1CNVA

Crystal structure of concanavalin b at 1.65 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
283
structure length
283
Chain Sequence
DISSTEIAVYWGQREDGLLRDTCKTNNYKIVFISFLDKFGCEIRKPELELEGVCGPSVGNPCSFLESQIKECQRMGVKVFLALGGPKGTYSACSADYAKDLAEYLHTYFLSERREGPLGKVALDGIHFDIQKPVDELNWDNLLEELYQIKDVYQSTFLLSAAPGCLSPDEYLDNAIQTRHFDYIFVRFYNDRSCQYSTGNIQRIRNAWLSWTKSVYPRDKNLFLELPASQATAPGGGYIPPSALIGQVLPYLPDLQTRYAGIALWNRQADKETGYSTNIIRYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Seed protein
molecule keywords CONCANAVALIN B
publication title Crystal structure of concanavalin B at 1.65 A resolution. An "inactivated" chitinase from seeds of Canavalia ensiformis.
pubmed doi rcsb
total genus 93
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 1995-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cnvA00
1V02A 4NI3A 2YLAA 2E4TA 5KEZA 3A4WA 1LLOA 4P7QA 2WMGA 4AZIA 2EQDA 1W9VA 2WZIA 2XFFA 2ZWYA 4P7LA 2UY2A 3KZSA 4Y7EA 1CGTA 2W62A 4TX8A 5AYBA 1W3KA 1H1NA 3WQWA 4ZE5A 3WEMA 4PCTA 1Q6DA 4W85A 4UQCA 3KWXA 4H7VA 4BF7A 3VIPA 3WMBA 5CGTA 1JZ8A 2J7CA 2NT1A 4U2YA 1WNOA 4PMUA 3O6AA 1VBUA 3VGBA 4JFUA 1SMAA 1UWRA 1QOXA 4AD2A 2DT0A 2CBVA 1W32A 4U31A 3BCFA 4MPKA 4B9YA 4RE4A 1XSKA 1HJWA 4WSJA 4C7GA 3N1AA 1CXFA 2JEPA 1KQYA 4P8VA 3CGTA 3B9AA 1MW3A 3VGDA 4M8UA 1E4NA 2FHCA 2VQUA 2YL8A 3A47A 2VZOA 1NWRA 4UFLA 1TR1A 3WSUA 2ZX9A 1WO2A 1UR9A 3FNDA 1EHAA 4PSRA 5E0FA 3THDA 4D6FA 1OGBA 2F61A 3GBDA 1QNSA 1GJWA 2OLHA 3M6DA 2ZUTA 4B9ZA 4UQAA 4Z2KA 2EEXA 4CU8A 3WUEA 4AY1A 2V5DA 1B3XA 4H04A 2XSBA 5FIPA 4BA0A 2X1IA 5CSUA 1OIFA 2CNCA 2XVPA 1BFNA 4AD4A 2CHOA 2UWFA 1B3VA 4CCCA 2WWCA 2WMIA 1V3KA 3FXYA 1QBBA 2OWXA 2V38A 1E55A 2EPOA 3FAXA 4QAWA 3AI0A 4BZYA 4GO8A 1UH2A 5E09A 1EHNA 4MB1A 4W5UA 2YOCA 5BXTA 1CGXA 3T08A 4ML4A 2EPMX 3U5UA 2B31A 5LA2A 2A3AA 1WZMA 1JFHA 4MJ4A 5JBEA 1ITCA 1XH0A 1V3MA 2GVYA 1E5NA 5A2CA 1SMDA 5A6BA 1TA3B 1XC6A 1GVYA 4TTGA 3A4XA 1P6WA 3FW6A 1UA7A 1C90A 4AD5A 1BF2A 3W4RA 4P7OA 1NP2A 3L2MA 4GZIA 3WNMA 4ACZA 5A6SA 2DDXA 3GNPA 5CPQA 4CVUA 3FHQA 1JDDA 3W82A 4PCSA 2X8RA 3WQ5A 2WVVA 3IK2A 1W2VA 3UG3A 1KGUA 1NOUA 1UKSA 4RE3A 1FFRA 5M17A 3AMKA 4Z2GA 1JL8A 3OG2A 1PPIA 3WN6A 2YA2A 2G3IA 1H0IA 2CERA 4BQ4A 1UKOA 1OINA 1UR1A 4J3SA 4HMCA 1QPKA 3AXIA 3B9DA 3VMPA 1VBRA 1DWFM 5A8MA 3L4UA 1UQZA 3WDJA 2ZXDA 4QDMA 2E40A 1KWGA 4HPHA 5C70A 1E6RA 2J75A 2F2HA 3D3AA 4XX6A 3CLWA 4QLJA 2C7FA 1GPFA 2CHNA 4P8XA 3SCUA 4WKAA 1FFQA 2NSXA 2ESCA 4PMVA 4UQEA 3EYPA 2PWEA 4CVWA 2WZHA 1TMQA 2VZTA 3CO4A 1F4AA 1B0IA 4PTWA 5FOOA 1NOWA 5D9OA 3RJXA 5EFFA 2A3EA 2WVVB 2X0YA 3WUBA 1CIUA 1JAKA 5A6KA 2D0FA 4CCEA 2JIWA 3EDKA 2WMHA 1V6UA 1TFVA 1W1VA 1B3ZA 3NYDA 4PEEA 3AICA 2WHMA 1HJSA 3OBAA 2WSKA 3PZ9A 1UWIA 3TTOA 4FLSA 1EDQA 3SCVA 3CZEA 1OCQA 1E1EA 1G01A 2WVTA 1QI0A 2WLZA 3NDYA 2EPNA 2VNCA 1CLVA 4JFVA 4Z2JA 1CLXA 3POCA 1EDGA 1G94A 4OOZA 4W8AA 1QNQA 1K9DA 4J3WA 3ARYA 4W93A 4OJYA 4PMYA 5A6MA 1GQKA 5CGMA 2GDVA 4BS0A 3OZOA 2E3ZA 3SCSA 1UD8A 4TTUA 3QGVA 1KXHA 3VOCA 3GZAA 3PHAA 1EA9C 1UWSA 1E72M 2CXGA 1E0VA 3QHMA 1VEMA 3AFBA 4H8HA 5CPSA 4PMQA 2J4GA 8CGTA 1PJ9A 2X2YA 5HDRA 4MJ2A 4MNLA 2DSVA 1FOBA 1CXEA 2QMKA 3GNRA 1W3JA 3VD5A 4W8BA 4XZWA 3ZM8A 1ITXA 4DWSB 4W8LA 4KMQA 3WDIA 4H8UA 3CH9A 3KL3A 3MO4A 3U7VA 3WENA 2CCRA 2ZXQA 1JF5A 4BQ5A 5D8ZA 5M3WA 1RD6A 3QHOA 1US2A 3NUKA 3ZMRA 4OZOA 1H4PA 2YA1A 4CD7A 4TOQA 1NARA 5ABFA 5HXMA 2HVMA 3RCNA 4ATLA 4PUEA 1ISWA 1RH9A 2AOSA 4R27A 1B90A 4GZJA 2YA0A 3QOKA 4E2OA 3BAXA 5I77A 2E9LA 4WIWA 5FCZA 3HN3A 1V0NA 2XHYA 4UFHA 1V0KA 1MQRA 3IAPA 3VM7A 1NWUA 1DWJM 3WUFA 1HVXA 4HA3A 4JCLA 1DWGM 4FLQA 4QCFA 1U33A 3AYSA 1OB0A 1WZKA 1G9HA 3AZRA 4TX6A 4AYSA 1E5JA 3MSDA 1Q6GA 3L4ZA 1V6WA 1AVAA 4R5EA 5IFTA 1U30A 3WKZA 5CSYA 1HNYA 3GNOA 3UCQA 4AIEA 1C8XA 1UD5A 2PBOA 3DHUA 3ARUA 2X0HA 4PTVA 4WKFA 2MANA 5IHSA 3WEZA 1UR4A 1NH6A 2PI6A 1B3WA 3CUJA 1E56A 4Q7NA 3L4WA 4JFWA 3PZMA 5GNZA 3N15A 1G1YA 1HJUA 3BLPX 2WC7A 5A6AA 5BXSA 5I2UA 4A3HA 3GH4A 3APGA 3L2LA 2DPEA 2GJPA 4LX4A 4XB3A 3CZGA 3VD7A 1JDCA 1VEOA 4MB3A 3MSGA 2CETA 2YBTA 2YKKA 1VFMA 1DWHM 5KZ6A 3VMOA 3IAQA 4W86A 3PZTA 4YHEA 4WSKA 1MFUA 1GQJA 1VEPA 4EK7A 4URIA 1E6ZA 4CKQA 2A3BA 1M7XA 3RMEA 3F4VA 1NQ6A 1R85A 3S6TA 1CECA 4XV0A 1W9UA 1CDGA 2WLYA 4AD1A 3AS3A 3WIJA 3WH9A 2JEQA 4AEEA 4N0RA 4HTYA 4Z2HA 2CEQA 3MV11 3ZOAA 4J3UA 6A3HA 3VPLA 1LWHA 1S46A 3T2PA 4D6DA 4OBSA 1EIBA 2WHKA 3BAIA 3PTKA 2HISA 1JNEA 5HNNA 3WH6A 2YDQA 1GQIA 4BCEA 4KGLA 3II1A 1KBKA 2G41A 4ATDA 2VOTA 4AW7A 3S2CA 3BAWA 3T2QA 2QPSA 3WY1A 2W61A 2QV4A 3PZUA 4W88A 4CN1A 4E8CA 2WYSA 1BSIA 2CYGA 4H2CA 3W81A 4P8WA 3MU7A 2FHBA 2BHUA 2JF7A 2YIHA 3CBWA 3VDHA 2BHYA 1BG4A 2GDUA 1NWTA 2DSWA 1VFOA 2VC9A 4HU8A 3WL0A 1LL7A 1ZS2A 3W24A 3IANA 2OYKA 2VR4A 1X6NA 1V3JA 1E73M 2WAGA 3E1F1 1HT6A 2BFGA 3AIBA 5HPCA 2VCCA 5I3DA 2CESA 1HJQA 1YQ2A 3L4TA 1HN1A 3LPPA 4AZGA 5CLWA 3CIVA 1DWIM 3OLIA 4OBRA 4UZSA 3CUGA 1DP0A 2XTKA 1ZBCA 4LYRA 1C7TA 2O92A 2DSUA 2WM0A 3VNZA 3U7BA 3WNOA 1XH2A 2OYMA 2G4FA 2D0GA 3W6MA 4CN4A 1W3HA 1I75A 1BPLB 3CZKA 1B1YA 4LXFA 2BVYA 3ZJ8A 4GO9A 2A3HA 3F5KA 3ARXA 1VF8A 2EBNA 3G6LA 3ZQ9A 3ZSTA 3UEQA 5C71A 4JL1A 2WZEA 2VJXA 3W26A 