3CH0A

Crystal structure of glycerophosphoryl diester phosphodiesterase (yp_677622.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
b'GMIQVPASFDIQGHRGCRGLLPENTIAAFTKALLLGVTTLEFDLVISKDNRVVVSHDTFFHHEITMMVDGEDVTEANEKNFNLYAMNYADIKEIDVGMKTHPRFKSQKKVPAVKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNIDHPNIALFCDLVVAEIKKAHITDRFTLQSFDVRALEYMHSQYPDIKLSYLVETKGTLKKQLEKLSFTPAVYSPDVTLVSKKDIDAAHKLGMRVIPWTVNTKEEIETLISLGVDGIITDYPDLFFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphodiester phosphodiesterase
publication title Crystal structure of glycerophosphoryl diester phosphodiesterase (YP_677622.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Hydrolase
total genus 91
structure length 272
sequence length 272
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ch0A00
4F2BA 1QATA 4QJ4B 1VD6A 4I8YA 2PZ0A 3I10A 3H4WA 4Q6XA 3L12A 2PTDA 4PTDA 1ZCCA 1DJYA 2ZKMX 3KS5A 1DJGA 3QR1A 4S3GA 2OTDA 2OR2A 3PTDA 1DJXA 3CH0A 3V16A 1DJHA 3QVQA 3NO3A 1V8EA 1PTGA 2F9RA 6PTDA 4I9TA 1YDYA 2PLCA 4RV3A 3EA1A 2P76A 3OHMB 4R7OA 3V18A 5T9CE 1QASA 2O55A 4I9JA 3RLGA 4RW5A 4RW3A 1DJIA 3KS6A 4QJ3B 2ISDA 1PTDA 4I9MA 4QJ5B 3EA3A 4F2TA 2FJUB 1T8QA 3H4XA 1GYMA 3MZ2A 1XX1A 4F2UA 3QR0A 7PTDA 1DJZA 3EA2A 4GNKB 4I90A 1AODA 5T9BG 1O1ZA 5T91A 1T6MA 1DJWA 5PTDA 3RLHA 3V1HA 2OOGA 4OECA
chains in the Genus database with same CATH superfamily
3PPHA 2DORA 4UQCA 1HVQA 3KDNA 1LG2A 3W6LA 1EKOA 4U31A 3HJZA 1Z48A 1GYNA 3IJ7A 3LDVA 2XYLA 3DOPA 3PBUA 2G95A 4DJDA 3BLLA 1EB3A 1GTEA 4YYCA 1D9EA 3TSMA 1VQTA 3EDFA 4AZ5A 3OGRA 1MRQA 2ONEA 1FVPA 1GGOA 4J2MA 4O16A 4MDPA 2XIIA 4IIBA 3FVMA 4GUHA 3THCA 3DHDA 1VFFA 3SN4A 1VFOA 3WYZA 2PU0A 3W26A 3H2FA 2Q6ZA 2TMDA 3GG0A 4G9PA 1KA9F 2V3DA 2PU1A 1FH8A 1R2RA 1ISXA 1I0DA 1O5RA 1TV2A 4LC6A 2B31A 1T8QA 4IWWA 1F73A 4GI9A 1LRQA 2WKLA 1XFBA 3M1ZA 3AYTA 2Y7DA 3PZQA 4CU7A 3PWIA 1Q7MA 1AJZA 1MZRA 5XIMA 2WQPA 4GY0A 1DHPA 1OK4A 4PTMA 4FOKA 4Q8PA 2WVVA 5FIPA 2WSPA 4S38A 3VO0A 5TNVA 1PZ0A 3FHAA 1CLKA 2GSHA 3AWOA 1NVMA 1AQHA 4W8BA 1CT5A 4CD6A 3M0IA 5BMXA 2J8FA 1TTJA 3UCCA 2ZWYA 2CLEA 1HJUA 1WZLA 3CH9A 1TPH1 1JQVA 4FNUA 4O12A 1VJSA 5CBIA 3EMZA 4IGHA 3PB0A 4N9BA 1X38A 1EH9A 1G1YA 4XTIA 3A3WA 1PHWA 4Q6JA 2FB2A 3LY0A 2XPKA 4MJMA 4GNJA 1V8EA 1U5HA 3Q65A 1K70A 1EA9C 4HPNA 2YLLA 3AROA 4DNMA 1F3EA 1S3HA 3NZQA 4NX5A 1OFBA 2BOEX 3AIUA 4IPIA 4DWSA 4A8IA 2FZ9A 2DZWA 1FFQA 3GBDA 3NEVA 4V1YA 4LAKA 1ZUAX 5A6BD 1ZRQA 5A8OA 6REQA 1YXDA 1XLGA 1TIMA 4MMWA 1Q5MA 1PKMA 4CU6A 2V2HA 2HE5A 5FOOA 1BVNP 3W27A 4CCEA 2EKGA 2VJXA 1FH7A 3B03A 3H8AA 1HP4A 4PUWA 3F4VA 3ARYA 2FH6A 1UKTA 3WUFA 3ATZA 3GLCA 8RUCA 3PFRA 3DHPA 3N17A 2BXVA 1IIGA 3LSCA 3DESA 1C8YA 2HQAA 3GFZA 4LOCA 1BHGA 2ZZ3A 1PYFA 1VFTA 3QY7A 1HJXA 3U3HA 4O19A 4ROQA 1GJPA 2R82A 3TWAA 4CQAA 2YKKA 1L6FA 1A0EA 4PCPA 3CASA 4A35A 2HVNA 4OUEA 3S6DA 1L9WA 2A21A 4AHPA 4OHQA 1L8NA 3PPGA 4WIWA 5G4HC 5CXPA 1M03A 1P7TB 4TIMA 3TU9A 1H60A 1P48A 4DZIA 2FTPA 1DXIA 3I7QA 4HT3A 3TCSA 4DYJA 3CAKA 4GO8A 4PEKA 2I9UA 2YCJA 2DVUA 2PTYA 3MMWA 1JCMP 3G1VA 1WV2A 4CVUA 3S1UA 3PPCA 3NSNA 1ITUA 3ITLA 4AD3A 3ITVA 4JAWA 2NSXA 3M0YA 4OIFA 4B5NA 2W67A 3V0SA 4BK9A 2ICSA 2ZXBA 3QLLA 3C0SA 4UR8A 1EIXA 3WDQA 3SGUA 4GGHA 1TB3A 2EHHA 4UR9A 3LEPA 4LBSA 4GUIA 4LANA 4JY8A 1FWHC 1X98A 3BG3A 3SI9A 3QEZA 4LRTA 2BASA 2AQVA 2E5DA 2ZXDA 3ORWA 2ZWZA 2XU2A 2VVNA 4Q4QA 2AOSA 3WQDA 5IDZA 2E6YA 4PMNA 2ALRA 5I0DA 1UUMA 4MTVA 5C9WA 1ONEA 1QMLA 1UD2A 2IMRA 4RV8A 3FA4A 4I8YA 1C3FA 1IWBA 2CWNA 4O11A 1JNDA 2NWRA 3HPAA 1ZBWA 3EDDA 1A3XA 3CV6A 4ZFMA 4LNYA 1EJVC 4IQLA 3VA8A 3LLFA 4E2BA 5BNKA 2QCGA 3MSDA 3W74A 1XDJA 3E0VA 4NKCA 4DEFA 3GU1A 3O63A 4Q8UA 3DKLA 3H22A 3EMQA 4R33A 4JTDA 4UTFA 4GI6A 4P7NA 1G4SA 2J7DA 4AC1X 2D24A 3WQEA 2ZC1A 4E3VA 3LCWA 4E8DA 1US2A 1VHNA 1IT8A 1BWVA 3W2KA 3KVJA 1FHUA 2P8BA 4GKTA 4Z2IA 1X8CA 1LP6A 1SMAA 5AHIA 3ZOAA 1XW8A 1W31A 3KS6A 2EPLX 1UJPA 3N29A 4PR4A 1AK5A 4MB3A 4KRUA 4C6PA 2ADAA 1I4NA 3UJSA 1Q6EA 1H3GA 3CBWA 4YPJA 4B92A 4TMBA 3GYEA 4P7OA 3PN8A 3RILA 3VD7A 3SCVA 1GJUA 4AD1A 1H5YA 2RAGA 1ZFJA 3B9OA 3BOLA 3LPOA 2CBJA 1KQYA 3CUXA 4WF7A 5BWFA 3BGGA 4FHAA 9RUBA 4YYFA 3FEQA 2PAJA 1DJQA 1JYVA 2YCEA 4KMQA 5CZKA 4B2DA 4OKDA 5FEXA 1OX4A 2XVKA 2CZFA 2X7VA 3L0GA 4PGLA 3R4IA 4LCQA 3BICA 3WFAA 1HW6A 3EWDA 4Q4RA 2RJHA 4G2DA 3NQFA 4JKKA 5D4YA 2DV0A 3BV4A 4WY0B 4YWSA 2QULA 4WSJA 3FDGA 3TNBA 3IGSA 2I5GA 1E6RA 4IH3A 2VZUA 4N6FA 3VOGA 3UQNA 1LLOA 2HSAA 2L5HA 1S1RA 2XN0A 3NDZA 1GZGA 3A47A 4JFSA 1X6NA 4MY8A 1QK0A 3LMZA 3COTA 2PF8A 1PSCA 1XRTA 1Q2RA 2ZVRA 3RLGA 2C13A 4ZOAA 2VWSA 3I6RA 3VOHA 1V3MA 3WLRA 3GR8A 5LNWA 4HSOA 4GACA 4O28A 4ZGYA 4XD4A 2WZTA 3GR7A 1KR1A 1VBRA 