4MB1A

The structure of mall mutant enzyme g202p from bacillus subtilus
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
559
structure length
557
Chain Sequence
EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIPSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase 1
total genus 225
structure length 557
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4mb1A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb1A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4mb1A02
3CHEA 4AIUA 4ZEPA 1J0KA 3EJRA 1B31A 3E1F1 1QPKA 3N11A 3FHAA 3GDBA 5FKYA 4AZ7A 2BVTA 1CECA 1V0NA 1H2JA 2XN1A 1K9EA 2WWDA 4JFUA 2YDSA 4UNIA 1QI3A 3PTQA 3KLKA 2G3MA 4U5IA 3VGFA 5CGMA 3GXMA 1JIBA 3K4AA 1US2A 3GNOA 2JF7A 2VRQA 5IFTA 1M53A 3N04A 3WD0A 1PPIA 4FLSA 1WZKA 4FF5A 2V3FA 4KWUA 1T0OA 7CGTA 5JIPA 1E15A 4Z2KA 4HPHA 2Q8XA 3AHYA 4GO8A 4HOZA 1W9UA 4WSJA 3AI0A 2IXUA 5BXPA 4PMNA 1GOQA 4QP0A 3SCNA 3AYRA 5A2BA 1GOKA 2VJXA 1QBBA 1Y7VA 1KBBA 1RP8A 3RCNA 4DM2A 5HPOA 2VVNA 4S3KA 1H11A 2VZSA 2FYVA 3BAKA 2O9RA 3VDCA 4PMQA 4PTXA 1NH6A 2ZOXA 1HNYA 4H7VA 2AOSA 1Q6CA 2YLAA 1PS3A 2V38A 1QHZA 1E71M 3NYDA 3BAYA 4PMDA 1BVZA 3PZ9A 4CVUA 1E1EA 3AHVA 3GBEA 2J7DA 2VTFA 3ALGA 3WDHA 5E0CA 5ABFA 2WMKA 1E0WA 1ECEA 2UWFA 2EACA 4NF7A 1VFOA 1ISWA 4F9DA 2ZIDA 3EDKA 1PAMA 3SCTA 2EAEA 5CSUA 4V28A 1CXKA 4QFUA 2ZWZA 2J4GA 3W27A 4GI6A 5D9MA 1C8QA 5EFFA 3RILA 2XWEA 3U7VA 4AC1X 4AWEA 2GJXB 3BLKA 3K8LA 4UFLA 1YHTA 2JEPA 2ZUMA 1HWWA 3VGGA 3FHQA 4AZHA 2QMJA 1KXHA 2DSUA 2CHNA 3W81A 3ZT6A 2J7CA 1ZJAA 1G9HA 2D73A 3CTTA 1QI0A 1JZ4A 1XH0A 3PZOA 1KGWA 1E4IA 2DSWA 2A3BA 2O92A 3FW6A 1WP6A 3AXHA 5I5RA 4A3HA 4GZIA 1JNEA 1V6YA 1CLVA 3ALFA 4HA4A 1R33A 1KQYA 3NSNA 1C90A 3T2QA 1UASA 2XVKA 1UH3A 3LX9A 2VX4A 3AS0A 1JZ3A 2OWXA 3WQ4A 1TFVA 3ZJ7A 3VMNA 4CD5A 1XD0A 3T0BA 2PWHA 4NXSA 1KR0A 3MSDA 1WB0A 1LQ0A 2F7QA 3CLWA 5AY7A 3N18A 2ZICA 2E9MA 3W28A 1JFXA 1UR1A 2J74A 1VFFA 1L8NA 3MU7A 3PZVA 4PTMA 1E6XM 4BQ2A 1NWRA 1Q6EA 1FP9A 3BXWA 4TTGA 4UQDA 5A8QA 1V3JA 2CERA 2WLZA 3ARQA 5FL1A 3BAWA 1VENA 1JXJA 1TMQA 1ESWA 1QVBA 1QI2A 1OSEA 3F4VA 3FXYA 4ZXLA 1UH4A 3WY3A 1GW1A 2D2OA 3CUJA 5ECUA 1AMYA 4RE2A 2CBVA 1V0LA 2X05A 4AZBA 4HU0A 2FDMA 2UY2A 5A94A 2C8NA 3PTMA 3WUGA 5LA0A 1W9PA 1HXJA 2VVSA 4AYGA 2XSBA 3EDFA 5IHSA 5A6LA 1JD9A 1M03A 2V3GA 1L0PA 1ISXA 3VINA 1E6PA 2VUYA 3VSTA 1W3LA 1V3MA 5FD0A 5E6ZA 3VD7A 2CYGA 4H8VA 1JYWA 2Y24A 4PMOA 4AIEA 2IXVA 1Q4NX 1QOXA 4N42A 4FNUA 3BLBA 1KB3A 2D1ZA 2EQDA 5DFAA 1W9BM 1EO5A 3LPGA 2DIEA 1B3YA 4JFVA 2BY3A 3H54A 4M8UA 3UR7A 1R8LA 2OW6A 2DSZA 4UQCA 2FH8A 4H41A 2EBNA 3MV11 3A21A 3H53A 1CXIA 3I3BA 3POCA 1JD7A 1BQCA 1VJZA 1D2KA 4C7GA 2X2YA 1R34A 1J10A 2OWWA 1XGZA 4GQRA 4GINA 4NI3A 4AISA 4EKJA 1NP0A 2ZUSA 1M7XA 2GJRA 3OA5A 1SR0A 2GUYA 2F7PA 3BAJA 2GDVA 2XTKA 2DSVA 3L4TA 3T08A 2PWFA 1E43A 2XYLA 4J7RA 2EABA 2BNJA 1NOUA 4CCEA 4ATLA 4W87A 2ZUNA 3RMEA 3OB8A 1E1FA 2XN2A 1HJXA 3BCDA 3ARPA 4Y7EA 2QV4A 1CWYA 3BAIA 4QCEA 4L4OA 3BVVA 1GONA 1UWRA 4ATDA 2JIEA 4KMQA 2WMGA 3PZTA 4GI8A 4CVWA 5I23A 5JUVA 3VM5A 1VB9A 5C70A 3TTSA 5DF0A 5FCZA 3CMGA 3VGDA 1XSIA 1CXHA 1V6VA 2DEPA 2PBOA 5BRPA 4NRRA 1EDGA 1CLXA 4B3LA 2F7OA 5DT7A 4PMVA 3QHOA 3QHMA 1UKOA 3EJPA 2VO5A 1FH8A 2YL8A 3OBAA 3THDA 1GOIA 3RPMA 5FOOA 3WKZA 1TR1A 4TXEA 4WKAA 2XVNA 2VT0A 2D23A 2W66A 2V3EA 1DWHM 1W1YA 1TUXA 4PMXA 4JHZA 2WVTA 1E0VA 3GXPA 1U2YA 2TAAA 3U7BA 3EMQA 4D6CA 4Z2JA 2CETA 1TQWA 4HTYA 2DGAA 2ZX5A 3BUQA 1I1XA 4L4PA 4Z2GA 1H0GA 3II1A 3VKKA 6A3HA 3PZQA 3W25A 2JE8A 3WNKA 1S46A 2EADA 3DYOA 5GNYA 6CGTA 4D6GA 2WYSA 4P8WA 3WF1A 2VCCA 3CO4A 5TD4A 4KRTA 3VO0A 4W5ZA 4FNTA 3GM8A 1EHNA 2YL6A 1J11A 4UQAA 4UQ9A 3WNPA 3VIMA 1GUVA 4CN6A 2QLYA 1PX4A 5KZ6A 3VVGA 3AS3A 1CYGA 3IJ8A 1IV8A 2EPOA 1J0IA 3AROA 1HVXA 4DM1A 3WNNA 4K68A 3WFLA 4HZ8A 3WD4A 3WF4A 4P7LA 2PB1A 3FAXA 1QI4A 5DEZA 2W63A 5D9PA 2XVGA 1QW9A 3WMSA 1ITXA 1BVNP 2OW7A 4TVUA 3S5YA 3AS1A 1H0IA 2QPUA 2G4FA 2VR5A 5A1AA 4XB3A 3ZR6A 1KXTA 5E6YA 1VJSA 4WF7A 1MVYA 2D3NA 1MYRA 2AAAA 1TA3A 1CZ1A 4CD4A 4P7QA 1VEPA 3WNMA 3L4WA 3CZLA 3HG5A 3MKKA 3AFBA 1V6UA 2QPSA 1JNDA 2WCAA 1W91A 1W1VA 3MS8A 4UZUA 3OZPA 1LLOA 2XPKA 4QCFA 2FHFA 1W1TA 4J3WA 1JFHA 1UZ1A 3A5VA 2WAGA 1UD4A 4J3VA 4TUFA 5E09A 1R7AA 1CDGA 3SUTA 4IPNB 3BSGA 3UG4A 1QNOA 4NX0A 5A3HA 3WY2A 3MUY1 3T2PA 1OIFA 2YL9A 1K9FA 2DH3A 4F79A 3WQ5A 4PTVA 1LL6A 3WDPP 5JIWA 4HU8A 2W4XA 2YFOA 3D52A 5E0FA 3PZNA 3EBVA 4KRUA 4WSKA 3I3EA 1UWIA 4YPJA 3DX4A 1I1WA 1V3LA 2D0GA 2V5CA 3WMCA 1J0JA 5IHRA 2OYLA 3W4RA 1B9ZA 3H55A 4HP5A 1NQ6A 1EHAA 2G3NA 4ZE5A 4D1JA 1B1YA 5D8WA 3L4XA 1AQHA 4M81A 1PZ2A 1ZJBA 3W6LA 4DUWA 5CPSA 2PBGA 1KXQA 4U33A 3WH9A 4Z2HA 1ZBWA 3K1DA 3AZSA 2J78A 4U2YA 2CBIA 3A24A 2EPNA 3A4AA 3BLPX 3MUAA 2ZXQA 5D9NA 4DUXA 4MNKA 1RP9A 1E56A 1NWTA 4HMCA 2AMGA 3TTQA 5I78A 2WMIB 1JYNA 3VX0A 2DT2A 1H3GA 2CKRA 3QR3A 2WXDM 4AXNA 4JL2A 1XH2A 1JZ8A 2CHOA 2WMFA 3SUUA 1HKKA 4WKFA 3TTOA 2G3IA 4XX6A 5DT5A 2GVYA 1FOBA 3EDDA 2PC8A 1PIGA 1M04A 3UCQA 3WDJA 2XIIA 3WEOA 1DTUA 2WC4A 4J3XA 3M7SA 2GJPA 2YBUA 2DQXA 3VX1A 1GZJA 5A6AA 3CV5A 3W26A 5ABHA 5A6KA 3VDHA 3CHFA 2E9LA 2WM0A 2BV9A 5BXRA 