3CH0A

Crystal structure of glycerophosphoryl diester phosphodiesterase (yp_677622.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
GMIQVPASFDIQGHRGCRGLLPENTIAAFTKALLLGVTTLEFDLVISKDNRVVVSHDTFFHHEITMMVDGEDVTEANEKNFNLYAMNYADIKEIDVGMKTHPRFKSQKKVPAVKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNIDHPNIALFCDLVVAEIKKAHITDRFTLQSFDVRALEYMHSQYPDIKLSYLVETKGTLKKQLEKLSFTPAVYSPDVTLVSKKDIDAAHKLGMRVIPWTVNTKEEIETLISLGVDGIITDYPDLFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphodiester phosphodiesterase
publication title Crystal structure of glycerophosphoryl diester phosphodiesterase (YP_677622.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Hydrolase
total genus 91
structure length 272
sequence length 272
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ch0A00
1DJGA 1VD6A 3EA1A 3NO3A 2ZKMX 3EA2A 1DJHA 2PLCA 3L12A 4QJ5B 4F2UA 4I90A 2PTDA 3OHMB 4RW5A 3I10A 4RV3A 1AODA 2O55A 1PTDA 3RLHA 4I9JA 2FJUB 1DJXA 2P76A 1GYMA 2F9RA 5T9CE 1DJZA 3KS5A 4GNKB 7PTDA 2OTDA 3QR0A 4F2BA 4QJ4B 5T9BG 3V16A 1ZCCA 3V18A 1V8EA 1DJYA 3H4WA 3QVQA 4F2TA 4R7OA 3RLGA 1T8QA 3V1HA 1T6MA 4I8YA 2PZ0A 3MZ2A 4S3GA 4QJ3B 1QATA 1QASA 3PTDA 2OOGA 4PTDA 6PTDA 1DJIA 2ISDA 2OR2A 4OECA 4RW3A 1O1ZA 3QR1A 1PTGA 1DJWA 3EA3A 4I9TA 1YDYA 4Q6XA 5PTDA 1XX1A 5T91A 3CH0A 3KS6A 4I9MA 3H4XA
chains in the Genus database with same CATH superfamily
1CGUA 3KUMA 3RO6A 3M5ZA 1LYXA 5EMKA 2YCLB 1IE7C 3RCYA 4GC3A 3M4HA 5A6MA 3W83A 1XI3A 1GVFA 1IWBA 3USZA 3EWCA 1ZALA 2V0TA 1A49A 1E6PA 1NQ6A 3BICA 3U2OA 1F61A 1XH0A 4S3AA 1FH7A 4UQ9A 3UWUA 3UGVA 1US3A 4DYEA 4UNIA 1VEMA 5DX7A 1RPKA 2NLYA 1XGDA 1YX1A 4H83A 3TXZA 3GDLA 1PXGA 2V2CA 4L6HA 3TJXA 4W7WA 1P7TA 3CIXA 4H8NA 1LJYA 4OE7A 1FRBA 2AQOA 3R25A 1U1UA 1RHCA 3DFQA 1M3UA 1CXEA 3BARA 2YIHA 2C79A 2A1YA 1NP2A 2A3AA 4C60A 3M6DA 5E6ZA 1TV4A 3P93A 3GC5A 3GG1A 2BOGX 5A6JA 4RE2A 2I5GA 3BSHA 2Y88A 1EYEA 2GVEA 2C1IA 2NVAA 4OZOA 2D73A 4D6IA 4AIOA 4AEEA 2OGYA 2YYTA 3CQIA 2FTWA 3CZGA 4E2BA 1EJTC 4AIUA 5CZKA 4A6GA 2J47A 1WA3A 2E40A 4IT1A 3UZYA 4QG6A 2YGYA 3O15A 1BTMA 3M0YA 2WVVA 4ACZA 1XBVA 3KBJA 1OC6A 5BU9A 3WQDA 1JPKA 3VC6A 2NV2A 2WQDA 3XIMA 3I65A 1JYVA 4BEQA 3KBMA 2VUYA 3B8DA 1YDNA 5EMUA 4F2UA 3FDGA 4ZVJA 4BI7A 3BSGA 2PTDA 4IIDA 5D38A 3DG6A 1K7EA 3T0DA 2DIKA 2WC3A 4KFOA 3VIKA 1JGIA 2AAAA 3JUGA 3G1YA 2B4GA 1A5LC 1RR2A 2PRLA 1IEIA 2AOSA 1YTKA 5CC7A 4YJ5A 1JUBA 5MKGB 3W87A 4Q4OA 4YVVA 4FB7A 3AMCA 3T1GA 3HPXA 1E6XM 5H8MA 1GQLA 1A47A 3QSTA 2PTWA 3P81A 3EOUA 4YTRA 4H9XA 3PVFA 3I7SA 2BS9A 4PCTA 1TX2A 4AMAA 1H62A 4U4MA 3XINA 3MDUA 1TPWA 2OG9A 4LRSA 4D6FA 1XLIA 3W27A 1XDJA 1O1HA 4DI8A 4QQUA 4IX0A 4ROPA 5HNNA 4LAZA 2TPSA 1PPIA 4XVEA 4EPEC 1LP6A 5DELA 3SCUA 4JTLA 1QMLA 1UW9A 3NYZA 2D2OA 5HK4A 1UPPA 3G1RA 4B9YA 2PGRA 4FLQA 1KRCC 4PB4A 1Q6LA 1VBRA 3MSRA 4D72A 4BCEA 4Z0JA 4UXDA 1BYCA 4NAEA 3CZEA 4JQ1A 3AU2A 3M0ZA 1CGTA 2EHHA 3PF3A 3GNPA 3FDKA 4KESA 2JKPA 1OYBA 4RZ4A 1QWGA 3S6DA 1G94A 1C3FA 2B7QA 1XBZA 3R11A 3SUTA 5C9ZA 2QCLA 4L5ZA 4QNWA 2QEZA 3VNYA 2PZNA 1W91A 2ZADA 3ABQA 2CW6A 1EA9C 4PMRA 1HKKA 1WYIA 4JR5A 1B4EA 3LENA 1NDVA 1FP8A 2A7RA 3AIRA 1MI3A 3T8QA 4J2MA 1CECA 4CCEA 1DJZA 2BOEX 3DGRA 1R8LA 2OYLA 1KBJA 4URIA 3LPGA 3BURA 2O9PA 1CLXA 2WZMA 2HPMA 2GJXB 2MUCA 3THCA 3HGJA 1SO3A 3CT7A 2D0HA 2ZC1A 1X96A 1TRDA 3MYOA 4HNOA 5XINA 3PBUA 3W74A 4YMZA 3CZ8A 4LAUA 4H01A 4WJXA 4FLSA 1H7PA 3OW1A 1E0WA 4IIBA 1S2AA 3GFXA 4Z1YA 3WLSA 3KWSA 3NZQA 2VHLA 1ZP3A 2RDWA 1F07A 5M03A 3PTKA 2C8NA 2PS2A 2QPUA 3UA3A 3UYCA 4UCFA 3LGGA 4FO4A 4MLJA 1WDRA 1XIBA 5HAOA 1XYBA 2XVGA 3B03A 3GRIA 4U3AA 1W3JA 3T8LA 3HPAA 2OFJA 2ALRA 1VRXA 2NV9A 4NJGA 3P7YA 2NXGA 5I00A 4BF5A 1B3YA 4Y6GA 1X7IA 3T9PA 4GIAA 4I7UA 3MCNA 4IJBA 4GABA 4R33A 1E0XA 4UR8A 4FXSA 4IMEA 5M1TA 2KX9A 1K6AA 2BY0A 1F9CA 1FUYA 1FXPA 4H8HA 1FHLA 1OCQA 1OT2A 1K9TA 3STEA 4K37A 1F6PA 3OYXA 2ASHA 4BWLA 2F38A 3BZGA 1BGGA 2C14A 1FH9A 4NF7A 2GWNA 2D20A 1C7SA 3SY1A 1N8IA 3QR1A 4GI9A 3UG5A 3OJGA 3GZ3A 1EF2A 3EEGA 1K8XA 3QKZA 4AAJA 1JDDA 4AZGA 3SI9A 2V5KA 2ACRA 4F4RA 4O1BA 4TOQA 1UQYA 2GVJA 1IYXA 4GX8A 2OZ8A 1TV2A 3F2DA 1PWLA 1NM9A 1AW2A 1C29A 4CVUA 4IWWA 1Q5MA 1W37A 2B81A 4LB3A 4XD4A 1XIDA 4AVOA 3RPTA 3WQ4A 4XSMA 3ARTA 1N82A 4DUXA 1IEQA 3O6YX 3Q58A 4P7OA 1TTQA 2VGBA 4GVIA 1BG4A 4NYUA 3TQPA 2PPGA 2PCQA 1RCQA 1YDVA 3GUGA 2JFEX 5FJPA 2QAFA 1ONRA 4EACA 3VNZA 1UBPC 1XGZA 5K3VA 3P74A 1XV8A 2PODA 2HK1A 5G5IA 2OTDA 4XAZA 1C8QA 2E5DA 2J9YA 3PNUA 3CO4A 4PTVA 1AL7A 3UNTA 4Q8UA 1TTIA 4X22A 3CIVA 3D5HA 3AIVA 1DEDA 1UR4A 2FH8A 4QBXA 5ABEA 4N6FA 3SO7A 1DQUA 1OADA 3AXIA 1AH0A 5DEZA 3N18A 5K9XA 1KGWA 4CQCA 2FGLA 4J1OA 4R3UA 1AH4A 3RILA 3LI0A 3WQ8A 3KVLA 4Y96A 5F2IA 5LA2A 1CWYA 2GJPA 1Q6CA 1VLWA 2DSKA 3W1AA 4E6MA 4EOUA 2CWNA 5CBIA 1KFLA 3F5JA 4YNGA 3MA8A 3BLOA 2WPBA 1DQWA 1OINA 2Y5SA 3L4UA 2PDMA 4OOUA 2XGZA 3EBVA 4TTGA 1ML1A 2PLJA 4WOZA 2XTKA 4E4UA 1GVEA 2E8ZA 3WNOA 2J74A 3OVQA 2OQYA 5HANA 3EWWA 1EKOA 3VGFA 1ZGDA 4GKTA 4D6EA 4DB7A 3QH2A 1DTUA 1LQ0A 2CHRA 3W23A 1KM2A 3FFSA 2VDHA 1XLCA 4PUDA 1OC7A 2WV8A 1XG3A 2NLIA 3LB0A 2A5HA 2ISVA 2Y7FA 2QF7A 3OZMA 4H6EA 4CNPA 5BXRA 2BODX 5D30A 1US0A 4A3RA 