3OZPA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with pugnac
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Active-pocket size differentiating insectile from bacterial chitinolytic beta-N-acetyl-D-hexosaminidases
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords N-acetylglucosaminidase
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ozpA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3ozpA01
5BYWA 2XWEA 3O9NA 1C91A 3OLGA 5D8WA 2B31A 5I6SA 1H09A 3A4AA 2WBKA 2O9OA 1QHPA 1I1WA 3FAWA 3VDCA 4DUXA 2WANA 3BH4A 4UFHA 2PBGA 4UQ9A 6A3HA 2VQUA 1IZJA 1KCKA 1W2PA 3T0AA 1E73M 4MNMA 4PEEA 1GJUA 3AIBA 2DQXA 1GOQA 3WDHA 4EANA 5A6BD 1QNPA 4GXPA 1CGWA 2BHUA 3GZAA 4B3LA 1DWJM 4TUFA 5JBDA 2CCRA 3WH6A 5CGTA 4OBRA 1OGBA 1CENA 3ZJKA 2V5CA 5HPOA 5EB8A 3N18A 1E4NA 2C8NA 2VX7A 1H11A 2W62A 4L4OA 4JAWA 3CZ8A 3ZJ7A 1UZ1A 1K9EA 2YBTA 1B3VA 2XTKA 1UWUA 4BQ4A 3ZJ8A 5HXMA 1V3JA 1CXFA 2PF0A 2XVNA 1NP2A 5JIPA 2VX5A 1B2YA 3OGVA 2V3EA 3CUIA 1MW3A 2AMGA 3D5HA 2WMJA 4MADA 3W4RA 4L4PA 2OYKA 3VD7A 2YJQA 4EK7A 2VZOA 2YL5A 1JGIA 3NDZA 3MMWA 1AQHA 3CZEA 3GNRA 5GNYA 1TA3A 1B1YA 4MDOA 1GZJA 3WDPP 1KQZA 1PZ3A 2QMKA 3VIFA 4MB5A 3ZR5A 1UR8A 3MU7A 1XH1A 1W9DM 3QHMA 4B9YA 1DWAM 4EE9A 1NH6A 4YHEA 4MAZA 1E6ZA 1V08A 4LYRA 1OT2A 1EO5A 1FH7A 2UWFA 3VIKA 3MO4A 3AICA 5BRQA 3G6MA 2E3ZA 5BXSA 3CZJA 4AW7A 1BLIA 2BXZA 1Q6CA 4UZUA 3VM5A 1HJSA 4CU8A 1HN1A 1A3HA 1J0YA 4CD8A 3AMGA 3WUFA 2G3JA 2ZX9A 3SUUA 4M8UA 1I75A 2X1IA 3CUHA 3ECQA 4GINA 3I3EA 3WIJA 4HOXA 5E0CA 3L4UA 5DMYA 4JCLA 1BG9A 4LX4A 1Q6FA 4W8LA 3WNKA 1RP8A 4PYSA 4ACZB 3N11A 3OG2A 4W87A 2BVTA 2W61A 2WAGA 4YPJA 4AD0A 1V0MA 1UWTA 2BVDA 1OM0A 2EBNA 2WKGA 4MNJA 3L4WA 5A2CA 4PMOA 5D9NA 1VIWA 3OGRA 3PZNA 5FL0A 3AMDA 2XSBA 1KWKA 1P6WA 3CHCA 3W27A 4AMCA 4GI6A 1CLXA 1JAEA 3MS8A 4D6CA 5CSUA 3WF2A 2CPUA 3T2PA 1QNSA 5DO8A 5AY7A 3A4XA 4J3WA 3ZSSA 5HPCA 4HMCA 3A3HA 4JKMA 2FH8A 2VQTA 3MMDA 3BC9A 3ARYA 1CXIA 1E1EA 4MB4A 1BAGA 4HU0A 4HU8A 4AEEA 1JXKA 3EMCA 4E4PA 4H8VA 1CXLA 5FIPA 4XZWA 3ZO9A 4KMQA 3ZQ9A 5I78A 3A4WA 1WDRA 4C7DA 3ARRA 1ZL1A 1JDDA 3EDJA 2CBIA 3EMZA 4PN2A 3N9KA 1SYTA 4NZCA 4ATWA 2D24A 3OIHA 3U7BA 1MYRA 3GXFA 1TMQA 4W93A 3VU2A 4P7NA 3BMWA 1UWRA 5M17A 2J78A 3ARXA 2EEXA 2ZXAA 6TAAA 4XV0A 2YL9A 1EQCA 1OT1A 1EOKA 1WDQA 2FDMA 1LWJA 1BG4A 3K8KA 3I3BA 2CESA 3WUBA 3W6MA 2ZOXA 2EQDA 5BCAA 3VO0A 3SUWA 3CZLA 1JNEA 4PMDA 4WKAA 3ZIZA 2J8FA 3PZVA 3AIWA 1AQMA 1SFSA 3EDDA 4XB3A 3VGEA 4R5EA 2AOSA 5IDIA 1C8QA 3VIOA 3NCOA 2X0YA 3RM8A 2CKRA 3BAYA 4W7VA 4U33A 3VVGA 1UUQA 3W0KA 1V03A 1GHRA 4EAMA 2WMHA 2EPOA 2QPUA 4QLJA 2OYLA 1Y7VA 1JZ4A 1H2JA 2J74A 3PTMA 3L4YA 1PEZA 2WCGA 1UOKA 4UOJA 3LPGA 2XIBA 2CERA 1HKMA 2WHLA 3T0DA 5F7UA 4NF7A 1O7AA 1XV8A 1E3XA 1R87A 4LPCA 4CD6A 1FOBA 1CYGA 5JUVA 1LG1A 4J3XA 1C93A 4UQEA 2ZUUA 2XFFA 1KWGA 2VR4A 1CLVA 1J12A 5CZKA 3W25A 4FLSA 3AIVA 2QLYA 1UQYA 1RP9A 2O9PA 1H4PA 3VINA 3A47A 1QBBA 1OIMA 1H0GA 3RO8A 4FLRA 5A6BA 4AIEA 1C8YA 3CTTA 4U3CA 4TXEA 3JUGA 5D9PA 2UY3A 3OLEA 1HKJA 1B31A 1EO7A 3CPUA 3AXXA 1XGZA 3WBAA 4FLOA 1KR1A 2J7HA 1EHAA 3ZM8A 5A2BA 1MVYA 1LJYA 1HVXA 3T2QA 3CUGA 1B3ZA 3ARZA 3VIMA 4HZ7A 4DM1A 4F8XA 1CXKA 1DWGM 4CN4A 1WNOA 4HA3A 1CXHA 3N15A 4U5IA 1BGGA 2VL4A 3EMQA 4UQAA 3T2OA 2ZUWA 2A3AA 3AS0A 1M7XA 4PSRA 1QBAA 5I0DA 1GW1A 4AZIA 1ISVA 4HTYA 4AZ5A 1W91A 3VIJA 3WD1A 1GUVA 1E15A 3DYPA 3K4DA 4M29A 1QHOA 1DEDA 4N42A 2FGLA 3ARQA 3WBEA 4PMNA 3LPPA 3GBEA 3NYDA 2WZHA 3S2CA 5ECUA 1ODUA 3WMSA 4H7VA 1LF1A 1E40A 1XCXA 3AYSA 4F79A 4OIFA 1B3YA 2ZX5A 3AMKA 1M53A 5CXPA 1HP5A 1PX8A 1J0KA 1E9LA 5E9AA 2YA1A 1UYQA 3SCSA 1Z32X 1ZS2A 2WVTA 3M7SA 1GOKA 3VNZA 2J7CA 2D0FA 2GSJA 2BS9A 2D2OA 4AY1A 3QHNA 3DYMA 2PBOA 3TONA 3M07A 4FMVA 4X0NA 5I5RA 3D3AA 1EDGA 3AIQA 5GQBA 5JIWA 2A3HA 4WSJA 1KXHA 2XWDA 1C7SA 4W7UA 5EFFA 2F2HA 2EPKX 4HMEA 2VI0A 3PZUA 4GQRA 5JBFA 1ZJBA 5C8BB 1JZ2A 3GNPA 1WB0A 1D2KA 4AISA 4AIUA 1H41A 2WNWA 1LG2A 2WVSA 3WN6A 1OGGA 4D6FA 3IAQA 4J3TA 2VMFA 1EQPA 4OOUA 1HNYA 4RE4A 4DM2A 2D23A 1V0KA 5D8ZA 1BTCA 4U3AA 2W91A 4H8UA 1C8XA 1SR0A 2DT0A 3UERA 3W29A 4P8VA 1Q6EA 3AZRA 4A3HA 5A6KA 1WDPA 3W53A 1R85A 4X9YA 1M03A 2J7FA 1R86A 1GOMA 3WD3A 1NOWA 5LA2A 3FN9A 1ZBVA 1UD4A 3FAXA 3K8MA 1TFVA 2GJXB 3GBDA 2DIEA 5KZ6A 4U31A 4UOZA 4J3SA 2Y4SA 4TX8A 3AYRA 3CZKA 1LL4A 4GIAA 3APGA 3TP4A 1HKKA 3SUVA 1G94A 5BRPA 5A8QA 1KQYA 1CWYA 1E56A 1AQ0A 2VZSA 1W9PA 1OD8A 5I79A 1R7OA 3VUPA 2NT0A 3WNPA 1UD3A 3WF0A 4Q22A 2WKLA 4HOWA 2JF6A 1W3LA 5A8MA 2BY3A 1UH2A 1N82A 1VBRA 1AMYA 1UG6A 2CITA 2CNCA 4DWSC 4D1JA 1JF5A 4OJYA 1GORA 1L0PA 1SMDA 2WLYA 2WSPA 1QW8A 3VMNA 2VRKA 5HNNA 1MQRA 1XH2A 5A95A 1UD5A 2NSXA 1KGUA 1E6QM 1W9UA 4KRUA 1EDTA 1UWSA 1QHZA 4D6IA 1ZU8A 5DFAA 1NWRA 2G4FA 4R27A 1QNRA 3W6LA 2VT0A 4QP0A 5C70A 1CECA 5BXPA 4LYQA 4P8WA 4W5ZA 4UQBA 1WP6A 2CXGA 4MJ2A 4GZJA 1BVZA 1JYWA 1JI1A 5ABFA 4LQ1A 1GQJA 1D7FA 4S3KA 3T09A 4IUGA 3AHXA 1UR2A 3II1A 3GH7A 1TA3B 3IJ9A 1UZ4A 1PX4A 1UA7A 1C92A 1UD6A 2BHZA 4GO9A 1NWUA 5I77A 1GNXA 2V3FA 3CH9A 2CEQA 3PTQA 4J27A 2DT2A 1OIFA 4TVUA 3ZJ6A 4BA0A 1H3GA 3WD2A 1BGAA 1M01A 1MFVA 1UKOA 2WSKA 1B9ZA 1TCMA 