1W31A

Yeast 5-aminolaevulinic acid dehydratase 5-hydroxylaevulinic acid complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
340
structure length
340
Chain Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords DELTA-AMINOLEVULINIC ACID DEHYDRATASE
publication title Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with the Inhibitor 5-Hydroxylaevulinic Acid
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 113
structure length 340
sequence length 340
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2004-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1w31A00
3KRSA 4IXXA 3TMLA 5HINA 4AEOA 3IIVA 2YFNA 4FB7A 3QYQA 3W22A 1HG3A 3B4UA 5J5RA 3BW2A 2NUWA 3NGJA 3LBMA 3MW7A 1DKWA 3C2VA 3CWOX 3G0XA 5F1VA 3U8GA 4K36A 5KZMA 4O18A 5DCDA 1EUNA 3TROA 1UJPA 2WJZA 5KITA 4FNUA 2CZFA 1EA0A 2R14A 2WO5A 1O5KA 3W86A 4HKPA 5D2VA 3GB6A 1TV8A 2RFGA 4K8EA 3W7HA 3MBDA 1H50A 4NQ1A 1YDOA 1T99A 3LHVA 1VR6A 1DJNA 1YPIA 3LRKA 4AVFA 1K8ZA 2CZDA 1XKYA 4FIRA 2QCCA 4UFKA 3A21A 2OMAA 3NZRA 1OG0A 4WJEA 4K8HA 1KM3A 1NVMA 3NQFA 2B4GA 1MEWA 1L9WA 4MYAA 2ISWA 3GXPA 1TJRA 2QF7A 4CNOA 3OG3A 3W7OA 2O7QA 1ZAJA 2A7NA 4MUZA 3OVQA 3QQ0A 5A8GA 4ZQPA 5FF3A 3T78A 2WNQA 3HPSA 3ZWSA 3A22A 1AMKA 4GUJA 4N6EA 3PUDA 3CTLA 2E77A 4ZQNA 3TSBA 1XL9A 3W1MA 6TIMA 5D30A 1J2WA 2ZCGA 2ALDA 3N73A 1ALDA 2XN1A 3L5MA 4Z0SA 2IQTA 2CZ5A 2C14A 3OEXA 5G2HA 1A5BA 2Q8LA 5HJLA 4AH7A 1O95A 3DZ1A 4XBSA 1A5SA 1KM4A 3HGSA 3NDOA 2UV8G 3H54A 4WOQA 2NV2A 3D0CA 1EP1A 3QW4B 1SW0A 4BWLC 3MI6A 4HNTA 2VEKA 2C1HA 4JDBA 1Q3NA 1DBTA 1GWJA 1F76A 3A5VA 3QFEA 4GWEA 4YCPA 3S5OA 1W3IA 1ZCOA 4K6AA 3TE9A 4Y96A 3NQGA 3LCGA 3W07A 4BF9A 8TIMA 1Z41A 1TPB1 2XN0A 4DPPA 3CT7A 3S9YA 1NAL1 3LB0A 2VC6A 1PHWA 3GK0A 1JUBA 2TPSA 5D37A 3W87A 4JTHA 1BWLA 2EHHA 4LS2A 4FNSA 4MJMA 1SO3A 5FEZA 2CLMA 3TQKA 4X22A 3OVRA 2VFIA 4LV4A 2YXGA 1TV7A 1B3OA 2G97A 3LV6A 4YCOA 2WSQA 1JJKA 3FLUA 3CPRA 3O1NA 4Q4KA 1BEUA 4O19A 3TC7A 4LUIA 4FIQA 4UIOA 5I3FA 2CLFA 3RK8A 2H6RA 1QPNA 3UXAA 1QFEA 3G22A 4PTNA 4RXGA 5G5IA 1YTDA 1H7WA 5IBXA 2QEZA 4GE8A 4JTTA 5AHIA 3P60A 5U7SA 3LXBA 4S2CA 3TQ0A 3NPVA 3BARA 1ICQA 3W23A 3NL5A 2QR6A 1F7BA 3S1WA 1B9BA 3S0CA 5H91A 2Q3OA 2C13A 5AYYA 3QPZA 3ABOA 3O6YX 3S1UA 2X2GA 3TDFA 3LTPA 2BZNA 3FKKA 1EWEA 3L0NA 4WZHA 1TPUA 4TO8A 4IQLA 3OA3A 1YXDA 3I65A 3MJYA 3R5EA 1KFCA 1FWRA 2C15A 4GUHA 4HPJA 4K38A 3S1XA 1D3HA 3LHTA 3P81A 3PBVA 5HWNA 3WK0A 2J9XA 4B5NA 2P1FA 3FKRA 4YL2A 4I7VA 4XZ9A 3GDKA 2QUVA 4YWIA 3S42A 3TJXA 3BLEA 2QUUA 1A50A 5D04C 2GVLA 3TIMA 3G1FA 1WA3A 1U83A 2XFWA 1N55A 4NJKA 3I6RA 1MZHA 1NF7A 1F73A 4MJZA 4ORMA 3UNDA 3LM7A 3UWWA 2GUUA 1TPH1 1GEQA 1OX6A 3G8RA 4JX4A 4TU1A 3W72A 3W7PA 2Z1BA 1TTJA 4KWVA 4A3UA 1OF8A 3M44A 5U4NA 5DCBA 5GVJA 2GJNA 1TRIA 3E49A 1K3UA 3BLFA 1GG0A 3NQVA 1DJQA 3UWZA 3GX9A 1G7VA 3L5AA 3V75A 5LZLA 1XFBA 1VYSX 1CI1A 3UWUA 3HG3A 1W8SA 3VI2A 4H3DA 3GR8A 3UY8A 3WJWA 2CZEA 3LCFA 4FX6M 1UB3A 2PE4A 1TPC1 4HHPA 4L4MA 2FFCA 3W2KA 1LP6A 5KZDA 3G1YA 4J9JA 2YR1A 3DFTA 2GOUA 2QJIA 4LOCA 3KXQA 2CLIA 1QCWA 3KRUA 2WNNA 1ZAHA 3PC0A 4O1AA 1PE1A 1R2TA 4BI6A 1W5MA 4JS3A 3C4UA 3G1DA 2CU0A 3EKZA 1KFEA 4HT3A 3L65A 2G5WA 3NNTA 4A2RA 2V0TA 4IPIA 2A5HA 3QM3A 3L9CA 2ZRUA 1KTNA 4O10A 2A21A 5HQEA 4UFHA 3T55A 1M7PA 1F2JA 3GIYA 2I1OA 1W3NA 4E2BA 1Q45A 2C3ZA 4K37A 4UTWA 3GDMA 1LBFA 2A7RA 1Z48A 4JTLA 4IMCA 2GQ9A 3RMJA 2DORA 4JTJA 3EX6A 3DFQA 1VS1A 1DV7A 1W37A 3INPA 3HJZA 3B0UX 1AL8A 3JS3A 1QPOA 4OHQA 4BI5A 3GDRA 5CZ0A 1QAPA 1OVDA 3PBWA 4NX5A 4O12A 4IJBA 4Z1BA 5HNRA 2Y7FA 1VLWA 1TSIA 1AW1A 1K7XA 4UUIA 4JXCA 3OBKA 1H7NA 5C2XA 4Q32A 4FXSA 3A5FA 2Y70A 3H55A 4K7VA 1H1ZA 3DXIA 1ICPA 4K39A 1H62A 1RD5A 3L0KA 3N2MA 3O6DA 4A29A 3PF3A 1NFBA 1QO5A 2HS6A 2GVGA 2C0AA 1G7UA 4E0CA 3P8JA 3DGRA 4R7JA 3HOJA 5HULA 4O53A 1NF0A 4JX5A 4P2VA 1G4TA 4ZMGA 1H7OA 3O06A 4LVAA 3NO5A 1M5WA 1MSSA 1TTQA 4RZ6A 3G3MA 4ONVA 1F5ZA 2EKCA 3W2NA 3UZ5A 4AAJA 1SFLA 3G1AA 1A53A 2AGKA 3WJYA 3TFXA 3NL3A 5TBOA 3TCEA 5BW6A 3L21A 1A5CA 1LBMA 3IVSA 2RHGA 5KZEA 1P0KA 3PG9A 4M19A 3VFLA 1VH7A 4LRTA 1JCLA 3QPYA 2ZA1A 1D3GA 3LHZA 3NQ6A 2OJPA 1X6UA 1LRQA 5F2GA 5EYWA 4O4VA 3R13A 3B0PA 4IMGA 3LI1A 4DBDA 3R8RA 1FWTA 3FYOA 2LLEA 4GRSA 3DFNA 1HFBA 4M6PA 4DBEA 2ZZ7A 3FYPA 4X2RA 3W7KA 1F05A 3C6CA 1RQHA 2O7SA 1MO0A 1YLVA 1LRTA 4UC5A 3W7DA 4BFAA 2X1UA 1TQJA 1KLZA 4UTMA 1VPXA 3FJLA 1OYBA 1VHCA 3O6CA 3R12A 4DF1A 1R30A 3LCWA 3QJAA 4BWLA 2VFDA 3S5YA 2Z2UA 3S5ZA 3BGJA 3KAOA 1LZOA 1P5BA 4JTKA 3QEZA 4FF7A 1TMHA 3B8DA 1X1OA 1XI3A 3TQVA 3IV3A 2JGYA 2ZRVA 4IX0A 4MIMA 5D38A 2A85A 4CLMA 3TW6A 3LX9A 5LNUA 3U2OA 4NJHA 2A1YA 3W7CA 5K2ZA 4N9CA 1T96A 4Y9AA 4IMDA 2ZZ1A 3IGSA 4O11A 4IXHA 2YGYA 4MYXA 4GUIA 3SGZA 1QWGA 4UMAA 4QNWA 1FWSA 1KFLA 1FBAA 3SJ3A 3MWAA 4WXYA 1QMLA 2W0UA 4XBKA 5CZTA 5L6UA 4CCCA 1T8XA 4O0ZA 5CZJA 3DHDA 3P80A 4CCEA 4C1KA 4MLRA 4M7SA 4RR4A 1H7RA 3W7IA 1ONRA 4RJEA 2VENA 1GJPA 4GUFA 3WK2A 3WJXA 1J5TA 2E5DA 4ZQOA 3B0VC 4Z0JA 4D2JA 1VCGA 4ZQCA 4CNNA 1JCJA 4OGZA 3WFAA 4LVBA 3PSWA 4TX9A 3M16A 3Q2DA 2V9DA 2OT1A 3QMSA 1KFBA 3BV4A 1DQWA 3STGA 3ZWTA 4DF0A 3LXAA 1L2UA 1VJIA 1PCKA 5CSSA 4HNNA 4N6FA 1ZALA 