4LANA

Crystal structure of cordyceps militaris idcase h195a mutant
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
370
structure length
370
Chain Sequence
TPVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLAPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-5-carboxylate decarboxylase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
total genus 137
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lanA00
1P1MA 1RK5A 2O4QA 2Z27A 3JZEA 4PCPA 4RDZA 3MVIA 2DVTA 1FWGC 3FEQA 3TN5A 3S2JA 2WJFA 1EJWC 4IG2A 3MPGA 2FVKA 3URBA 4WGXA 1ITUA 3GG7A 3GU2A 4C6KA 2EG6A 3MSRA 4INFA 4QRNA 4C6JA 2P53A 4ERIA 4H9YA 2F6KA 2Z29A 1V7AA 4HJWA 2XIOA 4QROA 3RHGA 1YMYA 1RAKA 2O4MA 4RDWA 4ERGA 3UPMA 3AUOA 4GY1A 2D2HA 3IJ6A 4J35A 2KAUC 3MJMA 1FWFC 2YZ5A 4IFKB 1POKA 3CS2A 4XD4A 3IRSA 1XWYA 3HPAA 4L6DA 4LAKA 1A4MA 1EJSC 4G7EA 3A3WA 4IF2A 4G2DA 4ZSUA 1A5LC 3R0DA 2FTYA 3A4JA 2WM1A 4C6LA 1HZYA 2OQLA 1I0DA 1R9YA 3K5XA 1R9ZA 1V4YA 2PUZA 4LCRA 4LCSA 1FKWA 2Z25A 3MVTA 3RYSA 4XD3A 1XRTA 4CQCA 1WXYA 4IFRA 2R1KA 4L9XA 1RK6A 4KERA 1YBQA 2YB1A 4YIWA 2ZC1A 4GXWA 2G3FA 1J6OA 4H00A 4IH3A 3OVGA 4ICMA 3PANA 4C6FA 3FDGA 1NFGA 4PCNA 3F2DA 3QGKC 1NDVA 2VHLA 2WJDA 2Z2BA 4P5UA 3OODA 4GY0A 4LAMA 3LGDA 4KF1A 4DLFA 2OODA 4C6NA 4C6CA 4IFOA 1RJQA 4H9XA 3B0YA 4IG2B 3PAOA 3S2MA 1A5OC 2R1NA 3LA4A 4PBEA 4C6PA 3EWDA 4KIRA 4LAOA 4B92A 1P6CA 4C6OA 2R1LA 1R9XA 2HNHA 4GY7A 1KRCC 2DVUA 1NDZA 2HPMA 3V7PA 4XD5A 2P50A 1UIOA 3IARA 2GSEA 4HK7A 3URAA 3WYZA 2E25A 5FSEC 3S2LA 4R85A 4AQLA 1KRMA 2PAJA 1IE7C 4GX8A 3B40A 4UBPC 3WMLA 3MKVA 3LU2A 1M65A 1I0BA 4RZBA 3E74A 2Z00A 2EG7A 4G7EB 2HBXA 3N2CA 4KESA 3GTXA 4KEVA 1ONWA 2E1WA 2Z26A 4GK8A 4GZ7A 4F0LA 4EPEC 1KRBC 1ZZMA 2YXOA 3E0FA 4ERAA 2AQVA 3T8LA 4MUPA 3UR5A 2OGJA 4QSFA 4C5YA 2CZVA 4GX9A 4TQTA 1FWBC 4GC3A 3QY7A 1YBQB 3T81A 4GYFA 4EPKA 4DIAA 5FSDC 3CJPA 2VR2A 4KEUA 4Z42C 1QXLA 4AC7C 3DC8A 1EF2A 3GUWA 3HTWA 4EPBC 3TNBA 4IGNA 1GKPA 3LGGA 2GWGA 1S3TC 1K1DA 1XRFA 1J6PA 2QT3A 3C86A 4LFYA 1A4LA 3GU9A 1KRAC 2D2GA 3MDUA 3QY6A 4IGMA 4DO7A 1P6BA 2IMRA 1FKXA 4R88A 2BGNE 5CH9A 2OOFA 4CNTA 1DPMA 3EGJA 2AQOA 1YNYA 5HMEA 4B3ZA 2VM8A 4JOMA 1RJPA 4H9TA 4F0SA 1O5RA 2HQAA 4GOAA 1GKQA 4J5NA 3URNA 4H9MA 1EYWA 3MTWA 4V1YA 1EJRC 4XAYA 4LALA 2AMXA 3OQEA 2GWNA 3PNZA 4C6BA 1ITQA 3GIPA 2EG8A 2Q01A 4RDVA 1WXZA 1EJUC 4I6VA 3DCPA 1O12A 5HMFA 4IQJA 2QVNA 3PNUA 1E9ZB 4NP7A 4H01A 4H9UA 4DI8A 1V77A 4B91A 2PGRA 4CQBA 1EJXC 2RAGA 4XAZA 5LXXA 4GBDA 3LNPA 4CNSA 4ZSTA 3TN3A 3RN6A 4NG3A 3GTIA 4BJHA 2VC5A 4RE0A 3GIQA 3ISIX 4C65A 4HK6A 3E3HA 4C6MA 2GZXA 1UMLA 1QW7A 4PBFA 2I5GA 3FDKA 5A6TC 4EP8C 2BB0A 1K6WA 4NI8A 4XAFA 1YIXA 1KCXA 4HA0A 2VC7A 1W1IE 4KQNA 3F4CA 1PO9A 3GRIA 3ID7A 3URQA 3BE7A 4HK5A 3NURA 3T1GA 4UB9A 3ORWA 1PB0A 4C6QA 4RDYA 3S2NA 5E5CA 4LANA 4M51A 4CEUC 1E9YB 4C60A 1FWDC 4H9ZA 1POJA 3UBPC 2HPIA 1FWIC 3E0LA 3B0XA 3KM8A 4C5ZA 3IACA 1ADDA 1RA0A 2GOKA 1JGMA 2YB4A 3LS9A 1J5SA 3LSBA 3UF9A 4DNMA 4EPDC 3E38A 3GTFA 4XD6A 3CAKA 1GKRA 4QTGA 2Z7GA 1NDWA 2VUNA 2ADAA 5HMDA 3IGHX 3G77A 4QS5A 4BY3A 4R7WA 1RA5A 3D6NA 4DZHA 2FVMA 3O0FA 4OFCA 2OB3A 3QY8A 4LEFA 4C6DA 1FWCC 3EWCA 4CQDA 2WJEA 4LCQA 1J79A 5G4HC 4KETA 1EJTC 1EZ2A 4C6EA 4D8LA 2Z24A 3IPWA 1VFLA 1A5NC 2HBVA 3LSCA 3ITCA 3O7UA 4H9VA 4F0RA 1YRRA 4KEZA 4E3TA 3IV8A 4DLMA 3GTHA 1V79A 3S4TA 4LH8A 1FWEC 4J2MA 4WVXA 4I6KA 5AKQA 2ICSA 2Z2AA 1A5MC 3SO7A 3LY0A 4CNUA 1XGEA 4B90A 1UIPA 2Z28A 3GU1A 3K2GA 2Q09A 3F2BA 2ANUA 3OJGA 1BF6A 3AU2A 3OU8A 3TN4A 2QS8A 4QS6A 3SFWA 2R1MA 3TN6A 3OOQA 2FFIA 2FTWA 3DUGA 2DVXA 1K70A 1FWJC 3WZ0E 3F4DA 4BKNA 4V1XA 1RJRA 4IFKA 4DZIA 3NEHA 2UZ9A 3F2CA 1M68A 3QGAC 4DYKA 3NQBA 3HM7A 1NDYA 1A5KC 1UBPC 4C6IA 3MDWA 1M7JA 3E2VA 2R1PA 3AU6A 1EJVC 4WHBA 1PTAA 2W9MA 3ICJA 3K4WA 3PBMA 4PE8A 1PSCA 2A3LA 2PGFA 3RCMA 2D2JA 4DI9A 2PLMA 1V51A 2QPXA 4CEXC 1ONXA 2UBPC 3UR2A 4XAGA 2I9UA 2Y1HA 1FWAC 3A3XA 1FWHC 2Z4GA
chains in the Genus database with same CATH superfamily
3H7RA 4PCPA 1K8XA 2J8TA 1QNSA 4WDTA 2XIQA 3TFCA 2WJFA 3M0XA 3GH7A 3FJ6A 1ITUA 5G4WA 1GYMA 3APTA 3GNXA 4LT9A 5T26A 2DW6A 4WIWA 3SADA 4A4AA 1GTHA 1MQQA 2ZXDA 3P14A 3W1RA 4ERIA 3N13A 1DE5A 2F6KA 1FTXA 4PUEA 1XL9A 2V67A 1HN1A 4MADA 3E6EA 1CBGA 4UCGA 3G8RA 4LVGA 2E28A 2X1RA 3IJ7A 3CYJA 3C0JA 5CZ0A 2Y7GA 3U4AA 3W1AA 2FFCA 3B8UA 1OABA 2EJ1A 1V03A 3AO0A 3TSMA 5RUBA 4J4KA 4Y9AA 3A3WA 2YL9A 4PB3A 2KX9A 4Q4RA 2JGYA 3L66A 3LHZA 5F4SA 4OBRA 2WM1A 4ROQA 8A3HA 4AIOA 4G1NA 2WMHA 4DF1A 2V82A 5F7UA 3CYVA 4XD3A 1XYMA 5IBXA 2X1IA 1QVBA 2A2IA 4PUKA 3PK7A 4S1FA 4NAEA 2IQDA 5DMYA 1X6NA 2CU0A 1AJ2A 3C8NA 1MZHA 3VNIA 1NFGA 4QJ1A 4W7WA 3AXMA 1RD6A 3S5SA 2BBFA 3DBNA 1W9XA 1GVOA 3FHQA 3LGDA 1PYFA 4UFHA 1XCFA 4Y9NA 1W6TA 2R6OA 4JDYA 1GVYA 3GH5A 1P6CA 4DO4A 3WDRA 4KIEA 2R1LA 3BSGA 3AIQA 3MP5A 3DFHA 2HNHA 3WF1A 1Q5MA 2P50A 1UIOA 3A12A 4AXKA 5D9MA 2VFIA 3RO6A 1HW6A 2CCRA 4M24A 1W5NA 3TX9A 5BZAA 1ZAIA 4ZOBA 2O55A 2A6NA 1DWIM 2CHOA 3IUHA 5KMYA 2C6QA 1XIJA 3ES8A 1AZ2A 5BOEA 2AQVA 4F0KA 4KEMA 3CMJA 5G1YA 4GC3A 3LCHA 4FX7A 2CYGA 2Q8XA 3SB0A 1RP9A 4OV9A 5EMLA 1Y5VA 4F66A 1B3WA 2BY1A 