1CNVA

Crystal structure of concanavalin b at 1.65 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
283
structure length
283
Chain Sequence
DISSTEIAVYWGQREDGLLRDTCKTNNYKIVFISFLDKFGCEIRKPELELEGVCGPSVGNPCSFLESQIKECQRMGVKVFLALGGPKGTYSACSADYAKDLAEYLHTYFLSERREGPLGKVALDGIHFDIQKPVDELNWDNLLEELYQIKDVYQSTFLLSAAPGCLSPDEYLDNAIQTRHFDYIFVRFYNDRSCQYSTGNIQRIRNAWLSWTKSVYPRDKNLFLELPASQATAPGGGYIPPSALIGQVLPYLPDLQTRYAGIALWNRQADKETGYSTNIIRYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of concanavalin B at 1.65 A resolution. An "inactivated" chitinase from seeds of Canavalia ensiformis.
pubmed doi rcsb
molecule tags Seed protein
molecule keywords CONCANAVALIN B
total genus 93
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 1995-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cnvA00
3S2CA 1JI2A 5M03A 3K8KA 4DUWA 1DWIM 4D6HA 1ESWA 1LWJA 1G01A 3A3HA 4DUXA 4DWSB 1TVPA 1UWIA 3L4XA 3VKKA 3SCWA 3UCQA 3MV11 1UKOA 3M07A 4CCDA 4EANA 6CGTA 3CZ8A 1KQZA 1PBGA 4U5IA 1E5JA 2J7DA 1FHDA 4W7VA 3B9AA 3IAPA 4W93A 1LG1A 2AMGA 3AZRA 3KL3A 3MMUA 4UOZA 2O92A 3VVGA 2VCCA 4W5UA 2DH2A 1M03A 3JUGA 1WDPA 4H8VA 4L4OA 3PTQA 2WHJA 4KMQA 4OOZA 3ARRA 1GHSA 4JL2A 2GJPA 2EPOA 1CXEA 1JXKA 5ABFB 5GNZA 1M01A 4MB1A 5HPOA 1CGVA 2G8ZA 1VENA 1XV8A 3VDAA 3EDDA 2YL9A 3FY1A 1B9ZA 3O9NA 1GW1A 1QBAA 3QGVA 3I3DA 2IXUA 3NYDA 1CXFA 3AIQA 4CKQA 4PMRA 1SFSA 1JNEA 3NCOA 2G3JA 3MUAA 1GCYA 1R7AA 4HTYA 2DT3A 3NUKA 1XD0A 3BXWA 3G6MA 1OB0A 2X09A 5C8BB 4ATLA 4AEEA 3B8SA 2YLAA 1IV8A 1HP5A 5A6SA 3K1DA 3PZUA 3L4YA 1W2VA 4GQQA 5CGTA 3OLIA 4KGLA 1LL4A 1HT6A 3OLDA 4OBRA 1X6NA 3WSUA 1UG6A 4W7WA 2BY0A 1UWSA 1K9TA 3OGRA 2YDQA 1FOBA 4W87A 2WNWA 3U57A 3UEQA 2FHFA 5HOSA 4Z2JA 1PJ9A 2BVYA 4LX4A 4GO9A 1CPUA 4CU7A 3IJ9A 1B31A 3OIHA 1VAHA 1IZJA 4RE3A 3QR3A 2W67A 5D8ZA 5CXPA 2WYSA 1LL6A 3VGFA 4CGTA 3VD9A 3DHUA 4CN6A 1VFUA 4UFMA 4AZBA 2OYMA 2D2OA 2A3CA 1E1FA 2YDSA 1QNRA 3SUUA 1ISZA 1C8YA 1XSJA 2VRKA 2CPUA 1U33A 1BPLB 4CU8A 1D2KA 1UD6A 1MQRA 2V5CA 2YKKA 3U5YA 1SMDA 4IM4A 2Y8VA 1V3LA 3BLPX 3SCNA 4U5KA 2VQUA 4MADA 1NP0A 1OD0A 1ZBCA 4ATDA 3BSHA 5D9NA 2XFYA 5I79A 1CGUA 1HJSA 3ZSTA 4CCEA 2CETA 3F5KA 2VCAA 3ZSSA 1CDGA 3LPGA 4JFWA 3FAXA 1V3HA 2RGMA 1J0ZA 4MJ4A 3HJEA 4V2XA 3ZT6A 3WDQA 3MS8A 4PMZA 1V0KA 1E9LA 4MB5A 3WDPP 1GJWA 2YJQA 1H3GA 1D3CA 1UR0A 1S46A 4AZCA 3BMVA 1C7TA 1LG2A 3GTNA 3AXHA 4J3TA 4FF5A 3ZIZA 5I5RA 2VRJA 3A4AA 2V3GA 4UFIA 1J0YA 4J7RA 4FMVA 4BQ2A 4HU8A 4N0RA 5AYIA 1UA3A 1PIFA 3SCVA 1RPKA 2WHKA 1OWQA 1W1VA 2VZUA 5D8WA 2VOTA 1H5VA 1HJXA 1RD6A 2WWCA 3N15A 2XFFA 3FHQA 3J7HA 1H09A 4J3SA 1VFOA 5E0CA 4DWSD 2VVNA 3WUBA 1PEZA 1KWKA 1QI4A 5I78A 3VIFA 4HOXA 4Z2LA 5F7UA 4JL1A 1UD4A 2WMIA 5HNNA 2W5FA 4EK7A 2ZX6A 4LXFA 2VZSA 3PZNA 3CTTA 3WF1A 3O2LA 2Y2WA 1HNYA 3HMCA 3WQ8A 4E2OA 5A6BD 2JEPA 1VBUA 4TVDA 3WDRA 1UUQA 5CGMA 3DYMA 4CD5A 1PAMA 3LMYA 3WQ6A 3PTKA 2WPGA 2VR4A 4ZFMA 1PIGA 1PX3A 1EOMA 3THDA 3VGBA 5CG0A 3ARQA 3ARXA 4AZ7A 3BCFA 1LJYA 1C8XA 1ZS2A 4WKFA 4AZGA 1RP8A 5JUVA 4Z2IA 2ZXAA 4PMXA 3AI0A 3CMJA 3ZR5A 5IFPA 4M8UA 1RH9A 3UERA 2CKSA 1V08A 1UWRA 3PZQA 5BYWA 3GNOA 1C8QA 3PTMA 4AIOA 4UOJA 3MSGA 1BYDA 1BFNA 2O9RA 2J7FA 4M56A 1CEOA 5A6MA 3I3EA 4WKHA 4D1IA 3VM5A 1TR1A 4MB4A 3VD7A 3KZSA 1BTCA 1GVIA 1EQCA 3W6LA 3MV01 4D6CA 4ATWA 4P8UA 2PWFA 3VGGA 3WF2A 1RP9A 5A8MA 3CUJA 5ABEA 1JGIA 3GH5A 2WB5A 3W82A 1G94A 5EMYA 4OIFA 3VIHA 5A6LA 3WH5A 1JFHA 1FP9A 1OT1A 1H41A 4J27A 3S6TA 5GNXA 2QV4A 3WEZA 2WZHA 1JAEA 1JDAA 1U30A 3NDYA 5CZKA 2EPMX 2XVKA 1WKYA 4BS0A 3WD3A 2V3DA 1V6VA 1JYWA 2WVVB 3BMWA 2VO5A 1V3KA 4R27A 1WDQA 1O7AA 1C7SA 1W9XA 1HVQA 2CHNA 4UQEA 5BRQA 2YA1A 4GZEA 2BXYA 5DT7A 4JFVA 3W29A 5BXTA 4FLRA 3AHTA 3N13A 4JAWA 3CBWA 2G3NA 5A3HA 3CH9A 2WVTA 4Q7NA 3VNZA 4MTVA 3AYSA 4F9DA 1SR0A 2O9PA 2ZUSA 2F2HA 3OBAA 3DC0A 1E4LA 3MUZ1 4JFTA 3AMKA 4ZE5A 2CIPA 5I24A 4GO8A 4W7UA 5AYBA 4QCFA 3AMLA 2PC8A 3OGSA 2MANA 5A2BA 3CZLA 4FLSA 2J74A 2ZXDA 3OLEA 4DM1A 2IXVA 1UKPA 1TA3A 2WMHA 4M24A 3RDKA 4ACZB 1NWUA 2DGAA 4U31A 2ZX5A 3RJXA 4M81A 5JIWA 2GFTA 3ARYA 2XPKA 3L4TA 2V3EA 3CHDA 1MXDA 1ZJAA 2VZOA 7CGTA 3A4XA 1VRXA 4BF7A 2JF7A 1KB3A 1CGYA 3AFBA 2PI6A 4KWUA 2EO7A 1OD8A 3PBGA 3QHNA 5KEZA 3N04A 3W28A 4MNMA 1CXIA 3AHYA 4OJYA 1OCQA 4X0VA 3BC9A 3DHPA 2J8GA 1GONA 2DH3A 4QLLA 4ML4A 3VIKA 2ZWYA 3NSMA 4CU6A 2J75A 4J3UA 4XB3A 1KWGA 3SUTA 1JI1A 1UWUA 3FAWA 3II1A 2YIHA 4F8XA 2DSWA 5IHRA 4CD6A 3VM7A 3AMCA 1J0JA 1E1EA 4GXPA 4EKJA 3WUGA 4JZ5A 4XZBA 4UTFA 4X9YA 2OYLA 4AEFA 5I0DA 3ALFA 3WNKA 2BXZA 3VX0A 5E9AA 1FA2A 4NRSA 5HBFA 3RM8A 1BYBA 4PUEA 3VIOA 2DSKA 2CESA 4GI6A 3GH4A 5GNYA 4NF7A 4PSRA 5I6SA 1FP8A 2VCBA 4QLJA 2J4GA 1K9DA 2VZTA 3T08A 4PUDA 3KWXA 5ABHA 3RMEA 1EDQA 5FOOA 2W91A 4KRUA 3ARVA 2D0HA 1J0KA 1KBKA 2XIBA 4B16A 1HX0A 2WK2A 3IJ8A 4LQ1A 3RO8A 2CBUA 3PZMA 2JEQA 3W24A 1XHGA 4TVCA 4D6DA 2XFRA 4ZXLA 1E4NA 5A69A 1B3ZA 1HJWA 1DEDA 2QPSA 3AIEA 1JZ7A 4ZEPA 1ISVA 1IZKA 4YHGA 3BAWA 3FNDA 2V38A 3MSDA 4P8WA 2EBNA 1E72M 2F8QA 4Y7EA 4PMDA 5IXEA 4E4PA 5DF0A 2B31A 2ZUNA 2PWEA 1Q6GA 4TTGA 1GNXA 2XYLA 4U3CA 1TVNA 4MDOA 4C7GA 1E43A 1Q6CA 1W3JA 1V0LA 4EE9A 3UR7A 2XSBA 2GSJA 3BAYA 2HISA 2OSYA 1V03A 5M3WA 3CLWA 