3BLKA

Role of aromatic residues in starch binding
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFADARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase 1
publication title Structure-function relationships in human salivary alpha-amylase: role of aromatic residues in a secondary binding site
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 172
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3blkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3blkA01
2ZIDA 3CUJA 1W3JA 4DUWA 2FGLA 2W4XA 3VOCA 1ZS2A 1UA3A 3PTMA 2WVVA 3I3DA 1ISYA 1UKPA 1TFVA 3FNDA 1JD9A 2JF6A 1CECA 2E9LA 1QHZA 2X1IA 4U5IA 2BVYA 3QGVA 2BXZA 5LA1A 1TE1A 5A6BA 5KZ6A 3LPGA 3AHTA 2X2JA 1JYNA 4BZYA 2ZXAA 4TOQA 4Z2HA 2OSXA 3MV01 3PBGA 3ZO9A 4AXNA 2JF7A 4PMVA 3SURA 2FHFA 4XB3A 1B2YA 1YQ2A 2J7BA 3KL0A 1NOFA 3AS0A 4QLLA 5BRQA 3W24A 4MTVA 4AD2A 3ZT6A 4CD6A 4GINA 1M03A 4UFLA 3UERA 2IGTA 3GH7A 1I1WA 3W6LA 1CYGA 4M24A 4JKMA 1UR9A 4GI6A 3LPOA 3WH6A 5M5DA 2F1AA 2BY2A 1UHVA 3VGHA 1AVAA 4TTUA 5GNXA 1W9DM 3OZPA 3APGA 4FNSA 4M81A 4P8UA 1KFWA 1JF6A 1HJXA 2ZWYA 4JL1A 4PMYA 1MW1A 3RM4A 4JL2A 3EDKA 1C8QA 2EACA 1XYZA 3IJ7A 1CGVA 1KR1A 4PUDA 4YHGA 4P8XA 4HZ6A 3WIJA 1VEOA 3AFBA 4J7RA 3ZM8A 1GHRA 3BXWA 1KTCA 4TUFA 3WEZA 2O9OA 1Q6EA 5I2UA 2YA1A 1O7DC 4A3HA 4B16A 1K9DA 3WY4A 4UQCA 1VJSA 2QV4A 1RPKA 5IHSA 4Z2IA 3GDBA 2YLAA 5CPTA 1H11A 2X0HA 4GZEA 4W8LA 1GVIA 2JFEX 3FHQA 4TX6A 4AWEA 1PX3A 1E6PA 4HMCA 3M46A 1MYRA 2G4FA 4AISA 1V3MA 4DWSC 2PBOA 2VO5A 1E5JA 1XHGA 1TZ7A 3K4AA 4XUYA 3BH4A 1HP5A 3WQ6A 2YFOA 3WMCA 4Y7EA 1L0PA 3O9NA 3JUGA 1W2PA 8CGTA 3WNKA 2GJXB 1SFSA 3T08A 2E8YA 2VX7A 3PZMA 4CGTA 3WDPP 3GXDA 3CBWA 2W92A 2EEXA 3ARWA 3AZTA 2WSPA 4JFWA 2WSKA 2XFRA 1R33A 3BLPX 1J12A 2ZXDA 3KL3A 3RDKA 1JDAA 1KCLA 1I75A 1FOBA 4UFHA 1BGAA 5FCZA 2J47A 3GNPA 3II1A 2OYMA 5TD4A 3ZR5A 2GFTA 1HJQA 1HXJA 1YHTA 3SCPA 1KWKA 1FH8A 4XV0A 3O6AA 1E9LA 4XZWA 3OGVA 2C7FA 2FHCA 4D6CA 3UG5A 3IAPA 3T0BA 3VILA 1C7SA 1UUQA 2Y2WA 4CD8A 4H41A 2XM1A 1J9YA 1ZU8A 1ISWA 2DEPA 4ML4A 3IGUA 1J11A 1W9VA 1XGZA 4H8VA 1BLIA 2A3CA 5JIWA 2J4GA 3MSGA 1CDGA 3VM5A 4E8CA 3VSVA 1WAWA 3VIGA 3RILA 1E3ZA 1CGXA 1V0MA 2V5DA 4UR9A 4RL3A 1J0IA 1TQWA 4JHZA 4UQAA 3L2LA 3TOPA 1E73M 2D73A 2D0FA 3SUTA 3POCA 3HN3A 3AXHA 3CZLA 5D8WA 1UR2A 2GDUA 5A6BD 4BQ4A 5JUVA 2QMKA 1PX8A 2UY3A 4MPKA 1DWAM 2VJXA 1CXFA 3W82A 2QMJA 5D4YA 3BSHA 2WVUA 2CITA 1XD1A 1QNSA 1NWRA 1HN1A 2CKRA 3T09A 3VNZA 2F7QA 1KGXA 1MXDA 1GOWA 1A47A 3EJSA 4IPLA 4NXKA 5I5RA 4AY1A 1MW2A 1UA7A 2YIHA 3CZSA 3AIRA 1OGBA 4PUEA 4F79A 1V6UA 3AHYA 3CHFA 1BYCA 4AMCA 5JBEA 1EHNA 2XYLA 3QR3A 2F61A 5I24A 1QI2A 4U33A 3ZJ7A 2D20A 1T0OA 3UEQA 2JALA 4EAMA 1JGIA 1V3HA 1E1EA 1N82A 3GH4A 2IXVA 3ARYA 2OLHA 2VZVA 1VB9A 2Y4SA 3N18A 4PMNA 3SCSA 2D0GA 4NRRA 3CC1A 2ESCA 1C91A 1XYFA 4GZJA 2IUZA 3RMEA 2PWEA 1E4NA 1XV8A 3SCVA 3DC0A 1UR0A 2J78A 1UD3A 5EBAA 2EABA 3NCOA 3LXAA 5M17A 3WH8A 1WZAA 1KQZA 3AZSA 4UFKA 5ABHA 7CGTA 3ARZA 2YFNA 1NWTA 4B3LA 1UWUA 3BAJA 4AD1A 3WQ8A 4MAZA 2EPKX 1KQYA 5E6ZA 2J7FA 4CU6A 5BCAA 2EBNA 4W89A 3CUHA 1OGSA 2WMHA 3D4YA 2VX5A 1BYAA 1CPUA 4JFSA 4HP5A 4QLKA 3O2LA 4J3XA 1E4LA 3EYPA 1SYTA 5HOSA 4EKJA 3M07A 1NOUA 1OB0A 2WYSA 4FNTA 2VTFA 3QOKA 3EDDA 3OLEA 1E0VA 2YA0A 3WFZA 1PJ9A 3DX3A 5BXTA 1JDCA 1GJUA 4FNQA 4URIA 2Q8XA 1FHLA 2OW7A 1MXGA 2WKGA 1HJSA 2EPOA 2Z1SA 5C8BB 2ZXQA 4NZJA 3W38A 2VMFA 5CPQA 3SCNA 3KE0A 2ZX9A 3LRLA 1TUXA 2OW6A 3MMWA 4AEFA 1J0HA 4JAWA 1KWGA 4FNUA 3N17A 4PMQA 2YDRA 1X6NA 2QF8A 2D24A 1WDSA 5JIPA 4CUCA 1LQ0A 1Q6CA 3AJ7A 2XWEA 3L2MA 5D9OA 4BQ2A 3DX0A 4HA1A 1TA3B 4TVCA 2XPKA 4AIEA 4M8UA 3ARVA 3CMGA 2D23A 3RJYA 4C7FA 1QBAA 2PWFA 2X2YA 1XSJA 2GJPA 4AYSA 1NWSA 4YHEA 5E09A 1ZL1A 3L4UA 4PCSA 2G3MA 2WMIB 3SUSA 1XH0A 2RGLA 3WH5A 1ISZA 3A5VA 3HG4A 1JD7A 1CIUA 1WDQA 3QHOA 4M56A 3QOMA 1VEPA 1GONA 3SUVA 1X6LA 3PZQA 2XTKA 4FNPA 4MNLA 1KGWA 4UQDA 1WZLA 4UFJA 1QPKA 3A21A 3DX1A 3WDRA 1HKMA 3AMGA 1AQMA 5E70A 4W7VA 1A3HA 2OSWA 3BAKA 2WM0A 3HG3A 1KXQA 1B3WA 3CTTA 3SCOA 2WC7A 1BPLB 1QI4A 1J0ZA 1GNXA 2DIEA 2XVGA 4QLJA 3M6DA 4R27A 1FP8A 1HIZA 1HKKA 5A8PA 3LPFA 1V6XA 4PMZA 1V3KA 2G3JA 2WWDA 3DX2A 4XZBA 3BLBA 1GOIA 4CU7A 1B1YA 1HX0A 3BCDA 3WQWA 2V3DA 3ARSA 4RE2A 1WDRA 2WHKA 4P7LA 2YL6A 4PCTA 1RP9A 4CCEA 1US3A 4FK9A 1JF5A 1QWNA 1LL7A 1ITCA 1OCQA 2CBJA 2WK2A 3AS2A 1JZ6A 1CGTA 1KXVA 1DWIM 3S6TA 4D6EA 3TTOA 3W28A 5CQ1A 2J77A 2DT2A 4D71A 4C7DA 4HZ8A 2FH8A 2PB1A 3T2QA 3OA5A 3WQ5A 5IHRA 2YDQA 3J7HA 1H09A 3WF3A 4P7QA 5E6YA 1KR0A 3A4XA 3VGDA 5BWFA 1TQTA 3W81A 1OIFA 5BROA 3VPLA 1F4AA 1XSIA 3SUUA 4FF5A 4F66A 2WWCA 4MDOA 2BVDA 3BAYA 3KWXA 1RH9A 4RE3A 2B31A 4S3JA 4GXPA 5AC4A 3DECA 1E71M 3VD3A 3RO8A 3EMCA 3HJEA 3B9EA 2GDVA 1O7AA 1EOKA 2F7PA 3KLLA 3K8MA 8A3HA 3WMBA 1TCMA 2EAEA 3BVVA 4U3AA 1WZKA 1TA3A 3AHZA 1OM0A 4UNIA 5A2AA 1GUVA 2V5CA 3W0KA 4AZIA 2YL9A 4ACZB 3GM8A 3VX1A 5GQBA 1CXKA 1LF1A 2WMIA 1ESWA 3WDQA 2WC3A 3QHMA 2PBGA 3RCNA 1FFQA 1QVBA 4GKLA 4W5ZA 4Z2JA 4JFUA 1B3XA 2J7GA 3MUAA 3WUFA 2UWFA 1E70M 2VCCA 1ISVA 3NSXA 3WF0A 3G6MA 3WF2A 4JHOA 2DH3A 1HKIA 4PMOA 3FXYA 4GI8A 2WHLA 1HT6A 4FLOA 4L4PA 1B90A 2GK1B 