1CTNA 1BYAA 4HPHA 2D0GA 3BSHA 2IXVA 1MXGA 4PUDA 1HL8A 3WH9A 2DSWA 2VVSA 3QR3A 4M81A 4QDMA 1W3HA 3GXIA 1ZBWA 1B90A 4CUCA 5A8NA 3BLPX 4ZE5A 3KE0A 3RDKA 1JXJA 1W1VA 1FP9A 2VCAA 3WDQA 3RM4A 4Z2KA 2E9MA 1E4LA 3VNYA 2WMFA 3N1AA 1W3KA 2G8ZA 3UG4A 4HP5A 4MJ4A 3W81A 1IV8A 3W82A 5A8OA 2D20A 4PTXA 2V3GA 2WK2A 3CO4A 2JEQA 1CXEA 5FD0A 5A8PA 1C3FA 3WQ8A 4HOZA 3SCOA 2VNCA 2X8RA 3CHDA 3OLDA 5CG0A 2OSXA 1E5NA 2WC3A 3PTKA 4XUYA 3WH7A 3PHAA 3OZOA 5DT5A 4W7WA 1W9BM 1TUXA 3UESA 3WSUA 1KXTA 2JIEA 1X6LA 4J7RA 1RH9A 5JBEA 3L4TA 3OB8A 4AZCB 1BQCA 2C7FA 5M5DA 3GTNA 2WMKA 3WEMA 1D3CA 1UR9A 1F4AA 3VDBA 4UFJA 2GUYA 3NDYA 1JL8A 3KEHA 4KWUA 5BXRA 3BLKA 3MUIA 4CN6A 2ZX6A 4B15A 2VZVA 1KFWA 4H41A 2WBGA 4Z2JA 2D1ZA 3VIHA 3BAXA 1CIUA 1E6RA 5GPRA 1UH4A 2EO7A 1UKPA 3VGDA 1R8LA 2X05A 1CBGA 5AC5A 2GJXA 2CYGA 3UG5A 4F9JA 3VGBA 3PZTA 1UKTA 5I2UA 4S3JA 1GQIA 1HIZA 5GNZA 2G3NA 2VOTA 3AZSA 2ZWZA 4D72A 1E6NA 3SIMA 1K9TA 1KR0A 4W85A 4LYPA 4PMVA 2ZUTA 3WL0A 4ZEPA 1GVYA 2XSAA 3EBVA 5AC4A 2YLLA 3KZSA 4OBSA 3GDBA 1UR4A 1DHKA 3EDFA 1EH9A 4JL2A 1HVQA 3MUAA 3I3DA 3U57A 1ZJAA 3GXMA 4BQ3A 3L4ZA 3KL5A 2J77A 3BAWA 5AYBA 1VFOA 4IISA 2WCAA 4CVWA 3PZGA 3T08A 4BF7A 3F5LA 4JKLA 1RD6A 1K9DA 3VMOA 3BAJA 2PWDA 3VD3A 4C91A 1HJWA 4AD3A 4ATDA 3CGTA 1O6IA 1Q4NX 5CGMA 5LA0A 3CMGA 3W24A 1QI3A 3AHZA 3NJ3A 1G5AA 3AJ7A 2YDQA 2W66A 3AROA 1XSJA 1J0HA 1VEOA 4D6GA 3WMCA 4DWSD 2XGBA 2WB5A 2O9TA 3PZ9A 1DWHM 4JIEA 3THCA 1TZ7A 1TG7A 1J11A 2BFGA 4DWSA 3AS3A 2IXUA 9CGTA 2J7BA 3POHA 4CCCA 2ZX8A 1J10A 1QNQA 2OWXA 4QLLA 3AQUA 1H1NA 1LLOA 1J0ZA 2A3CA 1B30A 3EDKA 1E6XM 4D1IA 1W2VA 5EBAA 2XVKA 1JIBA 5HDRA 2YLAA 3ARSA 4UZSA 3WQWA 3DYOA 2UY2A 1HP4A 5ABHA 2XVPA 4UOQA 4BCEA 5D4YA 4CVUA 5ABGA 2VJXA 1UWQA 3SCRA 2Y5EA 4ACYA 1W1YA 3IANA 2YOCA 4MB1A 4PRWA 4UFLA 2WPGA 2OWWA 4F9DA 1B3XA 4GQQA 4Q7NA 1PJ9A 1NQ6A 4KGLA 1OBAA 1RPKA 1XC6A 2EPNA 2NT1A 3RJYA 3GYCA 1DTUA 2X2YA 1V6UA 2A3EA 1OGSA 1YHTA 4DUWA 3S6TA 1BF2A 1J9YA 1WPCA 1V6VA 3RILA 5IFPA 4WK9A 5D9MA 1GHSA 1UKQA 2J25A 2OSYA 3B9EA 4B3KA 4DWSB 2YA0A 1Q6GA 5I3DA 2BY0A 4CCEA 3MKKA 2OWCA 3ARVA 2XM1A 1CGYA 1XD1A 4NSBA 3WNOA 4CU6A 4UFMA 1L8NA 3GH4A 1TR1A 1C7TA 3G6LA 3VOCA 2DGAA 4ZFMA 2GJPA 2WC7A 2C0HA 1JDAA 2A3BA 2JFEX 2O92A 2D3LA 2W67A 4AZHA 1E55A 3AISA 4WF7A 2E9BA 1E1FA 4H04A 1S46A 3FXYA 2E4TA 2D3NA 1V3IA 1WAWA 2IUZA 2FHBA 4AZ7A 3ARTA 4JHOA 1JZ8A 1JZ7A 2BXYA 1UHVA 2EPMX 3PZMA 5BWFA 2G3IA 1V6YA 3AFBA 4XZBA 1ZBCA 2E9LA 1E3ZA 3TTYA 3NSNA 2CKSA 3QHOA 1H0IA 2WVVB 2V5DA 1ITCA 3TA9A 2DH2A 4D6DA 2WMIB 1JFHA 3SCTA 3NIYA 3ZT5A 3VGFA 3WY1A 1EA9C 5A6AA 2JF7A 4PMQA 1SMAA 1US2A 4MNKA 2D22A 2XFYA 1E4IA 1MFUA 2PI6A 3PZIA 4CD4A 4LXFA 2VZUA 4ZENA 3LMYA 3EDEA 3VMPA 3W26A 3WENA 3WQ4A 2F8QA 3K4AA 1XCWA 1G0CA 1VJSA 4CN1A 4E8DA 6CGTA 1BYDA 1VFFA 2DEPA 3UETA 1GQKA 3WF1A 2VVNA 4IPLA 5CLTA 2CHOA 1FP8A 2Z1KA 4U2ZA 4OUEA 2YDRA 1NOUA 2YKKA 1I1XA 3VGGA 3BXWA 4P8XA 2VUYA 5EMYA 4C90A 2F61A 1G1YA 3GM8A 3ALFA 4AD5A 1ZB5A 5ABEA 5FL1A 3F5KA 2XGIA 3B8SA 4JFSA 3AIEA 4UQDA 4FK9A 2VTFA 4MDPA 3RCNA 2DSKA 1UKSA 4N0RA 4AD1A 3O6AA 5DF0A 3WUEA 4JCMA 1HL9A 2WZIA 4GKLA 1NARA 4H8HA 2WWDA 2HVMA 7A3HA 1CGXA 3UEQA 2XFRA 4AWEA 1PIGA 3AMLA 1QPKA 2J7GA 3WELA 3KL0A 1VJZA 3THDA 4NRSA 3QOKA 3SUTA 1QW9A 3WQ5A 5CJ5A 1DWFM 1QNOA 3MSDA 3WMBA 4IM4A 3PZQA 4AD4A 1J18A 4NI3A 3CBWA 1UR0A 3WFLA 3FHAA 3BAIA 1VFUA 2ZUNA 4MPKA 3L2MA 3WF4A 4Z2GA 3FW6A 4WIWA 4AIOA 4PMUA 1HF6A 1TVPA 1EXPA 1KXQA 5C71A 2ZE0A 1JYVA 2YBUA 1FFQA 1KB3A 1W9VA 2WXDM 1JAKA 2EPLX 3U5YA 1BYBA 1VBUA 5IXEA 2ZUMA 4P7OA 2VR5A 1XRVA 3AZTA 4AZ6A 1U33A 2RGMA 4NRRA 4M1RA 1Q6DA 4XX6A 2CBJA 1MQPA 1E4MM 2VRJA 1GOOA 4UR9A 2WVUA 1CGUA 4PMZA 1X6NA 2WMIA 3WDIA 1W9XA 4DUVA 1WDSA 4UCFA 2AAAA 2J7DA 3VM7A 1GOWA 3W37A 2W92A 1JD9A 4ZE4A 4E8CA 2XHYA 4KGJA 4PSPA 1WZKA 2WYSA 3CIVA 2XG9A 2CHNA 5E6ZA 3CUJA 3WDJA 1AVAA 4PCTA 4KH2A 5E6YA 4D6JA 2X09A 1XYZA 2BY2A 1KGXA 1NP0A 4HMDA 1VFMA 1CEOA 4M82A 1WCGA 3UG3A 5BROA 4JHZA 1JYNA 1IZKA 1PIFA 1B0IA 2D0HA 3AI0A 3WF3A 3MV01 1HJQA 3HMCA 2J8GA 1JFXA 2J7EA 2Q8XA 2WMGA 2VC9A 3UR7A 4M56A 4ML4A 3DHPA 1JI2A 7TAAA 1J01A 2CBVA 1E6SM 3AS2A 5A2AA 1XH0A 3MUZ1 3ZT6A 5LA1A 5CQ1A 2XUCA 3CZGA 3RJXA 1BYCA 5IHSA 1XYFA 1E71M 1BVNP 1R7AA 3SEPA 3N17A 3CHFA 2UY4A 3SCWA 2ZICA 2OSWA 1VEMA 4PMRA 1QI2A 2J75A 3HJEA 4MNLA 3VTRA 2PWEA 1NWSA 2CBUA 1LWHA 2O9RA 3F4VA 4JZ5A 1K9FA 5CPSA 5A3HA 1KXVA 2FHFA 1BHGA 3VIIA 4FF5A 2WHKA 4JFUA 3WH8A 4AD2A 2XYLA 4CU7A 2Y24A 1G01A 1HXJA 1PAMA 4AZCA 4HPGA 2OYMA 3FNDA 4TVDA 4PTVA 4TTGA 4ATLA 1E43A 1TE1A 5A69A 2ZXDA 3SCUA 1ITXA 1ISZA 1G9HA 4D71A 1XSIA 3AXIA 1ISYA 3K8LA 1NOFA 4D6EA 1J0IA 1U2YA 4UNIA 4HA1A 5FKYA 1DWIM 3WH5A 1QI4A 2VRQA 2VZTA 1GQLA 4F66A 2YA2A 3BCDA 8CGTA 2ZIDA 3SCVA 3UCQA 1FH9A 1V3KA 2DT1A 4W8BA 3RPMA 1VRXA 2ZUSA 5IHRA 5A1AA 4J28A 3OLIA 4OZOA 4AEFA 4QAWA 3NSXA 4GZEA 3UR8A 1V0LA 5BXTA 1VENA 3K46A 5FCZA 3J7HA 4E2OA 1MW1A 4URIA 3W28A 5FOOA 2VCBA 5I24A 1XHGA 2E0PA 4GO8A 3MANA 2JE8A 1E0WA 2GK1A 3ALGA 3HU7A 4PUEA 4QLKA 1CGVA 1A47A 1IT0A 2WZEA 2G41A 3VX1A 3AIUA 3N12A 3RMEA 1GOIA 1CPUA 2GFTA 3AOFA 3GNOA 1LL7A 4ACZA 1E0XA 1UD2A 1OSEA 4MAVA 5CLWA 