3OZPA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with pugnac
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords N-acetylglucosaminidase
publication title Active-pocket size differentiating insectile from bacterial chitinolytic beta-N-acetyl-D-hexosaminidases
pubmed doi rcsb
source organism Ostrinia furnacalis
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ozpA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3ozpA01
3K8MA 3CIVA 4LYPA 1CPUA 4AZ6A 1EXPA 1CECA 1LLOA 1ZU8A 2EQDA 2F2HA 1W2PA 5HPOA 3AJ7A 3RPMA 1RP8A 1JL8A 1E6ZA 4HU8A 4CD8A 1US2A 3KEHA 2ZXQA 4F9DA 2BXZA 1UKOA 1J0IA 3CGTA 1MW1A 2WXDM 4HZ8A 3WUEA 1EGZA 2BHUA 4MAVA 1OGBA 2W62A 1FFRA 1QBBA 2YA1A 4Z2HA 2VOTA 1QVBA 4M29A 1E6NA 1ISVA 3L4YA 4HA4A 1WE5A 2FH6A 3RM4A 1W1VA 5DFAA 5A8PA 3ZJ8A 4JCLA 3O2LA 2A3AA 5D8WA 4P8UA 3W81A 3OZOA 1FH9A 3TTYA 3VNZA 1BYCA 1E3XA 1R7OA 1JD9A 2E8ZA 1JG9A 5CZKA 5CLWA 4CU6A 1XYZA 2NT0A 3CZEA 1HJSA 2YBUA 1HF6A 2QHAA 5ABFB 4A3YA 3L4UA 3EMQA 6CGTA 1UKQA 4Z2LA 5TD4A 3PZTA 1HJWA 4IISA 2XVKA 4X0VA 1ISXA 1TVPA 3VINA 1LWJA 4UZUA 3OZPA 1CGXA 2X1IA 3QGVA 2J8GA 4CU7A 1Z32X 1J12A 1JNDA 3T2QA 1N82A 4AEEA 4LQ1A 5M5DA 1GVIA 3PZMA 2IXUA 4D6CA 2GUYA 1BLIA 4AISA 3ARRA 4W7UA 3AS2A 4OKDA 1E15A 5ABGA 4KRTA 1JDAA 2CETA 3VGHA 1HP4A 3SUVA 3N17A 1C8XA 4DWSC 4M1RA 3K4AA 2JALA 3ZT5A 2JF6A 1J01A 2CBJA 2YBTA 2D24A 3CHFA 3AIEA 3VD4A 2VRJA 1GVYA 4P8WA 3VNYA 1WNOA 2XSBA 4PMNA 1BFNA 3AIQA 1M03A 1XV8A 1QHZA 3ZT6A 3N13A 1PPIA 3A4WA 2X05A 1HIZA 1UH4A 4DM2A 3M46A 3KL0A 3FW6A 3VGDA 1H0GA 1PEZA 4BA0A 4GPNA 2HISA 4JCMA 4HMEA 1DWHM 4V2XA 3WF1A 3ARXA 4QDMA 2WHLA 3VIOA 4LGXA 3KL5A 3D5HA 2D3NA 2BVDA 3AIRA 1B3YA 1UKSA 4TOQA 1BG9A 1NM9A 1X6NA 5E6ZA 4D71A 1GPFA 2WMHA 4W8BA 4UQCA 5A6BA 3MUAA 3OLIA 1MYRA 4KGJA 2OWWA 1AQ0A 5I77A 1AQMA 2D22A 1E9LA 2J47A 2J62A 1B0IA 1PX8A 1UD8A 4ZXOA 3ZT7A 1E70M 3CHCA 2V3GA 1NWTA 3ZOAA 2CHNA 3OA5A 2BS9A 2EJ1A 2EPKX 3T2OA 3ZM8A 2XPKA 4D6GA 2J7FA 1MQQA 1W91A 3SCSA 4BQ2A 5DT7A 5C8BB 4AD4A 1B1YA 3MSDA 3K4DA 5I2UA 3BAYA 5CGMA 1UR9A 1JZ7A 3WL0A 2AOSA 1I1XA 2OYKA 2WVSA 3WBEA 4E8DA 4W89A 3WMBA 3IK2A 1GQKA 1TUXA 1W9UA 5HPCA 3ARYA 2WC7A 4AIEA 7CGTA 1GOIA 4AW7A 4JKKA 1JI2A 3BXWA 3B9DA 1C93A 2CBIA 4S3KA 1HKIA 3WEOA 4L4OA 1K9TA 1CGWA 5I24A 1ZBKA 5M17A 5FCZA 3OGVA 2FHFA 4JKLA 2WZEA 4RE3A 1J0HA 2VO5A 3AIVA 1LJYA 1JZ6A 3PZ9A 3LPFA 2ZX9A 1HX0A 1QNSA 1XH1A 3WKZA 1NARA 2JF7A 1H3GA 2XGBA 3O6AA 4CGTA 2FHCA 4H41A 4C7DA 2J7CA 3WMCA 2GSJA 5JIPA 1CWYA 1GUVA 2J74A 5FOOA 3UERA 3SCOA 1MXDA 5BCAA 2BY1A 1KXVA 2ZUWA 4QCFA 4UTFA 3ZR5A 3MU7A 2WW5A 1BHGA 4ML4A 4XZBA 1BYDA 3VO0A 5C71A 1CLVA 1CZ1A 3AHYA 1E4NA 1W3KA 1CBGA 3DC0A 1ZBCA 3WF3A 1C8YA 1CTNA 3F5KA 4KRUA 3GBEA 4UQAA 4W86A 3K1DA 3MMDA 2FGZA 1V0NA 4NSBA 3WNLA 3CH9A 4PTVA 3CMJA 2WMIA 1CEOA 3CUGA 1EO7A 3VIGA 2OSWA 2A3EA 2EPLX 3WDJA 3VTRA 4A3HA 1S46A 1VIWA 2WWCA 1AMYA 3FHQA 2WHMA 4W8LA 1MQRA 1CGYA 1WDSA 1W9VA 1UR1A 1C7SA 3M6DA 3IAPA 2WCAA 4M80A 3EYPA 1QOXA 3BMVA 1GJWA 2DH2A 4XV0A 4B3KA 1GONA 2VT0A 5JBFA 2VCCA 2Y2WA 3G6MA 4CCDA 3APGA 1XHGA 3A4AA 1JDDA 1O6IA 1UYQA 3AIUA 2WMGA 4JL1A 3QHMA 3SCTA 4IM4A 3FHAA 2QMKA 1SFSA 4UOJA 4TX6A 4M24A 1SR0A 3PTQA 3AMKA 4XUYA 4CD4A 4UZSA 1RP9A 1J0YA 3CO4A 3MKKA 3VIMA 4AD0A 1HL8A 4Q22A 4NRSA 1CDGA 5IFPA 3VUPA 4X0NA 4CN6A 5DF0A 3WEZA 5A2CA 3THDA 2YL5A 1TG7A 2CBUA 2UY4A 1K6AA 4XZWA 2JFEX 3UETA 1CXKA 3WDPP 4UFKA 4BQ4A 5GQBA 3WF4A 3CTTA 3K8KA 5DO8A 1V6XA 4V28A 4J3UA 6TAAA 3TTQA 1JF5A 5M3WA 2Q8XA 3AXHA 3WY1A 2OSYA 2VUYA 2VR5A 4P7OA 3AIBA 1CGVA 2QPSA 3ZIZA 1H2JA 3RCNA 1WP6A 4PTWA 1X1NA 4D6HA 1E4IA 5JBDA 4B15A 1FOBA 4PBGA 1AVAA 3DHPA 5EFDA 5FD0A 1BGGA 2V3FA 4MTVA 4W7VA 4GKLA 1J10A 1EHNA 2D0GA 3AHTA 2JEQA 1HN1A 4Q7NA 5A95A 3MUZ1 2XM1A 3BLPX 1QNPA 4ZE5A 3WQ5A 4UQDA 2OYMA 3OIHA 1VFUA 3MMUA 4UOQA 2VTFA 3TTOA 3VKKA 2XVNA 1FH8A 2PWDA 4AIUA 2WHJA 4JFTA 2D3LA 1Q6EA 4Z2KA 3IJ7A 3FAWA 2D2OA 1B90A 1VF8A 4BZYA 1V3IA 3EDKA 2E9BA 1IT0A 1V3KA 4PMXA 5D4YA 4AD2A 1KQZA 1RPKA 4AWEA 2WMKA 1LL4A 2WMJA 1FHLA 1XCXA 4D6JA 3HJEA 2IUZA 1JYNA 4C91A 1UWSA 4ATDA 1TMQA 1E5NA 4ATWA 2BY0A 1JXKA 2XJ7A 5CSYA 3AZRA 1JYWA 3A47A 5A6MA 1WCGA 3ZJ7A 4P8VA 4W93A 4TXEA 2BNJA 1AQHA 2WVTA 2PWEA 1E4MM 1UD5A 2YDQA 3W82A 4QLJA 4HOXA 1ISYA 2GJRA 4FLOA 3FN9A 6A3HA 1UWRA 4CD5A 3BAKA 2UY3A 2W4XA 3VIJA 1V0LA 4JFVA 3CZGA 3AYRA 4UFJA 1R7AA 3LMYA 1VFOA 3WH7A 3VIHA 1MWOA 2NT1A 2J78A 1XC6A 2GFTA 1B31A 1ZS2A 2ZIDA 1CXLA 2CITA 4D6DA 4UFMA 5CPSA 4PCTA 2WWDA 2ZXBA 3WFLA 1Q6DA 1WDQA 3PZIA 4W87A 2G3MA 3HU7A 5A3HA 2G8ZA 1PJ9A 3AS1A 1LG1A 4GZIA 4F79A 1NOWA 2XYLA 2WBKA 2O9OA 2ZICA 1W9PA 3A3HA 1WZAA 4P7LA 4J28A 3AI0A 2VMFA 3VGEA 1WO2A 3NUKA 4GQRA 3KL3A 2OYLA 4AD1A 4GZEA 1NWUA 3VX1A 2J77A 2VRQA 8CGTA 5JIWA 1XGZA 2UY2A 1R86A 3RM8A 2DIJA 3ARPA 3VX0A 3MUIA 1XH0A 4FLRA 2PB1A 1GORA 2BY2A 2YLAA 1JZ5A 3BLKA 2FGLA 3AISA 3PTKA 3N1AA 2EO7A 1KCKA 1YHTA 4MNKA 4AC1X 2D23A 3WQ4A 5IHSA 1CXEA 1X6LA 1W1YA 1ZL1A 2E9LA 1XRVA 3RJYA 1MW0A 1W3HA 1JAEA 2XVPA 1D7FA 1QBAA 3AQUA 3SCNA 3VGFA 3WH6A 3WH5A 4A4AA 3SCWA 2WBGA 2F61A 2YOCA 5HDRA 1UUQA 2EXOA 3CHDA 1GHSA 3VMNA 4J27A 2WMFA 1NWRA 