3BLKA

Role of aromatic residues in starch binding
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFADARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase 1
publication title Structure-function relationships in human salivary alpha-amylase: role of aromatic residues in a secondary binding site
doi rcsb
source organism Homo sapiens
total genus 172
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3blkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3blkA01
2CKRA 3LRLA 3ZT5A 1CGYA 4J3XA 4RE3A 1KGWA 2EABA 1R87A 4IISA 5A6BD 4M29A 3APGA 2BY2A 1KR0A 2X2IA 4D6JA 2ZE0A 2J7HA 4B9ZA 2GUYA 4AZIA 3L4UA 2OWWA 1DTUA 4URIA 2EPOA 4R5EA 3W38A 3BVWA 4M56A 2D23A 2W91A 5BXTA 1XH2A 3RCNA 1Q6EA 2DIJA 4AW7A 1GQIA 1ZB5A 3SCRA 1ISXA 2WVSA 2F1BA 4EK7A 3VD5A 4WJXA 2D2OA 3HU7A 1CGWA 2Q8XA 4B3KA 1TG7A 2XJ7A 1WZLA 1UA3A 3LXBA 3MV01 1H49A 5BRQA 4C7FA 3GXFA 4AD4A 1EHNA 2OSYA 2VUYA 3AOFA 3BVXA 4ATLA 2GJPA 2HVMA 1C7TA 1GHRA 2W92A 3AIEA 3TOPA 3TP4A 2PB1A 1M04A 1M53A 5HPCA 2W66A 3CMGA 3LXAA 3BC9A 3BAYA 4AY1A 2WKGA 4W8BA 5BXPA 2WVUA 3EJQA 5A8MA 1CGVA 1UOKA 3M07A 3NSXA 1JZ8A 3W29A 3CGTA 2PF0A 1WNOA 3GXNA 2W4XA 2YL9A 1H3GA 4D1JA 4NZFA 2VX7A 2VT0A 5HDRA 2BVTA 1FOBA 2DSKA 5FD0A 2EPKX 5A95A 1V6XA 3WY4A 1VENA 3A3HA 4PSPA 4Z2HA 3WY2A 4BQ2A 4UQCA 1UWQA 2DSUA 2WANA 4DUXA 3DX3A 3BUBA 3NSNA 4GINA 4GQQA 3HJEA 2RGMA 3BUIA 4KGJA 4P8XA 4FNPA 2V5CA 2VOTA 5A8NA 3PZTA 2E8ZA 2F8QA 4BZYA 5M5DA 1V6UA 3NYDA 1BGAA 4OZOA 1CECA 3WUBA 1ISZA 3WQ8A 3ZR5A 1GVYA 3T08A 2G8ZA 1MW2A 1BVZA 3B9AA 3CV5A 2VNCA 1GCYA 5LYRA 5CPSA 3VIGA 1QI4A 2YDSA 4E4PA 3N15A 2DQXA 3BH4A 3L4ZA 1CNVA 2UY4A 3AS0A 1U33A 3WDIA 1V6VA 5EBAA 3BLBA 3CZJA 3ZJ6A 5FCZA 2PWEA 3WBEA 3RIKA 3GXIA 2AMGA 4DWSC 1ZBKA 3IJ8A 4FMVA 3ARSA 3WH8A 1NQ6A 1OWQA 1BYBA 1K9TA 1E5NA 4MB4A 5CLWA 4ACZA 1JI2A 1TQUA 2X0YA 2OW7A 2WC7A 4M1RA 3LPPA 4HP5A 1V3JA 4CCEA 2VVNA 4LYQA 1W3JA 3ZMRA 2DGAA 1XCXA 3N13A 2J7DA 1HXKA 2DSVA 1NP0A 1GW1A 4U33A 4H8UA 2F1AA 4ZXLA 4GZIA 3VGFA 2GDUA 5C71A 1NOUA 1BYCA 4AEFA 4LYPA 3CZLA 1KFWA 1ZU8A 1NARA 2VCBA 3UG4A 4ZFMA 1W1TA 5JBDA 4BCEA 2FH6A 5EFDA 1NWTA 2FGZA 1TQSA 3VIFA 1NP2A 3W82A 2Z1KA 4XB3A 3W53A 1E43A 1VJZA 3PHAA 3AYSA 5IXEA 4CN1A 4PMVA 3SUVA 2ZXQA 1QI3A 3M6DA 1CXHA 3VSVA 4RE2A 3OBAA 4U2YA 3ALFA 4W87A 1D2KA 3K4AA 1QNQA 1GOOA 1HP5A 4N0RA 5A1AA 1U30A 1V3LA 2Y2WA 4RE4A 3WQ4A 2VO5A 1HF6A 1SZNA 1U2YA 3EMZA 4AZGA 3VGBA 1C8QA 2ZUNA 2VVSA 5BCAA 4ATWA 4W8LA 5A2AA 4EE9A 2J4GA 3OGSA 5GPRA 3BVTA 2CYGA 3RILA 4FNUA 2FHCA 2Y4SA 5A6AA 3AIWA 4AISA 2D0HA 2V3EA 1BLIA 5IFTA 1WPCA 1E6ZA 3O9NA 5I77A 1SR0A 3WMSA 3RMEA 4P7LA 1A3HA 4W5ZA 2CBIA 2EJ1A 4KRTA 3S6TA 1E40A 1JYVA 1BQCA 1BYAA 2F2HA 4XV0A 1G01A 1XYZA 4MDPA 3HG5A 1TMQA 2GJRA 4MAVA 3SCVA 4DWSA 4PMXA 2EEXA 2BVYA 2BY0A 1BFNA 1WDRA 4AIOA 1V02E 5E09A 1GJWA 2F7PA 3BVVA 1KTCA 2DH2A 3POCA 3IGUA 5IHRA 4WF7A 1B3WA 1E1FA 2EADA 4P8WA 1S46A 1QBBA 1TA3A 3ZR6A 3VIIA 3VIPA 4CD6A 2BVDA 4S3KA 1W1VA 4U2ZA 5E0FA 2YL6A 3WF4A 2WHLA 3DYPA 2EPMX 1I75A 3D51A 4AZCB 1UR4A 3FW6A 4WSJA 2WVVA 3WNOA 4UFMA 4CN4A 4CVWA 3UCQA 4CD7A 3SUUA 3W25A 1QW9A 4PRWA 4GIAA 2WCAA 2WSKA 1CLXA 4UFKA 5GNYA 1UKPA 3E1F1 1V3KA 3WH7A 3BAJA 3H54A 4FK9A 5E70A 1W9DM 2VQTA 2FHFA 3UESA 4X9YA 1E3ZA 1E0VA 2WWCA 3BCDA 2WB5A 1H09A 2ESCA 1C7SA 4TUFA 4B16A 1LF1A 3WH6A 4MPKA 3BSHA 1LG1A 5D9NA 3AXIA 5EFFA 2ZUUA 1UYQA 4UFJA 1JZ6A 2YA2A 2DSZA 2ZIDA 1YHTA 3MUIA 1US2A 1E6XM 2WZHA 1XC6A 1E6RA 3I3DA 2YA0A 1KXVA 3ZQ9A 1ISVA 3ARQA 4MB1A 1MFUA 1QBAA 4W7WA 1KXQA 1XSJA 3TV8A 3A6OA 4WLCA 4AZBA 4QCFA 1W3KA 3CZ8A 1IZJA 3ARUA 5A6JA 1LL7A 4ZXOA 1QNOA 1KQYA 1VB9A 4TX8A 4BQ3A 1JZ3A 3CLWA 1CTNA 1JDAA 5IHSA 1G94A 4CKQA 1GQLA 2ZX9A 1C8YA 2J47A 3FHAA 2QPUA 3BVUA 4RL3A 3TTQA 1O7AA 1E72M 2YBUA 1C8XA 4PBGA 1HJVA 3RM9A 2DEPA 3W24A 5HBFA 2WCSA 4B15A 1XH1A 3VDCA 5KZ6A 2V5DA 4DO6A 3WD3A 4P7NA 1Q6CA 3AICA 4NRSA 3CUGA 3W0KA 5FL0A 4ACZB 3T0AA 2XIIA 3NCOA 1OT2A 4UQBA 2YL5A 2PWHA 1LL4A 3WF2A 4QDMA 2YL8A 3ARZA 3GXDA 2J7FA 1J11A 3ARRA 4YHEA 1IV8A 1J0IA 3GH5A 1E4IA 3IAQA 3EYPA 2X05A 3ARYA 5LA1A 4JL1A 2VX6A 3ARWA 3AZSA 2BS9A 2UY2A 1GOIA 2CBUA 3L4YA 3F5JA 2IUZA 1MFVA 1KR1A 4AWEA 2VURA 3OIHA 1AMYA 1JNEA 1VF8A 1JD9A 1NOWA 1SFSA 3N04A 4AIUA 3EDKA 3B8SA 2O92A 1OT1A 4AC1X 4GI6A 3WBAA 3PZUA 2WAGA 1HX0A 3PZOA 3GDBA 2OYMA 1H4PA 4UFIA 2VRQA 1M7XA 1W9BM 3WEMA 4BQ4A 1BPLB 1H0GA 4QLKA 2B31A 2WMIA 2D20A 3M46A 2Y24A 3AYRA 4M24A 4ML4A 3BAKA 1UG6A 3SEPA 5CG0A 1JZ5A 1E9LA 4J3SA 1UHVA 2X2YA 3BXWA 3MMWA 5A8QA 1JL8A 3KLKA 3KE0A 2G3JA 3EMCA 3L2LA 3MMDA 2XVLA 3A4WA 3FNDA 1UR8A 4K68A 4C7GA 4QLJA 2PC8A 4AD1A 1DHKA 1P6WA 4PN2A 1HL8A 2VZUA 2J8GA 2YLAA 2XM2A 5GQBA 2ZX8A 1RH9A 2WZIA 1J0JA 3BLPX 3JUGA 4BQ5A 1LL6A 3CIVA 4OGZA 4UOJA 2VZSA 4NF7A 3WQWA 5F7UA 1EQPA 1UZ1A 5GNZA 4D6IA 1JAEA 4DM2A 3SUWA 4MNLA 3PZQA 2BY3A 1X6NA 3EJPA 3G6MA 3WUGA 1HKMA 3VMOA 4DWSB 3T2QA 1JFHA 2X1IA 5A6MA 1UD2A 1JG9A 4GKLA 1VFOA 1KQZA 4PMNA 5I79A 3L4WA 2A3CA 2CETA 3UERA 1PBGA 2E0PA 1J12A 2DSWA 3VO0A 3VIMA 2CBVA 4D72A 4PTXA 3SCUA 3PZ9A 2ZX6A 4OJYA 1TA3B 3SURA 2QV4A 3WD2A 3LRMA 4P7OA 5FOOA 4C7DA 4JFVA 1UR0A 1RP8A 3ZIZA 5C8BB 1HKKA 