2R1MA 4F9DA 2VHLA 3RR1A 3TQ0A 4GQQA 2PP3A 4LYPA 1BKSA 2PRLA 4IGMA 2CKSA 4F8XA 2Q3OA 2NVCA 1IWAA 5D03A 4MB4A 5GQBA 1EYWA 4DZHA 4JTUA 2VI0A 5G1TA 1VLWA 1NJJA 2F2HA 3ALGA 4MZ8A 1PCWA 5IFPA 2FPYA 5D2YA 3EKLA 5H6HA 4UCFA 2VX7A 3N9KA 3ARTA 3S1VA 4JICA 3W84A 4JD4A 1AUSL 3AXHA 2FGBA 4FNSA 1LZOA 1I1XA 5HWMA 6CGTA 1OT2A 3DYPA 1EDTA 1W2VA 4HQVA 2DT2A 1WDPA 1ITCA 4DI8A 4QIUA 3V75A 2QIIA 3UP8A 4A2SA 1XV8A 3OYXA 4YTTA 2XGZA 1H0GA 3TQKA 5CCZA 3D3AA 2F61A 3KBMA 2J66A 1PTGA 5DXYA 3AZTA 4U10A 3N2XA 5HPCA 5MF5A 1LUCA 1V4YA 3M41A 3IGUA 3EKGA 1CBGA 2BS9A 1E6SM 2CLLA 3OLGA 2OLHA 2PLMA 2VFFA 4S2CA 1HVXA 3DKJA 1YMYA 2HXUA 3N6HA 2WPGA 1IXQA 5CJNA 4NI8A 4QJ1A 2FZMA 3T4WA 3RX3A 3UZXA 4CQ9A 3B8IA 3UCQA 1JUEA 4FEZA 4JIQA 1R86A 1TZZA 1HZYA 4QJ5B 3P67A 3VKKA 1RJPA 4UFHA 4O17A 3SRHA 1IWPA 1VGAA 3DENA 2GSEA 1W3TA 1TWZA 2XVLA 3SDOA 3QOMA 3NVTA 1PKNA 4GNKB 5H8PA 3R79A 3CUHA 5A8NA 1JPDX 4Q8MA 1UH3A 3TYAA 2Z28A 4LS1A 3M16A 1ENUA 3GNXA 3N1AA 4RLIA 1W56A 4H8UA 1QOQA 5LA0A 3S9IA 3VNMA 2DZPA 1KC7A 4AHQA 5RUBA 4JTHA 3IJDA 4R53A 2QMJA 4UIOA 5FCZA 1EJTC 2Z1BA 1ZBKA 3L4VA 1RPKA 2HDJA 2XWDA 4REQB 2FFCA 3CB3A 4GUGA 2CC0A 3EPMA 4XWUA 4HHLA 1EQCA 3LNMA 1L6SA 3MI6A 1XINA 3SR7A 4Q4PA 1IEQA 1TUFA 1GQLA 1O60A 4JZ5A 4WGHA 3A13A 4PTNA 4XSMA 3BZGA 4O0QA 4Y7EA 3S4TA 3HOJA 2WVSA 3U4AA 4YHGA 4AAJA 3NL3A 3GXTA 5ABFB 3MHGA 2MUCA 5GNXA 1HNYA 3UZJA 2PTXA 3TW9A 5C2XA 2XHYA 4QAIA 2PC4A 3K4WA 4HJFA 1KBLA 3GRIA 3UF9A 2PC8A 2HPIA 3EOEA 3RUBL 1ODZA 1KR0A 5BRQA 3AUOA 1P0EA 4I90A 4MKVA 4NU7A 1XFCA 4ZXLA 1WXJA 2IPJA 5CC5A 1W9BM 4OVXA 1UWRA 1G5AA 4EXQA 1V7AA 1Q6LA 2I17A 1R6WA 5E09A 3GVVA 2VQUA 3TUUA 2WSQA 3FDKA 3E9AA 2J79A 4W87A 1J0IA 4DF2A 3WENA 1OHLA 1SR9A 2NSOA 1YNQA 9XIMA 3LN3A 4KS0A 1YXYA 2XN2A 3FKKA 3W6YA 3KCLA 3H2OA 3B4UA 3NFUA 1FWCC 1DJXA 2F6KA 5JMUA 3VU2A 3SW6A 1WNOA 1V6TA 1LTDA 4ICCX 1LT7A 1OF8A 3ABSA 3VAVA 3DXIA 3AMGA 2YYUA 4X2RA 4EIVA 1HT6A 3HMJG 1S46A 3VKJA 2B7NA 2NV2A 2CYGA 1TPWA 4E2OA 4FPSA 2ACQA 1QPRA 1VCGA 2DU2A 4H9MA 2RDXA 2FKPA 4HU3A 5HJLA 4LUTB 5H8UA 1VBHA 3G0SA 4KT2A 3U5UA 2OZ0A 5TF0A 4O53A 2D20A 4D6JA 2DSKA 2NVDA 1TPFA 1XCWA 5AC7A 3ZT7A 1EDQA 2GDUA 1YKWA 2OEJA 1M7JA 4AUBA 3TYBA 1UD6A 4PODA 1UJQA 5D33A 3GHTA 2G3MA 4BKNA 3F4NA 1HKIA 2YCIX 2BHZA 3DBPA 1V7YA 2TAAA 1YNYA 2V81A 3M5XA 4DHGA 1YBQB 1E71M 5EYWA 4BHYA 3RFAA 2JALA 1KLYA 3QQ1A 1SGJA 4DVOA 3IPWA 1FRBA 2Z27A 1B3VA 1A5BA 3R7MA 3M6YA 2R1KA 2W27A 1R3YA 5I23A 3UY8A 1B4KA 1W1VA 3TSDA 4ZE4A 2BG5A 3PZTA 6PTDA 4XZMX 3W2LA 4QQUA 1AW1A 3O9NA 2WMKA 1E5JA 4GIAA 4DWSB 2Y7FA 2XUCA 1E70M 3BE7A 5FJRA 1ODUA 5BRBA 3EX1A 1MO0A 4N7QA 4NZ3A 4J7RA 1CLXA 4IP4A 6REQB 1JDAA 5HOSA 5HINA 1XYZA 4XBSA 1UUOA 5H2ZA 3G1YA 1NWTA 3TR9A 5HWNA 5TBOA 4AZHA 4ES4A 3W7CA 3WD1A 5AN7A 5HDRA 4U5KA 4QR6A 1W9XA 4W84A 1J5TA 4G6CA 4XBKA 1A5UA 2TYSA 1IT7A 2QJJA 3C3UA 5HJYA 3ITCA 5F2IA 2UV8G 4J5NA 2A3AA 3N4AA 4K1GA 3B97A 2HK0A 3LA4A 1RPXA 3MHUA 5PTDA 5G1MA 1UWQA 2NXIA 2A7PA 4JHOA 2F38A 2PWDA 4R3UA 4X61A 4RNHA 3P93A 2GVLA 3MUY1 1TSIA 5E93A 5I6SA 1CNVA 2JKPA 3B9NA 2NX3A 3BAWA 1HJVA 4CLMA 1FP8A 2WNWA 1E9LA 2XM2A 2CLKA 1SZRA 3P82A 1D3GA 1RLDA 4B15A 1UP2A 3H24A 4ZA0A 3ERPA 4AVFA 3T0DA 1DTNA 1RQEA 4H8NA 4WOQA 3RJYA 1B31A 1BYBA 1EWEA 5BU6A 2VEIA 1XIHA 2X2GA 3OOQA 4QCFA 4ZB0A 4MNLA 3UY7A 2WSRA 5EPDA 4F79A 2DZSA 1UKPA 2HISA 2D23A 1WE5A 2W4XA 1S2AA 5KZ6A 3L0KA 2VX5A 4UR7A 4GIEA 3EDEA 3MC5A 1UBPC 3HPZA 3EA3A 3HU7A 1CW2A 4ZTXA 3CL6A 3O7UA 3WBYA 3RM4A 1VJIA 1XLDA 3QW3A 3TK7A 1GYLA 4QNEA 4XO6A 5T8GA 3DC0A 3HFYA 3SCRA 4NXSA 1RJQA 2XSBA 3AXIA 1L0PA 4JQ1A 3PWGA 4DLMA 3VD3A 3MCNA 2G4FA 3MBDA 1WX0A 4JBRA 3CB8A 4IIGA 4XZ9A 3LTYA 2QS8A 3MVTA 1BRLA 2GWNA 3FJ6A 3WJXA 1K77A 5FJIA 3QRHA 4G5DA 3HM7A 1BKHA 3QGKC 3HBLA 2IKHA 3O0KA 4E4PA 1FXPA 4K8HA 1SO3A 1OABA 2DH2A 3GIQA 1QHOA 4H6RA 2YB1A 4KWVA 4ZSTA 3VDBA 1TWWA 4C6LA 3LPPA 4DAFA 1W1YA 5A6KA 4HYRA 2GQ3A 4WR3A 3CC1A 3W0KA 2ACSA 2QQ6A 5EU9A 2ZRVA 3LLXA 4TX9A 2VC6A 1SFLA 3GB6A 2PP1A 4JEQA 3DC8A 4X0VA 1OFPA 4HOXA 3VIIA 1MRAA 4ILSA 4PULA 3WLLA 5FF0A 2NQJA 1JZ2A 1EDGA 3WLOA 3G1AA 3SIZA 2NQ5A 3CHVA 3MYOA 3VD5A 4JNMA 3B0UX 1AL8A 1WUFA 3ATYA 3EWYA 3KOXA 2BP1A 4EK7A 1X1OA 3GZAA 1LOLA 1ZJHA 2WZIA 2OPJA 4D8ZA 2YLAA 3WNKA 3QFWA 1JDCA 3LENA 4RZBA 5LIUX 3FSUA 3NXFA 1OM0A 2CZDA 2FDMA 4O1CA 3IRDA 2VWTA 1FWNA 5HNRA 2DSWA 3CK5A 2QCNA 1TCMA 1IGSA 1MUWA 4HSHA 4BQ2A 4HCDA 1UD5A 1UD4A 3CWNA 2PCQA 4Q8NA 1OX4B 1FWAC 3RK8A 1ITXA 3WMBA 3NO5A 4UTIA 2V68A 4Z1BA 3S0CA 2ZUMA 2Q8ZA 4PCTA 4XQ6A 5FJJA 4QDMA 3URNA 2A3BA 3WJSA 2BGNE 2OCZA 3FN9A 1R85A 1QT1A 3S42A 1RBAA 1ZJIA 4LEFA 1C8QA 1NH6A 4P8UA 3G77A 3WF2A 3E02A 2QR6A 1F6YA 3TYUA 4YCOA 1VAHA 3OGSA 4MGGA 5A94A 3JUGA 2WJZA 