4M19A 3SW6A 3FA3A 4E3TA 4FNQA 4AW7A 1H7XA 1LROA 4AD3A 1GTEA 3H54A 5C7HA 3WQ5A 4BF7A 5MHBA 4F0MA 1MEIA 3THAA 5AVNA 4JX4A 4EF9A 1P43A 1C91A 3N13A 2YSWA 4PZVA 1FY6A 3W1TA 3UXDA 4YCPA 2WYSA 1S3TC 3BWWA 1KRAC 2PEVA 4CN1A 1U33A 4AZ6A 1XXXA 5HWNA 2OEKA 4A8RA 1W1PA 4CQDA 2E7FA 1SO4A 3WLMA 4XZIA 3LTPA 4K6AA 2JQXA 2VC7A 1RY0A 1EC9A 4IGMA 4KFPA 4RV8A 3SR7A 1CXFA 5D33A 4XD6A 1AZ1A 3NR0A 4AHOA 1V7AA 1FDJA 2PRMA 1KGUA 3K2GA 4CN4A 1KO0A 3I4EA 3W7GA 1B2YA 3IGHX 4WKAA 3UWZA 3T40A 5FKYA 1UKPA 3WLHA 4GX9A 2ZRXA 3WEMA 3NFUA 4A8IA 1BYAA 4GQ0A 4UTFA 2ZRUA 1MRQA 2FQIA 2AKZA 5DCEA 2FKPA 5F1VA 1LWHA 1OX4B 2DSZA 3QHOA 1JG9A 1OGBA 4GI8A 4J3UA 3WEOA 4BKNA 1E56A 1IXQA 4PR4A 2B7OA 2EKCA 3BMVA 5HINA 2C7FA 5LA1A 4RNJA 4UFLA 3BZJA 1RY8A 1HQTA 4MOZA 1P6CA 2Y2WA 3W1UA 3T42A 1E72M 2YBUA 1C90A 1W3IA 3CUHA 2WLZA 1HO4A 1W8GA 5BRPA 1EQPA 1A5NC 5G2WA 5LGXA 3AFBA 2E1WA 1JCTA 1B1YA 1UP2A 3S2MA 1MQRA 2WNWA 2PDUA 1SVDA 3OGVA 1E9LA 4QLKA 1MZHA 4H6KA 3E0LA 5JIWA 3RR1A 2BXVA 4Q8OA 1RH9A 4NNAA 1XP3A 3KBSA 1EDGA 4PTMA 4F0KA 1UMYA 3UZXA 4YL2A 1NDZA 1NSJA 2A21A 2C71A 1KM1A 4MFDA 1W5PA 1DWGM 4WJ8A 4YTUA 3GAKA 1HL9A 3KZSA 2NW0A 4Q33A 4KPLA 1DKWA 5AHLA 2POZA 2DSWA 3N29A 4Y2WA 3G5EA 4DWSB 4HNTA 4HJFA 3MMUA 5F2GA 1EIBA 4HK5A 3WMSA 4IUOA 2A3HA 2YDAA 4QLJA 1A3WA 2QUMA 2BWGA 3RR4A 3W84A 5JUVA 5EKYA 3Q4DA 3QQ0A 4E8GA 3OIXA 2F84A 5ECVA 1WXZA 3UESA 3I68A 1EIXA 2X1IA 5E9AA 1OT1A 1UA3A 4FF7A 1T8XA 3M5VA 1LRNA 5GNYA 4CNNA 3QR0A 2A3LA 5IHRA 2QQ6A 1XH1A 5L9FA 1I45A 2QNEA 3O8AA 4R7JA 4UR7A 4Q8MA 3TAOA 3GTIA 1R2TA 3UR8A 3CT2A 4OT7A 4B90A 2JK2A 3P67A 5D37A 3C8FA 3WBXA 4DAFA 3VOIA 2BY2A 2PBGA 3VZYA 1E5JA 1YXYA 3ZVIA 2BVWA 3CL8A 2YKKA 1C93A 1EJRC 2XN2A 3RM9A 1KCXA 1TIWA 1VS1A 4P61A 2QULA 4XB3A 4AEOA 4MFEA 3SQLA 3RPMA 3GVVA 1KM6A 3TH6A 3UG3A 2J7BA 1J18A 3C2YA 1XLDA 2CERA 2BMBA 3EB4A 2G50A 2Z1BA 2ZZ7A 5DMMA 4Q8QA 1DJGA 3RK8A 1PTAA 2GLKA 1F7BA 5CPQA 4IISA 5AHEA 3PZMA 2FHCA 2WCAA 3UXIA 7A3HA 1BSLA 4AD0A 3KP0A 3VOGA 4WJEA 3ZR4A 4FR6A 3CV7A 1XLAA 2PTXA 4B5XA 2PDXA 1LTDA 2A0NA 1UIOA 4DPPA 4U2YA 1KQZA 1I8JA 4JTGA 1CW2A 3CHCA 5I3HA 2W3ZA 2FFCA 2I7GA 1BVNP 2A79A 3EPMA 3DI0A 2UWFA 1GOWA 4UB9A 4F9DA 1Q6DA 1V02A 1A4LA 5JBDA 4L4OA 1MO0A 5H91A 1OFEA 2UV8G 1V8EA 2Z1KA 4H9TA 3W7NA 4S3FA 4JL2A 1QW9A 2PZ0A 2GSEA 4X0VA 1RCOB 1OX6A 3AALA 4V1YA 1TPDA 4O18A 3OVRA 3OBAA 1KR0A 5BMXA 1LDCA 3WFZA 1XIJA 3LBOA 3RG6A 2QW5A 1W1A1 3KOZA 1VFTA 2CITA 4IFKB 1ODUA 3BH4A 4H7VA 4MVAA 2H8ZA 4DYJA 4PEEA 2PURA 1A50A 1ADSA 5JMUA 1AW1A 1XS2A 1S2UA 3T2QA 2VZUA 4L1GA 4QLLA 4CVWA 5CZ0A 1ONWA 3IWPA 4M5PA 2VOMA 2XYLA 3USBA 4QAWA 2VDIA 2OQHA 2XGBA 4GWEA 1YLVA 3CS2A 3DERA 1LG1A 3HN3A 3THQA 1FFQA 4QGCA 2QHAA 1FWHC 2E67A 2VEFA 4H19A 3ZLFA 2DY3A 1J0KA 4MB4A 4Y9OA 1FWBC 1J0IA 5HPOA 1VP5A 3GUWA 3IJQA 4DJEC 2GVGA 2DQWA 5LNUA 2DZXA 1DWIM 5CPMA 4E2OA 1D9EA 5CJ5A 2VR5A 2YBVA 1X6UA 3ITCA 3E2QA 4BJHA 1PKLA 2PWGA 2R9RA 4PULA 3F4DA 2WBKA 4NAFA 2E9BA 5D2YA 2QCEA 1GJWA 5JIPA 3CHFA 4LS0A 1SPQA 5D9NA 2IXVA 3TR9A 2JALA 3WQPA 3DYOA 2VFIA 3KCOA 2FTPA 1H09A 1I0DA 3WD0A 1RQHA 1FWDC 3LPFA 3PBWA 2QLYA 2YPIA 2ZXDA 1B90A 3HQ1A 3K30A 3CH0A 1BXNA 3U4FA 1O7AA 5CJNA 1RPXA 4HK6A 4JNZA 4B5SA 1BWKA 1QHPA 5T8GA 4MKVA 3UZZA 2CLIA 3EXRA 3SCRA 3TOPA 4ZOCA 1HL8A 3LTSA 3WELA 4PCFA 1DIOA 1RUSA 4NX0A 4S3KA 2OVLA 2OYKA 3NNTA 1D3HA 4WGHA 6REQB 5F2LA 3L5LA 1JR1A 2BVTA 3KWXA 3ZOAA 3CUGA 4AU0A 5HR6A 4G5DA 3CNYA 4NXSA 1V3IA 4G9PA 1R30A 3LDVA 4JEQA 4TUFA 1ZJHA 4WOQA 1JULA 4US5D 2J7EA 2YJQA 2NVDA 2YLLA 3M16A 4N9BA 4I8YA 3QGKC 3QSRA 3LMZA 4MJZA 3T6CA 4S3GA 5GJNA 1ADDA 1OFQA 3VOFA 4TX8A 2ZUMA 2VFHA 3PTDA 5F4SA 2VX5A 3NQFA 4FXFA 4KCWA 3I3BA 3S5ZA 4AWSA 5CC6A 4JYFA 1UD3A 3QTGA 2A4AA 2DZSA 2DZUA 2XSXA 3CPGA 5AZ0A 4ZO7A 4KRZA 1I1WA 1XLJA 3S1UA 1TELA 1MSSA 1F2JA 3UYIA 3NVDA 4CD7A 3APYA 4LV9A 4UWMA 4I9MA 4JIEA 1KBLA 2ZKMX 1ZHAA 2QUUA 3UWWA 1EO7A 2F6KA 3SCVA 4JICA 3EB2A 3FGCB 1M1BA 3WDQA 5EBAA 3O07A 1Y0EA 4HA1A 1JCNA 3E0WA 3C8NA 4LBSA 4MKSA 4D2JA 1J11A 2G41A 4RV3A 5I3JA 3TOYA 1IR2A 5FF3A 2PLMA 1RJRA 4EXBA 4E0CA 3HIJA 4PCNA 2OZ3A 3TTSA 2D0FA 2H9AA 4BHYA 2G37A 5MKGA 4GJ1A 1PIIA 5M3WA 2JBMA 4IFOA 1LRQA 1UOZA 4JN8A 3TR2A 2VQUA 4OGZA 1XHGA 3WF4A 3NXFA 4HCLA 1E70M 1EUNA 2F6UA 2Q8XA 1B3ZA 5CSYA 4FLOA 1NWTA 3FKKA 3PM6A 1F74A 4UMCA 3ABSA 3QV7A 1QNPA 3PUEA 1X8FA 3LV6A 3EZ4A 2BGNE 3NG3A 5EMLA 4C1KA 4ACYA 1KM0A 3NDOA 4DWDA 3UBPC 4M3PA 3RRXA 2DVUA 5BOFA 3MW7A 2WHJA 4O54A 2P50A 3DECA 1PL9A 4J27A 3GVQA 3C3NA 5B80A 2QJNA 2E9MA 2VRJA 3C52A 3WQCA 1KTBA 1H7OA 1LWIA 2DIJA 1WE5A 1MXSA 1ONXA 1SM9A 1TJ1A 4W8BA 1Z48A 3ECQA 1KV5A 2VD9A 4HJWA 3B9AA 1W3HA 5EU9A 5HUOA 5A69A 1M03A 1QW7A 2CLKA 5F7UA 2HNEA 1H63A 2GSHA 3CZKA 1XRSA 3K1GA 5A2AA 1OG6A 4H41A 4GZIA 4WDTA 1R9XA 3CTTA 5H8UA 5CKSA 4XIMA 2BASA 4ORMA 3B9DA 1XYZA 2PA6A 4JAWA 3OA5A 4B4FA 3WFLA 2HPIA 4PC8A 3TQ0A 4MWAB 1R46A 4ZODA 3PZIA 3GX9A 2GJXA 3LXBA 2JGYA 1JPDX 2EPLX 1DWHM 1S39A 2ZRVA 3FVDA 2DW6A 4G1KA 3VKDA 1V3HA 1OK4A 3VE7A 5HMEA 3T2PA 3NVTA 1E6NA 2XM1A 1SZNA 4DM2A 1FWGC 4GLEA 3V5FA 3QY6A 3SIMA 4NIRA 5KEZA 2ZA3A 2QCFA 3VUSA 4KCUA 4W7VA 3PG8A 4LS2A 1R86A 3UR7A 3CWHA 4A3QA 1XWYA 5K4ZA 4GCXA 1FWSA 2C1GA 3CQHA 