5HBFA 5C2CA 1AW2A 1TVNA 3IJDA 3WDJA 3W7GA 4AHOA 4YVXA 3PG9A 3M6DA 3O63A 2YJQA 3RLUA 2X8RA 4PCFA 5TBOA 3ZQ9A 4B5TA 1ALDA 1O66A 2CZEA 4LNYA 2C0HA 4GIAA 1CXKA 1HTIA 3LCWA 4G6CA 4JIRA 1PE1A 1QMLA 1JNDA 1VH7A 1DPMA 4QJ5B 1V8EA 1I8JA 1XC4A 4KESA 3KCLA 1A3XA 3E38A 3B0PA 2DT2A 5HUOA 4AMAA 2J79A 2FTWA 3N2OA 4GH3A 2CFFA 4CQAA 1O5RA 4GLEA 4UTMA 2ONEA 3ITOA 3QMSA 4MWAC 3URAA 2G97A 1RBOB 3TAOA 5E6ZA 1GZJA 4UR8A 1ODUA 3GR4A 3RILA 3VKKA 4LUTB 4R7OA 4D6HA 2Z1VA 4GABA 1NWSA 1K7EA 3OLIA 1H7PA 3N14A 1NDVA 4LS2A 2WSQA 4AD1A 5HQLA 4XTDA 3CJPA 1UR0A 4C6JA 4A3HA 4Y9OA 2ZTJA 3CM4A 2CKRA 4RNJA 2NQHA 4Y9MA 1R85A 2IXVA 1KW1A 4DUWA 4Q4SA 4RDWA 4J3SA 3NQCA 3IEBA 5J5DA 3ZM8A 3B0XA 1V6UA 2OEJA 1I75A 1SJDA 3GX9A 3GZAA 2GDQA 4ZQOA 2AGKA 3UPWA 4F0HA 3TQVA 3W26A 3GH5A 4UFMA 2PGWA 3S5NA 1E6SM 5AZ1A 3PY2A 3ABSA 1V02A 1JYNA 3TC6A 1E6QM 1P5BA 1YTKA 2QQ6A 1V79A 3LMZA 4GYPC 4LNCA 1CEOA 4XQ6A 1VRXA 3URNA 2EJ1A 1JYWA 2OO0A 5CC3A 1KA9F 1MNSA 1YQ2A 4GC4A 4AVOA 4XZLX 1DWIM 4OUEA 4HD5A 4ALDA 8CGTA 3BGGA 2PDXA 4BJHA 4WOZA 4K8GA 3KHJA 4U5IA 4IH3A 2WV8A 3G1FA 4K8EA 1OFEA 2BXYA 4GQQA 3OGVA 4HU3A 3BANA 4WKAA 5U7SA 1F9CA 1JCJA 1JDEA 4C6MA 4MZ1A 1IZKA 3PVFA 4YCPA 3VX1A 4GUIA 2FMNA 1E9YB 1CCWB 2F8QA 3FN9A 4FNUA 2J7FA 2ZA1A 1FVPA 2R9RA 4H6EA 3PZ9A 1ITUA 1UP0A 1TPWA 1V3KA 2J7HA 4LVDA 3VNZA 4KT2A 3PZMA 1OFQA 3DHDA 1BLIA 3HMCA 3QV7A 4PMZA 3B05A 3STPA 3AS0A 4HHPA 1AMKA 2JFEX 2W5FA 5JH1A 3KCJA 4V33A 2BBFA 5CLWA 5I79A 1EC9A 3UNDA 1JG9A 1MXSA 1HVXA 1HT6A 2PA6A 3W7KA 4CD4A 1W2PA 3KDOA 4DZ5A 2G3JA 4DXKA 2PCQA 3CYVA 1B1YA 3WD2A 2D3NA 3M0IA 4MOZA 2W6RA 1WDRA 3EWUA 5FCZA 3EOUA 3E2RA 1B9ZA 1TELA 3F2BA 4JTCA 4XX6A 1OF6A 2OZ3A 5FEPA 4CEXC 3MPGA 2P10A 2YDRA 3PSWA 4F9JA 3MUAA 3C0JA 3VZYA 4FLOA 1UIOA 1TJ2A 6ENLA 4D8AA 2VR4A 1H51A 2F61A 1OG0A 1H5VA 1UWSA 2PWFA 1TV7A 2WNQA 2XN1A 4Q7BA 2GQ3A 2XJ7A 4JXCA 1A49A 4JOMA 4DBEA 3S47A 1JPMA 2UY3A 2QJIA 1N55A 3NDOA 2WBKA 3UPBA 2V38A 5AVHA 2ANUA 2WYSA 1PO9A 4LWWA 5J8LA 2EJAA 4PC8A 3TV8A 4K1GA 1TIWA 4CCDA 4DXVA 2IKHA 3CWOX 4GUHA 1Q6QA 1C8QA 2IMRA 3DG6A 1RR2A 1DJGA 1Y5XA 2V3EA 4HB7A 3LHUA 1MW3A 1QHZA 1KXVA 2QW5A 3ITGA 