3TJLA

Crystal structure of a novel oye from the xylose-fermenting fungus p. stipitis
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
404
structure length
404
Chain Sequence
SSVKISPLKDSEAFQSIKVGNNTLQTKIVYPPTTRFRALEDHTPSDLQLQYYGDRSTFPGTLLITEATFVSPQASGYEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLIFLGRVADPAVMKTRGLNPVSASATYESDAAKEAAEAVGNPVRALTTQEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHLSTIVGADKIGIRISPWATFQNMKAHKDTVHPLTTFSYLVHELQQRADKGQGIAYISVVEPRVSGNVDVSEEDQAGDNEFVSKIWKGVILKAGNYSYDAPEFKTLKEDIADKRTLVGFSRYFTSNPNLVWKLRDGIDLVPYDRNTFYSDNNYGYNTFSMDSEEVDKELEIKRVPSAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase
publication title Structural and Catalytic Characterization of Pichia stipitis OYE 2.6, a Useful Biocatalyst for Asymmetric Alkene Reductions
doi rcsb
source organism Scheffersomyces stipitis cbs 6054
molecule tags Oxidoreductase
total genus 157
structure length 404
sequence length 404
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tjlA00
5EL1A 4IPJA 5KMYA 2OMAA 1RZMA 1F5ZA 3PF3A 2C15A 5E1QA 2FTPA 4FHAA 4QSHA 1L6SA 1T0OA 2FDSA 5AYXA 3MP5A 3RK8A 5LNWA 2JKPA 4S2CA 3HQ1A 1PE1A 2TYSA 3P84A 4OT7A 4A2RA 3TA6A 2NZLA 4TO8A 1W5QA 4XKYB 2VXNA 2A5HA 3DKJA 2X1RA 3TJLA 5AB3A 3QFEA 3V75A 5D02A 2XN0A 1OFEA 5DY2A 4HT3A 3P80A 1TQJA 5IM51 4RK8A 1OF6A 2VOMA 1YADA 1QPQA 3PG9A 4UFHA 1B4EA 3L68A 2RH9A 4YMZA 2PCQA 3LBMA 4JTKA 5G5IA 2WNQA 1T99A 1XBYA 3HG4A 1NVMA 2QCLA 3SJ3A 1F05A 3QMTA 5KTLA 1GPWA 3LTYA 5TBOA 3DFPA 3RNDA 1LYXA 2H3BA 1HO4A 2EKCA 2CLEA 1CW2A 4AEOA 1TO3A 3W7RA 3S1WA 3QRHA 4FNTA 1EP1A 3G8EA 1D3HA 4WY0F 3MI2A 4UFLA 5TQLA 3E49A 4DF2A 1TCDA 3NQAA 3CT7A 4EVZA 4NXKA 1SO6A 4HPJA 1W3IA 5AC6A 2C16A 3BLFA 5G1TA 3UZ5A 3W1RA 4JGDA 3KVLA 2V5LA 1I2RA 3A24A 1PS9A 4X9SA 3E12A 2CU0A 1G67A 3EXTA 4K7YA 2UV8G 1GG0A 4DBDA 2DJLA 3LHVA 1GVFA 3NZRA 3B4UA 2G96A 1HTIA 4Y90A 5CPOA 5LNVA 4N9BA 1G7VA 2WOQA 4O0KA 2CZFA 5CZJA 1SZNA 1K7XA 3LCGA 4YCPA 2ZRWA 4A22A 2ZRYA 1LRQA 1OFOA 3LXAA 1YXDA 2CLMA 3C0JA 5G4WA 4KFOA 3P5YA 4BF9A 4IX2A 2R91A 3UXDA 2GVGA 3HG2A 3OVQA 3PG8A 5D32A 4LVDA 3LCFA 3QPZA 4N02A 1U83A 2G95A 4UTHA 4UTJA 4OWGA 4GUGA 3A5VA 3TAOA 1FWTA 4OE7A 2HS6A 1EPXA 3PUEA 4BI7A 4O15A 4LVAA 1FBAA 2R14A 3YPIA 1OK6A 2OT0A 4XBSA 4KWVA 3FA5A 3MI3A 1O94A 4N9CA 1W56A 4YXGA 1VYRA 3B0UX 1Q6QA 5FF7A 4RKAA 3FOKA 3TX9A 3W71A 2H6RA 1OABA 1QOPA 4K37A 3M5ZA 1FDYA 3NA8A 4FO4A 1TIMA 2ISSA 3A22A 4R33A 3G1VA 3IRDA 3TAKA 2QUTA 4JDYA 3NVTA 1MO0A 2RDTA 2QJIA 1H60A 2QCDA 3W1TA 3IVUA 5CG7A 4DELA 4JIQA 4A29A 2BLEA 4MY8A 3BW2A 4FB7A 5F1UA 1KM2A 4M6VA 4MUZA 3DI0A 4WUIA 1I2OA 1ZHAA 1SSDA 1Z48A 4ZVJA 2H3DA 3S5NA 4ADTA 4AWSA 1JJKA 1AW1A 2ZA1A 3LTPA 1TRIA 1GZGA 4NNCA 3W7HA 4UTWA 4HHPA 1KM5A 5KITA 5K4XA 2TSYA 4YL2A 3FJ6A 1GVQA 2Q3RA 2FPTA 1WBHA 3DXIA 4ZQMA 1IXNA 5D2VA 1VPXA 3D0CA 2RHGA 4RZ5A 1W31A 3N2MA 1TTIA 1ADOA 2JBMA 3KXQA 1WAUA 1I4NA 5EPDA 5EKYA 1A50A 1KFJA 3FLUA 1BEUA 1XBXA 1C9DA 4DPQA 1YTDA 4RCXA 1TYGA 1L2UA 1WXJA 1B57A 1JUBA 4M6PA 3UWQA 2I1OA 4FX6M 1RQBA 3Q94A 4MJMA 3UQNA 1LBLA 3FJLA 3S1XA 1EUAA 3GYEA 3W3OA 3W84A 4O50A 1OYAA 3GXPA 5D2WA 3LCIA 2FJKA 4LOCA 2DU2A 2IQTA 3HF3A 1VGAA 3GDTA 3W75A 3NXFA 3M47A 3PSVA 1W3TA 2QCEA 1TQXA 4O28A 1W8SA 1RQEA 3L5LA 1XC4A 3SFKA 1AMKA 1WQ5A 1ME9A 1SR9A 3MMTA 3W76A 3MO7A 3NQEA 3KFTA 4UTMA 3LLFA 3R2GA 3WJWA 1MSSA 1IXQA 3N73A 4O4VA 1DJNA 3OBKA 4M7SA 5FEZA 2WJZA 3R13A 2DZSA 4RZ4A 3EWWA 4ALDA 3F1QA 3LM7A 4BR1A 3O63A 5AHIA 1FWNA 1FXPA 1TPWA 2LLEA 1P0KA 4FNUA 2YSWA 1A53A 3HJZA 4Y96A 3L0GA 8TIMA 3C56A 1YTEA 4FNRA 2QR6A 3GDMA 1VYPX 2V82A 3W1XA 3ZWSA 3F4WA 3LRKA 1EP3A 3TKFA 3IV3A 3TK7A 1IIHA 3IIPA 1ML1A 5FEWA 2VELA 3QW4B 4BWLA 2ISVA 3K30A 1ZY9A 3VI2A 4G1KA 2QUUA 1NF7A 3C61A 2W79A 5AHLA 5I3FA 3W7QA 1TJPA 1A5BA 3LXCA 4EF8A 4D2JA 2Y88A 2V81A 4JDBA 2RDWA 1OX4A 4MZ1A 1OK4A 3BO9A 5L9FA 2VFGA 1F74A 2Z6JA 3TV8A 1GG1A 1YXYA 2YXGA 4FX8A 3M1ZA 2V30A 3CU2A 3H53A 3LCLA 4M5PA 3LV5A 4N9EA 3L67A 1SPQA 1K8XA 1GTEA 1PV8A 5F2LA 5D04C 1O4UA 3NNTA 2R8WA 3P74A 1JCJA 2JGQA 2D73A 1X1OA 3I7RA 5HULA 5KSWA 2J9YA 3C2EA 1QNVA 1KFCA 1PCWA 3L2IA 3P7YA 3LHUA 2CLKA 2E6YA 5C2XA 4O17A 1AL7A 2Y89A 3EB2A 3B06A 2C13A 1KTBA 3KRZA 3IEBA 4UTKA 3LCXA 3STCA 1P5BA 1XL9A 1KFKA 2YFNA 4UIOA 1BWKA 1VHCA 4MYXA 3IIXA 3GDKA 2Q8LA 1B9BA 2OX1A 1T8XA 4LWWA 1TPH1 2V5BA 5HJLA 1Q3NA 4WX2A 4Q33A 5C55A 1Q45A 3LI1A 2RKXA 4ZL1A 3UWZA 1VYSX 5EYWA 3LERA 3NG3A 3G18A 2WQPA 3EX3A 2ZRXA 3ZR4A 3CEUA 1IXPA 3W7EA 4UMAA 1E51A 2V0TA 1D9EA 3O6YX 3FEMA 1VCFA 3E02A 4WOZA 5AN7A 3RLUA 3VCRA 4O53A 2VFFA 2OJPA 3R89A 2E5DA 4A2SA 1YTKA 3TQKA 2QAFA 4IJBA 3NPXA 2YCEA 2VFEA 4RXGA 1UUOA 3SIZA 1W37A 3M41A 5LSMA 1H7XA 3OHIA 4XZ9A 4R53A 1PHWA 3TXZA 1GOXA 4O1BA 3G1HA 1MEWA 2E09A 5AYZA 3QQ1A 4XQ6A 2RFGA 4Z1DA 4FIRA 4L4MA 2EF9A 1C8VA 2EAWA 3T7VA 1JCXA 1SW7A 5DELA 4LUIA 5H2ZA 2B7OA 2G5WA 1G4EA 4JS3A 3W2LA 2B7PA 3LLDA 5I3IA 4AHPA 7TIMA 4W9TA 3W23A 3LB0A 3NQDA 1G4SA 4JY8A 1OFDA 1WOBA 3KAOA 1S5TA 2ZFAA 1EIXA 2NUYA 1V5XA 4QM1A 3W1NA 1OFRA 4HNVA 5FF2A 3QZEA 3QQ0A 3V1PA 4HSOA 1HFBA 1H62A 1L9WA 3TMQA 3BV4A 5DXYA 3TSDA 3NQ7A 3DHDA 3Q2DA 1FXQA 2NX1A 3EKZA 4K36A 4DF1A 3SSJA 4IPIA 3DI1A 