2V5KA 3VIIA 4TIMA 4NYUA 1UC4A 1HJWA 1GG1A 5I3KA 3H12A 2OKOA 2CBVA 1OEPA 2RDXA 1J6PA 3COTA 2QAPA 3IANA 3PC0A 1P0KA 3BL3A 3PFMA 5U4NA 2C0AA 1AZ1A 3G1SA 3UP8A 3VIPA 4NVTA 1HKMA 1EF3A 2YDSA 3DECA 3RUBL 2MANA 1U2YA 1PBGA 3WQOA 7XIMA 1AQFA 4NF7A 3MW7A 5TD4A 2XVKA 4Y8FA 4A3YA 4QGCA 2J6VA 5EU9A 2Y7EA 4B3ZA 5LIKX 3UD6A 4MGGA 1OFRA 1WDSA 4FXJA 3BOLA 1JI2A 4W7UA 2YSWA 1EP3A 4Z0JA 1J8VA 3CHEA 5D2WA 3V1HA 5LNRA 1SW0A 4XZHA 4H7VA 1Z44A 1X8FA 3W82A 1B31A 4UZUA 2YYTA 4C7GA 4MAVA 5C55A 2FHCA 3GHRA 1B9ZA 1NEYA 4AMAA 1LQ0A 5D9PA 3N4FA 3HO8A 3LPOA 3Q94A 4NX5A 3SR7A 3HGRA 1DJIA 3VGBA 5LNWA 4AU0A 1JDDA 1AD4A 1P4CA 1A5CA 2ZKMX 3MI3A 3RN6A 4IP5A 4NRSA 3AHYA 2ZRWA 5DRCA 3HG4A 2R8WA 3L5MA 1GORA 4CU7A 4M8UA 1EPVA 1PDZA 2NSXA 2H9AB 5A6TC 1JCTA 4XAFA 1JCXA 2QUUA 3EDJA 2DZPA 1YIXA 2DUXA 1EC7A 4HHHA 3B05A 4KQNA 1XUZA 2EO7A 2YDRA 3M1ZA 2BFGA 1TQXA 4HK5A 4R5EA 4IP4A 3A5FA 5F1VA 3WY1A 1CGUA 4WY0B 5J5DA 1UBSA 4WX2A 2V3EA 3VGFA 2V5BA 1FWDC 3LPFA 4GJIA 2ALRA 4GYJA 2ZICA 2WLYA 2FZNA 4LOCA 1EA9C 1YDOA 4LC8A 3W7RA 4JTDA 5BMWA 2X0YA 1KBJA 2XN1A 2G0WA 3LS9A 4O8AA 1J5SA 3UERA 2PDHA 4AZIA 1P7TA 4JTIA 1CGXA 2FZ8A 2OOGA 1I2QA 1NOUA 4PTNA 3THAA 2YCKX 1OX4B 1I45A 1LLZA 2WBGA 5HPCA 4BY3A 1GQNA 3FXGA 1A0CA 2OB3A 1UOKA 4G56A 5JH1A 2XFWA 4PMNA 5BU9A 1KBLA 5I3JA 1Q3NA 2YL8A 1RQHA 4Q8QA 3GXIA 4W8BA 2WKGA 4FNRA 4AZ7A 1T8QA 3DG7A 2PDWA 1ISWA 1K9DA 2VGBA 2QR6A 1IEVA 3IIVA 2PTYA 2VOTA 4QJ4B 3H2NA 1ZENA 2DJLA 2W61A 4ATWA 3VNKA 4NL1A 2Y5EA 2BWGA 4FALA 1YKWA 4OUEA 3GDTA 3G3DA 5G2WA 1HJXA 1JYNA 4UQDA 3MV01 1K4GA 1XLLA 3ARVA 1KV5A 4GIRA 3WH9A 3CPRA 1W1ZA 1P1XA 3ZLGA 4FNUA 1HKKA 2JALA 4V1XA 4DZIA 3SJ3A 2VGIA 3AIVA 4HPXA 3VUPA 4ZFMA 1UZ1A 4K38A 3KBNA 2Z7KA 3ZJ7A 1ML1A 1G94A 2J62A 2YL5A 2QPSA 1ICSA 3AU6A 4FNSA 5F2GA 4R7JA 5A8MA 1VRDA 3ICJA 3SCPA 5A6SA 1EH9A 2PDGA 2YDQA 1E4IA 1PSCA 2XM2A 2Y5SA 3O16A 3SZ8A 5C5YA 4MMWA 2YFOA 3ZQ9A 5CPOA 2YW4A 3R5EA 3QFEA 3UR2A 5I3DA 2YIHA 4MPQA 2Z1KA 1P1MA 2Z27A 3JZEA 5KTLA 3L0GA 2VURA 4ZQRA 2L5HA 3TZNA 9RUBA 3TN5A 3MO7A 4QDMA 3M6YA 1GPWA 1XW8A 2WVVB 3V5OA 4DO5A 3QQ1A 2P53A 3KZPA 3WH8A 4UOZA 1SYTA 1V3MA 1KM3A 4L1GA 3GNOA 5AC7A 2O4MA 4CVUA 3UPMA 1E73M 3RMJA 4EWJA 2HWGA 1POKA 4XD4A 3NGFA 3CZJA 1A4MA 4OJYA 4IL2A 3POCA 1PWMA 2NQJA 5DMNA 1KD0A 2YDAA 1RALA 4PL1A 1JEZA 3M0LA 1AW5A 1KR1A 1V4YA 2P88A 4LCSA 3LXBA 1LQ2A 2FGBA 1XKJA 3TYDA 3DEQA 1YXYA 1QNPA 1J6OA 3S42A 2ZFAA 3EXSA 2V5JA 4Q8NA 1OYBA 2ZCGA 1VYRA 1EQPA 4C6FA 2ZTJA 5IOBA 1VBJA 3U7VA 3A24A 4P5UA 3TR9A 1D7FA 3T2QA 3IJDA 4GRSA 1A5OC 3AIUA 4HHLA 2OPJA 1VFFA 1VJIA 4S23A 2I5IA 2YCLB 4FX8A 1ELSA 5MHBA 2Y70A 4F40A 1R9XA 5I23A 1XBYA 5T9BG 3W28A 1LM1A 3SCNA 2E3ZA 1KM6A 4GQQA 2AMGA 2PTXA 2P1FA 3N2BA 4M1RA 1IE7C 3IUDA 4K3ZA 4LRTA 3MKVA 2WKLA 4G7EB 1J2BA 3OLIA 1XLFA 2FJUB 4KEVA 4NNBA 3JR2A 3W9ZA 2CLFA 4MKSA 2GQ8A 4LTSA 2WM0A 3SUUA 3T07A 4QSFA 4C5YA 3YPIA 1PX4A 3CZGA 4X3ZA 4EPKA 4UTTC 5FSDC 4NYYA 5LHFA 2WMFA 3RLVA 3P67A 3JZUA 4CLMA 3UA4A 4IIEA 3L4YA 2Q02A 3IJ8A 4GQRA 1EF2A 4G8TA 4B9YA 3GR7A 4UQEA 3SIMA 1JDCA 2BV9A 3HGJA 3FKKA 1S1PA 3GU9A 3NYDA 2OLHA 3TE9A 1H62A 1JNDA 2D2GA 1Q6RA 2RGLA 3UY8A 4L4LA 3VC5A 1AMKA 1XC4A 2BDQA 3U4FA 4DJDD 1UH2A 4AF0B 1JCYA 3AAMA 1NWRA 1EWEA 2PDLA 3LM3A 2GL5A 1W54A 1W3NA 4UZSA 2LLEA 3UZXA 4V1YA 3P0WA 2FGZA 1XM3A 1PZ1A 1TPWA 3TC6A 4PUNA 3WX7A 2DW7A 4UNIA 1T41A 1FFRA 1EJUC 3UVIA 5CC7A 3WLIA 3Q37A 4N9DA 1QU4A 5C8BB 3AXKA 1EWDA 2DP3A 5D37A 2JQXA 3C52A 5A95A 3VD7A 3GQYA 1ZP3A 1H7XA 2CZDA 1XLMA 4N4QA 4NZ5A 3S1GA 2VC5A 4H1ZA 1R3WA 1S46A 2GZXA 1WCGA 1AQMA 5FIPA 4E0CA 4IUOA 3N9RA 3WLTA 3OG2A 4LAUA 2F61A 1PKNA 2YR1A 4JNMA 4O13A 1AUSL 4EXBA 3TNOA 1K7XA 1XCWA 4LVFA 3AZTA 4DJFC 4JQAA 1U22A 5AC8A 2VZOA 3HJZA 1SVDA 3MUZ1 5D38A 1E9YB 1HGWA 2VI0A 5LNSA 4OECA 1IR2A 3TROA 1DJNA 5JBEA 3BG5A 1ZS2A 4A22A 1Q45A 1G4EA 1UWUA 2G41A 3IACA 1JPDX 1L6FA 4E8GA 3ZIZA 5IBXC 4OQVA 3GDLA 2Z7GA 1KXQA 1TV2A 4LRSA 2PDFA 2ADAA 3VO0A 3A23A 1TR9A 1C7SA 3DFYA 4KWWA 3D6NA 4PMXA 4LCQA 2XWDA 1CLKA 2A4AA 1DHKA 2I57A 1TWZA 1XLKA 1H49A 1M9HA 5HWJA 1G67A 3LSCA 1UASA 5AC6A 4YWIA 2J79A 3NJ3A 4OKDA 4PFHA 1V5XA 1K9TA 1Y65A 4ATLA 4IP7A 3WMCA 3G1FA 2ACSA 1W9DM 3NQGA 3SO7A 3TTEA 3PSVA 1WDRA 5H8MA 2DV0A 3EMQA 3FSUA 3GU1A 3E2QA 3DYMA 5EYWA 4H8HA 3OU8A 5D8ZA 4DJED 1S38A 5A6KA 3GB6A 4LX4A 1HG3A 4MWAE 3GYEA 5AHFA 1UD4A 1PX8A 3KTXA 2VX6A 2X2GA 2V5DA 3M0KA 4PFMA 3F5LA 2PLCA 3CNYA 1YXCA 5D4YA 1EO5A 4DEFA 2AKZA 3MYPA 4LUSA 2NLYA 4FF7A 4IIDA 5ENLA 4YTQA 3BDKA 3UEQA 3NQBA 4N4PA 2VELA 1VC4A 1QOQA 3KHDA 3HQOA 5D2TA 4FF5A 4L4PA 3BPWA 1E15A 3EB2A 3WLNA 1JZ5A 3QMRA 5FAJA 1HGYA 1V0KA 3INPA 4O12A 3N14A 3H2EA 3PBMA 3QPEA 1E4LA 1J10A 3PZ9A 3W2MA 4ZQOA 1E40A 1FWAC 1GZ1A 1PPIA 3KDOA 3L4WA 1Q6DA 1PE1A 2D2OA 5I3GA 2DVTA 1QAPA 3AMKA 3HV9A 2X0HA 5TQLA 1CGVA 5DBTA 3GVGA 3DG3A 3BMWA 1VGAA 1H5YA 4BHYA 3MSRA 4QRNA 4C6JA 1R7OA 4N02A 3KVLA 1IWBA 2X40A 3PULA 3IGXA 4LWWA 3H2MA 4RDWA 5E6ZA 3MBFA 3NQMA 1BAGA 1R3YA 2G3JA 1X39A 1EDGA 3W7EA 4UTKA 1A3HA 3W1PA 2DZWA 1LWJA 2X7WA 4A6GA 2HZGA 3ZLHA 3II1A 4NJIA 4JY8A 3A4JA 1JIBA 3EYPA 1B3VA 3BK0A 3PM6A 1I0DA 2E0PA 3R13A 1R9ZA 1TPC1 1RD5A 