4MB1A

The structure of mall mutant enzyme g202p from bacillus subtilus
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
559
structure length
557
Chain Sequence
EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIPSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase 1
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 225
structure length 557
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4mb1A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb1A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4mb1A02
5HPCA 4AZ6A 3O2LA 1UG6A 2V38A 1MW0A 3KLKA 2WMGA 2WVUA 1DWJM 1QW8A 2PWDA 1HJXA 2XFYA 3AIEA 3CUIA 1NWUA 1GORA 3RCNA 5LA2A 4B9ZA 1ITCA 3TONA 1GOIA 8A3HA 1F4HA 4AZ7A 1PPIA 3CUJA 3VX1A 3SCQA 1PIGA 1LL6A 3AIWA 3B8SA 5DT5A 3N18A 3WF2A 3WNLA 4P8VA 1TQWA 1NWTA 3CHDA 2F7PA 1J18A 4JCMA 3S5ZA 1CGVA 3L4VA 3VIIA 2WLZA 4YPJA 8CGTA 3UG5A 2FH6A 4D6FA 3L4WA 3OLEA 3CUHA 1V6XA 3VMOA 4HMEA 4D72A 3F4VA 2WM0A 3N11A 4ACYA 3BC9A 3WDQA 4AMXA 3O9NA 4F8XA 2J7FA 4ZFMA 1JNEA 4JCLA 1W9DM 4JL2A 3AYSA 1HXJA 1OIMA 4P8UA 3MV01 2G3NA 3BSHA 2WKLA 1NWSA 1CXHA 1UA7A 5HXMA 1DWGM 2XPKA 4OOUA 1VJZA 1VFMA 2J62A 3EMQA 3VOCA 3IAPA 3EDEA 2BVYA 3BH4A 2VMFA 1V6UA 3G6MA 3NSNA 4GIAA 1FP8A 1JZ4A 2OWWA 1EIBA 1JAKA 1JYXA 1K9FA 1UOKA 4FK9A 3T0DA 1CECA 4URIA 2BHZA 1GCYA 1KGWA 3BUPA 1V0KA 1B30A 3KL5A 1HJWA 4HA4A 2E8ZA 5FL1A 3N12A 3DECA 2D0GA 4PEEA 1FHDA 5FIPA 1UR9A 1OD8A 3AMKA 4NI3A 1V6VA 2DDXA 5IXEA 3AIRA 2YDSA 5I0DA 4JL1A 3UG4A 2XTKA 3ZJ7A 5A2CA 4MNLA 4AYGA 2XUCA 4HOWA 3EDJA 4U3CA 4PTWA 1FA2A 4AZBA 1WZMA 3OLGA 2YJQA 3W28A 3EDDA 1VB9A 3ALFA 4XB3A 1HKIA 3DC0A 1H0IA 4KWUA 2DGAA 4FNQA 1R85A 1IV8A 1UZ1A 1OINA 1HWWA 4AMCA 1WNOA 2ZUWA 2ZX6A 3WY1A 4UNIA 2J7EA 1QI2A 1RH9A 4U5IA 3MMUA 5KEZA 3WNKA 1TA3B 3AIQA 1BVZA 3TA9A 1EDQA 1E15A 5CLTA 1ZBKA 3W0KA 3WF4A 1XCXA 2GJPA 3KEHA 4PSRA 1UQZA 3CGTA 4MDOA 3ZO9A 1SZNA 4H04A 4IPNB 1WB0A 1QOXA 4FNPA 1MW3A 2ZUMA 3TP4A 4Z2LA 2RGMA 3PHAA 4W93A 1GHSA 3VMNA 2VO5A 2ZXAA 1LWJA 1WKYA 1VRXA 5I23A 1M01A 1E70M 1HTYA 1H2JA 3VIHA 5GPRA 4UFKA 2DPEA 3AMGA 1J0IA 3VNZA 1WZAA 4ZXLA 5A8QA 3EJPA 1EH9A 1WO2A 1GQLA 4PRWA 2X8RA 3VD7A 3GXIA 3DX3A 4XZWA 3U7BA 3F5KA 2WHKA 2XWDA 3GXDA 4P7LA 3MUAA 1DWFM 4FLRA 2WHMA 5IHSA 1JZ6A 5HPOA 3LMYA 4UQ9A 1TZ7A 3CMJA 1LG2A 4GKLA 1W9UA 3OZOA 2CERA 4GINA 4J3UA 4NZFA 1JZ7A 3TTOA 5A1AA 5A8NA 1E6ZA 4AZHA 1G01A 3MI6A 1XD1A 2C0HA 3W29A 2EPOA 4M24A 4CU6A 3LX9A 1OIFA 1G9HA 5FD0A 2OW7A 1W91A 2UY2A 3EBVA 3GDBA 4UZSA 5IFTA 1LJYA 2J74A 1BG4A 1JZ5A 1JDDA 1J0HA 1HT6A 2WHJA 2J78A 1E3ZA 3W53A 5E0FA 5FCZA 3D51A 2BY0A 3LRMA 2ZX5A 3TOPA 5D9MA 4PMYA 1H5VA 4CKQA 3CIVA 1FH9A 1FHLA 1HP4A 1TA3A 1PS3A 4DO4A 3PTQA 4D6JA 2DSZA 2X2IA 5A6MA 2YOCA 1UASA 2ZIDA 1H49A 1JGIA 1R47A 1HKMA 1WDQA 5LA0A 3K8MA 3BVTA 2Z1KA 5GNZA 1Q6FA 2CITA 2BVDA 3W82A 3GXTA 3ARSA 5D9NA 4KGJA 1JXJA 4UQBA 3BAYA 3ARYA 1PEZA 2CBIA 3UERA 2EPNA 3VD3A 1K9TA 2NSXA 1EO7A 1XH0A 4N42A 4S3KA 2OSYA 2ZUSA 1E6QM 4GQQA 1QX1A 1HXKA 2WSKA 2VX6A 3VVGA 2J8GA 1B3VA 2VVNA 1X1NA 4AZ5A 1VAHA 2EBNA 3EDFA 1R8LA 2GJXB 1UWRA 3NJ3A 1JI2A 2EPMX 3OLIA 1EHNA 1UWUA 3OBAA 5C8BB 2BNJA 3A24A 2GK1A 1VBRA 5FKYA 4AIUA 5BXRA 2VR4A 1B3XA 3WUBA 3OIHA 1CXIA 3H54A 3WUFA 3LPFA 1V6WA 3A22A 1S46A 2D2OA 1C8YA 2WMHA 3TTYA 1MQQA 1ISWA 1QHOA 1PAMA 2WNWA 4JKMA 3RDKA 4RL3A 4Z2HA 4HOZA 5JIWA 1W1TA 3ZT7A 1C92A 1OGSA 2D20A 1UKQA 3VIJA 2Y8KA 1DWIM 5D9OA 3SCPA 4M56A 1BSIA 2CXGA 4GI8A 3L4ZA 5I3DA 3W6MA 4Z2GA 2VTFA 3WQ4A 5E1QA 4LXFA 3VILA 3KWXA 1E6PA 4P7RA 3K1DA 1SMDA 3WENA 3DX1A 1R86A 4MNJA 1UWQA 3W25A 2WMKA 1QWUA 1GUVA 1DEDA 1HP5A 3WIJA 3PTMA 3LXBA 3CUGA 2DIEA 2WMIA 2PWEA 4DWSD 3HG5A 3VIGA 4AWEA 2CNCA 1ISVA 2WZEA 3ARRA 4MNMA 4AEEA 1RP9A 4QCFA 1GZJA 4HZ6A 4AD2A 1RD6A 2J7CA 3WF1A 3AISA 4CU7A 5BXTA 4CN4A 1GVYA 4D6HA 2JIEA 5A6JA 2YBUA 2PWGA 1V3LA 4XX6A 1GQJA 2UY4A 4KMQA 1D7FA 2F1BA 4UQDA 2YLAA 3UETA 2CBVA 4BZYA 1GNXA 2VVSA 4DO5A 2OLHA 3AIUA 2VZTA 4RE4A 3LXCA 4HU8A 2E3ZA 2UY5A 2GJXA 2D3LA 3ARTA 3WF0A 4TVUA 2D3NA 1FFRA 4N0RA 5I79A 2WB5A 2WCGA 2VZOA 2GSJA 3U5UA 2PI6A 1UWSA 3WDJA 1O7AA 1KR0A 1XC6A 1AQMA 1UD3A 5E9AA 3FHQA 3GXNA 3VD9A 1HJUA 1M04A 3AHZA 4BQ2A 1HN1A 3EYPA 4HA3A 1LF1A 1Q6GA 5BROA 1W1VA 2F7QA 1K9EA 2X09A 5CJ5A 3D4ZA 1WAWA 1NARA 1XH2A 5BXSA 5A6KA 2V3EA 1QNOA 1V02E 2DT3A 1Q6CA 1ESWA 1GOOA 3VIPA 1CTNA 1MYRA 1KGXA 1OT1A 2VCCA 2QPSA 4MAZA 2YL9A 1E1FA 1KB3A 4MNKA 2YL6A 2JF6A 1FFQA 1X6NA 3L4YA 4AIEA 5HNNA 4Z2JA 3SUTA 4JHZA 1K6AA 1X6LA 1VF8A 1KCKA 1LL4A 4B3KA 1ODUA 4PN2A 4PTXA 4W5UA 4X0VA 1UWIA 1CWYA 2F1AA 3WFZA 4GO9A 2O9TA 4HPGA 1WZKA 3IK2A 3K4AA 4JKLA 1CDGA 5EFDA 1B3WA 2G8ZA 4Z2IA 4D6IA 2A3BA 4J3TA 3VIKA 3CZSA 2WCAA 5M03A 1KTCA 4M81A 1JYNA 4R27A 2ZX9A 1WPCA 3BLKA 3WMSA 1V08A 2VRKA 4WSJA 3BAJA 2EAEA 4DUWA 1MQRA 3WELA 4M80A 2VZUA 4PMNA 4F9DA 2OYMA 1W3KA 4HMDA 3RM8A 2XM1A 1BYBA 4CVWA 2YL8A 2EXOA 2XN0A 1CXLA 4W89A 1UWTA 1VFUA 2ZWZA 1HIZA 3SEPA 4GPNA 1UQYA 3ARWA 1B1YA 3GNRA 4CCDA 4UCFA 1UD8A 1CGWA 4M1RA 4AMWA 3SCSA 1VJSA 1OM0A 3SCOA 3CZKA 1E40A 5DFAA 1JYVA 1GQIA 2EJ1A 1J9YA 2WW5A 2VR5A 3QOMA 1QI5A 4A4AA 2D22A 3EMCA 5CPTA 3CV5A 1JNDA 4GXPA 