1PX8A 2DH3A 2OSYA 5DT5A 1IT0A 3WQ8A 4WLCA 4AZCA 3WFZA 8A3HA 4PMXA 1GOWA 4KGJA 1A3HA 3WQVA 3WD2A 1VAHA 2X05A 1MW1A 2GJXB 2JE8A 1E9LA 4U33A 2O9PA 2VO5A 1E6QM 2XG9A 2XWDA 1PIGA 3AHXA 3WMSA 5A8PA 3SUVA 5IFPA 1OBAA 4ZENA 3WNKA 3ARPA 3BGAA 3WBAA 2WB5A 1W9BM 2O9RA 4CD4A 3K8MA 4A3YA 4JFSA 4J28A 2ZICA 1BYBA 2X09A 1TVPA 3MV01 2VL4A 1UQYA 3LPGA 5FD0A 1WP6A 2JFEX 5ABGA 2VX6A 4W5ZA 2CPUA 1BGGA 1QHOA 4F8XA 3GH5A 3IJ9A 4EE9A 1B3YA 1BG9A 4P7NA 2WSPA 1OT2A 3MMUA 4AZCB 3I3DA 2D24A 1KCKA 3AIEA 5A1AA 5HBFA 2FGLA 2XFYA 2YL6A 3BMVA 4NRSA 3UR7A 1QI2A 1JZ3A 5ECUA 1GOOA 5BYWA 2ZX6A 1MW0A 1GVIA 2VZUA 5A69A 4Q22A 1J0HA 3KEHA 4TVDA 4AWEA 4N42A 2VI0A 1M04A 1KCLA 1GW1A 2O9OA 3KE0A 2G3NA 2OWCA 1FH7A 2VTFA 5CLTA 1HKJA 3OA5A 1W91A 1J9YA 4MTVA 1ISXA 3EBVA 1KB3A 1WE5A 2XWEA 1GJUA 4UFMA 2FHFA 2JALA 3WF1A 1Q6FA 2J8GA 3D5HA 1JYWA 3WL1A 3VINA 2QPUA 2UY5A 1V6VA 1UD3A 1C92A 3HU7A 1FP9A 1RP9A 4GI8A 1JG9A 1OT1A 2WCGA 4OKDA 1NM9A 2WMIB 1G5AA 1IZKA 4MAVA 2DGAA 4IISA 4U3CA 1OWQA 3VVGA 1PX3A 3TONA 2WC3A 4D6GA 4FMVA 2Y4SA 3OLGA 5CZKA 5AY7A 2BVDA 1B31A 4AD3A 3O9NA 4HZ7A 1H49A 5D4YA 1C91A 3VD4A 2J7FA 1EQPA 1JD9A 4YHGA 1EH9A 3RM9A 3VDAA 3ALFA 4V28A 2AMGA 3N04A 1OIMA 1BTCA 1NOFA 2XSAA 3B9EA 5CPTA 5GQBA 4UQBA 3SUWA 4ACZB 2ZUSA 4CN6A 4CD6A 3U5YA 3AIWA 1V0LA 4P7RA 4GKLA 3VU2A 3K1DA 4QP0A 3W28A 4UTFA 2EPKX 4JZ5A 3GXMA 3SCPA 3SEPA 3MANA 4DUVA 1QNPA 5BXPA 2WNWA 4JHOA 3AROA 4V27A 3VDCA 3TOPA 2GUYA 1XHGA 4GI9A 5M5DA 4PMZA 3CHEA 5I0DA 2BHZA 4MNJA 5LA0A 1ISYA 1GOQA 3AYRA 2D20A 1QNOA 3WD0A 1B2YA 3VDBA 2J7DA 3BSGA 1E6XM 4E8DA 4AZ7A 1Q4NX 2W91A 4D6HA 1PX4A 4NF7A 4W87A 5D9PA 2VRQA 3W53A 3NSXA 1CGUA 3WDHA 1M01A 1EO5A 1XCWA 3VMNA 2J7BA 3EMCA 4PRWA 5AC4A 1LWJA 2DIJA 3AXHA 3EDEA 5AYIA 4AISA 1I1XA 5IXEA 2XIBA 3VO0A 1E70M 3OLDA 3A3HA 4PMRA 3RJYA 2G3MA 4D6IA 3CZ8A 2O9TA 1K9FA 1UWTA 2WBKA 1R86A 3LPFA 4HZ8A 2IXVA 5I6SA 2CBIA 3RILA 5I79A 5HPOA 2GFTA 4U5IA 2W66A 3ARTA 1WPCA 1JZ4A 2DH2A 2YLLA 1E4MM 2NW0A 3CHFA 3TTQA 1W1PA 3WH5A 2D23A 1V6XA 1WZAA 2ZUNA 1H11A 1JNDA 1W9DM 3NSNA 2VQTA 1KXQA 3FAWA 5I78A 2QLYA 2G8ZA 3WEOA 2C8NA 4CCDA 2XIIA 1E1FA 4LGXA 3T0BA 1AQMA 2W4XA 4GQQA 3W25A 1CTNA 1UYQA 3CZLA 2J47A 4H41A 2VX7A 2FH8A 1GORA 3IJ8A 3PBGA 1R7AA 2EXOA 2ZUMA 4TXEA 5JIPA 2VCAA 4DUXA 2PWGA 2ZX8A 3HJEA 1UA3A 1KWKA 1GOIA 3AXXA 1UOKA 2WHJA 2WVUA 1KQZA 1D7FA 3EMZA 1HX0A 1K6AA 2EJ1A 4FLOA 1WDQA 1ZJBA 2TAAA 5JUVA 5A6JA 5M03A 1JZ7A 2D0HA 4AMCA 3SIMA 4H8VA 2WMJA 4MNMA 1UH4A 2VZSA 4DUWA 4UFJA 4IPNB 3BCDA 3NSMA 2XJ7A 3T0AA 3B8SA 4ZEPA 3L4XA 1ECEA 4PMNA 5JBDA 2V5CA 1NP0A 3WNLA 5DO8A 1C8QA 4U3AA 1EOMA 4RL3A 3NIYA 2OWWA 1B9ZA 1MXGA 5LYRA 1UKTA 5CQ1A 4EAMA 2WKGA 1J12A 3W37A 1W3LA 4WJXA 1LF1A 5A6BD 1C7SA 1E15A 2A3CA 2Y24A 3RM8A 4U5KA 1UKQA 3VIGA 1XYZA 2VZVA 4X9YA 1C8YA 5DT7A 5F7UA 1GUVA 1R87A 1H2JA 3HMCA 3DYPA 1FHDA 3NCOA 2XVNA 1UD4A 1PZ3A 3SCWA 1R8LA 3VIKA 4JCMA 4UR9A 4EKJA 1JIBA 4PN2A 2DT1A 2D3NA 1W2PA 3J7HA 1G0CA 4JL2A 4AC1X 5E6YA 1TCMA 4B3KA 4J27A 4UFIA 1WB0A 1WZLA 1VJZA 5BROA 1BLIA 3PZQA 4U2ZA 3VIIA 4ATWA 5ABFB 1CENA 1OM0A 1X6LA 1E4LA 1V02E 2GK1A 1HJVA 3W29A 3N11A 1E3ZA 1VRXA 2QF8A 2WHLA 3GXDA 3OGSA 4AEFA 4GINA 2PWHA 1KXTA 2WVSA 1BHGA 3VIFA 3OZPA 4IM4A 4LPCA 4CGTA 2J7EA 2ZX7A 1UKPA 1UH3A 4J3XA 5ABHA 2J7HA 3SCOA 3UG5A 5BRPA 1VB9A 3ZJKA 4PUDA 2PF0A 4LYQA 4PSPA 1DHKA 5IHRA 3EDDA 3BLKA 1HL8A 3SUUA 3ZSSA 4AD0A 5JIWA 4P8UA 1TZ7A 3KL5A 1KXVA 1E0XA 5I24A 1RP8A 4S3JA 4L4OA 1CXIA 2WMKA 3WF2A 3AS0A 1PZ2A 2J25A 2J8FA 3EDFA 2V3FA 1FA2A 3VGGA 1WDPA 4JAWA 4C7DA 3N17A 4HU0A 4ACYA 4PMOA 3W0KA 4HP5A 5D8WA 3RDKA 2JF6A 1EOKA 1JYNA 3WNNA 2Z1SA 2XUCA 2YDRA 3A6OA 3VX0A 3VKKA 2GK1B 1K9TA 1B30A 1H5VA 1JGIA 3IJ7A 1BVZA 4J3TA 2WKLA 4UCFA 3ECQA 4PMDA 1PBGA 4QCEA 3GM8A 4PYSA 3QOMA 1GOKA 1HP5A 1TVNA 1KGXA 2E8ZA 4HZ6A 4DWSD 3BAYA 3WF4A 3TP4A 2Y2WA 3AHZA 4AIUA 3THCA 2Y8VA 4UQDA 4UOJA 2YJQA 1ZJAA 4HA4A 4M1RA 2XGIA 3PZOA 1E4IA 2W63A 4UNIA 5EMYA 1JD7A 3AMCA 2PWDA 1W9PA 1J11A 1HJXA 2WCSA 3GH7A 5D9MA 4F79A 4DM2A 1ZU8A 5GNYA 3AISA 1IV8A 1JI2A 3CHCA 3PZNA 7A3HA 4DM1A 2DT2A 1N82A 2PBGA 3NDZA 4D6CA 1BYCA 2RGMA 1AQHA 4PTMA 3SUTA 3BXWA 3CMJA 3VIJA 3UESA 1E6SM 2WMFA 3ZIZA 4E4PA 1DTUA 1UWUA 4QLLA 3OGVA 4CUCA 1E40A 1J0YA 1JXKA 1UHVA 3ZJ6A 3VD9A 4HPGA 3GXIA 4D6EA 3BAKA 4W7WA 1GNXA 3WDRA 3EMQA 4UZUA 2QMJA 4JIEA 2J74A 4F9DA 4HMEA 1DWAM 4X0VA 2VVNA 1GZJA 4KWUA 5IDIA 4IPLA 5BCAA 3ARQA 2GJRA 4NZCA 2ZX5A 5GPRA 1MXDA 3AJ7A 4GI6A 1WAWA 6CGTA 4X0NA 3RO8A 2DSKA 1UZ1A 3DYMA 4XZBA 1HL9A 3MMDA 2DEPA 1OGSA 4CD5A 3PTMA 1FHLA 2XVGA 1E71M 1E0WA 1WDRA 3PZVA 5EFDA 3TA9A 3M7SA 3N9KA 1XD1A 4M24A 4M29A 1GOMA 4JKKA 1GONA 2JIEA 2V3EA 1BQCA 2VVSA 3M46A 5A8OA 2AAAA 1VENA 1JI1A 1JYVA 5DMYA 1QVBA 1V0MA 4KRUA 3U57A 3AOFA 3MS8A 4OIFA 1K9EA 2BY2A 4W7VA 4HOWA 1NWSA 3W27A 1TA3A 1CWYA 1JDAA 1UD2A 1CXKA 3DC0A 3K8LA 3VIMA 5A2BA 3BH4A 4B16A 3VX1A 1IZJA 4NSBA 1E6NA 1V3IA 4NRRA 1D3CA 4GXPA 3POHA 4GQRA 4F9JA 1L0PA 2QHAA 1C93A 2DIEA 5HOSA 3OGRA 4TVUA 4Z2LA 1EXPA 4HMDA 3AMLA 3AQUA 3W38A 3SCTA 1X1NA 4AZHA 3AIRA 4PTXA 4EANA 2IUZA 3MKKA 1QHZA 4MAZA 1C3FA 2BY3A 1XV8A 1ZB5A 3ARRA 2J7GA 1OGGA 3AMDA 4D1IA 2G3JA 3OIHA 3AIVA 4AZ5A 3MUAA 2WBGA 3OLEA 1TG7A 2BXZA 