1IZKA 3BMWA 2GVYA 2DPEA 4FLRA 2YJQA 3SCQA 4JHZA 1TUXA 2WVVB 3ZT7A 1JDDA 4TOQA 4AZCA 5A6KA 1MXDA 4UZSA 2JIEA 2VMFA 4M82A 3T2OA 3WENA 1ODZA 3VDAA 3EJSA 1XSIA 1J18A 1NWUA 2DT2A 4GO8A 3A47A 3LX9A 1XHGA 3K46A 1EIBA 1R33A 4JHOA 3BUQA 5HNNA 1E1EA 5C70A 5D9PA 1W3HA 3AIBA 3AZRA 1E73M 5HOSA 2O9PA 4PMDA 1Q6DA 4J7RA 5AC5A 1OGSA 2VZVA 4B3LA 4JFSA 4AZ7A 3VINA 1J0ZA 4J3UA 3GYCA 3A5VA 2VZTA 2ZUTA 1JYWA 2VZOA 1E3XA 4OOUA 3LMYA 2W5FA 1UQZA 3ECQA 5BWFA 4OBSA 2QHAA 1W32A 3MO4A 3MSGA 2NT1A 3J7HA 4J3TA 1H41A 3CZKA 1QI2A 2WLYA 2OW6A 4TXEA 3I3EA 2JALA 1DWFM 1E4MM 1WB0A 3DYOA 4P7QA 3FY1A 1T0OA 4UFHA 3U5YA 4FNQA 1ZS2A 3CUHA 4QLLA 4NZCA 4AYSA 7CGTA 1H1NA 5HXMA 3OZOA 2XWEA 1UKOA 4E8CA 3KEHA 4Z2IA 4Z2KA 3WNKA 2A3AA 4WK9A 1UKSA 2OYLA 4GI9A 2ZX7A 3A23A 2ZUWA 1FH9A 2VCAA 3VPLA 1FFQA 4F9DA 1HL9A 4JKLA 4HPHA 4MJ2A 1XYFA 1GOMA 1WO2A 4GO9A 1G0CA 2QMJA 3D3AA 4MB3A 3VVGA 4UCFA 1AQ0A 4CD5A 4CN6A 3CTTA 3NJ3A 3SUTA 1Q6FA 1R75A 3OZPA 8CGTA 2JEPA 2WMGA 3D52A 2QPSA 1MQQA 5FL1A 4AIEA 3N1AA 2WYSA 3RJYA 4YN5A 5BXRA 4AD0A 3UG3A 5JBFA 2VC9A 2WWDA 4CUCA 3QHMA 3UR7A 4JL2A 1ITXA 3OLIA 2AOSA 2HISA 1W2PA 3EJUA 5GNXA 1QWUA 2CITA 3N17A 1UQYA 1WAWA 3NIYA 1W9VA 4X0VA 2PWGA 1LWJA 1E0XA 5E0CA 3DHUA 3UETA 1H5VA 4DWSD 2D0GA 3WD0A 3WUFA 4P8VA 3GXPA 3WFZA 5E6YA 2OSWA 4F66A 2ALWA 1PZ3A 3K8MA 4AYGA 2D73A 1NWRA 2BHYA 3A22A 3CZNA 1FP9A 1J0HA 2WMIB 1WP6A 1HIZA 3BAXA 1CDGA 3DYMA 1J9YA 2GSJA 3VM5A 2XYLA 1MQPA 3VM7A 3DHPA 1ZBVA 1CXIA 1J0YA 1AVAA 1OINA 1US3A 1KGXA 1O7DC 3EJRA 1CXLA 2D1ZA 5DT7A 4PEEA 3MUY1 3ZSSA 1E4NA 3WNLA 1B0IA 4D6FA 1VBUA 3VOCA 4HTYA 2GJXA 2WZEA 1OM0A 1R85A 4JFWA 3FAWA 5JIWA 3OLDA 1EDGA 2BNJA 2O9OA 2DDXA 3H55A 4FF5A 2ZXAA 3KWXA 5IFPA 2XVGA 3CZGA 1V0NA 4FLSA 2F7QA 3VUPA 2DT0A 4PMZA 4DUVA 3GH7A 1E6QM 3VIKA 1GOQA 2E9BA 2WXDM 2ZUMA 5CSYA 4IPNB 3AS1A 4FNSA 3B9DA 4U31A 4JIEA 4J3VA 1QNPA 3W28A 1L0PA 2X2JA 1FHDA 4TTUA 2XGBA 2VR5A 1V0LA 3OGRA 3VIJA 4DUWA 1ODUA 4W8AA 3BLKA 1HT6A 4P7RA 1BG4A 2XVKA 1R46A 1B31A 3A21A 1ZBCA 3NDYA 4CU6A 1B3ZA 3L2MA 3GXMA 3D4ZA 1TVPA 3CC1A 3KL5A 5BRPA 2DT1A 4AD2A 2DT3A 3VSUA 2VX4A 3KL3A 3PZMA 4H7VA 1E6NA 5DF0A 4D6HA 3S2CA 6TAAA 2ZUVA 1OBAA 4CGTA 3AROA 4OOZA 5CXPA 4ZE5A 1AQMA 3WD4A 4M81A 4EKJA 2VJXA 3CHFA 2G4FA 3M7SA 3OA5A 4H41A 4HPGA 2BV9A 2CEQA 1HKIA 2YOCA 3OG2A 1KWGA 5CZKA 5I24A 2CBJA 2JIWA 1JIBA 4HOWA 4JZ5A 3EDFA 1BAGA 2QF8A 3VD7A 3VSTA 2XVNA 4UNIA 4WKFA 3UG5A 3AMKA 3AHVA 1VFUA 1XD0A 4PUDA 1JDCA 2W67A 1UUQA 1KBBA 1TQVA 4NRRA 2WC3A 2JF6A 5CGMA 1UKQA 1ZJAA 2EACA 5D9MA 1V0MA 3HG2A 4R27A 1K9DA 3WEOA 3RM4A 1UR2A 5D9OA 2J62A 3AHZA 4D1IA 4TTGA 1TQWA 1UWUA 1V6WA 2WHJA 1IT0A 1CGXA 2J7GA 3S5YA 1JAKA 3FN9A 3VD3A 4GQRA 4HA4A 3VDHA 2WBGA 1KTBA 1WZMA 4KMQA 4W85A 1E0WA 3HMCA 5KEZA 4U3CA 4D71A 3N12A 5DO8A 2W61A 4MB5A 1EXPA 4OIFA 2IXUA 3VGDA 1W2VA 1B9ZA 2X0HA 2XTKA 2CIPA 2WPGA 2GK1A 3OB8A 2VRJA 4J28A 3DX2A 3U57A 2OWXA 3AHTA 3W6LA 1XRVA 3WIJA 3D5HA 1ECEA 4E8DA 7A3HA 4UOQA 2CHNA 4W86A 2F18A 3PZVA 4Z2LA 3EJTA 3S5ZA 3VILA 1ITCA 2CERA 4W93A 1K9EA 1QPKA 4MNMA 1XD1A 4HMCA 3IJ9A 1ESWA 3T2PA 4PMOA 1JD7A 4PYSA 2WM0A 2FYVA 1V03A 5D4YA 1M03A 3VGHA 4PTMA 4QFUA 4HZ7A 3PTMA 2WC4A 3AMDA 1GPFA 4XZBA 1HJSA 1QX1A 3LXCA 4WKHA 4HZ8A 2JF7A 1R8LA 4OUEA 1EHAA 2XN1A 3VD9A 5M03A 1E5JA 2CNCA 4MTVA 1XSKA 5EB8A 1NWSA 2D24A 4W7UA 1MYRA 1M01A 2V3DA 1FP8A 1E56A 3SCOA 3BMVA 5LA2A 3W37A 2X2HA 4W89A 4LPCA 3PBGA 3A24A 4NXSA 4D6EA 1C92A 2XGIA 4JKKA 5AY7A 4Z2GA 3SCWA 1XCWA 1W1YA 2XHYA 1EQCA 4MADA 3G6LA 1VEMA 3CUFA 1BYDA 3VMPA 3O6AA 4GI8A 4KH2A 1W91A 4BA0A 5DFAA 1GONA 3CPUA 1EO5A 1C93A 1OD8A 4M80A 3RPMA 3MI6A 3K4DA 2Z1SA 1WKYA 4CU7A 1JYXA 2TAAA 4UR9A 2Y5EA 3ARPA 1PZ2A 4UQEA 1ZBWA 3I3BA 2J78A 1W9UA 4KWUA 4W7VA 1V3HA 1MXGA 1DWGM 3NDZA 1UD5A 5CPTA 1QWNA 3VMNA 1AQHA 4Q22A 1OB0A 3T0DA 1G1YA 3W4RA 4PTWA 1BSIA 1WDQA 1GJUA 2BY1A 4HMEA 1FH7A 3WNPA 1B90A 2GJXB 1PIGA 1LQ0A 1PAMA 1BVNP 2XVPA 3TA9A 2YFOA 4JFTA 5A2BA 2XM1A 6CGTA 4WIWA 3WQVA 3AS2A 1VEOA 4V2XA 1GUVA 2JE8A 3LPFA 1F4AA 3OLGA 5FIPA 3QGVA 3GZAA 5E1QA 1JGIA 2YLLA 3WF1A 1H0IA 3VGEA 1CXKA 3DC0A 3LRKA 1DWJM 4FNRA 1LWHA 1KXHA 2UWFA 3BSGA 2BHUA 1HVXA 2ZWYA 3VIHA 2NW0A 2XSBA 3RO8A 3AMLA 3SCPA 3EDDA 3WSUA 1LG2A 1YQ2A 4GZEA 1MVYA 3A4AA 2PI6A 2WMKA 2FGLA 1PX4A 2E40A 2Y8VA 3NSMA 3BAIA 1Z32X 4P8UA 3WQ5A 1GOKA 2W63A 3HG4A 2VL4A 1TZ7A 3WNMA 1R86A 1OGBA 2G3NA 2C7FA 3WN6A 4U3AA 3WEZA 1CXEA 3WKZA 3CMJA 2EAEA 4M8UA 1B1YA 4TVCA 1CWYA 3MUAA 3VGGA 1JXJA 1JFXA 2VRKA 1KCLA 3B9EA 1KCKA 1KBKA 5JBEA 4ZENA 1VEPA 3GBDA 1CGTA 1B3VA 5ECUA 4XX6A 3AJ7A 3MV11 3WMCA 1J01A 1VFMA 3FXYA 1L8NA 1I1WA 3WL1A 1HP4A 4W5UA 3PZIA 4LXFA 2V3FA 1OD0A 1NM9A 1CPUA 4A3HA 3U5UA 2FHBA 2VI0A 2J7EA 4H8HA 1UH4A 3O2LA 4IM4A 3TTOA 5I6SA 3MU7A 2XN0A 2VCCA 4Q7NA 1UD4A 1TE1A 4EAMA 1WZKA 5M17A 2JFEX 3H53A 2EBNA 2J7CA 2J79A 4AD5A 1QHOA 4V28A 4JCMA 3WDJA 1TQTA 2ZXDA 3CBWA 2MANA 2XN2A 2A3BA 4AZ5A 2J8FA 3AHXA 3OLEA 3K1DA 3WDQA 4TVUA 3DX0A 3W27A 1TVNA 3ALGA 4W88A 4AXNA 1VJSA 3RM8A 4XZWA 4UQDA 4W84A 3ZM8A 1WDPA 5A6LA 1OGGA 1SMAA 4H8VA 3AIQA 2VR4A 1E15A 5DT5A 5A6BA 1H2JA 3L4XA 2GK1B 3T09A 4LX4A 3WL0A 1X6LA 3GXTA 1VBRA 1ISWA 4PMQA 4XUYA 