5IFTA 3AXHA 1FA2A 1NWTA 2BHYA 1JZ3A 3AHVA 2WHMA 2DH3A 3IK2A 3U5UA 2XPKA 5KEZA 3EYPA 3VKKA 3WUGA 2NW0A 4W86A 2YDSA 3VILA 4OOZA 4Z2LA 2ZXBA 2CETA 1ISXA 3B9DA 1FH8A 2BVYA 3VD4A 2BNJA 4JFVA 4WJXA 3FHQA 2V38A 3WD4A 1OD0A 1V3LA 1V6WA 2UY5A 4PMYA 1GPFA 2JEPA 2TAAA 3T0BA 3GXDA 2PWFA 2ZWYA 3AIRA 1HJVA 1ECEA 3AHTA 2EXOA 3WFZA 3WDRA 4TVCA 4CGTA 1JDCA 5AYIA 5A6LA 1CDGA 4MTVA 1KBKA 1PPIA 4HA4A 2G3MA 3VIGA 3VX0A 2PB1A 4GI8A 3ZOAA 4EKJA 3OA5A 5E0FA 3SCNA 1GONA 1V6XA 1WKYA 3BGAA 3TTQA 2ZUVA 1JNDA 3N04A 1JD7A 4CD7A 1MQQA 2XIIA 4LGXA 3NUKA 5ABFB 1V02A 3IJ7A 2WVVA 4TX6A 3VDHA 2RGLA 2QHAA 2WHJA 1E72M 4V27A 2J79A 3PZOA 2VO5A 2WCSA 1ESWA 4W88A 5M03A 2J4GA 3BCFA 1HKIA 5D9OA 2GDVA 3AMCA 3M46A 2E40A 3WL1A 2W4XA 4WSKA 1CGTA 3HN3A 4RL3A 1E6PA 2FGZA 4Z2HA 3ZR6A 3MMUA 3O2LA 1C90A 4IPNB 3BSGA 2YL6A 5TD4A 4AC1X 1BPLB 1VF8A 1KGWA 1MW0A 3AHYA 3ARPA 3SCQA 3VIPA 3ARUA 3LPOA 4GI9A 1XD0A 4V2XA 1HX0A 2WC4A 1F4HA 1KBBA 4OKDA 2PWGA 4PBGA 2DIJA 2ESCA 3CLWA 3OGSA 2OLHA 4BS0A 4AZBA 1EIBA 2XVLA 5A6JA 3PBGA 1FHLA 5E09A 1H49A 2QF8A 4P7QA 1GVIA 1UH3A 2EJ1A 4RE2A 1M04A 4UFIA 1FHDA 3K1DA 2DPEA 1V02E 3DC0A 1WZMA 1OCQA 2WLZA 1QI5A 8A3HA 4ZXOA 2Z1SA 4W5UA 2PC8A 4CCDA 1MWOA 2GJRA 3DECA 3KWXA 4B9ZA 2W5FA 2XJ7A 1OB0A 1W1PA 2XM2A 1DP0A 2ZXQA 3CHEA 4K68A 2DSUA 3SURA 4U2YA 1QI0A 3SCPA 4P7LA 1X1NA 1WO2A 2J62A 2VX4A 1W32A 2WWCA 1EGZA 3VPLA 3CMJA 4YN5A 5CPTA 4TOQA 1OINA 2DDXA 2GK1B 5CSYA 4P8UA 2WW5A 4Z2IA 3DHUA 1EHNA 3M6DA 4CKQA 3TTOA 1ZBKA 2Y8KA 1UA3A 3E1F1 3W38A 4JKKA 5E70A 4M24A 5EFDA 2YL8A 5GNXA 4UQCA 4W89A 3QGVA 3MSGA 3VGHA 4PMXA 2HISA 2BY1A 3IAPA 4J3UA 2MANA 3MUY1 4A4AA 1JG9A 1W3JA 2DT3A 1W1TA 3WQVA 3L4XA 4TTUA 1EDQA 3BMVA 2GDUA 2Y8VA 4C7GA 2FHCA 4JL1A 1WE5A 3OZPA 5HOSA 4X0VA 3ZSTA 4BQ5A 1QVBA 1QOXA 3FY1A 3WD0A 1J0JA 1JF6A 2BV9A 1H5VA 2VCCA 2QMJA 2JIWA 4QCEA 4W8AA 4PTWA 1E70M 4BQ2A 3L2LA 5M3WA 1EOMA 1GJWA 3MV11 4MB3A 3ZT7A 2CIPA 3GH5A 3N13A 1UWIA 3WNMA 4CD5A 1JZ5A 1ODZA 4KRTA 4PTMA 4AZGA 4B16A 4A3YA 1V3MA 3U7VA 4U5KA 4RE3A 2QPSA 5HBFA 4V28A 3A6OA 2JALA 2X0HA 4W84A 1E5JA 2ZX7A 3BAKA 2YIHA 2FH6A 1V3HA 3L4VA 1JZ6A 1OWQA 1V0NA 4H2CA 3WEZA 1XSKA 1TVNA 3CUFA 3POCA 1MW2A 4P7RA 1WZLA 4M80A 2DSVA 1ISWA 1PX3A 2WM0A 1UR1A 3SUSA 1UD8A 1VAHA 4AXNA 1HJXA 2DSZA 1FFRA 3LPFA 5A6SA 2VX6A 5CPQA 2GVYA 1YQ2A 1VEPA 5A6MA 1GCYA 2QV4A 1LL6A 3AS1A 4YHGA 4JFTA 4HZ6A 4Y7EA 1PZ2A 3VDAA 4ZXLA 7CGTA 4GZIA 1MXDA 3PN8A 1U30A 1HT6A 3F5JA 4PCSA 1PBGA 1B3WA 3TTSA 1US3A 4QCFA 3NSMA 5LYRA 3TOPA 3WEOA 4JFWA 3VD9A 1LQ0A 2PWHA 1HJUA 2E8YA 1VB9A 2XVGA 4J3VA 3B9AA 3ARWA 4HZ8A 3RIKA 3IJ8A 2W63A 1E0VA 3WNLA 5DEZA 5DT7A 1CZ1A 3WNNA 3RM9A 1JYXA 3ZMRA 4QFUA 3WQ6A 3VD5A 4UFKA 1CNVA 2J47A 4FLQA 4D6HA 4BZYA 5A94A 2E8ZA 4C7FA 4GPNA 4WLCA 2V3DA 1NM9A 1KCLA 2VURA 4WKHA 3OBAA 4AYSA 3KL3A 3QOMA 1BSIA 1WZAA 3WKZA 5I23A 1UQZA 2Y2WA 4UTFA 1K6AA 1BFNA 4WKFA
chains in the Genus database with same CATH superfamily
1TMHA 1S2WA 4M5PA 2XIMA 5BYWA 2XWEA 3VNJA 2NV2A 2E7FA 2B31A 3WJYA 1BKSA 1PV8A 2IPFA 2O9OA 4INFA 1QHPA 1UOZA 3HGOA 3CXOA 4QE1A 4QGCA 3W23A 4UFHA 4IQLA 3LHWA 2VQUA 4LH8A 1LOSA 1NY1A 1A5CA 1W2PA 5BU6A 4MNMA 5CBIA 3E38A 3AIBA 2DQXA 4HG6B 4EANA 1DXEA 3V35A 1S5WA 3BV7A 4GXPA 3GZAA 4XKYB 3FSTA 5CGTA 4MWAC 4L1GA 4OBRA 1CENA 2IPJA 1P48A 5EB8A 1TTIA 2YCEA 4FOJA 1L6FA 3N18A 1E4NA 2C8NA 1T8XA 4O19A 5HQMA 4Q8VA 2FZNA 5HJYA 1K9EA 1IHIA 1B3VA 3MHGA 4XKYA 4BQ4A 3ZJ8A 5HXMA 2WKJA 3BGGA 2AGKA 3N2CA 3L23A 2PF0A 5AECA 1D3HA 1Q4WA 3SY8A 4DNMA 3AO0A 1B2YA 4R7OA 3JVAA 3W3OA 3MCOA 2QUMA 1MW3A 2AMGA 2GQ8A 3LV6A 4MADA 3W4RA 4L4PA 5I3JA 4ZR8A 3H2CA 4L56A 1LUCB 2GL5A 4WJ8A 2INZA 3E0IA 3CZEA 4HNNA 2QCEA 3UWYA 1FKWA 1GZJA 4GH1A 1VRDA 2QMKA 4JQ3A 3GK0A 4MB5A 3TSMA 3D3FA 3VIFA 3DG3A 3D47A 3MU7A 2CWXA 3BJTA 3KTCA 4NASA 1WXYA 4GCAA 1DWAM 3STEA 1H7XA 1WAUA 3SQLA 4HPJA 4HMNA 1VIZA 1SZRA 4US5D 4GUJA 1NH6A 5G1YA 4ZA0A 4FA3A 3CYJA 1EO5A 3VIKA 5EGRA 2OX1A 3O6DA 2IPWA 5BXSA 4J2MA 1X38A 1EJVC 3GU1A 1BLIA 2PMQA 5EJ1B 7XIMA 3TUUA 1ITQA 2PGRA 1HTIA 2NWSA 1HN1A 1OYBA 4AHQA 1A3HA 2B81A 2IQ0A 3VNLA 3WUFA 2G3JA 3N29A 1Q7ZA 1I75A 3WLHA 3R79A 4AIBA 4GINA 3BK0A 3OP2A 3WIJA 3SN1A 3W7GA 3IGHX 1BG9A 4W8LA 1RP8A 1AH4A 3FSUA 4PYSA 4ACZB 3S6OA 3A12A 2BOFX 2EPHA 4W87A 4XO6A 3LCLA 4YPJA 5FF4A 3B05A 4GY1A 3W9ZA 4G9PA 1YRRA 4NKCA 1OM0A 2WKGA 5K9CA 4MNJA 1W1A1 1H61A 4KWSA 4PMOA 4A2RA 5D9NA 3PZNA 2Y5SA 2QAFA 3EWZA 2FFIA 1K70A 1VFLA 3ATYA 2QW5A 3W27A 2Z4GA 2YZ5A 3HGJA 4JGDA 1JUEA 5FSDC 3MS8A 3P3BA 2ICSA 3W7PA 1AL8A 4XD3A 5CSUA 5HNUA 4REQA 3WF2A 4C6FA 3T2PA 2KZHA 5AY7A 1CW2A 2XZ9A 1A80A 4JKMA 2AQVA 2FH8A 3QM3A 5BMWA 1V7AA 3ITGA 3V7PA 1P4CA 1BAGA 3E2QA 3TYZA 3PP7A 4HU8A 4HNUA 1JGMA 5DRCA 3EMCA 4LRTA 4LCSA 3KCJA 1E9IA 2FFCA 4IWWA 3L7RA 2E5CA 1WDRA 3ARRA 5D38A 4NQ1A 4PUNA 3KS5A 2X1SA 3TCEA 1IXPA 4UMCA 3W1RA 1L8PA 1M7JA 4G2DA 3LEPA 1D8WA 3T8QA 4GK8A 2YW3A 3UPMA 4ZOAA 1K7EA 3YPIA 3PM6A 2ZXAA 6TAAA 3KOWA 4XV0A 4GX9A 1OT1A 1HO1A 3GW3A 3MJYA 4C6MA 4L65A 1BG4A 4NT0A 4ZODA 3B06A 4LFYA 3PK7A 2CESA 3WUBA 4NAEA 5AHMA 2ZOXA 1TJ1A 4YWIA 4ZO8A 3SUWA 3UPBA 3CQKA 4LCRA 2OEKA 4MUPA 4OE7A 5AVNA 4Z1DA 1AQMA 