1H7NA

Schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with laevulinic acid at 1.6 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
340
structure length
340
Chain Sequence
b'MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
publication title The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Substrate and Three Inhibitors
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dehydratase
total genus 124
structure length 340
sequence length 340
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1h7nA00
2WNNA 1HO1A 1UASA 2TPSA 1H1ZA 4AF0A 1KM2A 1FUYA 3P80A 1S3HA 2O7QA 3BG3A 3UYCA 3I7RA 3IV3A 4UFJA 4GJ1A 3P82A 5HJLA 4Q33A 5FF0A 1NF7A 4ZQRA 3O63A 1JRCA 4GXMA 3QPZA 1EP3A 1YPIA 3R5EA 3CEUA 3PY2A 3N14A 1TTJA 1UUMA 3TR2A 2C6QA 4I9AA 3A23A 4NUWA 4U4MA 2QCMA 3O05A 1HTIA 3BK0A 1HG3A 3UY8A 3O6DA 5BOOA 3TROA 2ZRYA 2J88A 1LLZA 1DV7A 3UZJA 2QCDA 3LCWA 3GVGA 1G4PA 3GIYA 3MO7A 1RQHA 2X16A 4JTHA 3W1XA 3L2IA 5C6MA 3W6YA 4O1CA 4LW7A 1SW7A 1HUVA 2JBMA 1TV7A 1TJRA 4AB4A 4K39A 2WSYA 3LRKA 5EYWA 3R8RA 4UNKA 3W23A 3A5FA 4D2JA 4LRSA 1YPFA 1SSGA 1R2SA 3MI6A 4M6QA 3LHVA 2BLEA 2Y7FA 3TFXA 3OHIA 2R94A 3W2KA 2PC4A 5K9DA 2FB3A 3U8GA 5LNRA 4Q4KA 1LORA 4E2BA 4CQ9A 4MFDA 2QAPA 2ZRWA 2CLEA 3VNDA 4N9DA 3NQ8A 1OJXA 3PUEA 1K8XA 1PHWA 2ATMA 4MKNA 3KRUA 4RJEA 3S5NA 5AYXA 2E6AA 4ZVJA 3TKFA 4R7JA 1ZALA 2AGKA 3QZEA 2CU0A 3W2UA 2VFDA 1KM5A 3DHDA 3OA3A 3BVJA 1Q45A 2FPYA 5HWMA 4Z1AA 1L6WA 2TYSA 1ML1A 4M7TA 1VHNA 1Z44A 5CPOA 2VFEA 3QSTA 3M5YA 4JDYA 5TIMA 1OK6A 2ISSA 4FIQA 4UFKA 1BTMA 5K7JA 5KINA 4XBKA 3H53A 5C54A 3L5LA 2J9ZA 1Q6QA 3LLDA 1LTDA 3LBMA 2Y7EA 3NQMA 5AHIA 1TPVA 4QNEA 3NG3A 2RHGA 1H62A 3L9CA 4P2VA 2NX1A 3W2MA 2CLLA 3TC6A 1BWKA 2E6YA 1D3HA 1H7OA 4CNOA 5K9CA 2FJKA 4MY8A 1ZHAA 4NJJA 2WSRA 4PFMA 1AW1A 1VCVA 3M6YA 3N9RA 1R2TA 3PG8A 5FF7A 3DZ1A 3VI2A 2DU2A 2H3BA 2HMCA 3LB0A 1OYAA 3QRHA 3P60A 4EWND 3B06A 2GOUA 4HNTA 2V81A 3AJXA 1OYCA 4JTIA 3LRMA 3G8EA 1KFCA 1KFJA 4MLJA 3NQEA 4GUHA 2YXGA 5AB3A 1ZCOA 3W2NA 2Y89A 5HR7A 2Q8LA 3W74A 4MOZA 2A7PA 1OG0A 1PL9A 1Q6RA 3EKLA 5G4WA 1UCWA 3W76A 1PS9A 5HUPA 1R2RA 2VFIA 3S0CA 1OX4A 4FNSA 1GQNA 3R89A 1W1ZA 2NV2A 3LXBA 4O28A 1OFOA 3LV5A 1DQWA 3HO8A 4GUJA 3KAOA 3W7LA 1JQXA 2V2DA 3QW4B 1J2WA 3GYEA 2YYUA 5CPNA 1LRQA 2A6LA 4JD4A 3W7JA 3F1QA 1LBFA 1W8SA 1I4NA 4AF0B 1BEUA 1DKWA 1TJPA 2IQTA 2VEIA 3MJYA 3S1VA 2ZZ1A 4IPJA 3BLFA 5C55A 1K7EA 3ATYA 1KFEA 3G1YA 4AWTA 3HIJA 4RZ5A 4RXGA 3V75A 3TAOA 3GXTA 3VCRA 1VLWA 2ZA1A 3K30A 1QPQA 4MZ1A 1DQXA 3I65A 4UR8A 3A9IA 4BF9A 4OU1A 4LY8A 3L65A 2ZYFA 4X22A 4QISA 2QCDB 4A2SA 5C5YA 3NQ6A 2GQ9A 4FX8A 1OF8A 4X9SA 3H54A 4ZL1A 1A5BA 4Z08A 3T55A 5LNUA 2R91A 3GLCA 1DHPA 2Z6IA 1EUAA 2OZ0A 3WK3A 3WJZA 4UIOA 5F4WA 4Y6GA 4DQWA 1Q6OA 3S1WA 3MP4A 4ICNA 3HJZA 3FA5A 2EGZA 2DZWA 5BW6A 1FWWA 2ISWA 1KLYA 1NSJA 3W88A 4O1AA 3ABSA 3WFAA 1I45A 5KTLA 5CKSA 1SFLA 3DXIA 4LVDA 1VYPX 3G8RA 3LX9A 3HMJG 1Z42A 2WSQA 2A2IA 3PAJA 3O6YX 1JCMP 4DXVA 2H8ZA 1SQ7A 5HR6A 4IGHA 3BW2A 1KBIA 5K3VA 1O5XA 2ZZ3A 1M7PA 2XN0A 5LSMA 3HG5A 2C16A 4OBTA 3FFSA 1AW5A 3MHFA 5LGZA 2ZZ6A 3ANYA 4M5PA 2X1TA 4RX0A 4UTWC 1KW1A 4JY8A 4I7VA 3GNDA 5I3JA 4PC8A 1NEYA 3U2OA 3EB2A 3M43A 1W3NA 1T99A 1DVJA 1TPH1 4AAJA 2Y85A 5KZEA 4JN6A 2AAMA 4JXCA 1L9WA 4XBSA 1XUZA 4XKYA 1OFRA 3H55A 3PWAA 2C1HA 3CPRA 2VEPA 4IMGA 5AHLA 1XI3A 3TJXA 4LTSA 3TSDA 3LRLA 5AYYA 1SR9A 4HNVA 4BI6A 1IXNA 1P0NA 1C8VA 1ZAJA 4O1BA 2DZTA 1Y0EA 1N8FA 3E12A 3MP5A 4HIBA 3NL3A 4O57A 3TQKA 1UUOA 1ADOA 3QQ1A 4Q32A 2H6RA 1LCOA 2GJNA 4FEZA 3WJSA 4WOQA 4EVZA 3QM3A 2ZZ5A 1H63A 4UTHA 3HPSA 3L68A 2E1DA 2Y7DA 4RZ6A 2AQWA 1RPXA 3RU6A 2BXVA 4DO4A 4NX5A 1TPDA 1WOAA 3N3MA 1JCNA 3I68A 3C4UA 3B05A 3TQ0A 1GG1A 4QQ3A 4RCXA 5E93A 2EKCA 1MEWA 3NQ2A 4L4MA 3M5VA 2Q3OA 1PV8A 1AL7A 3FYPA 1F05A 2QJHA 1FCUA 5D32A 1YADA 2F7FA 3W7RA 4MYAA 3DH7A 1MZHA 1OX4B 2C0AA 3F4WA 3F03K 4ZQMA 3LCHA 3C2VA 4LUJA 3CTLA 3TIMA 3ZR4A 4LRTA 4UTMA 4HNNA 2YYTA 3E49A 4CNNA 5T26A 1EPXA 1GG0A 3FLUA 3G3DA 2QCCA 3LI0A 3HGSA 4K8EA 3NVTA 5K2ZA 2C13A 5HWJA 4IX2A 1YXDA 4TMBA 3L0NA 5AC8A 2CZEA 1FWSA 4LV9A 3L5AA 1K3UA 1KTNA 4X2RA 1SU5A 4UFMA 3T44A 4LVBA 4TMCA 3G1FA 2CLFA 1K8ZA 3S1XA 5IBXA 3OEXA 1T96A 3LCIA 1I2RA 1R30A 3RNDA 1P0KA 3DI1A 1X1OA 3TSBA 3WJWA 2B7OA 1KTBA 1HL2A 3TFCA 4GUFA 3O06A 5DCDA 3M5XA 1F76A 4A29A 5FEPA 1O60A 3G1HA 2X30A 4JDBA 3EX2A 4LVFA 1LYXA 2J9XA 4TO8A 2QJGA 1XC4A 3GNNA 1DL3A 2G95A 4EF8A 4R34A 1IIGA 3W7DA 3BG9A 3A5VA 4M19A 4S2BA 4BFAA 4WOZA 1E51A 1OX6A 2DZPA 3UY7A 4P61A 2PRHA 5D2TA 6TIMA 1H7XA 3NXFA 1L2UA 4LC6A 1TRIA 4NXKA 1R47A 3C61A 5CZ0A 5F2IA 1T0OA 2PRLA 3EWXA 4GBUA 3UQNA 3UWZA 4UR7A 1J4EA 1ONRA 1ME7A 4OHQA 3STEA 5DBTA 5CZTA 1VHCA 3NL2A 4KWVA 3V1PA 4EIVA 1LM1A 4C1LA 3WJYA 1FQ0A 1XBXA 4RKAA 4ZMGA 4AEOA 4N4PA 2Y62A 1H5YA 3D0CA 4PH6A 1QMLA 3B0UX 3A24A 3BW4A 4WZHA 2WNZA 1A5SA 1TO3A 5D37A 4FNRA 5DCEA 1WV2A 1GVFA 3NDOA 4NJKA 2X1RA 4MZ8A 1DORA 2CLIA 3NQAA 2TRSA 3B03A 4OV9A 3MMTA 3ELFA 2Z6JA 4MVAA 3CT7A 3QJAA 3GKFA 1DJNA 3CB8A 5F1VA 5L6UA 1PCKA 3DHFA 4JTFA 3LM7A 4KFPA 4O0KA 4BK9A 2YZRA 2YGYA 4LU0A 4ADSA 1X7FA 4XUGA 2VFFA 2R14A 5I3KA 