3TJLA

Crystal structure of a novel oye from the xylose-fermenting fungus p. stipitis
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
404
structure length
404
Chain Sequence
SSVKISPLKDSEAFQSIKVGNNTLQTKIVYPPTTRFRALEDHTPSDLQLQYYGDRSTFPGTLLITEATFVSPQASGYEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLIFLGRVADPAVMKTRGLNPVSASATYESDAAKEAAEAVGNPVRALTTQEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHLSTIVGADKIGIRISPWATFQNMKAHKDTVHPLTTFSYLVHELQQRADKGQGIAYISVVEPRVSGNVDVSEEDQAGDNEFVSKIWKGVILKAGNYSYDAPEFKTLKEDIADKRTLVGFSRYFTSNPNLVWKLRDGIDLVPYDRNTFYSDNNYGYNTFSMDSEEVDKELEIKRVPSAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase
publication title Structural and Catalytic Characterization of Pichia stipitis OYE 2.6, a Useful Biocatalyst for Asymmetric Alkene Reductions
doi rcsb
source organism Scheffersomyces stipitis cbs 6054
total genus 157
structure length 404
sequence length 404
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tjlA00
4LVGA 3W2UA 4LS0A 3PY2A 4RX0A 5J5RA 3TC7A 4LU0A 2DZPA 4MYAA 1GVOA 4AHQA 3KRSA 1M7PA 1LRQA 1OFOA 3NA8A 3SGZA 2A1YA 4UTWC 3BW4A 2ZRUA 3W3OA 3M6YA 1IXOA 2ZFAA 4IXXA 3TU9A 3QZEA 1LP6A 3LLFA 4I7WA 1H62A 5AHFA 2A2IA 1OFPA 2XN2A 3LBMA 4O11A 4BK9A 3MWAA 3LBCA 3FOKA 1FXPA 3O07A 3QPZA 3ABQA 5F2IA 1JUKA 2NUWA 3ZWTA 3P8IA 4N6FA 2H3BA 4GBUA 3HJZA 1ICSA 4XBKA 1KV5A 1ZFJA 1ZNNA 3W83A 1XDLA 1L9WA 2QUTA 4ZVJA 1OFEA 3L0KA 1OF6A 2A6LA 4O12A 4HNTA 3O06A 6TIMA 3GKAA 4ZQPA 3M1ZA 2CZFA 1W3TA 3U2OA 3DFPA 3NM3A 2QAPA 2R14A 1XBZA 2FDSA 3S42A 4A3UA 1M6JA 2Q8LA 1H1ZA 3S6DA 1U83A 2JKEA 1SW3A 1GYNA 3GNDA 2GQ9A 4JTIA 3W23A 1S5TA 2R94A 3O15A 2QUUA 3HPSA 4JY8A 2FPYA 1FXQA 4JX4A 4N02A 4DPQA 3NO5A 2NX1A 4GC4A 3W1AA 2VEIA 1XDMA 1ZJIA 1SPQA 2A6NA 3GVGA 5LNWA 1TQJA 1SZEA 5EA9A 4CNPA 1DBTA 5D2VA 1QMLA 3JRKA 1VZWA 1DVJA 3BG5A 1W5PA 4MPQA 2QF7A 3TXVA 1FY6A 3LDVA 3MP5A 3E0IA 1KW1A 4O8RA 5G1YA 3LGEA 2PRMA 3EX2A 4MUZA 5G5IA 5LGXA 1TPFA 5LZLA 4FHAA 2WSYA 5C6MA 1OX6A 1TPH1 3IEBA 4JTJA 3W2JA 4WY0A 3MHFA 5CPOA 3TQ0A 1QCWA 1QFEA 4GWEA 1I4NA 1G4TA 1THFD 2VOMA 3FKRA 1HFBA 2I14A 5G2HA 4A29A 1T8XA 1M7OA 2X1UA 3NAVA 5I3IA 1F6KA 3HF3A 3I65A 3EB2A 4WOQA 3E49A 4LT9A 3GLCA 4U28A 2EHHA 5IM51 2JGQA 1HUVA 1K8YA 2A85A 2DZUA 4AXKA 4GUIA 4UXDA 3TW7A 1KA9F 5LHEA 1GVRA 3U6WA 2A21A 3CTLA 4EOUA 3W7OA 3P80A 3TW6A 3G1SA 2QCLA 1QOPA 1D3HA 4WY0F 5LNUA 5LGZA 2A4AA 2RKXA 1AMKA 2Y89A 5EBUA 5A8GA 4NXKA 3T44A 4YXGA 3EEGA 4FX8A 3NQ7A 3S9YA 3LCWA 4FB7A 4DELA 1A5BA 3DKJA 2YYUA 2A5HA 1FDZA 4QSHA 1KLYA 5F2MA 1IIGA 2H8ZA 1SFLA 5DXXA 3W7KA 3KRZA 1YDNA 4YLWA 1FQ0A 1TMHA 2WSRA 3LCIA 1YADA 3CC1A 3GDLA 3NQCA 4LOCA 3TMLA 2I9EA 2BWGA 3UPWA 1H7RA 1W1ZA 4XZ9A 4POCA 5BOOA 5AHLA 4XKYA 1DQWA 2HTMA 1X1ZA 4LRSA 1QO2A 1BEUA 4O0KA 4YCPA 3G8EA 2ZDRA 4YWIA 3GXPA 3NQGA 5DLCA 1ZY9A 2ZRXA 2OZ0A 2E5CA 4HSNA 4UTKA 1TPC1 3UXDA 5C54A 3DU0A 3UQNA 4K7YA 4HKPA 2V30A 2E6FA 4HPJA 3W73A 2QKFA 3IIXA 1LCOA 1UCWA 1OFBA 2VFDA 3HPXA 1XFBA 3TNOA 3PWAA 2F84A 1W5NA 3R2GA 4QJ1A 1L6WA 4JDYA 4K8EA 5TBOA 4C1KA 1VCVA 3RU6A 1AL7A 4UTTA 1KM0A 1C29A 4X9SA 1CI1A 3GK0A 3W1XA 3C61A 1VS1A 3TQVA 5H2ZA 5FF7A 2YXGA 4KWWA 5K2ZA 3D0CA 2DJLA 3C2OA 5D02A 1R2RA 4OQVA 3PBUA 1GT8A 2OMAA 2Y7EA 4UC5A 1AG1O 2G96A 2PCQA 1RD5A 1PCKA 1YDVA 1R2SA 4KFPA 3TMQA 1H51A 2QCEA 5F1UA 2Y7DA 3NXFA 3F4WA 4O14A 3L5AA 3QQ1A 3LCGA 1MXSA 1K8XA 2WNZA 4IMGA 3QFEA 2P1FA 1SR9A 1H61A 1HL2A 3BGJA 4IMEA 1PE1A 3C2FA 2V0TA 2CLFA 2NXGA 3WJYA 1JRCA 3L65A 1MEHA 4IUOA 4QAIA 3G22A 1W5QA 3QM3A 4RKAA 2TRSA 3KVLA 3EX3A 5HQEA 3GKFA 4MKNA 1W3IA 4YCOA 1KM2A 3I6RA 1JQVA 2VXNA 3WFAA 1UUMA 1VYSX 1T99A 3N34A 4AF0A 3VKJA 2ABBA 5AYYA 4UFJA 3RK8A 3N9RA 3N14A 3KOFA 4IMCA 2VFIA 4IOTA 3CWNA 4OGZA 5G4WA 3CM4A 3ATZA 3QJAA 3SY5A 3NPVA 2YFOA 2Y88A 1OX5A 2VELA 4ZL1A 3AO0A 1VC4A 3W72A 2FPVA 2W79A 2CLLA 3P82A 4NQ1A 1B57A 4NJKA 1F76A 1LRTA 3W1UA 3DH7A 1G69A 4WZHA 3QPYA 4XBSA 1EWDA 2A7NA 4R53A 3E96A 3OVRA 3DZ1A 3P5ZA 4I7VA 4PODA 5KTLA 3H53A 4RZ4A 3MW7A 1LTDA 4O54A 2W6RA 3ZFHA 3NQEA 3BVJA 4Z0SA 1H7WA 5FEPA 4LWWA 1LDCA 5BMXA 1JCLA 1EWEA 4H3DA 2DZXA 3LHZA 2X2GA 1ME8A 3PBYA 1EEPA 4E38A 1L2UA 4K7VA 1DOSA 5IBXC 2R91A 3NPUA 4JN6A 1CX9A 1TO3A 3MUXA 5D03A 3N19B 3W1PA 2CWNA 2H90A 2WV8A 5FI8A 3NL6A 4CCCA 4UTJA 3TAKA 3MI2A 3NNTA 3O6DA 4LTSA 1NVMA 2Y6ZA 3W1LA 4BWLC 5U4NA 3S8HA 1LORA 2OT1A 3O6CA 1TB3A 3EKZA 2OCZA 4NZJA 1TV8A 2C19A 2FLIA 5AHMA 1PCWA 3PULA 2HS6A 1UB3A 3M5VA 2QCGA 5LNSA 2R8WA 3W84A 2ZQ0A 1W37A 2V81A 4X22A 3MHUA 1ONRA 1KM6A 4FX7A 5KZEA 1A5SA 2ZZ5A 4OV9A 3WJXA 3L5LA 1FWWA 4O15A 3IIVA 1K03A 1VR6A 5G2WA 3M7WA 1QWGA 5G1TA 1OHLA 2ZA1A 3C2EA 3L9CA 1G67A 1JRBA 1FCBA 3P60A 3G1FA 3L0GA 5K4XA 2Z6IA 2NXIA 1P0NA 2QR6A 2DZTA 3A5VA 2Y63A 4JX5A 4AAJA 3W9ZA 1VYRA 3EWZA 2UV8G 3WJZA 3H54A 3MP3A 5CPNA 5I3JA 3LERA 4O4VA 3TE9A 4WQ6A 2V8ZA 5BNKA 3V75A 3NQMA 4J9JA 1OFRA 3LTSA 4JTFA 1LBFA 4O1DA 3C52A 5CZTA 1DORA 2E6YA 1DJQA 1LLWA 3S1XA 4UTUA 3QW3A 2TSYA 5EPDA 6ALDA 3C3NA 2WQPA 2NXHA 2B4GA 1XCFA 5DCEA 4K8HA 3F03K 1OK4A 2PURA 2Y61A 2ISWA 4NJGA 1Z44A 3PAJA 2RDUA 3L5MA 1RPXA 3PB0A 5LHFA 4UFIA 4N2YA 4MVAA 2A7RA 4UTHA 1YXCA 1GJPA 4CQ8A 3LM7A 1ZHAA 2ALDA 3AJXA 4IPIA 