3CH0A

Crystal structure of glycerophosphoryl diester phosphodiesterase (yp_677622.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
GMIQVPASFDIQGHRGCRGLLPENTIAAFTKALLLGVTTLEFDLVISKDNRVVVSHDTFFHHEITMMVDGEDVTEANEKNFNLYAMNYADIKEIDVGMKTHPRFKSQKKVPAVKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNIDHPNIALFCDLVVAEIKKAHITDRFTLQSFDVRALEYMHSQYPDIKLSYLVETKGTLKKQLEKLSFTPAVYSPDVTLVSKKDIDAAHKLGMRVIPWTVNTKEEIETLISLGVDGIITDYPDLFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycerophosphoryl diester phosphodiesterase (YP_677622.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Hydrolase
molecule keywords Glycerophosphodiester phosphodiesterase
total genus 91
structure length 272
sequence length 272
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ch0A00
1QASA 3V16A 2PTDA 1AODA 1DJWA 5T9BG 3EA2A 2O55A 5PTDA 4QJ5B 2PLCA 3L12A 1PTGA 4S3GA 3H4XA 3OHMB 4QJ3B 1DJIA 4I9TA 1GYMA 4F2UA 2PZ0A 4F2BA 5T91A 2OTDA 3V18A 3KS6A 4RW5A 3EA1A 1O1ZA 1DJGA 1DJHA 1YDYA 2FJUB 3MZ2A 3CH0A 3PTDA 3QVQA 1XX1A 4OECA 3KS5A 4RV3A 1DJYA 5T9CE 1ZCCA 3V1HA 1QATA 3QR1A 3EA3A 4RW3A 1T6MA 3H4WA 4I9JA 1PTDA 3RLHA 1V8EA 4I8YA 4Q6XA 2F9RA 1T8QA 4I90A 2ISDA 2OOGA 2ZKMX 4F2TA 4R7OA 1DJXA 2P76A 3NO3A 4GNKB 4I9MA 3QR0A 1VD6A 4PTDA 7PTDA 4QJ4B 1DJZA 3RLGA 3I10A 6PTDA 2OR2A
chains in the Genus database with same CATH superfamily
2PTDA 4FIQA 2O9RA 1IXQA 1V6XA 2WW5A 3SY8A 2J77A 1E73M 2ACUA 1GPFA 2YDSA 2XN0A 4QITA 3B4UA 4NUWA 4G56A 3S2JA 3SM0A 4PTWA 3NFUA 1UR4A 3GWQA 1N8IA 2ZXAA 4P8XA 4KGJA 3JZEA 3QQ0A 5TF0A 3U4FA 3O8AA 3NM1A 2YLLA 4WEVX 1DHKA 3G0SA 3IRSA 5DN1A 2YW4A 3WLRA 3QR3A 2Z7GA 1XDMA 1KM5A 1GKRA 1RVGA 4Z2HA 5D04C 3TU9A 1MO0A 3ZJKA 3OGSA 1JPIA 3HPAA 2X8RA 1H1YA 3U3HA 2HISA 1CB2A 3GG8A 4A3UA 2F6KA 4IPIA 3EAUA 3P67A 1R7AA 4UQEA 5M03A 1IQ8A 1J0JA 2J7GA 5FJRA 1J4EA 2VVNA 4F0KA 2QUUA 1VS1A 4RE2A 2R1PA 4MLRA 2VTFA 5EA9A 4ERIA 3TTSA 4B16A 2PDQA 3CTLA 4MDOA 3TR2A 3VIGA 2BMBA 4W9TA 2CHRA 1TV7A 2GOUA 4QR6A 2D2GA 2Y63A 5D33A 2FZMA 4P5UA 5JBDA 4YNGA 3W27A 1XX1A 1UWRA 2NVCA 4JN6A 1KM6A 2QDHA 2BXVA 3N6QA 1REQB 4E2BA 5LHEA 4IUGA 1EC8A 4C1NB 4LBRA 3GXTA 4C6LA 2WHKA 3RILA 4WXZA 2JK2A 1JZ6A 4BWLC 3E2SA 4PUUA 1X8FA 5JXQA 3VABA 2BHZA 3OBKA 1XKYA 1D3HA 4JTQA 2ZWZA 1J11A 4QQ3A 4W88A 4Y9NA 4MG4A 3RPDA 4XTIA 4YXGA 4F0LA 2PDJA 1D8WA 2XH4A 4Q8UA 1OJXA 4WKAA 2E5BA 1DQWA 1QW7A 4KIEA 1T6MA 5HQEA 2NQLA 3RHGA 1KTBA 3ID7A 3LGGA 1ZP3A 3VGEA 3VD9A 1HW6A 3PC0A 1B90A 1LLZA 3LSCA 1S5TA 3TSBA 1K9EA 5DY3A 4DI9A 5DMNA 4KRTA 3V1HA 3VNYA 2VVSA 4D71A 1CGVA 1RALA 1WZLA 4J3WA 4MKVA 4AF0B 4H8UA 3DZ1A 1X98A 4B5UA 2PD5A 1B0IA 2J7EA 1FQ0A 3OLDA 5A3HA 2J7DA 3BCFA 3EB3A 1F8MA 4PMXA 3RM4A 4CGTA 1SM9A 2D0HA 1R47A 1J5SA 4XISA 2PDYA 2G0WA 5C7HA 3ZXWA 2XGZA 5G2IA 3SR7A 2YCJA 2QCDB 2RDUA 1OFRA 2GLKA 3WLMA 3AMGA 2BS9A 3CLWA 3VDAA 5AC6A 2HXUA 1TZ7A 1GQLA 3OBAA 1XDLA 4MB3A 3UXLA 4U10A 3MUY1 2PRLA 1NOFA 3UYIA 1TCDA 1JUKA 2OT1A 2HZGA 2CXEA 4PBGA 5A8MA 3BAWA 3G8EA 4A05A 4UB9A 4K8EA 5FF2A 1JGIA 5ECUA 4HNCA 4FS9A 1KM2A 2BOEX 3P2VA 3UR5A 3STEA 4H83A 2OKOA 4O1BA 4IT1A 1QPQA 3WH9A 4OT7A 4G7FA 5BXTA 4LS0A 5EY5A 4O18A 1UA3A 4HPHA 1KFEA 3O6DA 2V68A 1KKOA 2J27A 1L9WA 1R9XA 5FJPA 1UD3A 4ATLA 1NDYA 3SCWA 5IFTA 4B5VA 3F5LA 5U7SA 1ONXA 2FQIA 7REQA 1DPMA 3UBPC 4NI3A 3FJLA 2QMKA 2DV0A 1S2CA 4J28A 3RF9A 3ZWTA 3B8IA 2B7NA 2WNWA 3NSXA 3W72A 1R0MA 5DLCA 4X60A 3VNMA 3CWOX 1TB3A 1VPXA 1KC7A 3LZ3A 1EJRC 3NIYA 1H1NA 1VH7A 1ZAHA 1H49A 1GW9A 5MKGB 3Q4DA 3STPA 2C3ZA 4Q4RA 4RNJA 3PG8A 3K46A 1IV8A 5HJLA 3BMXA 1PO9A 1YIXA 2GJRA 1R2RA 3VIIA 2EXOA 1LWHA 5I3FA 2PFHA 4HZ7A 3DENA 4WJ8A 5IBXC 4LFYA 2GSEA 1KCLA 3MKVA 3SUTA 3IJ7A 3A5VA 2HPIA 4IZGA 2IPFA 3R89A 4B4HA 3CQKA 4AD5A 1WX0A 1P1MA 3ZQ9A 4H9VA 3W83A 1UG6A 3W84A 3H21A 3PWGA 3S5NA 1S2WA 2NV9A 4GMEA 2DU2A 4PMOA 3AHZA 4ZL1A 4H2HA 3ES7A 2GSHA 4J40A 3L5MA 3LLDA 2GUUA 4XD4A 1K03A 3UXDA 1BFNA 3AXHA 7CGTA 1J96A 1T0OA 1U33A 3VGFA 3UG4A 3VA8A 3TW7A 3AMLA 4ZQMA 2JFEX 5AB3A 3N3TA 1RCQA 3TC7A 2WPBA 3A9IA 4I9MA 1VCGA 3W7CA 5A6TC 4B2DD 3OU8A 3U0HA 4LVDA 3A13A 1YDNA 1B9BA 1JULA 4CEXC 3TVAA 5TD4A 4Y7EA 1IZKA 4WY0F 3UESA 1C92A 3DG7A 4D6IA 1VPYA 4ZSUA 4FLQA 5BYWA 1CGTA 1XLAA 1RXOB 3FHAA 1XIJA 4UFJA 2YCEA 1BRLA 5I3JA 2VCAA 4JTSA 2VEGA 4LW7A 4UFKA 2A79A 1YNYA 1W5OA 3TJLA 2D2HA 5HATA 1PS9A 5C2CA 4UTTA 2I17A 4HOZA 2WZHA 3ERPA 1V3KA 3AIUA 3TEVA 3GD6A 3B04A 1B57A 2V5LA 1V51A 1IGWA 1QNPA 1H4PA 3EEGA 3FS2A 4S1FA 1VBHA 1ME8A 4QISA 3G8RA 1VRXA 3AIWA 3ZYZA 1ISZA 2Y85A 1OZQA 2CBUA 2Y61A 5A2BA 2O7SA 3L66A 3VD7A 4AW7A 2YBTA 4RZ5A 1JQVA 4L1XA 3UF9A 4LXFA 4Q4PA 3MV01 1OWQA 5CSSA 1BVWA 4NI8A 4UQCA 1WOBA 1G1YA 4P7QA 4WLCA 3M0KA 4RUBA 4J5NA 4S3GA 3G3MA 2OKTA 3MDWA 4M81A 2HTMA 5HWMA 4B9ZA 1AVAA 4IIFA 3BV7A 4GH3A 2ZXDA 4ICCX 1TMHA 1A3HA 3LX9A 2ZWYA 2Z29A 4XKYA 2NSOA 1DWFM 1RCXB 4GISA 1XQKA 1JZ2A 3THQA 1ZCOA 3L4WA 4JZ5A 4XZWA 1VYSX 4MHBA 4P7RA 3CPGA 3KM8A 2QPXA 2PS2A 3DFTA 1SW0A 3AMKA 3MPGA 5MF5A 1MDLA 3T8QA 2TODA 1JJKA 3ZVHB 1MUCA 1OZMA 2DZVA 4ZVJA 3PG9A 3QQ1A 1XS2A 1K77A 3V36A 1E4NA 4M6QA 1LJYA 4JQ1A 3AXXA 4QIUA 1XSIA 3A9BA 2ZZ5A 3KFTA 3PZ9A 4U3AA 4PA8A 2F7FA 1H41A 4XX6A 