1H7NA

Schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with laevulinic acid at 1.6 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
340
structure length
340
Chain Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dehydratase
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
publication title The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Substrate and Three Inhibitors
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 124
structure length 340
sequence length 340
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1h7nA00
3TA6A 4LVBA 4OU1A 2OCZA 3S5ZA 5K9CA 1Q6QA 3GDRA 3HB9A 4DF1A 5C5YA 3LDVA 3TSMA 4IXXA 2GPTA 4UTWA 2J6XA 1UUMA 3BLEA 4UFMA 4FEZA 2X1SA 3TK7A 2GQAA 1TMHA 1FXQA 1T96A 3HMJG 2Z6IA 2E6FA 4WXZA 2JKPA 3TCEA 1SZEA 3IIPA 2NWSA 4FNQA 2E6YA 2VXNA 1A5CA 1NAL1 1ZCOA 1OYAA 2HMCA 2YFOA 1FX6A 4OT7A 2C1HA 3M41A 1VQTA 1G69A 4TMBA 1W0MA 3HGSA 4XBSA 3HGJA 3LCIA 4JTTA 3DH7A 3W07A 2OX1A 4LRTA 4FIRA 1H60A 4OV9A 4FF7A 4EOUA 3T7VA 5EPDA 4M7TA 3G1AA 1Z42A 3O6CA 4POCA 3QW4B 4RV8A 4QITA 1I4NA 3NM1A 3W7CA 5AN7A 1C9DA 1O4UA 3Q58A 3NQ6A 3W70A 3UWQA 3W2MA 3CIXA 4EIVA 4UFLA 2EF9A 5EBUA 1KFBA 4A22A 2CLFA 4Z1AA 1PCWA 3NAVA 4JYFA 3OVRA 4MJZA 3I68A 2Y61A 5E0KA 2VOMA 2VFGA 2G5WA 3DKJA 2CLHA 4KWWA 3TR2A 5FI8A 1GYLA 3IGSA 1OK4A 4MVAA 2BLEA 1B57A 4IMFA 1H61A 6ALDA 4O53A 4PL2A 4XUGA 4BK9A 3G1FA 1KBIA 1NF0A 5K9DA 5I3GA 3PG8A 3KAOA 3SGZA 2A85A 3NXFA 1K8ZA 1H62A 2BX7A 2E77A 2V8ZA 1OK6A 3K30A 1C29A 1K8YA 2FB2A 4LU0A 2F7FA 3W7PA 1GTEA 3P7YA 3B04A 1RR2A 2ZZ2A 1GTHA 1K7EA 3PSVA 3LHWA 2P10A 3UY8A 4X2RA 4CCCA 2R14A 2QDGA 3INPA 4OQVA 1TSIA 4UR8A 4O12A 1DBTA 3GAKA 3OHIA 4S2BA 4ZQRA 4N6FA 5I3HA 1KV5A 4HIBA 1LP6A 2YFNA 4JN6A 5D37A 4WZHA 3TUUA 3R89A 3E02A 4N4QA 1RV8A 1W3NA 1TJRA 3F4NA 3BG9A 3P60A 3GDTA 4PFMA 5HWNA 1KBJA 1FWSA 1KM3A 4M6QA 3P8IA 4N4PA 4O15A 1FBAA 3P5YA 1ML1A 3W7DA 5C55A 1H7WA 3MWAA 4DXVA 1PV8A 3NPVA 5KZDA 1R30A 3HPSA 4WY0F 3PB2A 3GR8A 4GC4A 3QFEA 2VKZG 4JTLA 3LXAA 5AC7A 4TR9A 3C2OA 3EX6A 2NXHA 4AHQA 1HO4A 3O05A 2CZFA 2HSAA 1SFJA 2EGZA 4YXGA 1LYXA 3FJ6A 2ZRXA 1QO2A 3N73A 2NX1A 3PC0A 3LX9A 1YYAA 3LXBA 3I65A 4NXKA 3UQNA 4WOQA 1OFBA 3W1UA 2V2DA 2XN2A 3STEA 1KA9F 2A0NA 4FB7A 2A7RA 1O5KA 1ICQA 1P5BA 1VYSX 5G2WA 4K8HA 4KFOA 4LNYA 3GDLA 5FEPA 3ABOA 2DU2A 2ABBA 2OZ0A 2R94A 5EMUA 3WJWA 4JIPA 4IUOA 5D09A 3TFCA 2RDWA 4N02A 1ZY9A 1SW0A 2GVGA 1XBZA 1XBVA 3WK3A 3FKKA 4ICNA 2NWRA 4OHQA 3SW6A 2X1RA 3O1NA 1I8JA 1WDWA 4DQWA 1YXDA 3HGOA 3NQ7A 2Y85A 4M6PA 4NJKA 4CCEA 1RQBA 3SY5A 3TNOA 2GQ9A 1KM6A 1JJKA 4M5PA 1EUNA 2ZRYA 1KM2A 2Y7GA 5K4ZA 5AHNA 1LLWA 2B7NA 5HINA 1JUEA 4FNPA 4JTJA 3MO7A 3PUEA 1TRIA 1S5WA 1SFLA 1GVOA 1W5OA 4LVAA 4UFJA 1DQXA 2FPTA 2ZRVA 3LHTA 2ZA3A 1JR1A 1MEWA 3USBA 5FF2A 1FWTA 3PBUA 1Q45A 3OVPA 3PUOA 3E0IA 2ZDRA 5BOOA 5LHFA 2F84A 1UASA 1VRDA 5LGZA 5HR6A 1JCJA 3LCWA 4QNWA 2Y89A 5IBXA 2X30A 3JR2A 4O54A 2YX0A 2A6LA 5DY3A 2ZQ0A 3G1HA 3NZ1A 3PUDA 1TV8A 1OFDA 3GXTA 4O57A 3HGRA 3L68A 3O6YX 2Y88A 3CEPA 2CLIA 3A22A 3TX9A 3Q2DA 3A21A 1D3HA 4JTIA 1LBMA 4PH6A 2YYTA 1EIXA 4UTLA 3W1NA 5F4WA 1YPIA 1LORA 1VCFA 5CZ0A 3GXNA 3TIMA 3P80A 4OV4A 3MI3A 1FUYA 1SSDA 2JGQA 1J5TA 4S2CA 4O13A 4UTWC 4A21A 1VYRA 3FA5A 3WJSA 3BW2A 3VE7A 3MP3A 4YMZA 2JBMA 4M6VA 3OG3A 5CZJA 4O10A 2FPVA 1VCGA 5K9XA 4J9JA 5D2YA 3PBWA 4AWUA 1B9BA 3W1PA 4QIUA 2GJNA 4OBTA 5U4NA 2EKCA 3RLUA 2O7QA 3MP4A 2DZVA 2C6QA 4RKAA 3UWVA 3WFAA 3IGXA 3W2LA 2CLMA 3QEZA 4LVDA 1LDCA 1XL9A 3VI2A 3TW7A 1AW1A 1RQEA 3W74A 1XKYA 3W7QA 2EHHA 4XBKA 2AQWA 4P61A 4AWSA 2PC4A 1EWDA 3MJYA 1TPDA 3LTPA 1LRQA 4LS0A 2Y62A 5U7SA 1MSSA 4AAJA 4E2BA 4JDBA 2Y70A 1SO6A 5F2IA 1T99A 1P0NA 3NQGA 3TSDA 3LGEA 4Y90A 1TPH1 5G4EA 3EXSA 1SZGA 1MO0A 1JCLA 3SJ3A 1M6JA 5TIMA 1WOBA 3LHVA 2J88A 4QNEA 1FDZA 4GUIA 3NA8A 4IOTA 1R2SA 3WJXA 3FOKA 2E5CA 2VELA 1OJXA 3LLDA 4WOZA 3C61A 1QPNA 3RLVA 2YSWA 3W9ZA 4R33A 2PCQA 1ME7A 2ZZ3A 1GVRA 3G1YA 3M44A 5BNKA 1O60A 4YLWA 4CQAA 1M5WA 4DO6A 5G1TA 5F2MA 3DHDA 1X7FA 1ZJIA 4AXKA 1N7KA 4MJMA 4N2YA 2E6DA 1G6CA 4RK8A 2DZSA 3SGUA 4JICA 1IXOA 4KWVA 2BZNA 3W2KA 4CQ8A 3H55A 4OE7A 5D2VA 3M7WA 3FKRA 4GE8A 2YW3A 1LBFA 3N9RA 4NNAA 1GT8A 1W5QA 1GPWA 3G3DA 1SO5A 3QJAA 5D38A 1F76A 5F2GA 2C18A 2WNQA 4DBEA 4YWIA 4UFKA 4JY9A 4UTHA 3DAQA 3PB0A 5HR7A 3KOFA 3TQVA 3EX4A 2A21A 2B4GA 1F5ZA 1WQ5A 3W85A 1A50A 4FNSA 3P82A 4UMCA 1IGSA 2GVLA 4CQ9A 5LNWA 2UV8G 5LNVA 3B06A 1BEUA 3NQEA 4IX0A 3TMLA 4I7VA 3FIGA 2A2IA 3NQ2A 4H4IA 2Y7FA 5FF4A 4UNKA 4A3UA 1NF7A 3TFXA 1OFRA 2HTMA 3GX9A 4HNVA 5C54A 3TH6A 3SIZA 3S1VA 1O95A 1W5NA 3O06A 2XFWA 4IX2A 1YTDA 4Z1DA 5D32A 1KFJA 3W1TA 3SZ8A 3GK0A 2OJPA 1KLYA 1L6SA 1R2TA 3AJXA 4KFPA 1AK5A 2VC6A 2NXGA 1IXQA 1JRCA 3KFTA 3UWYA 4HPXA 3W6YA 4L4LA 5BMXA 4NZFA 2A5HA 3M16A 1UBSA 3DZ1A 1Z48A 2PRMA 4MFDA 5FF0A 1WAUA 5D02A 1DJQA 4FX7A 3U8GA 4Y8FA 3DFOA 4O1CA 3DENA 1JUBA 1TPB1 4O1AA 5EL1A 4O16A 5FESA 1TQXA 4Y6GA 3EX3A 1KTNA 1SZFA 2JKAA 5D30A 3EEGA 4E38A 1A5SA 4YL2A 4TU1A 4BR1A 1W37A 2I9EA 5F4SA 1JVNA 4GWEA 2Y6ZA 2E1DA 2G96A 1D9EA 3HO8A 4P2VA 3EWWA 1ME8A 4RCXA 5I3JA 1ZENA 2GUUA 3C0JA 1I2NA 3PWAA 1SQ7A 1Y0EA 3TDFA 