1XD0A 2W67A 3K8LA 4AMCA 4MAZA 4ZXLA 2QV4A 1UZ4A 1E71M 3GTNA 4EK7A 2YIHA 2YKKA 3ALGA 2Y8KA 1DWGM 3OLDA 4GO8A 1CIUA 3SURA 2QLYA 3EDEA 2CCRA 2WPGA 1OD0A 2XUCA 3BSHA 1E6SM 1E6XM 2WK2A 1EQPA 2XVGA 3GH4A 1V3MA 3JUGA 2W92A 2CIPA 1MFUA 1TCMA 2YLLA 4OBSA 3CBWA 3EMZA 1V6VA 3BC9A 3QOMA 5KZ6A 1W9DM 1HVQA 2G41A 3TA9A 1CXFA 1G0CA 1XSKA 5CJ5A 1MQPA 3AHXA 3CHEA 3G6LA 4PSRA 3BAWA 1WZMA 4QCEA 4GZJA 5AY7A 2BV9A 1UR2A 3PHAA 3ZJKA 1E0VA 4PRWA 1E6RA 2VVNA 5I79A 2EBNA 4U2YA 9CGTA 1OCQA 4JAWA 1DTUA 2EPMX 4U5KA 1PZ2A 1W2VA 4GI6A 4L4PA 2W61A 2WM0A 2O9RA 1JF6A 3PZUA 2ESCA 3AXIA 3PZNA 4X9YA 2G3JA 3KE0A 7TAAA 4BS0A 1KXQA 3TONA 3L4WA 2VURA 1MVYA 1OIFA 2O9TA 1UKPA 1I75A 3ARQA 4GIAA 1J0ZA 1QHPA 3ARTA 3A6OA 1V08A 2RGMA 3LPOA 1GW1A 4UCFA 2WZHA 4M82A 2ZUMA 4CUCA 3B8SA 1JIBA 3WN6A 2O9PA 2W91A 1V6YA 4HOZA 3PTMA 1V3LA 5I6SA 4DUWA 4CKQA 2ZX8A 4H8UA 3B9EA 2WSPA 1QHOA 3FNDA 5CGTA 1EDTA 4J3VA 1PIFA 2WAGA 2GJPA 1B30A 2VRKA 3WNPA 3NSXA 1OM0A 3WFZA 1V6WA 3MUY1 1C92A 1ZBWA 1JDCA 2CXGA 3F5LA 3NCOA 2ZUNA 4PTMA 5EFFA 4TTUA 3GXIA 4AZGA 3UCQA 3ZO9A 4MADA 3L4XA 2V5CA 4U3CA 3EBVA 3GXMA 1G01A 2ZWYA 4AZ7A 4D6FA 4Z2JA 3WUGA 3SUUA 2ZWZA 4AY1A 2X0HA 4GINA 2PF0A 4HMDA 1A3HA 3VIFA 3W0KA 3VIKA 3VD7A 2XM2A 4PMUA 3WEMA 3II1A 1G1YA 2CBVA 1XSJA 1ITCA 1KQYA 5A6KA 1M53A 1EHAA 1ZJBA 3DYPA 4N42A 1E0WA 5A6SA 4ZENA 3B9AA 3AYSA 5E9AA 5IHRA 2DDXA 2X2YA 5BXTA 2VX5A 2DT0A 3N11A 4UFIA 3RIKA 2J7EA 3TP4A 1V03A 1M7XA 4HTYA 1JFHA 1BVZA 4LXFA 3WH8A 1PAMA 1VRXA 1UH3A 4HA1A 1XYFA 2Z1SA 1ISWA 2IXVA 3CUHA 2CHOA 1GNXA 2VX7A 4HZ6A 2WMIB 4ACZA 3BAJA 4TVUA 2ZUTA 3VILA 4D1IA 3IAQA 3SCRA 4W5UA 1QI2A 1LL6A 3ZR6A 4AZ5A 1KR0A 4CU8A 2WSKA 1B2YA 3SUSA 4HA3A 1EDGA 1ODUA 2YDSA 4TTGA 4PSPA 5IFTA 1E1FA 1E56A 4DWSB 3AMCA 1MW2A 4CVWA 1UR8A 4LPCA 1UWTA 2V3DA 3BCDA 1EDQA 5DT5A 1GQLA 2ZXAA 3WQVA 3K46A 4D1JA 1FP9A 3IJ9A 3WF2A 3L4TA 4TVCA 1I1WA 4DM1A 1W9XA 2WVVA 1KWKA 1KGWA 2QMJA 3CUJA 3ALFA 1GOWA 2YA2A 1Q4NX 4M8UA 5D9OA 3F5JA 3MS8A 1QI4A 3T0BA 1B3XA 1HKMA 2BHYA 2GJXB 4JKMA 4U2ZA 5ECUA 5GNZA 2Y8VA 1VJSA 5DEZA 3RM9A 2NW0A 3NDZA 3ARZA 4DWSD 4NRRA 3GNRA 4FF5A 3GNPA 3U57A 1DHKA 5EMYA 1D3CA 3CZKA 1GQJA 1VFMA 2V3EA 3BH4A 2VCAA 4PTXA 1QW9A 2X09A 5IXEA 4ZFMA 4RE4A 5CQ1A 1ITXA 2VQUA 1W32A 4JL2A 3BGAA 1DWAM 4F9JA 1DWJM 5CXPA 3AS3A 2GK1A 5BRQA 2A3HA 1L0PA 2QPUA 4U5IA 3UR7A 2VC9A 3E1F1 4W88A 1KGUA 3W6MA 5I23A 1ECEA 2Z1KA 4BQ5A 1G5AA 4OOUA 3T0DA 3AZTA 1HJVA 3ZJ6A 4MNLA 2F8QA 1JZ8A 4P7QA 4QP0A 1QPKA 4AZCA 1TVNA 1EIBA 2W5FA 2VZVA 3VD3A 1UA7A 4ZEPA 1JYVA 1K9FA 2W63A 1TR1A 1VAHA 1EA9C 4DUVA 4GI8A 1HXJA 4JFWA 3UEQA 2YDRA 3VD9A 1FH7A 4GO9A 2DGAA 2O92A 2VX4A 4ZE4A 3CMGA 3WD2A 4HP5A 4F8XA 1CXHA 4H04A 5ABEA 1PZ3A 4YN5A 1BF2A 1OT2A 3AXXA 1WZLA 2BVTA 3RJXA 4CCCA 2VCBA 1TA3B 4AEFA 2WLYA 3ARUA 1GJUA 2W66A 3ARSA 4EANA 1FHDA 3L4ZA 1GZJA 3VU2A 1V0MA 4R27A 5HBFA 5CLTA 1E0XA 1OSEA 1H41A 2J25A 1OWQA 2BVYA 3VMOA 1HL9A 3D3AA 3MANA 3THCA 3A4XA 4TUFA 1J11A 5A6LA 1R87A 3AIWA 5D9NA 4P8XA 4UFLA 4K68A 4MJ4A 5A69A 1OGSA 2PBOA 3OGSA 2WCGA 5ABHA 2VZOA 1BYBA 4WJXA 1JXJA 3BSGA 4PMOA 5KEZA 1BGAA 5AYBA 1RD6A 2J7DA 3AS0A 4C90A 1RH9A 1HP5A 3ZMRA 4WKFA 1NH6A 4AD3A 3WD1A 2ZX5A 4AD5A 4XX6A 3WNKA 3OG2A 2PC8A 4NF7A 1B3VA 1UA3A 2J7GA 3NSMA 3S2CA 1JFXA 3M07A 4CVUA 1LF1A 1V02A 2JE8A 2ZX6A 3W28A 5BWFA 3NIYA 1C90A 4TX8A 5CPQA 4H8VA 3WNNA 1DP0A 4PEEA 4GI9A 2BY3A 3WD0A 4WKHA 3N9KA 4H2CA 2AMGA 1OIMA 5AC4A 2FDMA 2A3CA 1LG2A 4HPHA 1PX3A 4JFSA 1HJQA 1NWSA 1TZ7A 1UWIA 5JUVA 2XFYA 2WHKA 1VEMA 3AMGA 3U7BA 3SCPA 1KWGA 1CYGA 1B3WA 3ZSTA 3VDAA 4MJ2A 4RL3A 1ESWA 1V6UA 4W85A 4WIWA 5HOSA 2XSAA 4CN4A 4OJYA 1MW3A 2WNWA 2BFGA 3OB8A 1E1EA 2DH3A 2V38A 2UWFA 1UH2A 4YPJA 4OBRA 3BAIA 3VGGA 4EAMA 2WZIA 2XGIA 4JHZA 2A3BA 2QF8A 2ZUVA 1IV8A 1VBRA 3VOCA 1W3JA 4E8CA 1US3A 1UQYA 3EDJA 4OZOA 1C3FA 1H1NA 4P7NA 3AHZA 4CD7A 1UR4A 2WCSA 4OUEA 1O7AA 3VGBA 2YL8A 1XH2A 1NP0A 2VR4A 4UQ9A 1WZKA 4PUEA 3SEPA 4NZCA 1QW8A 2J7BA 1VJZA 2DPEA 4PMYA 1GHRA 3MV01 4URIA 1HT6A 3BCFA 1ODZA 5D8ZA 1M01A 2CESA 5DMYA 1WKYA 3OLGA 4P7RA 3VIIA 5GNXA 2DT3A 3LPGA 4IUGA 3W4RA 1UWUA 2DEPA 2X8RA 3L2LA 3W27A 4Z2GA 3N04A 3CZLA 3QHOA 3PN8A 3WD4A 1KCLA 4HU0A 1K9DA 1CXIA 1H11A 3L4VA 4MB4A 2YL9A 5F7UA 1U30A 1HVXA 4PMVA 1Q6FA 2CNCA 3MV11 4PYSA 3MMWA 5BRPA 4WKAA 1J18A 4D6EA 5ABFA 2WVUA 2ZUSA 4AZBA 1BAGA 1CGUA 4AYSA 4FLQA 3OBAA 4MPKA 2ZXDA 3QHNA 4WK9A 1YQ2A 2AAAA 3WDRA 1UHVA 2J8FA 4AXNA 5A8MA 1FFQA 2DSUA 3FAXA 1QNOA 3SIMA 2UY5A 3GNOA 1UQZA 3VDBA 4N0RA 5A2AA 3WDHA 3VDCA 1F4HA 4H7VA 1QNRA 1UZ1A 2E4TA 1BVNP 1H5VA 4AZIA 1DEDA 1K9EA 2ZE0A 3W29A 4MNJA 1E55A 3MO4A 2CERA 2PWGA 3FY1A 1V0KA 4UQBA 3NDYA 1CNVA 1E43A 2C0HA 2CEQA 4CN1A 3PZGA 4MB5A 1M04A 2D1ZA 1CGTA 3AICA 4U31A 2WKGA 4J3TA 1H4PA 1C91A 4JFUA 7A3HA 5BXRA 1KBBA 3DECA 2YJQA 5A2BA 5A6JA 4V27A 3ZSSA 5EBAA 4EE9A 4CCEA 1JAKA 1SMAA 1TFVA 3DYMA 3GBDA 4MB1A 2E9MA 3CPUA 2VVSA 2WB5A 3AMLA 1IZJA 1E5JA 2WANA 2B31A 4B9ZA 5D9PA 3W24A 3AROA 1XSIA 2ZOXA 2ZX7A 1KB3A 4MB3A 1GOOA 3WSUA 1MFVA 5BXSA 5A6BD 2DQXA 4UR9A 1DWIM 5AYIA 5CPTA 2D0FA 5CG0A 2PBGA 3EDDA 1BSIA 1NQ6A 1JZ3A 1QI5A 4D72A 5M03A 4QLLA 2E0PA 5I3DA 4KMQA 4R5EA 2XTKA 