4NZJA 4GZEA 3VSVA 2BXYA 2D3LA 3D5HA 4N0RA 3KEHA 4J3SA 4E8CA 4AZ6A 2EPMX 3WQ8A 3VOCA 3IJ7A 2ZE0A 1WDQA 1EA9C 3O2LA 4CCDA 4MAZA 2WCSA 3LXBA 4QAWA 4UCFA 3G6MA 1CNVA 4JAWA 3N12A 4AZGA 2HVMA 4BCEA 3L4ZA 3U5YA 1BSIA 3AMGA 5E70A 1JZ2A 4GQQA 1BHGA 4F66A 2WWCA 3OLIA 4JFSA 1HJQA 1FFQA 5BXTA 4XUYA 4ZXOA 4RE3A 1BLIA 4OIFA 5D8ZA 2XM2A 3NCOA 1EH9A 1KGXA 2OLHA 4UOZA 2WPGA 2X2JA 4LYQA 4UQEA 2QMKA 3GXNA 4QLKA 4GI9A 2VX7A 3EJQA 1Q6GA 3WH7A 1BGAA 2C0HA 4LGXA 1VRXA 4GZJA 4AZ5A 2ZWYA 1B3WA 1CGWA 1WCGA 4EE9A 4UZSA 3VD9A 4LYPA 5GNXA 3ZJ8A 1MW0A 1LWJA 2WB5A 1EGZA 3WD2A 3DX2A 3AISA 1TE1A 4JHOA 5CJ5A 1E6RA 5LA2A 4XZWA 4D6JA 4UFKA 3VD5A 1W32A 3PZMA 3A3HA 3W82A 2V3DA 3RJXA 1GCYA 2GDUA 3MMDA 2J25A 1BGGA 1CGTA 2E0PA 1WZAA 2DDXA 3O9NA 4D6EA 1KQZA 3HN3A 3DX0A 3TA9A 2VCAA 3OIHA 1G1YA 3VIKA 2D0FA 3DYMA 3M6DA 3AJ7A 3MANA 4PMRA 3GZAA 1V08A 3AICA 1VEOA 1XRVA 4E4PA 1O7AA 1NWSA 1JL8A 3KL0A 4BA0A 4U2ZA 3BAXA 5I2UA 1AQMA 3QOMA 5A6JA 1W3KA 3AIVA 2JALA 3UG5A 1C3FA 2J8FA 3DDFA 2UY5A 1OGSA 5DO8A 3LMYA 2Z1KA 5I79A 1PX8A 1ZBVA 2WBKA 1MW1A 3OLGA 3WNOA 2ZUTA 2Z1SA 2IGTA 3NSXA 1V03A 3CZJA 3CC1A 2YFNA 3D4ZA 1EXPA 2FGZA 4D6IA 4FNPA 1K6AA 3D50A 2WVSA 1GHSA 2XFFA 3WDRA 3WSUA 1KCKA 1C8YA 1G94A 3SCRA 4W86A 3DYPA 2J7FA 2QF8A 2E8YA 3BVXA 5BRQA 2XGIA 1ISYA 1CXLA 1GQKA 5M5DA 3BCFA 2OWCA 1IZKA 1CGYA 2ZXDA 2XG9A 4OBRA 4BF7A 3GNPA 2XVLA 3W0KA 4RE4A 4AZCA 3BVWA 3ZOAA 4X0NA 2F8QA 1OT2A 3D3AA 3AIQA 3ARYA 2GFTA 4FLRA 3SCVA 1HN1A 3AHTA 3SIMA 2V5DA 3NIYA 3BUBA 3DX1A 3AS2A 1VF8A 4MPKA 4ACYA 3GXDA 4RL3A 1ZU8A 1W9VA 1WKYA 5C8BB 2FHCA 3KLLA 5EMYA 3ZO9A 1WZMA 3ZT7A 1A47A 4CD6A 2XM1A 2W91A 1J0YA 2G41A 2WHLA 3AZTA 4ML4A 1W3JA 1K9DA 4MB3A 3KL5A 4B9YA 3WQWA 3WENA 1JF6A 3VIPA 2YDQA 1CIUA 4FNSA 1FH7A 5CPQA 3N13A 3RM8A 3VNYA 2A3AA 3TV8A 2XGBA 4R5EA 2G8ZA 4PSPA 5GNZA 1MQQA 4ZFMA 1HXKA 1MWOA 2WVVB 1HVQA 4NRSA 4FLQA 3ARSA 2CXGA 5CSYA 1UR0A 2WLYA 1KFWA 1JXKA 2WSPA 2ZXAA 3CZEA 3LPOA 1ZBKA 4BQ5A 1R47A 3WF3A 4MNLA 1TVNA 1TQVA 4YHGA 2VRKA 2F7RA 3ECQA 5M3WA 3ARRA 3DDGA 8CGTA 4JIEA 1KR1A 3CMJA 1WE5A 3WMBA 1W2VA 1W9DM 4P8VA 1WDRA 1DWGM 4R27A 3GXIA 3RM4A 1E5NA 4C7FA 5I6SA 1DWJM 1MFUA 1BG4A 2VC9A 2ZX9A 5CZKA 3WBEA 5JBDA 4M82A 2ZUWA 2WMIA 5C71A 1B90A 3N17A 4KGJA 3VPLA 5A6MA 2BVYA 3EJSA 5HPCA 1US3A 3PTKA 1HT6A 5IFPA 3LPPA 3DHUA 4PEEA 1TG7A 4DWSA 1OD8A 1OD0A 3OG2A 1UZ4A 4D71A 4PMZA 4DO5A 2Y8KA 2WANA 1KXVA 3L4UA 2J75A 3UEQA 1XCXA 2WHJA 4MDPA 3AOFA 1ZBCA 3QGVA 3VSUA 1DHKA 4W93A 1TQTA 3WH8A 2EXOA 1JGIA 2J62A 1JDDA 1U30A 3WD1A 1X1NA 1D7FA 1VEMA 2GSJA 3HG4A 3IANA 1OINA 5EBAA 2VQUA 4MNMA 4TTUA 1CXEA 4IM4A 1JZ6A 1IZJA 1TZ7A 4H8UA 2Y4SA 4CKQA 5A8PA 3T0AA 3WL1A 1UA7A 1W9XA 3CZSA 1J12A 4UTFA 4A4AA 2Y2WA 1ITCA 3S6TA 3HG2A 4CU6A 4AYSA 4MAVA 1HKJA 4MNJA 5AC5A 2WSKA 2EEXA 5BWFA 3DC0A 5HOSA 1WNOA 3M07A 4U5KA 2YIHA 2W62A 3VM7A 4ZENA 3EJTA 3WIJA 5BXSA 3RDKA 3VILA 5GQBA 2UY4A 2J79A 3VIOA 2WZHA 1TA3B 4DO4A 3ZJKA 1ODZA 4W84A 4WKHA 3WUEA 1CGUA 2X2IA 2GK1A 2EJ1A 2Y5EA 4LXFA 4HA1A 1M01A 1XV8A 3OGVA 3BVTA 3UERA 1ZL1A 4FNRA 2VZUA 3IAQA 2F1BA 3M46A 3GXTA 1UD5A 4JL1A 3BGAA 4JCLA 4B15A 4U3CA 3L4YA 3LRMA 1HJVA 3PZUA 1GVIA 1IT0A 1UA3A 4JKKA 1B30A 3WQ6A 1JI2A 2YJQA 2B31A 3AIEA 3L2LA 1GPFA 4UOJA 3VMPA 2F61A 1FP8A 1XYZA 3T0DA 3A23A 4E8DA 5AYIA 4HZ7A 1QNPA 4JCMA 1SMAA 2YOCA 3TTYA 3EMCA 4PUDA 4PN2A 4CD7A 3CHCA 4OGZA 3SUVA 2WZEA 4QLLA 3BVUA 2CCRA 1R85A 1UWUA 4UR9A 3CH9A 2VL4A 4AY1A 4H8HA 1B3XA 1OIMA 2DT0A 1TVPA 1W1PA 4UQBA 1GVYA 4EAMA 3VUPA 2F2HA 3EDJA 4B16A 2ALWA 1UD8A 1F4AA 3EJUA 1JAEA 2J8GA 4AZCB 3AMCA 1GOOA 3VGHA 1BF2A 3PBGA 1E4NA 2YA1A 1Q6DA 2ZX7A 1B2YA 1GHRA 3HMCA 2XSAA 2E40A 1HL8A 4KGLA 1DP0A 3B8SA 2XFYA 2C7FA 5CPTA 3W53A 3FN9A 2CITA 4CD8A 3BUIA 3WELA 1SYTA 4E2OA 2EPKX 5M03A 1KCLA 4HMEA 3AZRA 3G6LA 4OBSA 4AD5A 1RPKA 3WNLA 3B9EA 3VNZA 4FK9A 5FL0A 3WN6A 4P7NA 1Z32X 1LJYA 2ZUUA 1HP4A 3K4DA 2CBJA 4DUVA 1FHLA 1TQUA 1ODUA 3CZ8A 1XSKA 1GOMA 1QW8A 1GQIA 4C7DA 3AIBA 3D51A 2G3JA 1SZNA 4TOQA 1W2PA 1CGXA 2NT1A 3TOPA 1UKTA 2DSKA 2XUCA 4A3YA 4BQ4A 3ZJ6A 4Z2LA 1MFVA 2BHUA 3W37A 4Z2IA 2E4TA 3ARVA 1NOWA 2XN0A 4NZCA 1UQZA 2VCBA 2D20A 2VQTA 4UFJA 4W8BA 3VD4A 1H49A 3U5UA 3UETA 4D6HA 2XWDA 1GORA 2VZTA 4AIOA 2E9BA 5I24A 3WQVA 4F8XA 1HJUA 1VIWA 2DT1A 3GYCA 4TVCA 1HTYA 3GBDA 1NOFA 3CGTA 3WUBA 1GQJA 1E3ZA 4M1RA 1UH2A 3MV01 2ZX6A 1UR4A 3AMDA 3ZIZA 1XHGA 3KWXA 3MMWA 1CEOA 2J7HA 3IJ9A 3NDZA 5HNNA 1GQLA 5I3DA 2D0HA 4JFTA 1BYDA 1GOWA 1V3IA 1ZB5A 1EDQA 2RGLA 1HJWA 1E6SM 4OJYA 5GPRA 2DT3A 5ABEA 3DECA 3F5LA 3NDYA 4EANA 4LX4A 1BFNA 5JBEA 9CGTA 4LYRA 4M24A 2WHKA 3FAWA 1EOKA 4TX6A 5BCAA 1B3ZA 3ZR5A 1QNSA 2XIBA 5ABGA 4AEEA 1KGUA 3TONA 3WUFA 1MXGA 2J77A 2YLLA 3NUKA 2O9OA 4AMXA 4D1IA 4PRWA 2EPLX 4GO9A 1DWFM 1FHDA 1UWTA 1J0ZA 5A69A 1GJWA 1PIFA 4MTVA 1EIBA 2WC3A 1QNQA 2YL5A 4CUCA 3CHDA 3A4WA 1UQYA 4GIAA 3FY1A 2W67A 3CUHA 4IPLA 2VMFA 1JI1A 1B3VA 4YHEA 1TQSA 2E8ZA 4AEFA 1UR8A 4U3AA 2JIWA 4DWSD 4CCCA 3W29A 1VFUA 1C93A 4B3KA 4X0VA 4HOWA 1QWUA 4Q22A 4D6FA 2W5FA 1ISZA 1G5AA 1J18A 1BPLB 3RIKA 2A3HA 5A6BD 4J3UA 2VRJA 1J0HA 1HKIA 4W89A 3UESA 4AZIA 3ARZA 3DX3A 3SCUA 4MB5A 1JDAA 1MW2A 4ACZA 1A3HA 3RJYA 