2VFHA 4K6AA 3NEVA 3HF3A 3W3OA 2ZA1A 1DORA 4IPIA 3L65A 3W2JA 4B5NA 3ANYA 2BSLA 3LCGA 3CWOX 3L66A 1IF2A 4JTEA 3PBVA 2JK2A 2FIQA 4O1BA 1A5AA 4JTGA 5EA9A 1TPC1 4RX0A 3HBLA 1I2OA 4UTTA 1TPFA 5K3VA 2QCDA 5D2TA 2YGYA 1LCOA 3N14A 1J4EA 5AHEA 3NDOA 3LCHA 3S6DA 2CU0A 3BV4A 4JNMA 4N9DA 1QPRA 1LTDA 2C19A 2I1OA 1SPQA 3ATZA 3UPWA 1YTKA 4O50A 4Q32A 1FY6A 3BGJA 4ML9A 1W31A 1W8SA 4HT3A 4HSOA 1XI3A 3EWBX 2Q8ZA 2QCGA 3G1SA 1GWJA 2Z1BA 3N9SA 2YXGA 3EWUA 3G1XA 3W22A 1TB3A 1QMLA 1YLVA 3R2GA 3W73A 4EF9A 2CLEA 4MKNA 2YPIA 4U4MA 3STGA 2VEKA 3CQ0A 1Q6OA 4KFNA 4MFEA 4AMAA 3THAA 3KXQA 1FWWA 3BLIA 5D05A 5DBUA 3KRSA 1AW5A 5D03A 3ZR4A 2OMAA 3L0GA 1VLWA 1RQHA 2TYSA 3P62A 3W75A 3ABQA 2X1UA 1X1ZA 3MI6A 5HWMA 1G7UA 2QF7A 3JS3A 1KFKA 3MUXA 1WBHA 2CLOA 4UC5A 3W1XA 6TIMA 4LV9A 1DL3A 3CPRA 4FHAA 4JD4A 3MMTA 3LCFA 2NUXA 5GVJA 4WJEA 5CGQA 1GZGA 4QM1A 3B05A 1M7OA 4JX6A 2C13A 1SU5A 5I3FA 5AFDA 2QCLA 2QEZA 4E2DA 3OBKA 1VC4A 4N6EA 3EB2A 7TIMA 4DEFA 2PE4A 2AGKA 3LBCA 4O11A 3L5MA 3LM7A 1I2QA 1XCFA 4WUIA 1SO3A 2V2CA 1XUUA 1PVNA 4IMCA 4MY1A 1LOLA 3RMJA 5L9FA 2QUVA 4RR4A 5D33A 4CLMA 4ZQCA 1WBJA 3DI1A 1GVSA 4XTDA 3IV3A 4UCGA 5BRBA 4WY0B 1JCYA 3LHYA 1K3UA 2RH9A 3VE9A 1MEHA 2PRHA 5G2HA 4JR5A 4O0KA 1U5JA 4EWND 3HPXA 1ZAIA 3G1VA 2ZTKA 4NX0A 1GOXA 3MHGA 1QO5A 3G22A 2Y7EA 3MYPA 1FCQA 1OFPA 4UTMA 1K02A 3O8AA 4Z08A 3T40A 3R12A 2YR1A 3NL3A 1ZNNA 2NV1A 2VFFA 4UFHA 3TC7A 3ELFA 1ICPA 1HL2A 4AB4A 3MHUA 2DP3A 1UCWA 1H5YA 2H6RA 2ZBTA 1E51A 1YDOA 5C6MA 5MHBA 4ONVA 1LOSA 5DELA 1K7FA 2DZWA 4AH7A 3LOTA 4ZQMA 1XM3A 4JTKA 3G8RA 3YPIA 4GXMA 4Y9AA 1EUAA 1SSGA 4M19A 1W54A 4EF8A 2ZYFA 3G0UA 5L6UA 2Z6JA 4N9CA 4UTJA 3OVQA 3QSRA 3L9CA 3CEUA 2QUTA 3S1WA 4JYDA 1WV2A 1G4TA 1OFOA 2B7QA 3L5LA 1WA3A 4NJGA 2ZZ6A 3RK8A 5KZEA 4DO5A 4LS1A 1B4KA 3DFQA 3NQCA 1HO1A 1L6WA 3THQA 3W2UA 5LHEA 1ONRA 4NJHA 1H63A 5KSWA 2CZ5A 4NUWA 4L4MA 1F2JA 2ISWA 3FS2A 5EY5A 1GG0A 4TO8A 5CSSA 4AHPA 1TPWA 4AF0B 1TV5A 3IRDA 1BWKA 1I2RA 1F6KA 4DPQA 1XDLA 3FYOA 3H53A 2P0OA 5HUPA 2R91A 3PVFA 5FEZA 1PHQA 4LTSA 4HNTA 3IGUA 4JS3A 5CPLA 1OX4B 3BPWA 4XKYB 3EKLA 2Q3RA 3NR0A 4LW7A 1EPXA 1XFBA 4O18A 3QMSA 1XC4A 1TV7A 4BI6A 2VFDA 4K8EA 1WYIA 4NJJA 2G97A 3PG9A 4GUFA 1VCVA 1KV8A 2DZTA 4GBUA 1OVDA 5ABTA 1PHWA 4UTIA 3DHFA 3G18A 5AC8A 4MIMA 3B0PA 5CPNA 4K39A 4WY0A 1VGAA 1VR6A 4OWGA 3TW6A 3LRKA 3EKZA 4JTFA 3NPXA 2CW6A 3E49A 3O15A 1A5BA 3GXPA 3W86A 1QOPA 5K7JA 5I3IA 1IXNA 2H8ZA 2HS8A 4MZ1A 3NOEA 3EX1A 1VS1A 1S3HA 4FX8A 1O94A 4HNNA 3BGGA 5SWUA 4W9TA 4UXDA 3QPYA 2A4AA 1KW1A 4QAIA 1T8XA 4Z1BA 2V81A 3EWXA 2ZFAA 4ORIA 4RXFA 2GOUA 3E96A 5CKSA 3ATYA 5AB3A 1T0OA 2E6AA 4ORMA 3DFNA 3NZRA 3HOJA 5TBOA 3GAYA 4JTUA 4ADSA 1YXYA 3BK0A 2DORA 1W1ZA 5A5WA 5CPMA 3QMTA 5HQEA 1DV7A 3GLCA 3NGJA 1YTEA 4WX2A 1Z41A 4IWWA 1SR9A 1XBYA 1LROA 3TQKA 2R8WA 3NL6A 3STFA 3E12A 5H2ZA 2VEPA 1H51A 2C16A 3LERA 2ZTJA 3S1UA 3OA3A 2W79A 4PL1A 1QCWA 2X16A 3HG5A 1PS9A 5G4WA 3PY2A 3CIWA 3N2XA 1R2RA 4K37A 4MOZA 5DBTA 4RZ4A 4X9SA 4UMAA 1VLIA 3M0ZA 3W7KA 1F6PA 3E9AA 1ICSA 4PEKA 3SSJA 1YPFA 3B4UA 4LWWA 3I7QA 1TRDA 3CHVA 4LT9A 3S8HA 2TSYA 3TKFA 4JGDA 5LZLA 3TJLA 3R8RA 1JQXA 3GB6A 2D73A 3W87A 2J27A 2C15A 1W3IA 5K2ZA 1EP3A 4Z1CA 2ZZ5A 2DJXA 4AF0A 3PR2A 5T26A 3C2VA 1RVGA 1P1XA 4BFAA 1OFEA 1JQVA 5BW6A 5G5IA 1TTPA 3QF0A 3UWWA 4XWUA 3LI0A 3MW7A 2JKEA 1D3GA 3W7OA 4N9BA 3G24A 2YCEA 4I9AA 2YYUA 1TCDA 2Z0IA 3L0KA 4HHPA 3W23A 1OX4A 2VEIA 4XKYA 2HS6A 5CG7A 5G1YA 4YCPA 3SFKA 1S5VA 4BF9A 3M1ZA 2C3ZA 3BW3A 3W7IA 4HSNA 4JX4A 3FFSA 1TYGA 1LBLA 2KZHA 1BKSA 4Q4KA 3BO9A 3UNDA 2OT0A 2TRSA 4O17A 1K03A 3TAKA 1TIMA 5HJLA 1IIGA 3RF9A 1PCKA 4NT0A 3W7GA 1KFCA 1QNVA 3LCLA 4MZYA 1YADA 2QKFA 3GZ3A 2WSRA 2J24A 1KFEA 2QAFA 4XTIA 3Q94A 1VPXA 4LVFA 1XXXA 2ZRZA 4WXYA 5F1UA 3N34A 4GNJA 1GEQA 3L2IA 2V0TA 3W1MA 2QJHA 3LV5A 4RZ5A 1FQ0A 1PL9A 1UJPA 3CT7A 3L0NA 2V2HA 3UWUA 3S42A 1DKWA 4NX5A 2NXIA 3S0CA 4NNBA 4ZQNA 3P74A 2PURA 2WKJA 4HPJA 1OF8A 3W84A 4BI7A 1JUKA 2WJZA 3ABSA 5DXYA 3GKAA 2WNZA 4UIOA 3PF3A 3JRKA 1R47A 1TQJA 3NQ8A 1FCVA 4QQ3A 3MP5A 3TMQA 2FB3A 1L2UA 2ZZ7A 3C4UA 4DPPA 1FDYA 4LC6A 5KTLA 4IMGA 4NVTA 4U28A 3TAOA 3NL2A 5E1QA 2WV8A 3A5FA 3WK2A 4WD0A 3FYPA 5DCDA 1K8XA 3Q37A 4I7UA 2DJLA 5FF3A 3KVKA 2B0MA 3NQMA 3B0UX 4JXCA 1LM1A 4O28A 3LXCA 2FQIA 3OIXA 1FDJA 1XDMA 4HKPA 2DZXA 4MZ8A 3P84A 2QCNA 5FEWA 3KRUA 1KLZA 3L5AA 4Y96A 4UUIA 2NX3A 2DZUA 4LUIA 1F73A 1X8FA 4LUJA 2FDSA 3W1AA 1X6UA 3UXAA 5F2LA 2QDHA 4NU7A 1H7NA 1W5PA 4O1DA 2ZA2A 1L9WA 2I14A 1I45A 1W5MA 1LLZA 3TE9A 1VH7A 3KVJA 4IXHA 2RDUA 3LCXA 3LI1A 2TMDA 3PULA 3TXVA 5AYZA 5IBXC 3LRMA 1YDNA 3IEBA 2O7SA 3ZWSA 4Q33A 5EYWA 3F4WA 4UNLA 2ZZ4A 3G3MA 5TQLA 3AO0A 3EX2A 1SW3A 4O14A 2G95A 3LB0A 3PBYA 5LNRA 3SECA 1P4CA 2H8XA 1N8FA 3MHFA 4UTKA 4CNPA 2RHGA 3QQ0A 4BWLA 3NM3A 5HULA 3WJZA 4JTHA 1OYCA 5AHLA 4D2JA 3UY7A 3W7NA 1OHLA 1LRTA 1VYPX 3HQ1A 2W0UA 5H91A 3HG3A 4CNOA 1NVMA 4DF2A 3LTSA 3VKJA 4TMCA 4QSHA 4ZQPA 4FXRA 1ZAHA 4A2RA 2YZRA 1EA0A 3DKLA 1NSJA 4GUHA 1AG1O 1WXJA 1UUOA 2RFGA 2E09A 2GVJA 1H7RA 4Z0JA 4MLJA 2V82A 4O4WA 1R46A 1SW7A 3NQAA 3QSTA 2QCHA 3GR7A 1OYBA 4PCFA 4JX5A 1ALDA 5EKYA 1IIHA 3HJZA 3FEMA 2CLKA 