4LANA

Crystal structure of cordyceps militaris idcase h195a mutant
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
370
structure length
370
Chain Sequence
TPVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLAPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
molecule keywords Uracil-5-carboxylate decarboxylase
total genus 137
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lanA00
1R9YA 4HK6A 3DCPA 2FVMA 3V7PA 1E9YB 3URQA 3UR5A 2DVXA 1RJRA 1UBPC 2R1KA 2VM8A 2GWNA 4PBFA 2VUNA 3QGKC 4ZSTA 2AQOA 2E1WA 1FWJC 2Q09A 4DO7A 2D2JA 2GSEA 5AKQA 4DI9A 5G4HC 1A5OC 4F0SA 4F0LA 3GIQA 3UPMA 3TN4A 2P53A 3WZ0E 1GKQA 4DLMA 4IG2A 4HK7A 4XAFA 4C5YA 1NDZA 3RN6A 2HNHA 4C6NA 4D8LA 4RDWA 3WYZA 3S2JA 3ITCA 4GY7A 4XD3A 2D2HA 3JZEA 3EWDA 4CEXC 1O12A 4IGNA 3IV8A 4INFA 2R1PA 3IACA 4GX9A 4KQNA 3GTHA 4DIAA 1FKXA 2D2GA 1FWHC 1KRAC 3GRIA 1M68A 1NDVA 4LEFA 1HZYA 1PO9A 3IJ6A 4ICMA 4G2DA 3LS9A 4WGXA 1EJWC 1RA0A 4H9MA 2ANUA 2BB0A 2HPIA 2DVTA 1PB0A 1I0BA 1IE7C 2QVNA 4PBEA 4C6IA 2F6KA 3S2NA 5FSEC 4I6KA 1PTAA 2Z26A 3GIPA 4H9XA 5LXXA 4ERIA 1V4YA 4BY3A 1YRRA 2O4QA 2Z4GA 1K6WA 4GZ7A 3PBMA 2HQAA 4ERAA 1NDYA 3ICJA 1K1DA 3PNUA 1FWIC 4H9ZA 1A4MA 3HPAA 2YZ5A 3TN3A 4RE0A 4LAOA 1VFLA 3LGGA 3D6NA 1YIXA 4OFCA 4H01A 2FTWA 3S4TA 2Z00A 4C6FA 4WHBA 3FEQA 3RYSA 4C6BA 1EJSC 3R0DA 4HK5A 4EP8C 4QS5A 1GKRA 4P5UA 2ICSA 1FWGC 3B0YA 1R9XA 2HBVA 2QPXA 4DYKA 3LY0A 4C6MA 3GTFA 4JOMA 2Z2AA 4H9UA 2G3FA 5E5CA 1ONWA 1V79A 3AUOA 1A4LA 1GKPA 4C6PA 4GY1A 2I5GA 4CNUA 4H9VA 4F0RA 4DLFA 3E3HA 3IGHX 2R1NA 3E0FA 2VC7A 1RAKA 1A5LC 4TQTA 3SO7A 2YB1A 2I9UA 2HBXA 3K5XA 4GK8A 4DNMA 1FWDC 1FWBC 1YBQA 3T1GA 2PUZA 2Z29A 1UIOA 3URNA 4KEVA 3F2DA 2A3LA 3ID7A 4MUPA 4HJWA 4LALA 4QS6A 2XIOA 3GU9A 4V1YA 1NDWA 2UZ9A 3UF9A 3WMLA 3FDGA 1FWCC 1RK6A 4C6CA 4QROA 4KEUA 4IG2B 4RDZA 3MSRA 3E38A 3PNZA 1M65A 2EG8A 1O5RA 4LCQA 4C5ZA 3E0LA 4L6DA 4LANA 4C6EA 3A3WA 4HA0A 2VR2A 4NP7A 2AMXA 3OU8A 4IFRA 1UIPA 1KRBC 2ADAA 4LH8A 3UR2A 1I0DA 1P6CA 2GOKA 1A5KC 2OGJA 4GX8A 4E3TA 3DUGA 3IARA 4J35A 2OB3A 3BE7A 4CQDA 4CNTA 1S3TC 4GYFA 4KETA 3URBA 2HPMA 1WXZA 1RJQA 1XWYA 2KAUC 4LAMA 3QY7A 1DPMA 3TN5A 2YB4A 4J5NA 1EJRC 2P50A 2Z7GA 3K2GA 4CNSA 3MKVA 3O7UA 4C6LA 3E74A 2GZXA 3LGDA 1KCXA 4UBPC 3ISIX 1EZ2A 3MVTA 1EF2A 3LSBA 3O0FA 4NI8A 4B92A 1A5NC 1XRTA 2PLMA 3FDKA 1E9ZB 1RA5A 3NQBA 4XD5A 3K4WA 3MTWA 1ITUA 1WXYA 4IQJA 4QSFA 2QT3A 4C6DA 4BKNA 4C60A 3EGJA 1K70A 2Q01A 2Z28A 4KEZA 4EPEC 3RCMA 3NURA 4GOAA 3MDUA 4KF1A 3MDWA 1KRMA 1YBQB 1FWEC 3GG7A 4XD6A 3UBPC 2E25A 4CEUC 2OODA 4WVXA 4EPDC 3F4DA 1JGMA 1POKA 4I6VA 3NEHA 2UBPC 4GBDA 4QRNA 4EPBC 2Y1HA 3LU2A 3GU2A 4IGMA 1QW7A 4NG3A 1P1MA 2OOFA 2PGFA 2OQLA 1EJVC 3KM8A 2Z27A 4IH3A 4PCPA 4EPKA 3OQEA 2W9MA 2DVUA 1FWFC 3OOQA 3EWCA 3IRSA 2ZC1A 4R85A 4G7EB 4H9TA 1ITQA 4BJHA 4LAKA 3OJGA 4B3ZA 1NFGA 4RDYA 1W1IE 3G77A 4YIWA 2GWGA 1V77A 4IFOA 4C65A 4CQBA 4Z42C 5CH9A 4C6KA 1V51A 3GU1A 2Z2BA 2WJEA 4J2MA 3CAKA 4C6OA 3LSCA 4AC7C 4LCRA 1PSCA 2FVKA 1XGEA 2PAJA 4LCSA 4L9XA 3QY8A 4GXWA 3MPGA 1YMYA 1EJXC 3URAA 4IF2A 1M7JA 5A6TC 4LFYA 2WJDA 3T8LA 3AU2A 4KIRA 1ONXA 4IFKA 1ADDA 4KESA 1BF6A 4KERA 2R1LA 1R9ZA 3A3XA 4H9YA 1P6BA 1POJA 2QS8A 3MVIA 3GTIA 3PAOA 3B40A 3OODA 1UMLA 2Z24A 2FFIA 3S2LA 3CJPA 1XRFA 2VHLA 4C6JA 2YXOA 1ZZMA 3AU6A 4C6QA 4RDVA 1YNYA 4R7WA 3RHGA 4XAYA 1FWAC 4UB9A 4ZSUA 1J6PA 1EJTC 1QXLA 3ORWA 2IMRA 2WJFA 3MJMA 3CS2A 3LNPA 4IFKB 4CQCA 3TNBA 4G7EA 3DC8A 1RJPA 3GTXA 3HM7A 5HMEA 4ERGA 2FTYA 5HMDA 4PCNA 1FKWA 1KRCC 4PE8A 4DI8A 3A4JA 4DZIA 3HTWA 1RK5A 2PGRA 3PANA 3TN6A 2Z25A 4XAGA 3QGAC 3IPWA 3T81A 3N2CA 4XD4A 4AQLA 3C86A 4GY0A 2EG6A 4B91A 3GUWA 1V7AA 5HMFA 4GC3A 2O4MA 2R1MA 2EG7A 3OVGA 3B0XA 3F4CA 3LA4A 1EJUC 4RZBA 3S2MA 4DZHA 3QY6A 3F2CA 1J79A 2BGNE 2WM1A 4M51A 4QTGA 4B90A 3E2VA 3SFWA 4V1XA 2CZVA 2AQVA 2VC5A 1A5MC 1J6OA 2RAGA 1EYWA 5FSDC 1J5SA 4R88A 4XAZA 4H00A 3F2BA
chains in the Genus database with same CATH superfamily
3WQWA 3Q45A 3D46A 3RPDA 4LNYA 1UBPC 1UR9A 5CBJA 3AYRA 5E0KA 1XC4A 2JK2A 3PS7A 4S23A 1U5HA 1VHNA 3M0VA 4XIAA 4XSLA 4E4UA 5G4HC 4Z0SA 4BI6A 4F0LA 2DY3A 1E3ZA 2TSYA 2BP1A 3PZMA 4AD5A 2WJZA 5C9UA 2DT0A 2XINA 1RLDA 1WUFA 3N4AA 3SRHA 1LRQA 2W0UA 5JIPA 2WO5A 4N6EA 3CASA 1BVNP 3S6DA 3IACA 2CBJA 3GVGA 5LKYA 5FOOA 1X96A 3PZVA 3IJ6A 1Z44A 3EX4A 2AGTA 3M0IA 4URIA 4WGXA 3WLKX 3HQ1A 1FRBA 3MZNA 3Q2DA 3TAOA 5CPMA 2XGIA 2Y8VA 4PTVA 1Q7ZA 2ABAA 3CZJA 2Z0IA 3PSVA 3H55A 2RDXA 1EH9A 2VQTA 2XWDA 1GNXA 1KCKA 4PULA 3UXKA 3APYA 4ZTXA 5PTDA 2J6XA 3BLEA 2H90A 3MYOA 5BXRA 1FWIC 4MNKA 1H63A 4JNYA 4ZO7A 2WKLA 3HPAA 3C2RA 3FKKA 2A3HA 1DQWA 1U83A 3QHOA 5CSRA 4QNWA 1G7UA 4UUIA 1EP3A 1KKRA 2WHJA 2VRJA 2CKRA 3C61A 1R7AA 4O52A 1XYMA 4QS5A 1JZ7A 4IHCA 3VM7A 4FALA 2WC7A 1S5MA 2RH9A 3PTKA 3D47A 1Y0EA 4DYKA 4LAUA 5AHFA 6REQB 4PUJA 3LM7A 4JHZA 3Q67A 1FA2A 1EA0A 1V79A 5LHFA 5AYBA 3AUOA 4CGTA 2XJ7A 3LCFA 5LNWA 1DYSA 4ZE4A 4CNUA 3VNMA 3PUEA 2Y7DA 2V5JA 1W37A 1B54A 1VPQA 4GK8A 1RH9A 3P62A 5HWNA 3UETA 3W27A 3ID7A 2WMJA 1XFCA 3QQ0A 3CAVA 4CLMA 1XIJA 2QW5A 1JDFA 2ZXBA 4UTKA 5IBXA 1LLOA 4LV4A 2DSZA 4Z1YA 1F8IA 4X3ZA 