1H7NA

Schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with laevulinic acid at 1.6 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
340
structure length
340
Chain Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Substrate and Three Inhibitors
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dehydratase
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
total genus 124
structure length 340
sequence length 340
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1h7nA00
4B5NA 4AHPA 3C61A 5LHEA 5FEZA 4BWLA 3C6CA 3TW7A 3MBDA 1W5MA 2ALDA 4MVAA 3CB8A 3UD6A 1YTDA 3O1NA 4WY0A 1RD5A 2QCCA 2FTPA 2V5BA 3EKLA 4JTJA 3M9YA 1N7KA 2RH9A 4KWVA 3FKRA 4N9EA 4WQ6A 3ABRA 1T0OA 2Y61A 1DJQA 1JCYA 3EX1A 1G67A 4AB4A 3L0NA 2B7PA 1O5KA 4GE8A 1D3HA 1JCMP 2QCDB 2ZRXA 3LRMA 4N9BA 1TPDA 4RXGA 1FCUA 2BTMA 3EX6A 4NJJA 2NUWA 2Y88A 3QW4B 2R94A 1XC4A 1K8ZA 1OX4A 3PSWA 4DQWA 2J88A 3W85A 1KFLA 5H2ZA 5EL1A 4ZL1A 3NYZA 1Z42A 2Y62A 4O18A 3BGGA 1YXCA 3A24A 3G1YA 2WPBA 2NXGA 4ML9A 4PEKA 3HIJA 2QUVA 3KOFA 3O06A 2B4GA 1RV8A 4FB7A 4Z1DA 1JR1A 4DO4A 3DZ1A 5KITA 3DGRA 4LVFA 4UXDA 4S2CA 5C2XA 1R2SA 1YPIA 3STFA 4K37A 3INPA 2Z0IA 4Q4KA 5AOUA 2E6AA 3WK1A 4ADSA 3TR2A 1SO3A 4YLWA 3RU6A 3VI2A 1G4EA 4JTTA 4O8RA 3TK7A 2ISWA 2VFDA 4UNLA 1X1ZA 2WKJA 3MP3A 1AL8A 2NX1A 4WXZA 4HIBA 2YXGA 3N2MA 3W7HA 3DAQA 5F2LA 1WBJA 3MUXA 4TX9A 2V8ZA 1G4PA 4RV8A 2W79A 1LOQA 3EX4A 5KSWA 1TTQA 5LNSA 5F1UA 1EA0A 3HF3A 5C5YA 3M5YA 1SZNA 4JTUA 4IPIA 3OIXA 4MY8A 3D0CA 5EKYA 4CQ9A 3FS2A 3LTPA 3NQ2A 4K36A 1VGAA 4ZMGA 3QMRA 4HNVA 4AVFA 1TTJA 3PBWA 4WZHA 4Z0SA 4AMAA 5CPNA 3MP5A 3PUEA 4FNQA 2Y85A 1FDZA 5G5IA 4FX8A 3UWZA 4DF2A 4EIVA 5KZDA 1QMLA 3UY8A 4K7YA 3WJSA 3CC1A 1JRCA 3A21A 4NJGA 4AF0B 2ZZ5A 1PHQA 2ZFAA 1K7EA 3GNDA 2E5CA 3NEVA 5BMXA 4O1CA 1LRQA 5CGQA 3LHZA 2DZUA 3QMTA 5KMYA 3HGSA 1OABA 2OJPA 1TB3A 2PRHA 3G1FA 2GOUA 1TPH1 1NFBA 3P74A 3NQFA 4YWIA 3RFAA 3FFSA 3SY5A 3LTSA 2NWSA 1UASA 2A21A 4UTLA 3EB2A 4O57A 2FB2A 3S5NA 1HO4A 4FHAA 4UTIA 2A85A 1PCKA 2YPIA 1EWEA 2X1RA 2CZ5A 1OYAA 3QJAA 3L0KA 3W1PA 2YZRA 3DFQA 2FPVA 3I65A 2Y7GA 2UV8G 2C14A 1KTCA 4JX5A 1JQVA 3F4WA 4A22A 3NQDA 1FBAA 6ALDA 4IMCA 3LCXA 3UPWA 3FIGA 4IMDA 4JX6A 5K9CA 4Z1BA 4Y6GA 4LRTA 3M43A 5AC6A 4PL2A 3WJXA 1CW2A 5AC8A 2V2DA 2V5LA 1DJNA 3W7CA 1MEIA 1DV7A 4O50A 1N8FA 3N34A 3G1HA 2YGYA 3IV3A 1OFEA 4PH6A 2PRMA 3W1AA 3PM6A 1JULA 4CQAA 1Q6RA 3BG3A 4ONVA 4XZ9A 3THQA 4P61A 4XTDA 3W7RA 3IVUA 4AH7A 1J4EA 5C55A 4O13A 4X9SA 4LS2A 1TYGA 5HJLA 4HHPA 2E6FA 5HUPA 2QAFA 5FF7A 4FNUA 4NZFA 2NV2A 1OHLA 1ZAHA 4TR9A 3NQ6A 2O7SA 4KWWA 1F2JA 3K30A 2ATMA 1FUYA 4UMBA 1VLIA 3HPXA 3H54A 3W7GA 3VKJA 1JUKA 3LRKA 4JTEA 4OHQA 1W5PA 3BG9A 2Q3OA 4X2RA 1D3GA 4UC5A 3G24A 1W5QA 2J27A 3R2GA 5LNVA 3LRLA 4NNCA 3L5LA 4J9JA 3TUUA 2H6RA 3LGEA 3LCHA 4NVTA 1JVNA 2F84A 1LROA 2X2GA 4RZ6A 2W0UA 3MHGA 5G4WA 4AWTA 5HNRA 2R14A 1M7PA 1OFBA 1O5XA 3SJ3A 1LRTA 2VFFA 3QPZA 4A2SA 3ZR4A 1DOSA 3LHYA 1TO3A 2QR6A 1WXJA 3QSRA 3IVTA 3PBVA 3PR2A 3MYPA 1OFQA 1GVRA 1TV5A 4JTFA 4JYEA 1H51A 5AYYA 3CU2A 2V2HA 1IXOA 1TPVA 8TIMA 2ZBTA 4IWWA 2ZRVA 2ZRZA 3FLUA 3IIPA 3NPXA 4UMAA 4Y8FA 4M7SA 1G7VA 4A21A 1LYXA 3EWBX 4JTKA 2RKXA 2CLKA 5I3KA 2QCDA 3NM3A 3T78A 2A6NA 1KV8A 1TIMA 4FO4A 1DHPA 1KFKA 2PURA 5DN1A 1ME7A 4UFIA 2J9YA 2CZEA 3SR7A 2R8WA 4E2DA 3V1PA 4M5PA 5TQLA 3BLFA 1SFJA 4N9DA 3LOTA 4FIQA 2YX0A 3EKZA 1WDWA 1A50A 3QPYA 3PUOA 2QCGA 4LC6A 5G2IA 4WUIA 4BR1A 2E6DA 3G1AA 1GTEA 1VR6A 5G2HA 3R89A 1TREA 1FXPA 1Q45A 3PC0A 5HWNA 1EUNA 2XN2A 5G4EA 5FESA 4O1AA 1F7BA 3ABQA 1IIHA 4A29A 1G6CA 2V82A 2QEZA 3SGUA 3NQCA 4MJZA 3TA6A 4LV9A 1YDVA 1P4CA 4C1KA 3FEMA 2DZWA 1VC4A 4BI6A 3S0CA 1V7YA 1WX0A 3Q58A 4EWND 4AEOA 4QISA 1ZNNA 2GPTA 4M6QA 2H8ZA 4XUGA 2JK2A 3L2IA 4RJEA 2QDHA 5KINA 4NJIA 4MZ8A 1KV5A 1WQ5A 3FYOA 5FEWA 3UXAA 1RR2A 1GZGA 5AN7A 1A5BA 4NJKA 4OQVA 4UNKA 3EWYA 1L2UA 2ZTKA 2WO5A 3EWXA 4O1DA 4UTTC 1X1OA 1N55A 1XDLA 5E1QA 1SO4A 1TPB1 1GWJA 4FF7A 5D2YA 1JRBA 2GVJA 3M7WA 2VEPA 1ZAIA 1ICQA 2GJNA 1C8VA 3MBFA 2FIQA 3C4UA 2BSLA 3GX9A 1FXQA 2X1SA 4IPJA 1GYNA 5HUOA 2W6RA 1OK6A 3P67A 2ZRUA 1G69A 2WNZA 1X8FA 3IVSA 4LW7A 3YPIA 2QJGA 2ZZ6A 1TRIA 1XBVA 2Y89A 4QQ3A 2P1FA 1KLYA 1E51A 1QPQA 3OVRA 2G97A 2NX3A 3W3OA 2ZYFA 3BO9A 5GVJA 3DFTA 3NDOA 1B4EA 5J5DA 3UWUA 4DPPA 4IGHA 5C54A 3B0UX 4GBUA 4K38A 3NR0A 1LCOA 2YW3A 1VLWA 3GYEA 2C6QA 1EP1A 2BWGA 2QCEA 4GWEA 4UFJA 1U83A 3SW6A 2FPYA 1R2TA 3KFTA 4YMZA 3UZ5A 1EIXA 1YTEA 3L0GA 4LVAA 5HULA 3W1RA 4JXCA 1R46A 1KFJA 1EPXA 5TIMA 3VE7A 4MZYA 4QAIA 4MLRA 2O7QA 1H5YA 3BW4A 1H63A 4Y90A 5EYWA 3IGUA 4RZ4A 3BG5A 1WA3A 3P5YA 2CU0A 1GOXA 3W88A 1LDCA 4UUIA 1D9EA 1QO5A 1Q6OA 2VENA 5K4XA 1GG1A 2NWRA 2I9EA 5D37A 3MW7A 4RCXA 1OFRA 3GVGA 3N9RA 5K3VA 1YYAA 4RKAA 2FDSA 1WYIA 2DJXA 4UFLA 2ZZ3A 4MYXA 3GXPA 4ORMA 3FJ6A 4LVGA 1J5TA 1TPWA 3I7QA 3P8JA 3FA5A 3TXVA 4IXXA 5LNWA 2EPHA 1I2OA 3H53A 5HR7A 3DFNA 3R12A 4QSHA 3SZ8A 1KM2A 3JR2A 4GXMA 1W5NA 3LDVA 3UYCA 2GJLA 2A7NA 3CEUA 5IM51 3N2XA 1S5VA 2DORA 3TSDA 5L6UA 2TRSA 1I8JA 1MEHA 4OBTA 2EGZA 5E0KA 5AHEA 4UFMA 2QCMA 3STEA 2YFOA 2C16A 3UXDA 3TNOA 4JD4A 4R34A 2X1UA 