1OY0A 3NCOA 3WQCA 1SVDA 4G2DA 2E9LA 3UU0A 3LB0A 1MDRA 1V6WA 1O94A 2ZCGA 3F5KA 2X41A 3R4IA 4LCRA 2YZ5A 3R12A 3LV5A 3WH7A 3LPPA 1V7AA 1Q13A 2F2HA 4DJFD 4QQUA 3UR2A 5AYYA 4Q22A 3T0BA 3VGGA 4N02A 1KBLA 4PUJA 4FEZA 3C2YA 4HNLA 5DRIA 2GGJA 1E0VA 5L6UA 4CVWA 2AKZA 3R1ZA 3SRKA 2VX7A 4HPXA 9XIAA 4PTXA 1Q4WA 4IG2B 1C7SA 4O14A 3SCNA 3KHJA 1QT1A 3TYUA 3NQ7A 1ITXA 3KUMA 3F1QA 1LWIA 2WCAA 2R14A 3OODA 4LCSA 2PP0A 5F4XA 3OZOA 4QM1A 1UZ1A 4DIAA 3ARZA 3MUAA 3UEQA 1FWJC 3S5OA 3FCPA 2EF9A 3UJ2A 1VR6A 3C3NA 3TN5A 4O0QA 2VGIA 1KRMA 1ZU8A 1VFUA 2WHJA 2YOCA 4AWTA 2Y7FA 2ADAA 4IL2A 2ACSA 2GUYA 2F38A 3C5QA 4HMCA 1O4UA 2X0HA 2EPKX 1WE5A 4D72A 4JEJA 2A21A 3H4XA 5XIMA 1GEQA 4GI8A 2WO5A 4IMEA 3EKLA 3GUGA 3T4WA 4NKCA 5LXEA 4JCLA 2FMOA 4HZMA 2C0AA 3E2VA 2KAUC 3H2EA 1IWAA 3AXKA 4GG9A 1E9IA 2PLMA 1BGGA 2DUAA 2YXOA 3P0XA 2POZA 5AFDA 4R9OA 3ZJ8A 4R34A 4AG0A 3H7UA 4WD0A 2G41A 3L67A 1UQZA 4PUNA 4CEUC 7ODCA 4WX2A 2VEFA 1VCFA 4BEUA 4Q7IA 3GU9A 5KZEA 3FY1A 1VYPX 1WYIA 2A4AA 4L9ZA 1JF6A 5REQB 3MS8A 2UWFA 3REQA 3WH6A 1WO2A 2V5JA 3AALA 3FNDA 1W6TA 4MWAB 3ANYA 2VC6A 3WDPP 2VC7A 3W1PA 1HJWA 2VFDA 3K4WA 3LXAA 5BXRA 3R2GA 4GY0A 4UTIA 1V03A 3DCPA 4XIAA 1ML1A 1DWJM 1FA2A 1R9YA 2NUYA 1YHTA 1AZ1A 1NH6A 3W7RA 1YPXA 2CZ5A 3WENA 2VEIA 1W1IE 5HULA 4W8LA 1PIGA 5K9DA 5G1YA 4GXMA 5H1WA 3WFLA 1F73A 4PN2A 1WDDA 4K39A 3K2GA 4G8TA 1B3XA 1FWRA 1FVPA 1WP6A 4BY3A 3LY0A 1YXCA 3W4RA 1TJ1A 4DBEA 4C6PA 1P6WA 1LYXA 4DZIA 2AL1A 4YTQA 4WKFA 2PDLA 1Z8AA 1VGAA 1H51A 5DY2A 4C7DA 1JCYA 1CGXA 3SO7A 2A7RA 4GQBA 2E40A 2WZEA 4MJ2A 2XHYA 3QKZA 3A3HA 4NVTA 2YKKA 5FEPA 4ZEPA 5F2GA 1XD1A 1MQPA 4DEFA 3L21A 3GDRA 3IIPA 2Z1KA 1H50A 4O17A 3HPZA 1CLKA 3UQNA 4IFRA 5BU6A 1EPVA 3LHWA 4CKQA 4DPQA 3WD2A 3ZFHA 2Y24A 2OXNA 2NQ5A 5JIWA 2PDMA 4LNCA 2ZUUA 1FBAA 3KBVA 1M7OA 3P81A 3OVGA 2OWCA 1GPWA 3L4UA 1IWBA 3E2QA 3DESA 1TKKA 2J74A 1EBGA 3BJFA 3GDTA 1ZJIA 3NVDA 2DY3A 1Q6DA 2XWDA 4QLLA 4CNOA 3WIJA 3ZJ6A 2VUNA 1ZP4A 1W2PA 3BAXA 1PDYA 2QCLA 5AYZA 3S46A 1J12A 3FJ6A 1JYWA 2Z2AA 3W2NA 4QG8A 4GIAA 2YLAA 1QHZA 3O6CA 4BHYA 2PDFA 3BGAA 3IJDA 2FVLA 1QWGA 3CUIA 3TJ4A 1K7XA 4AZIA 4H04A 3HBLA 4ZB0A 5AC5A 4H8HA 4MB4A 3WQGA 4RCXA 3AIQA 5BOEA 4L56A 3KWXA 4I8YA 2PBGA 1ONRA 2IKIA 4PGLA 1QASA 3GNXA 3RO6A 2OGJA 2IXUA 2R1NA 1TIWA 2QV4A 1IXNA 3LZ5A 5FEZA 3O63A 4F2UA 3V18A 4FX7A 4Z0SA 3UETA 3N9SA 4JDYA 1BYAA 5A8NA 1A0EA 3GTNA 1NAL1 1MEWA 2R1LA 3W0KA 4XD3A 3DDMA 1ZHAA 2QV5A 2V69A 4TR9A 1WDWA 2QCEA 4HHPA 3VZYA 3A47A 3LI1A 4LUIA 4QSHA 3R0DA 4W7VA 3SCSA 1MUMA 3NYDA 2R8WA 3SBFA 3QJAA 4AZ6A 1NVMA 5T8GA 4OQVA 4OTKA 5JMUA 3CU2A 3UZJA 3K30A 4R27A 2CC0A 3H12A 3IJIA 3DKJA 6TAAA 1TWSA 2REQB 3LCIA 2DZAA 3LHUA 2X2YA 2YGYA 4JAWA 3N2CA 3ITGA 4MY9A 4FA3A 3ALFA 4CD8A 3K8LA 1OFAA 2DZWA 4MWAE 2F84A 4MB1A 3U2EA 2F2KA 2DZPA 2TYSA 2E5CA 4Z0JA 1BD0A 1MZRA 1MW1A 3APTA 1ZY9A 1DJXA 1BEUA 4RZ6A 4FNPA 3CK5A 1P48A 2BASA 4NJGA 4ZR8A 4DF1A 3WQ5A 4NRSA 3KRBA 1DVJA 3NSNA 2Q8ZA 1F05A 3WF1A 1W3IA 5I77A 2PDUA 3AWOA 3LCXA 4KCTA 2VUYA 4IP5A 4C6MA 5C9ZA 1LLWA 3A3XA 2TRSA 2D22A 1E56A 1GW1A 4W89A 3TMLA 5HQLA 1GG1A 3ARUA 4UR7A 1TELA 3WO8A 3PUGA 3LDVA 5I7GA 2CKSA 3CBWA 3GFXA 5D37A 3DFOA 2X1RA 2ZC1A 4RDZA 3GNPA 3BG9A 4Q8TA 5D03A 1XKJA 3VDCA 3A3WA 3UT0A 1MI3A 4JIIX 4K7VA 4Y6GA 1VBRA 3LI0A 4GNJA 4BR1A 4PB4A 2GVLA 4QLJA 4W86A 4FXJA 4ROQA 4HPNA 4FSAA 4HJWA 4HYRA 3EDEA 4O1CA 3CUGA 2NQHA 3U6WA 1NWSA 2AAMA 4K8HA 4GPNA 3CO4A 3B8DA 4PSPA 1OT1A 3HFYA 4RXGA 4DJFC 4CD5A 1BTMA 1A5BA 2CETA 4A8RA 5DXXA 3B8WA 3QSTA 1AJ2A 2CBVA 3WDIA 3EKZA 1VAHA 3VKDA 4G9PA 5KINA 3OVRA 1SFSA 1RQHA 1AK5A 3GY1A 3D3FA 1R38A 1X38A 1IEXA 2BY2A 4AWUA 4Q8WA 3GZ3A 3AMDA 2A5HA 3JZUA 4PZVA 4JBRA 3MQTA 4NSBA 4ZFCA 2DIEA 1UWIA 3DYPA 5K9XA 5LNWA 2VEKA 1RBAA 1W1A1 3OYXA 3R13A 3KOXA 4DXXA 3KRSA 3MMTA 3O06A 4BQ3A 2W91A 1L8PA 4PTNA 3LERA 1OK6A 2Q8XA 3LLFA 1SZEA 2QS8A 5D05A 4M7SA 2CLIA 4UBPC 1UC5A 4ZO6A 2C14A 3MMWA 5A8GA 3W9ZA 2PWUA 3V5OA 3W7QA 1X1ZA 5H8UA 5E9AA 2Z1XA 5AHLA 4ZB5A 1E9YB 4JKKA 1JYVA 1MWOA 1OC5A 3FXYA 3VXGA 1JZ7A 4GVFA 1PKLA 4RV8A 3AS3A 3QN3A 2XN1A 4JFSA 4X9SA 1XP3A 3AUOA 4TXEA 3OLEA 1KFWA 1XRVA 3WBAA 4NZ1A 2GDQA 3EPMA 2VRQA 5I3HA 3FLUA 4Q7NA 2E67A 4PMDA 3WLPA 4DVOA 5GJMA 4IPNB 3WQFA 1QOQA 2WZTA 5HNRA 4GUGA 4NNAA 1W32A 2BZNA 1GQJA 1BSIA 5EMYA 1QNOA 4GGHA 1DJNA 1L6SA 3TNOA 2TSYA 4GK8A 5HR6A 2E9MA 5DEZA 2E1WA 4IMFA 4WIWA 2TMDA 3G3DA 1C8VA 2VELA 3GYCA 5EFDA 3N9RA 4ZOEA 1OFPA 2EPOA 1HUVA 2D2OA 4UFLA 3GBDA 4UTHA 5IOBA 2W0UA 2XSXA 3H2CA 2DJXA 3QPYA 1EYEA 3GDKA 4JCMA 3NXFA 3SQSA 2VMFA 1XLLA 1ITCA 2C0HA 1XLIA 4TU1A 4AUBA 4WGHA 4IQLA 2ZXBA 2ZX5A 3CUZA 3ANVA 3GG0A 3CUHA 3ABOA 3DUGA 4C60A 1V6VA 4I8DA 3DGBA 2ZX8A 1YE4A 3MKKA 3EXSA 3QM3A 3M9YA 4FXSA 3A22A 5FKYA 4REQA 4JIRA 1P7TA 1T5AA 3W01A 5EB8A 5I07A 4MNKA 1KCZA 4P8WA 3COTA 3R8GA 3GK0A 5EFFA 2D73A 1VIWA 3CHDA 3SECA 3FXGA 1FUYA 3WSUA 5C71A 2WVUA 1J0YA 1I2RA 2XUCA 3LMYA 4GBDA 3LUTA 2GFTA 1I2PA 3PZOA 3L5LA 3W86A 2WVVA 5CQ1A 2XIQA 4O53A 2E68A 1UOZA 4GA8A 4YCPA 4HU8A 4B9YA 4MPQA 4QGCA 3N3MA 3RYSA 2HK1A 3PBMA 4NT0A 2P3ZA 4WRHA 3GR7A 3VUPA 3W29A 3UY8A 1DWAM 4ZE4A 1PCKA 2HE5A 4ILSA 5CZKA 1XRTA 2CLOA 3CZKA 4L6OA 4GCXA 1Z89A 1G94A 