1V6WA 1U33A 4WJXA 3LRLA 4GKLA 1C8XA 2YDRA 4XV0A 3VGBA 1K9TA 1QI5A 3CUFA 2JEQA 3VIJA 4ZE4A 4KH2A 3W24A 3EDEA 2BXZA 5A95A 4S3JA 3SCOA 3MO4A 3L2MA 1MQRA 4IUGA 1V02A 1PBGA 4AD3A 4FMVA 1QHOA 3VGEA 3BMVA 1E0XA 1EQPA 3PZIA 1MW3A 4JKMA 2XVPA 3GH7A 4URIA 5FIPA 3BH4A 2XHYA 2YBTA 1CPUA 1G01A 5D4YA 3MUIA 3SUSA 4W88A 1J01A 2FE0A 2PWEA 3VIFA 1UOKA 2ZXBA 5BYWA 1H09A 3ZQ9A 1BTCA 1JAKA 4HOXA 3GXFA 3LXAA 3ARXA 3WF0A 2VR4A 3WD3A 1O7DC 1WZLA 2F1AA 1UD2A 2CKSA 4FLOA 5JBFA 1R87A 2OYMA 1DWAM 3GH4A 3K46A 1XD1A 1DWIM 4CU8A 1WO2A 1C7TA 1OT1A 1XC6A 3IAPA 2JF6A 4ATWA 2WK2A 1XCWA 1QNRA 2O9TA 1DEDA 1O6IA 1WPCA 4W8AA 1UKPA 5E9AA 5A2AA 4MDOA 1KBKA 3B9DA 2VZOA 1LL7A 3PN8A 5A8NA 3B9AA 3ARWA 4IISA 1JG9A 2DIJA 4PBGA 1C7SA 2W61A 1YQ2A 3F5KA 1G0CA 1X6LA 3WH5A 4W7UA 2MANA 1V0KA 5IDIA 1H4PA 3WEZA 2WCGA 1WAWA 1E70M 3VDBA 1MXDA 3K8MA 1HKMA 2WC7A 2YA0A 2CBUA 3APGA 1I75A 1ZS2A 3AIRA 3OZOA 6TAAA 1F4HA 3ZSTA 1EDTA 3CUGA 5AC4A 3SURA 1UKSA 4QDMA 2CPUA 3THCA 3JUGA 1JDCA 3W6MA 3LXCA 1OM0A 1HL9A 1ISVA 4HPGA 4OZOA 3BC9A 1V0MA 3AMLA 5HXMA 2OYKA 4GXPA 4J28A 3GTNA 4D6DA 2WKLA 2BHZA 3BMWA 5CQ1A 3ZT5A 4CGTA 1W3HA 1E6ZA 4OOZA 1KWGA 3CIVA 3SEPA 5KEZA 2CESA 3WH6A 3OLDA 3VMOA 2OSXA 4UFHA 1E5JA 1HJSA 4P8UA 5F7UA 1HF6A 2YKKA 5CGTA 3SCSA 3SUWA 3UR8A 1PJ9A 1VAHA 4MB4A 4MJ4A 1EQCA 1PEZA 2ESCA 5D9OA 1QX1A 1XH1A 4MADA 5CLWA 1KTCA 2DH2A 4LPCA 2VX6A 1RH9A 4ACZB 1NP2A 3DHPA 1H1NA 4BS0A 4WK9A 4TVDA 1X6NA 1OGBA 2PF0A 3IK2A 1UR2A 2X09A 3NSMA 2J7GA 4MJ2A 1E40A 3LPFA 3WFZA 1GJUA 4MB1A 5A8OA 2WVVA 2BY0A 3CPUA 2J7BA 2VI0A 3BSHA 3N1AA 2JFEX 3BUPA 1NWUA 1OWQA 1UHVA 1OCQA 1SFSA 1MQPA 1SMDA 2DPEA 4UOQA 3IGUA 1LG1A 1LG2A 1LL4A 3RM9A 3L4VA 1UR9A 4NXKA 3N9KA 1RD6A 2OSWA 3ARTA 4J3TA 4HA3A 3QOKA 1AVAA 1LF1A 2YA2A 3VDAA 5CG0A 3CZGA 3HJEA 1C92A 1XSJA 3HU7A 4B9ZA 2GJXA 3AIWA 1XYFA 3KZSA 1R7OA 2A3EA 1HP5A 4AD4A 3ZMRA 2X2HA 2EO7A 2A3CA 4AMWA 1TCMA 3KE0A 3PZGA 1NARA 5A6BA 2GK1B 3SCQA 1BYBA 2W92A 4OUEA 1AQ0A 1V3HA 5BROA 1UYQA 3AXXA 3GNRA 3N15A 1QHPA 1JZ7A 3A6OA 1E3XA 2ZX8A 1E9LA 3FNDA 3OGRA 4U31A 2WNWA 7A3HA 4UFIA 5A2CA 3AIUA 4PSRA 4JZ5A 3KL3A 3VD3A 1JYXA 3EYPA 2NW0A 2X0YA 1H41A 2NSXA 3NJ3A 3S5ZA 2NT0A 1Q6FA 2FGLA 4FNQA 3F5JA 4F9JA 1HX0A 4TX8A 5LA1A 3WDQA 2VNCA 4WIWA 3BUDA 1PX3A 1V3KA 2D24A 2VZVA 1JF5A 1OB0A 2WBGA 4H04A 2BHYA 3WY1A 3J7HA 4DWSC 3WF2A 3ARUA 3EMZA 4CN1A 1WDPA 2WHMA 1EOMA 7TAAA 3O6AA 1R46A 1FA2A 2BS9A 4PMYA 3VIHA 4YN5A 4AMCA 4JFWA 3K8KA 1BYCA 4Q7NA 2BY1A 1E6NA 3HZ3A 1UKQA 1QWNA 2PWDA 5M17A 2UY3A 1GNXA 5A8MA 4AD1A 3MMUA 3MI6A 2XFRA 1N82A 2D22A 2PI6A 3A4XA 3W38A 1CXFA 1VFMA 1UD6A 1J9YA 3CZKA 3MSGA 1PZ3A 3T09A 1V02E 2WKGA 4P7OA 4M56A 2WMJA 3WEMA 4PYSA 3VTRA 1BYAA 5A6SA 1JYVA 4CU7A 1NM9A 5IXEA 3AHXA 1FFRA 4AW7A 2F18A 3MUZ1 1VBRA 4DWSB 1FH9A 2VOTA 4WLCA 3AQUA 1UD3A 5CXPA 2PWGA 3AYSA 1E4LA 3S2CA 1D3CA 4OOUA 4PCSA 4JKLA 1E73M 2X8RA 4X9YA 3ZM8A 3OLEA 3A47A 2BFGA 2WMHA 4AD2A 1CENA 4P8XA 2WVUA 5HDRA 3AXIA 3WDIA 4NSBA 2WZIA 5AYBA 1H5VA 5HBFA 4V2XA 1P6WA 3VU2A 1CGVA 2BY2A 1R86A 2QHAA 3WL0A 3CZNA 2BVDA 3CUIA 3TP4A 3GH5A 2VURA 4P7RA 3AMKA 1E6QM 1C91A 1OBAA 4BQ3A 4BZYA 1HIZA 4XZBA 2J47A 4OKDA 4EK7A 5E1QA 4PTWA 4PUEA 3OGSA 3U57A 4M80A 4UFMA 5I0DA 1E55A 4HMDA 4W7VA 2XJ7A 4PMUA 1BG9A 5EFDA 3VIGA 5EB8A 3HG3A 1KWKA 3CBWA 4LQ1A 1QBAA 1KTBA 2X1IA 4W5UA 4M29A 2FHBA 2O9PA 5CLTA 1CBGA 1UWQA 4QLJA 4W8LA 3WY4A 4GPNA 1WDSA 2CNCA 2OSYA 3QHNA 3T2OA 1LWHA 2HISA 3I3DA 1UUQA 3WBAA 1OGGA 3UG3A 1E72M 2CEQA 4V27A 2J7EA 4D72A 2ZUVA 1R75A 3POHA 1BAGA 1UG6A 2IUZA 1JZ5A 4H2CA 3D4YA 1E4MM 4CN4A 3AHZA 4W7WA 1VBUA 3VIIA 8A3HA 5LYRA 2X0HA 4PCTA 1V6XA 2E3ZA 2VX5A 3LRKA 3SCWA 5ABFB 2Y8VA 2WW5A 1B0IA 3RO8A 4J27A 3PHAA 2RGMA 3SCPA 3A22A 4NZFA 4DO6A 4W85A 4AD0A 1UWSA 1CTNA 5DMYA 1EO7A 2CIPA 4HZ6A 3ZSSA 5I77A 2FH6A
chains in the Genus database with same CATH superfamily
4AIUA 1J0KA 2CLRA 3UXDA 2WMPA 3PULA 1GZHA 1CDJA 4G8AC 4WEEA 1NLBL 3ZTNH 3H6OA 1TWSA 1A9BA 2YAFA 3E1F1 4AEHL 1ONEA 1QPKA 3KYNB 3LHAA 3GDBA 3RPBA 4K71B 4A2MA 4PJXF 3U2SB 1XBRA 3LY0A 5TE4H 2KX9A 5DK0B 3HFYA 1KF9B 4YC2B 3KHQA 5KAQG 2KT6A 2XN1A 2JIXD 3UWZA 2EXYC 4QRFA 2NTFB 1OWRM 1EEPA 2WWDA 2X4UB 3LOTA 4QT5A 1GPOL 2WNZA 1AMXA 5D1ZD 5E5RB 2C71A 1UUMA 3KPRB 4PRIB 4XZUB 3GXMA 3OKKA 3S42A 2D31B 1U22A 2OZ4H 3M1OA 4N0YH 3JUYA 5I6OA 3QRFM 3I4KA 2O61A 2EKGA 1AI1L 3F12B 3PBUA 25C8L 4OM1H 4L3EE 4FXSA 1EP1A 2BSSA 3C2VA 2KZHA 1DN0A 4FEMA 5D8JH 1QLRA 4P8QA 1R3KB 2R2HB 1V5JA 1JWSB 4OH2A 1HGYA 5DZOA 3S37X 5AB3A 2HUHA 1RQHA 4L1GA 4GO8A 3IFOA 3PTDA 2F53B 1AR1C 3RDTA 2XU2A 3DBPA 2V2WB 1ZKAA 2RALA 5DS2A 3UTTA 2N1TE 2P4AB 5I28A 2HMCA 4MNQB 2C9VA 1U6AH 3EGXA 5KW9L 3OTRA 2AANA 2FZ3B 2IO5A 3VKAA 2DQCL 1GOQA 4QP0A 1KLGB 3RWJA 3W9DA 2X88A 3MXWL 5DMGC 2LW3A 4FF7A 4QAIA 4P06A 2ADJA 3C09B 5F6IC 5EBWB 3R7RA 5E4EB 3QN3A 3I6LE 3W57A 1KBBA 2GOUA 3LNGA 2FPTA 4BH7B 5T1JA 2CO3A 2MSPA 4J3OD 1RA0A 5HHQA 3L4CA 1PIIA 1TTJA 2YOAA 4JPVL 5HD8C 1EX5A 4LCIL 2VVNA 2Z31B 3MSPA 4JMXA 1FXQA 5I6SA 4XNMA 1AFVH 3VDCA 2CLFA 1IAOB 2AEQL 5EDSA 4PMQA 4PTXA 7ODCA 4H7VA 3B0XA 2DQHL 3CDCA 3FTSA 1Q6CA 3VNJA 1BF8A 1PS3A 2GSHA 3C2FA 4MMXB 1CIDA 1AGCB 