1GEQA 4UTIA 5AHNA 5F1VA 1W5MA 5AC8A 1S3HA 3N2XA 5LGXA 2Y70A 5C5YA 1O95A 3O1NA 1A5CA 4GUFA 4LU0A 3VFLA 2PRHA 1M5WA 3GVGA 1VHNA 2WSRA 3HGJA 1OX6A 1WBJA 2WNNA 4O10A 3RU6A 2C19A 5F4WA 2OZ0A 4C1LA 4Z0SA 3M6YA 3UWUA 3C4UA 3TQ0A 2GPTA 3W7CA 1QWGA 1S5WA 4J9JA 4LY8A 2FQIA 2QJGA 4Q32A 3BG3A 5D33A 5BOOA 2ZA3A 3CLMA 1FDJA 1A5AA 2E68A 5IBXC 3WJYA 3L21A 2ZZ5A 4LC8A 1QOQA 4FXSA 5DCEA 1Q6OA 4QIUA 3T44A 3NDOA 3QW3A 5AC7A 4CNOA 5CZ0A 3N14A 1GJPA 1RV8A 3PWAA 2QKFA 1TB3A 3NGJA 3MHFA 1I45A 4FEZA 4B5NA 4AXKA 1AW2A 1GYNA 3B8DA 5FESA 4FNQA 4LC6A 4HIBA 3W6YA 4N4QA 3M16A 4UFJA 5D09A 1DQWA 1M6JA 1TTQA 2CZ5A 1AL8A 4UUIA 3G3DA 2Z1BA 1KV5A 5ABTA 3PUOA 2TPSA 4HSNA 3NR0A 4O57A 1F76A 5TIMA 4WY0A 2HMCA 5HWMA 4E2DA 3BG9A 1ZFJA 3EXSA 2NXIA 5E0KA 2CLHA 5H91A 1GTHA 2B7NA 4PEKA 1ZJIA 4DXVA 3OVRA 3KVJA 1H61A 1OFPA 5HNRA 1AW5A 2ZRZA 1XUZA 2ZZ3A 3TDFA 2QCDB 3NPUA 1DORA 1ICPA 2NX3A 3LHTA 1RR2A 1GVSA 4O13A 4QQ3A 4AHOA 5FI8A 3S9YA 3G0SA 3WFAA 5CZTA 5D2YA 1Q6RA 2ZTJA 3KRUA 2J27A 3TSMA 1Z42A 3I68A 2CLOA 1YYAA 3HPSA 3GNDA 1LRNA 1JUKA 3BK0A 4NX5A 1TSIA 3DH7A 4Z1BA 1R2RA 2C18A 2QF7A 1PCKA 4GC4A 3H54A 3L0NA 5L6UA 3QSTA 5C54A 3UXAA 3IGSA 3S42A 1WX0A 2VFHA 4NU7A 3UNDA 1TMHA 3W88A 2ZDRA 2Q3OA 3W1QA 2V2DA 1LBMA 3NQGA 3ANYA 2VEPA 4GJ1A 3IVTA 1H7NA 3GAYA 4O18A 3FKRA 4CNNA 4LRSA 2WNZA 3IIZA 4LVBA 3TC7A 4MLRA 2CFFA 4YCOA 4LVFA 3UY8A 4AF0A 2JGYA 5KZDA 1JRCA 5F2IA 4PCFA 4M7TA 2YDAA 3INPA 3W7PA 1DHPA 4FNSA 3M0ZA 4UFKA 3WJSA 4QJ1A 2E5CA 4N6EA 2C6QA 3NQCA 4QITA 2X16A 5I3GA 4GBUA 1YDVA 4JNMA 4P2VA 1EA0A 2GVLA 3G1XA 4IXXA 5K3VA 3LRLA 4JD4A 4JICA 1JULA 2QDGA 4K39A 5DXXA 4S2BA 3L5AA 4O0ZA 3HB9A 3U6WA 1VR6A 1TPEA 3W7OA 3GDRA 2BTMA 2F7FA 3TIMA 4LS1A 3WK3A 4E2BA 1YXCA 3I65A 3SW6A 3NQ6A 3NQMA 3W83A 2ZZ4A 1YLVA 2QCGA 1JRBA 2V2HA 5HWJA 5A8GA 4EIVA 1K03A 5CSSA 1U5JA 3DFQA 4Y8FA 3F03K 3TE9A 4UTTA 2DP3A 4CQ9A 1NSJA 3HPXA 1AK5A 3JR2A 3P62A 4IOTA 3PR2A 3WK0A 4AWTA 3PY2A 4O19A 3G0XA 2ZTKA 1LRTA 2NV2A 3GLCA 1QMLA 3HGSA 5KZMA 4JTGA 4RZ6A 3E0IA 4QAIA 1X8FA 3PAJA 3BARA 4AAJA 3KX6A 5HWNA 1O60A 4FF7A 3WK2A 1KFBA 5K7JA 5A5WA 1I2NA 3MW7A 2FPYA 5CSRA 3GK0A 1TTJA 2XN1A 2DZUA 1H50A 4NNBA 3JS3A 4O12A 3W73A 4H4IA 4Y9AA 5KINA 5DY3A 4E0CA 3B04A 3FYOA 1EWEA 3FIGA 1P4CA 5AFDA 3W2NA 2ZRVA 3L5MA 3ELFA 2EPHA 2CLIA 3TC6A 1VRDA 4NT0A 1EWDA 3M44A 2YX0A 5D38A 4LUJA 1OX4B 3F4NA 3W7GA 4Z08A 2WSQA 5AHMA 2ABAA 2C3ZA 1G7UA 1LROA 4JEQA 4Z0JA 4N4PA 1M7OA 1QCWA 3UWVA 4NZJA 3MBFA 2DJXA 1P0NA 3MUXA 2GQ8A 4WXZA 2GQ9A 1X6UA 2Y7EA 1X7FA 4K7VA 3L65A 3HG5A 3SI9A 2GUUA 2DZXA 3C52A 1F6KA 3FYPA 2ISWA 2FB3A 1KM6A 2A6NA 2BZNA 3KVKA 2VKZG 1I2QA 1QR7A 3TCEA 1S5VA 2J9XA 1Y0EA 4N9DA 5D30A 3WJZA 3G1YA 1PL9A 2FPVA 3RFAA 2OT1A 4POCA 1JCLA 3M5VA 2DZWA 1DOSA 3GB6A 2CLFA 1KFLA 4ORIA 2NLIA 3OG3A 4UMBA 4XTDA 2NXHA 3BLIA 3H55A 4LS2A 1JUEA 3CWNA 2V8ZA 1OJXA 2QCNA 4GNJA 4YLWA 1WOAA 4JX4A 2B4GA 3NM3A 1QAPA 4DO6A 3S5OA 1IIGA 2DZPA 3TW7A 3IIOA 4JTJA 2ABBA 3W70A 3UZJA 1T96A 1ALDA 1YPFA 1CX9A 4JYDA 2YFOA 4UNLA 2TRSA 3LV6A 3PUDA 2OCZA 3VNDA 3BGGA 1C29A 5DBTA 4NJJA 4WZHA 3QPYA 5U4NA 3NOEA 3VKJA 1GVOA 5HINA 2NWSA 1KM1A 5BRBA 5J5DA 5LHFA 1W5PA 4LT9A 1H1YA 3BGJA 4MKNA 5I3KA 5DLCA 3W9ZA 3B05A 4A21A 3MBDA 4LTSA 5EMUA 1JCYA 2PRLA 3QM3A 3E96A 3GX9A 2P0OA 4WOQA 3W2KA 3GR7A 1O5XA 1DQXA 3PVFA 4PFMA 4DQWA 3UD6A 3RLVA 2A6LA 3IIVA 4GWEA 3GAKA 3LGEA 3P81A 3HOJA 3NPWA 3GZ3A 1J2WA 5I3JA 3STEA 4ZQRA 3HO8A 1VC4A 4WQ6A 2QCHA 2Z2UA 2NWRA 1LZOA 3KOFA 4AH7A 3MP4A 1UCWA 3HBLA 3UY7A 4ZQNA 3C2RA 3TXVA 3C2FA 1LLWA 1SUXA 1THFD 3EWUA 4TX9A 5HUPA 4NJGA 4DEFA 4NJHA 4DO5A 3T55A 4N6FA 5AOUA 4JY9A 1FDZA 3HIJA 3M5XA 3GKFA 1H7OA 4HN4A 4MY9A 5BW6A 3LRMA 2P10A 1A5SA 3TUUA 1DJQA 3TU9A 2Y6ZA 3I7SA 3M43A 4UTWC 1P1XA 3P8JA 3P5ZA 4DF0A 1W5OA 2J6XA 2E5BA 2VC6A 3OEXA 2AQWA 3FFSA 3P60A 4Y6GA 3LHYA 4ZMGA 1FWWA 3VE9A 1DBTA 1B4KA 4RX0A 3LDVA 4TMCA 3DZ1A 4IMCA 1JVNA 3W7JA 1BKSA 4FIQA 1KBJA 4KFNA 4PL2A 5U7SA 4QNWA 2ZCGA 4UCGA 2WV8A 1H5YA 4TU1A 3Q58A 3W7IA 3HMJG 2ATMA 3NO5A 2J9ZA 5T26A 4N2YA 3S1UA 5CKSA 3W2JA 1JCMP 3NQVA 2V2CA 4K6AA 3PBUA 1B3OA 3OA3A 1NFBA 5DBUA 1DVJA 3W7LA 1FCBA 4IMEA 1AG1O 1IXOA 1EX5A 1G69A 5K2ZA 5LNUA 2H90A 4O1CA 1XDMA 4NJIA 4UXDA 1L6YA 2FB2A 2WO5A 5FF4A 3R5EA 1KTCA 3P67A 4MFEA 2RDUA 1RVGA 2YW4A 2Z0IA 1H7WA 4RJEA 3SGZA 4O54A 4O4WA 3W2UA 4JYFA 1W54A 2QJHA 3PBWA 4Q4KA 3TW6A 2VEIA 3NQ8A 3EX6A 4NJKA 3W1PA 2VFIA 4E38A 1F73A 4JTIA 5K9CA 3MYPA 2C14A 4WY0B 1LCOA 1VH7A 1J5TA 5D2TA 1UASA 1SFJA 3SECA 2YGYA 3ZFHA 1KV8A 2AAMA 2I14A 3NPVA 3LCHA 1HL2A 4K8HA 3DFNA 3S0CA 5FEXA 4ZQCA 5DCBA 5SWUA 1TJRA 1W5NA 2NXGA 1GQNA 4BK9A 1LOLA 4KFPA 3S1VA 4JTFA 4ADSA 2JKAA 4NZFA 4PC8A 2BWGA 3EWZA 5AYYA 2VENA 4NXSA 4P61A 4TR9A 3PS7A 3MP3A 1SZGA 4RXFA 1KLZA 4BWLC 4U28A 4O1DA 2YYTA 3QEZA 4O16A 3THQA 3G3MA 4LW7A 1KW1A 4DPPA 1DL3A 3ABQA 1K7EA 3LTSA 2O7SA 3EX1A 4OQVA 1UB3A 1KA9F 3CPRA 4UTUA 1TV8A 1VCVA 2W6RA 3UPWA 1SFLA 2A2IA 4JTLA 3PB0A 4I7WA 3G0UA 1FWRA 3TH6A 2E6DA 2QAPA 4TIMA 2B7QA 1QFEA 3L0KA 4MPQA 3GDLA 2ZZ2A 3LHWA 1SW0A 3ABSA 3Q37A 4AF0B 1XCFA 2CWNA 2CZEA 2EHHA 5LHEA 4RLIA 1RQHA 3G1AA 1VLIA 4UNKA 3A9IA 5E93A 5BNKA 3O8AA 3BLEA 2X2GA 3LHZA 3QF0A 2VEKA 2X1TA 1XDLA 4KWWA 2A4AA 3GIYA 2O7QA 