3TTYA 1HXJA 1O7AA 2EPLX 2VRKA 4ZFMA 3ZT6A 4AXNA 5CG0A 1XSIA 7TAAA 5FL0A 5A95A 4ZXOA 2ZIDA 1JYXA 4ZXLA 1CGYA 1FH8A 5E6ZA 3VTRA 2WCAA 1UZ4A 2CBJA 2VRJA 3OB8A 2J79A 5BRQA 1MWOA 1LL4A 4QLKA 3WDPP 3WQ6A 1CYGA 4V2XA 2Y8KA 4CU7A 2Y5EA 1BAGA 1VIWA 3LMYA 4S3KA 3PN8A 3DHPA 5A8NA 2UY4A 3BC9A 3ZR6A 3GDBA 2OYLA 4M56A 2VT0A 5DEZA 4F66A 4XUYA 4YPJA 2CIPA 3UR8A 3VIHA 5BXRA 3SUSA 2YL9A 1HF6A 3AHYA 1UG6A 1J0ZA 3QR3A 4DWSC 1AMYA 9CGTA 1Q6CA 5EBAA 4LQ1A 2BY1A 1EQCA 1GQLA 3WH8A 3WBEA 5A3HA 4AZBA 1MFVA 3WH7A 2VX4A 1M53A 1CPUA 4TUFA 1MQPA 3WDQA 3EDJA 3AIUA 4KH2A 5E0CA 3WF3A 2PWFA 5DFAA 3ZO9A 1MQQA 2UY3A 3WD4A 1J0JA 1V08A 4J3VA 3K4AA 1CEOA 3ZR5A 2E9MA 4YN5A 5GNXA 2XVLA 3MUIA 1W1TA 2WANA 2BV9A 5EB8A 1FP8A 2VURA 4BQ3A 4JHZA 3GTNA 3WD1A 5A94A 1SFSA 4ZE4A 2D22A 3SURA 3GYCA 3FHAA 5ABEA 1CBGA 1UR8A 3AS1A 2ZUUA 4W7UA 3NJ3A 2NT0A 2W5FA 3AMGA 2D1ZA 1HIZA 3DECA 1OD0A 4B15A 4HA1A 1RPKA 1W9XA 7CGTA 1BGAA 4MB5A 2WWDA 3SCQA 4W89A 2FGZA 2VR5A 4GIAA 3AS2A 3VIOA 1QHPA 4DWSA 1TE1A 3CMGA 1KFWA 1UR2A 1DEDA 1KR0A 1CXLA 4OUEA 4PBGA 1CXHA 4M82A 5C8BB 3BMWA 4JKLA 4LYPA 2XYLA 5AC5A 2PC8A 3CUHA 3FN9A 4OOUA 2J78A 3VUPA 1CZ1A 3ZJ7A 2E8YA 3RPMA 1WKYA 1LG2A 1LJYA 3LPOA 1JZ5A 1ZBWA 2BNJA 4HOXA 3GXFA 1WDSA 3AHVA 5DF0A 5BWFA 3SCNA 1QBAA 2EO7A 5D9NA 1UUQA 1Z32X 4AIOA 4AZ6A 1BYAA 4JKMA 3CUIA 3F5JA 1VFUA 3UERA 4HOZA 1JZ6A 1V3LA 2PB1A 4CD8A 3ARZA 1BVNP 3L4VA 2WC4A 1H0GA 2C0HA 1Y7VA 3WNPA 5JBFA 3PZIA 1YHTA 3MUY1 3A4AA 3UETA 4RE2A 4GPNA 1Q6EA 3N12A 2BVTA 1UR0A 4MDOA 1MW2A 1J10A 3CHDA 2D2OA 3CTTA 2YDSA 1OD8A 1HKMA 2OSWA 4CU6A 1ZBKA 4A4AA 2FH6A 3QHNA 4JFTA 3AIQA 5CJ5A 2VCBA 3K46A 3MMWA 1L8NA 2CKSA 3RM4A 3MUZ1 1EDTA 4D6JA 3VGEA 4UOZA 4C7FA 3ALGA 3AZSA 2BS9A 4QFUA 4WK9A 4TVCA 4J7RA 5LA1A 4MADA 3PZGA 5CXPA 3ZT7A 2VX5A 3VNYA 3VGFA 1TUXA 5TD4A 2Z1KA 1J0IA 1ISVA 1KGWA 3CUFA 1JF6A 1HP4A 2E0PA 4B3LA 3VD3A 4UQ9A 1CGVA 4W84A 2XPKA 4MB4A 1ODZA 3T2OA 1E6PA 1J01A 4D72A 1MVYA 1WCGA 2DQXA 1J18A 4WKHA 1GCYA 1EGZA 2V3GA 1ESWA 3O2LA 3ARWA 3VM5A 1U2YA 5FKYA 3ZT5A 5A8QA 1VJSA 2DT3A 4L4PA 2J62A 2XM1A 3CPUA 4WF7A 1QI3A 1CGWA 2ZE0A 1F4HA 1ZL1A 5I23A 1XSJA 2J77A 1QI5A 3L4YA 1LQ0A 1XCXA 4M80A 2BY0A 2WPGA 3TTSA 3VGHA 1JZ2A 2VUYA 2ZXAA 3WUGA 2DSZA 2F8QA 2E9BA 3CZJA 3T0DA 2Q8XA 3ARSA 3G6MA 5FL1A 1LG1A 2XFRA 2CKRA 4D71A 1E43A 5I5RA 5E70A 1JXJA 1GHRA 3F5LA 1J0KA 1D2KA 1XRVA 3BSHA 1H09A 6TAAA 1PIFA 3WD3A 3T09A 3I3EA 2WK2A 1XGZA 1M03A 2ZWZA 4UFKA 3UG4A 1A47A 3FY1A 1ZBVA 1HKIA 1PAMA 2XM2A 2ZUWA 3ARVA 2FDMA 4KRTA 1AQ0A 1ODUA 4D1JA 1V3HA 4FLRA 2W67A 1OSEA 1JAEA 3WQ4A 1H41A 2ZUVA 3N13A 2WW5A 4GZEA 1QW9A 4BQ2A 1LL6A 4K68A 2RGLA 3K4DA 1V6YA 3JUGA 3KL0A 1QW8A 2BXYA 1US3A 1FH9A 1I1WA 4FF5A 1H3GA 3WELA 1JFXA 1QI4A 3WF0A 3N18A 2WXDM 3SCRA 2ZXBA 2XVKA 1CNVA 3AHTA 3GBEA 1XYFA 2OSXA 2YBUA 2CITA 3VILA 3DYOA 2D3LA 1UWQA 2ZOXA 2YL5A 2VMFA 1KR1A 1SYTA 1XD0A 2CBUA 4IUGA 2GSJA 1MYRA 1W1YA 1VFFA 1HKKA 4MNKA 4MDPA 5A2AA 4Z2IA 3RIKA 3WFLA 5A6LA 1PEZA 1R7OA 1KBBA 1SR0A 1E3XA 1V03A 5E9AA 2GJXA 3BAJA 3K8KA 4M81A 3W6LA 4UOQA 1BYDA 1UD6A 1XH1A 4FK9A 2W92A 3AZTA 1ISZA 1EO7A 2V3DA 3WMCA 1GHSA 2XGBA 3M07A 3I3BA 1QNRA 3PTQA 1HVQA 2IXUA 1O6IA
chains in the Genus database with same CATH superfamily
2YFNA 1V02A 3PF3A 4JIRA 2YLAA 4UMAA 1LLOA 4P7QA 4AZIA 2Y62A 4N02A 1CGTA 1N55A 1H1NA 4E6MA 4ZE5A 3PJTA 3NGJA 4W85A 3KWXA 3N25A 4HPJA 1DQXA 3WMBA 2E6FA 3WLPA 3LG3A 1LYXA 1EJ7L 4AU0A 2V63A 2NT1A 3QTGA 3TE9A 3O6AA 3S5ZA 3TAKA 1VBUA 1TJPA 4C1NA 1XGDA 3S9IA 2DT0A 4MPKA 4KS0A 4JQ1A 4P8VA 3IIOA 2XH0A 5I02A 2NV9A 3P84A 4DYEA 3REQB 1D7KA 1NWRA 3FJ6A 1DJQA 1DIOA 3JW7A 5LNUA 1TR1A 3IIZA 2OB3A 2NXIA 3TZNA 1RBOB 1PXGA 2I1OA 3DESA 2OELA 4RLIA 3SR7A 1KA9F 2QGHA 4UQAA 2C14A 4HNCA 3O0KA 1VIZA 4FALA 1KM4A 4H04A 5D04C 1R47A 2ACSA 2DU2A 5CSUA 2HRWA 1P0NA 1BFNA 2CHOA 3LK6A 2UWFA 2QUTA 3BLEA 3FXYA 3V75A 3FAXA 3FS2A 3MZNA 4QAWA 3EWWA 1UH2A 4WQ6A 4Z42C 2Z6IA 4MB1A 5CPMA 4W5UA 5BXTA 1CGXA 4PUKA 4B91A 4IIHA 3CIWA 4GXMA 3L7RA 4FPSA 4AHQA 1QNVA 3HV9A 1ITCA 1V3MA 2QJHA 3IIVA 1TA3B 1GVYA 4RV8A 4JTIA 1R9YA 3WG6A 3A4XA 1SSGA 3N4FA 3T05A 4XO7A 3W4RA 1NP2A 3L2MA 3E38A 4A8RA 4LUIA 4HIBA 1H1ZA 5DMLA 3FHQA 2W6RA 4PCSA 4GI4A 4GXWA 3EB3A 2QJIA 3GR8A 2WVVA 2CLHA 3ATYA 5DXXA 1KGUA 4O0KA 2HVOA 4JTUA 4QQUA 2P8CA 3OG2A 4LB4A 4XO6A 3R7MA 2YA2A 4FB7A 4OVXA 1H0IA 1FWRA 2CERA 3PUDA 3NXFA 4BQ4A 1PSCA 4HK5A 1UR1A 1B54A 1QPKA 4F0LA 3W7JA 2HJPA 5A8MA 3L4UA 5TQLA 3ITCA 5K9XA 4Q8WA 1JQXA 1XBZA 3LCIA 2GVEA 2RHGA 3TIMA 2J75A 2ZTKA 3VI2A 1LBLA 4JEQA 4ZOEA 4ERGA 5D2WA 4GZ7A 1CI1A 2I57A 5HINA 1WA3A 3R58A 1SVDA 4WKAA 2NSXA 2BMBA 4UQEA 3OOQA 4CVWA 1IT7A 1BKHA 1D8WA 4LAUA 1TMQA 2VZTA 5K3VA 4PTWA 3H8AA 3V36A 1NOWA 5D9OA 3RJXA 2ZBTA 2A3EA 1EBGA 2WVVB 2X0YA 2B0MA 3TEVA 1AW2A 2VGGA 1OX6A 1EWDA 5EMMA 2CWNA 2PDXA 4PEEA 3AICA 3U2OA 1F9CA 3PZ9A 3GNDA 4NX0A 3PPHA 1UWIA 3KCJA 1Q6OA 2R9RA 1H62A 4K8EA 3TTOA 1I2RA 3E6EA 4JNYA 1EDQA 4XZHA 4H1ZA 3H24A 2C13A 2OZ0A 2VNCA 3TLLA 4JFVA 1CLXA 3NR0A 4XAGA 1L6SA 2ANUA 4M7TA 1EDGA 1G94A 4ZQOA 3ITXA 3CEPA 3KOXA 2NVDA 5ABTA 1XC4A 4OJYA 3NZQA 4DO5A 5A6MA 1GQKA 3C3NA 4GH3A 3OZOA 2E3ZA 3SCSA 3CB8A 1UD8A 3QQ0A 4TTUA 1C8VA 3GZAA 1XQKA 3QV6A 