3OZPA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with pugnac
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
b'EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-acetylglucosaminidase
publication title Active-pocket size differentiating insectile from bacterial chitinolytic beta-N-acetyl-D-hexosaminidases
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase/hydrolase inhibitor
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ozpA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3ozpA01
4ZEPA 4HU8A 1I1XA 1WZMA 3T08A 5CSUA 4U31A 1BF2A 2WWCA 1LQ0A 2A3CA 3TTQA 1C92A 3WEOA 3W27A 1CBGA 1JXKA 3WD2A 1UYQA 4QFUA 4L4OA 5BCAA 2XGIA 5D9PA 3T0DA 3VM7A 9CGTA 2J7FA 1MQRA 4U3AA 5JBDA 1BTCA 3WF1A 2EPMX 2Z1SA 3EYPA 5DT7A 3VINA 5HOSA 3A3HA 1EHAA 5DEZA 5E6ZA 3NIYA 3AZTA 1UD5A 4OZOA 5JIPA 4D6JA 4N42A 3EDJA 4TVCA 1OT1A 4J3SA 1V6WA 1CEOA 3WDQA 4D6CA 2G3JA 2BVTA 3A4AA 1BYCA 2WMHA 1UA3A 4JFSA 5CJ5A 3D3AA 2YL9A 4FK9A 4UQ9A 2ESCA 2W61A 5D8ZA 1H41A 1ECEA 1EIBA 3QHNA 4A4AA 3W4RA 3CUHA 4M82A 1CPUA 2DIEA 2WWDA 2VCCA 1WDRA 4P7OA 2FHBA 1W3LA 1MXGA 4GQQA 3RMEA 3WEMA 1C8QA 4AD2A 1ZBCA 3MUZ1 4AZ6A 2VRQA 5D9NA 1O7AA 5BXSA 3SCSA 1UKTA 4PCSA 1BYBA 1VJZA 2JFEX 1JDCA 3PZUA 3CUIA 1KBKA 1JF6A 1ODUA 3KEHA 1V08A 1CECA 2BY2A 1E71M 3VVGA 4U33A 3CIVA 1M53A 2VQTA 1NM9A 1CZ1A 2X0YA 1OSEA 1GOIA 1HVQA 1GHRA 2WK2A 3AIRA 1E56A 1EGZA 4Z2IA 4CCDA 3WUBA 1G5AA 2NSXA 1UR8A 2V38A 2PWEA 2YA0A 2J7GA 1RH9A 3VKKA 1XSKA 3QR3A 1TG7A 3ARYA 2NW0A 1EDQA 2W91A 3IJ9A 3L4TA 3ZIZA 4GZEA 4AYSA 1CGTA 3WBAA 3VIJA 2E4TA 2VX5A 5D9OA 1K9FA 1Z32X 2UY2A 4MDPA 3PZ9A 4IM4A 4R5EA 3W53A 3PN8A 1GJWA 1UD3A 3KE0A 2GDVA 3SUSA 1KXTA 4MDOA 2YJQA 1TCMA 1JI1A 1OBAA 3ZT6A 2FHFA 3ZSTA 3W82A 4PMRA 2VQUA 2XUCA 4KGJA 4Q7NA 3K46A 1KR1A 4PRWA 3U5YA 2GVYA 1EH9A 1CGYA 1Q6FA 1C90A 4Z2KA 3WF2A 1WZAA 4CD5A 1QBAA 3VMPA 3W81A 3WQVA 1JZ3A 4WIWA 3DYOA 5A2CA 2DDXA 2O9RA 1ISVA 2G3IA 4ATLA 4HA3A 4EAMA 3L4XA 3OA5A 3VUPA 2W4XA 1J0HA 2CYGA 1P6WA 2NT1A 2A3AA 1HKKA 3G6MA 1EQPA 3VMNA 2WB5A 3M6DA 2J8FA 4CKQA 3GH4A 4GKLA 4A3HA 5A2BA 4TTGA 2PWDA 1JG9A 2WM0A 1KGUA 3W28A 1W1VA 4MAVA 1JNDA 1H2JA 1QI0A 2CPUA 4GZIA 4DUVA 4P7NA 1E1FA 1MW3A 1US3A 2ZX8A 2BHYA 2WLYA 5A6JA 7TAAA 3GXMA 1BLIA 2ZXAA 3AJ7A 5FD0A 4PTVA 1NWSA 1JNEA 2EQDA 3MSDA 5AY7A 1GOWA 4KMQA 1QW9A 1S46A 3OZPA 1BYAA 2VX4A 2NT0A 3IJ8A 4LXFA 1E4IA 1E1EA 1ITCA 4ML4A 4GO8A 2ZUTA 2F8QA 3CLWA 4ZXOA 1LWJA 1H4PA 4E4PA 1H0IA 1PEZA 2BXYA 1PPIA 2XFRA 3GNOA 1XH0A 3HU7A 5A2AA 3UR8A 4AW7A 2E8YA 2ZICA 1UUQA 2BXZA 1LF1A 4PUDA 3F5KA 3RM8A 2WMGA 3MUIA 1EA9C 5CSYA 2ZUMA 3LPOA 3SCOA 1KB3A 2WXDM 2VX6A 2VMFA 2VZTA 1PZ2A 2VNCA 4BQ2A 1VIWA 2GFTA 2VT0A 4IPLA 4JZ5A 1BGGA 1E72M 4AD5A 3CMGA 3E1F1 4AZIA 2XVPA 5D8WA 2XWDA 3N04A 5CPTA 3O2LA 1KCKA 2D0GA 1EHNA 4WSJA 3RM4A 4JFUA 4NRRA 4XZBA 3MUY1 1ZL1A 5LA0A 3RCNA 4HZ7A 3WH8A 1LL6A 2B31A 4CD7A 4D6IA 2Z1KA 1ESWA 3VX1A 5D9MA 2OWXA 2VRJA 3B9AA 1WPCA 1VFOA 1JL8A 3ZJ6A 1AQMA 1E5JA 2J78A 4MPKA 1CGVA 3MMDA 1B3XA 1HJVA 4MNKA 4P8VA 5I78A 2J25A 1VB9A 4UZUA 2DIJA 3AXHA 2WCAA 3BMVA 1AMYA 3CUFA 3ZMRA 3FAXA 1HKJA 4QLLA 4P8WA 2FH6A 3EDFA 4W7WA 1DP0A 1JYNA 5DMYA 3VDCA 3WDHA 3N11A 1FOBA 2XVKA 4KH2A 3NJ3A 3QHOA 2W5FA 1C3FA 2E0PA 4AZ7A 5M5DA 4MB4A 3VO0A 2VUYA 1PX3A 3VMOA 1ZB5A 3WFLA 2WBKA 3IAQA 3AS0A 1PIFA 3OG2A 4AY1A 3WMCA 3L4ZA 5FL0A 4YHEA 4DM2A 4U3CA 1EQCA 4QDMA 2WZIA 4C7DA 4CUCA 1JD9A 3WMBA 2VURA 4HP5A 2XIBA 3KWXA 1JF5A 5I0DA 1E40A 3WDPP 3VGGA 1GW1A 2DGAA 2RGLA 5A8NA 2V3DA 5I6SA 1B31A 2WANA 1V3MA 1WZLA 4UFLA 4AD4A 2QV4A 1LLOA 3O9NA 3WD1A 2Y2WA 1ODZA 2J47A 1AQHA 1M01A 1PX8A 3CGTA 1OWQA 3EMCA 4H7VA 4YPJA 4D72A 1BG9A 1H1NA 4C7FA 3L2MA 3OLDA 1FP8A 2J75A 1MVYA 3N9KA 4PCTA 3LMYA 4LPCA 2EBNA 4D6DA 3FY1A 1JFXA 3A6OA 1QW8A 3ARZA 2VZOA 1HF6A 1G01A 4JKKA 1YQ2A 3BMWA 4CVUA 5GNZA 2WSKA 2IUZA 3HMCA 5JUVA 1UH4A 1TUXA 4BS0A 1JZ5A 2A3BA 1CXIA 2X0HA 3PZGA 3SURA 3CBWA 3WH7A 1R7OA 3AMGA 2IXVA 2WBGA 3BLPX 2EPLX 3PTKA 3WQWA 2D24A 3UG4A 3VU2A 1E15A 1R7AA 1QI2A 3WF0A 5HXMA 3VDHA 1KXHA 2WHKA 5BXPA 4OBSA 2EJ1A 1W9XA 4DUWA 2BHZA 3WEZA 5I24A 4XUYA 4NI3A 3WNMA 1E0XA 2WC3A 4UCFA 1GQJA 2OSXA 5IDIA 3W24A 3AZSA 1BFNA 2DQXA 3AROA 3PBGA 4WSKA 3WH5A 1W3JA 4FLQA 1TR1A 2X1IA 1XSIA 3ARVA 4JKMA 2DSUA 3NDYA 5GPRA 3T09A 3CHEA 2Q8XA 3GM8A 1YHTA 3AMKA 2VJXA 2GK1B 2YDSA 3WNLA 5EB8A 2ZUSA 3VD5A 1VEMA 1E6XM 5HDRA 2WNWA 4P7LA 4FMVA 2GK1A 2F2HA 1UR0A 4F79A 3ZT5A 1JZ6A 3ZJ7A 3VIPA 4BQ4A 3MSGA 2DT1A 3APGA 3WL0A 1B9ZA 2A3HA 2ZXDA 2J74A 4CGTA 8A3HA 3IJ7A 2YLLA 2Y8KA 2GJRA 5EFDA 4ZE4A 3WIJA 3N1AA 1VFFA 4AZCB 4P7RA 3THDA 1NWTA 2VZSA 3VD7A 4E8CA 4UFKA 2WVTA 3FHQA 2XWEA 2V3FA 3SCNA 2WYSA 4P8UA 4LYPA 3GBDA 3NCOA 5A6BA 1Q4NX 3U5UA 5A1AA 1HP4A 2ZX7A 1XYFA 2HVMA 4OOZA 3VX0A 2ZUWA 3N18A 1XH1A 4S3JA 2CBUA 4Z2GA 3SIMA 3WL1A 1V3HA 2BHUA 5HBFA 1HXJA 1J9YA 3AYRA 3ZOAA 4LGXA 3TP4A 1I75A 1MFUA 4GO9A 1NH6A 1HJUA 3WMSA 3RILA 5BWFA 2CHOA 3EBVA 5A6BD 4ZFMA 4OIFA 4PMOA 2JIWA 3CTTA 5BROA 2TAAA 2UY5A 2VO5A 4AZGA 1UR1A 3WQ4A 1FA2A 2CIPA 4AWEA 4MJ4A 3WUEA 3F4VA 1LJYA 2XJ7A 2D22A 4JFTA 4K68A 4UQDA 5BRQA 4D6HA 4AZ5A 2WZHA 2D0FA 4GPNA 2CCRA 