1PDYA 4NF7A 4HPXA 3MI2A 1QPNA 4PBGA 3WQOA 1FY6A 5JU6A 4HB7A 3WLJA 1HG3A 4FB7A 2EG7A 5EFFA 1W5QA 3H12A 3LGDA 4BI5A 2Z00A 1S2UA 3WEZA 3UJEA 3I7RA 3H55A 4DJEA 1UR2A 1TJ1A 2WK2A 1BSIA 4HHPA 4R34A 4QQ3A 4DZAA 3ARSA 4H9VA 2B4GA 3IJ9A 5KZEA 3P3BA 3OA3A 1TMLA 3WO8A 2WMJA 4H04A 2W5FA 3VOIA 3R5EA 1B1YA 3WL1A 1JFHA 5A6MA 1NELA 2PZ0A 4S3EA 3PBVA 1A0DA 2YXOA 4BF7A 3C0JA 3VNYA 1IGWA 2VR5A 4JHZA 1EO7A 3THAA 2ZZ6A 5C5YA 4JFVA 5C9XA 3M5ZA 5AC6A 3KOZA 4B9YA 3EKZA 4NZJA 1QRQA 2WC4A 5A2CA 4AVNA 3WBWA 4X0NA 2KZHA 5DCEA 3CT7A 1E4MM 4PTWA 1V08A 3SJ3A 1LUCB 2CEQA 4WKHA 1JPKA 1OCQA 2EPHA 3BG9A 2CXGA 1KFEA 3QC3A 4KQNA 4HSNA 1EJ7L 4GX8A 2V5DA 4KWUA 1BG4A 1H49A 2OWCA 5AB3A 2FZNA 3I4EA 4UNKA 1R87A 4F2TA 1NARA 1Z32X 3UWYA 5C71A 3QPZA 3GNDA 3JRKA 1E40A 1TYGA 3W29A 1WKYA 2Y70A 4HYVA 1EOMA 1NF0A 3AHYA 4E0CA 1SJDA 4JTCA 2C18A 1UCWA 4JX6A 4GJIA 2ABAA 4QGCA 4WUIA 1S5MA 2WMIA 4QS5A 2OSXA 2XJ7A 3OYZA 2OOGA 3SSJA 3T2QA 3QYQA 4Q4SA 1K6AA 3AIVA 4CQBA 2GJRA 1MVYA 2ZA3A 1I75A 3CHDA 4UTTA 5K4XA 3WLTA 2PPGA 3T7VA 1MZHA 4ZB2A 1XRFA 4OOZA 2Y62A 2BODX 1V3HA 3EMCA 1SJCA 3WLNA 3IIZA 5AHNA 3QR1A 1XBVA 2VL4A 3V3WA 2DW7A 3FVDA 3ABZA 5I5RA 3NPXA 3UJ2A 3W7OA 2RH9A 3KOYA 3G1SA 1LL4A 4PFHA 4AZCA 1V02E 4K39A 2GQ8A 3SUUA 2GVJA 2ZXAA 3RITA 3MKCA 3QZ6A 3BLKA 4DZ5A 3VDGA 3LCGA 3S1XA 1QPQA 1REQA 1D7KA 3GM8A 3E2QA 4O1AA 4AMCA 3WUBA 2XIQA 1WA3A 3JW7A 3NAVA 2V3FA 3SB0A 2GQAA 4AIBA 1JYNA 4O1FA 1SZGA 4MG4A 1KTBA 2JGQA 4LBRA 1GKRA 3T2OA 3R10A 4XZBA 3QTPA 3TC6A 2V82A 4JTTA 3LQLA 4A8NA 2HROA 2XSXA 4CN4A 3BVJA 3UR2A 1LT8A 1DTUA 1O7AA 4PYSA 3SQLA 2WBKA 1MXGA 3CHFA 3PF3A 1YW1A 2E68A 4O10A 4F66A 1JCJA 2VT0A 3UCDA 1X8FA 1U1HA 4WXYA 4FXJA 2I56A 1Q6QA 1TZ9A 2QJNA 4B5TA 3B8TA 4TOQA 3WQCA 2CHNA 3M0VA 1XUUA 2Y5SA 5DXXA 1BTCA 1Z7AA 4JYEA 3P84A 1DEDA 3B05A 5REQA 3FW6A 4WJEA 1TX2A 2ANUA 4W89A 4QLLA 1GZ1A 5K3VA 4KGLA 4HU4A 3GFXA 1KGXA 4TTUA 3VYLA 2GSJA 3LZ3A 3L66A 4WGXA 4BFAA 3ZMRA 1ZALA 5HANA 4MWAD 4Z1CA 3OLEA 4GCAA 4IPPA 4YCPA 3C4UA 4CQCA 1HX0A 2JKAA 5HNUA 2F7FA 3GYCA 5M3WA 2JEPA 2TSYA 3STGA 4ML9A 3WLMA 3BJSA 3PUOA 3BSMA 2QKFA 2E4TA 5GPRA 1A53A 4Z17A 3TJLA 3QH2A 4HK7A 1T6MA 3I68A 1QWGA 3L4ZA 1QR7A 1RCQA 4ZOCA 5H91A 3W83A 3WQ4A 1Y8BA 4INFA 2XH2A 4PMJA 1H2JA 1XYFA 4MDOA 1KXQA 2OLSA 1LDCA 2UY3A 3KOWA 2DZBA 4QHRA 3NQBA 4PTXA 3BW4A 4AYSA 1BAGA 3FHQA 2VVSA 1EGMA 5GJNA 1AD1A 2Z24A 4EPEC 4PE8A 4P2VA 1F05A 1TRDA 1MFVA 1OCNA 3ELFA 1J18A 3R0DA 4MOZA 3NO3A 1KW1A 4QITA 1EZWA 5FF2A 3ZVIA 2D2JA 1EC8A 5EL1A 4XAZA 2AL2A 2W66A 4EOUA 4GCXA 2YPIA 4D1JA 5T9CE 3N13A 3OJGA 3CTTA 5F7UA 4CGTA 1W3LA 1WAWA 3NYDA 5FSDC 4KWWA 1W32A 2YR1A 3EWBX 4BCEA 1G9HA 3W1MA 3C0LA 1XIFA 4XD3A 4UQAA 4EX4A 5C9ZA 3ZWTA 4E6MA 2Z25A 3QOKA 2G41A 3NQGA 2XGBA 1P6WA 3W38A 1SYTA 3RLVA 1DKWA 1ZHAA 1V3IA 3RPMA 1WXYA 1T96A 1BSLA 2NV9A 1PZ3A 1W9UA 2GYIA 4XKYA 4EF9A 1DIEA 1S2CA 3KHDA 3L2MA 3KVMA 3TR2A 3SY5A 4O52A 1PIIA 2BGSA 3UJFA 4DBEA 3I7SA 5EMKA 3VNKA 3ITXA 1A3HA 3ZSSA 4E8CA 2J25A 4GH3A 3FYOA 4GYPA 4EPBC 4B5SA 3R13A 1LWJA 2J8TA 3RMEA 1GORA 4HTYA 1VH7A 5KSWA 1C9WA 1V6YA 4QLJA 1PKYA 1UA7A 5HMFA 2Y1HA 3S46A 3T1GA 1IXNA 1E6QM 1UASA 3QHOA 3SRKA 5GVJA 4TQTA 2ZX5A 3RRXA 1UZ1A 5A6JA 4L9ZA 5AY7A 3A64A 4TMCA 1XQLA 2OQYA 5DEZA 3R8RA 2QZRA 3MI3A 3O6DA 4MUZA 3CPGA 4AX7A 2CERA 1O94A 3EX6A 3H4XA 2A7NA 1XX1A 3AYRA 4KCUA 2ZRUA 1WZKA 4FIQA 3MDWA 1QNQA 1Q6DA 3UU0A 2HZGA 4MFEA 3SECA 1MNSA 3LV6A 4TO8A 3HURA 3FEMA 2OG9A 2P3EA 1YDVA 3AICA 5I77A 2YSWA 5I3JA 3WNOA 4BQ5A 2VEPA 2CU0A 2WNQA 4KERA 1NP0A 2X41A 1R30A 2DJLA 3AI0A 1ZJAA 3W02A 1OG0A 2W92A 4GJJA 2D1ZA 4HOWA 2DQWA 4IIDA 1JDFA 4K1WA 5GJPA 1I2RA 1CPUA 3R8GA 4KH2A 2X0YA 1N7KA 4DELA 2QCLA 2CLMA 4E2VA 8CGTA 1YDNA 3CUGA 4NSBA 4PMYA 3CUZA 3IAQA 2WHKA 2YA1A 3AS2A 5E70A 1M04A 2FB3A 4FZIA 3IJQA 3CZGA 4R9XA 2P3ZA 2QDEA 5K4ZA 3PZVA 3P62A 4QG6A 3LLDA 3OHIA 3DFOA 1V5XA 1W5PA 3WF4A 3NQEA 5FKYA 2V38A 4ZR8A 1JAKA 3TP4A 5K9CA 3AJ7A 1K8YA 2WCAA 2DZVA 4O0ZA 3STFA 4GHRA 1FWRA 3AIRA 4ENLA 4HU8A 3W87A 3ZWSA 4P8VA 1H7NA 2QMKA 2EJAA 4YXGA 3XINA 2OLAA 5A6AA 3LHVA 4D8AA 2QPSA 4W7UA 4BQ3A 3RU8X 4YTQA 4OBTA 4H41A 4DXVA 1AODA 4TVDA 1Q4NX 3W88A 3C5QA 4JQ4A 2Y4SA 3CQKA 3AYVA 3PZIA 1PHQA 3S2MA 1MEIA 1XD0A 4OECA 2FMOA 2WVUA 1L2UA 4HNOA 5AYIA 1W3KA 3LHZA 7CGTA 1J6OA 3CMJA 2VR4A 4JN6A 3IJIA 3LMYA 3VOFA 1R9XA 3EXTA 4PMXA 1PX4A 1MW0A 3IVTA 1PAMA 2C1IA 2CWXA 1AA1B 1U83A 3VE9A 3BG5A 1UG6A 1X96A 4ICMA 3WK3A 4ZENA 4NAEA 2QPXA 1JUBA 3IVSA 1JRBA 1PZ1A 1HIZA 3CLMA 1V6WA 2BGQA 3TDFA 4QM1A 1TJ0A 1SU5A 3OG2A 1EQPA 3EB3A 5BW6A 3ANVA 3STPA 2X40A 3A3XA 1IXOA 1VCVA 3OU8A 9XIAA 2H3BA 1ICSA 3HA1A 3VD4A 2GLKA 3DIPA 5A8GA 1UQYA 3L2IA 2O55A 5CAHA 3M44A 4NL1A 1XDMA 4NZ1A 2ZZ1A 4FS9A 