2ZX5A 2BFGA 4AEEA 4MJ4A 4CVUA 4F79A 4CU8A 5HPOA 4JAWA 3W26A 2PBGA 1EO7A 4GXPA 3IJ7A 2YDRA 1JZ7A 4PMRA 3LPGA 4PSRA 4BS0A 4UZUA 4B9YA 5A8PA 1E71M 3UEQA 5IDIA 4HA3A 3WD1A 1C90A 2YKKA 4FLQA 5CLTA 2EO7A 1Y7VA 3CUJA 2GDVA 3IK2A 2WMHA 4D6DA 2XG9A 2XFFA 5A94A 3CUIA 5E6ZA 1K9FA 2FE0A 1E6PA 3BUPA 1RD6A 2XSAA 3SCNA 5A69A 3EBVA 3VIOA 2DH3A 2PWFA 3FHQA 5LA0A 4QAWA 4ACYA 3AXXA 3AZTA 1UWSA 3GNOA 4ZE4A 1F4HA 1UWIA 4H2CA 4UTFA 3LPOA 2ZUSA 1UASA 3IAPA 3AI0A 1MW1A 3BGAA 1B3YA 3AISA 1QW8A 1CLVA 1GQKA 3WDRA 2D3LA 1BGGA 4IPLA 3OGVA 1E70M 3WDPP 1HJUA 2D0FA 4PMYA 5D8WA 1VIWA 1JI1A 3WF3A 2WLZA 9CGTA 2QMKA 3PZNA 5I2UA 3WF0A 3WY1A 3N18A 4YHGA 3UR8A 3W6MA 4UOZA 5D8ZA 2ZXBA 3ZJ8A 1E6SM 1TFVA 3MUZ1 5DMYA 1G5AA 5ABFA 1R7OA 4S3JA 5BXSA 1NH6A 3MANA 1HNYA 1UWTA 1OCQA 3PTQA 3AQUA 4JFUA 1BHGA 2A3HA 1LLOA 2IXVA 2F7RA 1HN1A 1W1PA 3VX1A 3F4VA 4MAZA 5AYBA 1HJXA 1EDTA 3ZJ7A 4IUGA 2WNWA 4PUEA 3DDFA 3AFBA 4DM1A 5JUVA 2G3MA 4U5KA 3DDGA 4AMWA 1J0KA 1B30A 5I23A 2WVTA 1RP9A 1CXFA 4TX6A 1JZ2A 3MMUA 3IANA 1O6IA 3ARVA 1DEDA 1VRXA 3PZGA 1KWKA 3VX0A 2YA1A 1BTCA 1CBGA 4HU0A 5AC4A 1OIFA 3U7VA 1HJWA 3AMCA 1KXTA 3GBEA 4TVDA 4LYRA 3FAXA 2YFNA 2UY5A 1EGZA 3ARXA 3CHDA 1HVQA 2X8RA 1ISYA 4NX0A 5ABHA 2O9TA 4E2OA 4A4AA 4L4OA 1V6YA 1FFRA 1C3FA 2XFYA 2CCRA 3GM8A 1BG9A 4AZHA 1V08A 1RPKA 2FH8A 4U5IA 1QHPA 5A3HA 2OWCA 1I1XA 4OBRA 1J10A 2OLHA 2EQDA 4AMCA 1MWOA 3K8KA 3POHA 1UH2A 1QNRA 1NOFA 2XUCA 3L4TA 3AHYA 2YDQA 5ABGA 1EA9C 1UR9A 1UR1A 1VAHA 2YIHA 4HOXA 4F9JA 2D22A 1SMDA 2F7OA 3W81A 2BXYA 2XFRA 4QCEA 2DIEA 3EDEA 3CHCA 3GH4A 6A3HA 1XV8A 3AXHA 2ZOXA 1VFFA 1G9HA 3BCFA 3U7BA 1Q6GA 3T0BA 5TD4A 3VNYA 4UFLA 1UD3A 1XGZA 1OIMA 1CIUA 3MKKA 5A2CA 1JYNA 3VD4A 2X09A 1QI0A 2C0HA 2BHZA 4CD8A 4CD4A 3F5KA 2E8YA 1WDSA 5E9AA 2PWDA 4DO4A 5A8OA 3K8LA 4N42A 1D3CA 2EXOA 1MW3A 5I3DA 3KL0A 1UKTA 3DX1A 3WH9A 2WKLA 1DWHM 1PS3A 4PTVA 2CPUA 3AS3A 2J75A 3HZ3A 2WMJA 4FLOA 4J3WA 3F5LA 3PN8A 3WMBA 3VNZA 1X1NA 2WBKA 4AD3A 1WE5A 1DWAM 2XIBA 1PJ9A 1MQRA 1KB3A 1D7FA 4AMXA 3RJXA 3II1A 3QOKA 3HG3A 5CQ1A 5AYIA 1K6AA 3WH5A 3SCSA 1PEZA 2PBOA 1CGUA 1HXJA 3L4VA 1PIFA 4H04A 2J25A 2VX5A 1UD8A 1EOMA 3TTYA 4HZ6A 1FA2A 3A4XA 3AIVA 3AMGA 1UH3A 1ZJBA 1FHLA 3ARTA 3SUSA 1B3XA 3ZOAA 1JF6A 1V3IA 4NXKA 3ZT6A 2G3IA 2V38A 2WHKA 4V27A 1QVBA 3THDA 4MNKA 1V3MA 4CCDA 1DWIM 4JKMA 2F61A 4LQ1A 4A3YA 1JF5A 5I0DA 2XPKA 4HA1A 3GTNA 4F8XA 4ZEPA 1GNXA 3CZSA 2E4TA 1WCGA 2J74A 4D6CA 1H11A 4JCLA 3AIRA 1W9XA 4D6GA 3QHNA 4PCSA 1QOXA 5CPQA 1JZ4A 3DECA 1UD6A 3TTSA 2WW5A 1R34A 3HN3A 4FNTA 1HWWA 3BAWA 2CHOA 3KZSA 2OSXA 1ZL1A 4Y7EA 2WCGA 3SIMA 5CJ5A 2JEQA 1WZAA 3WQ6A 2V3GA 3CHEA 4KRUA 1W9PA 2QLYA 1TR1A 3SCTA 1KGUA 5CSUA 1B2YA 3VDBA 3N9KA 3THCA 1CYGA 1GOWA 1PPIA 2NSXA 1N82A 2VQUA 3ZSTA 2WMFA 3WNNA 4MDOA 1Q4NX 1DP0A 1UWRA 1EDQA 4HMDA 2WK2A 5A6SA 2D3NA 5EMYA 1HTYA 1SYTA 2J7BA 4PCTA 1R47A 2J77A 4NI3A 3CO4A 4L4PA 1QHZA 2E9LA 2AAAA 3QR3A 3WFLA 4LGXA 3DX4A 2C8NA 4X0NA 4WKAA 3AIUA 3PTKA 5I78A 4HOZA 3N11A 1HKJA 5ABFB 2GFTA 1GHSA 2E9MA 1V02A 2Y8KA 3BUDA 1E4LA 2VTFA 2CKSA 1V0KA 4HU8A 2WHMA 3CZEA 3WELA 3GNRA 1CENA 2EPLX 4QP0A 4NZJA 4KGLA 1EH9A 3TONA 2OYKA 2G41A 1A47A 1QNSA 3EMQA 1BF2A 3EDJA 2ZWZA 2YBTA 2WSPA 4UQAA 4J27A 1PX8A 1GQJA 1XH0A 1CEOA 4ATDA 2RGLA 4AZ6A 5M3WA 4NSBA 1W3LA 4CCCA 2CXGA 3D50A 1C91A 5I5RA 3WUEA 1JNDA 3CH9A 7TAAA 1LJYA 4MNJA 3RDKA 3ZJKA 3QHOA 1HJQA 2IGTA 5DEZA 3QOMA 4Z2JA 3VKKA 1PX3A 2EPNA 3NUKA 4GZJA 2NT0A 4DO5A 1FH8A 1OSEA 2W62A 1UZ4A 5BYWA 2FDMA 3VTRA 3D4YA 2ZICA 5CGTA 1CZ1A 4PMUA 5BROA 4YPJA 3GNPA 1E55A 1EOKA 3MS8A 1QI5A 1GORA 1GVIA 5FKYA 2CESA 1TCMA 3MSDA 4OKDA 1UA7A 2BXZA 4GPNA 3VU2A 1R7AA 4EANA 2O9RA 4UQ9A 2A3EA 5ABEA 3WDHA 3ZO9A 3KLLA 1JXKA 4BF7A 1GZJA 8A3HA 3WY3A 2XWDA 5JIPA 4WSKA 2UY3A 2E3ZA 1MW0A
chains in the Genus database with same CATH superfamily
2R1XB 2YN3A 1JTPA 2O6FA 3HS0B 3TBSA 2CZ5A 4KI5F 4D6JA 4YE0A 3CQQA 4I85A 4DGVL 1D5MA 1DTUA 5FM5O 2MKWA 2DJ4A 4MWAA 2DMBA 4WNQB 5JXAH 1ZB5A 3GHBL 4F7TA 1XPGA 3L5XH 4YUEH 3BP7A 3OQ3B 1JF1B 4JN2B 2VGLM 4ANUA 2Y6SC 1RHFA 1WLHA 3UGRA 5CSBA 1SO5A 4NUJA 4FRWA 5CC3A 1ZPUA 2VDOH 4PG2A 4NZUL 3H4GA 2DYRB 3UTQB 4Y8EA 3SJ3A 2BWDA 3F04A 1OE1A 3W29A 4OGAC 3TVMD 4FALA 5E2VH 3P73A 2X2UA 4YWGH 2MQCA 1QWGA 3HG1B 3FRPA 4J6RL 2EPKX 5A95A 5XIAA 5B3JF 2CK0H 1PKQA 4G42A 4BQ2A 2ZP8A 3SGKA 2DSUA 2RGMA 4Q8OA 1D7CA 4JY5H 2V5CA 3RPIB 3R8GA 1VERA 2ZQ0A 2XRAH 4P9HC 3U6RB 2G8ZA 1MW2A 4RA3A 4XVUC 4H88H 3CFNA 4HJ0C 4M6UA 3XINA 2ZOWA 4GY0A 1QASA 3DPDA 2A2IA 3WDIA 2E77A 4JTEA 3RG6A 3ZJ6A 4ZUVA 4AE0A 5CZSA 5ISZB 4UU9A 1NEZA 4XD3A 1RV8A 4ABUA 4U1MA 3V5CA 2L04A 2F6XA 2NWSA 5KJRL 2VVNA 4BK4A 1GSKA 2F54D 3NAVA 5SWSA 2VDIA 3VFSB 3FFDA 2WP3O 5F7KC 4M48H 3BZFB 1RZKL 3GRWL 5D5MB 4E9RA 3F2LA 4NQEB 1IEHA 4NLHA 4QM1A 4OGYL 1LOQA 1G9ML 2FGZA 2HXTA 4M1DL 4XB3A 4Q7BA 3HZVB 3FYYA 3PHAA 2R56H 4F7PB 4NC0B 1QI3A 1GC1C 4IOSA 1JJUA 4BCZA 3JU2A 5L4FA 5LNWA 5EPMB 1C08B 2LFGA 4TXVB 1WT5A 3GC2A 4L29A 4I3RH 4RE4A 4ZNEA 1HF6A 4FULA 4QRUB 3S3SA 1UC4A 4Q8PA 4D8AA 4X7TA 2Y1ZA 3FYEB 3LHZA 5E2TH 4ZMVA 5JW5B 2Y4SA 1Y65A 2CO7A 2ZA3A 5ETUA 5FYJU 5GGRA 1IAII 3T9PA 5EEWA 2J27A 