4MB1A

The structure of mall mutant enzyme g202p from bacillus subtilus
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
559
structure length
557
Chain Sequence
b'EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIPSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQADLKSISLKPYEAVMGISI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase 1
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 225
structure length 557
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4mb1A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb1A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4mb1A02
1JI1A 1EOKA 5FD0A 5GPRA 1CGTA 3BUDA 3CUHA 2YFNA 4J27A 4GXPA 6CGTA 1Q6GA 4FMVA 1CGVA 4MADA 1Q6CA 5A3HA 4N42A 1W3KA 1XH2A 5DMYA 3WFZA 4PYSA 1JGIA 4PMUA 2D20A 3KL5A 4DWSD 2AAAA 2CKSA 1V3JA 4TTGA 1BF2A 1UD2A 1EDTA 3RPMA 1BG9A 3OA5A 3WDQA 4PUDA 4CCEA 2XM2A 4HZ6A 1ZBCA 1LL6A 2VCBA 5CJ5A 2DT2A 3BVVA 4W8LA 1AQMA 2FYVA 4PTWA 4AC1X 1GQKA 1HXJA 3T0AA 3SUSA 3QOMA 5JIPA 3EJQA 4P8WA 1C8XA 3AMGA 5A6JA 1WPCA 1XD0A 1E5JA 1E6PA 1E3XA 2XN2A 5IDIA 1JZ5A 3OGSA 3WDJA 2DSKA 2BVYA 1BFNA 3FXYA 2BY0A 3F5KA 4HP5A 3ARSA 3POHA 4F8XA 5CXPA 2WAGA 1OCQA 2J62A 2J7EA 3MMDA 1WAWA 1R7OA 2WC4A 1WZKA 1C8YA 1E71M 3AYSA 1JFXA 4UQAA 1VEMA 4B9ZA 2JALA 3LX9A 1BGGA 4TTUA 1QNPA 1G94A 1MQPA 4P8UA 1HKIA 3PZOA 2VQTA 1UWIA 2WXDM 1E40A 3FAWA 4J3XA 2AMGA 4H7VA 2YBTA 1FH9A 4AEFA 2J74A 3CZGA 4JKLA 4KGJA 4FLSA 5A69A 5A95A 1KXVA 3KL0A 3VX1A 1G1YA 1Q6EA 4JL1A 4MB5A 1LL7A 3WELA 3SURA 1GNXA 2WSPA 3CZLA 5GNXA 4YHGA 3WQ5A 1QOXA 3J7HA 1E1EA 2VL4A 2XGIA 1QX1A 1CLVA 5DT5A 1UUQA 1DWAM 1HXKA 1KBKA 1E6XM 1MWOA 1JXKA 1US3A 2BY2A 2JEPA 1QHOA 3IAPA 2XIIA 5CPTA 3B9EA 1QW8A 3RIKA 1NOWA 2ZIDA 5HNNA 3VDCA 2WVVA 4B15A 5A6KA 3PZUA 1WDRA 1W9DM 3AHVA 4UZSA 4PSRA 4WKAA 3L4UA 2J7GA 1KGXA 1CZ1A 2BV9A 2WVTA 4MNLA 2W62A 3W53A 2WB5A 2IXUA 3K46A 3WEMA 2ZE0A 1EH9A 3CHEA 2GFTA 4X0VA 1UD8A 3VOCA 1B1YA 1E6RA 3A23A 1UG6A 3I3EA 5E09A 3WUFA 4ZE4A 2J7FA 2OW6A 2G41A 1W1PA 1TVNA 3U5YA 1DEDA 2V3FA 1JXJA 3WY3A 1OM0A 2UY3A 2Y2WA 3AOFA 1E73M 2WCGA 1K9DA 4UTFA 1UA3A 2ZX5A 1MW0A 1IT0A 1B3ZA 2WWCA 5FIPA 2YKKA 2G8ZA 4J3WA 1OD0A 1CXFA 1GHRA 4TUFA 3LXCA 2FHCA 3TOPA 5A1AA 3RMEA 5ABGA 1FHDA 4ML4A 1FH7A 2F8QA 4M80A 3FW6A 4LYPA 2HVMA 1J01A 3ZJ7A 1TR1A 5BRPA 4M81A 3VNYA 4DWSC 2G4FA 2X1IA 4OGZA 3EBVA 2VX7A 4OIFA 3HG2A 3BAIA 4B3KA 1G01A 3BSHA 2CETA 5BXRA 1SFSA 1NOFA 4OOZA 2W66A 3WH9A 2XHYA 1GVIA 4GO8A 3WFLA 1NM9A 4DWSB 1US2A 3A4XA 4AZ7A 3WQWA 5BYWA 4UQ9A 3IAQA 4AZ5A 1C93A 2WZEA 4JAWA 2F1BA 3AROA 1JDCA 3T08A 4ACZB 1PIGA 4WIWA 2ZUTA 1E0VA 3BXWA 1HVXA 1CGWA 1OIMA 3ZSTA 5ABEA 3W27A 2FGLA 4PCTA 3UG5A 3S5YA 2EPNA 4L4PA 4B16A 1JZ4A 4JCMA 4AIEA 2JF6A 3EYPA 3PZTA 2CIPA 4OOUA 5D8WA 3TP4A 4D6GA 2XN0A 2J7BA 2VX5A 1TQTA 3AHZA 1XSKA 1UKOA 3ALFA 2YL6A 5C71A 1BPLB 5I79A 3W24A 5IXEA 2CCRA 1Q6DA 1UR2A 1E70M 3AICA 1XV8A 3GBDA 3DHPA 3AMKA 2ZX9A 5ABHA 2EAEA 1E43A 1JD9A 3WNMA 1FHLA 1CXHA 1WZMA 3CUGA 4CD5A 3SEPA 3K8KA 3UCQA 4NXKA 4Z2GA 4TOQA 1HL8A 5A6AA 3LRLA 1UZ1A 3CMJA 3M7SA 3WH7A 3BCFA 4YPJA 1ZS2A 1E4IA 4S3KA 5I23A 1FH8A 4GPNA 5A8OA 5E0FA 4NX0A 1C7TA 1KR0A 4J7RA 4E4PA 5A2BA 2C7FA 1LJYA 3WQ4A 3UG4A 1BYDA 3HMCA 1MFVA 4MJ4A 4W7UA 2E4TA 1I1XA 5EBAA 2EPKX 3CUJA 3I3DA 4BQ5A 5A2CA 4JFUA 3WSUA 1MVYA 1WNOA 3DX2A 2E8YA 5CGMA 1XGZA 2NT0A 4AIOA 2XFRA 4P8VA 1VBRA 2VZVA 3MUZ1 1H09A 4KH2A 6A3HA 4Q7NA 4TVCA 1ISVA 3A4AA 2WBGA 4PMVA 3WMSA 4IM4A 3NDZA 5IHRA 1J0IA 3II1A 2WBKA 1KCKA 1B9ZA 1M53A 3IJ9A 3IJ7A 4K68A 4NZFA 1E0XA 4PTXA 3N9KA 1UD5A 3VD7A 1ZBVA 4C7FA 4V27A 1TUXA 1PAMA 4M8UA 4NI3A 3WY1A 3L2LA 5CG0A 1EQPA 5I78A 1M01A 3QHOA 2CESA 1XYZA 1JZ2A 1NARA 3VGEA 4AMCA 1B3WA 2F18A 1FP9A 4XUYA 2EQDA 1GCYA 1YHTA 3F5LA 3A4WA 4URIA 5KZ6A 1W2PA 3VM7A 4AD2A 2CBJA 3WNKA 3OIHA 3FN9A 2YOCA 3LPOA 1ODUA 3PZQA 2VUYA 1KFWA 2DH3A 1E56A 2PWHA 3MMUA 1UOKA 3TTYA 1WDSA 7TAAA 3WDPP 4R5EA 3NSNA 5DEZA 4GI6A 4W86A 4Z2IA 3CC1A 4JFWA 4J3TA 2CNCA 2JFEX 4A3YA 1VIWA 4DWSA 2WMJA 1D2KA 2PBOA 4MJ2A 1R75A 1D7FA 1J11A 3VIMA 3RM4A 3CLWA 1H5VA 4U33A 2J78A 3CZJA 1E6NA 3W82A 2FDMA 5I0DA 1KQZA 2O9OA 3GM8A 3ECQA 3VD5A 1UKTA 1ISWA 4ACZA 2YLLA 2YIHA 2FH8A 4HOXA 2CERA 1H49A 1QBBA 1TQUA 5AC4A 2PI6A 3AHYA 4WK9A 4UFIA 4DM2A 1CECA 4JCLA 1UZ4A 2YL5A 4RE4A 1MW2A 1GOKA 1UR4A 5M17A 2UY2A 3EDDA 1J10A 3KLKA 1UR1A 4HA3A 1P6WA 1OT1A 1XYFA 1CTNA 3SIMA 4JIEA 3TTSA 1ESWA 1VB9A 3F4VA 4LGXA 1GOIA 4UCFA 3GNOA 2F7PA 4D6FA 4TVDA 2BY3A 4DUVA 1HKKA 2XYLA 3WEOA 5A8MA 3KWXA 3GH7A 2BNJA 3U5UA 3CZ8A 4AWEA 2W67A 1OGGA 1QI0A 3QHMA 3GXMA 1E9LA 3CMGA 1JF5A 3DDFA 2WHLA 2OLHA 2GJRA 3D50A 4F66A 4MTVA 3WN6A 2F7RA 4YHEA 4AMWA 2E9MA 1RP8A 4W89A 3K8MA 2XWEA 3OLGA 4PMDA 4Q22A 2WVVB 5ECUA 1G5AA 3L4TA 1PS3A 3BMWA 1I75A 3VGGA 3CV5A 4W8AA 2VCCA 2XSBA 3ARWA 4TX8A 3PZNA 1PX3A 3VMPA 3SUWA 4OZOA 3MI6A 3ARPA 3NUKA 3VGFA 4NXSA 1ECEA 2V3DA 3BAXA 4RL3A 3EMZA 1TZ7A 1CXEA 3FY1A 1CYGA 1VJSA 4JL2A 3VSTA 1MYRA 4IUGA 1H11A 3W26A 4PRWA 2BXYA 3VIOA 1GOOA 2JE8A 4QP0A 2EADA 3PTKA 3CZKA 2AOSA 4BQ3A 3WUGA 1HT6A 5BXPA 3G6LA 1JG9A 1JZ8A 2J7CA 5CGTA 1E1FA 3DYPA 5HDRA 1NWTA 1ZBKA 3U7BA 1GQLA 1SZNA 