3GSRA 5T5FH 2OJZL 3R19A 1IM9D 4CQAA 3TYFA 4D9LL 4ODWA 4CSSA 3B5GA 4YJZL 2WXPA 3AHVA 2Z91B 3WFHA 3ALGA 5I3IA 3F04A 3QULA 3WDHA 2O26U 5EZOL 3SBWC 3MZNA 3B2MA 2UY6A 5E0CA 5F2IA 1KDJA 2W88A 3FSUA 3IGHX 5DN1A 2VDPH 3TBYA 1U8IB 3SD2A 1S1RA 4NNYA 5KJRL 2Z7UA 2NLIA 2LVEA 3E0FA 3S36X 1E0TA 5FYLE 1UXWB 4JRWA 1P53A 3D2TA 5DURB 3SPCA 2C1OA 3PXJA 2FJHA 3FGCB 2EC9U 1F5ZA 3GBLA 4NQEB 3P67A 4AU0A 3FTWA 1DJGA 3CXDH 3O4OC 3OXRB 3E2QA 1SXAA 4N7QA 2DWDA 4A04A 2EAEA 5AOIA 4QDGA 4OCXH 4ANVA 4O5LH 4E42B 4V28A 2VMEA 1WFOA 3HPXA 1M4KA 5E03A 3F4WA 2PRHA 2X30A 1C8QA 5CGYD 1IWBA 1T66C 3I6KB 2XWEA 4RGMC 2FTYA 4AQEB 5AENA 1XFBA 2GJXB 3BLKA 4NYLA 3P7YA 4P5TC 3M7OA 5C07E 1H50A 4L5FL 4GEJA 4K3JH 1YHTA 3O2WH 5L2KA 2J12B 2BIPA 5IMLB 4OSUH 2W59A 4XWOC 4X2UA 3STZB 5IHUH 1L4IA 2IQ9L 1DXFA 4PRRA 4QKXB 2HFGL 2QNEA 4ZNCD 3IACA 1T2XA 1U3JA 2F5AH 2CAKA 2Z27A 1FVPA 3BUVA 1S5IH 2EGZA 1ZDQA 3LQZA 1XPYA 1O6VA 3W81A 3E8VA 2CK2A 3NVDA 1ZAGA 3WQPA 1MHPH 2XBDA 4MFHA 4AM0A 5EHFA 5I75C 2PGRA 1IAII 3FEQA 3O11A 3BP5A 2RCSL 3FT3A 3MNZB 5CS7A 5E2VL 1J6PA 1KGWA 3EZJB 4NT6B 1XCFA 4S23A 4G7FA 4M7LH 4Y19E 1OABA 3UXKA 3LVEA 2A3BA 2IS7A 4YHZH 5B39G 3PNWA 2DQCH 5GZNC 4LYKA 1NM4A 4OIAA 1M6JA 1FWSA 4GO6B 5CU5A 2VQ4A 2V17L 1YYAA 1MRCH 3IBOA 3NFPB 4PGJA 2V2XB 3IFPA 5HYJE 1FAKT 3AU0A 1DQVA 4B0MB 3RWIB 4UIKH 4FF9A 1V6YA 2OO6A 4AK1A 1CBVH 1S7RB 2QR0A 2YX0A 3QQWA 4O17A 3B6SA 4MCYA 3LQLA 3RJXA 5JLZB 3F7RA 3TA6A 1RJYB 1U3NA 1UXSB 2YSTA 4WI5A 1J8RA 3O4OB 3THML 2XVKA 1NDYA 2VM3A 1NCIA 3ALWA 4XMKL 5DUBB 4LNYA 4GP8B 4MMYB 3CDYA 5E0QA 1B4KA 3WQ4A 3GRWL 3ZJ7A 1R24B 1JBJA 5KTEH 3ULSA 3KVKA 3TBSA 1XD0A 1LE5A 3MBXL 1OLZA 5J6GB 1RULL 1P1ZB 3TA3A 1MCWW 5I1KL 1NCUA 4NXSA 3O9WA 4OIIH 4TSBL 2Y7MA 4UBDD 4YSSA 4EI5D 2CBQA 4GUJA 2K3HA 1ME7A 3O3AA 3B3IA 3HAEG 2VDPL 3HB3B 5PAZA 4DETA 3SSZA 1UZ8A 1GK8A 1L7IL 1ED3A 1YVLA 4GD0A 4C54A 1F6LL 2BVQB 3N18A 1EIXA 4MAUL 1T5XB 1EWHA 3W28A 1SUJA 2ZYSA 4PJIF 3FTGB 5D4HA 3VXME 3QEQE 1JFXA 4LLDA 1UR1A 1VFFA 5DUML 2K8QA 3HOJA 3UTPE 3MU7A 1KBWA 3PZVA 2OLSA 1I4FB 4DWHA 1AQ8A 4JUTA 4U1NB 2EC8A 3O0RL 1FP9A 1Q6EA 3R58A 1G1KA 4NKDB 4G7SB 2GTZA 3MJ7B 2HJFB 1Z66A 4X0KB 4O15A 4PFHA 2WLZA 3E9TA 5FL1A 1PDKA 4Z18A 5LXGL 4DLMA 1YEHL 4D7PA 3FCTA 4XMXA 1IGFH 4ZA0A 1A3LH 4KVCL 4F33B 4F9LC 3T8VA 3IAGC 1QVBA 4YTRA 4U1MB 4LP8A 3TGXA 4ZXLA 3RX4A 2V5BA 1PKYA 1W72B 3MRNB 3CWHA 5IVNA 5DK2A 1AMYA 2B5IC 2OCJA 2Z64C 1IAIH 2X05A 2WSRA 2FDMA 2UY2A 1J9QA 1G9EA 4TNWK 5AKTA 1N59B 3UXAA 1LP9B 5PCYA 1A65A 3NQBA 3URQA 5FFGA 1NFDB 2ZA3A 4RR4A 5AG9A 2XSBA 1HSBB 3NJVA 5FYKE 3VB9A 2X1UA 4C6MA 2NNAB 1P0NA 3U4AA 4JDEB 4JRYB 1YEDA 4PJAE 4AKPA 1EJXC 1I1FA 3VINA 3WBWA 4NHCL 1AH4A 1IGJB 3VSTA 1FIGH 1V3MA 3O6KH 2CKBA 4KK6D 5FUZL 2CYGA 5FD0A 2XLLA 4TTDD 3DJRA 1ZLEA 4AIEA 2IXVA 3UVAA 3IMBA 4WNQB 1EX0A 5HQMA 3LIZL 1EC7A 4HJIA 3UDWC 4DUOA 3C8KA 2GTQA 4N42A 2AW2A 4R97C 4MZ2A 4X60A 3BLBA 4YSAA 2FD6H 5DXYA 4UILH 4HLJA 1KB3A 5JOFA 1XB3A 4P2QE 5DJYA 3UYPB 5D05A 2BCMA 3VFGL 1EO5A 4HXAH 3LPGA 1ETA1 3WO4B 3BCJA 5M7QA 3Q43A 4APXA 1S78D 3H2EA 2IPKB 2DDQL 4KI5E 3WOVA 3MKVA 4AVOA 2E6YA 1DVJA 3CXDL 4BR1A 1NGXA 1Z7AA 3L3OA 2Q20A 5EU6A 4GG6A 3C2YA 3RIAK 5I8KL 2WIIB 4K94L 1YNKH 2DSZA 5ABTA 3GAYA 3V0GA 3RWGA 2B0SL 3M1BB 1OPOA 2FH8A 4OIIL 2EBNA 4E5TA 3H53A 3QIUB 1CXIA 4WY7H 3SO3C 4IK6A 1TLMA 4M02A 4PWJA 3ZRFC 1R3YA 2KPWA 4JK0D 2ATPA 4GRWH 2NZLA 3QUZD 5KOVC 3V5FA 3SGGA 4U6XB 3M1BA 4U6TA 1R34A 4XIAA 1J10A 5ESVB 4ZYKA 2ICEB 4NC1C 3LIZA 5HDLA 4L8CA 4S39A 3D3FA 4GINA 2X7LB 2CU0A 4CLMA 2WSYA 3DMMC 4U6YB 2E77A 2CM5A 3UTZA 2XH0A 3KUMA 1BFVL 1UZGA 2GJRA 1PZUB 4L1BA 2Y1HA 5EC1B 3BIKA 3RE0A 5DSCB 1TPC1 4APXB 4FOUA 1WDDA 2E3VA 3TUUA 1DDHB 2JJSA 4ABWA 3WIHA 1X1OA 2J1KA 3BAJA 1FNFA 1I7ZA 2Y22A 5JOFB 4H2AA 4H9XA 3GG1A 1XF4B 4YXKL 5L88L 3I6TA 3TYEA 1O6TA 3M5XA 2QGBA 1U6AL 2NNCA 4ZMWA 5KW9H 4LVHB 4E6MA 4XO7A 1ID2A 2LQRA 3E2HB 3QORA 3PIQB 4YDJB 2G4EA 2NZIA 4LV9A 2P49B 4ZNEE 4W87A 4ATLA 1SO5A 3EA1A 3ULVE 3TN3A 3MGOB 4KNTA 5KVFH 4JICA 4X6DF 1QLEB 2XTJD 2PODA 4ZSOB 3V75A 3ABKB 2D7TL 3AM8A 1TTFA 2Y6SC 2ZD0A 3BAIA 2PRLA 3CYJA 1TXKA 3MJWA 4JRYA 3H6AA 5GS2H 1X1ZA 3KBWA 3CIQA 5HQLA 4LOEA 2UVEA 4KKAD 5FUOH 1BXAA 5KYXA 1OD9A 2HVKA 4KMQA 1TMLA 1LBFA 5KVDH 1RZPA 4PODA 4QQ3A 1IC7L 3GMRA 3ZRSA 4PJCE 1ZCCA 2JXMA 5IV2A 4C56E 5C0RH 5I23A 3LEYL 2WO4A 1AZVA 1NL0L 2L0DA 4PR5B 1E50A 5DZNA 4BQBA 1C5BL 4JQ3A 5CJ8A 5JUVA 3VM5A 1VB9A 5D70L 1ORSB 5C70A 4A3UA 4HVBA 3T81A 1DE4B 2NY6D 4YSTA 5F1UA 1MFNA 1RVFH 3RU8H 4C6QA 2XQBL 3CPLA 4XXWC 1PDKB 3HLKA 1X7QA 1GGIH 1XSIA 1OM9A 3UAJD 5BZDB 4PRAB 1CXHA 4J4PC 2AXFB 3B2DC 3F85A 2EHHA 4LAQL 1T0NB 3LQAC 3MJ7A 4NQDB 3ITGA 3DUGA 4AVHA 2JWYA 3W9EB 2OZ4L 3AREC 3QQ3A 4NRRA 2A4EA 4LE8A 1EDGA 3TN4A 3R1GH 2JCCE 4JE4B 3CAQA 4B3LA 2D7NA 5DT7A 3PFRA 1BF5A 5XINA 3HUJB 3QDMD 3ZKQD 1SM3L 1RY0A 3BAEH 1JRHL 1FH8A 1XMWA 2HT3C 3OBAA 4D9RD 1MWAB 3VAEA 1Z42A 1ED3B 1HILA 1IEWA 1CG9B 3ZDXF 3JQOB 4TXEA 2XVNA 2D23A 2HTLD 2V3EA 1RPUA 2WVTA 3GXPA 4ZPTB 4U1GB 1OCJA 4RXFA 5IB1B 3N2BA 1EJ6A 4NKCA 5J6GA 4G9FA 1JDFA 2WIMA 4WW2F 1S2VA 2PDYA 3U7BA 4O58L 2EC9T 3KXFD 5I1HL 2E6AA 1I1RA 