4LANA

Crystal structure of cordyceps militaris idcase h195a mutant
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
370
structure length
370
Chain Sequence
TPVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLAPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-5-carboxylate decarboxylase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
total genus 137
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lanA00
2Q01A 5HMFA 1FWEC 4CNSA 4BJHA 2RAGA 1A5NC 2EG6A 3S2LA 4QSFA 2HPMA 4C65A 3GIPA 3MSRA 4GX8A 4KEZA 3GTIA 4LFYA 4C6EA 2Z28A 4HA0A 4F0SA 1W1IE 2HNHA 2OGJA 4RDYA 4B91A 4ERIA 4ZSTA 1RA0A 4DLFA 2CZVA 2VHLA 4G7EA 4H9ZA 4RDZA 5A6TC 3GTHA 3EWCA 4GK8A 2UBPC 4DO7A 3CJPA 1YBQB 1YNYA 3S2JA 3QGAC 4DLMA 4Z42C 3LA4A 4B92A 1R9YA 3A3XA 3AUOA 4BKNA 2F6KA 3R0DA 4MUPA 4WGXA 4R85A 4EPBC 4RZBA 3CS2A 1PTAA 5FSDC 4C6OA 1UBPC 4IQJA 4WVXA 3K5XA 4LAOA 1XRTA 4CNTA 4H01A 3HM7A 4H9MA 1EJXC 4DI9A 4CEXC 4KEVA 3EWDA 4WHBA 4RE0A 4XAGA 1EJUC 1A4LA 3MVIA 3FDGA 4ICMA 4IG2B 4DNMA 2EG7A 3V7PA 2HQAA 1POJA 1PSCA 1RA5A 1ZZMA 4DZIA 2WM1A 2GZXA 3ISIX 4CNUA 3FEQA 3B0XA 3MKVA 2YZ5A 3LNPA 2IMRA 2R1KA 2Z00A 1V4YA 2QPXA 2A3LA 3ID7A 1RK6A 3SO7A 1GKPA 1GKQA 2P50A 3URBA 4KESA 4CQBA 4PCPA 1XGEA 4XD4A 2Z29A 3MTWA 1NDYA 1ONXA 2GWNA 3C86A 4C6PA 4EP8C 1O5RA 4GY0A 3IJ6A 2YXOA 1R9XA 1E9ZB 4C6KA 1BF6A 2OQLA 2R1NA 2Z26A 3O7UA 3IRSA 2FTWA 4G2DA 3E74A 2AQOA 3OU8A 2FTYA 2HBXA 3GIQA 4C6NA 3RCMA 3LU2A 3TN4A 3TN3A 4C5ZA 1KCXA 3OOQA 4UBPC 4DI8A 1FKXA 2PUZA 2BGNE 3ORWA 2GWGA 4D8LA 1XWYA 3JZEA 2HBVA 3URNA 3AU2A 3OJGA 3A3WA 2BB0A 1FWDC 2WJEA 4LAMA 2PGRA 4LCQA 4NP7A 4GY7A 1FWFC 4C6LA 4DIAA 4IF2A 2O4QA 4DZHA 4P5UA 4EPEC 3GRIA 3GU9A 1QW7A 4QS5A 4AC7C 1EYWA 5HMDA 2GSEA 4IGMA 4XAYA 3MDWA 4C6MA 2ANUA 2D2HA 2FVMA 4E3TA 4AQLA 3RYSA 3IACA 2E25A 2I5GA 3PNZA 4KETA 3OODA 4J35A 4YIWA 4C6CA 3E2VA 1NDVA 2DVTA 3G77A 4HJWA 3AU6A 1UIPA 4LH8A 4V1XA 4XAZA 4C5YA 1POKA 2VUNA 4KERA 2PLMA 1E9YB 2QVNA 4HK5A 3S2NA 3LY0A 3UF9A 4KIRA 3MPGA 3LSCA 3S4TA 3WZ0E 3DCPA 4C6IA 4GBDA 3GU2A 2Q09A 1V77A 2PGFA 3NQBA 3GG7A 4LCSA 4F0LA 4NI8A 4TQTA 2WJDA 1EJVC 1V7AA 1FWHC 4XD6A 3T81A 1J79A 1P1MA 2VM8A 4GY1A 4B90A 3F2CA 2AMXA 1RJPA 3F4DA 1EJTC 2Z2AA 2Z7GA 1V79A 4H9UA 2R1PA 4GXWA 2HPIA 4G7EB 4C6QA 1WXZA 3MVTA 4QTGA 3O0FA 3LSBA 3LGGA 3F4CA 2QT3A 4IFKA 5FSEC 4J2MA 1XRFA 3N2CA 1YBQA 2E1WA 4XD3A 4KF1A 2ICSA 1NFGA 2D2GA 2QS8A 2YB1A 1FWAC 4DYKA 3F2DA 1KRAC 2Z2BA 4GYFA 2PAJA 3TN5A 2DVXA 4I6KA 4KQNA 4H00A 1I0DA 1A5MC 1A5KC 4R88A 1J6PA 2Y1HA 4PE8A 3K2GA 2Z24A 1ITUA 4KEUA 2XIOA 1WXYA 1V51A 4GC3A 3DC8A 3NURA 2D2JA 4EPDC 3UPMA 2GOKA 4L9XA 1EJSC 1RJQA 3PBMA 2ADAA 4C6BA 3T1GA 2FVKA 3URAA 3GTFA 4H9TA 3RN6A 1UMLA 2OB3A 3MDUA 4IG2A 4LAKA 4JOMA 4C6DA 4GOAA 3NEHA 2EG8A 4XD5A 1GKRA 3BE7A 4QRNA 4XAFA 2G3FA 3HPAA 1RK5A 1KRCC 4GZ7A 1IE7C 2FFIA 3B40A 1J6OA 4H9VA 3PNUA 5E5CA 3PAOA 3WYZA 4LCRA 2R1LA 4F0RA 1ONWA 2KAUC 4I6VA 2DVUA 3KM8A 4PCNA 4H9XA 1YMYA 1JGMA 2UZ9A 3E3HA 4ZSUA 4PBFA 2VR2A 3WMLA 1NDWA 4IFKB 4H9YA 4CQCA 1EJWC 4HK6A 3ICJA 1M65A 2AQVA 4RDWA 1UIOA 1PO9A 3URQA 3EGJA 5G4HC 3OVGA 4ERGA 3UBPC 1FWBC 1VFLA 3TN6A 3A4JA 3IPWA 4BY3A 2WJFA 1RAKA 1HZYA 1EF2A 2P53A 4R7WA 3GU1A 2I9UA 1YRRA 2O4MA 4RDVA 3IV8A 1RJRA 2YB4A 4L6DA 4M51A 1PB0A 1FWCC 4C6FA 1EZ2A 4J5NA 2R1MA 3HTWA 4LALA 1A4MA 2VC5A 1KRBC 3LS9A 4B3ZA 1P6BA 1K70A 4IH3A 5CH9A 1K6WA 4UB9A 1A5OC 3QY7A 1ADDA 3QY6A 4EPKA 1K1DA 1FWGC 3D6NA 4LEFA 1QXLA 3ITCA 4IGNA 4C6JA 3B0YA 2OOFA 3FDKA 3CAKA 3QY8A 1NDZA 2OODA 3MJMA 4IFOA 3QGKC 1KRMA 3TNBA 3OQEA 1P6CA 3E0LA 4IFRA 5HMEA 3RHGA 4NG3A 4INFA 2Z25A 3E38A 3GUWA 5AKQA 1FKWA 3UR5A 4LANA 4HK7A 3PANA 1O12A 4ERAA 1M68A 1EJRC 4QROA 3SFWA 3IGHX 4CEUC 3GTXA 4OFCA 1S3TC 2W9MA 3IARA 2VC7A 4QS6A 3UR2A 1M7JA 3S2MA 1ITQA 1YIXA 4C60A 1FWIC 1I0BA 1R9ZA 2Z27A 1FWJC 3E0FA 1DPMA 3DUGA 5LXXA 3LGDA 1J5SA 3T8LA 2Z4GA 4GX9A 4V1YA 3F2BA 1A5LC 4PBEA 3K4WA 2ZC1A 4CQDA
chains in the Genus database with same CATH superfamily
2RAGA 3WF1A 1QHOA 2VJXA 2FH6A 4IIGA 5KINA 3WK2A 4XBSA 3PSWA 1TPUA 4B5UA 2DH3A 5G4EA 4ZQMA 3W2LA 3FYOA 3A3HA 1W2PA 4CQ9A 3DIPA 3BL3A 2A1YA 2VX5A 1XIHA 1OZQA 1W1ZA 3O6AA 1QK0A 2OGJA 2X1IA 3WMBA 2HSAA 2XPKA 1OX4A 3ZJ7A 5JVLA 1EO5A 3LA4A 3GKAA 5D09A 4LWWA 2V9DA 5D2XA 1CWYA 3ARSA 2HK1A 2GJXB 2RDTA 4YHEA 3QF0A 2IPJA 3ITTA 4GNKB 2J88A 2E9BA 1PTDA 2X1SA 4B16A 1ADOA 1J01A 2Z1SA 3GXNA 2BHUA 4O10A 2HTMA 3VI2A 1G7UA 3WK3A 3T0BA 4JCMA 4JHZA 3FGCA 1F4HA 3CXOA 3SZ8A 1PSCA 1E4IA 4UQEA 3D3AA 5BOFA 3C6CA 5IBXA 4Q8NA 3RUBL 3UWUA 4A8RA 1I75A 3CWHA 1F3EA 3R0UA 2ZCGA 2VWSA 2NVDA 1WCGA 2GGEA 3SCRA 3F5JA 3HG3A 4N9DA 3F7JA 1JGIA 1MXSA 1M7OA 2Z29A 2E77A 1JZ8A 1UJQA 1M04A 3UYIA 1X6UA 3MUAA 4N2YA 4ZGYA 4ACZB 1Z3NA 2FGLA 4FXSA 4X2PA 4GY0A 1V03A 3CASA 4HMEA 4FMVA 2FZBA 2YLAA 3LK6A 4X63A 3MUZ1 1UR4A 2Y62A 1OJXA 4Q7BA 2I9EA 3GIQA 4C6NA 1I9CB 1O68A 1XLBA 3R7MA 2F9RA 3ABSA 1KKRA 4ILSA 2C79A 2QGYA 3UGRA 1GTHA 5D04C 2OEMA 5BU6A 4GCXA 1H11A 4HTBA 1LRNA 2BB0A 1H41A 3CV2A 1YDVA 4M6VA 1W37A 3PPHA 2V2HA 3W07A 5LNWA 3AHVA 4U3AA 2BDQA 1F7BA 1S39A 1PV8A 1F73A 2WHMA 4P7RA 4UFKA 4QE5A 4CCDA 