2C1HA 5H91A 5HINA 4DBEA 3GK0A 3W22A 3G1DA 5CZJA 4O16A 3I7SA 2DZPA 3CHVA 1P5BA 4NX0A 3P60A 3W2JA 1DQWA 4CLMA 1IF2A 4FEZA 3LHVA 5D33A 4PTNA 5I3HA 3C2EA 4HNTA 5MHBA 4N9CA 3W1QA 1H7WA 3DFOA 4JS3A 4R33A 1T96A 4XKYB 1TQXA 1XI3A 1TPC1 1QWGA 3B03A 2VFHA 1W3IA 5G1TA 3HOJA 1QCWA 2CLLA 1JQXA 5D05A 3ABOA 4Z0JA 5CPMA 2C18A 4UTWC 4CCEA 4HNUA 3P82A 4R53A 4MLJA 1Q6LA 4JY9A 4LU0A 5D30A 1BKSA 3W7JA 4EVZA 3ANYA 4O17A 3CWOX 2CW6A 3TX9A 4O1BA 1JCJA 3UZJA 3WK3A 3R8RA 2JKEA 1TQJA 3LHTA 1RQBA 4PL1A 7TIMA 1HO1A 4JTHA 4AWSA 4OWGA 5AB3A 1M7OA 1QDSA 4UTTA 2XFWA 3IIOA 3R13A 4N4PA 1OFPA 3QW3A 3L21A 5KTLA 1YTKA 2TPSA 3DU0A 3QF0A 3LCFA 1A5SA 1K8YA 3CT7A 3LBMA 4EF9A 5HQEA 3GB6A 2WSQA 4IMGA 4W9TA 5AFDA 5J5RA 4JX4A 3NZRA 5IBXC 3DKLA 3OVPA 1ONRA 3O6DA 3W7QA 1FWRA 1OFOA 3LHWA 3HG3A 1LLZA 1F6KA 5CSRA 2YSWA 3UWVA 5AYZA 1A5CA 3E96A 5CKSA 3LI1A 1VS1A 4O12A 2OT1A 1KM5A 1KFEA 2Q8ZA 4TMCA 2Y6ZA 3LLFA 3BARA 1TTPA 3S1UA 3T55A 2AQWA 2EKCA 1AG1O 3HB9A 4BWLC 3W7LA 3EWWA 1F6PA 1Z44A 1AW1A 4Z08A 4JICA 1QAPA 4X22A 5AYXA 1SU5A 1DL3A 1GVQA 2VXNA 2CLOA 1H7PA 2NX9A 4NX5A 3MYOA 4POCA 4UFHA 1F76A 1W37A 4I7WA 4UCGA 4H4IA 1LBLA 1XUZA 4Y9AA 3NVTA 4UR8A 3PG9A 4UMCA 5C6MA 1A53A 3W74A 2VC6A 2ZCGA 4O10A 1IGSA 3STGA 2YYUA 3M47A 4ZQNA 1SW0A 3B4UA 4I7VA 4N02A 3SFKA 3KAOA 4DEFA 1A5AA 4DELA 4MYAA 3KXQA 4HNNA 3FOKA 1YADA 3G0UA 1OJXA 1AL7A 1BTMA 3GAKA 3QQ1A 3P81A 3PG8A 1FWWA 3UNDA 1LBMA 4M6PA 1R30A 4WXYA 3NL3A 5G2WA 1HUVA 1HL2A 3W75A 3QEZA 1W56A 3B04A 2A4AA 3W72A 3DHFA 3DKJA 1F73A 1AW5A 4NJHA 2HS8A 1Y0EA 3EX3A 3W73A 3BW3A 3T4CA 1OVDA 4YCPA 1PCWA 1KA9F 1YDNA 1RVGA 1EP2A 3V75A 1KW1A 3DFSA 4O19A 3P61A 2Q3RA 3S5OA 2JGQA 2YYTA 4IQLA 3M0ZA 2NUXA 3S1VA 6TIMA 4NZJA 4H3DA 4UR7A 3G0SA 1GT8A 3IGSA 3S8HA 5AHNA 1X7FA 1PIIA 2I14A 3UWYA 2GVLA 4HPXA 5K4ZA 3A5FA 4RK8A 4DO5A 2A0NA 1TV7A 5D2TA 1K7FA 5L9FA 5AHLA 3LCWA 4LC8A 3RK8A 2V9DA 2QF7A 1KLZA 1LZOA 4S2BA 4JDYA 4RZ5A 2YFNA 3G0XA 2EF9A 2OT0A 1H1YA 3VNDA 1NF7A 5EA9A 2PC4A 2VFEA 1H50A 1QPOA 1M5WA 4UTWA 3N9SA 2A7PA 1MXSA 2ZZ1A 1K03A 1TJPA 3LCGA 3TSMA 3B8DA 2GQ9A 1H61A 3L5MA 1KFBA 4PCFA 4S1FA 2JBMA 3TQVA 1YPFA 1VYRA 3HGOA 3TFCA 3KRUA 4TO8A 1VHCA 3IIZA 1XL9A 3L68A 4OE7A 3OVQA 1Z48A 1VZWA 4BF9A 5BRBA 2QCLA 1NVMA 3QFEA 1B9BA 4HSNA 3S5YA 4K8HA 5FF3A 4DF0A 4KFPA 2X30A 2KZHA 4QIUA 1OF6A 4O4WA 5KZMA 3E12A 4L4LA 2E09A 3ELFA 4H6KA 3W2MA 4KKXA 4HPJA 1SSGA 2OCZA 5CZSA 3ZWSA 3UPBA 3PB2A 4N6FA 5F4WA 1QNVA 3NQ8A 4G1KA 1GTHA 1VHNA 3AO0A 4EF8A 4ZZ9A 1RPXA 5LGZA 4P2VA 1FDJA 3MI2A 4KFNA 3E0IA 3W2NA 1W0MA 1VQTA 3TIMA 2C13A 1GVSA 1F74A 3QYQA 3I7RA 1ICSA 1SSDA 4NT0A 5D2WA 3HGRA 2VOMA 3PWAA 1C9DA 1EB3A 5DBUA 4DF1A 1PE1A 5FI8A 3T7VA 3CTLA 3C3NA 3IEBA 2CWNA 3TAKA 4WOZA 1ADOA 1OX4B 1MEWA 1BEUA 3GKAA 1OG0A 4M6VA 3KVLA 4MFEA 3A22A 2WSRA 4LOCA 1EUAA 1ZY9A 5D32A 1OX5A 2P0OA 3B06A 3KHJA 3LM7A 3SECA 2Z6JA 1UUOA 3P5ZA 3W1NA 1P1XA 1QR7A 3BV4A 3PBUA 1UBSA 1V5XA 1T8XA 1QFEA 3NQEA 2CLIA 1KM6A 1ME8A 4I7UA 4CNOA 1PVNA 1VH7A 5I3IA 3RF9A 3NXFA 4WY0B 3KVMA 4NXSA 3MHUA 3W84A 3LLDA 3HJZA 3OEXA 3C56A 4DO6A 5K2ZA 4FNTA 4TIMA 5U7SA 3U6WA 1LORA 2FQIA 3TE9A 3O6YX 4JYDA 3DXIA 1W8SA 4X3ZA 1KFCA 4TMBA 4Y96A 3M5ZA 3OHIA 4O14A 1VYPX 1R2RA 3GDMA 3LV5A 3DENA 4RXFA 2ZDRA 2Y7EA 1NAL1 3NPWA 5FEPA 3UQNA 4CNPA 4PA8A 5F4XA 1I2PA 1KBIA 4Z1CA 1J2WA 3GDLA 1M6JA 2AAMA 5AHIA 1TTIA 2RFGA 3G3MA 2YR1A 2EHHA 1FX6A 3WK2A 1SO6A 2A1YA 3NPVA 2QCNA 1F05A 2A6LA 5DCDA 3W1UA 4XKYA 3W2LA 1IXNA 1GPWA 2ZA2A 4E38A 4Z1AA 1I45A 4FX6M 4K7VA 2V0TA 1DBTA 3TMQA 5F1VA 1L6WA 2WJZA 2V81A 1TCDA 2VKZG 4OV4A 3S42A 3EXRA 4BI5A 3B0PA 1K02A 3G3DA 3P8IA 5K7JA 3NGJA 3N73A 3CPRA 2BZNA 2H3DA 1H7RA 3UWQA 3G8RA 5ABTA 1VCFA 3PUDA 2D73A 1LRNA 3EWUA 5TBOA 5DLCA 4LTSA 3Q37A 1FWNA 2X1TA 4UFKA 2B7QA 3P62A 1BWLA 3NOEA 1QO2A 3Q2DA 5F2IA 1IXPA 3EXSA 3M44A 3NL2A 3R5EA 3W07A 2J9ZA 3LCIA 2CFFA 2BX7A 3W70A 1UCWA 1O60A 3DI1A 2QJIA 3KVJA 1TV8A 3LX9A 1SO5A 5FEXA 4AAJA 2TSYA 3LCLA 3HG5A 2WSYA 4GUHA 4A2RA 1WAUA 1SW3A 5LKYA 4MFDA 1IXQA 4GFSA 3W7NA 3PB0A 4JYFA 1H1ZA 5DY2A 2NZLA 4E2BA 5A8GA 5CSSA 4RX0A 3C8FA 3F03K 4I9AA 3EWZA 4WY0F 2OX1A 4RR4A 3TJLA 3LXAA 1LOSA 3TH6A 2OMAA 1ALDA 3M1ZA 3CLMA 1UUMA 1EP3A 1H62A 4O11A 2E77A 1HTIA 3PS7A 2G95A 1EX5A 3NPUA 5T26A 3BLIA 2C0AA 4UTUA 4LY8A 3NQGA 2PCQA 3GKFA 2QJHA 1SUXA 1GJPA 2OZ0A 1LM1A 2EAWA 3HG2A 4U28A 3N19B 4JR5A 4HSOA 2CLMA 1Q3NA 3KX6A 5DBTA 3T44A 2E5DA 3QRHA 3L66A 4UTMA 2ZA3A 2H3BA 4OT7A 3LTYA 1GVFA 3DI0A 3C2VA 1W3TA 2NXHA 4IJBA 3TCEA 3W6YA 2WNNA 4LUIA 1QPRA 2J9XA 4JDBA 3B0VC 3CIXA 3BW2A 3PF3A 2VEIA 4LVDA 4LV4A 2IQTA 4GUIA 4FIRA 5FF0A 5HMSA 3KRZA 4AF0A 1I4NA 1B57A 3P84A 1XKYA 4JEQA 3GDTA 3GIYA 5BNKA 1KBJA 4MY9A 2Z2UA 2E5BA 2ZTJA 3TQ0A 1JJKA 1JCLA 1Z41A 1CX9A 4MIMA 4MOZA 1LTDA 3QSTA 3USBA 3E02A 2XN1A 3RMJA 3M6YA 4KFOA 4JTLA 4PFMA 2R91A 3HO8A 4WD0A 3W9ZA 3THAA 4UTJA 3A23A 2ABAA 4XQ6A 2ISVA 4E0CA 5DY3A 4M19A 2LLEA 5D02A 4GUFA 2G5WA 4FNSA 4XTIA 3WJWA 1JCXA 1L9WA 5FF4A 2VEKA 2QKFA 4O28A 3NQAA 3WK0A 3A5VA 3T40A 2V2CA 5I3GA 3O15A 1S5TA 1H7NA 2CLFA 1SZGA 4WOQA 4TU1A 3KRSA 3CIWA 3Q94A 2Y70A 3W7PA 5F2GA 3PVFA 1MZHA 4FNPA 4ADTA 4D2JA 2C19A 1ZHAA 4XBKA 