2GQ8A 4R33A 3UPBA 3TK7A 2OMAA 2ZRZA 4N2YA 1RV8A 3RLUA 2PE4A 4LV4A 1LRNA 2VELA 2NLIA 2NUYA 2Y88A 1IGSA 1K7FA 2RDWA 1UB3A 3P7YA 3TAKA 3W73A 3DENA 3R13A 2ZZ7A 3QF0A 3KRSA 1G4EA 4A2RA 1W5MA 3TX9A 3C2FA 3Q2DA 1YTEA 3TCEA 1LP6A 5BMWA 3EWZA 2ZQ0A 4WY0A 1KM4A 3EX6A 3CWNA 5I3IA 1XCFA 2G5WA 1SUXA 2I9EA 2RFGA 5CZSA 1VJIA 2A6NA 2B4GA 1KM6A 5BMXA 1GOXA 3SR7A 1FWTA 3RLVA 1QPRA 4N6EA 4JTGA 2QCGA 3IGSA 3NNTA 2FPTA 4UMBA 1V5XA 1RR2A 2VEKA 4O54A 4Z0JA 1GPWA 3NL5A 5KMYA 3B0PA 1R46A 2G96A 2I1OA 4XTDA 1A5AA 4H6KA 3TUUA 4RXFA 3DKLA 3IRDA 2ZA3A 2ISVA 5AHEA 2EPHA 2V5BA 5D09A 2W0UA 3HOJA 1B4KA 1IF2A 4JTUA 3BARA 2V0TA 4RK8A 3QEZA 1K8YA 5I3GA 5EBUA 3KFTA 2A7RA 2YW4A 1ME9A 3IGXA 3C2OA 2ZRUA 2YW3A 3CIWA 5G5IA 3CWOX 4E2DA 5CSSA 3MHUA 4I7WA 5A8GA 2V2CA 3DI0A 1AMKA 1PE1A 1VCGA 3O16A 1MSSA 4JTLA 3NM1A 2H3DA 2X1SA 5HWNA 1JUEA 2GPTA 4WUIA 3W3OA 1W54A 2G97A 1SO5A 1GZGA 1S5TA 1WX0A 4YL2A 3STGA 4JTEA 3CM4A 3BGGA 3HG4A 1H7NA 3E9AA 5E0KA 1G6CA 1JVNA 2XN2A 2YPIA 5G2WA 3MUXA 4TX9A 1G69A 1V7YA 1F73A 3LHUA 5D2VA 4Y8FA 1ICSA 3LCXA 3CHVA 3PSVA 3UWWA 3PSWA 1GTEA 2ZFAA 2C15A 3NPWA 1OFQA 3P8IA 4LS2A 3W2LA 3M44A 3DBPA 3LXCA 3PUDA 5CPMA 5AYZA 1QDSA 3BO9A 1EB3A 2ZRVA 4E38A 3IIPA 2Q3RA 2V30A 2E6DA 4O12A 1OX5A 2VFHA 3GB6A 1S5WA 3TV8A 4EOUA 1KV8A 3E0IA 3NM3A 5CPLA 1F6PA 5EY5A 4DEFA 5IM51 3LHWA 3W1PA 3IEBA 4UTTC 3BPWA 4WY0F 5KSWA 2Y6ZA 2NXIA 2VFGA 3DU0A 4UXDA 1FXQA 5HINA 3W7PA 3LV6A 3W85A 3BG5A 3AO0A 1H7PA 3PBWA 3I7SA 4MPQA 5DY3A 1ZAIA 4K7VA 2PRMA 5F4SA 5G1TA 1DBTA 2YX0A 1TIMA 4YCOA 2B7QA 3STFA 5I3HA 4TR9A 3GDMA 4ZZ9A 4HHPA 4JY9A 2ZCGA 3EWBX 1OFPA 1M7OA 4FIRA 4MY9A 4GUGA 4IQLA 2R8WA 3LXAA 3C2EA 3G24A 1QO2A 2ZTJA 1FDJA 4BWLC 5C2XA 3EKZA 1TB3A 3MYOA 1Q3NA 3USBA 4CCDA 1D9EA 2QCLA 3NYZA 4CQAA 1IXOA 2QJIA 3W83A 3TMLA 2ATSA 2VENA 4OWGA 1T8XA 3SJ3A 4GFSA 2VOMA 6ALDA 3TJLA 3GXNA 3OVRA 3VKJA 5D33A 4AWSA 3INPA 3O8AA 4WY0B 5D30A 4ORMA 5EL1A 2QDGA 2JKAA 3TXZA 3KXQA 4BR1A 1K7XA 4NJGA 4QM1A 3MHGA 5EMUA 3FYOA 2ZRXA 1IIHA 1M6JA 3S9YA 5AFDA 3P62A 3W7NA 2J9YA 1FWNA 3CQ0A 1EP2A 1WDWA 2Z2UA 4UFHA 2Q8ZA 2P10A 4LNYA 1TPB1 3HG3A 2RKXA 3UNDA 1RQEA 3RK8A 3GK0A 5D05A 5LNWA 4K38A 3HBLA 5H91A 2E09A 3P5YA 2BWGA 3LERA 4MFEA 1N7KA 2E68A 3W7IA 3FOKA 3C0JA 4AWUA 2H90A 4YWIA 3S5ZA 1BKSA 1GWJA 5D03A 3GR7A 1J5TA 5I3FA 7TIMA 1VS1A 2FLIA 4RLIA 2QCHA 1OFAA 3RFAA 1G4SA 3MYPA 5DCBA 3KVMA 4ZQOA 4KFOA 4JICA 5DBUA 3IGUA 4J9JA 2DJLA 2QAFA 4N4QA 5EKYA 5DLCA 4CCCA 1OVDA 1LROA 1SO6A 3TC7A 4WXZA 2YDAA 1QCWA 3PC0A 1KM1A 3M41A 1TCDA 3VE9A 5HMSA 3SZ8A 1SZEA 4IUOA 1B57A 3ZWSA 1TPC1 1GT8A 2QEZA 1D3GA 5SWUA 2J6XA 3HF3A 4MLRA 1QWGA 3FKRA 2W79A 4UTWA 5FESA 3QSRA 4UTUA 1VZWA 1LOQA 1X1ZA 5F2MA 3G1SA 3TW6A 2A1YA 2BTMA 4LUIA 3EXRA 4DPQA 3ABQA 4O17A 2RH9A 1QO5A 2OCZA 3W86A 1JULA 5AC6A 2GQAA 2GVJA 1W5NA 3QYQA 1FCVA 3SSJA 1SZFA 2E77A 3JS3A 4PEKA 5D2XA 2A7NA 4LS1A 2NUWA 3W72A 3CIXA 3T40A 3W07A 3W1AA 2V5LA 1TREA 3GAYA 5G2IA 2CLOA 3KVKA 4QITA 3DFTA 1EWDA 5KZMA 4CCEA 1ICQA 1O4UA 3FEMA 1VYSX 1LBMA 3G1XA 3QH2A 3S5OA 3EWUA 4O50A 2EAWA 2TSYA 4MYXA 3TU9A 4O53A 4N6FA 1SW0A 1I2PA 1PHQA 2WQPA 4QIUA 1QR7A 3P81A 2HS8A 4UMAA 3LCLA 3L67A 4NT0A 4POCA 4PTNA 1ICPA 2UV8G 3E96A 5K4XA 1GVRA 4O8RA 4ALDA 1LDCA 3WJXA 3GDLA 4JX5A 3PULA 3P8JA 1SW3A 3IVSA 3N34A 2BSLA 1VYRA 2TMDA 4JTKA 5CG7A 1B4EA 3N19B 4AXKA 3NAVA 3G22A 2V82A 4O10A 2E5CA 3T4CA 3S6DA 1Z41A 1TPFA 4UFIA 3GX9A 1A53A 2QDHA 5DELA 3YPIA 4DO6A 3P74A 1NVMA 3C52A 3DFPA 2JGQA 4K37A 5AOUA 4NJIA 2CWNA 3HPXA 4JTSA 3IIXA 3MI3A 2Z1BA 1IXPA 2ABBA 2RDTA 5F1UA 3KRZA 3GDRA 3W1TA 4KFNA 4IX0A 4HKPA 1KTCA 4LS0A 4ORIA 4K36A 1WBJA 3FS2A 3P67A 3THAA 3TA6A 2ZZ4A 5U7SA 4XWUA 1SZGA 1W31A 2ABAA 2QUUA 5DY2A 3W7OA 3HGOA 4IWWA 2JKPA 3BW3A 1PIIA 4M7SA 3PR2A 3EXSA 4GNJA 1JCLA 5CSRA 2Y70A 3P61A 1RD5A 3PB0A 3W75A 1K02A 1DJQA 1RQBA 1AG1O 4XZ9A 4NNCA 5K9XA 3UXAA 3DFNA 1WYIA 4PA8A 2XFWA 4IXXA 4JX6A 5DN1A 1CW2A 5AHFA 3ZWTA 4Y90A 3W87A 3OBKA 5AC7A 2D73A 3HB9A 3G0SA 1X6UA 3QMRA 1TRDA 2WPBA 1W56A 1KM3A 3QC3A 3BLEA 2FDSA 1C9DA 1GVSA 4NU7A 3LI1A 2XN1A 2WKJA 5LHFA 4N9CA 1QAPA 2ZZ2A 2E5BA 3EWWA 4HT3A 1XKYA 4JNMA 2CZFA 4IPIA 3SECA 1VC4A 5ABTA 4N9BA 1WA3A 1RVGA 2LLEA 3NR0A 1JCXA 1Q6LA 1YXYA 3JR2A 1VCFA 3EX3A 3W22A 2BZNA 3GDKA 1LZOA 4AVFA 4NX0A 2VKZG 3DFSA 1XFBA 4NJHA 4OE7A 4QNWA 4NQ1A 4OT7A 3IVTA 4WX2A 4MY1A 4JTJA 5LKYA 2RDUA 4KKXA 1TPEA 4MUZA 1RZMA 1VLIA 1TV5A 4UNLA 1XDLA 3BV4A 2QUTA 1CI1A 1XBYA 1NFBA 3MBDA 1G7UA 2YFOA 4FNPA 1ZAHA 2DZUA 3SFKA 1X8FA 3I7QA 4YCPA 1YDOA 3CEPA 4UMCA 3NO5A 3PF3A 2A4AA 1XBVA 3O6CA 5AHNA 1OHLA 2ZTKA 4XQ6A 4DF1A 4FO4A 3LBCA 1KV5A 1YTDA 4HPXA 1YYAA 5FI8A 3EEGA 4O15A 2JGYA 3CC1A 4MZYA 3FJ6A 1U5JA 4DBDA 4O11A 3HPZA 4O52A 2NWRA 3GKAA 3SW6A 1H7RA 1H60A 1QNVA 4I7UA 3WK2A 3W1QA 1TPUA 2PURA 5LNSA 5F2GA 2NUXA 1SO3A 3ATZA 4UTJA 2WNQA 3N9SA 4M6VA 3UPWA 5D2WA 1A5CA 4DF0A 4GWEA 2EHHA 3ZFHA 4QJ1A 5HULA 1VQTA 1VGAA 1P1XA 3KVJA 3QW3A 1AK5A 1BWLA 3B4UA 3W1RA 1B9BA 1PCWA 5BNKA 1XL9A 3W1MA 3W1LA 1M5WA 1YDNA 1L6YA 3Q37A 1Z48A 3G1AA 3DFQA 2DORA 4JGDA 2FIQA 2BX7A 1OABA 1F7BA 2C18A 1LOLA 4E0CA 1EEPA 1B3OA 3SI9A 5J5DA 3OVPA 3FKKA 1JUKA 4JIPA 1YXCA 4HSNA 