3P82A 5CPMA 4JTSA 1GWJA 1KM3A 2XFWA 3GR8A 1W1ZA 5F2MA 1DKWA 3G1SA 3DFSA 3PULA 2XN2A 4I7UA 4XTIA 4OU1A 3OVPA 4MZ8A 3W86A 4ZQPA 2I9EA 5KZEA 3SY5A 2Y63A 4AMAA 4UC5A 1EUNA 1H1ZA 2EGZA 4ZZ9A 2YPIA 4JX5A 3LXBA 3B03A 3CM4A 4I9AA 4ML9A 1LM1A 3S8HA 4PTNA 4U4MA 2ZZ6A 2H8XA 4R7JA 3CB8A 3ATYA 1WA3A 3EX4A 4A3UA 1Z41A 3BVJA 3UWYA 4CCDA 1WDWA 4IMFA 3TMLA 1TPUA 3S5ZA 2A85A 3W7DA 1H7RA 5K4ZA 5LNRA 5K9DA 3IGXA 4MLJA 3N19B 3LI0A 4R34A 1W0MA 4QISA 3NL6A 4IMDA 1IF2A 4XKYA 3C2OA 1NEYA 3O15A 3SR7A 1BTMA 3ATZA 2Q8ZA 1LOSA 4EWND 1Q6LA 1QPRA 1ZCOA 5HQEA 1LP6A 1XBVA 3M7WA 3W74A 4LRTA 3GXNA 1TTPA 1KBIA 1UUMA 3TSBA 1XFBA 2X1SA 1R2TA 1XI3A 4PL1A 1ME8A 2NX9A 4HNTA 3N3MA 3NQ2A 1TPDA 4UMCA 3EWYA 3O07A 4GUIA 5BMWA 1LOQA 1J4EA 4LNYA 2E77A 1GT8A 2E6AA 4GUJA 4KKXA 1ICQA 4WXYA 5HMSA 4CLMA 3LX9A 4BI6A 4CQ8A 1QPOA 1OVDA 3B0VC 4LS0A 1ZNNA 1XUUA 2GJLA 3KRSA 1PHQA 2FFCA 1TREA 1I8JA 1ZALA 2Y7GA 4O1AA 3O6CA 1PVNA 5G2WA 3N9RA 1ZENA 5F4XA 2A7PA 2NV1A 1FCQA 3A21A 4JR5A 1BWLA 2R94A 1JCNA 3LCWA 3W7MA 4HKPA 2P1FA 3G8RA 3T78A 5D2XA 5HUOA 1LLZA 5FEPA 1TV7A 4TMBA 1RD5A 1FWSA 3EXRA 1NF0A 2HTMA 3CIXA 1OX5A 1SU5A 2QCFA 3HG3A 3TFXA 1IGSA 2Y7FA 3A5FA 2YR1A 1FY6A 1KFEA 1NAL1 2X1UA 3TJXA 2AGKA 3SGUA 3C8FA 3WJXA 1OYBA 3I7QA 4IX0A 2YW3A 4PH6A 1F7BA 4YWIA 2A21A 3HPZA 3BG5A 3STGA 1R46A 3UPBA 1OHLA 2H8ZA 3PB2A 2QCCA 2ZZ7A 3DHFA 3EWXA 5I3HA 3QSRA 2CW6A 5F4SA 3DU0A 2ZA2A 5G2IA 1HUVA 1D3GA 2HS8A 3N9SA 4L4LA 3W7NA 1SQ7A 1SW3A 2W0UA 4IWWA 2QDHA 1K02A 2ATSA 4GXMA 1YPIA 4GUHA 3M5YA 4AB4A 3DGRA 4X2RA 4GFSA 1YDOA 1N7KA 1UBSA 3T40A 6TIMA 4FXRA 5FF0A 3GKAA 2QEZA 5EBUA 2G97A 1SO3A 1ZAHA 3C3NA 2C0AA 3KVMA 4IXHA 3T4CA 1SO4A 1K7FA 2E1DA 4LV9A 1EP2A 1RPXA 4ORMA 3O6DA 1OFAA 2YZRA 3MWAA 4ZQOA 1OFBA 3W22A 1SZEA 2KZHA 3DKLA 3W1UA 3MYOA 4RR4A 4XBKA 1KTNA 5CGQA 2DZTA 1FUYA 1N55A 4LV4A 3STFA 1QPNA 3EX2A 3P8IA 2X30A 4H6KA 1H63A 1WYIA 3CQ0A 1WV2A 4WD0A 2Y62A 5J5RA 3R12A 4O14A 5HR7A 1TPFA 1LORA 2ZQ0A 3DENA 4MIMA 4UTLA 4Z1AA 4ICNA 2PURA 1SSGA 3O06A 4IGHA 3U2OA 3FKKA 5LGZA 3MHGA 5CPLA 2WKJA 4IMGA 4QNEA 3MHUA 4DO4A 3G1DA 3W2MA 4NX0A 3HGRA 3HGOA 5DCDA 2FIQA 3W1AA 3PBYA 3C2VA 3NL2A 2A7NA 1HO1A 3MJYA 3RF9A 4K38A 4NVTA 2QUVA 4AVFA 3EKLA 5IBXA 3A23A 1VJIA 3W1LA 1EB3A 2F84A 1M7PA 4NNAA 1H51A 1VQTA 3TNOA 3L9CA 4BI5A 3E9AA 1GVRA 2QCMA 2GJNA 3QH2A 4CNPA 3CWOX 1MEIA 3NM1A 3QMSA 2A7RA 5HR6A 2NUXA 3PBVA 3M9YA 3P61A 5LZLA 3NL3A 1KLYA 1VZWA 2Y85A 2HSAA 3LOTA 3NL5A 3C6CA 1QO2A 4ADUA 3G22A 2Z6IA 4IUOA 2J24A 2YYUA 1VS1A 5LKYA 3UYCA 5F2GA 4OHQA 4C1KA 3QC3A 5CZSA 4UR7A 1F6PA 3G24A 1K8YA 3DBPA 4JTTA 2GQAA 3S5YA 1YDNA 2PE4A 3DFTA 1OF8A 2BX7A 3SZ8A 3I6RA 3PC0A 2DZVA 1JQXA 3CEPA 4HNNA 3CTLA 1LBFA 1FX6A 3DFOA 2CLLA 4MOZA 2ZZ1A 3AJXA 3B0PA 4S1FA 2A0NA 3VE7A 3AO0A 3NAVA 4JTUA 1VLWA 1R30A 1OFQA 3ABOA 3GXTA 4MZYA 2J88A 3N34A 2VFDA 4OBTA 1TPVA 2FLIA 4JX6A 1L6WA 5MHBA 2CZDA 1KM4A 4K8EA 4H3DA 4CCCA 4M19A 1V7YA 1XKYA 1F2JA 4JIPA 4MY1A 3OIXA 2TMDA 4Z1CA 3W72A 4M6QA 1LTDA 3W85A 4UR8A 1OG0A 4JTEA 5D05A 3G1FA 4MYAA 3TROA 4FX7A 4UTTC 2B0MA 4HNUA 3FS2A 2WSYA 2BXVA 3QJAA 4JXCA 3DAQA 5GVJA 4MFDA 3NEVA 3BPWA 1G4TA 2PRMA 3U8GA 1XM3A 1ME7A 4JYEA 3ABRA 2Y7DA 2DORA 1G6CA 2PC4A 3BW4A 4OV9A 5EY5A 3IVSA 4XUGA 2Y61A 4XWUA 2ZRUA 5D37A 3TQVA 4BFAA 5C6MA 4O11A 4CCEA 3O05A 1SZFA 3USBA 3CIWA 1HG3A 2BSLA 4DBEA 2A1YA 4PODA 1QDSA 5DN1A 2ZYFA 4MVAA 1QO5A 4GE8A 1XBZA 4O52A 1VCGA 4JN6A 2GVJA 5G1YA 3TR2A 3TFCA 1MXSA 4X3ZA 1GYLA 3EEGA 3NQFA 4GRSA 1X1ZA 1MEHA 1JR1A 3R8RA 2ZBTA 1R47A 4X22A 5AHEA 1ONRA 1PIIA 1MZHA 1H7PA 4O8RA 5AHFA 1LDCA 4IQLA 4UFIA 3O16A 3NZ1A 2C1HA 1Z44A 4AHQA 3KHJA 5CPNA 3ZWTA 1K3UA 5FF3A 6ALDA 3LBCA 3W87A 2ALDA 3CC1A 2NUWA 1FCUA 4FNPA 3EWBX 1TRDA 5D03A 4I7VA 3IGUA 4NQ1A 2JKEA 3QMRA 4OGZA 1R2SA 3UWWA 3S6DA 1G4PA 1UJPA 4EOUA 3ZS4A 1OYCA 4MJZA 3RMJA 4LVGA 1K8ZA 4JTHA 2E6FA 3PSWA 4AWUA 5LNSA 1EEPA 3MI6A 4ONVA 1ZAIA 3W7KA 4HPXA 1JQVA 3CHVA 5G4EA 3BW3A 2GOUA 1XXXA 2JK2A 1FQ0A 1N8FA 1ZAJA 4UFMA 1KM0A 3L66A 1TV5A 1CI1A 2VEMA 3GNNA 4PA8A 1O5KA 1DV7A 1SO5A 1W3NA 4OV4A 5G2HA 3W07A 2WPBA 3W1MA 5K9XA 4RV8A 3NYZA 3THAA 4CQAA 3JRKA 1FCVA 1TPC1 5EA9A 3WK1A 3QYQA 3PM6A 4EF9A 4WJEA 5BMXA 2V9DA 1I2PA 1TPB1 1ICSA 4NUWA
chains in the Genus database with same CATH superfamily
4KRZA 2ZE0A 4DX3A 4BCEA 3PF3A 3D5HA 2DT1A 3NSMA 2FDSA 3OO2A 5A6KA 3MP5A 1C92A 1ZJAA 2X1RA 1FP9A 1W1YA 1FA2A 1AZ1A 5D02A 1OFEA 3L4YA 5DY2A 1E3ZA 3P80A 3LMYA 3U4FA 4DLMA 4C7GA 2VI0A 4YYCA 1YADA 3BXWA 1QPQA 3G6LA 3PG9A 5FL0A 1B4EA 4YMZA 3LBMA 1XIJA 5G5IA 3ME3A 1T99A 1XBYA 4A8IA 3SJ3A 3L2LA 3QMTA 3V7PA 1GPWA 2OO6A 3DFPA 1LYXA 2H3BA 4UQAA 3BMVA 1HO4A 1MDRA 5A6AA 1UG6A 3W7RA 4FNTA 1EP1A 4GXPA 3AS3A 1D3HA 1P0BA 1HKVA 1NWSA 3REQA 3LPPA 4NHVA 4EVZA 4IHCA 4NXKA 4S3CA 4HPJA 1W3IA 2XSXA 1XH1A 3WCZA 3KVLA 3A24A 1I2RA 3RYSA 1PS9A 1UKSA 4X9SA 4EAYA 1CGWA 3HA1A 3N2OA 4QLLA 1ZP4A 4K7YA 2UV8G 1GG0A 4DBDA 1FWBC 1GQJA 3CAWA 3WNLA 5DRIA 1XICA 2NVDA 5I07A 5D9NA 3O3RA 3TONA 3UWEA 1K7XA 2D24A 3LCGA 2DGAA 4NYYA 2OLSA 1H1NA 2IKHA 4NSBA 1EXBA 3LQGA 3HG2A 3OVQA 2OQLA 2WW5A 4D8LA 3PG8A 1FHVA 1IE7C 5D32A 4ATWA 1TUFA 2G95A 4OWGA 5CQ1A 1O12A 3VIHA 4NAFB 1MWOA 1QWKA 3PUEA 1IEIA 5HK4A 1FBAA 2R14A 2OT0A 