3TJXA 3W1MA 3CM4A 4HKPA 3W7KA 1XBXA 2RDTA 3TKFA 4AWUA 2Z6IA 1JUBA 5D2VA 3BPWA 3LERA 3O16A 3GXTA 4IOTA 4ZQCA 3DH7A 5DXYA 3RLUA 5D2XA 4OV9A 4O54A 2Y7FA 3NA8A 3W23A 1TJRA 5KZEA 3FKKA 1EWDA 3PAJA 2PE4A 5CPOA 3TW6A 1ML1A 5BW6A 2RHGA 4K8EA 1OK4A 2Y63A 2ABBA 1H7XA 3P7YA 1NEYA 2C3ZA 4FXRA 2CLEA 4IX2A 4EOUA 4U4MA 5HWMA 5I3FA 1FCQA 1TSIA 2E6YA 3MO7A 3HQ1A 1KTBA 2ZA1A 3LBCA 3F4NA 1O94A 1FWTA 2H90A 3HMJG 5K9XA 4O53A 3M41A 4ZQPA 3DFPA 3TSBA 2AGKA 4C1LA 3NZ1A 3ATZA 3U2OA 2JGYA 5DCEA 3G1XA 2QCHA 3O8AA 2DJLA 1FCBA 1S5WA 2ZZ2A 4MZ1A 4CQ8A 3GLCA 1B4KA 1OF8A 3ZS4A 1T99A 1NF0A 3GXNA 5EBUA 3VE9A 1FQ0A 4ICNA 2E1DA 3N14A 3GR7A 4NU7A 1GYLA 1LLWA 4ZQMA 3TMLA 1KM1A 1HG3A 2DZSA 1DVJA 2ATSA 1GVOA 2J24A 2ZZ7A 3JS3A 1OYBA 3GDKA 3W1XA 3WJYA 1BWKA 2FJKA 1AMKA 1UJPA 2VELA 3NM1A 4CCCA 1B3OA 3VCRA 3NO5A 3RLVA 1VJIA 3MWAA 3I6RA 2YDAA 1I2QA 3C0JA 3HBLA 3L9CA 5BOOA 3QMSA 1ZFJA 2CZFA 1AK5A 2C15A 5G1YA 1K7XA 2DU2A 4JTGA 2WOQA 3ZWTA 1MO0A 4BFAA 4R7JA 4DPQA 3DHDA 3G1VA 5F2MA 2Y7DA 4QJ1A 1GEQA 4O15A 4LUJA 4CNNA 1GG0A 3WFAA 1MSSA 4LT9A 3M5VA 3LXCA 1SFLA 2B0MA 3W76A 1HFBA 3LHUA 3IGXA 1PHWA 5LZLA 1O95A 2B7OA 5I3JA 1UB3A 3O07A 3MJYA 3JRKA 1ZAJA 3EEGA 3W7EA 4NNAA 4ALDA 3TAOA 3NAVA 1EEPA 5D03A 4PODA 2GQAA 1X6UA 3SGZA 3MMTA 3M16A 3SIZA 4AXKA 3W87A 1G4SA 3E9AA 2HS6A 1WOAA 1ZALA 2FFCA 2QAPA 2QUTA 1OFDA 1THFD 5D04C 3TFXA 3HPSA 3P80A 3LV6A 2WNQA 3L67A 2DP3A 3OG3A 4JIPA 3G22A 3TC6A 1W5OA 2I1OA 3VFLA 3F1QA 3C2FA 5D09A 1OFAA 2NV1A 4FXSA 5AHMA 3E49A 4IMFA 2A5HA 3S1WA 3WJZA 3G18A 5EMUA 1JUEA 2H8XA 3ZFHA 1OX6A 3ABSA 5FF2A 4GJ1A 2J6XA 1SZFA 4WX2A 4NQ1A 1ZCOA 4K39A 1SQ7A 1WBHA 1TPUA 4JGDA 2ZZ4A 1DORA 3G1SA 2HTMA 4PC8A 3S9YA 1XBZA 3EX2A 4NUWA 1R47A 4MPQA 2QCFA 3BLEA 1SZEA 4LWWA 3IIVA 4GUGA 1TMHA 2NUYA 4QM1A 4AHQA 3S1XA 2QUUA 3MP4A 1KTNA 1P0NA 1PV8A 1FWSA 3SI9A 4JNMA 3LXBA 4YCOA 4N4QA 1XFBA 4MY1A 1SR9A 4CCDA 1FCVA 4Q32A 3PBYA 5CPLA 2P10A 2JKPA 4ADUA 3AJXA 1L6SA 1QOQA 3HGJA 3S5ZA 3QZEA 3W1LA 2CZDA 1XCFA 2NLIA 3L65A 1ICPA 3DBPA 3W7IA 4LNYA 2HSAA 1YXDA 3O63A 3O6CA 3I68A 5D38A 4ORIA 2GUUA 2F7FA 1WV2A 1PS9A 1K3UA 1XM3A 5EPDA 3FYPA 1P0KA 3A9IA 1VRDA 1XDMA 1YLVA 3BVJA 2ZQ0A 1SW7A 2B7NA 5LGXA 4JTSA 3IIXA 3OBKA 4ZQOA 4Q33A 5LSMA 1XUUA 1Q6QA 4XBSA 3GNNA 2G96A 3H55A 4LRSA 5CZ0A 2NXIA 1PL9A 4HT3A 4JIQA 3SSJA 3C2RA 4GUJA 5HR6A 4HN4A 5F4SA 4JY8A 4OGZA 1TPEA 4WJEA 3W7OA 4NNBA 4IX0A 3MI6A 4JTIA 3MI3A 3PY2A 3N3MA 5A5WA 3W86A 3STCA 1KM3A 1TRDA 3W1TA 2ISSA 4OU1A 1H60A 2GVGA 3TU9A 1AW2A 2TYSA 5LNRA 1H7OA 1KM4A 1VCGA 3HPZA 5AC7A 3KVKA 3CQ0A 1L6YA 1WOBA 4ZVJA 3QC3A 1ZENA 2QDGA 3TROA 5E93A 3OA3A 1VPXA 4O0KA 4IUOA 4UTKA 4LVBA 1TPFA 3NQ7A 5HWJA 1OYCA 3S6DA 1W54A 4JN6A 4YL2A 1LBFA 3TQKA 5BMWA 3TV8A 2FB3A 4QITA 1RQHA 1LOLA 4O0ZA 3NL6A 2BXVA 4K6AA 2E68A 4AHOA 3TDFA 1GQNA 4QNWA 2A7RA 1I2RA 3U8GA 1JCNA 1K8XA 3CWNA 3NQMA 4UIOA 4GRSA 5LNUA 2DZTA 2ZRYA 3NNTA 1CI1A 3W71A 3TXZA 3CEPA 1YXYA 2ZRWA 1FDYA 2FPTA 3UWWA 1F5ZA 1IIGA 3NL5A 3QM3A 4M7TA 3QH2A 5SWUA 5CG7A 2YW4A 4UTHA 2WQPA 4QNEA 2FLIA 1G7UA 4NXKA 4IXHA 3L5AA 4FX7A 4YXGA 4DBDA 3RNDA 4LS1A 2JKAA 5DELA 2YCEA 1DQXA 1LP6A 4LS0A 4GC4A 2DZXA 2VFGA 1SPQA 3LI0A 3FJLA 3GR8A 1FY6A 2RDWA 3IRDA 5U4NA 5AHFA 3EXTA 1XXXA 4L4MA 3PSVA 3TC7A 3ATYA 3BK0A 4MKNA 2V30A 4O52A 4FNRA 3UY7A 5DCBA 2GQ8A 1U5JA 1QOPA 2BLEA 5EY5A 4XWUA 1DKWA 1W3NA 3GZ3A 2PRLA 2WV8A 2XN0A 3HG4A 3NQVA 3LB0A 1RZMA 4ZQRA 1O4UA 4A3UA 3O05A 2VFIA 4DXVA 3W2UA 3G8EA 2TMDA 3W83A 1C29A 2CLHA 4RLIA 2A2IA 1VYSX 3W7DA 2HMCA 4MJMA 1YDOA 2Q8LA 3C52A 2Z1BA 1S3HA 4N2YA 1W1ZA 3MHFA 2VEMA 2X16A 3PULA 1KM0A 3M5XA 1NSJA 5DXXA 5K9DA 1VCVA 4O4VA 3BGJA 1ZJIA 5IBXA 3B05A 2RDUA 3QQ0A 1I2NA 2DZVA 3W7MA 5LHFA 4GNJA 3GAYA 3GDRA 1XBYA 1QPNA 1ME9A 1G4TA 3NG3A 5CZTA 1W31A 4MUZA 4N6EA 4BI7A 1RQEA 3W2KA 4BK9A 3C2OA 4IMEA
chains in the Genus database with same CATH superfamily
2VRQA 4NSBA 5LHEA 2R1KA 2PGFA 4BWLA 3AS3A 3H23A 3GZAA 3O1NA 3CWHA 3EKLA 4JTJA 1EIBA 4FMVA 4D6IA 3M9YA 4S3AA 3TONA 4WQ6A 4KEZA 3S6OA 4H1ZA 1JCYA 3WF2A 2XIIA 2AL2A 3NO1A 3QGVA 4JQ4A 1F3WA 1IWBA 4U10A 2ZRXA 3WKZA 3QZAA 4I3GA 5J04A 2VR4A 1XH0A 3CUFA 4B3LA 2CESA 2I5GA 4JNZA 1JZ4A 1JPDX 3OODA 3GHTA 3O0KA 1KFLA 5H2ZA 4KCUA 3NYZA 4E5TA 5D9MA 4REQB 1YXCA 4PEKA 3B8UA 5XINA 4D9PA 3O06A 3FNDA 2XH4A 4RDYA 2VDIA 1C91A 3BUVA 3RLGA 2BXYA 4DO4A 4ATWA 3URQA 4IIBA 1W1A1 1WDRA 2ANUA 1M9HA 1CXLA 4K37A 1POJA 1CXHA 1BRLB 1XPYA 2Z0IA 4Q4KA 3NCOA 3WK1A 1UH2A 1G4EA 4C5YA 4TV5A 1CECA 2ZIDA 1KXVA 2FH6A 4OZOA 3UCDA 2BHZA 3QHMA 3GH7A 2CEQA 5DFAA 1EA0A 5F1UA 1NU5A 4XKMA 3M5YA 3W82A 5DRCA 1SZNA 1BFNA 4H2HA 3SUVA 3NDZA 3IRSA 5EKYA 4DXKA 1V7AA 2VC9A 3NQ2A 4K36A 3T2OA 3OIHA 2XVNA 4PCSA 4HNVA 4AVFA 3LBOA 3WLPA 4LYRA 4AMAA 5CPNA 3MP5A 5G5IA 5DANA 3V5FA 2VWSA 5KZDA 4Y9MA 3UY8A 4K7YA 3TYCA 2NVAA 5GQBA 3UGVA 5EMLA 1PHQA 2ZFAA 4GJIA 1XDJA 4UQAA 1LRQA 4MNJA 1YRRA 3LHZA 3QMTA 4MUPA 3GDBA 1OABA 2PRHA 2VC5A 2ZX7A 3G1FA 3UJFA 2OYMA 4QS6A 3OZPA 1TPH1 3SIMA 3ZOAA 4XZIA 4B16A 1CXFA 1NM9A 1OEPA 2OTDA 3WH5A 2WM0A 1JYVA 3SY5A 2G50A 3LTSA 3MUIA 3QHNA 2FVMA 1JYNA 1UASA 4GY0A 2VZOA 2GWGA 3FGCA 4IIDA 4O57A 2PTXA 2FB2A 2HVNA 4E4FA 