3OZPA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with pugnac
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-acetylglucosaminidase
publication title Active-pocket size differentiating insectile from bacterial chitinolytic beta-N-acetyl-D-hexosaminidases
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase/hydrolase inhibitor
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ozpA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3ozpA01
1JNDA 4PSPA 1R7AA 3UESA 1UH3A 1XSKA 3GDBA 3N17A 4UQCA 1E1FA 3MV11 4ML4A 2ZICA 2V5DA 1GNXA 1WE5A 5EBAA 1QNRA 4M82A 4AYSA 1UH2A 3F5LA 3FW6A 3VINA 4KRUA 3WBAA 1K6AA 4J7RA 1B90A 1H49A 4WK9A 1PX3A 4AZ7A 3NDYA 4GO9A 1EOKA 4PTMA 5FIPA 4H04A 4RL3A 4HA4A 5CPTA 1MW0A 2GJRA 1XCWA 1AVAA 2CESA 3MO4A 3BMWA 5FOOA 1E15A 2XIIA 4F8XA 4J3TA 2YOCA 1OD8A 2CIPA 3BGAA 4AZIA 2A3EA 1CTNA 4D6CA 1BAGA 1V3HA 1JZ4A 3W6LA 2X0HA 1MVYA 3CZKA 1K9EA 1XSJA 2J75A 2VZUA 5A3HA 2CHOA 3ARVA 2CBVA 2WKGA 4AZCB 4HPGA 1W2VA 2ZWZA 1E4MM 3WH5A 4GO8A 2WNWA 2YKKA 2E9LA 1U30A 3PBGA 7TAAA 1R7OA 1V6UA 2YL9A 2C7FA 2XVKA 3MUAA 4EAMA 3TTSA 3WD4A 1EQCA 2BV9A 2ZXQA 4U3CA 3SUUA 4UQ9A 3T0BA 4L4OA 3T0DA 1PAMA 2WZIA 3A4XA 3OGSA 3VDHA 2G8ZA 5A6AA 1ZB5A 2B31A 1HJSA 3VX1A 2O9RA 4OOZA 3GM8A 4A3HA 1GCYA 4AZ6A 1B2YA 3PZQA 1BG9A 3UETA 1ECEA 1ZJBA 4PBGA 3VGGA 3ZMRA 1QI0A 1VB9A 3T2QA 1MXDA 1UZ4A 2ZUWA 3POCA 3ZSSA 2DEPA 4DM1A 1XYZA 1I75A 3DC0A 5FL0A 3WDQA 3PN8A 4B3KA 4IM4A 1ISWA 3MSDA 3VX0A 3D3AA 2J62A 2BS9A 4FLRA 1M01A 1JG9A 3N13A 2VTFA 2D24A 2ZUMA 7CGTA 3CUFA 1JI1A 2UY4A 3GNRA 3GH7A 1TCMA 4CCCA 1E40A 3WF4A 1JFXA 4S3JA 4N0RA 2ZX9A 1VEMA 3CMJA 3RO8A 2G3NA 5DF0A 3HJEA 4H8VA 1QHOA 1B9ZA 3TTOA 1OIFA 4KH2A 1C8QA 1TA3A 3UEQA 5TD4A 1O7AA 4BA0A 1H09A 4JKLA 2QLYA 4TVDA 3WH8A 2WZHA 2E0PA 4DWSC 1F4HA 3WSUA 2W66A 3CTTA 1KR1A 2F61A 3AIEA 5D9NA 1E56A 2NSXA 2XGBA 1FA2A 1FH8A 1TG7A 2E40A 1WP6A 3WFLA 4B3LA 4ZENA 1NM9A 5JUVA 4PTXA 4F66A 4UQBA 4QCFA 1OINA 3AS1A 3K8KA 4M1RA 1QNOA 4MDOA 2G41A 3WMSA 2TAAA 5A8PA 1E6ZA 3AXIA 4HPHA 4E8CA 1EDGA 4UQDA 1MXGA 3MMWA 1LL7A 4PMQA 1BVNP 3G6MA 3AQUA 1UYQA 5I77A 1H4PA 1EGZA 3WMBA 3B9AA 5HPOA 3T0AA 3M7SA 3RILA 5HNNA 5A6JA 3DECA 3WNOA 5I78A 3GZAA 1E6PA 3VIJA 5JBEA 2JFEX 1UG6A 2XVNA 3PTQA 1ZBVA 3BH4A 1TR1A 1OM0A 4JCMA 4PRWA 1JXJA 2BFGA 4JL2A 1HVQA 3QHNA 5M17A 4H7VA 3SUSA 4CN1A 4F79A 2D0HA 4XZBA 3WY1A 4PMZA 3BAIA 4AY1A 1NOWA 1XHGA 2AAAA 1B31A 2NW0A 3CZLA 1JF5A 1XGZA 2W61A 1TFVA 1CXIA 5CG0A 4U3AA 1P6WA 3SCWA 3VIKA 1UD8A 5I3DA 2PWGA 1M7XA 5M5DA 1VFMA 1G0CA 5BCAA 1UR8A 1OCQA 2WVTA 2YLLA 1OT1A 5C71A 4LX4A 3WEZA 1BGGA 1E6RA 1OSEA 1VF8A 5A8OA 1CNVA 4GI9A 3ARWA 4GI8A 2ZUTA 4QLJA 3DHPA 3THDA 2VVSA 3EMZA 3PTMA 1WDSA 3K1DA 2F8QA 3VDBA 2Y8KA 3RIKA 1WDRA 1GONA 2Y4SA 4W5ZA 4CU8A 1HXJA 1WZMA 5GQBA 1BG4A 5A1AA 1JZ8A 1CLXA 2WLYA 2VOTA 3VIGA 3FXYA 3BAYA 4YN5A 1CXKA 5HDRA 2X09A 5I79A 4TXEA 1US2A 3EDJA 2ZUNA 2CXGA 3GXMA 1LG2A 1C92A 1VBRA 2WWCA 2CYGA 1I1XA 1PJ9A 3LPFA 1V03A 1ZBWA 4M29A 3N11A 1M03A 4QP0A 1E4LA 3ARUA 4MNLA 3BLPX 2J7FA 1KGWA 1SMAA 2FGZA 1W3KA 1J0IA 5E0FA 3AIBA 1HNYA 3AIVA 2WLZA 3UR7A 2WW5A 3AZTA 3DYOA 3AS0A 5KZ6A 5ABHA 3ARPA 1D2KA 1OD0A 4L4PA 1GPFA 2IUZA 1JD7A 3L2LA 5IXEA 4U31A 4AD0A 1FFRA 4M24A 4AZ5A 1B3WA 3ARSA 2PWFA 4CGTA 2J74A 4S3KA 1LLOA 2YDRA 4PMRA 1LQ0A 1QI5A 1UR2A 1XCXA 2XM2A 5LYRA 3ZO9A 1ISZA 1K9TA 5FD0A 4QLKA 4Z2IA 1K9FA 3UERA 7A3HA 4AZCA 3MS8A 3GYCA 2D3NA 3T09A 3L4YA 1DHKA 1XC6A 1NARA 2X2YA 3AHYA 3PTKA 3QGVA 2QPUA 4D72A 1V6XA 3A4AA 3W82A 4M8UA 3D5HA 3SUTA 3VVGA 4CD8A 2ZOXA 4J3SA 1C7TA 2XIBA 3EMCA 4DM2A 1BFNA 3WQ5A 1UKPA 2OWCA 2XFFA 3I3BA 3LMYA 2DSZA 2D20A 2O9TA 1HN1A 4PMVA 4E4PA 1HKKA 1HJQA 2NT0A 3GNPA 4JL1A 1KB3A 2YBTA 3GXIA 2O9PA 1B1YA 6CGTA 4HMDA 5BWFA 1JZ2A 2ZIDA 1EQPA 1V0MA 4HMCA 1UA7A 1ITCA 1EH9A 3IAPA 3NSMA 2D23A 1JNEA 2EPNA 1W9UA 2YJQA 4MNKA 5BXSA 4X0NA 3FNDA 3MUIA 3SCQA 1H0IA 1QHZA 4WSJA 3L2MA 1LJYA 3ZJ8A 2XSBA 2CCRA 4HA1A 4Q22A 2EPKX 1FP8A 1JYVA 1BYCA 3CGTA 4MNJA 3APGA 1UA3A 1JI2A 3WH7A 1U2YA 1H2JA 2BY0A 1UD6A 5D9MA 3WEMA 1J0KA 3BAWA 4TVCA 1E55A 3VM5A 3OLDA 4B9YA 3OA5A 4FLSA 3QOKA 3TOPA 1DP0A 3KWXA 5AC4A 1JZ5A 1J0ZA 3MANA 4MJ4A 1CGTA 1GOWA 2EPMX 5CSYA 1JDCA 1WCGA 1VFOA 4BCEA 1E6SM 2VO5A 1E6QM 4D71A 1B3XA 1BYDA 4BQ2A 3GXFA 4IISA 1V0NA 1BF2A 2X0YA 1BHGA 1E73M 5CQ1A 5A8MA 1A47A 2O9OA 3AJ7A 3KE0A 1H1NA 3AYRA 3NSNA 1QHPA 4U5KA 3A4WA 5IHRA 2VX7A 4YPJA 1W3JA 3ZIZA 2BHUA 4ACYA 3ZM8A 3A6OA 4TTGA 2XGIA 2FH6A 5DT7A 3WDHA 3PZ9A 2DDXA 1SFSA 4TX8A 3WN6A 4W8AA 3W26A 5E9AA 4CKQA 1Q6CA 1GORA 2W62A 1D3CA 1VEPA 4WKAA 2XHYA 4JCLA 3NYDA 2VNCA 2WCGA 3AMCA 1G1YA 4ZXLA 3UG3A 4PN2A 2BY1A 2D0GA 3CUJA 1W3LA 3SCSA 5BRQA 1DTUA 4Z2KA 1R86A 4D1IA 2BHYA 1IZKA 1GJUA 3BMVA 4TVUA 2GJXB 1E6XM 2D3LA 4JFVA 3VM7A 1GVIA 4AEFA 5IFPA 1MQPA 5E70A 1R87A 3FHAA 3MKKA 1KXTA 2WVVB 5DMYA 1E1EA 4W84A 1CZ1A 2EO7A 3CHCA 3S6TA 2OYLA 4KWUA 4JFSA 1GZJA 1HKIA 1W91A 2J7CA 4QDMA 1KXHA 2G3MA 1WZLA 1KFWA 2FHCA 1X1NA 3VTRA 1W2PA 3ALGA 1VAHA 1J0JA 1PX4A 2PC8A 3AOFA 3WD1A 1VENA 2Y2WA 4D6IA 3SCRA 2XFRA 3ZQ9A 2DIJA 1HJVA 1BQCA 2C0HA 3VIHA 1DWGM 1OBAA 4B15A 2YL6A 1ZJAA 4HA3A 