1CNVA

Crystal structure of concanavalin b at 1.65 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
283
structure length
283
Chain Sequence
DISSTEIAVYWGQREDGLLRDTCKTNNYKIVFISFLDKFGCEIRKPELELEGVCGPSVGNPCSFLESQIKECQRMGVKVFLALGGPKGTYSACSADYAKDLAEYLHTYFLSERREGPLGKVALDGIHFDIQKPVDELNWDNLLEELYQIKDVYQSTFLLSAAPGCLSPDEYLDNAIQTRHFDYIFVRFYNDRSCQYSTGNIQRIRNAWLSWTKSVYPRDKNLFLELPASQATAPGGGYIPPSALIGQVLPYLPDLQTRYAGIALWNRQADKETGYSTNIIRYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of concanavalin B at 1.65 A resolution. An "inactivated" chitinase from seeds of Canavalia ensiformis.
pubmed doi rcsb
molecule tags Seed protein
molecule keywords CONCANAVALIN B
total genus 93
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 1995-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cnvA00
5HDRA 5HNNA 5EFFA 2WHLA 4FLOA 3MU7A 2EPNA 4UNIA 2VI0A 5ABFB 2C0HA 3WFZA 3SCNA 4DUWA 1MW1A 1ZBWA 3OIHA 3AS3A 2WMHA 2EPOA 3G6LA 5M5DA 3W6LA 4D6FA 5AC4A 1E1EA 3QOKA 4UQCA 1ISVA 1UZ1A 3WUGA 4CU6A 1M01A 2QMKA 4E2OA 3SCSA 2DQXA 4QCFA 1DP0A 3ZR5A 3HU7A 3RDKA 5AC5A 4UR9A 1H2JA 5AYBA 3L2LA 4J3XA 1QOXA 4PRWA 1RPKA 3CO4A 3UCQA 3I3BA 2BY1A 3T0AA 4EANA 4GI9A 3UG5A 3VIHA 1IZKA 1UD2A 1Q6DA 2UY3A 3AFBA 4WKAA 3AZTA 1E9LA 3WQWA 3AOFA 1J0ZA 3GXMA 2VR4A 2WLYA 2BHZA 2V3DA 3T2QA 1DWFM 3T0BA 1GQKA 1JAEA 2DSWA 3KZSA 1UG6A 4IM4A 2ZXDA 3AROA 1KXQA 1HL9A 2HISA 1QI4A 1W2PA 2OWCA 1BFNA 3WN6A 2WXDM 4LGXA 3B9EA 4CD4A 1UQZA 4FLRA 4M80A 4B15A 4HU8A 1JDCA 2QPSA 1XHGA 2DIJA 2ZE0A 4B3LA 4HTYA 4AIOA 3CZJA 1ITCA 3UESA 3PZOA 1JFHA 1GORA 1HN1A 1GPFA 3UR8A 1HF6A 3NJ3A 5BXSA 1HVXA 2D24A 1NARA 1KBBA 2J77A 5D8WA 1JZ2A 2DSZA 1B31A 1QBBA 4P7QA 4PN2A 2ZUUA 1JG9A 2WK2A 2GJPA 3WDIA 1G0CA 4ZFMA 1KCLA 1W9VA 1VEMA 2YJQA 3GBEA 4F79A 2ZX5A 1MQQA 3DHPA 3W28A 1TUXA 4D71A 4E8DA 2CXGA 4MAZA 2WPGA 1KR0A 3AICA 4JFTA 2WZEA 2YL6A 4OUEA 2WMJA 5CGMA 4ATWA 4UZUA 1V3KA 3AHZA 4C7GA 2QV4A 1E0WA 4HA4A 2BV9A 1JZ6A 2B31A 2ESCA 2QLYA 1JI2A 4AD4A 4CVWA 2GJRA 2JEQA 3VKKA 3ARUA 1NOUA 1JZ5A 4PSPA 4KRUA 4H7VA 1GQIA 3VGBA 3ECQA 1SR0A 2A3EA 3KL3A 4IPLA 4KH2A 1R87A 5EMYA 5JUVA 5JIPA 3MSGA 1GOWA 1W1YA 2WCGA 1RP9A 1VAHA 4AMCA 5E0FA 1RD6A 1M04A 3SUSA 2AOSA 4D72A 2V5DA 4R27A 4AZIA 3AI0A 1HJUA 3AIUA 4D6CA 5AYIA 3AMCA 1XCXA 3AS1A 3ZT7A 1EQPA 2PWDA 3NDZA 3BMWA 3ZSTA 1KGXA 4GPNA 5A95A 2DSVA 5LYRA 1V3MA 1XH2A 4JFSA 1QW8A 2DDXA 1KWGA 4JAWA 3QHNA 2VT0A 3THDA 4EKJA 3VD4A 5DT7A 4U5IA 4UFKA 1TCMA 3ARVA 5DEZA 1NOWA 4GKLA 2G4FA 1C8YA 4P7NA 4F9JA 1BGAA 4OJYA 1EA9C 1PX3A 1UR9A 3VOCA 1QI5A 5I79A 4QFUA 2XVPA 4OOZA 4CD6A 1CGTA 4MDOA 1SMAA 1LG2A 2E9LA 1PIFA 1HJXA 4HZ6A 2E9BA 4UZSA 3PZMA 1ZB5A 1V3IA 3M46A 4C7FA 3AIQA 2A3CA 1ESWA 1WDSA 4PMNA 3PZGA 3OLGA 3CHFA 1WZAA 1TA3B 1CXEA 3WH6A 1X1NA 1UR8A 1QNSA 9CGTA 2GUYA 3BCFA 5CG0A 4N0RA 2VCBA 2YL8A 4OKDA 1LWHA 3AIRA 1JZ3A 2G3MA 4X0VA 1ZJAA 1E71M 1BF2A 1FH7A 2GJXA 3GXIA 2BHYA 5I23A 5M03A 4DWSA 4AY1A 4JL2A 2BXYA 1JGIA 1NWUA 5GPRA 3VU2A 1V6WA 1EGZA 1GCYA 2CPUA 4PSRA 2XIIA 3PZTA 1CPUA 3IAPA 1OGBA 3WQVA 1GOKA 4TTUA 4PMOA 4AW7A 4BQ3A 3WQ5A 3A47A 4UFLA 1ODUA 4KWUA 3PTMA 4GZIA 5LA1A 1MYRA 3TTOA 1E3XA 1KXHA 5DF0A 4XZWA 1H5VA 1OBAA 1CECA 1GONA 5IDIA 2WW5A 3CZKA 1UWTA 2VRJA 4IUGA 3WNPA 5CXPA 1ITXA 1NWRA 1H1NA 2VOTA 3ZSSA 4JHZA 3OGSA 1GVIA 1HXJA 2CYGA 4ACYA 4AEEA 2GSJA 5E0CA 2FGZA 4CGTA 2YL9A 5FD0A 3U7BA 3ZM8A 5A6BA 4B16A 1UD3A 3W25A 5CSUA 3G6MA 3EDKA 4YN5A 1FHDA 4HOZA 4MJ4A 1HP5A 3VD5A 4CU7A 1Z32X 1AQ0A 2E8ZA 1S46A 1W3JA 5CQ1A 5D9NA 2NT1A 3ZIZA 3VD9A 1VFOA 1UD5A 1X6LA 1JDDA 3AMKA 5GNZA 2J47A 2ZXAA 3TP4A 3ZJKA 1AVAA 5E09A 1QI2A 3CHEA 1U33A 1OD8A 1ECEA 1U30A 1FA2A 1B90A 2V3EA 4AXNA 2J8FA 1V3HA 3II1A 4W87A 4QP0A 2WMFA 1UWUA 2G8ZA 1KXTA 4JCMA 1WAWA 3PZUA 1KWKA 1J11A 3SURA 2XVNA 4M82A 5LA2A 3UR7A 4IPNB 4J3UA 4L4OA 4F9DA 4W8LA 3K4AA 1J18A 5CZKA 2WSKA 1QW9A 2EBNA 3MKKA 1FH9A 3WNOA 1Q6CA 1ZBKA 5BXPA 3PBGA 3SCPA 1E6NA 1E56A 1VEOA 4CD8A 2VTFA 3CBWA 1HT6A 1MFUA 1OD0A 1MVYA 5ABGA 4TTGA 4M24A 2Y4SA 3L4TA 1L0PA 2VJXA 4W8BA 1EIBA 3BAWA 1DWJM 2ZX8A 3POHA 3VIGA 4AYSA 1GHRA 5I6SA 2GVYA 1DWIM 2J25A 3VIFA 2IXVA 2YBTA 3UERA 4P8XA 5HBFA 4TVUA 1M03A 1DWAM 1J0IA 4EE9A 1UR2A 1BYCA 1CLVA 3KL0A 5C70A 2E4TA 4MJ2A 1W1TA 2XVLA 1ISWA 1QI0A 2A3BA 1V02E 2CNCA 1K9EA 3RIKA 3OZOA 3T2OA 2ZWYA 4MPKA 3W38A 2BNJA 3T2PA 2E40A 4DWSC 1CGWA 4LYRA 5GQBA 4HP5A 4PMUA 5ECUA 3VD7A 4PMVA 3WDHA 1H09A 2O9TA 1VEPA 2Y24A 2DGAA 1UWQA 3K46A 2ZICA 2BY2A 4HOXA 1E6XM 5FL0A 4GXPA 2D2OA 1UKSA 1H3GA 4TX8A 4QAWA 1QNRA 5EBAA 3MUAA 2W61A 1R7AA 3FXYA 4XX6A 1JZ4A 1WPCA 3L4ZA 5E6ZA 1CIUA 2Y8KA 5C8BB 4GZEA 5IXEA 1XSIA 1NWTA 2VUYA 1GNXA 4W86A 2WAGA 3CIVA 3WD0A 2XFRA 1HIZA 4OZOA 3APGA 1NOFA 4A4AA 2J74A 3RO8A 4D6DA 2WVSA 1WDRA 3AZRA 3J7HA 2Y5EA 2YIHA 4GQRA 4MNKA 3IJ8A 1GVYA 2VO5A 3GXFA 3WEZA 4W7VA 1ISZA 1CGUA 3BCDA 2EPKX 3ZT6A 2FHBA 3VDBA 2Q8XA 1R85A 2OSYA 2WC3A 1FP8A 2BHUA 1CTNA 3BGAA 1SMDA 3SUUA 2CETA 3DYPA 3AHVA 1I1XA 1E15A 2J7FA 3WEMA 5DFAA 4QLKA 3WD2A 3ARSA 8A3HA 1N82A 2FGLA 2XGIA 2WMIA 3AS2A 3A6OA 1UHVA 4JIEA 1J12A 1BG9A 3KEHA 1RH9A 4ATDA 2VQUA 1HL8A 3CHCA 1PPIA 2ZXBA 4PMQA 2WCAA 3LPFA 3T09A 3DYMA 3ZJ7A 1JL8A 3WKZA 4WKHA 