2GDUA 3CHCA 3EDFA 4P7RA 1J01A 1DWGM 3WNPA 3AIUA 1E4MM 3AYRA 1MW1A 4FK9A 2XWDA 4PN2A 3VD5A 1HF6A 2QMJA 3T2QA 3WDJA 1UD5A 3BH4A 3WH9A 3CUFA 1UZ1A 3L4UA 3GXFA 1UD8A 2XIIA 3IAQA 2XGBA 1UD2A 4LYRA 5E6ZA 3VIGA 1GJUA 1WDRA 3W26A 1VJZA 4QLKA 5I77A 2J7EA 3G6LA 4PBGA 4W89A 3AISA 1V6UA 1EGZA 4BQ4A 1KGXA 2DEPA 3WBEA 1UR8A 1NARA 3B9EA 3GBEA 1ISYA 1HKJA 4JHZA 4HU0A 5GPRA 4YN5A 1LF1A 3AMGA 2GJRA 3WL1A 4RE4A 1NWRA 5FKYA 2C7FA 2G3IA 1I75A 4WKAA 3TONA 1AQHA 1VBRA 2E9MA 2EPNA 3EDJA 1XSIA 1CIUA 3WD2A 1ODUA 4UZSA 2J8FA 9CGTA 1E73M 2YA0A 3WN6A 3EMZA 2CHOA 4QDMA 2UWFA 3CPUA 1ZBVA 2YOCA 4KH2A 4URIA 3T0BA 4LYQA 4HZ8A 1QI2A 2IUZA 4H41A 1UWTA 4GIAA 1X6LA 1J10A 1DWFM 1V6WA 3CUGA 2G3MA 3W37A 3WF3A 3W0KA 1U2YA 1CNVA 1CGWA 1WZAA 4QCEA 4UNIA 5FCZA 2YBUA 2J77A 4AZCB 4MJ2A 4DM2A 3AXIA 4PMVA 1AQ0A 1JZ4A 1H0GA 3D3AA 4JIEA 3VMPA 1ZL1A 1UKQA 5A94A 1QHOA 1XC6A 1DWAM 4HA1A 1QW8A 1TCMA 2X2YA 3WH6A 2V5DA 5D9PA 1LLOA 5JBEA 1E0XA 2WMFA 1J12A 3DYOA 3WFLA 3VO0A 4AYSA 1M53A 2GJXB 4F79A 4UFKA 5BRPA 2DPEA 2DQXA 1BG9A 3W6MA 3BSGA 5A2AA 1GOKA 1OGGA 1E71M 1N82A 3L2LA 3EMQA 4XZWA 3GXMA 3VMOA 2D22A 1PX8A 5IHSA 2XVNA 4GQRA 1ZBKA 2TAAA 1JG9A 3OZPA 4BQ5A 1B0IA 1UH2A 2GJXA 1OGBA 3GDBA 5EB8A 1WE5A 4UFJA 1WP6A 5CLTA 4CD8A 1BGGA 3GXDA 3FHAA 4PTXA 1MQQA 2WMJA 2D0GA 1UKTA 1E6SM 1E6QM 5A6AA 3TOPA 4AD5A 4UQAA 1GQJA 3N1AA 5AY7A 2XG9A 3WNOA 1R8LA 3T2OA 1KGWA 4WF7A 2NSXA 3U7VA 2VX4A 3FXYA 3POCA 4MNLA 1HJQA 4HA4A 3ARZA 1CBGA 1WZKA 5BXRA 4A3HA 2ZWZA 1JZ3A 1UH4A 4UZUA 1Y7VA 3NJ3A 3WH7A 4KRTA 3WDIA 1GZJA 2FH6A 1EIBA 2E8ZA 1C90A 1EQPA 2XM2A 1HL8A 1BYAA 6TAAA 2AAAA 1H1NA 2D20A 2VX5A 3PZGA 5BROA 3VDHA 1C91A 2UY5A 3A4WA 5D9OA 5JBDA 1GQLA 3WENA 5JIPA 1A47A 1V0MA 4MB3A 3BLKA 4QAWA 2VR5A 3KEHA 1JYNA 1ITCA 3CUHA 1SYTA 3B9DA 3VIMA 1I1XA 7A3HA 1J11A 4PMNA 5JBFA 1VEPA 3E1F1 3WQ4A 3ZJ7A 4OKDA 1EHAA 4V28A 5BXPA 4HMCA 4W88A 2D3LA 1CLXA 1UWQA 2NT1A 3AROA 3VPLA 1P6WA 5A6BA 3TA9A 1E6NA 3N12A 3SEPA 1JD7A 1GHRA 2Q8XA 2VRQA 4CN1A 1FH7A 3LPPA 2DSUA 5CPTA 2WCAA 2A3EA 3MMDA 4BZYA 4D6GA 2WBKA 5GQBA 2J7CA 4M80A 1PX4A 1TG7A 2WLZA 3T09A 1V3JA 2YL5A 2FHCA 4TXEA 1JZ8A 4AC1X 1EA9C 2ZUUA 1X1NA 4U2ZA 3POHA 4YPJA 4IUGA 3SUVA 1UHVA 2Y8KA 1US2A 2JIEA 1V3MA 1QVBA 1B2YA 1EH9A 4LPCA 8A3HA 3K8LA 1K9EA 1KCKA 4ACZA 2ZIDA 1BF2A 1DP0A 2WWDA 3IJ7A 4RL3A 5E0FA 4H04A 1E3ZA 3WMSA 5LA2A 3AZTA 1HP4A 1W1TA 1UR2A 2VJXA 1AVAA 1EDTA 2PBOA 2ZUTA 1K6AA 2VUYA 1R85A 4CUCA 2WVVA 5A6JA 1UQZA 3GNPA 3MANA 4Z2HA 3RILA 5HDRA 2QPUA 1E40A 3WD0A 2WC7A 1HL9A 3WH8A 3AXXA 4XX6A 3GM8A 4AW7A 5I23A 3CHEA 1VFMA 4OUEA 2CNCA 1ZBWA 1HJVA 3VILA 1R87A 1UA7A 3PN8A 2WXDM 3WF4A 2VX6A 3AHZA 3WMCA 1B3VA 2FGZA 4PMOA 4CVUA 1E70M 1BHGA 1MQPA 1NP2A 2UY2A 3W53A 3VIJA 1VB9A 2WMGA 2DT0A 3LPFA 3QOKA 1J9YA 3MMWA 3T2PA 5A8QA 3ZT5A 3UETA 1WAWA 4PTWA 4AMCA 2PWGA 1B3YA 2VC9A 3DYPA 1JXJA 2J7HA 5C70A 2DSZA 1QI5A 3SCOA 2BS9A 3DECA 1PZ2A 3O6AA 3PZ9A 4PMQA 3HU7A 5ECUA 2WHLA 3VGEA 2J7GA 1GPFA 1NM9A 4TUFA 2FH8A 1DWHM 2WC3A 1CENA 1XGZA 1E3XA 4GI9A 3MO4A 1EO7A 1UZ4A 1ZU8A 4M1RA 2VMFA 4JFSA 1JIBA 2XGIA 1JFXA 1CLVA 4YHEA 4GZJA 1H49A 2XHYA 4RE2A 3UG3A 2WZEA 3AIBA 3AZSA 4DWSC 4OOUA 4B3KA 2J79A 1DWJM 4KGJA 2YL6A 1H11A 2Z1KA 4BQ3A 4LGXA 1UQYA 1W2PA 1V3IA 4U2YA 1NOUA 3K4AA 3W25A 4JCMA 3SCTA 1G5AA 3WEOA 2CKRA 4AISA 1MFVA 3WKZA 5CPQA 2GK1B 7TAAA 3TTOA 3KL0A 1WDSA 1YHTA 2E3ZA 2Z1SA 1JF5A 2XJ7A 2WC4A 2BVDA 1E56A 3BAKA 3SUSA 2W4XA 4F66A 5LA1A 1BAGA 2EPLX 2FGLA 1JNDA 1QI0A 1B3WA 3RPMA 2WSPA 1HIZA 2D3NA 3EDKA 2WKLA 3VDBA 2BNJA 2ZUWA 3CIVA 5E6YA 2XVLA 4EAMA 1EXPA 3NIYA 3SUWA 4FLOA 2Y24A 1OSEA 2X8RA 1BQCA 3AHXA 4PRWA 4C7FA 5A8OA 3WD1A 2E0PA 5D4YA 2WHMA 3ALGA 4ZENA 2NT0A 2W92A 1C3FA 4WSKA 4PTMA 1GQKA 3K8MA 3AICA 3W27A 1JZ2A 1W9DM 1WPCA 5IFTA 3ZO9A 2DIEA 1MW0A 5FIPA 3GXIA 4H8UA 4D1JA 5DT5A 2D23A 3AS2A 1B30A 2WKGA 4QP0A 4W84A 4CD4A 2WW5A 2OYKA 2NW0A 3CUIA 3SCQA 5E09A 3UG5A 3ARUA 4PSPA 1ZB5A 1KXVA 3CMGA 2G4FA 1CXLA 1UH3A 1W3LA 1KCLA 1QPKA 1GOIA 2DT1A 3WUEA 5IDIA 4P7LA 3VUPA 3HN3A 3QHOA 1JZ6A 2E8YA 1OM0A 4HPGA 2X05A 4TTUA 4HMEA 1C93A 4D6FA 1MW3A 2EJ1A 2WANA 1BVZA 4TVUA 3MUIA 3RJYA 1EOKA 2BHYA 2BV9A 4HMDA 1B90A 1XRVA 1CGTA 3TP4A 4MAVA 4AZIA 2CCRA 3N9KA 1FFQA 1GVYA 1AQMA 1OIMA 3VINA 1V02E 3TTQA 2BHUA 3MU7A 4XUYA 3VNYA 3VGDA 1MVYA 2JIWA 3UG4A 5LA0A 1WZMA 2WZIA 3CHFA 3RCNA 2CITA 2A3AA 4AIEA 3UR8A 2J47A 1ODZA 3IK2A 1GOMA 2CEQA 1XYFA 1FHLA 1ECEA 2X0HA 1UR4A 3WIJA 4AZHA 3PHAA 1TZ7A 2WAGA 2ZX9A 2E9LA 1KXTA 3NSNA 1ITXA 1H2JA 4PCTA 5EFDA 3M46A 2WMKA 5DO8A 2CYGA 1E0WA 1V6YA 3WY1A 5BCAA 3IANA 2XVGA 4AY1A 1XH2A 3ZQ9A 3VD4A 2A3HA 3K46A 2J62A 1OT2A 1QNQA 4OBSA 3FW6A 4W8BA 3BGAA 1KFWA 2V3FA 4MNJA 1KXHA 5I3DA 1QW9A 4UOQA 2VT0A 3ZJ6A 1CXKA 1KXQA 2E4TA 4QFUA 2YLLA 3M6DA 4CD7A 4GI8A 3OGVA 5HPCA 3NDZA 2OSXA 4P8VA 3I3BA 2JALA 1QI3A 2PF0A 2ZOXA 5ABFA 3FN9A 3RIKA 2O9TA 1W1PA 3ZR6A 4P7NA 4E8DA 1FH9A 2VQTA 2VNCA 2XM1A 1CWYA 3U5UA 4BA0A 4UQ9A 1NOFA 3PZIA 1KR0A 4D71A 4LYPA 4D6EA 3THCA 1ISXA 2WCSA 5M17A 4A3YA 4W85A 1NWSA 5DMYA 1ZJBA 1JAKA 3EMCA 3ZM8A 1CECA 3EYPA 3MKKA 4AWEA 3WF0A 1HN1A 1E6XM 3ZJKA 1B3XA 2QLYA 3ZJ8A 1V6XA 2VX7A 2AOSA 3GNRA 1H4PA 2BFGA 3CZJA 5CLWA 2BVTA 2PWDA 1E0VA 