4P7LA 2OSWA 4PMXA 1H11A 3SEPA 2VRKA 2J7HA 3AROA 4RE2A 5AYIA 5C70A 3M6DA 3VOCA 2BVDA 4CVWA 1FH9A 2J7DA 1C90A 1XD1A 3SCUA 1PX8A 3RM8A 1TZ7A 4UNIA 3VGHA 2XG9A 1EIBA 5A6LA 2DGAA 1MYRA 2E8ZA 1CDGA 4AIUA 3SCPA 1G94A 1IT0A 2FH8A 1TVPA 1WDPA 1W9VA 3RMEA 3G6LA 1C7SA 1CYGA 2VQTA 3VIFA 4J3VA 2YDQA 2W63A 5CLWA 4HTYA 3AMGA 4PEEA 1B3ZA 3OGVA 4W86A 8A3HA 2W5FA 4JKMA 2XYLA 4ZE4A 1JYNA 1ODUA 3AHZA 2C8NA 1DWHM 5LA2A 5IFTA 3VD9A 1VBUA 4W89A 3SCOA 4BQ3A 5F7UA 1KWGA 1JZ7A 3E1F1 3CUHA 4D6FA 3GXDA 3DYMA 1JDDA 4OKDA 3VUPA 3OGRA 2GFTA 5EFDA 4JHZA 3MUY1 3FAWA 3ZJ6A 2VMFA 4MB1A 4WKHA 3W25A 1OGGA 3BLKA 1ISYA 5IDIA 1UR4A 4AD5A 3KL3A 1QNSA 2XVGA 4IPNB 2J78A 2WMKA 4WKFA 4D6JA 1LF1A 2ZX7A 2J77A 1YHTA 1VEOA 1Q6GA 2WBKA 1VJZA 4BQ5A 3CZGA 3IJ8A 1JAEA 4UQEA 1VFUA 2J7GA 1XSIA 1UD2A 5GNZA 2IXUA 2J8FA 3CHFA 4A3YA 2RGLA 2VQUA 2ZE0A 4Q7NA 1CGWA 3ZSTA 3TONA 3TTQA 4RE4A 1V3IA 3WDJA 1ISXA 5I23A 3WUFA 4OUEA 5GPRA 5CSUA 2WAGA 2PWDA 3UG4A 3WF1A 5I2UA 2E8YA 3W53A 4HMEA 1E4IA 4AD4A 3N9KA 1J0HA 1Y7VA 3VIPA 4RE3A 4XV0A 1E6NA 3PZGA 1LL6A 4WLCA 2VL4A 1B3YA 3DHUA 3CZEA 1W9DM 3EDDA 1UUQA 1HF6A 1MFVA 2CPUA 1DWFM 5BRPA 1D7FA 3W28A 5BXPA 3AICA 5D9PA 4U33A 3OLEA 2ZUUA 1B0IA 1MFUA 1ESWA 1IV8A 4JAWA 2JF6A 1QI4A 1W9BM 2E3ZA 1E70M 2Q8XA 1UQYA 4JFUA 2VCAA 3PZVA 3OG2A 3KEHA 2CEQA 1Z32X 4W88A 2ZUSA 2V3DA 3QHMA 5D4YA 2Y8VA 4UFJA 2W92A 4PUEA 3IANA 4UFIA 1RPKA 2BXYA 3CLWA 3VIMA 5HBFA 1JAKA 5CJ5A 4BS0A 4TX6A 4C7DA 5CGMA 4UOQA 2JALA 1W1YA 1BSIA 2BNJA 5A2CA 3U5YA 3NJ3A 4GZIA 2WHKA 1UR0A 3RDKA 3WH6A 3MUZ1 4ACZA 1HVXA 2WVUA 2OWWA 4H41A 4MNMA 4CD5A 4GPNA 3CZ8A 4W85A 1PZ2A 1J10A 3CZJA 1SR0A 4W8LA 3EDKA 4UFLA 1JL8A 1B30A 1NP0A 3AISA 1UKTA 1EOMA 1FH7A 2JIWA 2WMFA 2BHZA 3L4WA 3WIJA 5AC5A 2DSWA 2J79A 1W1TA 3VPLA 3AMDA 4UQAA 3L4VA 3WDPP 1NOFA 4BQ4A 3OIHA 1MW2A 1NWTA 3WENA 4QCEA 4LQ1A 1HKMA 4P7QA 1E3XA 1LL4A 3HMCA 1KGXA 4JHOA 5A8QA 1TMQA 2GDVA 3WQ4A 1JZ3A 4AIOA 3EMQA 2WCSA 3AYSA 3AMLA 4NF7A 2X05A 1TUXA 5GNYA 3K46A 1GOMA 5A6BA 4CCEA 2PBOA 3WL1A 4GKLA 2NT1A 4JFWA 5DFAA 1SYTA 3TP4A 3RCNA 4UR9A 1PZ3A 2GVYA 3CMGA 3T08A 3W37A 4MJ2A 1BGAA 3RJYA 4GIAA 4W5UA 1YQ2A 5A94A 1E5JA 4F9JA 4E8DA 5CPQA 1RH9A 4GQQA 3VIIA 5JIPA 5AYBA 4C7GA 4OJYA 4PMOA 2ZX8A 3WNNA 2VZTA 2YIHA 1AQ0A 4PTWA 1E0XA 1GW1A 1NH6A 1NP2A 4WSKA 2GJXA 1UR9A 3NIYA 2ZX5A 4PCSA 3ZT7A 3ZOAA 1F4AA 1EA9C 4AW7A 2VZVA 4DWSB 2WVVA 4ATDA 2W91A 4LYPA 4LXFA 4Y7EA 4A4AA 3ARYA 3VMNA 5HPCA 4K68A 5A95A 3CPUA 1GOKA 4WIWA 1G5AA 1CGUA 1QNPA 3NCOA 1KXQA 5I6SA 1CPUA 2BVYA 2VZSA 3WKZA 4UFHA 1VFFA 4AMCA 1NQ6A 2DQXA 1KXVA 2WMHA 3ZJ7A 1MQRA 4W8BA 3K8LA 1A3HA 1ISVA 3KL0A 5A2BA 4MAZA 2JEPA 4QFUA 1VIWA 4AC1X 1EDTA 2FHFA 2QMKA 3AHTA 4MAVA 1TA3B 1KBBA 4KGJA 3CHEA 1BVZA 5GNXA 4MPKA 3SCNA 2DH3A 3W81A 3PZIA 4NSBA 1V02A 4DUWA 1OT2A 3RPMA 3B9EA 1V0KA 2CHNA 3VKKA 3SIMA 1UWTA 1PIGA 1BLIA 2UY5A 3WDRA 1HP5A 1GJWA 3MV01 3THCA 2AOSA 1L8NA 1JDAA 1QW9A 1CXHA 1HJUA 3U57A 1EDQA 1EO5A 3K4AA 1JYWA 1R85A 3WD2A 3VD3A 4AD3A 1QVBA 2X1IA 1GHRA 3WQVA 4Z2HA 1ZBKA 4ZXOA 5D8WA 4P8XA 3EDFA 2BXZA 1OGSA 3AXHA 1JXKA 5CPSA 1FOBA 3NUKA 5E0CA 3ARRA 1MW3A 2QMJA 2VVNA 4J3WA 5EB8A 2EEXA 3CHDA 4D6HA 5M03A 2WHLA 4MB4A 4MTVA 3PZOA 5A69A 1MW1A 3N04A 4KMQA 3NDZA 2WVSA 4AISA 1J12A 5FKYA 2WB5A 2E9BA 1J11A 4AXNA 2OSYA 4ATLA 2J47A 1PPIA 2WHMA 4PMNA 4NI3A 1CLVA 4ZFMA 2BY2A 2EBNA 4HU8A 3W29A 4J28A 2VUYA 1WPCA 3O9NA 4W7UA 3WNMA 1QBAA 4MB5A 1V3LA 3U5UA 4ATWA 3ZT6A 4X9YA 3WUEA 1E71M 3WD3A 1UWUA 1PIFA 2GUYA 1KCLA 3UG5A 2ZXBA 3M07A 4W87A 3B8SA 1C93A 3PZTA 1JD9A 3RM9A 1HT6A 4PTVA 4B16A 2EQDA 2DSUA 4JFTA 4Z2GA 3L4XA 2G4FA 3VGFA 5M3WA 5D9OA 2CETA 2J7EA 1BTCA 3TTYA 3AS2A 2JF7A 2XUCA 1KGUA 4HP5A 2GK1B 1KBKA 2J8GA 1WDQA 5IHSA 4XX6A 3RJXA 2HVMA 1QNQA 2YL8A 1TVNA 2WKLA 4FLQA 4TUFA 3MMUA 3JUGA 4UOZA 2DT3A 3ZT5A 2VCCA 4EK7A 2CNCA 5I0DA 4J3XA 5CGTA 3W4RA 2V5CA 3ZJKA 3MU7A 4HU0A 4PMUA 2EXOA 3AI0A 2CKSA 3MMDA 2FHBA 1OIMA 3AHVA 3CO4A 3U7BA 1FHDA 4Z2LA 5ABEA 3BSHA 4ZE5A 2WM0A 1ZS2A 3K4DA 1S46A 1V3KA 2WBGA 2YDSA 3SCTA 4URIA 1HJWA 1UZ1A 1EXPA 1AMYA 4H8UA 3KL5A 1KQYA 5DEZA 5KEZA 5DT5A 2CITA 5CXPA 3WH9A 1UKQA 5A6BD 3A3HA 2QF8A 2D2OA 4HOZA 3ARTA 5E6YA 4XB3A 3CIVA 4CD6A 1MQQA 2G3JA 2DH2A 1WNOA 2VC9A 4NZCA 1CWYA 1PBGA 1I1WA 1NOUA 1W1PA 1QI2A 1V08A 2WMIB 2PF0A 5BYWA 1HIZA 3QR3A 2OSXA 1E4NA 3DYPA 3EDEA 4V27A 2QPSA 3N15A 3SUWA 4UFKA 3OLGA 4PUDA 5BXRA 1WAWA 3B9DA 3FAXA 3BAKA 1C3FA 1GQKA 3GH5A 4MADA 1UOKA 3WUBA 2ZXDA 3F5KA 3II1A 5EMYA 3W24A 3K8MA 1B3VA 1E9LA 4XUYA 3AIWA 3GBDA 4AZBA 2VX6A 4HZ8A 1UD4A 3BAXA 3WQWA 1TE1A 5FL1A 2A3BA 1M04A 1CGYA 1DWJM 4CU7A 3U7VA 3OB8A 2WXDM 3WL0A 1GUVA 2CKRA 3WQ6A 3WNLA 2F2HA 1G9HA 5AY7A 2XM1A 3ZR6A 3WQ8A 1KR0A 2WYSA 2DSVA 3BC9A 4DWSA 3NSXA 1XH0A 1JIBA 2E9MA 2YA2A 4M56A 4EANA 1W9XA 1NWUA 2V3FA 4M81A 3CUIA 1VJSA 1CXFA 1KWKA 3VGDA 4UZUA 4U2YA 1US3A 2A3CA 4B9ZA 1V6WA 4IPLA 3IK2A 2DPEA 4QAWA 4N42A 2V3EA 4OOUA 5E09A 3VD5A 3WELA 1GHSA 4R5EA 3WF2A 1UHVA 2OLHA 3N12A 1FFQA 3BAJA 4AZGA 1ZBCA 3WF3A 1XH2A 4QLLA 3WF0A 1N82A 2AMGA 2XVLA 1WO2A 3WMCA 1K9DA 3ARQA 3HN3A 1VRXA 5EFFA 3IAQA 1QPKA 1E0WA 1UD3A 4PMYA 1Q6FA 1LG1A 4GZJA 4GI6A 2D0FA 2ZX6A 