1JF6A 4NRSA 3O0KA 1M7XA 3WLLA 2X42A 3IUDA 2J6VA 5G5IA 5A5WA 1CB2A 4YNGA 7REQA 3BLPX 3PZ9A 3ARPA 4E2VA 3BW2A 2GUUA 4DBUA 1U22A 1HL8A 3EPOA 4IUOA 3IWPA 1BXBA 4UFKA 2Y4SA 2C6QA 4J35A 1PZ1A 4J3WA 3UA4A 1BD0A 3W22A 1JD9A 2VR4A 2VD9A 3TN5A 3IUIA 3STGA 5D9OA 3OP2A 1I2PA 3AYTA 3TK7A 2A3CA 3CIXA 2G8ZA 3MKKA 2C3ZA 2ZRZA 1C7TA 1KCXA 4JFTA 1VP5A 2ZUMA 3VIFA 3ES8A 5CZJA 3IVSA 4WR3A 4QEEA 2ZUTA 5DF0A 3UW6A 2PLMA 4YXGA 4PZVA 3WD0A 3CU2A 4IP7A 2OU4A 1E4LA 1P0EA 3LPPA 1Q6DA 1TJ1A 3QH2A 3WK0A 4UNKA 3VIGA 1K70A 4GIYA 4H19A 4I5XA 2FLIA 1OFBA 3LMYA 3RCMA 5AYZA 1SFLA 2CIPA 2YBTA 4MKSA 4ZBCA 4Q8WA 1E9IA 2UY4A 1XUZA 4H04A 5AHLA 4I9TA 2AAAA 4UC5A 5I3KA 3TVAA 2Y1HA 1S5WA 1GPFA 4U3CA 4YVPA 4W7VA 3TDFA 2Z27A 3FHQA 3RDKA 1R3YA 1VS1A 4XTIA 4XUYA 3QV8A 4IL2A 3DFTA 3P61A 4NZJA 5CZSA 4R85A 2EPLX 2Z2UA 3BC9A 4QHRA 5J8LA 2EJ1A 1E1CA 3W88A 2NVDA 1HF6A 2Y62A 3H70A 3TIMA 2Y7FA 1UKOA 2FTPA 3UYIA 2OELA 2ZXQA 4AEFA 1GTEA 2OJPA 3VOIA 4R34A 3VOHA 3B3DA 4A3UA 2VZOA 4FZIA 1KBKA 1CGYA 3ABRA 4C6KA 3UXIA 3FK4A 2OYKA 1UHVA 3L68A 2C15A 3QZEA 4LS2A 4MB3A 4POCA 1J18A 3H2OA 4KGJA 3QY8A 1H7XA 1NOWA 1PPIA 4FB7A 3RX3A 2W61A 2WW5A 3ABOA 2ZRXA 1T7LA 5DANA 4LRTA 2R1LA 1R9ZA 4BQ4A 2BHYA 3ITVA 5FL1A 1UCWA 3EOOA 3TX9A 4QJ3B 1VBRA 2OSXA 2YL8A 2KX9A 1X7FA 1AJZA 1YDOA 3WBEA 3HPSA 1QPRA 7CGTA 1QAPA 4UNIA 3FAXA 4O15A 1L6YA 1UBSA 3NOEA 4JTDA 4O4VA 4O17A 2QHAA 3M5YA 1I2RA 1E55A 4Q8NA 3KTSA 3PN8A 3E0IA 1RPXA 8CGTA 4JCMA 3RLVA 4YVVA 3WDJA 3VO0A 4NT0A 3WMBA 3W72A 1ZBVA 1DJQA 3DFYA 5K2ZA 1ZBKA 3BLLA 4JAWA 5FEWA 3WLJA 3FW6A 3TWBA 1GQKA 3UVIA 3BICA 4GC3A 4DUOA 1HGWA 3COTA 3UPBA 2I17A 2Y89A 3VIJA 1LL6A 1CGWA 2FHBA 1FH8A 2V67A 3SUTA 1AH0A 5D30A 4R88A 1GT8A 3F2BA 1R9YA 1MW1A 3HF3A 5LIKX 4HNNA 3C6CA 7TAAA 4LOCA 1CGUA 4TVUA 3PTDA 2R1KA 4DZAA 1RLCL 3LGEA 1SW0A 2BWGA 1MNSA 2ZUUA 1J10A 4LT9A 4HZ7A 2QULA 1GKQA 2BOGX 2VD8A 2A3AA 3NZRA 1HKWA 1UWAA 2J7HA 2YCIX 1F8MA 4KRZA 1CXKA 1XLFA 4GUFA 1TV8A 4CQ9A 1XBYA 3JZEA 4CEXC 3H12A 2D20A 5DRIA 4G5DA 2Y24A 2CESA 1TSIA 3QXBA 4PRTA 4HA4A 4NU7A 4GCAA 4RCXA 3BSHA 3WF4A 2E40A 3HJEA 3L23A 3PY2A 4DUXA 4M29A 1JQXA 4LUTB 4PBEA 3UGVA 2YBVA 2I7GA 2QCEA 4UTIA 3H8AA 1ISXA 3TYAA 2VZTA 3ZJ6A 1CGTA 2X40A 2J9YA 4GYKA 3W1NA 4H4IA 1YRRA 3LCLA 5K9DA 1RXOB 4HSHA 4OU1A 3AZSA 2B7QA 4V33A 3WBXA 1YQ2A 2QJNA 3MU7A 4UFIA 3GW3A 3BCJA 3UCCA 4EVZA 2J9XA 1DXIA 4Q6JA 3QPZA 3LGGA 5FESA 1REQB 3SQSA 3PM6A 4WQ6A 1N8WA 1S5NA 4M81A 1G7VA 5D2WA 3B9AA 5F2LA 2ZIDA 1EJSC 1F7BA 5KINA 3R0DA 1V0MA 1DJZA 3ARWA 1R47A 3MI3A 1NM9A 3U8GA 4Z1DA 3VNDA 2JGQA 1XPYA 4YYCA 3PP7A 5XIMA 1EF3A 3DIPA 2PP0A 1REQA 3NNTA 3T0AA 3VVGA 5JH2A 4WX2A 3XINA 4YHGA 4GY1A 3LERA 1Q45A 3IGUA 4LVGA 1WDPA 3Q65A 1XLEA 1TUXA 2XVKA 3R12A 3KBWA 1UP2A 4UQCA 3ZOAA 3NPWA 2DZSA 3GR7A 2C0HA 5CBIA 1VYRA 4WJ8A 1HG3A 1E5JA 4M24A 4GNKB 3GR8A 4FOKA 1W9UA 4IIDA 1MRAA 4J9JA 1W1YA 1LG1A 3RO6A 1KGUA 3CQHA 1IGWA 3WDHA 3TYDA 3PNZA 2V63A 2YBUA 3JR2A 3AMLA 2RDUA 5C70A 4WKAA 1EP1A 2P0OA 3S0CA 2Y0FA 2DIJA 3LDVA 1DIOA 2ADAA 4JD4A 4CD4A 1P6CA 1O7AA 1FH7A 2XN2A 4QE4A 1TJPA 2FPTA 5AVHA 1UB3A 1FCVA 3N9KA 3LYEA 5CG7A 1LBMA 2DW6A 3MKVA 3VOCA 2NQZA 4GGHA 4DWDA 1ALDA 3EX1A 4PCTA 2BHUA 1XRTA 1JCLA 4UMCA 1RA5A 3WNOA 2HS6A 1KM2A 3PVFA 1KV8A 2ZUWA 4PTMA 1MMFA 1W5QA 3M0KA 1LBFA 4IQJA 2ISSA 2PRMA 1N8FA 1YNPA 4JBRA 1RQBA 4IIEA 1H0GA 3FV9A 3IS4A 2ZCGA 3KDOA 1MO0A 2OODA 2HMCA 3FN9A 1J0KA 2NXHA 3WFZA 5M2FX 3VNYA 2V8ZA 2WC3A 4PCFA 3M41A 2OQLA 1SO6A 2C16A 2I5QA 4J3VA 4PCPA 1JDEA 3T4CA 3E0WA 1CECA 1WDQA 3UZZA 2IUZA 3W75A 3DFSA 3QFEA 3EWCA 1X8CA 5E6ZA 3H4WA 3EWZA 1OM0A 2HJPA 3VKDA 5F4XA 1XDJA 2WMIA 1NFGA 3WK3A 4Q8TA 3NXFA 1G1YA 2YOCA 7ENLA 4YIWA 1L6WA 2Y7EA 5JBDA 1QOQA 1QR7A 4UTLA 4CQBA 1KFKA 1AVAA 2XDFA 3PZOA 1FX6A 2GGGA 3EWUA 3U7VA 5D2VA 3CV6A 4RR4A 2EPHA 1KW1A 5IRPA 3B0VC 2CFFA 2P0IA 2ESCA 3ITGA 1CLVA 3URAA 1TPWA 3YPIA 1HGYA 4EAYA 3A3XA 4O28A 3U2ZA 4ZZ9A 2BX7A 1TE6A 3BVJA 3DG3A 1QBAA 4AD0A 4QSHA 1BRLB 1O1ZA 2VEPA 4DM2A 4L1GA 4RDVA 1YNYA 2CXEA 4LYQA 4R7WA 1WP6A 4HD5A 4MG4A 3S8HA 3U9IA 4ML4A 3EAUA 3G8RA 2PLKA 3G0UA 5L9FA 3OZYA 1IV8A 1XPGA 2XIJA 3V5OA 4QITA 1GVFA 2A0NA 4AD1A 1ZTVA 4PE8A 2PZNA 2G3IA 2P8BA 1QASA 3CQKA 2EXOA 1B90A 4JIEA 3EXSA 4EWND 1SZNA 3APGA 1E6NA 4XZNX 3LI0A 1MSSA 1V3IA 3CB3A 5AYYA 3BG5A 5I2UA 3LA4A 4RZBA 3F2CA 3QPYA 4XKMA 1W3IA 2I1OA 2VC5A 3S9ZA 2O9OA 3GR4A 1VFSA 4U2ZA 1FP8A 3B8VA 1OF6A 4XB3A 1WX0A 4GG9A 1Y8BA 4RZ4A 1C7SA 1JCTA 5REQB 5CJ5A 2DVXA 1MYRA 3IV3A 1PKNA 3EDEA 1LF1A 5LA0A 2X7WA 4N9EA 5K3VA 1JRBA 3AICA 2Y5SA 1UASA 2HXUA 1DXFA 1DWAM 3ZLFA 3A4WA 3IGXA 3JUGA 3GAYA 3NDZA 1XYLA 1WXJA 4D8LA 1F5ZA 3WJXA 2VELA 1P1XA 3W0KA 3VZZA 1PYMA 3WEZA 3ZJ7A 1IEQA 5FEPA 1MUWA 2OYMA 1KRAC 3CQ0A 3BJTA 2XSAA 2YDSA 4DYEA 5LHEA 4UZUA 3LS9A 3W81A 3UG5A 3F5KA 3W1UA 1JEZA 2Y6ZA 5C54A 2H3BA 3PB2A 1JPHA 6ALDA 2NQ9A 1ICPA 4AISA 2ZXAA 2X8RA 1IEWA 4XKYB 4WGHA 2C7FA 1OFQA 1Q6OA 1ML1A 3E96A 3NIYA 2YXGA 5JVLA 4O1CA 4S3GA 1ENUA 3TCSA 1UOKA 4MM1A 1Q4NX 1FQ0A 4HNOA 2NW0A 2EPKX 3GB6A 3IGSA 5BOEA 3P2VA 4G1KA 4GINA 1KWKA 4NILA 4MNJA 4O18A 1RVKA 3PR2A 1T96A 3NVTA 4YCOA 4A8NA 3N9SA 3AJ7A 3W4RA 