4MB1A

The structure of mall mutant enzyme g202p from bacillus subtilus
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
559
structure length
557
Chain Sequence
EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIPSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase 1
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 225
structure length 557
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4mb1A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb1A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4mb1A02
1E6XM 2MANA 3BUIA 1Q6GA 2ZUTA 5CSUA 2QLYA 2VOTA 1G9HA 3CZ8A 2WVVA 1OD8A 4L4PA 4MNMA 4P8UA 2ZUVA 3HMCA 5CSYA 4UQDA 1E1EA 5E0FA 1WZLA 2XWEA 1E6ZA 3GNOA 3N04A 3NJ3A 1V6XA 3WQ5A 5EBAA 2AAAA 3FNDA 4C7DA 2YOCA 1I1XA 3N13A 4HMEA 3T2PA 2D20A 3WDJA 1QWNA 1BAGA 2YKKA 3RM8A 1R85A 1BF2A 1JI1A 1DWJM 1B3YA 3CHFA 1D2KA 4MAZA 1J0IA 1WPCA 1W9UA 2ZUMA 2WVSA 4HZ8A 2HVMA 4W8LA 4PMQA 1JIBA 3S6TA 2VX6A 2WKLA 4CN1A 3WF0A 4ZFMA 1QPKA 5AYBA 2XPKA 4M24A 2YFNA 1CGTA 2B31A 3AMKA 2V3GA 2EPLX 1W9XA 1WNOA 3RJXA 2WC4A 1FFQA 1GJUA 1HKMA 3ZSTA 4X0NA 5DF0A 5CXPA 2JFEX 4LYRA 1JYWA 1W9BM 1J18A 3KLKA 4PMUA 3MANA 2F18A 5HDRA 3CHEA 2V5CA 3SCQA 1B30A 2QMJA 1W2PA 3VINA 1T0OA 2WMHA 1QHPA 4UFMA 4C7GA 4WKAA 1CXEA 1AVAA 3EJRA 1OD0A 3VOCA 1KFWA 4U2ZA 1LL7A 3ZT7A 1OB0A 1F4AA 1M03A 5FCZA 3BCDA 1VEOA 2GDVA 2PBOA 3FHQA 5GNYA 1XRVA 1R7AA 1CGYA 1Z32X 1R7OA 2A3CA 3EYPA 4Z2JA 3THDA 3CHCA 1VFUA 4WLCA 5IHSA 4OOZA 1NM9A 3W38A 4HMDA 3QHMA 1MW1A 2BY3A 1IZJA 1NOWA 1UR1A 2YJQA 1LWHA 5A69A 3GYCA 1TFVA 1AQMA 3WFLA 2VT0A 3L4YA 1UH2A 4CU6A 1KCLA 4J3TA 4BCEA 1H4PA 4OZOA 2GVYA 1BSIA 2G3JA 2ZUNA 1ZBKA 2WLYA 2CNCA 2XVPA 1XGZA 4AXNA 4W84A 1JZ7A 4PUDA 2EJ1A 1N82A 2WB5A 1FH7A 3ARUA 4JFUA 4W7VA 2Y2WA 3A4XA 3VPLA 2JEQA 2VI0A 4AC1X 1OT1A 5DFAA 4XX6A 1HJXA 3W25A 1ZBVA 3PZGA 2F2HA 1EDTA 3AJ7A 5A6BD 4W85A 3TA9A 1PZ2A 1C3FA 3CGTA 4TX6A 2GJRA 2X0YA 1UR4A 3CUFA 3I3DA 2CKSA 1JNDA 3BAKA 3SCOA 4TVCA 2G3NA 2DIEA 4J3UA 1KXQA 3TONA 5I79A 2UY5A 2E9BA 1V03A 3W6MA 1W1PA 2J79A 2XGIA 1BGGA 4DM1A 1GQIA 1MQQA 4U2YA 2F7PA 2J7GA 4GQRA 1WP6A 1GHSA 2CESA 4B15A 1TA3A 2EADA 3QHOA 3WN6A 2PBGA 2VR4A 3AS1A 1W1YA 1EQCA 2ZXDA 3NIYA 3LMYA 1E6NA 3W27A 1H1NA 1OCQA 2WMKA 2YL5A 4FF5A 4M81A 4XUYA 4AD5A 3K8MA 4NX0A 4W93A 5DT7A 1FP8A 4F9DA 3WQ8A 5TD4A 2VRKA 3DHUA 4KWUA 1UWIA 2JIWA 3OBAA 3AIEA 2FE0A 3K4AA 2WC3A 1JF5A 4AD1A 1EO5A 3KL0A 5C70A 2TAAA 3BSHA 4Z2HA 1HXJA 7TAAA 4CCDA 1HTYA 1QOXA 3VGBA 1V3IA 4ZXLA 4DWSD 4YHGA 3OIHA 3FN9A 4E8DA 1DWFM 2QF8A 1XH0A 1OGSA 2X2IA 2EPOA 4CD7A 2VJXA 1G5AA 1DWGM 3NDYA 1HWWA 1P6WA 1KQZA 5JBEA 2WHJA 3I3EA 2D1ZA 3BVXA 1V0MA 4V28A 1HT6A 3FAXA 2XIIA 1WDRA 5I3DA 4LQ1A 1E3ZA 4B3KA 3MMWA 3ZOAA 4H8UA 4GXPA 3GXNA 3BUPA 2XVLA 5BXRA 3T2OA 4W5UA 2WKGA 4KH2A 1EQPA 4ZXOA 4PTMA 3LXBA 4HOXA 3WH8A 1CECA 4URIA 3L4WA 3ZJ7A 1Q6EA 3OG2A 4W7UA 4FK9A 1G0CA 4JCLA 1ITXA 5A8NA 1UR2A 2CBJA 3WUEA 1NP0A 3WBEA 3AIQA 3HG2A 4AZ7A 4D6FA 1E71M 2XM2A 2X09A 3F5JA 2OYLA 4GQQA 1VF8A 4NRRA 3ALGA 5BRQA 1QI0A 3D51A 3CUIA 5A2BA 2AMGA 5A8OA 3ZR5A 1HF6A 1MXDA 3PZUA 4HPGA 3AXHA 1VJZA 2V38A 1TQVA 1J0KA 5HBFA 3VIPA 5E70A 1V0LA 1E0VA 4FNQA 5CLTA 2Z1SA 4CU8A 4X0VA 5ABFA 1AQ0A 1VFOA 1HL8A 1WCGA 1KXVA 4PCTA 1QNSA 3BAXA 3SCPA 5IFPA 3EMQA 2VTFA 4BZYA 1U33A 3VM5A 4JL1A 1US3A 1V0NA 1XCXA 3BVVA 4PYSA 3D4YA 3IJ8A 2GJXA 1WDQA 5A6BA 2EACA 3N11A 1PEZA 1UR9A 1GOKA 1S46A 2CHOA 4JAWA 3A47A 3UERA 1E73M 9CGTA 1E5NA 2XSAA 2ZUSA 3UCQA 2DGAA 2DSKA 3W0KA 4U33A 2JF6A 3NSMA 1PX4A 1QBAA 1CXIA 1QI3A 4XZWA 4JHZA 2J62A 4UOJA 1YQ2A 5JBDA 3DX3A 4GI8A 1JXKA 1ZB5A 3WENA 2VC9A 4OOUA 4E2OA 1E6RA 2VNCA 1FHLA 4HMCA 4AZHA 2XWDA 2XN0A 5D8ZA 2D0HA 3BH4A 2FH6A 4JCMA 3TTYA 1QI2A 2YDSA 2GK1B 3ARYA 4WSJA 4GIAA 1B3XA 3LXCA 3CMGA 3GZAA 2WSPA 1V6WA 2VZSA 3T0DA 2DPEA 3VIKA 1UG6A 2XIBA 4MPKA 3VIJA 1UZ1A 3H54A 3OA5A 3EDJA 3WF3A 4AMXA 3CPUA 3II1A 3WL1A 3T08A 3GXTA 1CGXA 2W4XA 1K9EA 4PMVA 2F61A 2E0PA 1EIBA 3TOPA 2WYSA 1NOUA 3ZJ6A 1W9DM 2Y5EA 2J7EA 2OW6A 4V2XA 4U31A 4IPNB 3APGA 4H8HA 3TTOA 1B3WA 2JF7A 1W9VA 1OGBA 1BG9A 5JIPA 4LYQA 3RJYA 4Z2LA 1V3JA 2QV4A 1SFSA 3WD3A 1C7TA 5E09A 3PZ9A 1IT0A 3WSUA 3CZEA 3KE0A 4PMDA 3VUPA 4D6DA 2WVUA 3POCA 1B2YA 1CYGA 2O9PA 2J7DA 1BYAA 2EBNA 3GM8A 3NSXA 4EE9A 3CZJA 1H5VA 3PZVA 3SUWA 2YFOA 3AQUA 2DDXA 1AMYA 2WZHA 4WK9A 3LRKA 3SCUA 4PSPA 2O9TA 1HJUA 2V3DA 4FNSA 3L4XA 4OJYA 2HISA 2PC8A 1GW1A 4FNRA 2Y4SA 3VSUA 1E56A 3POHA 5FIPA 3SUUA 3FHAA 3KWXA 3MSGA 4GPNA 1QVBA 1B3VA 3CZLA 5A6KA 3KEHA 1QNPA 3WMSA 3VNYA 1E6SM 4HZ6A 1UR8A 1CGWA 1KWKA 2QHAA 4QFUA 3EDDA 3BAIA 3HU7A 1W1VA 4WKFA 3VD9A 4AZCA 1B31A 3VGFA 1ISZA 1BYBA 3WF1A 1BVZA 3U7VA 1R47A 1XSKA 1OIMA 2PF0A 3VDAA 1E3XA 1GOQA 3AZRA 3K46A 4NXSA 2YLAA 2Y24A 3CUHA 3WDRA 4JZ5A 1E4IA 4CCEA 2V5DA 3D52A 3VGEA 1TVPA 3TTSA 1NWTA 1OGGA 3HZ3A 5CPSA 3S5ZA 1H11A 1CXFA 5M3WA 3SCWA 1ODUA 1WZAA 2PWHA 1Q4NX 1E4MM 3UG3A 2RGMA 3AS3A 3OLDA 1SMDA 1KR0A 1LL4A 1C7SA 1QI4A 4XV0A 2PWEA 1JYXA 1NH6A 2Y8KA 5E6ZA 3WY2A 5I23A 5BYWA 1VRXA 1MQRA 3N12A 1E72M 1HKJA 1LLOA 2XFYA 4AY1A 2YDRA 1CTNA 1BPLB 3SUTA 5C71A 1UASA 2BHYA 2D0GA 2D2OA 1NARA 2XSBA 