3L4TA 3BCDA 2IXVA 4TOQA 5BXTA 3AZSA 4PSRA 4U5IA 3L4ZA 3MSGA 1E72M 8CGTA 1CGXA 1XRVA 4EE9A 2PWHA 1BYBA 1E0VA 4CU6A 3W38A 1V3MA 2G3IA 2DT1A 4CN4A 1OB0A 4C91A 1LWHA 3VU2A 2BVTA 5ABFB 1LWJA 4D6EA 3VGBA 4UOJA 1H41A 1CENA 2WPGA 3W0KA 1E3ZA 1W32A 2WSKA 2W4XA 2A3AA 2MANA 1C91A 5CZKA 4C7FA 3QOMA 3GTNA 1ITXA 1UWIA 1QBBA 2D1ZA 3AIRA 2WC4A 2PWEA 3VD4A 2BY3A 4C90A 3FHQA 2UY3A 2ZUVA 3AZRA 1HX0A 4UTFA 3AIQA 1J0YA 3L4UA 2CBJA 3TA9A 2HISA 2Z1KA 4P8VA 2EPLX 1X6LA 4PMDA 4H2CA 1HJXA 2VX4A 1UD5A 3KZSA 3WNKA 1ZL1A 4D6GA 5C8BB 1EO7A 1QI3A 1BPLB 1J01A 2DIEA 4GXPA 5LA1A 3AS3A 1JF6A 1CIUA 2WANA 1V3JA 5JBDA 1L0PA 3AMKA 1AQMA 4DUVA 2XSAA 2QV4A 3VDAA 4HZ7A 1GVYA 5ECUA 3A47A 2ESCA 2VZOA 2EJ1A 1U33A 1C8YA 3GBEA 2WMGA 5A6MA 3FN9A 1H5VA 3WNPA 3T2OA 3ALFA 3LPPA 1NWRA 1W9PA 2PI6A 4V2XA 2XWDA 4CD7A 4AEEA 1JFHA 4LPCA 2UY2A 4PCTA 1CGVA 2PBGA 4LYQA 4W93A 3VIOA 3CUGA 2GK1A 2JE8A 3RM4A 1OGBA 2WK2A 2CBUA 3PZNA 1XH1A 1CEOA 1E5NA 1HL8A 1R8LA 3PHAA 1UWQA 5A2AA 1BYAA 5BROA 3N18A 1WZAA 1UH4A 3ARZA 2YA0A 1WKYA 5JIWA 4CCDA 2WMJA 3GH4A 1V02E 2DT2A 4P7RA 4IUGA 4W7VA 4FMVA 5LA0A 2VT0A 4YHGA 2GSJA 3UCQA 3BCFA 1QOXA 1Q6EA 3IJ9A 3I3DA 2Z1SA 4JIEA 1EHAA 4P8UA 3VD7A 2PB1A 3VNYA 1C8XA 2WZEA 2V3GA 2VX5A 2YLAA 4UZSA 3VO0A 1UWSA 3WBEA 4OBRA 3OZOA 3N1AA 1ZU8A 4OZOA 1RP8A 5ABGA 4OBSA 3S2CA 3VGEA 3VMPA 2VRJA 2XTKA 1V6YA 4D6DA 1UKOA 2Y24A 3QHOA 4UCFA 2J7BA 3EYPA 1DWIM 2DSKA 1J9YA 4PYSA 4GZEA 5CLTA 4YHEA 2OYMA 4D1JA 3I3EA 4FF5A 1UQZA 2ZWYA 4WF7A 2WMIA 3AFBA 2JEQA 3ECQA 2XFYA 4AD1A 4FK9A 2XPKA 1X6NA 2WCAA 1W1VA 2CERA 1CXEA 1UKSA 2QHAA 4HZ6A 4M80A 3SCVA 2VURA 1O6IA 3W27A 1NWSA 1QW8A 3AIUA 4DWSD 2V38A 1KQZA 3CBWA 3OZPA 4P7OA 1UR1A 2O92A 2VCBA 2X8RA 6TAAA 3OLIA 5I5RA 4BF7A 4GQRA 1H3GA 1HL9A 1XYFA 2YBUA 1DEDA 1WB0A 4MDPA 2OWXA 4LGXA 2J25A 1M53A 2J4GA 3PZMA 4TTUA 1FP9A 2VR4A 4CUCA 4LYRA 2CBIA 4H8HA 1E43A 1SMDA 4WJXA 3SUVA 3HU7A 1WZKA 1GOQA 1MWOA 3WDIA 4P8WA 3VNZA 4MB3A 3OBAA 4DUXA 1G01A 2WC3A 1GQIA 5A6KA 5JBFA 4CD4A 2WSPA 4JKKA 4P7NA 1V0LA 3W6MA 2FGLA 4CN6A 3IJ7A 4V28A 5I24A 4JZ5A 4HOXA 1IZJA 2WC7A 4E2OA 3VDCA 1PEZA 2JIEA 4AD2A 4AWEA 2VJXA 1Q6DA 2XVPA 2W67A 2FDMA 4J3UA 3WD0A 2Y5EA 4NRSA 3AXXA 4F9DA 1KCKA 2YL5A 1XV8A 1CBGA 1CECA 4GINA 9CGTA 2GJPA 3CH9A 1GQJA 2A3HA 1AQHA 1GQLA 3PZUA 5A8NA 3F5JA 5HOSA 3BXWA 3UR8A 3T2PA 1Q4NX 4ACZB 5DO8A 1FHLA 1CXLA 2VR5A 2D22A 3J7HA 1EHNA 2EPOA 2UWFA 3VILA 2RGMA 1RP9A 3EBVA 1JGIA 2XJ7A 4AZHA 2YA1A 2WWDA 5HXMA 3BSGA 2ZXAA 3WUGA 4KGLA 2OYKA 4XZWA 3SURA 4HOWA 5A6SA 2XWEA 4Z2JA 3AHXA 3M46A 1DWAM 3LPGA 3POHA 4W7WA 3FY1A 5ABFA 2VRQA 3GNOA 3ZR5A 4ZEPA 1GOIA 4J27A 4KRTA 4AIEA 3VMOA 5FCZA 1HKJA 1ODZA 3WFZA 4R27A 3O2LA 4CVUA 4NRRA 1RD6A 3O6AA 2DT0A 1JZ6A 1J18A 5E6ZA 5D8ZA 3F4VA 1JYXA 4BZYA 4FLOA 1V6VA 1UWRA 1W3HA 4OIFA 2E4TA 1OWQA 6A3HA 2GDUA 2WHJA 1H0GA 1HP4A 1GOOA 3ARXA 1XD0A 4U2ZA 4X0VA 3LPOA 2VI0A 4UFMA 4EKJA 3WEOA
chains in the Genus database with same CATH superfamily
4JTRA 1RCOB 4HNLA 4DWDA 1LLZA 3M47A 3UESA 1Q45A 1XSKA 3GDBA 3MV11 4GQGA 3B3DA 4CEUC 4WDTA 3L5LA 1WBJA 3GG1A 4M82A 4NXKA 1UH2A 4AYSA 4KRUA 1WV2A 4WK9A 1H49A 1PX3A 4AZ7A 4GO9A 1SM9A 2A6NA 4H04A 5G4WA 2GOKA 1UC4A 4HA4A 5HQEA 3VFCA 5AOUA 2CESA 2GVEA 3IEBA 1IGSA 2H9AB 1LUCB 1AH4A 1OD8A 4WEVX 1BWVA 4ROQA 1WX0A 1V3HA 4YIWA 1VS1A 2QYGA 1GWJA 3HQNA 1F6PA 2HWGA 3A21A 3CZKA 2VZUA 1TJ1A 4G7EB 2UV8G 1TRDA 1B5TA 4AZCB 4EVZA 4C6DA 2WNWA 5AYXA 2YKKA 1U30A 4WY0F 4IIBA 2YL9A 1EP1A 4EXBA 1O60A 2C7FA 1K6WA 3MUAA 3C3UA 4H6RA 3W70A 3JS3A 2BV9A 1XICA 4GQBA 4ADTA 4UQ9A 3T0BA 2ATSA 3T0DA 3WLLA 1EJRC 2HNEA 3VDHA 4WGXA 4A3QA 2HQAA 3TNBA 3PZQA 1BG9A 2HK1A 5J5DA 4Q3MA 3CMFA 1NY1A 1F9CA 3PNUA 5CPLA 1VB9A 4DBWA 1ZP3A 2VWTA 1UZ4A 2R8WA 2ZUWA 5D2XA 4HJWA 1SW7A 2B4GA 3MDWA 2HPIA 1OQFA 3WDQA 3PN8A 4J5NA 1FWEC 3D3AA 4O53A 2CZVA 2ZZ4A 4EPKA 4FLRA 1M01A 1N8FA 4H00A 3N13A 4GFSA 4DJFC 2VUNA 1TWIA 2D24A 4Q8VA 3EOSA 3CUFA 3RX2A 4EACA 2DZUA 4RR4A 2QUTA 1QHOA 3TYCA 3TTOA 4C6QA 3UEQA 3DESA 1H09A 1KM4A 4QG6A 1LZOA 3I65A 3RK8A 4UBPC 3IV8A 3IJDA 1NTHA 3WSUA 2W66A 3PG9A 1FWJC 1KM5A 4K1GA 3QV8A 1F3TA 1E56A 2NSXA 1FA2A 2PP3A 4B3LA 4ZENA 4UQBA 3K8KA 2DZXA 3CQHA 1QNOA 2G41A 1PKMA 1FX6A 1E6ZA 1SVDA 1PL9A 1DQXA 4D8LA 4E8CA 4UQDA 3P74A 3MMWA 3M0XA 2EHHA 1H4PA 1ADSA 2E5BA 1PDYA 5IBXA 3RO6A 3K1GA 5A6JA 1HZYA 3VIJA 2PTXA 4QJ5B 4IJCA 4QR6A 2PDWA 2YXXA 1TPH1 2YW3A 3I68A 4AC7C 1WAUA 2FJKA 4O54A 4K7VA 2DVXA 4C1KA 2DQWA 1TPC1 4HHHA 3U48A 4IMDA 4A2RA 1U22A 4YXGA 3LN3A 3ZXWA 2E5CA 4J35A 3FOKA 4H7VA 4RK8A 4CN1A 2D0HA 1ME7A 3BAIA 1X1OA 3ITTA 1EWDA 2AAAA 4RXGA 1DXIA 3CNYA 5FEWA 1JF5A 1TFVA 5CG0A 2C13A 2BDQA 1V6TA 4U3AA 2RDTA 1HO4A 4KT2A 1UMLA 4ES4A 2RAGA 3RYSA 1ZRQA 3MI2A 1G0CA 1IEVA 1OCQA 3HPZA 3DH7A 4Q8UA 4NZ4A 3FYPA 2DZPA 4PUNA 2G5WA 1A0EA 4OQVA 5C71A 3FVDA 2GQ3A 4GI8A 2ZE3A 2J9ZA 4GVIA 4MPQA 5FSDC 4YVVA 1YRRA 4BEUA 3DHPA 3CB8A 3THDA 2I5QA 1EIXA 5FEXA 1HG3A 3RIKA 2Y4SA 1CLXA 1HKWA 2WLYA 3A22A 4RV8A 4OV9A 1LRQA 4HCHA 4M7TA 4GCAA 1R2SA 1OF8A 3M5VA 1JULA 1N8IA 1VBRA 2XZ9A 2CYGA 2PF8A 3QV9A 2FJUB 4F0HA 3GRIA 1ZBWA 4S23A 3IIZA 1LP6A 2FGZA 4M6VA 1J0IA 2E09A 1UROA 3PANA 4LVBA 