4MB1A

The structure of mall mutant enzyme g202p from bacillus subtilus
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
559
structure length
557
Chain Sequence
EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIPSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase 1
total genus 225
structure length 557
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4mb1A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb1A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4mb1A02
3OBAA 1B31A 3ARZA 2G41A 1TQVA 9CGTA 1GVYA 2XWDA 3ZMRA 1E0VA 4V28A 2C8NA 1V0MA 3D4YA 1OD0A 2JF7A 3VGEA 2MANA 4L4OA 4AMCA 2BY0A 1ISVA 4HP5A 4D6FA 1PBGA 2XN2A 1QI0A 2DT1A 3SIMA 3SEPA 4KRTA 4LX4A 5A8NA 4ZEPA 1XHGA 5E09A 2G3MA 4PSPA 3ARYA 4AY1A 4DWSD 5IFTA 1MXDA 4AD0A 3VSVA 1HN1A 2YDSA 2WMGA 1V0LA 4CN4A 5A2CA 3HN3A 3MKKA 2AMGA 1IZKA 3VIKA 1WAWA 4JAWA 2PWFA 4WSJA 3SURA 2XTKA 2OYMA 5E9AA 2Y8KA 3SCTA 2GDVA 2QHAA 1D3CA 1XRVA 2GJPA 3AIEA 2A3HA 4MTVA 3WY1A 4W8BA 1R75A 4PTVA 1KQZA 4CD8A 1HNYA 3B8SA 2VX6A 2CCRA 4FNQA 4EKJA 5HPOA 2PF0A 1JZ2A 4TX6A 4B9YA 1BVNP 3MUZ1 4PBGA 4UQ9A 3EDEA 2W63A 1CWYA 4DUWA 1VEOA 2VR5A 5E1QA 2WZHA 3AMLA 3BH4A 1Q6GA 1GJWA 1B2YA 3MS8A 3SUWA 3VTRA 4J3XA 3QHMA 3EJQA 1ZU8A 4M1RA 1E4MM 3CZEA 1CGWA 1MW3A 4U3CA 1L0PA 3GH5A 4P7NA 5M17A 3FAXA 1WDSA 4DM1A 5DO8A 4UZSA 4ZE5A 5ABHA 2G3JA 3W4RA 4BA0A 2YFNA 1UH3A 4M8UA 3NDYA 3WDIA 5A95A 1NM9A 1BG9A 4CUCA 4XZBA 2X0YA 3WH5A 1JIBA 1R46A 1LWHA 2J7GA 2O9TA 5BXSA 1CXKA 2ZXAA 1PIGA 2V5DA 3VD4A 1K9TA 2YDQA 1FP9A 2WBGA 4CU7A 4HOZA 4AMXA 3AIBA 4Q22A 2WC4A 2VNCA 4HZ8A 2YA2A 3UETA 4PCSA 1XH0A 3PTQA 3VIOA 1KGWA 3PZUA 1WZAA 5CGMA 1H11A 1R86A 1WDQA 2VZTA 4CVUA 2WM0A 2X2IA 1HJWA 2FHCA 1W1YA 2V3DA 1I75A 3PZMA 4A4AA 5A6LA 3LPOA 3BUQA 4CD6A 4QAWA 2BHZA 5CG0A 4ATDA 1A47A 1HT6A 3TTQA 1UR8A 3G6MA 3TOPA 1OWQA 2PB1A 4F66A 2F1AA 4UQDA 3BXWA 2PI6A 2VI0A 1G9HA 5GNYA 1TE1A 3DX4A 3WKZA 2J78A 3NUKA 4AD1A 5EFDA 2YOCA 3CO4A 2XFYA 4RE2A 3N18A 1KTBA 1WDPA 2E8YA 1KXTA 1CDGA 1EGZA 2PWHA 2A3AA 1C7TA 4P8VA 1E71M 3ZR6A 4P8WA 2J8FA 2WHKA 4NX0A 4UOZA 3SCRA 4XB3A 5M3WA 3AISA 3M6DA 4J3WA 3OLGA 5BROA 3SCQA 3LPGA 1NWRA 3BAYA 5HPCA 2Y2WA 2DQXA 3ARVA 2WZEA 1XSIA 2CESA 2GFTA 3N13A 4W87A 4LYRA 3AICA 4LGXA 1P6WA 1C8YA 1PEZA 4AD5A 1QNRA 5A94A 1CGXA 4GIAA 1VJSA 1E55A 3VOCA 1TQWA 2EBNA 4Z2IA 3AHZA 3CMJA 4AZ7A 1SZNA 1W3HA 3D51A 3B9DA 3VMPA 1JXKA 3GNRA 3BMWA 4LXFA 4K68A 1GOWA 3S5YA 5EFFA 1JD9A 1JYVA 2ZWZA 5GNXA 1GCYA 4CCDA 2DPEA 4AIOA 1G1YA 2EADA 2WMIA 1E6ZA 1NWTA 1UR4A 4BQ3A 2J62A 2BXZA 3CMGA 3RPMA 3CTTA 2YDRA 5CSYA 2JE8A 1E70M 4FLSA 3A47A 2VC9A 1EDGA 4WF7A 2WVVA 2XVGA 2XPKA 1X6NA 3ZR5A 4AZ6A 3APGA 4Z2GA 2XGIA 1QWNA 2G4FA 1QHPA 1WPCA 3WNPA 3PBGA 2EPOA 1V6VA 3U7VA 4TVCA 2UY5A 3EYPA 1U33A 4AD4A 1OT2A 3A23A 3KEHA 5I0DA 1MFVA 1WKYA 3AZTA 1J0IA 3MV11 2E0PA 3L4WA 3MU7A 3S6TA 3LRMA 2EPLX 4JL2A 3LXAA 1Q6FA 2ZXDA 2QPSA 4UCFA 3VU2A 2E4TA 4TVUA 3ZOAA 1BHGA 4D6HA 3A5VA 3A4WA 2C7FA 3WF3A 2EPKX 2OWXA 3FNDA 4MDPA 3W81A 1RP8A 4U5KA 3VPLA 5BCAA 1W32A 4D71A 5M5DA 2ZUSA 3DDFA 4PTMA 1DWGM 4M82A 2EABA 3CZNA 4W8LA 2XN1A 1DHKA 3HG4A 3QOKA 1UQYA 2DSWA 1TA3B 1LF1A 3WF0A 4HMDA 2X8RA 1Q6CA 3CHEA 3SCSA 2W5FA 1OINA 2BY1A 1TZ7A 1ISXA 4HOXA 1ZS2A 2WVTA 3AJ7A 1E5JA 4AMWA 3O6AA 1GOMA 2ZE0A 1AVAA 4D6JA 4UZUA 1R47A 2DIJA 4DM2A 3SCNA 1M04A 3M07A 4NXKA 3ARXA 3AYSA 2XVKA 1MQQA 3M46A 4P7LA 4P7RA 3HU7A 2CEQA 1GQLA 3AS0A 4UQEA 3WEMA 2E9MA 3N12A 1HP5A 2J74A 1KCKA 3ALFA 3W29A 4EAMA 3AHTA 1Z32X 3SUVA 1DWJM 1FOBA 3T09A 5A8MA 2EACA 3LMYA 4E4PA 3K1DA 2FHBA 4JFUA 5HXMA 2F7QA 4P8UA 4H8UA 5BXPA 4WK9A 1VIWA 2VX4A 3GM8A 2D0HA 2WAGA 2GSJA 1JAEA 1H5VA 1B3WA 5A2AA 2CKRA 1W9BM 4IPLA 2XVLA 1H2JA 4MADA 1J11A 1E4LA 2CERA 3OLIA 5LA1A 3N15A 4W7VA 1NOUA 4WSKA 1GOKA 1QNSA 3BAJA 3IJ7A 1VFUA 1DWHM 4FNPA 3NSXA 3DYMA 1LWJA 2CBJA 4MPKA 1ODUA 3U7BA 4GI8A 3EJUA 1OBAA 4RL3A 1EOMA 2JFEX 2XSAA 1VRXA 4FLOA 3THCA 3HMCA 3DX0A 3WL0A 1PZ3A 3BAWA 4TXEA 1QWUA 1R7OA 1Q4NX 1VBRA 1QI3A 1V3JA 1IT0A 3A3HA 4U3AA 4WKHA 2O9RA 4R27A 3AHYA 3FHQA 3QHNA 3WQ4A 5D9NA 1TFVA 4CCEA 1LL7A 3SCWA 1AMYA 3B9EA 3ZT7A 2WHLA 2ZXQA 5E70A 1CBGA 1E6QM 1QOXA 3EMCA 2WC7A 2V3GA 3CZJA 3TTOA 4GI9A 3HG3A 3T08A 3ZIZA 1E4IA 5AY7A 3ZQ9A 2JF6A 2WW5A 1KGUA 3AHXA 4MJ2A 1US2A 3BVVA 5E0FA 1UYQA 4M24A 3TP4A 4GXPA 1XD1A 3VIHA 3SUTA 2D1ZA 3RJYA 4JFSA 3AQUA 3D50A 3MO4A 4GPNA 1TQTA 4TTUA 4PCTA 1BVZA 3TV8A 4QCFA 2CNCA 1R87A 1V6YA 3AMGA 2YKKA 3AROA 1K9DA 4X0VA 1HKKA 2W62A 1FHDA 4QLJA 2A3CA 3FY1A 2UY4A 3RIKA 3UEQA 1PAMA 5A6SA 4QLLA 4UQBA 3PZTA 3EDJA 2NSXA 1ZJBA 1UWSA 1ISWA 3EJTA 3L4XA 3GXDA 4D6IA 3BUPA 3K8KA 3A6OA 4JKLA 2J77A 3ZJ7A 2UY3A 4A3HA 4MB4A 2XSBA 3TTYA 3VIIA 1BGAA 3EJRA 4UQAA 2DSKA 2Y8VA 3CUFA 2WB5A 1C7SA 1HX0A 4FLQA 3T2QA 4KMQA 3GBEA 1OIMA 1W9XA 2BY3A 2YLAA 1CLXA 3F4VA 3EDKA 2CHOA 4MNKA 2FGZA 3CUHA 2VVSA 3L4VA 3ARUA 1XSJA 4XV0A 2OSXA 1TMQA 2WCGA 1CYGA 3WD3A 1HXKA 3KL0A 1KR0A 5I2UA 3VGHA 1SYTA 4E8CA 3L4UA 1JDCA 1E6XM 4JHZA 3W6LA 1BG4A 2X2YA 1TA3A 5JBDA 2Y4SA 1UD2A 1XH1A 2XFRA 5EBAA 5CPQA 3CC1A 2WMIB 2E3ZA 3SCUA 1JL8A 3IAPA 3WH8A 2W92A 1E4NA 4RE4A 1E72M 4J27A 3WY4A 