3BLKA

Role of aromatic residues in starch binding
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFADARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-function relationships in human salivary alpha-amylase: role of aromatic residues in a secondary binding site
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase 1
total genus 172
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3blkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3blkA01
1E3XA 1WDSA 4RE4A 3AMGA 3LRMA 4FNRA 5I2UA 2W91A 5CZKA 2CHOA 3BLKA 1UH2A 4ZE4A 3QGVA 4UFJA 3QR3A 1HJXA 4JCLA 1GOMA 2ESCA 2WMHA 4IPLA 1VFOA 1UG6A 5CPSA 1KXVA 4CN4A 3ARTA 2XIIA 1XSJA 2QF8A 1J01A 1R7AA 3S5YA 3PN8A 3U7VA 2XTKA 2CBJA 2O9PA 5A8MA 4N0RA 2ZX7A 5GPRA 3MV11 2F8QA 3MV01 1KXQA 3PZNA 1HXJA 2BVTA 3NYDA 1NOWA 1CXHA 2XVPA 4ZXOA 2G8ZA 2BXYA 2XHYA 4FLRA 3WD1A 3H55A 2CXGA 1UWUA 2CITA 3AS2A 7TAAA 1LL6A 4DUWA 1JGIA 3PTQA 5LYRA 4AZ6A 4JFWA 5JBDA 4D6GA 4JAWA 4Z2IA 5JBFA 1XYZA 4A4AA 4FNQA 1E72M 4P7QA 1G1YA 1H3GA 3FY1A 4YPJA 3N18A 1JL8A 1H0GA 1FP9A 1HJUA 1MYRA 1UWTA 4TTGA 5A6JA 2VL4A 1UH3A 4GI6A 4HZ7A 5I3DA 4EAMA 3VSUA 2V5CA 2ZWZA 1VB9A 1GHRA 2C8NA 2QV4A 2CBIA 3VIKA 3WDQA 1DHKA 3DYOA 1Z32X 2DIJA 2VCAA 1G0CA 3UCQA 1PIFA 3M07A 2E8ZA 3VMPA 4HP5A 2X1IA 3T2PA 1D3CA 1OGSA 1KWKA 1PAMA 2VI0A 2DEPA 3SCUA 2J7FA 3BAYA 2GSJA 3VUPA 1MW1A 1E0WA 3VD4A 1XRVA 3DX2A 3RM8A 5CQ1A 4UNIA 5E1QA 1DTUA 5AC4A 4QFUA 4PMZA 3D4YA 3AIWA 3KWXA 4TXEA 4U5KA 1ZS2A 3F5KA 4J28A 2MANA 2GK1A 2VX4A 2ZUTA 1UR9A 3VGHA 1UKPA 4QAWA 1V0KA 4KMQA 1W3LA 1QBBA 1ODZA 2J4GA 4P8UA 1KB3A 3WMCA 3WNPA 1HVQA 3N11A 1J0HA 5DMYA 3L4WA 1ODUA 2O9RA 4W8LA 3APGA 3CV5A 3AYSA 6TAAA 1E6ZA 3N1AA 4EANA 3AHYA 5I5RA 2Z1SA 3WH6A 4AIEA 3OLIA 3WFLA 5HPCA 2ZXDA 1ZB5A 3A4XA 3LXAA 4PSPA 3IAPA 2OYLA 1NOFA 2EPLX 1E0VA 5ABFA 3VM7A 1BGAA 1TQUA 6A3HA 1WAWA 4M81A 4RE2A 5A94A 3I3EA 4TTUA 3TA9A 2NW0A 2GDUA 3MO4A 1R8LA 1V6UA 1HTYA 2V38A 1C7TA 3W29A 3VKKA 1MW2A 1TQTA 2IXUA 1ZBVA 1XH1A 4AMWA 1B90A 1BHGA 1KBBA 2EBNA 1J10A 2OSYA 3IANA 4CD4A 1UD8A 1KGXA 4J7RA 2CPUA 3VGBA 2WLZA 3I3BA 1CTNA 2WBKA 2VZOA 1HKMA 1OIMA 4H8HA 1BQCA 1H1NA 1HWWA 2GK1B 1WB0A 3EJTA 2CYGA 3EDJA 1O7DC 3A23A 3W6MA 4AZHA 1CLXA 4H04A 1EDTA 3H54A 2WZHA 3AI0A 1HP5A 1E70M 1HN1A 1T0OA 1CXFA 1VJSA 1HKJA 1C90A 3AMKA 3UR7A 1LLOA 2UY2A 1MQQA 1LG2A 1JAKA 2UY4A 2VX6A 1A47A 3B9DA 1KCLA 3D3AA 3T2OA 4NZCA 2V3EA 1V6XA 1K6AA 1CXEA 4P7RA 5CGMA 1OGGA 3NSXA 2XG9A 2PI6A 2WMIB 3IJ7A 1D2KA 1JNEA 1W91A 5E0FA 1ZU8A 3VIFA 3CHCA 2VUYA 1QNRA 2YA0A 4FLOA 4PMXA 3EDEA 3CIVA 4EK7A 3ARVA 3VINA 4PTMA 3GXPA 4D6EA 2GJPA 1TVPA 5DT5A 1WDQA 1H2JA 5D8ZA 1TE1A 3ZJKA 3W53A 3CZJA 3CGTA 4JZ5A 1JZ6A 5D9OA 4H7VA 4WSKA 4TVUA 4UQ9A 3W38A 4UOJA 3CUJA 3CTTA 5E9AA 3MMUA 1KXTA 2WMGA 2X09A 3W4RA 2WVVA 1AQMA 2VQTA 1OSEA 2J7EA 2V3FA 5FL0A 4W86A 3SIMA 3GNOA 1W2VA 4XX6A 1J0KA 1GUVA 1VENA 4W89A 2G3MA 1SMAA 3BMWA 1GOQA 4F66A 4HA4A 1NM9A 3PZVA 4W8AA 1CEOA 1LQ0A 2WSKA 1B3XA 4V2XA 1GQIA 2E9MA 2YA2A 1EIBA 3SUTA 3ARRA 3WEMA 2ZX5A 1VBUA 2F1BA 1PPIA 3T0AA 4AIUA 2YLLA 3ARSA 3WUGA 4AD1A 5CSUA 2XGBA 1OD0A 1NWRA 5ABEA 4OGZA 2EQDA 2E9LA 4UZSA 4FLQA 3VX1A 3SURA 5BXTA 3W25A 3K46A 5FIPA 1WKYA 3WKZA 1JD7A 3RJYA 1GOWA 3CPUA 3L4TA 4JHOA 4AW7A 1QI5A 1HL9A 1WZMA 1NARA 5I77A 1HIZA 4AISA 2OW7A 2PWGA 1RP8A 2BXZA 3GNRA 2DT2A 1E0XA 4MDPA 3SCVA 4OBRA 2X05A 2J7CA 1GOIA 4PN2A 4XZWA 4ZEPA 2OW6A 1NQ6A 3K1DA 4C7FA 2WVUA 3OZPA 1LWJA 5E6YA 4JFTA 1FH7A 5EFFA 4UOZA 2YBUA 1IV8A 3WQVA 5DFAA 4HTYA 3BH4A 1HXKA 1UR4A 1GONA 3BVTA 3POHA 5HXMA 4LYPA 1HP4A 1OT2A 3AXHA 1F4AA 3AZRA 1M01A 4FNPA 1QNPA 1TMQA 1UWQA 4HU8A 2JIEA 3OG2A 4H8VA 2J8GA 3PTKA 4AWEA 4DO4A 4CU6A 1JZ7A 4Z2LA 3B9AA 3AXIA 3PZOA 2G41A 3K8KA 1WDRA 3JUGA 1W1TA 5EMYA 2QMJA 4HMCA 1AQ0A 1BYAA 3PZ9A 4JFVA 1QW8A 1OGBA 2X0HA 4MNKA 4GI9A 1CYGA 1PX8A 4TVCA 3CZEA 3ZT6A 4OKDA 1IT0A 8CGTA 1W1VA 3SCPA 3N13A 5IXEA 1J11A 2E3ZA 3AYRA 2D0GA 2BY0A 2FHBA 1UUQA 3EJPA 1QBAA 1BG4A 3RDKA 3A47A 1H11A 1C8QA 3CHEA 4AD0A 3EJRA 3OGRA 2OYKA 2X8RA 1EHNA 4JKKA 4C7DA 1E6RA 3WDIA 4AZCA 4TX6A 3S5ZA 2VCCA 3TOPA 2BVDA 2XUCA 2PF0A 2WWCA 3SCSA 3THCA 5GQBA 1EHAA 1B3VA 2IUZA 1HVXA 3LPFA 3VDHA 3MUIA 4MNMA 1YQ2A 3VSTA 1E1EA 4DM2A 2AMGA 3BAXA 4AZ5A 2EPOA 3WEOA 4UTFA 4PMQA 2VRJA 2C7FA 1VRXA 3VDBA 5A2CA 5IDIA 3RIKA 2XJ7A 4AD4A 4AZBA 1DP0A 2X2HA 3EBVA 3HMCA 2ZE0A 4GXPA 3GXTA 1EOMA 3VGGA 3WELA 2GDVA 3VIPA 3O9NA 1ISYA 3OA5A 3BUDA 3L4YA 3W24A 4RE3A 1G9HA 2WKLA 1V3KA 2O92A 4DWSC 2O9TA 1CNVA 2PWDA 4LYQA 4MPKA 1R75A 3OGVA 3GXFA 4NZJA 5A1AA 4AMXA 3UG3A 2DH2A 4MB5A 1XD0A 3GNPA 1CDGA 3TTYA 3HN3A 4TOQA 4TVDA 4CCDA 2VRKA 1O7AA 1E4IA 2FHFA 4ATWA 4WK9A 4CU8A 2DIEA 5CXPA 2J62A 1XC6A 5IFPA 4GPNA 1FH9A 1UASA 2X0YA 3NJ3A 4MB3A 3SUSA 3MUY1 1R7OA 2G3IA 3M6DA 1TQWA 3BCFA 3TV8A 1M04A 2V3GA 3VIIA 3QOMA 2Z1KA 1EOKA 1OCQA 2A3AA 3W81A 4PMYA 1W9XA 3CZSA 1SFSA 1E40A 1ZJBA 2WANA 3WH9A 1UD4A 1TFVA 5HPOA 2VJXA 3G6LA 3BVUA 4D6DA 1F4HA 1GVYA 4B9ZA 1TUXA 5I23A 1BFNA 1VEMA 4CN6A 3KEHA 2D2OA 3BVVA 5A2BA 1ITXA 3VIMA 3S6TA 3BVXA 2FH8A 3TP4A 4LXFA 3EMQA 1B3YA 3WQ6A 1JF6A 1J0ZA 3SCWA 4HOXA 4QCFA 1BLIA 1CXLA 1JZ2A 1B3WA 