1YQ2A 1Q4NX 4Q22A 5IFPA 2UY3A 1O6IA 4PMOA 5FOOA 4MPKA 1QWNA 1C3FA 1EOMA 1H11A 3AHTA 1BVNP 5E6ZA 3WQ5A 3CO4A 4HZ7A 2QMKA 5A8OA 5M17A 5I5RA 1MXDA 2WZIA 1CXEA 3POHA 1UH3A 2FGZA 2EEXA 3CZEA 4AZIA 2DSVA 3OGVA 1MFVA 3GXFA 3CUFA 3SCWA 4M82A 3VSVA 5CG0A 4GI9A 1V03A 5HBFA 4NZJA 2Y8VA 1EQCA 4HU0A 2NW0A 2D0FA 4PTMA 4WLCA 4MDPA 3VM5A 4C7GA 4P7OA 1XH1A 3CHCA 4NSBA 4PYSA 3MUIA 4H8HA 3VSTA 3BAKA 2W5FA 4UQAA 4CD8A 1H3GA 2JE8A 3EJRA 1QW9A 2GVYA 3VTRA 3I3DA 3VINA 2VX5A 3M7SA 5A6BA 3PZOA 1VFFA 4XZBA 2X05A 4CN6A 1KFWA 5DMYA 5JBDA 1NM9A 1XGZA 3BMVA 4FLQA 1MVYA 3GYCA 3K8LA 5CGMA 1W3LA 5ABEA 1D3CA 1JAEA 5LA1A 2HVMA 1E0VA 4ZEPA 3UG3A 4KGLA 2PWHA 3WD1A 3MKKA 4AC1X 4EANA 3W26A 1W32A 3NDYA 3F5JA 3LPOA 4HTYA 1VEOA 3W6LA 1B0IA 1UH2A 5BWFA 1E9LA 3QHNA 1OGBA 1C93A 4J28A 1E0XA 4LYRA 4J3SA 5AYBA 1QBBA 2E4TA 5I78A 4D6DA 1J01A 1VFOA 4AYSA 4ZE4A 1GJUA 2QPUA 3WF3A 3ARUA 3WY2A 1H1NA 1R75A 4BQ5A 1OWQA 4YHEA 6CGTA 3ZOAA 4UTFA 2ZICA 3CLWA 1KWGA 2J47A 4QCEA 4YN5A 4LQ1A 3L4XA 3WDHA 3B9EA 3LPPA 1PX8A 5E6YA 2PBGA 3ZR6A 4UFMA 3PZIA 4IUGA 5A94A 2EQDA 1XCWA 3BCDA 4M8UA 3BGAA 1XD0A 1Q6DA 1J0YA 1HKKA 4PUEA 1OB0A 2J77A 4MJ2A 4QDMA 3ARQA 1RPKA 3OZPA 3ZJ8A 9CGTA 1GPFA 1E4MM 2W61A 3PTKA 1BQCA 1E72M 1PZ3A 2XGBA 4BA0A 1TR1A 5D8WA 1PJ9A 1UD6A 3VD4A 3CHFA 4P8WA 1E4LA 3CMGA 2D23A 1T0OA 2AAAA 3PZUA 1WCGA 4TOQA 1CLXA 4H8UA 1AQ0A 2E9MA 3WBEA 4PMVA 1E6NA 1TQVA 3CBWA 3QHOA 3VDBA 1HVQA 3ZJ6A 1NOUA 3OB8A 3DYOA 1R7OA 4PCTA 3D52A 1Y7VA 1KXQA 3AXHA 2JFEX 3NCOA 3W37A 1CZ1A 2VL4A 4CCCA 2D0HA 3WQWA 1M7XA 3GNPA 2WBKA 4MB4A 2YLLA 4QLJA 2FE0A 1HJSA 5DO8A 4IM4A 1B31A 3SCNA 2V3GA 2EADA 5A69A 4MB1A 2FGLA 4AD5A 1V0NA 3GXPA 1IT0A 4HP5A 1R87A 4TVCA 4W85A 3WEOA 4A3YA 3RIKA 1EGZA 2MANA 2WBGA 4DUXA 1EO5A 1UKSA 1DP0A 4H2CA 4H8VA 2ESCA 2XVLA 4WKFA 5CSYA 3WMBA 1QNPA 1AQHA 3MV11 1P6WA 2VZVA 1M53A 4W8LA 4EAMA 1V3JA 4TTUA 1TCMA 2Z1SA 1EQPA 6TAAA 1UKOA 4W5ZA 1V3IA 3PZVA 4OBSA 3WD4A 3WH5A 2WC7A 1KBBA 1L8NA 3N04A 2WVVB 4JZ5A 1GVIA 3VDHA 3B9AA 1SMAA 3BVXA 1QI3A 2VX7A 1UA3A 1TVNA 1H41A 3UESA 5D8ZA 4MJ4A 4JFTA 2G3JA 1R33A 4CD7A 1W2PA 4FNSA 2ZUNA 1AMYA 1WDSA 3SUUA 5C70A 3CZNA 3WH8A 3HZ3A 3AXIA 3EJTA 2PF0A 1JF5A 4FLOA 4ATLA 1W9BM 5BXPA 2WYSA 5DEZA 5BRPA 1TMQA 3CZLA 2IGTA 3VD5A 1MWOA 2VURA 3CZJA 2EACA 4EK7A 2WMJA 1SR0A 2GDUA 4AEFA 3VPLA 2IXVA 2PWFA 5A3HA 1SYTA 1I1WA 1JDAA 4OIFA 2ZXQA 3FAXA 1CXFA 3IAQA 1NWRA 2A3HA 3PZQA 4GZEA 2YFNA 4JHOA 3W4RA 1PX4A 2XIIA 2XHYA 1L0PA 1CGTA 1E1EA 2D24A 3T0BA 4NZCA 2GUYA 1V0LA 1UD4A 2WHLA 1JXKA 4ATWA 2BY2A 3WH7A 1VEMA 1CGUA 1TQSA 3OA5A 4J3XA 3BLPX 3WD0A 2FDMA 4F66A 1QI0A 4B16A 3CZGA 3VGFA 3AMCA 3VM7A 2CEQA 2VQUA 1WDRA 3EJUA 2EO7A 3I3EA 3K8KA 3T09A 1DHKA 4XV0A 1G1YA 3AXXA 1W9VA 5JBEA 3SURA 4PMXA 2EABA 2F7OA 2Y4SA 4MB3A 4AZCB 4C7FA 1BAGA 1GQKA 5AC5A 1QBAA 4FNRA 1JZ3A 2YA0A 5ABFB 4UOZA 1NP0A 4AD1A 3PZGA 3BUDA 4JAWA 2VNCA 1KWKA 3TTQA 6A3HA 3AZSA 1W9PA 2ZX8A 2WLYA 1H09A 3MSGA 5GNXA 4NX0A 4AISA 4PBGA 3QR3A 3DYMA 3AZRA 1ISZA 2OWXA 3ARZA 2QLYA 4CD5A 4ZXOA 3HN3A 1E5NA 4C7DA 5A6SA 2DQXA 2JEQA 2BXZA 3EDKA 1E4NA 5A8PA 7TAAA 1E73M 4F79A 1I1XA 1US2A 2ZXDA 1ZJAA 2W92A 1CGXA 1ZU8A 4DWSB 1W3HA 4NRSA 3BVVA 1B3YA 4MTVA 4UFHA 2QHAA 3T2OA 2WK2A 3PN8A 3O6AA 4FLSA 3AOFA 2YDQA 1G5AA 3POCA 3VGEA 1TVPA 4WIWA 4KRUA 3NDZA 1GOKA 2C8NA 4ACZB 1OBAA 2XGIA 4WJXA 4UQCA 2G41A 2QMJA 1HJVA 4GI6A 3ZSTA 1GW1A 1E6RA 1J0ZA 2A3AA 2WPGA 4PMQA 2BY3A 3VIOA 4V28A 1QNSA 5CSUA 3SUVA 5A2AA 1E6SM 4DUVA 1J0KA 3DX0A 1FOBA 2TAAA 4FNTA 1PBGA 3PZMA 1SFSA 2YKKA 1C90A 3THDA 5F7UA 1MQPA 1R34A 4NXSA 4W7UA 1LL7A 2QV4A 4UOQA 4V2XA 3VIFA 2XIBA 3VGHA 5I77A 5D9PA 3U57A 3EJSA 3M6DA 2G3MA 2E40A 3LRLA 3AHVA 3D3AA 2VRQA 1UR0A 4L4OA 3WL1A 2BY1A 3CPUA 4AZCA 4MAVA 1GHRA 5ABFA 5ABHA 2XVKA 3VMPA 2W91A 3MSDA 5AY7A 4BF7A 4IPLA 2W67A 2CESA 5A8MA 2J25A 4Y7EA 4AZGA 1A3HA 1ZBCA 5BYWA 3N15A 4W7VA 3WQ8A 4BQ4A 1BYAA 4KRTA 2F2HA 4UQEA 1WDPA 2D73A 1KGUA 1B9ZA 4OUEA 5DF0A 3WL0A 2CKRA 3AIVA 1QHPA 5A95A 2XJ7A 4DM2A 1ISXA 3BUIA 3WDRA 3JUGA 2V3DA 7A3HA 2AMGA 3VGDA 1BYDA 3FAWA 1E5JA 3J7HA 2VX4A 3WNPA 3WSUA 3BSGA 1ISYA 2ZUTA 2O9RA 2XFRA 1V0MA 3FN9A 3CHEA 1BYCA 4ZENA 3PZTA 3GXMA 2E9LA 2YL5A 3GH7A 1J11A 1E4IA 3L2LA 1Z32X 4CU8A 2FYVA 2WWDA 1UYQA 2YBTA 3GNOA 3UCQA 4B9YA 2DT1A 4TVDA 3VSUA 5CPSA 2WZHA 2X2JA 3U5YA 3FNDA 1TG7A 1QNRA 2OYKA 2OSWA 3MO4A 4OZOA 5IHRA 1BFNA 4TUFA 4U2ZA 3S2CA 3B9DA 3G6LA 1UKTA 3N1AA 3M07A 3A4AA 2J7HA 1XYZA 3D4YA 1ZL1A 1EA9C 2CHNA 3MMWA 3IJ8A 4LYPA 1HVXA 1LWHA 2DH3A 1HJQA 3N17A 3WQ6A 2G3IA 3D50A 1J12A 2JIWA 3LPGA 1E43A 4D1IA 3OG2A 2XVGA 3AI0A 1C7TA 1JL8A 1EDGA 3DDFA 1US3A 3W81A 4H41A 2JALA 5TD4A 5E09A 1W1YA 4W8BA 4FMVA 3QHMA 2WSPA 4FF5A 3M46A 1U30A 4X0NA 4WK9A 3OGRA 5JIPA 3DHPA 3VU2A 3MS8A 1R46A 3VDAA 3SIMA 2XSBA 4PMRA 4R5EA 1JI1A 2BVTA 1EHAA 3II1A 3KLLA 4K68A 3PBGA 1GOMA 2CKSA 2X2HA 1TQUA 2Y5EA 4WKAA 4E4PA 3WNMA 4UR9A 5BRQA 3RJXA 1ZS2A 2ZXBA 1JZ2A 1JDCA 1V3KA 4OKDA 1Q6EA 3GH4A 4KH2A 1B2YA 1OCQA 4TX6A 2FHBA 5CXPA 1JD9A 5EFFA 3OLDA 3SCVA 4AD0A 4P7QA 1LQ0A 1TFVA 2IUZA 3UR8A 2V5CA 1AVAA 4U31A 1VENA 3RILA 5CPQA 4HOXA 1KXTA 4E8CA 1UUQA 3CTTA 5FL0A 2DSKA 3PZNA 3PZ9A 1HX0A 