2YCLB 2WW5A 2EG7A 2BVWA 3T78A 2AL2A 3DYOA 2I5GA 1MXSA 2XN2A 2AGKA 1UMYA 1S39A 1JD7A 4AVFA 1TPVA 1EBGA 2C1GA 4FX6M 3QYQA 3O7UA 1FFRA 4M24A 3NQEA 2F6KA 4INFA 4IP4A 1PDZA 3A9IA 2ZKMX 4IX2A 1I6NA 2ANUA 4S3KA 1K3UA 1LLOA 4PMRA 3UA4A 5LYRA 1ISZA 1XINA 1ELSA 7A3HA 3L4YA 4LS0A 1DHKA 3AHYA 3CQKA 4WOQA 3S1XA 4M8UA 3WCZA 2POTA 3O16A 2H6RA 3VVGA 1IEWA 3GTIA 3R6IA 4J3SA 3LCGA 1XLDA 1BFNA 4MZ8A 2OWCA 5REQA 1J5TA 2D20A 4DXVA 4HT3A 5HAOA 3DZ1A 4E4PA 4DRSA 4JL1A 3GVVA 4E0CA 1EJUC 2JKPA 2P10A 4HMDA 4O4VA 1V0MA 2Y62A 1G7VA 3G8EA 4JTFA 1US0A 1K7FA 2X42A 1XYMA 3EA3A 4MKSA 4WDXA 4UMBA 2YJQA 4MNKA 1P7TB 3ZVHB 2VXNA 4GNKB 4X0NA 4L9YA 3FJ4A 1VBGA 3W2JA 1XFCA 1LJYA 3ZJ8A 4HA1A 2H8XA 3URQA 3P61A 3Q94A 5CBIA 1JYVA 3MBDA 3GG8A 3S1GA 1QW7A 1U2YA 1ZALA 2Q6ZA 1ICSA 3DU0A 5GJNA 1H62A 5LGZA 1E55A 1K03A 5CZJA 3VNLA 1KA9F 3FYOA 1AW2A 1DP0A 1JZ5A 1XXXA 4XAGA 4F3HA 1GOWA 1JDCA 1RSCA 5HATA 5I07A 3SGGA 2VO5A 2DJLA 3DFQA 3GXFA 4B5VA 3HQ1A 4GK8A 3R1ZA 2X0YA 1BHGA 4CNNA 5HNRA 1V7YA 3NL2A 3KE0A 1JUKA 4QM1A 1AMKA 1PO9A 4ML9A 4U5KA 2P76A 3A4WA 3N9RA 1H61A 4TTGA 2FH6A 5DT7A 2OO6A 2VEKA 1RR2A 4CNOA 2QCDB 1XLFA 4NP7A 1QO5A 1Q6CA 1GORA 2O0TA 4WKAA 1FCUA 4FR1A 3R4IA 2Y85A 4JCLA 3BG5A 4ZXLA 1GVFA 1W6TA 2DUXA 1CCWB 1DTUA 3H8AA 3S5YA 3M0MA 4TVUA 2GJXB 5E0KA 1E6XM 1GTEA 1EPXA 1R87A 3FHAA 3P5YA 2DW7A 2WVVB 1E1EA 1UP0A 1CZ1A 2MNRA 2VC6A 2Z6JA 4KWUA 4UC5A 1GZJA 1HKIA 1W91A 2Q71A 1WZLA 1TVLA 4DO4A 4PRTA 1R30A 5AHMA 3VTRA 1LTDA 1W2PA 2JKAA 1VAHA 4C1NB 1PX4A 2PC8A 3SGZA 3KZPA 3HPXA 3AOFA 4LBRA 1Y5XA 5JMUA 2XFRA 4HSNA 2RH9A 3ZQ9A 2DIJA 2OJPA 3NA8A 1BQCA 2C0HA 3VIHA 3B4UA 1OBAA 1L6GA 1JUBA 4B15A 2YL6A 2CWXA 5LIWX 1QK2A 1I2QA 2OSWA 1H11A 3UJFA 1EX1A 5C70A 2V81A 1XUUA 3BURA 3DGBA 1W5MA 5LKYA 1PX8A 5BOFA 3BV4A 2PGRA 4RLIA 2PTYA 1CDGA 4WGHA 3WQGA 3F4NA 3WQPA 4XISA 5CPNA 4IPIA 1NELA 4I5UA 3W7DA 2XISA 1WDPA 2GUUA 1CYGA 3PB0A 2W63A 4HYWA 4HPNA 5ABTA 2HRWA 1B3ZA 3B40A 4ZE4A 1JYNA 2C8NA 1DWHM 4W89A 3C0QA 4PMJA 4WY0A 4Y9NA 3QPEA 2CFFA 3CAVA 1JZ7A 1CI1A 3CUHA 1WQ5A 4K6AA 1OC7A 1JDDA 4OKDA 3OGRA 2GFTA 4AY7A 1L6SA 3MUY1 1FKWA 2GGEA 3BLKA 3PPCA 5F1UA 1QNSA 2XVGA 4IPNB 2O56A 4JTLA 2ZX7A 3ABSA 4Y9MA 4XZIA 3B4YA 2WBKA 4KPLA 3CZGA 4UNKA 4K36A 2OZ8A 5HNTA 3MHFA 1QXLA 2OQLA 1QPNA 1S5TA 4MWAD 1KM3A 3CEPA 3GFZA 5GNZA 4HBKA 1MUMA 2RGLA 3CWOX 3G5EA 1XDMA 1PSCA 4Q7NA 4ERAA 1YLVA 1ZNNA 3G1DA 3QC3A 3N3MA 1TIWA 1Q65A 4OUEA 1EYWA 4FPSA 3WF1A 5I2UA 1G4SA 4HMEA 1KTNA 4NJHA 1C9DA 4BI5A 3PZGA 3G1XA 3D3FA 4Q6XA 3MYPA 3CZEA 2WJFA 2VEIA 1D9EA 1HF6A 1DWFM 1D7FA 3W28A 3AICA 5D9PA 4ZO8A 2ZUUA 1ESWA 3NOYA 2JF6A 1QI4A 4A35A 2Q8XA 3FJ6A 4JFUA 4ZOEA 4L4MA 3DAQA 3OG2A 5K7JA 1XLLA 3N2MA 4EF9A 1AD1A 4Y90A 1LORA 1WKEA 2V3DA 3EA2A 3QHMA 3P81A 4US5D 4IFKA 4UOQA 5FJIA 4DN1A 2AMXA 3W02A 3ATZA 3U5YA 4I7VA 2WHKA 1UR0A 3WH6A 2V68A 1RJPA 3SY8A 4DI9A 3PWIA 4H41A 4B90A 4GPNA 2R24A 3CZ8A 1TR9A 4QROA 2PDHA 1EJVC 3H24A 3M64A 4W8LA 5E93A 1JL8A 1JPKA 5IBXC 2OEJA 4M6UA 1OK4A 2RDWA 3AISA 1UKTA 4QE5A 1TJRA 2WMFA 5HR6A 2J79A 1AJ0A 3L4VA 3WDPP 2TMDA 4QEEA 1GG1A 4LQ1A 3I6EA 3P8IA 3NQVA 1HKMA 2P0IA 3NG3A 5FI8A 1DKWA 3GVWA 3WQ4A 3VZYA 1MRAA 1JZ3A 3EMQA 1OX5A 2WCSA 1VZWA 4S3EA 4YTRA 4ZTXA 5A6BA 3LTSA 1EGVA 3LHTA 2PLMA 4JFWA 4UR9A 1PZ3A 1GZGA 2GVYA 1BGAA 5HINA 3S1UA 2W3ZA 3LM7A 4W5UA 3W76A 3RPTA 4DLFA 4E8DA 4FS9A 1AZ1A 1HGYA 3GYEA 3LI1A 2VZTA 1JPHA 3RU6A 1TRIA 2E7FA 1E0XA 1NH6A 1W3NA 1UR9A 1AL7A 3KBMA 4PCSA 3ZT7A 3MSYA 3SN1A 2QUUA 3MCNA 1F4AA 4KESA 1EA9C 4J2MA 3W1NA 3WX7A 2ZBTA 1KBJA 3O0KA 4I9AA 5A6TC 4LYPA 1POJA 1XISA 3CUXA 6XIAA 4RDYA 3ARYA 3BJSA 3KTSA 5D2YA 4K68A 3WLNA 3EA1A 2HEJA 3Q2DA 3EXSA 3DCPA 2V9DA 4PCNA 2I14A 1RAKA 3DKJA 4CNTA 1H7PA 1VFFA 4LC6A 4AMCA 1KXVA 2WMHA 5AB3A 2OFJA 3LV5A 4JYEA 3TW6A 1P0DA 3FJNA 4QFUA 3AHTA 3EKZA 2Z29A 3GU9A 1KBBA 3OYZA 3T6CA 4NJKA 1QPOA 4L4LA 3QLLA 4NSBA 5CZTA 1V02A 3M43A 2CHNA 1UWTA 3LB0A 3V5OA 1K70A 2VKZG 4NILA 2ZRYA 4FNPA 4FXFA 1HP5A 1GOXA 1L8NA 1QW9A 1XYAA 1EA0A 5BRBA 1JYWA 1TQJA 3I7QA 4AD3A 1F73A 1W8GA 3NQ8A 4MVAA 4JIRA 3EZ4A 2YCEA 1O1HA 1TV4A 3WQVA 3IRSA 2GQ9A 4EP8C 1Z7AA 1CLKA 2OMAA 2DZVA 4GVFA 1YPFA 1HL2A 1JXKA 3MUCA 1FOBA 2E77A 3ARRA 1YEYA 1MW3A 2YYTA 3EWYA 5EB8A 3CHDA 4S3CA 4L6OA 2ON3A 1YW1A 2HNHA 4R53A 2WHLA 1Z44A 5TF0A 4MTVA 1SO6A 1MW1A 3PFRA 4KMQA 3LEPA 1RBOB 3SN0A 3KBJA 5FKYA 1J11A 3SADA 5AHFA 2PURA 1MNZA 2X1SA 1HFBA 1CLVA 4NIRA 4CQBA 2EAWA 4KWSA 2G4JA 4ZFMA 2BY2A 3PBUA 5B7ZA 4ZOAA 1KRBC 2GGHA 3CU2A 2EBNA 2VP8A 1X39A 2AKZA 4ZZ9A 4UTTA 3GHRA 4PR4A 4GI4A 3W29A 1TV8A 2X30A 4J28A 5K9XA 5LGXA 3WNMA 3BLDA 1QBAA 5KINA 4MZ1A 4ATWA 3WUEA 1PIFA 4W87A 2JBMA 3LY0A 4XK2A 5EMKA 3TU9A 1KCZA 2V5KA 1OYBA 2XIOA 1W31A 5PTDA 3VGFA 4S1FA 3RFAA 4E3VA 3K13A 2WV8A 2PC4A 3OP2A 2BP1A 3AS2A 4HNNA 3UQNA 2XUCA 2GK1B 3INPA 4IOTA 3RJXA 1TVNA 4FLQA 1XKYA 3C0JA 5KITA 4J4KA 3ZT5A 1BKSA 5JVLA 1T6MA 4J3XA 1F76A 2A5HA 1R3VA 2VFGA 4C6PA 5CGTA 3RITA 3IWPA 4XZLX 4M3PA 1XLHA 1M7PA 1FWHC 2H90A 3AHVA 3CO4A 5C7HA 4HCLA 4ZE5A 3T1GA 1S46A 4XBSA 1I2PA 4GABA 2YDSA 3SCTA 3TWBA 1F6KA 2A4AA 5D33A 1EXPA 1L2UA 3S47A 1SSGA 3RCYA 3WH9A 1UKQA 4A8RA 4HOZA 1ZFJA 