4KWVA 3KCOA 4GZEA 1A3HA 3TTYA 5I02A 1VYRA 3WBXA 3KBMA 3C2YA 3TX9A 3AXIA 5HATA 2O9RA 3PJXA 4Q6JA 2FGLA 4FO4A 1PZ0A 4ACYA 1TIMA 1S3TC 4MUPA 3IRDA 3TAKA 2QUTA 1ADSA 3MQTA 3KWSA 3NVTA 2V5CA 2QCDA 3IVUA 1XLFA 4B5VA 1O7AA 3LMZA 5F1UA 5CBJA 4M6VA 4J1OA 3KWXA 1Q7ZA 1Z48A 2H3DA 3MCMA 4HYRA 2ESCA 4L9ZA 2WZEA 4J3WA 3W37A 2XVGA 2ZA1A 3UXKA 2CWXA 1Q8JA 2NV9A 1FWFC 3D47A 5I23A 1UZDA 2TSYA 2WSKA 3D46A 3Q45A 1EL3A 1NFPA 2Q3RA 1FKWA 4ZQMA 5D2VA 3D0CA 1MQRA 3DYPA 4NKCA 3EA3A 1E0TA 3WZ0E 3IUIA 3GC2A 1KFJA 1BEUA 3OG2A 1C9DA 3PP7A 1ESWA 4RCXA 1JL8A 3NDYA 2BY3A 2X0HA 1B57A 1N2VA 4NAEB 1RQBA 3WNOA 3SJNA 3FJLA 2HCVA 3SN4A 2X2YA 3S1XA 2WB5A 4MB4A 3W84A 4PYSA 3GXPA 1TX2A 3LCIA 3ZSSA 3FAWA 3HF3A 1Q7QA 3GDTA 4HPGA 1W3TA 3GTHA 3FNDA 3VMNA 3IK4A 3GG0A 1EHNA 3SUWA 1UHVA 5AYBA 2X0YA 3SFKA 3P2VA 2I57A 5M03A 2QLYA 1F9CA 3NQEA 2WKLA 3KFTA 5FOOA 3LLFA 3WJWA 1BSLA 1VEPA 1EXPA 4CD4A 3VILA 3N73A 3PHAA 4PRRA 2PGFA 5JIWA 3BSGA 1U5HA 2WM1A 3UJFA 4X61A 2WJZA 3R13A 1W9BM 4C1NB 1BXNA 4PBFA 2XIJA 3VA8A 1DE6A 3WELA 5AHIA 1A80A 1GKPA 3AIUA 1XIGA 2VMFA 2LLEA 2Y8KA 4FNUA 2YSWA 4LANA 5XIAA 1EOMA 4AZCA 1F6YA 4DYEA 1YPXA 4JFSA 4Y96A 3L0GA 3C56A 2QR6A 2G0WA 4MWAA 1T41A 3IV3A 5REQA 3IIPA 2F6UA 4BWLA 1MW0A 1J79A 4IFRA 2ISVA 4WKAA 3T4WA 4P8UA 2QUUA 5AHLA 3O6AA 5XIMA 3BLPX 2XPKA 1NDWA 1OX4A 4MNLA 5CJNA 2IQ0A 1JNEA 4JTQA 1OK4A 1HX0A 3BO9A 2Z6JA 3TV8A 5AVHA 4CU8A 1Q2SA 4FX8A 2V30A 2VDIA 2EQDA 1ITQA 4I9JA 3LCLA 3LV5A 2EKGA 5F2LA 2JGQA 2PD9A 1Q5MA 5HULA 3BDKA 1KC7A 1XIEA 1VFFA 1QNVA 2KAUC 1KFCA 2BV9A 5DX7A 2Z26A 3L2IA 1Z6KA 3PZGA 4B3KA 3P7YA 4PUKA 1R87A 4IGSA 3CAVA 4H6EA 3EB2A 2QGYA 3PZTA 4BQ4A 1YW1A 3KRZA 3IEBA 3GRIA 3SCVA 2GVEA 1W17A 1LT7A 3VNJA 1VHCA 1QHPA 4JCMA 4MSSA 2Q8LA 1B9BA 5E0CA 1XC6A 1T8XA 3KL0A 1TPH1 4GKLA 4Q33A 4C6MA 4S3EA 1Y65A 3CHFA 4ZL1A 3UWZA 4DNMA 4O1EA 3WH7A 4LAOA 1F4AA 4NZ3A 3ZR4A 1HKWA 4KCUA 5CGTA 3NOYA 3CEUA 4ZB0A 2OFJA 4K1WA 5AY7A 1JXJA 3BSMA 2VQTA 1DWAM 2PC8A 3DECA 2Y1HA 4ICMA 3RLUA 4GGHA 2OJPA 4J3TA 2E5DA 2HK0A 3RJYA 1J0KA 3TQKA 3G2GA 2YCEA 1GUVA 4F0LA 1BG4A 1H7XA 4ZEPA 4AZ6A 4O1BA 2DT3A 3G1HA 5BRQA 1MEWA 3T2QA 2PBOA 2PDGA 2DSWA 4ZE5A 4AX7A 3R25A 1RH9A 4IPLA 1ZBCA 5CC3A 1PIGA 2EF9A 1SW7A 2Z1XA 4Q7IA 1HJSA 2OLHA 2G5WA 2AAAA 5LA1A 4P5UA 3CYJA 1BGAA 7TIMA 3LB0A 3QR3A 4S39A 1WOBA 2IPGA 2PDFA 2ZFAA 2V68A 1EIXA 2NUYA 2VZTA 4QM1A 3TR9A 1OFRA 4HNVA 4IIBA 1XYCA 2HXTA 3DX5A 1JFXA 2XSAA 1EZ2A 1H62A 1L9WA 2XYLA 5DXYA 3TSDA 3NQ7A 1W8GA 4DJEA 3N29A 4G6CA 2QF8A 4FK9A 4K36A 3TTSA 3SSJA 1GOKA 2DSVA 1KCKA 3CTTA 2PSNA 1TV3A 1S3HA 3N2XA 3SUSA 3GHSA 3H2FA 4LU0A 1ZSXA 3GVGA 1NH6A 1OX6A 3AWNA 1PJ9A 4O10A 5AECA 3KDNA 4H9TA 4K68A 3TQ0A 1QWGA 1QVBA 1S5WA 4J9JA 2PU0A 2QJGA 3GHUA 3RX4A 1UWAA 5I24A 2E68A 4DWSD 2VOTA 1AJZA 4JOMA 4LC8A 1B3VA 1HP4A 5DCEA 2AOSA 4LALA 4Y9PA 5AC7A 2WSPA 3U5YA 1GW1A 3E0LA 5CZ0A 1RV8A 3IRSA 3PWAA 3UR8A 3TYEA 2Q01A 1VFMA 4XIMA 3GM8A 4CNTA 4B5NA 5EMMA 3B8DA 3VZZA 2FZBA 2HQAA 3WMCA 1DIKA 4LC6A 4HIBA 4DAFA 4H9YA 3M16A 4UFJA 7PTDA 1A0EA 3WDPP 3KDOA 5ABEA 3GDBA 1U1HA 2VUYA 2Z1BA 4JTRA 1BFNA 3Q4DA 3CV6A 4AZ7A 2OYLA 2IXUA 2OSYA 2ASHA 4WY0A 5HWMA 4E2DA 1CGUA 3HPAA 3R8GA 3EXSA 3RLHA 2F38A 3ZYZA 2NXIA 1GTHA 5HNUA 3MU7A 3ZJKA 4NG3A 1ZJIA 1E4NA 3OVRA 1JZ2A 3U7BA 2DH3A 1AW5A 3RUBL 4B92A 2ZRZA 1PBGA 3CT2A 1XUZA 3WQEA 2E1WA 2NX3A 3LHTA 1OQFA 4GVIA 4AHOA 1U33A 3S9YA 5XINA 3WFAA 1LUCB 5D2YA 2NLYA 3WNMA 4GABA 1Z42A 2WMHA 4ECLA 3OLEA 1E6QM 3GNDA 1LRNA 4TOQA 1Y5WA 3BK0A 7ENLA 1TSIA 3DH7A 3JZEA 4ATLA 3PPCA 1HGWA 2CXEA 1A0CA 2D2GA 1C91A 3L0NA 3V36A 3S42A 4DO7A 3WBWA 1WX0A 3OZOA 5E0FA 3A6OA 2OWCA 1QBAA 1VBGA 1XX1A 2V2DA 3NQGA 2VJXA 3IVTA 4ML4A 4PCSA 2Y24A 3CUXA 3I10A 4CNNA 3TC7A 2WNZA 2CFFA 2XIOA 3NURA 4NZ4A 3RG6A 4ZFCA 4Q7NA 3INPA 4FNSA 4N6EA 3KTXA 3PZIA 3L2MA 3NQCA 3CL7A 3PPFA 3GU9A 3KOWA 5CZKA 4QITA 4REQA 4JNMA 4P2VA 2BOFX 4IXXA 4G2DA 3TJIA 5IFPA 5DXXA 2D0GA 1DXEA 4DRSA 1XHGA 6ENLA 1TPEA 3SDOA 4ICCX 2IUZA 3ARSA 4WIWA 3W83A 4MJ2A 4FLSA 3SB0A 1K03A 1U5JA 5EMJA 2ZUWA 4GQQA 2QIWA 3F03K 2BFGA 2GL5A 3OGRA 1U2YA 1DJIA 4CQ9A 1B5TA 3PR2A 3ONCA 3G0XA 4V15A 2INEA 3ENLA 1EJSC 1QMLA 5KZMA 4JTGA 3GNXA 2YL6A 1X8FA 5HNNA 3N4EA 1GORA 3TOPA 1O60A 5CPSA 1I2NA 1S46A 2GGJA 3MW7A 3GK0A 2DZUA 1AJ2A 1QK0A 4QROA 3W26A 4OKDA 4D6CA 4O12A 4ZGYA 1IWPA 1ZUAX 3CH0A 4F2BA 4E0CA 4HK7A 1EWEA 1H49A 1ODZA 2CBIA 3FIGA 4IQEA 2ZRVA 3L5MA 3TC6A 4NT0A 1EWDA 2J7CA 3M44A 4NRRA 4H83A 2YX0A 1V6UA 4Z08A 5AHMA 1V3LA 2C3ZA 4E8DA 1NOFA 1ZBKA 5D9OA 1PX8A 4H8HA 2V69A 4CKQA 4NZJA 1DJWA 4W5ZA 1M9HA 4WXZA 3QV9A 1GYMA 3ZLHA 4L6DA 2GQ9A 3IWPA 4GIAA 2Y7EA 1F3EA 4MDOA 2PZNA 4UQCA 2GWGA 5MF5A 2RDXA 1TE1A 2P5NA 3RITA 1V6XA 3C52A 3FYPA 1XLAA 3C86A 3GH7A 4H9UA 1XG4A 4WSJA 3T1GA 3JVAA 2ISWA 2FB3A 3VNKA 2A6NA 2PGWA 2VR5A 5I03A 1KR0A 4H19A 3MUCA 4A3HA 4S3FA 4MMWA 3ALGA 3CAQA 1H0IA 4ZSTA 3G1YA 2FPVA 1F8IA 3A4WA 3AU6A 2XH7A 3CAKA 3W27A 3FY1A 2WJEA 2CLFA 1Q6DA 3OG3A 2NXHA 3H55A 5JBEA 3MZNA 3CWNA 2V8ZA 1OJXA 4Z1YA 3WLKX 2W63A 1MXDA 2B4GA 4LYPA 4H9ZA 4DO6A 3ERPA 1IIGA 4OFCA 1VIZA 3KP1A 2ABBA 4HK6A 3W70A 1Q7MA 3G1RA 1ALDA 1FFQA 1VFLA 5BXRA 2TRSA 3PUDA 3VNDA 4PSRA 1C29A 2DW6A 2NQHA 1W1VA 4WZHA 1X38A 3CZEA 1Q8AA 5HINA 