3IGHX 4UR8A 1FTXA 5CC6A 5TAOA 3CGTA 4JFUA 4MPKA 1HL2A 3QRHA 4P8UA 1KBJA 1HJSA 2CNCA 3QR0A 1K4HA 4AWEA 1US2A 5U4NA 1DTNA 1G67A 3VMOA 1E5JA 1C7TA 1G4TA 3P6LA 4DM2A 1X39A 3W73A 3NQVA 1N55A 1K9DA 2VI0A 2OG9A 3SRFA 1M65A 1TA3B 2DEPA 4IFKA 1EGVA 3OBEA 2O9TA 3GR8A 4Y90A 3UYCA 4CU6A 1Z69A 4XIMA 3MHGA 2VWSA 9CGTA 5AYBA 1JRCA 4FMVA 3GTIA 3B9EA 1SYTA 2F6UA 4GI6A 3GDBA 5GJNA 3EDDA 5C6MA 1RP8A 2PRMA 1Q85A 1HO4A 2PGWA 1BQCA 4XVEA 4FX8A 4CD6A 1SO6A 1LT8A 2X1UA 3UP8A 1Q6CA 4FR1A 4PUMA 3ZLGA 3PB0A 1UMYA 4O4VA 3R0KA 2BGQA 3U5YA 1FHUA 2J9YA 5C9WA 5JH1A 1XLJA 3CHCA 3CEPA 4JTAA 4O12A 4AWSA 4HKPA 4JY8A 3E3HA 4YHGA 3S47A 3E0VA 1EJTC 2DIJA 4CQAA 4UCGA 4WDTA 1W8SA 2G95A 5E9XA 2JQXA 4WY0A 2XPKA 4K8GA 4W87A 1NP0A 2Y6ZA 4JQ3A 1B4KA 1PKMA 3WK3A 1AD4A 5C9XA 1JAEA 3H2OA 3M41A 4IX0A 4IFOA 1PHWA 2C13A 2Z26A 1NWRA 4ZOBA 1NARA 3WJZA 1LLOA 5IHSA 3POCA 3WJSA 1G5AA 4ICMA 2GVYA 4H8VA 5CG0A 1F5ZA 1EO5A 2QUVA 1D3CA 2PZNA 1AZ2A 1OIFA 1MW0A 3C52A 3G6MA 1R3SA 3LCGA 2RGLA 3KW3A 1XFBA 4G6CA 5LA2A 1GOIA 4YTUA 1BQGA 3RU8X 1VFLA 3QFWA 1FWHC 3WK1A 1UB3A 3TN4A 4J9JA 4AD4A 1Q7QA 2EHHA 3R8HA 4NP7A 1QTWA 2Z2BA 5I3GA 3MBDA 4N9DA 3UZYA 1LP6A 3SCVA 3U7VA 4NAFA 4HJFA 4XBKA 3VC5A 1YNQA 2HK0A 4PL1A 3OJGA 1E6RA 2BHYA 4FOKA 1ZJHA 5HK4A 1XF0A 1UOKA 3MYPA 1LOQA 4GKLA 2ZZ1A 4KBXA 3N18A 3M5XA 4AD2A 4GUFA 1XI3A 1YXDA 5AYXA 2XISA 1J9YA 2D1ZA 3LHVA 3DHUA 3EPNA 1MW2A 1TR9A 4IPLA 1ISWA 3LN3A 1HVQA 2PDPA 3U4AA 3TQKA 2YBVA 3W1RA 3A5FA 4ACZA 4HQVA 2NW0A 1J18A 5F1VA 2ZFAA 3E02A 1WCGA 4IQDA 2YA2A 3NSMA 3BLEA 3CZEA 3T81A 4W85A 1R46A 3B4YA 4IOTA 1ADDA 1BKSA 4NYUA 3TFXA 4B92A 2YCIX 2WCGA 2QNEA 1FHVA 1ZTVA 3W1LA 3ZJ7A 4K2SA 5BRBA 1N8WA 4FZIA 4Z1BA 4KWVA 1LORA 1IEQA 2OX4A 2LLEA 3UJFA 3PWIA 3AS2A 2PDWA 4ZQCA 2NUXA 3OZMA 2H9AA 1KO0A 4CNUA 3NVTA 3PULA 2OJPA 4AYGA 2QAFA 1C91A 2DH2A 3QR1A 1KGXA 2OELA 4LC8A 1R3YA 1EXBA 5K2ZA 3S4TA 3ISIX 4P61A 5LGXA 1CX9A 5I24A 3L12A 2PRHA 5FI8A 1B30A 5ENLA 3H7VA 3RG6A 3F4VA 2D0GA 4LJ3A 1KV5A 1I8JA 1XFCA 1XW8A 3O16A 1UWAA 4I7UA 1QNRA 3AXIA 3NQ6A 4XO6A 1IZJA 1XWYA 1SU5A 5CC3A 2JEQA 3TYEA 2GDVA 4O0ZA 2VFHA 3TYAA 3MVIA 3NEHA 4I5UA 3UNDA 4DBUA 1EQPA 1TV3A 3RITA 4AVNA 5D9PA 1T8XA 1JZ3A 3NQAA 4I90A 1GQNA 4L9XA 3O15A 4OVXA 1UH3A 1JAKA 3N13A 3VNZA 5H8PA 1K6AA 2EPNA 2O4QA 1K1DA 1AUSL 1CYGA 2OLSA 3M0HA 1BTCA 1HQTA 6ENLA 1J10A 4KH2A 3P62A 3T09A 2FTYA 4S3FA 4DN1A 1F76A 2Z6JA 3HJEA 1EDGA 3VU2A 2IKGA 3S1UA 1G7VA 1LQAA 4NXSA 3KTSA 4KEVA 4G5DA 3GG1A 2PWGA 3BUVA 2FKPA 3WNNA 1FFRA 4LS1A 2DZUA 3EMQA 3T2QA 4AZGA 2WKGA 2YXGA 1E6XM 2QCNA 1EYWA 1EO7A 4RR4A 4E4PA 3C0LA 2XFFA 2JGQA 4GWEA 3S2CA 3ARRA 4JGDA 1JL8A 1X7FA 4W8AA 3QYQA 3UD6A 4DJDA 2RHGA 1MQQA 2VL4A 5A6BA 2IKHA 1CZ1A 3ZS4A 2BVWA 3V1PA 4REQB 4E6MA 1PIIA 2XIOA 3VM7A 2YIHA 3P74A 3B0XA 1W9DM 6REQA 3TWBA 2WXDM 3CV1A 1LOSA 3NTYA 4GZ7A 2C6QA 5EMKA 3W1XA 1VP5A 3M43A 4IHCA 3HG2A 4JXCA 5G5IA 3TMQA 4LUYA 1V0LA 3M4HA 3VD3A 3GXMA 1VC4A 3TX9A 7XIMA 2FPTA 2Q09A 4TVUA 3MSYA 4XTDA 3IK4A 5G1MA 4Z1DA 1FCVA 2I1OA 3RGTA 4Q4OA 1GHSA 5IDZA 2JBMA 4KCUA 3S1WA 3GNDA 5FAGA 3IS4A 4LUTB 1SSDA 3BW4A 4M6VA 3KBSA 2P53A 1D8CA 1EOMA 1E70M 2Z27A 4J4KA 2AKMA 1K7EA 1L6GA 1J2WA 4E2VA 3QTPA 4TQTA 4UCFA 1JR1A 2O7QA 3UXKA 3VIJA 3W7MA 1JZ4A 2IW0A 1YADA 3BJTA 3MYOA 1XH0A 2V81A 1QNSA 3I7QA 3G1FA 2XH2A 3WBYA 3JS3A 3T0DA 3PM6A 4ZOCA 3S9YA 3FGCA 3PBGA 1R3WA 2BOGX 3WY1A 2PPGA 1BPLB 2A2IA 1CECA 3TLQA 3QGKC 1QK2A 1E6SM 1JCXA 1BRLB 3L4TA 3AUJA 1S2TA 4DJDD 2R94A 1XLCA 1E0WA 2WANA 2V38A 3AIVA 1O12A 1JF5A 1DYSA 4U4MA 1UZHA 4DHGA 3NPVA 3NQDA 2V5DA 2E6DA 3C2EA 4PCFA 4W84A 3GXIA 1Q45A 3EWCA 2Z00A 3U2CA 3DEQA 5I3KA 1PYMA 4PMUA 1JFXA 4UTMA 4PTVA 3NL6A 4AVFA 4F48A 1OFEA 3E49A 3DFSA 3VGDA 3C2RA 1UKOA 4TVDA 4ATDA 1P5BA 2ZZ4A 4PCTA 2W62A 3GSMA 1TREA 4YWSA 2YCKX 5AHFA 1QK0A 3W7IA 4Q8MA 3MMUA 3W1UA 1PBGA 5G2WA 3BQ5A 4XZ9A 3GNRA 5BOOA 3WJXA 1C9DA 1XIMA 1ZLPA 5BMWA 4AY8A 1AFSA 4V1XA 1KTNA 1NWTA 1YE6A 2R1KA 3HU7A 3ZOAA 1GTHA 1BXBA 1SJBA 1VLIA 4NJHA 4Z08A 4B5WA 3EMZA 3RX4A 1XC4A 1OBAA 2C71A 3ICJA 5H6HA 1IEVA 4W7WA 2V5BA 5CZJA 1VHNA 2PBOA 3NO1A 2FJKA 2HCVA 3STCA 1VJSA 2VZVA 2NX1A 2PZ0A 1PWMA 1KV8A 5D38A 4DAIA 1VBUA 1UD2A 2ZZ2A 1HJXA 3LNMA 2X42A 4C6QA 3BLIA 3DERA 3WUBA 4LT9A 5I06A 1RPXA 3NQFA 5JBFA 2PWVA 2BY3A 1NDZA 2KX9A 2OFJA 3N2BA 4YPJA 1OG6A 3NZQA 2IQ0A 3ONCA 4KS0A 3W88A 3GBEA 5CKSA 5E5CA 2Y5EA 5BU9A 2PU1A 1E4MM 5C7VA 4GY1A 4IISA 4U5IA 3E0IA 3P8JA 3KCJA 1ISYA 2PD9A 5DT5A 4NJKA 1TWDA 3U2ZA 2H6RA 3OVQA 3BTNA 5CZTA 4RDYA 3NDYA 1VJZA 1J0HA 4L1GA 3U57A 5I5RA 2D23A 1OABA 3WQPA 3THCA 3W1QA 3M0XA 3RLUA 2YA1A 1F9CA 4EXQA 4RKAA 4F9JA 1TA3A 4A21A 4FAMA 3G1SA 3DECA 3WQWA 3QQWA 2HE8A 4QJ4B 1JUEA 3WEMA 3QHMA 5CXPA 3BQ6A 3MCNA 4H9XA 3K13A 2QULA 4XWUA 3QC0A 3VE9A 4CN1A 3WLOA 4GUHA 1BYDA 3N2XA 2Z1BA 4I9TA 4ZQPA 4PODA 3OTRA 4LRSA 1FHLA 5CSUA 1H62A 2FTWA 4LVGA 2J8FA 2QKFA 3NYZA 2F8QA 4UFMA 4GO9A 3BK0A 1QI0A 3C8FA 4V15A 4YVPA 3P7YA 2QIIA 1W3JA 1K8CA 4IF2A 1L6FA 4EPKA 1SMAA 5CPSA 3W37A 5A6JA 3OHIA 3C8NA 1RAKA 4RE3A 4Z2KA 4QS6A 5T9CE 1E6QM 1CGWA 3QY6A 4M56A 4C6OA 3TLLA 4TX6A 1W91A 6XIMA 3E5PA 1J2BA 6PTDA 1BAGA 3AOFA 1NF0A 1F61A 2J7HA 2JIEA 4CCDA 1FXQA 4DB7A 1TUXA 