1OGGA 1R75A 1G5AA 3WSUA 1JZ7A 4DM1A 1I1XA 1JZ8A 3ARXA 4MB1A 1CGWA 2QPUA 5DFAA 3CMJA 3EMQA 4JZ5A 1ODZA 2WZEA 5GNZA 3AQUA 1JZ4A 1ZBCA 4AZ5A 3MANA 1PZ3A 3GH5A 1M01A 7A3HA 2WC4A 3MMDA 4ZXLA 1E4MM 1V0NA 5IDIA 1XH2A 3VINA 3AXIA 2PF0A 4D6GA 4V2XA 2ZUNA 2QLYA 3VUPA 3VDAA 1LWHA 5EMYA 1MW3A 3PTQA 1ZBWA 1FP9A 2VZUA 4QP0A 3TV8A 1B30A 2J8FA 1HXKA 2F1BA 2DSVA 3OGSA 1KXHA 3ZQ9A 1H49A 2G3IA 4FLSA 4FMVA 2WAGA 1R85A 2BY1A 5CGTA 1B3YA 4UOJA 3WEMA 3VX0A 2CKSA 3EMZA 5ABFB 3RIKA 3HU7A 2F18A 1B31A 2WMGA 1VEMA 1CENA 2WLZA 4W7WA 1W3KA 1UR4A 3AI0A 1VBUA 2DT1A 3THDA 4NI3A 4P7RA 4ACYA 1BSIA 1CWYA 1WZMA 3IJ8A 3BGAA 2VURA 4F8XA 4UQEA 1W3HA 4U2YA 2V3EA 3GNRA 3SCUA 3AMLA 1JFHA 3K8KA 1JXKA 2CESA 3FN9A 3LRKA 1UR1A 2WKLA 4EE9A 1BYDA 5GNYA 2FE0A 4KGJA 2CXGA 4ATWA 1S46A 4MDPA 4TXEA 4OKDA 2W67A 4ACZA 2WLYA 3EJUA 5AY7A 2A3BA 5EB8A 4NZCA 1MWOA 1LG2A 1CLVA 4WLCA 2XVPA 3LMYA 5IXEA 4BS0A 1UG6A 5A95A 4AD3A 3OBAA 3WQVA 2YA2A 3AS1A 3AIBA 2WB5A 4PRWA 5HPOA 1NP2A 1VFMA 2JEPA 2GJRA 2C8NA 3CZEA 3T2PA 4IUGA 3W6MA 1SMDA 3CZGA 1TQUA 3BMVA 2ZXBA 1E0WA 2ZOXA 1V02A 3A22A 4CD4A 3E1F1 3NIYA 1DWHM 5HPCA 1HNYA 4WKAA 6TAAA 2GK1A 1GPFA 5A6MA 5AYIA 3EJRA 5A6SA 4WJXA 4AYGA 3WBAA 3MI6A 1UWIA 2EPNA 1E6ZA 1BGGA 1MFUA 3VDBA 1R7OA 1D2KA 3GXFA 4DUVA 2XVLA 2FYVA 1H0GA 4J3SA 5DT7A 2E0PA 2YLLA 3HMCA 2VNCA 1X1NA 2BXYA 4R5EA 3VIOA 2JIWA 5BXRA 2XJ7A 4HPGA 2VC9A 4BQ5A 1DWJM 4LYRA 3CV5A 2WPGA 4OIFA 4CVUA 1UOKA 2WBGA 1E0XA 5E1QA 4N0RA 4Q7NA 1CXLA 3VMNA 2YL5A 2WZIA 1LL4A 3H55A 3CZKA 5ABFA 1EDQA 3BUPA 3MUZ1 1R46A 3WD4A 4HU0A 4UFMA 3ZMRA 1U33A 1NWUA 2A3HA 4LX4A 2E9BA 1QBBA 3W26A 1WNOA 1OD8A 2WNWA 3WBEA 4J28A 3TP4A 2CYGA 3VIPA 4D6JA 5HBFA 4DO5A 3RM8A 1UD2A 4JKKA 5I0DA 1IZKA 2ZUWA 5CSYA 2X09A 2CNCA 3KL5A 6A3HA 1EGZA 3M7SA 1G0CA 1Z32X 4AIOA 3A6OA 4PMXA 1V3IA 2D2OA 2YL8A 4LGXA 1CXHA 3VIMA 4BQ3A 1M04A 4PMDA 3WNLA 1CBGA 4GI9A 1BG4A 2CIPA 4WF7A 4CKQA 4W8BA 1H4PA 4D72A 3WD3A 3VD4A 2EQDA 1JAKA 1GQJA 5I78A 4H8UA 2CERA 1G94A 4DO6A 1IZJA 2FDMA 3CUFA 1IV8A 2VX4A 3GYCA 5FL1A 1GORA 3W53A 3WD2A 3VGBA 1R87A 5E0FA 4IISA 3HZ3A 3G6LA 3ZJ6A 3RM9A 1JYVA 2DDXA 3WNNA 2DPEA 2XG9A 4IPNB 4A4AA 2E40A 2J79A 5A2CA 2XVNA 2ZX5A 2XFYA 4Q22A 5CPSA 3GXIA 3WDIA 5FKYA 1H1NA 3VDCA 1HL9A 1VF8A 4PMUA 1E6RA 5IFTA 4HMDA 5A8QA 4MJ2A 5CLTA 2EADA 4CN4A 3RJXA 1FA2A 3DX4A 3AHVA 2WANA 1W9UA 4AEEA 4UQ9A 2ZUTA 3MO4A 3OB8A 1JI1A 1K9FA 1C7TA 2XFFA 4NRSA 2J8GA 2YOCA 3N1AA 3ALFA 1M7XA 3VIFA 4J27A 3VU2A 5F7UA 3K4DA 2PI6A 1UQYA 4X9YA 4D6FA 1JL8A 5DF0A 2DH2A 5JBFA 2ZUVA 1E6NA 4BCEA 1JYWA 4JKLA 5DEZA 4CD7A 2W62A 1Q6GA 4S3KA 3ZR6A 1TR1A 3LXBA 2YBUA 4PSRA 3SCTA 3A23A 3LXCA 4LQ1A 3AYSA 2J74A 1WCGA 2EXOA 5HXMA 3POHA 3GNOA 3BLKA 5E9AA 4OOZA 4H2CA 2FGZA 1TMQA 2VRQA 4TVUA 1H5VA 2J7DA 4D6IA 4LPCA 2W66A 4AMWA 3PN8A 3WDHA 1CXEA 5ABEA 4NSBA 2BNJA 1V0LA 3N12A 4MNKA 1TG7A 1HJWA 1XSKA 3WUBA 1JFXA 3T0AA 3KZSA 1V3JA 4UQBA 1UD8A 4JIEA 3CHEA 5I79A 3BVTA 3UR8A 1JZ2A 1GOMA 3H53A 4WKHA 1V02E 1PIGA 4GQQA 5AC5A 1UZ4A 3TTYA 2CBUA 3UCQA 2MANA 2V3GA 3MU7A 3VD5A 1WPCA 1E55A 4OBSA 5CSUA 3GBEA 4PYSA 3U7VA 3S2CA 2VQUA 4X0VA 1JG9A 1SR0A 5LA2A 3CZNA 1U30A 2XSBA 3EJTA 3PZGA 3U5UA 4WKFA 1E43A 1JZ5A 4P8VA 4L4OA 4AD0A 2J25A 4HPHA 1C3FA 3UR7A 2OSYA 4W7UA 3VD9A 3HG5A 3L4YA 2NT0A 4MJ4A 1KGUA 4PTVA 4B9ZA 3N15A 5A94A 3B8SA 3NYDA 2JIEA 4RE4A 3AXXA 4W87A 3F5KA 1ZBVA 3WEOA 1VFFA 5ECUA 3WKZA 3D3AA 3MV11 3W25A 4FNRA 3WF4A 5DMYA 2BHZA 1ZBKA 3MMUA 3L4ZA 1QNPA 2F8QA 2E9MA 3WENA 1XD0A 1MQRA 4DUXA 1UWQA 3VDHA 3N13A 2BFGA 2CETA 1WDPA 3CUIA 3FW6A 3FAWA 3QHNA 1E4IA 1EXPA 1SZNA 2FHBA 3FY1A 4W93A 2AOSA 1B3ZA 3BUIA 2DSWA 2NT1A 3D52A 2YKKA 2UY2A 2VZSA 1UWRA 5A69A 1Y7VA 1CEOA 1GOOA 4AIUA 3TTQA 3OG2A 2DT0A 1PBGA 1LG1A 1C90A 3VGEA 3W27A 5I6SA 2QHAA 4X0NA 1UKSA 1GVYA 3DYMA 2D0HA 1P6WA 2WHMA 1QX1A 3K8LA 3VMPA 2BY0A 4KRUA 2AMGA 4AZCB 4CCDA 3WF1A 4CCCA 3RPMA 4D1JA 3GXTA 1AMYA 1DHKA 3HG2A 2XIBA 3CZJA 1FHDA 3NJ3A 3DHUA 3WELA 2O9RA 1JXJA 2X2HA 1MQQA 4F9DA 4PEEA 1WKYA 2E8ZA 2BHYA 2V38A 1KXTA 5A8MA 4AZBA 3VIIA 4QAWA 2VR5A 2YBTA 1BVNP 3ALGA 3WY2A 1EQPA 2CCRA 4EANA 1OBAA 1RD6A 2G8ZA 3T2OA 2VX6A 1W2VA 3DYOA 3PZVA 2WCAA 1HWWA 3WH7A 1MQPA 6CGTA 3GZAA 4OUEA 4MADA 3IK2A 1W9BM 2J75A 1Q4NX 3THCA 5I23A 1NQ6A 2EJ1A 3MS8A 3U7BA 2GUYA 3D51A 1UWTA 1IT0A 2D3NA 4BA0A 3BCFA 1H0IA 1DTUA 3CLWA 3WDJA 4MB5A 1VIWA 3T0DA 4M80A 3IANA 1W32A 3L4TA 3PZNA 3LRMA 1NARA 2BHUA 2WCGA 5CJ5A 1GQLA 2BY3A 4E2OA 1W91A 1CTNA 3ARTA 1OT2A 4OBRA 2NW0A 3A4WA 4HOWA 4JFVA 2HVMA 1QW9A 1E56A 2Y8KA 1GQIA 1UZ1A 3EBVA 3ZOAA 5FOOA 3PTKA 4AZ6A 3WUEA 4AMXA 4F9JA 1W3LA 2X2IA 3CGTA 1QHPA 1JI2A 3WY3A 1FH9A 1GOKA 1BTCA 3UETA 4H8HA 1R47A 1U2YA 1GOQA 3WN6A 2AAAA 1HTYA 4Z2GA 1EH9A 3OGRA 5CG0A 1QNQA 2WVTA 3PZTA 1WP6A 3TA9A 4E4PA 3BMWA 3A4AA 1UKTA 5A6LA 3PZIA 3VMOA 2WMKA 1BAGA 2WCSA 1PX4A 1J0KA 2D3LA 1GCYA 1XRVA 1VENA 2X8RA 4E8DA 4ZFMA 5C70A 5BXSA 1PAMA 5LYRA 3VNYA 3I3BA 1RP8A 2WHJA 1XC6A 5AYBA 9CGTA 3A3HA 5D9PA 3K46A 2WZHA 4AZCA 2YJQA 1W1YA 2G3NA 1HVQA 1UD6A 5A6JA 2V3FA 1MFVA 3FAXA 2GSJA 1KB3A 1KTBA 2NSXA 3CZ8A 1R8LA 4UZSA 3VIKA 4GIAA 3NDZA 1CXIA 3TONA 2F7OA 3BC9A 1JIBA 3D50A 4B3KA 3AROA 4OJYA 