4K7YA 4O4WA 3RF9A 3WK0A 3BLIA 1VRDA 4JYEA 2J24A 5EPDA 3L0KA 4CLMA 3HGRA 1L6SA 5J5RA 5TQLA 3G0XA 3R2GA 4PCFA 3CLMA 2A0NA 4TU1A 4CQ8A 1GYLA 4JR5A 3PB2A 2NX9A 2C3ZA 1JQVA 3W1NA 3HQ1A 5EA9A 4A22A 2CLMA 4A3UA 4O18A 2GVGA 5F2LA 3E02A 1NF0A 3W7MA 4H4IA 4OGZA 3EWYA 4Y9AA 2ZDRA 3UD6A 2VC6A 4YMZA 4KWWA 4PL1A 3HGJA 4N02A 4O13A 3NOEA 3W7EA 4JYFA 1QPNA 1MXSA 1TMHA 3FJLA 3A21A 5LZLA 1FY6A 1F5ZA 1QOPA 1W5PA 3F4NA 4WXYA 1P5BA 1JCYA 3PBUA 1JR1A 3S42A 2DP3A 2NX3A 2QF7A 5E1QA 4UTTA 2NXHA 1WBHA 2HS6A 4LOCA 1A50A 2VXNA 4ZQPA 3PBVA 3LHTA 3S1UA 2QKFA 4FX6M 3QFEA 2WV8A 3W7KA 3QMTA 3KX6A 4GE8A 1JRBA 5FF3A 2NWSA 1P4CA 1FDYA 1H50A 3NQGA 1KM0A 5G1YA 4ADTA 3A22A 1GEQA 3OVQA 5D2YA 3P84A 5D04C 4IMEA 3B0VC 1F6KA 3M47A 1XXXA 1ALDA 4RV8A 3W71A 4DPPA 4JIQA 4FHAA 5LHEA 1EA0A 2DZVA 4L4LA 4Z1BA 4BWLA 3EX1A 1FBAA 3PG9A 4UUIA 4WQ6A 4Z0SA 3M16A 1WXJA 1GVQA 2NZLA 5GVJA 4ML9A 4UTKA 4Z1DA 4AHPA 3NPXA 2Y7GA 3NQCA 3GZ3A 2Y63A 4DELA 2CZDA 4S2CA 1ZJIA 2E5DA 1FCQA 5AN7A 3O07A 3NPVA 1XUUA 2Z0IA 2A5HA 1AL8A 3W7GA 1ZENA 2C14A 3L21A 3UWVA 5FF4A 3T7VA 3W2JA 3N73A 5CGQA 4G1KA 4O1DA 2OT1A 5FEZA 3MW7A 1LRTA 5DXXA 2JK2A 5LNVA 4NXSA 2ZBTA 3RMJA 3VFLA 3R12A 4A21A 1GJPA 2WOQA 1XDMA 4FXRA 5HUOA 4QAIA 1PVNA 2YCEA 2A21A 5K4ZA 1YDVA 3PBYA 1FX6A 3MI2A 2GUUA 3NZRA 1LBLA 4RR4A 4EF9A 4ZQCA 4PODA 3NQDA 1FDZA 4JEQA 5LGXA 4O4VA 4NNBA 3IIVA 3GXPA 3L0GA 5AHMA 4O19A 1QPOA 4C1KA 2E6FA 3W9ZA 5F4XA 4WD0A 1K03A 1O95A 3S5YA 1XM3A 4FNUA 4FXSA 4K8HA 4PL2A 1EX5A 8TIMA 5G2HA 1KBJA 3QQ0A 2CLHA 4R53A 3Q58A 1ME8A 1KLZA 1SZNA 4RZ4A 4W9TA 1I2OA 3C2RA 3EXTA 3LTYA 5FEXA 5KZDA 4ONVA 4JTTA 1VPXA 1SPQA 1OFDA 2WO5A 1JJKA 2FTPA 1QOQA 1VR6A 4HPJA 4OV4A 1TQXA 3P5ZA 3ZS4A 2C19A 3VE7A 1W5QA 1UBSA 1TV8A 4FB7A 1NAL1 3B8DA 3TH6A 1MEIA 1CX9A 3TNOA 3LHZA 2V9DA 3C8FA 4LT9A 2YSWA 3TDFA 4X3ZA 5MHBA 3NGJA 3UWQA 4M6PA 4HN4A 2QCEA 2B7PA 3NQFA 4U28A 4IJBA 3GDTA 3SIZA 4GUIA 3STCA 1GTHA 2B0MA 2P0OA 1O5KA 4O0ZA 4MJMA 4AH7A 1TSIA 3TXVA 3N2MA 3KHJA 4IMCA 1H61A 5DXYA 1LLWA 2HSAA 1OFEA 4TIMA 4HSOA 2P1FA 4FX7A 4O14A 5FEWA 1EUNA 2QCNA 4AHQA 3SGZA 1TTPA 4LWWA 3U6WA 3W7CA 3L66A 3W84A 3LCGA 2A85A 3LTSA 3G0UA 3MBFA 1KFLA 2X2GA 2KZHA 3W70A 2X1UA 2YFNA 4NNAA 1LOSA 4UTIA 4Y96A 3UWYA 1TPWA 2NXGA 3O1NA 3EX4A 1WQ5A 3KVLA 3FIGA 2GJLA 3UWUA 4JYDA 3I6RA 1EWEA 3THQA 1MO0A 3C3NA 2HTMA 1WOBA 4IMFA 5FF2A 4XTIA 1SFJA 2YR1A 1FWRA 3TQVA 5KITA 2FFCA 1UJPA 4B5NA 1HO4A 4WJEA 1KFKA 1QFEA 1GYNA 2QCFA 2DZXA 3MP3A 5H2ZA 1ZY9A 1ZNNA 2OT0A 4DBEA 1YTKA 4IXHA 1F2JA 1VH7A 3NQ7A 3M7WA 4S1FA 1WAUA 3PM6A 2WJZA 2FQIA 3M5ZA 4ZQNA 5IBXC 5TBOA 3TE9A 3WK1A 1TTIA 3ABRA 3DKJA 3JRKA 2FPVA 3DGRA 5L9FA 1AW2A 1TQJA 1I8JA 4FNQA 2DZSA 2JKEA 4UCGA 2OX1A 1TTQA 2V8ZA 2NV1A 4FNTA 2V2HA 4ADUA 4YLWA 1W5OA 3DAQA 3M1ZA 3NZ1A 4UFLA 1O94A 1F74A 3C6CA 3IVUA 3LLFA 4N9EA 3QMSA 4YXGA 4UC5A 3TW7A 1YLVA 1W0MA 3LGEA 3NL6A 3PUOA 2O7SA 3CU2A 4FF7A 4GRSA 4LVGA 4NVTA 3PVFA 3M9YA 1TYGA 3ABOA 2Y61A 2CW6A 3LDVA 2DJXA 3PS7A 3TMQA 1I2QA 2CZ5A 3LTPA 2QUVA 3Q94A 1OYBA 4OQVA 1IXQA 2B7NA 2VEMA 2W6RA 3SGUA 1JCJA 1THFD 2F84A 1SSDA 1OF6A 5U4NA 4LC8A 1U83A 5HNRA 3OIXA 2PCQA 4LVAA 4HNUA 4Z1CA 2GVLA 3LOTA 4JX4A 1EP1A 5G4EA 1EIXA 3LCFA 4H3DA 4JS3A 3NEVA 3B04A 3G18A 1W37A 4NZFA 4CNPA 3GAKA 4UTLA 1DOSA 1H1YA 4IOTA 4BI5A 3S8HA 3NPUA 1JUBA 2I14A 2QR6A 3W1UA 3DFOA 3G3MA 2CLKA 2FB2A 5D38A 3BGJA 1FXPA 3SY5A 4AMAA 3IIZA 4QSHA 2EF9A 3IIOA 3QPYA 4XKYB 1G7VA 2ALDA 3C56A 3HG2A 5A5WA 4K6AA 3G1VA 4O16A 1OK4A 3MWAA 1C29A 1GVOA 1SO4A 5HQEA 3LHYA 1FCBA 2H8XA 1KFBA 3NQVA 1G4TA 3N2XA 1MEHA 1H51A 4BI7A 3UXDA 4AHOA 3T78A 1H7WA 4MIMA 3M0ZA 3OG3A 5D02A 1OFBA 4IMDA 3W7QA 1HFBA 4GC4A 1W3IA 1ZFJA 3L5MA 4DO5A 3GR8A 5BRBA 1G67A 1XBZA 2CFFA 3NA8A 5CZJA 2ZA2A 3UZ5A 3TSMA 3KOFA 4NZJA 3W7HA 2J27A 1I2NA 3O15A 1N55A 4MJZA 1S5VA 1KA9F 3G1DA 1W3TA 4DF2A 2OJPA
chains in the Genus database with same CATH superfamily
2WNNA 3CL8A 1UASA 2ISFA 2ZWYA 1S3HA 5CC6A 3UYCA 1PKYA 2X41A 3I7RA 1HKIA 2WMHA 3RPMA 3PPGA 1QW7A 3VA8A 5HJLA 5M03A 4NZ5A 3B40A 4Q33A 5E6YA 4ZQRA 3O63A 1JRCA 1UOZA 5C70A 1EP3A 1PKMA 1UD6A 3R5EA 3CEUA 3NO1A 2MUCA 4I9AA 3SAZA 4U4MA 4GVIA 2O4MA 1UROA 1EQCA 5C6MA 2OX4A 1PTDA 4AB4A 1XQKA 1F07A 3BL3A 1XH0A 2RDXA 3LRKA 4LRSA 4V33A 1SSGA 3E0VA 4I6VA 2FZNA 4M6QA 3O6AA 1Q7QA 4WSHA 1J01A 1NJJA 1LORA 5A2BA 2ZRWA 3PZNA 1PDZA 3CGTA 3VNDA 2PTYA 1OJXA 3EGJA 4MKNA 4RJEA 3WUGA 1BF2A 2UWFA 4IL2A 2Y5EA 1H3GA 2RGMA 1NIUA 5FSEC 3DHDA 3K8KA 1Q45A 2OXNA 5HWMA 3ZR5A 4H6EA 1E9ZB 3WG6A 1PKNA 3QSTA 5TIMA 2GZXA 4W8BA 3DG7A 5D9OA 4PMJA 1LL7A 3A12A 1BTMA 4YIWA 5KINA 3E0LA 3IV8A 4BY3A 2BVYA 2YA0A 4ZO7A 3UR5A 5AHIA 2NQZA 3NG3A 1BSLA 2NX1A 4G7EA 1I0DA 4AWEA 1D3HA 1MRAA 1KQYA 2XDFA 4NJJA 4PFMA 3O3RA 1AW1A 3LD5A 4Q7NA 1R2TA 5FF7A 2GJXB 2Z24A 4RDWA 1OYAA 3QRHA 1OQFA 3EPNA 3M0HA 1LT8A 4EWND 2GOUA 3AJXA 4MB1A 3PWGA 2PS2A 1KFJA 1PAMA 4MLJA 3APGA 1GVEA 5AB3A 1ZCOA 1W9PA 2Y89A 3OO2A 5CC3A 3E0FA 4IH3A 3OU8A 5G4WA 1E0VA 3W76A 5HMDA 3UNTA 5HUPA 2ZE0A 1XLJA 1OX4A 4EAYA 1CXEA 1W1ZA 1LF1A 4BEUA 5C9ZA 3MB9A 1JFXA 1OFOA 4CNTA 3W7LA 2Q6ZA 2V2DA 4JD4A 4ZFCA 5ABHA 3KS6A 1H0IA 1F61A 1LBFA 1W8SA 1I4NA 2BXYA 