4W8BA 4UQBA 1GQLA 3BAIA 4CKQA 3VX0A 3AROA 4UR9A 2YDSA 7CGTA 4ML4A 3K8LA 3POCA 3ZJ7A 1TVNA 3AIRA 3VD9A 2EPMX 4P8VA 3CHFA 2VT0A 1UWSA 2YKKA 2FGZA 1KTBA 1K9DA 3RPMA 2BY2A 1N82A 1CENA 3LXCA 3WF1A 1JDCA 4W7WA 3OLEA 3ZO9A 1TZ7A 3GXDA 3WY2A 3OIHA 2EJ1A 3KLLA 2DPEA 1AMYA 1PX3A 5FCZA 2DH3A 2CHNA 3ZSTA 5I78A 3WBAA 3ZOAA 5A6BD 5A8OA 4MAVA 1XHGA 3AQUA 4AZIA 2AOSA 2VRQA 2VR4A 1OWQA 3AS1A 2W62A 1CGXA 4FK9A 4W93A 5HBFA 2GJXB 4AZGA 3MUZ1 4CCCA 5I79A 4BF7A 4F79A 4PTWA 3ZJ6A 4OOUA 3VM5A 4MADA 1W9DM 3U57A 4MNJA 1JAEA 3ZT7A 2WLYA 5I24A 3WH7A 1M7XA 1UKOA 5DF0A 4RL3A 2WB5A 5AY7A 4R27A 1JXKA 3GXNA 1PZ2A 4P7OA 4B3LA 2WM0A 1L8NA 3WSUA 1NWSA 1FP8A 5BXSA 2OWXA 4C7GA 2W61A 4FNTA 1UHVA 1H09A 1Q6FA 4R5EA 3VSVA 8A3HA 4AXNA 6CGTA 1W9PA 2VC9A 2V5DA 1S46A 4DUVA 4PMRA 4XUYA 2WWDA 3EMZA 1UR2A 3EDKA 4DWSD 1U33A 1BYCA 5CPTA 5HOSA 4JFSA 3THDA 4MTVA 1C91A 5JUVA 3W82A 1JZ3A 3A24A 1Q6GA 1EA9C 4W84A 1U2YA 1EDGA 2VX5A 2B31A 3VNYA 4AMCA 2BHUA 3VDAA 4D6FA 4WF7A 2VVSA 4QLJA 1NH6A 2W67A 4CD5A 3PZGA 4W87A 2DT0A 1VFUA 4PEEA 1E4NA 1XSIA 2GJRA 1E15A 2GJXA 4AD5A 1E4MM 3MMDA 4LGXA 1UWIA 3IJ9A 4MB4A 1O6IA 3W28A 1VEOA 4NF7A 4ACYA 4AEFA 2X2IA 1R46A 2J77A 3ZQ9A 3PZQA 3SCOA 4L4OA 5ABHA 2XM1A 1UKTA 3IAQA 1L0PA 5A8PA 1GCYA 2XM2A 2CETA 3BXWA 1JYVA 1QWUA 4BA0A 3SCQA 2Y5EA 2F2HA 1UQZA 1TQVA 4TX8A 3VU2A 1US2A 4PUEA 4LPCA 4HOWA 1V6YA 1DWGM 1B30A 3L4ZA 3L4XA 4PCTA 1ZJAA 2BNJA 1UKSA 1QHOA 1D7FA 3WENA 2BVYA 4IM4A 1CBGA 4ACZB 2WHLA 2YL5A 1V3IA 3MANA 1OINA 1CIUA 2WBGA 3U7BA 5FOOA 3WD4A 1LWHA 3VGEA 3WF2A 2YDRA 3ARXA 2OWWA 3OBAA 1ISXA 4XB3A 1JXJA 4NSBA 3PTMA 2D0FA 1CGTA 1AQHA 1JZ8A 2J8FA 3BAKA 4CN1A 1X1NA 3BUPA 3D4ZA 1MFUA 1CXIA 4HPGA 4BCEA 1HJWA 2ZOXA 2VZVA 5BYWA 1W9UA 4FNSA 1PX4A 3N04A 2YFOA 1R34A 5EB8A 3ZMRA 3BSHA 3EJSA 4QLLA 4LX4A 4MNLA 2UY3A 1BTCA 1X6LA 3AS3A 1E73M 3MI6A 3U5UA 4PMNA 2WSPA 2VNCA 3G6MA 1BPLB 5E6ZA 1K9FA 4OIFA 4QDMA 2VO5A 5GNZA 3HJEA 2CKSA 4ZE5A 1E6XM 1FH8A 1E6SM 3CMJA 1JFHA 3PZMA 2QMKA 3WNLA 2ZUSA 2EPKX 5F7UA 5D9PA 3OLDA 4PCSA 1K9EA 2XSAA 2XVLA 4U5IA 1XGZA 3UETA 4ZXLA 5LA0A 5GNYA 1CPUA 1IZJA 3WY3A 3QHNA 4ACZA 2GUYA 3L4UA 1SZNA 2E0PA 2PBOA 2E8YA 3BUIA 1Q6DA 2JFEX 2XGIA 2X2YA 2QPSA 3ZSSA 4EKJA 4UQEA 1CWYA 3T2QA 4E2OA 2OYMA 1B3ZA 2W63A 4V28A 5A6KA 1J12A 2DGAA 4BQ2A 4AEEA 1KGWA 1GJUA 1RPKA 1Q6CA 4D6CA 3VDCA 1KGUA 1E43A 1I1WA 3II1A 2F7OA 2J74A 4OUEA 3W26A 1JDAA 4DM1A 2W92A 2J25A 2E40A 1H49A 1IZKA 1UOKA 4KRTA 4YHGA 1KQZA 3TTSA 2EO7A 3NIYA 3F5JA 2RGLA 4YHEA 2TAAA 3CZKA 4HA1A 4DWSA 3WDHA 2Y8KA 1KR0A 3AIBA 2F7PA 2G4FA 4YN5A 5CLWA 1OT1A 2XIBA 1ISVA 1W2PA 1PEZA 4WKFA 4GQRA 2BY3A 1W3KA 2WC3A 1FHLA 3CUGA 1QWNA 2DSWA 3WF3A 2CCRA 1WCGA 3NSNA 4BZYA 3DHPA 1DWJM 2D1ZA 2Y2WA 3FAWA 3ZM8A 1JFXA 4FNUA 3WFZA 5ABGA 4AYSA 3GXMA 5KEZA 2ZXAA 3SCTA 1BVZA 3BUQA 3WNOA 3W6LA 1XYFA 1R47A 3FHQA 3VD5A 1DWAM 3CH9A 2QPUA 3PZTA 3WQ4A 3UESA 4AYGA 4Z2JA 3B9EA 4GKLA 1RH9A 3AIVA 4KWUA 4EE9A 3GH5A 5A6MA 2XVKA 4BS0A 1UKQA 1BF2A 1W32A 1JYNA 4MJ2A 4DWSB 3K8MA 2WC4A 4JHZA 1GQJA 4BQ5A 4UQAA 1Q6EA 1EQPA 2YL8A 1MXGA 3K4DA 4ATDA 1WPCA 4UZUA 1NWTA 4U3AA 2D3NA 2YL6A 2GFTA 4DO6A 4ATLA 5AYIA 1ZBWA 3VILA 4AZ7A 1PJ9A 2WCGA 4AY1A 3WN6A 4PUDA 4M82A 3RO8A 2VTFA 1HKIA 3CHDA 2QHAA 1TCMA 1BGGA 3SCRA 2UWFA 3I3DA 2XVGA 2ZICA 3LPGA 3L4VA 1QOXA 1FOBA 1KTCA 1QVBA 3W27A 4PMUA 2VURA 4AZCB 5CLTA 1GJWA 3M7SA 1HJSA 4B3KA 1JI2A 4HZ6A 2J79A 4JKMA 4CVUA 4U31A 2VZTA 1QHPA 4Z2GA 1HT6A 1MXDA 5A95A 4NXKA 1J0YA 4M24A 2XN2A 3KL0A 2CBVA 2DSVA 3A4AA 3HU7A 3DHUA 4P7LA 2PB1A 2OLHA 3WNMA 1W9BM 4WLCA 3VPLA 3AISA 3ZR5A 5A6LA 4QCEA 2DSKA 1M53A 2JALA 2XWEA 2WZEA 3GH4A 5BRPA 3AICA 1ESWA 3RJXA 3CZLA 3WUBA 4W7UA 3L2MA 3N12A 1G01A 1SR0A 5DO8A 4HPHA 3EDFA 3WDPP 1WNOA 3GDBA 3H53A 1TG7A 2CBUA 3WQWA 3UG4A 1E4LA 1RP9A 2XFFA 1WZKA 5D9NA 3HG3A 4H2CA 2DSUA 3IGUA 1CGYA 3GBDA 4GZIA 3IK2A 2WYSA 5BCAA 2J7HA 3WNKA 4J3UA 1OIFA 5E0CA 1PZ3A 2HVMA 3TTOA 1LL7A 4GZJA 2OWCA 4CD8A 4OZOA 3PBGA 4DO5A 1J18A 1E6PA 3AHVA 4JL2A 3WUFA 1ZL1A 2F18A 4B16A 4UFHA 3WDRA 3MSDA 2VX7A 4HMEA 1V3JA 4W7VA 1B0IA 2JF7A 4P8WA 1KXHA 1HNYA 4M80A 1VAHA 1BAGA 4CGTA 1QHZA 1Q4NX 3A22A 3AZTA 3D52A 3AHTA 1MVYA 1WDPA 4B9YA 3VD7A 1ITCA 2XN0A 1MQPA 1BYDA 4BQ4A 1QNOA 1KBKA 2NT0A 3D5HA 1V0NA 5BROA 1GORA 3RM9A 3PHAA 3IJ8A 2D23A 3FN9A 1EH9A 3FAXA 1EXPA 1AVAA 3BCDA 1XH2A 1Y7VA 5A8QA 1ISZA 3ZT5A 3A3HA 4MAZA 2G3NA 2DQXA 2PC8A 2ALWA 2E4TA 3ARQA 3FXYA 3MSGA 1DWHM 2ZWYA 2Q8XA 1J0IA 1P6WA 3WY4A 2A3BA 3ARYA 3T09A 3ZJ8A 3KZSA 5ECUA 2BHZA 4NI3A 3SUVA 4J27A 4HMDA 4UFKA 2VOTA 1KFWA 1NWUA 3WIJA 3N15A 5IFTA 3WQ8A 5D4YA 3VIJA 2YDQA 2VZUA 1V0LA 1I75A 3F4VA 4E4PA 4DUXA 1CLVA 5CGTA 3OZOA 1V08A 3VNZA 3VOCA 1VIWA 4P8XA 1EO7A 3ARWA 1JZ4A 5M3WA 2WK2A 2F7QA 1UA3A 1QW9A 2WVTA 1KQYA 3RMEA 3CZNA 3MS8A 2YL9A 1GOOA 2XSBA 5C71A 1KR1A 3GH7A 4LQ1A 2WPGA 2XFYA 2F7RA 4QLKA 4PMDA 4WSJA 3DDGA 2J7DA 1GNXA 3J7HA 4K68A 1U30A 1UZ4A 4NZFA 5A2AA 3AMLA 5JBEA 4XV0A 2ZUUA 4URIA 5CJ5A 3HG4A 3K4AA 2WNWA 2A3HA 3LPPA 4MDOA 1VF8A 1J0JA 1QPKA 5I0DA 3AIEA 1VJZA 3AOFA 1LG1A 1QI0A 4OBSA 2DDXA 4W5UA 2DT1A 3LX9A 3FW6A 2W5FA 2WCAA 3MUAA 1JZ5A 4FLSA 3QOKA 4ZENA 2JIWA 3WH5A 2J78A 