4J9JA 4AY7A 5DT7A 4YU1A 5FEWA 4YIWA 3IJQA 2VEKA 3IRDA 2V2DA 3AHZA 2HMCA 1LRTA 2WB5A 4DWSD 4H41A 5EY5A 3A5VA 3AWNA 1EP1A 3IJ9A 4DX3A 4IIGA 5ABHA 4JIQA 3AHVA 4FSAA 4P8VA 4IFOA 1RJQA 3B0YA 4PBEA 1NQ6A 3EWDA 4QE5A 3W7MA 2GJXB 3F5KA 4I5UA 1W2PA 4GY7A 5AZ0A 5C70A 4BF5A 3VNYA 3V7PA 4NZ1A 2P0IA 2TODA 3TCEA 1G5AA 4X9YA 1WXJA 1VIWA 5CSSA 2PTDA 4D6GA 3B40A 1C8YA 3WQEA 3N04A 4RR4A 3QF0A 4P8WA 2EPKX 4S39A 3N2CA 4GJ1A 3KTSA 1OHLA 3GXDA 1HO4A 1D3HA 1TPFA 4F0LA 1W56A 3UVAA 1KLZA 1W5OA 4HNNA 3CUZA 4FLRA 3QGVA 2AOSA 3TYCA 4MG4A 3S9IA 1I2PA 1YBQB 3VIKA 3A9BA 5GNXA 2R91A 3FA3A 2GQ3A 2VRKA 3DYOA 3VE7A 4JTAA 1S2CA 3BJSA 4A3RA 4OZOA 1ZL1A 2EXOA 3GUWA 4EPBC 4N2YA 4A3HA 3AZSA 4A3UA 2WV8A 2ZZ4A 4N6EA 1XSIA 2CERA 5EKYA 1ITXA 3ABRA 4MJZA 1SO3A 5A3HA 1S1RA 1Y8BA 3O06A 2J7GA 1P6BA 2F2HA 1SW7A 4ZR8A 3ITVA 3L68A 4PMUA 5LXEA 1EQCA 4B5SA 1EGMA 4W8AA 3QOKA 1A5BA 2BODX 2VO5A 2VQUA 4JYFA 2DFAA 3AJXA 1E6QM 1KFJA 3R7MA 4J5NA 1GHRA 4MVAA 4GKTA 4CKQA 2J8GA 5HNNA 1VLIA 4I6VA 4DNHA 5BCAA 4JFVA 5FJUA 3M41A 1RP8A 3PTKA 2D3LA 4GACA 3DH7A 1P0DA 2ZRZA 3ALFA 3TEVA 2XSXA 4DF0A 1D3CA 2VENA 4DI8A 1Y5WA 4ZSTA 1VCVA 4K68A 4UTMA 4Q3MA 2NXIA 5BMXA 4B16A 3NQ6A 1L9WA 2GGJA 3WJYA 4ATDA 3T6CA 3VD5A 1XH1A 4NI8A 3T2OA 1QK2A 2DSZA 4EXAA 4M6VA 3UXLA 2PURA 4O8RA 1S3HA 5GJMA 2WHLA 3CL8A 3Q45A 1XIMA 1R87A 4H9ZA 4WDXA 6REQB 4HBKA 1H7RA 4WR3A 2V0TA 1QHZA 4O1AA 3W7LA 3IJIA 2ISVA 4R9OA 1AD1A 3B8VA 2Z6IA 2RDTA 3MSDA 3BARA 1JDAA 2PD5A 1JDFA 1XIBA 3G0SA 2VD9A 4J3SA 3PUEA 4QM1A 2OGYA 3NNTA 5D33A 2QV5A 3QY8A 5HJLA 3SN1A 1K02A 4C6DA 3CM4A 2HXTA 3GS6A 1PZ0A 1KCLA 1Q7ZA 4US5D 1KM0A 2Z24A 5FF7A 2OSWA 4S3AA 3VXGA 3RILA 3CIVA 1CTNA 1WUFA 4H9VA 3P62A 1YRRA 2DIJA 3R0UA 4TMBA 1C90A 3TTOA 4L65A 5LZLA 3NIYA 4MKNA 2XVLA 3TA6A 2CLIA 4I6KA 4HSNA 1ENUA 4FHAA 4ZB2A 3U7BA 3DGBA 3G22A 1UIPA 4QE1A 3WH7A 1UROA 5DX7A 4IMAA 5C2GA 2ZBTA 1UWRA 3BTNA 3P84A 5JQ9A 4E38A 5C6MA 1YNQA 5I3FA 1DJYA 1U30A 4AYSA 3VI2A 4AAJA 4Y6GA 1VQTA 3LXCA 2WW5A 1H7NA 4AHOA 3CQIA 1M7JA 4FAMA 3SQSA 3BZJA 1YYAA 3QR3A 3EXRA 1I2RA 4GI6A 2QZRA 4IMDA 5LNUA 4KFNA 4BCEA 5EBAA 5G5IA 1X6LA 3ZR4A 2XIBA 5FEZA 3DU0A 4DZAA 2XZ7A 2Z4GA 1CXLA 5B7ZA 2EPNA 3MVIA 2VDHA 2WPBA 1FWGC 4BZYA 1OGGA 1SJDA 2V81A 1QASA 3DFQA 3HFTA 2BOGX 4WGXA 3WBYA 3OGVA 1L6YA 1OFQA 4CCDA 3VOGA 2VX7A 2ZXQA 3E0VA 3PPHA 4G6CA 2TAAA 3F03K 3VZYA 2Z0IA 3SCUA 5K9DA 1RAKA 3E5PA 3TH6A 4ZTXA 4QG6A 3ABZA 1CB2A 5AVNA 2RJHA 3RK8A 7TAAA 2GDUA 5H8UA 4KPLA 1J12A 4B4FA 2P10A 4DXKA 1J11A 3PWIA 1W9BM 3I7RA 3R0DA 1V3LA 3NPXA 1ZU8A 3K5XA 1A49A 1XIIA 2RUSA 4ZODA 2NX9A 2ZDRA 3LBOA 2YZRA 3RPMA 5BRPA 4QQ3A 3VM5A 2G3FA 4FP1A 2VZSA 3NVTA 1B4EA 1ME9A 3WFZA 4HPJA 3VDAA 3O6YX 3RPTA 2WJDA 1HO1A 1FCQA 5E9AA 3OVRA 4J1OA 3K4AA 3TJLA 4C6PA 4DQWA 4ORIA 1TX2A 4LAOA 2CPUA 3S47A 2VZVA 3N18A 3QKZA 3S6TA 1VIZA 2GVJA 2OT0A 1VKFA 2IXVA 3PBWA 1QI5A 4AWSA 1DKWA 2H90A 2VCCA 2C19A 3KLLA 3HN3A 1EOMA 2QUTA 3EA1A 1VH7A 4QIUA 4PBGA 5LGXA 3PZIA 5CLWA 3STCA 3WLQA 1I0BA 3P7YA 2XVNA 3UR7A 1ADOA 1F3TA 3KOFA 4ACZA 2QJMA 3ZMRA 2WSKA 1ONWA 2IKHA 2IW0A 4HCHA 1FP8A 1OD0A 2EKCA 4RXGA 6ENLA 2IUZA 1FDZA 3LHUA 1DQXA 4GD0A 4MWAD 3STFA 1ISVA 5D9NA 2YXXA 1JXKA 4H7CA 3LRKA 4LS1A 4GVGA 4JTHA 2VR2A 3H7UA 4YXGA 5LA1A 2WQPA 1Q6QA 4DAIA 1WDPA 1BFNA 3E1F1 8RUCA 4XIMA 2BX7A 2I9EA 3TNBA 1WDDA 3W1QA 1JQXA 4GYPC 2X30A 4HVXA 5D2VA 4RJEA 1O68A 4TVCA 2GDVA 1H0IA 2B4GA 2POTA 5LNVA 2Y8KA 1ZBCA 2E7FA 3F4VA 4ONVA 4V27A 3MJYA 1TTPA 4DUOA 2YKKA 4NI3A 4EK7A 4KKXA 2VT0A 4HOXA 1JD7A 1RZMA 1ZJBA 3T0CA 4F0SA 1B4KA 1XGZA 1SPQA 1JCLA 2W91A 1TREA 2X1TA 3AS0A 3UNTA 3TAOA 1EJRC 2F6XA 4WSJA 1KFBA 3OQEA 2OO0A 2VEPA 1HP4A 3WO8A 4EIVA 2PP3A 2QEZA 1ITQA 4JFTA 4AWUA 2CLOA 1C91A 4IX2A 2E8YA 1VFSA 3H4GA 2G37A 3FA4A 4TU1A 1NVMA 1FQ0A 4Y8EA 5REQB 1AL8A 3LNMA 2A3AA 4IXHA 1OC6A 3UWVA 1UHVA 1K77A 1DJQA 2OCZA 4ZO9A 5F4XA 4M6PA 2ZUWA 1ONRA 4DJDA 1SFSA 1V02A 4F2TA 3LV5A 3GNPA 2AQWA 2CLLA 5KEZA 2QCLA 2FJKA 3UG5A 1B54A 1NF7A 2CZFA 3ZWSA 1M5WA 2Y24A 4N9EA 4LF1A 1KTBA 1ME7A 3NURA 3IGSA 4GFIA 4ASTA 1JZ7A 1VFTA 4YHEA 1M41A 3VDHA 3H7VA 3LBMA 4MTVA 1P0NA 3MUY1 3TYAA 1TG7A 1FWIC 1VYPX 3M07A 2QCDB 1NTHA 4NHVA 4C5ZA 4V28A 1NOWA 1PEZA 2BVTA 3C0QA 3NQ7A 4GCXA 2PDPA 1RCXB 3UWQA 4V15A 2ZUTA 4QS5A 4DY1A 4O0KA 1KGUA 5CBBA 4DUVA 1KM1A 3Q65A 5LIYX 1WZKA 2WC7A 2PC4A 3WELA 2E4TA 4FZIA 1WO2A 4BWLC 4YYCA 1PKMA 3MYOA 1SJBA 4JQ1A 3THCA 5CXPA 3EX3A 3APYA 5M03A 2BGSA 3VVGA 2QCHA 3B97A 1DWAM 3FLUA 3KP0A 3PWGA 1A50A 3VOIA 3GBEA 5DMMA 2AKMA 2JGQA 4J7RA 3DG6A 2AGKA 4O19A 2QGHA 2ZZ3A 1MRAA 4JQ4A 4AD5A 3QC0A 3FV9A 4KFPA 2YOCA 3WNMA 2NUYA 4FB7A 2QDHA 1WBJA 4TTUA 3PB0A 3HG5A 1KWGA 1VRXA 1R7AA 2J78A 2PEVA 2ZDSA 3NQ8A 3UA3A 1JYXA 3W23A 3O1NA 3MSGA 4HQVA 3GXFA 3GAKA 4ZA0A 4IQDA 1I4NA 4UR8A 1AMYA 3AHXA 1V51A 2PWEA 2ZUSA 4DJEA 1A80A 4IT1A 4HOZA 4I7UA 4R3UA 2B7PA 4LV4A 1QFEA 5D32A 2O7SA 4AIBA 3OEXA 3BAXA 4DO6A 3CMGA 3W2KA 4P8UA 1VZWA 1XSKA 3AALA 2DZXA 3B0PA 1IIHA 4IQLA 3CPGA 2VGFA 4X2RA 2PBOA 4Z08A 3MSYA 4ERGA 2QW5A 3TYEA 4Q7IA 4AD3A 3CAVA 1C93A 3B0UX 3CUGA 4PRTA 2KAUC 1P6WA 1OB0A 3FY1A 4IFKB 4HU0A 4S3BA 1HJUA 1VPYA 1WOAA 2RJGA 