3ARTA 4XB3A 3CIVA 4CD6A 4B91A 2QCCA 3NFUA 2VC9A 1A5KC 2INFA 4UXDA 1CWYA 1W1PA 1BWKA 1QI2A 5DMNA 4GY0A 3TMLA 2HTMA 3VNJA 1EUAA 3EDEA 3L12A 2QPSA 4UFKA 1XBZA 4H9VA 2PD5A 3BAKA 3W00A 1C3FA 1WOAA 4YJ5A 1UOKA 2ZXDA 1XFBA 3P8JA 4F48A 3TC3A 2GQ8A 2FKPA 3CAWA 5EMYA 1TWZA 1F74A 4PL1A 5CAHA 3LBMA 3NO1A 2QZRA 4AZBA 3GC4A 1X7FA 4HZ8A 1UD4A 3WQWA 3L67A 1TV2A 1SZNA 4KFOA 1KV8A 3RAOA 1ENUA 2WXDM 4FOJA 3WL0A 1GUVA 3C52A 4JOMA 4O8AA 2ISDA 3O6YX 3G1HA 4B4HA 3UNTA 5BU6A 2Z25A 2DSVA 1AQFA 4YYCA 3BC9A 1IXPA 2BSLA 3C2YA 4V15A 1MEWA 4R9XA 3RR1A 1VCGA 3DFOA 3M0KA 4GLEA 3LS9A 1E0TA 5I3HA 4UZUA 1M7JA 4U2YA 1US3A 1KO0A 1WBHA 2A3CA 3PBWA 2J6XA 5G2HA 3AU2A 3TKFA 4N42A 2OEKA 3MWAA 3W75A 1FTXA 3WELA 3WQOA 1UHVA 1UR3M 1T41A 2OLSA 1J96A 1XH2A 4QLLA 4ZTYA 1N82A 1GT8A 1K9DA 3HN3A 3NZPA 5D2TA 3OPSA 1QPKA 3MYOA 1UD3A 1Q6FA 4GI6A 1K8CA 5BXTA 3H2EA 1HW6A 3MSGA 1G69A 1XRVA 2PWHA 1BYBA 1E0VA 5TNVA 4CU6A 1NFGA 3W38A 3SFWA 1NQKA 4XAZA 4CN4A 2PDCA 2DY3A 3CM4A 4PA8A 1IE7C 5C9RA 2BVTA 4GVHA 4WHBA 4B5XA 1PTGA 3PULA 1H41A 4K38A 1CENA 3VI2A 4J3ZA 1E3ZA 1YMYA 2WSKA 3W1MA 1MNSA 4H83A 3TMQA 3BOLA 1X98A 3S5ZA 1DJIA 4B5TA 3VD4A 2UY3A 3AZRA 5KETA 1YE6A 4UTFA 4AHQA 4DQWA 3AIQA 1J0YA 4ZSUA 2CBJA 4KEVA 4OGZA 4NXSA 3G77A 3TA9A 2ZRUA 1ONWA 1XLMA 2Z1KA 4PUWA 3W1AA 4PMDA 4JQ3A 1FCVA 4H2CA 4S3FA 2GJLA 1ZL1A 1O12A 1BPLB 1LRNA 3TWAA 1BXBA 4GJIA 1LWIA 4UTUA 1V3JA 1O1ZA 1L0PA 4O52A 4XSLA 4WD0A 5D09A 4C6FA 1RJQA 2C18A 2VZOA 3GR7A 3AAMA 2EJ1A 6REQA 3GBEA 4LUSA 2WMGA 3H4GA 3C3NA 3GDRA 4GWEA 1H5VA 2DZAA 3T2OA 3I10A 3LPPA 1NWRA 1PKLA 2YGYA 4ZQMA 1LDCA 1JFHA 1UUMA 2ACRA 3CQ0A 2VD8A 2OZ3A 1KM1A 1VFLA 4KCVA 3VIOA 2X41A 2CHRA 2NQHA 1MMFA 2WK2A 1P0KA 4O57A 3W86A 5F4SA 1E5NA 1TPDA 2EGZA 3F2CA 3KOFA 3DDMA 3NZGA 5A2AA 3W2MA 3VOIA 5BROA 4BEQA 4LNCA 3S4TA 2WNNA 2NQLA 1V02E 3LLFA 4FSAA 4P7RA 4FMVA 5LA0A 2JGYA 2VT0A 1TMHA 4IL2A 1UASA 3UCQA 3BLEA 4IMCA 3A24A 1QOXA 4B4FA 1Q6EA 3I3DA 2X7VA 4I90A 2YCKX 1G4TA 4PEKA 1TYGA 3P93A 2V3GA 7ENLA 2YLAA 3VO0A 2V2CA 2Y1HA 5CSSA 3APYA 2VFIA 3N1AA 1ZU8A 3OZOA 4RDVA 5ABGA 2IKJA 1YXCA 1TZ9A 2ASHA 4UCFA 3DC8A 5B80A 3GUGA 2A85A 4D1JA 3HGJA 4FF5A 4KEUA 3WLHA 3WJYA 1V4YA 4IUOA 4QNWA 5K4XA 1QU4A 1VD6A 2XFYA 3NZ1A 4FK9A 3BICA 4N6EA 3P5ZA 3GR4A 3W7LA 3SCVA 3UWQA 4POCA 2OKTA 3TC7A 3W27A 4HNCA 3WLPA 4C6NA 3Q65A 1NWSA 4DWSD 3R12A 7REQA 2KX9A 4P7OA 1UR1A 2O92A 2VCBA 3UT0A 4XO7A 3N6HA 1SJCA 2FVLA 1W1A1 3B8DA 1M68A 2PWVA 1XYFA 2IKIA 1IWPA 1MO0A 3DFPA 1WB0A 4JQ4A 4MDPA 1KNWA 4IH3A 4Q4QA 2Z00A 3RG6A 3R25A 3TDFA 5HR7A 1XIMA 2Q3RA 3PZMA 4TTUA 5AZ0A 8RUCA 4XSMA 1LOLA 2BZNA 2VR4A 4CUCA 4LYRA 1NDYA 4HJFA 4GUFA 3NOEA 4M7SA 4H8HA 1E43A 4WJXA 4QDWA 3SUVA 1WZKA 4CNPA 3L65A 4WDUA 4MB3A 3P80A 2WC3A 5A6KA 4CD4A 4X61A 4H6EA 4P5UA 3W6MA 3KBSA 3UXDA 4Y6GA 3VC6A 3BE7A 3F4CA 1PEZA 3ABRA 4AD2A 1KFBA 4EAYA 4UTKA 1Q6DA 2Y5EA 1SZGA 2QCEA 3SSJA 2CZ5A 1XV8A 3B0YA 4O17A 4JYFA 1CECA 1PB0A 1OCBA 2VFEA 4PB3A 2GJPA 4LAOA 4GISA 7TIMA 2A3HA 2Y7DA 2E5DA 4O14A 3UR8A 3T2PA 1SO3A 1EHNA 3OODA 3GVRA 1E9IA 2RGMA 1RP9A 3UZ5A 1FY6A 3V3WA 3WUGA 4KGLA 5K9DA 3O8AA 3SJNA 1SFJA 3TZNA 4AF0A 2XWEA 3DHFA 5M2FX 1A4MA 3TEVA 1AFSA 2ISSA 3IK4A 1UBPC 3FY1A 5ABFA 3ZR5A 1VCVA 4XKYB 3GW0A 3OU8A 2VGGA 5LSMA 1ZY9A 3EX2A 4CVUA 1V93A 1BVWA 2DT0A 5IOBA 1JZ6A 1Z42A 3F4VA 3BW2A 3EKGA 1EGMA 4XBKA 2DVTA 3C8NA 4QRNA 4UTTC 5J8LA 2GDUA 3UWUA 1GKQA 1GOOA 1EC7A 3BLIA 5CBBA 4X0VA 5FESA 2VI0A 1VH7A 5AFDA 1JNDA 4LH8A 1KM2A 4UQCA 1DJGA 2A21A 3EWXA 2ZICA 3CT7A 4AUBA 1F3EA 3OTRA 4GD0A 2FFIA 3W2UA 3WBAA 1E0UA 3M7WA 4N9BA 3RLGA 1EFZA 4PTMA 1J79A 3RXZA 5T9BG 4JTDA 1A0CA 3SBFA 2GJRA 1XWYA 3MO4A 4JN6A 4LALA 2BGSA 1E15A 3IGSA 4Y2WA 3LNPA 3GHSA 3LG3A 1A3WA 4OE7A 4D6CA 3IUHA 4H3DA 4IGMA 1JZ4A 3W6LA 3DUGA 4JS3A 2X0HA 3EX3A 3M44A 4X3ZA 1KRMA 1XSJA 3EX6A 4WZHA 1H7XA 2XINA 3A5VA 3KVJA 4PUUA 2WKGA 3G1SA 1E4MM 2NQZA 3EEZA 2NXGA 2ODOA 2VEGA 1V6UA 4HNVA 3QY8A 2V5BA 2V6AA 4HIBA 3TQPA 1TJ0A 3LXCA 3TTSA 3H6OA 4ICMA 4U3CA 3SUUA 2XU2A 1PAMA 2WZIA 5REQB 1UP3A 1XBXA 2J27A 1ZB5A 2B31A 1HJSA 3CXOA 3VX1A 4FHAA 3HG5A 4OOZA 1MDLA 3Q4DA 1B2YA 4S39A 3UETA 1ECEA 4IX0A 4PBGA 4JX5A 3HG4A 3BZGA 4I8YA 3T2QA 2WSYA 2B81A 2DEPA 4REQA 1XYZA 3DC0A 1PXGA 2REQB 5E9XA 1ISWA 3O0FA 3LZ5A 1F8MA 3CWHA 2ZUMA 7CGTA 3LCHA 1BKHA 1BXCA 1W5QA 2UY4A 2ZDRA 3GH7A 2Z1BA 1EJWC 4KRZA 2B7PA 5AYZA 5BOEA 2BG5A 3TSMA 5DF0A 1XL9A 3S1VA 4H8VA 1ICQA 1B9ZA 1CB2A 2ZRWA 1TA3A 5TD4A 1F7BA 1OZQA 4BA0A 4CEXC 1EZWA 5G1YA 4AG0A 3LOTA 4TVDA 3W1PA 3WH8A 4KCUA 3PJUA 3D47A 3B8VA 2WZHA 4HSOA 3GIPA 1F4HA 1RALA 3CTTA 3VOGA 3H2AA 1FWGC 2YZ5A 1FH8A 1G4EA 3WFLA 3GDMA 1UIPA 1NM9A 4PTXA 4F66A 3AS1A 4DJED 2OZ0A 4XUGA 1X6UA 3WMSA 3LDVA 1VKFA 5A8PA 4LY4A 3BL3A 3A64A 1TX0A 3AXIA 3KM8A 1EDGA 1OX4A 1YPXA 4KCWA 1LL7A 5HUPA 4LRTA 4Q8MA 1BVNP 3UZZA 1RLCL 4XBJA 1UYQA 1FHUA 4IPPA 5I77A 1EGZA 3WMBA 3NO5A 1RK5A 2AQVA 3WNOA 1UOZA 3GZAA 2FTPA 4Z1CA 3RRAA 1X7IA 1FBAA 4NAFA 2RHGA 5I7GA 4GE8A 4R3UA 3PTQA 3R7MA 1TR1A 4JCMA 2PGEA 4PRWA 3W7OA 1JXJA 1TWSA 2BFGA 1HVQA 1EEPA 3ABOA 5GJMA 3SUSA 4GJJA 1O5QA 3OJGA 1B31A 4Q8QA 4IL0A 2AL1A 1XGZA 3TJIA 3BJFA 3SCWA 3VIKA 3HURA 