3PZMA 2V5DA 3QGVA 1B30A 2FHFA 2GUYA 1A47A 2PB1A 3ARZA 2CHNA 2EACA 3ZQ9A 4GQQA 2GJPA 1R85A 1V3LA 3A21A 3A47A 1KWGA 3WIJA 1V03A 5M03A 1KTCA 2EO7A 5M3WA 3WH6A 4W5ZA 4JKMA 4CUCA 3AZTA 5ABFA 1JD7A 3WF3A 3GZAA 1B3XA 4NRSA 2XIBA 5A6BA 1KB3A 3WD0A 1ODZA 4HTYA 3ZJ8A 4UOQA 3GXNA 1ITCA 1R87A 3W38A 3OGRA 2WC7A 2ESCA 3WD1A 2XVLA 3WDIA 1TA3B 5D4YA 1QNSA 1CIUA 4J3UA 1VF8A 1KXQA 1MQRA 4WSKA 1PX4A 3TV8A 3WH8A 1BYAA 2W92A 2WMFA 2W4XA 3WNLA 4UOJA 2E9BA 4D71A 1H3GA 4MB3A 2J7HA 1HJUA 1Y7VA 3HZ3A 4FK9A 4GZJA 2QF8A 1UWRA 4GIAA 4HMDA 3NSMA 3S6TA 3D5HA 3ARQA 2VZTA 4GQRA 4OJYA 2EPMX 3LPFA 1HJQA 1HKJA 5AY7A 2Y24A 3AXXA 3MU7A 2XVNA 1J9YA 2YL9A 2UWFA 4GZIA 5A2AA 1OSEA 1V02E 3GXDA 3AISA 5FL1A 4W7VA 1CPUA 2DIJA 2WKLA 2E3ZA 4NRRA 5I3DA 4D6DA 4M1RA 2WHJA 4ZE5A 2BFGA 1HJSA 3SCOA 2WLZA 1UWQA 3L4VA 4NSBA 3L4ZA 3WH5A 5I24A 4HA4A 3PTQA 1GOMA 3RM8A 1UYQA 3VIPA 1JL8A 2FE0A 2J25A 3K1DA 3LRMA 4FNSA 3SCQA 1VENA 1EO7A 1J18A 2WM0A 1BVZA 3BVWA 3N18A 3PZVA 3VINA 2YLAA 2VMFA 3WY2A 4HOWA 2DEPA 1UD4A 1CXIA 2W91A 3QHNA 2J4GA 2XFYA 1R47A 1VFOA 4H8HA 3EMCA 4Z2HA 2ZXBA 2PWDA 5LA1A 1UHVA 1KBBA 3VGHA 3W6LA 3AIEA 4P8XA 1B2YA 3GDBA 5LA0A 1XH0A 3VIFA 1QHZA 1JYNA 3HG5A 1WKYA 1CGUA 3D4YA 3VMNA 1E6ZA 1W9PA 2WC3A 3BH4A 3BAKA 3VVGA 3VD9A 3GYCA 3T2OA 3POCA 1MQQA 1HJXA 3L4YA 1UR0A 4GZEA 1E5NA 1UA7A 2XSAA 2XFFA 2Z1SA 1FP8A 2DT0A 1D3CA 4XZWA 2EXOA 4QCFA 2WMIA 1HVQA 3L2MA 1V6XA 4TVUA 3T2QA 3DC0A 2QV4A 3EDJA 4UQCA 3VKKA 1G9HA 2E0PA 2G3IA 5A6BD 1VFFA 2VVNA 2X05A 3OBAA 2J47A 1M03A 2OSYA 4FLRA 4Y7EA 2X2IA 4F79A 4PN2A 1ZU8A 2CXGA 1CDGA 5E6ZA 1VFMA 4KRUA 3GNRA 4BCEA 4CCDA 3EDFA 8A3HA 5JBEA 4U3AA 5FOOA 1R86A 3AZRA 4AISA 2EPLX 5CPSA 3S5ZA 5C70A 1Q4NX 2VRQA 1E6QM 3B9AA 5E1QA 4L4OA 4OKDA 3M07A 1W3JA 3D3AA 3EJPA 1TA3A 2ZX6A 5GNZA 3BCDA 1ZJAA 2BHZA 1R8LA 2B31A 1V6WA 2CITA 4CU8A 3VM5A 3EJSA 3IANA 5D9MA 1AVAA 1E3ZA 3SCVA 3PZGA 5DF0A 3WUEA 4JHOA 1H0IA 3CZEA 2D0FA 3WD4A 4AY1A 5FL0A 3GTNA 3AIWA 3AMCA 2F1AA 3K4AA 3BUBA 2BXZA 2ZX7A 3CUIA 3WMBA 1VFUA 3PHAA 1QPKA 4RE2A 2BHUA 1B31A 1VAHA 3ZT6A 3ZJKA 2RGMA 3HG4A 1B3YA 3WDHA 5BRQA 6TAAA 3VO0A 2ZUSA 1VEPA 3CIVA 3N15A 3VIHA 3A3HA 5HBFA 1C91A 2VZOA 1EGZA 4LYRA 4U2ZA 4DO6A 1WP6A 2YA0A 1M04A 4HPHA 4A4AA 1XSIA 4CCCA 4QCEA 1HP5A 3WY4A 1OGSA 2GK1A 4J28A 4X0NA 1DWJM 2J7DA 4HPGA 4WKFA 3RILA 4HU8A 1V6UA 1WO2A 3IK2A 1CGYA 3GBEA 4CN4A 5I2UA 1HF6A 3MUIA 3G6MA 4D6HA 4ATWA 1NWRA 1ITXA 5E9AA 1EIBA 1V0KA 1JDDA 2GSJA 3SUTA 3SUUA 3VD4A 5CQ1A 3DX0A 3VIJA 3KZSA 1KXTA 2ZUMA 3PN8A 4JHZA 1K9FA 3BC9A 1JDAA 1RP9A 2Q8XA 3VTRA 2D22A 3ZR5A 1MXDA 3W29A 5D8ZA 1E72M 1W1TA 1ISYA 1R34A 3N11A 4GI8A 2JIWA 2F7OA 2WMKA 2O92A 2WPGA 5I77A 1SMAA 1BSIA 1Z32X 1J12A 3DECA 1GQIA 1C7SA 3ZOAA 2WNWA 4FNPA 2D23A 3RDKA 1W3LA 3WDRA 1B0IA 1BG4A 2IXVA 4NF7A 3N13A 3BVUA 4W88A 2X8RA 2DDXA 2CHOA 4Z2LA 3UEQA 3FAXA 2QPSA 3QOKA 2XUCA 2WCAA 1TG7A 2A3BA 7A3HA 2GJXA 4E8DA 1WCGA 1X6LA 5EFDA 2VI0A 4HA1A 5A8QA 4N0RA 4D6IA 3W4RA 1V6YA 2YDSA 5M5DA 4M82A 4ZFMA 1WDQA 3WNNA 4CGTA 1V3HA 4QDMA 5AYBA 1GUVA 3U7VA 5ABFB 4FNRA 1Q6FA 3H54A 3CHCA 4PCSA 4PMXA 4E8CA 2XVKA 3ARTA 1QNOA 3BLPX 4CN6A 3TTQA 1TCMA 4DO5A 3VSUA 2CKRA 3MV01 3VMOA 2WCSA 4AYSA 4UFLA 1H2JA 1UASA 4CKQA 1C3FA 1WE5A 4R27A 1FOBA 2YDQA 3OGVA 1FFRA 3HJEA 1AQHA 1NP0A 2G3JA 2CBIA 3S2CA 1DWFM 4CD6A 5JIWA 2VJXA 4AIUA 4QLJA 3DX4A 4AYGA 3LPGA 2CBVA 1GQJA 1EO5A 4BA0A 3NYDA 4AXNA 4TX6A 1BLIA 3BUIA 2D0GA 3AQUA 1UQZA 3MUAA 1OD8A 2ZUWA 3SCWA 1E55A 3EDKA 1UWTA 2VTFA 1UQYA 3AIRA 3T2PA 4W5UA 3VILA 3WF1A 5HOSA 3TA9A 3PTMA 3WF4A 3AXHA 4WJXA 4LXFA 3SCNA 1R33A 4LQ1A 2GDUA 4F9JA 3BUPA 1UH2A 2YBUA 1QNRA 2E8ZA 1JZ6A 2ZXDA 1OGBA 4CD8A 3N12A 3WQ8A 2EPOA 4U31A 2PWGA 4D6CA 2BY1A 4MNKA 3WUBA 1V3IA 2V38A 1F4AA 1W3HA 2XVPA 1ISZA 3TONA 4JFSA 2OSWA 2VR5A 4C7GA 1PIFA 3SUVA 2YJQA 4CD7A 3AS0A 2WANA 2DT1A 4W7WA 3KLLA 1PJ9A 1UD3A 4FF5A 2D3LA 3NDYA 1IZJA 9CGTA 1CLXA 2XWDA 3KL3A 1TMQA 1WZAA 5E6YA 2YDRA 4BQ4A 3EJUA 1BYCA 3CBWA 5GQBA 4B3LA 1WDPA 1UWUA 3AZSA 4A3HA 3CHFA 1QWNA 4QFUA 2WVUA 1W9BM 1LG1A 3W81A 1PBGA 5A8NA 1K9TA 5DO8A 3CZNA 1CNVA 4UR9A 3T0DA 1L8NA 3CZSA 5CSYA 5JBDA 1JAEA 2W63A 3OLEA 3M6DA 3RCNA 1HX0A 3VGBA 2NSXA 1O6IA 3DX3A 1KR1A 3AIVA 2J75A 3E1F1 1OWQA 5IHSA 3IJ8A 1W91A 3ZO9A 5KEZA 2C8NA 1KCLA 1GVYA 2VRJA 4LYQA 1EA9C 4RE3A 4AZCB 1UR9A 2VC9A 1MW1A 1XSJA 1HP4A 2WK2A 2WMIB 3AMDA 2GDVA 4UFMA 2XM1A 3MUY1 3SCPA 1JZ7A 1GJWA 1JAKA 2DH2A 1R46A 4H8VA 4AD3A 1XC6A 3CTTA 2YA1A 4M29A 3BGAA 3RO8A 3L4XA 2A3HA 1UKQA 3MV11 3MSDA 2X2HA 3TTOA 4PTMA 3FHQA 2XTKA 2CPUA 1B90A 3ZM8A 4LX4A 3ZIZA 3KE0A 4HMEA 3ZMRA 1MFUA 1HTYA 1NP2A 5A6MA 3WKZA 1QBAA 3A22A 1HJWA 4AW7A 2BVDA 1LQ0A 2JIEA 4D6EA 2HISA 3W25A 1GORA 3W37A 3BLBA 3GH4A 1OIFA 3UR8A 2E9LA 3NJ3A 4XZBA 3PZ9A 3VUPA 1CGXA 2E40A 1NOUA 3FHAA 4MAVA 4PUEA 4ATDA 4M24A 3VDAA 3BUQA 2FGZA 3OG2A 3WQ6A 3NSXA 5EB8A 3CHDA 1KGWA 2ZX8A 1S46A 4AEEA 2XVGA 2C0HA 2BVTA 3AFBA 3K8LA 3VGDA 2DSVA 2OWCA 3AJ7A 1UKPA 4DM1A 1LL4A 5AC5A 1IZKA 2Y8KA 3WF0A 1B3VA 1BHGA 3AMLA 4Z2JA 1ZBWA 1VRXA 4WLCA 2WLYA 4FLQA 1W32A 5A6LA 4OUEA 4U2YA 3AIUA 1M7XA 1ZB5A 2QMKA 3BVTA 2OWWA 1UH4A 2GK1B 5HPOA 3DHUA 2ALWA 3L4WA 4NZCA 4XV0A 3WBEA 2WKGA 