5BRBA 1KM1A 4PB3A 1W5PA 1H1YA 3BGJA 3TWAA 5DLCA 3RM8A 4XZHA 2PRLA 1RSCA 2PWEA 2J7FA 4W89A 1IR1A 4H41A 3H22A 2A6LA 4RDWA 1KBKA 2FVLA 3POHA 4PR4A 4QDPA 3GAKA 3W01A 3B9AA 3P81A 3UA3A 4L1WA 2ZKMX 3W00A 1VC4A 4WQ6A 3GO2A 2QCHA 3MP4A 1VIWA 3HBLA 3WUGA 1DHKA 3TXVA 3T8LA 4QEHA 3EWUA 4NJGA 2G3IA 4N6FA 3T55A 3MSYA 4JY9A 1CYGA 3GKFA 4HN4A 1XRTA 1JI1A 3LRMA 2P10A 3AXXA 3K8LA 3I7SA 4UTWC 1GKRA 4HNCA 1LQ0A 1R86A 3I4EA 2CHOA 2DZAA 3BCDA 3AI0A 1W5OA 2E5BA 3WDIA 3GTXA 2OB3A 3OQ8A 1C8QA 1H3GA 2YLLA 4XAFA 1CXFA 4JFWA 4ZMGA 4RX0A 4XO7A 3JU2A 4HSHA 1JGIA 3LDVA 3DZ1A 1HW6A 2EO7A 5E6YA 1KBJA 4KFNA 3GG7A 1BGGA 4F2UA 1H5YA 1OADA 3W7IA 4EKJA 1TJ1A 2ATMA 3FHQA 3NO5A 5T26A 3SN0A 3LSCA 2V2CA 4K6AA 1EGVA 3S6OA 1Z7AA 4QLKA 1FH8A 1AG1O 2YCKX 1E6ZA 1V6WA 1XDMA 4MJ4A 4NJIA 1J9YA 1DEDA 2GYIA 4C7DA 3KBJA 1TWIA 4D6IA 4MFEA 5B7YA 4RJEA 4F4RA 1U1JA 4O4WA 3W2UA 4JYFA 4Q4KA 3SCSA 3WQVA 2G3MA 5FJRA 1WDSA 1VPQA 4C6IA 4JTIA 5K9CA 3EOOA 4FALA 1E9LA 1J5TA 1R9YA 5FJJA 4C6EA 3ZFHA 1KV8A 2RGMA 2I14A 3ARRA 1HL2A 4K8HA 3LYEA 1SJBA 3ITXA 5SWUA 2NXGA 1GQNA 3F2BA 3PJUA 4BEUA 2OEMA 2E7FA 4PC8A 4M24A 2VENA 3WQPA 1OG6A 3CMFA 5LA2A 3V5FA 3WF1A 3T0AA 1R85A 1VEOA 2YCIX 1WZMA 2OWXA 1UWTA 5LIUX 1RXOB 4ZENA 2XGZA 4IPPA 4HMCA 4HVXA 1ZGDA 3QKZA 4DPPA 1K7EA 5A2CA 3P14A 3AC0A 1UB3A 3WUEA 4QG9A 4UTUA 1B3YA 1TV8A 3UPWA 2A2IA 4V1YA 5I09A 3DG6A 3PB0A 3G0UA 1FWRA 3K1GA 2PP3A 5I2UA 2CETA 3TYAA 5MKGA 4JPGA 3WUBA 4CD5A 4PUWA 3ABSA 3Q37A 4AF0B 4ZXLA 3AICA 3RCYA 1R5YA 4EPEC 4LAKA 2EHHA 3B9EA 1RQHA 3G1AA 3A9IA 4HA4A 3TN4A 2AL2B 4KWOA 4BQ3A 3O8AA 2XJ7A 3N13A 4JTDA 1XDLA 2VR2A 2O7QA 4H6QA 5CPMA 1GWJA 1KM3A 2XFWA 3E2VA 2DV0A 5F2MA 1AFSA 1DKWA 2QHAA 1A3XA 3G1SA 3DFSA 2AKZA 3RCMA 4ERIA 4JNYA 4XTIA 4HOWA 4MZ8A 1X6NA 4ZQPA 5BXPA 1M04A 3T0TA 1H4PA 2QNEA 4UC5A 4GYPA 1UA7A 3STPA 3UYIA 3LXBA 4RDVA 3VOHA 1RLDA 5TAOA 4AIBA 4Q3MA 4PTNA 4BF5A 4D8ZA 3IUDA 1H11A 3RCNA 1NARA 3F2CA 4J2PA 4HN8A 1PZ1A 2WHMA 3CB8A 3QZAA 3ATYA 1E56A 1WA3A 1YBQB 3N11A 4A3UA 1DTUA 3LPFA 3UWYA 3TMLA 1TPUA 3MCNA 2F2KA 3OGSA 5LNRA 5K9DA 5BU9A 3LI0A 1RP9A 4R34A 1W0MA 3VIGA 4QISA 1EBHA 3PJWA 1E6RA 3MKCA 4YHGA 1NEYA 3LUTA 2OPJA 3DC0A 3UG5A 1LOSA 3MDWA 1C7SA 3U0HA 2PDKA 4AU0A 3GE7A 1ZCOA 1BYBA 2FGZA 1CTNA 1TTPA 1C90A 2AMGA 2BBFA 2AL2A 2P8BA 2X1SA 4PL1A 1E15A 4GVHA 1WDRA 3EWYA 3GR4A 3R0DA 1Z3NA 3GXIA 3IJ9A 1UR3M 3L4XA 4BI6A 3PJTA 4R7WA 4PUUA 1OVDA 3KRSA 1RD6A 1TREA 5CC7A 1ZALA 1AH4A 2PD5A 2Y7GA 3O6CA 4LFYA 4S3AA 5FJPA 4F2TA 1BYCA 3N9RA 3UVAA 3THCA 2JF6A 1D7FA 4XD5A 2XHYA 5FKYA 4C6QA 2P1FA 3VX1A 4C6CA 1CLVA 1LLZA 1E5NA 3EXRA 3SCTA 3VCNA 1W9UA 1OX5A 3HG3A 3TFXA 2WMJA 1J0IA 2ZE3A 2YR1A 5C9XA 1KFEA 2V5JA 2P8CA 3B9OA 3T07A 1JDAA 3TYBA 2WZMA 2YA2A 3WLIA 4J28A 1M01A 3L7RA 3HPZA 1XR2A 4CQCA 1FWIC 1R46A 4GY1A 3UPBA 2J8TA 2H8ZA 2QCCA 1O1ZA 1Y5VA 4AZGA 4QGCA 2CW6A 3DU0A 1HJWA 5C7HA 1HUVA 3GTIA 1SW3A 2W0UA 2Z2AA 4IWWA 1A5LC 2OO0A 4LUTA 1K02A 2REQA 1YPIA 4GUHA 3M5YA 3K46A 5H6HA 3S47A 1MW1A 3R43A 6TIMA 2J4GA 2GJXA 1HXJA 3M0HA 3Q65A 2XM2A 3WMSA 1OSEA 1SO4A 2ONEA 2QJJA 5HOSA 2W62A 3WENA 1RA0A 1I0BA 1XLHA 3MWAA 4DWDA 5JH1A 3FDGA 4P7RA 3WX7A 3TN5A 4Y9NA 1SZEA 3W1UA 3GIQA 4S3DA 4UZSA 1KTNA 1YNPA 1V6VA 4GVGA 3M4HA 4GH1A 3PFRA 5HR7A 9CGTA 2ZQ0A 4MIMA 4UTLA 1UD6A 2G3JA 2J7EA 1P6WA 2Z1SA 1SSGA 3O06A 4WRHA 4DZHA 3MHGA 2ZUMA 4KH2A 2ANUA 1B30A 1RCOB 1RBOB 4U3AA 2J75A 1YX1A 3MHUA 3CQKA 3SCWA 3HGRA 3RJXA 2FIQA 2YXXA 1GOMA 3K4DA 3S9ZA 1TV4A 2G8ZA 5IBXA 4NNAA 1VQTA 3E9AA 4C6NA 1XS2A 2HE5A 3ABZA 4Y2WA 3QH2A 4FXJA 3QMSA 4C6KA 2A7RA 2YDSA 4R3UA 3NL3A 1A5KC 4HMNA 1QO2A 2J24A 3KP0A 4N7QA 5F2GA 1FWHC 1E4MM 5CZSA 5M2FX 3H2EA 3ZZ1A 1K8YA 3DBPA 2V5DA 4JTTA 3VGHA 1YDNA 2NT1A 2PE4A 3DFTA 1OF8A 1UH2A 1B1YA 1TX0A 3GFZA 1XQKA 4F9DA 4E3TA 1JQXA 4HNNA 3ARWA 3DFOA 1PZ3A 2PGEA 4CU7A 2ZZ1A 3SBFA 1W9XA 1QNSA 3QR1A 3AO0A 3NAVA 1VLWA 1Q65A 3ABOA 4QG8A 3AIQA 2ICSA 4OBTA 1REQA 2CZDA 4PMQA 4UTFA 4CCCA 3ZR6A 3VNMA 1XKYA 1F2JA 1RA5A 4JIPA 3VXGA 3W72A 1WCGA 3AIBA 4JTEA 4QDMA 3OHMB 4UTTC 1OD8A 2B0MA 3FS2A 4JXCA 3DAQA 2FHFA 2Y5SA 2PRMA 4H7CA 2ZWYA 3GC4A 2HRWA 4FOUA 1W3KA 3MKVA 3VYLA 2ZRUA 3CPGA 1AD1A 3TQVA 5A8OA 2ZYFA 3VGEA 4O52A 1RCXB 1LWHA 3QV8A 3ICJA 3TFCA 1MXSA 4ZE4A 3ITCA 2XIQA 3DOPA 1X1ZA 3U48A 1MEHA 1JR1A 3L23A 3R8RA 2QULA 2FH8A 5AHEA 1QNPA 4YTTA 1PIIA 3ISIX 1H7PA 3MUY1 4UFIA 3O16A 4NI3A 2C1HA 1Z44A 3KHJA 4B5XA 3WQ6A 2RUSA 4RE0A 1TVPA 5FF3A 6ALDA 4U10A 4GBDA 2NUWA 1FCUA 3EWBX 4RNJA 5GPRA 2OWWA 4YNGA 3V16A 1E1CA 2OZTA 1GZ1A 2JKEA 5A6BA 4OGZA 3LZ3A 3S6DA 3VIOA 1UJPA 2R1NA 4A4AA 1OYCA 1POJA 4CEXC 2E6FA 1TZZA 1U5VA 1HL9A 4A3QA 3UR7A 5M5DA 3CHVA 4C5ZA 2JK2A 1KM0A 1TV5A 3GNNA 1CI1A 1SO5A 3W4RA 5G2HA 4Q22A 3UESA 3W1MA 5K9XA 3MV01 3ECQA 3THAA 1F3TA 3UFYA 4MWAC 2WK2A 4UCFA 1E6SM 5EA9A 1E5JA 3PM6A 2C91A 1ZJBA 1H0GA 4AD2A 1TPB1 2QPUA 4EWJA 2D0HA 1UKQA 5EL1A 4IPJA 1QT1A 4WHBA 5KMYA 5ABHA 2YB4A 2AQOA 5E1QA 3K1DA 1DP0A 4LCQA 5BRPA 5AYXA 4WEVX 2JKPA 4S2CA 3P84A 3NDZA 4ZODA 4A2RA 3MUAA 2NZLA 2VQUA 1MW3A 1DJYA 3HU7A 3I4KA 1NIUA 1EHAA 5T8GA 1PB0A 2BS9A 2OODA 2VOMA 5GNXA 3P93A 4N42A 2RH9A 3PAOA 3TTQA 4I5UA 4JTKA 3UETA 2FH6A 1NVMA 1JYVA 3U2EA 5KTLA 2Q09A 2VCBA 3N6JA 3RNDA 1TELA 