5FF3A 3W2LA 1OJXA 3WQFA 1GZGA 3DHFA 3G8RA 4RK8A 4HGXA 1G4EA 4U4MA 4AUBA 3V0TA 4ZCWA 3NCOA 2X0YA 2CKRA 4W7VA 4JYEA 2FMOA 1KKOA 2X41A 4F0SA 3C3UA 5J5RA 3ZVHB 3S47A 4HCLA 1GHRA 4EAMA 3CK5A 3Q4DA 1PHQA 3WLIA 1NF0A 3BMXA 2EPOA 2A6LA 1PKMA 1OABA 4MOZA 3PTMA 3L4YA 4HJFA 3WQOA 2WCGA 3QF0A 6ALDA 4HNTA 3DUGA 2CERA 1HKMA 1A5AA 1E3XA 1R87A 4LPCA 4BI6A 4CD6A 2HS8A 1CYGA 3A3XA 1LG1A 4JNYA 4UQEA 2XFFA 2C18A 2VR4A 4Q6JA 2HE5A 1CLVA 3HG2A 3TYDA 1PWMA 1RP9A 4ADUA 1H4PA 5BMXA 4LV4A 1QBBA 3GXTA 3LRKA 1H0GA 3RO8A 1T41A 1M68A 4PUJA 3SB0A 3JUGA 2UY3A 2PLCA 2OT0A 2VELA 4BKNA 3CPUA 3W1LA 3WBAA 4ZTXA 3NG3A 5F4XA 2DVXA 3ZM8A 4IFKA 5REQB 1IGSA 4AB4A 3ZWTA 1PCWA 3CUGA 4IL0A 2R1PA 2PCQA 5G4WA 4ZBCA 1LBLA 4MY8A 4K6AA 1TPC1 3G3DA 1F6KA 2C1GA 1TV7A 4G8TA 4HA3A 3E2SA 1CXHA 3IVUA 3N15A 3BQ5A 4U5IA 5H91A 2VL4A 5K3VA 4FXSA 2FVKA 3TLLA 3GYEA 1UBSA 1QBAA 2RH9A 3OODA 3ENLA 1SW7A 3L21A 3CQIA 3RUBL 1RBAA 1DEDA 3TH6A 3UU0A 3N2TA 3VCNA 2PGEA 2XIQA 3GAKA 5G2WA 2CFFA 3WMSA 2PP0A 4A2SA 1E40A 4DF1A 4E2DA 1XISA 4JTRA 5CXPA 1K1DA 1PX8A 2YA1A 1Z32X 1Z41A 3O15A 2J7CA 2D2OA 4AY1A 2PBOA 3EWYA 2J9YA 1B57A 4F2UA 3ITXA 3MKCA 4X0NA 1XLIA 3GY1A 3D3AA 3LCIA 1EDGA 5JIWA 2XWDA 3NGFA 5EFFA 2EPKX 4HMEA 3OIXA 1NELA 4GQRA 2JQXA 1FTXA 1QOPA 3G22A 4AISA 4HVXA 4AIUA 1RXOB 1H41A 3TWAA 5FEZA 3S0CA 6TIMA 5LXEA 1K8YA 1TQJA 1SJAA 4D6FA 3TFCA 2BP1A 3IAQA 4J3TA 1EQPA 1S2UA 5FA5A 4RDWA 4RE4A 2INEA 5E93A 3L65A 2D23A 1J93A 3CAQA 3W29A 4Y9NA 5E9XA 1Q8AA 1TPDA 4B4HA 2UZ9A 3W53A 1UIOA 6XIMA 3W72A 1HGWA 4H6EA 1UROA 3LHYA 3MBFA 1K02A 4XTDA 2NV9A 3TKFA 3GG7A 1R5YA 2ZFAA 1IEWA 1Z42A 3S4TA 5AHFA 2VC6A 2GYIA 1EJUC 4GHRA 2REQA 1GJPA 3O06A 4G56A 3S8HA 1JDFA 3CZKA 5HMDA 4GIAA 3BICA 3TP4A 5A8QA 2KX9A 2Z25A 3PPFA 4QBXA 4K37A 1E56A 4FIRA 2VZSA 2BG5A 2A2IA 1KTNA 2PDHA 2NT0A 3WNPA 1TX0A 1UD3A 3TJ4A 4KS0A 2WKLA 3BLFA 1WUFA 1GZ1A 1EFZA 1VBJA 3ISIX 3XISA 1UH2A 1N82A 2FDSA 4L64A 1VBRA 2QGHA 2XH4A 2QCDB 4GQGA 3S1WA 1GORA 1OC5A 4DY1A 4GIYA 2QCHA 1DE6A 1UMYA 3VMNA 1XH2A 4LY8A 5J5DA 2G96A 1OC6A 3NYZA 1XC4A 1DJXA 2QDEA 4KRUA 4XBSA 3VNKA 3NO1A 3LI1A 4K36A 1I8JA 3ONCA 2VT0A 3KVKA 2GJNA 4W5ZA 4MJ2A 4H19A 1S39A 5AC6A 1UR3M 1LT7A 3GVRA 3CU2A 4S3KA 1PKYA 3E74A 2R91A 4KIEA 3T09A 3AHXA 1TA3B 2VGFA 1PX4A 4NP7A 4GO9A 1NWUA 1QCWA 3EA3A 2E1WA 2HXTA 1V77A 3NQ2A 3BARA 5IM51 4NJGA 3HPSA 3PTQA 4B5TA 2DT2A 3C2VA 4BA0A 3KRUA 1BGAA 1B9ZA 1QRQA 1EX5A 4HPHA 2GWGA 3BSHA 2IXVA 3IJDA 2J13A 3KTSA 3PB2A 3UZZA 4M81A 1RALA 3WLPA 5A8NA 3KE0A 1JXJA 1FP9A 3WDQA 3RM4A 4Z2KA 4B5WA 1XDMA 5FI8A 2E9MA 3RR4A 4G1KA 1W3KA 5AC7A 3ELFA 4M7TA 2BXVA 4LNYA 3W82A 3RK8A 2V3GA 3IGSA 3GHSA 5FD0A 2Y89A 2OQHA 2DZPA 2Q8LA 3CHDA 2W0UA 4JTAA 3ABQA 2PDLA 5F4SA 1E5NA 3VKDA 4PB4A 5EA9A 3PHAA 3OZOA 4W7WA 1W9BM 3NXLA 4GLEA 4J7RA 2AL1A 1RH9A 1F61A 3L4TA 1NFBA 3MYPA 1RHCA 1DPMA 2WMKA 4WHBA 1D3CA 3LY0A 2QPXA 1UR9A 1LORA 2PODA 1A5UA 2Y61A 2HRWA 4KWUA 1VFHA 4CN6A 3QV9A 2VZVA 1KFWA 2PTYA 4H41A 4IXXA 4FP1A 1TPH1 1KRAC 3T07A 1QK2A 3IEBA 3BAXA 1E6RA 1JJKA 5GPRA 1UH4A 5EKYA 5K9DA 3R8GA 2PGFA 4B5VA 3LD5A 2QCNA 1A4MA 3WQCA 2GJXA 1EP1A 2CYGA 4F9JA 3DN5A 1JUBA 1UKTA 4GJIA 5I2UA 1KA9F 5H2ZA 4LBRA 1VFSA 5GNZA 2G3NA 2BZNA 2JK2A 5ENLA 5M1TA 1E6NA 4DJFC 4O1CA 4GUFA 4PMVA 4XO7A 3JRKA 5FF7A 1GVEA 1GVYA 3CIXA 4O16A 4A8NA 4LUSA 3DIPA 4Q4KA 5D2TA 2W3ZA 3O3RA 1FWGC 1Q6LA 1UASA 3BLIA 4JL2A 4N9CA 1VZWA 3FXGA 2XH7A 3I3DA 3GXMA 4GGBA 4E3TA 3Q37A 2J77A 4Z0JA 4MYXA 2WCAA 4CVWA 4LNCA 1PIIA 3F5LA 3UR5A 2E68A 3K13A 3BAJA 4FR6A 3W2KA 3R1ZA 4ATDA 5AYZA 3CGTA 1Q4NX 3ZXWA 4JTSA 5C5YA 1XSJA 2PDXA 2P5NA 3WMCA 4IMAA 4DWSD 3RG6A 2E67A 1DWHM 4KWWA 3THCA 1TZ7A 4D8AA 1D3GA 1J11A 2BFGA 5MHBA 4DWSA 3A64A 2IXUA 9CGTA 2C19A 2J7BA 3POHA 3W75A 2ZX8A 1QNQA 2CLOA 3S1UA 1TJPA 1LLOA 3CUXA 5I00A 3EDKA 2QDDA 3P74A 4KFNA 2FLIA 3W7JA 1W2VA 4OGZA 5EBAA 4CEXC 1OYCA 5A8GA 4Y96A 2R82A 2OELA 3C6CA 5G1MA 1FRBA 3PULA 3DYOA 5JMUA 2UY2A 1XKYA 2XVPA 3I6RA 3KBWA 1PB0A 5D4YA 4CVUA 2P53A 3SCRA 3I7RA 3VKBA 1W54A 4UFLA 4HBKA 2JKPA 4F9DA 3CV1A 5AHNA 3VNMA 4PODA 1G4TA 2JGQA 4Q7NA 3MMTA 2VWTA 1RPKA 3OBKA 4WEVX 2O4MA 1DTUA 1TJRA 2A3EA 3LHUA 2PDGA 5IFPA 4DI9A 3AWOA 5D9MA 2QUTA 4JS3A 1SR9A 1JCMP 1WYIA 1AW5A 2J25A 4B3KA 4DWSB 4B91A 1TCDA 1XL9A 4CU6A 1L8NA 1TR1A 1XFBA 2CLFA 3S2JA 4DLMA 2A0NA 3TQPA 2A3BA 3F4NA 5PTDA 4AZHA 4JTKA 2G95A 3H24A 1OQFA 1J79A 1AQFA 2E4TA 2NUWA 2BB0A 1WAWA 3F2CA 4GVHA 4AZ7A 3ARTA 2YCLA 2BXYA 1UHVA 1QFEA 3NVTA 2XN2A 4FNRA 5J8LA 5BWFA 1G4SA 1V6YA 3AFBA 5LIYX 5E1QA 3CT7A 2OU4A 4IIHA 3M9YA 4N7QA 3EXTA 4F4RA 2QZRA 3SFKA 3R13A 2DH2A 3CC1A 4Q8QA 3VGFA 3S1XA 4R53A 3R89A 5A6AA 3URAA 1US2A 4H01A 3B8VA 2PI6A 3PZIA 2CZFA 2XN1A 1IXQA 4AG0A 4ZENA 1QJWA 1QAPA 1SFLA 1KLZA 3K4AA 5IOBA 4O57A 4YVVA 1VJSA 3TYCA 4CN1A 1XUZA 1W5PA 4MZYA 2DEPA 3D6NA 3GWQA 3KOZA 8XIAA 3NZPA 1XICA 4J40A 3CV6A 1OCBA 4X61A 5D32A 2YKKA 3P84A 2HDJA 3JU2A 1YDNA 4S3BA 4RNJA 4XKMA 2AKMA 5DRIA 1HKVA 5EMYA 3GVVA 4C90A 3UA4A 4K8HA 3QBUA 3GE7A 2YXXA 4QJ5B 6REQB 3ALFA 1DJNA 2BGQA 1ZB5A 4ZGYA 1RQBA 4M6UA 3LLXA 4UQDA 3V0SA 1OY0A 5JQ9A 4S3FA 1LRQA 1DIDA 1KFBA 3WLQA 3SFWA 2QS8A 3ZLFA 1XYBA 3UY8A 