3BGAA 3F5KA 5I5RA 4JFWA 4Z2KA 1EHNA 1Q6DA 2YL9A 2J7HA 1B90A 1KQYA 2Z1SA 4YHEA 4HA1A 2CITA 1CZ1A 1IZJA 1UR9A 2W61A 1N82A 3CUIA 4YN5A 4OKDA 4JFVA 5JBEA 3FAWA 1ITCA 3W53A 3VNYA 5C70A 1JYWA 2E8ZA 1PPIA 3D3AA 1HP4A 1ISZA 3N04A 2XWEA 1BPLB 1GPFA 4UQCA 1V6UA 4MNLA 2WANA 1RP9A 5FD0A 4D6EA 3JUGA 3L2LA 2VZSA 4PUEA 3POHA 3H55A 3L4ZA 5CGTA 4KH2A 4IUGA 2Q8XA 1J12A 4XX6A 3VIGA 2YBUA 4ZXOA 4H41A 5ABEA 4HPHA 4R5EA 1EA9C 3VNZA 1KXVA 3PZIA 2YFOA 4CD4A 4BF7A 4CCCA 3D5HA 4BQ4A 1H49A 3WNMA 3MI6A 1HL9A 2GK1B 2E9BA 2DT0A 3VKKA 1WE5A 1TQSA 1CXFA 1V3LA 3RCNA 2JIEA 4UOQA 4N0RA 2PWGA 3I3BA 3LRLA 4W7WA 1A3HA 1G94A 4HMCA 4AZ5A 2A3BA 1GORA 2GUYA 1UD8A 1EOKA 1HTYA 3KZSA 1FHLA 1QNPA 4QCEA 2V3EA 1VFMA 2F7PA 3CUGA 2BVDA 3U5YA 2CBIA 3MMUA 1UD5A 2VO5A 5I77A 1LJYA 4HMEA 3BLPX 3GNOA 2WCSA 1G0CA 3OB8A 2FE0A 5FCZA 4AISA 5BYWA 3F5JA 1QBBA 5CPTA 4UR9A 3WUFA 4AD3A 4PTXA 3I3DA 3D52A 1MXGA 6TAAA 1GOQA 2J7CA 1FH9A 3WQ5A 3KLLA 1XCXA 2DT2A 4WIWA 4ZXLA 3NSNA 1Y7VA 1VF8A 3PZGA 3UG4A 4P7OA 1K9EA 1KXQA 3VDAA 3WUGA 5FL1A 3AXXA 3LXBA 5HNNA 6A3HA 3TA9A 1TCMA 4LYQA 2F1BA 4TTGA 2X09A 5AYBA 3WH9A 3ARRA 3CZKA 2EPNA 4KGJA 3J7HA 3UR8A 1LQ0A 4C7GA 2ZXBA 3VIMA 1UR1A 3BSGA 4CVWA 5I78A 6CGTA 4C7FA 1TUXA 1KTCA 2X2HA 1FP8A 4IM4A 4AIEA 1DWFM 5I3DA 2OSWA 1OCQA 4JZ5A 4E8DA 3EDDA 1WZMA 1DEDA 1J0JA 3E1F1 4KGLA 1WZLA 4NRSA 2J75A 2IXUA 3WF2A 4OBSA 1R85A 1SMAA 4Y7EA 2Z1KA 2F2HA 5DMYA 2WVVB 2WK2A 1BYBA 4TVDA 2X0HA 1JGIA 3VGBA 3T0BA 2CXGA 5D8ZA 1ZJAA 4X9YA 2ZUMA 1KWKA 3WDRA 4LQ1A 3WUBA 3KE0A 3WDJA 3W38A 1BYAA 1NP2A 1U30A 1UZ1A 1HWWA 1UKTA 2OYKA 1FH7A 3VD5A 4C7DA 1XH2A 2HVMA 3LPPA 3POCA 2ZUUA 4UOJA 3AMKA 3EDFA 2EPMX 4GZIA 1QHZA 3KLKA 3WNKA 2WVSA 3MMWA 1G5AA 1D2KA 1C93A 4NZCA 2F7OA 2WZIA 2YL8A 2WYSA 2VX5A 2D24A 1UD4A 1TQUA 3DYPA 2WMFA 2VZVA 2W4XA 2F7RA 3BVUA 5I79A 1QHOA 3SUUA 1ZBCA 3WQVA 1PX3A 2E40A 1F4AA 1V02A 3VD9A 5BRPA 1W1PA 2J8GA 3IJ8A 2GJRA 4Z2LA 1OT1A 1XCWA 1R33A 4AZHA 3NIYA 2DSVA 3ZM8A 3AZRA 7TAAA 3AS1A 3UCQA 1WDRA 2OWWA 3WBEA 1C8QA 5EMYA 4PMNA 5CQ1A 5LA2A 5FL0A 2BXYA 3L2MA 4PEEA 1YQ2A 2G3NA 4AZCB 2HISA 1KB3A 5DT7A 3AS2A 1SMDA 4JFTA 1U2YA 4M29A 3OLEA 3W28A 4Z2HA 3ZT6A 4GINA 1E15A 1HJQA 2D0GA 4H04A 3WF1A 4F9JA 1RD6A 3WD2A 2WSKA 1O7AA 2UY2A 3W24A 3ARQA 3VM7A 5KEZA 4KWUA 1W9UA 2J25A 4V2XA 3AI0A 3CGTA 2WMJA 2BHUA 3PHAA 3W82A 1CECA 1NWSA 5I6SA 1UQZA 1IV8A 1JD7A 2X05A 2DSZA 5HOSA 3W27A 2D3NA 3GYCA 2WLYA 2ZX7A 5DT5A 1UG6A 2O92A 5DF0A 3BCDA 1ZBKA 2D0FA 3WIJA 3SUSA 1W91A 2ZUVA 4AW7A 1XV8A 4WKAA 4HA3A 2F18A 3NJ3A 1OSEA 1UWQA 5I24A 4WLCA 2DSUA 3A24A 1H0GA 2WC3A 1X1NA 2D3LA 3FXYA 1NOWA 1EXPA 1OGBA 3LPFA 4BZYA 2QLYA 1R8LA 3T0AA 4BS0A 3BAXA 1UWRA 3N17A 4J7RA 1K6AA 3N1AA 3AIRA 5GPRA 1VFFA 2OW7A 3T0DA 2WKLA 4GQRA 1HJSA 3LRKA 2YJQA 3WELA 1W3LA 4RE3A 1O7DC 1ODZA 3TONA 3A22A 3GNPA 1HJXA 3RILA 1J0HA 1E6RA 1VBUA 3BAIA 1BGGA 3AIQA 1E73M 2DH3A 1GHSA 2VCAA 3BUIA 3PZNA 1G01A 1DWIM 3WQ6A 1JFHA 3WD4A 1E0WA 3VGFA 1E3ZA 2WWDA 2O9PA 1FFRA 2D73A 4U2YA 3WEZA 4HPGA 1LG1A 3EBVA 3VMOA 3L4TA 1E0XA 4UFMA 3UESA 1CTNA 2XHYA 3PZOA 1M01A 3WH6A 2VT0A 2CETA 1C3FA 1UR2A 5GQBA 1GVIA 2ALWA 3O9NA 1AQ0A 1T0OA 4GO8A 1UOKA 2ZUWA 3NCOA 4YPJA 2IUZA 1S46A 5A6BD 1J01A 2ESCA 1DP0A 5AC5A 5A6KA 4AXNA 4OUEA 1UD3A 1UKQA 3RJXA 3II1A 4DO4A 3A21A 4Q7NA 3DX2A 3T2OA 3RM8A 1MQPA 3SCPA 3OGRA 3IANA 2E9LA 2EXOA 2F8QA 2OSYA 2BHYA 5A2BA 3M7SA 4S3KA 4BQ2A 1HKMA 4EK7A 2QMKA 4JCLA 2V5CA 3IK2A 4PUDA 2BV9A 4CD5A 5IDIA 3MUAA 3RM4A 4HZ7A 3CZ8A 5D4YA 2J7EA 2JALA 4W88A 4N42A 1UH2A 2NT1A 2QF8A 3HZ3A 1HKJA 4CN1A 4EE9A 5FOOA 1SFSA 3VDBA 2ZUNA 4ATWA 2YA0A 4PTWA 3WFZA 3D4ZA 3ALGA 3VMNA 1VEMA 1NP0A 1CPUA 2WVUA 3VD3A 3H53A 3BC9A 3DDGA 5A6MA 1OB0A 7A3HA 3K8MA 4B3KA 1J0KA 4NSBA 4ML4A 1PIFA 3WEOA 1W1TA 1QNOA 2CPUA 4NRRA 3VX0A 3W0KA 3DC0A 3AXHA 4QP0A 5JBFA 4J3TA 3VVGA 4D6GA 4EANA 4PSRA 1FA2A 1EH9A 4H2CA 1JI1A 2CHNA 1OM0A 5CSUA 3CHFA 1JDDA 3WDHA 2VMFA 5A6JA 4FNTA 4LYPA 3AFBA 4IPNB 2CBVA 3EMZA 1UA3A 2W67A 3HG2A 2WWCA 4PMXA 1QBAA 1XYFA 4OBRA 1NOFA 2B31A 1GONA 2RGMA 1B3ZA 2YIHA 1XYZA 1OGSA 2EEXA 3WY2A 4OZOA 1B3XA 1UKPA 1J0ZA 1GOOA 2DT3A 1RPKA 3BCFA 5JUVA 4L4PA 4HU0A 3DX3A 1EO7A 3TTSA 4LPCA 4D72A 4B16A 2DDXA 2W66A 2XG9A 1R34A 2PBOA 4FLRA 2ZIDA 4FNSA 1KR1A 3GXPA 4P7QA 2WBKA 2G8ZA 3A4AA 1BLIA 2VVNA 4U2ZA 3WNLA 1MFUA 4ACYA 4PMUA 4W86A 1MW0A 5A6BA 3VDHA 5D9MA 3GXMA 1H1NA 3H54A 4UFHA 3WH7A 1E6NA 1RH9A 3VGGA 4GI6A 5HDRA 4QLKA 2PWEA 3MUY1 3HJEA 1C92A 2IGTA 1WZKA 3VGDA 1ZB5A 4AZIA 3T2PA 3BVTA 1UA7A 3CLWA 2C0HA 2WCAA 3G6LA 4AZGA 1J18A 2XYLA 4P8XA 3WDPP 1KBBA 1MW1A 1W9DM 3VIPA 1KCLA 1GW1A 5ABGA 1E3XA 1NARA 3BUBA 4HA4A 2J79A 1VENA 3ZJKA 3NYDA 4H8VA 2VQTA 3OGVA 3CHDA 1GJUA 2QV4A 1CNVA 4DWSC 3CIVA 3AXIA 3FN9A 4CGTA 2CKSA 5A8OA 2XM1A 2J7FA 4MB3A 1UHVA 1V3KA 5KZ6A 2CBUA 2G3IA 5BXRA 2J4GA 1CXHA 3N11A 1VFOA 3IGUA 4NXSA 1PX4A 5A6AA 4D1IA 4D1JA 2BNJA 3OZPA 1M7XA 3VX1A 4D6CA 5ABFA 1NQ6A 3WY3A 2AAAA 4QDMA 3WQ8A 4V27A 3EJSA 3ARWA 2FH8A 2XGBA 4UNIA 4QFUA 5CZKA 4W84A 4PYSA 1JG9A 3RO8A 4NF7A 2VURA 4MB5A 2WKGA 2PC8A 5CPSA 1CEOA 2RGLA 3N9KA 1B9ZA 3ZSTA 3GDBA 1JYXA 1OIFA 4DO5A 1KBKA 4F9DA 5F7UA 4JCMA 3IAQA 4JHOA 2GJXB 