2FH8A 3WD1A 3CUJA 3K8LA 3MU7A 3S2CA 2ZXQA 3VGDA 3VX0A 1GZJA 4W89A 3BAJA 1CPUA 2F8QA 2DT1A 1DHKA 3K4DA 4D1IA 1JF6A 4B9YA 4W86A 8CGTA 1E43A 1JZ2A 1GQJA 1HJVA 3PTKA 1FH8A 3S5YA 4BF7A 3QR3A 3GXIA 2IXVA 3AZSA 1DWIM 2AOSA 1JFHA 2OWWA 2F7OA 4QLKA 1VB9A 3WFZA 2WXDM 2WZEA 2O9RA 2DSZA 5EFDA 2WNWA 1EHNA 1BHGA 2O9OA 4ZE5A 2DIJA 4LYPA 3W29A 1QHZA 1A47A 3N17A 4AZ6A 3UG5A 1UYQA 4HZ7A 2DQXA 1HIZA 2YL6A 3GXDA 2VRJA 3DHPA 1XD0A 3ARPA 5I24A 3HG3A 3WMBA 2VR5A 1GCYA 2VZUA 4BA0A 4M8UA 1JD7A 3LX9A 1MYRA 5DEZA 1WDPA 1HKIA 4DO6A 4S3JA 2WCSA 4M80A 1KGXA 1B0IA 2WC7A 1JAKA 1V08A 1TCMA 4NZCA 4XB3A 4IUGA 3WH6A 3PBGA 1E0XA 5E0CA 1EXPA 3WDQA 4CD5A 3PHAA 3LPGA 3WQVA 1QWUA 4J3SA 1E55A 1O6IA 1SZNA 2BY1A 1QBBA 5FKYA 4JHOA 1E40A 1KBKA 6CGTA 1VEMA 5CG0A 1UH3A 3MI6A 1LJYA 4GZIA 4M29A 3IAQA 3F5LA 1NWUA 1L8NA 3BC9A 3OGSA 3MUZ1 3WUGA 3WY1A 3VSTA 4D6EA 2NT1A 2FHFA 1CXKA 3PZNA 3PZOA 4AMWA 3HG4A 3DC0A 1VAHA 3UG4A 5A2CA 4ATWA 3AIUA 2CITA 1TA3B 1KXHA 1VIWA 4P7OA 5F7UA 4P7NA 3VIIA 1WZKA 1MW2A 3TTQA 3A4AA 4FNUA 4TUFA 4FNPA 3DX1A 4E4PA 1KQYA 3OGVA 1SMAA 4A4AA 5BROA 4HPHA 2VVSA 4PBGA 3KLLA 4WF7A 1V02A 4ZENA 4CD6A 1JFXA 2D3NA 5BCAA 1C93A 1KR1A 2WM0A 1FOBA 1JGIA 4U5KA 4MAVA 3U5UA 2E8ZA 5AY7A 3AHYA 4WKHA 2YL9A 1CGUA 4TVUA 1W3LA 3VD5A 1O7DC 3CBWA 2W63A 4TTUA 1QW9A 4WIWA 3WEZA 2VUYA 5A1AA 1VJSA 3EJTA 1CLVA 2VL4A 5GNXA 1XYFA 1UQYA 2VX5A 4OBRA 2OYMA 4AD2A 3L4ZA 1MW3A 4CD4A 3A23A 4CKQA 4PEEA 3WQ4A 2VCCA 2UY4A 3CMJA 4AEFA 4CVUA 2YBUA 4R5EA 3THCA 3CZSA 1E5JA 1UD6A 4N0RA 5C8BB 4AW7A 1SR0A 2Q8XA 3WUBA 2VCBA 3EJPA 1GJWA 2J8GA 2ZX5A 3ZT6A 1JDCA 1C8YA 5D4YA 3FAWA 1VEPA 1FA2A 3ZMRA 3UESA 1GPFA 4IISA 4NSBA 1GOOA 2VQTA 4YPJA 1DWHM 4U3CA 2UY2A 3ZO9A 2E9LA 3IJ9A 1V02E 1XSJA 4P8WA 3B9DA 1TG7A 1CXLA 3CLWA 1HKKA 3RIKA 4MNLA 5ABEA 5A8MA 2Z1KA 2OLHA 1GQKA 4Z2IA 3ARXA 2CBUA 3F5KA 1GOMA 4CUCA 4E8CA 1QX1A 3VIMA 4F79A 2F1BA 1NOFA 4CU7A 2GUYA 2FDMA 2BXYA 1KB3A 3AROA 3BVTA 1TZ7A 4AYGA 2J8FA 1LQ0A 3A21A 1XYZA 5CQ1A 5ECUA 3L2MA 2ZOXA 4A3HA 1OT2A 3A3HA 4JFWA 5AYIA 1B1YA 1Y7VA 4OIFA 3WEMA 3B9AA 5A2AA 3PZIA 1KGWA 2WMIA 1CBGA 4TX8A 4OGZA 4AWEA 1PBGA 5GQBA 4EANA 5ABFB 1H09A 3MS8A 1C91A 1V3MA 3WD0A 4B9ZA 2X2JA 3WNNA 3K8KA 3LPOA 3QOMA 5CJ5A 5KEZA 1NWSA 1JZ8A 2J7BA 3M7SA 5A94A 5ABHA 1X1NA 1UD4A 4Y7EA 2ZXAA 2IXUA 3UEQA 1JYVA 3WELA 4AISA 5CGTA 1V6UA 5AC5A 3WF4A 2C7FA 2W67A 4CVWA 4HOWA 1XHGA 4NXKA 2JE8A 3VM7A 2D22A 4J3XA 2FHCA 3T0BA 2XG9A 4NI3A 4AIEA 1UA3A 1A3HA 5BXTA 1OSEA 1JZ5A 1YHTA 3TV8A 4ML4A 3ZM8A 2CPUA 1FH9A 3BUDA 3FY1A 4W8AA 3N9KA 1V6YA 3L4TA 3H55A 1BYCA 2V3EA 2BVDA 3LPFA 3AMCA 1J10A 4D1JA 1G1YA 3OLGA 3ARZA 2WMFA 6TAAA 1CGVA 1UWTA 4ACZB 1W2VA 2W91A 2YLLA 3ZJ8A 3GXPA 4PSRA 2XVGA 2YIHA 2GSJA 5D9PA 2CKRA 1UR0A 3WMCA 5EFFA 3SUSA 6A3HA 2OW7A 1Q6DA 5LA2A 3DECA 1L0PA 1X6NA 1KTBA 2BVYA 1ZJAA 1CXHA 1R34A 4UTFA 3CH9A 3A6OA 4AIUA 1GOIA 5KZ6A 4D72A 4NZJA 2FHBA 3ZR6A 4RL3A 4UZUA 1XV8A 4PCSA 4OUEA 3PTMA 1UZ4A 1PPIA 3ARRA 3VD4A 1PS3A 1JZ6A 1EDQA 1C8QA 3VVGA 3NSNA 3GNPA 3CTTA 2CETA 1EDGA 3W53A 1RPKA 1XCWA 2CCRA 4UOQA 4UQEA 3M6DA 5CPTA 2EXOA 3O9NA 1D3CA 1U2YA 1UD5A 1M53A 1ZBWA 4JKKA 3GH5A 1R87A 3AXIA 1UD8A 3PZTA 3BXWA 4U3AA 3H53A 3J7HA 2E4TA 1E4NA 4HA1A 3VIHA 5I6SA 2VZOA 4F8XA 4HP5A 3PZMA 1HVQA 3ARTA 5E1QA 1V3LA 2VO5A 3AHTA 1UKSA 4GZJA 4DO4A 4PTXA 1M04A 2XYLA 4F9JA 1K6AA 1FHDA 1JZ4A 2X05A 2BS9A 1WB0A 2WHKA 1J0ZA 1GORA 4MNKA 2FGLA 5HNNA 1J0HA 3N1AA 3HG5A 4P7LA 3BAWA 1EO7A 3SCVA 1NP2A 4JL2A 3M07A 2Y8VA 1V0KA 1F4HA 4YHEA 1RP9A 1MW0A 2D23A 2OSXA 5JIWA 4UZSA 4IPLA 3WD4A 3ZT5A 5DMYA 3HJEA 5LYRA 3ARVA 3OLIA 3QHNA 3AS0A 4PMRA 1BFNA 2W66A 2XFFA 1RP8A 2EAEA 1E6QM 3CZKA 4UFKA 2J78A 1BGAA 3RILA 3U5YA 2YA1A 3IK2A 1BG4A 1QNRA 2C0HA 4DWSA 1DP0A 3GH7A 2VCAA 5IXEA 4PMOA 4RE4A 4GINA 4AMCA 4IM4A 5IFTA 3G6MA 1UUQA 1OWQA 5IHRA 4KRTA 2X8RA 4M56A 1OINA 2WPGA 4RE3A 1QI5A 1MFUA 1J9YA 1PX8A 4UQ9A 2NSXA 3WQ6A 1GVYA 3EJSA 3U7BA 2GK1A 4C7FA 3VMNA 1ZJBA 5CPQA 3OB8A 5D9NA 5DT5A 4FLQA 2WANA 3IJ7A 4UNIA 2JALA 4AD4A 4AEEA 1UD3A 1E6PA 3MSDA 4B16A 2DT3A 3CHDA 3L4VA 5CLWA 2VVNA 1ESWA 3DX0A 4UCFA 1CLXA 8A3HA 2WVVB 1EOKA 3ZQ9A 5HPOA 2ZX6A 1XH2A 5HOSA 5M17A 3GDBA 1JXJA 4J3VA 3VMPA 3WY4A 1OBAA 5AC4A 1PIGA 1M01A 3RMEA 1CIUA 2WHLA 4QLJA 1LG1A 3GTNA 2RGLA 1QHOA 2OWCA 1RH9A 2OSWA 2EEXA 3IAPA 3DYPA 2BVTA 1MWOA 1TR1A 3VD7A 5BXPA 4PMZA 1BLIA 1PIFA 2J74A 3AIVA 1H0GA 4ATDA 1GUVA 4U5IA 4GO8A 4DM2A 3MO4A 4UQBA 3VDHA 1JL8A 2WMJA 1UHVA 1HP5A 2W61A 3VMOA 1ZS2A 1M7XA 2CXGA 3QGVA 1WO2A 3W26A 4MDPA 5GNZA 2DH3A 1JDAA 4TTGA 1LF1A 1OIFA 2E8YA 3MV01 2EPNA 2D73A 1HN1A 3GH4A 1IV8A 3EDFA 1UWQA 2J47A 4M1RA 4MTVA 2ALWA 3A22A 3D5HA 5I78A 5M03A 2DSUA 3WBAA 2EPMX 1TMQA 4HA3A 4BQ5A 1K9TA 1B9ZA 1HX0A 4Z2GA 1C8XA 1W3HA 4D6CA 3UETA 4KMQA 2WWDA 3EDEA 3WNPA 1CNVA 1J01A 4AD0A 2UWFA 5A6SA 3VDBA 5IDIA 1KWGA 5I0DA 1XD1A 2BY0A 4JIEA 1JI2A 2QPUA 5EMYA 4XZBA 3WUFA 3EJUA 2ZUWA 2ZX7A 3DYOA 3EDKA 3AHVA 3LXAA 1UKQA 3AHZA 4HU0A 3F4VA 2D3LA 1BTCA 1ODZA 3CC1A 1VBUA 4X9YA 3CZNA 2JEPA 4D71A 3NCOA 2ZUUA 2WWCA 4OBSA 1W32A 2J7FA 2PB1A 3T0AA 2W92A 1J11A 3VD3A 4GI9A 4DO5A 1E9LA 3AFBA 2J77A 3B9EA 2QMKA 4J7RA 3AMLA 4D6JA 1J12A 