1HL9A 2WZIA 5DBUA 4GKLA 2GUUA 1FWSA 3ES7A 3WLOA 1AH3A 2HVMA 4EXQA 3UEQA 4R3UA 3WELA 2ZQ0A 1H50A 1VJZA 3THDA 1VLIA 2Q3OA 4QROA 1Q63A 1NIUA 1QNOA 2BX7A 1IT8A 4IM4A 1J18A 4NI3A 1WBHA 3TCSA 1HZYA 4MUZA 3LXBA 3L2MA 3WF4A 4Z2GA 1PSCA 3EB4A 4JIHA 3H53A 2PWUA 1TVPA 3HG3A 2YBUA 4LAMA 3S1GA 3R43A 5FAGA 4Q4QA 3PSWA 3W70A 1VBUA 1PVNA 4XUGA 2ZUMA 3AZTA 2GLKA 4AZ6A 4M1RA 3W1QA 1YW1A 4QHRA 3O8AA 3KS6A 2CBJA 1R3YA 2OZTA 1IQ8A 1EBGA 1C9DA 4PRTA 1CGUA 2WMIA 3WDIA 1W9XA 2QR6A 4UCFA 1TV8A 2OZ0A 2ATMA 2B7QA 2PGWA 2ALRA 4UTWA 2XHYA 4MSSA 1WZKA 1JULA 2PDMA 1FQ0A 4XZHA 3E0FA 3GIYA 4PCTA 1KGXA 1NP0A 3M5VA 1FY6A 5HWMA 1VPYA 3UG3A 1PIFA 3WF3A 4I7UA 3JW7A 3IARA 2PU1A 2AQOA 4PA8A 3NO3A 2X0SA 4DYJA 4M56A 3DHPA 3F1QA 2OB3A 3TW6A 1IEIA 3AS2A 4IH3A 3MUZ1 5CQ1A 3CZGA 3QY8A 3RJXA 2VUNA 1PXGA 5JVLA 3DFTA 4GYPC 1XIJA 3CHFA 2ZICA 1XM3A 4MNLA 3VTRA 3P80A 1XWYA 1O5RA 3W1TA 4JZ5A 2XH0A 3G24A 1OYAA 5A3HA 1P7TA 4IQEA 2WHKA 4V1XA 3WH8A 3PVFA 3T0CA 4CU7A 2Y24A 1U1JA 2HVOA 3LLFA 3GG8A 4UTLA 4V15A 2OYMA 4PTVA 4ATLA 1TE1A 1UP0A 2WOQA 3OA3A 9RUBA 1P6CA 1ZP4A 4O4VA 5HWNA 4TIMA 4TQTA 4O13A 2GJLA 1YPXA 4Q4MA 1J0IA 1U2YA 3NOYA 3JS3A 1DWIM 3WH5A 2WJEA 2VRQA 1GQLA 4IIDA 1ZALA 8CGTA 3O05A 2ZIDA 3UCQA 4LAOA 4F2TA 2LLEA 4DO4A 4KETA 5IHRA 1SJBA 1I2PA 1IGWA 1VYRA 3M0HA 3K46A 5FCZA 2BDQA 3TR2A 4GY0A 4ZB0A 5FOOA 2IQTA 1ONXA 1O60A 2A4AA 2Y70A 3B3DA 2G41A 3WBXA 4Q3MA 1CPUA 3AOFA 1OFAA 4YYFA 4JOMA 1UD2A 4LSBA 1XIMA 1Y5VA 3AXHA 1NWTA 3G8EA 3PAOA 4X63A 1NAL1 3I10A 1YIXA 1UJPA 5KEZA 2YDSA 3DCPA 3TN3A 3NQFA 3QYQA 3QQ0A 3S5OA 4PL1A 4GCXA 3QTGA 3BW3A 3FHQA 2V38A 4CLMA 1XYMA 4YTUA 1V6WA 1EX1A 4PMYA 2Y7DA 2TAAA 3T0BA 1REQB 1MDLA 3GXDA 4AH7A 1L2QA 3LK6A 3W2JA 2EXOA 4CGTA 5A6LA 3JZUA 1KRCC 1EJTC 3PWGA 1PPIA 3VX0A 2Q6ZA 4R85A 3OA5A 4XAPA 4XZIA 1V6XA 3BV4A 1J5TA 3FKKA 3BGAA 5IBXA 2Z1WA 3TTQA 1R2RA 2PEVA 2A6NA 1P0EA 4N9BA 3NQGA 2B0MA 2WVVA 1BKHA 2WHJA 5C9ZA 2R94A 1W8GA 4AF0A 3BCFA 1HKIA 2O55A 1VYPX 2GDVA 1EBHA 4RL3A 1OFPA 5KSWA 1PDYA 4IPNB 3BSGA 2DIKA 4AC1X 1BPLB 1EXBA 1VF8A 1KGWA 4HJWA 3NTYA 4O28A 2ZZ6A 3OVGA 4PFMA 4V2XA 1F3XA 3B0UX 5CKSA 3KM8A 5JU6A 5IDZA 2ESCA 1TPB1 3CLWA 2OLHA 2ZTKA 2NXHA 1EGVA 5DANA 5E09A 1H49A 2VDHA 1NEYA 1G4PA 2QF8A 4P7QA 1GVIA 2ISWA 4O1AA 3BW4A 1M04A 3PFMA 1H62A 3QW3A 4WGHA 2QDHA 4FIQA 2FTPA 1WZMA 1OCQA 3FV9A 1Q45A 4KERA 1XF0A 5G5IA 4Y8FA 2VFFA 1A3WA 4ERGA 5FJTA 3U6WA 3RAOA 3DECA 1BWVA 3KWXA 2CHRA 4QXIA 4M6QA 1OB0A 1W1PA 3W7MA 3G5EA 4P7LA 4YYCA 4C6KA 1RY8A 2VX4A 5AB3A 1DHPA 2J6VA 3CMJA 3R6IA 2Z24A 5FJUA 3GG1A 3U2ZA 1Z3NA 2I5GA 4JR5A 4ERAA 2WW5A 3MUCA 3M6DA 4JICA 1XRFA 3TYUA 2CZEA 3GVQA 4M24A 2Z1BA 1XPGA 4UQCA 5KZDA 4IHCA 4MY1A 2Y0FA 4ZB5A 5D37A 1R9ZA 2BY1A 2YGYA 3G18A 2MANA 3MUY1 4I8DA 2DT3A 2X30A 3WQVA 2VD8A 1WOBA 4TTUA 1EDQA 1R6WA 3CPRA 3TC7A 3TYBA 1QOXA 3WD0A 3NPXA 2JIWA 1E70M 4BQ2A 3UF9A 3LBOA 1GJWA 3MV11 1GT8A 4DIAA 2BLEA 3MYOA 4PTMA 3BG5A 4AZGA 5BU9A 3GFYA 3REQA 4RE3A 1XRTA 1N7KA 5CC7A 2QJJA 3A6OA 2JALA 3BAKA 4DXVA 2YIHA 2FH6A 2J27A 1JZ6A 4BWLC 1V0NA 4H2CA 3CUFA 2HPMA 1EYWA 1LUCA 1XLAA 2CLPA 1WZLA 4M80A 4PGLA 2DSVA 1ISWA 3TROA 4PH6A 4WVXA 1VAHA 1FFRA 1Y5WA 3QPEA 3SY1A 3KOFA 3QLDA 5CPQA 2GVYA 4I7WA 1ZGDA 4R7WA 1PZ2A 7TIMA 1GEHA 4ZXLA 3W85A 4BEUA 1E0TA 1SFTA 1MXDA 3D46A 3PN8A 4GMEA 2YZRA 1LLZA 1US3A 3H70A 1ALDA 1H7OA 4GXMA 1LQ0A 3AWNA 4S3GA 1IWBA 3BE7A 3B9AA 4HZ8A 3RIKA 2OX4A 3DESA 1CZ1A 1VBHA 4B5SA 1R9XA 5KINA 1F76A 4UFKA 4D6HA 3SAZA 4BZYA 5A94A 2YYTA 4CQBA 4XWUA 2Z26A 3VE9A 1LT8A 4PTNA 2DJXA 1HGYA 3QOMA 1BSIA 3WKZA 2Y2WA 2GUBA 1KW1A 3HB9A 1K6AA 2WQPA 2VEPA 4AWTA 1BVWA 2ACUA 3M0JA 3RX4A 4REQB 4XG1A 2QVHA 1OF8A 3O9NA 3B8DA 1C91A 5D8WA 5I6SA 1PYMA 2WBKA 2TMDA 2JBMA 1IZJA 1XQLA 3T0AA 1QPQA 2H9AB 1GOQA 3EEGA 1B9BA 3WDHA 5A6BD 1A0DA 1LLWA 4MHBA 4EACA 4TUFA 4I9MA 2CCRA 4LC6A 2I17A 4K39A 5F2LA 5HPOA 2VX7A 3T42A 3W1AA 3G1AA 4JAWA 3ZJ7A 1JEZA 3BZGA 1UZ1A 2HBVA 4IGHA 3Q94A 1DV7A 2VKZG 2Z6JA 1NP2A 2VX5A 4JD4A 5C9RA 3TXZA 4N02A 3W7NA 3THQA 3C2FA 3TE9A 3P2VA 1TTPA 1AW1A 4GIEA 1YDYA 1V93A 1XJBA 1ZTVA 2YL5A 5CZSA 3LM3A 1BF6A 3TW9A 3UJ2A 3GNRA 2P10A 4IUOA 1B1YA 3WDPP 1KM4A 2A7PA 3FA4A 4MFEA 5MF5A 3ZR5A 4FXJA 3V75A 1W9DM 1Q8JA 2J8TA 1MZHA 2DUAA 4HK6A 4YTRA 2VEMA 4NX0A 4K1GA 3W7EA 4IP5A 1FH7A 4K2SA 1E51A 2ISDA 3WLKX 3PNZA 4HSOA 3MO4A 3AICA 5BRQA 4JY8A 1X98A 3G6MA 4RZ4A 4PUWA 4HNCA 1UP2A 3NL2A 3CZJA 3ZVIA 4AW7A 1IEXA 1Q6CA 3OZMA 3KBVA 5DCDA 5LNWA 3EX3A 4ZQOA 1H7NA 3CTLA 3SUUA 3QGAC 1JQXA 3CUHA 3ECQA 3PJTA 3UG8A 3CL7A 3TYAA 4HOXA 1I4NA 2CWNA 1Q6FA 3WNKA 4DJDC 2VEKA 2X1RA 4RW5A 1FWTA 4QG6A 5XIMA 1V0MA 1UWTA 2EBNA 1M3UA 1BTMA 1XYLA 5A2CA 5FSEC 4GVIA 2NVAA 1U1UA 1YXYA 3ES8A 4AMCA 4ZQNA 5T8GA 4XTIA 1OFQA 1AH0A 5HINA 3HGSA 4BHYA 3NR0A 4LF2A 4ZTYA 4AWSA 5DO8A 4J3WA 3H4XA 3ZSSA 5HPCA 3A3HA 1O4UA 3P82A 3MMDA 1N55A 3WQDA 2PDWA 3TA6A 1E1EA 1SO4A 1JXKA 5MKGA 3QKEA 3V0UA 4XZWA 3ZO9A 4KMQA 3S6DA 3B8UA 3H23A 3A4WA 4IJBA 2GPTA 4O1BA 1ZL1A 1JDDA 2QIIA 3TN4A 1M7PA 5C9XA 1LRTA 3UCDA 3EMZA 4UTTC 4ATWA 3GLCA 3CL8A 3C2RA 3OIHA 2RAGA 3GXFA 4MFDA 5FEWA 1VP5A 2OZ8A 3BMWA 1UWRA 5M17A 2J78A 2YL9A 1EQCA 4JX5A 