1DQWA 4FNUA 3PSWA 3S5YA 4O52A 1Q3NA 3BLFA 2P1FA 1OG0A 5FF7A 3TV8A 3A9IA 1V5XA 3QW3A 1ME9A 1G4EA 3A5VA 3QMRA 5E93A 3RNDA 1Q6RA 1KM5A 2ZCGA 3VCRA 2VENA 1WX0A 4LRSA 4PODA 4JDYA 5J5RA 1AL7A 3L21A 5J5DA 3W7JA 2VFIA 3DXIA 5AOUA 4NZJA 1VZWA 1W3TA 1QPOA 4JTSA 3L67A 3DFTA 3TJXA 1FCUA 2E5DA 3V75A 3IIVA 5A8GA 1BWLA 2A6NA 2H3BA 4Z0SA 5LNSA 1KTCA 4NNCA 4S1FA 4R34A 5IM51 2QR6A 4CCDA 2ATSA 2JGYA 4UFIA 2RKXA 1DJNA 3NO5A 3S9YA 1K7XA 4GJ1A 1OF6A 3QRHA 3SR7A 3M5VA 4LV4A 3DI0A 1TPEA 1YXCA 2WO5A 1EP2A 1KFLA 4X3ZA 3ZFHA 3TU9A 3B8DA 5K4XA 3W1LA 3G0SA 1QOQA 3MYOA 5AHFA 4IJBA 4AHOA 1FXPA 3TROA 3C2RA 3OEXA 2EAWA 4HN4A 3MBFA 4LY8A 1JCNA 3M5ZA 3CB8A 3W72A 3P8JA 3W76A 3WJYA 2GJLA 1ZALA 3C2EA 2NUWA 2QAPA 2A1YA 4PA8A 3IIOA 3STCA 1IXPA 4FNRA 2ABAA 5DXXA 3N2MA 1OX5A 4UMBA 2Q8LA 3IIXA 2DZPA 3S1XA 2Y63A 2NV2A 1HG3A 4CNNA 1EP1A 3G1DA 4C1LA 1TPVA 3PM6A 3W7EA 3BG5A 2QCMA 3M43A 2CLLA 3P67A 3NVTA 3ZWTA 4TX9A 5F1VA 1AL8A 5LSMA 1LRNA 3MBDA 3BW4A 2BTMA 2C14A 1TO3A 1EX5A 3W1QA 3A24A 1ZHAA 2FLIA 1X1OA 3D0CA 3W83A 3ABRA 3O6DA 5FEXA 4AVFA 2C0AA 3V1PA 4R53A 5DN1A 3DGRA 3A23A 3QH2A 3UD6A 4PTNA 1GVQA 1OABA 4PC8A 3M5XA 3UZ5A 3W88A 4FNTA 5I3KA 1QAPA 1P0KA 3EXTA 2EPHA 1GVFA 2OT1A 2WNNA 3NG3A 4IGHA 5D2WA 2GQ8A 3KVMA 2B7PA 2LLEA 4DF0A 3P81A 2CZEA 4C1KA 1H1ZA 3LRLA 2V30A 4MPQA 4ZQOA 1KM4A 4NJIA 4M7SA 2YW4A 1H50A 4ZVJA 5DLCA 1GYNA 4HNUA 4K7YA 2AAMA 2NX9A 1H7XA 3T4CA 3DU0A 1S5TA 3QZEA 3KVLA 4XQ6A 3EWZA 2V5BA 2WOQA 1MZHA 1V7YA 1DOSA 4RZ6A 3GKFA 4NXSA 1G4SA 4RLIA 2ALDA 3H54A 3LBMA 5F4XA 3BARA 5CZTA 3PAJA 3DFSA 5HUOA 3NQDA 3WK0A 3HG2A 4H3DA 3UZJA 2YDAA 4K36A 2V5LA 1TREA 1FCBA 1XUZA 1H7OA 3I6RA 3M47A 3I7RA 1QR7A 2ISVA 3R5EA 4ADTA 8TIMA 4XZ9A 3G0XA 1TJPA 4GFSA 3FJLA 3VFLA 3LLFA 3C8FA 3M9YA 1HTIA 1J2WA 4JIQA 3BVJA 4UTTC 3T78A 4ZZ9A 4MLRA 1OFQA 3W7MA 3SI9A 3W7RA 3QQ1A 2E5BA 2BXVA 1GG1A 2WPBA 1EEPA 4UR7A 1GQNA 5BMWA 2Q3OA 4O8RA 2QJIA 1WOAA 1F7BA 2QCFA 1M7PA 5AHIA 3NPUA 2ZZ1A 1DHPA 1ADOA 1G4PA 1Q6LA 3C56A 2J9YA 4IMDA 5LNUA 1H1YA 3O63A 1KM1A 3UXDA 3O07A 1G7VA 1O5XA 3IVUA 1BTMA 2NZLA 4JY8A 1CX9A 5CZSA 4BWLC 1CI1A 1YDVA 1L6YA 3U6WA 3QPZA 3EXRA 4RJEA 5D2XA 1THFD 3FLUA 1QFEA 4LC8A 3B03A 3G8EA 3NQFA 4MUZA 1QDSA 3VNDA 3GDKA 1KM0A 1JRBA 1F05A 2B7OA 4FX6M 4AEOA 4ADUA 4IMEA 1LZOA 1XBXA 3GYEA 2WSYA 3TSBA 3NPWA 2TPSA 4IPJA 5AYXA 3GDMA 2ZRUA 3CWNA 3W2NA 1NFBA 4E0CA 1UB3A 2CFFA 1NEYA 2WSQA 3CLMA 3GVGA 4K38A 3WK1A 3TXZA 5DCBA 2A7PA 5KITA 3GIYA 4OGZA 4MYXA 1RD5A 1AMKA 1H7PA 4UTUA 1G67A 3M6YA 1DVJA 3I7SA 4H6KA 1SUXA 1PE1A 1TTQA 4A29A 3MI2A 2QJGA 5C2XA 1TTIA 5D04C 3UWZA 5KMYA 3UPBA 3GNNA 2X2GA 4QISA 3NL5A 2ISSA 3QM3A 3DFPA 1EWEA 3P5ZA 1I2PA 1B4EA 3QYQA 3EWYA 4MYAA 4BI5A 1Z44A 2QCDB 3C6CA 3NYZA 5KZMA 4ALDA 3UYCA 2QUUA 2W6RA 1FWRA 3KX6A 3RU6A 1KTBA 1ZFJA 3B0VC 3R13A 5HWJA 1VHCA 2H90A 2Y7DA 4FO4A 4IQLA 4RXGA 5LKYA 2BWGA 1RZMA 3HPZA 1MXSA 3CM4A 1HUVA 1N55A 4LS2A 1EB3A 5DCEA 3BG3A 4JEQA 2H3DA 2FJKA 4DBDA 1FWNA 4I7WA 4N9EA 1PIIA 3LHZA 3KHJA 2RDTA 3ZS4A 4K7VA 2ATMA 4ZMGA 4KKXA 4A2SA 3CTLA 2NLIA 1W56A 1VJIA 1JULA 5CSRA 3RFAA 1OFAA 2PRLA 3F1QA 3DBPA 5AYYA 4NQ1A 4O0ZA 2NUYA 3TC6A 5KINA 1TPUA 1C8VA 4LVGA 4MY8A 4EVZA 1RPXA 1B3OA 3IIZA 3IVTA 3C52A 5HNRA 4GUGA 3N3MA 4LOCA 1SZNA 4WQ6A 1JCXA 3T44A 3CU2A 3PS7A 1AW2A 3QC3A 2CWNA 2Z2UA 1HFBA 3U2OA 1VHNA 1A53A 4ZL1A 3NQVA 2J9XA 2IQTA 4O4VA 5LGXA 3S5NA 2XN1A 3W71A 2J9ZA 3HG4A 1MEIA 3LTYA 4AWTA 3GNDA 4YCOA 3N19B 5AHMA 5AC6A 5CPOA 4FXSA 1GJPA 3C2FA 1CW2A 3W1RA 1QWGA 3O16A 4MY9A 1OX6A 3LHUA 4GUJA 3T55A 2FFCA 2E68A 4O19A 3KRZA 5DY2A 2WQPA 2A7NA 4R7JA 2FTPA 2CZDA 3M5YA 1SO4A 4DELA 2XN0A 2FPYA 3NNTA 2QCCA 1U83A 2X1TA 3F03K 3P61A 1QPQA 4FIQA 1ZAJA 4TIMA 3S5OA 4G1KA 1JCMP 2QCEA 3TQ0A 2V9DA 4GRSA 3IVSA 2VFEA 3C3NA 1F74A 4JYEA 5G2IA 3W7LA 4DO4A 5HMSA 2VEMA 1LOQA 1TTJA 3CC1A 4QJ1A 4X22A 2ZRWA 3LV6A 3W7HA 3HIJA
chains in the Genus database with same CATH superfamily
3CMGA 3TA6A 5K9CA 3GDRA 4DF1A 1JDDA 2ISDA 3ZT5A 2ZADA 1S1PA 4DJDA 1V0LA 2DEPA 3QR1A 4H6QA 2GPTA 2GVYA 2J6XA 1UUMA 4UFMA 2Z1WA 4ZB0A 4TX8A 3ZOAA 2GQAA 5DF0A 4L65A 1T96A 3DG6A 3BWWA 2ZE0A 3NO1A 2VT0A 1MYRA 2XFYA 3S9ZA 4U3AA 2YFOA 4G7EA 4OT7A 3RX4A 2GZXA 1NTHA 5A8MA 3HGSA 3HGJA 1ZU8A 2OX1A 2X09A 4Z2LA 1H60A 4GBDA 2P88A 3NIYA 4XVEA 4C6DA 4M7TA 1UWIA 2GGEA 3WQOA 2R1KA 2DV0A 1S1RA 2NT0A 1MRAA 4RV8A 3NM1A 1C9DA 5JVLA 2D69A 3H2EA 1EJUC 3UWQA 2FVKA 4M82A 2AKZA 2RJHA 1SJDA 1OSEA 3RJXA 3OVRA 2Y61A 5HK4A 3WQ4A 3OZYA 3I3BA 2VOMA 4PMVA 1ZB5A 3FSUA 1QK0A 1EC7A 4P7QA 2BLEA 1B57A 4IMFA 3PJWA 6ALDA 2GOKA 4O53A 1B31A 4PL2A 3UVAA 3DDMA 2PDCA 1T5AA 1KBIA 2VQTA 3U48A 2XPKA 1WZMA 1JDEA 3SGZA 3NXFA 2E77A 2V8ZA 1C29A 2FB2A 2IMRA 3P7YA 2GJRA 4AVNA 1K7EA 5CC6A 3PSVA 4W7VA 3LHWA 3ANVA 3UY8A 1H0GA 2WHJA 3PJTA 4XD4A 3CASA 3VGFA 4H8NA 4KRZA 5C9WA 2QDGA 2VNCA 3INPA 3LLXA 4C6IA 4NYUA 3GAKA 3OHIA 4YS1A 1QATA 2YFNA 4WZHA 1EOMA 4C7DA 1GOIA 1W3NA 1TZZA 1K4HA 1XH1A 3BG9A 3P60A 5I06A 1V3KA 1DJXA 1V03A 4W5ZA 4JFUA 4N4PA 4CU6A 4O15A 3P5YA 5C55A 2XH7A 3ZJ7A 4NG3A 2ZX9A 5LA1A 1C7TA 4J3SA 3R58A 3PB2A 4DI8A 2XH2A 2WVVA 5JIWA 3SN4A 5CPQA 4GQ0A 1IT7A 2VKZG 1ZGDA 1V0MA 3TA9A 5AC7A 