1RV6X 3A9IA 4XV0A 3AALA 1ZP3A 2R1XA 4ELMA 2FX7H 1KB5B 3N1FC 4Z42C 3H2FA 2DH2A 3IFNH 1VACB 5C0DB 1NGQH 1CCWB 3B2PA 2ZWKA 1O12A 4EPBC 4B3ZA 4JQXC 1LP9A 5D7KD 1I75A 1TVDA 4X0KB 3HTWA 4AZCB 5BRZE 3FW6A 3EO9L 1V7ML 1G4PA 3A9BA 3QPQD 3SUUA 3MROB 4JN2A 1JF1A 4ROQA 4PRWA 4QG6A 2A6KB 1PSKL 1ZGLP 1EO8L 4X9YA 1P5BA 4A8LA 1XIFA 1V7AA 4AKQA 4S1FA 4G82A 1UYQA 4D0BA 3TM6A 4UFJA 1E9OB 1GGIL 1HHKB 4JZNB 1NCBL 1P5VB 4ZQOA 3LCIA 1KTDB 1E6XM 3IT8D 3I3DA 4JZOB 4IX2A 3M7FB 3HG1A 5LNDA 3WLMA 5KVMC 3LKQA 5E8PA 4XOCA 4HKBB 5E0KA 3EJJX 4M02A 3MUGA 1PXGA 2C3VB 3ARUA 3OHMB 5IIEB 1LL7A 3MKGA 5F9WC 5KVFE 3BZ4B 1NGYB 4FXSA 2CHRA 4U6HA 2KT6A 5KANG 1QFOA 3QEQA 5DMKA 4J1OA 1K8ZA 5CILH 4IW4C 4MJIB 4IRJB 3U6RA 2YBUA 4PBGA 1M2VA 1TX2A 5HBFA 2WBJD 4QHUA 1V8EA 1N6VA 3F83A 2BZ7A 2P49B 4UTCA 2CK0L 2SEBA 1AW1A 4QHMA 4H13C 3EYQC 4PTNA 3HFTA 1OEPA 3ILDA 1R6VA 2G9KA 2B39A 1FL6A 4FTVD 3QDGD 4XO9A 2J88A 3UP8A 1PZ5A 2WLKA 4N9GA 2W81C 4JL1A 1FYTE 1ZCCA 4KY1H 1RA0A 3VXNB 5DD1L 4H88L 3FJTA 4AC2A 3V0AC 5BV7H 1KR1A 3AUVA 1Q9KB 4IGBC 4L64A 1JULA 4NQEA 3EGDB 2VM8A 3FLUA 4PFHA 4CSZA 2V5SA 4OCNC 1HDMB 1SXNA 2OYMA 2J44A 4KWVA 1H0GA 4YEFA 3HZVA 1OAKL 4N2YA 3LN3A 4WJ5B 1BZDA 1GKQA 5A8QA 4PLNC 4GXMA 2H3KA 4B50A 5JW4M 3SKOB 3JV0A 5D5MF 4JRXA 1MUJA 4KQ4L 4ZTXA 5C0BE 4ZRGA 1FDJA 2CH8A 2OCCB 2R4RL 4QRUA 2XM2A 1Q6LA 4D9RD 4KTEH 5IBXC 2D7QA 4GRSA 1EQPA 2YSWA 3IWPA 2WW8A 1BF8A 1AXSB 3PZQA 1PDKA 2BGSA 4APQA 3T2QA 4EZLA 3GPSA 4D9LL 3D3VA 2VDPB 3U9PL 3CX5K 2HFEA 3EOAB 3LNMA 1IGCH 3G3LA 1S9VA 3QIWB 3VIMA 4YK4C 5GGVY 4R7WA 3WD2A 4P7OA 1QBLH 1AY1L 3UA3A 1JVKA 2EXSA 1KGCD 3KYNB 1FAKT 4AWSA 2J6EH 2DPEA 1RSCA 2WUCL 4GIYA 3L5IA 1J1XH 4AZCA 2AVFA 2R0KL 2C79A 2ITDB 2V2CA 1ODZA 1K4DB 2WB7A 3OWRA 3EJSA 1OG6A 4ADUA 3H9YA 1PTDA 1E2VA 2BW4A 4PEKA 2A6KA 2VE6B 5C70A 3NA9L 4X5LA 1W3HA 1YO4A 5L2KD 3D39D 1SVCP 4HCLA 1IWPA 5D4IA 3QG6A 5I6LA 1HHKA 1CQYA 1WG3A 4GJTB 3MHGA 3X3FH 4ZMZA 1UQZA 1LYXA 1T8XA 4NN5C 1T7YA 5F44A 1VCVA 5SWZD 4L8DB 3P74A 3NESA 4WI0B 4JM0A 1T0OA 5EU5B 4HKBA 1QPXA 3DUUA 3DUGA 3OZOA 3K72B 3B5GA 1JV5B 4PRPE 4RZ4A 4LSRL 4I7WA 1A2YB 1FH9A 1NPJA 3QQDA 3VPLA 3FKRA 4C56B 3SY8A 2QMJA 1AMKA 4XBGA 4ZTPL 3CTTA 4BFAA 3E3QE 1KELH 1U91B 3PWPE 1CLOL 1JWSB 5JHDB 4A55A 3O11A 5GZOA 4JTTA 1WFUA 35C8L 1E0TA 2J73A 1TWSA 2JTYA 5CJQH 2WNKA 1RXOB 3VXMD 1SXZA 3VAEA 1W1ZA 5GNXA 1RQBA 3WNIA 4N6EA 5E0CA 3SRFA 4Q4SA 4NU7A 4HK7A 5DJCA 3WD0A 1HHHB 3WUFA 3OVPA 2O93L 1LROA 5H37G 2N56A 3CEUA 3T4YB 1TETL 3ASNB 1T1ZA 5F8QC 4NRZA 1NWRA 4KRPB 1FG2B 4NCC2 2WMIB 3L3JA 2XYLA 1ZBVA 1J0YA 3MLWH 4U3SB 3V0WH 1IGWA 1HILB 2GTZA 2DP3A 2WP3T 5HI5C 2FBJL 4RX4D 5T3ZL 2NQ5A 4BXSV 3SPVA 1Q94A 2DD8L 3VOCA 4JFWA 5AVUB 4EF8A 1L3WA 4GABA 2VH5L 3DVNA 2XVGA 2MPAL 4DTGH 4P2CG 1AXTH 4TUJB 4Z7NE 2PW1B 1KM0A 4PMZA 3KCJA 4B95C 2BPBA 1AXSA 2V9UA 3TAKA 2DI8A 4JEJA 4P4KD 1TR7A 4K7PX 1K1DA 4DUWA 2E7BA 2PU0A 3U9WA 4TLKA 3BOLA 2WQXA 3K6NA 4MFEA 2ZXEB 3QNYB 3MY9A 5HP5A 2HVNA 1BQHB 2CBPA 1XKYA 2CLZA 3TJ4A 1MG2C 4KTEL 3ZKSD 4PWJA 2WO2B 5E51A 1LUCA 1K4DA 2DWEB 4HOWA 1RCQA 3EDFA 2CZFA 1PZUB 5D2LE 4R9XA 1PZDA 2VE6A 1WWBX 4G7QB 5E8NB 3UYCA 1LVEA 3FT2B 2FVNA 2F5AL 3SBWA 3ULUF 1RULH 4HJEA 2QTVA 1FHVA 4NX5A 4WZHA 3GMNB 1DQDL 1D5ZB 3QISA 2RAGA 1TQWA 1HSAB 4HGWA 2WO4A 3S5YA 5D71L 4AH7A 1RUKL 3A6CL 3B9KC 5XIMA 4L8DA 4ZFFA 4WI0A 2W61A 3NFNB 2RGSA 1L6SA 4BD4A 1NVMA 3K72A 1M6UA 4DGWC 3K13A 3P77B 2BIMA 3DCPA 3EYVB 3ZMNA 3RXZA 1I1RA 3HB9A 1EX0A 4QO1B 2NUPB 3QQWA 4GX8A 1KN4L 2PCFB 5JW3H 4Z1CA 4MNMA 2AZAA 1GJIA 2BNUB 4K39A 3BDYH 4L65A 5I3JA 2EEFA 3FN0L 5JHDA 1GTFA 1MCSA 2PR9A 3HQOA 2W88A 1ZK5A 4NM4L 2P48B 1LO5B 4H00A 3UC0L 1G6RH 1M01A 2E6JA 1N2VA 1YEHL 3BMVA 4MA7H 3PBGA 3GMPB 3MRJB 5F72S 1NC2A 4LRSA 1BYDA 3KM8A 1OGTB 2C9VA 4J8RB 4XK2A 1KIRA 4KVPA 1HQ4B 1OADA 1RQHA 3MI6A 4WTWA 4FXGA 1XB3A 1WKYA 3G2GA 1G7UA 4PUBH 4Z7QB 2IW0A 3I02B 4KCTA 1WBXA 2RDWA 3MCKA 5CKAA 4U3SA 1HILA 1QWNA 4Q22A 1U9KA 2F19H 1CE1L 4Q0XH 3UTSE 4JANA 5DUPH 1AZ2A 5IESH 5A2BA 5I82A 4V2XA 1W5NA 2OMYB 1NAKL 3K3QA 1MN4A 2BSCA 2C9PA 4GSQA 2OU4A 4GSDL 2ED7A 4TUJA 4JVWA 4EACA 1AGFB 1B4TA 4JYEA 3C5ZA 4G1NA 3HMXH 1KCVL 3V7AE 4S38A 4P46A 1R24B 4MQXC 4CDGC 2OX1A 2OKMA 1BJ1H 3BQUC 4ALAL 6FABL 4Y16B 5T26A 3TEZA 5I1EH 5IT2L 3B05A 1NMAL 1V54B 4Z7VE 2P50A 3VE0A 1JFXA 3IXAB 2NW3A 3RB5A 3S4SG 4YHZL 3ME0A 3FUFA 3P9LA 4ZENA 4H20H 3W85A 4M6ML 2WKOA 4XX6A 3MV11 2DY3A 3WMCA 3Q5OA 3PWNA 3T0XA 2Z9TA 2H1XA 5D70H 4WHDA 1J88A 3HFMH 4GXVH 3FT4B 1JV2A 3MCNA 5EEVA 1S4IA 4XHJD 4O02H 2H8PB 4IG2B 4XNQB 1BQLH 1BXAA 2WXHA 2W95A 1A7RH 1TQTA 3H2PA 3FQXA 3H9HB 1PZBA 4NYLA 1BQSA 2V0TA 4MA1C 3EYFA 3S2AA 5CCZA 4C4KO 4OIIL 3IMVA 1YYAA 1JK8B 3ZM8A 5A6LA 4WUUA 5DT5A 3NFNA 4KDTA 1NGPL 4NJIA 1DOSA 1S3KH 5ITBL 1A4BA 5D96C 5I1CL 3P77A 4JREC 4WO4B 1JZ7A 1NY1A 3PL6C 4ANXA 5J3HD 1OB1B 4QO1A 4IFRA 2X6MA 1UWEH 2DQGH 2NR6C 1FRGL 2QR0A 3OMNB 4HD9A 5D4JA 2XFFA 1UVQA 2BNUA 4TQEL 1K9FA 3VH8A 3QG7L 4A1RA 4N2DA 2GOUA 3SCNA 4JR9H 5C2UB 3QUMA 1ACZA 4F9LC 4I5RA 2ZUSA 3C8KB 4RZ5A 1OXYA 3UG8A 4F8QA 4GWEA 3KM2A 4JFPB 4PJFE 5JXED 3QDJE 4UOZA 1I9EA 2WWMD 3F7VA 3URAA 3SJVE 2F7RA 2DWSA 