1A5LC 5FAGA 2I16A 1QNOA 2E6AA 2XVGA 5K4ZA 3BMVA 3OLGA 3VOCA 1JZ4A 1WXYA 4LC6A 1XXXA 1B3YA 3DXIA 3QR1A 3WLKX 1W1A1 4H00A 3GR8A 1G6CA 3ZVHB 5HA7A 3PANA 3F5JA 3M4HA 4PUWA 4XV0A 1LJYA 4PCNA 3ARXA 4X9SA 1UD3A 3Q4DA 1CWYA 1B57A 3T0AA 3S5ZA 3PWAA 1GQJA 1SQ7A 4WD0A 3U6WA 2WMIA 1PV8A 1XLAA 1GG0A 3THUA 3JS3A 4AZGA 3QTGA 3QMTA 1CX9A 3AZRA 3VZXA 4JL2A 1TUFA 3SCTA 1NDZA 2HPMA 4Z1DA 3Q58A 4FXFA 3HZ3A 3S2LA 5CBIA 4JEQA 4YHGA 3WN6A 3CH0A 3QSTA 4I9MA 4JYDA 1C8QA 4A8NA 1EUNA 2UY5A 4DWSA 1NELA 4AEOA 2CXGA 4WKFA 4NQ1A 5K9CA 3TYBA 5A6AA 1GK8A 4G1KA 3TJXA 1DIOA 4AVFA 2F7FA 1BTCA 3A13A 3R12A 3WJXA 3GTNA 2JBMA 3KZSA 2XHYA 5AYYA 1Z3NA 3WBXA 3W26A 3RCNA 3DC8A 3VM7A 1PS9A 4U3AA 2VTFA 1XG4A 3B9DA 3WKZA 4L4MA 1QW8A 3C86A 5F2IA 1OT1A 2X1UA 1JXJA 3HPSA 5JH2A 3ONCA 1MWOA 3P8IA 4UQCA 3CQKA 1G0CA 1TMLA 2NSOA 2VVSA 3B03A 1UR1A 2WQDA 3C5QA 1N8IA 3F4NA 3TC7A 1CW2A 3GNDA 4GOAA 3G24A 3SCRA 3WUBA 1V93A 5EB8A 2ZRVA 4O53A 4RZ6A 3KFTA 2R24A 3M5ZA 3OG3A 3GVRA 4Z1YA 1QRQA 2YA0A 1YPFA 1ZFJA 3VDGA 1YTDA 1NQKA 3A3HA 3PNUA 4LVAA 4Y9PA 4UTFA 2XTKA 1WV2A 5C2CA 3OYZA 4N42A 4H6QA 1DIDA 4CNSA 1F6PA 1Z69A 2Z6JA 4BJHA 3GIQA 5HINA 3E3HA 2FYMA 3H54A 2Q71A 4PBFA 4GJJA 3FDKA 2WVTA 1VS1A 1NARA 1OY0A 1XJBA 4AZCA 5CPLA 1TVNA 4JGDA 1OG6A 4IZGA 4JPGA 3CEPA 2XJ7A 1DJXA 1J01A 1B1YA 1LP6A 4N9CA 4DRSA 1H1NA 4Z2KA 5FF4A 5EBUA 4I3GA 3DHUA 1VBHA 3R4IA 5E5CA 4FR1A 2QMKA 4O1CA 1SUXA 1B5TA 3ANVA 3ALGA 4O28A 1VFUA 3D3FA 3B8IA 1JPMA 1POJA 1SSGA 4O1BA 2BTMA 4V2XA 1G4TA 3MY9A 4OE7A 2FLIA 5IHSA 1DBTA 2VD8A 3ELFA 4U4MA 2GSJA 1RCOB 5HWNA 4XZNX 4MLJA 1M1BA 1JVNA 3UXKA 4L4OA 3U5UA 2AL1A 3SM0A 1JL8A 4FX6M 2WSYA 4BI5A 1YQ2A 4MM1A 3GW0A 1GOMA 3EBVA 3K8LA 4AIEA 3QRHA 4RZ4A 4LUIA 4U5KA 3UG4A 3LCWA 3ZT7A 3WQVA 1ICQA 3WNOA 3PZVA 4PUMA 2GVYA 1WQ5A 4HNTA 1MW0A 1PKYA 1LWIA 1BKSA 1E6PA 4Z2GA 1TWDA 2G95A 3NDOA 3FHAA 1MSSA 2G3IA 3EDEA 3O2LA 3W87A 1HJQA 2WC3A 3BUVA 1UA7A 4GYKA 3GFYA 4RCXA 3HQPA 2O7QA 2O9OA 4MZYA 5ECUA 1JZ8A 2OTDA 2PS2A 4PTMA 1J93A 2ZYFA 4W93A 1MXGA 3FSTA 1KR0A 4JR5A 1UD5A 1FHVA 4LQ1A 1GOKA 4RXFA 4JX4A 1YHTA 2WKJA 2PU0A 4DYKA 4US5A 3DIPA 1UBPC 4DVOA 4I5RA 1KCZA 1EJVC 3W1MA 3L7RA 1PTAA 3H53A 3CV6A 8TIMA 1BG4A 4QJ3B 3EZ4A 2D2JA 4DI9A 1UPMB 2QPXA 4NASA 5A8PA 3NZPA 4XAGA 1QMLA 2G5WA 3VKCA 2WVUA 3GFZA 1QPQA 1OADA 1Z9AA 1Q4NX 1KNWA 3TDFA 4CUCA 1QPOA 4BEQA 1EJWC 3MPGA 2OQYA 5CJNA 1W0MA 3GU2A 2VC9A 1MW2A 4FIRA 4IUGA 3UCCA 1K7EA 4UTWA 3PTMA 4LUYA 1LG2A 1UR2A 2VL4A 1TA3B 5JVLA 2FZMA 3WQ5A 4Q6XA 2V9DA 1O6IA 4PYSA 4HCLA 2YZ5A 1W5QA 4LVDA 3IRSA 3WNLA 2WSQA 1I2OA 3NSXA 4IF2A 2X41A 1FX6A 4JIHA 1VBRA 1R9YA 2YL6A 1R3TA 4J2PA 4L9XA 2CKSA 3W2LA 3DAQA 1H1ZA 3BANA 3H21A 3MZ2A 4ZE4A 3ITYA 3P61A 4XAPA 4I8DA 1MVYA 3CV7A 3WDHA 1E3ZA 5G2HA 2PDCA 4ZMGA 1REQA 1W1VA 2GFTA 3WBWA 3F2DA 2PF8A 4IL0A 2YA2A 5IFPA 1QNQA 2OODA 2Y8VA 5HMSA 3W7NA 2GVGA 5M17A 2BGQA 5TNVA 4B92A 1ZRQA 3AYRA 3B8SA 2HXUA 3K8KA 1AJZA 1XLCA 2GSEA 4HK7A 3AOFA 3URAA 4F9DA 1FH9A 1F74A 1MQPA 1O94A 2YLAA 4QG8A 2A7RA 4AQLA 1ZBVA 4QLKA 3CHDA 4UBPC 2GK1B 4I9TA 1IEXA 4HYVA 4BK9A 3W84A 4JX5A 2PPGA 1WAWA 5I24A 5CGMA 4GK8A 8XIAA 3LERA 1BKHA 2YXOA 2WHJA 2ZZ6A 2VDGA 1TR1A 4O14A 2REQA 2I7GA 2NX1A 1XLIA 3NM1A 1UZDA 3GW3A 5E1QA 2VFDA 1WKEA 3L12A 3W53A 4X22A 1XUUA 1LG1A 1UWQA 2VKZG 7ODCA 5CSUA 4XUGA 2W3ZA 1GKPA 1GNXA 2INEA 3BH4A 3C61A 1K1DA 3UESA 1SO5A 5BWAA 2QDGA 5KZDA 3GC4A 4QX4A 3M0MA 4RZ5A 4EF9A 5GNZA 4C1KA 2PWGA 2XH0A 5AYIA 1EFZA 1UA3A 1U5VA 1AG1O 2ZZ2A 4Q22A 5CH9A 2XH2A 4Q4KA 4HMNA 5DXYA 1UR9A 1ZCCA 4O1DA 1UR0A 4UR9A 1QPNA 4MWAA 2BHYA 3L5LA 5I2UA 5BU6A 1KKOA 1O5RA 3LCLA 1X1OA 3URNA 3UWEA 4ZOAA 2CLHA 5CC3A 1HKIA 2ISWA 4XAYA 2WPGA 2QF7A 2QMJA 3PNZA 4HMEA 1OIMA 5D2YA 4AG0A 4XBJA 4ML4A 4IGHA 3WENA 1UWIA 3CB8A 3RNDA 1ECEA 1O12A 4FMVA 3RU8X 4CQAA 4UQBA 3RLUA 1W1YA 5AB3A 5LXXA 4UIOA 1BHGA 1KC7A 3TKFA 1DORA 3BW4A 1SZFA 1QNVA 3KVKA 3EX4A 5BRBA 2WCGA 1KCXA 3N2TA 4DZ5A 4JCLA 3URQA 5PTDA 1DWJM 1W9PA 2XSBA 1S5TA 4C1NB 1FBAA 1RY0A 4LANA 3ARZA 4X2PA 2D69A 5FCZA 4Z2LA 1UQZA 1GVRA 3KWXA 4B5UA 2O9PA 2PLJA 4I9AA 4JNYA 3VIFA 1HL8A 4YS1A 3ABSA 3FVDA 3POHA 1Q66A 1KTNA 2W92A 3LZ3A 4PGLA 2JF7A 3H23A 4OOZA 2ZZ7A 5K3VA 3CAKA 1D8WA 1MEIA 3SN4A 6ALDA 5HMDA 2E6FA 2XM1A 2Y62A 3B3DA 5LSMA 5H91A 1LF1A 4QXIA 2FVMA 4AWTA 1GOWA 1KTCA 3GHTA 4GCAA 1R5YA 5HR7A 4Q4SA 3QFWA 4GNJA 4NIRA 3U57A 1A5NC 1CGYA 4AZ6A 3PN8A 1Z89A 4CQ9A 3NA8A 4M6QA 4F0RA 2FDSA 1BG9A 3KX6A 1S2TA 1E6XM 1OQFA 2OU4A 5AC4A 1QO5A 1GONA 4Y96A 1J4EA 3W83A 5AFDA 4B90A 3AU2A 4CN4A 2RGMA 4GI8A 5T9CE 2VCBA 3TA9A 1EKOA 5DANA 3O05A 3ZSSA 3IIZA 1SMDA 4QEHA 1XH0A 3QJAA 2V5CA 2BOFX 3SCOA 4F2UA 3BAJA 3EWZA 5C2XA 1LL7A 4GLEA 3KBJA 2DORA 2X05A 4RNHA 1TJ2A 4F79A 2ZZ1A 2Y6ZA 1GWJA 3NPVA 1OD8A 3DESA 2QIWA 2W6RA 4C6IA 5IFTA 3NWRA 5I3HA 3EWYA 1KO0A 5CZKA 1E1FA 3SSZA 1E6NA 3CQJA 2CZEA 3ME3A 1UKSA 4LV9A 5AHLA 3L2IA 1OZQA 6XIAA 3FYYA 3IV3A 3QBUA 1VENA 2DQXA 1ME8A 2O4QA 2DIEA 2DQWA 5CGTA 1PKLA 1F9CA 2V38A 1L0PA 4LNCA 4E2BA 1WPCA 3OHIA 4DELA 4CD6A 4Q8TA 5F1UA 1Q85A 4MF4A 3TLQA 5E6YA 3KCJA 2PZ0A 4WGHA 4MNKA 4IIBA 5EMMA 4HU8A 3AUOA 1M6JA 1DOSA 3LI1A 5A94A 4WDUA 3V0SA 