1I1WA 4DWSC 5JUVA 2CYGA 1NWRA 4CGTA 3UR8A 1TQTA 4EKJA 3OLEA 4JFSA 3U57A 3ZJKA 2E9MA 3MMUA 2XHYA 2G4FA 2EQDA 2BFGA 1MVYA 3DX4A 3AXXA 4LX4A 2EPKX 4LXFA 5HPCA 2C8NA 4H2CA 1RD6A 1PAMA 3WNKA 2G3MA 1KXTA 1W9PA 3BLPX 5BWFA 1R8LA 2VZVA 1VFMA 3HN3A 1GNXA 4HA4A 2ZXBA 1W1TA 2CIPA 4QP0A 3W28A 4MB4A 4FNTA 2G3IA 2BHUA 3FXYA 3MUAA 7CGTA 1E0WA 1MFVA 1CZ1A 3N18A 1ISXA 1TE1A 3DYMA 1VFFA 3VGHA 4Q22A 4QCFA 2XUCA 1HVXA 3GXMA 4ATLA 2ESCA 4BS0A 1ITCA 3AOFA 1D7FA 1KTCA 5A6AA 2J7HA 3WD2A 3T2QA 3K1DA 1V3HA 1V6VA 3W6LA 1WE5A 3WL0A 4UOZA 4EK7A 3O6AA 3AS2A 3A4WA 4D6GA 1G94A 1JNEA 1HJSA 3AYRA 3WIJA 3WH7A 4QDMA 4YN5A 4MNJA 1KGUA 5E6YA 4D6IA 3MMDA 2ZWZA 3G6LA 4H7VA 3OGRA 3VIGA 2CERA 2WVTA 2WK2A 3MKKA 4W7WA 3BLBA 1AQHA 3L2LA 1MQPA 4UQAA 3EMZA 4CN6A 3MUY1 1TQWA 3BLKA 1ZU8A 2W5FA 3A24A 3WH5A 3AIRA 3GXFA 5DO8A 2WMIB 1R86A 2YDQA 4K68A 4MB3A 1EGZA 1BVNP 2WZIA 4PMXA 3EMCA 2NW0A 3SCNA 1E4LA 3W82A 3VNZA 1UWUA 4AIOA 4W88A 1QNOA 4A3YA 4OKDA 1I75A 3ARWA 3SUVA 3GNRA 4FMVA 2A3BA 3CO4A 3PZQA 1W3KA 1X6LA 3OZOA 1GHRA 1H49A 3O2LA 4P8VA 1C90A 5FOOA 2A3AA 2F7QA 3WEOA 4MDOA 3VIFA 3DX2A 3ARSA 3GBEA 1BYDA 2WBGA 1TUXA 3ZIZA 2J75A 4PRWA 1WZMA 2YA2A 4UFJA 3W4RA 3SIMA 3PN8A 3RDKA 1EA9C 1O7AA 2D24A 3EJQA 5A6JA 4AYSA 5CZKA 2UY3A 2X2HA 1JDDA 5I5RA 4BQ4A 3SCSA 2X1IA 1JD9A 1HJWA 3FW6A 4GKLA 5M5DA 2BV9A 4JKLA 5I77A 2YA0A 3ZSSA 1ISWA 2IUZA 4QCEA 1WAWA 1UD2A 3OZPA 1QNQA 1KCKA 3MUIA 3WDHA 5A3HA 1R75A 5FD0A 4PUEA 2W62A 4KGLA 1HJQA 3W24A 3ARQA 1GVIA 4MADA 7A3HA 4CN4A 4HOZA 2NT0A 4GO9A 1UKPA 3DDFA 3VU2A 2OWXA 3JUGA 3VIOA 3AMGA 1PX3A 2G8ZA 4W5ZA 1GOWA 3BGAA 1JAEA 2ZIDA 1XSIA 2J4GA 3RM4A 1CDGA 3RCNA 2XN1A 2GJXB 4JFVA 4TXEA 3VILA 3VDCA 1UWRA 2CHNA 5BRPA 4ACYA 5D9OA 3RPMA 2QPSA 1CENA 2FGZA 1ZL1A 4BQ3A 3B8SA 2XM1A 3WY3A 3CV5A 5D9MA 1HL9A 4MB5A 2X2YA 3TP4A 1H2JA 2J7CA 1TQSA 1R33A 2DSWA 1JYNA 4AZ5A 1VBRA 4TVDA 4P8XA 5I2UA 3AISA 4MJ2A 2WLZA 3KL3A 3LRMA 4DUXA 1CEOA 2VURA 2PWDA 3I3BA 4KGJA 4PTWA 4AD3A 4RE2A 2WBKA 1WDSA 1H41A 4GI6A 2D0FA 3CIVA 3WNOA 1J0YA 1OM0A 2X0HA 4UQCA 3WKZA 3L4UA 2YBTA 3MV11 4CD8A 2A3HA 1W3JA 2DT2A 3AI0A 2XJ7A 2ZE0A 4EAMA 2ZWYA 1ISYA 3A5VA 1EHAA 3BMWA 2E40A 4LGXA 4CCCA 3KL5A 2JIEA 4S3KA 2VRQA 1IZKA 3AIWA 3AIBA 2WHMA 1GONA 3LPPA 1PJ9A 5HXMA 3BVWA 4GZEA 1FP9A 4FLRA 4UFIA 3BAYA 5E9AA 1E1FA 1NQ6A 5A95A 1VENA 3IGUA 4Q7NA 2XFRA 4NZFA 1UOKA 3AZTA 1R46A 2G41A 3SCTA 2WW5A 4D6HA 4J27A 2V3FA 1FFRA 4NF7A 4UR9A 2EO7A 2O92A 4DWSB 2DH2A 3NDZA 3IANA 5GPRA 4AZGA 1LG2A 2ZX9A 1JG9A 3SEPA 2CBVA 3CZGA 1QW8A 3BSGA 5D8WA 1UKTA 4PN2A 4ZEPA 4LPCA 1E70M 3W81A 3CUGA 2XTKA 4R27A 4N42A 1US2A 5EB8A 2IGTA 1G01A 3N15A 2WSKA 3ECQA 3VX1A 4ACZA 5ABGA 4V27A 3PTQA 2VX7A 1V3KA 2DT0A 4DUWA 1DEDA 1MXGA 2PWGA 1H3GA 4J3WA 2ZX8A 1JZ3A 1UH4A 4JFTA 3UR7A 4JKMA 2XN2A 2CBIA 2OSYA 2WCGA 1UA7A 2OYKA 3VO0A 1ZBCA 4P7QA 3NYDA 4Z2KA 1KBBA 5FL0A 3ALFA 4AZCB 3D3AA 3VGGA 2BY2A 5A8QA 3WNLA 3WQWA 3AYSA 4W87A 2BHZA 3VKKA 3WNMA 2EABA 2ZICA 3AICA 1BQCA 4W8BA 4M82A 3SCRA 1J0JA 2VZTA 1GQLA 3SURA 1C92A 1XC6A 1U30A 2DSVA 1HNYA 5A6MA 1B3ZA 2GDUA 3D50A 1PZ3A 4NRSA 4WJXA 1HXKA 2XGBA 3W37A 2GFTA 1LWJA 2VX4A 2XVNA 5LA1A 1Q6FA 2BNJA 1WKYA 4MJ4A 3WF2A 2WAGA 3WH9A 3BMVA 1EH9A 2J25A 5BXSA 3VSVA 5LA0A 1E15A 4AZBA 2PI6A 3GBDA 5CGMA 4QAWA 1TVNA 2WCAA 3QOKA 4UFHA 1UKOA 4ZE4A 4HU8A 1CWYA 5FL1A 4PMNA 1DTUA 1UQZA 2FYVA 5A6LA 2VQUA 1ECEA 3WDPP 4MB1A 4PTVA 2YL8A 2CEQA 3RO8A 2PWFA 4HTYA 1UWSA 1K9DA 1W91A 2VMFA 4F66A 3RM9A 4P7RA 3AMDA 4FLOA 2F7RA 3EBVA 4H8VA 2A3EA 3VTRA 3BVUA 1H0IA 1HP4A 1EOMA 3M46A 3WDIA 3T09A 4FLSA 4KRUA 4QLLA 4TOQA 3AHXA 3BUQA 1TQUA 5A8PA 2GJPA 5JBFA 4BQ2A 2BXZA 1ISVA 4DUVA 1SYTA 4UFLA 3LRLA 3KZSA 1B90A 3BCFA 4PMYA 3BUBA 3E1F1 4H04A 3NUKA 2F1AA 4AZIA 4B3LA 1K9FA 1LL6A 4H41A 1DWAM 2DEPA 4L4OA 4J28A 3D4ZA 2XVKA 1Q6CA 2WMGA 3DDGA 4WSKA 2E3ZA 1XH1A
chains in the Genus database with same CATH superfamily
3ZKSD 3RX4A 1EHXA 3O63A 4NCDA 3O4LB 4M3HA 5KYXA 5DZAA 3OKKB 1L0XA 1D8CA 1ZFJA 2XWEA 3VGAB 3N04A 4S0TD 2IADB 4UILL 1SYVB 5E99L 4DWDA 5HDQL 3PCYA 5T26A 1NFPA 1JV2B 4LSDA 5EUKA 1B3YA 2BCKB 1WITA 5HP5A 3DIFA 3LIUA 4HZ8A 4DETA 4W8LA 1YUHB 3S6TA 4LLUB 5K39A 1ROWA 2JKRM 4CN1A 3A4DA 3W7HA 4M7KL 1MLBA 4XBEL 4KU1A 4N3UA 2DM7A 5ESAA 5F97E 4PMUA 4UTAA 3UY8A 1B30A 1HXYB 2WMHA 5DT1L 3PPEA 1CXEA 4E0RA 4MZ1A 4G11A 4MJ5B 3DETC 1YNLL 1MRAA 4BWUA 4BWLA 5IHSA 3OJMB 3Q1EA 2V69A 3DI0A 1PCXA 5CN1A 4DIXA 1IBDA 3QHTC 3MRJB 3T6VA 3GSNH 5FV2A 1A7RH 4GKZA 4P4RA 1DQLH 3VWKC 3GNXA 4K3DH 4HUWA 2MSPA 1S3HA 4LSQL 1TPWA 1BCIA 1FFPB 3E8VA 3SJVA 5D2TA 3GB7B 3IXAA 3LBOA 2F2HA 3GSUA 4LLAA 4LSUH 1EDYA 1C3FA 2YS4A 4OV4A 3SGEH 4TU1A 1O9WA 1ZXKA 3VWJD 1EX0A 3NIDF 5FYJD 1DDTA 4Z7WF 3FC8A 4QGYA 1FJ1A 1Z42A 3TONA 3LYRA 1ZEAH 5DMKA 1E0UA 5J11C 3BESR 3L21A 4XOCA 3UZJA 3H3PH 4I8DA 4R2GB 1U8NB 5E9DE 3PV6A 4GW1A 4X6CB 1MDRA 1IBGL 3W27A 1ZGDA 4YSUA 3QUZA 2F8VA 1IU1A 2DP3A 2QKIC 3WQ8A 3GEFA 3MTWA 3CC5A 4F8PA 4JEQA 2E68A 1RZFH 4N28A 3TO4A 4CCDA 3RU8L 5KVGL 1EIXA 1IAMA 3EOLA 3SB0A 5DUBB 3VNDA 2W0UA 1XIWB 3S8FB 3PUOA 3SM0A 2D1ZA 1HT6A 2HRPH 2N7BA 3QQ9C 5FYLD 3NZHL 1E3ZA 2I07B 4B3KA 1YTKA 1W31A 5LIKX 2Z1BA 3LXBA 