5FKYA 5BXSA 2D1ZA 1GW1A 1XD1A 1GOWA 3OLIA 2BHYA 2F7QA 4EE9A 2EJ1A 5DFAA 2O9PA 3HG3A 2VZUA 1H4PA 3DX1A 1E4MM 1UD6A 3BMVA 4IPLA 4HZ8A 1LWHA 2IUZA 4MNJA 7CGTA 4FNUA 5CZKA 3O9NA 1HN1A 1L0PA 1C92A 5A94A 5FCZA 3A24A 4UQEA 2MANA 3GNPA 4W87A 5TD4A 3OZOA 5E70A 3UG3A 2XGBA 3WL1A 1J0KA 3B8SA 1N82A 1QHPA 4MAZA 1BYBA 1KTBA 5D9OA 3A6OA 1XH1A 4W85A 4CU6A 1EDQA 2ZICA 1KXHA 1OINA 1YQ2A 4PSPA 4YN5A 1T0OA 3ALGA 2PF0A 4AZIA 2X0YA 1CENA 2RGLA 3VU2A 1H41A 3ARXA 4W8BA 3ARUA 1PZ3A 3GH5A 2UY4A 2ZUVA 3WBAA 4AZCA 2J8GA 2X2YA 4QLKA 2GJXB 1PX8A 4P7NA 2DQXA 1QI2A 1CBGA 4AMXA 2PC8A 5DT7A 5D9NA 3W0KA 2XPKA 4AZBA 1RD6A 1ZJBA 1FA2A 4J3SA 1HJVA 3APGA 3DYOA 5BWFA 1W1VA 4P7OA 2WZHA 4AD0A 5CSUA 5HPCA 4IISA 4DUXA 4ACYA 1JZ3A 2ZUUA 2ZUNA 5LYRA 1BGAA 1GHSA 1E4LA 1LG2A 2X2JA 4JFTA 2PBGA 3EJRA 5EMYA 1V0MA 2VZSA 3HU7A 1GONA 5HXMA 3SCTA 4PMOA 3QR3A 2TAAA 4MB4A 1CXKA 4D72A 3VIIA 2XN1A 4ATLA 1AQ0A 4MNMA 1GPFA 3W6MA 1EOMA 2DSZA 4P7QA 5IFTA 4BF7A 4JFVA 1RH9A 1H0GA 3O6AA 1XRVA 3UETA 2Z1KA 5GNYA 2VCAA 4PMRA 3CGTA 3N17A 5JBFA 1QVBA 4HZ7A 5AYIA 3DDGA 3F5JA 4W93A 1NWUA 3WNOA 1HKMA 2JEQA 4NZJA 4D6JA 1C8QA 2V3GA 1NQ6A 1E6SM 1LF1A 2D2OA 1NH6A 3SCRA 1TQWA 1XCWA 4D1JA 3OZPA 4IPNB 3KEHA 3ZT5A 1KWKA 1AMYA 2GVYA 2V3EA 1MXGA 3B9DA 1TVPA 2UY5A 1BQCA 3MS8A 2OYKA 3IGUA 4GI9A 2FHBA 3NIYA 4CVWA 1VJZA 1IV8A 4OBSA 4FNTA 2WW5A 1BTCA 4BQ2A 3LMYA 4AZGA 4U5IA 4PTVA 8CGTA 3MMWA 2IGTA 2WHKA 4PBGA 5F7UA 5A8PA 3ARVA 2NT1A 2O9TA 2WHMA 3VDBA 1PEZA 1A3HA 1UH3A 2ZXQA 3LXBA 3CO4A 2QMJA 4H04A 3EJTA 1HWWA 2G3MA 1CEOA 4AD4A 3AI0A 4TXEA 3SCUA 1JIBA 4PMZA 3VDHA 2FH6A 3AS1A 4ZENA 2CYGA 3AS2A 5CPQA 3EMQA 3HN3A 1UKSA 2DSUA 4WSJA 3DYMA 3W28A 4PMNA 2XJ7A 2DIEA 4MDOA 3U57A 1EQCA 3MSGA 3WQVA 1PZ2A 3OB8A 4FLOA 4ZXOA 2PWEA 1TE1A 1G0CA 5I5RA 4ZEPA 2V5CA 4DUWA 4CN1A 1OB0A 1JFHA 3AYRA 1DHKA 1TQVA 1BAGA 2X0HA 3JUGA 1X6NA 2VX4A 2WVSA 2J77A 3CH9A 2WWDA 5BROA 2OSXA 1NWSA 1W9UA 3VPLA 1E0WA 3EDEA 1JNEA 2VX6A 1O7AA 3WEZA 1HNYA 1V08A 5JUVA 1W2VA 2A3AA 2W61A 3D4ZA 5LA2A 3VSVA 2XG9A 3NCOA 2D0HA 3BAJA 1DWIM 1SMDA 2DSWA 2OWXA 4HMCA 1TQSA 4EANA 4EAMA 1CXLA 3D52A 3AXIA 1U33A 4ZXLA 3PBGA 5BXTA 3UR7A 4EKJA 1U30A 3BAYA 3PZIA 1VBUA 5CLTA 3MKKA 4B9YA 3AIQA 3AHXA 4WKHA 4UFKA 1OT2A 2YL8A 3WL0A 4M56A 2WMHA 4UQDA 3SCSA 3GXIA 4KRTA 1C90A 2VO5A 3UERA 2Y8VA 1VEOA 1WZLA 1GOQA 2VRKA 4EK7A 3D51A 3LRKA 1HIZA 1WB0A 3ZR6A 2YFOA 1E15A 1V6VA 4F9DA 4S3JA 4AZHA 1W9XA 4JKKA 2EEXA 1XHGA 2VOTA 3WMCA 2OYLA 4BZYA 3UESA 1QWUA 3VD3A 1QNQA 1U2YA 5D9PA 4DO4A 3VX0A 3THCA 4MB1A 3LXAA 3ZSSA 2D73A 1J0ZA 4CVUA 5A6SA 1W1YA 1UWSA 3T0BA 4X9YA 2QPUA 1GJUA 1EHNA 4UZUA 1R7AA 3RM9A 5EFFA 4P7RA 2NW0A 2YA2A 3VNZA 3CUFA 3BVXA 1LLOA 3THDA 4LPCA 4C7DA 2QHAA 3N1AA 2CBUA 3BAWA 2DT3A 1V3KA 2O9RA 2ZWZA 1I1WA 5E0CA 5CLWA 4V2XA 4UFJA 4UOZA 1OBAA 2WMGA 2VURA 4V28A 2OW7A 2Y4SA 1MW3A 1SR0A 2W5FA 5BCAA 1DWHM 4AZ6A 1X1NA 1K6AA 1HL9A 2EBNA 3WF2A 4HOZA 4XB3A 3WNPA 2OYMA 2ZOXA 1JNDA 2VT0A 1ISXA 4UQBA 4AD5A 2J79A 4FNQA 3K4DA 1KGUA 2D24A 2D3NA 1TFVA 3T09A 1SYTA 3H53A 3ARYA 4MDPA 2X09A 1JYXA 2EABA 3A5VA 4UFHA 1H1NA 2VVSA 1E4NA 4D1IA 1J0JA 2WYSA 3GXPA 2F2HA 1J0YA 3GXTA 1V02A 4XX6A 3BSGA 3LPPA 2VNCA 4PMYA 4CU7A 2QLYA 1JI2A 3I3BA 4KMQA 1DTUA 1DP0A 2A3CA 3ARRA 1EDGA 1LWJA 1RPKA 1KQYA 3WD2A 4GKLA 1BVNP 5C8BB 4CD4A 4GO9A 4H41A 1QI5A 3WENA 4KWUA 1J0HA 1V3MA 4QAWA 3N04A 2JF7A 1DWGM 1EXPA 4Z2KA 4WF7A 2WZIA 4GINA 1XCXA 1O7DC 2DGAA 3AIBA 2WSKA 4PEEA 1GZJA 5IFPA 3CPUA 1EHAA 3GXFA 4OBRA 1QW9A 3MO4A 3AHTA 2DPEA 4KGLA 3ZT7A 2ZWYA 2CEQA 4UNIA 3BLKA 3M46A 3FNDA 1V0LA 2G3NA 2PWFA 3H55A 1V0NA 3RJYA 4MPKA 2F61A 2VR4A 1F4HA 2J8FA 3O2LA 5I6SA 1K9EA 2ZXAA 4U3CA 2Y5EA 1CWYA 4PMQA 1W9VA 2BS9A 4J3VA 1QI4A 3MANA 4U5KA 3OLDA 4H2CA 3AS3A 1QI3A 3ZJ6A 4JZ5A 4E2OA 4W84A 1JYVA 1UR8A 1FFQA 4P7LA 3RJXA 4H8UA 1JYWA 1ZL1A 1JF6A 2A3EA 4QLLA 3VIGA 4AD1A 4HU0A 2VQUA 4BS0A 3VIKA 1PPIA 3WD3A
chains in the Genus database with same CATH superfamily
3EKZA 3SDDC 1UZ6F 2P76A 1GHFH 4Z08A 2EYRA 1A7OL 5D7HA 4UZGA 3UZQA 4NP9A 4Y8FA 3KL5A 4WHBA 2CKSA 2AQTA 1KPRA 2HPIA 3ASWA 4RNHA 2GBUA 4P5KB 4WO4A 4RMSA 2DP3A 1KO0A 3WJLC 3NSCA 3MI2A 4EOWH 4HZ6A 3BP7A 1L5GA 4Q58C 1G7QA 3TTEA 4NPKA 4MJJA 1IFHL 1DVTA 3EJQA 1FVEA 1E5JA 2DKSA 5GJTH 3RTQA 2EIEA 3OGSA 4JHUA 3S37H 2ZUQB 1G5GA 1OD7A 2VGIA 2Y06L 1I2PA 4E9LA 4PJEF 4ZFFB 3ITOA 5E6IB 1MCSA 3CX5K 4OU3A 1W8EA 3ZTJG 4AEFA 3SE8L 5MERA 3QISA 1ZA3A 4RZKA 5GNXA 3QEQD 3UXKA 2UZIH 1WHOA 2KC0A 2YAQA 2WBJB 1A6ZA 2XIIA 3O8AA 4EPDC 3FSTA 4LH8A 3B3IA 5A6KA 3UJSA 1XIWD 5DD3H 4O02A 4LBAA 3O4OC 2CBMA 2LT9A 5I1GH 4PMEA 4OCRL 1YLBB 3CHEA 1I1AC 4X0VA 1G1KA 3ARDD 1RULL 2J7FA 1N0LA 5SWZB 4ZMLA 2EH7L 2UY3A 1CLKA 3C2EA 2P10A 1ZV2A 4YHLL 4UTFA 2C13A 4F80A 1B3ZA 5CN3A 5E4IA 2YKKA 4LLYB 3OZKA 2NY0B 4U3SA 1OAYL 3TR2A 3PY9A 5AQ0A 2WPBA 4GXVH 1JF1A 2F8QA 3S83A 3MLRL 2OMVB 2O61A 1OX4A 1G6RH 1NGQL 3FO1A 2P5ED 4YBQD 5BXRA 2CRMA 2CU9A 2YYTA 4P05A 5D5MB 1W8GA 2W66A 3FS9A 4DWSB 3FIGA 3NOIA 3FRPG 5TGBA 1DBTA 5HDBF 1V7ML 3MRHA 3AYTA 2RAMA 3KG5A 5LJYH 3C8NA 4JIQA 4AY7A 4D0CA 5IMLA 2EPNA 4LLUB 3H23A 5FYKD 3PZTA 5E93A 1KB5L 3QE5A 1NCAL 2XXFA 4FQIH 1F3RB 5ECGA 1TR9A 