5E6YA 4M1RA 1WCGA 4DUXA 1E43A 1W9VA 2JF7A 1H0GA 1TE1A 3L4UA 2PBGA 2J79A 3ZM8A 4FLOA 3T2OA 2W66A 4UNIA 5IHSA 2ZXBA 5BXTA 2OSWA 3W38A 4AISA 1G94A 1UWUA 4PMDA 1NP0A 2YL5A 2Y5EA 3VDBA 3VGHA 3UCQA 5DFAA 5I5RA 4D71A 2PC8A 3ZT7A 4UOQA 3AQUA 4CD8A 2D2OA 2XPKA 4XX6A 3SCTA 3GBEA 4JFVA 4AMCA 1XGZA 2O9TA 1KQYA 4M29A 4PBGA 4AIOA 3NSXA 4H8HA 4HPHA 2YOCA 4RE2A 4C7GA 1MQQA 2WPGA 1XV8A 2XYLA 4M24A 2BY1A 1JAKA 2OSYA 3PHAA 1Q6GA 1SMAA 2E40A 5JBEA 2O9PA 4W5UA 4D1IA 1C8YA 3HJEA 4HPGA 3RJXA 4PMUA 4MADA 4CN6A 3CMJA 2XFFA 4HZ6A 1LL7A 4PEEA 3ZSSA 3AHZA 4Z2LA 2BVDA 2PBOA 3W29A 2WAGA 4DWSB 2BY0A 4J3WA 4NZCA 4J7RA 2G3NA 4DWSA 4LYRA 3AHYA 1G0CA 3BAJA 4MNMA 4UOJA 1W32A 1CXEA 1C8XA 5CXPA 3WENA 1GOKA 3WNNA 4EKJA 4FLSA 3BAKA 4GI8A 4Z2HA 1HX0A 4S3KA 3VGEA 4NSBA 1V02A 1QI3A 1E6QM 2WMIA 4YHGA 3MV01 4AIUA 3BLKA 4DWSD 4U2YA 1Q6EA 3ARWA 3MUAA 2D1ZA 5A94A 2XM1A 3AYSA 4D1JA 5IFPA 1WAWA 1QNPA 4HZ8A 4LYQA 2CKRA 4CD4A 1KXVA 4GXPA 2XVGA 4PTXA 1B3YA 1MW0A 3NDZA 5GNYA 3NSNA 1BGAA 3OBAA 4TOQA 2Y4SA 2DSVA 3IAPA 2DSZA 2XHYA 3N17A 1OD0A 1VFMA 3PZMA 4WKHA 1HIZA 1CXKA 4J3UA 4PMNA 4M80A 4YN5A 3WDRA 3OZOA 2WCGA 4PMXA 3RIKA 1DHKA 1X6LA 4FLRA 1DWIM 4AZBA 3VIHA 5LA2A 2AMGA 1M03A 3LPFA 3II1A 3VILA 3MKKA 5C70A 1UR9A 5A6AA 4CN1A 4U2ZA 2VVSA 1UZ1A 4OOUA 4BF7A 5I77A 1UOKA 2OYLA 3CHCA 1E55A 1HJXA 3GH7A 3MS8A 1GHSA 2XM2A 5AYBA 3WD0A 2ZWZA 3FN9A 4KGLA 2W67A 3WY1A 3QOMA 2VOTA 1DTUA 2X05A 5GQBA 5EFFA 1R87A 3SEPA 1KR0A 3WNKA 3L2LA 2CBJA 2QPUA 4UFJA 2CESA 3EMQA 4HOWA 3VM5A 3FAWA 5ABEA 1TA3B 3ZR6A 4KWUA 5IFTA 3N12A 1OIFA 1QVBA 5C71A 1VFUA 1MW2A 4WJXA 1RPKA 1GVYA 4PN2A 1TA3A 4MTVA 4GIAA 2DT3A 3OB8A 1BSIA 1V3IA 2WLZA 3ARXA 2PWGA 2BV9A 3AIWA 4MB5A 2XG9A 1V0NA 2AOSA 1CXFA 4JIEA 3PZVA 1M04A 1TVPA 1WZKA 4B16A 2CKSA 3UERA 2VR5A 3VD3A 3DECA 4MAZA 3GXIA 2C7FA 4N0RA 7CGTA 4BZYA 1UWRA 3BSGA 1HN1A 1V0MA 4AD1A 1MXDA 5A8OA 4AD0A 4HOXA 2O9OA 3UEQA 3IANA 3WF3A 5FCZA 5CZKA 3M7SA 1E6RA 1J12A 5JBFA 1G9HA 4M56A 2G8ZA 3K8LA 4D6GA 2J8GA 4JHZA 4CN4A 2JE8A 1SR0A 1W3HA 2VTFA 5ABFA 5CLWA 1IT0A 3A4WA 1HT6A 4UQBA 3S2CA 1UKPA 2WZEA 4J3XA 2YA2A 4W8BA 2YDQA 5I23A 4HA1A 3VNYA 5HNNA 4M81A 4ZE5A 1NP2A 4JFWA 5CGMA 2FGLA 1UQYA 1B90A 3DC0A 5FL1A 1CLXA 1D3CA 4AD3A 4CU7A 1KWKA 1NOWA 1BVNP 4F9DA 3GXDA 5A95A 4QLKA 5FKYA 4WK9A 4DWSC 2RGMA 4HU0A 2G4FA 2Y8VA 3U57A 3OLIA 5E9AA 2XSAA 1GVIA 1V3LA 3VDAA 2WMFA 1V6UA 3WBEA 1V03A 3M07A 1ZU8A 1JIBA 4W88A 1Y7VA 2FHCA 1EOKA 2QLYA 2GJXB 3DYPA 3QOKA 4UQAA 2WC4A 5DT5A 2QMKA 4W84A 2FGZA 2GJXA 3N15A 4W89A 3J7HA 2IXUA 1NWRA 3VOCA 4NF7A 4WKAA 1V0KA 1GOQA 3ZR5A 1W2PA 1PZ3A 4JL1A 1CENA 2ZWYA 3AXIA 1GNXA 3SUVA 4U5KA 3G6LA 2QF8A 1CTNA 4HMDA 8CGTA 4GI6A 1X1NA 4JCLA 1J0JA 1XHGA 2J7DA 3L4VA 1J0IA 5DF0A 1L8NA 2O92A 1UH3A 1NARA 1JAEA 5A6MA 2PI6A 4UR9A 1FFQA 1OCQA 3JUGA 4JKLA 1E0VA 1GCYA 3B9DA 1JYVA 3KL3A 3DYMA 1B3ZA 4D6EA 3WSUA 4L4PA 1UR4A 1QBBA 4HMEA 4OKDA 4UQCA 4B15A 1C7TA 4IISA 1C7SA 1W1TA 1R85A 1VENA 1MWOA 1VBRA 1HNYA 2YBTA 1DWHM 1VEPA 2Y24A 3AMCA 1CWYA 4CD6A 5CGTA 2YL6A 1L0PA 3WN6A 4Z2JA 4PSRA 3QHMA 3WF4A 5FOOA 3M46A 3DHUA 1XD1A 3GTNA 3SCRA 3NYDA 3QGVA 4TVUA 1D7FA 5BYWA 1CGUA 3I3EA 3RJYA 1J18A 1B3VA 3WDIA 1E4NA 1WB0A 1IZJA 3VIMA 1V6YA 1UKQA 1FFRA 1DWGM 2BS9A 1V02E 4CU6A 1H09A 4Q22A 5C8BB 1UG6A 1UWIA 2GSJA 4ATWA 1QI5A 4JCMA 1XH2A 2OYMA 4HOZA 3GH5A 4ACZA 2DPEA 4PMVA 3IK2A 4XB3A 1WDSA 1E6SM 4Y7EA 2V3GA 3SCPA 3W25A 3RM9A 2W92A 3GNRA 2PWHA 1TZ7A 2E3ZA 1GQKA 3AMDA 4TX6A 1H11A 2J7BA 2CXGA 2ZUVA 1US2A 3NUKA 2C8NA 1OT2A 1PX4A 1VAHA 3A47A 2X2YA 2WVUA 2WW5A 2QPSA 3T0BA 1UD2A 3AS2A 5E0CA 1LWHA 4MJ2A 1JGIA 4URIA 2C0HA 1A3HA 1E70M 1WE5A 3BAYA 1QNQA 4C91A 3ZQ9A 2VCAA 1MFVA 1ZJBA 4ZXLA 3TTYA 3PZOA 3UR7A 3WUFA 1CDGA 3BAWA 2WVVB 4PMZA 3BSHA 2D20A 1B3WA 3OIHA 3FXYA 1R86A 3UESA 1E9LA 1HJSA 1U2YA 1V0LA 3THCA 1D2KA 1K9TA 3TTOA 2W63A 1CXLA 3K4DA 2WVVA 2WC7A 2XIIA 3U7VA 1B0IA 1CLVA 2X8RA 1A47A 1V6XA 1JZ4A 5A3HA 3VIOA 1J11A 1UHVA 3WQ5A 4E8DA 3CPUA 4QP0A 3VTRA 2WHLA 5BRPA 1K9DA 1UD8A 4MNJA 2XGBA 1NOFA 3PTQA 1XC6A 6CGTA 1B2YA 1BVZA 1XRVA 2WKGA 1VBUA 1W9DM 2BFGA 1MW1A 4UOZA 5M03A 3AFBA 4J28A 1E3XA 1WDQA 3SCWA 3SCQA 3AIVA 1XSJA 3AISA 1QNOA 4MB1A 1KQZA 3VIKA 4RE4A 3EDEA 3GDBA 2GJPA 1FH7A 3K8MA 2CEQA 3WH6A 4WF7A 4J3TA 1KGXA 4B3LA 1GZJA 1R8LA 2VRKA 2XTKA 4PSPA 3CUGA 1VEOA 1E73M 2XVNA 2JALA 5HPOA 1DWAM 4E2OA 1MYRA 1ZS2A 4PMQA 1RD6A 1WNOA 3OLEA 3WH9A 3VIIA 1FH9A 1AVAA 5DO8A 1EXPA 3KZSA 5EBAA 1UWQA 1EO7A 2OLHA 3CO4A 5D4YA 3GZAA 3BC9A 1Q6CA 3W37A 1OGSA 1J0YA 4H8UA 2FDMA 2VZVA 3UG5A 4H04A 1BQCA 3K4AA 5A6LA 2EXOA 1J10A 5AC5A 3K8KA 2EPOA 5A8PA 1LL4A 3GYCA 1UD4A 3BCFA 5JIWA 4PMYA 4CVWA 2YL8A 4W85A 1JXJA 2PWFA 4FF5A 1BHGA 2EEXA 2DT0A 1EDGA 2AAAA 2BVYA 2CETA 1OGBA 1LG1A 4LQ1A 3S6TA 3AXXA 2D0HA 1IV8A 4A3YA 4MNLA 3SCUA 3SUWA 3A4XA 1UWSA 2WCSA 3WQ8A 3CZJA 1TVNA 3CZKA 1SMDA 4QCEA 3AIEA 1JDDA 1EO5A 2FH8A 3UG3A 4W5ZA 1JZ2A 2OYKA 3BAXA 2YDRA 2HISA 2EO7A 3MO4A 4X0VA 4AZHA 5BXRA 1BYDA 2WMIB 2XSBA 1CNVA 2VC9A 5I3DA 4HA4A 5FIPA 1QPKA 2V5DA 1J0ZA 1OB0A 4UFHA 2JEQA 1XCWA 4F9JA 4V2XA 1QI4A 1ZJAA 1CIUA 2YIHA 5A69A 3OGRA 2VVNA 3I3DA 3BAIA 3WELA 2CBVA 1QHPA 3BH4A 4PTMA 4TTUA 