3CHFA 4J4KA 4WRHA 1H1NA 3IJ7A 3A23A 1P4CA 4QJ5B 1ZJAA 3BOLA 1BAGA 4JTIA 4QAIA 1W9XA 4JOMA 4LJ3A 3SSJA 4DJEA 2HNEA 4B15A 2YX0A 3NSNA 1HFBA 1DTNA 3CMJA 3A9IA 2G37A 4K39A 2UV8G 3UG3A 1SFJA 2NXIA 3A22A 4W5UA 3SO7A 2GDVA 2YB1A 4BF7A 5BXTA 2PUZA 3WK1A 1GQLA 2DGAA 4JTEA 3WEOA 2Z1KA 3R0UA 1TV4A 3LQLA 4HSNA 4L4PA 4KEUA 3LBOA 2YCKX 3WH5A 5I5RA 2XGZA 5EFDA 3E38A 2ISVA 5IDZA 4LCQA 3MHGA 4HCLA 4EF8A 4Q8MA 4CD6A 5CLWA 2GJLA 1EBHA 3NYDA 4HA0A 2AMXA 2ZX5A 2GUBA 3N25A 4IT1A 3SRFA 4GQRA 4XVDA 1W91A 5AN7A 3AMCA 4C90A 2XPKA 2GGJA 4IUGA 3H53A 3WMCA 4JZ5A 1OHLA 1FWWA 3W1PA 3FS2A 1JZ3A 2VFHA 4F48A 3NZ1A 2J8FA 3B8IA 4NZCA 4CNSA 1B3WA 4NY2A 3WQFA 4QGCA 1XLIA 4UR7A 2A3BA 2E8ZA 1N55A 2EO7A 3TFCA 5CGTA 4JTKA 1O66A 1PYFA 4LUJA 2V3DA 3WNLA 1WXYA 1UD4A 2PURA 3HMCA 4C6DA 2BXYA 5F4WA 4L1WA 1SW7A 4C60A 3LXCA 4GNVA 4KEMA 2DH2A 3NQFA 4KEZA 1H4PA 1OCBA 4KWOA 4AZHA 2VQUA 1H1YA 1GOKA 3A5VA 2BY3A 1ADOA 5BU6A 4PMQA 1KNWA 1YYAA 4UTWA 3P80A 2UBPC 4GFSA 1PE1A 2H9AA 4MADA 1RQHA 2JALA 2WSKA 3UJEA 3AI0A 2PDHA 1EJVC 4AVNA 4E3VA 3VK5A 3V5CA 5FL0A 3MO4A 3TA6A 2WSRA 2PTDA 1E0VA 1HJVA 1MNZA 1R3RA 2NX9A 2VGBA 3TH6A 1VZWA 3RLGA 4S3JA 3ME3A 1A3WA 4O12A 3KS5A 2MANA 2ZZ2A 2XVPA 4Z42C 5BRBA 3OBEA 4M5PA 3W25A 4R33A 2YLLA 3FIGA 1UWIA 1OFOA 2VURA 3M1ZA 1RP8A 3BLKA 4IF2A 3U5YA 2Q8ZA 3P67A 4AEOA 4HNTA 4QR6A 4X9SA 4DJFA 3AIVA 1WOAA 3PSWA 1OFEA 3W3OA 3QR1A 1CGXA 2WWCA 1IIHA 5A6KA 3CUJA 4QLLA 2V69A 3CIVA 1P43A 1V02E 4WKHA 5IFPA 2Y5JA 5LZLA 3WUGA 2WVUA 1JDDA 5CSUA 1CEOA 5AHMA 2EQDA 3UYCA 4IMDA 1EJTC 4ZOEA 3QVQA 2V5KA 2WMHA 2ZX6A 4HHLA 3KZSA 4WIWA 5DBUA 3QLLA 3CWHA 3W2MA 3PBVA 3RX2A 3B9EA 4GUGA 3NL6A 3A4JA 5AHIA 1VCGA 2ZRVA 3G8EA 3M6YA 2W5FA 2X2GA 5XIAA 1F2JA 3ZSSA 1HJUA 4MWAE 4NF7A 3P93A 2R1MA 4DZ5A 3H23A 1TE1A 3TWAA 3I7SA 3NFUA 5CPTA 2X1TA 4BQ2A 3BW4A 2CZVA 1T5AA 3CPUA 3DFPA 4DPPA 1JL8A 4FXRA 2E3ZA 2Y70A 1XLJA 3URQA 5A6MA 1ISVA 4GNJA 8RUCA 1X7IA 2PDXA 2OVLA 4WK9A 5B80A 3PULA 4Z2IA 1T8XA 1E6SM 3QYSA 1MXSA 3C0JA 4MJZA 4J3SA 1F3XA 3AS1A 1RCQA 1B9ZA 3WDQA 1LDCA 1TPVA 3VUSA 4A22A 4C6NA 1QVBA 3UT0A 2XWEA 3BAKA 4IPPA 4CN6A 1K02A 2DH3A 4PRWA 9XIAA 4GBUA 3MSDA 4HVXA 1ELSA 2CBIA 4JFSA 3KOXA 4I8DA 1LWJA 4XG1A 2QYGA 1DTUA 2GJRA 2J7BA 4OVXA 1WUEA 1G0CA 4YN5A 1HJSA 3BQ5A 4HPHA 4GO8A 4HPXA 1UC4A 3U48A 2QCCA 3W7CA 3QHNA 3FJ4A 3ARTA 5LXXA 4FK9A 3UJ2A 1QK0A 1KGWA 3C4UA 1YDVA 3TJXA 5IDIA 1GGOA 1TJ0A 2Z7KA 1W9BM 3NDYA 1XYFA 2AL2A 3O6CA 3B9NA 5H8PA 3ZVHA 4IQLA 1K1DA 3WX7A 3U3HA 5DMLA 3UR8A 2ON3A 2VFFA 3TAKA 2NUXA 4IJRA 4HJFA 3R7MA 1F6KA 5IFTA 1UKQA 2FTWA 4CQ8A 5BCAA 5DXYA 4GI4A 5EMJA 2PDLA 4C6BA 1Y7VA 3GHRA 3DXIA 3OVRA 3NCOA 3A47A 3WF3A 3LTYA 3JW7A 1SZFA 1JNDA 1UJPA 5TBOA 2XGBA 4S3KA 4EXQA 3BTNA 3EA1A 1RCOB 1G6CA 3BARA 4E8CA 2O92A 2IQTA 1H62A 4Q32A 3SI9A 4O1DA 1OVDA 3TQPA 1C8QA 3W01A 3MUAA 4F0RA 4N02A 2BMBA 2HWGA 3K4DA 4G9PA 3EXTA 3U57A 4GE8A 1KTCA 4PMRA 1PX4A 2VC9A 3IVTA 3N04A 2CBVA 2CLEA 3N73A 2XIOA 3VGDA 3OA3A 3OBKA 2DUXA 3ZXWA 4MDPA 2ZUVA 3W6YA 4IG2B 1MUMA 1F61A 2A6LA 2PP1A 1M65A 3AWNA 2V3GA 3M47A 4GZIA 3ARVA 1US2A 4O1FA 3JS3A 4HOXA 4DY1A 4M1RA 2Q02A 4NVTA 1EPVA 1FXPA 2CC0A 3NAVA 3MI6A 1Z7AA 4OQVA 3AQUA 3G2GA 4AXKA 3I6TA 1FWNA 3NL2A 1DOSA 4AH7A 1P7TA 2AMGA 5KZMA 1O6IA 2W79A 4KETA 1XUUA 2AL1A 3NPXA 4US5A 2IKHA 1V7YA 2H8ZA 4V27A 4D6EA 4UTTA 1GG1A 3BLIA 4JIRA 3UCQA 3MUXA 1O4UA 2BBFA 2NT1A 3VX0A 2DV0A 3GDBA 3TW6A 3DBNA 4QDMA 2F6UA 1VBJA 5DO8A 3I65A 3O0FA 3NOYA 2X2YA 4Q22A 3EWYA 5J04A 1ZENA 5FI8A 2VOMA 3FVDA 1XSKA 2ZRYA 1P0BA 4JPGA 4NJJA 4M80A 4GOAA 1AW5A 4UTJA 3FJ6A 1CB7B 1BSIA 1BTCA 4KS0A 1B31A 5EU9A 2FMOA 4ALDA 4IXXA 4L64A 4E2OA 1B1YA 3FSTA 3A5FA 4WVXA 2A2IA 3GM8A 4MJ2A 3T8QA 5BMXA 1QHZA 4JYDA 2YLAA 4X2RA 2Z6IA 3N2BA 4IISA 3LU2A 3QKEA 1PTGA 1KM5A 2DPEA 2OOFA 2YFNA 1EUAA 3BSGA 4CU7A 2WNZA 2VWSA 3HIJA 3BZJA 1BLIA 4Q8PA 2HVMA 4XBKA 2PWUA 3E5BA 3NM1A 3OGSA 3H2NA 1V6UA 1G67A 4TXEA 1W0MA 2GLKA 1FUYA 1TMHA 1WAWA 2FH6A 3VU2A 1XW8A 2IXVA 1U2YA 1SJBA 1TPDA 3O3RA 4FIQA 2FKPA 2YA1A 5DT7A 2WB5A 2R14A 4JIPA 3HGRA 5JXQA 4NYUA 2QCFA 3M5XA 3KL0A 2PAJA 3UZXA 3II1A 3I4KA 2E7FA 3RCNA 5DN1A 3TQKA 2PDQA 1OFAA 1V3HA 3AU2A 1UR8A 3CM4A 4IJBA 4RK8A 2DP3A 2RFGA 4H7VA 2C79A 1H2JA 3S2LA 3CJPA 3N15A 2QPSA 4NJKA 3KOYA 2G50A 1KQZA 4ZVJA 1L2UA 4PC8A 3RHGA 3MC5A 1W3KA 2DJLA 4DX3A 4X2PA 4JTQA 2C91A 1CNVA 3LBMA 1EHNA 1X6LA 4CQCA 1EYEA 1OQFA 2YCLB 1RJPA 5EMUA 1XD0A 1JNEA 2J66A 4F66A 1K8YA 2WANA 3MB9A 4X60A 1KWGA 3VA8A 3QGVA 4N2YA 4DI8A 3T42A 5AHNA 1XLGA 3FJLA 4K6AA 2GFTA 4O4WA 4HHHA 3L5LA 4RKAA 4TTUA 4HT3A 1K9FA 3RPMA 4NXSA 4I5UA 2V6AA 2O4MA 2WHMA 1DORA 3QY6A 3FA5A 2ZBTA 3KX6A 5GQBA 3CUHA 2BDQA 1TRIA 2CZFA 1Q63A 3W53A 1Y5WA 3AOFA 4TV5A 1A5MC 4JL2A 5CPQA 4S3DA 5BRQA 4H00A 4GX9A 3G1AA 3LNMA 2QDGA 2YCEA 1RJRA 3SCPA 2CZEA 3KLLA 4ZQMA 5I3IA 1H11A 4GXPA 1TPUA 4M19A 3AHTA 4EF9A 4KPLA 4MNMA 3UZYA 2FHFA 4Z2KA 5C9XA 4PMYA 1VCVA 4Z17A 3QKZA 1SFTA 1QOXA 1UWTA 2OLHA 4RDWA 2XN0A 1J0IA 2J62A 3ITCA 4UXDA 2DUAA 2DJXA 1QPQA 2QAPA 1R7OA 3S83A 3GTHA 3MP3A 2FVLA 4MFEA 1K7EA 1PKLA 4JDYA 5A69A 4CUCA 3CZGA 5G4WA 4NNCA 2X0HA 4IPNB 2QVNA 3B04A 3TMQA 4C6IA 