1EDTA 5EU7E 5U4NA 3SOBL 4NQCB 3MDWA 1B30A 4JO4H 3JWNH 1RP9A 2CJ3A 5IMLB 3QEZA 2CLIA 1UM6H 1NUDA 3RA7L 1WA1X 5DN1A 1J05B 1NCIA 4X99B 2C1GA 4TVDA 1OL0A 1UP3A 2OMYA 3ZHDA 4RFEA 3LSCA 2Z27A 5LAPA 1HIMH 1TT6A 1K8YA 4Z7QF 3DEQA 3MLUH 3FA5A 3GSUA 5ALCH 1H7PA 1QFPA 3TEYA 2W9LA 3QA3B 4NRXB 4YDLB 4PRIB 2WXJA 5BZAA 3G18A 3POHA 3SO5A 4YDJA 4LVAA 4N2CA 4NQSA 1R24A 2YKLL 1IBGL 2XUCA 3E0VA 3TR9A 1JGLH 1UR9A 2EILB 3R25A 2I9TB 1A5NC 3L3IB 2VLJB 4CGUB 5TDPA 3H2OA 1CBVL 2XG5A 1QZ1A 1T1WB 3NDZE 1K4GA 4HU2A 1PTGA 4CD4A 2E8YA 1P7TB 4K0OA 1HNFA 1KW1A 1G4TA 5A8OA 3K8LA 3IVUA 5M95B 4WVXA 5D6CA 4U3HA 3KFTA 2CPUA 5LBSA 2WMJA 3CVHL 5KOMC 1X1NA 3D8MA 1PVNA 2W9DH 5I1JL 5L2JA 4JRYD 3QW9A 2YSTA 3OKLB 3GI9L 4AQ1C 1KB3A 3CYJA 3BPCB 1IO4C 1KV5A 5CQ1A 2P3ZA 2DM4A 4OF8A 1MEXL 3H9HA 3L4VA 2J25A 1IWBA 4BFOA 1TJ1A 1QLEL 2YRZA 1UH3A 4HZLB 3ZZ1A 2AEWA 4DZ8A 3HOGA 1MRFH 1D7KA 3SYQA 1N8ZB 2DZAA 1I8IA 1N59B 2C4XA 4HA1A 3MBDA 4F8XA 5TF1H 3KJ6L 2Y6TE 3CV2A 1KENH 5I73C 1EEYA 2OTWB 1TZZA 1QOXA 5IP4A 1OB1A 1A7RL 1YNTB 3X1EA 3JTSA 3KZSA 3UOAB 4NAJA 4O2FB 1TR1A 3SCTA 3MLXL 1MRCL 1RZPA 1KGUA 1TYJA 3FTZA 1RCXB 3U1SH 2EYTA 1F1GA 2Y3AA 1SYTA 5D30A 1DBTA 4ZMGA 4TNFA 4I7UA 4PRDB 3W7GA 3AY4A 4FQJH 2JMRA 2FPVA 2WXPA 1OCJA 2EIDA 5IQ7L 1OPOA 3RDTD 2Y8KA 4LCUB 3WS6C 3FO9A 3RLHA 4YSUA 1S7UA 2E74C 4E9YA 4OCLC 4J8QA 3NO5A 5D2NC 3I6EA 1A47A 4O1CA 1C1EH 4NQCA 4DJDC 1SJHA 2A74B 1YA5A 5IMLA 4HKXB 3P2TA 4MD4B 2CGRL 2XH2A 1MIML 1LJYA 4MNJA 1A4AA 2F38A 3GHEH 4M6OL 2NSOA 3GO1L 4NN7B 4OF5A 4IIDA 2HVJA 3ZUCA 3WXWL 4N8CH 2D31A 2JIXA 1GZJA 2DQUH 2ZOUA 5EU4A 2RFGA 3CVIH 4HK0B 4PGBB 3FK3A 3FC8A 2NZ9D 1W17A 1R87A 3W7EA 1XR9B 1S2TA 3ETSA 2VLJA 4H1ZA 4YHIA 5HJBA 4YPGA 1S3HA 1MFAL 3DJSA 4B2DA 5HYEA 3BVWA 4NKOA 4YDNA 3M0IA 1P7TA 5BS0D 2Q7YB 2WVSA 1X9QA 4MYAA 4LCRA 1RURL 3E8VA 2TSYA 3HU7A 1PSCA 3GSWB 1YDNA 2ARJB 5DJ0A 4UM8A 2DZWA 4BFNA 2WUBH 3I9GH 1E6JH 2W9EH 3C2AL 1M04A 5F7EL 4ABQA 3NQVA 3VXSD 4BK8A 1S5WA 1KLZA 3E2QA 2ZWNA 2E76C 3FQRB 4Q89A 1JZ8A 2PZNA 1EFXB 4U1IA 3F5WB 4IJ3B 4ICWA 5TAOA 3EJYD 4XAWH 3PY2A 1A6TA 3OG6B 3AUJA 5F1NA 3JVGA 5F7DA 2ZJSH 4H9TA 1HI6A 1N59A 3PUDA 3UTOA 4JPIB 1KYFA 4P8XA 2WWKO 3PAVA 1WYIA 4PJXB 1GZ1A 4BZYA 1WVZA 4C4KT 4XD4A 4OZOA 3P2VA 3GB7B 3G77A 4JTUA 2YR3A 1E90A 4R84A 1N55A 2E7MA 2DQXA 1G4RA 4IJCA 1GGYA 3BLBA 5FCZA 3TH6A 4QR6A 3UYIA 3HPFA 1DFBL 1W15A 2O56A 1X96A 1U92A 4ORGB 2CIKA 2R2HA 4PP1D 4D94A 2B1HH 1I7RA 2ZA1A 3LCHA 1YNTF 4I48A 3IU3A 2LLLA 4PRDA 1R3RA 2MCMA 4LBEB 2CM6A 3TCXA 6XIMA 4ZXLA 4QRTB 4LCWE 2GDUA 1VPYA 3LB6D 4GMSL 1EBGA 4L80A 1TJXA 2ZCKH 3ELAT 1AH4A 3ABLB 4LCUA 3LM3A 2V17H 1WH0A 3R0DA 1CICA 5IXEA 3H3KA 3BSZH 3PWJA 4UAOB 3LLFA 3W2KA 4Y9MA 4HN8A 3G08A 4XNUH 5E1HB 3VSVA 1P9MA 2NTSP 4HKXA 3ALFA 1MIEH 5JPNA 4F2MA 4RCXA 4EI6B 4ILSA 3EUUA 3OD3A 4KFOA 3C8FA 4C54A 4YTQA 5SV3A 5ENWA 3SCMC 3OGSA 4A8IA 3HO8A 2C16A 4TQHA 4LCSA 3HC0A 3LZFH 1A5BA 5F2GA 3CHQA 3N0PB 1O6VA 2UX7A 4B92A 4WWKC 4PGBA 3UC2A 1MCJA 1F76A 4GRWE 3P0GB 5CCGE 1YEGH 3PABB 1GVQA 3H6OA 3N19B 3OEXA 1DQKA 4CD6A 1YMMB 1UTDA 1RIUL 3NEXA 5D7JC 1I8LC 3ELQA 4ENLA 5IWLA 2NNXA 4WOZA 1S7VB 1KJVA 5DYOB 4N2EA 3MRCB 3CNYA 1EF3A 3E1F1 2ARJA 3OR6B 3UZEC 3W1PA 4XAGA 1E8YA 5CCKL 2KZ1B 2XQBL 3FUNA 4GQPH 1ETB1 3K4WA 1XQKA 4LZKA 3PBMA 2A6IB 3PSVA 3TN3A 3P30H 1XC6A 4LEOA 4CILA 3FTUA 4P2RD 3H8NA 2PD9A 2YCEA 1P5UB 3FF8A 3S0PA 1XSJA 4CNOA 4NNXA 1KRAC 3ZDYE 3F00A 4MMYA 4CCZA 3OL2A 3WYRA 1QUNB 4MWAE 5GRZA 1VB9A 1S5MA 1KRBC 1LE9A 2QSQA 4PJXA 5IHSA 3GKFA 1G94A 3O3DB 2QPUA 3I2CL 5T3XH 4Z7UB 2ADGA 5H8MA 1XH1A 5I3HA 5DHYB 3BEWA 2YPVL 2DVUA 3V0IA 5LXEA 1LL4A 2P8MA 4PJXF 3ELFA 3KRZA 1ZS8B 2IDSA 3D0VB 2OS7A 2GBAA 3DIFA 4ACTA 2OPCA 1RZ7H 3BO8A 4LAUA 3F6JA 4HFUH 4DGYH 2EDLA 4FKEA 3WBWA 1WUNT 1PKQE 3STLB 2DZEA 4AVIA 2AEIT 5C0EA 3CFDA 1JD9A 5AFDA 1SFSA 3N34A 3D0CA 5LQBL 5FACA 1OT1A 4MXVE 4XX5A 5I8KH 4GI6A 1I6NA 1OCWL 3QO1A 4RMWA 1ORSB 4YN3A 3IFPB 4QNWA 1SGJA 4PWKA 3PR2A 3AYRA 1Z2KA 3BAKA 1KPUB 1HAUA 2WQ8A 4TVPL 4J3SA 3PJSB 5GS0C 3FN3A 1ZHAA 1UXLA 5DHVB 2APTA 5DXWA 5G55A 5DCEA 5TK2A 2LU3A 4CNIB 3GBML 1RFDH 4XGZA 4LF2A 2APXA 3E2HC 2NZ9C 3BD4A 2WZAA 1K8CA 3KBSA 4HJGA 4JFDB 5SWSE 3BSZL 3QORD 1JG9A 4PMNA 3QNZA 3ARED 4KAQL 3FUMA 4RH4A 3F2BA 1E5YA 3LEYL 2QDGA 4P05A 5L6YH 3PK7A 1AD0B 1XLMA 4FP1A 3UD6A 4TNVK 2IOIA 1YMMA 3OHXB 4KK5D 2GVYA 5KN5A 4BH7B 3GEWB 1YLVA 1XXFC 4UZSA 3WENA 5L9DH 1S7VA 4R7JA 2IPTL 3VDAA 2PODA 3LX9A 3SBPA 2FMNA 5AYYA 1XMEB 5FDWB 3IDXL 5KVGH 1LTXA 4ZW6A 5B3NA 1R3IL 2X4PA 2PXYA 3O6FC 5KSBB 1GVOA 4BSWB 3SDAB 3MJ9L 3HI6L 1XH3B 4BWTA 4J40A 4GY1A 2NY3C 4B3LA 4PJGA 5ILTL 1GG0A 1UC5A 3LERA 3OP2A 3A5VA 2Y6SD 3L3HB 5LKNA 3SD5A 4ELME 4OBSA 2IWEA 2PD5A 4MHHI 3STFA 4P61A 2D8KA 1BWWA 2P46B 3S5OA 2VDRB 4FNQA 1R0AL 2QGBA 4HOMA 1TTIA 5F3FA 2DWTA 3DG7A 1QUNA 1DLFH 4NGHL 2ZXWB 1LP9E 4OGAD 1M1BA 1MWAH 1BQGA 3ICJA 3A23A 2ZUWA 4H9VA 4TQTA 2Y9RT 2ARJQ 4HPHA 4Z7UA 2Q7AA 1VGKB 2VDLB 3Q43A 4CN6A 1NBVL 2JEPA 2HFTA 2AMXA 1IARB 4XP6H 3ZDXB 1P1MA 2J1KA 3DV6A 1ZHBA 3R4DA 4KRLB 1KBIA 4AITA 5JBFA 1KFAL 5HHOB 5JQ6H 3O6YX 5CINL 3QHMA 5CC7A 3HRZB 1OSZA 4XVUD 3D0VA 3T4AC 4HJ0D 4Z7UF 