4XN7A 5I8EB 2WQDA 2IH3A 5L6UA 4KIRA 3BUQA 3GSNL 2CJSA 2ODHA 2HJPA 3B9OA 1OGTB 1FFOA 3BWSA 4TQPA 2BXVA 5DR5L 3RCMA 3LCYA 5B1CA 1I8LA 4A6YA 1WTGT 1CB2A 1XWYA 2NY2D 2WM1A 3Q01A 1WISA 1YPFA 3CLEH 1EJTC 3RY5A 2EADA 1GYAA 3BK0A 2NY5C 4XGZA 3EOTL 1GR7A 3P73B 2FWLB 4NHCH 2AAVA 1CD1A 4OZ4A 4NP4H 2FVMA 3FHEA 3H7BA 2YCJA 2NY3B 4C5YA 4Q7IA 1OF2A 1EXGA 2WYSA 4WVRA 1B0WA 2AK1H 1UTDA 1JPHA 2EDHA 2OR8A 4KI1A 5E56A 3MA9H 3S5LA 1TPB1 2VCCA 2VXQA 1EXUB 3QE5A 4O02A 5F0LB 3DO4A 1ZE3C 4OQTL 5EOQH 5F7MC 1NIUA 4KRTA 5EO9B 3DENA 4NQSA 4M6NL 3EOAA 4AQZA 3THUA 1ZHLB 4UQAA 3RTQD 3BSMA 5F4SA 1N2RA 3VIMA 3AG4B 1GUVA 4X9HA 2QLYA 4CN6A 2GZXA 2VN4A 3F7LA 4HB7A 1LK3L 1FUYA 3VVGA 3TWBA 1BX2A 2J5LC 3AS3A 3ZE2B 3CEUA 2QCHA 5D1QB 3EZ4A 1FBIH 1RHCA 9XIMA 1ZT4A 4WW1A 5DRWA 3U1SH 3T42A 5D09A 4URKA 3QSTA 2VISA 4ONHB 1HVXA 2X1WL 5JH2A 4AYFA 4BHUA 1J5SA 3ECWA 4DM1A 3IU3B 3LCLA 2ZDRA 3WD4A 3WF4A 4D0DB 5DEZA 2QCMA 3G04B 5DD0H 1BD2E 1DO6A 1NLBH 3ZTNL 4HKJB 4CADB 3EKGA 3G1VA 4LFYA 2OW7A 4G6JH 4TVUA 2V5RA 4XXCA 3W85A 1XR8A 3B8WA 3AS1A 4ZX6A 4QEGA 5SWZB 4H9YA 3V4VL 1M05B 2WY3B 4TOYH 3VXRA 3OXRA 2VR5A 5IHLB 3K91A 3G9VA 3MCKB 3CV2A 1E9OA 1SM3H 3ZR6A 5D9SA 2XSXA 3UAEA 2WWKT 1N4XH 4AJ0A 4K3HA 3CCHA 2CBMA 3TLLA 2NX9A 1H7XA 3H42L 5INCA 4LRNH 1QFUH 4BZ1H 1R6WA 2HTKD 2AJ3A 4XWUA 1P1XA 4CD4A 3Q44A 3QFGA 3L9BA 4F7TB 4HX1A 1UFGA 1VEPA 4B5VA 4PTMA 4N8CL 5LBVA 1B3JA 5C08A 2AK4D 4GYBA 3FMGL 3AFBA 2KH2B 3SQOH 3IMSA 2QPSA 5ABAA 5ICYA 2WCAA 1N0XL 2AQNA 5EBLB 4WDUA 3GSRB 4R9XA 2MTPA 4UZUA 4BWUA 3BZEB 1SLUA 5IOBA 1WG3A 4Z7OB 1A6AA 3UGXA 1YO4A 1IAKA 4RMRA 4M48L 5CCGE 2E76C 4M7KH 4PRPA 2DZWA 2PP1A 1UCBH 4OFYA 1IAOA 1ZV2A 2XFGB 3ISWA 1JFHA 1UQSB 2HJLA 4OD3H 1E4HA 1A7RL 1RFDH 2PR4H 1UD4A 4Z6AT 3HM7A 3VOJA 1NAMA 5FUOL 1ID5I 3BPLC 4LS1A 3LK6A 1WT5A 2RA1A 3D09A 4H4NA 2O5NA 2XICA 4L4VA 1DDTA 3HFTA 3SUTA 1VZGA 2WXNA 1EJ7L 3BSGA 2FZ9A 4YEFA 4GMTL 1QNOA 1K4HA 3GFZA 3WY2A 2XX0A 2W1NA 2VEPA 3R79A 3U2IA 3TYAA 2C0HA 4HHAB 3EYSL 4MJJA 3QDJD 4L4VB 1G7HB 5AKSA 4LT9A 3QGAC 4QGYA 4OM0L 5AYUL 5AOJA 2HSIA 3QDJB 5F96H 4Y5XB 2VEMA 3WQ5A 3S88H 2W80C 4HU8A 1UR3M 3DIDA 2W4XA 3D52A 4PB9L 1UQSA 4PY8J 5E0FA 3S9IA 2O6CA 1J5OL 4PRPB 5HR6A 4ZW7A 4WSKA 1UWIA 3MYZA 1N18A 1HFUA 2YK1H 4MQXC 2DW5A 1NKRA 3D18B 5EZLA 1VKXA 2A0NA 5L9DH 3NCXA 1J0JA 5EF0A 4P2AA 5IHRA 2OYLA 3OKKB 3ABMB 1FH5L 4DGUA 1HKLL 5EU4B 5I6XB 4Q8VA 4YDLC 3U79A 5AW9B 3R4DA 2VUNA 2H9GA 5CINH 3N3MA 3SGKA 5FK9A 1LBMA 1KFCA 2WZTA 4ZE5A 4PS8A 3UPMA 1JZGA 3EZ8A 2NTFA 3CCHB 5D8WA 1KBJA 3L4XA 2QTVA 4PV1C 1AQHA 4TMBA 4FI6A 1ZHKB 1G6RL 3TASA 5I26A 1PZ2A 2WKOA 2P10A 4ZMLA 2I9LA 3A67H 4DUWA 5HYFA 3OX8A 5A6TC 2PBGA 1NCOA 1KXQA 2E9IA 1LYXA 1CB7B 5D33A 2NXZB 4N6EA 1ZBWA 1L6WA 3KXFA 5IJVB 2OMVB 4JO3H 2B0SH 4GCAA 4Y2OB 4CJ0A 5DZAA 5B39A 3AZSA 4G1KA 2CLRB 5KS9F 1AKJD 5E23A 4DVRL 2WO5A 4U2YA 3V4UL 3AYVA 3ZWSA 1ZK9A 2WO2B 2ZXQA 1OYCA 5D9NA 4IKIA 4J8RA 5EF1A 2VXUL 2WXKA 2EG7A 1RP9A 1HHJA 1MDTA 3O06A 2XTJC 3GRGA 1VIZA 2DY3A 3LZ3A 3WO8A 2ENYA 2V5MA 1D5MA 3LKRB 4HJ0C 2DZAA 2NXIA 2A38A 4LUSB 4QRAA 3P2VA 3NZSA 1TRDA 5I78A 7PTDA 1EGJH 4HGWB 4DJMA 2B39A 3OJGA 2Z7WA 3EW3B 5LNUA 4BFAA 5BOZG 1H3GA 1G7MB 3VKJA 4H83A 3QR3A 3S47A 2WXDM 4P4RA 1T4KA 4M6QA 4LDEB 5I1AA 4ZUVA 3V5DB 4MZIA 1XH2A 3C2AL 4NQSB 2WMFA 3SDXE 2BZDA 5DHEA 3QHZL 4XVTL 1IE4A 3ZE1E 1OFAA 3OPUA 1HKKA 3KAAA 4AV5A 1A6WH 1RUSA 1F9CA 4XX6A 3TQPA 1JTOA 2DQTH 5E4EC 5F1SA 1NLDH 3OAUL 4F5CE 1FOBA 2NY6C 3ESVF 4TUJA 3U0TA 4YHOH 2OJPA 2PDLA 2V9DA 1WICA 4GRWB 1IAIL 4JFDB 3WEOA 4AYID 3H7BB 5KVFL 4GUPB 3SBFA 3TU9A 2AK4A 4JANA 2Y0SA 3P73A 2B4GA 1MLBB 2H1LM 4ZAKD 5GGTL 4Z1BA 3MYPA 5I73C 3GG8A 3DROB 3CHFA 4I5UA 2WM0A 3SJVE 2P50A 1MHHB 2HFFB 2LT9A 4S3BA 1OGTA 3B8YA 4LCUA 4DQAA 2RB8A 3R0NA 4Y4HB 4LS2A 3I02B 3SB3A 2BXYA 1A6VL 1WUFA 3KYKL 5E6IC 2ID5A 4M1DH 4GS7B 1R3RA 1I60A 4KK8C 1H19A 4G9FB 4JIRA 1JCXA 5IQ9A 2J66A 2KQNA 1A4KB 2HKAA 2EPMX 1JNNL 2IC2A 3QZAA 4NZUL 3WTXA 2FQFA 1RQEA 3TU6A 1UM6H 2DEWX 1RHHB 5FYJD 4JTQA 4LRNL 3KBJA 2JK2A 4WK0B 2JQXA 1MUWA 1CFQA 3HCVB 3LXBA 4YXKH 2FIKA 2VSDA 3GBNH 4X5XB 4F8TA 4AB4A 4MVBD 1U8NB 1XGUA 3D46A 3GSXB 2A6JA 5DJ6A 2V2DA 2R4SH 2WBXA 4FOKA 2MPAH 1MAJA 4DP8X 1CNVA 2K6YA 2PLMA 3EJYD 2Z31C 1YNKL 3WUWG 3T9WA 3LSCA 2HVMA 4AZGA 1OD7A 3U5YA 1BSIA 2V6AA 1XSOA 3AMGA 5E70A 4OY9A 4WW2B 1BHGA 4NQDA 1QZNA 1KPRA 1UCBL 3UMTA 2WWCA 2IGLA 3ETBF 1O9WA 2AXFA 1RK5A 1FLRL 5SWQA 4MOZA 1FFQA 5BXTA 3QRGH 4I7WA 1PB0A 4LDOB 4ZXOA 4XB7A 4HSOA 2UVFA 3UPBA 4WFHE 4MKMA 4KETA 5FYKH 1JQVA 3G0XA 4C1KA 4Y2DC 1S7UB 1UEYA 2FQGA 4BFIA 3RFZC 1VD6A 1ETJA 1MZYA 4E9XA 4M6UA 2JXMB 3BN9D 5BRZD 2Z35B 4MWAE 4ZB0A 3PU7A 2IOIA 2X2JA 3GXNA 2EZ0C 1WKDA 5EUKB 5I3KA 4HAGA 4HS3B 1E51A 4ZSTA 3V0SA 1HHIB 3JV5A 4QRPD 5CZVH 5DD3H 4GW1A 3M0JA 4OF5A 5KOMC 3TMLA 3VI4E 4QRQA 5I30H 1W8OA 3KP0A 4IX2A 3U4EA 1XLHA 5J8LA 4BM7A 4AZ5A 4ZQOA 3OMZA 4NQVB 5D7JA 4CBZA 3OBKA 1XF5A 1R5IB 1B3WA 1WCGA 5AFDA 3LIZH 1DQKA 3LSBA 3PIQA 4QTHA 5EOCH 1MFCH 1QPQA 2PYFA 3QJFA 1FO0A 2E7DA 2NLJB 5E6ID 1J4EA 4WKZB 1KFEA 4H6EA 2QGEA 5GNXA 1UXMA 3ZJ8A 1MW0A 4I5XA 1HESA 5CBEB 2VDNL 1R3HA 3BVNA 1NJ9A 1DJHA 4K4KA 