2RJHA 2PWVA 2E25A 1B3ZA 2OELA 2EKCA 2VDHA 3W6MA 3H2CA 4KQNA 4CEUC 4B90A 1TO3A 3S1WA 5HAOA 1Q4NX 4PMDA 5I78A 3PZUA 2YL9A 3NQAA 3VIIA 1PKLA 3W25A 2GK1A 1JYWA 5AC6A 5G1TA 1U1UA 4GQ0A 5A8MA 2PZ0A 5TF0A 4CN1A 3VC6A 1JZ5A 3E12A 3QTPA 4JQ1A 4LX4A 3UEQA 4ACZB 1JGMA 4MB1A 3NIYA 3E5BA 1OCNA 3LHVA 4F0SA 1GVFA 8CGTA 2G96A 5LNVA 4LQ1A 4O0KA 4UZUA 4DUOA 3POCA 2ZRWA 1V51A 4A22A 2ZRYA 1OFOA 2UWFA 2ACUA 1YXDA 3LNPA 3CPUA 4GG9A 4XIAA 1Z9AA 4FF5A 2GJPA 3W29A 1FWDC 3M07A 1BLIA 3NJ3A 1E0XA 3LCFA 4N02A 1U83A 3A3XA 1EYEA 4D9PA 3ZVIA 4GUGA 2C1GA 3TAOA 1RAKA 3CNYA 1EPXA 2OGJA 4BI7A 4O15A 1OK6A 3GFYA 1QBBA 3FA5A 3MI3A 3ITTA 1O94A 3IANA 4N9CA 1W56A 1EF2A 4PCNA 3W71A 1OABA 1QOPA 3OA5A 4WJXA 4DJEC 3A22A 4ROQA 4R33A 3G1VA 4ROPA 1MO0A 4PB4A 2RDTA 2QJIA 1XF0A 1H60A 4DY1A 3MDUA 5G1MA 2GDVA 4DELA 3AIWA 4JIQA 4ZOBA 4A29A 3RXZA 4MY8A 5HQMA 3UG4A 1KM2A 2Q6ZA 4WUIA 1I2OA 2D22A 1ZHAA 1JDEA 4ZVJA 4ADTA 3WEOA 4AWSA 4US5A 3WF0A 1AW1A 3BMWA 3IAPA 1P6CA 1TA3B 2P0IA 4HHPA 3CZ8A 4ZXOA 1GVQA 2FPTA 4GH3A 1WBHA 3BURA 2ZX8A 2FZMA 3RPMA 3SQLA 3WBAA 1VPXA 5DQPA 3WLPA 1A5UA 1UR8A 4QFUA 1XSIA 1WAUA 3KBVA 1I4NA 5EKYA 1V3HA 2HVNA 1KGWA 4DPQA 1YTDA 1MI3A 1TYGA 1L2UA 4C6DA 1Z8AA 3L12A 1JUBA 4M6PA 3UWQA 4F66A 2PTXA 4P8WA 1UH3A 4JQ3A 4FX6M 3UQNA 4MJMA 1QI5A 1N8WA 3ARZA 3VOJA 5JXQA 1SJCA 1B31A 1BF6A 1OYAA 1KBBA 5A8QA 4KRUA 3B8IA 3BC9A 2DQXA 1XLEA 2DU2A 2PP0A 4HZ6A 4LOCA 1TWWA 4GNKB 4IFOA 3W75A 3PSVA 1V8EA 3VFCA 1TQXA 4JQAA 1RQEA 3T05A 1V3KA 3W76A 1JNDA 3MO7A 4EE9A 2A3LA 1UBPC 1KGUA 1CXHA 1CGYA 1MSSA 1IXQA 1HIZA 4I9TA 4O4VA 3OBKA 1VD6A 3UU0A 1PYMA 1TA3A 3M64A 1KBLA 2VHLA 5CAKA 3SCRA 4QQUA 5FEZA 3W82A 3QV7A 3URNA 3APYA 1JPHA 4ALDA 4GPNA 2XIBA 3O63A 1FWNA 1TPWA 4Y7EA 1NP2A 4KMQA 3T0CA 1V0LA 3WH9A 8TIMA 4FNRA 4O8AA 3BAWA 3LRKA 3TKFA 1GKQA 3QKEA 5FEWA 3QW4B 3IS4A 3K30A 4AMCA 1HGYA 4HTYA 4WKHA 3E38A 2W79A 3V5CA 4M29A 3W7QA 1TJPA 2D20A 2V81A 2PDWA 1JPMA 2RDWA 1R3QA 1RLCL 1XCXA 4XX6A 2ALRA 1R3RA 4QE4A 3PFMA 1GTEA 1WP6A 5D04C 4XVDA 4H9MA 2D73A 5KSWA 4H01A 3ZT7A 4C6BA 3EPNA 3GD6A 2E6YA 1EH9A 1HKKA 3E1F1 3XINA 2GSHA 1CXEA 1R6WA 3LCXA 1Q6FA 1CLXA 1XL9A 1KFKA 5JU6A 4CN4A 5JBFA 1J12A 1BWKA 3EDDA 2ZXDA 3IIXA 3KOZA 1XYFA 4LWWA 3EWDA 2V5BA 3A4JA 1BVNP 3GH5A 2V3DA 1Q3NA 4V2XA 5C55A 2RKXA 1KWKA 4LCRA 4L1XA 1VYSX 4IH3A 3C0QA 4AVOA 3G18A 5EMLA 3CMGA 3OBAA 3EX3A 1DIEA 4IQJA 2ZRXA 3UCDA 1IXPA 3N1AA 4AC7C 4UMAA 1IGWA 3BLLA 1D9EA 3O6YX 1J5SA 3ZQ9A 4JL2A 3FEMA 1VCFA 3DYMA 1XPYA 4JQ2A 3VCRA 3O0FA 4O53A 4PUEA 3ZR5A 4A2SA 1YTKA 4IG2B 3GQYA 2IKGA 1RK6A 2VFEA 3SIZA 3VOFA 1X7IA 2WVVB 3OHIA 3QY8A 3KS5A 3KE0A 3OLIA 3TXZA 1JF5A 2G41A 2NSOA 2X41A 1EC7A 1R3VA 1AQFA 1G01A 1POKA 4DI8A 4FIRA 4L4MA 3KZSA 3LD5A 1Z69A 2EAWA 3T7VA 5BCAA 3WO8A 2XU2A 3ITVA 4OZOA 4YTUA 4LAZA 4F8XA 1D7KA 2B7OA 4AYSA 1G4EA 3W2LA 3GW3A 5I3IA 4YPJA 1G4SA 1CECA 3WLTA 1OFDA 4LGXA 1S5TA 2OU4A 1FWCC 3QQWA 3VM7A 3W1NA 3V1PA 4HSOA 3W6LA 1UJQA 5E9AA 5KEZA 1E0UA 3TMQA 1V6YA 2YL8A 3ANVA 3M0KA 1SYTA 3FJNA 3O9NA 1G5AA 2DW7A 4IGMA 3GSMA 3S2NA 3EKZA 2I9UA 4IPIA 4GYKA 1V6TA 1W1B1 4FPSA 1QNRA 1JF6A 4RE3A 5AHNA 5F1VA 4RZBA 4KRTA 1W5MA 4KT2A 5H8MA 4PBGA 5LGXA 1O95A 3WLRA 5BXSA 1E3XA 2PRHA 1M5WA 4C6LA 1VHNA 4C60A 1JPDX 3RU6A 1E43A 4CUCA 1E6PA 4GZJA 3C4UA 3KBNA 4WDXA 1MZRA 4K2SA 4W7UA 2GFTA 5GJPA 5I6SA 1MQPA 4Q32A 3BG3A 4W4QA 3SO7A 1FDJA 4LF1A 1BXBA 3L21A 4D1JA 4FA3A 3IAQA 4QIUA 1NQKA 3NDOA 4DB7A 2ZADA 4H2HA 3TTEA 1EBGA 4LYQA 1XSKA 1GJPA 5CJ5A 1R3WA 2WNWA 1R3YA 1WUEA 3MHFA 3NGJA 3CZJA 3OYXA 2SFPA 1AW2A 4FLOA 5FESA 1ONEA 4D1IA 3V0UA 3W6YA 2W66A 5CC6A 4OJYA 4FOJA 1DQWA 2CZ5A 1HF6A 1AL8A 3E3HA 4Y9OA 3TEVA 3NR0A 3VMOA 1XLLA 2W3ZA 2OLAA 3IJDA 1TVLA 1WB0A 1W9VA 1PAMA 3SCNA 1AMYA 1ZFJA 5LIWX 5E0KA 2PPGA 5H91A 2BP1A 1CT5A 3HURA 1PTDA 3VOCA 4J3ZA 1OFPA 1XIIA 3AIEA 4L1GA 2ZZ3A 3TDFA 4GI8A 1ICPA 1RR2A 3M0IA 3FDKA 3VO0A 3W24A 4ERGA 3S6TA 2VT0A 3HQNA 2J27A 3TSMA 1KNWA 4LPCA 2CLOA 4RPPA 3OZYA 4Y9MA 2HNHA 1R2RA 1PEZA 4E6MA 1PCKA 3DGBA 4C6OA 1JPIA 1LG2A 4UOQA 3IGSA 3MUIA 2VZOA 4L9YA 2CBJA 1UR0A 3WQ8A 1W1IE 1VAHA 3ANYA 5BU6A 3F5JA 3UP8A 3GAYA 3QR0A 2D1ZA 4UQDA 4KGJA 4LVBA 1K6AA 1OD0A 3FCPA 4LAUA 1BQGA 2UY2A 2G37A 4PSPA 2VGBA 3AYTA 1TUXA 5F2IA 1X98A 4M7TA 2YDAA 3ARTA 4PCTA 4Q4MA 3M0ZA 4UFKA 3VPLA 3KBWA 2E5CA 3IACA 1C93A 5FIPA 3TLQA 4P8VA 4XZNX 3OODA 1HQTA 1B3XA 4QP0A 2GVLA 4EAMA 5K3VA 5AVNA 3QN3A 1ISXA 3XIMA 1V3JA 2QDGA 2XH0A 4K39A 3NXLA 3PANA 5HDRA 1W2VA 1C3FA 3HB9A 3RO6A 1YIXA 2ZX6A 2QPSA 1VPYA 3U6WA 4DM2A 5DT5A 3AUOA 3V0TA 2F7FA 3WK3A 1YXCA 3I65A 1T40A 3NQ6A 4I5RA 5A2AA 1JZ4A 1JRBA 2V2HA 5HWJA 3NO3A 1NP0A 3DG7A 1WAWA 1ELSA 3TE9A 2FTYA 1KRAC 2DP3A 3CZGA 1NSJA 3HPXA 3FX4A 3PY2A 4O19A 1VRXA 1IHIA 1WZAA 3GLCA 2YCLB 1J01A 1WKEA 3CJPA 3PAJA 1HT6A 5HWNA 1KFBA 1QXLA 1XV8A 4C6PA 1TTJA 2XN1A 3RRAA 1ZS2A 4NNBA 3L4UA 1CWYA 3W73A 4H4IA 3TYZA 5KINA 1ISWA 2NQLA 4DXXA 1ECEA 5AFDA 1SJAA 2OEJA 1UZ1A 4HZMA 5D38A 2ZWZA 2CKRA 1K6WA 3F4NA 3WH8A 4Z0JA 2ADAA 4N4PA 3QV6A 1M7OA 3MBFA 2DJXA 1A5OC 3MUXA 5H1WA 2DUXA 5FSEC 1IT8A 5E70A 3WQOA 5H8PA 3DBNA 2YZ5A 3V0SA 3B8VA 1S2TA 3HG5A 1XIFA 4IFKA 1W9DM 4JKMA 3HPFA 1XIMA 4MPKA 1Q66A 3VKBA 2IPJA 4GYPC 4ZA0A 1V0NA 1QR7A 4MNMA 2J9XA 