1PZ2A 1XQKA 3OVPA 1YE4A 1NOUA 3M5VA 2OZ8A 3RIKA 4BR1A 1W9UA 1ONEA 3IV8A 4C91A 1JZ8A 4H19A 2O9RA 1P6WA 4H6QA 2J27A 4Q8TA 2XSAA 6TIMA 3A3WA 5FEWA 4H7CA 2JEQA 1A5MC 1IWAA 2VFGA 4GACA 2O7QA 2Y85A 3PBUA 2PLMA 3KTCA 1LJYA 3DIPA 6PTDA 1KGUA 3E2SA 1M53A 1T6MA 1Y5VA 2PSNA 4ZOEA 3HBLA 1I45A 4GNJA 1ZB5A 1HF6A 1UROA 5EBAA 3QXBA 2FHCA 1JYXA 5CAKA 3QYSA 4W7UA 1OFPA 1V08A 4Q8VA 3GG0A 4WJ8A 2Q6ZA 4O8AA 1NM9A 1PYMA 3QY7A 4WJEA 4ZFMA 1TPB1 5TNVA 1C9WA 3CGTA 2VGBA 1ADSA 4S3EA 1OGGA 3QW4B 2WVVB 3TW6A 4IIEA 1K7FA 4H4IA 1XWYA 1BVZA 1WO2A 4H83A 1M7XA 2PWHA 3GXIA 4OT7A 4F0MA 1K03A 3EWZA 3BDKA 2XSXA 2ZXQA 3FS2A 1TKKA 3GFZA 1G4PA 1U5HA 2FVLA 3EPMA 3V16A 2XWDA 3N12A 2Q71A 4R53A 3THCA 3VM5A 5BOOA 4LW7A 1XBYA 5H2ZA 4CCEA 2OG9A 5CEWA 1SR9A 1HVQA 3NPVA 1EF3A 1XFBA 3SUUA 4EXBA 3V5CA 4GUGA 3O1NA 1J01A 2BVTA 2Y5JA 1OFRA 4Q8PA 1VHNA 3EOEA 1E55A 3D3FA 1QOXA 2FH8A 3N29A 4K37A 1PIIA 2DT0A 1PYFA 4JTFA 4WXYA 3HV9A 5ABEA 1O7AA 2YCKX 2HZGA 4CGTA 3L65A 1XIBA 3H4WA 1D2KA 1W5MA 1EC7A 3FJLA 5B7YA 3LENA 2NV2A 4O1AA 3U0HA 9XIMA 1F8IA 2BFGA 3QQWA 3NGFA 4GGHA 3PBYA 2JE8A 3W87A 1AA1B 4NAFB 5CC7A 1JULA 4JTHA 3KW3A 3SFKA 1XUUA 1FBAA 2E5CA 4JTRA 4DB7A 1SSDA 2ZIDA 3APTA 3O0KA 4V1XA 1G4TA 3N17A 4DIAA 2Z24A 1PZ0A 3LDVA 3PZVA 3PUGA 4JCMA 1W8GA 1X97A 3C3UA 3P0XA 4RV3A 2DUZA 4U3CA 5TAOA 4Y96A 4YCOA 3CL8A 2ZVRA 4LV4A 1NEYA 1ZPTA 3URQA 3DI0A 5C2XA 4RXFA 4EOUA 2E3ZA 4NZFA 1BXBA 7XIMA 1HP5A 1PZ1A 1FCBA 3A3HA 3NIYA 4CN1A 3BE7A 3PZQA 4ATLA 1J8VA 3GDTA 2XIJA 5HWJA 3EZ4A 3BG9A 2OOGA 2YFNA 4RR4A 3VD9A 4JQ1A 6REQB 3ABRA 3PANA 4LVFA 3FVMA 5LA1A 3W37A 3EDDA 3KHDA 4JN7A 2CHNA 3U8GA 2F7FA 3AZTA 4BI6A 2B7QA 2ZZ1A 1CTNA 4IMFA 1RZMA 1FWBC 2ZUVA 4AD5A 1IEWA 4MWAB 1Q7MA 3E0WA 4F2UA 5LA0A 1MRAA 2V82A 4PUUA 3L4YA 2WXDM 2VX5A 1UR3M 4ML9A 3MQTA 4PTXA 5FL0A 4B2DA 3HIJA 3WN6A 1UD5A 3K2GA 1KO0A 5GVJA 4ICCX 3WNNA 3TCSA 3W02A 4GIYA 1D3GA 3EEZA 1KLZA 1EP1A 2P3EA 3SN0A 1M3UA 3OG3A 4UTJA 1EH9A 1WX0A 3RF9A 2C71A 4ZXLA 3W7LA 1F61A 1SM9A 5CSYA 1OY0A 5E0KA 1FWRA 1REQB 4H6KA 2I5QA 4HMDA 2V68A 1W17A 1E6RA 5CGQA 5IFPA 4GFSA 1SO5A 4P7OA 3A23A 3RR1A 2J7DA 1P0KA 4KGLA 3K1GA 5D2VA 