1UD5A 4QP0A 4AXNA 1VBUA 4BS0A 1WZLA 1W1PA 3DX4A 1HNYA 3RO8A 3LXAA 2VOTA 2X1IA 1BPLB 1TQTA 2WKGA 1C91A 2XN1A 2XFFA 2XVNA 3QOKA 4D6EA 1CIUA 4JFUA 1WP6A 2CETA 2WANA 4TTGA 3AIBA 2VQTA 3GTNA 3KZSA 3WY4A 2ZOXA 4RE2A 5I6SA 1FH8A 1JZ8A 1KTBA 1N82A 1BLIA 3ZMRA 4CD4A 3I3BA 3ZJKA 2YIHA 2ZUVA 4OGZA 4P7NA 3ZT5A 1CGYA 3UR7A 1MW1A 2J75A 3AS2A 4X9YA 4U2YA 2UWFA 2E0PA 3A3HA 4WSKA 4PMUA 1E55A 2AOSA 2PBOA 1V6YA 3WEZA 2EPLX 3OGSA 4B3LA 2O92A 1U2YA 4TX8A 4MADA 1NP2A 4JFWA 1LG1A 1PZ2A 3F5LA 2BFGA 3EMZA 3VIMA 3VGGA 2VC9A 3AICA 1OGGA 2IXUA 4UOJA 4ATDA 2OSXA 2XG9A 1G94A 4D6CA 3N9KA 3AZTA 1UHVA 2GJRA 3VX0A 3DX2A 4FNUA 1E71M 5HOSA 3IANA 3LRKA 1J10A 2DH2A 4JKKA 2J7BA 1UZ4A 4AW7A 1KR1A 3K46A 2GDVA 4P8XA 3WD3A 2J8FA 1W3JA 3ECQA 4WF7A 2J7GA 3K4DA 4UFIA 2OW6A 1C8XA 3NSXA 2B31A 4QLKA 3AROA 3HMCA 4LYQA 4QFUA 2DT0A 3A47A 1HL9A 2W66A 2ZX7A 3FHAA 3A5VA 3BAWA 1GJWA 4UZUA 3UEQA 5GQBA 3ARPA 3AS1A 4W8AA 1RP8A 2W62A 5I24A 3ARVA 3MU7A 4M29A 4LX4A 2VCAA 3D5HA 2VZSA 1PIFA 2GK1B 3AS3A 3WQVA 3MUZ1 1CEOA 5BCAA 2XVPA 3IGUA 1KBKA 2ZWYA 2BS9A 4GO8A 3WH9A 4NF7A 3BUBA 1ZBWA 2EPKX 5IDIA 1UR1A 1E3XA 3GM8A 3FY1A 3WFLA 1G0CA 1K9DA 4AD4A 2XN2A 1HL8A 3HG3A 2CYGA 3AMLA 4J27A 1M03A 4Q7NA 2CBJA 2OYLA 1H0GA 1C7SA 4AD3A 3HU7A 5LYRA 3IJ7A 3T08A 3AJ7A 1NOFA 1H4PA 3FW6A 2V3FA 1BTCA 1DTUA 5C71A 1KCLA 3APGA 3ZR5A 3SCUA 4U5KA 2BHYA 1EDTA 3T2PA 5EMYA 3W38A 4HZ8A 3GH5A 1DWHM 2X0HA 4JFSA 1KQYA 4YHGA 1W9XA 2WMIB 2ZE0A 3AHYA 5HDRA 1QPKA 4UFJA 1MFUA 2NT0A 2XM2A 1VIWA 2D1ZA 1JG9A 3AMDA 4HMCA 2BV9A 1XSKA 4EKJA 2F61A 3ZM8A 5JBFA 5A2BA 2CPUA 2YFOA 2CCRA 4J7RA 3CH9A 1CPUA 3A23A 4IISA 1C8QA 3T0AA 3S5YA 3VKKA 3W27A 3TV8A 1UH4A 1E0WA 5A6LA 1GOQA 2J79A 2XWEA 2QF8A 2Y24A 1ODZA 1DWAM 4QLLA 1TUXA 1CYGA 3EJQA 2E9BA 1XYFA 2BHUA 1BHGA 2JEPA 1BGGA 5JUVA 3SCTA 2BXYA 5D4YA 4PMDA 1VEPA 5ECUA 3A4XA 4W84A 4U33A 5E0CA 3GBEA 3BLBA 4W88A 2C7FA 3CC1A 4OOZA 5I2UA 3VUPA 2CHOA 1IZKA 1QHZA 1EOKA 4DWSC 5AYIA 2GFTA 3HG2A 3BCFA 3HG4A 4LPCA 3WDPP 1OT2A 2WMFA 3KL3A 2WWCA 3DHUA 1ZJBA 3VGBA 4BQ3A 1XV8A 2VRJA 4EE9A 2WXDM 2WVVA 1B3ZA 4WKHA 3IJ9A 1W2VA 1E6XM 3BAIA 1YHTA 2ZUUA 4UFLA 3DDGA 4F9JA 3BVUA 2VT0A 1E56A 3AYRA 1A47A 4D71A 2WC4A 4V27A 3RJYA 7CGTA 4A3HA 1ITXA 1XSIA 1UR2A 3AFBA 2PC8A 4LGXA 2HISA 4ZE5A 3MANA 4JIEA 3THCA 3WUEA 2WVSA 2Y2WA 3CZ8A 1OD0A 4W86A 4OBRA 2CIPA 3NUKA 3ZQ9A 2VJXA 2WAGA 3L2MA 1O7DC 1NQ6A 4W87A 3H53A 3L4TA 4NRRA 3FXYA 5M5DA 3T2QA 2PB1A 1V3HA 4CGTA 2X2YA 2Q8XA 3WN6A 5A6AA 1UKPA 3VO0A 5CQ1A 1HF6A 3A6OA 4PCSA 3WD2A 1JYWA 5M3WA 2W63A 2YA2A 4HPHA 3N13A 1QVBA 2F18A 4GZJA 4DM1A 4E8DA 1HKJA 2ALWA 5DT7A 1TE1A 1MW2A 1ECEA 1NOWA 3VNYA 1OSEA 4D1JA 2YDRA 1PX3A 2DT2A 1CLVA 4H7VA 2J4GA 3WH6A 1GOWA 2FHFA 2J7DA 1JF6A 3NIYA 2DIJA 3TTSA 3BMWA 2W4XA 1R7AA 3GBDA 3VDCA 1D2KA 2G4FA 4RE3A 1XRVA 4J3VA 3WUGA 1B90A 4HA1A 3HJEA 4GZIA 3MUY1 4ML4A 2DEPA 5GNYA 5EB8A 3WY3A 3KE0A 4L4PA 4PUDA 4PSPA 2DSWA 1XSJA 3WMCA 4JFVA 1CBGA 3RPMA 4BCEA 2E8YA 2WCSA 2CBUA 1FH7A 3WNNA 2A3CA 3H55A 1GONA 1V3MA 4AIOA 1F4AA 4XUYA 1V02A 1CENA 2FH8A 3RM9A 3AHXA 1QNQA 4MB5A 3WKZA 3WDIA 2XYLA 5CGTA 5A6BD 3RM4A 2DSUA 3SUSA 1JD7A 1QI4A 1CNVA 3L4UA 2F8QA 4NXKA 1JIBA 1BGAA 2XSAA 1XHGA 3ZT6A 4CN1A 2VUYA 3DYPA 1J0JA 1UD2A 4E2OA 4CD6A 1NH6A 2O9OA 1I75A 2FHCA 3U7VA 2VCBA 4AY1A 4Z2KA 1ZB5A 4DWSA 1U33A 3BVWA 3NSMA 3GZAA 1IZJA 3WNOA 3A21A 2WC3A 1FP9A 2V5DA 2F7RA 1UR8A 3A4WA 3SUWA 1ZBVA 3WBAA 1UR4A 1WE5A 3W24A 5CZKA 3S6TA 4B15A 2YA1A 2X0YA 4GQRA 2A3EA 4ACZA 3WEMA 2OWCA 5EBAA 3QGVA 1BG9A 3BAXA 3RMEA 4CUCA 4J3WA 4CCEA 3ZIZA 3BUQA 4OJYA 1KXVA 3ARXA 5ABGA 5CLWA 3ALGA 5KZ6A 1LLOA 2VI0A 4U3AA 5E70A 3AQUA 4DO6A 1JFHA 2JF7A 5AC4A 1CXKA 1JFXA 2NT1A 4CVUA 4QAWA 4W7WA 3AS0A 4S3JA 4TXEA 1KQZA 4PMZA 3ZSSA 2WVTA 2RGLA 4D6GA 3BXWA 3NYDA 4PTVA 2O9PA 3MMDA 1EXPA 1MXGA 1BF2A 3SCRA 3KL0A 1KXHA 3E1F1
chains in the Genus database with same CATH superfamily
4U1GC 3EKLA 2CO6B 4P06A 3DHDA 1GVQA 3H6JA 3SIZA 5AENA 3N85H 1XQKA 1GORA 1FYTA 5KVDH 3PHOA 4Q8NA 3CUJA 2EVFA 4G42B 3QIBB 1Z44A 4UT9A 5A2FA 3PAJA 1V7ML 3OLEA 1IM3D 2NQCA 1F6KA 3W2DH 3GNMH 5ADPL 3VFCA 3G04A 5KSAC 3G5YA 4YSCA 4HXAL 4PB5A 4KXCA 3SJVA 4G5AA 1KGJA 2CM5A 2ZWSA 4F0LA 4WGVB 3FCTB 2EDYA 4HQQH 3GK0A 1ZTMA 3K0YA 3F7KA 2WD0A 3PDDA 5HVGB 5G5IA 3BH4A 1V6UA 4IOFD 1Q1JL 4PJHF 4D8OA 1JAKA 2YYUA 3UGEA 3SN0A 5TJWK 5FV1L 2JJTC 1KGWA 3KPNB 1TG8A 3NQMA 3DXAD 3Q1SL 2GABA 5FIPA 3V6OC 1OD8A 3BW2A 3HEIB 4RZCB 1JP5A 5I1HL 2JBMA 4PJ5E 1IIKA 4IGBC 3C8FA 4YDNA 5HI5D 3SDYH 1WV2A 1RJPA 4L9XA 4YMPA 3PWJA 2GIXA 3QJOA 2TRYA 3KPRB 1XF3B 4JANB 1ZK9A 4AAJA 3OBEA 4Z95H 1TA3B 4NWUL 4M7LT 1KA9F 2BDNL 1GGIL 2I32A 3QR2A 1GHFH 3VMNA 3FH5A 1BQHG 1LWJA 4M9PA 4AYFA 1IBGL 3PWLA 2DB8A 1CB7B 4UFKA 2WXHA 3LU2A 2BIMA 2Z92A 4IJ3B 1JEZA 4YHMH 4ONGL 4NCC1 1IQDA 5E2TH 3UTTB 1JRCA 4PBEA 2XTJB 1SVZA 5E4OA 3IDYC 5JU6A 1KPVA 4FG4A 5C7XL 4Q33A 1MHCB 3I68A 2ZWKA 1RUKL 2LAAA 1ZT4B 1OKEA 3RR1A 3HVDA 1KZYA 5A8NA 32C2A 3WEBA 2C0HA 3W29A 2V5YA 5FD0A 3MV9E 2KI6A 2HJKA 1N67A 1JZ5A 3MX0B 1OFRA 4WK4B 4ENLA 3D51A 3NEVA 3SCMA 3D3VA 2B7NA 1UATA 3LQGA 3ZKXB 3P6LA 4CKQA 1LRQA 3W0WA 4NZUH 3PTQA 4NOFA 2KL6A 2BPBA 5LA0A 