4W8LA 5E09A 1UA7A 1VJSA 4R27A 1DWJM 2WHJA 3TA9A 3D5HA 1C93A 4AXNA 1NQ6A 3FHAA 3VGDA 1WO2A 5A6SA 3EDDA 1BPLB 2VR4A 1HKIA 4AC1X 5HPCA 3L4WA 2DH2A 3CZGA 4TX8A 3KL0A 1H3GA 5CPQA 3BXWA 2VI0A 2JEPA 2YBUA 3EDKA 1BG4A 2V3EA 3AMLA 3ALFA 1B30A 4UFMA 4W8AA 1W9UA 2WVSA 3WQ6A 3AOFA 4H8VA 1JZ7A 1PJ9A 1EOMA 4XZWA 3DHPA 4X0NA 3VGFA 3CHDA 1N82A 1OD8A 1DEDA 3TTSA 5EMYA 1LG2A 1K6AA 1E6ZA 1C91A 2UY3A 1KGWA 4M8UA 3WFZA 1KFWA 1B1YA 3POCA 5M17A 1V3JA 3WUGA 3ALGA 2CERA 1W91A 1MQPA 4BQ3A 1U30A 3CH9A 1CGWA 1HL9A 1H5VA 5KEZA 3VIGA 1ZBVA 3SCVA 1V6VA 3VGBA 4XV0A 4C90A 1QHOA 1G1YA 1XD0A 1CGXA 4H41A 2VX7A 1CYGA 3OGSA 2YLAA 1UKOA 3VD9A 5LYRA 3O6AA 2E9MA 2DH3A 3GXFA 3RDKA 1ISWA 5I2UA 2WMKA 4KRTA 2F61A 3LPGA 5ABHA 1JZ8A 3K1DA 1FP9A 1HL8A 2QHAA 5AYIA 1ZBWA 3GNPA 4B3KA 4CU8A 3VPLA 4HTYA 3WNPA 1WP6A 4U5IA 4IUGA 1ISZA 3UETA 1ZBKA 2E9LA 2YKKA 2ZIDA 3CZ8A 3NSMA 1E4LA 1V3KA 3PZNA 1OINA 4EE9A 3ZJKA 5GNXA 1H49A 1W1YA 2BNJA 1GJUA 3MMWA 7A3HA 3WNOA 1QNSA 2GDUA 2DT2A 3KL5A 3SUTA 1JYXA 2MANA 4J3VA 4TXEA 1VF8A 3VIFA 3F5LA 1RP9A 1GORA 2VCBA 1QHZA 1E4MM 5I79A 2JIEA 3PZIA 4V27A 5TD4A 3B8SA 1U33A 1NWUA 4NRSA 4CCCA 1GUVA 4ATDA 1E3ZA 2A3EA 2QMJA 2ZX5A 4GINA 4UQEA 5AC4A 4GQRA 5ABFB 3N13A 2EPKX 2DEPA 1TFVA 2JF6A 1OGGA 4WKFA 5A8MA 2VL4A 3CHFA 5E70A 4B9ZA 3PTMA 1J0KA 5A6KA 4W87A 2UWFA 2WMJA 3W6LA 5F7UA 1HJQA 3ARPA 3L4YA 1TMQA 3RPMA 4BA0A 4BQ5A 3ARRA 1Q6DA 3EMZA 4QCFA 4JL2A 1W9PA 2G3MA 2XFYA 4OUEA 4JAWA 1DWFM 1QOXA 4ZENA 3RO8A 2J7HA 1UH2A 2D3NA 2YA1A 3LPPA 4EK7A 5ECUA 1UWTA 1GQIA 4HMCA 3ZO9A 3B9EA 3I3BA 2DSWA 1UR2A 5CQ1A 3WD4A 2UY4A 2BY3A 3CZLA 3CUJA 4TVDA 2ZUUA 2E8ZA 2ZX6A 3W6MA 3AIQA 2OWWA 2DSKA 3AI0A 3ZJ8A 2J77A 3AIUA 3T2QA 5CG0A 1CXHA 4AEFA 1E6NA 2G41A 3AZRA 4BCEA 1M7XA 2ZX9A 4QAWA 4W93A 4RE3A 1WKYA 1X6NA 2PB1A 3AHXA 3ARQA 1SYTA 1GOOA 3MV11 6TAAA 2WKLA 4F66A 2CITA 1BAGA 4P8XA 2XVLA 2E9BA 3WKZA 1QNRA 1HP5A 4W7VA 2J7CA 1HKMA 1FHLA 3AS3A 4X9YA 4AIEA 1RP8A 1W1PA 1JI2A 1E6PA 3W0KA 1FH8A 3POHA 4UZSA 3AHVA 4H2CA 4F8XA 3FNDA 1UZ4A 1GONA 3MMUA 3ARUA 1ISYA 4W7UA 1W2VA 4V28A 4OJYA 1GOMA 2EPNA 4ACYA 4B9YA 1ITXA 2WSPA 3CZEA 1WDPA 1NOUA 4QLJA 1I1WA 4J27A 3BGAA 1KBBA 4PTWA 2OWCA 2ZXQA 4JHOA 3VNZA 3HN3A 3PZQA 3PZTA 3F5JA 4UFIA 2CBIA 2W62A 2ZOXA 1KCLA 3ECQA 3FW6A 4IPNB 1PAMA 1KXQA 4LX4A 3SUUA 4TUFA 3AS1A 3U7BA 3AHTA 4EANA 3VD4A 4D6FA 4GZJA 4WLCA 3ARTA 3MANA 5E0FA 3OGVA 4ACZB 2WHMA 4CCEA 3TOPA 3AICA 5A8QA 4KRUA 1JYWA 1E0WA 2CNCA 1GPFA 4W86A 3BCDA 1VRXA 2J62A 1W9BM 4MB3A 1GQLA 1UQZA 2CHNA 2VZUA 4DM1A 1EDTA 2V5CA 4OBRA 4GI9A 5KZ6A 1AQ0A 1HVXA 1XYZA 3OLGA 1F4AA 2GUYA 3T0AA 1F4HA 1JFHA 5CLTA 1PIGA 3W26A 1K9EA 4PUEA 1ISXA 3WDJA 2J7EA 5ABGA 1OIMA 4AEEA 2ZE0A 1SFSA 1JDAA 4P7QA 3TONA 5IHRA 1OM0A 2J4GA 1FHDA 1JD7A 3T2PA 5IXEA 2PF0A 3WD3A 1XCXA 1UKSA 2D3LA 4AZCA 2X09A 1PBGA 1J01A 4PYSA 1E5NA 4UTFA 4RL3A 1IZKA 5LA1A 6A3HA 1KWGA 1HJWA 2D23A 3ARSA 5M3WA 3MU7A 2ZUNA 1UD6A 5CPSA 1W3KA 1O6IA 3AIBA
chains in the Genus database with same CATH superfamily
1I1XA 3UZZA 4K8GA 2GUUA 3T08A 5CSUA 1EJSC 4UB9A 4DJDD 4KT2A 1LQ0A 2A3CA 3RAOA 1C92A 1OFPA 1NQKA 3D47A 3WD2A 1UYQA 4QFUA 3UA3A 3B0PA 3NQAA 4J2MA 1JCNA 9CGTA 3IPWA 3SY8A 2Q09A 5EJ1B 1P4CA 1B4EA 2AL2A 4IP4A 2EPMX 3GWQA 4GUJA 2BODX 4JY8A 4HTBA 3I68A 4M6VA 3AZTA 4D6JA 3KDOA 4N42A 2QCNA 3R79A 4C1NB 1XICA 3W73A 4J3SA 1BVWA 1VP5A 3A4AA 2BVTA 2WMHA 3QW3A 2W61A 1ZP3A 5D8ZA 3B05A 3W4RA 1VFLA 3KBVA 3ES8A 1IWBA 4GXMA 2XGZA 3W23A 1IGSA 3VNLA 1MXGA 3W87A 1JUKA 1C8QA 1MO0A 3MUZ1 5B80A 1EYEA 3HURA 4UTTA 4AZ6A 2QCGA 3KDNA 5D9NA 3TLLA 1O7AA 4B4HA 3AAMA 5EIYB 3PZUA 2QCDB 4IQLA 1V08A 1CECA 4HPJA 1GW9A 3CIVA 2VQTA 3GXNA 1CZ1A 1GOIA 3TOYA 4L6HA 3AIRA 1OFRA 4Z2IA 3UXDA 3CPRA 3EB4A 1UR8A 2X1SA 3V1PA 2XIMA 4EXAA 3QY7A 4JYFA 4WR3A 4PULA 1DBTA 4MLJA 3ARYA 1G4SA 3LHYA 2NW0A 2W91A 3TSBA 2PAJA 3O1NA 1CGTA 2OJPA 3TSMA 1Z32X 3FKRA 1XYMA 3DHFA 4C6PA 5BWAA 4HPNA 3G0UA 3QZAA 5H8MA 1KXTA 3NO1A 4Q4MA 4MDOA 2YJQA 1TCMA 2REQB 2VGFA 3ZT6A 5K9DA 3F7JA 2WPBA 3CQKA 3FJNA 2XUCA 3QPZA 3PBVA 4PRWA 2ZQ0A 4NHVA 2OLSA 1C90A 1L2QA 2YXXA 2R94A 1CT5A 4Z2KA 3VNDA 1WZAA 5B7ZA 2C0AA 3VMPA 1EPVA 3H2FA 2PLKA 2VC6A 3DYOA 5A2CA 4IXXA 4KPLA 3H7VA 1XXXA 4ATLA 1SZGA 4YVXA 3T1GA 1DJYA 1OCNA 1J0HA 4ONVA 2CYGA 2XN0A 2I56A 3G6MA 2WB5A 4DBSA 3IRDA 2E68A 4IIHA 5D05A 4TTGA 3PAOA 4L4LA 3KAOA 2H8ZA 2WM0A 1KGUA 3M16A 1H2JA 2JKPA 1VR6A 4HG6B 1IWPA 1BLIA 4PUNA 2V81A 1UP3A 1EZWA 4TV5A 2EQDA 3W01A 3NTYA 5HWJA 1GOWA 5I3GA 3L0NA 5LGZA 1WQ5A 4ASTA 4JTQA 1UBPC 3OZPA 4O28A 2PD5A 4BI6A 2E6DA 5HQLA 1E1EA 1ITCA 4O53A 2F8QA 3ES7A 1LWJA 3L21A 3ZVHB 3GU1A 3BVJA 1PPIA 3HU7A 5A2AA 4JGDA 4ADSA 2ZICA 1UUQA 3NGJA 2BXZA 1T41A 3NURA 1NFBA 3F5KA 2P8BA 3P0XA 2PTXA 1ZUAX 3STPA 4Z1AA 1TTIA 4X63A 5KZMA 4BQ2A 1VIWA 4FNUA 1NFPA 2GZXA 4W9TA 2Z00A 2XVPA 4GG9A 3N04A 5D8WA 5CPTA 3W88A 1KCKA 1YYAA 4NRRA 1UIOA 3LV5A 5LA0A 4C65A 1FXPA 1LL6A 2B31A 2DU2A 3U9IA 3H12A 2WQDA 4D6IA 1ESWA 2KZHA 5D9MA 4YS1A 2G4JA 2E09A 2PWVA 3UQNA 1XDJA 3FXGA 2J78A 3RPTA 1M6JA 3WLHA 1HJVA 4MNKA 5AHLA 4DVOA 2J25A 1SJAA 4C6DA 3CUFA 1AJ2A 3ZMRA 2IPFA 2GSHA 4ZOAA 1GTEA 1FWRA 1R3QA 4P8WA 3CPGA 3EDFA 3AUJA 