4LANA

Crystal structure of cordyceps militaris idcase h195a mutant
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
370
structure length
370
Chain Sequence
b'TPVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLAPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-5-carboxylate decarboxylase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
total genus 137
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lanA00
4HK7A 2WJFA 4GYFA 2QVNA 4EPEC 1EJRC 3E0LA 3QGKC 3S4TA 4YIWA 4C6PA 3GU1A 3TN5A 4V1YA 3MSRA 3GTFA 4G7EB 5FSEC 1FWCC 1FWAC 4XAGA 5A6TC 1P1MA 4H01A 1YNYA 4I6VA 4PCNA 4H9UA 2HPIA 3NURA 3PANA 3C86A 3F4DA 3GU9A 2W9MA 3MJMA 2EG6A 2Z2AA 4BY3A 4DZIA 4HK5A 3OOQA 3ICJA 1E9YB 3QY8A 4QS6A 1A5MC 1NDVA 2O4QA 3JZEA 3TN6A 2GWGA 4H00A 1ONWA 1A5NC 1VFLA 1NDWA 1XWYA 1K1DA 1YIXA 2VC7A 4ZSUA 1M68A 3IGHX 4DLMA 1KRAC 2HPMA 4IQJA 1WXZA 3KM8A 1NDZA 4RDVA 3E38A 4XAFA 4F0LA 1RK5A 1J79A 2PGFA 3URNA 2HNHA 1PB0A 4C6LA 4HK6A 1NDYA 1KRCC 4B92A 3O0FA 3URBA 2WJDA 4DI8A 4IFKA 3OODA 3E3HA 2AMXA 3AU2A 3SFWA 4C6NA 2R1NA 3LSBA 3A3XA 2WM1A 2FVKA 3PAOA 2IMRA 2ICSA 3HTWA 3UPMA 3ORWA 1RAKA 4GXWA 4RDZA 3QY7A 3CJPA 4J35A 4R7WA 4H9ZA 2GOKA 3ITCA 1A5OC 4GY0A 3ISIX 4H9MA 1PTAA 3K2GA 4INFA 2OOFA 3LA4A 3UR5A 3K4WA 3PBMA 4KESA 1RA5A 4PCPA 4QSFA 3IRSA 4C6BA 4QRNA 4CQDA 3RYSA 1V51A 1YBQB 4H9XA 1EJTC 4C65A 5G4HC 1FWEC 4M51A 4C6JA 4IG2A 4DZHA 4LCSA 1I0DA 4CEUC 1ONXA 3LGGA 4QS5A 2DVXA 4IFKB 1UIPA 1KRBC 4LFYA 4XAYA 2E25A 2YXOA 3G77A 3F2CA 4C6EA 4C6OA 4C6CA 3F2DA 1P6CA 1O12A 5FSDC 4BKNA 1XRFA 3IJ6A 4KERA 2OB3A 4R88A 1EJXC 2PUZA 3TN3A 3OU8A 2R1LA 2QS8A 3GIPA 2ZC1A 3LY0A 2GSEA 5E5CA 2AQVA 4CQCA 4KQNA 4C6FA 4HA0A 4UBPC 4I6KA 2HBVA 2YZ5A 1FWBC 1ADDA 2E1WA 4EPDC 1RA0A 3EWDA 4KIRA 1ITQA 1FWGC 3N2CA 5CH9A 3DUGA 2OQLA 2Z2BA 2DVTA 4LAOA 4LCQA 4C6MA 4LCRA 3B40A 5AKQA 4RDYA 3D6NA 3OVGA 4L6DA 4C5ZA 3CAKA 1I0BA 2XIOA 1IE7C 4RDWA 3MPGA 2Z00A 1YRRA 2WJEA 4ICMA 3UF9A 1PO9A 1V4YA 2OODA 1FKWA 1J6OA 3LU2A 1A5LC 2HQAA 2VM8A 2D2JA 3E0FA 2P53A 1V7AA 4RZBA 3TNBA 2FVMA 4D8LA 2R1MA 3MDWA 4WGXA 4TQTA 2QPXA 4GC3A 1FWIC 4DI9A 4CEXC 1K70A 2CZVA 1M7JA 4XAZA 4H9YA 2DVUA 2AQOA 3S2JA 3DCPA 2UBPC 4C6DA 3F2BA 1RJQA 1WXYA 3ID7A 2GWNA 1V79A 2Z28A 1EJWC 2PLMA 3LNPA 4AC7C 4C60A 5LXXA 4XD5A 1PSCA 3UR2A 4RE0A 4EPBC 1EJSC 3T81A 1GKPA 2VC5A 1A4MA 1EF2A 1DPMA 3PNUA 2EG8A 2RAGA 3AUOA 1FWFC 3GRIA 4EPKA 4G7EA 4GX8A 4DLFA 2D2GA 3MVTA 4KEVA 3GTXA 1KCXA 3NEHA 4P5UA 3WYZA 2PGRA 2Z26A 4LAKA 1FWJC 2VHLA 3R0DA 4AQLA 4GK8A 4H9TA 2ANUA 2P50A 2A3LA 4LALA 4DO7A 4XD6A 4C6KA 2VR2A 4GBDA 4JOMA 1QXLA 4C5YA 2Y1HA 3FDGA 2Z27A 4XD4A 4BJHA 3MTWA 2F6KA 3K5XA 2QT3A 2YB1A 4GZ7A 1ITUA 4L9XA 4LAMA 1A5KC 3MVIA 4ERGA 2UZ9A 3B0YA 3GIQA 2Z29A 3RHGA 2I9UA 4H9VA 4PBFA 4OFCA 4IGNA 3S2NA 3TN4A 4B90A 2GZXA 1XGEA 3RCMA 1XRTA 3T1GA 4E3TA 4ERAA 4QROA 1A4LA 3LGDA 3E74A 4CQBA 4R85A 4KEUA 4LEFA 4IG2B 1YMYA 2O4MA 4B91A 4QTGA 4KF1A 3UBPC 1J6PA 2R1PA 3B0XA 3IV8A 2R1KA 3RN6A 1EYWA 1RJRA 4IFOA 4IGMA 3DC8A 4C6QA 1ZZMA 1GKQA 1R9ZA 1UIOA 4CNSA 3WZ0E 2EG7A 4HJWA 3WMLA 4GX9A 4LH8A 3FEQA 3GTIA 1V77A 3PNZA 3MDUA 3QY6A 4IH3A 3BE7A 4ERIA 4EP8C 2Z24A 3SO7A 2PAJA 4GY1A 4WVXA 5HMDA 3IPWA 3T8LA 1YBQA 4NP7A 1GKRA 2G3FA 5HMEA 2I5GA 4CNUA 2Q01A 1P6BA 3S2LA 2FTWA 4XD3A 3E2VA 4KEZA 1EZ2A 2Z4GA 2ADAA 1M65A 3URAA 3IARA 3OQEA 4DYKA 3QGAC 1QW7A 2Q09A 3OJGA 3S2MA 4DIAA 1J5SA 3GU2A 1FWHC 3HPAA 4UB9A 3LSCA 2Z25A 3V7PA 3O7UA 2FTYA 3LS9A 4J2MA 1EJUC 2YB4A 4B3ZA 3GTHA 4V1XA 4Z42C 3IACA 4ZSTA 2Z7GA 3FDKA 4MUPA 1POKA 2OGJA 4IFRA 1FWDC 3EWCA 4J5NA 2D2HA 1W1IE 4PBEA 3EGJA 4GY7A 3CS2A 1BF6A 2HBXA 1EJVC 2VUNA 3GUWA 1E9ZB 1K6WA 5HMFA 4LANA 1UMLA 4GOAA 3URQA 1JGMA 1O5RA 4NG3A 2FFIA 4C6IA 4IF2A 1R9YA 3HM7A 4PE8A 1NFGA 1UBPC 4DNMA 3F4CA 4CNTA 1RK6A 4WHBA 1KRMA 3A4JA 1FKXA 4KETA 1R9XA 1POJA 2BGNE 4G2DA 3A3WA 1HZYA 2KAUC 4F0SA 3NQBA 2BB0A 3GG7A 1S3TC 3AU6A 1RJPA 3MKVA 4NI8A 4F0RA
chains in the Genus database with same CATH superfamily
3W1MA 3OIXA 4GYFA 4EPEC 1EQPA 2UV8G 3PZVA 1RD5A 3TJIA 3SI9A 2XFYA 1FWCC 4B3KA 3N04A 1Q2RA 3UETA 2WXDM 3UJEA 3S9IA 4B5VA 4AYGA 3PANA 1UJPA 1I2OA 2W9MA 1LJYA 1UWTA 2PDKA 1ALDA 1JPHA 3USZA 3BWWA 3PWGA 3UA3A 1O7AA 1WDDA 1OJXA 2CNCA 3U4AA 1M68A 3UXLA 3PZMA 3CHCA 2J7HA 4LSBA 1NELA 3TA9A 1DP0A 3LPGA 3CTLA 1PZ3A 4KEMA 2RKXA 1QOXA 2OFJA 1JPDX 1WAUA 2DIJA 4IZGA 4DJFD 2EJAA 1Z42A 4C6NA 5I3IA 4NI3A 4G9PA 3QQ0A 3SURA 5D32A 3UWZA 8XIAA 2UY5A 2V38A 4AZCA 4C1NA 3VFCA 4IPNB 1LOSA 3WDPP 3TUUA 4QG8A 3CM4A 4N02A 2Y70A 1G0CA 3BG9A 4KKXA 1NIUA 1OCBA 2QW5A 1KBJA 1JCLA 2ZBTA 4Q4KA 4QRNA 2FGLA 1OBAA 3UNDA 2QV5A 3TDFA 3WENA 2PBGA 2WJZA 5G4HC 1OYBA 1AW1A 1CX9A 1GOMA 2E6FA 2QJJA 2WSQA 2ZTKA 3OLGA 4A3RA 1MFVA 1V8EA 1H62A 4DZHA 5F7UA 4NZ5A 1I0DA 4RNJA 1R87A 2OWWA 3QTPA 1Q6CA 1DTNA 3TTEA 4XAYA 2YXOA 1IEXA 4H83A 3E96A 3WLRA 3MUXA 4FI4A 3ONCA 1B3ZA 2G5WA 4PTXA 4PMJA 3VXGA 5AVNA 4QE5A 2R1LA 3CWHA 3WEMA 4AIUA 3CO8A 3TP4A 3P3BA 2GQ8A 1I1WA 1XF0A 2WVVB 2ZZ7A 4DJEA 1MSSA 3H2NA 3GHTA 3VX0A 1AW2A 1UZDA 2ZRWA 3SIMA 4CU8A 3WDRA 1UASA 2RGMA 4H2CA 4POCA 1LRTA 4LCQA 1UP0A 1BKSA 1H7OA 3ZMRA 