4HZMA 3IK4A 4ERIA 1HKJA 2YL5A 3LK6A 2UY5A 1XX1A 4BY3A 1TIWA 3AIQA 3KVLA 3TC6A 1Y5VA 2XH2A 1DXEA 2QVHA 4PCSA 4K1WA 4GZ7A 3C2YA 1GJUA 1WOBA 3R10A 3W38A 1TZZA 4Q3MA 2CPUA 4LVAA 2E1DA 1J12A 4KW2A 4FF5A 1Q2RA 2ZA1A 3PPCA 4Y8EA 1W9VA 2GSHA 3D6NA 3VIHA 3TONA 4BFAA 2Z00A 1LZOA 3ANUA 4WHBA 2NSOA 3DFHA 3A4AA 1HL9A 4MDOA 3G0XA 3QQWA 2NVAA 1Q6FA 3TCEA 4X0NA 3KBJA 3B0YA 1R9XA 2A1YA 1ADSA 3VGHA 1OYCA 5JU6A 1F76A 1K9TA 3LG3A 6ENLA 5HANA 4H9VA 5GNZA 4DLFA 2YZRA 3CZ8A 3D0CA 1KFEA 4GD0A 4PB4A 1FWDC 1W3LA 2ONEA 3SY5A 4DJFC 4JTHA 7XIMA 2J79A 4G6CA 4PR4A 3RRAA 1BEUA 1ZQ5A 5LIXX 4IM4A 3HGJA 1F6PA 3L5MA 3OO2A 3G3MA 2RUSA 4AZGA 2XYLA 2PLCA 1JFXA 2CYGA 2TMDA 1E0TA 3DG7A 2F8QA 3L12A 4C6EA 3B8WA 3WQOA 1BG9A 2BSLA 4WOQA 3CAWA 1NJJA 1TKKA 3LTPA 1I6NA 3I3DA 4JS3A 4YCPA 4H6EA 3VE7A 4M0XA 2D69A 2TODA 3L67A 3UNTA 4LUSB 4GCXA 4PUWA 1V3LA 4PB3A 3SY8A 3IARA 4UQBA 1EIBA 1ONRA 1RJQA 1GEQA 3GG1A 3W7IA 2ZA3A 1R3WA 1CTNA 7A3HA 1EJRC 3OGVA 2XISA 3KTCA 1XM3A 3RIKA 1Z9AA 4RW3A 5E0FA 1AMYA 4DUVA 3R8GA 2WPBA 2O7SA 1PDYA 1THFD 4TX8A 4GIEA 1UH2A 3WJWA 4QE1A 1ZCOA 1A5NC 2IQDA 1SO3A 5SWUA 5H1WA 4Y96A 3MTWA 2CZDA 1W17A 4X63A 4WSHA 3GNOA 1NVMA 1RALA 3S1XA 4BKNA 5CZ0A 1W8GA 2FZNA 3UGRA 5E1QA 2C71A 4ICNA 2IKIA 3REQB 4IP5A 2HCVA 2OYLA 5I3JA 4D9PA 4PUKA 4W86A 5K4XA 3KL5A 4OZOA 5IBXC 1E0UA 4UR8A 4I6VA 1DJIA 4PTNA 4QRNA 3PUOA 3GIYA 5M03A 2QJHA 2C13A 3KM8A 4AAJA 6PTDA 5D32A 2H3DA 2GDQA 2FGLA 5EMLA 1JXJA 3H54A 5HJYA 3OOQA 2PDUA 4D8AA 4MYXA 2PRHA 2YYTA 4CD5A 3RM8A 4B3ZA 1V93A 1JUEA 1OG0A 3VD4A 3MZ2A 2VNCA 4F2BA 4LUTA 1V77A 2C8NA 3OB8A 4MWAD 3VMNA 3VD7A 4WCJA 3N18A 3EWBX 4K38A 1R8LA 3QEZA 2JBMA 4C6OA 4JTCA 4ONVA 1IT7A 3S9IA 3AXKA 2IQ0A 2WV8A 1E6XM 2Z1XA 3R8RA 4J40A 3CUIA 3LBCA 3C52A 1M7JA 4L9YA 5BROA 4C1KA 4D6GA 3GVQA 4RZ6A 4KESA 4WY0A 4DAFA 3WF0A 3MT1A 1JYXA 3WLQA 1EX1A 1VIWA 3M7WA 3QV7A 2VHLA 3GNRA 4UR9A 1ZZMA 2ZX8A 4GVGA 4S39A 4UQAA 4NQ1A 1HKKA 4D72A 4TUFA 2PS2A 3LPOA 3UESA 4P8XA 5AC6A 5DT5A 3VNLA 3L9CA 2BG5A 4JX5A 3SM0A 2XFWA 1TWSA 1VGAA 2GL5A 1KRCC 1CT5A 1J96A 3S5NA 1FDYA 3HMJG 2GK1A 4W8BA 4KMQA 2X30A 5KZEA 3VKJA 3IPWA 5E6YA 5I0DA 4MOZA 1HL2A 1FBAA 3GUWA 1PUDA 4FLRA 2IPWA 2P76A 4G56A 3DU0A 2O56A 4FXSA 3ZFHA 3NQEA 3LPFA 4NX5A 1J01A 4XZHA 3KWXA 2WM1A 3VD3A 1DQUA 3E2VA 3O6DA 2GGIA 2CLPA 2XVLA 3NSXA 4A3HA 1DQXA 3WK2A 4IQEA 3TW7A 4MLRA 3TYZA 1BXCA 1XDMA 4B5SA 2XFYA 3STCA 3N14A 3ANYA 3PBUA 3VIKA 2QR6A 4O1BA 1ZP3A 1OX4A 1A5OC 1VJIA 2G3JA 2YL9A 3RR1A 1PKMA 3TN4A 2P53A 1VBHA 9RUBA 3L21A 3MCOA 1DWFM 3VIIA 1GZGA 3N6HA 4HMCA 4AWUA 1C29A 3M0HA 3NUKA 2Z1WA 1F4AA 1UWQA 3EEZA 3IV8A 3C2FA 4MZ8A 1XXXA 2PRLA 5XINA 1NDVA 2VGGA 1HZYA 3SY1A 1UG6A 3LCWA 5TQLA 2ANUA 5CKSA 1QNOA 3KW3A 2A7PA 3UG4A 4DXXA 3CWOX 3ERPA 4LBRA 2Z26A 4XSMA 2XH7A 1EDGA 4KH2A 1GOOA 2FJKA 4QJ1A 2INEA 2VENA 3B05A 5D37A 3QN3A 2CW6A 3EKGA 3L2MA 3UXDA 1ITXA 4ERAA 5DY3A 1HJWA 2PWHA 2DSWA 3QFWA 2O7QA 2D22A 1DJWA 1D7FA 1ZLPA 5BNKA 1OC7A 3KRBA 3TN3A 4IIFA 4N4QA 1GHSA 1KXTA 3V4BA 4OFCA 4H01A 1E43A 1G01A 1DJGA 5I06A 3JZUA 3ZVHB 1KBJA 1PVNA 1DVJA 2FJUB 4P7NA 3EOLA 3UPWA 4HK5A 2J9ZA 5HK4A 1PZ2A 4KWUA 4NI3A 4PL2A 3FNDA 3WLRA 3PFMA 1LRTA 4OBRA 1EOKA 1HNYA 4I7VA 3ARZA 3S5OA 4NUWA 3VC5A 1BWKA 4U5IA 4A29A 2DW7A 3EB2A 1E0WA 2WMGA 2PF8A 4GUJA 5FEXA 1EGZA 1DV7A 5I09A 3TXVA 1RPKA 3MWAA 3OTRA 1P48A 4XWUA 3NQVA 2V2HA 4PODA 3NQ7A 1AUSL 5KITA 4ADTA 3VTRA 4OV9A 1K7XA 4NZ4A 4QROA 1GORA 4RDZA 1XCXA 4L6DA 1KD0A 2H6RA 3HURA 3ARQA 4X22A 1OX5A 3EPMA 3PG9A 3T7VA 4WSKA 3R5EA 2QCLA 4FP1A 2PCQA 2X0SA 3BCDA 1JZ6A 4M3PA 2ZX7A 3TOPA 4OT7A 4HU3A 3TLLA 3V75A 1OD0A 2WLYA 2OB3A 4M8UA 2ODOA 2OZ3A 1K4GA 1W3JA 2NUWA 3KBSA 3QJAA 4LAMA 3UXAA 4LSBA 1DPMA 3LZ5A 2IXUA 4CU8A 4J5NA 2GZXA 1A0CA 3OG2A 3EPNA 3BH4A 1L8PA 3O1NA 4AMAA 1HP5A 4XIMA 3AMGA 3OHIA 2ZZ7A 4GYPC 1SU5A 2ZA2A 5EL1A 5GJNA 2X1RA 5FF0A 3IIXA 4A21A 2DDXA 2Y63A 1B3XA 1MQQA 4KF1A 2F7FA 3UWYA 4Y9PA 3R4IA 4FLQA 4H3DA 3GG7A 3GHSA 3FAWA 1FFRA 4ZL1A 3S6TA 3OZOA 4GI9A 3UEQA 5AY7A 4EPBC 3FA3A 3P74A 5EYWA 3TJLA 1F3EA 3UZWA 4JQ4A 4L80A 4DB7A 3FLUA 4PEEA 3BGAA 5MF5A 3ONBA 4UTUA 4AYSA 4W88A 3ZS4A 2O9TA 3IRSA 2PTZA 4G7EB 4H9TA 4C7FA 3LHWA 2R9RA 3WQ8A 3PAJA 4PFHA 2VEMA 3SCRA 3XIMA 3ENLA 1AK5A 4G8TA 1SQ7A 3RRXA 3VKAA 5A6AA 2OPJA 1TV5A 3UNDA 4CNOA 1OCJA 3N3MA 4S3EA 4OUEA 3ELFA 4RNIA 2UWFA 3MPGA 4K3ZA 2VX7A 4TX9A 1SYTA 1BGGA 1UD3A 1A47A 1JZ2A 1M7PA 3M07A 3KCLA 1H7OA 4TV6A 2VEKA 3ARXA 3NQ6A 2ZZ6A 3AYSA 5ABEA 3TTEA 2J88A 1RY8A 2V5DA 4QP0A 2PBOA 1SM9A 4C1NB 3NQDA 4LS0A 3RU6A 2OT0A 7PTDA 4Y9MA 1K9EA 1NFPA 4AHOA 3RG6A 2PDCA 1ME9A 2PDPA 8XIAA 2QF8A 3DKLA 1OF8A 3QRHA 3QV9A 1HX0A 1NIUA 2NWSA 5IOBA 4S3BA 3RF9A 2XIMA 3S42A 1VJSA 2YCLA 3M0JA 1NOFA 1NF7A 3CV1A 3THUA 4DZIA 2NV2A 5B7ZA 2Q6ZA 1PHQA 1XLKA 1YLVA 2HDJA 4BZYA 4NL1A 3BOFA 1RD6A 1UZ4A 3CMGA 3ZYZA 3RXZA 1JGIA 4ZB5A 4ZFMA 4B5TA 2AAMA 2F2HA 4KFOA 4N9BA 2OEMA 2QV5A 2CLMA 3CL8A 5U4NA 2V5LA 4NRRA 3CL7A 3EX3A 4QTGA 4B90A 4IGSA 3KXQA 6XIAA 2D24A 2RAGA 3W71A 1V6XA 2YA2A 1JZ4A 2AQWA 5C2GA 5I77A 3KWSA 4B9YA 1JPDX 3D3FA 3V0UA 3W7OA 1XBVA 4L4MA 4BQ3A 2H9AB 1B4KA 2GWNA 3IJDA 4BEUA 2V38A 1XS2A 