3WL1A 3W37A 1QW9A 1M03A 4F79A 4U31A 4URIA 1XSKA 4WKFA 4CU8A 1B0IA 2EAEA 1W2VA 2Y5EA 3BUDA 2O9OA 5LA0A 2PBGA 4HOWA 5BRQA 1ZL1A 3MV01 5C8BB 1BQCA 3AOFA 2WHMA 5ECUA 1V6XA 3A4XA 3WUEA 1HVQA 1TVNA 1JF5A 4W7UA 1E40A 3CZGA 2TAAA 1MVYA 3KWXA 2GK1A 3WMCA 3LX9A 2VTFA 5TD4A 1JYNA 4WJXA 3UERA 3W25A 2ZX9A 1HIZA 1EO5A 4PMQA 4CKQA 3PTMA 1NH6A 1B1YA 1TG7A 1QI5A 3SCOA 2YBTA 1H09A 1CGVA 5FIPA 1VEPA 1PS3A 5IFPA 1QVBA 1TVPA 2JIWA 1GOIA 2YLLA 5CJ5A 3VIJA 1V02E 5D9PA 1C90A 4HTYA 4OGZA 1OGGA 4M56A 1JXJA 3AZSA 1E5NA 1VB9A 1B3YA 3GXNA 3MUIA 4OOUA 5ABFB 3AYRA 3WD1A 4PMYA 1ESWA 5A69A 3AS3A 3GXTA 4Z2JA 3WF4A 1BTCA 4W5UA 1B30A 3QOMA 1UKSA 2BVYA 3PTKA 2IXVA 3WD0A 2DEPA 5CXPA 1GNXA 2DH2A 4W93A 3DX1A 3WENA 1XD0A 3I3EA 3BLKA 3BVXA 1V0KA 1JZ7A 3FHAA 3KL5A 1PJ9A 2WXDM 3CV5A 4AD2A 2VUYA 1EDQA 2JEPA 3CBWA 1CGYA 4MNMA 1KXHA 3GZAA 4MB1A 4F8XA 5M03A 3GH7A 1KGXA 4JKMA 1Q6EA 4J28A 3CUJA 3DYOA 1PZ2A 4PMOA 3CPUA 3WDQA 4PMRA 2VRKA 2GDUA 3AIUA 1V3MA 1JFXA 4AEEA 5I23A 1QNQA 1W9PA 1GZJA 1H3GA 1H41A 1UKOA 3VUPA 1UWIA 1JZ6A 3B9AA 1X6LA 1JZ5A 4X0NA 4NZFA 3PZVA 4MJ4A 2FHFA 4MAZA 2WPGA 2ZWYA 1QX1A 1WCGA 1GQIA 4TUFA 1BYDA 3OA5A 1H0IA 2VJXA 2CIPA 3VSTA 1UWUA 4MNJA 4H8HA 1UUQA 3OIHA 2EJ1A 4A3YA 1JAKA 4AEFA 4PMZA 1YHTA 1EQCA 3DHUA 1UWTA 2VR4A 2Y24A 1XC6A 5BWFA 1EDTA 1QPKA 1J0YA 3WNNA 2D22A 2J7BA 1JF6A 4AYSA 3ZSSA 1R7AA 4XUYA 5A1AA 1BYCA 5JIPA 1WO2A 5D8WA 4DO6A 3AMCA 1O6IA 3QHOA 3ZJ8A 3GXIA 2XIBA 1D7FA 1NWUA 2FDMA 1HF6A 3OZOA 2BY2A 1BAGA 2DIEA 3GXFA 3OG2A 2QPUA 1V03A 4TOQA 5DEZA 5E0CA 2NT0A 4AZBA 2YA1A 1W2PA 2GJXA 5AYIA 5C71A 1DTUA 4DWSA 1ZBVA 2FH6A 1LLOA 4PMDA 1JDAA 1E6SM 4PN2A 2FGLA 1B3VA 8A3HA 3BVWA 1W9VA 3K4DA 5EB8A 2WHJA 1F4HA 3BMVA 5CLTA 1GQJA 3MSGA 1UD6A 2WMHA 1ITXA 2XVNA 4BCEA 4E2OA 3CHCA 1JZ3A 4DUVA 1CIUA 1V3HA 1JZ8A 1PX8A 1MW2A 4AIUA 2VCBA 2NW0A 1VJZA 1HL8A 4FNUA 2OYLA 2PWDA 3GH4A 3BAKA 3CZSA 2XN0A 4H7VA 1UH4A 3VILA 4FNRA 1KWGA 1HJVA 3MMDA 1EHAA 2VRJA 1JZ4A 2BVTA 1EQPA 2D23A 4FK9A 5JIWA 1BSIA 1BF2A 2WLZA 1E1FA 4MAVA 4JKKA 3VSUA 1EIBA 5GNZA 3ZO9A 1J9YA 3WMBA 1MWOA 1V08A 1GQKA 3W6MA 4J3UA 1KFWA 2V3FA 4W89A 3UG5A 1GUVA 1DWAM 2XIIA 3PZ9A 1JI2A 1ECEA 1CXLA 3WN6A 4ACZA 1I1WA 2VOTA 2VQUA 5HBFA 4M80A 4CN6A 4GZJA 3U5UA 2WMKA 2XVPA 2JEQA 1E9LA 3L4YA 2W91A 3AIWA 3SCVA 1C8XA 5CLWA 1ISYA 2ZOXA 1FH8A 2OWCA 4ATLA 2V38A 2EQDA 2XUCA 3QGVA 4DUXA 1LL4A 4OOZA 8CGTA 1UASA 3S5ZA 3AIVA 1V0NA 3K8LA 3RMEA 4ACZB 2DGAA 3IJ9A 1HVXA 4JL1A 1UZ4A 3MANA 1CGUA 1CXIA 3ARSA 2OW6A 5DFAA 2X2JA 4UTFA 4XZWA 1WB0A 1HJUA 4M81A 4U5IA 3RM9A 4B9ZA 1HXJA 4W8AA 2D20A 4ZE4A 2XJ7A 1CLVA 4OJYA 1FFQA 2GVYA 1JNDA 4U33A 3NDZA 3FW6A 1AQHA 4IISA 2D2OA 1JNEA 4PRWA 4AC1X 4W85A 2YL5A 3RDKA 1ZBWA 5IHSA 3MSDA 3KL3A 1I1XA 5BXTA 1OD8A 1QW8A 2BS9A 5E6YA 1XGZA 3W26A 1V6WA 3WQWA 2QMJA 5IXEA 5A8PA 3DHPA 3PN8A 1BFNA 2XFFA 3O2LA 1LG2A 4GO9A 3WNOA 1L8NA 2CYGA 2J7DA 3K4AA 2WNWA 4CD7A 3BSHA 3ARPA 3OLDA 1US3A 3CH9A 1VAHA 1H4PA 3F5LA 4MDOA 4TX8A 4J3VA 3HG5A 4NZJA 4UFKA 5FKYA 3ECQA 2FYVA 1J10A 1E6PA 3OGSA 4AZCA 4CU6A 5A3HA 2OLHA 3LXCA 3DECA 4NI3A 4HZ6A 3BLBA 1E43A 2X1IA 1TR1A 1E56A 3VINA 2AOSA 2VL4A 1CXEA 5A8QA 3WFLA 3S2CA 2ZUTA 1CGTA 5E6ZA 1AQMA 2A3EA 2ZICA 4ZENA 2J47A 1W3JA 5IHRA 4S3JA 4GQQA 3UG3A 2EO7A 4W5ZA 1V3IA 4J3SA 1WNOA 3UR7A 2ZX8A 3AMDA 3U57A 3ZT5A 4HU8A 2UWFA 1C91A 2VX7A 1W1VA 4DWSB 2VCCA 2WSPA 4D6DA 2XM2A 4YHGA 5D9OA 3EMQA 4PMVA 3PZQA 3VO0A 4AWEA 1QI4A 2ZX5A 1GHRA 4ZFMA 4UFLA 5AC4A 4GZEA 1CENA 3GBDA 3VDCA 3WSUA 1MYRA 1UR0A 1M53A 2VZUA 2YL6A 3K46A 4FF5A 5LYRA 2ZX6A 3VM5A 1HKIA 4BQ5A 1WP6A 3QR3A 3GTNA 1QI2A 1W3KA 1MQRA 3WBAA 3VD7A 4KRUA 4OIFA 4GKLA 3CZLA 7CGTA 3NSMA 4UFIA 2F61A 2BFGA 4AYGA 3ARTA 3VIFA 1SR0A 4B15A 3AHVA 1E1EA 3WMSA 2VZOA 4B3LA 3EJPA 4FMVA 3ZJ6A 1LL6A 3THDA 4UFJA 2VRQA 1K9FA 4JIEA
chains in the Genus database with same CATH superfamily
3OBAA 4ZO9A 1FHNA 4PRPA 3VI2A 3ZE0E 1QPOA 2BIIA 1TX2A 4PRNB 1FE8L 2CDEA 3O6ML 3DG7A 4XZ4A 3GSRB 4YUEL 3D3VE 3MO1A 2XWDA 4PJEE 5EUKA 4V28A 1V0MA 3OJVC 1TPEA 3LHPH 5D6CA 4WY7L 4EXPX 4I13B 5AVTB 2DOCA 3E2SA 4HA0A 5CBIA 1E1CB 2NUTA 3QEGH 4NZTL 5F44A 3ZKXC 3M4HA 4AMCA 3WSQH 4G6MH 3NSJA 3WK0A 1PBGA 3O9WC 4W6XB 4HT3A 4LKXA 2DT1A 4LEEA 4Y1TA 3NFUA 4C6NA 1XHGA 4PQXA 1X9UA 5AENA 2NZLA 2MMXA 5E09A 4AY1A 3VYOA 3N73A 4UTIA 2PLCA 4DWSD 4JRYE 4MYPA 3QXBA 4YHYC 2WMGA 1I45A 3OJGA 1FCVA 3TK7A 3ARED 4NERA 4PVNA 4MZ1A 1FWSA 4G8FA 1UUMA 3FMGH 4LESA 2QQKH 3RZCA 2V5KA 3W00A 5JU6A 1KLGB 2P80D 3QFDB 4LH8A 4JAWA 2JCWA 1I3GH 3K6SA 5HGDA 3Q65A 2OYMA 4OLXH 4PRHE 2VLRA 4U1IB 1PDYA 4FIQA 4FEIA 1XBYA 2C9XA 4P59L 4DEPB 1IGFH 1RIHH 2X89D 4TQ8A 4KHXH 4XZHA 2Q20A 1XRVA 2GJPA 1T1ZA 2YD9A 5M94B 1SF5A 2ITFA 1BVKB 2YAOA 3WY1A 5KOMC 3NCCB 1G6CA 4MTVA 3GB7B 4LL4A 3TNMB 2JMRA 4S23A 2RB8A 4AF0B 5F2GA 2GJ6B 1HNYA 5F1NA 4K8RH 1E4XL 5JHDD 4JX5A 2ZKMX 2R24A 3W7OA 4JCWA 2VJ0A 1RIVH 1AD0A 4X6BB 4YN3A 2WLMA 3EPMA 1DSWA 4HG4J 1XHHA 2CE6A 1EJ6A 2A1WH 2FFIA 2PF0A 4QRTA 1T83C 2EVHA 3FB6B 1UC6A 3QIBC 4BXSV 2Z0IA 1E28A 2MCPH 2L0DA 1A53A 4MA7H 3C60B 4OJFL 1RK5A 4PRIB 4B9YA 1RPUA 3LI1A 1PQZB 2CRMA 5FV2A 4DNHA 5KVGE 1CT5A 4Y7OC 1WKEA 4NRZA 5E99H 