1VYPX 3ARYA 2VFDA 1I4NA 4YHEA 1WKDA 2CLFA 2PTYA 1RVGA 4A3QA 3MPGA 1YRRA 4IUOA 4C7GA 4Z1DA 1PO9A 5T9BG 1H2JA 2FTPA 3J7HA 3W84A 5CZSA 1UR2A 3TTOA 1ELSA 4P8VA 4QCEA 2ZZ4A 4IJBA 4A2SA 3KS6A 1UD3A 3ES7A 3WD4A 1SMAA 3W00A 4M7SA 1PIIA 5F4SA 2EF9A 2J8GA 5E0FA 3LTYA 3SCTA 3TAKA 1SO3A 4WD0A 3MCMA 1TIWA 1V5XA 1EOKA 3UJSA 3SZ8A 4MWAA 1ZJBA 5GNZA 3PTKA 4GJIA 7REQB 1BG9A 2EGZA 4FIQA 3FEMA 1FWFC 1KV5A 1TV4A 4GX8A 1E0VA 3SQSA 2PTWA 1AH4A 4UOQA 1PL9A 1FWJC 3THDA 3C2OA 4HPJA 1XSIA 4GK8A 2YLAA 1WOAA 5LIUX 2W62A 4W86A 1M41A 1UWUA 3U8GA 4H1ZA 2J88A 3GBEA 4H19A 4LWWA 5L9FA 1LL7A 3EAUA 4EE9A 5EBAA 2VYOA 4P8XA 3WNPA 1WV2A 2ZFAA 3VOGA 1PBGA 3B0YA 3NTYA 3RFAA 3W7JA 1QNOA 3L5MA 3H7UA 3BUVA 4HOXA 2Z1XA 4IGNA 3VINA 3SN0A 4G5DA 4V2XA 3M0XA 4F2TA 2WW5A 1JQVA 1P0EA 1JZ4A 1RZMA 2XZ7A 2NX3A 3LHZA 4BF5A 6CGTA 4EACA 4AD4A 5H91A 3BAIA 4CQBA 4YVVA 1A49A 1QOPA 3PN8A 4FEZA 2X0HA 4BQ2A 4HJFA 1ZP4A 3UBPC 4MSSA 3W7DA 1T5AA 2XN2A 2R1KA 4C6QA 1WP6A 2CXEA 3UCDA 3VCCA 1GT8A 1S2UA 4AC1X 1VIWA 1XDLA 1W17A 3QY6A 1LBFA 3PZOA 2QUVA 5KZMA 3SGUA 1ZBKA 3CZ8A 3VD3A 4AUBA 2RDTA 4YWSA 1MQRA 3BGJA 3SEPA 5CGMA 2I9EA 3HQOA 1BVZA 3S42A 2PS2A 1EZ2A 3KOYA 4BHYA 2QGYA 1Q4WA 2BG5A 1ECQA 1H63A 4NAEB 3LMZA 4KH2A 5I7GA 1U5HA 3RK8A 3GU2A 4MFDA 3UG3A 3LXAA 3U9IA 3HG3A 2VR4A 2VX6A 5K9XA 4GUGA 6TIMA 2DQWA 1E0UA 1FWDC 1PTGA 4FX6M 2INEA 4NAFA 1H7XA 2D2HA 3A24A 4J4KA 4Q22A 3NUKA 4GY7A 4B5UA 5IDIA 2VUNA 3OP2A 3WQ8A 4WR3A 4PTMA 3O63A 2GL5A 2HVNA 2FZBA 3HFTA 2YL6A 3Q58A 4GNKB 1XCWA 3DEQA 3F4CA 4K37A 3EBVA 4IGHA 3SIZA 4QDPA 3HQPA 1JDAA 1TJ0A 5T91A 4GQBA 3WQCA 4F0SA 5DLCA 3IRDA 1TG7A 4E8DA 2ISFA 3IUHA 4AD3A 1L8PA 4E2BA 1VFMA 1GQKA 4LYPA 1VAHA 1RQBA 1HG3A 1JF5A 4PODA 1EUNA 5FI8A 3WLPA 1BXBA 1T96A 3SQMA 3APTA 1LL6A 1YNYA 5TQLA 4H9UA 1JYNA 4LYQA 3C86A 3AXKA 3MJMA 1RBLA 3ICJA 3TROA 4IPPA 3UXKA 3VU2A 4AH7A 2FZMA 1NDVA 1EF3A 4ZFMA 1YTKA 2W6RA 3PUDA 3EMCA 1K1DA 4R5EA 2PBOA 2AKZA 5HPOA 2WZHA 2SFPA 4MZYA 4C91A 3JUGA 4HN8A 2VL4A 4M7TA 1GONA 3IIXA 1Q6QA 2VFEA 2PGWA 4KW2A 1FWSA 1W8SA 2HNHA 1RLCL 4J3SA 2P10A 4HK6A 3RILA 2W0UA 3PAJA 1B3YA 1MZHA 5DN1A 4XZLX 3TQVA 1NWRA 3L4XA 2AMXA 3CUHA 2QJIA 4D2JA 3OYZA 1R85A 4Y2WA 1VENA 2WNWA 5EMUA 3BGAA 5A6BD 4WDXA 3P8IA 2IUZA 5A2BA 4JGDA 1GVYA 1RAKA 3M0ZA 4I8YA 3RUBL 4UTMA 2W61A 4DWSC 3SCVA 2G3NA 3RLHA 3VDGA 1PTAA 3VMNA 3XIMA 5FJOA 3TOPA 1XIBA 1XIHA 3EXSA 2OWXA 1TVNA 4WKHA 5KINA 2WMIA 4QFUA 4MDPA 5KSWA 1VEOA 3ZIZA 5CPQA 3ZVHB 8TIMA 3UP8A 1JG9A 4I9JA 1ONXA 2XVGA 2WMJA 4KWSA 1F76A 3W24A 1FHLA 1PPIA 4NL1A 4XWUA 2PDFA 5LNRA 1YNQA 5FOOA 3L21A 4B15A 4C6OA 4C1KA 4W84A 5CZJA 5EFDA 3RX2A 3EPOA 2WC3A 2BHYA 3CQJA 3AS3A 4O12A 2QS8A 1V02E 4MB1A 2GSEA 2I7GA 2B7OA 3PVFA 4NXSA 3SJ3A 4LTSA 4XSLA 3OVRA 4MJZA 3LGEA 1QWKA 2VZOA 3R4IA 4NJKA 1X98A 3ZSSA 3S5YA 2Z2BA 1HX0A 4NILA 2VURA 3S1XA 4KWVA 1JNDA 1JCNA 2D3NA 3CYJA 3GDMA 1EB3A 1EP2A 1HP5A 4XZWA 3QKZA 4K7VA 1EGMA 1W1TA 5FA5A 2A1YA 4ONVA 4AWEA 3VD5A 1XIJA 1C29A 7TAAA 1SFSA 3BLLA 1GEHA 1M1BA 1OFDA 5EMJA 3EOSA 4JTUA 1P48A 1B9ZA 3U57A 2OSXA 4TQTA 3SCQA 4ORIA 4XO6A 1K70A 3T07A 4NZCA 3W28A 2H3BA 1OZQA 1E72M 2WHMA 2PRLA 5L6UA 3DCPA 5D2XA 2UBPC 4KRUA 3LBCA 1MW0A 3JW7A 1XBYA 4S3DA 3WCZA 2G8ZA 2Z1KA 3FSTA 3V36A 3B4YA 1PSCA 1W3IA 1GKPA 1IYXA 3PY2A 3EDDA 4IMCA 4RNHA 3LCLA 2O56A 4ZL1A 2E9LA 3WQDA 3B9NA 1UR3M 1XYMA 3NEHA 4H7ZA 4J3TA 3DN5A 3R0DA 2PLCA 1R3QA 1FFQA 5GQBA 2P50A 2A3LA 4DO7A 2WLYA 4UFJA 5I79A 2C0AA 4JOMA 1ISYA 3E1F1 5A2AA 3UGRA 7PTDA 2Z27A 4ZQNA 4M29A 1HW6A 3H22A 5HUPA 1AVAA 2D3LA 4GZ7A 1ZLPA 3FFSA 2EQDA 4E2OA 4KCVA 1UBSA 5JMUA 3GXPA 3DYOA 2WK2A 1QBBA 1LQAA 4O0QA 4S23A 3SCNA 2CERA 1IWPA 3FCPA 4LVGA 3ZSTA 4GQRA 3QFWA 4IP4A 1AD1A 4PA8A 4XQ6A 4IIBA 1WKFA 2EEXA 3RU6A 4B5TA 2PLKA 3CXOA 5I5RA 3HU7A 4MYXA 2X1TA 2GVYA 5I0DA 1R2SA 5I2UA 3OLEA 4HHLA 3PPCA 3SJNA 1RY8A 3RN6A 3VM7A 2REQB 5HXMA 4O57A 9XIAA 4MB3A 1LWHA 1ZHAA 1FA2A 2CBUA 1Q63A 4NJGA 5CZTA 1YPXA 2V30A 3VMPA 1OCQA 1V77A 3SDOA 4ERIA 1U83A 1AQ0A 2V82A 3F5JA 2V0TA 4MPKA 1M7XA 1WXJA 2PDPA 3NQVA 4Z2HA 3T0DA 2Z4GA 3A47A 5AHEA 1J4EA 1CB7B 2E6AA 4RNIA 5FF0A 2TYSA 3WLIA 5BZAA 3VO0A 1KXQA 2EPMX 2Z25A 4B3ZA 4ZZ9A 4OV9A 4ZOBA 2VOMA 1EPXA 2QCEA 4Z42C 1T8QA 5AC4A 2OGJA 1WE5A 3QZAA 1RLDA 1XDJA 3A3HA 4N42A 2YYUA 3LCFA 1BF6A 1ESWA 3GUWA 3IGSA 4LS0A 2WKJA 3GHRA 4M0XA 4MY8A 3BC9A 1JYWA 1N55A 3B8WA 3A3WA 3MHFA 3T44A 2JBMA 4M19A 3GE7A 2D0GA 3TC6A 4BI6A 3GAYA 3P74A 2DH3A 3PSWA 3GG1A 2PDNA 5CKSA 2YPIA 2BP1A 3TN5A 1TWZA 2XIQA 3S5NA 3K4DA 3P62A 4H01A 1B3XA 2ZADA 4LUSA 2XVLA 3M7WA 2GJRA 5ENLA 1S1PA 4NU7A 3BW4A 1W91A 1EIXA 1XLJA 3IJ9A 2OR2A 2EG6A 1OYCA 1E9YB 1R3WA 1GOWA 1YTDA 4DF2A 4FLOA 4FB7A 1NF0A 4S39A 4HOWA 2X16A 3V0UA 4GUIA 1LWIA 3CLWA 2HPMA 3L4YA 4O10A 1B90A 1DHPA 1V3MA 3CHFA 4UUIA 5M1TA 3T0TA 1T7LA 4PL1A 4GVGA 1EDTA 1KRCC 9CGTA 1QASA 3LCIA 3ALFA 3M43A 4LBUA 4B9YA 3L4UA 1P1XA 3DFPA 3QV7A 3O6AA 2ICSA 3AHXA 2TODA 3NDOA 5CG7A 3KHDA 1JZ5A 4K39A 2CLMA 4A21A 3KZSA 1J11A 1MDRA 3K4WA 2Y7EA 1BAGA 3T6CA 2UY3A 3EPNA 1Q6DA 1X6UA 4CD4A 4AZBA 4D72A 4N6EA 4UWMA 2P76A 3SCUA 1B3OA 3SN1A 5C9RA 2HK0A 2DVXA 2BXZA 1QNVA 3NO1A 3W1LA 4D1IA 