1ESWA 5FEXA 2CHRA 1RSCA 2V82A 3SUSA 1Y0EA 1D8WA 3G77A 4W7VA 2NX9A 6ALDA 2GQ9A 5CJMA 3AUJA 3KUMA 1E1EA 1QHZA 1GZ1A 1R3TA 3OQ8A 1A5AA 1K8XA 1CXIA 3KCLA 5EFDA 2XH2A 1BXNA 4TMBA 2WZMA 4WLCA 4M82A 2BTMA 2CBIA 2EXOA 2YW4A 4XTIA 1NM9A 1JYWA 3U0HA 2DU2A 5FAJA 5CSSA 3CMJA 3PZVA 2UV8G 1RJPA 5CGTA 2R14A 5D03A 2YBVA 4ECLA 1JPHA 1EA0A 4MDOA 3BZGA 3W1XA 3WCZA 3W7KA 2WNNA 2VEIA 4IPNB 3ABQA 3LHTA 3MO4A 3QRHA 1Q65A 2WV8A 1W91A 3T2OA 1FWSA 1MQQA 1K03A 5KZEA 4CU7A 4NZ1A 3EWXA 1E6PA 2FZ8A 4CN6A 3QTPA 1TV2A 3A64A 3Q67A 1TJ2A 3H7UA 4YTSA 1SYTA 2J27A 2EGZA 4M3PA 3E9AA 4HP5A 3EXTA 5I06A 3BC9A 4IGSA 4L61A 1MSSA 3GXFA 1VF8A 4FXFA 3MUIA 3VDBA 4I5RA 1TR9A 4UUIA 3T44A 2GOKA 3WMCA 3KBNA 3M0KA 4XZ9A 5A6BA 3W1UA 3KCJA 3AWOA 4LAKA 2ABBA 4TTGA 4DJFA 1QUMA 1K9EA 4PUJA 3O6YX 3WNOA 1RCOB 4GYJA 2R1LA 3MUCA 2HV5A 1XLFA 5A2AA 3LHWA 1XG4A 2PWEA 3BLFA 3N12A 4AXKA 1T7LA 1D7KA 2PDJA 4IFKB 4H4IA 1M65A 3AXMA 1UZDA 3FJ6A 1GVYA 3CIWA 1FWBC 3SQSA 3EDJA 3GU1A 4XZNX 3SM0A 3T7VA 2I56A 3NDZA 3W2JA 2PURA 2IPGA 5JU6A 1JEZA 4CCZA 3R0KA 3OTRA 1S3HA 3RO6A 1W2VA 3UWWA 3HGJA 3E6EA 3M9YA 1K77A 1OM0A 1WBHA 3TFCA 3O05A 4MJZA 1VQTA 4M7SA 3WL1A 5EU9A 3QY7A 4XZMX 1A5SA 1HVXA 3P7YA 4U2ZA 3GUGA 3HJZA 2F2KA 4DUWA 3FDKA 1QI5A 3MP3A 1W1TA 5D30A 1R30A 3UETA 2G96A 3P93A 5FL0A 2Z1VA 4NG3A 1TTQA 3S9YA 1CGTA 2NXGA 5E0FA 2WOQA 4BWLC 4FLSA 1J93A 1G94A 4AUBA 2NVCA 4O4VA 4CCCA 3CHDA 1PX8A 3KP0A 4W93A 1Z6KA 4IP4A 5D4YA 2FHFA 2B7OA 3HQOA 3LN3A 3U2OA 3GXPA 2VGIA 2NX3A 3S9IA 1W31A 4JY8A 4HB7A 2WNQA 3UJRA 1QDSA 3LGDA 4PMVA 1SJDA 1HP5A 4KBXA 5AHMA 1XFBA 4CNSA 2ZRZA 2A85A 4M29A 3ARRA 3J7HA 3ALGA 3N3MA 2INFA 4FX8A 4K1WA 1B5TA 5C2CA 1E6XM 1KCZA 4GQRA 4GX8A 2OGYA 3GAYA 5EY5A 2DZXA 3H2OA 2DZWA 1EC7A 1UBSA 1O66A 1US0A 2WMIA 1MQPA 4GQBA 2O0TA 4GK8A 1GVFA 3VIIA 3EKLA 1ZCCA 4Z2IA 3ITGA 4TXEA 5KMYA 2J24A 3WLRA 3AUOA 1R6WA 3L4YA 2HRWA 3DFPA 4ACZA 1EUNA 4WGXA 4GYKA 2P88A 4RZBA 4NAEB 4ZVJA 1ZP3A 1JIBA 1K02A 1BWLA 2NQLA 2PRMA 2UY4A 1C8QA 3MUXA 4F4RA 2WLYA 2ZX6A 2OT1A 1WZMA 1SZEA 2V6AA 4O1BA 3T2PA 1VPXA 3TYEA 1EJUC 4DF1A 1LUCA 4ICMA 4XX6A 2CCRA 1XH0A 2BWGA 4MF4A 2FB3A 1D9EA 1DWJM 4QNEA 1HT6A 3AYTA 3FEQA 2EQDA 3VCRA 1UMYA 1SM9A 1DJIA 2XGIA 4D6GA 2I17A 4RZ6A 2VGFA 4P7NA 7CGTA 4EIVA 3VILA 4FIRA 1ZL1A 1PJ9A 2XSAA 1GKPA 3UCDA 3VOJA 4ZCWA 3URBA 1JUEA 2E6AA 3EKZA 4YL2A 1EWDA 1RBOB 1W32A 2HNEA 3MI2A 1H63A 3SW6A 1JPKA 3GYCA 1KKOA 4C6PA 4J1OA 5D8ZA 4MYXA 2R1NA 4PMYA 3G18A 4M6PA 3O7UA 2ZZ7A 1NP2A 3O2LA 3M1ZA 2HBXA 3H24A 4K6AA 1PXGA 1E3XA 1W9PA 2CIPA 3LTYA 3U5UA 4DPQA 2NXHA 3RRAA 3B06A 3RCMA 1U1UA 2AAAA 3M0YA 1ZCOA 3PZ9A 2E3ZA 4NJHA 1AD4A 3F5KA 2TMDA 1JG9A 4B5XA 1LORA 3FLUA 1S2TA 1DIEA 3KZPA 4H6KA 1FH7A 1OINA 1I6NA 5MKGA 5MHBA 1B4KA 3OJGA 2A3AA 1U30A 1UQZA 2YLLA 1KA9F 4QM1A 1E73M 5K7JA 3SUTA 4ACYA 1BWKA 3VM7A 1RY8A 3W6LA 3LXBA 2CU0A 1ZNNA 5F2MA 4KRTA 3OLIA 2ZZ5A 1DWIM 5CAHA 3THQA 2VL4A 2GUYA 7ENLA 2DZUA 3B4YA 5AYIA 3DH7A 3W1LA 4O50A 1CBGA 3UNDA 2BGSA 2BODX 3GSMA 3GIYA 3OZOA 4ATDA 1QI4A 4AZIA 4N9EA 1JZ2A 4IOTA 3CUFA 3T81A 1V6YA 3VKCA 5HK4A 4IJBA 1H7RA 5DRIA 2EAWA 2RH9A 5HJXA 4ZMGA 1WKEA 5CEWA 4M8UA 4LGXA 1ADSA 1XW8A 4UQCA 3LERA 2QT3A 1QNVA 4W88A 4C7DA 4IFKA 3NIYA 1VP5A 1AMYA 3N2CA 2IKJA 1ZS2A 2E1WA 1R3VA 3QW3A 2NZLA 1T99A 1ZB5A 3S6TA 2QS8A 3W29A 3UFYA 3BCFA 4K39A 2BZNA 3H70A 4AWSA 4Q8WA 4QDPA 2GJLA 4I6KA 3LMZA 2D0GA 1O5KA 5XIAA 4L64A 4S3DA 3VDGA 3PBVA 4NASA 2GPTA 4ADTA 3YPIA 2VD9A 3NURA 2FHBA 4RJEA 4OE7A 3L4VA 4LS2A 4JTIA 2RDUA 4XQ6A 1UMLA 1MWOA 4JOMA 6REQB 1W8SA 3AS2A 5JIPA 2GLKA 1E6SM 1UD4A 2ZRWA 1KRCC 3U2ZA 5J8LA 3LENA 2FFIA 3KVLA 1SFJA 5RUBA 4MJ2A 1WBJA 3LOTA 3TQVA 5C7VA 4Z0JA 4ZSUA 4XIMA 5FD0A 4QJ4B 4FP1A 3M7WA 2H9AA 5F4XA 3WJZA 2F6XA 4HK6A 2AQVA 4RDWA 1DJQA 3ARVA 5CZSA 5HJYA 2XH0A 3NO5A 1VFLA 1Q2RA 3WLTA 2Q6ZA 4DVOA 2IKIA 1WOBA 1EF2A 3VKAA 1M3UA 1DIOA 3T9PA 4RDVA 5DCDA 1M41A 1MRAA 4BHYA 3QHNA 3O07A 3GFYA 3SN1A 3TLLA 1GVQA 2REQA 2VC5A 4R9OA 2ZA2A 2Y8VA 4JTEA 1E0UA 3EWWA 4S2CA 5CJ5A 4LXFA 2YCJA 1Q3NA 3VOCA 1TZZA 1K1DA 4Y9PA 2J7GA 1HKWA 5DANA 3BMXA 2QCMA 5E1QA 3WY1A 4KW2A 1F07A 3EOUA 3I3BA 5I3KA 3U6WA 3RDKA 1U5HA 1KM4A 3VIJA 2Y7DA 5FKYA 4BR1A 2WC3A 4A8NA 3E38A 3VZYA 3WDIA 3I10A 3EOLA 1G67A 2OZTA 2XVGA 1JZ4A 3W1RA 3R94A 4LANA 3R25A 5A1AA 1SFTA 1XYFA 3AIRA 2OOGA 4XUGA 1E3ZA 4JFWA 2C16A 5D9OA 5D33A 4QS6A 1M7JA 1ITQA 3UZYA 3MA8A 1CYGA 3W7DA 2VCBA 4Q4PA 4NRRA 1CB7B 5DQPA 4D1IA 4IQLA 2B4GA 4WK9A 1OIFA 4RNJA 8CGTA 2NT1A 4AZGA 4EF8A 3OEXA 1UPPA 1XYCA 4UMBA 3L4WA 2W62A 3RLUA 2BP1A 3UJFA 1AJZA 1KCKA 2YW3A 3U2EA 1PPIA 2P1FA 3M64A 4JIHA 1XUZA 4X61A 3GVWA 1E0VA 4ZSTA 2VRKA 5AYBA 1IWAA 4DWSA 4H8UA 4DO7A 3S5OA 1TMLA 4JTCA 2QMKA 2QUNA 3EA3A 1F6YA 1FBAA 2J4GA 2XTKA 2VX6A 2PMQA 3R0DA 8XIMA 4GUIA 2JEQA 4GKLA 1XINA 1PTAA 4GI4A 3TSDA 1E9LA 4UCFA 4JS3A 2PU1A 2XN1A 2R6OA 4IM4A 2CLKA 2O7QA 3VOGA 4UQ9A 1I45A 1VEMA 4ZFCA 2AGTA 2VZVA 1SZNA 5A2CA 1H62A 1F76A 2WWDA 1TRDA 1PX3A 4V27A 4O1CA 3K8MA 5T26A 4QAIA 1X7IA 3GXIA 4F0KA 5BWFA 5DF0A 3W7GA 3HU7A 2GVEA 3RCYA 3G1VA 1BSIA 4FX6M 3ZXWA 3B0XA 1PS9A 3E0WA 1TREA 3CTLA 2BY0A 1FCVA 1V4YA 4UNLA 1ZGDA 1EA9C 4GIRA 