4MNMA 4H8HA 2W4XA 1O6IA 3IANA 4M29A 5BROA 2WHJA 3WQ4A 4RL3A 2BFGA 4Z2GA 2X8RA 1W1PA 5BWFA 1UH3A 1HX0A 1VIWA 2DEPA 4GINA 3HJEA 1UKOA 4KGJA 4AZ5A 1NWSA 5DMYA 2QHAA 1DEDA 3MUZ1 1A3HA 1JAKA 1XSJA 4W5UA 3RILA 3CUGA 3ZR6A 2BXZA 2G3IA 3ZMRA 3AIBA 4Q22A 2WBKA 4XZBA 4HMDA 1W2VA 2WVVB 1OGGA 1ZS2A 5IFPA 2JIEA 2X0YA 3CPUA 3A3HA 5BCAA 3AHTA 3GNPA 1GQJA 3EDFA 1HKKA 3BC9A 4W85A 1W1VA 1WDQA 4YHGA 4AZGA 1US2A 3VX0A 2J7EA 1CYGA 4JHOA 2J7CA 3VO0A 3AISA 3WENA 3K8MA 4GI6A 4M81A 5D9OA 4C7DA 4K68A 1MWOA 3U5UA 3EBVA 4BA0A 5A8MA 1UUQA 1PEZA 4CCDA 4JZ5A 1JDAA 2DPEA 3GM8A 3BH4A 1UKQA 2PBGA 4LX4A 3NDYA 1F4AA 1WP6A 3NSNA 4PMXA 1J0HA 3AYRA 2PWFA 2FH8A 5IHRA 2CKSA 3FY1A 4D6GA 1V6UA 4J3SA 4J28A 1J0KA 1QNPA 3WMBA 3ZOAA 2XG9A 1W9DM 3ALFA 3BSGA 3AMDA 2W67A 1H41A 3CUFA 2OWXA 4M56A 3OZPA 2XYLA 5A2BA 3OB8A 2WSPA 1GOIA 3UG4A 2J4GA 2WWDA 1B3ZA 1B0IA 3ARWA 3CZEA 2JE8A 3WH8A 4U3AA 2OYKA 3WF4A 4AD5A 1JI1A 2CBJA 1K9TA 2YDQA 3WL0A 2D22A 3W81A 1MXDA 4W5ZA 1W9BM 4PMDA 3WDPP 4P8UA 1LL7A 4PCTA 2JEPA 2O9PA 1TE1A 2A3AA 2XJ7A 2YOCA 4ACZA 3SIMA 3VUPA 4WKFA 4AWEA 2VVNA 3TONA 1LL4A 1JF6A 5I2UA 2D1ZA 1HKMA 2GK1A 3W0KA 2XM2A 6CGTA 2CBVA 1BHGA 1C93A 2TAAA 2DT2A 3WDQA 2PB1A 4UQBA 1VENA 3NUKA 4AISA 3FW6A 1UD4A 1CNVA 3W4RA 1FFRA 2VC9A 1TR1A 4Z2LA 1VF8A 2X05A 1CGVA 2VMFA 5JIWA 3L4YA 1AMYA 3SCTA 1E6RA 3ARRA 2WANA 3NSMA 4AZCB 3W53A 1QVBA 2X1IA 3WD3A 1BLIA 3CMJA 1DWGM 1UWIA 4GO8A 5A6AA 2WVUA 1E1FA 1UQYA 5HOSA 4YHEA 1P6WA 2WKLA 1MXGA 1NH6A 4EK7A 5CJ5A 1C7TA 3L4VA 2V3GA 4CCCA 3PTQA 8CGTA 1C8XA 3WNKA 3BAYA 1H49A 1Q6EA 4J3WA 1C92A 2CCRA 4CN4A 3AXXA 1CXKA 4V28A 3DYOA 1MQPA 1EDTA 3MO4A 2WM0A 3DECA 5ABFA 3ALGA 1BAGA 3IJ7A 3AIVA 3ARTA 3SEPA 1KCKA 2PC8A 3WH7A 3VGHA 3F5JA 3N17A 3VIKA 1B3XA 1OT2A 1BG4A 4RE2A 3VIMA 1H0IA 4AD3A 1R86A 1UR4A 1TMQA 3DHUA 4QDMA 1JNDA 4UQ9A 4URIA 5AY7A 1GQLA 1R7OA 1GOOA 2JF7A 3ARXA 4AIUA 1EH9A 3UEQA 3AS0A 3AZSA 4U33A 3VNZA 2NSXA 4LYQA 2YL5A 4XUYA 1E4NA 3F5KA 3AHYA 3WF2A 1JYNA 3OGRA 3CMGA 4OBSA 3GYCA 1E70M 4AZ6A 5LA0A 1HVQA 3MV01 1A47A 4JFVA 3WD4A 4PTMA 3UETA 4Z2KA 4KMQA 3ZO9A 3WNNA 2XVKA 1JXJA 2DSUA 2D0GA 4AD2A 2XWDA 5I78A 4D1IA 3WH5A 2CHNA 1E0XA 3FNDA 1BPLB 3L4UA 1JYWA 3WQ6A 1KXVA 3FHAA 3W6MA 4E8CA 5A6LA 1ISXA 3O2LA 1KFWA 2CEQA 4HPHA 2PWGA 2BVTA 3CUHA 4OIFA 4TOQA 4U31A 2QMJA 4CN1A 2W62A 3RPMA 5JBDA 4UQEA 2D3NA 1HNYA 2YA0A 3TOPA 1B3VA 1XH0A 1OB0A 1V6VA 3MUIA 1C8QA 3VMNA 3CGTA 2CBIA 2YLLA 1JYXA 3VPLA 3VILA 1JFXA 4D1JA 3CZGA 5A8PA 3I3EA 3AQUA 5FKYA 4WSKA 1XYFA 5ABHA 3D5HA 4H8VA 3N04A 1TVNA 2A3HA 1J9YA 3OA5A 3RJXA 2X2YA 2XSBA 3U7VA 4WF7A 3ARZA 2EJ1A 5DO8A 4XV0A 4PTWA 3VTRA 4FK9A 2GK1B 4AIEA 1GW1A 4AD1A 2UY5A 2UY4A 2D3LA 4FLSA 4PTXA 4GIAA 5BRPA 2J7HA 2WMIB 5FCZA 4FMVA 4HZ8A 2WVVA 1LJYA 3EMCA 3S2CA 3VX1A 1LG1A 4NF7A 3PTKA 3AXIA 3FAWA 5E6YA 5CLWA 4U2YA 1H0GA 1VBRA 1FP9A 1E40A 3THCA 1EDGA 3EDJA 1V0KA 1JD9A 3BLPX 3HN3A 1HJWA 5E70A 3O9NA 3WELA 1WB0A 2BVDA 1NM9A 4AZHA 4IISA 1KB3A 3VGEA 2IUZA 5A8NA 3A4WA 3FN9A 1WO2A 4TVDA 4D6JA 3TTYA 4CCEA 3CZLA 4ATLA 1U2YA 2UY2A 3AHXA 1VJSA 3RJYA 1LF1A 5A2CA 2WHMA 1ZU8A 2DH3A 4PCSA 3L4WA 3MMUA 1M53A 1OCQA 1XV8A 1Q4NX 2J7BA 3MUY1 4WSJA 2D20A 3ARPA 4CU8A 5D9PA 3WEOA 3GH4A 3GH7A 3GH5A 3WNLA 5HPOA 1HKIA 3K1DA 1EQCA 1UD6A 4KRTA 3WFLA 5A94A 4S3KA 4MADA 4Q7NA 3LPOA 2XSAA 3LPPA 3SCWA 2OYMA 1VFUA 2X0HA 1GJWA 3BAJA 4PBGA 5BXRA 1DTUA 1W9PA 4MB4A 3WSUA 4CD5A 1MQRA 1CXHA 3RM9A 1W3LA 2ZUTA 1OINA 2XFFA 5D4YA 2GFTA 2WYSA 3PZNA 1V3JA 1CEOA 3WUFA 1PX4A 2W91A 2WWCA 4H2CA 3UG3A 1AQMA 1V6YA 2VX6A 4MNLA 4AEFA 4OBRA 5A8QA 4DWSD 3EDEA 4W7WA 1XGZA 1D2KA 2WC4A 2VQTA 2V5CA 1NP0A 1QHOA 4KGLA 4LPCA 3VNYA 1V0NA 1CDGA 4JFUA 3WBAA 3NSXA 4W93A 2YA2A 1UWRA 2F8QA 3WMSA 3BSHA 3VM5A 4CKQA 2PWHA 2W5FA 3VIIA 4DM2A 3F5LA 1EDQA 4LYPA 4QLJA 5IFTA 3BLKA 2Z1SA 2IXUA 2XIBA 1MW3A 1WNOA 4JKKA 4D6HA 3W26A 3SUWA 4CUCA 5JBEA 4HOWA 2XFYA 1NP2A 3NIYA 4OOUA 3GBDA 4NI3A 1D3CA 2Y2WA 3EYPA 4MTVA 4DM1A 1XH1A 5BYWA 1V6XA 3PZ9A 3W82A 3FHQA 2G3JA 2YBUA 1V0MA 2WZHA 5IHSA 1KGUA 3S6TA 3QR3A 1X6NA 2HVMA 4N42A 1K6AA 2V3FA 1W3HA 1C90A 2ZUWA 1RP8A 1LLOA 2QF8A 1V08A 2JFEX 2VX4A 5BXTA 2PBOA 1H11A 3OLEA 2VL4A 3F4VA 3SCVA 1KGWA 3WF0A 1YQ2A 4UOZA 1BYAA 4V2XA 2J7DA 1QHZA 5A8OA 1CXLA 1E3ZA 3PZIA 2FDMA 1C7SA 1WDPA 1TVPA 2FHCA 1E4IA 2O9RA 3GNRA 1CGXA 3PZQA 2WMGA 1KBKA 2F61A 3WUEA 1OIMA 4RE4A 4S3JA 3K8LA 1OT1A 1PZ3A 1BTCA 5C71A 3WUBA 3A4XA 4D6EA 1VFMA 3B9AA 4GQQA 7CGTA 1QNQA 1IV8A 1R8LA 2F2HA 1VFFA 4WK9A 3ZQ9A 2CERA 2XHYA 5EB8A 1F4HA 4BQ5A 5I0DA 1HP4A 1UKPA 2FHFA 3NYDA 3HMCA 2QPUA 4BQ2A 1GOQA 1O7AA 4ZXOA 3T0DA 2GJXB 5A3HA 2ZIDA 3VVGA 3VMOA 1BYBA 4ZE5A 3VD3A 3QHOA 3SCUA 3PN8A 3WDRA 1MW2A 4U5KA 3OLIA 1DHKA 3O6AA 1UA3A 2WVTA 2VX7A 4PUEA 2OWWA 1G5AA 3NCOA 2ZXQA 3KE0A 3M07A 3FAXA 4H41A 1WZMA 1L8NA 4UTFA 3DC0A 3WBEA 3U5YA 4P8VA 4NSBA 7TAAA 1W9XA 3M7SA 4NZCA 2PI6A 4ZENA 2PWEA 6TAAA 3VDCA 4U3CA 3WL1A 1PJ9A 2C8NA 3BAKA 2WMKA 5CPSA 3E1F1 3L2MA 1UYQA 4X0NA 3RCNA 4WLCA 3A4AA 2JALA 1M7XA 1W91A 3ZJ6A 1EHAA 5CPQA 3GNOA 1HJSA 4AZCA 2J79A 2J75A 2OSXA 4ZE4A 4X9YA 2MANA 5M17A 1XCWA 2XUCA 4LXFA 1VB9A 1JNEA 1LL6A 1BSIA 5JBFA 2GDUA 3RMEA 5A69A 1E6SM 2D0FA 2WHKA 1OGSA 4MB3A 4AZ7A 