1H0IA 3CZ8A 4WSJA 3DYOA 4B9YA 3WQ8A 1UD4A 1NP2A 4AZHA 2G3NA 3WDQA 1EOMA 5E09A 3HMCA 1J0KA 1XCWA 4WSKA 1W9BM 4H8HA 5D9MA 2GDVA 2CPUA 3U5YA 2Y5EA 2G4FA 1Q6GA 4B3LA 3WNOA 5A8OA 1KXHA 1F4AA 3VDHA 3EMCA 5A8NA 3UR8A 1XD1A 5IDIA 1HKJA 1BPLB 3KWXA 2D0HA 2TAAA 3WNMA 4UOZA 2VJXA 1SYTA 1W3LA 4TVDA 2RGLA 2XVLA 2PWHA 1D2KA 1SMDA 3RO8A 5FL1A 4ACZB 4EKJA 1NOUA 4F66A 2ZUUA 2CKSA 4YHGA 4IPNB 3T09A 1EO5A 2FHBA 5FKYA 4E4PA 4BQ3A 4JIEA 3W6LA 5E0FA 1ZB5A 3VM7A 3W26A 1VBUA 4YHEA 3WQWA 1OINA 1JYXA 1EH9A 3WMSA 1E6PA 4W84A 4JZ5A 3WIJA 4B16A 2C8NA 3PZOA 3FXYA 4ACYA 2WLZA 3AZSA 5A8QA 3AMDA 4U33A 3UG4A 1GCYA 5A6AA 3WQ6A 3SCQA 1KXTA 3WH9A 4C7GA 3PZVA 4PMDA 5HNNA 2HVMA 5BROA 2DT1A 3AOFA 2WVVB 2EEXA 1WDPA 5FL0A 2Y24A 3M7SA 4PMZA 3J7HA 1TE1A 1DWFM 1J9YA 3WL1A 4HZ7A 5E70A 1QI3A 3RMEA 4PUDA 3WUBA 2GDUA 1BG4A 1HNYA 4QLKA 3WDIA 1LWHA 4LYQA 2BHZA 4LYRA 5I78A 3WF0A 5E0CA 4QAWA 3GZAA 3POCA 3SCUA 4CD6A 5LA2A 3I3EA 3ECQA 3GYCA 4IPLA 1G9HA 2EPNA 4DWSA 1E6QM 1E72M 1WPCA 4M81A 2XFRA 3UG5A 3GXDA 1KBKA 2WC4A 2XWEA 4S3JA 3U7VA 1MXGA 1L8NA 5LA0A 1UD3A 5AC5A 1JNEA 1CENA 2MANA 3F4VA 4FMVA 3VVGA 4HOWA 2GK1B 1WDRA 3CZJA 1A47A 2VQTA 2X0YA 2Y4SA 1KR1A 1V3HA 4J3WA 4LX4A 2PI6A 1HKKA 3CUFA 1JD7A 3RDKA 3GM8A 2YA0A 1HJXA 2DSKA 4PMRA 4BCEA 4UFHA 1ISZA 1CLXA 2XG9A 2CKRA 2GJXA 1W1TA 4NI3A 2V5DA 3TOPA 3W53A 3MSGA 4J7RA 3N12A 1QI0A 4KWUA 4AZCB 4ATLA 2XFFA 3VPLA 1VB9A 2PWFA 5E6YA 3SCVA 4J3XA 3SUTA 1U2YA 2VX6A 4UNIA 1E73M 3ARWA 2DT2A 4HPGA 3WENA 4FLSA 3ZQ9A 2WYSA 1W1PA 2OWXA 4OOZA 4UQEA 3GH5A 4FK9A 4Z2IA 1BQCA 1PIGA 5HXMA 1QNQA 1ZJAA 3PBGA 1LQ0A 4PN2A 5GNYA 1H09A 2XWDA 3IJ8A 1GOQA 3W25A 3VIPA 1OD8A 4KH2A 2E3ZA 2FH8A 1GOMA 1WB0A 2JEPA 5EB8A 2J4GA 1KGXA 4Y7EA 1GOKA 1OB0A 2YL6A 3NSNA 3TTSA 1G94A 1Q6CA 2DIEA 5BXPA 2JIWA 3O9NA 2VZTA 3W37A 2E8YA 2CYGA 3SUWA 2OWCA 1EQCA 4W5ZA 3VMPA 1OGGA 3WD3A 2VZSA 3BAXA 2C7FA 3HN3A 1V3JA 1H49A 3ARVA 4MDOA 1VEPA 5I5RA 1U33A 4JHOA 3U5UA 1P6WA 4W8AA 2DSWA 2E40A 3LPPA 4E2OA 1IZKA 3NJ3A 4M56A 3WUFA 4RE2A 4GXPA 1NOFA 2OLHA 3T0AA 4HMCA 4QFUA 1UD6A 2J79A 4PCSA 1R8LA 1VENA 4MNMA 5I0DA 1TA3A 1JGIA 4U3AA 4MDPA 1E40A 2WC3A 3BMWA 2VNCA 4C7FA 5A94A 4OIFA 1LL7A 3PZQA 2XIIA 1PBGA 3VM5A 4XB3A 3QOKA 3N15A 5CSUA 3POHA 2WKLA 1UG6A 1GQIA 1R85A 3GDBA 3L2MA 1VFFA 3NYDA 3T2PA 4BF7A 1B9ZA 1OT1A 2D20A 3UG3A 3T08A 3AFBA 3I3BA 1E3ZA 5BYWA 1JZ2A 3GXFA 5C70A 3WELA 3QR3A 3S6TA 2BXYA 3I3DA 3W38A 3N18A 2G3IA 1Y7VA 5A1AA 1B3ZA 2J7HA 1BTCA 4WLCA 2VI0A 1UKTA 1J0JA 1UWQA 2VL4A 3CUIA 1ZBVA 5JBEA 1PX4A 3DHUA 1KFWA 8A3HA 3CLWA 3OLEA 4GQQA 1JI1A 4AIOA 2OSXA 3KZSA 4J3SA 2DSZA 3OGRA 3UESA 4D6IA 2EPOA 5LA1A 2XHYA 1JZ4A 5LYRA 1OBAA 1BYAA 1VEOA 2GVYA 1FA2A 4DUXA 2DSVA 2VZUA 1C8QA 1HJUA 4W7WA 4PMQA 3GH7A 4WF7A 1V02E 2XIBA 1C7TA 2J75A 3VD5A 1E4LA 1FP8A 3IANA 1UOKA 1UD2A 1WAWA 3WBAA 1UR0A 5FIPA 4KGLA 3AHVA 1EOKA 3RILA 5GPRA 3EDFA 2NSXA 2JIEA
chains in the Genus database with same CATH superfamily
3P81A 1TVLA 3QLDA 1CPUA 4A2RA 1HO1A 1DIKA 4RPPA 5HPOA 3HGSA 3TXZA 1E6ZA 3WLPA 4HU8A 3UZWA 2GL5A 3S1GA 2BXZA 3Q58A 2OLAA 4IIFA 1J0IA 2PTDA 1EGZA 2BHUA 4MAVA 2ISWA 1DJZA 1IHIA 1FFRA 1XFCA 3TU9A 3QR0A 1QVBA 2CZFA 2WZMA 1E6NA 1ISVA 2PD9A 1NTHA 6TIMA 2W6RA 5DFAA 5A8PA 3ZJ8A 2VFDA 4PC8A 2I5IA 3GIYA 1O5XA 3UA3A 2YB1A 4JQ3A 2HBVA 2BB0A 1BQGA 3VNZA 2ICSA 1I0DA 1R7OA 3OVPA 5CLWA 1XYZA 3PJXA 4F0HA 1HF6A 1WYIA 5ABFB 4PZVA 6CGTA 3DHFA 3GTXA 1HZYA 3PZTA 5CJNA 4DZ5A 1ISXA 4GVFA 1TVPA 3TW7A 1JNDA 3T2QA 4GZ7A 2WPBA 4LQ1A 3PZMA 4D6CA 4GY0A 3ARRA 4KRTA 2Z25A 3ENLA 3KHDA 3ONCA 2YZ5A 3PB2A 4M1RA 2JALA 2ZZ4A 2JF6A 3ID7A 3M1ZA 1PKLA 2YBTA 3CHFA 3M0IA 4CNNA 1GVYA 3VNYA 4AMAA 2Q6ZA 1WNOA 3DCPA 2I9EA 4HPNA 3ZZ1A 1M03A 2W9MA 1NF0A 1XV8A 2OGYA 3ZT6A 4IIHA 2CLMA 3EA1A 4GLEA 3N3MA 1HIZA 4GPNA 4JCMA 4V2XA 1YIXA 3WF1A 1T6MA 1XYBA 3C86A 1XIFA 2D3NA 3KTCA 1W0MA 4LCQA 1EJUC 2TSYA 1XLBA 5C7VA 3PUGA 4J35A 2WMHA 4Q8QA 4GC4A 7REQA 3ITCA 2ZRWA 4ZVJA 1MYRA 5D2YA 3W75A 3LX9A 4PCPA 3P6LA 5I77A 2D22A 1SW3A 2J47A 4H9MA 3BG3A 5JMUA 1UD8A 4BKNA 1NEYA 3LQGA 4XBJA 2V3GA 1NWTA 2CHNA 4QS6A 2XPKA 3VKDA 1W91A 3SCSA 3Q45A 3VZYA 4HG6B 2A6LA 4R85A 2SFPA 1DJYA 1EP2A 3F2BA 3K4DA 4OT7A 3W87A 2V5JA 3EX6A 4K1WA 1UR9A 3BOFA 3NXLA 1I1XA 2CZVA 2OYKA 2WVSA 4E8DA 1PTGA 1QW7A 1W9UA 5H8PA 4DQWA 1J93A 4S23A 1YRRA 2HXTA 4AIEA 3W02A 3GU2A 4JKKA 3T4CA 2R91A 3B9DA 1C93A 3S2JA 3WEOA 1NY1A 3H23A 1CGWA 3K30A 4A8IA 5M17A 5FCZA 4B5NA 4Q8PA 2FHFA 4MKVA 3O07A 3PBYA 4MKNA 2ZCGA 5SWUA 4JKLA 1I6NA 2PDWA 3VOGA 1P0DA 4UTHA 3RN6A 1V4YA 3A24A 4ZGYA 1E0TA 1SVDA 5L6UA 1Y65A 4ADTA 1JULA 1XDJA 2GSJA 1JCYA 1EJSC 3NQDA 2J74A 5LGZA 2C1HA 4LH8A 2CLFA 1EC9A 2ZZ2A 3S9IA 3ITTA 2BY1A 1IXPA 1EF3A 4AVOA 4RZ6A 2WW5A 5C9XA 3A9IA 4ML4A 3STGA 1ZBCA 3WF3A 1C8YA 4KRUA 1EC8A 4ZB0A 3QV6A 1V0NA 3GK0A 4NSBA 3CH9A 3CMJA 2WMIA 1OADA 2YX0A 1S2UA 2P0OA 3LCLA 4BI6A 2E6DA 4GYPA 3VIGA 4UR7A 5J04A 3FDGA 2I57A 2FMOA 3R10A 1V7AA 3DG6A 3EOEA 4Q3MA 3K5XA 3I7QA 3UNDA 1F9CA 2F38A 5E93A 3TWBA 4YVVA 3M6DA 4M80A 3EYPA 2ZVIA 3C0SA 3W1LA 4B3KA 3EWUA 4XZ9A 2VCCA 4X63A 2HBXA 3KX6A 3G1HA 1TV5A 1IT7A 4CCDA 3WQCA 1O6IA 2C19A 4YMZA 4ZOAA 4H4IA 