3VGFA 3UERA 5TQLA 1CZ1A 2QZRA 5KSWA 4X0VA 1NDYA 4JTHA 3VD4A 1ISXA 2JKPA 3C86A 4AVOA 3I4EA 5DMLA 3I3EA 3LZ3A 2A3BA 4C7FA 4PMDA 3WLIA 2D22A 1HF6A 3GLCA 4G2DA 1B9ZA 4O0KA 2A6LA 3ZJ8A 4AMCA 1EOMA 3EB4A 1YTKA 1CLVA 1WNOA 3RM9A 4H41A 3DN5A 1L6SA 4C5ZA 1XBVA 3UR7A 4FR1A 3WSUA 2ATSA 3PBGA 4QAWA 5LIWX 2YA1A 3OIXA 4CD5A 3BOXA 1W1B1 3MCMA 4LAMA 3TYZA 4LCQA 3R8GA 3CIVA 4C6LA 5EMJA 2PLKA 3MSGA 2XHYA 3SRFA 4WCJA 3MCOA 3GRIA 3OVQA 3D0CA 4DAIA 1FY6A 4DF2A 4Z2LA 3E5PA 4QBXA 3VE7A 1D3HA 3LI1A 4MM1A 2I5GA 4J35A 4JNYA 4O12A 3M5ZA 4WXYA 2VX4A 4TVUA 4WDTA 1TPEA 1NQ6A 4LH8A 2PWDA 3A13A 1QNOA 3CL8A 4JNZA 4OTKA 3I6TA 1ECEA 1ZAHA 4HOWA 1PX4A 3NPUA 3B8SA 2IKGA 2XGZA 7TAAA 1SPQA 1NWTA 3VZXA 3UF9A 1M7PA 4JYEA 3VTRA 4P7LA 2DSZA 3DCPA 3LLDA 4C6IA 3PSVA 4PN2A 1KR1A 3A9IA 3BXWA 6ENLA 4TQTA 2DSVA 2A0NA 2XN0A 5HA7A 4B5VA 5G2WA 2XWEA 1KTBA 2YX0A 4ALDA 2JF7A 1EEPA 4ZR8A 3R43A 3JU2A 2C14A 4BF7A 3F4VA 4S3CA 1AQHA 3WELA 4OKDA 3W81A 2DH2A 1JCJA 1SQ7A 1LWHA 2G5WA 3G0XA 3DERA 1XYAA 1FDZA 4QITA 4DYKA 1BQCA 4MMWA 3AAMA 1T40A 3H54A 1RCQA 4WOQA 5CXPA 4N7QA 2BASA 1W6TA 4X22A 4L4OA 1WV2A 3RU8X 1SO4A 2INZA 4NKCA 3DFNA 2XIOA 3QMRA 1V6TA 3T4WA 3BCDA 4IP7A 1T8XA 3SCPA 2XINA 2P8BA 2FVKA 2PLCA 1E4NA 3NO3A 1GKRA 3ZM8A 3UWYA 3MV01 1PHQA 1QK2A 1JXJA 1QI0A 3QZ6A 2NQHA 1YNQA 4D6HA 4O8RA 2CITA 2X41A 5DCEA 5FEZA 4S1FA 1JPDX 1JDEA 2TYSA 3B0UX 3O9NA 3ZLHA 3A22A 3EYPA 1RD5A 3SCVA 1KM0A 4LUYA 4IT1A 5I79A 1A3XA 3TW9A 4W8LA 1UPMB 3PFRA 2WZIA 5BZAA 2QCNA 3A4JA 4Y96A 2QCLA 4S3EA 4F8XA 4HMDA 4U2YA 5BRPA 5H6HA 4NJKA 3IV8A 1AL7A 2OZ3A 5AFDA 2G3MA 4JN8A 2OLHA 1BG9A 4RZ5A 2A7NA 3GFZA 1XBZA 1EZ2A 2ZUUA 4LC8A 1TV4A 5A6SA 2RKXA 5GPRA 2Z6IA 1TKKA 1JF6A 2TSYA 3CO4A 3C0QA 1HGYA 3IAQA 2XFFA 1PVNA 2UY2A 4WY0B 1VENA 3NSMA 3BAXA 4JY9A 1IXOA 3B0YA 1UZ4A 1TQXA 1GOKA 1E56A 5I02A 2A3HA 4GMEA 3QOKA 3PZTA 3GDRA 2TAAA 4W7WA 2VD8A 1AQ0A 2ZA3A 4JN6A 3BSHA 4Q4KA 1MI3A 3O0KA 3GUWA 1UKSA 1YDOA 5LGXA 1BKHA 4MVAA 3W1TA 3W7QA 1NWUA 3D3FA 4DM1A 5GNYA 3BO9A 4Q8PA 1O1HA 3IJ8A 5AHLA 1UCWA 3VFLA 2O9TA 4A8IA 3FKRA 3W7HA 3QXBA 3FXGA 4E2DA 3VNMA 2WQDA 3KEHA 2E8YA 3R10A 5FJIA 2DUAA 1DPMA 1CENA 4JIIX 5LXXA 3P80A 3QZAA 1RUSA 3XISA 4FO4A 5K3VA 2WMHA 2ZRXA 2BVYA 3O6DA 4Q7NA 1GORA 1CEOA 1FTXA 1E51A 2OKTA 1LM1A 5DBUA 1C91A 1GEHA 2C71A 3TJXA 4HA0A 4DO5A 2X8RA 1M9HA 2ALRA 2YYTA 2BFGA 2DIEA 5H91A 1VFOA 1ICPA 2CZEA 4BF9A 5CPNA 3CJPA 3CIXA 3S5YA 3HURA 4LUTB 4QR6A 3RX3A 4J3TA 5FJUA 4LUSB 2XFYA 1R9YA 4GC4A 2FZ9A 3WQPA 2WCGA 2JGYA 2YA0A 3ITLA 1OD0A 2W4XA 1X8CA 2Z1KA 5M3WA 3VK5A 3UP8A 1FFRA 3NTYA 1N2VA 4F9JA 1GTEA 4LAOA 2W91A 3ZS4A 1F05A 4GBUA 1HFBA 4DI9A 3ZSTA 3WH6A 4EKJA 2PD5A 3H21A 3DBNA 5EGRA 3S9ZA 2YL5A 4H2HA 4RLIA 1XBYA 3GDTA 3V7PA 4EXAA 4AMAA 4FXRA 4JQ1A 4UWMA 3AMKA 4KFOA 2YXGA 5HPOA 2GSHA 5E09A 3IEBA 1GYNA 1XHGA 2W63A 3POHA 3LMYA 3MI6A 3I3DA 1J0HA 3ES7A 2Q02A 5ABGA 3SIMA 3NQ2A 1NARA 1Y7VA 3WLHA 3E1F1 3BH4A 3HQPA 1I4NA 3S2CA 3M0IA 1H61A 2WMKA 3B8TA 1UWTA 3IJ6A 4ZOBA 3A9BA 4AB4A 5A69A 3IRSA 2P0OA 3TA9A 3ARPA 2ZFAA 2DPEA 3M0HA 1VEPA 4HNOA 2Z7KA 4U5IA 4BS0A 4GVGA 3TN3A 3BW3A 1DXIA 3AIWA 3RK8A 4BWLA 2QF7A 5ABTA 1KBLA 1IEIA 2BGNE 1OCNA 3H26A 5BMXA 2QDHA 1JCMP 3NL3A 2OYKA 1QRQA 4GH3A 1YW1A 3KL3A 2FPTA 1H60A 1PWMA 4PMZA 7A3HA 1WDRA 4PUWA 2O4QA 3EOOA 1ZP4A 4DZHA 2NLYA 4ZQNA 1EYWA 1NTHA 1S2VA 5G1MA 3GM8A 2DW6A 3Q94A 4K36A 2JQXA 3HIJA 2C13A 1JQXA 2WPBA 3TTSA 3ZZ1A 5BCAA 5I7GA 4O1FA 3E0IA 4Q4SA 3RX4A 1B4EA 2XH7A 1IZKA 1P1XA 3BGAA 3K8LA 4FNTA 3F4NA 2MUCA 5A8MA 1HX0A 4C90A 3CUGA 1TE1A 1XKYA 4ICNA 3VMNA 3SSJA 2VCCA 5DX7A 4QP0A 2QCDB 4AD3A 3WJWA 4JTFA 4JTSA 1DJYA 3M43A 1Z41A 1PEZA 1KBBA 3HV8A 4REQA 4W87A 2E6YA 1OADA 2EPHA 1UH2A 4WKFA 5LNSA 3BLDA 4N6EA 4Y8EA 3AISA 1EEXA 1WKYA 3P62A 4FOKA 3VYLA 1TMQA 3GK0A 4CQ8A 1NWRA 2FHCA 2I5QA 2HVOA 1X97A 2PP1A 2BXZA 1JDDA 4DYJA 2EHHA 4BI7A 2QCGA 4W5UA 5E6YA 4O4WA 2NQ5A 4ZE5A 4W5ZA 4P7OA 3QFEA 4HPJA 1T6MA 1AA1B 4ONVA 2NWSA 2VOMA 4UQBA 2PAJA 4B4HA 2FPVA 3BCJA 3TJLA 1DQXA 2PD9A 1A5MC 2GGGA 1LOQA 2C0AA 1GNXA 3TC6A 1P43A 2YCLB 1V5XA 4O18A 2CESA 3DC8A 1DYSA 5CJNA 2G4JA 4ZB2A 1PZ2A 1GJPA 3URAA 2VGBA 3AXHA 1EF3A 1WOAA 4GH1A 1E0TA 2G3FA 1RK5A 2Y85A 4Y9AA 4OZOA 4Q6JA 5E9XA 3PAOA 3CQ0A 3N04A 2GVGA 1VBJA 4RW3A 2OYMA 1EWEA 1NSJA 2UZ9A 2E09A 5EL1A 1JD9A 3MW7A 4L1XA 3CPUA 4XZLX 4Q8VA 2QJHA 3L2MA 8A3HA 2DIJA 2E6FA 5G4HC 3H8AA 1ZUAX 3H7RA 1OGSA 3IPWA 2BHYA 5IOBA 4U28A 2P53A 4ORMA 5JXQA 2IQDA 3VABA 4AIEA 1BVWA 1UC5A 2QULA 3B97A 4ATWA 3P2VA 5ABFA 4PEKA 4RV8A 1LOSA 4JEJA 3W0KA 4JL2A 3FHQA 1VS1A 2HDJA 4JCLA 1HVQA 2OZ0A 3L66A 2X0HA 3W2UA 2BY2A 1QATA 3UEQA 3H53A 2Y5JA 2F84A 4W7UA 3D6NA 2AMGA 5LSMA 4LVBA 1QFEA 9XIMA 3M6YA 1YKWA 2J9XA 4WJEA 1E1CB 1K8YA 3QGKC 4QE4A 4PC8A 5CC6A 1GOWA 4AG0A 2BHZA 3SR7A 3OQEA 1XIJA 2DY3A 5HINA 1KFWA 3IK2A 3IK4A 3L2IA 1AH0A 4BQ5A 1CT5A 1VR6A 4LUTA 4FSAA 1Q7QA 2X0YA 4J9JA 4LUSA 5KZMA 5JH2A 4NJGA 4LNCA 4ZQPA 1R3YA 1UWRA 4HVXA 1AMKA 1J18A 2BX7A 1FXPA 1R2RA 4FOJA 3VE9A 4AX7A 1GW9A 5CLTA 2JKAA 1S3TC 3BGGA 3G1XA 2Y70A 1GHSA 3GNOA 3WNLA 1FH8A 2D69A 4QEHA 4QJ3B 2DJXA 5LIYX 5A8GA 1GZGA 4FNRA 3NDYA 3OA5A 1SFSA 