3PP7A 2A85A 1KC7A 3SB0A 1JFHA 4IM4A 2O55A 3CHDA 5HPOA 1FBAA 6ALDA 2J7GA 4GYPA 5B7YA 1KGUA 4MWAA 2D1ZA 1KQZA 4IMDA 2HBXA 2D3NA 4JX6A 2EPMX 4Z1BA 4PRWA 2GGJA 3WJXA 1CW2A 2NQZA 3VO0A 2VWTA 4JKKA 3WDRA 1E6RA 2D2GA 4O50A 3WY1A 4L1WA 1JXJA 1D2KA 1OSEA 1WKEA 2I9UA 5JMUA 4Q4OA 3KLKA 3CZ8A 2BVDA 5EFDA 4S3DA 3A3HA 4O13A 1AQHA 3CAQA 3PZIA 4XZLX 4LS2A 2Y24A 1TYGA 1AQMA 3IJLA 2WHLA 3PHAA 2QAFA 4FR1A 4QG8A 1MI3A 1R3QA 3P93A 1H4PA 1FRBA 1NDYA 4KWWA 2ATMA 1DWGM 4UMBA 1E6QM 3HPXA 2VL4A 2RGLA 1JUKA 1M1BA 2QQ6A 5I06A 2Q3OA 4XX6A 1D3GA 4UC5A 4HU3A 3RRXA 5LNVA 3SY1A 2WKLA 5CBIA 3UF9A 3EDJA 3CMJA 2H6RA 3OLEA 3LGEA 1IR2A 3LCHA 1JVNA 1YNPA 2ZXQA 4QFUA 3LS9A 1W1TA 1LROA 3GWQA 2X2GA 1XIJA 3WF1A 1CXKA 2W0UA 2XFYA 1K4HA 5G4WA 5HNRA 1QNQA 4F79A 4CNUA 1ZBKA 1M7PA 2QVNA 4XVEA 3ITVA 2VFFA 1TO3A 2QR6A 4PUWA 3FXGA 4XG1A 1QBBA 3CU2A 5AYYA 4WCJA 4HQVA 3CAVA 3PTMA 3FLUA 3NPXA 5HPCA 3A9BA 1LYXA 4JTKA 2RKXA 4H83A 5I3KA 2X7VA 2WVTA 3H4XA 1DWJM 1TIMA 2BP1A 3UESA 4YN5A 1KFKA 3H2FA 1AH0A 4QBXA 5I2UA 3CO8A 4BF7A 1AH3A 3V1PA 4LF1A 4M5PA 3BLFA 4PYSA 2P50A 1R87A 3U7VA 1SFJA 2D20A 3S5SA 4N9DA 3LOTA 5IDZA 1Z89A 1G0CA 3PUOA 1ZPTA 1EDGA 2DEPA 1PKYA 4JZ5A 4JTQA 3R89A 4RV3A 1H2JA 4OFCA 3PC0A 5FESA 4PGLA 4GQRA 3E38A 4AY8A 1LT8A 3R79A 5HQMA 3SRDA 2JF6A 3MT1A 4W84A 1GQKA 4GD0A 1XH1A 1PZ0A 4TOQA 1MVYA 3FEMA 2DZWA 3S0CA 1V7YA 1WX0A 4C91A 3UG3A 4KRTA 3PWIA 4AEOA 4GZEA 1AD4A 1QTWA 1MQQA 2QDHA 3CHFA 1KV5A 2VUNA 5D9NA 5FEWA 1LWIA 3UXAA 1GZGA 5AN7A 3R94A 1A5BA 4NJKA 3AIVA 3V0UA 1LWHA 4PTXA 1TR1A 2YCLA 5E1QA 1TPB1 1GWJA 3BOFA 4ZB0A 3EPMA 1C8VA 3MBFA 1S5NA 2J47A 5HUOA 1Q2RA 5G4HC 2Z1SA 3P67A 2ZRUA 2OZ3A 3ZJ8A 3CPUA 1V6YA 4JQAA 2ZZ6A 3BLOA 3EA2A 4GXPA 4GO9A 4LAOA 4Q8UA 3ZSSA 3ZJ7A 3DG6A 2FHFA 5CC6A 2DSZA 1W9BM 3OB8A 5AVNA 1ZS2A 4K38A 1LCOA 2R1LA 4RL3A 3SFWA 1JXKA 1EP1A 4ZO7A 2QCEA 2PDQA 4GWEA 3CIVA 4V1XA 5M2FX 4RDVA 2AQVA 3FDGA 2GVYA 1YTEA 1R46A 1KFJA 1EPXA 2PP3A 5TIMA 5EB8A 4MZYA 4XV0A 4WJXA 1H5YA 5M03A 4C6QA 3IGUA 3LK6A 4RZ4A 2CU0A 1GOXA 1LDCA 4UUIA 2WWDA 3TYZA 5K4XA 2ONEA 2NWRA 4RCXA 1MDLA 3AROA 4EE9A 1KRMA 1W1YA 4JIHA 1WYIA 2V5KA 4W7VA 4MYXA 2Y8UA 4LVGA 1TPWA 5CJ5A 3FA5A 4GKLA 3TXVA 1FFRA 1I2OA 1L8PA 3UYIA 1IWPA 3GHSA 4KW2A 4KWOA 3N6JA 1UR9A 5TD4A 3VFCA 1KM2A 3JR2A 3EMZA 4FA3A 4GXMA 2CHOA 3UYCA 3SCOA 2J7BA 4GYFA 3CEUA 4GYPC 5IM51 1S5VA 3SCWA 1I8JA 3IWPA 2CCRA 5FA5A 2EGZA 2PP0A 4L9XA 3GG0A 3VX1A 7A3HA 4HNLA 4LCSA 4HA4A 4R34A 3UWEA 4Q4MA 1V3HA 3TLLA 4PUEA 2DZPA 2J8GA 7PTDA 4RNHA 4I6VA 3F2BA 4YVPA 1IF2A 4FEZA 5IFTA 5D33A 1VFHA 4HNTA 1IEXA 1H7WA 1MDRA 1Q6CA 2NQLA 1XI3A 3B03A 3A6OA 1DJWA 3LGGA 3V0SA 3HOJA 1HP5A 4O1FA 3TVAA 5D05A 4HJFA 3BMWA 4CEXC 4E4PA 3MTWA 2RUSA 4MLJA 1Q6LA 4LU0A 5D30A 1VFLA 4BF5A 1BKSA 2QV5A 3W7JA 4DJDC 3WQEA 4NILA 2OX4A 2CW6A 4IL0A 3GTNA 3EEZA 3S1GA 1JCJA 1EJWC 1SJCA 2JKEA 1D7FA 1HL9A 4C6JA 1HO1A 4JTHA 4AWSA 2JEQA 5AB3A 2AKMA 1M7OA 1QDSA 3R13A 4N4PA 1OFPA 2E3ZA 1KXTA 3VA8A 5KTLA 4DWSA 3AICA 2F6KA 2IPJA 3M46A 3AMCA 5HQEA 3DCPA 4W9TA 4AY1A 4JIIX 5J5RA 4JX4A 5CQ1A 1UC5A 5HANA 3O6DA 2IKIA 3A13A 1KCKA 1CEOA 3Q65A 4E8CA 4CD7A 5MF5A 2NQJA 2D69A 3ARQA 2O4MA 3BAJA 1K9EA 3PBGA 6ENLA 4IQJA 3S1UA 1V4YA 2AQWA 3PZUA 3W29A 3HB9A 2ZWZA 3H24A 1Z44A 3DG3A 5G1MA 4JICA 3W38A 1ZZMA 5FD0A 5AYXA 4H9MA 3DGBA 2VXNA 5LA0A 3K8LA 3MYOA 1QI4A 4H9YA 1OCQA 1F76A 1W37A 4PTMA 5KZ6A 4H4IA 4KEUA 4Y9AA 3LPGA 4LY4A 4UR8A 4S3BA 2VC6A 4O10A 3F4VA 3A4WA 3EWDA 3STGA 2XU2A 3H12A 3B4UA 1VBGA 4N02A 3KAOA 3PZQA 2WBGA 4DELA 2NVCA 2E0PA 2Y1HA 3FOKA 3IJ8A 1XLDA 1CGTA 3QQ1A 3UNDA 1C90A 4M6PA 3KRBA 3W72A 2QF8A 2BXZA 2HS8A 2BY0A 2Y5JA 2RJGA 3KL0A 2X41A 1RPKA 3BW3A 3AS0A 1YMYA 3N4EA 1AQFA 3KWSA 1V79A 4HA0A 1NY1A 3A4AA 4O19A 2JGQA 3M0ZA 4F0KA 6TIMA 4H3DA 5AHNA 1X7FA 5LIWX 4K1WA 4KCTA 1UD5A 3PNUA 3QV8A 4HPXA 3HFYA 5FAJA 1DWHM 2IS7A 2QV4A 2ZX9A 3RK8A 2QF7A 3T0BA 1KLZA 1LZOA 4JDYA 5DEZA 2EF9A 2X0YA 1PJ9A 2WC4A 1JDAA 1NARA 1NF7A 3IJIA 1OCNA 5EA9A 1H50A 4HU0A 5A6LA 2DW6A 2MUCA 3BLLA 2A7PA 3L4TA 1TJPA 3LCGA 1U2YA 3UR7A 3WMLA 1H61A 3L5MA 1O7AA 1AD1A 3U2ZA 4DUXA 3WL0A 3TFCA 3KRUA 4CUCA 3KDNA 4C1NA 2YCKX 3OVQA 1P0DA 1Z48A 4MB3A 2ODOA 2CLPA 3CAWA 1Q7ZA 4W87A 1B9BA 2WZTA 3AYSA 2PZ0A 1HXJA 3WUGA 1R3TA 4LBRA 3R4IA 3E12A 3OGVA 3ELFA 4IFRA 4NP7A 2CITA 4KKXA 3EB4A 4HPJA 5LXEA 3N2BA 4JPGA 4QX4A 3A4JA 5EMJA 3A4XA 4OOZA 1HKWA 3CTTA 2X42A 3UG4A 3NQ8A 5I7GA 4ZZ9A 1RPXA 5LGZA 1FDJA 4KFNA 3E0IA 4Q8WA 3NDYA 4XZBA 2C13A 3IK4A 3S9ZA 4HTBA 3HGRA 4J5NA 3QYSA 2YB1A 1C9DA 2J62A 3C3NA 1BEUA 3KVLA 1FVPA 4LOCA 2PAJA 1EUAA 3DYPA 4DLMA 1OX5A 2P0OA 3LM7A 3R8HA 3FDKA 1UUOA 5BOFA 4LAMA 1QR7A 1UBSA 1V5XA 1QFEA 4PBGA 2GDVA 1KM6A 1ME8A 4PTWA 1PVNA 4V28A 3AJ7A 4FF5A 1F4HA 3APYA 1OADA 2O9RA 3MHUA 2JIEA 1Q4WA 4J2MA 5CLTA 4RE2A 1UWUA 3C56A 1MW2A 5K2ZA 4FNTA 4TIMA 3CZKA 4H8NA 2O9OA 3O6YX 5FAGA 1UWSA 4TMBA 4Y96A 1CPUA 3OHIA 2WQDA 2HRWA 1UR3M 4O14A 1NWSA 3DENA 2BMBA 1REQA 4GZJA 1Q6GA 2OLSA 3BQ6A 3UQNA 5F4XA 2E40A 1EX1A 2W91A 3PAOA 3UJ2A 1M6JA 3T8LA 1TTIA 1QRQA 2RFGA 1VBHA 1FX6A 3IK2A 1UKSA 2QCNA 2A6LA 3NUKA 5LIKX 4XKYA 2ZVIA 5ABGA 4E38A 2WCSA 4FX6M 5C8BB 3TMQA 5F1VA 