2OLHA 3CO4A 2QF8A 1E6RA 2ZX8A 4B9ZA 1IT0A 1J0IA 3VGHA 3WELA 4AD4A 3AHVA 2E40A 2OWXA 1US3A 1FH8A 4F9JA 2ZICA 1QOXA 3W38A 1F4AA 4WSJA 2W66A 3OLGA 3ZOAA 1W9PA 1TFVA 3OG2A 5C71A 1CTNA 1Q4NX 2WM0A 4HA3A 1LQ0A 1MW2A 1QHZA 3F5JA 4P7QA 1KQYA 1W91A 3AIRA 3CZGA 1HKMA 3T0DA 4GKLA 3CZKA 1AMYA 1MFUA 4XV0A 4ZE4A 4OZOA 3W81A 2D1ZA 2E9BA 1WNOA 3WBAA 3WNLA 3AJ7A 2FDMA 1D7FA 3VIPA 4PMUA 1PPIA 5CQ1A 1G9HA 4MDPA 2VURA 4GPNA 4P8XA 4D6IA 5LYRA 4CCCA 4UR9A 4NI3A 2DIJA 5EBAA 4DWSA 1GOOA 1CZ1A 1DHKA 2C0HA 3VX1A 3WUFA 2VI0A 2XTKA 1G1YA 3SCSA 2JF6A 2ZUVA 3D5HA 4HZ6A 1CXHA 2VZVA 1JYXA 4IPLA 5DFAA 1OINA 1W1YA 1W3KA 1R86A 1EO5A 2ZX7A 5FL1A 1VEOA 3AMDA 3WMBA 4W8LA 1CYGA 1ISWA 2Y5EA 5BXSA 1JDCA 2PB1A 3PZOA 2WLYA 2QHAA 4J3VA 2GVYA 1GORA 1W9BM 1OBAA 1BGAA 3WNNA 3APGA 4BCEA 4AZ6A 3KE0A 1GUVA 1BSIA 5FL0A 1NQ6A 4J3XA 1Q6FA 1HXJA 1Q6DA 1JZ5A 3VTRA 2DDXA 4HOWA 1KGUA 1GOWA 3GBDA 2WVUA 5E70A 5FD0A 1J18A 4Z2KA 1M04A 1G0CA 3AIWA 1J0HA 4UQCA 4UFLA 4PYSA 1QNSA 3BAXA 1HJUA 3VD3A 4R5EA 1O6IA 1LL7A 4N42A 4C7DA 3OB8A 3MUY1 2J78A 4W8AA 3CGTA 3SCRA 4HPHA 1OGSA 2D24A 4X0NA 1H0IA 1W9VA 3SCPA 1E15A 2G41A 5A6KA 2XVPA 4H8HA 2O9OA 3F5LA 2XSAA 2JE8A 1TE1A 2UY3A 4IISA 3QHMA 3ARWA 2DSVA 1V0NA 2ZXQA 1W32A 1XSKA 1JD9A 2YBTA 4NSBA 4PCSA 3OA5A 4JCLA 5KZ6A 5BWFA 4JKKA 2CBIA 4UQDA 3AS0A 3WDHA 3AS3A 4W5ZA 3WQVA 3VOCA 4K68A 4UFHA 1F4HA 1QHPA 1UD3A 1VF8A 4TX8A 3WNMA 3N11A 2CBVA 4GINA 2ZXBA 4CVWA 1E5NA 1VEMA 2ESCA 1EHNA 5AC4A 1BLIA 1I1WA 4J3WA 2UY4A 5EFFA 2WBGA 2BY2A 5D9MA 6A3HA 1NOWA 3VDCA 4D6JA 4WK9A 5CSUA 2X1IA 4PEEA 1UR9A 4JKLA 3ZT7A 1XCWA 4WJXA 2BHZA 1LWHA 4JHOA 3WQWA 2OWWA 4B9YA 2EEXA 4Q22A 2GK1A 5HXMA 2W63A 3WL0A 1E55A 4B15A 1HKIA 3GZAA 4JFUA 2FHBA 3RM4A 1V02A 4IPNB 3TTSA 3L4VA 2XWEA 2VTFA 3N18A 4D72A 4J28A 2YL8A 1JDDA 4Z2GA 1EDGA 2VVSA 4WLCA 4MPKA 2Y4SA 1WZLA 4NRRA 4L4PA 1YQ2A 3TTYA 2HVMA 3A47A 2OSWA 3ARTA 2DT2A 4P7OA 3ECQA 2PBGA 3L4ZA 3N17A 1FFRA 5TD4A 5I2UA 3GYCA 2C8NA 3M7SA 1WO2A 1QNOA 3SURA 2YDRA 2F61A 3PZTA 4ZXOA 4CN4A 3WQ5A 8CGTA 2EQDA 3EDEA 4TOQA 4DUVA 3BAIA 3PZVA 5DEZA 2WSKA 2WVSA 1Z32X 1JF6A 5M5DA 4H2CA 3VU2A 3BCDA 4WIWA 1E4IA 4NZCA 1Q6EA 1R7OA 3SCUA 1TA3B 3L2MA 3CZEA 3AOFA 4GZIA 1NWTA 1XH1A 2VL4A 4HZ7A 2A3BA 3EBVA 3U7BA 1JYVA 3F4VA 3ZMRA 3AS1A 3NSXA 1W3HA 1C92A 3KL5A 4UQBA 1M7XA 4HP5A 4U33A 1HVXA 2CERA 4E8CA 3UESA 4MAZA 4ACYA 2GUYA 3T0AA 3VMNA 5A8NA 1BVNP 5A8PA 1HKKA 2CXGA 4S3KA 5CPSA 4H7VA 5A1AA 3WD4A 4V27A 3QOMA 1NH6A 1VFFA 5ABGA 5A95A 2D0FA 4AD1A 1BG4A 1SMAA 1JL8A 1UR1A 2QMKA 1DTUA 3RM9A 1BYCA 1XYZA 2EPKX 2X0YA 4AD2A 1E6ZA 4MNKA 1GOQA 1WB0A 4W86A 5CJ5A 3WFZA 2ZE0A 2BY1A 3AQUA 4PMYA 4UCFA 2EXOA 2WMIB 1PZ3A 3ARSA 1W9UA 1KR1A 4TX6A 1TUXA 4JKMA 4PTVA 3W4RA 3OZOA 1UKSA 3LPOA 3K4DA 2CBJA 1MWOA 4AD0A 3VIIA 5AC5A 1VIWA 2JFEX 1TMQA 3BAJA 1L8NA 1CGXA 1XH0A 3A6OA 2XUCA 2W62A 1VJSA 1XD1A 1GQIA 2J7BA 2WCGA 1KBBA 3ARPA 3GH7A 1MXGA 1QNPA 4AD3A 2W61A 4B3LA 2J25A 4A4AA 4AXNA 1L0PA 4M29A 2YA2A 2ZUMA 2RGLA 1QBBA 1B1YA 4S3JA 4FLQA 4HOZA 4AIUA 3WEMA 1MYRA 5CSYA 1OIFA 3SIMA 2GDVA 1WCGA 2PWHA 3AIVA 1A3HA 4AZ5A 2OWCA 1K9FA 1XCXA 4U3AA 1E6PA 1UOKA 1UYQA 3L4WA 2BY3A 5A2CA 4M82A
chains in the Genus database with same CATH superfamily
3B0VC 1FQ0A 3AUOA 4X9SA 3RCMA 2I16A 4INFA 1DWIM 1VHCA 1G01A 4WOZA 2VEKA 1LM1A 4BJHA 1WDWA 3VKKA 3LU2A 4DZIA 1UKOA 1VQTA 1FWDC 4RDZA 4EANA 5AHMA 3NTYA 3CZ8A 3C2YA 1EGMA 2BXVA 2GSEA 2OMAA 3AZRA 5AKQA 3MMUA 3VVGA 3CAVA 2J66A 1HUVA 1DPMA 4KMQA 4FX6M 1P1MA 3IV8A 4O57A 3V0TA 4O18A 5CPNA 1RALA 2OOGA 3QV6A 1CGVA 2BLEA 3EDDA 3MI3A 3UXAA 4A2SA 2YL9A 1B9ZA 1U5VA 9RUBA 3QGVA 3I3DA 3LV5A 3NYDA 1CXFA 3CUXA 5KINA 3A5VA 1SFSA 2V2CA 2G3JA 3EX1A 4TX9A 3NUKA 2HSAA 3PPGA 3CASA 1IE7C 4ATLA 1EC9A 4L1XA 4MKSA 4XZLX 1IV8A 3PZUA 2RDTA 4OU1A 3EWXA 3G1YA 2I17A 4C1LA 3DI0A 1X6NA 2POZA 1LUCB 2NQZA 1NFGA 1SJCA 1K9TA 1TWSA 3M0YA 4W87A 5HNTA 3VKAA 1H1ZA 3UEQA 5F2MA 1JCJA 4K2SA 4GOAA 4N4PA 3OIHA 4O4VA 3QW4B 4YCOA 4WXYA 4BEUA 5CXPA 4E2BA 4LEFA 4H1ZA 3VD9A 4CN6A 4F0HA 2KX9A 4Q4QA 1Z44A 2A3CA 3L67A 1E1FA 4Z0JA 1QNRA 3NXFA 3BLFA 1R9ZA 2FIQA 4C6QA 1XSJA 1CX9A 1QO2A 2GGGA 4RPQA 2CPUA 3LS9A 3V18A 3MPGA 3FYOA 1FDZA 3HFYA 3DUGA 1MQRA 2V5CA 3GAYA 4DJFC 4AMAA 1V3LA 3BLPX 4GUIA 2VQUA 1GTHA 5KZMA 1NP0A 3BSHA 1LBLA 2XFYA 3ITGA 5I79A 3H4WA 3F7JA 1NDWA 1HJSA 3ZSTA 4CCEA 3R0UA 4AWUA 3GU2A 3B9OA 1CDGA 3LPGA 3FAXA 1FX6A 2W6RA 3PJUA 1ML1A 3ZT6A 2EAWA 3QFWA 4RNIA 4PMZA 3BPWA 5DN1A 1KBIA 1YPXA 4DJFA 4G7EA 1UC5A 2JK2A 1F73A 4H19A 1A53A 1S46A 5LHFA 3PAJA 3BMVA 5I5RA 3AXHA 3HPFA 3ZIZA 3NNTA 1JR1A 2V3GA 3IRSA 3LV6A 3TWBA 4ZB2A 1PIFA 4WVXA 2WHKA 5KSWA 2HBVA 3Q2DA 2VZUA 1MEWA 4IP7A 2REQA 3JZUA 1HJXA 3NEVA 1RD6A 1YTDA 3GG0A 3FCPA 2ASHA 4QSFA 6REQA 3LBMA 4J3SA 4JDBA 1R3SA 3INPA 2OZ3A 2VVNA 1JRBA 1F3TA 1V8EA 1HKWA 1PEZA 4F2BA 3VIFA 4HOXA 3EX4A 3W7KA 4YJ5A 1FXPA 4JIRA 3TYAA 5KITA 3OVQA 3HMCA 4Q8PA 4E2OA 4ICCX 5HJYA 3IJ6A 4H6KA 3EOEA 1PE1A 4CD5A 3TIMA 3WQ6A 3L12A 2G0WA 4ZFMA 4L4MA 1Q45A 1FY6A 3GXTA 1K3UA 3ZLGA 1SZFA 2J6VA 3SRFA 2R1KA 4B4HA 1X98A 2Z6JA 3UZYA 3ZR5A 2WJFA 3FFSA 1JPMA 3UERA 2CKSA 1V08A 2G4JA 1TJRA 3S83A 1C8QA 2PDIA 4O1FA 4ASTA 3T42A 3N2CA 3LHWA 4M56A 1CEOA 3KLKA 