1AQKH 2DWTA 1VGKA 4MHHG 3TFCA 1HIML 1WV2A 4X5WA 2IG2L 1CWYA 4RZ5A 4F2ME 1NBCA 2VR5A 3VOGA 1QPPA 1AGEA 1WDAA 2PCPA 3R2GA 3PU7A 2SFPA 2WOQA 2DLEA 3BP6B 5T1LB 2XQYA 4X6FB 5HGGS 1JCVA 5SX4H 5T3ZE 2QKIC 3KPRA 1Q6RA 3VTRA 2Q02A 3H4WA 5T8GA 1UA6H 4AC7C 3QG7H 5EUOB 1PY4A 3E96A 3LOTA 1T03H 3ROLA 1E4MM 3CQJA 2O5XH 2YD6A 3DOSA 5DYOB 3S4SA 1MW3A 2ALAA 4U3CA 4NKOB 4QMEA 4HAGA 1MCCA 2H90A 3NGFA 4LCWE 3CX5K 5I9QB 3BPCA 1XGUA 3QA3A 2XWJA 3BPWA 5DO8A 2XKNA 1YXDA 3A4EA 3MRQB 3MP4A 4AG0A 4IRSC 2H3KA 2MWCA 1F6YA 4ETQA 2Y7OA 1HAWA 1HFBA 4CNIA 1UH3A 3O9WD 5BV7H 3LLDA 4PRBA 3P73B 4NUGL 4MY1A 2QSTA 5LHDA 3HR5A 2XGZA 3KYMB 5A95A 3H9ZA 2HWGA 5AWNH 1RJQA 5F2LA 1NEZA 1PLGL 2HNHA 2YCEA 4XZBA 3L1EA 2J66A 3BDYL 3IJIA 5DJDA 4S10A 2R1WB 3SBWC 4NENA 1RXOB 1CXKA 3DJZA 3HG0A 4RMTA 1SN0A 5EU6D 1GTHA 1X38A 5I6XB 2V5DA 3TVMD 2H0JA 1I9JL 2MCMA 2H9GB 5EU5A 1K9TA 1HWGB 4EN3D 2QUVA 2X4TB 1T0PB 3MB9A 5TPWL 2DLFH 3QWNA 5FYLH 3NOIA 4CU7A 3BAEL 4BFKA 4E0RB 3QZWA 1J6PA 3DC8A 4JQ4A 5FSDC 2R29L 3V95A 4AMXA 5I18H 3EWWA 2J8TA 4AX3A 2XETA 3QI9B 3EAKA 4K07A 3AY2A 1CFQB 2VLKB 3IMWA 4BELD 4MA3A 1TJGL 3GDCA 2O93L 2AL2B 4J5NA 4AXKA 4G5ZH 1FZMA 1YEYA 1TQBC 4FO4A 1AXIB 2R2BB 2I9UA 1XFCA 1UB3A 4Y1AE 1XLKA 2ZCHL 4EDWH 1H11A 2A9NL 2VDNL 3Q2VA 5AQ0A 2XSXA 5FFGA 1WDQA 2ZUQB 2X0VA 2YPVA 3M1OA 3LNMA 4IS6A 4MVAA 2CKBA 4A6YH 1XWVA 3DERA 1FPTH 1KPVB 5D1ZI 2VZTA 4CVUA 3PXLA 1XGQA 2WJEA 3W7KA 4C57C 2A83A 5G2NA 4H44C 4F58H 3ABOA 2X2IA 1HJWA 4LAJH 3DK0A 5FW8A 5CO1A 3SY0B 1GTEA 3HI1A 4AUJA 4I3SL 4EOWL 1D5BA 2OSLB 4C56A 3IGHX 1FVEB 1KNOA 4WO4B 3P30H 1I75A 2DJ4A 4ZUUA 3DVIA 3PZMA 4O57A 4RGNE 3IU3B 3RRAA 4HX1B 5A6LA 2ZRUA 3DVFA 1RSYA 2UXGA 3BUQA 4CD6A 3JYCA 1POKA 2NVAA 2BHZA 2AQ1A 1J87A 1FWNA 1UJ3C 1ZRQA 3QW4B 3V10A 3IDJA 5H37A 5DFVD 5FJIA 2NQ9A 4FHKA 1T0NA 3IMRA 2PB1A 4NFBA 3UZEC 1BJ1H 2A74C 2DDQH 2UYLA 1MHPH 2IKJA 5TE7H 3KBJA 1UXSA 3SRHA 4F66A 3PBUA 3GNNA 1CZ8H 2GY7B 4OFDA 3C09B 4GY4A 5JZ7C 4UQDA 1P2CB 1HS6A 3BXWA 1JN6B 2FPVA 4PUKA 3P1VA 3L5XH 2M83A 3NCWA 1NTDA 5LKYA 2DVTA 2V7HB 1LM1A 2C3ZA 5FK9A 1RQ5A 2OQHA 1T7XA 1YPZA 2QSCH 2W60A 1ZA3A 5MP6H 3N5AA 3BT2H 4ZNCD 1EERB 2EYSB 2KZ1B 4XD4A 5DS8B 2IPGA 3MRCB 1R3JA 3LQAL 2E59A 4M7ZB 2L5HA 2XFYA 2DPKA 2ROXA 4JEJA 4PUUA 1OSPH 4FXKA 4RE2A 4UR8A 3QUYB 4BCYA 1AJ7H 1NANH 4HXAL 1WDPA 3ZX1A 4K7VA 1MCLA 4N28A 4KK6C 1RUKL 3B3BA 5TQ0L 1CICD 1FLTX 2AXJA 2R1WA 2JCCA 1HTIA 2GQ9A 4YGAB 1DYZA 4EDXA 4P8VA 3AQYA 1LLZA 3ONBA 2QCEA 4U1HB 1VADA 3AQZA 4WENB 3S3PA 3VXUA 1PUDA 1UVQB 1A1NB 1TVDA 1E9YB 4XB3A 1FFNB 3CBRA 7PAZA 4ML9A 1HJBC 2HLFD 3M6DA 3V6OE 4DAGL 5M3WA 1J5OL 3OWEA 5J12B 1ZHLA 2YD8A 1J8KA 4W9KC 3FQYA 4ZG1A 1VLIA 4C6MA 3Q5OA 5BROA 2OZ4A 3ILPA 3NQCA 4POZD 1TIUA 2VLJA 5HPCA 4NN6B 1IT9L 2Y2WA 4YHML 3WKML 2VEPA 4AIZB 2JI3A 2WZEA 3L65A 5E8NA 1O1ZA 2G3XA 2YRBA 4QJ1A 2FQDA 3QWRA 2CESA 4X6DE 3U0HA 3B0VC 1FXPA 3N13A 1MHPL 4OJAA 3QFJE 2X10A 5KSBF 2FBJH 3B0YA 5JHDE 4D9QD 3QAZB 3GNML 4JY8A 3HMJG 2XN9E 43C9B 4LSVL 4B9IA 1CUOA 4Z2IA 1XR9A 2GBUA 1KMGA 3NABL 5C5YA 3FTXA 1RMFH 3EWBX 1CT8A 4WTWA 5D5MF 4YQXH 2G2NA 4QAMB 4Y2NA 1RAKA 1PVHA 2P0IA 2LT9A 3CFEA 4GBXD 3O63A 2BBFA 3TVAA 1UOZA 5HHMB 4DZ5A 4LXFA 1ME7A 3CWOX 4MNGE 1MZYA 5C0RL 5E6RB 4K68A 5EFFA 4AWTA 3G08B 2E9IA 2VD9A 4LNCA 1D5XB 4MF4A 2ZWZA 5IVXB 4HLZG 2H2PC 4HBKA 4KK9C 4GRLD 4CBPA 2A1YA 4AIOA 5HMFA 2EADA 1IQ8A 2ZE3A 3T6ZA 1ADQA 1E6ZA 2PN5A 4H9TA 5DZJA 5IJVB 5KVEL 1P4IH 3CMGA 3JWDH 3FU8A 1SXNA 1L9QA 3I6RA 2N7BA 4Y4FA 5IBUB 2J6EH 4FLSA 4L3FA 3UWVA 2E74C 4N5ED 1Q4WA 1QG3A 4QRAA 4AE1A 2X1SA 2M2DA 2XPKA 1XR9B 3ZVHA 3WE6B 4FKEA 5ABAA 3R12A 3C9NA 3IE4A 5DFTA 1QWNA 4LNVA 1J5TA 3FTGA 3CN1A 4HAKA 4N2GA 4WCJA 2DZAA 1R3HA 4GRLC 3CFCH 1DANT 2QUTA 4IIQA 5DBUA 3UWUA 2NYKA 4B50A 5IVXE 1V6VA 2W65B 5DJ6B 2VP8A 4B6ZA 4TVCA 4Y4HB 3EYPA 1RCYA 1EUNA 4KKBC 5H6HA 2J4WL 3I75A 1PKQA 3A23A 5CP3H 4GIRA 2NNXA 4LSSL 4AVIA 5I75B 5I0DA 4IBLT 5JHAA 2OP4L 5TE6L 2K7PA 1WYJA 2PW1A 3BW9B 3G5YB 2DWYA 3MV11 3LCXA 4I3SH 4OLWH 5A8GA 3JWNH 4MZ3A 4CC1A 4PRIE 4JL2A 4MAYA 3LXAA 3TWYA 3H0TA 4M9OA 4UCFA 1UP3A 4N6QA 3QFJB 4PRAA 3BN3B 3ZOAA 1UYWH 4D6HA 3INUL 4K3DH 2C7FA 1NZRA 1IAOA 3PP4L 2NXZB 3L95B 4YOKA 3SE4C 4R7OA 2C3GA 5GRZA 1KEGL 1HEZB 4Y5XC 1HWHB 4RFEA 2EG8A 3FNDA 5IUSA 2CLRA 4X4YB 4N5UA 3S83A 3G1HA 3L2IA 4LEXH 5JUEL 5BCAA 4RIRB 4WJKB 3GF8A 4ZMWA 5AVYB 5DMKB 3W1UA 4AKOA 1E6JL 4HPOH 3MBXH 2P5NA 1U58A 1IGML 1UA6L 2JELH 5DJ0A 3EF7A 2BRRL 4XX1G 1DORA 1EUUA 5EZJA 4XBSA 3AGWA 5C9WA 1G7LA 1OCCB 4LSUH 1MHCB 1UCBH 3CV2A 5C0ND 4M82A 5I73B 4JX6A 3GINA 2QJMA 3RCMA 3RX2A 4PCNA 3MA9H 3F4CA 3CMFA 4Y4KA 4W8LA 3O4LB 2X30A 4A3QA 3LQAC 2R2HA 1W0VA 2GQ3A 3P2VA 3HG4A 1N6UA 3QOKA 4JTUA 1Q0XH 4RR4A 5GJSH 2DSWA 4GOSA 1U3HB 1ZIBA 1FC1A 4UANA 1LF1A 1TA3B 4KZCA 4HMDA 3FFOA 2OTUA 4RFEB 4XPBL 2C9PA 1AXSB 3QJQB 4IKNA 4IKJA 2QGHA 3W88A 3CHEA 5TDPA 3HIJA 4N24A 3SCSA 1UWXH 3MLRL 4ORGA 3E2RA 4QDWA 5D93C 4B5ZA 4Z7WF 1ECQA 2JQZA 5KSVA 3NFSH 4ZAKB 1ISXA 4HOXA 3M1BA 4XHJD 4PRTA 1KV7A 2WVTA 1UEYA 1TTFA 4GYBA 5IG7B 1TTPA 2X1TA 3BWWA 5K9DA 5FYJH 4NM8L 4A38A 2EDNA 4HCDA 1S7RA 2XTJC 4A29A 1H5BA 4RGOH 2V2XA 4BSVB 