3HO8A 5CSRA 1KWKA 4BF9A 3E12A 4MYXA 3AYSA 4ZL1A 3G22A 5G5IA 4MB1A 1W3IA 4DUXA 3RCMA 4EPKA 4M7TA 1GQJA 1J79A 1H7OA 5FL1A 3H4GA 2DDXA 1E4LA 2X42A 1VKFA 2CHRA 2WJEA 1XSIA 4I5XA 2XIMA 3NQ8A 4FLRA 1XIMA 3VC5A 4H19A 1VHCA 2XVNA 2Z7KA 6XIMA 2Z2BA 1C91A 5ABEA 1MFUA 1UKQA 1Q85A 3MSRA 2A0NA 3AU6A 1W0MA 1YDOA 4LQ1A 5I07A 3ZQ9A 5XIAA 4J3XA 3MA8A 1R47A 4US5A 3UR7A 3W73A 2PWEA 5HAOA 2EGZA 2YFNA 4K3ZA 1GVEA 1XHGA 1YTEA 2BMBA 4AXKA 2A6NA 3QPEA 5LHEA 1RY0A 4HYWA 1BVWA 1KRCC 3ZM8A 1QPOA 3KWXA 3QKEA 4NNBA 3KOFA 3EA1A 3PB2A 4O4WA 3PUDA 1D3CA 2AKMA 2A4AA 3T05A 3U5YA 1HKWA 1XDLA 2OODA 5FL0A 3REQB 1QHZA 1EJXC 2Z29A 1NDZA 4J28A 3CGTA 3F1QA 3WIJA 3W23A 4K37A 4JX5A 1LORA 3L9CA 3H21A 2BSLA 1POKA 1V6UA 3NM3A 3AU2A 4HK6A 3FGCA 2WYSA 2WMHA 4PA8A 4JIPA 4LUJA 2WMIB 3WH6A 2INZA 4CKQA 1EXPA 5DY2A 1QATA 1FP9A 1MQRA 4DPQA 4WKAA 3TLLA 4IQJA 3EX3A 3F03K 5JBEA 4PB4A 6TIMA 1KFLA 4HNLA 1E0WA 1ZTVA 3WD3A 1EHNA 1XL9A 2ZVIA 5LXXA 3UNDA 4XX6A 1JULA 4DXKA 2VENA 1LM1A 1UR8A 2CBVA 5AZ1A 3W1XA 3QMTA 4X63A 3V16A 4GJ1A 3E2RA 3CO8A 3QVQA 3UYCA 2F9RA 2OOFA 2QAFA 3MS8A 3GHUA 1CXLA 3FV9A 3WQFA 3CAVA 4F0HA 1K02A 3IGHX 2A2IA 3QKZA 3TYZA 1DWHM 4XVEA 4I3GA 3FFSA 3VIOA 5DO8A 4M81A 2JF6A 1PUDA 2WMGA 3GNRA 4JTLA 4H1ZA 1K4HA 3N12A 1GVIA 2DUAA 2V5LA 3MP3A 4YL2A 1K03A 3BOXA 3VNZA 4A21A 4IP5A 5ECVA 4M6QA 2C8NA 3B8WA 1CZ1A 2ZYFA 2BXZA 3K4AA 2J78A 1O68A 4WSKA 1XLKA 1MSSA 1K9DA 3WFLA 5F2GA 1PBGA 1UD3A 3RM9A 3INPA 5EBAA 3E2SA 2FJKA 1EPVA 3BLDA 5C55A 2QGYA 1KCXA 1Z9AA 3LK6A 4Q8OA 4RZ4A 1FWDC 4UQBA 2XN1A 4N9EA 4WVXA 3PZOA 1LL6A 4M6VA 4P7LA 1GQIA 3HGRA 4PUDA 1YYAA 3KRUA 3KUMA 2NUWA 2J27A 2WSKA 1Q3NA 1WQ5A 3OIHA 4RPQA 5F1VA 1EF2A 3TMQA 4EVZA 3DYMA 3G6MA 3BJFA 1XG4A 1ZQ5A 3N9SA 2HXTA 1C8VA 2IKIA 3BSGA 2ZDSA 4LVFA 4DPPA 1ONWA 1CLVA 3A3HA 4GYKA 3H7VA 3R12A 4MUPA 3PZGA 1HJSA 5REQB 3QV9A 1G4TA 1OQFA 1JEZA 3WZ0E 2XGIA 3KBJA 4WQ6A 1E3XA 3VGDA 4JTQA 4O1BA 4E3TA 4CD8A 3BMVA 1C8XA 2Z2AA 4EPDC 3GKFA 5CC6A 5CEWA 4DRSA 3STEA 1F8IA 2OWXA 3CS2A 4HNVA 1B4EA 4PCNA 1N8FA 3BLOA 4GC4A 3MUCA 3WJZA 1J0JA 3EWXA 4XKMA 1IV8A 2FVKA 4EKJA 3WUGA 3SGGA 2ZICA 4O57A 1TA3A 4TTGA 2O9PA 4JTKA 3TONA 2CESA 2BBFA 4HMEA 1K9TA 5TIMA 4IIFA 4P5UA 2P0IA 2BOFX 3GH5A 2XISA 2QJGA 2RKXA 1V93A 4FLOA 2VCCA 1CEOA 1XBZA 1THFD 3KBVA 3KXQA 4LV9A 3DFPA 4OOUA 1UB3A 5C8BB 4QG8A 5EKYA 1EL3A 3SBFA 4LFYA 3E38A 4KEZA 3ZJKA 5CBJA 4JDBA 4U4MA 3VOJA 3KCOA 3GO2A 1YHTA 1XIDA 4X22A 5LYRA 4CEUC 4LAMA 4ZSUA 3TOYA 3LOTA 1CI1A 2J7BA 3TE9A 3VKBA 3S5NA 3N04A 1NWRA 1KD0A 3G3MA 2E25A 5I3GA 1DV7A 1VFMA 1GYMA 1Y5VA 4R27A 3G0UA 3U7BA 2E0PA 1X1NA 1DWIM 4J4KA 1TTIA 1GW9A 4Q8TA 3WQ6A 4FAMA 1RVGA 1C90A 4GYJA 2PF0A 1X6UA 2BY1A 3IV8A 1O6IA 3TA9A 2V8ZA 3GXPA 4XKYB 2V0TA 1FA2A 3ZLHA 1TTQA 3EZ4A 7ENLA 2XFYA 4K6AA 4Y9NA 1M7XA 1XD1A 2YZ5A 4J1OA 3HV9A 1EJRC 4G1NA 2ZX6A 5AC4A 1LG1A 3OBAA 3KTSA 2DUXA 3OZYA 1J8VA 3LZ5A 2PTDA 3OVGA 3UT0A 4N9DA 4DAIA 1UWIA 4PCFA 3RM8A 3S5SA 4QP0A 4KF1A 3VXGA 3DI0A 3E5BA 2YZRA 1A80A 1RHCA 2E9BA 1DPMA 3IUHA 2PI6A 4NJHA 2YDRA 2ZRXA 4L6OA 1Q2SA 3HGJA 3QM3A 1KBIA 5D9MA 1RVKA 3GVGA 4DF0A 1E1CA 3E1F1 3TIMA 3TX9A 1M65A 2J7FA 1VFUA 4FX6M 3FLUA 5D9PA 3WN6A 3B04A 8XIAA 4GUFA 5I3DA 4W4QA 1OJXA 1T7LA 5L9FA 1PE1A 2Q02A 5M2FX 3W6MA 3GW0A 4HKPA 1G01A 4RZ6A 2DEPA 1PTDA 4Z42C 3S5ZA 3L4XA 4JDYA 4L1GA 5I7GA 3N2BA 5JQ9A 1SM9A 3THUA 4L80A 2VUYA 3MUAA 1JPHA 5CPLA 3C3NA 3KTXA 1QK2A 4Q3MA 1GOKA 1HQTA 4DM2A 4DO7A 4NP7A 4WLCA 1RR2A 3AHTA 3V5OA 4RDVA 3QBUA 4F2BA 4KESA 3MMUA 1MXSA 1U5JA 3ZS4A 9CGTA 4RNJA 1P0NA 4IL0A 4HZ8A 3WF1A 1J10A 4NILA 5D2WA 2BB0A 4MZYA 2JF7A 3GXNA 3RAOA 3WL0A 2B7PA 1QHPA 2KAUC 3VCNA 3W1TA 3N6JA 4GLEA 4PL2A 4W8AA 1VEMA 2DIJA 5HATA 1DIDA 3VD9A 4UB9A 4NQ1A 4N4PA 1FHVA 2DT1A 3A12A 1FHDA 1NTHA 1Z69A 5IRPA 2ISFA 3PANA 1ME9A 3UXAA 3S47A 3VGGA 2IPWA 2IPFA 1XGEA 3WD4A 3VMPA 4H7VA 1L6WA 4Z08A 3PBGA 4J3WA 3TJIA 1GONA 2W91A 4DYEA 2Z4GA 1A5LC 4X9SA 1JZ6A 4L7ZA 2JQXA 2Y7GA 2QIWA 2QUVA 4JEJA 3NZGA 4PMQA 1YADA 4TV5A 3GIPA 3EOUA 3MPGA 3LXBA 2VFEA 3E5PA 4UTWC 5HPOA 3SFWA 1RBOB 4KFOA 1R38A 1TFVA 3HGOA 3TQPA 4L4MA 3KHJA 5T91A 5EB8A 5D2VA 2HPMA 3VZZA 3JU2A 3LCFA 2FHFA 3GAYA 4AISA 3B0VC 3WH9A 3V5FA 5LHFA 4NYUA 3FAWA 2VZTA 3AZRA 4EAMA 2PGWA 1KB3A 2ASHA 1MYRA 2OZTA 2NVAA 3GY1A 3K30A 3UWUA 4LU0A 3KBNA 3ARWA 1UH2A 2HBVA 2GDQA 2UY5A 3LCHA 3WK0A 3P60A 2WXDM 1PIGA 4IJCA 3SCPA 2F6UA 2WAGA 3GTXA 3MJYA 4NYYA 1GK8A 5F4SA 4H9UA 2DZXA 4EWND 5A6LA 1FXQA 3DH7A 3VOCA 1U5VA 3W1LA 2DSZA 3WDRA 4JTFA 2Y0FA 2Z1KA 1DWFM 3CQHA 2QGHA 3TTQA 2J8GA 3A24A 3OA5A 5D30A 4XD6A 3B3DA 3TSBA 3WH8A 3MUIA 2FZDA 4LBUA 3MY9A 4KEVA 1ME7A 4JTIA 2QVNA 1XH0A 2PSNA 3W53A 1XRVA 3RN6A 3L5AA 2PWHA 4CN6A 1VENA 1JR1A 3UG5A 