3IIPA 5A6AA 3STGA 3UCDA 2QKFA 3HPSA 1OC6A 3BW4A 1WDPA 1TUXA 4HNLA 3TZFA 3NM1A 2C0AA 4B2DD 4U10A 1S2TA 4QM1A 5C71A 5G1TA 1MRQA 3UXIA 3G22A 2WSRA 3LV5A 3CZ8A 4JFUA 3UJEA 3BSHA 3WQFA 3N9SA 4Z1BA 3HA1A 3WD3A 3EOOA 2BXVA 4V2XA 3KS6A 4BCEA 3GVQA 1W8SA 2R94A 4H9MA 5GNXA 3BH4A 4O57A 3EMZA 1M9HA 2IQ0A 4OGZA 2RKXA 4NJJA 3LCIA 3SJ3A 1XH2A 3WQOA 1J0IA 4ZTXA 2EPKX 3QV9A 1J5SA 5HQEA 1FKXA 3W2UA 5CC6A 4UTTC 1J0KA 4AZ5A 1L8PA 1UIPA 1ZCOA 3S1GA 2V3FA 2OFJA 3ISIX 4E2VA 3RO6A 1FY6A 4Q22A 1Y65A 3MCOA 1K8CA 3LMYA 1JZ4A 4MWAE 4FXFA 2CKSA 2XFYA 5EMUA 4GG9A 2CLPA 4K1WA 5D2WA 1XF0A 5CCZA 2G50A 1T7LA 2J25A 1H3GA 3DG3A 4ZQMA 1XJBA 2AQWA 3ZS4A 3FYPA 2YYTA 2RH9A 2PC8A 2X1IA 3FEMA 1V6VA 2E0PA 2C18A 4Y90A 1EO5A 3QKEA 1FH7A 3TDFA 1J6OA 1F3TA 3MMUA 5FAJA 1X6UA 1GHSA 1G67A 2HVOA 2G8ZA 3DGBA 3STCA 3HJZA 4QGCA 4QSFA 5G4HC 2Z1XA 4GO8A 4PUMA 4GY1A 3WO8A 2VX4A 1KBJA 4O1FA 4M5PA 1DORA 5GJPA 1HO1A 3V3WA 4MNMA 2INFA 3TMLA 1A5OC 5I6SA 1B3VA 5HJXA 3S0CA 4R7JA 4XKMA 2W92A 3AZSA 3NSNA 4O54A 1K3UA 4KF1A 4NAEA 2MANA 2WJFA 3VYLA 2WHJA 1FWGC 3FHQA 2J77A 4QAIA 4IL0A 4LTSA 4HPXA 2UWFA 3KRBA 4LUSA 2C19A 1FWJC 3NM3A 4I7VA 1GOXA 4WKFA 2XVLA 2ISSA 4X0NA 4GZIA 3I6TA 1BEUA 4OBTA 2F6UA 1R2TA 1ADDA 1PIFA 3L4UA 4C7FA 1VP5A 2HS8A 3TQKA 1Q45A 2X7VA 3UYCA 4RPQA 4MJZA 3EA1A 5A6BA 3OLGA 3CUZA 2VEIA 4XB3A 3GNOA 3SRDA 3TYZA 1PKYA 3JZEA 2I17A 3QVQA 7ENLA 1E0TA 1FWDC 4PB3A 2CIPA 3OLDA 1OWQA 1HKWA 2DORA 1YDOA 3OQEA 4MLRA 3C8FA 3CPGA 4WSKA 3W75A 4HHMA 4IMGA 2G0WA 1QHPA 3WEMA 4NF7A 4BKNA 1ZJHA 5H8UA 4IFOA 3IJ6A 4JKKA 1RPKA 5AOUA 4UIOA 2WPBA 1VBUA 4HJWA 3NJ3A 4O0QA 1C29A 1K4HA 1A5CA 4JKMA 4PUDA 4L9YA 3MUIA 2PDFA 1XM3A 3DYOA 1TWSA 3H70A 4GJ1A 3AIBA 5DFAA 3H24A 2ZRXA 1JRCA 4GO9A 2WM0A 3TYUA 1ZZMA 4A8RA 3RPMA 3TZNA 1H0IA 2VYOA 3G0XA 1QWKA 5AHIA 1E6NA 2G3MA 1QATA 4DO4A 1MW0A 4FAMA 1FHVA 2E9LA 2GSEA 3MBFA 3PBWA 2GFTA 4PL2A 2A6LA 3KRZA 3MI6A 1E4LA 1RXOB 5EA9A 1A5SA 1ICQA 2DH3A 2GL5A 1W6TA 4KERA 4I9MA 1YPXA 2OQHA 3FGCA 1JCMP 1A4LA 1LT8A 3SEPA 1WXJA 4MSSA 3OTRA 1LWIA 1UC5A 2BY1A 3DFTA 3VIKA 2Y24A 1I60A 1E15A 2D0HA 4LJ3A 3S2LA 3VO0A 2PLJA 4IIDA 3SCVA 1PZ3A 3IRDA