4HBKA 2QMKA 1SFSA 2REQA 4JX5A 1OX4B 4JS3A 4UOJA 1T41A 1N2VA 2PGFA 3VCRA 4M24A 3WLOA 3PR2A 3MKKA 3WCZA 4Q22A 2Z6IA 4NRSA 4MWAA 3E3HA 1CDGA 3URNA 4X0NA 3WEZA 1TV2A 4NAFB 3TR2A 1CX9A 2ON3A 4DJFC 2CBUA 4XZWA 3UJFA 3TJ4A 4MUPA 5LNUA 3ICJA 2BOEX 3K8KA 1POKA 4Q4OA 2X40A 4B5VA 4S3GA 2G97A 6TAAA 1MI3A 2Q8LA 2QAFA 4UR8A 1ME8A 1VYPX 2X1TA 3AXHA 4WY0B 1S5VA 2QJMA 1FRBA 2VR5A 2PEVA 3BO9A 1CGVA 2QPSA 1H2JA 2PRMA 1OK6A 4QNEA 3M9YA 2HCVA 2XDFA 4PTWA 1X1NA 3MJYA 5KETA 1AVAA 5EFDA 2OJPA 4AG0A 1OFQA 1MXSA 2AL2A 1R3SA 4C6OA 4C1NA 4LVAA 3E38A 3WQ5A 1X8CA 2QJIA 3NYZA 4LUSB 3B8TA 4LAMA 3OIHA 4KCVA 4XO7A 2VTFA 3SRKA 3TTOA 1FH8A 2D3LA 1A5MC 5HULA 1B90A 3O6YX 2DZVA 3GRIA 3N4AA 2Z2AA 2WNQA 4EP8C 1WXJA 2WMKA 2OFJA 2WMJA 4C91A 4FEZA 1E5NA 4KKXA 2BY0A 1P4CA 3ITOA 5CSYA 2O56A 1JYWA 3RLGA 1WCGA 2X7VA 3GSMA 4MZ1A 2BNJA 2H8XA 3W2MA 2PU0A 1I60A 3STPA 4R88A 1VYSX 1PWMA 1W8GA 1ISYA 5D32A 1US0A 4FLOA 6A3HA 4Z1BA 4ADSA 3VABA 4CD5A 4V1YA 2UY3A 1MEIA 2FYMA 5FF2A 3H21A 1V0LA 3VIJA 1R7AA 3LMYA 1TO3A 5LIXX 3NPWA 1MWOA 2NT1A 2J78A 4HNLA 3W85A 1PCWA 4A3UA 4MVAA 5KZMA 3BK0A 4TQTA 4G8TA 4H9TA 2CWNA 1WA3A 2PP1A 1MSSA 4UFMA 2B0MA 1FWRA 5CPSA 5GJNA 5HMSA 3WLJA 3B97A 3WFLA 4DO6A 3QMRA 3HPAA 1Q6DA 3PZIA 5DBTA 1BTMA 5A3HA 2G8ZA 1PJ9A 4S3BA 5H8MA 2PTWA 3R1ZA 1DL3A 2PLMA 2ZICA 4O12A 4DXXA 3GO2A 1WZAA 3ZVHA 3R94A 3AI0A 3V35A 1ZNNA 2VMFA 2P0IA 5BU6A 1WO2A 3DZ1A 3OJGA 2D73A 4EF9A 4AD1A 4GZEA 1H51A 3VX1A 5LHEA 1XGZA 4H1ZA 4PUKA 2UY2A 5E0KA 4H6QA 3DDMA 1SM9A 3VX0A 4GXMA 1HGYA 4X9SA 3G8RA 5BOOA 2PB1A 1GORA 4LAZA 3BLKA 2QUNA 1FWFC 4E8GA 3AISA 4E5TA 3G1FA 3N6JA 4A3QA 2VR2A 1XDLA 2H9AB 4GCXA 4NJJA 2HJPA 2QYGA 1XC4A 1ZL1A 1W1YA 4C6FA 1XRVA 1UPMB 3TYEA 4M1BA 4A21A 1DTNA 2OQYA 5E9XA 1W3HA 2CLKA 3LGEA 2QKFA 3VGFA 1EJVC 3SCWA 2DV0A 3T9PA 2WBGA 3A64A 2F61A 1U1UA 4IPPA 1XIBA 3H2MA 1EZ2A 3CQKA 1EYWA 1L2QA 3K8LA 3MVIA 2A2IA 4MAZA 1T7LA 5DMNA 5F2GA 2DU2A 1S3HA 3N9SA 4EK7A 2YKKA 2Y8KA 3SURA 3OBKA 1FKWA 2QLYA 2WPGA 1RLDA 2XUCA 4Y8EA 3V0TA 4I8YA 1E6SM 1A4LA 4LY8A 1V3MA 4GCAA 3THAA 2W92A 1TCMA 1W37A 5B7YA 4OBSA 2Y88A 1TMLA 1V6VA 2DFAA 3BC9A 3EXRA 4CNUA 5KZ6A 1W9DM 3YPIA 1CXFA 4NYYA 1PS9A 3GWQA 1G0CA 4PSRA 1Z8AA 4Q4MA 4GYJA 3WK3A 4GZJA 3N9RA 3HG2A 2ZZ5A 1I8JA 3DGRA 2H3DA 1YNYA 3W3OA 2DUZA 5I79A 3CIWA 3P5ZA 2DIKA 3OYZA 2W61A 2WM0A 1JF6A 5F1VA 2EAWA 5F4XA 1E1CB 3KE0A 4BS0A 3FGCA 3CAQA 3UYIA 4C6MA 1Y5WA 1DORA 3GG0A 2VURA 1QHPA 3URAA 2LLEA 1TQXA 1V08A 3VUSA 2Y85A 2CLPA 5CPLA 1GW1A 2ZUMA 3WN6A 4OWGA 1JPHA 3G77A 4HOZA 1V6YA 1PTDA 3NQCA 4JDYA 5I6SA 4YWIA 1D8WA 5FACA 4H8UA 3QRHA 1QHOA 4IFKA 3BE7A 4F0SA 2ZKMX 4FZIA 1AW5A 1B30A 4UTKA 3PF3A 1OM0A 3QN3A 3ANUA 3MUY1 3F5LA 4E2VA 5EFFA 1AUSL 3Q67A 3L4XA 1DJNA 2NV2A 4U3CA 3EBVA 5CC6A 2ZWYA 1IWBA 5T26A 4AZ7A 4D6FA 3SUUA 4BJHA 4C6IA 4GINA 1XBVA 1KKRA 1EX5A 5C2CA 3WLIA 3TYAA 3KBMA 4Q8UA 3W0KA 1XLLA 3G1YA 3UGRA 3VD7A 4WX2A 5AYXA 1G1YA 2R94A 1KQYA 3L66A 2FLIA 1ZJBA 3T07A 1E0WA 4LRSA 3LBMA 4NZ3A 3QPEA 4ZENA 2DDXA 2GGIA 1J96A 5H1WA 3I10A 2VX5A 4IL2A 3N11A 3RIKA 3DFHA 2RJGA 1TV7A 4LXFA 1QWGA 3PSVA 3LHTA 1YBQA 2HROA 1MNZA 2DVTA 4UXDA 4KQNA 1ISWA 3LD5A 1GZ1A 2DUAA 3H2OA 1VPXA 3LCGA 3BW2A 3GFYA 1GNXA 2VX7A 4HZ6A 3S47A 2ABBA 4L4MA 2QGYA 1TPH1 4YU1A 4AUBA 3CAKA 3BAJA 3NEVA 3OP2A 4D1IA 2P88A 2VGBA 3SJNA 3LK6A 5I3FA 1RVGA 2OCZA 3OZYA 4ML9A 3ZR6A 4AZ5A 5EY5A 3SUSA 3FX4A 4GNVA 1ODUA 3NG3A 5IFTA 3B0YA 4WCJA 1E56A 2PAJA 3AMCA 3MDWA 3M5XA 1MNSA 4LPCA 2V3DA 4C5ZA 3W00A 1EDQA 3CJPA 1AQFA 1NF7A 4PBFA 3PUEA 1F3XA 3GW0A 4YXGA 3W2JA 3L5AA 4NNCA 3WF2A 4TVCA 3S0CA 2Z1BA 3I65A 4ZQNA 4Q8VA 3BTNA 4QQUA 4DF2A 2YA2A 1Q4NX 4M8UA 4YYCA 2Z00A 3ABXA 4GVIA 3F5JA 1KBLA 3LSCA 1GW9A 5FEPA 3QZAA 2C15A 1AW2A 3UWQA 2BXVA 2JQXA 5DEZA 2NW0A 5LIKX 3VKAA 4NL1A 4NRRA 4HNNA 4FF5A 3GNPA 1YADA 5EMYA 2V3EA 3BH4A 1TJPA 1A50A 3OZMA 3SAZA 4ZFMA 5CQ1A 1IGWA 4XAYA 2VQUA 4UWMA 3TWAA 1DWAM 5BRQA 3UZZA 3ELFA 3SN1A 1L0PA 1BWVA 1EGVA 4DXVA 5K2ZA 1AW1A 3PPFA 3E1F1 3GZ3A 3TQKA 3PULA 1ECEA 2XN2A 3T0DA 3AZTA 1HJVA 4MNLA 2F8QA 3HM7A 3R89A 2OZ0A 1DV7A 4KETA 3QZEA 3F7JA 2W5FA 1W17A 3LZ5A 2DUXA 4ORIA 2O0TA 4Q7BA 3P0XA 4ZOBA 3DN5A 4HJFA 2BG5A 1XDMA 2PCEA 1HXJA 4I5RA 4HCHA 2WOQA 1CI1A 1DE6A 4ZQOA 1Z9AA 5TNVA 2ZA1A 3G8EA 1WV2A 1RHCA 3CMGA 4XBKA 4F8XA 3B05A 1OYCA 1WDWA 1FWNA 4TV5A 5K9DA 4BWLC 3NZ1A 3SGZA 3QGAC 6REQB 3U9IA 4CCCA 3A21A 1W1B1 3G0SA 4Q6JA 3ITGA 3H54A 3I7RA 2Q09A 4EANA 3L4ZA 3TMLA 1GZJA 3ABOA 1V0MA 2PF8A 1OEPA 2WSYA 4JTTA 2J25A 4DNHA 2BVYA 2GUUA 3S9YA 1TJ2A 2DZXA 1HL9A 1YXYA 3MANA 3U48A 1L2UA 4TUFA 2PC4A 1A5LC 2HS8A 4F0KA 4Q8MA 4UFLA 3V16A 2VXNA 3KUMA 1OCBA 2AKZA 2PGRA 4F4RA 3KBJA 4PTDA 3R25A 4K36A 2BZNA 1BYBA 4WJXA 5HUPA 4C6KA 1BGAA 4NILA 4A05A 1C8VA 2J7DA 3AS0A 4S1FA 1RH9A 1JCNA 4AF0B 1P0EA 1NH6A 3EWBX 5AHMA 4AD5A 5CAKA 4NZ4A 1ZGDA 2PC8A 4WOZA 1QU4A 3NSMA 3AO0A 2CZDA 9XIAA 3W2UA 4MSSA 4EWJA 1V02A 2Y7DA 2ZX6A 3ZLGA 3MP5A 3P14A 5CPQA 3TAKA 1XKYA 5BOEA 4PRRA 2FTYA 5MF5A 4NUWA 2Z4GA 4XKYB 4C6CA 3SO7A 1UWIA 2P3ZA 1LTDA 3WBYA 1AJ2A 3ATZA 1CYGA 3WBWA 1Z6KA 4MJ2A 3RFAA 1ESWA 1V6UA 4C6NA 5HJYA 2RDXA 3VOHA 5DXYA 1TELA 1SGJA 2BFGA 3OB8A 