4N9DA 3WF4A 1XPGA 3RFAA 2OT1A 3SEPA 1HJXA 2CITA 1DOSA 6TAAA 3CO8A 3QLDA 5IDIA 3BLIA 1CNVA 4LS2A 1E9IA 4L5ZA 2QCNA 4JX4A 2WHJA 1EX1A 2DZPA 5J8LA 2CEQA 4JTJA 1Y7VA 1T96A 2J66A 1OIFA 1YPFA 1CX9A 1TE6A 4JYDA 2YFOA 5I7GA 2QJMA 4UNLA 3LV6A 1KRBC 4NJJA 3QPYA 3VKJA 3NOEA 2E9LA 2NWSA 3T09A 4ZR8A 3GUGA 2I16A 3UZWA 2QYGA 3AHYA 5I3KA 3DERA 1FH7A 3GX9A 1TZ9A 3W2KA 3PVFA 4B9YA 4DQWA 2PBGA 3U3HA 2J8FA 4AIUA 5AKQA 3WYZA 5JQ9A 4XISA 4GWEA 3HOJA 2F6KA 3STEA 3HO8A 4PBEA 5IRPA 1EKOA 2NWRA 2Z2UA 3WD3A 3LY0A 1XGEA 3ARUA 3BWWA 3QVQA 1ISYA 1XRFA 1LLWA 4TX9A 6REQB 1N8IA 5CSUA 1QHZA 4MM1A 5BW6A 1A5SA 3MVTA 2Y6ZA 3TA9A 4LYKA 2NVCA 3P5ZA 2R1KA 2QDEA 1JCTA 5IDZA 4IPNB 2V5KA 4WGHA 4QCFA 3P60A 1FOBA 1GHRA 3OEXA 4GHRA 2FZ9A 3TC3A 3II1A 1EGZA 1HVXA 3D6NA 1IWAA 1B4KA 2XVLA 2DVTA 4JIHA 1X97A 3EDJA 4TMCA 1JVNA 3ARQA 1XLBA 4GI6A 4J27A 4TU1A 2OSWA 1GPFA 3AMCA 1OT2A 4LJ3A 1Q6EA 5ECVA 3VNIA 3BAXA 1HN1A 3S1UA 2W61A 3M46A 3TWBA 3NQVA 1XLIA 3PBUA 5I77A 2TAAA 3W7LA 1M7XA 4UQBA 3WLOA 4QJ5B 1VKFA 5LNUA 3SRHA 1R7OA 1LJYA 4AFYA 1EO7A 2WJFA 1M41A 1DJXA 1PYFA 3R5EA 1KTCA 4GJJA 2Z0IA 4GYFA 2OGYA 2OZ3A 2QJHA 3OTRA 3PBWA 3TW6A 6REQA 3ES7A 5HJXA 3NQ8A 3W1PA 3WY1A 2VDGA 2VFIA 4E38A 3R79A 1YKWA 3MYPA 2E40A 3WEMA 2J8GA 3W28A 4KGLA 3AQUA 1KXHA 3THDA 2BODX 3AIVA 2AAMA 1VFHA 3ZJ8A 2HROA 4ZQCA 1TJRA 4HU4A 2DIEA 4LAMA 1BRLB 4BK9A 1LOLA 4DJDD 4Q4SA 1TFVA 4NZFA 1GQKA 4Q4QA 4E2VA 3DHUA 5FJUA 5A6JA 4NL1A 3PS7A 1F07A 2ZXAA 3MP3A 4RXFA 3MUZ1 3SFWA 3FA3A 4O1DA 4BEQA 4O16A 2VGFA 3A4AA 4LW7A 1K9FA 1KW1A 1E72M 1DL3A 3ABQA 3VDAA 5DFAA 3GVQA 2JIEA 3CPRA 5A6TC 3WD4A 4I7WA 2E6DA 2QAPA 2ISFA 4TIMA 2B7QA 2E28A 3GDLA 2ZZ2A 3LHWA 3NO1A 1XCFA 5CBBA 1QI0A 1ITUA 4DWSA 4GZIA 2O55A 1MNZA 4U5IA 4B5SA 5FSDC 3PTKA 4RL3A 5BNKA 4Q8PA 3LHZA 2H9AB 3EGJA 3QF0A 2X1TA 3BOFA 3GIYA 4XAYA 4MF4A 4NYUA 4C90A 1XWYA 4FR6A 4AD5A 1QNOA 1K1DA 2KX9A 2QJNA 5CH9A 5A94A 5HA7A 2ZUVA 2I9EA 5KZEA 2PF0A 1AODA 4AMAA 1TR9A 5I00A 1R7AA 4QXIA 2EGZA 3TTOA 4G7FA 2YPIA 4JX5A 5D8WA 3CM4A 3BJFA 4B2DD 4ML9A 3UPMA 1KRCC 4U4MA 5CC5A 2ZZ6A 1YNYA 2AKMA 2H8XA 3KRBA 1T7LA 4PEEA 3EX4A 2I5QA 3CBWA 2J7BA 1WDWA 4INFA 3S5ZA 3KLLA 2A85A 1YE4A 1H7RA 1PZ2A 3W7DA 5K4ZA 3IGXA 4QRNA 1CCWB 2YIHA 5FA5A 2XVPA 4IMDA 4MB3A 5EGRA 4U5KA 3GXMA 3K8MA 7ODCA 1OC6A 1J0YA 4PB5A 3SR7A 2WC7A 1NQ6A 1NU5A 2Y5JA 4EWND 2WWCA 1OINA 2POTA 1ZB5A 3MO4A 3M7WA 4ZFMA 3GXNA 1Q85A 4H7ZA 1KBIA 3M0VA 2QZRA 4V28A 4F0RA 3AU2A 3ORWA 4XZIA 1RALA 1XI3A 4KERA 1J8VA 3EYPA 4PMRA 3T9PA 2V3GA 3F4VA 2OTDA 1PWMA 3O07A 5BMWA 1JAEA 1B90A 3U2ZA 1GT8A 2E6AA 1M53A 4KKXA 4HCDA 1V93A 4HZ7A 1QPOA 4ATDA 4PRWA 3WG6A 3B0VC 2VX5A 3UERA 3K5XA 2Y2WA 1XLMA 4OECA 1FH9A 5G2WA 3WDRA 2QT3A 4H9XA 4JR5A 3SCUA 3AMGA 3G8RA 4AD4A 3T78A 5HUOA 4QS6A 4P7LA 4NRSA 2ZUTA 1FY6A 1RJQA 4IF2A 3TJXA 4Q8WA 9XIAA 3SGUA 4QJ4B 5FJTA 3WJXA 2WJDA 2YW3A 1I60A 2GGEA 1F7BA 4YWIA 2PMQA 2F61A 3STGA 4D6EA 3AZRA 3PB2A 2HWGA 3EWXA 5DT7A 2RAGA 5G2IA 4A8NA 4E2OA 4Z2LA 4GO9A 4ZOEA 3W7NA 1T6MA 1SQ7A 2PDPA 1FRBA 4YTRA 1RBAA 4NAFA 4F0HA 4GXMA 1S1PA 3URBA 4AB4A 2E9MA 4AIOA 1YDOA 1N7KA 4MWAE 1YQ2A 1GJWA 3AXKA 3TOYA 2EPMX 3QYSA 5FF0A 4KWUA 5EBUA 3B8UA 1DWJM 4DJFC 3EOEA 4IXHA 4BZYA 4ORMA 3ARPA 1OFAA 2V63A 4QS5A 1WKDA 1UQZA 4ZQOA 1GVYA 1PPIA 2KZHA 3VM5A 3MYOA 4EPDC 1R3SA 1D3CA 1FUYA 1QI4A 4LV4A 3MZ2A 4KESA 2X30A 4ZTXA 4GOAA 1P7TB 3H2NA 3WLLA 1H63A 3S83A 3CQ0A 4WD0A 5J5RA 2IKIA 3DENA 4WKFA 1TZ7A 4ICNA 5J04A 4IQDA 2PURA 2FZ8A 4DZIA 3FKKA 1XYBA 1YE6A 4IMGA 4QNEA 3B9DA 4WDWA 3UZZA 3G1DA 4IL2A 3W2MA 1IEQA 3PBMA 2R6OA 4G7EB 3H7VA 1HO1A 3UF9A 3RF9A 4K38A 4NVTA 4AVFA 2J47A 3EKLA 4JNZA 4MADA 1H51A 2QCMA 4WDTA 4LEFA 4NAEA 3CXOA 2HJPA 3CWOX 2YOCA 5HR6A 3PBVA 3S1GA 3M9YA 4LNCA 3L4WA 5G4HC 7CGTA 2VEFA 4ADUA 2JEQA 3G22A 2YYUA 4IMAA 2CBUA 4F0MA 1ZBVA 2QMJA 2GDQA 3QC3A 4UR7A 2EJ1A 1F6PA 3RU8X 1JDCA 2DSZA 4GQBA 5KZ6A 2PLMA 3BANA 1LBFA 3MSDA 1UPMB 3BICA 3ZLFA 3ITOA 2CNCA 3B0PA 4S1FA 3VU2A 1V08A 3CYVA 3WD2A 2CLPA 1I1XA 4C1NA 1R30A 1OFQA 1J93A 3GYCA 5T9CE 2IPFA 1TPVA 4JX6A 5MHBA 3PZVA 1FWGC 4W7VA 3H2OA 1K4GA 1GK8A 1V7YA 4EP8C 1MFVA 1TMQA 4Z1CA 1OG0A 1KCLA 3FHAA 4G56A 4KEVA 4MYAA 3TROA 3VKAA 4M0XA 3OJGA 4TV5A 4WLCA 2BB0A 2BXVA 4ZO9A 3QJAA 5GVJA 3NEVA 3CGTA 1RY0A 3ZJ6A 4S3JA 3ABRA 2Y7DA 1M3UA 4JIEA 1G6CA 3KOXA 3T0DA 1XKJA 3GBDA 4XUGA 2AL1A 4HYWA 3WLJA 3F7JA 3N2BA 4CCEA 3CIWA 3O7UA 3HM7A 4H9VA 1QDSA 4W86A 4MVAA 5GJMA 2QDDA 1QO5A 1XBZA 3N12A 1EOKA 4WK9A 2GVJA 1UKTA 2VGIA 3S2MA 4X63A 3QGAC 1HKIA 3LGDA 2DZBA 4XV0A 5DO8A 3GXFA 5HMFA 4W85A 3EA1A 3HN3A 3B40A 1R47A 5DMMA 4O8RA 3S2LA 3NZ1A 4AHQA 1TV2A 2DFAA 3UBPC 2X05A 4B3ZA 2ALDA 2ZXBA 4YYFA 5D03A 2OEKA 2FMOA 3IGUA 4K1GA 3M0LA 4WSHA 5EFFA 1L6FA 1TCMA 4GGBA 4IUGA 4BQ5A 3UT0A 2V6AA 3IARA 1IZKA 3MI6A 5FAGA 4ONVA 1ZAIA 2VC5A 3BW3A 3QHMA 2QPXA 3FA4A 5JUVA 4HOXA 1N8FA 3CZLA 4PA8A 1ODUA 1O5KA 1DV7A 1W3NA 3VDHA 3S9IA 3H23A 2FGBA 2GQ3A 2WPBA 1UP3A 4RV8A 3JRKA 3RGTA 1TPC1 3VABA 4KETA 4M56A 4EF9A 4ES4A 5BMXA 4Y8EA 1I2PA 1VBUA 2EBNA 4KPLA 4NUWA 5HANA 1F5ZA 2P53A 4GIRA 4PE8A 4AZIA 2C15A 1QATA 2D0FA 1AJ0A 4QSHA 1L6SA 1A0DA 1T0OA 3IJIA 3WQFA 5LNWA 1PUDA 2DSKA 3HQ1A 2TYSA 4A3RA 4OT7A 1V79A 3TYCA 3TA6A 4TO8A 4XKYB 