3CH0A

Crystal structure of glycerophosphoryl diester phosphodiesterase (yp_677622.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
b'GMIQVPASFDIQGHRGCRGLLPENTIAAFTKALLLGVTTLEFDLVISKDNRVVVSHDTFFHHEITMMVDGEDVTEANEKNFNLYAMNYADIKEIDVGMKTHPRFKSQKKVPAVKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNIDHPNIALFCDLVVAEIKKAHITDRFTLQSFDVRALEYMHSQYPDIKLSYLVETKGTLKKQLEKLSFTPAVYSPDVTLVSKKDIDAAHKLGMRVIPWTVNTKEEIETLISLGVDGIITDYPDLFFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycerophosphoryl diester phosphodiesterase (YP_677622.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution
rcsb
molecule keywords Glycerophosphodiester phosphodiesterase
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Hydrolase
total genus 91
structure length 272
sequence length 272
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ch0A00
4R7OA 4F2BA 3OHMB 1V8EA 3RLHA 2ZKMX 1PTGA 1ZCCA 1DJYA 1PTDA 2PTDA 3QR1A 6PTDA 7PTDA 1VD6A 3EA2A 3H4WA 4QJ5B 3L12A 1DJIA 4QJ3B 3EA3A 5T91A 3PTDA 1XX1A 4RV3A 3V16A 1YDYA 3KS6A 3I10A 1DJWA 5T9BG 4Q6XA 4F2UA 2PLCA 1DJGA 1DJHA 4RW3A 2OOGA 4F2TA 3V1HA 3EA1A 1T6MA 1T8QA 4I90A 1O1ZA 1AODA 1QATA 4OECA 1QASA 1GYMA 3QVQA 4QJ4B 4I9JA 5PTDA 2PZ0A 3NO3A 4RW5A 2ISDA 3MZ2A 1DJXA 2OR2A 3V18A 2F9RA 4I9MA 2O55A 2OTDA 3H4XA 3CH0A 2P76A 5T9CE 3QR0A 3KS5A 4GNKB 3RLGA 4I8YA 2FJUB 4I9TA 4S3GA 4PTDA 1DJZA
chains in the Genus database with same CATH superfamily
1RALA 4LEFA 4WRHA 3EX1A 4MADA 1I4NA 1XGZA 3Q45A 1MQPA 1T7LA 2BY1A 3W6MA 4GPNA 4IGMA 2DJXA 4AIUA 3FS2A 4UR8A 1W1YA 1XP3A 2XH0A 3QYQA 1OSEA 1UD2A 9XIAA 3W85A 3FGCB 3B0XA 1F05A 2PGEA 5CG0A 1KGUA 5KTLA 3NJ3A 4A22A 1T99A 5AYBA 1NF0A 3IVSA 3CBWA 1PKMA 3S9ZA 4H7ZA 3P0XA 2ZWYA 3KBJA 1RP8A 2WM0A 2A1YA 3TEVA 5E9XA 3W9ZA 1DIOA 4NNAA 1V6TA 4DXKA 4IXHA 3W88A 4PTMA 4YTQA 3ANYA 4GNJA 2NZLA 3UJSA 5F1VA 2OR2A 1OFDA 3V5CA 3LPGA 4Q22A 2W66A 1UWIA 1BPLB 2PDLA 3WQFA 4N42A 1UA7A 2C14A 3K8LA 4AF0A 4JCMA 4N9CA 5HWJA 1V6WA 1B5TA 1JL8A 1HP4A 5I3KA 3B40A 4E0CA 3GUWA 3BAYA 2CZEA 3ARZA 1XLKA 1Y5XA 4CEUC 3CZJA 4IFKA 4GI6A 2PP1A 3AS3A 4PBGA 1UG6A 3C8FA 2HEJA 3PF3A 4GQGA 3EOOA 5D4YA 3BC9A 3BMWA 1JG9A 3ABSA 1AW1A 4YTRA 3WJSA 1JFXA 2O9TA 3QN3A 1OFPA 1EO5A 1EA0A 4O1CA 2O4QA 1OX5A 1ZBWA 2PDPA 3W7QA 4UFIA 1CCWB 4QE1A 3FJ4A 5DQPA 2BXVA 1NWTA 2E6AA 1V0KA 2R82A 4JL1A 5HJXA 2V2DA 3UWYA 3BJTA 3B9EA 1DJGA 4WKAA 2HROA 5BW6A 3ZWSA 3QM3A 1OX6A 4W7VA 1NDWA 3LNMA 3HG3A 1DHPA 5EMLA 4XB3A 3VA8A 2QCNA 1SO3A 4Q8VA 2PWGA 1EGVA 1Q45A 3MYOA 3T81A 1F3EA 1XI3A 2GDQA 2GJXB 4FAMA 1UR9A 2GUBA 2RGLA 3C2YA 1RK5A 2FHFA 5CQ1A 1MW0A 1OFOA 3OG3A 1BD0A 4PL2A 4L1WA 2QNEA 2VZVA 1LYXA 5CBBA 2ESCA 4HOZA 4FLOA 4Y9PA 3T78A 3VPLA 2B7PA 1R8LA 3JU2A 2AQWA 4EXAA 1T96A 3CZKA 3KHDA 1JDCA 1UUQA 4GYPC 4MAVA 3O07A 4TVUA 4IGHA 1UR0A 1FWBC 2RDTA 4U3AA 5BU9A 4C6DA 3TXVA 2XFYA 4FLSA 3THQA 1J79A 1Q85A 1FWHC 3FA3A 2AL1A 3WLPA 4N02A 4JQAA 4C6FA 4HHHA 1H11A 2A2IA 4C65A 1UR3M 3G3MA 1IXOA 4Q4OA 1QI2A 1SQ7A 3RM4A 1P6BA 3RK8A 3S2JA 3MI2A 5IHSA 4KMQA 1OGGA 2EAWA 5AKQA 3NL2A 4JIRA 1OFRA 1DPMA 2BV9A 4AH7A 3WL1A 1VHCA 1VEMA 4IPLA 1E5JA 4H2HA 3NPUA 3E5BA 1V08A 4ZO6A 5H1WA 3EXSA 3VFLA 1QNQA 3QKEA 4KS0A 4JTFA 3QC0A 3PG9A 4Z1AA 1QK2A 4M3PA 4XBKA 3FV9A 2QJGA 1EPVA 3W02A 1Z6KA 4K2SA 6TIMA 2PRMA 4UIOA 4DZIA 1UR1A 1C8QA 2J8FA 4JTUA 2VDHA 3KBVA 3BW4A 4JTHA 2INZA 3N04A 1WKEA 1UR2A 1TSIA 4HMCA 5JH1A 1LWIA 2RFGA 3LQLA 3BL3A 1QHZA 3KEHA 4X63A 1RJRA 3EMQA 4GYFA 3KOXA 4D6DA 1S5VA 4FR6A 1PWLA 2YBVA 1LQAA 5M2FX 3UG5A 1PB0A 5LNSA 3CJPA 3L0NA 3KP0A 5LIKX 3LD5A 2D2JA 1AJ2A 4LY4A 1UC5A 3K5XA 4ZGYA 3BG9A 1IT8A 3OHIA 4G2DA 4DAIA 2GWNA 3HTWA 3SAZA 1LBLA 4A29A 1ZLPA 5JIPA 3S6OA 2Y5SA 3LS9A 1O6IA 3LV6A 4WHBA 2FIQA 2IKIA 4YLWA 1WXYA 4J27A 1CW2A 2V9DA 2NXHA 2XFWA 1QJWA 1TV8A 3H4WA 4BWLA 1XW8A 5A6AA 4N7QA 1W5NA 4IT1A 1S2AA 2HWGA 1TVPA 5BOOA 2PDCA 4Y9OA 2I17A 4G1KA 1XIBA 3LI0A 4CCCA 3H2EA 5DY2A 4NXSA 1EFZA 5C55A 4UR9A 4AWSA 4F2TA 1QPOA 4H8NA 1K8ZA 2I5GA 4WJ8A 3T0AA 1H49A 4RPQA 4AEOA 2J77A 3EPNA 3GH5A 1ZJIA 2Q3OA 4KFOA 4AVOA 4AHQA 4PB3A 1PE1A 3GRIA 1W1A1 4HYRA 3AHYA 1UJPA 7CGTA 4H6EA 3EX6A 2GK1B 2VO5A 3GLCA 4QLKA 5DT5A 4J3WA 1I75A 1V3HA 2FTYA 1ZFJA 2PDUA 3W0KA 3N4EA 3V7PA 2XIMA 3F03K 1J0KA 3AHXA 3H12A 4L4OA 2R14A 1RA5A 9RUBA 1EPXA 3MV11 1DV7A 2ZIDA 3P60A 1F9CA 1OX4B 1S1RA 1LL4A 3S47A 4MKSA 3OB8A 4DF1A 3LXAA 4GWEA 5D37A 3O16A 2X1SA 4DJDC 4LUJA 2QCDA 1C29A 1O94A 1FUYA 5D2YA 4S3FA 4PE8A 3L2IA 1HKJA 5CPQA 5L6UA 3DFOA 3Q2DA 1W5OA 1FKWA 1TJ2A 1XSKA 3A4JA 3ITTA 4XIMA 4HPHA 3O15A 1NY1A 3RO6A 1OHLA 3O8AA 4HA1A 3GWQA 4IIEA 3VGEA 3CLMA 3LGEA 4X2PA 2VFEA 4X60A 5I3IA 3W7GA 3F4CA 3R13A 3TWBA 3M1ZA 2Y0FA 2XYLA 1VBUA 3MUY1 5FCZA 3W38A 1X97A 2OZ0A 4WCJA 5DANA 4AYGA 4CEXC 1VFOA 2ATSA 4Q6JA 4B5VA 3FGCA 3W82A 3GXPA 4E8CA 3SB0A 3EWYA 1IIHA 2PTXA 3THAA 3ZFHA 3R8RA 2F2HA 2JKEA 5HANA 2J79A 3DI1A 4UFMA 3PZ9A 5D9OA 1CXKA 1QOQA 3ZJ6A 1Q6LA 2HJPA 1LBMA 4Z08A 1GOMA 1WDPA 3COTA 1JRCA 5HULA 1XLIA 5EFDA 1REQB 3N2CA 3GG1A 2VEGA 1SSDA 1QT1A 3BE7A 2YLLA 2Y4SA 5A6BA 4KKXA 3WH7A 2DP3A 4INFA 2CLOA 2YCIX 2J47A 3MZNA 1HNYA 2QDGA 3STCA 3SADA 5HPOA 4QS6A 4RV3A 2P8BA 3BO9A 4TUFA 