2ORBH 3IMBA 5SWUA 2C14A 1S8DA 3E6EA 2QNEA 4ERGA 3S5NA 5EL1A 5HUOA 1KBLA 3NFPB 3ALGA 5GS1B 5JXED 3HFTA 1KBGL 3PZUA 5KZCD 3VFSB 4FNQA 1L6ZA 5FYJH 3IDGA 1B4LA 1I6NA 1HL8A 3DLQR 4TSBL 2ENSA 1U4FA 2XWBA 1Z6KA 3KLHD 4FA3A 5MEOA 1PUDA 1BZ9A 4UM8A 2K7PA 2DQMA 4L9ZA 2CLKA 4AYFB 1N0XH 2X4SB 5A6BA 2Z8RA 3V5HB 1XCQB 3HAEG 2CSPA 3BCJA 3E02A 3EYVB 3L8QA 4DGYL 3SDCB 3LCLA 4LCQA 5F6HJ 3TNNB 1GVRA 2YR1A 3MLTB 3THUA 5K4ZA 1AGCB 1YEWA 5DLLA 3U1QA 4DSYA 3WTUA 1L9NA 4G8GB 3KVPA 3KFTA 3EIFA 2ZYIA 3FU3A 4U1SB 1IEIA 3LXCA 5F7KC 3GDTA 3MRKA 5K9DA 3WLTA 1AAJA 2E6FA 2JTDA 4GNVA 1T5WA 1WXJA 2JK2A 6PCYA 1YN6A 3WL1A 1CURA 1G69A 2WLLB 1R2SA 1OGAA 2OJPA 3KGSA 4Y9GA 2CZEA 2QUUA 5FYLH 4P5RA 2EHHA 4EN2A 1Q63A 3B2XA 1OHQA 3C5QA 1F02I 1I9EA 3IWPA 5EU6E 4KHTH 2P5ED 2QKSA 1NDWA 1WCBB 3GM8A 1XWVA 2WQWA 4FXSA 5AZ2L 4O51B 3BIAX 1AMYA 2WZHA 3NACH 3MRFA 2EYTA 1JWUB 3N34A 3UCCA 2OSLB 2QHLA 5LIWX 1FCVA 1XH3B 4JTSA 2AK4D 1IBHA 4OLVH 5HYJD 2WQVA 4WFGE 5BPPA 3UP8A 1QSFE 3KWXA 4GPNA 4GRSA 3WQPA 3EJYC 4AUBA 4XVUD 3QORC 1GW6A 2G5BB 4OE7A 4Z42C 1WIUA 3QPEA 1NFBA 3KXFB 4D2NA 1YN7B 3U7VA 1OIMA 3DXAB 4OQTL 3SZ6A 3K46A 3UBGA 1V8EA 2GL5A 4JZ5A 2F19L 4WRLA 4LVEA 4RGNC 4HT1L 5HA7A 1IM3B 1G0YR 4GG6E 1E4MM 3QVQA 4HG4K 4M4RA 2PWEA 4EAYA 3P60A 2J6EH 4WCJA 5D2XA 4O19A 2EKCA 4XMVA 3N12A 2XFYA 3FTVA 5JYLA 1WOBA 1RZJC 3WS6C 3HEIB 4YXKL 2ZYSA 3FYIB 5AZEH 2FJHA 3K4DA 4YHNB 1A7PH 1NVMA 5JOFA 3MJMA 4G6FB 3GXIA 1EZVX 4WGKA 1MHCA 2B4CH 1AXTH 2JIXA 1R5YA 1P0BA 3FQ1A 1O7DE 4J4KA 2GIMA 3JWDC 1SXCA 1WDWA 4I48B 3DHPA 5AVSB 1I0BA 4GRMB 4E3TA 1QO3B 3C08L 2H47C 2J20A 1Y1DA 2VEIA 4Y4HD 2P8MB 2RMNA 2V7NA 3CN2A 4AVOA 3DTXA 1OZQA 3V0AC 3MOAH 1JAKA 5I71C 5GRVK 5D5ME 3MWCA 1DJSA 4MY9A 2Q7NA 3HFMH 3PHAA 4JJ5A 2VM8A 2BIHA 3O4LA 1BDYA 3FQNB 5FKYA 3OKKA 2XA3A 3FQYA 3O11B 3TIDB 2IADA 3IS1X 1NWUA 1T22B 3JVGC 3UTSD 2PRHA 3MNVB 3SYAA 2BCKA 3HG4A 3W1PA 4Z0BL 2DQEL 5DU7A 5A2CA 1JRHH 5IJCC 5ENWB 1YUHA 1VIWA 2X53A 5I3JA 3IMTA 4MD5B 1RMFL 1I9RH 1ZLSH 1XKJA 1VADA 4ORIA 4A4AA 1PNDA 4NNYB 1TENA 1FKWA 4L8CB 4HJEA 1WWCA 4OY9A 4H20L 5HGGS 4BUQA 1D5XB 3HUJE 4Y5VB 4KKXA 4YXLL 1WA3A 5H8PA 3HHMA 3INPA 3QRLA 4L2LA 1JGVL 1SZGA 5BZZA 1WLHA 4MJ5A 3Q4DA 1Q0XH 4LPVA 1FL3B 2QDWA 2QSQA 1DN2A 3CN3A 1F6AA 3T3PE 1RZKH 2B59B 1C8YA 1GTNA 3EH5B 3GG1A 4YUEH 4IISA 3TFKC 1J8KA 3SRHA 3RCMA 5I1EL 3BN9D 3QH2A 3WLJA 3G24A 4OFQA 1OP3K 5DJ0A 5KYWB 4KX9A 2FWOB 1YXYA 2CBUA 2O5YH 5CJNA 5D7LE 4MUZA 3PANA 2H2SD 2FDMA 2P9RA 4HBCL 5HDLA 1BFOA 3P69A 4ENZA 4QWWD 2YUWA 5IHUH 3FQWB 4TSCL 5AYIA 1TB3A 5IVXE 5JR1H 3HE6B 4MKMA 4EDWH 4H01A 4XD3A 3WD0A 1VF5C 2EG8A 1MPAH 5EU5A 3LPOA 4YGAB 2KBGA 4ANUA 1UJ3C 2EVHA 1U8NA 3WE1A 3SPVB 3UR2A 1SFHA 3NA9L 1FWXA 1H1ZA 5CC3A 4I9AA 2E59A 3DETD 4BWTA 1V7NL 2V5KA 4HK0B 5HHME 5IFAL 2ONEA 2QJJA 3M0VA 1FH9A 4DVBB 5ES4B 4XO6A 5B22A 3L4TA 3BZDA 4JDVB 4R4FH 3PGCA 3B4NA 2WKJA 5KSAD 1BGXH 1CGVA 1L8PA 3MY9A 1F90L 3UWZA 3R06B 3SRFA 5J8OA 3WE6B 2UXTA 1TTIA 2O93L 3LQLA 1XIWA 4D72A 4ZGYA 2FHBA 4FQIH 3EPNA 1JZ6A 4HC1L 1W8NA 2I07A 4K3EL 2OP4L 3UCRA 5BXFB 1PG7X 1XCWA 1L6XA 2A1WH 3A9IA 3K71A 2C4FT 4Q52A 3B8YA 4O1EA 4LCWD 1P4IL 3N4EA 3OQ8A 5IROC 3W1NA 2DQCH 3T05A 4AVNA 2VO5A 3NFPA 3AHTA 3KUMA 2A6LA 3K91A 4PUMA 5GS1A 1FAKT 2DPKA 4YSSA 2IH3B 3AITA 5E0QA 3QV9A 3VFSA 4MWAB 1ZTXE 4C56B 4R7NB 2FGLA 3IU4L 1TZZA 3CMOH 4PJHF 4F9PC 1E5ZA 4NT0A 1MW0A 4O1BA 2JELH 4WJEA 3G22A 3T2NH 3GIZL 4PP1C 4OM0L 5KG9A 3UYOD 3AB0B 4Z7NE 4O58H 2YLHA 3AS0A 2X4SA 5LQBH 1XJBA 2VC2L 5E9NA 3GGWA 4JZJB 1XCQA 1JPEA 2IQAB 3SBPA 2BX5A 4UAHA 4P46D 3VXNB 2C0HA 4ADUA 1N59B 1AGCA 2NY1B 3H4HA 3OHXB 4IM4A 3NSFA 3QQ9D 3E8UH 3PFMA 4GMTL 1F58L 4G8GA 3EJSA 1BQHB 4FCHA 1BXAA 4U1SA 5CPQA 3KLSA 2WGXA 4DF2A 1GZPA 5D7JA 1SXAA 1BXCA 4BE5A 4WKZB 1U3HB 1N7ML 2XWZA 3DARA 5IFHH 1CDJA 1PD0A 4XPTH 3MHFA 3W3OA 3WJSA 1ACXA 5DGQA 1S6NA 3ZQ9A 2ZX6A 3GZ3A 3GBML 3HC2A 2AANA 4MMZC 3UYPA 4ZMVA 2FATL 3W2DL 2IOMA 1WBYB 2RGLA 1Q94B 3P5YA 3FSUA 4X5RA 4N2NA 2CIKB 4HU3A 3ZFHA 3C5XA 3SCMB 1WCBA 4J4PC 1DO5A 3SGKC 3VG9B 2Y3NA 4G6JH 2BOCB 3QGVA 3LHUA 3HPFA 5GISL 1JWUA 2OSLA 3D09A 3L5WB 2JWYA 3C6LB 1VKXB 2D73A 2O6DA 2BFVH 1HN1A 1W72L 4MTVA 5HMFA 1TVHB 3FUFA 1A4LA 3HPLA 2G5BA 3ZZSA 1C5BH 2GVJA 2TRHA 4JMXA 5GGRB 3BW3A 4UTMA 1QOPA 2K3HA 1HX0A 4JN2A 4F57H 1YN7A 1MQKL 2GHWB 4BEUA 4PN6A 1DYZA 3EDEA 4URKA 1EC9A 2NY0C 1L3NA 3VFGL 3MNDA 2P5PA 3FT4B 3HLKA 1UKQA 3DSFL 3TZVB 5E9DB 2UXVA 1TJPA 4D71A 4F7TA 4ZTPL 5CLYA 2WWCA 4EPBC 4MCYA 2SEBB 4QHUB 3WIIH 1FWTA 5I6XB 5TQLA 5F2GA 3KWUA 2VXNA 4GQBA 1FGNH 4PODA 4ZB0A 1SY6H 3BSMA 1TTJA 4G2DA 5JPNB 3CWGA 1O6TA 2BFGA 2DQ6A 2FB2A 2EDLA 4OJDH 4MSWB 4YHNA 3WBDA 1GZQB 1ZT1A 1A5KC 5BWFA 1QUNB 3QCVL 2AFNA 1TE6A 4CSZA 4KK8D 2VXSL 1SDYA 3EJYD 3L45A 2ZBTA 3FXYA 1Q90A 3TAOA 4AM0Q 2OFQA 5GHWL 4HS6B 1WICA 1INQB 1Q0EA 2BLFA 2Y7SA 4L9XA 3UIZA 4GRMA 1IC5H 3T2QA 2I7OA 1OFAA 4LHUD 4NAMA 4I9JA 1QO3A 1ZPUA 3UXFA 2P8MA 1AFVH 4ZUVA 5JDSB 3FU8A 1J1OH 2FJKA 3IS4A 3APMA 2X7VA 1KFCA 5PCYA 5B3JE 3OGRA 1HHGA 2WK2A 4A6YH 2IKIA 2OT1A 4KNQA 2GBUA 2VN6A 3AG2B 4PJCA 3ERXA 3GHEH 4X6BA 3EMCA 3KDPB 1T22A 1T6MA 1E4LA 4IQEA 1I75A 3ARWA 1T1WB 5JHLA 