3UW6A 1KDIA 1JWSB 1UR2A 1GY1A 3LNGA 2H1LM 4CD5A 4NXKA 2HX7A 3MCKA 1AH4A 4S3KA 3RHWF 4EOWL 4YJ5A 3M44A 2DJUA 1TZHA 1C7TA 4J7RA 2CZNA 2C7FA 1QRKA 4WEUD 3E6HB 1BVKB 3V4BA 3PP4H 5HGDA 2EPKX 4O2FA 3I7SA 4BQ5A 5GJTL 4D9QD 4JGUA 2IOIA 3PFRA 3S37L 1BZ8A 2NT0A 1H09A 3C2VA 4HIHA 5EUOE 1QWGA 5D7LA 1KV7A 5KS9A 3MREA 5EIIA 3HBPA 4NQ1A 4MQTB 2XSKA 3BVDB 1GZHA 3F03K 3D30A 4GC4A 2VEMA 5IEKA 4HCDA 1MPAH 4KV5F 2RJHA 1CE6B 3H6JA 1E9OA 1WBXA 3TFBA 1Q6QA 2ZKWA 1BCIA 3KD4A 2BNRD 1ZA6A 4ZUWB 1DOSA 1XYZA 4OQVA 4PJGA 2UZIL 5E8EA 1YAZA 3W74A 2OULB 1U3HB 5LGJB 1JCXA 1RXLA 2G5UA 1GCYA 2ATSA 2E47A 4DBWA 4DQAA 3OIHA 1NA8A 4MVBD 2V5SA 4ENEC 1I7RB 1GKOA 3OGCB 2CLZA 5K93A 3KR3H 5DD3L 4XHQA 1H5YA 3PQYA 2WMJA 1KCZA 2GUOA 4Y4HD 3VI4F 1H5VA 4N1CA 5XIMA 2C3XA 1OVZA 5CP3A 5KSAA 3VD5A 1EVUA 2YLLA 4WJEA 3B0PA 4DM2A 4M4PA 4A3RA 2UZXA 3WQPA 3ULVH 4L4MA 3APNA 2V8LA 3RGVA 1KXVC 4O51A 3OF6D 5SWSE 5CD5D 5AAWC 4F3FA 4L8DB 1JXFA 2YCJA 1WFUA 4MCZA 4B5VA 1ZPUA 1HKKA 1ASPA 4TNVF 5HYJA 5D05A 2YMOA 2ZOWA 3UZVB 1KBGH 2HVKA 4OZGE 3LHYA 1G6RL 3Q8AA 4JCWA 1XQ4A 5EUKB 5A2LH 3VOIA 2AAVA 4ASTA 2BSRB 2N1TE 1IT9H 1TWSA 1HHHA 4QT5A 2D7MA 2Q3OA 3BGMA 3P74A 2FFCA 1NEUA 3IDJB 1VRSA 1OGTB 1PX3A 1QR1A 2NQJA 3ARPA 1JGMA 3BKYH 2KERA 1J6PA 2V7NB 3V5DB 5D1ZD 3FY1A 4Y9FA 1DJQA 1TIUA 3GKZA 4X4KA 2HA1A 4I7UA 4FFYH 2JFCA 1JG9A 4HU3A 1T5XB 2WKOF 3L8QA 3QPZA 3DRTA 4OCXL 2PO6B 2PUQT 5G4MA 1B30A 3P62A 2CHDA 5AYZA 2GI0A 5CIPA 2OEKA 3OAYK 4O5LL 5FEWA 3L3IA 2PP1A 4Y9AA 1IC4H 4GSDH 3A47A 5MEND 3WIJA 4P5TD 1U8QB 1K2DB 3ZPDA 3ZLHA 2TSBA 4YMPA 5IK3A 4KKPA 4XBPB 3VFNA 2APXA 4W9GC 4RGND 4EBQH 3HGSA 3PP4L 2IGFH 2CLHA 2EDFA 3DMMA 1R87A 4EUPA 5CSZB 4Y9GA 2ZCLH 3SE4C 4H2HA 3BISA 4I87A 1MNUL 2F9RA 3VXUA 3O6FD 2YPVA 3GWQA 5E1IA 4ZO9A 4MAYA 1MJ8L 2G50A 1RCXB 3CUPA 1UWRA 4U05A 3V0WH 3FO0H 3LPFA 2GSHA 2Q7YB 1OZUA 1SQ2N 3IXTA 5BJTA 3SQRA 3S1UA 5FL1A 3KHDA 2WKLA 1FL6A 3TBWA 2HS6A 2A3TA 1KJMB 4W9IC 5D2LA 4YDLB 3HPLA 1Q5MA 2FE0A 3LRMA 4K15A 3TT3H 1EF2A 1J18A 4K2UL 1OF2A 4G3YH 3R8GA 3PZVA 4JIHA 2JTDA 3O3EB 1W72A 3QHNA 3KR3L 3U6XA 2V6HA 4DH2A 4Y1AB 2E6JA 5INCA 3ITVA 1H9VA 5I1LA 2A9ML 4GH3A 5CEXB 1XMEB 3P2VA 4K3DH 5JW5B 3ULUL 5IVZA 5FECA 2X41A 3L1EA 3GR4A 3CXFA 2YKLH 4XN2A 1KBWA 5EOTB 3W11D 3L4YA 4PJ5B 1DJSA 4GZEA 3FVDA 3UYCA 3T81A 2XFFA 1SN2A 3PWIA 2Z2UA 4MD0A 2OGYA 4YDJB 4XI5C 3PUOA 4E3VA 4XNMA 4NKQB 2G3IA 4JIIX 3STEA 5A6BD 3DG3A 3VD0A 1KBGL 3TL5A 1S2TA 1GG1A 2VC5A 4CVXA 2VDHA 1EAJA 4JNYA 1BFTA 1XX1A 2JQAA 2ZSWB 4HBQA 4FABL 1W3NA 1A65A 5DRCA 8A3HA 4J1OA 4HIIB 1KRMA 2C0AA 1Z5YD 1GYAA 4OKDA 3HE6B 3NCJH 3DDMA 3D3AA 3EJPA 3PULA 2BXVA 3BKYL 4PVLA 1RCYA 2YCLA 3EJSA 1Q6OA 1PEWA 1PZUB 2YCKX 4KFPA 3QC5X 4EIVA 3UBGA 4XZIA 4FFYL 4XZNX 2NY5H 1G6VK 2E4FA 3MJ8B 1ZS8A 2AEQL 2MRYA 4QO1B 4ZSTA 3HG4A 3BP4B 3H2PA 1SZEA 2HMIC 4IBQA 3RWCB 1XB3A 2EH8H 1INDH 2QUTA 4AITA 4DO6A 2VZ3A 3EOAA 1BBDH 4GSDL 5DZPA 4QHLB 4KJPC 4NUGH 1MNSA 5JORB 2ITCB 3ULVC 2XQYK 4JY8A 4OTXL 3PJSA 2QV5A 5LHEA 1HF6A 4XD3A 4UT9H 5KYUB 2FJKA 4P9MH 2X10A 4H25A 4X5RA 1GOHA 2IGFL 3CDZB 1G4RA 2VXTL 3VD4A 3LZ3A 3RL2A 1CW2A 4WEVX 2ZCLL 2PTWA 3ZR5A 1N8ZB 1A6TA 5GZNA 4IRZH 3FU7B 4YQXH 1H7XA 3DVNB 4XB8A 2WMKA 3PFMA 5HYQB 3FO0L 5IHZA 1GQIA 4YZFF 3UTTE 3WDRA 1KEML 3ZKMC 4NQXB 1G4MA 4WJ5A 3QOKA 3HB3C 1GQNA 7A3HA 4RDQG 1MJJA 7XIMA 1X6LA 3V5KB 4L4TA 3QFJD 3TT3L 1IEAA 2CGRH 5CZTA 4G3YL 4IHOB 5C7XH 2JCCE 3VXOB 3PSWA 1XGTA 4ZMGA 3U6RB 3RUBL 3VKJA 2P7TA 1IO4C 4E8CA 3ARTA 1OEPA 4ZX5A 4DVRH 4WJ8A 4AYSA 4UFLA 3SE3C 5HI3C 5L8LB 4PB9H 1ZVHA 4K3DL 4DYJA 1YEYA 3EW3B 1BQKA 2F68X 2JMRA 2YKLL 2VLJE 1DZ0A 3KVLA 3QJSB 3O3BA 4BA0A 1BLIA 1M1SA 2QBWA 4GKZA 2ZZ1A 2Q9OA 1DSWA 4I7VA 3AU2A 5DD0H 1KTLB 4BHUA 2WXJA 2O5ZL 4D9RD 2C9XA 3BT0A 2J5LB 3BUPA 2YBUA 1TZGL 1QNRA 4GKSB 3LQGA 3HPAA 1I9RH 3QWNA 4ZMPA 3S97C 4PR5A 5HWMA 3EIFA 1AOZA 1COBA 3TZFA 4Z78B 3WK1A 1SF5A 2V8ZA 4QOKA 2F6XA 4FQCH 2VERN 2Y6SD 3QJFB 3F85A 5FM5O 1PKOA 4JRLA 3D85A 2J8UB 3ICJA 1FUNA 1BYCA 3KAOA 2R29H 4U1GC 4EIZC 3AZSA 4HC1A 2WGNB 4IBVA 4GGBA 2H2SD 2HROA 1RZPA 1E4KA 3HRZC 4Q4RA 5EDSA 2CR3A 4NJKA 4TSAH 1B4EA 3VGBA 2C4XA 5F71A 5J11C 1XAUA 2J75A 4J3OH 1L9NA 3ML8A 3AACA 3HI5H 1IE4A 2C1HA 3K6FA 2VRJA 2BZDA 3STZB 1P0SE 3CK5A 4KFZC 4YTRA 2CR0A 3KPOA 1BBDL 4I5RA 1GJWA 4NUGL 1UOZA 3OWRA 3V7AG 1MRCH 3RO8A 4DJFD 4NJAH 3CH1B 2RB8A 1M5WA 4M93B 3TTOA 3ARFC 4P9ML 4KKLC 4UTCA 32C2A 2QUNA 1UOVA 4HH9A 4IBYA 4UB9A 1BJ1J 4XB7A 3VCCA 1A25A 4G8EA 5AD0A 1I9IH 3MSRA 3BLBA 4YQXL 4NENA 4XN8A 3O8XB 2WXKA 3XISA 1AKJB 4IH3A 3KDOA 1J4EA 5J6GB 3VD2A 1WWWX 2F53A 1KYUA 3T04D 3OG2A 3KXFE 4IRJB 2CO7A 5IY5B 1MI5E 2BVTA 3V6FA 4Q6JA 4OLWL 2ADFL 2VMCA 4WI5A 4F7MB 2J88A 4N8PA 1LO2H 4NNAA 4CADA 5K3VA 3BVNB 2ED9A 4NO2A 3I02B 4JPKL 2NX1A 3UA4A 2OS7A 1MNZA 2NY5C 4L9XA 5BXSA 4QNWA 2VJ8A 2NSQA 2O4QA 4EE9A 2PPAA 2J6XA 2X44D 4F2MB 3SY6A 2YZ1A 4UM8B 4DVRL 5CZKA 3W86A 43C9B 3V0IA 5AW8B 1R3YA 2BP3A 5IMKA 4G2AA 5AAMA 3WL1A 3Q1EA 1NMBH 2A9NH 3DRQA 1QRQA 1ONEA 1UOLA 1NL0H 4JY9A 4UDTB 3E0FA 1R5IA 4PLOB 1EXGA 1XB6A 1DVUA 4PSPA 4YN5A 4HKZB 4YO0A 4R0LC 4ZW7A 4WEBH 3Q58A 1CENA 4AQZA 3X13B 1FSKC 5FSEC 3VH8B 3W9ZA 3GSVB 1AGCB 