3MUIA 3VGFA 1MW0A 1L8NA 4MNJA 5IFPA 4U31A 3BVWA 1VJZA 1US2A 4OZOA 4H7VA 4HU8A 1ECEA 3WL1A 1ZJAA 1BFNA 4EK7A 2E3ZA 3EDJA 5M03A 3GXPA 1KCKA 1CZ1A 2XGBA 1Q6DA 1DWGM 4WSKA 1E6QM 4LYPA 3ZJ8A 4PTMA 3GTNA 2JE8A 3GXMA 1NH6A 1UH2A 4DO4A 1DWFM 2TAAA 1HP4A 4QFUA 4CVWA 1KBBA 4WIWA 3S5YA 1E72M 2DSUA 2W63A 2VZOA 2J7HA 2OWWA 1JZ3A 4YPJA 4NX0A 3VD7A 3ZIZA 4M1RA 1OWQA 4MB3A 2GVYA 1HJVA 1V3LA 3CIVA 2O9PA 4LXFA 1HL8A 1G01A 3AIUA 3GBDA 1E1FA 5C71A 3L4VA 1SMAA 3LPPA 3TTSA 2DSKA 3VGGA 2XIIA 5JBDA 1EDGA 2Y24A 2EO7A 1E6SM 3N9KA 5A2BA 2WW5A 3IAQA 3PZOA 1PEZA 3WY1A 2XM2A 5FL0A 4FLRA 1V6YA 2WBKA 1C92A 3A24A 3BUDA 1LWJA 1TVPA 4M82A 4BF7A 4P8WA 3VSTA 3CHDA 4GO9A 5I3DA 1BHGA 1JNEA 3H54A 4DWSB 2CEQA 2XGIA 1C8YA 3SCRA 1TVNA 3WNPA 5A8OA 3I3EA 1NOWA 2XHYA 3B9AA 1UD5A 2O92A 1OINA 1UH3A 3WMSA 1XH1A 1ZJBA 4ZE4A 3ZSSA 3W37A 2F2HA 1GW1A 3NDYA 3SUWA 5D9NA 1V6VA 1ODUA 4N42A 2BV9A 2VRJA 1XCXA 1TQVA 3NSNA 3NSMA 3NUKA 1EA9C 2G41A 1BQCA 1QHOA 3CPUA 4HMEA 2WVSA 2XWDA 2WMJA 2CHNA 4MNMA 3WUGA 2A3EA 1VFUA 5LA0A 4U2ZA 4ZENA 3AIQA 1DP0A 3VM7A 4MAVA 3MUY1 1O6IA 4UCFA 3CO4A 1HKJA 1W1TA 5A8NA 4UZUA 3AZRA 3ARQA 2WXDM 3ARRA 3KEHA 5BRPA 4K68A 2ZX7A 1M53A 1PPIA 1R7AA 3EDEA 5CGMA 4TX8A 1OT1A 3S5ZA 2DT3A 2CHOA 5HDRA 2HISA 3VKKA 4D6DA 3AS3A 3CH9A 1D3CA 4J3TA 1H41A 4U5KA 1QWUA 1C8XA 3PZ9A 1QI0A 3AOFA 3PHAA 5D8ZA 4B9YA 1C93A 1H3GA 4ATLA 1NM9A 2GJXA 5D9MA 4KRTA 1GJWA 2D22A 1MVYA 3DDGA 1V03A 1E3XA 4QCFA 4ZE5A 3BAWA 4LYQA 3ECQA 2VQTA 1W9XA 3BAIA 1AQ0A 2CPUA 1JDDA 2VZTA 4HZ7A 3L4WA 3AISA 4D1IA 1QNOA 3WH9A 2O9TA 4H04A 2RGMA 4PSPA 1NP0A 3SCQA 2C0HA 3WL0A 3AMKA 4U3CA 3F5LA 3N11A 3D4ZA 4CN1A 4AZ7A 1J0JA 2VL4A 2VRKA 3BUBA 4CU8A 4CN6A 3VO0A 3KLKA 1R86A 4TVDA 3AIWA 4PTXA 3BVXA 2ZWZA 4HA4A 2ZUUA 4NZFA 3LX9A 2VVNA 1EO5A 3FHAA 4W5UA 1XCWA 3UG3A 3EJPA 3W4RA 2XVKA 1E6XM 4OOUA 3WQ4A 1BF2A 1CNVA 1UASA 3AMDA 4AZHA 2VI0A 1LLOA 1EDTA 2XN1A 2ZE0A 4FLQA 1UWSA 3CHCA 1AQHA 1QI3A 2BVTA 4DWSA 4HOZA 1PS3A 7TAAA 3WD0A 4GO8A 1QI5A 3BVUA 1J10A 1VRXA 1FH7A 1HF6A 3W29A 3ARPA 1GZJA 4JCLA 2ZUMA 5FD0A 1BG9A 3K1DA 1VAHA 2ZX6A 2CBIA 2JEQA 4V27A 5KEZA 1E15A 2QPSA 1VFOA 2D1ZA 3SCWA 2VVSA 1EQCA 4AZGA 1Q6FA 4ATDA 3ARUA 3MSDA 2DSZA 3WFLA 3OLIA 1W9PA 4PMRA 1VBRA 2J7EA 1K6AA 1V0KA 5HNNA 2VT0A 2XN0A 4J3UA 2OYKA 1FFRA 4W88A 2X05A 2J7CA 1BYBA 1CGUA 5CLWA 1ITXA 1W1PA 2A3AA 4AD4A 3BSGA 2XUCA 4ZXOA 4PBGA 3A47A 2Y5EA 4UOQA 2OWCA 2W5FA 5I77A 1UQZA 3EDFA 4P7NA 1BVZA 3DHPA 4WSJA 1WO2A 4ZEPA 1B0IA 1LL6A 1K9TA 1E40A 1E5NA 4W86A 1G9HA 3N04A 4QDMA 3WD1A 3DDFA 3ZT5A 3VIJA 4A3YA 2BS9A 4UTFA 4V28A 4KMQA 3SIMA 1UR8A 1UKOA 2IXUA 3AYRA 3L4XA 5GPRA 2VOTA 2WVVB 1G1YA 1QNRA 3D5HA 3WNMA 3VIHA 1JYXA 4GPNA 4W85A 3ZSTA 4B15A 4DM2A 2XN2A 3VVGA 2UY5A 4D6HA 2W61A 2YDSA 5A6AA 2J62A 3F4VA 4J3WA 1R34A 3AMCA 4TTGA 5DO8A 4AW7A 1JAEA 1LJYA 3DYPA 3BUQA 3OLDA 5BXPA 3ZT7A 4KGLA 1PZ2A 4HOXA 4C7GA 4Z2KA 4NXSA 2PC8A 4IM4A 2X0YA 5E0CA 3AIEA 1ZB5A 1J0YA 1OIMA 4JFTA 3U5YA 5A6KA 2ZUSA 3PZUA 2ZICA 1OD0A 5EFDA 1B3VA 3EJQA 2ZX8A 2OWXA 1OSEA 4KWUA 1ISXA 1B9ZA 2VCAA 5ABGA 5A3HA 1QW8A 4CD5A 4GQRA 2PWGA 1EHAA 1WB0A 2VR4A 1KBKA 1EOMA 3B9DA 2OYLA 3WNOA 1EIBA 5FIPA 1UYQA 1V6WA 2WMFA 4GZIA 4XX6A 1D7FA 1J01A 1F4HA 2PWHA 2DQXA 2DIJA 3UG4A 3AIVA 1UKQA 2F7RA 2VCBA 4UFIA 1HVXA 5CZKA 2CBVA 1UD4A 2VUYA 3CUGA 4JCMA 1W1VA 3VSUA 4PTWA 4P7OA 2FH6A 1UH4A 5EFFA 4YN5A 1H2JA 5CXPA 1CLXA 2Y8VA 2ALWA 3MKKA 1PIFA 3F5JA 3OIHA 4HTYA 4UOZA 1HJUA 4NF7A 2PWDA 2EPLX 5DT5A 2DGAA 4OGZA 1GQKA 5A1AA 3ZJKA 3VTRA 1EO7A 1WE5A 3AICA 4PN2A 3AHXA 4MB4A 4AC1X 4QCEA 4W8AA 1K9EA 4HA3A 1J18A 3BAXA 4W84A 2E4TA 3OZOA 1JNDA 3SEPA 1QOXA 4J3VA 4M29A 1DEDA 5M3WA 3OLGA 3IJ9A 2XSAA 4DWSD 3GXNA 2EPMX 2UY4A 1TQSA 1GHSA 4AD5A 4WK9A 4Z2LA 1V08A 3UESA 5BYWA 4KH2A 2Z1KA 3U57A 1CGYA 2W91A
chains in the Genus database with same CATH superfamily
1T2QL 1FWDC 4U05A 2OEMA 2FGLA 43CAA 1A3RH 2OFJA 3ILQD 3NCMA 3KAOA 4XPFL 2LLLA 4UT7L 1TNMA 6TIMA 3UMNA 1R3WA 3FTYA 4OR1A 3FPYA 3QC5X 4BZYA 1FCBA 2A74C 3PULA 3ZQXA 4XBSA 1KRAC 1YQ2A 5EF2A 4I89A 1HL5A 1UYWH 2ARJQ 3GH7A 1JNHA 2BZ7A 1CYGA 1HH6B 2J57A 2W0KA 5MEOB 3WJXA 4ROPA 4OCRH 2DY3A 5MKGB 1JHLL 3G24A 3D0LB 3RPKA 4EXAA 1AC6A 4F40A 5EU7C 3MJ8B 5DVMA 4M9PA 4C5ZA 5DMGD 4UU9A 4E9YA 4H1LG 3T4WA 1EHXA 3R18A 1YNQA 3MLUH 1E5CA 1NCCL 3WIJA 2Y5TA 2JTYA 4JRXB 4IX0A 3ZE2F 4XTDA 1LEGA 5J6GB 4QOKE 1DL3A 1RAMA 1AFSA 1BQLH 1OZQA 3FQ4A 5FLVA 1HTIA 4UTCA 4GVHA 3WTUA 2H3XC 4AU0A 4N86A 4AISA 5FGBC 1SN5A 3STZB 2GPZA 2H45A 3ZDZB 4V2BA 2AJXL 3R25A 2WLIB 1VH7A 5CD3B 1LO3L 3C2AH 3CDCA 2CM5A 4WEEA 1W2PA 4PI0A 1TPEA 1TQBB 2WTOA 2OFQA 5K9XA 1FKWA 2QT6A 2GBUA 2PRHA 3GSNL 3XINA 5JO5A 5C54A 2H8PA 4AJWA 3Q45A 2XFRA 4DPPA 3JWDH 4XP9H 3KPRE 5KANG 1N67A 3KL3A 3I74A 3UGUA 4OD2B 1NQBA 2CFFA 3JZ7A 4DP0X 4JN2B 2DUZA 3HI1A 1CFSA 5DD0L 2Y61A 1UGKA 1Z89A 1C7SA 1A6AB 1UUQA 2BVPA 1J9YA 2VDPB 3KPNB 4NJIA 5C9UA 2EDWA 3CVHL 4XCCH 5B3NA 4BSVA 5F72S 3LBCA 3WE1A 4MA7H 1DIDA 4RGMB 1CGXA 4KQ0A 3CE1A 1S5WA 1KSRA 4JNYA 3TOPA 2D73A 3ARDA 3QJXA 3AXHA 4R0LA 4RZCB 2IOIA 2Q76A 3W82A 2QMJA 3N6JA 4DP1X 1I9CB 4LCUA 4JPVH 4Z95L 3B3BA 2FX9H 3B04A 4OTKA 1DQJB 3T6ZA 