5CZSA 1UWSA 1E72M 2CXGA 1F3TA 4DXVA 3QHMA 3EXSA 2Q3RA 4HU4A 3CV1A 8CGTA 2EKCA 1TJ0A 1DL3A 4C5ZA 4BI7A 1Q13A 3B9OA 2OGYA 3LGDA 4AQLA 1NF0A 4XBJA 3L5LA 1XG3A 5FJOA 4NNCA 3LCXA 4ES4A 4RDWA 1ITXA 4FOUA 5CBBA 4H8UA 3HG4A 2BSLA 3U7VA 3N34A 4WRHA 3WENA 4L61A 1TPEA 3E0WA 2ZXQA 3MYPA 1UJQA 3GS6A 5AHNA 2O56A 3NUKA 3EKLA 2KAUC 1BXCA 4W4QA 3VA8A 4TOQA 3SRFA 3H2MA 4S3DA 1NARA 3G18A 1OHLA 2HCVA 2V5BA 5ABFA 5HXMA 2HVMA 2BG5A 4GZJA 3CHVA 4WIWA 1IZCA 4PB3A 3DKJA 5MHBA 4UFHA 4GIRA 1DTNA 1V0KA 3MSYA 3DN5A 3VM7A 4DBSA 1NWUA 1DWJM 2JBMA 4JPGA 3GYEA 3WUFA 1HVXA 3E2SA 2Y85A 4FLQA 2Z26A 4FNRA 1EJVC 1U33A 3HZ3A 1OB0A 3PP7A 1G9HA 2GVJA 2Z28A 1E5JA 3MSDA 2DVXA 1AVAA 1Q6RA 3USZA 1GZ1A 3T1GA 1HNYA 4FNSA 1KKRA 3CQKA 3DHUA 1RV8A 3W7RA 3BLDA 3WEZA 2PI6A 2R1MA 2QUMA 2OTDA 3TFCA 3QSTA 3RAOA 3L4WA 3PZMA 4C6EA 1M7PA 3N15A 1HJUA 3BLPX 3UZXA 1PYFA 5I2UA 5CAHA 3APGA 4C6QA 3B8VA 4A8LA 3UWEA 3MVTA 1SO3A 2YKKA 3OA3A 3TV8A 1LUCA 4JTHA 4IFKB 2C79A 3QFEA 4A3UA 4EK7A 3RLUA 3WMLA 4URIA 2YCKX 3F4VA 1KRMA 1MO0A 3P74A 2Z4GA 1MNZA 4OQVA 3E2QA 3WQDA 3M43A 3M6YA 1JQVA 4J3ZA 4XV0A 3N2XA 1OF6A 4AD1A 1KC7A 3R11A 4RZBA 4HTYA 2D2JA 4X3ZA 6A3HA 4FNUA 3GD6A 1EIBA 1FWWA 1IXNA 1O5RA 5HNNA 1AD4A 3LLFA 1NIUA 3UXDA 1GQIA 1KBKA 3C0LA 1TWIA 2G41A 1HFBA 4WY0F 4AW7A 6REQA 2PDMA 2QDGA 1FBAA 2QPSA 4JOMA 2W61A 2QV4A 3PZUA 4H8NA 4KERA 3W81A 4MYAA 4DZAA 1LUCB 4D9PA 3EWZA 4FO4A 4B5WA 2WPBA 2BHUA 2LLEA 2YIHA 4PRRA 2GDUA 1NWTA 1UZDA 2DSWA 4RV3A 3GXPA 1VFOA 1TV8A 1LM1A 3VNKA 1V3JA 3E1F1 1IHIA 4ZO7A 3RX2A 1YQ2A 3L4TA 1ICQA 1Q2SA 4AZGA 4Q4RA 3G22A 1Q65A 3CIVA 1DWIM 4DY1A 1PTDA 5G4WA 3TQVA 2QKFA 2XTKA 4LYRA 4W9TA 1C7TA 2OJPA 2O92A 2WM0A 3NQ7A 1R0MA 5MKGB 4QITA 4CN4A 3SFKA 1B1YA 1FWBC 4GO9A 2A3HA 3STEA 1VF8A 3EWCA 4YMZA 2QCNA 4JL1A 3R6IA 2EF9A 3WQ8A 3SN4A 4FF7A 1A49A 4E2VA 1RVGA 8A3HA 3VCCA 2D73A 3W1TA 1EWEA 4JNMA 4UMCA 5B7YA 3W1MA 3WQVA 1ZUAX 3WD2A 1VAHA 3DUGA 3PWAA 4OUIA 3L65A 3UGVA 5AC6A 2VO5A 1E6QM 3TX9A 2XG9A 4IT1A 3CIXA 5HWNA 1TPUA 5BW6A 1UPMB 1ADSA 3RXZA 3WBAA 2C16A 3EX2A 4A3YA 4J28A 4OHQA 1T6MA 2X09A 1YDNA 2R6OA 5GJMA 1XBYA 3LRLA 1WP6A 2JFEX 4Z0SA 5LIXX 2CPUA 1IEIA 1BGGA 4I7VA 3GH5A 1XIIA 2AGKA 4N9BA 1BG9A 4LJ3A 3KTXA 4L4MA 1A5CA 1A5MC 4PUNA 5J8LA 3DFPA 5ECUA 1TV3A 1MW0A 4XSMA 4GVIA 2OO0A 1UC5A 5BWAA 1RBLA 5F4XA 4N42A 2VI0A 2OZTA 5LIUX 1KCLA 1XLLA 4UXDA 2R82A 1ONXA 2ZZ2A 5HNTA 3W72A 2RDWA 4LVAA 1F8IA 3KP0A 4R33A 3ABRA 3G1VA 1W91A 1XS2A 4LUJA 3T44A 1AQFA 5FJIA 1EP2A 1KB3A 1V77A 2XWEA 4ZTXA 3NQGA 3MCMA 2FHFA 3WF1A 1ZAHA 1Q6FA 4WJEA 3RO6A 2QUNA 5T26A 4R53A 4DJFC 1LRNA 1TPFA 4Q8MA 1V6VA 1HGWA 2VGBA 2OPJA 1NM9A 2C18A 4MAVA 2O7QA 2OOFA 2DGAA 1KFBA 2PODA 2QGYA 1PX3A 1BQGA 2WC3A 4EXAA 4FMVA 2Y4SA 3KZPA 1OFDA 2ZRYA 5AYZA 1DE5A 5LNRA 1Z9AA 1AJ0A 3VD4A 3G1SA 2JGYA 1EQPA 1EJUC 4IOTA 1US0A 1ML1A 1EFZA 3L12A 3M5XA 1F8MA 4G7EB 2DZBA 5CPTA 4FNQA 2CLOA 4UQBA 2ICSA 4UTTC 3LRMA 3U5YA 1UIOA 3UNTA 3GG1A 4Y9NA 1V0LA 3U8GA 2OFJA 4NX5A 4ZO6A 4HA0A 4GKLA 3K1DA 4QP0A 4JZ5A 2AL1A 1RD5A 2HNEA 5E5CA 4QDPA 3FVMA 3SEPA 2OCZA 2NQLA 5BXPA 2ALDA 3TYUA 1ZQ5A 2EHHA 4O28A 4O53A 4B90A 3CHEA 4O1DA 2Z2UA 4OU1A 3AYRA 2D20A 1QNOA 2VEPA 4DJFA 2ZZ5A 1E6XM 5FF7A 1VHCA 4XZLX 4HK7A 3BGGA 1L6WA 1OFAA 2NQZA 1M01A 1XCWA 4HSOA 2J7BA 3EMCA 5G4EA 3AXHA 4JTEA 5AYIA 4QHRA 3GW3A 3KBVA 4Q8UA 1XR2A 1O5XA 3PB2A 3KBMA 3OLDA 1LRTA 3LZ5A 1VD6A 2G3MA 2VFGA 2WBKA 4HZ8A 2IXVA 5I6SA 1TMLA 2CBIA 1PKNA 3H70A 3RILA 3TFXA 4FIRA 5I79A 4XAYA 4DBUA 2NLIA 4QG6A 3H6OA 3U4FA 2QXWA 4UTTA 1UIPA 4ROPA 2Q3OA 3SDOA 1V6XA 1W9DM 4O16A 3B3DA 4J4KA 1W1ZA 2G8ZA 3WEOA 3GZ3A 4FA3A 1N8FA 1TX0A 4FXRA 4GQQA 3LY0A 4N9CA 2FH8A 3PBGA 1UC4A 1XLBA 4NL1A 4DUXA 3STGA 1Q4WA 2XINA 1UA3A 4O14A 1L6FA 3OG3A 4RDYA 4DHGA 1UOKA 2WHJA 1K6AA 2EJ1A 1JCXA 1TVLA 4HN8A 2PDFA 5I3GA 4AMCA 4O57A 3MSRA 3KTCA 3APTA 1FWJC 1UH4A 4N2YA 3BCDA 2OMAA 1TPC1 4S3EA 1M6JA 3PG8A 2XJ7A 4ZEPA 3HV8A 3L4XA 3PUOA 1WQ5A 5DO8A 1UBSA 1B9ZA 3UJSA 4EAMA 3EX4A 2HS8A 2WKGA 1J12A 1LOLA 3U3HA 3GFXA 4PTDA 5A6BD 1X6UA 4ZO9A 2I5IA 2CZEA 2A3CA 3HPAA 1UKQA 3VIGA 1C8YA 5DT7A 5D37A 3KRBA 1NFPA 3DYPA 6XIAA 2YPIA 1WBJA 4B5SA 5DELA 1TTPA 3SCWA 1XLHA 4DBWA 1FWIC 4JCMA 4CNOA 2D3NA 3J7HA 3LHVA 5E6YA 3W3OA 1TCMA 3NO5A 4UFIA 1WB0A 3U2CA 5KZMA 1SUXA 2EKGA 3M1ZA 3VIIA 1QOPA 4U2ZA 4ATWA 1X6LA 2RUSA 3BOFA 3LQGA 1HJVA 1LTDA 1E3ZA 2QF8A 2X40A 4E2BA 3TR2A 4H7ZA 1RLDA 3ES8A 4BWLA 3SN1A 1NDZA 3VNLA 1UKPA 4ILSA 1UH3A 4J3XA 1W3TA 3S5OA 5BRPA 4DO7A 2ABAA 4KKXA 2B7NA 2DUZA 3NPWA 2FJKA 2PDPA 3PB0A 3ZSSA 4AD0A 3A64A 4P8UA 4UMBA 3I4EA 2QPXA 3GDTA 2FMNA 1RP8A 1Z7AA 3BTNA 4G1NA 2VXNA 2Z1BA 4AIBA 4F3HA 2H90A 2L5HA 1FA2A 3VGGA 5KTLA 3NQBA 3QR0A 3KS5A 1Q66A 2DUAA 1A4LA 4PB5A 1JYNA 3E5BA 3VX0A 3VKKA 4M0XA 3WBYA 5J04A 1K9TA 1VC4A 4UTWC 5EL1A 2V69A 4Q32A 3O6DA 1YTEA 3NQ8A 3ECQA 1PBGA 1X97A 4KPLA 5AECA 2GGHA 4YYFA 1TWWA 1HP5A 3TYEA 3W71A 4HZ6A 2E8ZA 4DWSD 2ACUA 2YDAA 5KSWA 2IKJA 2PDNA 2YJQA 3CS2A 3N2CA 4WX2A 5XIAA 2AGTA 3L68A 1LT8A 4GQGA 1A5SA 1JD7A 3H4GA 3AMCA 2PWDA 1W9PA 3O63A 4QR6A 4NILA 3B04A 3R0UA 3ZVIA 2QW5A 4WOQA 3PANA 3FYYA 3MWCA 3PZNA 3CHCA 1L9WA 1SJAA 2DT2A 1N82A 3NDZA 3R8HA 4D6CA 3RCMA 3SUTA 3BXWA 4E4PA 