3V16A 4IMCA 1XC6A 3W2NA 3VNKA 5FF7A 1PAMA 1QBBA 5MF5A 1KFLA 3G5EA 3EX3A 1F8MA 3MCNA 2H8ZA 3E02A 2V81A 3RLVA 5IFPA 4LFYA 1I2QA 1JYXA 5G1YA 1D3CA 4X3ZA 4NAFB 1HL2A 3WLPA 4RDZA 5A6TC 1Q4NX 4LF2A 3S2JA 3N9KA 1SJAA 3OLGA 5LGZA 4HGXA 1E71M 1TPWA 4FNSA 4QCEA 4NVTA 2ZZ1A 2IUZA 3FYYA 3GFXA 1CXLA 1K7XA 1OFBA 4BKNA 3RJXA 1IXQA 4QLLA 1HN1A 2WYSA 4OIFA 2NV1A 1UA7A 4MADA 4C6OA 4S3GA 3W74A 4UFMA 5E70A 3PWIA 2J75A 1XRTA 1GT8A 2YDRA 3T8QA 3SECA 2GGIA 5DMNA 4AU0A 2XVLA 2X1UA 4WJXA 4HSNA 4MZ1A 3RPDA 1P5BA 3EMCA 1KFKA 1RR2A 1RPXA 3H55A 2ZOXA 1UR0A 2BV9A 3GBDA 5BOOA 2ATMA 4YYFA 1XCWA 3HFYA 3N2BA 2OVLA 3CC1A 2Y8KA 3GO2A 2X2GA 3G8RA 1NU5A 1EP1A 3A4WA 2GDVA 5BW6A 5BRQA 1ODZA 2ZX5A 9XIAA 3KX6A 3W71A 2DP3A 3ALFA 4JFVA 2V3DA 2WNZA 2QV4A 3NQDA 3SY8A 3MTWA 3NOYA 5FCZA 2CC0A 3ABXA 3Q65A 1HIZA 4NF7A 1EGMA 1HQTA 3S6DA 3WFLA 4JICA 1KCLA 3QR3A 2W92A 2ZC8A 3P81A 3LU2A 4K38A 3OOQA 1OFOA 5CPTA 3HMCA 2CKSA 2XVPA 3N2TA 3AYVA 4N0RA 1XWYA 3KL5A 3URNA 2TODA 1FWNA 3AXKA 4TX9A 3DX5A 4TOQA 3EDEA 4MGGA 3FJLA 4GY7A 2QJNA 4DIAA 3E2QA 5DMYA 2Z1BA 4IF2A 5PTDA 1IIHA 1RP9A 4Y7EA 4XKMA 1JFXA 1F9CA 1XCXA 4U33A 1G4EA 3WNKA 2ACSA 1R8LA 1R38A 3ABOA 2A7PA 1KLZA 1ZJIA 3MBFA 3TKFA 3W7RA 3A4AA 1S5NA 3AC0A 4RPQA 2DVTA 2PDCA 3LV6A 3LPGA 2PI6A 3WQOA 1GEQA 3II1A 4QQ3A 2YPIA 5CBJA 5F1VA 3S6OA 4ATLA 2YCLA 3STPA 3LY0A 2PWFA 3M16A 1Q63A 2XU2A 1XV8A 1ME9A 4JTJA 3TJIA 1MVYA 3SQMA 2PDXA 1LOLA 3IUIA 3H2MA 2ABAA 3B8IA 4DBEA 3AO0A 5K2ZA 5BMWA 3CQJA 3IS4A 4XD6A 3VDAA 3DYPA 4KWUA 3IUDA 2JFEX 5C70A 5JIWA 1UZHA 2GDUA 2GOUA 1D7FA 4YTQA 4AD1A 2OEKA 4H19A 1HJWA 4GABA 4DUVA 3MSDA 1MEHA 4GI8A 5A8PA 1DQWA 4M1RA 4GVHA 4PTVA 1QMLA 5CBBA 3P5ZA 2XM2A 1PWLA 3MZNA 5I23A 3T4CA 4PUMA 3N2MA 4JIPA 5M5DA 4GZEA 2ZWZA 2X7WA 2DVXA 2HMCA 3M4HA 3A21A 1W3LA 1QNRA 4XWUA 3WQ5A 1IHIA 1CGUA 4BZYA 4L7ZA 4AVFA 1IXNA 1FWWA 2PS2A 1PIIA 1WUFA 3O63A 4O15A 3UPMA 2PEVA 3FAWA 3HB9A 4MKVA 4DQWA 4O8AA 9CGTA 4WD0A 2VWTA 1JZ6A 2YIHA 2RJHA 4PFMA 3RN6A 4IG2A 3CTTA 1RVKA 1VHCA 2QIWA 4QHRA 3LM3A 4XAFA 1SO3A 5G2HA 1GOXA 4NU7A 2J9ZA 1FP9A 4GO8A 2O9OA 3STGA 3KM8A 4H9XA 1Q6GA 4HD5A 4WXZA 3S1GA 1DE6A 5A3HA 1TRIA 3PTKA 4ZQOA 3N73A 2IS7A 4N9CA 1AODA 4KEMA 1RAKA 2W66A 3P8IA 4Z1BA 3TCEA 3NWRA 4LUJA 2FDSA 3BJSA 3JS3A 4GE8A 2F8QA 5HATA 2YB4A 1KXTA 3KP1A 4A21A 2WMFA 1VD6A 5JH1A 5CG0A 2WBGA 3LZ5A 3C56A 1OZMA 4LALA 1A4MA 1K6AA 4RKAA 4PMJA 3UPBA 1PCWA 4NJIA 4ZQRA 1HKIA 1OFAA 3DC0A 1H51A 1H7XA 1FWGC 3VMOA 1W56A 2PWUA 2XVNA 1C8XA 4GXMA 5FA5A 3LUTA 1NDZA 5AHIA 1DWGM 3ES8A 1AUSL 3GWQA 2OEJA 3DFSA 3VC5A 3AALA 4JEQA 3UR8A 4HZ8A 1IEQA 1TVLA 4Y2WA 3VIMA 1FHDA 4IHCA 3KZSA 1F2JA 3GG8A 4MWAD 3U9IA 1L2QA 1VBUA 1DP0A 1G4PA 2X40A 3NQAA 4AZ6A 1QR7A 3JW7A 1PYMA 3ABZA 5BXRA 1S1PA 4PRRA 1EQPA 3QW4B 4MNLA 4IQDA 5AHFA 3HZ3A 3FX4A 1XD0A 5FJPA 1VAHA 3WBYA 5CCZA 3W3OA 4YPJA 5M2FX 5BU9A 2WQPA 1LDCA 5BYWA 4MFDA 1DHKA 2C91A 3L4XA 4KEZA 1SSDA 1Z7AA 4B3LA 4PMXA 3LQLA 1OB0A 3L0GA 4GLEA 3PB0A 4DLFA 4PULA 1FHLA 2A5HA 3V5FA 3TCSA 4GNJA 3SUUA 4W84A 3W53A 3SI9A 5FAGA 1NF7A 1VJIA 1EP3A 4W8AA 4XZIA 4YLWA 2VFIA 4CN1A 3LRLA 4DJEC 2P76A 3ZQ9A 2CZDA 1JCXA 3L4TA 4PBGA 2QIIA 4IQJA 2P3ZA 2YGYA 4E2BA 1DL3A 1RHCA 1UD2A 2B7NA 4WUIA 3WQFA 1XSJA 1XM3A 1B2YA 3QC0A 2V0TA 1QASA 4PSRA 2YL6A 3W4RA 3NL6A 2H6RA 1BQGA 2FGZA 4IIBA 2EG7A 1TA3B 2WM1A 4FLOA 4A6GA 2NQZA 4NNBA 5EBUA 4CNUA 3PJWA 4U5KA 2I16A 4LB4A 3BDKA 1JZ5A 1XSIA 1AW1A 1MEWA 3XINA 2IMRA 1W5OA 1TUFA 3UWZA 5I2UA 3HV9A 4IL0A 1OCQA 4MYAA 1CW2A 3PJXA 4PCPA 3TYCA 1WDQA 3ZFHA 5ABHA 1RQBA 4XAPA 2FJKA 4CVWA 2X16A 1FH9A 1R9XA 1LROA 2PWHA 2NVAA 1WQ5A 4MWAB 3S3GA 3USBA 1AZ2A 3BMWA 1JULA 1MW1A 4AZ7A 2VDGA 3DHDA 4DXXA 2HK0A 5IHRA 4P7QA 2WVUA 2CEQA 1CI1A 1TJ0A 2PUZA 2QVHA 4TMCA 1MUWA 4BK9A 2XUCA 3A4XA 2XFRA 5IHSA 2OT0A 4LVAA 4Y6GA 3ZLGA 1X6NA 3AWNA 1UHVA 3AXXA 4J3ZA 1EDQA 1SUXA 4NYYA 3WL0A 3G1HA 2BVTA 3WLOA 2GSEA 2ZKMX 1QWKA 1ME7A 3QV7A 2D2HA 2V5CA 3L5MA 4E3TA 4Q8UA 2YDAA 3SURA 5F2IA 1HKJA 2ALDA 4YIWA 2B0MA 3LYEA 2W79A 3DG6A 1VZWA 3DESA 3GG1A 2VUNA 3GKFA 4UTWC 1MUCA 4M7TA 4YVXA 2BSLA 2PLMA 1TELA 4I7VA 4HYVA 4HPGA 1H4PA 2AKMA 2ZRVA 2PGFA 1ELSA 3BGJA 3NPXA 2ZQ0A 1O95A 2OR2A 5LIXX 4DUOA 1BVNP 1LTDA 1VEOA 3H2FA 3VGGA 4Z1AA 3GS6A 3FA3A 3C8FA 1F6PA 4B5SA 1UOZA 1OIMA 3I7RA 3LGGA 3ZR4A 1OYBA 3MS8A 2VYOA 2WB5A 4TUFA 4TO8A 1AVAA 3Q2DA 1ZRQA 4KF1A 3HQNA 4E0CA 2D2GA 5T9BG 1NF0A 3N25A 7TIMA 1XR2A 4LVFA 3WF0A 4UTHA 3MKKA 1G4TA 4U10A 4OOUA 2WW5A 4ROPA 5LHEA 3V0UA 4JHOA 2QCFA 2NLIA 1FQ0A 3G0UA 2BLEA 3D47A 3QSTA 4R88A 5C9RA 4UTFA 2PE4A 1OFPA 3B4UA 4HHHA 2D0HA 1BTMA 1XYBA 1H0GA 4HU4A 3LHVA 1J10A 1KQZA 3H12A 1EQCA 2A4AA 5CSUA 2H3DA 4GWEA 5D8WA 3BAJA 1KGUA 1OWQA 3VX0A 5DELA 1QPKA 2Y6ZA 4MB4A 5CZJA 5C8BB 4Q4OA 1KM6A 3NPWA 1ONWA 4I6VA 1P0BA 3VDCA 3N13A 1PCKA 1YPXA 1EJWC 3NR0A 2NQJA 1PO9A 4UTJA 3SUWA 1I8JA 3RO8A 2YBTA 4TX8A 4ZB0A 4LC6A 4BEUA 3AJXA 2Q8LA 3V5OA 2O4MA 1TTJA 4Q4MA 3B8UA 3APYA 3KAOA 1JZ7A 3K13A 3UCQA 1Y5XA 3LNMA 1IXPA 4WEVX 4JX6A 2PDQA 2XN2A 3TTOA 4C6FA 2TRSA 4U4MA 4ZZ9A 3TE9A 4MG4A 2R1MA 1W1YA 4XO6A 1GOOA 4HTYA 1JCLA 1Y8BA 3TTQA 2ZZ6A 1ENUA 1U2YA 1MNZA 2ZUTA 1QXLA 6A3HA 