3I3EA 2PE4A 3UG8A 4A35A 1RY8A 1AQFA 1GVEA 3DU0A 3CTTA 3CC1A 4ATWA 5AKQA 3IIXA 1S39A 1PXGA 3OOQA 5HMEA 3MSDA 5BWAA 4H7VA 1QXLA 4GZEA 2FH8A 2BY1A 1W8GA 3PAOA 4Z2GA 2A0NA 2OEKA 4LEQA 4DPPA 4H6EA 5G2HA 1GGOA 5B7YA 3L23A 3ZSTA 2CZDA 1QNVA 1HJVA 1IYXA 4A29A 2O4MA 1LBFA 1XBXA 4HD5A 1Q63A 1O6IA 5KZMA 2WC3A 1PYFA 4OBSA 1A5AA 4KKXA 4QDWA 2NX9A 3W2UA 2VOTA 1F8IA 3QYSA 3MBFA 4X2PA 1ZBVA 5D09A 4HCLA 4Q6JA 3ABRA 3NZGA 3W23A 2DVXA 4JX6A 3MSRA 2G8ZA 3GXDA 2BGNE 4B5NA 4AISA 3ONBA 3WBXA 3LQGA 1MRAA 3LHYA 2W5FA 3G5EA 4WDWA 1BXNA 5E6ZA 2A3AA 5EMUA 1YQ2A 1ZBWA 4E5TA 2ZVIA 3PSWA 4NZCA 1GJPA 5I23A 5F2MA 3CMJA 3BH4A 3UWYA 3KOZA 4O8RA 2WSRA 4H4IA 3CQJA 1B5TA 3HJZA 1XSKA 3AJXA 1NTHA 2V63A 3LTPA 5GJPA 2Z24A 4DYJA 5F2IA 1M7JA 1A4LA 3S9IA 2JF7A 1KFCA 3WQ4A 3FK4A 1CW2A 4G7EB 4WDXA 4H9MA 1J8VA 3UWVA 3O6AA 3EDFA 3DHDA 3I65A 4TMCA 5CZ0A 1EDQA 4Z1AA 3S6OA 1SR0A 1B9ZA 2R24A 1CXEA 5CZSA 3U48A 3PJXA 3URBA 5CGMA 3TAKA 5JQ9A 3W75A 2PP1A 1W1YA 3CZLA 3RR1A 5XIAA 2OWWA 4LBUA 5DMYA 3UR8A 2X1IA 2CHNA 1QPKA 4ADSA 3M1ZA 2VD8A 2UZ9A 2B7QA 3MWAA 2GVGA 4WZHA 4P2VA 4HSNA 2XWEA 4O0KA 4GIYA 3JU2A 3SFWA 4OHQA 3FSUA 1G4EA 2NSXA 3HIJA 3MB9A 3H2AA 2XFRA 1RD6A 4G1KA 4KFOA 1OC6A 4Z2IA 7A3HA 1XYZA 3VFCA 1CI1A 2ISFA 4PCSA 1BWVA 2FGZA 3L2LA 3QH2A 3W7JA 1HIZA 1OK4A 4JTUA 1EB3A 4IMCA 1JEZA 3P80A 1EH9A 9XIMA 3GQYA 3IV3A 2YL6A 4DUOA 2JKPA 1W9BM 1EJ7L 1PL9A 4PMRA 3SSJA 1FDYA 3OG2A 4AVOA 2ZQ0A 5BXSA 3WCZA 4PRTA 4ZTYA 4UZSA 3G24A 3VNKA 3TTOA 3T0CA 2Q6ZA 2E8ZA 4H9ZA 5DBTA 4EPEC 4GKTA 1QBBA 3QMTA 3GB6A 1CBGA 3W7EA 3W76A 4QRNA 2ZUWA 2PDXA 4WVXA 4LYKA 3EDKA 1JZ5A 2VGBA 3EEZA 1C8YA 1IT0A 1S46A 1ZJBA 1V3LA 1AMKA 3H8AA 3BG5A 5C2GA 4K1WA 3FOKA 5I79A 2CZVA 4UNLA 3CUFA 1ICQA 5KZDA 1R5YA 5D2YA 3CL7A 3SQLA 4FF7A 3I4KA 4WGXA 4A8IA 3UG3A 1D3GA 3OZYA 3VCCA 3V75A 4LF2A 3KAOA 1J0KA 5I78A 4Q32A 1U2YA 1N8FA 3HQNA 4XG1A 5CLTA 3BPWA 4ASTA 1K9TA 3SJ3A 4DBSA 3EA1A 3GTFA 4C5ZA 4U5KA 4HPJA 3ZLHA 1XYAA 4LC6A 4AZCA 3MP4A 4N4QA 5MHBA 3TQVA 5CBJA 4C6DA 1Z9AA 3H6OA 3GM8A 3HQOA 3CV6A 1IXOA 1TQXA 1QHPA 2C15A 1S5NA 8XIAA 1WKFA 2VENA 3ZT7A 4UC5A 2VR5A 3UY7A 2HQAA 1A3XA 4DWSA 1W9UA 2ZUNA 3A6OA 3V4BA 3AHTA 4M5PA 5M2FX 1NY1A 2FB2A 1A5MC 1Q2RA 5KETA 4R33A 3DFYA 1UBPC 2XVNA 4O15A 1TPH1 4Y2WA 1NOUA 3F7JA 2NT1A 1XCWA 3B9DA 1EWEA 2PDIA 2Q01A 2V2DA 4CNSA 1GVFA 1VEOA 2VRKA 4D2JA 2ZUSA 3SRHA 2QDEA 2VC9A 3CYVA 4O1FA 4M3PA 2WVTA 4JYEA 1DJGA 1G4SA 1VEMA 5JIPA 4WKHA 2GQ3A 1XLFA 4S38A 3PPGA 3RK8A 1GQKA 2X1TA 1TZZA 1OHLA 2MNRA 3SDOA 5LSMA 3CMFA 3Q65A 1S2UA 3T6CA 4RLIA 1MZHA 1SW3A 1A5NC 4ZE5A 3RXZA 2DT2A 1OEPA 3TOPA 4B5TA 1V0MA 4KRUA 4XBSA 1FXPA 2I14A 1LL7A 5K7JA 4I7WA 4HMEA 3S2MA 1MEIA 4EOUA 1KTCA 2WQPA 4TVCA 4F2BA 1EP3A 3E12A 1XICA 2WKLA 4CQ9A 5LIUX 3A64A 2Q3OA 1UWTA 1QI5A 2WQDA 5SWUA 3GH5A 1ZJAA 3APGA 5FACA 5ABGA 3GIYA 3W6YA 5G1TA 4EE9A 4V2XA 1TV5A 2IKJA 3NOYA 1BVZA 1WDRA 3APYA 2VZSA 2CESA 3WNPA 3ZT6A 4Q33A 3M44A 3KL3A 4B5XA 3NL3A 3W2KA 1U1HA 1P43A 1PV8A 1KGWA 1AW1A 1HL8A 1KXTA 1C3FA 1C9WA 2VM8A 1EFZA 4LTSA 4DUWA 1EUNA 3XIMA 3N73A 1CT5A 5DXYA 4X0VA 1S5VA 1I6NA 1TZ9A 3ENLA 3L9CA 3CYJA 5B7ZA 5LHFA 3UWZA 2DT0A 3FGCB 4QAWA 5CLWA 2W67A 8XIMA 3OIXA 3ALGA 3CUXA 3LPGA 1LG2A 4L4PA 4NQ1A 1EBHA 1W54A 1RHCA 2VZUA 3B0UX 1AG1O 2QZRA 3B9OA 5E0KA 3KS6A 2RJHA 4GHRA 1F4AA 1ZCCA 4D6CA 4Y9OA 1HP4A 3LMZA 4Y8FA 2NLIA 4ERAA 1PAMA 1TTQA 2J47A 2C7FA 2QCDA 4H6RA 3VVGA 3IGUA 4LS2A 3AZRA 1QOXA 3B9NA 4AQLA 2WJFA 1OCJA 2ABBA 4KEMA 4ADTA 1IWPA 3KVLA 3P82A 1F07A 2Y89A 4KF1A 4O50A 4N42A 4V1YA 1V3HA 3BL3A 2UY4A 1IT8A 3WQDA 4C1NA 1LG1A 2PP3A 3OP2A 3TTYA 4O28A 3BOFA 3ES8A 3HG5A 4NAFB 4JHZA 2HNHA 4CCCA 1IR2A 2NWRA 3W7KA 4B3LA 1IIGA 4IGNA 3QVQA 5D2TA 4KEUA 1PIFA 1QFEA 5A6BD 5AHEA 2X2GA 5F1UA 4HIBA 3NAVA 1YBQB 1O5KA 4OZOA 3W7NA 3W26A 4NAEB 3VINA 2OYMA 3GFZA 3WG6A 1FWWA 4NNBA 4FNTA 4Q8VA 1UP3A 3REQB 2QMJA 3O1NA 4BFAA 1FHDA 3PPFA 3SI9A 4E4UA 4HSHA 1H5YA 3BLKA 4GACA 3FYOA 1I9CB 3C0JA 3SQMA 3O07A 3WMCA 2CW6A 3P0WA 1JCNA 4MY8A 2OLHA 4IJBA 1F3EA 2HBXA 1G6CA 3VIHA 3M0JA 3S9ZA 2VXNA 3HF3A 3PN8A 2XGIA 7TAAA 5FEWA 2DP3A 4N6EA 2Y2WA 3VAVA 4HU3A 2G97A 4YS1A 1FWCC 3GXFA 4TIMA 3EWYA 2FB3A 3GVRA 4CU7A 3ITTA 3TAOA 1F3WA 1RLCL 3R79A 5AOUA 4C5YA 4CQBA 3VGBA 2V67A 4HT3A 3XISA 1KQZA 3L65A 1PTDA 4WSHA 4WF7A 4D6GA 4GNKB 1A0DA 4J3SA 5DMLA 1EA0A 5DELA 4PEKA 1GZ1A 3M0YA 4MFEA 4JS3A 2DVTA 1Q5MA 5HR7A 2VURA 2QJNA 3DN5A 5FL1A 3LGDA 1PDZA 3UWEA 1QCWA 4HK7A 4EACA 2GGGA 3BMVA 1O5QA 3RMEA 1OX5A 4FR6A 1YPFA 4FNUA 1MNZA 1Z42A 4ECLA 4AHOA 2Y4SA 3S1GA 4XSLA 2GJNA 2I16A 4F4RA 1IZCA 1GZJA 4CN4A 5LNUA 1UUMA 1I1WA 4PULA 4AEOA 1E1EA 3KVMA 4R7OA 3HURA 5J8LA 1H3GA 5CCZA 1QW9A 4GFSA 3WEZA 3UJRA 1E0XA 2J78A 3FIGA 2EJAA 1V6UA 2ZICA 1JNEA 4QTGA 3OLGA 4JL2A 1RVKA 4RDVA 4U28A 4X0NA 3UJEA 1F4HA 3W7LA 1JUBA 3SY5A 2E4TA 3KHDA 3NDOA 1OGSA 3CPRA 3NM3A 2H8ZA 1UASA 1X97A 5LIXX 4ZENA 5TIMA 3PPCA 4XV0A 3Q2DA 4AZHA 2ABAA 4IIDA 2BP1A 4GQGA 3HV8A 1DJHA 2DZBA 4CCEA 4XQ6A 4A4AA 2J25A 2A3CA 2WJDA 4EWJA 2VDHA 4UMAA 2G37A 2WMGA 2YXXA 3P5YA 2ZOXA 4Z1YA 1EZWA 1RZMA 2DORA 4QG6A 4ZCWA 1FWSA 3IK2A 1V77A 2ESCA 2R6OA 1WV2A 2ZADA 3QBUA 3T40A 3CQHA 1XYLA 1UJQA 3IIZA 5J5DA 1XH2A 1A5OC 