3USBA 3ABSA 2YYUA 3NYZA 3FJ6A 1G4EA 5C6MA 1LOLA 1IF2A 2WOQA 5CPNA 2ISSA 1M7OA 1VQTA 1IXOA 1R46A 1TPVA 3KRZA 3VNDA 1CW2A 1IIGA 1SW7A 3RFAA 4HIBA 1BTMA 3N9SA 1GVQA 3GVGA 3CHVA 1DORA 5G1TA 2V2CA 4LVFA 2EPHA 1TTPA 2A2IA 3DAQA 3EX3A 1ME7A 2J6XA 3T44A 1EUAA 5CG7A 4HNUA 1WBJA 5J5DA 4PH6A 2FDSA 3T7VA 3BG3A 1XM3A 4YLWA 1WAUA 4O0KA 4ZVJA 3GKFA 5D2TA 5I3HA 4DEFA 2E6FA 1O5XA 2A0NA 4NXKA 5DBTA 3TA6A 2E1DA 3S8HA 5AOUA 2TMDA 4JTGA 3LDVA 3GKAA 4E2DA 5CPMA 4UFJA 3C61A 1SZGA 4Y6GA 5EKYA 1Q6LA 3W1QA 2F84A 1OJXA 1GTEA 3Q58A 5KMYA 4ORIA 4UMCA 4JD4A 2BWGA 5AN7A 4M6VA 4MZ1A 3IEBA 3NZ1A 3W1XA 3QC3A 2ZRYA 4EWND 2VKZG 1JVNA 1L6YA 2NLIA 3TV8A 4TIMA 2ZRWA 3LHWA 1ICSA 4PEKA 4DPQA 5HUOA 2V2DA 4GC4A 5SWUA 2H3BA 1G67A 3CIWA 2A4AA 2H8XA 5G4WA 3EWYA 3W74A 1FWWA 2RH9A 1YXYA 3M43A 3MHFA 1LOQA 4UMBA 4LY8A 2EGZA 2RDWA 4Y90A 1K03A 2Z6IA 4JDYA 3RU6A 2FPVA 3EWBX 4QQ3A 1TPEA 3DKLA 3CQ0A 2C6QA 3E12A 2B7QA 1EWDA 2RDTA 4RX0A 2DZUA 5FF7A 3TXZA 5DY3A 2J24A 1W5QA 4OE7A 4N9DA 5C54A 4PL1A 3BW3A 4NU7A 4GXMA 1XBYA 3DFSA 1SO4A 1NEYA 3PR2A 3O07A 1Y0EA 3TXVA 1IXQA 4DQWA 2E5BA 3PB2A 2Q3RA 3ZR4A 2Z0IA 2R91A 5EMUA 2OCZA 3EX2A 3L66A 3MI2A 4FEZA 3DKJA 5D32A 1KM5A 1JCNA 1JR1A 3NM1A 3WK1A 4UTKA 1WX0A 4X9SA 1ZHAA 3M5XA 3GDLA 2QDGA 2WSYA 5LNRA 2WQPA 1QOQA 3L0GA 4FX8A 5FI8A 4JICA 5DXYA 2QCGA 4JN6A 3C2EA 2ZRXA 2ABAA 2ATSA 4QSHA 3N2XA 4M5PA 5AYZA 1OHLA 4GFSA 2QCEA 3W1UA 1Q6RA 4O1DA 4OT7A 4JIPA 3TH6A 3HF3A 4LTSA 1TPFA 4EF9A 1I2QA 4JEQA 3THAA 5I3JA 3W7GA 2AAMA 3O8AA 4FNTA 5AC7A 4HNVA 4CNPA 1FDYA 4C1LA 5EY5A 3VCRA 1WOAA 2QAPA 4ZQMA 3BG5A 1F6PA 4UNKA 1ZFJA 1C29A 4WQ6A 4ALDA 3TMQA 2H3DA 1FWNA 1W54A 4Z1CA 5EA9A 4O8RA 3LV5A 3W76A 4ML9A 4UTUA 3GDTA 1I8JA 1DHPA 3LLDA 5F2MA 3RF9A 5F4XA 1Z44A 4NNBA 3M41A 1DVJA 1P4CA 3IVTA 3N14A 3LOTA 4HSOA 4IX2A 1S5TA 5D05A 5G2WA 4NT0A 3IIOA 4AF0B 4JYFA 2JK2A 3LRLA 1SSDA 3EWWA 3GZ3A 4PL2A 5FF2A 1DOSA 5LNVA 2JGQA 1IXNA 3ATZA 3EX4A 4KFPA 3I7RA 4O17A 3NQ8A 2NZLA 1KFJA 3NQCA 2DU2A 3F4WA 1XDMA 4AXKA 1H51A 5K3VA 3CIXA 2DZWA 2W79A 4LVDA 1RVGA 3S6DA 2X1TA 3ZFHA 1GVRA 3LHUA 3LRMA 3O05A 1HO1A 2Z6JA 3BLIA 5AHNA 3DH7A 4O1CA 4PFMA 3LXCA 1I4NA 1W5PA 3CWNA 4RK8A 1F6KA 4HPXA 4CCDA 3C3NA 1X8FA 4TMBA 4DF2A 1RZMA 5AC6A 3MP5A 3HG2A 3WJZA 3G8EA 5DBUA 1B57A 3TU9A 4ZQRA 3PVFA 1VGAA 4JIQA 3W85A 4O50A 3P67A 4O15A 1Q6QA 2ZYFA 1ZJIA 2FB3A 2Y7EA 1TV5A 2FJKA 5K4ZA 1M6JA 1PV8A 2H8ZA 3O16A 1OK6A 2D73A 1K7FA 4N2YA 4NJJA 2NV1A 1AW5A 1EX5A 5BMXA 2BSLA 1SO6A 3LHYA 4LV9A 4BI7A 3FFSA 2YZRA 4UTIA 3NQ7A 5HR6A 5A5WA 4AB4A 1MEIA 1KTCA 3AJXA 4O4WA 3MO7A 1OFQA 4MLJA 1PHQA 3SI9A 1I2PA 4CQAA 4Y8FA 3TAKA 4UNLA 4A21A 1LM1A 1YTEA 3MBFA 4NZJA 3F03K 3HG4A 5AFDA 3V1PA 3IVUA 3W1LA 1TREA 1RPXA 3VE9A 1LBLA 3LCLA 1LOSA 2BX7A 3PM6A 3B03A 2Y6ZA 4I7UA 4QNEA 1LLWA 3DI1A 1KTBA 1AK5A 1ZAIA 2NX3A 3KVLA 4XTDA 4WX2A 1EPXA 2PC4A 3TKFA 2GQ8A 2Y7DA 3WK3A 4W9TA 1O60A 2QAFA 3VKJA 3EWUA 1OYAA 1VHNA 2GJLA 1FY6A 3EWXA 5LGZA 3PUEA 3PB0A 3ELFA 3CLMA 1VCVA 2CW6A 2DZTA 4MY1A 3UQNA 1JRCA 2QCFA 2CLEA 3KHJA 1KM6A 3PY2A 1XCFA 3E0IA 1LCOA 3KFTA 1JRBA 1N7KA 3W83A 3MYOA 2E09A 1K8XA 3PULA 3HGRA 1C8VA 5E1QA 4PODA 2OT0A 3OHIA 1XUUA 1P1XA 4NVTA 4JTIA 4IGHA 3KVMA 3CB8A 3IGUA 1JCYA 1OX4B 3CM4A 3N9RA 1C9DA 1WQ5A 2ZRZA 1XUZA 4E38A 2ISVA 2ZZ2A 3C2OA 2A7PA 2F7FA 4O52A 3MP3A 5HMSA 1LTDA 3UD6A 2NX1A 4JNMA 3I7QA 2V30A 2NXGA 3TX9A 2FLIA 2ZBTA 3LBCA 5DCEA 4CQ8A 1W1ZA 1OFAA 4RZ5A 5HR7A 1TIMA 2A6NA 4UTLA 4FX7A 3HIJA 5LKYA 1H7PA 3TAOA 3RNDA 4U4MA 1YDNA 3BO9A 3DENA 4MPQA 3MMTA 3CU2A 2WKJA 5F2LA 1GOXA 3P82A 3QH2A 1QOPA 1KBJA 3R2GA 1VC4A 1EP3A 4QITA 1Z42A 4JY9A 1HTIA 1VRDA 4LW7A 3GAKA 1IGSA 1BKSA 3C2FA 4FXRA 3LCIA 3BK0A 3W70A 4XWUA 4Q33A 1GVOA 3W3OA 2NUXA 2J27A 3R89A 2W6RA 4WOZA 1KLYA 3MP4A 3NPXA 3EKLA 3EXSA 1I2RA 3NXFA 2J9YA 4UTJA 3WJSA 2PRMA 1J4EA 3KOFA 3LCHA 3BW4A 3EB2A 1KV8A 1TCDA 4R33A 1XBVA 1SFJA 2JKEA 5CGQA 1XBZA 3ABRA 5I3IA 2ZZ3A 3PUOA 1SU5A 1XXXA 3UWVA 1RQEA 1R2RA 1V7YA 2CLKA 2VEMA 4O57A 3EWZA 3T4CA 2QJHA 3QZEA 3NPUA 4DELA 1JQXA 2BXVA 3QSRA 1TTIA 4HN4A 6ALDA 1TQXA 5KINA 3NA8A 3HG5A 3QMTA 4AF0A 4AWUA 1V5XA 1G4PA 3M1ZA 4JYEA 4A2SA 1G69A 2I9EA 3FA5A 3W7EA 1HUVA 5TQLA 3GNNA 2FIQA 4OV4A 4XKYB 3UPBA 2B7NA 3KVKA 3NVTA 3NQDA 4EIVA 1WXJA 4NNAA 1W56A 4WXZA 5BNKA 1XC4A 2QDHA 3NM3A 1LDCA 3TUUA 3L5LA 4LU0A 1UASA 3C0JA 3SZ8A 4UTTA 3G24A 4OBTA 3STCA 2CLOA 1Q6OA 3G3DA 5D03A 5AHFA 1S5VA 2TSYA 3HMJG 2VEPA 4DO5A 3UWYA 4H4IA 2R94A 1FQ0A 1SPQA 3GAYA 3ZS4A 1IIHA 2HS8A 4O1BA 5BMWA 2PCQA 4NUWA 4FO4A 3U6WA 4IPJA 1I45A 4RZ4A 4EOUA 4Z1DA 2WPBA 3AO0A 2V81A 3P84A 4WUIA 4WD0A 2EF9A 5AHEA 2TYSA 4AWSA 3I68A 1VYPX 3F4NA 4KFNA 4AHPA 4NNCA 4DO6A 4LC6A 4ZZ9A 1NSJA 3G0UA 2VFHA 4MVAA 3I7SA 2Y88A 1KFKA 2V5LA 1ME9A 1KW1A 1ADOA 3PSVA 1JULA 4JX6A 5TIMA 1PIIA 4Z1AA 2PRLA 3A9IA 4O16A 5C55A 4MKNA 3YPIA 1KM0A 3HGJA 4N4QA 4O13A 3GR7A 2NWRA 3RLVA 3THQA 2PURA 4JTSA 5LGXA 1FX6A 4UR8A 3L67A 4K7YA 4I7WA 1FCVA 3W7LA 4BR1A 2ABBA 3W88A 2CFFA 4GNJA 4FHAA 3UZJA 3KVJA 3BVJA 1WBHA 4LVGA 5ABTA 1GT8A 4Z08A 3H53A 2KZHA 1W5NA 3EX1A 1FCQA 1U5JA 1WOBA 3FIGA 4JYDA 4AHQA 2CLHA 3SECA 3ABQA 1EP2A 1FXPA 2ZFAA 1KA9F 4M7TA 3TFCA 1B4EA 2I14A 