2FMOA 4PUMA 3OGVA 3H2NA 2P5NA 2CC0A 1JXKA 3VOGA 3W7EA 1VYSX 4D6EA 4NY2A 1GNXA 2Y7GA 3A22A 3IEBA 4OV4A 4HJWA 4HMEA 4MIMA 3KDNA 2Z6JA 4AEOA 2G3FA 3W75A 4ZQMA 5J5RA 4YS1A 4UTWA 5GPRA 1TE6A 2ZRXA 4HPXA 3RO8A 3MI6A 3T0TA 3WLQA 3TMLA 4KESA 4AC7C 4FP1A 1K7XA 3LXCA 4K1GA 1WDRA 1F7BA 1JPDX 1YTKA 5HR6A 3VFLA 4TR9A 5AHIA 4M29A 1GVRA 2I14A 3KLKA 1V7AA 2MNRA 2VVSA 2PDKA 2AAAA 3KBSA 4WXYA 4O1CA 1JI1A 5DMYA 3G0XA 3W1XA 1K9EA 1U5HA 4J40A 1PTAA 2A7RA 2ABBA 4YIWA 1UD2A 1CXKA 1QPQA 2QDEA 3QY6A 3SGUA 4ALDA 1XIMA 3V16A 4FR6A 3B8DA 4WDWA 2OVLA 3KVJA 1S1RA 2ON3A 1L0PA 2XH7A 4LY4A 5HWJA 3OTRA 3MHFA 4AHPA 1ALDA 5EMJA 3GKAA 2OLSA 2NQ5A 1QT1A 4H6KA 3W38A 4AZHA 3PTDA 3GIPA 1X7IA 3S4TA 1W6TA 3MKKA 2P50A 1C3FA 1Y5VA 5D2YA 1TZ9A 4JTGA 4H83A 4HMNA 2G3JA 3AYTA 4Q4MA 3BL3A 1KM2A 2BXZA 3VNMA 4AXNA 3CV7A 3C0JA 3FJLA 3TZFA 3ZT6A 5CKSA 4S3BA 3C8NA 3W2UA 3RPDA 2EAWA 1CGYA 1FH8A 3QFWA 3MMTA 4S3CA 1UZ4A 1NF7A 2CBJA 2VRJA 5BRQA 2VWTA 4QLKA 1AW5A 2Y8KA 4CU7A 1YE6A 5FESA 4S2BA 4NJJA 3PN8A 3DHPA 3OU8A 5A8NA 3VYLA 4NZJA 2G96A 1KFCA 2OYLA 4M56A 2VT0A 1XPGA 1SO5A 4MFDA 4PFMA 1VYPX 5BXRA 4NZFA 2O7SA 4ZA0A 1HF6A 1J0ZA 1O5QA 3G5EA 1K8XA 3BLOA 4MHBA 1HO1A 1E1CB 5GJPA 1GZGA 1TIMA 3JR2A 4TUFA 3ITOA 3I7RA 5HJLA 5U7SA 1RQBA 4IGSA 2FKPA 5E0CA 4X22A 2PWFA 5DFAA 5CPOA 2UY3A 3PVFA 4A6GA 4LT9A 4J3VA 4KBXA 1LLZA 2E9MA 4I8YA 2WANA 1RVKA 4EAYA 2R1LA 4PL2A 3S6DA 3T8LA 4JHZA 4C5YA 4PUWA 1R38A 5A94A 1JCYA 1J6OA 1SFSA 1ADDA 5HUPA 1IGSA 2D22A 3RYSA 1UR8A 4C6FA 4JTFA 1EF3A 1O1HA 2ZUUA 5HQEA 4HD5A 1A50A 2D1ZA 1HIZA 1OYAA 4XBSA 1GPWA 2QQ6A 1NFGA 2GUBA 5AZ0A 3N4EA 7CGTA 1O66A 3TTEA 1YXYA 4IP5A 1OFRA 4HSNA 4Y8FA 3VIOA 5HANA 1QHPA 3GU9A 4IMDA 1KFWA 1DEDA 3GC2A 1KO0A 1YADA 4OUEA 4JKLA 4AY7A 1KKOA 1MSSA 4ORIA 4OOUA 5M1TA 1ONRA 2R1KA 2QAFA 2YCEA 3R43A 4R3UA 1LG2A 4PZVA 1JZ5A 3EEZA 3RR4A 3QPZA 1SJCA 3AHVA 2FYMA 2FTPA 3L5AA 2H8ZA 4ZOCA 1UUQA 1Z32X 1YX1A 2CZVA 3NQ2A 4JKMA 4MYXA 2G37A 4H01A 5E9XA 3ENLA 1I45A 3UERA 3HB9A 5BOOA 1YMYA 2PB1A 3Q65A 4QSFA 4CD8A 1XF0A 3MDWA 3L4VA 2C0HA 1Y7VA 1GVEA 3VK5A 3A4AA 1DJYA 4UBPC 1Q6EA 2KX9A 1J10A 3CHDA 4ZB5A 4MPQA 1AMKA 2PD5A 2E6DA 2DP3A 4AAJA 3OEXA 1XRSA 5CJ5A 3K46A 3BK0A 3ORWA 3MMWA 1L8NA 3VKBA 2W0UA 3MUZ1 3W1UA 4DEFA 4D6JA 2HMCA 4JIPA 4UOZA 4AWSA 1FCVA 3FEQA 1TTQA 4QG8A 4LCSA 2JQXA 4P61A 1HP4A 2E6AA 1POJA 3HA1A 1CGVA 3OJGA 1QUMA 1ODZA 1RSCA 4MUPA 3MPGA 2DQXA 1WCGA 4E3VA 1AL7A 1GCYA 1EGZA 5LNSA 1KV8A 4L56A 4NYYA 4LBSA 3KVLA 3LQLA 5FKYA 3F7JA 5A8QA 4DAIA 1VJSA 2J6XA 3CPUA 4WF7A 1QI3A 1ME7A 1F4HA 4A3QA 1AJZA 5I23A 1XSJA 2J77A 3L4YA 1XCXA 1TELA 4WY0A 3W87A 3TW6A 1JZ2A 3AXKA 3WUGA 1OX5A 1VS1A 3TN3A 4ZSUA 1LORA 3ARSA 3G6MA 4FX6M 4ZB2A 4QNWA 3GNNA 3U0HA 3WQCA 1EXBA 3KOZA 3U2EA 4EACA 1R5YA 4B5NA 1F76A 2Z1WA 1J0KA 3TSMA 3ZS4A 3BSHA 1H09A 1OC5A 3BUVA 4QISA 1Q7ZA 6TAAA 1PIFA 3TDFA 5FEWA 1IF2A 1KBIA 3TQ0A 2Z0IA 1XX1A 2EJAA 4UFKA 1YBQA 1C29A 5EMLA 1HKIA 1DIDA 4LNCA 3ITGA 2GZXA 3BOXA 5I3JA 4YVXA 4D1JA 1CB7B 3DFYA 4FLRA 3MVIA 3P0XA 4DLMA 1XIGA 2E7FA 2PLJA 2F2KA 1GTEA 2YGYA 5G2IA 2HEJA 2E28A 3KL0A 3E0IA 1QW8A 3FIGA 4IGMA 4FF5A 4G5DA 3WELA 3PJXA 1XPYA 1QI4A 4YTQA 2OEMA 3WF0A 1M5WA 3T4CA 2PGWA 3SN0A 3DBNA 4JN6A 3HGJA 3GBEA 3R10A 1XYFA 2CLEA 3SY5A 4EWND 2ZOXA 3N9RA 2VMFA 2AQOA 3XIMA 4UTMA 1N8WA 3I7SA 1AFSA 4MNKA 2PLKA 4K1WA 3M7WA 4GMEA 4PA8A 1H7OA 1F3WA 1S2AA 5A6LA 1SR0A 1YNPA 4I90A 1E3XA 5HMDA 3MUXA 3K8KA 5DMMA 3UJEA 1UMYA 7REQB 4O18A 1UD6A 1XH1A 4FK9A 2NUWA 1A0DA 3AZTA 1EGVA 5HMEA 3PTQA 2IXUA 4US5D 3QMSA 3A4WA 4IJBA 3ZXWA 2WMGA 2WQPA 1W9VA 2WZIA 4Y7EA 2V67A 2W62A 3UYCA 5AYBA 1I9CB 1A80A 3RUBL 1H61A 4UQCA 4H7VA 4BF7A 2C1IA 5DN1A 3VIPA 3EEGA 3NURA 4Q8NA 1B4EA 1JZ8A 4YTRA 4U2YA 3WQGA 3OIXA 3OBEA 4ICCX 3VGBA 3GVVA 4A21A 1SMAA 1UWRA 1QOXA 4XZNX 1VFTA 4DO6A 1W32A 4B9YA 1W8GA 4RE4A 3HIJA 4C7GA 3GKFA 1CXFA 1KQYA 2D69A 5MF5A 1JPHA 1MW3A 1TTJA 4TQTA 4XVEA 3VGDA 3W1RA 4AG0A 4M8UA 1Q85A 1QWKA 4IZGA 2FHCA 1J96A 2YL8A 3O3RA 3WSUA 1EBHA 1EGMA 1UOZA 1WO2A 2ZA3A 3HPSA 4PSRA 1C9WA 1OGBA 4JTDA 3FKRA 3GBDA 2ZYFA 1GJWA 2ZTJA 3FJNA 1XYMA 4MWAC 3LTYA 4B9ZA 1PUDA 4JYDA 4Z2KA 1ELSA 2EEXA 4CU8A 1F05A 5IBXA 3TROA 6PTDA 3PR2A 3LSCA 4LAZA 3CWNA 1GKPA 2CLPA 3A3XA 2BASA 2XVPA 3C2RA 2O0TA 1MEIA 4KT2A 4CCCA 2WWCA 2WMIA 1V3KA 1QBBA 3UZWA 2OWXA 2V38A 3TJLA 4LALA 3H4WA 1FDYA 5E09A 1S3HA 3SIZA 4NXSA 2YOCA 4M51A 4KEZA 4UR8A 3QPYA 4JBRA 3T08A 2VC6A 2PD9A 3C56A 5LA2A 1EC9A 3LU2A 2OQHA 4RZ4A 5JBEA 3ZZ1A 3P7YA 5CCZA 2GVYA 1Z8AA 3UPMA 2PSNA 1E5NA 2BGSA 5A6BA 1XC6A 2NUYA 1H60A 4ZO8A 1P6WA 1UA7A 4L1XA 2VC5A 4O0QA 4AD5A 1D8CA 4IL2A 1GQNA 4P7OA 2QV5A 4LUSB 1XLDA 4OFCA 2DDXA 5EKYA 5I07A 4CVUA 2V5KA 1JDDA 1ZGDA 2X8RA 1JEZA 4LS2A 5K2ZA 3IK2A 1W2VA 5AHLA 3DFQA 1UKSA 2ISDA 1BD0A 3DHDA 1QOQA 1W8SA 4MWAA 4ZVJA 4J3SA 1TV7A 2NUXA 3C2YA 3AXIA 4B92A 4KEMA 4NAEA 3N6JA 3E3HA 1VPXA 2YCLA 2ZXDA 4QDMA 1KWGA 1FXPA 3LZ3A 3D3AA 3NQMA 4L6HA 3AU2A 3L21A 2CHNA 3SRKA 3SB0A 3P6LA 4P8XA 3SCUA 2ESCA 3EYPA 4DNMA 5TNVA 4GVHA 2NXGA 2V81A 3EPMA 3S1UA 4ZODA 1CIUA 1JAKA 5D2TA 5A6KA 4CCEA 1PB0A 2JIWA 1O4UA 4PFHA 3B0YA 1M65A 3C4UA 3NG3A 3TCSA 1PHWA 2PRHA 3MTWA 3OBAA 1HJSA 3ZFHA 5D05A 3UWUA 5BZAA 1LLWA 