5E1AB 4RGNB 3V4VB 3V4UL 1TTRA 4MJIE 1HHKA 4XMUA 1HNFA 1HINH 4PUUA 1X7SA 1K85A 2PW2B 4NO5B 3CIQA 1JEZA 4HS3A 1NSNH 4I9WD 5CPMA 2F5BH 4TNVK 4ERGA 4FE9A 3CC1A 3E6HA 3L5XL 4XNUH 1A4CA 4DJFD 3HV9A 3DC0A 5B1BB 1PBYA 2P5EA 3SDXE 5ABHA 1VSCA 3N1MC 5CG7A 1WSST 3KRSA 2EDFA 3LHUA 5C6WH 1IB5A 5ABZA 2FPTA 2A1WL 2WMHA 1YN7A 4FF7A 4TO8A 4Y16A 4P8QA 4KRZA 4E9VA 3LGEA 5M95B 2CZ5A 2XKSA 1IFRA 1E0VA 3O6LL 4ODSH 4XHJD 25C8H 1QFPA 3PJWA 3GI9L 5JIDA 1TTCA 5C8BB 2QDEA 1KG0A 1PG7X 3GR8A 1QO2A 3MMWA 2OK0L 2NQJA 2BOGX 1WCBB 1OE1A 1SXBA 1UB6B 3JV6B 1EVUA 2ATKA 4WI3A 5B8CB 1L7TH 1IL1A 3RDTC 1ZQ5A 4XMWA 2IAMB 4MRCA 2DMCA 4M93C 3SPVA 4YHEA 2HJFA 5IB2B 2UZXA 5LHDA 3F5WA 1KB5L 4Z5RB 4Z3HA 3P3BA 2ODOA 1MXSA 2P5WA 4X6DA 5JXED 3HFFA 3B3IB 3W56A 4N6EA 3A21A 1PZCA 4YLQT 3S5SA 1U8PB 1VGEL 3ZGIA 4C6MA 2Z31D 3V52H 1QI4A 2F6UA 4S3BA 3VZXA 4FXSA 2XVGA 4JDZA 3B2DC 3ET9F 1V6XA 5KSVB 3NCCB 2I9UA 3TXZA 4B91A 1L3NA 1PKLA 1HZKA 2B4GA 3FCSB 4PRBB 1GOIA 3LN4B 2VUKA 1QPXA 4O11A 4L8BA 1A2YB 4AC4A 2H3NA 1ROWA 2O4QA 2VDIA 4JRXE 1PSKL 1Q8JA 3HZYB 4B3EA 3S35X 3NTYA 4Z7OB 1HSBA 4MYAA 3T71A 2B1HH 3W28A 2P44B 2FH8A 5CJXA 1CFTB 2J6XA 5GJMA 1B0WA 1GZQA 3ZDZE 4MCZA 3VGDA 5L6YL 4K3EL 3M0YA 5C0ND 3ZL1A 1KIRB 2B31A 4S3JA 3QUZA 3UROR 3U2CA 4LCYB 4FX7A 4JFXB 2YO3A 1DYSA 4ODWB 3GNNA 1XJBA 3Q6FA 4OCSH 1XIDA 5H94A 1EEZB 3GSOB 1P9MA 5DS8A 2EXTA 1ES0B 2NX3A 3RCNA 1W72B 5DEFB 3A4DA 2CA3A 3HA0A 2QELA 2V5SA 2NPLX 1ZSDB 2UWFA 5IT2L 3X3FH 1IT7A 1HKIA 1L9SA 1HOCB 2QQKL 4L4PA 5LO7A 3FO2A 2C3XA 3IDNB 2W5PA 5TF1H 4CVXB 5LAXB 5FYKU 1JZ4A 5I6NA 3MANA 3WFAA 1V0NA 3GDCA 1NJJA 4V2XA 2YYUA 1ZBWA 1FIGL 2WV3A 1XGQB 2KDYA 3L7EB 5BS0D 1CWVA 5IMLA 2MCMA 4Y1TA 3QJTB 4RGNE 4FLSA 1RSCA 3MA9L 5L7XL 3NL2A 4P2QE 5JU6A 1JHKH 6REQB 2Q71A 5D1QB 1KFBA 4X6EB 3TJPA 2BDNL 3DKLA 3OOQA 4DXVA 3VZYA 3L1OL 3PL6D 1ITUA 1XYBA 3LCXA 4HCDA 2XN9D 4P59H 5AYTA 4Y7MA 1OW0C 2Q8BL 3DO7A 3A6CH 1KN2L 3KWSA 2AK4D 3DVGA 4ORGA 4JAMA 3KXFE 1KCRL 3LCHA 1SQMA 1TO3A 4JBSA 3C5ZA 3CZGA 3GG7A 3BMVA 2ZXBA 2NYKA 2OA9A 1VGAA 5DY3A 3QEGL 3FRPB 3B0VC 1HNYA 1TT6A 3FJNA 4L3CA 3VGAB 3GW3A 3ZTJG 2J13A 3E80A 1LVEA 2A9BA 2VSDA 4BFRA 2EG7A 1M5WA 2WNGA 2V69A 1H0GA 3Q05A 3SY5A 3DVFA 2E0PA 2OSLB 5K39B 1NSJA 3LN5B 4L7ZA 4P06A 2MOVA 4EZMA 3OQRA 3WQPA 4YHOH 2AVGA 3PB2A 3G5XA 2WBGA 3BPNB 3TZVD 3V9FA 3RZCD 2FJGA 4P61A 3UZEA 4JS7A 2HMIC 4KQ4H 3KDMB 4I1PA 5ABFA 5CSBA 2BZCA 1R46A 3FUMA 2O72A 3LB6C 3W7KA 5BV7C 4GABA 3C0LA 3CFJB 5I6LA 3JBG7 2CBMA 4DP4X 5DYFA 3T3MB 1PKNA 4KZCA 3U7WL 3CU1A 3MXWL 2X09A 3UPWA 2PP8A 1EGZA 5HDQL 1TLKA 3C6LA 4AIOA 3DV6A 5E2JA 2OJ1A 3QJUB 1XWVA 1U3JA 3HGSA 1H9DA 1CBGA 4KJPD 3AREC 4JJHA 3GRWA 4EDWL 2R1NA 3QDMB 3TNNA 4GSDH 4J1UB 1MEWA 4KXCA 5T33H 3QFJD 3ZJ6A 1TTFA 3Q4DA 1P4IH 4GXFA 4Z7OE 1EFXD 1JRHH 5C0BE 4Q4MA 2IQ0A 4QO1B 5FK9A 5CLTA 5J57B 4JFDD 2DQ6A 4KXDA 5FB8B 1MZHA 2WANA 4X0KA 4Y1AD 4I85A 2ZUTA 1CFMA 3BJ91 2XA3A 1AXSB 2FUQA 1GGBL 3SDYL 2YUWA 2XA8H 3MGAA 5F7UA 3VFGH 5E8OB 1NCUA 4GAYA 1SO6A 4LLQB 1ICQA 4MKNA 2UZPA 1OZTG 5G5DB 3Q58A 2C0AA 3V0GA 3BSZH 2DD8H 4P46A 4M1BA 3LXBA 4Q7BA 5KW9L 1E9IA 2J74A 1T1YB 4KX9A 3RQ3A 2P49B 5DWUH 3WDHA 4XD4A 5ABEA 1P0DA 4FHKA 1YBQB 3WUBA 3KZSA 1FO0B 1V3JA 1AS7A 5EDSA 4ZUVB 1P4CA 5BQ7B 3PABB 2SEBA 3N6HA 4AZ8B 4CADB 1EJ7L 1CVRA 3SKOA 4IRZH 3QDHA 2XPGB 5IW1B 4UOW1 4S3FA 1JG9A 3I9IA 1T66D 3VRJA 1TO5A 3JVGC 3ZDXB 4JFOA 4HCGA 4AENB 4AQ8C 4LEFA 4I3RH 1XL6A 2ITDA 5CEYA 2YD4A 2B20A 4IGMA 3LKSB 2D2GA 1E5BA 1LDSA 4C6LA 1UM6H 3N2OA 3MV7D 3SN6N 2XN9A 2AKRA 3N13A 3PJTA 1G7HB 2OZTA 1W5NA 5IIEA 4L9XA 2YAPA 4ZTOL 4WWOA 4D9LL 2WWOA 2AK4A 1SLUA 2CBPA 4KKPA 5B3JE 3HJZA 2YKKA 4ZFGH 2OLAA 4FQXC 4I7UA 1RFDH 3USBA 4YHZL 12E8L 1XI3A 3GJFB 1NMCC 1EFZA 4I6KA 1QZNA 3ALXA 5KVFL 2FMNA 2WNKA 7FABL 2OQJB 3UC2A 4KCUA 3R89A 2W1NA 4BK9A 3C87A 2VH5H 5I2IB 1Z41A 4O28A 4A3QA 3ESOA 3SRDA 2UV3A 3AVEA 3ZTDC 3GMPB 4LLDB 3UYOD 3O3BB 1FF5A 3CNYA 1EQPA 1FBIH 3CHVA 1VIZA 3C6EA 4WEMB 3RGVA 2GY7B 1F7BA 3CG8A 4A3RA 5D1ZC 3UJIL 2XSXA 5J56B 4DN1A 3L0NA 4EXQA 3BCFA 3MRJA 4JTLA 1IT8A 4NT0A 2GJ6D 4O1BA 3DURB 1OT2A 4UM9D 4GCAA 1J1XH 2NCMA 5MI0B 1R5IB 3EBVA 3S2JA 2P45B 2TRSA 1NCDL 3GNMH 4K5OA 4PRIA 4KVNL 4ODUB 4QROA 5KYYB 3T3ME 3CXDH 5B4MC 4R26H 3K0YA 4HG4J 3PFRA 2E27L 3RX2A 2ZVIA 3M5VA 5H35B 4X4ZA 4QNWA 3W57A 4HLZH 1XRVA 3QFJA 5C70A 4P4RA 4YE4H 4AVHA 3RPIB 5LYRA 4LSVL 1V8EA 4FTVD 4M6QA 3ZRCC 3QRHA 3UZVA 3T77A 2Q8AH 1XLJA 5I1JL 3XIMA 1JERA 3QDME 4PJBA 4TL4A 4GIAA 3W11D 4OT1L 4HZLB 3S9DB 4X5XB 4YNGA 1F58L 1OSZB 1KTLB 4BKSC 4HU8A 4I3SH 2W65B 1OGPA 1KT2B 2AJUH 4OD1H 4ZBJA 4JTEA 2IQAA 3CFIC 3RVVC 3MBDA 3RTQA 4AAJA 5AG9A 3SPHA 1N2VA 4J3ZA 5FJTA 2PLJA 1V3LA 3QEQA 2E46A 3U2SA 1LTXA 5KOVC 4DELA 5FKPB 1AKJA 4GOSA 2G2PA 1XIWD 4RXGA 1YLVA 4LSDA 4WVRA 5G55A 4MDJB 5FEXA 4BF7A 4GP5B 5C09A 1NBQA 1BVOA 4E4UA 1NAMB 3TVMA 3GRWH 5DCEA 1AD9A 4HGKC 4X2RA 2C9UA 4MUPA 4C4UA 2G2RA 5KN5A 4OV9A 2IWEA 4YHPA 4HGWB 4YSOA 4ESKA 4XZIA 1P4BH 4GKSA 5AOIA 1UWGH 4P5KA 1O94A 2CIIB 5T26A 1XLMA 4JHUA 4M62L 3SZKC 3FONA 1MFAH 2ZZ3A 3MA7A 4HIQA 4KNQA 4UQ3B 1IBBA 4HHPA 3LQAC 2HRPL 3EO9L 4UZUA 5EPMB 1OT1A 3BP4B 2DT3A 2E3VA 