2RDXA 1J5TA 2BX7A 3MWAA 4XBKA 4H9MA 4XTIA 3TYUA 1XIMA 1H5VA 2BTMA 4HPXA 4IGHA 3RIKA 6XIMA 3OVPA 4CD4A 2J77A 3W7JA 1JYNA 4S3DA 1VR6A 4NNCA 2DVXA 2A3EA 3HGSA 4IMCA 4Q8VA 5FIPA 2D1ZA 1EC8A 1EO5A 4FXJA 2PAJA 2NZLA 2Y7GA 3N73A 3NL2A 3WL1A 4GPNA 3CAQA 2WKLA 5M5DA 1FWFC 3GO2A 3UWQA 3EX3A 1JZ6A 2CFFA 3H70A 2PWDA 3ZQ9A 3WLQA 3O9NA 4GIYA 4DAIA 1MEHA 2OT1A 4UTTC 3U7BA 4BA0A 3INPA 1KTCA 1FWJC 4IIEA 4ZQCA 3QVQA 5G2HA 3OPSA 4O14A 1M41A 3VNJA 1NOFA 5D04C 3WH9A 4Q4QA 1L6YA 1L8NA 1QXLA 3P2VA 2WMKA 1NFPA 3WLNA 1BF2A 3NIYA 3BW3A 3SCPA 1H7WA 4W93A 1GEHA 2ZX7A 1VZWA 5CPSA 4Q6XA 3W2MA 1PHWA 3XISA 1ZPTA 3TYBA 4LV4A 4JHOA 3TE9A 3W7PA 3EXSA 4DBEA 1IXNA 2WCGA 2XIBA 2YFNA 1F4AA 4XAYA 5C2XA 3A9BA 2CLOA 1V77A 3PFMA 2NQLA 3R4IA 1H60A 2W0UA 3C5QA 4RE3A 3AI0A 1QCWA 5CJMA 3LBMA 3OG3A 3OHMB 4ZZ9A 2VXNA 4M7SA 3M0VA 3LHUA 1TO3A 3OYZA 3E1F1 3WMBA 5M2FX 1RAKA 2JKAA 1OEPA 4ATLA 4DHGA 1ZBKA 1R2SA 4P7LA 4NASA 1SZGA 3CZJA 1O68A 3UWEA 1O12A 1MQQA 4NJIA 1DE5A 2QMKA 4HPHA 3BAKA 2HXTA 3NO5A 3DFPA 4JTHA 2PMQA 4H7CA 3W37A 3SCWA 3MZ2A 2X2GA 5D9MA 3SFKA 5FJOA 3DAQA 3GAYA 4D6CA 1NDYA 3ITGA 2QKFA 4KWUA 1JCYA 2CLPA 2DZPA 1Y5XA 1MW2A 4PMJA 4LGXA 4PSPA 4M6PA 3KFTA 3VD5A 2ZDSA 1TPFA 3G1XA 3LLXA 1JUKA 1HKVA 3DCPA 1J2BA 3S3GA 1ITUA 3VC5A 3CAWA 2QDGA 2IQDA 1HX0A 3W1XA 4LUJA 1JZ4A 1EDTA 2QDHA 2PRHA 3KBNA 4CNOA 4UNLA 1I75A 1Q6EA 1YPFA 2VC9A 3FYYA 4H9YA 3W28A 2SFPA 2FVMA 3SGGA 1EL3A 4GYJA 4KRTA 3GD6A 1J8VA 5I24A 2I5QA 2GZXA 1LWJA 1J01A 4RDVA 4NZ5A 1W32A 1XLGA 3W2NA 2R1PA 1P5BA 2H6RA 4O53A 5IM51 4M81A 3FEMA 5CGMA 1QNSA 2J7GA 1RQBA 4DIAA 3BG9A 1WKEA 1QWKA 4KGLA 3VNIA 3A6OA 3N04A 4B5VA 4LW7A 1EJWC 3U48A 3E6EA 3B4YA 4RZ5A 3PG9A 3UD6A 2BOFX 3CZLA 4UZSA 4MJMA 4FSAA 3WYZA 1XLKA 2I9EA 4V2XA 3SCOA 4C6BA 4OTKA 4DO5A 1B30A 4HQVA 3A4WA 2Z2UA 4HMDA 1XD1A 1DIEA 1NF0A 2IW0A 2BDQA 4N6EA 3DBPA 4GUIA 4K8EA 2C1HA 2QUNA 3AYSA 3NL6A 1LBFA 3NGJA 1P6BA 4ZTXA 3QY7A 5AY7A 3SM0A 1EEXA 3IIVA 1QR7A 3WMCA 1RLDA 1S1RA 1K03A 2W66A 3K5XA 4B3LA 3HJEA 3PSWA 4GXWA 3DENA 5HNUA 2WM0A 3C2OA 2WJEA 1LBMA 3S2JA 2FIQA 1B3WA 2DUAA 1TVNA 5AYYA 2RJGA 1W9XA 3WF3A 2OX4A 5AC7A 1ZBWA 4IMDA 3W4RA 4GMEA 3BLEA 1Q7QA 3SQSA 1OX4A 1ISWA 2P53A 4DZHA 5HATA 4GNKB 5AOUA 1P0DA 3NGFA 3ONBA 3PZ9A 4C5YA 3O05A 1JQVA 2E5CA 4L6OA 3NQMA 5E9XA 3QLLA 2JKEA 3QR3A 3RO8A 5LNRA 2EEXA 3V1PA 3HOJA 3F2BA 2O4MA 2O9OA 3WLTA 1C8XA 1H41A 3VMOA 2DFAA 4K1GA 3AC0A 1GVQA 5HQEA 2QCCA 4JTUA 3HFTA 1GQKA 3CMGA 1UOKA 1NQKA 3BCFA 2PU0A 1XFBA 2X1SA 1PCWA 1Z89A 2E28A 1K70A 1DXEA 2OLAA 3II1A 5AHNA 2NWRA 1R3QA 2RKXA 4IP7A 3TTQA 1U1JA 5D05A 2ISWA 5HA7A 3BLFA 2WZTA 4JN7A 3TYEA 2ZE3A 4U5KA 2FHBA 4RLIA 3ZXWA 4DWSA 4PL1A 3DGBA 4QG9A 4HNNA 3EWBX 4NUWA 2WK2A 5IDZA 3U5YA 3MPGA 1V6WA 4KEZA 3I6RA 2ZCGA 3WQVA 3FNDA 2E8YA 4W8LA 2VYOA 2FZNA 3MWCA 2CLFA 3AHXA 2DH2A 2GGGA 4NILA 1WOAA 2XH2A 4ZO8A 2ZFAA 4PODA 1W31A 2XFFA 2IKHA 3AS3A 3TN5A 1GOKA 3C56A 1CEOA 4WXZA 1BD0A 4MZ1A 2RAGA 5CGTA 3R8HA 3CHVA 1OABA 3UVAA 3VAVA 3T7VA 3BOXA 2QAPA 2BLEA 3PP7A 1QI4A 3CEPA 3E5PA 3S1WA 2BGQA 2IKJA 4Q7IA 1KV8A 3ANVA 2E1DA 3FJ4A 1GQJA 3W1PA 3BAJA 3WLOA 2IUZA 1G67A 3U9IA 2FFIA 4TV6A 3PHAA 1OF6A 1A5UA 1E40A 3TZNA 1EPXA 1FKXA 1AMKA 2IXUA 4PB5A 5A2BA 2VX6A 4XAPA 3U3HA 3PZGA 3VNKA 4DZ5A 4LCRA 3CLWA 2WKGA 1FDZA 2OLHA 4WKFA 2CBIA 3F5KA 3ANUA 4N9DA 3HMJG 1X7FA 1UCWA 1PWMA 4ZO9A 1FWAC 5DFAA 1IGSA 4H2HA 3BTNA 3WSUA 1V0LA 5F4XA 2R1MA 2O9RA 2FZBA 3LM7A 4DN1A 1R6WA 3CL7A 3S8HA 1GPWA 2HVMA 1G4TA 5CG7A 3F03K 5K2ZA 3WD3A 1QNOA 4GD0A 3TLQA 3LG3A 5G4WA 4F2BA 3ZZ1A 4US6A 4DJFC 4UMAA 5C9UA 2VCCA 1AA1B 3AHYA 4KS0A 3FOKA 2PE4A 1ADOA 3SRDA 5A3HA 4LH8A 4ORIA 2QS8A 4NRSA 2X42A 3F4NA 2GSJA 3DESA 5HQLA 3MJYA 2Y1HA 3VCCA 5BRQA 4C1NA 3HF3A 4W88A 2WVUA 4NSBA 3WQFA 3S47A 1PTGA 4KH2A 1THFD 5DANA 4IFKA 3WLIA 1OY0A 3LHVA 4Z1BA 4PFHA 2GJLA 2GQ9A 3GU1A 1QAPA 2ABBA 4R9OA 3N6QA 3DHUA 4OV9A 3AIBA 3TJLA 1RA0A 3VYLA 3BGJA 4GUGA 5HWMA 3QN3A 1JEZA 3VD7A 3DZ1A 4GY1A 4CQBA 2QIWA 4A3HA 1A0EA 4L9ZA 1ZAJA 3E0VA 4FLRA 4X9YA 3IIOA 5U4NA 3RLVA 1BSIA 1E6RA 4O57A 1RCXB 2WSYA 1ITCA 5JXQA 4DEFA 1PCKA 4KETA 2VURA 2I57A 1QI2A 2WZEA 3P3BA 5E1QA 1CB2A 3QRHA 2F9RA 2OU4A 4IJCA 3G8RA 3UEQA 3V75A 3CJPA 4PMUA 3GK0A 4KT2A 3VKCA 3B8IA 3W7HA 4JQ3A 2G8ZA 3DIPA 2J8GA 1H1NA 3W7OA 4C6JA 4TVDA 1Q8AA 4IX2A 4GC4A 4DPQA 5CSUA 4E4PA 2YFOA 1A4MA 4PUMA 3AAMA 4V27A 1V02E 3NCOA 3BE7A 2XDFA 2G96A 2IKIA 4LF2A 2FGZA 3ZJ8A 4DXXA 1OB0A 4QP0A 3AS0A 3O0FA 3CGTA 6A3HA 5I7GA 1R2RA 3W75A 4LU0A 3GXFA 2Y61A 1WZLA 3HJZA 5A2CA 4OJYA 1CTNA 2EO7A 1NP0A 1TMHA 4N0RA 2C18A 5DCDA 2QCNA 2GQ3A 2J6XA 4C90A 5I2UA 3NQAA 1VCFA 2XIJA 4FXRA 2NQJA 2VMFA 3W53A 6TAAA 4U10A 4O10A 5CZTA 3AYRA 2PCEA 3D3AA 4GI6A 4K39A 4TIMA 2XVNA 4C65A 1DHPA 1VRDA 4FOKA 3SGZA 1BLIA 1PSCA 1Z3NA 3TFXA 2XWEA 3VKJA 3TEVA 6REQA 3JW7A 3B40A 1W3NA 1EPVA 2YDRA 1H7RA 4LVAA 3ISIX 1DVJA 2EPNA 1G0CA 1XLHA 1YBQB 2OZ0A 4WRHA 3EKLA 3P82A 3AZSA 2J66A 5FF2A 3W1QA 2P0OA 4XO7A 4JDYA 4GBDA 4QIUA 2GOUA 4P7NA 5D8ZA 3VI2A 4QE5A 5G1TA 3NJ3A 1Q3NA 1FCBA 1HW6A 1SO6A 4O17A 4XAFA 3VE9A 3H24A 4UOJA 3CMJA 3VMPA 1EA0A 6PTDA 3CHEA 3MP4A 3MTWA 3W7RA 3UJ2A 3GTNA 1OFOA 3L7RA 1W56A 1JF6A 2EBNA 1F05A 3MCOA 1FA2A 4Z2IA 