1UA7A 3CTTA 3N18A 2E3ZA 3ZT5A 4Z2IA 4DUXA 3TTQA 3VDHA 5ABEA 1GHSA 3VINA 1E5JA 2WB5A 5D8ZA 1GOMA 4V27A 2WCSA 1HJQA 3VGGA 5HPCA 4JKLA 1E6QM 1US3A 5M3WA 4HZ7A 2W92A 1ZJBA 3CUIA 2BVYA 2YDRA 2OSWA 4MB5A 2VRKA 4ACZB 3BXWA 2ZUNA 1LQ0A 2VRQA 5CLTA 3WF1A 1XSKA 2JF6A 3IJ9A 5CGTA 5TD4A 5I3DA 1CLXA 1BVNP 4P7RA 1E55A 2EXOA 1W9UA 5A1AA 2VVSA 3N12A 3AIEA 4AC1X 4UQAA 4WIWA 1MW0A 2GDVA 5EFDA 1XD1A 3QHMA 4JKMA 2W63A 2YLAA 3IAQA 2G3NA 4LQ1A 3ARYA 1C91A 1QHPA 2X09A 3MMDA 3AMGA 2DIEA 1LWJA 4NRSA 1TZ7A 1AQHA 1BVZA 2V38A 3I3DA 4AZBA 4Y7EA 1JZ8A 4P7OA 1UR1A 2EO7A 1JYVA 3GTNA 4B9YA 2CIPA 3M6DA 4P8WA 1ISYA 1DWHM 1BYDA 3WDJA 4GO9A 2BY3A 2WBGA 1CZ1A 5GNYA 1PX8A 2VNCA 1E5NA 4TX6A 3AJ7A 1ZBCA 1HJVA 5HXMA 4CVUA 2CESA 2WKGA 3GDBA 3IK2A 1W32A 1KQZA 1GUVA 2ZX6A 1XYZA 1E4MM 1VRXA 2J8GA 2VZOA 2XVGA 5A6KA 2BY0A 3MANA 3AXHA 4XB3A 4TUFA 1Q6GA 3K4DA 2XWEA 3EDDA 3BAIA 3W29A 4GI8A 4J27A 1WCGA 3AMLA 2G41A 3KWXA 2AAAA 2XM1A 3OGVA 4HU0A 2NW0A 5BRQA 2NT0A 1E73M 4PYSA 5A6BD 3W24A 4TVCA 3N15A 5A6SA 4GZJA 4P7LA 1CWYA 3N1AA 1XRVA 3RM4A 3ZJ8A 3B8SA 3D3AA 4F8XA 1OSEA 1TFVA 2XGBA 1TA3A 1JD7A 1WZKA 4J3TA 4HMCA 2E9MA 5GNXA 3WD1A 4DUVA 4D6IA 3W37A 3N13A 4B3KA 4R5EA 1XC6A 2RGMA 1Y7VA 3VDAA 1WE5A 3BAXA 1K9DA 2YA1A 3SCRA 4MNJA 4HA1A 4J7RA 1K9FA 2ZUSA 1I1WA 4Z2HA 4MDPA 5KZ6A 1BQCA 4TXEA 1EO5A 3MS8A 3CUJA 7A3HA 1IZJA 4HMEA 5D9MA 3K8KA 2ZOXA 5A2AA 1J10A 1WKYA 3JUGA 1YHTA 1GJUA 1ODZA 2VZSA 1G1YA 2Y8VA 3SUTA 3EMZA 1E43A 4AD0A 5KEZA 2J7GA 1WZLA 1ZBVA 2O92A 1D7FA 3MSDA 1JXKA 1EOMA 4HPGA 3OG2A 1UOKA 3LPGA 2VZVA 2AMGA 2VX5A 2CBUA 3PHAA 2C7FA 2DT0A 2O9OA 3VIOA 1EOKA 4MB1A 4W84A 2VCAA 2EPMX 3L4XA 4W89A 4UQDA 4WJXA 4JL1A 3T08A 1HKJA 4QLLA 3W27A 2D23A 2EPLX 2UWFA 1H4PA 1B9ZA 3CHDA 1QPKA 1V02A 3OBAA 4MAVA 1JF5A 1Q6FA 4J3VA 2E8YA 1J01A 3VIJA 1MFVA 1XD0A 4BZYA 1CXIA 1OWQA 2OYLA 4UFHA 1PBGA 3WY1A 2XTKA 2YDSA 3AYSA 1FOBA 4M8UA 4UOJA 2EQDA 2WC7A 2WLZA 1JIBA 2YKKA 4W7UA 4PUDA 2BS9A 1EHNA 3OLDA 4E4PA 2W66A 3WH9A 2ZX9A 2ZUVA 1QNOA 3VIPA 1VBUA 1CGYA 1G94A 2VURA 3ARQA 3QOMA 1UH4A 2OLHA 4JFWA 1TG7A 4QCEA 1V0LA 5DT5A 2CHOA 2DSKA 4BF7A 2RGLA 4UFJA 2EEXA 1CENA 1EO7A 1UWSA 1I75A 2FH6A 1B2YA 4UOQA 2Z1KA 3GXDA 2J62A 5A6JA 1E6PA 4H8UA 3SUVA 1G9HA 5FIPA 1UKTA 1E72M 2XPKA 4CD7A 2VCCA 1BGGA 1ZL1A 1FFQA 4UCFA 1FH8A 1QBAA 5A6MA 4BS0A 2ZX7A 3POCA 1J0YA 1KQYA 4A3YA 1EXPA 3AIWA 4BCEA 2E0PA 2J78A 1NQ6A 2PF0A 3VGDA 1PIGA 4ML4A 1SFSA 1B30A 1UH2A 5FL1A 4RE3A 2CITA 1VJZA 3SCQA 5FOOA 4PMZA 2D0HA 3TA9A 4FF5A 4PMRA 4UFMA 1UR0A 2DT3A 3U57A 3LMYA 3VGFA 4Z2JA 1GZJA 2JIWA 1CXFA 1OIFA 4B9ZA 1E6ZA 4YPJA 1E4LA 1UD8A 2ZWZA 4W88A 3MMWA 4UFIA 4W8AA 3VM7A 4A3HA 4L4PA 3RM8A 2VZTA 3EMQA 4NRRA 4JCLA 3MV11 4ZXLA 1W3KA 1QI3A 3KL5A 3SCOA 4DWSB 3BMVA 4U2ZA 4H04A 4PMYA 1OM0A 3GZAA 3N11A 1B3YA 3CZ8A 5E9AA 3CH9A 1SYTA 3WF3A 3B9DA 4CN6A 5CSYA 2VZUA 4M1RA 4HA3A 3PZVA 1CBGA 5F7UA 3WNMA 1KR1A 4PEEA 3WMCA 1PZ2A 4F66A 3QGVA 5I5RA 5I77A 1C3FA 1FHLA 2WNWA 2DT1A 3CLWA 1B3WA 3TTSA 5I24A 1PAMA 5CPTA 2VR5A 4FLQA 4ZEPA 1B1YA 1E0VA 3WIJA 1J0JA 2WZIA 4EAMA 3N9KA 2CKRA 4BQ4A 3VMPA 4PTVA 3WQ8A 1JZ7A 6A3HA 1V3LA 2DH2A 1IT0A 2ZUMA 1V03A 1G01A 1UZ4A
chains in the Genus database with same CATH superfamily
3T4WA 3DG6A 4A6GA 3SCNA 5EMUA 1QXLA 2DUZA 4OE7A 3OIHA 2VP8A 3CV1A 4K6AA 4CNUA 1XYCA 2EPOA 4GE8A 1Q3NA 4RUBA 2QPXA 4JD4A 4M51A 4H6RA 4CU6A 1M01A 2P88A 4Y96A 3QY8A 2XFWA 2ISSA 5AHEA 4EP8C 3MQTA 4LCQA 5AYBA 1QOXA 5D2VA 2HPIA 4HN4A 3OVPA 3PAJA 3VIHA 3GDKA 1UD2A 2FGBA 4YYFA 1E9LA 3WQWA 4NXSA 2VR4A 2WLYA 4ZGYA 1GQKA 3W1NA 1JAEA 4HCDA 1QI4A 1W2PA 1IEIA 1S1RA 4FXSA 4LGXA 3MTWA 2OEKA 4DWDA 4CD4A 3W71A 1H1ZA 4A21A 1TPEA 1PKNA 1XHGA 1J2BA 2EG6A 2XH7A 3WYZA 1IXNA 4M6UA 4HTYA 4AIOA 3CZJA 1GORA 4JEJA 1A80A 1GPFA 1FKWA 2VFHA 1VBJA 1HVXA 2GVJA 3W6YA 3E74A 1KBBA 3VC6A 3MPGA 2DSZA 4Q3MA 2PTXA 1B31A 4HPXA 2ATMA 1JCJA 4PN2A 2I56A 1OYAA 1UMLA 4FX7A 4ZFMA 2IS7A 4XAPA 3W74A 3GBEA 4F79A 2Y8UA 2FLIA 3GU9A 3H6OA 3DBNA 1LOSA 4POCA 2E68A 4M6VA 5HJXA 3W28A 4OQVA 3UA4A 4E8DA 4L1WA 4Q4OA 1REQA 3AICA 2WZEA 4ROPA 1NAL1 3T40A 2BV9A 1K3UA 2B31A 2PRMA 1OADA 2CXEA 2YCKX 5KZMA 3VKKA 3LK6A 4PSPA 3TA6A 1DJQA 1GQIA 3ECQA 3ITTA 4IPLA 4KH2A 4LBSA 3IGHX 3QC0A 1GOWA 1XLIA 2YB4A 2JGYA 3CUXA 1MUWA 3NPWA 3USBA 3N4EA 3AI0A 1C9WA 4ZOEA 3AMCA 1XCXA 3C86A 3AS1A 3ZT7A 4XKMA 3BMWA 2J88A 1H7PA 1KNWA 5A95A 3WK3A 1XH2A 4HU4A 2HRWA 5C7HA 4G7FA 2FPVA 4EKJA 3M0XA 3NDOA 3I10A 2F84A 3PR2A 5DEZA 3G1DA 3TIMA 2B7QA 4UTUA 5B7YA 4K37A 3B0PA 1X8FA 1AODA 1B4KA 1UR9A 5I79A 3CK5A 3BLOA 1Z42A 4OOZA 4PUKA 1R47A 4N9CA 1LG2A 2ALDA 4HZ6A 3LSBA 3T78A 2A3CA 1ESWA 4MWAD 4HYRA 1OCJA 3R8GA 3ITCA 5LIYX 1KV8A 3WH6A 1DV7A 3HV9A 3M64A 2VGFA 5HULA 1EPXA 4PZVA 3AC0A 3HA1A 3AIRA 4QSHA 4JIIX 4C91A 1BF2A 5DCDA 5C9XA 2BHYA 4KFPA 3O8AA 3CYVA 3BW3A 4IMGA 2DJLA 3BJTA 4XZHA 1EGZA 1EP2A 2KZHA 3PZTA 4M5PA 3E6EA 2XZ7A 4BQ3A 1D8WA 1LZOA 3A47A 4LU0A 3PSWA 2PDFA 1ODUA 4KWUA 3M47A 3IJLA 3IJDA 3NQCA 3PTMA 2W3ZA 3NQ7A 5C6MA 1E3XA 3BCJA 4WJEA 2ICSA 1H5VA 4XZMX 3G3DA 1CECA 4HK6A 3T8QA 3CH0A 5FEWA 1GONA 4V33A 3WBYA 4CNPA 3FK4A 3LEPA 1VBHA 1ITXA 3D6NA 1Q85A 2VOTA 1S2CA 4HN8A 1FDJA 4AEEA 4FHAA 4CGTA 4IIEA 3ZM8A 3LCIA 