4G1KA 1LROA 4IWWA 5AYXA 2E5CA 3FOKA 4LUJA 1ML1A 3HPZA 4NX0A 3IIZA 1O4UA 4YMZA 1H5YA 1LYXA 3B04A 4IMFA 2DZSA 2NXHA 1PL9A 4KKXA 2YX0A 3P5ZA 3P5YA 4L4LA 4OWGA 2ZQ0A 2Y63A 4CQ9A 3UPWA 1WV2A 4POCA 2J88A 3QF0A 1OX4A 3EXRA 3W7QA 1GG1A 4QM1A 2YFOA 3K30A 2CWNA 2YPIA 3DI0A 3LTYA 1UBSA 3STEA 2Q8ZA 1JQVA 2ZA3A 1H61A 3IIPA 3N3MA 3L2IA 1YXCA 2NWSA 1THFD 2X16A 3PAJA 1FCUA 5G4EA 1QPRA 4S1FA 1QR7A 2VFGA 4JR5A 4NZFA 5HWJA 2ZZ4A 5DELA 1OK4A 2ATMA 3TR2A 3GNDA 5K9DA 3C2RA 3STFA 3OVPA 2J9ZA 2OX1A 2B7OA 3SIZA 1TJPA 4UTTC 4N02A 3L68A 2YW4A 4MFEA 5BRBA 3GYEA 1SQ7A 3DFPA 5FF0A 5F4WA 2BLEA 4R53A 2G95A 1TRDA 1VCFA 5AB3A 1TPDA 4UFMA 1JUKA 3SGUA 2WV8A 1OFRA 2QCHA 1KM2A 1W0MA 4OV9A 3P74A 2NXIA 4FNPA 3LGEA 1HL2A 3W71A 1ME8A 3PS7A 3MHGA 2VOMA 3RLUA 4ADTA 4AHOA 4DXVA 1VLIA 4RXFA 2Y7GA 4QAIA 4UFIA 3W1RA 1CX9A 1O94A 3T40A 1EB3A 1LORA 4JTUA 3G1VA 2FB2A 1R47A 4O28A 3E9AA 3M47A 4EF8A 4O14A 2WSRA 3QSTA 2PRHA 3TK7A 1IXPA 3LCXA 4GUGA 1ZY9A 4R34A 3W84A 3TSMA 5DXXA 3M5VA 4N4PA 1P0NA 4FNRA 3NPWA 5CSRA 3DHFA 1SR9A 1SW3A 5C5YA 2QKFA 3P62A 1SZEA 1JCXA 2C16A 3W7RA 3SSJA 4XKYA 1GPWA 3M7WA 3W9ZA 4LNYA 1YPFA 1YTKA 1UUMA 2V5BA 5HUPA 2QCDB 2HSAA 3W1AA 1S5WA 3W1NA 2X1SA 1OYCA 3TC6A 3A23A 3QMRA 5KTLA 1OFDA 5CPOA 2OZ0A 3PBUA 3ANYA 3EXTA 2B0MA 1ZENA 3W7JA 3BPWA 5T26A 3LI0A 3CEUA 4IOTA 1FXQA 3M5YA 3HPXA 4WY0B 1BWKA 4MY8A 5EPDA 5EBUA 5FEXA 4RKAA 3S1VA 3QRHA 4RV8A 3NQEA 4QIUA 3W1PA 1EIXA 2E6YA 1K02A 5K7JA 4LRSA 4RCXA 2QCMA 2YYTA 1QDSA 1I2OA 3W1TA 1SSGA 1W3TA 2DZXA 2YDAA 3C8FA 1SUXA 4JY8A 3GLCA 3FEMA 1GZGA 3NQ2A 2Y85A 3UYCA 3W7NA 5F4SA 1TYGA 5LNWA 3P8IA 1QPQA 2ZDRA 4JTEA 5L9FA 1FDZA 4XUGA 2JKPA 1MXSA 1L6SA 4OQVA 1KBIA 1OFEA 3NL2A 2ZTKA 3VE7A 5KSWA 4ICNA 3PG8A 2DJXA 1F74A 3C56A 1OABA 4P61A 1SO5A 1N8FA 2RKXA 2Y61A 2VELA 3NEVA 3TW7A 2EAWA 3PWAA 3NAVA 2P10A 1XBXA 2HTMA 4ADSA 1YADA 4EVZA 4GJ1A 3HBLA 5FEPA 1S3HA 1T0OA 5DY2A 3W2LA 4NJGA 3N19B 4XQ6A 3NG3A 4ZL1A 4YXGA 1H1YA 4NJIA 2CLLA 5FESA 2YCEA 1PS9A 3DFOA 5D2WA 3PBYA 1TO3A 4UCGA 3TNOA 3C52A 1X1ZA 5LNSA 3S5NA 3M5ZA 1HO4A 4AMAA 4N9BA 2VXNA 3EEGA 1YYAA 3SY5A 4DO4A 2GQAA 1E51A 4PA8A 3F1QA 4UXDA 4LS1A 1OFOA 1R2SA 1SZFA 2FQIA 3A24A 4PC8A 3UY7A 5IM51 2BTMA 5IBXC 4N9EA 5K4XA 2AQWA 3W75A 3E02A 5E0KA 2G96A 5K9CA 2DZPA 4X3ZA 1MEHA 3JRKA 3FS2A 1KV5A 3P61A 3G0SA 1W5OA 3DBPA 4H6KA 4I9AA 4IUOA 4UTHA 1RQBA 3SR7A 1GVSA 5K9XA 1FDJA 1OX5A 3SW6A 1OFPA 3P7YA 3HO8A 5E93A 3ATYA 3TSDA 3W73A 5AC8A 3IGXA 3B05A 4M6QA 3KX6A 2V2HA 3G1XA 1L6WA 1PVNA 2XN2A 2R8WA 3E96A 5BOOA 2C19A 4TR9A 2FTPA 4LWWA 2QCLA 4S2BA 5MHBA 2X1RA 3BGGA 3W2UA 1FUYA 2YW3A 2ZTJA 2QCNA 4KFOA 1SZNA 3DU0A 5G2IA 3MI3A 5EL1A 2NX9A 4KWWA 3G18A 1JUEA 5LHFA 3QQ1A 5AHMA 1DQXA 3LLFA 1VYRA 2NUYA 5D2XA 1WYIA 1X7FA 1AL7A 2E6AA 5LHEA 3BG9A 1XDLA 3B06A 2B7PA 3SFKA 5DN1A 3O63A 5CPLA 4QJ1A 3OIXA 1OFBA 1H60A 3HB9A 3M0ZA 5CKSA 2Y89A 5I3KA 2GVJA 1VZWA 1LRNA 3NL6A 1AW2A 1PCWA 4TMCA 3Q94A 4MOZA 5AHLA 4ADUA 3W6YA 2HMCA 1QNVA 5D2YA 2QJGA 1KM1A 1YDVA 1EEPA 3G1SA 4HSNA 3CC1A 4XTIA 5I3GA 1ZNNA 1JCMP 2V82A 2WNZA 2P0OA 3W7MA 2DP3A 2FPTA 3N34A 7TIMA 5HWMA 5H2ZA 5D02A 2DJLA 1TPWA 4MFDA 2VFEA 1B4KA 3MHUA 4FNQA 4QISA 4UFLA 4IMEA 3NQMA 3M6YA 1UCWA 3LERA 1GYNA 1GTHA 2ZZ6A 3TJLA 1WDWA 3MYPA 5D33A 2H90A 3G1HA 2C18A 2E68A 3HGOA 1AG1O 4U28A 1UUOA 4OU1A 1TB3A 4LS0A 4LT9A 1GVFA 3NR0A 1DL3A 1RR2A 4LC8A 2QUTA 2VFFA 2ZZ5A 4MY9A 2JBMA 3GXNA 3LTSA 3NOEA 1H63A 2A6LA 3Q37A 3QW3A 3M9YA 1K8YA 4PCFA 5G1YA 2VEIA 1A5AA 1I2NA 2QCDA 1FCBA 3IRDA 3IIXA 4NXSA 3W2JA 1QO2A 3UXDA 4JGDA 5D09A 5DLCA 1GQNA 3HQ1A 2X30A 2RDUA 1H7XA 2DZVA 3MUXA 4UR7A 3CEPA 4UTWC 1W31A 5F2IA 3NQAA 1RV8A 4A22A 2JKAA 2GPTA 4WY0A 4AWTA 4GBUA 2FPYA 4JTFA 1G4SA 1D9EA 3O15A 1G6CA 1LLZA 1OF6A 5F1UA 2V8ZA 5FEWA 5FF4A 2TRSA 2Y62A 4BK9A 3W2MA 4WY0F 3UWQA 2YSWA 2E6DA 4MZYA 2ZA2A 1GYLA 4O54A 5CZSA 1K7EA 4MZ8A 5LSMA 3JR2A 3GXTA 4RLIA
chains in the Genus database with same CATH superfamily
3KRSA 4XZWA 2C0HA 4AEOA 3VDBA 3AXXA 2BASA 4FB7A 3ERPA 1UUQA 3K8KA 3C2VA 3U8GA 2VUYA 3EKGA 3VIJA 1A5LC 3AU2A 4O18A 1EUNA 3QGVA 2J8FA 3TW9A 4AZGA 2J62A 3W86A 4HKPA 5D2VA 3GB6A 1TV8A 1DE6A 4K8EA 4Z17A 1ZQ5A 3TYDA 1VR6A 3R4IA 3QHOA 1YPIA 1J0YA 3LRKA 4AVFA 2AL1A 5IDZA 5J04A 2W61A 2OMAA 1XLDA 3NQFA 4NL1A 2ISWA 2J13A 3EGJA 5I3DA 1NIUA 1TJRA 1NQKA 2QF7A 3OG3A 4MUZA 1VIWA 3QQ0A 1MW1A 4DZAA 1G94A 2WNQA 1O12A 3CUIA 5H6HA 1DE5A 1XLAA 3A22A 4LYPA 3PUDA 1CIUA 2BGSA 2WBKA 3G2GA 4L4OA 3B9DA 1XL9A 1BQGA 3H70A 5CPTA 4PBEA 5I5RA 5IRPA 2ZC8A 3N73A 1ALDA 3C0LA 3QYSA 1NOUA 2F2HA 2OQLA 3C0QA 5ENLA 2C14A 3MANA 5HJLA 2ZUSA 2XH2A 3DZ1A 4JOMA 4CQDA 4U3AA 3H54A 1TKKA 1BG9A 1I6NA 2XSXA 3FV9A 4MG4A 3VMNA 1J5SA 2D23A 1YNPA 2BNJA 4ZEPA 5FD0A 2C1HA 3O6AA 5T8GA 1BG4A 3QFEA 2FGZA 4Y2WA 1B3YA 2V3GA 4BF9A 3ISIX 4B4FA 1SYTA 3CT7A 2DUAA 4AZ5A 3T07A 1C3FA 3GK0A 1CCWB 3UZZA 4JTHA 2WYSA 3UJ2A 4C6PA 5IHSA 4D1IA 4P7OA 1MW2A 1UP2A 3FDGA 1W3LA 4IH3A 5FEZA 3TQKA 1L8NA 4C1NA 1QT1A 4BEUA 1JJKA 2QDDA 3IJLA 1A0DA 1BEUA 4ERAA 1PKMA 5CZKA 4UIOA 1SM9A 4X2PA 2D1ZA 1VBUA 4H8HA 4PTNA 3M7SA 2V5DA 1YTDA 1H7WA 5IBXA 2QEZA 2CKSA 3H12A 4LFYA 3RO8A 1HKIA 3LXBA 3BCDA 4Y7EA 1N8WA 