2AQOA 4KWWA 4AIOA 1T6MA 5AKQA 1X98A 4Z08A 4CNPA 1I60A 3AJXA 1V3MA 4CN1A 3CK5A 1HQTA 4GVIA 1DE6A 3UWEA 3DX5A 2V3FA 1KLZA 1MXGA 3LHZA 1I1WA 1R2SA 3WIJA 4CQAA 1V0LA 2ATMA 4EXAA 4IGNA 1OYBA 3WDRA 3GNXA 1JRCA 3HQNA 3AHVA 3VIMA 3PPGA 3LM3A 5HJXA 5LNSA 2WZTA 5ECUA 2B31A 1RA0A 1NFBA 5BOOA 1JYNA 1PB0A 4LEQA 4CD7A 3NTYA 4MY9A 3WJZA 5LNUA 3NZPA 2F6KA 3S2NA 3W76A 2OR2A 3W1LA 4H9XA 4AWEA 1JXKA 1S1RA 1TMQA 2VZVA 3B97A 1VEOA 2J7GA 5HBFA 3UJRA 3FSUA 4F0MA 4GC4A 4PTXA 1Q5MA 2CKSA 4KCUA 1RY0A 4XK2A 1SSDA 1A4MA 3ALFA 4UCGA 2QCNA 4RE0A 1YXCA 4ZMGA 4RXFA 4L65A 4HYWA 1QU4A 3C8FA 5C6MA 2X41A 4YTSA 1OCQA 3EWXA 1J0JA 4JY9A 1LLWA 5HOSA 2J4GA 3QZ6A 1LOLA 2OG9A 1DJYA 2QIWA 4OBTA 2GVGA 1TJRA 5BMWA 2FFCA 1OB0A 3KVMA 3EB3A 3I6EA 3GNDA 1XLDA 1WKFA 4Z2JA 3DESA 1ONWA 3ZWTA 3ZQ9A 1X6NA 5AC7A 3P5ZA 3W70A 1S39A 4ZR8A 1BYCA 1ESWA 3DH7A 3IGHX 5D04C 4EK7A 4AIBA 3GXFA 6A3HA 4MFDA 1WZMA 1R86A 1VEMA 5FJIA 3THDA 1AL7A 4ZENA 3ABQA 4AG0A 4QLKA 1GONA 1OC6A 1JPKA 4LY4A 1VRXA 3IEBA 2G3MA 3QOMA 2J24A 3U0HA 2BTMA 4GLEA 1FWCC 1TVPA 5I3DA 4C6CA 4AX6A 4X0VA 5DXXA 4MMWA 4DJDD 5TD4A 2HK0A 4UTWC 3MSRA 4U33A 2CLOA 4PRRA 1TA3B 1P0NA 1EGVA 4A2RA 3B8TA 1QATA 1OK4A 3LX9A 3B06A 5F7UA 3HA1A 3HU7A 4Y9OA 4HOZA 3MCMA 1M3UA 4IL0A 3QW4B 1I0DA 1KM1A 4D6CA 4NJHA 3DUGA 3N6JA 1P6WA 3LV5A 4K8EA 1TJ2A 1SZEA 3BANA 3MANA 3CZLA 3WNKA 4HU0A 4P8UA 4O0ZA 3H4GA 1OINA 3AYVA 3QMTA 5CCZA 4EOUA 3U4FA 2J8GA 3QYQA 1V0KA 3VKKA 4F0KA 3W7EA 5HUPA 2V9DA 4XD5A 2INFA 4E0CA 1DKWA 4A35A 4O0KA 5I07A 3VOJA 2PFHA 1RUSA 3H2CA 1E1EA 3S1VA 3NURA 5MKGA 2J13A 4P8WA 4HHMA 3OA5A 1OJXA 4JNZA 2BNJA 4HNUA 2VVNA 2QCDB 1R85A 3SUSA 4FMVA 3LCXA 2WVVA 1FWRA 4YHEA 3I68A 1PTDA 1ZSXA 3W37A 2XHYA 1AH4A 3W7PA 4GBDA 4L6OA 3KUMA 4J2PA 4J28A 4MIMA 5HATA 1S1PA 3MSGA 2PGFA 1NH6A 2PGEA 3PJTA 3BXWA 4WKFA 4QBXA 4EPKA 4V2XA 1LQ0A 1E4IA 1ICSA 1TYGA 1XSIA 3MMWA 5ENLA 1Z48A 4F9JA 4IOTA 3QM3A 3MP4A 2D23A 3TYBA 2VEGA 2GWGA 5KZDA 3OVPA 3VNZA 4DNHA 1OEPA 4QJ4B 4ROPA 1XCFA 4W85A 4HGXA 2J74A 4WXZA 5U7SA 1V6VA 3LSCA 1UPMB 2EJAA 2A5HA 2GOUA 1QDSA 1YXYA 1CI1A 3LHYA 3SCNA 4REQB 1YMYA 1HVXA 3LCHA 5GNXA 1RV8A 2X7VA 1J9YA 4QQ3A 1VAHA 4OTKA 1H7WA 1POJA 1VYPX 1MRQA 2VT0A 3KBVA 4J27A 5G1YA 1LQ2A 5C5YA 1ISZA 3NQ2A 1W6TA 1XRVA 5JIWA 3DENA 2VDHA 3WJSA 3EZ4A 2HSAA 4BS0A 3DHFA 1TB3A 3ITYA 4QAWA 3ORWA 4YVXA 1ISWA 2IMRA 4KWVA 1IT8A 3GNPA 3AROA 3SRKA 2JKAA 4DUWA 1OABA 4HNVA 2B7NA 3L4ZA 1XIGA 2GGEA 4BK9A 1KM6A 1RZMA 3A9BA 3P84A 3CYVA 3TZFA 3VOFA 4K1GA 4B3KA 1OY0A 5DCDA 3CWNA 3NA8A 6TAAA 5BW6A 3MMTA 2OKTA 3NG3A 2EKCA 3C86A 3A21A 3E2RA 1GQIA 4Z2HA 1W9DM 2CHRA 2YGYA 4GFIA 1IR1A 1XG3A 4RPQA 1KR0A 1SVDA 1J79A 2Z1BA 2E09A 2NZLA 1WDDA 1SZGA 3KOFA 3WO8A 1D8WA 1QPOA 1OSEA 1WDWA 1J5SA 3H21A 1RR2A 4ML9A 5EGRA 4M6PA 1VF8A 2JIEA 4DPQA 5KEZA 3CH9A 1FVPA 1TZ9A 2IKGA 3QOKA 2WVSA 2VM8A 2PGWA 1DJHA 1JFHA 5I6SA 3BSMA 3IIOA 3RMJA 4Q4SA 3JRKA 4DWSB 3QC0A 2FZ9A 2E8YA 5LYRA 4KCWA 2VGIA 1NWSA 3OYZA 3WYZA 5CAKA 1WYIA 4UMBA 3KCJA 2OX4A 4X61A 2DZVA 2V5BA 3AIRA 1UUOA 4GQBA 1EKOA 2D2GA 2EPOA 1FWHC 3BAXA 1HJQA 3VDHA 1PO9A 4DXVA 1K03A 1ZUAX 1JQVA 1NY1A 4BI5A 3ZT7A 3GK0A 3IANA 3AIUA 5FJRA 2DVTA 2V2CA 4DF0A 5DMYA 4V15A 4C1LA 3BG9A 2FPVA 5C2XA 1XYAA 1LWHA 1RBLA 1Q6QA 2A7NA 1BWVA 4N0RA 5DFAA 3M7SA 2I9EA 1L6SA 2AKZA 2Z4GA 3IJLA 1PIFA 2TYSA 2BGSA 3S2CA 1UR0A 3BLOA 3WF1A 1Q4WA 1ZJHA 1XIMA 2G96A 5CPNA 4GVHA 5IHRA 4JYEA 7REQB 1F74A 3LEPA 1KGXA 5L6UA 3SUWA 3VNKA 2PD9A 1NP0A 3TMLA 3VMOA 2IPFA 4FAMA 2DSVA 3N2OA 3C2OA 2BZNA 4HIBA 1E15A 4Y2WA 1V02A 4S2BA 1KBLA 2NQHA 1AZ2A 1BFNA 1E71M 1C90A 1CXEA 2QPXA 4QFUA 1KFJA 4Q4MA 4R53A 2DFAA 5CPSA 1DJNA 4P7LA 4H9UA 3GH7A 1GCYA 3K46A 2CLHA 5GVJA 2MNRA 2J78A 3T2QA 2QNEA 2GSJA 2QIIA 1GKPA 2SFPA 3WH9A 2O9RA 3ITLA 1W8SA 1C93A 3WD1A 1RAKA 2YDQA 4XX6A 2I9UA 3UU0A 5AFDA 1E51A 1BKSA 4FR1A 1KFCA 4EKJA 1TRDA 3LV6A 1BG4A 4MUPA 4IMFA 5H8MA 3TP4A 1DJXA 1OGBA 1H7PA 2AKMA 2IPGA 4IICA 4MPQA 2OWWA 5A2AA 1DL3A 3TXZA 1D2KA 3M0XA 5GPRA 1I45A 1O5RA 3WLIA 4JQ2A 3BJFA 2QCHA 4KRUA 5CZKA 3L4VA 5CPOA 1PCWA 5AC4A 3OU8A 5HQEA 1TX0A 3F03K 5B7YA 2WVTA 5AYIA 4O54A 2WNNA 1BVZA 2G97A 1JULA 4IPIA 4C7DA 1OC5A 2X0YA 3LRLA 4OOUA 3WNMA 4LV9A 2PLJA 2RKXA 4P7RA 3FFSA 4CQDA 3TSMA 2GDUA 3URBA 1U30A 3HFTA 4AF0A 3P6LA 2PDGA 4ADUA 1Z3NA 3AS2A 3UWZA 4ASTA 3P3BA 4RXGA 4O11A 2FIQA 3PHAA 1J93A 3NO3A 5D9MA 2Y61A 1M04A 4UBPC 4QM1A 3C0SA 5GJMA 1XRSA 1AQMA 1G4EA 4KT2A 2HZGA 1PX8A 1EWEA 4WLCA 3ZJ8A 4Q33A 3W7DA 5FJOA 1B4EA 4KIEA 3ZM8A 1ZAJA 4A3RA 2EAWA 4FF7A 1PCKA 1IGSA 3L4YA 3Q94A 1R3SA 3ARRA 3G5EA 1UUQA 2V82A 4IX2A 1FOBA 2CETA 1EXPA 3FX4A 2D0GA 3WFLA 2ZDSA 1E72M 1VPXA 2BY1A 4KGLA 1QK2A 4E8GA 1UW9A 2ZRWA 3CB8A 2GJXA 1B9BA 2B7PA 2VGFA 3GU2A 4NG3A 1OZQA 2VMFA 4B2DA 2DZAA 4OJYA 1XH1A 4FNPA 1A0EA 1D3HA 1SR9A 1MQRA 3H4XA 3GNNA 2CLLA 2VFGA 1QHPA 1V6TA 3CL6A 1PIGA 4BJHA 1YTDA 3DGRA 4A4AA 2QUNA 2XZ9A 4HMDA 4J1OA 3N19B 3OJGA 1WZLA 1O94A 3SN4A 1PJ9A 3T40A 1CPUA 4I7UA 4QIUA 4RNJA 1BQGA 4IPLA 4LB3A 4XISA 2Z2BA 4QCEA 1OFRA 1A50A 2Y5EA 1PSCA 4FX6M 2YDAA 4MKNA 3MV01 5C9WA 2PWFA 1BF2A 1CZ1A 4H7ZA 1X97A 2ATSA 3H6OA 4AD4A 4YU1A 3RJXA 1BF6A 