2W27A 1MPAH 3QNZB 4P59H 3WYRA 5HGDA 1T7XA 4Y4FC 1KIUA 2ZP8A 1K9TA 4G1MA 1X5FA 4RPPA 1NTDA 4HC1A 2VMCA 1R3HB 4QRSA 3DX9A 3KGSA 4HLJA 3GFZA 3ZTCC 1S2AA 2GJXB 4UIKL 1GGBL 4DP5X 1B3XA 1Y6KR 2B81A 1B3JA 1QKZH 1V6WA 2B08A 1JPMA 1JPEA 3D18B 4ABUA 1CGSL 5T3XH 4TO8A 4RZBA 1XR2A 3VIJA 3AT8A 1U5JA 3EJZD 1WBJA 4J4PD 3RG1C 4ZS7H 1QRNB 4B9GA 3VILA 4WKZA 2EYRA 3C0JA 2ADFH 3DX1A 1TQCC 4PRID 5FJRA 1S5HB 1XR9B 2VXUL 1U6AL 3HB3B 3M7FB 2WJ5A 5FO7A 1OY0A 3NZGA 2CLOA 1UCBL 4TQEL 4MKVA 1X6UA 4AK1A 3PUUA 3ASOB 3P4NB 1DQKA 2W60B 5F1KC 4XX6A 5DD5H 3WU1A 1ZA6B 4Z17A 5ICXB 3T0WA 1WWWX 2NQ3A 1A3LL 2ERJC 3WLMA 2PTXA 2OCZA 4K9EC 1NCTA 2WBJB 2E3ZA 4Y8EA 1I9CB 3N42F 2VGGA 5AYZA 3UR2A 4IHOA 4TVUA 3GEWB 4NNAA 3R43A 5I79A 2A5HA 1MCRA 1TKWB 2ATPA 1UD3A 1P5VA 5IBXA 5KVGL 4BZ1H 1KLZA 1T5KA 2XG5A 1TMLA 4NQCA 3D25B 2ZZ2A 5DJ0B 5A6KA 2DT3A 2VC2L 2VCCA 1U8LA 1RK7A 1OK4A 3EOOA 1OB1B 1LO0H 3AABA 4ZMAT 1K6AA 4TUOB 1VF8A 4Y4HB 2ZRZA 5IOBA 3XIMA 1JBJA 5KUMA 5ACZB 1UG9A 5EEXA 2A7PA 2DQMA 1YPZE 5AB9A 2J5LC 3QXAA 4QO1B 2WCAA 1THFD 3QV9A 5M03A 1KTCA 1SZFA 5GJSL 3BLKA 4P2RB 2X9YA 3BVNA 4XTDA 3QO0A 4G7QB 3RM8A 2H9GA 1YJDH 1P4BL 4CVWA 2YL8A 4P5MB 1XIWB 2ZYRA 1LDPH 5DVNA 1X5KA 2VABB 3K1GA 2NY2B 1JDEA 4AMWA 1U22A 5FF7A 1X8CA 4X5LA 4KERA 4N9EA 3QJTB 2HNEA 1Q4NX 1HFUA 4E2DA 3KCJA 2Z6IA 3FSOA 3WUWG 5CJOH 1NTHA 1NFBA 4D0CB 3QORC 1RV8A 1FAKT 4Q6JA 1XRFA 4IQHA 5I66A 3CN1A 2O6CA 5E9DD 3ECBA 2WLLA 4AQ1A 1NEUA 3BD3A 3L3OC 4WLCA 1F61A 2FEEL 4NIYE 3VFOA 4WU7A 5CD3A 4JO2L 4PJHE 5AVWB 1C16A 5C08D 2PW1A 1L9TA 4V2CB 2QJNA 4OZGF 4H44C 4NO2A 3SKUD 2HKAA 1ZHNB 3L12A 3LMZA 3QQ1A 1E27A 3Q45A 3I3DA 5LNWA 3S4SA 1ZE3C 2K9FB 1E9QB 4M1GL 4NRYA 2Q2LA 2ZVIA 3SKMB 1OF2A 1VPOH 1SJEB 4YS4A 1EZLA 2RIKA 4WI5A 5HHOE 3GGWA 2YGOA 2NTSP 4ZUTB 5IGXH 4F92B 3E9UA 3CZFA 3DI0A 5HTSA 5ILTH 3F5JA 4E9LA 4CNNA 4Z6AT 1U1HA 1AFSA 3S2JA 1MRCH 5IVZB 1C93A 4KVCL 5CPNA 2HJLA 4D3CH 4XNUL 2AEPL 1RXOB 2Z7ZA 3WY2A 1JPFA 4BQ5A 1OWQA 3H7UA 2VISB 4MZ3A 2ZG2A 5E6YA 4N0UE 2Q5BA 1C9SA 2EYTA 4H25B 3PFUA 4LUSA 4NN7C 5A94A 1ETZB 2VD8A 4TF4A 3IIXA 5F1NB 3CU2A 2DZSA 1GC1L 1DQUA 4JZNA 4Y2LA 4UNUA 2QHRL 2IMNA 3S36X 5HYQB 3RDTC 4Z7WE 1M2VB 2P8PA 1UWEL 1PJ9A 5JHAA 5D5MB 5L2KD 3OR7A 4BFIA 5GGSB 3T4AA 5H1WA 1AHMA 3C3NA 5FCUH 2QR0B 1OC7A 3QFWA 2E77A 4X5QA 3OB8A 5EU4B 1KXQA 5HJXA 1INQA 3RX8A 1CIDA 4RX4D 2JKWA 3TCLA 1WV7T 5KANI 4DUXA 4L3EB 3CUPA 5I8CA 1LYXA 1OGAE 4ZUUB 4Y8AA 1MG2C 4E38A 3U8GA 3TJEL 3VXRA 1R0AH 5JPNA 5JTWA 3DFHA 1EQPA 1UKOA 4NQEE 2PFHA 3EXTA 3KXFB 5DEFB 1GZGA 5T8GA 2VFDA 3BAEL 5CLYA 3S9YA 4F0SA 4QTFA 4NWTH 4LTSA 1PKMA 4H8NA 3WTVA 4PTTB 3LS5L 3MCG1 1KJVB 4Z0BH 3AT9A 3BD4A 4LU5H 3E0GA 3R18A 1EJRC 1FZOB 5BXPA 5C0DA 3HI6H 3OVPA 1T1ZA 1RJYB 1FWBC 4ZB2A 1ZSHA 1WOBA 3P2DA 4BFFA 3W4RA 3GPSA 2XHYA 1L2QA 3OPUA 5F9OH 5DA0B 5BZDB 4TLKA 3GU9A 1UD4A 2Y9RT 1MOEA 5I1IH 2C3GA 3EXLA 3L9CA 5J1AA 15C8H 1Q94A 3L3KA 3DARA 4XOEA 2F54A 2VXSL 4KX8A 2VCOA 2OJPA 1G1YA 4JDTH 5CSGA 3CVBA 3SURA 2NZ9C 1FKWA 4GXWA 5ABFB 3F1QA 3R4RA 4ZFZA 5TE4L 1FFPA 5ESVB 4HGWA 4WDIB 4XBGA 3CSYA 1MSPA 4P23C 4XMLH 1W9PA 2OGYA 1EBPA 3T40A 1VZHA 4JHUA 5LIUX 5I5MA 2YSSB 4H8QA 3GLCA 5DRXB 2EE2A 3H3BC 3DURB 2W9EL 4I5BA 3HW7A 4AJWA 3BESR 1GYAA 5DS1A 4GXMA 4KHXH 4E5TA 1KB9K 3GIPA 4Y9GA 4DESA 2WK2A 5CM1A 1IEIA 3ITYA 2HMCA 4PJXF 3Q9PA 3AOFA 4KAQH 1NZRA 2NQJA 3RLHA 1JPTL 4H4NA 1AO7B 2NY4B 2BSED 1IQ8A 4WJXA 2H3NA 3GSOB 1V77A 3BW9B 2ZCLL 1T8XA 1YY8A 1WT5C 1FOBA 1FDZA 2K3HA 1J8HB 3B2UC 1NCJA 2B4CC 4URKA 5F7UA 2PYEE 2N01B 1LL7A 3TA3D 2ITCB 2QUUA 4JMNA 3P40A 2VM9A 4GC4A 3GMPB 5B4MC 1KMGA 1GZHC 4PJ7A 1Z0NA 4XP6H 3CG8A 4KO5A 4Z78A 4KRPD 1FYTB 5BYWA 5ISZA 4XKMA 3PHOB 5T9CE 4MZIA 4ETQA 2D8KA 2X1WL 3H2CA 4W70A 2ZT9C 5CZRA 4HJUA 3QY8A 4DPCX 3ITOA 2DQDH 1K6QH 3C52A 1BYDA 3F2BA 3EZ4A 1RL1A 3G04B 3JVFC 3G5YB 3SJVB 2HN7A 1RUSA 1J11A 4JFPA 4KKBD 4CU8A 2FYVA 5F72S 1A02N 1EEPA 4G6JH 1OAJA 2A6NA 1A0EA 2OYKA 5JHDA 1JV5A 4HH9A 5KYWA 4YTRA 3N1AA 4Q9CA 1FL5A 3NQEA 4OZGE 2RQ8A 2DQUL 1AQDA 1EA9C 1M56B 1OAXL 4HZLA 1Z89A 3MMWA 3EHBB 4U3HA 2R56L 1UBSA 3LNEA 2XVGA 1MLBA 4FQPA 4KKAD 3H2FA 4LOUC 4LARH 2Z25A 2FZMA 5DQ9A 4FF5A 1JSYA 4PVMA 5JIPA 3VU2A 1R46A 1FNAA 3EGDA 4LAQH 4NJAH 1EHAA 4F5CA 1CL7L 3U6XA 3ZBMA 1TR9A 3RJXA 1E5AA 2ZXBA 4I3GA 1V3KA 3H2MA 5C9WA 5DHDA 1M7DB 1YG9A 4N1CA 3OLDA 1IL1A 2VXQA 4FQ2H 2AP2A 3AWFA 2BOGX 5HI3D 2COQA 4AYFB 3PWLB 2HP4A 4ZOCA 2Z92B 3DTUB 2A73A 1A6ZB 1NLBL 1E9OA 1T4KA 1QUPA 1OVDA 1ICPA 3NAAL 5AW4B 3C12A 1KPVB 4K7VA 3V55A 1XF2B 3W1AA 1MHEA 3IMVA 1FCCA 2EDOA 32C2B 4KK8D 2AOSA 3I4EA 3CIAA 2PBOA 4A2RA 3CDFA 2O92A 3EYUH 2HJKB 3GUTB 4HPJA 4MJID 2CWXA 3LEXA 3AICA 3OPZL 3OQRA 3SCMB 1JNNL 3N9KA 2BODX 3D3VB 2I25N 3DX2A 4OLVL 3RU6A 1A3QA 5TE7H 5T5FL 4X9GA 4H40A 3EOTL 5F3BB 1T6BX 2E59A 5SWSE 5HGDB 3O06A 5JW3H 1KTRL 4LSPH 1JCKA 1WEJL 4NZ3A 2ZX7A 3SRHA 4OWGA 1W3NA 2JKPA 3TYGL 5DS2A 4OD2A 1SO3A 3DX9B 1FVCA 3H8NA 2EG6A 5D1ZI 1EQWA 4PRTA 4M29A 2OZ3A 1WA1X 5D93B 1JZHA 1WHOA 2WINA 1UZ6F 2F84A 3OJDB 3N5AA 4HJGA 1N8FA 2OV0A 2AQSA 1O7VA 3VXMA 1QMUA 4UTBH 5AALA 4GBXA 1H0GA 3Q8BA 2HJPA 2NY3D 1Q6RA 2I07A 1KC7A 4Q8QA 3QPQD 1WAEA 1TIWA 