2NXHA 4PMDA 1HO4A 2PFHA 1ITCA 2PPGA 3FK4A 2ZRXA 1K6WA 4GZJA 3H26A 4AY7A 3TYAA 4PN2A 3UW6A 1JL8A 4RE0A 4U5KA 1LWHA 3IUIA 3SQLA 3GUWA 4NHVA 4X60A 3S4TA 2Z28A 2A0NA 2A7RA 3VGBA 3TOPA 4GQBA 3T42A 5D09A 3KCLA 4XISA 1XBZA 4ICNA 1BPLB 2IS7A 3O1NA 1ODUA 3ZLFA 1I8JA 4M56A 4DQWA 2Y85A 4CCEA 1BQGA 3UA4A 2TAAA 1OT2A 1EUNA 2ZRYA 3L2LA 4ZO6A 1DWAM 1LLWA 2B7NA 2G3MA 5HINA 4JNZA 2DVUA 3WMCA 2V3FA 1S5WA 1SFLA 1GVOA 1F8MA 1WCGA 2PTWA 1W9DM 1DQXA 4UFJA 3HM7A 2F61A 2J7FA 2JIEA 1UWTA 1V79A 1ZJHA 1C93A 3OVPA 3E0IA 2ZDRA 1UASA 1VRDA 5LGZA 1JCJA 4QNWA 4CEXC 3QV7A 2HK0A 3FCPA 3WLQA 5IHSA 4PE8A 1R0MA 5T8GA 5FL1A 2OELA 3DG3A 3NZ1A 5C71A 4O57A 3F2DA 3WF4A 4D9PA 3BAJA 3Q2DA 4MPKA 1QI5A 3A21A 4QQUA 1QOXA 3REQA 4JTIA 4HNCA 1LBMA 2XIQA 1LQAA 7REQA 4NSBA 1ZJBA 2XIIA 3UJFA 3TIMA 3R0DA 1BD0A 4B4FA 3FAWA 1U1UA 1J5TA 4LUSA 3BW2A 4DUOA 1M03A 4J7RA 4YTTA 2FPVA 1VCGA 1EZ2A 4AWUA 3CO4A 2WCAA 3UXKA 2V69A 3MP4A 2HE8A 3E2VA 3IGXA 4IGSA 2CLMA 3QEZA 1M1BA 1A47A 2HXTA 1EFZA 1RQEA 3EMZA 4CD5A 1NFGA 4B92A 2EHHA 3T0TA 4HGXA 4P61A 4AWSA 5FSDC 3LTPA 1LRQA 3PZNA 1R7AA 2Y62A 3EA3A 1CLXA 1MSSA 2JF6A 2L5HA 4JDBA 3TNBA 1EBHA 5F2IA 2Y5SA 3VIHA 2F2HA 3NQGA 3LGEA 1BSLA 3ZJKA 4RDZA 2D3NA 3SJ3A 1M6JA 2PDWA 5TIMA 1WOBA 4A8NA 2EJAA 4GUIA 3NA8A 2XISA 2ASHA 3UJ2A 3FOKA 1BLIA 4R7WA 1E70M 2E5CA 3KP1A 3BLDA 3WMSA 4MJ4A 4CQDA 4ASTA 5PTDA 2YSWA 3WUFA 4QJ5B 3G1YA 3POCA 5BNKA 3ZQ9A 4YLWA 1UQYA 4DO6A 1X7FA 1ZJIA 4NL1A 3KZSA 4N2YA 3LQGA 4GC3A 2ZX5A 1ADSA 3L7RA 4CQ8A 3H55A 4CN6A 2CZVA 1S3TC 3M7WA 1DXIA 4HOXA 1EBGA 3FKRA 3W6MA 1F76A 5GJPA 4O0QA 1W1VA 4INFA 4GXPA 4PMQA 3D3AA 5HR7A 4XAFA 1XIMA 2SFPA 2A21A 1WQ5A 3W85A 1A50A 2REQA 1NU5A 1I60A 4QR6A 3LNMA 4GLEA 2UV8G 3TW9A 4I7VA 3DECA 3FIGA 4Q4QA 2Y7FA 4G56A 1LT8A 4IFKB 3MANA 2CBJA 2BFGA 4UNKA 3TFXA 1QRQA 1OFRA 5C54A 4I5RA 5H1WA 3AHZA 3VA8A 1HL8A 5D32A 3QKZA 1UD4A 1UZ4A 4XIMA 4PBEA 1HP5A 4Q7BA 3SCSA 5H8PA 1A5KC 1TMLA 1HIZA 1JRCA 3KFTA 3UWYA 4AD4A 4HPXA 5KZ6A 5BMXA 3P0WA 1IEWA 1UBSA 1A5NC 3P14A 4MFDA 5FF0A 4B5VA 3IS4A 1PB0A 2J75A 3LGGA 4AG0A 1AQ0A 3IK2A 4LYRA 1P0EA 3DYMA 4O1CA 1MW0A 4GACA 2P3EA 4W8AA 2CEQA 4NASA 2J62A 4YU1A 1Q6DA 2YBUA 4PMNA 3ARSA 4E38A 2GDQA 3KBJA 3RO8A 3ZSSA 1W37A 2BHUA 1VFMA 2E1DA 2G96A 2HNHA 1RBOB 3HO8A 3GNRA 4ACYA 4MJ2A 1ME8A 3H8AA 5I3JA 3C0JA 1S2TA 1VFSA 4DNHA 3CZLA 1PKMA 3HF3A 2ZA1A 3W2JA 4B5NA 3TWBA 3LCGA 2YCJA 2JK2A 3M4HA 3LYEA 1U1JA 1TPC1 4C6FA 1I2OA 2CYGA 4UTTA 4H2CA 1YNQA 3BOFA 1LCOA 1J4EA 5AHEA 3VUSA 3NDOA 3U4FA 4N9DA 2C19A 2HQAA 2G3NA 1HJSA 3MUCA 1PWLA 4BKNA 1JFXA 3EWBX 2QCGA 4XIAA 2YXGA 3EWUA 3G1XA 3W22A 3STPA 1J8VA 4V1YA 2CLEA 4GIRA 4MKNA 3T05A 2YPIA 4DLMA 3STGA 2HPMA 1Q6OA 3MSGA 4KFNA 3SRHA 2QV5A 3GSMA 1H4PA 3KXQA 3WG6A 2UY2A 4H9ZA 1Q6GA 1XYZA 3W28A 3ZR4A 3NSNA 1RQHA 3T08A 1X1ZA 3ARXA 1E5JA 1G7UA 3W38A 2QF7A 1KFKA 4GG9A 4GCAA 3H24A 6TIMA 3CPRA 1G1YA 3DGBA 5I07A 4JD4A 4EXQA 3M0LA 2NUXA 5GVJA 1NWSA 1U1HA 3TTQA 3E0VA 3CH9A 2C13A 3ARQA 2D0GA 3GQYA 4S23A 3VM5A 2QEZA 2KAUC 3OBKA 4RZBA 1QASA 7TIMA 2PE4A 3CL6A 2DW6A 2MUCA 3L5MA 3M07A 2V2CA 2VEGA 3H4WA 1XUUA 4IMCA 4H9TA 4PUMA 4HPHA 3DCPA 1WBJA 3DI1A 2DT0A 1E6XM 2AAAA 1CDGA 1GZ1A 4D6EA 1JCYA 3LHYA 1E1CA 3WFZA 2Z1KA 1MEHA 1FWFC 5G2HA 3VGGA 4C6PA 3BSMA 3OYXA 4O0KA 2ZTKA 4WVXA 3A4AA 4H19A 3H2MA 2G4FA 1DTNA 3T0CA 3RO6A 3WL0A 1WE5A 4JTCA 1FCQA 5DMNA 4Q6XA 3T40A 3WLPA 3NL3A 3WUEA 1UUQA 4D71A 6CGTA 4ZFMA 4D6CA 4L4PA 4H1ZA 1FWDC 1ICPA 3GU2A 1XX1A 3MHUA 4AYGA 4AXNA 3PWGA 3LOTA 2QYGA 1XM3A 2G8ZA 3G8RA 3B4YA 1SSGA 4ZR8A 3RUBL 4EF8A 3G0UA 2Z6JA 1XPGA 4UTJA 4M51A 2PWGA 3L9CA 1SZRA 4JYDA 1WV2A 3VZYA 2GGJA 1Q65A 2ZZ6A 4DZ5A 2AQOA 3NQCA 1HO1A 3SY1A 1YRRA 1L6WA 3W2UA 1MDLA 3GFXA 1V6WA 5KSWA 2CZ5A 1EDGA 4KCWA 3IJLA 3FS2A 3MVIA 4M3PA 5CSSA 4TO8A 4CCZA 4AHPA 3CAKA 4MWAA 2R1MA 1CNVA 4PTVA 3IRDA 1BWKA 3RX3A 1F6KA 4DPQA 1XDLA 2R91A 3UG8A 2PC8A 4MB4A 3IGUA 3NSMA 2CERA 3HA1A 2VCBA 3KLLA 4XD5A 3M0VA 1FH7A 4LW7A 3DHUA 2IW0A 4O18A 3QMSA 1XC4A 4K8EA 5A94A 3PG9A 3H23A 3FX4A 3H6OA 1VCVA 4GUFA 3A4XA 4M81A 4Q4RA 3EPMA 5GJNA 2EO7A 5AC8A 4MIMA 4ZODA 5CPNA 4K39A 2OO6A 3LRKA 3NPXA 3O15A 3HIJA 3T2QA 5E9XA 3OGVA 2WMFA 4S3GA 3O3RA 1QI3A 3APYA 2OOFA 4MZ1A 3EX1A 3AU6A 2ACUA 4HNNA 3WD0A 2VTFA 3BGGA 1JD7A 4AYSA 2A4AA 3LPOA 1KW1A 4AIEA 2ZICA 1T8XA 4Z1BA 2V81A 3EWXA 3CL8A 1WKFA 1XIJA 5CKSA 5AB3A 1K6AA 5BWFA 4Y9OA 1LQ0A 1C8XA 1E55A 5FCZA 4K2SA 5TBOA 3H70A 1DJIA 4HU0A 3PK7A 1E56A 2CHOA 1TR1A 1DV7A 3GLCA 3NQBA 3KCJA 1CZ1A 1Z41A 2D2OA 4Y8EA 4OOZA 3ES8A 3STFA 4MDPA 3E12A 1H51A 1KRBC 1ZTVA 3BAIA 3LERA 2ZTJA 3WCZA 3S1UA 3ZVHB 4QCFA 3VMPA 4PL1A 1K70A 1QCWA 5G4WA 3PY2A 3CIWA 5AYBA 1R2RA 4P7OA 1NJJA 5HANA 3SSJA 2O4QA 5IXEA 3MKKA 5C8BB 4LT9A 1EJTC 3TKFA 2D73A 1XD1A 2C15A 2FGBA 5K2ZA 1EP3A 2DJXA 3MKCA 3C2VA 2BGNE 2JQXA 3VD7A 3KDOA 4PBFA 4DVOA 2R1LA 3UWWA 4QSFA 4KCTA 3LI0A 2JKEA 2ZUNA 3W7OA 1TCDA 3A9BA 4XKYA 1Q2RA 5G1YA 1A4LA 1S5VA 3M1ZA 5DT7A 2VMFA 4J3WA 1E6NA 3O7UA 3Q4DA 4L5ZA 2OT0A 3F5KA 4LAMA 1IIGA 3RF9A 4F2UA 5HMDA 5ECVA 1XS2A 4RV3A 1EXBA 2QT3A 1YADA 3VXGA 3GVVA 2QKFA 5I78A 4X2PA 2J24A 3WD4A 1UKPA 2DFAA 2Z26A 1TE6A 3Q94A 4YYCA 1KGWA 4LVFA 4GQRA 