5DT7A 4J7RA 2CXGA 3AYTA 5LA0A 2J13A 2DDXA 1LRQA 3RIKA 4C6JA 5HQMA 1TVPA 4BK9A 1HKWA 2PU0A 2FDSA 1KQYA 2RDWA 2YDRA 5IRPA 1SMDA 3T08A 1K70A 4LY8A 3G0UA 1T8QA 2BVTA 3KDOA 1O7AA 4ACZB 4MNLA 2XSAA 3BZJA 5E6YA 3KTXA 2J79A 3VDBA 2QYGA 3SCTA 5G4WA 3G22A 3DGRA 4FXFA 4J3TA 1F2JA 4H9YA 1IXPA 1IIHA 5EMMA 3FFSA 9RUBA 3G18A 1NEYA 1XIDA 3CUJA 2BVDA 4AC7C 4XSMA 4EX4A 3WUGA 5C55A 4OV4A 4S3DA 1PVNA 1XIFA 4WQ6A 4ES4A 2FGLA 2Q71A 5J04A 2D2JA 3H24A 3PBWA 4YCOA 1E4LA 1K02A 4YWIA 3DG6A 1A4MA 3TQ0A 3HG4A 5A6KA 4C6FA 3BAIA 2QUTA 1KCXA 3BCDA 3G1DA 3HA1A 3MO4A 2EPLX 2Z1SA 3PK7A 3ZR6A 3PSVA 3WL1A 1GKQA 2WAGA 3EOOA 3M7WA 4LUSB 1RQEA 1R9ZA 2IXVA 3WKZA 2GSJA 4XVDA 2HMCA 2OOGA 4YVVA 3WDHA 5M5DA 5CAKA 2WNNA 5F2LA 1QPNA 1CTNA 1XD0A 1DWGM 2Z1VA 2I57A 4ZODA 4S3AA 2GGIA 5HWJA 5D9OA 2PI6A 1H7RA 2FPVA 4C6NA 5EMJA 3LNPA 1X6NA 4L64A 4PUKA 1M68A 1ZB5A 3WF4A 2FZ8A 4TOQA 1OT2A 3CO8A 3THDA 3URQA 1I2OA 2OX1A 2A3HA 4JIHA 3GIQA 4A3HA 4JKMA 1J0IA 1U83A 4KRZA 2I7GA 4D6DA 3NL2A 4RXFA 2WSPA 3GC4A 5KTLA 3PJUA 1PCWA 2GL5A 2ZRVA 1FOBA 3VFLA 1GVQA 2H9AB 5I6SA 1KLZA 1AQHA 1WKYA 5H91A 3RX2A 1FX6A 1XUZA 1LUCB 4LY4A 2XZ9A 3LBMA 4UTWA 3CASA 3N19B 3N6HA 5E0CA 4B3ZA 3T55A 5EPDA 4GABA 4AH7A 2RFGA 1G7UA 2UY5A 3QOMA 3WLLA 1NFPA 1P0DA 1GJUA 1V08A 2GGEA 4M24A 4QE4A 1VFFA 3SCRA 1OM0A 3GKFA 3MUIA 2QF7A 3ITXA 1Y5VA 3BV4A 3W53A 1L0PA 1YEYA 3BGJA 5D9MA 3VX0A 5TNVA 3B97A 1JRBA 4XAGA 2B0MA 4D8ZA 2DIKA 1V93A 1E1CB 4RL3A 1QBAA 3ARXA 4WOZA 1D9EA 4NXKA 3W70A 1UA7A 4CNPA 2HSAA 4PMVA 1ONWA 1W3NA 2J9XA 1US0A 2BG5A 2EKGA 4H8NA 4KPLA 1KFLA 4OOZA 4KMQA 1Q6OA 1W5PA 5PTDA 5GNXA 4IPPA 3GW3A 2NXGA 1W1PA 2OQLA 2J9ZA 4DLFA 3NJ3A 4PTMA 3UG5A 3AS0A 1YW1A 1KFBA 3ZZ1A 1X8CA 1M5WA 1PB0A 5CPNA 4KGLA 4B2DA 4H6KA 2BXYA 1WA3A 3T05A 1X7IA 3WNLA 3UFYA 4HYWA 4E3VA 4H41A 4LSBA 1V5XA 1HN1A 5F4SA 2GGHA 4F0RA 1O66A 3H55A 1RBLA 1QATA 1EWDA 4WJXA 2Z1WA 1ESWA 4WCJA 2WBKA 4JTHA 5HBFA 2OO6A 3B3DA 4C91A 5TBOA 3GTHA 4A3RA 3PFRA 5BOFA 1GG0A 3L5AA 4PUEA 1XYFA 3OEXA 2I9EA 1W3LA 3UPWA 4HA1A 1V7YA 3AICA 1X96A 4AHPA 4RNFA 3J7HA 4C7FA 4GE8A 3G77A 2P8BA 3UZWA 4QJ1A 4GQRA 2FHFA 1XXXA 3TSMA 3VOIA 2WYSA 4RW5A 2FYMA 5FA5A 2A7NA 1IE7C 2ZE0A 1ICPA 3CJPA 4C90A 3AHXA 2CYGA 4DWDA 4LU0A 1PZ0A 4LV4A 3ZVHA 1JYXA 3UCQA 3V0SA 2DJLA 3NL5A 4EANA 2GK1B 4LYQA 4O54A 5CGTA 4XZBA 5IDIA 4GQQA 1CENA 1TPWA 4W4QA 2WBGA 4DF0A 4ZA0A 4PBFA 4DRSA 2CWNA 1TPEA 5FAJA 4UTLA 2Y1HA 5A94A 3FAXA 3SEPA 3CNYA 2PWEA 1J6PA 3TK7A 1UD5A 3P3BA 2J24A 1M53A 4QLKA 1XYBA 3W07A 4I9AA 2NLYA 3T42A 1WBHA 3CAVA 4PRWA 3ANUA 1VJIA 4GBUA 5CEWA 3GHRA 2I9UA 1CGUA 4ML9A 2X40A 1I75A 6REQB 3IRDA 3KL0A 3V0TA 4UXDA 4I5XA 1ADSA 3S5YA 2J7BA 2NQJA 1TPUA 1B3OA 1P6BA 4IIHA 1FWTA 1UQYA 2VGFA 3BARA 4OUEA 5T9BG 5BWFA 1C29A 5H8MA 3MANA 1TG7A 1QDSA 4ZZ9A 3MP3A 1WKEA 4OECA 3ORWA 3DBNA 4AY7A 2QJIA 4H00A 4RW3A 2A1YA 4XKYB 1IEIA 1EJWC 3FYPA 3DYOA 4Q4QA 2ZUVA 1UC4A 4NAEA 4PYSA 4OOUA 4S3CA 5HPOA 4LEFA 4QJ5B 3WLKX 3AQUA 2DUXA 1WDQA 2B7PA 4ZB2A 1DHPA 4S2CA 3CHVA 1L2QA 3SN4A 3BGGA 3XINA 2WCSA 4DZHA 1FP9A 4UIOA 4K38A 4XD6A 4JN7A 5DF0A 3L7RA 5A1AA 3GTXA 4A8NA 3PUEA 1ODZA 2Z2UA 4JYDA 5GVJA 3AYSA 3B03A 1OD8A 5AC4A 1Z48A 2ZYFA 4ZMGA 1X1NA 3WNKA 4QE5A 3CWHA 3NA8A 3E1F1 2V3DA 2BODX 3MW7A 4ZXLA 3E5BA 4HTYA 4ADUA 2VFIA 1T40A 1LRNA 2PTWA 2RDTA 3ABZA 2XSBA 3TZNA 2Z25A 1P0NA 4HPGA 4R85A 1UR2A 5LZLA 4NG3A 1SO3A 3EWDA 4F79A 3N4AA 4AD1A 3F2DA 3R7MA 4MMWA 2O0TA 3M7SA 1DIDA 4DNHA 2D69A 3RLGA 2YL5A 3H26A 1Y7VA 2VP8A 5AHNA 4DZAA 2B4GA 4DYKA 1P0KA 3GDMA 1QI4A 5GPRA 3NPUA 2J7FA 3N34A 3CAKA 3PS7A 1A49A 3R6IA 3BAYA 3QPEA 3VD5A 4Q8QA 2X0SA 3Q37A 3AZSA 1MRQA 1LDCA 2E6FA 1MXSA 1ZFJA 1BG4A 2DSUA 4R7JA 2DSZA 2QHAA 4EIVA 4JTKA 4JNMA 3VO0A 3PZNA 3S5ZA 2XGBA 1NIUA 3QMSA 4R5EA 2PCQA 4BEQA 3LPFA 2A3EA 4PB5A 3GNOA 1IT7A 3I7RA 5D9NA 3QXBA 1ZAJA 1FWAC 3BSHA 2CHOA 3PZQA 2GVJA 3MJMA 1JQXA 3GS6A 4LANA 4M7TA 4U2YA 3SN0A 3QMRA 2ZC8A 2MUCA 1NQKA 3KXQA 5FJUA 5ABHA 4XAZA 4Q4KA 5GQBA 3EOSA 5JU6A 4FO4A 4Q4SA 1J79A 3G0XA 3PVFA 1E5NA 4LPCA 5HDRA 2AQVA 3ITOA 4HCDA 1JPHA 2G96A 3IACA 1CLVA 4D8LA 1MQRA 2FGBA 1I0DA 3C0QA 5FIPA 1XR2A 2VWTA 1TPFA 3E38A 5E1QA 5BRPA 5FEXA 1JXJA 3C6CA 3H4GA 3SCOA 5L9FA 1JDEA 5A6MA 2YPIA 4NNCA 3FKRA 1GKPA 3SUUA 1GZGA 2BNJA 3AMCA 1SR9A 3JVAA 4LGXA 3WLTA 4BQ2A 3WD1A 4IQJA 1SGJA 1XSJA 4IIBA 1HJUA 3SJNA 4ENLA 1EP2A 3NDZA 2BFGA 4AIBA 4A2RA 2YA0A 2Y8KA 4PTDA 5EMLA 4UNKA 1UR9A 3IUIA 3VGHA 4N2YA 2OYLA 3SB0A 5GNZA 4JFWA 1MW3A 1U5JA 5BCAA 1S1PA 1ITQA 3ABSA 3W25A 2H3DA 3M0LA 4CNNA 2PTZA 2V2CA 1Y8BA 1QOPA 3BXWA 4N9CA 3MC5A 3OGVA 1L8NA 1QVBA 4MDPA 2ZA3A 3WYZA 3POHA 3IWPA 4IQEA 3UPBA 4IJCA 1WNOA 4IGHA 3TKFA 2WHLA 3AFBA 3WUEA 4KWSA 5LYRA 2X7VA 3VZZA 4LB4A 4JQ4A 1JPDX 1GUVA 3GAYA 3OPSA 4JY9A 1EDTA 2HS6A 3CS2A 3W3OA 3W7OA 4GINA 3VMPA 2HWGA 4HNOA 3DI1A 1M9HA 3S5SA 1PX4A 3ITLA 3VI2A 1V4YA 1RY0A 4PMZA 3NPXA 3PBVA 1YTEA 1KLYA 3W81A 3EX2A 1VFOA 1K7FA 1XC6A 4QDMA 1UR1A 4QCEA 4AC1X 4GCAA 2WOQA 3VKBA 4FOUA 1VB9A 4MY1A 3EOEA 3S8HA 2E25A 4H7ZA 3BW2A 1TX0A 2A7PA 4WK9A 5LNSA 1E51A 1RQBA 2OU4A 2B81A 1WB0A 3ATYA 2ZKMX 3N17A 4RDWA 3T7VA 3TH6A 4M1RA 1TO3A 1I45A 1EIBA 3GXPA 1L2UA 4IIGA 1VBJA 1OCNA 1PEZA 4GI4A 1BSLA 