1EYEA 2CU0A 2V38A 1AA1B 2VEKA 4R9XA 4JN6A 4GNJA 1MUWA 4KWWA 4J5NA 1A4MA 4GKTA 2PMQA 3CQ0A 3CQJA 2HNHA 4QHRA 1V79A 3RNDA 1US3A 3IV3A 2X16A 2OZTA 2X30A 3PPCA 3EDJA 4OZOA 4ROPA 1NFBA 1H1NA 4P7NA 1TPB1 4MHBA 3RLVA 3TN6A 4TV6A 4OUEA 4E6MA 1DJHA 5LIYX 2YPIA 3GR7A 1VLIA 2PRLA 1PKYA 2J7BA 1VJZA 4PMYA 3IIOA 1HT6A 4Q8OA 2HPIA 3OLGA 1F05A 4P7RA 1OCJA 3VK5A 2VEGA 4AC7C 3W4RA 1QK0A 3H4GA 1TB3A 4HB7A 3LXCA 3CZLA 4LNYA 3F2DA 4HU0A 1K9DA 1CXIA 1H11A 3M0JA 2V82A 4EWND 2Z28A 3EA2A 3V1PA 1LUCA 5F7UA 4FP1A 1HVXA 1LBLA 2CNCA 3MV11 5BRPA 4IIBA 2FPTA 1XLMA 4AYSA 5EMMA 5FF4A 1YQ2A 2AAAA 3WDRA 1U1HA 2WNNA 5REQB 1FFQA 2Q02A 3SIMA 1XL9A 1H7OA 1UQZA 3VDBA 4DB7A 3G1RA 4H7CA 4C5YA 5J5RA 1F4HA 4H7VA 3MW7A 2ONEA 3SB0A 1BVNP 4GJ1A 3SQSA 3P67A 4OU1A 4R53A 4AU0A 4NXKA 1E55A 2OZ3A 3PUOA 3NDYA 3KVMA 1TWSA 4O0QA 4REQB 3QYSA 4H01A 4MB5A 4MG4A 1CGTA 6PTDA 1BVWA 4MUZA 1FWEC 1C9DA 1ZSXA 7A3HA 4L5ZA 3H2CA 1XIIA 4OHQA 4E0CA 2F9RA 1KBBA 2YJQA 3HURA 2PTYA 5A2BA 4K2SA 2V2DA 3BLEA 4IP7A 1PTAA 1SMAA 2V30A 4MB1A 3M47A 2J88A 1B54A 3MYOA 3AMLA 4S39A 1QTWA 1GYNA 1HO4A 2B31A 5BWAA 3DH7A 1XSIA 2ZX7A 3SECA 2I16A 4KWSA 4MB3A 1UR3M 3EWWA 2CZEA 3PFRA 5ENLA 4WRHA 2DQXA 4XG1A 3RR4A 2YXOA 4GMEA 4UR9A 3GG1A 3S3GA 2OQHA 3E2VA 2PBGA 4G7EB 4QQ3A 1AZ2A 2NUWA 4KMQA 3JU2A 2XTKA 3CZ8A 4D8AA 3LXBA 3R8RA 3AXMA 4LUTA 4B9YA 3MO7A 3WQ8A 4C6JA 4AZHA 2G3NA 1XYLA 2YXGA 4IX2A 1XCWA 1W9BM 1YW1A 5I03A 3H26A 2G4FA 3C2RA 3WNOA 1U5JA 3HO8A 4GIRA 1F4AA 1S2AA 1IIGA 1TX2A 1ONWA 3PBWA 4IIGA 4M6UA 3HFYA 4QROA 1XD1A 2J6VA 7TIMA 1HKJA 3V5OA 2TAAA 4LF2A 3WNMA 3EPMA 4UOZA 1SYTA 1W3LA 2HE5A 2V67A 2RGLA 2PWHA 1SMDA 4ACZB 4EXAA 2CKSA 4YHGA 1EO5A 2QUVA 4BQ3A 3PAJA 4JIEA 3UCDA 3H7VA 4GVGA 1VKFA 1XBZA 3WQWA 1B57A 4O16A 3WMSA 5AC6A 2YCEA 4B16A 3PZOA 4MY9A 3PS7A 1HQTA 1OF8A 1MUMA 3LTPA 3AZSA 3AMDA 3UG4A 1EFZA 3S2LA 3SCQA 1GVOA 3PZVA 3TQVA 1EJTC 2HVMA 5LZLA 3AOFA 1WDPA 5FL0A 4PMZA 3B4UA 3LI0A 1TE1A 2VDHA 2YCKX 5E70A 4FXFA 4QE1A 3ZFHA 2GDUA 2GWNA 3IRSA 2WSRA 2REQB 1YDVA 3M41A 3WDIA 1H62A 4IF2A 4TR9A 2C1GA 4I90A 4L9XA 3TNOA 4DYKA 3AWNA 4DWSA 1E72M 1FWAC 2QVHA 2QDEA 4MWAB 3LNPA 3GXDA 4L1XA 3D47A 2QT3A 4S3JA 1IWPA 3U7VA 5F1UA 4YJ5A 1UD3A 5AC5A 1CENA 3LZ3A 4HOWA 4FMVA 2GK1B 3CZJA 4FOKA 2W79A 2X0YA 5C55A 2O55A 3M43A 3CUFA 3TYBA 3RDKA 3GM8A 2EG8A 2QULA 2XG9A 1PB0A 5BNKA 1W1TA 4NI3A 1KV5A 3T0TA 1QI0A 3KCOA 3GS6A 3REQB 4KWUA 4ATLA 2XFFA 4K3ZA 4I7WA 3W01A 4P02B 3ZQ9A 2WYSA 3TW6A 2X0SA 1W1PA 1W5OA 4GG9A 4OOZA 1VHNA 1PIGA 5HXMA 2BBFA 1PWLA 1OFRA 1EBHA 2AL2B 3PBGA 4C1NB 4IMFA 2GSHA 5CSSA 3W25A 3VIPA 1OD8A 4V33A 4EXQA 4A22A 4MFDA 2QCMA 4WGHA 1WB0A 2JEPA 3KHJA 2G4JA 2YB4A 1OB0A 2YL6A 3TTSA 2Y89A 1Q6CA 5JH1A 3CMFA 3S2MA 1JEZA 2E8YA 3N14A 2OWCA 3RAOA 3RX4A 3USBA 4JIPA 1OGGA 2HVOA 2VZSA 3P93A 3HN3A 1H49A 3DI0A 1U33A 1LZOA 1N7KA 4KFNA 3HG4A 3LPPA 2J27A 2PU1A 4RE2A 1JPKA 1NIUA 1IEIA 3QKEA 4HMCA 5AHIA 3W84A 4DRSA 4NZ5A 2A79A 2YCLB 3BMWA 2VNCA 5A94A 1OFOA 4OIFA 3PZQA 3LRLA 3VM5A 4XB3A 3P0WA 3TNBA 2IQDA 3LHYA 4GYFA 1UG6A 4N02A 3W74A 3E0IA 3NYDA 4BF7A 1OT1A 4GBUA 3M44A 4L4LA 1E3ZA 4YYFA 1TWDA 3FVMA 5BYWA 1JZ2A 4UMBA 1KKOA 5C70A 3N2XA 3QR3A 3W38A 1ONXA 3N18A 2G3IA 4QSFA 5A1AA 2GWGA 2J7HA 2XIOA 3WG6A 2HV5A 3NL3A 3RU6A 2PTZA 1HFBA 5I06A 2W27A 3GG8A 1KFWA 8A3HA 2IMRA 3LGGA 3OLEA 4GQQA 2F6XA 3KZSA 1OY0A 1QCWA 4AHQA 4J3SA 4IOTA 3FOKA 1EIXA 3UESA 5B80A 2XHYA 3B8VA 5MKGB 1OBAA 3QR1A 4US6A 3EWCA 1BYAA 1VEOA 1PL9A 3ZVHB 4PFMA 4PUMA 1MRAA 4OVXA 4ERGA 3KFTA 1GWJA 2B7PA 3TQ0A 4N9CA 4WF7A 3WMLA 2J75A 4JR5A 4O52A 2QXWA 3QVQA 1UD2A 4LY4A 3ES7A 4MLJA 4KGLA 3M0MA 4RW5A 3GNXA 4UTIA 2NSXA 3ABQA 3ABSA 2DZAA 1GTEA 1ZU8A 4NJGA 4EPEC 1W2PA 3AJ7A 4DJDA 1D8CA 3FA3A 2NLIA 1US2A 2ZXQA 2XGZA 3S4TA 1V6TA 3A5VA 3BW4A 3TW9A 3WUEA 3HPSA 2E68A 4K8HA 2VELA 4BF5A 5M2FX 2W62A 2DZWA 4O28A 3KVJA 4RNJA 3UQNA 4UTLA 3KS6A 3L4YA 1WE5A 2ZBTA 4JCLA 3BSMA 4GUJA 1AMKA 2A3AA 4P8UA 3W81A 4ZTYA 2OX1A 2ATMA 2PURA 3TIMA 2IQ0A 2VM8A 4LAOA 1XBXA 3FKRA 1E3XA 5CZKA 4CU6A 3RPTA 4JTJA 1HJSA 4DJED 3T8LA 3EMQA 3O06A 2GQ9A 4HK5A 1LM1A 3MI2A 2NQJA 3PWIA 1HJWA 1X98A 3ZWSA 4X0VA 2KZHA 3R4IA 4NAEA 1RY8A 3FSTA 3UJRA 5IRPA 1RLCL 2J8GA 2Y7EA 1H60A 1Z32X 4OTKA 1N82A 3QTPA 4LS1A 1GVIA 2J8TA 3KZPA 2IXUA 3LS9A 2GUYA 4DZHA 3D46A 5G4HC 3I6EA 4W7UA 4OKDA 5AZ0A 1JDAA 4L6HA 5D04C 3GTHA 3K4AA 3QPZA 3PBMA 2Y0FA 3GAKA 4GK8A 1FQ0A 2D24A 2P3EA 4P8WA 1I0BA 2XSBA 2PWUA 5DRCA 3B4YA 5D38A 3SI9A 1R3RA 4RR4A 3PNZA 1I2PA 1OC5A 3KL0A 3FW6A 1UZHA 4GXWA 3OOQA 1H0GA 1PEZA 4BA0A 3H70A 1R30A 4KCWA 3DFYA 2XH7A 4UBPC 2E1WA 3UZYA 4QDMA 3LYEA 3KOFA 3KL5A 2B7QA 3D5HA 3JS3A 4G5DA 3APYA 2IKGA 3AIRA 4RNFA 4GOAA 4IFKB 4HHHA 4EX4A 1QK2A 2PP0A 1SZEA 4D71A 3OEXA 1I2QA 1SSDA 4DZAA 2DZUA 4XAPA 5A6BA 3NPVA 4FOUA 1KRCC 4Z1DA 1B4EA 4DVOA 1AQ0A 1AQMA 4JPGA 5K7JA 4HCDA 1B0IA 3TYUA 1PX8A 4KBXA 4ZXOA 3E0LA 4DBEA 3W70A 4O10A 3CHCA 4B5TA 2YGYA 3RF9A 4I9MA 5HWJA 2BS9A 3T2OA 2EPKX 3AAMA 2RFGA 3BQ5A 3QY6A 1ZAIA 5KITA 2IQTA 4GABA 4WR3A 4XZMX 1R6WA 2NUYA 1B1YA 3MSDA 1YDNA 2C6QA 4M7TA 4WXZA 1JZ7A 3WL0A 2D2JA 2AOSA 5HR6A 5CBBA 1YXCA 2GVGA 4Q4QA 3WMBA 3IK2A 3ZLHA 1TUXA 