4GNJA 1DE5A 4GHRA 3L2IA 3UR8A 3W1MA 4S3AA 2QJHA 2QDDA 3DIPA 1UJPA 3L0NA 4Z2GA 1F07A 4KBXA 1XD0A 2DUXA 3FVMA 2OZTA 3RRAA 1WZAA 4NX5A 4TOQA 1NWTA 2XSAA 3V0SA 2DY3A 4AUBA 2C1IA 2WZHA 2ZIDA 3B8UA 4BI7A 3OO2A 3FAXA 2WJZA 3ABSA 2XU2A 3GKAA 1A5UA 1XSJA 1GOKA 4JFVA 2WKLA 3EMQA 5HQLA 3NQ8A 4QQ3A 1U2YA 4PUKA 4QLJA 4WJ8A 4UQ9A 3QGVA 1CXKA 2F6UA 3TMQA 4D6IA 3C4UA 1L2UA 4EPKA 1GHRA 3PNUA 3OLGA 4C91A 1ONXA 1Q4WA 3VKAA 1AJ2A 1XLCA 4IUGA 2UBPC 4I9MA 3SDOA 3NL2A 3HV8A 3RR1A 3B8VA 4XZNX 1UKTA 3WK2A 1D8WA 3Q37A 1JPMA 2DSVA 1XCWA 2B0MA 4ML4A 3B0UX 4JXCA 3LXCA 3RLGA 2FQIA 2PLMA 1N8WA 1FDJA 1XDMA 4HKPA 3KOZA 4WJXA 3QQWA 4B15A 1KLZA 3SCUA 4FR1A 4UUIA 3T2PA 4JKKA 4CGTA 3UT0A 1X8FA 3NCOA 2RDXA 2QDHA 1UR8A 2DVXA 4O1DA 2D3LA 1ISVA 3THDA 3K1DA 1LLZA 4C6LA 3DEQA 3THUA 5BXPA 2FZMA 2VD8A 4MM1A 1KRMA 2NQHA 4IXHA 5I24A 1E72M 1IWPA 2G3FA 3DBNA 2DVTA 3LRMA 3ZWSA 1UHVA 4Q33A 4ZA0A 3F4WA 3TEVA 1VFTA 3PPHA 3AO0A 3CV1A 1QWKA 4O14A 5C9RA 2IPWA 2AMXA 1EL3A 1UR3M 1P4CA 2H8XA 1N8FA 3SECA 3MHFA 4G9PA 4AIOA 1F9CA 4JEJA 3KZPA 1V02E 1W17A 3W7NA 1OHLA 4CNOA 1NVMA 4TVDA 4TMCA 1BF6A 4ZQPA 3RYSA 4A2RA 4JHZA 2AGTA 3OLDA 3BOXA 2CXEA 4F0SA 3QVQA 4GUHA 4PSRA 1XLEA 9XIAA 1UOZA 2HXUA 4OFCA 4XZIA 1QNSA 4G5DA 1E4MM 1V51A 3HQNA 3MV01 2QCHA 2NT1A 1OYBA 4JX5A 2JEPA 5EKYA 2IKHA 1PKYA 1RXOB 1Q3NA 3TV8A 1WP6A 3A9IA 3VC5A 1Q85A 2XGZA 1MI3A 3ARWA 5E93A 4TTGA 2F2KA 2Y0FA 4YJ5A 1KM5A 4CU7A 3VCRA 3K13A 4PODA 4JDYA 1WAWA 5J5RA 3L21A 5A6BA 1IR1A 4NZJA 4NZCA 3SN0A 5ENLA 4JTSA 4PTDA 3TJXA 1I9CB 4EK7A 1OG6A 1HW6A 2DIKA 3PZUA 5LNSA 4NNCA 3OIHA 4J3UA 2CESA 1AQHA 5IOBA 2JGYA 2RKXA 1DJNA 1K7XA 2ZVIA 4CD6A 4AZCB 4BEQA 2WCGA 4RPPA 4PMUA 3DI0A 3PZGA 1F3XA 1AJZA 3MPGA 2XUCA 4X3ZA 3ZFHA 3B8DA 4MAZA 5K4XA 3G0SA 1QOQA 3VOFA 3GRIA 1XFCA 2EJ1A 2OU4A 1JCNA 1H0IA 1W3JA 4C7GA 3CB8A 3WJYA 3VGDA 4D6DA 2VEFA 1DHKA 5FAGA 2VJXA 2PBOA 3URAA 1EQCA 5FA5A 3WEZA 4FNRA 2ABAA 1AUSL 4PULA 3ZM8A 1J18A 2DZPA 2PDKA 1X8CA 4IQDA 3S1XA 1PZ2A 4UBPC 2Y63A 3C2YA 4X63A 3TN3A 1DWHM 1EP1A 1GW9A 3G1DA 2QIIA 5E0FA 3BG5A 1RH9A 1HX0A 1WKYA 2RJGA 2V3EA 2X1IA 3I10A 3AYVA 3R94A 3LPFA 3ZWTA 4L4OA 3LMYA 5LSMA 3IACA 3WFLA 1BYBA 1BKHA 3W1QA 1ZHAA 3W02A 5CGTA 4LF1A 3V1PA 1RP9A 3SUSA 1TWIA 3U5UA 5CQ1A 3P3BA 1GVQA 2VL4A 4PC8A 4GFIA 1BGAA 4B5TA 3UZ5A 3W88A 4IJCA 4KT2A 1BQCA 4QE4A 3K46A 4L1XA 2B7PA 4RUBA 3P81A 3CS2A 1CGWA 1VFFA 1OGBA 3GU1A 2YW4A 1GQIA 4ZVJA 3AROA 1O5RA 4GISA 1S5TA 1GCYA 3KVLA 1B5TA 5FKYA 1DOSA 1YNYA 1EQPA 2J7CA 3GKFA 3LD5A 4MNMA 3BARA 3I4EA 4AD3A 4Z42C 4IIHA 1SYTA 3UZJA 5IHRA 2QIWA 1Q8AA 1XUZA 3OZOA 1IR2A 4HTYA 5C7HA 3G0XA 4GFSA 2FFIA 3VFLA 3C8FA 3E1F1 1DJGA 1R5YA 2WC7A 1X38A 3UERA 2BVDA 1OFQA 1H1NA 3U7VA 2BGQA 3E6EA 3SI9A 5IDZA 1GG1A 1EEPA 4UR7A 1GQNA 3RDKA 1KXVA 2HDJA 2QJIA 1QHZA 5AHIA 3AS3A 5CSUA 2ZZ1A 4MG4A 1DHPA 1ADOA 1Q6LA 4IMDA 3UETA 2OODA 3OLEA 3EAUA 1QJWA 1MNZA 3GO2A 1R3QA 3UXDA 4GD0A 3CGTA 4HQVA 4NI3A 2VCCA 1G7VA 3ZMRA 5M2FX 4AU0A 2G3IA 2NZLA 5GNXA 4PR4A 3O9NA 1US0A 3GNOA 2NQZA 1CI1A 3OQ8A 3WLJA 2OX4A 4RJEA 4IP4A 5D2XA 1AZ2A 2OYMA 1RA5A 4HOZA 3EKGA 2NVCA 2INEA 4F3HA 3RILA 3WQEA 2ZDSA 1JRBA 1AQMA 3U9IA 3LNPA 3UCDA 4ADUA 2PDBA 1IGWA 2WSYA 3S2NA 1UD8A 4U3CA 3GDMA 3AS2A 3CWNA 1NFBA 4E0CA 4OOUA 1UB3A 2CFFA 3UZYA 1N8IA 1X1NA 4HK5A 1W3LA 1BYCA 3AQUA 2A7PA 3WEMA 4J4KA 5EMKA 4DJED 4AZGA 5LIWX 1RD5A 1G67A 3SRFA 3QPEA 2YB4A 1REQA 1OGSA 1TTQA 3MI2A 1X96A 3D46A 3EOEA 4QISA 2ISSA 1BVNP 1UA7A 3QM3A 1AMYA 5EBAA 1HJWA 2D0FA 1I2PA 2FGZA 1US2A 3AI0A 1I6NA 1LF1A 3K1GA 3UPMA 3PJUA 2CHNA 4PUEA 4Q4PA 2D2HA 5CZKA 4ALDA 1B0IA 3PZVA 3UYCA 2BY0A 7ENLA 1KTBA 4B3ZA 1ZBVA 2WMIB 2WZTA 3CZKA 3R13A 4JNYA 5HWJA 3IAPA 2OOGA 5A6MA 1B90A 2XH0A 5DT5A 2ACSA 2H90A 2Y7DA 4IQLA 4JQ3A 1N55A 3WNMA 5DCEA 2OSWA 3BG3A 4XX6A 1RPKA 4WCJA 4DBDA 4ZBCA 5H8UA 2RDTA 3XISA 3RU8X 2WMJA 4WK9A 1I0BA 1F4HA 3O2LA 2VC9A 3I6TA 3RFAA 3WNPA 3MVTA 4M80A 1DEDA 3EDFA 2PWVA 4HMEA 4CVUA 3V5OA 5KINA 1V3IA 3QLDA 1RPXA 3O6AA 1B3OA 3GG8A 4LOCA 2Z1VA 4IPPA 3T44A 4C7FA 3CU2A 4HK7A 3QC3A 4W7WA 3TZFA 1HFBA 4H9XA 3U2OA 2O4MA 4ZL1A 4RDVA 2J9XA 2IQTA 4O4VA 2O92A 3KOWA 2UZ9A 3W71A 4HNLA 3HG4A 3SO7A 1MEIA 2WYSA 5CH9A 1SGJA 5CPOA 3SCOA 4FXSA 5CJMA 2R1PA 1GJPA 1O5QA 4MY9A 1YIXA 4PMRA 4HZ7A 7CGTA 2A7NA 2ZUUA 3M5YA 3KLKA 3KBNA 2XN0A 1PDZA 3RHGA 3NNTA 3F03K 1QPQA 3COTA 3QOKA 4HP5A 3QHOA 4TIMA 1JCMP 4UOZA 4ZTYA 1EC9A 4GRSA 3IVSA 2UY3A 2FZNA 4XV0A 2QUMA 3B9NA 3UA3A 2ZRWA 3P93A 4OU1A 2OCZA 3S5ZA 4Q7IA 2OTDA 3FHQA 3HB9A 5B7YA 4JAWA 2GL5A 3W27A 1GKPA 4QLLA 3TSMA 5B7ZA 1A0DA 3CWHA 2VC7A 4UTWA 2Z2AA 1Z89A 4LH8A 1JDCA 4AZ6A 1WUEA 3F4CA 1MQQA 5BOFA 3N2CA 5BZAA 5C9UA 3TCEA 3ME3A 3IIPA 2NWSA 1MW2A 2E6YA 2GUYA 2VXNA 4GGHA 1FX6A 3WELA 3BAKA 1V3MA 3EB4A 3ZJ6A 1W0MA 4B2DD 4G8TA 4AISA 3LCIA 1EEXA 5JBDA 1RLCL 3DH7A 4FIRA 1VAHA 4V15A 4UWMA 2QZRA 1IWBA 1ELSA 2WLYA 4TXEA 4P7RA 1C8YA 4S39A 1I4NA 2A3CA 1LL6A 3RPTA 4G1NA 3NQ6A 1CXHA 4ZXLA 2XWEA 4EIVA 4UFLA 2IXUA 3UYIA 2EF9A 2OZ8A 5EBUA 4DJFA 3APGA 1PCWA 2XGBA 4Z2HA 2GGIA 1C3FA 1Y7VA 4E3VA 5E0KA 2CLHA 1UWAA 4V1XA 4IHCA 4MNJA 1QW7A 1XRTA 1QU4A 5FI8A 3TR9A 4MVAA 1ITUA 1H61A 3OZMA 3G1FA 2HJPA 