3BZGA 3W74A 2JE8A 3M5ZA 1Z7AA 3B8SA 1FWNA 2BBFA 1PZ1A 4ZTXA 1W1B1 1T99A 3INPA 1WAUA 3ARSA 2YX0A 4YTRA 1NF7A 3F03K 1OYBA 3TOYA 2PDNA 1M6JA 4M1BA 4O19A 3VX1A 2EJ1A 3B06A 3PAJA 1MFUA 4BWLA 2RH9A 2ZX6A 4IWWA 4KQNA 2DZSA 3R94A 4RK8A 1H0GA 1VPQA 3VNDA 1VF8A 5CPLA 3H23A 2YL9A 1EJVC 4X2RA 3WLHA 1VHCA 2DZXA 1NM9A 1AMYA 1YBQA 3WL0A 3ZMRA 1U5HA 3W2LA 2L5HA 3LSBA 3L0KA 3K5XA 1FKWA 4HZ6A 2PDGA 4MJMA 1B3YA 1SZFA 2QGYA 2R9RA 2YFOA 3GX9A 1CXHA 2ANUA 3A12A 5DBUA 1EC9A 4AY1A 2W92A 3FYYA 4Z2JA 3AIBA 3P61A 1UZ4A 4M8UA 3VK5A 4I7VA 4YHEA 4RV3A 2RAGA 2XZ7A 4H9TA 4LVFA 3AJ7A 3SZ8A 2VO5A 2AQWA 3NQMA 4O57A 3QF0A 1XBYA 3N4EA 3UWUA 3E2RA 3GHSA 4J35A 3L0GA 1IEWA 5CJNA 2ON3A 3HGJA 4GFIA 3THUA 4ZXOA 4L5ZA 1E3XA 4MM1A 3NQCA 4UFHA 3NQEA 4AAJA 3WFZA 3KP0A 1V3JA 2ZRZA 3L4VA 6CGTA 3CV2A 5D2XA 3RX3A 4H2CA 3TYBA 4FNRA 3TWAA 5D32A 1M01A 1I1XA 1ZAIA 3B8VA 1XINA 2H3BA 4W7UA 3LCLA 2WKJA 5CPOA 3G1AA 3QV9A 4OIFA 1REQA 4N0RA 3GC2A 1HJQA 3MP5A 4R9XA 4IMGA 3KBWA 4IP4A 4M29A 1NSJA 3II1A 1NFBA 3ARYA 3F4WA 1TVLA 4E2DA 3A24A 3NURA 2PMQA 3PZMA 2I5GA 4LYPA 1F74A 4IICA 5CPQA 1YPIA 1ZUAX 1W9XA 2ZA1A 5M3WA 2C1GA 1AJ0A 1W17A 1H7XA 2D0FA 4X22A 1CGYA 1ZL1A 1WUFA 3TW9A 4UNIA 1FP8A 1H0IA 4F0MA 4QS5A 2O55A 1SQ7A 1JPMA 3WNMA 1EQCA 3SGUA 4TV6A 3RJYA 4FI4A 3DC8A 4YTTA 4J2MA 4BI7A 4GVHA 2IUZA 4K7YA 5C70A 3PP7A 3NR0A 1ZZMA 4LF1A 2A3BA 1DJZA 1OG0A 2YCLB 3MDUA 1EXPA 4D9PA 3CLMA 3STGA 7TIMA 3HPSA 1VFTA 3TTQA 1JZ8A 3S6TA 1R8LA 2XIIA 5K4ZA 4J3ZA 3UCCA 2P88A 4JTDA 1R2SA 1JDCA 2OEJA 2ZX7A 4JD4A 3L2MA 1NOWA 2HJPA 5E70A 2EPMX 4UTJA 4BI5A 4GVGA 1S3TC 2CFFA 4MWAD 3C56A 1A5UA 3NUKA 1O5XA 3H2FA 3VIMA 2CLFA 4NX5A 3QV7A 5A69A 1E71M 4GYJA 3UCDA 4MNMA 4MUPA 3SURA 1UIOA 4AHQA 1EEXA 3ELFA 3NXLA 3WNOA 2NV1A 1TV8A 1R3QA 3CHEA 4EXAA 5BMXA 1B54A 3CT7A 1K8XA 1FH9A 5DCBA 4O8AA 1OYCA 5C8BB 3LXBA 3RN6A 1ADOA 1KKRA 4HP5A 3WF0A 1QNQA 3M6YA 4CQDA 3ITCA 1OFOA 2QPUA 4L9YA 2ZBTA 3W1AA 3A4JA 1P4CA 3WQEA 1OCBA 2XIJA 1FH8A 2AGTA 1XIBA 3EX1A 4LVAA 3HOJA 3KP1A 4BQ5A 2ISSA 3CH9A 4UOQA 4Q3MA 1KA9F 1LQ2A 2EKCA 3WQ6A 5A95A 2QJGA 1E43A 3WQOA 1P7TB 5E93A 1DJQA 2YSWA 1W5NA 4JPGA 1TJPA 3M5YA 3HZ3A 4H01A 4CU8A 3C4UA 4FXRA 3KE0A 1VFHA 1Q6LA 4NZ4A 3IJ8A 3O9NA 2XVKA 2J66A 5C2XA 2P3EA 4HSOA 3UZZA 3UVIA 3NZPA 4I6KA 5M17A 3LM7A 1EOKA 1UWUA 3RCNA 2XYLA 4Q6XA 1BG9A 4W5ZA 2CBIA 1LRTA 1EP1A 2PLCA 5IBXA 3CIXA 2OEMA 2V3GA 4AMCA 3L0NA 2ASHA 4K68A 1EJXC 2VQTA 2OZ8A 5CAHA 3PTKA 1AW5A 1YX1A 4FNSA 1DXEA 3ZM8A 4WSJA 4RJEA 1S38A 2O56A 4HA4A 3RM8A 4XAFA 3WN6A 2BGSA 3I3DA 3M5VA 1PE1A 4MZYA 5CPTA 2GJXA 2ZIDA 1NFGA 3MO7A 2W63A 2EPHA 5G4HC 3VOCA 1DV7A 4S39A 1E4IA 5HUOA 3W1NA 3I4EA 3EX3A 2YYTA 3AS1A 1XPYA 3WEOA 5BW6A 1GOMA 4LAOA 4W5UA 1HX0A 3YPIA 4YYFA 4FLRA 4B4FA 1A53A 2WM1A 3AHVA 4RE4A 3WDRA 1ISVA 4HN4A 4GIRA 3G2GA 4IFKB 1ALDA 4QEEA 5AECA 1PUDA 2F9RA 4GZJA 1F3XA 5JBEA 1S5WA 1UHVA 1VEPA 4O10A 4YIWA 5CC7A 1H61A 4P7OA 2A85A 4NF7A 1S2VA 3UA3A 1XYCA 2I56A 2G3JA 2QCHA 3OQ8A 3KL5A 4KWOA 3GFYA 2AGKA 1F6KA 2W4XA 3G1XA 2ONEA 1J5TA 1C8XA 3SIZA 3M16A 1HKKA 1VRDA 3TNBA 3M6DA 5EKYA 2V5CA 4LALA 1JCJA 2IQDA 4JX4A 4E8DA 2CLKA 4DXKA 1WDPA 3DH7A 3NG3A 2OOFA 4FP1A 1DJWA 2BDQA 4IH3A 1DWHM 3VIPA 1DXFA 1XLDA 4JQ2A 4QNWA 2BV9A 1FKXA 1RJRA 4JIQA 4DWSD 2W61A 5EYWA 4FK9A 4L4LA 4YTSA 4H6QA 4MJ4A 3KOYA 3P60A 1JFHA 4HOXA 3GVVA 7REQB 2ATMA 3CAWA 2ZRWA 5D8ZA 4AZ5A 2CCRA 3KRUA 3EXTA 3RR4A 2CKRA 4QJ3B 1Q8AA 4U3CA 4JTFA 2G3FA 1ZENA 4M82A 3O3RA 1Q2SA 2AL2B 3EZ4A 2Z6IA 1TE6A 3UZXA 3QSRA 5CSRA 5MKGA 4P7NA 3HFTA 3SY1A 4CQ8A 1I0BA 3WZ0E 1FCQA 3WJWA 4FPSA 2YB1A 1UR0A 4E8CA 1DE5A 3T2OA 5HOSA 3BW3A 2XVPA 3VIKA 3CPUA 4N9EA 4BQ4A 4XD5A 4OKDA 4RPPA 3NNTA 3WD4A 5ABFA 1O95A 1US3A 2CLPA 1LL4A 4QHRA 1CNVA 2C8NA 2C16A 4MKSA 3W38A 4GYPC 1HZYA 2XTKA 3NZRA 3U8GA 3W2MA 3LBCA 3DHPA 4XKMA 1Q8JA 4Y9MA 2Q3RA 4GUJA 4LQ1A 1XGEA 1Q4NX 2V0TA 2IPWA 5HINA 4C1LA 2PDHA 3VKJA 1HVXA 4DJFA 2QEZA 3QZAA 3D0CA 5EBUA 4GY7A 1PPIA 2WMJA 4WOQA 1HP5A 4S2BA 1QMLA 3MUZ1 5LXXA 1DKWA 3VCNA 1EX1A 1V6YA 3PJTA 3UA4A 4IL0A 1DQUA 1XISA 3GU2A 1OGGA 3DKLA 1GOWA 2A3LA 3IJQA 2DZTA 4E0CA 3VM5A 2TPSA 1UBSA 2REQA 3MI3A 1OX4A 1MVYA 2GYIA 4LV9A 1FWEC 3TZFA 1S2AA 3KWSA 4ORIA 3U2OA 3GRIA 3ATZA 3BLDA 3M07A 1LCOA 5CJMA 2YR1A 1HO1A 3UW6A 1H11A 4R88A 4GJJA 3LU2A 4PL2A 3WD3A 1KR1A 1UP0A 2J4GA 1RK5A 2ZRYA 4N9BA 3N15A 3PF3A 1OF8A 4UQAA 3OIHA 1HF6A 3TTEA 3PZIA 3F2BA 1WZKA 2QF8A 3E0FA 5FD0A 3TR9A 1ELSA 1TV4A 2XM1A 1LBLA 2E6AA 1LTDA 3QY7A 2GOKA 2PUZA 1CDGA 1UCWA 2VZOA 5FF4A 3V35A 1WZAA 1WBJA 3BO9A 3K1GA 4C6EA 4TX8A 4CVUA 4AF0A 1OD0A 4I9JA 1YDOA 1OF6A 4W93A 3SCQA 1HKJA 3RUBL 4PH6A 3MSGA 2RDXA 2QJMA 1KFKA 3GG7A 3OZPA 4HOWA 3KVKA 1CXIA 3O0KA 2G3NA 5HNTA 3IVSA 4MF4A 4L6DA 2J88A 3GAKA 4JTGA 2QDDA 1Z44A 4KWWA 1FY6A 1QRQA 4L4MA 4A3QA 1THFD 3RO8A 2WNQA 5A2CA 3OW1A 2C1HA 4JKLA 3MUCA 2PGEA 2Y7EA 2H8XA 2UY3A 2G3MA 2E28A 4LRTA 4LX4A 4O52A 1YDVA 5AN7A 1NDWA 5BROA 2YJQA 2AAAA 1SFLA 1XIGA 4UTKA 1Y0EA 4UUIA 1X6LA 4XZMX 1NJJA 1AQ0A 2FPYA 2VX6A 2YB4A 2QLYA 3FDKA 4ZOAA 1E9LA 5CBBA 3PB2A 1TWIA 4FHAA 1E15A 1ITUA 4LUJA 4F3HA 1CXKA 4HA0A 4MWAC 2Y8VA 1UWSA 1H1ZA 3DBPA 1UWQA 3WH8A 2DT1A 3GUWA 1H60A 1BYCA 2YFNA 3L68A 2Y8UA 