4DVOA 4GMEA 1QO5A 2FTPA 1XBZA 1FCBA 2HPMA 3P3BA 1PX4A 4H8HA 1A5UA 1UA3A 1ZGDA 2B7OA 4L4LA 3GDRA 4C5ZA 3KOFA 1S2UA 5HMEA 3WF4A 3TROA 1TR9A 2HTMA 3L4VA 3SW6A 4LUYA 2CC0A 2ZA1A 1NVMA 5K9DA 1J01A 3TV8A 1WA3A 1EHNA 1SJBA 3CWHA 4RKAA 1OYBA 1PS9A 3GO2A 1IHIA 1K7EA 1KC7A 4Q8WA 1H63A 3AIBA 3AHTA 2FGBA 4GH3A 2OWWA 3A3WA 3H2CA 2OZTA 3KVJA 4LS0A 4E4PA 1JD7A 4AHPA 4OZOA 2NSOA 4PC8A 1F2JA 3EWZA 4XZ9A 1DE6A 2XVKA 4RL3A 2UV8G 2WJFA 3NQAA 1CT5A 3HPZA 4W89A 2CLPA 4GUIA 1A5SA 4ZVJA 2ZA2A 2V5LA 1H7WA 1UKOA 3UETA 4Z0JA 3WMCA 2PDHA 3PBGA 1IZKA 1VP5A 1OG0A 4TV5A 1FX6A 5REQB 1Z44A 2GJXA 1W2VA 3HPXA 1K3UA 1RR2A 3TSDA 1XBYA 4U5IA 3SRFA 4N6EA 4AZHA 4GLEA 2E77A 3GNRA 2OX1A 4E2BA 2REQB 1GKRA 2AMXA 1W91A 4TTGA 1I1WA 4P8VA 4KRUA 3BANA 2X1IA 5KZDA 3WLHA 3VMNA 1TUFA 3F5KA 3IGXA 1OC7A 2G4JA 5FF7A 1E3ZA 1G0CA 4Q8PA 1US0A 1UKTA 3QLLA 3YPIA 3I7SA 3OO2A 3NZQA 4K39A 4ATLA 3UVAA 1BTCA 4MY8A 2XISA 3AUOA 2ISVA 3WQPA 5F4XA 2QEZA 2VOTA 1RV8A 2ZWZA 1KFLA 3MMWA 2EO7A 3BOXA 2GYIA 5GPRA 1OM0A 8XIAA 2YLAA 3GG7A 4IF2A 4DUXA 5A6BD 1LG2A 4OVXA 2XVNA 1E0XA 3ZSTA 2QF8A 4I9MA 3DFHA 3LCXA 4UTUA 2ACQA 4UFHA 4ZO7A 3DGRA 3VIOA 5IFTA 2W27A 3GVWA 1UWAA 5U4NA 5KINA 1V6XA 3CNYA 3QQ0A 2WM1A 3RCYA 4NJGA 2JK2A 1Y5VA 4GBDA 1GQNA 3R11A 3AXMA 4IHCA 4L4MA 5FKYA 5CBJA 1ISVA 3AHZA 2WCGA 1B9BA 1PDYA 3LA4A 3KW3A 8A3HA 2XIOA 5HDRA 3BWWA 1NFGA 1R3RA 4M80A 4MNMA 1KR1A 1J18A 2YW3A 6PTDA 1CYGA 4DF2A 1L6WA 3EKZA 2Z1BA 2V0TA 4NAEB 3U2CA 1SMAA 2ZVRA 1XSIA 4NX5A 4DBEA 3W71A 1ZRQA 3NUKA 2J7HA 1LF1A 3M7WA 4X61A 4KGLA 5LXXA 4O53A 5RUBA 3PTKA 4JIIX 2Z2UA 4IUOA 3TA9A 3VCCA 3I3EA 4HU3A 4E3VA 4AISA 3NQMA 3V1HA 3TW6A 4AEEA 2FHBA 2FGZA 1PCKA 4LS1A 3MDWA 4GUHA 3ITOA 5FEPA 2OKOA 4P7LA 3EWBX 2D73A 4CD7A 5AYZA 5TNVA 1E6NA 1O5RA 2J74A 4MB4A 4O50A 1G6CA 2L5HA 1GVQA 3GSMA 4FX8A 2X09A 3BGJA 5H6HA 4GI8A 2A3BA 5I3HA 4MNKA 4ZB2A 3TH6A 4ACZB 3GDMA 3QZAA 1DWAM 2YSWA 3DFQA 1QW8A 3TUUA 3UWWA 4UTKA 5BWFA 1M7JA 1UIPA 4S2BA 3MC5A 4FSAA 4YTUA 3WENA 2FVMA 2XPKA 2ICSA 1V8EA 1A3WA 3GR7A 1ME8A 4IH3A 1K6AA 3IVTA 3VE7A 3WDQA 4J9JA 1FP8A 3RPMA 2UZ9A 3EOLA 3E5PA 1V0LA 5I3GA 3V75A 4K68A 4MOZA 1HUVA 5LA0A 2ZADA 3KWXA 2GK1A 2YL9A 4FXJA 3SUSA 4EACA 5C71A 2VQTA 2B4GA 1ADOA 3GD6A 5DO8A 2WSYA 3M5XA 1FWWA 4H01A 5E93A 4HN4A 4IJCA 4P7RA 1Z9AA 5JUVA 5I6SA 3B04A 1OIMA 1OX4A 3CQIA 2HSAA 2A21A 5FEZA 4H19A 2PF0A 4OTKA 2QXWA 3TKFA 4FB7A 1UROA 3TE9A 4B2DD 3TZNA 3Q65A 2VRKA 1VYSX 3R12A 4YVPA 1X39A 3GNPA 1Q6CA 4NZCA 3FJNA 3D47A 2QUNA 3NGJA 4NRRA 3WCZA 4NG3A 5BNKA 1XYAA 5GQBA 1HKKA 1SW7A 3G2GA 2ZRYA 2XVLA 1ZJAA 2WMHA 4O1BA 4X9SA 4ML4A 4XZNX 1M68A 4H41A 4AZ6A 1PEZA 4W4QA 3HG4A 3WDHA 3B8DA 1FWTA 3E2SA 2QCLA 1HKMA 1RP9A 3T4WA 5ABTA 1UKSA 2WSPA 2Z00A 1IR2A 1KGXA 4JFTA 1VJZA 2GLKA 1MZHA 1GG1A 1MWOA 1HO1A 1RBLA 4O18A 3PG8A 4XZBA 3TR2A 2PWEA 3RM9A 1EBGA 4S3JA 3GHSA 5CCZA 2YCEA 5FJTA 4F8XA 1JXKA 4LQ1A 3LBCA 1QPKA 4W5ZA 3VD7A 2BGQA 4J3XA 1UQYA 3B9NA 4AFYA 1GZ1A 4A05A 2Z2AA 1XPGA 2WYSA 3IRSA 4EXBA 4PUJA 3PPGA 4CNPA 1X1NA 4QXIA 1TPWA 4M6QA 1RCOB 5DX7A 2NQJA 4TIMA 2EG6A 3MWAA 4JQ3A 1K9FA 3S6TA 3M7SA 2R6OA 3ANUA 4CQDA 1R47A 3CT7A 3QSRA 5LSMA 3M16A 2Y70A 3HPFA 2W0UA 2NVDA 3S9IA 2FQIA 5HQMA 3UF9A 2HDJA 1RSCA 4RE0A 1VRXA 3NQFA 5BXTA 3Q94A 2CEQA 3G6MA 1WPCA 3JRKA 4RX0A 3WLQA 5E6YA 4BZYA 3GDBA 3B8IA 2ZRWA 5CPMA 1J0YA 4P5UA 2QIWA 4CVUA 3N3MA 3STFA 4UTWC 3APGA 5ECUA 3W4RA 1GQJA 4F2BA 4HGXA 1US3A 5CGQA 3KFTA 3N17A 5DRCA 5AHNA 1LL6A 4R5EA 1PV8A 3N34A 3PBUA 4D72A 3AS0A 4XVDA 4DBUA 1H41A 1I9CB 2V6AA 1XG4A 3LLDA 4JFUA 3V35A 1D7KA 1DTNA 4DJFC 3KBWA 5DXXA 5J5RA 1ZSXA 2E6DA 4HMNA 4IGNA 5F7UA 3NXLA 1E9LA 1RLDA 2X30A 5LNWA 4KWOA 4PUKA 3EMZA 1ODZA 2BVTA 2HV5A 3UA4A 4CCZA 3TONA 4JPGA 5JQ9A 2VZUA 3SQLA 1GYMA 2IKHA 4D9PA 1GOIA 4ORMA 2VURA 2R1NA 4FNQA 2OFJA 1CLKA 5HWNA 1VFTA 2CITA 3GYCA 3OW1A 1UMYA 4KIEA 4AD4A 3UEQA 1Q6FA 4G56A 4MF4A 1BYAA 4X9YA 2CZFA 2CHNA 3K4WA 4D1JA 4FIQA 4PEKA 1KRBC 4LT9A 4ICNA 2P1FA 3W6YA 1PCWA 1A5NC 2O9OA 3UPBA 2GVEA 2QHAA 4R88A 3K1DA 2EF9A 3DOPA 3PFMA 3U4FA 3L0KA 1SR0A 2VFFA 1TQJA 2C3ZA 3PSVA 1CB7B 3B9AA 1TPB1 4TOQA 1U1UA 4CD4A 2OJPA 2PWVA 3WMSA 2UWFA 2Y24A 4JIPA 4ZBCA 4AZ5A 3LCWA 4ML9A 4FI4A 4QJ5B 1FWDC 3CU2A 3M9YA 3O0FA 2A85A 2Q6ZA 3CMJA 2VDGA 2Z28A 4AIOA 4UFLA 2Z6IA 4LNYA 4KCVA 2W61A 1XBXA 1MW2A 3KBNA 3ARSA 5B7ZA 3VD4A 1UZHA 2EPHA 3MSDA 3G5EA 3QSTA 3SRDA 1RY0A 1BLIA 1GHSA 3PS7A 4XAZA 3W29A 2E7FA 3GXFA 3LQGA 1ZCOA 2FPTA 5IDZA 2YL6A 3LSCA 5A5WA 4DAFA 4S2CA 4GOAA 4QLJA 1F3WA 2XG9A 4PA8A 1VAHA 4HTBA 5CGTA 3SUTA 1EP1A 1AG1O 2EQDA 3A13A 3FSTA 2CLKA 4NJKA 3VOGA 3PANA 2WLZA 3W76A 2PDFA 4AD5A 2ACRA 4V1YA 3UXKA 4YIWA 5C7VA 4IQLA 1W1B1 4DJDA 2VEFA 4XD4A 3WBWA 4E8GA 4NF7A 1KFWA 1NDVA 1NP2A 3CWOX 4IMEA 2IPWA 4ZQRA 5K4ZA 4DYEA 5EPDA 5HNUA 2VENA 4DQWA 4UZSA 2DORA 3W7PA 3LLXA 2GDUA 3SSJA 4DJEA 4XBSA 1W9DM 4K37A 1E0WA 2YPIA 3CUFA 2J7DA 2QCFA 2DUZA 2OODA 1HJQA 2J75A 3SGZA 2PLCA 4ACZA 4UTIA 2V30A 4S38A 5FEXA 4PB4A 2OOGA 3E12A 1TV4A 3CK5A 2OYKA 3LPFA 3UZWA 3MCOA 4OV9A 4PRWA 4MJ2A 1W8SA 2WCSA 4CD6A 2ABAA 4I7VA 3WFZA 1C92A 3S5SA 4NP7A 2OU4A 4QQ3A 4JYEA 3MZ2A 3GKAA 2V3FA 2F9RA 1IWAA 2X42A 2OEKA 2Y88A 4HQVA 4P8XA 3KCLA 1R2RA 4RE3A 3NQVA 