1MEWA 1FWFC 1XFCA 5DY3A 1E0XA 5GPRA 1F6KA 5M2FX 2WAGA 3G0UA 1RVKA 2QCGA 3NZGA 3K1DA 5A6BD 1UH3A 4GC4A 2DT1A 1CGTA 2VFHA 4HHPA 2SFPA 3LHYA 2VWSA 5C9UA 3BV4A 5DF0A 4L61A 3VCNA 2CFFA 1BVNP 4IH3A 4JKMA 2E6DA 4JBRA 4PH6A 1IQ8A 4AFYA 3B4YA 4X61A 4PRRA 1K8CA 3TVAA 3BLLA 1TIMA 1RR2A 2WBKA 4LAMA 3L23A 3WUEA 2CKRA 2PE4A 4E2VA 3FJNA 1V6TA 2E09A 3PSWA 1GVIA 2J7BA 3V0UA 3UZ5A 1MUCA 2PCEA 3KOWA 1S2WA 1HVQA 3QPYA 4Q32A 2VRQA 2ATMA 2DVUA 1QHOA 4OTKA 2WZIA 3SCQA 4UTIA 1E1CA 5CGQA 2EPOA 1KM5A 3B9AA 2OWCA 4BQ3A 1KRMA 4UNLA 1R3QA 3EB4A 2V5LA 3KS5A 4PTDA 1RPKA 5HDRA 3UQNA 1L8PA 3ITLA 1QATA 4LVBA 3T8LA 3RIKA 4TO8A 5IM51 3ZWTA 1R3VA 1V6UA 1XR2A 1MDLA 3CJPA 1G4PA 1EC8A 4JTKA 4YJ5A 3UGVA 1F4HA 3CBWA 4NNCA 4M82A 2FDMA 2CEQA 5I06A 2E5CA 2XYLA 4GGHA 1T40A 3LGGA 3WL1A 2GWGA 7CGTA 1ZNNA 3MA8A 5FESA 4L1XA 3UZYA 3TSDA 3MMTA 4FLOA 1TTJA 2C7FA 4DWDA 2UWFA 2BLEA 1UR4A 3WDPP 4YMZA 2OOFA 3LENA 3WUGA 2HVMA 2VWTA 1XX1A 5LHEA 1E6RA 1LQAA 4EANA 5D04C 4PN2A 2VM8A 3W73A 3WNNA 2OMAA 4JN8A 2G3NA 1WBHA 4GH1A 4PUJA 1LBLA 3BOXA 4JKKA 2DZAA 1TCMA 2QCCA 1Q6LA 3H55A 4HYWA 4Q33A 3LCFA 4NJHA 2CNCA 4MJ4A 1BGGA 3QQ0A 4K8EA 3CHVA 4HMCA 2QDDA 3RF9A 3T08A 3EMZA 4FK9A 3WD4A 1H7OA 1HFBA 3GE7A 4P7OA 3VK5A 1FP9A 4CNPA 5HAOA 4B91A 3WDQA 3MP3A 1U5JA 3P80A 3AWOA 2ABBA 1CLXA 5CAKA 1W31A 4YVPA 1QBAA 1XSJA 4UTWC 1SW3A 2AAAA 2EPMX 1PO9A 2PU1A 2V6AA 3VC6A 3AS3A 3DZ1A 3QVQA 4FI4A 3BSHA 3M46A 3FAXA 3VIJA 4XWUA 4HA3A 4B3KA 2W27A 3KP1A 3FAWA 3AYTA 4QCEA 1H5VA 1P5BA 4Q8VA 4PB5A 1LOLA 3AXXA 5DCEA 5FF2A 4X0VA 4QR6A 3WDIA 2DU2A 1W1TA 1JGMA 3W3OA 3VKKA 4Z1CA 3V35A 2QUMA 1CNVA 3TWAA 1FWNA 3OP2A 3UF9A 1GOQA 2Y2WA 4F0MA 1N55A 2QVHA 3PBYA 3FFSA 1O1ZA 5TF0A 2BXZA 3TMQA 3LMYA 3OHMB 7REQA 4QDWA 4QITA 3EWCA 1MQRA 1SGJA 4PCFA 3P5YA 3PR2A 1DWHM 1F07A 4GVFA 3MUCA 2PI6A 5DY2A 2ZX6A 1VFLA 3HPFA 3HIJA 3GY1A 2OG9A 2QNEA 1TRIA 3TP4A 4HIBA 4E3TA 1KB3A 4K1GA 4JS3A 4ZXLA 1V79A 3N2XA 4WVXA 2J9YA 2Z2AA 3LXAA 3RJXA 5BXTA 5HNRA 3F2BA 3GVVA 2Q09A 3O8AA 1X8CA 3HOJA 4WJ8A 5IRPA 2FFIA 1VCGA 3D47A 2I14A 4FO4A 2V3FA 2NVCA 4JIRA 3JU2A 2GJPA 2DT0A 3U0HA 1PWLA 2VJXA 1XLDA 4M29A 4WRHA 2X09A 2UZ9A 3J7HA 3L5AA 1W1B1 1VB9A 3BCFA 3TYZA 1GUVA 4RE3A 1VFMA 2DSWA 3DFOA 4CCEA 2ZE0A 1IZCA 4HZ8A 5ABFB 2W62A 4AD2A 3E2VA 1WOBA 3FKRA 3OZYA 4D6FA 3NDZA 5MKGA 3CTLA 1M01A 4J3WA 4QISA 4L80A 2W9MA 1TE1A 3CWOX 4PMYA 3MMUA 4BI6A 4QBXA 1E3XA 4WOQA 4C7DA 5ABTA 3O6CA 1XBZA 2WMGA 5DN1A 1OF6A 1VBGA 1RK5A 1W9VA 4M56A 3EEGA 1YADA 4CGTA 1PHQA 1IEIA 4IG2A 4HSOA 2ZVRA 3GC5A 1JCJA 2FVKA 5T8GA 3URBA 3VABA 1CXHA 3NEVA 4PSPA 4KBXA 5I6SA 1XISA 1XLJA 1ADSA 3UFYA 5AVHA 4XKMA 3RJYA 4NZJA 1F7BA 5KZ6A 1UOZA 4WLCA 4ENLA 4FA3A 2V30A 1YMYA 3H2OA 3BLKA 4FLSA 1GW1A 2FPVA 1FWWA 4GY1A 3E5BA 3IJ6A 1F3WA 1GT8A 4J35A 4Q8OA 3HJEA 3N4AA 3S83A 3QXBA 1JAEA 4Q8PA 2BY3A 3CO4A 1DV7A 2V63A 4PRWA 4AX6A 6XIMA 1DXFA 1UR3M 1RLCL 4ZSUA 3H22A 1GVSA 4IHCA 3W7OA 3MBDA 1KCKA 2OXNA 4AZHA 1HVXA 1JG9A 1XRTA 3ARUA 3MP4A 2IQ0A 4C1LA 1GEQA 3W2JA 2X8RA 4KW2A 3VA8A 1KWKA 3UG3A 3OVGA 4NNAA 3U3HA 3GDKA 4ZVJA 2OSXA 1WUEA 1K3UA 1KFEA 4W86A 4JKLA 2J7HA 2WWCA 3RM4A 3USZA 4LBRA 1V3HA 4H2HA 4QJ5B 4A3QA 1US0A 3VILA 3MUAA 3G1XA 4C6OA 3AI0A 3NO1A 3W1TA 3S6DA 1G7UA 1VYSX 4O50A 1LUCA 1PCWA 3L67A 2BZNA 2J6XA 2UY2A 5E93A 4DJFD 5GJPA 2QLYA 3V1PA 3HA1A 3U9IA 2J75A 2DJXA 4P61A 2GGIA 1SU5A 3DOPA 3LU2A 4MUZA 2J7DA 4NU7A 3BOFA 1DQWA 3N19B 3T4WA 3GTXA 4IM4A 5LA0A 3R89A 1IT7A 4Z2IA 3DN5A 4EXQA 1KRBC 4O1EA 4I7WA 4MUPA 2GVLA 3LMZA 1B90A 2PF0A 2NWRA 2WANA 1LLOA 2PDKA 2DGAA 3DFPA 4NAEB 1J18A 3LN3A 2A3BA 3FGCA 3HMJG 3WLSA 3W22A 2H6RA 2GJRA 1ZLPA 3FN9A 3TTYA 1H51A 4LGXA 2GUYA 2B31A 5BXPA 5CCZA 2IPJA 1I8JA 4B3LA 1C8VA 1S2AA 3HU7A 3NQVA 4U31A 3T09A 1VAHA 3LV6A 2QT3A 3N2MA 5BYWA 3WLJA 4W84A 3W1UA 5AYZA 1K6AA 1E5JA 3NDYA 3MDUA 3QY6A 1EYEA 2AL2A 1FKXA 3BAIA 4CD8A 4NAFA 3EGJA 2HNEA 2J4GA 4MAZA 3M5XA 1G9HA 4EE9A 1TFVA 1LROA 5CSYA 4JIIX 5G1MA 4H9MA 4GI4A 3NQDA 4D72A 4GUGA 2VVNA 4AHPA 3SRKA 1FRBA 1PXGA 2Q01A 2WNQA 2F6UA 1YDVA 4AY8A 1PX3A 1LRNA 4F3HA 3QV9A 5D02A 2EPLX 4S3KA 2DT3A 5M5DA 1N82A 3U2OA 2FIQA 1G7VA 1JQVA 3RX2A 3LNPA 3SBFA 3SGZA 3BLPX 1XD0A 4FR6A 4RE0A 3P0XA 2C1HA 1OYAA 1H63A 2E77A 1QW7A 2I5GA 3FCPA 1U1HA 1GQIA 3UJRA 2HVOA 5DQPA 4GBUA 3GUGA 3M47A 5GNYA 5T91A 3F4CA 6CGTA 3GRIA 1O5XA 2VDIA 1SO6A 3LLDA 2XFRA 1LZOA 2C8NA 1S2UA 3OGRA 4KMQA 4UFLA 3OYXA 3MCOA 2FPTA 4D9PA 5D30A 1JCMP 4CEUC 2ZX5A 3AMDA 1J0HA 3KOZA 4MHBA 2JIEA 2ZQ0A 4ORMA 1O5QA 4TOQA 2OYLA 1I2NA 2YB4A 5C9ZA 5BNKA 1DXEA 3G8EA 2A21A 1NDWA 1OCQA 2VUNA 2B0MA 5CKSA 1EIXA 5H1WA 1E70M 4Z2HA 1AQHA 4JTSA 2P8BA 3S5OA 3FYPA 1FHLA 1I75A 1J79A 1W5MA 2J13A 1EJTC 3EDDA 4GVHA 4HU4A 1CT5A 2PWVA 3W00A 1U33A 5BWFA 3PZGA 4XKYA 4HNUA 5FJTA 1OM0A 4DLMA 5IHRA 3HQNA 3O15A 1R85A 1B3ZA 3ITTA 3U5YA 3WEZA 2OWXA 3UR8A 3LY0A 3KBWA 2R82A 3KL5A 2Z28A 3WK2A 4G9PA 1JJKA 4EOUA 3W7QA 3TN4A 1L2QA 3VE9A 4ES4A 4PEKA 1TIWA 3OLEA 4HPGA 3CUFA 3GG0A 5CZSA 4US6A 3LDVA 1UD8A 4NILA 5AHNA 3NOEA 5EMUA 5U7SA 1P7TB 3PS7A 5DFAA 1XLHA 1TPEA 1EC9A 1GZJA 3PG9A 3WJSA 2VC6A 2PRLA 4YCPA 2XFFA 4JTTA 4OV4A 4WUIA 4B5NA 1OFPA 