4UZUA 3G8RA 1L9SA 2O72A 2ZXGA 3GSXA 1YYAA 5DFVC 2KL6A 3EGDA 3ZDXF 1TE6A 4K7PH 1TSRA 2QCCA 2CWRA 4JPIA 4C6EA 5JW5A 3PWNB 4NQCA 4KXBA 1IBFA 3R06B 3CFTA 3M07A 3TNNB 1A4KA 4DPBX 4ELMA 1ONEA 1TWWA 2EHHA 1T7VA 4M7SA 1R0MA 5ALBL 3M46A 2YXWA 3AYSA 4US6A 2DM2A 3HU7A 2BWDA 4FQHB 2CEQA 4B90A 4YE4H 3UYRL 1GQLA 3AS0A 1GVEA 5CJ8A 4QRRB 1DLHB 4UQEA 3U0PB 3GHBL 4DZ8B 1T89C 3FSOA 4WV1C 1MSPA 4AIXA 1KC5L 4JLRA 3KPOB 5AALA 3ALFA 3AHTA 4PS3A 4FFVD 4ICWA 5E99L 5TTRA 3ZHFA 1HZLA 1T41A 3SUVA 4N0FA 3SBPA 2O5YH 3T09A 3TZNA 4AZHA 2DQUH 2VN7A 3P0YL 5LBSA 5E1GA 4BFBD 5AB9A 5A8MA 3ZLFA 5LNVA 3K1DA 4S3AA 1NPJA 4JFUA 1WV7T 4BQ3A 3QJFB 1P1MA 2F7QA 1U8IB 1C8PA 1YW1A 3F5WA 4WWKB 2R51A 4NUWA 2VISA 4P8UA 3CFBA 4H8UA 1N8IA 1VIWA 1G7MA 3LOWA 3K6OA 4GQGA 3GYRA 1VBGA 3GM8A 3WD5H 4PJXA 1RI8A 4DT2A 2WO5A 4NC1C 2XA8L 3ZIMA 4N9DA 5LXXA 1AZRA 4LUJA 3ARDB 1OLLA 2J3SA 1W9BM 4IIBA 4M19A 4MADA 3MREB 1DFBL 1J11A 3FS9A 1FFOB 1M56B 5C0GA 3V0IA 3ULVH 3DGDA 3CHPA 3OLIA 3LHZA 1B3OA 3S4SG 3TJHD 2IADA 5FUCE 4E68A 4XNMB 4ALAH 4YLWA 4WCYH 1G9NC 3LS5H 2FKPA 1R30A 2Z7WA 1NIBA 2QCHA 3PM6A 4X7DC 3V6ZA 1TWSA 1ZV9A 1N6VA 5FA4A 5I3JA 1DQTA 3VFTB 3NH7H 1O94A 3H6OA 5J13C 5DK2B 1MXSA 4FNPA 3NSXA 2AV7A 2BIMA 5G5IA 1S2VA 1N5AB 1HKWA 1A4JA 2XICA 4MPKA 3TJIA 4M6PA 5I00A 3SJ3A 3MLSH 4RL3A 3T3MF 2YCKX 2IOMA 2A6KB 1ZA3B 4RWHA 3VXRE 3LQGA 1WIOA 4FLOA 1HKFA 2CHZA 3KGTA 4EIVA 1NLBH 8FABA 2CLMA 1H7WA 2VABB 3CE1A 4RPPA 1CU4L 3SZ8A 5AB3A 1AW2A 2ED7A 4NZ4A 2GSEA 4XGZA 3SBWA 3GMOB 3SE8H 1M1SA 5EDXA 1QWUA 4PWKA 3IGAA 4AGMA 1R7OA 3W7IA 2OMZA 3GRGA 4PS8A 2JCCB 3WO4C 3WTWA 4GQZA 2P49B 2KLRA 4HULB 1V3JA 1IARB 4Y90A 1IJNA 5T33H 4XD3A 3ANVA 1IT0A 3A3HA 1M71B 1HE8A 3QORB 2R1NA 3RUGE 3T6XA 4ZFQA 4Z42C 2Y88A 4O4WA 4LSPL 15C8L 1DSYA 1DUYA 4LB4A 4YHPB 4CCEA 4U4IA 4OZFH 5ESAA 2FSEB 4M6NH 4WO4D 5J6HA 1XXXA 2ZKWA 3B5TA 1T66C 5FWQA 4YTQA 3T4CA 3UNDA 2HTKD 4HX1A 2BNQE 3CXDL 3G22A 3I9IA 3P2BA 4KHTH 5I8CB 4GG6F 1ZLEA 2PGFA 2ZTBA 5E70A 5E2WH 2Y5SA 5TQLA 3LBOA 4OQ1A 4O58H 4DZ8A 3FONB 3IFOB 4XPAH 1DBAL 1JWMA 1ADSA 2V3GA 3AYVA 5LCVL 3TURA 3WJSA 2A77H 3X1EA 1UYWL 5T5NG 1EZVY 5SV4A 3ZYZA 5BUAA 1O7VA 3C5QA 3WQPA 1VYSX 4IQEA 2WSYA 4IX2A 3ZIZA 4EXBA 1KTLA 1E4IA 5I74C 3DG6A 5AY7A 4K5PA 3VWJD 3ZQ9A 1RULL 4L4VD 5I1LB 5E5MB 2JF6A 3EWZA 1QABA 4EE2A 3CUPB 3VD1A 6PTDA 3QQ4A 4R83A 4FA6A 1U8QA 3DKJA 1OTUC 4PJHB 3AHXA 1GS7A 2EECA 5IB5B 1XGEA 1NDMB 5GGTH 5B38B 5HSFA 4AEOA 3B97A 4H0HB 5E2JA 5E0FA 4HJTA 1ZVYA 1OGPA 4MJIA 1RJPA 1UYQA 1TR7A 2WSQA 4FSAA 4M24A 1DZBA 3KDMB 3VIHA 1DBTA 1IM9B 5ICYB 3SUTA 4JFSA 5C6TL 3N40P 1KXVC 4K9EC 3AQUA 2OL3A 1IGIL 4LCVA 3BLLA 3LHVA 4G9FA 4GUHA 4P0DA 1OAXL 4IMEA 5MENE 1XR8B 4PCTA 3M0MA 5CAKA 4M93B 2NWRA 1PKOA 3TZVC 2CNCA 4QCFA 1L2QA 1PS9A 5EU6B 4YX2L 4WEBH 3V6FA 4MJZA 1EAOA 2YKKA 4NKIH 3NPUA 3BP4B 4EIUA 3FKRA 5DQPA 2NLJA 5KWYC 3V6ZB 2GJLA 4G42B 2I5IA 1JNLH 4FFYL 1SY6H 3DETC 3WFEH 4QLJA 3LY0A 5KYUA 2C9RA 3HZVB 4ISVB 4KMTL 5D1QA 4FTVD 3RIKA 2IBZX 4HCRL 1PAMA 3JVAA 1JGVL 2WO3B 3M5XA 1N5YH 4QLLA 1EDHA 3UO1H 4PGCB 4KKCC 3ULUF 1AFVL 3BGJA 1SLUA 1ISWA 4K3EL 4O54A 2XZAL 3L4XA 3VE0A 3LBCA 3P0YH 3LBMA 4EWND 4JXCA 3ARGA 3TFBA 3N2BA 3NZ8A 3K8KA 1R5IB 2K1MA 3M86A 1WT5A 1KXQE 1UT2A 1IAKB 2VLLB 1KFKA 2J77A 4NL1A 4HIIA 4N90D 2HWZH 2EE9A 4LLUB 4PJ7F 1BZ9A 2ZWKA 2X4OB 5E1HB 4DKTA 4F15B 3TTYA 2LLLA 3VIIA 2PGWA 2IAMA 4M7JH 1ZK9A 4UYQA 4HWBH 3EJRA 3QFJA 1IGMH 4Z95L 1F7BA 2E25A 4P46C 3GG0A 1I1RA 1XZWA 1Z2KA 1GC1L 3CG8A 32C2A 4DEUA 3GZPA 2Y8VA 4XNXL 3FVMA 4NUJB 1U8OB 2H9AB 4Y16D 3EOEA 3Q6FA 5GRVL 3GBEA 1CLOL 3I68A 5T5NF 4A1RA 1AHWB 1IT9H 1W9XA 3MJGX 4YDJA 3GGWB 1S3HA 2YLAA 4YXHL 1UR4A 3C60D 3TPUA 2V37A 3OAYH 4WQOA 5DQDL 5IROA 3WIHA 4ODHL 4K3JH 2R0LH 2INFA 1K8IB 2VVSA 2MCPL 4KV5E 2GQAA 1ZVSB 3L4VA 4KBXA 5FEPA 3ARUA 2C3VA 2EYTA 2XWRA 4GUFA 1S7UB 3QTPA 5K5YA 1QOPA 2X44D 4LLWA 2X0SA 2OSXA 1HHGA 2YWYA 1F76A 1CYGA 3MLZL 1LQSR 1QRNB 3PDGA 4GG8A 1HXKA 3KL0A 1GVRA 2J1KA 4XC3L 3K2UL 1UURA 4HWZA 5E8PA 4JRXA 3TR2A 3NK4A 3WFDH 3HPZA 3BQUC 4KS0A 4HC1H 1CFSB 4NCC2 2GITB 3H9SB 4L1WA 3QEQD 3ORWA 1QA9A 4WU5A 3W6LA 4QXVA 5C6TH 4Q8QA 1YECH 4AV5A 1YDOA 1YLBB 2G4EA 4GI4A 4PJXB 1GG0A 2H1XA 4KJPC 2FIQA 1B2WH 1MI3A 1A5NC 3SCUA 3D87B 4YHLH 1A6WL 2DKUA 1KM1A 3UIZA 1BQHB 4X6DA 2H32H 3WH8A 4PBXA 2I07A 1ZVSA 1NINA 1YNPA 4DLMA 3S88H 4GAGL 2AJ3A 1WWBX 3MCLH 3BGAA 3NVQA 4Q6IA 2WBJB 2OK0H 4AJVA 3F5KA 4ZTYA 5FUZH 1JCTA 1AANA 1DVFA 4DXKA 2XWXA 4TXVB 1Q6DA 4CVXB 3QUHA 2NNRA 2QDDA 4QTHA 4C1LA 3HLAB 1JWUB 3IE9A 4XAFA 2PTDA 3LCHA 3ATZA 2Z1SA 1ND0A 5L4IA 1HXYB 2CITA 1CZ1A 1RLCL 5DD1H 3U36B 4ABVA 2EXTA 1JPKA 3UPCA 5B39G 1N82A 2AQ3A 5IQLA 3W7MA 4A2HA 4JFVA 2X9ZA 1IGWA 1ITCA 2IPTL 3VNYA 4NN5C 5AZ2H 1JYWA 2E8ZA 4GXFA 3QW9A 2PUZA 1HP4A 4L9YA 2FJUB 4QTIH 4L0PB 5IQOA 3GDTA 5CPOA 2XV3A 5JDJA 4CADB 1BPLB 3WQFA 2CH8A 4ZXBB 4UQCA 3CNYA 4KRMB 1W0YT 4CGUB 2BWIA 1RP9A 4YBLC 4MNLA 4ONVA 2ZKHL 1ZRUA 2ZCLH 5A40E 4ODSL 2P80A 2VZSA 3HAEH 1E6OL 1OE1A 2IDFA 4XNQB 3U25A 1FPTL 1WVZA 2EEDA 4KROB 3OBKA 2J4WH 3KWWB 1NKGA 3A4DA 3T8XA 2PETA 4IRZA 3GZKA 2R1XB 4AM0A 2X6CA 4N85A 2HX8A 3LMJL 4HB7A 1THFD 1GYLA 5JPMB 