2AKZA 4MKVA 2FMOA 3QOKA 4QG8A 5B7YA 2OTDA 2VEPA 4D6CA 1HW6A 2ZVIA 4QS5A 5D04C 4XSLA 5KITA 1LORA 4JQ1A 3NDOA 1V3MA 3M5VA 3LG3A 4POCA 4XAPA 1H2JA 4PUDA 1WZKA 1IXQA 1O5KA 1EYWA 2QUUA 4GQBA 4HU4A 5M5DA 5DCDA 4MAZA 1A5OC 1OVDA 1Q7QA 3WIJA 1LT7A 4UOQA 4ILSA 2WKJA 4XKYB 3OODA 4D6FA 4F0LA 1W3JA 4FMVA 4J2MA 3QR1A 3PZTA 3SRHA 1J4EA 3MKKA 4FXRA 1ADDA 5IBXA 2DT0A 4JTEA 4DBSA 4GJJA 3B06A 1FXQA 1AJ0A 1UW9A 3UZ5A 1MXDA 3WQ5A 4IL0A 4OOZA 2I5QA 4YNGA 1UWTA 4A6GA 4EK7A 2E6YA 2ZZ2A 1C8XA 4Y90A 3GK0A 1EP3A 4RCXA 2NX9A 4GQQA 5D2TA 3WLMA 5E0FA 1G9HA 3MS8A 1Q6DA 4IPIA 2GJPA 1D3GA 3PJTA 3W7EA 5I09A 3WQEA 3QYSA 3F2CA 3GXDA 6TAAA 3ZJKA 4B3ZA 4P7QA 4QX4A 1T40A 4RW5A 4DO7A 2ZUVA 4JZ5A 3VIGA 4XD6A 1NSJA 2YL5A 3FW6A 1BG4A 3CHDA 4G5DA 3NZRA 3GC4A 2OWCA 4O57A 3FYYA 1OT2A 3LM7A 3O63A 1W1ZA 2E09A 2CKSA 2OOFA 4WDXA 1RPKA 2PDIA 1ISXA 2OYMA 1EZ2A 3F5JA 4HZ7A 5DLCA 4LTSA 2WBGA 5FI8A 2P0IA 3FSUA 3IANA 3J7HA 3S1GA 3GVQA 3UJFA 2E9MA 5D9MA 3KL3A 5GNXA 5AECA 5IOBA 3WNOA 4U2YA 3N9SA 1R30A 1PO9A 3FK4A 3GNDA 1XLEA 4KWSA 2BVWA 3I10A 3ITXA 5EB8A 4JKLA 4IIHA 4Q3MA 2AQOA 1ISWA 4I8DA 1GW1A 1MW3A 1ZTVA 3PY2A 4AVFA 1H0IA 2NXGA 1EDGA 1HJWA 3WLJA 1BGGA 4LSBA 1H7RA 1OK6A 4NNBA 3UWEA 3O6CA 4E4UA 3CEPA 2VEMA 1IQ8A 4XZIA 3SGGA 3I68A 3I3BA 3E0WA 1WKFA 1TYGA 4QR6A 3V3WA 1H7OA 1LP6A 3WLIA 4IL2A 1G7UA 2G41A 2C1GA 4ES4A 3W7RA 2GDVA 3GTNA 1XH1A 3W1UA 4DZHA 4O4VA 3L4YA 3GVRA 1FHUA 1YE6A 2FTWA 3W1AA 4F4RA 2XZ9A 4EE9A 4QLLA 4R7WA 1QU4A 3MUAA 4PODA 3M0IA 2FZDA 3HO8A 1CXHA 3B4UA 3G1RA 1GEHA 3MSRA 2ZZ6A 4CQ8A 4PYSA 1ZAJA 3AHVA 4WX2A 1Q7MA 5FAGA 3H2NA 3W00A 3M0HA 3M6DA 1KLZA 1GJUA 5HUPA 4LF1A 4LFYA 1CI1A 1MEHA 3EWCA 1UPMB 3NWRA 4Y7EA 4HKPA 4C1LA 4C6JA 1JCTA 4L64A 5CKSA 4GVGA 4K36A 4QE5A 1AL7A 2DIJA 1RBOB 4C6LA 1E43A 3II1A 3EEZA 4W86A 3M64A 1R3QA 2X0HA 4K7VA 2V38A 1XLHA 4P2VA 3OLGA 4HJFA 1FCQA 1TWSA 3WD4A 1QPQA 2DZTA 4JIQA 3UZXA 1QXLA 2X16A 3R94A 3T8QA 2Y63A 1EUAA 3QC3A 4F0KA 4HPXA 2VYOA 3LOTA 5DMNA 2GJNA 3EEGA 5LGZA 3GG8A 4ZOBA 3DGBA 4LX4A 3QFWA 4GISA 3NL6A 4UTTA 3WDIA 1EEPA 1UWRA 2DY3A 2V69A 3GTXA 5T9CE 3SSZA 3A9BA 4D6HA 3ARVA 3GE7A 4V15A 3BPWA 3V4BA 4Y9AA 2HS8A 1QR7A 5LXEA 3O05A 3VUPA 5D2VA 2NLYA 1LDCA 2XU2A 2BS9A 3WMLA 3UXIA 4XD3A 2D3NA 1HL2A 2ZC8A 3RLUA 3GXIA 4MFEA 5C5YA 1JZ4A 1H50A 3SCPA 4GIEA 2YW4A 1EEXA 3MKCA 2XFFA 4WF7A 4UTJA 5B80A 3N3TA 5EY5A 3G77A 1DE5A 3JUGA 4ATDA 3EBVA 3M4HA 3IIPA 2ZDRA 3KOYA 2Z1KA 4MSSA 2V5BA 4O1EA 2GQ9A 4M82A 5GJNA 3AUJA 4LYQA 2E5BA 4ZA0A 4N9EA 1J10A 1JGIA 1QW7A 2HMCA 2VUYA 3MT1A 3A5VA 2H8XA 1CB2A 1KW1A 4CNOA 5KMYA 1I0DA 5FESA 1WBJA 3OTRA 1BVNP 4IIGA 4PCNA 3UQNA 3WLKX 4XKMA 2V5JA 2P5NA 3BJSA 2A3AA 1KD0A 4ALDA 2XIBA 8CGTA 3BAKA 2VMFA 1DWIM 4AWEA 1XG3A 5EMMA 5TBOA 2HQAA 2WV8A 3IV3A 1MI3A 4XUYA 3WNNA 3AJXA 4D6JA 3C0SA 2CZDA 1AVAA 1HVXA 1HIZA 1EC9A 4WJXA 1ISZA 2DZWA 1PZ3A 4JOMA 1K70A 3V0SA 4NX0A 3SECA 1JQVA 2PMQA 3PBMA 1OB0A 1FWFC 2PDYA 1ZCCA 1W9XA 3QGAC 2QPUA 7REQB 1UP3A 4JDBA 1TPC1 3GM8A 1PHQA 2V8ZA 4JL2A 1K03A 1RQBA 1E15A 2W9MA 3BW2A 3SBFA 1BRLB 1J0IA 2Q71A 3MW7A 4IXXA 3HQ1A 1LJYA 4YYCA 3G3DA 3E2RA 4MJZA 3MTWA 3LCHA 2ALDA 4K7YA 1OGSA 2Z1SA 1KKOA 3EMCA 3TYBA 1S1PA 2HCVA 2HK1A 2Q8LA 4AZCB 4NKCA 2DQWA 2FHCA 1SO6A 5CG7A 1K7FA 5MF5A 1S5WA 1DBTA 3WEOA 4XKYA 3F2BA 3EYPA 1LTDA 4JTDA 4HU0A 1X6NA 3A22A 2X1TA 3MP4A 1B0IA 3U3HA 3FEMA 3OVQA 4IJRA 3WF0A 5AHIA 4F9DA 5K7JA 2PDXA 3FLUA 3ME3A 1FBAA 3VC5A 4MWAB 3DIPA 3IACA 3KRZA 3KLKA 3S1UA 5IRPA 2Y1HA 2ISWA 1NIUA 3RLGA 4JY8A 4KERA 2OMAA 5C7HA 1EB3A 2BXYA 5CJNA 3OGVA 1WAUA 1XIDA 1VCFA 4MKNA 3RLHA 1QAPA 1PTGA 3U9IA 1M3UA 2B81A 2BGSA 4LU0A 1GTEA 4WXZA 1UKQA 3LB0A 1IEVA 2QR6A 1U1HA 4UTMA 3B8TA 2WCAA 1EJTC 4IPPA 3GQYA 3FFSA 2Y7GA 3NQ7A 3LK6A 3TNOA 4DF0A 1LT8A 4OFCA 3VOFA 3NQDA 3MJYA 1K1DA 4KCUA 1TTPA 1A5LC 1XCFA 1SZGA 4XD5A 2ZRUA 3F4NA 2J8TA 3BQ6A 3XISA 4JYDA 1V7AA 3W6LA 1XLFA 2TPSA 3MI6A 3CZ8A 4GD0A 1J8VA 3LRMA 2BTMA 3D0CA 3L4XA 4LW7A 3UR5A 3REQB 3BURA 1KCZA 4H4IA 5BXPA 3WD3A 4TO8A 3SJ3A 4YHGA 3K30A 4UNLA 1R46A 3PNUA 4GYJA 4ZQOA 1NOWA 4X0VA 4GABA 4PRTA 3FXGA 5D33A 4L1GA 1E3XA 4B91A 1G7VA 8TIMA 3R79A 3CMGA 2ZTJA 5C2XA 1UUMA 2WHMA 4H00A 3WUEA 4J3SA 2O92A 3A23A 4A3HA 3PN8A 2OKTA 1VS1A 3TMQA 4DELA 2J9ZA 1GQIA 3ENLA 1CGUA 2A7RA 1EZWA 3WK2A 1I2NA 1KQYA 1DWJM 2WZMA 1FWCC 3CXOA 1JXJA 1SZRA 4G8TA 1IGWA 4O54A 3D3FA 2I5IA 5D8WA 2W5FA 1GOWA 1R5YA 1UR4A 3SO7A 2FPYA 1MYRA 3G8RA 4WVXA 5CC5A 4PMUA 1BWKA 1BG9A 1CZ1A 3DKLA 4BQ2A 3AXKA 2VNCA 3PAOA 2ISDA 3GVGA 3M6YA 3P61A 1X8CA 2TRSA 3OVRA 3CYJA 2VI0A 2JEQA 1CPUA 3E0VA 3W1TA 4YU1A 1Z89A 3NVTA 2Y7FA 4JFWA 4KRZA 2EG8A 1E6RA 4ZFCA 2PPGA 1LG1A 1RPXA 5HPCA 1TPDA 1OABA 1MUWA 2RDUA 1TO3A 4HPGA 2ZZ1A 3C2VA 2E5DA 2BNJA 4RZBA 4J28A 1AQMA 3QPZA 5L9FA 4XAYA 3MUZ1 1A0DA 1XXXA 1J93A 4J35A 1AW2A 4J7RA 2P10A 4TU1A 4W7WA 3KOZA 5AHMA 4AYSA 5F1UA 1TTQA 1OY0A 2Y8KA 1B31A 2YA0A 1LQ2A 1RLCL 1LLZA 1WP6A 4KQNA 1NWSA 2YXOA 2POZA 1E1CB 1VCGA 3PTDA 4UFJA 1S5TA 4DO4A 1OCQA 3UESA 5I3FA 5I24A 1BYBA 5BRQA 3PUDA 1AH0A 1TELA 3B9OA 4X3ZA 3GTFA 1N2VA 4O0ZA 3FKRA 2YDRA 4Z1BA 1GQLA 1QI5A 1ICSA 4KRTA 6ENLA 1ITUA 2PLMA 1J9YA 3N2OA 1F6YA 3THUA 3FVDA 1JYNA 3KM8A 1DJXA 1E6QM 2GFTA 4WJEA 