3WNNA 3D51A 1V0MA 3EJQA 4HOZA 2EADA 4W5ZA 3ZIZA 7A3HA 3NUKA 3LMYA 2YJQA 3AHZA 3CLWA 1GZJA 1FFQA 1HKKA 3E1F1 3NDZA 3GYCA 3UEQA 1ECEA 2WW5A 1W3HA 3T0BA 3N9KA 3NDYA 3BC9A 2A3EA 3VMNA 3UERA 4GI8A 5C8BB 3AHXA 2D24A 1UZ1A 4U2ZA 2HISA 2IGTA 1R33A 1V3MA 1CECA 3QHOA 4KH2A 2G3JA 1W1PA 1GVIA 3WH8A 4JIEA 2VMFA 4WIWA 4NXSA 3SUWA 2BHYA 2WMKA 5ABFB 2WAGA 4F9DA 1JYWA 2ZXBA 1GOKA 1CGVA 4CUCA 2YBTA 2C0HA 4H8UA 1QNQA 4Y7EA 4GIAA 2QLYA 2OSXA 2CIPA 1VFFA 2ZUNA 1G94A 3LPOA 2J7GA 1FA2A 4PRWA 3TONA 4GQQA 4GO9A 4KGLA 3U5YA 3BSGA 4A3HA 1KCKA 2BY1A 2WMJA 1V02E 1MFVA 4UQCA 3ARUA 1UYQA 2JF6A 1J9YA 3DX0A 3BGAA 4Q7NA 5A6BA 1ISWA 3DX1A 3PZUA 3A4WA 2GVYA 2JE8A 3VIGA 2YA1A 2CEQA 4D71A 1E6QM 1BVNP 3M46A 2WHKA 3HZ3A 4GZEA 4OJYA 1MW0A 2W4XA 3AMDA 3GXIA 1E5JA 3AZSA 1QX1A 1OBAA 1PBGA 5A6AA 4GINA 3VMOA 3WMBA 3WBEA 2JEPA 1HL8A 5AYBA 1M03A 1R86A 2WCSA 3BMVA 4X0NA 1E55A 1G5AA 3SCNA 3BLPX 3W37A 3WF0A 4M8UA 2O9OA 2WMIA 3MU7A 4N42A 4B15A 3DX3A 4J3SA 1SYTA 4D6JA 4XZBA 3WD2A 3WD0A 1WO2A 2WHJA 2ZX9A 3WMSA 3CC1A 2FDMA 2EABA 4E8CA 1MWOA 4IPNB 2XVNA 2D73A 4PTVA 1UR1A 1LJYA 1OM0A 3EMCA 5HNNA 3ALFA 5DEZA 3GZAA 3B8SA 3O6AA 2PWHA 3PZIA 1B2YA 4D1IA 4D6HA 2XFRA 1XCXA 1NP0A 4PBGA 3WDJA 1JF5A 3D50A 3DDFA 1C3FA 1V03A 2WVVB 1ZBKA 2WHMA 4Q22A 4J3TA 5LA2A 4J3VA 3BVWA 3WY1A 1C8YA 5BRQA 1E6NA 5E09A 5KZ6A 3A6OA 2EPNA 2J75A 2E9BA 4A3YA 4ZFMA 4JL1A 3CUHA 5M03A 1X6NA 3WL0A 4NRSA 3UG5A 1VFMA 5M17A 2CKRA 2CERA 1VBRA 2XPKA 1LL4A 2J7BA 1HX0A 2XYLA 4UOQA 1B9ZA 1C93A 3VIHA 5M5DA 4W88A 4AC1X 5IHRA 2YFNA 2BS9A 4Z2HA 4F9JA 1DWFM 2FHCA 3HG2A 5LA1A 3KL3A 1WZLA 1QI2A 2RGMA 1H5VA 3BUBA 4H41A 5C70A 1JG9A 1XH0A 4UQDA 2VQUA 1MW3A 1JYXA 1EO5A 4WJXA 4S3KA 1NOUA 2YLAA 3KE0A 2WVSA 2W66A 1JNDA 4PTXA 3SEPA 1TQSA 3MMWA 4JKLA 3AS0A 5AC5A 2PWEA 1KWGA 3T0DA 2ZUVA 2D20A 3GTNA 2XWDA 1E1FA 2Y4SA 1R87A 4KRUA 2VCBA 4KGJA 5FD0A 4MJ4A 4J3XA 2FGLA 5HDRA 1FFRA 1UQYA 2WXDM 1GQKA 4WKAA 5CSYA 3GM8A 4NX0A 4PMOA 3WQ5A 1W3JA 4HU0A 1GW1A 1W9VA 1LF1A 1QI4A 1B31A 5D9MA 1EDQA 2WC7A 1C8XA 3VTRA 3GBEA 3KL5A 3FHAA 2WKGA 1E9LA 4JCMA 1JI1A 3EJUA 4F8XA 3O2LA 3KLKA 3CUFA 4D72A 4UFLA 5E70A 1JIBA 1FHDA 4IUGA 4M1RA 3RCNA 5A3HA 2UY5A 3A21A 3RILA 3N17A 2X2JA 1E56A 1H41A 2PBGA 4M29A 3QHMA 4HA3A 4E8DA 4QP0A 2V3DA 1C92A 1YHTA 2J47A 5A6SA 2ZX8A 3RM4A 1JDDA 4AD2A 3WEZA 1XV8A 2NSXA 5FKYA 1OB0A 1UR8A 4CU7A 4U3CA 3WF4A 4CCEA 3CZGA 1GPFA 2FE0A 3ARZA 4IISA 1JD9A 1A3HA 1UD5A 1V02A 2A3CA 3F5LA 1MQRA 5BXRA 4AIOA 3VO0A 1UWRA 4HZ8A 2F61A 1CZ1A 3WL1A 3CUIA 4U2YA 1BYBA 3DECA 5I6SA 3DYPA 1XCWA 1HJQA 2ZXQA 1K9TA 1UA7A 3VD3A 1RD6A 3AFBA 3DX4A 4FF5A 1EGZA 2VVNA 2ZIDA 2D3LA 3L2LA 3LXBA 2CNCA 2VR5A 4CVWA 1TA3B 1DWIM 4BQ3A 1R85A 2D22A 1BSIA 5BXPA 2NT1A 2FYVA 3BAJA 1C7SA 2EACA 4GO8A 4FMVA 4X9YA 1ZBCA 3AIUA 1OD8A 3T08A 2CESA 4PSRA 5A8NA 3LRKA 5A69A 1CXKA 1E71M 2D0HA 2YIHA 5FL1A 2IXVA 3S2CA 1V6WA 4JFUA 5IHSA 4CD6A 3DYMA 3LRLA 4LYRA 1XSKA 4MB1A 5GNXA 3EYPA 2VZSA 1CGUA 9CGTA 2ZX6A 1PS3A 4W85A 1I1XA 2ZUWA 1V3LA 4P7NA 4S3JA 4PMVA 3NSMA 3ZR6A 1BG9A 2BFGA 4X0VA 3DC0A 1SMDA 3FNDA 2AAAA 4UFIA 3VGFA 2ZUMA 5JIPA 4WKHA 1GHSA 3BLBA 1UR0A 2EXOA 5TD4A 4V27A 3AJ7A 3OLGA 4UFMA 1V3HA 2OSWA 2DT3A 1WP6A 1WZAA 2PWFA 4CD7A 5EBAA 1PIGA 2EEXA 1W1YA 3TTQA 4OOZA 1CGWA 1V6VA 3AXXA 4NRRA 1UH4A 3CMGA 3OGSA 4D6IA 1E3ZA 3ARPA 3AMCA 4UCFA 5BWFA 3AIQA 3VGDA 1TA3A 2YOCA 3HG5A 4PYSA 1QNSA 1NP2A 1E5NA 2WMFA 2WZIA 3ECQA 1H0IA 3EDDA 5JIWA 1XD1A 4TUFA 2EAEA 3W0KA 1H4PA 1US3A 3VIOA 3CBWA 1QI3A 3MKKA 1B1YA 2BV9A 5EFDA 3VVGA 3OB8A 3A5VA 1HF6A 2F1AA 5DT7A 1VEPA 3CO4A 3ALGA 4Z2KA 3UR8A 2Y8VA 3WUEA 4U33A 4AD3A 5CPQA 1TR1A 2Y24A 1UD6A 3CZ8A 2FH6A 3SUUA 3BAWA 3WD3A 5D8WA 1EQCA 1WE5A 1UD2A 3NCOA 5CG0A 4D1JA 1DEDA 4J3WA 2XN1A 2DSZA 1UD3A 4M56A 1HJVA 4L4PA 2JEQA
chains in the Genus database with same CATH superfamily
1IC0A 2R0LH 4KROB 2X41A 3RWIA 3N6JA 1X5ZA 4P3WA 2W9LA 3GY1A 5IMKA 5KJ4A 2QQ6A 3FRPA 3JWNH 5J7CC 1GYVA 3O6ML 3LRMA 1CFNB 4FNRA 3UJTL 5L6YL 2Q01A 5I2UA 2Y2YA 1GZ1A 3W2DL 5CZKA 1TPWA 3QI9C 3BLKA 1A0QH 1A4KB 1UH2A 4FP8H 2I60H 1ONWA 4ZE4A 3QGVA 3KOWA 3R7MA 4JX4A 5JHAA 4Y4HA 1VKXB 1WAAE 4RVBA 4X50A 2Q76B 1HJXA 4PH6A 2VLRA 1G4TA 4FA8A 5B8CB 4XPHL 1D5IH 5H37A 1I9RL 5F88B 3H56A 2Z2UA 2HZHA 2XIIA 4GRMB 1OFAA 3W1AA 3NDOA 1XSJA 1AZRA 1F6AA 3LQZB 4X98B 2B4CC 4RIRB 4U1JA 1RALA 5BOFA 3PN8A 5AAPA 2J8UF 3H9SA 2XTJC 5J3HD 2X4NB 3UAFA 2OFQA 4IRZH 2CBJA 1JWMB 3V5DA 4CADB 5SWQB 3EGXB 4N0RA 2FJUB 5EU6D 5FLUA 3IIOA 4KF1A 5BOEA 4D8AA 1BIHA 4MQSB 4DNLA 3IXAA 3PZNA 3ES6A 5AVXB 3EXJA 1EP3A 1XICA 1A5FH 4HS6B 5AWNL 1U91A 5DMLA 1M6JA 1DIDA 3P30L 1A6AA 1D7CA 2BXYA 1OGTB 2XY1A 3IF1A 2NZIA 1FDYA 3LS5L 3M0VA 3OVPA 1IEBA 3WD1A 2YD6A 4Q9BA 2YDAA 2GK0B 4DUWA 1C5CL 4CNIA 4AM0Q 1H60A 3GSVA 7ENLA 2EYSB 5LYRA 3QWRD 3MJ7A 3EIFA 2VH5H 1F61A 1I1YB 1MFBL 2AKRB 1KCUH 1UA6L 4N85A 1U8CA 3OR6A 5CSBA 1E72M 4P7QA 4A4AA 5DRNA 1H3GA 2BSED 1SXBA 4YSDA 3U4AA 1G6VK 3N18A 1NIAA 2IANB 5FECB 1ELSA 3VFCA 1JL8A 4GCXA 5GVJA 3VOJA 3KWVA 3TU9A 2V0AA 1LE5A 3GHRA 1S7UA 3CXDH 5FAJA 3VFGH 1CDUA 3U6RA 4ZO6A 4FXKA 3G6DH 3CIWA 2FVMA 1JXGA 2MMXA 4PJXA 3H2EA 1D6VL 1IGJA 3WBXA 4P07A 4NWTH 