3M5YA 1J4EA 3H55A 3LCFA 4DF0A 3G1AA 4FIQA 4IXHA 4N9DA 4NJJA 2BX7A 3TIMA 1GWJA 5FEWA 1TPB1 1WX0A 2YCEA 4RJEA 1OX4B 4Y90A 5C2XA 4FNPA 1LROA 4CNNA 3G18A 2H6RA 3IIOA 4NNCA 3VE9A 3VI2A 2CLHA 2ZA3A 3FLUA 3B04A 2ABAA 4N9EA 4UTMA 1F2JA 4MY9A 1B3OA 1DV7A 3DKLA 4JD4A 5G2IA 2QDHA 4O18A 4PFMA 4JTKA 1TCDA 2J27A 3EWXA 3G3DA 4GUJA 2ZZ1A 1RV8A 2LLEA 1XXXA 1KV8A 1QO5A 4AHOA 1SO4A 3ABSA 5TIMA 3DFTA 4O1BA 4DF2A 5F1VA 3LXBA 2NWRA 5C55A 5DXYA 4CQ9A 3FA5A 2CZEA 3LTPA 4KKXA 3MI6A 4MY1A 1Q45A 4FX6M 1EB3A 4O17A 5AHEA 3S5OA 3PUOA 1A50A 2E68A 3UWWA 2JKPA 1YXYA 4WOZA 1YLVA 3GIYA 4JTEA 4DQWA 4FO4A 5D37A 2DZWA 4K38A 5DY3A 4X2RA 3LRLA 2EAWA 4K36A 1OABA 3NQDA 2NX9A 2AQWA 3HO8A 8TIMA 1EUAA 2BTMA 2WJZA 2WNNA 5CSRA 3DHFA 5AC6A 1P4CA 2JBMA 1Y0EA 3W7GA 4NVTA 1OF8A 2P0OA 2V5LA 1K3UA 3GR7A 1G6CA 1AL8A 3FEMA 4P61A 4JTGA 4LVDA 2TPSA 4Z0JA 3TSMA 5F4XA 3LV5A 1VHNA 1XM3A 3HBLA 3SSJA 1H63A 5KZDA 1KFEA 2Z0IA 3NOEA 4LC6A 3S5YA 4I7UA 1A5CA 4S2BA 4LV9A 5GVJA 1FWSA 1IXNA 1JULA 3CWOX 2FJKA 5AFDA 5EKYA 2ZRVA 3NQ6A 4RK8A 5F2LA 3DI1A 1KFKA 1TPVA 1DL3A 4AB4A 4OBTA 1EUNA 3JR2A 3TK7A 4O19A 3S1VA 3DXIA 3F4NA 5AN7A 2C16A 4OE7A 3TXZA 5HR6A 4PL1A 2QJIA 1VCGA 2NV1A 2X1TA 3G1VA 4LVFA 1TTPA 1WA3A 4NUWA 1B4KA 3B0UX 4TIMA 3W7PA 1JCNA 3A23A 2G97A 3ATYA 5AHIA 1JCYA 4AHPA 3EWUA 3S5ZA 3OA3A 4E2DA 5AYXA 4PC8A 3Q58A 1ME9A 5KINA 1AK5A 1TPWA 4GXMA 4JIPA 4JTHA 1H7NA 2CW6A 3UZ5A 1ZAIA 3M43A 3O1NA 2J9YA 3EX1A 1LOQA 3EWBX 3K30A 5EMUA 1VRDA 4MFEA 3TAOA 2J9ZA 5DBUA 3GX9A 3NL3A 2Q3RA 2C18A 3FYOA 3MYOA 3G8RA 4P2VA 1Z48A 3PG9A 1KM3A 1VHCA 3SR7A 4ZQNA 1FWRA 3GDTA 3BW3A 3G24A 1VH7A 5K9XA 1HTIA 1DJNA 1GTEA 3QMTA 2BXVA 3QMSA 3BPWA 1SO5A 1S5WA 3UWZA 3LHYA 5HWJA 2ZZ6A 1WBHA 3NZ1A 4NX0A 3N9SA 1S5VA 1XC4A 4UNLA 4RXFA 5K7JA 4R33A 4TO8A 3W7JA 4XTDA 2XFWA 3P8JA 1W56A 1YXDA 4LV4A 1IXQA 3SJ3A 3QSRA 1H7PA 3EWWA 1K02A 2H3DA 4O13A 4OT7A 2AGKA 4GUFA 4RZ6A 3THAA 5D04C 3S1UA 3P81A 5DY2A 3CEUA 4MZ1A 1GYLA 1TIMA 1S3HA 4QQ3A 3G0XA 3MHGA 3W85A 3ABOA 1A53A 3NQAA 3VNDA 1WQ5A 4XUGA 1DQXA 4I9AA 2VENA 2B7PA 3W7RA 3O8AA 3GNNA 3W2MA 4Z1DA 1Z41A 1GVQA 2DZVA 3MBFA 2YSWA 3PR2A 1KM5A 2X1RA 4CLMA 4O0ZA 3L67A 1FWNA 3LX9A 4NZFA 3TDFA 4XKYB 3S1WA 2WSQA 5CZSA 2VEKA 3BARA 2QAFA 3PSVA 1TRDA 4C1LA 1TREA 3OIXA 1G4EA 3NPWA 1EP2A 3NQVA 1GTHA 5KZMA 1TYGA 1SZFA 4JTTA 4A2RA 5HUOA 1JUBA 3BLFA 3G1YA 3E12A 3GDKA 3M44A 3W70A 1IF2A 3ANYA 4FNSA 4DBEA 4JIQA 4RXGA 3UZJA 4DPPA 2QCFA 4FXRA 3PM6A 1OG0A 3GXTA 3OVQA 2DJXA 3O16A 4LS2A 4TR9A 1NEYA 2ZRWA 2NV2A 1XBXA 4DO4A 4IQLA 1ZENA 3GXNA 3W1NA 4EIVA 1WOAA 1RR2A 1T0OA 3UY8A 4ZMGA 3IVSA 3IIZA 5DCBA 2X1SA 4HPXA 4NU7A 2E6DA 3SECA 1OFQA 3STCA 3CU2A 4TMCA 3LI0A 2Z2UA 2C13A 3DHDA 3NQ2A 4M6VA 1PIIA 3NGJA 1SSDA 3WK3A 3TSDA 5LNRA 3IRDA 3R12A 3TUUA 1TSIA 2I1OA 4ADSA 2VFFA 1SU5A 3G0UA 4PTNA 4MJMA 4W9TA 5CKSA 5D05A 1W31A 1GPWA 1W54A 4O50A 3U8GA 3W1TA 2X30A 1G7VA 2C1HA 4HHPA 5EY5A 1TJPA 4TU1A 2NZLA 5L9FA 2E5DA 4CCDA 1TPEA 1HG3A 3RFAA 1FWTA 4IX2A 1KBIA 4NT0A 3P84A 1PVNA 1TQXA 3C56A 3B8DA 4IWWA 3TJLA 2RFGA 3LCXA 5DBTA 5D33A 3B0PA 3UWVA 1F73A 4KFNA 1L6SA 3W87A 3B0VC 4LRTA 3ELFA 2QCCA 3C2VA 2J24A 4UMBA 3NEVA 4CNOA 3LHTA 3W86A 2FIQA 1KLZA 4EWND 3Q2DA 5EYWA 3S5NA 1Q6RA 4FEZA 4FNUA 2TMDA 1SUXA 4OU1A 3KVMA 4UCGA 2OT0A 4RLIA 3CQ0A 3CIWA 2Z6JA 5I3FA 1LLZA 1RZMA 1O60A 2NLIA 5KSWA 1I2RA 3DGRA 5CZJA 5AC7A 2C15A 2Z1BA 1MEIA 2QCDA 4UTLA 2EF9A 5D2TA 5HMSA 1FBAA 2B7NA 4ICNA 1O5KA 3TA6A 3S0CA 2NUYA 3TROA 3W7LA 4D2JA 4G1KA 3G0SA 4U4MA 1R30A 1KFBA 2X16A 3UWYA 5F2GA 1H1YA 3I68A 4DEFA 1LZOA 1XBYA 3LLDA 3W07A 1WYIA 3LXCA 4TX9A 5HJLA 1NF7A 4LVBA 1C9DA 4Q32A 3KAOA 1FCUA 2JK2A 1B9BA 3W74A 4NJHA 5K9DA 4NXSA 1ICPA 1TPDA 3G1HA 2W0UA 1VPXA 2ZBTA 3QQ0A 3A24A 3LHVA 4H4IA 5AC8A 1SW7A 3FKKA 3TJXA 3OVPA 4UTWA 4BI6A 2G95A 2ZZ7A 5I3KA 2V82A 2CZDA 1TTJA 5D2XA 4UTTC 2PRLA 1YDOA 4UR7A 2E77A 3NL2A 4MZ8A 4QM1A 3TSBA 1K7FA 4ADUA 3CPRA 1UUOA 3PBWA 4IJBA 5LKYA 4R34A 3INPA 3WK1A 2C14A 3NM1A 4LY8A 3N73A 3L66A 2BLEA 5SWUA 4ZQOA 2E5BA 4PEKA 2ZTJA 3W22A 1QR7A 3ZWSA 1KM1A 2GVLA 3PC0A 4M5PA 4WX2A 1P1XA 1M5WA 3KVKA 3Q37A 4KWVA 1YPIA 1IGSA 3EWYA 4QITA 4M6PA 1Q6QA 1GEQA 3W7DA 5CGQA 1GG1A 2GJNA 3M16A 5LSMA 3QH2A 4HNNA 3KX6A 1SZGA 5EL1A 3PVFA 4M7TA 3USBA 2VKZG 1ADOA 2QEZA 1XL9A 3BO9A 4EVZA 3EXSA 5MHBA 1XUZA 4O57A 3T55A 3GDRA 3QEZA 3L68A 2YW3A 1X6UA 3QYQA 3BG3A 5DCDA 2VEMA 1IIHA 2OJPA 1OJXA 1BWKA 2DORA 3IGUA 2ATSA 4S1FA 4GJ1A 1NFBA 4PCFA 5HNRA 1QDSA 4IMDA 4FF7A 1OX4A 1K7EA 4NJIA 3E9AA 5HULA 4K39A 3UWQA 4QISA 4RCXA 3W1MA 3PS7A 4L4LA 1ZCOA 1NAL1 3JS3A 1PL9A 2GQ8A 1LM1A 3C8FA 5LNVA 4MLRA 4GUHA 1U5JA 5FF2A 3QSTA 3SZ8A 1H7XA 4ONVA 2B0MA 2HSAA 1J2WA 3DENA 3FS2A 4ML9A 1ALDA 2O7QA 5DN1A 1W0MA 4GNJA 3BGGA 2GVGA 2EGZA 1XBVA 5C5YA 2B7QA 1TJRA 3GR8A 1VLWA 3MJYA 1CW2A 1MSSA 4DXVA 1MZHA 3UY7A 4O52A 5CPLA 3LHUA 4Q33A 3PUDA 2VFHA 3N3MA 3NYZA 5E1QA 1X1OA 1WXJA 1JCJA 3DAQA 4JTSA 3TX9A 1I45A 3T78A 2TYSA 3GB6A 4PL2A 1KFLA 5J5DA 4A2SA 4IX0A 2GQAA 4JTLA 1WOBA 1RQHA 1OVDA 5FEXA 1G4SA 1VCFA 3B06A 4UFMA 1Q6OA 3QW4B 3HGOA 3PSWA 1X7FA 4BI5A 1LOLA 2ZRYA 3W71A 3C2RA 2CLIA 1PS9A 3QMRA 3M0ZA 4WUIA 1FDJA 4O4WA 3UYCA 4IGHA 2RHGA 3E02A 3O6YX 1BKSA 5D32A 2FFCA 4QNWA 5E93A 5AYZA 