2RKXA 3QXBA 2OWXA 4Q4PA 4UQCA 1OWQA 3R0UA 4MYAA 3CPRA 5EMJA 2QCGA 4NU7A 4WUIA 2OT0A 1QMLA 2X8RA 1S2WA 1Z32X 2J9YA 4DBDA 2C1HA 1FHDA 4J3UA 5A1AA 3MCMA 3OG2A 3LXBA 4UZUA 1YPIA 3GXNA 4ZTXA 4ERGA 4C7DA 5A8OA 3FN9A 3NCOA 3WBXA 5C6MA 3FEQA 3TN4A 2TAAA 4YPJA 1W3TA 3MUCA 3T9PA 1XYMA 1FY6A 5A6TC 5KSWA 3CQHA 1BSLA 3FJ6A 1YLVA 3JS3A 4F0SA 3K1GA 4ZO9A 2D24A 3IIXA 3UR7A 4WEVX 3WDRA 4HNCA 1S2TA 1DL3A 3NQGA 1GHRA 4P8WA 1LUCB 4FO4A 3UWUA 3N9KA 4ZO8A 2PRHA 1GG0A 1NELA 1Q7ZA 3E0FA 2W6RA 5LIXX 2RDWA 4KEUA 4NIRA 1VFSA 2E1WA 2G0WA 5HNTA 3D46A 2RJGA 2OT1A 4H8VA 2YA2A 1Q8AA 3M43A 3RM8A 3W1NA 4HD5A 4MNLA 4ENLA 3KRBA 3UW6A 3QFEA 4F0MA 5CSUA 3SQSA 3BAXA 1R9ZA 3G24A 3BGGA 3WQ6A 3A9IA 3V0TA 5K2ZA 3HPSA 4GKLA 2WSKA 4H9VA 2PDJA 4QIUA 3S5OA 2QQ6A 2NSXA 5C2CA 3DERA 3T07A 3H2OA 5BZAA 5F2MA 1ML1A 1V5XA 4FHAA 3TOPA 1KBIA 4CD8A 1J11A 3KZPA 5LHEA 2WW5A 4IZGA 3DFPA 4MDOA 1AD4A 1KRMA 2P0OA 2VCCA 4BY3A 5JIWA 3RIKA 1E55A 2Q8XA 3HA1A 2HISA 1X96A 4NHVA 1E70M 4I9TA 3H55A 5CXPA 4F0HA 4PBFA 1LOLA 2H8ZA 3IJLA 4US5A 1G01A 5G4EA 3Q4DA 4HJWA 2CKRA 1N7KA 3H70A 3W23A 5BMWA 1QWKA 1R7OA 2VR5A 2ZE3A 1WUEA 4NZ3A 2NQ9A 2PSNA 4U33A 4B5NA 4U5KA 1PTAA 1XX1A 4KWWA 4GQRA 4AX7A 3UZJA 3WQWA 3PPFA 4HHPA 3CV2A 3NQ2A 1YDNA 4MWAA 3UXDA 2INFA 4MGGA 3UBPC 1DWGM 2ZX5A 4FF7A 1R85A 1PKLA 2C19A 3PB2A 4ZENA 3OQ8A 2WLYA 4QE4A 4I9AA 2CBIA 5HBFA 3KP1A 3SDOA 1W3LA 1BF2A 3GZAA 3WNLA 3F4WA 3ZZ1A 2V63A 4GNVA 1GPFA 1EH9A 2VUNA 4GC4A 3DI0A 2BGNE 1E0TA 4OUEA 4O52A 6REQB 3GIYA 4HCLA 4A3YA 2PCEA 4I3GA 4D6IA 2ISFA 3UERA 1A3HA 1G94A 2GL5A 4L61A 6CGTA 2GGJA 1XL9A 3AMKA 4CNNA 4BI5A 2PS2A 3WF1A 5BROA 2OLHA 3QEZA 3VM5A 3PNZA 4V28A 2OZ3A 4FZIA 2EJAA 3T08A 4JX5A 2YCKX 5HQEA 5TQLA 1X1ZA 3MP3A 4UBPC 3TZFA 2PGWA 3POCA 2F6UA 4AF0B 1MVYA 3G6LA 3SN1A 2ISSA 1W56A 5M17A 3WJYA 3BLKA 3REQA 4IFKB 2QVHA 4ONVA 4N2YA 4UNIA 2RUSA 2OO6A 4GX8A 4Z1YA 4PSPA 1U5HA 1E4LA 3TU9A 4JY9A 2OLSA 4TX6A 1LRNA 5A6SA 5FOOA 1CXLA 5T26A 3Q58A 3RR4A 3NQCA 4N4QA 4ZFMA 5XIMA 4MNJA 3T1GA 4DWSC 4LALA 4O10A 4JIHA 3LZ3A 3L21A 4V33A 1T6MA 1EC7A 4U2ZA 1VHNA 4US5D 3UPMA 1FP9A 4DX3A 3MUXA 4URIA 1QOPA 3BDKA 3VD3A 3VD5A 4HB7A 1OYAA 3KAOA 1MFVA 2WWDA 3TXZA 5AZ1A 2YL8A 4K6AA 4ACYA 4ZXOA 4W7UA 4QISA 3URNA 1US2A 2EXOA 5DCEA 4FP1A 1XIJA 2E40A 4H9MA 3DG7A 3ARQA 2G5WA 3W1MA 1U2YA 3AIEA 5AOUA 3BZJA 4L9XA 1JZ3A 1OIFA 4MWAD 1XV8A 1UBSA 4GC3A 4PUUA 1XKJA 1LOQA 2B7QA 3W86A 2H90A 3R2GA 5FEWA 1GYNA 1P4CA 4ZB5A 3N11A 5I0DA 4RDWA 2D69A 4R34A 3W75A 3T4CA 3LTYA 3HF3A 4F66A 1JF5A 1LCOA 4JTCA 1XIEA 2WSRA 1VIWA 3SN0A 3LM3A 3UD6A 1VC4A 3IJ9A 3S83A 3DHUA 3BV7A 4KFPA 1WZAA 2WC7A 3GYEA 3H24A 5CC6A 3ZJ7A 3VKJA 1J6PA 2Z26A 3C8NA 2DZSA 4FK9A 3GBDA 4AUBA 2GJLA 1ZNNA 1OADA 2PDGA 4FLRA 3N73A 4MB5A 2DZAA 3NDZA 1L8PA 1EYEA 2PD5A 1OC6A 2NWRA 4GI4A 2EJ1A 4G1NA 3NURA 4O8RA 2QAFA 1EJ7L 3IPWA 2VZTA 2BLEA 3HGJA 5G1YA 1ECEA 3PBWA 1JEZA 5ABEA 3C2FA 3ZVIA 1IT0A 4L56A 7XIMA 3BXWA 4AIBA 4IGSA 2Y2WA 1E1CA 1TVLA 1GTHA 3OPSA 2PE4A 1K4GA 4IMAA 5F2IA 4Y8EA 4Z2JA 3PWAA 2X05A 3N29A 1S2CA 4KEMA 3W7OA 2XVPA 4XO7A 2FB2A 3R25A 1Z41A 3W73A 1N8WA 4ZE5A 2PRLA 4P8UA 2DUXA 3AXXA 3BMVA 1NOFA 2HNHA 1KR0A 4JX4A 2HE5A 2UY4A 1W3NA 3H8AA 1UC4A 1YYAA 3OQEA 2CLMA 2BHYA 4GACA 2AOSA 3GDTA 2XINA 3JZUA 5AVHA 5C70A 4BI7A 1SSGA 5CPOA 1BTMA 1S5MA 4JTTA 5IXEA 1ZBVA 4UFKA 4C6IA 1GOXA 3EXTA 4MUZA 3O6AA 4LJ3A 5GNYA 2YOCA 1XGDA 1DJWA 3QOMA 1WDQA 3T7VA 4AD1A 3DFTA 3CHEA 4IPJA 5CJ5A 3CZEA 1EGZA 4LUTB 4JQ2A 4FALA 1RBAA 2ZX7A 2QF7A 3GAYA 1EIBA 4LXFA 5A2BA 5A8QA 2WMKA 1V93A 1EJUC 2O9RA 3NM3A 5E1QA 3W3OA 4KF1A 1GOQA 3TJXA 2V81A 3E6EA 3NO3A 4JX6A 4FNTA 3VNYA 4WQ6A 1LBFA 3P80A 1MQRA 2VX5A 4HT3A 1UUOA 1VFLA 1IXNA 2IMRA 2WVSA 1LUCA 4I7WA 2GSJA 3AU6A 5C9UA 4CNTA 2E1DA 1K02A 2VX4A 4V2XA 2PC4A 4KCWA 1PKYA 2VC6A 2H3DA 2VTFA 2GUUA 2WNWA 3NDYA 4JTRA 1F61A 1XLCA 3UJEA 1BXCA 3WNKA 2IKJA 3VOCA 3HN3A 3SY8A 3ID7A 2VELA 4YHEA 3OZYA 2PWUA 5GVJA 1DQXA 1AZ1A 1QTWA 3ISIX 2G3JA 4HA3A 3ES8A 3M44A 5BOFA 1CENA 3E3HA 5HMFA 4FNPA 1TMHA 1HN1A 3TR9A 3LENA 4HBKA 4Q4RA 2PP0A 3KS6A 1G1YA 3EDDA 4J5NA 4KEVA 4XISA 4ERAA 1XINA 3ERPA 3CIWA 1PPIA 2IPGA 4B4FA 7ENLA 4L5ZA 1CTNA 3K4DA 4WGXA 2GVYA 2Y5EA 2QLYA 2ZOXA 3VNMA 1HKWA 1K8YA 3BSMA 1E56A 3F4VA 3BLIA 4IX2A 5G1MA 4W87A 3HJEA 3DG6A 4QITA 2FLIA 3P93A 1KTCA 4QSFA 2IQ0A 4DI8A 3T8LA 2QJMA 2PCQA 3ZR5A 2F38A 8XIMA 1MSSA 2PEVA 3W72A 3ANVA 2AGTA 1IIGA 3RU8X 1ITXA 3LTPA 1B4EA 3DHFA 3IUHA 4LNCA 2DIEA 3NPVA 4Z17A 4S3AA 4LV4A 3UG8A 3HMJG 4L65A 1R87A 3FDKA 4XAFA 1WE5A 2E8YA 4R33A 1UKPA 4QGCA 1KFBA 2XGZA 1ONWA 4I5XA 3KRUA 3W25A 7A3HA 2GZXA 2A0NA 4A3QA 1W5MA 3TYUA 1W9VA 6REQA 1XIIA 3L4TA 1F73A 2ZE0A 2YBTA 4MWAE 1O7AA 3GXTA 3NM1A 4LCRA 5FL0A 1HQTA 2ZUUA 1R3YA 1R86A 2MNRA 5DF0A 1EOKA 1D2KA 1XDJA 3PBVA 2XM1A 3AI0A 3H26A 3CZLA 1LM1A 1BYDA 3MO4A 1HJSA 3ZLHA 4DYKA 3LGGA 3A47A 2PDNA 3T2OA 2Y61A 1E4NA 4LB4A 3NFUA 4KETA 1QDSA 4HA0A 3RILA 4MHBA 5C9ZA 3QW3A 3AC0A 3UR8A 3N15A 4HNTA 1YNYA 1JCLA 3H4XA 1Q2RA 2POTA 3VNKA 2CCRA 4RNHA 4DPPA 4GNKB 4JHMA 1FH8A 4MY1A 4NQ1A 5FJRA 1ELSA 4ZOEA 2G8ZA 1GW9A 5A8GA 5AVNA 1YTKA 4R9OA 2Z1XA 5CZKA 5LNUA 3UNDA 4LWWA 3SY1A 4PTWA 5D30A 4NT0A 3GBEA 5HR6A 4GK8A 1YBQB 3KDOA 