3ZJKA 4AF0B 4C6DA 3VIPA 3GHRA 2ZZ1A 1QT1A 4JTRA 1KFEA 1P0DA 1YHTA 4L1GA 3U0HA 4IP7A 3IWPA 3MSGA 1QNPA 3VCRA 1VLWA 4E4UA 2QJMA 3K30A 2PWDA 1N82A 3GXFA 4UR8A 3RJXA 1W2VA 3A9IA 1RBOB 1GPFA 5M17A 4Z2GA 1BG9A 5C5YA 2ZUVA 4GXWA 3NQ6A 2BNJA 2GQ9A 2I5IA 4FX8A 1FWGC 4X9SA 1A5BA 3GW3A 4IIBA 5LNUA 1J5SA 3GLCA 2OZ0A 3PZ9A 1I1WA 3CJPA 3M0JA 1UQYA 3S1WA 1XPGA 3WBEA 2EGZA 5BW6A 3W88A 3WD4A 5EB8A 3AXXA 1OEPA 1JYNA 4LVDA 1MXDA 3EA2A 3CUHA 2WSQA 1QNOA 3VYLA 1JCMP 2DIEA 1XRSA 2H8ZA 1SQ7A 1EO5A 4IGHA 1PYFA 4OBTA 3FFSA 3MHFA 3ANYA 1XLKA 4GY1A 1E9IA 1KW1A 3TLLA 4QJ5B 3GNDA 4DLFA 5I3JA 4PC8A 1NEYA 3VZZA 3U2OA 4B92A 1T99A 1DVJA 4JQAA 3BE7A 1PSCA 4UQBA 2AAMA 1XUZA 1WZLA 2Q02A 3OG2A 1OFRA 3H55A 3SCPA 1XLGA 3K13A 1DIEA 5HPOA 3CPRA 2VEPA 4IMGA 3GVQA 1JNEA 4DJFA 1R7AA 4KT2A 5AYYA 1OM0A 1C8VA 1KO0A 1H11A 3M6DA 4A4AA 1Y0EA 3CH0A 1JG9A 1BRLA 4O57A 3TQKA 1UUOA 2VZOA 4NRSA 4EAMA 3QQ1A 1M65A 1OT2A 2H6RA 2FH8A 2IS7A 3WJSA 4WOQA 4ZO8A 3QM3A 4H9YA 1KWKA 1EEXA 2J7GA 3HPSA 3L68A 4HP5A 1ZJHA 2Y7DA 3EKGA 4OOUA 3RU6A 4HPHA 1F3EA 3EMCA 3LMYA 4NX5A 1TPDA 3W00A 3L4UA 2BHUA 4K1WA 4F40A 1B30A 3Q4DA 3DUGA 3W4RA 1B0IA 4B16A 3ZO9A 4TVCA 1YBQA 4C6LA 1OZMA 3NQ2A 5FJRA 2ZX6A 1GK8A 4QEEA 3D6NA 4H8HA 3FYPA 5CJNA 3D3AA 4MYAA 3WD3A 3DH7A 3F03K 3K4DA 3C2VA 1VPYA 3RCMA 4NAFA 4LUJA 1V6WA 3TIMA 4LRTA 3FSUA 1WKFA 4ZB2A 1LUCB 3VZXA 1IZKA 1GG0A 1BF6A 4ES4A 2GDUA 4N7QA 4YHGA 2PU1A 2ON3A 2OR2A 2RUSA 3WD1A 1PTAA 3PPCA 4FLQA 4UZSA 1YXDA 4TMBA 1Q65A 1GQJA 2OOGA 3DHUA 2OWXA 5IBXA 1P0KA 3DI1A 3TSBA 1PJ9A 3TYBA 2BV9A 1RPKA 2P88A 1CCWB 3CBWA 2YLLA 5FEPA 3LGGA 2XJ7A 5T91A 3EX2A 4M0XA 2QPUA 5HMEA 1ADDA 4EF8A 4BHYA 1JCTA 2V5KA 1IIGA 3P0XA 3U5YA 3W7DA 3BG9A 1W3LA 3A5VA 4BFAA 5A6KA 4WOZA 1E51A 2DZPA 1M1BA 3UY7A 1HJXA 6TIMA 3E2VA 3GHTA 5T8GA 3FY1A 1D2KA 1TRIA 4NXKA 2VWSA 3GBEA 4GBUA 1NQ6A 1J4EA 1ONRA 1ME7A 4PCPA 3CNYA 4BQ2A 5CZTA 4WF7A 3V1PA 4C1LA 4RKAA 4ZMGA 2WVVB 4AEOA 3RILA 1Q7ZA 4N4PA 2G4FA 3D0CA 2P3ZA 1DJYA 1RLCL 1J2BA 1OG6A 4X9YA 2VR4A 3U3HA 2J8FA 5FJOA 2WNZA 1TO3A 5DCEA 5DRCA 4Q4QA 3GW0A 2G50A 1P6BA 1UWQA 3I3DA 3IAPA 2TRSA 4OV9A 4E5TA 2V5CA 4V1XA 4MVAA 4DBUA 2VR2A 2QV5A 3GKFA 3CYJA 4A8LA 4LCRA 1XFCA 4H6QA 5E0CA 3FSTA 3DHFA 4BK9A 2YGYA 3PJTA 1X7FA 5IDIA 4AZGA 1N8WA 4QGCA 3N2BA 3WEOA 5I3KA 4WDUA 2GQ8A 3UPBA 3KTSA 4CD8A 2ZRZA 3LY0A 5LIWX 2VELA 1EIBA 2WHJA 2PDUA 4LAZA 2NUYA 2PWUA 1YPXA 4E8GA 1EZ2A 1UB3A 3P7YA 3RCYA 3W73A 1ZPTA 4WDTA 2Z27A 3DENA 4NY2A 4S3GA 2VUYA 3R13A 4D71A 1FWEC 3QC0A 3QF0A 1G4EA 3Q2DA 1O5RA 4AC7C 5BMWA 3EWZA 1V7AA 5I3IA 3ZLFA 3QY8A 3VC6A 3VGDA 3VX0A 2RFGA 3CL7A 4GVGA 3VIFA 1KM6A 1GOXA 4XIAA 3HQPA 3IGSA 2WM1A 3SRFA 4R5EA 3CPGA 1KKRA 3B0PA 4KH2A 1R46A 1VRXA 4AIUA 4J2PA 1CLKA 4XTDA 3T2PA 3H8AA 3AQUA 1PTGA 1VB9A 5FSDC 3IRDA 2ZA3A 1HJSA 2CBJA 4ENLA 2W0UA 1B4KA 6XIMA 1F3WA 1VFLA 2O56A 3EPMA 1WE5A 5ABFA 4HNCA 2V67A 4EPBC 2A7RA 1DIOA 2YW4A 3C2OA 2PTWA 4GOAA 1DIDA 4YNGA 3ITLA 5CSUA 3BGAA 3SN1A 3VKAA 3VDGA 1MSSA 4DWSB 4JTLA 1EPVA 4IIGA 1E1CB 4IM4A 2PI6A 1TVLA 1JUEA 4QBXA 4WUIA 5BROA 3W3OA 1CTNA 1SO5A 1HKWA 1S5TA 1Z32X 1WX0A 4YL2A 1UD2A 3GDBA 3CM4A 5E0KA 1JVNA 4A8IA 2YPIA 5G2WA 4TX9A 5A2CA 2XGBA 5D2VA 1V0NA 4Y8FA 1ICSA 3CZGA 3PSWA 2VCBA 1GTEA 2C15A 1PUDA 3GC4A 3P8IA 4LS2A 3WY1A 3CH9A 2JFEX 3DBPA 5AYZA 1EB3A 2ZRVA 2Q3RA 5GQBA 1OX5A 3ZMRA 3SCNA 3TV8A 4KWOA 5CPLA 4C6EA 5EY5A 2QNEA 1CGUA 2XIQA 4US6A 4ZR8A 5KSWA 4UXDA 4LUTA 1FXQA 1DWIM 3LV6A 3BG5A 3AO0A 3VCCA 4Z17A 1H7PA 3NTYA 4W8AA 3PBWA 5DY3A 4MPQA 1JXJA 1E5NA 1K4GA 1NTHA 2YX0A 1LL6A 4LCQA 2PB1A 4ZZ9A 3AXKA 2ZUTA 3AOFA 2NLYA 1XGZA 2R8WA 3LXAA 3CQJA 1QO2A 4M29A 5C2XA 1C9WA 4ASTA 4L9ZA 1Q6EA 3MYOA 3VOGA 3MV01 3KLLA 1R7OA 2GQ3A 2QCLA 4M1RA 2QJIA 3VKKA 4Y9NA 4XK2A 2BOGX 4OWGA 1K9EA 2GUBA 1Q6DA 1UG6A 2OGJA 4H9UA 3GXNA 3TJLA 5D33A 4AWSA 4PMZA 3VAVA 1KD0A 2UBPC 1H4PA 5D30A 4ORMA 1K9DA 4NHVA 5EL1A 4D6CA 3N2TA 4YU1A 4KWSA 4BR1A 2OZTA 4NJGA 3RLGA 3CYVA 3FYOA 1UR1A 2UY4A 2G3JA 3W7NA 2XIBA 2DIKA 3CQ0A 3TQPA 1IT8A 2OYMA 3GY1A 2OZ8A 1OADA 4L6OA 4NAEB 4UFHA 2Q8ZA 4LNYA 4B5VA 1UR4A 4HU8A 1GQIA 1RQEA 4KW2A 3SUVA 4OKDA 3I6TA 5LNWA 3UG4A 2E09A 3VGHA 4DUVA 2XVLA 1KXHA 2XG9A 4AWUA 2H90A 3S5ZA 1ODUA 4PMXA 2BHYA 4WKAA 1BTCA 1G4SA 3V0SA 4C91A 1G5AA 3GO2A 4BQ3A 1YNYA 2DJLA 4N4QA 5C9XA 4GABA 1P43A 4F2BA 1KM1A 1CB7B 3VE9A 1XKJA 2P50A 1DE6A 2R1NA 4XSLA 1HKJA 3AFBA 4WEVX 3VDCA 3HF3A 3RN6A 1E70M 4PSRA 4K68A 4CEUC 1A5OC 5FESA 3H2OA 3QSRA 5FL1A 1UR8A 1VZWA 4RW3A 3DEQA 3CV6A 2J13A 2ZICA 2Y0FA 4IICA 5A8QA 1HX0A 4XVEA 3TW6A 2A1YA 4LUIA 3EXRA 2BDQA 3OGVA 4O17A 2RH9A 4DNHA 1QO5A 1UWSA 4GXPA 5C8BB 4P7RA 5DMYA 1JD9A 2GVJA 3QYQA 3OLGA 3CHDA 2XVGA 3JS3A 5HQLA 4PEKA 1UYQA 5D2XA 3SCOA 4EKJA 2ZIDA 1J0HA 3W07A 3W1AA 3WLLA 4QITA 1QK0A 2QGHA 5KZMA 4CCEA 1ICQA 4QLLA 2VM8A 3JU2A 4ERGA 1LBMA 4B3KA 1KCXA 3VM7A 3GUWA 1NP0A 4MYXA 4O53A 3PK7A 1SW0A 1DWGM 4S38A 4UMAA 3AYSA 3TYEA 4DI8A 1FVPA 2PD9A 4PTNA 1ICPA 3OZMA 4O8RA 4Y9PA 1LDCA 2EPKX 4WGXA 3WJXA 3GDLA 3PULA 1SW3A 3IVSA 4ZXLA 1VYRA 1TWWA 4FXFA 2VC7A 2TMDA 3ARXA 2V3DA 4JTKA 1LQAA 3N19B 3W01A 2V82A 4KMQA 2E5CA 4MJ4A 3OVGA 4UFIA 1BKHA 3GX9A 1XRVA 4DO6A 