4AIOA 1W2PA 3FKRA 2QV4A 3DDMA 3C0QA 3KCJA 4IHCA 3PNZA 2Q8LA 1GOQA 3IUIA 3G2GA 2PBGA 5CJ5A 2CLIA 5F1UA 4DNHA 2C6QA 2AMXA 1WPCA 4PUNA 5EBUA 3HG2A 2Q09A 4ZODA 3MCMA 4O18A 2ZRYA 4JOMA 3SCOA 2BLEA 1J9YA 5CKSA 2PODA 3N3MA 1JGMA 1E9ZB 3BLEA 4WXZA 3AHZA 1UWUA 3BUVA 4GI8A 4HNUA 5EMYA 5FJTA 1GUVA 4W93A 2DFAA 1LYXA 3CEUA 1KM6A 2ZZ2A 2VX4A 3MSGA 4L9YA 3RCNA 3T81A 3OLDA 3ANYA 2A85A 3W82A 4M1RA 2HTMA 1B3OA 3BC9A 3LQGA 1CXHA 4RPPA 3DG3A 4AY1A 2HMCA 1TJ2A 2PD5A 1JCYA 4IISA 4PSPA 3FGCB 3I3EA 2DSUA 1G94A 4ZOEA 3QJAA 3SUVA 1Q8JA 4EF8A 4M19A 1BF2A 4HN8A 4ZO9A 1KM3A 4Z2JA 3PY2A 4K2SA 5HMSA 3NDOA 5LGXA 3RIKA 2QYGA 2XM1A 4NIRA 1Q45A 3H26A 3URBA 3LBCA 4MWAC 1EUNA 2CLPA 1OINA 4BI6A 4HZMA 1TIWA 1ISYA 4IGNA 2GQ9A 1FWIC 3T42A 1EX5A 3MW7A 1A5OC 4M82A 4Y96A 4HPJA 4UZUA 3CPUA 4YVPA 4GVGA 3H53A 2V3GA 4FF5A 3HQPA 1YPXA 1BGAA 2XFWA 4IUOA 3ZXWA 4IGSA 1I2OA 4ZQRA 2YL8A 2XH0A 4IUGA 3LB0A 3RYSA 3V0TA 4LUTA 1U33A 1UUQA 4PZVA 1LBFA 4Y90A 2WOQA 3W7HA 2ZUWA 3SUSA 3CZLA 2VRKA 3C86A 4ERGA 1WP6A 2WNZA 3H2NA 2W0UA 2H9AA 4DBDA 3MZ2A 5KZMA 3QZEA 2ZFAA 5I3IA 1ADSA 3D5HA 3CAQA 1D8WA 3W24A 4GY1A 1MQQA 1W3HA 3N25A 2J88A 1YBQA 5FEPA 4AU0A 1W1TA 3AAMA 1CECA 1FHLA 4FIRA 4QDPA 1R3VA 1WOBA 2FMNA 3OP2A 4L4LA 1KGWA 1F61A 2Z1WA 5LNSA 2OO0A 3WDPP 1NWUA 4AH7A 2PURA 3GSMA 4WDXA 4OUIA 2XH7A 1TPEA 3IJLA 3CEPA 2SFPA 5B7ZA 1DIOA 4AD4A 2P50A 1KV5A 2O4MA 3QF0A 1H7XA 1KXVA 5DMMA 3WEOA 4AZ7A 3D6NA 3MDUA 3HQOA 1EJWC 5FAJA 5LIWX 1S2VA 3DGRA 2PGEA 3RPDA 1OB0A 4L64A 4DWDA 2DVXA 3GBEA 1JG9A 3KZSA 3TTYA 2D69A 1TQJA 4TX6A 2PTZA 3A5FA 2Q01A 4JX4A 2VFDA 3ANUA 4FXRA 2ISDA 4ZBCA 1TPUA 2X0HA 3FY1A 3LCLA 1O5QA 3W1UA 3S2JA 3T0CA 3AHVA 1KFWA 3KM8A 2PCEA 3BAKA 3MJMA 2W61A 4LVDA 1HO1A 3LRMA 1UYQA 2Z2UA 3QR0A 4O54A 1P43A 5K9DA 4ASTA 4MY9A 5DT7A 5C9UA 3EB4A 3R0UA 3C2YA 2HVMA 3N18A 2FTWA 3EOSA 1QBBA 1TA3B 2BY0A 4R7WA 2GOKA 4EE9A 1NSJA 2R94A 5CAKA 1MUCA 1VD6A 5BXPA 2WLZA 4KGJA 7TIMA 3AIEA 2QCHA 3AC0A 5FSEC 1UP0A 2FZ8A 2EF9A 1PV8A 4HVXA 3SAZA 4AY7A 5ECUA 4L6HA 1P6BA 3CQIA 4MNMA 2ZADA 4TX8A 1ZLPA 2V5CA 2RHGA 3E2VA 1MMFA 4LGXA 1J2WA 3NM1A 5CLTA 1T8XA 4W5ZA 3WQGA 1RA5A 3BAIA 4C60A 5CSUA 4MJ4A 1LLZA 2ISWA 3TZFA 1KGUA 3QV7A 3WD2A 4FNRA 3HQ1A 2NZLA 2ZIDA 4F48A 3V18A 3KP1A 4DB7A 3SCNA 1TKKA 3L4TA 2ZDRA 3W00A 2WCGA 3VMNA 5JVLA 3QPYA 4U3AA 4PH6A 3ARXA 1QOXA 3O2LA 5E6YA 1XLHA 4GKLA 2ACUA 2P1FA 2OYLA 3EPNA 3AS0A 3W86A 1G0CA 3VIPA 4GFSA 1NDYA 1JF6A 3AQUA 3FYYA 3BTNA 1F3XA 3THQA 2QHAA 4KEUA 4D72A 2R14A 4TVCA 3W2NA 3FX4A 1BWKA 4D9PA 5TAOA 2RDUA 3ID7A 3DERA 3SCQA 1GVQA 4EAYA 4FI4A 2JIEA 4LTSA 3WLQA 3R89A 1TPDA 3USBA 1TJPA 4GIRA 3NZPA 3VGFA 3IS4A 2ZUUA 3SEPA 1IT0A 4MKNA 3H4WA 4H6EA 4BA0A 2A5HA 1WZMA 4DJFA 4PUEA 4M29A 3NPVA 4FMVA 4PSRA 1ZCCA 1IZKA 5E0CA 1U22A 3PJXA 5EMJA 5EY5A 1QCWA 4DIAA 4AC7C 2OX4A 1G67A 5A3HA 1OY0A 1ZP3A 4M8UA 1V3JA 3ONBA 3NGFA 4F3HA 2E6DA 2EKCA 3G3DA 5A1AA 3S1WA 3TNOA 4A4AA 2ABBA 4O1DA 1R2SA 3WK2A 1DP0A 5JBFA 1Z89A 1E1CB 4GBUA 4J35A 1E9IA 3FCPA 1BGGA 3KRBA 3AXMA 4Q8VA 1V79A 3SN0A 4WSHA 4FX8A 2V63A 5HNNA 1W3JA 2E3ZA 4CCDA 4RE4A 2PTWA 1DQWA 3TZNA 3K8KA 4FLQA 3AZSA 3UJRA 3W4RA 3WBAA 3R8HA 3N2TA 5KEZA 3O06A 2QV5A 4JIIX 3Q45A 4WZHA 4M6PA 3W81A 1VBUA 4F2UA 4GQRA 4DX3A 3CJPA 4GPNA 1QW8A 4DO6A 2YIHA 1JCLA 5FEWA 4D6IA 1BWLA 2ZE3A 3S6OA 1DBTA 1SZFA 2DGAA 4F40A 1M3UA 3EWCA 2Y5EA 1J11A 3UWQA 1GOMA 3W7PA 3KP0A 4NXKA 3T6CA 3MANA 3DGBA 1C9DA 3EAUA 3MTWA 5JUVA 4PEEA 3W07A 3NJ3A 1YTDA 4RXFA 5CPSA 1K7XA 1TMQA 3CNYA 4Y9MA 3C6CA 3HG5A 4PFMA 1KO0A 4QLKA 2O4QA 1H62A 1VR6A 2NUYA 4QE4A 2IQ0A 4LC8A 4OE7A 1R0MA 4U3CA 4G56A 1EO5A 1ZAHA 2I1OA 4XBJA 1DL3A 3OHMB 3H70A 3NO1A 2G3IA 3BK0A 4KCWA 4HGXA 5D38A 2QJMA 2OEKA 5I24A 2PDYA 5J5RA 1W1B1 3WJYA 4GZJA 4IIHA 3P14A 4ZOBA 3N4FA 2E8YA 2INEA 1ZP4A 3S2LA 3UW6A 5CG0A 4HP5A 5CC3A 1WUEA 4IF2A 4NY2A 1MUMA 2PGRA 1NM9A 1NY1A 2PMQA 1KKRA 2WWCA 4KIEA 3MP5A 2PWUA 4Y6GA 3T0TA 1XICA 3O16A 1OD8A 4QS6A 4UFIA 1OG6A 1GPWA 1Q6CA 3B8SA 3BW2A 2D2GA 3POCA 2G4JA 4AZ6A 3WDHA 2PDXA 2Z1XA 3A9BA 3HPSA 3S5OA 2DUZA 3RRAA 1DJNA 3APTA 3H2CA 3T4CA 1U1UA 3SM0A 3ITTA 1OT1A 3T55A 3M07A 4ML4A 4J40A 1K4GA 3P81A 4S23A 1KQZA 2OGYA 3O07A 1QO2A 4PMDA 3CL7A 2X1RA 3UXLA 6ENLA 2YL5A 3WMLA 2C1HA 1S5VA 2E9LA 4D71A 2HE8A 4JTRA 1V0KA 4FP1A 3OBEA 1ELSA 2PDWA 3TXVA 1JPMA 4QFUA 3Q58A 3WMSA 4P8XA 2X8RA 5U7SA 4Q8QA 4MAVA 1C92A 1GWJA 3P8JA 1J0HA 2XSAA 1EP1A 1L8PA 1Q7ZA 1J4EA 3SRDA 1Q8AA 3BARA 2PFHA 3W7RA 3GG1A 3GG7A 3R0KA 3W1RA 4AEFA 3ITGA 2Y61A 4LB4A 3VE7A 3WH7A 5AYXA 1DQXA 4D6CA 3NL2A 1T99A 4NNCA 3I6EA 3W1NA 4JTEA 2J9ZA 4Q7BA 4IJBA 1UR0A 4LAUA 1TV3A 2RGMA 1UKSA 4M3PA 4NHVA 1I60A 3J7HA 1D3HA 3LXCA 4C6BA 4G7FA 2X1TA 3F5JA 4B3ZA 1RP9A 4AEOA 4H9YA 