3BH4A 1JFXA 3NO1A 2A3HA 1GGOA 4N42A 1K6WA 1K8CA 3S1WA 4WSKA 5AYYA 3QPZA 1S1PA 2HROA 2X2GA 3QVQA 4IQLA 1MUWA 3I65A 3WH9A 2POZA 1UP0A 3A64A 4C6JA 3KCJA 2WVVA 1YNYA 1UQYA 4K38A 5BXPA 4QBXA 3PBVA 4QLJA 3THUA 1UH4A 5HWNA 2JQXA 4Z2GA 2P1FA 4GI4A 3GDKA 3T1GA 1H49A 1A50A 1J01A 5D04C 3WDPP 4D8LA 3G1FA 1AFSA 2Z28A 1EYWA 2XFWA 1XINA 3R94A 4A8LA 4ORMA 3UWWA 4PUEA 1UD8A 4MNMA 3GXDA 3G8RA 2HK1A 3UESA 2PDNA 3W7PA 1TTJA 5BXTA 6XIMA 2VVSA 1ECQA 4ILSA 3QC0A 2C79A 1ZRQA 3N2OA 4KT2A 3WDQA 1ZTVA 2BVYA 3ZXWA 3WSUA 4MPKA 1Z7AA 2XTKA 3M46A 4ZENA 1GG0A 2YA1A 3IS4A 4AIOA 1G7VA 3V75A 1EX1A 1XFBA 1TZ9A 1CI1A 4ICMA 3HG3A 1W8SA 3VI2A 4B3ZA 1ADDA 2CZEA 3PP7A 2ZC1A 4XISA 1LP6A 5DMYA 1Y8BA 3AMCA 4PMJA 5KZDA 4J9JA 4H9VA 3VGBA 3KXQA 1IEXA 3BSGA 2CLIA 1TCMA 3P3BA 1KRMA 1P48A 3UR7A 4O1AA 2DIEA 1K4HA 3R0DA 4HT3A 1OC6A 3LPGA 3DG6A 4C6CA 4A2RA 4NRSA 1R3SA 4AD4A 4ZGYA 3FGCB 2G3MA 3OODA 2A21A 2JIEA 1KC7A 3T55A 1BFNA 3ZM8A 3PTMA 3G1RA 4K37A 2ZVIA 3GDMA 2HISA 3FHAA 1Z48A 2D2HA 4EPDC 4MWAD 3WF1A 4AIUA 3ABZA 1KCZA 1R7OA 3DFQA 1R3YA 1VS1A 1GZJA 3MSDA 4PRTA 4DJFA 1XF0A 3NGFA 1BQCA 4YJ5A 4L6DA 3T8LA 3GDRA 1EF3A 4NX5A 5ABEA 1OGSA 3VAVA 1Y7VA 4ZA0A 2VCCA 2Y7FA 4WIWA 4WR3A 1AW1A 4CD8A 4UUIA 1E9LA 4JXCA 5DF0A 3H2EA 3A5FA 2YXXA 4K7VA 2OX4A 2EBNA 2XM2A 3N2MA 2KAUC 2ODOA 4EXAA 2HS6A 5KEZA 5JH1A 1UOKA 1DTUA 2C0AA 4BS0A 1JD7A 1G7UA 4PUJA 2O9TA 3DGRA 1M3UA 5HA7A 2PLMA 3HOJA 4O53A 3S3GA 4AG0A 4TTUA 3SRFA 3PK7A 3TN6A 3H8AA 2XDFA 3TTYA 3JU2A 1H7OA 1UR0A 4FAMA 2BXZA 1TTQA 3G3MA 1F5ZA 2ZX7A 2EKCA 4WLCA 3UZ5A 1MXDA 3ZOAA 3IJIA 3WJYA 5HOSA 3CV1A 4XVDA 5TBOA 3WLNA 1YEYA 1KKRA 3SQSA 2VQUA 3IPWA 3VFLA 2ZA1A 4PUDA 1B9ZA 5F2GA 1ZBCA 2ZX8A 4IMGA 1IT7A 3BXWA 5M17A 1UWAA 2LLEA 3LGDA 1PYMA 1HFBA 3Q65A 4M6PA 4DBEA 3FVMA 3ORWA 3ZVHB 2X1IA 5BROA 2XPKA 4HHMA 4YTQA 3SCQA 1Q6GA 5JVLA 4M29A 3W7DA 1TQJA 1OYBA 1CZ1A 3O6CA 1POJA 4F2BA 4LSBA 4HK6A 2Z2UA 4XZLX 1XH2A 3BGJA 3KAOA 3QEZA 7ODCA 1JYWA 4FF7A 3B8DA 4XVEA 3QFWA 4IP4A 5A6LA 3IV3A 4KEZA 1WO2A 2ZRVA 4BY3A 3BJFA 2ZADA 2GFTA 2A85A 3CH9A 4A05A 4JHMA 4B3LA 3ITXA 4V2XA 1O1ZA 1EYEA 4QR6A 5LXEA 4GD0A 2W67A 4H8NA 4UMAA 2YBVA 4PSPA 1B1YA 5CZTA 2SFPA 2P0IA 5A69A 4MLRA 4M7SA 4ZFMA 5JBDA 4RR4A 1K1DA 3ITGA 2QMJA 2FHCA 4G9PA 4S3CA 3RUBL 4GUFA 3WJXA 3KBJA 1H3GA 3BLDA 1BGAA 3B0VC 5BOFA 1TUFA 4B92A 1E6PA 3T08A 4JN7A 5B80A 3PSWA 2VHLA 4TX9A 4H9MA 3PBMA 1E0VA 5FL0A 4ZXOA 4YNGA 1NWUA 4JFVA 2OT1A 5DT5A 2G4JA 3BAYA 9XIMA 3BMWA 1Z89A 1GNXA 4BQ3A 4I6KA 3BZGA 5CSSA 1QNPA 4HNNA 2NQJA 2CYGA 1UR8A 3UVAA 2J75A 1IF2A 4FOKA 1AUSL 3QY8A 5G4HC 1M03A 4DHGA 1M7OA 5FIPA 1M04A 3AIEA 1IIGA 1SW7A 3CMFA 4HIBA 2HJPA 2OOFA 5CSYA 4IFOA 1M68A 5BCAA 2G3FA 1BTMA 5G1TA 4LVFA 2A2IA 2AMXA 3T44A 1EUAA 2Z1VA 5I0DA 5J5DA 2PGRA 6ENLA 1XM3A 3L4VA 4YLWA 3VGEA 4O0KA 4PUNA 4ZVJA 5D2TA 5I3HA 2X8RA 1A3XA 2E6FA 1VB9A 2VL4A 3MY9A 4JTGA 3LDVA 4AYSA 1P7TB 4I5XA 4I8DA 4Y9NA 3W1QA 4EX4A 3KL3A 4JD4A 1GOMA 2NQZA 3QGAC 4M6VA 3NZ1A 3E0WA 3W1XA 4GX8A 2ZE3A 1C90A 1FOBA 1L6YA 2AL2A 4TOQA 2O4QA 4IIFA 4TIMA 3VC5A 3LHWA 4GC4A 5DEZA 3MV01 4ZSUA 2DY3A 2H8XA 3MT1A 4PMQA 4URIA 3W25A 1UD6A 4F48A 3VNKA 4MM1A 1GOOA 2EGZA 1CLKA 1K03A 4JDYA 3EWBX 3CQ0A 2B7QA 3LM3A 2INFA 4RX0A 1RCQA 1P1MA 1GJUA 3CT2A 3APGA 2ZOXA 2PDIA 3GIPA 4TUFA 2VRJA 1NEYA 3PR2A 4DIAA 4DQWA 5CJ5A 2E5BA 3PB2A 1UH3A 1VBRA 3V35A 2OWXA 3E5PA 4C6FA 4FEZA 4GVHA 4MGGA 3V0TA 1OADA 4F9JA 1ZHAA 3WYZA 5ABFA 2QDGA 3L0GA 5FI8A 5DXYA 1PTGA 1VENA 3VZYA 2ZRXA 4U31A 4M5PA 2ZX6A 1Q6RA 3ARWA 1HKVA 4LTSA 4EF9A 1I2QA 1H4PA 1E0WA 2F2KA 4O8AA 3UETA 4LAKA 1PZ1A 1FDYA 2OQYA 3BDKA 4ZQMA 1F6PA 4UNKA 3KOWA 1ZFJA 2IQ0A 2ZIDA 3TMQA 5CH9A 2V5CA 2ZUUA 3W76A 4AQLA 1I8JA 5F2MA 4NNBA 1FFRA 1N2VA 3HM7A 3N14A 3L12A 5G2WA 2PWHA 4AF0B 2JK2A 3AIUA 3LRLA 3NSXA 3L4ZA 3EWWA 3P14A 1JXJA 1DOSA 4HZ6A 4J3XA 2JGQA 5A3HA 3ATZA 3B9NA 4KFPA 4M1RA 4D6EA 1KFJA 3VKBA 1ZZMA 2DU2A 1XDMA 5I00A 4YVPA 5E6YA 4DJFD 3PPFA 1NP0A 2BVDA 2X1TA 1MXGA 1HO1A 1YBQA 5AHNA 3DH7A 4L56A 1WXYA 1W5PA 1SJAA 4HPXA 1B3ZA 3M0HA 1KFWA 2P8CA 4DF2A 5AC6A 3JVAA 3MP5A 5A1AA 3W85A 2A3AA 1C93A 5B7YA 2Y7EA 3QOKA 1J0ZA 2D73A 4N2YA 4NJJA 2NV1A 1AW5A 1GUVA 2J78A 3HA1A 3M4HA 2XG9A 4XZIA 1E4LA 2ZUTA 4MNLA 4TV6A 3VDGA 4UTIA 1QTWA 3NQ7A 4H1ZA 3WIJA 4HMEA 1TV3A 4FLRA 1MEIA 3HV8A 1RY0A 4GCXA 3DCPA 1OFQA 1S2CA 1BVNP 4PEEA 1Q6EA 1YPXA 4L1XA 1OINA 1BD0A 1YTEA 3MBFA 4L9ZA 4UCFA 3PZTA 3FAXA 3NJ3A 2WHMA 1FWEC 4IL2A 4K8GA 1LQAA 5I79A 3W1LA 1TREA 5FJPA 1LBLA 2FZDA 2DUXA 3LCLA 3M0YA 4GLEA 1QI0A 1LOSA 3PM6A 3B03A 1OZMA 3OLEA 4AZBA 2DFAA 3OQEA 1XPGA 2PC4A 1A5OC 4H8VA 3TKFA 2GQ8A 4F3HA 5FSEC 1WE5A 3UZYA 1ZBVA 4MHBA 2WPGA 4NI8A 1O60A 3BE7A 4GQQA 5HMEA 3UCQA 3B8TA 2CERA 3GC4A 3CLMA 3IUIA 1H0IA 2WVSA 2CW6A 3WLMA 1KXHA 4KEUA 3GU2A 1QK2A 4QROA 3LZ3A 1ITQA 1C92A 3WLRA 3PY2A 1J10A 4ML4A 3GH4A 1S46A 5EFFA 4HNCA 2Z26A 4GKTA 1C8VA 3VUPA 4PODA 3VA8A 3OHIA 1XUUA 3B9AA 4NVTA 4OZOA 4HBKA 5E0CA 1OX4B 2WCGA 1XUZA 5ECVA 3L2LA 3ANUA 2J8TA 4PRRA 1D3CA 5EMKA 2F7FA 4P8XA 3BAWA 4O52A 3N13A 4GY7A 5HMSA 2NQ5A 4JFTA 3CHFA 4F0HA 2NX1A 6REQB 2ACUA 4M8UA 2FYMA 3W26A 1MWOA 2FLIA 1NDYA 4RZ5A 3BOFA 4JNZA 2FH6A 1TIMA 