3BLEA 3R8RA 1NSJA 1VQTA 3N2XA 3W2KA 3I7RA 3EXTA 2PE4A 3DFSA 4M19A 5BMWA 4RR4A 5AB3A 5KMYA 2DZSA 2E6AA 4FXSA 4JR5A 2A7PA 2D73A 1C8VA 5FF0A 1QOQA 2WOQA 4K6AA 2QCHA 4PA8A 3TV8A 1X8FA 1H5YA 1MEWA 4Z08A 3W7CA 4KFOA 2ZZ4A 3TH6A 1I2NA 3EX4A 4O53A 4JEQA 1P5BA 5CG7A 1OYAA 1B4EA 3KXQA 4JS3A 1GG0A 4ORIA 4AVFA 1TTIA 4HIBA 1O4UA 3LB0A 2FB3A 4QIUA 1VLIA 3F1QA 1JJKA 1RQBA 4BI7A 1RVGA 3G3MA 4AEOA 2E09A 3EXRA 3YPIA 2ZA2A 3W1QA 2Y85A 1BWLA 4Z1BA 4N9CA 3W7MA 1JCMP 5I3HA 3CLMA 4IPJA 4CQAA 3L21A 1JR1A 3NG3A 2P10A 3FFSA 1ME7A 3MYPA 3DFQA 1N55A 4XWUA 3NPXA 5FF4A 3RF9A 2C0AA 2PRHA 4MLJA 2Q3OA 1WBJA 2FTPA 2NUXA 4JNMA 4A21A 2YPIA 1SQ7A 3O05A 2ZCGA 1D9EA 2QUVA 2GUUA 1QPOA 5TQLA 5ABTA 4FNQA 3UD6A 3P67A 4N6EA 3I7SA 2YW4A 2WO5A 1F74A 1PHQA 3CIXA 1N7KA 4XTIA 2ATMA 4MY8A 4WY0B 5AHNA 1LRNA 2YDAA 1R47A 3WK0A 4B5NA 3P5YA 5F4WA 3MP4A 4UFKA 1W3NA 4WXYA 4XQ6A 1J5TA 2YR1A 3LCHA 2CLKA 5HR7A 2Y7FA 1KBJA 2Y62A 4H6KA 1ZAJA 2V2HA 2RH9A 1ZALA 4GUGA 4MZYA 2EKCA 3GZ3A 2JKAA 3PUEA 3QRHA 4JY9A 1EIXA 5HWNA 2H8XA 3HB9A 1GVFA 1ZAHA 2CFFA 4UMAA 1TTQA 4MOZA 4UFLA 3THQA 2QJGA 4N4PA 1WDWA 2FB2A 3CT7A 3W6YA 1EP1A 1XKYA 1LOSA 4FNRA 3IGSA 5IBXA 1E51A 3W2LA 2HMCA 3MO7A 5D38A 5K3VA 4FIRA 3ABRA 3L2IA 1LBMA 5CZ0A 3B4UA 3FIGA 3FJLA 3OBKA 1IXPA 1H50A 4N4QA 3W7HA 3W88A 5DELA 3A9IA 4JDBA 5H91A 4UIOA 4UNKA 3VE7A 2CLEA 3RNDA 4BWLA 2CU0A 3TQKA 3HGRA 3OEXA 4BFAA 3P61A 3MMTA 1YTKA 1SW0A 2ZTKA 1I2QA 5D09A 4AWTA 3P62A 1I2PA 3W7IA 3ZS4A 1RQEA 3GDMA 4ZQRA 1KFJA 1OYBA 3UWUA 3W7QA 4ORMA 2GOUA 3UPBA 3HQ1A 1F6PA 5CPMA 4YMZA 1FCQA 1OYCA 4ZZ9A 3TFCA 5HUPA 4MIMA 1I2OA 2WNQA 3HIJA 4UTIA 3OHIA 4MFDA 1FCVA 3R13A 1YTEA 4LUJA 3TCEA 1A5AA 4OV4A 1YTDA 1V7YA 2QCMA 1G7UA 3V1PA 1MO0A 2RDTA 3CHVA 3KFTA 4Q4KA 3CEPA 1DHPA 4R7JA 3TFXA 2FPTA 4LNYA 1UASA 1UJPA 2J6XA 2RDWA 3WK2A 5FESA 2V9DA 1ICQA 4YL2A 1D3GA 1K8ZA 1W5MA 3FYPA 3O63A 4M7SA 1F5ZA 1HO4A 3IVUA 1XI3A 3FJ6A 3LTYA 2VFGA 1F05A 3A22A 4UMCA 3B05A 2CLMA 3NQFA 2YYTA 4AWSA 3DBPA 1F7BA 1OFDA 4FNTA 2DP3A 3BK0A 4GE8A 1EP3A 2CZ5A 1VGAA 3GYEA 3T40A 2VFEA 3CB8A 1AW5A 1HO1A 4HNUA 3STGA 1O94A 4JICA 4RV8A 5HINA 3IGXA 2E1DA 2V5BA 1Q3NA 3LCLA 3QC3A 3UNDA 1KTBA 4ZQMA 2ISVA 3I7QA 3RMJA 2BZNA 5BW6A 1QPRA 2AAMA 5T26A 3SW6A 3KVJA 4X3ZA 2YX0A 1QPNA 4Z1AA 4AF0B 4WJEA 3TKFA 4UUIA 5AOUA 2XN1A 1TV5A 3M41A 3NVTA 3LRKA 4K37A 1FX6A 1H60A 2EPHA 1OFAA 1KTNA 4JXCA 1JCXA 3LXAA 1PV8A 3IV3A 1K7XA 1TPUA 4N9BA 2QJHA 2DU2A 3DFNA 3GAYA 1SZNA 1DKWA 5L6UA 5HWMA 3T7VA 3W2NA 1EPXA 1GZGA 2Y7GA 2GJLA 2OX1A 4EF8A 2CLOA 4NNAA 4L4MA 3A5FA 1SFJA 1P0KA 3M5XA 4NNBA 4O28A 1N8FA 2YFNA 1Q6LA 1QNVA 1VYPX 2NWSA 1W5OA 2JGYA 2NX3A 3M9YA 1WV2A 2FQIA 3KHJA 1T96A 4UR8A 2A0NA 4HT3A 3EX6A 3EKLA 3P74A 5CSSA 2ZZ3A 4BR1A 2QCDB 4WD0A 5F4SA 1JQXA 3G1XA 2ISSA 3IVTA 1QAPA 4ZQCA 4LUIA 4A22A 3W75A 1R2TA 3LOTA 5K4ZA 4EF9A 4LC8A 2G5WA 3PG8A 2YGYA 3KRUA 4JYFA 1YYAA 1YPFA 5A5WA 4NX5A 4AH7A 4WXZA 2F7FA 3GAKA 7TIMA 3WJWA 1WAUA 5G4EA 3STFA 1NF0A 2WKJA 2BSLA 3SFKA 4E0CA 1TRIA 4AWUA 4OHQA 1L6YA 3R89A 3NQ8A 3SI9A 1SSGA 2C3ZA 2VC6A 3NR0A 2Q8ZA 4HN4A 3UXAA 2J9XA 1JVNA 2V2DA 3STEA 1PHWA 3SIZA 2C6QA 1GVSA 4O16A 2J88A 3T4CA 3ZR4A 3LRMA 4JX6A 5D2YA 4LVAA 3HPZA 3W76A 3LI1A 3B03A 5I3GA 1JUEA 3TC6A 3MBDA 1OK6A 3PB2A 3BG9A 1O95A 2B7OA 2XN0A 3HMJG 1XUUA 3VFLA 4MYXA 4DO5A 4TMBA 3W1RA 3WJSA 1UBSA 3HG2A 5E0KA 1QPQA 4DF1A 3HG4A 3W7NA 1FUYA 1GQNA 3OG3A 4JTUA 5FEZA 3HGJA 4Y96A 2Y70A 4IMFA 4AMAA 3HOJA 2GVJA 3M47A 3RLUA 1LYXA 1EX5A 4DO6A 2O7SA 3LHWA 3VCRA 3G1DA 5K9CA 5D30A 3L0NA 3HG3A 4ADTA 3DFOA 4OWGA 3M5ZA 3DI0A 1R46A 3N2MA 1VJIA 5KITA 2WPBA 1LBLA 3PF3A 3MI3A 2V2CA 3LV6A 1SO3A 1H7OA 4PH6A 2IQTA 1BTMA 4GFSA 3SGUA 4UFHA 2HS8A 2ZYFA 4O1AA 3A21A 3PBVA 5FF3A 1SO6A 2YZRA 4RZ5A 3NDOA 4GRSA 4HNVA 1O5XA 5U7SA 2GPTA 4Z1CA 3W7EA 2VEPA 2ZZ2A 4DBDA 3BLIA 4CCEA 2QCNA 1FDYA 1V5XA 4O1CA 1W8SA 5D2WA 1KTCA 3NL5A 4Y6GA 3QF0A 1EA0A 4O10A 4Y9AA 1G4PA 4JYEA 4LS1A 3Q94A 4E2BA 1AW2A 3NZRA 1GOXA 1KM4A 3P7YA 1KFCA 3C6CA 3RLVA 3TR2A 4QNEA 4JGDA 4M6QA 4S2CA 1AW1A 4LW7A 3C0JA 3HG5A 3R5EA 1ML1A 2KZHA 3BV4A 1I8JA 3IIPA 2QDGA 4Y8FA 4BF9A 1TV7A 4HSOA 4ALDA 3BW2A 3C4UA 5BRBA 2ZRZA 2PC4A 4JYDA 3HGSA 1Z42A 4MJZA
chains in the Genus database with same CATH superfamily
2WSKA 3EDFA 3PY2A 3ERPA 3G6LA 1DWGM 5J5RA 3IJ8A 3DC8A 4MYAA 4AHQA 3KRSA 3NA8A 1QI4A 5GJMA 3B9EA 3BW4A 2C71A 2O92A 2ZRUA 3PFRA 2BNJA 1IXOA 2ZFAA 1R3WA 4I3GA 4IP5A 4I7WA 3GUGA 4ZTYA 4IL0A 5BXRA 2DT0A 2XDFA 2XN2A 3LBMA 4BK9A 3MWAA 3Q4DA 4X0VA 3LBCA 1QI2A 3O07A 5F2IA 2WVSA 4J40A 3E38A 3WY1A 3JW7A 4BCEA 3HJZA 1ICSA 1KV5A 1ZNNA 3V3WA 4Z2GA 3TCSA 3ZQ9A 3VKKA 4ZVJA 1BAGA 3PK7A 3VNJA 3L0KA 6TIMA 1Q2RA 3H2CA 3T0BA 3UVIA 4E4UA 2BMBA 4IFKB 3S42A 5BOEA 1ZJBA 4A3UA 3RMEA 2VGGA 4HTYA 4OBRA 3M0YA 3WQ8A 3FXYA 2HVMA 1S38A 3HPSA 1P1MA 4KWSA 2FPYA 1CGUA 1I0DA 2HNHA 1XDMA 1ZJIA 3L12A 4QJ4B 1PZ3A 2WC4A 1Q5MA 1XYZA 3EA2A 1DBTA 5D2VA 1QMLA 3RJYA 1PKYA 1I75A 3GBEA 2G37A 3LDVA 3E0IA 4GBDA 1KW1A 4QJ5B 3XISA 5LGXA 4MUZA 1GKPA 4FHAA 8XIMA 5C6MA 1DWIM 4WY0A 3PAOA 1QCWA 1W1PA 1HQTA 5E0FA 2RJGA 3M0LA 4GWEA 1I4NA 1THFD 4DBUA 4W5ZA 1VF8A 1OEPA 2I14A 2Q8XA 1IR1A 3GUWA 3NAVA 2PEVA 3E49A 4ZODA 1PJ9A 4U28A 1WDDA 4KCTA 2EHHA 