4GZIA 5FJJA 4ERIA 2ABBA 3BQ5A 1HGYA 1W17A 3WBEA 4AU0A 1EL3A 3V5FA 1EX5A 3T09A 4BHYA 3QY6A 4GJ1A 4LAMA 4GO9A 1QCWA 1ZP3A 3K13A 4R27A 3CQ0A 5BU6A 3WLLA 4F2UA 3IGSA 4MDPA 4DZ5A 1SJAA 1EOMA 3VOIA 4ADTA 1ZJBA 4LY8A 4H3DA 4JICA 2QULA 2WWCA 3M0MA 2FZ8A 4LEQA 4HHLA 2VC5A 4MLRA 5EBUA 1PAMA 4V27A 3R8GA 1W2PA 2R91A 4JTLA 2VGIA 5IHRA 3W7LA 3H7VA 1SUXA 1LRQA 1EXBA 4HN8A 1XLLA 4JR5A 1U33A 3CLWA 4XO6A 3PZIA 1A5MC 3DG3A 3CAWA 1UR8A 1DWHM 2PDBA 3SIZA 1SYTA 3UCDA 1EBHA 3W37A 3TAOA 5A6JA 3W81A 4MFDA 1PXGA 1UBPC 1ZUAX 4IUGA 4D8ZA 1UD3A 3OZOA 3P62A 2A3HA 1WXZA 5MHBA 1TR1A 2QKFA 3QMTA 1ODUA 1GWJA 3T2PA 1KXQA 3W7JA 1A0CA 1E40A 4MG4A 4BA0A 1SR9A 4M24A 1U5VA 4HSNA 3FA4A 3GFZA 4R7OA 3CZGA 1HF6A 3DYPA 1XDLA 1XR2A 4YXGA 2CBVA 1NM9A 2DFAA 1BFNA 3VNZA 4GVIA 1JGMA 1A4MA 2E9LA 1SO5A 1M9HA 4IJBA 4I5RA 2XTKA 2NVCA 3S46A 2GGHA 4PSRA 4Z1CA 1IEXA 3D5HA 2G3MA 4FNUA 4CD5A 3EWXA 3B0UX 1LQ0A 2YGYA 4ZSTA 2BOGX 3E02A 3VX1A 3U8GA 1KFCA 2G50A 4JEJA 1JNDA 2GVJA 1W1VA 2Y8UA 4US6A 3A3HA 2VGGA 3RHGA 3MVTA 1V3LA 3T0CA 3AO0A 5JVLA 4NZ5A 3GH4A 4PMXA 1JULA 2VEIA 2VT0A 3MU7A 4GZEA 3WNPA 1Y65A 1KM5A 4Q8NA 3RU6A 1OQFA 4ZQPA 1Z48A 1XISA 5CZ0A 3N9RA 3OGSA 2D22A 4QDWA 5I79A 5HXMA 3VIFA 3HJZA 2W3ZA 1FDJA 1S46A 1WCGA 3ITLA 5CPLA 2WVTA 4NASA 1MZRA 3Q37A 2DZUA 3K4AA 4PMVA 4I8YA 1SW3A 3LHWA 4JHOA 2BBFA 2ZXAA 1W9PA 2QGYA 3EB3A 4LUTA 4XIAA 3TTOA 4AW7A 2BDQA 2E25A 5J04A 2AL2B 3KXQA 1H5VA 1FWAC 2EGZA 2VRJA 3PUOA 3DHDA 1KV8A 4MVAA 3EOUA 5E9AA 3MUIA 2VRQA 3TYDA 3FA5A 5DBUA 2ZRXA 1QHOA 2CETA 3CHVA 4JS3A 4QJ3B 4C6KA 4GFSA 2ONEA 3C3NA 1IEWA 5DCBA 5DRIA 1Q6OA 3TIMA 4H6QA 3LV5A 1NWRA 3VKKA 2VWSA 2IPFA 4Q33A 4Q8QA 2AGKA 5AC6A 2QUMA 1ZB5A 4JBRA 3CH9A 3ECQA 3VI2A 3G1DA 4EF8A 3UY7A 3S5YA 3TC7A 3MHGA 3VDCA 4RE2A 4H1ZA 2I9EA 3UG4A 2XWDA 1CIUA 5C9WA 1JZ2A 4HYVA 1XYFA 1H5YA 1UP2A 3PBYA 5ENLA 4JFVA 2BY0A 5CH9A 1WX0A 1FDZA 3CYVA 3EPMA 1I8JA 1GVIA 4AAJA 2BFGA 1JZ5A 2QZRA 4K1WA 4X22A 4GRSA 1EJWC 5CJMA 3O2LA 2XH4A 1RA0A 1AQ0A 4IMDA 3CHCA 1X38A 3PSWA 3BLDA 5EKYA 4MLJA 3WQDA 5DBTA 3S1VA 4B9ZA 4XWUA 1ONRA 2PGRA 2JKAA 1IF2A 3LHUA 3ATYA 3TQPA 4D8LA 5G4WA 3EAUA 3S9YA 2MANA 1VBGA 5I23A 4Y9NA 2FH8A 4HTYA 5A2AA 3S2MA 4B16A 4L6HA 2QUVA 3UJ2A 1F76A 4KEZA 1Q13A 3CO8A 3P8JA 1KWGA 1QI4A 2WJZA 3PB0A 1UYQA 2CW6A 2PDWA 3OYZA 5KEZA 1EP2A 2G4FA 3T55A 4DEFA 1UZ4A 1KM6A 3FHAA 2DSKA 1NU5A 1OCBA 4QAWA 1A5BA 4M7SA 3LXCA 4UXDA 4N9DA 4PMQA 3ALGA 4CU8A 5K4XA 1P1XA 4JKMA 3CB8A 1GVEA 4RUBA 4QTGA 4P61A 1UPPA 3TJ4A 3TYZA 1L0PA 1W3IA 1HXJA 3GX9A 3QTPA 1F8IA 2XWEA 1K8XA 4RJEA 2NW0A 1NH6A 1TZZA 4ADSA 5HNRA 3ZVHB 1NFBA 3FAXA 3KRSA 2WJDA 3AYVA 4RNFA 4QHRA 1N82A 1VFFA 2E67A 3CEUA 2YR1A 1JPIA 1DQUA 3ARUA 2I1OA 2QUTA 3S2LA 3IIVA 3HZ3A 3WF3A 5HJYA 5ABFB 1JCXA 3QPEA 1BEUA 2V5KA 3WQ4A 4RPPA 3N4FA 3STPA 2NT1A 3MBFA 5JH2A 3U57A 4DHGA 2Y7DA 4XAGA 3R8HA 2GVGA 3AZTA 5A94A 1Z3NA 1JCYA 1A5CA 3R0KA 4JGDA 1LOSA 4DBWA 2PLKA 3NSMA 4GXPA 1F07A 1ME7A 3TJIA 2DEPA 2YCJA 3O06A 3UWZA 3WEZA 3GY1A 4O15A 4JAWA 3WL0A 3W7NA 4K8EA 1I2QA 4GE8A 3ATZA 1JPHA 1W9BM 3CUJA 1BYCA 5EMUA 4AC7C 3N2TA 4LYKA 2ZZ7A 3IUIA 3CHFA 2VR4A 3MYPA 3QZEA 1A80A 1FOBA 5FJOA 4QJ4B 3GU2A 2E28A 1OZQA 2XH2A 2F7FA 2J78A 1YBQA 3H53A 5FAJA 2H3BA 4AZBA 1FCVA 1OZMA 1P0NA 2IQDA 4GYKA 3T6CA 4DLFA 4YJ5A 4ZB0A 3ZLFA 4WSKA 1D9EA 2DZPA 3ZR4A 3W01A 2P76A 5LA1A 3AISA 3C6CA 2J24A 4Y2WA 1CXFA 3FJLA 4H6KA 2VHLA 1XJBA 2WZTA 4S3EA 4B5TA 1JAKA 1YDVA 2V2HA 1GKQA 2QGHA 4HSOA 3QHOA 3L7RA 1UHVA 3GNOA 1XF0A 1XYCA 5I78A 1I2OA 1XFBA 4AC1X 1GNXA 2J88A 3T40A 1YE4A 1JJKA 3Q67A 1AMYA 3AJ7A 2DH3A 2WSQA 4U4MA 4NUWA 2BY2A 2Z27A 1F74A 3RNDA 3B97A 3QW4B 2VCBA 1E51A 4PGLA 4WY0B 1RZMA 1O68A 3P0WA 3VUSA 3HQNA 1XUUA 2QW5A 3RJYA 3WMBA 3GC2A 3QR3A 1ZAIA 1DJHA 4EVZA 3LHVA 4PFMA 3PC0A 1VH7A 3PP7A 4JNYA 4LYRA 5M03A 1WNOA 4F48A 4JCLA 3VZXA 3B4YA 3T0TA 4WSJA 3AIWA 3VIIA 4Z2LA 3IUDA 3HIJA 5DELA 5JMUA 1SVDA 3W2MA 1OF8A 1H1ZA 1R3VA 2ZXQA 3I6EA 2XIQA 4NJJA 3EDKA 3E0IA 4XZMX 3H23A 4H83A 3I3DA 3N6JA 4H6RA 4NYYA 1WXJA 5AN7A 1NARA 2BVYA 4C1NB 2VM8A 4AY1A 1DXFA 4YTTA 4AWUA 4A21A 2B31A 1F4HA 2FFCA 2ODOA 1O60A 3V1PA 2C91A 2W62A 1SJDA 4U10A 1C9DA 1NQKA 2ADAA 5FJIA 4EPKA 1X98A 3VABA 1MO0A 1UD6A 1S38A 1PBGA 4L6DA 1EKOA 3FCPA 3G0UA 2XH7A 2OSWA 4L80A 4Z1DA 3B8VA 1RHCA 4QBXA 4LH8A 3WBAA 1TWDA 3RCMA 1FFQA 5G5IA 4B3KA 2HE8A 1J12A 4JNZA 3DCPA 2YZ5A 5TAOA 3U2EA 3N4AA 3LERA 2DVTA 3KLLA 1LRTA 4O13A 4CN4A 3LHZA 1QO2A 2Q02A 2F84A 3QHNA 2AL2A 1B2YA 4HNOA 3KHJA 2PU0A 5FF4A 1PZ2A 1TE1A 2BG5A 3WJZA 1L2UA 1CGTA 2DZVA 3KCJA 1NWUA 4GXWA 2QCCA 1V3IA 3CAKA 3W1QA 4DNHA 3NOYA 3A4WA 4DRSA 4FXFA 2WOQA 4PH6A 3BOLA 1I2RA 2F6XA 5JU6A 2VEKA 1KRCC 3EX3A 2JE8A 2G97A 1M01A 1CLXA 1PZ1A 2CERA 2VD8A 1I2PA 4OU1A 4Q8MA 3FYPA 1GT8A 1KCLA 3NQ6A 4NZFA 2V5DA 1KRAC 4BF9A 3EWWA 1I60A 4N4PA 1VB9A 1XIHA 5HK4A 5A95A 3GKFA 3CPGA 3UCCA 3VDBA 2OQHA 1KQZA 1YHTA 3IJ8A 2PBGA 3FKKA 1WV2A 3T42A 1JPDX 4FLQA 2GOKA 2BSLA 4PMNA 1PX3A 5A8PA 3DFSA 4E4FA 4EANA 1JNEA 3L66A 4JN7A 2WB5A 3AMDA 4WOQA 2V3EA 5FIPA 1UH3A 1F4AA 3I6TA 4LF2A 1VBRA 2CLFA 3E38A 3N2XA 4LRSA 4W84A 4PRRA 4MPKA 1R3TA 2NLIA 3V18A 4X0NA 2XFRA 2ZX6A 5CSSA 3L5AA 3QHMA 2DSWA 1DWFM 5LA2A 3LHTA 3SCQA 1GJWA 