3JZEA 3AISA 5ISZD 4YIQA 4PG9A 2OT0A 1TTPA 1JGEB 4JHOA 4WI0B 2CO6B 4HCRL 4YSCA 1E6RA 4S1SL 3R94A 3HHSA 3ARFB 3C5SA 3EXTA 1EAPB 3VD5A 4F7EB 2GSGB 4GRMA 2FATL 4B7LA 3QP3A 1BRLA 3PZMA 3A3HA 2ICEA 2HTKC 2V3DA 3F7PC 4QHMB 4QS5A 1GCYA 3H2WA 2GDUA 2UXTA 3C4UA 5HNRA 1H3UA 1AZZC 5FJTA 4UMAA 4N68A 1BGGA 3K6DA 3X1EA 1ZFJA 3X11A 5F1OB 4H1LH 4PJFB 1VQTA 3TN0A 4Q4EA 1WV7T 1U95B 1WZAA 3MRIA 3QIUA 5GJTL 2QZRA 2AERT 2DQIH 3U4BL 5C3LD 1KQZA 1U1UA 5F97E 4D6EA 1OK4A 2V7HA 1F4YH 1Z9OA 4MYWB 1W5MA 1I8LC 4NAEA 3SIZA 1WJ3A 5KYUB 1GJPA 3VFPA 2R4SL 3DX0A 7XIMA 2Z29A 3HNTL 3CHQA 3WIFB 4F27A 1D5IL 2QCCA 3QGKC 5G4WA 2CK0H 2J21A 2JI1A 3NIFF 3AJ7A 1T7VA 3GMNB 4QE4A 3O6FA 2WZ0A 2J72A 1XRVA 2YMTA 3VI3E 3ME0B 1M7DA 2ZA1A 5E9DD 3GJEB 3OJDA 3JU2A 3TIEB 3BVDB 4W68A 1U8PB 3NG5A 3RZCB 4BSWA 3FFCE 3OSKA 3T4AC 2IW0A 2VERA 3M17B 1JL8A 1IEHA 3MC5A 1MRFL 4ZMOA 1QK0A 3O6DA 5C5YA 1BBJB 3KL0A 5E5UB 1EL3A 1BZ9B 2Z92B 2EKSA 1TTGA 3B9KA 3C5ZB 5FWRA 5E95B 2Z7YA 2AL2A 1H5YA 5KSUA 1TJIH 5C2CA 1T22B 3WEXA 2IG2L 4Y2DA 4WHYG 5JQ6H 4FRWA 1W3KA 3AIVA 1UWEL 3M4HA 2YC1A 1ECZA 4JFZL 1OZMA 3TJIA 1W0VA 1C3FA 4BF9A 5IEKA 1QDSA 1XIHA 4DSYA 3WQCA 2UY5A 3LMYA 1U8JA 2Z1KA 4LW7A 1QSEE 3BGMB 3MGTA 1VGEH 3EOTH 4MQXD 4QRRA 3DRQB 5HVHC 1F90H 3W7CA 3CC1A 1FBIL 3NZHL 3VGAC 2OI9B 3FONA 1TV4A 2YZRA 2TSAA 2WLMA 1HGWA 2R24A 2ZXCA 4PA8A 5D37A 3THQA 3WLPA 4Z7UB 2EIEA 1FNEA 2E68A 1BQHB 1JK9B 3D50A 1QUPA 4DGWC 1W1ZA 2XQBH 5C0EB 5EOQL 4WY0B 3TBWB 3ZL2A 3WSUA 1KCKA 2PTTB 3NG3A 5FYLD 2D69A 1UA6H 2JSFA 4R88A 3EYUL 1T1YA 2R1PA 3TBVA 3HIJA 1NIBA 3MC0A 1G87A 4CKVX 3AXLA 2HJFA 5LZLA 4Y1AD 3DYPA 5B7ZA 4E41B 1AZBA 2J57A 4RZKA 2QF8A 4ORMA 5LWYH 1BFSA 1I4FA 4O4WA 4JFFD 3U7WL 3QV9A 2NMSA 4P5RA 5HGDB 1PNCA 4MYXA 5DX7A 1WS8A 3MRMA 2VL5A 3L5XL 1O6SA 4H1LG 3VXNB 5D2WA 5IHZA 4QHKI 5C2XA 4QG8A 1IZKA 1CGYA 4UZGA 5D6CA 2BVQA 2OEKA 3KLQA 4U49A 4XPHL 1C8PA 2O7SA 1TNMA 4BF7A 4HIIA 3QSRA 3JVGC 2XVLA 1AGDA 3URNA 4B2DD 1UZ8B 3QUZC 4CNPA 1EJSC 5I1JL 1EJWC 3B3IB 1KBIA 2WZMA 3DFQA 3ZOAA 3ILEA 4G11A 4YE4H 3VXMD 1JNHA 1QT1A 1EVUA 2WLHA 1EJUC 1BD2D 4IQLA 2JKWA 1F4YL 3C5ZC 3C60C 4O58H 4RLDA 4HFUH 5IJKC 3PB0A 4J2QA 5E9DA 1HN1A 3C12A 3DTDA 5D38A 1X5ZA 3DX7B 4LMQE 3AHTA 2KI6A 5SWUA 4M48H 2ZZ2A 1E8YA 3QG7L 4MMYA 5F7WC 1FY6A 1TPEA 3DMMA 4J1UA 3KH3A 2OX4A 3DX1A 3HZVB 1OO2A 2ADGB 2QKFA 4GI4A 1JV2B 4LCQA 3GUFA 3HGJA 4FJZA 4FLHA 1WKYA 3LKSB 4RNJA 1S7RA 3VI2A 3ZDZF 1PW3A 2UZIH 3ZT7A 3TA4D 1SOXA 4NRYB 2V2XA 2VGLM 5XIMA 3UD6A 4CD6A 1UWGL 2J6EL 2V37A 3WKML 2W91A 4J5VA 2VLKA 3VE0B 2O4EA 2G41A 3NZQA 3BGFB 1U58A 2KYIA 3A4FA 3ILDA 3NCCB 4I0PD 3PNWB 1OANA 2ACRA 2EEBA 1ZSHA 4X7FC 1YECL 4NRYA 5EN2B 2WQRA 4WO0A 2Y7FA 1YPZE 1A5SA 1PLAA 2G4GA 3W39A 3WIAA 4N6RB 3MNZA 4TXVB 5ISZE 2UWEB 2BP3A 2IQDA 3VNYA 3OYZA 3D5OF 4MDJA 5CWSA 3DK0A 3TV8A 4CVXA 3BN3B 4N86A 2G8ZA 2JJTA 2XGBA 3DMMB 1R5WA 4FHKA 1JGVL 4UI2A 3MJ9L 3LEXB 1MQQA 4ZFMA 1HXKA 2EDEA 3IWVA 4IRZA 2WVVB 1HVQA 4NRSA 1HXMA 1WT5C 1NTDA 1V7NL 2AC0A 5I5MA 1CF8L 3FUKA 2XPZA 4MAYA 5EH1A 1LM1A 3UWEA 3ARSA 3AUJA 3F58L 4HDIA 2CXGA 1IGMH 4KUCD 1M1SA 5EULV 1R3LA 4BCXA 5CSYA 4YL2A 1NPNA 2IOOA 3CVHH 2ZXAA 4XPFL 2XTLA 4AWJC 3V7PA 3FBQA 4BQ5A 3E38A 3V35A 1MQ8A 1AGDB 1INQA 1E6JH 3RG6A 4U28A 3GUWA 3PP4H 2ZUYA 3N29A 1SYVA 1FZOB 5IHZB 1ITUA 4W9HC 4KFMA 4Y5YC 3ARRA 3K2KA 3DDGA 4L64A 2HPMA 4BFKA 1XAKA 4A3RA 1QUMA 2QZ5A 3MNMA 4JN2B 4UTBH 2PD9A 4GW5A 25C8H 3PQYD 3LQGA 2DWDB 4IPJA 3FB7B 1IXQA 3FYOA 4QX4A 4O5LL 3VCRA 3P4MB 4E41A 2I9UA 3AXLB 2C1OB 2I32A 3FGCA 3N3TA 3GB7B 1SPDA 1E5NA 3EA3A 1MFUA 2FO4B 5JVLA 3KYOB 5E9DE 4HIPA 1SHXA 3WBEA 3TBWA 1XLDA 1G43A 1XKYA 1JPFA 4CSPA 2IDQA 3B9NA 1BQHA 3W7MA 3LHPL 1Z5LA 2Y62A 5B7FA 4L56A 1B90A 3GK0A 4IICA 4RH4A 5TBOA 4JM2C 3N17A 4AY7A 2VERN 4KGJA 5T8IA 2BVYA 4R4FL 3ECBA 5A6MA 3LLFA 4UWMA 1E2ZA 4APQD 2ZWSA 1J5CA 3LPPA 4OLUH 2CWXA 3E02A 3DHUA 4K9EH 4PEEA 3KYMB 4X5RA 4UTAA 2R7EB 1TG7A 4PUNA 4DWSA 3DU0A 1WKFA 3HQ1A 2XZCH 3NP4A 2FZMA 1W0VB 3BYYA 4D71A 1ES0B 1H60A 2YC1B 2RDUA 3S5NA 2AEQH 3VXSE 4AHOA 3WQOA 2NSOA 2NW2A 5AW0B 1DXEA 4RW3A 5KTLA 3EG9B 1P5BA 5F1IA 3HPLA 4MDPA 4QSHA 2VZ3A 3FULA 2GB2A 2EKSB 2CHZA 2CSPA 2R59A 3KYKH 1E30A 3QGVA 1CCZA 2H6PB 4RWYH 4XP4L 4YHZL 5J11B 3WH8A 1HI6A 2QDDA 1RQ5A 3ESPA 2FZ3A 4IIHA 4BSWB 3RZCA 1EFZA 2J62A 3TIEA 4OZHF 2B81A 3GJEA 2CJUL 3WD1A 2FWOB 4PTDA 2QVKA 1LBLA 1OFPA 2O4QA 4I48A 1VEMA 3IFOB 4E8GA 3CS2A 2ZUQC 4U4MA 1VFBA 2YPVA 4NUGL 3N5AA 2BOCA 1DSYA 1IEIA 2GJLA 1QLRB 4MXQD 1OINA 4JFFE 4H6RA 5MKGB 4LL9A 4ILSA 2BO0A 3GRWH 4TTUA 3UJJH 1XWVA 3AAZB 1MZZA 5IFAH 1HXYA 2VW6A 4PRIE 1IRAY 3PWAA 1E0OB 3AFLA 4Y4FC 2HVOA 4DGYL 1KA9F 3S37H 2J1XA 1AE6L 1MPAH 1MEXH 3FSAA 5JNYA 1LORA 2Y4SA 3KPRA 4JG0L 3TN0B 4Z3IA 3RUGE 1Q6QA 1Y65A 4U1JB 4RGMB 5C09B 5DVPA 5JOPE 3N55A 3QV6A 1BZDA 4F37K 1TWDA 3S3GA 1ASOA 3TROA 3UFIA 3GF8A 2AGJL 4V1YA 3ATEA 1PCSA 3N44B 2WYTA 1K4GA 4TSCL 1YTDA 2GC4C 2FPVA 4WEVX 3BP7B 4NJAH 3LZFL 2OS7A 3G6JB 3GRIA 5CCJA 1MHEA 2VJ8A 3KPTA 3L16A 2VFHA 2B9AA 4ZB2A 1DVFD 1DIDA 1S8DA 5AC5A 2YQBA 3GMOA 1QP1A 3V4UH 4HBCH 3NPWA 1PKNA 2WJZA 2A6DA 3KBVA 1KGCE 3RPDA 2JH2A 1N70A 5HOSA 2NQLA 1QYGL 