1ZB5A 4RV3A 1W9PA 2WHLA 3W7MA 4WOZA 1P6BA 3MVIA 3KFTA 3B40A 3WDIA 5EBAA 3M9YA 1TCMA 2CCRA 1A5CA 4OE7A 2G4JA 1RP9A 2VDIA 4HQVA 4C6QA 3TU9A 2E9BA 3B8DA 4PMOA 1XIDA 1J6PA 4DF2A 1HKVA 4NZ5A 1EHAA 4HA1A 3NXLA 3SGGA 5A2CA 1B3ZA 3CHEA 1IHIA 4G7EA 1A5BA 3KRZA 5HMEA 3HM7A 2FTYA 2ZADA 1YKWA 5KTLA 3GXTA 4JN7A 4NKCA 5CG0A 3GQYA 1XKYA 2VTFA 3PANA 3SJ3A 3N2MA 5E0CA 3W82A 4GY0A 4HTYA 1NELA 4GZEA 1UZDA 2XG9A 3QTGA 3OVGA 3GO2A 4H2CA 3S2MA 4JTGA 3S9YA 1PXGA 1O95A 4WJEA 2W6RA 1KFLA 3PBYA 3LXBA 2X05A 3OLGA 4GACA 1V0NA 4IMCA 3OEXA 1VLWA 4ZA0A 3TV8A 1L8NA 1AL8A 1KBBA 3V7PA 4GJIA 1T41A 1SPQA 2JF6A 2ZRUA 3E6EA 1R6WA 1B0IA 4JNMA 4LYKA 4YWIA 4JN6A 2ZC8A 2GSEA 3LRKA 2XSXA 4PMZA 4DO7A 3GIQA 1PX3A 5EKYA 2GJXB 1RSCA 4W8AA 2E5DA 5FCZA 3T55A 4FOJA 1F05A 1E3XA 4RPPA 4MWAB 2Y8KA 4LXFA 4AVFA 3S2JA 3U2CA 5FF7A 3BMXA 3RNDA 3LHUA 1M9HA 3DC0A 3QF0A 2GQ8A 3LHVA 3MP5A 4XZWA 4AZBA 1AG1O 1A3XA 3KEHA 4O0QA 1XGDA 5M17A 1PS9A 2A6NA 2BS9A 2PC8A 2QJJA 2HPIA 2W3ZA 1CBGA 3W2UA 1WKYA 1LWIA 2XFFA 1RVGA 1MW0A 1ZY9A 4GQGA 3C0QA 3RLUA 2PPGA 1YE4A 4E6MA 5A94A 4Q8QA 3IAQA 1V4YA 2ZFAA 3BGJA 3REQA 4ZQOA 4R9OA 4JHOA 3SUVA 2ZE0A 2B81A 2W27A 3B4YA 5D05A 1W1PA 4W87A 1C8YA 1GVIA 1GWJA 3G1VA 3FXGA 3GKFA 1IZCA 1I8JA 1VFOA 4A8LA 4F3HA 3RM9A 4JTRA 3STEA 2JIWA 1FCBA 3OQ8A 4BEQA 1K8ZA 4GGBA 1YTEA 4IIBA 1E5NA 1W2PA 5G2WA 3FEQA 3PZIA 3BOXA 3T2PA 1XH0A 4EP8C 4Q7IA 1SJAA 2ICSA 4HCDA 1AW1A 4KRTA 1EXBA 2V0TA 4PGLA 3MMDA 2F9RA 1U5VA 1AQ0A 3GDRA 2F2KA 3G0SA 3HPZA 4S3CA 4LBSA 3FEMA 4JFUA 2C14A 3V18A 1VH7A 4LVFA 3QW3A 2WZEA 3NQ8A 3QMSA 4HZ8A 2Q3RA 1UIOA 1XBZA 4LYPA 3VAVA 5HNRA 4GHRA 2PSNA 2PC4A 3SIZA 3H24A 2YDRA 2WQPA 1C8XA 1HO4A 1VEPA 3QTPA 3PPHA 2EG8A 3BWWA 4HCHA 2E6YA 3A3WA 4IZGA 2WQDA 3GS6A 4L1XA 1VFHA 5FA5A 3WLNA 1W5NA 3EDKA 3PBWA 1DIDA 4IIGA 4GJ1A 2F84A 1JF5A 5G2IA 1GVSA 1PIIA 1DWHM 3AAMA 3N34A 5EBUA 4BHYA 2GOKA 5EMMA 2O9PA 3BMVA 3HB9A 4AX7A 1X1NA 1VPYA 5A2BA 1S3TC 1H61A 5C2CA 4PEKA 4MVAA 3POHA 3CZKA 3TUUA 2YB4A 1S2VA 1ODUA 1GPWA 3O7UA 3RM4A 1BYDA 1KM3A 3MQTA 1DEDA 3LLDA 2D0HA 1EZ2A 2TPSA 3MHUA 1XC6A 5H91A 1QRQA 3MBFA 3LSBA 4OWGA 4B92A 2ISWA 1W1VA 1UR2A 2W92A 1LRNA 1FHLA 1N2VA 3DFNA 2WNQA 3MUZ1 3W85A 1SMAA 4W8LA 1O60A 1UKPA 4MHBA 4C91A 2PDNA 1TPC1 3AFBA 4L7ZA 1Z32X 4EWJA 4H1ZA 3UFYA 3F4DA 5AC5A 3ARSA 1QCWA 2ZE3A 5EMKA 3ZR4A 3W6MA 1UKTA 3WNNA 3NQAA 2E0PA 3AHXA 3M0YA 4ENLA 3AS0A 1W5OA 1EIXA 1ZL1A 3PC0A 1E4NA 2ZOXA 3EKLA 4WDWA 3GDLA 4GYPA 4JFVA 1EO5A 3CEUA 4I8YA 5DLCA 3W07A 3NPVA 4BQ5A 1BHGA 1S5VA 2WZMA 1GYMA 1XINA 1Q6CA 1W5PA 3IUHA 5I03A 2ZQ0A 1E6QM 3PWAA 2I5IA 4GXWA 3F7JA 3I6RA 2GVYA 1WAUA 4MLJA 3K8KA 3EX6A 4F40A 3F4WA 2OMAA 1XV8A 1EB3A 3FA4A 3PZNA 3EEGA 2IS7A 3HOJA 5C9ZA 4DBSA 3E1F1 1JI1A 3PUGA 4ZO6A 1XYBA 2JEPA 3L66A 3CNYA 2PTXA 5HINA 2WKJA 4QCFA 2AOSA 2BY2A 3B8SA 3UA3A 1VCFA 3G6MA 3ITOA 4A3YA 4PUMA 4ZSUA 1CCWB 3FYOA 1QXLA 4N7QA 2WJFA 2BASA 4QE5A 3OVQA 2JQXA 4NIRA 1IXNA 1XICA 4PCNA 2E67A 1O5KA 2NX1A 5FAJA 1UH3A 4MTVA 5FIPA 1RK5A 3WSUA 5CGQA 4B16A 3TN6A 3NZQA 2QDHA 2RDTA 3NSMA 2V81A 3EDFA 1WKEA 4Z2LA 3M44A 4LC6A 2I56A 3E2SA 3WENA 2I57A 4DZHA 1HXJA 4U4MA 1TR9A 5FF2A 2QQ6A 4AW7A 4H8NA 2OLSA 3ARUA 1EYWA 1AW2A 3I3EA 4DO5A 1HT6A 1YX1A 4IJCA 1T40A 2G95A 2EGZA 4NAEA 1XHGA 3G1HA 3O6YX 1TPEA 4O10A 4ATLA 4DI9A 4XZMX 5I00A 3VCRA 2WSYA 1LL7A 3M0LA 1N82A 1TREA 3ZZ1A 1UQZA 5CGMA 3LOTA 4UWMA 3S5SA 4KFNA 4HK7A 1G94A 3AZTA 2P88A 3IJ9A 1GYNA 3PWGA 3AC0A 4GPNA 1WCGA 3VKCA 1KM4A 1SUXA 5ECVA 3GZ3A 3EWDA 4LBUA 2ZTKA 3EOUA 4DIAA 1FKXA 3RPTA 2OEKA 2ASHA 4E2DA 4LEFA 1SGJA 3A64A 1Z8AA 4TVDA 3RK8A 2O0TA 3ALGA 3JU2A 5CC3A 4GO9A 1BRLA 2E77A 1PKYA 2I14A 3NDOA 3VM5A 1S3HA 3S47A 3MSYA 3RCYA 4S1FA 3LN3A 4MSSA 1US3A 1OT2A 1MFVA 3ICJA 1MEHA 4N4PA 1H3GA 1R5YA 3LI1A 1XD1A 1W3HA 5HNNA 1Q85A 2PE4A 2V2DA 2XH4A 3ONCA 4DBWA 3W2LA 1YIXA 2YW3A 3GVVA 4JTLA 5AZ1A 3MUCA 1DHKA 1XLHA 3ABZA 2XVNA 3S4TA 4HMEA 4MUZA 1XIHA 4OIFA 3MHFA 3THQA 1O68A 4DELA 4P5UA 4FEZA 2EF9A 3DHDA 1FWGC 5H6HA 3K13A 3WQDA 2W91A 1LROA 2NLYA 5HQMA 3KRUA 4RX0A 4XZLX 1QPKA 4LF2A 5HULA 1Q13A 3TR2A 1R2RA 2Z6JA 4Q4OA 1A4LA 5C0QA 3FYYA 1ZP4A 2GVEA 3GYEA 4ACYA 3NYZA 4B5WA 1UD2A 1W32A 5D9PA 4PUNA 1MZHA 4DNMA 3T1GA 4K36A 4V28A 1RQEA 4DHGA 2ZX9A 5BU9A 5A1AA 3UERA 2XU2A 3AIWA 3H7RA 4J3XA 4YTRA 4V1YA 4IMAA 2DORA 3CZEA 4WY0F 3B8UA 2HE8A 1KFWA 3QV6A 3P0WA 1MI3A 4IMGA 2NT0A 1C91A 1WE5A 1L6FA 3WQPA 5CPLA 3HG3A 4I7WA 4D71A 3CV2A 4TOQA 2JKPA 4BWLC 4DEFA 3N17A 1GW9A 4AZ5A 1MW3A 1H5VA 3GKAA 4D2JA 3IIVA 5G4EA 1TA3A 3DHPA 1IT0A 3WELA 1CWYA 5TNVA 3QR0A 4FNSA 3EBVA 4U10A 3T9PA 3BJSA 2QMKA 2FB3A 1GYLA 2KAUC 1W31A 2VEFA 3SCTA 2YR1A 4W93A 1AD1A 1E4MM 1FHUA 1ME8A 1UJQA 3EOEA 3PBGA 4WF7A 1S46A 2VXNA 1JJKA 1I1XA 4MF4A 2PEVA 3TLQA 4DJED 2E6DA 4KCTA 5F2IA 1O1HA 3CTLA 3K4WA 4R9XA 2PA6A 3WLOA 2HISA 4UTHA 3BAJA 3UR7A 4QSFA 1J11A 3AXIA 4C7GA 4XZ9A 5HNUA 4DF1A 1QFEA 4TVCA 1KM0A 3THAA 5I3GA 1PWLA 3EOSA 5E09A 4XD6A 3WLHA 3UBPC 1PAMA 1XFBA 1OD8A 4I9MA 4MAZA 3L2IA 2VX5A 3CGTA 4XBSA 4AYGA 4IGMA 4YLWA 4LUIA 1P1MA 1EL3A 2PDMA 1FP9A 1R3QA 4IH3A 3SJNA 3GFZA 4OHQA 5HR7A 3HG5A 4WSJA 1EGMA 3K30A 4OKDA 3E9AA 