4H01A 1KFJA 3C0SA 4KH2A 3CTLA 1TMHA 4M6QA 1ZENA 1NEYA 2OLAA 3S2MA 3LCWA 3TQKA 3G1XA 2O0TA 4AY1A 1W17A 4HNCA 4QDMA 4F40A 1KM5A 2YCLA 4HP5A 3MB9A 2XIBA 1EJVC 1DXEA 3WDPP 2XIJA 2DGAA 5AZ1A 5A8NA 2WANA 2PDIA 3VNKA 2GGEA 2Q3OA 1AQHA 4Q7BA 2E28A 1M5WA 6XIAA 2PP3A 4KCTA 1FRBA 5I09A 2J75A 1MVYA 1Q65A 4L7ZA 4PCTA 2EBNA 1OY0A 4YYCA 4HGXA 1S1PA 3MY9A 1WX0A 4HMNA 1HF6A 3TMQA 2FMOA 1YTEA 4F2BA 4E3TA 4BY3A 1F8MA 3HMCA 3P82A 2MUCA 3KUMA 2Z6JA 2A3BA 1R7OA 5F2LA 3AMGA 3EOLA 2IXVA 2WBGA 4S3BA 3ZLHA 4R88A 2D24A 5HNUA 3VU2A 2P3ZA 5LNRA 3WF0A 5BXPA 4DZIA 3S9IA 2EJ1A 3A22A 4FNPA 1TTPA 1KRAC 2A3LA 4HJFA 4QR6A 5A5WA 1SW0A 3THQA 4YTUA 3N2BA 1W1B1 3AROA 4WSKA 1W3JA 4HU4A 3GDKA 4QG8A 2PDXA 1R3WA 2CLEA 4JKMA 3S5NA 1GVSA 4C5ZA 2GGGA 4Q3MA 1I2RA 3M0MA 2GK1B 2JQXA 3WNLA 2BGQA 3E0WA 2YW4A 1D9EA 3VD5A 3DG3A 3ANUA 3FGCA 3V35A 1VEMA 3LCFA 1UIPA 3LY0A 2WNWA 4P7LA 5FSDC 5IBXA 3OP2A 3GAYA 3DX5A 3ABSA 5IM51 4B5SA 1KNWA 4L9YA 3ZJ7A 1A50A 3VIPA 3NVTA 4DZHA 3TFXA 1ME9A 4XZ9A 4US5D 3E0FA 3ANYA 3GD6A 3WLNA 5EMLA 4ZE4A 1OK4A 3WIJA 4IP5A 3ZVIA 3S46A 3THDA 3VD7A 1XRTA 5FEPA 3VCNA 3SCNA 2HVNA 2YZRA 4P8UA 2RDWA 3NCOA 4UTMA 3LRLA 4GJ1A 5A6BA 3QKEA 2A79A 3CEUA 1XYFA 4CQCA 1QASA 3VOGA 1R3SA 2ZUWA 4S3JA 4QE5A 4Z2GA 2V67A 2ONEA 3FJLA 3WL1A 1J9YA 3AYRA 2X1RA 4IICA 5IOBA 1SVDA 4O52A 1MFUA 4GO9A 3WMSA 2I9UA 3KVLA 3VABA 5CEWA 3W76A 3QBUA 1S2WA 2JIWA 1Y5WA 4Z0SA 4PFHA 1P1MA 3W1TA 3EXRA 5F4SA 4GYPA 4C6BA 3RLGA 2VD9A 3G1YA 3WUEA 4F2TA 3CK5A 1LJYA 3NPUA 4X2RA 3R25A 2D22A 4UQDA 1F5ZA 2OG9A 4GPNA 3PTDA 1WCGA 3CWOX 1WV2A 5K7JA 2JF7A 2Y5SA 4NY2A 4AF0B 2YDAA 1L6WA 2PBGA 4I5XA 4AVNA 4H1ZA 3ZM8A 1F7BA 1VCFA 4NZFA 1KTCA 3U2EA 2FZ8A 2OSWA 3W38A 3VZZA 1DJWA 3UYIA 1NP0A 1OADA 1Y5VA 3W2UA 2Y5EA 2QF7A 3HOJA 3RCMA 3TVAA 4L56A 2A7NA 4D71A 1OX4A 5C2GA 2OXNA 3ITXA 3AQUA 4ES4A 3VZXA 1EKOA 5XINA 2NWRA 3SCTA 1I2PA 4O18A 3RLUA 3LCHA 3WJYA 5KTLA 3T7VA 1MQQA 3KS6A 1XV8A 3ZWSA 1H1YA 4RPPA 4QQUA 3WLOA 1Q6GA 1OG0A 2RH9A 4ENLA 1AL7A 5JBEA 2OOFA 2O9PA 4D1IA 2V5BA 3TH6A 2OPJA 3HJEA 1SJDA 3QQ1A 4HPGA 4PMUA 1GOXA 4ZOEA 2XFFA 1KM4A 3H4XA 1K8ZA 2RAGA 2FQIA 2PFHA 4DYJA 2WAGA 3CV1A 4R33A 2O56A 3SJNA 2PC4A 3QRHA 4LYRA 4GD0A 3VFCA 3WLRA 3C56A 1CXEA 3M0JA 3CNYA 1C8XA 3G1RA 5CXPA 4HN8A 4EKJA 4FLSA 4PTDA 4EPDC 4Z2HA 1HX0A 3LNMA 4NSBA 3G0XA 3A64A 3UNDA 1K02A 1V02A 2VFGA 3CT7A 3KOZA 3BLKA 1Q6EA 2HS8A 3ARWA 3IS4A 4B5VA 4YWIA 2HBVA 3GX9A 4DJEA 2XM1A 4K37A 5IFPA 1PTDA 1WAWA 1PVNA 2W6RA 2RJHA 3O15A 4LYQA 5AHIA 1Q63A 3P84A 1XR2A 2XN2A 3BG5A 1ME8A 4H7ZA 3BSMA 2RDXA 3WMLA 1MZRA 2DSVA 2WSRA 3LB0A 4OTKA 3LCIA 2ZDRA 3HO8A 2DSZA 1OD0A 3PZMA 4J3UA 4PMNA 4YN5A 3V4BA 3CU2A 3OZOA 2WCGA 3LRMA 4PMXA 1DHKA 3LCXA 5FACA 4R3UA 1X6LA 3SM0A 4FLRA 3U48A 2Z6IA 1KD0A 2YB4A 3LPFA 1OFDA 3VILA 1UR9A 4P5UA 1M9HA 2Q8LA 4GGHA 4JS3A 4BF7A 1RA0A 1UOKA 3DC8A 3H53A 2WOQA 2NQHA 1ONEA 4HCLA 1GVFA 2UZ9A 4ZOBA 4NT0A 1AQFA 1Q7ZA 6TIMA 5AYBA 2ZWZA 1H7NA 1Q6LA 4L4MA 3NO5A 4U4MA 2OOGA 2VOTA 2X2GA 3QMSA 1L6SA 2NQJA 3SEPA 4F4RA 1KR0A 2ATMA 2ZTKA 2CBJA 1XL9A 2ZRXA 1JUEA 4KETA 3UPMA 4UFJA 1KM0A 3VM5A 1O1HA 3FAWA 4PEKA 3ZLFA 4LALA 2D69A 3GTXA 3ZR6A 2A1YA 3GAKA 4O16A 1BSLA 2EAWA 1A5UA 5C71A 5KETA 4KCVA 1TA3A 3GU9A 4MWAC 3WK1A 1NFGA 1BSIA 1G69A 1AMKA 2TRSA 4JIIX 2XG9A 2ZZ6A 3R43A 1WZKA 2P0OA 4G8TA 3VD3A 4Z1DA 3DECA 3WJSA 3N29A 4GBUA 4S3DA 2A7PA 4LYKA 4BZYA 3EOSA 1UWRA 1HN1A 4IZGA 4AD1A 4BKNA 5FCZA 5CZKA 3T8QA 1TTJA 3BV4A 4OT7A 1J12A 1G9HA 2WSYA 3K8LA 2QXWA 4YCOA 4XIAA 2JK2A 4JHZA 4CN4A 1AD4A 5K9CA 2DW6A 1GKPA 2PF8A 2PDWA 4I8YA 3DENA 1PHWA 1SZRA 1JCTA 4HA1A 5EGRA 3VNYA 1EB3A 1QJWA 1TREA 4JFWA 5CGMA 1UQYA 5BNKA 3GO2A 1CLXA 1NOWA 1ZQ5A 2YCLB 3REQA 4Q32A 2PRHA 4DWSC 4WK9A 1ZGDA 2RGMA 4HU0A 2JBMA 3CT2A 5E9AA 1MEWA 3IJDA 3SIZA 3VDAA 3NEHA 3TYZA 4EOUA 3E2RA 2CLMA 1ZU8A 3H2MA 4UTWC 4XQ6A 4W88A 4MWAE 1KFLA 2FHCA 1EOKA 1HGYA 2QLYA 4O15A 5BMXA 4UQAA 1N8FA 4KWSA 3MHGA 2AL1A 4GIYA 5DMMA 3TW6A 1XIHA 2GJXA 3N15A 4C1LA 4W89A 1OC6A 3VOCA 2PA6A 3SY1A 1TPEA 3KVJA 1V0KA 4I7VA 2QVHA 2PU0A 4OE7A 3FDGA 3S6OA 2Z7KA 3SQMA 1BXCA 3BOLA 2ZWYA 4K7VA 2FJUB 3P7YA 4PB4A 5EL1A 4HMDA 2W3ZA 4YXGA 1L6FA 4JCLA 1J0JA 2HJPA 2J7DA 4EPBC 3L4VA 1J0IA 5DF0A 3V5CA 1NARA 5A6MA 4NJKA 2PI6A 3JUGA 3MJMA 4C6OA 1JYVA 3KL3A 3L5MA 4KESA 1UROA 4D6EA 1UR4A 1QBBA 4HMEA 2DZXA 5HR6A 3K5XA 1VENA 3AU2A 1MRQA 2YBTA 1DWHM 1VEPA 5B7YA 1WXYA 4DBWA 2OODA 5CSRA 2NVCA 3URNA 3L67A 2DW7A 2YW3A 2BGNE 3S1UA 3W7MA 2DQWA 3DHUA 5LIWX 3GTNA 3NYDA 3QGVA 1D7FA 4I6VA 1IEWA 1RK6A 1B3VA 1DQXA 1X7FA 1IZJA 3CEPA 4NNBA 4FZIA 2XH2A 2VP8A 4EAYA 2ZA1A 4ATWA 4JCMA 4ACZA 2DPEA 2QJMA 4LC6A 3M44A 1E6SM 4Y7EA 2V3GA 1CX9A 3E5BA 2PWHA 2HMCA 4H6RA 1GQKA 3I6RA 3LBMA 1PX4A 1VAHA 1Q66A 2Y63A 1M65A 2WVUA 1SFLA 3LM3A 2WW5A 3QW4B 1LWHA 4URIA 4QEHA 1SQ7A 5G2IA 5C2CA 2X7VA 2DVUA 3KTSA 4PZVA 3BAYA 2C1HA 3GTFA 4K7YA 4C91A 2ZZ5A 3B8TA 5C54A 2VUNA 4ZXLA 4XAZA 3TTYA 4M6PA 3ONBA 2PGWA 1BKHA 3WUFA 3HPAA 3AC0A 1HG3A 4XK2A 3HG5A 1EBHA 2D20A 1VQTA 3WQGA 4HQVA 1JDFA 1E9LA 1HJSA 2OGJA 1U2YA 1K9TA 3IIVA 3TTOA 1CXLA 2WVVA 2Y7EA 4XUGA 2WC7A 3H26A 1N8WA 1OFOA 4CLMA 1B0IA 1S2VA 1JPHA 1EC9A 3VIOA 