5IM51 2D69A 1PWLA 2V3EA 1HUVA 1XISA 3TTSA 3AIUA 4GUIA 4UXDA 1GVRA 3H4GA 3CTLA 4EOUA 1XSJA 3CQIA 3M0MA 2HZGA 2NT0A 1D3HA 2HJPA 3T42A 3H2NA 2Y89A 5A8GA 3T44A 3MT1A 5C0QA 4DELA 4S39A 1EO5A 1SFTA 4Y7EA 1L8PA 4DBSA 1QOXA 4WSJA 3D3AA 3W7KA 1DXIA 4XZIA 1FQ0A 4HK5A 1TMHA 2WSRA 5CC6A 1DJWA 3TMLA 2I9EA 3OVGA 2BWGA 1R85A 3UPWA 1W1ZA 5AHLA 1PTAA 3UJSA 1BG4A 4O0KA 5A8PA 3B3DA 1BVWA 1OC5A 5DLCA 3TOPA 3UR2A 2ZRXA 7REQB 1Y5WA 2E5CA 2QMJA 3UQNA 2VZOA 4JOMA 2GLKA 3SFWA 3W73A 3IIXA 2G3NA 3SCTA 4Q8TA 3TNOA 1UKTA 1VBRA 3R2GA 3THCA 4JDYA 5TBOA 3SQMA 3OP2A 3QV7A 4H8HA 2J6VA 1VS1A 4XD5A 5FF7A 4GFIA 4NZ3A 5D02A 1R2RA 4OQVA 2YDSA 4HTBA 2Y7EA 1POKA 2PCQA 2HK0A 1UR9A 4P8VA 5F1UA 2Q01A 2Y7DA 4O14A 3F4WA 3L5AA 2YL5A 2WNZA 4J1OA 4OJYA 2P1FA 3CUFA 4JFVA 3H4WA 3VGEA 1Q6GA 4XIMA 2YIHA 1H61A 4IMEA 3GNRA 3C2FA 2V0TA 2FGZA 2WMGA 1HJQA 2DZAA 1JRCA 4GNKB 3SGGA 5CGMA 3TYAA 1MW0A 1FFRA 1S5NA 3T2QA 3VNLA 3FGCA 3VIHA 2ZXAA 3QM3A 1QNQA 5AYBA 4X2PA 3T81A 3EX3A 5HQEA 1W3IA 1KNWA 3I3BA 1JQVA 4HZ6A 1UUMA 1EJTC 3FCPA 4Y2WA 3WBYA 1VPQA 1XH0A 1OINA 4NYUA 1AZ1A 2DVUA 2IPFA 1DJIA 3ATZA 1EXPA 3PZIA 3LEPA 1XGZA 2CNCA 4YVPA 4NJKA 3O3RA 4DJDC 1F76A 1LRTA 3CB3A 2NQLA 3CTTA 1EL3A 1TUFA 4R53A 1J8VA 2PTXA 1BF2A 3BZJA 1XICA 2D2JA 2WCSA 1TKKA 2IPGA 4Z0SA 2P8BA 1XLLA 3GTHA 1JCLA 4H3DA 4QLKA 1O68A 1U33A 2BP1A 4LCRA 3PBYA 3H2OA 1EEPA 2C79A 1L2UA 4K7VA 1E56A 3BLDA 3ITVA 2CWNA 4PUEA 5FI8A 4CCCA 3MI2A 2BVTA 1US3A 3WLHA 3PN8A 1CGTA 1JYVA 2CLPA 4OFCA 5D9OA 4BWLC 2IXVA 2OT1A 3IRSA 1WZAA 2QJNA 4WKAA 1QNRA 1ZGDA 4PTMA 3T0TA 4I5UA 2OGJA 3GH4A 5LNSA 1HT6A 1W37A 1WP6A 3VD3A 4FX7A 1KM6A 3HPFA 4ZE4A 5KZEA 1WUEA 4D9PA 2PDJA 3L5LA 4GVHA 1N8WA 1VR6A 5AY7A 1QWGA 5G1TA 1OHLA 3C2EA 3VUSA 3G1FA 3ARRA 3L0GA 4LBSA 5K4XA 1P0NA 4DWSA 1P7TB 1CLKA 1JZ6A 1VYRA 3WF2A 4ENLA 1G0CA 1GOKA 2DIKA 1QK2A 3H54A 4PEEA 3LERA 1JPMA 3TE9A 3HV9A 3TWBA 3V75A 2XINA 1RBLA 5JUVA 1LBFA 1X98A 4O1DA 1DJQA 2JQXA 3VZXA 2TSYA 5EPDA 1L0PA 3C3NA 3WLQA 4MF4A 5FJIA 3ZLFA 5HATA 4K8HA 2PURA 4AD3A 1M68A 4NJGA 1Z44A 4PGLA 2RDUA 4MWAA 3PB0A 3VPLA 4N2YA 1Q13A 2A7RA 3VX0A 3MB9A 3LM7A 2ALDA 4IPIA 3M5YA 2WLZA 4LF2A 3L4VA 4M1RA 2RGLA 3GH7A 2EJ1A 1GWJA 1OBAA 4AG0A 1A0EA 2YCEA 4PBEA 1YE4A 1OX4B 5C2XA 4MB5A 4LF1A 1Q6FA 4GXWA 5HQMA 1DJXA 2ZA3A 4C1NA 3UXKA 3FLUA 2ABAA 4N9EA 5E6YA 4UTMA 1F2JA 4XKMA 4MY9A 5A6TC 3DKLA 1OM0A 1N82A 4ZOEA 4DZHA 4JIHA 2J7GA 4JTRA 3BMWA 1EJXC 3H70A 2LLEA 4INFA 3AHZA 1QI0A 5IRPA 1FP8A 2R1LA 4JN8A 3GO2A 4KQNA 3EMQA 1X38A 3KL0A 4YYFA 4YN5A 3ITOA 2MNRA 5I07A 2XFFA 3E74A 1R8LA 3LTPA 3S46A 2YL9A 3CYJA 1Q6EA 1ZLPA 4UR9A 2QYGA 4LY4A 4B3LA 4O1EA 3PUOA 2E68A 3UWWA 1IYXA 4DYKA 3GVVA 1UOZA 4XZWA 4YS1A 2AL2B 3VA8A 3GIYA 5I09A 3BAIA 4FO4A 4K38A 4BQ4A 1OC7A 1ZZMA 4V1XA 5BCAA 4PSPA 4K36A 2PBGA 3RYSA 2NX9A 2BB0A 3LPFA 1PX8A 2WNNA 3ONBA 4Q4PA 4QE5A 3N3TA 3VOCA 2FH8A 5KEZA 1OF8A 2PDFA 2YBTA 5AVHA 1G6CA 1K6WA 4PCTA 3R25A 3LG3A 3WFLA 2OLHA 3LV5A 2J78A 4CEXC 1XM3A 1H63A 3WH9A 2Z0IA 1UA7A 3PFMA 4I7UA 3KS5A 5GVJA 1ITUA 4GO8A 4U3CA 1UR4A 5EU9A 4LAOA 1HKIA 3CWOX 1QNSA 3WLPA 3MPGA 4RK8A 3LSCA 5F2LA 3DI1A 4NZ5A 5BWAA 1ZS2A 1TPVA 4AB4A 3WUBA 4O19A 3MSYA 1NJJA 3TXZA 7TAAA 4PL1A 1YE6A 4IH3A 4IQJA 3ZM8A 3MVTA 5ABEA 4NUWA 4GI6A 4DAIA 1CXLA 1K9TA 2ZUVA 3A23A 1JCYA 2WBKA 3OA3A 4H9UA 1QASA 4LQ1A 3VD9A 1BYDA 4JIPA 4YHGA 5JU6A 3UZ5A 1ZAIA 3M43A 4AZCA 1ZBKA 1JYWA 2J9YA 1LWJA 3EX1A 3EOUA 1VRDA 4EAYA 2VX5A 4HPGA 3A3WA 2J9ZA 3NGFA 3GX9A 4J3VA 4I6VA 4AZGA 2HE5A 1TUXA 3WUFA 1KM3A 3GDTA 3BW3A 1MZRA 2OB3A 3CL8A 2G4JA 3VU2A 4AWEA 1P0DA 1E6RA 4LAMA 4PMYA 1A5MC 1H11A 3BPWA 1HJSA 3H2MA 3KS6A 3QOKA 3UWEA 1CGYA 2W9MA 1W8GA 1ZCCA 2CETA 2IS7A 2Y5JA 5K7JA 4R33A 3W7JA 3P8JA 1B1YA 2ANUA 2HVOA 3OB8A 2Z26A 3WEOA 3PPGA 1K02A 2H3DA 3RO6A 2QPXA 2W27A 1DE5A 2XWEA 4OUIA 4V28A 3THAA 5D04C 4YTSA 3S1UA 1I1XA 4ZOCA 1C93A 1GYLA 1S3HA 1BWVA 4PSRA 3W85A 4DYJA 1ISZA 5FOOA 4C90A 3ZIZA 1WQ5A 4I9AA 2VENA 4DVOA 3GW0A 3VNKA 3O8AA 1T40A 2EG7A 8A3HA 4HU0A 2WQDA 1EYWA 1GUVA 3L67A 1FWNA 2WMJA 2OYKA 4NZFA 3GTNA 1RUSA 2Z27A 3OHMB 2WSQA 1GJUA 3BARA 4TVUA 4GNVA 4LGXA 3PSVA 3GG8A 4C1LA 3ES8A 4ROPA 5I5RA 1X7IA 3OIXA 1GTHA 4CCZA 5KZMA 3F4CA 4JTTA 3BLFA 1R87A 3E12A 5DF0A 5H8UA 3WUEA 4QG6A 1C90A 5EMYA 1TA3B 4JIQA 3APGA 4W5UA 4RXGA 4WLCA 1C8QA 3ZMRA 3GVWA 4DPPA 4AY7A 3OVQA 5EFFA 3QLLA 3WMLA 1QHOA 2UY2A 1RK6A 1PBGA 1DYSA 1IHIA 3CMGA 3IK2A 2HBVA 1XGDA 3W1NA 4IIHA 1T0OA 3AWNA 3UY8A 3QR3A 1ZP4A 2YCLA 3H2EA 3BCDA 3K4AA 4M24A 3SECA 1OFQA 4RPQA 3LI0A 3H26A 4M6VA 4CQDA 3MO4A 4GH3A 1PZ0A 3IRDA 3OA5A 2I1OA 4E2OA 1SU5A 3H12A 4MDOA 2X0HA 4PTNA 4GY0A 1VFFA 1W54A 4O50A 3W81A 1DXFA 1G7VA 2C1HA 4ZSUA 3VYLA 2E5DA 1HG3A 3GFYA 3WD4A 1FWBC 3CV7A 4IX2A 4NT0A 3CJPA 3W27A 2QVNA 2Y1HA 1UMYA 2C0HA 5D33A 2Z28A 1F73A 2ODOA 2Q71A 4LRTA 4V2XA 3CZLA 4UMBA 3NEVA 5TF0A 1E9IA 1KLZA 2GVYA 4EWND 2BG5A 1Q6RA 4FNUA 1XHGA 3BL3A 2WMIA 3ARTA 3CQ0A 2Z6JA 1TWDA 2HCVA 1FWHC 4MTVA 1RA5A 2NLIA 1PPIA 2NQHA 4UTLA 5HMSA 1FBAA 4B91A 3QN3A 2ICSA 3OU8A 3TROA 1A5LC 3BOXA 1MYRA 3G0SA 3QOMA 1KFBA 2Y2WA 3BMVA 2YDRA 5HANA 3LLDA 3ZOAA 3CH9A 2HK1A 1NF7A 8CGTA 4HPNA 4JFSA 3KAOA 2V38A 5XIAA 3T07A 2XWDA 1UC4A 5K9DA 4EAMA 4HCHA 2W0UA 3QQ0A 