4EJ1C 1Y07A 2X4OA 1HZYA 3RB5A 4WKZB 5MF5A 3SCUA 2EYRB 4K3EH 3D06A 1XSOA 3W9ZA 5E8NA 5D4HA 4YVUA 4X2PA 4J4KA 2EECA 1EJ7L 3AHYA 3EYOA 5FO7B 2D1ZA 3NIFB 3QDAA 2EEFA 5FJPA 1B0GA 4UB9A 4TUJA 5C9KA 4X8GA 1KCVL 1PZ1A 1E0WA 2V5LA 3E0VA 1DWAM 2BS8A 1IGCL 3H24A 2E9BA 3KS5A 1JWUA 4IJRA 3BGMA 1L3NA 3TYUA 1P0SE 5E0CA 1TSIA 3GUWA 1IXNA 4IBZA 5D2VA 1HIML 2GFTA 1P5VB 4IBVA 1PWLA 3EXJA 2PA6A 2XG5B 1R3IL 3NCCB 2J43A 3Q1EA 4LSRL 4ZO8A 1AFVL 3DUUA 2PLKA 2ZUUA 5I6MA 1U8LB 1MDLA 4V27A 5FAAA 4A3HA 2HDJA 1IBBA 3K5RA 1FAIH 3UBFA 4FJ6A 2X4QA 2HWGA 2YDAA 1UOWA 3QXAB 3BRDA 3ULUF 1NUFA 3TN5A 3ZMEA 1DVFA 4G9FD 2Q8XA 2ZZ1A 2HX9A 1X5YA 1ZTXL 3MLYL 2VC2B 1RBAA 1QO3A 1WKFA 1JYWA 3NN8A 3QO0B 2VD9A 2VXVL 3A4EA 1N64L 5KSUA 4XMUA 2XQBH 3KOYA 4BXVA 3IJLA 5C0IB 5JIIA 2J7DA 3DGGB 3QPKA 1AZ1A 3GMMA 2XZCL 3EH2A 3HMXA 4HKPA 4W81A 2A21A 3QULA 3TTEA 1PTGA 1ZAJA 1NCBL 5EMUA 4PSPA 2WAHA 3KTCA 1AODA 3K6DA 3Q9QA 5LIXX 2YD8A 3ETBF 2ARJA 1I9RL 3ECBB 2WLLB 3LHAA 4AQ1B 1XQLA 2CXKA 2J57A 1B9BA 4WU7B 1MIEL 3RM4A 2NR6A 1U3HA 2PW1B 3MBED 1CNVA 4RMUA 2ETWA 4GZ7A 4PLJD 5D7IF 3FBKA 4NO2B 3GQFA 5IHZB 1UD2A 2O9OA 3GVRA 3S4SB 2ZUYA 1W0MA 2IALA 4WW2A 1QPQA 1GTFA 3R0MA 2WC3A 3B8TA 1RY0A 2IKIA 4LHUG 4NRYB 2NUPA 2G37A 5EB9A 3GHPA 1OF2B 1KV3A 3KD4A 1S4IA 3WEMA 3GGWB 5DELA 1FVPA 4O58H 2DQIH 1TPDA 3CZFB 2R1MA 5HHMB 4YR6A 4ODUA 2HJLB 4RRPG 4MOZA 3EH5B 4O0ZA 3RRAA 2O9PA 1BF2A 4DKDC 1OW0C 1IQWL 5JDJA 1AACA 3QEQD 2WMGA 2WVUA 4R2GC 4DT2A 1RBLA 2VC5A 4N86A 3C9NA 2EYTB 1QVOA 2UV8G 1M9WA 4KZEH 4ERIA 3RWJA 3BG9A 3NOEA 1N3NA 2Y23A 4ROPA 1D9KD 3AIWA 4JZNB 5CZXD 4DJDA 3DO3A 4GQPH 1NWTA 4UTTC 5B1AB 4KZ0A 2P8PB 5EL1A 3C6CA 3VXUE 3EYQD 3OR7B 4BFIB 4A68A 5D72L 1UACH 3V5HA 4ACYA 1OY3B 5I8EA 4CC4A 4F8XA 4HJ0C 4WHBA 1W9DM 4N9OB 2YD9A 5FYJD 2A4ZA 1F02I 1DWGM 3RZWA 5J7CC 4GIAA 1JZ4A 2WKOF 3T0DA 2XY2A 3F2CA 1F1DA 5F8RC 1WFJA 2OPCA 4KJWC 1ZT7A 5AG9A 3CUPB 2IFFH 2I7OA 5I8CB 3M9YA 2Z34A 3VXRB 5AVQB 3KX6A 1C5BH 1X4ZA 1EXHA 4U3CA 4UV7H 4AZBA 3JS3A 1D9EA 2XZAL 4DBDA 4C60A 1HSBB 6PCYA 1MRAA 1OC5A 3BI9X 3HF3A 2CLEA 1UZ6E 2O1AA 5C0DB 4B5NA 4N5EC 1W1IE 5L2JA 1SZNA 2FYYB 1QNIA 1Z1WA 4JFFB 2XXCB 4JTIA 3OMAB 3BO8B 1T1ZB 2ZRVA 1UP2A 4YXLH 1E70M 3E6EA 1HTYA 1YMMD 3MNWA 2VENA 3S97C 1HCVA 5HUPA 2FZ9A 3CLMA 4LBAA 2ZE3A 3EWWA 4WWID 3S2NA 4OZFG 2BOBA 4FLRA 2DYRB 4IM8A 5J1AB 3LZPA 4PJEA 1CFQB 1U3NA 1YAIA 3KPNA 4NJGA 2IWKA 2F54B 1P1XA 4X4ZA 4AZHA 3MI6A 1JS4A 2XJKA 3T05A 4GSUA 2QCCA 2VDMH 4DO7A 4ZFZB 2YPVL 2FO8A 4ZAKA 3MRHA 3HN5A 4HGWB 4HS6B 4XBGB 2E4FA 3CSYB 1HHJA 2J78A 5C9XA 1NC4D 3TO4A 2F5BH 1KLFA 4KFMA 3HS9A 3T0CA 1IBYA 3R19A 2Y69B 1UM6H 3UR5A 5FYKE 3O0FA 1T2QL 1TA3A 1PS3A 5I00A 4DO4A 5JHMA 4JPGA 2CZ5A 4A55A 4YE4L 4L2LA 1JHLL 1A6PA 2BVDA 4I5BB 4LAUA 5DHMC 1TTJA 4IT1A 5D9NA 2GT9A 4UQBA 3ARYA 1PEZA 5AG8A 1M9SA 2OSYA 1L6ZA 1FG2A 5CP7B 2J8GA 1BQSA 1FGNL 4PRPD 1EP2A 2H3NB 1NAML 2FTWA 4WTZG 4F33A 3PK7A 2BNJA 1YY8B 5FO8A 4HWBA 5T3ZD 3B05A 3C5SB 3JZUA 4NZTH 2D2OA 5E6IB 3ULUE 4M7JH 1ZJHA 5E03A 5FXCH 1FTXA 3PULA 4C59B 3KWVA 5D4QA 3DX6B 3KWXA 4Z78B 4M48L 5HJ3A 3DZ1A 5AC8A 4PCYA 5HBBA 4ETQB 2N56A 3QMTA 4AWEA 4KNUA 5CEZL 3KTSA 4Y9PA 2BOLA 2QFRA 1Z7AA 1GZJA 1ESOA 2DKSA 2JKXA 3R8RA 3RHWF 1PHQA 4GY1A 1YECH 2J9XA 2A7RA 1DQML 1I0DA 2HN7B 1AH4A 5HGAA 3OG6B 1G7QA 4JFPB 1XF0A 3ABSA 1SSDA 3RWIA 2VITA 4EWND 3CU1A 1OIOA 2YAQA 5JHDB 2XINA 2GJXA 3O6LL 1IGIL 2VDOB 1TTCA 4KFOA 4HH9B 3PE9A 5HY9A 3UTSE 1FL5B 4JM2A 1F3DH 5D7IE 4TUKH 1DBBH 1AQDB 4N0CC 4G6ML 2ZUQC 1UWSA 2YRPA 1KR0A 3GXNA 2IQAB 1KT2A 4XMWA 1OM3H 2VDIA 3ECUA 1Q5MA 3M1CA 1MLBB 1TTUA 4ZFQA 4YSOA 3GIQA 5EEYA 5ADOH 1A5FH 2YEZB 5DQ9B 1J8VA 2RH0A 1NDYA 3BZEA 1R30A 3EGDB 4OIIL 5H4ZA 2TPSA 3N0AA 1LROA 4D94A 4F7PA 4FL4C 3BKCH 4MMZC 4KK6D 1HCYA 2HRWA 4R27A 3IMSA 1ZGLM 1IL1B 3GLEA 2Y36H 2GJ6E 4PMNA 4N87A 2VZUA 4I5UA 3TPUA 1ZA6A 5CD5C 3Q13A 3WS3A 3BV4A 4QM1A 1XLAA 4GPNA 3BKMH 3TN0A 2C1HA 1LNUB 2A73B 2VKXA 1OOAA 1O7DE 3VU1A 3CZKA 5DFAA 1NMCB 1ZLWH 1T4KB 4K71B 4E9RA 1PVNA 3QOMA 4PB4A 5I18L 4PMOA 1KFKA 4MPKA 2V33A 4OGXH 3S8HA 1LK2B 3WHXB 3I2CL 1NDVA 4M7KL 5DX7A 3D25A 4HU3A 1UH3A 1MWAH 4LOVA 5DJ0A 1AD0A 2Q3AA 5BOFA 1G9MH 2GSMB 4M82A 1ZS8A 1EMTH 5HBFA 3S0CA 4O57A 4R84A 3VM5A 5AC6A 5MHBA 4APQA 1XH1A 4Y4HA 4YSPA 4Y19E 2BVWA 4H1LH 1K4HA 1GG0A 3QWNA 4G11A 4PEKA 1NDWA 4MQ7A 4IIQC 1GS8A 1IC5H 2IQ0A 1VFFA 2X05A 3LG3A 1XHHA 4ELMB 1MDTA 4WEUD 2JSFA 1XGZA 2AVGA 1Q7MA 1FV1A 4YLWA 4P2RA 5BWAA 5KZDA 1O94A 2DDQH 1MVYA 3K8LA 1TTAA 1CLYL 3KZPA 2W9MA 2QGDA 5CCKL 4M5YH 2WMPA 4IBUA 1UENA 4EANA 4P2QD 4OD2B 5U4NA 1KFAL 1FVCB 5BWFA 1GKEA 1YEGH 5DHXB 2XN9E 1I9IH 4XPTL 2WINB 2R69A 1J01A 4HJGB 3MLWH 3ARUA 3ZZQA 2ZICA 25C8L 4N24A 1F41A 2H8PB 2J20A 3VXMB 1SVDA 2Z6JA 1DQDH 4GBXB 4D0CA 2INFA 2X4TA 4I7ZC 2I07B 1TJ1A 2X4OB 1YEDA 4WWKD 3UADA 1BREA 3ZKMC 4K3ZA 5CSRA 4X80H 5KBLA 5E8NB 2ESVE 3PTKA 1OAYL 1E72M 2Y63A 3WE6A 3EYOB 2PP7A 3BKYL 1AS8A 3KBFA 1AY1H 1E9QA 1SO5A 1B0GB 4TUJB 4XD5A 3WQWA 5HK4A 1TV4A 2WBKA 2WP3O 4BZ2A 2PDNA 3WLBB 3MPCA 3TFCA 4NZRH 3QZAA 1JWUB 2R1YB 5A69A 2HT4C 3GB7B 3BGMB 4TVCA 3ZTEA 4UQ2A 5D7SH 3RIKA 2V9RA 4FQXA 2XVLA 1GJPA 1M53A 4EAMA 