2IPJA 1JYXA 1NF0A 5K9DA 5I3GA 3KAOA 2PZNA 1K8ZA 5FJIA 1K9FA 3WLKX 1DP0A 2WHKA 4JKMA 4LU0A 2F7FA 1GTEA 4EKJA 3B04A 1EX1A 3EPOA 1N82A 1GTHA 3PTMA 1UW9A 4X2RA 4CCCA 1HT6A 1TZ9A 2QF8A 3WQCA 2ICSA 1C91A 1TSIA 5I3HA 4N6FA 1LP6A 4JN6A 1GJWA 1JF6A 1FP9A 3IUHA 3E02A 4P8VA 3F4NA 3H4XA 3VDBA 4PFMA 1CYGA 1KBJA 2DUAA 2YXOA 1ML1A 3W7DA 1PYMA 3IJ9A 4EAMA 4IM4A 2E28A 3NPVA 5KZDA 1R30A 2CKSA 6XIAA 3S2CA 3B3DA 4CNTA 1V77A 3AUOA 2CHRA 3V0UA 2QJNA 4AEFA 1J9YA 5BWAA 3EX6A 2EBNA 3EOOA 1YPXA 3F5JA 3MV11 1E4LA 2EGZA 3A3XA 4YXGA 1UD3A 2V38A 3M0KA 3EDJA 4QXIA 1JPHA 2NX1A 2VR5A 4OECA 1YYAA 3LXBA 4NXKA 1BXBA 2V2DA 2XN2A 4UNIA 1O5KA 1ISWA 1P5BA 2W5FA 2FH6A 4KFOA 1Q5MA 4LNYA 5FEPA 1XH0A 4PRTA 1IZCA 4L9ZA 5ECUA 2R94A 3PPGA 1PTDA 4RNFA 5EMUA 3TFCA 3AZTA 4N02A 1ITQA 3CZEA 3ABZA 2PD9A 1SW0A 2GVGA 1OM0A 3WBYA 1V3JA 1XBVA 3VCCA 6REQB 4OHQA 3CJPA 4PZVA 3CZGA 3VM7A 4GINA 2VP8A 1X6NA 4L1WA 1A49A 3HGOA 4M6PA 1POKA 4WGHA 1KM6A 1KM2A 4QG6A 5K4ZA 2PDNA 5AHNA 3GD6A 2J74A 2WLZA 4JTJA 1TRIA 2PODA 4Q8WA 3UZZA 1MW1A 4LF2A 2PA6A 3TQPA 3USBA 5FF2A 2YL5A 4HMDA 3PUOA 3S6TA 4GX9A 5LHFA 5HR6A 3LCWA 1LL7A 4W88A 4V2XA 3TYCA 1GUVA 2F38A 2X30A 4O54A 5HMEA 2X42A 5C2CA 3URBA 3B97A 4AZCA 1VBGA 3RRXA 4JHOA 3L68A 4YYFA 1I0DA 3H7UA 2Y88A 3CAVA 2CLIA 1UKQA 4A3QA 3MMWA 3TX9A 1LL4A 4IIDA 1K1DA 3CUXA 1Z69A 2PTDA 1EIXA 4AZIA 4REQB 5F4WA 1YPIA 2G0WA 5CZ0A 5EMJA 3BCDA 4OV4A 1XWYA 1FUYA 3PZMA 4HPGA 4S2CA 4O13A 4UTWC 3FA5A 4NZ3A 3RPMA 3VE7A 2A3EA 3OG3A 2WQDA 2XVLA 2J7EA 4U2ZA 3VIMA 3B9OA 4J9JA 5D2YA 1B9BA 3VOCA 4D72A 4MNKA 2P76A 3RLUA 5FIPA 1E9LA 3K4AA 1H11A 1U33A 2D1ZA 1AW1A 3AMKA 1XKYA 1XRFA 2AQWA 4QEEA 3PN8A 2PC4A 1EWDA 1PUDA 3MJYA 3ZSTA 3ITGA 3O0KA 1E1EA 3N13A 3GTNA 4KH2A 2ZX7A 4E2BA 3A6OA 1CENA 4LBSA 3BL3A 4ROPA 4Y90A 1TPH1 1SMDA 5D4YA 1SZGA 1OIFA 4DJFC 4ROQA 2J79A 3LHVA 5A1AA 2J88A 1FDZA 2YDSA 1R7OA 1WNOA 1ZBWA 1FH9A 1E4NA 2VR4A 2PUZA 2VELA 1XW8A 4WOZA 4CUCA 1JNDA 2PCQA 1ME7A 2ZZ3A 1GVRA 5A6TC 3M44A 1O60A 4CQAA 1M5WA 5G1TA 3DHDA 2WM1A 3U3HA 4AXKA 1N7KA 4H2HA 2E3ZA 5A6KA 3I3DA 3VOGA 2DZSA 4JICA 1IXOA 2BVWA 1NP0A 3W2KA 1TV3A 4D8AA 1CGXA 3N9RA 4NNAA 1F4AA 1GT8A 1GPWA 3G3DA 1SO5A 3WLSA 2PAJA 5F2GA 3KL0A 4Q22A 1DXEA 3GXIA 3SUWA 4DBEA 1NH6A 4UFKA 5FJTA 4JY9A 3PB0A 3UJSA 5HJXA 2AL2B 3ERPA 2B4GA 1F5ZA 1NDYA 5I3DA 4FNSA 4UMCA 1IGSA 2GVLA 5A2AA 3B06A 1BEUA 2PDQA 3S47A 3SAZA 4H4IA 4CQCA 1QK2A 1V6YA 4EE9A 2OLAA 1TWDA 2HTMA 4HNVA 1E15A 3TH6A 3S1VA 5LA2A 3O06A 2XFWA 5CAKA 3ZT6A 4QE1A 1YTDA 1H41A 4TVCA 3WENA 1KFJA 3SZ8A 1EGVA 2OJPA 2BXZA 3KP0A 3CT2A 1UR2A 1IZKA 1KBKA 1AK5A 2NXGA 3TTOA 2VZTA 3B9DA 4JFWA 3T09A 1MDRA 3W6YA 3CQKA 4PBGA 3M16A 2BY3A 1UZ1A 3FNDA 4PCSA 1GQKA 4I90A 4Y8FA 5ABFB 2DSWA 4FP1A 1JUBA 4O1AA 3FHAA 5EL1A 2ZXQA 3N17A 3BURA 5FESA 3NO3A 1M53A 4Y6GA 2ZXBA 3UJEA 1OCQA 2JKAA 2CIPA 5D30A 2HEJA 1EH9A 1A5SA 3OYZA 2I9EA 5F4SA 3W81A 1LLOA 3BJTA 1XYBA 4O8AA 3F2CA 3KTCA 1ZENA 2GUUA 2E40A 2I5GA 3BICA 4Y7EA 1SQ7A 3TDFA 4K6AA 3SADA 1RK5A 1TWZA 3R4IA 2OB3A 3CZJA 4JCMA 1VBJA 1F8IA 2VOTA 1IHIA 3CWOX 1R3VA 1A0EA 4JTEA 1XYMA 1RP8A 4XAPA 2YKKA 1A5AA 4JTGA 3HBLA 3AHTA 1TPFA 2YGYA 3WQ5A 4E4UA 2VC5A 3LCHA 1BAGA 3GVQA 3ATZA 1SPQA 1YTKA 4IP5A 2WMIA 4O50A 1FY6A 3VIPA 1W31A 1W8SA 4ACZA 4HT3A 3N6QA 2PTZA 3N9SA 2WZIA 1TB3A 3HJEA 5E09A 1KBBA 2XIMA 4DYKA 3SFWA 1PPIA 1HJXA 4EF9A 4AFYA 1W9BM 2VEKA 3QN3A 1MUWA 1ZPTA 4J2MA 4MFEA 2ODOA 2JFEX 2I57A 1FWCC 1X98A 3R10A 4RNIA 3B8SA 1VLWA 2QVHA 1R87A 2VHLA 4A8RA 3W75A 3MI6A 1A0CA 4D6HA 3RGTA 3MUXA 2O56A 3QHMA 4LV9A 1TUXA 3ABXA 5BRPA 1S2UA 1B2YA 1F3EA 1HVXA 5CGQA 2VVSA 1JXJA 2O0TA 3B05A 1M7OA 3EB3A 1O66A 2PU0A 1QI2A 2G37A 2QCLA 4ZENA 4E2DA 2W27A 1VC4A 3ZO9A 4N6EA 3VD9A 1WZKA 2VWSA 4DEFA 3LBCA 4WKAA 4R27A 2XVPA 1TMQA 4NAFB 4J5NA 3LM7A 3QYSA 1GNXA 3NVDA 3RMJA 1FKXA 2WC4A 1V08A 4HVXA 4ZQCA 2QMKA 4N0RA 4XTDA 4LBRA 3IV3A 5BRBA 1C8QA 3N15A 1E3ZA 1MRQA 4GYPC 4JOMA 1MMFA 3AXIA 4GI8A 1H2JA 1TWSA 4CN1A 1U5JA 3HPXA 1FWBC 2OEJA 3VIOA 3GR4A 3MHGA 1J2BA 1RY8A 5GJMA 1QO5A 4WHBA 2Y7EA 3PBGA 4UTMA 2D20A 1K02A 3O8AA 1SFTA 1ZNNA 2NV1A 2VFFA 2XG9A 1KXQA 3TC7A 3A3WA 2FZDA 3ELFA 3EMCA 5D9PA 5BXRA 4KCUA 2I56A 1UCWA 1G94A 1H5YA 3LENA 4PUNA 1YDOA 5MHBA 2O9OA 3AMDA 1GW1A 4IG2B 5DELA 1G9HA 3LZ5A 4I9TA 5RUBA 1R8LA 4ZQMA 4JTKA 4KW2A 3HN3A 2VUYA 2WHMA 4GXMA 4Y9AA 5ABGA 1YBQB 4M19A 4GJIA 1W54A 3EYPA 4PFHA 3FJNA 1VEOA 5CAHA 2FHFA 1PTAA 1PYFA 1UD2A 2GYIA 5KZEA 4QJ4B 3DX5A 5A2CA 4M1BA 3THQA 1ONRA 5C0QA 3MMDA 4NJHA 4NUWA 4L4MA 4F0MA 3UG5A 2ZUWA 1F2JA 3ITOA 3SN1A 4IICA 5EY5A 3VABA 1GG0A 2X05A 1TV5A 2W66A 2WSPA 3AS0A 5REQB 4GVHA 5HUPA 4AW7A 3PVFA 1UYQA 3GFYA 5FEZA 1XYAA 4LTSA 4FLOA 1PO9A 4JS3A 2NV9A 1BXCA 4Y9PA 3JVAA 2YA1A 3TTYA 3ARVA 2Q3RA 1BRLB 1EPXA 2RAGA 2VFDA 1C7SA 1WYIA 3OBEA 4E8GA 1KV8A 2X8RA 4GBUA 1C92A 2BS9A 1DWJM 3DHFA 3BXWA 5EU9A 3CUFA 3E3HA 1QT1A 3WMBA 4MUPA 3F5LA 4WY0A 4EP8C 1JG9A 2PP0A 1A5BA 2P3ZA 3UR7A 3VKKA 1B30A 6ENLA 1IXNA 3GBDA 3DHPA 3E0FA 4CD8A 4CU8A 1PIFA 1E0VA 4FXFA 1VS1A 2XVGA 2W62A 1VBHA 3PUGA 1U22A 3CXOA 1EHNA 3QPYA 2PWEA 1DTUA 4RXFA 4E4PA 1EJWC 3E96A 3VUPA 1JGMA 5HAOA 2Z7KA 4KERA 4W4QA 3AIWA 3DFNA 