3H2WA 5K5YA 5ENWA 3BICA 1IJNA 3QDMD 4MD5A 2O72A 2WBWB 4ZUTB 1M65A 3MJGX 3RWIA 2D24A 1T7XA 3GSOB 2XYCA 5CZKA 2XIDA 1GYAA 4WTZA 4JQIL 2WQUA 2BV9A 4ACTA 4L8CA 3NPWA 1D5XA 2ZZ3A 3QZAA 1VA9A 2VDPL 3Q8FA 4QAMB 1R3YA 4E5XG 3WJXA 5DANA 1CD9B 3GC2A 1WWBX 4MJMA 3BGAA 1FL3A 1IJ9A 5GGUB 2B59A 4UTWA 3G5VA 1HC1A 3T8LA 4NKIL 2EEAA 2JXMB 4Q8OA 3HVNA 2FWOA 1GIGL 4DI8A 1B4KA 5XINA 1CDIA 1NGXA 4G9FD 5EU6B 4HS3A 4LU5H 2AVGA 4AD3A 3FXIC 3FQWA 1E0TA 4ZODA 5F3HB 5CC5A 1U8QB 2YBTA 2IWEA 1OP5H 1I1AB 3HE6A 5ID0B 1RZJH 3U4KA 5F0JB 1AKJA 1QSFB 2ETWA 4P57B 2A9DA 4JYFA 1WYJA 5F7NC 1LP9F 4KNUA 1TPUA 1LDSA 4M3KB 3EEGA 4Y96A 1QOKA 3OQRA 1W1A1 3CWNA 2OL3H 5LVEA 2H3NB 3QDGD 4JFDE 1RZIA 2ATKA 4XO3A 3F64A 2KI6A 4GXUN 1YE4A 2PWVA 2VMCA 2HT2D 4HGXA 1JG9A 2HZHA 3E2HC 2J12B 2J8HA 4DVBA 4YC2B 3JWDH 3HZYB 3T2LA 5D8WA 3VA8A 4JDVA 32C2B 6PAZA 1B9BA 3IU3B 3L1FA 4MA1C 5IREA 4LPWA 2H8PB 4DP8X 4I1NB 4WEUD 4JHUA 3HGSA 1KEGH 4XK2A 2Y88A 1DEDA 5B7FA 2DN7A 2I9TA 3L9CA 2FIKA 2ZVRA 1QACA 3KYOB 3WTWA 5IB5B 5GJTL 3MKCA 1FY6A 4I88A 3EGDB 1XYMA 1JHTB 5FEPA 5TFSL 3BQUB 4RJEA 3VGGA 3RPTA 1OFRA 1BJMA 1HHKB 4XMPH 3AICA 5BXFA 1BQCA 2JF1A 4CC4A 4ODHH 1AFSA 2NDFA 3C5SB 5HNUA 4MS6A 2P46B 1O5KA 4Q4SA 4NRSA 4QE5A 3VFMB 4AGNA 1I8AA 2XV0A 35C8H 1VPXA 3SDXF 1QA9A 1FE8L 5K9QI 1IAIM 2PCEA 5CGMA 4BA8A 1NKGA 4UFHA 4S11A 4C56A 1CTMA 4R7NA 1UKOA 1EZSA 3OG6B 3UTZA 1CWYA 4XOAA 4C4KO 3KVKA 4U3HA 5D5MB 3RO8A 1CDCA 1DQMH 2PPAA 4HIHA 5E4OA 3MRQA 1CGSH 4GUHA 3AMDA 1CL7H 4Y16B 4JZJA 2OI9B 4G6KH 2VDML 4ERSH 3G6AB 1HP4A 2IQAA 1CFVL 3WDIA 4ODSH 4ODBD 2J1WA 3T09A 3GUFA 4AE1A 5JHDD 4ZSTA 3OHXA 2DV0A 5A8PA 4D9QE 2Y62A 1GKQA 4UT9L 1SYTA 2ZKXA 3C4UA 3DFOA 2ESVD 1BQHA 4JICA 4GWEA 7XIMA 3VRLF 3Q06A 3ZJAA 3KWVA 1KJVA 4UNTA 1MVFA 3ARGC 1S3TC 1LL6A 1KV7A 4X4ZA 1DWAM 1E2WA 1K03A 4BFAA 4WY7L 5IROD 4WKZA 1F6PA 1ACYL 1U3HA 2C1GA 1EFXD 3VKBA 3KTXA 3NFSH 3U48A 5IHLB 1Q6GA 2F74B 1K3IA 5FUCE 4JS7A 3C2AH 1TFPA 2OAAA 4XIMA 3A4FA 4ZK8A 3HUJB 2VXVH 1NIBA 1E6ZA 3GNOA 1O0VA 3LY6A 1WBYA 1KJMA 5IR1B 3UYCA 4CNNA 4IM8A 1D2KA 1J0IA 4EOUA 3VXOA 4GACA 2CIKA 3SCMA 4WFFD 1ZNNA 4QY8B 1QPKA 2DIAA 2OLAA 1M7IA 5KSUA 1IGTB 3B0XA 1QDSA 4L4VD 4Y2DB 2OO6A 1GJUA 1ME9A 3L65A 3L5WA 3C6LA 1VKXA 1J18A 2YRZA 5GRWA 4L8DA 2QMJA 1T0OA 1TVHA 4BZ2L 1BEXA 3BARA 4ICCX 3TROA 4XN4A 3ZT7A 5A2IH 2JK5B 3I75B 1OAZH 1SEQL 3W1UA 4XCFL 3FUIA 3ENLA 4QHMB 2A3CA 1VESA 5IVXB 2O61B 2J8UE 5IVNA 5CCKL 4ZOEA 4GUQA 3GTFA 1L2UA 2EPHA 1SXNA 4M8RA 2VMJA 3LXUX 1AZ1A 1LK3L 2OVLA 5A69A 4PFEA 2HCZX 3FT4A 1A14H 3BKMH 3QRBA 2IXQA 3TZVA 5E9DA 2GVYA 5EKYA 4PUDA 1E42A 1VGKB 1N8OE 5EU7E 2VWSA 2Y06H 5SX4H 5HHMB 4QHUA 1FNSL 4IX0A 3F8UB 1THFD 4N0YH 2DZAA 2YD1A 1I8MB 4FC3E 5HDWA 1OM3L 5JPNA 3CUFA 1XL9A 2IGFH 4GRLB 1YEKL 1F4WL 1OB1A 2APBA 3Q2CA 3R12A 1UWGL 3ITGA 2OODA 4GH1A 4HJJL 1TPEA 3W7JA 1QUNA 5MERA 5D1QC 1J9RA 5H94B 2V17L 3V4PA 4JE4B 5BZWB 4A2EA 1MCOH 3COOA 2JB5H 1WP6A 2FD6H 4YIQA 5FO9B 4HS6A 3QNXA 1FNEA 3PGDB 2Y1AA 2G97A 2NY0D 4NX0A 1IE4A 5JDSA 5TD4A 3MLXH 4B5VA 4QE1A 3HGJA 4DPBX 1UPMB 2V9RA 2YKLH 1OCRB 1XXDC 1JR1A 3D3VE 2ZZ2A 4R96A 3P0GB 4ODWB 1KTLB 4GLEA 1DQJA 1XI3A 4V1YA 5GRZA 4JPIB 1PCKA 3MMWA 4Z7NB 4LL1A 2RAMA 5IMMA 3I84A 3KPMA 3MROB 5GZOD 4X50A 2Z91B 3OKDB 3OG2A 4ZUTA 2I16A 3MKGA 2OQJA 1JV5B 4DJEA 3N44B 2Y6ZA 4DQAA 3VXQB 3SE9H 1P7KB 4HPGA 2AJUH 1BOGB 2V63A 1NMCB 1NBCA 3S88L 1PTGA 3MNMA 1QNSA 2G2PA 1BEYL 4XXWC 1A4BA 2I9LB 3IFOB 4Y9PA 3VH8B 1Z89A 4NQTA 2V5LA 1A2YB 1W5OA 3BWZA 1Q8MA 3GJEB 5FCUH 1WDQA 4DQOH 5LDUA 5GGUA 5EB9A 4QRPE 1IKNC 3S5OA 1NFKA 1LO4H 4Z3FA 1MAML 3LJ3A 4O1CA 3I50H 2JXMA 3SZ8A 1PVHA 4YHPB 4MNQE 1ZB5A 3PUEA 1RQBA 4Y19E 5EU6A 1U8MB 4KI5F 3WV0A 2XN9D 1XS2A 3II1A 5F3HA 1M3JA 3T08A 1RY7B 4HTBA 3ZDYE 5ID0A 1NOUA 1UIOA 3QV8A 5BQDA 1QSFA 1X7QA 2B9BA 5FWRA 4TR9A 4P57A 4L56A 2RUSA 2GT9B 1M6JA 3QAZC 2ZP8A 3L0KA 2OA9A 4Z3EA 3MJ9H 3OAZK 4WVRA 3DG7A 5E09A 2C3WA 3MLVH 4I85A 2TSAA 4HHLA 5HHPB 1B2YA 5HJBA 3LERA 3HZYA 3D9AL 3W1AA 5AW4B 2ZCZA 3KJ4C 4YDJA 4GG6A 1KCRH 3BW4A 2DB8A 3IU3A 1LDCA 1K6QH 4FNSA 2H8PA 2OXGA 2HISA 5I74C 5E5LA 3VSUA 5G1MA 5FIPA 3SUUA 1A21A 3FHAA 3TA6A 4HIXH 3S1VA 4JHVA 3O9WA 5IB5A 5FJUA 3KEHA 3WMSA 5EGRA 4PVNA 3EGDA 2O4MA 5LIXX 2FWSA 3BQUA 1TETL 4WFEE 3HBLA 2W0PA 1HHKA 1ZV9A 4L8SC 1N6VA 2X44D 3NJHA 5EUKB 1A0QH 4FO4A 1NWTA 3DIFB 2KS0A 1OGGA 2XIQA 5AZ0A 5CEZD 5DI8A 2VYOA 3MVTA 4A05A 1KR0A 1C7SA 2PURA 4QXUL 1YIXA 3EFOB 5DHVB 5LHEA 1MQRA 1IB5A 2I7GA 2B5IC 3IPFA 4X5PA 5C9KA 3S9ZA 5ESAB 1OSPL 1T5KA 4I5RA 4W89A 5D5MA 1CPUA 3BZ5A 2A9AA 4J12A 4HDIA 4X7EC 1RHCA 3NEOA 3RBSA 5DYFA 3IFLL 4FG2A 4K38A 1UM5H 4JVWA 2H45A 4Y16A 1VB9A 3N43B 1NC2D 3NL3A 3SO5A 3G6AA 3GAKA 4WW1B 2XWRA 4HSCX 2Q3RA 5A2KH 5JORA 4HHHA 4LOVA 4P4RB 4S3JA 4ONFL 4QDWA 2HK0A 3GR4A 1IFHL 4XVJL 4HUWB 3SSJA 4XB3A 4IUGA 5DHDA 4LEFA 1KC7A 2XU9A 3OV6A 1EXPA 1OXYA 4CD5A 5E2VL 3F6JA 1FWSA 5C0AE 4ZO9A 2VGFA 1UGNA 2F74A 1JRBA 5C07E 3VFCA 1X4ZA 1O6VA 2CH8A 4FSAA 3HUJA 2PRMA 4GZIA 5HMSA 2VITB 5DMKB 3IIOA 2RR3A 3VJ6B 3DC0A 1NQKA 2R1NA 3KVJA 3PV6B 5CEZH 1MW2A 4BFBD 5JXEC 5KWYC 4QY8A 4JUSA 1CFSB 1IGTA 1EA0A 1JCTA 4F8LA 3QUZB 4XT1C 4KCWA 