1XI3A 2UZ9A 1SVDA 1GVIA 1EQCA 3VOJA 1TPFA 1DJXA 5ABEA 1JGIA 5C6MA 2VFEA 1BWVA 5G1MA 1R3VA 2RDUA 3WH5A 1JFHA 1S2WA 4LUJA 3EWWA 3UPMA 1TMLA 3GTFA 5HMEA 2OZTA 4DJDD 1RBOB 5GNXA 5I03A 2QV4A 3DC8A 1LRTA 2WZHA 3LCGA 3O6YX 3FA4A 1TVLA 3ITTA 1AUSL 1A0DA 1Z69A 1WKYA 1ZZMA 1RBAA 1KTBA 3UGVA 3WD3A 4XVEA 3G5EA 3FKKA 4R27A 4Q8TA 1XRTA 2WV8A 5D03A 1TIWA 5LKYA 1C7SA 1ZJHA 2CHNA 2H8ZA 1OFEA 2AGKA 1MZHA 5D33A 1H7WA 2A7NA 5DT7A 3TSDA 1W5QA 5LNSA 1Z41A 4JFVA 1E9ZB 3PJWA 1TJ2A 3EKLA 2PAJA 1VYRA 4F9DA 6TIMA 3TZNA 3NYZA 1E4LA 2FVMA 4I8YA 2QUMA 3VI2A 3HG4A 4Y2WA 3VAVA 4IMCA 5CSSA 1UC4A 3OGSA 1IGWA 4UR8A 5A2BA 2YBVA 2HVNA 1SO6A 4DM1A 4Q8NA 3ZS4A 1VFTA 1IEIA 3NQCA 1R3QA 2I14A 4M24A 5AYYA 3TN4A 3NL2A 4ACZB 2QCLA 1NWUA 1LQ2A 2DGAA 2PSNA 4U31A 2PDHA 4HPXA 2WPBA 5JIWA 3L4TA 5MHBA 2V3EA 3A13A 3UXKA 1AQFA 4ICNA 4NYUA 3CNYA 4GNJA 1A5MC 4K8EA 1EUAA 3AFBA 4HYRA 5KEZA 1ADDA 4WY0A 1OYCA 2YCKX 1S2UA 4MNMA 4GYKA 1CXIA 4OJYA 4X0VA 3BC9A 4WQ6A 5FF0A 5TIMA 2ZWYA 4B4FA 1UWUA 1XGEA 3I6EA 4KIRA 1XIDA 3VKJA 4QAIA 2DSWA 2FZBA 2VHLA 3NQBA 4GXPA 4EKJA 1QATA 4FB7A 5AVNA 2ZZ7A 4XZBA 3U8GA 4S3DA 2OYLA 5I0DA 3F4WA 3A9IA 4G6CA 5I02A 2I7GA 2NX9A 3ABOA 1R30A 1B3OA 1FA2A 3AC0A 1FWJC 1ENUA 1BYBA 3SGUA 1GG1A 3GH4A 1KM1A 4NF7A 4PSRA 1QXLA 5I6SA 1E1CA 3R89A 1F9CA 2VZTA 3I4EA 3MKVA 4PUDA 3B0PA 2QIIA 2QXWA 4S3FA 2WK2A 1EFZA 4O11A 5LXEA 1KTCA 4AU0A 4YXGA 3IJ8A 4LQ1A 2CBUA 4D6DA 2XFRA 4A35A 1E4NA 5FEPA 2XIMA 2FLIA 1RY0A 1JZ7A 1MO0A 1W5NA 3GDLA 1ISVA 3BAWA 3FNDA 3FA5A 3UWZA 4PZVA 2OGJA 3TN5A 2PTZA 4P8WA 5IXEA 4E4PA 3PB2A 5DCDA 4TTGA 4ZB0A 4U3CA 3BJFA 5CPOA 4HSNA 1POJA 3PULA 2XSBA 1BXBA 4GHRA 3OG3A 5M3WA 1NELA 1V03A 3CHCA 4P7RA 3ME3A 3CQKA 4C6JA 3VD5A 3D46A 1VYPX 1V93A 3P2VA 3BH4A 3L4UA 3IAQA 3GIQA 5E6ZA 1W0MA 4GYPC 1WDRA 1LQAA 3W22A 2J88A 1IT8A 4QLKA 3G6LA 3AISA 1EGZA 2V5KA 1UR8A 3B9EA 1R3RA 1PB0A 4N9BA 4PUUA 4YN5A 3B06A 3NAVA 3G24A 1X8CA 1KV8A 3LHTA 1IYXA 3GE7A 4KIEA 2C7FA 1XLMA 3GC5A 4WKAA 1AQHA 3B0YA 3GYEA 2QJNA 1XSIA 3G8EA 2A3LA 3PWIA 3EMZA 2CHOA 3FGCA 4GX8A 2YOCA 4OTKA 3GFZA 4HZ8A 4H41A 2GOKA 2XDFA 3P74A 1WX0A 4QDWA 1EPVA 3BLEA 1X6LA 1J10A 3M9YA 1Q6LA 2XH0A 5ENLA 4DPQA 1RHCA 1U2YA 3S47A 3U4FA 4FA3A 4L1GA 3E74A 3SI9A 3G1FA 1MNSA 4DM2A 3ABQA 1XIMA 5AHNA 1KFEA 2D69A 4MHBA 2Z29A 2C3ZA 4NNBA 1EUNA 1QWGA 3RLVA 4WHBA 2QUVA 4RZBA 1XC6A 1DWAM 2XN0A 4NZ5A 4RXFA 1VC4A 3N14A 3APYA 2WMFA 3KXQA 3B8WA 3UA3A 3WFLA 3HO8A 2GJXB 4F79A 3VUSA 4NX5A 1BG9A 3W6MA 3WLHA 3AXMA 1GOKA 1OGGA 6XIAA 3B8IA 3O6DA 3UVIA 1UZDA 5F4XA 3EMQA 4XZWA 3GXMA 4QIUA 2D22A 4B5XA 4J40A 4NAFA 3K4WA 4XKMA 2XVNA 4GQRA 1DJHA 3UWUA 1ZBKA 1JG9A 4OT7A 4BQ5A 1B0IA 5EB8A 2NLYA 4HZMA 1WE5A 1XYLA 1L2UA 4RKAA 1PDYA 1X39A 3ANYA 3GXDA 3E0WA 1D9EA 2O4QA 3ERPA 4C6IA 5T9BG 2DW7A 3WMLA 3RNDA 1E6SM 4G9PA 4AD5A 3AUJA 2OKOA 3N1AA 5AY7A 4WDWA 1P0KA 3PANA 1ZP3A 2Y70A 2VX4A 3MW7A 4OBTA 1ADSA 3NL3A 2BSLA 4MNLA 1HJQA 4HA4A 3H70A 1ITUA 3SFWA 1YE6A 2GGIA 3ATZA 3TROA 1GZJA 3QH2A 4PCFA 5FAGA 2D20A 3W7JA 4DJDA 1W5PA 2NV1A 2Z1VA 3MP5A 1RLCL 3KRUA 1GQLA 3NEHA 3NL5A 3FEQA 1OYAA 1V0MA 4MB3A 1IWBA 2DZXA 1SYTA 3VIMA 3W85A 1YRRA 1Y5XA 3C2VA 3KP0A 3E1F1 3HPAA 2YB1A 1XDMA 4Y96A 1R9YA 1I9CB 2D3LA 1UWQA 5C2CA 4JNYA 1PS9A 1P6WA 1E6NA 4TIMA 1CB7B 2VRQA 4CN1A 3S46A 1OX4A 1VRDA 2DSUA 4A3UA 3MMDA 1H50A 4NKCA 4FHAA 1PX4A 4M80A 1TG7A 3V3WA 3N3MA 4Z1CA 1JCTA 2WLZA 3T09A 5CZTA 1GZGA 4NT0A 1ZSXA 4OGZA 3QRHA 4IP5A 4RW3A 4YYFA 3V5CA 3R4IA 4AC1X 2ZZ2A 4BHYA 4PMJA 3LX9A 4IUGA 5EPDA 4NJJA 3H2NA 2JIEA 3M41A 2HBXA 3CQIA 4LFYA 1BXNA 4AVNA 1XLFA 1EH9A 8A3HA 4NJGA 1KCKA 1VKFA 5HULA 1VZWA 1TTPA 1DP0A 3W7OA 3NQ7A 4N7QA 1DJGA 1ZGDA 3OTRA 4EP8C 3RYSA 3VZXA 4B2DA 2HMCA 3WMSA 7ENLA 3KBMA 4JNZA 2VJXA 2ZBTA 1IXOA 3STGA 2ZZ4A 4E38A 1KM3A 1Q6OA 2VUYA 2WVVA 5D2WA 4ORMA 3TW7A 5A6JA 5AOUA 3IK4A 5D2VA 1W56A 4H6EA 3WD0A 3WH8A 3AXXA 1I2NA 1S5NA 2D2GA 3CHEA 4UR7A 4A29A 3SDOA 1BRLA 5G2IA 1TX0A 1ZBWA 3VILA 1R87A 2G95A 1W17A 4GXMA 1LT8A 5G2WA 2VX6A 1M7JA 1B3VA 2FGZA 1Y5VA 3PF3A 4PMOA 1E70M 1SZNA 4DWDA 4Q4PA 3O06A 5L9FA 4I9MA 1Z8AA 3HG3A 2GUUA 4GX9A 1N8IA 1VB9A 2WMGA 2DT0A 3LPFA 4LNCA 5AC8A 3DZ1A 3SGZA 3MMWA 1OX6A 3ITLA 5A8QA 2IW0A 3ZT5A 4HNCA 2O7QA 1B3YA 3R6IA 2ZRUA 2BDQA 3AU6A 7XIMA 4IQLA 1NM9A 5CPMA 1SSDA 4TUFA 1JUKA 3LCHA 5LHEA 2OLAA 4GI9A 2ZADA 3LHYA 2BMBA 3LXBA 3O3RA 4M1RA 3SO7A 5LSMA 4JFSA 1JIBA 1JFXA 3PUEA 4RE2A 1PL9A 2WZEA 4US6A 4DWSC 1C29A 4B3KA 5MKGB 3QPZA 3FV9A 2YL6A 2XIQA 3Q67A 4K37A 4N6EA 3L66A 3C5QA 4U2YA 1EEPA 2MUCA 3W25A 4JCMA 3SCTA 1G5AA 4N9CA 5HUOA 3CYVA 4IIGA 1MFVA 7TAAA 3ONCA 3KL0A 4X61A 4G2DA 1WDSA 3L7RA 1JF5A 4H7ZA 3TJXA 2XJ7A 2BVDA 1MEIA 2O56A 3BV7A 4MFDA 2Y61A 4GY7A 2ZDRA 2WSPA 2D3NA 2P0OA 2DZTA 5BU6A 3SSZA 3VDBA 2BNJA 2VM8A 3CC1A 3SRHA 2R1NA 3SUWA 3DFNA 4H9UA 2DP3A 3VABA 2X8RA 3WD1A 2WHMA 1FWHC 1XIHA 1XLIA 1C3FA 2FQIA 4PR4A 4XBSA 3UGRA 1FWRA 3K1GA 3W27A 1JZ2A 1WPCA 2P1FA 3ZO9A 2VD8A 4NZ4A 3AS2A 3FSUA 2WKGA 4HK5A 4W84A 5LGZA 4GQGA 1ZB5A 1KXVA 3G1AA 1UH3A 1W3LA 5A5WA 1P0NA 2DU2A 2DT1A 1UJQA 1FHUA 1JZ6A 4QISA 3KCJA 1TWZA 1R6WA 4HMEA 1UP3A 3E0VA 3E12A 4L7ZA 2PWVA 3H6OA 5B7YA 1P4CA 3TP4A 5H6HA 1SW3A 1AQMA 1OIMA 3VINA 5H8MA 1BWKA 