1B1YA 4O16A 2XIJA 4TVCA 3KS5A 4S1FA 1DOSA 1VEPA 3CTTA 3VGDA 4NJHA 4AY8A 3MDUA 2XZ7A 4ZOAA 1KCKA 4HNNA 2I9UA 2PDQA 1FHLA 1JZ8A 5FJUA 3QF0A 1H62A 1VRDA 2HK0A 3RX3A 3AFBA 1Q5MA 1V6YA 3CL8A 4D6EA 2YKKA 4ZMGA 1QNVA 2J27A 2NT0A 2VVSA 4UOJA 2DT3A 3BMXA 4GKTA 1VR6A 5AC4A 2GSHA 1MNSA 3NGFA 1XLJA 3BCJA 1ITQA 5D03A 3HG5A 3ZO9A 2RAGA 1XCXA 3GU1A 3ZVHA 4TR9A 4ZEPA 3HG2A 4MZ1A 2DW6A 4GYPA 6A3HA 3LX9A 4NILA 1KV5A 3VO0A 4PUMA 3R89A 4G7EB 1IT7A 2ZICA 2YYUA 1TV5A 4IFOA 3VU2A 1XYBA 4UB9A 5ABFA 2P50A 2R8WA 3C56A 3VGGA 2Q8ZA 4WR3A 1GORA 5D9NA 4JFSA 4FF5A 5H2ZA 3JW7A 2HBVA 5ABGA 1OF6A 3GR8A 3KDNA 5E6ZA 3IJ7A 4JTGA 1AH3A 4W5UA 2QDDA 1L9WA 1AL8A 4CCEA 3APYA 2CIPA 2G95A 1V03A 3ZR6A 2C15A 2BP1A 3TTSA 3VIHA 3SCWA 1W9UA 1GQKA 2TMDA 3LLFA 3V0UA 3PWGA 3H6OA 1QNOA 2FVLA 1XBVA 2R9RA 3AICA 1B3YA 3MHUA 4MZ8A 1XRTA 3GFYA 5EMYA 2BX7A 4WIWA 1UH2A 1VD6A 2PB1A 3W84A 2I14A 4KIRA 1UIOA 2EKGA 2QCMA 4O28A 2VJXA 1X7IA 1GKPA 1YNQA 4AEFA 2ZQ0A 1V4YA 4JTIA 4LRTA 1X6UA 1GONA 4FEZA 5HWMA 4PMRA 1A0EA 5A8NA 1W32A 4HA4A 3URQA 2W79A 5D9PA 5CAHA 3FDGA 1GVYA 1A4LA 3R43A 2JFEX 4NNCA 3ITVA 4LANA 3ITYA 1Z69A 1MUCA 2HS6A 3OYXA 1XD1A 3FAWA 4MZYA 4HK7A 3HFYA 1FHVA 2O7SA 3I6RA 2OZ8A 4FIRA 5IM51 6XIMA 1FH7A 3QV7A 3CH0A 2JF6A 1MEWA 2X1UA 1KM3A 4WY0A 1QFEA 1JAEA 2DDXA 2IQTA 2PF8A 1SO4A 3GU9A 4F0RA 5AY7A 5A6MA 2ATMA 3F7JA 1ICPA 3WDJA 1UWQA 1K77A 5I2UA 3M0JA 1OINA 4CQBA 4NZJA 3M5ZA 3P7YA 3P74A 3L65A 2YX0A 3M0XA 5AC5A 3W7IA 3EB4A 1YPFA 1JI1A 1OCNA 1W1PA 5D02A 1B3XA 3GW3A 3MY9A 4WSHA 3OLEA 5G1TA 3MKVA 3D6NA 5D2XA 4WKHA 2O56A 1TKKA 2JGYA 1QRQA 3UZZA 1EWEA 4C1NA 1MRQA 2GJRA 4MTVA 4RLIA 1ONXA 5LIWX 5KZ6A 3PZUA 3AQUA 2NX3A 4KWVA 4HNLA 3GR4A 4A2RA 2ZUWA 3BSGA 4WD0A 4OKDA 1VFHA 1P48A 3AIVA 3QZ6A 4CN1A 3UNTA 3CUGA 1BKHA 5MKGA 4WY0F 1G4SA 3DU0A 1DXEA 2C0HA 1RVGA 3GHTA 1DIEA 1RJPA 3BGAA 2IXUA 3HPAA 1PWMA 3AYTA 1CLVA 2C7FA 3TLLA 3I7QA 1VPYA 3PZMA 3BLLA 2P88A 4GFIA 2W92A 1YQ2A 3R0DA 3WD2A 1W5QA 3OHMB 3U7BA 1P0KA 1JUBA 4R9XA 2A3CA 2Q01A 2ZX8A 2QCEA 1SZNA 3O6YX 5CSRA 1B3WA 4HVXA 1M04A 1X7FA 1Q65A 3A4XA 1B90A 2MUCA 4DO6A 4ZQNA 3MQTA 2D2HA 1E0VA 3SCUA 3VNLA 2FGLA 3R5EA 1SZFA 1FWEC 4YL2A 1YW1A 5AC7A 3L23A 3G1YA 3SY5A 2OELA 2WNQA 4KCTA 4L9ZA 3SUUA 3A4AA 4DNMA 1AJZA 1MNZA 4NSBA 3WQOA 3S1WA 3C4UA 4DY1A 3WLSA 2ALRA 1H1NA 3VOHA 1QBBA 4PTVA 4C6EA 1QOXA 1UP0A 3W70A 2DZBA 3L0GA 2J66A 3KOWA 3VMOA 4EPEC 3PUGA 5GNZA 4PMOA 1AW5A 4M81A 3WQCA 1SFLA 3GW0A 3LZ5A 2DIKA 2YFNA 1TJPA 2ZUMA 4W8BA 1E5NA 3S5NA 1L2QA 4BI6A 3LPOA 4DUWA 4BEUA 1GPWA 3DENA 4OQVA 1O12A 4O1DA 3IJQA 1FWSA 3UT0A 3LMZA 3ARTA 1T8XA 2BY3A 1RXOB 4LPCA 3VGFA 3K8KA 3C86A 1GK8A 3C0QA 3EGJA 4H9YA 3N13A 3MBDA 1KXTA 4PCPA 1H4PA 1R0MA 4DJDD 5U7SA 1TTIA 2NV2A 3CQJA 2IXVA 4AWTA 2AQVA 1C9WA 2D1ZA 3MO7A 2V3DA 4H2CA 3PJWA 2VQUA 2ZDSA 3V16A 2EEXA 1TV2A 3DKJA 1HP5A 2QMKA 2W4XA 2PAJA 1Q6GA 4CNSA 4DJED 3L4WA 3ZT6A 4AD2A 2Y62A 2WNZA 1KGWA 5A6LA 2C13A 1KKRA 2Y8VA 5HINA 1ZBKA 2HZGA 1A3XA 2Y6ZA 3VKDA 3BOFA 1UH4A 4IIBA 4AB4A 3VVGA 3IRDA 3BG5A 4PL1A 3TQVA 3E0LA 1ITCA 1QK0A 1JRBA 4PCTA 1KWKA 3E96A 2CWNA 1NP0A 1KM0A 4DI9A 4GA8A 3RPDA 4LCSA 1WAWA 3G0SA 3TLQA 1RH9A 4D71A 3WF2A 3U6WA 4NYUA 1RUSA 5BMXA 3LN3A 2ZRZA 1CGYA 3CV7A 1ONEA 1E6XM 1CGVA 1EX1A 4WDUA 2PURA 2J25A 2VOMA 2RH9A 4AY7A 1A47A 2EBNA 1AQFA 4C6CA 4G7EA 1ZP4A 1ZJHA 4ZXLA 3W24A 1Q66A 1E6PA 3OEXA 4CQ9A 4A8NA 3N19B 4ICCX 5DXYA 3TC3A 2DT1A 4L9YA 3H4GA 1R2TA 4AZGA 2AAMA 3WK1A 1XIFA 3EA2A 2BODX 3OA5A 1FH9A 5E09A 2OSXA 1RCQA 3KBSA 2OQYA 4CCDA 1T41A 1JYVA 1E71M 4TXEA 2FDSA 2WMFA 1KXVA 4UC5A 3G8EA 2G3IA 3UYCA 4B90A 1TIWA 1FXPA 1TPH1 3MJMA 3PFRA 3B03A 3N14A 3IJDA 3B0YA 1QPNA 1TJRA 1XLGA 2IS7A 2CYGA 2YXGA 3O0KA 2CLEA 3ZYZA 1XS2A 2J62A 2CU0A 2J7BA 3KTSA 1VFUA 2DQXA 2ASHA 2FPVA 1K8CA 1YDOA 1WDRA 1ZENA 3NZGA 1PL9A 1RVKA 1OBAA 3XINA 1KBJA 1WQ5A 4C6NA 5LKYA 3ZQ9A 3DX5A 1Q3NA 3SFKA 4DJEC 4GUGA 2ZUTA 1LROA 5CPTA 1B3VA 4IQJA 1VQTA 4C6MA 3IJ6A 4NJIA 3POHA 4PCSA 2HXTA 2D3LA 2FH6A 1MUMA 2DJLA 3AS1A 4UNKA 1V02A 3IIOA 3EKGA 4GY7A 3BVJA 1E72M 1Q63A 3LCGA 1QWGA 2ZKMX 2RHGA 1TTJA 4GQ0A 4DXVA 2DVUA 3VD9A 3RDKA 3LBMA 1XICA 2C79A 3S2NA 5I03A 3WX7A 4D1IA 1UOKA 2VWTA 3LGDA 3VDGA 7PTDA 3HOJA 3GNNA 4AG0A 4C6PA 3IS4A 3FVMA 3W7KA 1AUSL 1OD0A 4GIRA 1DIDA 1XC6A 4EXQA 1TREA 1P0BA 3RGTA 1VBHA 2A4AA 5KETA 2DU2A 5IFPA 4HPNA 2ZFAA 3PUEA 3TCSA 4QNEA 3GHUA 4EOUA 3PZOA 3NSNA 2VC9A 2E0PA 5DN1A 4NZ4A 1Y5WA 1LZOA 1EJXC 3P8IA 3VINA 4GX9A 5F4WA 1ALDA 2X7VA 3BLOA 4B5WA 3RLVA 4AMCA 2CBUA 9CGTA 1W54A 4MY9A 1OGBA 3OOQA 3GB6A 4EPDC 5IBXC 4V1XA 3JVAA 4TVDA 3NO1A 2OQLA 3QGKC 2XVGA 4GO8A 1E9IA 5HQLA 3UPWA 2WC3A 4I5UA 2FJKA 1P6WA 3ORWA 2VZSA 2P8CA 5C9RA 2HXUA 3GH7A 1P0DA 4IMGA 1YX1A 4IG2B 1UZ1A 3DECA 3CC1A 3WFLA 4B4HA 3R10A 3LCFA 2OGJA 4N9BA 1ZL1A 1DJYA 1TPFA 1VEOA 2A3EA 1H7XA 4B92A 1VJSA 1VZWA 5JBFA 2P3ZA 3SGUA 3WK3A 2Y7EA 3AIQA 3WQ8A 5F4SA 4M6VA 2QVNA 3WELA 1HFBA 4XG1A 3QKZA 4UUIA 4KFNA 3TW7A 3RRXA 1FWNA 4ZL1A 1UASA 2BOEX 4LVFA 1OFEA 3TYCA 5SWUA 4AZIA 2XGIA 4M5PA 3E1F1 3KVLA 3ARXA 4B9YA 4MB3A 2OG9A 5HMDA 3RX4A 3IARA 1W1IE 3APTA 3CL7A 3UVIA 3SFWA 3GUGA 4A8IA 3CUZA 3MANA 4MPQA 1QNRA 2AMGA 3BJFA 1TPVA 1PX8A 2CPUA 3OVGA 4O4WA 