4NJKA 3W7GA 1A5OC 1XBVA 1Y5WA 1Y5XA 3DI1A 1K03A 2UV8G 3CZEA 1OCQA 1E1EA 1G01A 3OZYA 4UNKA 3NDYA 1JPIA 1TPB1 2ATMA 4H2HA 2PUZA 3W1PA 5LXEA 1HTIA 1V5XA 2PS2A 1M7JA 5GJNA 4OOZA 3JZEA 1SGJA 4CCZA 3N29A 3TR9A 2ZKMX 4PR4A 1T5AA 3WJWA 5FSEC 3QGVA 4NT0A 4C6OA 2ASHA 3PJWA 3O07A 3QKEA 3NVDA 4A29A 1EA9C 1KM3A 4HKPA 3VDGA 3CWOX 5CPSA 4UIOA 1SJDA 3NZRA 4LC6A 4XD5A 2ZRVA 1FOBA 2QMKA 3CTLA 3BWWA 1W3JA 1QRQA 2I5GA 2X7VA 4XZWA 1RJQA 4DWSB 4XD3A 3FA5A 4Y6GA 5KZEA 3B03A 1ZFJA 3NL2A 3WLTA 3G77A 1L8PA 3CH9A 3KL3A 3QGKC 4XKMA 1JF5A 2Z7GA 1VBGA 3QYQA 4BQ5A 5D8ZA 5M3WA 4LWWA 3MI2A 1US2A 1EC7A 4O4WA 4OZOA 1H4PA 2YA1A 3CYJA 3MKVA 3UG8A 4CD7A 3HQ1A 4MF4A 1RK6A 1WUEA 4N6EA 4ATLA 1ISWA 4OECA 3ZLFA 1B90A 3GNXA 3QOKA 1WOBA 4GUIA 1S3TC 4WDXA 3IJQA 4C6LA 1OZMA 1V7YA 1LZOA 1GOXA 3LCLA 2FZNA 4UTLA 3UZYA 3S46A 1CLKA 4B5XA 3G1HA 2A4AA 5CJNA 3RCYA 3QV9A 4JCLA 1W17A 4QCFA 3AYSA 1WZKA 1IWAA 4UTHA 4Q4SA 1TJ2A 4MY8A 4AYSA 4HHPA 3HQPA 1A3WA 3ANYA 1V79A 5FEZA 3WKZA 3PM6A 5I3KA 3VOJA 3UCQA 3ZVHB 4Q7IA 2CWXA 1UD5A 4WKFA 2MANA 5HULA 1B3WA 3C6CA 2ZE3A 2H9AB 5AZ1A 4RE0A 4K8GA 4WD0A 3PWGA 5H8PA 3V0UA 2EG7A 3HO8A 4I6KA 5A6AA 3TCEA 1OFOA 4LV9A 4A3HA 3GH4A 3QH2A 2GJPA 4LX4A 2NQJA 3QPEA 1VEOA 1I0DA 1VLWA 3S0CA 1VFMA 1DWHM 1M68A 4W86A 3UT0A 4YHEA 1MFUA 4EIVA 3ABZA 5JH1A 4RZ5A 1E6ZA 1M7XA 5DANA 3AALA 3OQEA 2H8XA 1JCLA 3W1AA 4FAMA 5CEWA 3RLGA 1CECA 3BV7A 3W7OA 5I03A 3ES7A 2ADAA 3KBJA 3MBFA 4KWWA 4RKAA 4F2BA 4K3ZA 3DGBA 4XQ6A 3MV11 2QCDA 4J3UA 3VPLA 1K4HA 1S46A 1TRDA 1ZSXA 3T2PA 4D6DA 4HHMA 4Z17A 4CNTA 3BAIA 3PTKA 2PTWA 2GJLA 1YW1A 3IIPA 3UY7A 2YDQA 3I7QA 4BCEA 2V82A 4Q4OA 4X63A 4H9VA 1MUCA 1T40A 1QPNA 3W22A 3N19B 1ITUA 3GG0A 4QGCA 3WJSA 4WGXA 2FZMA 4H4IA 5AHEA 3ITYA 1R3WA 1XCFA 2VR2A 2IKIA 2GVGA 4H2CA 3D3FA 2RDUA 4Z1DA 1XQLA 3QJAA 2OKTA 1RXOB 2F38A 1BG4A 3T42A 5C9UA 4GC3A 5CAKA 4N9DA 1P48A 4GYPC 2VC9A 5CC3A 1ZS2A 2VR4A 1E73M 3FXGA 3MC5A 2FPYA 3AIBA 3QR1A 5HPCA 2WKJA 3BLLA 3B9NA 1XLJA 3KVMA 2NX1A 1SO6A 4DYKA 4AVFA 3C86A 1NTHA 3WNOA 1J79A 2D0GA 4GVFA 1T8XA 3ZJ8A 2Y89A 4JTKA 4BFAA 1TREA 4L7ZA 3F5KA 3ARXA 3V1HA 2EBNA 3H54A 3R4IA 2AL2A 4HNOA 1P6CA 2WZEA 4AUBA 1PX8A 2R94A 1G7VA 1XLKA 4NAFB 1IT0A 4AZCA 4GX8A 4S39A 2TYSA 3WFZA 4I5UA 3OVGA 4PMXA 2DZXA 4AX6A 1GOWA 4KGJA 3MP5A 2BOGX 1TPH1 2X7WA 2QDDA 4DBDA 2X05A 3W7KA 3RPTA 5C9WA 1MW1A 2Z2BA 3UA3A 2JE8A 1E9LA 2RAGA 2WJEA 4GG9A 1PIGA 4C90A 4H19A 3WMSA 5FSDC 4ZENA 2Z29A 3DH7A 4GYPA 1H7NA 4I9MA 2O9RA 4CD4A 2FVKA 1Z6KA 3K8MA 1NFBA 5EMKA 3T4WA 4GUJA 3NPVA 1AH3A 4PB4A 3UF9A 1IYXA 4REQA 3LPGA 3ZLGA 5FD0A 4Z1YA 4W5ZA 2J24A 5REQA 1KTBA 4QJ4B 4P7NA 3RU6A 1OT2A 4AZCB 3QZEA 4F48A 1XLEA 3I3DA 2D24A 1KCKA 4JTSA 1L6YA 5A1AA 2E09A 3TXVA 2YL6A 3BMVA 3W7IA 4NRSA 3UR7A 2P10A 4HB7A 5BYWA 1GVIA 2VZUA 3WQFA 2IQTA 4U4MA 5A69A 3OVPA 4UB9A 1GYNA 1P5BA 2I17A 4O54A 3KE0A 2VTFA 9XIAA 3NXLA 3PSVA 4O52A 4Y9AA 3R89A 1N2VA 2FB3A 3PG9A 4MTVA 4V15A 2QCGA 1DIKA 3EBVA 5DLCA 3TQKA 4ZQCA 1WE5A 3UWZA 5G1TA 5REQB 3IJDA 3D5HA 4DJED 1T99A 2QPUA 4IQEA 3W7PA 4RDVA 1UD3A 1C92A 3HU7A 1RP9A 1JG9A 4XIAA 2WCGA 2J66A 4OKDA 5DQPA 5RUBA 5JMUA 3PY2A 1WXZA 4GGHA 5F1UA 3TONA 1MI3A 4OBTA 4UTIA 2HE8A 4EOUA 2Y88A 4HJFA 3O9NA 1Q6QA 1H49A 1XWYA 3P61A 1JD9A 1Z44A 3RM9A 3VDAA 2NQ9A 3ALFA 4Q7BA 4DLFA 3NYZA 3WCZA 1OFBA 3KRZA 2DV0A 4C6NA 3NL6A 5GQBA 1A5NC 3GVQA 4ACZB 2ZUSA 4X9SA 3AIWA 1KW1A 5FAGA 3HG2A 3C0QA 3A5VA 4NU7A 3S1WA 3SCPA 3RG6A 3T0CA 1QNPA 2DW7A 2YZRA 3E49A 1UMLA 5LZLA 1OADA 1QPRA 1PTGA 1REQB 1WKFA 1XIEA 4GI9A 3BLFA 4PMZA 5I0DA 3DI0A 4MNJA 1GVSA 2YW3A 4FOJA 3VDBA 2J7DA 4RCXA 2OZ3A 2NWSA 1TR9A 3L0GA 1Q4NX 4NF7A 5D9PA 4NHVA 5TBOA 3W53A 3NSXA 1CGUA 3KX6A 2Q6ZA 1EO5A 3R13A 3NTYA 1BTMA 3EDEA 5T9CE 1U1UA 4KFPA 3G8RA 3A3HA 2X16A 3GRIA 2HXTA 3KOYA 3ABSA 2WJDA 2CLFA 1DXIA 1EZ2A 3MUCA 1NDWA 5AC8A 4D8AA 3K4WA 3M5YA 3T40A 4U5IA 3WK2A 4QE4A 2QCFA 3KS6A 1KV5A 1WPCA 1JZ4A 2DH2A 1H50A 2YLLA 2NW0A 3CHFA 1W1PA 2CFFA 3IUIA 3NQEA 1H11A 4J35A 2H6RA 1JNDA 2C15A 3T78A 1Q5MA 2VEFA 2XIIA 3SY1A 3PPGA 3MHGA 3T0BA 1GEQA 3W25A 1NSJA 3IVSA 2J47A 5TAOA 1WBHA 1GORA 3CH0A 2EXOA 5JIPA 2VCAA 1RAKA 3MJMA 1X1OA 2PRLA 3NL3A 4M1BA 2ZA2A 1WDQA 3IK4A 5BU6A 2Z7KA 1DORA 4KCTA 5M03A 1JZ7A 1K4GA 1P1XA 3ITLA 1LDCA 5C2XA 1YDVA 2WMJA 1EJTC 2R24A 2VZSA 4IPNB 3FYPA 3FGCA 3B8SA 3NOYA 5I3IA 4A35A 3S3GA 4PMNA 2V5CA 3T81A 3WNLA 3E2RA 1NEYA 3KCLA 4RL3A 4JDBA 1DJIA 3AAMA 2IQ0A 3W37A 1LF1A 4PBEA 1C7SA 1E15A 2ACQA 4DI8A 2C1GA 2QNEA 3U2ZA 5A6TC 3A9BA 1BXBA 1R87A 3KHDA 5KITA 2XVNA 1OX4A 1PZ3A 1JIBA 4PN2A 2DT1A 3N9SA 4S2CA 3NQDA 1G0CA 4AC1X 3K30A 3BARA 2OGJA 3ZWTA 4GBDA 3PZQA 2C6QA 1CENA 4R34A 3B8TA 4KW2A 3GXDA 3GHUA 3KWSA 2WVSA 4H9YA 3NAVA 3VIFA 2PCEA 4IM4A 4PODA 4YVVA 4IP4A 4LPCA 1TV5A 4CGTA 2ZQ0A 5ABHA 2J7HA 1XJBA 1JDFA 5C6MA 3MA8A 3EWXA 3BG9A 1WV2A 3H2AA 2G50A 2AAMA 4PUDA 1VBJA 4GQBA 1B5TA 3NZPA 4LYQA 4H9MA 1DHKA 3KVKA 5IHRA 4I5XA 4IGHA 3FLUA 1F5ZA 2PAJA 5JIWA 4HNTA 2WM1A 1OX4B 4LB3A 4C6PA 1RBAA 4S3JA 4L4OA 5F2MA 3H21A 2WMKA 4FOKA 3AS0A 3PULA 2RDXA 1F74A 2J8FA 3MP3A 3AC0A 2QJMA 5LKYA 2V3FA 3G0UA 4C7DA 1U22A 4PMOA 1DJHA 1I2PA 4ZZ9A 2ISSA 4HP5A 1J2WA 3RDKA 3F03K 1EOKA 2YDRA 4GUHA 5A5WA 1B30A 