4UTLA 4FX7A 2BOEX 1PO9A 5LKYA 2CLPA 3RNDA 4CUCA 1A5MC 1JIBA 3BO9A 2IPFA 2QPXA 2WMKA 1I9CB 1GOXA 1X8CA 3WLQA 1EP3A 1YHTA 3WFZA 2QDEA 4QDPA 2IQDA 3SCWA 3ARRA 3N2TA 4HTYA 5HATA 4LW7A 3GAKA 1SJBA 4Q8NA 3QXBA 1RHCA 3LCIA 4I90A 2XSBA 4Q33A 1XPYA 2HXTA 1GVOA 2JF7A 2X41A 5C71A 1W9VA 2J27A 5AZ0A 1KLYA 2HPMA 1IE7C 4RNIA 2O92A 5BRPA 1XLMA 3EXSA 4UTJA 3SN0A 2PRMA 1MW0A 1E3ZA 1YKWA 3KOFA 3LCHA 3EB2A 1LUCA 1TCDA 3CH0A 4R33A 2MUCA 2FZ9A 1XBVA 1TJ0A 1R3QA 1DIEA 3SCUA 1XXXA 4GIRA 3OGVA 1V7YA 4M24A 1ZCCA 2IKHA 2VEMA 3T4CA 1KR0A 4XX6A 2QJHA 3P6LA 4KH2A 3OVGA 3VDHA 4H6EA 3OGRA 3VM5A 1KKOA 2GK1B 3U57A 1RLDA 2BVTA 4A2SA 1G69A 1U1UA 1HUVA 3GE7A 5TQLA 3GNNA 2FIQA 4XKYB 1ZU8A 2HZGA 3TJ4A 4EIVA 1WXJA 4A3QA 1UASA 3T6CA 3QTPA 3ZIZA 3AZTA 2CLOA 7ENLA 2MNRA 3G3DA 4KWSA 2TSYA 3WLHA 4UTFA 4IFKB 4BHYA 1Z6KA 3UWYA 2YL6A 1FQ0A 5JIWA 3ZS4A 4ACZA 4AY8A 4U2ZA 1IIHA 2PCQA 3APYA 3ZJKA 3IRSA 3SCVA 1W9DM 2QIIA 1IZKA 1VFLA 3GD6A 3EDJA 3AIQA 2IKJA 5AYIA 1VJSA 4KFNA 4LC6A 3H4GA 4I9JA 2WJDA 2VFHA 2WANA 1KFKA 1XLKA 2DSUA 3TVAA 1ADOA 3PSVA 4LUSB 2GYIA 3A9IA 3WUBA 3E3HA 3UF9A 3LD5A 4N4QA 1DJZA 2JF6A 3THQA 1BRLA 2PURA 4CQCA 2XVNA 1X7IA 1V6YA 3GH7A 4R3UA 3W7LA 4BR1A 1JZ8A 3W88A 2CFFA 4GNJA 4FHAA 1ITUA 3OLIA 3RILA 3AU6A 3B4YA 2JEPA 4U10A 3V3WA 1IWBA 4XUYA 1W5NA 3EX1A 1U5JA 1ZP4A 4J3VA 4AD1A 2CLHA 4GG9A 3SECA 1TVNA 4DBWA 4KGLA 4M7TA 4XAPA 4G1KA 4XIMA 3E0VA 2E5CA 5C2GA 3B97A 1ML1A 1YE6A 4RNJA 2VR4A 1EJTC 4INFA 3VFCA 3W82A 5C9RA 3RLGA 1H5YA 4F0KA 1ZJAA 2IKGA 2GWGA 4L4LA 3V0SA 1JD9A 2QYGA 4BQ2A 4ZB5A 5DANA 3SFWA 1P6CA 1R9ZA 3ICJA 4WJ8A 1UP3A 3MDWA 3N6JA 3AC0A 3LPOA 4JHOA 1TJ1A 2PGEA 4GYJA 5CXPA 3ES8A 3WNKA 3UT0A 2ZA3A 4KCVA 1H61A 3IIPA 1ISXA 3N3MA 3LMZA 4ZFCA 1THFD 1QPRA 2VEGA 3CNYA 2H9AB 3CL6A 3VDCA 4NZFA 2ZUMA 4E6MA 4UQCA 5EMJA 3EDDA 4CD4A 5HPOA 2VGBA 2WK2A 4OVXA 3POCA 3VGGA 1BVZA 3GNDA 4MSSA 3GNPA 3OVPA 2EEXA 1PX8A 1C8QA 2B7OA 2Z4GA 4CEUC 1F6YA 4AZCB 5BRBA 1SQ7A 1XX1A 3G5EA 5FF0A 2Z24A 4ZB2A 2G95A 2AQVA 3EDKA 1VCFA 1EDTA 5AB3A 3WH7A 4UFMA 3SGUA 2WV8A 3TNBA 4MWAB 4RPQA 4OV9A 3B8WA 3WQ4A 2WCSA 3WEZA 4KETA 3LGEA 4H83A 5REQA 1DIDA 1LWJA 3B8SA 3BAXA 3MHGA 1TELA 3RCYA 1W9UA 5C70A 5GPRA 3W1RA 2AAAA 3OPSA 1LORA 3G1VA 3WBAA 2PD5A 3U7VA 2VC7A 1R47A 1QBAA 3E6EA 1W1IE 1C8XA 4OFCA 1DP0A 2WSRA 3KBSA 4AW7A 2PRHA 5E6ZA 3W00A 3TSMA 3DHFA 4GY0A 4W85A 1SW3A 2QKFA 5LYRA 3ZZ1A 3WN6A 2C16A 1EZWA 2VDIA 4J5NA 1JZ5A 1C9WA 1HL8A 1OD8A 1YTKA 2Y24A 2YBTA 2HSAA 1OYCA 3TC6A 1XGEA 3RX2A 3W7JA 2PFHA 3LI0A 3CEUA 1FXQA 3S2NA 1US3A 1NWTA 5EBUA 1W1YA 1CDGA 3CZKA 3QRHA 3TYEA 3NQEA 3W1PA 3N18A 2CWXA 1EGVA 2E6YA 3ARPA 4WDWA 3RGTA 1DWFM 3EDFA 3W1TA 1SSGA 1GPFA 1W3TA 4PUKA 4XD6A 2DZXA 2XZ7A 3F4DA 4AX7A 1CXHA 4BJHA 1Q65A 4PZVA 3NQ2A 1GZGA 1CGYA 4RDVA 3KHDA 2AOSA 3GBDA 3SCPA 5CCZA 1XLIA 5LNWA 4OJYA 1JYXA 2QLYA 2V67A 4XUGA 2JKPA 1MXSA 1L6SA 2EXOA 2QQ6A 1D2KA 1VIZA 5CC7A 1VEMA 3BJSA 2PPGA 3DYPA 2ZTKA 5KSWA 2VDHA 2DJXA 2P8BA 1OABA 2PZ0A 1XICA 2VELA 2Y4SA 3NEVA 4ATDA 2EAWA 3PWAA 4JFSA 3FHQA 3IJ9A 4HYWA 1LF1A 1QPKA 5FEPA 1S3HA 1T0OA 5LIYX 4I6VA 4NJGA 3N19B 4XQ6A 1JZ7A 5FESA 1JAEA 1WDDA 3OYXA 4B9ZA 3UR5A 2OSXA 5RUBA 3DFOA 1EGMA 1YW1A 3M5ZA 1HO4A 3EEGA 4H6QA 1YYAA 2G3NA 4W87A 4PA8A 2HVMA 4FOJA 3AALA 4UXDA 1OFOA 2E67A 3A24A 4PC8A 3UY7A 1VFTA 1Z69A 5IM51 1A80A 5IBXC 4RV3A 3E02A 1YE4A 3WNMA 2G96A 4WDTA 2DZPA 2J25A 4X3ZA 1MEHA 3VM7A 1TWDA 3DBPA 4GCAA 4DRSA 3ALGA 3WUFA 1FDJA 3SW6A 4DLFA 3HO8A 3CLWA 3W73A 3B05A 3AHZA 4F2TA 3G1XA 1PVNA 3K5XA 4MB4A 4HZMA 3KTSA 3B9OA 2XN2A 4QE1A 3E96A 5BOOA 3DEQA 4K1WA 2C19A 2I57A 4ACYA 5CLTA 4S2BA 4GGHA 4G2DA 3R43A 2WNWA 3BGGA 1MI3A 2BFGA 3JUGA 1FUYA 3H6OA 1XH1A 3WDIA 1IWPA 4KWWA 1XRFA 5G1MA 3G18A 1ONEA 5D4YA 3D46A 5AHMA 1DQXA 1E0TA 1JDFA 1CXLA 2IXUA 4YTUA 5LHEA 1BHGA 3WH8A 3Q4DA 2FZ8A 3RXZA 2B7PA 5DN1A 1AJ0A 1V7AA 3OIXA 4DXKA 1OFBA 3N25A 2GGIA 5CKSA 5I3KA 3G6LA 5CC6A 1R38A 4Z42C 1VZWA 2OGJA 1XS2A 4JIIX 1VBHA 3RM8A 4W89A 4RE2A 2AMGA 1AA1B 1AW2A 4MOZA 5A95A 2HBVA 3PZVA 2QJGA 4GC3A 1KM1A 1A5NC 1YDVA 5BYWA 3ARVA 2ASHA 4XTIA 3VX1A 4MB1A 5D9OA 3AROA 1JPKA 2V82A 1OIMA 1OSEA 4PB3A 2QJJA 4Y9OA 2WJFA 5HWMA 3E74A 1PJ9A 2F38A 5T9CE 3AYSA 1JYNA 2VFEA 2E9MA 2A3LA 5FJOA 2HVNA 4IMEA 4UFLA 2F6XA 2WVVB 1UROA 2ZZ6A 1CXFA 2C18A 3HGOA 4U28A 1UUOA 4OU1A 1XYBA 4LT9A 4E4UA 4NYYA 2QUTA 2VR5A 3EOSA 1Y5VA 3APTA 2XFYA 3NOEA 5C9UA 1K8YA 3THDA 1A5AA 3K1DA 3IRDA 1DYSA 3B8IA 2FZBA 4LCQA 5D09A 1KQYA 1ZPTA 6A3HA 1R0MA 2X30A 1H7XA 4NAFA 2X05A 4CU7A 4DJDD 3NQAA 2GPTA 4GBUA 3AS0A 1UR1A 5I02A 3ITOA 5M3WA 2XIJA 1CGUA 4P7LA 4IQDA 4DJFC 2V8ZA 3W2MA 1DHKA 1JAKA 4WY0F 3UWQA 2V5JA 5CLWA 3MU7A 2B81A 3RDKA 2ZA2A 5BWFA 2PAJA 5EMMA 5LSMA 3JR2A 1OC5A 3NVDA 4RLIA 3WD3A 2GJPA 4IXXA 5HINA 1E6SM 1HW6A 2DVXA 4BA0A 4WKHA 2NV9A 5E9AA 5J5RA 2NUWA 3BWWA 4GYPA 1UIPA 3CWOX 4IG2B 4LF1A 2F6UA 2F8QA 1EJXC 4RE3A 2E8ZA 2WO5A 1O5KA 2F9RA 3OO2A 2RFGA 3E0FA 3LHVA 2GLKA 4XZNX 1DJNA 3UG5A 1EOMA 3TA9A 5IFPA 2CZDA 4IFRA 1MUMA 4UFKA 3BURA 1OG0A 4K8HA 1KM3A 1NVMA 3KZSA 1MEWA 4MYAA 2O7QA 1ZAJA 1GHSA 1CBGA 2CITA 3CZLA 5KZ6A 3JZEA 2GSEA 3ZWSA 3WQVA 1AMKA 1JDDA 4O1EA 4KW2A 4QCEA 4N6EA 