2ZA1A 3ZJKA 2I17A 4WJXA 4QE1A 3GAKA 1UG6A 4LJ3A 5DFAA 3TLQA 1UR9A 3IVTA 4IMEA 3KUMA 3KL5A 4TTGA 2DIKA 3PK7A 1VF8A 4MWAE 3H2EA 2BBFA 4EPDC 4AVOA 4J9JA 4NX0A 1UWRA 2HEJA 2TAAA 3NL2A 1L0PA 3STPA 2DZSA 2ESCA 4QISA 2D1ZA 3I68A 3RLUA 3VUSA 1XPGA 1IE7C 4PMDA 1H09A 4K1GA 2PFHA 4ML9A 1M04A 4IQDA 4ZGYA 2O9OA 1W9VA 1XI3A 3PB2A 2VM8A 3ZT6A 4FK9A 3RXZA 5C71A 2WNQA 1JZ3A 5A8MA 1W9XA 2GJXB 4JYDA 1FX6A 2OKOA 4I9MA 5KEZA 1YNPA 5D9PA 3NM3A 3QLLA 3B9EA 7TIMA 5J04A 3C2EA 3TEVA 1TR1A 4WDTA 4OT7A 4GVIA 5HANA 3G6MA 1BGGA 3DBNA 4W4QA 4JIRA 1UPMB 1IHIA 3BAJA 2Z28A 4AC7C 1PEZA 1KM0A 3OB8A 3DFQA 5BXRA 4ZB0A 3UR2A 1EJSC 4BS0A 3OQ8A 1S1RA 1BSLA 4GFIA 4ICCX 4PMUA 3ARPA 3G22A 2ZUTA 4X9YA 1V6YA 1X8CA 1IEWA 4UR8A 3NQFA 2Q8XA 3WUBA 3N2MA 2Z26A 4LAKA 4UQAA 3SCRA 4A8IA 1YE4A 2QIIA 4S3BA 3LI1A 1AG1O 3BAYA 4C5YA 1XG3A 4BK9A 2BODX 3QKEA 4S3EA 3EA1A 2YB1A 5E1QA 1QI2A 5K2ZA 4GH1A 4LAMA 2YJQA 3RRAA 3K13A 3GYCA 4I9TA 1UOKA 4ZO9A 1K4GA 2OLSA 2F6UA 1A5AA 1VKFA 3FGCB 2XH7A 3V5OA 3XISA 2ZIDA 5I3FA 4A35A 1JYXA 4KCUA 1GVQA 2F8QA 2ZE0A 3T1GA 1QK2A 3E74A 3I6RA 1XSKA 1GYLA 1UPPA 3VDHA 5CSRA 3T55A 1LROA 1TTJA 3I6TA 1ZJAA 3WLQA 4B91A 4QTGA 1TVPA 3APGA 3EPMA 3UG8A 1JZ2A 3LXBA 4M5PA 3H70A 2E40A 2DZVA 1UROA 1GZGA 2PA6A 1F3XA 3ARVA 4Q7IA 1RSCA 1IWAA 1KFLA 4NSBA 2B0MA 1BG4A 3ZJ7A 4MYAA 5FJTA 3GTIA 1Q5MA 1MDLA 4I7UA 4HA4A 1JFHA 1SUXA 5F2GA 5E09A 1O5QA 3PJTA 1YBQA 4NP7A 9RUBA 1S5VA 1XCXA 4O0ZA 4GYKA 1ZGDA 2QCDA 1GCYA 3OVQA 5EPDA 3URAA 4MZ1A 2QDDA 4DWDA 4DYKA 3S1GA 1XKYA 1I1XA 1G4SA 2NT1A 3N9KA 3KDNA 1I2NA 3AICA 3E5BA 4WGHA 5IFTA 3PJUA 1LRNA 1NP0A 1OK6A 1I2PA 2A7RA 3CS2A 1T40A 1XM3A 4X2PA 1PWMA 4IIFA 5HMFA 3B4UA 1CGWA 4NG3A 3QYQA 1TQJA 4M3PA 4D8ZA 3GFZA 5DMMA 1JZ8A 3V1HA 1J01A 3KS5A 1X1NA 3P60A 1H3GA 4IL2A 1LOQA 1QWGA 3IAQA 2RFGA 4XZ9A 1NM9A 4L65A 4H7CA 5E93A 1J0YA 2FGZA 3CUIA 3R25A 4Y6GA 1VPQA 3LHYA 5FSEC 1I6NA 1RP8A 4AVFA 2WZEA 2YSWA 6XIMA 2A3EA 4ZR8A 4HK5A 1LUCA 2R9RA 1O66A 1M6JA 1LM1A 1ZAHA 5AYZA 3JZEA 2BTMA 1Q4NX 1Q13A 3L4VA 2XH0A 4IQLA 3UZZA 1HF6A 4D9PA 3QGVA 4PSRA 3GXNA 1IEQA 3PZIA 3UU0A 1WXZA 2D23A 1XLBA 3H53A 5H1WA 1GEQA 1QPKA 2AL2A 3BCDA 4F2BA 1EUAA 2OEMA 1CGVA 1DJHA 4DWSA 3TKFA 3QV8A 2J9XA 4N9CA 2V2CA 2TMDA 1Q8JA 4AIEA 4WIWA 2NUWA 2GFTA 3G1YA 4HMEA 3EXTA 4X3ZA 5BWAA 3MKCA 4LC8A 1S5MA 2R6OA 2X42A 3STGA 2JE8A 3EDEA 3VIGA 3KW3A 2ZX9A 1BWKA 4R7WA 1M7OA 1WKYA 2CBVA 1XLAA 4HNLA 3PC0A 2I1OA 3G2GA 1BLIA 4GQGA 4CD7A 1JPIA 3W7QA 1M3UA 4QSFA 3IRSA 4TVCA 2RDXA 5D38A 1V51A 5A5WA 1EC9A 2C71A 4ZQCA 1XW8A 1H4PA 4F2UA 1QO5A 3NVTA 4U2YA 3TK7A 3EDFA 3BW3A 2DFAA 4IFKB 1PX8A 4XO7A 1BYBA 2DPEA 3CUFA 4PYSA 3BQ6A 3G0XA 1B4KA 3D5HA 3VUPA 4D6EA 2C91A 2OB3A 4EANA 4D6HA 3W85A 1XS2A 1XC4A 2VENA 1Q6EA 4HA0A 3NL3A 4O18A 1IT7A 2F38A 2EKGA 2UWFA 3O07A 1HKVA 1CGTA 2C14A 3M6DA 3NNTA 2E5CA 2HZGA 1ZUAX 2VJXA 4PMVA 1OFRA 3AIBA 3BMVA 3L4WA 3T05A 5C9XA 2GSJA 1VRDA 3KLKA 5MHBA 2OO0A 3U2OA 1VH7A 3BJTA 1Q3NA 4HPGA 5CPLA 1UA3A 2VCAA 1A5SA 1NP2A 1DWIM 4FP1A 3MC5A 5SWUA 2FZ8A 3BLDA 1E43A 3HA1A 3WD0A 3CC1A 3M47A 4PTDA 3AALA 4R34A 1JCJA 4FALA 4I9AA 3I3EA 2FPYA 1M7JA 1JI2A 1Q8AA 3MT1A 2X7WA 5JIWA 2I5QA 1HL8A 4IISA 3NL6A 4RXGA 2CBIA 3G0UA 3SFKA 3LNPA 4XZBA 2CXGA 1P5BA 1S2AA 1QOQA 3MUY1 4GXMA 4RW5A 4XBSA 5ABFB 5GVJA 4QLKA 2VFIA 3MO7A 3TMQA 1AW5A 4GZIA 3B05A 4HNUA 3W4RA 3AZTA 3P81A 1UWAA 3MVTA 1XIDA 2WNZA 5EMMA 4JXCA 3FJLA 2ZUMA 4UIOA 4MJ2A 3PBVA 1B54A 3A4XA 4H9TA 4MVAA 3LHTA 3QSRA 4YPJA 3O05A 1TMHA 3IWPA 1OX4A 2JEPA 1J0JA 3LQLA 3GDRA 4O17A 3TYDA 2F6KA 3MUIA 4WXZA 1JD9A 3W1UA 1BFNA 5D05A 1YADA 2IQ0A 4TO8A 4W5ZA 5B80A 3TNOA 1FBAA 2C16A 2JKPA 2YCKX 3GIQA 3MANA 2ZOXA 5M17A 1TZ7A 4GACA 2XM2A 4B9ZA 3WBAA 3VDBA 3EX4A 3CHVA 1XRTA 3QV6A 2VNCA 1SFTA 3Q37A 3N3MA 4TIMA 2WC4A 1H0IA 2G0WA 3UCQA 4UC5A 4MB4A 3VOJA 3W82A 3IGUA 1UD4A 3M0MA 4DYEA 1CPUA 4HT3A 3O8AA 4QJ4B 3AS0A 2OCZA 3DOPA 3BGGA 4D1JA 4M8UA 3UZWA 3GH5A 2X7VA 1VFOA 4IGMA 2FMNA 2PC8A 1JUEA 4CNSA 4ZXOA 1SZFA 3KRBA 2FKPA 3I6EA 4LH8A 4K6AA 4MADA 1UD8A 3WH5A 1GVSA 1V3IA 2Z24A 4US6A 5FD0A 1XLDA 2NLYA 2YCLA 4GZEA 3VNKA 5HMDA 3IPWA 3FY1A 1F6PA 5HMEA 4GNJA 2ISDA 2GK1A 5CPOA 3ZLHA 4OTKA 1TPUA 2ADAA 1SW0A 3OQEA 4JTRA 4HNOA 1XIMA 1PKNA 1SZEA 3CH9A 2DZWA 1JUKA 4NZ3A 1Z32X 3TIMA 1FWHC 3HPAA 4LB4A 3Q2DA 3EOLA 4NRSA 3S3GA 1VYSX 1KV8A 4JHZA 3MCNA 1KLYA 1SW3A 5KZ6A 5JH1A 1AA1B 5FEWA 2R8WA 1W6TA 3BMWA 3E02A 1QW8A 1DQUA 4PUKA 2XN1A 2Y2WA 4AEOA 1ZS2A 2R82A 1TJ1A 4NQ1A 1L6WA 1K9FA 2RJGA 3FVMA 1E0XA 3AWOA 4M24A 1KRMA 5HQLA 1HKMA 3TJXA 2KAUC 4QXIA 2ZCGA 5M5DA 3BCFA 3CUJA 1OT2A 3FXYA 1GOXA 3NQ7A 4EWJA 3W70A 4E2VA 4KRZA 3KOZA 3HQ1A 1OABA 1CBGA 3LLDA 1YDVA 3VKBA 2DEPA 1OIMA 5HJYA 3STFA 2J8TA 2VUYA 5BXPA 3M0HA 1XPYA 3KDOA 4JFVA 2A7NA 4Q4MA 1E6RA 1W5MA 4DZIA 1JDCA 3KAOA 1AJ0A 1VJZA 3AXHA 1NVMA 4B4HA 5ABGA 2OGYA 1X38A 3VI2A 2E7FA 3UA4A 4IIDA 1V0KA 2VC7A 1ITXA 4MY9A 3CMJA 1Q7ZA 5FL0A 3EWWA 3E38A 4NHVA 3C0QA 4URIA 2YCIX 4CN6A 1QPNA 1E5NA 1W5NA 4AD5A 1NDYA 1IF2A 4Z1AA 3GFXA 3GIYA 1FH8A 1P43A 1MEHA 5ECUA 3TYUA 4E38A 4AISA 3LCGA 1B57A 2QDGA 5D03A 2E5DA 2WAGA 3BSGA 3GM8A 1TZZA 3GR7A 3ZS4A 4HSNA 1K8CA 