2IPGA 2X16A 1WDDA 5HMFA 4PE8A 1IZCA 1EJ7L 1FCBA 5BZAA 1LWJA 3O0KA 3I4EA 2PTDA 3UXDA 3CAVA 4RDZA 2IKHA 3DBNA 2EQDA 5BCAA 1DJZA 2CLEA 4CNNA 1ITUA 3QH2A 4PMDA 4QSFA 3ZIZA 2J8FA 1S5MA 5TF0A 4K7YA 3TXVA 1GQNA 1ZPTA 1C8QA 2ISVA 3L5AA 4F0MA 4U33A 4UBPC 4JX6A 1DVJA 1YEYA 1UUQA 7REQB 3O0FA 4JXCA 4DJEA 4H6RA 3W7LA 3LM7A 2Z7KA 4IOTA 3LYEA 3TNBA 2OYLA 3A13A 1T8QA 1Y7VA 4WQ6A 2ZDRA 2J74A 1XDLA 4ALDA 2FYMA 3BWWA 4IG2A 1DIEA 4C5ZA 3UZJA 2I56A 1EUNA 2XIBA 5TIMA 3GDKA 4YL2A 2F7FA 3AJXA 2X42A 4NF7A 1XV8A 3HPXA 1ZCCA 5JUVA 2V63A 1C93A 1X97A 5KTLA 3UXLA 1BXNA 2DZTA 4NVTA 5CZKA 1O5KA 4FLSA 1SW0A 2QLYA 3GU2A 2I57A 2O9PA 1XXXA 5HJXA 1RCQA 3FK4A 1NF7A 4FLRA 4R33A 4AXKA 3CTTA 3E02A 2YCIX 1FWJC 4TXEA 4H3DA 5D2VA 4IIFA 2J24A 4QX4A 3GRIA 1XGZA 4IGSA 2YCKX 4CNUA 4FLOA 4PBEA 3W7HA 1EHAA 5A2BA 4UTWC 2ZCGA 1GYMA 1MVYA 1HO4A 1HVXA 7REQA 3MUXA 4A3RA 5AZ0A 2HQAA 3VZYA 1AK5A 3M44A 3KWSA 1CXKA 2OVLA 1DWGM 3N2XA 1WNOA 2ZRVA 4E38A 1ZRQA 2B7OA 4RNHA 4Q7IA 3EPOA 2ZUWA 1M7XA 2GGIA 5JXQA 1GW1A 4AZIA 2ZTJA 3WBYA 1ENUA 4EIVA 1IF2A 4AZ5A 3VIJA 3WD1A 1GUVA 1E15A 3DYPA 3K4DA 4HIBA 1WKEA 3BJFA 4QTGA 2FGLA 3ARQA 3VOGA 3M5ZA 3E0VA 4RNIA 3WBEA 3GBEA 3S2CA 2OO6A 1LF1A 4OWGA 1Q7QA 2P8CA 4F79A 4KEMA 1XKJA 2EJAA 5HWJA 3VKCA 1M53A 1DJIA 1QT1A 5E9AA 1E9LA 2ACRA 1UYQA 3SCSA 2WVTA 1KNWA 1Y5XA 3VFCA 3QQWA 1TREA 2BS9A 1XG4A 1Y8BA 2ASHA 4FMVA 2WNZA 5I5RA 4NXSA 3AIQA 5GQBA 2CU0A 4HHLA 3FA5A 4WSJA 2NSOA 1AODA 2FQIA 2F2HA 4DXXA 1SVDA 3PZUA 4GNKB 2C0AA 4QM1A 3H7RA 1XUUA 1KC7A 3T1GA 3QC3A 1XQKA 3EOEA 1OGGA 1LQAA 4H9YA 3URNA 1OFRA 1HNYA 2R8WA 2WSRA 4DM2A 1Z89A 3EXRA 1RQHA 1YTEA 1V0KA 1TMLA 3MDUA 4H8UA 3ITLA 4QEEA 3L0GA 1IIHA 3EPMA 4KESA 3I7QA 3DAQA 4A3HA 4G7EA 1H1YA 4H4IA 1WDPA 3GIQA 1NDWA 1ONEA 4FOUA 1XR2A 1M03A 2J7FA 4NZ4A 3K4WA 4QR6A 1CCWB 3BG3A 3GX9A 5CPNA 4YTTA 5EMLA 3P14A 1UD4A 5CSSA 4UXDA 3PFRA 1G6CA 1AD1A 1GG1A 4N4QA 4FNUA 4DJFA 2DIEA 4UOZA 1R47A 1R38A 3AYRA 2Y7EA 5CJNA 1LL4A 1XBXA 3IUDA 2XIJA 1LBMA 3APGA 3M5YA 2HPIA 3PUDA 4A22A 1KQYA 4IT1A 1X96A 4QE5A 3NEVA 3RF9A 5I79A 3GFXA 1L2UA 3WF0A 1MO0A 2IKGA 2Y62A 2YBVA 1EJSC 1JCXA 4HOWA 2NQ9A 4U28A 1W3LA 3E2RA 3ANVA 4UTJA 4LJ3A 1AMYA 4V1YA 2CITA 5B80A 2SFPA 4KRZA 4HTBA 3LZ3A 3DGRA 4L4LA 1U22A 3T6CA 1S5NA 2WSPA 1QW8A 1UUMA 3KOYA 2WJDA 2RKXA 4IG2B 3CMFA 2X1UA 3C8NA 2NSXA 4QAIA 2VFDA 3HIJA 4JEQA 1E6QM 1W9UA 1PWLA 1EDTA 4D6IA 5DFAA 1L6SA 1XIGA 1NWRA 1QNRA 4HD5A 3W6LA 1ZFJA 3W00A 1EZ2A 5HNTA 5FF2A 5BXPA 2GGJA 4LYQA 4P8WA 1AUSL 2CLMA 3C2YA 4GZJA 1PTDA 1WA3A 4MZ8A 1TB3A 4HCHA 3GHTA 3L5LA 1VHNA 3PUOA 1G67A 1F6YA 4GZ7A 1W31A 1UA7A 4L5ZA 1K3UA 4YS1A 2V3FA 3M6YA 1OIFA 4TVUA 4H9UA 1H3GA 4GRSA 3TJXA 4BEQA 1LOLA 1K4GA 3SZ8A 3W84A 1DE5A 2YFNA 1BYAA 5CCZA 4PUDA 1PZ1A 3NL5A 3AXMA 7PTDA 5GJMA 4ZO6A 3GXIA 2PLJA 1B90A 4CUCA 2CLIA 1W1IE 2VXNA 4A21A 2VCAA 2P0OA 3THAA 5D30A 3FEQA 1XCFA 4IP7A 2AGTA 3H4GA 2WMFA 1NU5A 3N1AA 4ICMA 2I5QA 3W7KA 4WDUA 2ALDA 2D20A 2HS6A 1KBLA 2CLKA 1VPXA 3FA3A 5A8PA 1C3FA 4QQ3A 1V6TA 4DAIA 3SCOA 2VNCA 3BLDA 1W56A 1KBJA 2PA6A 2WC3A 5DT5A 3MKVA 5CH9A 1TUXA 2ZRWA 2JIEA 4Y9AA 4MYAA 2VOMA 2PP1A 3OB8A 4AZCB 3EKGA 2ISSA 4NY2A 5M5DA 3GTNA 1RBOB 3WEMA 1W8SA 4LANA 3GR4A 3FX4A 4XZMX 1BSLA 3VDBA 3ZLHA 2GUYA 3NDYA 3MUIA 4ECLA 2J66A 2ZX6A 4B15A 3KCOA 3SSJA 3IUHA 4Z2JA 5CPLA 2FB2A 2D1ZA 1I0BA 3TJIA 1CIUA 1UKPA 1R8LA 3AYTA 1CBGA 3EX6A 2IKIA 5AC5A 3VC5A 3O07A 1KV8A 1NQKA 1HIZA 1LRNA 1PTGA 3WBWA 2VOTA 5FJJA 3HQPA 1LP6A 3XINA 4LYPA 5BOFA 2ZUTA 1TPWA 2E77A 3LUTA 1E9ZB 3EBVA 2YCLB 5IBXC 3ZFHA 4OBSA 3GDBA 4YLWA 1UR4A 1MEHA 1RQEA 5AHIA 3LBMA 1HG3A 3MUAA 3U57A 1ZJAA 3HQOA 3N9SA 3I7SA 3TAOA 5LNRA 3KL5A 3BAWA 3BO9A 5CPMA 4J4KA 2DVTA 1RZMA 3PZGA 4YJ5A 3T08A 2OMAA 1X7FA 3OJGA 4XVEA 1RD6A 1K9DA 3VMOA 3R7MA 1PDZA 3N4FA 4UTUA 4WOZA 1OF6A 1LWIA 2GQ3A 3H21A 1KBIA 1QI3A 3NJ3A 3AJ7A 2EAWA 3AROA 3F4CA 5AOUA 2VC7A 2OQYA 4QS5A 3QSRA 4KKXA 4L1XA 4D6GA 2WB5A 2O9TA 4Y8EA 5DLCA 4PB5A 1B54A 4FNSA 2VFHA 3LGGA 2DFAA 4UTMA 3LZ5A 1MZRA 3ATZA 2C13A 2NVDA 1J10A 5U4NA 3L66A 4LVDA 5CPOA 3LLDA 5FEPA 4QLLA 3AQUA 2MNRA 2OLSA 1B30A 4D1IA 4LTSA 3TDFA 2XVKA 1J6OA 1JIBA 4LC8A 5C0QA 3U8GA 1TR9A 4XAYA 5ABHA 3G1RA 4DZHA 2PDYA 2VJXA 4RZ5A 4ACYA 4EVZA 4Z42C 2YOCA 3O6YX 3V1PA 1KV5A 3HJZA 2WPGA 4PCFA 4GQQA 4LRSA 3DG7A 3SR7A 4X22A 1UUOA 3QN3A 3N6HA 1PJ9A 1NQ6A 1OBAA 1XC6A 2EPNA 1TV2A 3MP3A 1J4EA 2X2YA 4GBUA 1YHTA 4QDPA 4WY0F 1J9YA 4NAEB 1V6VA 1MRAA 5H1WA 3PJUA 2ACQA 3UQNA 4GYKA 4E6MA 1GHSA 3TR9A 2HCVA 4Q8NA 1ME9A 1BWLA 2OSYA 1P1XA 3R0UA 3NAVA 2YA0A 3QMRA 4CCEA 3IWPA 1SO6A 4QDWA 3MP5A 1CGYA 1NVMA 1XD1A 1DXIA 4NSBA 3GO2A 2PRMA 3GH4A 5T9BG 3INPA 3LQGA 3VOCA 4ZFMA 4LVAA 3LHTA 1JDAA 4B5UA 3H4WA 3M47A 4XZ9A 3SY5A 4ONVA 4TU1A 2XSXA 4M51A 1PS9A 2D3LA 2W67A 5CSRA 1E1FA 1XLLA 4FR1A 4H04A 1S46A 3KP0A 2IUZA 3JR2A 4JHOA 4G6CA 4DBSA 5AHLA 4E8GA 2G3IA 2W79A 4LVFA 4ZQMA 1E3ZA 2R1KA 3QHOA 3WCZA 1H0IA 2WVVB 3RU6A 4PULA 2FJKA 3FIGA 4D6DA 2WMIB 1F5ZA 2V2HA 3NIYA 3WY1A 3E9AA 4Z0SA 1ZSXA 1GTEA 2VC5A 3NQMA 3KW3A 4PMQA 2R24A 2D22A 1F8MA 1DKWA 2XFYA 1VBGA 3CM4A 2NZLA 1MFUA 4PBFA 3RHGA 4CD4A 1F8IA 3ITTA 5EBUA 3W86A 2VZUA 