3PZMA 2VKZG 4OV4A 4RW5A 5K7JA 1PZ2A 4L4PA 3CL6A 3CPRA 1J79A 3ABZA 3UWQA 1VCFA 3M0VA 1WDQA 3GFXA 1QBAA 3OBEA 5TBOA 4B2DA 1BYBA 3B8WA 3Q37A 1TZ7A 3P62A 1QO2A 1OC7A 2PWUA 4R27A 4AIOA 5HAOA 5F2IA 4CD6A 3EBVA 3R5EA 2J9ZA 2HXTA 3UEQA 1UCWA 3T08A 2OWCA 1GCYA 1YBQA 2WAGA 3LX9A 3MSGA 2HISA 1V0MA 4A2RA 1WAUA 1R85A 1PBGA 1XLAA 4DBUA 4JYFA 3M0IA 3GU9A 1DE5A 4S23A 4E2BA 5CSSA 3MU7A 5I5RA 1B3ZA 3WDPP 4AY7A 4WY0F 2OX1A 1XG3A 4V1YA 4JKMA 1KGWA 3TH6A 3M1ZA 3CLMA 1JFXA 1H62A 5CH9A 4O11A 3M7SA 1HTIA 5ABFB 2QZRA 3BC9A 3NPUA 1NP0A 3P0WA 4UTUA 2C0AA 1ZGDA 1E4IA 2GWNA 2JFEX 1SUXA 4I9TA 2JIWA 3T0AA 1LM1A 1O68A 3ZT5A 1MNZA 4B4FA 4JR5A 4KQNA 2QMKA 4G7EB 1OY0A 2CLMA 3L66A 4PMYA 2FZBA 5A2AA 1GVFA 4HPGA 1NOWA 1R5YA 3DI0A 3MDUA 2NXHA 4C5ZA 3MY9A 2D24A 3ZT7A 4LUIA 3B40A 2PDIA 3A12A 1H49A 4A8RA 4L1XA 2VEIA 4LV4A 3MSRA 4FLRA 1FP8A 2OQHA 5HMSA 3PBMA 1ZBCA 5CAHA 4RNFA 1B3XA 4LBUA 4X60A 3BH4A 2E7FA 4JEQA 4TVDA 4QDMA 4GCAA 3G5EA 2W67A 2Z2UA 3AWOA 4R5EA 3TQ0A 1JCLA 2PU1A 1CX9A 4S3EA 5C70A 2HBVA 1U5VA 2XN1A 4HMEA 3RMJA 3FW6A 3M6YA 4KFOA 6XIMA 4UTJA 4DNHA 2ABAA 4PB5A 1TKKA 5DY3A 3E3HA 2EJ1A 2LLEA 3AIQA 1PAMA 3W00A 4A8IA 3SCSA 1ZBWA 1WDDA 4FNSA 4XTIA 1CGXA 3PPFA 1JCXA 1RA0A 4Q22A 3SCNA 3AS1A 4HN8A 2Q09A 4J35A 4YYFA 1SZGA 3AXHA 4GIYA 4FNPA 5FIPA 5J8LA 4D2JA 3TJXA 3W1MA 3W7KA 2RDTA 3WLQA 1WXYA 4AWUA 7REQB 1W1PA 1MFVA 4IOTA 1RD6A 3RLUA 1MRQA 3IV8A 4O54A 4OV9A 1XV8A 3NA8A 2GGGA 1TJRA 1S39A 3GS6A 1EWDA 3CYJA 2PE4A 4QROA 2RHGA 1U33A 2REQA 2FDMA 2BVWA 3IUIA 1H7XA 1TELA 4M82A 1ISZA 3FJNA 2XG9A 4EOUA 4U4MA 1PEZA 5DMNA 3MO7A 1QK2A 3EOUA 2Z26A 3UZYA 2BODX 5K9XA 4O53A 4IIEA 4IISA 3BSGA 1X98A 3ATZA 4C6CA 2ZUUA 2GDUA 1A0EA 4BQ4A 2BASA 4DJEC 1A5UA 2QVHA 4HYRA 4CQ8A 3GLCA 4K3ZA 3C0LA 4YWSA 3GXNA 3MCOA 3VE9A 4ZB5A 3CL7A 4U2ZA 2V5JA 4NAFA 3TMLA 1HG3A 8CGTA 2ZZ7A 1GVOA 4PE8A 1IE7C 3BLPX 4NAFB 1G5AA 3QY7A 1QHOA 2BB0A 3W1XA 2XGZA 1S2TA 1AMKA 3NM1A 3XINA 5ECVA 3VKDA 1DIEA 3VCRA 3RLVA 4PMNA 3L9CA 3AFBA 2HE5A 4MWAB 1US2A 5LIXX 3HN3A 2FVKA 1Y7VA 2GFTA 4JTGA 4DBWA 3B9OA 2BGSA 4J4KA 5DO8A 2Y7DA 4NIRA 4QJ1A 4AD0A 1GEQA 5JH1A 3S4TA 3BZGA 4LUJA 5E6YA 1MSSA 3WMCA 2HPIA 3LXCA 4AD1A 4JL1A 3GTIA 3SRKA 2B7OA 4JOMA 5I3JA 1E0VA 4EPDC 3W37A 4EPEC 4LAZA 2WVUA 3QY6A 3QY8A 4LANA 1OGBA 2YKKA 4L4OA 5D03A 4DZAA 3VKAA 3JW7A 3VUSA 3AXIA 3M16A 2HNEA 1QNRA 1KR0A 2DVTA 4JCLA 4J2PA 2WHJA 2FFCA 4FR6A 5CC3A 3H7RA 3WDJA 1TMQA 1I60A 3LV6A 5HXMA 1TWWA 3TC6A 1CT5A 2J75A 4IMFA 5EFFA 1VBUA 2PDUA 4FK9A 5A1AA 1SZFA 4Q8MA 4IH3A 4Z2LA 4K39A 1B5TA 1WBHA 4IP7A 3DFHA 4NUWA 4MPQA 5D9OA 2QCFA 3VVGA 2EPNA 2NUYA 3GNPA 4QM1A 4AHQA 3FEQA 4GVGA 3MP4A 1EYEA 1KTNA 4DUVA 3O6AA 3RYSA 4YCOA 1XFBA 1R3SA 3WNLA 2FHBA 2NSXA 4BEUA 1AODA 4E8DA 1KR1A 1BVWA 1OB0A 1QOQA 1K6AA 3Q67A 4E4UA 2INZA 2CZDA 3KOYA 3U5YA 1XCFA 3CV1A 3ZJKA 1W8GA 4QJ4B 1OINA 1YXDA 3O63A 5I77A 4ORIA 3TTYA 1XM3A 5EPDA 3UW6A 4IIHA 1XDMA 5TF0A 1AZ1A 3D3FA 3I6EA 3VCNA 4Q7IA 5I09A 4Z42C 3VD9A 4K2SA 4C6EA 3STPA 4TUFA 1KGXA 5C7HA 1X1NA 5AY7A 1S3TC 2OQLA 2ZDSA 4NZ3A 2G96A 1Q6FA 5CZ0A 5HR6A 1JPIA 1E40A 1RCOB 1K9DA 1TMLA 4WJEA 3W7OA 4D6DA 2YOCA 5DF0A 4ZEPA 1EXPA 4IX0A 2XH2A 3MI6A 1Y8BA 4B5VA 3N3MA 1R8LA 2FJUB 2ISSA 1H60A 2Y5SA 4WEVX 1H7OA 1B90A 1GKQA 3TWBA 1VCGA 5A6TC 4HMCA 1H5VA 3NYDA 3VZXA 3FSTA 3EPNA 4Q4RA 3UVIA 3TROA 2P3ZA 3I10A 3GNXA 3OA3A 4IUOA 1TPFA 3NQ7A 1FHVA 3VOHA 3UVAA 4TTGA 2V67A 3S6DA 1W54A 1CGVA 2PBGA 4LUSB 5BMWA 5FJTA 1Q6DA 3WD3A 2X0SA 1UD6A 6REQB 1LOLA 3NL6A 1K8XA 3AYVA 5LNUA 4J7RA 1UKQA 2ZRWA 2FPTA 4GVIA 5HJXA 2ZUWA 3H22A 2HV5A 4M7TA 4WJ8A 8XIAA 3QC0A 5CG7A 1DHKA 4UTHA 5JIWA 3KDOA 1N2VA 2FLIA 1CENA 4NXKA 4IXHA 2XZ7A 8RUCA 4FX7A 1DTNA 1JF6A 4LS1A 2JKAA 1NDZA 3DC0A 1LP6A 1ZP3A 1A3HA 1M68A 1XRVA 2DZXA 4Y9NA 3DYOA 1XF0A 4XAPA 3BAYA 2EG6A 3FJLA 1PDYA 3EXTA 4L4MA 1G94A 1REQB 3RR4A 3PSVA 2MNRA 3ATYA 3KE0A 2QW5A 5DCBA 4LGXA 5FJOA 4DJFD 1OWQA 2VVNA 1M53A 3AIUA 3LY0A 1QOPA 4XWUA 2V68A 2ZUSA 1P7TA 2WV8A 3HG4A 1IT0A 3NQVA 2YL5A 3H6OA 3W2UA 3RPMA 4JQ1A 4YHGA 3W7DA 1YDOA 2Q8LA 2J78A 2VX4A 5BYWA 2CBIA 1W1ZA 3PULA 1DYSA 3BAXA 3CPGA 5K9DA 2J7HA 1MMFA 3BGJA 1J8VA 2WXDM 3PTQA 2NT1A 2RDUA 1SYTA 2PA6A 3ARRA 1UKTA 4AD3A 2IPGA 1E3ZA 3BLKA 3S2JA 1KKRA 3ITYA 3GAYA 3GDRA 1ESWA 5DMLA 4CD8A 3V18A 4H9VA 5CJMA 5A2BA 1X97A 3C2OA 4IMEA 1XIFA 4RUBA 1IR1A 3OZOA 4GKTA 1IEIA 1P48A 1Y5XA 3L4XA 5FEZA 3C6CA 2ALDA 1YTDA 4PZVA 1TUFA 4WY0A 3HV9A 3K4WA 5HNTA 2QCCA 1QASA 1N7KA 1UWIA 4N9EA 1EZWA 1XLGA 3MC5A 2Y61A 3A64A 2O4QA 2PLMA 3V5CA 1G67A 1ZJBA 5H1WA 3WQOA 3DX5A 2A3LA 4FLSA 4IL2A 1D3HA 3LRMA 1FCUA 3EX6A 3NZQA 2X05A 4AX6A 2Y88A 2R94A 1K8ZA 1JAKA 1OX4A 3WLRA 3WUBA 2J88A 4DQWA 3W85A 3L23A 3A24A 1F8MA 3G1YA 2WHKA 1VFOA 4H8VA 2WZEA 1JR1A 4FXJA 4H9ZA 3WN6A 3RM4A 4LVFA 1BF2A 3VOFA 2J8FA 2PDKA 4UOJA 1CLXA 1YPIA 1HGWA 3STFA 3W28A 1FWIC 2VGBA 4GC3A 4YLWA 3RU6A 3W6MA 4O8RA 4ROPA 3TK7A 2ISWA 2VHLA 3UCQA 2TAAA 4LUTB 2VFDA 1J11A 1QI2A 3I3DA 3M0MA 4MHBA 4I8DA 1AL8A 3RJXA 3PZOA 3N2MA 7TAAA 3UCCA 3FYYA 3LPFA 5F2LA 3L4YA 3MUXA 4US5D 1W9VA 2V8ZA 4EX4A 5KSWA 1W3LA 4ZXLA 1Q13A 3OIXA 4CQ9A 3FS2A 3FXYA 3LTPA 4UTFA 3U4FA 3TTOA 1HJXA 