2PBOA 3RO8A 1YHTA 4MB3A 2G95A 2PODA 4GJIA 2CBJA 2FVLA 5D2XA 2FMNA 2PRLA 4Y9MA 1EKOA 3E5BA 4GY1A 4CD6A 3TSBA 5IHSA 1ZJAA 3PBWA 3INPA 1XFCA 3K8LA 2X42A 2GGIA 4XZHA 2WVUA 4CEUC 1V0NA 1XLFA 3ZWSA 2XUCA 3PC0A 4WX2A 1P1XA 3KVKA 4KWVA 4N42A 1KWKA 3RM4A 4M6PA 3F4DA 3WD3A 1UWIA 1HZYA 4P7LA 1GG1A 5LSMA 4HMNA 4MGGA 3MA8A 3L4YA 1SZGA 1XIMA 2D1ZA 4DWSB 1ADOA 3BO9A 2PDPA 4RW5A 1IWPA 1XUZA 1QHPA 5CPTA 1IT0A 1MQPA 3R10A 1V79A 2X0SA 1EF2A 2ATSA 5FCZA 5HNRA 4AY8A 5C8BB 1K7EA 1EJWC 3PPCA 4NJIA 3E9AA 4IFRA 1W32A 4EACA 1BPLB 3CYVA 3W1MA 4Q8OA 3PS7A 4L4LA 1ZCOA 3JS3A 3KCOA 4Q7IA 4HD5A 1RY8A 2D22A 3IV8A 4IPLA 4OTKA 2DGAA 3DN5A 1BQGA 1QVBA 1PZ1A 4QG9A 1TJ1A 4L9YA 1H7XA 4MWAB 2B0MA 4KIEA 4DUXA 3RG6A 2Y8VA 2XG9A 2O7QA 1BVZA 5DN1A 1QBAA 3T2OA 2GVGA 3W82A 1UR8A 1NFPA 2HE8A 1KCLA 2EGZA 3S2NA 1XBVA 1BF6A 2B7QA 4KWOA 1TJRA 2ZKMX 5ENLA 1VLWA 3MJYA 5A2BA 2CITA 1DPMA 2NQZA 3NUKA 3AMDA 3UY7A 4CKQA 4S3EA 3BCJA 3LHUA 5LIXX 4K3ZA 2PLKA 2GJPA 5GJPA 2OSXA 5HJXA 1OT2A 4LEQA 3R94A 2XH7A 4JTSA 1V6TA 1I45A 1MQRA 2TYSA 3GB6A 3IS4A 3U5YA 5J5DA 3CLWA 6A3HA 4IX0A 2ZADA 1RQHA 1N8IA 4UFMA 3UEQA 1EDQA 2ZRYA 2CLIA 1XQKA 1FDJA 4WDUA 4IGHA 5B7YA 2VVSA 4XISA 4RE4A 3TYDA 1R3TA 3BSMA 1XPGA 5E93A 3BLEA 2PMQA 3N2XA 4B9YA 3W2KA 2JIEA 1PTGA 1HKKA 3RPDA 4PZVA 2PE4A 3F5LA 3CIVA 1E71M 4JR5A 2A7PA 4KT2A 2NQJA 1C8VA 5FF0A 1QOQA 1D2KA 4K6AA 1KKOA 1H5YA 1I2NA 4V1YA 3V36A 1F4AA 3ICJA 4BF7A 1P5BA 2ZUTA 9CGTA 4EKJA 3AMGA 4HIBA 5ABFA 4FSAA 3WELA 2FB3A 1VLIA 1JJKA 1E4LA 2OWWA 1DTNA 1MXGA 2VD8A 2VR5A 3OBAA 4PUJA 2EPLX 2KAUC 1GORA 1ZRQA 2ZX6A 3SY1A 4Z1BA 1Z89A 2OZTA 4ZE5A 3CLMA 4D6IA 4C6FA 2R1PA 1B30A 1JR1A 4ICMA 3NG3A 3GTIA 3F2DA 5JQ9A 2XIJA 3MYPA 3DFQA 4HOXA 4S38A 2ZWZA 2C0AA 1B9ZA 4NAFA 4G2DA 3WQOA 3EMZA 1SQ7A 1R0MA 2DQWA 1GVEA 1X8CA 2QUVA 5ABTA 4FNQA 3UD6A 1C9WA 3P67A 2W3ZA 2WO5A 1PHQA 4AQLA 4H7VA 4BS0A 4MY8A 2BY0A 4RNFA 1LRNA 3UZWA 2O9PA 1AQFA 3TJ4A 3EAUA 1GOIA 9RUBA 1UKQA 2FZ9A 4UFKA 4GIRA 3M0KA 1YQ2A 3GHTA 2PDLA 2Y7FA 1KBJA 2J7FA 1AJZA 2PU0A 4HMCA 1YNQA 5HQLA 4MZYA 1E0UA 3U4FA 3ARXA 4WDXA 3EDEA 1GHRA 1ZAHA 6REQB 3PTDA 1RXOB 3THQA 4AX6A 2AKMA 2AMGA 1EP1A 1NU5A 2VWSA 5IBXA 4CNSA 1S1PA 3L2IA 3RPMA 4AZ7A 3B4UA 3VKAA 1RP8A 3FJLA 3OBKA 1IXPA 4N4QA 3W7HA 1HX0A 3WCZA 1W9UA 4Z2KA 2P3EA 5H91A 4YU1A 1U2YA 3AZSA 3RNDA 2CU0A 4DRSA 3P61A 3DG3A 3MMTA 1OG6A 2ZTKA 1B54A 4FA3A 3T08A 3GHRA 4IP4A 3KBSA 1ZQ5A 4QHRA 5BXTA 3A4WA 3GU2A 3BICA 4A8NA 2AGTA 3S1GA 3A64A 3SADA 3NYDA 5M5DA 2PTWA 4U2YA 3UPBA 3HQ1A 1BVNP 3VILA 3VNIA 5LIWX 5A95A 5HUPA 4MIMA 4XZBA 4BQ2A 4HJWA 1CXHA 5HJYA 3OHIA 2JEQA 1FCVA 3R13A 1YTEA 5HAOA 1LT8A 4YHEA 2VR4A 4HYWA 1YTDA 2QCMA 4UOJA 1NQKA 4Q4KA 1W9XA 4EX4A 3TFXA 4GLEA 4LNYA 2RJHA 2J6XA 2OU4A 3UGVA 3BAYA 1D3GA 3LGGA 3FYPA 3O63A 4M7SA 1F3WA 4H8VA 1M04A 3LTYA 2OWXA 4HU3A 4UMCA 3B05A 4AWSA 1V3MA 3B8TA 2DP3A 4GE8A 4XD6A 3T40A 2ZUNA 2VFEA 3SJNA 2HBXA 4ZTXA 1HO1A 4MHBA 4ZOBA 1QUMA 2FMOA 3HZ3A 5I6SA 2V5BA 3LCLA 3W53A 3WO8A 3EGJA 4PCNA 4W93A 1KTBA 2J66A 2BZNA 1QPRA 5TD4A 4ROQA 2WYSA 2YX0A 1QPNA 4Z1AA 2X7VA 3THUA 4WJEA 1UH3A 3OGRA 4CD5A 1TV5A 3LRKA 1XIFA 4FR6A 4IMAA 1UD3A 1PB0A 3N1AA 1H49A 3C0SA 1V02A 1X6LA 4JXCA 1JCXA 1XF0A 3LXAA 2RUSA 4M6UA 2EEXA 2QJHA 3GAYA 1DKWA 4ZENA 3W2NA 4GIAA 5M17A 4GQQA 4XVDA 1FWAC 5FD0A 2CLOA 3QHOA 4EXAA 3JVAA 3FDGA 1P0KA 4NNBA 1J0KA 3OZOA 1Q6LA 1UKPA 4Q8UA 2POZA 3WQVA 2P53A 3PZGA 2XIOA 1Q7ZA 3DESA 1E6XM 1RJRA 4L1XA 1GKQA 2WANA 1T96A 2VR2A 1I60A 4KWUA 1OC6A 3H7RA 2ZZ3A 2GSJA 2VUYA 2WPGA 4WD0A 1DIDA 4PMVA 3IVTA 1PEZA 2YL8A 3UA3A 2O9TA 1R2TA 4A8LA 1LL7A 4LC8A 3DYPA 3KTXA 1PKMA 1IZKA 3JU2A 3GVRA 3URAA 3AS2A 1M53A 3ANVA 3UG5A 1NWRA 4AH7A 4WXZA 2F7FA 3WJWA 3SCPA 2YZ5A 2BSLA 3DHUA 4E0CA 1L6YA 4PB3A 3NQ8A 4V33A 2QGYA 3U0HA 2C3ZA 3NR0A 4HN4A 2V2DA 1BRLA 3KP1A 3ZR4A 4WSKA 4PUNA 1JPDX 4ZFMA 3HPZA 3W76A 1FWEC 3PJTA 5I3GA 4G1NA 4AD5A 1O95A 3MWCA 3SCWA 1X97A 3VFLA 3VM7A 4DO5A 4GI4A 4GA8A 3WJSA 2WKLA 4H2CA 1CXEA 1GQNA 2ZXQA 4L65A 3HGJA 4Y96A 1HVXA 1E3XA 3LLXA 4AMAA 4DUVA 3HOJA 2OSWA 1KRCC 3ARSA 3MKVA 2BOEX 3G1DA 4W8LA 3B97A 3DFOA 1CGXA 2XVLA 2ZUWA 1VJIA 1LBLA 5I2UA 3AFBA 1SO3A 4HNCA 1BTMA 4UFHA 2VT0A 3A21A 4RDZA 4EPBC 1HKJA 4JKLA 2YZRA 3A4XA 3NDOA 4HNVA 3T0CA 1C8XA 5GNYA 4Z1CA 4LBUA 2AQVA 1TV3A 4CCEA 2QCNA 1V5XA 3B8WA 3W0KA 4HZ8A 3D5HA 2E40A 3WQGA 1EA0A 4WF7A 1G4PA 2OELA 4GH1A 1AQMA 1BYCA 4QNEA 3RU8X 1ML1A 2WNWA 2KZHA 3ARWA 4FS9A 4EANA 1I8JA 1QI5A 1A5OC 4BF9A 1I0BA 1TV7A 3OO2A 1K9EA 3AMLA 2ZRZA 4JYDA 5DRCA 4JQ1A 4LVGA 1E73M 1K6AA 4UCFA 3B9NA 4WHBA 4LU0A 4QEEA 3GDBA 4KPLA 1GVOA 3WH8A 1LRQA 4ASTA 3SGZA 4FAMA 1DP0A 3N2OA 3W3OA 2UY5A 3M6YA 1M7XA 3JZEA 1HW6A 4C6EA 3UFYA 4P8WA 1B31A 3QZEA 1LP6A 3ISIX 5AHFA 2A2IA 1OFPA 3ABZA 4AC7C 4D1IA 1O12A 3QPZA 2POTA 3MCOA 2NUWA 2PLJA 1JYXA 3NWRA 4LYPA 1ZFJA 3GNPA 3FJ4A 3CZGA 1XLDA 2FJUB 3V1HA 4AVOA 4DJED 3QV8A 1ONXA 4O12A 4HNTA 2Z1KA 3SEPA 1J9YA 2HEJA 5DX7A 2BGSA 3IUIA 4X63A 3DFPA 2QAPA 2B81A 3BJSA 1FH8A 1VFOA 1NTHA 1XLMA 1E1CA 3S6DA 1U83A 2O4MA 1UP0A 1GYNA 2XH4A 3GNDA 2GQ9A 3WH6A 4JTIA 3W23A 2XSAA 4JY8A 2A3BA 1S2CA 3VKDA 3WNPA 4DB7A 4DPQA 2NX1A 2V69A 4JQ2A 3CAWA 2V63A 3W1AA 2VURA 3VZYA 1K9DA 3GVGA 5DANA 3WF3A 5E0CA 