1MKFA 4MUZA 5EBLA 2P8LB 2XH0A 1WFNA 1H5VA 1S8DB 1DJZA 4K3JL 3TSMA 1DEEA 3QEUB 2XXFA 1ZJHA 3MSYA 4A6YB 5F7MC 1TMLA 5EL1A 4ELDA 4N9OB 3SE3A 3QEQE 4WIQA 1TPEA 6TIMA 3MCLH 1J9YA 5IFJB 2YMTA 2AV1B 1SZFA 3EEGA 2A6JB 4YTUA 4HETA 1VGAA 4N68A 1TRIA 4OV6F 4JPGA 3QLDA 1U4FA 1F86A 5DHVA 3IEBA 1BD0A 3PULA 3OGCA 3WHXB 5A2FA 2W0KA 1U8IB 4HTYA 4MNQD 1VKXB 2DDXA 3G24A 4UTMA 4KVNH 1QFWL 2RCSL 4OT1L 4AUJA 2MSPA 3CL8A 1SFHA 1ZLEA 1IFHH 3SN0A 1GRWA 2YUVA 3TYGL 3E6EA 2ALAA 3B9DA 2R23A 3GUTB 5D09A 1FL5A 3FCSB 3MRHB 2AXJA 3VFWA 5CEZL 3RPDA 1ZBCA 2BFVL 2P76A 4QF1B 1AD0A 3KL5A 2DT1A 2AL2A 2ZVIA 2DW6A 3BDKA 1TVBB 3QUXB 1KT2A 4E0CA 3WD4A 1NFAA 4BH7A 1FDLL 3G5EA 3U46B 1P7HL 5K9JH 4BSVA 1XG3A 3UZJA 1T03L 3HVNA 3B7TA 2HROA 3ZTJH 2CNZA 2HB0A 1HOCB 4JRXE 3MLYL 1MO0A 2R2CA 1URZA 3VC6A 1F3TA 1RLWA 1IJ9A 1ITBB 4N90D 4S1SH 4BSWA 2LU7A 3RGHA 1KBBA 3SQBB 1YNYA 1VESA 1XH3A 3T0TA 1TJRA 2VC5A 1N6QL 4RPQA 4I6KA 5ESAA 2XV2A 3GTTA 2XKNB 5EOQH 2J62A 4PGDA 1IAKA 3N3TA 2NX5B 3RVXC 3D3VE 4GQRA 3G1SA 1IEAB 2VFEA 5HHVL 4RGNB 4XPGL 4BE5A 4MMXC 2EXYC 2MCPH 3LIUA 5EU6A 5KSBF 4WI8A 5AW3B 5FFLA 4QYOA 2PMQA 3NVDA 4O1FA 3V5OA 1NKOA 4G80A 3B0XA 2PDWA 3S3GA 3SPCA 3W6LA 1TQXA 3UO1L 3TBTA 4W86A 4IXXA 1ZIAA 5DJYB 1PTZA 4GW5A 4DP0X 1CLZL 1SSDA 1P84K 1W3NA 1RUML 3FO0H 3VWJA 5E2WH 5C97A 3ZL2A 5JUEL 1AC0A 4P2OC 1TZHB 2AC0A 1U3HB 1U93B 4PJEA 3OXSB 5HJGA 5DO2C 3UX9B 1AR2A 5LCVA 2BSDA 6REQB 3HRZA 1J5IA 5D8JL 5HNUA 2A9NH 4EZMA 1A7OH 2P8LA 4GS7C 1I31A 3RRQA 1VEMA 3GWJA 4NAEB 4BHUA 3GR7A 1DSFH 4ODVH 3ZDXF 1EGVA 3EYQD 4K7PL 5J5RA 1A5UA 4Y1AB 1EWHA 4NN6B 1XF3A 4UQEA 2DMGA 4JG9A 2J78A 1AQKH 3P14A 1ZGLB 1DWGM 3EX6A 4IGBD 4ZPVA 1OB0A 4YNGA 4I9MA 5DUBB 4DP6X 5JIIA 1UXWA 5FA3B 3VKDA 3MQTA 3WHXA 1I1YB 2ZRVA 4XODA 2HFGH 1CR9H 3DTXB 1HEJC 1ZE3H 1GUVA 4R7VA 2E6YA 4X4KA 3BH9B 4JX5A 3KPMB 1LWHA 4NJAH 3AUWB 4L0PB 5F96H 3M1BB 2XWJB 3KPQB 1XLHA 3NFPA 1GZHC 3MCLL 1HVXA 1A1MB 2XSBA 1N7MH 3AMLA 4ZFOL 2O5ZH 3SCPA 4NO0A 4NYYA 1A4LA 1LG2A 4XNAA 3VXOB 1PX4A 3T2LA 4A68A 3WQ5A 4ILDA 5D1XB 1Q9OB 2WSRA 1YBQB 5CHNA 3V5KB 5JIHA 2P44B 4PRNA 2Y69B 3VJ6A 5HHMD 1ZTXH 3U46A 4S3DA 2JJUA 1DQLL 1XYBA 1RU9H 3FO1B 3GZPA 4GNVA 2BTMA 3PAZA 1BVKA 3D85A 3FXYA 3HE7A 4X8JB 3H23A 5I6PA 4YHPB 2GAZA 1OD0A 5C9JA 1CB4A 3LSBA 3BKML 3QPZA 2J7EA 4IBQA 3SQBA 5I6SA 3VOHA 3D25A 2XSKA 2VC7A 1OCBA 2EBNA 1E67A 4HKJB 4YVVA 2Y7EA 5IUSA 1M7OA 2QQNH 1ZEAH 1SO6A 4E4UA 2GSIA 4O4WA 2GW5A 1E15A 4ALDA 1LLWA 1XQLA 3V0FA 3R8RA 5HJXA 4CVUA 3BWUC 4M6NH 5B7EA 4GB9A 1U42A 5DHXB 5AVHA 3TCLB 5DJYA 4S3EA 3B37A 4AWJC 4HIIA 5IJDC 3QYSA 5IDIA 2C4FU 5KWYC 2KLTA 4JM4L 1F4WL 5TTRA 4TR9A 2BOCA 2B2XL 1I85C 4C1LA 3IJHA 4GJIA 1A7NL 2BNQA 2LFEA 1FH2A 3TX9A 3OXSA 3MLRL 3CFJB 3IRZA 5AHIA 3HV9A 1RPQA 4UTFA 4Q8QA 4IOFC 4DBUA 2LVEA 1AXIB 3FFOA 4H0HB 1AH0A 4I77H 4QEHA 2OQJA 1AUSL 4LRTA 3IPEA 4OIBA 3BE7A 3OWEA 2POTA 2AK1L 4TKWA 1MI5D 5MP6H 5LNSA 1R7OA 4GQ0A 5FYKL 1U21A 4GZ7A 1A3RH 4XPBH 4LKXA 4KFZC 3U82B 2ZOLA 2A3HA 3UXKA 5LAXB 2NTFB 4UTBH 4IUGA 3SRDA 5CSSA 3SE4A 3DDGA 4N7QA 1M3UA 4QAIA 2H32A 3D4GA 2EDDA 2E1DA 3OM3B 3S3DB 4LSPH 2EE2A 3S88H 3FB6A 3WQCA 3MV7A 3ARXA 3BH9A 4JG1H 2B4CC 1YDVA 4L4OA 5HI5D 3UBXA 1N3NB 1BFVL 2XWJA 3ZHLA 3CUPA 3UFIA 4OQTA 3CPLB 1LM8V 3AYVA 4LUSB 2P0OA 3C86A 1E42A 1EA9C 2VDQH 4HOXA 2X1RA 2AJUH 5EBWB 3HS0A 4DJFC 2HRGA 3AG3B 1G9HA 4O4VA 5G4HC 4HWNA 4H9UA 4W9KC 3NYKA 2Z1PA 5A2CA 1EPXA 2C0HA 1JNNH 4WNQA 3APFA 1H1YA 2PYFB 1XQ4A 3MBXL 5I3DA 4X8JA 2JQXA 4WWNA 2WKLA 2D7NA 3IDJB 1P0DA 3I65A 4XAPA 4DT2A 3PN8A 4TLTA 1RMFH 4Y2DC 3CWGA 3LU2A 4Z95H 2OLAA 3H1ZA 3HG3A 2F53B 2WQDA 2PBOA 2XQ0A 3UTQA 5E2UH 3CAVA 2L7JA 5JXAL 3AMGA 4G8GB 1FHLA 5IFAH 1N70A 5FC9A 1TO5A 4NOFA 3L5XL 4YUEL 2YCJA 2V38A 1UUOA 3THDA 5IB5B 1KOAA 4CJ0A 3E3HA 3Q13A 2O6PA 5EIVA 4XISA 2QXWA 4PODA 4RXFA 3GG8A 1FWSA 3LK6A 1GYUA 3QHNA 3B9KD 4JTQA 4AV5A 5FR3A 2VDOL 3RPIA 5LO7A 4QKXB 3HN3A 2OXNA 1N7KA 3LQGA 1ZL1A 4M3KB 4GAAA 2QLYA 2CE6A 3FFSA 1BXVA 4Z1YA 2PF8A 5E2VL 1GOWA 4YWGL 3BQ5A 2Q3AA 3CQJA 3FTGB 3MRFB 5ISZA 2J71A 4LEXH 2FKPA 1AODA 4L4PA 4WK2B 1UP2A 6PCYA 3M88A 4B60A 2CUHA 4JY5L 4PRBB 2G0WA 1S7XB 1MCFA 4WUUE 2XRAL 4PWEA 1AE6H 1U6AH 3VFSA 4Y9CA 3PJWA 3BARA 2YQ2A 3BZFA 5D5MA 2WXKA 5ALBH 3TS8A 1A0DA 1I1AC 5I1HH 3LV5A 2DJLA 2E5EA 3G6JB 3P4LA 4HCRH 5IMOB 1T0MB 4LBUA 4F7PA 5AD0B 5DJAB 4A2HA 1JNDA 3CH9A 5EMUA 1KM5A 2RH9A 3JBG7 5EPMA 1C08A 4EUPH 3QPKA 4M48L 3T71A 2LQRA 3C2OA 5HDBB 1GL4B 4U4MA 5CGTA 1PDYA 3RFAA 4EE2A 1RZFH 1PCWA 5JW5A 4R97C 3UZVB 1PY4A 4WHYH 3HG0A 5I71C 2Q8ZA 4ZCWA 4LUSA 4BF7A 2FSEB 3FUEA 5K4XA 2R56L 1REQB 1HZKA 4NC2B 3U7YH 5F2MA 4CRPA 1B4RA 2J6WA 1JPIA 1KB5A 4N0YH 1DBBH 4I3RL 1U22A 1KA9F 1DJIA 1VACA 5C0DA 4GY4A 4O0KA 3Q4DA 1K7FA 1YEWA 2D7TH 1Q6EA 5E2TL 3C56A 4MQXD 2FQDA 3V4LA 4X0KA 3VXRB 5CIPB 2F1BA 2OV0A 4GEJA 3BQUD 1Q8AA 4JRLA 4N3UA 2ZG3A 3MROA 3UT0A 1YVLA 3GXFA 1BM3H 2GJPA 2I5IA 3V6BR 2FX7L 4AUYA 4Q4IA 3OB0H 4QE1A 3QRGH 3Q2LA 1JXGA 1BWKA 3IFNL 1CGVA 1E9OA 2M8XA 1KGIA 1NGQL 4JZNA 1CDBA 1P5VA 4RW3A 1UOVA 3DGCR 4G8GA 1KTDA 1KGYE 4JEGB 3NA4A 4JZOA 1A5OC 2YAEA 4Z2HA 2Q87A 2GVGA 4ADIA 4IJTA 4POZC 4DUXA 2I1OA 1T7WA 