5BXSA 3RITA 1J0JA 1R6WA 1C8VA 4NI8A 3NPXA 1XM3A 2PLJA 2TYSA 3E9AA 4Q8OA 3SIMA 4FX7A 1W6TA 2VL4A 5EL1A 3A24A 3OLDA 1IE7C 3QR0A 5GJPA 3R4IA 2P3EA 4L6OA 2UY3A 2FDMA 3S42A 3PWIA 2XJ7A 3WH9A 4B5XA 1PYFA 3AZRA 2VGBA 3NYZA 3BAIA 1RK6A 3B8UA 2DZXA 2WVVB 4H04A 4ZOCA 4PULA 1B9ZA 1J5TA 3WH8A 2EKCA 2NV9A 2GOUA 4Z2KA 2QDEA 3PPHA 4GI9A 2VR2A 2OEMA 4A3RA 3TC6A 2GWGA 3TNBA 2E9BA 5CPSA 2V3GA 1W3KA 1ZU8A 2FZ9A 5TF0A 3GG0A 4WOZA 3ZLGA 3W2UA 4DLMA 2OCZA 2G37A 3U0HA 3DUGA 2R1LA 3ZMRA 5I3DA 4Q6XA 1KTNA 2WZHA 3P81A 4OT7A 2NXIA 2PP3A 4UTWA 3MCNA 4B2DA 4O0KA 3C5QA 3H21A 4AXNA 3NR0A 4HIBA 1K6WA 3GVVA 4Q4KA 1W1TA 3B05A 4GY0A 2C6QA 1OT1A 2B7NA 5CAKA 2P53A 1LLOA 3IJIA 3I65A 4D6GA 4RNIA 2R94A 1M7PA 1PDZA 2OO0A 2NVAA 4W8AA 3WUGA 1TCDA 3EXRA 4DJFA 4RNJA 2GGIA 1VIZA 3KWSA 9XIMA 2OVLA 3HURA 3KVKA 2NQ5A 3SM0A 5A2CA 4HMEA 2ZC1A 3ABOA 3CWNA 1ZZMA 4KH2A 5J8LA 4X2RA 1KM4A 4H9ZA 1WDSA 3NXFA 2YDSA 3KVMA 1NTHA 1BXNA 2PA6A 3HFTA 4DM1A 1Q6RA 3HM7A 5G2WA 3OBKA 1GOOA 5FSDC 3WQGA 1HX0A 1PZ0A 3R58A 3KUMA 3L67A 1HG3A 1JPMA 3EOEA 4D8AA 1KA9F 1ZS2A 1CX9A 3KE0A 4UTTC 1C90A 4BK9A 2NQLA 5G4HC 3MSYA 2OPJA 2Q09A 1JDDA 2NWSA 5HR7A 1XPYA 3TX9A 4JHZA 4JTQA 4TX9A 2VCAA 2Z0IA 8RUCA 2CNCA 3LEPA 4XVEA 1XQKA 5M1TA 2OXNA 5F2LA 4GVFA 2BVDA 4Q32A 2PZ0A 4GZ7A 1DTUA 5I5RA 1ADSA 4G6CA 3TYAA 3TYEA 4Y96A 4REQB 4ZQMA 1XIMA 3IVUA 2VZOA 3USBA 1EJSC 2PBOA 4J1OA 5IDIA 4G7FA 5EGRA 4NL1A 4Q7IA 4UCFA 3VCNA 2C18A 1PVNA 5DFAA 4DXXA 1L6YA 4IMFA 3C0JA 5FACA 1GVRA 1Y7VA 4PMJA 4A2SA 3SEPA 4W8LA 4QG6A 4TTUA 1ZAHA 3EDFA 2Z7GA 3SR7A 3WLNA 1F8MA 2O0TA 2VFDA 2F61A 2QDHA 1ZQ5A 1M65A 3GTIA 2UY5A 2XSXA 1JFHA 1TB3A 1PUDA 2PTZA 4HP5A 1V51A 1DJQA 2QYGA 1DHKA 4DJFD 2G3FA 2Y89A 5A6KA 3ZS4A 1MQQA 4S23A 5AC8A 3ZWTA 1K7XA 5I7GA 3W7CA 1O5XA 3AMGA 1XYLA 4YMZA 4PBEA 1BAGA 1PIGA 3PM6A 3BAJA 2GPTA 2PZNA 5FA5A 1GCYA 1KFJA 2RJHA 4J3TA 2EG7A 1TZ9A 2VXNA 2QV5A 3BTNA 3NEVA 3SUWA 4ROPA 1CXEA 1OEPA 4PB5A 2X0YA 5D38A 2WKLA 2GVLA 3IK4A 1WO2A 4L7ZA 3MVIA 4F3HA 1REQA 3RRAA 4TMBA 3KBMA 1RQHA 4BJHA 4QFUA 1KFEA 2PFHA 3SI9A 4FNRA 3A3XA 1JD9A 3BCDA 5CZTA 1V02E 1SPQA 2ZBTA 3RMEA 4NAFB 4W93A 4Z42C 4UQ9A 1FWIC 2EPKX 4GXMA 1QI3A 1C7TA 4JXCA 4YCPA 3B9DA 3SCOA 1NJJA 1R2SA 2A6LA 1MXSA 1T5AA 2NQHA 3SRKA 1TUXA 2ZX9A 3ELFA 3WD1A 1CXIA 4YVVA 2YDQA 1JIBA 2WMJA 4LOCA 4P7OA 1S3HA 4WKFA 2O9PA 4TV6A 1G4PA 4NRSA 1OG6A 4HZMA 4U31A 1TIMA 1H0GA 4Z2HA 4AD0A 4EIVA 2I7GA 2CZ5A 2XSAA 5AYIA 4DUVA 5T9BG 3KL0A 1Y8BA 1FKXA 5DMMA 2QT3A 3C3UA 1EC8A 2WO5A 1LL7A 3EA1A 4Q4QA 2JQXA 3O6DA 4IG2A 1VYRA 4QJ1A 3GZ3A 4ORIA 2YFOA 3SCSA 3WH6A 2QJJA 2VFHA 3E49A 3N6HA 4FOKA 4YYFA 3W1RA 4DUOA 1V79A 5CEWA 1JUKA 3AMCA 3RMJA 3KZSA 1JPKA 2WKGA 3NYDA 3UYIA 4A8LA 1VPXA 1C91A 1XLDA 4JN6A 4FR1A 5JXQA 2DT2A 1JYXA 1HKIA 1RD5A 1TPUA 4Y9MA 3IEBA 1B3ZA 4BCEA 5REQA 3A64A 3C61A 3OGRA 1WDWA 2REQA 3RN6A 1JCJA 1U5JA 4H7VA 3ZIZA 2DSUA 4GBUA 3NNTA 2PTWA 1S2VA 1Q4WA 2Z25A 4B3LA 3PJUA 2OYLA 2W63A 2WPGA 2OEJA 1OC5A 6ALDA 1K4HA 1VKFA 1FFRA 3W87A 3LTSA 3T0BA 2R1PA 1H51A 2WANA 3L12A 5T91A 3NO5A 2D20A 1LLWA 3TVAA 1EIXA 3MP5A 7TIMA 3AIUA 3H7RA 5BCAA 3BG3A 3AS2A 3RR1A 2Z6JA 3A6OA 2WMGA 1CBGA 3VIJA 1WOAA 2VFGA 4AZ7A 3NZPA 5D2WA 2V68A 3B3DA 4O0QA 5I07A 2IPJA 2ZXBA 2YDAA 2WVVA 2D0FA 2HVNA 1Z42A 3L4ZA 1XWYA 2A79A 3P6LA 1TRDA 1W31A 1GZJA 5G2HA 2X0SA 5E0KA 2QPXA 4AIEA 3C0LA 3ZSSA 2V67A 4RK8A 5CLWA 3TOYA 3OA3A 4NXKA 4FA3A 5LNRA 3VTRA 1X8FA 4H9XA 2XM2A 4GUJA 1QNPA 5AYXA 5K9CA 3H2FA 5LGXA 1GJPA 2GQAA 4XQ6A 3CL6A 3VILA 4Q4MA 4NAEA 2DPEA 5XIAA 1Z7AA 3LMYA 3V5OA 1H7NA 2XSBA 4MYXA 4BQ3A 1KBKA 2VDIA 1JZ7A 3W07A 3MMDA 1ICQA 3GXMA 3E2QA 4W85A 4HOXA 2PTDA 1W8GA 3CAVA 3NA8A 1DKWA 4K8HA 1PHWA 4OWGA 3XIMA 1H60A 3GHRA 4HPJA 1IEIA 1EDTA 1YADA 1BQGA 1WOBA 2ZTKA 3I4EA 4RZ6A 2DV0A 3A12A 3F1QA 1P7TB 3RO8A 2Y85A 1X6LA 4IFRA 1UOZA 1TVNA 2E8ZA 1AK5A 2ANUA 3UR2A 1K9TA 3GIPA 3OU8A 4I6VA 4QCEA 2QIIA 4EWND 1V6VA 3CS2A 4Y8FA 1WZMA 3WZ0E 1WB0A 3EWUA 1C8YA 3ARWA 5CGMA 3TN3A 1O66A 1BSIA 4I9JA 3VKCA 1XDMA 2ZA3A 2LLEA 3OIHA 1D3CA 3VNIA 1RY8A 2J8GA 3PTQA 3P14A 4IQEA 2IW0A 3OIXA 4GH1A 4M6PA 2VX6A 3W2LA 3WJXA 5AHFA 1JDFA 1LWJA 3HV9A 4LVAA 1MDLA 1JDAA 3CAQA 3D3AA 4F40A 4ICMA 4OBRA 3WK0A 3W7DA 4ROQA 2FJUB 1XKYA 3QQ1A 2CFFA 3BARA 4CKQA 2CWXA 4PTNA 3PZQA 1LWHA 3SJNA 1ZPTA 5I3JA 3M0YA 2ZUNA 4GIAA 2J7EA 2QJHA 3NL3A 2PD9A 3NZ1A 5C8BB 1TMQA 3TCEA 2V82A 1AA1B 4RDYA 2Q3RA 4LB3A 5FSEC 1UD8A 3A5FA 1BVZA 4UWMA 4GZJA 4REQA 1D8WA 3MHFA 1M7OA 2Z24A 1IWPA 3L4UA 3VIPA 4RXGA 4HSHA 4DIAA 4DO5A 2QAPA 4PUEA 4QSHA 2XUCA 2BHUA 2HRWA 4EWJA 3ES7A 2F8QA 1KFKA 1XH0A 2A3LA 3W7HA 1Q6QA 4M1BA 4UTFA 5FF2A 4MJ4A 4PUNA 1GVFA 1SFJA 7ODCA 3E2VA 3N12A 4CQAA 2QJNA 1AZ2A 4L4PA 4C91A 1FVPA 3TJLA 4MIMA 2GQ8A 3VZYA 2JKPA 4LV9A 1N8FA 3DBNA 2WMIB 3V36A 4YN5A 2WK2A 2JEPA 3CGTA 3LRKA 1GEQA 2PTYA 4KBXA 3DFYA 2YBUA 4UTLA 5BXRA 5K3VA 5FF0A 3CUXA 3KTCA 4M0XA 3ARPA 2Y5JA 1UD5A 1VYPX 1AMKA 5FJPA 1UCWA 4ZCWA 1AH4A 1F3TA 4XK2A 4HOWA 4CN6A 3MMUA 4UMCA 1WBHA 2J4GA 3VGHA 4HNUA 4IWWA 4M8UA 4WDTA 4BQ4A 5CBIA 4E8DA 4ATWA 5FL1A 1O4UA 4CNUA 4HZ8A 3P2VA 3UY8A 1JZ6A 3W53A 1GVSA 2PI6A 4HHMA 3PTMA 1W37A 2AKMA 1QNSA 1IV8A 3C52A 3ZJ8A 1TQXA 2WZIA 3SQMA 4UQBA 3BLEA 