1IT8A 4CNPA 1QT1A 4PUKA 3JRKA 1VZWA 3U48A 2DVTA 1SVDA 4MPQA 1FY6A 4FR1A 3LGEA 2PRMA 4LCQA 4ES4A 4H9MA 5LZLA 3WLNA 3IEBA 4JTJA 4UB9A 2PD9A 3ZSSA 1GOQA 2X2YA 3EDDA 1QFEA 1FH9A 1G4TA 4A29A 1T8XA 1D3CA 4ILSA 1F6KA 2D24A 3EB2A 3R0KA 2VZSA 2HXUA 2J47A 2PWHA 1KCZA 1K8YA 2PGRA 1V0KA 2WZIA 4HB7A 3TW7A 1KA9F 4A8RA 3U6WA 3VDCA 2QCLA 1QOPA 2A4AA 4NXKA 2VL4A 4YXGA 2R1NA 4LUYA 2GFTA 3NQ7A 4P7OA 3S9YA 1A5BA 2J74A 1GZ1A 2HXTA 4FXFA 3VUPA 1U22A 1FDZA 5F2MA 2C8NA 3TC3A 1T6MA 5DXXA 1AFSA 3CZ8A 1E4IA 1UD5A 1OSEA 1TMQA 2O55A 2ZVRA 2DUAA 1YADA 4GD0A 1TE6A 3NQCA 3QGAC 4F0SA 3DG7A 2DEPA 4XZ9A 5BOOA 3T05A 1WKDA 1X1ZA 4LRSA 1QO2A 1BEUA 4YCPA 2D2GA 3G8EA 1TX2A 3REQA 3PP7A 3ZZ1A 3QKEA 2OZ0A 2HPMA 4S3GA 1A0DA 3UXDA 3K2GA 3DU0A 4K7YA 3VGGA 3AXIA 1UQYA 2E6FA 2UBPC 1MUCA 1UCWA 3HPXA 2VFDA 3EWCA 5JH2A 3PJXA 3EOEA 2F84A 2PWVA 1JFHA 4QJ1A 4REQA 4ML4A 3VX1A 4P8UA 4O8AA 4TOQA 1FFQA 3GR4A 3ZJ8A 1VCVA 3CS2A 1H0GA 4UTTA 1KM0A 4C6NA 1C29A 3SDOA 1EHAA 3TQVA 2V6AA 1VJZA 2YXGA 4KWWA 3D0CA 2DJLA 3RDKA 2IPJA 3PBUA 1GT8A 2WC7A 2DSWA 1PAMA 2ACSA 3CAKA 1PCKA 4KFPA 3VINA 3CUHA 4W88A 3R11A 2GK1A 3A12A 4R88A 1MXSA 3AROA 3UU0A 4IMGA 3QFEA 3UESA 4LUTA 3M0HA 1LWIA 1CWYA 2NXGA 2J13A 3WJYA 1F61A 1MEHA 3P0WA 1VAHA 3N2CA 3OTRA 4IF2A 4PMUA 1W5QA 2XVPA 1MNSA 4Y8EA 1IEXA 2TRSA 4MNMA 3GXIA 2OGYA 5C9ZA 1H2JA 3I6RA 3WFAA 3BLKA 4UQDA 1WCGA 3CL7A 1T99A 3VKJA 3A4AA 5AYYA 4UFJA 5FL1A 4Z2JA 2BBFA 3N14A 5JBFA 3KOFA 3KTSA 4IOTA 5GNZA 4OGZA 3RX2A 2HVNA 2CBUA 3SY5A 3NPVA 1OX5A 4S3AA 2VELA 4QRNA 3AO0A 1VC4A 3B4YA 2IKJA 4YTQA 1UH4A 1G69A 2E3ZA 3KBWA 4I7VA 4PODA 2XGBA 4TUFA 5KTLA 3MW7A 1BYAA 2W6RA 4L1GA 3ZFHA 4XVEA 3NQEA 5BMXA 3PWIA 5E9XA 2PDUA 4C7FA 2I9UA 1ME8A 3POCA 3SRKA 1AA1B 4E38A 3I10A 4DY1A 3V5OA 3FA4A 2ESCA 2W92A 3MU7A 3MUXA 5D03A 2H90A 2VTFA 4TX8A 2XISA 3T8QA 3ZJKA 2REQB 4DUOA 4LTSA 2PWDA 2PDGA 4GO9A 2OKOA 3BAKA 3O2LA 4J3UA 3EKZA 3CQHA 1TV8A 2C19A 3FJNA 1KXVA 5MF5A 1A49A 3PULA 3S9IA 3GFXA 5A6BD 1UB3A 3VKBA 3TYEA 3QZ6A 3W84A 2ZQ0A 2V81A 2PWFA 3KOYA 3CV1A 1ONRA 3LZ5A 4XAYA 5FSEC 2ZZ5A 4OV9A 1W9BM 4JHZA 4O15A 1B3YA 3IIVA 3CAVA 1K03A 1K4GA 4XV0A 1RSCA 5G2WA 1VEMA 4ZB0A 2ZA1A 4DNHA 1JRBA 3P60A 2P50A 2YB4A 1WDRA 2PDMA 4DXXA 3IAPA 1R86A 3R6IA 2Y63A 4JX5A 2PP1A 1V3HA 1KRAC 2OSYA 3EWZA 5HPOA 2DPEA 3MP3A 4HPHA 4O4VA 4B5VA 3VAVA 1UR1A 5BNKA 2FZ8A 3A3XA 4J9JA 3BWWA 4DJEC 1M1BA 4NRRA 4D6FA 4XG1A 3K5XA 2BY3A 3ORWA 1E70M 3C52A 5CZTA 1DORA 3N17A 2Z4GA 1VB9A 1W2VA 3S1XA 2IUZA 1BRLB 1MRQA 5C9UA 2GQ3A 2CIPA 6ALDA 2WQPA 1XRTA 1CTNA 3B9DA 1XIGA 3VZZA 2G3MA 3UR5A 3CPUA 1JGIA 1GOOA 1PDZA 2Y61A 1A5UA 1CXKA 5D9MA 3L5MA 1RPXA 1Q7MA 4PUWA 4MVAA 3SSZA 1QW8A 5A1AA 1YXCA 1GJPA 3M07A 4CQ8A 3AJXA 1TJ0A 1VIWA 5E9AA 3DEQA 3LCFA 3WFZA 1JXKA 4FIQA 4I5XA 2IKHA 5T9CE 4YYCA 3WQDA 1UJQA 1D7KA 5FAGA 1WX0A 3TTYA 3KE0A 4Y90A 4BQ3A 1DEDA 4FI4A 4YVVA 3CNYA 4JFUA 4Q4MA 4NNCA 3IIOA 5CC5A 3VE9A 1ZB5A 3E0WA 3VI2A 2YBUA 1XGEA 5C70A 2QDHA 1BXBA 3VGDA 2PLCA 2PTDA 2J27A 2VO5A 3F7JA 2PSNA 1UZDA 1KV8A 3A3HA 1XYAA 4O1BA 5CC3A 4DF2A 5F1VA 3EBVA 3GW3A 2E67A 2VEFA 2NWRA 5C55A 2X40A 2WM0A 1MRAA 5H8PA 1XYLA 1Q45A 4O17A 4D8LA 2VC5A 2VQTA 1A50A 3OYZA 3QLDA 2JKPA 4WOZA 1ZPTA 4DQWA 4Z42C 2DZWA 2WVTA 2DT2A 3WLSA 4Z2LA 3S47A 3LRLA 1U5HA 5A2CA 3NQDA 5CXPA 1HGWA 3CUZA 3HO8A 1XPYA 8TIMA 1B2YA 2J4GA 5E6ZA 3VD5A 1KO0A 1XLKA 4C6MA 2FZDA 5AC6A 1LWHA 2JBMA 1MFVA 2WBGA 1Y0EA 3W7GA 4PMZA 2QPSA 4NVTA 2P0OA 3TZNA 1K3UA 4E4FA 3CMFA 3FEMA 4E6MA 4B2DD 1ZTVA 4JTGA 1PKNA 2ASHA 3WDHA 5FIPA 4Z0JA 3MDUA 5F4XA 2OXNA 2W61A 1VHNA 4QSFA 1GK8A 3SSJA 1KFEA 1BLIA 3OW1A 4LC6A 3S5YA 3DFHA 3UBPC 1M7JA 4W4QA 1RK5A 1Y65A 2CWXA 3E3HA 1ONEA 2ZRVA 3NQ6A 1OCQA 4GI8A 3GFZA 3BMXA 5DEZA 5FL0A 1DL3A 3TK7A 3S1VA 3DXIA 1JZ4A 4C65A 4NF7A 2C16A 5HR6A 4UNIA 1E1CB 3AIEA 3QV9A 3WLJA 3PJUA 3IUHA 4ICCX 4DZ5A 2OZ8A 3V16A 1B4KA 2G97A 3EWUA 1NDVA 2FHFA 2Y8UA 1AK5A 3QXBA 3E0LA 1VFUA 4PN2A 2VRJA 3K30A 5EMUA 5DFAA 2YLAA 3OOQA 4HGXA 4CGTA 1A0CA 1MVYA 3RJXA 4QS6A 2XU2A 3NSNA 4NIRA 5BRQA 4F0KA 4I90A 3SR7A 4ZQNA 2V5CA 4IG2A 1R7OA 1DJNA 1RJPA 1RP9A 1GTEA 2BXVA 4H9YA 3QMSA 4URIA 3HTWA 1S5WA 4E2VA 2KX9A 3AIWA 3EPMA 2BVDA 1WBHA 4NX0A 1VBHA 3N9SA 4V27A 2CEQA 1S5VA 1XC4A 4UNLA 4RXFA 2TODA 3NZQA 3NCOA 2JIWA 3RM9A 7REQA 2BFGA 4H6RA 1A3WA 3EWWA 1ISWA 4O13A 4OT7A 1RVKA 3VMOA 4Q22A 3TYUA 4RZ6A 1BG9A 3N13A 2CBVA 3TYZA 2GDUA 4WRHA 1A53A 3F5JA 3T2PA 4WJXA 3VNDA 2GGHA 4XUGA 1DQXA 2O4QA 2B7PA 3W2MA 3L2LA 2YSWA 1KM5A 2PF8A 2PGFA 1YDYA 3S83A 3TDFA 4LYQA 3QVQA 4MSSA 3S1WA 1J12A 4F48A 2QAFA 4IGNA 1AZ2A 4FMVA 3REQB 1V08A 3AS0A 4DJFD 3NPWA 1ELSA 4ERIA 1C7SA 5RUBA 1XIJA 5HUOA 3CPGA 3GDKA 3WSUA 1ONWA 4NHVA 4E8CA 3WBXA 1UUQA 2OLAA 3ANYA 4FNSA 3FEQA 3UZJA 4IT1A 1AMYA 3BQ6A 5BXPA 4YTTA 4FXRA 3VXGA 1KXHA 4LS2A 2V68A 2Z1WA 1NEYA 3MVIA 2BS9A 4DO4A 2OTDA 1WOAA 2WJFA 3LENA 1KD0A 1FWIC 1Y5VA 1ZBWA 1YX1A 2X1SA 4NU7A 2E6DA 3MZ2A 3STCA 3CU2A 2WW5A 3WDQA 2Z2UA 6ENLA 3DHDA 4Q4SA 5XIMA 1TZ7A 2GK1B 2YCKX 1MDLA 4F9JA 3WK3A 3UERA 4K8GA 1TV4A 3TUUA 3K4DA 2E9MA 1FA2A 1E72M 5KETA 4MJMA 4W9TA 1W31A 1RBOB 2PC8A 4A4AA 2DSZA 3UG4A 4HHPA 1TJPA 2NZLA 5L9FA 1OCBA 3RFAA 4F0RA 4QQUA 5C71A 3P84A 1UYQA 1E55A 1PVNA 1TQXA 3AXKA 