1KENH 4XISA 3CG8A 2WZ5A 1FBIL 3AHYA 2B0MA 5D7LA 2X10A 3CLFL 4S0SD 4V11A 2E09A 2W63A 3KLHC 3CC5B 3LN9A 1KYOJ 3RX7A 3EJTA 3CV1A 4OBRA 2JK5A 4AD2A 3TO4B 3I75A 5BO1H 4PEEA 5B4MC 3C8KB 1DEEB 3C56A 3ARDD 4QHMA 5MHSD 4S3AA 4Y4FB 5IVXA 2FPVA 4Y4KB 3H2OA 1PG7H 4Q89A 3EJPA 5BMWA 4JQ4A 1I9CB 1NPUA 5TIMA 3MV9E 4NSBA 3FDGA 2WZAA 3UF9A 4FL4B 4EEEA 3IKKA 1E27B 5FW7A 1Z2KA 1F3DJ 2OLHA 5E6RB 1FUNA 1P7QD 1VGKA 1U5HA 3QDAA 2QS8A 4KNTA 5ID1B 4X7SH 1T4WA 5SWZD 4NQQA 4P2QE 1LQ0A 1XYZA 2D3JA 4GRLA 1BWMA 5LGKA 5TE4H 3A3HA 2CAKA 1RLWA 1DBJH 4UTBA 5KYNA 4PJCE 1KTRL 3CVIH 4HPYL 5KN5B 1FZJB 2XWBB 3K8KA 3GKFA 3QOMA 1NWSA 3T07A 1BZ9B 5BZWA 4WJG3 3OIXA 5EZJB 5FO9A 4DZIA 2IMNA 3HIJA 1AHWB 5I0XA 4NI3A 3BI9X 3WGUB 3RX9A 3PFUA 1WDDA 2G0WA 4HCGA 4PM1A 3ZL1A 3FY1A 3W70A 1V6YA 1BYCA 4E4UA 2H90A 3OW1A 2EEBA 1N55A 5AKSA 6TAAA 1T8QA 2C1IA 3MRKB 1PWLA 4HLEA 1T5WB 5EFFA 3MR9A 1LYQA 1EJUC 3HBQA 3LNDA 2HUEA 3D39E 2NW3A 2WYTA 5D2LE 3HS0C 3US9A 4ODWA 3A6OA 4HQVA 3IF1A 2GIXA 4YIWA 5B38G 1OGAB 3VD4A 1DE6A 1RPKA 4QT5B 1LO2H 3O6KH 4OB5H 1I1CA 3MROA 1DO6A 3S2AA 4WUKH 3OKDA 2LLEA 2E4TA 3UXKA 3HNTH 4WJ5A 4B92A 3ES8A 3PZMA 1PZSA 3ITCA 2XY2A 4QM1A 4R9OA 2WZ6A 4EVNA 4XNUH 3FSAA 1S7QA 1P7KA 3MRFB 2WHKA 4JR9H 3TCEA 1BOGA 4MNKA 1FFTB 4N0FA 1DVZA 4C4BA 1F4HA 2NNXA 3GSMA 2OQLA 4N2YA 3BW9A 3VH8A 1A2YA 5L88L 3GJEA 5H35A 2D9QB 1HOEA 2O4EA 4ODTL 4X8GA 5F3BB 1H62A 1UP3A 4Q8QA 3BRFA 1F8TH 2B77A 4B5EA 5IXEA 4Y4HC 5IFTA 3A0OA 4RX4A 2X8RA 4JHBA 4AC2A 4UT6A 3FKRA 3G0XA 3J2PA 1RZGB 4M4RB 3RFRA 3VMNA 4FCAA 1U8MA 2A3TA 2GABA 4R83A 1TJMA 1E6PA 3AY4C 4DP0X 4B16A 8A3HA 1SLVA 3CWOX 2W27A 1XH2A 2FJHB 1FWDC 1IEHA 3MOBH 3O1NA 1PHQA 5JOFB 1QTWA 4QLJA 3LH8A 4I3RH 4UUJA 4JFOB 2DQHL 2HQAA 1Q13A 1EAQA 2J8UB 1IC4L 1KUMA 3AIVA 5HHPA 3I6EA 1GUVA 4BF9A 1HESA 3DG3A 4LYKA 3H56A 5FCSH 3L7RA 4EUPG 2GOKA 1LJMA 2J7LA 1SFDA 1WO2A 1R3IL 1QO5A 3INUH 3BGFC 2B1AL 2YC1B 4LARH 4RMSA 4KAQH 4FA8A 1F6LL 4MJZA 1UWQA 2P28B 3GSRB 4OCWL 5CZXD 2MNJB 1LQ2A 3U46A 4MZ2A 1D5BB 1Z8AA 1LOLA 2WWDA 3BN9C 2NW2B 5IDIA 1FPTL 1YYLL 3WUFA 5TF0A 1H0DB 2FQDA 1QQDA 2J1KA 4I2XE 2H2SC 5D6DC 3R0DA 5L2JA 1EBHA 3EFOA 3H9SD 4QWWC 1AG1O 1VADB 5DHVA 3VXSE 1O5XA 3W87A 1KCSH 4J7RA 4D6JA 3DI2B 1HCVA 2VDNB 1TQTA 4IRSC 1AIZA 4QKTA 1FHVA 2EQDA 3CFCL 1QFWH 5HPCA 4IKKA 3EXLA 3TT3H 3D3VB 1FG2B 4DPRA 1F3WA 3V0TA 2AJVH 4RGMB 1L6SA 4FQJL 4AKPA 2QQKH 2PTWA 2P1FA 1GAFH 2J4WL 2HFTA 4WW1A 1CZ1A 3B7YA 4XPFL 1GK8A 4WDXA 3QQDB 1F6AB 2OTDA 2ZWLT 4ASTA 4BS0A 2XTJD 2OMUB 5L9FA 3V9EA 3ZHKA 5KSAC 1IQWH 1TPB1 3S37X 5DJ0B 1JGLL 1OAKH 4NILA 2V2DA 2XU2A 3PDGA 4AJWA 2E46A 5D2WA 4LOFA 1BFOB 2Z7WA 4MSSA 1HKFA 5A2LH 3BLBA 3CFBA 2C3XA 1YNQA 4PB4A 3BOXA 2YDQA 4K68A 3QR2A 4E9LA 3G6JE 1EEPA 4N20A 3GRBA 1UPPA 2VITA 5EU5B 2ENQA 4W88A 3U6XS 3CHQA 4QMEA 3VJ6A 1IVTA 3GNRA 1OYAA 3PZQA 4NGHH 4A2HA 1AJZA 1SVDA 4U0QB 4QRPB 3U30C 4OD3L 1CFSA 2CLOA 4PFHA 4XVEA 3ZY7A 2YB4A 4AYSA 4I3SH 2OMNA 3FO1A 4MNQB 2VWEE 2Q76B 4LHQB 1FCCA 5CSRA 1J9TA 2IALB 3ML8A 3PGCB 3E9TA 2EUXA 1QCWA 2YX0A 5DQJB 1QNQA 3QIWD 2IOOA 3ULUL 5A3HA 1KA9F 4KGLA 3W2JA 4JFHD 1EV2E 4XO7A 4HOZA 1CF8L 3C8KA 4HJGA 1UKPA 1DEEA 5AHFA 3VIOA 4Q4OA 3FRPG 1PX3A 2G8ZA 4W5ZA 1GOWA 2F6XA 4Y4FA 2V33A 1DQKA 4P46C 3ZDYB 1KC5H 4Y4KA 4QX4A 4OR1A 5F8RC 4JPKL 2RTTA 2P5WD 1KBIA 4PHXA 1SUJA 3MLYL 2XM1A 5MKGA 1TWSA 2V5SA 4HUVB 2VOMA 1HL9A 3U2ZA 5ISZD 2JJTC 3F7RA 3K71B 1G7LB 4JFDA 1E27A 2XQYK 5KITA 3PNRB 1YEGH 1DIDA 4P8XA 2WLZA 5ID1A 1XEUA 3ISYA 4X7FC 1ZLUH 4JKNA 3JXAA 4JQXC 2D0FA 1JPSL 4ZFOL 3BXNA 3PWAA 1FRGH 4IBTA 2MEJB 4BD4A 2A3HA 1M7OA 1W8OA 2P10A 3Q8EA 1RBLA 5KN5A 5C09E 1FZJA 1KW1A 3DTUB 1X6UA 2WWOA 5KG9B 4TNGA 5DC4B 1I85C 5EZJA 4Q7NA 3GGWB 2J6XA 5B4MD 1LGVA 3CXHK 3OXSB 4FHAA 4WY0F 1VC4A 1AHWA 4GP5B 2R4RL 4A7UA 5H8DA 4ZMQA 2P8PB 3N6JA 4JW3A 3IARA 2XACC 2IGLA 5AAPA 4N42A 2O5XH 3OSVA 3N25A 4D9RE 4O5LH 2ZCKL 5DJ2B 1GZPB 5TGBA 5D7JB 1V3KA 1BWVA 3NPXA 3I6TA 4PJXE 3RF9A 1ZAIA 4OZFB 4E9VA 3TSDA 1ZLVH 3D3AA 2IPWA 2BY2A 3WNLA 3UYPB 2R69H 4QT5A 4HXBH 3PY2A 4OJFH 5EULV 4B97A 4XSLA 2O56A 2NR6A 4PJ5E 2A85A 4S0HA 2AGKA 4WJXA 3ZZLA 3ESMA 5DD1H 2NY6B 3M41A 4IOTA 1KFGA 3QEQE 3VSVA 2QPFA 4AZBA 3S96A 2WCAA 1MFEL 1KD0A 2I24N 3OMZA 2EE2A 1VFSA 2QF7A 3GLAA 4F2UA 2ADFL 1JFQH 4TF4A 4KK8C 1RAKA 1DJHA 5C0AB 3MKVA 4RE0A 1OD9A 1U22A 3HPLB 5C07B 3EO1B 5AOMA 1NJ9A 3GHTA 5KSBA 2PDQA 4PAZA 4P5TD 5F3BA 3CH8A 4K37A 4JN2B 1PQZA 2C9AA 3C5ZD 3SB3A 3GS6A 1INDH 4IBYA 5D09A 4JIRA 5DFTA 5BW7A 5D71L 4L29A 1S3RA 2ZC8A 3DENA 5JBFA 5LGZA 4P9ML 4XNZB 3MBDA 1RZGA 3MC0A 2VLME 4LDOB 2X87A 4F7TB 1TTFA 4XP5L 2WLHA 4MCYB 2PF6A 2GPZA 3UDWA 4F7MB 3E3QC 3Q5TA 3TX4A 1OC7A 1E6XM 5LKYA 3UJRA 3WJZA 4CQDA 1MLCB 1E1EA 3PG9A 5GGVH 1ZT1B 2HWZL 3I6KA 1KBVA 3BZGA 4X6FB 4M7SA 3WDJA 3QSRA 4MPQA 3RM8A 4JFOA 1XGYH 2P80D 1YQVH 2ZQ0A 1W9UA 3FFSA 1RHHA 2J8UA 3IJQA 2VERN 1KBJA 4IDJH 5I1CH 1IC1A 4JTRA 5CZVL 3MV9B 3VXPA 5IWLC 5H4YA 1ILUA 4ADTA 4LVAA 1X38A 1W9XA 1X98A 3ZYJA 4ZUVB 2WC4A 3PXJA 4XPBL 5LXGH 2YC1A 2P0IA 1UZDA 2ICCA 2JFEX 1HJBC 4RFNB 1T0MB 2D2GA 4YTTA 4GG9A 2O5ZH 3GSRA 5GGSY 1AVAA 4P2QB 1LL7A 1JMZA 1HHGB 2H3DA 3HNVH 5DBTA 3L5AA 