3AYTA 2FVKA 4GI6A 4QCFA 4NNBA 1FVPA 3PBUA 3C2FA 3TA6A 1GOIA 4LF1A 3DBPA 5AHMA 3B0UX 4L80A 1TFVA 1L6SA 2WVVA 3W72A 1MQQA 4H9MA 1HGWA 1P0KA 3G6LA 1O5XA 2C1IA 2Z1WA 2VQTA 4MMWA 3HG4A 2BV9A 5IXEA 3T2PA 4FNUA 1C9DA 3NZPA 5IFPA 2IXVA 2EKCA 1IGSA 3R8GA 1HL9A 1QU4A 1TV2A 1FWEC 3CHEA 2VX7A 4PUDA 2Q71A 4WDUA 2PEVA 3LQGA 5FF3A 5J5DA 2VGGA 1JYVA 1OINA 1XP3A 1B5TA 1K9DA 1ZAJA 1TVLA 5DMNA 3BV4A 2E25A 1DJXA 3F4NA 4C6CA 3H24A 5H6HA 4NF7A 3OO2A 1B3VA 3VGBA 3T2OA 1TCDA 3DKLA 4GO9A 1YE6A 1AUSL 5FKYA 3GDLA 3S6TA 1L6YA 1RCQA 4KQNA 2WBKA 2YYTA 2FGBA 3ECQA 5CPNA 3EKZA 1DWHM 1GUVA 3ME3A 4I6KA 3WMCA 1W54A 5J5RA 2YZ5A 1ADDA 2XSXA 3OBEA 2X40A 3N73A 5C7HA 1ML1A 1OFEA 4ROQA 4JFWA 1OC7A 1VD6A 2ZXDA 3MQTA 4WRHA 1QATA 1D7FA 1PJ9A 1YDNA 3CASA 3DI1A 2QCLA 1EKOA 1MXDA 2P8CA 3DGRA 1PE1A 3VNLA 3S5ZA 4WSKA 1KR1A 2EXOA 1TCMA 3RLGA 3GDTA 1JDFA 1OWQA 3C61A 2ZVIA 2PZNA 1ZJHA 3IIZA 2PDWA 4H8UA 4PB5A 2WYSA 4Y8FA 1PKMA 5DRCA 2ATSA 5E9XA 2VMFA 2X30A 4D6CA 1E56A 4R33A 4XBKA 4MJ4A 2ZA3A 1UR4A 4GI8A 4U10A 2CZVA 1NARA 2DVUA 2DIEA 2DSKA 3H2CA 3U5YA 3ARSA 4FA3A 3S2JA 5CSSA 1IXNA 1K03A 4I5RA 2XWDA 1V3JA 2GVLA 4F9DA 1HJVA 3W29A 3LOTA 3KZPA 4ROPA 3CMGA 1W1B1 3I4EA 4RE0A 3NEVA 2YL5A 3DDMA 3P82A 3BICA 3EWXA 1NU5A 5I3KA 3DX5A 5DMLA 2D2GA 1RBAA 5GNXA 3WF0A 2NXGA 3LTPA 2PU0A 4FNTA 1YEYA 4L4MA 4Z1BA 4DO4A 3FK4A 1FXQA 1NAL1 4AHQA 1E4NA 3SQLA 3G1HA 3W71A 5JUVA 1J0IA 4XAPA 5IM51 3UJ2A 2W79A 4XD4A 4X61A 2X1IA 4A05A 3AO0A 1L8NA 2VD9A 3GH7A 1KWGA 5BU9A 1UC5A 4JBRA 1A5KC 2CWNA 3NOEA 1MNZA 1W32A 3MUCA 4PH6A 4U3AA 4IHCA 5I6SA 1U30A 3CLMA 3NZGA 4REQB 5DY3A 3BQ5A 2QV4A 2EPOA 3EX6A 1JCTA 2X1UA 1UD2A 4UZUA 4QROA 4NAEA 2CLKA 3SUWA 3QM3A 5CPMA 4L1GA 4CN4A 2QZRA 1IZCA 3W01A 3FKKA 4CLMA 3CZKA 2Y8VA 4JDBA 4I90A 5A6BA 3SN4A 3VKDA 5DMYA 1QK0A 1CXLA 5RUBA 4JN6A 4N9DA 3WZ0E 5REQB 5FF7A 1H7PA 3H12A 4PEKA 1AZ2A 3BE7A 1TMLA 2PAJA 4JX6A 3G18A 4N4PA 2V9DA 4LUJA 1GKRA 5TAOA 3VC5A 4GO8A 3HPSA 4TVDA 4WF7A 5C5YA 3NGJA 4LUTA 5LHFA 1N8IA 1J0HA 4IQEA 1QW7A 3KL3A 1Q6LA 1OVDA 4K36A 3P6LA 1FWNA 4QBXA 4IUGA 2AAAA 2FTYA 2YB4A 3GTHA 5BXSA 1R3RA 5CJNA 1YQ2A 4PB3A 1UUQA 3QC0A 4ZFCA 4TMCA 2Z0IA 4PBGA 3WLTA 1TSIA 4NYUA 2RUSA 3NL5A 5C2CA 3HV8A 5EL1A 1XLKA 3G1VA 1U1HA 1SYTA 3REQB 2YOCA 1GPWA 1RH9A 3NOYA 1GTEA 3Q65A 4AWTA 4DO5A 1LCOA 3E49A 4DNMA 3R89A 4QM1A 4HZ6A 1PHWA 3GVRA 4WHBA 2UY4A 3E0WA 3I10A 1QNSA 1QHZA 3I65A 4M82A 4E5TA 5DO8A 2CZFA 4F8XA 3AU6A 2PDHA 4AY7A 3PUOA 4K8EA 4ZO6A 3NO3A 4P8WA 2QVNA 2VDGA 4E0CA 5C9WA 1KGXA 1LLOA 1NTHA 1YX1A 4JQAA 2V63A 4UXDA 3GTFA 3TSMA 4U5KA 1S5NA 4I6VA 2LLEA 1IT8A 4DBUA 2NV2A 3P0WA 1QAPA 3OBAA 2GVEA 3KVJA 1W8GA 3JU2A 3UZXA 3DG7A 1CDGA 2FHBA 4QS6A 1A5MC 2Y4SA 5AYIA 3VD7A 2EO7A 1ICQA 1VFLA 4O53A 1MUMA 1B30A 3BLIA 3I7QA 3EOEA 3G8RA 1US3A 1UHVA 2V2DA 1OF8A 4RZ6A 2QEZA 3C2VA 2I56A 3WL0A 1F3TA 1KO0A 4O15A 4D6JA 1E51A 5HQMA 3O1NA 3G24A 4JTIA 3URBA 3PFRA 1UYQA 1W3LA 1BYDA 5AYYA 3AU2A 4DM1A 4KWUA 3A3XA 4DX3A 1A5CA 3N2TA 3HTWA 1A3XA 3VZZA 2XIIA 2ZE3A 2XFRA 1XQLA 3LMYA 4GY0A 5GJPA 2C1GA 4JEJA 4C90A 3PBMA 4H6EA 2EPHA 2INFA 2E09A 2WHKA 4OBRA 1WO2A 4A4AA 4L1WA 3AJ7A 3ATZA 2BY2A 1CXFA 3B8SA 2XUCA 1A5BA 4LB3A 1RVKA 4O4VA 1KRBC 2EPNA 1X1ZA 1W5PA 4XB3A 2YR1A 5AN7A 1FDZA 4QDWA 4Y9OA 1D8CA 1L6GA 3W2UA 3OGSA 2WSRA 2VWTA 3P61A 1A0CA 1O12A 4J3VA 5AZ0A 3WQ5A 4KERA 1UH4A 3WUFA 1BRLB 4UFLA 3NYDA 3H2AA 5CBIA 4OOZA 1PAMA 4WSHA 4W8LA 4YTUA 4UFMA 1WDSA 4L56A 4UNLA 4E8GA 1FCUA 5G5IA 2VZUA 5F4XA 4MB5A 5HUOA 4RDYA 1VCFA 3WQPA 4ZODA 2AMGA 5HOSA 3QR3A 3OVGA 4WLCA 2OELA 2O7QA 3R13A 5JXQA 3M07A 4XSMA 3MY9A 3CBWA 3PB0A 4A8LA 3FJ6A 1HXJA 3V5FA 1CIUA 2ACQA 2WCGA 1P4CA 2DGAA 5A3HA 3M4HA 4PMYA 3IIVA 3F1QA 2DW7A 4PMNA 3IVSA 4D8LA 5C8BB 4H41A 1XLGA 2F2KA 2WQPA 3SGGA 4ATLA 4LRSA 1P6WA 2B81A 3SRHA 4HA1A 3JZUA 5D4YA 1RJQA 4UTUA 4QEHA 3KBSA 3LERA 5LXXA 3LI0A 3ZT7A 3BLKA 4Q8QA 3TC7A 4PZVA 2GGHA 3QHMA 3PNUA 3GO2A 3WNMA 1DJQA 1HKKA 2OTDA 1ECEA 1Q2SA 1EX5A 3ARTA 1ME9A 4LS1A 1H1NA 4BQ4A 5FL1A 2VWSA 1UQZA 1C90A 1DOSA 5D33A 1DJGA 2Y5EA 3LLXA 2POTA 1XRVA 2J7EA 1ZL1A 2YFNA 3WMBA 1GQLA 3THAA 4LYKA 1ICSA 3HURA 4BWLA 2V5BA 5IHRA 4BI5A 4C6KA 4GPNA 1SJCA 4HBKA 3VE9A 1IGWA 1TPEA 2Y1HA 5D9OA 3FDGA 3VGGA 4TTUA 4C7DA 3RPMA 4JNMA 4HZMA 2BSLA 1XUUA 4AZCB 3W83A 1B9BA 3A13A 5DRIA 1YKWA 3MVIA 1TWWA 3VD9A 1HQTA 2YFOA 4MKSA 2O0TA 2FZDA 3L7RA 5A94A 1HUVA 1XICA 3GBDA 3S0CA 2X2GA 2Z29A 2PP3A 1QJWA 1VYRA 3HO8A 5KMYA 1VCVA 4WDWA 2QPUA 4JCLA 1TR9A 2BX7A 2WM0A 4IIHA 4NZ4A 2B31A 4ERAA 1E6ZA 1ONRA 2A4AA 5FAJA 3C5QA 1VEPA 2O4MA 4JQ4A 3UXIA 1GTHA 3K8LA 3N3TA 1UKOA 2F7FA 2VC6A 2GGGA 3YPIA 1G1YA 1T99A 5EMKA 2OZ3A 2A3BA 4B5XA 4FAMA 1DORA 1V93A 2I16A 3UQNA 2OT0A 3VGDA 4MF4A 2UY2A 4O1AA 4GY1A 4ZB5A 2ZTJA 3PR2A 3MYOA 3WJZA 1QO2A 4GUHA 2G3FA 3B0PA 2FTWA 3GQYA 4GUFA 5IBXA 3CEUA 1EGZA 4FHAA 2XFFA 2ISSA 5A69A 3GXDA 3TJ4A 2Y5JA 3LBOA 5HWNA 1VS1A 1PUDA 3WBEA 3MSDA 1CB2A 3WLJA 1IQ8A 1A80A 3KWXA 3O7UA 3C0JA 3VGHA 2ON3A 1XYLA 1P0DA 4J2MA 3HG5A 4D6FA 6XIAA 4IXHA 2BVWA 1EIBA 4IFRA 2RH9A 4UMAA 2Q02A 3FYOA 1TV8A 3EGJA 3BAXA 1DVJA 5AYXA 2FMOA 4ML4A 4IMFA 4F79A 3NDYA 1JZ7A 4F66A 2OWCA 4Y90A 