3VIMA 1TG7A 4IPNB 1XIEA 3GVQA 4Q8VA 5DBTA 4GINA 4C6JA 4G7FA 4IZGA 2X09A 3FXGA 4B5SA 3W87A 3B0VC 1FHDA 4N7QA 2J24A 4YJ5A 1DIEA 1TFVA 4JBRA 3W86A 3Q2DA 3S5NA 3DC0A 4FEZA 3PNUA 4OU1A 2XM2A 1UG6A 1PO9A 2J79A 2OT0A 3EOSA 3ZYZA 4QEHA 2BODX 1LLZA 4LUSA 4F2BA 3R0DA 2QCDA 5D2TA 3TJIA 4ICNA 1ISVA 5HNNA 3TA6A 1XS2A 2NUYA 4G1KA 1KGWA 1EJ7L 2AMXA 1E4MM 5GJNA 1R30A 3QPEA 5A69A 1GOWA 4DEFA 1XBYA 3N18A 1V4YA 4TX9A 5HJLA 1C9DA 4B5UA 1ECQA 4S3CA 3WBAA 1VFSA 4PTDA 2PDWA 3LPPA 3W74A 1ICPA 3KOZA 3N2BA 2ZBTA 4H4IA 3TYBA 1KB3A 3TJXA 1Q85A 4OBSA 1NWUA 4WKFA 5I06A 4ZB5A 4W85A 5I3KA 5EB8A 1XINA 4UR7A 2A3CA 3HU7A 2YJQA 2G3FA 4MM1A 3CPRA 1KWGA 1JCTA 3MCNA 1UUOA 4IJBA 4H9XA 4MUPA 4R34A 3BGAA 3RXZA 1Q4WA 4LY8A 4KIRA 5LIUX 4NY2A 5SWUA 2BLEA 4YTRA 4JHOA 2A3HA 4PEKA 2NQ5A 4C6LA 5CSUA 4WKHA 4GYKA 3PZNA 1M5WA 1HJVA 4DI9A 4F8XA 1YPIA 1Q2SA 1IGSA 3EWYA 1F3TA 4XX6A 2PGEA 4KRUA 5AC4A 8XIAA 4BHYA 1J11A 4Z17A 2VVNA 4IJCA 5EL1A 5DT7A 3USBA 1MUMA 2QEZA 4EVZA 5MHBA 1W1IE 3GDRA 3RGTA 2YW3A 1X6UA 3ZJ7A 3MS8A 3H7UA 4GQRA 4WDTA 1XG4A 2J25A 1BWKA 3RR4A 2VRKA 1ZBVA 3IJLA 1BFNA 4GZEA 4HOZA 4FF7A 1OX4A 3WF1A 5HULA 1M3UA 2PFHA 2XSBA 4K39A 3UWQA 4RCXA 4AD1A 4AIOA 1TE1A 4RE0A 1NAL1 4D6DA 1JDDA 2GQ8A 3UVAA 3LNPA 4MMWA 4NRSA 3ZT5A 4GCXA 4E8DA 3QSTA 3SZ8A 3QBUA 4Q8PA 2EPNA 1Q66A 1J2WA 1P43A 3WH5A 3VGBA 5IHRA 4ML9A 1W0MA 4D6EA 3UA4A 1SYTA 2DT1A 2VGIA 1FWJC 2XTKA 3URBA 3SN4A 4L1WA 4H01A 5FA5A 5C5YA 2C1IA 4M80A 1Q65A 2XGZA 1CW2A 2W91A 2YDQA 4IL2A 1MSSA 4DXVA 4TVCA 4J3TA 1R38A 3AIRA 2E0PA 5CPLA 5CAHA 3UXIA 3PUDA 2AL2A 3WLKX 3DAQA 3TX9A 1SJCA 1VBUA 1Q6DA 1CYGA 5MKGA 4LYRA 1OVDA 5C9WA 1G4SA 1VCFA 4GXPA 3IK4A 4F79A 1ODZA 2QJMA 4BI5A 1LOLA 5CQ1A 3AU2A 3SB0A 1EH9A 1XH2A 5M3WA 1EJUC 4O4WA 3B8SA 1EF3A 4PBGA 2RHGA 3O6YX 4MNJA 1E9LA 4PTXA 2E28A 2FFCA 3LQLA 1CDGA 2IXUA 3EOLA 3VDAA 4M19A 3QGKC 4RR4A 2DZSA 4FXSA 4US5D 2D73A 2IW0A 2GDQA 1E1FA 3T4WA 4O0QA 3L4ZA 4PA8A 2Q02A 4BEUA 1HJXA 4DHGA 4Q8NA 3TH6A 4UTFA 3W6LA 4O53A 4DJFC 3I3DA 4IHCA 4GVIA 3QV6A 1GG0A 3P6LA 4WGHA 1O4UA 3S2CA 4QXIA 5T9BG 1A80A 3ANUA 1TJ2A 3LMZA 2Z25A 4HHMA 3EXRA 1R5YA 3W1QA 2Y85A 6XIMA 1G94A 1M01A 3W7MA 4G5DA 4KRTA 5I3HA 5A6JA 4AD4A 2ZUSA 2WVVB 4M29A 5LYRA 5A3HA 1RLCL 1ME7A 1XKJA 3RF9A 2Q3OA 3VABA 2YPIA 3KCJA 1QPOA 1RH9A 2BDQA 2CKSA 1GGOA 4N6EA 1F74A 1BXNA 3CIXA 1N7KA 4HCLA 4XTIA 2ATMA 2VNCA 3IJ9A 3GXFA 1W3NA 1J5TA 2YR1A 2CLKA 5ECVA 1E9ZB 3KTCA 4DJDA 5HR7A 2Y62A 4H6KA 1ISYA 1FH7A 3GG1A 4H8NA 3OPSA 1H1NA 1TWIA 1CLVA 3GZ3A 3VD4A 1L2QA 3WQCA 4ZB2A 3PUEA 1KC7A 3C0QA 5AC5A 1ZL1A 3OBEA 2CFFA 1AJ0A 4UMAA 1WDQA 1S46A 4OOUA 1TTQA 4GOAA 4MOZA 4UFLA 1B3WA 2QJGA 4GMEA 3CT7A 1W1YA 1XKYA 1KXQA 3H8AA 3WNOA 1J6OA 4IG2B 3IGSA 3W2LA 1KCKA 3MO7A 4B5WA 5K3VA 1DWFM 1LBMA 4HN8A 3WEMA 3GC2A 2XIMA 3FIGA 4C7DA 4F9DA 3W88A 1XSIA 2DW7A 4W89A 3UGRA 1GW1A 3M6DA 5JIWA 4UIOA 3GY1A 3F4VA 4PUUA 4UNKA 2CLEA 4AD2A 4BWLA 1WZMA 4B4FA 4BFAA 1TZZA 4JQAA 1SW0A 1OIMA 5FJPA 3UZZA 3UYIA 1P6BA 3K13A 4KCVA 4BA0A 3W7IA 1TA3A 1KFJA 3PUGA 3MC5A 3UWUA 1WXZA 4U10A 3W7QA 4ORMA 1L6GA 3BLLA 4UOQA 3KCLA 1F6PA 5CPMA 4LJ3A 3MQTA 3AHTA 4Q8WA 2D20A 1HKWA 4ZZ9A 1QW7A 1QBBA 4UTIA 1J93A 1MWOA 4PULA 3LQGA 3V1PA 4E3VA 3CHVA 3N4FA 4AYSA 3ZT7A 1DHPA 4HHLA 1UASA 3B8UA 3WK2A 3RN6A 1ICQA 4YL2A 4QTGA 4DUWA 1K8ZA 3FHAA 4QCEA 2ACUA 3AU6A 3N9KA 1XI3A 3A13A 3A22A 2QDDA 4GPNA 3WNNA 4R27A 1F7BA 3H4XA 3WMBA 3E1F1 2CZ5A 3CV2A 5C2GA 3CB8A 2JALA 1AW5A 1NWSA 4IIGA 3STGA 5C9RA 1GHSA 4RV8A 4OECA 2D3NA 3QC3A 1J6PA 1OCNA 3UNDA 4ZQMA 3SRFA 3I7QA 1F3EA 3Q65A 1O1HA 2GDVA 1XLCA 4AISA 1RALA 4AY1A 4AF0B 2UY3A 3DCPA 1MW1A 3NVTA 4YPJA 3TN4A 3G1RA 1PKLA 3NVDA 3ECQA 1OFAA 2NW0A 1S5MA 5CAKA 1US0A 2HQAA 4N9BA 2DU2A 3DFNA 4AC1X 4E5TA 1Z3NA 5L6UA 5HWMA 4L9ZA 1NP2A 1GZGA 2Y7GA 2OX1A 2W67A 1FHVA 4NNAA 3MUIA 5CSYA 1R9ZA 3VNZA 5A8NA 1AH4A 1IGWA 1N8FA 4XO7A 2NWSA 4GHRA 1OD8A 2AOSA 2NX3A 3MKKA 2QV5A 3TA9A 1W1TA 2FQIA 4LUSB 1JAEA 4C6PA 1ADSA 4HT3A 2YKKA 3EX6A 3P74A 5CSSA 2QCDB 1JQXA 4KEMA 6XIAA 4JN7A 4CQCA 1X96A 3N6QA 4LUIA 4A22A 4IUGA 3LOTA 2E8ZA 4JTDA 3SCSA 2XH0A 3AHYA 3UPMA 2OOGA 2FFIA 3UP8A 3KRUA 4JYFA 1YEYA 3K1DA 1YPFA 5A5WA 5EMJA 5G4EA 3STFA 1XCXA 1EZWA 2FGBA 2YXXA 2PPGA 4MAVA 3O9NA 1SSGA 5KZ6A 2Z7GA 2J9XA 1JVNA 3TOYA 3STEA 3WNKA 1JF6A 3SIZA 1GQKA 2C6QA 4V15A 5D2YA 1AODA 3MDWA 4H9ZA 1DWJM 3NDYA 3AICA 1UOKA 1JUEA 2F6KA 1XUUA 1RAKA 3I3EA 4L64A 2WK2A 5E0KA 2E25A 1IEWA 2GJXB 2WWCA 2Y70A 2WAGA 3BC9A 3CZJA 2GVJA 1EX5A 3T6CA 5I02A 1TWWA 5K9CA 5D30A 4ADTA 3WQFA 2EBNA 4OWGA 1XRFA 1EGZA 3NJ3A 4HMDA 2I5IA 5BROA 3APYA 2OVLA 1ZU8A 4I9JA 3ZVHB 2QDEA 4GFSA 2NVDA 2D0GA 1MW3A 4O1AA 3H7VA 1B3VA 1EDTA 3VIJA 3W01A 4RZ5A 1XWYA 3H21A 3N15A 3BOLA 5U7SA 2GPTA 5I24A 4A05A 3W7EA 1FDYA 3KUMA 4GZJA 1SZRA 1VRXA 3QF0A 3R8HA 2QW5A 4O10A 3KOXA 3NZRA 4M82A 4C91A 1CZ1A 1KM4A 1UR2A 2Y5EA 3P7YA 7ENLA 3RLVA 4C60A 3E2VA 4CU6A 4JGDA 4S2CA 1AW1A 4L5ZA 4LEFA 5FKYA 3R5EA 1BHGA 4G8TA 3BV4A 4PB4A 4HSOA 3BW2A 3C4UA 1V51A 2PC4A 1UZ4A 3HGSA 3CQJA 1Z42A 4LS0A 5IDIA 2DZPA 3WX7A 1M7PA 1OFOA 2PDIA 2A1YA 3CO8A 4UTWC 2MUCA 2X1IA 4CN6A 1IQ8A 3DIPA 2DUXA 1NM9A 4RNIA 3LLFA 1H62A 4E3TA 2VC7A 1VPYA 5I3DA 2SFPA 1XLJA 3DYMA 1V3JA 1FXPA 1JUKA 