4JDBA 3PPSA 2DV0A 1FRGL 4D2NA 4AITA 1YYML 1NGXB 1LE5A 2M1KA 1AQ0A 3IJSA 3EO0A 3TYCA 2I85A 4H88L 2EE0A 5EN3A 3QXWA 5FF6B 3TYEA 5CCKL 3BUTA 3UXAA 4ZW6A 2WUCH 3QZOA 2D03H 1CLCA 4CN1A 5K9OB 4OECA 3VO0A 3KBJA 1UOVA 4HJTA 1TWZA 1N10A 3MW7A 4UWQB 4FXKB 3IXTA 2BWDA 1KBGL 3C09C 1QI3A 5BQDA 4B7IA 2R0LL 2DYPA 3BFWA 2ZUMA 1BG9A 5EOTA 1YTKA 4BRVA 1FWBC 4P3DB 2PPDA 3PWNA 5ERWB 3S2MA 4LVOC 2Y72A 5HR6A 1QO3A 1WBXA 2JI1A 3UZJA 1BPVA 2DJSA 5IHLB 1ET7A 2D7MA 2WGNB 2AQWA 3G5WA 1SEBB 2VT0A 1JGUL 1LT8A 3TFCA 1WXYA 2GUOB 4XPBH 4P23D 4ES8A 5CLWA 1T4WA 3N85L 5CPLA 4XZUA 3PUOA 2ZJSH 3GVQA 1UM5H 1A1NA 1WO2A 4GQZA 3K30A 3VG9C 3U9PL 2X4PA 1R9XA 4EUPG 1WHPA 1QLFA 5GPRA 4I0KA 4XPTL 4GUGA 1O9ZA 3QNZA 5J4MA 3RF9A 1CQYA 3U0WL 4O2EB 5K9QI 4AW7A 4FTVA 3CWHA 5D5ME 4I48A 5A2KH 3VKBA 1J6PA 5IVXA 2IPKA 1I31A 2X7WA 1A1OB 3NDYE 1B9ZA 5HJLA 4PY7A 5ABGA 3NR0A 4XO5A 2AVFA 3UYPA 4L4MA 1SJHB 5C0AA 1ZXQA 2EJAA 3I6GA 3S2LA 3PUDA 4XHJC 1UD4A 4JCMA 1MFCL 4MVAA 5TPWH 1EZUA 4JGUA 4UOZA 4IOFC 3CLEL 3VTTA 4XAZA 4JCWA 1CE1L 3VTRA 1BQHG 2WJDA 3LEXB 4OFYA 1VHPA 3I75A 3MOQA 1NJ9A 5ANMA 2CUIA 4Y5VC 4WV1A 2WLJA 1GEHA 2J24A 5HDBB 1BZQK 1O0VA 3L08A 3OLGA 3HAEG 4YLBA 2UY4A 4GFIA 2DEYX 5LG6A 4WK9A 1M7JA 1J1PL 2Q3ZA 4JANA 2Z00A 5IQ9B 5JHLA 3WE6B 1Q65A 4S3CA 5E2UH 3FNDA 4AQ1C 1CBVH 1CECA 2E9LA 4PWFA 2X1IA 4KEVA 4AGOA 1XLAA 4FULA 2YPKA 4QRQA 2ICSA 3QZWG 4X2PA 3MJMA 2ZKYA 1Z3GL 4AD2A 4GLRH 1P6BA 3TBYB 4GI6A 3LPOA 4JDEA 1PLCA 4GSRA 1P69B 4QR7A 2H32H 2GKIA 2HBVA 3EOUA 3X3GL 4FNSA 1MCBA 3CSGA 3P74A 4L8SB 2B0SH 2C15A 5F1UA 3H4GA 1H50A 2NXHA 2PYFA 1KLZA 4JFFB 2IADA 4G2AA 4HZ6A 4J7RA 3BXWA 1KTCA 2V5LA 2ATSA 1OOWA 3X11B 4CNPA 4WTQA 3GEFA 3RBSA 3HBQA 1K9DA 3MLYL 3GPSA 2OMXA 4YHNA 1VFBB 3T0XA 1IGML 4WGWB 2PDXA 3GHUA 1GSMA 3VFVB 4IRSB 4WRHA 4YR6A 4HMCA 1V3MA 1WEJL 4DWSC 4CC4C 3S36H 3BI9X 4NQDD 3QW9A 1HP5A 5IBXA 4NQCD 5E7BA 3T08A 2E8YA 2VXVH 3QJOA 4JG5A 1ZLUK 3C8NA 2FB4H 5C9RA 4NQTA 1NCBH 3SW6A 1JV5A 1P1ZB 3CBWA 3V95A 3KYMA 3MLSH 4KVCL 4GRWB 2QVNA 3FO0H 1ZLEA 3QVAA 1RK0B 1FOBA 4UFHA 4DPAX 1HJQA 1TKWA 3G1AA 1AZRA 3CHXA 1U91B 4HNUA 4XB7A 3QZNA 3BVNB 2E7LC 2XZCH 1BM3H 4TNEA 3K2UL 1TTPA 3VCRA 2J4GA 3GVRA 4E8CA 2AV7A 3VSVA 3IGSA 4KOBA 5E08H 3T9PA 3L5HA 2WPBA 5ICUA 1G6RA 2YXVA 5EY5A 5AW0B 4HHLA 2FL5A 4G7YH 2Q86A 4DKAA 1D9KC 2DWXA 2UY3A 1Q5MA 1IEAA 4H0LC 4EXKA 3WD5L 4UBDC 2V9QA 3MKVA 5DHYA 4XAYA 5DUPL 3W75A 4M1DH 3SGEH 2V5JA 3IRSA 3RWEB 6ENLA 3NXLA 1XGYH 5CM1A 5CBJA 3MDWA 4QRUA 1WYIA 2XIMA 5ISZB 3EOOA 3HC0A 2HVJA 3RDTD 1T2JA 1Q45A 2XYLA 1RUPL 5F71A 3GMNB 1TKKA 1DUZA 1I0BA 4U1MA 5JQ6H 1YEGL 3U4FA 3RNQA 1BIHA 2QXWA 3BXNA 3QJHA 4C6QA 3QKZA 4GZJA 4MDRA 1G0YR 4XC3L 1WC7B 3WH8A 3FDGA 2OO0A 1WZAA 1LM1A 2FJHB 1UWUA 3WQ8A 2W0UA 2DTMH 1AH1A 1JVNA 1FXQA 3M1CA 1NFBA 5LIYX 4Q0XH 3WJJA 4MMZB 4C6IA 4TUKL 1F3EA 4NFDA 5A7BA 4QLRA 1PJ9A 2OS7A 1WTLA 1VGKB 1MXGA 2VLKA 3W7GA 4C1NB 2ZX9A 5AZ2H 3H7BB 2G4EA 4M7ZC 4Z7WB 3EPOA 4PBXA 1X6NA 2WNQA 4UTBA 1M6OA 1IGFL 1G1CA 2FEJA 5H4YA 4XT1C 1U3ZA 3TN0C 5E2TL 1KJ3H 4HD9A 2D23A 2R1YA 3UXFA 3KWWB 4J3OF 4LCCC 3WYRA 3L5AA 3SE4A 3TH6A 4OW6A 4WY7L 3HRPA 3UBFA 4FG0A 4B5NA 1WZLA 3OG3A 2O4MA 1D6EA 2V5RA 4ONVA 4KAQL 1MEHA 1V5XA 3GRIA 1T2QH 3H24A 4Y5YC 3V0EA 5INCB 1NF7A 1NAKL 3HI5L 3MRHB 1NCIA 3QEHA 1XLCA 5C07B 4Y5XB 3LI1A 1Y65A 3ERXA 1J6OA 2O6FA 2NXYC 3IDGA 1FNEB 4IUOA 4PCTA 1S5VA 3KLHC 2ISFA 3DI0A 3AS2A 3ONCA 4HC1A 1JZ6A 4DXXA 1RJCA 4NQCA 5CHNA 5IFJB 2B2XL 1KYAA 5JHLH 2KC0A 5FGCB 5JHAA 2GK0A 3GSUB 3WF3A 1F05A 1S3KL 3EW3B 3LDBB 3TBTB 4F66A 4MDOA 2H41A 3MNVB 1ZRQA 5CF3A 3B8IA 3B2VH 3NQMA 3RO8A 1J9TA 4GKTA 1UR3M 3T81A 5JW3H 3VSQA 3BVVA 5BNXD 4GRWE 2YR1A 3W0KA 1OG0A 3R13A 4XCNB 5F7EL 3GM8A 4ZTYA 4NY2A 2WMIA 1OARH 3CYJA 3TL5A 4U1LA 3CC5B 1QVBA 4YPGB 2JJSA 4LDEB 1LO3H 4MY9A 2YRPA 1URIA 2GB2A 3K80A 3TH3T 3QTGA 5J1AA 5JORA 4Q32A 1I6NA 4DVRH 3M0HA 1I1XA 5AYZA 4XBJA 2YC1B 2Y3AA 1CGWA 5AZ1A 3HGRA 3RL2A 5FDWB 3P40A 3VUAA 4ML9A 3FYPA 2WC4A 2ITCA 3VCCA 1XH2A 4MXVF 4WY0F 3UPRA 4GPVA 1L9RA 5DD0H 1MFDL 4AI7A 3KHDA 1S9WB 3UGEA 1RXOB 4AQOA 1OF2B 2UXFA 4OF0A 5ISZE 4XH2A 3RIKA 4IK6A 2OZ8A 3WEXB 3TJLA 3BIKB 2HMID 1E4XL 2BG5A 2OL3L 3LLFA 1SDDA 3AI0A 4RDYA 1CO1A 3LB6D 4HYVA 2NY4C 5H91A 1W3HA 2GIXA 3K8KA 5G1TA 4FCHA 1A5CA 3S98A 2NQ3A 3L95B 4ATWA 5E8DL 4Z95H 2ZT9C 3V5CA 4GBDA 4IJ3C 2WKJA 2DZEA 2XICA 3V4UH 4PVBA 3G1FA 2XVPA 1P0EA 1G6RH 3ARED 4BV1A 1ZFJA 1FZMB 4WDUA 2JQAA 4WW2C 4Z7UB 1D2PA 4F3FA 1W31A 2WYHA 4GG6A 3WHE1 4HUKB 2OXGA 2XWBA 2CU0A 3MLVL 5AYIA 5A6SA 3BO8A 4HN8A 3TC3A 1JTTA 2ZRYA 4AQAB 3FU0A 3GXFA 5IHBA 3MRGB 5DT7A 1WISA 3AUOA 1X1NA 3LV3A 1QFWH 4J9JA 3LNDA 2EO1A 4HPGA 5HNUA 4Z7WE 5T3XE 4OBTA 1HEZA 2GSEA 5KSAA 4FHJA 1I9IL 3L3JA 4POUB 5L6UA 4WUUD 3WLPA 3NSDA 4JDTL 4KDWA 4KNTA 4Q4QA 2YMXL 1XBXA 3L8QA 2WW8A 1DBTA 2PLTA 4IP7A 3O6LH 2GY5A 3Q44A 4LX4A 4GXUN 1ZGLA 3ALWA 4CEXC 5GSRB 3GI9H 5MENA 4L4TA 4BCZA 2PCQA 2R2EA 3L3HB 1QSEA 4GYJA 3UXKA 4O2FA 5HQMA 1EERB 2OODA 3S4SA 2HJKA 5AB3A 2VDML 2VDRH 4PMXA 2Y85A 3FH5A 1R3VA 2VD9A 5EZOH 1WLHA 3R8RA 2QQQA 4R88A 4WUKH 1A3XA 2JH2A 1BZ7B 5K59E 1FL6B 1XLEA 3DI2B 1O95A 3LLDA 3RFRA 3NZSA 5C07E 