2V6AA 2O92A 1BHGA 2QXWA 4AEEA 1M1BA 3NO3A 5J5RA 4N6FA 1OADA 3E74A 4MZ8A 4JFTA 2ISWA 5DQPA 2GK1A 1EF3A 3P93A 3PPHA 3H54A 4FB7A 3ARPA 2WSQA 3OQEA 1U5VA 1QUMA 1CEOA 3RPMA 4BZYA 4PUWA 2P0IA 4HGXA 2VHLA 3BLOA 3BSGA 4FIRA 4O1AA 3ZR5A 1XLGA 3TP4A 2WSKA 4PC8A 2NQZA 1Q6EA 3CXOA 3WUFA 3H53A 1N82A 2VRJA 4PR4A 2PA6A 4PMJA 2ZVRA 4CN6A 2PAJA 3MCMA 5EBAA 1N7KA 3IUDA 1OGBA 4NZ3A 2R82A 4M19A 3R5EA 1LOLA 4ZO8A 2GJPA 5K9CA 2PB1A 3GO2A 1WDSA 3QLDA 3Q58A 2PWFA 1FWBC 3OB8A 1V02E 4LOCA 2XJ7A 4XUYA 3AZTA 3QV6A 4C7GA 1SJCA 2C18A 2CIPA 4O13A 2HBVA 2MANA 3W6MA 1ZS2A 3AHYA 1AA1B 2BSLA 1WQ5A 5T91A 2DH3A 2VDIA 4ROPA 3UR7A 3PZTA 1GVIA 4L1WA 1W1VA 5HNNA 1V79A 8RUCA 2I5IA 5CGQA 3D3AA 3KTCA 1KM0A 3UGRA 3QKEA 3H7RA 4JNYA 4KIRA 3WLNA 1KR0A 3WH5A 2DQWA 1YMYA 3KBJA 2QPSA 3Q45A 1RV8A 2X30A 1RA0A 3C2VA 2W66A 3G1YA 2O9OA 1HNYA 1YYAA 3WLQA 3I68A 2DT3A 4D1JA 4NL1A 3GHTA 3TYCA 1AD1A 2CERA 4AX7A 3PZGA 3SRDA 2BLEA 4PCPA 3VCRA 1X1OA 4L7ZA 2XINA 5A8PA 3PUDA 3LEPA 2NV2A 3TONA 2V5KA 1RCOB 4URIA 2OR2A 4N4PA 2VX4A 1KRCC 3DX5A 2QAPA 4TTGA 4HNUA 4M6UA 2ZA2A 4DI8A 4DO5A 4A8LA 4KW2A 5T26A 3O05A 4NILA 1TPB1 3KOFA 1LL6A 4GD0A 1Q3NA 3D46A 2QJHA 4MZ1A 2WMFA 4C6BA 3T0TA 1OFQA 3ABXA 3M64A 1HKIA 1PSCA 3NWRA 2BX7A 5D4YA 2EBNA 3B8TA 4JDBA 2ZDSA 4MWAA 1EIXA 3WX7A 1B2YA 1DE6A 3FVDA 3IEBA 3ZWSA 4GLEA 4INFA 1JCMP 4WR3A 2B7OA 1A5CA 3W02A 1RJQA 4DO4A 3LS9A 1UKPA 2CLHA 1T41A 4KESA 4WHBA 4E38A 1YLVA 4GYFA 3STFA 4CCZA 2AL2A 4R7WA 3H2NA 4KT2A 4HHLA 4HNVA 3FA5A 1WZMA 3PNUA 2W3ZA 2P50A 4MIMA 1RP9A 1LT7A 4DJEC 3R43A 3GDLA 3D47A 3HTWA 1DQXA 1HKVA 1HXJA 3S83A 3UZ5A 3W2JA 4PMQA 2PEVA 3QW3A 4ACYA 1BYBA 3WELA 2IPJA 3P84A 3E6EA 4NIRA 1L6YA 1FWIC 4DWSC 4K6AA 3VILA 3OG3A 3QHNA 5FJJA 1XIIA 1LM1A 5A8QA 4M0XA 5ABFB 4GYKA 4EF9A 2GQ9A 3EB4A 3ZO9A 1R3VA 3T78A 4UQBA 4UQDA 1P1XA 1TJRA 2I5QA 3DHFA 7PTDA 1K8ZA 4MYAA 1E55A 2FZDA 4DLMA 5H2ZA 1E9ZB 5CBIA 4GO8A 3EWWA 4QX4A 4JTEA 1AH3A 3TJXA 1GEHA 3KRZA 1GORA 4LYRA 3VUSA 4OE7A 1R87A 3NEVA 4UR9A 4DUVA 3R8RA 3PHAA 2E09A 3PY2A 5D2VA 1TE1A 3I3BA 2Y7DA 3EKGA 4D6FA 3SFKA 4D6HA 2WVVB 4EPBC 3NGJA 4GIEA 3I6EA 3N4FA 3SCPA 3PTMA 1JD9A 1Q66A 4UMCA 1RBOB 3R25A 3VIFA 4ZO7A 4XO7A 1XH1A 1XL9A 5I02A 3HGSA 3HGOA 4OUIA 2INZA 4AEFA 1W3HA 1RK6A 5FL0A 1EJSC 1D2KA 3AI0A 3LG3A 2HVNA 1KWGA 1XQLA 1VQTA 3IARA 1BF2A 1F6PA 1ME9A 5EL1A 2QCCA 3N2OA 4MGGA 4JICA 5CPMA 3VKKA 3UXIA 4D6EA 3W7HA 1XJBA 1RUSA 3QW4B 1AH4A 2DSVA 5GNYA 5A2AA 1ECEA 1UD6A 3MI6A 2ODOA 2INFA 1J0ZA 3FV9A 2FZNA 4S3BA 4QG9A 5I03A 2ZDRA 2XIMA 4Q7BA 4TMBA 3NQ8A 2RGMA 3TC6A 2WJEA 4AFYA 2NX3A 4ORMA 1S3HA 2HPMA 3TC3A 2O9PA 1W31A 1WPCA 1KWKA 1RD5A 4PUDA 4F0HA 1M04A 2G3IA 3F5JA 5AZ1A 1DP0A 4IG2A 4L61A 1XG3A 1W56A 3ZVIA 3LGEA 4AYSA 3JW7A 5HJXA 3VDHA 4ZQNA 4HCHA 3NGFA 3HB9A 3EBVA 3CAQA 2VGGA 2AMGA 3EPOA 2QIWA 3DXIA 1XCFA 3JUGA 3VOFA 4GGBA 3JRKA 1WAWA 3E0LA 2E8YA 4XAYA 4PMYA 2FFCA 4LVBA 4MJZA 4NZJA 4L6HA 4XZIA 1LUCA 1ZNNA 5HA7A 1W0MA 5C54A 1JG9A 1B31A 1SFJA 2G4FA 3N25A 3TQPA 2GJXB 4G7EA 3S42A 3IVTA 2GJLA 4JX5A 4NU7A 3CHFA 4ZSTA 3CWNA 4QNEA 1WKDA 2XVLA 1XDJA 3CEUA 1OVDA 3TUUA 1CWYA 4ZBCA 4Y8EA 2QDGA 1H09A 3SGZA 3OHMB 4D6JA 4UWMA 1E0UA 2CITA 3O2LA 4ALDA 4DJDC 1DJYA 2WSYA 1EEPA 5I09A 2V30A 3VYLA 4M6PA 3LHTA 1GVRA 3LQLA 3DFPA 1U1JA 2CZFA 3E96A 1UR8A 1GYLA 1ICSA 1JVNA 2FMNA 4XBJA 4C1KA 2EGZA 3R0UA 2OODA 2POTA 4UZUA 3RU6A 3AIEA 5ABTA 1XRFA 2CBJA 1OC7A 4DO7A 4OWGA 2HVMA 4UFIA 1W37A 5ABEA 3VZXA 1UKTA 4CUCA 1QU4A 3IAPA 2CWXA 5DCDA 3SW6A 1H7OA 1KXQA 1E6NA 3IAQA 1K6WA 2C91A 1KRBC 1QW8A 4IMDA 3L4XA 3T0AA 2PWHA 3AAMA 4PFHA 2W27A 1OSEA 4AX6A 1EHNA 5FJOA 2Y5JA 2ZRUA 3USBA 5FESA 8TIMA 1A0CA 3AWNA 4MUZA 3IGXA 3GH4A 3FEMA 4O16A 2VEMA 4JR5A 4P7LA 2J6XA 3W7GA 3P8IA 3CZ8A 3LYEA 1TPVA 4AIEA 1VIZA 1HKMA 3T1GA 3LENA 1VFMA 3ZIZA 2V9DA 4C6CA 3W24A 2PODA 1CLXA 2WB5A 1SZRA 3NZ1A 1AODA 4IUOA 4U33A 1KCKA 1UUOA 4H19A 3USZA 5LNRA 3BLLA 8CGTA 4A2SA 3TXZA 3ARWA 1V0KA 4AD0A 4K1GA 5A8OA 3ME3A 3O6YX 4CQCA 1Q6QA 3FSTA 3VKCA 2WNZA 1ZALA 2GZXA 2VFFA 4F40A 2V3FA 4QFUA 4A3YA 2HS8A 1A50A 4GH1A 1I2QA 3GLCA 1WOAA 3W7PA 4BF5A 3W1TA 1MYRA 3C3UA 1ZSXA 4IX2A 2XFYA 4FLSA 2NT0A 4XUGA 4EVZA 1TTIA 2DVUA 1OX4B 4EP8C 3HM7A 3AC0A 4LAMA 4NHVA 2JGYA 5C9RA 3BCJA 1W1TA 2J75A 3QZ6A 3GR4A 4X3ZA 1FH7A 2DSWA 2OZTA 3GIPA 3V5FA 1U22A 1H7PA 1TCMA 1XHGA 1MSSA 2RUSA 1QR7A 4GX8A 2HV5A 4L65A 3H2MA 3B0PA 1VD6A 3MTWA 2OQHA 4FX6M 3QOKA 4W8BA 4YMZA 1A5LC 2HNEA 4DWSB 4JTLA 4R53A 3N12A 5AHMA 5HUPA 1H5VA 2HVOA 4AB4A 1TIMA 1UP2A 1CB7B 1KD0A 3TXVA 3VE7A 1VCVA 4HVXA 4Z1CA 3DYMA 2VNCA 5AC7A 2A6NA 1HTIA 1UMLA 3HPXA 2ZRXA 4I6VA 5LIWX 4NZFA 1A3WA 3EB2A 3GC5A 1W3TA 3MA8A 4MB5A 2VEPA 2ALDA 4OGZA 1MXDA 2ACRA 2W79A 3EOUA 1BLIA 2VOMA 1K3UA 1RA5A 2VR4A 1WXJA 2PWDA 3A21A 5D02A 5LGZA 1MFVA 2Y0FA 2NZLA 3FJ4A 1V0NA 1YXYA 1AQMA 4JHMA 5JVLA 4HTBA 2DW7A 4IXXA 2JKAA 2EQDA 4LAKA 1TR1A 1O60A 1R85A 1W5QA 3PBYA 3DC0A 3S0CA 4NYYA 3RRXA 3EOLA 4US6A 2OTDA 3DFHA 1S5MA 4QAIA 1XLEA 3WMSA 4JTJA 3V5CA 1TJ0A 1W1ZA 3VTRA 3PNZA 1NELA 3WDJA 5D30A 4OJYA 1UJPA 5F7UA 2JF6A 4GYPA 1M3UA 1JDAA 5DFAA 2H90A 1T7LA 4J3UA 3FX4A 1PZ2A 4H1ZA 1E3ZA 2R1MA 1U1UA 2V8ZA 3L4YA 4K36A 3IIOA 2QJJA 1BKHA 3UJSA 2CZEA 