1J11A 3W7GA 1TWIA 1K9DA 3B97A 3EB2A 5CG7A 1BVZA 1WUEA 3R0DA 5C5YA 1YNPA 5M03A 3AFBA 4J28A 4GVIA 4QNWA 1KQZA 2PSNA 1U22A 3GDBA 2GJPA 1TMLA 2CEQA 1IXNA 2VGIA 2OMAA 4WF7A 1HKVA 1KGXA 3B8DA 4YLWA 4B3LA 3QTPA 2VRKA 4LTSA 5H8UA 4PSPA 2XVNA 2JALA 5ENLA 4PMQA 1DE5A 3ABOA 1V7YA 5DO8A 1EXPA 1UWQA 4XD4A 1JPMA 1W6TA 3G0SA 1ONWA 3GZAA 1PYFA 4KBXA 1XLLA 4AYGA 4JNYA 4H04A 2QCMA 4IL2A 2EXOA 1J10A 3GR7A 2EPOA 5A8PA 4XAPA 5JIWA 4PMYA 3BLIA 4CVWA 4W85A 4WDWA 2EEXA 4BHYA 4AVFA 1EDGA 1LG1A 1AODA 4WEVX 1IV8A 4A3YA 2GOUA 4DO4A 1M7JA 3GG8A 1UWSA 1YMYA 4Y6GA 4NP7A 3V1HA 1O66A 3CZKA 4NX5A 3R7MA 2V69A 4QCEA 2QIWA 1XI3A 3UG3A 1JZ2A 2E77A 1QOQA 2YDRA 1XLFA 2EO7A 3MO4A 1R38A 3LYEA 2XSBA 1FWNA 1GPWA 5HUPA 3DKJA 2FMNA 2ZRWA 4JTRA 2HBXA 4HPXA 1J0ZA 5MF5A 2HVOA 2PURA 1XCWA 2YIHA 1IEXA 1UOZA 3PUDA 1X38A 1TPB1 3E9AA 4GFIA 1UPMB 4IQJA 1UA7A 2C71A 1ZJHA 4R27A 1DWJM 4A21A 1C93A 4AXNA 4E4UA 1U1HA 1AL8A 1WO2A 5A6SA 4O10A 1XGEA 1G4PA 1HKIA 4LH8A 4FF7A 1W5NA 1GVEA 3L4WA 4QJ3B 4ADUA 2XH4A 1Z9AA 3BXWA 3M5ZA 3KVMA 3PC0A 2JEPA 2CHRA 2YBUA 3EDKA 3O0FA 4F3HA 3KOWA 4S3AA 1QFEA 4O57A 4UFMA 5EY5A 3M47A 3MZ2A 1YNQA 4WDXA 1EC8A 4N9BA 3VGFA 3CHDA 4IMAA 4ZSTA 5LGXA 1LG2A 3HPXA 4KRZA 1SZNA 4H9TA 1DHPA 1RQBA 3E0VA 1W91A 3LSBA 2ZTJA 1Q7QA 1G7VA 1PWMA 1U30A 4Q8UA 1CGWA 1P48A 1UBSA 4A2SA 2R1KA 3SCVA 4LBRA 3CS2A 1GK8A 1XYAA 1MUMA 1V51A 2IKIA 3TU9A 4EXBA 1QHOA 1ZNNA 2C91A 1YXCA 1NIUA 2FTPA 2Q02A 3P81A 2V8ZA 1UKOA 1EJXC 4H9YA 3NQ6A 5LYRA 2E9MA 2DH3A 4NJHA 1XKYA 4REQA 2NX3A 3RDKA 2QV5A 3FEQA 2H90A 5I2UA 2WMKA 4YIWA 1H7RA 5ABHA 5I00A 1LTDA 3UG8A 3TN4A 4Y9PA 3R5EA 4QITA 1MZHA 1ZBWA 3E74A 4B3KA 4OV9A 4HTYA 3WNPA 1REQA 1WP6A 2ZIDA 2FGBA 5EMMA 4IOTA 3NSMA 3PNUA 3PZNA 4EE9A 4UXDA 1W1YA 2BNJA 2OR2A 1PKNA 3KLLA 2GDUA 2DT2A 4DF0A 1JYXA 1VF8A 1P0EA 3TZNA 2OZ8A 1RP9A 1E0UA 1HGWA 2IKHA 4PODA 5AC6A 3FDKA 3PZIA 3RX3A 4B5NA 1PZ1A 1NWUA 4NRSA 3HFYA 3BG3A 1E3ZA 1HTIA 1H7XA 1PE1A 2QMJA 2QAPA 4UQEA 4LVAA 4LVBA 3URBA 1FWIC 5ABTA 3TR9A 4WKFA 1ZAIA 4PRTA 3BDKA 1FUYA 5E70A 1OFEA 2OZTA 2CLIA 3KRBA 4D9PA 1J0KA 4DPPA 1Q6OA 3NM3A 2UWFA 1XW8A 4ECLA 1HJQA 4RZ4A 3G1FA 1TMQA 4UC5A 3KBSA 4JTTA 4QCFA 3M7WA 1RLCL 4OUEA 4XZMX 1LUCB 1W37A 3VKAA 4X60A 2Z26A 2Z7GA 4RCXA 1Z7AA 1OCJA 3IRSA 3SRKA 3WD4A 3CUJA 3T4WA 3PP7A 1KA9F 3VNIA 2DSKA 2J77A 2E6YA 4LOCA 3AIUA 1NELA 2ASHA 3IACA 3T2QA 3UT0A 2WV8A 4ZCWA 6ENLA 1M7XA 1H61A 2PTYA 2EKGA 1POJA 2ZC8A 3GFZA 3U4FA 1QTWA 1FCQA 5C0QA 2E9BA 3FS2A 2PP1A 1I4NA 1A80A 4XSMA 3B3DA 4AIEA 1G4EA 3HG3A 2VFEA 3KBMA 5CJMA 4ZOCA 1FH8A 3POHA 1H5YA 3QY6A 3Q45A 2ACRA 2HQAA 1A49A 4MSSA 1V8EA 4F8XA 1S5WA 1CCWB 4QGCA 2A2IA 4HK5A 3UCDA 1ISYA 4ADTA 2EPNA 3R12A 4ACYA 2WSPA 3CZEA 4O1BA 2R14A 3PANA 4B4FA 2PDBA 2VOMA 4PTWA 3NPVA 3OBEA 3VNZA 3MCOA 2O4MA 4QISA 3OIXA 3PZTA 4OWGA 1RV8A 3H55A 4UFIA 2BBFA 2BOEX 3E0IA 1KCLA 3H6OA 4IPNB 1ICPA 1OEPA 3QPEA 2B0MA 1M68A 1PAMA 4LX4A 4TUFA 4GJIA 3AS1A 3AHTA 1ALDA 4KFNA 4PUMA 3QKZA 4FXSA 3OGVA 5LXEA 4ACZB 4CCEA 4B5TA 2CXEA 3H70A 1GPFA 3N2MA 2J62A 4MB3A 4Q4RA 1HO4A 4JEJA 1EDTA 1V77A 3A23A 4GI9A 4US6A 2E25A 3TYEA 1GG0A 1CW2A 4QEEA 1F4AA 1F4HA 1RCOB 1LOLA 1JFHA 4S3GA 4LVFA 3RF9A 4B2DA 4K6AA 1ZAJA 2VGBA 5ABGA 1OIMA 3B9NA 2WJDA 4P7QA 3H24A 3T2PA 1IR1A 1LROA 4K2SA 1XCXA 2D3LA 1P6CA 2X09A 1NDYA 4PYSA 4JN6A 4JYEA 4UTFA 3NOYA 3BK0A 2EHHA 1PS9A 3QN3A 3FK4A 3L66A 4XSLA 4C1KA 4NYUA 5CPSA 1W3KA 4QX4A 1SR0A 2OKTA 4WOZA 4HU8A 1EJTC 3U2CA 1WZMA 4A05A 1BF2A 1DOSA 2WWCA 3TTQA 5CAKA 3TQVA 2BOFX 2NZLA 3CUXA 3IEBA 3HM7A 5M2FX 2VFHA 1CBGA 3B04A 2I16A 4OUIA 3T42A 4AY8A 3VM7A 1DQWA 3CQIA 3PAJA 5FA5A 1MQRA 3W00A 1BTCA 3WF1A 4WD0A 3EYPA 3VINA 3I10A 1R9XA 3SFKA 2XH0A 3OVGA 3WLMA 5FJJA 3DKLA 3KP1A 3V5FA 1V6WA 3N4FA 1CEOA 2G3JA 2QPXA 3B40A 4QTGA 1QCWA 1UA3A 3DGRA 5CJ5A 2YL9A 2ISDA 1PTAA 4M82A 1OK6A 3A9IA 2WWDA 3PBMA 1ZP4A 5DY3A 1W3LA 4C60A 4GQQA 3W70A 3RMEA 1R2SA 3VNMA 3NQVA 2NQLA 1PKYA 4Q8MA 2ACQA 5DX7A 3BQ5A 3LZ5A 2ZADA 4WJEA 2PDUA 1UKTA 4PCSA 1G4TA 5CBBA 4Q6JA 1VJZA 3IGSA 4RNIA 3F03K 2YSWA 1D7KA 2PD9A 3CUIA 1B9BA 4E5TA 3KEHA 3PUGA 4ZQRA 1NM9A 3TK7A 3RGTA 2R91A 2NUWA 4XKYA 5PTDA 1HVQA 5HMFA 4GCXA 1GHRA 4YYFA 2WK2A 1F3EA 1TTQA 4IXHA 4KKXA 1RALA 2J7GA 1RH9A 1QPRA 1TG7A 3AXKA 3S4TA 3IJ9A 5CC5A 1JGMA 3ZIZA 2PEVA 4AAJA 4H2HA 2OX4A 1QW7A 1XLEA 3W53A 3PN8A 2XZ7A 2OO0A 2GDVA 4UTWA 4DQWA 4FNRA 3SUSA 4J40A 1R3YA 2AKZA 5EMKA 3LD5A 4IG2A 1OBAA 4UTJA 4ZQCA 1YDYA 2VQUA 3LSCA 2JKAA 1KR1A 1XIGA 3HPFA 3EOOA 2PWUA 4Y90A 3WF2A 4CD5A 1YBQB 2Y62A 1F9CA 1B3OA 4PBFA 4PR4A 2DDXA 2P1FA 2O9RA 3HGSA 3E02A 1K6WA 1RJRA 4IIEA 4HNTA 3L4XA 2HV5A 3EWBX 1ADSA 3WLTA 4KFOA 4BI5A 1P6WA 2NT1A 1F07A 4UNKA 3M6DA 2DZSA 4FHAA 2HDJA 3GIYA 4CKQA 4F0MA 3O16A 4A3HA 4FX7A 1FKXA 4HYRA 3P60A 3OZMA 3KP0A 1JG9A 3JZUA 4AWSA 1W1VA 4MAVA 2CPUA 3V36A 2PODA 1E1FA 3CB3A 4QS5A 3GXMA 1BXNA 2QGYA 2ZXAA 1POKA 1EFZA 4CQAA 1XKJA 3GFXA 4PTVA 4OVXA 2GPTA 2GVLA 1W8GA 1S46A 4R85A 4MF4A 1BYAA 1F8IA 4LCSA 1E4IA 4DPQA 1AJZA 3TQPA 1TZZA 2Y7GA 1FCVA 3MI6A 2O55A 3C6CA 4JD4A 3W02A 2XFRA 4Y9AA 4YVPA 1Y0EA 2E8YA 4AW7A 3TZFA 1PXGA 1LF1A 4PUDA 5EA9A 3MC5A 1EJRC 5CSYA 4M19A 1V79A 2I5QA 