1H5VA 3TN6A 2PRMA 1BVZA 4J3TA 4B5UA 5EYWA 2PDIA 4XAFA 2JKEA 3GM8A 2QCLA 1GOKA 3S83A 4PL1A 3BAYA 3TP4A 5AN7A 3AHZA 5B7ZA 2HPMA 3NFUA 4AIUA 2DJLA 1SZRA 1VHNA 2YYUA 4M1RA 3DZ1A 4UNIA 4CQAA 1JRBA 1J11A 2W27A 3EWYA 4CNSA 1FQ0A 1OYBA 2WCSA 3GH7A 4ZFCA 4DM2A 2QS8A 1ZU8A 5H91A 3VAVA 4F0KA 4YXGA 1JI2A 3F2BA 2ODOA 7A3HA 4ZOAA 3DFNA 3UJRA 4PTMA 4B2DA 5CSSA 1E6SM 2WMFA 3ZIZA 4JY9A 1DTUA 2INEA 1UWUA 3H2OA 2GGEA 2J27A 3V5OA 1UHVA 2PU0A 4NNBA 3BAKA 1GGOA 3NA8A 1G4SA 4WOZA 2QMJA 4Y2WA 3HGSA 3DFTA 2VVNA 3WLHA 1TPDA 1TZZA 3NNTA 3ZWSA 4NIRA 2OEKA 3H7VA 3H7UA 3O06A 1GT8A 4K2SA 1BKSA 2YB4A 3ANVA 3O15A 4HCLA 4POCA 2DEPA 3PTMA 3CAVA 4Q8QA 1RJPA 1N8IA 1L2UA 4LS0A 4JN7A 2REQB 3M7SA 2E5CA 5C5YA 1YNQA 4NP7A 1FXQA 4M24A 3B0XA 4LFYA 4LVDA 1GOMA 4OV9A 2J9YA 1GONA 4LTSA 4YU1A 1THFD 1JYVA 2P76A 2F6UA 1ICSA 3BO9A 3F4WA 4KRUA 2G4JA 3MS8A 1UB3A 4CNPA 2OG9A 3CL8A 5KMYA 4HOWA 2CW6A 3R94A 1TA3A 1CWYA 3K8LA 3VIMA 5A2BA 4QX4A 1UPPA 3QVQA 3USBA 4CNUA 4Q4QA 1BRLB 4B16A 3W1QA 2XDFA 3IGXA 3VX1A 1E6NA 1V3IA 2PGEA 3TC3A 2QVNA 5FF2A 4F9JA 1NQKA 3WJYA 4XTIA 5HOSA 3WBXA 3GFZA 3ABQA 4H7CA 1F3EA 3TAOA 4HMDA 3G1FA 3AMLA 3AQUA 2WNQA 1X1NA 4L6DA 4EANA 4L65A 4EVZA 2CLMA 4QRNA 2IUZA 2YX0A 3EKGA 1RCQA 1ZB5A 1HGYA 2E1WA 1X7FA 4D1IA 3OIHA 3AIVA 4RX0A 3LLDA 5LNWA 3PUGA 1RQHA 2WBGA 3I6EA 1O7AA 1OQFA 2VRKA 4GACA 5FL0A 5A95A 2QEZA 3QW4B 4A8NA 4LCQA 5D03A 3TK7A 1JYXA 4ZXLA 2RFGA 1JCNA 4GRSA 2ONEA 1MWOA 3IRSA 4IPPA 3WQ6A 1CYGA 2Y5EA 2XSXA 1VIWA 5HQLA 2VENA 2VHLA 4N4QA 3ZR6A 3I4KA 2PZNA 5DEZA 1J93A 4MKNA 1ZALA 4XUYA 4FI4A 4YPJA 3TSBA 1U5VA 4LBUA 3FDGA 1L2QA 4ZQRA 3T55A 1W3IA 4DJDD 5B80A 2QCMA 3N2MA 1Q6CA 9CGTA 2X0SA 4IL0A 5EBAA 3LN3A 2OODA 7TIMA 3WBEA 5A3HA 4AZBA 1S39A 1KFJA 3IV3A 1Q3NA 4HNUA 3HBLA 4MGGA 1MQPA 3GB6A 3AIUA 4FXSA 2WZTA 3WF3A 1XLIA 4WR3A 4YJ5A 1EA0A 4MZYA 4IFOA 1HQTA 4EXQA 3BVJA 5AKQA 3VOIA 5KINA 1V08A 2VGFA 2QIWA 3K4AA 3STPA 5LGZA 4CQDA 2XVLA 1KTNA 4WEVX 8RUCA 2VURA 1IIHA 4IG2B 3H12A 4GYKA 3N3MA 3SURA 2ZRZA 3LBCA 4ML9A 1R3VA 5D2XA 7PTDA 3PFMA 3AS1A 4W7UA 3IARA 4UCGA 3UYIA 3SQSA 5CZTA 2OT1A 2W5FA 3AMGA 2QF7A 3DECA 4NXKA 3G8EA 1KFLA 1K70A 4B15A 1RPKA 1W9XA 1J8VA 1LQAA 3AS2A 1JUBA 4H9ZA 2Q02A 1ZP4A 3DBPA 3EOOA 2PTYA 1CXLA 3V18A 5C8BB 1CXHA 4Q33A 1NDVA 2UBPC 3S1GA 4LYPA 5HMFA 3H55A 3W2LA 1VKFA 4HCDA 2HWGA 4HZMA 3VUPA 1X1ZA 2FQIA 1IWPA 3LCHA 3LBOA 1LJYA 4LF1A 2BNJA 4HOXA 4IX2A 3QLLA 2Z1XA 5CC7A 5JXQA 3WLNA 1NU5A 4DO4A 3I6RA 3LS9A 5BWFA 1J4EA 2PDCA 1BWKA 1QBAA 4PE8A 4JD4A 3AJXA 5E0KA 1BYAA 3CUIA 2NVCA 1MUMA 4HVXA 4JEJA 3MCNA 1CCWB 4EWJA 4HOZA 3MZ2A 1V3LA 3ARZA 3GR4A 4J5NA 3CUXA 3WLJA 2ZCGA 1H7RA 3UP8A 2BOEX 5JBFA 3PZIA 3MW7A 4ZMGA 4HYWA 3N12A 4MDOA 3URQA 2D2OA 2ZADA 2YDSA 3VE9A 1HKMA 1ZBKA 2FH6A 3S2MA 4MKSA 1FCBA 3M0HA 5H6HA 2CXEA 3AIQA 2VCBA 2PURA 3P82A 2J6VA 1PE1A 3ALGA 3AZSA 4MJZA 4QFUA 4TVCA 3QV7A 1W1IE 2VELA 3B40A 3QZ6A 5G1MA 3KW3A 5CXPA 3P5YA 4N6FA 4ADSA 3VNYA 3R0KA 3VGFA 5TD4A 1JF6A 3M5VA 2E0PA 3SJNA 3UXKA 4AYGA 4UQ9A 2POZA 3SSJA 1YPXA 4GCXA 1HKWA 1J18A 4WKHA 3M64A 2OQYA 4LOCA 4IFKA 5CZJA 5EU9A 2JGQA 2WV8A 4R88A 1EX1A 3VM5A 1S38A 2B7OA 4HNNA 4NQ1A 2TMDA 1EUNA 3FA3A 1CGWA 2RKXA 4MFEA 1TWZA 6TIMA 3HOJA 4C1KA 2WPGA 4ERIA 3ZLHA 1PDYA 2DSZA 2QYGA 4DPQA 2F8QA 3GTIA 2E9BA 1XYLA 3SZ8A 3T0DA 4XAPA 3CNYA 5DCBA 5FL1A 4BF9A 4ZQNA 2MUCA 1GHRA 3F5LA 2HBXA 3M0VA 1T8QA 1YRRA 1EEPA 3V0SA 3EOUA 3QEZA 3K1GA 1DJWA 3VOHA 3T09A 4ASTA 3UG4A 1FWGC 1A47A 1ZBVA 4EPEC 5CBIA 1E9IA 1SQ7A 1Z48A 1KRCC 1YNYA 2FDMA 4QXIA 3UY8A 3FK4A 3MO7A 3A12A 1SZNA 4JIIX 3UGRA 2W67A 1OSEA 1JAEA 1YLVA 1PCKA 3KM8A 3N13A 2WW5A 1QW9A 3UW6A 3TYBA 2A6LA 2RGLA 1YYAA 3MT1A 4XTDA 1V6YA 3JUGA 1I1WA 2XIMA 1O12A 1QWGA 1H3GA 5MKGA 1PDZA 2V2CA 3AHTA 1MUWA 3RGTA 4BEUA 2A21A 3VNJA 3GWQA 2CITA 1PL9A 3A5FA 2D3LA 2TPSA 4X60A 4Q8PA 3U6WA 4Y96A 4BF5A 1XD0A 2A5HA 2GQ9A 5LIKX 2QULA 4JTCA 2HQAA 1Z3NA 2PDQA 1MYRA 3TJIA 3TXZA 5BNKA 3M44A 5HJYA 4IP7A 3N2TA 4G6CA 4GOAA 4MDPA 4WSHA 3NWRA 3O6YX 2E5BA 3RIKA 3WFLA 3F2DA 1MRAA 4M5PA 1R7OA 3IJIA 2Q8ZA 1V93A 2I16A 3BQ5A 1IXPA 5E9AA 4LC8A 3BAJA 4QQ3A 4V1YA 4UOQA 2JK2A 2EPHA 1ISZA 1EO7A 2V3DA 3WMCA 1WUFA 2R1NA 2XGBA 3FV9A 2XH2A 1OFQA 4IMEA 3CXOA 4RNJA 1O6IA 4XIMA 4I6VA 3H2CA 4ZOBA 1FWTA 4NI3A 4NUWA 1R2TA 2E4TA 4N4PA 3TC7A 2EQDA 4JIHA 4YCOA 2ZWYA 4NVTA 4P7LA 2UY2A 3KZSA 1W3KA 3WQWA 3LA4A 4PCTA 3NL5A 4NZ1A 5CPNA 1IE7C 3UNDA 3W74A 3NPXA 3PSWA 7XIMA 2J7CA 1NY1A 2OEJA 3ERPA 3V5FA 1ONWA 8XIMA 2VFIA 4JFUA 1RY0A 1GVFA 4AD2A 2CBVA 3L23A 2UZ9A 1HJWA 2J13A 2JEPA 3I10A 3N3TA 4TV6A 3B9AA 4JX4A 4IPJA 4IMGA 2P3ZA 1XW8A 4JTRA 1OJXA 1I6NA 3A47A 2VZOA 4K8HA 1JUEA 3SECA 1EKOA 4GFIA 4S38A 4UFLA 1UR9A 3TSDA 3IWPA 3FNDA 1EHAA 4D6FA 3W6YA 2F61A 1UP3A 2INFA 5AOUA 2ZA1A 3M6DA 2ZUTA 3AXMA 2A79A 1ZJIA 3LRKA 1RPXA 3FDKA 4A22A 3LLXA 4JTQA 2VOMA 3WUEA 3E02A 1HW6A 1GTHA 2V5DA 1B3XA 5FIPA 4FNTA 4BA0A 3C5QA 4Y9PA 2X1IA 2DIKA 3CLMA 1OIFA 2CNCA 4AD4A 1VCFA 2VDIA 3RLHA 1QFEA 3VNIA 1B3VA 3FA4A 1HUVA 3EOEA 4BZYA 4CEUC 1XFBA 1EHNA 2HROA 4ML4A 2EPMX 3U5UA 1S5WA 1A5UA 1WZMA 1JFHA 4RUBA 4Y9OA 1XH0A 2X30A 1RHCA 1X8CA 5A2CA 1E0TA 4I5RA 3W85A 3FW6A 2P0IA 3MJYA 3BZGA 4G7EA 1C90A 3VZXA 3CV2A 1BF2A 