1V02E 3MU7A 4QNEA 3UA4A 3BLOA 1M7OA 1TZ9A 4XAZA 3VNDA 3GVWA 4B3ZA 4IX0A 2Q8LA 1K8ZA 2A3AA 4AIEA 2J24A 3ENLA 1F3XA 4DNMA 3HFTA 1FHLA 4JXCA 5EMUA 2ZX9A 3NSNA 3DBPA 4PCTA 4GVHA 4DAIA 3SW6A 1EWDA 3HPXA 3KS6A 4IQJA 2WMKA 1VPQA 5B80A 1E0WA 1UR3M 1YTKA 3MP3A 3S4TA 3UD6A 2A3HA 4PRRA 1OT2A 1QNQA 4OBSA 3KVJA 3MZNA 5TF0A 1UCWA 2V3FA 5I3DA 4JN6A 2PDBA 3REQB 3GHRA 2A79A 1V7YA 1CXKA 2DQWA 3TV8A 3C52A 1FWNA 2FPYA 2OSXA 1Q6QA 1HQTA 4KPLA 3WJZA 4MZ1A 4O15A 3O1NA 4P7NA 4E8DA 3MB9A 3H2CA 3C8FA 3EGJA 3TNOA 1FH9A 2ABAA 1XIJA 4AC7C 4BA0A 3BARA 1NOFA 3DGRA 2AL2A 1S2AA 2WCSA 3RITA 3ITOA 2Y7GA 2HS8A 4DO5A 3CL7A 2OODA 2VWSA 1JAKA 1E0TA 3ZM8A 1SGJA 1J93A 4GIEA 2QCNA 3GR8A 1VIZA 2E7FA 4IFKB 3TQ0A 4B92A 3GNRA 2TPSA 3UJRA 2BFGA 2BVTA 3MZ2A 2CLKA 4M7TA 4N4QA 3VGHA 1J6PA 3W7CA 1PTGA 3W1MA 3ABSA 2W9MA 1F61A 5AHIA 2W66A 1I0BA 4JTFA 3RX2A 3OG2A 4IWWA 5C71A 1CTNA 1Q4NX 2WM0A 1LQ0A 3GHUA 2X2GA 4LAMA 4MZ8A 4DYJA 3AIRA 3BICA 3CZGA 3T0DA 4GKLA 4GLEA 1I2QA 1O5QA 2RKXA 3VKDA 3WBAA 3WNLA 4NZJA 2X41A 1TJ0A 4Y9PA 4AH7A 2VD9A 3MBDA 2OZ0A 4IMEA 5BW6A 3DKLA 4WRHA 4ILSA 2Z1WA 1PPIA 3PUGA 4K1GA 3UWQA 4LUYA 3WQGA 4ZMGA 3I65A 3W71A 4UR9A 5EBAA 1GOOA 2ACRA 3L9CA 4GGHA 3MSYA 1QPQA 2C0HA 3TOYA 3N6QA 2DZPA 3AU2A 2V0TA 3OZYA 2XTKA 5EL1A 2NXIA 4A8LA 4L5ZA 5DFAA 1W1YA 4E2DA 2XH7A 1R86A 3GG1A 4R85A 3S42A 3QY8A 5FL1A 1VEOA 4IPPA 3WMBA 3TQVA 2PDUA 3UJEA 3C2RA 3QKZA 4AVOA 4J3VA 3A64A 5CSRA 3E0FA 1BSIA 5FL0A 2B4GA 1RK5A 2PCEA 3MCNA 2WZTA 4NL1A 3IUHA 3RUBL 1CW2A 1OZMA 3VTRA 1R38A 2E1DA 1RJRA 3KBVA 4LJ3A 3SJ3A 1NDYA 3CB8A 4DBDA 1M04A 4M3PA 4S3CA 4UQCA 4PYSA 1HJUA 4R5EA 3R8HA 2NQLA 3QV7A 1XYMA 2BTMA 3MUY1 2BVWA 2J78A 4HSOA 4X0NA 1H0IA 7REQA 1YDVA 1NTHA 1FCQA 4ZOAA 3WJXA 2XSAA 4DJFD 1PYFA 4XIAA 1RJPA 4IISA 5FJTA 1V0NA 1TPDA 2Z7KA 1W32A 1JD9A 2YBTA 4PCSA 4JCLA 5BWFA 3MJYA 3TKFA 3IGUA 3AS0A 3MCOA 3WDHA 2ISWA 4W5ZA 3VOCA 3WQVA 4K68A 3LK6A 2VGBA 4C6BA 2R82A 4H9YA 2C71A 3DH7A 1UD3A 4IG2B 3LN3A 1Q5MA 4Q4RA 3G18A 3CTLA 2ESCA 3NGJA 1XIIA 1CCWB 4L6DA 2EGZA 1XX1A 1PIIA 4QGCA 1I1WA 1WKEA 3BG3A 2WBGA 4O52A 3VDCA 1DV7A 3IGHX 4CQ9A 2X1IA 1HKVA 1OEPA 2Q09A 1P7TB 1O4UA 1BD0A 2W63A 3MBFA 4MUZA 2WSRA 4IIHA 3W7NA 2Y63A 4B15A 2DZSA 3GZAA 4JFUA 3RM4A 1SZEA 5I06A 3TTSA 1T8QA 4IG2A 2YL8A 2VVSA 4M19A 3BANA 2FVKA 2DIKA 3KTSA 2NUXA 3TTYA 2HVMA 5G5IA 4DF2A 4N6FA 4YL2A 3ARTA 2DT2A 1UPMB 4PUWA 3EPOA 3ECQA 1ME9A 3KBSA 1H7PA 3GFXA 1MZRA 1X1ZA 3E6EA 3CLMA 3GYCA 3UVAA 3M7SA 4FNRA 1ICQA 2YDRA 3H22A 3PZTA 7PTDA 3WQ5A 2EQDA 5C55A 4TOQA 3ZWTA 4LAKA 3AALA 2WSKA 3TFCA 2P88A 2QNEA 3QW3A 3JS3A 3VU2A 1M41A 3UYIA 1AJ0A 3NA8A 4E8GA 4NZCA 2DV0A 3M5XA 4HHMA 5I3HA 1YXDA 3L2MA 2KAUC 4S3BA 4GZIA 4IH3A 1NWTA 3TC6A 1SR9A 3GTXA 4HZ7A 2A3BA 2YZRA 3EBVA 3U7BA 3ZMRA 4UUIA 2WZMA 2NVDA 4UQBA 4U33A 4NJIA 2CERA 1EX5A 3W2UA 4MAZA 4ACYA 2ANUA 4F4RA 2QCMA 2E68A 1N55A 5CPSA 4AIBA 5CC5A 4DHGA 3SQMA 5D2XA 4JN8A 4JPGA 1VFFA 5A95A 2D0FA 2PEVA 3LTYA 4G1NA 5LIUX 1JL8A 3KM8A 1DTUA 2L5HA 1RQHA 3M44A 4MSSA 5JH2A 2EPKX 4LEQA 3IIOA 1GOQA 2R24A 5IM51 4N9DA 2BY1A 3UQNA 4UCFA 5LIWX 3K5XA 5EGRA 2QDGA 3ARSA 4TX6A 3CV6A 2ALRA 2J9XA 1O66A 4Q33A 4DZAA 2XSXA 1MWOA 4DXKA 5AC5A 1VIWA 1TMQA 3R10A 4LOCA 4CNUA 3H4GA 3GLCA 1XD1A 2WCGA 3IIXA 2QZRA 1QOQA 1W54A 3E2QA 3GW0A 4D8ZA 4ZR8A 4AD3A 3KZPA 1UOZA 3FLUA 2J25A 4M0XA 3N2BA 2YW4A 4M29A 3JVAA 3NGFA 2RGLA 1QBBA 1G67A 5BU9A 2OQYA 1AZ1A 4H01A 4HOZA 4NAEB 1G7UA 3GD6A 5CJMA 1MYRA 3QV9A 4GVFA 3WEMA 4S1FA 5CSYA 3CAWA 2GDVA 3MUXA 3QYSA 1W37A 4L61A 4GUJA 4JQ2A 2BY3A 1LOQA 4WY0F 1S38A 3LSBA 3WZ0E 1O60A 3L5MA 4S38A 1TYGA 5CC7A 2QKFA 3H2AA 3M5ZA 4D6HA 4G5DA 1ICSA 1LWJA 3N73A 3LGEA 3MY9A 1TVPA 2R1PA 4H8NA 3L4XA 5TBOA 1SJDA 3P84A 2E1WA 2FFCA 4NVTA 6CGTA 1KM2A 1KQZA 3NL6A 3S2NA 3TCEA 5FJJA 1PBGA 4JTUA 4WXZA 3HTWA 4AB4A 3TMLA 3IAPA 2AMGA 4GACA 3NFUA 4BY3A 3N9RA 4HNLA 4W5UA 3MHFA 3BZJA 3TYCA 3NO1A 4LAZA 1LBMA 3SSJA 4L4OA 2PDWA 2V2DA 3ARRA 4HYWA 2GJPA 4UTTC 4PBEA 5GNZA 1PCWA 4MB1A 3GTIA 3AYTA 1U1JA 4ZO9A 1SZRA 3O9NA 1GW1A 1J8VA 1QNVA 3DKJA 4PMRA 3MUAA 1GCYA 1XD0A 1OB0A 2X09A 4GA8A 4DX3A 1ZLPA 4AEEA 4ZGYA 4Y9OA 1K03A 2PRHA 2FPVA 1LORA 5EMKA 1HP5A 3L4YA 2ZA1A 4GQQA 1Q4WA 5CGTA 4YMZA 3B8UA 1SM9A 1UG6A 2OVLA 4KWOA 1UWSA 3DFTA 3S1VA 3LCIA 1W5OA 2OT0A 2WNWA 3GC2A 3H24A 2X42A 2DZUA 4U4MA 3U3HA 4LX4A 4GO9A 4XUGA 1XL9A 2PDPA 3KOFA 4TU1A 4IPIA 1B31A 3MO7A 1IZJA 4Q4KA 2PF8A 4NP7A 3MYOA 4ORIA 4XBKA 1M68A 2WYSA 4CGTA 3DHUA 1VFUA 5CZJA 2PPGA 3ITCA 2FPTA 2OYMA 3RRXA 3SUUA 1AW1A 5DANA 2VRKA 1U33A 2CW6A 3E5BA 1QOPA 5FJRA 3B9NA 3KHJA 4BF5A 2Y8VA 4GUHA 3KOYA 3SCNA 2VGGA 4NI8A 1J79A 1AH4A 1AH0A 5JU6A 5D9NA 3ZFHA 1GYLA 4GI4A 4JOMA 3QGAC 3S2JA 5BWAA 1V3HA 3T0CA 2FKPA 4Q4SA 1J0ZA 4MJ4A 2I9UA 2F84A 3HQOA 4MB5A 3WDPP 4MVAA 4PA8A 3NOYA 2YJQA 1D3CA 1PKYA 1LG2A 2WJZA 4FF5A 1T6MA 3UWWA 3UG8A 4FMVA 4BQ2A 3QR1A 4N0RA 4I9TA 3QMRA 1RPKA 5D8WA 4XTDA 3BOFA 2VOTA 1H5VA 2FMOA 4A22A 4EOUA 2WWCA 3V35A 3C2FA 4DO6A 3M6YA 1MMFA 4AWTA 1H09A 3MCMA 3ZZ1A 5E0CA 1P1XA 3OEXA 2EF9A 4IQDA 4O1BA 3WUBA 3UXLA 1OCJA 4UTMA 3QY7A 3VZYA 2VC5A 2VXNA 1UD4A 2WMIA 5HNNA 2Q02A 2H3BA 4X2RA 2VZSA 3PZNA 1TB3A 3CTTA 4HPJA 1HNYA 3WQ8A 1XPYA 4FX7A 