2VEGA 3GRWA 2QKSA 3VIGA 2YBUA 4ZXOA 4H41A 4ZMGA 4LKCB 4PJGF 3FGCA 5DMKA 4N2FA 5KETA 5LQBH 2CDFA 2DQJH 5T9BG 2ISSA 2MSPA 1TJGH 4EPKA 5CCKH 2EDMA 1LMKA 2YEQA 1YEGH 2J2ZB 3QHTC 1X8FA 4LSBA 4CD4A 4LDCA 3UBXG 4XAZA 5DS1A 1T7ZA 2Z91B 3RLHA 4KTEL 1RURL 3CC5B 3BN9C 3MI6A 1H0DB 4KI5F 3CO8A 5CBEA 4PUMA 4B5EA 1S9YB 4ZMNA 4BQBA 4MD0B 1I9JH 3ULVE 2KX9A 2QGEA 4JYFA 3O3BA 3VKKA 2PYED 4KVPA 4M8RA 3K2GA 3TJEL 5FWRA 1OEPA 3ZE2F 3F7VA 2POZA 3PDOA 2FDSA 3HMXA 5AWNL 1DN2A 1Y18A 3MNDA 4QJ4B 4W7WA 1F2XK 1PBYA 4ANVA 1A3HA 1KB5H 3IU4L 4ZS6D 4F7TA 5KSAB 2XKUA 3L1OL 2ADGA 5FUOL 5ICYA 4YQXL 4NJHA 3GJFB 5HBBA 3BEWA 5MP6L 4AZ5A 3MKVA 5AAMC 1FBIL 1GORA 1NCOA 1HUVA 1Q6OA 1NGQH 1WBXA 4J4KA 5F96H 4BFGA 4PJDA 4E9RA 1R2SA 1NCGA 3GMQA 5JDSB 1TPFA 2MHAA 4N3TA 4KO5A 4NQEB 4WDIA 5J5EA 1HTYA 1EIXA 1YADA 1FHLA 2RJGA 4XNAA 5ABDE 4JICA 4O18A 4O15A 1JWSB 3RR4A 5GS1A 5KSAC 3ES7A 3UAEA 3Q06A 1FNSH 4IU3A 3V7MA 2XWBB 3EYSH 3MRNA 3SDXF 3NPXA 2LE9A 4G8GD 3KTSA 3ASWA 1NKRA 1MCIA 4M3HA 3TVMA 4TF4A 3KP1A 4KTDH 1RY7B 1BFOA 5HI4C 3FN3A 5I77A 1LJYA 4EVNA 1J5OH 2XNAB 4LBUA 3SGDH 2KC0A 4V1XA 5EF0A 4O1CA 1TJHL 3MV7D 2VDPL 3QNXA 4ODTH 1PTZA 4TVPL 4IGBA 5HVHC 2AXGA 3CFUA 1RL1A 1TQBB 3LN4B 5HQLA 1G0CA 1HQTA 2PDQA 2FE0A 4AYFA 1LOLA 5B7FA 4AISA 3STZB 1W37A 2PDKA 1FZMB 5FCZA 2K4AA 5D2NC 1I9CB 2V6AA 1K1DA 5I6NA 4JBSA 1MXGA 1A1OA 6TAAA 3S35X 4G8GB 3A3YB 1CL7H 1CDUA 3FO9B 3HR6A 5DWUH 5JOPE 3HZMA 5DC2A 4EEEA 4OJDH 4R90H 1IC1A 1H3VA 4BSVA 1XCXA 2DT2A 2DKSA 3E2VA 4WIWA 3WQ5A 1KG0A 3NSNA 5IBUG 4MJ6A 3K3QA 2NPLX 3LN9A 4ZNEA 1TCDA 4ZSOA 2AV7B 1K9EA 2BVOA 2NUXA 4NZ5A 1RK1A 4K3JL 4F37K 1CX9A 3QORC 1TREA 1FGNH 2GUUA 4RUBA 4HKZB 5KYWB 4O1FA 3SQMA 4Z3EA 2YSSA 1DDTA 1OGTA 4PJEA 5F9AC 4QGTA 3LXBA 5C07B 5HGHB 4XUGA 5HNNA 1JR1A 2AXGB 3LN4A 1SVDA 2R23B 2AL1A 2DYPD 1FZKA 2X1PA 4XNMA 1A6TA 1SXZA 1TCMA 1XR8A 5F9OH 3MHFA 4JY5H 4LYQA 4LU5L 2WYIA 5I3IA 1VPOL 2ADAA 6FABL 2ADIA 2WBWB 2IO5A 5DZPA 4RCAA 4D2JA 1OARL 4HWUA 1NUNB 3EX1A 2FAUA 3KLHC 2N3JA 3TCSA 5D7JA 4MCNA 5HHNA 2PCEA 3UTSE 1LQ0A 1LEGB 1E6JH 4L23A 3B05A 3OIXA 5HWMA 4UV4H 2Q6WB 1OFRA 3VIMA 1DQLL 3D07A 4OQTA 3H21A 3UR2A 3BDYH 3VCRA 5HHOA 1VCAA 3PFRA 3EYVB 5HI3D 4U6TA 4XX5A 2IMRA 5I78A 6CGTA 4C7FA 2NY5L 1TUXA 2MNRA 1VR6A 5D9SA 1EJSC 3CVIL 4RX4D 4AIEA 1QNZH 1FP8A 3FIGA 2ZQKA 2FD6L 4RRPG 4Y9FA 5GGSA 2OSWA 3RTQA 3SKJH 3H2WA 1OCQA 1QU4A 5EOQL 1A7PL 2JKPA 4K6AA 1QBLL 4HU4A 3G0SA 4TVPE 3C5SA 4AYBA 4JZ5A 4JFFB 1QRKA 1HL4A 1G69A 1AO7B 3D2TA 2PDWA 1HQ4A 4L8CA 4JX4A 3EDDA 5DTFA 2ORBL 1DEDA 4KU1A 2B14A 1J0JA 1N4XH 2EIEA 4QJ5B 2ICWI 1MI5D 1AIZA 2ERJC 3EFOA 3LS4H 3CV7A 4KGLA 1F3DH 3S8HA 3UL4A 4FFZH 2RQ8A 5INDB 4FQXB 5D7JD 1DUYB 1LTXA 3RHWF 2QELA 2F2HA 1OJXA 4DRSA 2EO1A 2HKFL 5IM7B 5CGQA 3W71A 2C13A 2ZA3A 4WJG3 2PLKA 4KO6A 4ICNA 5JXED 3TO4B 1JGIA 1BLNA 1NGZB 2PKDA 4WAFA 1XQ4A 4MWFB 1FVPA 2F84A 3E2QA 3T0BA 1TJHH 4QRBA 4TVPH 3TH2T 2C9UA 2UVFA 2QDEA 2F6UA 4AX6A 4OUOA 5A16A 2SODB 4R4FL 3WDRA 3SIKA 1ACYH 3U6RA 3ULSA 3QNXB 3QP3A 2W6RA 3P8JA 3F65A 2XWTA 3ZKQD 5F3HB 5FS5A 1OYCA 4XNDA 5FECA 2AHIA 3MXWL 3MZ2A 3DX5A 3WDJA 5CJNA 1AS7A 4JRYD 3W38A 3O6CA 1V7MH 1FN4A 1SLXA 4OM1H 4PS4L 3L3IA 2B7DT 3ZE0B 1PIIA 2I7GA 4K15A 5IJDC 1ET8A 3D0CA 1G5GA 3C0SA 1WAEA 3NTYA 2E6FA 3T07A 2DWDA 1HWWA 4X5QA 2OYKA 2YZ8A 1FH7A 1BWLA 4ACTA 4PRPD 1WC7A 3PJLA 3VAEA 1XUZA 5TF1H 4UOJA 3MTXA 5T8IA 3VKDA 2R9HD 3EDFA 3GK8H 3KLQA 4KY1L 4F8NA 4KKBD 2EUZA 4X7FC 5LCVH 2OA9A 1YXYA 2ONEA 3MBDA 3SKJL 4PC8A 3QXVA 4M6ML 3WNKA 4UB0H 1MNZA 1U91B 3C87A 3UXAA 5H35B 3H2MA 5CHNA 3DTXB 5C0CA 1D5XA 3QAQA 1ZPTA 4R9OA 3EYQD 3RZCD 2YB4A 4FOKA 3FQWB 1I85C 3B9KC 5BXFB 1OP9A 2PPAA 3SYPA 4JEQA 3C2AL 3T71A 4WFED 4EN3B 4BFAA 1JJUA 2QQKL 3ZHNA 5IESH 2FJGA 1I7RB 3UBGA 3AUOA 3GIZH 4PCKA 2W79A 4DPPA 5AD0B 2VX5A 4EF9A 2ZRZA 2ALRA 1ZT1B 2VC5A 3I6TA 3MACH 1D7DA 4HIEA 4AY0A 5KTEL 4CVXA 1AD9B 1ECZA 3DI2B 3FHEA 3OGOE 3U4AA 2R1KA 2CJTA 3K13A 3R7QA 3MR9A 3QDGB 5CILL 2LR4A 2W94A 2XFWA 1P6AB 1MZZA 3AABA 3MJYA 1A7BA 1IAMA 3GVWA 3W7NA 3GU9A 4G7YL 2WP3O 1BRLA 3BD5A 5LGYA 3EH4B 3PL6A 5KANG 4RZBA 3CSFA 1ZBCA 2ITDA 3MHGA 2LU7A 1ZSDA 3WQVA 1UM6H 3BGGA 4IFKB 2ARJB 2J1ZA 4M7KL 4E9WA 1LVEA 2P43B 2A1WL 4E5XB 2P3ZA 3MRKA 2GTZA 4LSQL 5I1JL 3IJ8A 2Y7QB 3UZZA 3MLVL 4YC2C 3QDHA 2V9DA 4TO8A 1F8TL 2W88A 2GFBB 4XXDA 4LAQL 2EVFA 1MCJA 3L3KB 4AK2A 1AQ8A 4G8AC 3M8OH 2CLZB 4PJCB 1X7QB 4M7LH 1QUMA 2VR6A 4TQIA 2Q10A 2D7TH 2PDHA 4FQXA 5C1MB 3H7LA 4XH2B 4O02L 1ZTVA 3OVPA 4GNVA 1QRNA 3L9EA 5IEKB 3CN2A 2RCSL 5DYOA 3S4SB 3WLQA 5CAHA 4LV4A 1F4WL 3ISIX 2OWWA 1SM3H 2ATMA 4OLZH 4IIGA 4OLUL 1C8QA 3PWPB 4PMNA 4PFHA 2WCPA 1ITQA 3BG9A 1X5KA 3EA3A 3V0GA 1E0TA 3SADA 1SSGA 5J1AB 1TU2A 2G4GA 4GXUN 2HISA 3U2OA 1GS6X 2JXMA 4W9CC 1KB3A 3IXAA 2TSAA 2W9MA 4G11A 1EFZA 3RFZC 1W8NA 2APBA 3STBA 3VTTA 2V33A 5H94A 3C61A 1PSKH 2YBVA 25C8H 4KJQD 2XBTA 3DV4B 2XXCB 1J1PL 3JV6A 4GINA 4Z7VF 4PJCE 5GRJH 3S9DB 4L64A 1XGYL 1PEWA 4GRWB 3D39D 3WKYA 3ISWA 5LGJA 4F9JA 1U3JA 2OM5A 1RD6A 2FQFA 2AQNA 2DBLH 3WD2A 1WH0A 3RWJB 2ARJQ 1T21B 4Y4HC 3BHBA 1NSNH 2DWEA 1O7AA 1TPH1 2A7NA 4JFXA 1A6WH 3I10A 1TMCB 1M71A 1UGKA 2DYRB 3VM7A 