3NN8A 4F37F 4HJWA 1Z32X 3EYPA 1KNOA 3THDA 4PJCB 1D5BA 4X6BB 2NW2A 1RIUH 5I1HH 4OOZA 5F7HA 1GKRA 4ONVA 4APXA 1MEXH 3GKWH 2EO1A 5DYOB 1H0DA 3N1FC 4NKOB 2G3FA 3BQVA 3RGTA 1YA5A 5K3VA 1R3KA 3BO9A 4P2RE 1FH7A 3RWIB 1JULA 1IQ8A 4DJDD 1EDTA 1VR6A 4R7OA 4KRNA 2V5BA 4TX6A 4ELDA 4TLKA 5D37A 3BHBB 3PABA 4TPRL 1OL0A 4RUBA 4BF5A 2UY7B 2UY5A 2E9BA 3D3VA 1FG2A 1VERA 4AGLA 5D2LB 1N7KA 1ZVYA 3U1PA 3E0WA 1UOWA 2CESA 4B15A 2APFA 5FYJU 4GW5B 2HT2C 1Q9KB 1B3OA 3QQDA 1GHFL 3AS1A 4QJ1A 1NDYA 2P43B 5IRPA 3NIYA 3HM7A 3G5VB 2OMUA 3CK0L 4XI5D 3WAJA 4Z1AA 2K8QA 1S7WB 1NGXB 3HBPA 5HMDA 4IOSD 2VXQL 4BFNA 4HS3B 4IOFD 4WK2B 3KL0A 2TODA 5CCJA 3UMTA 4JFFD 3PM6A 5I66A 1E8ZA 1IR1A 3THAA 1XH0A 1ERNA 1TZIB 4ELME 3MSYA 2EPOA 4APQB 4IRSD 1G5AA 5JBEA 1ONQB 1AKJB 4J40A 4WHBA 2PXYA 1MWAB 2B7DT 3PPHA 2FJUB 5E95B 4GRWF 3GXNA 3MJ6A 5BQ7B 2E1DA 4OFIA 2E7BA 3T3MF 1CECA 1HYSC 1RZIB 2ATKB 1G0CA 4QRPA 4GUFA 5B39G 2CBJA 2AJSL 3L66A 1UCBL 1EMTL 3TUUA 3F5JA 4L61A 4HQQH 4I1RA 4NNAA 2XJLA 3PWJA 2E27L 2KPWA 4MNQA 2Q76A 3C0QA 3CUIA 4Y19A 2EC8A 3QWNA 2J43A 1OGTB 2IALA 4J23A 2RHEA 5DQJA 5DRCA 4AQ1C 2X1QA 2IANA 3VA2C 3LTYA 3CX5K 1TYJA 2QADB 3FUJA 4PV8B 5DGRA 3UZVA 2YEZA 2OO0A 3RWCB 1KYAA 2VTFA 2I9TB 1W0VA 2FIKB 4J5NA 2UZIL 2WUBL 1V0NA 3VXRE 2WOBA 2ITDB 1FP5A 5G4OA 4CL7A 5KAQG 4FHJA 1IC0A 3W0KA 2GHZA 3KBEA 4HUVA 3S5LB 5I8CA 2I17A 3VFRA 5KYUA 1G7LA 3VI3F 5I8OH 1JXKA 3ZE2F 1BQSA 3SE8H 4WSGA 3IGSA 1ZLEA 1PD1A 1MFAH 3G1DA 2VFHA 4KKRA 1MDLA 3CMGA 2EE0A 5K9JH 4NUPA 1QA9B 2XIBA 4M6NL 4MPKA 3VIJA 3UJIH 3C09C 5F1UA 2F61A 3UTZB 4H1LB 4AI7A 1EIBA 4AWUA 3BOVA 5FYKL 4QF1A 4JDTH 3APGA 1B3WA 2MPAH 3MA9L 4HIHB 3MRQB 4N1EA 4OF0A 4UTLA 4FG6D 4FNLH 1DQUA 4MKNA 1T7VA 4HA0A 3OXSA 2XFXB 2TSBA 4FQHB 3CZEA 3QPXL 2EUZA 3LNIA 4HUMB 3DMMC 3SY5A 2H3XC 2D31B 4QHRA 3UPAA 2C34A 4S1QL 3KHDA 2P8PA 4FOKA 3DOHA 3CPLA 1IKFL 2DDXA 3NABL 4I2XB 3VQLA 1TOXA 3L4XA 1KJVB 1T89A 5DJ2A 1ACZA 3HR5B 4GXVL 3SODB 3VXSB 4E9WA 3UVAA 5E08H 5DDHB 4PR5B 4LSRH 4X8JB 4WEBH 1FVEA 4IGNA 2RA1A 4NO0D 4QFUA 4OZFA 1KLYA 4LBEA 3OAUH 2EKJA 5C0BD 5CJXA 1KJMB 4LAQL 2X1TA 3VXME 3CUHA 5T1KD 4CCEA 1P5UC 3VGEA 1BF8A 1ZA6B 1K7EA 3VXOB 4UNUA 1H11A 1ODUA 2PWHA 3I2CL 4NNXA 4KRPB 4YEFA 1NAML 2HUHA 1M7IB 5KSUB 4XHJC 4G8IA 2J71A 2NXYC 3OF6A 1WEJL 3FCGA 4R85A 3WD1A 3MV7D 5I1DA 2C6QA 3SIKA 1XTLA 3MA7B 3KS6A 4L8DB 2ERJC 1ZLWK 4QO1A 1HJVA 5C0AA 1JCNA 2V9DA 1U8JB 3VYOA 2B20A 3NRFA 4L0ZA 2DMKA 5C07A 3EO1A 5MENE 3VD2A 5FEZA 1XF5A 4PUBL 2D3VA 1EHNA 3CQFA 2K4WA 1WS8A 2YPVH 1S2VA 4X83A 2PDKA 1FWHC 5H37A 4O9HH 4PJAF 3GVRA 5C9UA 5H2ZA 2DU2A 1WZ1L 2IXQB 5DEZA 3B3IB 3V7MA 1HKIA 4MKTA 1TKKA 1SQMA 4U4MA 4ABQA 4YHOH 2WC7A 4OFPA 4N2FA 4OCSH 4F7MA 2J9YA 4DXVA 1Y1UA 3V7AE 5LGXA 5KYYB 3H8NA 4R4NC 1RK5A 1Q1JL 3B2VH 2MCPH 3E0IA 4H0IA 4B9IA 1KBKA 1OB1B 4NN5C 1MLCA 1UH3A 5DVLA 4NZ3A 4X6FA 5MERB 5GZOC 3LD8B 3WTTA 3V4PB 2FQFA 5J12C 2YMXH 4YIQB 3OD3A 4DEPB 1EEZB 2Z1PA 1AQKH 5FIEA 3CSPA 4Y9OA 3MV9A 5IBLC 4HNLA 1YEDB 3QNXB 1FNEB 3C2SA 5IQOA 3X2QB 2KZWA 1C93A 4B2DA 1JZDC 4XNDA 1R0AL 2CLHA 5AY7A 4UINL 4CNSA 1CGUA 2COQA 4IWWA 5ALBL 3FFCD 4TTUA 1ILSA 1X7IA 3WEZA 1TXKA 4LBUA 1T0MA 3NA4A 2VL4A 4G72B 2E6JA 4P2QA 2YW3A 5ADOH 2ZSWB 4R96B 5FO2A 1TUFA 3VC6A 5TE6L 1Z1WA 4WU7A 3MODH 1DQJB 5C08A 5C09B 4EO5A 5DYOA 1GPFA 4UTHA 2XRAH 4NKOA 5A7BA 5IJKA 1V02E 5IMMB 3R6IA 4UQ2B 4NP4H 3KPMB 3SBWC 3N85H 1OZTG 1GOMA 3C2EA 4IF2A 2GK2A 1OAUH 3TCTA 4OTXH 2OQJB 5GRJH 2A1YA 1Z0MA 4I3GA 5AW7B 5CPNA 2J8FA 3H42L 2P3ZA 4WO4A 3BHBA 5L9DL 1I3GH 4BFJA 4Z0SA 2UY7A 3E49A 3QO0B 2XTLA 4KX8A 1SSDA 3D39A 1H7PA 5D2LA 2C9QA 1RU9L 1JPHA 1NGYA 4PR4A 3NCBB 1PTZA 4GW5A 1Q9KA 4M19A 2A9NL 1FORH 1TTGA 1LUCB 3BD4A 1K4CB 4HGKC 3RJQB 4AIEA 1A3HA 5HQEA 1KKOA 3K2IA 3BSZH 5AVQB 2PP3A 4FFTA 1F76A 4PJ5B 2V9UA 5FGRA 1J10A 3FQRB 1S7WA 1AANA 1YYMH 4IMKA 2WQRA 3CE1A 2OMAA 2WMFA 5I07A 2W91A 3ZJ8A 1PZ0A 2XVGA 2Y7DA 3TGXA 4PYHA 3VNJA 1MHEA 3QEQB 5J1SC 4HVXA 4TIMA 1TZIA 3CH9A 3TVMB 2DJXA 4APQA 3M88A 1M71B 1ONQA 4L4MA 4Q4QA 1X7QB 4LMQI 1MWAA 1OCZB 4AFYA 4KWVA 1A0EA 4HUCA 3CVHL 3B0YA 2F08A 2HJPA 5BQ7A 4R0LA 3V4VH 5AAMC 3GRWL 3GH5A 4DLMA 6FABL 1MRDL 4XSMA 4C1LA 5CCHE 4Y0GA 4W1TA 3L08A 5E1QA 2YCIX 3HA1A 2HTKD 3O4OC 1CVSC 3UTPD 1X5ZA 3DNKA 1PZAA 4YDJB 4GG6B 2BVWA 4QRRD 3P5ZA 1OGTA 1KCZA 5A6TC 3PHSA 2KERA 4JG1L 1PY9A 3HG5A 2OXGB 1ET8A 4PV8A 3THML 3RWCA 4YHEA 3NSCA 3OYXA 1AR1D 3O9WB 2ADYA 3WYZA 1B5TA 3PUUA 2ITDA 1AE6L 1CBJA 5I8KH 4NWUL 3CZKA 3D85D 3Q94A 1VCAA 4KVPA 2YA1A 3B7TA 1Z3GL 2V9QA 1PLBA 3S5LA 4AMCA 3A67H 3EH2A 1RY0A 2WXPA 1OWQA 1OINA 4X80L 5C5YA 1MFUA 3WQ6A 5DI8B 3PLYA 2Q3AA 1HYSD 5FEBA 4DHGA 5GS3A 4JX6A 3APDA 2Y5JA 1OTSD 4AG4L 2EGZA 4YWSA 4KFNA 4H1LA 4K7YA 2NY4D 1NCWH 1FWEC 4PJ7F 5LNVA 3GDBA 4HDIB 3VMPA 3VFOA 1PS9A 1OFEA 2DKSA 4AHQA 1RH9A 1JNHA 3U2EA 3FYEB 5EBWB 1QK2A 1U5JA 4IRZA 2XFXA 4F1ZA 4XZHA 4FQHA 3WUWG 5JH1A 4XAKE 3R10A 2ZYFA 5FYLE 2I57A 2J74A 2D31A 1LM8V 5HHNB 1VBJA 5JORB 3S37H 5E6UB 4R7VA 2QULA 2P0OA 2CXGA 1HSBA 3ZE1E 4I2XA 4O4WA 4MDPA 2ASHA 1MJ8L 1RZMA 1OIFA 3HR5A 5A3ID 3VXSA 4P2CG 4MYXA 4CILA 3ARDC 3IS0X 5DDHA 4PR5A 2CO7B 4X8JA 5TJWK 4Q6IC 4KQ4L 1QASA 