3DZ1A 3HMJG 1KB3A 3V0UA 4DZ5A 2VX6A 4O4WA 2VZTA 1PZ2A 5CH9A 2VT0A 1OG6A 4CNUA 1BGGA 3CIWA 4AD5A 3CMGA 1Y5XA 2HCVA 3O2LA 4WSJA 4XZBA 1ZL1A 3AO0A 2DIKA 1UWAA 4HZ7A 4FO4A 3WH8A 4S3CA 3GVQA 2PDQA 3L9CA 5BRBA 1KM1A 3B9AA 3W7JA 1AH0A 1WPCA 2BGSA 1R2TA 1PO9A 4MFEA 4A8LA 1JL8A 3QFWA 3IGUA 4RNFA 1AQMA 1SJBA 5J8LA 3MMDA 1B3XA 5I78A 2WCAA 3EKZA 4Q4SA 2XSXA 1SO4A 1TJPA 3T78A 3STEA 4HYWA 1D3HA 4G9PA 3VDCA 3N11A 1QOPA 1FOBA 5CC7A 1IYXA 2F6UA 1OZQA 3M41A 2Z28A 5M5DA 3VO0A 2VUYA 2P8CA 4F0LA 3DFPA 5FF0A 5F2IA 4R7JA 4NAEA 1I6NA 3OG2A 4UTKA 4I7UA 2JKEA 3L4ZA 4YHEA 4NIRA 1LLWA 2B7QA 2PTZA 4Q6XA 4CUCA 2J6XA 1LP6A 4YTSA 2F6XA 3HFTA 3KWXA 2GWGA 5LXXA 2V63A 1JUBA 2V3DA 5I6SA 1B31A 3UJFA 4UFLA 3ZWTA 3QLDA 4OFCA 4AG0A 2J47A 1OWQA 4H7VA 4YPJA 4D72A 1H1NA 4C7FA 3KCLA 5TF0A 4DEFA 5HUOA 1B5TA 3N9KA 2DUAA 4HHHA 2OO6A 3MPGA 3EWXA 3BMWA 3QSRA 3MWAA 3F4NA 2ZKMX 3NQCA 3SZ8A 1VRDA 1UH4A 1FVPA 4BS0A 3GW0A 2J88A 3SURA 2HSAA 1A3WA 1AFSA 5F1UA 1EJ7L 2XFWA 2EPLX 5LSMA 3PTKA 2VYOA 4JQ3A 3CJPA 1JQXA 1R7AA 1QI2A 3GDMA 1KXHA 2DZVA 2WHKA 3GK0A 3H22A 4OBSA 2V30A 4DUWA 3FSUA 4XUYA 4XZNX 5REQB 4JTDA 1E0XA 2EGZA 4UCFA 2FZ9A 1GQJA 2DQXA 3PBGA 3W1XA 1WUFA 3VYLA 4DUOA 3BJTA 2OT1A 4IFRA 4KWOA 3PBWA 4LAMA 4XIMA 2ZC1A 3CHEA 3IVTA 1FDZA 2Q8XA 4CQ9A 3AMKA 3DCPA 2OT0A 3WBWA 4UWMA 4X2PA 2ZUSA 3W7IA 2ZA3A 4FMVA 1L2UA 2V82A 1C29A 3LOTA 2GQ8A 3W7RA 3ZT5A 1VPYA 1JZ6A 4GACA 2PTWA 3EEGA 4BQ4A 3GB6A 5I3HA 1B9ZA 5FEZA 8A3HA 3UCCA 1VYRA 1QWGA 4PA8A 2Y8KA 1NDZA 4GOAA 5LKYA 3IK4A 1I8JA 1VFFA 4GH1A 4HZMA 1NWTA 2VZSA 4E8CA 4UFKA 5IDZA 2WVTA 3FHQA 3BJSA 1E1CA 2WYSA 3TN3A 3W1AA 1NF0A 3U5UA 1HP4A 4AB4A 2ZX7A 3GHRA 2V5JA 3RR4A 3DHDA 3LGDA 1XH1A 1BF6A 3MW7A 2CU0A 1QPQA 3SIMA 4UUIA 1V3HA 2BHUA 4MJMA 3ZOAA 3CAVA 4JXCA 5ECVA 1I75A 4FR6A 3L5AA 1EP1A 3RILA 5BWFA 2YFOA 1FY6A 3TC6A 4R53A 4PMOA 1UC5A 1ZTVA 3CTTA 5BROA 2OEKA 4ALDA 3NZGA 2TAAA 3QTGA 5EMUA 2UY5A 1W3TA 2VO5A 4AZGA 1FA2A 4MMWA 3N6JA 3O6YX 1UMYA 3JW7A 1WKEA 4AWEA 4UR7A 3F4VA 1KBJA 2OQLA 4XWUA 1PV8A 3RO6A 3M64A 8XIAA 2CCRA 5E6YA 2X1UA 1X98A 3T9PA 3EPMA 7REQB 1W9VA 3S5SA 4MWAB 3HGOA 5BOEA 3CWNA 4C5YA 3LI0A 5DCEA 1V93A 3OODA 4QJ4B 1FDYA 3T2OA 1KBIA 4UNIA 5KMYA 5IHSA 2ZXBA 5BXTA 1XJBA 1VPXA 4TQTA 1FHVA 4C6MA 3SECA 2V5KA 3CAKA 1OC7A 2VM8A 5AB3A 4LS2A 5I5RA 2R82A 3JVAA 1TSIA 4CCZA 5HULA 4CD8A 5MKGA 4MWAD 4WDTA 2XPKA 4XX6A 2QR6A 3GR4A 2HZGA 3PWGA 2O9TA 3AYVA 1KQYA 3QFEA 3ZR4A 1KFBA 2ACUA 4HPHA 1Q6RA 4C7GA 2YYTA 5GVJA 1UC4A 1V6TA 4ZB0A 3E96A 3OVQA 2BY1A 1JAKA 2OSYA 4XKYB 3F4DA 1RA5A 1SMAA 2E40A 1ZJIA 2Y85A 1SUXA 3MBFA 4WQ6A 3FA3A 1C8YA 3PWIA 4IJRA 3M6YA 3R0KA 4HZ6A 4PEEA 3AHZA 4H4IA 1PIIA 3ITLA 1GQNA 3LM7A 4DWSB 3W29A 3VC6A 3KRZA 1B57A 1N8IA 3E49A 4NZCA 3LGGA 1IR2A 2NX1A 1G0CA 3BAJA 4MNMA 5FJIA 3EZ4A 3W2MA 5CKSA 3EGJA 1YE4A 4UTUA 1GOKA 1FBAA 4IG2B 4QJ5B 3QJAA 4HHLA 1UW9A 1WAUA 1E6QM 2WMIA 1CB2A 3GTHA 5HA7A 4DB7A 2FB3A 4DWSD 2BMBA 3W1QA 2D1ZA 3BGJA 1GZGA 1FDJA 3RPDA 3RXZA 2X1TA 2W0UA 5IBXC 1RHCA 3DFOA 1PTGA 4NYYA 4E2BA 2GGHA 4PFMA 1KXVA 1B3YA 3G24A 4OU1A 5GNYA 3DG6A 3OBAA 2Y4SA 3IAPA 4DJFC 2XHYA 3N17A 3RX2A 1VFMA 2QKFA 4PH6A 1X1ZA 1CXKA 5G5IA 4R9XA 5HAOA 1QT1A 1WA3A 4LUIA 3E5PA 3VIHA 3UZJA 4ZQPA 2DFAA 3II1A 3MKKA 1M1BA 1A3XA 3T0TA 4DJDC 5HANA 3AUOA 2VVSA 2B7NA 2OYLA 3FVDA 3C2FA 4H9ZA 4KFPA 3SW6A 3TV8A 1DV7A 5AYZA 1E55A 1LZOA 3GNNA 3IIPA 1HJXA 3FLUA 1X6UA 3JZEA 2EJAA 1ADDA 4LC8A 4MZ1A 1GHSA 3P61A 3QR1A 3CUZA 4LBUA 3SN1A 2W67A 4FX6M 3URQA 3RN6A 4JIHA 2ZFAA 3EX6A 4GC4A 2AKMA 3FJ4A 3W1LA 3L2LA 4GYPC 3HQPA 3WNKA 3V3WA 3PFRA 3GHUA 2CESA 3EMQA 4HOWA 3IJQA 4NG3A 4S38A 4GMEA 4CQDA 2E5DA 5IFTA 3N12A 2ISWA 1ITQA 4LEQA 1P0BA 1GVYA 1NVMA 3GTIA 2DT3A 2FZMA 1AJ0A 3Q2DA 5KZDA 3GG0A 4GNJA 1DJNA 2WLZA 3A12A 2PWGA 1T8QA 2BV9A 5LIYX 4ZQOA 2AOSA 2RHGA 5IRPA 3EWCA 1M04A 4B16A 3UERA 5KITA 1SJCA 3EX3A 4TIMA 4MAZA 1XIMA 2V2DA 5U4NA 5TNVA 4XAGA 1JCYA 1WOBA 1PSCA 1MXDA 3CIXA 2O9OA 3UEQA 4QDWA 3R4IA 3NG3A 1Q3NA 2G8ZA 4JTCA 3KRSA 1BD0A 1P7TB 2VTFA 5ABFA 2WKJA 2DVXA 4GQBA 1IT0A 4ZO7A 1HT6A 5C9XA 4BJHA 3S5ZA 4UQBA 1UASA 4ML9A 4F0SA 2QUVA 3FJ6A 2CZVA 5I23A 4F48A 4NAEB 4M81A 1LRTA 2VDIA 4ZE5A 2BOGX 4R7WA 1NP2A 2FGLA 1UJPA 4UR8A 4K38A 2E67A 4CU7A 4QROA 2P5NA 1K7XA 3CMFA 3P67A 5LZLA 3S2JA 1UP0A 4GIRA 4QLKA 1UJQA 1GVRA 2Y8VA 4L80A 3NM1A 2NUXA 3NGFA 2XSAA 3W1PA 3NQEA 1V3LA 1V6UA 4C6IA 3M07A 5HQEA 1FHUA 4Z1BA 1JIBA 3WBYA 1Y7VA 1W1ZA 4MOZA 3V0SA 3DYPA 4FNSA 4ZQMA 2WC4A 4DJEC 3O06A 3STGA 1U1JA 2WNZA 2FGZA 1S3TC 1IEVA 3EPOA 3NXFA 2Z27A 3ZR5A 3COTA 4EF8A 3HA1A 4LAOA 4JTIA 1GNXA 3SUVA 1NU5A 3G6LA 3SJ3A 2CW6A 8CGTA 1F73A 4FPSA 3UJEA 4F0HA 4RK8A 2Z1WA 1L8NA 1KFEA 1FFQA 1OCQA 3B9DA 2EKCA 3DYMA 5AC7A 2QW5A 4DNHA 1W3NA 7XIMA 1A5KC 1MWOA 1FTXA 4A8NA 2HTMA 2WZTA 2YL6A 3OVPA 3TTEA 1IEIA 4GIEA 5HMSA 1X8CA 1RBLA 3NL6A 2VEPA 5DRCA 1ZRQA 5D02A 3SCRA 3I3EA 3MKCA 1YXDA 1TJ2A 3M5YA 5GJPA 2ADAA 1DWGM 1TIWA 3HPZA 1V02E 3NYZA 1LORA 4O4VA 4NJIA 5EKYA 5DMLA 5C8BB 2V68A 5AHFA 4ZB2A 1QI5A 2OYMA 4BR1A 3IK2A 4XB3A 4LAKA 2PRMA 2GQAA 1RY0A 3W25A 2QDDA 3GNRA 1TZ7A 1E1CB 2E3ZA 1TPDA 4CQ8A 1H11A 2QT3A 2FFCA 4QSFA 2G0WA 2J7BA 2CXGA 