2C1GA 3DFPA 4L1WA 4WJXA 2J7DA 4Q4OA 4RPQA 2Z1BA 1IXPA 2ABBA 5F1UA 3KRZA 4CEXC 1W1TA 1JAKA 2D0FA 3R94A 4GH1A 3VCNA 4ORIA 4K36A 2DDXA 4GY7A 4IGNA 2ABAA 1B1YA 3W7OA 4PZVA 4F9DA 1X8CA 3RRXA 2DEPA 4AD3A 3EXSA 1EC7A 5FA5A 3L23A 2INZA 2OB3A 3PTDA 4E3TA 1ODZA 1DJQA 1RQBA 4XZ9A 4NNCA 3PZUA 3IAQA 1WYIA 4PA8A 2XFWA 5DN1A 1XRTA 1NQKA 5AC7A 1GCYA 2FZMA 1W56A 2I7GA 3WLPA 1GVSA 1TZZA 4HMCA 1QAPA 3BZJA 3W53A 1XLCA 1XIMA 2VHLA 2PLJA 1HVQA 2CZFA 4IPIA 3WIJA 1RVGA 1JCXA 3LSBA 3WBYA 3JR2A 4KIEA 2XFRA 4AVFA 4F9JA 3S2LA 4QNWA 1TJ2A 3IVTA 2RJGA 3WLIA 2RDUA 5BXRA 2Z1VA 1TPEA 1J6PA 5HAOA 1VLIA 3BV4A 3SFKA 2J77A 3CEPA 4UMCA 3G77A 4LAMA 3PF3A 1CNVA 3N13A 1HKKA 4JIHA 1XYMA 4FO4A 4F66A 5AY7A 1E4NA 1YYAA 3SCWA 4YS1A 1E15A 4J35A 1ECEA 4O15A 2VDHA 3HPZA 3GKAA 1ZL1A 2Y2WA 5C9WA 2XTKA 1H60A 1QNVA 2HK1A 2YB4A 3W1QA 4DX3A 1C8QA 3ALGA 3WUEA 1CLXA 4F0HA 3EDEA 4K8GA 3BH4A 1T40A 1A5CA 1A0CA 2BOEX 2EHHA 4P7QA 1FWHC 3GIQA 2DGAA 1VGAA 1AK5A 1BWLA 2XIMA 3B4UA 1FH8A 5JMUA 3VNIA 3AUOA 4YYFA 3QGKC 2VD8A 3EZ4A 3BOXA 1Z48A 1Q66A 1WDDA 2DORA 3UJFA 1XIJA 4JGDA 4AZ7A 1XJBA 1F7BA 4QLKA 3RLHA 1AD1A 3IJDA 3SI9A 5J5DA 3AU2A 4JFUA 3GTHA 1CYGA 3KOZA 5GJNA 1C3FA 2OQLA 2J24A 4JQ4A 1YNPA 3NOYA 2VEFA 1OD8A 3S2MA 5J5RA 1SR0A 3G0XA 4PCFA 4TU1A 3CLMA 2A0NA 3RM4A 2VGGA 1GYLA 3PB2A 4D6GA 2XGZA 5A69A 3VMOA 3AHTA 1JZ5A 3VIJA 3E02A 1Y5WA 4CU6A 3SCUA 4CQCA 1UMLA 2OEKA 4H4IA 4Y9AA 1IZJA 2PTXA 1AJ0A 2ZDRA 3W6MA 4PL1A 2WMIB 2WMJA 4RW5A 1MVYA 4DAFA 3W7EA 2QF8A 1QPNA 4FLRA 4ZA0A 2J66A 3A21A 1F5ZA 3DC8A 1XD0A 3TYDA 1X6NA 3KCOA 4AD2A 5EMKA 3L12A 2DT3A 4MG4A 2DP3A 3W26A 2G3MA 2HS6A 2OTDA 5HA7A 4L1XA 1S1RA 4NG3A 3PBVA 1BPLB 3EWCA 3S1UA 2QKFA 4FX6M 3QMTA 5HXMA 3WBWA 2JIWA 4GE8A 3M64A 3URAA 4LBUA 4D6JA 4KEVA 1UW9A 4MJ2A 4MB4A 1P4CA 3H4WA 3USZA 2OSXA 5G1YA 3OVQA 2J4GA 1XXXA 1A5LC 1ALDA 4E4PA 4RV8A 4DPPA 2DZVA 4KCWA 2ZKMX 7XIMA 4L4LA 6ENLA 1E1EA 4E3VA 3BLOA 1ZJBA 4UQEA 5G1MA 3N9KA 4WQ6A 1WXJA 3MKKA 5M1TA 5DMMA 5CAHA 5CBIA 4AHPA 1DXFA 5XIAA 2Y7GA 2Y63A 3VGFA 3KS5A 4S2CA 5AN7A 4L64A 1ZENA 2C14A 5FF4A 3RX3A 2YCLA 2X8RA 1H49A 4G1KA 1QK2A 5A6LA 2W5FA 5FEZA 1LRTA 3ONCA 4U2ZA 2ZUSA 4IP5A 1TMQA 3FJ4A 4WCJA 2JEQA 1VD6A 2J75A 4PTXA 3RIKA 1L6FA 2O0TA 1LQ0A 5K4ZA 1QXLA 3PBYA 1LBLA 4NP7A 4RR4A 2D0HA 4DAIA 4PODA 2GFTA 4O4VA 1U22A 4NNBA 3GXPA 2NQ5A 1VBRA 1EXPA 2ACRA 1UZ1A 3FN9A 4GY0A 1XIBA 3T08A 2CHOA 2X7WA 1FWDC 1GOIA 1B2YA 4K8HA 1EX5A 3EDKA 3QGAC 1FWCC 5B7YA 3NSXA 4MWAE 1M01A 2CLHA 3ZT5A 1QBBA 3CHEA 4ZSUA 3EXTA 1ONEA 3LTYA 3IJLA 4L6HA 4RDZA 3OYZA 2R1MA 3ZOAA 1VPXA 3DECA 3WQDA 3WH8A 3GNOA 2WO5A 4AUBA 4LYQA 1EXBA 5A6BD 5KZ6A 3B8DA 1EJXC 1V6TA 2WPGA 1UQZA 5J04A 7PTDA 1MEIA 4PBEA 2V6AA 4ZEPA 3WQVA 3VUPA 4RDVA 4IL0A 2FTWA 3U57A 2QMKA 4RDYA 1UD3A 3DYOA 3AXIA 5IRPA 1AH0A 4Q22A 4AYGA 4Q7IA 4GUIA 3STCA 3SB0A 4AH7A 4QROA 3W37A 3TXVA 3KWSA 1ISVA 3KHJA 3N2MA 3QKEA 9RUBA 3MZNA 2CHRA 2HSAA 2X7VA 1NFPA 1GVIA 5CC7A 1JNDA 2E0PA 5FAGA 5EGRA 2QCNA 5A6SA 3VD5A 3W7CA 3LTSA 3T1GA 4LB3A 1XHGA 2X1UA 3LM3A 1E0WA 3RGTA 4J28A 2GDVA 4Y96A 1IR1A 2NXGA 1DHKA 2DSUA 2EG8A 2VVSA 3KVLA 5I7GA 1UR3M 4HSHA 2GJLA 1NP2A 2QVHA 3W29A 4DWSD 2P8CA 3VTRA 1WOBA 1K6WA 1SFJA 2YR1A 2FFCA 3ARPA 1HO4A 1IWPA 1QFEA 2DZXA 2EJ1A 1ZNNA 1KFWA 1MDLA 4DBEA 4H7VA 4E2VA 1FP9A 1WAUA 2FQIA 2HWGA 1M7XA 5TBOA 1C90A 2WLZA 3JRKA 2VYOA 1AW2A 2DZSA 5FACA 4ECLA 2BY2A 3DESA 4PMDA 3R43A 2D1ZA 3JZUA 3M1ZA 1F74A 3C6CA 1WP6A 4YXGA 3BSMA 3TW7A 2IKIA 3CU2A 4FF7A 4EACA 1ITXA 3POCA 3ABOA 3OQ8A 2CW6A 1E6ZA 2VR5A 3TMQA 2W9MA 2CZ5A 1TUXA 3LTPA 4OQVA 3CAKA 4KGJA 2B7NA 4UCFA 3KP1A 4MMWA 2PDBA 4J27A 1R38A 3KM8A 3OIXA 2PCQA 4MAZA 4HNUA 2C71A 4GJIA 1EIXA 1ZLPA 1QI0A 4JS3A 3WQPA 3B04A 3G18A 2BVDA 4EWJA 2Z25A 4NZFA 3GAKA 4GMEA 3CAWA 3S8HA 2VRKA 4JIRA 1E56A 1S5MA 1A5NC 4RL3A 3S2JA 3BGJA 2FVKA 2GJXA 4AMAA 5I5RA 4KRUA 2EF9A 3IIOA 3QPYA 3LZ5A 1X7IA 4PCNA 3C56A 3IACA 3HG2A 3SUUA 3WH6A 2YJQA 1C29A 3JUGA 4Q8UA 4NI3A 5GJPA 2F61A 3N2XA 3S3GA 1H51A 3QGVA 1OGGA 4G8TA 3T78A 4HBKA 1A5MC 4J3VA 5HJYA 1ZB5A 1FFRA 3IK4A 1JPMA 4HHHA 1KXTA 5BRBA 1PO9A 1F8MA 1XBZA 5CZJA 3UZ5A 1FTXA 2NW0A 3U4AA 4NZJA 4OVXA 1I2NA 1N55A 2CKRA 3H24A 3NZGA 1V4YA 1KA9F 3G1DA 4JZ5A 1LJYA 4IG2B 3B8TA 1HKMA 2GGIA 4AF0A 1B90A 2RJHA 4RZBA 1KGXA 1YBQB 3VDHA 3IV3A 4UFJA 2NVDA 2OPJA 2PBOA 1WUFA 4YHEA 5FF0A 2VQTA 1UHVA 4C65A 4GXMA 3QPZA 1YPIA 2FZDA 4KS0A 4GH3A 3PBMA 1TTJA 3WD0A 2PWGA 5ABGA 2C6QA 4PRTA 3FXGA 3HZ3A 3T0AA 2XSAA 4NUWA 4NAFB 3O05A 3BK0A 1HG3A 4ZSTA 3O6DA 2GJRA 3TROA 3URQA 3GVGA 1EJSC 1V79A 3W1XA 4DRSA 3V0UA 2SFPA 1V51A 4LW7A 1HUVA 4UQDA 1TV7A 2OKOA 3PWIA 3QFWA 3R8RA 4UNKA 3T07A 3HM7A 2EPLX 4DUXA 4D2JA 2Y7FA 3H4GA 5JQ9A 1RCXB 5C2GA 3OHIA 4NZCA 3U8GA 2OYLA 5LNRA 1VFTA 1WKDA 3WUBA 4E2BA 3RJYA 4R3UA 1VBJA 1W1IE 1C7TA 1HVXA 2QS8A 2CLEA 2DT0A 4Z2LA 3R4IA 1K8XA 2ATMA 3N15A 3KRUA 4KGLA 2E6AA 3ARSA 1XIIA 2E67A 4S3AA 4ZVJA 3A4WA 3VO0A 3S4TA 3OA3A 2E9MA 2J7BA 4D8AA 2TYSA 2QIWA 7CGTA 1VHNA 1Z44A 2ZXAA 2F6UA 4JDYA 2WZIA 4FIQA 4GZ7A 4DZ5A 5DANA 3MA8A 3SCTA 1K4HA 3LBMA 3GFZA 3NCOA 1TPVA 4QNEA 3A64A 4R7WA 2OELA 5HNTA 3TC6A 1H7OA 2Z1SA 3E2RA 5K9CA 1POJA 1ZHAA 2WSRA 