2E77A 1EH9A 4ZQNA 3TSBA 2VM8A 3HQPA 3W1MA 1Q6DA 3VNLA 3WG6A 1BAGA 5FJIA 1JPHA 2J77A 4NRRA 4IQEA 4Z0SA 5CJNA 3OEXA 3NO3A 1A5BA 5G2HA 3AYRA 1QHZA 2X40A 1A5SA 2RGLA 1KM4A 1UWSA 3HGSA 4R9XA 5I06A 5FACA 2NV2A 3D0CA 1OCJA 4DZHA 4I5UA 4F0LA 1H5VA 1OWQA 3AJ7A 3FA4A 3GHTA 2ACSA 2XIMA 3COTA 5E70A 1GEHA 2HNEA 5AY7A 1F76A 4GBDA 4GWEA 3S5OA 4XZBA 1W3IA 1UKOA 1ZCOA 4R5EA 3OZOA 4Y96A 1KO0A 3WX7A 1GOQA 3LCGA 2PDXA 1Z41A 3D3FA 2WW5A 5T91A 1SVDA 3CO4A 2VC6A 1BWLA 2ONEA 3ZYZA 4FNSA 5B7ZA 1J11A 1SO3A 1XIEA 2VFIA 3C2YA 4LV4A 3T2QA 2YXGA 1B3OA 2G97A 4L65A 4FF5A 3PJTA 3FLUA 3VK5A 3CPRA 4Q4KA 1VFFA 3TC7A 1D7KA 4LUIA 3AXIA 2REQA 3PFRA 4HQVA 2H6RA 2E4TA 3G22A 3VKAA 5A6KA 1XIIA 5AHIA 3ARTA 2V63A 5U7SA 8XIAA 3BGAA 3EOOA 4LAUA 4C6LA 3NPVA 1OY0A 1XFCA 2BS9A 4DAFA 1DXFA 3WD0A 4BF5A 2GOKA 3GU9A 3R1ZA 1Q8AA 3ABOA 3ARSA 3O6YX 3TDFA 3SCRA 1EWEA 2QXWA 2X7VA 3AHTA 1TPUA 4TO8A 4G7EA 3VD7A 1CPUA 4TVUA 1UWUA 4QXIA 1ZSXA 1A47A 3UVIA 3S1XA 3LHTA 1V0MA 3ZVIA 1NELA 1R3WA 1RP8A 3CUFA 4XZ9A 4REQA 4YWIA 2QV5A 4NY2A 3TJXA 3BLEA 2QUUA 5DX7A 3SN4A 3A12A 3QKZA 2VP8A 1Q4WA 3B8VA 3KCLA 1MVYA 1SJDA 1WA3A 3VIIA 1U83A 3KRBA 3G6MA 3VOHA 3N12A 1QVBA 4QJ3B 1US2A 1F73A 4MJZA 3WLLA 3LM7A 2WXDM 4V27A 4H6RA 4F66A 4JX4A 5I03A 3W72A 1QHPA 2Z1BA 3FAWA 3N15A 3R7MA 4KWVA 2XVPA 3M44A 2PI6A 3GNOA 1US0A 1TRIA 1NDZA 1VPQA 1TUXA 4US5A 1KBBA 1JNDA 3NQVA 3VILA 3UWZA 2CZVA 2WSPA 4AMCA 2XWEA 3MUZ1 5C9WA 3UWUA 2R1MA 2ACRA 4G1NA 4UOZA 1K9FA 2WHKA 2FFCA 3W2KA 1G9HA 2IPJA 3G1YA 2VUNA 3DFTA 4S3AA 2QV4A 1XLBA 2J7EA 2QJIA 4F4RA 1RK5A 2VO5A 3IWPA 1ZAHA 3PC0A 1PE1A 1W5MA 3AWOA 3C4UA 4F0SA 3BICA 1KFEA 1R5YA 2OEJA 4S3DA 4F0MA 2G5WA 3NNTA 2V0TA 4IPIA 1QWKA 4FR6A 3QM3A 3L9CA 2ZRUA 2I56A 4O10A 3U5YA 2EG8A 1PXGA 4UFHA 2OLSA 1M7PA 3N17A 5M5DA 1A4MA 1W3NA 1Q45A 3UU0A 4UTWA 1LBFA 1FP9A 3G77A 7XIMA 4IMCA 2ESCA 5BXSA 2PEVA 2PUZA 4JTJA 3EX6A 2EG7A 5I23A 1DV7A 3HTWA 4JTQA 3HJZA 3RX4A 3WO8A 1XYAA 3GG1A 1BXCA 1OVDA 5HJXA 4DBUA 4GI8A 1QI3A 4OECA 4LUTA 1VLWA 1TSIA 3VU2A 1K7XA 3W81A 2R1LA 1PX3A 1H1ZA 1F9CA 2GSJA 1E70M 4K39A 1RD5A 3CAVA 3VIKA 4A29A 3CYJA 3T05A 2MANA 4EAYA 4JTAA 3P8JA 3R10A 2WKLA 4JX5A 4PCPA 3GVQA 5LA1A 2HRWA 2XWDA 3PJXA 4UQ9A 4QP0A 2QF8A 3NO5A 1S2AA 1M5WA 1NDVA 1MSSA 1UQZA 4ONVA 3W2NA 3G1AA 4R9OA 1M53A 3W6LA 3IJQA 1HVQA 1KNWA 1RP9A 1LBMA 3IVSA 1P0KA 4M19A 4GH3A 3HZ3A 2OJPA 1Q8JA 3EMQA 5ABFB 3R13A 2BV9A 3LI1A 4PMOA 4DBDA 1B2YA 1FWTA 4XD5A 4IGNA 2PWUA 4GRSA 3CXOA 3RPMA 3I3BA 1F05A 3VZXA 4NZ3A 2EPMX 4IIDA 3NZPA 2OO6A 1RQHA 1XR2A 2O7SA 4J4KA 1KCLA 1A3HA 1W1PA 4UC5A 2X1UA 1EA9C 1KLZA 4J2PA 1VPXA 2AKZA 3FJLA 3WLPA 4XSMA 4Q8WA 5FAJA 2YL5A 4FSAA 3QJAA 4BWLA 3TWAA 2VX7A 3H4XA 1P5BA 2OPJA 2VDGA 4QJ4B 1X1OA 2XH0A 4JKLA 4DBSA 5D38A 1GOWA 3CUXA 4S3JA 4M51A 3WEOA 3OLDA 5LNUA 4NJHA 3M0MA 5K2ZA 4Y9AA 1E1CB 2ZZ1A 3IGSA 4O11A 5HNNA 4IXHA 1HJQA 2VZVA 3M0JA 3N04A 3KEHA 1KGWA 4X60A 2G3JA 3SJ3A 3B0XA 4Q7BA 3MWAA 1FWDC 1WDPA 3AUOA 2DV0A 4PCNA 4XBKA 3PPHA 1HF6A 4CCCA 4O0ZA 4P7NA 1JPDX 5CZJA 1OCNA 4IUGA 4HJFA 1H7RA 1W17A 1X39A 1REQB 1ONRA 1YBQB 4WDXA 1J5TA 1MNZA 1K77A 3U48A 1CGWA 1GOKA 8CGTA 3VO0A 1EXPA 4Z0JA 2YBUA 4CNNA 2EKGA 4IPLA 3ARUA 1J93A 4LVBA 3UGRA 1H09A 2PCEA 1XLGA 3QMSA 1AVAA 4W93A 4KCUA 3L4WA 1YQ2A 4PULA 3WFLA 1I1WA 1S1RA 3LXAA 3ZWTA 2INEA 1PCKA 3KOXA 5ECUA 3T42A 2O9OA 1ZALA 2F61A 4HHHA 4X0NA 1TVLA 1RD6A 2YL9A 4TXEA 2YYUA 3NYZA 4LH8A 1G4EA 1LOLA 1W9PA 2ISSA 3FX4A 1AQMA 3KRZA 1FVPA 4CVUA 3S6TA 2R6OA 3N29A 5BZAA 1BYBA 4QS6A 4JAWA 1OCBA 1C91A 3GVGA 4NF7A 4DI9A 3DAQA 3EX3A 1IYXA 4CCZA 3I3EA 3DC8A 1RLCL 1EPVA 4JTRA 4WKAA 3KBVA 4CNUA 2XSAA 3AHXA 4DEFA 5DBTA 4DLMA 4NXKA 2E1DA 2TMDA 3BOLA 2FMNA 4MB3A 3AMDA 1SZGA 3WF0A 2F84A 1HNYA 4ORIA 4UMCA 4HNOA 2BWGA 4YS1A 1YMYA 3IEBA 3QC3A 3VCCA 2GGGA 2GZXA 1JVNA 4AD5A 3M0XA 3C8NA 2NLIA 2OGYA 4DNMA 4JFUA 3UW6A 1G67A 3CIWA 4YVXA 3N4FA 2A4AA 3WDJA 4ROPA 2VQTA 1HKMA 3EWYA 3KTXA 3FCPA 3W74A 1YXYA 3MHFA 1LOQA 1BF6A 2E28A 2RDWA 3RU6A 1EF2A 2Y8KA 2FPVA 4IIHA 3DKLA 3KUMA 1DJWA 2C6QA 3E12A 3WF3A 3MC5A 2OVLA 2DZUA 4H9UA 5FF7A 3STPA 5DY3A 4GVFA 3DDMA 2G8ZA 1XP3A 1VBGA 3MCMA 3D6NA 2QNEA 1EBGA 5HMDA 4NU7A 4I8YA 1KWKA 1SO4A 4UQEA 3ZO9A 4HGXA 1YX1A 2OELA 3AOFA 2Z0IA 5EMUA 2OCZA 3VOGA 3V18A 3UJFA 1S2UA 3DKJA 2DW6A 3V36A 1JCNA 1L8PA 2JE8A 3N4EA 3U2ZA 4US5D 3M5XA 1TV2A 2WSYA 4JIHA 4Q4SA 4JN6A 5AYZA 4QSHA 3N2XA 1OHLA 4HK5A 1XJBA 2DZBA 2PBGA 1WDRA 4OT7A 4JIPA 3TH6A 1OGBA 5I77A 1AZ2A 1TR9A 1TPFA 4EXQA 3NWRA 4ZTYA 1I0BA 2YB4A 4GJJA 4CNPA 5EY5A 1LUCB 1WOAA 2QAPA 3A4WA 3AAMA 3ABXA 2OLAA 1NARA 2H3DA 1FWNA 1W54A 4Z1CA 5EA9A 4H9TA 4O8RA 3LV5A 3BZJA 3GDTA 1DHPA 3PNUA 5F4XA 1Z44A 4AEFA 1FKWA 4PB4A 4NT0A 3IIOA 2ZDSA 2P3ZA 4AZHA 3GZ3A 4PL2A 5FF2A 2PA6A 4AY7A 1IXNA 2PDKA 5HBFA 3EX4A 3KP0A 3NQ8A 3WUGA 1I0DA 4AXKA 1QU4A 1B31A 1UKTA 2VNCA 2DZWA 2CHRA 2DSZA 4LVDA 1UIOA 1FRBA 1GKPA 1RVGA 3VKKA 4GABA 1XC6A 4DJDC 1M7JA 4O1CA 2E40A 4JBRA 2QUMA 3CWNA 2PBOA 2ADAA 1WB0A 3AHYA 4MAVA 4TMBA 4IFKA 1RZMA 2Y8VA 3WJZA 2CIPA 4OBSA 4ACZB 3HU7A 1B57A 1OEPA 4ZQRA 1F4AA 3PVFA 1H11A 3FVDA 1I1XA 1R3TA 2PDLA 1ZJIA 2FB3A 1EJUC 3CUJA 5K4ZA 1PV8A 1OK6A 2DT2A 1K7FA 