3GH7A 1TZ9A 3W7IA 3TMQA 1QJWA 1W3IA 4MJ4A 2YZRA 1JAEA 3P0WA 3GY1A 4TVCA 2VDIA 2IKHA 3B0VC 1KRMA 1TMHA 3WBXA 1TE6A 4KWSA 1FDJA 4XKYA 2Z25A 4OECA 2JBMA 5AKQA 1KTNA 4Q33A 4GA8A 4ZODA 2E5CA 2C1GA 3SCOA 4CEUC 4OFCA 3ITVA 4UC5A 1FCBA 2B7QA 3I65A 3ZR5A 5ENLA 3CNYA 3PPGA 4HJFA 1I0BA 1PKLA 2ZE0A 4L56A 3TW6A 2QPUA 4XK2A 1KXQA 1A5LC 1TA3A 3T6CA 4BJHA 2CLOA 4D6EA 3BV4A 3QOMA 3OVPA 1IYXA 3G1SA 2VUYA 1Q2SA 5GJMA 3D5HA 3HOJA 4JX5A 4UFJA 2RHGA 8TIMA 3VIOA 2NUXA 3K4AA 5DN1A 4IIEA 4ZEPA 1DWAM 4ERIA 4HHLA 3RILA 4WY0F 4S23A 2IXUA 3CGTA 3IJ9A 1GQJA 3M46A 1EBHA 3VVGA 2JIWA 5B7ZA 5FL1A 2Y7EA 3AYSA 4DLMA 4Z42C 6XIAA 4C1NB 1Z44A 5CZKA 3TC7A 3W2KA 1SGJA 5C9ZA 1FDYA 3TWAA 3CS2A 3GDLA 1NP0A 4EWND 3TWBA 4DO6A 3LCFA 4DB7A 1HJUA 3NYZA 4A3YA 3FK4A 2WHJA 1TIWA 4FF7A 1M5WA 2WM0A 5BOEA 3AIBA 2VENA 3PN8A 3USZA 4AIOA 5CPOA 1KQYA 4ZE4A 3O06A 4CNPA 4S3FA 2XIBA 4XAGA 2EBNA 3MVIA 1SO6A 1H50A 2VELA 2AAMA 4F40A 3WMSA 2Q3OA 3LCLA 2QF8A 4G1KA 1SO5A 3RG6A 1LBMA 1JDFA 3EDDA 2NX1A 2QJIA 4C1LA 1UG6A 2ZVRA 3RMJA 5HDRA 2BOGX 3SJ3A 2R1KA 1Z69A 5C9UA 4CD6A 3ID7A 1TPFA 4RNHA 4PRWA 3R4IA 4CQBA 4XD4A 3B3DA 1CNVA 3PB2A 4G9PA 3GZAA 1VFUA 2CKRA 3UXLA 3WNMA 3V0TA 3DXIA 2YXOA 4ZTXA 3PHAA 3LHUA 3AXIA 3FVDA 4LNYA 4E8GA 2DIKA 5I77A 3IVUA 1IV8A 1N8FA 2AQOA 1IT0A 1S5MA 1FHUA 4FIQA 5FF3A 1QT1A 1TYGA 1XLLA 3MU7A 4JPGA 4DJED 4MUZA 2HBVA 1MO0A 4L9ZA 2NUWA 1LYXA 3ZVIA 4XZHA 1E0WA 1R5YA 3W1PA 4EX4A 1EIBA 1PKYA 3G1YA 2XSBA 3FN9A 3AI0A 3W73A 3SCUA 1NFBA 3QH2A 3BANA 2PGEA 3V36A 2V30A 4E4FA 4QDWA 3NJ3A 5GQBA 3EX1A 4WR3A 1Q66A 1UW9A 3TX9A 1Q6LA 4F2UA 3KVKA 4IUOA 3IIOA 1UIPA 2BOEX 2Y0FA 4IICA 3MBDA 5AHNA 1F8IA 4C5YA 1W54A 2D3NA 7REQB 5HQEA 3NQCA 3WLMA 2XGBA 1PZ0A 2W6RA 2V5BA 2QVNA 3NSXA 1QOQA 1GUVA 2D23A 3RGTA 1E6RA 3WEMA 2V67A 1K9DA 3W2MA 5HULA 3BLEA 5A8NA 4MB3A 3CYVA 2J8FA 2AMXA 1QW9A 3PC0A 3EWUA 1JQVA 3ANUA 4H9UA 4HMNA 4AVNA 1X98A 1W5NA 3KHDA 5J5DA 1YBQA 3GW3A 1SJCA 5A2BA 5H2ZA 3UPWA 4FXJA 2VVSA 4K3ZA 4KQNA 5FJJA 2V63A 2IW0A 1RBLA 1E1FA 2CLEA 4OT7A 5GNZA 1H1ZA 5BRBA 2CHOA 4UFLA 1V51A 3CEUA 4YTUA 4I9JA 2D2JA 1SFLA 3W6YA 2VXNA 2CXEA 1S5WA 1V3JA 3BLIA 1TQJA 3PZOA 3EX4A 3M0MA 2J8GA 4GZIA 4HOZA 3QKZA 4PODA 4J28A 5HXMA 1A49A 2ZZ3A 5E5CA 4Y8FA 4BI5A 2VEMA 4H6EA 5SWUA 1JYVA 2VC6A 3TQPA 5HNRA 3KXQA 3W85A 2BXVA 4QIUA 3C61A 2VT0A 4JNMA 3OVGA 5E93A 3W27A 5D2VA 1DWFM 1TJ1A 2PDKA 4OBRA 5CZTA 4IIFA 3F4WA 3V0SA 4O1DA 3W76A 2A7RA 4TTUA 3VO0A 3GNNA 3BARA 3B9DA 2ON3A 4LRSA 2PC4A 1FX6A 2WXDM 4PTNA 3FIGA 2P8CA 3DFQA 2C1IA 2PFHA 4LU0A 4ZL1A 3QR0A 5CC7A 1ICSA 3ZVHA 3S8HA 3LRMA 2WVVB 4C6JA 4US5D 3ELFA 1HG3A 4CD8A 3GVGA 4CNNA 1NELA 3P8JA 3KBJA 3GDBA 1LG1A 1FWTA 1VCVA 3RR4A 1V0KA 5CBIA 1UZ1A 4GYPC 4IWWA 4HNTA 1V3MA 2OQHA 2E5DA 3BAKA 3R6IA 1W1VA 3AICA 3FJ4A 4PMRA 5CPSA 2UWFA 3CZ8A 2FPYA 4XTDA 3LPOA 1EJRC 1XYLA 4GNVA 4QROA 4ZOCA 4Y90A 3G1FA 4I5UA 5AZ1A 1XLEA 1OABA 1WXJA 5F4SA 3QV9A 1VRXA 4RZ4A 4LTSA 4Z2KA 1LL7A 1MFUA 4BF5A 1BYDA 4AXNA 4TR9A 3VNLA 3DUGA 1G5AA 3LCGA 3GXDA 4D72A 4YYCA 5HMFA 1XS2A 4J27A 3R5EA 3HGRA 1UWUA 3L0KA 1B3XA 1KBJA 4C91A 1HJSA 1R46A 3QLDA 5AZ0A 2ZUMA 3BOLA 2GVLA 4M56A 4AF0B 3UJSA 3CUZA 4WGHA 3LTPA 2PDUA 1LJYA 5A6LA 3WEZA 5TD4A 5A6MA 3S5SA 4R9XA 1QOXA 1TJRA 2CYGA 3IJDA 1YNYA 1TIMA 4MY8A 3DFHA 1MW2A 4DJDC 3A3XA 1XPGA 1IEWA 4FPSA 4AFYA 1LL6A 1DIKA 1XIBA 3UWVA 1XH1A 3IAPA 1FVPA 1GQKA 1OFRA 1GGOA 3OLEA 2POZA 4H9MA 4PSPA 2FLIA 3L4ZA 4MKNA 1A4LA 4HSOA 1IEXA 3O3RA 4RE4A 1R86A 2DFAA 6PTDA 1C7SA 3F03K 4WRHA 5HUPA 3BWWA 3KRUA 5LA2A 3UA4A 3V35A 4GFIA 3SRDA 1TVNA 1SSGA 1PBGA 3NAVA 1C9DA 2NWRA 2V3GA 4IL2A 4KGLA 4X9SA 2CBUA 3P84A 4PUNA 4U31A 2ZXQA 3WLNA 4NILA 3NQGA 3IUHA 3VOHA 4DX3A 3ZJKA 1LWJA 2PZNA 3FV9A 4J3WA 3C0LA 3FW6A 2OQLA 4Z2GA 7REQA 1QO5A 2DDXA 1W9DM 2D2OA 4FK9A 1YXYA 2RJGA 4TIMA 5TF0A 3BV7A 3VM5A 1DQUA 3TV8A 4OVXA 2WC7A 5HNTA 3MYOA 1JD7A 1NVMA 2V69A 1XLJA 2J78A 2GK1B 4A3HA 1MMFA 1VFMA 1I2NA 3VOIA 4QLKA 5FF0A 3PZIA 1CB2A 4PA8A 2PDHA 4OGZA 3SFKA 1SZGA 1UWQA 3C52A 4HIBA 1BPLB 3PAJA 4HT3A 3WK1A 3QJAA 1V3IA 2Z2UA 2FH8A 3M7SA 2PODA 4HCDA 1QW7A 3WDPP 4ZO8A 1EYEA 1KFCA 3OG3A 2OCZA 4GJ1A 3W28A 3SY5A 1K3UA 3RYSA 2E25A 2ACUA 4KETA 3FEMA 1ML1A 3CPGA 2VZSA 2ZE3A 3I6RA 3MMTA 4RV3A 3SUVA 2WKLA 4MPKA 3N17A 3DECA 5BXSA 1EZWA 2EPOA 4RK8A 1X1NA 3U8GA 3G2GA 3CWOX 1KW1A 1Q45A 3AHTA 4KRUA 3PUOA 3LCHA 3F1QA 2O9RA 1JL8A 3N9SA 2DORA 4AX6A 5H8PA 4FNUA 3ZT7A 4F0LA 4MNKA 1LP6A 3W7PA 3RITA 4DJEA 4Z08A 1J79A 3F2CA 4GY1A 1WAWA 2F7FA 1F3WA 1E4LA 4PMNA 1PHWA 4JTGA 4G7EB 4JTDA 2J7HA 4NXKA 3SCWA 1E43A 3MVTA 1C7TA 5DRCA 4JD4A 1I2OA 1XDMA 3F4CA 2D1ZA 1YQ2A 1QI2A 3DG3A 3TR9A 1SZRA 1C92A 4WIWA 1VPYA 3QZEA 1G9HA 3WH7A 3TC3A 2HVNA 3BLOA 3F2DA 3HPSA 2OLSA 1OT2A 3BZJA 3GR8A 3MY9A 4AY1A 3BW4A 2GJXA 3VDHA 1F4AA 3B8VA 4D6DA 2DZSA 4KWVA 5CSYA 3TFXA 4B2DD 2XISA 3K2GA 4UTTC 3WD2A 3LB0A 3GDKA 2JK2A 1W5PA 2XVKA 4EPDC 3B8DA 1AFSA 2HE8A 3E2SA 5A95A 3GTFA 4IXHA 3EMQA 4YN5A 5G4WA 3DGRA 1X8FA 4NZJA 1N8IA 1TSIA 3C2EA 4XBJA 3BK0A 3GVQA 2CXGA 4HZ7A 3KTXA 1B3VA 1P0NA 2KAUC 3WQCA 4KRZA 4ZTYA 4F2BA 5ECUA 2OPJA 1T96A 4H7VA 3IVSA 4GO9A 3VD3A 4AAJA 5E6ZA 2ISVA 