1J0IA 3H2AA 1E55A 3M6YA 3N9RA 1UKPA 2DU2A 2H3BA 2PC8A 4QS5A 4KEUA 4HNTA 4I8YA 2PGRA 3BTNA 1OYCA 3P93A 4JTIA 4AVNA 3LRMA 3G8EA 4DI9A 4GUHA 3U2CA 1V03A 3W2NA 4GZJA 1FFQA 3R11A 1OC5A 5D4YA 3AHYA 4PMYA 3LZ3A 4MOZA 3GVWA 2WYSA 5JBFA 1U1UA 4H83A 1I1XA 2VFIA 5JUVA 3S0CA 1NY1A 3N04A 1GQNA 4OUEA 2NV2A 3LXBA 4FXJA 1QI2A 2DY3A 4O28A 3R8GA 1DQWA 1ZBVA 1LUCA 2YYUA 4LAUA 3MJYA 3S1VA 4IPJA 3BLFA 1RA0A 1DJZA 5CAKA 4AWTA 3HIJA 4TX6A 1V02A 5HNUA 3TAOA 1BVNP 1EO7A 3MT1A 2R1PA 1W17A 3BWWA 4C6IA 2XIOA 1XR2A 1XCXA 2I17A 1XYCA 3N6QA 4MZ1A 3I65A 4ATDA 4BF9A 4XD6A 4X2PA 2VD9A 4QISA 4WRHA 4A2SA 3QBUA 5DT7A 1X39A 3HMCA 5XINA 3EA3A 4KCTA 3MANA 1OF8A 2BODX 4ZL1A 2YCKX 4Z08A 1DHPA 4PMVA 1EUAA 3WJZA 1Q6OA 3WMBA 5G4HC 1Q7MA 3WF2A 2WJFA 3HJZA 1S5NA 2Z29A 1FWWA 1KLYA 1NSJA 2E1WA 3URNA 4QDPA 4MNJA 3CV2A 3WFAA 2EG6A 1Z42A 3BUVA 1KQZA 2AMGA 3O6YX 4HGXA 3BW2A 4HHMA 1B3XA 5LSMA 2C16A 4OECA 1AW5A 5GNXA 3WEZA 2J7EA 4PBFA 2PDIA 4UTWC 1Q2RA 4I7VA 1XLMA 1CXHA 4KBXA 4W93A 4C6FA 3EB2A 3M43A 1JFHA 1W3NA 3ITOA 5KZEA 2Y85A 4XSMA 4JN6A 4JXCA 4TV5A 1W3KA 1JAEA 4OFCA 2ACUA 2J8GA 3AHZA 1UWTA 3K5XA 3TJXA 1YX1A 4LUYA 2NQJA 1TA3B 4JCLA 4HNVA 4BI6A 1P0NA 1T8QA 4CN1A 4IT1A 3LPOA 3F5LA 4L61A 1ADOA 4GGBA 4Q32A 4L65A 1FH9A 4Q3MA 1GOOA 1NWTA 4EVZA 4CN4A 2MNRA 1CGVA 3VABA 3OOQA 4RZ6A 2AQWA 4L9YA 3V35A 4DO4A 1BYAA 5A6BA 3TZNA 1OT1A 1JCNA 1TFVA 2P3EA 2WCGA 3I68A 3TQ0A 1GG1A 2EKCA 3QXBA 4L4MA 2Q3OA 3KCLA 2PDQA 3PNUA 4HA4A 1XLIA 1PV8A 4PTVA 3KHDA 1F05A 2YB1A 4HN8A 5A8OA 1YADA 1V3HA 2F7FA 4A6GA 4PMRA 1MZHA 3LCHA 2JE8A 3SRHA 2W4XA 2XM1A 4HA0A 3U7BA 3UR7A 3ZR4A 4KCUA 4UTMA 1IV8A 1DWAM 2PDYA 2VNCA 1V3IA 2YYTA 1E6QM 3E49A 3EOSA 3N12A 5T26A 4UNIA 3FLUA 5E09A 2G3NA 2ZWZA 1PX8A 4AY1A 3AC0A 3LI0A 1I0BA 5K2ZA 4H9VA 1FHDA 3WH7A 4ATLA 3BCJA 3A4AA 3SADA 3SM0A 1OCBA 3L5AA 4A8NA 1K3UA 2J62A 3P0WA 4X61A 4UFMA 1Q5MA 3G1FA 1K8ZA 2WBKA 1MYRA 4C6CA 4D6EA 3OEXA 3LCIA 1I2RA 1X1OA 4TTUA 3CMFA 3WJWA 1NWRA 3R0DA 3ZJ6A 4DWSA 1E1CA 1ELSA 1EC8A 1O60A 3CLWA 1WDSA 5ENLA 2QJGA 1XC4A 3GG7A 3RM8A 3VK5A 2IKGA 2DUZA 2PPGA 5A3HA 4IJRA 3CQIA 2GUYA 3ZLGA 4P61A 4QP0A 3WLMA 4FMVA 5D2TA 1A49A 3VXGA 3M0IA 1ZBWA 1AZ1A 5F2IA 4NZ4A 1T0OA 1T7LA 2PRLA 3VVGA 4HOWA 2Z7GA 3UQNA 3FYYA 4UR7A 1FRBA 1XLDA 4OHQA 1HL8A 5DBTA 3PUGA 4KWVA 2WKLA 5EFDA 1FQ0A 4TVDA 2HVOA 3L4ZA 3CO8A 1H5YA 2O55A 2XSXA 1QMLA 1HJVA 3DX5A 4GQBA 3B0UX 3VOHA 4HNLA 3A24A 3BW4A 5MF5A 4WSJA 3KTCA 5AYBA 2XZ9A 1WV2A 1VEOA 3NDOA 1DORA 3F2BA 2CLIA 1Z69A 3NQAA 1YDYA 4IHCA 3ELFA 4XD3A 8A3HA 3CT7A 1W8GA 2O9OA 1PCKA 1GYMA 1Z8AA 4JTFA 3LM7A 4KFPA 1QW9A 4UQ9A 2Q8XA 2Z28A 4LU0A 3CT2A 1O6IA 2R14A 2E9BA 1TKKA 4HD5A 4N2YA 4DYEA 1RV8A 2HVNA 4PUDA 2DPEA 1XH2A 2PE4A 3VINA 1LRNA 1BGAA 3UGVA 3GH5A 2NLIA 1IGSA 4PR4A 2RDWA 3CK5A 4UB9A 3FA4A 1PX4A 2VO5A 3QPEA 5J8LA 2I56A 3KRSA 2FFIA 4W8LA 1W5MA 1UKOA 3TX9A 3C2FA 5HPCA 1YTEA 1FKWA 4JKKA 3EX6A 3CWNA 3GH4A 5AYIA 1NWSA 1EBGA 3PZOA 1QRQA 2B4GA 5BMXA 4CQBA 3SR7A 1FWTA 2YL5A 4N6EA 1UC4A 1KR0A 1RR2A 2VEKA 4O54A 3MWCA 5KMYA 2XVPA 1ZP3A 1LWIA 4NAEA 1A5AA 5GJMA 2HPMA 1SJBA 4HA1A 1JYVA 2EPHA 2CBVA 4JTUA 4AD4A 2XM2A 5I23A 1K8YA 4DHGA 5I3GA 5EBUA 2YW3A 3CIWA 5G5IA 2BY3A 3CWOX 4QX4A 1JZ4A 3RCNA 3MHUA 1Q8AA 3KBMA 4ZENA 5A8GA 2POZA 4Y9MA 4MSSA 3ARVA 1AMKA 3MUIA 3WLTA 3NM1A 3OW1A 1JF6A 2HE5A 2H3DA 1V6YA 5HWNA 1XH1A 3EWDA 1ZJAA 4I9JA 4DZHA 1XSKA 2FGBA 4C6KA 1ZSXA 4JN8A 5KETA 3QKZA 1TE1A 4M8UA 1G69A 1V7YA 4F0RA 3OP2A 4IGMA 5C7VA 5I07A 3ARQA 3BSGA 3MZ2A 4X0NA 2QDEA 3NPWA 3IJQA 4D8ZA 3FAWA 4QCEA 1WZKA 3M44A 1KKOA 2YA1A 3BO9A 3HQOA 4E38A 3IIPA 2V30A 3A9BA 4DN1A 2PDCA 3OPSA 3OGRA 2PCEA 2JF7A 3E0IA 3NM3A 1KRCC 1VJSA 3LHWA 3IEBA 4UTTC 2DSWA 5BZAA 3BPWA 1EA9C 2EXOA 4KCVA 1POKA 1R9YA 4NL1A 3MY9A 2XWDA 1RVKA 1ZAIA 2PRMA 3BAWA 1DBTA 1TIMA 7ENLA 2B7QA 4BF5A 3STFA 2YDRA 5I3HA 4TR9A 2UZ9A 3GDMA 2WJEA 4CGTA 4HU0A 3PPFA 1E9YB 2IKJA 1HGYA 4GUGA 1MI3A 2NV9A 3BICA 3AXHA 4IQLA 3BAJA 3C2EA 1UWRA 3G24A 4BWLC 3CMGA 3R6IA 2QXWA 5CPSA 4IIEA 1JDAA 3N3TA 2X0SA 3CZLA 1D9EA 4HMEA 4CQAA 4QDWA 4ZO6A 3W83A 4QTGA 4B90A 4GFSA 2VOMA 4ACZB 6ALDA 3R25A 3LU2A 2QQ6A 1HP5A 3VKJA 3N4AA 1VIZA 4WY0B 3EPOA 3CUZA 4ZOAA 2QDGA 2C1IA 3TXZA 3H26A 2G37A 5BXTA 4GQRA 4EXQA 2GGJA 1TZ9A 5DFAA 1IIHA 1M6JA 3S83A 3P62A 1BG4A 2J9YA 2NT1A 1B3VA 4LYRA 6A3HA 1WDWA 4XAFA 1QPKA 1RSCA 1TPB1 3M7SA 3WL1A 4DIAA 4S3JA 1UH4A 3GK0A 5D05A 3LQLA 3HBLA 3IUDA 4IZGA 3WMSA 4JFTA 2Z7KA 2E68A 4YTSA 3H2FA 4YWIA 3GR7A 4XZNX 2CPUA 5I3FA 3OQEA 7TIMA 4JOMA 1IEQA 5DCBA 3KVMA 1CT5A 4AYSA 4L4OA 1WUEA 3H7RA 1LL4A 4BQ4A 3IGUA 4J9JA 3WLNA 3K8LA 3SCRA 4CCCA 1HL9A 3VD7A 4Q8MA 1Z6KA 1LROA 3I3BA 4WXZA 2YDAA 2UY2A 1P7TB 3M41A 4AXNA 4LB4A 5I78A 4GI6A 3GXDA 4IUOA 4AEEA 4V1YA 1K1DA 2QEZA 1I9CB 2J6XA 2R9RA 4XVDA 1XYAA 3DCPA 3PFRA 4RNIA 2R1LA 4JL2A 1X1ZA 3G1SA 4KRTA 1KXVA 4DPQA 1Y5VA 4PE8A 4Q6XA 1QTWA 2OG9A 1KWGA 3WDJA 1R3SA 1E6SM 2HQAA 3W86A 1VF8A 5AC6A 1X38A 1FCVA 3H22A 1R3VA 3W72A 3CIXA 3T40A 1TREA 2CLOA 3MCMA 3DFTA 1EWDA 1WB0A 3FEMA 2W63A 3G1XA 3QH2A 3S5OA 2EAWA 2TSYA 1XRFA 2HDJA 1E0XA 4IMAA 4N6FA 4WDWA 1I2PA 2WQPA 3TTQA 4QIUA 3P81A 2HS8A 4YJ5A 3WMCA 5AECA 