4QG9A 3JZEA 2YZRA 1O95A 3QGVA 4OGZA 3B0PA 5C2GA 4OJYA 1SMDA 4IMCA 4Q7NA 3DC8A 4LBUA 1HJVA 4XZLX 1Z8AA 1P1MA 5EMKA 3GAKA 4UQDA 4NAFA 2JBMA 5KZEA 1NEYA 5DY3A 3JR2A 4Z0SA 3G1HA 5I02A 1POJA 4F79A 3W2KA 2EPMX 4LC8A 2QJIA 1A53A 2WHKA 3G1VA 4GVHA 3H7UA 3DYOA 3G1XA 5A8MA 1O1HA 4CUCA 1MEIA 3VE9A 1VJIA 1FTXA 2UBPC 3VYLA 3MMTA 2NQZA 5I77A 1BVWA 1O5QA 1J2BA 2R24A 1CECA 1IZCA 1WUFA 3OZPA 4PFHA 3R1ZA 2OX4A 4MWAC 1L6FA 4N6FA 1PSCA 4EF9A 3QRHA 5JBEA 2VP8A 2XHYA 1G5AA 3QH2A 2QPSA 5XINA 3AIRA 4QEEA 1JCMP 2CLLA 4B5SA 1H7PA 5G2IA 4WZHA 2D0GA 3FXYA 1ZBCA 2JF7A 3LI1A 4HCDA 4J3VA 4OBTA 2QCHA 3EA3A 2I56A 3LU2A 4ZE4A 3TDFA 3LUTA 4C6OA 5JBDA 3SZ8A 2AAAA 2CESA 4HCHA 1HJXA 4UR7A 2JGQA 2O4MA 4UMAA 2BXZA 2GUYA 3NIYA 3B0VC 1TPEA 2YYTA 3NVDA 4GGHA 3UCQA 3RCNA 1HTIA 3PVFA 4I90A 2ZXDA 3DC0A 3RXZA 3S6DA 2HBXA 4GGBA 3VC6A 1FWGC 1MMFA 4O1AA 4PMYA 2D23A 4E2VA 3M5YA 1V3KA 3P5YA 1M03A 5DT7A 1S39A 2JALA 2WAGA 1AQHA 3U7VA 3LY0A 3WYZA 1GZGA 4R7JA 1YEYA 1KLYA 1KB3A 1XGEA 4JKKA 4XBJA 2F6KA 5CPNA 4IICA 4QM1A 1JQXA 1KBBA 1OCJA 5AFDA 1DJZA 4QDPA 4H9UA 4HMDA 4QP0A 1XIGA 4Q7BA 4C7GA 4ASTA 2EPNA 3TSBA 4CU7A 3S4TA 3GDLA 3EKLA 3ITGA 1TA3B 4XTDA 3U2ZA 3WG6A 5LIYX 2VC7A 4OE7A 3CO4A 1C3FA 2HVMA 2V5CA 5BRPA 4LBRA 7TAAA 3VIMA 5T8GA 1E4MM 4GINA 3PJXA 1YDYA 2JIEA 3EOSA 1Q8JA 3PAJA 1L6GA 4OV4A 1V7YA 5E0CA 3N6QA 4DWSB 2C71A 3VMPA 3SCRA 4FX6M 5J5DA 5ECVA 3UP8A 1M6JA 2G3NA 4M51A 3RX2A 3CB3A 3TK7A 4BFAA 1ISYA 3AXHA 3TN5A 3LNPA 3T44A 4OECA 1E9ZB 3WSUA 3K46A 4PMDA 3QV9A 4ZZ9A 1DYSA 3CIVA 1IYXA 4Y6GA 4AQLA 3W1LA 1I45A 4GY1A 2FVKA 3BZGA 4YTSA 1FRBA 1JVNA 1MXGA 1P43A 3NL5A 2CLHA 1QPRA 3LBOA 2NX1A 1R7AA 1P7TA 1EXPA 2E68A 2TODA 3SCVA 4H7CA 1TX2A 4KGJA 5H8UA 4Q8TA 2J7FA 2KZHA 5EBAA 2E4TA 3AROA 1VFMA 3AZSA 2ACUA 3G18A 3AU2A 4QCFA 1A49A 3DBPA 3BSHA 3L9CA 2E5CA 4QAIA 1H61A 1RQEA 2WPBA 1EDQA 1B30A 1VCVA 3TTQA 2D0HA 2V2CA 3CUHA 2DW7A 4TX8A 3C2RA 5C0QA 1GYLA 2Z29A 3USZA 3WQVA 2R1MA 1D7FA 2RDXA 1V77A 3UXAA 5HOSA 3CT2A 4PTXA 1F3XA 1XCWA 1B3OA 2WZEA 3ZXWA 2I16A 3BICA 4WXYA 4DM2A 1T8QA 3VAVA 3U5YA 3A21A 1YRRA 1U30A 3BW3A 1ECQA 1YXYA 5EA9A 2F2KA 2QMJA 4Q8UA 3TP4A 1E73M 4YWIA 3WUFA 2E6FA 2VD9A 4A8RA 1IR1A 5BWAA 4MB1A 4S3KA 4F9JA 2QV4A 3TQ0A 4XX6A 2E3ZA 3I4KA 4D2JA 1TWWA 4J40A 1QUMA 3F4DA 4J4KA 1TWZA 3TTEA 3M0ZA 3PZVA 3W2NA 4EPBC 1JDEA 3QPYA 3P67A 2Z2BA 1XLMA 3S8HA 3PZNA 4K38A 1JYWA 3HGRA 1T0OA 5HAOA 3VM7A 3UA3A 1THFD 2UY2A 3L5MA 1DORA 3QJAA 4IISA 1SZEA 1HO4A 4RXFA 4L1XA 4LAKA 3QV8A 2ZUSA 3IIZA 1WKDA 3T2QA 3FHQA 3IAPA 3GIQA 4OBSA 2H6RA 2VX7A 4QEHA 5AYYA 4JYFA 4PUWA 2XN1A 3O1NA 2WMIA 3RJXA 1D8CA 2FMNA 2XDFA 4JTSA 4J3ZA 3ABXA 1NOUA 4MM1A 5AHEA 3W1PA 3DH7A 1H3GA 3L2LA 5AZ0A 3NAVA 1HL8A 3VKBA 1VPQA 3W22A 4O12A 3EPOA 3EB2A 1BKSA 4O17A 3RPTA 2B0MA 1YXCA 1XLBA 1Q2SA 3WJWA 3NSXA 3VKAA 3N18A 4P7NA 5EYWA 4JNMA 3TN6A 1MFUA 4H9TA 4OHQA 1JCNA 3BV4A 1X1OA 4UQAA 4PEEA 1XHGA 3OP2A 1UWSA 5LIUX 1HVQA 1DJNA 4RZ4A 4FPSA 1BHGA 3C2EA 3ZM8A 3WD0A 1IZJA 3VFCA 1P5BA 1C7SA 1EUNA 3P5ZA 2WQDA 1UD4A 5HUOA 3LCIA 1A5KC 1EJVC 5H8MA 1CWYA 3GFXA 1V3JA 3ONBA 4NVTA 1SFSA 2J6VA 1UB3A 1UMLA 2DVXA 4JN8A 2ON3A 2VKZG 3UZYA 2D2OA 4M7TA 3URAA 1A5AA 4FNSA 4CQCA 1M7XA 3ARYA 4IP7A 3WFAA 1DP0A 1W3HA 1P0EA 2PDKA 3OBAA 4C6BA 1UWUA 1RJQA 4O11A 2Z1WA 2SFPA 1VGAA 4XTIA 3CTLA 1OFAA 3B8SA 3LYEA 4LBSA 4LYPA 1EQCA 3UGRA 4C6QA 1J2WA 1K9EA 4TMCA 4BEQA 3K2GA 1R3WA 5DMYA 3W1XA 2A7NA 3HU7A 2DSVA 1KBLA 1N55A 4RW3A 3I7RA 3RAOA 3GS6A 4IM4A 1BQCA 1YMYA 3DHPA 3G22A 3OBEA 4CVWA 1HT6A 4XSMA 1I0BA 3AXIA 4JTJA 3GNXA 4MMWA 4OIFA 4C7FA 4S3BA 4H8UA 3DDMA 3R7MA 1XRVA 2XN2A 3TFCA 4R3UA 3WLTA 2WJEA 4NI3A 4Z2GA 1JUEA 4CLMA 2O55A 4E38A 2WC4A 1DXIA 1YTEA 2YCLB 2YIHA 4DPQA 5M3WA 3P82A 5C54A 3ICJA 1V0MA 1GGOA 1NFPA 2C16A 4O8AA 1MW1A 4DYJA 1SJCA 3IV8A 5HJLA 3CASA 2YB1A 3U4AA 4IIDA 4JTAA 1M53A 2DUAA 3DXIA 1DIKA 1NF7A 4FOJA 3UXLA 1GOKA 3INPA 1KXHA 4W9TA 4S39A 2Z7KA 2BB0A 1TV3A 1E1FA 4ZTYA 5CC3A 4YVXA 3DN5A 1KTBA 4I6KA 1NDYA 2OSYA 2C0AA 3UJRA 5D05A 3VCRA 1XFCA 2ZZ3A 4WK9A 4DB7A 1QBAA 1XLAA 4O1FA 2R1KA 3HBLA 3TWAA 3HMCA 4MUPA 1ESWA 4LAOA 3DFNA 3VX0A 3MV01 4LUIA 3PPCA 3W28A 1U1JA 4LCQA 1OYCA 4G9PA 1P6CA 1ZY9A 3CMFA 1WDDA 4AHOA 3QY8A 3W74A 4AMAA 3HQOA 1POKA 2NUWA 1S5NA 1UQZA 1TA3A 4A4AA 3FYOA 4KPLA 1TG7A 2H9AB 5CC7A 2X1RA 1PYMA 4IPNB 3WKZA 2ZZ5A 3WBYA 4RZ5A 1H09A 3ABQA 3TFXA 5DEZA 3W83A 1F6PA 3WLRA 3IGUA 2I57A 3MA8A 3ONCA 3B8WA 5I00A 1BXBA 4E2OA 5CZJA 4DWSA 2FKPA 2NUXA 1KCXA 4GCAA 1ZALA 2PWDA 3CIXA 2J7GA 3T0DA 3VNJA 1FWRA 4QROA 4UMBA 2C1IA 1IEQA 3GC5A 3PHAA 1YNPA 4S3DA 3O3RA 4XUGA 3O9NA 4BS0A 5LNVA 3BLFA 4IP4A 1F7BA 3WLOA 2WQPA 3P84A 3SCNA 4BQ5A 3H2MA 3U2OA 2KX9A 3MI3A 1FDYA 4PZVA 3LSBA 4GHRA 4YS1A 2OB3A 5E5CA 1HGWA 6XIAA 1EF3A 4OUIA 1I1XA 2YA1A 2PUZA 3MSGA 3URBA 4E2DA 3RUBL 5CZSA 5D8ZA 1YXDA 3N2MA 1VLIA 4IOTA 3UWVA 1NDZA 3SN4A 4QQUA 1CGXA 3LDVA 1G67A 3BCFA 2HNEA 4PCFA 5LZLA 3ABZA 4C90A 1QHPA 4S3CA 4LGXA 4WDWA 3LCLA 1D3HA 3UGVA 3H2AA 2RGMA 5TIMA 3S2CA 4GIYA 3ZT5A 4DN1A 1XD0A 1SFTA 4JD4A 4K8GA 1TZ7A 3WUBA 4QRNA 2PWHA 1OFQA 1TRIA 1C93A 3W2JA 2INEA 4HNVA 3T05A 2FFIA 3FOKA 2IKGA 1U22A 3L2MA 4M29A 3AWNA 3ZT7A 1L6SA 7REQA 2TSYA 2W67A 1Q6EA 3HGOA