3NUKA 2C8NA 4K1GA 4INFA 3A47A 4YL2A 3G2GA 3WBXA 2W79A 3EOUA 4TX9A 5F4XA 3A4JA 2VC7A 3MJYA 3SRFA 1WE5A 2ABBA 1KLYA 4XD3A 4N2YA 4DBEA 3V0TA 2VCAA 3CHVA 1TIMA 3TXZA 1BWVA 4ICCX 2KX9A 2FZBA 3PZOA 3TE9A 4FNQA 2ACSA 5CBIA 1ICQA 3H2CA 1JCLA 3OIHA 3HGJA 1R86A 5T9BG 1D2KA 1MDRA 3TJLA 2W63A 1OFQA 1X8FA 1KKOA 2Q6ZA 2XIIA 3I4EA 3UWUA 3W7LA 1SW3A 3LUTA 3DH7A 1JZ4A 1J6OA 3B9OA 4XVDA 2POZA 3VTRA 2WHLA 4MHBA 4MNJA 5LIUX 2IQ0A 3PTQA 2NV2A 1O68A 1XC6A 6CGTA 1YLVA 1B2YA 3TWBA 1IXQA 1XRVA 3BG9A 4MY8A 1W9DM 2IQDA 3BLOA 1JPIA 4UOZA 1WDQA 2NV9A 1XSJA 1LOSA 1QNOA 3G8RA 4MB1A 3EDEA 3R11A 3WJXA 3I65A 2BVWA 2OU4A 2NVAA 4KCWA 1R8LA 2CLLA 4FIRA 1VEOA 2X7WA 3M0IA 1UPPA 5HPOA 2Z1XA 4E2OA 3NO3A 4NAFA 2Y8UA 4IF2A 2WJZA 5K2ZA 1WNOA 3L0KA 3WH9A 3VIIA 2PS2A 1EO7A 3CQ0A 1XIEA 3IGHX 2Q01A 3M5XA 1EXBA 3W6YA 5JVLA 3W86A 2FDMA 4C6EA 3UZXA 3UG5A 4MZYA 1BQCA 1R6WA 4JTGA 5AC5A 3R8GA 2PLJA 3GYCA 2H6RA 3W83A 2YL8A 4A8RA 2BWGA 1BHGA 4ILSA 1WXJA 4NILA 1XPGA 2AAAA 4GYJA 3TC3A 1EA0A 3GVVA 3M9YA 2D0HA 4HBKA 3SUWA 3A4XA 4LY4A 3TXVA 3CZJA 2BP1A 1TVNA 2A4AA 1EO5A 2OELA 4W5ZA 5LNWA 5FEXA 2DVTA 4HCDA 3BPWA 1RCXB 3KWSA 3GKAA 4AZHA 1SO5A 5BXRA 3ABZA 2WMIB 3MYPA 3M0HA 3GU2A 1CNVA 3L2IA 4HA4A 4AUBA 4O1DA 4A22A 3G1SA 3BZGA 5FIPA 1OB0A 5K3VA 2JEQA 5E0KA 1S38A 1KCXA 4F9JA 4DY1A 3QF0A 2VVNA 4UMBA 3I3DA 3UP8A 3TCSA 3WELA 4AVOA 4HJWA 3NAVA 2GYIA 3TX9A 3C0QA 3S5YA 1L6GA 4LAUA 4DIAA 4IPPA 2OGYA 4FS9A 4C6LA 3VE9A 1BPLB 2QUTA 4MY1A 2VR4A 1NDVA 2B7OA 3DFYA 2ISVA 3CZGA 2Q8ZA 3KL0A 1YRRA 2ZVRA 2VI0A 2A21A 3AMLA 1B30A 4NI8A 4W8AA 1K3UA 1W9UA 3LHTA 3STCA 1JQVA 3WQ6A 3AOFA 1E0TA 2WQPA 1O5KA 1EJWC 3WJZA 3OPSA 4S39A 1EOMA 4XZWA 3VDGA 5FAGA 3DHPA 3B8VA 4JN7A 1N82A 1DEDA 5EMYA 2J13A 3LXCA 2C13A 1C91A 3C5QA 4L1GA 2SFPA 1KGWA 3WFZA 3NQFA 1QAPA 4GUIA 2FTYA 1B1YA 3VCCA 2W27A 1V3JA 3NPWA 3WUGA 2PDJA 4BQ3A 2ABAA 3CH9A 1WKFA 3OQEA 1HL9A 4DXKA 4RDZA 1H5VA 4GABA 5KEZA 3OOQA 1V6VA 3VGBA 3B8IA 3QGAC 3VOIA 1XIJA 1XD0A 4HHPA 2VX7A 4Q4PA 3VD9A 1R3VA 1H7OA 3HQ1A 5EU9A 3UFYA 4S2BA 3GXFA 5FF7A 1KBLA 4RE0A 3FIGA 1FWAC 4ZZ9A 5C6MA 4IIDA 1FP9A 1M3UA 2QHAA 5AYIA 2PDNA 4LNYA 3Q58A 2FKPA 4JX6A 1F05A 1K70A 3EA3A 1ISZA 4ZQNA 2ATSA 3T05A 3TYUA 1OYCA 3GW3A 2QUNA 3ZJKA 5GNXA 3FOKA 5G2WA 3G22A 3RCYA 3M0XA 4RUBA 4TMCA 1KO0A 4O0KA 3LMZA 3SUTA 2MANA 4L6DA 2TMDA 3UF9A 1I0DA 4IX0A 5BMWA 4F2UA 2JIEA 5TD4A 1S5VA 3B8SA 3AU6A 4TU1A 4CCCA 4O19A 2A3EA 3SI9A 3E2SA 3T07A 4GQRA 5ABFB 5H2ZA 2DEPA 1HKWA 4XZIA 1XLGA 2DZBA 2C18A 2R9RA 3DFHA 4MM1A 3CHFA 5HJYA 5AKQA 1LWIA 1JCJA 4YNGA 2WMJA 5F7UA 3THAA 3L4YA 1T99A 4IJCA 1OZMA 3QH2A 3W07A 4BA0A 4BQ5A 3ARRA 3EMZA 4XD5A 3DN5A 2QCEA 3BL3A 4DAIA 4ZENA 4ZODA 5BU9A 3WO8A 1JRCA 5AFDA 3PPHA 3QC0A 3EWYA 1UWTA 1GQIA 3B9EA 3C86A 3I3BA 3CL7A 2UY4A 3CZLA 2GVGA 3AIQA 1VFTA 2DUXA 1K4HA 2JGYA 1O12A 1TYGA 2QS8A 5CG0A 1CXHA 3W9ZA 4IIFA 2VELA 1E6NA 3F1QA 1Z69A 4QAWA 4BF5A 4CEUC 2DZPA 3M5VA 1WKYA 1A0DA 3KVKA 3ARQA 1Q5MA 6TAAA 2WKLA 4F66A 3WKZA 2XVLA 4WY0A 3FKKA 3KBJA 4PB3A 1HP5A 4W7VA 2J7CA 1HKMA 1FHLA 2D2JA 2P0IA 4ZMGA 4X9YA 1XRSA 3CQJA 1W1PA 1RZMA 4N4PA 4Y8EA 3CLMA 4DO6A 4NZ1A 1J2BA 4IPIA 2Y6ZA 3AHVA 3IVUA 1ZCCA 2PE4A 1ICSA 3GC5A 3ABRA 4RKAA 1UZ4A 3ARUA 3D0CA 1W2VA 4V28A 4OJYA 1GOMA 3S0CA 1WDPA 3NR0A 1A5MC 3W2LA 3BGAA 4MUZA 1IT8A 3G5EA 2OWCA 4JHOA 3WQFA 3R2GA 3EKGA 3O7UA 3LG3A 1Z89A 4TO8A 3B0UX 1R5YA 4IFKA 3BJFA 4DI9A 4FOKA 1U5HA 4X3ZA 4G5DA 3WK3A 3C3UA 2R8WA 1VHCA 3U7BA 7TIMA 4P2VA 4PRRA 4HNOA 3TQ0A 3R89A 4Q4QA 3MUXA 2CWNA 4XO6A 1ONXA 4GZJA 3EWDA 1A53A 2BLEA 4AH7A 1JYWA 1E0WA 2CNCA 2ZE3A 4I9AA 3V7PA 5FI8A 3SADA 4IQEA 4NJGA 4XTDA 1VRXA 4NUWA 3L23A 3W7OA 5D09A 4U10A 4DO7A 1YE6A 3UWWA 1UQZA 3BW2A 5JH1A 4FR1A 4GY0A 1HVXA 3OLGA 1PHQA 2Y89A 2A7RA 5KINA 3F2BA 2GUYA 3FVMA 1EGVA 1XLCA 5A8GA 1XLHA 1O4UA 3P8IA 5D38A 3UR2A 4RNJA 2NQ9A 3GNXA 4DJFA 1ISXA 3WDJA 2J7EA 4GUFA 2ZE0A 1SFSA 1JDAA 1YPFA 5IHRA 1OM0A 1FHDA 4KEVA 2R6OA 3M0LA 3WD3A 4IP7A 2EF9A 1TO3A 1XUZA 2OX1A 1OX6A 1PBGA 4MPQA 3S47A 1YTDA 4DJDA 4RL3A 2PTDA 3R6IA 5DBTA 6A3HA 2HXTA 5EBUA 5M3WA 1S2CA 2ZUNA 1VD6A 3AIBA 3SGZA 1EX5A 1LLZA 2LLEA 1TWZA 3WQEA 3QLLA 4HK7A 1S39A 4M51A 1RPXA 4O1AA 2NQ5A 2H9AA 4U31A 2MNRA 1KTNA 3W7NA 3W27A 1JXKA 5BCAA 2AL2B 3N2CA 3T0DA 4XZLX 2J7FA 4N7QA 3C61A 4U3AA 2R1MA 4H8NA 3K4WA 2VWSA 1Q8JA 4KQNA 4Z1CA 1S5NA 1AZ2A 2H3DA 3W2JA 2WM1A 2GGIA 4GBDA 3A3HA 1EHAA 1XG3A 3NIYA 3LX9A 2C16A 3Q4DA 2PDLA 3EAUA 4OZOA 4FNTA 3TYDA 1F2JA 3EDJA 3NXLA 2VD8A 4D6CA 1BYCA 2ZRUA 4GH3A 2BXVA 4DHGA 3TW9A 4JFSA 3D3AA 4C1NA 2ZCGA 3UVAA 2ESCA 2EG7A 1R30A 1YW1A 5BU6A 3CUHA 3ITGA 2ISFA 2DIEA 4MY9A 4P7OA 2FHBA 3DG7A 2DZTA 3WEMA 4AD2A 1ZBCA 5AC8A 2VRQA 1THFD 1H7WA 4GVHA 1BYBA 3GR8A 3V5OA 2W9MA 2JFEX 1ECQA 1WOAA 4Y9MA 1JJKA 4I5UA 5HNTA 3L0GA 1HQTA 1KFKA 3VKBA 1WXZA 2O7SA 3LLXA 4XAYA 1FCUA 5CZJA 3VVGA 4O14A 1M53A 2QCDA 3N25A 2I5GA 1OSEA 5I03A 4WXZA 3SGUA 1E56A 1EGZA 4CCDA 3PUEA 5CPLA 1G5AA 1P0DA 2PGEA 3H4GA 2PWEA 3UXLA 1C8VA 4H83A 2YA0A 3QV8A 4CNSA 2ZYFA 3L68A 1OFAA 2YX0A 3L4TA 1U5VA 4D8ZA 4GZEA 4AYSA 3WLPA 2E4TA 1DJQA 2VX5A 3P80A 3G18A 4HCHA 1OC5A 4JX4A 4MDPA 4OGZA 3O3RA 4R5EA 1GJWA 5C55A 3AYTA 