1W2VA 1E71M 1WZLA 3VOJA 2BXVA 2W0UA 1S39A 2INFA 5HATA 4NJGA 3G1VA 2QJNA 4LUJA 4R27A 3K30A 2A7PA 3GG7A 2BVYA 4H83A 1WB0A 2PFHA 2YGYA 1KXVA 4M80A 2A1YA 1FHDA 4TVDA 1RQEA 2PWUA 3T0TA 1ZCOA 4JTQA 4A35A 1PZ3A 1XDJA 3KCLA 4D6EA 1HT6A 3VNMA 4GNKB 4Q7BA 2R94A 5A2CA 4LAKA 4MY8A 4AVOA 1FCVA 1ODUA 3HMCA 3W01A 3P60A 1T0OA 3A6OA 4XTDA 4BEUA 1BRLA 4K6AA 5HJYA 2EQDA 4CQCA 3CC1A 2DUZA 1QW9A 2TMDA 3N73A 3T42A 4QNEA 2R1KA 1G1YA 1I60A 1L6WA 1RK6A 3W6LA 1K8ZA 5C9XA 3I4EA 1S5VA 4ECLA 3Q67A 3WLMA 2VR5A 1D7KA 5A2BA 4WDWA 3N11A 3SQMA 3HGOA 1BF2A 1SM9A 4UOJA 4HSHA 2Z2BA 3VPLA 3KDNA 4KF1A 1UUOA 5J04A 3LB0A 1BSIA 2GUUA 5JBFA 3S2MA 2JIWA 1DWFM 3C56A 2DT2A 3MI2A 4JQ3A 3ONBA 2XGIA 3QYQA 1GYNA 3MCNA 2CXEA 1JYVA 3DENA 5A6BA 1RQBA 4M0XA 3MC5A 1RV8A 2ZOXA 4Q8MA 3SRDA 3MHUA 2W67A 5K7JA 2XSAA 4LUTA 1TYGA 1F3XA 3CUJA 3C3UA 2ZRYA 3ZJKA 3CMFA 3EWBX 5A6MA 1F76A 3ZO9A 1V0MA 4ERAA 3IJLA 2WHMA 5FJOA 2OGJA 3MT1A 4XO6A 1JF5A 5HJXA 1FWBC 3WCZA 2W4XA 4DIAA 3SECA 1O7AA 2NT1A 4KEUA 1QXLA 2Y88A 2VEMA 3CIXA 4CCZA 1XYZA 1PIFA 1KXTA 1SFLA 2OLSA 1L2UA 2PDBA 5GVJA 4L6OA 2F2KA 3EOUA 5H8PA 3CHCA 3HTWA 1AK5A 2C14A 1XICA 3FW6A 2DZBA 4AD1A 3WBEA 1EBGA 4O10A 3S6OA 3LOTA 2E9LA 1KGWA 2NT0A 3DHFA 3IUIA 2G3MA 4Q4OA 5BOFA 4DO7A 1LWHA 4NZ3A 3VOFA 4IPLA 5HBFA 4H8VA 4QG9A 3TTSA 1W1PA 4MB3A 1YNYA 4XZLX 3HB9A 2OZ3A 3RX3A 4WSKA 4JOMA 2A6LA 1RPXA 4H9TA 4IISA 5JU6A 1LT7A 4PA8A 3REQA 1VJZA 4L56A 1GKQA 1FDYA 4MZ1A 2DH3A 3E96A 3C8FA 2JFEX 2XINA 3OBEA 3VKBA 3UJ2A 1BXCA 3WQGA 3T8QA 3FVMA 3NR0A 4KGLA 2CW6A 4R33A 3WLPA 3VD3A 1L6GA 1KFKA 1D3GA 1E9ZB 4JN7A 1E4MM 2OVLA 2TSYA 4L7ZA 1BYBA 2D22A 3VU2A 1XF0A 4RNIA 5D9OA 4ZQCA 2NV9A 4XBSA 5FJRA 3S46A 4BS0A 1LTDA 5FI8A 3M0JA 5FJIA 4EP8C 5ABEA 1F2JA 1W1IE 4Z1AA 3NVDA 4RE4A 4E2DA 3EWXA 1WZAA 5I7GA 4LB3A 1QI2A 1W37A 5EA9A 1NM9A 4RDYA 1Y7VA 3R58A 3C2FA 2F38A 1R30A 1HTIA 4DF2A 1QUMA 1XIFA 2GSHA 3UPBA 3XIMA 3V3WA 1KW1A 4M6UA 3ATYA 3UBPC 3G6MA 3MANA 4RKAA 1OWQA 4O54A 3SEPA 1F8IA 3H4WA 1BWKA 3UZZA 4I5XA 1RUSA 1I1XA 2PZNA 3AICA 3NG3A 4XTIA 5L9FA 3BQ6A 4B5VA 3VNDA 3ENLA 3UZJA 1H11A 1GJPA 4KCWA 2P8CA 3KVMA 3WLLA 5JIWA 3G5EA 1B2YA 3CQ0A 1XV8A 4FOJA 4WKHA 1ZB5A 4IOTA 1XRSA 3CZLA 4QEEA 3W25A 1RA5A 3GH4A 4GQ0A 2QPUA 1XQKA 1KBKA 1W3KA 4JTJA 4CQDA 1TPUA 2O92A 1TKKA 1TJ1A 1XP3A 4C6EA 1PHWA 3CAQA 4D1JA 2HISA 4D8LA 3S0CA 4ZEPA 3UETA 2QHAA 1LCOA 5G4EA 1MNZA 4HJFA 2J8FA 2OEJA 3NM3A 3P6LA 2DPEA 3MMDA 1FWEC 4J2MA 2A5HA 2ICSA 2ATSA 3EDFA 3PHAA 4DB7A 2HE8A 1TPDA 3W7HA 3OJGA 1BF6A 1X98A 3HG2A 3VZZA 1YNPA 1X96A 2R1MA 3TN6A 2OX4A 1IHIA 1ZALA 2WNNA 4FNTA 1EIBA 2NQ5A 4D2JA 1CCWB 4I8YA 4U2YA 3BG3A 1NSJA 4AEEA 1HKWA 3CXOA 3VCRA 5K4XA 1HF6A 1A5KC 3WD1A 4S3FA 3WD0A 3TXVA 1ISZA 2QF8A 2J9XA 4YCOA 4MPKA 1EHAA 1OG0A 1P0BA 5A2AA 3R6IA 1A5UA 1H61A 1YTEA 4MDOA 1TMQA 2A3HA 1I1WA 3H2FA 3CK5A 3T05A 3VFCA 3WNKA 4HYRA 2D23A 3TJIA 4HGXA 9CGTA 1CPUA 1VJSA 4RDZA 4ZZ9A 1R46A 3ARWA 2NQZA 3M43A 3PBUA 3S2JA 4ADSA 1KBBA 2OKTA 3GXPA 4AD0A 1C8XA 3GSMA 3W07A 3APGA 2CLMA 2CHRA 2Z29A 3BGGA 2XIOA 3BAYA 3L4UA 4AYGA 1GVEA 2YPIA 3FXYA 5HPOA 3GD6A 3MHFA 1BEUA 5HR6A 4LUSB 5AY7A 2EF9A 3AUJA 4UC5A 4KCVA 1KFLA 4UTTA 3P82A 1SR0A 1KLYA 3ARPA 1FHUA 2OWWA 4C6LA 2OYMA 4PEEA 2WLZA 2QCMA 5IXEA 1BXNA 1PZ2A 1JFXA 3AIRA 4XZMX 3T9PA 2ISDA 3WMSA 3USBA 4ICMA 1UKTA 2Q6ZA 3CUHA 7ENLA 3EOOA 2UY3A 2YCIX 1TELA 3CL7A 4J3UA 3QEZA 4PZVA 4LB4A 3L4TA 2VEIA 1NFPA 3PAOA 3RLHA 3OBKA 3TCSA 3VGEA 4REQB 4Q8UA 3PJWA 1R47A 2ZRUA 4W5UA 3DHPA 3A47A 2RHGA 4QHRA 3N12A 2OYKA 3L65A 3XISA 1EGZA 5I78A 2A0NA 1EDQA 4K37A 1UZHA 1GQLA 1XC6A 4DPPA 1N8WA 3ABQA 1F61A 2DEPA 3PZQA 3KL3A 3KHJA 4GMEA 4U2ZA 1DJWA 4D6IA 4M5PA 3WMLA 2NQ9A 3PUGA 1N7KA 3N25A 4UTJA 4RZBA 5IDZA 1V02E 3S2CA 1EEPA 1BYDA 2VX5A 4GXMA 4KCUA 1ZZMA 4YVVA 2FB2A 2PLKA 4TUFA 2TRSA 4U5IA 1QDSA 1O95A 3CZKA 4TQTA 3S1VA 1XBXA 1Q13A 3BG9A 4LSBA 1DHPA 5I77A 4GIYA 4HNVA 1E56A 5AYBA 1H1YA 3CWNA 3A4XA 2ZIDA 4KRTA 4DJFA 3BLFA 2WZHA 1C7TA 1S3TC 4IJBA 3KBMA 3L2LA 2H9AA 3OPSA 3CU2A 2R9RA 2WNWA 4AHQA 3VIGA 4QDPA 3N34A 5HUOA 1WKFA 1HIZA 3AJ7A 4WY0A 1AODA 3D0CA 2J25A 3PZNA 4Z17A 3BAKA 1XYBA 1RJPA 3KW3A 1CZ1A 3RR4A 3BZGA 3I68A 2V69A 4LALA 2ZVIA 4YL2A 1E51A 4MY9A 5TIMA 5CAHA 4F4RA 3H24A 1BVWA 1MXSA 4UFJA 3E02A 1TZZA 5M1TA 1S5NA 6TAAA 3DCPA 1X1ZA 1OX4A 2QUNA 3NGJA 1PAMA 3WQWA 3QV7A 1KQZA 3E0WA 4WXZA 3WH5A 3GM8A 4NP7A 3RR1A 1Q2SA 3TZFA 1H2JA 2CESA 2PGRA 5E0FA 3LCGA 4DAFA 1OSEA 3NZQA 2XPKA 3OIXA 1HL2A 3GKFA 3QN3A 2WOQA 3EPOA 3W7JA 4C65A 3PUOA 1RBOB 2Y5JA 2WC4A 2Y0FA 3WBAA 1G4SA 3ZLFA 4MNMA 5A5WA 1X97A 1OGBA 3PPGA 1JF6A 4HA0A 3WQFA 4H3DA 4XZ9A 4NJKA 1AL7A 1F8MA 4U3CA 3WQDA 3W2NA 4BF9A 2AGTA 2YW3A 4W85A 2C3ZA 1QR7A 4YNGA 4ZQNA 2O56A 2NQHA 3GWQA 4C6QA 3E2SA 3RM9A 2D1ZA 3GDMA 1KFWA 1AVAA 3HURA 2PDIA 3QV6A 4GZJA 2DUAA 2PGWA 3KE0A 4W88A 3T7VA 4ZQMA 3V5CA 3M7SA 3I6TA 5D05A 2HPIA 1MO0A 3M5VA 3DC0A 1BGAA 2I56A 3NZ1A 1M7OA 4DYJA 1K9FA 1SJAA 3DX5A 2X0SA 3LSBA 2FMOA 4BI7A 2E5BA 4H19A 1GKRA 3C2EA 4QTGA 2Y4SA 3EA3A 1T5AA 4GZIA 5GQBA 3CEUA 3W81A 3IGHX 3WF2A 3MB9A 3UWZA 2XG9A 1EP2A 4LEFA 4JZ5A 1FWCC 1V6WA 4ML9A 5CG0A 1HL9A 5AOUA 3SSJA 3TWBA 