4B16A 5CSUA 1FHDA 4JTKA 3OQEA 2GQAA 3GC4A 3MCMA 3W1LA 1BWLA 3GC2A 3SR7A 1AQ0A 4MY1A 1S46A 5D9NA 1VFOA 4QXIA 2OELA 1UD5A 3DERA 3EEGA 4GVFA 3UXAA 1AVAA 1LORA 2I16A 4ZQPA 3SJNA 1OD8A 1ECEA 1U30A 3W2UA 1DIOA 4W87A 1LP6A 5HNTA 5EL1A 1UWUA 1CB7B 1J5SA 3ABRA 3PZUA 1XPYA 1LUCB 3GC5A 3M5YA 4PL1A 1VGAA 2WSRA 4HYWA 3IVUA 3MW7A 2YCIX 3UR7A 4XTIA 2Y5SA 3RMJA 3K4AA 4ORMA 1SU5A 2OG9A 3MKKA 1AZ2A 1FH9A 2CLHA 4XBKA 1O95A 1E56A 3BQ5A 3I4EA 1HT6A 5LGZA 2WQDA 4TTGA 2Y4SA 4HPJA 5KITA 1GK8A 2YZRA 1DWJM 2FVMA 4HNNA 3F2BA 1NSJA 5I6SA 3IRDA 4F48A 2Q01A 3UERA 3U6WA 5HBFA 5TIMA 4UTLA 1M03A 2YCLB 3TNBA 1CLVA 3LUTA 4RK8A 1W1TA 2XVLA 4Y9MA 3CYJA 1A49A 1X6UA 1V02E 3E2RA 1K9EA 1LQAA 2V68A 2ZWYA 3PNZA 1P6BA 3W38A 4E2DA 5HR7A 1CGWA 2YYUA 2AKZA 1Q63A 4HP5A 2Y89A 4PMUA 2QF7A 3H2AA 3CS2A 3VD7A 1V4YA 1H09A 4PC8A 2DGAA 2ZICA 2BY2A 4HOXA 2PDCA 5FL0A 2PP0A 1OK6A 1UKSA 1H3GA 1XLLA 4QEEA 1JPHA 1QNRA 5EBAA 1THFD 2W61A 3PUDA 3FXYA 1JZ4A 1JR1A 3NZ1A 1UR3M 1CIUA 2Y8KA 4XSMA 3H4XA 4K39A 2ACRA 4OZOA 2ZRZA 4A4AA 4D6DA 2G0WA 2PD9A 3J7HA 4YXGA 7ODCA 1WV2A 2AKMA 4LAZA 1R9XA 4O50A 3IJ8A 3V0TA 2BOEX 1Y8BA 4B5XA 4C5YA 1GVYA 1MUCA 2VO5A 1GZGA 4EVZA 5F4XA 1X98A 4W7VA 1ISZA 1EJSC 3W1PA 3R2GA 2EPKX 1A3WA 2C71A 4JGDA 4H6QA 1R85A 2DZVA 2OSYA 2WC3A 1FP8A 2HS6A 3SN1A 1UB3A 5XIMA 3TN4A 4GOAA 2BHUA 5CPLA 1QO2A 4QLKA 3Q65A 1FXPA 2XGIA 2WMIA 1AJZA 1EB3A 1BG9A 1RH9A 2VQUA 4A2RA 4KIRA 1HL8A 1PYMA 4C6IA 1PPIA 4PMQA 3WLLA 3LPFA 2I5GA 4AYGA 3T09A 3WK0A 3W2LA 1UP3A 2W4XA 1A5KC 3VABA 1TTQA 5BROA 2FMOA 4RL3A 3RU8X 2BFGA 2ODOA 2X8RA 3S3GA 1W1PA 2DEPA 4AZ5A 3VE7A 2IKHA 1XSJA 4H9XA 1OFBA 2YFNA 4ZBCA 3ZR6A 3W1AA 2C14A 2G3IA 5CC7A 4BEUA 4RLIA 3AIBA 4Q22A 4AC7C 4GH1A 5FF0A 3BW2A 3VCRA 1VD6A 1LBFA 4RNHA 3CPUA 5BCAA 3EB3A 4RZ4A 3MCNA 1RZMA 3PBWA 4KKXA 1W1VA 4AZGA 3VX0A 2J7EA 1E9YB 1YBQB 1Y5WA 3KRSA 1UBSA 3AISA 5D9OA 2VFGA 4K68A 2NUWA 3U5UA 1VYPX 3W1TA 1UUQA 3M0IA 2Y63A 4CCDA 4JZ5A 2QAPA 1EF3A 1UPPA 1UKQA 4LX4A 2PZNA 3NDYA 4PMXA 5HWNA 3G22A 3KRUA 1GEHA 4Z1BA 4X3ZA 5HWMA 1I45A 4O4WA 3MSRA 2PSNA 1V6UA 4O0QA 1KLYA 4J28A 1QNPA 2XG9A 1FUYA 4U28A 3A3XA 2J6XA 3OBEA 2W67A 4GUHA 1T41A 3PPHA 4M56A 1AW1A 4QEHA 3UG4A 1AFSA 4HNCA 1B3ZA 3PJTA 5G1MA 4A05A 4AD5A 1JI1A 5HWJA 1K9TA 3IGUA 3R0UA 2D22A 1MXDA 4W5ZA 4Q4QA 1P0BA 4YTQA 1DQXA 3BICA 3LRMA 2QGHA 2XJ7A 3UPBA 4Q8PA 4ACZA 4Z1AA 1JPMA 4XQ6A 1HKMA 3DI0A 1ZPTA 5CZJA 1VYRA 1XIEA 3LCLA 3O6CA 4WHBA 4LW7A 3V16A 1DHPA 3NUKA 1L6SA 3C56A 1TV2A 4AISA 1UD4A 5AYYA 3UZYA 4Z2LA 5H8UA 4PUNA 2X05A 5JIWA 3UQNA 3TSDA 3RX4A 3EB2A 3W53A 9XIAA 2IKGA 1DWGM 1JCMP 1KO0A 4O16A 4QG6A 4JIPA 4M6QA 2PDLA 3S8HA 1P6WA 4HTBA 1R9YA 3RNDA 3PPGA 4ENLA 3L4VA 1XLEA 2YPIA 1C8XA 3LRKA 3NOYA 2G96A 3WNKA 3BAYA 1TWSA 1MUMA 3FJ4A 2VC7A 4DJDA 1C92A 2CCRA 4CN4A 4DJEA 4DZHA 4ZO6A 5LXEA 3VNLA 3NQVA 1EDTA 2ISVA 1BAGA 3VDGA 3SSJA 4DXVA 3SEPA 4M0XA 2Y85A 3F5JA 3N17A 3VIKA 1S5NA 4A3UA 4CLMA 1LLZA 2ZRXA 4RE2A 2INFA 3CTLA 2HCVA 1R86A 3F4NA 1UR4A 4O18A 4URIA 1GQLA 3GTFA 1N8IA 3W88A 1GOOA 2JF7A 3T4CA 4AIUA 1BWKA 4A3RA 1MNZA 3REQB 3CL6A 1RY8A 4AG0A 3UEQA 4C1LA 1CCWB 3AS0A 4HSHA 2YL5A 2DUAA 4XUYA 3AHYA 3GIPA 3G0UA 4OBSA 2EG8A 5JH2A 1TRIA 5G4WA 4LVBA 4YTSA 1KC7A 5I3KA 1OFOA 4PTMA 1RCXB 2REQA 3UETA 4HSOA 4KMQA 4IJCA 4DAIA 2Z26A 3LLFA 3QQ0A 1KM5A 4LF1A 1RA0A 4AD2A 3BLLA 3DC8A 2CHNA 1E0XA 1BPLB 4AWSA 1JCXA 2INEA 3QF0A 3W6MA 4OUIA 3DOPA 4IMAA 1ISXA 5A6LA 3E0FA 3QLLA 2CEQA 4N9EA 4MMWA 2QDEA 4OIFA 2QMJA 2W62A 4V1XA 4JBRA 4I6KA 5HQMA 3KOYA 4FOJA 2IW0A 3TC7A 3TOPA 4C5ZA 3HQOA 4H2HA 3JW7A 2A2IA 1NVMA 2V5KA 1Q45A 5EYWA 1AG1O 3W23A 5HQEA 1K77A 3DAQA 3A22A 1B54A 3VILA 4D1JA 4GY0A 1ICSA 3M0JA 4HMNA 1BF6A 5HA7A 4LC6A 2ACUA 5BNKA 1XL9A 1R5YA 3DFOA 4C6FA 1F74A 4IG2A 1AJ2A 1TVNA 4IOTA 3BWWA 3OA5A 5ECVA 2CC0A 2XSBA 1TQJA 1FWFC 1O5RA 3DFHA 3ARZA 2EJ1A 4N2YA 4US5A 4XV0A 5C2CA 2LLEA 4FK9A 2GK1B 4B4FA 1GW1A 3S5OA 2UY5A 2UY4A 2NV9A 1ZTVA 2D3LA 4FLSA 4PTXA 4DLMA 4WRHA 2WMIB 5FCZA 4FMVA 1GKQA 3CAQA 3VX1A 1LG1A 4NF7A 2QCDA 4DI8A 3I6RA 4YYCA 1VBRA 1E40A 3THCA 4IIGA 1V0KA 3PUOA 3BLPX 3PBYA 3F2CA 1G4SA 1OZQA 2XISA 3CQKA 2BVDA 4K7YA 1XG3A 5A8NA 1P7TA 3FN9A 3V35A 4D6JA 1U2YA 3AHXA 4ONVA 4GX9A 2ZC8A 2OQHA 4ZQCA 3TFCA 3W87A 1NQKA 2CZFA 2C1HA 2DZAA 2VEFA 2H8XA 3L4WA 3D3FA 4HK7A 1OCQA 3MUY1 2WJFA 3WEOA 1RQHA 5DELA 3D0CA 3WNLA 3M5VA 3DZ1A 4Z1YA 4Q7NA 4DN1A 4MB4A 4K1WA 2NQ5A 2GL5A 4FALA 1Q65A 3B9NA 4Y9AA 3WUFA 3E38A 1KRCC 1V6YA 3RFAA 1R3SA 3EDEA 1AUSL 4W7WA 1TJPA 2QUVA 1XGZA 4DJEC 6ALDA 2WC4A 1D8CA 3L68A 2GSHA 4KGLA 1FKXA 3THAA 4ES4A 1TTIA 4C6OA 1EJVC 3STCA 1ELSA 3AUJA 1S2WA 3RXZA 2BBFA 2PA6A 4JQ2A 3VM5A 5EA9A 3VIIA 4DM2A 1JQVA 4LYPA 5E0KA 4GYKA 4HD5A 2XIBA 4B5TA 3RCYA 3L21A 3VOHA 5G2WA 1VQTA 1T0OA 4RW3A 4CUCA 4XISA 2XFYA 4NI3A 4MTVA 1V6XA 1UC4A 3K4WA 4PE8A 5IHSA 4MOZA 3MUCA 3ES8A 2NX1A 3L66A 4L56A 2WJEA 1LM1A 2V3FA 1C90A 4NAEA 4K8EA 2X7WA 4EF9A 3W7JA 2ZZ6A 1IE7C 1H51A 3F4VA 4FX8A 5DMNA 2ABBA 3LBOA 4F0HA 1EBHA 1BYAA 4WDUA 2J7DA 1XDJA 2P8BA 4GMEA 5A8OA 1W3IA 1CXLA 2FDMA 3SY8A 2VFDA 1EP3A 4GC4A 4Q7BA 2POTA 5DCEA 1FWSA 2VR2A 2O9RA 3PZQA 2WMGA 3AYVA 1KTNA 4GD0A 3DU0A 4C6QA 4IJRA 1PZ3A 3JZEA 2NV1A 1GOXA 3A4XA 