2ADAA 4F0KA 4IIBA 3WQ4A 2F8QA 4O1DA 5SWUA 2PTWA 1SPQA 1QK0A 3PC0A 1MMFA 4A6GA 3AU6A 3UETA 2PS2A 4US6A 2YXGA 3WF1A 3PY2A 2VEGA 2CHOA 2Y85A 1FP8A 1MEIA 4OUEA 2YDRA 1YMYA 1E9YB 3RXZA 5EIYB 2BVWA 5BOEA 2VUYA 2QCCA 1FDYA 2A1YA 5HMEA 3W71A 5I3IA 4NIRA 1G1YA 4RDVA 4DI8A 2Q02A 1B5TA 2PCEA 4JQ1A 3H55A 1A5BA 5FL1A 3FJ4A 3AIEA 1MI3A 4DBWA 3FJ6A 3RCNA 4C6BA 3F4DA 2DSKA 3F2DA 1EF3A 4AD1A 4HHPA 3U0HA 1NARA 2OKTA 2HROA 4H8HA 4EWND 3DI1A 2QJHA 7A3HA 3UGRA 4JBRA 2FKPA 1QOQA 3AMLA 2J7GA 3ITYA 4CQCA 3KL0A 2O56A 3E2VA 4NRSA 1WOAA 2VFIA 4OUIA 5K4XA 3WQ5A 1H7RA 1K77A 2WZMA 3M64A 3GUGA 3PZQA 1EYEA 4I9TA 5I02A 3CBWA 3T05A 3GC2A 1V51A 4GFIA 3PNUA 2ZUNA 2G3FA 3IIZA 3IIPA 1YLVA 4IL2A 3PBMA 5EMMA 4H7ZA 4HN8A 4P5UA 1JAKA 2YXOA 2EPLX 4DN1A 2O0TA 4M6VA 2VR5A 1XRVA 2E28A 2RGMA 3B03A 4NRRA 2ZVRA 1IXOA 2G5WA 4HSNA 1FHVA 4RX0A 1EJRC 3WQEA 1MQPA 5D05A 3Q45A 5BRBA 1V4YA 1E4MM 4OU1A 1M41A 2WVUA 4S2BA 1EL3A 4AQLA 2EG8A 1O1ZA 4MKNA 1X6NA 1IE7C 4C6QA 2AAAA 1GOWA 4JIPA 2W92A 4KGJA 1EC9A 3MHFA 4S23A 3A5VA 2CHNA 2WM1A 5E6ZA 3CUJA 3VI2A 1FWIC 2UBPC 3PPCA 2X09A 1XYZA 3S5YA 4HMDA 1H7PA 3N2MA 3DXIA 3DDMA 5E5CA 3WJSA 5FAJA 4N6FA 5GJPA 1QATA 1IZKA 3TEVA 2D0HA 4JN6A 3AI0A 3MV01 4OV4A 3HMCA 3QKZA 1GGOA 5HANA 5KETA 4K38A 2Q8XA 3W83A 3HMJG 1XYAA 1KM3A 1JI2A 2E09A 2RDTA 4HQVA 3ZR4A 3UW6A 3FJLA 1TV5A 2NQJA 4TMBA 2JKAA 3B4YA 1XH0A 3A4JA 3ZT6A 2REQB 4IGMA 2DP3A 4PUMA 2F2KA 5JH1A 3QEZA 3PJXA 5T9CE 1E71M 3SEPA 3N17A 5G4EA 4RW3A 4PMRA 3ICJA 2PWEA 4ZSTA 1LWHA 4Y2WA 1K9FA 1KXVA 2FHFA 2EG6A 4O15A 3GW0A 2Y1HA 3A21A 4N9EA 1X1ZA 1G01A 3LBCA 1K4HA 3AALA 1TE6A 1HXJA 3A9IA 4HPGA 4OHQA 1E43A 3C2EA 1OEPA 4IIGA 2ZXDA 3SCUA 4R34A 1UC4A 2AKZA 1G9HA 2OTDA 4G7FA 1XIIA 2ZVIA 3L0KA 1ISYA 4G7EB 2QUVA 1YNPA 4UNIA 5FKYA 3WMLA 4DYKA 3BCJA 1CT5A 2F9RA 1LROA 4F66A 1O12A 3P0WA 4IP4A 3LCGA 2XGZA 1RLDA 2ZUSA 4NJKA 4FALA 3N25A 3RMJA 1YNYA 5A1AA 4O18A 3A24A 1EB3A 4OZOA 4AEFA 2WNNA 1V0LA 3LMZA 1VENA 4RCXA 1GVSA 4J5NA 2RJHA 4GO8A 2JE8A 3ALGA 3HU7A 4PUEA 4ZFCA 2PPGA 3QZ6A 3AIUA 1GOIA 2NVCA 3GDTA 3GNOA 1X6UA 5LZLA 1OSEA 4MAVA 4ZOEA 5IFTA 5KMYA 3CO8A 4MWAE 1N2VA 2PTXA 3C0SA 2BHYA 7ENLA 3H26A 3IK2A 2XPKA 3EYPA 3N2BA 3VKKA 4S39A 3WUGA 1RK5A 4OOZA 3USZA 4Z2LA 1OZMA 4XSMA 2QJIA 3B9DA 3VD4A 2BNJA 4WJXA 3KDOA 3MY9A 3BDKA 4A05A 3KP1A 2VGGA 3V36A 3FDKA 2TPSA 2PWFA 1XLGA 2I5IA 3NZ1A 2BASA 2W6RA 3AIRA 1KM0A 1HJVA 1ECEA 3WFZA 4TVCA 1CDGA 3DBPA 5AYYA 4GI8A 3TLQA 1LYXA 1GONA 1VYSX 3AU2A 3BOFA 3EAUA 1WKYA 4JTUA 2ZUVA 1JNDA 2A79A 3N04A 2D2GA 1JD7A 1R9YA 4LYKA 2XIIA 4TX6A 3QGKC 1GEQA 2H8XA 2RGLA 4V27A 2J79A 3FKRA 2VDIA 4DXKA 1ESWA 5M03A 5D9OA 1F7BA 2W4XA 3S9IA 4Z2HA 1E6PA 3IRDA 4XIAA 2FZ8A 3MMUA 1C90A 3DKJA 2W27A 3OW1A 1KM2A 2YL6A 1YBQB 4CCZA 1JUKA 1MW0A 3KLLA 3S46A 3VIPA 3ARUA 4ML9A 2F38A 1XD0A 1DIOA 2WC4A 2DZBA 1KBBA 4OKDA 4GUHA 3MSYA 2D2JA 4PBGA 4NL1A 3C3NA 3KDNA 3VNDA 4L7ZA 3UGVA 3ZVHA 2WJZA 4BS0A 3P60A 2XVLA 1MUWA 1S5VA 4TX9A 3UWEA 4C6CA 3GDMA 3EWDA 1XI3A 3IK4A 4UFIA 1FHDA 3L2IA 2DPEA 1V02E 4OVXA 3WFAA 3DC0A 4HPXA 1V5XA 2Z2BA 4CQAA 4O8RA 2NQHA 1KRBC 4GJJA 4ZQCA 2YR1A 2QEZA 2PC8A 1ZP3A 3APYA 1MWOA 1TYGA 2GJRA 3B0XA 3HZ3A 2P0IA 3WLJA 4B9ZA 2W5FA 4K68A 3CHEA 2DSUA 3SURA 4U2YA 4Y9OA 3SCPA 2J62A 5HNRA 4D2JA 2HJPA 1ONRA 4QEHA 4N4PA 1C8VA 3QQ1A 1YADA 1KCZA 2OXNA 5DN1A 5D04C 1TTQA 4Z2IA 1EHNA 1UWAA 1Y65A 3KXQA 3TTOA 4M6PA 5D2WA 3MI3A 1ML1A 1AZ2A 2ACSA 2XDFA 1OX6A 3MSGA 3VGHA 5GJNA 4Q8OA 1P0BA 2BOGX 2HISA 3MTWA 3CLMA 3OPSA 3M16A 3IV8A 1W1TA 1JPMA 3BMVA 3C0JA 5A6TC 2Y8VA 4IQDA 1OHLA 2FHCA 1WE5A 1UPPA 5HOSA 3ZSTA 4LF1A 1QVBA 1YDVA 3FY1A 3F7JA 1LTDA 3PUEA 2VCCA 1H5VA 2YFOA 4OT7A 2IMRA 1I2NA 4ZOCA 4QCEA 2C1HA 1LM1A 4MB3A 1G7VA 4CD5A 3WZ0E 2DJLA 4B16A 1WXZA 4ZQRA 1V3MA 1NFPA 4HHMA 5HULA 2H90A 4RE0A 3QLLA 4GH3A 3VOFA 3ORWA 2QYGA 2NQZA 1V3HA 1TRIA 3I65A 4BF9A 1UB3A 3POCA 4NUWA 1A0CA 4PB3A 3G1DA 1PX3A 3SUSA 1UD8A 4C1NA 4AXNA 3E0LA 1A49A 2DSZA 3TSDA 3OOQA 5A6SA 2XIOA 1LOQA 3RCMA 5DXYA 4AU0A 3BW2A 3LSBA 3T0TA 2RDXA 4HZ6A 3MCMA 4MMWA 3CAKA 1XPYA 5I3HA 7ODCA 5DMLA 3AYVA 3VC6A 1Q7MA 1U30A 3GAYA 2FZ9A 3N4AA 4PCSA 1PBGA 1B3WA 3TTSA 5HAOA 4QCFA 3NSMA 2X7VA 3WEOA 1ELSA 3VDGA 1SJDA 2E8YA 2Z0IA 1OK4A 2VGIA 3ARWA 5HMSA 1RBLA 1GOXA 1JYXA 4J35A 1V7YA 4JN7A 4GIRA 1CNVA 5CEWA 2IS7A 4GYPA 2E8ZA 4C7FA 3SBFA 3GTXA 5BW6A 2Q3RA 3A9BA 4B90A 3KL3A 3JZEA 4E4FA 4Q8WA 2A7NA 3WK3A 4I5UA 2YX0A 3OLGA 2ODOA 1GVOA 1H09A 3HFTA 3EX4A 3FAWA 3VDCA 3ITVA 2P50A 3BH4A 4UNKA 4UQ9A 2E1DA 4CNTA 3W73A 1KCKA 1O95A 1TTJA 1E73M 3VKJA 5D02A 4PEEA 1GJUA 4Y9PA 1TQXA 1QNPA 1CGWA 2BHUA 4B3LA 1DWJM 4GABA 3W74A 3DGBA 3I4KA 3NQBA 6ENLA 1S3HA 4F0LA 3ZJKA 2V5CA 3UVIA 5EU9A 4GI4A 1SM9A 1H11A 2W62A 2VD9A 4L4OA 4NZJA 4QG9A 4JIQA 3STFA 1J2BA 3LG3A 2XTKA 1UWUA 1O68A 5KZEA 1TZ9A 2NX9A 2GGHA 3SADA 4DPPA 2VFEA 2Z1VA 2V3EA 3OGVA 3RPDA 2HZGA 1RSCA 4JIRA 3D5HA 4F0RA 2OYKA 1TV4A 4FB7A 4RXFA 4MGGA 1JGIA 1OCJA 5HJLA 3UY7A 3G0SA 1YKWA 3UA3A 5GNYA 4LVGA 1TA3A 3EOSA 1KQZA 1PZ3A 2UV8G 1UBPC 3FDGA 1XH1A 4Q6XA 1ICSA 1MNZA 4RDYA 3I6TA 3VCCA 3QHMA 3QTPA 4RLIA 5RUBA 3W7IA 4EE9A 3K30A 1EP3A 3A3WA 3NPWA 3UD6A 4OECA 1IEVA 