4MG4A 1UD8A 1EBHA 2PWGA 1M7XA 4YTTA 3NQCA 3AUJA 3CUZA 3VYLA 3MBFA 3O6CA 2ZDSA 1VFMA 2WVTA 4UB9A 1A5CA 2YLLA 4BK9A 1A5UA 2A0NA 4LX4A 4XVDA 3WEZA 1E6RA 5A8OA 1TPEA 1EB3A 3UR5A 4Y9AA 2PUZA 5CSRA 3O1NA 3KRBA 2E68A 3HJZA 9XIMA 4FO4A 3U2EA 1WDSA 3NZQA 3MC5A 3VDBA 1WDRA 4NNCA 1HXJA 1WZMA 5GQBA 1JZ8A 3UZWA 2Q8ZA 2VOTA 1YXYA 4YN5A 4O15A 1LQAA 3ISIX 1CXKA 2X09A 2NX1A 5I79A 3C2OA 1ZSXA 3EDJA 5LIXX 4JXCA 2ZUNA 1LG2A 1C92A 4F2UA 3KX6A 1I1XA 5AYYA 3FYYA 3LNMA 4JYDA 3APTA 5HUOA 3TJLA 1XIHA 1E4LA 4MNLA 2QEZA 1W3KA 3EWWA 1SJDA 2PP0A 2Y88A 4X22A 1O4UA 1HNYA 2UZ9A 3QF0A 3UR7A 2ACQA 2R6OA 4AMAA 1QRQA 3AS0A 4C6EA 3ARPA 3HGSA 4L4PA 1KBLA 3ES7A 5IXEA 5G1TA 3FDKA 1A5SA 2OLAA 3FKKA 5CC7A 4ZQCA 2Z2AA 3ARSA 1YTEA 2PWFA 4CGTA 4X63A 4DYJA 4ICNA 4LUIA 1H7OA 3BLOA 1LQ0A 1UR2A 3ZO9A 5FD0A 3UERA 1XM3A 4M51A 1T0OA 4GIYA 3S46A 1XC6A 2X2YA 2PDUA 1TSIA 1V6XA 3GNXA 1Q3NA 1Z41A 1DVJA 5HNUA 1KFJA 5FF3A 4H7ZA 5AVNA 2I16A 4N9EA 2XIBA 1RCQA 4XAPA 1UKPA 3T0CA 2CLEA 3NYZA 4YTSA 3VNIA 3B8WA 2NT0A 3W2KA 4B2DD 2PA6A 4MWAA 1KB3A 4LBSA 3N2BA 3E02A 4WR3A 5TQLA 4LCRA 1GG0A 1JZ2A 1F3WA 5AC8A 5G4EA 1UA7A 3OIXA 1ITCA 5K2ZA 2NQ5A 2C6QA 3ZWSA 3LHUA 1AW5A 1W9UA 1LCOA 2ZTJA 3NQBA 2VDIA 3VCCA 1R5YA 3LTYA 1M9HA 1O66A 4DUOA 3QPZA 3MUIA 4OECA 4ZOCA 2NUXA 2XSBA 4MOZA 2Y70A 3ELFA 2EPKX 5DXYA 4IFKB 1J8VA 3CGTA 2YBVA 4MNJA 5HK4A 1I2OA 1Q6OA 3WH7A 3GKAA 1U1JA 5F4WA 2GWGA 1UD6A 5D9MA 3WEMA 3BAWA 4TVCA 2P3EA 2C1HA 1EJSC 3VM5A 3OA5A 1XLIA 3QOKA 3TOPA 4QITA 3OEXA 2QIIA 3KWXA 3MANA 5C2XA 5CSYA 1KTCA 4ILSA 3DG6A 3UPWA 3UGRA 2R1NA 1E6QM 1PKYA 4D71A 2QCMA 1BYDA 4AH7A 3Q37A 1QATA 1OX6A 5CQ1A 5A8MA 2ZVRA 2NVDA 3AJ7A 3NPVA 4US5A 4K8HA 1LBLA 4LYKA 4L7ZA 3ANYA 5EBUA 1QHPA 1W3JA 3ZIZA 4N4QA 3WDHA 3U6WA 3QR1A 3PZ9A 2DDXA 1R9XA 3OBKA 2O55A 2W62A 3TYAA 1VEPA 3GFYA 4D8AA 4B5UA 1DBTA 1T5AA 3OG3A 3WLKX 2XHYA 4QQUA 2I7GA 1K02A 3SR7A 3AMCA 3T05A 3EOLA 3UG3A 3CWNA 3C61A 2D0GA 3CUJA 1W3LA 3SCSA 5KZEA 1DE6A 3MWCA 1QJWA 3HB9A 4JY9A 4Z2KA 2RUSA 1R86A 4X9SA 3LK6A 1QFEA 3LLXA 3VM7A 1KRAC 2FZDA 1I2NA 1MQPA 4C6BA 4WUIA 3H7RA 5KTLA 3LSCA 3MKKA 1KFLA 2FTWA 1OHLA 5T8GA 2EO7A 3IJIA 3UPMA 2OYLA 4JFSA 4GX9A 4JNZA 4QDMA 3T8LA 5EKYA 3ALGA 5AHIA 1J0JA 3GD6A 1IEXA 3WD1A 1VENA 2Y2WA 4C60A 3SCRA 3G2GA 4MFDA 1FWFC 2QPXA 1V5XA 4GACA 4JTCA 1JQVA 4PTDA 4HA3A 4MF4A 2CLHA 3E0FA 2VRKA 2J7HA 4RE2A 3PSWA 3W7IA 4ICCX 4PBEA 3OOQA 2GVJA 1C90A 2J7DA 4CVWA 4CNSA 3SCUA 3UJRA 4CQCA 1TZ7A 3VGHA 3BWWA 3DI0A 4O16A 2C14A 2E8ZA 4PB4A 1Q85A 4Z1BA 3T42A 4OU1A 1CB7B 1XLGA 3O15A 1N7KA 3SCPA 2ZA1A 2FH8A 1TVPA 2EKCA 1ZHAA 1W9VA 1TKKA 2P8BA 3G6LA 4TV5A 2FB3A 3D46A 3VIFA 4J3VA 3VA8A 5CLWA 4GQ0A 1UPPA 1SGJA 1O5KA 2X7WA 3AUOA 4KFPA 1OFEA 3AHZA 1BWLA 5LA2A 5IFTA 1VPXA 2BOEX 3QGKC 3R58A 2OQHA 3H2NA 3MP5A 3E1F1 4D6FA 3DYMA 3O3RA 3VUPA 3NR0A 4JHZA 3ITGA 3FAWA 5CH9A 3M5ZA 4YL2A 1E1CB 3IIXA 4Q6JA 3V5FA 4AEOA 2VMFA 4MB1A 2B7OA 3SIZA 3TZFA 4YS1A 4O1BA 1LF1A 3MHUA 4ZQRA 2J9XA 1OG0A 1VJZA 4U28A 1MZRA 3QKEA 5LHEA 1VFUA 2J6VA 3T0TA 3DGRA 3UJEA 1UD2A 5EYWA 3CHFA 3EXTA 4UR8A 3CPGA 4E6MA 2ZE0A 5C6MA 4RE4A 3G1FA 4LBUA 3NQFA 2OO0A 1OY0A 3KVLA 2BX7A 1TELA 1PYMA 4PODA 3PC0A 1J0HA 1TWWA 1B3OA 3VIPA 3DG3A 4ADUA 3W9ZA 1LL6A 2VL4A 1XLBA 5E1QA 1W9DM 3NQDA 2G3FA 4RKAA 4L56A 3EPNA 1KLYA 1MFVA 2CPUA 5BRPA 1OFRA 3B97A 3QBUA 4UMCA 3S2NA 1S1RA 3OLEA 1B0IA 1IV8A 4HA0A 1E70M 2QUNA 3R89A 3W71A 1UQYA 1YNYA 2VCAA 1JCLA 1F6YA 1VBJA 4BWLC 4W88A 1KRCC 1G6CA 2C1IA 4ZQOA 2Y8VA 3W72A 2W92A 2PDFA 1RPKA 5HBFA 3CLWA 2PLJA 1EYEA 2QJMA 4BS0A 4TX6A 2PDBA 2JALA 1ICPA 1BSIA 2ZZ3A 4QS5A 5FJJA 1NAL1 1HVXA 4FOUA 1P0EA 2QCFA 2PMQA 2NX9A 3L0NA 4GNVA 3E0IA 4D9PA 1W1IE 1FDZA 2POZA 1PZ2A 1J10A 1SR0A 3R0DA 4H9ZA 4Q32A 4UFLA 1GQNA 4DAIA 1MEHA 2XSXA 2JIWA 3L4WA 3WIJA 4HSHA 3UJ2A 2DSWA 4GXMA 3VPLA 3FGCA 1XRFA 3IIVA 1NWTA 1R2TA 2Y7GA 3WJSA 4P7QA 4N4PA 4JDYA 4BKNA 5MF5A 1MRQA 5C2CA 3N6QA 2GSEA 4E4FA 4LAZA 2EKGA 3P2VA 4OVXA 1X97A 4CLMA 1VQTA 4JTQA 2X05A 4UIOA 4NASA 1EEXA 3E2VA 2GJNA 4JTUA 3R8RA 1SYTA 3GC5A 4IIHA 3CMGA 2IQTA 3W37A 1VLIA 4MJ2A 4AX7A 3RJYA 1YQ2A 4JICA 1E5JA 3A3WA 3N4EA 4GQQA 3VIIA 1VC4A 2AKMA 1QAPA 1RQBA 4OJYA 4HNUA 2ZX8A 4PTWA 4V1XA 3NIYA 1FWBC 4O18A 4TO8A 4MWAE 1PCWA 1M65A 1ITQA 2QGYA 3LA4A 4FNUA 1E9ZB 3M4HA 4LXFA 5AC7A 3HQPA 3B05A 3OO2A 4PZVA 1Z89A 4RZ6A 2EG6A 2H9AA 2QGHA 1LUCA 3VXGA 2VOMA 1QNPA 4LW7A 3G24A 3P3BA 1CPUA 2BVYA 4HGXA 4UFHA 1ZENA 1NQ6A 3TVAA 4L9XA 3RMJA 2DQXA 3BW3A 3BJTA 3P62A 1A3HA 1KC7A 1ISVA 4Q4MA 3KL0A 4QSFA 2JEPA 3BANA 1VIWA 4AC1X 3G1VA 5XIAA 3WLSA 1VYPX 2QMKA 3W7MA 1W0MA 1H7RA 3IVUA 1BVZA 4MPKA 4ORIA 3SCNA 5IM51 4DUWA 3TN6A 3GUWA 1QK0A 1OT2A 5LIKX 3W7HA 3U2ZA 1BLIA 2FFCA 5D38A 5K4ZA 3LD5A 3MV01 2AOSA 3N73A 5BZAA 2HBVA 1TWDA 2FZ8A 4IMEA 2W27A 1R85A 4L6HA 3VD3A 3SN4A 2X1IA 2PRHA 2X1UA 4FB7A 3ZLFA 4Z2HA 1ZBKA 1GKRA 3GLCA 4AHOA 3DKLA 2ZFAA 5HJYA 2CLPA 3EDFA 2BXZA 1WXYA 1OGSA 3PPHA 3W7RA 4P00B 4IIDA 2QMJA 2WZTA 2VFDA 2FMNA 2WSQA 4D6HA 5H1WA 4L80A 4JY8A 4HK6A 3FA4A 3PZOA 1GEQA 3N04A 3COTA 4PGLA 4A2SA 3NDZA 4DF0A 4KS0A 2QJHA 1XGEA 2WB5A 2FGBA 4XIAA 4PMNA 5EJ1B 3LU2A 4NI3A 3QLDA 4MWAC 2CC0A 2PSNA 