4LCRA 3A23A 7CGTA 1YBQB 2ZFAA 4J9JA 4LUJA 3IRDA 8XIMA 1HKIA 4L4OA 1K9TA 5I24A 1ML1A 1XUUA 1XLIA 4F2TA 2VOMA 4KCUA 3BG5A 4H9ZA 2DZTA 2ZZ3A 2WZEA 4RE3A 1J0HA 5CPNA 1EEPA 1XRFA 2OG9A 2QGHA 1O68A 1JZ6A 3TC3A 4O1DA 1Q6OA 2ZX9A 1HX0A 3PWGA 1NARA 3LB0A 1H3GA 4DLMA 2XGBA 3O6AA 4LFYA 3STCA 1Z7AA 5DLCA 1RBAA 1U5HA 3GKAA 3WX7A 1NJJA 5FOOA 1NDVA 3SCOA 5BCAA 1KXVA 2ZUWA 4UTFA 3NR0A 1L6FA 3ZR5A 1R2TA 3PG8A 1BHGA 1J79A 1BYDA 5BW6A 3VO0A 2X2GA 4QG8A 3NOEA 2FIQA 3W2NA 3DC0A 1CTNA 3F5KA 1IXQA 4UQAA 2GOKA 4W86A 3K1DA 2FGZA 5IBXA 3BURA 2EPLX 2UZ9A 1S5NA 1MQRA 1CGYA 1WDSA 1IQ8A 3QXBA 3IAPA 3KDOA 2WCAA 3CTLA 3IGSA 1V7YA 2VGIA 1KRBC 2ATSA 2VKZG 4LWWA 3UW6A 1DYSA 2QS8A 4A2SA 1RAKA 3G6MA 1UW9A 2YFNA 3APGA 2QDDA 3A4AA 1JDDA 4V15A 3T40A 1OX5A 1M7PA 1ADDA 1SJCA 4QITA 3LLDA 4TX6A 3W7OA 1X1ZA 4JTCA 4WGXA 3GAYA 1EF2A 4AD0A 3IJQA 1RVKA 4HNOA 1SFLA 2GGHA 3TYCA 3O3RA 3UR5A 5IFPA 4CN6A 1TR9A 1YDOA 5A2CA 2YL5A 1JRBA 4UFKA 4BQ4A 5GQBA 1N8FA 2PGWA 2V68A 3MZ2A 4JN8A 1O66A 5HNRA 3DFPA 2WV8A 6ENLA 5HANA 8XIAA 3EEGA 2OGJA 3GDRA 2A7RA 4AWSA 1JF5A 4GC3A 1FCVA 7XIMA 3KM8A 3S42A 2GQAA 4G56A 1O5QA 2QJJA 4Q4RA 1R9ZA 1RK5A 4QG9A 3RCNA 1E4IA 4IJRA 4DEFA 1DOSA 5FD0A 2V3FA 3AYVA 2FPYA 1S2TA 1K1DA 1J10A 4RNIA 2Q01A 1FHUA 1RA5A 1UBSA 2VFIA 4Y6GA 1HN1A 1XGEA 2XM1A 3BLPX 4U4MA 1LWIA 2HMCA 3NFUA 1S2VA 3TJXA 4UQDA 5GVJA 4A29A 1F2JA 1TPC1 2DJXA 3VKKA 2XVNA 2PWDA 4K8EA 1UOZA 2FVKA 4JFTA 3G0UA 4Z2KA 2Y1HA 1FWSA 1SSGA 4BZYA 1V3IA 2O4MA 3SSZA 1IT0A 4AD2A 1KTBA 1A0DA 3K1GA 5LNRA 2Q3RA 3BWWA 4D6JA 3VCNA 3NVDA 1UWSA 1TMQA 4ATWA 1S5TA 3PJUA 1NDYA 3HJZA 4FXSA 4MM1A 3ITYA 4FNSA 5DRIA 3C0QA 3U4AA 1U22A 1JUBA 3UWWA 3W82A 2Z2BA 4HOXA 4GQBA 2OODA 5EYWA 3LG3A 2GJRA 4GVHA 3R8GA 3CB8A 3W1PA 4HK7A 3BAKA 2IKIA 1GVFA 2W4XA 2I9UA 3V75A 3G1VA 1BRLB 1T8QA 2XH4A 3PG9A 3CZGA 4UFJA 2A3LA 3VDGA 3VIHA 3EOUA 2INEA 4GUIA 4JQAA 3GDMA 5FF7A 5TIMA 4JQ4A 3U0HA 4WD0A 5FF3A 4KEMA 2ISFA 3QQ1A 2ZXBA 1WOAA 1JRCA 2P8CA 2XU2A 3HU7A 2OVLA 2NWRA 1R5YA 2VUNA 3RCMA 2R8WA 1LG1A 4F79A 1NOWA 2XYLA 5XIAA 3GR4A 3OG3A 1DIDA 1RQHA 3C52A 4C65A 5G1MA 1UROA 3NUKA 1DKWA 5G1YA 3N6QA 5C9ZA 3KL3A 3NQBA 2J77A 2DY3A 5JIWA 2PDXA 1R86A 3T1GA 2DIJA 3ARPA 3MUIA 3P3BA 4FLRA 3ZXWA 3LQLA 3N1AA 1K70A 5D02A 2EO7A 4FR6A 1TWZA 1KCKA 4MNKA 3A5FA 1T99A 2X7WA 2D23A 3WQ4A 1PUDA 1QATA 1SU5A 4O50A 1LUCB 2C16A 3HQOA 4C1KA 1OYAA 3DIPA 3RJYA 4Q8WA 5HR7A 5G5IA 2AAMA 3BMXA 1X96A 3LXAA 4JHMA 4OECA 1D3HA 2FZDA 2YOCA 3MP3A 4QGCA 3FLUA 3SY1A 3OIXA 2EXOA 1GHSA 4J27A 2PFHA 2W67A 2ZZ6A 4AMCA 3W1QA 3TTEA 3MB9A 4ZXLA 1YTKA 2QV4A 3L5LA 3R0DA 4IJCA 5IDZA 1AH4A 1E71M 2YIHA 3QZ6A 3ALGA 3OLDA 1TSIA 3WO8A 2CCRA 3T7VA 2GGJA 4GY7A 1D3GA 1E6XM 1XLGA 3NQ7A 3NQVA 3SADA 1LYXA 5AHNA 1R3YA 1SW7A 1MFUA 3W83A 3CBWA 3QOMA 5A5WA 1HVQA 2HK1A 1XLEA 2ADAA 4H7ZA 1FTXA 3PHAA 1QT1A 4Z08A 4Q7IA 4PRWA 2VVNA 2YCJA 5HQMA 1ZJIA 2EBNA 1GZGA 2EPMX 4L4PA 3E0FA 2PGEA 4TU1A 3M5YA 3PZUA 4ZZ9A 3QW4B 2FFIA 5F2LA 1OZQA 3FYPA 4N6FA 4IMEA 3TONA 3TR9A 4JTEA 1UKPA 2XIMA 4JTKA 3ARTA 3TMQA 4LSBA 4KEZA 2OKOA 4Y2WA 4NJHA 4E2BA 2RGMA 4FA3A 3LPOA 3WK2A 2WZHA 1JIBA 1TQJA 3H7UA 3PTMA 1V3LA 2GGGA 2HRWA 2H8ZA 1MUCA 1GKPA 3MI6A 4LUTB 4DUWA 3P84A 5D37A 3B9EA 4OUIA 5E5CA 4L9ZA 5CGTA 4DXKA 3UA4A 3VOFA 4J3VA 3B04A 5U4NA 1TTIA 3KVLA 2G37A 1V77A 3CB3A 2FTWA 2DZBA 4DO7A 1C92A 1S2WA 1E9YB 4DPQA 4JTAA 4PTMA 3C2EA 2WJZA 3UCQA 4AFYA 1N8IA 1NFGA 1G01A 2BWGA 2ZWZA 2PF0A 1XG4A 2QUTA 4KRZA 3NL5A 3C0JA 1XXXA 3CC1A 3DBNA 3SDOA 1F61A 2NXHA 1NFPA 3BZJA 5U7SA 1XSJA 4LF1A 1J6OA 3CO8A 1EHAA 1S3TC 4N42A 5A6SA 3AYSA 1VYRA 3PC0A 2C1IA 2X2YA 2X1RA 1BWKA 1V03A 1M7XA 1FX6A 3RU8X 1O12A 1SO4A 3EEZA 4OE7A 1PAMA 1VRXA 3CK5A 3C3NA 1RV8A 1XYFA 5FJPA 3SY5A 2QW5A 4CQ9A 2GUBA 4BEQA 3PFMA 2E5DA 2ZDRA 1OFEA 1KO0A 1O1HA 5TF0A 3FVDA 4LBRA 2ZUTA 3VILA 2W0UA 4J2PA 4HYVA 3TSDA 4W5UA 1IXOA 4QX4A 1GG1A 4K7YA 1UP2A 2BODX 5C6MA 3O16A 3MBFA 4HA3A 1EDGA 2Z26A 3WJYA 3IWPA 1RA0A 4DWSB 1Y5VA 4CEUC 3E9AA 1KLYA 3S5YA 4CVWA 5HA7A 4KFOA 4KPLA 4E4UA 1GQLA 2ZXAA 3WQVA 4S2BA 3V4BA 4D1JA 2VEMA 1A53A 3IJ9A 4AHPA 2TODA 3L4TA 2WVVA 3W7PA 3S46A 4D8ZA 3CUJA 4H19A 1FCUA 4AVFA 3ALFA 1GOWA 2HDJA 3U2ZA 4C6QA 5D9OA 3VNLA 3T0BA 2ZC8A 5AOUA 1HKMA 3W72A 1XYMA 3QSTA 1UZDA 4HA0A 3TCEA 5D03A 1UC4A 3AWOA 3UJ2A 5ECUA 3BVJA 2Y8VA 2A7PA 2RKXA 3MCOA 3NDZA 5FJUA 4RZ4A 4YCOA 3NWRA 4OBTA 4PTXA 2VFEA 2GJLA 1FBAA 3L12A 5K4ZA 3QJAA 3W1TA 3MYPA 1DWJM 3SN0A 1T96A 4MZ8A 4TX9A 4ZB5A 2QR6A 2F2KA 2NX1A 4JX6A 3UR7A 3PUDA 1PZ1A 4NNAA 1ME7A 4BQ5A 3UXAA 1H5YA 3ITXA 4GGHA 1JZ8A 1KA9F 4P7QA 7ENLA 4QP0A 1TPDA 3BCJA 4FNUA 4AZCA 1QDSA 3V7PA 3VD3A 3TN5A 1K9FA 2I17A 3KP0A 3MCNA 1EA9C 1QPQA 2GLKA 4NZ1A 1MMFA 4IX0A 2PA6A 1FH7A 3URQA 3Q4DA 3OO2A 3H8AA 4FIQA 1ME9A 1CXHA 5ABEA 1PZ3A 4YN5A 3ITLA 1BF2A 4WDWA 1KRAC 3RJXA 3B0VC 4I9TA 2Z7KA 3ARUA 1NQKA 5EBUA 5DCEA 3H12A 3H55A 1FHDA 2PP3A 1U83A 1P6BA 3GW3A 5HNTA 2H3BA 4ZTXA 2ZADA 3VMOA 1IIHA 4O53A 2VEFA 4I7UA 3D3AA 3A4XA 2Q3OA 3GDLA 1J11A 2V5KA 5A6LA 3AIWA 4P8XA 1WX0A 1OGSA 3OGSA 1F5ZA 5HMEA 4OV4A 4JTIA 4WVXA 2GVLA 3BSGA 4PMOA 5KEZA 1ZFJA 2BX7A 1RD6A 1O4UA 4L6DA 1HP5A 4AD3A 1SO6A 