4CCZA 4Z0SA 3W81A 1QK0A 3PUEA 4FX8A 1QMLA 3WJSA 3I3BA 1UOKA 2BOEX 1K7EA 4CVWA 6TAAA 2E5CA 2BOGX 2G3FA 4O1CA 2ZX6A 3UNTA 4HYVA 4MAZA 4PMXA 1HVXA 2GOUA 3KWXA 5D8ZA 3V7PA 4H6EA 2PI6A 1OZMA 5BWAA 4YJ5A 2NV9A 2EJAA 1A49A 2A3BA 3KP0A 2NWSA 3NTYA 1XJBA 1B3VA 3S5NA 2PCEA 1HO4A 4AD2A 3KLLA 2YPIA 4PR4A 1EWEA 2CZ5A 5HJYA 1OYAA 2YZRA 1FWAC 2FPVA 4PFHA 4ZFMA 1KNWA 2UV8G 2C14A 1KTCA 4JX5A 4UQCA 2FZDA 3F4WA 4PUUA 2WC7A 1NOFA 4IMCA 1E15A 3UPWA 4GZ7A 5BCAA 1XYAA 4X9YA 5K9CA 2CBJA 1HGYA 3U3HA 2YCLB 3QQWA 2CXGA 4F0LA 4EANA 4LRTA 3WBYA 2GSEA 4HNCA 1WUEA 1YHTA 2V2DA 2V5LA 1DJNA 1MWOA 1XLEA 1TR9A 4ACZB 1PYFA 1N8FA 4R3UA 1N8IA 3W1AA 1Q65A 1RXOB 1EQPA 4GHRA 3BG3A 3CNYA 3RAOA 4XTDA 3W7RA 3IVUA 5EBAA 4AH7A 5A6JA 3I6TA 4X9SA 3CQKA 2V69A 1W9PA 2PGEA 4HK7A 3VMNA 1TWZA 2OZTA 1XYBA 1C7SA 3VILA 3U0HA 1OHLA 3O3RA 2W9MA 2OG9A 3FJ4A 3H54A 3NO3A 1B1YA 3FX4A 1KWKA 1W5PA 3B8TA 3BG9A 3QTGA 4I90A 4HZ8A 2FGZA 4AZIA 1SR0A 4XZNX 3G24A 3PZGA 3DDMA 1DXEA 4IG2B 1UH4A 1VRXA 1YPXA 4NNCA 5DT7A 3L5LA 4J9JA 2F84A 5JBFA 1R9XA 4B9YA 1VFTA 3QVQA 5T8GA 1EJUC 3DIPA 3S9IA 3DN5A 4CU8A 4DM2A 1OFBA 2WJEA 4ACYA 2V3FA 1LRTA 1V6UA 3BJFA 1E4LA 3QPZA 2FZNA 3Q45A 4A2SA 3ZR4A 4PN2A 5LYRA 4JHMA 3IVTA 3SDOA 3PR2A 4R9XA 5T9BG 2W4XA 1GVRA 3OGSA 1RK6A 4QXIA 1QNSA 1H51A 3BQ5A 3MVTA 1TPVA 5CC5A 2HXUA 3SM0A 3AUOA 2ZRZA 1UBPC 4Y8FA 3RDKA 1BXBA 2ZADA 3ZMRA 3WELA 1E6PA 2ZXBA 4D6JA 4FO4A 4U2YA 1ME7A 5F7UA 4UFIA 2CZEA 4K1GA 4E2DA 2VEFA 5HMEA 3RLHA 3B0YA 3SCQA 4LCRA 3D47A 4FIQA 3QV6A 1WDWA 3MCNA 3GH4A 4B15A 5G2IA 5E9XA 3QOMA 5G2HA 5HATA 3WLNA 2GUBA 1FXPA 4ZE5A 1IEWA 1XFCA 1J0HA 3GXFA 1UR8A 1US0A 2QEZA 1UG6A 5E5CA 4MJZA 4J3XA 2WHMA 4URIA 4U3CA 1XINA 4LV9A 1YDVA 2Y8KA 2BDQA 1P4CA 3NURA 2PDWA 5ABEA 5JXQA 1VC4A 2NLYA 4PRTA 3LN3A 3IAPA 3Q58A 4AZ5A 4EWND 1OG6A 4M51A 2PDJA 1IEQA 4XUGA 2JK2A 2YLLA 3UJEA 4S3FA 3MZ2A 1EA9C 4HMNA 2ZTKA 3EWXA 2WO5A 1RHCA 1X1OA 4A6GA 1XDLA 4FF7A 2PDCA 1Z7AA 3T4WA 2I7GA 4AIUA 4V2XA 3GO2A 1PKNA 3ZZ1A 2GJNA 1FWHC 2FIQA 1PDZA 2X1SA 3F2DA 1OK6A 3B3DA 3RM9A 3V0TA 4C6PA 2WNZA 3IVSA 2XYLA 2Y89A 4QQ3A 1D7KA 3VABA 3K4AA 4IF2A 5I24A 3CJPA 1EZ2A 4ATDA 3DFTA 1JNEA 5J5DA 3NWRA 3UWUA 1QJWA 4U31A 1UP3A 4GX9A 4QEHA 4GBUA 3NR0A 4KRUA 2YW3A 3CZEA 3GYEA 3GM8A 1YE6A 3RX4A 3GXMA 1IZKA 4GY7A 2FPYA 1R2TA 1YEYA 4Z2KA 4YTQA 4PUJA 3UZ5A 1EIXA 4AD4A 4LVAA 1WZAA 2O9TA 3T0DA 1T40A 3GUGA 4QHRA 4AWEA 1H1NA 2W62A 1V02A 2DSUA 2ZUVA 4MLRA 5DQPA 3BW4A 2QJMA 1GORA 4ACZA 1E6NA 1XLKA 4ZA0A 2BHUA 1GQIA 3PNZA 4H8HA 2QGHA 1PTAA 3TNBA 1Q6OA 1KFWA 1UQYA 1UR2A 3MUZ1 5D37A 2BNJA 3GVGA 3N9RA 1EKOA 4RKAA 4P8VA 3L2MA 1RSCA 4WVXA 2ZZ3A 3KW3A 5E0FA 1H3GA 2VOTA 3GW3A 2AAAA 1RP8A 3I7QA 4QLLA 4FP1A 5LNWA 4OTKA 3H53A 4FPSA 4QSHA 3W24A 2CWXA 3E5PA 3LDVA 3WH7A 1BD0A 3KBVA 4AUBA 2XUCA 3WMSA 2CBUA 3M64A 5E0KA 5AHEA 3QBUA 3STEA 4D8LA 2C16A 3MJMA 3UXDA 2WVVA 2PLCA 3CB3A 4A3HA 3TNOA 5CJNA 1DJIA 4JD4A 3WZ0E 1HJWA 3AIWA 4DBEA 4NX0A 1DQWA 4CLMA 4B91A 2PDHA 2R1PA 2Z1XA 5I3HA 3ES8A 2FZMA 3C2EA 5MHBA 3HU7A 4JS3A 3WQFA 4XKYB 1TQXA 4D71A 4W5UA 4IPNB 1GOOA 3QR0A 1W3IA 2VQTA 4H6RA 3ABOA 5CPMA 4ERGA 2QUNA 3GU2A 4UTWC 2P5NA 2XIJA 3AYRA 4EVZA 1PTGA 4IQDA 3ANYA 3ZVHA 4GQGA 4LNCA 4WDXA 3TX9A 3R8RA 3LHTA 7ENLA 1DIDA 3RN6A 1K1DA 1RQBA 4PL1A 1WAWA 4OWGA 2XZ9A 3IIOA 4F2TA 4W93A 4MMWA 1Y5VA 1H09A 4S38A 3DU0A 4HTYA 4C6LA 5A95A 3VDAA 1A5SA 3GB6A 3QLDA 5IBXC 3DKLA 3BURA 3WLJA 3LHWA 3WEZA 1E0XA 3HG3A 4L7ZA 1LLZA 2YSWA 1A5CA 3E96A 2PUZA 5CKSA 3LI1A 2DT2A 4EACA 1PYMA 1VIZA 1DTUA 4TMCA 1TTPA 3CAKA 1WKFA 4DWDA 2GGIA 2VYOA 3RM8A 2EKCA 4I9JA 3IS4A 1AW1A 4Z08A 1QAPA 4EK7A 4X22A 3E2SA 1DL3A 1DJHA 3BCJA 4POCA 4RPQA 4UCGA 3T6CA 1XUZA 3NVTA 4F2UA 3W74A 3VM5A 4PMUA 4LAKA 2VCAA 1IGSA 3C2YA 4KH2A 1LL7A 2X2YA 2AGTA 2OELA 1OIMA 5ABFA 1L8NA 4HU8A 3G0UA 4A8LA 5M1TA 1AL7A 3GAKA 7XIMA 3TC3A 1FWWA 2OGJA 2IKGA 3F4DA 4LYKA 4WXYA 1HL2A 1NFPA 3BOLA 4M3PA 1LQ2A 2P53A 4MKSA 1IWAA 4GQQA 1ZLPA 3U9IA 1AW5A 3II1A 3VGDA 1W1IE 4XO7A 1R3YA 4KGJA 3QR3A 5FJIA 3EX3A 3W73A 1E43A 3T4CA 3C0SA 3WMBA 4CU6A 1PCWA 4LYQA 2I5QA 4TVUA 1EXBA 4M1BA 4LQ1A 3PANA 3DFSA 3E0VA 3F5LA 2J66A 4KCVA 4IQLA 4MKVA 4XAGA 3S1VA 5M17A 4I5XA 1GT8A 3S8HA 1VBJA 4JEJA 1PIIA 4ZOAA 2FGLA 3UWYA 5K4ZA 3NEHA 4PMRA 3A5FA 5D2TA 4N7QA 3LCWA 4B5TA 3SCUA 1AJ0A 4S2BA 5D8WA 1J0YA 1SJDA 4RZ5A 3G0XA 3GBEA 4MSSA 3WNNA 1W91A 2I5IA 3VNDA 2J7FA 4GIAA 3CH9A 1YX1A 4ZXOA 5JIPA 1CXIA 3BLDA 2Y2WA 4WKAA 2GQ9A 3DESA 1KFBA 2JBMA 3TQVA 1ZP4A 3HGOA 4IPLA 2D2HA 4TO8A 1VHCA 3W27A 5H8MA 5HNUA 3MUY1 2ZE0A 4BF9A 5BRBA 1PSCA 3KOWA 2EG8A 1Q8JA 5LIYX 1XLLA 1AVAA 1VFSA 4ML4A 2YIHA 4DF0A 4QIUA 3VDCA 4GVHA 3PUGA 4KIRA 9XIMA 1A0CA 1LUCA 4PMQA 4JFSA 3UPBA 4C6OA 4LYPA 4N42A 4IGNA 5F4WA 4KERA 4AU0A 4P2VA 2VT0A 1NJJA 3CZJA 3W2NA 1KXHA 4GXWA 2DUXA 1ICSA 1TA3A 2QYGA 1EC7A 4Q4QA 3PWAA 5DBUA 4L6OA 2CWNA 3TAKA 4Z1YA 1OG0A 4MFEA 3A22A 2WSRA 4IFOA 4HCDA 1ZY9A 3NIYA 1TG7A 3N4AA 1O1HA 4GLEA 2Z6JA 3P5ZA 3WLIA 3W1NA 4GI6A 2JQXA 3BV4A 2W61A 1T8XA 2CLIA 3CXOA 1WUFA 3H2MA 4WDWA 3B9AA 3VZZA 3OG2A 4C6MA 2A3EA 2XSXA 3W84A 3LLDA 3SQLA 2P8BA 3OTRA 3C3UA 1FWDC 4HHLA 5U7SA 1LQAA 3THCA 2IUZA 3U6WA 