2D9QB 4W9LC 4Q4KA 1V3IA 4FA3A 4PULA 4HFUL 2F58H 1EGVA 5AW6B 3DUUB 3N40F 1KYDA 3QW3A 3O07A 5GJNA 1R33A 1VZGA 4AX3A 4EX4A 2Z4GA 3ARBA 2IWEA 3ID7A 2BK8A 3WH8A 3P73B 4UNLA 3U2CA 5C9RA 2WNGA 4LIQL 3UABA 4DBEA 3DFPA 2X4QB 3MLZH 2NMSA 5AYUL 3FS2A 5GGSA 1J05A 4AEFA 3VPLA 1DVFB 2QR0A 1QO3B 1N4XL 3BTNA 3OL2A 1OGTB 2VZ3A 3NN8B 4FXGC 2XY1A 1MFNA 2AS5M 2H3XC 5KSUB 2G4GA 3FO1A 2WHLA 1JXKA 5L8JB 2WV3A 2J88H 4J3XA 2RDUA 3QAQA 3GMMB 4NAQA 4UTUA 2VQUA 4N6RA 2NY1C 1DHKA 3QULB 3PNRB 3U2OA 2QPFA 2HXTA 4JBRA 3UY8A 1GQKA 1F07A 2E6FA 3GO1L 3F85A 3G24A 4ANKA 5CBEA 3P11H 5DEFA 4RFNC 4MQXC 4RGNE 4NQ1A 1H09A 5GNXA 3S9DB 4P99A 1PZ5A 4FTVD 1U3HB 3BJFA 2DQXA 1FZOA 1PLAA 3FTXA 4JPWL 2J21A 1A5LC 2X6AA 2IALB 4WW2B 1A5SA 4UFHA 2QKSA 5H37G 4JX4A 2CGYA 1L7TH 5GRUH 1VHNA 2RALA 1A25A 3KCOA 5BVPH 4QJ4B 4XVTL 5MP6L 2ANUA 1QFOA 3CFQA 2P8CA 3TC7A 3LEVH 3R94A 4GI6A 1J0ZA 1CD9B 4PJFE 2BY3A 2VQ4A 4ZSUA 4KIRA 3G6JF 2RTTA 3IGKA 2YKKA 1EZVX 1MI5E 2R6OA 3RPBA 2I5YL 1SY6L 2CRYA 3QS3A 4ODUB 4V2XA 3VIFA 3D85D 3TH3T 4LESA 4R8WH 1YEWA 1M7OA 5BU6A 3OHMB 2RJMA 2IS7A 3BN3B 5ABFA 4JZJC 3UWVA 2XC8A 1G6RH 3C9NB 4P9HC 3DKJA 1BFOA 3LSCA 2J25A 5CFHA 2VFEA 1FA4A 3RWJB 3SDAC 1N3NB 3UBXG 4PY7A 2HVBA 3BUIA 2ZF9A 4F8LA 1OANA 5I2IA 1OX5A 1XKYA 4KDTC 3DURA 5JOPE 1S2VA 3V5HB 4KI1A 3GZPA 5I8EB 2E9LA 3NSCA 1XXDC 3FSWA 3SOBL 2WWDA 4GRSA 1BD2A 1QSEE 2GOKA 4OH2A 1UTDA 4LW7A 3WKPA 2VDLL 1T83A 2YQBA 3DBSA 4K9EL 4UWMA 1J8HA 3U1SH 1ZT7B 3H42L 4J3OH 3KH3A 3X1EA 3OJMB 4LLAA 4YHPA 2BNQE 4KTYA 4MLRA 3HNVL 4LLVA 3VXSD 4EPBC 3GMPA 2QQKH 4FMVA 1LJMA 2VUOA 5HAOA 4FQIL 3NCJH 2QADB 4HJIA 3FTGB 5LLIC 4S3GA 3KW7A 4JIIX 5JQ9A 2X2HA 4NM8H 4YHIA 1ZLEA 3GH4A 2FHBA 2CR0A 4X3ZA 1RUML 1JCNA 2N1KA 2VGLM 5L2JB 4E3TA 2IUZA 5CPQA 4OLYH 1O9WA 4Y2DC 5FL0A 4QXVA 4Q8WA 4R85A 4WHYH 2ADIA 1VBGA 2DYSB 3BVJA 3MNWB 4WFFE 1YE4A 5LJYH 4HN4A 2WKGA 4K55A 5DC2A 1OADA 2CETA 2ILLA 3BMXA 4JGJA 4TTGA 3VOJA 4BD4A 2UXTA 4AMKH 2BOBB 2G75A 1KTBA 3WKYA 2IH8A 4KKLD 4PJEB 4CD4A 3D0AA 4JDBA 1CGYA 4KEVA 3UR7A 2DBLH 3IDJA 3VG0H 3WUZA 4KCVA 2E0PA 1XLCA 3R89A 4Z3EA 4BWWA 1INEH 3NCXA 3B8WA 4TVPL 4YFEA 4ZAKB 3MRHB 3M43A 5KBDA 3WS6A 1HHJB 1OGGA 4UOJA 3WO3B 1RUAL 4MGXA 3MSRA 4HT3A 3TO4B 1KLFB 1OYCA 4NJ9L 3WTUA 4S3FA 1F4WH 3HC4H 4CQDA 1M7DA 4G72B 3ULUC 1NMBH 1XMEB 3K4DA 2J7GA 4FZ8H 1U1JA 1F3JB 2GT9B 3TN3A 2Y8UA 4C1NA 2WLMA 3TBYA 5E08H 4N9GA 3AB0B 2W66A 1VCBC 1ACCA 1GJWA 4UZUA 3QA3A 1FG2B 3QY6A 2PO6C 1IWAA 1OCRB 4DVRL 1CI1A 4F33B 1A6ZA 4P2OB 4FFWD 3AS3A 5FO8B 1KELL 5D1XA 3STBA 3LS4L 1EJXC 4GO8A 4NNXA 2EKCA 1XF2A 3WFLA 3OKEA 1DLFH 4AM0A 1C8VA 3P61A 2PLJA 4N2FA 3UPRA 1IIHA 3T08A 3V0IA 2XYCA 2XH0A 1Q90A 1VFSA 3G08B 1TTRA 4Q6IC 1IGFH 4NO0D 3GUTA 2IANA 5FF3A 1NKRA 4KKCD 5HJ3B 2AZAA 4DPBX 1C9DA 1L6PA 4JFSA 4BELD 2HWZL 1Z9OA 5DMGC 2F19H 2YD2A 1TQXA 5BMFH 3SI9A 1TLMA 4EKJA 4NFBA 3F7VA 3N2XA 5F3BA 3FH8A 5JW4R 4AF0A 3OWEA 5HGAB 1G7QB 5FJTA 2NX5D 3CK5A 3RWIB 2VITB 4JN2B 2JEPA 4JG1L 3I6RA 5H8UA 3SOTA 3MR9A 1GPOL 4W84A 3SE3A 4CQAA 5JZ7C 4KETA 4GO6B 2WCPA 5HY9B 4JM2B 3M47A 3OJDA 1IAMA 5F2GA 4MNQA 1J5SA 3QH2A 3HG4A 4BEQA 4AYEC 2AJSL 1KT2B 5GGTL 2JQZA 1A4KA 5D2XA 5FB8A 4H01A 2PPCA 4HHGA 4YVXA 3DSFL 3AYRA 3FFSA 1WA2X 2MRYA 5EY5A 1D8CA 1CK0L 2KMWA 3BZEB 2LLNA 5LHDA 1FSKB 2IPUG 2DIBA 4XO4A 5C0CD 2CIPA 5INCA 4F7PB 1O7DC 3H53A 3L4TA 3MRPB 1ZALA 3T2QA 3UPWA 1ZSXA 5FEBA 1J1PH 5BW7C 3S3BB 2YAMA 1I8IA 5IG7A 3F01A 4XXWA 1XQ4A 4F3FA 3TPUB 2UWEE 4E8DA 2YZ8A 1XBYA 2MQ0A 2B5IB 2J9YA 4UIMA 2NUYA 3WS3B 3SDCA 4FABH 2WY3B 1MW2A 2C0AA 5AHIA 4RK8A 1UMYA 2YDRA 1PX3A 4WWPA 3TN0B 1WF5A 4BK5A 1RVFL 4ZMYA 1T21B 2DPKA 1I45A 1UP3A 3UAJD 1MUWA 4J3VA 3WUGA 3ZE2F 4PJDF 2ZPKL 3MY9A 3S46A 3T7VA 4RAHA 2ZA1A 3Q8AA 3PB0A 1KTDA 2IGLA 4ANVA 1AD0B 3MWAA 2CK2A 5CUSL 4Z0JA 1NU5A 3CAKA 2E7BA 5HI4D 1ZS8B 4RETB 4KQ3L 3RYSA 5CR1A 2YD5A 5CGTA 4APQB 3CUZA 5F1UA 2OTWA 1AR1C 4FC3E 1DQJA 5JVLA 3DYPA 1XIBA 4MQ7B 1A3WA 2CLIA 4ETYA 4G2AA 1U8PA 1XB3A 1FV1B 1ZT1A 5MENA 4DGYH 4TULL 2D2GA 3FULA 1EJVC 3OZKA 5CBAA 1SDDB 3RPKA 3EZJB 4CUCA 1CN4A 2WMPB 2JWYA 3FFCD 2WXGA 2A0NA 5C0IA 1NEZA 2YPLD 3DGGA 1TV2A 3ME3A 4D6GA 1DCEA 2H47C 5E7BA 3EADA 4NHCL 3KL0A 4R4ND 1KXHA 5HUOA 2J8UA 4LRTA 2X4TB 4LSVL 4IBQA 3DFNA 1SEBA 1NDTA 4FI7A 1F4HA 2IW0A 4FXJA 3MRKA 1YEDB 1RZKH 4S3EA 3E96A 3N18A 4BQCA 1DSFH 3LDBB 4WQOA 5TFSH 3IWVA 4YHZL 4UIOA 3WE6B 5IHZA 1NBQA 1I85A 2WJDA 3BWWA 2VN4A 2IV8A 4U1GB 2WM0A 5BUGA 1OVZA 3BC9A 1RERA 4Q7BA 2CU0A 5FPIA 2WSYA 1OIMA 4K2UL 2K9UA 1J1OH 2JFCA 4JO1H 4J2PA 4QD2E 1VJZA 3FOMA 3RF9A 5F7HA 1RU9H 4C83A 4WOZA 3JYBA 3AM8A 2OJEA 5JO5A 3K6SA 2C13A 2BHZA 4UQ2B 3DLQR 3QFJE 5I3KA 4FQXB 1T5XA 1PKNA 4KQ4H 2ZA3A 2QKFA 3C5ZA 1L6XA 4EQ3A 3AIRA 3UG4A 2XTKA 2GSIA 3RA7H 4EZMA 4AV0A 2DTML 3CVHL 4HOWA 4HBQA 4C4BA 3M5YA 2YJQA 1VB9A 1X4YA 3B1TA 5I1JL 4KKRA 5C0BE 1AIFA 1HWWA 4KWWA 5LXGH 2P5ED 3ARBB 43CAA 5JUEH 5IWLA 1RH9A 4ZFOL 2NXZB 3TJXA 3STGA 5AZEH 3LD8B 4KO9A 3KPLB 4IPNB 3PPGA 4HJWA 3MV7A 3TT3H 1J05B 3LM7A 3Q5TA 3TM6A 1M01A 4PJ8A 4DELA 1YO4A 3VD7A 4RGNC 3U7BA 4LDEB 1SUJA 3FO1B 3GXDA 4P7LA 2A1WL 3WN5C 4HAGA 3UWWA 2UVEA 2XQYK 1QK0A 4K15A 3MV8E 4GAAA 