2I17A 3AB0C 3ZBMA 2C3VA 5J89A 3G3DA 3LS5H 5IIEA 3DVGB 2DM2A 3BZ4A 1NGYA 1P6CA 4G59C 3KPLB 1BGAA 4ZQPA 5B22A 1ISZA 5E1GA 3HHSB 4MJIA 2YAMA 1OOAA 4IRJA 4DQAA 5LKYA 5JH1A 5HYSG 1I9RH 3SECA 1YPIA 3PL6D 2EUZA 1TO3A 4YR6B 1TQCC 5D1QB 1CVRA 2NR6D 2WC7A 4HP5A 3OVUB 3ZMRA 4PRBA 1TFPA 4KMTH 1CC3A 1HXKA 1GW1A 3LCYA 3SIZA 5CILL 5HWJA 5C71A 1XLAA 4MD0B 3VXNA 5MHSE 1Q9KA 4ZFMA 5IVZB 2PDCA 2VO8A 3EGDA 1A22B 5J56B 1HDMA 1JCKA 1SLUA 5F7HA 3PP3K 2C9UA 4CN1A 1OQOA 1T0MA 4UM9D 3UTTE 1NSNH 4X83A 4N1CA 4WJ5A 1TZAA 4K1WA 1MREH 1U30A 2AKZA 3WQ4A 3SKOA 4QJ3B 4KY1L 3VE7A 2VVSA 4R2GB 3IGXA 5BV7L 3F4CA 3BUVA 3C5JB 3DIPA 3G6JF 2ITFA 4P5SA 3WMSA 2GJZB 3K0WA 4P7LA 3UZVA 4XPHH 3S6TA 2XZCH 4A2MA 3VTTA 2ZUXA 3MKCA 1REQA 1UATA 4KF1A 3LV3B 3VABA 3EOAA 4CQAA 3GLDA 1IR2A 1H7WA 1IE4A 3QIWA 4NRYB 4WTZA 2EADA 5HDBF 3D7PA 2V81A 3EKGA 1QACA 3G1DA 2YL6A 1FNGB 4XR8C 4M7LT 3KYNA 4H83A 2G4EA 4UXDA 4UFMA 4CN4A 2WQPA 3SDCB 4G8EB 2ITDA 3DDMA 3CAKA 2W5PA 4GUIA 3TCSA 1CLXA 2ACQA 2F8VA 3ISYA 2VAJA 4I0CC 2R9RA 4K7YA 5MEND 3ZZQA 4DPPA 4GAJH 1BZEA 3Q06A 1IGCL 4F0MA 5C0GB 5J11B 3NCMA 1LG1A 3HMJG 1QBLL 3BN9C 1K6QH 3VK5A 5SWUA 2J6EL 4DF2A 4FA7B 1J1XL 5CFHA 1KTKE 1W0YT 4WI4A 2XACC 3WKQA 5J7CC 4LWWA 3P61A 4L3CB 1X97A 2FEDC 1BMGA 2YR1A 2YGNA 4YBLB 5EU5A 4EP8C 3SGDH 5AYZA 2FT8A 3VTAA 4YH6A 1HKFA 1JV5A 5BO1H 4IHCA 5CD3B 2DYSB 3JZUA 2MH4A 4CMHC 2KYIA 1P6BA 1A2YA 1JRBA 5FJJA 3HHSA 3IM1A 4PUUA 1HJVA 4NHVA 3NABH 4C56A 2JFCA 1WICA 3X3FL 2X6AA 3CV7A 1U91A 4XIAA 3EWUA 1JWSA 2BMKB 3TN0B 4NRSA 4JIHA 3P4OB 3WSQH 5D1QA 1JGMA 1TIWA 3ARRA 3G1FA 5HYJB 2QCGA 4XCFH 2YD9A 5CF3A 3SGZA 3UDWA 4OZHB 2BS9A 3MDUA 1O1ZA 3MGOB 4YHKH 1AK5A 4E42B 4BUGA 1MFVA 1HC1A 3NXLA 1QTYT 2IO5A 3G8EA 1HHHA 3GYRA 1MCCA 2RB8A 3HHRB 3N9SA 3MR9B 3T4YA 1KELL 1H4PA 3KH3A 4Q74A 4CAGA 1YXYA 2ZRZA 4DGUA 1RHHB 1FG2A 2BSEA 2WMIA 3L9YA 1HESA 2CRIA 4MA8H 5CJQL 1JL8A 3IARA 1BV8A 3EMCA 1T1XB 3CBRA 5T5NG 3FNDA 2UVEA 4WW2C 5B7YA 2PC8A 1P6WA 2VZUA 4HGKC 2E6QA 3IGLA 1KBGH 4DJDD 3OJMB 3UYOD 2RFXB 1UZ1A 2Z25A 2XZ9A 2R29A 1KM4A 1IILE 2FT7A 2BY3A 2PW1A 3WUGA 2ESVD 2QVIA 5A6MA 4A7SA 1VFOA 3CZUB 3MLWL 1N26A 3V0WL 4Q3MA 5FO9B 3ISRA 1TMCB 1GOXA 4NKQB 4U7SA 3PZ9A 1D5BB 2QDHA 3VNDA 4C7DA 5G4MA 3PP3H 1IZKA 3CLFH 3QNYA 3X13B 4PRHD 1HHGB 1BQHA 1FNGA 4B4FA 4CKVX 1DVXA 5T1KB 4DTGL 1AXTL 2Z00A 3MP5A 4F2ME 3QEGH 4LAMA 1NWUA 3SDCA 1J8SA 1MCNA 4YO0B 2DWEA 4EIZC 4JHOA 1T20B 2H3DA 5HHQB 1QA9B 4DIXA 3GRWA 5FSEC 1NICA 4W9FC 5E8NA 4XNZC 1Q6DA 4J7RA 5FGCE 3FT2A 5ID1B 1PQZB 1OGSA 1EKOA 2VZVA 1FO0H 3KOZA 3TV3H 4U0RC 4XAKE 2OFQA 5H1WA 2UXTA 3GMNA 3BFQG 3LMYA 1D5ZA 2V5RA 1HSAA 3HB3C 3T42A 1IEXA 5LB1A 1SF5A 4UQ3B 3RP1A 4FSAA 7CGTA 3FFCD 4U1GB 3MV8B 4XO8A 2I5QA 3EYVA 3ZKMC 3MTXA 5I0XA 1HL9A 3VXUD 1RULL 1WO2A 2NUPA 2PCFA 4FZ8H 2AV7B 3KW8A 2OLDA 4QOKB 4V11A 1EJRC 4W9IC 2ICCA 2ZRUA 1LO5A 4Q6JA 2HISA 5HYJA 1MNSA 1QAWA 4IOIB 3EBHA 1XB8A 3GMPA 1QZNA 2NXGA 1ND0B 3MA8A 2ON3A 3MRJA 3IVKB 4CC4C 4E42A 2H45A 3OG4B 5JW3L 4YSDA 4PJ8B 4ZO8A 1OGTA 1B3JA 4J8RA 2ALWA 2Z1XA 4HYTB 5KZCB 4L7ZA 1HQ4A 3BDYL 3DYMA 2MPVA 1TO4A 5GJSH 3HV8A 3QUYC 1V79A 5MEQB 1H6FA 3I02A 1G5GA 2BZNA 1E4NA 4OZHF 1F74A 4S1DC 1G6RL 4JGDA 1BQKA 5IOKA 4GUHA 4MA7L 3IJEB 3LQMA 1R3KB 3RGVB 3B2UC 1XL9A 4BHUI 5TBOA 2O9OA 3H2EA 4ODHH 4B5WA 4XTIA 3QDMD 1XINA 3H7BB 3GMQB 5AOJA 1M7PA 3TVAA 4NS0A 4PUBL 5K1VA 1AGFA 1J93A 4WOQA 2ZZUT 4TTUA 2X0SA 4P7RA 1UP0A 5FO9A 8RUCA 3ECVA 5EU7C 3OZYA 1EXGA 3SCMD 4DFHA 4CU6A 4PS8A 1D5BA 2F19L 1URIA 4Q0XL 2NY2B 3VSUA 5DUPL 2ALRA 5IESL 2GGHA 1ADQH 4Y16A 2R4SH 3OZ9H 1AACA 3CHFA 2G4FA 3NSJA 3RWGB 5A2KH 3OA5A 5IROA 3IXAA 1LBLA 5T1KA 4WWKD 3SKJH 2PGWA 5E4IA 3QZOA 5F7FA 5CZJA 4ZQNA 4BINA 5FYLE 4XWOC 3HMXL 1ZAIA 2XTLA 1WFIA 4N9EA 1S5IH 5HHQA 3TPUB 5D7JD 3FT4A 1A5CA 4XT1C 3VCCA 5BOEA 2H8PA 4IG2A 1F6YA 5D38A 4XNQA 4ZZKA 5I1EL 4N24A 1T7VA 4WWID 1OIOA 1IT0A 1ACCA 3U4BH 4KMQA 5E4AA 4H20L 4D71A 1CD1B 4PGJA 5L4JA 1KM3A 4MB5A 1O75A 1JK8A 5D70L 1XIDA 2VSDA 2X0HA 4B5NA 3NCWA 3C2EA 3HFML 3QZBA 4GXVL 4PGZA 2CD0A 3MV8A 2G5BB 2ENPA 2EDBA 1MNZA 4WO4A 3S5ZA 4O02L 2YOAA 4DPBX 1BQLL 1RZJH 5J06A 4YFDB 1BAFH 4K8RH 4PBVC 2IWGA 3VGHA 3M4HA 3I9PA 5AFAA 2XQYK 2GCYB 1HEZB 1H8SA 4PJGE 1E5JA 2JELH 4HHWA 1S3KL 2WBXA 3C8KA 3PP7A 4LPCA 1EEZB 2BODX 1ND0A 4JFPA 4JD4A 4PJ8A 4M9PA 1UWEL 2DQGL 1TTQA 2J8HA 3RPMA 1F3DJ 2V5JA 2GK2A 3QXWA 4JTIA 2Y5EA 4G71B 1ZBWA 4YDZA 5CD5C 4JR9L 3BFOA 2Q1EA 1Q65A 4RWHA 1EC7A 4PTWA 2I9UA 1AJ7H 3UL4A 2V69A 2XVPA 2GVJA 4JFTA 2YQ3A 3Q9PA 3IAGC 1KBWA 4DX3A 5KSAB 5C3TA 1M4KA 3OX8B 1NEPA 1J05A 4X99A 1RJLB 3NQGA 2X4QB 1QSFD 1Q2RA 4G8AC 4R33A 3IE4A 3H7BA 2VKZG 5GS0D 2QCMA 3VIHA 1NL0H 2PCQA 3QA3A 1BXBA 4NRXA 2E40A 4NO2B 4PRIA 2OBGA 3D09A 2SFPA 4JO4L 4PH6A 4FI7A 3NIDB 3HG4A 4G7YH 4OCYH 1UM6L 4L4VE 3IMSA 3WIHH 3KRSA 3B0UX 3F03K 2PETA 4U3AA 3CXDH 2I9TA 3L3IA 2GEQA 3B9EA 4NC1C 5JBEA 1HIML 1T1WA 3RUGB 1L6YA 2NX9A 3GBDA 4BKTC 3UBXI 1DBJH 3MLUL 4NQQA 1U4EA 4AGNA 4IU3B 4HLZH 5ALCL 2PKDA 2IS7A 4IP5A 1V27A 3CHPA 4G5AA 3WLKX 1RY0A 2V3FA 2PLKA 1JEZA 2FHBA 3F8UB 2QYGA 2D2CC 1P0KA 3FQ1A 4G8IB 2BVEA 1JGLL 1GPWA 3TTOA 2J13A 2G5WA 3QMTA 