4GOAA 3AYVA 2EPLX 2I14A 3UJFA 4BQ5A 3W87A 3B03A 1N8WA 4ZXLA 3BANA 3S1WA 4CQ8A 2DQXA 4JTCA 1TX2A 5EA9A 1SO6A 3CZEA 2J25A 3B3DA 1J10A 3G1RA 5HNNA 2PWEA 4GE8A 4C6PA 5DT5A 3S1VA 3P80A 2Z1SA 2A2IA 2Y0FA 4O1FA 1NWUA 4QQUA 2ISVA 3ATYA 4QJ3B 5FESA 2BGQA 2Z2AA 4BY3A 3EKGA 1UUOA 3QY8A 3PZQA 5LA2A 2OOGA 5EGRA 1RQEA 3AIRA 1OIFA 4JTEA 2CW6A 4S1FA 3CQIA 3N4AA 4DJED 2DUXA 3WO8A 3H26A 4QLJA 4CNOA 1PDYA 3D0CA 4HNNA 4ADSA 3W7RA 5B7ZA 3NXLA 5TNVA 3AXXA 4IOTA 5F1VA 4AAJA 3M64A 4IJCA 4RV3A 4FS9A 1IXOA 1U5VA 1A47A 1UWIA 5A6SA 4FX7A 3FS2A 1J18A 2OMAA 1SJAA 2HE8A 5JVLA 4J35A 4LPCA 5AB3A 3GC5A 5A6LA 1V02A 3HZ3A 3NXFA 3GX9A 3MZNA 3BOXA 3GXTA 3K2GA 1XLMA 3G8EA 4WK9A 1H51A 2Y7DA 3A4AA 4O0KA 2ACRA 4AX6A 4YXGA 3R5EA 2O7SA 2JEQA 2DORA 5BMXA 1DBTA 4Z17A 1T0OA 1TWDA 2VRQA 1XIIA 1DIKA 1J12A 4R9XA 2OU4A 3RRXA 1O68A 1TJRA 1D3GA 1AJZA 1JDDA 4RKAA 3CNYA 1CTNA 5DT7A 2CLOA 1X39A 2CHOA 4F40A 1XLFA 2YDRA 1W2VA 1XRFA 1SU5A 3ZR5A 5EYWA 3V1PA 3R8HA 2R94A 3TWAA 4DQWA 2OLHA 1D2KA 3GIPA 2ZC1A 3IIPA 4NAFB 3M0JA 4CCDA 5FIPA 1JJKA 4IPLA 3SUUA 2BZNA 2OG9A 2CZDA 3BO9A 5DELA 3SRFA 2DVTA 3UPBA 1ZRQA 2BOFX 3O6YX 2VI0A 4L6DA 3IIOA 3G5EA 2G37A 4PCTA 3FA3A 3T7VA 3VKJA 1ADSA 1J8VA 1R6WA 5G4WA 3DYPA 3W1QA 5GNYA 1K7FA 3T8QA 2VGIA 5A8QA 4WGXA 4CCZA 1BYCA 4X22A 5BRPA 5FAGA 5AVHA 1EDQA 4A29A 1KC7A 3IAPA 4QP0A 1VFTA 2QYGA 4JFSA 1EBHA 1WXYA 1A0DA 1I8JA 1QI3A 4AD0A 2PD9A 1V3LA 2A85A 3FGCA 4W88A 2R24A 4M6UA 1I60A 5BOFA 2E8ZA 4YN5A 2CESA 1K9TA 3FVDA 4JAWA 4B16A 2Y6ZA 5DEZA 5AECA 2C3ZA 2FVLA 5D02A 4R7JA 2YXGA 3PM6A 3W25A 3LD5A 3LRKA 1MRQA 2IPWA 4HSOA 4LALA 3KOXA 3DH7A 3UZYA 2FHFA 3HF3A 4GIAA 2FHCA 5MKGB 4S2CA 2GQAA 4XZNX 4IMDA 3MCOA 4GXPA 2DSWA 4QJ5B 3UYIA 3AHVA 3EWZA 4RLIA 4DXXA 4Y9NA 2DJLA 4GI4A 4DO6A 5BRQA 4WY0F 1W9UA 3UWEA 2E3ZA 2CWXA 3W1NA 1DTUA 3TLLA 2OZ8A 2ZXAA 3W7HA 1XGEA 2V3DA 4UQCA 4FNPA 1OFOA 2WMIB 4QEEA 4E3TA 3C52A 1JQXA 1JIBA 6REQB 3OLIA 5JQ9A 1LQ0A 4B5NA 2VEKA 4Z2KA 2Y61A 4O1EA 3CYVA 3BOLA 1ZSXA 1VP5A 4DBSA 1D9EA 1ZZMA 1GKQA 1R9ZA 3W0KA 2EG7A 1R5YA 2YXXA 3CTTA 4M1BA 2PP0A 3PNZA 1Q85A 2Y63A 5JU6A 3RR1A 2FFCA 1L2QA 2V67A 1J2BA 4AW7A 3E12A 3NPXA 4GABA 3BW2A 3E2VA 1FHDA 4XD3A 2CCRA 1V0NA 2JIWA 3QW4B 3IJIA 1W3TA 2NSOA 4R27A 2PDLA 3QGAC 4FOJA 3EWUA 4AY1A 5CEWA 2AKMA 4Q8WA 2QMJA 3WQ4A 4HU4A 5CC7A 3KOWA 3LV5A 3VKCA 1D3HA 4DXKA 1CENA 1W37A 1TMQA 3RG6A 2GQ3A 3BLEA 2HSAA 5XIMA 4YTQA 2PWVA 5CBBA 1QMLA 1XYZA 1FCQA 1E6QM 3AMKA 3HM7A 3RIKA 3I3BA 1XXXA 2YL9A 1BQCA 3OTRA 4ZE5A 2ALDA 5LKYA 2VD8A 3K8KA 3GSMA 1PCWA 3SUVA 4YS1A 3IS4A 4N9EA 2VX5A 1XLCA 3ENLA 3DECA 3N19B 3PTMA 3E2RA 4KPLA 2WSYA 4GWEA 3TQPA 3M0VA 3GNNA 1Z9AA 1OC6A 1KXHA 1EHAA 2V5DA 3MV11 1E9IA 4PRTA 4Z1YA 1OFAA 5ABTA 1NOWA 3W76A 5TF0A 4W7WA 4WOZA 4UQBA 1VR6A 1QNRA 1A3HA 4HOZA 4J3XA 3TAOA 3UWUA 3AOFA 3UXAA 3UVIA 2I5IA 2Y5SA 4LVDA 5A1AA 4BCEA 4LVBA 3IV3A 3TN6A 3DGBA 1F9CA 1ITCA 3EMQA 4KS0A 1YXCA 2RGLA 3C2YA 3NR0A 2QCNA 1JFXA 2WHJA 8XIMA 4IQJA 3XINA 5CLWA 3FNDA 3OG2A 4XAFA 2NQ9A 4BEUA 4HKPA 3PJWA 1J79A 4JKLA 3H4XA 4I5UA 1UZ1A 2Z7KA 4B92A 2ACUA 4IFKA 3PJXA 2CLHA 4JS3A 3IUIA 3HN3A 1ZBCA 3H7VA 2R1NA 3WIJA 4Y9MA 3ITXA 3GHUA 3WH6A 4Q8TA 3MI3A 2J6VA 3P0XA 3QY7A 3A5VA 2HVMA 2C6QA 4HP5A 1ZY9A 4KFPA 4DPQA 1R7AA 4HCDA 4JX4A 4NUWA 3QZ6A 3BG3A 3ABXA 1RA5A 1KM3A 1PZ0A 1MW2A 1JEZA 3UYCA 2QUMA 2J79A 5H8PA 3W7KA 1JXKA 3JVAA 2C18A 3QRHA 3B8UA 1PX4A 3JR2A 4EVZA 4IP5A 4JYFA 4YL2A 1XGZA 3CUZA 3QHNA 1KR0A 1LDCA 3QC3A 3MYPA 3F2DA 1P6CA 3W2KA 4LY4A 4ZOCA 3IJ6A 4R88A 2ZXBA 2BVTA 2Q8ZA 2GYIA 3AJXA 2AQVA 1CEOA 2OZ0A 4ZO7A 3A4WA 1F6YA 2CKSA 5IOBA 5C9UA 3Q94A 3HIJA 1HVQA 3MU7A 2BVDA 3GNPA 2BVYA 3L67A 1RA0A 3GZ3A 2V6AA 4Q8PA 5EFFA 5HATA 3B8VA 2C8NA 2JQXA 4DAFA 3B40A 3W1RA 2JALA 1Z41A 4ACZA 1CXEA 4ATWA 3GDKA 4X60A 4DBEA 4GQQA 1JCXA 3VOHA 1T41A 4GJJA 2MUCA 4IMGA 1ENUA 1V4YA 3KP0A 4MM1A 3ABQA 1SR9A 2G4JA 2WCAA 1BKHA 2HQAA 5LIXX 4GC4A 4W5UA 2ZZ5A 1AZ1A 2OQYA 2ZUSA 5ABHA 3AIQA 4LUSB 4CEXC 1CYGA 4DZAA 2AQOA 1QI5A 5E0KA 3QR1A 3QW3A 1M01A 1HJSA 3N2XA 4C6DA 4KFNA 4W89A 1MI3A 1E1CA 1RPXA 1E15A 1GG0A 1WZAA 4XZMX 3ITYA 4UNKA 4QJ1A 3UWYA 3S6DA 1BD0A 1AJ2A 3M5VA 2XGZA 4DB7A 4HCHA 5EMLA 3A9IA 4M80A 4YTSA 2PGRA 4Q3MA 2BWGA 3K46A 3W7MA 4FNRA 3NPVA 2WC7A 4TOQA 5CQ1A 3THQA 3CAQA 4A3YA 4BQ3A 4FOKA 1QXLA 1B3WA 3GZAA 3PZGA 1TE1A 5FJUA 3LM7A 3A23A 4WXYA 2QT3A 3R43A 3QOMA 4FXSA 2E8YA 5A2CA 3WH8A 1GYNA 1SO5A 3MKKA 2YCJA 3L2LA 1QUMA 3CIVA 4H9VA 4PBFA 3TTQA 3WX7A 1GOQA 4XIAA 1E9LA 3T0AA 2H8XA 1WUEA 2PCQA 3DI0A 4AMCA 3UXDA 4QG9A 3L65A 3CO4A 1WBHA 3OVPA 3R0UA 1XBVA 3N18A 3LPPA 3W7IA 4KF1A 1UP2A 4DJEC 3ZXWA 3TC3A 1RCXB 1GQNA 4IFOA 2AGTA 1XJBA 1S38A 2G96A 5CGQA 1UKTA 2Y8KA 4HJWA 1FY6A 3QZEA 2B7PA 3AIWA 5CZKA 1KD0A 4IH3A 1HO4A 4U2ZA 5KTLA 3P8JA 5TBOA 1G7VA 1GVEA 4CNUA 4GNVA 2VP8A 2YA0A 2AOSA 4MNJA 4DBDA 3A5FA 3DAQA 3AHYA 3IARA 5T26A 4P61A 2ZDRA 3FN9A 3T42A 1W1A1 3CQKA 1HT6A 1JZ6A 3BAKA 3ZJ6A 1EC7A 3D46A 1FH7A 2DZAA 5D04C 5AY7A 3VA8A 2OLAA 4LAUA 3N6JA 3BPWA 4L4LA 2OKTA 3VNJA 3NQMA 4YCOA 1X1OA 4CCCA 2VC9A 5LSMA 1ZBVA 3U48A 2XHYA 3VE7A 1EYEA 1XD0A 2ONEA 4OQVA 1WBJA 1K3UA 3ZZ1A 4Z1CA 1NOUA 