3DG3A 1RY8A 1SO6A 2YZRA 4V1YA 5HR6A 2BMBA 5CPQA 4AB4A 3QHNA 2W66A 4PB5A 1F07A 3MO7A 4LY4A 1S39A 4DVOA 3SI9A 1I2PA 3F5JA 2GL5A 1DTNA 4I9TA 4NZJA 3F03K 4WJXA 1J96A 4NKCA 3V1PA 2NT1A 1GVEA 1RUSA 1XLJA 4GQRA 1MDRA 4PTDA 2PODA 4PFHA 3H7RA 3RAOA 2BX7A 2DZAA 1GCYA 1LLWA 2YLLA 1KTBA 3IUHA 1DJIA 4XV0A 3KVLA 2CKRA 1UPMB 3XISA 1ELSA 2OKTA 3MWCA 4W9TA 3GFZA 1VHNA 2GJLA 1NDWA 1ZL1A 5LGZA 4F8XA 5I09A 1HP5A 3AS2A 4RW3A 2DZTA 4MY1A 2C91A 3UQNA 1D8CA 3H2NA 2CLEA 1UZ1A 3TYBA 3KDOA 4H7ZA 1JRBA 3MYOA 1PTDA 4W88A 5E1QA 2CBVA 1F8MA 1P1XA 2A3CA 2IMRA 3KVMA 1TWZA 3CB8A 3IGUA 3SQLA 1EHAA 2GUYA 3N9RA 2ZRZA 4OUIA 2I7GA 3SAZA 4MNKA 2ZZ2A 3TJIA 1TX0A 1M1BA 3MVTA 4I5RA 4UB9A 4B5XA 2PDBA 7A3HA 4FP1A 2JFEX 3CO8A 3UD6A 2WZTA 2Y2WA 4AZ7A 4JQ2A 4C6EA 3TX9A 2X0HA 2ZBTA 5AECA 4CQ8A 1W1ZA 1OFAA 3SRDA 1A3WA 5HR7A 1NTHA 1TWWA 2H9AA 1HQTA 2OSWA 4V1XA 3IAQA 1UC5A 3WMSA 4FI4A 4U4MA 3CU2A 3SB0A 2FZNA 1E6QM 3LK6A 5F2LA 1W32A 4LBSA 3N11A 3P82A 1QOPA 3QV8A 3R2GA 1VC4A 2HXUA 1UH2A 1Z42A 4Q7IA 3UJSA 1QOXA 4ES4A 2HNHA 3WBEA 1IGSA 3TOPA 2GGHA 1BKSA 4H19A 3BK0A 2NSXA 3W70A 4XWUA 1I75A 3OLGA 4N7QA 4MWAA 2NUXA 4D1JA 2W6RA 1TG7A 1W1VA 5REQB 3NPXA 1BXBA 2J9YA 5C9XA 1J4EA 3BW4A 1KV8A 2YOCA 1SFJA 2JKEA 3LZ5A 5CGQA 1WKYA 1LQ2A 2XYLA 5I3IA 2J74A 1CYGA 4L5ZA 4UOJA 3KBNA 4KIEA 1PB0A 4O57A 2VZUA 2I5GA 2D0GA 3QZEA 1BYCA 3L7RA 3CL7A 1JQXA 5JBFA 2PZNA 4L1WA 5GQBA 3NZQA 4YU1A 1OIFA 5HNUA 1V5XA 1G4PA 3M1ZA 4JYEA 3W7EA 4QG9A 1M41A 4JIEA 3UPBA 2B7NA 1LG2A 3NQDA 5CAHA 5BNKA 2WVTA 2Q01A 1CB2A 1XC4A 2QDHA 1V0KA 3NM3A 1S2TA 3UA3A 4ZO8A 4EACA 2YA0A 3OB8A 3G24A 4OBTA 1Q6OA 1UD3A 3W27A 1ENUA 3LG3A 2PGWA 1FWAC 1V3IA 4H4IA 4PUMA 4QAWA 3VOCA 2R94A 1SPQA 3BV7A 3PFMA 2HS8A 5BMWA 5CGMA 4NUWA 2VMFA 3SGGA 1O5RA 3U6WA 1DWJM 2W5FA 3BSHA 1CXEA 4EOUA 1F8IA 3P84A 4WUIA 3TN4A 2BHYA 1AQ0A 4Q4MA 4AWSA 5CJMA 2DVUA 1EC8A 3I68A 3F4NA 3GS6A 3ZLFA 1OG6A 4DO6A 3A4JA 1NSJA 3G0UA 4MVAA 1LJYA 2Y88A 4C91A 3PWGA 1KW1A 4D6DA 2PU1A 1JULA 3YPIA 2VD8A 3S2MA 1CNVA 1KM0A 3HGJA 4GIAA 2NWRA 5LGXA 1FX6A 4K7YA 3F2DA 1CXKA 3LU2A 3IK2A 3CYVA 3BVJA 4JCLA 1UHVA 3MSRA 5ABTA 3LNPA 3H53A 1PUDA 3RG6A 1FCQA 7PTDA 2EJAA 2EO7A 1W6TA 4C7GA 2RAGA 4QLKA 3TFCA 1B4EA 2I14A 4A3HA 2PDQA 4Z2JA 4XAYA 1QW9A 1T5AA 3SO7A 2CBIA 2W4XA 4YMZA 4IMFA 2NXHA 1PL9A 4Q8MA 3RCNA 3P5YA 1FHLA 4OWGA 3UXKA 1KQZA 1WXZA 4J3ZA 1XIBA 2X7WA 2Y63A 3NSMA 3TTEA 4CQ9A 2D3NA 1TWIA 3UPWA 1WV2A 3UR2A 2ZKMX 3QF0A 4ERGA 2PP1A 3VD9A 4ZXLA 3MZ2A 3V5OA 1QUMA 5D9NA 3AXMA 1J79A 2Z29A 1VF8A 3OHMB 2YFOA 4DJEA 2CWNA 2YPIA 3DI0A 3BMVA 1W91A 2X09A 1C8YA 1F61A 1YXCA 1V3LA 1VFMA 3T09A 3PAJA 3MKCA 3CTTA 5G4EA 4XKMA 3SRHA 5DELA 2EPNA 2QHAA 4MWAE 3TR2A 2CC0A 3AUJA 4O0QA 1YRRA 2OWCA 5HAOA 1V6WA 2OX1A 2CPUA 4UTTC 3I10A 2XFFA 2YW4A 3GYEA 1N8IA 3DFPA 3VX0A 2BLEA 4HU4A 3VGHA 4YWSA 2GDUA 1UMYA 1TPDA 4GIEA 3M6DA 4FXJA 5IXEA 1X1NA 3K8MA 1W0MA 3LNMA 4BF7A 3AXHA 1V08A 2PDCA 4US6A 1VFHA 3PS7A 1GKRA 2VOMA 2W62A 1VLIA 4QAIA 4CNTA 4E3VA 5I78A 3T40A 4UQBA 1EB3A 4QQUA 1KRAC 2OO0A 5DFAA 3GG0A 2FB2A 3GHUA 3PTQA 4FOUA 4GYPC 4O28A 4IJRA 1SMDA 2VVNA 1LG1A 2Q6ZA 4RNHA 2DH2A 1XGDA 4O14A 2VCBA 5AC5A 2FVLA 5TD4A 1CGXA 4R34A 4F40A 3S2JA 1FWBC 4DAIA 3R0UA 5D9PA 5C5YA 3P62A 1JCXA 3P0WA 2WKGA 4NILA 1GPWA 2DW7A 4ZOEA 3SY8A 1GORA 2GSHA 3W1NA 1U22A 1C7TA 3TEVA 5KTLA 4CD5A 1D7FA 3ANYA 3EXTA 3ZJ6A 4NAFB 4A3YA 1T7LA 1E6XM 3T8QA 1BWKA 5EPDA 1P0BA 3BCFA 1Q6CA 1QNOA 4LJ3A 2W91A 1CWYA 3D47A 5K7JA 3TN5A 3SUWA 3DYMA 2QCMA 2YYTA 1RH9A 3S2CA 4IIBA 4JKKA 1MQPA 4WKFA 4ZO9A 3LS9A 3TZFA 3MTWA 2QUNA 1JG9A 1JDEA 1Y5XA 2DGAA 1GONA 1IZCA 3UFYA 2BOFX 1KBIA 3WNLA 3F4CA 3VE7A 1E55A 2VX6A 1IT8A 4Z2LA 4IG2A 1JDAA 4P61A 1N8FA 2RKXA 1SZRA 2BDQA 2Y61A 3TLQA 3CAQA 2ZWZA 3TW7A 3NAVA 1S2VA 3B9EA 3R6IA 4ADSA 3VNMA 1YADA 4EVZA 4GJ1A 5DY2A 4D6IA 1KCKA 1DPMA 2Y8UA 4D6CA 4B2DD 4ZL1A 4YXGA 3AWNA 4BCEA 1H1YA 3BAKA 5GNZA 4GGBA 4AISA 4QHRA 2XIBA 3C52A 1XSJA 2PWDA 4DO4A 1UA3A 3F1QA 5M03A 3QKEA 1SZFA 3K4WA 3ZMRA 2BTMA 3QY6A 2YL8A 3KBMA 4MKVA 1ISYA 1AQFA 1OCQA 2BB0A 3PZOA 5K9CA 1GQLA 3RR4A 3FS2A 2WMIB 3KLKA 4I9AA 1RQBA 1OX5A 1OFPA 4HSHA 3RJXA 5AC8A 2VRKA 1JF6A 1L6WA 1XLCA 4RE4A 5FJTA 1EO5A 1R9YA 4LWWA 2PC8A 4GNKB 1B0IA 3GSMA 5EB8A 4HPHA 3W2UA 3QLLA 1UR9A 1QJWA 3DX5A 4KFOA 3DU0A 4IL0A 3CQKA 4GFIA 2GVEA 2NX9A 3WNPA 1WKDA 1WDQA 1DJGA 1JUEA 5LHFA 4KWUA 1B3WA 1UG6A 4L64A 2IPGA 3QY7A 4X9YA 3DHPA 1X7FA 2VEFA 1AL7A 2E6AA 3BG9A 3SJNA 4J3WA 3AYTA 3O63A 4ZO7A 5CPLA 2O55A 1CXIA 2W63A 4Y8EA 2GVJA 3SCOA 4ZO6A 1LRNA 3ZSSA 2REQB 4YHGA 3EB4A 3CHCA 4YTRA 4ADUA 5D2YA 1P0DA 1O7AA 3PPCA 1XISA 3G1SA 4HSNA 3CC1A 2XINA 3ONBA 2D0HA 5CQ1A 8RUCA 5I3GA 1ZNNA 4NI3A 3VGFA 3W7MA 1GOIA 1QNSA 2Z1WA 4DM2A 3CGTA 2IS7A 7TIMA 3CL8A 4GJIA 3MHUA 4KWOA 5BOEA 5M1TA 2D24A 4G7EB 2HQAA 1RJRA 3NQMA 1UCWA 3LERA 5A8NA 4Q8OA 4AX6A 1ZJHA 1XG4A 2ZICA 3A13A 1TB3A 4LS0A 2UY3A 2J7HA 4HOZA 1I60A 4REQB 1EGZA 2ZZ5A 4PUWA 4V15A 4AXNA 2JBMA 5E09A 4HU8A 2VT0A 3M9YA 3W4RA 3S5SA 1TE6A 3J7HA 3IIXA 3W2JA 1PKLA 1H41A 3HQ1A 2DZVA 3QBUA 4UTWC 1AODA 1Q13A 3WD2A 1HVXA 2JKAA 3VIHA 3H26A 1ZJBA 1EDQA 2POTA 4JTFA 1G4SA 1D9EA 8A3HA 1HJXA 1G6CA 1LLZA 5FF4A 