2ZX5A 3WNKA 3GLCA 4GE8A 3S5SA 3IVUA 4O8AA 1ZCOA 2JE8A 3T6CA 5LHFA 1OYBA 1EJWC 4IUOA 5T9BG 3W28A 3TLQA 3MKVA 2WO5A 1C90A 2PUZA 4H8VA 4LS0A 4ZSTA 3DFOA 2QEZA 5DY2A 1P0BA 2RDUA 4GI9A 3NNTA 3N9KA 4H2CA 1TPEA 3NQ8A 1OIMA 4B2DD 5AC4A 1LP6A 4UNLA 3TJIA 1LG2A 4HPHA 5AFDA 4JFSA 3VFLA 3K4WA 3CM4A 1AG1O 1MEWA 2P1FA 3AMGA 4XD3A 3F1QA 1KWGA 1B3WA 3ZSTA 4B5XA 3LN3A 4WIWA 4MPQA 1QPOA 2YZRA 1W1A1 1HTIA 4HTBA 4ZBCA 1E1EA 2ZDSA 4NHVA 1H7NA 2UWFA 3IACA 1UH2A 4YPJA 3VGGA 4AEOA 3MTWA 1YTDA 4IHCA 2H6RA 1O60A 2ZUVA 2PZ0A 3SFWA 3UXKA 1FWTA 1Y0EA 1UQYA 3WQFA 3DXIA 7PTDA 3TZFA 4XVDA 4R33A 2Q71A 3AHZA 3H24A 3VE7A 1ITUA 1O7AA 4E3TA 4UQ9A 3GVRA 3SEPA 3C3UA 4ZFCA 4NZCA 1QW8A 1W3TA 4C6DA 2DPEA 3VZZA 3CAWA 3MV01 3IJIA 3B0PA 5A8GA 2XIQA 3BCFA 2DJLA 1M01A 1HG3A 3HPXA 3O6CA 2E28A 4HVXA 4MF4A 3GY1A 3VIIA 5BZAA 3LENA 2QDGA 2ZRXA 3CT7A 5GNXA 3LPGA 3MUCA 5B7ZA 3VAVA 2B7OA 3NQEA 5EGRA 5JQ9A 3QHOA 3PN8A 4R7OA 5G4EA 1KCLA 2JKPA 4MB4A 3T8QA 3D3FA 5DMMA 4DJFD 3UWUA 1XLKA 1JCMP 2A7NA 1Q6FA 3MMWA 4R34A 4WKAA 3UZXA 4D6EA 5ABFA 1SUXA 2ZUSA 4IGMA 4JTHA 5C2GA 3OBAA 4MPKA 2ZXDA 3GU1A 4NT0A 3QHNA 2F6UA 6ALDA 2J8FA 3N34A 5A8MA 4BWLA 3MHGA 5FEZA 1QNOA 3O63A 1O94A 2UY5A 1L6YA 4N0RA 3SY8A 3WDHA 2VFGA 5EKYA 3V0SA 3VCCA 1TJ0A 1ZHAA 4QNWA 3GXTA 5HWNA 1H5VA 3HV8A 4IL0A 2A21A 4AZIA 3W29A 1EWDA 2CERA 3FY1A 1V0KA 1CNVA 2CEQA 3OA3A 5DN1A 3TJLA 5AZ1A 5LKYA 1DJQA 1M04A 3SRFA 3BW3A 2WKGA 1KBIA 4J3TA 3OVRA 4YS1A 2V8ZA 1I45A 5BXRA 3DFTA 4BY3A 3DECA 1TPVA 5HMFA 1PCKA 1JAKA 1PKNA 2ISVA 1TFVA 3DYMA 2E9MA 3CPUA 2GSEA 3SQLA 4INFA 3KTXA 2KX9A 4P61A 4B5SA 1E5JA 1VCGA 4QTGA 3WZ0E 1VBHA 3SSJA 1KRMA 2YW3A 2ZOXA 3RPDA 3C4UA 4ZSUA 1GOOA 4UCGA 2TMDA 3A9BA 3AYTA 4ORMA 4HNVA 5FJRA 3TC6A 1AL8A 4JDBA 3VNKA 3GUGA 1Q8AA 1FHVA 2CXEA 1WKDA 4RUBA 4MGGA 3EDDA 2ISDA 1BSIA 4MY1A 1QI5A 4D72A 2ZRUA 1OFAA 2RDTA 4JQ1A 3FXGA 1TRIA 3DYOA 1F3EA 4ZO7A 3L5MA 1UD4A 3NZGA 2ASHA 3RRAA 4UTWC 1EOMA 3M5ZA 5E09A 3GQYA 4L7ZA 5EA9A 1J4EA 4WSKA 4H8HA 3U2OA 1RUSA 3IIVA 3P2VA 3TV8A 2CPUA 4OGZA 1VIZA 1F3TA 3DAQA 4NZJA 3EMCA 2QCLA 5A8NA 3CL7A 3UR8A 4GI4A 3HQNA 1RALA 3PM6A 4X3ZA 4TVDA 4FOJA 4LBUA 1D2KA 1UMLA 3MWCA 3EX4A 3UXDA 4EKJA 2Q8ZA 4CQCA 2FVLA 2J66A 2FHBA 5FKYA 5T8GA 3VM7A 1ZB5A 3BQ6A 3N4FA 3GC5A 2R24A 4W84A 1WUFA 5CZTA 2WLZA 2ALDA 2OB3A 4U33A 2FZMA 1GCYA 1SZRA 1KXTA 4YTRA 1PDZA 5BROA 2OOGA 4DLFA 1M68A 1M5WA 1GVQA 2EEXA 1EWEA 4M6VA 1FUYA 1PYFA 3J7HA 3CV2A 2R14A 3G24A 4HZ7A 4ZQCA 5G1TA 4PUDA 4XBSA 1BG4A 1HNYA 3RK8A 4LYQA 3W7HA 4LYRA 3T0CA 5I78A 3WF0A 4CD6A 4XZNX 3W7KA 4ZR8A 4S38A 3PJWA 2EPNA 1E6QM 4M81A 3SZ8A 3DC8A 3W7DA 1KBKA 4UMAA 2XH0A 2WC4A 2XWEA 2VWTA 4FNQA 1L8NA 5LA0A 2Z27A 1G4EA 4YL2A 1FKXA 2MANA 3ABZA 1A5NC 3BUVA 3F4VA 4RJEA 1A47A 4XSLA 2Y4SA 4J3WA 3EWYA 4PRTA 2YYUA 1QRQA 3B8UA 2UV8G 2G96A 2YA0A 4QDWA 1FCBA 4FX7A 4UUIA 3TA6A 2CKRA 5BMXA 4QEEA 3NEHA 3S8HA 4IPJA 3TOPA 5HWMA 3N12A 4PTNA 3NGFA 3VPLA 1VB9A 2PWFA 2I1OA 4J3XA 1U2YA 1JQVA 4UNIA 1Q6RA 1E73M 1EUAA 1GTHA 4HPGA 3WENA 4FLSA 3KBSA 1UP0A 3HGRA 4FK9A 1BQCA 1K8CA 1T0OA 2AGTA 4AB4A 4FR1A 4RV3A 4IFOA 4FS9A 4JTFA 2DVXA 2HPMA 1QOPA 4PN2A 5GNYA 3RHGA 3BLIA 3BL3A 3QQWA 4LALA 3WLSA 1VS1A 2E3ZA 2FH8A 5EB8A 3EX1A 1G94A 3F2CA 4WY0A 1OCNA 3E02A 4DUOA 5BXPA 4LVGA 2VZTA 3W37A 1ADOA 3G3MA 1EQCA 3B06A 3VMPA 4B5UA 3SQMA 3ARVA 3CL6A 1VEPA 2QAPA 2ZTKA 5I5RA 1AL7A 3U5UA 4FPSA 2JBMA 2AMXA 4HHLA 3V3WA 3TSMA 2V2CA 5C2XA 1IEQA 1IZKA 4M56A 3QH2A 4R3UA 3T0AA 4ICNA 3O0FA 2FB3A 4QFUA 4ZO9A 1UD6A 3TX9A 2X1SA 3M0XA 1VENA 4MNMA 1EB3A 3B8WA 1TA3A 2PDFA 4LUSA 1E40A 5AKQA 2Z1XA 3ES8A 3UWYA 4QG6A 3QOKA 3N15A 2WKLA 1G67A 3FIGA 3N19B 3GDBA 3L2MA 2C0AA 3T2PA 1B9ZA 3NAVA 1H7WA 3UG3A 3T08A 5HMDA 3GXFA 3R0KA 3WELA 2GYIA 1J8VA 1YEYA 1OF6A 3HB9A 3I3DA 6XIAA 3MCMA 3C8FA 4DN1A 1BTCA 1A3XA 2VI0A 4EPBC 4N2YA 4MJZA 2B4GA 5JBEA 2PDNA 1PX4A 1A0CA 4IICA 3CLWA 2J24A 1JI1A 1FWDC 1H1YA 4AIOA 2OSXA 4R7WA 3GHUA 5GJMA 3OGRA 3W71A 3FA4A 3AUOA 4M51A 1UASA 1ONEA 2A0NA 3UWEA 1M65A 2DSVA 2ZYFA 4RNHA 1C8QA 3GH7A 3WFAA 1XR2A 3WLTA 4WUIA 5CG7A 1QMLA 1IF2A 1WAWA 3WBAA 3PBUA 3RILA 3EDFA 3K8MA 1BEUA 3CIVA 4J3ZA 3E5BA 3NQAA 1S1PA 2F2HA 4EXBA 3RPMA 4PB5A 3GXNA 3F4NA 1L9WA 2HE8A 1Q7MA 1XS2A 4CD8A 4O4VA 4CQBA 3KEHA 4ZA0A 4F9DA 3CS2A 1UKOA 3TLLA 4Y9AA 5CSRA 1MW1A 2WXDM 4HZ8A 1TCDA 1TUFA 3IGUA 1W31A 3RUBL 1QBBA 4O13A 4Z2HA 1Q2SA 1DBTA 4HA4A 2FH6A 2Y62A 3RM4A 4PUNA 5D8WA 3G1XA 4C60A 2ZA3A 3TTYA 1BYCA 1W1ZA 4NNBA 2E8ZA 3FKKA 3CZEA 1ZLPA 3A13A 2G95A 2QHAA 3QPYA 4JN7A 4A3YA 3L4UA 3UT0A 3RR1A 5TD4A 2NQ5A 3OQ8A 4IISA 3WJZA 4JNMA 2XVKA 3OZPA 1CGXA 3IVTA 2V69A 1MDLA 3VKJA 3FS2A 5M5DA 1BLIA 2Z7GA 3ONBA 3U4FA 4HNUA 3AS2A 3B3DA 2CETA 3VGHA 3W1XA 3SUVA 3N17A 1C8XA 4DWSC 5LIWX 3ZT5A 1J01A 2CBJA 1BF6A 4FI4A 3ZLFA 3I4EA 3VD4A 3ERPA 2VRJA 5D2TA 3B8DA 3L0NA 1V8EA 4LVBA 2NV1A 2J9ZA 1QHZA 2ZQ0A 4PUUA 1A5SA 3TAOA 3A4WA 3CLMA 3O05A 1UH4A 1XINA 3VC5A 4DM2A 4KS0A 2BDQA 5D2VA 3RGTA 2I14A 3E96A 3NOYA 4HMEA 1DWHM 5XINA 3ARXA 1P7TA 1F76A 3PTDA 2WHLA 3NGJA 4K7VA 2E7FA 4GX8A 3KOXA 4JTDA 2BVDA 2A4AA 3M0ZA 1UKSA 2IPFA 1ZTVA 1NM9A 1X6NA 1RBLA 5E6ZA 3CAVA 1GPFA 4I9JA 3HBLA 4UQCA 