4OECA 1DSYA 1FHVA 4XGZA 2FWLB 1JWMB 5CR8A 3QIWA 2J8GA 3QWOA 1HCVA 5AOZA 4WHTA 5D9NA 3V6OA 3O6CA 4EIBA 4P3DB 2PDYA 5CZ0A 3WN5A 3U2SB 4FQCL 4FADA 5DFVC 1N10A 2H6PB 4P5SA 2PBGA 1HAWA 3R0UA 2GUBA 2B14A 4RR4A 5JPMC 3VWJD 3SOBL 5HHOA 1JXGA 3PV6B 4XAPA 4D72A 3F2CA 1CFMA 4ATLA 2XZCH 4JFVA 1X7IA 3L3KB 3I6RA 3DX8A 4ZNEA 1DBBL 1EK3A 5ITBL 4D0DA 3F5JA 3FTGB 3L7EB 3S5LG 1WT5C 3HI5L 1B0GA 1SUXA 3F7LA 2INEA 2GVYA 1A3XA 3B9DA 4OCLC 3H3PH 5KANI 3DAQA 2J57A 1QG3A 2WW5A 3QO1A 4TVPD 2CLMA 1J88A 1A5NC 1CVRA 4NJAL 1HEZA 2FEDC 3G1SA 1WXZA 1Z0NA 2R15A 3TZVD 4AD4A 1IKFL 5L7XL 1IXOA 2WZPD 3W1AA 1I9IL 5H2BB 3QJAA 1OCCB 2B9BA 2YPLA 5LSMA 2M2DA 1SLWA 3QQWA 4JTQA 4FLOA 2NQHA 2R2EA 5CLXA 5EF3A 3OZ9L 1X6NA 4D9PA 4K7VA 2NUXA 2PP0A 3JZUA 4XOBA 4KZ0A 3HN8A 4L3AA 4H4IA 1XPYA 5ENLA 3CFKA 3EJYC 3C5JA 2PURA 3WO8A 3JR2A 1FDZA 3D52A 3D4CA 1QUNA 1HKVA 4J3OC 4MNHB 2P80D 4OD3L 3ISIX 1NBCA 2EIMB 3FU3A 3LN9A 4Y19B 1EXBA 1FAIH 2Y8VA 1WZLA 3QUXB 1EAPB 3Q9QA 2O93L 4UDUA 3QDME 3HAEB 2OYLA 3SGEH 5AYTA 1NMBL 2A9NL 3VD3A 1U2YA 1LEGA 3NFNB 3THCA 2MNJB 4NKIH 4PCYA 1TREA 2CHRA 3GRWH 3SD2A 1S5NA 4G5ZL 3MJ7B 1OO2A 1R3JA 5K9JH 1CL7L 1R7AA 4OF7A 3Q6GL 2HDJA 1MCIA 1FWFC 3I68A 4BEQA 3SSZA 5HR6A 1LUCA 4XZ9A 2UV3A 2ZF9A 2DZEA 5KJRH 5EH1A 3T1GA 1X1NA 1MAKA 2BRQA 4JKWA 4O0KA 1AR1B 2Z1BA 2EKSA 3U1SH 5L2JB 2J56A 4AD5A 4XVSL 5KYYB 2VDQB 4NZUH 4XN4A 1W5PA 2QADD 1WBZB 3N41B 4LZKA 4PJ8A 3WUWB 1SHSA 1G0XA 4L3CB 3DIFA 2W07A 2IAAC 2VEGA 3FSOA 1A1OA 1X9QA 5JZ7C 3TH4T 4ZS6D 2DQTH 3QULB 1I3VA 1A0QL 2EE0A 2BX5A 4KDTC 4D2JA 1KFAH 3EGXA 5IM7A 3SW6A 4F5CE 3IT8D 5DJ8A 3ZKNC 3QORB 1AODA 2BWDA 4LKXA 3H3PL 4E38A 3V0HA 5I09A 1HWGB 5FEXA 1TZ9A 4LUSA 3QHZH 4Q8PA 3LSOA 4GQ9H 5H8UA 3V0DA 5D71H 3GQFA 3GMLA 4IIHA 2BVPA 2G5BA 3NL3A 1O5PA 5C0ND 2PDUA 1OOAA 2F74A 3ALXA 4XO6A 4ZO6A 3VW3H 1TUFA 1G9EA 1ZLDA 3GKWH 3K72B 1HFBA 1JCMP 4JR5A 1M65A 1Q6CA 2NXZC 2I60H 4M7LT 5AYUH 3WFZA 3QQ3B 1V3JA 3KJ4C 2VN4A 2PGWA 1RCQA 2FYVA 3STGA 2DQJL 1JVKA 3V4PH 3HC2A 3SUSA 4HHHA 2QTEA 5JIPA 4P8WA 4PJ9D 1C8XA 4IMEA 1ZGLP 3WKNA 4CVZB 1K5NA 3O6DA 4RMUA 5EO0B 4O4WA 3NIFF 2Q10A 2QGHA 1FZOA 1VCGA 2BY0A 3NA9L 3S37X 4F37K 3MGTA 4HTBA 3B56A 5JIIA 3NDYE 4FOJA 4UQAA 3ULVE 1N59B 2IF7A 3B2DC 1G94A 1QSEB 2W9LA 1T5WB 5FO7B 4KKRA 1UWIA 2VC7A 4X7TB 1T0MB 1LK2A 3QZ6A 3Q44A 5I17A 1KCXA 1NFAA 3KL0A 2IDQA 3VX1A 1AOHA 4QITA 3VYLA 3WFEH 4NKIL 2DU2A 4XO3A 3GRWL 1GNXA 4WFHE 1PZAA 3Q7JA 2VLKE 3FUIA 3U2ZA 3APDA 5K9JL 2XWJB 1OF6A 3LEYH 3D2UB 4YUEH 2HJFB 1S3TC 4LOFA 5LBGA 2OPJA 1E6XM 2V0TA 3D3VB 1QHOA 4I9WD 1UB6A 1H8NA 2Y9RT 2G37A 1Q66A 5G4EA 4GVHA 4ZUUB 4PJFF 5KJRL 3US1A 4OI7A 3B9KA 3KPSA 2VITA 4MXVE 3SRHA 1TKWB 5E09A 1LRTA 1TXKA 4HJSA 4NZUL 3TN4A 2WCGA 4FKKA 4AVOA 4K5LA 2G0WA 1TQCB 3LXCA 3R43A 3P73A 1CGSH 3IMTA 4ODXA 4XAYA 5DVPA 4NLHA 5C9JA 2X42A 1K70A 1BFOA 4NHUA 1SFSA 1TU2A 4MQSB 3KBSA 5IIEB 1C29A 4H88L 2AERT 4KUCF 2E27H 4GQ9L 3K74B 4NUWA 4GFTB 3E38A 5CJQH 3J07A 3UCRA 5D71L 1PIGA 1FWGC 2E6FA 1JK9B 5G2IA 4CILA 4OFVA 3ZSTA 3LQZA 3TVMA 3UG5A 1XLCA 4L4PA 3SDXE 5F9DC 2JF6A 3HMXH 3H2QA 1UP2A 2CIPA 4GSXA 2I7GA 3HCVB 3GSNA 3R25A 4C6LA 3MWCA 3WQOA 4MZ3A 4OZ4B 4ELME 3GKWL 1NTHA 4LCCB 3U9WA 4I9JA 3STPA 2QELA 2Z4GA 2VISA 2I60L 3DHPA 3W9EB 3WNMA 3FEQA 1WTLA 3L54A 3DHJA 2OQJB 4UYQA 4PRIA 5EOCJ 1XPGA 3T0ED 3CMJA 4C60A 4Z3IA 5DJXB 1GXEA 2YQ3A 3LKSA 4ESKA 2AC0A 1ZT7A 4RAUA 4OFPA 4BYHA 3M9YA 1DJYA 1FFOB 1DJNA 1QATA 2AQSA 1L2QA 4UINL 1IFGA 3DX2A 1KFLA 1XIWC 2X4RB 3K13A 4L4LA 2OX5A 1JULA 3CB3A 4OLYL 5BZDB 5D4JA 4P2QB 5E5MB 2F54B 3NN8A 4HBCL 1W0WB 3HI1B 1EEZA 3QI9B 3IJ7A 5HJ3A 4GX9A 2BB0A 2DL9A 2BASA 4I9MA 3P2DA 1UD5A 2EYRB 3GMMA 1XUZA 4KZDH 3DO7B 5I78A 3UZQB 2HBXA 1KPRB 3LEYL 4OVUA 3MZ2A 4Z3EA 2PKDA 4YUEL 1YHTA 3MBEA 3MUHL 3A4WA 3LDVA 4L3EA 4WO4B 1AA1B 4P04A 5AOJA 3U36A 4L8BA 1L5GB 1CIDA 1G7QB 4YBQC 4X6EA 1A4JA 2K7PA 5H4YA 4GQGA 3NSNA 1T1WA 2PTVA 4Z2IA 3R12A 3OZMA 5F8RC 1UB5A 4O2CA 2AGJL 5EN3A 3RTQB 2ZOLA 5J6SA 2FLRT 1RI8A 4W6WB 4OSUH 2IDSA 3GM8A 3WQDA 1HQRA 2QEJA 4OU1A 1FO0A 4NN5C 4BZ2L 5CZXC 3IJQA 3GJFH 1EPFA 4S1RL 3BCJA 4B92A 4S3BA 3P8IA 5MERB 5GRUH 1RUML 1ZA3B 2FJSA 2NX5E 1CGSL 3HC4H 3N2OA 2XTSA 3GO2A 5DJCA 3WFDL 1CD9B 2QPXA 4F66A 2Y8UA 1A6ZB 2H0FA 1TTQA 3RVVD 2CZEA 1T83A 3OOQA 2FO4A 2E27L 3TCTA 7PAZA 1RIUL 5KVMC 5CJQL 4AF0A 2HJLA 3UEZA 2OTPA 1SM3H 3FSVA 3F00A 3VGFA 4CNUA 3HMXL 3W57A 3BAXA 4OIIH 1CXEA 3N2MA 4PRWA 5I3HA 4U7KA 1OC6A 1TJGH 4NZ8A 1MDAA 3BK0A 2J7CA 1YG9A 3DYPA 1LQBC 3EX2A 1ZBKA 5DMIH 1Y18A 1SY6L 3NCEB 5HA7A 4WNQB 1TWWA 5C5YA 2ABBA 4CC4C 3AADB 3QGAC 1R85A 5JA9A 1JF1B 1MCFA 4JY5L 1NGXA 4L1TA 1KTCA 2O61B 1OX4B 2EO7A 3FO1B 4ZAKA 4LHUB 1VBHA 5BVPH 3AZTA 2DLEA 3ISRA 2O4MA 1FDYA 3FA5A 5CJNA 1A6UH 3ITXA 2JV6A 1RUSA 1FYTB 2ADAA 1DQDH 3WD1A 4UF7C 2NLIA 2JJVA 1NMCB 5TGBB 4NDMA 3MRHB 3AB0C 1UEYA 5KN5A 4D71A 1B0RB 4B9CA 4D0CB 3F84A 5IMLB 3V0VA 1XFCA 3BG3A 3WJWA 3FKRA 1KC5H 5INDA 5E9DD 1WWCA 3V6ZA 4ZD3L 4X7DC 2FSDA 5ANME 2FSEA 2QAPA 5D7JD 4XNAA 3BD4A 2A77H 3WS6A 5CD5C 2DZSA 2WHJA 5BMXA 5E6UB 4FFZA 2DJMA 1CQKA 4JQ1A 5I24A 2QHLA 1GOMA 3RM8A 3MCKB 1BVZA 3N18A 1TZHB 5DMLA 2DEWX 5LBSA 2EDJA 5I71C 1R47A 