3LCLA 4M24A 3CZJA 2VURA 5K4XA 3CUXA 1XG4A 4ALDA 1UKTA 4G1NA 2E9LA 4JX5A 3MUCA 3P8JA 1CGWA 3PZTA 4GIRA 3G22A 4O10A 3AIVA 4QRNA 4C6NA 4YTTA 4B4HA 5LIUX 3YPIA 2VCCA 3G6LA 1NVMA 3C52A 2JGQA 4P7OA 4IFOA 4K37A 2AKMA 4H19A 1RHCA 3CASA 3N25A 3WSUA 3GC2A 1UZDA 1P0BA 3B3DA 1CXKA 1MWOA 1VIWA 5A94A 4HKPA 4G5DA 4LS0A 3MJMA 3THAA 4HHLA 3T8QA 2ZZ4A 1X96A 1SZGA 1EJWC 5DMLA 2FVMA 3OODA 2OZ3A 1BAGA 2QZRA 3BW3A 1V93A 5IOBA 3B9OA 4W84A 1JCLA 5CG0A 2Y70A 3MCNA 3P61A 1V6XA 3SUSA 2ESCA 1RD5A 3W75A 1K02A 3WLHA 4MKVA 2ZUMA 1BXCA 3UXAA 1BWVA 3AALA 2AGTA 2A3EA 5EFFA 1BXNA 2F6KA 4KERA 5AHFA 2BG5A 2D73A 3UZZA 4M6UA 5FCZA 3ITGA 3QMRA 2WMIA 4GNVA 4B5UA 1C9DA 3RRAA 4NU7A 5LHFA 4EANA 3UW6A 2CITA 1E5JA 2WBGA 2VZUA 4F48A 1EHNA 1WA3A 2LLEA 2F9RA 4HPGA 1YEYA 4QHRA 1YXYA 3B0XA 1VCFA 2C79A 3EX3A 3W22A 2BZNA 1CIUA 4FZIA 1Z9AA 1C7SA 3HJEA 2VKZG 2X40A 5CGTA 1XFBA 1OC7A 4NQ1A 4OT7A 4NILA 2FHCA 4N0RA 3QVQA 5LKYA 3EOLA 3TW9A 3BJSA 4PMNA 4L5ZA 1OIMA 1XDLA 4ROQA 3DOPA 1V3KA 1CI1A 4HQVA 1H1NA 2ZX5A 1ZAHA 2CC0A 1X8FA 1XINA 3DBNA 1S39A 1CGYA 3ZSSA 4EX4A 3NO5A 1IT0A 2A4AA 2UY3A 4TTGA 5AHNA 3N17A 2ZTKA 4W87A 4DF1A 1D3CA 1L0PA 1KV5A 2CBUA 1E4MM 4HPXA 1P48A 2QPSA 3EEGA 4F0SA 3CC1A 5A6MA 4MZYA 3FJ6A 4O11A 2NWRA 1H7RA 4I7UA 3WENA 3K46A 1TUFA 1XD1A 2PURA 5LNSA 3GVVA 5F2GA 2EJAA 3VOFA 4LNCA 1BQCA 2PGWA 2GVYA 3ATZA 2WNQA 3M0KA 5D2WA 4DXXA 3FVDA 4G7FA 3ZFHA 1S2UA 5IDZA 3QW3A 5C9UA 3A3WA 3ENLA 3W1RA 1B9BA 3RAOA 4MWAD 3W1MA 3ISIX 3W1LA 1X97A 1OCJA 1DTUA 4E8DA 1S2VA 3F5KA 3UYIA 8XIMA 1SFSA 3R0UA 2C18A 3WQCA 4B2DD 1EEPA 1NOFA 4L4PA 1PXGA 5HDRA 4O4WA 3WK0A 3WCZA 3GZAA 5I79A 4JTQA 4JYEA 4QXIA 3L0KA 1I60A 1JGMA 1MFVA 1WZAA 5TQLA 1W3JA 3EDDA 4GKLA 4CQ8A 1R3QA 1R86A 2NX9A 2XFFA 4XZBA 1JI2A 2BP1A 2YKKA 1GVYA 4A22A 2CLMA 4O18A 2GVGA 5F2LA 4DVOA 1NF0A 3TJ4A 2VX4A 3A6OA 3RR4A 2BVWA 1HXJA 2PODA 1KGUA 4CD4A 2YIHA 2VC6A 4YMZA 1BVZA 3FCPA 4LALA 1VAHA 4N02A 4O13A 1HNYA 3NOEA 4JYFA 4AX6A 1BGGA 2QUNA 1MXSA 1IEIA 5LZLA 1FY6A 1GKQA 3F4NA 4XKMA 1P5BA 2VT0A 1JCYA 3GNRA 3PBUA 3KUMA 3BAYA 2WCAA 3S42A 4XIMA 1XLLA 2YZ5A 4FOUA 4JQ3A 4ZODA 3O0KA 1RUSA 3VNJA 2XSBA 3LHTA 4HCLA 3QFEA 3W7KA 3SIMA 1DWHM 4GGHA 4Q4MA 1EOKA 1FDYA 3VGBA 2GGHA 4I3GA 1V0MA 4ADTA 3A22A 1YNQA 1U2YA 3UPMA 4IMEA 3B0VC 1F6KA 4FHAA 2VVNA 4R9XA 1Q4WA 2DQWA 1FBAA 1LQ2A 4UUIA 1CXIA 1YIXA 2VQUA 1N2VA 4ML9A 4Z1DA 4YN5A 1XYLA 2YXXA 3IJ7A 2O4QA 1FCQA 3QV9A 3O07A 4A3RA 2GSEA 1RAKA 2Z0IA 2A5HA 3UVAA 4CQDA 3AZRA 1QWKA 3L21A 3UWVA 3T7VA 4GX9A 4GX8A 4O1DA 3OA5A 3MW7A 4H41A 2FYMA 2PLMA 5DQPA 3GNPA 2GJPA 2R6OA 2ZBTA 1UWAA 3WNPA 1QBAA 3KRBA 3VFLA 2O9PA 4A21A 1EYEA 1EGMA 2PGFA 1SM9A 3FDKA 1JDDA 4FXRA 1RJPA 1PVNA 4PBGA 1FX6A 3MI2A 3NZRA 4MNKA 4JCMA 4EF9A 1PEZA 3ITXA 3LYEA 3VD3A 1BFNA 3ZSTA 1FDZA 4JEQA 3BQ5A 3IIVA 2OYKA 3L0GA 3UXKA 4S3FA 4O19A 3GUGA 3QZ6A 4C1KA 3MMUA 3W9ZA 5LYRA 4ZXOA 1ZGDA 2G3IA 5E0FA 4PTWA 1XM3A 4FXSA 4PL2A 8TIMA 4CN6A 4B5WA 4JEJA 3ARUA 1T41A 1CXLA 2VC9A 2Y8VA 4GBDA 1OFDA 1HN1A 3AIQA 5I03A 2ZC8A 4DWDA 4HPJA 1VR6A 3H6OA 1MQRA 2PDGA 4H9ZA 4ILSA 4C6QA 3WQEA 2V9DA 2WAGA 1A80A 4O1FA 3WQ8A 3WNOA 3WZ0E 3K1GA 3KCJA 4HN4A 3MV11 2QCEA 4KIRA 2D3LA 1WKYA 3GDTA 2CERA 3SIZA 2X42A 2WZHA 3OJGA 5JIWA 3GTNA 4GYPC 1FWFC 4C6MA 1W32A 4IMCA 1H61A 1MNZA 2OSYA 1OFEA 3II1A 4IPNB 2PZNA 2P1FA 4C5ZA 1JGIA 4O14A 4I6KA 1PYMA 3SGZA 1TTPA 4LWWA 1VFHA 1J8VA 2WMFA 4GVFA 3L66A 3W84A 2A85A 3ARYA 4RUBA 4IG2A 3MBFA 1PIFA 1SJDA 2HNHA 5AKQA 4HZ8A 4AW7A 4QSFA 2YFNA 4NNAA 5JVLA 2J6VA 2A3HA 4UTIA 1LG1A 4H9TA 3UWYA 1TPWA 3O1NA 5FD0A 5CXPA 4J5NA 2E25A 1WQ5A 3BMVA 3KZSA 4MTVA 4HA3A 4JYDA 3I6RA 3THQA 1RK6A 2REQB 3C3NA 1QU4A 4J7RA 2HTMA 1TR1A 2BBFA 3EDJA 4XTIA 3TQVA 2FHFA 4WJEA 1KFKA 1SZRA 2QCFA 3KBJA 1KBBA 3MP3A 4I8DA 2OT0A 1GORA 1U33A 1YTKA 4IXHA 4YTUA 4S3EA 1F2JA 3NQ7A 4X60A 1CWYA 1EJRC 2WJZA 3M5ZA 4ZQNA 3ECQA 1JD7A 1FHVA 4H2HA 1E0TA 4XX6A 3ZM8A 4B91A 2Y4SA 1P6WA 4KPLA 1TV2A 2JKEA 2A3CA 1V0LA 2OX1A 4UCGA 1JZ6A 1TTQA 1UWIA 5LA0A 4I90A 2NV1A 4FNTA 4CD5A 1A3XA 5M2FX 2XFYA 2V2HA 4ADUA 3NZ1A 5I77A 3C0LA 3IVUA 3VKDA 4M51A 3WELA 5A95A 4GRSA 4LVGA 4AZ5A 3M9YA 4IIDA 5CQ1A 1W6TA 2GK1B 3HPFA 3N6JA 3PS7A 4XO6A 1UD4A 1M04A 1AMYA 3PTKA 3TYUA 5CSYA 3UA3A 4REQB 3CO4A 1Q13A 3I6EA 4LC8A 5HNRA 4H8UA 4Z1CA 3ES8A 2IPGA 5G4EA 4QE5A 4UQCA 1J0YA 2J25A 3NEVA 4QJ4B 3ANVA 3SJNA 1W37A 2FJUB 4UTLA 1H1YA 3B8WA 4BI5A 3JW7A 3NPUA 3S1GA 2G4JA 2HEJA 4HK5A 3WDIA 4TQTA 1TIWA 3G3MA 2XH0A 2CLKA 5CZKA 1R0MA 4P7NA 3IIZA 1C91A 1AZ2A 1QASA 1RBLA 1PBGA 1G7VA 2ALDA 5A5WA 3N2OA 3FGCA 1XIDA 4GZIA 2E7FA 4M82A 4GZEA 3SFWA 3UXDA 4AHOA 3GFYA 4QG8A 3M0ZA 3OG3A 3W7QA 3U9IA 4GC4A 1ITQA 3S6OA 1W3IA 1ZFJA 3L5MA 1EX1A 4B5SA 3NA8A 4GK8A 1KGWA 2V69A 2OFJA 4OBRA 5JXQA 2J27A 2E8ZA 1VP5A 3O15A 4MJZA 3R0KA 1XGEA 1K70A 4PEEA 4XZMX 4EXBA 3HQNA 3DFYA 4FK9A 4DF2A 4GFIA 1EF3A 2TPSA 4AIOA 4KEZA 4GO8A 4AY8A 3BG3A 4DJED 2BASA 2OO0A 4JFWA 1XLFA 4HZ6A 3BOLA 2V5JA 2BVTA 3W28A 1NF7A 2PEVA 2W66A 1ENUA 4WJ8A 1OINA 3N14A 3V4BA 3BV7A 3SN0A 3TR2A 2ONEA 2O9RA 2ASHA 2FVLA 2KX9A 2QCMA 2HRWA 2P76A 2J88A 4NZ3A 3KOYA 3UZJA 3LCWA 1G4PA 3GIYA 3MO7A 2X16A 4JTHA 4KEMA 3L2IA 4HNOA 