2WQSA 2XFGB 4Y5XC 2EPHA 3OKLA 4V28A 3LBMA 3A4FA 3BRFA 3BPCA 3V6FB 1MNNA 2AAMA 1TYGA 1EJTC 3SN1A 3O6FD 1CD1A 4O17A 4H0LC 2GVLA 4HZLA 2NY3D 1YIXA 1HUVA 3NZRA 3S5LG 3SDDC 1N8ZA 1VBRA 1A3XA 1RUQH 4JN8A 4F79A 4K9JA 1GYLA 2W9DL 1PF3A 4BS0A 2PYEE 5A8PA 1E71M 1ERNA 1VJIA 4AOFA 5H91A 2OTWA 1A7BA 1NMBH 1YNTA 2LTQB 4Q6IC 3DBXB 3NSDA 1AIFB 4O2FA 2X89D 1OZQA 1GVSA 1QAPA 1RD6A 2XJKA 2YAOA 5LA0A 1MRFL 2BCKB 2P4AB 1YTDA 3ARFC 3QAZB 2PLMA 3TESA 1B3YA 3W73A 3ZYIA 5TF1L 3NAAH 2WJ7A 1HJUA 5B1JC 5D8WA 3T5WA 2CALA 1KENL 3AADB 9CGTA 3ECWA 5EU6E 3KPRD 2WIMA 2ZXBA 3UZYA 4CDHA 3NRPA 1Z9MA 2GITB 3KVPA 2VUNA 3AXKA 5AYBA 1H6TA 1U1UA 2Z8WC 5H8UA 3U1SL 4GO6B 3WLTA 4OCSH 1XT5A 2A74A 1DEDA 5ANMB 3VWKC 1PKLA 4MD4A 1WUFA 3GBEA 4K94H 3L65A 4Z0XB 1YRRA 3CB8A 4WCYH 3N1GC 4R9HA 4PJEE 4FQJL 5HDWA 4KI1A 4NX0A 1SQ7A 2NY6C 4JO3H 2PMZA 4A4AA 1BD2D 1LEGB 2INZA 3SKUD 1C3FA 2A4AA 3BD3A 4Y4HB 4HHPA 2HCVA 4B6ZA 1OW0C 3WOVA 1I1XA 2IPUG 3P4MB 1QEXA 1A1NB 4H5SB 2XOTA 4QHPA 2CZEA 1C1EL 5J6GB 1ZA3B 3AU6A 5C6PB 1NU5A 1MAMH 4OU1A 3MCYA 4HK0A 3SQOH 1BF6A 4HUCA 3KVMA 3NOEA 3GH4A 1W8EA 1XR9A 1TCRB 3BCFA 3GHEL 3QIUC 5AAWA 1Z5LB 1TLKA 3MYJB 2XWRA 2AABH 3KL0A 4N8CL 2Q7YA 3EYUH 4ZXBB 3NIDF 3V0DA 1AJZA 4DN1A 4RSYA 5FGRA 4KKLC 3D1MC 3GSWA 2DQUL 3DMMC 4KI5E 3WMBA 3NQ6A 3CVIL 4GNKB 3K6DA 4S3FA 3RUGF 4PUJA 2Q2EB 3FKKA 4OZFG 1MVFA 2WNZA 1TTFA 3GG1A 2FX8H 1T0PB 3FQRA 3AIVA 1EFXA 4ORIA 1BKHA 2DVTA 4B91A 3F5WA 4UOW1 3PDOB 2NV9A 3W74A 5J6HB 4LQ1A 5CCHE 1SUJA 1NIAA 2R82A 4UNUA 3RVXD 4X7DC 1U3YA 4JPIA 1Z3NA 4QD2E 2WUBL 3I9GL 1E6JL 5IFHH 2W9EL 2ZWSA 1R34A 3ZE1B 1IX2A 2EXYD 2OSXA 5JIKA 3GB7A 5HNTA 5GGSY 3ZLQC 4XC1H 5AC7A 1B4EA 3E9TA 1DXEA 3THCA 1XBZA 5FOJA 4BKNA 2VQUA 5B3JE 4XAWL 4LS1A 3VACA 5LWYH 1EDQA 3CXHJ 1OF6A 1I0DA 2ZJSL 1SN2A 1HTYA 3VFLA 1L7IH 4DNLA 4ORGA 1R47A 2HVOA 4XE0A 1NFGA 2YD7A 3B2VH 2OJ1A 4X0NA 1D5XB 3FMGH 4P2OD 4HUVB 1MMFA 3N11A 4LBEA 5DMIH 4QRTA 2GLKA 3LIZH 5DO2D 4XE5B 4CVXB 3EWCA 9XIAA 2GITA 4HU8A 4M3HA 4QRPD 3CVHB 2J8TA 1CENA 1DVTA 1PBYA 4J27A 4A66A 4ESKA 3VYNA 1FG9C 2WQRA 2G4GA 2AQNA 2B1HL 3GHSA 2VD9A 5CAHA 1QLEB 1XLBA 3C6SB 2GC7C 3E5BA 4Z0XA 2BNQE 4EI6A 4Q9RH 3NXFA 3NUKA 4NAMA 3CL6A 1QFUH 4P06A 2F7FA 2ZCKL 3V55A 4Y88A 2ZICA 4MZ1A 4YPJA 1NCCH 3QFJD 1QI5A 4HTBA 4Z0JA 1OHZA 1ICTA 2V17L 4YHYB 2VFFA 3QKEA 4O02B 3IFLH 1LO3H 3P4MA 4V1DD 3GBNH 2HJLB 2FZBA 3RG1C 2CKRA 2XZ7A 4XNUL 5I1KH 1XF1A 2EABA 4JO1H 4M29A 1S5HB 1KJ2H 2E86A 5MKGB 1MIEL 3TJPA 1XXDC 5I6XB 3QQ3B 3PABA 4GYPA 4NFBA 4R5EA 1Z5LA 3AAMA 1SFDA 3HFFA 4JTAA 3R1ZA 1WV7T 4X9HA 1WJ3A 4FIRA 3TNOA 3WKYA 1F1DA 4YL9A 1YYLH 2FB3A 2D2OA 3LZFL 5DYOA 3MRCA 4DZBB 3MV7E 4ZNEE 4GUFA 3PDDA 4YMZA 1EHNA 1FC1A 4N0FB 3AOFA 3OR6A 3WFAA 1TELA 3LNDA 2NWRA 2QCNA 1YJDH 3TP4A 1YEGL 3VQMA 2GZXA 1UT9A 3QSKB 3BAYA 2QFRA 3NM1A 3SPIA 3L45A 3NSXA 1JPHA 2A6IA 2KHAA 1SXAA 1LMIA 1F00I 1ZQ5A 2Q6WB 4PS4H 1P5UA 3WNJA 4BZ1A 1JRHI 4H7ZA 4YSCA 4HCGA 4RVBA 1WT5C 4MCMA 1SW0A 3L48A 2BOFX 2VOTA 4FYRA 4G6MH 1RZQA 5M5DA 1NKGA 5K93A 4K38A 3WTWA 2I25N 3O3DA 32C2B 1MLBB 4YL2A 3P30L 1SGKA 3ULVH 2Y06H 2IMNA 1FH5H 1CW2A 5DHYA 1NQ6A 5FA4B 2PDKA 2WWKT 4AI7A 2QADB 5E5MB 3URNA 4N1HB 1MCIA 4OJAA 2WINB 5TFSH 4H1LB 2F0CA 3V7AG 3ZE1F 1ZS8A 4PLJC 5KS9B 3GHRA 1NBQA 1U83A 2IAND 5ERWB 3HG1E 5GRUH 4KFMA 5T3XL 1NOUA 3GG7A 4CQBA 3STLA 2GGEA 3LQAH 3S2MA 4IOFD 2FH6A 3NIGB 1G43A 1TQSA 2OT0A 3AQYA 2QHRH 3O05A 1ORSA 5FUZH 3IFPA 3W1QA 3CVBA 2I14A 2V9RA 3KGUA 3Q94A 4NO3B 1KPUA 1YCSA 2IQ9H 1FQ9C 2AGJH 2BIIA 2ZFAA 2G3XA 3PJSA 1FNSH 4GIPD 1RZ7L 3C6SA 4IQHA 4AZ8B 4CC0A 4I9TA 1EDHA 3J2PA 4HFUL 4DGYL 4CNIA 3INPA 3WLLA 2Z65C 2E09A 2Y63A 4EE9A 5ISZE 2TSAA 4X80H 4A2RA 4Y0GA 5I8KL 2YC1B 3DRQB 3IETB 4X63A 2EJ1A 1BYAA 4F15C 4X5WB 4JFDA 3L54A 3GSQB 2AXGB 3NQ8A 5AKRA 1KY6A 3HLAB 1F6FB 4MA3B 5AB2A 5ACMA 1ZLPA 2DWYA 5D5ME 4B96A 1NJJA 4NQEE 4DPQA 3JWDH 3QQ3A 2EUXA 1RFDL 1SYSB 3OHXA 4Z0SA 4HFWB 4IBVA 4WSJA 1ITUA 4HBCH 3WNOA 2Z34A 1GS7A 3VZXA 4DJFD 4LVNC 4DJEA 4M1GH 1RUSA 4XN8A 2Z92B 4M5ZH 4LCCC 1HYSC 1KLFB 3UU0A 5FDWA 1TVHB 1OX5A 4ONVA 5KSBA 5L6YL 3SDAA 2APWA 1B5TA 1QO5A 4WW1B 3EBGA 2WZHA 2ZOTA 2O55A 3L3HA 2FEEL 4KHTH 4W7WA 4Y2DD 4XXDB 5L9DL 4LEEA 2MMXA 3H3PH 1KLYA 2C3HA 5C0AB 5KVGL 4LNVA 4JYFA 2E25A 3MNDA 1C8YA 4WHTB 3C0JA 4RL3A 3G5XB 1Q1JH 3CLEH 1VGKA 2CA4A 1RVFH 3VDCA 4NZ1A 4UV7H 1UW9A 1XF0A 2I7OA 3O4OB 1NA8A 2AJXH 1UWAA 1D2OA 5E5MA 3UXAA 3FX4A 2OJEB 3P7YA 5HHOA 4FQIH 4MXWH 2GY7B 4H1LA 5C0QA 2GSMB 1DLFL 4Q8BA 2QS8A 1MWAL 3EOYG 1WQ5A 3ZIMA 3FJ6A 1NBYB 1HCFX 3QBUA 3MSPA 2YUXA 1Q0XH 1JGEB 3M64A 3MLZH 2H0FA 1S8DA 1D5RA 3QEUA 1P48A 3V3WA 1K77A 4A6YA 3RWDB 1ZNNA 4Z1PA 3HKZA 3MBFA 1IQWH 5E56A 2QJDA 3H9SD 4XP6L 4U6TA 4H9YA 1SHMA 4YJZL 5IFJA 5KS9F 5DZJA 1R2TA 3H7RA 2AV1A 1BOGB 4MJIE 2A6JA 2DLFH 1JZ5A 5JQ6L 3UXFA 3M5YA 1EWDA 3HGOA 4LIQH 2X4OB 2VWSA 4OKVB 1TJIH 1I1AD 4FD0A 4LFHG 1LE5B 2W79A 5IHHA 3WUWB 1U8IA 5CJNA 1UEMA 3NIGF 2WZ6A 1NLBH 2AQSA 1JZIA 1VKXA 3ILEA 2WZIA 3BLPX 1FNEB 4OI7A 4G83A 5GNZA 3TEWA 4K71B 3EJPA 3G6MA 3CVCA 3VMOA 3GSQA 3GUTA 1FYTD 1QD0A 1XF2B 3FCSA 3MRHA 3VO0A 2PN5A 5I5IA 3G1VA 4YTTA 4P5TB 4QF1A 1H5BC 1UR0A 4ETYA