4RKAA 1FKXA 4BWLC 2D22A 1TMHA 3DYOA 4X3ZA 4Q4KA 3MBFA 1DXFA 1S2TA 2VUNA 4CNPA 2E28A 2CBIA 3I6TA 2IXUA 5CSYA 5JXQA 5HJXA 4JTSA 5CJMA 1WDQA 4HNCA 3A4AA 3MVIA 2POZA 4H00A 3P8IA 3L23A 3QFEA 1JXJA 3VABA 3S6TA 3CTLA 4YVXA 4WRHA 3RDKA 1ISWA 4MWAE 3EX2A 3CYVA 4MLJA 1W5MA 3W71A 3M47A 3M64A 3RX4A 1XGDA 2CLHA 5I03A 3B40A 2YW4A 3CMGA 4CNSA 2QUMA 1XGZA 1TWDA 2VDHA 3GZ3A 2QF8A 3GXIA 1KTCA 1SW0A 4I5RA 3EGJA 3WKZA 3CZKA 3VCRA 1F74A 5KTLA 2Y63A 4LUIA 1JVNA 2ZX7A 4UOQA 2J7EA 1DORA 5J5DA 2ZZ7A 1J6PA 3DHFA 3GH7A 3CIXA 2OZ3A 1WZAA 1OFAA 2QEZA 1XLIA 1P4CA 4XZHA 4KETA 1OZQA 3SCSA 5KZDA 4KWOA 1R9ZA 4CCZA 4YMZA 4RJEA 2BY3A 2DZTA 4H7CA 3TKFA 3VDCA 5LA1A 1EA0A 5HUPA 1A3WA 4M5PA 1CENA 1TV4A 2GL5A 2OELA 3N11A 4H8HA 1F76A 1CXEA 4R9OA 3M0HA 5A8QA 2Z6JA 5D9OA 5B7YA 4DJDD 3EDKA 4J3UA 1OYBA 4UQDA 4AZIA 4G8TA 5IHRA 4A6GA 2ZBTA 3PG8A 2J7GA 1GHSA 4WEVX 2J7HA 1N2VA 2FZBA 4AVOA 2R1LA 3UVIA 3F2DA 1UC4A 1ALDA 1SFSA 1SJAA 2OXNA 3OVQA 2PLJA 3BAJA 3TAKA 1ONRA 5CZTA 1N8WA 2A3HA 3BDKA 4C6DA 3UEQA 4PB5A 1TR9A 1WDRA 2YBUA 2J75A 4IT1A 5A69A 3T08A 4TV6A 1FCVA 4LXFA 3W72A 5FF7A 4HHMA 4AFYA 1DOSA 4QRNA 2H9AB 1F4HA 2YFOA 3B8DA 2GK1A 4NJJA 4M56A 2XINA 3IV3A 1XYBA 4GXMA 1LBLA 2BHUA 4WCJA 3GAKA 3PJWA 1O5XA 2EPOA 4HPHA 4JFTA 5HNTA 3O6CA 4ROPA 3VX0A 1TRIA 2PZNA 1UWAA 3LHYA 4NAFA 3FSTA 3L2LA 3P0XA 3LGEA 3KL0A 3NQDA 4RL3A 1ECQA 3IWPA 5IFTA 3EWZA 3WSUA 4J3SA 5I00A 1K1DA 4D6HA 2QPUA 3DZ1A 3VX1A 1FWBC 2AQOA 4GX9A 4ATDA 3THDA 3WQWA 2P5NA 4D6EA 1B3WA 1CTNA 1VPXA 2PDCA 4I5UA 1V0MA 3CO4A 1W91A 1KV8A 4JHMA 1UZDA 1QJWA 4CNNA 1PS9A 1KFKA 3WG6A 3C8NA 2P53A 4JKLA 2JKEA 4U33A 2AAMA 5AYBA 4ZFCA 3C56A 1J2BA 1HO4A 4JIHA 4DWSD 1FWFC 3M4HA 4HOZA 2OZ8A 5DT5A 1D8CA 4BY3A 1OZMA 3R6IA 1QFEA 2WW5A 4JFUA 3F4DA 4A8RA 2CPUA 2E77A 3FK4A 5C54A 1TCDA 4ONVA 2PDKA 3M7SA 2LLEA 1W9DM 2G3NA 4KWSA 2EG8A 1BFNA 1FDZA 1DWAM 3AIWA 1LROA 4M80A 4CU8A 1RD5A 2HNHA 1B3XA 1IEXA 1IHIA 3MMDA 1SSDA 4CNTA 1QPKA 3B9AA 3PHAA 3EEZA 4DBWA 2DJXA 1PCKA 3MO7A 4IJRA 4MF4A 1QI3A 1RD6A 3UG8A 1TZ7A 3T09A 4B91A 2ZOXA 1O66A 2C16A 3CMFA 1R7OA 4H9XA 2DIKA 4JNYA 2PBOA 2HCVA 2GGHA 1A5MC 3LM3A 3I10A 3K8MA 4IM4A 5CGTA 1FUYA 1IE7C 3NTYA 4LAOA 4FA3A 3LHTA 4PTVA 1FBAA 1S2WA 2BVDA 2E7FA 4Q22A 4W5UA 1NFGA 3ES8A 2WKJA 3WDIA 1VBJA 1W6TA 1VCFA 1QXLA 2FPTA 2O92A 1GKPA 4Z0SA 2CZVA 1TTPA 5A5WA 5DFAA 5E1QA 3WELA 3ZYZA 5HA7A 1DWGM 1BQGA 3LCXA 4V1XA 3VGBA 5HR7A 4M51A 2CIPA 1Z41A 4MSSA 1OCBA 3PZMA 3TTEA 1J01A 3ZSTA 4C6QA 4FXFA 4L56A 4JS3A 3HPXA 6XIAA 2PDPA 2G5WA 1TE6A 2TODA 3BLPX 3ZFHA 5CC7A 3VPLA 4G7EA 3NYZA 4LY4A 4MADA 1Y0EA 3BSHA 3KBWA 4MFDA 1VC4A 4S3DA 3W7JA 1OGSA 3SRFA 2DY3A 1AW2A 1ECEA 1EP2A 2XTKA 1TREA 3Q67A 3TFXA 3AHXA 3CUFA 3P7YA 4LT9A 1SZEA 2V30A 2EXOA 5I09A 2BV9A 3TLQA 2XG9A 3QYSA 3BLIA 4QXIA 2F84A 2VZSA 2QLYA 3EXSA 3T0BA 3HMCA 3N73A 2QXWA 2NXGA 4R7JA 2X05A 5LNVA 4MNKA 5L6UA 1OFRA 3N2MA 4UNIA 2VP8A 3WLPA 3HFTA 4B5UA 1EJUC 4Y8FA 2BWGA 3NQVA 3UA3A 1GJWA 1S5TA 4A2RA 3GIYA 1XLCA 3KL3A 3BANA 2EPMX 2YX0A 1A5NC 3GU2A 2B0MA 1XQKA 3KLKA 4DJFD 3N19B 1E0VA 2GJLA 3MKVA 3RO8A 1JFXA 3UBPC 2WV8A 4F0RA 1KFBA 2YL6A 4FXSA 4O4VA 3WDJA 4ACYA 1XLMA 5DBUA 4ATLA 3UZWA 1SPQA 3KVLA 1XLFA 1OYAA 1GEQA 3LS9A 4AMAA 1ZAJA 1T0OA 4YJ5A 2IQTA 3GVWA 3UFYA 2E5CA 3W7EA 3QSTA 1JCXA 2CKRA 4JPGA 3HV8A 1EEPA 5AFDA 2QF7A 4UOZA 3TN4A 3M0KA 1K6WA 3ISIX 4QCEA 3BMWA 1C29A 5BMWA 2Y24A 3GK0A 1JD7A 3GHRA 4L4OA 1SMDA 2I14A 1M6JA 3LBMA 1K8XA 2PUZA 1EC7A 4CVWA 2OKTA 3N15A 3H6OA 3LG3A 3MT1A 3I3BA 1B9BA 3OTRA 1FKWA 7ODCA 2WNNA 4NJGA 4LVAA 2Z7GA 4CD4A 2YYTA 4B2DD 3IIXA 1OFDA 5A6TC 1SW3A 2CZEA 1OFQA 4F0LA 3W7KA 3D47A 4HA1A 1E6NA 1KM4A 1QNOA 1TVPA 1YE6A 2Y5JA 3SCUA 1S39A 4WHBA 1IQ8A 2V69A 2GJPA 4ZE5A 4IG2B 1FWTA 3LYEA 2G3FA 3OVPA 5K7JA 4NT0A 4WKFA 1X7IA 3AS3A 2NT1A 4DBSA 3LXAA 2QUUA 5C9RA 4IQEA 3QV6A 4L65A 4IMFA 3VM5A 2X09A 5BOFA 4RW3A 3FAXA 1OK6A 3BL3A 3CXOA 3WLIA 2WSYA 1YPFA 3A4JA 3QXBA 1DHKA 1GVFA 3BO9A 3AIQA 4D1IA 3QR3A 3CM4A 1DJZA 4MPQA 1T41A 4C6MA 1XIJA 3L68A 1I1WA 4N6EA 5M03A 1ICQA 4B4FA 3HB9A 1Z44A 5LNUA 3ARPA 1CB2A 1JGIA 1QBAA 1HP5A 1I2QA 3M9YA 3RO6A 3ZJ8A 5CZJA 1NQKA 4PRRA 1KKOA 2W63A 1QUMA 2P8CA 1V6VA 2FQIA 3LRLA 1GW1A 3TOPA 5I78A 3G0XA 4B5WA 2GUYA 1N82A 4M0XA 4RDYA 3CWOX 1EEXA 1XLBA 3TEVA 3GDBA 1RQHA 4GXWA 1DJHA 1G7VA 3II1A 3REQA 2C71A 2QNEA 1FFRA 1XKYA 1XG3A 1H0IA 1L2QA 2IPGA 4BQ4A 4ATWA 3UWZA 4RV3A 4U2YA 3QC0A 3OIXA 3QQ0A 1H09A 3T44A 4JQ3A 5CZ0A 2HBXA 3O1NA 1KCKA 3AMKA 3KFTA 3WY1A 3HF3A 3DBNA 2P0OA 3MSYA 2C0HA 4UTMA 4F0KA 2DT3A 3H23A 3LBOA 1DE6A 1MI3A 4UC5A 1HXJA 4OTKA 1PWLA 3PBMA 4CD7A 3BMXA 1NOFA 3E0FA 3CZJA 5CPTA 1KBBA 1IEVA 1LL7A 1H1ZA 3EA2A 1HN1A 4PUMA 1OD0A 1GVSA 1FX6A 4HA4A 2ZA1A 