2QUTA 1VFMA 1YPIA 3PBMA 3P93A 5EMLA 5I09A 7CGTA 3ANVA 4GA8A 1EZWA 3SRHA 4QIUA 3ZQ9A 2CERA 2QCFA 4WZHA 4DAFA 2J13A 1HP4A 1VBGA 5C9UA 1KKOA 1UKPA 2O4MA 1VHNA 4ZXOA 3DUGA 3QPYA 3M0LA 3E2SA 4HJFA 3UZ5A 1BYBA 2ZDSA 3N2XA 1NJJA 3QHOA 3TR9A 3SCUA 1E51A 3PN8A 3WDRA 1MW2A 5AVHA 2IKIA 4U5KA 3GTIA 1U5VA 1UA3A 2WVTA 4Q6JA 3HZ3A 3GDLA 4PUEA 2HE8A 3NCOA 3NQ2A 4DZ5A 3FAXA 3ENLA 4HGXA 3MKVA 2NXHA 4AMAA 3DC0A 1QPNA 3GSMA 3SFKA 3CXOA 4H3DA 1ZALA 3A9IA 6TAAA 1DXFA 4U3CA 1DE6A 1A4MA 3DI1A 3C2OA 2UV8G 1WKFA 3E1F1 4XWUA 2WPBA 3S47A 5C2XA 4Y9OA 3RCNA 1MO0A 3N2TA 4YVVA 2DQWA 3ZJ6A 5CPQA 3NQGA 4K8GA 3DHFA 4LAUA 3GNOA 1TSIA 4IIDA 2CHRA 4LUSB 4MPQA 4ZE4A 1RCOB 4X9YA 1XCWA 4PL2A 4LXFA 4RPQA 4GJIA 1QOPA 1BSIA 3SJ3A 5JBFA 3RMEA 1UWAA 3KTSA 1EX1A 3WJXA 3ABXA 1GYNA 5AOUA 5G4HC 1WXZA 4DB7A 4AVOA 5ABEA 1P43A 3VINA 4NX0A 4YWSA 4GQBA 1H7NA 2NQHA 3A12A 3BE7A 4UTJA 1HJQA 1E6QM 1YLVA 4HZ7A 2W92A 3W00A 1ZGDA 1ZJBA 2PGWA 3CUIA 4LCRA 4TU1A 1R3VA 3E5PA 3TUUA 4I9AA 7ENLA 2ZUNA 1UROA 4LUJA 1LQ0A 2FZDA 5CGTA 1H63A 1CLXA 3SW6A 1BVNP 2DIKA 4P7RA 1W9UA 3WQGA 1PV8A 4QS6A 3AIEA 1LT8A 1MW0A 4ICCX 4GQGA 4JKMA 1YNPA 4QNEA 5KZEA 2F7FA 2B7OA 2FIQA 4LBUA 2NQJA 1N8WA 5AYXA 4RW5A 4DJFC 1QMLA 3SZ8A 3S1VA 4GUGA 1JYVA 3GTNA 3GNDA 4P8WA 4YVPA 1DWHM 1CX9A 2YYTA 3CMFA 4LNCA 1J8VA 2BY3A 5D30A 4LAOA 3NEVA 3L9CA 2VNCA 1ZZMA 4TX6A 3AJ7A 1WOBA 1TR9A 1XJBA 4B91A 5HXMA 1ONRA 1VPQA 3GDBA 3IK2A 3M44A 4ZFCA 1KQZA 3FGCB 3LLXA 1GUVA 3O15A 4YTTA 2C16A 2DZBA 1JRCA 4IFKB 2V63A 2J8GA 1K8XA 2Y7FA 5A6KA 4XB3A 4TUFA 4NKCA 4EIVA 1QOQA 4DNMA 3BAIA 5GJPA 3MP3A 4J27A 4G2DA 2ZZ2A 3KWXA 3G1FA 4NJIA 2XM1A 3NL5A 1PKMA 1RY0A 2NT0A 1NFBA 4PYSA 5A6BD 3W24A 4Z0SA 1HFBA 2AL1A 4PUUA 2A6LA 4PA8A 4ZVJA 3N1AA 1XRVA 3ZJ8A 2VUNA 4F8XA 1TFVA 4J3TA 1RALA 1SO5A 4IFKA 5GNXA 4D6IA 1ZNNA 3H7VA 4B3KA 2E5CA 4R5EA 3W85A 4GJJA 2RGMA 3W7HA 3MP5A 3SCRA 3W7EA 4J7RA 2YCLA 4I5XA 1BQCA 4TXEA 1EO5A 3SQMA 3CUJA 3U0HA 5DXXA 2ZA3A 2YW4A 3O7UA 2X2GA 4DIAA 4JY8A 4Q4MA 3USZA 1ODZA 4O15A 2Y8VA 3EMZA 3GG7A 5FI8A 4UTTA 4MWAE 2O92A 1PHWA 3W7NA 1EOMA 3LS9A 3LPGA 2VZVA 4H83A 1FBAA 4B92A 2NLIA 3R8HA 4W84A 2EPMX 1SJDA 3W27A 2D23A 2EPLX 3U48A 2QIWA 2UWFA 1YXCA 1K4GA 3URAA 2X7VA 1V02A 3OBAA 1ZAIA 4MAVA 1X97A 3KVJA 4E4UA 1QPQA 3DG7A 4GCAA 2Z29A 3G77A 4GK8A 1LUCA 2OYLA 4UFHA 1XLJA 4UBPC 3WY1A 1PB0A 1VR6A 4UOJA 2WC7A 1JIBA 2YKKA 1EBGA 2DZSA 3R94A 3BJFA 3ITYA 3WH9A 2ZX9A 3HG4A 2HWGA 1VBUA 4AXKA 1CGYA 1G94A 3QOMA 2OLHA 2YXOA 3TX9A 1IWBA 1Q7ZA 1W5QA 5DT5A 1RJRA 3EKZA 3VC5A 4R33A 4UFJA 4D8ZA 3T9PA 4RDZA 3UR2A 3UYCA 4IGSA 4JN7A 1B2YA 2Z1KA 5A6JA 3BJSA 3SUVA 5FIPA 4PMJA 4FPSA 3V18A 1E72M 2DJXA 3WQOA 3FYPA 3LCWA 2VHLA 2OCZA 3C6CA 4R3UA 4UCFA 1SW7A 4NG3A 4BS0A 4S3AA 3POCA 1UC5A 1U5JA 2PP1A 3EX2A 3LBMA 3VOFA 1OHLA 1EXPA 2IQDA 3AIWA 4BCEA 1GG1A 1GYLA 1IEXA 1JUKA 4ML4A 1EJXC 3M0KA 4RE3A 1T40A 4R88A 3SCQA 3R5EA 4PMZA 2PU1A 2QV5A 4PTNA 3U57A 3VGFA 2AQWA 5IBXA 2Q3OA 1OIFA 1AH0A 5FJOA 4B9ZA 4S3CA 4W88A 4C6DA 3MMWA 3ZWSA 4AVFA 3VZZA 3EMQA 4KFOA 4F2UA 3MV11 1XFCA 3HV8A 2X30A 3CEUA 5AHMA 3KL5A 3NVTA 1L6YA 2R9RA 1WXYA 5HJYA 2DY3A 3QQWA 3QMTA 3GZAA 4WDWA 3F4CA 5E9AA 4KWSA 3CAWA 1SYTA 1RQBA 3CQJA 3EOUA 2VZUA 4RV8A 3B04A 4R7OA 1J6PA 4DYEA 1PZ2A 4EXBA 5D09A 2H3DA 5HNRA 4GZ7A 2R94A 3EWYA 3L0NA 3U2ZA 5CPTA 2VR5A 3WLQA 1QR7A 4ZEPA 2DZUA 3GNNA 2UZ9A 2HVNA 2WZIA 2CKRA 3H2CA 6A3HA 3E0WA 1V3LA 1WKDA 4JICA 1ONWA 2E5BA 1JPDX 4GUFA 1G01A 1K02A 5HDRA 1EFZA 4XK2A 3RYSA 5ABFB 2C0HA 2BGQA 5CKSA 4DUWA 2NWSA 1MW1A 3GKFA 4EWND 4HNUA 1ZBWA 2Z4GA 2WKJA 3SSZA 4FNUA 5HUOA 2V69A 3DFTA 5AC4A 3EZ4A 3W7CA 1NFPA 4QHRA 2P3EA 3WUGA 4YVXA 4E2OA 3GHUA 3ZR5A 1DP0A 4PRTA 2W27A 3LDVA 1SFTA 5MF5A 4UR9A 4C65A 4BEQA 1Z48A 4Z42C 4PRWA 1RPKA 3UCQA 4G7EB 3P81A 4GI9A 4G56A 1LRQA 4TX9A 1UUMA 3BG9A 3FJ6A 2UY3A 3M0MA 3N2BA 3GXMA 2HDJA 3UT0A 4U4MA 3CLMA 2V3DA 4R7WA 3T0BA 2DSWA 4O13A 3WLMA 3KZSA 1J4EA 4DEFA 1UG6A 3AROA 2OWCA 1BFNA 3WN6A 3C8FA 2Z0IA 5LNWA 1S1PA 1XQKA 2QPSA 1UJQA 4AX7A 4WEVX 2DIJA 4B3LA 4DF0A 3V0SA 1ITCA 3UESA 1JFHA 1ZP3A 1HN1A 3UR8A 4ZCWA 3NJ3A 5BXSA 3NZRA 3VOIA 4Q4RA 1QBBA 4P7QA 4JS3A 1JG9A 2WK2A 3WG6A 1KCLA 1F6YA 2VDIA 1VEMA 1FWJC 1WKEA 2HNHA 2QUUA 1KM4A 3N4AA 3ZLFA 1EUNA 1X1OA 1M9HA 3OZYA 3UD6A 2V9DA 1RLCL 2R1MA 5LSMA 1KR0A 2GZXA 4A8LA 3QZEA 3INPA 1REQB 3H53A 4OUEA 2WMJA 5CGMA 4HZMA 1V3KA 2QV4A 1E0WA 4G9PA 1TX0A 2ESCA 2P5NA 4CVWA 2GJRA 3W7GA 5LNRA 3UY7A 3RG6A 1NOUA 4Z1DA 4KRUA 3LSCA 1XPGA 3KL3A 1EEXA 4QNWA 4GGBA 3MSGA 1J96A 2WCGA 1M04A 3RX3A 3SUSA 4D72A 2V5DA 3FYYA 3IJQA 4MUZA 4AZIA 1TJ0A 1PUDA 3W86A 3UGRA 4D6CA 3T8LA 3BZGA 3V5CA 3TYDA 1EQPA 1POKA 1QJWA 3C0JA 4O57A 1KGXA 2B7PA 1W3NA 3MKCA 2DDXA 2R6OA 3NFUA 3FGCA 3LCGA 2ACQA 5FF2A 3NQFA 3A3WA 4REQA 3THDA 2A5HA 2OQLA 2C1IA 3MDWA 3ARVA 1NOWA 1BQGA 5K3VA 4P7NA 4LTSA 2PLKA 4OJYA 1PX3A 5AHIA 3ZVIA 3GWQA 1ADDA 1DE5A 1WAUA 2XVPA 1I2PA 3KOFA 4CD6A 4WVXA 1CGTA 3WMLA 4MDOA 3ZVHA 2PDBA 5C9RA 2E9LA 1PIFA 1HJXA 1NU5A 4J5NA 1V3IA 4C7FA 1AD4A 3AIQA 4LCSA 3KFTA 1DOSA 4YTUA 1WDSA 2VENA 3PZGA 3JZUA 4F40A 3OLGA 2Q3RA 3CHFA 2PDWA 2ZA2A 1DTNA 1X1NA 1UR8A 1QNSA 1H1YA 2FZBA 1JPKA 3BCFA 3PY2A 5CG0A 1VC4A 4X9SA 4CQDA 