4N4PA 3DFTA 1VFLA 3H4XA 2X8RA 5IFTA 5REQA 2XIOA 4OOZA 5LYRA 1BKHA 1WBHA 4M6UA 1HN1A 3DHPA 3FGCA 4C6DA 4DF0A 4XKMA 1OZQA 3K4WA 1WAWA 3VPLA 1VLIA 2HXUA 1F8IA 3ME3A 3AUOA 3WD4A 1TCDA 2ZRWA 3RLHA 3UXLA 3WIJA 4NZFA 1XRFA 4RZ6A 1RV8A 1QPNA 2QUTA 3MUCA 1Z9AA 3WK0A 3W82A 4QEEA 4Y7EA 2BZNA 2A7PA 1XRTA 1UZHA 2VFDA 3SCQA 3TCEA 1MNSA 3AMKA 4JNMA 4UTUA 4F66A 1OJXA 2FJKA 1WBJA 3BL3A 1GWJA 3A47A 3F4VA 4MYAA 2V2HA 2VEMA 1XM3A 3PJUA 3LUTA 1SR0A 1WZKA 3UWYA 1H2JA 4GA8A 3M6YA 1GYNA 5CPNA 1QHZA 4PTDA 2EPMX 3ZLGA 3A3XA 3RU8X 3ITTA 3E12A 3CC1A 2XVLA 4CQAA 3AXMA 2E0PA 2VX7A 1TRIA 1ECQA 1TWSA 2EPHA 3B8SA 4GUHA 5E0FA 1B0IA 2B31A 5EA9A 1LOQA 2Z1WA 2X7WA 1W9UA 2HISA 1EX5A 3IARA 4IFRA 3FCPA 2CZDA 4MAVA 2DH3A 3A12A 3BJTA 1X38A 2ZVRA 4QFUA 2P3ZA 3C6CA 3JZEA 3OGSA 3ABRA 3N25A 1GZJA 3LEPA 1TKKA 5LIWX 2WANA 3GBDA 4HP5A 4WLCA 5ABHA 4UTWC 1UHVA 1WDDA 4WSJA 1TX0A 4MADA 1A53A 2X0YA 3EDFA 2BY1A 3R8RA 5I3KA 3APTA 4MB3A 4KEMA 3MV11 1JGMA 3KL3A 1TTPA 3HA1A 3WJZA 3M5XA 3B8WA 4PUJA 5LHEA 1U22A 1GYLA 1XUZA 4EXQA 5T9BG 3L66A 1IGWA 1XW8A 8CGTA 5BW6A 3LXCA 3ZO9A 2DP3A 1DJYA 2ONEA 1KBKA 4MWAA 3GNOA 4QS5A 1K8CA 4IG2A 5IRPA 2DIEA 3TJ4A 3RNDA 3CV1A 4QTGA 5HPCA 3W76A 1DQXA 2W79A 1F76A 2YXXA 2GUBA 3BDKA 3SUUA 3ZT6A 3Q67A 2V30A 1W9PA 3GXNA 5A8OA 3GG7A 4GY0A 2ZRYA 3HG4A 3AIQA 4UTJA 1J10A 1IV8A 4LAKA 3V5OA 1UWQA 4JTCA 4IIHA 1L6FA 3ZT7A 4CNSA 1QRQA 1UD5A 4CGTA 2O92A 3VIMA 4C7GA 5LIYX 4WY0A 5HWJA 2PDFA 2W91A 1B3XA 4H04A 1T41A 3R5EA 1F3WA 1EJVC 4O50A 4B2DD 4LNCA 5F2MA 2HRWA 3W86A 4NT0A 3BCJA 4DXKA 1QPQA 1TV5A 5LIUX 3P6LA 7ENLA 1AQMA 2Y6ZA 2ZTKA 3RJXA 1IZCA 4TQTA 2BXZA 1PKNA 1R3VA 1JI2A 5JBEA 3W26A 1SMAA 3PPHA 2J88A 2OSYA 3S2LA 1VFHA 1O94A 5G1MA 4OFCA 4FP1A 4Z2JA 4HSHA 3KTCA 4REQB 5A8GA 2Y8UA 2WMGA 1W3KA 4ECLA 1K7XA 5HJXA 3VDAA 3ICJA 1E9ZB 1TMLA 4GHRA 1MEWA 1YEYA 3VOHA 4OVXA 1ISZA 1VPQA 3GC4A 3AIWA 2GPTA 4NQ1A 5EB8A 4ICCX 2EAWA 3G18A 1P6WA 4Q32A 1S5MA 1GPFA 1BAGA 3SCTA 3KX6A 2QJHA 4X2RA 4BR1A 4B3ZA 3NA8A 4N9CA 5BXSA 1I1XA 4P2VA 3GXIA 3SN1A 2VEGA 4I3GA 1DXFA 1SO5A 1JL8A 3L4YA 4I9AA 3MKVA 1H0IA 4W5ZA 4DQWA 2I5IA 3IAPA 4MZ8A 4YN5A 4JTSA 4R27A 4GK8A 5L6UA 4HZ8A 1ZBCA 1VBHA 7REQA 1Q6QA 3F4WA 3QOMA 4GUJA 2F61A 4DJDD 3CK5A 4XZWA 1E55A 3ZJ6A 3IACA 2INEA 3EWXA 2ON3A 4LVBA 3L21A 2FYMA 1M04A 4CQ9A 3FYPA 3R12A 5DN1A 3BLLA 4P7QA 4CD5A 1J5SA 1Q4NX 1TWZA 2D0GA 4EE9A 1Y8BA 4R88A 1E71M 2YZ5A 2Z25A 5I78A 1PS9A 3H23A 3WBWA 1RD5A 4WDUA 4LRTA 4DVOA 1FXQA 1EFZA 2P8CA 3TA6A 1BYDA 3ZFHA 5AHFA 2ANUA 3IJ7A 5G1YA 2KAUC 4LVDA 2NSOA 4S3JA 3VGGA 1Q85A 1M7OA 1WAUA 2GL5A 4S3EA 3GS6A 3SQMA 2A3CA 2QXWA 1CZ1A 2V67A 3QPZA 2JEQA 3ES8A 3ARQA 3TWBA 1JYWA 3R58A 4FPSA 4O1FA 2ACQA 1UROA 2QVNA 4IGSA 4L56A 1Q7ZA 4GUFA 3DC8A 4IQJA 1QW8A 1BRLB 5K4XA 3KS6A 1TVLA 2FMOA 2OKOA 4WSHA 3BPWA 1IWAA 2V3EA 1KCZA 4AZHA 2GWGA 3K4DA 3MHFA 4LUTB 1Z7AA 5K9CA 4FNUA 4FK9A 2QGYA 3LBCA 4HZ6A 1MUWA 2OCZA 3NL3A 1OD8A 4JFWA 1T40A 2PTZA 4EAMA 4W4QA 4UTWA 5U7SA 3KRZA 4J3ZA 3G22A 3G6MA 4JTQA 3KHDA 2YCIX 4GFIA 5TF0A 2QJJA 2X1RA 1AD1A 4CNUA 4ERAA 3OLGA 1DWAM 1A0DA 2X05A 1I4NA 1SW7A 1PX3A 4QROA 4CCCA 3IJIA 5HMSA 3L4VA 4X3ZA 3TJIA 3PZUA 5FL1A 1M5WA 2TSYA 4PGLA 5EFFA 2O7SA 5DY2A 3RUBL 4LAOA 4X0NA 1ZSXA 1E4NA 5DQPA 3CHDA 1JZ2A 5TD4A 2GDQA 2VFEA 2PDYA 1JAEA 1PUDA 3EX2A 3TONA 1B5TA 5CPLA 4ZA0A 3U0HA 2ICSA 3UCCA 1IIHA 1V08A 1WKDA 4Z1DA 1N8WA 4ZE4A 1FTXA 3C2FA 1X97A 2AL2B 3IIZA 1BWVA 4JL1A 3PWIA 1K3UA 1CX9A 1W9VA 1WB0A 2IS7A 3ALGA 4XG1A 3VA8A 1D8WA 1OFAA 2JIEA 3RAOA 4QCFA 4I90A 4K7VA 4XISA 1FP9A 1ZU8A 1KW1A 1GW9A 1UH3A 4DM1A 1XBXA 1HVXA 4JTKA 1LL7A 3M41A 1B9BA 3CPUA 1SGJA 4Z1CA 1OG0A 3MU7A 1JZ5A 3V35A 3CUFA 4MB5A 1PB0A 3E0FA 1GJUA 3HM7A 1ZY9A 1PIGA 5EMMA 3WDHA 4JXCA 5JQ9A 4UTLA 1J4EA 3H7RA 1OYCA 2YCKX 2Z6IA 2GFTA 5CSSA 4DRSA 3QKEA 4AYSA 1E9IA 4PN2A 5B7YA 2DT1A 4DLFA 3SBFA 4RE0A 5CQ1A 1UASA 2X30A 3WNMA 1BQCA 4PH6A 3ZWTA 2BFGA 2XH0A 1EGZA 3WF2A 5LKYA 3E02A 4EF8A 2NX3A 1JZ7A 3AO0A 4JFUA 2QT3A 4O15A 3W9ZA 3TN4A 1UB3A 3MY9A 4LX4A 1IWPA 2X0HA 4A35A 1H1YA 3UP8A 1AD4A 2ISDA 3MSGA 3WK2A 4HBKA 1TPC1 4ZO6A 3RDKA 1ESWA 3WBYA 4DJED 4UIOA 4XBSA 5EMYA 2OSWA 3GHTA 2UY2A 4KEVA 1W1VA 3NQ7A 2WLYA 3CQKA 4PMOA 5ABFA 3FHAA 2JE8A 4Y9NA 3M0IA 1PYFA 4A3UA 4PCPA 2ZX5A 4H3DA 3RHGA 2PTYA 1K7FA 3V0TA 2VTFA 3W07A 1EJXC 3A5FA 3OVGA 4TX6A 2J24A 3WMLA 1UUQA 2IPWA 1H11A 3L4TA 1J2WA 2WHMA 3BG5A 4C6PA 1TQJA 1OZMA 3WLKX 3RFAA 4YYCA 3S0CA 3QFEA 3VDCA 4ZOEA 1MZRA 2E5BA 2RH9A 3GXPA 3K8MA 1YE4A 4BWLC 3TTEA 2H8XA 2ZQ0A 3FXGA 1HGWA 2DPEA 4HOZA 2YOCA 1RBAA 3DYPA 2ODOA 5DBTA 4AIBA 3WQWA 3B8UA 2AQVA 3GIQA 2WMFA 3IGUA 2ESCA 1W6TA 1M65A 3M47A 3FW6A 2QUVA 4AQLA 3DG7A 1V79A 2AQWA 2CZFA 5AKQA 3BQ5A 3IUDA 1ISYA 4FNSA 4BEUA 5RUBA 3RN6A 3CWNA 2HS8A 3JR2A 1GVRA 3MI6A 2AGKA 4AD4A 4ZFCA 4UCGA 1GZ1A 2H90A 3AROA 2HZGA 4ES4A 6XIAA 3VIOA 5A6LA 3VIFA 3A4JA 3L0KA 1DIDA 2VOTA 1UYQA 2INFA 3DBNA 3I4KA 3GHSA 3B9OA 4HZMA 1DJHA 2Z7GA 1OHLA 2CZEA 2Z6JA 4DBWA 3FVMA 3ZT5A 4YPJA 3YPIA 1SSGA 2PSNA 1DL3A 4YIWA 1V3MA 2RGLA 3G1HA 2JIWA 4WF7A 2YW3A 1X8CA 1RVGA 2WVVB 1TCMA 3B8VA 1W1ZA 4KRUA 1WV2A 3C61A 4F8XA 1AQHA 2Z29A 3VCNA 2EJ1A 1XKYA 3NSMA 3LN3A 2DW7A 1L6WA 4BQ3A 1JFXA 