1UPPA 1FFOB 2QNEA 4PRHA 1GQJA 1FCQA 2EDRA 2CERA 4DO6A 4GQ9H 2C1PA 2XX0A 5E0FA 1YW1A 4YSPA 3BH8B 3EA2A 2OU4A 4TVPD 3S96A 4Q22A 4O5LL 3D39B 5JLZB 1NFIA 3DX7B 3MVTA 3PDOB 1DIOA 5TQ0L 4NJKA 5FGCE 2JB6A 1PV8A 1VGEH 2AQQA 2H6PB 4LLWA 1E90A 3K5XA 4Y19B 2I57A 1WWAX 4XBPA 3S9IA 1YDPA 3HCVB 2IJ0C 2XFFA 5DSCA 5IGXL 2ITFA 3T0EC 3ALFA 4ISVA 2BK8A 1KC5L 4M7JH 2HKFL 4M6OL 1F8IA 4D6FA 5JBFA 1AIFA 1CG9A 1A0QL 3CVDA 1GJPA 2JKWA 3VRLF 1PSKH 3ZR6A 4FQXD 1TR1A 2YBUA 4KKNA 3SCTA 1YYLH 2VDNB 5FJRA 1MHEA 3FUIA 5DCCA 1F3JA 2VW7A 3FO1B 5A2FA 3GVWA 5HMFA 2ZRZA 3N12A 2DVTA 1IBDA 5AVQB 3CHEA 2EDOA 1BBJA 5EC2B 4Q97A 1BWKA 3OZLA 1GOMA 4KFNA 1XBYA 3UR2A 3WL9B 2OCCB 1WAAE 2RJMA 3M7FB 4LL1A 1NFDE 1WDAA 4UIKL 4PJCB 3Q2CA 3BLOA 2NZ1A 2HXTA 1GYWA 1XB8A 5I18L 4Y9PA 4X4XA 1ECQA 1XHHA 3DX6B 3H7RA 2PP3A 2WNXA 4XMXA 4ZPTA 3RFZB 4MZRA 5D1ZD 1JK8B 3M45A 1JPEA 1SOSA 1YC8A 1ZT1A 4E41D 4L0ZA 3WKZA 5ICXA 3WF4A 3GXUB 2PMQA 1ZBKA 3L4ZA 1Q9LB 2DQUL 2QQKH 1DYZA 4JHWH 5DRXB 3MRQA 4PRPE 1FPTL 4I2XB 3BP6B 2GTQA 4PJ5D 4PP2A 1ID5I 3S46A 2DSWA 3TVAA 4G7QB 2R23A 4FTDA 2BNQB 4ZFFB 1MJUH 5B4MD 2HS6A 4H9YA 2K9UA 1E7VA 4WFEE 3VGEA 1FIGH 1VBJA 4XUGA 2D0HA 2Y6TE 7REQB 4IGBB 4YK4B 4FXFA 1PDZA 2AMGA 1S9YB 3MA9H 3WF1A 1XDLA 3VA2C 5DJXB 4NNYA 3P2TA 1EX1A 1E4WL 4Z7UE 1MCIA 3L1OH 3VFPB 5ID1B 2BHYA 5TDPB 3IXAB 3B9OA 4DGYL 2HCZX 3G7TA 1N8IA 1RZ8B 2Q8BH 5A5WA 1JMZA 5L0QC 4F8OA 3QJAA 1KN2H 4PRAA 3PZVA 5E6IC 1MSPA 5F7KC 2E76C 1DORA 3FOLB 3R7MA 1OAQH 2TYSA 2V8LA 4MRBA 3P2BA 4Q8PA 3U7BA 4WFGE 3RVVD 1MRCH 1KCRH 1IAKB 1AZNA 4M8QB 3PWVB 3CLWA 4G7SB 4LIQH 4HX1B 2ZYSA 3VA6A 3OPUA 1JDEA 5HYSA 1IWAA 4ZYKB 1QW9A 1E56A 1CJYA 1QSZA 2YZ1A 3ZL2A 4LUTA 4L3EA 5CO1A 1W3LA 3QA3B 3WY3A 3H9HB 4IBUA 3HRZC 4AYDC 5FEPA 4YDKL 5TF0A 1IZCA 5DYOB 2R7EA 3MZ2A 1FZOA 5CJNA 4Z0JA 5AW5B 3JVGA 4OLXL 3BKYL 2FLBT 5I19L 4NKDB 3VA8A 2GYSA 1AL8A 4E4FA 4LARL 4OLWL 4P05A 3ZUCA 5L2KA 5EZIL 1FHGA 1YEFH 1TQJA 2F7OA 1FWGC 1GTFA 1INEH 3IS1X 2PYEB 3MUIA 1FP5A 4UQ2A 3EX4A 1MW0A 3LRSB 4MNJA 3PWPB 3V0JA 1XW8A 4D9RD 5KVEL 3D39E 4ZTEA 1NLDH 3M5YA 3GXPA 1E9QA 2XX1A 5KANI 3GXMA 2VIRA 3MGOB 4K2UL 5IB1A 3R0UA 2TAAA 3A3XA 3I7SA 3R11A 1HCFX 2P4AB 1E72M 4EDWH 1MI5D 3EBHA 4NX0A 1FZKA 3GK0A 5E7FA 4QY8A 1EIXA 3DHDA 1QRNA 4LXFA 4O1DA 3UTZA 4XK2A 4UINH 3LPPA 3GD1C 2EO7A 4R84A 3C60A 1B4LA 4QQ3A 4FLRA 2WBKA 2PDHA 5CEZE 3H22A 1OCNA 2IBGA 1PZSA 3T4AA 4E5XA 4U1KA 5JNYB 1KGJA 1OAXH 3ZE0F 3WTVA 4S1QL 3DPDA 5ELIA 2H9AA 3V5DB 2W0PA 2YGNA 1PVNA 3B9AA 3IFLL 2NZLA 4H6RA 3SDYH 1P7KB 4MNHB 2ZZ2A 2FZNA 4G6FD 2X4QB 3I6KB 5D9NA 5LIXX 3QWQB 4PJCE 4YDLB 2A5HA 4NZ8A 3NUKA 4E0CA 3CFBA 1RVGA 3AWGA 3UAJC 1IVLA 1DQLH 1NEZG 2DZUA 2PKDA 5I5MA 3G22A 3W1MA 1H19A 2Y3NA 2MCPL 5ESAA 3IIZA 3MUY1 1O6IA 1ZV2A 1CE6B 5HYEA 1I8IA 1TJ0A 5EOCL 2VWTA 4U7KA 4D6DA 3FPXA 5HYJB 3SN4A 5F8QC 1NM9A 4EOUA 4KRTA 4I2XE 5T1MA 2NY7L 1TO4A 1OFPA 4QCFA 1M42A 1W9XA 4OIIH 4YEFA 3L4WA 3FTSA 4MPQA 1FN4B 3AGVA 3P9MA 3IBOA 1XCFA 2BNQE 5L4IA 1CGSL 1IM9B 4G3YH 1AR1B 2VRKA 2XKNB 1WKFA 3W7HA 2HSAA 4EF8A 2JLPA 4UT6A 4A2MA 1ZA3B 1QWKA 3IJ6A 5GGVY 2F8XC 1H6EA 1ND0A 1VZIA 2CXEA 3PK7A 2FZBA 2XVKA 3RIFK 3GS6A 5CLYA 4AZHA 4S3GA 5JW4M 1UWSA 5HK4A 4LUJA 5I76A 3UDWC 2YQ2A 1ZT7B 5I28A 1W37A 3SDAA 5E24E 1UUOA 4OF8A 4NWUH 4KNUA 2YRBA 1DQDH 3DTUB 4FQ1L 2DIAA 2VVSA 4R9HA 2ORBL 1ZLWH 1SGKA 3WQOA 5AYUL 2QIWA 4IOFD 3UABA 2MUCA 4YNYA 5KVFH 2CBTA 5T8GA 3MSPA 5BV7H 1B3OA 1BXNA 2RJGA 1BYBA 3ZLGA 1BX2B 4AD4A 3WBWA 2WQVA 2YPVL 1BJ1H 1JPIA 4FX5A 3DHPA 3KCWA 4NBYB 1SM9A 3T3PF 3D18B 1G4TA 2X4RB 4HA0A 1YXYA 3Q1EA 1L4IA 1F18A 1XF3A 3WNMA 3PU7A 3BSZA 1JYXA 3ZSTA 4MZIA 5F97E 2W61A 2HFGL 3RA7L 1INDH 3EYSL 2ZSVA 4KGLA 2HVOA 1ZB5A 1J0YA 5GS1B 4X8XA 1SLWA 1P2CA 3G3MA 4BQ8A 3D2TA 3NG3A 5GGRA 5G2IA 2VR4A 4IRZA 1EIBA 4GZIA 3KH4A 4DJMA 2VUYA 4KVNH 4ECNA 2ZNXA 4A2EA 4L18A 1ET8A 4D8PB 3RUGF 3MKKA 5I3HA 3OIHA 3I10A 3DGRA 3MCKB 2NY1B 2E27H 5HJDA 3UCDA 1JQXA 1ICSA 1M68A 1A4KB 4AC1X 4P4KC 1SEQL 5D93B 2J6EA 1KPUA 4LSVH 2CHDA 5BOFA 5IRPA 1AHWB 1OCRB 3BL3A 5C9JA 3QBUA 3T2NL 3SY0A 1F4WL 2ZWNA 5I1JH 4E3TA 4DWSD 3CK0L 1H8NA 2XNAA 1F58H 1WF5A 2BP0A 2YPLB 4ENZA 1NDGB 4RH4A 2ATPB 3GZPA 3MV8B 2WVVA 2X28A 1ISYA 4W9FC 1MNUL 3OHXB 5KS9F 5HI5C 3TK7A 4U5IA 4QTGA 3Q2WA 5FSDC 4H9TA 5AECA 5D70H 4TVPH 3OTRA 3HHRB 4APQB 4PJ6A 3AYTA 1VACA 4XB3A 3M7WA 2NV9A 4U4MA 2NW3B 2IGLA 1U2HA 1TJGH 1R6WA 5EOQL 4QXUH 2DQFB 3ELQA 3LCIA 2HE8A 4DQOH 4TULL 2YRZA 3BT0A 4CQ8A 1ETZA 3N9GL 4PCPA 2F1AA 5DT1L 3LDVA 5GNXA 3M86A 5IJVA 3CFUA 4LAQL 1OQOA 4P5MB 1LDPL 2ZWYA 1P4LB 1H6TA 3CUZA 4YIQA 1Y18B 1FBAA 3VE0B 1D5RA 4HJFA 1ZAJA 4OI7A 1XF4A 4A8RA 4LBRA 1D9KD 5HGGS 2IWKA 4DJFA 4UBDD 4JTGA 5F9WC 3CFCL 1RPKA 1B0GB 3ULUE 2K0RA 4OE7A 5F1NA 1RJLB 1BFSA 4FADA 4NKIL 4AWEA 2OZ3A 3UWZA 4BI7A 1G1KA 4F33B 2VM9A 3BH4A 1S2EA 4AT6B 3FU7A 1SFTA 4G6KH 3MPGA 3IVTA 2VX7A 1J7VR 5IZ7A 2B39A 3EO9H 4YSAA 1YIXA 1KCVL 1XLLA 1RZQA 4IU2B 1XBDA 4LHUD 1JULA 2VLMD 1LO5A 1YX1A 4JY6B 3QR2A 2GFTA 2QKFA 1YYMH 4XV0A 4BF5A 1Q8MA 3IAPA 1ZLVK 5CCKH 2ZZ7A 4XO4A 5E51A 5EZPA 2NY5L 1O5DT 4PG9A 5AHNA 1UOZA 3LQGA 3CSYB 4NI6A 1H5YA 3QCVH 4M6NL 3KTSA 2QGDA 