4N6RB 5C09D 4NUJA 5DCBA 2IO5A 2LQRA 3J07A 3C6LA 4MDIB 1S3KH 5CBEB 4QLRA 4HSQA 4HHHA 1QFUL 4NNCA 5D1ZD 2BFVH 1HSBA 2E74C 1E5CA 1PZ5B 1MREH 4L7ZA 3LRMA 1ITBB 3NAVA 2ZX5A 5LUMA 4LLDB 1IEAB 3MSPA 4GYBA 1CLOL 1JGIA 2V5SA 2EINB 5FGBC 2FYYA 3I6EA 4JFFA 5HANA 2Y7OA 4OUOA 1FCQA 3B5GA 3BO8A 5F93C 3MREA 3OKLB 4NOBA 1ADWA 2X9XA 2WQXA 1ADQH 3RVVC 3FQXA 3QV7A 2K6ZA 1JHKH 4Y2WA 1E6QM 1RLBA 1B3VA 2IBGA 2OG9A 3VJ6A 1EHNA 3JXAA 3R7RA 3WUBA 2DQJH 1U42A 1CFQA 3RE0A 1S46A 4GGHA 4GAGL 1PAMA 4BQ6A 4K23L 3ZT7A 1F18A 3NCYS 5FR3A 2PPAA 2EIBA 3W6MA 3UFIA 1O1HA 1BFOB 4L9ZA 4HS6A 3EPMA 4EIUA 3GSNH 3O3UN 4D0BA 2OZNA 1CZ8H 3T6ZA 3ARRA 4WGWB 4PY7B 4AEEA 4P3CH 1SQ7A 1YTDA 4HZ6A 3ZE2E 2Y61A 5I2IB 4CU7A 1JPSL 4MA7L 3ERPA 4Q58C 5EZLB 2ZTKA 2WUBH 4U49A 4KMQA 2CBVA 1HHKA 1KCXA 1BD2B 4JVUA 2VXTL 3QRLA 3RNDA 3MW7A 1NBYB 3AIUA 2VZTA 4TSCL 2QTVA 1DJYA 5CP7A 4B60A 4GVGA 5IB3B 2OQHA 1ZCCA 4QRAA 3ARTA 3FU5A 2DYPA 1AXIB 1TZ9A 4DWHA 3SDDD 3T0TA 1VLXA 1QYGH 3GS6A 2PTDA 5LBVA 1W15A 3C5SA 5E6IA 5LN4A 4ACPA 3GBLA 5E4EC 4YHPB 2V7HA 2BIQA 4LLVB 4GT0A 2WXKA 3RX7A 3I7RA 2VDLB 4KBXA 1KB3A 2PDXA 3VW3H 3DHFA 3DX6A 2OSLA 1XYBA 1X6LA 4WD0A 1UB3A 1RZFL 4JRXD 4PN2A 1KJ3H 2GI0A 3WFZA 4P4KC 5I1EL 5EFDA 1G7VA 2NLJA 2EDWA 4QRBA 4AYDC 4NKCA 3GHSA 4YHIB 4KWOA 2PDLA 3CZSA 4W6YB 4S1SL 3MRNA 2H6RA 4N0YH 5AECA 1ECYA 1WUZA 2XBDA 5KVMC 2DEWX 2L7QA 2EAEA 3VVVA 2OYMA 2LAGB 2QDEA 2EXOA 2EH7H 4W89A 2ADIB 4JX6A 4RDQF 3SE4C 1S5IL 3L1GA 1O0VA 1KCRH 1E40A 4F1ZA 4HHAA 1VPYA 4L4TE 4UTAH 4A4AA 2G75B 3U36A 4LASL 5KZCD 3MHGA 3B9OA 4JTFA 4X4ME 5CZ0A 3MYOA 3ZKNC 4LKCA 2IQAA 2BZ7A 2QMKA 4NG3A 4P2AA 3IDJB 4IBSA 5I5RA 4QX4A 5DJ2A 3MOAH 4ECLA 3MLVH 4JUSA 1NCWH 4Y5VC 5E2WH 2YEZA 4Y1AA 4UNKA 2A7BA 4AJVA 1FNSL 4JQ4A 4O5LH 4RDQG 3V36A 2Y25A 4WUKL 3BX7C 5EBWB 2VWEE 3ZQXA 1XF4A 1LGVA 4UTIA 4YH6A 5D7JC 1FI8C 3P80A 1YEEL 2HUEA 2Z29A 3V4PL 1U21A 4PTUA 2X9WA 1JAEA 2HVMA 3CFTA 4C1NB 2OBGA 2Z93A 3TBYB 4RNRA 4L1TA 5I74B 4N9GB 5FUOL 3UIZA 1T7YA 4ZMXA 3REWB 3TZVA 3QA3B 4O4YH 3FCSA 3SGJC 1UH2A 1RLWA 1LNUA 4KI5F 5C07D 2CKBH 3MLUL 4B9KC 3FSUA 3QQWA 4EI0A 5D1XB 4GAFB 3ILPA 1FLRL 3O0KA 3APCA 4NNXB 3DMMD 1NIBA 5TF1H 1T7LA 3ZTDC 2J47A 3LEYH 3OKEB 1LK2A 3WHXA 4AM0B 1QSFA 2C79A 1GWJA 5TNVA 3UPRB 2EQDA 3K4ZA 1TFPA 1EJ8A 1I3RB 4UAOC 1WJ3A 2GG1A 4A7VA 3FRUA 4LCYB 4QDMA 3JT2A 2IANB 4JM4L 3D5OF 1GZ1A 1WAAF 1PCSA 3SQMA 3IXTA 2IAMD 3VD4A 2YN5A 4KCTA 3E0LA 1W8OA 4ELMA 4PRAA 3F7VB 2PDQA 3QUZD 2I5IA 3RNQB 3QHOA 4G7SB 4AF0B 1SUXA 2XG4B 2ORBL 1YNTF 3SBQA 4L5FE 3UH8A 3SD2A 4G6FD 4KEMA 1CICA 5IHLB 1V0NA 1UJ3C 1Z5LA 3MR9B 1J8RA 3LH9A 5T5FA 2MANA 4MVAA 4GQ9L 5ACMA 3W74A 4JE0A 2DKMA 4MNQB 1QNPA 4M7TA 4PU2A 2VFGA 2R4RL 1A4KB 5FB8B 2H8PA 5FEXA 1SHXA 4WUUD 4OT7A 4FFVC 4G9PA 1YNKH 4IF2A 1TVNA 4YVPA 4JFTA 4J1UA 3W11D 1W2PA 3ZKQD 4O1BA 3SUUA 5FJOA 1NWPA 5J3HD 4XVDA 3KAAA 2WYZA 5C0RH 3KPQA 5INCB 2JMRA 1OTTD 3VD5A 1YNQA 4LAZA 3APNA 3ARDD 4GOSA 1F73A 3FAXA 4N2YA 1I8IB 4P07A 5IG7B 2YFNA 4F3FB 1L0PA 3U2SB 2OODA 4XN7A 1E1EA 1K1DA 3REVA 4N2IA 4UIMB 2GVJA 3SDCB 3RWEA 1U4FA 3WLBA 1CGUA 2R1YA 5EZJA 3A9BA 2X0UA 3GB7A 3O6MH 3MZTA 2GY7B 5D6DC 4R7NA 2O4EA 3CE1A 4TRPH 3BKJH 3R12A 3K80A 2EABA 2Q0ZX 2OTUA 3T0EA 1KEGH 1KTDB 3WOVA 3GWQA 2CBOA 1ZHBA 4PJXE 4DF9A 3EOYG 4FX7A 4PBGA 5AYQA 4FP8L 3QR3A 3DYMA 5I6KA 5IFHL 2YK1H 5LWYH 2OTWB 3P73A 3RAJH 3MA7A 2DZAA 1DQJB 3EBAA 3TFKC 4F79A 2J4WH 3K1KC 3S37L 4NIKB 3KJ6H 3MDWA 3CXHK 3QQ3A 2WB1A 4ZMVA 1U8PB 1ZT1B 5MENB 5TAOA 2C14A 4YK4B 1G5AA 1OGTA 3QQXA 4ZSOE 4EDWH 3IIPA 5J5DA 3EEZA 4QCIA 5CBAB 1GOKA 4YS1A 4B27A 5H8MA 3WG6A 4V1DA 4I5XA 5E99L 1E6SM 4MAYA 2TAAA 5EUKA 1XLBA 1NEZB 3LY6A 1Z9SA 1ONXA 3WMLA 3V6BR 4YTTA 3YPIA 3ETBJ 4X42A 3QISA 4OTXH 1J5CA 2AQWA 5HMFA 2O5XH 2OI9B 1XXXA 5AOKA 5F1OB 3MP3A 4A2HA 2J3SA 4GG6B 4LRNL 4G8GE 2J8UB 1T1YB 4IPLA 4BKNA 1K3ZA 1SZEA 5IOKA 2HLFD 4FZEL 4HD5A 1SEBB 2CBQA 2WZPA 1IWBA 1KLYA 5ABZA 3GZKA 3MRKB 3RKPA 2H1XA 5D55A 3LHPH 4B5ZA 4LOEA 1TJGL 1VQTA 4G7RB 2V5BA 4XP1H 1MFBL 2NW3A 4QGTA 4UXDA 3B7UX 2WP3T 1V0MA 2YL5A 5EMJA 2OZTA 1G4SA 2NNFA 1AQKH 5E1GA 3FOMB 2AXFA 4HCHA 4LV9A 4C83B 2JELL 4QOKE 2OJEB 2HE5A 3QUML 5JO5B 3K6SB 1OTSC 4QYAA 5HMEA 2PSNA 2BRRL 2WWNA 5ALBL 1T5XB 2J7LA 1TSRA 5H6HA 3ELAT 3C5ZB 4RMSA 4D1IA 4LGPB 3O2WL 1IAIL 5HDQH 2GSIB 3GDMA 2FFCA 1T5AA 2Z2BA 2UY7B 4H00A 2HH0H 3GLZA 3BLOA 2X10A 5IRPA 1BXCA 1AIFB 3RWFA 1S5TA 2E7LC 4GKTA 4LYKA 3GVVA 3L3HA 4KI5E 43CAB 3FQ2A 1RZJH 5EZOH 2PLCA 4LVAA 4AD0A 3CVHB 2WZMA 4TR9A 4UBDC 1TFVA 5GRZA 3MV7B 1I1FB 3O8AA 4DLFA 1A14L 2VDRL 1RZQA 3WYZA 1MNSA 4PJ8B 2Q8AH 1ZCOA 4N68A 3STCA 5I82A 3D9AL 2BVUA 3COTA 1CIUA 1WHPA 1WAAE 1W6TA 1RULL 4A3QA 2YIHA 4NUJB 2H3DA 4TV6A 2O30A 4YDJB 1UADC 4Z7NB 4HPNA 3E2VA 4WSKA 3C6LB 4ZW8A 3KR3L 1MAJA 2EPLX 1U2YA 3MCMA 1WKDA 4LL9A 1PZ2A 3N73A 4MWAE 3Q2CA 4RLIA 5J04A 2LABA 4B3EA 3FTGA 2J24A 1U8QA 4EMZA 3G0UA 3GZQA 4S1DC 3BP6A 1WD8A 1KN4L 4PG9A 5EO9A 1ASOA 3ZE0F 4LVBA 2J7BA 2PGEA 1V7AA 1UZ4A 3QTGA 5AVXB 1MZYA 3MFFA 1X97A 3UDWC 5I0WA 4C6KA 3NQ6A 3FKKA 4WO4C 4NQDE 4J2QA 5AOJA 3MREB 4QI3A 3FQXB 3QXVA 5IP4A 3BWSA 5EYWA 2G2NA 1ZVSA 5T1DH 3RGVA 2O4QA 3AS1A 5GRJH 4RMVA 