2WXDM 1WCGA 3VD4A 4O11A 3H12A 1Q6RA 3V3WA 3IJLA 1H4PA 4M0XA 3REQA 3UJFA 1YPXA 1HFBA 3VNDA 3MI3A 3W71A 5A5WA 3W7EA 1D3CA 1VEPA 1W9BM 4KFNA 1AFSA 3AZRA 4WKHA 1ELSA 3PAOA 2E25A 1WUFA 4OIFA 4QRNA 3R79A 4Z0SA 4LNYA 2NQ9A 1K9DA 4D8ZA 3KOFA 4C5ZA 1G01A 4HN8A 2G3MA 1UKOA 3G77A 3KCLA 2R24A 2RHGA 3B97A 3W3OA 1L6GA 1W1IE 2Y8VA 4P5UA 4DYKA 2XHYA 4O1AA 3W6YA 4RNHA 4K1WA 3SJ3A 2ABAA 1CGVA 3AOFA 3OBKA 4ZQMA 1R9YA 5C7VA 1XSJA 1S46A 4CCDA 3AXXA 2ZRZA 1EH9A 2V3FA 4ROQA 5G4EA 4Y9PA 4JY8A 5EYWA 1XLMA 3F2CA 3STGA 2VGFA 1K9EA 4A2SA 1F4HA 2WVTA 1W5QA 2V5DA 3PK7A 5A1AA 4TX9A 4PBFA 1BG9A 1HG3A 4RK8A 3KHJA 3TP4A 3WDRA 3ELFA 3IVUA 1HP4A 3W7CA 3LLFA 4K38A 4W86A 4N42A 1NWSA 3WJXA 1ALDA 1VFMA 2V5JA 5FEZA 3GNXA 3MANA 4QDWA 1QOXA 1YXDA 3SN0A 2PDWA 4IQEA 1PIFA 2OELA 1CGWA 5GNZA 3KVJA 4HD5A 4B15A 3GH5A 5AC6A 4AZBA 1EB3A 3MYPA 3VVGA 5CAKA 2D2JA 3RMJA 1S3HA 4J9JA 5IDIA 5XIMA 1EQCA 2Z2AA 1OIFA 2ZUTA 4GZJA 3CAKA 1RSCA 1V3JA 4JTRA 3N2MA 4UTKA 1ICSA 3GQYA 2E68A 2ACSA 4G8TA 4LB4A 3LU2A 2R94A 4QISA 3CLMA 4LOCA 3W2KA 4UOQA 1TUXA 3ARVA 3RCNA 4CN6A 2EJAA 2J4GA 1XDLA 3QHMA 1IQ8A 4LCQA 1M68A 3WJYA 1PHQA 4Z08A 1CDGA 4W85A 1U5JA 3DXIA 2WJDA 2HBXA 5D32A 3AJ7A 4IIFA 5LHFA 2VO5A 2J7HA 2LLEA 4U2ZA 1IT7A 3LSCA 4L1WA 2XZ9A 3SSZA 4GFSA 3TFCA 1YBQA 3NSNA 3DH7A 3HV9A 4PBGA 1MNZA 1FHUA 1IT0A 2E77A 3VIGA 2VWSA 2PBOA 3N9KA 3BCDA 1S2WA 1J93A 2VT0A 3M9YA 4UFJA 4LEQA 2OWXA 1J79A 4Q7BA 3QLDA 4GYPC 5HULA 2FVLA 4KGJA 1VB9A 5I3DA 1F6KA 1J0JA 2A6NA 1KBIA 4I6VA 2REQB 1JZ8A 4RW3A 3KW3A 3PZOA 1O1ZA 2Y62A 1TWWA 3WCZA 2HJPA 1Y5WA 2IMRA 3GHUA 3GVGA 4PBEA 1A5AA 2VKZG 4M6VA 4H9ZA 1ZCOA 3LNMA 1AJZA 1HT6A 4YTTA 1RK5A 3O6CA 4DLMA 5FI8A 3O2LA 4QX4A 2ISSA 3NO3A 4R53A 4D1JA 1G4SA 1BXCA 3QQ1A 3PZVA 4LC6A 2GVLA 1AZ2A 1QBAA 1CB7B 3G2GA 4LYKA 3BLKA 4QJ5B 1TR9A 3TLLA 4S2CA 1R3TA 3WNKA 3HTWA 2YR1A 4PMYA 3VOCA 3VZXA 1Q4WA 2XGIA 2XFYA 3M5YA 1G5AA 4KWOA 4QXIA 1UP3A 3UY8A 3MC5A 1PJ9A 3DOPA 4X61A 2O56A 3M0MA 1JCLA 4BQ4A 3S46A 1E0TA 2IQ0A 1EZWA 3URQA 4JBRA 2WSQA 3D0CA 3S1XA 1L6SA 2WHKA 4NY2A 2DSVA 3FN9A 3CV2A 4Q3MA 2VEKA 2YCEA 3C3UA 4RNIA 2YDSA 1J9YA 4AZCB 3W02A 3OLIA 3AXKA 1W3LA 4CEXC 1ENUA 1LQAA 1UBSA 2UY4A 3LM3A 2YL8A 5D2WA 3O6AA 1XSIA 4WR3A 5JH2A 3KLLA 4C6CA 1V6TA 1UD2A 3GNDA 4JIHA 3W6MA 5ABTA 1GG0A 5H8PA 2PDLA 3UXAA 1XX1A 1GKPA 3WDPP 3HV8A 3TUUA 3U2ZA 8A3HA 1LZOA 3LX9A 3PC0A 5A8QA 1UH4A 1AUSL 4LUSA 5SWUA 1V0KA 2YDQA 4CD8A 3RRAA 2PLCA 3EAUA 2G3FA 4ZB2A 3N4FA 3MB9A 3JRKA 4HHLA 4A3YA 3QTPA 2B7NA 1NF7A 1ZRQA 4C6LA 3SY5A 4OQVA 4AX6A 1N7KA 3QZ6A 5CBBA 3LCLA 2NX9A 1XYAA 1Y7VA 2PUZA 4J3TA 1L8PA 4D6GA 1WDWA 2OO0A 4QE1A 1B3VA 2F2KA 4KCTA 1ISVA 4RX0A 3A5VA 3UETA 1RBLA 1GNXA 2J78A 4GIRA 5CPTA 3FAXA 4QG8A 3BJFA 5I0DA 3KRSA 4ENLA 1QO2A 3KBWA 4GNVA 3UW6A 1YRRA 4L61A 3TDFA 4L4MA 5IFPA 1XDMA 3PFRA 2J75A 4UUIA 1NEYA 2VQTA 4ZBCA 1DJIA 1LRTA 9XIAA 1KLYA 4JFSA 2Z00A 1BWLA 2FGBA 1CXKA 1FCQA 1G9HA 1TV7A 1J0YA 3W22A 1J0HA 1VBUA 2PDJA 4P8WA 1XR2A 3S6TA 2XZ7A 4YVPA 2OWWA 4JQAA 1DWFM 1KXTA 2X2YA 3UZ5A 2WC4A 4UQEA 1OQFA 3B9EA 4CLMA 1QVBA 3U4AA 1R0MA 1HNYA 3IVSA 3BAWA 2VVSA 4LBUA 3BAIA 1HO1A 3WF1A 1LF1A 2CKRA 3CUZA 4XV0A 4K3ZA 3WH7A 2DT0A 2PDIA 2OKTA 3IRSA 1NWUA 1TE1A 3WBAA 3GW0A 4RPPA 3SZ8A 3HQOA 4US5A 4FZIA 3O06A 1Q65A 1V51A 3MS8A 3CWOX 3QQWA 4AFYA 1S5NA 2Z28A 3MMDA 4JTAA 1DJNA 1SU5A 3MKKA 2A7NA 2P8BA 3N11A 3WLRA 4MSSA 3NZGA 1B54A 4E5TA 1ZCCA 3V36A 3MMTA 1SJCA 5HR7A 4O4WA 1TQXA 4MKNA 1FWCC 1T6MA 4GYPA 3OP2A 3PPGA 4DUVA 1MW1A 2FH6A 3H2EA 2X40A 3O3RA 4JQ2A 3TYZA 2WNZA 2Z26A 2QZRA 2D69A 3BQ6A 4S3CA 1TG7A 5I3GA 5KMYA 5KSWA 4DO6A 3T55A 4MWAE 1KCKA 4K68A 5EY5A 3I6EA 3NPXA 1U30A 4R5EA 2P10A 4LEFA 3GKFA 1KBBA 4KWVA 3TN3A 3L0NA 3QMTA 5CSRA 1TJ2A 9CGTA 4V33A 1YYAA 4GQBA 2BVYA 2R1KA 4C6FA 1EXBA 2ZXQA 4RDYA 5CG0A 2DORA 4GYKA 2GK1A 2ZE0A 1C8YA 3A21A 3IJ9A 1EHNA 4C1LA 1VYRA 1Q66A 4NZCA 3ZVHB 2BHZA 5GJMA 4JKLA 4AZ5A 4WK9A 4UBPC 5CZJA 3IPWA 2G97A 3PPCA 1RQEA 3OHIA 1JPMA 5A6BD 2C0AA 2X16A 4Q4MA 2XIQA 3OQ8A 1NAL1 4ADTA 1DIKA 1R7OA 3TYDA 3ARYA 2E9LA 4HSOA 1J96A 3QY8A 3OZOA 3QHNA 3RM8A 1RD6A 1GVOA 3I6TA 3MBFA 3TVAA 1SZEA 3SFWA 4POCA 1UUMA 1QNRA 4PUNA 4GG9A 3IVTA 5I5RA 1BRLA 2F7FA 3TTOA 3TIMA 2Y4SA 1D8CA 2ZWYA 5DMNA 3LRKA 2TODA 2WWDA 2FLIA 3ZWSA 3VABA 4CKQA 4B5UA 2Q01A 4ZQPA 3MV01 1JQXA 3QYQA 1W9DM 4LUTA 4JHMA 1LUCA 1T7LA 4MMWA 3N6HA 4LYQA 4WSKA 4TMBA 3BAXA 3I3DA 4AWEA 3RF9A 2NUWA 3N2TA 3GVRA 3I10A 2EKGA 5K9DA 1IEXA 4JTDA 3GDKA 3RM4A 1AODA 5CC5A 3IUHA 3V4BA 2XSAA 1KFWA 2WNQA 3QF0A 3PJWA 1ITQA 3CB3A 2YXGA 4H8VA 1LBLA 4AC7C 1MUCA 4YWIA 2AL1A 4XAGA 4RXFA 3GDTA 1H61A 5FSEC 4EK7A 1VCVA 2QF8A 1KKRA 3LHYA 4INFA 2VRKA 3C4UA 3T0CA 2XPKA 3RYSA 2HEJA 3UA4A 4F0RA 2VC6A 7XIMA 1GEQA 1K4HA 1QBBA 1XPGA 3LCHA 2XVPA 1EUAA 4J28A 3SSJA 1ITXA 1UKQA 1VEOA 4HPNA 2J27A 2D22A 5AC5A 5KETA 4GISA 1JCXA 1UD6A 3G1DA 2AAMA 3Q45A 4Y9MA 1RBOB 2GGIA 3QC3A 4YLWA 2AL2A 4DJFD 2CLMA 3B3DA 3HB9A 1Z44A 1RXOB 3S1GA 3CUIA 1XSKA 4F9JA 2Y5EA 4XO6A 1JIBA 3AIEA 3ERPA 4IQDA 1TUFA 3TQVA 3DFHA 3GTXA 5DRIA 5A8MA 4FMVA 1H7NA 3QZEA 1VHCA 2PDQA 1CXLA 4Y90A 4TTUA 3TSMA 1S1PA 5A8NA 4E2VA 3RXZA 4LALA 1CYGA 1DXIA 1FWWA 3UF9A 3EDJA 1YHTA 4WDWA 2J7FA 