4QX4A 4N0RA 4LV9A 2DZXA 3KAOA 3TW6A 2GVLA 1P0EA 1JZ3A 2Y70A 1QK2A 1E71M 3P62A 1WUFA 4GIYA 4H9YA 2ABAA 3BW4A 4AH7A 2ZA1A 4JL2A 5GPRA 3WK2A 1GCYA 4D9PA 1Q8AA 4LANA 2XIIA 4I9JA 4W9TA 3WQVA 4FNPA 2FMNA 3GR8A 1GOKA 2BX7A 4L9YA 4PMOA 4AW7A 2NZLA 2Z6JA 2V81A 1W31A 1XFBA 5I3HA 4GZIA 3E2QA 1Z44A 2PCEA 2MNRA 3O05A 5M1TA 1KXHA 3KOXA 3U9IA 3G8RA 3SN4A 4H7ZA 4I3GA 1OBAA 4AFYA 5T9BG 2F38A 2WSQA 1D7KA 2YBVA 4PCPA 3PG9A 4IUGA 3WNPA 4OT7A 3M0VA 1Q5MA 1FY6A 1H1NA 3ZSSA 1BXNA 4HIBA 3URBA 1HXJA 4ACYA 4ERIA 4ERGA 3NQEA 2GSJA 4LAMA 2D69A 1C9DA 3VOJA 5A6BA 1EIXA 8RUCA 1I4NA 3FVDA 3LHZA 2JBMA 3W25A 1VPYA 1IGWA 3G6MA 1JVNA 1I2RA 3LI0A 3SB0A 3VD5A 1Z32X 2E8ZA 1W3JA 1SSDA 1TX2A 4JTQA 4WY0F 2PDJA 1H7OA 1JDDA 1PWLA 2J47A 3ZJKA 3NG3A 1XLFA 3S5YA 5CAKA 4BJHA 1U33A 2PLJA 2Z24A 2Z7GA 2X16A 3GFXA 3S9YA 3R0DA 4DZIA 1B90A 1H7RA 2Z27A 4JEQA 1V3HA 3II1A 3W1UA 2WMFA 2E67A 2OEJA 2OOGA 1KW1A 3EA1A 4I8YA 1MDRA 4JCMA 2B7NA 2FZMA 1WAWA 1OG0A 4O54A 1J11A 3SURA 4RZ6A 1IIHA 2PTZA 3N3TA 2XVNA 4JNYA 4NNCA 4IPNB 1B4EA 1LTDA 1J18A 4J2PA 5A5WA 4WGXA 1Q6CA 1ZBKA 4TR9A 5BXPA 3SCPA 1VEOA 3R13A 3GS6A 3CBWA 1MFUA 4CEUC 4LB3A 1FCVA 2G4JA 1GGOA 5TQLA 3L4TA 4W8BA 1EIBA 3BAWA 2ZRWA 4FB7A 3GXPA 4Y8FA 4AYSA 3POHA 3VIGA 1GHRA 1GVEA 1RJQA 2GVYA 2J25A 2IPWA 1R3QA 2Z6IA 1PL9A 3NL3A 1KCXA 3EPOA 1DORA 1TKKA 2FZ9A 4EE9A 1UR2A 1BYCA 2DORA 3KL0A 1XKYA 2HROA 3HFYA 4O1CA 3VFCA 1DPMA 5D03A 3OZOA 3T2OA 4MPKA 3QZ6A 3E9AA 1W56A 3NL2A 2VC6A 1E9ZB 4GBUA 3S1XA 1DJXA 1SQ7A 4US5D 4UNLA 4O28A 3C0LA 3TJ4A 3K46A 1E6XM 4QJ5B 3THUA 2D2OA 5IOBA 2DVXA 3VZXA 2QCMA 3STFA 4TX8A 2ZC1A 4XX6A 1OFPA 5F2LA 1WPCA 3SRKA 2R1KA 1OX4A 4CNTA 5E6ZA 5C8BB 3L0KA 4GZEA 5IXEA 4W86A 4CQAA 4FP1A 3APGA 3LHWA 1NOFA 3TJXA 4F0MA 1WDRA 3AZRA 3KDOA 3TMQA 4GQRA 4MNKA 3R1ZA 4UXDA 3GXFA 5G2IA 4ILSA 1FTXA 3WEZA 1Q6RA 2Y88A 1CGUA 1FHUA 3EX3A 4NX5A 4DPQA 1IR1A 3JU2A 1CTNA 2ZZ3A 1G7VA 3BGAA 5CBBA 3AHVA 3M9YA 3CV2A 3EOEA 2F9RA 1VJIA 3ARSA 8A3HA 1N82A 4AWUA 1IHIA 4GNKB 3P3BA 4MGGA 2CWXA 1SFJA 4ATDA 5D04C 4ZOAA 5CBIA 2ZXBA 3RUBL 3FOKA 1TPDA 1AL7A 3EKLA 3NQ6A 1YE6A 4H8HA 4BFAA 2HJPA 3EPNA 3NNTA 1PXGA 2QUNA 3VI2A 2WHJA 3R11A 2OXNA 5BWFA 2PTWA 1HX0A 1VIWA 4GINA 3HJEA 1UKOA 2PEVA 1NWSA 1TMLA 5DMYA 2QHAA 2ANUA 1JAKA 3RILA 3CUGA 4XVDA 4QR6A 4XBJA 2WBKA 1O68A 1W2VA 3KVKA 2WVVB 4I5RA 3TQ0A 5IFPA 4FOKA 3W7DA 3I6EA 1GQJA 3EDFA 4M19A 1Z89A 1HKKA 3BC9A 3C8NA 1US2A 2IKJA 3NPVA 5LIKX 4L9XA 2XDFA 3GVRA 1BEUA 4I90A 3QW3A 1ONEA 4JHOA 3WQCA 3QR1A 4XAYA 2E1WA 3VO0A 3WENA 1H61A 4GI6A 1UJPA 2NVAA 1F8IA 3CO8A 4BA0A 2I1OA 1KFEA 1X39A 1PEZA 1VH7A 3LTSA 2A79A 2Z1VA 3TSMA 4AHQA 2DPEA 5HMDA 4PULA 3BH4A 4HSNA 1K8YA 1KM0A 4XD6A 1WP6A 3TXVA 2O55A 1J0HA 3VXGA 1ICQA 4TV6A 4LWWA 1A5CA 3WK1A 4D6GA 4G1KA 1TJRA 1MSSA 1A0DA 3ZOAA 2VEMA 3UWEA 4DBDA 1W9DM 4Y6GA 4WCJA 3CUFA 3GQYA 3MDUA 1AW5A 1B0IA 1GVFA 3KBNA 2OO0A 3CZEA 3NL6A 2WZTA 3UXKA 1RQEA 3WH8A 3WF4A 2OYKA 2HQAA 2RDTA 3APTA 1DKWA 3K30A 3QGKC 4JYFA 3W81A 1W9BM 3TYCA 3DFNA 3EWWA 4L80A 5LIXX 4D8LA 4ZQRA 2O9PA 4A35A 2YGYA 2Y0FA 2Y7EA 4S3BA 3E0LA 2VVNA 1QT1A 3TONA 1LL4A 3IV8A 1L6FA 3TYAA 2GK1A 3RRAA 3TLQA 2R82A 3UFYA 1RA5A 3CM4A 3R4IA 1TCDA 3G1RA 2TAAA 3OOQA 3WDQA 2CW6A 3PBUA 4UQBA 1W1A1 4FAMA 3FW6A 3DG3A 3W4RA 2JGQA 2VC9A 4ZOCA 1CGVA 4ERAA 1E6RA 4JYEA 5ABTA 3SBFA 2BB0A 3QRHA 1QVBA 3R12A 1BLIA 3CMJA 5T8GA 1IT8A 3V4BA 4WX2A 1B9BA 1GKRA 2FB3A 2WVUA 2X1UA 3P8JA 1K6WA 1Q6LA 2WKLA 3T7VA 1O12A 5K2ZA 1UIPA 3QV7A 1H50A 3HG3A 4I7VA 5HAOA 4CQCA 4ZMGA 5DBUA 1LOLA 2HK1A 5HATA 1CXKA 2GPTA 3N29A 2XIQA 1GJPA 3IJ7A 3WQDA 3GVWA 1KBIA 1KCKA 3RX2A 1JEZA 4X2RA 4DI9A 4H6KA 2GUUA 3BOFA 1FXQA 1OF6A 4RCXA 1B3XA 1RR2A 3TJLA 4DYKA 1N7KA 4NP7A 4RDWA 3N6QA 2WSYA 4PUJA 3PANA 1JNDA 3W2MA 4I8DA 2D73A 1R7OA 3HPSA 3ARXA 4LVGA 4PB5A 2V2DA 3DFPA 4D8AA 2OGJA 4ZSTA 1F73A 2G95A 4U33A 1H60A 3VNZA 4CEXC 2NWRA 3WF2A 1SW0A 4GYFA 4KF1A 4AF0A 1JYNA 1PE1A 3MCOA 4GHRA 4AZ6A 5LA0A 5CPNA 3LX9A 4JFVA 5FJRA 2XN1A 2E5DA 1IXQA 4EOUA 1A53A 3C2RA 1XBXA 1GYMA 4C6MA 3GW0A 3EWCA 3ZO9A 4I9TA 5I3GA 4C6JA 1PS9A 3WNNA 4QJ4B 3LCXA 2VXNA 1JUBA 2D0GA 1S5MA 2XWDA 3M41A 4D1IA 3WQ6A 3FHAA 1P0NA 3ABSA 3JRKA 2CWNA 4E8CA 3O2LA 2DFAA 4HPHA 4YNGA 4WXZA 4KT2A 4CN1A 2L5HA 3NEHA 3BSMA 3UWVA 3OU8A 2NUXA 4UQEA 1E9IA 2D3NA 1HNYA 2YA0A 4RE0A 3IPWA 3N6JA 1B3VA 4YIWA 1KRBC 3MUIA 4GX8A 4GYJA 2YLLA 2ZVRA 3LXAA 4QTGA 1TO3A 3LU2A 1JFXA 3LN3A 3A64A 4ML9A 2XINA 1ZUAX 3CZGA 4O1DA 3AQUA 5FKYA 2NLYA 4WSKA 3W9ZA 4H8VA 3N04A 3OPSA 5CCZA 2HV5A 1D9EA 2XIOA 2GUBA 3RJXA 1PVNA 2YXXA 3TYEA 2OX4A 3U7VA 5DO8A 3KTCA 1Q13A 3VTRA 5CC3A 1FWIC 3RLHA 1YDOA 4LRSA 4PCFA 3E0IA 3TAKA 5CSRA 1R30A 3HG2A 4HZ8A 3ZS4A 5HK4A 3LV6A 3AXIA 5E6YA 2PDXA 3IVSA 1FP9A 3EDJA 1PKLA 5E70A 3O9NA 1PTDA 3CV6A 2W6RA 4GLEA 3U2EA 1NM9A 3HIJA 3L12A 7XIMA 1XIBA 1P6CA 3UWQA 2J66A 1M6JA 4TVDA 3HPZA 3TTYA 1G7UA 1LBMA 2NXIA 4HNLA 1EF2A 3TROA 1LF1A 5A2CA 3P60A 3TTEA 1I2OA 2GYIA 3WLPA 1F2JA 3MMUA 1YDNA 1M53A 4HB7A 2VOMA 3GH4A 3GH7A 1FWWA 5JQ9A 2E28A 5D2YA 3IWPA 1HKIA 3L7RA 4KRTA 3SN0A 4JTDA 5CZTA 3LPOA 3WCZA 4HT3A 4QITA 2OYMA 4J2MA 1V77A 4LS2A 3GD6A 3RLGA 4CD5A 1L6GA 2ZUTA 1DQWA 3SRDA 4C1KA 3F4DA 4B5VA 3F1QA 4F0RA 