4PJ9A 5JMRA 1HGWA 2G4GA 2FEEI 3WKML 5KSBE 1K9TA 3L5LA 3KBJA 1GA2A 1SZFA 3PHOB 4H8QA 3MLSH 1IGCH 2VLLB 1J6OA 2ZUWA 3G1VA 1X7SA 1ZA6A 3EDKA 5EOQH 4MAYD 2A7RA 3W0WD 1ODZA 1F73A 3NVDA 3T3PB 2JEPA 3V6ZA 2GJ6E 2VEGA 4MHHG 5HJXA 5F4SA 4DO5A 3DMMD 4JPWH 2D7OA 1DR9A 5D7LB 2IQ9L 2UZXA 3MA7A 4OIAA 4N25A 1UWEH 3SAZA 2DBJA 4JHWL 1P9MA 1U8JA 1W9PA 3TPKA 4LC6A 2A9MH 3BLEA 4QP0A 3LN5B 2UBPC 1F4YL 5I82A 2BHUA 7CGTA 2GJZB 1K2DB 3G6JA 3UVIA 1R5IB 4H8WC 5HDOA 2ZAHA 4CNIA 5C0RH 2UWEF 3LY0A 4H88H 3NA8A 4L1DA 4YWGL 1IARB 1QNZH 3B3IA 1R6VA 3ABGA 3K1DA 2HKAA 2C9RA 4FI6A 1E6JH 3RAJH 2A6JB 4BI5A 2D7NA 1HNFA 3BP7A 3GTVA 1OX5A 2FZDA 1KLUB 1M9SA 1E9QB 3KPRE 4NN7B 2WVTA 5KYYA 2AK4E 4XHJD 5I0VA 3GK0A 2NXYD 5KANG 1KB9J 5FKAB 2ED7A 3SKOA 1H3TA 3CB8A 3K6FA 4HB7A 3M8OH 3O3AB 4RZ5A 2A3BA 4HK7A 2XKNB 3VXRB 5E03A 3OZOA 3B3BA 1GEHA 4P8VA 2PW1B 1EEZA 1WBXB 4YDIH 3RR1A 4M6OH 1L7TL 1TUXA 3QEGL 1YEDA 3EJQA 1QU4A 4M48H 6ENLA 3C87A 2UY3A 5I5RA 2ZOKA 3SCSA 3URBA 4FOUA 3TNOA 3BEVA 3UOAB 5B7ZA 3BKJL 4LQFL 3UQNA 4W4OC 2Y07H 4BKNA 4LVOC 4NM4L 1GGIH 2W62A 3MR9B 2R4SH 3LOTA 2NW3B 2ZSWA 2QPXA 4MYPA 2W9DL 4AU0A 4LF2A 1M1BA 3IF1B 4TXEA 1AS8A 4R4ND 5D7HA 4BI7A 4XODA 2CRYA 1NC4D 5C09A 2EXSA 4WEEA 2AKMA 4S10A 3Q6GH 3O81A 2HK1A 2ZTBA 4LSSL 4GFIA 5I1LB 4UQ2A 1YNYA 4LL4A 2J7CA 3AU6A 4V2CB 3KCOA 1OW0C 4UOW0 4WJ5B 4GVIA 2KMWA 1S39A 2ED9A 3FEQA 1LRTA 2B0SL 4OIIL 4PTWA 5F1VA 4EVNB 4L3EE 3GI8L 1YY9D 5IBLD 2FBRA 1S7QB 1SMOA 2KC0A 3ZTNL 2IDUA 4CD8A 3BN3B 2E7CA 1OFOA 4MY8A 2ZWYA 4N0FB 3QO0A 4J4PA 1Q7MA 2VRQA 2POTA 1N4XH 5G2IA 4P5KA 4PJXA 4UFIA 3BW9B 3MLWL 1NQ6A 1I9JH 1MZZA 5H35B 2IPUK 5F96H 3SGDH 1LUCA 4G6ML 1K4CA 3EGSA 1ZAHA 1FLRL 5FDWA 4UR9A 2Y6TE 3SFWA 2FLRT 3VXMB 1RUQL 4WWKB 4PJ5A 3EPMA 5CSGA 3FQRA 3PS7A 1I2QA 1H8LA 2IGTA 2O7QA 4BEQA 5B1AB 4BXVA 4NNPH 2IANE 5IK3B 4LCYA 5CZXC 4BUGA 4FAMA 1Y6NR 4M93B 2OZ4H 3QEQA 2AI0H 4WHYH 1RUKL 2CBPA 2WXQA 5KVFH 3TVMA 4U6TA 1KJ2B 4MGXA 2BNRE 1M71A 1UA7A 3X1NA 3UAJD 3QZNA 5A8QA 1E0OB 3UX9B 4WGXA 4IJBA 4BRJA 2RAGA 4UUJB 2AEQL 3JT2A 1Q7QA 4LE8A 5MENB 4L5FL 1GQLA 1DZ0A 3VE9A 3NTYA 3WK1A 1TELA 4PJEE 5AOLA 3EX6A 2BRRH 1EYWA 2ZFAA 2A6NA 4N2DA 5BV7L 3JWNG 1HILB 4UMAA 4OI7A 2VXUH 5FM4A 2CLFA 2OKOA 4Y9AA 3FHEA 3WK2A 3A64A 4QPEA 2LTQC 4LO9A 4QG6A 2Y36H 4WR3A 3GLEA 1FSKB 3EBVA 3ABZA 1IM9B 5LXEA 1EOMA 2XTJC 3OZ9H 3U46B 2ZP9A 3HRZA 3KBMA 2WWKT 3F7QA 1E5AA 4IMCA 1U8CA 2YEQA 1MI5A 1QQDB 5L2JB 1NLBL 4K3JL 4G1MB 4L4OA 4J28A 5AKTA 1IXOA 5T91A 1J5IA 3LZNA 1A9EB 4DKEL 5ABZA 3T9PA 5LGHL 5CSYA 4LEXL 4ZFCA 1CLZL 4Q6XA 1V6XA 2WYZA 3N3TA 2HLFD 2WGNB 1I1XA 3P81A 2CU9A 5DQDL 5EBWA 2YKKA 4D0DA 2N0KA 1ZUAX 2H3KA 4P3CL 1JIBA 3U2OA 5HHNA 1A6PA 3ZBMA 2WQDA 2UVFA 3WF0A 1KIUB 3ZYOA 5DCCA 4LCWE 1EGJL 4BUHA 5HWNA 1SFLA 2FQGA 4BDVB 3LD5A 3QIWC 1DVFA 5I5MA 4P2RA 4EXKA 5L0QC 4UFMA 1QHPA 4UIKH 2CO7A 3VOCA 4M00A 3CFBB 1TT6A 4DEWA 4IXXA 3DHJA 3V4UH 1G87A 4ZAKD 4OUUA 1A5OC 1NCDL 2PGRA 3MRLA 3PHOA 3W9EA 4PUJA 1MNZA 2VLLA 3F03K 4CQ9A 5C0GB 4Z0JA 1PV8A 3NIGF 4DP1X 4HCRA 1P4BL 1Z5YD 4QYOA 1KNWA 4LALA 3F4NA 2LV4A 1UURA 4HUKB 4H0GA 1UUNA 4W7VA 1G4SA 1VKFA 5DFAA 3ZL2A 4XZ4A 1HJXA 5EEVA 2Q3OA 1Z48A 1SJCA 4RV8A 3FO1B 1R5VB 3CD4A 1N26A 2GJRA 2AC0A 2EEFA 1NCCL 1PZCA 1KN2H 3F7JA 3CZUB 3IGFA 3QFGA 4HJGB 3BD3A 3LN5A 4ELMA 2IBBA 4ZQMA 3WTYA 2GJZA 1K2DA 5AD0B 1R5IA 2ZZ1A 2P8CA 3F01A 2ZOUA 2J1ZA 2CKNA 5MKGB 4NPYB 5I15L 3GRIA 1XQ4A 2CXEA 1DIEA 4JM2F 5E2WL 4JFDB 2MCAA 2A6JA 5FFLA 5HPMA 4Y1SA 5HYSB 1W5QA 5DRZA 4Q7DA 1KLUA 4D8LA 1RFDH 1JF5A 3ZRFC 1E9QA 4BZ1L 2WOQA 4P5UA 4DGIL 4LAMA 3WQCA 4CNOA 3BWAA 5ESQB 3M1ZA 3BXNB 2EDTA 3I9GL 3WLIA 5DCBA 3HC0B 1GR7A 1DWGM 4V1XA 4O4YL 5TDNB 2XH2A 5FKAA 2REQA 5C08E 2BSED 4OECA 1BFVL 5CP3H 2XIIA 4PRRA 4HG4J 3O3AA 4O02L 1E4XH 2XKNA 3VXRA 1EQPA 2PW1A 4ZXOA 1WBXA 4URIA 3H22A 4JFQA 1BYPA 1G7UA 4D6FA 2F5AH 4S1RL 1XCFA 5AW0B 2DZWA 4CEUC 4PI0A 1ZTXL 4PBDA 3ZR5A 3QUXD 1KO0A 6REQA 3JQOB 4ALDA 4N68A 5HBFA 1MCHA 4N87A 4WJKB 3C61A 4PWJA 5BNKA 3TBYA 5TGBB 3NDYE 1AW2A 2ZWSA 2WJZA 3IKCA 4P5TC 3GMMB 4F40A 3C5ZC 5I1JH 3D4YA 3E2RA 4Y1TA 4NC1C 2DEYX 3ARGA 2D03H 4Z3TA 4AQZA 5B7EA 4EXBA 2XWXA 3CQPA 3DKLA 4BQ9A 1A6AB 1KIQA 5I1LA 4M43L 1HTIA 4GI8A 2VC9A 3AO0A 3TJXA 5D8ZA 3KPSD 3ETBJ 2GK1B 4RNHA 1YPIA 4HYRA 1CE1H 5D70L 2SODB 3CK5A 3QCTH 3S6OA 3ZE1B 1I8LC 4AMXA 5GJMA 4NM8H 4ENLA 4M62L 3S96B 4RGNE 2E0PA 4DXKA 4Q9BA 3J27A 1R24B 5CBBA 2Z7ZA 4L6HA 4A8NA 1EP1A 2VR8A 3TTOA 5HULA 4LVBA 3S5SA 4MDIB 4OSUH 2HEJA 2Z8SA 2WO4A 4Z2LA 1NJ9B 3EYOA 3LNMA 2DYPD 3NGBC 5KSBB 4ZD3H 1H9DA 1PQZB 2XXCB 3RIFF 3XINA 2NNAA 2CO1A 4RRPM 4NQUA 4L29B 3VXMA 2PP0A 4MGGA 3CZJA 4WWKA 5K59F 5CNHA 4H8WH 1ZENA 2ISFA 1E30A 1WKDA 1DSWA 4EPEC 4PSPA 4YVUA 3WJJA 5IK3A 3VOFA 3LLDA 4D3CH 2GJ6B 3OVUB 3VYNA 3NPUA 5DMNA 1K3ZA 3E80A 3RLGA 1QNPA 1KJ2A 4QHNB 2YEVB 3IEBA 4Z08A 4AYID 5AVRB 3EDDA 2VB5A 4FFYA 2XUWA 3I6KB 2PPGA 3AZRA 2L0DA 3H26A 5MENA 5TPWH 1LDPH 3L7FA 1RHHB 3FXGA 2EG7A 2UUDK 1KLFB 2BSBA 3HJZA 4DJDC 4GGBA 1WSST 3U9UA 3S97C 3VXPB 1WFUA 1EPXA 2INFA 4TUJB 1HILA 2DICA 1VZIA 2PMQA 2WZ0A 3VX0A 2F8QA 3KPOB 3KPRB 4G59C 3BWSA 4BF7A 4IHCA 1EXGA 3T0CA 4KC3B 3DUSA