2PS2A 2O0TA 3FT0A 4ODXB 4F8NA 2VN6A 2Z91A 5JXEA 1PX8A 1Z5YD 3OKMB 1DWAM 5DZAA 1MQKL 4M4RB 3L6FA 2A99A 5D4YA 2YLHA 3AG2B 4IWWA 2Z31A 3O3AB 5F88A 1M2VA 4A63A 1AI1H 2VFHA 4DF2A 3CVCA 4M1CC 4UT6H 5F96H 3WKML 3AIRA 4PUEA 3TN0D 3LCFA 4NDMA 2PDMA 2AGJH 4J1OA 1BFTA 4JKPL 2F9RA 1JGUH 4ZFCA 1V3HA 4X2UA 3N85H 1E1EA 3QQ3B 4EWND 2FZMA 3I6RA 4IMAA 1CFBA 3SCSA 2ESCA 2RD0A 3ASWA 4NSKA 5MEPA 1QLEB 2XG4A 1TZGL 4I5UA 1ZV9A 3UPAA 1P5UB 4PJIF 4F9LC 2M8XA 1GOHA 1M7IB 3PM6A 3R0DA 4B3LA 1LO2H 1POJA 4XC1H 5TH2A 5IM7A 2GTWA 1A6TB 5DMKB 2FX7H 4A6YB 3G2GA 1OGSA 1BYAA 1MZRA 1AC0A 1SY6L 4PTUB 2NXYD 2PMZA 2H8XA 5HOSA 3WFCL 3KLHD 5GJNA 2VTFA 3BTNA 4FL4B 5H8MA 5IOKA 1OHQA 2C7UA 4R4BB 2WKGA 3VXUB 1ZAHA 5ENLA 1BQ5A 3MZGB 1T5WB 3PIQA 3FB5A 1DZ0A 5FA4A 3LY6A 4PV1C 3KPMB 5AL8A 1MFCH 5GSVB 4K8GA 1T1WB 1IGTA 1U1HA 3FFOA 2FQFA 3FCPA 4ZUTB 4Y9OA 4YHLL 1VCAA 4WDWA 2A6IB 2BNRD 3CMGA 1E9ZB 4AJYV 3LQAH 2X1WL 3B3DA 1OADA 3ME0B 4PR4A 4TIMA 5BS0A 2AMUA 2F54B 3IEBA 4KIEA 2XTKA 4UFJA 3MJ7A 2W9MA 1E67A 3TQ0A 1J1PH 3S37X 5CJMA 5CIPH 1R24B 3CTTA 1LP9F 3PL6A 1LLAA 1AQFA 2XXMB 3QG6B 1GTHA 2WWDA 1UBPC 2J6EH 4J8RB 2P8LB 3BCDA 4WGVB 1I9JH 5D1QE 4HU4A 2AJYH 4GSUA 4F7EA 4LY4A 4ZAKB 4FK9A 4C4BA 2CJUL 1Z3GH 4PYGA 2OR7A 1VCGA 4G7VH 1SOXA 3HQ1A 4X9HA 3VXNB 2VN5A 3OA5A 1JDFA 3NP4A 4XNBA 2V6HA 2XXCB 3X3GH 3QULA 3FQXB 1N5AB 4W9TA 3MMEA 2XC8A 2FB3A 5I8CB 1AY1L 3WLTA 2GT9A 5DZLA 5AZEL 1B9KA 1G87A 3ML9A 1F6LL 3CX2A 5D7EA 2NY4D 4U6TA 1K4DA 3UTOA 2F7PA 3U4AA 4UAOB 4JR9L 3MLYH 3Q01A 1BMWA 1IGMH 3VX1A 4RNIA 4IRJC 1R0AL 3U1PA 1QD0A 3U4BH 2OMTA 3AM8A 3CQPA 2OPJA 4JFUA 1FE8L 3MUAA 1EMTL 1DN2A 5D96C 2O5NA 3EYFA 3TZVA 3SJVB 3RZCA 3TIEB 3V6OE 1HT6A 3KWTA 2MQCA 3W71A 4AZUA 1MUJB 3FTGA 4GHRA 4N90D 4HIBA 1X5LA 3H42L 3N5AA 4MB1A 1QUPA 5EC1B 4KVCH 1F02I 3G1YA 3EMQA 1LILA 4CW1A 1ZENA 1M01A 4NT6B 5E9DD 4NUGH 3O8AA 4FQQA 4CQDA 4QKXB 4DZ8A 2EDBA 2F7IA 1WBYB 1HOEA 3KPSB 3DG3A 4OZHF 3QI9C 4BFJA 2PTZA 1RK5A 4Q6JA 1MLCB 3M8OL 1N6QL 3NPVA 1VS1A 3ZQ9A 5GRXG 4MVBC 2IAND 3K2UH 2G60H 4E68A 3HB3B 3MBXL 3HZVB 2OYPA 2VISA 4ABWA 1ZVNA 1QOQA 1VEMA 4K8RL 4ZMPA 5F6IB 5HPMB 2D4DA 5E99L 4UR7A 4XMVA 2ZYFA 7ENLA 2QVIA 3ROOB 1EFXA 4UQEA 4Z3GA 5D05A 4I1RA 3SCUA 3DPBA 5FWQA 1XCQA 2VC2B 4LV4A 1T6VN 4L4JA 2CXGA 5DUPH 3U9UB 3A4EA 1KXQE 4JFDA 1RL1A 2H6OA 4HNCA 2CUHA 2W67A 2R0ZL 4PIRF 4Y1AA 2ZQKA 2FVKA 1OO2A 4K3JL 2H32A 5HA7A 1UG6A 2OKTA 3UZYA 2F58H 5CZVH 4PJGB 2C8NA 4X9FA 1TQUA 3OQ3B 1DUYA 1TSRA 3MN8A 1YEGH 2WOQA 4GGHA 4M43H 5F6HJ 4WKAA 5KITA 1TU2A 1CQKA 1N4XL 3UYRH 1EF2A 3HUJF 2BASA 1E6ZA 4NFBA 4NIYE 2D3VA 2K3HA 3VXUE 1KEGL 2NQCA 4XC3H 1ZE3C 5HGAA 3SN0A 3S48A 3HMCA 1KPVA 4TSBL 4HPYH 1AGBA 1EGJL 3GJFK 4AF0A 4MJHA 3K5SA 1LCOA 1XLIA 3T0ED 3FVDA 3V9CA 1JXGA 1FV1A 3BPOC 4KI5F 4UTIA 4TUKH 4HULB 1FH5H 2FO4A 4V1YA 1QZ1A 4BH8B 4HU0A 3MRPB 2QZQA 3BG9A 2Y0FA 3BGGA 5JQIB 2F54E 2YAFA 5CC6A 3RM8A 2V5YA 1C16A 3ZDXE 3MV7A 1OAJA 2P9RA 3LS5L 4LALA 1IAOB 5CP7A 1F8MA 2B77A 4OU3A 1KFLA 5FAAA 2D2OA 2AQ2A 3C8HA 4U3HA 2MHAB 4EZLA 5E2TH 3P4OA 1JNJA 3IJEA 1FNLA 4GQBA 2BRQA 1GORA 1U8JA 2QJNA 3VGBA 4JGDA 2F5AH 4QG9A 5E5UB 3DX9A 3LGDA 4K15A 3C5QA 2ZX5A 5FKYA 1ED3B 4WHBA 4KAQH 5HQEA 1W0YT 1I2OA 1AXIB 3FCBA 1ZP3A 5D7IB 5HUOA 3BWZA 5SWSD 3IN0A 3FTVA 4JTJA 1NAKH 1TREA 3HI5H 3LEPA 3L3GB 4MD4A 2PR4L 5IVNA 4U6HA 3QYCA 2R8WA 3CXFA 1SJEB 3PXJA 4NKMB 2G5BA 4KPHL 1SJBA 3NDZE 2POZA 3WLJA 1XFPA 4TQIA 5IJKA 1XAUA 3F4WA 4LWWA 2VRQA 5FYJE 3TJHC 2JJUA 3OZ9L 1HSAA 4KRPB 5DK0A 2WM1A 3P82A 1TG7A 1HXMA 4B5XA 3WJZA 3MRLA 4LCRA 3TCTA 1REQB 5HHXL 1S3KH 3INOA 4S10A 1IC7L 4ZQTA 3BVTA 4WEUD 3V5FA 3OKEA 2GJ6A 4GQQA 1UZ4A 5LHEA 4CVZB 3UCQA 4UM9A 2BMKB 3W9ZA 5AKTA 5I00A 4GLEA 4PMEA 2I16A 2HB0A 1I8JA 2P1YA 3UTPE 1BWLA 3FB8B 1LGVA 2CLMA 3MRKA 5E6ID 2KZHA 3KPSE 3STLB 1A4JA 4B9ZA 4DVBA 2EUWA 3KCJA 1XEUA 5B39G 3HPZA 3MVSA 4QG6A 1N55A 4FNRA 3BPLC 2G5WA 2BGSA 5FSEC 4LRNL 2HZHA 4PFHA 2BFGA 3UWYA 3D25B 3MKCA 4G1MA 5KBMA 1R3KB 3QLDA 2FWOA 2Z2UA 4OV4A 4O02B 1WYJA 4Y6GA 3H0TA 1BOYA 3TTQA 4P49A 1A50A 3MRRB 3LZPA 3L9YA 3O06A 1JR1A 3BQ6A 2QHAA 3V9EA 1GVYA 4WKZB 4S1DC 3LOWA 4XR8C 5ILTL 3IVKA 4JN1L 2E9JA 2WUBL 4PP1C 3VXQA 3UZ5A 2HWGA 3H2OA 5IDZA 3COOA 3W1TA 5I30H 3WELA 2J88L 1AMXA 4HPNA 1JNNL 2DV6A 2OL3H 1Q38A 2TRYA 2OMUA 4ODHL 3BH9B 2EKSB 1TPXC 1XIWA 1KEMH 1BQKA 3ALGA 1HNGA 2XZ9A 2XG5A 4AG0A 1RD6A 2G8ZA 4PWEA 1W2VA 5E8DH 4O9HL 4BHYA 5KSBA 1G7VA 2Y1ZA 4ETQA 4V1XA 4LCIL 3N6YA 1YPZB 1ZAGA 3ARGC 4EN2A 1R3SA 4HV8A 1H51A 1E5ZA 4JW3A 2EF9A 2WCGA 4GJJA 5SWUA 2CGYA 2QULA 1KCZA 5C0DB 1YY8A 4JTTA 3H70A 3T8XA 3UA4A 5DQ9A 1BJMA 4AZ6A 1B3JA 4F9JA 1ANUA 1J5OH 3EWYA 4KJYB 3CBKB 3D0VA 2VN3A 3SE9H 1UKTA 1H7XA 4JDVA 1PWMA 1KUMA 4GUCA 2NVDA 3W86A 1BGXL 4FQJH 4LCWB 1QR7A 4WEBH 3ECBB 3MREB 4JDTH 2YJQA 3WSQH 3CV6A 3K72A 5A6JA 2ADGA 2YMXH 3OR7A 2NSXA 3VAEA 1FHVA 1B4TA 1R8LA 3UAJD 3WTYA 5J11C 2H0EA 3W39A 2HCVA 4B3KA 2R94A 1E2VA 4MMWA 3E2VA 4YSCA 2FDSA 1U5HA 2A0LC 2I9TB 1XBRA 4PJ7A 4XMZA 4ZBCA 3QZEA 1BFNA 2FQGA 4UM8A 2CLPA 1Q6DA 4LYPA 3S5LA 5D7IE 4JO1L 4AEIL 5EU4A 1KCWA 4ELMB 1UH2A 4JXCA 3RWCA 4GUPA 4BSWB 4QGCA 3PGDB 3BZDA 3EJZC 2EEAA 3KH3A 