4HYRA 4HCHA 3K4DA 1HNYA 3BK0A 3K8KA 5A5WA 3BV7A 5CPMA 5HQEA 4KCVA 1YTEA 4ATDA 4WX2A 1KQZA 4X9YA 3UNTA 1IWAA 1XBYA 2XWDA 2YA0A 3TQKA 2R8WA 1Y8BA 4OBRA 2C16A 4IL0A 4B3KA 2W79A 4WSJA 1MNSA 4GA8A 1KWKA 3I6EA 2EQDA 3HG5A 1PS9A 1CGYA 3LSCA 3N6JA 5DBTA 4MHBA 3KBMA 2NSOA 1W6TA 3E9AA 4PEKA 3PJXA 1JEZA 3B4UA 1TRDA 1IEIA 2TSYA 2PI6A 5LIKX 1W9UA 1W3IA 3H7VA 3WNLA 3NYDA 4Z1CA 2ZZ5A 4AF0A 6REQA 4ZSTA 4QEHA 1P1XA 2Y1HA 3I4KA 1TTPA 3UR2A 3GC4A 4PTWA 1D3GA 1EF3A 3CH0A 2YCEA 4HHPA 3L0KA 1OX4A 4LX4A 4BF9A 3N12A 3NZGA 1RJQA 2C3ZA 1D8CA 2ON3A 4HB7A 1DJHA 1M7JA 4EANA 5BROA 1R9ZA 5BXTA 3UNDA 2TRSA 4CD7A 2WVTA 2WMHA 4O17A 3TAKA 1TIMA 3FYYA 5HJLA 1ISYA 2GSHA 1JI1A 2JIWA 4NT0A 5M1TA 1QNVA 1XRSA 2NSXA 5I6SA 3OPSA 1GVYA 3GZ3A 2WSRA 1SJBA 1FHVA 2PGEA 1VPXA 1XXXA 2J25A 4LEQA 2ZRZA 3VCNA 2FZ9A 3GH7A 4JQ4A 4RZ5A 1PL9A 2VM8A 4REQA 4XZHA 3CT7A 1MZRA 1XLAA 3UWUA 1MUCA 4AD2A 3C0LA 4JIEA 3ZIZA 3F4DA 3N2TA 1GQLA 3S2JA 3WLOA 4DUVA 2PURA 2V67A 2EEXA 3VDCA 2NQ9A 3W84A 4UIOA 3TC3A 3PF3A 3NEHA 4K3ZA 1Z6KA 1UWRA 1Q4NX 3WF1A 3L12A 1XRVA 4C1NB 3KOXA 4FS9A 2X7WA 3UCCA 5JU6A 1FWGC 4NVTA 2GJXB 2WV8A 2HPIA 4B4HA 3A5FA 5D8ZA 2YOCA 4LUTA 4Y2WA 3FYPA 4H41A 2DJLA 1NOWA 2C71A 5FF3A 4KEVA 4H9VA 1LM1A 2P0IA 4O28A 4LB3A 4JL2A 3BJSA 4J2PA 2XVNA 3L5AA 4Y96A 2NX3A 4BEUA 2ZVRA 4AD5A 4GMEA 2B31A 5A6LA 4DLFA 3ITLA 2PB1A 3N29A 3NUKA 5F2LA 3OHMB 3SJNA 2ZUVA 3RXZA 3LEPA 4NU7A 1H7NA 1W5PA 3SCNA 4QCEA 2V6AA 2I14A 2ESCA 2W92A 1YW1A 2XZ7A 3TE9A 3VIFA 3WQDA 4ZTXA 5T9CE 3MWCA 3GNXA 4AX6A 3HV9A 3LI1A 5DQPA 2TMDA 5TD4A 3PULA 3TXVA 3DESA 1VJZA 4JN7A 4GI9A 5AYZA 5IBXC 4C6MA 2D2JA 3IEBA 3UESA 3G3MA 3PBMA 3VNIA 1JPKA 1DQUA 1SW3A 2Q01A 4DJEC 1XC6A 3LB0A 4PGLA 3CYJA 4BWLA 1AQFA 4JTHA 3UY7A 4EWJA 3A4JA 3OTRA 1KD0A 1VYPX 1VBRA 1P6WA 3HPAA 2AL2A 4DF2A 3LTSA 3VKJA 3WBWA 1Q8JA 4MKSA 2J8TA 1ZAHA 3MSDA 3CMFA 5H6HA 1UUOA 2OO0A 4MLJA 2V82A 4AY8A 3D47A 2YZ5A 1S38A 3FXYA 1E73M 1ALDA 3UZWA 4IPLA 4R3UA 1MXGA 4ZXOA 1J6PA 5CLWA 3QXBA 5HOSA 4TV5A 4IIGA 5ABEA 1V5XA 1J01A 3QFWA 1Q6RA 4XB3A 5FAJA 3GY1A 2BOFX 2VENA 1JZ8A 2YL6A 1AL7A 3PANA 4DJDD 3W7JA 4US5A 3DXIA 4W93A 1BTCA 5BCAA 1W3TA 1EA9C 3MZ2A 1QPOA 4IISA 2OPJA 3V75A 3IIVA 1UZDA 1BWLA 2H3BA 4Z0SA 3SBFA 1B1YA 3MA8A 1FWAC 5G4HC 4U33A 3QY7A 4S1FA 4R34A 3AHYA 3V3WA 2E8ZA 5DMYA 4YIWA 3AMLA 1QW8A 5C9ZA 1OF6A 1XV8A 3QRHA 4L6OA 4JIRA 3RX2A 4DYJA 4F0KA 3OB8A 4Z2JA 3B0YA 1GVEA 4ENLA 4DZHA 1YXCA 4KGJA 3OZPA 4PEEA 4GNVA 1ZCCA 5AHFA 1G5AA 2HISA 4AHOA 3CNYA 3OEXA 4C60A 3MBFA 4LY8A 4KIRA 3BAXA 1B3ZA 1UA3A 1JAKA 1HKVA 4M24A 3C2EA 1E71M 2QAPA 2VI0A 4PA8A 3G77A 2E7FA 1YMYA 3WDPP 2Q8LA 4HHMA 4ZOCA 3IIXA 4FK9A 3R11A 4CNNA 1TPVA 3PM6A 3W7EA 2CWXA 3PPCA 4KETA 4E6MA 3M43A 1WXZA 4TVUA 4CNSA 3U2EA 4S3CA 1P6BA 3WLLA 1ZUAX 1LRNA 3TWAA 2JEQA 2G3JA 1CPUA 3GVWA 4EPBC 4AVFA 1Q6FA 2C0AA 4WDXA 5MKGB 4MDOA 5A2BA 4HHLA 1UH4A 5DN1A 3WDHA 1QAPA 1P0KA 1AD4A 3EXTA 1GVFA 1DIDA 2OT1A 2WNNA 2CKRA 4Q3MA 4HU8A 3C3UA 3RAOA 4NAFA 4C1KA 4KEMA 2PWDA 3VX1A 4S3JA 1XICA 5DLCA 4ZEPA 1GYNA 4HNUA 3ZVIA 2NX9A 4PTXA 5HQMA 5LXEA 1MZHA 2PGRA 3N4FA 1SMAA 4NXSA 1G4SA 3B8WA 1CXFA 4GI4A 2YL8A 3LZ3A 3HG2A 2YDAA 3K2GA 1FCBA 3I6RA 3C0SA 5CC5A 3E38A 4ADTA 1B3WA 2PDMA 4Y9NA 3FJLA 3FGCB 3LLFA 3BOLA 5FJOA 2EPOA 3T78A 1XCXA 4KWOA 1W1YA 3QQ1A 2E5BA 2BXVA 2W63A 1M04A 4DB7A 2Q3OA 1R38A 1QI0A 3C8NA 4PMXA 4H8UA 2QCFA 4IG2A 3WQPA 1M7PA 3SCTA 5T9BG 3UG4A 2OGYA 1UP0A 3GHTA 4I6VA 2J9YA 3WUBA 2OWCA 1H1YA 1LUCB 1HP4A 1YBQA 3O07A 1XLKA 4R7OA 4P7LA 1V3HA 2HNEA 3KCOA 5CPSA 4ZO7A 4BWLC 1XP3A 1L6YA 3U6WA 1QFEA 5DMLA 1VBUA 3B03A 3NQFA 5I00A 3VVGA 4HN8A 1QDSA 3OOQA 3GDKA 4EPEC 4FX6M 3FSTA 4XSLA 1XIFA 1R3YA 1LZOA 4EACA 2PWHA 1EO7A 3TSBA 3NPWA 1YE6A 3LQLA 2ZRUA 5BRQA 2QVNA 1UPMB 1ZS2A 4ERAA 8XIMA 1NEYA 5FD0A 2WSQA 3GVGA 3WK1A 1T40A 5DCBA 1HKWA 3GIYA 4OGZA 2BNJA 1H7PA 3DERA 1DVJA 3I7SA 4NAEB 1S2VA 3IK4A 5C2XA 1TTIA 3UWZA 5EFFA 5KMYA 4O1FA 1EHAA 3GNNA 2HCVA 1SM9A 1E6SM 4QTGA 1B3YA 1IEVA 5D9NA 3ID7A 3EWYA 4LAZA 4NILA 3E0LA 5FACA 2QCDB 1OB0A 1Z8AA 2QUUA 2W6RA 3QTGA 1FWRA 3KX6A 4ERIA 3B0VC 3ZLGA 1IT0A 1VHCA 2BWGA 4HK6A 4FPSA 4ILSA 3CM4A 4AMCA 3TCSA 4XZBA 4E2OA 3URQA 1QPKA 2PEVA 3K5XA 1J0HA 2F9RA 3KHJA 2ATMA 4PUDA 3CTLA 2NLIA 3IRSA 1EF2A 5CSRA 4P7NA 1W3KA 1OFAA 4PRRA 3V0TA 1XLFA 1Z9AA 3AYSA 3F1QA 3M0YA 4O0ZA 5XINA 1C8VA 4MY8A 3IVTA 3C52A 5HNRA 1UIPA 4HJFA 1JCXA 3GDBA 3UG3A 1XGDA 3OA5A 2OSYA 1W9XA 4M0XA 2CWNA 4KEUA 2XIBA 2Z2UA 1XYLA 1A53A 2GJPA 4JBRA 4ATWA 2DDXA 3BCFA 5LGXA 3RJYA 3FN9A 5JIPA 1CGVA 4G7FA 4AWTA 5HA7A 4A8LA 5EFDA 3WYZA 1NIUA 1E6PA 1JYWA 2BODX 2FJUB 1OX6A 3LHUA 3L4YA 3NDYA 3T55A 4O19A 2J6VA 2G4JA 1UP3A 5DY2A 2FTWA 1K77A 3ITYA 4GYJA 2X1TA 3P61A 3TLLA 3DC0A 4QG9A 3OU8A 2ZX8A 2BB0A 1AODA 2F6XA 4G1KA 3HMCA 1HXJA 2JF7A 1M65A 5HBFA 4UR9A 2XSXA 4JQ2A 4XO7A 4ATLA 4HOWA 5FJJA 4DO4A 3ZJ8A 1TTJA 3CC1A 3A4WA 2FHBA 1KGUA 1DIKA 4LVBA 1Y5XA 4NRSA 1Q6QA 2CNCA 5C5YA 2VWTA 1A3HA 4PCPA 2QLYA 3BLEA 4HYWA 2A3BA 1XLDA 2QV4A 4GOAA 3WBAA 1TMHA 3M64A 3VMOA 4WXZA 3E2RA 1R85A 2JKPA 3H4GA 4FNQA 2VVNA 1A5CA 1NAL1 1SJCA 1L8PA 3CAQA 5AKQA 2FVLA 2WW5A 4WKFA 3V18A 4AZ7A 4FALA 4AEEA 3M41A 4NZ4A 