1FUYA 4JIPA 1OC5A 4OUIA 4DHGA 2VFHA 3GW0A 2H9AA 3BLPX 1G01A 4RZ5A 3PWAA 1EJRC 2BDQA 1WX0A 3ARQA 1XSJA 1A0EA 3ITGA 2YA2A 4QX4A 1OEPA 4XAGA 3GH4A 3LEPA 3BV7A 4PTNA 1FDYA 2XM1A 3SCPA 3HQNA 3NURA 4HSHA 2V3GA 1DIEA 4ZOAA 1EEPA 1QNQA 4XTIA 1JRBA 2GDVA 4DUWA 4HCLA 4YCPA 3WDJA 2W66A 1Q7MA 3BSHA 1ONWA 4NNAA 5I06A 3NFUA 4AEEA 3GUGA 3ABZA 4F3HA 3IGHX 1GG1A 4H8HA 1V7YA 4RL3A 2E5BA 2P0OA 2D24A 3KL0A 2CEQA 2ODOA 3N2OA 2GDUA 1RK5A 4HHMA 4LOCA 3LRMA 4GBUA 3H7RA 4Z08A 4Q4RA 2FH6A 3MMUA 1XH2A 5XIAA 1L2UA 3W86A 2WJDA 4DI8A 2C79A 4JTAA 3VIKA 3GNDA 4AFYA 1UZHA 4AX7A 3SFWA 4JIHA 2QJNA 1HGYA 4NNCA 5LIKX 3VOFA 3UFYA 1OF6A 3UNTA 4RDZA 4O54A 3LUTA 2JKEA 2V5LA 5CLTA 4P7LA 4M6VA 1R3VA 1LYXA 4AZHA 3SGZA 2Y7GA 5A8OA 3L23A 2VEGA 1ME8A 3ZVIA 4RE4A 1QPQA 4J3UA 2W5FA 3WF3A 4O4WA 1ZB5A 5CJMA 4U33A 1MXSA 4AWSA 1PYFA 4CQDA 1YBQB 5CJ5A 1W2PA 1TUFA 3BK0A 4FZIA 5FACA 2NV9A 5AOUA 2YW3A 2ATMA 1UIPA 3L5LA 2PDBA 1REQA 2E6DA 1ISXA 3E0VA 3LHWA 3DERA 1OGBA 2I57A 5AC5A 1R0MA 3MBDA 3LY0A 1OT1A 3IJQA 5HAOA 5E5CA 2NQ5A 4UBPC 2VDHA 4Z2LA 4Q7BA 3KHJA 1FDJA 2IQTA 4TU1A 4CVWA 3ZQ9A 4ADUA 3RNDA 1E1EA 4BZYA 4NZFA 1DE5A 1UKPA 3KCOA 2PE4A 3POHA 4P2VA 5C2GA 1JAKA 4XIMA 3K8MA 3NWRA 4Q6XA 1DWFM 4H6KA 5BMWA 2X05A 2XU2A 1FH9A 2P3EA 1IV8A 3BJFA 2NX9A 2WJEA 2YDQA 3DENA 2QDHA 4PL2A 1XLLA 4XKYA 3LU2A 4JNYA 1Q6GA 4JHMA 3KTXA 1AODA 2HROA 1E4MM 1ZJIA 1HJUA 1AD4A 3W2NA 3CZGA 4PFMA 4GG9A 1A3WA 2DU2A 2J7FA 5BOOA 2E67A 1UC4A 1JCMP 3UESA 2A0NA 5I3HA 4DJFC 2WB5A 4TMBA 4EXBA 3N11A 4ZO8A 1LUCB 2CLEA 2J7BA 1FHVA 4YWIA 1TPC1 3F2BA 3WF1A 1UCWA 3ID7A 2YX0A 1DJZA 2PGEA 2ACSA 2H8ZA 4AU0A 3A22A 1I45A 3SY5A 4O14A 2GUBA 4RZ4A 3TYEA 1VQTA 3PPGA 5DX7A 4ES4A 2ZX5A 4PMRA 3M41A 1TPDA 4HD5A 5EB8A 1VIZA 1KGUA 2CLLA 4DWSB 3KTSA 3TWBA 2VHLA 3R1ZA 1EXBA 4QNWA 1H50A 1WUFA 5D2VA 3MW7A 4FX8A 3GVQA 2CHRA 5B7YA 2NXHA 1ZCCA 3VNIA 1DJYA 3MTWA 3VKAA 3MP3A 4HVXA 4IICA 2QVHA 2VKZG 3HBLA 2FJUB 4HMNA 3JRKA 3W2JA 1QI4A 5EU9A 1SZNA 2ZUNA 4UTTC 3STEA 3QN3A 1GORA 1TRDA 4GIRA 3FV9A 1WCGA 1EA0A 4GZJA 3WQVA 4IIGA 4EAMA 1MUWA 4B90A 2ZQ0A 3C3NA 3NVDA 4WY0A 4JYEA 1J96A 3UZ5A 1SSGA 3HGRA 5F2IA 1RY0A 3W7NA 3RJXA 5A95A 3WUEA 3H21A 4LV9A 1E6NA 4Y9PA 1SO4A 1TKKA 4DYJA 4MY1A 3R58A 1HTIA 1MWOA 4AVNA 3WJXA 4JTGA 4F0HA 1ADOA 5EBUA 3ZWSA 5LNSA 1VEMA 3EB3A 3W9ZA 3PPFA 3PUEA 3VGFA 5GJMA 2WPGA 1F4HA 2PDQA 4JL1A 1KFWA 3EEGA 1WNOA 1H0GA 1DXIA 2NQHA 2NQLA 1VFFA 4EP8C 3MWAA 4Q8MA 3L9CA 2IPGA 1DWGM 4JFTA 4JIIX 6PTDA 2CYGA 3P2VA 5K4XA 4KEZA 1U1UA 5AHNA 1H7WA 3GY1A 3VNYA 5F2MA 2A79A 2GUUA 3M7SA 4S3AA 3RMEA 2G50A 4C1LA 1Z44A 4KCWA 4UB9A 3LS9A 3DKJA 3VMOA 2AL1A 1UD6A 3RGTA 4JY8A 3KXQA 1EP1A 2PLJA 3BMXA 4MDOA 4W87A 1B1YA 4LQ1A 3WNOA 1W1IE 3AZRA 3VOCA 4DUVA 4TUFA 4DF1A 4HU3A 4Q8NA 3P5YA 1BTCA 2C0HA 1CT5A 2ZICA 2QIWA 3EOUA 2IPFA 1DXEA 4J28A 3GKFA 4OBSA 2PDIA 4WZHA 3W7OA 2DSZA 4PE8A 1XQKA 4AY8A 3O0KA 3D3AA 5FEXA 5BRBA 4O16A 4AD2A 1LORA 5HNTA 4NASA 3NQBA 3QR0A 1S3TC 4Y96A 1MW1A 3KP1A 1Y65A 2NUYA 4DAIA 3CIXA 2WJFA 4WJ8A 1OFBA 4MAVA 5HWJA 1G94A 4YNGA 1OZMA 2HNEA 2P88A 4UTLA 4DY1A 5D9NA 2QQ6A 2BXVA 5DY2A 1OYAA 5CAHA 4D6DA 2EAWA 2PDYA 1PTDA 4ZE4A 1Y5VA 2PZ0A 2CC0A 3EA3A 3R79A 5JBDA 5CC6A 1OX4B 4ENLA 4L61A 3QQWA 4ZSUA 3NSMA 3D3FA 4DLMA 1X8FA 2X0SA 2HJPA 4RDVA 2J47A 2XINA 4JTJA 2CBJA 4N9BA 4IXXA 1QDSA 2PGFA 1IIHA 5DXXA 3LNMA 2ASHA 1PB0A 4C6LA 2WZTA 2VX4A 1NQKA 1JPMA 2OSYA 2A5HA 3E9AA 1AFSA 1SFLA 3KBJA 2HWGA 2WWCA 3CIWA 2DT0A 2A3HA 4ZVJA 1E70M 3G1FA 4H4IA 2HK1A 2ALRA 1BRLA 3KVLA 4H9ZA 1JD7A 1KB3A 3ZM8A 1FCVA 3HPXA 1QTWA 4KBXA 3ISIX 3VVGA 2V81A 2OOFA 3S47A 1G69A 4J27A 3UR5A 2ZX7A 5GPRA 3W53A 3N12A 3DESA 3UT0A 2VVNA 1Q6FA 1EA9C 2FB3A 3RPDA 4ASTA 4UFHA 1EH9A 4GLEA 2BHZA 3N1AA 4IG2A 2J6XA 4CEUC 3LGGA 2BLEA 3ES8A 4FXRA 8A3HA 4MLRA 5F1UA 1TPVA 4A2RA 3DG6A 2ZRUA 4LFYA 3W1TA 3Q45A 1TPWA 4KWWA 2P5NA 3WD1A 1LG1A 3ANUA 5F4WA 3CAWA 1UA7A 3C56A 1JULA 3VD4A 3V0TA 1TZ9A 2ZDSA 1MNSA 2PU1A 3WELA 4N7QA 1IXQA 4OZOA 4PCFA 3EWDA 3TFXA 4CD8A 4BA0A 4ZOEA 3SB0A 3M1ZA 1TV7A 3RMJA 5HJXA 5E9AA 2HS8A 1LP6A 3SCSA 1TJPA 4Q4OA 3NQDA 3WNKA 4UFIA 1CLXA 4JD4A 1XD1A 2BXYA 4OE7A 2OODA 4RNFA 1EWEA 3VGEA 1XL9A 1E4IA 1F2JA 2WVTA 4M81A 4J3ZA 1DXFA 2GPTA 4H8VA 1M9HA 1KCLA 1WAWA 3RM4A 3VX1A 2Z6IA 3W07A 5HDRA 3TTYA 3TX9A 3VK5A 4ZQMA 5BYWA 5BU6A 4UNIA 1IT0A 1CXHA 2F84A 4HHPA 1V79A 4O50A 3RX4A 3WEZA 1EJ7L 4JTDA 4MZ8A 4XD5A 1R3TA 1AMKA 4O13A 4TX6A 3TYZA 3TQKA 2HXUA 3VPLA 2BGSA 5IRPA 3WJYA 3LPOA 1K8YA 3HOJA 1XIEA 2CLPA 4G7EA 5FEPA 4Z2IA 2PRHA 1OCNA 3JS3A 3N17A 3KVKA 4DZ5A 1KW1A 4AQLA 3WKZA 1RQHA 3GS6A 1G5AA 4AWUA 3WG6A 3QV9A 1KCKA 4GBDA 2VGBA 3OZPA 5AC7A 2X0YA 2J78A 3S2CA 3K5XA 3QPYA 5BWFA 3BLOA 2D0FA 2UZ9A 5I3GA 3SY8A 2XIJA 2DH2A 3LCHA 3B9OA 3DIPA 4W8AA 3N25A 1KFEA 2V5KA 4OECA 2DZTA 5CAKA 2GZXA 1V08A 4RE3A 3RCMA 3VIOA 5MF5A 3L0NA 1MEIA 3TOYA 2AQWA 5C7VA 4LYRA 3DHFA 2ISWA 4PTVA 4R85A 4F0KA 3DYMA 5FCZA 1G4PA 1PIFA 1X96A 4L9ZA 1KTBA 3IV8A 4NRRA 1EYWA 5H2ZA 2Y89A 4EIVA 1ZTVA 1OM0A 4U3CA 3WBWA 2X09A 3DHDA 3TW6A 3WLLA 5KITA 3II1A 4JTFA 3WJSA 4QHRA 4EK7A 1XG4A 1VBGA 1C8YA 3LV6A 3KCLA 4P8UA 2V5JA 1BXNA 1JCYA 4XK2A 2BMBA 