3ULAB 2FVNA 1NFAA 3HI6L 3RWIA 4OM0L 3O3DB 5C71A 1P7QB 3WK0A 5MHBA 4NUJA 1GYVA 4G72B 4M6AA 4YXGA 4O5LH 4P23A 5CEXB 2NX5D 3A24A 1O7VA 1IMHC 5TQ0H 3QNXB 5KETA 2EIJB 1V8HA 2WSYA 2EDMA 1DQXA 4RNFA 5A6TC 1OJXA 4LCVA 4PB9H 3XISA 4GY4A 3UTQB 3SCRA 4G8GD 2FZ3B 3IJYB 3I3EA 4R2GC 5DZNA 5IGXH 3WLKX 4QRFA 3WMSA 1XH1A 1FC2D 4AJ0A 5AB1A 1S9KC 4DEPB 3WYZA 3K81A 1A0QH 2MCAA 2OXNA 4QHLA 4NAEB 4WWKB 4H44C 2P3ZA 4QDWA 2COQA 1T1ZB 2EE9A 4QNPE 3CPLA 2A74A 3P54A 2I9LB 3ARQA 4G80B 3TBVB 3ARRA 2R14A 2NLJB 2N0KA 3CLMA 3PGCA 4FFVC 2O61A 4J3TA 4PJ8B 4Y9GA 3BFOA 1MCJA 2GJXA 1IC1A 4Q6XA 3QUYB 4WHCA 1PKQB 2Z26A 1N2RB 2P3YA 4KZDL 3DDGA 4AY0A 3BOVA 5EIIA 3W07A 4LSPH 1NTHA 3R79A 4HFUH 3I50L 5I18H 2H26A 4DHLA 4JFYA 2Q3AA 1A22B 1FXPA 4OUOA 3VNMA 5DURB 2AL2B 4P07A 1HDMA 2VVNA 4V1DD 2VXQL 1RBOB 1E6XM 4YGVA 1NQKA 5LWYL 1RR2A 3RL1B 5E4OA 3FUJA 2DQUH 2ZE0A 2FIKB 3P8JA 5FGBA 3GSWA 1HZLA 1AW1A 5KG9B 1MG2C 1FH7A 3TXVA 2BC4B 3GMLB 3NEHA 4N2DA 1FNHA 4V27A 1UB5A 1E15A 3CFDB 1TLMA 4PJDF 5HDBE 3CU2A 2EIMB 3STEA 2YSSA 3DMMB 2XRAL 1HHGA 1TE6A 1KB5A 1Z9OA 4BKLB 4QIUA 3OLIA 3Q67A 3V1PA 2C26A 4LLYA 4WW1B 1V0KA 4JFED 2HJLA 1ORSB 4A67A 3BZ4B 2ADIA 2XYBA 4JY5L 4HKZB 3WN5B 3SKJH 2DJLA 4P4KD 2Y5EA 3EDFA 1INQB 4IS6A 4MDIB 4QEHA 1IARB 4L65A 3KRUA 1KO0A 1X1OA 3NJIA 2I5QA 4CSTA 3O3EA 3DDFA 1E4WH 4BK5C 4V28A 3B5HA 1QXLA 1UXSB 4P99A 3RNKA 1KJ2L 1MCQA 1G1YA 3OB0K 4FHAA 3APMA 1HWHB 4D3CH 3VVGA 3LEYH 1UZHA 2EVHA 4R3SB 5K4XA 2GHWB 5HI5D 3B6SB 3P0GB 3OLDA 4L64A 4FJYA 2PC8A 4HF5L 4DEFA 4ZFOL 1SF5A 3L3IB 3L48A 4XPFH 4QT5A 5CC5A 1A5NC 4TLTA 4N9BA 4UT7H 2X0VA 4N2LA 4JFFE 4QHMA 1FJ1B 4PL1A 4L8DA 2EPHA 3QWOB 3VWJB 1AGFB 2J73A 5C0GB 1TVBB 4NQDA 2OQHA 3CDFA 5F7NC 1D7FA 1F97A 1DIEA 2X6VA 3OAUL 4F92B 4LFHG 1TQXA 2Y5SA 4XX1E 1CLXA 3E12A 3F5JA 1JHLH 3OAYK 2EH8L 2APSA 4RXFA 4X6BA 4XP1L 4OLXH 3BKYH 4HIIB 5K3VA 3HS8A 1NCCH 1XLDA 7ODCA 1XUZA 3M0JA 1AL7A 3MJYA 4ZODA 4JB9L 3BD3A 3ARFC 4E2BA 1HXYB 4OLWH 2YXOA 1WDWA 3WAJA 3N4FA 5EZIH 1CGYA 1RH8A 3CUJA 1W3JA 1DLHA 2W4XA 1VBGA 5FJIA 2VQ4A 1YO4A 5EEWA 4XBEL 5KVEH 4BA8A 2AJXH 3TROA 3CO8A 3LZOA 3QGVA 3GSRA 1KA9F 3WFBL 3L9CA 3FVMA 3MBEB 3L68A 2UWEA 4TOQA 3CX5J 3PBGA 4K2UH 1J4EA 2JF7A 4XXCC 1EC9A 3GSNH 4PR5B 3AACA 2GSIA 3WG6A 1R3IL 2X9XA 2K6WA 3SYOA 4CNSA 4U6YA 2HE5A 1AG6A 4JKMA 2DN7A 3C3NA 4MD0B 4D9QD 4TQTA 4WFHE 3RDTA 3H2AA 3RCYA 3B0XA 3PQYD 3L1FA 3CVHH 1DO6A 3AFBA 3EFFA 5CILL 5DZVA 5IR1B 5F4SA 3P77B 4WU7B 2Q6WB 1IIKA 5F9AC 2NTFB 1PKQE 1JUFB 1BVLA 4DH2A 4YN3A 2IFGA 1IC5L 1E6PA 4N9CA 2DICA 4M1CD 4J5VA 3BT2L 4LAUA 4Q4SA 1W2KT 3N2TA 1IGWA 3PS7A 3GXDA 4FXGC 1IHIA 2UZIL 4OAWA 4G1EA 4JFWA 4YC2C 5EOCH 5T3ZE 1W56A 1A8ZA 4HW6A 4Q33A 3RDKA 3TQVA 4QTHA 1HXJA 3SCPA 3CDGB 1BREA 4CNIA 1GOXA 5DJ6B 3BCJA 3ARBB 2EECA 3FT9A 5KAQF 5JOEA 4U28A 4D8AA 1O1ZA 3RI5F 2LTQB 3L5XH 2DEPA 1QFUL 4EVNB 1JGVL 4Q8OA 4PB5A 5IMMA 2X2UA 3RILA 3VYNA 4PUWA 4R34A 1TQWA 3L2LA 4Q2ZB 1ZSHA 1ZWIA 4CBPA 2A1WH 4L4LA 3WLIA 1SO3A 2XIJA 2FRGP 4YVVA 1PIIA 5D30A 4LDLB 1KW1A 4LO9A 4XCEA 3WO4B 3HVDA 5KZCD 1KGXA 4X5WA 3SQRA 4NXKA 4LVGA 1VR6A 1ENUA 4RV8A 5C7VA 5B7FA 3OQEA 1HFUA 3CZSA 2I5YL 3RWFA 3LKPA 5LGJA 2CCWA 2EEFA 3ZBMA 3UTTD 2OK0H 4XD3A 1S7RA 1ML1A 4U33A 1FX6A 1T0OA 1FSKC 3DUUA 3TC7A 3R0KA 4FI4A 3MUJA 2YPVH 1N82A 2WWMC 3FT2B 2O93L 4XQ6A 5J06A 2QR0A 1F4XL 4N4QA 2IUZA 2E47A 3I6LD 3OGOE 1TX0A 1JPFA 4RMBA 1XLBA 1S5IL 1KB5H 4G9PA 3VE9A 1XGPB 3BAJA 4R9XA 2YZRA 5EEUA 1RZKC 1Z48A 2J7FA 1MZYA 3RA7H 3KPOB 3EYSH 3A12A 1WBZB 5FAGA 4MMYB 4TVSa 4UMAA 3GR7A 4PQXA 3KYNA 2AXGA 4QLKA 2IH3B 1AGDB 1OW0A 3WJLC 4WDIB 3STGA 2LVEA 1OTTC 1DVSA 1E0UA 2EPOA 3EB3A 4PJAA 2X6AA 2VMFA 1QEWB 3S3BB 5CGQA 1F8TL 3V5HA 4NKCA 3X13B 1FL3A 5I6XB 4K1GA 4IT1A 1QQDB 4KXAA 4CMHB 1WDSA 3DUSA 4CAGA 4E42A 1X7FA 4BQ2A 2PDFA 1NGPL 4HLEA 5L6YH 3DVNB 4IMLA 3AQYA 1UW9A 4K3EH 4MSSA 5GS2D 4F0SA 1SEQH 1Y0EA 3FQWA 2G3MA 2E09A 1U6AL 3SUSA 5DRZB 1ISZA 3IRZA 1RCYA 2OVLA 5F9DC 2R1WB 4IRJD 1GYCA 4LF2A 1HKWA 3KCOA 3SE8L 3CK0H 3TH2T 3KPPA 3QFDA 5DRWA 3AMGA 5DQJB 3BAKA 4LS0A 3K2KA 4WHDA 2DIEA 1OK0A 3M6DA 4JPGA 4N0UA 4PC8A 2B1AL 4TRPL 3CAQA 5IT2H 4S1FA 3OVRA 5AALA 2ZG1A 5T5NG 1SQ7A 5D9SB 1QWNA 2LLEA 4X7EC 5D7LD 1OLZA 4YCPA 3X12A 3URAA 3QI9D 1FUYA 5EOQH 2KUTA 2HPTA 1FG2A 4KF1A 3PG8A 3G3DA 4MVBD 1R3TA 5DT1H 4JNZA 3WQ5A 3RKDC 5TDOA 2YARA 4OV5B 4DP9X 1QOKA 3AREA 3KRZA 1CDHA 4Z77B 4NYLA 1MREL 3LKOB 4L5FE 1V77A 1KM0A 4RE3A 4Z7NB 5L7XH 2R27A 5A2LH 1LMKA 4IPPA 5FA3B 4OV6F 5FX3A 2AJ3A 3PWGA 5HY9B 4G9FD 2DVXA 8A3HA 3GGWB 3GSVA 3E49A 2BDNH 2RTTA 5JHDB 4QD2E 3CFCH 2IDCA 3M9YA 1A6UL 1U95B 5ENWA 2IH8A 5C0CD 4N2EA 5JO5B 4X63A 2J7GA 3KW3A 3NZ8B 3QC6X 1R3LA 4WUUA 2DH3A 4DI8A 5JHMA 3FTWA 1R75A 1G5AA 3G6JF 4C1LA 4ZNCD 1RZKL 2QPUA 5IY5B 2J1YA 3NVQA 1ZBCA 3L4CA 3GH5A 3CDYA 5F6HI 3MMDA 3QEGH 4BSVB 3KGTA 4LEOB 2QLYA 4MJJA 5I26A 3PTQA 3FQNB 4Z7QF 4W9GC 5BRZD 2GCYB 1NFGA 4RBPK 4ATTA 1XEDA 1S5MA 1S7XB 4A35A 3F64A 3QZAA 1XGTA 4C56D 2B14A 4OZGA 3I6TA 1B3YA 4GW1A 4UOJA 2CKSA 1MUWA 4FJZA 3C2EA 1QKZL 2F18A 1H60A 2WXQA 2WMGA 1CB7B 4W7WA 4LDCA 4ZB0A 3BUYA 2DT1A 4AQ8A 3MSYA 4HZ1A 3LMZA 1ACCA 3KRBA 1YDOA 4XI5C 4Q89A