5I24A 1MNNA 3VJ6B 4EXKA 1OLZA 4J3BA 3H6OA 1CFVH 1FJ1A 2HSAA 1FYHB 4XP5L 3GM8A 4OCNC 2Z7WA 3VNMA 3IIVA 2OR9L 1GMEA 3JRKA 3ITVA 1L9OA 3L67A 5D1QD 1HYRC 3SD5A 3MRJA 2XDFA 5C71A 4G8IB 2AQTA 4B6ZA 2DTSA 3B4YA 4FS9A 5G2WA 1IKNA 4ZXBA 2AJXL 4ANWA 5MERA 4D0BB 4WNQB 2Y22A 2XA8H 3CAFA 1JPIA 2PCQA 1PY0A 3N9GL 4X0KA 3QEUB 1LEIA 4M4RA 4XSLA 5FGCE 3ZM8A 2H2PC 4C57C 5IR1A 5DMLA 3QW4B 2FIKA 5F2IA 3BRFA 4ZDHB 3D09A 2YPVA 1F3JA 2KLRA 1HHKB 4EN3C 4DEFA 2BHUA 1X3DA 2IGFL 4TNEA 3QEGL 2KQMA 1VEPA 3T3PF 2WBWB 1KYOK 4P2OA 2DYPB 4PS3A 5C0AB 1F6YA 3LMJL 5IMLA 3CH8A 4DGIH 5F6HJ 1F90H 3RFRA 3ULVL 3RVWD 3RGBA 4AEHH 3T42A 3RY6A 4O00A 3HVNA 4A8IA 2ITEA 2ZRXA 2V7HB 3BAIA 5A2JH 2AFNA 2WC4A 2K7QA 3G08A 3TFXA 1NAMA 2OSLB 4G2DA 4EZJA 1PZDA 4K3JH 2WVSA 2JK5B 3GK8H 3SKNA 2AK4E 1LWIA 4W86A 4C56E 1CG9A 2PCXA 3QUXB 2NLJB 3V4VH 1NQ6A 4W87A 5JHBA 5HHNA 1V3HA 3QWRA 4HLZG 3MRNB 4OF6A 3Q8CA 1T2XA 2APWA 3C87A 3EBGA 2L5HA 1RZ8B 4B53A 5D96B 3D2TA 2YGNA 2W95A 5EA0L 1LP9A 4JN2A 5JQ6L 2CR3A 2XFGB 3MDUA 3CV6A 5FYLH 2VGBA 4HHAB 4F91B 1ZGDA 3U36B 1R7AA 3K7UA 4H2AA 1HQTA 3Q37A 2PURA 4DJFC 3L5XH 4LKCB 4MRBA 1WZ1L 2OM5A 5CINL 3BSZH 5DJ2B 3A6BH 2EH8H 3VZZA 3F4DA 4LCSA 1CDHA 1V3MA 4KKXA 3BK0A 5BV7H 1FH5H 3IJYB 1CENA 5DZ9A 4ENED 4Y1AB 1TRIA 4XZ9A 2XVBA 3WKZA 4E3VA 5DRWB 3LIZL 3KLQA 1NEYA 1JD7A 2YN3A 1VFHA 3TFBA 3CCHA 1XF4B 3D08A 5DCEA 2SFPA 4AHOA 3MRPA 3NSMA 4FYQA 5DD6B 4CQ9A 3CH1A 3WNOA 3G5EA 1ML1A 1KYAA 5IFAH 3GG0A 4OI8A 4HS8L 4PTUB 4K2SA 3MMEA 3FUIA 3US9A 3S6TA 3NSDA 3B8DA 3KBMA 1ROCA 2Z93B 3BAXA 4RNRB 2R2HA 3EEGA 4BH8A 2NY5C 4OJYA 3KGUA 5F9WC 3TZVB 3HZVB 3FCSB 4AG4L 2CZFA 2YCEA 4DO6A 2CA3A 1CXKA 1GGCL 5CEXA 4CVUA 1T21A 4GEJA 3BXWA 3ILPB 3M7OA 5A8GA 3S1WA 1DIDA 3HAEG 4LCWE 4GEIA 3VI3F 1QSFB 2GBUA 3CWNA 5FWRA 3NYZA 2BSSB 4B9ZA 3HUJA 2POZA 1P4IH 1TZIB 5HYFA 4LCQA 3FRUB 3SCQA 5DO2C 3NJNA 2Z7UA 3QPXL 2MKLC 4IOSA 3WNLA 3IU3A 5DHVA 1W8EA 1G4EA 8CGTA 2OK0H 3ARFD 2PPEA 5I9QC 4GWEA 2ZC8A 3IXTB 2GYSA 2Z0IA 2FH6A 3A3XA 2O7SA 1CTMA 4HMEA 4OV4A 3TQKA 4PRAB 5BVJB 3TW7A 4TOYH 2FB4L 2WKLA 5EF3A 5FW7A 4QRFA 3BVDB 1X7SA 1SDDA 2EE9A 5BS0E 2AI0L 3G6MA 3M8OL 1KOAA 2PDGA 1SOKA 4L6DA 1CICB 2O0TA 2ZZ4A 3E2QA 1Z5LB 1E8XA 5DZLA 4IX2A 1B30A 4NKIH 1HJWA 2DQHL 3ZE0E 4L0YA 1F0LA 1UR9A 3VWJD 3SQRA 4ZQKA 4RJEA 1NL0L 4G1KA 4JRYE 3MRGB 3LSBA 3RG6A 4K8RH 3S3JA 3OLGA 4E9YA 4DP7X 1GKPA 1TETL 4J1UB 4MJJA 3NIGB 4DZBA 4M6AA 1NFDF 4KJPC 1KYFA 4MZ2A 3NMEA 3KPQB 1QBLL 1O5QA 3IJDA 1OAQL 4H04A 4ORIA 4LLYA 2VO5A 3X1NA 5T5NF 2ZXAA 4PJCF 4ORZC 4Q0XH 5D70L 2IMRA 1JZEA 1J0IA 5G4OA 1WZAA 3E9TA 5JH2A 3ATFA 4PRWA 2LFEA 3ZL4L 1YXYA 4OM0L 3REVB 4TLUA 4O10A 2PDIA 3RWEB 4Z76A 4LSTL 2WHMA 3LUTA 4AWTA 5EZJB 3EYFA 3QFDA 5F8QC 3DXAE 4LVOB 4O2EA 1F3XA 4R7NB 2X6MA 1JERA 3S47A 4GINA 4FSAA 2P52A 3ISIX 5FYKL 5KSAA 2ZTJA 1IC7L 3FYPA 1OCNA 2MPVA 3O4LD 2OTUB 3T0EB 4E4UA 1MVFA 4ADSA 4KQ0A 4KZCA 5T5NG 4UUJA 3KDOA 4WHCA 1JDDA 2HJFA 1ZHBB 1DQLL 2WHJA 3TJHC 2FECL 2W59A 5E0FA 1FRGH 4E0RB 4IOIA 1ZIAA 1MHPL 2ABAA 3XISA 4PMYA 4LPUA 4XN9A 3MA7B 2JJTA 3CBJB 2OCFD 1CDJA 1H62A 4I87A 4IDLA 1DLHB 3KPLA 1S1PA 3ARSA 4AIZA 2PNDA 1CX9A 3CFCL 1JXJA 3QQ3B 1X1OA 2BOEX 3ULUL 4B9IA 1SJVA 4IGBA 3O6YX 5GGQH 3P0VL 4ZNEE 1F45A 1JGMA 4Q8TA 4QCIB 2EBNA 3S1XA 5C8BB 3TLRA 2P8LA 4V1DB 1VBRA 4KIEA 4MAYB 2VR4A 3ISRA 5DUPH 4Z3FA 5EUKB 1E8ZA 4WI4A 1Z9SB 1K72A 1W0YT 2HG0A 3QPEA 2HVNA 3KVMA 1TZ8A 1B5TA 2BZDA 1F3WA 4I90A 1TPWA 1W3IA 4XD6A 4MDIA 2WLKA 1BSIA 2D03L 3L4ZA 5I3DA 1MFCH 1XLMA 3W85A 4ODVL 5AW3B 4MJ5A 1D6EA 4EOWH 4OFYD 1R86A 5D05A 2C5DC 4FMKA 4UMAA 1IXPA 3LXBA 1DL7H 1M5WA 3BLEA 3BDKA 2WM1A 3INPA 3O6FC 5IT2H 4LLDA 1IEAA 3FK3A 5FFOA 5DZJA 5DVPA 5C7HA 4A7TA 1OPGL 3D69A 1R4XA 4XVEA 2NW3B 5H91A 1C5DA 4OD3H 1GIGL 4LLMA 2ODHA 4CN4A 3FO0H 2JIEA 1F5ZA 4FIRA 2VLRD 3FB8A 3OKLA 2P80D 2KERA 4GUPA 1LK3H 3U9WA 5I3JA 1Y0EA 4JO4H 2P8MA 1M2OA 4LNYA 4AQ8C 1QFWH 3EGSA 1I4NA 2APXA 4HU8A 5EF2A 4I0PD 2AXFB 3CLEH 3WF0A 2DD8L 3FMGH 5T3XD 2ASHA 4LSUH 2GSJA 1A2YA 2NXYD 4F9PC 5CCZA 3KS0H 5E9AA 4JO3H 1NDZA 2QQQA 4MJMA 1I82A 2GSGB 1ZD6A 1DVJA 1LF1A 1P1MA 3CSBA 3NQVA 5CJ5A 3UTZA 1AJ7L 1QFWI 5BXSA 4Q4MA 4Y4FA 4WY7L 3WFEH 1SW7A 4FXKC 2YL9A 3MACH 5T1KD 2ZXWB 3L4YA 3NO3A 1Q2SA 2ICWJ 3VAEA 4N2AA 2JCCF 1LL4A 4PRIE 2F1AA 3RWFB 1GS7A 3IDGA 4HPOL 1A9BA 4JKLA 3LYRA 3L3HB 3N2JA 4JN8A 1SY6A 5DTFB 3GRIA 1DJQA 1UOLA 4OQTH 3OAWA 2A9AA 1DVSA 2OEKA 4W9ZA 4YWGH 4JCWA 1UEYA 1MCNA 1JUBA 4M81A 2ZX9A 1VCFA 2JIXA 1N0LA 1RZGB 1FG9C 1RIVH 4FNLH 1W17A 1W3KA 1LP6A 2ZJSL 1PZ0A 2NDFA 1AW1A 5EZLA 1BYBA 1K7FA 3A3WA 3QJAA 2Q9OA 3BLIA 4MKTA 3O0RH 1NBYA 4HIIB 5DMKA 4MWAC 3FH7A 5IB3A 4EVNA 3WLIA 4Q4IA 3O6DA 4HEME 2D22A 3UY7A 4HUNB 3Q2LA 1QNZL 5FKAB 1EOMA 5B80A 3AFLA 3IEAA 4UYPA 3NSFA 4YYCA 1FWIC 3AUJA 3T3MF 5JXEC 2EEXA 4OY9A 2WTOA 1FE8H 3GSQB 5DU7A 3GIZH 1VC4A 4YCPA 5HDBF 1D5XA 4KVNH 1F76A 6FABL 5CFAA 3BAKA 2GI7A 3C6SA 4CD8A 4E68A 4GH1A 1U8QB 3URQA 3BP6B 4PV9A 4PG9B 5EO9B 1W8NA 4FFYH 3UTQA 3MFFB 4KOBA 4D8LA 5MKGA 3IKKA 5IJDC 1NCAH 2QDDA 1U3YA 2GL5A 4KGLA 7FABL 4HCDA 1XAUA 4MZRA 2YGVA 1ZVSB 4FEIA 3RGVB 3BP5A 3GUGA 2TYSA 5CJBA 1JPKA 4KROC 1U9KA 2QGYA