3ZWTA 3P8IA 4N6FA 2H3BA 1UC5A 4GBUA 4JFWA 5MKGB 1YW1A 4XBKA 4GYPC 3T8LA 4B4HA 1XDLA 1OFEA 2FZMA 2A6LA 1DJHA 4MNKA 1JZ8A 4ZQPA 3BXWA 5I78A 3M1ZA 1W3TA 1U1HA 3U2OA 1UW9A 3NM3A 4XAGA 4C6DA 2R14A 3FDKA 1XBZA 4DNMA 1M6JA 1ISXA 1SW3A 1VFLA 3EWDA 3ZR6A 1FXQA 3K1GA 4HCDA 4JX4A 4N02A 3WNMA 4QDWA 1GYMA 2VEIA 3V4BA 1SPQA 2A6NA 3BOFA 1TQJA 1SZEA 3LM3A 1V03A 3KOWA 1XG3A 1DVJA 2R24A 3CHCA 3LY0A 4DI8A 3MP5A 4O8RA 5G1YA 3EX2A 5G5IA 1V0MA 3SM0A 1OX6A 1TPH1 3W2JA 2V5JA 3MHFA 5CPOA 3N25A 3TQ0A 4CU7A 2F61A 3U5UA 1CENA 2HISA 5CBBA 2VOMA 1IT7A 1HFBA 5TAOA 3AMKA 4XSLA 2OFJA 3EPOA 1M7OA 5H8MA 2I5QA 4WOQA 4LT9A 2ACRA 4PR4A 3QR1A 5T8GA 2BY2A 5A2AA 3S2JA 4FZIA 4GYJA 2R9RA 2DZUA 5LHEA 4IGSA 2A21A 6REQA 3W7OA 3P80A 4EXBA 3TW6A 4JTCA 1E5JA 4IP7A 4WY0F 5LNUA 2RKXA 1AMKA 5EBUA 3EEGA 3S2LA 1KCXA 3LCWA 4RE2A 4FB7A 4ZO7A 4KGLA 4MJ2A 1W9VA 4UZUA 2YYUA 1VEPA 3THDA 1GCYA 4IISA 4QSHA 4W7VA 1R9YA 4K1GA 3C86A 1F4HA 1LQ2A 4GC3A 2W62A 2H8ZA 4IFOA 3MMWA 3LCIA 5A6KA 3MUCA 3CZEA 3GDLA 2GSHA 2OZ3A 2HTMA 4ZCWA 4F2UA 3CAQA 2ZDRA 4YWIA 3NQGA 1ZY9A 3H2AA 2VUNA 4HSNA 1EJRC 4XD4A 1LUCB 1NY1A 3TN5A 1IEQA 3ITCA 4HKPA 2V30A 4HPJA 2QKFA 1OGBA 4XUYA 3PWAA 3EDJA 3TVAA 3PZUA 4HK7A 3AISA 1JPKA 4K8EA 5IXEA 1B3XA 2QHAA 3GRIA 3RU6A 4C1KA 1AL7A 4X9SA 5FACA 3W1XA 3SCUA 3C61A 1WUFA 5H2ZA 2GL5A 2IQDA 5K2ZA 3ITLA 1NDWA 3C2OA 3MV01 4PMRA 2WWDA 4TV6A 1X39A 2PS2A 4H6QA 3E6EA 2OMAA 4UC5A 2VX6A 1JFXA 1YDVA 3RM8A 1R2SA 3TMQA 4LAKA 1QW9A 3UR7A 3NXFA 4BJHA 3QQ1A 3LCGA 4UQAA 1A3XA 2DVXA 2ZC8A 2GUYA 1SR9A 4IQEA 3VNYA 3BGJA 2QVHA 1GVIA 5CBIA 4PRRA 4IUOA 4DM2A 3GNXA 4QAIA 1GQLA 3G22A 3IJ7A 2A3AA 1R3SA 4RKAA 3R7MA 3NDZA 2PAJA 3LYEA 2GOKA 3KVLA 4C6KA 5BOFA 3GKFA 4MKNA 3R1ZA 4MPKA 5F7UA 4YCOA 2WSPA 1KM2A 3UCDA 2VXNA 1FKXA 3W00A 1JL8A 1EQPA 3RK8A 4IMCA 2VFIA 2NVCA 1EGMA 4WR3A 5G4WA 3CM4A 1QNOA 1J0ZA 1Q63A 1VKFA 2CCRA 1GKRA 2E9LA 4ZGYA 3J7HA 2HNEA 4NI3A 3W72A 2FPVA 2W79A 2CLLA 1EEXA 4NQ1A 1RCOB 1B57A 3M0IA 3DX5A 2E8YA 2PTZA 4KETA 1EWDA 3P5ZA 4J2MA 4RZ4A 2V3GA 1P48A 2FTWA 1UIPA 4O54A 1POJA 2EG8A 4XAPA 3BVJA 1H7WA 2VZUA 1LDCA 3ZO9A 3VVGA 1EWEA 2EO7A 4EWJA 3LHZA 3A9BA 2QJJA 5LA0A 1CX9A 3OLEA 4H04A 2OYLA 3U3HA 3ITTA 1JI1A 3N19B 3W1PA 1E0VA 3NNTA 1UKSA 4XZNX 1Q8JA 1ZUAX 4CD4A 1WE5A 3O6DA 4Z2IA 5JMUA 2VI0A 2Y6ZA 3AALA 3NQBA 3W1LA 1SJDA 3S8HA 4S3KA 4C5YA 4NZJA 1Q4NX 4QDPA 3CGTA 3IARA 1LF1A 3M5VA 3QKZA 2R8WA 3UJEA 3P14A 1M03A 4G6CA 4B90A 1A5SA 3WJXA 3AOFA 3FNDA 3RCNA 1U1JA 5HMDA 3LGDA 3SAZA 5D8WA 3SN1A 3FHQA 1DTUA 2PDXA 2I57A 2Z6IA 4UQEA 4AX7A 2QR6A 3A5VA 1JGMA 4I9TA 5A8OA 3POHA 4C6CA 2V8ZA 1WDPA 3NQMA 1ODUA 1OFRA 1EC9A 3LTSA 4JTFA 5IFTA 1DXEA 1A4LA 1Q8AA 1Z6KA 2E6YA 5LXEA 2NXHA 4UZSA 1XCFA 5DCEA 2XIQA 3R4IA 4LAZA 4AU0A 3F03K 3OIHA 3PAJA 2VCAA 4FK9A 1WDSA 3M0JA 3SUWA 3WD1A 3KDNA 3MTWA 3VIGA 1F8IA 1J4EA 1PXGA 4IXHA 4N9DA 4NJJA 2BX7A 3TIMA 2VGBA 1DIOA 5FEWA 4R5EA 1TPB1 1GNXA 4FLSA 4FNPA 5XINA 1FHLA 2UZ9A 3VOGA 1G9HA 1E3ZA 4F3HA 1W2PA 4CNNA 4HA3A 3G18A 4DZAA 4GYFA 3ZR5A 2PWUA 5JIPA 3G6MA 3B04A 1B3OA 4JD4A 2YXOA 3E0FA 5G2IA 5CLTA 3K8MA 4JTKA 4B5TA 2GGJA 3UCQA 2INZA 3G3DA 3NURA 4GUJA 1CB7B 3SCRA 1HXJA 1RV8A 1XXXA 1J0HA 3AIBA 4UQCA 2ZE3A 1CBGA 1QO5A 1SO4A 3LBOA 4PRWA 5TIMA 3DFTA 1EPVA 4Q4QA 3LXBA 1LLOA 1EDGA 3II1A 2OEJA 1AUSL 2UWFA 4CQ9A 1D8CA 1S2VA 2CZEA 5TNVA 4KKXA 2ZWYA 4NL1A 1XC6A 4FX6M 1EB3A 3TLQA 5HK4A 2J7BA 1VBGA 1R3YA 3VTRA 4AMCA 2BVWA 1M65A 1O66A 4JTEA 1LL6A 4XZMX 3MANA 4GKLA 1OABA 4H1ZA 4QX4A 2AQWA 1EUAA 5CSRA 5CJNA 1C8YA 4RL3A 1P4CA 4GY7A 3I4EA 1S1RA 2VDGA 2GWGA 4D6GA 4P61A 4LVDA 2TPSA 2DSKA 1EZ2A 2I17A 3TSMA 4NZCA 2I16A 3R43A 4PCPA 2BHUA 1RLDA 3HBLA 5KZDA 5GQBA 1NOFA 3NOEA 1F6YA 2PDCA 4S2BA 4HSHA 3W6MA 3H23A 1IXNA 4L4PA 1W3HA 3AYVA 1JULA 1O1ZA 5AFDA 4AZIA 3T0DA 3DHPA 1KFKA 1EUNA 2D0FA 1AQ0A 3F4NA 3O0KA 3K4WA 3OZYA 1RJQA 2QJIA 1VCGA 3BAXA 1ITXA 1XRVA 2X1TA 2BHZA 1TTPA 4DAFA 2BXYA 3B0UX 3ME3A 1WPCA 3ARUA 3S5ZA 4E2DA 5AYXA 4PC8A 1ME9A 2IKGA 5KINA 3COTA 3AS1A 4JTHA 4U2ZA 3ALFA 4I6KA 2PDKA 7CGTA 3U2EA 2YCJA 3AZTA 2R6OA 1LOQA 5A6LA 3EWBX 4MFEA 3B8VA 4LH8A 4K68A 1E6PA 1ESWA 2C18A 5CPQA 3MYOA 2PWGA 1Z48A 2ALRA 4PE8A 3PG9A 2F6UA 1DE6A 1VHCA 2QF8A 5K9XA 4LAUA 4R9XA 1HTIA 3W4RA 4WK9A 5E5CA 2X7WA 3TTOA 4AD0A 2XVGA 1SO5A 3UCCA 2WCGA 5HWJA 3V18A 1HL8A 3N11A 1SGJA 4TO8A 1EOMA 3WQWA 1TCMA 3PANA 3SJ3A 3QSRA 2P0IA 2AGKA 4A3QA 5DQPA 3P81A 1EJVC 4CQBA 2D0HA 1U5VA 2W63A 1Z9AA 1TIMA 2FVMA 1UD6A 3WLLA 3HV8A 4QQ3A 3EDKA 4QGCA 3WUGA 2E4TA 4DWSD 3BCFA 3GNNA 1Z41A 3UZXA 2DZVA 3DGBA 4TX6A 3H22A 3PR2A 2X1RA 4O0ZA 2HDJA 3LX9A 3UW6A 3CT2A 4IIFA 3CXOA 3SY8A 3AS3A 5CZSA 2CERA 3KDOA 4B16A 3BAWA 1TRDA 1TREA 1C92A 1G4EA 1EP2A 3NQVA 2VZTA 4PMXA 3M44A 4WGXA 1WKFA 1IF2A 1HIZA 4IPPA 4KRZA 4KF1A 2QCFA 4M1BA 4DXKA 2QZRA 4MWAD 4CD8A 5DO8A 1XBXA 4IQLA 1ZENA 3GXNA 4EIVA 3GIPA 1EBHA 5LA1A 2ONEA 3WQ5A 1XIDA 4IIDA 1U1UA 3EOOA 3IIZA 1HKVA 1MUWA 4HPXA 4HBKA 1QWKA 4TMCA 1SSDA 2C7FA 4GABA 3SIMA 3R12A 3DECA 3S5SA 3G0UA 1K4HA 4ZXLA 5EFDA 5CKSA 3WBEA 1WZLA 4OOZA 3LA4A 3U8GA 2X30A 1S39A 3NZPA 1XYCA 5B7ZA 4CCDA 1TPEA 3NSXA 5HA7A 1FWTA 1W6TA 1KBIA 3B8DA 3EZ4A 1JDEA 3ITXA 3TJLA 1RY0A 3LCXA 1DWHM 5D8ZA 3B0PA 3UWVA 1GQJA 1L6SA