2YB4A 2Y8KA 3FX4A 1VIWA 1TZ9A 4V28A 3SECA 4LF1A 2CXGA 1VHNA 2GQ8A 2C16A 4E8CA 1DORA 1Q63A 1VAHA 2DQXA 1KFKA 1HKJA 1IEWA 3E96A 4ZR8A 4PRRA 4ZXLA 2QJMA 3W2LA 1EGMA 2XH7A 3COTA 4GGBA 4PA8A 2A3BA 3AS1A 3MUAA 3TC3A 5TIMA 8RUCA 1BXBA 3DX5A 2YCLA 2NQHA 4ZL1A 5D9PA 3PB2A 4M80A 1XYMA 3TROA 1W54A 2G3IA 2L5HA 4ZENA 4YXGA 3B4UA 3BUVA 3M0XA 2E6DA 3MKCA 1JDFA 3FJNA 5FEPA 3GXMA 4HMNA 3HGRA 4XKYB 4A8LA 3ZR5A 3AQUA 5HJLA 4AVFA 3TN6A 4GJJA 1JCMP 4TV5A 1RJQA 4U33A 5LGZA 4D1IA 2XN1A 4L80A 5I23A 3TKFA 3WLJA 3WX7A 1KFJA 2HSAA 2RDTA 3B9NA 3MBDA 2XFRA 1LLZA 3NQGA 1MMFA 2OO6A 3UXKA 3ZYZA 3TV8A 1IHIA 3GYCA 3LV5A 3UCDA 5IBXC 1Q6OA 3POCA 1FKWA 3DFOA 5EL1A 4P7RA 4AX7A 2VEIA 3N3TA 3W01A 3UPBA 3KAOA 3SDOA 3NQBA 2VCBA 1SZFA 2F6XA 4IZGA 1QK2A 4JPGA 3NZPA 4IXHA 4HHHA 2POTA 3HBLA 4UTMA 1BYBA 4M6QA 4PMXA 5D8WA 1OGGA 1CXIA 2W67A 3WUGA 1IXOA 4J4KA 2P5NA 1T0OA 2OEJA 1TPEA 2I17A 5AYXA 4WQ6A 2PP1A 4X63A 3U57A 1B31A 1QUMA 4ONVA 2DEPA 2ZX8A 2QJGA 1Q45A 4NL1A 1HKMA 3OGRA 5PTDA 2VD8A 3W2UA 3P0XA 4LXFA 5DBUA 4IH3A 1WZMA 2C15A 1OCJA 3PPFA 2HCVA 3FEQA 1AW5A 5JH1A 1JRBA 1KQYA 1PVNA 2X1UA 4ATDA 3I7RA 4PRWA 1QPOA 3NURA 1KLZA 1QT1A 4GVHA 4UFIA 3VCRA 3BSMA 3SB0A 2ZICA 1OFDA 4AZ7A 1D7KA 2VGGA 2QV5A 3C2RA 3STPA 3LCIA 3GXDA 1Y5VA 4MPKA 3N4AA 3IS4A 4AMCA 3BW2A 4MF4A 3H2FA 4W7UA 3JS3A 3PZTA 2YW4A 3BLPX 3AHVA 3U2CA 1NARA 2V63A 4MM1A 2XISA 4AC1X 4HOWA 3ORWA 3A4AA 1EXPA 2BHUA 2H9AB 3GIPA 4O1EA 2HDJA 3GIYA 5HOSA 3L2IA 4HPJA 1ZAHA 3WQOA 2FPYA 1GOMA 1XCXA 4JFVA 5I06A 4ML4A 1VFUA 4H4IA 2OXNA 4HNVA 3P60A 3DUGA 2Q09A 3HG3A 4C91A 5HBFA 2WSRA 5AN7A 3H2CA 5C2GA 4GYFA 3UWVA 1O5KA 3UPMA 4FEZA 2CEQA 4ADUA 4MYXA 4Q4SA 1IT8A 1ZBVA 1XD0A 1FH8A 4AD2A 5FSDC 3WK3A 2BG5A 2WOQA 4GVGA 2ALDA 1M7JA 1M7PA 3L65A 1UZ1A 3CEUA 3L5MA 3JVAA 4JYEA 3T09A 1TVPA 1TZ7A 4A2RA 3ARWA 1QOPA 3DEQA 3DYMA 1AJ2A 4ZGYA 4JEJA 3P61A 3H2OA 2FJUB 4KCVA 1GOIA 2ZZ2A 1CLKA 5AYIA 2P76A 2XSBA 3VGEA 1F5ZA 4GY7A 4IUGA 1U1HA 3TNOA 3VO0A 3B0YA 1PKMA 2WJZA 3GWQA 3QGAC 4E3VA 5DXYA 4H1ZA 3MVTA 3S5YA 2HVOA 2VL4A 5FCZA 1X1OA 5A95A 3TMLA 2VM8A 2WMHA 3ID7A 4PMZA 4U31A 1TYGA 4UQDA 4V15A 3P84A 4AXKA 3RX3A 3EWDA 5EPDA 4R7OA 3MP5A 2QMJA 5G4HC 2B0MA 2VCAA 1QATA 3IJDA 3W1LA 2Z27A 1JDAA 3W29A 3CO8A 2NQ5A 4IHCA 3RX4A 2ZIDA 3N19B 3UZJA 1TTJA 4HHPA 3HURA 4HU3A 2WAGA 4IMGA 4J7RA 4S38A 5HNRA 2ZUUA 3AYTA 3FAWA 1UMLA 1K1DA 3EWUA 2Z1XA 3LD5A 4Q4PA 2FTYA 2CU0A 3F7JA 2AKMA 4B91A 3EMZA 3CV6A 4C6QA 1NTHA 1S5WA 3DKJA 2TAAA 2A2IA 2ZXAA 3B0XA 1QU4A 3A9IA 4AEFA 3T44A 2PWHA 1GQIA 1LLWA 4LCSA 3S5OA 2VEPA 4J35A 3EPNA 1JDCA 4K8GA 3HO8A 2G5WA 5G2IA 2E09A 2FDMA 3WLLA 4CD6A 1XKJA 2DDXA 3C2VA 5FJIA 1IIGA 4F40A 1EEPA 2GJNA 1Z42A 3SY8A 1ECEA 3GR8A 1YMYA 2E6AA 5IBXA 4HU8A 3CYVA 5HXMA 3KS5A 2EQDA 3MUIA 1I2QA 2YXOA 2J9XA 3ARSA 1BGAA 3P5YA 2XG9A 3WUBA 2AGTA 1MW0A 5FJRA 3BLIA 3PB0A 3G0XA 5B7ZA 1ZNNA 1MQPA 4JFTA 3W73A 4XBJA 2C6QA 3JU2A 3NQVA 1FFRA 3ZM8A 3DG3A 1E51A 2OLSA 2WO5A 3M7WA 3WN6A 3EKGA 3LA4A 3NQCA 1XYLA 3KDOA 5FL0A 2EG7A 3B06A 1UKTA 1JPIA 3KOYA 2REQA 3GM8A 3O0KA 2PD5A 4Q8TA 2O7QA 4RE4A 3DN5A 3TW6A 1OCBA 1GONA 1R9ZA 1E4LA 7TAAA 1I60A 4DWSC 3K1DA 4F0LA 1KTNA 3QYSA 3R1ZA 2PDBA 3EX1A 3PZNA 4H9VA 5E93A 3WBEA 1XQKA 3PZQA 3VIIA 3EA2A 3TSDA 1WDQA 1DJQA 2EXOA 3S42A 1P1MA 4BI6A 3VILA 3I7QA 5BMWA 1D2KA 4W87A 1KCLA 4MZYA 2I1OA 4B92A 3T08A 3LMYA 1KB3A 2Y85A 3MQTA 3VX0A 2PC4A 3AS2A 4IP4A 4A21A 1F3TA 3ITOA 1K02A 4IICA 2DUXA 3EX6A 4IQLA 1I9CB 2PB1A 2QGHA 3WNPA 2I9UA 4IOTA 9XIMA 2XH4A 4YU1A 3WDIA 3PULA 3SRKA 4WIWA 5D09A 4AUBA 4UFMA 1O95A 3KZPA 5M17A 4O52A 3AWNA 3UPWA 2XUCA 1SUXA 1V5XA 1XF0A 1TPB1 3N2BA 4F2TA 3SRHA 2DSUA 5FD0A 4GNJA 1KKOA 3A22A 4AZCA 1P0KA 1E1EA 2PDNA 2W63A 3VOJA 1EGVA 2PDCA 2G4FA 2OMAA 2DZAA 3G1AA 3H21A 3VDHA 3W70A 5LIXX 1EWEA 1RP8A 4B4HA 3L4ZA 1HL2A 3WH5A 5C6MA 1X6LA 2XM2A 4JGDA 1VC4A 2CLLA 4N7QA 1E0VA 1DHKA 1EP1A 4C6NA 4B5NA 2CHOA 3EA1A 3UG8A 3NQEA 3K46A 2AMGA 3H8AA 3KP1A 1VIZA 4FOJA 3NOYA 4UC5A 2GGEA 5HMFA 5IXEA 1XC6A 1ZZMA 1KXQA 5DY3A 3VGHA 4CCZA 3OU8A 3VFCA 1FVPA 1TV8A 4G7FA 5KZEA 2V6AA 4JKKA 3N2XA 1XLLA 3T78A 1V6UA 3NDZA 1W5OA 5EGRA 3PUDA 4QNEA 1NWRA 4QCEA 4JTTA 1E3ZA 2ZDRA 5T9CE 1ICQA 4HU4A 2QYGA 1ODZA 4S3BA 3VDGA 3EWYA 3VUPA 1K8YA 1XJBA 1HF6A 1RJPA 1ME7A 1M01A 3BW4A 3R89A 4R7WA 1ISXA 3TW9A 1QDSA 1XIFA 3E74A 3HU7A 1DV7A 3M07A 4OUIA 3PSVA 4GXMA 1E1CB 4PMDA 4G2DA 1RA5A 5LNWA 3PBYA 3QPYA 1VJIA 4MG4A 1WKFA 1R3SA 1YIXA 2D23A 4PMNA 1DJWA 3QXBA 3C0SA 3ALFA 3R8GA 4G1NA 2VC5A 4A22A 3SADA 2R91A 2C13A 4CU8A 4Q8WA 1NU5A 2PDGA 3EOOA 2A85A 1W3TA 1MDLA 4MJ4A 1I6NA 1W1B1 1HXJA 3VM5A 3RCMA 1EOKA 2D2GA 3C2EA 4U5IA 4NX5A 4Z17A 4ZEPA 3N14A 2HBVA 4H6QA 2I56A 2KZHA 3L68A 4DZIA 4H6RA 1GVYA 1EJUC 4Q4RA 4ZCWA 1AJ0A 2O55A 2J9ZA 3TNBA 1UG6A 3UNDA 1C92A 2PF0A 1UR3M 1FWEC 2B7PA 1JRCA 1PYMA 2DZTA 3LTYA 3SGUA 2VUNA 1PZ0A 5H1WA 2PDPA 5AECA 2GQAA 1KFCA 4S23A 1AK5A 1OD0A 2PDHA 1S38A 1VCGA 4HA3A 3E2SA 3IAQA 4E4FA 1ONEA 4G7EB 2W6RA 4RZBA 4GRSA 3TAKA 3P5ZA 4V1XA 1MDRA 2WKJA 1HJSA 1KM3A 5LXXA 2Y7DA 2ZUWA 3ABZA 1LLOA 4QDPA 4M51A 4IPIA 1FOBA 3NQ8A 4DJDC 4ZFMA 1I0BA 4Q8PA 1L9WA 2CYGA 4J5NA 4NI3A 4O13A 3IJ6A 5T26A 3AIUA 2GYIA 4FIRA 4IF2A 3RPDA 