4A8LA 1BVZA 4I90A 4JCMA 4HOWA 3LK6A 3WSUA 1Q6FA 2YJQA 1UP0A 4RNJA 2HBVA 4WK9A 1LL6A 2Y61A 4FNQA 1JCNA 3GLCA 3WL0A 4LH8A 5BW6A 3BGJA 5AKQA 4JYEA 3MKKA 3LG3A 2E40A 1A5SA 3G1RA 3AYVA 4OWGA 2WVVA 3C6CA 3B9EA 4O15A 1IF2A 3MUXA 4W8LA 4PUUA 1R3RA 4QS6A 3CV1A 1I6NA 2FPYA 1V6YA 1RBAA 3OOQA 4S3JA 3GXNA 3AQUA 3MQTA 3EMCA 2Z1XA 1OX5A 1K70A 1FWJC 4S2BA 3TOPA 3CO8A 3NEHA 1DIKA 1WKYA 2PD9A 3RM8A 3CUXA 1YW1A 4MYXA 1S5MA 3NQCA 1XDMA 1CLVA 4CNOA 3H8AA 3MKCA 7A3HA 3BLDA 3UG8A 2HK1A 4TMCA 1BQCA 1IXQA 1XI3A 4ZQPA 5DCDA 4MIMA 4FEZA 3DERA 3PTQA 4KFOA 2A3LA 2PGFA 3RCMA 3VYLA 3NPWA 2FZDA 4ADUA 3CQHA 5DMLA 3PZUA 2Z2UA 4LXFA 2R14A 1THFD 3E49A 4XBKA 3ABOA 2PP1A 3EOEA 4JICA 1UKQA 4POCA 1UKOA 3IVTA 2J9ZA 4RV8A 1KGXA 1W3TA 4DBDA 4D6HA 4O0QA 2YCLA 4CN1A 4E8DA 3LUTA 3IIPA 3KBVA 3K8MA 3TQVA 1UH4A 2XFYA 4HJWA 4QROA 2G4JA 4U33A 2QGYA 4JHOA 3BJFA 5BRQA 3TK7A 1MYRA 2VEFA 2J47A 5F2MA 1SZGA 1XHGA 5AC5A 1BLIA 4WEVX 3ZS4A 4WZHA 4G7EA 1GOOA 4C91A 1FOBA 1R38A 2F8QA 2OQLA 1DJHA 4RW5A 4LCRA 2WCAA 2D3NA 3PP7A 1VD6A 4KGJA 4EF8A 3CWHA 3SDOA 3BW3A 4KERA 2B7OA 1TTIA 3SRHA 4LYKA 4S3CA 5KSWA 5GJNA 3G2GA 3PBVA 3S9ZA 4RNFA 4C6CA 3R2GA 2NWSA 3SAZA 2QYGA 3F4WA 4OU1A 4ICNA 5LKYA 5LA2A 3W1XA 2E25A 4AF0A 2Q3OA 4R85A 1G01A 4ZXOA 3FNDA 4RE2A 1EX1A 4W87A 1V0NA 3IEBA 4YTSA 4KESA 3KRSA 1OT2A 3RGTA 3V36A 4QAIA 5LIXX 4W4QA 4MB4A 1Z6KA 3GR4A 5CPNA 1TRDA 3PZMA 4KRZA 3K13A 3WDJA 4GX9A 5EGRA 2ESCA 3W0KA 1XYAA 4M7TA 3UWUA 3WF0A 3WLOA 4JD4A 4Z42C 2J7EA 3EKLA 2X16A 1GCYA 3VNZA 2DY3A 3SUSA 3LBCA 1UB3A 4A2RA 2YYUA 4UNKA 1GZGA 1Q6EA 2W79A 2O0TA 1JR1A 4IGNA 1MUMA 3E9AA 1XRFA 5FF3A 3TTQA 4K7VA 4AX7A 3TW6A 3AYSA 5DXXA 3ZT5A 1E5NA 2BGNE 2P0OA 3OA5A 1VEOA 2AQOA 1TCDA 3W7PA 3WK3A 2VZUA 2GLKA 3WIJA 3LGEA 3W2UA 4L64A 5CJMA 2HQAA 3VIHA 3PBGA 1DVJA 4ACZB 3N29A 1QTWA 2XU2A 4DHGA 4GHRA 3BXWA 3QLDA 2C18A 5HQMA 1WXZA 2CLKA 2WYSA 3KAOA 3MCMA 4BQ5A 4UWMA 3NO3A 3TJ4A 1HKVA 4AEFA 4EKJA 5DEZA 5HNTA 5HMFA 1CYGA 1QO2A 1W5PA 4CQBA 2RAGA 2ZUUA 4KS0A 3ZXWA 1SFTA 1YXDA 4A8RA 2CITA 1UMLA 1V6XA 1MNSA 2PWFA 2IQTA 3A4WA 1K6WA 3HF3A 2VYOA 3W7DA 1V7YA 3GIYA 4JX6A 3SY8A 3ID7A 1U1UA 3BE7A 3LPGA 5HXMA 4M81A 4Q4PA 1UWSA 3VTRA 2PA6A 1AQ0A 4E5TA 2WCSA 4CD4A 3UXIA 3W24A 5CPMA 4TXEA 4TX9A 2CHNA 1EA0A 2DH2A 3QSRA 5KZMA 2GJNA 1O60A 3GXMA 4DM2A 2YXGA 1XQLA 3CHFA 4YYFA 4JN6A 1MW3A 3KM8A 1R2TA 1LOSA 3G1YA 3WJWA 4GVIA 1TZ9A 4K8HA 4XD6A 1MFVA 4AWEA 2HROA 4Y7EA 2OZ0A 3ECQA 1YEYA 3W70A 4W5ZA 4RL3A 4D6CA 4GO8A 2POZA 1H3GA 1K9EA 4GQGA 2C79A 4H6KA 1T8XA 3BV7A 1FWTA 1XGDA 2GDQA 4L6HA 2H3DA 5CC6A 2B7QA 4QAWA 4KEZA 4PTXA 4ADTA 4ZFCA 3LCIA 1CDGA 3SUWA 3IS4A 1C9WA 1HNYA 2QJJA 4UMAA 2OT1A 5D2XA 1OGSA 3WLHA 1XIEA 3H2CA 1OCNA 1OCBA 5C0QA 1FH8A 1TB3A 1IXPA 3SFWA 2JEQA 1BD0A 2WMJA 1QI0A 2V68A 1HJVA 3WUFA 1SMAA 1DP0A 2IXUA 1Z8AA 1NH6A 3NSNA 5CLTA 4LYPA 1M68A 4XVEA 2VFGA 2PWDA 1HJSA 3QGAC 1RSCA 4J3TA 3SJNA 3HM7A 1LT8A 2XGBA 3H70A 1HUVA 4S38A 1Y5XA 1R8LA 2FH8A 4Z1BA 1H60A 3VKJA 2QCFA 4B15A 4AB4A 1DJGA 3M9YA 2ACQA 4PE8A 5I0DA 2VFFA 3W71A 4LAZA 5HUPA 6TIMA 4IIFA 1ZGDA 1A3XA 4RK8A 3KEHA 4RLIA 3NQFA 2A3CA 2EHHA 2ZZ5A 2X1SA 1US2A 1VFHA 1S5WA 3EAUA 2XGZA 5HK4A 1XS2A 1PDYA 2VRJA 1TVLA 3R43A 1IXNA 3AROA 3IVSA 2CLEA 4QQUA 1DQUA 2GJXA 4TV5A 3W72A 1EL3A 1NAL1 4OOUA 3UJEA 1ZBWA 3RHGA 3STGA 4O17A 3ZJ8A 3F7JA 2Z1VA 4P7LA 3LRMA 1XIHA 3UY7A 3DFSA 5CC5A 1R86A 5FA5A 3FJ4A 3FEMA 3CB3A 1OVDA 4ZENA 4NRRA 1JFHA 4FXSA 5SWUA 2UY4A 4CN6A 3LTPA 1AH3A 2OX1A 4JIPA 3SGGA 2FTYA 1UWTA 1HZYA 4PC8A 3RRXA 1D8CA 1RHCA 4E6MA 5FL0A 2PUZA 1X7IA 3UCDA 4AISA 3CZEA 4GYPA 3CLWA 4IFRA 3KCOA 4GE8A 2JKEA 1YBQA 2YB1A 4A29A 3BLIA 1Q8JA 2FQIA 4B2DD 4YN5A 3N3MA 3TSBA 4AZBA 1KM2A 2QDEA 4AD4A 1A5AA 2IS7A 3PTDA 1BYCA 3MS8A 5D09A 4Q6JA 2VHLA 4PMVA 4GY0A 2YA1A 4A8IA 2NXGA 4H9XA 4HMDA 2R1NA 3T78A 2J7FA 1SZNA 1CXKA 4X63A 4WQ6A 2ACRA 1M53A 1GEHA 4CCCA 4XD5A 3W27A 5KINA 1GYLA 4C90A 5K2ZA 4J28A 3IWPA 5A8OA 4CD5A 1QNRA 3C0LA 4AXNA 1VLWA 2PAJA 1ESWA 3W85A 1B30A 2PTZA 3AMLA 4HZ6A 1IEQA 3M16A 2EG7A 2XN2A 2HBXA 1UWAA 3HQ1A 5DCBA 1IIGA 1DWGM 1TWIA 3L4VA 1ZP4A 2X42A 3DDMA 1UJQA 1QI4A 4EPEC 5C9RA 3RLGA 4GZEA 3ZT6A 2J24A 2W66A 1DIEA 3UR5A 1VHCA 2NX3A 2CZVA 2NLIA 3ARQA 3LCXA 1O1HA 4XG1A 1Z32X 1PIGA 4REQA 4K7YA 1XIGA 3S3GA 1VEMA 3G6LA 3H4XA 4PMRA 4OGZA 1KKRA 1VBUA 2HDJA 3W7GA 3BLEA 4GI9A 3UXDA 2HV5A 4AVNA 2F84A 1BWLA 2NW0A 1PTDA 2ABAA 1CENA 1XLEA 2Q8ZA 3L2MA 4ZB0A 4FOKA 4JEJA 2WMIB 3HFYA 3NL2A 2CBJA 3I10A 3DYPA 1G69A 1TX0A 3GG8A 4WJXA 3UJSA 2IMRA 4R88A 1DPMA 4TV6A 1OC7A 2KZHA 2G4FA 4BA0A 2A85A 2ZE3A 4QCFA 4IIHA 4UFIA 3DGRA 1A0EA 6REQA 1ZPTA 3TV8A 1EEXA 3ZM8A 1NP2A 2FZBA 4DWSB 1DE6A 2BHUA 1T7LA 4ZGYA 1EUAA 2QKFA 1U83A 4N9BA 2W63A 3OVPA 3S8HA 4TX6A 4BWLA 4JHMA 3ZVIA 3CUIA 3MZNA 1A0DA 4DBUA 3P3BA 2D0GA 1GGOA 3U2EA 1B9BA 3HBLA 1E6SM 1ZBKA 2PBGA 2E5DA 4H9UA 3BGAA 4JFWA 1V77A 3HPZA 1FWRA 2QQ6A 5CSRA 1XH2A 1UUMA 4LPCA 3KS6A 5HANA 2WZEA 1IXOA 3ISIX 3WK0A 4C6MA 1YE4A 1U5HA 5A1AA 3OIHA 4LYRA 2BG5A 3MU7A 3UPWA 1JUKA 3AMGA 3S9YA 3UWYA 1EPXA 4GXPA 1K7FA 1NJJA 5A69A 4JFUA 4LY4A 4W7VA 1XIDA 2P3EA 4H8UA 4UB9A 1YDNA 3PZOA 3ZFHA 3VNLA 