2D0HA 3R43A 1UOZA 4FLQA 2VO5A 1R0MA 3TE9A 4HZ6A 4DWSB 2OOGA 4JYDA 2PTWA 1PTDA 2ISDA 4PB4A 3DXIA 1W8SA 1JPHA 5I78A 3M5ZA 2DIJA 1XCXA 1HZYA 4JCMA 4CNTA 1VYPX 1R2RA 3GDMA 3LV5A 4TTUA 1KRAC 2Y7EA 1NAL1 4DVOA 4CNPA 3EB3A 3A3XA 4PA8A 2BVYA 1I2PA 4S3JA 2GYIA 1KBIA 3PJXA 4Z1CA 3AZTA 3BICA 3VOCA 4S3GA 2WVSA 1HKIA 1JGMA 1UD8A 1W17A 3G3MA 2YR1A 2PTDA 2GJRA 2V3EA 4LBSA 3OVGA 1SO6A 2A1YA 4EAMA 4YNGA 1F05A 3W1UA 5CPSA 4JTCA 1J12A 3H2NA 1IXNA 4B5XA 5JU6A 4OBRA 1XD0A 1T6MA 4Z1AA 4K7VA 3B9EA 3EWCA 3UJSA 1XISA 1TVLA 2V81A 2Z1WA 1TX0A 2ZX8A 3P8IA 3NGJA 2H3DA 2VGGA 1H7RA 4JFWA 5ABTA 3BOXA 2YA1A 3AUJA 2D73A 1LRNA 3MA8A 2Z1KA 1GUVA 4HBKA 5A3HA 3WD0A 4LTSA 5CCZA 2YA2A 4UFKA 4PSRA 3NOEA 1E1CB 3QKEA 1IXPA 3RO6A 3EXSA 3M44A 3NL2A 3IJ7A 3LCIA 1VIWA 1AZ2A 3W70A 3CH0A 1WCGA 4ZO9A 1O60A 1Q8AA 1TV8A 4AAJA 1JGIA 1XWYA 3LCLA 1NQ6A 2VUYA 3HG5A 3E0LA 1IXQA 1DJXA 2NZLA 1XYCA 3P14A 3VGGA 3F4CA 1WZMA 1VEOA 1BXCA 1TCMA 3BWWA 3HQNA 3EWZA 4RR4A 1LT7A 3EGJA 4I8YA 4BHYA 4W5ZA 1EP3A 1HN1A 3USZA 3MMDA 2E77A 5HQLA 4NZ4A 1R9YA 1EX5A 5T26A 2VMFA 3JZEA 3CGTA 2PCQA 2OZ0A 3HG2A 4TQTA 4HSOA 4PBEA 1EBGA 1Q3NA 1EJVC 4I6KA 4LFYA 1DQUA 3LMZA 4OT7A 4AFYA 3ZM8A 4GABA 4A3QA 1SFTA 3R11A 1TE1A 1BQCA 3C2VA 4JQ3A 1DXFA 3UXIA 1SVDA 1VFMA 4IFKB 4AD5A 1QPRA 4JDBA 1UH3A 2C1IA 5AVHA 5FKYA 1Q63A 4GJJA 1FHDA 3OZMA 5FF0A 5A8MA 3GUWA 4LSBA 1I4NA 2E67A 4KEVA 3URBA 4Q4SA 1UD4A 3GDTA 1RCQA 1V77A 2G41A 4QGCA 5GNXA 2ZTJA 1Z41A 1ONXA 4MOZA 2ZXAA 3USBA 4IIGA 2A3CA 5HDRA 3U57A 1KD0A 1GEHA 3HO8A 4IFKA 4WD0A 3VIOA 3THAA 4C6FA 3A23A 5JQ9A 2IKHA 4WKHA 2C71A 4WDTA 4GACA 2F8QA 1U1UA 3LEPA 2G5WA 4L65A 1O6IA 1FKWA 4MM1A 3WK0A 3A5VA 5I3GA 5FACA 1WO2A 2DT3A 2VX6A 3KRSA 4YHEA 3Q94A 3W7PA 1XIBA 5F2GA 4LB3A 1MZHA 2QNEA 1Y5WA 2YLAA 4ADTA 3CM4A 3VOIA 1V6WA 1S2VA 4G5DA 2AMXA 1C93A 5D2VA 1XR2A 3O16A 3GXTA 4ZQCA 2Z7GA 5DXYA 4JNYA 1C8YA 3W23A 1HJVA 1XLIA 4MG4A 2ISFA 2F9RA 3FKKA 3DOPA 5KZEA 1GKPA 1WE5A 2VP8A 5BW6A 3O2LA 4K8EA 3FK4A 4PUDA 3RX3A 3K8KA 4Z2IA 3ARYA 5C9WA 1ENUA 3W0KA 3LQLA 2ACQA 3CL8A 2E6YA 2SFPA 3GIPA 3HQ1A 4ZB2A 2ZA1A 1P6BA 1U1HA 2H90A 3HMJG 4JFVA 1LLOA 3TSBA 3GTFA 3BJTA 4XD6A 3R1ZA 4C1LA 1Q6EA 2PSNA 3HJEA 1FCBA 1S5WA 2ZZ2A 4MZ1A 1B4KA 1T99A 1KB3A 5EBUA 1UR4A 1KM1A 1FKXA 1DVJA 2J24A 1JG9A 3SUTA 1A0DA 3WQCA 2FJKA 3CASA 1UJPA 2Z1VA 1M04A 4CCCA 4A35A 4C90A 1JZ2A 1EJXC 2BY1A 1C3FA 2E4TA 3QMSA 4US5A 5G1YA 2DU2A 3HURA 2VTFA 4X2PA 3I4EA 1MO0A 4BFAA 1B30A 2OYKA 3BJSA 3WO8A 1KBLA 4O15A 4CNNA 3HZ3A 4PMZA 3ES7A 3W76A 1HFBA 8A3HA 1O95A 4GVFA 3AZRA 3URAA 3MJYA 3JRKA 1ZAJA 4C7DA 3W7EA 3AXKA 1GZJA 4HU4A 1SMDA 4CD5A 2GQAA 4E2OA 3SGZA 2PDBA 2VZSA 1I75A 3L4WA 2VC7A 5GPRA 5A6KA 1RVKA 2DGAA 1J6OA 3QXBA 2HS6A 4WHBA 2WCGA 3KP1A 3SADA 1OFDA 5D04C 1BPLB 1QVBA 3P80A 1CLVA 4H41A 4WRHA 4JIPA 3K2GA 2I1OA 5A2CA 3VFLA 4FXSA 3E49A 2O56A 3ALGA 3BAKA 3S1WA 3DEQA 3DHUA 4J3ZA 3DG7A 3M6DA 1JEZA 3TOPA 4WX2A 4NQ1A 3SCVA 1Q2SA 1V3MA 4HK6A 5M5DA 4P8WA 1W3HA 4JGDA 3G1SA 1DORA 4ERAA 2HTMA 1NOUA 1XBZA 4ZSUA 1S46A 1NWRA 1EHNA 5DT5A 3IIVA 4GA8A 1C8XA 1YKWA 2A79A 4PMDA 5AYBA 2Q6ZA 2WM1A 4WK9A 1TVNA 1W9XA 5E09A 1HKJA 4GK8A 4JTDA 1QATA 1BG9A 3EMQA 1B31A 3VPLA 2WZMA 5A6MA 3CK5A 1FCVA 1UMLA 5CPLA 5I03A 3M0JA 3AJXA 1RAKA 1L6SA 1BYAA 4MGGA 2NLIA 1ICPA 2QUMA 3ZYZA 3N29A 4RZBA 1P1MA 4LNYA 5CZKA 5D38A 2GUUA 2F7FA 4KBXA 2PS2A 2GOKA 4H00A 3AAMA 4H8UA 5I6SA 4W85A 1SW7A 1W1VA 3IIXA 1JF5A 3OBKA 4PCNA 2PB1A 1DWIM 4L64A 2R1MA 7REQA 4XBSA 1ODUA 4DWSC 1E3XA 3SSJA 4JIQA 2VM8A 4A05A 2W66A 3KHDA 4HN4A 3OQEA 3QHOA 1TPEA 2OSYA 3VIJA 4NNBA 4UR9A 3AHYA 3J7HA 3UR5A 4QE5A 2WK2A 4BJHA 1BSLA 3WUFA 3WDIA 2HCVA 2XWDA 3WLHA 2E28A 5IXEA 5LNRA 4PTDA 1LG2A 4I5UA 3HPZA 5AC7A 3CQ0A 2DSKA 1KBKA 2GQ3A 4M8UA 1ZENA 2OR2A 5E93A 1XIGA 1XRFA 1VPXA 1LF1A 2BBFA 2J25A 4LVBA 1FH7A 5CAKA 3VKCA 3TQKA 1GPFA 3TV8A 5A6BA 1CB7B 1KCLA 5BXSA 5IHSA 4K6AA 3LYEA 1MUCA 2E68A 4AHOA 1GQNA 3U8GA 1LL4A 4PCTA 1JCNA 5T91A 3GR4A 4UIOA 4GRSA 1CI1A 3W71A 4NKCA 3FN9A 1IYXA 3CEPA 1YXYA 3AALA 1IIGA 1EBHA 4D6HA 4DUWA 2ZKMX 4BY3A 4QNEA 5A6AA 2WKGA 3OO2A 4YXGA 1XSKA 4AG0A 2OGYA 3RNDA 3VNYA 1TWDA 3Q4DA 4GX8A 2YCEA 1DQXA 2FMOA 3WNPA 1IHIA 3ITOA 6REQA 4GC4A 2VFGA 1R7OA 3LI0A 1DJZA 2QS8A 2XM1A 4LUSA 4XISA 1EHAA 4IZGA 3GFZA 1LQ0A 2E9MA 2WCAA 3IRDA 1XXXA 4XIMA 4O52A 4J3SA 1KCZA 4FNRA 4ZO8A 3VU2A 4IGSA 3WQPA 1PZ1A 2HE8A 3WL1A 2BLEA 5EY5A 1DKWA 1W3NA 3GZ3A 1BKHA 1CCWB 2BOFX 4C1NB 2VGIA 1BGGA 1UZ4A 3O05A 2VFIA 2E8ZA 1X8CA 3W83A 1BQGA 4JL2A 2X40A 1VYSX 3UXKA 2HMCA 2Z1BA 4NZ1A 4MNKA 4LEQA 5FSEC 1CXEA 4DI8A 2VEMA 1OC5A 2HVMA 4RE3A 1BWVA 1NSJA 3LZ5A 5DXXA 3TN6A 3TYBA 1ZJIA 5IBXA 3B05A 5FCZA 2E25A 3TZNA 4GNJA 1XBYA 1QPNA 1O1ZA 1ME9A 3NG3A 1W31A 3IACA 4N6EA 1GVYA 3THDA 3TZFA 2XJ7A 2WPGA 1FH8A 1QXLA 4EAYA 2VDGA 1PWMA 3AXXA 3ONCA 4C7GA 3IJQA 1S1PA 2YL9A 3HMCA 4B5NA 4AHPA 3C61A 1FFQA 2RGMA 1QHZA 1W5MA 4MVAA 3UD6A 4IP5A 2E1WA 1RD5A 2QGYA 2FTPA 2H9AB 1VAHA 4F66A 4KWVA 3FKRA 3ABRA 3H2CA 4WF7A 4WSKA 1FHLA 4AB4A 2B7PA 1O5KA 4AC1X 1JCMP 1GQJA 3OP2A 4N9BA 3R25A 4ZOBA 3MQTA 4JFTA 3KEHA 1S5MA 4NJJA 3VTRA 3MKKA 1XC4A 3PSWA 3AC0A 4BQ3A 1Z42A 2Y62A 3NVDA 