2XFFA 2ZKMX 3PS7A 1CEOA 2FTPA 3SQLA 4JQAA 1ITUA 3OYZA 3S2MA 5A8QA 3HQ1A 3PTDA 2VQTA 3P82A 2RJGA 2KAUC 2QJNA 3N73A 1QHOA 4LPCA 6REQA 2WM1A 1V0NA 4GVHA 1XLKA 1OX6A 4W93A 3VKJA 4XZLX 2E25A 2PWHA 3RAOA 4CKQA 4GIEA 3F5LA 4QLJA 2J24A 1TWWA 2Z1SA 3G3MA 1QTWA 3UBPC 1L9WA 2Y7DA 3PBVA 4XIMA 3TJIA 5JBEA 4QDPA 4NYYA 4QQ3A 3NIYA 4OOUA 2A6NA 1AW2A 2Y2WA 4DM1A 4AU0A 1XH1A 3GAYA 3W82A 3W7OA 7REQA 2QUMA 4C6LA 3S1WA 4N42A 1QAPA 1W3HA 1G4EA 1ZJIA 4XTDA 5BXTA 4GBDA 4IH3A 3OLEA 4GUJA 3QKEA 1FRBA 1DXEA 3V5OA 3W7KA 4V2XA 3FKRA 2R1NA 4MSSA 2FYMA 2E77A 2FPTA 1E3ZA 1U22A 4E6MA 3C2FA 3ONBA 1WDPA 2RKXA 4JXCA 3WJWA 4TIMA 3CL8A 1KBKA 3A24A 3UG8A 3N25A 4R7JA 3K8LA 1BTCA 1YKWA 3MHFA 5C71A 3PP7A 4D6EA 1I9CB 3VCCA 2JK2A 1DVJA 1IV8A 2PPGA 4BHYA 2CLMA 3W75A 1GTEA 4KQNA 1IGSA 5FEXA 2W79A 4F2BA 2XHYA 5FAJA 1TTJA 3FEQA 2TMDA 3F4WA 2DZWA 4H7CA 1PZ1A 1T8QA 4MKSA 3MJMA 3UJEA 3TLLA 1F3XA 4NY2A 2QPUA 3DH7A 5B80A 3TN6A 4BQ2A 4EPDC 1KM2A 1W1ZA 5A3HA 1RAKA 3VVGA 4IFRA 2A3LA 4ASTA 4ZO7A 3H24A 3NPXA 4UTWA 1BWVA 4ZE5A 2PURA 3VD3A 2C6QA 5REQB 2YW3A 2QEZA 2HBXA 4TMCA 4NUWA 2PMQA 4C60A 3OLIA 1YDYA 3O6AA 4AY8A 4H1ZA 2VX7A 2E6DA 2OWWA 1V51A 1V6TA 3KE0A 4H41A 2VFFA 3BK0A 1GEQA 1L8NA 1XIDA 5TNVA 1VS1A 1DJZA 3U5YA 4P8VA 4NSBA 4F2TA 1XRFA 4ZENA 1O5QA 4WGHA 1HO1A 2PC4A 3PWGA 3WL1A 1F8MA 4MM1A 3STEA 3HGOA 4UTIA 5FF7A 3VKDA 3BAKA 2WMKA 5CPSA 4DXXA 3DFSA 4OWGA 4WLCA 4UTMA 3A4AA 3M1ZA 2JALA 1XG4A 2Z25A 3AJXA 3CPGA 3PK7A 1XWYA 1W91A 1Q4WA 2PGFA 1C8VA 1VPXA 2ISFA 4QM1A 4JTFA 3OHIA 3WQFA 1JNEA 1KTCA 1O5KA 3TWAA 4U10A 1Z7AA 4CQ8A 4YJ5A 1GQNA 1OGSA 3M0YA 4BR1A 1YPFA 4XO6A 1ONXA 4MB3A 3NA8A 2E3ZA 4Q8TA 4Z2IA 3TTQA 3VDHA 3TWBA 4DBEA 4ICNA 1GHSA 5D2WA 1O4UA 5EMJA 2WB5A 5D8ZA 3U4AA 3HG5A 2ZQ0A 1S5VA 3W7RA 3CT7A 4XKYA 4JKLA 2Z00A 1XBVA 2HXUA 3NTYA 3PWAA 1W5MA 2OSWA 1FWGC 4MB5A 1FWAC 2VRKA 4UWMA 1K7XA 4J40A 2W0UA 2VRQA 5CLTA 1XSKA 5CJMA 5TD4A 3EB4A 4JNZA 3H22A 1W0MA 3B3DA 2V82A 2Q8ZA 5CC5A 4WIWA 2GDVA 4JQ1A 2DW7A 5FJUA 4EXQA 4O1FA 2W63A 3H7RA 3IAQA 5SWUA 3TZNA 2G3NA 4L61A 3BDKA 4GWEA 2C18A 1LWJA 4NRSA 1BVZA 3FJLA 3H4GA 3EWDA 4HCHA 4P61A 1JZ8A 6XIAA 2G3FA 4PTDA 1UR1A 4LUTA 4K36A 2B0MA 1ISYA 1BYDA 2GGEA 3WDJA 4QJ1A 3CHVA 5JXQA 2DVTA 4UR7A 1OX4B 3V1HA 4DX3A 3P5YA 1CZ1A 1PX8A 5AB3A 3L67A 3TNOA 1BXCA 1LDCA 3AXMA 4NZ1A 2AGTA 2WKGA 1A5SA 4KWWA 4AQLA 4LEQA 4K2SA 4EF8A 3L5AA 2ASHA 2XVGA 5BU6A 2BY0A 3MANA 5HR6A 1JQXA 2JKEA 4Z0JA 4JTCA 4N6FA 4JDYA 1WX0A 4J35A 3UNTA 1BXBA 3L2IA 3DIPA 3KP0A 3SAZA 2GJNA 2AAAA 2PGEA 4KBXA 3UWWA 4HU0A 1KFKA 2H90A 1P1XA 1BRLB 1E73M 3KP1A 5A6SA 3LY0A 1PHQA 4B4HA 3B97A 4BWLA 1PDYA 3QBUA 4P7LA 3BV7A 4QQUA 2P3ZA 2QNEA 3B8SA 3D3AA 4FIRA 1EJ7L 2PRLA 2XGBA 3H8AA 3EX1A 2ACSA 4Q8NA 3WD1A 4QBXA 3VZYA 1XX1A 5CEWA 1Y7VA 1AH3A 3T55A 3BAXA 3GVGA 4NJHA 2YA1A 5CPMA 4MNJA 3IJIA 4WUIA 4G6CA 1JGMA 3KX6A 1K9FA 2PGRA 2CLFA 4MDPA 4JTEA 3MS8A 4LT9A 3TKFA 2A7PA 1KA9F 4IX2A 1VCGA 1MRQA 4DHGA 1IZJA 3GYEA 5KETA 4I9MA 2V67A 1CLKA 4HMEA 5D9MA 3K8KA 5A2AA 3JUGA 3CC1A 5D02A 4NJJA 5KEZA 4I7WA 1ZBVA 3MSDA 3G18A 2GJLA 1JXKA 3ITGA 3NQDA 3VK5A 1XS2A 2O9OA 2GQ9A 1QATA 1S2UA 4MB1A 1DBTA 4W89A 4UQDA 3M7WA 3OODA 3ZWTA 1U83A 1H4PA 1TYGA 1JF5A 2E8YA 2HEJA 3U4FA 3VIJA 2PE4A 5I3FA 4B5WA 1S38A 5I03A 3R25A 1GW9A 3PSVA 1FOBA 4M8UA 3GDMA 5TBOA 3EPMA 1RK5A 3OP2A 3P5ZA 2W66A 3Q45A 1QNOA 4LF2A 2OZ0A 1JDFA 3ARQA 1UH4A 4JFWA 2V6AA 2WNZA 1XIJA 2DSKA 1XDLA 4XZIA 1OCBA 1CENA 1XGEA 2J8TA 1PTAA 4LUSA 4NNAA 4IIHA 4E5TA 4PUWA 1KRAC 3H26A 4H8UA 3N4FA 3C5QA 3M43A 3CB3A 1FFQA 3KWSA 1T96A 4DO6A 1SUXA 1J0YA 1KQYA 2Y7GA 1IWAA 4RDVA 2J78A 1NQ6A 2PF0A 1X8CA 3VGDA 1NTHA 1PIGA 1YNYA 3FA4A 3N34A 1UH2A 2NXGA 5AECA 5FL1A 3KHJA 5FJJA 1CI1A 5FOOA 3C2VA 4GRSA 1P1MA 4L4MA 2D0HA 3H54A 1UCWA 4PMRA 4UFMA 2DT3A 3LMYA 4UNKA 3LRLA 4Z2JA 1TQXA 1XW8A 4JTLA 3VNIA 3S2JA 4YPJA 2ZWZA 4DBWA 4S2CA 4IGHA 3VOGA 4A3HA 4IQJA 2VZTA 3COTA 4JCLA 2BOGX 4ZXLA 1W3KA 3BV4A 1QI3A 4S39A 1XIMA 1KFBA 3GNXA 1V79A 4DWSB 1TIMA 4U2ZA 1HG3A 3U2OA 3ZYZA 5A8GA 1FQ0A 3N11A 3LBCA 2P1FA 2IMRA 2SFPA 4PH6A 5CSYA 4TQTA 3NQ8A 4HA3A 1CBGA 5LNSA 4DUOA 2V2HA 3WNMA 4A2SA 3T0TA 2E09A 1DJGA 5I5RA 3HFTA 3K2GA 2DT1A 3CLWA 1XLDA 4FX6M 5F1UA 1TREA 3L5MA 1H7WA 1PAMA 3NXLA 3LD5A 3GHRA 3WLJA 2PDGA 1E0VA 3ZZ1A 1J0JA 2PDHA 4AY7A 2P53A 4CNNA 5LZLA 5KSWA 3GZ3A 5D37A 3NWRA 1ZCOA 4PTVA 3I4KA 2RDXA 3C3UA 3GY1A 4XD3A 4Q4PA 4JTGA 5EY5A 5DXYA 5HNNA 5EFFA 2HNEA 1OYBA 3MU7A 3EWZA 4UNIA 2VI0A 1TWZA 7TIMA 2BG5A 3WFZA 4NASA 2WMHA 4L1XA 3T0CA 3W6LA 4D6FA 4FNQA 2EG7A 1E1EA 1IEWA 5I02A 3TVAA 3SCSA 2DQXA 3IUDA 3NPUA 3RDKA 5DLCA 1H2JA 1XICA 3L2LA 4FOUA 3I3BA 3BUVA 3CWNA 1IEVA 4INFA 4EANA 1IZKA 1K7FA 3EKGA 3KBMA 1QU4A 5IDZA 4S38A 1DIKA 3W3OA 3S1GA 4DF2A 4S3DA 3AOFA 4HBKA 3SADA 4NHVA 5A6TC 4A22A 1MXSA 1O1HA 2ZXDA 3P6LA 1YIXA 2QULA 4HHHA 1LOQA 3LXBA 4A8RA 2HMCA 1UQZA 4M80A 4B15A 4HU8A 1JDCA 3ICJA 1TV3A 5EPDA 3I7SA 3IIOA 2ZE0A 3LB0A 2O7SA 2OZ8A 3XINA 3DX5A 2BZNA 2XIMA 2EAWA 3PZOA 4JIHA 5DX7A 4C6EA 4NZJA 1HF6A 4M7TA 4ZO9A 1XLGA 3W01A 2J77A 2PUZA 1JZ2A 3S6DA 2OZ3A 3PPFA 1R3RA 1FVPA 2ZUUA 2GJPA 1G0CA 1W9VA 3B8TA 1JJKA 2ZX5A 1P0DA 1HW6A 3DHPA 2OKTA 4D71A 4R34A 2CXGA 4MAZA 2WPGA 