3JYCA 1QR4A 5F72S 4Z7IA 5FYKL 3LD5A 4U5KA 1YXYA 3QBTB 1ZXKA 2PYFB 3IM1A 3QJFB 3R8BB 1DBJH 4J23A 4XVJL 4UB9A 1ZHNB 2OR7A 3VM7A 4JR5A 4JYFA 4ZENA 3UY8A 2V8MA 1SF3A 4L9XA 3M5ZA 3QZPA 4WV1A 4ADSA 3K0YA 1CZ8L 5E5MA 1UUSA 3RDKA 3X17A 5GQBA 1X97A 2WINB 3VIOA 4QRQB 4N8PA 1TA3B 5C7XL 5T1KD 5CD5C 3MRFA 4WTZG 4EEEA 4JY8A 1LLOA 1Z6JT 3FZUC 5DQDL 4CSZA 1ODZA 5DJDA 4C91A 5DO2D 4UDTA 4LKCB 1LWIA 3MYJA 3WUEA 2X2IA 4X2PA 2GK1A 2EJ1A 2M2DA 1YY8A 1XM3A 4GUIA 4B9FA 3U46B 1LUCB 2I7GA 3LD8C 4N2CA 1XV8A 1HDMA 3VWJD 4DNHA 2JK5A 1S2AA 3LEYH 3QWRA 4BFIB 4FNRA 4BFGA 2VDMB 4HFWA 2VZUA 5L8JB 2F1BA 1NIAA 3GXTA 1NJJA 4QJ1A 2EDRA 4XTRD 1K3UA 4G9FD 5ECGA 4UIKL 2KZWA 5BRZE 1JTTA 3LRMA 1HJVA 5ITFB 3PZUA 2ODIA 1D9KC 5I1LB 4Z1CA 4XC1L 1OGAD 1L7TH 1TUPA 4U3SA 1EPXA 4WW2A 2OMWA 3CVCA 5FO8B 1AODA 3JV6A 3WQ6A 3IN2A 5K9CA 4UTAH 4YDZA 2NY3D 5B1BB 4C6JA 2YJQA 1A9EA 1YEWA 5CAHA 2ERJB 2FX7L 1ZT1A 2VDQB 1GPFA 4IL2A 3GZKA 3V5HA 3EOYG 1MRQA 3ESOA 4ZOCA 1FP8A 2CCWA 4I7UA 4KC3B 1JNNH 3MB9A 1AW1A 3GK8L 4P3CL 1P0KA 2VUKA 5IROD 4KK6C 3CG8A 4UT7L 4DZIA 3HCVA 1G7PA 2BNQE 1HZKA 4ERSH 2OMZB 3WL9A 4HZ7A 4HIHB 1WFNA 2NZ9D 3TTYA 1M7JA 1RHHA 1A21A 2OXGA 2XRAH 4JDBA 2VKXA 4PMEA 3FU7B 2PGFA 4NQQA 3UTSD 1A3QA 1NEZG 1GGBH 4MWAB 3BZ5A 1IC5L 2W60B 4Z0JA 4FAMA 3UA3A 3LEVL 5E8EB 1S2EA 3WO4C 5C07A 3SGEI 5ICZB 1SDDA 1XGTA 3C6SA 2WZEA 4QLLA 5IBXC 3AITA 2HNHA 1I1CA 4FQQB 1K8IA 1OAZH 4JGNA 3O0RH 1UWUA 4UR9A 2GFBB 5FEPA 1Q2RA 4Y4HA 4FABL 4HJJL 1TJIL 1W5OA 1VLIA 3FXIC 5TF0A 1YRRA 3GHUA 5GS1B 3LLDA 5HHPB 4AY1A 4H8HA 1ZIAA 1TPH1 4ZBCA 1CFSB 4K9EL 5MEND 1DORA 3QIWA 3MKCA 3DROA 3QRGL 3U25A 2CO4A 3RCYA 4XPTH 1NMAH 2C1PA 5DYOB 5JR1H 2VKZG 4EAMA 2GBTA 1RZKH 1CYWA 4NKMB 4X99A 3EDJA 4KNQA 2R82A 3MBFA 4WR3A 2YYUA 3H85A 4Q14A 2IPTH 2OTUA 3A3YB 2ALWA 1V8EA 5J04A 3NAVA 1UD8A 1F4AA 1VBJA 1RL1A 4ODXB 3H12A 3D3VE 1PG7H 1BXNA 4KO9A 1D9KB 1YJDL 4Y9MA 3QEGH 3W7JA 4P9HL 3T4AA 4LEOA 1JOIA 2AVGA 3EJZD 3MV8D 4P5TD 1N8FA 3VGHA 2OR9H 1IE5A 1H3PL 1UVQA 2Z4QB 2NQZA 2DZBA 3IFLH 1G9NC 1BF2A 1QFEA 2X6VA 5D6DA 1XKJA 2YA1A 5LGJA 3C0JA 1B2YA 2Y23A 2X89D 4Q6IC 3HMCA 1L9TA 2XSAA 2BSDA 2HFTA 4HEPA 4K8EA 1XAUA 3S3PA 3TFXA 3MPGA 1AXSB 2DZUA 4OECA 2V17H 4GYPC 4EP8C 1DLHA 3P84A 4PW4A 3TSMA 1YNYA 4KOCA 2O5YH 3GKWH 1K4DA 4WHYH 4ZO8A 4E5XA 3PNUA 4YO0B 4CD8A 2G37A 4ODVH 1E5YA 4IH3A 1S1PA 3WELA 3T9PA 3TDFA 4JLRB 4ZPVA 3CFUA 1EJVC 3NOEA 3P82A 3PP4L 3K71A 4AE0A 5E6IA 4RDWA 2X9XA 3M7WA 4M8QB 3GZQA 4TSCH 3TWYA 2FRGP 2RH0A 5FCSH 2PDJA 2HG5B 2XG4B 3VNZA 4FK9A 2GTWA 3D9AH 3I2CH 4DXKA 5C6MA 1WFJA 1P1VA 5HATA 2WOYA 5FESA 2O4MA 1KPVA 2EE2A 1HP4A 1AW5A 2G5BA 1TQUA 2X41A 3ZGHA 5LNRA 2V9TA 5HSFA 4KK5C 5U4NA 4GKZB 2HEJA 1JGLL 2FZBA 2I1OA 1ENUA 1I8KA 1SZGA 3GNNA 3LERA 3X3GL 1GQIA 1VCFA 1VKFA 2WGXA 3D51A 5I1GH 1W6LA 3QLLA 1IC4H 4IJRA 3N50A 1BFTA 3WKMH 2NT1A 2LTQB 3IXTA 4N8CH 5EF2A 5D7IF 1VKXB 1FKWA 1KZQA 1HJBC 2DSKA 3VOGA 4L2YA 2LAGB 3ZYJA 3L7FA 3O6MH 4KEVA 2ORBH 3JBG7 4EPBC 3W37A 4Z2IA 1A1NB 2C3GA 4PJAB 2PZ0A 1P7TB 3L2IA 3S4SB 5LG6A 1BEYL 3FQRB 2X1RA 5KJ4A 2GUUA 4H13C 4OKVB 2I9EA 1UQZA 3KOXA 5CP3H 4I5RA 3QH3A 3SADA 3LKQB 4EQ3A 2BRRH 4Y5XA 3BEVA 3DX8A 4UMSA 5DHVB 3WD5L 1D8WA 2FX9H 1KRCC 3U5UA 1Y1DA 4IMDA 2C15A 5E6SB 3MOQA 2ADYA 4MD5B 4E3VA 1XG4A 4KJPC 2J6VA 3NQ6A 2ZZUT 3U9PL 1TQJA 2GVEA 3GTIA 3KCWA 1F6AB 3QUKB 3T6XA 4R4FH 2ACQA 2GJZA 5EEXA 3PGFL 4QRTA 4PUJA 1GQJA 4GZ7A 3KS0J 3MLZH 3QG7H 3VAVA 2I07B 4XTIA 4K9JA 4Z77A 3FVDA 1H63A 2E75C 5CCZA 1E3ZA 2DIKA 1OGAE 5FOBA 4YBHA 1UR4A 3AMDA 4PWHA 4QO1A 1FHUA 5FHBL 2JKNA 3WFCH 5C0AB 3KWXA 4NQXB 1AJ0A 1A6AB 2ZOOA 2QVTA 1M1XA 2LE9A 3IJ9A 2I56A 5EBUA 5GZOA 5FR3A 1XGQA 5D1XC 1GQLA 1RULH 4UIMA 3TF4A 1F8MA 2D0HA 3RJOA 5K9KB 4R8WL 1IKOP 3STLA 3K4WA 1N5AA 2OMNA 3IXAB 4AAJA 4HWZB 4FO4A 5C08B 2BVWA 2Y1ZA 3D6GA 4YDIL 4O50A 2W38A 3D85A 3GHPA 5EBGA 1QFPA 3SKMA 1F97A 4BFFA 5L9DL 1TVLA 1ZB5A 4AUJA 5DZJA 1E6SM 1C16A 2AJ3B 4Q9QH 3EHBD 4KKZA 5ABEA 1YYMH 2EO1A 3DGBA 2ALDA 4N02A 5JU6A 3N6QA 4EANA 1JGVH 3BLIA 5A43C 4LX4A 5D9SB 2REQB 1BFNA 5KS9A 3QPEA 1IR2A 3NT0A 4LYRA 4FJ6A 1ZNNA 1XIWC 4U1GC 6REQA 1KCWA 3BSZL 1BOYA 1XR8B 2PPEA 5LDSA 1VADA 3IMUA 4HK3J 2R0LH 1KM5A 3NQMA 4TX6A 5CAYB 1IQWL 5D1QC 4HK0A 4QHPA 1F74A 5FA3B 4Q9RH 4HK3N 4L3EA 4XCYA 4M6AA 5AOMA 4OZIF 3ZR5A 4S3FA 3VC5A 3AREA 5KYWB 3CE1A 2BOEX 1LT7A 4AC4A 4WNSA 4RFEA 4LU5L 3VH8G 3WFBL 4Z5RB 3NUKA 5E7FA 1XXXA 2O9OA 1TYJA 3I65A 2CG9X 5JW5A 4Y9OA 4NP4L 2XKNA 3FQ4A 3K72B 1VS1A 3QHFL 3N1QC 5AAWC 2WXHA 1YRKA 3CHXA 2JMRA 4H8WL 3GIZH 4NN5B 1U91B 3OC8A 1IL1B 5K9QG 3SY0B 4OLUL 2GI0A 3K6OA 2EPLX 3QMRA 5IREA 2ROYA 3ZVHA 5DRNB 1GOGA 3BQUA 1J0ZA 1WV2A 1GJWA 3ABRA 1ZLWK 1Y0EA 5T5NF 4FQPA 1EIBA 4HZLB 1QFUL 4H01A 8TIMA 4IF2A 2H26A 4KDTC 4LLYA 3QAQA 1EXUA 3H2MA 4GA8A 4KRMB 1I0DA 4Z3JA 2W67A 5IWLC 3ISIX 2GJ6E 1BYNA 1DE5A 3KOZA 5AYZA 2VMFA 3DMMD 1FWEC 1I0BA 5IY5B 4GBXA 5C92A 4YHEA 1TQSA 3ABLB 3MAWA 1KTKE 2SEBB 1EWDA 3R7MA 4AEFA 1W0YT 2H1XA 3X1GA 1K7FA 4U3AA 2QFPA 1H5BC 3QO1A 3QNYA 4FQ2L 1U41A 4XGZB 2HT2D 4YHPB 4EOWL 1DQQA 4GIEA 4IWWA 4CCCA 1SN0A 4WTWA 1ILUA 3GLZA 4Q6XA 3QQXA 4X0VA 2NYZA 4LCIH 2CBPA 1X98A 