1G69A 1O68A 4XO6A 4GH1A 1JCTA 3B9AA 2XM2A 3KE0A 3L23A 3VK5A 2I5IA 4FF7A 4EOUA 3T7VA 3CMJA 5EPDA 3G1AA 1Z42A 2AOSA 2V68A 3O6CA 2FH8A 1DJWA 4POCA 1M3UA 3EEZA 1J96A 4QITA 3W7CA 5AN7A 5A8QA 1O4UA 3Q58A 4Q8UA 1F6YA 2WAGA 4FAMA 4E5TA 2XJ7A 4Q8TA 3W2MA 2D24A 3QV9A 1KFBA 2CLFA 4Z1AA 2X40A 1K8CA 3PWIA 3W0KA 3NAVA 4LQ1A 4MJZA 4M6UA 5HNTA 4GXWA 2VFGA 2G5WA 3DKJA 4KWWA 1VD6A 2WB5A 2V63A 4D6GA 1GYLA 1QXLA 2CBVA 4NY2A 4XUGA 3GG1A 4PSPA 1US3A 4YNGA 1QNQA 3VNJA 3R43A 1TFVA 3W37A 1O1ZA 3AXMA 3UCQA 3TYEA 2BX7A 2KX9A 2CCRA 3K30A 2Z2BA 2WPGA 4B5WA 2JALA 3QTPA 3QR3A 4IFRA 2P10A 5A8NA 3KHDA 2BGSA 2Y5EA 4O12A 1DBTA 2E9MA 1KV5A 4HIBA 5D37A 3BANA 1MQRA 1CECA 2VDHA 4W5UA 4LJ3A 2OWXA 3GU9A 3VZXA 1ZZMA 7REQB 4NYYA 3GDTA 2WCSA 3CHEA 1K9DA 4BQ3A 5HWNA 4JTAA 1KM3A 3P8IA 1FBAA 3IJIA 1BYDA 4LUSB 4ZB2A 4DXVA 1V7AA 3AWOA 3EPNA 4EAYA 1EPVA 1R9XA 5FSEC 1WZLA 3WQVA 4GC4A 3ECQA 3QFEA 1E9YB 3AMGA 3SQMA 4TR9A 4KRUA 3VTRA 3C2OA 2E9LA 4AHQA 5EB8A 2CZFA 1SFJA 1G0CA 4GH3A 3WH8A 1JFHA 1LYXA 3FA4A 1Q2SA 1QO2A 3N73A 1EJSC 3T0DA 2VDGA 2HWGA 3PC0A 4LSBA 3I65A 3BLKA 4FF5A 3UQNA 4WOQA 4R5EA 1OC5A 4IQEA 3STEA 1ICQA 5G2WA 4K8HA 3N6HA 3GDLA 2I17A 1P48A 2Z7GA 2DU2A 2ABBA 4JIPA 2Q6ZA 1QNPA 4F48A 3A47A 3MY9A 1E0XA 2FVMA 2NWRA 3SW6A 2GGHA 1EYEA 4N7QA 3S5SA 1YXDA 4UZUA 3NQ7A 2EG6A 2XYLA 1HGYA 1RQBA 5M03A 4B9YA 3SY5A 2GQ9A 4OVXA 2DIEA 1JUEA 3MO7A 3CV6A 3PP7A 3DOPA 3N4EA 4PUUA 4E8DA 5HDRA 5FJRA 4LVAA 3RCMA 4WDTA 4QBXA 2ZRVA 2ZA3A 1JR1A 2C7FA 4IF2A 2NQ5A 1FWTA 2TODA 5EMMA 1WDPA 3NWRA 2YDRA 2JE8A 1ONEA 4S3KA 4C6OA 1N2VA 3M0XA 2BHZA 1EKOA 2ZQ0A 3G1HA 3DFYA 3PUDA 1Z7AA 1OFDA 2PDHA 3HGRA 3KUMA 4LPCA 3FEQA 3CEPA 2QXWA 3A22A 2PDIA 1FVPA 1D3HA 1ZJAA 4PH6A 2YYTA 3W1NA 1GKRA 2FKPA 1TE1A 4MWAD 4C6JA 1VCFA 4LB4A 3GXNA 3LK6A 3P80A 3TP4A 4R88A 1D7KA 3MI3A 4MKVA 3Q67A 3CHDA 1WKDA 4UQAA 3MP3A 3WD3A 4YMZA 1PZ0A 2JBMA 4O10A 3PBWA 4US6A 2GJNA 4OBTA 4ZO9A 1LWJA 2O7QA 2W9MA 1QW9A 3WFAA 3W2LA 1Z3NA 2WM0A 3W74A 5CC7A 4HBKA 1HZYA 1TPDA 2EPKX 3IJ8A 4NI8A 4LS0A 3S9IA 5U7SA 3MSYA 1U5VA 3AYTA 4UQCA 4V28A 2Y70A 5MKGA 1T99A 3II1A 2YLLA 3GM8A 3GHSA 4YTRA 3TSDA 1OC7A 3E2QA 1J6OA 1EXPA 3WL1A 1MO0A 2E4TA 1JCLA 2XDFA 4FOJA 3UF9A 1KBLA 4HD5A 1R2SA 1W1PA 4RL3A 3WJXA 1QVBA 3NZQA 4LAKA 3AJ7A 1CXLA 2GQ3A 1VFUA 3RLVA 2O9PA 4ZOBA 3W9ZA 4R33A 2YIHA 4L9YA 1ENUA 2WBGA 4F8XA 5F2MA 2ZUSA 4MJMA 1CCWB 4U2YA 1V6UA 4PUWA 4IQJA 1HL9A 4RK8A 5GQBA 4Q8VA 3KEHA 4KWVA 1CTNA 2PZ0A 1FFQA 3W53A 4GE8A 4U5IA 3G6LA 1W5QA 2FDMA 1KXTA 5CBIA 2C18A 1JYVA 2PGFA 3WX7A 1VF8A 1FWEC 1C90A 2DIJA 1XPYA 4UTHA 3DAQA 4WR3A 3KOFA 4XKMA 3TQVA 2PDLA 1W2PA 2PS2A 3P82A 3CBWA 2R24A 5LNVA 4ZSUA 1TVNA 3TMLA 2A2IA 3NQ2A 3LM3A 1S5NA 4XSMA 3U2CA 3SIZA 1O95A 1V0KA 4R9OA 4IX2A 4Q8QA 3IV8A 2FGLA 4DBWA 3GK0A 4MGGA 1A5LC 1L6SA 1R2TA 3POHA 3QGKC 3WIJA 2HBXA 1IXQA 1GK8A 4L4LA 1HKIA 2A5HA 1LT7A 1Z48A 2POTA 3FY1A 2PD5A 5ABHA 3WDIA 3HQPA 3DFOA 1JD9A 2ZE3A 1TPB1 2ANUA 1NQ6A 3UEQA 3LBOA 3EX3A 1KTNA 1S2WA 1SZFA 1XF0A 3HURA 3G6MA 3M7SA 3WQGA 4YL2A 2AKMA 4TU1A 3CQJA 1JVNA 1Q66A 2Y6ZA 4P2VA 3EWWA 3SUUA 4ZE5A 2DH2A 4NAEA 4RCXA 3PWAA 2VFHA 4KF1A 3W3OA 4IPIA 3AIBA 4IGNA 2WHLA 2WKGA 1JDAA 3ANYA 3AZSA 1PAMA 2VZUA 3L66A 3WD1A 3AIUA 3VD4A 3WF2A 1A4MA 1T7LA 4HU4A 5EA9A 5K3VA 2QCDA 1NFPA 1FTXA 3ITTA 3N14A 5C70A 1TVLA 2QS8A 1FP8A 2CU0A 2XIOA 1QPRA 1LTDA 2I1OA 3LUTA 3W24A 3G1RA 4P5UA 4Q32A 1DWIM 4ML9A 4QJ3B 1XI3A 3G1SA 3M0MA 4DHGA 3H22A 1YE4A 3R2GA 3FA3A 1EJVC 1TV4A 4U10A 3VNKA 1CLKA 3CQ0A 4GVIA 1FWWA 4PMJA 5D05A 5DBUA 1CGUA 1AW5A 3L4XA 3BMVA 3L0GA 2ZWZA 4ICMA 2TYSA 3P62A 2B81A 3ABQA 2X1UA 2ZWYA 5I5RA 4MWAB 1KRAC 4IIFA 2CLOA 1JGIA 2J7BA 1DL3A 3MMTA 4WJEA 4IFKA 2ONEA 4QM1A 4DBSA 4JX6A 4RPQA 1UOKA 5I3FA 5AFDA 2VX6A 4ZCWA 3QZAA 2GDUA 2BY2A 3R7MA 3UP8A 4BCEA 1R86A 2AGKA 2ZUTA 3DYOA 1TELA 2OKOA 3SGGA 3PZTA 4Z2KA 1XCFA 1XIIA 4WUIA 3HQOA 1SO3A 1PKLA 1V0NA 3AIQA 4RR4A 4IT1A 4W84A 5A6AA 1Y5WA 4UCGA 3AYRA 5CBJA 3TVAA 2PU1A 3MUY1 4H6RA 2Z27A 4JQ1A 5I79A 4NX0A 4PTMA 3MDWA 3MYPA 1OFPA 1JZ2A 1XIDA 4HCDA 1DIOA 4UFHA 3NDZA 1F61A 1FWJC 3IAQA 1HL2A 3H12A 2DP3A 3EDKA 4D6FA 2H6RA 2ZBTA 1E51A 1GQJA 1TJ2A 2WMGA 1LOSA 3UZXA 1K7FA 1A3XA 2DZWA 4A05A 4AH7A 1J0ZA 4IMAA 3GTFA 2YCKX 3VDGA 1TJ1A 4KWUA 1XLMA 2ZYFA 4W89A 5EGRA 2BV9A 4KIEA 3GIQA 2J7HA 5A95A 3QSRA 5A6BD 3CEUA 2QUTA 3S1WA 1G4TA 3BAWA 4XAZA 5M17A 1WA3A 3OW1A 3QV8A 3PZQA 2W91A 3RK8A 4LS1A 3VDAA 2QGYA 1DWGM 1WXYA 4HA0A 4QFUA 3FV9A 1GYMA 2PTXA 2PDJA 1H63A 3V1HA 4MWAE 1IEXA 3W26A 1HJVA 1TPWA 3GTHA 1I2RA 2DT2A 1TZ7A 1JPDX 3FYOA 3H53A 2E8YA 4H8VA 1PHQA 5I7GA 1UD6A 2CBUA 2J66A 1L6GA 5CPLA 1G01A 3QLLA 3BPWA 4XKYB 3EKLA 3UBPC 4NF7A 5HATA 1H5VA 1OIMA 4BZYA 1WDRA 1XFBA 1JI2A 3DC8A 1TV7A 4BI6A 2G97A 4CN4A 4XD6A 3VINA 2F8QA 4L9XA 1OVDA 1TA3B 5ABTA 1PHWA 4LNCA 4Q8MA 2V3GA 1L6FA 1QHOA 3AS1A 3ITXA 4C5YA 3B0PA 2D23A 4GPNA 1VGAA 1VR6A 3TW6A 4XZWA 3EKZA 2DZAA 4JTFA 3E49A 1VKFA 4EXAA 5HPOA 1QOPA 5CCZA 1Q6EA 1TWWA 3UU0A 4EPDC 2HS8A 4GVGA 2PGWA 6XIMA 4JQAA 4FX8A 1O94A 2WZMA 3FDKA 5SWUA 1E9ZB 4W9TA 3USZA 4YVVA 1PIGA 2ZFAA 4B16A 3TTSA 4DJDC 3ICJA 2GOUA 3UFYA 3V5FA 3ATYA 4HZMA 3T9PA 1T0OA 4BS0A