1XIBA 1W3TA 3TYEA 4LF1A 3CL7A 1WPCA 1ZLPA 3O9NA 2RDUA 1M6JA 2P5NA 4MB5A 3U5UA 3ZT6A 2ZYFA 2GUYA 2OGYA 3I4EA 2ZXBA 3M07A 3UG5A 2O4QA 1C93A 3PZTA 4F0MA 3RM9A 3NURA 4PTVA 4B16A 4E2DA 2QUMA 3MO7A 5M3WA 5D9OA 3YPIA 5HQMA 3JVAA 2CETA 1BTCA 3GB6A 3W1QA 2RJGA 3GU1A 2QAFA 5FF2A 2HVMA 1QNQA 1SW0A 2YL8A 4A6GA 2DT3A 3P14A 3GXTA 5G4HC 3ITLA 2CNCA 1SPQA 4TV6A 1SZFA 3V0SA 3ZR4A 1DIDA 1FQ0A 3H12A 1XW8A 1YDYA 3ZJKA 4PMUA 2PDJA 3HF3A 3MMDA 1UZHA 3PUDA 4AYGA 2ZQ0A 3PY2A 1JCYA 3DI1A 3E74A 2YFNA 1FHDA 4Z2LA 2B0MA 2WM0A 1QR7A 2WBGA 4KWOA 1HJWA 1XIGA 4MFEA 3WG6A 4DZIA 4IFRA 4NL1A 3HV8A 3F7JA 5DT5A 2CITA 4IQDA 4U10A 5E6YA 1WNOA 1I4NA 3IUIA 5I3JA 4LVFA 4RDZA 4NZCA 3I7SA 1I1WA 4N9DA 1V08A 5C9ZA 5BYWA 5C5YA 1HIZA 3QR3A 4FX8A 3QY7A 3FXGA 1BD0A 3DYPA 2I17A 5BMXA 3N15A 1NF0A 3OLGA 3BGGA 3WYZA 5BXRA 2D2JA 4NJIA 3KTCA 3F5KA 3OBEA 2WM1A 5A8GA 3S3GA 7REQB 2YXOA 3L7RA 3W24A 3K8MA 4WJEA 3SB0A 4HZMA 3GNNA 3AIWA 4MUPA 1XC4A 1ADDA 2CW6A 3BAXA 4GBUA 4ZOBA 5FL1A 2A3BA 1KFKA 1K7XA 1M04A 1DWJM 1YBQB 4DNHA 4L65A 5F2MA 2YCIX 3U7VA 2F84A 2VR2A 3DX5A 1UZDA 3MVIA 4O0ZA 1A4LA 4HG6B 2CKRA 3WNLA 2F2HA 1G9HA 1PUDA 3WQFA 1ZGDA 2ZVIA 4Z42C 2DUZA 1VHNA 4MHBA 4DWSA 4LTSA 2R1MA 2ACSA 3NSXA 3TE9A 3SSZA 2E9MA 2NV9A 3STCA 3STPA 1TV3A 1NWUA 4GXWA 1B54A 5EA9A 4O50A 2FVMA 2NV2A 1I45A 3V7PA 1KWKA 1J4EA 1I0DA 2R82A 3LHWA 3OVRA 3VGDA 1V6WA 1VR6A 3IK2A 2DPEA 4NX0A 4QAWA 2QDEA 2V3EA 3CIWA 4LC8A 4OOUA 2E1DA 4Q4KA 1JR1A 1GHSA 4R5EA 3N12A 4QSHA 1FFQA 1ZBCA 1WUEA 2AMGA 4R33A 2XVLA 3F1QA 4I7UA 1WO2A 1VRXA 1D3GA 1S2VA 1XUZA 4DX3A 2ZX6A 4MUZA 4TOQA 4UCGA 1AODA 1KCXA 8CGTA 2C0AA 5KZMA 4ECLA 1ECQA 4AF0B 3NQMA 3W88A 4GUHA 3HPAA 2G3IA 2DT1A 2A7PA 1DIEA 1T99A 1Q5MA 2ZRVA 3TSDA 4C91A 3VU2A 7PTDA 5ABFB 2F38A 4UOJA 1GW9A 3XINA 3R11A 4YVXA 2TRSA 2KZHA 2QT3A 3CQIA 5BMWA 2MANA 3TH6A 6TIMA 4N6FA 4HTBA 3UWWA 1P7TA 1W54A 3ZVHA 3ORWA 2PODA 1W1ZA 1MZHA 4H6QA 3Q67A 4LANA 1W37A 1BRLA 3RLHA 2HXTA 4MSSA 2HISA 2PU1A 4LCSA 4P8VA 3T40A 3MZNA 1ME8A 5DMMA 3WLTA 3DOPA 4XKMA 3GDLA 2DIEA 4G2DA 3AS3A 1JF6A 2WANA 2IKGA 5JBDA 2QAPA 2LLEA 1AQMA 2XSAA 3F4WA 5ECUA 4R88A 4PCFA 4W4QA 3WLOA 1U33A 1C8YA 4GYFA 2HMCA 2V8ZA 3UXAA 3KFTA 3ALFA 1UP2A 2PI6A 2XWDA 4CD7A 3UD6A 5AZ1A 1SQ7A 2UY2A 4PCTA 5D04C 3TN5A 2ISVA 4W93A 3VFLA 2QCDA 2JE8A 1OGBA 4LAUA 3KS5A 1CEOA 2DP3A 1LRTA 3I4KA 4A8LA 4AVNA 4ADSA 5AN7A 4YNGA 5DRIA 4JTKA 3TYBA 4KERA 1W5PA 1TTJA 1BEUA 2DZSA 2TPSA 3NWRA 3USZA 4QE1A 4MKVA 1UH4A 3C2FA 4DJDD 3TR9A 3N29A 4I3GA 1WKYA 4XZNX 4WSHA 9RUBA 4MMWA 4AXKA 3QV7A 4PULA 3BPWA 4IUGA 6PTDA 3EWDA 4YHGA 2J88A 3BCFA 3T7VA 3IJ9A 5C2GA 2W9MA 3TFCA 1U5VA 1XLKA 3KLLA 2A7NA 3VD7A 2PB1A 3G1YA 3VNYA 2WZEA 4UZSA 3NAVA 3HBLA 3S9IA 4WOZA 1K4HA 3VGEA 2VRJA 4D6DA 2DZTA 3EYPA 3XIMA 3QN3A 1J9YA 3P67A 4PYSA 2D2GA 4GZEA 4YHEA 3MA8A 4FXRA 4RNHA 1EP3A 2ZWYA 3DN5A 4XD3A 2HS8A 3AFBA 4S3BA 4AD1A 3WJXA 2XPKA 1A50A 2DFAA 4ZCWA 3XISA 4LUJA 2HE5A 3VE7A 5KSWA 1UKSA 3QJAA 4M80A 3BVJA 2Z28A 2PCEA 1WA3A 4NKCA 3AIUA 3SFKA 2V38A 1YX1A 1KQZA 4A22A 4V33A 3NPWA 2X8RA 4XD4A 4JN7A 3GIYA 4GQRA 5HJXA 3KOXA 3KP1A 2A7RA 2OWXA 1ZP4A 1GVQA 4K37A 2J25A 1M53A 4M19A 2EF9A 4H6KA 4H8NA 4EPDC 1LOQA 3M0LA 2CBIA 1OF6A 3G3MA 1OX4B 1MWOA 4P8WA 3OBAA 2HROA 2FIQA 5GVJA 1TUFA 1R3WA 1BXNA 3QM3A 4FZIA 1EPVA 4P7NA 4CN6A 3IJ7A 1PV8A 3WQEA 1CT5A 4F2TA 1PIIA 1T8QA 1EC8A 1DORA 2QDGA 2W67A 3OW1A 3WD0A 4DBSA 5D30A 4NRSA 4F9DA 1RLDA 4WQ6A 3IGXA 4DJEA 2GVLA 2B7NA 2PGWA 1IHIA 1S3TC 2BODX 1GQJA 1AQHA 1GQLA 3PZUA 1R0MA 2ALRA 5DLCA 5HOSA 4ACZB 5DO8A 1A5OC 1A5AA 1FHLA 4PBFA 3LYEA 4K3ZA 3VILA 3GR8A 2IS7A 4K39A 3U8GA 3BARA 1VRDA 2XJ7A 2HDJA 3CHVA 4NJGA 3V1PA 1XG3A 1PYFA 1IEIA 3UWVA 1Q7QA 1RBAA 1BSLA 3RNDA 3FFSA 1DWAM 5SWUA 4LU0A 4H9YA 3WK1A 5LNWA 4JHMA 3H2MA 4KRTA 4AIEA 4Q7BA 4XZ9A 3VMOA 4HVXA 5FCZA 4IICA 1HKJA 5D2WA 4BY3A 1GVRA 1J2WA 4NRRA 4R7JA 3O6AA 3CL8A 1O94A 1J18A 1X38A 5E6ZA 3B8UA 4BZYA 1OVDA 1UWRA 4YCOA 2E4TA 4LB4A 1V79A 2WHJA 3G8RA 5LXEA 4A21A 3ARXA 1XD0A 3ITXA 2Z0IA 2QXWA 5JH2A 3M0VA 1R7AA 3H2FA 2YXGA 3AXKA 1UH3A 2FMOA 3N9SA 3N17A 2HS6A 1PTAA 3MP3A 3H7UA 3IVTA 1GNXA 1WE5A 4NYYA 5EBAA 6ALDA 3F5LA 3VINA 3WFAA 4J7RA 1B90A 2X1TA 2A79A 5FF7A 4A3RA 1EOKA 3LX9A 1Q66A 1VCFA 3ZLGA 3ABZA 4RL3A 5CPTA 3PF3A 3QW4B 3SM0A 3BMWA 1RCXB 3ES8A 5FOOA 2XIIA 4F8XA 2I56A 4QJ4B 1H7NA 1MDRA 4AZIA 4GYPA 2A3EA 3B03A 5CJNA 5T91A 2BLEA 3V18A 4NZJA 4FX7A 5KZDA 3H54A 3NEHA 3H53A 1NIUA 1R3RA 2ZWZA 4MYAA 4LOCA 4KETA 1XLAA 4RX0A 2E9LA 3PBGA 7TAAA 1R7OA 2TSYA 4QISA 1JCTA 2XVKA 2R14A 4EAMA 3WD4A 3WLMA 1RVKA 2NV1A 3TW7A 3WO8A 3V1HA 2IPJA 2ZXQA 1XPYA 4M0XA 4LAMA 2OGJA 3A4XA 5A6AA 5H8UA 1W56A 3ITYA 2JGQA 4ZL1A 3UG8A 2O9RA 6ENLA 4A3HA 4GGBA 4AZ6A 4F2BA 3E49A 1ZJBA 4NX5A 2VC7A 3VGGA 4MWAB 1PTDA 2XGZA 3CAQA 1MXDA 1VPYA 3ITCA 5DCDA 3WJZA 3POCA 4DM1A 1I75A 3T81A 3HV9A 4B3KA 4IM4A 4C6LA 4G1KA 1GEHA 1FCBA 1KV5A 4JEQA 3AO0A 1F5ZA 3UY8A 1JG9A 4XD5A 5DCBA 2ZA2A 3UZYA 1JI1A 3GNRA 1Z9AA 1E40A 2F6UA 3KRSA 4N0RA 4K1WA 3CMJA 3RO8A 1GTHA 1M41A 1WOBA 4B2DA 2HJPA 3HJEA 3DHDA 2V2DA 4KH2A 1C8QA 3GFXA 5DRCA 1O7AA 5EMLA 4JKLA 2QLYA 1DL3A 3UF9A 2NZLA 4DWSC 1KR1A 4EWND 