1V08A 1XSKA 3FAXA 3URQA 4GQQA 3EAUA 3NGFA 3ONBA 4N02A 2WO5A 3F5LA 3W24A 2QUMA 2EKGA 5IDZA 4JQ4A 1QBAA 3EB3A 2HXUA 2ZRYA 2QMJA 4IP5A 3N11A 9RUBA 3WO8A 1SR0A 3H4GA 1OG6A 3OGSA 3TXVA 3AZTA 4K8GA 3QKEA 2C6QA 5ABEA 2YFOA 4UB9A 4AHPA 5F2GA 3QTGA 5ECVA 1OCJA 2QAFA 1C8VA 3MQTA 4PH6A 4BEQA 3DEQA 4AF0A 4UTWA 4UNKA 4ZXLA 1FCQA 3V75A 1PIGA 3MP4A 1EPXA 3WDJA 4KWOA 1FOBA 4R5EA 4O54A 1W3NA 3WIJA 2VOTA 3FSUA 3TXZA 3PANA 3UWQA 3STEA 1WA3A 3PZGA 5CGMA 3TH6A 5KITA 2NT0A 2VC7A 1GVRA 3VD7A 2CLLA 3VUPA 4R34A 3BOFA 1ZLPA 6TAAA 2E40A 3SCNA 3VD9A 2FB2A 3ANVA 1IR2A 1GJUA 4MAZA 1A5NC 1YE6A 3SY1A 1B3OA 2Y2WA 1QNSA 5I0DA 4HPHA 3WF4A 1KFEA 2YCIX 4HNVA 1XUUA 3IIXA 1JDCA 4A05A 1XCFA 4LX4A 4O11A 3WH8A 3KVMA 3FSTA 2FIQA 1DJWA 1HKVA 2OX4A 2XYLA 4J3XA 1JI1A 2ZX9A 1E15A 3QMTA 5DBTA 4NNCA 4HU0A 3CZGA 3EBVA 3W25A 1ZBVA 1O1ZA 4KCTA 1W9XA 2VDHA 3KOFA 5DXYA 4PCFA 1H1YA 2PDWA 4P2VA 2ZUNA 3W82A 4OWGA 3KFTA 3DFOA 2QJGA 4JFTA 2OWXA 3ME3A 2G37A 2QUUA 3UJ2A 2NV9A 1KM2A 4K2SA 5K9XA 3FDGA 4DNMA 3RJYA 5U7SA 2QR6A 4DZIA 1M7XA 3RIKA 1H5VA 3AFBA 3QPZA 3W7MA 5TIMA 3VNJA 2X1TA 4L6HA 4LV4A 2YCEA 2WSQA 3A47A 1MW0A 3L2LA 5I6SA 1UD3A 3W86A 1P0EA 4KWWA 1JR1A 4QDMA 3GVVA 1H7PA 1KD0A 2VZTA 3PTQA 4OBTA 5F4WA 2ASHA 2FDMA 3NQ8A 5HQLA 1Q6EA 1Q6DA 4R7OA 4EP8C 1A3HA 1CX9A 3QV6A 3BURA 3IJ7A 3QPYA 3TU9A 4N4PA 2AL2B 1KR0A 1RLCL 1EXPA 7ODCA 4JQAA 4NY2A 2E6DA 1Q6RA 3IVTA 1HKMA 4DJDD 4WDWA 4BFAA 1C8YA 4UOZA 4UMAA 3AROA 5C2GA 4DNHA 2Y88A 2CERA 5M17A 2CLHA 2P10A 1TPB1 3SCQA 4RUBA 4H8VA 3WBWA 3A3WA 4AD2A 1YEYA 1JDAA 1UP2A 3PG9A 1XD1A 4NP7A 3T0AA 3STCA 1FWFC 1R2SA 4WX2A 4ROQA 1HL9A 1UH4A 2WZTA 4M0XA 1UR3M 2VURA 1ZHAA 4QS5A 5DCBA 3SRHA 3BVJA 1GK8A 4XZBA 2GFTA 4IQEA 5KZDA 2C15A 3L7RA 4ZQCA 4U3CA 3ZT5A 4GJJA 1XC4A 4AYSA 4HJWA 1O6IA 3G1DA 4ML4A 1T8QA 4V1XA 1QVBA 4TX6A 3QQ0A 4WOZA 2A79A 3IIPA 3KRBA 3RLHA 4LYRA 4L4MA 3HF3A 1VCFA 4KIRA 4NT0A 5FJTA 1CLKA 1JXKA 1JAKA 3OGRA 3BQ5A 3PJTA 4LCSA 1E6QM 3HPXA 2WJDA 1OEPA 1V7AA 4YVVA 1A5UA 1EJTC 3CUIA 2Q8XA 1Z48A 4C6QA 2XM1A 3B05A 3OLDA 3V1PA 2QCHA 4O0ZA 2E1DA 4QG6A 3PTDA 3QVQA 1XRFA 3G6MA 3W7JA 4LEQA 1B57A 3LXCA 1A5CA 3K8KA 4PMOA 2ACQA 1BFNA 1OC6A 2OFJA 2YB1A 3TDFA 4O53A 3LLFA 3P3BA 3C2VA 4PGLA 4NAEA 1TCDA 3T40A 3SBFA 2PRLA 5XIMA 1MXDA 4IPIA 1GQNA 1N55A 4H8HA 3THDA 4C7GA 1Q4WA 2EF9A 3CV6A 1IGWA 4QEEA 1L9WA 1M01A 2YBUA 4GGBA 1LQ2A 3RCNA 3W70A 4XD5A 3CO8A 4JIEA 3VIPA 2X1RA 3B9EA 1HW6A 3MMUA 1YHTA 3WG6A 4F0RA 3KDNA 3TVAA 4WSHA 1VLWA 3VIFA 3RR1A 1DTNA 4QJ5B 4I9MA 2XH4A 4GACA 4YVPA 4AY8A 2F61A 1LRTA 1V3KA 1JYNA 1HUVA 5C71A 2X30A 1W9BM 1WKDA 1HO1A 1HZYA 4R7WA 4RPPA 3LXAA 1E9IA 2XZ9A 4PMUA 4IMDA 4LY8A 1U5JA 3O15A 4WDUA 2QHAA 5A6BD 3ATZA 1FWCC 3FJNA 3MMWA 2B81A 4B2DA 3OBEA 5C54A 3LS9A 4JHMA 2PDYA 4DJFD 1R3SA 4IH3A 2DZVA 3HG5A 3QHMA 2J77A 1K6WA 4EXQA 1BGAA 2YL9A 3UQNA 3GB6A 1ECQA 2J7FA 4IPPA 2VVNA 3CQKA 3QY8A 4AH7A 3P6LA 4D9PA 3CAWA 3TNBA 3TJ4A 1OC5A 4HMCA 1H09A 4H83A 4YJ5A 2NUYA 2VR4A 3C0JA 1OQFA 1JRBA 3CL7A 2ISDA 4H3DA 4MSSA 1VBGA 4RXFA 2PA6A 2KZHA 2Y4SA 4D6IA 1E5NA 1M68A 4M81A 1EIXA 5DLCA 3UR2A 1FP8A 4C60A 4AC1X 2PP0A 5HJLA 3UCCA 3RNDA 3FA4A 4V1YA 1F3TA 4PBEA 3VKKA 3TN6A 2ZC1A 3BQ6A 3U2CA 1O5XA 2QPSA 2Q3RA 1R85A 1GOQA 3XIMA 4PTMA 1OFEA 3UG8A 2PBOA 3IGSA 1IWPA 1W1IE 3BW2A 1WP6A 4H9ZA 4NZCA 5A94A 1XG3A 1LLWA 1P6WA 2PDNA 3FCPA 2C3ZA 3DAQA 3SIZA 4GHRA 3BSMA 4OV4A 2F6KA 2GVYA 5BNKA 2VX7A 4JYFA 1ITCA 2XZ7A 5LIUX 5FSDC 5AYZA 2R8WA 1VFTA 1UBPC 1TWZA 3QYQA 1RZMA 5TAOA 1XQKA 4ML9A 5LNVA 1TUXA 4JTQA 3CZJA 4MNJA 4I90A 3EEZA 3RAOA 4KEVA 1U33A 3S5ZA 2I1OA 4NYUA 1XIGA 3TQ0A 3Q37A 3PTMA 1RA5A 3LBCA 4A3QA 3PY2A 5KEZA 1I1XA 6REQA 4Z2HA 1TWIA 3MKVA 3AHXA 5EFFA 2YZ5A 5E9AA 2W0UA 2QYGA 1J5TA 5I3DA 3BJFA 1ITXA 3T42A 1UKTA 1E70M 2A3LA 1QPNA 3KBWA 3WBAA 2ZA1A 3JR2A 2ZZ4A 4F0HA 4FX7A 5IRPA 4B9ZA 3L23A 1KNWA 2PF0A 3DHFA 3N14A 2V38A 3CQHA 3N9RA 4M19A 1M1BA 1SW7A 2HCVA 4C6KA 3T09A 1OYCA 4TU1A 1P7TB 2QDDA 2OX1A 5XINA 4AZCB 3PPFA 5IDIA 2FTWA 1UJPA 1K4GA 3OU8A 1VYSX 4L4PA 4GYPA 2NQ9A 4CKQA 3MC5A 1QU4A 1Y65A 4GISA 1HJXA 1JI2A 3Q58A 1Q6CA 2CLPA 4M80A 1KFJA 1J12A 3ZJ6A 3APTA 3H4XA 3WQ4A 1UR1A 3LRKA 3VA8A 2JALA 1DJNA 1E0XA 2MANA 3B9NA 4O0QA 2FVMA 2ISFA 3DZ1A 1NEYA 4J3SA 2Y89A 1XLKA 2V2DA 3C3UA 3NQ6A 2CNCA 5FJOA 1OFQA 2YFNA 4E2OA 3SGUA 4EAYA 2J8TA 1GYLA 1EGVA 1Z32X 3WKZA 5EMKA 4O14A 4KERA 3NZ1A 4XG1A 3RM4A 3VGEA 3EOEA 2PWVA 4HK5A 4D8AA 5HBFA 4MKSA 3VAVA 1GZJA 1R7OA 3WF3A 1KM5A 5I03A 3MPGA 5LKYA 3FYPA 4S2BA 3PFMA 3AYRA 4DJDA 4GZJA 1EDTA 3GG7A 4PYSA 3CLMA 4DEFA 5H8UA 4LSBA 1LCOA 1HP4A 4DBUA 3U7BA 1LBLA 1MNSA 4DY1A 1JPIA 2WMIB 5TNVA 2HPIA 4HZ6A 4E3VA 4AWEA 8XIAA 1BKSA 1L8PA 5IFTA 2J7CA 4V2XA 4NUWA 3GXTA 4LOCA 3GE7A 5M1TA 3W7LA 3WH9A 3GTNA 3MI3A 4PEEA 1C9WA 4ZFMA 4OJYA 5GJPA 5CGQA 5E0KA 3T55A 4V15A 1OYAA 3A5VA 2PTYA 1T5AA 2OSWA 4K7YA 3IWPA 2YJQA 3JZUA 3KBVA 1E40A 1UUQA 1Z8AA 1B3ZA 4WZHA 2H90A 3I7SA 4PE8A 1J6PA 1QAPA 3SJNA 3VOFA 2BG5A 2VEKA 3G3DA 4KEUA 4LS1A 3PZNA 3A6OA 4IPLA 4Q8MA 3O16A 4OQVA 2QEZA 3S83A 1LUCB 2D0FA 3THUA 4C6BA 3UY8A 3ARUA 4E6MA 4WKAA 4H9TA 5AOUA 1GPWA 3BLLA 3LI0A 3DYMA 4W9TA 4QRNA 3NQ7A 