4YHEA 2O7QA 4MAZA 1V08A 4LYRA 1VCGA 2OFJA 1P43A 3TSBA 1MDRA 1OT2A 2UWFA 3Q58A 1A3XA 3GDRA 1SO3A 2EF9A 3BTNA 2NQ5A 2BXZA 3IV3A 4UZUA 3TNOA 3VM5A 4CU8A 4GGHA 4CD8A 1XS2A 3AMGA 1C29A 4M8UA 2X1IA 5LHFA 4RKAA 4KPLA 4BJHA 3UJFA 4I5RA 3SW6A 3EWXA 1TWSA 3QSTA 5DMYA 4JCLA 4LX4A 3NQ6A 2V82A 3N11A 1SQ7A 3LCHA 2BVTA 2W61A 1POJA 4AD0A 3M0LA 4H9ZA 3QV6A 3L4WA 5TAOA 2ZRUA 1VIWA 2GOKA 4KEVA 1P6WA 3CHCA 1MXSA 3EA2A 3RRAA 3B4UA 4WD0A 1CLXA 1EC7A 2Q8ZA 4N2YA 2EHHA 4ZOBA 4D6CA 5B7YA 2DV0A 4NX5A 3TN5A 4E4UA 4HMCA 3H12A 2VQTA 4GE8A 3WK0A 2IW0A 2A5HA 3UCCA 1TIWA 4HU0A 2V67A 4AEEA 4OFCA 2G97A 4Z08A 1B4EA 4MVAA 4LW7A 1XLDA 3ZQ9A 5I78A 5K2ZA 1QR7A 3TU9A 3K5XA 3EDJA 4C6DA 2CBIA 3T8LA 3N9KA 4I9JA 1S2CA 4JNZA 1FDJA 4NZCA 2ONEA 2WO5A 5CBJA 1GKPA 3U7BA 2GZXA 4LVBA 1MYRA 1CB7B 1SJCA 1TMQA 3CWNA 3N4EA 3VU2A 4E0CA 4HYWA 1ME8A 4RZBA 2G37A 2RJGA 6REQA 4P61A 5D2YA 2EEXA 4JTDA 1YPIA 3RRXA 1EOKA 1XLHA 1WDQA 2FDMA 4WOQA 8RUCA 3K8KA 3V5OA 3EXSA 3M0KA 3WLTA 1X7IA 3VO0A 3T81A 2OGYA 5DCEA 1E0UA 3LTPA 5C7HA 3Q2DA 3CZLA 1JNEA 4UTHA 1W3TA 2P3EA 4I9AA 1I45A 3AIWA 3EDDA 4IJCA 3RLUA 3VGEA 4R5EA 5IDIA 3R11A 2D69A 4HT3A 5C9UA 1O5QA 4ASTA 3RX3A 3W0KA 1V03A 1UPMB 3WLNA 3V5FA 2QPUA 2BOEX 1W1ZA 2RHGA 4QIUA 4YCPA 4B4FA 4QLJA 4EPDC 4ROPA 1F9CA 2DUZA 1PEZA 1UOKA 3IVTA 3MCNA 3LPGA 2WHLA 3EX1A 5F7UA 1XX1A 3N9RA 4GUIA 1KWGA 3BLOA 2FIQA 4DBUA 2JGYA 1H1ZA 1UQYA 3PG8A 1OIMA 5A6BA 1LDCA 2Y88A 2CW6A 5EJZB 5D9PA 3OLEA 4LUJA 1M5WA 4YVXA 1EO7A 3AXXA 1DOSA 1KR1A 2QJMA 4MWAD 1EWEA 1LJYA 3C0LA 3UT0A 1B3ZA 3ARZA 3VIMA 4HZ7A 2E25A 4DM1A 4F8XA 6XIAA 1REQA 3H2AA 2O7SA 4GG9A 1BGGA 2D73A 4LUIA 1BRLB 5G4HC 2A3AA 1PKLA 1ISVA 4HTYA 3O63A 4HK7A 3TK7A 2OT1A 4MY9A 3CASA 3S3GA 3FGCA 4H9XA 4N42A 1PCKA 1P7TB 3P0XA 3NYDA 2WZHA 5ECUA 1NSJA 1ODUA 3V16A 3TW7A 3O1NA 4AWUA 3MSRA 1XCXA 1Z7AA 1W3NA 3AYSA 1M1BA 1D7KA 2YPIA 4I8YA 1B3YA 3AMKA 4CNOA 2G0WA 1QPNA 1J0KA 4GC4A 4KT2A 3H2OA 1NJJA 3NXFA 1GOKA 3VNZA 2D0FA 2GSJA 3DYMA 1NFGA 1A5MC 1EKOA 3DFQA 3TONA 2PURA 2A3HA 1C7SA 4ROQA 3G1YA 3U3HA 1YXCA 1ZJBA 5C8BB 3GNPA 1D2KA 1OC7A 2WNWA 3HURA 1LG2A 2WVSA 4RXGA 2VMFA 3NL3A 3QW4B 4OOUA 4NNAA 5AKQA 1H60A 3SI9A 4GX8A 2B7NA 3O16A 3NM1A 3N3TA 5D8ZA 4U3AA 1TZZA 2W91A 1SZGA 2DT0A 2C1IA 3DI0A 2PWVA 4MLJA 1R85A 4X9YA 1A5NC 2GWNA 1GOMA 2PF8A 2PZ0A 3PJWA 1HQTA 1NOWA 1AJZA 5LA2A 3WX7A 3FN9A 3VZZA 2FTWA 3FAXA 1RR2A 3GXNA 1TFVA 3RITA 2GJXB 3GBDA 1K8ZA 4WCJA 3A23A 4J3SA 4QQUA 3GSMA 2DUXA 1HKKA 3BQ6A 3S1VA 4UNLA 1CWYA 4FX8A 1AQ0A 4O0KA 4AAJA 3RPTA 3RR1A 1ZNNA 4JN8A 2I9UA 1IWAA 4Q22A 2FGBA 3M0MA 4IICA 2Z7GA 3DX5A 3GR8A 5A8MA 3HTWA 1Q85A 2C79A 3CHVA 1ZAJA 4AVOA 1C9WA 2I14A 3COTA 3NGJA 3TV8A 3SRHA 2F84A 1SZFA 3KRZA 1L0PA 4I3GA 3R10A 3DG6A 3CUZA 1JCLA 1SMDA 3KTXA 1H7WA 4UC5A 2HEJA 4MF4A 2VRKA 5HNNA 1MQRA 4O54A 5A95A 3W7OA 2H8ZA 3UYIA 2V5KA 2G4FA 4R27A 1XLEA 3W01A 3TAKA 4MLRA 1S1RA 4QP0A 1Q2RA 1HFBA 2QF7A 3NZQA 3I68A 1US0A 4UQBA 1M6JA 1Q6RA 1WP6A 4PFHA 2J6XA 3LRLA 1BVZA 1JI1A 3IIVA 4C65A 4IUGA 3HV8A 3II1A 3GH7A 3UWZA 1UZ4A 5I77A 1GNXA 3CH9A 2CEQA 1KFEA 1FVPA 1MFVA 3U2OA 1TCMA 3GZ3A 4LOCA 1CTNA 3NOEA 2D0GA 1AL7A 3KAOA 1JCTA 3WH9A 1UP3A 1LCOA 3QR3A 4MKVA 5BWAA 4IFKB 5L6UA 4QDMA 1ZBWA 1W5MA 5C2GA 4ZE5A 4PUUA 4RV3A 1W1VA 2V81A 1RJRA 3MWAA 3UXAA 1X8FA 1XFCA 3IIXA 1FWDC 4HP5A 5XINA 3BOLA 4PTXA 2WK2A 4AHOA 1QW7A 2R1NA 3M0ZA 2JEQA 2BGSA 3KVLA 3DFSA 2WSYA 3IACA 4PCNA 4HOZA 5F2MA 1J96A 3U4AA 3WG6A 3DENA 4JTGA 2ZZ7A 1PO9A 2DZVA 3U4FA 5CG0A 3BJSA 1DJGA 3PTKA 4XUYA 3WH7A 1YTDA 1QMLA 1ZCOA 3WSUA 4XAFA 1KXTA 4L80A 2GQ9A 3B9NA 1X6LA 1Q3NA 1XLJA 1BQCA 2C7FA 1I0DA 3MVIA 3LGDA 1ECQA 2V69A 1R3QA 2XH2A 4JTCA 4DJED 3USBA 3BLKA 3W7CA 1EEPA 5BXRA 3TOYA 3KLKA 3VCRA 1DXFA 3RNDA 4PCPA 2Z00A 4GWEA 3VIHA 1RY0A 1VKFA 2CXEA 2X05A 5DMNA 1GWJA 5A5WA 2C16A 4DZIA 3NQVA 1N8FA 3VGBA 1S5TA 3PZTA 1FWWA 1KFJA 4DUOA 2PU0A 4ILSA 3E5BA 3URBA 1AG1O 3EWWA 3AZSA 2ZWZA 3QZAA 1YE4A 1K9TA 4LWWA 1ME7A 3TWBA 2I7GA 2PE4A 4YTSA 4ZEPA 3E6EA 5AC4A 1A53A 3KZSA 3M41A 4O0ZA 3W2UA 3TMLA 4WY0B 1EH9A 1P0NA 1HVQA 4S2CA 4LUYA 4PMJA 4ORIA 3L4ZA 1GG0A 3TZFA 2HE8A 4POCA 2E6DA 5AYBA 4JYFA 1VFOA 4O4WA 4YWSA 4XSLA 2ZA3A 4U10A 4JKLA 4B5XA 4Q4RA 4F40A 5C2CA 1JPHA 4JQ4A 4C91A 4AD3A 1FKXA 3T55A 1O6IA 4DO5A 5CGMA 3CMGA 3EA1A 4WDXA 3W24A 1G5AA 2YDQA 2W66A 4WUIA 1RA0A 4LEQA 4IPJA 1J0HA 4QS6A 4DVOA 2YSWA 4JTHA 2ZRZA 2XGBA 4DO7A 5D33A 4JIEA 2NLIA 3CNYA 2BWGA 2DQWA 3REQB 3H2NA 1S2TA 2QAPA 4IFRA 4V33A 2QV5A 4JQ2A 2BGNE 3P8IA 2OWXA 4Y9MA 5AZ1A 4L6HA 1QO5A 1J0ZA 2A3CA 4YIWA 1E6XM 1W17A 1EPVA 1ADSA 3QY7A 5I3KA 1WKFA 3WLSA 2ANUA 5CZTA 3GB6A 4XIMA 3WQWA 2V5JA 3IJQA 1HP4A 1JVNA 4UOQA 1KTBA 4BCEA 3VOJA 1THFD 4RPPA 5ABGA 2HVNA 2Y5EA 3PPGA 2HK1A 1WBJA 4FZIA 3PWIA 4PRWA 1BWKA 3HA1A 4I6VA 1FHUA 3N6QA 3E3HA 4LU0A 4H2HA 2VDGA 3OHIA 3STCA 2NT1A 4HSHA 2VENA 3QMTA 4HYVA 3RJYA 8TIMA 1TWWA 1V6UA 2P1FA 3ERPA 2H9AA 3BG9A 3S6TA 4IF2A 4Q4OA 5EPDA 1WPCA 3RILA 3NQEA 3VAVA 4NXKA 1XP3A 4NJJA 4LAKA 4NJHA 2X2GA 1TX2A 1AA1B 2QDGA 4AX6A 1RPXA 2PLKA 3B9EA 3ITCA 4K8GA 1S1PA 5I3DA 2BY0A 3F2BA 3MKKA 3A5FA 2ZZ4A 3ARVA 5HR7A 1TKKA 4S3DA 1X39A 1WXJA 1RJPA