1FBAA 1IEXA 1ITBB 3B1TA 2VL4A 4KK6D 4X6CA 1UH3A 2OX5A 3FUIA 3KDMA 25C8H 4NC0B 5DZNA 5EORH 5E2WH 3T0EB 3CH0A 4GY4A 3KCJA 1VACB 3ZTNH 3PV6A 3W7PA 2ZYSA 4XMXA 3VSUA 1CLCA 1WC7A 1LNUA 4DP5X 1ZE3H 4R26H 3TYGH 2ZWZA 3B3DA 3LLXA 4GJJA 1VB9A 1BM3L 3X14B 3UABA 2QV4A 4F33A 5BS0B 2X7WA 3PG9A 5HGDB 5CAKA 2WWMC 1AKPA 4M1DH 3LI1A 1ZT1A 3SYOA 1KBIA 3FUJA 4U4MA 4J8QA 1G0CA 1XLKA 3CN3A 3RJXA 3RWGB 1KDIA 2UZIL 2MEJB 3FKUS 4B3EA 4HNVA 4ZAKA 3M07A 5B1CA 1BYPA 2D31A 2HPIA 2IAMC 2YAHA 2J3SA 4HP5A 5KSAD 3REWA 4ETYA 2X1IA 3SO7A 3QUXB 4PRIE 1TMHA 1D3CA 1IO4C 1OGSA 4FNLL 4QXTA 2J21A 4UTTC 3REQB 1Q1JH 3TT3H 2J7FA 1D7BA 4FQ2L 3KYNB 1SW3A 2GSJA 3VUPA 4HF5L 3KTXA 5CGQA 4F2TA 1MCBA 1OGAE 5EBWA 3ZZ1A 3NEEA 1NGQH 2GABA 2WZAA 1NLDH 4XXWA 3EOTL 5IQ9A 3RM8A 1C9WA 2WLKA 2ZXEB 1J8HD 2IAND 5D1QE 4MAYC 2XX1A 3ZU8A 2DQJH 5AG8A 4P9HL 2DZUA 4LSUH 3MLWH 4UNIA 3RVVD 1QRND 4QE5A 2KLSA 4NJ9L 4L9LB 3G5ZA 3MACL 3JV4A 3MJYA 4PMZA 3UVAA 3DIFA 3AIWA 4P2OB 4P5UA 1RHHA 2G9HA 2BNUB 1Q9OA 2CJ3A 4ONGL 1YNTB 3PREA 5I8EA 5JO5A 1RJQA 4TXEA 5G4EA 3PFUA 1PG7L 4KQ3H 4JQ1A 5D7JC 5EFIA 2ZUTA 4P59L 1UR9A 4J8RA 5C0BA 3VGHA 3P0VL 3SHSA 5CUSH 2IBZX 4JG0H 1QBBA 5FA3B 1H3PL 1DBML 4LEQA 5IMLB 2P45B 3EX2A 5JW3H 4JVPA 3MRGB 3GSNA 5DMYA 2WXQA 3OZLA 1LO0L 1N6UA 1JP5A 5C8JA 1GCFA 1KV8A 3AYSA 1E6ZA 4X8JA 2X4OA 3VIHA 5FYJD 1K8XA 3ALPA 1DIKA 2R1XB 1O9WA 3OLIA 4J6RL 3WFLA 1MQKL 3L54A 2XSKA 1E8WA 4MD5B 4P57A 2DICA 5KBMA 1CD9B 3TBWB 4YFDB 4YHYC 1QMLA 2IFFH 5DD3H 5I1GL 5H4ZA 3EBIA 3ARBC 3SZ6A 2PW2A 5BQ7A 2FZBA 4LSQL 3V4UH 3LKOB 5GGUA 3VM7A 3QH3A 4LZKA 4GLRH 4M7LL 5AW1B 1DBAH 3C60B 4ZAKC 3W56A 3RPDA 4W6XB 3DA0A 3UQNA 4M81A 5F93C 3U2EA 3QCUL 1I7UB 4QXWA 3PB2A 1QRNB 4ODWB 4DEPB 1Y5VA 1Z9LA 3R18A 1NC4B 4L0ZA 4S1DC 2NW0A 2HTLC 1CU4H 4IMKA 4NZTL 3X11B 3W9DB 1R8LA 3PABB 5FGCE 3MO4A 4ONFH 4Y9CA 2G37A 5D1XD 1NSJA 4EN3A 2WP3T 1OYAA 3MBED 3VQ2C 2ODHA 1MDAA 4MJJA 1MW2A 1MJJA 5DK2B 3T4YA 3WS3A 1QLFA 2QKSA 3H0TB 1E1CA 1VR6A 1X6UA 1BXCA 3IDXL 3QW3A 4X7SL 1ZFJA 1I8LA 2W80C 2ZJSL 5GZNC 1DL3A 1B90A 1NQBA 3H8AA 2Q8AH 4B91A 4MXWH 4YR6A 2Y5TA 3PNRB 4NU7A 2X42A 2EBNA 2OSYA 4DZBA 4KXZH 4CD4A 2FUQA 4FZIA 3NCYP 4LBAA 4O52A 4X60A 1KIRA 3AITA 4NN6C 4TPRL 3V7AG 2CGZA 4D3CL 4IIQC 2X38A 4X6EA 4DQOL 1PU0A 4G8IB 5FXCH 5I76A 4L18A 1J6PA 1IGSA 4MAYB 4KRPC 5J1TC 1OIMA 2HG5A 4OGXL 3BZEB 3CAVA 1G7LA 1OD7A 2QT6A 5E4EB 4ZZ9A 3LS4L 5F3HA 3EDJA 1O7DC 4JVWA 4HSNA 2YMOA 4LHUA 3R19A 2X4RA 4KOBA 3ZJAA 3N55A 1GVFA 4AZHA 1FZOB 4HH9A 1U8QA 1QYGL 2XHNA 1OFEA 4NCDA 4H04A 4WI2A 1MVFA 1GG1A 5E2UH 1DVJA 4X6BB 4ZMGA 4P49A 3QDMB 1GJPA 1YEFL 1UWFA 1HN1A 2N0MA 1E70M 1Q66A 3OX8B 3DX8B 4HS3A 1Q9LB 2ZD0A 3MO1A 4KDVA 1S5WA 3WE6B 3B4UA 2Z31B 4TVPH 4FOMA 5IB2B 1ZDQA 3ITXA 4BQ8A 3IUIA 1LLOA 3MBEB 3CX2A 4LVNB 1F1AA 1HNGA 3K5SA 3WTYA 1W8SA 3RGVA 3QI9D 2UY4A 1EK3A 3TA6A 1GYCA 2O5ZH 2FD6H 4P46B 2DWYA 4UT6H 3KGRA 3RZCC 3T2OA 1H50A 3SRKA 4NZCA 4ZYKA 3ALXA 1K6AA 3SY8A 1CXEA 1ZPTA 2H8PB 3PZVA 1FL5A 3JR2A 3QQ0A 4P7RA 4PRAA 3NSXA 4XCNB 4RFEA 2XG9A 4HHGA 5IB5A 2V2WB 2PUQT 2WYHA 3RRQA 3V52H 2PI6A 2A7RA 3W1XA 1KT2B 4G1NA 4BKTC 2DYRB 1CR9L 4HG4J 1JN6B 3UGUA 4MMZB 1RJZB 1WZ1L 3W00A 3QZEA 4FLOA 4LSVL 4PMXA 2OX1A 4R26L 3EYFA 1GS7A 3QQ3A 3QNXB 3UTSD 2NY7L 3GD6A 3ARVA 2GIYA 2AI0H 3VZZA 2AEWA 3ZK0A 3ZL1A 3NZGA 2H45A 4FL4B 1P84J 2H32B 4GAJL 4I48B 4LEFA 1K8DB 5B39B 1B5TA 2H9AB 3R89A 1HH9A 3QN3A 3CX5J 1JZDC 5E94A 1OOAA 4I0PD 4CMMA 3V5OA 3AB0C 4K94L 1PG7W 1CK0L 2H6OA 2BNRA 1WS7A 2A9MH 1XF2A 1H2JA 5KTEL 5I0WA 1TE1A 3OZ9L 4OFPA 3OXSB 3NO5A 4GGBA 4H6QA 2V7HA 3OPZL 3W7LA 2CWRA 4DIAA 3EZ8A 1JZJA 2EYTA 4KKBC 4PB4A 1TPC1 2VC6A 3QI9B 4UV4L 3T3PB 3RLUA 4KZEL 1KB5L 4H7VA 2A79A 1Z44A 3D34A 2GG1A 1DSFL 2NMSA 4XAKD 4XOCA 5C6TH 4LUSB 4QTHA 5JQ9A 1H15B 5D6DA 5KINA 2OOGA 2NR6C 3VB9A 1FCCA 1U6AH 2AXJA 1GZGA 2AXWA 4E0RA 1THAA 2HFGL 2WVVA 2X09A 4GRLD 4DY1A 3BXNA 5C9WA 3L5XH 4FYSA 5CMAA 3IPFA 1JZEA 2AZAA 3BKMH 4JPGA 5E5LA 3LB0A 3RIAF 4ZTOL 4LMQI 2EDDA 2WP3O 2X3BA 3EWXA 5KG9A 4IZGA 4RE0A 2BOLA 1L9MA 1ZS8B 2ESVA 2HWZH 4AWJC 4P23A 4W86A 3SIMA 3PWJB 3F7YA 3DTXA 1DJYA 7PCYA 4JRFA 1W2VA 2RHEA 5E1IA 1U8OA 1LORA 3TIMA 3ZE1E 1A5KC 4B3ZA 1MIML 3VFRB 3DHMA 4LU5L 1FZJA 1VENA 2C5DC 3IUDA 5C6WH 4HWBL 4ALAL 2OMAA 2CRYA 4L4MA 1FNGB 2PCPB 3D08A 5HANA 1P1VA 4F66A 5D1QA 5IB3B 1NM9A 3BPNB 3GSNL 3CU1A 1UZ8B 3MRNB 3QW9A 4G72B 4JGUA 4M93B 4YC2B 3STLA 2X6AA 3ECVA 4KKLC 5DJAA 4ZXBA 2JIXB 4N0CC 3UA4A 4DKDC 2HLFD 5KYYB 4LVGA 1EF2A 2YEVB 1MDRA 4NAFA 1FWTA 4FYQA 2ROXA 3DJSA 4C6QA 5RUBA 5JNYA 4A37A 1B3XA 2NY4C 2VSDA 4FQCH 4LP8A 3MJMA 2YA2A 1EIBA 4OZIA 1IIHA 3SUTA 2OR9H 3DUSA 2FWLB 3GS4A 1BG1A 3WEMA 4N9DA 4XUGA 1LD9B 3F4NA 2F5BL 4YHOL 1DQMH 1GYWA 3ZVHA 5J6HB 4JHWH 4AIUA 1NELA 4PD4K 1FH5H 2YLLA 3CT7A 4K3DL 2AMUA 4J23A 5CF3A 3VACA 2WZTA 3WUGA 4AQLA 1CZ8H 4Q9CA 2GEQA 3HJZA 3F1QA 4O02L 2DQMA 2YQGA 3OG4B 4RGOL 4LCRA 5DVNA 2BG5A 4J3ZA 3TF7C 2BHFA 3R8HA 4UZSA 5SX5K 5CC5A 3MOQA 4U0RC 2JJSA 3R12A 5EOQH 3THML 5C0JB 5F89A 4QEEA 1BQGA 1MLCA 3W25A 3WLHA 2VDKL 5FIPA 3E3QC 3MWCA 2K3HA 1DJHA 1EVUA 3G2GA 2K6ZA 2NX5A 1KGYE 1G4SA 1UMLA 4K23H 3CPUA 5J6GA 1F8MA 