3AHTA 1RP9A 1R38A 3THUA 2XU2A 3URNA 5FAGA 2ZZ6A 3TX9A 4MY1A 1QPKA 3JZUA 1CNVA 1JFHA 2QV4A 4QAIA 4JN6A 3FK4A 3WZ0E 2Z4GA 3G6LA 2HNHA 4HNCA 3DFNA 3LSBA 2IPGA 5LA0A 5EFDA 3E2RA 4PUWA 4S2BA 2DT3A 4FALA 3KOXA 3W81A 1KRMA 3AUJA 4JKMA 5FEWA 5HQMA 1W2VA 3CL6A 1NDWA 1WXJA 3NAVA 1K4GA 3ARPA 1VF8A 2V3GA 1NOUA 4LY8A 2ISFA 3MT1A 4AISA 3ZVHA 3T4CA 1BTCA 3VINA 2NVCA 1WXYA 2W92A 4XX6A 4FF5A 1ZJAA 1HJVA 3G1VA 1DYSA 3SUVA 4JNYA 3Q37A 1I2OA 3IK2A 1L2UA 4I7VA 5LZLA 1X1ZA 3GFZA 3LOTA 1XYCA 3FIGA 3RLUA 3EDEA 3N15A 2OOFA 2V5CA 3OLDA 4R34A 1P4CA 2X0SA 3CQ0A 3U6WA 4JIPA 3KE0A 9RUBA 2YX0A 1JZ3A 4MY9A 3CQJA 1CENA 1GCYA 5LXEA 4PMQA 4TU1A 1BEUA 3B04A 5GNXA 2Y63A 1HKWA 3WD2A 4IPLA 1R85A 4Z1AA 3SURA 1EYWA 1LG2A 3RU6A 2X41A 3M0JA 1R87A 2XWDA 2VZVA 1K6WA 2Q71A 4HT3A 1W8SA 4DY1A 4I7WA 1GT8A 2Y89A 2Q02A 3C0JA 1KD0A 1S5TA 1ME9A 4HMCA 3KBVA 2CNCA 1JJKA 2DVTA 2OODA 3C0LA 4O8AA 4BF9A 1DOSA 2RGMA 3AICA 1VBGA 2BV9A 4C6IA 3HZ3A 4J2PA 2QPXA 5CPOA 1M9HA 4LBRA 1XIIA 2WMJA 3P80A 1E1FA 2YB1A 3WD1A 4FOUA 2PDKA 3KRBA 3H7UA 1YW1A 3T2OA 2CCRA 2CBUA 1CXHA 1JYXA 4JQ4A 2GUYA 2X1TA 4JIIX 2ATSA 5CZSA 4MPQA 2OT0A 4HIBA 3TMQA 3AMLA 4CQ8A 3AISA 2J8TA 1XCWA 4M56A 4XQ6A 1WPCA 3UCQA 3H2NA 4NZJA 3RLGA 5BOEA 5BZAA 3UZWA 5C54A 1GORA 3BOFA 5KZDA 3WLPA 3CAVA 3R6IA 2BGSA 2QCDB 1IEVA 3QW3A 1PEZA 1HJXA 1WKYA 3BV4A 4RKAA 2ZOXA 1MFVA 2A6LA 3W88A 1GTHA 4D6DA 1EWDA 3QFWA 4B2DA 1UWTA 2PWVA 1XLEA 1UZDA 1CBGA 5AYBA 1E6ZA 4QR6A 2P0IA 2PFHA 2HVNA 4GKLA 3OEXA 2PLKA 4C1NB 4MDPA 3MSYA 2ZTJA 1UA7A 2JGQA 3FY1A 3NXLA 1Q7MA 1TV3A 4L6DA 4ICNA 1KXVA 3GLCA 2PU1A 1YADA 2WPGA 4WD0A 4XZLX 1TWDA 5CGQA 4EWJA 1PZ3A 2RUSA 2FB2A 2XVKA 3SN4A 1LQ2A 3H7VA 4XSLA 4HNUA 4FNRA 4H2CA 4JD4A 3WJSA 1UPMB 1W17A 3NQ2A 3MHGA 1UWAA 3A13A 1OVDA 2NXIA 5C5YA 1A5KC 4MWAC 1LT8A 1DJXA 4ASTA 2IQTA 4HCDA 4J3SA 1FWRA 1Q13A 5GVJA 4B5WA 2ZA2A 4F3HA 3U2EA 3GH7A 4WZHA 4EWND 5BXTA 5FJUA 2GDVA 3R10A 1TIMA 1LL6A 3AMGA 3QC0A 4XZNX 1S2CA 1XLFA 3OO2A 4GGHA 2H3BA 3LHWA 2XN0A 5BWFA 4M7TA 2QCGA 2FZDA 2J7DA 1NFGA 1XIGA 4F48A 5BYWA 3MSDA 4KWWA 1E6QM 5J5RA 1UWRA 1JNEA 1P0NA 2C0HA 4ML9A 4DJDA 3OZPA 5FF0A 4OECA 3ATZA 3N12A 2C91A 2HQAA 1F73A 4DF1A 3AYVA 3ARZA 3ZLHA 5I09A 1SQ7A 3UJRA 1M7XA 2GGHA 1VFOA 2WM1A 3TYCA 4N9EA 1O4UA 1O5QA 4I6KA 2I14A 4XD3A 3APGA 1LT7A 5CC3A 5FF4A 4J3XA 4YCOA 4OWGA 4XKYA 3AZTA 2Q8ZA 3GC2A 3R94A 5C70A 5DRCA 2VGIA 1QJWA 3HPFA 4UMBA 4EKJA 3NEVA 2NX1A 1KM4A 2NXHA 3AHZA 4WHBA 5TQLA 1VJSA 3RMEA 3T07A 4E8DA 3PR2A 1G7VA 3AJXA 3R2GA 3FSTA 3VIHA 1CGXA 1TPH1 4HYRA 1FHVA 5F4WA 1UWUA 5JU6A 3OZYA 4MDOA 1OFRA 1ZENA 1A5OC 4BS0A 4EIVA 3A3HA 3TW7A 3MZNA 3LCGA 1BVWA 3M7SA 1FHDA 4LVGA 2WHLA 4TVCA 3QPEA 1YKWA 4QE4A 1Z8AA 4YWSA 1JNDA 1TREA 1V93A 3HG2A 4IPNB 2QCMA 4MGGA 3LCXA 2D3NA 1EJ7L 4ZQNA 1H1ZA 4WVXA 1LL4A 3KVMA 4AB4A 1YDOA 3IIXA 2R8WA 4KERA 1K77A 1YQ2A 1OF8A 5E09A 4XVDA 3T0BA 4PCSA 1NFBA 2OR2A 3W00A 4PSRA 2VFFA 1U2YA 1DBTA 2V2DA 2OQLA 1G4PA 2GVYA 4I9TA 3VMNA 1J0ZA 1GKRA 4LVFA 5TNVA 3KXQA 4O1CA 3BOLA 3ZSSA 4UQBA 3VGBA 2QVHA 1VD6A 5AC4A 1C9DA 3SUSA 2HV5A 2FZMA 1TPUA 2ZZ5A 3QBUA 4E38A 3SAZA 4C6EA 2BSLA 1FCVA 2ZA1A 3VDBA 2VELA 3SJNA 4Y8EA 4XWUA 4R85A 4RCXA 4MLRA 1DWJM 1XLBA 1UUOA 2EPKX 3LZ5A 4C6OA 1HTIA 4DO7A 4K2SA 2Q3OA 1POKA 5REQB 1QFEA 3BO9A 4JS3A 3N34A 1TA3B 4HVXA 3IRDA 2CBVA 3ZJ7A 3WJWA 3UJEA 1GYMA 2GGJA 2F2HA 3IGXA 3QV8A 1UD4A 4HPGA 1HJQA 4IJRA 4RL3A 4DNHA 3EXTA 2WB5A 1VYPX 1KC7A 4CNTA 2Y0FA 3UFYA 3B05A 2W9MA 1XINA 1PDZA 5IOBA 1LOSA 1UJQA 1GGOA 5GJPA 5C8BB 4P8XA 8XIMA 1V0MA 4PEKA 4D8AA 3MCMA 3W38A 4LTSA 5KZ6A 4C6KA 4YS1A 3GFYA 4LPCA 4DI9A 4RNFA 4GQGA 4MY8A 1E4MM 1NVMA 3H4GA 1DE6A 4FX8A 5I3IA 4ZQRA 2G3JA 4MNJA 4JIRA 1NJJA 3DI1A 5HUPA 3W7DA 3GBEA 4C7DA 4LSBA 3EPOA 4PMVA 5DF0A 1O5XA 1AG1O 3L0GA 4IL2A 3RX2A 4OBTA 1VGAA 4Y8FA 3TTYA 3NZ1A 1N55A 4ZOBA 3QEZA 4KBXA 3E3HA 4CUCA 3U8GA 1ZB5A 2UY3A 2CESA 4GJIA 1J6PA 2W5FA 4A8NA 3H2MA 4GE8A 1KR1A 4O12A 4NJKA 3GKAA 4E2DA 1TJPA 2NUYA 4M1RA 3UVIA 5AFDA 2HMCA 1B3OA 4HTBA 3L67A 5CAHA 3KOWA 2W4XA 1SFSA 3FJ6A 1PO9A 3L4XA 1VJZA 4ZB5A 4DJEA 5ENLA 3WO8A 1GQNA 3FYOA 5DMYA 3KLKA 1H50A 2D3LA 3NEHA 5AHIA 5BNKA 4ICMA 1OM0A 1E3XA 2OOGA 5DT5A 2CWXA 4ERGA 4K8HA 3WH8A 2YYUA 4WX2A 3MO4A 1F3EA 3IUIA 5DO8A 1RK6A 4IG2B 3DKLA 1QI5A 3PTQA 3S4TA 1V7YA 4JTFA 2GOKA 4KMQA 4AHQA 3VD9A 3ITXA 3FLUA 1REQB 1VFFA 1V6XA 3NM3A 3E38A 3LQLA 3LHZA 1GVIA 2Z2BA 4RUBA 5ECUA 3DU0A 4MHBA 1VENA 3ABOA 2WMIB 2VENA 3K8LA 5LNSA 3TZFA 3VTRA 3W25A 4HMEA 3BK0A 5AB3A 4WY0B 5KZMA 3LXAA 5C9WA 4KEUA 3K4AA 1XL9A 2DGAA 4YVXA 1V0NA 4Y9AA 2J13A 2OWCA 1FDYA 2HWGA 4FAMA 2W62A 1JXJA 3ARRA 1PAMA 1OC5A 3B0VC 3LNPA 1GKQA 4UOZA 4DBDA 4O4VA 3KEHA 4GH3A 3CXOA 2PWFA 3V18A 1F8MA 4A05A 3A64A 3GH4A 3WQEA 4P8UA 3RITA 8TIMA 1H49A 4QHRA 3UR2A 3AU6A 4LUYA 1QI0A 4YHEA 3IEBA 3T0AA 2OB3A 3NM1A 2FVKA 1DPMA 2HTMA 4LFYA 5HJYA 1C7TA 4CEUC 4N2YA 3QMSA 3FA5A 3ITLA 4WXYA 1QPRA 5FJJA 1XIHA 1YTEA 1PX8A 4EP8C 1I2NA 1GK8A 3G1FA 1SFLA 4ILSA 1R47A 1TZZA 4AD1A 4HHMA 3P14A 4ZOAA 4ZMGA 1BF6A 4QSFA 3WUEA 1KA9F 2PGEA 3PS7A 3NZRA 4DF2A 2MANA 4BQ2A 2ACUA 3P62A 1YTDA 4PTWA 3UERA 4RW5A 3FSUA 4WY0F 7REQB 2OZTA 4X60A 2DZBA 1KWGA 1FBAA 3GG8A 3H53A 3WQ6A 4LWWA 