3WS3B 4D6FA 3QPQD 1ACCA 3R8GA 3K2UL 3QUYD 4I13B 2BGNE 1ISZA 4PUWA 2BMBA 1W37A 4AQLA 2IH3B 4A67A 4Y16C 3G3DA 4XBSA 1CI3M 3BX7C 3H9SD 4AVNA 4B9JA 1QOPA 2KDYA 2H45A 1GS7A 3WFAA 4JNZA 4BH8A 1AY1H 3MSRA 5CZJA 3ZR4A 4KHXL 1HKIA 4ZPTA 5C0BA 1O5PA 5SX5H 4MJID 2Z26A 3GAKA 3TNOA 4IFKB 3QS2A 5E00A 4A2FA 1KTJA 1TJ0A 1GPWA 3ARZA 2IDFA 1MVUB 3SCUA 4MLIA 4R4BB 2YD4A 1PWMA 3CASA 3ML8A 1WIOA 4WWKA 1CFBA 4BSJA 3NA8A 5JIQA 4NCC1 3WMPA 5GISH 3MODL 3MV9D 5DRXA 9RUBA 4ZZ9A 4K3ZA 4WJXA 1IC4L 3LRLA 3HGOA 3IKKA 4NJAL 1PVNA 1C5DA 1C8XA 5I3JA 4YL9A 4BQCA 3FOKA 2XBTA 4MNGE 2YDRA 3PVFA 4R7NA 4TMCA 2A9ML 3BSZH 2X0UA 4HN4A 4MFDA 1NUNB 3OG3A 3QCVH 5T3XH 2X4QB 3W9EA 3L3OC 4M03A 4POCA 5HWNA 1ME8A 1T0NA 4B9IA 1BEYH 4PN6A 5CO1A 4ZE4A 4LAOA 1YAZA 4XRCA 1W6TA 2GJ6A 2E74C 2BSBA 1X7QB 2VDOB 3HG1E 1IM3D 2HYMA 3L2MA 3D85D 4H6QA 4XKYA 3NK3A 1KC5H 3VGAB 3MV7D 2XZQL 1YNTA 2QQLL 3OHXB 3PL6A 3D2UD 3ZO0A 5B3JF 3M0XA 1V02A 4FAAB 4I0PB 1XIEA 2YXMA 1QHOA 4L4JA 4LP5A 3KLHD 3P40A 4NKIH 5IT2L 4ZFFB 3GHEL 3VGEA 5HY9B 3NO1A 3OW1A 4PR5A 1J6OA 2P43B 5HJLA 2ZKHH 1EQPA 4PRTA 1H5BB 4JM4H 3N9SA 3MACH 5HYSB 5GRVK 2P3ZA 2WTRA 3GSNH 1JHTB 1OP3H 5E99L 2ZF9A 1RR2A 4S2CA 3GHRA 1XZWA 2HVKB 2ESVE 4IYKA 5DQDH 3L3DB 5IB5B 1NFIB 2HT2C 4GVFA 3STPA 4QE1A 1G01A 4WUIA 1TJHH 5FHBH 3C2AH 4JPSA 4EAEA 3D0CA 2VJ0A 3P11L 2IXQB 1KKRA 3KRUA 5D7JC 1GEQA 4IMAA 3MMEA 3L3GB 2PWEA 3RRXA 3VIFA 4IOIB 4X6CF 5T3ZD 2ZOWA 5GGVY 3CHOA 1H09A 4O1CA 4YHYC 1AQDB 4PD4K 4NM8H 2B14A 5ICXB 4AX3A 2ZOKB 2FBJH 5LAXB 3NQAA 2YCIX 4UNVA 2BGSA 4QROA 1YJDH 1HTIA 3IJYA 1FH5H 1XF4A 2O5YL 3LXAA 1QOQA 3BE1H 4M9OA 4PULA 2D7QA 2HUEA 5DDHA 4IXXA 1HZHL 4TVPE 4B53A 1O7DC 3GZPA 3N44F 3EXJA 3EA2A 3HEIB 2OX5B 1Q94A 4UIOA 3S9ZA 3K2UH 2HT4D 3O6FD 4W9GC 1XLJA 3UGUA 2HXAA 1WZLA 2EXWD 1UD2A 3IYLW 4G1MB 4X9SA 5HHOA 5IP4A 3L1FA 2XJLA 4FLOA 2OYMA 2OTWB 3DOIA 4NI8A 1JHKL 4ZYKB 5ESVA 3GBMH 3PHOB 5HR7A 2H32H 5I66A 4F7PA 1G6CA 1PSKL 1XD1A 3JV4A 3NVQA 5L8LB 5AW4B 1WDWA 1NUDA 1AAJA 3DUSA 4CU8A 2ATPB 4POZD 3V0WH 4Z1YA 3MUXA 2A0LC 3IAPA 4LESA 4KZ0A 1OCNA 2E6DA 4WWKC 4Y5YB 4MXVE 1I53A 2O9TA 3MLTA 3D0LA 5JDSB 5I1EL 1CL7I 1UWAA 3FX4A 4BIKA 3FPYA 1HSAA 3KCPA 2WIIA 1UKPA 3NJNA 4ZTPH 3OQEA 5A2AA 3CV7A 1KBKA 3P54A 4JTUA 5AZ0A 4DJED 5CEZD 1UZ6E 1GC1H 5T33H 5IR1B 1PWLA 1J9SA 4O1DA 3B9AA 3ARWA 1OP3K 5B22A 4GS7C 3T05A 2W61A 1YQ2A 3NH7L 4KJWD 3NYKA 4AOFA 3DHFA 1RMFL 2YXGA 3F5KA 3DURB 1HH9A 3H8AA 4A8IA 2BNQD 3DBXA 3VOIA 3UJTH 4Z17A 4AJVA 5JPNC 2ARJB 1X6LA 3X3GH 3C8KB 2HCZX 4W7UA 4MD0A 2MANA 2WW8A 1V0KA 1QR1A 5IDIA 4LGSB 4TU1A 3IMWA 3QW3A 1G1OA 1H8LA 5DMIL 2WCGA 4C6NA 2AK1L 4DELA 1SN5A 2V4LA 3WKNA 3EH5B 2IBZX 5DJ8A 3KPNA 3JZUA 4IG2A 4LEFA 4UTTC 3ILQD 2Y2YA 1UJ3A 2AJXH 2NUPA 1TEGA 2YD6A 3MNWA 1F3RB 4PPTA 4R9HA 3GD6A 2K6ZA 4LC8A 2NX5B 2YA0A 2CBUA 1Z2KA 5AHNA 3OBEA 1YQVL 1ZS2A 1FN4A 5H8DA 1WAAA 3QPZA 5G2HA 3GTTA 1NFDA 4QGTA 6TAAA 2HPOA 3A9BA 3NQIA 1LQAA 3WS6C 2DV0A 1N59A 2Y5QA 4X9GA 4IPPA 3VFLA 1A25A 3LNEA 2R23B 5E4OA 5KVEE 1EDTA 3CUGA 1CFTA 4S10A 3BQUC 3SURA 1UKSA 4PVBA 2VITA 3W9ZA 4LY4A 2YSSB 3FT9A 3JUGA 3BUYB 4AVFA 4HALA 2IAND 4FHBD 1HL9A 3FCTB 1NC2A 4DVBB 1QU4A 4NT0A 4DEFA 1Y8BA 5AVHA 4HKXB 1OGPA 4WKXA 5DD0L 1WAAF 2JKSA 1AYOA 4UILL 4QMEA 4UANA 1LM8V 2C26A 3EYUH 3GTNA 2Z34A 3L48A 3WBDA 1OQFA 5G2WA 1F86A 3NCBB 4C6BA 4D6DA 3BMWA 2Q3XA 5HMFA 1QWGA 5FA5A 5CQ1A 1YMMB 1E1CA 4Y8EA 1FZJA 2OJZH 4A2EA 4YTQA 4CGTA 1W3HA 2R14A 3BWZA 4AUBA 4KXDA 4OOZA 3SN4A 3CIVA 1J5DA 4WD0A 1FVDB 5CFHA 1OTTC 1R0MA 3M16A 4TLTA 5CGBA 3V52L 4JTEA 1T5XA 4JHBA 2PP9A 4MQ7A 5CZSA 1MCPH 3OLDA 3P9LB 3EYVB 4NLAA 3L7EA 3SZ8A 3FSVA 3HG1D 5H2BB 2QPFA 4R0LB 1CT5A 1AO7B 2YPKA 2ZJSH 1HJSA 5F7UA 2V68A 4P8UA 4N2AA 3WQFA 2AFNA 5EUOA 5I1DA 4LOCA 3G5WA 3WTUA 4HKZB 1OKEA 3E6FB 1BM7A 3THAA 2I14A 3KPSB 1LEGB 3UQNA 4R7XA 2CRIA 5ITBL 4GCXA 4MJ4A 1WD8A 1YEFL 3BYTA 3K1GA 1PTZA 4XD5A 1XF3A 3EB3A 3MRRA 2QZQA 2ESCA 3A6CL 1K85A 3P0YL 5CLWA 1IEXA 4H1ZA 1R24A 2DH2A 5LHFA 4F2MB 2P76A 1CICD 3L3KB 1GC1L 1KLFA 3ZWTA 3TYDA 3AWEA 2L04A 1RJYA 5KSBB 2X9WA 1JUEA 3BZJA 4D9PA 3B6SB 1OGBA 1MJJB 3QAZB 3AT0A 5CZVL 3FQXA 3ICJA 5F93C 1GVRA 3QORD 4GRWE 3NXLA 1A50A 4MJ2A 4PJHA 3O2WL 1I2RA 1FI8C 1ICPA 1QTWA 3JV0A 4R90H 3WFZA 4L7ZA 1HHGA 2FBRA 1KB5H 4IZGA 1RY8A 1EJOL 1MVFA 3T6WA 1MCBA 4NZ1A 4CVZB 1F41A 1OL0A 2J7BA 1XEUA 2YO3A 4A8LA 3BSHA 1FCVA 4G1EA 1VFTA 3N1AA 4RESB 4C83B 1ADOA 1C9SA 1ROCA 4HUNB 1NWUA 4EI6B 4NBZB 4EOWH 1UHVA 1JPSH 2OR9L 3RWFB 2XPYA 2BSTB 1SMDA 2RQ8A 4LCWA 4RBPK 2DPEA 3FK4A 3MY9A 4I9TA 3W75A 4B92A 5HYQB 4FX7A 1WA2X 3T4WA 2WQSA 4GNKB 1LL4A 3UGRA 3CMOH 1UR9A 2P1FA 2QJNA 1T41A 4GNVA 3LQZB 1IYXA 1XX1A 4KKPA 1UWXK 4KX7A 3TIDA 1JZDC 2BNQA 4O2CB 4G8EB 3NYZA 3ZDZB 1UMLA 2VEIA 1GTEA 5CEWA 1OEZW 2OOFA 1WDAA 2FATH 1AY1L 4MQSB 3GUTA 3GIPA 4CNIA 2DWTA 3HJEA 3VJ6B 4KUZH 5IMLA 4TSBH 4C55A 1YMHB 1Z9AA 2ACSA 3V6ZA 3MJMA 2R6OA 4IGBA 4NZRH 4EZJA 1AKJA 4G7RB 2O0TA 3BWWA 4BKLB 2E47A 4MWAD 2GJXA 3FRPB 3B7RL 4G8GB 4AGPA 3PUCA 2NNFA 2MRYA 3W1ZA 3EH2A 1HP5A 1DE6A 3S8WA 2NNRA 1UYWH 1IIHA 3T4CA 2XKUA 3QM3A 5SV4A 4E42A 4QGCA 1AS8A 1HKWA 3PZGA 3RPTA 1G7QA 3AADB 4EMZA 4N0U