1V93A 4L64A 3T04D 1P7HL 1AQDB 1TEGA 4TN9A 1QI5A 1MCOL 3GU1A 4WJKB 1BD2A 2JMRA 4K73A 2XNAA 3BPLC 2RKXA 5I77A 1ZXQA 3SD5A 4DVBA 15C8H 3L1OH 4HIXL 3VFPB 5IB4A 4LS1A 3LEVL 1RP8A 3T7VA 1EEYB 3U4EA 3GNRA 2DT2A 3HPSA 1WICA 3JVGA 3GX9A 4AENA 3VAEA 2V67A 3M43A 3CX5K 3SZKC 4YIQA 3UTPE 5HYIA 1N68A 1OM9A 2EILB 1ZGLA 2VEMA 5G1TA 5JZ7C 4I7VA 4Y4HD 4C7FA 1L9TA 3QSKB 2VFHA 3P2BA 3T40A 5GS2D 3S34L 1EGJH 1KULA 3ES7A 4X5XB 1Q13A 4KEMA 4Y6GA 3QM3A 1KJVB 3QCTH 4EN3D 5C0EA 4IFKA 3V2AR 5EMUA 4J1UB 4JFTA 4ZFFB 5H35A 1FVEB 1NMBH 3GMPA 3OKEB 1IIKA 2E28A 2VC2L 4X4MA 1IV8A 5F0LB 3JBG7 4EBQH 2H0EA 5FUOH 5TQ0H 3G3DA 4G1MB 2REQB 2OS7A 1IAKB 4ISVB 1HXKA 3G08A 1EP1A 4HTYA 4S23A 2CWNA 4YAQA 3ONBA 4WR3A 4XPAL 3PAJA 3VQMA 3BGFB 3SE9L 3SGKA 3MKCA 4IHOB 3CPLB 4BHYA 1KYDA 2PCFA 4PRPD 2VR7A 4B60A 2QKIA 1RMFL 1MSSA 1Z69A 1IFRA 5EDXA 3C5ZA 1NLBH 3SKMB 3VWKD 5AC7A 3V0VA 1GYMA 5JVLA 1I1AA 4FHJA 1PCKA 2FPVA 3AZRA 5HDBF 1B0RB 5D2WA 2VFFA 1XL9A 4ZD3H 4MWAB 3U9PH 2J43A 5JXAL 4D94A 2NR6A 4X9GA 3ULAB 5I8OH 3W83A 5L2KD 4PFHA 2G30A 4OCSH 2X6UA 2J8GA 4N9OB 1Q3NA 3LRSA 1A4LA 4GFSA 9PCYA 3SKJH 1V54B 1EJ7L 2BSEA 4L29A 3HE7C 3V0WH 1JZ7A 4YVVA 1Z7AA 3GIPA 1LZOA 1J1PL 1MFCL 2FZDA 4HWUA 4MCMA 3G9VA 4N25A 4I9AA 4X9HA 3V4VA 2NXYC 1GC1L 4TO8A 1FWEC 5D2NC 1B0WA 5C0BD 5EMYA 1M9SA 2IADB 4U1HB 3LH8A 5DBUA 1MEXH 2OQJA 2NY3C 1TV4A 5HTSA 4LCSA 1JRHH 3QJHB 3IFPA 2DIBA 3S5NA 5DQ9B 1OGBA 2J9ZA 4MNKA 2OXGA 4PRHA 2VDPB 1KCSH 5ADPL 1NA8A 1ZRQA 4WQOA 3LN3A 5DCEA 5HQLA 2J88H 1ZTXL 2KZKA 2Y7NA 4HUXB 4NNPL 3N85L 4ZS7H 3QJUB 2I16A 3BQ5A 3GK0A 4S38A 3ZXAC 3QIUD 3CZEA 4D3CH 1A8ZA 2CDFA 2OTWB 4G6ML 4OFDA 2W27A 4NRYA 4M5SA 4Z7OE 3TJEH 4MIMA 3I75B 1OAZL 4KO9A 4YWGL 1E30A 1HAWA 1Y0LA 2XZAL 3DI2B 5I1KL 5EULV 5L7XH 3LERA 5IVNA 1T3FB 1A6UL 4JFEB 2ZAIA 5JHBA 3F6IA 1TWDA 1I8MA 3U36A 2VXVH 3S4SG 4PJXF 3IJDA 2LU4A 3URQA 1UUQA 2PDPA 4MAUH 4Z0JA 3GM0A 5KBLA 3W7EA 1BG4A 1LMIA 4C4KO 3RDKA 4JNMA 1T4WA 3LYRA 1QSFE 1EAPB 1FGVH 3MREB 1QZ1A 1JR1A 1D7DA 1AR1C 2V5YA 5AZ2L 4F20A 3QEHA 4JRXB 4QOKE 4RMUA 2DI7A 4PGBA 4PGZA 2OYKA 1G69A 3UXLA 4AD0A 5T33L 1N7KA 1PKQE 3N42F 1YEKL 4GSRA 2BSTB 2QQNL 4C7DA 1GMEA 3WDIA 3EOBA 3QIWB 2HRWA 5C0AB 3H7BA 3ARBD 3S5ZA 5LUMA 3LNIA 4RESB 2LT9A 5C09D 1QR7A 3OR7A 3OAZK 3MDUA 4Y4FD 4IFRA 3SJNA 1RUPL 2PDCA 4W9KC 2P5NA 1D5BA 1FC1A 1IBGL 2Z31C 1KM2A 1TWIA 1GOHA 1QR1A 1A1MB 3OF6D 5HYQA 1EFXB 1D9KD 1TJIL 3FYIB 5I75C 3THCA 2NDFA 4Y2DA 4BK9A 5ABZA 2IUZA 1XGUA 4PGDA 4TNVK 4Z76B 3S83A 3HG1E 2C9QA 4V1XA 3IEBA 1NAML 2GIXA 4F7PB 3HKZA 4DM2A 2BIQA 4WZHA 5T91A 2Y22A 3BG3A 2VQ4A 5AD0A 4FFVC 1NGZB 1E7UA 5FO9B 3HGSA 2DEWX 2OK0L 2YSSB 3EYOB 3US9A 1MEHA 3NQMA 3L3GB 4FAAB 2HNEA 1LDCA 3T81A 3NIDB 1MCWM 4PRIA 3GGWB 4NZ8A 4FO4A 4C91A 3EB3A 3VDBA 3CFQA 1JHLH 4ZDHB 2P8LB 2ZZ2A 2XJ7A 4J3OH 3NQ2A 3UWVA 4H9MA 1SZFA 5DJYA 2ZOTA 4ENED 3TF4A 3B7SA 1DE5A 3VK5A 1D5RA 1GY2A 1TNMA 4FEMA 2AQVA 1N64H 2X2HA 4XNBA 4GKTA 2ZE0A 4L9ZA 4UMAA 3BE1L 1FNSH 3QUZA 4PR4A 4DBWA 3BKYH 3WELA 3PL6A 2CIKA 2Z8WC 3KLAA 1MI5A 2Y2TA 5I71C 4N5UA 3W24A 1MCOH 1Z0MA 4ZUWB 2IS7A 2OGJA 3Q1EA 5I16B 3D39A 2ZA3A 4RE3A 5EMLA 2NY6B 2WKLA 2QCFA 4MMYB 1DN0B 3GZPA 5EU5A 2ZZ3A 2XXCB 5C09B 1T4KB 3N41F 1I85C 3HRPA 1E5YA 3QXAA 4Y4FB 4LYQA 4GBXC 5DXWA 4KTDL 4XN5A 3FFOA 3C86A 4JPIA 4NZJA 3HQOA 3SECA 4QRPB 4A7VA 3UWUA 4AMXA 2XG5B 4Q74A 1LEIB 4HW6A 2ADYA 1RY7B 1RK1A 3QPQD 1CDGA 1F4XH 3HN3A 4FFTA 5EEXA 4MMWA 4CQDA 2XWCA 5HAOA 3MRJA 4CCDA 1IEVA 2R56H 3FQ1A 3SQSA 2HJLB 3SE4C 1O7AA 1BQHG 2CK2A 4AH2A 5C92A 5CBEB 2VCOA 5G2IA 4JTLA 1OD9A 2ZCLL 3EAKA 4UQ3B 1KLUA 1FVDA 1JNLL 2FHFA 4ATWA 4E6MA 2DIEA 2YO3A 3AG3B 4LDEB 2Y5JA 3I65A 2J62A 4FXFA 4JQ3A 2WXHA 3DUUB 2J1KA 4XNMA 3H9HA 5M94B 2Z6JA 3ABXA 4JTHA 3K91A 4YHKL 3VYNA 1WIUA 3QJOA 5HJYA 3NJ3A 4LWWA 4Q8NA 4KC3B 3MUY1 4YBLB 3VD2A 1OQFA 2G3IA 4IBVA 2YXMA 2Z6FA 4IGMA 4K36A 3S4TA 3V36A 1SO6A 4OI7A 5C0DB 3C0LA 5ABAA 4EIUA 2B81A 1CL7L 2G3ZA 3GG0A 2XZCL 3S3PA 3UEZA 5BRZE 2W9MA 4AXKA 4PMJA 4UIMA 2V3GA 3TN0B 4U28A 2A6DB 1J9RA 3SY0A 4MXQC 1R5VA 2DY2A 1QPRA 1O94A 1KJMB 2A7NA 3C61A 1UUMA 1R2TA 4ZNEA 1MFNA 2EF9A 3KRUA 2J72A 2Z1KA 1EOKA 4OD2B 2A3AA 5ACLA 5J3HC 2Y25A 4IOFC 1I9IH 1HL4A 4FFYA 3QCVH 3K5XA 1LT8A 1SFSA 3DVNA 5MEOB 1TMCB 5TQ2H 1LUCA 2PP1A 1HC1A 1XF3B 3R2GA 4I9JA 3WH9A 2N7AA 3QV7A 2ALRA 1UD4A 3P40A 5KVFH 3BPCA 3L9RB 2B7DT 3BVUA 5FW8A 3RX5A 1J88A 3VXRA 3TYBA 4CNUA 3COTA 1O5KA 2H9GA 4PW3A 4JFFB 5SV3A 5IROD 5D2YA 1FRGH 1GKEA 2Q87A 3FL7A 4OQTA 4PLJD 4K7PX 4DKTA 2F6UA 4RK8A 3UZXA 1VEMA 2O56A 4O58H 3KEHA 4XCCH 2CUHA 1EYWA 4P2QD 2AEQL 3S6TA 4ZQOA 1EO8H 4OD3H 3UTTE 2GBTA 4I2XE 3OMNB 3AFLA 4OJCA 4PRPA 4BFRA 3ABMB 1IE4A 1MDTA 1YEEL 5IOPB 2XWXA 4NWUH 1MZHA 1B3YA 3ARED 2ADIA 2YAPA 3EGSA 1BDYA 3KH3A 3U7AA 4HOXA 4Z6AT 2GFBA 4KVNH 1BLIA 3H4FA 5IQNA 5CBAB 4AHPA 5ENLA 1B2WL 3KG5A 4NERA 1A6UH 4R88A 5AVQB 2WINB 1M7PA 4U1KA 4NQCA 1H7NA 4BI7A 3UJJL 2O55A 1USZA 3EWZA 1ZLUK 3MI3A 4JICA 4X2RA 5K3VA 4FABL 5TJWK 4ZB5A 1ETJA 2VZ1A 4MNQD 4ML4A 4QRNA 3W75A 3M47A 1OW0C 2ZWSA 4WSGA 4BI5A 4XN4A 5F0MB 1HYSC 1RIVH 1TVNA 3REVB 1BIIA 3O11B 2XWJB 1PZ1A 4M9OA 4BZ2H 2FVLA 5I66B 4OU3A 3MLXH 