2F61A 4MIMA 3AIEA 1TE6A 2XGBA 4FXJA 1PWMA 2E40A 3MUXA 4V1YA 3S5SA 1AJZA 3BG9A 1OINA 3VABA 2DORA 4HNTA 5AECA 1YKWA 2TAAA 1AA1B 1V51A 2OG9A 4BHYA 1XIIA 1RPXA 1KW1A 1A5NC 2NQ9A 4PMQA 3G6MA 1XLEA 2QVNA 3QKZA 5MKGB 5HULA 3B9AA 3N4AA 4RNFA 3T0AA 3M7SA 5HNNA 1FXPA 4PUKA 1E6PA 2YYUA 4K8GA 3QXBA 4F0LA 4XD6A 4XZHA 2GOUA 2UBPC 4HHLA 2D73A 2XVNA 1ZBVA 5D03A 3BH4A 1Z48A 1OM0A 1JCMP 4JL2A 4QE4A 2J66A 3QHNA 1NU5A 3W23A 3W1RA 3EPOA 4TU1A 3FX4A 3WY1A 3E2QA 4PMZA 1U1HA 3C2VA 4LNYA 3G18A 3TJ4A 3QGAC 1DYSA 4FNTA 1A49A 2A2IA 1CXIA 3SRDA 3M5XA 5I3DA 3S6OA 2GDQA 3L0GA 5M5DA 3BG3A 1CX9A 4Q4PA 4KBXA 1UR8A 3N19B 3QY6A 1H1ZA 4RPPA 4RV3A 4O19A 3UGVA 4GI9A 2AAMA 3GWQA 1O5XA 1XCFA 2WO5A 1JPDX 2NLIA 2PLKA 1D7KA 4DXKA 1Q7MA 1XBVA 4QLJA 4E8GA 2OPJA 2VVSA 2X1RA 2QS8A 3K1DA 2F8QA 2Y8KA 4LV4A 3HFYA 2OR2A 3L23A 4W5ZA 5RUBA 1RBLA 5A1AA 3CC1A 3LSBA 3VIGA 4I6VA 3R2GA 5BWAA 5HDRA 1US2A 4QG9A 2CXGA 3GXMA 1DXFA 2WWCA 3LPFA 2NXIA 3OZMA 1V03A 1P1XA 4M29A 4JX6A 3N11A 3ARUA 1I2RA 1MSSA 5EGRA 3CH0A 5LZLA 2FZBA 5CC5A 5E0FA 3SDOA 1XIFA 3AIBA 3AIVA 5JQ9A 4G7FA 2WLZA 2Z6IA 4WX2A 3VOJA 2YB1A 5BOOA 1C29A 1D2KA 4JNMA 3EX1A 3HIJA 4AD0A 3FA3A 1XI3A 4AZ5A 4ENLA 3PUEA 3M0JA 5EPDA 1C8VA 3CO8A 2J74A 2YDRA 2ACUA 4Q4RA 1QI5A 5IRPA 1U5HA 5C7VA 3JU2A 4XVEA 4Z2IA 5H91A 3T09A 3G22A 3UXLA 3FV9A 3QGVA 1NARA 4GIEA 2QPUA 4U4MA 3IACA 3RU8X 3PPGA 4NNBA 3EB4A 3SUTA 1JRCA 3SY1A 4CD8A 3KOYA 3AWNA 2ZOXA 1C7TA 4FNRA 4C6OA 1FDJA 3C86A 2F6XA 4FIRA 4AU0A 1Q8AA 3LMYA 1PCKA 2DSZA 3QMSA 2O9TA 1HN1A 3T4CA 3FEMA 3UCDA 1H50A 3GNPA 4MZYA 3NM1A 1S2CA 2VDGA 1GVEA 1BQGA 1W5NA 3A5FA 1B1YA 6CGTA 4HU3A 3QPYA 2P50A 2ZIDA 1EQPA 4HMCA 4K7YA 1EH9A 1ZJIA 3IAPA 2RKXA 2D23A 1YYAA 2I57A 3MI3A 5CG7A 2FLIA 3VKJA 1YE4A 3FNDA 1RHCA 4LEFA 3SCQA 1QHZA 2BWGA 4JTHA 4LT9A 4B92A 1PKNA 2CZDA 1TV5A 1JQXA 1UPMB 3B8IA 4PTNA 3VKDA 3LMZA 3STGA 1BYCA 4J40A 2JK2A 1UW9A 1TPUA 4O1EA 1PHWA 1H2JA 2PDGA 1ZUAX 1J0KA 3EOEA 3RUBL 3OLDA 4FLSA 1PE1A 4WDWA 5AC4A 1J0ZA 4MJ4A 3HM7A 1XIEA 1TCDA 1WCGA 2CLMA 4BCEA 1B57A 3LHYA 1B3XA 1IT7A 2QJIA 1N8WA 1BF2A 1E73M 2QUVA 1A47A 2O9OA 4IG2A 2OOFA 1H1NA 4AX6A 3S9ZA 4F0KA 3AYRA 3R43A 4GH1A 3RR4A 3FJLA 5IHRA 3QQWA 4DJEC 1U83A 3A6OA 2HV5A 2V0TA 7XIMA 5DELA 3V0UA 1SFSA 4L1GA 4TX8A 3SECA 4LUTB 1UB3A 5E9AA 1AK5A 3S1WA 1ADOA 3N2OA 3F03K 2EJAA 2WCGA 4QQ3A 4FF7A 1FWIC 4PN2A 2JQXA 2BY1A 2YSWA 1JCJA 3GIQA 3NGJA 5BRQA 4GRSA 2BHYA 3N34A 1GJUA 5U7SA 3BMVA 2D3LA 4JFVA 3LRMA 5E70A 2PDPA 3LUTA 1W1B1 4DBEA 4OT7A 3HA1A 4IMGA 4L5ZA 3S2JA 4XG1A 1KXHA 4PL2A 1DJXA 1Q2RA 4I9JA 3W7PA 1EF2A 4DBDA 1HJVA 2J24A 3ZFHA 3W7NA 5IDZA 3W87A 2ONEA 2ZZ5A 1IT8A 4P7LA 4PMXA 4F4RA 3AROA 5FF4A 1XGDA 4KW2A 3HPFA 1FH9A 1XD1A 4E5TA 2PTDA 3RM8A 4B5NA 1QPRA 3K30A 5I3IA 2XG9A 1EIBA 2DGAA 3LCFA 4LJ3A 3WLRA 4G8TA 4GUGA 5JXQA 4UTMA 4R85A 2IQ0A 1IT0A 4IFOA 3HGRA 3EPMA 4NG3A 1IIGA 4HK7A 1C7SA 2YDQA 3PP7A 4ZODA 2XIMA 4HTYA 5H8MA 3AMGA 2R94A 4GYPC 2C91A 4QIUA 2W5FA 1VBUA 4ZA0A 5I00A 3W7JA 3B0UX 4BQ3A 3GXDA 3KBWA 1M3UA 2GL5A 1V8EA 3IJQA 2W6RA 5K3VA 3A23A 3ZJ6A 4O12A 4HU4A 3W25A 4P02B 1ISYA 1IWBA 1UR4A 2G95A 4AD5A 5F2GA 2J78A 2WMKA 3LCLA 4QEHA 5CPOA 5ENLA 2DVUA 4GG9A 2J77A 1YHTA 1VEOA 3RHGA 4AB4A 4IF2A 4MM1A 4R34A 1RZMA 5FJRA 2J7GA 2MUCA 3KBVA 4DZAA 4G6CA 4IMFA 4JIQA 3LXAA 4GFIA 4NUWA 1KKOA 2IXUA 4Q4OA 1KTBA 3V5CA 1XIDA 4OHQA 1FWDC 3G3DA 3HTWA 4LUYA 3SQMA 3PNZA 4C6JA 3ZSTA 5JH1A 1KFEA 3TONA 3TTQA 1XPGA 3W1UA 2D2HA 1ISXA 3P0XA 5I23A 4JD4A 3WUFA 5EMUA 4YTUA 1VBHA 2QDDA 2YZRA 5GPRA 5CSUA 3DXIA 3M0ZA 2PWDA 4UTJA 3UG4A 1W8SA 3W53A 4O1AA 4RNJA 2PE4A 3VUSA 1Y7VA 3OQEA 3VKAA 3RLUA 3PBVA 4WLCA 4S3AA 7ODCA 3PJWA 4MY8A 3CV1A 3MSRA 3DERA 1Y65A 1KLZA 1J6OA 3TXVA 2WSRA 3PPFA 5BXPA 2IMRA 4U33A 4QGCA 5FA5A 1MFUA 2E28A 4C5YA 1UUOA 3KEHA 3GNDA 3URBA 4BR1A 2CEQA 3DFHA 4IGHA 3TN3A 1DXEA 4EPEC 1EXBA 4UFJA 3BGJA 1Q7ZA 1YTDA 4UFIA 3H55A 4C7DA 2VWSA 1XDJA 2C79A 3O6DA 2BNJA 2QJNA 5A2CA 4GZIA 4Q8PA 3RDKA 3FIGA 3MUZ1 2WVUA 4Q8TA 4Z0SA 2OWWA 4CD5A 1RY0A 4W85A 1OC5A 3CZJA 1OADA 1Z69A 3EDKA 1K7EA 4L64A 1NP0A 2WKJA 1LT7A 3H7VA 4A05A 5AC5A 1W1TA 3AMDA 1X8CA 1NOFA 1XYLA 3THQA 3W3OA 3E5PA 4NZ5A 3TK7A 3OIHA 1MW2A 4HHMA 3WENA 4QCEA 2INZA 4XKYA 1E3XA 3CB3A 3BK0A 3BUVA 4O10A 1LM1A 4JHOA 3AYSA 2CXEA 3AMLA 4NF7A 1GOMA 2PBOA 4O1DA 4N2YA 4GKLA 1AUSL 1DPMA 2NT1A 4G9PA 5DFAA 3TP4A 4B5SA 3T44A 1OFAA 2PDKA 1DTNA 4EWJA 1T7LA 5A94A 4F9JA 2WQPA 2PDNA 1RH9A 4LS1A 5JIPA 5AYBA 4C7GA 3L21A 4UTHA 4PMOA 3WNNA 3GW3A 3QQ0A 1R2RA 1AQ0A 4E4UA 2DUAA 4FP1A 1NP2A 1QTWA 3RGTA 2W79A 4WRHA 1ML1A 2YX0A 3ZOAA 1ONRA 4AW7A 4DWSB 4L1XA 5HMSA 4LV9A 5D02A 1WDWA 4Y7EA 1YDNA 3PWAA 3VMNA 5HPCA 5A95A 1XF0A 3CPUA 4WIWA 1G5AA 4PE8A 4IIGA 4A8NA 5I6SA 3GK0A 3R10A 1XQLA 2VZSA 5T9CE 3ENLA 3WKZA 4KEZA 1NDWA 1F61A 2E25A 2OKOA 8TIMA 1MQRA 3JR2A 2OODA 4UNLA 2A1YA 3WK3A 4OBTA 3ABXA 4JR5A 5A2BA 4MAZA 3NQ6A 2CLOA 1EDTA 4JPGA 4MAVA 5CZSA 1ONEA 3W74A 4KGJA 3CHEA 1KBIA 1M1BA 3CYJA 4KIRA 5GNXA 4DB7A 3LCIA 2EPHA 1VIZA 5F2IA 3LCXA 3W81A 3GDTA 4QHRA 1K1DA 3GC2A 1S2WA 3VKBA 3N2TA 3RPMA 3B9EA 1V0KA 2J9YA 3SIMA 4DY1A 1OABA 3T9PA 2UY5A 1D8CA 5DBTA 4S2CA 3TLLA 3THCA