3LSCA 1P7TA 2CLIA 5CGMA 3DYMA 1XBVA 3RR4A 4BEQA 3LMYA 1NIUA 2WPGA 3I6RA 2WNNA 1AMKA 1KV5A 1POKA 5CAHA 3VGBA 4J35A 3ARXA 1S2VA 4WD0A 2PDYA 3V75A 1MRQA 1C8XA 3C6CA 4UTKA 4LRTA 1X6UA 1ZS2A 3O07A 4AZGA 2Y0FA 5G1YA 1OF6A 4LBSA 5JUVA 4PMXA 3FS2A 4NJHA 4M8UA 1RH9A 4CNNA 4F48A 1P0EA 3SQLA 4AIOA 3GU9A 4HU3A 4MYXA 2O9RA 1TV5A 4EPEC 2J7FA 1EJRC 5G4WA 2OEMA 5F4WA 2AL1A 3I4KA 4BI5A 1K02A 4WKHA 2CFFA 5I00A 2C6QA 3VM5A 1TR1A 4MB4A 2BP1A 2VR2A 1YKWA 3EB4A 2Z26A 1XISA 3N34A 2QUNA 3MV01 3W6LA 4DNHA 3S3GA 4ATWA 1C9DA 3GQYA 1WV2A 2PWFA 3MMTA 3WF2A 1EF3A 3CUJA 4ZTYA 1IEWA 4MM1A 2WB5A 3G22A 5D2TA 2VEPA 1G94A 5EMYA 3RPTA 4ZQNA 1PDZA 3GXNA 3OODA 1OT1A 3N2OA 3W1TA 1H41A 3P67A 3ZWSA 1ZCOA 4JTTA 5U4NA 5FJUA 1KFBA 1JAEA 4CQ8A 3UYCA 3B8TA 5CZKA 2XVKA 2PFHA 2A6NA 1JPDX 4BS0A 2V3DA 3SB0A 1V6VA 1WDQA 3VCNA 1TR9A 3VNIA 4L9XA 4QX4A 4UQEA 2WJDA 3STCA 3A5FA 3QM3A 5DLCA 4TQTA 2IPWA 4QJ1A 3OVPA 1REQB 3W29A 1DXIA 4Y8EA 4FLRA 2YYTA 3CBWA 2G3NA 4DO7A 2WVTA 1Q2SA 4LS2A 2O9PA 2ZUSA 3KBJA 2QW5A 2F2HA 3DFOA 3MUZ1 1EP3A 2HROA 1TV7A 4GC4A 2E67A 3OVRA 2XIOA 4ZE5A 3P81A 2BODX 2PC8A 3U6WA 3HV9A 3STEA 4KCUA 3CZLA 2CWNA 4FLSA 3S5YA 3H2EA 4DLFA 3WG6A 2IXVA 1K77A 1TA3A 3TW9A 3E0IA 4Q8UA 2NQHA 5I3FA 3TTEA 4LSBA 4ZO6A 4WZHA 3GIYA 3CHDA 5JXQA 1IIHA 1MXDA 1ZJAA 2VZOA 4XTIA 4RCXA 1VRXA 1CGYA 4KWUA 2EO7A 4OQVA 1OD8A 3PSWA 2PLJA 2J6XA 5C9ZA 3M47A 4QJ3B 1IEQA 2G37A 1OCQA 2YXXA 4IT1A 1K4HA 1XYBA 1GONA 1XG4A 3R13A 2PRMA 3NQAA 1J4EA 5AN7A 1DXFA 2HZGA 4XB3A 5HK4A 4F8XA 1A5BA 2EKGA 4CD6A 3AMCA 1DXEA 4TV5A 2TYSA 3WUGA 1AJZA 4JZ5A 4UTFA 4IQEA 4ROQA 3SN0A 3WNKA 1GTEA 4XKYA 3OU8A 3TMQA 3VX0A 5E9AA 3U4AA 4NRSA 1OY0A 3RM8A 4PUEA 4RE0A 5FF2A 2PGRA 2PUZA 4S3AA 1KRCC 2CZFA 2QCCA 3BJTA 3NZQA 3H21A 2OPJA 1K8YA 2UV8G 3KWXA 3BW2A 5FOOA 4XKYB 4KRUA 4ZTXA 4QXIA 6ALDA 1KBKA 3LNPA 4BFAA 1GWJA 3RO8A 3PZMA 4RZ4A 3C0QA 1OFRA 2Y7EA 1OZQA 5BOFA 1B3ZA 1DEDA 3IUDA 3E02A 5D04C 1SSGA 3VKCA 5LIYX 1IZKA 4MY8A 4XZ9A 1VLIA 3MSDA 4E5TA 1E72M 4DPPA 4JQ3A 4O0QA 4AG0A 4IMFA 4C6MA 4JS3A 1GNXA 1KTNA 1TVNA 2A6LA 4C7GA 1E43A 1BRLB 1W3JA 2GGEA 3QMTA 4LH8A 3SY8A 1V0LA 4IP4A 3GG7A 4IJRA 2GDUA 3TSMA 3GXPA 2CZEA 4IMGA 1J01A 1M7PA 3MJMA 4ZL1A 2ZTJA 1OVDA 1RQEA 1WOAA 2PDQA 3M0KA 1NQKA 1HF6A 3IACA 4XD6A 4GG9A 1JPKA 1A5SA 2XIIA 3N6HA 3BGGA 4B91A 4LYRA 4AY8A 1GT8A 5GJMA 3BJSA 5I77A 4PBGA 1FCBA 3QPYA 4RNJA 3FJ4A 1HKJA 3F4CA 3PPFA 5GPRA 3HBLA 1O1ZA 1RSCA 3GHTA 1LF1A 3TLQA 4XAPA 2GJRA 2V5LA 3WL1A 3LENA 5PTDA 2JGQA 1NWRA 1DYSA 2JKPA 2BASA 1XIFA 1VBRA 1EJUC 3F2BA 1CIUA 4UZSA 4H9XA 3MWCA 3IVTA 1HL2A 4KH2A 1RBLA 4EACA 4A3RA 3P60A 2IUZA 3DI1A 4GISA 1S2TA 1S3HA 1DJZA 4R7WA 3CUGA 1T40A 3WF3A 4LUTB 3W0KA 4O1CA 3N25A 1CGWA 1WZAA 3OHIA 3LHVA 4C65A 3DBNA 3BLDA 3AXIA 4PMVA 4GE8A 8XIAA 3KW3A 2X30A 3XISA 3D3AA 1IF2A 4JIEA 4K1WA 3P5ZA 4LUTA 2PLKA 1ZL1A 5A94A 4C1KA 3NQGA 1IWPA 4C6EA 4GCXA 3BL3A 4XK2A 3DIPA 4I9JA 2HV5A 1XYAA 1S5TA 5K7JA 3BWWA 4ZQRA 2V30A 2VELA 3CWHA 1TCDA 4YWSA 3KAOA 2AGTA 5BRPA 5A2AA 1U83A 5FF4A 3LOTA 4KQNA 3USZA 1ME8A 3L5LA 3RMJA 5D2YA 4P2VA 1XXXA 4NNCA 1PX8A 4RR4A 2WOQA 4UBPC 2TAAA 4H7CA 1BQGA 1UH2A 1OGBA 3GDBA 3CIXA 2YCIX 3DGBA 6XIMA 1V4YA 2YCJA 2Z2UA 3QLLA 4UFJA 4C91A 5CLTA 5BOEA 4IGHA 1T96A 3T81A 4R7OA 1YNQA 5EMJA 5FSDC 5M1TA 1GZ1A 2TODA 3WNOA 4WF7A 3B8DA 1T41A 1W3TA 2Y1HA 4KBXA 3U7VA 1R9XA 1RCOB 3M16A 4MJMA 5F2LA 3L0KA 4DBEA 3OIXA 1ZJIA 5BXRA 4C6DA 5MF5A 1TPH1 1DQXA 1S3TC 1L6YA 4XSMA 4UZUA 3LEPA 3TYEA 4KRTA 2VYOA 2E8ZA 2XISA 2XM2A 3RN6A 1HL8A 1BYAA 1XLEA 2HNHA 1KC7A 1FUYA 4JGDA 5BROA 3VDHA 1C91A 2UY5A 4LF1A 4GH3A 4M51A 3A4WA 3EWYA 4S3EA 2XH4A 5REQA 5IOBA 3FSTA 5D9OA 4QG6A 3L21A 2GQ9A 4NIRA 3BLKA 2HK1A 4RNFA 2QDDA 3CEPA 1J11A 3BZGA 4NJKA 1VEPA 4R3UA 3WQ4A 1G6CA 3ZJ7A 4A21A 3M7WA 1W5MA 1XYCA 4OKDA 1EHAA 5BXPA 1E9IA 2QGHA 4F3HA 3G8RA 2IKIA 1H7RA 4W88A 3LBOA 4UB9A 1NJJA 3SEPA 2OZ8A 3S1XA 2FZNA 3CJPA 3LYEA 5GJNA 3LPPA 1BXCA 1DJQA 2V9DA 2WBKA 5GQBA 2J7CA 3M0MA 3S0CA 2CLEA 1R5YA 1V3JA 2FHCA 3GVRA 3S5ZA 3W72A 3RLGA 2XGZA 1HGYA 2ICSA 5CBBA 3DCPA 1EA9C 2ZUUA 2Q71A 2AKMA 4U2ZA 3POHA 1XQKA 3SUVA 4O13A 1ZY9A 3WLQA 2ZRZA 3BLLA 3TN6A 1QVBA 2Z28A 5C5YA 2SFPA 4E3VA 4L4LA 2ZIDA 4HD5A 3BW4A 3I7QA 1KM6A 4RL3A 3UU0A 3BMXA 1K7FA 1FTXA 1W1TA 4RV3A 1PZ1A 3GVGA 1UR2A 2AQWA 2HJPA 1XINA 1AVAA 3ORWA 3WQDA 5KMYA 3HURA 2PBOA 2Y7DA 3UR5A 3CMFA 3HIJA 1R85A 4GVIA 2BWGA 4KWVA 3GNPA 4S2CA 4IIBA 3VNMA 3RILA 1K7XA 5HDRA 1W1A1 3GM8A 4AW7A 1HFBA 2ZFAA 2CNCA 3WFAA 5C54A 4LANA 2HCVA 4JX6A 4KKXA 2WXDM 1O95A 3WF4A 3WMCA 2E5BA 4ECLA 1TV2A 4YTTA 1MQPA 1A3WA 2UY2A 3NM3A 1FHVA 2OEKA 4XAGA 3CT2A 4HJFA 1YADA 3EOUA 4QS6A 2TSYA 1J9YA 1PCKA 2A21A 2LLEA 2XIJA 1JXJA 2J7HA 5C70A 4L9YA 1F7BA 4PODA 5M2FX 1QI5A 3SCOA 2BS9A 1M65A 1PZ2A 3PZ9A 4AWSA 5ECUA 2WHLA 3VCCA 3VGEA 4FAMA 4RX0A 1NDVA 1FWSA 3P62A 2FH8A 1DWHM 2DZWA 5HR7A 3WLLA 1KCXA 1BWLA 1QU4A 2E6FA 1CLVA 1H49A 3UG3A 1KD0A 3UZJA 2WQDA 3QSTA 1WA3A 2JBMA 4MPQA 3G1SA 1NOUA 3UP8A 3QJAA 1UP2A 1G7VA 5CPQA 4DRSA 3HPZA 2EG6A 2YGYA 3TTOA 1KO0A 1H62A 4IUOA 2YW3A 3M5VA 2WC4A 3BAKA 2W4XA 3N4EA 1JNDA 4Q7IA 1QI0A 3KVKA 3NPWA 3EDKA 3LUTA 3KCOA 4FIQA 3PG8A 2ZUWA 2XVLA 2HWGA 4GYPA 3H55A 4FLOA 