2J9ZA 4JFTA 3E5BA 1D3GA 4ATWA 2GGHA 5MKGA 2ZZ5A 2MUCA 1JZ6A 1JI2A 2XIJA 3UVIA 1PDZA 3CNYA 3ZVHB 2JEQA 4AWTA 3AYTA 4XO7A 2BOFX 1G4TA 4WR3A 4H01A 1KKRA 3M0HA 3SFWA 3MI6A 5K9DA 1SR0A 3TQKA 5EMYA 5JUVA 1Q7QA 3AWOA 1R2RA 3S4TA 4AMCA 4IT1A 3EOLA 4R53A 4R27A 1HJUA 3AIUA 3CEPA 2PCQA 5GVJA 3BLEA 3QW4B 1W1B1 4P5UA 2XH4A 3THQA 4XG1A 3NDZA 1LRNA 4KCTA 3TFXA 4GPNA 3FIGA 5LYRA 3UA3A 4JFSA 1VFSA 2YFOA 2TPSA 3NOEA 1KWGA 5J5DA 4JAWA 2FKPA 1SO3A 3AWNA 5DY2A 2GVGA 4U5IA 1W5OA 4UFKA 1TB3A 1TCMA 4GKLA 2G4FA 1C8YA 3NO5A 4F9JA 1BGAA 6ENLA 4DO5A 4PEKA 4JX6A 2J27A 4QFUA 2PDPA 2X0SA 4MLJA 3DFQA 2RHGA 3LI1A 3O6YX 4H4IA 4J1OA 4UMAA 4O52A 1ZLPA 1WZAA 1TA3B 1CXEA 9CGTA 2GUYA 1I0BA 3QLDA 3HPFA 3HPXA 3V0UA 2OT1A 3GG0A 1CT5A 2YL8A 4G8TA 1LWHA 4IP5A 4X0VA 2V8ZA 1FH7A 3GXIA 3BARA 5G4EA 5I23A 4AY1A 3SIZA 2BXYA 1NWUA 3VU2A 1V6WA 2PTYA 3S5ZA 3HF3A 1CPUA 5GJNA 3IAPA 1OGBA 4X2PA 1ME9A 3BURA 3SQSA 3WQ5A 4GNVA 4UFLA 1XCFA 3L65A 4YU1A 1VCFA 2EHHA 5LA1A 1MYRA 1TPVA 5H91A 5F1VA 2ISDA 4R85A 2DVUA 3ITLA 1Z8AA 5IDIA 2WW5A 4H6EA 1N8FA 1OC5A 1UZHA 4HYVA 4JHZA 2FZNA 2CYGA 4NU7A 3P8IA 1OK4A 4QG9A 5CPOA 1HKWA 5E0CA 3VE9A 2FGZA 2YL9A 3U7BA 4BY3A 4YN5A 3E0VA 4WOQA 4CU7A 5CQ1A 3I7RA 1S3HA 3VD9A 3FVMA 3QR0A 3UVAA 3KOZA 1I0DA 3WQEA 5GNZA 3TP4A 3FYOA 5FJIA 5E09A 1QI2A 4J4KA 1M7OA 2O7QA 2WV8A 1FA2A 2PDQA 1NDYA 4O53A 4QISA 2ZTJA 4JTTA 2J8FA 3HTWA 3N6HA 2H6RA 4QP0A 3TH6A 3CIXA 4LY4A 2BGNE 1KXTA 4DBSA 2FQIA 1Q6QA 3TZFA 5FEPA 3PNUA 2D2GA 1OF8A 2ZZ4A 1KWKA 4GH3A 5REQA 1TMHA 5DRIA 2EKGA 3G1SA 5LA2A 1AH4A 4MLRA 1XINA 2PFHA 3BG5A 4J3UA 4L4OA 1Q7MA 1VFLA 3W2KA 5AHFA 4G1NA 5CZKA 2WSKA 1QW9A 1Z9AA 4CQBA 3BLDA 3B06A 1E6NA 3V75A 4LS1A 4FXRA 4WJ8A 4CD8A 3CJPA 2OOFA 3DCPA 1MVYA 3B03A 3CIWA 3NAVA 4N4QA 1ME7A 3KTXA 2I5QA 5BOFA 2CZDA 4OHQA 1UP2A 4N9DA 3U8GA 3KW3A 3VIFA 2IXVA 1A0CA 4QE5A 3MYPA 4QGCA 3UZWA 1DWAM 3S9ZA 2QYGA 5C70A 3LZ3A 2E4TA 2R24A 3FJNA 1FCQA 1QI0A 2OR2A 1VYSX 3RIKA 3SY5A 1EC7A 2C13A 4AIBA 2DP3A 2BNJA 2OT0A 3T2PA 2E40A 4DWSC 1E0TA 3W76A 4LYRA 1K7EA 1TELA 2PLMA 5XIAA 5E1QA 3WDHA 4ZL1A 4R9OA 1VEPA 4C6KA 1TJ2A 2Y24A 4OU1A 1UWQA 1TPUA 3EA3A 2B81A 4MYAA 4GXPA 2BODX 4QAWA 3MUAA 2OX1A 3L4ZA 3NO3A 2GOKA 3R10A 3R7MA 3VNKA 2VUYA 2WAGA 2XFRA 4H9ZA 3W07A 4HCLA 3UWZA 2J74A 1MI3A 3TYBA 3RO8A 5C0QA 2Y5EA 2J9YA 3MP4A 1IR2A 1ZQ5A 4IQEA 5H8PA 1KFJA 3CAKA 2FHBA 3VDBA 4MVAA 4DZAA 3UCCA 3LHUA 4CNOA 4NAFA 4LUYA 3FA5A 3QGAC 3DYPA 4HHMA 4GVGA 1I1XA 2J7FA 3WEMA 1KD0A 3WD2A 5HJLA 4GXWA 1EJTC 1MEIA 2FGLA 3AS2A 2GQ8A 4IP4A 3A6OA 1UHVA 4JIEA 2PDYA 1J12A 2AQOA 1ZRQA 3KEHA 1A5MC 5L6UA 3NO1A 1HL2A 4NI8A 1B57A 3PUGA 3ZJ7A 1M5WA 1HTIA 4WKHA 2G37A 2NSOA 2GGGA 3LG3A 5F2IA 1A3XA 4M29A 4GNJA 2CFFA 5C54A 4Q8UA 1UH3A 2JKAA 2ZFAA 1DEDA 3MUZ1 2BXZA 4O14A 3KS5A 4DJDC 1FDYA 3ZMRA 4WQ6A 1ZJHA 3LGEA 3XIMA 1OGGA 5G2HA 1ZS2A 3HMJG 5D2XA 2QR6A 2X0YA 1IEQA 1MEHA 3B8IA 5L9FA 4W85A 4YHGA 4AB4A 3KM8A 1QW7A 2RAGA 1ZY9A 2CU0A 3W2JA 4AAJA 4LC8A 1RLDA 1I6NA 1SM9A 4L1GA 3K8MA 3PUEA 4C7DA 3MZ2A 3G0SA 4DJFD 1Y65A 5A8MA 1S39A 3CQHA 2YZ5A 1LWIA 1F4AA 1LRTA 1LROA 2NQZA 3AYRA 2FH8A 2CKSA 4LUTB 1WUEA 4E0CA 1XIHA 5FA5A 3NM3A 1WBHA 4Y90A 3ALFA 3BL3A 2VD9A 3APYA 2OWXA 4EPBC 3OZPA 4YMZA 4O17A 2WSPA 1GOIA 2J4GA 3GDTA 3GO2A 2E7FA 1VP5A 2PTDA 5J04A 2JE8A 4U3AA 3N19B 1W54A 2CBJA 3KBJA 3WO8A 2YDQA 3UZZA 4GI4A 4PMDA 1TWDA 3WDPP 3GTXA 4P8UA 3CAVA 1LL7A 4PCTA 1TE1A 3SGUA 3SIMA 4WKFA 4AWEA 3RLVA 2Q6ZA 5I2UA 1F7BA 3QQ1A 2XM2A 4HHPA 3MVTA 4C6NA 4HA0A 2CBVA 1R9ZA 1V7AA 2DT2A 3LV5A 1K8ZA 2PB1A 2FFIA 4XZNX 3GXTA 1FFRA 4N02A 1TR1A 2QCHA 4YWIA 1JDEA 1F6PA 3NQBA 4LNYA 4ADSA 2VMFA 1AMYA 3KCOA 2P50A 5D33A 3SCTA 3VNJA 3ARRA 2ATSA 1Y5VA 2YCJA 4AZCB 3Q2DA 3WD3A 1M65A 4GVIA 3QM3A 1UWIA 4MY9A 1YE4A 2EPHA 1F05A 5A6AA 2DZTA 4QROA 5HOSA 3LYEA 2W9MA 1K4HA 4MUPA 1M7JA 3W1XA 1MXGA 4ZZ9A 1NH6A 4EK7A 1C7TA 2ONEA 3TU9A 1YEYA 2XH0A 1KTBA 5LGXA 3UZJA 1Q6EA 1EYWA 3AXXA 1VCVA 1TPH1 1KLZA 3DYOA 1MQPA 3MO4A 2WM0A 4WSHA 3AIVA 5DRCA 3IARA 3S0CA 2FPYA 5U7SA 4FXJA 3VGHA 2JKPA 4FF7A 4F0LA 4KIEA 1VZWA 1Z69A 2X40A 3VIMA 3DFYA 1JULA 3N2MA 4AD3A 3DHUA 1XBZA 5AY7A 2F6KA 4KEUA 1RBAA 1UOZA 4UB9A 4IXHA 3EAUA 4H19A 3LTPA 4OV4A 3AZSA 1IIGA 4Z1CA 1XYLA 4IL2A 1YDVA 3A5VA 3QPZA 4HHLA 2QJJA 3S5NA 5LNUA 3GYCA 2F6UA 1I2NA 4C6PA 3MV01 3WD4A 4PCNA 3CASA 3O0KA 1JCYA 2HZGA 1T7LA 2O0TA 3MHGA 2GGJA 2XVKA 1AL8A 4CNSA 1JXJA 1TWIA 1KCZA 5I78A 1W17A 3FNDA 2OPJA 3L4UA 1JYWA 6TIMA 3ATZA 3WLHA 2TYSA 5BOEA 2PWGA 2BVTA 2RDWA 4TOQA 4U31A 1EX5A 3H7UA 3KBSA 4FSAA 5HANA 5JBDA 5D2TA 4C90A 3G2GA 3KCJA 2QKFA 3UW6A 4FIQA 3MMTA 1XH0A 1V6VA 3QH2A 3CGTA 2P10A 2FJUB 4H9TA 2P8CA 4PFHA 1XISA 3P0WA 5A8PA 4O12A 3I3EA 5LHEA 2NV2A 3GG8A 6REQB 7REQB 1K8CA 1B5TA 2A3HA 1J9YA 3N9RA 4F0KA 1P5BA 4O1BA 2QJIA 1SFLA 5AN7A 1PO9A 3LGDA 4AIEA 4AD1A 2ZE3A 4NZ3A 4GIAA 5BRPA 2J7HA 3O16A 4NJKA 2WVVA 1LJYA 2DV0A 3GTHA 3ME3A 4X22A 3PTKA 3FAWA 4HJWA 1UPMB 4BI5A 2ZTKA 3HN3A 1UIOA 3BVJA 2VM8A 4HKPA 1VKFA 3WELA 2QZRA 4IISA 1W6TA 3VGEA 1SJCA 1OFAA 3ZLHA 4UTKA 2IUZA 4S3GA 1WO2A 4JN8A 2UY2A 1VJSA 3RJYA 1RVKA 4Y8EA 1ZU8A 4O11A 4YLWA 2XU2A 1Q4NX 1FWTA 2D20A 2YX0A 3ARPA 3ZXWA 3GAKA 1DJIA 3E3HA 3ERPA 3GH5A 5HPOA