3BGGA 4XSLA 1E71M 3E2QA 3HIJA 2IKJA 2QUVA 3KOFA 1WPCA 2B4GA 4HVXA 5GJPA 4FB7A 4HPNA 3P2VA 4XBJA 3DZ1A 5EGRA 2OWXA 4UXDA 3IJ9A 4S2CA 1R2SA 5C2XA 1VF8A 4M81A 2E8YA 4UOZA 3INPA 4INFA 5E70A 2XH0A 1BSIA 2BY2A 1RJRA 3TR2A 1SO3A 3ARVA 3VI2A 1P0BA 4JTTA 1DJYA 3CV7A 3JZUA 2Z28A 4O0QA 1FTXA 2WKJA 1BYDA 2YXGA 3W7HA 1WBJA 4TX9A 1I1WA 3RG6A 1PX8A 2W79A 1KO0A 3EX4A 1WKDA 2J6VA 3HF3A 4L61A 4F40A 2XVLA 4ZTXA 4JHOA 3WQDA 1VGAA 3NOYA 4YS1A 4ZMGA 3QMRA 1OM0A 3PJWA 2CKSA 1TTJA 1PUDA 3PBWA 5CLWA 5A8NA 4WZHA 1VBRA 4FNQA 2Y85A 3W53A 3G6LA 3GG7A 4QQUA 2ESCA 3A21A 2ADAA 2ZZ5A 1DP0A 1OGGA 3SCRA 2H9AA 3NEVA 5CGQA 4UQ9A 2Z7KA 2EKGA 3GSMA 1YW1A 2OJPA 1HJQA 2WJFA 1NFBA 1B3YA 1AJZA 3P74A 1UMYA 1D8CA 1DIOA 3NQFA 3OQ8A 4YWIA 1U22A 3V5OA 3JU2A 4G8TA 4RPPA 3EMCA 2A21A 3CV2A 2FHCA 3EB2A 4US6A 5A8QA 3BAIA 3CZLA 4FHAA 3TTQA 5E9AA 1PCKA 1XGDA 1PX3A 1RLCL 5XIAA 3W1PA 4FAMA 1RALA 3NXLA 1KXQA 2I57A 3NQDA 3LCXA 4Q8OA 4Y6GA 3M43A 1IQ8A 4JN7A 5A6SA 5AC8A 1E9YB 3WQGA 4B5WA 1MEIA 1CGUA 4B3KA 2AMGA 4KGLA 3N34A 3RPDA 3G1HA 3IV3A 4L56A 1OFEA 4PH6A 2PRMA 1JULA 4CQAA 2PF0A 2A3HA 3THQA 4P61A 4NG3A 1J4EA 4WDUA 3O7UA 1EJRC 1Z9AA 1A5LC 4HHPA 2E6FA 2PODA 3OW1A 5HUPA 1EO5A 4HJWA 4BKNA 3MZNA 3AHXA 4FNUA 4NZFA 3ANUA 4NYUA 4TR9A 1OCBA 3K30A 4ZGYA 1ZUAX 1FUYA 3WBWA 3AQUA 1ISVA 4DJDA 3BV7A 1JDCA 3VKJA 4H7VA 1BVNP 3ITXA 4OHQA 1JZ7A 4LEFA 3IGHX 2OODA 4V33A 1W5QA 4HZ7A 2J27A 3LRLA 3KCLA 1QW8A 3TUUA 4NVTA 4YTTA 2Z2AA 4RZ6A 4J1OA 4IG2A 3MHGA 2WBKA 2BGQA 3CYVA 1LJYA 4L6DA 3ZO9A 3SJ3A 4NAEA 1DOSA 1E73M 3LHYA 1WXJA 3QSRA 1XLHA 3ZLHA 1E1EA 3GYCA 1OFQA 2XSAA 4GFIA 4ZODA 1K70A 3IJ6A 1JYXA 3EAUA 1TV5A 4JTFA 2ZBTA 4IWWA 9XIAA 4UMAA 3IIPA 1JDFA 3WSUA 4M7SA 5CPTA 4A21A 5C2GA 2CLKA 2QCDA 4JTRA 4H9XA 2A6NA 3N3TA 3CLWA 1DHPA 2PURA 3LENA 5DN1A 3GY1A 2J9YA 2R8WA 3A47A 4LCQA 4KWSA 2YDQA 1HL8A 4LC6A 2G8ZA 1X6LA 4GNKB 3G1AA 1FWFC 3VIIA 1GTEA 5A69A 4QLKA 1TREA 3NZPA 1E55A 1VPYA 4AW7A 2P8CA 5HWNA 2XN2A 5G4EA 2YXXA 2FTWA 3AMLA 2CC0A 1G6CA 1E1CA 3SGUA 3E0FA 1R38A 4HSHA 1T41A 1E4NA 3K46A 2FH8A 3UA3A 3TA6A 2WMIB 4TV6A 3TYAA 1E9ZB 4M0XA 4C1KA 1E4MM 2IPWA 2C0HA 4H6QA 4BI6A 4F0SA 1GONA 1TFVA 2GPTA 4M6QA 3V3WA 3WQ5A 2H8ZA 1VJSA 3B8IA 3WD2A 5AZ0A 5KINA 4MZ8A 1M65A 1WQ5A 4CN6A 3MMWA 1NWUA 1RR2A 4XB3A 5EMMA 4OQVA 2DQWA 1N55A 1XHGA 4V15A 4BQ5A 2PTZA 5D2YA 1ECQA 3M7WA 2YBVA 3E2VA 1V02E 2P3EA 3TYUA 5A6BD 3GBDA 1KBBA 1Q7QA 1UKPA 4B92A 4IIFA 4IP4A 2QJGA 2YA0A 1TRIA 3SEPA 2J79A 3PZ9A 2P1FA 1A4LA 1E51A 1QPQA 3OVRA 2G97A 4TX6A 4BCEA 3W3OA 3TYEA 3BO9A 1YDYA 5GVJA 3UETA 3NDOA 3S6TA 3B97A 4IGHA 2CHRA 5C54A 1XIDA 3TYDA 4C65A 4QAWA 3C86A 3RMEA 1GZ1A 2BGNE 3SW6A 3KFTA 4YMZA 4DWSD 2XVGA 3L0GA 3W1RA 1QHPA 4JXCA 2Z4GA 5C9UA 4MB5A 5REQA 3VE7A 2QIIA 1V6TA 4D72A 5EYWA 3FAXA 2WMKA 3BG5A 3W88A 1J9YA 1QO5A 1GG1A 1Q4NX 2NT0A 1OCJA 5DRIA 3MW7A 3S83A 2D0GA 1YYAA 1XC6A 4EXBA 1CGWA 5BROA 1D3CA 1R3WA 2F6XA 2FDSA 1UWQA 2DJXA 4C6DA 4UFLA 1ZCCA 2PZNA 2Z24A 4ZFCA 3FJ6A 1XYZA 4W8AA 3CBWA 3DFNA 3R12A 1XW8A 2V3GA 1SMAA 3ARPA 5REQB 4GISA 3RUBL 2WMHA 1IV8A 2VZTA 4AZGA 2BY3A 4F9DA 2D22A 2A7NA 1XPGA 2VVSA 4MWAC 3TSDA 5L6UA 1EPVA 3GD6A 4OBTA 5D9PA 4UQEA 2QCMA 3LMYA 2YFOA 3LSCA 1L0PA 1K8CA 5C9RA 3ZR5A 3KTSA 3DC8A 1M7JA 5FSDC 4Q8PA 1GOWA 1T8QA 5HINA 3UG8A 2XFRA 3VXGA 2WB5A 3ZIZA 3W2JA 3GIQA 4R9OA 3CQJA 3LHVA 2ACSA 2OKOA 4N9CA 4PBFA 1F61A 1TIWA 3FY1A 1P6CA 4B4HA 1TPC1 3R6IA 5LXXA 3XIMA 2ON3A 3OPSA 2CBVA 3MB9A 4GI4A 2YZ5A 3E1F1 1MRAA 4CCEA 3P82A 1B0IA 4R53A 2GGHA 4G56A 1E6SM 3WF0A 1F3XA 3OHMB 1W2PA 3MS8A 3UZJA 5FJUA 2YCIX 4ES4A 4MNMA 3VC5A 4UTTA 2XFWA 1S38A 3LQGA 3SRHA 4AIEA 5HBFA 2TPSA 4HCLA 3QF0A 3IPWA 2WYSA 1GW9A 3LG3A 1T7LA 1EC9A 1GYMA 1K8YA 1RUSA 2OFJA 3CT7A 3CS2A 3LBMA 3W02A 2CERA 4EF9A 3C8NA 1E56A 4IICA 4IMGA 5AFDA 5IDIA 2Y8VA 2PWEA 2ICSA 1RK5A 4GQBA 1OQFA 1NDVA 3KZSA 3W7QA 1FWRA 4JHZA 3VIFA 4P5UA 1F6KA 4GOAA 3EZ4A 5AYZA 3UWVA 1IZCA 3P0XA 1VS1A 1BYCA 4O12A 2OT1A 4NL1A 1KM5A 1EJTC 3LLFA 2G3IA 1GOMA 5LA2A 1AG1O 3W7LA 4L5ZA 5C0QA 3QKZA 2GZXA 3OYZA 4Z17A 4C60A 4NI3A 1GVQA 2CLOA 2NX9A 2YXOA 5T9CE 3D3AA 3AS2A 3PG9A 4UMCA 3T8QA 1W3KA 1XG4A 3REQA 2IPFA 4HP5A 4J28A 2YYUA 3V4BA 3M47A 3LPPA 4QCFA 4ZQNA 4I7VA 3SFKA 2PDLA 4DEFA 1A5AA 5ENLA 3KXQA 3WQ8A 4G6CA 1YADA 2BFGA 1BTMA 4IJCA 1E6XM 2VR2A 3JUGA 3P81A 3WBAA 1UA3A 4KPLA 4LF2A 1AMYA 2L5HA 3QEZA 1W56A 3VIHA 2W27A 2A4AA 3DHFA 3G2GA 2PLKA 4NJHA 3MV01 1XYLA 2GL5A 4FOKA 1UUQA 1BXNA 4YCPA 1X96A 4XAYA 3OJGA 1YDNA 3V16A 3THUA 1EP2A 4XVDA 3V75A 2P88A 2Q3RA 2PD5A 3S5OA 2YYTA 1ZL1A 2NUXA 4NZJA 4DJFA 3W01A 4UR7A 3G0SA 1OBAA 2J7EA 3N17A 3IGSA 1CBGA 1FWCC 3R0KA 3WF4A 3T2PA 2I14A 4QP0A 4JAWA 2GVLA 2PGWA 3VKKA 4K68A 1LUCB 4RK8A 4DO5A 3EDKA 1B3WA 5L9FA 1K7FA 5AHLA 2Y5EA 1E9IA 1QT1A 2YFNA 5I02A 2VFEA 1S2UA 3NSXA 2G3MA 2XVKA 4C6BA 3AWNA 4UTWA 3ZR6A 3N9SA 1MXSA 2ZZ1A 2YJQA 3M0LA 3TSMA 3UXLA 3B8DA 1OC6A 2QPXA 5BXPA 4S1FA 3GQYA 1F6YA 3IIZA 3BMVA 1XL9A 1GJWA 2Z27A 4UNIA 4OE7A 3TWAA 1VZWA 3KBMA 3EDDA 2AL1A 2QCLA 1NVMA 1VFUA 5FJPA 4HSNA 4K8HA 4B3ZA 4KFPA 4M24A 4O4WA 5KZMA 4L1GA 4L4LA 2E09A 4B5SA 3NQBA 3VC6A 3RHGA 5CSUA 5MKGB 2CHNA 3OLDA 1SSGA