1VFOA 3UTSA 1ONQB 4I77L 2XQYA 3G5VA 5HGDB 4O2FB 3Q8CA 2Y6TE 3AU0A 5LA0A 4W9FC 3TYEA 4OSUL 1QHZA 3MACL 3UXLA 4HIHB 4AQOA 4GKOA 3GUFA 3M6YA 3OEXA 3V5OA 4K3ZA 4G8GD 5D7LB 3VD9A 5KS9B 3MREB 5EIIB 3TUUA 3NCYS 4GUJA 1QRNA 3Q9PA 1T89A 1ET5A 4MX7A 1E6OL 3DJTA 4MNGE 4RAVA 1FP8A 3VJ6A 3ETBJ 5GRUL 4QCFA 1E9OB 3HC4L 1CT5A 1WBXB 4L5FH 1GPOL 3TLRA 1OAJA 4PJGB 4KO7A 2J47A 5E8EB 1C9WA 3FVMA 2FWOA 4K3EL 4J2MA 4KPHH 3VG0H 4KRUA 1P0EA 3RP1A 2CRYA 3SOTA 2CLZB 5DR5H 5LO7A 3BP5A 1PYFA 1E6QM 3G1FA 2OZ8A 4BKNA 4M6ML 2GUOB 1CQYA 4XP1L 4OIIL 4HIJA 5KSAB 1P0BA 5A40E 1I9JH 3T8XA 1UVQB 3K4AA 4Z7NF 2ZX7A 3CUIA 3WMBA 5G1MA 5HMEA 2UZXB 4EWJA 1M2VB 4RE2A 1GKPA 3X12B 2AQ1A 3RGVB 4LOEA 5DMIL 4PWEA 4PW3A 3L1OL 4F3FB 3CH0A 3M5ZA 2G2RA 4MCZB 4ADGA 1ITQA 2Z28A 4X0NA 5HYJB 1DWJM 1WXJA 4QRQB 4B50A 4DI9A 5HI4C 3USBA 3DFYA 1C08B 5BVPL 3QXBA 2BHFA 3SKNA 1SOSA 1TCRA 3KAAA 1DQDL 1QR4A 1DVFD 3FRUA 4IQDA 3B8TA 1JDAA 1HHHB 1T1ZA 4QT5B 1HSAA 3BGMB 2PDMA 5I6OA 1QMUA 2C3ZA 1PL9A 1QR1B 3VYOA 1KBIA 4UTTC 1J9SA 1JPSH 1EA0A 3OX8A 3GSMA 4ZSOE 3UU0A 2QJNA 2E7HA 5F2LA 5DZJA 4FTVE 1AQ8A 2CHOA 3DRTB 4JG0H 2B7PA 5EG6C 4YTUA 1IJ9A 3GC2A 5CIPB 1N5YH 1AJ2A 3W7CA 3L3IB 5LWYH 2NNXA 3H22A 1WITA 1MFEH 1Q6LA 1SPQA 1PYMA 4D8OA 1E4JA 3DFQA 3D6GA 4TQHA 3ZIYA 5IK3B 2WQRA 5C0RL 3H54A 3VFNB 4M6QA 3MTRA 2PZ0A 5IOKA 1E28A 3DMMB 4JFDA 4EUPB 3L65A 3ITYA 3U0TA 1U8HA 3B2XA 4G9PA 3VXUB 2GJ6E 1AQHA 5ADOH 4MAYB 4CD6A 3EYQD 2ASHA 4AIUA 3CUPB 3H2FA 1QFHA 1GAFL 1EO5A 4ES8A 2AEOA 4TYUA 3R06A 1E55A 2CW6A 4PW4A 2ZCKH 5EL1A 3IXTB 4XCEA 5BJTB 3U46B 3WF4A 1FL6B 1P5UA 4L5FL 4UCGA 1AGDB 3DGGA 1UH2A 4PJHF 1WKFA 5D2LB 4Y16A 4NP4H 3HPLB 1V3IA 5EU6A 1NF7A 2V38A 1F4AA 4C1KA 1WXYA 3ZVIA 3CSBA 3B3DA 4GG6F 4V1DA 1OF2B 4KPHL 2A6IA 3VG0L 3VE0A 2LTQB 4MOZA 4RRPM 3NIDF 1UD3A 5DR5L 4BA8A 3Q2NA 3EJUA 4PJDF 4KZCA 4KNSA 1R9FA 1QWNA 3GK8L 3T65A 3QNXA 3S3JA 1EERB 3RCMA 2VN5A 1I9JL 5E2TH 4NKOA 5FECB 4I3GA 5GS2D 4D2NA 3TJLA 4Z7WA 1WGVA 3OJVC 2YAHA 1EA9C 4G8TA 1XSJA 3QEGL 5A6IA 4K7PH 1LLWA 4XNMB 4KK9D 1JVLA 1O5RA 4CVXB 1IAIH 3LDBC 2IQ9L 2CPUA 3ZM8A 5HAOA 4NWUL 3ZE1E 4IZGA 4IDJH 2LR4A 2QDEA 1LQ0A 4IP4A 5I74C 1GZPA 2DD8H 4H1LA 1Q0XH 3TYZA 4BCXA 1JPSL 1HKWA 1B9KA 1JCKA 3GG0A 1NIFA 4N4QA 3FO9A 1S5WA 5IBXC 1SLVA 2AQNA 1ZS8B 5IOBA 3IKCA 1TWDA 4YXHH 1WH0A 3D39D 5IESH 5I06A 2H9AA 1BHGA 1B3VA 1N5YL 5FKAB 3BDYH 5LWYL 3ROOA 1J05A 3ESPA 1OW0C 3EOAB 4YDIH 1MFEL 3OKOA 2LFEA 1OAZH 4MIMA 3PJSB 5BZXA 4I90A 4JLRA 3LLDA 2VDPB 5IB2A 5BZWA 4NNXA 4H25B 4HSAC 1R3RA 3QQ1A 3QEQE 3RL2B 4O52A 1FHUA 3QRGL 3RLUA 2Y6SC 5F97E 4FKEA 3GNPA 2ODIA 1A6TB 2BSED 1M3UA 5ADOL 2QGCA 3SDAD 1TR7A 3U48A 2H2SC 4G42A 5IHZB 3TROA 2ZCKL 2F1EA 2ICES 1ZV9A 2HFFA 3PPSA 3LHUA 4W8BA 4X8CA 4WJ5B 1PZ3A 3GH5A 1OHLA 4GXWA 4KS0A 5GJSH 2DLGA 3NIGF 4NP4L 1LOQA 5EZLA 4IM8A 2GJJA 2PC8A 3W0KA 3GMOA 4QRUA 1FA2A 3DFTA 2YD4A 3RJOA 2OELA 3TGXA 4DJFC 2O6FA 4L80A 3G9AB 2PTUA 1GHSA 1S3KH 2OT0A 1D9KA 1TV5A 3VTAA 4PUBH 2P5EE 3CHOA 4S1DC 1TRIA 4XAZA 2Z1KA 3CFNA 2VCAA 2YD8A 4UTBH 1X4XA 3RB5A 2O5NA 1Z5LB 3O3BB 1R3HA 1ES0A 4GKZB 4NZJA 1SM9A 3CV2A 3ATBA 4PJ7E 1TQWA 3H4GA 1DUYA 1FCGA 1S7QB 2R0KH 2JI3A 3S6CA 5I6MA 4GISA 1AIFA 4UTAL 1H6UA 3FA3A 1ZENA 2IGTA 5IF0A 4PWFA 1ITUA 3DBXA 3TJEH 4PR5B 4PL2A 2WHMA 3EHBD 1RL1A 2CZ5A 2QMJA 2ZCHH 1GHFL 3MZNA 4QOKB 1IAOA 3NVQA 2B15A 4OLEA 2F5BH 3D85B 1UM4H 1ETZA 2DD8L 2PC4A 1KW1A 4PMNA 3ZRFC 2PODA 4RAHA 1V05A 3BYTA 3VNJA 1H7PA 2N1KA 4DUWA 5GS1B 4I18A 1OB0A 4D9QE 2X0HA 43CAA 4ZXBD 4O57A 3H85A 2OSXA 2PTXA 4YXHL 2K4WA 1CFBA 2BGNE 5IESL 4JNZA 3UMTA 1NOAA 4MXQC 4N8VB 4W4NA 5HJDA 1OSYA 3AXIA 2DMCA 2ZQ0A 1P6AB 4B9YA 4QRSA 4PLKD 4JRYB 3FGCB 4UFKA 2YL8A 4FEMA 4HUWA 1DJIA 32C2B 5GGVY 2VFGA 1UWXK 2DI9A 3MA9H 1MCBA 1KLYA 4A2DA 1D5BA 3BWZA 5AD0B 1K85A 2PP7A 4YWIA 2DJXA 4NENB 3QSKB 5AENA 3U0PA 5HJLA 3F7YA 1UWSA 4GJ1A 2BZ7A 1GJUA 3P3BA 1IIKA 3RM9A 3VK5A 2CO7B 4Q8WA 4QHUB 1I7TA 3CUFA 3V6FB 4S0HA 4N6QA 3D87B 3T2LA 3WKYA 2BMBA 3QAQA 3WGUB 5I1GL 4CADB 1IC5H 3DGCR 2NDGA 3H42H 4NO2B 4FYQA 1KG0A 1EAQA 2CAKA 1HL9A 1R2RA 3ML9A 2DLFH 4HOZA 4NZ5A 2UYLA 2PF8A 1S3KL 2DZBA 5B3SB 1KGUA 3TZVC 4HWNA 4QEHA 4JM2F 4HIXH 3CQFA 3IU4H 3ITGA 3P1VA 4PUBL 1X7TA 2F2KA 2R9HD 4GXVL 4G6JH 4I1PA 5IMKB 5GGTH 1DTUA 3DRQB 1IUZA 2WYHA 4FOMA 3O3RA 4AHOA 1BVNP 4W9KC 4UTBL 4IKNA 1R5IB 2W81C 2UUDK 1EXPA 3SGJA 4E9XA 4YO0B 1RJPA 2ICEC 3FSUA 1JNNH 2R0KL 3W02A 2PWUA 3ZL2A 3AHTA 2HUHA 2SFPA 1P4CA 3TNMA 4FHAA 1UWYA 3LZ5A 3QIWB 2ZXAA 3H2AA 3QWOB 4H2CA 4WHTB 3ZJ6A 1UCWA 4FQIL 2C14A 1ZL1A 4A55A 1FL5A 2VEPA 2VQUA 3UWQA 1UM4L 5MENE 4U4MA 3N9GH 1PWMA 1XIHA 3BRGC 1FF5A 4PYGA 5D2XA 3OKLA 2Z6FA 4U0RC 1AS6A 4P2OD 4PWJA 1OVDA 1UD2A 1GYUA 4TUOA 1O9WA 4D0DB 3FKKA 1KPVB 5J1AA 1B0GB 1F3XA 3DARA 4PWIA 3RDTA 4EAYA 5A6JA 4GRWH 3ZTNH 3L08A 2NY2D 5K59F 3QO1B 4KJQD 1JZ5A 1HEZB 3POHA 1PCXA 4PRPB 2YSSA 1MPAL 2FECI 1I3RB 1OFQA 2I9LA 1MQPA 2VQTA 1DEEB 4L8CA 5JIKA 1XDLA 2QADC 2YAMA 4C4KO 2YPLB 1G1YA 4DP6X 5HJXA 1TEFA 1QLEB 1Q6EA 3ZU8A 4ZB0A 4LPXA 1BQGA 1DWAM 4ZS6C 1HQ4B 1TPXC 2Y1AA 2OB3A 3IBOA 1OP9A 3IAPA 2VIRA 3B9EA 3LERA 1M6UA 5I3FA 1IC5L 1RZ7H 4KWSA 2BVOA 3CFKB 2PCFA 2R7EA 3C5JB 