3UZWA 3DBPA 2EGZA 2IKGA 1VCFA 2INZA 2YCJA 4MZ8A 2DZUA 3BQ5A 4O0ZA 3QLLA 5ECVA 3R79A 3G1AA 3SQLA 1RA0A 2GOKA 4JIEA 1ZJHA 4FOUA 3R1ZA 2E1DA 1NWUA 4UR7A 2C71A 1XDLA 1E0TA 1L8NA 4P7NA 1UP3A 2HS6A 2BVDA 1FH7A 3CT7A 1HXJA 1X7FA 1H7WA 2JE8A 3VIOA 2O9RA 1NFBA 1F4AA 3FS2A 1QOPA 3LI0A 2BOEX 4P8XA 3VKAA 5AN7A 3GVWA 4QLLA 1NY1A 4UMCA 1XG3A 2QULA 1JZ3A 3ITCA 2IKJA 3I3DA 3QQWA 4AZCB 4H6EA 2RDWA 2VX4A 3GTHA 3ITXA 4B5TA 4E4UA 4DUWA 2PWHA 2E6YA 4DJDC 2G97A 2OLAA 1C92A 3AIWA 3TOYA 4GA8A 1RVGA 2OEKA 4PUDA 2YBTA 3DUGA 1UJPA 3OLDA 3B06A 4JTRA 3CAWA 4LBUA 4A2SA 2DSVA 3AMCA 4GUJA 4K8GA 4NSBA 3ZJ6A 1YDYA 2HJPA 3G0XA 1XCXA 3QC3A 2P76A 4S3EA 1CECA 4UTUA 2R1PA 3QOMA 5E0KA 4HNCA 1OYCA 4DXXA 4LU0A 4GNVA 4F8XA 1FXQA 4CVWA 2HS8A 1P43A 3ARTA 3PJTA 3L4XA 3NAVA 4Y9OA 3W29A 1MI3A 2I9UA 3A3XA 4ACYA 1OINA 1JULA 1Q7MA 1BPLB 2CETA 3PJUA 1JZ6A 5BROA 4XVDA 4NJJA 3VIMA 1C3FA 3EWUA 2VZTA 4INFA 3TR2A 3C3NA 4YLWA 1EGVA 2GUBA 3DHDA 1R2SA 3FJLA 1QT1A 1EJ7L 3GC2A 2FB3A 3F1QA 4JTGA 3PFRA 4MSSA 4UXDA 3XINA 3HPAA 1EX5A 4DBSA 3UYCA 4DYEA 1LYXA 4OHQA 3L21A 2E67A 1MDRA 5HQLA 2WSRA 2WMKA 2Z25A 1GQKA 3NTYA 1JDEA 4GABA 2ZC1A 1CI1A 3FIGA 3BCJA 3GHSA 3V5FA 5FF0A 4G7FA 1AH4A 2ZUMA 2DZVA 4HPHA 3OGSA 4MYAA 4PMOA 1QJWA 3FDGA 4NX0A 1JRCA 4AH7A 3JW7A 3AC0A 4DLFA 4AY1A 3PUDA 3SY5A 3LA4A 5J5RA 3T40A 4GUIA 2HE5A 4DJEC 1OFDA 2HRWA 4W89A 1OZMA 4EWND 4GO9A 4TTGA 3AHTA 3ZR6A 4Z2JA 3DFTA 3NSMA 4XX6A 4EVZA 3HGSA 3VUSA 3BC9A 3LPPA 3I7QA 3WF4A 1UCWA 2ZA2A 2E1WA 4ZO8A 3KXQA 4GZ7A 3E0FA 1M7XA 5CEWA 4JQ2A 2NVAA 3MMWA 1UPPA 3I4KA 3WLRA 3QY7A 2HCVA 5REQA 3RO8A 1JPIA 2AAMA 1ALDA 3B8WA 4PMJA 1LDCA 2XZ9A 1TV3A 1JZ2A 1IGWA 1REQB 4GWEA 1TV8A 3QPZA 3EKGA 3SCVA 3O9NA 3UW6A 1J0IA 5HQEA 4CU6A 4ZL1A 3B8DA 3MI6A 4JTEA 4F9JA 3EOSA 2CIPA 1ZAHA 1Q6OA 5EL1A 2QUVA 4J3ZA 3MWAA 4HN4A 4UCFA 1SSDA 3LM7A 1ITCA 4QLJA 2OJPA 3BSMA 4AMCA 2QJHA 3DKJA 3I3BA 3RG6A 1PIIA 4GQBA 2WSPA 1B3XA 3KLKA 2QCDA 1XLGA 3TW9A 3OA3A 2CBIA 3QZEA 4H8NA 4PTWA 4QNWA 5DRIA 2Y7FA 1B3OA 4RDVA 1W91A 2C1GA 2OEMA 3AS2A 1IEWA 2REQB 5F4WA 3CV2A 4PB4A 2PDYA 2YLLA 4KT2A 2J27A 4DWSC 4N0RA 2ZA1A 3R11A 3M0VA 1CIUA 3M5YA 4ROPA 2ZXBA 4XAZA 3JVAA 3I7SA 4PMDA 1V6VA 3TXZA 4NG3A 3UCQA 3SI9A 2WXDM 2V2CA 4BF7A 1DL3A 1ZTVA 5EFFA 1BXBA 3QHMA 4HNLA 1TWWA 4O18A 1UC5A 5FD0A 3GDRA 3QZAA 3VMPA 3H6OA 4IX0A 1WX0A 4F2BA 3B4UA 4MWAB 2JKAA 3ES7A 4MFDA 3T2PA 1FDJA 2X7VA 2TPSA 3HG3A 3QTPA 3A21A 3N15A 5JIPA 3MO4A 1SZRA 5FEXA 1WP6A 2BASA 3A22A 2GYIA 4YTTA 4EPDC 5C54A 5MF5A 1J0ZA 3W7KA 1C29A 2VQTA 3LD5A 2YBVA 3G77A 4JFSA 2ASHA 4OFCA 1OFBA 3WJZA 4FS9A 1EZ2A 5A6LA 3IPWA 3QZ6A 1KBIA 2V3DA 3RX4A 3KRUA 3NXLA 3M0HA 2VGGA 2JEPA 3S1WA 4D1IA 3PJXA 4FIQA 1W3IA 3GYCA 4O4WA 5XINA 1MMFA 3NXFA 8CGTA 4OT7A 1ODZA 4B9ZA 4NUWA 4IPJA 3TQKA 3VOHA 3K2GA 3WQ8A 1QOXA 5E0CA 2QS8A 4ZBCA 3I6RA 1PUDA 2Y8UA 3IAQA 4KH2A 1FA2A 2EBNA 1TV7A 1RJRA 4IFKA 3N2OA 2FTPA 1H41A 4MNLA 2C0HA 4URIA 4NZCA 4HKPA 4WY0F 1NDYA 3VGGA 2DSKA 4R34A 1EBHA 4IMGA 4RPPA 4D6DA 3O3RA 4IJRA 2PCQA 2C1IA 4IMCA 4Q4QA 4EAYA 4HTBA 2HTMA 3IIXA 1IZKA 4B5XA 1LORA 1TO3A 3N9KA 3NL6A 4CEXC 1ONXA 1Z41A 3ZVHA 2YFNA 5ABGA 3RCYA 3HPXA 3VX0A 1AJ0A 1V8EA 3FEQA 2ZUVA 3NUKA 1E55A 3THDA 1N2VA 5C9WA 1YX1A 2QXWA 3UWWA 2OELA 3SN0A 4C6KA 3EB3A 3A64A 3UXAA 1EOKA 3V4BA 3VD9A 4AUBA 1V7AA 2E68A 3ZZ1A 4TX8A 2PP0A 4UQAA 2GGGA 3BWWA 1A3WA 2D2HA 2QV4A 4HNOA 3JUGA 3B0VC 4PODA 2J88A 1JPHA 3SCSA 1K8YA 1XWYA 3SCWA 1EJSC 4PMQA 2VOMA 3VDBA 2WWDA 4LNYA 4J3VA 2ODOA 3KUMA 1BQGA 3W76A 3LTYA 2BS9A 3FYOA 1E0VA 3ARSA 3MVTA 4C7FA 1WNOA 3B9NA 4RX0A 4S2CA 1XKYA 1XRVA 1YPIA 4WF7A 1IGSA 2NV2A 1YPXA 2PSNA 2GOUA 3R8RA 1E6ZA 3W88A 5TBOA 5FEPA 2RFGA 2WZMA 2NUWA 4MFEA 1W8SA 2YBUA 4X0NA 1NDVA 3OODA 5HNUA 1XD1A 4C6NA 3N6QA 2BY0A 3WQ6A 2A79A 4JDBA 5HULA 5EMYA 3K1GA 3O0KA 3L0NA 4MLRA 4NZFA 4KIRA 1MFUA 5FKYA 3D5HA 3P81A 1XPGA 3WFLA 4L5ZA 3SGUA 1GJUA 4YPJA 2DDXA 3AXIA 1EHNA 3EX2A 3KVJA 1NWSA 5B80A 1JAKA 5AYXA 4UFKA 3AXHA 3BJTA 4IICA 1Q8AA 3ANUA 1GW9A 1LBFA 1M04A 4XUYA 5G2IA 1F05A 1H09A 2BXYA 3G18A 3OTRA 1IZJA 4GX8A 5E70A 3M7WA 4B2DA 2TYSA 2XISA 5FOOA 3KBSA 1F6YA 3RXZA 1E0WA 2Z26A 4MOZA 2X2YA 4B4HA 1RXOB 2FHBA 1GVFA 1Q65A 3B8TA 3T81A 1UKPA 5DELA 4ICCX 1Q6CA 1NOFA 2HVNA 4Z0SA 1TJ0A 3C4UA 1TSIA 3UU0A 4I9JA 1ZSXA 4GGBA 6PTDA 4E4FA 3OZPA 1QI3A 1KA9F 3PPFA 4H4IA 1W8GA 1AW2A 3W02A 3TFXA 2CLPA 1VP5A 4OBTA 5J8LA 5K9XA 3STPA 4Q8WA 1OK6A 4EAMA 3PY2A 3EOLA 1KRAC 5EPDA 2VNCA 4UOQA 3KOXA 5CZTA 1EZWA 1JI1A 4TVUA 1WKDA 3NPUA 4IGMA 2ACUA 2OQHA 4RPQA 4ZTYA 3OZOA 4K2SA 2PRHA 3N9SA 1W17A 1QBBA 5EMJA 1EXPA 5D8WA 1E1CB 2Z1SA 5HMEA 2FVLA 4XZIA 4RUBA 1CB7B 1LL4A 1MEHA 5C71A 2ZX9A 3GBDA 3DFNA 1EYWA 3MTWA 1OCJA 1UD6A 1WZMA 3LLXA 5AHEA 4HCDA 3BVJA 2P3ZA 5I3IA 2EAWA 4E3VA 3W1LA 4ALDA 2FKPA 1ZY9A 3QKEA 3T0DA 3IAPA 4OUIA 3TQ0A 4R7OA 1FUYA 1HP5A 2V8ZA 3N6HA 4IQJA 4GUHA 3RAOA 2QVNA 2JF6A 5AHMA 4H01A 1CGWA 5CBJA 4PCTA 1UQYA 1OIFA 3TUUA 3GNRA 1YLVA 5A8NA 4JNZA 5CJ5A 4GH3A 3RPDA 5I09A 4EACA 1V08A 3AISA 3GHUA 5BXSA 1BYAA 1GVQA 4K39A 2BB0A 4XISA 2D73A 1Q7QA 3OQ8A 1ZJAA 2VC7A 3QHOA 3CPUA 3A9IA 1WDWA 3ATZA 4HU3A 1IV8A 3OVQA 4HP5A 1LLWA