3AWOA 1FWFC 1C92A 1Q66A 1ZFJA 4Q4KA 3VGFA 2BVYA 5I23A 1WO2A 4PMJA 4W7UA 3WJYA 2WSPA 3STFA 4CVUA 4RDYA 4QISA 4DXKA 2DU2A 4Q8VA 1V5XA 4DJFD 3W86A 2BHZA 4BWLA 1IQ8A 4IFOA 3VINA 1LT8A 1GK8A 3VDCA 1MZRA 4O13A 1V51A 1UD5A 1HW6A 1LJYA 2IW0A 3GDTA 1QOPA 3H2AA 4WDTA 4Z1CA 3P8JA 5JH1A 5ABHA 1KFBA 2V3EA 3HV8A 1G4PA 5A8GA 3WBWA 1EO7A 1JAKA 4JL1A 3ZT6A 3E2QA 1US0A 1FDZA 2NWRA 2HE5A 4HU4A 2CWXA 2QS8A 4DVOA 2OSYA 4ZE5A 4AVOA 4R7JA 1TWIA 1JDAA 1UOZA 3ECQA 2P10A 3BAWA 4IP4A 2VCCA 4DJDC 1QI2A 4N9DA 1Q7MA 2INZA 4ROQA 2PTYA 3OLDA 4XTDA 1CXHA 1VR6A 4UOQA 3CS2A 1XQKA 3R1ZA 4IFKB 1E40A 3DC8A 4CD8A 1H1ZA 1HKMA 2OTDA 3B03A 4L9ZA 2ZZ4A 1J2BA 4K7YA 4YTUA 2OO0A 4B5UA 4B5NA 3WQCA 3DN5A 4JR5A 4XO7A 3N2CA 5HQLA 1ZRQA 5HUOA 3WQGA 6XIMA 3W7KA 4B91A 2NVCA 1M1BA 3USBA 1SO4A 3MYPA 2R8WA 1BTMA 4HBKA 4Z2GA 4LAZA 4V1XA 1VRDA 3L4TA 2BXVA 1JPMA 2RJHA 2FVMA 1TQJA 2Q71A 3UR5A 4XUGA 2WLZA 1OYAA 4J3TA 1OZMA 3GXNA 4FX8A 1UYQA 3W84A 5D2XA 1NF0A 1UR3M 1DWGM 3UPMA 3KVKA 4B4FA 4PSPA 1W3NA 4DM1A 4TTGA 4IQDA 4QDPA 3M16A 4YPJA 3HFYA 4GXMA 3KLKA 2WC4A 4I9JA 3MO7A 1EQPA 4AZ7A 3BQ6A 3OYXA 1O12A 2WOQA 3N29A 1YHTA 2FZBA 3U2EA 1W1TA 2QZRA 1IXPA 3CV7A 4ICMA 3T0CA 4DN1A 3W87A 4K68A 3OZMA 2FPYA 2QEZA 3BURA 5EPDA 3AALA 3VYLA 3VDBA 2DQXA 1IE7C 2V30A 4NHVA 3I7QA 1C9WA 3GIPA 4RNFA 2PF0A 2YSWA 4QG9A 4M7TA 1K6WA 1O5QA 1TX2A 2GQ3A 4H6KA 2D3LA 2YCJA 4H9ZA 1WBHA 1B57A 1S2CA 4L61A 4HHPA 4R7OA 4Q8OA 1TPB1 1LORA 4FLSA 3KOZA 3S6OA 3RITA 2A4AA 1UQYA 1K8CA 2PWGA 4FI4A 5AZ0A 2BGQA 3PZQA 4JQAA 2PWVA 1Q6GA 3GC2A 2HBVA 4YTQA 5T91A 4QDWA 3HQPA 3UJSA 1VHCA 1H49A 1YPFA 1LQAA 3QBUA 2CXGA 4ZXLA 4Q4QA 5E5CA 2DQWA 4NJIA 2I5GA 4GZJA 4KBXA 1K77A 4PMDA 4E4PA 4ORIA 1S2TA 3PWIA 3G6LA 4DYJA 4TQTA 2HBXA 1FCUA 3FYPA 2Y7GA 1AZ1A 3SCUA 1CENA 4KEVA 3F2DA 2VI0A 2OSWA 1AMKA 3WD3A 4ZODA 4PMUA 3WMLA 3RILA 1RK6A 3SCOA 2P5NA 4ES4A 2NX3A 3T08A 2POZA 3NQGA 2QGYA 1TFVA 4J7RA 4AZIA 1HTIA 1WZKA 1NSJA 3NQMA 4LANA 3H7UA 3V1PA 4PH6A 1DE5A 3VC6A 3R8HA 1F6YA 4KCVA 4IFRA 3UR2A 8XIMA 2ZZ1A 1EC8A 3MUIA 1JD7A 3E49A 3WUBA 1A5KC 4GX8A 3SECA 4E3TA 2GPTA 2REQB 1NAL1 3BE7A 5IXEA 1F4HA 3VDGA 2FZMA 4ZOBA 1TV7A 3VZXA 4D1JA 2QDDA 1U1JA 4XAPA 4H8UA 3G1XA 1JYWA 3Q4DA 3CO8A 4AD2A 1R46A 1XI3A 2PBGA 3QSRA 4BI7A 4JX4A 3FDKA 3IJIA 1JG9A 2ZYFA 2D1ZA 2J75A 3LZ3A 5DMNA 3ZJKA 3PZGA 4FR6A 4JHMA 4DRSA 2QT3A 1LUCA 1YE6A 1A49A 1QI3A 3L4WA 2QUVA 1KXQA 4DAIA 5E70A 3IIPA 2VWTA 1HN1A 4M7SA 4AWSA 3GVRA 3I4EA 3CH0A 4H7CA 1XDLA 1J0YA 1D8CA 3AO0A 2VJXA 1QW7A 2HS8A 1CDGA 4LRSA 1CXFA 1FWSA 4S2CA 4O1AA 1L9WA 3EDDA 2WKGA 3ANVA 2NV1A 2YYUA 1EEPA 1HP4A 4H6RA 4ZXOA 8A3HA 3LCGA 1NTHA 2W9MA 3TYUA 4HNLA 1GOIA 4HP5A 2QJGA 4LAKA 4W4QA 1HUVA 3SN1A 4B3LA 4RJEA 5CJMA 1N8IA 2G3NA 2GUYA 2NXGA 3TOYA 3D5HA 1UR4A 1TG7A 5A3HA 4H41A 4CNNA 4ZQNA 3GWQA 3K8MA 4GMEA 4MPKA 3QMRA 4Z1BA 5D8WA 1MDRA 4N6FA 3GY1A 5JUVA 1ONXA 1QJWA 3V1HA 2QUTA 4KERA 4MWAA 2POTA 4XBJA 3MY9A 3L7RA 1J0ZA 3GTIA 3KHJA 1UMLA 1ZJIA 5CAHA 4BR1A 1KC7A 1NQKA 4TX6A 1XRFA 4EXBA 5LIYX 3W7GA 5FD0A 4LB4A 2FZ8A 1E73M 5T9CE 2E6FA 3CXOA 1MWOA 5CZTA 4JIHA 4MJMA 2BXZA 1H7NA 3GTXA 3SCQA 4D6IA 1GTHA 3VXGA 1CXLA 3HZ3A 1TTQA 1R3TA 1XQLA 3GG8A 4AUBA 2QGHA 2EG6A 1NWRA 1BKHA 2X1IA 5HMFA 2F6XA 5HA7A 2GYIA 2C1GA 3XISA 3BPWA 4UQEA 2BGNE 3NZGA 4JTUA 5AECA 2HK1A 4B5XA 5HPCA 4FS9A 5CJNA 5A8PA 1B3VA 3SFWA 3NJ3A 2AQVA 1BSLA 5KSWA 1W1B1 1GQJA 4S38A 7ODCA 3GG0A 3TKFA 3CQIA 1KA9F 1W1ZA 4LF1A 3L0NA 2J7CA 3SIMA 4MY8A 1EJ7L 5AVNA 4K37A 4TR9A 3WCZA 4E2BA 1HO1A 3W1MA 5I78A 4PFMA 1G69A 2QKFA 1XCWA 3AHYA 1D3CA 4HU8A 3PJXA 1RBAA 4JXCA 1QNPA 4UIOA 1IF2A 2Q3OA 3C2VA 4H2HA 4B5VA 3GBEA 2P1FA 1VBGA 3RJYA 1YW1A 3WDPP 4QEHA 2R1PA 3W24A 2W66A 4QLJA 4KWSA 5FJJA 3GRIA 2BVWA 2UY3A 1BPLB 1M03A 2B0MA 4LC8A 2WXDM 1UP0A 2C1IA 2ACUA 4D6FA 2WVVB 5F1UA 2QCDA 1TTJA 1G4TA 3GVWA 1P5BA 1KKOA 3TQVA 3G1RA 3W83A 5MKGB 3N9RA 2RGMA 1J8VA 2O4QA 1B2YA 3EDJA 2C18A 3EMQA 1H0IA 2Y2WA 3M5ZA 3O06A 5D2TA 3HBLA 3NGJA 4LW7A 4TU1A 1ZALA 5LNRA 2EBNA 3S5YA 1EUNA 2OWCA 1U5JA 2CERA 4LS1A 2ZZ5A 3CTTA 3P60A 3EA3A 3A4XA 3ZSTA 2BY0A 4DWSC 4MY1A 2CWNA 2W4XA 1IR2A 1NP2A 4F2UA 4HMNA 4ILSA 1YADA 4CVWA 3LMZA 1LUCB 2QPUA 3KE0A 3SAZA 2R94A 4NAFB 2PD5A 4NNBA 3W7JA 3PPFA 1QBBA 3BO9A 4UCFA 3VD9A 5DCBA 2R1NA 2VDGA 1M5WA 4QNEA 1JCYA 1YBQA 2VOTA 3DEQA 5ABFA 3I10A 4TO8A 3URNA 4ZB2A 4F4RA 3BLFA 4QS6A 4MYAA 5CBBA 1NDWA 4JFWA 3UF9A 2XH0A 4YTTA 3UQNA 1VFTA 4M6VA 1QTWA 3OIXA 1VFFA 1XR2A 2XM1A 2FB2A 2XVGA 2QDEA 1LL4A 2NUYA 1W3TA 2OXNA 3W1AA 2ACQA 2VR2A 1PHWA 3SDOA 5BXSA 3RLHA 2DSKA 4LH8A 2GQ9A 4JKMA 3DFQA 1XIFA 3CUGA 1CLKA 3O05A 4JY8A 2PODA 1S2AA 3R89A 3UD6A 1XF0A 4JIIX 3P7YA 4GYFA 2VZSA 5AHEA 4O8AA 2QLYA 2QCMA 5DELA 1Y5XA 3VKBA 3FHAA 1NOUA 1V8EA 1EC9A 3VNIA 3LGDA 4RLIA 1BGAA 2DZUA 1UA3A 2PDKA 3LRMA 1EF2A 2X09A 3HV9A 1W2VA 1IZJA 5E9AA 3KRSA 4YJ5A 4CCCA 4B9ZA 3N4FA 3B0PA 4PUDA 1I4NA 5A6JA 3GH4A 1XSJA 1UA7A 3T0TA 2HRWA 3BL3A 2CLFA 5E93A 2GJNA 1Q8AA 3ATZA 2QXWA 1QWKA 1WV2A 1QI0A 5BYWA 4AD3A 3KP0A 3LLFA 5M3WA 3WH8A 1RCXB 5FACA 3MI2A 4XO6A 3O63A 3GXDA 1VB9A 3PFRA 4BA0A 2JFEX 3NEHA 3ES7A 4FNUA 1XLBA 5IHSA 5REQA 2FMNA 4TMCA 