2Q01A 3S2LA 4FNSA 1Q45A 1EZWA 1W3KA 3AHTA 3G1SA 2YLLA 3R10A 2G95A 1G4EA 1S2VA 3RR4A 2V3FA 3SM0A 2QCMA 3AMDA 2WZIA 2Q09A 1DQXA 8CGTA 1CWYA 3PP7A 4DIAA 3TTSA 3N34A 3CZJA 4K2SA 3LSCA 2PDUA 4O19A 4W7VA 5FJIA 1B4EA 3NQCA 5DXYA 1J5TA 3QF0A 5CC3A 6ENLA 5LNUA 1E71M 1GVRA 1S2WA 4JX5A 3CL8A 4RPQA 2QCHA 4EXQA 1EJVC 3VIMA 2WMHA 4ACYA 3UY8A 3GXIA 1IIGA 5J8LA 3URQA 3SW6A 4G8TA 1U2YA 3R0KA 1AH3A 5G1YA 4CNTA 2QGHA 4IPIA 2ZZ3A 4AG0A 4ADTA 4EWND 3O06A 4KETA 4RCXA 1BSIA 1KQZA 1JRCA 5G4EA 5H8UA 1C91A 2BB0A 3GG7A 4ZQPA 1SVDA 3H2OA 2VEMA 3BZGA 3CK5A 3WLKX 2NSXA 1I2RA 2JFEX 1TV3A 3VIPA 3TW9A 3S4TA 2V2HA 2Z2UA 3AISA 4V1YA 1O6IA 4O1DA 1W9DM 3MO4A 3T0BA 2HE5A 2YDAA 2EBNA 3OZMA 3O6CA 5HQEA 3PWIA 2NZLA 5F2LA 2IPJA 2D69A 3KCJA 5I00A 4XKMA 1PCKA 4IX0A 4U31A 2YCEA 1KA9F 3ZO9A 4NKCA 5H8MA 2TPSA 1CNVA 3M5XA 3V0SA 3FJNA 1DJIA 1TA3B 4MNKA 2E6YA 1RP9A 4AHPA 2P0IA 2OO6A 2NQJA 1O94A 2TRSA 3FYYA 1MO0A 1M7PA 1PXGA 1YHTA 3N6QA 5TD4A 3M0LA 5A6MA 4JTQA 3WUGA 1PHQA 1TE6A 4ZA0A 1LT8A 5C55A 4PUWA 5JBFA 1Y5WA 5LYRA 3TH6A 3LSBA 4L4OA 3C8NA 4AD1A 2OEKA 2VEFA 4EF8A 3UPMA 5AYBA 2PTZA 3ORWA 2DY3A 1WA3A 2O9TA 1FWRA 3UZJA 4N0RA 1W5OA 3TMLA 2PI6A 3MMDA 2YBTA 3PBYA 4EX4A 1QR7A 2XDFA 3L4TA 2XH4A 3QPZA 4CNPA 2IKGA 4FNQA 4H8NA 4C6BA 4K8GA 2G3IA 3SCWA 5A6JA 2VDIA 4M51A 4BR1A 3AQUA 3E2SA 3D47A 3EA2A 2QCGA 3AIVA 4Z0SA 5AHIA 4LUTB 5LXEA 1F6KA 4AIOA 2WHLA 1GK8A 3PG8A 1F8IA 4CUCA 4J7RA 4H2HA 2WKLA 5G2WA 1W3NA 4G56A 3SADA 3F03K 3F2CA 3N9RA 3T4CA 1QBAA 1E3XA 1RUSA 2PUZA 5G2IA 3LZ3A 4R7OA 4H3DA 1NJJA 3NG3A 3PULA 1WDRA 2PD5A 3U2EA 3P93A 4CKQA 4UMBA 4U28A 3PHAA 3E2QA 3LG3A 4GRSA 4GUJA 1BVNP 3AS2A 3CGTA 1XV8A 3DHUA 1FP8A 4CNNA 2QF8A 4UTKA 3B04A 2VT0A 4AF0A 4F4RA 1XH1A 3IK2A 4HB7A 2QMKA 4FLQA 4AEFA 3W7CA 5A6KA 4JTLA 1I0BA 4DJFA 3KTCA 4ICMA 2QULA 2QPSA 2XZ9A 3C0LA 5HJLA 2XIBA 1GZ1A 1BQGA 4G6CA 3HPZA 3CH0A 1R46A 1WPCA 3MHUA 3ITLA 4OIFA 2BASA 2A6NA 1CLKA 1XH0A 4GVFA 3W02A 1R47A 1UKSA 4HNVA 4B5SA 2VEPA 1XYBA 3Q67A 1C93A 4ECLA 3KRZA 1H7RA 4UQDA 1Y7VA 4E3VA 5MKGA 4GCAA 3RCNA 3W1PA 4DI9A 4AZ6A 1DE6A 4P7QA 1UMYA 3BCJA 2Y88A 1B2YA 1AL7A 2A6LA 2GWNA 1KCZA 1RHCA 3O6DA 1H5YA 4V28A 1BWLA 4LVAA 2YW4A 4OJYA 3A9BA 4M6QA 4GD0A 2QLYA 3TZNA 4EPBC 1HFBA 1DPMA 1RD6A 2EG8A 5D8WA 3AUOA 1JNEA 4EPKA 5T8GA 1FRBA 4B5WA 3CT2A 4V27A 5BW6A 3WYZA 1AK5A 4P5UA 1TELA 1X7FA 4UTTA 6REQA 3NM1A 4XD6A 4D8AA 3CB3A 4HHHA 3B97A 1X6NA 2J13A 3RLVA 1M5WA 4KMQA 4JCMA 3U7VA 1QW9A 3AC0A 2J27A 4B2DD 5D9MA 4GIEA 2DZPA 5G1TA 1E3ZA 3M44A 3T9PA 1P0BA 5DBUA 3RHGA 2I9UA 3P7YA 2WMFA 4GCXA 3E0IA 1ISWA 3WBXA 5LHEA 4GI9A 3TYAA 3SSZA 3P14A 4FF7A 3OYXA 1OD8A 2F61A 1LQ2A 3NQ2A 3WK3A 3DFNA 4LEFA 4ZEPA 4A8RA 3W6LA 1YMYA 3WLMA 2F6XA 2NWSA 2VELA 3L4ZA 5CCZA 3TVAA 1OX5A 4Q6JA 1Z69A 3KBVA 1JXJA 1XC6A 1WDQA 3LRLA 4L5ZA 4Q7NA 5HBFA 2IXUA 4U4MA 2CFFA 4M56A 4DBWA 1OG0A 3UWVA 2Y8UA 1A5UA 5DCBA 1HNYA 1ZFJA 2QHAA 1SSDA 2F9RA 3EYPA 4NVTA 3VTRA 3CPGA 3VZYA 1IEVA 2NUXA 5D2YA 4OHQA 2JGYA 3QOKA 1P6BA 4MHBA 4OBTA 4LU0A 1C3FA 3WK1A 2J9ZA 1J0ZA 1BTMA 4WCJA 2D20A 2DT3A 1W3HA 2DJXA 2W91A 3S2MA 1XBZA 3DFHA 2GDQA 2G3JA 3V7PA 4MIMA 4EOUA 1EJUC 2ZZ2A 4LBSA 2QUNA 3RM9A 3CAVA 4LGXA 1YW1A 4J5NA 1KXTA 3GKAA 5EMYA 3OLDA 4QSHA 1K8ZA 3QEZA 2PDCA 2OYMA 1SPQA 1UMLA 4F0MA 2MNRA 3ITVA 1JGMA 4FIRA 3H8AA 1EO7A 3WH7A 3W81A 1NFGA 1XFCA 1YYAA 1ICPA 4QNEA 4QQ3A 3A4JA 4HZ7A 4JN7A 1C8QA 1M03A 2VEIA 2V8ZA 4JEQA 2HRWA 5D8ZA 2XWEA 2PP1A 2ZWYA 3GWQA 1C8XA 5K3VA 2P1FA 1HO1A 4YIWA 1BEUA 1NQ6A 3FIGA 2OZTA 4WKAA 5C9ZA 1WKEA 4LAZA 4PCNA 2CPUA 1WZMA 4EAYA 1TQXA 3UEQA 1ONEA 3F4DA 1ZBWA 2VRKA 1SM9A 4DNHA 4PMXA 3W22A 1V6TA 1LLWA 1DYSA 1MYRA 3WN6A 4OGZA 1CGUA 4FLRA 7REQA 1R7OA 4DJDD 5I09A 4E4FA 1EGVA 3C4UA 4UQ9A 4EKJA 1TTIA 1Z89A 1BYAA 4GA8A 3TCSA 2V5CA 2DSVA 4TX9A 2GLKA 1OADA 4L9YA 1DJWA 3LPFA 4QITA 3FJ4A 4UFKA 4IP7A 4PUJA 4GISA 1LF1A 2OT1A 4XVDA 4K8HA 3U0HA 1EPVA 4HMCA 3S6OA 2XTKA 1F73A 1Y0EA 3M5ZA 4HYRA 1W1VA 3NSXA 4BF7A 1A5OC 2ABBA 2DT2A 2PWHA 5EKYA 3ITOA 1Q66A 5M03A 1DL3A 5LIYX 1UWSA 2W3ZA 4JDYA 1NSJA 3FHAA 2HISA 3MUAA 4XG1A 5D09A 3MMTA 1L9WA 2INZA 3GNOA 1NFBA 3WLHA 1MXGA 3WQWA 3MHGA 5T9CE 2Y7FA 1XGDA 1IEIA 2QJGA 3L5AA 1YPIA 2J24A 3G77A 4W93A 1NFPA 3LENA 5E0CA 3AI0A 5FSDC 1UKQA 3RPTA 4IL0A 3PTQA 3W3OA 1CZ1A 3CMFA 1GHRA 3OU8A 1V03A 2ZA2A 3FAXA 1Q6OA 3H23A 5U7SA 4S2BA 3WDHA 4IX2A 2DW6A 1FWBC 4ILSA 4LF2A 1NY1A 1ISVA 1E1FA 4KIRA 4K3ZA 4QGCA 2JF7A 3H4GA 5JIPA 1JPKA 1XR2A 3S46A 4LCRA 3U2CA 1N8FA 2Y62A 2IKIA 4C5ZA 2XIOA 1AMYA 1VBHA 1GQIA 4JQ1A 4AZIA 1A5LC 3OGRA 1R2RA 3HGOA 2D2JA 4FR6A 3WBYA 3WY1A 2DSUA 1EBGA 1GW1A 2KZHA 2XYLA 1MW3A 3G3MA 3N29A 3S83A 4GC3A 4HTYA 4HA3A 5FEZA 1P7TB 4XAZA 2NVDA 4H9YA 1RR2A 4HNTA 1DIDA 2Q6ZA 1GVFA 1TB3A 4PUEA 3M0IA 4QIUA 4RR4A 2PLMA 3N4EA 1FCBA 1KQYA 2O9RA 3A6OA 1O1ZA 3W2LA 1XIFA 5DANA 3GFYA 1IZKA 3ANVA 1GHSA 4ZTXA 4TX8A 1LZOA 3SUSA 5BROA 5KZEA 4S3JA 4GYPC 3ABRA 1BVWA 1TIMA 4K38A 3RF9A 5I78A 3OEXA 1CI1A 3QHOA 3OGVA 1IR1A 4DVOA 1B31A 2HV5A 5CSYA 4PTWA 1SR0A 4XUYA 1KNWA 1FWTA 4K1WA 4L9XA 3LB0A 3HMJG 3AMCA 5I77A 4HYWA 3FKRA 1XISA 7CGTA 4DELA 1EX1A 3OA5A 2PWUA 5HNUA 5BXTA 3TV8A 1CECA 