4WUIA 4DM1A 1JNDA 4DJED 4UQ9A 4AIOA 1CIUA 2BOFX 1M03A 1OQFA 4KEZA 3R58A 1RPKA 4JL1A 4GI9A 1R7OA 3WJYA 1AH0A 3QGAC 3LRKA 2ACQA 1TPC1 3M0ZA 3A23A 5FSDC 2WC7A 4Y9AA 4RPQA 3BMWA 2ZZ6A 1DTUA 1W9VA 4ML4A 2BHUA 3LTSA 2OZ3A 3N29A 3W00A 1CXLA 4GRSA 4M80A 2QVNA 1TVNA 3FHQA 1GWJA 3MVTA 4I3GA 5KMYA 5C0QA 3MT1A 3A4XA 3CB8A 4Y96A 4Z17A 3F2CA 4D1IA 2BB0A 4XZLX 4KCWA 1MMFA 4EWND 3GU1A 2ISVA 4K3ZA 2YL8A 2BWGA 3RNDA 3QY8A 1QI2A 1AL7A 2JIWA 8A3HA 4HBKA 5BXPA 3U5UA 3QZEA 3IUHA 3CL6A 4M51A 4NX0A 4B15A 3LOTA 2X05A 4KFPA 2X16A 3B0YA 3S2NA 2HDJA 2E9BA 3W28A 5K4XA 2JEPA 3CV7A 4HHHA 1AW2A 4NY2A 4E4FA 4HB7A 4AMAA 3N14A 3LRMA 3MU7A 1O68A 2SFPA 1GNXA 4JHOA 2ZZ3A 4E2OA 2W9MA 3TA9A 2B31A 4US5A 1ONEA 4LUTA 1R86A 2D20A 1FWDC 3N9KA 3K4DA 5A6AA 1ZBKA 1BGAA 4HNNA 1R3RA 4RE0A 2XDFA 3ITVA 4TX9A 4TUFA 2VZTA 3RMJA 2FJUB 2NWSA 4GX9A 3U9IA 1B3WA 3OA5A 1XUUA 1SFTA 3FA4A 4Y9PA 1BWLA 1TPDA 3M0VA 2ZX9A 3SUSA 3WF2A 4GQ0A 1OX6A 3IPWA 1IGSA 4TTUA 1E0TA 2FIQA 4PBEA 2FLIA 1SZGA 1I60A 5HMFA 3S2LA 3KOWA 1WUEA 3UGVA 2G50A 3LXCA 4IIEA 4PEEA 2PF8A 5KZ6A 4FLOA 3OYZA 4ERGA 3MHUA 1JYNA 1P6CA 2CLLA 3IVUA 1NQ6A 1LZOA 1E40A 3N04A 1VLWA 3VNIA 4GVIA 3ZSSA 1TWWA 1JI1A 2WMIB 3AIRA 4YYCA 5IHRA 1LROA 4WDUA 1LF1A 1Q6GA 2X0YA 1JGMA 1UROA 3IJ9A 1EPXA 4K37A 3MMDA 4IP7A 4BS0A 2IS7A 1KXHA 2E0PA 1E6ZA 3NQBA 1G4PA 1N2VA 1Z41A 3IJLA 4JTRA 2OPJA 2GVEA 2XG9A 2DSKA 1HL9A 3MUXA 1UKQA 3EYPA 1VYRA 2P1FA 2QCFA 1XLMA 3CZJA 3WQVA 4JIPA 1TFVA 3PZUA 3PR2A 3F4CA 1DBTA 2DPEA 2PURA 5DMMA 3TSDA 1F3TA 1X6UA 1QPRA 5A6SA 3KDNA 4DAFA 1C93A 3TW6A 3C2FA 1G01A 5LIYX 3BAKA 1K8YA 3LK6A 3WLJA 2XH0A 1EX5A 3KBNA 4PSRA 3A4AA 2QW5A 3M47A 2VCBA 4IJRA 3EX4A 4YU1A 3SADA 4YN5A 5XINA 1EC7A 4Z42C 1SO5A 2XVGA 3MV11 3BOLA 3VDGA 1SSGA 3N2TA 3MHFA 4O1DA 5FF7A 4EXBA 2FHBA 2YBUA 5KSWA 2PDCA 2CLMA 2RJGA 2VDGA 3KLKA 2XIBA 3CH0A 4HU0A 1Z6KA 2VT0A 1T96A 1UPMB 1Y65A 2ALRA 4IM4A 2ZUMA 4MYXA 3S1XA 3K8KA 3IV8A 4NRRA 4AZBA 3GVGA 4DBWA 3KCOA 3OVPA 5JH2A 2V82A 2EG7A 2EG6A 1BVNP 4JN8A 4AIUA 3NQGA 3CMGA 2V3EA 4IPJA 4PMNA 1E72M 3BWWA 3MCOA 4E3TA 3CQIA 1EZ2A 1FCUA 1GJWA 4HMDA 4A22A 3KZPA 1GOOA 1GONA 4CLMA 3GH7A 4KFNA 4QP0A 3TDFA 2UBPC 2Q02A 4KETA 4RNHA 4PCNA 4DXVA 1IR1A 1UZDA 2OZ0A 3AYVA 5EU9A 3LRLA 3DOPA 4P8VA 3WD0A 4YLWA 1PZ3A 3LPOA 4S3EA 1I4NA 4I5RA 5E0FA 1GK8A 1BF6A 3WBEA 1DWIM 3HV9A 3DFNA 5A5WA 5I2UA 2FFIA 4MKNA 2J62A 4QE1A 1Z3NA 4R3UA 1M41A 5A6LA 3VOGA 2DUZA 2P8CA 3TROA 2YZRA 3GKAA 2ZUTA 2VFGA 1UW9A 1AL8A 1HGYA 3KX6A 3V3WA 1EHAA 1W2VA 5C9UA 1FWGC 4S3KA 2PDKA 3CM4A 2OWXA 5DANA 1GCYA 4X61A 3LV6A 1G9HA 4EAYA 3MWCA 1MEHA 4MVAA 3UWWA 3UVAA 1UH4A 3MI2A 2VQUA 4Q4MA 3RJXA 1XRSA 4Q8PA 2NVAA 3B9AA 3PZVA 3AO0A 3EXRA 5D8WA 3W1MA 3RAOA 3AXMA 2FVMA 3URNA 3BLPX 3GE7A 4LH8A 1OIMA 4US5D 3B0VC 3S6DA 3W71A 4BJHA 4C65A 4D8AA 3IGSA 4V33A 5CC5A 4HA3A 1ENUA 3T4CA 3DG3A 3Q94A 4C6IA 5AZ0A 3LHZA 3UPMA 3BLFA 4JIEA 4ONVA 1OYAA 3HQPA 3FDGA 5HMDA 4YVXA 3THAA 3GNNA 1M7XA 1Q6FA 3IIVA 2WZMA 3WBWA 2J6VA 5HWNA 3BOXA 3LM3A 1UIPA 5HMSA 3PBUA 2G4JA 3PTDA 1PTAA 3FA3A 3N2MA 4ZFMA 1R30A 1POKA 1JXKA 1HFBA 3BC9A 1KW1A 1YTKA 4MOZA 2NVDA 4G1NA 3P5ZA 2CLEA 3V7PA 2AQOA 1OB0A 3CZGA 1TUFA 5FF0A 4KCVA 1I2NA 5FJTA 3TYDA 4PB3A 3VPLA 2QGHA 1B4EA 1RH9A 3NOEA 3WLSA 2ATSA 3EWUA 2VFEA 1K9FA 1ZBCA 1QAPA 2ZE3A 1SO4A 5AY7A 2ZTKA 3LCWA 1ECQA 1P0BA 1O1HA 1DIKA 3UWQA 3DFQA 4NASA 2J8GA 1FRBA 1ME7A 1H7NA 4HK6A 4IXHA 4GJ1A 3W22A 2ISDA 1MNSA 3QLLA 2DGAA 6ALDA 2GPTA 1MUWA 1Y5XA 4DBDA 4DX3A 1SZNA 3EGJA 1EA9C 3GYEA 4BKNA 1KBIA 1R3TA 1TRDA 1FFQA 5LKYA 3CQ0A 3QC3A 5CJ5A 3TA6A 4LAUA 3G1HA 1PX8A 2V2HA 3CT2A 3VOHA 2FZBA 4DJEA 3HGRA 4JQAA 3AYRA 2WM0A 2NXIA 1WXYA 1EKOA 3A4WA 1PTGA 4BF9A 4XZNX 5HNUA 2WLZA 1EGZA 2WMHA 4NJIA 4JYFA 5TQLA 1SJAA 2WMKA 1RSCA 4DF2A 4DQWA 3RM9A 5HPCA 4UTFA 4CNTA 1JDDA 3I6TA 3KBMA 3LCFA 1C8QA 1UYQA 5BNKA 2E3ZA 1GTEA 3GHUA 3LTYA 1LBMA 4J3VA 2Y5SA 1AJZA 1E6PA 2FHCA 2J8TA 4OBTA 2FTPA 1PX3A 1KBKA 1TV2A 5CG7A 1UD4A 1M7PA 1EJUC 4MNJA 4V28A 7ENLA 3FAWA 1GOXA 3SIMA 4FF5A 4J1OA 2PC8A 1GYMA 3ZR4A 1QO5A 4B5SA 3L2IA 1TMQA 2EEXA 2F6XA 4J3XA 2TAAA 2QUMA 2OSXA 4LCQA 3CIWA 3SUVA 3WK0A 3RCYA 1YTDA 4TV5A 3LD5A 4QROA 2QUNA 6TIMA 2DQXA 1E1CA 1OFDA 3VOJA 2BY0A 4KWUA 1XG4A 1G69A 2X7WA 3EWZA 3H22A 5DO8A 4QCFA 2YDQA 3BJSA 5FOOA 2UY2A 3KS5A 1V8EA 3AU2A 1ZRQA 2HXTA 4UTTC 2Y62A 1CXFA 5LIKX 1P0EA 2PLKA 1Z32X 4XK2A 1UR3M 2RKXA 3BICA 3N11A 3TN6A 1G0CA 4AD3A 5BZAA 1V6TA 4HU4A 1JD7A 2E1DA 1R6WA 4L4OA 3WMLA 1XCXA 2NQ9A 3TE9A 2Y88A 1DIOA 3DAQA 5AVNA 4H3DA 4ZGYA 3WDQA 1XYMA 3O0FA 1B3ZA 4LBSA 1QWKA 3T07A 1W3KA 2D3NA 2E7FA 2X1SA 3T8LA 3D5HA 2C79A 1SPQA 3WLIA 2A6LA 3T2PA 3NPWA 3Q67A 4POCA 3R11A 3W7DA 3KCLA 3QHOA 1SJDA 1B1YA 3TFCA 1LWJA 1EL3A 5D2WA 1GVOA 3S3GA 5CH9A 5HJYA 5EGRA 4X63A 1VKFA 1TMLA 4BCEA 3KVJA 1QPOA 3O7UA 2CPUA 2GQAA 4OFCA 3ARQA 1H2JA 1F6YA 3K8MA 3UNTA 3M0MA 1A5SA 5ECVA 3GZAA 1S1RA 1SUXA 4JTTA 3VNJA 4GOAA 1GVSA 1O1ZA 2WV8A 3MZ2A 2AOSA 3BAJA 2WPGA 3RLVA 4AU0A 3EWBX 3B05A 1OCQA 3MJYA 3ABQA 4F0SA 3PUOA 3PFMA 3U7BA 2KZHA 3EA2A 1D7KA 5FCZA 1XBVA 1GOKA 5DRCA 1DJIA 3WFAA 3BE7A 3ARVA 4HN8A 1PJ9A 4MLJA 2VYOA 1XLBA 2GDUA 3RLHA 4EAMA 2WJZA 2P0OA 1QI3A 4DNMA 4Z2LA 1TQJA