3NR0A 4Q8UA 3T4WA 3MS8A 2C1HA 4F2TA 1OX6A 1YXDA 2WZHA 2DT1A 2NQJA 4LU0A 3O8AA 3SCVA 4OECA 1Q8JA 4HPNA 1CIUA 2VC6A 1R3VA 3VUPA 1I75A 3JVAA 1D3GA 4ZQPA 5CEWA 1L0PA 3EYPA 5K7JA 3EXRA 3ZT5A 5CC7A 1GOXA 2VL4A 4C65A 2HTMA 4F9DA 1S5TA 4GABA 3HGOA 3MMUA 3HPFA 4JQ1A 4K8GA 4AC7C 3MA8A 1GOMA 3WG6A 2VFDA 2OZ0A 3AISA 2F61A 2WMKA 3T44A 3U4AA 4PTDA 1U33A 4P2VA 5A6TC 4IFKA 1ADDA 3PB0A 1ZCCA 1GJWA 2QAFA 5GNYA 1G5AA 4CU6A 3R2GA 4YYFA 2KZHA 1BWLA 3WBAA 4YL2A 1TCDA 4ACZA 2W62A 4MKVA 1QI4A 3R6IA 1X38A 4XAYA 5D8ZA 1H09A 3BGGA 3LUTA 1ECQA 4YWSA 2WNWA 1V08A 3QSTA 4YMZA 1TZ7A 4ICCX 1SW3A 3I3BA 2BOEX 4UTTC 3SQLA 4M56A 2DT3A 1EFZA 4ATDA 3GHTA 2E28A 4HPJA 2Z25A 3NGFA 1N7KA 2RGLA 2PU1A 1AA1B 1Z6KA 5G2HA 2WHKA 3W29A 5T9BG 4J3ZA 1KQYA 3KBMA 4AQLA 3FOKA 1AODA 3MCNA 3GBDA 3L0GA 1UROA 3N2XA 1BQCA 4L4LA 5A6BA 3BAIA 3TTOA 4A3QA 4BCEA 2QV4A 4R5EA 1J6OA 3A12A 1MDLA 3M46A 1B3YA 4XAZA 2WBKA 2WAGA 3DCPA 4OOZA 3H22A 1PWMA 5CSYA 3V5FA 3ARYA 5DBTA 3ZWSA 1ISYA 3DERA 5C7VA 4UFLA 1GJPA 3INPA 1JPIA 5D4YA 1LG2A 4EANA 2Q09A 1IWBA 3VI2A 1KV5A 4N42A 5JMUA 1H50A 1OWQA 2JKEA 4WZHA 6REQA 2W67A 2HNHA 1FTXA 1TTIA 1TV3A 3MUY1 3EX2A 3WL0A 4E5TA 1UWUA 2WMFA 3ZR5A 3N4EA 2ACRA 2HVNA 3DG6A 4J3UA 4O1EA 3SR7A 2RHGA 3VOGA 4Q7BA 3W2KA 2V68A 4REQA 3S1GA 4JIQA 2W63A 3G1SA 1T0OA 5BZAA 5HNTA 1XYZA 4RL3A 4RV8A 4G2DA 3IK2A 4M1BA 4D6JA 2VZUA 2BB0A 1SFSA 3TC7A 4F8XA 2WZIA 5FSEC 2WMIB 1EC7A 3W7RA 2ZICA 3VX1A 4FNQA 1TPH1 3CAQA 1UMYA 3I7RA 4MJ4A 4GH3A 3RO8A 4P7OA 3IJ8A 2DEPA 3TROA 4UNLA 1WBJA 3M0ZA 4LQ1A 4AC1X 4IPJA 3CUFA 5FEZA 4NZ1A 1WNOA 4IXHA 3V3WA 3U5UA 1K4HA 4LNCA 2YXXA 3UP8A 3LB0A 3KZPA 4JICA 1FY6A 1GVYA 3Q58A 3RYSA 2VYOA 1NARA 3RU8X 4US5D 3HJZA 2P8CA 1KB3A 4FX7A 3WMSA 3NO1A 1IEXA 1TWWA 1P7TB 3TEVA 1VYSX 3VFLA 3PF3A 1VJZA 3VFCA 4UTMA 4C6MA 3GTFA 2G3FA 1OT1A 1OFPA 2VFIA 1SR0A 1Z42A 1E0XA 1NWUA 3CPGA 4C6PA 3BCFA 3HO8A 5D33A 4MGGA 3ABXA 1FWBC 1I9CB 1CLXA 2WWDA 3E02A 4YS1A 5M5DA 2Q8LA 2Q8XA 4GQ0A 1VD6A 1H41A 1BVWA 3FXYA 3H2EA 3LTSA 4WUIA 5LGZA 1J4EA 1V3KA 3C5QA 3APTA 2EHHA 5A6SA 3UG8A 1H51A 5BWAA 4GRSA 4Y8FA 1E6RA 3F1QA 3F5JA 1UIPA 2OZTA 5TAOA 2HVOA 3BDKA 1K8XA 2EPNA 3KDNA 1XLCA 2FGBA 4WDUA 1LLZA 3ZLGA 1TUFA 2HROA 3GH5A 4W9TA 3O16A 2YKKA 2HPMA 1XP3A 3QY7A 3CYJA 5DQPA 4D6HA 2P50A 3FJNA 3GXPA 5LA1A 4A05A 4NZFA 4AY8A 3EMCA 3G22A 1ZS2A 2E6AA 3F5LA 1LOQA 3N3TA 3TZNA 5K9XA 2X1SA 4R3UA 1E9ZB 4I5RA 3NQBA 5A8OA 1U1UA 4FIRA 4AXNA 3CHVA 1RBOB 3OIHA 2Z28A 4LYRA 4QXIA 1ZHAA 4DWSD 2PU0A 1TR1A 1VKFA 3DHUA 3EB4A 3SADA 1PZ3A 1OIFA 4GWEA 1K9DA 4AIEA 1KTNA 1UD6A 2WCSA 2X1UA 3PTQA 4I9AA 3TJIA 1Z89A 1VENA 5BWFA 4H6QA 3PTMA 1UWSA 5FF4A 3ITTA 4S3FA 3SW6A 2YJQA 1X6UA 1EDTA 4ZB0A 1ODZA 2DVUA 3UJFA 3KTXA 2G0WA 2ZC1A 2D3NA 3ZO9A 4OUIA 2VO5A 3RAOA 1JYVA 4NX0A 3SEPA 4TIMA 3W1TA 3G77A 6TIMA 4WXYA 3HG4A 3OG3A 2D73A 1LBLA 4L4OA 4JGDA 5CH9A 1OX4B 1SJDA 3W7LA 1S38A 2CU0A 3UWUA 4LCRA 5I7GA 4JQ3A 4TMBA 2GK1B 3W02A 1QW8A 4ZQCA 3VABA 3VGGA 1Z41A 4PMVA 4IX0A 5BXPA 1EJXC 1VIZA 4ECLA 1FFQA 5A8QA 3KBNA 4LWWA 5H2ZA 3TE9A 5HAOA 3ITXA 4ZOAA 3PAOA 1C8VA 3OBAA 2GJPA 4CCDA 1VFMA 2A3EA 3GAKA 1FWAC 1OK6A 3HQOA 3BV4A 1T99A 2OT1A 3T07A 3LNPA 3KCOA 5LXEA 3DBPA 3N2TA 3EWWA 4ERGA 4L5ZA 1OBAA 1XIBA 2J7EA 3WN6A 5D38A 1TPFA 2Y8UA 3WBYA 4MNLA 3DGBA 3G24A 3RFAA 4CCEA 1BXNA 3SQMA 1M7OA 4XAGA 4A8RA 5K9CA 3O15A 5F2MA 2QF7A 2CITA 3U6WA 3UVAA 4BF5A 2FDSA 4ZOCA 3B0XA 1GHRA 1D7KA 4B2DD 4RZ5A 2VP8A 1XYCA 2PDFA 3L2LA 1IXQA 2PWDA 1ITCA 4WY0B 5FSDC 3SFKA 3NPUA 4F0HA 3DKJA 1QO2A 4LGXA 3WQVA 1GVOA 1W1A1 4JN8A 3IVUA 1OFDA 2YL6A 2VUNA 4ZSTA 1MW2A 3TFXA 2E1WA 1SJCA 4PMNA 5D03A 2ALRA 1F07A 2OO6A 4AWTA 3T2OA 1LYXA 1EX5A 3SB0A 3ZR6A 4DLMA 1K6AA 2IPJA 3VCNA 1I2OA 2VFEA 1CX9A 1MEWA 4EAMA 3AXHA 5T8GA 3MJYA 4XD3A 2D2HA 1V6WA 1DIKA 5AC8A 1TVNA 3HGSA 2XSBA 2XIIA 3R0KA 1CW2A 1M68A 5HJLA 5A6BD 5G1TA 1A5AA 5J5DA 3VGBA 3WNPA 2TAAA 4H9MA 1KBIA 4Q4PA 1Y65A 4PYSA 4UFJA 3FGCA 1YPXA 4HOWA 4M6UA 4RW5A 1KXHA 3WFAA 1XBXA 1JAEA 2LLEA 1X8FA 5EY5A 4FXFA 1LTDA 2RJGA 1R2TA 2XIQA 3WL1A 1F9CA 1TVLA 4HSOA 4CKQA 3NQCA 4Z0JA 3PBMA 2HQAA 2OOGA 3GC4A 3GD6A 2BODX 1CYGA 1QNRA 3O07A 1PL9A 1Q7QA 3THCA 3FGCB 3VPLA 4LAOA 3B9OA 5HXMA 4H83A 3GZAA 3P82A 4W84A 4FA3A 5LIWX 2D2OA 3GXIA 5TIMA 5I3FA 4GKLA 2CEQA 8TIMA 2DSUA 4I90A 4XV0A 3AHZA 1GVEA 3AMDA 2L5HA 1MXDA 3RUBL 2VCAA 2ABBA 4UQ9A 3MV11 3EMZA 4H8VA 7TIMA 4AHQA 3BAYA 2CZ5A 4NAFA 1DWJM 3CQJA 5A6LA 3K8LA 3SGZA 3AUJA 1E70M 3B4UA 3WLMA 3GFYA 3PJWA 1ZBCA 2Z29A 3VD5A 4XVEA 2WPGA 1Q6EA 2JE8A 3GU9A 3CLWA 3T0BA 2HV5A 3FDGA 3OPSA 1M41A 4DO6A 5G1MA 1SMDA 3F4VA 3WUEA 3SBFA 3O6AA 1G4SA 1LOSA 1ONEA 3QQ1A 3E0LA 1A5SA 1QMLA 4JEQA 4A8IA 3SCSA 3S5ZA 4NP7A 1ZPTA 3BV7A 2OFJA 1VQTA 3W7HA 1F3WA 1MEIA 3E12A 3ZVIA 5AOUA 5FKYA 3TA9A 2YPIA 3WH6A 3OHMB 2D0FA 1XIEA 3C0LA 1B3OA 2OKOA 2ISFA 1SO5A 4GA8A 1XWYA 4DBDA 4UOZA 2C0AA 3C2EA 3UWWA 3V0TA 3CHDA 5FJUA 3K2GA 1YTKA 3WQEA 3NWRA 2FGZA 3W1RA 4K8HA 1JCXA 3MVTA 5LSMA 1TTPA 4AMCA 1B30A 1XLAA 5F1VA 1OADA 2VVSA 1BYAA 4K7VA 3W23A 3L4XA 3T05A 1GZJA 5K4ZA 3G3DA 4K2SA 2ZKMX 2Q01A 1GVRA 1X1OA 4MB1A 4AY7A 3MDUA 2NQLA 3OZPA 4FHAA 1QWGA 1KRMA