3ARXA 1C29A 2B7PA 4FI4A 3GC4A 3L21A 4H9VA 1FXQA 4JDYA 1XIIA 4MB5A 1ZY9A 5HWMA 3EPNA 1LBFA 2E9MA 4R7JA 3R8HA 1MW3A 1YMYA 3THAA 1TV7A 4PBFA 1E5JA 4O1EA 3K46A 1K7FA 3TYUA 1TZ7A 2G8ZA 1Q5MA 4JX4A 2CFFA 4O13A 3KOXA 3EOSA 1DV7A 3RM8A 1QO2A 2BY3A 2WSKA 1OC7A 3N6JA 3WUEA 1Q7MA 4M51A 5LXEA 3ZLFA 3R12A 3HTWA 4IISA 3QHOA 1OK4A 3VX1A 1VBHA 3BUVA 3W23A 4P8UA 3APGA 3W1NA 4D6JA 1A5OC 2FGBA 3E12A 4YXGA 3WDQA 3W02A 5HOSA 5MKGB 2VO5A 4EPKA 1MUMA 3HG4A 1V0LA 3R13A 3DENA 3B04A 3G24A 1VFFA 3TUUA 4YWIA 2DZAA 3CAKA 4PCTA 4R33A 5EMLA 2A6NA 2ONEA 5JMUA 3LQGA 1MEIA 3K30A 2BVDA 2ZTKA 4DELA 3STFA 3NOEA 1Q6OA 2EO7A 3BICA 1JNEA 4IX0A 4NL1A 1FKWA 4E5TA 1NJJA 2PF8A 4DO4A 1RD6A 5C0QA 4CNOA 2VEPA 2R9RA 4IX2A 3REQB 5JBEA 3M0VA 3P14A 2ISWA 1YIXA 1Q6QA 2Z0IA 3NO1A 2V3FA 5J04A 5F1UA 2HWGA 6CGTA 2OSXA 3HGOA 1GG0A 4L1GA 4NSBA 4FLQA 4HN4A 1JCNA 1LT8A 1V93A 2V5KA 2WC4A 5D2TA 3R1ZA 2YYUA 4PCSA 3S2LA 4GINA 4JZ5A 2LLEA 3L67A 4IPJA 4BQ2A 2PTDA 3NZPA 4OUIA 3KVJA 2NW0A 1XLGA 1E72M 2CBJA 2X05A 4RDYA 2QNEA 4K7VA 4LBRA 3VMPA 3KE0A 4URIA 4UTTA 2EPKX 3GTHA 1XLMA 4F0MA 4YCOA 4ZXOA 3RFAA 5CPLA 4GUHA 1DJZA 2X2YA 4UXDA 4UMCA 3NYDA 3T0DA 3VC6A 1P7TA 1RVGA 4LYKA 1QW8A 4AZCA 1DJGA 2Q71A 2VFEA 4LVGA 1OY0A 4QISA 2AL1A 5AHEA 4AWTA 4PUDA 3OA3A 2CHNA 2WNWA 2E5BA 1VYRA 3HFTA 3QGVA 4UZSA 5I3FA 4CU6A 3WQEA 3T05A 4S3JA 3LG3A 1XPYA 4MZ8A 2WMJA 3BAYA 4AHOA 1V3HA 4DWSD 1VYPX 5FIPA 5BXPA 1DOSA 1NOWA 3VFCA 2PCEA 4IMAA 5AYXA 3S42A 3WNPA 3WQGA 5CG7A 2DT2A 2H9AB 3HO8A 4NIRA 1UWSA 4KESA 3LTSA 2ZXDA 3VD5A 3H4WA 1GONA 1UP3A 1AZ1A 1IT7A 3EA1A 3E49A 1KFBA 2F38A 3FHAA 1E9ZB 4QFUA 2VI0A 5G2IA 4XO7A 1IEVA 3BPWA 1MDLA 1PKMA 4UIOA 2REQB 1RXOB 1UASA 3U4FA 2IXVA 4K8HA 3GW0A 3R79A 1DORA 3DHUA 1KCXA 1SJBA 4XSLA 1EFZA 2CETA 1S1RA 2GWGA 1TV3A 4Q4QA 1K8ZA 4ZBCA 3PBWA 4PUUA 3UG4A 3AIUA 3AU2A 4WY0A 1UKOA 3CB3A 1OBAA 2WJEA 4I7UA 2J7DA 5IXEA 4MWAC 3GD6A 3VNDA 4GQ0A 4IMGA 3SN0A 1XJBA 1XP3A 1P48A 2ANUA 2VP8A 4JQ3A 1VCGA 1OK6A 4S3AA 3IANA 3BAWA 4E8CA 3TR2A 1DEDA 3BLKA 1POKA 5LA1A 1IQ8A 2BXYA 4P8WA 2G3JA 4ADSA 4ZA0A 1ZBCA 3RPMA 2EKCA 1DXEA 5CLWA 3G8EA 4JQ2A 3MUY1 1UC4A 4CD7A 1V6XA 4A35A 4G1NA 1R7AA 1GJWA 1G0CA 4YS1A 3S0CA 1V77A 4NI8A 1BYAA 1E6ZA 1EJVC 1X7FA 5EMMA 4B90A 1XYZA 4GI9A 3F4DA 3PBUA 4G8TA 3R8RA 3I7QA 1ONEA 3WBEA 3H2NA 2ZX7A 3EWYA 3OZPA 2OJPA 4DBWA 4DWSB 2FZDA 3ENLA 4ADUA 1NWSA 3UZJA 5C9WA 2RDWA 2QDGA 4J2MA 1RLDA 3FFSA 4DXKA 2FKPA 1BF2A 1WDPA 1PZ1A 3NXLA 4A8LA 1BD0A 1FHVA 3ZSSA 3U4AA 3E0VA 5EYWA 4JTRA 2Z2BA 4GYFA 4MNMA 3VU2A 1K8CA 3N34A 1M6JA 1XIDA 2C19A 4F79A 3WUBA 5HANA 3BMVA 1TR1A 4DRSA 2DUXA 3S1WA 2L5HA 4GC3A 4NQ1A 4O57A 2J62A 5FEWA 1JRCA 5BXTA 1EPVA 1ICQA 5CC5A 4F3HA 3NEHA 2EG8A 1W3KA 1EXBA 4JTAA 3AQUA 3WDRA 4WF7A 3LHYA 4NXSA 2ACRA 4R27A 2I7GA 4RXGA 1OSEA 2PDPA 3PG8A 4QJ1A 2ZWYA 3CAQA 1X6LA 4CCEA 1XRSA 1OVDA 1A53A 1GVSA 2CZ5A 2PTXA 1XBXA 4BY3A 1R3RA 3REQA 1NIUA 4J40A 1VFHA 1V6UA 3HBLA 4UR7A 1ZAIA 5A6KA 1SU5A 3W72A 4Q22A 4F48A 4JFUA 5AN7A 1KRBC 2CLMA 1VIWA 4EXBA 3B8WA 3PJUA 1WDSA 3RLGA 3SN4A 4MLJA 5I07A 1JZ3A 1ADDA 3WD3A 4IMFA 1DJHA 3L5AA 4LEFA 1PIFA 2PCQA 3QC3A 3V3WA 3G6LA 1L0PA 3WUGA 1JVNA 1JCTA 2C1HA 3P0XA 1R2TA 1ZU8A 1P6CA 4KCUA 5HMSA 3MYPA 5F2LA 2PDMA 2X0SA 3GHUA 2OU4A 2XIMA 3NL5A 3UT0A 2VNCA 4Z1DA 3UR5A 1IIGA 2E4TA 4ERAA 3W1AA 4EAMA 3HQ1A 4DN1A 1DBTA 3T07A 4P8VA 3H6OA 2Z6JA 2HJPA 5BWAA 4H2CA 3UXKA 3CBWA 3PPCA 5I5RA 2GGHA 3M41A 3QBUA 1XL9A 4J2PA 3MHUA 5FACA 5CC3A 1FCUA 3CZLA 2QCDA 2FZMA 1VHNA 1KO0A 2TPSA 2GUUA 1CXEA 3DGBA 4JIRA 2EEXA 3MV11 1BHGA 4PTXA 3GIPA 2VCAA 3PM6A 1LF1A 1H49A 1BTCA 1PUDA 4KGJA 2D3LA 3P74A 1LWIA 4UQDA 3S1VA 2CZVA 4I9TA 4TV5A 2WCSA 3EWCA 2UBPC 3GG0A 2GQAA 4JAWA 3QGAC 3GNRA 2ZZ2A 3V5CA 1AW5A 4N4QA 3W00A 3KCOA 2XIJA 1U5VA 1AH3A 2PZ0A 4R85A 1RCXB 4K1GA 2YL8A 4I3GA 2V68A 3M5XA 2GJRA 3TTEA 4O1AA 1YTEA 3KS6A 3VGBA 2X7VA 4IJRA 1W9VA 2V5JA 1XQLA 3R89A 4LBSA 2YDSA 4CUCA 1GG1A 1ONRA 3A24A 4J3UA 2GZXA 3W6MA 3KWXA 1XH2A 4LQ1A 3TYAA 1O60A 1A80A 2PPGA 3C2FA 2YXXA 3WF2A 4UTUA 3AMGA 3ATYA 3AJ7A 3EDFA 4AIBA 3QV8A 3EB2A 4DZ5A 1RK6A 2IPFA 1UR9A 1OD8A 3SADA 1RQHA 1GHRA 1ISZA 4ZO6A 1A50A 4E8DA 4QXIA 3IJLA 1F61A 1OFDA 2DUZA 3W75A 3CHFA 5J5RA 4G7FA 2UY5A 2XG9A 1WDDA 3QMSA 2FTYA 3WD0A 5A8QA 2WVSA 4ZOEA 1WZAA 4LY4A 2PTWA 1A47A 2CWNA 2DJLA 3ITYA 2WZEA 1UROA 4I5XA 3N4EA 3N6QA 4JBRA 3C2RA 1FWDC 1O7AA 5EBAA 1EHAA 4PZVA 2ZBTA 4CGTA 1E1CA 4GD0A 3COTA 1DE5A 3T0TA 1UR2A 3G1RA 3GU9A 3TSBA 2KX9A 1ISWA 4C6MA 1EH9A 5AYYA 2RFGA 2G95A 2P3EA 3IGXA 4HSHA 1KLYA 1W1PA 5D2WA 1T41A 2MNRA 1V3LA 5D9MA 1PKNA 3LLXA 5AY7A 1XGZA 3GZ3A 4XBKA 1J2BA 3PS7A 3CWNA 3GHSA 4ORIA 1OCBA 3P5YA 4KS0A 3LSCA 4GBDA 2Q09A 5JBDA 4FAMA 4R53A 1IR1A 3N18A 4MZYA 4L65A 1P1MA 2XDFA 3QSRA 2Z7GA 1YNPA 4XSMA 1EB3A 1US2A 2R1PA 1SW3A 2NSXA 2V8ZA 4ZENA 3N1AA 4BA0A 3NQFA 3KRSA 1BEUA 4NAFA 1W0MA 1VKFA 1MZRA 2OO6A 3N4AA 2OYLA 4XD3A 3VZZA 1D8CA 3DI0A 2QCEA 1MDRA 3N15A 1B9BA 2XWDA 3TN5A 4QX4A 1A5BA 2DSKA 3EA2A 1PDZA 2G4FA 3ARWA 4J3VA 1I0DA 1L6YA 1RQEA 4MIMA 2ZUVA 1QWGA 2RGLA 3OIHA 1OX6A 2JGQA 1PE1A 1LZOA 2HROA 3HPFA 1RJQA 5C7HA 3NVDA 2G41A 3WLSA 3MDUA 2WHLA 