4QS6A 1PWLA 1B54A 3KE0A 4WGHA 3OG3A 3TCEA 3WFAA 4IL0A 2QJNA 2VXNA 2FHFA 3RG6A 1S5TA 2ZDSA 4KGJA 3OU8A 3K46A 3MHUA 3WX7A 2REQA 4O11A 3ORWA 3U5YA 2GVYA 2BX7A 1Q6FA 4ZTYA 3ONCA 4GY1A 4NVTA 2V5LA 1FWFC 4RZ5A 3W81A 3WQVA 2A5HA 4ZGYA 4O1FA 4DZAA 3APYA 1QATA 1U83A 2QDGA 1JPKA 2G3IA 1LDCA 4GJJA 4HA3A 1LM1A 3OA5A 3VUPA 4PL1A 3FYOA 4PCNA 1RVGA 1JULA 2A3AA 1HKKA 2BG5A 2ON3A 1EQPA 2J8FA 4GKLA 1TRIA 4Z0JA 3A5FA 2OZ0A 3E3HA 3W28A 1QI0A 4DUVA 1MW3A 2ZX8A 2BHYA 4V1YA 4GQGA 3NQ2A 3PJTA 2WLYA 1G6CA 5A6JA 3AJ7A 5FD0A 1KM6A 2C19A 1NWSA 1J5TA 3MSDA 5AY7A 3VNJA 3OJGA 1QW9A 3W1RA 4QAIA 2TODA 4Y8FA 2NT0A 3IJ8A 4ML4A 4RNHA 5CPNA 2ZUTA 2PUZA 3CLWA 4ZXOA 2FJKA 1H4PA 4E4PA 2P76A 4WX2A 4QQ3A 1JVNA 1H0IA 1W5OA 1FX6A 5CAHA 4HNNA 1XH0A 3UR8A 1XQKA 1LT8A 3ZVHA 4JTJA 2WMGA 4JQ4A 3MUIA 2PDPA 2ZUMA 4ZVJA 3SCOA 3PULA 2VMFA 3NL2A 4MZ8A 4NASA 2GFTA 2DJXA 3GG7A 2D0GA 1EHNA 3FA4A 4NXSA 3RM4A 1HUVA 5HWNA 4JFUA 3TFCA 5AYXA 4MKVA 3QYQA 4HU3A 5C9WA 3E12A 3GDTA 1J93A 2NLIA 2A6LA 2QCCA 2Z1KA 3VX1A 4QG9A 3PJXA 1ZZMA 1GTHA 3N9SA 4HVXA 3BV7A 3MUCA 4MPKA 3H2EA 3A5VA 4P8VA 2GQ3A 3FX4A 3AXHA 5G2HA 4IMGA 1AMYA 4QLLA 3B0VC 4G6CA 3TR2A 4W7WA 4DN1A 1YX1A 3H4WA 2W5FA 1C3FA 2OTDA 3PNZA 5KSWA 3GS6A 1KKRA 3PM6A 3VMOA 3NZRA 3WFLA 4M7TA 3IAQA 2CLFA 4D2JA 2INZA 4ZO8A 4JDBA 3WMCA 4DM2A 2CZFA 3F4CA 1RQHA 4IX2A 1XX1A 2WZIA 3I6TA 3WMBA 2VURA 4WY0B 5I0DA 1JR1A 4QRNA 5AHEA 3VGGA 1GW1A 3D6NA 7ENLA 2RGLA 1XFCA 4K3ZA 1OFBA 2B4GA 3LHZA 4L5ZA 3U3HA 2Y2WA 1PX8A 3HQOA 3A3XA 1LOQA 1Z44A 5D30A 3QQWA 3OLDA 3A3WA 4GI4A 1OYAA 2B7PA 4EPEC 3BLDA 4LPCA 4D6DA 3FY1A 3A6OA 4A3UA 1QW8A 1QMLA 4E0CA 4RZBA 1KCZA 1G01A 1Y65A 1A5LC 1YQ2A 4NQ1A 4CVUA 2WSKA 3B8UA 5JUVA 4Y9OA 2VDHA 1W1IE 2G5WA 1KTBA 2X0HA 3PZGA 1D3GA 4O54A 4O1CA 3EA1A 1R2RA 4IFKB 5D2WA 3UG4A 3JS3A 1E15A 5HXMA 3C2EA 2BHZA 1O5XA 5D2VA 2Y88A 4NI3A 1RBAA 4LAZA 4Q8PA 3W85A 1SGJA 2WC3A 2CZEA 4GHRA 1V7AA 5IDIA 5F2MA 1NF7A 3W24A 1BFNA 1DE6A 2A6NA 3WZ0E 3WH5A 4ROPA 4HSOA 2E6AA 2DZWA 3ARVA 5F4WA 3FGCB 3T09A 4GRSA 1YHTA 2DJLA 4X22A 1Z41A 2VJXA 3FYPA 4MLRA 4US5A 4LW7A 1E6XM 5HDRA 2GK1A 3DBPA 3UD6A 3VE7A 1RVKA 1RXOB 3SRDA 1MUCA 1RCQA 2X30A 3QV7A 3WL0A 4LWWA 1TVLA 4CGTA 3TYAA 3IJ7A 1MXSA 2YLLA 1DJZA 2GJRA 2XN1A 3UGVA 3DAQA 3MBDA 4WRHA 1PZ0A 3TSDA 2ZA2A 1W1A1 2V3FA 5HINA 4PE8A 2FVMA 4JX5A 5DCBA 3G1VA 4L64A 3KRUA 3VX0A 3NZQA 3PJUA 3EX2A 2CBUA 1TPWA 3D46A 1HXJA 4E2DA 3RUBL 4LGXA 4A6GA 3O63A 3TP4A 4JQ2A 3TDFA 1PDZA 3NPXA 1FWDC 1HJUA 4NNCA 2CWXA 1E9YB 4RZ6A 4XBSA 5A6BD 5CC6A 3TKFA 4ZFMA 3R94A 4OIFA 2OVLA 1K7FA 4H9UA 2WJEA 1UR1A 3QV6A 2CIPA 4WHBA 3N3MA 6PTDA 4NX0A 5H1WA 4LVDA 4JFTA 1HFBA 2WZHA 5EYWA 4G1KA 4M1RA 4DUXA 2Z4GA 1H0GA 2OEJA 4PUJA 3ZZ1A 3THUA 1IQ8A 2Q3RA 2F2KA 3L4UA 5D04C 3DI0A 4EVZA 3G8EA 1DYSA 2J79A 4FLOA 3CV7A 1F6PA 2W66A 3PY2A 4AF0A 3TC7A 3LENA 2Y5JA 1VHNA 4AISA 3V18A 1TWWA 1OX4B 1H51A 1UWUA 3QR0A 4PMDA 3C8FA 3L7RA 4GZ7A 5D37A 3KHJA 3VDBA 1M7OA 4MIMA 1DXIA 1OABA 2P10A 3ZT7A 1YNYA 4NZ4A 2PMQA 4EIVA 3UW6A 3GBEA 5EJZB 4AMCA 3OYXA 4PBGA 3CO8A 4AIOA 4NNAA 2RKXA 4K8EA 1IEQA 3NSXA 4H8HA 4RE2A 2WPGA 3JU2A 1FWBC 1AZ1A 4M24A 4IPJA 1DPMA 1YDNA 3UJRA 4Q8OA 3D3FA 5AVNA 3FCPA 3PVFA 3RJXA 4I90A 1K77A 1ZALA 4JOMA 4MADA 3CMJA 1LL7A 3BW4A 2F6KA 3SO7A 4HNVA 1TE6A 2IPGA 5D03A 3UZWA 5J5DA 2YZ5A 4UOJA 5G4WA 1W32A 5D2TA 3CASA 3LHWA 4S3KA 4FX8A 3O07A 3RYSA 4RXFA 1XQLA 2X0SA 4L61A 1J6PA 1QI3A 3P0WA 2GOKA 3V75A 4AIUA 3G1AA 4LJ3A 4I8DA 2YCEA 2VDGA 3MQTA 2FB2A 3S5OA 3MDWA 3MUAA 1G7UA 1VS1A 5A94A 2YFNA 3AYSA 5I7GA 4D1JA 3JR2A 3LDVA 1QNPA 3EX1A 4FAMA 4HZ8A 3PK7A 4AU0A 5FEWA 2CKRA 4CD4A 4GXPA 3LGEA 1MW0A 3QPYA 4ORMA 3NSNA 1DVJA 1IHIA 5HJLA 5RUBA 3NNTA 4DJED 2HNEA 3HQNA 4XO7A 1HIZA 4M80A 1Q13A 3WDRA 4KS0A 1QK2A 2GJLA 4I7WA 1DIKA 2XZ9A 5K9XA 4FIQA 3H8AA 3CL6A 1O1ZA 4AZBA 5LA2A 1EEXA 2AMGA 1M03A 2ZZ2A 1J5SA 3HGRA 5A6AA 1XRFA 4CN1A 4U2ZA 1GYMA 3ABQA 4OOUA 5I77A 3CHCA 2O7QA 4IGHA 3FFSA 3EKLA 3GH7A 3MS8A 3RFAA 4XTIA 4NZJA 5E9XA 5DN1A 3WD0A 3FN9A 3GE7A 4KGLA 2QCHA 4GLEA 1DTUA 2X05A 3F4WA 1RJQA 1R87A 3FYYA 3R0UA 4UBPC 3GNDA 3ZLGA 4FEZA 3BOFA 3VKCA 2R24A 5ABEA 2VKZG 3QQ0A 2FFIA 1TA3B 5FJTA 4AX6A 1MSSA 3KOXA 3ICJA 1OIFA 3DOPA 1C9DA 1QVBA 3N9RA 1MW2A 1RPKA 3HG2A 3PB0A 4GIAA 1KM2A 3MMTA 1V3IA 3C2OA 2FPVA 3AIWA 5C9ZA 3IJLA 3TAOA 1V0NA 4JIEA 3PZVA 1KRCC 1XGDA 1TVPA 3QVQA 1M41A 4PL2A 3CV6A 3NFUA 3C0JA 4W4QA 1RR2A 2QEZA 2C7FA 4N0RA 3SGGA 3LQLA 2QULA 3TN6A 1ZSXA 3TW7A 4AD0A 5D32A 3WF3A 3NDOA 3M7SA 1E6RA 1LQ2A 2CC0A 3M0KA 4QJ1A 4D6GA 1N55A 5G1TA 2J8GA 4AWUA 3WQDA 1W3HA 1FCBA 3K13A 1OQFA 1B4KA 2FPTA 5CLWA 1UUMA 3A4WA 4RDVA 1UUOA 2GGJA 1ZAHA 2YA2A 4W8BA 3ISIX 3OYZA 2P53A 3LU2A 5HNNA 1TV7A 3REQB 3DC0A 2V9DA 4LRTA 4XBKA 1KWKA 1D3CA 4F9DA 3GXDA 1TV2A 5EPDA 5H91A 3N34A 1ZY9A 4WXYA 2VENA 4DWDA 2VEMA 3WBEA 2Y7FA 3MDUA 3S8HA 4F0KA 5DMNA 1MRAA 4YWSA 2Q71A 5TBOA 3VFLA 4RV8A 4MKSA 3UWQA 3DFTA 3S6DA 1V5XA 5FESA 2GJXB 1TRDA 4XKMA 1VLWA 1TCDA 3GVRA 5DT5A 2C14A 4W84A 4H3DA 3J7HA 2IXUA 1NWRA 4YCPA 4NF7A 1GOQA 1SO6A 1BRLA 4LFYA 3EWWA 4JL1A 1CENA 3AXIA 3VKJA 1GGOA 3L12A 3HV9A 6XIMA 1CTNA 3USZA 3ZS4A 4GI6A 3KOYA 1ADOA 1PKLA 1F6YA