4E4UA 1JCMP 3CHFA 3VI3E 3ZRSA 1OX4B 2EIJB 1P4IL 2F53B 2UYLA 3QEQA 1TCRB 4LBUA 4C90A 2CLHA 2UXFA 1JXFA 1A65A 4YPGB 2WZ5A 5ID1A 3PJXA 2FGZA 4PRHD 3RWEB 3RY6A 3RPMA 4PJEF 5AAMA 2CIIB 3BP7A 3QDJE 2B1AL 3Q3GB 1CENA 4Y2NA 3UYOD 4EXAA 1JDCA 1NCOA 5D71L 2ZCGA 2K4AA 4YZFE 2NX5D 4ZMXA 4C57C 3ZO9A 4P23D 3QY7A 2IMRA 3M1BB 4APQB 2JXMA 2W6RA 1A4MA 5LCVA 4MA1B 5I0XA 1PHWA 3BQ6A 3QMRA 3OIHA 4HK0B 1FBIH 1N8IA 4DO7A 2DPEA 3ULSB 4V33A 2Z8RA 3NFSL 4XZMX 5FCZA 1BZEA 1XR8B 3CVHB 4JFEE 4R83A 2ITCA 3K0WA 5DVKA 1R3QA 5JXAH 5I78A 3OKMA 4OJFH 2R0WL 3CVDA 5ESAB 5A6BD 3U2SA 4GXFA 2BO0A 3IJSB 1L2QA 4MAVA 3QQXA 1XHGA 2HFFB 2D4FA 3W0WB 5BXFA 2AOSA 1ULVA 2FECI 2VRQA 2NDGA 4L23A 1L3NA 1L9NA 1RJYB 3B6SB 3SOTA 1KNOB 3LHYA 3TQPA 4KK9C 1XLLA 2PO6C 1OWQA 1XRSA 3ANVA 4PS3A 2DM7A 4NS0A 3K72A 1D9EA 4FP1A 5HBFA 3C2AL 4GKNB 2R9RA 3ULVD 3SGJA 3B97A 1BP3B 3IDJB 1TPDA 3VFSA 3NL5A 5EN2A 1F3TA 4UT7L 2KS0A 3MYJA 5TE4H 3GIZL 3S35H 4QRUA 5KVGL 1NBQA 2CH8A 3WKMH 4KVCL 2CKBH 4WFEE 1HHGB 4JFPA 5C9UA 2NUTB 4OOUA 2Z64C 1F42A 1FO0H 2F58L 4APXB 2Y6SC 2V0TA 2VMEA 2E5CA 2CJSA 2YD8A 4LT7A 4YZFF 1MAMH 5I24A 2QJHA 3A3WA 4OLYH 4IYKA 1BQLH 4NP4H 3AACA 4AC4A 4FX5A 1OW0A 4R27A 4G5ZH 1T5WB 2DV0A 5LQBL 3DG7A 1P5BA 1GGUA 1MRCL 1F4XL 3BKCH 1O5QA 3UYCA 3MRMB 2N59A 3JU2A 4HGWA 4F7MB 5BXSA 3WEAA 4AQ1B 5EN3A 3ZYJA 4FNTA 3IMRA 1QLRB 5DHXB 3BZDA 2FL5B 4JDEA 5IBTH 3PP3K 3DO7B 4ZS6C 1SHXA 4FHAA 5EY5A 3AXLA 2Y3NA 1PYFA 1UQSA 2ZXGA 3MYPA 3ARFC 5DR5L 1Y65A 4E9WA 4H7ZA 4G8EB 3C2SA 6TIMA 4GUGA 6CGTA 1JNHB 4TMPA 2ISFA 1N8ZA 1TZHB 4DBSA 1KN2H 1OZTG 1BXVA 2NQCA 3B7TA 4PJFA 5T1MB 1S46A 3ZY7A 2YGVA 2F9BT 3BO8B 2B77A 5EZPA 2LU3A 2N56A 3DGCR 1FG2B 1NGYB 1CCZA 2D7MA 2XPZA 4HWZB 4L3EA 1KFGA 4PY7A 5KSVB 3VA8A 1MHEB 1YEKH 4BKLB 4NO2B 4UWMA 2MPAH 4DWSD 1DQKA 2BLEA 5IKCB 3RLVA 2QVIA 4L61A 2RDWA 1T7ZA 4ADTA 4ERIA 3D2TA 1H5BC 1NFIB 1Q8AA 1IFGA 3DMMB 1CFVL 4JFSA 4Y8AA 4C55A 1C91A 3ZE2F 2PTXA 5AHMA 3W82A 2A6KA 5U4NA 4KVPA 4WO4B 3GG1A 1U8MA 4O02H 4IIGA 4AY8A 2PGRA 1RK7A 4UIKL 1SJCA 2VX5A 2BSSA 3SQBA 4ORGB 4ACPA 5L6UA 4GK8A 3T4AA 1OAYH 1SN5A 3FUHA 1ONXA 4XPGL 2PLJA 2JV6A 1I9IL 4FFZA 3HZKA 3L6FB 4XTRC 3MOBL 4CRPA 3CFEB 2VZ3A 4Z7VE 1BM7A 2YEQA 4D7PA 3HI5L 3V0SA 5KUMA 1NAMH 5FB8B 1SPQA 2UBPC 4AQ8A 1CLYL 5KMYA 1TETH 4LLVA 4QLJA 5D7LD 4DVRH 2W67A 3WE1A 4R53A 5FF3A 1EUUA 4EPBC 2E67A 4W87A 1VFUA 4OM0H 3F12A 1XSIA 3P4OA 4DKFL 4GRLC 4UYPA 1E4NA 1JTOA 2GJXA 3JZEA 3QWQB 1FV1A 1FFNB 3UBHA 3PG8A 1FRGL 2QR0B 3ALWA 5HHOB 3ZYIA 4YHIA 1S5HB 3IJ9A 4PJHF 3UBXA 3ZYZA 2DL9A 2ZAGA 5BRZA 4K0OA 4QNPE 1RVGA 2P8MB 3UYPB 1TREA 4DJDC 5JPMC 1FNSL 3GNDA 5TPWH 4DJDD 4IBYA 1N64L 4L4VD 3MBXH 2YEZB 4AEFA 4UILL 2YCIX 2HB0A 4IP7A 2R39A 3M7FB 5L4MA 4HJGB 1G6RH 4DK5A 3SQLA 4L4OA 4KI5C 4YHPB 1F05A 3BWZA 1Q1JL 2WWMD 4UOW1 4HK7A 1JPGA 1IXQA 1PUDA 5A8PA 3KOXA 4JMNA 4FXLA 3KRSA 1LQBC 2OMNA 5H1WA 3BW9B 1M7JA 3BXWA 3DMMD 4BA0A 3GRBA 2GSEA 3SCQA 4JM0A 4ODXA 3FQRA 1UQZA 3TPKA 15C8L 3XISA 2WXOA 3JYCA 1PD6A 3LNEA 3TFCA 5IHUL 4GW1B 1KELL 3N1FC 3VRLF 5L8LB 4XMPL 2CO7B 1RU9L 3MV7E 4HOWA 1EBHA 1UXSA 2R56L 3O4OC 1F3JA 4GIPD 4KAQL 3GSRA 4NQDB 4RFOH 1GYLA 2YBRA 3L4XA 4G6AC 4EVNA 3Q45A 2PTZA 2VDNL 2XJLA 3TZVA 4OCRL 2QCEA 1UKSA 2ZCLH 4ZQNA 3CS2A 2REQA 1GG0A 5HDWA 1CBGA 4IM4A 4ACZB 2A0LC 4Q6XA 1SYVA 2PTTA 3DV4A 3K2KA 1C1EH 3NJFA 3CDZA 1TMLA 4JQ2A 1IWBA 5DFTA 4DFIA 2WBGA 2DQDH 1T2XA 3MNWB 2TODA 3U7BA 1I1CA 3WD4A 5FOOA 3K81A 3CLFL 4AT6A 1AXSB 3WF2A 2YDRA 3WK3A 4FQ1L 3OBAA 3P2TA 3KPSB 1ISXA 5L8JB 2ZC1A 2DQEH 3MFGB 5DK3A 4XWGL 2BWIA 4UQ2B 5EUOB 4QF1B 4LBEA 2P88A 5IDZA 2KZ1B 1ECYA 1OTSC 2OJEB 2ZOKB 4L8BB 3D5OF 3GMRA 1FBIL 3HI6L 4LCUA 2IFFL 5DD3L 3BUPA 5I1GH 1X1NA 3TXAA 1JGUL 2ZOOA 2Y06H 3L5IA 5I6OA 3X1NA 4ZFOL 5CEZD 1CXIA 3HBLA 3U4FA 4PJCF 2VD9A 4K07A 3UDWA 4WO0A 1Y0EA 1VSCA 3KYMA 1N3NB 3L3IB 4PR5B 5K4ZA 4KRNA 3R06B 3M5XA 1PDKA 4CEUC 4R97C 1R34A 3NFNA 1SDAB 2GK2A 1OY0A 5F7MC 3UJRA 3E0FA 2X89A 4LX4A 5IR1B 1E3FA 3QJFA 1KKRA 4BZ2A 5KYXA 3F5WB 1B4KA 1A2YB 4LTSA 2YAOA 3MI6A 5MEND 1GS8A 2QQLL 5GGQL 1YEWA 2WSPA 1IGTA 4PMNA 5DS8B 4H8NA 4A7TA 1I9RH 3PPCA 1BPLB 3ULUC 3WX7A 5E6ZA 1R0MA 1NANH 1K9FA 5C9KA 5TAOA 4QDMA 4D8LA 4E0CA 1S3HA 1EO8L 2XA8H 3IM1A 4OD3L 3EYQC 4R7LA 1JFQL 3ULUD 1HJBC 1XUUA 3O15A 4IQEA 2IKHA 4AITA 4I90A 4IDJL 3VVWA 3TVMA 3TK7A 2MSPA 2V17H 1QNIA 3IRPX 3U79A 2ZUSA 2EPKX 1X44A 1NCWL 2KHAA 3EFDL 5F7UA 5T5FA 4I1PA 2GWGA 4FALA 3QORD 5TGBA 4GYPC 5A16B 2L4OA 3H3PL 1K9EA 3U0TB 2OTDA 3C52A 4G7EA 3TJEL 4XB7A 3UETA 1RCQA 2VEKA 4ZXLA 1XLGA 3C6LB 3I9PA 4WU7B 3UZQA 3IWPA 3L4UA 3DXAA 3EGDA 1J1XL 3FH7A 4L80A 3T4WA 4MHHI 2FWSA 4PJBF 2HAZA 3D39D 1Q6DA 1UENA 3L5JA 2XGIA 4FB7A 3HS0C 5K1VA 4J3OG 3KP0A 3NXLA 2QPSA 4EKJA 3QJSB 2HN7B 2MTAA 4Q6IA 3B3IA 4O2FA 3CCHB 3R4DA 5GGTH 4ATTA 4C6IA 1F00I 1FGVL 4LDLB 1SJEA 3C12A 4XAKE 2E7MA 3S5LG 4OIIL 1CLZL 2OYMA 3F58H 4WRLA 1Q9WB 1DBJH 1G7MB 4AYFA 2EUWA 4F37K 4P06A 2W63A 2G5BB 3NJHA 2CZNA 1S7WA 3QO0A 4GAFB 4H44C 4L8DA 4E5XB 1KGWA 4YE4H 4K8RD 2AK4A 5FHAL 4GG6A 1XPGA 4MZ8A 3ZXWA 1DQDH 3V1PA 3DBNA 2EDEA 3IDYC 2FIKB 1E43A 3HAEB 3LZNA 3WIIH 4JGNA 3JSSA 4KKCD 3WSQH 2B7PA 