4WZHA 3MUAA 4XUGA 5I3GA 1E1CA 3G0XA 2BMBA 4L9YA 3ISIX 4KGJA 2OWWA 4O19A 3S1VA 4FAMA 2J62A 1UMYA 2PRHA 2CFFA 4K38A 3OA5A 2ALRA 2EJ1A 3ZM8A 1SJAA 4D6GA 1MDRA 1OFDA 1UWAA 5C8BB 3QMSA 4LB3A 1ZRQA 4QJ5B 3STFA 5C54A 3BAYA 5CGMA 4E4FA 2FFCA 2BGQA 4W89A 4WOQA 2VP8A 4E3VA 5HPCA 2PDPA 2WC7A 5I02A 2A6NA 1M6JA 1XM3A 3BXWA 3W7CA 3TKFA 1UJPA 2J13A 4Z1AA 2BGSA 3OGVA 3WLQA 4B5WA 3R8HA 1GYMA 4ZCWA 1U1JA 3TYDA 8TIMA 4FALA 3MUXA 3NQGA 4KW2A 1LJYA 3L7RA 3QF0A 3OHMB 3HIJA 3NA8A 1QNSA 3WKZA 2JF7A 2FHCA 4C7DA 3IS4A 5JIPA 5CZ0A 1RPXA 3M6YA 2BOGX 2R1NA 3VA8A 2QVNA 3LCXA 2QUMA 3UERA 1MXDA 2ACQA 2PDUA 1EP1A 3LERA 1CLVA 3AHYA 7ODCA 4L61A 1E4NA 1K03A 1CBGA 3IJ6A 4N4QA 4QM1A 3GBEA 4I6KA 3MMDA 5HQEA 3DEQA 3CXOA 2OOFA 3NDOA 3WDJA 3VTRA 3QMTA 2QUUA 1VFHA 1S46A 1B3OA 1SQ7A 1AMYA 1HW6A 4LV4A 3FHQA 2WHMA 3VI2A 2P76A 3KLKA 1G6CA 1KFLA 1C7SA 2OKTA 1XP3A 5HUOA 5HK4A 1QOXA 3BMVA 1TRDA 1GJWA 4QJ4B 3TN3A 2QCEA 1IT8A 2ZVRA 1GONA 5BRBA 2VT0A 1TX0A 4GA8A 5JBFA 1K3UA 1I2NA 2V63A 3M0KA 2BASA 1UYQA 3AIUA 3W73A 2QQ6A 3QHMA 3SCTA 2RAGA 4IM4A 5D2WA 3CQHA 4P2VA 4DX3A 4A35A 3LBOA 4EVZA 1LORA 2IW0A 3CUXA 3KCJA 4TIMA 2GJNA 3AMKA 3O8AA 2NXGA 3LOTA 3VZXA 4RXFA 4UZSA 1K7XA 3DUGA 1J0YA 3VIMA 1HL8A 3R6IA 4IXHA 4UC5A 1W5PA 3CH0A 2OO6A 4QEHA 3MY9A 4LCSA 2OT1A 3VUPA 3BV4A 2E5CA 2OU4A 1TG7A 1K6AA 4IFRA 3KBVA 3UETA 1CXKA 3C2VA 2CLHA 4DELA 3FJ4A 4LANA 3CTTA 5BMWA 1V6XA 4V28A 5CC7A 3TTQA 3CEPA 3NL6A 5C9UA 2KAUC 4RDVA 1VQTA 2OSYA 4XVEA 5AYZA 4P7OA 4NKCA 4ILSA 5EL1A 1CB7B 1WP6A 4D6HA 1XWYA 4M6PA 2J9YA 3DHPA 5DXXA 1BGGA 4GKLA 1OZMA 4DNMA 1EHNA 5FJIA 2D0GA 1KCZA 3AHTA 2CC0A 4LYKA 4ZE5A 4DO5A 2QCHA 5FAJA 2OYMA 3LV6A 1OK4A 1VFUA 3GDKA 4UOQA 4HU3A 4XIMA 2ZC1A 1YPIA 4DAIA 4F2BA 3FAWA 4KT2A 2D2OA 2O7SA 1VF8A 4PA8A 1NU5A 3EDKA 5D4YA 1V3KA 4PMXA 2W3ZA 3U2EA 4YWSA 4G7FA 1LL4A 1FHLA 3HJEA 1JYNA 4B91A 3VFCA 1JXKA 2XJ7A 3A47A 4IGSA 5T91A 1H61A 1TV3A 4R7JA 4GX9A 3GIPA 4W93A 1L6WA 4WQ6A 3UP8A 2HXUA 1VFSA 2Y6ZA 2PWEA 3KCLA 1E4MM 1UD5A 2YDQA 4XTIA 2HK0A 3H7RA 1JCLA 3UNTA 5LNSA 2QDHA 3F4DA 3CPRA 5CC3A 2DZPA 1XRSA 3MPGA 4RKAA 3MBDA 3XISA 3HG5A 1JR1A 1UIOA 4FNTA 3E2QA 4JFVA 1GPWA 1PSCA 3UZJA 4GYKA 3WH7A 2VHLA 5CZJA 4F2UA 4HJWA 1XC6A 1WXYA 3CL8A 1B31A 1B5TA 1ZS2A 2X42A 1CXLA 2CITA 2Z24A 2OQLA 3R58A 4PCTA 2Z2UA 2WWDA 4P5UA 4O18A 1EGMA 4JIQA 3S6OA 2EHHA 2GOUA 1WDQA 3CEUA 4XKYA 3QEZA 1ZY9A 2OT0A 3AS1A 1O5RA 3FYOA 4NQ1A 2WSQA 4GZIA 3QKZA 3TH6A 2WBKA 2O9OA 1W9PA 4GUGA 4J28A 1Q65A 4XQ6A 4X60A 4GQ0A 5AHLA 1KM0A 4GUFA 3M0LA 3KRZA 2VFFA 4GQRA 2VDGA 2OYLA 4CEXC 4JYDA 2VRQA 2OMAA 3SIZA 3RM8A 5LIUX 4WJEA 1XIMA 3W23A 4C1LA 1CB2A 4XD5A 4ZO8A 1XH0A 2YLAA 1JZ5A 1XF0A 5DBUA 3BLLA 5H6HA 4DJEA 3XINA 2FZBA 4AC1X 4QAIA 1X6LA 2E9LA 4PBEA 3SGUA 4DZIA 3LI1A 3MVTA 1JAEA 1R9YA 1D7FA 1IE7C 3WH6A 3N29A 3WH5A 3G1SA 4A4AA 1X38A 2R1PA 5DMLA 2X41A 1F3WA 3RX2A 1R0MA 1UUQA 5IBXC 3CHDA 3VMNA 2WMFA 2PCQA 2TPSA 1MEHA 1QO5A 1NDZA 1V93A 5JH2A 2Y7FA 1SFTA 5EJ1B 2JKEA 3W7EA 2XISA 3LBCA 1KLZA 4RXGA 1DWGM 1CIUA 4GO8A 1IR1A 2NQHA 1OFPA 1OD0A 3S1XA 3FK4A 1QUMA 3EXTA 2WK2A 2XVGA 4GACA 1U5VA 4HCLA 3SFKA 4MJMA 2CIPA 1V5XA 2YLLA 2G41A 3TA9A 1ZPTA 3S5ZA 1XSKA 5CJ5A 3G6LA 3L67A 2A1YA 4PODA 3OTRA 2BV9A 5REQA 3MWAA 1UR2A 4Y9NA 3W9ZA 3ZJKA 3DENA 3UF9A 3APTA 1E0VA 2GQ8A 1OG0A 1Q85A 4U2YA 1FWWA 4JAWA 2NWSA 1DTUA 1RQEA 4U5KA 1W2VA 7REQB 1K7EA 4L80A 2ESCA 4X9YA 2G3JA 7TAAA 4WY0F 2E1DA 1KXQA 3CIXA 4HD5A 4A8LA 4H9XA 4REQA 3ARQA 4GIAA 3S5OA 3S5NA 2IKJA 2P50A 2OEMA 1J5SA 1I2RA 2PDHA 2YW4A 4MYAA 2QPXA 2W91A 1ZP4A 1L6GA 5TQLA 1R2RA 4CKQA 5AHEA 3G18A 3OHIA 2WSPA 3FNDA 1RY0A 3PPGA 4ZOCA 1DJWA 2XFWA 2GJPA 1XCFA 3WNPA 2C91A 5MHBA 1V6WA 4XZHA 1KCXA 2QCFA 3UGVA 3NO1A 2CXGA 3EWZA 5FJOA 2VD9A 4AZGA 3GXIA 1RK6A 4ZOEA 3ZO9A 1YTEA 3WQOA 4AY7A 2GQ3A 1W1IE 3GXMA 4Z2JA 3WUGA 3UCCA 4QIUA 2VEPA 4AY1A 2X0HA 4D9PA 1A3HA 1RR2A 4G7EA 3VIKA 1HL2A 4O1CA 4G6CA 3LHUA 3WEMA 2CBVA 3H2EA 3GHRA 1ITCA 1IXNA 5A6KA 3W07A 3L0GA 3HGJA 1VJIA 3DYPA 1H7XA 5E9AA 1B4KA 5IHRA 3N4EA 1QXLA 2Z6JA 5FSEC 1K8ZA 3VXGA 4NYUA 2J7EA 1A5BA 3TP4A 3K2GA 4HTYA 3VYLA 1PDYA 4HIBA 4HA1A 2Z1SA 3MA8A 3M4HA 2QCDA 4DO4A 3M5VA 3LRMA 3GDTA 2G50A 3CUHA 2CHOA 3VE9A 1S2CA 2F84A 2WQPA 2WMIB 1M9HA 3N3TA 4ACZA 3TROA 2IPGA 4TMCA 1UB3A 1IEWA 3IAQA 2NVAA 3SCRA 3VKBA 4A8NA 3KAOA 1LL6A 3L68A 5C7HA 3L65A 5FESA 3FA5A 1M7JA 4Z0SA 3BLFA 2Y5JA 4WXYA 1MW2A 4RZ5A 2YYTA 3BCDA 5CZSA 3HZ3A 1GT8A 1MRQA 2PDLA 3K46A 3OPSA 2A85A 1LOSA 3ZVIA 1FP9A 4DWDA 1I1WA 1W9XA 5EU9A 1FWBC 2QMJA 4ZQRA 4PH6A 4AXKA 4GISA 3MS8A 2PLCA 3W1NA 3WK0A 4Z1CA 3NXFA 2JKAA 3OVQA 1ITQA 1ONRA 4YVXA 1T40A 4PEKA 4JKMA 5GNZA 1JPMA 1VJSA 3LA4A 4DYJA 4DBUA 4EACA 3UY7A 3GNRA 1EPXA 4WHBA 3KVKA 1DHKA 1D3CA 1VFMA 3IVSA 4YTQA 1QW9A 5IXEA 5D30A 1KW1A 1JUEA 4RE4A 2NXIA 4JL2A 1W32A 3BGAA 4CQ8A 3H2AA 4F9JA 1F8MA 3AS3A 2GK1A 5CC5A 2A3HA 4PCNA 3SBFA 1FVPA 1R2SA 3TE9A 3DFQA 1Q4WA 4NXSA 4U5IA 3G3DA 4JOMA 3LLXA 2POTA 4O0KA 2VC9A 5LXEA 3UU0A 4C6PA 3IIXA 4W88A 1KGUA 2DVUA 4MOZA 5I23A 3CT2A 1G5AA 4OOUA 4N9DA 2QJNA 3FV9A 1EKOA 1ZCCA 3OYXA 3REQA 4LVDA 1QJWA 1QPKA 1JPDX 3W88A 4HN8A 3G2GA 3W1UA 4ZEPA 5C9RA 2W63A