3PZTA 3ZFHA 3KFTA 3Q4DA 3DFOA 1EFZA 1DHKA 3N4FA 3DFTA 2O92A 1R30A 2R1PA 3B0XA 3O2LA 4E2DA 1FTXA 2J66A 3VIFA 3U3HA 3OPSA 2CU0A 2XVNA 4LVFA 2V68A 3DC8A 5ECVA 3KLLA 2BOEX 4UTWC 1KFCA 4GQ0A 4US5D 2PSNA 1OQFA 3AXMA 3FW6A 4ICNA 1MEWA 5HPCA 3M16A 1F3EA 1E40A 5I03A 1FWWA 1GOKA 3ZVHA 5AZ1A 3GK0A 5CG0A 3CWNA 3SR7A 3I7SA 3NDZA 5FF2A 5A8PA 4LW7A 1VFUA 4D6IA 4C7FA 1JUBA 3VILA 4L4PA 3N9SA 2H3DA 3MZ2A 3IACA 2FZ9A 1M53A 4DUOA 1POKA 3G1DA 2GOUA 4UMCA 3TR2A 3RCYA 5LZLA 1OSEA 4O8RA 1E9ZB 1K6WA 3AS1A 3OZOA 5KETA 1G6CA 2XN0A 2YBVA 1F5ZA 1XLHA 4MOZA 4N6FA 4IM4A 3NIYA 4BEQA 3S5OA 2W67A 3IVUA 1FKXA 1VFHA 1POJA 4LBRA 3GNXA 1XX1A 4LC6A 2C1HA 1HZYA 3EMZA 3R12A 1RJPA 4O8AA 4UTIA 4AB4A 5LA0A 3IGXA 2BY3A 4AZGA 1O5KA 3OHMB 3W37A 1NH6A 2PODA 2PB1A 3CV2A 1PIGA 1D3CA 3GU1A 3W88A 1TRIA 2ZYFA 1MVYA 3MSRA 1XLEA 1S5WA 1LT7A 3S8HA 1P1MA 3KE0A 2CETA 4MLJA 1EOMA 3GU9A 5LNVA 1A53A 2QUTA 3KEHA 3MJYA 2CZEA 1MRAA 1EO5A 2O4QA 4UZSA 2GWGA 3LM3A 1ZAIA 2PWGA 4GJ1A 1SFJA 1KBIA 3O16A 3INPA 3LLFA 1FXPA 2PPGA 1QT1A 1NDZA 5D2TA 3RAOA 4XTDA 2WV8A 7ENLA 4J1OA 2PMQA 3UWWA 1JAEA 4HTBA 3OBKA 3ANYA 1VZWA 2DUZA 2FJKA 4JNZA 3OODA 1KBLA 3C8FA 4PMZA 2CIPA 4JTTA 3MSYA 3T40A 2IMRA 3GB6A 4GXWA 1XLIA 2E77A 3CJPA 1V6XA 3VAVA 3GC4A 4W9TA 1DKWA 2GOKA 2PTXA 1JI1A 3ITCA 4YJ5A 1QNPA 4KIEA 2IKHA 1LBLA 3MI6A 4INFA 3SSJA 2CLIA 1Z3NA 3FX4A 5LIWX 1DV7A 3GVGA 4HU0A 3THCA 1QHPA 1W9BM 3RYSA 3EB4A 2VZSA 4MKNA 1UUMA 2VXNA 4P7RA 4LCSA 4IJRA 3T08A 3NA8A 4R3UA 4HNCA 4LNCA 2DP3A 1V6UA 3QFEA 4X9SA 1KM5A 4DN1A 1G9HA 3CPUA 2VFFA 2REQA 1HVXA 4C6EA 2J75A 3FA4A 1GPFA 1EJXC 4C1NB 2NV1A 2ZX6A 1LWJA 4F9JA 2PCEA 3UG4A 2HDJA 1KM1A 3CEPA 3B8IA 3AHZA 3EWYA 4LUIA 4PULA 1OHLA 2CHNA 2JIEA 1WZLA 4QR6A 3R8RA 4CU6A 1ITQA 1D8WA 5G2HA 3T2QA 5EY5A 4LAOA 1T6MA 3DXIA 2J62A 1FP9A 1IR2A 1THFD 2G4FA 3CAKA 4QLLA 3GLCA 4NZJA 4RDWA 1OX6A 4ZQRA 3EB2A 4A22A 1W56A 4RV8A 1MFUA 4UTFA 1J6OA 2QNEA 3ZWTA 5K9DA 2E4TA 1DIOA 3QQ1A 3E5PA 4DM2A 2P53A 3CWOX 5AFDA 2GQ9A 3W1XA 1SZRA 2WCSA 3TNBA 3PBWA 3V16A 2VQUA 3C6CA 3B06A 3MI2A 4TV6A 4PFHA 2JGQA 4ZB2A 1K7XA 1VC4A 1UH3A 1CCWB 2VCBA 5C0QA 1OY0A 5JBEA 5M3WA 2YDSA 2YZRA 3TQ0A 2ZWZA 3L12A 3AUJA 3WJWA 3N15A 4XBJA 1ZP3A 3TU9A 2WANA 1VBUA 1VRXA 3VNDA 3F4VA 3WL1A 2W92A 4B4FA 2E68A 3TR9A 4GKLA 3T81A 1QRQA 4NJHA 1I9CB 2FLIA 4WKFA 3IANA 3PZNA 2P8BA 2B7NA 2OQHA 3GTXA 3L66A 1KCXA 4PRWA 3W6YA 4LS2A 4WSJA 4OVXA 1NEYA 1AQFA 2VR5A 2NVCA 5FF4A 4Q33A 1XYAA 2Y24A 4NIRA 1E6PA 2FPVA 2WOQA 1R3YA 3BXWA 3TONA 4RUBA 3MWCA 4QE4A 2VO5A 4MGGA 3OIHA 3N2BA 3H6OA 1OCJA 4Q8VA 1HKJA 4MWAB 1G7UA 3T09A 3VC6A 4V15A 4YVPA 4OFCA 1CGYA 1RXOB 3M0YA 3NQ8A 3POCA 1IZJA 2WBGA 1MMFA 4JIEA 4Q4PA 4NX5A 1VHNA 2PDGA 3LGDA 3GR8A 3WK0A 5A8NA 3GDBA 1H61A 1PZ2A 1XFBA 3HB9A 3DC0A 3F5LA 1U22A 4MAZA 2GGIA 5D37A 1YDYA 1Q65A 2QCCA 1LOLA 3U2ZA 1FQ0A 1VPXA 4DJDC 1W1ZA 4YTTA 4Z0JA 4W8BA 1UIOA 3MMWA 4BF9A 2VVSA 5CGTA 5I24A 3WMLA 3GNRA 3BLFA 2G3MA 2OX4A 1OG6A 3U5UA 4DF0A 3AWNA 3SO7A 1BPLB 3IJ8A 4WVXA 3EWBX 3AYRA 3VDCA 1GYMA 2JKAA 4HMDA 4EXAA 1XIGA 2FB2A 4KCTA 1WDPA 3BL3A 3BG5A 3C2RA 4PRRA 1QFEA 2XVPA 3UY7A 2XGIA 2FIQA 4MUZA 1GZJA 2B4GA 3M46A 3OJGA 4ACZB 1A50A 3NZRA 1KTCA 1J5SA 3THUA 5C70A 3R94A 1ZENA 3B9DA 1TPH1 3TZFA 1W31A 3M0KA 4M6PA 2VCCA 3FDKA 3NQGA 4ZSTA 1RCOB 2XPKA 2ZUUA 4ORMA 1E73M 4PBEA 2ZRYA 3BSMA 1CGXA 3WLOA 1R86A 2Z1VA 4MKVA 2PF0A 3MA8A 3NAVA 1HJQA 1EQCA 5CXPA 3V5CA 1O5RA 3B8DA 2OSWA 1RK6A 3KBNA 4MWAD 4JPGA 1JDEA 2BGNE 4Z2GA 2NXIA 4I3GA 2D73A 2W63A 4ALDA 1IXPA 1H49A 2HS6A 3MUZ1 5CBJA 1E1CB 4F0RA 4UOZA 4HK7A 1EDGA 2NX1A 3E0LA 3NCOA 4Q8OA 3F4WA 4IWWA 2BY0A 1G67A 4BWLC 1TV5A 2WSKA 2P3ZA 2GJXA 3GHSA 2XH2A 1FWAC 1TO3A 4Z2JA 4JTSA 1KFKA 1L6FA 2WPBA 4HN4A 1LTDA 3TXVA 1TTPA 2E1DA 1OGGA 2KX9A 3BARA 4FPSA 2EPKX 1V6WA 2X41A 3UGVA 4NT0A 4H00A 3UPWA 3I3DA 3P5ZA 1W1PA 4DRSA 3L0KA 4JHOA 1VLIA 3GR4A 2GJPA 1KLZA 4L64A 3N14A 3S9YA 4I7WA 5IHSA 1H5VA 1UR0A 2PRMA 2B7QA 3DU0A 3LTSA 1E6SM 1BF2A 3WQOA 1I2QA 2Q3RA 1VBRA 4J3WA 4F0LA 2YKKA 5DQPA 2QXWA 3HG2A 4HQVA 3URNA 1R38A 3VIHA 4WQ6A 2FDSA 2DT1A 9XIMA 1VBJA 1EWDA 1KBKA 3EEZA 1BHGA 1F4AA 1XYFA 4PUNA 2D22A 1O1HA 1YLVA 3COTA 3VIJA 4IPJA 6TAAA 1VHCA 3QMRA 4CQ9A 3VKKA 3PAOA 5DBTA 1KFJA 3TJLA 2DZUA 1WYIA 3B0VC 4LT9A 3MBFA 1R8LA 5BNKA 4A3UA 3S5SA 4D6GA 4QG6A 1XDMA 2NVAA 4I5XA 3FOKA 1C7SA 5IBXC 3F5KA 1ISZA 1QCWA 1Z6KA 3B8TA 4O52A 2BS9A 4CCEA 4RW3A 3WD2A 4XISA 5CZ0A 3UR8A 3W23A 2EJ1A 1WQ5A 3ZR4A 4C6JA 4JKKA 3IEBA 2YIHA 3PSVA 4JQ3A 4JTKA 2XG9A 1JVNA 4MPQA 4ZENA 3CV6A 1TUXA 1PWLA 1WOBA 4YU1A 1H1ZA 5PTDA 3R6IA 4BI7A 4OV4A 3WFAA 3ALGA 3E6EA 4CGTA 3QTGA 4MFEA 4CQCA 4AYSA 4HGXA 2QJMA 1ZCOA 5LA1A 1V0MA 3NGFA 1V3HA 1GQJA 1F61A 3UG5A 5AHLA 2YBUA 4LY8A 3U4FA 4B3LA 5CH9A 4GKTA 1ZNNA 4C6MA 5XINA 4PUUA 1LG2A 1H60A 2WWDA 4F48A 1EC8A 4GVHA 5FJPA 5FJRA 2O55A 4L6OA 1X97A 1H11A 3QMTA 3WQ6A 2H9AB 3ZLFA 1J0KA 3CL6A 1KKOA 1FKWA 2OYKA 3PG9A 4PR4A 4LXFA 4S3GA 2PF8A 3NJ3A 2FPTA 4PN2A 4V33A 3KRSA 4E4UA 3E0FA 1O60A 3GYEA 3LZ5A 4HYVA 4H6RA 3PS7A 3P67A 1DEDA 4OWGA 2EHHA 4H6QA 2QPXA 4LX4A 2VZVA 2GVGA 4YMZA 3WK2A 3VCNA 1PS9A 2X1RA 3W7LA 1V3KA 3V35A 2V69A </