2VX7A 2VTFA 3FEQA 3VOCA 3NURA 3G1RA 3GNXA 1FHLA 3AS3A 4K39A 2XH2A 5EYWA 2OO6A 2VMFA 1JEZA 1KBKA 3A5FA 3EOEA 4W89A 3W23A 5H8UA 1YPFA 1FA2A 3CAVA 1R2SA 3EA1A 2BLEA 3XISA 3W2KA 2PC4A 5K9DA 1VBUA 4GINA 1TWZA 4CQ9A 4MFDA 4GPNA 3TLQA 4N9DA 3MUZ1 2WC7A 3NQ8A 1PHWA 3S2CA 3S5NA 5FJUA 1OSEA 3TKFA 1MW0A 1EGVA 4PRWA 3QZEA 5PTDA 4FS9A 3TTSA 3W2UA 2PBGA 2EEXA 1L6WA 1ML1A 4M7TA 3GQYA 3H2MA 2VFEA 3M5YA 4B2DA 1OK6A 4UFKA 2NQ9A 2VDIA 1VKFA 1VJZA 4AFYA 4E8CA 2BGSA 5H8MA 4P7LA 5K7JA 4XBKA 1J0ZA 5C54A 1M53A 1QNRA 4F0KA 1TA3A 2J9ZA 1Q6QA 3LLDA 5CEWA 5M3WA 3OLIA 1LTDA 2Y7EA 3NQMA 4XO7A 3L9CA 4P2VA 3WLOA 5HATA 1R3YA 3VD4A 1BWKA 3L2LA 2E6YA 4FF5A 4AEFA 4JFSA 5T9BG 3ZVIA 3UJEA 2IKHA 3DYPA 2DW6A 4UQAA 1OWQA 3QY6A 3VI2A 4GYJA 3LB0A 3F5JA 3BXWA 3B06A 3TJIA 1XIFA 1A4LA 4ROPA 5EU9A 1VEPA 3RX2A 4XD5A 3CTTA 1G0CA 3RR1A 1XPYA 1US2A 5C9RA 2Q8LA 4PUKA 4Z42C 1J6OA 4HMNA 3T6CA 1EJTC 2A7PA 4JL1A 4B9YA 1OG0A 1PL9A 1Q6RA 1IEWA 3EKLA 1UCWA 5TF0A 4B4FA 1PWMA 1R2RA 1CPUA 4FNSA 1E4LA 2WC3A 3KTXA 1X1NA 1S3TC 2DFAA 4GUJA 3KAOA 4ZB5A 3QW4B 1J2WA 3WNLA 1LRQA 2A6LA 3W7JA 4QEHA 3QR0A 1TJPA 1DKWA 2IQTA 4K2SA 3LBOA 5E70A 2PP1A 3G1YA 1RP8A 4H1ZA 4PB4A 4RZ5A 4RXGA 1PZ2A 4R85A 3GXTA 4CCZA 1VFOA 3NYDA 4LAOA 4GI8A 4C7FA 4OU1A 4M1BA 4LY8A 4MB3A 3L65A 1C8YA 4CD7A 2QCDB 1E4IA 2FMOA 2ZADA 3H54A 2R91A 4JTCA 2Z6IA 3WK3A 1W1VA 4GQGA 4UIOA 3T0TA 1LWJA 3ITCA 1YRRA 3VDBA 4GCXA 2I57A 3ICJA 4Q8WA 1JZ2A 4FR6A 1JYWA 2XPKA 4DJFD 1JZ8A 1S46A 4O1AA 3ABSA 5KTLA 1I45A 5CKSA 3DXIA 3Q67A 1VYPX 3G8RA 4CD6A 3LX9A 4DY1A 2A2IA 4W86A 4DXVA 5HR6A 2CHNA 1KBIA 1NDZA 5K3VA 2Y8KA 1M7PA 3HG5A 3LENA 1ISXA 2DV0A 4HU4A 1R87A 5LGZA 2ZZ6A 3MTWA 4M5PA 4RX0A 4U5KA 3KBSA 3CMJA 3N1AA 4PMUA 1TPH1 4AAJA 2DZAA 1OCNA 1L9WA 1Q6FA 3ZJ7A 4XKYA 3UERA 3PWAA 3AMLA 5MKGB 2C1HA 3EEZA 3NDYA 2WW5A 5AHLA 4J40A 2Y24A 2VZSA 4LTSA 4WKHA 3WDRA 1VENA 1SR9A 2WKGA 4Q7BA 1IXNA 4S3BA 1ZAJA 4UOZA 4MAVA 2P0IA 4U3AA 1H09A 2VOTA 3E12A 3MP5A 4QG9A 4HIBA 4NI8A 2DQXA 1LCOA 3PFMA 3UG8A 3WQWA 1H63A 1O12A 5FIPA 3HV9A 2E1DA 3BCFA 2PDHA 4CU8A 1WOAA 4YYCA 3T2OA 5B7ZA 5CPTA 4WK9A 2PDNA 4C6OA 3C4UA 4JIEA 3TZFA 4FLOA 3H7VA 3PZMA 4MDOA 4PUUA 1MEWA 1EL3A 4XG1A 4A3YA 1AL7A 4GVHA 1O1ZA 3L4XA 1MZRA 1TV3A 3TN3A 1UP0A 5D32A 3W7RA 2PDJA 1TJ0A 2C0AA 3F4WA 1PDYA 3NXLA 4W4QA 4JKLA 2D69A 2HISA 2Z1XA 1VEMA 4QFUA 1IGWA 2A79A 1EPXA 4YTQA 3M0YA 2XIJA 5CC5A 3DGBA 3G3DA 2EBNA 6PTDA 2QCCA 3HGSA 4K8EA 3NVTA 4TVUA 1NU5A 2C13A 3AHVA 1OC6A 2OWCA 4S3CA 3A47A 1V02E 4IX2A 4GHRA 5AC8A 2CZEA 3UZXA 2QVNA 3T44A 2PMQA 4LVBA 4TMCA 2CLFA 5H6HA 1D7FA 3RNDA 1R30A 4R27A 2OQYA 1HL2A 3AISA 4GUFA 4Q4RA 5DCDA 4IQEA 3VPLA 1F76A 3TCSA 1E73M 3CV1A 3G1HA 1KCKA 4WVXA 4LVFA 1LYXA 4TO8A 4AQLA 1J0KA 5BU6A 1QI5A 2G0WA 3GNNA 2VEGA 1DL3A 1TX2A 2G95A 2Z26A 4YTRA 4P8WA 4S2BA 4DLMA 1JI1A 1RD6A 2PRHA 2YCJA 5IFTA 1H7XA 3NXFA 1L2UA 5AC5A 1GZ1A 2WHLA 2XH4A 3HFTA 1PZ3A 1R47A 1XW8A 3TA9A 4HB7A 3TOYA 1RY0A 4FOJA 2VRQA 1ZP4A 1XDJA 4DZIA 3AWNA 3STEA 2GDQA 1LM1A 4HCHA 2Y62A 3BQ6A 4A05A 2YL8A 4PUNA 1US3A 4OIFA 2E8YA 4WZHA 2CXGA 4FNRA 3RPTA 3IJIA 4NJKA 2X1RA 3HFYA 2GWGA 2HK0A 3S46A 1F8IA 2Z6JA 4CU7A 3C0SA 1TCMA 2PDXA 3CB8A 5F1VA 5L6UA 4OBSA 4IGSA 4O0KA 3FDGA 4ZOEA 5FJTA 2BMBA 2Q09A 3B8SA 2C0HA 4R33A 1GEHA 2OMAA 3AMDA 1DXEA 3D47A 1H41A 4HTBA 4JAWA 2FGLA 2D24A 3WBXA 3WLKX 3BLLA 4ACZA 4I9MA 7REQB 1GONA 2OSWA 1S38A 2ZQ0A 4TXEA 4WY0A 3NSMA 1XCFA 3AMKA 2G5WA 2I9EA 1VJIA 4LJ3A 2A6NA 2VGIA 2FHBA 4YVVA 1FWJC 4LYPA 3RLVA 3LPFA 1QPRA 2Z1WA 4JTGA 1DQUA 2FPTA 3TNBA 4UMBA 2R24A 4Z0JA 1BYDA 4PCTA 1GPWA 1KCZA 2POTA 3CHFA 2G96A 4TX8A 4WR3A 2I1OA 5BOEA 2ACSA 1FHUA 3PN8A 3B9DA 5I09A 3FVMA 3TUUA 4ZOBA 1P0EA 3DKLA 2ISVA 5D09A 1Y5XA 4W7VA 4H8VA 3OIHA 3T81A 3BARA 3CAQA 1TELA 3Q45A 5CGMA 1NARA 2PWVA 4ZE5A 2H9AB 3UCDA 4DJEA 2F2KA 3SUWA 1EH9A 3KFTA 4AZCB 4V15A 3WH5A 4E2DA 5LXEA 5CSSA 3R7MA 3BMWA 4IPPA 1PE1A 1VCGA 3O16A 3QLDA 2X0YA 1UKQA 1PIGA 5REQB 1P7TA 1O1HA 2GPTA 1W54A 2G97A 1HQTA 2QJJA 4MWAC 4LUSB 3HG4A 2GSJA 2XISA 1G6CA 5ABEA 2HZGA 1B3WA 2YLAA 3VKCA 3AYVA 1F73A 4WKFA 3UG5A 4GNKB 5FJPA 5HANA 3SRDA 3BSHA 3UWWA 3V3WA 1OFQA 3W2LA 5I6SA 1M3UA 1J12A 1OB0A 2ICSA 3LXCA 5CPMA 1QDSA 1IR2A 1MXGA 3PHAA 2Y1HA 3VNLA 4O12A 3BCDA 4NYUA 3VX1A 2VFHA 1B3ZA 1S5WA 1WDQA 4LFYA 1KV8A 5IM51 1DJIA 1U5HA 3AU6A 4WY0F 1C8XA 2DSVA 1XYFA 2NXIA 4J2MA 4DYKA 3BAIA 1L8PA 5HINA 3W85A 4WSKA 4M80A 3VNYA 3GU1A 4YCOA 3ANUA 4JY9A 1XLBA 4E4FA 4UZUA 4RV3A 1OFPA 3KBNA 4FIRA 4MY9A 3TYCA 1ITCA 4ACYA 2HVMA 1SVDA 1FDJA 1MDRA 3PTMA 4JHZA 1MRQA 3EKZA 1TB3A 3U4FA 1XG3A 3SURA 1HF6A 5DEZA 1HJQA 3T8LA 4CCDA 3WQ5A 2W67A 1IXOA 4J3UA 3MKVA 3TMLA 2ATSA 4F79A 3SJ3A 1SFTA 2J74A 4NIRA 3L4VA 1W1PA 1XP3A 4MKSA 4W7UA 4QQUA 3KE0A 3ORWA 3WNNA 3QTPA 5D9NA 1G01A 1RY8A 5ECUA 1HZYA 4GC3A 5EMUA 1EBHA 3EOUA 3IJ6A 5AFDA 2GWNA 1E6RA 1EQPA 1ISZA 3C86A 3W82A 1FWNA 1EP2A 2ZXBA 3ME3A 4NZ1A 4C1NB 2QHAA 1E71M 4B15A 2P10A 3WQ6A 3HG3A 4HMDA 1EYWA 1A5KC 3UNDA 3V18A 3ABZA 5CJMA 3TTOA 1GOMA 2YBTA 3SQLA 2BWGA 1N7KA 3W7IA 2FZ8A 4V2XA 3C0JA 1BKSA 3LUTA 1GWJA 5D03A 3TN5A 2CYGA 2FLIA 4QE4A 3RFAA 3A4XA 2ZVRA 3MYPA 3CWHA 5DBUA 5EKYA 1OVDA