1OK8A 1X5LA 4F7CA 2J74A 3NPWA 3W1UA 2ATPA 3S8FB 5SWZB 2UVEA 4O0ZA 1IBDA 1U8NB 3OMIB 1L8PA 5U7SA 2ERJB 1UADC 4H7CA 1P69B 1MVUA 1N8FA 4RNFA 2VABA 5AW4B 4KI1A 3C2RA 3BGMB 3EYUL 4JG1H 5D70L 3RFZC 1JDFA 12E8L 4GKZA 5KVGE 4YHGA 1HHHB 3MLYL 1YEHH 4H1LG 5B7FA 1NFKA 3OKOA 3TLLA 3RY6C 2A77H 3DKHA 2EDWA 2X9ZA 1R0AH 5CCKL 4FQ2H 1DQLL 2XIOA 1WXJA 1C16A 3FTSA 4I3SH 1FY6A 2DBJA 1RBOB 2TAAA 4Y5XA 5D7EA 5GHWL 5IW6B 4HYRA 3D48R 4DWSA 2J5WA 3CAFA 5I1IH 1SOSA 5HGAA 1GTHA 4MFEA 5JOPE 2I9LB 1BBJB 5KVGH 1AGDB 4BKSC 3BG5A 1WDAA 3GIZH 1T7WA 4OZ4A 3S35L 4CVXB 2DZBA 3CC5B 3O4OB 3EKLA 1JPEA 1VFAB 3ZTCC 1GGIH 5AVRB 3SPGA 5DSCB 2KT6A 4HUWA 3BAEH 1ISVA 4YHMH 4O8RA 1P5UC 5IROA 4ORMA 4ZGYA 4XPTL 2F2KA 2W79A 4WKFA 2HFEB 4YS1A 1A9BA 1DVSA 1FHLA 2CC0A 1BQLL 4G7QB 1CFSB 4AVKA 4RUBA 1J5OH 2VIRB 3JTBA 3MV8E 3EWUA 2DN7A 2H1PL 3V79C 4UTAH 2GVEA 2I57A 3HR6A 4KK8C 4LLUB 2FQIA 3RCYA 3DHFA 1L9WA 1ZWIA 2IAMB 4UDTA 1KPUB 4KAQH 3BE7A 4QNEA 3P11L 3HN5A 4MYPA 1Z8AA 3J2PA 1EJ6A 4MMXA 3WJYA 4A6GA 1DJSA 4GW5B 2BVQB 5JA9A 1NC2A 1ZLVH 4KWSA 1JOIA 1RZJH 1L0QA 1IEWA 3T78A 3GI9H 1RURH 3U0PA 4D9QE 3KPQA 4OZGF 1S3KH 4NHUB 3AXKA 2ZZ4A 4AYSA 4KFPA 3APTA 2Y9RT 5F3BB 2ZXAA 1CICA 4RQQA 4WWNA 3VFGL 4QNWA 4Y9NA 4AWTA 3VQ1C 3RB7A 2Z92B 1QOQA 3ETBJ 3X3GL 2OLSA 3L5WB 2PTVA 3IE4A 2XDHA 5I1CH 3QIBD 4KITB 2FO4A 4MJID 1BJ1J 2Y36L 1HXMA 5EOCL 5EF0A 1Q9KA 3C5SB 2PCXA 4NBYB 3AT0A 3QIUC 3KPMB 3GYRA 1QSED 2OJ1A 4GG8B 5KW9H 4MYWB 2DUXA 3R43A 4Q33A 3FHQA 3WNIA 3QZBA 3VD5A 3N2CA 2CWXA 4DJFC 1MZYA 3UESA 4AYGA 3DSNB 4LSTL 4KRPD 4N4YB 1H3XA 3EFFA 3U3HA 3ZS4A 4NZUL 4WO4C 4JDTH 4DKAA 1TQJA 4HV8A 3SKNA 4JPVL 3RTQB 2QCDA 3AIVA 2HLFC 2QVFB 3BX7C 4IK6A 4L4JA 3LIUA 1A7PL 4WAFA 1Z66A 2MHAB 3UTZB 4A2MA 4BS0A 3FPXA 1PVHA 4MDIB 5BZWA 3OQRA 3VFUA 4IUOA 4PJ8A 1C9SA 1V4YA 4RGOH 4PGLA 2OSLB 2HROA 1ZVHA 2AQQA 4DN4L 4GRLA 2ROYA 1Q6EA 1KA9F 3B37A 1DJGA 1TELA 1YEIL 1T0PB 4MBOA 5GGRA 1WG3A 2PXYC 5TPWL 4ATDA 3VI4A 4B3VA 3LYEA 4UZUA 3PTDA 1AGEA 4EUPH 3Q9QA 4U3AA 3ZDZE 4LB3A 4NN5B 4KHXL 1UWEL 4U6VL 1RY8A 2CK0L 3GMNA 4K55A 3E8UL 4LGRB 6ENLA 3TFXA 1C5DB 4K23L 2JGYA 3OL2A 4BY3A 2BVPB 2LOEA 2O61B 3O8XA 4ZUVB 5FWQA 1MY5A 2WCGA 3N9GL 2FWOA 2DRUA 2ZC8A 3EA2A 3ZFHA 1AD9B 2BDNH 4P2QE 1G9EA 4FA7B 3OKNB 3NZUA 3V0IA 1AW5A 4Z78B 2VAJA 1QR4A 3LCXA 1G7QB 1HKIA 1H5BA 4KVNL 5JHDB 1J05A 1S7RB 2HMCA 4ZXBD 1EYEA 5FUZL 2F0CA 1YADA 4ABWA 3VI3A 5JOPD 4WW2B 3VE7A 2C9VA 3QUHA 2VMJA 4PB9H 3BOFA 2UWFA 2YD2A 3I3DA 2JCCA 2XVGA 1UWGH 4YTRA 4XCYA 4XQ6A 3G5VB 2O72A 3RY4A 3AO0A 5FO7B 3NYKA 1KTCA 2YHGA 1Q6OA 1QVBA 3V4VH 4A8RA 4ADJA 3ARFA 4WEBL 4N2EA 3SDYH 3ZVVA 3OJGA 1CGSL 4A63A 4IMGA 2Q3ZA 2WO2B 4FXGB 4YDJA 2AVFA 3LCFA 1IKOP 2Y7LA 4MJIE 5DUPL 1HJSA 5E2TH 1JI2A 4B3KA 4HZ6A 1OE1A 4HK3J 3NP4A 4P9ML 5KBPA 4Q8BA 3RHWK 3KLHC 4NM4H 4LEBA 4E5XG 3O05A 1TQBC 4FA6A 4PCYA 2F15A 4YTSA 1NFDE 2OKMA 1OSYA 1HAUA 4CVUA 4GQ0A 4JY5L 1XXFC 2PTUA 5ISZD 4Y9PA 2VZTA 4U31A 3E3HA 1D5MB 4CILA 4U1SA 5A95A 2DW5A 4NXKA 4EQ2A 4MD0A 1PKOA 2E7FA 3MDJA 4M24A 1BLNB 3QORA 3QPXH 1W2KT 2HVBA 2PYFA 3DX9B 3B5TA 3GTTA 3KR3H 4AQEB 2A7PA 2NUYA 1KFKA 5DYOB 3ARDC 1JUKA 3V55A 3VFWA 4G5DA 1TTRA 1BVNT 1O6SB 1RVFH 2XKNB 4ORIA 1UB5B 5DXXA 4FI6A 3MNMA 3MUUA 3VFTA 3FF7A 3IDMB 3MGAA 4FRWA 4ZB0A 1W9BM 5IMOA 1YA5A 4HHAA 1GGBL 4GT7A 4JM2C 5SWZE 3TJPA 4C47A 4LALA 3VPLA 4A8NA 2BMKA 3TMQA 5A6LA 1QSZA 4UM9B 2J13A 1NEYA 2CZDA 2R23A 3GNMH 3L67A 5JH1A 4ECLA 3MJ9H 1FNAA 4MXWL 5E8DH 2BSRA 4BRJA 3GH4A 1BQKA 3TZVD 1J96A 1ESWA 2GYIA 1CFTB 4JTUA 5DJCA 1JCTA 4NUQA 4AXWA 1G01A 1IM9A 1CFBA 5F97E 2AJXL 1SF5A 2GHZA 1FL6B 2XZQL 1WNOA 2ZSVB 1TG7A 4GRWE 3SBWC 4PJFF 3GLCA 2PDLA 3QRFM 1E4LA 2ZCKH 4M48H 4N8PA 4AVIA 2XFFA 4F8OA 3ML8A 1WZKA 4GNKB 3BAEL 4ANKA 1EUNA 4GJ1A 5D9NA 4Z7WA 4LVBA 4H2CA 3QWOA 4G83A 4QPEA 3EXLA 4LPTA 4GZIA 2B16A 2WYSA 3L95B 4MA3B 3KPNB 4NYUA 1XGYH 1DSWA 5E2UL 4X5PA 1PZ3A 3MSPA 5HJ3B 1GAFH 4R3SA 3H2PA 1LL7A 1OEZW 2OAAA 4A7SA 3TJLA 3L3DA 1FCBA 4KTGA 3IDNB 4QYOA 2P5WB 1P1ZB 2OCZA 1OGPA 5FUCE 3QXWA 3EJYC 4LASH 2OMWB 4OUUB 4OY9A 4YDNA 3VJ6B 3BRFA 3EWBX 2GGJA 3PQYE 3RPTA 1E6JL 3PDGA 4JL2A 4ZSOA 1EPVA 1XGEA 1KY7A 3WDRA 1WHOA 4X4XA 4WUUA 3MSDA 4C56D 1YTKA 4H1LB 2VX7A 4D9PA 1BVKA 5ILTL 3ULUH 2WQVA 5E6ID 4XBGA 2IVFC 5T33H 3VWJA 5ISZE 4L48A 4W7VA 1G7HA 3L48A 2R2HA 1W5OA 5SX5H 5GS0D 4HJJH 3LOWA 5D96B 4Z7NF 3M7WA 4YLWA 4G7YH 3ANUA 3W3OA 1HHJA 4WI5A 1VAHA 1NGWB 3MGTB 3ZL2A 5ECGA 3NQFA 2FEJA 2XINA 2F5BH 4P2RB 2NOYA 3G0SA 1I6NA 2AJZA 2PDJA 1D5XB 3RM4A 3BQUB 5D1ZB 5IBUG 1HHIA 3D52A 3O6KL 1WBHA 4L4TD 1Q94A 5C2BH 4KS0A 3ILEA 5BU9A 1XF1A 1E5AA 1T83C 5AQ0A 1URIA 1AG0A 1QNOA 2VKZG 1KBKA 3I10A 2OG9A 4DGIH 5IOBA 4Y4KA 3RM9A 3SO5A 3KJ4B 3VCLA 1QFWL 1I9JH 2OEJA 3UJSA 3F85A 2D23A 4P5TD 2ICSA 2IQAA 4JRLA 5DZVA 3GB7B 3ZMNA 1W3NA 5GRVK 5DWUL 2BFVH 5LAXB 1HINH 5AHNA 4QRTA 1GYUA 1NDGA 4K94H 4FC3E 5HHXH 4HXBH 1Q63A 3VFVB 1Y7VA 2P5WD 3VUSA 4A2GA 1FIGL 5GGSA 1ISZA 3HPZA 3MI2A 1OV8A 2CLVB 4MAZA 3FYPA 3O6LH 2DMHA 4LYKA 5E6UB 2DLFL 4A2RA 2OI9C 3AWEA 1BXXA 2E4TA 3FT3A 2ZWYA 1XT5A 3FT4B 4UT6A 4K5NA 5TF1L 1Y6MR 3NSFA 1B4TA 4BQ9A 5HY9B 4JFYA 3EEGA 1AANA 3ARYA 4YDKL 