1MQPA 3U4FA 1RH9A 3CAWA 2GUBA 2NW0A 3KTCA 4NVTA 2HS8A 1WBHA 1L6YA 4Z0JA 3NSMA 4H8VA 4HNNA 2YBVA 4KEMA 3ENLA 1ADDA 3U6WA 4O0KA 1L6GA 3MMTA 1Q65A 2Q71A 5CQ1A 4Q33A 4J3ZA 2QCDA 1HTIA 2B81A 1OVDA 2XIOA 1POJA 2O56A 3WF0A 5AVNA 4Q7IA 3O3RA 2VGIA 2WM1A 4S3KA 2D2OA 3V5CA 4AD2A 5FF3A 3GTFA 4WJXA 3IUDA 3G1HA 2VELA 3D0CA 4OBRA 1CGTA 4XTDA 3TTSA 3G6LA 4H6KA 4AEEA 3UWWA 3TN3A 3UZZA 3AUJA 1GQKA 4LB3A 1AFSA 4W88A 1JAEA 5LNRA 1J0YA 2EAWA 2E6FA 3PTQA 1ITQA 4R5EA 2YA2A 3QMRA 3PWAA 2YB4A 1E1EA 1XYMA 5CZSA 1QAPA 3JZUA 1MEHA 4FX7A 4S1FA 2CZ5A 3W7QA 4NG3A 4IIEA 3CQ0A 4NZ5A 5E0FA 1AVAA 3W37A 3TAOA 3UZ5A 2W9MA 2JGYA 3GVRA 3L21A 5JIWA 3UXKA 4W7WA 3AS1A 3S2NA 1XYAA 1CXFA 2GZXA 2C0AA 3ARQA 2E40A 5FACA 4Z2HA 2D0FA 3L12A 1FTXA 3CPRA 4UQEA 4MHBA 4XV0A 3N4EA 2VQTA 3I3DA 3N34A 3G8EA 4B16A 3OVRA 4W9TA 1E0TA 4HD5A 5HQLA 3W75A 1FWSA 2NQ9A 1R3QA 1AH3A 3PTDA 3NQAA 4LH8A 3NPUA 1EFZA 1M41A 4NASA 3WMCA 2YBTA 1NIUA 1O95A 1FDYA 4Q8WA 3PUGA 4LALA 3F2CA 4NX0A 3T78A 3HZ3A 3PNUA 5E5CA 2BVTA 2D73A 1MXDA 1TV8A 4LV4A 1OC6A 2DT0A 3F2BA 3GX9A 1CCWB 1OEPA 2MNRA 2PD9A 3DFHA 4OT7A 2XVGA 4I9JA 4O15A 1JUKA 3W2MA 1DYSA 1UMLA 3FYPA 1BTMA 4A05A 1H41A 4QJ3B 3W7DA 5EA9A 3WEMA 1FCUA 1MWOA 2FHBA 3ARZA 2GK1B 1TVNA 1TVLA 1HKMA 3NPWA 2V9DA 4DM1A 4EANA 4ERIA 4I9AA 1XYLA 4D6GA 4KRTA 1A4MA 3GDLA 3MUZ1 3MZNA 1IXPA 1IZCA 5E6ZA 1DIKA 3O05A 1KRBC 1Q63A 1ESWA 1P1MA 3RMJA 4P7RA 4NAFB 1X6LA 3H54A 1TWSA 2FFIA 1YTKA 1EPXA 4A3QA 3NGJA 4LRSA 4C1NA 4V33A 4YWIA 4AIEA 3M0MA 3PTMA 4IL2A 3C61A 5DRCA 5IXEA 4H2CA 4HCHA 1Y5WA 3V1PA 2AQWA 1JI2A 3IJ6A 5HQEA 2XVPA 4FLSA 3B8UA 1XLJA 3PJUA 3ICJA 2CLFA 1RSCA 3EEGA 2PLKA 4UCGA 4UTWA 1XISA 3HN3A 4A3RA 3KRZA 4CQ8A 3PM6A 1MDRA 1VFHA 3BPWA 3M0ZA 1NDVA 4XUGA 4ZQNA 1E6PA 4K7VA 2BXYA 3A5VA 3M7WA 3NWRA 1UR4A 3VNLA 1PKLA 3R58A 4QISA 2FVMA 4MJ2A 1TWIA 1XSJA 3QQWA 2OYMA 1MW2A 2AL1A 1KBJA 1CYGA 1W3NA 2AGTA 3PR2A 3K4DA 2C91A 5BWAA 1T40A 3ZIZA 3CIWA 3NDYA 5BU9A 4E38A 1XCFA 4IZGA 3AXKA 2ATMA 4HK5A 1AH0A 4NNAA 4JY9A 4N9CA 5JH2A 3BCFA 2WHJA 3Q37A 5DMNA 3TJXA 3GHSA 4H01A 4ZQOA 2V5BA 6TAAA 2QAPA 4JR5A 3UXIA 3U9IA 5BRPA 2X30A 4LX4A 2PDFA 2W62A 1W9VA 3AWNA 3GTIA 5GJMA 1LQAA 1WKDA 3NQCA 4GISA 2YXGA 1F8MA 4LAZA 1E72M 1XLAA 3UR8A 3L4UA 3RGTA 3C2OA 3C2RA 1PVNA 4L1WA 1AQFA 3PTKA 3WNPA 4Z1AA 4IPJA 3EOOA 2WHLA 2FVLA 1ADOA 3QHMA 3B0YA 1JQXA 5I02A 3RF9A 1W8GA 1EOKA 1HJQA 4HJWA 3SIMA 1C7SA 1SO4A 1FWEC 1GNXA 3FNDA 4I9TA 4HZ6A 3OQEA 1Q6GA 5BXTA 1TELA 3GVQA 4M24A 4N0RA 1SJBA 2GGIA 2A3EA 4XZNX 3F5KA 4JL1A 1R5YA 2RUSA 1QASA 2DIEA 4GXPA 4LW7A 1EZ2A 3ARVA 2WJDA 1JCTA 4G7EB 1P0DA 4JYDA 3JS3A 2WJFA 4F4RA 1CGUA 4ZO6A 1WDWA 1IEIA 1NAL1 2OEMA 1EBGA 2OT1A 3TWBA 5LSMA 4Y8EA 4Y9AA 1JZ4A 2NUXA 1WDDA 4LVGA 2VDIA 3IJ8A 5A6SA 2GGGA 4U5IA 4QAWA 4JIEA 3GFYA 3MCOA 3SZ8A 3TH6A 3TROA 1FWGC 4ADTA 5J8LA 4ZQPA 1SFJA 5M17A 1FDJA 4V28A 3LV5A 4JGDA 1G69A 2O0TA 4GQGA 4J2PA 4G1KA 2ZUVA 4UTJA 4LWWA 1UKOA 1M01A 3L67A 3BCJA 2H8ZA 3Q4DA 3T9PA 4XIMA 4IMDA 2NX9A 2OSWA 3R94A 2OX1A 1XLEA 2EG6A 5C6MA 1PL9A 2RDTA 4DI9A 5GNYA 1PZ2A 2OYKA 5BXRA 5TQLA 4QTGA 1F07A 3W22A 4MYAA 3OLIA 1EHAA 2J77A 4CNUA 3R43A 4HA0A 4AX6A 2CCRA 4AD0A 5E9XA 3CLWA 3GNPA 3HIJA 1JD9A 4A3UA 2VGGA 3B8VA 4MWAA 4FNQA 3RJXA 4HIBA 1IYXA 1CXKA 3DFQA 1W37A 2WC7A 4IX2A 2V3EA 1YEYA 4GRSA 1ZB5A 2POTA 1J5SA 4PN2A 4QROA 1RAKA 3S1GA 3EWUA 1EUAA 3IIPA 3W25A 2NQHA 4PBFA 3AOFA 3VIJA 2FPVA 3R2GA 1ZU8A 1LQ2A 4H7ZA 3BQ5A 4A3YA 3EPOA 3QLDA 3U2ZA 1IIHA 3WLHA 3SO7A 1U2YA 1EGVA 3ABXA 4XD5A 5IM51 1EP3A 4HN4A 2VGFA 2WVVB 3G8RA 4O14A 1BF6A 4UMAA 3WH5A 2IQDA 1QNPA 2D2HA 4JKMA 5DMLA 4JXCA 3DX5A 4HPGA 3W76A 3BLFA 2HRWA 3M0LA 2WC3A 1UHVA 5IBXC 2EQDA 2E5BA 4YTUA 2VURA 4O8AA 3LUTA 3DFTA 3OGVA 3ES7A 3QSRA 1ZS2A 3E3HA 4B9ZA 2ESCA 2VD8A 1YPIA 3L5LA 4TVUA 2QUTA 4C6NA 3DU0A 1EX1A 3O6AA 1WKFA 3NOYA 4QBXA 5D2TA 1Q4WA 2GPTA 1RQBA 1JRCA 3RNDA 1V03A 3QZAA 1CIUA 2ON3A 3PG9A 1N55A 4PB3A 1TPVA 2BOGX 3TQVA 6ALDA 4UQ9A 4GINA 7A3HA 1NEYA 3LX9A 1JDDA 4ADUA 1AJ2A 1SZNA 2VFIA 1JYXA 3BOFA 3VGEA 1UIPA 4K8EA 2J9XA 1RCOB 1VPYA 2XIJA 5TD4A 4L6DA 3FIGA 4DJED 1XSKA 4YN5A 1J93A 1PWMA 1M7PA 2HS6A 3P5ZA 4PUUA 4XZWA 3XISA 1F7BA 8XIMA 3GH4A 1B3YA 4PMUA 2C3ZA 1W5OA 2BNJA 4DLFA 1AH4A 1A50A 1TG7A 3AJXA 4R88A 3K1GA 1I8JA 1QO5A 1E56A 2Q3RA 4JNZA 2PP0A 1TO3A 1KFJA 1NP2A 3W2UA 4FO4A 3UPBA 2H8XA 2GJNA 3VIKA 4MM1A 1NOWA 3HGSA 2F2KA 2FHCA 3VINA 2J47A 2PDNA 2C1GA 3KS5A 1W17A 2VR2A 4E4FA 3IARA 2WPBA 1H50A 3GXMA 4A3HA 1XC4A 4UOJA 5LXEA 2RGLA 1R46A 5H1WA 3GU9A 3URQA 1AQ0A 1GPFA 1I9CB 2UY2A 1Y65A 3NNTA 4GFIA 2WANA 3E0IA 2YA0A 1F3WA 4D6FA 3PUEA 1RCXB 1QW9A 5F2MA 1MNZA 2E1WA 3R1ZA 2YOCA 4U2ZA 2NT0A 4AG0A 3AALA 1ZNNA 4DJDC 3TMLA 1HF6A 1R7AA 3CUJA 