1BQCA 3AHXA 2E0PA 5D4YA 1H60A 3UY7A 1DOSA 4UTTA 1ZQ5A 3S6DA 3VC5A 4WSKA 3PP7A 3B40A 4PTMA 2I9EA 1Z89A 3AICA 1TWDA 3FVMA 1W9DM 4J2PA 1I6NA 3EEGA 1PTAA 3GXIA 4D1JA 3U2EA 2I1OA 2D23A 4GVGA 5H8PA 2JGYA 3B04A 4QP0A 4CD4A 1LDCA 3IPWA 4XZNX 3SCQA 3ARUA 2C19A 4PSPA 1TSIA 2G4FA 4FPSA 3NQ2A 4Y6GA 1KCLA 3BV4A 4LUSA 2GVJA 3W3OA 2X40A 3H2OA 2Q8ZA 3SBFA 4P7LA 3HN3A 3QHOA 4K3ZA 3T1GA 1SO4A 3KX6A 2X05A 1WXJA 4QS5A 3IIZA 3QC3A 5BMXA 2V5BA 1C93A 2FYMA 1Z7AA 2WANA 3RJYA 1EOKA 4HMDA 4JY8A 3QQWA 2CCRA 3BUVA 3OVGA 2B7NA 4WGXA 4KT2A 2BHUA 4XUYA 5IDZA 1GVQA 2V8ZA 4GXWA 4KFNA 5FEZA 3ZVIA 1MVYA 1X8FA 3TC3A 3O8AA 5HWMA 2WZIA 3CHFA 2CITA 1SFLA 3KDNA 5HANA 3UR8A 1BVWA 1US0A 1R2RA 2V68A 3LCLA 2J47A 1G69A 5HINA 4Y9AA 2FB3A 1GOMA 2X0HA 3WJSA 1P6BA 3WIJA 4G8TA 4AZHA 1ONXA 2H6RA 2I57A 1TZ7A 1KXTA 1ITXA 4WJEA 2QDHA 1H2JA 5EFDA 1U1UA 4MLJA 2W27A 5DO8A 4XZHA 1JULA 3WBYA 1FCUA 3E9AA 3VD4A 3LXAA 4QDPA 2J62A 3R11A 3EX6A 1KLYA 3FW6A 1XRFA 3WQOA 1OC5A 1KFWA 1QW9A 2WKJA 3NQ6A 1LYXA 4DF1A 3OO2A 1KXQA 2QVNA 4QFUA 1W8GA 2YLLA 4C6FA 3M0HA 3M6DA 5HPCA 1ITQA 4OV9A 4P8VA 3VNJA 1DJIA 2OQHA 2JALA 1QI3A 5ABFA 1EJSC 3RIKA 1W1PA 3W7EA 3NPUA 3NO5A 2VQTA 3B0XA 3H54A 3PZIA 2HDJA 1F6PA 5H91A 4E3TA 1R0MA 3AYVA 4JTSA 1NWSA 2OEJA 3JR2A 3NURA 4PH6A 4S39A 4UIOA 3HV8A 4FP1A 4B5UA 4FI4A 4AX7A 4GKTA 3WF0A 1HN1A 1E6XM 3A12A 1B3XA 2Y5SA 2X1RA 5EYWA 2E28A 2IQ0A 2VX7A 2GQAA 1LUCA 1HTIA 1TPEA 3CZJA 2A2IA 3LCFA 3RX4A 2HVOA 1LLZA 1W3IA 1TQXA 1E6RA 1XKJA 1XLJA 3WELA 3N4FA 1O68A 2E40A 3AHVA 3GSMA 3LXCA 1XDJA 3W38A 1L6SA 3I68A 1PWLA 3ZOAA 1TFVA 3GTHA 3SR7A 3VOGA 4HA3A 5C9RA 4OECA 4HSHA 1QHZA 4YCPA 3EA2A 2A85A 2QT3A 2VFDA 1KQYA 3RXZA 4H9MA 1KNWA 3TVAA 2CHRA 1MFUA 3WLOA 3TAKA 1KBLA 3KTCA 5FEWA 4OZOA 3TDFA 1OFOA 2D1ZA 2E9BA 4ERAA 3T8QA 3ZLFA 2H9AA 2IKHA 4XIMA 5I09A 1H51A 3GVQA 3UR2A 4X3ZA 3ZYZA 3KFTA 4NI3A 4DWSA 3EX3A 1A5CA 1CZ1A 1DHKA 3NOEA 3D5HA 4HZ6A 5HUPA 2QCFA 3WLSA 4PUJA 1OINA 1QK2A 1EO5A 1MUCA 2F6KA 2NLIA 1CLKA 3AMDA 3E96A 1CYGA 1JDCA 2PTYA 1F76A 1OFDA 2WLYA 1GORA 3C4UA 2BBFA 1OBAA 3DFHA 3APGA 4PTNA 1GUVA 1NQ6A 4J3XA 1Q6FA 1HXJA 2Y89A 1FWEC 3KP1A 1YXYA 1XUUA 1KGUA 3TYBA 3MTWA 1G0CA 1X7FA 3AIWA 4O4WA 2QPXA 4JTLA 3VA8A 4UFLA 2X7WA 1QNSA 1ZUAX 1O6IA 3IJDA 3NVDA 3NDOA 2PDMA 2V63A 1JPIA 2P8CA 3URBA 3OB8A 1RA0A 3B3DA 3MI6A 4S3GA 1UPPA 4JTEA 4B5VA 3W7RA 1OGSA 1QJWA 2D24A 1W9VA 2AMXA 4MY9A 2G41A 2XVPA 3VOFA 4CQBA 4GBUA 2O9OA 2H90A 3NG3A 3F5LA 3PPHA 1MXSA 1ICPA 1XSKA 2A0NA 2HPIA 3M5YA 4F0MA 4NSBA 5T8GA 4FNUA 2CBIA 1MUMA 1HGWA 3AS3A 4LBUA 3W1UA 3L5AA 3OYZA 2B0MA 3CWOX 1OADA 3FXGA 5BRBA 1QHPA 3B03A 4TX8A 3WNMA 2CBVA 4GINA 2YPIA 3C56A 2ZXBA 3UCDA 4JEQA 2POTA 4Z08A 1PKNA 3WQEA 2QCDB 3LRMA 3EA3A 5B7ZA 4FXSA 3WLKX 5EFFA 1LRQA 1V51A 4V15A 3QR0A 3SRDA 1PSCA 1UR9A 2V5JA 3ZT7A 1XCWA 3R79A 1EGVA 1F6YA 1Y0EA 3C61A 4U28A 5AHLA 2ZRYA 3RHGA 3WL0A 1E55A 3FYPA 2G96A 2I5GA 4FNTA 2RJHA 3L4VA 5BMWA 2PS2A 5IRPA 4D72A 8TIMA 1A5KC 1EDGA 4LBRA 3PY2A 3GW3A 2GL5A 3N9SA 2QJHA 4LC6A 2ATMA 4ZODA 3HGJA 1L6FA 3A47A 2QS8A 1RZMA 1GPWA 4JY9A 3L4ZA 3N17A 3VKBA 1IWAA 4Q3MA 5DRIA 2C8NA 4Q6XA 1WO2A 1QNOA 3EWCA 2F61A 2QJJA 4GWEA 4ZXOA 4Q8WA 8CGTA 4C6OA 1SJBA 3PZVA 4PBFA 5M5DA 4H2CA 3KLLA 4WIWA 4EIVA 3LGDA 4JQAA 1Q6EA 4AVFA 1R7OA 1WBJA 3V36A 3I10A 3CL6A 4GY0A 2AAMA 3B8VA 3QSRA 3U2ZA 1J2WA 3F4VA 4ZCWA 4IGMA 5RUBA 1W3HA 2I56A 1OABA 5J5DA 1OFQA 4HP5A 4JNMA 4GJIA 1XLHA 3NXLA 1NFPA 1VBJA 3T0AA 3VMNA 3QGKC 2ZA2A 5A8PA 4PUKA 2R94A 5JQ9A 1QW7A 1V7AA 1KFKA 4PCNA 3O15A 4AD1A 1SMAA 4J9JA 4V33A 1UR1A 3U2CA 4IL2A 3DOPA 1XYZA 3VCRA 3B4UA 2P0IA 1E6ZA 4MNKA 3Q94A 2J13A 3O7UA 2IQDA 5CJ5A 2A7RA 4PMYA 4DB7A 3V1PA 2EXOA 1KR1A 1VFLA 2EKCA 4REQB 2NV2A 2GDQA 1EP1A 1S39A 1N8WA 1IEVA 4L1WA 3OZOA 1QAPA 4IJBA 5HMFA 3RU8X 3K4DA 4O8RA 3W7QA 3VIIA 1G4TA 1L8NA 1CGXA 3NR0A 3A6OA 4XBJA 3KRBA 3QQ1A 2XUCA 2HS6A 1RJQA 3FVDA 3G1HA 2E5CA 1DL3A 2PLMA 3GH7A 1HG3A 1MXGA 1L8PA 3VC6A 3APTA 3LCWA 4B3LA 3S8HA 4A4AA 2YA2A 2YYUA 2O0TA 4FLQA 5CH9A 5C2GA 1OIFA 4LU0A 1U5JA 1OCBA 1A3HA 2OWCA 1ZCCA 1E6PA 3XIMA 4XAFA 4HBKA 5A2CA 1KM0A 2FMNA 1KFCA 4LCSA 1JI2A 4DLMA 3URNA 2HE8A 3BVJA 5M03A 1GVSA 4JTHA 1TRDA 2DORA 4DUXA 3A3HA 1UWIA 4M7SA 3SCWA 3UCQA 3OBEA 4UTUA 4CCDA 3GR7A 3IRDA 3FDGA 2NVAA 1E5JA 4N9EA 4U5IA 2J7DA 4Z1BA 3B9AA 3USBA 3BQ6A 4W93A 1LG1A 1UIOA 4D2JA 1PUDA 4UOZA 1XLDA 2MNRA 2VCCA 1WUEA 2NSOA 1K6WA 3PTQA 2CLHA 2RDWA 3UY8A 4MY1A 1O94A 1E0UA 1GHSA 3H2FA 4JL2A 2F38A 1EZWA 1RK6A 2EPOA 1CXEA 4C1NA 3PBVA 4GIYA 1JXKA 5ABFB 5HPOA 1TX2A 2G8ZA 4FXFA 4HIBA 1XV8A 3FY1A 5EBUA 1Q66A 1QBAA 4CKQA 1JNEA 1PXGA 4C6LA 4HTYA 3O16A 5CBIA 3BXWA 5AHFA 4DY1A 2QJGA 2YX0A 3TN3A 4AHPA 4NASA 5C8BB 3QKEA 1QO5A 4O19A 2YLAA 1PZ0A 1KRMA 3K1DA 3HQNA 4U10A 1HT6A 4OBRA 4MUPA 3WSUA 4QG8A 3MYPA 1PV8A 4IXXA 1WAUA 3C2OA 4RDVA 7REQB 1KW1A 3LHZA 2BY0A 2VC6A 3OGRA 4HNUA 4IFRA 4EXQA 2ZVIA 1W1ZA 3U57A 3ES7A 3OBKA 4QE4A 2FHFA 4I6VA 4Z2JA 1PJ9A 3W1XA 1T0OA 4XAYA 3VFLA 4CU7A 3IJ9A 4A2RA 1XUZA 4RE3A 4QSHA 3QR3A 4UMBA 4DEFA 1F8MA 2W67A 4KFPA 3OPSA 3VGFA 1TRIA 3FX4A 2D73A 4UFMA 3C3NA 4AZBA 2DVTA 2D2OA 3LLFA 3PM6A 1WBHA 1C8YA 3V0SA 3W83A 2CXEA 4KF1A 4CU8A 3VNKA 1D2KA 2YKKA 3U5YA 