1K8YA 4C60A 1NTDA 5HGHB 4JTAA 1MCPH 1YPZB 3T09A 3ZJ8A 3KZSA 5LBVA 2Q7YA 3WN5A 2BHZA 1CBJA 4MJIA 4PG2C 1PYMA 3FIGA 2PO6B 4CJ1A 4MJ5B 2ITDB 4B9PA 4W8LA 1QSEA 3NIGF 1F74A 3SDXF 1I1FB 4HMDA 4PJ7E 3MRPA 4KXZI 3LNMA 1TTBA 1TYRA 5AALA 1K6WA 2VD8A 3MACH 3LY6A 1DBBH 4POZD 1E9PB 1TFHA 2NV1A 1CLVA 3MZGB 3UAJA 1KB5H 4QY8B 5G5DA 5JPNA 3HQ1A 3T8QA 3AADB 5HWJA 3CDGB 2CLRB 4IQDA 4QHRA 4R0LC 1MOEA 1H62A 3MHFA 1MHHB 5CJNA 2VN5A 3UACA 2LLNA 3MBWB 3ZTJG 5TTRA 5BOJA 5H94B 5LKYA 2JLPA 3HB3C 3P73A 3D69B 2EXWC 1DBMH 3KW7A 3WHE1 2B7NA 2WMJA 1JZ4A 3ESNA 3SDCB 3SRFA 2VDNH 5FDWB 1SJAA 5HDQH 1KTNA 5BOOA 4XRCB 5GJTL 4PCNA 4LIQH 7REQB 2NQJA 5BJTA 3FO0H 1IAOA 2NYYD 3BV7A 4QQUA 3NBNA 1QDSA 3MS8A 2PODA 2YL9A 3RVUD 3HPLB 5C71A 4LQ1A 2YC1B 4OU1A 2NCMA 2Y6SD 4XP1L 1EHXA 3UWEA 1SFLA 4DPPA 1EJRC 3QZWB 2XFYA 1U3ZA 1SFTA 1JPFA 1JZFA 3LKNB 4OAWA 5FACA 2J7DA 2B3RA 4YSAA 4WCYL 4OT7A 3J7HA 4K68A 2OTUB 3F7KA 4NO5B 1ADWA 2GIMA 1U5HA 3FQWB 1O5RA 2HLEB 4KI5F 3H2QA 3BEWA 4HCRH 4V1DB 2CCLA 5EG6C 4XV0A 4JRYD 3QZLA 2UUDH 3TUUA 1ZA3B 2EE9A 2Q1EA 3F05A 4PP2A 4DP2X 4H8PA 5CJ5A 4QEHA 3SRHA 3FT1A 2OQYA 1G6RB 3RWJA 2DZXA 4JPSA 3SDDB 2CQVA 5INCB 3LPPA 2A3HA 1ZLVK 2R91A 3ARFD 4LKXA 4HG4K 1MREH 3BYTA 1NUNB 4JTDA 4OFCA 3SFWA 1DHPA 5HI3D 3E0VA 3AIEA 3RTQC 5A8GA 1VJZA 4YH6A 3G1FA 4H25A 2HE8A 2CAKA 1LG1A 3TN5A 4LLQA 4IX0A 3FK3A 2G96A 4W5UA 2EIBA 1PJWA 2C9UA 3HA0A 2HK0A 1O75A 1OCWL 5M7QA 4PAZA 2WCAA 1JZ5A 4PJEA 2H4EA 3L3JA 4GBUA 1PZ5A 5MHBA 4TQIA 2ZOLA 3V4PH 3WNNA 2XUWA 4EOWL 1T0NA 2OQLA 4ODHH 5L4FA 1V0MA 4GKSA 2ZCKL 4LHJB 3C6SB 5EYWA 4MF4A 2PDUA 3V4PA 3BZFA 3EJQA 4IMEA 2W8CA 4OTXL 3IRSA 4JFZL 1VP5A 1ZT7A 2PP7A 2VHLA 3ZDXF 3QZNA 1K7EA 4UNTA 1RPXA 1JV5B 4W5ZA 1WWAX 5CN2A 3ZIZA 4A8LA 7A3HA 3SR7A 4ZPTA 3JWOH 4WWKC 4LEOB 4NZDA 3ULUE 5E08H 2R14A 3LMYA 2ILLA 1KV3A 2X1PA 2FJFA 3EO0B 1UP2A 1ETA1 3CLWA 2AJ3A 2Y85A 3QRHA 1FFQA 3MRDB 4LF2A 5DC4B 3O3AB 5HPMB 1A0EA 3GPSA 4X63A 5F2MA 2RR3A 1DBJL 2YWZA 4FQJH 4ILSA 5F7KC 3HCVA 1P6CA 4Z7UE 3T0BA 3RL2B 5DZOA 2HPTA 2IQDA 3BC9A 3N9KA 3U7WL 3NDYA 3W39A 1ZVSA 3KBMA 3RU6A 3SDCC 2IMNA 4U4IA 3SDYL 3GR8A 3QQDA 1CVSC 3MMEB 4A6YH 4KESA 3RZWA 2OPJA 4K3GA 4PHXA 2W9DH 4JDVA 2PDWA 1DQQB 4XI5C 1CGSH 1EC8A 2D24A 4RLIA 5IUSA 4MOZA 3LZPA 1UACH 2HH0L 1X4XA 1JWSB 4RZCB 1WGOA 2ZQ0A 4U2ZA 3PNUA 2HPMA 2IGTA 3QYMA 4FXGC 1PY0A 3L7FA 4MKTA 3SGDI 3WMQA 2V5RA 5I6XC 4XD3A 3S4SB 5LNVA 4NFDA 4UV7L 4IU3A 3NPSC 5CPLA 4D9RE 5DWPA 4H5SB 4FQHB 1DIEA 1PCXA 3DEQA 4JIEA 4IKKA 1C29A 2L3BA 2GVGA 4DXKA 4IIDA 3ZDXE 5LNUA 4R0LA 2DDQL 2XIQA 5A43C 5ABFB 3WL9B 4GW4A 1IGMH 4R4ND 4JOMA 2W60B 4F7TA 2ZXBA 3LKPB 2G50A 1CGVA 4HEMA 4GJTB 1T1WA 3WOVA 4H8UA 1AW2A 4N2IA 4Y7EA 2X9WA 4GIAA 4GAAA 1HQ4B 2QLYA 4LF3A 5I74B 2ZFAA 2FT7A 4I2XA 5EU4B 5IEKB 4IHCA 5AL8A 1XF4B 3GJFB 1G94A 3LPOA 3HE6C 2JBMA 5G4WA 4A35A 3BUVA 4R8WH 5TDPB 4XNZB 1UW9A 2FR4A 4NUJA 4C56A 2GT9A 3U0HA 5I07A 3ZRFC 3UNTA 1N0XH 3R7RA 4JJOA 5DZLA 1L6XA 4GQQA 4OKVA 3L5AA 4NO0D 4MA7L 1T1YB 4KGLA 3FU7B 2R69L 4G8GA 5F7LB 3ENEA 2DU2A 3T77B 3UPRA 2NVAA 4O1DA 1INEH 4X42A 2AXFA 4F57L 2XDFA 4G82A 1UC4A 1XIBA 3AU1B 2AJXH 4E4FA 1MFVA 1RJCA 1L4IA 4UR7A 2Z35B 2GQ9A 2G5RA 5IJBC 2NX3A 1AZBA 1H0DB 3WJZA 1IKFH 1UYQA 4JQ4A 5CJBA 4WTZA 2JB6A 5IIEB 3OU8A 3ASOB 1PD0A 4N6EA 4JEQA 1ISWA 4BINA 1ZP3A 5K9OA 5DUML 3C4UA 1HZHH 4PRID 4F40A 4MQTB 1JWUB 1VGKB 2WLLA 4G9DA 2XWTB 4M4PA 4MXQD 2WN3A 4N0UE 3F04A 2GVYA 5DD1L 1ZIBA 3EKZA 5DTFA 4WXZA 2A9NL 3R0NA 1ZAIA 3PY2A 5CZTA 4IMLA 5CD3B 2ARJB 3EJCA 4IRZA 1E6QM 1S5VA 2A4CA 3ATZA 1V7AA 2YAFA 2WHKA 3MR9A 5B38B 1RJLB 3SSZA 3AQUA 4GZEA 3S37L 3HQPA 1A6ZA 4L8SB 4U3XA 1SW0A 3GXIA 5J57B 1E6JH 2I14A 2CBPA 3FSOA 1TJ1A 3AZSA 3E2QA 3P11H 5JU6A 2WZPD 1JSYA 2XC8A 3GHTA 4GINA 4TUKL 3JRKA 1QQDA 3KBJA 2KZHA 2CLEA 2LLLA 4P48A 3WMBA 3NZ8A 4AM0B 3F4DA 4Y19E 3BLLA 4WK2B 2GC4C 1TZ9A 1U1JA 2R24A 3K4ZA 32C2B 2FVNA 2Z1VA 4IHBA 1P0SE 3PP4L 4X0NA 1U3JA 1KPVA 3O2WL 4HAGA 3SQOH 4A2EA 4HCHA 4R3UA 3SOBH 1BWWA 1MG3C 2HS6A 1LDPL 5JW4M 4F9PC 1Y5WA 2YPLA 2ICEB 3KPRB 1BEYH 1TZAA 1XB6A 2B0SL 4LVOB 4OFVA 4QRRB 3WFDH 3W37A 3EO9L 1LILA 2OK0H 4I5UA 4M8UA 3UAJD 4P5KA 4JQIA 2WMIA 4O16A 1VCAA 3VE0B 4UANA 3B2UD 2WSYA 3D3VE 3M0YA 3CV1A 4ABVA 4XXCA 2DDXA 3C8KB 3WUBA 5D5ME 4G43A 3LD8C 3CK0H 5IVZB 3WIFA 2PPGA 4YCOA 1FHUA 3NNTA 4XVTH 4V11A 4RJEA 3RLHA 3E96A 5DWUH 4OZGA 2WV3A 4XMUA 3QLDA 3RB5A 3WD0A 5EA9A 3ILPB 4XVSL 1KENL 2H3BA 2EABA 3QQ4A 3QO1A 2Q8LA 1K4CB 5ESQA 5KUKA 2CCWA 2X4SA 4G70B 5EL1A 5LNDA 3UWWA 3WJJA 3HE6A 2XLLA 4PLKC 4BWWA 3NH7H 5TF1H 5F7YC 3EO1B 3TA3C 1NBYB 3CFBA 1BQHA 3ALFA 1B2WH 2MCMA 2NVCA 3EH5B 2G60L 3NGJA 2V37A 3M0XA 3MCOA 3PZIA 1B2YA 1X9QA 2MCPH 1UWEH 3KEDA 5I8KH 3RCMA 4FZ8H 4D6HA 1XCXA 2AGKA 4GE8A 1TZGH 4MHHG 3S3SA 3GNNA 5JUEH 2XJKA 4M03A 3IARA 3D0AA 4HNLA 3IGFA 3W76A 1CYXA 4GSDL 2ZDSA 3W3BA 3L45A 3KPRD 4JFDB 4RAHA 4AYEC 1KBLA 4FOJA 1XSOA 2DQHH 4KXCA 3VXUD 1OTTD 1JCLA 4P59H 2W07B 4PJDA 3MRHB 4OD1L 5AZEH 5C0CA 5LA2A 4J3VA 3PQYB 5IVXA 1C8YA 3BLDA 3DI1A 4B9FA 4OCYH 4PC8A 1H1ZA 3F7RA 4WEVX 4Q6YA 5E6IC 1BAWA 1P5UB 2JKXA 3TIEB 5GZOA 2J75A 2E9BA 3H2AA 4KQ0A 3F01A 4P5TA 4ZFMA</