3RVTD 3HE7D 3H42L 4W9ZA 3DERA 4ETQA 2BV9A 1L9SA 3FQXB 4WKZA 2DLFL 4JX4A 3ULVL 1E6RA 1PMYA 5DEGB 1JEZA 3TJXA 4NRXA 3WY3A 4Y96A 4HIXL 1GGCH 4M03A 3IU4L 3HZKA 2QKFA 3F58H 1J5DA 3CVDA 4G6JL 5FGCE 3NSYA 4UDUB 4HV8A 1TNMA 5GGTL 3UTOA 4B9JA 4HYWA 3HC3H 1LEGB 5A1AA 3RMEA 2CGYA 3FTWA 4U3HA 2XISA 1KIPA 4X6CE 1R3JB 5G4NA 2G4FA 1IT9L 1ZHKA 3BAIA 1U3ZA 1JNNL 3BSHA 4FYRA 3IJSA 4AUBA 3QJTB 3ZDZB 3UTPE 1ZJIA 1D6VH 4U4IA 4IOFC 1NPJA 2X28A 1T04B 1C93A 1F9CA 2P5NA 1LUCB 1IR1A 5D33A 1JDCA 2C16A 5KITA 3E96A 1E0VA 1TLKA 5CCKH 5IRPA 3W27A 3GU9A 3TA3D 6XIAA 3S1VA 4XIAA 1IARB 2EKSB 3TP4A 4D6GA 2OZ3A 3EBAA 2VERA 2FZMA 1H5BC 1J93A 3G5WA 4PJ8B 3UPCA 4IX0A 1IC4L 3DIFB 2W07B 1J5TA 3G1RA 1A1OB 4D3CH 4FXKA 4HUKB 3EXLA 4EBQL 2XBZA 2DQWA 3EGXB 5IM7B 5DJ8B 5A2BA 4O54A 2YR1A 5C0BD 4QDPA 4ANUA 1MFVA 4LKXB 5JA8B 4W7UA 3A6CH 1E9ZB 4LUSB 3LSOB 1O6VA 1UJ3A 4WUIA 5IMMA 2OTWB 1YRRA 1WS8A 3UF9A 3V0WL 1QAPA 6A3HA 3PSVA 4JZOB 1K7XA 1H60A 2BVPB 2G5BB 2IANE 4HKXA 2F74B 3KPTA 4PY7A 4UMCA 3QFJE 4Q7IA 4Y4FB 4L5FE 3S8HA 4PR4A 3MJ9H 1CDUA 2EQDA 3I9IA 2X4UA 3C9NB 1T2JA 3VRIA 3FU6A 4JZJA 2YO3A 1RZ7L 2XICA 1FWHC 3V4VA 5I6XC 5BQ7A 4YLCA 1DVQA 3EOYG 1Z5HA 2VLMD 1K5NB 4H8PA 4UTWA 3GHBH 4RMBA 4E2DA 1FZOB 2MPAH 3MGTB 4R9XA 3FH5A 1QBBA 1CFSA 3SJVA 4KVNH 4UFIA 4JGJA 1DZBA 1TKKA 2YL5A 1XF5A 1GOKA 2MSPA 3F58L 2VENA 2IPUK 4N2GA 3D47A 1LK2B 4UCFA 1KM1A 2YB4A 3LV3A 4FALA 2IOOA 1U4FA 2OAAA 4ZR8A 3KWXA 4JHVA 3I7QA 1O1HA 3DBNA 5E94A 4Y2DD 3S4SG 3VXPA 4ORGA 3QHMA 2NTFA 5D72H 3KOWA 3CBJB 1MKFA 5E7BA 3TU9A 1QSVA 1DSFH 1D6VL 4AMWA 2CKBA 1UB6B 3NCJL 1QPOA 4GBUA 2NY3B 3K1KC 1PNCA 3HIJA 3CV5A 4Y9PA 4PUNA 3ULSA 2VCCA 4N2CA 3QWQB 3ARWA 1JV5A 2GSEA 4TX8A 1DKWA 2PETA 2FX7H 3B9KB 3RHWK 2NY5L 4YSAA 3KPSB 2VITB 2HTLC 1CYGA 1WWAX 3W26A 3RIAF 1X5AA 3VIOA 4OFDA 1NC4A 4G1MB 2YPKB 1L7IH 3QXUA 3RY5A 2EH8L 1INDL 3P6LA 2ZXWB 1PTZA 2AJUH 3GTVA 2OR7A 3QV9A 2XXGA 1UACH 3P73B 3R0NA 4ODXB 4Z0XA 4D3CL 4UT9L 5C9JB 4LLVA 4NO0A 3E80A 5M03A 5DS2A 3HHSA 5DUPH 3RBSA 1BFOB 1YMME 4W5ZA 1TU2B 3H24A 5KMYA 4P49A 4BGDA 3VQ2C 3EFFA 3WO4B 4S3FA 3A6CL 4HVBA 4IRZL 1F42A 2QSCH 4RDVA 2XVLA 1UT9A 2IG2H 1BA9A 4Z7UE 2WMFA 1TVHA 2VKZG 5ABTA 4GAFB 5CBAA 3NA8A 2F6AA 3HZ3A 3LQZB 3TVMB 2ADIA 5M1TA 3KRSA 3H2MA 3JBG7 2B59A 3GSNB 5AY7A 4LPUA 3AXXA 1TVBA 1KIQA 2EXWD 3MU7A 1Q8MA 1K77A 2AJZB 3BSZH 2PPEA 3DOHA 2VISB 3PIQA 4NM8H 4GMTH 2VDKH 4NUMA 5SWQB 2CGRL 3VD1A 4B4HA 2ODOA 2WLZA 3L4ZA 3WH5A 3UZJA 4PRIB 3PGCB 3WIIH 1INQA 5C7XL 2V69A 4FXFA 5IFJA 4GS7B 2K8QA 2QJJA 2FTWA 3LKSB 3BVWA 2AS5M 1AC6A 3QUKA 1ZT7B 1IGJA 5DTFA 5KVFE 3LEPA 4RAUB 3MW7A 1H50A 2Z4TA 2XFYA 3AM8A 2OJ1A 3LBCA 4A6YB 4Y5VC 3MC5A 4LB8A 4H20H 2ISFA 4PB9L 1FH5H 1EWDA 3M0JA 3VGHA 4JGNA 5TQLA 1BQ5A 5FKPA 4TNVK 2MPAL 4Y5XA 1MRQA 3QI9D 3HG5A 4ZFCA 3CEUA 3MB9A 4PJAB 4KVNL 1ZGDA 4DETA 2W9MA 1DQIA 1NFDE 2EILB 4KXBA 5DD0L 4KETA 3UXAA 5HJ3B 2Y23A 4AT6A 4YMZA 2EXOA 1I9RL 2MNRA 1CTOA 3DC0A 1N12A 4X63A 4PWGA 2E0PA 1YN6A 4L37A 5D72L 1P1ZA 4JN1H 4Y7EA 1M71A 3MBEB 4YXGA 4L3EB 4MD5A 3UBPC 4HYTB 4YTTA 3OKDA 1DSFL 3WLMA 4MGXA 1JDFA 4KNUA 2R29L 4KAQH 1FWWA 1TYEB 1T1WB 2R56H 2J9XA 3CL6A 2O6CA 1UB5B 4O2CB 4FG2A 4NQCE 5BOJA 2FX7L 3BCDA 5DUJA 4O1EA 1FC1A 4LC8A 4TSAL 1HQRB 1FO0B 4HZMA 4ERAA 1AVAA 7FABH 4AY1A 4LVGA 4MTMA 4G9DA 1A5AA 5F89A 2F1AA 2D2JA 2ICSA 4LL4A 3N25A 3SY0A 4EMZA 1SFLA 3CDGA 4MWAA 3KHOA 1YY8A 3EKLA 1BQRA 1C91A 5I5MA 1MRCL 2VZOA 3RMJA 1UACL 4U2ZA 4G6KH 2FIKA 2OR9H 5D7JC 1M04A 1AZVA 3TAKA 4RBPH 1VZWA 3RILA 1FWSA 5FA5A 4UAOB 3D1MC 5DJCB 5KYWB 3WX7A 4OI8A 4QRNA 4LRSA 3VXSA 2QSCL 1MHCA 2IG2L 2FO4B 5IJCC 1FWRA 1RP9A 2Q8XA 4LWWA 3AUOA 4KCUA 4AF0B 3TOYA 3V0SA 3TN0C 4YHMH 2O92A 1SMAA 3ZS4A 5DANA 2Z1WA 3TEUA 2PYFA 1C7SA 2QNEA 1EUUA 4FNPA 1LO2L 5DGQA 4WO0A 2X8RA 3DH7A 1ZLUK 3WNJA 3GC4A 3UEQA 1OPOA 3FAXA 2VDKL 3AW5A 2YD5A 1F4YH 1Y18B 3SGGA 3W2NA 3EYVA 4LHUD 4OJCA 4GT0A 5LNEA 1NGXB 4N0RA 5GZOC 1FYTD 1QFWH 5JQ9A 1JUKA 2IDFA 4ZAKB 4JYFA 1DDHA 2DQFB 2FVLA 3EZ8A 4CL7A 4MASA 1K4DA 1V7NH 3VWKD 3KCWA 4H20L 4M8QB 1FH5L 3G7TA 4RGOH 4YHIA 4OVXA 1JCTA 4YFLF 2B7QA 3NQ7A 1NL0L 4DXVA 4NDMB 3LZFH 4REQA 2JJSA 4R27A 5KN5B 1PKQA 1X5JA 4QDWA 1CLZH 5E56A 4S3AA 5LGKA 2RA1A 1TB3A 1WZ1H 3SJ3A 4WEBL 2WQUA 1IAIM 1JS4A 4XX5A 4JPIA 3V0VB 3NYDA 1U83A 2WXQA 4WR3A 4MMZA 2WNXA 4YK4B 2Z7KA 3G77A 1YNTF 3RX8A 4BQ9A 5INDB 3VFVA 1UQYA 5CBIA 3T2PA 3V6ZB 4N2FA 3PS6A 4L4VD 1L3NA 4CGUB 2FSEB 4I5UA 5KTEH 4QF1A 1F1AA 4NAEA 1P53A 4TS6A 1QSZA 1QK2A 3AT9A 1XYBA 1N6VA 4TNWF 4JN1L 3KCJA 3ZIMA 2XVPA 1YTDA 4AJ0A 1V6TA 3LD8C 5F21B 1T96A 3H9SE 1DR9A 2X4OA 2DT1A 1V4YA 3PWPD 4KAQL 1JQVA 3L68A 1EP2A 1E2WA 2R56L 2XZCL 2AHIA 1T1YB 2ZADA 3G5VB 3IRZA 1UWUA 1DVFC 4A3HA 1X96A 2RDXA 3M7FB 1C5CH 4U1IA 7FABL 5GXBB 3PL6C 1TZAA 3B1UA 4P2RA 3RCNA 4YNYA 3AIVA 1DQJA 5IQ9B 4MX7B 1OHQA 5DVKA 3ZO9A 4XQ6A 2GQHA 5EMKA 2IXQA 5DFTA 4RAVB 3VJ6B 1IBHA 3IJ6A 3UAJD 3NJNA 3P7YA 1R19A 1HP4A 3AMDA 1SUJA 4G6KL 2XM1A 4K7PX 5CKGA 2XWCA 2DTMH 4M29A 4YLQT 5CLZA 5IQNA 1FG2B 2DMHA 4H6RA 2FWOB 3PTDA 1MDRA 1E8XA 3OKNA 4Y9NA 1TZIA 3PF3A 1ILUA 4JRXB 4DVOA 3BP5B 4DF1A 1AL8A 2YW3A 2W0FA 2WOBA 3LMZA 4WFFD 2PTTA 4YHML 4MJ5B 