3M6DA 1AG1O 3BE7A 3VNZA 3L5LA 1HJVA 1YTDA 4W85A 3DOPA 4HNNA 4PFHA 4PTWA 2ZX8A 1OGGA 1R0MA 4LCRA 2FQIA 1F3XA 4MJMA 1OHLA 4PCNA 1B31A 1UWAA 2C0HA 4O19A 1TX0A 1B1YA 4NZFA 4YHGA 1GQLA 2O92A 1CDGA 5TBOA 3E96A 4H8NA 2Q8ZA 1BLIA 3BG5A 4KFNA 4OUEA 2G0WA 2WJFA 3UZ5A 5DT5A 4MAVA 3I6EA 1RV8A 2NV2A 1YRRA 3O8AA 1XYMA 1ZTVA 5DO8A 4AWUA 2OSYA 1VRDA 2GUBA 3PZUA 4L6DA 4QNWA 3GC5A 3CT2A 3NQEA 4AZHA 4DZAA 3P61A 4NNAA 4PB4A 4Q7IA 3LBOA 3ZYZA 1F74A 2E68A 1UUMA 5CH9A 4HCHA 1H7WA 1EC8A 3LCXA 3BG9A 4QLJA 3PUDA 2QDEA 1JUKA 1HGWA 2DGAA 4IGNA 2BOFX 1R3WA 4UFIA 1G01A 3CL6A 3OO2A 3CYJA 2C7FA 1QTWA 5D9PA 1RY0A 3N2OA 4MY1A 2OODA 1KXVA 3M0XA 2Y61A 3E0LA 2YOCA 4IFRA 1VH7A 1CGVA 3WFZA 5C5YA 2JKEA 2J66A 1ZALA 2ZADA 1ALDA 5A8OA 4RE3A 3RRXA 4GRSA 2OWWA 2OWCA 3SFWA 3EDKA 1CTNA 2W9MA 3IARA 4FS9A 1P4CA 3FA5A 1R9ZA 2Z27A 3WQDA 2FJUB 1QNQA 4JTUA 1L6GA 1J5SA 2Z4GA 4HHPA 4CQDA 4GCAA 3WLLA 4REQB 5EPDA 2BMBA 4OHQA 2EG6A 3EZ4A 4JFSA 4S3KA 5D05A 1LLZA 4DAFA 2FMNA 1YXDA 1Z89A 3OZYA 3GTIA 3W1MA 1LLOA 2R91A 5LIKX 4GQGA 4B91A 1RA0A 4CD4A 2CW6A 1BRLB 2JE8A 7XIMA 1W8GA 1SMDA 3LM7A 3CH0A 5B7YA 3H23A 4AHQA 1ZJHA 2BVWA 1TB3A 1RH9A 4MB1A 4B92A 2E28A 5FI8A 1OGBA 1ZJAA 2WMGA 3UWEA 2V5LA 2POTA 4B15A 4HQVA 3UD6A 3FVMA 4HNUA 4CVUA 3W88A 3EWDA 3W38A 4RE0A 5I3JA 3K4DA 3GC2A 2HQAA 1UQYA 3DKLA 2A2IA 2J9YA 1AQFA 2HXTA 4GUFA 5AC7A 2CLIA 3VNIA 3WD1A 4P8XA 4XV0A 3MMDA 1QHPA 1ME8A 3W01A 5T8GA 2D24A 4S3BA 2J7BA 3IJIA 4X9YA 2Z00A 2QPXA 3VIHA 4L5ZA 3WQVA 1ZJBA 2R94A 1XDJA 4UNIA 2WLZA 3V1HA 3M5VA 3BSGA 1CXKA 3ZT6A 1KGWA 3AZSA 2GWNA 1WUEA 4NI3A 4POCA 1O5RA 5JBFA 4Q8QA 1BF6A 5F7UA 3FY1A 5ABFB 3WX7A 1MRQA 3UW6A 2DSWA 2BNJA 4H6QA 4M24A 5CPMA 3WENA 1PZ3A 2AGKA 3M0ZA 3NA8A 2I14A 3RU6A 2ZXAA 5I3GA 4UBPC 4DI8A 3LV5A 4G56A 3TAKA 3SQLA 3UG5A 4YNGA 2JEPA 4MWAE 3ITXA 1EUAA 1F6KA 4ASTA 1XLCA 4ZOAA 3W26A 4JKMA 1G4SA 4IUGA 2I5IA 3MP5A 1H5YA 1O5QA 2HZGA 3UJEA 1SZFA 3FOKA 4P5UA 4EPEC 2EJ1A 4AEOA 1N8WA 4AC7C 4Y9NA 3WQWA 5HMDA 4IGMA 3MDWA 1E6NA 3SAZA 3THCA 1GVOA 4B5NA 1G6CA 3EX6A 3S47A 1GOIA 4KPLA 4A3UA 2E0PA 2ZVIA 3RMEA 4YTTA 3B03A 3H22A 1WYIA 3NQMA 4KFPA 3WJYA 1FUYA 3MHFA 2F2HA 3NGJA 4CN4A 1R3QA 3QYSA 4JIQA 4Z1YA 3NZQA 4NX5A 5HPCA 2OO0A 2PSNA 3S2NA 3ZR6A 2WKGA 1H7NA 3NCOA 1IWBA 1J0YA 4KMQA 3GU2A 4RCXA 4B5TA 3U48A 1FWHC 1HL8A 3PF3A 4W8BA 4JN7A 1RP8A 3EKGA 1YE4A 1V0MA 3WUFA 4GXWA 1UR8A 2P5NA 1VIZA 4FZIA 4MFEA 1TVPA 1XIMA 2W27A 3MJYA 1DKWA 1VBRA 4Z2JA 3P82A 3OPSA 1A0EA 3L4UA 1NFGA 2CBVA 3CMGA 2EJAA 3NDOA 1FWAC 3WJXA 4L6OA 3OW1A 4AY7A 4GUJA 3H2CA 2X42A 2OKOA 3U57A 2QV5A 3CPRA 2OQYA 1GOMA 1Y5VA 3NL2A 3B9OA 1DTUA 3S5NA 2QXWA 2VKZG 3AS3A 3MB9A 3PBMA 1WZLA 1WO2A 2ADAA 1RPKA 5H1WA 3CLWA 4C6DA 4O28A 5C9XA 3T2QA 3HG2A 1J0KA 4PMQA 4F66A 3BG3A 1IE7C 3C5QA 3CM4A 4B9YA 4EOUA 5I09A 5DY2A 2WSRA 4L1WA 4A2RA 5AC6A 2VFGA 1JGMA 4W4QA 3E3HA 3TEVA 4ZB5A 4P61A 1S2CA 4QGCA 3HPZA 2FTPA 2PU0A 4IXXA 1TWDA 2R24A 4MOZA 4DUXA 2O56A 3E5BA 3OBKA 4A3RA 3PK7A 3CZKA 1DIDA 4JGDA 3NUKA 5AVHA 2I9UA 4GIYA 3CHCA 4MWAA 2SFPA 3D46A 3GX9A 1XXXA 4B4FA 2W5FA 4A4AA 1P6BA 2J7EA 2FYMA 4UQAA 3UXAA 3QY6A 4LV9A 3W9ZA 4W89A 4RE2A 3UZXA 4E4PA 3R2GA 3CUXA 3NNTA 1J4EA 3L9CA 4OU1A 3W7OA 4M1BA 1GVEA 3NXFA 3CB8A 4IFOA 4Y9MA 3WFAA 4C1KA 2F6UA 5C6MA 4KKXA 4MY9A 4PL1A 1BRLA 2XIIA 3FKKA 1FFQA 2HISA 1LRQA 1IF2A 3CU2A 3C3NA 3VCCA 4L4LA 4YCPA 1S2UA 4AZ5A 2G3NA 3L12A 3V4BA 1YDYA 2WPGA 3TAOA 3IGHX 3ONCA 5JUVA 1W3TA 1SMAA 3S46A 2QKFA 1IGSA 1YADA 1S46A 2V3EA 1W1A1 4ZO9A 2DT0A 3WD4A 3WH5A 3UXDA 1O94A 1EGZA 5AC5A 3OHIA 3KL0A 4EACA 1P0DA 3GHTA 1FWEC 3W87A 4MDPA 4KT2A 3CT7A 1CECA 4QSFA 3OYZA 1E55A 1A0CA 5C55A 2DQXA 1E4MM 3SCTA 4C6EA 2C8NA 4RX0A 3EEGA 2Z28A 4DYEA 4EE9A 3MWCA 4YMZA 3ARYA 3DKJA 4R3UA 1J2WA 1W17A 4GI6A 3OHMB 3KTSA 1YXCA 2GL5A 3NG3A 2GGJA 4LT9A 4HOXA 3S1UA 4GFSA 5HR7A 4MUPA 5IM51 1BXBA 4EPBC 2WK2A 4EK7A 1VJSA 1M53A 1TTIA 3W84A 3ZOAA 3UU0A 2BBFA 3K5XA 1W3HA 1AJ0A 3WEOA 1XRVA 3TZNA 2VEFA 4PL2A 4H01A 3U3HA 1R47A 1X1OA 1J0IA 1VFSA 4AYGA 3OZMA 1H1NA 5D02A 3TP4A 3NVTA 1B30A 3MANA 1KV8A 1OT1A 2E9LA 4M6QA 4Q4RA 3TTYA 4GVIA 4RR4A 2VRQA 3AOFA 4IG2B 2O9PA 1MXGA 3M44A 3EX2A 4CU8A 1XLIA 3TZFA 4HBKA 1UD5A 1YPIA 3NM3A 4HYWA 2HVMA 4LAZA 3LNPA 2VZUA 4LAUA 1XI3A 4X60A 4H7CA 1EP2A 3BJTA 3G0SA 3LHZA 3VIKA 3SO7A 4EF9A 2V5DA 1XGEA 1JCYA 1EBGA 3TMLA 3CUHA 4KCVA 3C4UA 3ARTA 1TV5A 1YX1A 3PWAA 3KBMA 3HGSA 3KS5A 1L6WA 2PLJA 3UZWA 3QLLA 3NSNA 3CV7A 2OELA 2E7FA 2QQ6A 3EMZA 3M5YA 1XLAA 2YKKA 3TSMA 4NX0A 4WKHA 3TN4A 3SGGA 2FZNA 4PB3A 3HA1A 3UNTA 2WJZA 1EDGA 4Q8TA 4S39A 3LPFA 5HQMA 3K1GA 3QPEA 5HWJA 3KW3A 1NOUA 4KCWA 1CGWA 1KBIA 1T0OA 2PGRA 2Z1WA 3WDHA 1JNDA 2QJJA 1JFHA 4GUGA 1MYRA 5FEPA 5A6JA 4DBDA 3N19B 4AQLA 4UTMA 1TCMA 4WSJA 1KXHA 3OODA 3PUGA 3WJSA 3CUJA 3KBSA 1V0NA 3NPVA 4C6CA 1R87A 3E2VA 3INPA 4QQUA 3TOYA 3CQIA 3CK5A 1WKFA 2QW5A 3TA6A 1GPFA 5M03A 5I3IA 1BGGA 4NJJA 5HNUA 3QN3A 1B90A 1E9YB 2D20A 3ECQA 4GJIA 2PDIA 4XUYA 2YR1A 1Q13A 2V2CA 2Y8UA 2FVLA 1K9TA 1X96A 3WNNA 4NZ3A 1MQRA 2PWGA 1XDLA 2WKJA 5G5IA 1TPDA 4XVEA 3MT1A 5U4NA 1GVIA 1XFCA 1DXFA 1YYAA 1V79A 5FF2A 2ZTJA 1RBAA 3VINA 1GCYA 2J47A 3AS0A