4AYGA 2V9DA 1VYSX 3EOSA 1Z69A 1JPHA 3BC9A 1UR2A 3WEZA 3SCSA 2ATMA 2UZ9A 4HA4A 4ZTYA 1QNQA 3DFYA 4BZYA 4W9TA 1XBYA 4XTDA 2QJIA 4FS9A 3MVIA 1U5VA 3SCNA 3UY7A 3FS2A 3NYDA 5HNTA 2FB3A 1HKIA 1W1YA 2O4QA 1VFSA 3URBA 2CZ5A 4NP7A 1AQ0A 3R13A 1B4KA 1XCFA 2OPJA 2Y24A 3V0UA 1MWOA 3VIPA 5BXPA 3NWRA 1E15A 1S2TA 4LC8A 7ODCA 2Y5JA 4KWSA 3E0IA 1D3GA 1OX5A 3P8IA 1Z6KA 1JDEA 4AZIA 2CXEA 2PP3A 3EMCA 4PYSA 1BFNA 3N4EA 4PFMA 1TJ0A 3LLDA 3S83A 3WG6A 3S2NA 4AY7A 4BK9A 1Q2SA 2PP0A 2V5BA 3W72A 4L9YA 3UJSA 1ZL1A 2VNCA 3N9RA 4RXGA 3S2CA 4J3WA 4HU0A 5I07A 1AMYA 3IANA 4HK7A 3EGJA 3QJAA 1FWTA 1BKSA 3NUKA 3PUGA 4RPQA 4M8UA 2PGFA 3ONCA 2BVDA 3AMDA 2CPUA 2TYSA 6TIMA 4KIRA 4MJ2A 2NT1A 4Q4KA 3Q2DA 1P0BA 3QV6A 2E6YA 3C0QA 4NYYA 3LERA 1HVQA 1QHOA 1HP5A 3V1HA 3BANA 1T5AA 5IHSA 2ZYFA 2C19A 3THDA 1Q6GA 4H8UA 5I02A 1QASA 3IK4A 1E1CA 4NJHA 2Y70A 4XK2A 1OCNA 5BRBA 1XQLA 4AD5A 4AF0B 4HA0A 1EHAA 3GE7A 3A4XA 5A6SA 1EX1A 5ABGA 3EA3A 2ZC8A 1SYTA 4JTJA 4TMCA 1JI1A 4H7ZA 2WJFA 1FWNA 4FR1A 3ES7A 1GZGA 4WUIA 4EVZA 4ZE5A 3S9YA 3ITVA 1IZJA 4B3KA 3H2AA 1KFEA 1IR1A 2PI6A 3R7MA 3EDDA 5TBOA 1DTNA 5BWAA 4LAMA 3BVJA 3HPZA 4UTHA 3BXWA 1YNPA 4O19A 2XIIA 3PBVA 3NPUA 2O0TA 4GINA 1V03A 3VGDA 3SEPA 5AVHA 1R7AA 2OJPA 4FHAA 4LJ3A 4AY8A 1UH2A 1Q6FA 1XC4A 2VFGA 1CIUA 1FWIC 3VU2A 1O6IA 1V6YA 1ZJIA 1RLCL 4O0ZA 2C3ZA 3LYEA 4HCHA 2AMXA 4Q6JA 4GIEA 1F3XA 5K7JA 2G95A 4LY4A 3V16A 1QNVA 1N2VA 1L2QA 4PTNA 4FA3A 4KKXA 1OYAA 4G7EA 4OBSA 3O1NA 1B9ZA 3EDKA 3LS9A 5C71A 3VFLA 4JCMA 3M0HA 4UTTA 7TIMA 4KW2A 3VXGA 1Q2RA 1DP0A 3GU2A 4JIQA 1W1TA 4FNTA 1W5MA 1TPVA 1UJPA 3H55A 4L65A 1XGEA 1KWKA 5DMLA 5CEWA 1OIMA 1OFPA 4OV4A 5AHMA 1Y65A 4XUYA 1KFBA 1JD7A 3L23A 4TVUA 4BFAA 2ADAA 3FXYA 2ZUNA 1GJPA 1R3YA 3S5NA 5D02A 3VD3A 1A3HA 3L12A 4U3CA 1NY1A 1Z32X 1NELA 1ZP4A 4NU7A 2CBJA 4LT9A 1EP2A 4FX6M 5ABFB 3WH6A 2UY5A 1U83A 1WDPA 5I3FA 1X6NA 3MO7A 4ZB0A 6ALDA 3MUXA 3CUJA 1W0MA 4O0KA 3BV7A 2HE8A 3CB8A 3OA3A 5BROA 3PN8A 1EOMA 3VIJA 1O60A 4K36A 1P7TB 1YNYA 5A94A 2IKGA 3M0LA 4UQAA 2VZOA 1J12A 2FDSA 2CHNA 3AXHA 4Q8NA 2VVNA 1OBAA 5E0CA 3PWGA 1H0GA 1TJRA 1UKSA 2EPOA 4RDWA 2Z7KA 4GBUA 3NPVA 4R9XA 2PGWA 4DNMA 3W1RA 2FMNA 5KTLA 3FJLA 2WQPA 3BGGA 4IMFA 5D2VA 1TWIA 1QTWA 3GR4A 4KIEA 3OQEA 4IM4A 1EJSC 3T05A 2YL9A 4HYVA 3N9SA 3CUXA 4QM1A 3ARUA 3VX1A 4EANA 3GSMA 4IMAA 1JAKA 7CGTA 4EPDC 4UFKA 3U7VA 1GHSA 3V0SA 2Q3RA 3TA9A 2EG8A 3NSXA 1MFUA 5DCBA 4ACZB 1EC7A 4OHQA 4HZ7A 3D47A 4JTEA 1WQ5A 1VKFA 1YXCA 1UQZA 3GNRA 3ZIZA 2XJ7A 4AWUA 5E6YA 2G3NA 3IGSA 3GDMA 2V3DA 1E73M 5BOOA 2FPVA 4QDMA 1M53A 2ZX9A 3M1ZA 2YLAA 1X1NA 2Q6ZA 1PTDA 3IV3A 4I9JA 4I5XA 2X09A 2ZZ4A 1IF2A 1A0CA 5A6AA 2BBFA 3T0TA 3BLDA 2GDUA 3NTYA 2P3EA 4XZBA 4M1BA 1VPYA 3R0KA 1SFTA 4UZUA 4Z2HA 3GHRA 1TR1A 4RDZA 3WF0A 4NVTA 3LY0A 1AH3A 2DZWA 2YL5A 4HYWA 5FOOA 1Z41A 1TMQA 3NOEA 1NOWA 2TRSA 4GXPA 3URAA 2G4JA 4FIQA 4ATWA 1SSDA 1UC4A 3K13A 4AIEA 1RALA 1XICA 4UR9A 3M43A 2QCDA 4XZHA 3S9ZA 2XFWA 1R3WA 8XIAA 3UU0A 1K8ZA 3REQB 2HK0A 3TQKA 2RDUA 1CGYA 3STFA 4PTXA 1ZFJA 4QITA 3VKAA 1LCOA 1AVAA 3EOEA 1R3RA 3EOLA 3CIWA 3GXTA 3L2LA 1PDYA 3GY1A 3CU2A 4NAEB 2JEPA 1ME8A 3SIZA 3PJXA 4JTIA 5DT7A 5C2CA 3MP3A 2Z24A 3OIHA 1OWQA 3W0KA 2PD9A 1A3XA 5JBFA 1XG4A 3QMRA 4PL2A 2DJLA 2F8QA 4NZ1A 2J79A 2VDGA 2ZZ3A 3WK1A 3LHTA 3I3EA 3PBMA 5H2ZA 3P0WA 4PUKA 3L5AA 2QCHA 4O0QA 2R6OA 1I2PA 4IL0A 4HN4A 1WP6A 2RFGA 1QK0A 1BQGA 1ZS2A 1MRAA 1GUVA 4QJ4B 3KL5A 1A5SA 3EEZA 3CH9A 3G8EA 4JY9A 2WCSA 3DHFA 3WFAA 1QI3A 2V82A 1YNQA 4C7FA 3MMWA 3KVKA 3N17A 3ABXA 4UQCA 2V38A 2ZVIA 3MDWA 2GJRA 2ZX6A 3WNLA 3LRMA 2WWCA 3TC6A 3UG4A 1IXPA 3LGDA 3OG2A 4Z42C 5KITA 4S1FA 4N02A 5C9RA 5H6HA 1PZ1A 4HSNA 1XYFA 1CLVA 4NNBA 3H22A 4Q7NA 2NUXA 2P88A 3HGOA 4L64A 3SRFA 4LYPA 1E6SM 2OGJA 2ZXBA 3M44A 3NQDA 5E0KA 3TC7A 1JCJA 1Q8JA 4FNPA 1E43A 3IJ8A 4PE8A 2P1FA 1W5NA 5BU6A 3R0DA 2W27A 1ZUAX 2ZBTA 4U28A 3E2VA 4JX6A 2G0WA 4GO9A 1KGXA 4L7ZA 4XUGA 5FACA 5CCZA 3D6NA 4L4LA 3N2CA 5D2TA 2PWEA 2R14A 2YA0A 4JZ5A 3G1SA 4PUUA 4ALDA 1EZ2A 2QDEA 3GNNA 4EPKA 6ENLA 1BHGA 5A6BA 3KRUA 2EGZA 3HQPA 4ZSUA 3GR7A 3TWAA 4GACA 5J04A 7PTDA 3RGTA 3HQNA 4JCLA 1AQFA 2ZUVA 4W8AA 1HZYA 4QEHA 5E70A 1AL8A 2X7VA 5JVLA 1MW3A 1LORA 1GOXA 2E3ZA 4DUWA 5CLTA 3F1QA 1TE6A 4QSHA 4IXXA 1GOQA 4UFHA 2E6FA 4DBSA 3W24A 1H3GA 2WC7A 4D71A 4JYDA 3VNMA 3ZSTA 3OLEA 3EWZA 3LRLA 4UNKA 4F79A 4F0HA 2DV0A 2R82A 3M46A 1OK6A 4L4PA 1VQTA 4M29A 5AYZA 2JF6A 4QQ3A 3VM7A 4GH1A 1JD9A 1ZLPA 4I5UA 4P8VA 5CLWA 3G0UA 4X9SA 1F6YA 4N4QA 5HDRA 4GZEA 5HMDA 3GB6A 5E5CA 4EAYA 2O9TA 3E9AA 4NG3A 1XISA 4L1XA 2INZA 4AG0A 1JUEA 2J62A 3L2MA 1PX4A 4OUEA 2CKSA 5AC8A 3AWOA 4IPJA 2RJHA 2WNNA 2MNRA 5EMJA 4ADSA 4AVNA 1GG1A 2VX4A 3D3FA 4YTSA 2PF8A 3PAJA 3VKKA 3W1NA 1TA3A 5I79A 3H6OA 2YCJA 3DDMA 4PRTA 2Z1VA 1SZRA 2VR4A 3W7QA 3OTRA 3MUZ1 4DWSD 5DXXA 4AWTA 3LGEA 3NL5A 3LQGA 3VK5A 1PBGA 3W7MA 2NQZA 1R5YA 3S1VA 3TYAA 4WDXA 3HFYA 1V3KA 3G3MA 4WEVX 3WKZA 1SFJA 4XD5A 2IPFA 2CLHA 4BQ5A 1ZQ5A 3N6JA 1SMDA 4J3VA 3OODA 4DJFA 3FHQA 1UC5A 4GZ7A 4GOAA 3VNLA 4A4AA 4NJJA 2VJXA 1EBHA 2FZ8A 2DU2A 1EP3A 2IPJA 4X2PA 3LCWA 1RZMA 4G6CA 4Z2GA 4O16A 4RR4A 4CU6A 3LK6A 1XFCA 3G0SA 3KM8A 2NWSA 5CH9A 1OGSA 2V8ZA