3AQYA 3GUTA 5IVXE 2QGYA 3S3CB 3T8XB 2ZX8A 3BH9A 3QUYD 4JFHD 4X8XA 4YHPA 3AJ7A 1UKPA 4YNGA 5FYKH 4C65A 1F4YL 2E46A 3BV7A 5MEPA 2G2RB 4E41D 3NH7H 2CFFA 3IDIA 4U7MA 4PGCA 4MJIA 1WEJH 1W1IE 1S1PA 5J0BA 1QFWL 3GSWA 1FAIL 3KBWA 3HG3A 4AX3A 4K8EA 3BH8A 3GSRA 1M2OA 5KAQG 3SKNB 3KCPA 3NNTA 2IUZA 1TCRB 3OAZH 2H0EA 3O6LH 1I4FA 1T1ZB 1BVOA 1HSAB 1Q63A 3LZFL 4PG9A 3BZ4B 3EKGA 4I9WE 1RV6X 1R9XA 2FVMA 4W85A 4FG4A 3PG8A 1MF2H 2BW5A 2Z35A 3K1GA 5LAXA 4MLJA 5D7SH 4JFFA 2Y1HA 2V9QA 3PU7A 4EZLA 3ZE2E 1HYRC 4JEGB 5AFDA 2GHZA 5KTEL 2DVXA 5JIDA 2OR8A 5EORH 1E65A 3DETD 2ACQA 1VKXA 1EJSC 1SGJA 1QBMH 2UX7A 1W5QA 3U1SL 1NDMA 3CN3A 1T3FA 4UUJA 3GIZH 2C9UA 4C6FA 1A0EA 2H90A 3Q05A 2UY7A 3MV9A 3MBDA 3X1GA 4C56A 4KROC 1RY0A 5D7KD 3P5ZA 3BRFA 2NY1D 1XGRA 3L16A 3SCTA 4L0PB 5E5CA 4XK2A 4DNMA 2GC4C 1M9WA 3U0TB 2DQTL 5IFTA 4JRWA 1C5CL 4E9SA 4DK5A 1KFAL 4M7ZB 5D2YA 1X5KA 3DDGA 1ZPTA 3H7VA 4QRPD 4U6VH 3G1AA 4ICNA 1TTCA 8XIAA 3QHZL 3LJ3A 3T0WA 4XCEB 2FT7A 1EBAA 4BK8A 2V3EA 4GRWE 1P5UB 3SM0A 3NIYA 3DGGB 3RL1A 4OBSA 3LMYA 3SBWC 2DTML 4CRPA 3FJ6A 4IGMA 1MFCH 1WG3A 5IROD 4Y16B 2PDCA 2PW2A 1QEWB 4ZNCD 5EU6B 3ARVA 5HNRA 5K4ZA 4V1DB 4BSJA 2A6IB 2YWYA 5FF4A 1VGAA 3VE0B 3VW3L 1NICA 3GS0A 2NQZA 3BPLB 5FEBA 3BQUB 5AYUL 1Q6RA 1FKWA 2P43B 3DYMA 4GIYA 3CZFA 2GVGA 3T65B 2K45A 4FHKA 2OJPA 4WTZG 5LB1A 5AHFA 1GMEA 5I0ZA 2V5CA 3BLLA 2GITA 4NKOB 1L6SA 3V4PL 2A99A 1FJ1A 2KDGA 5ACMA 3VPLA 4Z7WB 3CTLA 4BXSV 1DQXA 4J3OG 3D4ZA 3AFLA 4OH2A 4APQD 4M62H 4PRHA 2Y7MA 3NH7L 3JV6B 3B2MA 5HY9A 5J04A 5DWUH 1WEJL 5T3ZD 4DEPC 3P0GB 4RX0A 3PBGA 2D7NA 5BXTA 5CD3B 2JQMA 3PABA 1H3WM 4R7DA 3ARDC 3AHXA 4MYWB 5CS7A 2WMHA 2DUXA 1C90A 1KIRA 4RWHA 5TE7H 3QUMH 3KGUA 3O6LL 2B5IC 1V6VA 3WFEL 1P84J 5JHAA 3QR0A 2QKSA 1GZPB 4M4RA 4H1LB 3AREA 3FU0A 1BEUA 2VLRA 1J0ZA 2X89D 4FA7B 4TLSA 3FO9B 4QXTA 1EHNA 3BP7B 5FC9A 5D7SL 2YXVA 5TK4A 4QRBA 3C4UA 4P7RA 3VFRA 3QXAA 3IKCB 3QZMA 1FVEB 4XNYH 4RRPG 3T3PF 4UOZA 1QBML 2VURA 1J05B 5E6ID 1GYLA 4C1NA 1VZIA 1FBAA 1K6AA 3G6JA 3OKOB 3QF0A 2J6EA 3I65A 2ZOXA 5AB9A 2VT0A 2RHEA 2PNDA 4FNQA 1AG0A 3BFQG 4F9LC 1RUQH 3APTA 3S2JA 3HFMH 2WBJD 2QSQA 2LV4A 1UJTA 3VTMA 4LUYA 3BQVA 5B1AB 1RPKA 3QUZA 3NXLA 3SGKC 2PFHA 4G42B 3WQEA 4U6VL 3TK7A 1Q1JH 4US6A 5DQPA 3FKUS 2GHWB 3KS0J 3B3IB 4RA0C 4QROA 4ZXBC 2HFFB 5TE6H 1V0LA 4O02B 2HZHA 4DQOH 1C9DA 5SWZD 4BKSC 1SZRA 1MFCL 5JOPD 1QI4A 4PUWA 2WJ7A 5EZLB 2HKAA 2AQWA 1IGWA 3OHXA 1N0LB 3GMOB 4QRUB 3L3OC 4OF0A 4JTHA 2WO4A 1NU5A 6ENLA 2NY0D 4GX8A 5D7IF 4PLKC 3S8FB 2EDQA 1D9KB 5MHSD 2AP2A 5IJVA 4IIZA 3C09B 4U3SB 4MADA 3V16A 4JM4H 1GGBH 2AXJA 3KTCA 4JIRA 3EFDH 4DWSD 1VP5A 2GBTA 3PXHA 1R3HB 1ES0B 4MVBC 1JGLH 4HUCA 2DT2A 1Q1PA 3EYUH 3MLSH 4DPQA 1XD0A 1AIFB 1PY0A 1FY6A 4BFNA 3LEVH 4Y4HC 1FORH 3TIDA 2XN2A 5C0JA 2YXXA 1GKEA 5E9DE 5IF0B 3F5KA 4KKQA 4Y89A 3TLLA 3LZOA 2J62A 2DWEA 3N2JA 3AYSA 4W68A 1M3JA 3QUML 4BF5A 3U3HA 4N2AA 4KZDL 1ETZB 3MTXA 5I73B 1GTNA 1NM4A 3C0LA 2FPVA 1A4CA 3M47A 1OARH 4OBTA 4OLUH 4EPSA 1QLFA 2PLKA 3LS5H 3US0A 2VR3A 1IWAA 5AVTB 5T5FA 4I18B 1VPQA 43CAB 3S0PA 3QBTB 1IEXA 2NWSA 3V79C 4ZTEA 1V79A 4CJ0A 4HNOA 3FUMA 2PEVA 4XNYL 2ZIDA 4C58B 4PJEA 2F8IA 2HLFD 4WY7H 4JY6A 4JRYD 1CZ1A 3TYDA 3S3DB 3W53A 4P99A 3UYOD 4UT6A 5D1ZC 4QRSB 1FTXA 4N0UA 3VTTA 1YNKH 3D05A 4HUWB 5TE4H 5IEKB 3SJNA 4WGWB 1RUQL 2Y2WA 1E73M 1U3HD 2NV2A 3VGAB 4GG8A 1WDWA 2ZX5A 1D5BB 3PV7A 5D4QA 2WWCA 4GY4A 1C1EH 1ZA6B 3CX5J 4AYFA 2ITEA 2HP4A 3U0PB 4ZGYA 3DK0A 1J01A 4JQAA 3F7YB 4P5TC 3D48R 3KVMA 3EZ4A 4XVTH 1I7TB 2OV0A 3G0SA 3TEVA 5TE6L 4RGNC 1GWJA 2YBRA 3PQYB 4X4YA 4A29A 3OHMB 1SM3L 3EOTH 3BI9X 3QW4B 3G6AA 4XXDA 5E95B 1ETA1 4WIWA 1KG0B 3HS0C 3O6FC 1JOIA 4DZHA 2DY3A 4O50A 1TJGL 2ZUXA 6PCYA 2UYLB 2H0JA 4AENA 2J7BA 4O51B 4LNYA 2YL6A 4XG1A 1UZDA 3ZZQA 1W8NA 4LF2A 4JM4L 5H37A 1GGBL 2EAEA 4YC2C 1ID5I 1DO5A 1ZSHA 3EFDL 1L4IA 4PG2A 2HVKB 3UCQA 1E2ZA 1FCUA 4OGQC 3M7SA 2DYRB 3BCFA 4WJKB 4AJVA 2Q1EA 4ZTYA 2PCQA 5IHWA 4NQDA 1A6UL 1JGLL 3AAZA 4KH9A 4MSWA 3MRBA 4HIBA 2L7UA 1ZANH 3EYUL 2IBZX 2WJDA 4Y4KA 3BW3A 2ZRXA 4XBKA 1E7UA 1I1XA 2XPGA 4W4OA 3TNMB 4POZD 5C07E 3I4KA 1BJMA 4ML9A 3HE7C 2VZVA 1SJBA 2FCBA 4GIPD 2PO6D 5IHRA 2R69H 2GTZA 1KC5L 4M5SA 1FL5B 4QTHA 3W11C 1VESA 2AK1H 1W31A 2ZUYA 1F13A 2HPOA 2VDRH 2A77L 4UV4H 3MRFA 1F05A 4MUPA 1ZBVA 4XVJH 3ZTDC 1OARL 3OKLB 4I8YA 4OLUL 2WLLA 1EQPA 2BM3A 3C2AH 1EWHA 4K9JA 2GWNA 3A5FA 2ZG2A 2PP9A 1FNSH 2F18A 4R9OA 4BV1A 4TUOB 3WNKA 3ILEA 4FXRA 5TQ2H 1KV8A 3PZQA 2YXWA 2PWHA 3TTYA 4OCNC 3WDPP 3BHBA 3RDTB 5KVDE 4RIRA 2C1GA 2CNCA 2QQKH 4PRPD 1MMFA 5E2VH 4DOHB 4MJ2A 5TTRA 3OWEA 1FWAC 2Z91A 4WOZA 1DFXA 4QBXA 4MMWA 2HG5A 3ZDXF 2FH8A 1YNKL 2J1XA 3IV8A 2YSSB 1VCFA 1MW2A 3TBWB 2QCDA 1C1EL 3UABA 5FM8A 4L8CB 5KOMC 3Q1SH 2PLMA 1CD8A 5C7VA 4FS9A 4NIRA 4Y1AD 2W67A 3VI4A 1W72B 2W6RA 3CXOA 5KVFH 1XH3A 4H13C 5H6HA 3WN6A 1MRFH 5FO2A 3BJ91 1DIKA 3IJLA 2E9MA 2DKMA 5INCB 4M02A 3K8MA 4KNQA 5GRVK 4A39A 3EOTL 2UXGA 2BVOB 5I1LB 1ZLSH 2PCFB 4L64A 2CO4A 3PAVA 4WUKH 4CNIA 4PJ5D 4ETQB 1YEKH 3IKKA 4QRRA 1CFNA 2WINA 5IVZB 4WKZB 3IBEA 5C6WH 5KZDA 2H5UA 4ZTXA 3T0TA 3V1PA 1HHIA 2JVUA 2Z7UA 2JE8A 4GY0A 4NRXB 3VA6A 1KLUA