5KEZA 1A3QA 1KY7A 4JVWA 2J25A 2SEBA 5BVJA 3NQGA 3URNA 1ZGLA 4MXQC 4QPEA 2VYRE 4NDMA 4ONHA 4XNYH 2BHUA 3GU2A 1C08B 2KDGA 3OG4B 2L04A 3THQA 3UYRH 4A8RA 2FECI 4GP4B 1E4HA 4XMWA 3PHAA 3MT1A 4OCMC 1E9PA 2J72A 5IVOA 1CECA 1NWSA 1XIJA 1UQZA 1M3IA 4HUCA 3KYKL 2CO2A 1ORSA 2DBJA 4BUHA 3ATFA 3CH1A 3GKWH 4Z7AA 3CQQA 5IB2B 1OC7A 3N9RA 4M7LT 3VZYA 2ZVRA 3D2UD 2O7SA 2XRAH 4I9XA 4X98B 1JK8B 3OKNB 5EBWA 3O6YX 3R8RA 1W8OA 3UYCA 3C4UA 2DAVA 4KY2A 3TCEA 1UG6A 3G1SA 4PCYA 5IZ7A 5DF0A 4XVEA 2FX9L 2J8UF 4JRXE 4QUOA 1ZBKA 2WTPA 4NNXA 4HJGA 1XIIA 5AOJA 1EPFA 1X96A 3OYXA 3SUSA 3DH7A 3S9YA 2A9DA 3OQEA 2ITEA 1J48A 3S3GA 4KJQC 1XV8A 2DL2A 4AW7A 3VNJA 1KF9B 1JE6A 3QAZC 3VUSA 4A35A 1IGYB 4HJJL 1WXZA 5IFJA 3FL7A 3S5LB 1H9DA 1M7DA 4ZFFA 2HKFH 5I6KA 4WLCA 2QGBA 1MRCH 3NR0A 5CCJA 1H3TA 1SYVA 3A24A 3LKRB 1C8VA 1H0GA 3UTSA 4QRPD 1JVNA 2HFEB 3FXYA 3SD2A 5A2JH 4RZ6A 2QCMA 3V4UL 1GYAA 4XPTL 1NOWA 1OGBA 2VXNA 4BZYA 5TAOA 2CLFA 2UWEB 4L65A 4NQCE 3ZO0A 1O5KA 3AY4C 5D7KD 3THML 4XE0A 3KMDA 1UWRA 3VFPB 4GIYA 3WLMA 3CHXA 4HH9A 3Q1EA 4OLVL 3ICJA 5DEGA 4NAQA 2CWNA 3WN5C 1L0QA 4Q9CA 3WFAA 3F4DA 1IRAY 2QIWA 1BPVA 1PG7L 3KPRD 3NJHA 3P73A 3UD6A 4A22A 3LB0A 3GJFA 3AIRA 2OR9H 3UDWA 4JLRB 4ILDA 4FS9A 4IIHA 4C6IA 1HJSA 4YDIL 4R7DA 1W3LA 1KT2B 4YDNA 4PJAB 3RY6A 4YWIA 4N22A 3S42A 1SF3A 5E2UH 4HIXL 1ODZA 1HGYA 3TMQA 3QDMA 5E6IB 1W0WB 5JQHC 1CVRA 3QUMA 4F0KA 3N91A 1OZQA 3G1FA 1F2QA 2JB6B 4OUIA 1E6RA 1EJTC 4MMZC 2BH0A 4IGBC 3EO9H 4Z7OB 1A4MA 4K2SA 2DS4A 4FDWA 4L4MA 4XN5A 4BINA 4W9ZA 2G95A 4GIOA 3HPJB 1I7TB 1WIUA 3ZL2A 1R9XA 3R1ZA 5HPMB 4WHDA 3VWJA 3V4PB 5AYXA 1IKOP 1RUQL 3MGTB 3SE8L 4WRHA 3PZNA 2V5YA 1G01A 3WQ6A 1KN4H 4ZAKC 3W74A 1E0WA 1FFOA 1KNOB 5C0GB 3W83A 2WWDA 3ZIYA 2OKOA 5FYKH 4ZAKA 3RTQD 2I27N 3QXWA 1FFRA 1E9PB 1LHZA 5IOBA 4UMCA 4AH7A 2ZKYA 2V9QA 1RKRA 1KJMA 4C83B 5ICZA 2Z91A 3VMOA 4UUIA 1KPVA 2LLEA 2LV4A 4QRSA 3QEUB 2YC1A 3U46A 2JTDA 3QUMB 2BNRA 2I5QA 2WQUA 2YAHA 3LVEA 4RMSA 2Q86B 3ULUD 1AJ2A 1H7RA 1RV6X 2XNAA 4Y2OA 1M01A 1G6RB 2JFCA 5I1EH 2CETA 4PLKC 4NQSB 2IWGA 4UBPC 1UR2A 4N2HA 4WW1B 3MRBB 1F3WA 3VI4F 3K74B 5F9WB 4GO8A 1U41A 3K2KA 3ABRA 3CHRA 4PW4A 1SM3L 4X7SL 2P48B 1R3KB 1KTNA 3NCOA 4AZCA 2UX7A 1BM3H 1D9KB 1BVKA 2ZSVA 3TEZA 2EXWD 3K91A 1M05A 1DBBL 2GQHA 1NCDH 4GRWE 4XOEA 1Y65A 2RKXA 3RX3A 3A6BL 1P6FA 2YAMA 5IK3A 1J01A 1RUML 1T1WB 1JPMA 3HB3C 4WDUA 5LG6A 3ABMB 5LBSL 3FPYA 3UFIA 3B06A 2MHAB 1GGIL 1YY9C 3NJMA 1ZLWK 4DP2X 5KVMC 4IOFC 5A6KA 5LKNA 2VMCA 4OUEA 4DNLA 1FI8C 1OTUD 3ABZA 4PM1A 3OR7A 3D5OF 3NDOA 3A21A 3ILQD 1I8LA 2OBGA 1YY8B 3SY8A 2Q8BH 3QCVH 3P60A 3FJTA 4IBYA 3SCPA 1K6WA 5A7EA 3IANA 3OGRA 2F8QA 4AQEB 1HXYA 3N2TA 1A9BA 1TZOA 2A6DB 3C6LA 2R4SH 4AE0A 1ODAA 1J1PH 5F97E 1URZA 5L0QB 2BHYA 2EDTA 4XP4H 1QBMH 1SO5A 1G1CA 4M5YH 1HKMA 1IFRA 4LCYA 2QMKA 4JCLA 1RJYA 2BFVH 1E9OB 2VW4A 4FS0A 2E56A 5A2FA 3IK2A 1FE8H 3O6MH 7PCYA 2BV9A 4GW5B 1SY6L 3PS7A 5DELA 3PG8A 5IDIA 3TV3H 5IFHH 3FV9A 1NCJA 4Q7DA 1A80A 1WUFA 3HQNA 3RM4A 3W2UA 1E2ZA 3UJJH 4GJJA 5ILTL 2O6DA 5CEWA 4PGZA 2NNAB 4PB9H 3KJ6L 4JFDB 5D4YA 2B3RA 5F4XA 3THAA 4AHOA 4Q7IA 3O41B 4PMFA 2GL5A 2XTJE 4NQEE 4E4FA 2JALA 4KTEH 4Y16C 2A85A 4BIKA 4PUBL 5D02A 4K1GA 2NQ5A 1I7TA 3RAJH 4TM9A 4AM0B 1E2WA 4ADUA 1CTMA 2BM3A 4IG2A 2E9WA 2GITA 3H9SA 4ATWA 3F7LA 4P2OC 3APYA 4HF5H 4L4TD 1BXUA 3S36H 3ZZSA 2JKEA 3VWKD 1VEMA 1A0EA 3KPQB 1EUTA 2WVUA 3H22A 5CEZL 2V5LA 5BU9A 3BC9A 3PJNA 4LC6A 2XG5A 1PKMA 4B92A 1KGJA 1GVSA 3BZFB 1OB0A 4Z0BL 3V6OC 3K8MA 1A6VH 4JDEA 1J0KA 4UQ2A 4NSBA 5HYQB 3VKBA 4DGYL 1AOHA 3WEOA 1SZFA 1MFBH 3RWFB 2CPUA 2DB8A 3SE4A 4NRRA 2BVPA 4M5TA 4WKZA 3VX0A 5GS2D 4RQQB 3HJZA 4I18A 2NX1A 5LAXB 3RU6A 3TW6A 4S2CA 5FA5A 1WC7B 2ZCZA 1SHSA 2GC4C 1HHHA 3NPSB 3WTYA 1FA2A 5F89B 2OR8A 4LSUL 5C0EA 4HV8A 2CHNA 1A4LA 2OFQA 2ZOWA 1TFHA 3PV7A 1C5CL 2WZ0A 3E8UL 3CHFA 3G0XA 3RZWA 3N6HA 2NUPA 3CU1A 2VMFA 3EB4A 1UWGH 3FJ4A 5HMEA 1A1MA 5D04C 4YWGL 3HPAA 5HANA 3GJEA 3ANYA 3EG9B 3AFBA 2O0TA 5E8EA 5BRZA 4UTAL 5DMIL 5IFJB 1DBKH 4AIZA 2W67A 4QM1A 4A05A 1LE5A 3ATEA 3DMMB 5I82A 3W70A 3C8KA 4DK6A 3QIBD 2P4AB 3RIFF 5JQ6L 4BY3A 1NOFA 3VH8A 2I5YH 2FVKA 1JK9B 2B31A 3DENA 3H4GA 1UZGA 3EA1A 2OJZH 2R82A 4C5YA 4Y6GA 1TEYA 3BP4A 1HXMA 4NY2A 1UWYA 3VWKC 3LAFA 4MQXC 3WY2A 4AV0A 2X7VA 1QHQA 3PP7A 1GOOA 3RHGA 5SWUA 5JUVA 1AGFA 3AT0A 4L4PA 3V5DA 8PAZA 4OGYL 4AY7A 5CEZH 3DV6B 1GMEA 3Q8EA 4MMYB 4FG0A 5BXFA 4NU7A 4K8RD 1LP6A 3UPRB 3IPFA 1WQ5A 1M2OA 4CW1A 5AHEA 3DX3A 1XDTT 2XZQL 1T8XA 4FZ8L 3KPSB 1AJZA 1EO7A 4IDJL 1YPFA 4YFEA 3RP1A 2EG7A 3UXIA 5IVXA 3IDGB 2XG9A 4X42A 5EA0H 1PXGA 2ZIDA 5T3XE 3QWOB 3RNKB 5DHVA 1YMMA 5CKSA 2QEJA 4LCCB 2PO6D 3PQYA 4BQ6A 4H0GA 3U9UB 3PVFA 4RDWA 2G8ZA 3A4AA 4PWEA 5SWZD 1BXAA 1DVFD 4H9YA 1N19A 5AW4B 5F72S 3NBNA 2I9TA 3KPPB 3QQ3A 2P76A 3KOZA 3GMNA 4G2DA 4B41A 1EF3A 1YNQA 1XB3A 3CYVA 4PMUA 4W86A 4AHQA 1EMTL 5BOOA 4Z3TA 3EUDA 1CFVH 1WA2X 3X1BA 3MLYH 4KJWD 3BICA 3OPZH 3ZE0F 4WWPA 4ZUSB 2VC7A 3GAYA 3STGA 1TJMA 3IIVA 4ICMA 3GXMA 1Q66A 3W7QA 3TYFB 1O6SB 3INUH 4K3DL 3H54A 4UT6L 4Y4HA 4UFHA 4DCQB 1J5HA 3UNTA 2FD6H 2V17H 2NW3A 3TPUB 3VGGA 3UVAA 5GS0C 4UTWA 3CLEH 