2VXNA 2A5HA 5C9RA 3DEQA 3DKJA 3MKKA 5AB3A 2MANA 3V75A 2XN0A 3WH6A 3MS8A 3RR4A 4HT3A 4BF7A 2FJUB 1TQJA 1A4LA 2P3EA 3WUFA 4OTKA 4DZ5A 3NZQA 4R7OA 2G3FA 2ZX5A 1SVDA 3HG4A 2QCLA 2TODA 1F05A 3LTYA 2NSXA 3KW3A 2XH2A 1WZLA 5CPQA 2Z1KA 4ZO6A 3F4CA 1JEZA 2Y4SA 3KEHA 1CW2A 4GISA 4AEOA 1AQHA 4PMYA 2QV4A 3G8EA 3LSBA 4U2YA 1QI2A 4WY0F 3MI2A 5ABGA 4DF2A 1TCDA 3O0KA 2PDQA 3BLFA 3UZ5A 3B4YA 2BMBA 3W1RA 3QHOA 2R82A 3AS0A 2XINA 2Z1WA 1G67A 3EXTA 2HK1A 4XK2A 2DJLA 1BYAA 2YKKA 2QS8A 4IM4A 1GCYA 1EQCA 1ZLPA 1G7VA 3SY1A 1S2AA 4L64A 2CZFA 4AIEA 1XIHA 1UWIA 4YCPA 1LRQA 5A6LA 3LXAA 2CLMA 3WDQA 4KFOA 3RAOA 4BF9A 2R91A 3R94A 3UXDA 2GVGA 1KRMA 5LIXX 1O66A 5CAHA 4U3CA 4LVDA 3R10A 5A8NA 4UTHA 3A5VA 1FWTA 3BGAA 2YJQA 4OE7A 4J3UA 5DEZA 2ISDA 4LVAA 2XUCA 1OC7A 1FKXA 4UQEA 2X7VA 2F2HA 5DANA 5I3DA 4GCXA 1CB7B 3BJSA 4K37A 3M5ZA 1FDYA 4PUJA 1UKOA 3WQ5A 2CYGA 4LYRA 3CUFA 1QU4A 4K3ZA 4X9YA 1MUCA 1E70M 2GSEA 2V3EA 3W1TA 4WF7A 3CK5A 2BLEA 3SAZA 3BW2A 2Z4GA 5BWAA 1LUCA 1QJWA 1ZP3A 1X39A 3DI0A 1QPKA 1SSDA 2PF8A 3S5NA 1JJKA 1VF8A 1XYLA 1UH4A 2ACQA 5CG0A 1TRIA 1GZGA 4NNCA 3W7HA 3BOLA 4UTWA 2YA0A 1KM5A 1Q63A 4LUYA 1NM9A 5KITA 5K4XA 1XLGA 2VCAA 1EIBA 4PULA 4YL2A 1I75A 5BOFA 3FJ6A 2UBPC 3QOMA 3LN3A 4AISA 4Z42C 3DXIA 1IXNA 1FHLA 1TTIA 5EPDA 2BXYA 2DT0A 4LEQA 4Q8UA 1DYSA 2WMIB 3VDCA 3VTRA 1TWZA 7REQB 4M6UA 2YL5A 1X1NA 2W5FA 3PK7A 3H7UA 1TR1A 3E5PA 3Q94A 3KZPA 1XD0A 1MNSA 2DY3A 2UZ9A 4JFTA 4AW7A 1EUAA 3GYEA 5AC5A 3SCQA 1OBAA 5D2WA 2FJKA 3OBEA 4GY0A 1QW7A 1KKOA 1UR9A 3BZGA 2PDUA 3NXFA 3OP2A 3AOFA 3ZVHB 1W8SA 4HYVA 4BQ2A 3DC8A 3L5LA 1XC4A 1AMKA 1WQ5A 3KLKA 1GVIA 3WQDA 4UTMA 4IP7A 2PDJA 4PTDA 5C71A 1HJUA 3KTCA 3T2PA 1DJNA 2VUNA 3UXLA 2PU1A 1Q13A 2QW5A 3T2OA 5AZ1A 1G0CA 1GOOA 1IYXA 1DWHM 1QUMA 1C9WA 4EX4A 2DZSA 3VIFA 3IJLA 4RZ4A 3EWWA 2WC3A 1UOKA 5LIYX 3VGGA 1IEXA 1BYDA 1R0MA 3WF2A 3QFWA 4HBKA 1P0KA 4PMZA 2PDMA 3LK6A 1BG9A 1UMLA 4MAVA 3VKCA 3NZGA 1YTEA 3AMLA 3ARVA 2V82A 2OKOA 4HP5A 1EP3A 3TK7A 1ML1A 3VGBA 1HJVA 3UZYA 3PUGA 1DJHA 4E5TA 4XKMA 3C61A 1KXTA 2R24A 5I3FA 3VIJA 4JCLA 5LYRA 1A5BA 4F3HA 2X42A 4LCSA 3R8HA 3N3TA 3EMQA 2Y88A 1EJWC 3F4DA 4JDBA 1VFUA 1FHUA 4MZ1A 4C91A 3UJRA 3MPGA 4L6HA 3O2LA 5L9FA 2VFGA 2Z27A 1F74A 1GG1A 1YXYA 2YXGA 3J7HA 2QVHA 3EOUA 4N9EA 3B8SA 1PV8A 1O4UA 3NNTA 1GOIA 3WQGA 4IISA 5BXTA 3I7RA 4R9XA 2POZA 2XG9A 1PCWA 1ZQ5A 3CUGA 4GY7A 1KGXA 2FZDA 4XSLA 5C2XA 4F79A 2O9OA 4WSKA 1AL7A 2Y89A 2C13A 2ZX9A 3N25A 4XB3A 3VOIA 4UTKA 3I3BA 1W3JA 4YWSA 2YFNA 5BWFA 4Q6XA 4OIFA 3GDKA 3BMXA 2OX1A 3NSXA 5HJLA 1UC4A 4WX2A 1Q45A 3LI1A 2WHKA 3OGVA 5EYWA 1PDZA 3M7SA 2WQPA 3FSTA 2CERA 3K2GA 1QRQA 3W7EA 2XZ7A 1E51A 3AHXA 2V0TA 3E02A 3CUJA 1SM9A 1UC5A 2VFFA 3ZMRA 4S23A 5E9XA 3QOKA 1QI3A 3NPXA 4WCJA 3FSUA 3H24A 2VD8A 2Y5EA 1UUOA 2GSJA 3M0XA 3BQ5A 4X0NA 1PKMA 3M41A 5LSMA 5BOEA 1E71M 2E09A 4PUDA 2WVUA 3S46A 3QQ1A 3CUZA 1OCJA 3HFYA 4U2ZA 4XQ6A 4Z1DA 1ZZMA 1C8VA 4AUBA 2WCAA 4CVUA 5EFDA 2ZUNA 4CGTA 5DELA 1IT0A 4LUIA 2C79A 4HPHA 3GHTA 3LLDA 3QHNA 1IEWA 4AHPA 4W9TA 3W23A 4JY8A 1IT7A 1CGVA 4EPKA 3BAJA 3LBOA 4M8UA 1V5XA 3AISA 2ZUUA 5FF2A 3H21A 1HFBA 2YCJA 3PZNA 2DUZA 2PFHA 2B31A 1QW9A 4PMXA 1R8LA 3BV4A 1UWRA 4GZ7A 4H8VA 3DHDA 3Q2DA 2WC4A 3GG8A 3SUVA 3ABXA 2XIIA 4JL1A 3FW6A 4L9XA 4UTIA 4HCHA 1HKMA 2Y70A 3C0LA 1NOWA 3CB3A 4GUFA 4AZ5A 1UZ4A 3PZOA 3REQB 2GGIA 3HGJA 4MKVA 1E4IA 1WBJA 4WR3A 2C19A 2OZ0A 4C1LA 1NDYA 3M6YA 4OOUA 4AY8A 2GPTA 1VFSA 3MMWA 4QR6A 4LY8A 2FQIA 1MVYA 1HJQA 2WPGA 5D33A 3VINA 5BOOA 2ZA3A 3CLMA 3PWGA 3EOSA 1YMYA 2G4JA 5FAJA 4W87A 1UUQA 1OIMA 1QOQA 3DHPA 3QW3A 3WNKA 1BVZA 4AZHA 2AQVA 4TVDA 1TB3A 3WNPA 2GVYA 4FEZA 4CD6A 2VRJA 1GYNA 4D8AA 2WM0A 3MANA 4FNQA 1E6XM 1YDYA 1D8WA 1XFCA 2PB1A 4N4QA 3WSUA 1LQAA 3GXDA 2BHUA 2ZIDA 1TTQA 4FMVA 4NP7A 3GC5A 2GUBA 4UUIA 4NI8A 2WVSA 3PUOA 1QHOA 4JZ5A 2TPSA 2EXOA 1S5NA 5TIMA 5A69A 2HMCA 1XSJA 4OOZA 1SFTA 1WXYA 4AC1X 1EA9C 3RX2A 2GWNA 3KVJA 1H61A 4Q7BA 3UG3A 2QCDB 2Q02A 3NPUA 1DORA 4O13A 1GVSA 5FI8A 1EDGA 2VRQA 5AYIA 2JE8A 3G0SA 3HFTA 1UR4A 1QOXA 1Q6RA 2ZTJA 3GBEA 3ALFA 4B3LA 5KETA 1RP8A 1MUMA 1YYAA 3HPSA 4FZIA 5GQBA 1JDFA 2VC9A 9RUBA 5JVLA 3H54A 1FWEC 2W27A 3QSTA 2HPIA 5C54A 3UXAA 2WZIA 2E8ZA 4I9MA 2P3ZA 2VFHA 4NU7A 4HJWA 4I6VA 1DTNA 1UD8A 3W88A 4J35A 1IZCA 2PAJA 4L61A 1KXQA 2Q3OA 2BOEX 4JQ4A 3W1QA 1LBMA 4J3XA 4Z2KA 5RUBA 1CEOA 2VEPA 4GJ1A 5B80A 4HU3A 3W81A 4O18A 3FKRA 2VYOA 2CZVA 2A3CA 3UY8A 4AF0A 5LIKX 1B9ZA 3SM0A 1F8MA 1UQYA 3OQEA 1G9HA 4PCFA 1OB0A 2QXWA 1DPMA 1E6NA 3W7PA 1DHPA 2DPEA 3ARYA 3TYDA 1RHCA 3V35A 4QJ1A 1SFSA 1ONXA 1BF2A 1XRVA 5CEWA 5CSYA 4GO8A 4V27A 1EA0A 2RJGA 4HU8A 1W3HA 4JD4A 4JICA 1JULA 3A47A 3L4VA 4O0ZA 4XVEA 1VR6A 2NQ5A 3W7OA 5C2GA 3IPWA 5C2CA 4LS1A 4E2BA 1PO9A 2C71A 3NQMA 4YVVA 1YLVA 4R9OA 4AG0A 4EIVA 1U22A 1YBQA 2HBVA 4UTTA 4JAWA 3PBGA 3WK0A 2ODOA 4IOTA 2NQZA 3ZT5A 3IJ8A 3WLQA 1RY8A 4A8RA 1LRTA 2NV2A 2NT0A 3HGSA 4H6RA 2XVKA 4AZCB 3E0IA 1UW9A 4QAIA 3S2CA 4CQDA 2A3HA 3KX6A 3RHGA 1TWSA 1UKPA 5A5WA 4MWAB 5CSRA 5JH2A 1NWRA 3VIPA 3DESA 5REQB 4Y9AA 1WO2A 3CHDA 1O1HA 4UQ9A 4YTQA 2CXGA 5DY3A 2W92A 3PWIA 4GNVA 3N4AA 2E67A 4Z17A 2EPHA 1VRDA 4DWSC 1OX4B 4FAMA 2WSQA 4D6FA 2ABAA 1V77A 2V67A 2CESA 2HV5A