3M0IA 4GZIA 5A6SA 5CPQA 3S2NA 2ISFA 1FTXA 3W82A 3S47A 2SFPA 3WLKX 4RE3A 5M17A 3LEPA 1PPIA 3WN6A 1KTCA 4B4HA 4IMCA 3B8IA 1PV8A 3GXTA 4JNZA 1UKOA 1OINA 1KLYA 3LHTA 1EF2A 1ADOA 4G2DA 4AVOA 1AZ2A 3B9DA 2PFHA 1VBRA 1DWFM 1UQZA 4PULA 1R3SA 2TSYA 3A13A 3MB9A 5C70A 1E6RA 3UWYA 3CLWA 1F07A 2C7FA 4QLJA 1KM6A 3GVWA 3M9YA 1ME9A 2YYTA 5BMXA 4LVBA 4I8DA 3QQ1A 4HNLA 2QIIA 2PWEA 1P0BA 3CO4A 5FOOA 5I3HA 4U28A 5EFFA 3WUBA 2D0FA 3RRAA 2WQDA 2ZZ7A 5C2GA 1IEXA 3M4HA 5FJPA 3C52A 1V6UA 4NJGA 4O1BA 1W1VA 4IHCA 1B3ZA 3NYDA 1NDYA 2WHMA 3D0CA 4WZHA 1S1PA 1UP0A 4HN4A 1S2WA 2ZZ6A 3AWOA 4FLSA 3SCVA 2P88A 5C9RA 2WVTA 4IJCA 1QI0A 2WLZA 1OY0A 1P4CA 4QJ3B 1CLVA 3P14A 2R91A 4XZMX 3W86A 1EJWC 1UASA 1V6TA 3DERA 2J9ZA 2W79A 4W8AA 1QNQA 1K9DA 2FLIA 4GIEA 2Y7EA 4W93A 4FZIA 4PMYA 5CGMA 3RMJA 2GDVA 4V33A 1RA0A 5D2VA 1JPKA 5K7JA 3RN6A 3N2OA 2IS7A 3OYZA 3SGZA 4H8HA 3ZR4A 1OEPA 3KHJA 3VOFA 2J4GA 3H2EA 1XDMA 2V30A 1PJ9A 1QR7A 4MJ2A 4IIDA 4MNLA 1WYIA 4HYVA 1DQWA 3JS3A 5K9CA 3ZM8A 1R46A 3GDKA 3PAOA 4W8LA 4KMQA 3B0VC 2ATSA 3QV8A 3HG3A 3EX6A 4Z1CA 4MG4A 2FJUB 3RFAA 1RD6A 3QHOA 1OVDA 2QCCA 2QUVA 1VH7A 4Q8TA 4XG1A 4YNGA 3RCNA 4LYKA 4PUEA 4IIFA 1RH9A 2AKMA 4L80A 2DZVA 1NJJA 2Y63A 4R27A 4WXZA 2YA0A 3UWQA 1YXDA 4GFSA 1KRAC 3BAXA 5I77A 2E9LA 5FCZA 1V0NA 3JRKA 2XIQA 2WNZA 4LVGA 1MQRA 4S3FA 1B57A 3IAPA 4RW5A 3O7UA 5XINA 4JIQA 4YCPA 4H9XA 1DWGM 1PCWA 1XUZA 4OGZA 3AZRA 2G95A 1Q6GA 3MWAA 1GG1A 5DY3A 5IFTA 1W5MA 4DJDC 1J2BA 4AIEA 1DJGA 3Q4DA 2P1FA 3ARUA 3P3BA 3APYA 4PTVA 1UR4A 1NH6A 4JYFA 4JTJA 3NGFA 4MKVA 1E56A 2C91A 4MUZA 3GQYA 3K5XA 5FEPA 3VC6A 1LRQA 1VRDA 5GNZA 2Y70A 1H7PA 3MBDA 3L2LA 2DPEA 2IPWA 4XB3A 3WLMA 1S5VA 2A6NA 2ISVA 4IGNA 4DB7A 3VMOA 3PZTA 3QYSA 4WSKA 3M0JA 1X96A 3KTSA 1IXQA 2FDSA 3RMEA 1NQ6A 1R85A 3GC4A 1FCUA 1M7OA 1W9UA 1CDGA 4TV5A 2QCEA 3AS3A 3WIJA 4N0RA 4Z2HA 3W2NA 3RITA 1WDWA 4LRTA 1JNEA 3K13A 3P62A 3UBPC 4FX7A 1W5NA 4KGLA 4DJDA 4ATDA 1QO2A 1H63A 3P0WA 3RRXA 3TNBA 1IEQA 1XIFA 3BAWA 3T2QA 3AUJA 2VEKA 3WY1A 4CN1A 3BOLA 3TWBA 1M3UA 2CYGA 1XP3A 4ZSTA 4LSBA 1EP3A 4ROQA 1IEWA 1V4YA 2G5WA 4MZ1A 1QK0A 3C2VA 2JF7A 3CBWA 5DCDA 2ZVRA 3VDHA 1OC6A 5AYXA 3CM4A 3CL7A 3N4AA 1DV7A 1XDJA 4HU8A 1YKWA 3W24A 3OO2A 2OYKA 1XRTA 1ZCCA 1X6NA 1HT6A 2BFGA 4R9XA 3TU9A 1XKJA 1Q7QA 4F0MA 2NXHA 5CLWA 4N9EA 3OLIA 4QG9A 3CU2A 3LBMA 3HMJG 2DSUA 3U7BA 2OYMA 4GD0A 2DVTA 3W6MA 3QGAC 1W3HA 5JQ9A 4LXFA 2BVYA 3LENA 4L9XA 1XM3A 4O13A 2NV2A 3G6LA 3UEQA 4GNJA 1HG3A 3O0FA 4NZ5A 1J6PA 5CH9A 3W26A 5DT5A 3KDOA 2X42A 5BRBA 5CZ0A 1TV4A 1RK5A 4E38A 2OO6A 2PLMA 3W7DA 2GJXB 1G7UA 3STFA 5I00A 3W1NA 3W7HA 2XWDA 3OBKA 3AHXA 3CPGA 5LSMA 5I06A 3SUVA 4UNLA 1OBAA 2RDTA 2EG8A 4K36A 3ARPA 3WYZA 2Z00A 3PAJA 1KCXA 2XU2A 4I3GA 3LCWA 4DF1A 1TTIA 3ICJA 3NO1A 1BYBA 1TVPA 3PPCA 4CNNA 3MV01 1UQYA 2GLKA 2VX6A 3L2IA 3DC8A 3LERA 2PMQA 4JY8A 1QHOA 2V6AA 5T9BG 3BJFA 2WSPA 3MMUA 2ISWA 1R6WA 2HV5A 1OCNA 3AIEA 2XN2A 1W54A 5HBFA 2XIOA 3NDOA 1D9EA 2B4GA 4LNYA 4C1NB 1OFPA 5HA7A 1Q7MA 2I9EA 4TVDA 1M04A 2V2HA 1G4EA 1OG0A 4Q6XA 2O9OA 4LAMA 1KCZA 5EY5A 4NI8A 2G3NA 5CLTA 1HKJA 4QJ1A 5K9DA 1W0MA 3OA5A 3UZJA 3GVRA 2QR6A 2WOQA 1E1CA 1ISXA 6ENLA 1AUSL 1R3QA 1UCWA 2I56A 2ZC8A 4RW3A 4QAIA 3W07A 4UFMA 1KM1A 2J8GA 3HQOA 3VINA 5C0QA 3L0NA 4XISA 1FP9A 4LU0A 4GI8A 2PWVA 3S5SA 1IZKA 4IISA 3UFYA 4UTKA 3QSRA 4U3CA 1P0DA 3VVGA 3CAKA 4IIBA 4D6GA 3LMZA 3OLGA 5AYYA 5CZKA 5AY7A 2CLKA 1A0EA 3SRHA 4AD3A 1G69A 5D4YA 1C91A 1W5PA 3F4CA 3IIXA 4YHGA 4LAKA 2JKPA 3INPA 2GL5A 5EGRA 3N04A 1OIMA 1ZENA 2VGIA 3IGHX 1M9HA 3O6CA 3O05A 5I3FA 3KOFA 3W02A 4CN6A 1W1B1 3OHMB 1M1BA 3O16A 3KCOA 4P7RA 5G4HC 1W5OA 3V4BA 3VU2A 2A85A 4UTFA 3GXMA 3PPFA 1RR2A 3MDUA 2VD9A 1RCXB 1O94A 4DUVA 4MVAA 4E4UA 3AROA 1LOSA 3UWWA 5M5DA 3R5EA 5JVLA 1WOAA 5LA0A 1GOQA 3CWHA 3LTPA 1B2YA 1DJXA 3BSGA 1TQJA 4E8DA 1F61A 1K02A 2W91A 5G2HA 2VRQA 3NZ1A 5EMUA 1A53A 1FKXA 3VMNA 1XLMA 1X38A 3BJTA 3BG5A 4HQVA 4E0CA 4ICNA 3DG6A 5DX7A 4AISA 1EX5A 3CMFA 1JCJA 3H23A 4PMRA 3CZ8A 1UUMA 2XN1A 3M0YA 2O9TA 2OR2A 1K9FA 3EOLA 1R86A 1OFEA 3LPFA 2DORA 5C7VA 3RF9A 3S1VA 4XVDA 3W7NA 5HPOA 2GFTA 4OWGA 1OG6A 1KFEA 3G1AA 3TTQA 1SZFA 2Q09A 2FVLA 3WH5A 2D23A 2ZUNA 4V1XA 3JU2A 2FB2A 1TMHA 3NSNA 1Q6LA 2VQTA 1KXQA 4Y9MA 5I78A 1F2JA 1QPOA 1S5TA 4E2DA 4CCDA 4LBRA 1YEYA 4JX5A 1T41A 1CTNA 1UYQA 4H41A 3GR7A 3IJ8A 1R7AA 4TXEA 2X1UA 1KFKA 1R3RA 2ZX8A 3UU0A 3HJEA 5FA5A 3QKZA 4AWUA 1GOIA 5EBUA 2XIJA 2WVUA 1KQZA 1HX0A 1ZJBA 2TAAA 5JUVA 3G1DA 1VYRA 3SIMA 4H8VA 2YR1A 4MNMA 4CLMA 4TMBA 4UFJA 4GGBA 4GABA 1CT5A 1B9BA 3NSMA 2BGQA 2DZWA 2QAPA 4IICA 4PUJA 4Q4PA 4BY3A 3EA1A 3W23A 3VZZA 1C8QA 4AX7A 4OE7A 1OK6A 3NQVA 4WVXA 3ISIX 3JVAA 1MXGA 4B4FA 5CQ1A 3LOTA 3VKCA 1X39A 4WJXA 2VEGA 5AVHA 2Y24A 4HK6A 4U5KA 1PS9A 3QC0A 3LV5A 1XYZA 1MZHA 4X9YA 1LCOA 5F7UA 1DJZA 1GUVA 2INZA 2WSRA 4M7SA 3NCOA 1JULA 1UD4A 4Q8OA 4MY9A 1R8LA 4NNAA 1NVMA 3A3WA 4UR9A 5D09A 4RNFA 3DIPA 1G6CA 2VFEA 4KCVA 2YCIX 3V5CA 4J27A 1U1JA 3HM7A 1WZLA 3E2VA 1A0CA 5BROA 1YPIA 3TA6A 5ABFB 3XINA 1OM0A 1E4LA 1V02E 2V5LA 2GK1A 3VABA 1KM5A 3E0FA 1K77A 3TJXA 2WHLA 3UQNA 4AEFA 2PWHA 1KXTA 1BHGA 3ID7A 1FKWA 1VP5A 2V5JA 3LGGA 3PNZA 4C6KA 5A8GA 3WQOA 1ZCOA