1SMDA 2E6YA 4IM4A 1ZAJA 3K30A 4UXDA 1SZGA 2OX4A 4X63A 3LI1A 3UCCA 3SRKA 1DIOA 2XN2A 1OD0A 1ZBCA 4ATDA 1ZRQA 3KBWA 3SN4A 2Y62A 2CETA 2ZZ6A 3F5KA 4JTDA 2VCAA 2RGMA 1IXPA 3NWRA 3N4AA 1XW8A 4V2XA 4S2BA 1XIEA 1V0KA 5HATA 1GJWA 1ZALA 4OFCA 1H3GA 2F2KA 1C7TA 3GTNA 3A4AA 1QPNA 4UFIA 4J7RA 4FOKA 4PGLA 3WLRA 4GJJA 5HWJA 3SCVA 4MKNA 1OWQA 1IXNA 2RDXA 2G50A 3FEMA 2XFFA 3FHQA 1Q7QA 4F2UA 1THFD 1VFOA 3RG6A 4DWSD 2E6AA 4KWSA 2RH9A 2P53A 4XD5A 4PFHA 3DESA 5I78A 5F7UA 4JL1A 4PCPA 2E09A 2ZX6A 3K2GA 4GIRA 4LXFA 2PTWA 5EU9A 4HNOA 3O2LA 1QCWA 5A6BD 4TVDA 1VBUA 1UUQA 4H9TA 2PDFA 1CT5A 3AXKA 3EAUA 3PTKA 3KRSA 5A8GA 3Q65A 1PX3A 1A0CA 5CG0A 3ARQA 4OV4A 1Q63A 3NZPA 4LT9A 4M6PA 5A6TC 4WKFA 4PULA 2OG9A 2PGWA 1FWBC 1UMYA 4IF2A 1X38A 5DRCA 3PBMA 2GJLA 3CMJA 3C0LA 5IFPA 4QEHA 4F0SA 4MIMA 1EBHA 3GU1A 2X0SA 3CV7A 2ZC1A 5BYWA 3KOXA 1QDSA 1YNPA 3CQJA 1Z42A 1JCXA 2CZVA 1KBJA 4HB7A 3T4CA 4Q8QA 1KA9F 1JUBA 1XP3A 1YLVA 2QUUA 1Q65A 4NQ1A 5A6MA 4D1IA 2PDNA 3KZSA 1LWIA 1QASA 3VXGA 1OCNA 2ZZ1A 2FGBA 5XIAA 4HVXA 4D6CA 4LB3A 4GUFA 2IPGA 3BG5A 1RP9A 2C79A 1FWCC 1JCYA 1XPGA 5FJPA 3W82A 4QR6A 4O12A 3VIHA 5A6LA 1FP9A 2QV5A 3EA1A 3OW1A 2FZ9A 3P8IA 3DEQA 4J27A 2DFAA 3S6TA 1MUWA 3MQTA 3T78A 4TMBA 5I3JA 1RY8A 4IMDA 2V69A 5ECVA 3NDYA 4I3GA 4K39A 3W7LA 5HQLA 1PHWA 3L0NA 4ZBCA 2WVVB 2VO5A 1V3KA 3CUZA 3R7MA 3TJIA 1W9XA 1HVQA 2QUTA 3OOQA 1LP6A 5BRQA 4GZEA 2BXYA 2PDXA 3L23A 4F0KA 5BXTA 2PODA 3AHTA 3UZ5A 2A1YA 3TLLA 5A3HA 3LTPA 4Q7NA 1SR0A 3WBXA 3W02A 2FFIA 3OBAA 4JFTA 1UBPC 1EYEA 4GO8A 4HNTA 4W7UA 3SY5A 5CPLA 3REQA 5AYBA 1Q85A 1A4MA 3AMLA 3SJNA 1YX1A 2MANA 2GVGA 2H9AB 4I5UA 2ZXDA 3TU9A 2OLSA 4QM1A 3KWSA 3LMZA 3RDKA 3W7GA 4F0LA 4PL1A 1BF6A 4H83A 3LY0A 3HJZA 1XQLA 3RJXA 4M81A 5C0QA 3ARYA 3G3MA 4WCJA 2C16A 2AL2B 2ZZ5A 1YPIA 7CGTA 2DUAA 3M0ZA 1JGMA 4E2VA 2PI6A 2WM1A 1L6GA 1XLBA 5C9XA 4OVXA 4LY8A 4IIDA 2NWRA 1FWFC 4O50A 3AHYA 3QEZA 1MSSA 3DHPA 2J8GA 3XINA 2DH3A 5D30A 4ML4A 3VIKA 4CU6A 3GDTA 2NUWA 5HNRA 3DHDA 4J3UA 1DIDA 4XISA 3II1A 2NV9A 4IXHA 2YIHA 4JTAA 5IHRA 4O10A 2ZRVA 3VM7A 1J0JA 1UASA 1E1CB 3ITVA 3KDOA 2ZRWA 4AEFA 1VCVA 3ALFA 2BXZA 1ALDA 5HBFA 1SPQA 4GNKB 4O0KA 1VBHA 3VIOA 1XLCA 2DSKA 2CESA 1KFJA 4GI6A 3LDVA 2RUSA 5GNYA 4LC8A 1FP8A 4QLJA 3IVSA 4XD4A 3DX5A 1XGDA 5D02A 1E51A 5ABHA 3RMEA 2Z00A 1FWAC 2XH2A 1J0KA 4B16A 1GEHA 4ZQOA 1OFPA 1DORA 2JEQA 3W24A 4TVCA 4O1AA 5C2XA 4N02A 4F40A 1R3YA 5A69A 1RAKA 3CU2A 2FJUB 2QPSA 2J9ZA 3HPSA 3D3FA 1EEXA 4ZEPA 1SO5A 3GAKA 1H63A 3G3DA 4DJED 2RJGA 2F8QA 3FYYA 4O17A 4PMDA 3BOXA 5H2ZA 2B31A 4E4FA 1Q6GA 3BK0A 5I3IA 3WLPA 1F05A 3S6OA 3CK5A 4EE9A 3BAYA 2HISA 1OC6A 1TTQA 3E3HA 7ODCA 1E4MM 3AYRA 1EX1A 1AFSA 2J8TA 2HK0A 4Z42C 2QMJA 3FGCB 4IIFA 2P8BA 3UF9A 3WH9A 1UZ1A 5HAOA 1EP2A 5KETA 4I5RA 2ON3A 2R6OA 2XGBA 1UD2A 4NNAA 1R3TA 1GW9A 1VFHA 3VIGA 3S9ZA 1VJZA 4DBWA 1VD6A 4W89A 4IL0A 4BQ4A 1KGXA 3WBEA 1NARA 3GBEA 4C1NB 1ISYA 4JHZA 3W7DA 3AMGA 3W1AA 3BLIA 3LLXA 4RE4A 5FKYA 1JPHA 4PC8A 2G3IA 4TO8A 4Y9MA 4AQLA 3HM7A 3PVFA 3UJSA 2E9MA 4MFEA 9CGTA 3WD2A 4RDWA 1ODUA 3C8NA 4KFOA 2UWFA 3RCYA 1ZBVA 3T0BA 3DXIA 4LYQA 1T99A 5AYZA 1UWTA 4J1OA 3KTXA 4G7FA 3JRKA 2RAGA 4GIAA 5FACA 5FI8A 1DWFM 5DXXA 1V6WA 4JIPA 2G3MA 5U7SA 4I90A 2Y6ZA 2DW6A 3D47A 4UNIA 3EX2A 5FCZA 1IEXA 3M4HA 4HA0A 3S1GA 4JQ4A 3LGGA 4YTUA 2Q3OA 2Z1XA 1RQBA 1H0GA 1I60A 2YFNA 4GYFA 2Z2AA 5H8UA 3VMPA 1UKQA 3NVTA 3UJ2A 4MWAD 1QHOA 3LQLA 3T6CA 1QW8A 2X2YA 2V5DA 5KZEA 2DZVA 4HPNA 5D9PA 5JBEA 1E0XA 4IFOA 1LCOA 2FZ8A 5DY2A 1J96A 3DYOA 2NX3A 1M53A 4UFKA 2E6DA 1TPB1 4EPBC 3VOIA 4IFKA 2V6AA 3L2LA 3DDMA 1JCMP 4LUIA 1H7NA 5AC7A 1K4GA 3VE7A 2GJXA 2ALDA 1U5HA 1NFBA 1B4EA 3ABXA 4LVBA 1WP6A 4CD8A 1BGGA 1JDFA 3FHAA 1F6KA 4DJEA 3TX9A 1O5KA 1JQXA 1UKTA 3RLHA 4UQAA 2DY3A 1ZP4A 1W1B1 1OF8A 3RR1A 2XG9A 1R8LA 3T2OA 1XIGA 5AYXA 4NX0A 3U0HA 3KVLA 3POCA 3CAQA 1CBGA 4EXAA 1QK0A 3V0UA 2ZWZA 3SGGA 1JZ3A 4B90A 1UH4A 2QYGA 1VLWA 3S5NA 3WH7A 4HK7A 3WDIA 4B5WA 3URQA 1EIBA 2A4AA 4JYDA 2JQXA 1C90A 1SW0A 1H1NA 3PZGA 3R43A 3EXTA 3H23A 1XLGA 3WENA 5JIPA 1QPOA 4QAWA 3DFQA 1C8VA 2VR5A 1RD5A 3KEHA 3NPXA 4JYFA 9XIMA 1Q8JA 3E5PA 3H26A 2OCZA 4ZB5A 7A3HA 4PMNA 5JBFA 4XZMX 1R2SA 4JQ1A 2VFFA 2RFGA 3P3BA 1H7OA 5CZ0A 1UUMA 4HMCA 5D32A 2DJXA 3VPLA 4O14A 3TA9A 3QLDA 2QDEA 2Q8XA 4KWWA 4UNKA 4WJ8A 1FH7A 5FESA 1AD4A 2A3EA 4BZYA 4D6GA 3GUGA 5LNVA 4MWAE 5F2GA 3MVTA 2CLFA 4AAJA 2HEJA 3H12A 3ONBA 1JRCA 3IWPA 5FEXA 2NQJA 3TK7A 4LCQA 2GZXA 4DO4A 2Y8KA 1US2A 4MWAA 2YB4A 2C18A 3IJLA 3CQ0A 4CLMA 4LPCA 4ZSUA 5G4EA 1K9EA 3F1QA 4ACZA 1TTJA 1TQJA 3GDKA 2GJNA 2WWDA 3NQFA 5E0FA 4BK9A 3PNUA 2YR1A 3QY6A 4H04A 4C90A 3EKGA 3AZTA 5DELA 3N2MA 3T8LA 4L64A 2FTYA 5DQPA 1EDTA 1GQNA 1BTMA 5J8LA 4CUCA 1GYMA 4RZ6A 1UQZA 3MANA 2TMDA 4IJCA 2QPUA 1B57A 4OE7A 4BI6A 1HL9A 4XX6A 4DF0A 5CEWA 2YCLB 3G1VA 3OQEA 1VFMA 5E93A 2HXTA 3L2IA 4OUEA 3PK7A 3H7UA 3W1LA 1UA7A 1YW1A 1OK4A 2VC7A 5HQEA 4CVUA 2AQVA 1BHGA 4IIEA 2PP3A 3FJLA 1NP2A 2Z6IA 1X1OA 1EB3A 3VIJA 2PC4A 1NF0A 3W76A 1Z9AA 4GFSA 3QOKA 2BOEX 2INZA 1AJ2A 3T2PA 2B7OA 4PTWA 4ML9A 4AMCA 2PWGA 1GVRA 3DYPA 1A5UA 4GYJA 2DSZA 4JN7A 1XR2A 4B2DD 1F3WA 3EZ4A 1Q3NA 3DECA 3HU7A 3R8RA 3R5EA 2J7GA 1GPFA