3O11A 1ZLVH 2R8SL 1CLCA 3PWUB 1SHMA 3RL2A 4BFEA 3WE6A 1NC4B 4NNYA 2YX0A 1ZIAA 2WXRA 3T2PA 3BVTA 4KDWA 1D5ZB 4OM1L 1JJKA 3M7WA 4K9EH 3GTVA 2INEA 3T0CA 5D2YA 1OK8A 2DMHA 3NAAL 4UM9A 4XVUD 1ZHKB 1RQHA 2NNCA 2N4IA 3EUUA 1T7WA 2XYLA 4P8XA 3UGRA 1GTFA 4PODA 2HJPA 1KBBA 5E8NB 3A6CL 3ML8A 3HIZA 1AH4A 1SO3A 3ME0B 2TSBA 3T1GA 4P5TD 3HGJA 2CKNA 2ILLA 1SOKA 4DQAA 4RAVA 4BV1A 3DROB 3BUBA 4FRWA 2QULA 3W07A 1PW3A 4ZOAA 1G7QB 2Z7GA 4GYPA 2GVLA 2OI9C 5DZNA 3OGVA 1K8CA 3N42F 1LO3L 2B1OA 4H40A 3CIVA 4HNNA 4Q4EA 5BOEA 2ZRYA 2CKSA 5A8OA 1HKLH 1AR1D 5C6MA 2J7FA 4MDIA 1B4JH 2H4EA 4HJGB 1V3KA 2A4AA 5AYUH 4DETA 3W2JA 5KZ6A 4OFQA 4YHIA 3UP8A 1BQLH 4JX0A 1CXHA 5FYJD 1EZWA 4ZQRA 3ZE1F 1IM9D 5HGHA 3IGUA 1J8HE 4JQIL 4TQHA 1FQ0A 2A4CA 1JSYA 3IJEB 5DEFA 3V0JA 2BZNA 2EZ0D 4L9LB 5ID1A 2OR7A 4HFWA 1PDKA 2PDPA 2PGEA 4BK9A 4LK4A 2DF3A 5ITBH 2PP0A 1AR2A 4DTGH 4Z76A 2LABA 1GOGA 3MOAL 4UAOC 4HLEA 1Y5XA 5ABFA 3OV6A 3WY3A 3G1XA 1L9WA 4DX3A 2WLNA 4V27A 5FF3A 2A77L 3EJSA 1U2HA 1AI1L 4KZDL 4M4RB 4DJEC 5DY3A 3HTLX 5D7SH 2IANE 4JM0A 4NKOA 5E2WL 1KPRB 4PYSA 1JG9A 4UTAH 4MVBD 2BZ7A 2JI1A 4L1GA 2XPGA 2CCWA 3TNOA 3WJYA 3WJJC 5KZEA 2WXOA 2Y89A 1UB6A 2WKGA 5AB2A 3HMWH 4X9BA 5FF6B 3XINA 3N9KA 4P3CH 1DDHA 5HDQL 3GDBA 3EHBB 3ULUC 4E9TA 2IPUG 3LKRA 3SN0A 2P9RA 4GCXA 1OIFA 4IK6A 5EN2A 3RVXC 3VFNB 4Q97A 3LVTA 2FQIA 3QJUB 4TX9A 1SHXA 4XP6L 2CG9X 1FBAA 2FZ9A 5HYEA 5JMRA 2TSYA 3EKCA 3TVMB 1UTDA 5IJKA 3O15A 3ABSA 4G3YL 2WNZA 4HYWA 4HH9B 3DO4A 4WX2A 1L7TH 1ROWA 1M03A 4H8NA 5K4XA 2HPIA 1HNGA 2BMKB 4Q0XH 5GISH 2GKIA 4F9LC 1NLDH 3MLPA 4P06A 3WLIA 3C12A 3K4ZA 5DGQA 1S7QB 2YBGA 4F27A 4HOWA 3HGSA 2AQQA 1ZL1A 5CLXA 4ZI8A 1G87A 4F8OA 1TPB1 5ECUA 3P4NB 2W38A 4R5TA 5EIQA 1RZFH 5DI8A 1V6XA 3A4XA 3NRPA 3WUEA 1YKWA 5LIYX 1PG7W 12E8L 4GXMA 2NQZA 3L5XL 4W7UA 1CFQA 2TAAA 2B15A 1EAPB 1MVYA 2OAAA 3M9YA 2ZVIA 5EMLA 3O2VH 5EN2B 1NGXA 3LX9A 3P40A 3C75A 1Z9SB 4S2SA 4DVBB 2OKMA 3SOTA 2HLAA 4PUBH 1MQKH 3PPSA 1JCXA 2VR9A 4XR8C 5E56A 2KMWA 4C56D 5I6OA 3N55A 3PTMA 1NH6A 2BS71 2MKLC 1MQ8A 5JXQA 4H7ZA 5CBJA 2CKBB 3LIZH 2B7QA 5I1LA 5GJNA 5ILTH 3D09A 4LZKA 1AGCA 5C55A 1RJLB 3GM0A 2ENQA 2JIWA 1A6UH 4F9PC 2PF8A 5FF4A 5HULA 4PTNA 4K7YA 3II2A 1RZGB 3LKQB 1P7QB 1V02E 4GQ0A 2IH1A 5MHSD 3BP6A 4XXCC 4JQXA 4RDBA 1REIA 2XXMB 2VDML 4Q8BA 5HDWA 3UZVB 5EBLB 7ODCA 1W15A 4XP5L 1AGDB 5DK3A 3QUKB 1S8DA 1BEYL 4Z3HA 1E5NA 3NACL 1VB9A 3QUGA 1M7IA 3SSJA 2FT7A 3LKPA 4P48A 3QNFA 4ANUA 1KLYA 1AE6H 3LNGA 5DUBB 4OOUA 2ZG1A 3HI5L 3STLA 2C1PA 4PMYA 3W86A 4PGDA 5AB0A 4AMKL 3GXTA 1Q7ZA 4QX4A 2A9CA 1BTCA 4J35A 3R06A 5DZAA 3TNNA 3X1GA 1B30A 4W5UA 7REQB 3E6FB 1QQDA 5IKCB 1TPVA 5DYFA 1M2VB 3QG7L 3R25A 4MJMA 2RUSA 4HWEH 5K93A 4NWUL 2IXVA 1MFCH 5TJWK 3RGBA 1KM4A 2TMDA 4KK8D 1YXCA 1EA0A 4JE4B 3H42L 4BE6A 3JZEA 2NW2B 1GNXA 3GD6A 2XY2A 4L6OA 3WENA 1ZJIA 1XD0A 5GIRB 1BJ8A 4PE8A 4ZOBA 2WQRA 1A5OC 1JZ7A 2GTZB 3PWJB 2ZJSH 3KL5A 1TPWA 1PJ9A 5AOIA 4LBRA 3EJYD 3GD1C 3LQZB 3MFFB 3NGBB 2P5EE 1PWMA 4U1KA 2H9GA 3TW7A 4O2CB 1BW8A 4MCYA 3TIEA 2ZP8A 4QRTB 4JPWH 1K7FA 2Z4TA 2PLTA 3IS0X 1NCDL 2NZ1A 4XXCA 1MRQA 2H3DA 2C18A 2JEPA 4I7VA 1QVOA 3TC7A 2JB5L 1LK2A 3FCSB 4FKHA 2A99A 1X5XA 4P3WA 4Y8DC 3W11C 5DDHB 1ICPA 1W6TA 4F8XA 5IKCA 1AH0A 1L9RA 3CUJA 4RAUA 2Y2YA 2WJFA 4A2RA 1IGCH 1KBGH 2VRKA 2GDUA 1V8EA 3KBSA 3QZ6A 3AIUA 1AGEB 3MDJA 3EGXA 5J11B 3TWCH 1CF8L 2FECL 2MOQA 2OX5B 4DZBA 1R3TA 3QZOA 5KG9A 2GWNA 3B9AA 1F02I 1X6LA 2XFXA 2YMOA 4N2NA 5AVWB 4BH8A 3FQWA 5IJVA 4GC4A 4KESA 1A5FL 4LRTA 4US5A 4EI5A 1HQ4B 5JYLA 4L8CB 3DA0A 3HZYA 2QW5A 3GMPB 1G1KA 5T1DL 1FQ9C 2GK0B 2IQAB 4ECNA 1RSCA 4TLSA 5EKYA 3FULA 4GSDH 3VC6A 1X44A 1F07A 1OAXH 3MI2A 2GBTA 4EX4A 4QHUB 5CC3A 1QX1A 4FR6A 1WCGA 3WLRA 5T3XH 4F7PB 2DWSA 5EMMA 5BZAA 2NV1A 2VJXA 1H0IA 2CIPA 3Q05A 3QJHB 1QLRB 3TA3B 1KIUA 3OIHA 4JDVA 4LAZA 2EJ1A 3TJHC 3L3DB 2GJNA 3NCJL 2N7SA 3QIUD 5DVPA 2Z27A 3T9WA 1O0VA 2NUTB 2WLLB 3GO1L 3VU1A 3IKCA 3FC8A 3LSOB 1Z69A 4LCYB 3BKML 3DHUA 2H1PH 4P5MB 2VR4A 3DJRA 3DX9B 1D6VL 4Z7UB 1JPST 1ZV2A 4QDGA 5BWFA 1PDKB 4S0SD 4ZDHB 3KPMB 1QPKA 2VLRD 3MRPA 4HK0A 4XPAL 3K0WA 1Z9NA 4FF9A 3JVGC 3TN0A 3WLBB 2CPCA 1RIVL 1YEIH 5C0NC 1B3JA 4RDQG 2BSED 1JF6A 3UTQA 2XZ7A 3DHDA 4G71B 4C6PA 4JFEA 1DVUA 1U4EA 4TV5A 2EVIA 2E6QA 2R0LL 3KXFE 4LCCC 1T1YB 5A1AA 1AZUA 5AYZA 3S1VA 4OD1L 3H1ZA 2FZ3A 4G6JL 1Q85A 2X3CA 4NHCH 5EU7E 2IPKB 4DGUA 3RYMA 4GXVL 3V4BA 1HHIB 1CLOH 4G1MA 5AAPA 3OXRB 2B7OA 1TX0A 1D7FA 2EYSA 4QE5A 2AEPH 4PJ9B 2ENSA 4WHYH 2DIEA 3C8KB 2PR4H 1V03A 5BV7C 2DZBA 3QIWA 2DMCA 4AEIL 2LTQB 1KYFA 4B53A 3V0WL 4O53A 4P23D 3FUNA 5HYQA 3KCPB 4JGNA 4OBTA 4DQOL 1YRRA 5E0CA 3WTTA 5GGTL 1K85A 3NCBB 1B6UA 4KAQL 5AYIA 4PRPB 1DTUA 3HNVL 3O4LA 1ZDSA 1TNNA 5KVEH 4IMLB 3U36A 4AWUA 1S38A 1KTKE 4KC3B 3MRJA 4U6VL 3EBAA 4ETYA 1E6SM 3BVJA 1F3TA 3GKWL 4OE7A 4F7MA 1A7NH 3S37H 2E7LC 3N1FC 1W3IA 4JUTA 3ITGA 1BP3B 1FBIH 3GIVB 5TDOB 3TC9A 1K3UA 3M0YA 3T78A 1LE9B 2H26A 1T8QA 1W9VA 1FIEA 3OMAB 5ACMA 3RAJL 1LEIA 4HCHA 5EB8A 4Z2GA 1EQWA 1F4HA 3BMVA 4DQWA 1VERA 1DIOA 2B08A 1UD6A 2BIPA 3VQMA 4E2DA 5DJYA 4JRYB 1SEBA 2YKLH 1UPPA 2HROA 2FL5A 1AG0A 4WI2A 4E2OA 1CYW