3JW7A 3VMPA 2TRSA 3H23A 5ABGA 4BK9A 4A3RA 1E40A 4OIFA 3UJRA 1F3WA 1GYLA 1A4LA 1ITCA 4YN5A 4XAGA 1JYVA 4B3KA 2VX4A 2UY4A 3GXTA 2OZ0A 5FOOA 1NQ6A 4IP5A 3TMLA 3MO4A 4CNSA 2D2OA 2ZX9A 2VC9A 1IGWA 1SR0A 4DJED 2YFNA 2WM0A 3BCJA 1HG3A 2GWNA 3WQPA 3I4EA 4Q22A 3NGJA 3LBMA 3MW7A 1DKWA 5F1VA 4Z1YA 2I17A 3G0XA 4K36A 3HN3A 4JQAA 4S3EA 1E72M 1XRVA 3F7JA 2VD9A 1QI5A 3BLLA 5KITA 4FNUA 2CZFA 3WBXA 3WLKX 1EA0A 1P0EA 2R14A 1UBPC 1JCTA 1SFSA 1E5JA 3W7HA 3MBDA 4NQ1A 4Q3MA 1T99A 1KGUA 1CLXA 4PUUA 2YLAA 4GX9A 3CUGA 1K8ZA 1XKYA 4FIRA 3NZRA 1EQPA 1XLEA 4QE4A 2IUZA 3PAOA 3UG8A 3C3UA 4CNOA 3W7OA 4TX8A 4GACA 4ZQPA 5FF3A 3T78A 2XH4A 4GQ0A 5CGTA 1V3MA 1TVPA 4GUJA 3CTLA 2NVDA 2O9PA 4A8IA 5D30A 4D6FA 1RCOB 2XN1A 5XIMA 4C60A 2IQTA 4W5UA 1Q7ZA 4XBSA 1IHIA 5DRIA 5A8QA 3NDOA 4LUTB 4UBPC 4WOQA 2R1KA 4HP5A 2R1PA 3HMCA 3QW4B 3LEPA 2ZUNA 3EAUA 4BWLC 3MI6A 2PF0A 5CBIA 2VEKA 5GJNA 4KIRA 4JDBA 2C1IA 1UR3M 3PJWA 4JFWA 3OG2A 1DBTA 1GWJA 3UJEA 2VWSA 3GC5A 4YCPA 5DMLA 4JL1A 4GZJA 1XKJA 3NQGA 2J79A 5EGRA 4S3KA 8TIMA 2W9MA 2WZIA 1AMYA 3Q45A 2XN0A 4DPPA 3S9YA 1NAL1 1TV4A 3LB0A 1JUBA 1TE1A 2TPSA 2VURA 5D37A 3W87A 4RPPA 1R3RA 4MJMA 3CQHA 1E0XA 3I4KA 3PZUA 4X22A 3WMLA 3PTKA 3IK4A 3ZQ9A 4YCOA 3P93A 4OTKA 3W02A 2Y5SA 3GNRA 3DBNA 2CLFA 1PPIA 3RK8A 1ZGDA 2QULA 1DWIM 3UXAA 5IFTA 1FP8A 3BSMA 3ANVA 3BAIA 4GE8A 3WBWA 1ZP3A 4S2CA 4PTWA 3BQ5A 5CG0A 3BARA 5H8UA 4QRNA 1V0LA 1HJWA 1B9BA 1RPKA 1SFTA 3S0CA 1AZ1A 3EA3A 3KZPA 2Q3OA 2C13A 4G7FA 2CXEA 3S1UA 3LTPA 1DIKA 3FKKA 4WZHA 1AJZA 4JQ4A 3OA3A 1RSCA 3MJYA 3R5EA 1A5KC 4Q8UA 2ALRA 2C15A 4GIYA 3U4AA 3U4FA 4FA3A 1WKEA 3P81A 2J9XA 1G0CA 3USZA 4B5NA 3IJ8A 3FKRA 4YL2A 4CQBA 2QUVA 4FZIA 2WMGA 3MMWA 3VIGA 3AIBA 4D71A 5HANA 2VX5A 2VGIA 3I6RA 1E1CA 4MDPA 1NF7A 2IKIA 4B5VA 1J2BA 6PTDA 1X97A 2E9BA 2GUUA 3FNDA 3E2QA 1S2WA 3ARZA 4Q8QA 3GDBA 1XYLA 1OX6A 4JEJA 2V3FA 1UZ4A 3VMOA 4IQJA 4OKDA 2NQ9A 1J6PA 4R7WA 1ZBWA 1Z3NA 5U4NA 2BHUA 2PP0A 4PMRA 4Q4QA 5FAGA 2VJXA 3AICA 3RM4A 2EPOA 5C9ZA 1Z32X 2R9RA 3S47A 1REQA 3O2LA 1MQQA 3GBEA 2DIJA 1K9DA 3A3XA 1RA0A 2DQWA 2JALA 3CASA 2ZXAA 3L5AA 5LZLA 1K4GA 3NFUA 4H3DA 3UY8A 4ZODA 1UB3A 1TPC1 4HHPA 4M1BA 1XV8A 3TZNA 3GY1A 3E2RA 3EWDA 4H00A 2GOUA 1FKXA 3KW3A 1WPCA 1ITXA 3GVWA 4LYQA 3L4XA 3WDHA 1QCWA 2WNNA 3MKKA 1YDYA 3II1A 4BI6A 1EIBA 3G1DA 2CU0A 1GQJA 4IF2A 3M0KA 3B8UA 2A5HA 1JGMA 1E43A 1Q4NX 5HQEA 1FH9A 3DC0A 3GFYA 4GYFA 2GQ3A 4ZR8A 3GIYA 1POKA 3DOPA 2JEQA 4RUBA 1J9YA 4JTLA 4NG3A 2PP3A 1W9BM 3ZJ7A 2GQ9A 2BGNE 3MKVA 2VI0A 3INPA 2WMFA 4IIGA 3TYZA 1V93A 3B0UX 1AL8A 4YYCA 1EC7A 3JS3A 4OHQA 4BI5A 4DZIA 3OA5A 5CZ0A 4DB7A 4FALA 5HQLA 4NAEB 3U3HA 4IJBA 3CWHA 4Z1BA 1M65A 1Z8AA 3VOJA 1IZJA 4YPJA 1NY1A 1VEOA 1XIDA 3OBKA 1H7NA 5C2XA 1NFPA 4Q32A 4FXSA 4R27A 2Y70A 4GO9A 3LGGA 1ICPA 1E1EA 3L0KA 2G3IA 4GMEA 3SADA 4H8UA 4IISA 3PF3A 1NFBA 1QO5A 4E0CA 3E0LA 3FXYA 4R7JA 2Z2BA 4Z2HA 3S6OA 2V5KA 1TFVA 1NF0A 3W29A 2NLYA 1UYQA 2NSOA 3C0SA 1HL9A 4P8UA 4ASTA 4ZMGA 3O06A 4HU3A 4LVAA 1JI2A 4GH1A 4CN1A 4D72A 1U1HA 4GZ7A 1U2YA 3CIVA 4HA4A 3TN3A 4CGTA 3N2BA 5I7GA 4AAJA 2X42A 1IR2A 1A53A 4PMNA 2AGKA 1PZ2A 3OYZA 2DVTA 2V3DA 1EJSC 3GG7A 3TCEA 1XRTA 1A5CA 1EXBA 2HEJA 3MPGA 2RHGA 3DECA 4XG1A 1JCLA 3QPYA 3FEQA 3NQ6A 1Q6FA 1X6UA 4DWSA 2D20A 3SIMA 2XU2A 4DWDA 3R8RA 4B5SA 2KX9A 2ZZ7A 3FYPA 4X2RA 3W7KA 4IMAA 4Y9PA 3E2VA 3MVIA 1LRTA 1ZS2A 2YCLB 4DF1A 3GWQA 1H2JA 4PMDA 3AHVA 3CUHA 2VFDA 3S5ZA 2VCAA 5AVHA 2XH7A 1TMHA 1V6TA 1XI3A 3TQVA 1UD5A 5C7HA 2JGYA 4IX0A 4MIMA 3R11A 3WQ8A 3EPOA 5I07A 3TW6A 1BXNA 1V3JA 3LX9A 3GG8A 3W7CA 4N9CA 1T96A 3W6MA 4LUYA 3AMLA 1Y5WA 3SRKA 1KD0A 3BLPX 1F3TA 2YGYA 2OWWA 3AQUA 4GKLA 3SGZA 1QWGA 2J6VA 1A0EA 1KGXA 4QNWA 4FXFA 1FWSA 1KFLA 4B5UA 4WXYA 1QMLA 3M0LA 4Q6JA 3BQ6A 1T8XA 4F0RA 4W8LA 3P80A 4CCEA 4C1KA 1UKQA 2PTDA 2TODA 1PZ3A 5HDRA 3GM8A 3R25A 4ZQOA 2ISFA 2C8NA 4D2JA 4ZQCA 4DN1A 4UOQA 2Q8XA 4CVWA 3SCSA 1W1TA 3AS1A 4PTVA 3WQEA 4UR9A 3MUY1 3Q2DA 6TAAA 2V9DA 1KFBA 4RDWA 2Z2AA 4C7DA 3BUVA 1DQWA 1L2UA 1VJIA 3VGDA 3DUGA 1PDYA 3MMDA 3WNOA 4ZSTA 3USBA 4WDUA 3VABA 4GK8A 3ABSA 4D6JA 1V8EA 4E4FA 3FJ6A 3HPAA 5C6MA 5CPNA 5XIAA 1IXOA 1ESWA 1R46A 1B3VA 1CW2A 4LAZA 3RFAA 2XGZA 1CECA 4GOAA 4LANA 1J6OA 1GK8A 1V0NA 3N9SA 1GVQA 3CHVA 3WKZA 4W5ZA 1ME7A 1R86A 4HNUA 1RJQA 4PH6A 4Y9MA 3T7VA 4ZOAA 3PBGA 5A6BA 4D6GA 5E0FA 3ONCA 2HBXA 1LWHA 2A0NA 3TA6A 3S8HA 2ACQA 5AOUA 3GKAA 4DJDA 4E2DA 5CPMA 2Y0FA 4MWAC 1S38A 4Y6GA 4GI9A 1OJXA 1GTEA 5KMYA 5AN7A 1XCXA 1XYCA 4C6KA 5JBEA 1E71M 3O0FA 2CCRA 2IPWA 3H22A 4QGCA 2EQDA 2XVGA 2ZRWA 1OM0A 1ICSA 4PEKA 4DPQA 4B5WA 5EMLA 2V2DA 5SWUA 2HDJA 3GVRA 3N3TA 3WUEA 4GPNA 3N9KA 1XIFA 3RJYA 3ARQA 2WAGA 4HA1A 1EJ7L 1FWWA 1VJZA 3M43A 4PCTA 4UWMA 4Y90A 3FDKA 4QQ3A 2W27A 4DI8A 3C86A 3KLLA 3RYSA 3TXZA 4U33A 5LIXX 2J24A 1W5QA 5C54A 1Q2SA 2BY3A 1Q7QA 1WP6A 3BW3A 3NTYA 2AGTA 1XBYA 3DFSA 1MFUA 1Y0EA 3TXVA 1IXQA 5CPSA 3ZR4A 3FY1A 1AD4A 2R91A 1M01A 3CB3A 4HCHA 2FTWA 5D32A 3VCNA 5DRCA 3WK1A 1EFZA 4UTKA 1WX0A 4P5UA 3AYVA 3GDLA 2D2GA 4JICA 1XIMA 2VOTA 2QCGA 2FMOA 4UQAA 3LSBA 3W1UA 3ID7A 4W8BA 1OBAA 4L6OA 3NDYA 5PTDA 3THAA 2GJXB 3W7GA 5A2CA 4W8AA 1NM9A 1L6FA 4NZ4A