1NF7A 2Y88A 5FAGA 2ZRZA 1UOZA 2BX7A 4JL2A 2UWFA 3G24A 5C2GA 1V51A 4MAZA 3O8AA 1XCXA 1QVBA 3CIVA 3KZPA 4BS0A 2VOMA 1VYRA 5J04A 1F5ZA 1PB0A 4HMCA 2X7WA 4PMVA 5DBTA 2X16A 1QI2A 2NWSA 1YXCA 4C5ZA 1M53A 1IR2A 1R2TA 1W1ZA 3UVAA 3NG3A 2RJGA 4TXEA 3H7UA 5BROA 4AZGA 3E96A 4JYFA 5DX7A 1GOXA 3KWSA 2PDUA 3ARUA 4GI4A 4ZMGA 3G1XA 2VC7A 3GE7A 3B06A 4AYGA 4HNTA 1KM1A 1V3LA 1ZL1A 2R9RA 2JE8A 2QCDB 4JN7A 2OQLA 2CXEA 1JYWA 1E3ZA 1ME8A 2I16A 3RPTA 4H9TA 5E0KA 2QW5A 3WQ8A 4QDWA 2WHMA 4CNOA 2DVTA 2VZVA 5DCDA 4ZEPA 3W28A 1O12A 4AZBA 3FJNA 1YRRA 4UMBA 1DQUA 3WBEA 1BYDA 4UTHA 1CB7B 2PRMA 2NLIA 3GKAA 4OZOA 1VIWA 3NL5A 4I7VA 3TCEA 3UGVA 5F4WA 2YCLA 1B2YA 3RR4A 1JZ8A 3NURA 2V2CA 4K7YA 1VB9A 4OBSA 1BYCA 4O13A 3SADA 4C6KA 4Q4MA 4OGZA 5A2AA 5DCBA 1VZWA 1VF8A 2FGLA 3QTGA 4U28A 1YE4A 2A1YA 3LERA 5LIXX 1Z8AA 3KE0A 1G4PA 4J3VA 3PPFA 5T9BG 3ZJ6A 1JCNA 2VZOA 3H7RA 3KW3A 4DWSC 2WZHA 3KBSA 3V7PA 1GZJA 3ZZ1A 3NL6A 4EACA 3IK4A 3QV8A 5FI8A 2J6XA 4GABA 1ZBCA 4LEQA 3NIYA 4QSHA 3W1QA 3BH4A 3GD6A 5G4EA 3DN5A 1VRDA 4GK8A 4IOTA 5AC8A 2I7GA 3QGAC 2GVEA 1PEZA 3MO4A 2OR2A 1E0XA 4XO7A 5I79A 3A6OA 1H1YA 1UROA 4LS2A 4URIA 5EFDA 4RE3A 3VKAA 3GDMA 1HUVA 4W7VA 1A4LA 1U1JA 2P76A 2I57A 1P6CA 4IXHA 1BPLB 2EO7A 1YNPA 4Z2LA 5LGZA 3H2AA 1F3TA 4A8LA 4MIMA 3U2OA 3MV01 4CEXC 4C90A 2GFTA 3NSXA 4P8WA 2BTMA 7XIMA 2QCFA 2REQA 4OV4A 4I7UA 1OX5A 3VKDA 1OADA 4L4PA 4IFKA 3VNDA 2OB3A 5FJOA 7PTDA 1OIFA 2Y7EA 3PBYA 1QOPA 5AHMA 3CZ8A 1E9YB 4H2HA 1HL8A 4I6KA 3GTNA 1NFPA 2GJXA 3WQVA 4GVHA 1MW3A 3N14A 4C1NB 1WKEA 4O8RA 4HBKA 4IFOA 2X2YA 3ONCA 3G18A 4IFRA 1PTAA 5BZAA 3MWAA 3EB2A 3HTWA 4UNLA 1XC6A 4Z1DA 4FALA 4AWTA 1GG1A 1KM2A 1QTWA 2ISVA 4MLRA 1GQNA 2ZUNA 3GWQA 4I8DA 3R25A 3QY8A 4S39A 1TE1A 1LCOA 4C7FA 1B30A 4XZLX 4RUBA 1XKJA 2BHYA 4ZXOA 3GC5A 4XIAA 1HL9A 3N6QA 4S3CA 3TC3A 1DXEA 1OFOA 2BFGA 1Y7VA 5HUOA 2QDGA 1A5CA 2W79A 4RDZA 3BWWA 2WLYA 3NQ2A 3N3TA 3UYIA 4QE1A 3T0AA 2F8QA 2HJPA 3DAQA 1Y5XA 2C19A 5JIPA 4N42A 3VGHA 5DMYA 5BOOA 1OX6A 4FNPA 1JDEA 1DJIA 4J3TA 1XRSA 4LUSA 4LF1A 1UW9A 3VIGA 3TVAA 1TQXA 4UFLA 1A5AA 5KITA 1M5WA 3NQ7A 3S3GA 3EX4A 4GA8A 2R8WA 4JQAA 2PWGA 1KWGA 5A2BA 5CSSA 1VIZA 3PZ9A 4LS0A 4DJFC 4B90A 4UFJA 1JPIA 3GR4A 1OC7A 3ECQA 1KXTA 4XG1A 1UC5A 2DW6A 3W3OA 1UR3M 2G37A 4HHHA 4HA3A 4L1XA 4NUWA 3PBWA 3HPFA 1IF2A 4L9XA 3VK5A 1WXZA 2YJQA 1E1FA 4RR4A 2XIBA 4XISA 5AOUA 5M5DA 3R11A 5CBBA 4UTUA 3WQPA 2OFJA 5I06A 1AZ1A 4DYKA 3U2CA 3ZLFA 3ALFA 2FYMA 2UZ9A 4GZIA 1T5AA 3RU6A 4JN8A 3SN1A 3KEHA 3LPGA 3URAA 1RXOB 5HXMA 4QNWA 2G97A 1XI3A 4CUCA 3CV1A 2ZUSA 1TX0A 3EWWA 4ALDA 2FGZA 1UOKA 3OODA 1E55A 4TUFA 4BWLA 3NA8A 4ZVJA 3UPMA 2CLOA 1R9YA 1QNSA 1HL2A 2IKGA 1TPC1 1I45A 1VFLA 3EYPA 1US0A 2GVYA 4C91A 3F5LA 4GZEA 2ZRWA 3A4XA 1EYEA 3TN6A 1LOQA 1GOWA 4TU1A 1W9PA 3FJLA 3APGA 2VXNA 5XINA 3G1RA 4F0SA 4V15A 3V1HA 5HR6A 1UBSA 2XH4A 1NU5A 2IXVA 5HULA 3T8QA 3LM7A 2D3LA 2VO5A 2D0GA 2PDBA 3PZUA 4MB5A 4PCSA 1XM3A 2G8ZA 3D3FA 4AW7A 1C93A 1RUSA 2WM0A 3M5YA 5HWJA 2GUUA 1UP3A 4ECLA 4C6IA 3ZT5A 1WOAA 2FTYA 1HKKA 5D9NA 4NZFA 4ORIA 1A5SA 5EMUA 4BZYA 3U8GA 5DY3A 2QDDA 4PMZA 3F4WA 4C6OA 2ZQ0A 1GVRA 4LUYA 3Q94A 5DF0A 1ICPA 5G4WA 3B0XA 2VYOA 2JIWA 1SSGA 1VP5A 3CU2A 1HGYA 2E8ZA 1ZCOA 3ABRA 1F9CA 3LNPA 1HKJA 1OGBA 5T26A 2FLIA 1ZGDA 1V02A 1ZZMA 1JJKA 1GVOA 4LY8A 3K13A 4IMCA 3GUGA 1UZ4A 2J74A 3ZR6A 1UPMB 1KCLA 1K7FA 3VIHA 4MWAB 3CV2A 2HV5A 3TYEA 1XPYA 4O50A 4GQ0A 4UXDA 1BG9A 1G4EA 1GEHA 4GVFA 4GYFA 3G1FA 1KM0A 3LI1A 2J4GA 4GGBA 1KTNA 1H11A 1CDGA 2FH8A 4M1BA 3CT2A 3AFBA 3LHUA 4MPKA 4H4IA 1O1ZA 1M1BA 4GWEA 5AHFA 4C6EA 3NVDA 3NXLA 3UD6A 4AXNA 4POCA 5G2WA 3P2VA 4K38A 2Z0IA 2WBGA 1Q6FA 1KCZA 3OZMA 3OEXA 3VNIA 5FA5A 3CQJA 2XFFA 2RFGA 2YDQA 6A3HA 1P0BA 1B90A 4C7GA 4KBXA 3SCWA 3V36A 4JIRA 4MKSA 5A8MA 3MUXA 2Y85A 3IK2A 1R3SA 1C7TA 1RV8A 4WD0A 4HCLA 3UETA 1AD4A 5D8ZA 4DY1A 3DCPA 4AF0A 3F4CA 3U2EA 3U57A 4KKXA 4GG9A 1SVDA 5D2XA 5EMLA 4KRZA 3ZR5A 3BURA 1KFCA 4WY0F 1WO2A 2AGKA 3KAOA 3A9IA 1HKVA 1ZAIA 2NLYA 2CNCA 3NUKA 2WMFA 3E0WA 4QG9A 1AJ0A 3CV7A 1UIOA 3L0NA 1GKQA 1OWQA 3IRSA 3JZEA 3L7RA 3L4WA 3ABOA 3PP7A 5C7VA 4MJZA 3WNNA 3E74A 3EBVA 3MKKA 2PDHA 3B9EA 3VFLA 2VTFA 3PZNA 4YTRA 5B80A 3H2MA 4RZ5A 1OBAA 1X7FA 2TPSA 1XBXA 4EP8C 2OKOA 4BI7A 4C7DA 3AXXA 1H63A 3CZEA 1AMKA 4GIYA 3GUWA 4P61A 4H6QA 3WLKX 2UY4A 2Y8UA 2I5IA 2IKJA 3MWCA 2GDVA 4WK9A 5CGQA 1VPQA 4YS1A 2A3LA 3VM7A 1KBKA 2YXXA 4M6UA 5CLWA 1H61A 4PUKA 4US5D 5HMDA 2OTDA 3WFZA 1QDSA 3CH0A 1KLZA 3HQNA 4XAGA 3V0UA 1YLVA 4AY8A 2PDLA 1AZ2A 2PDQA 1Z3NA 3E0LA 4GC3A 2PWVA 3IVUA 2X1SA 3F7JA 3HJEA 4LJ3A 4RDWA 3NCOA 2PLCA 4JFWA 3T07A 4C6FA 5KINA 4LNCA 1RLCL 1UWSA 5E9AA 3VDAA 4UZSA 1Z42A 1H4PA 1V77A 4Z2KA 2O9OA 4IPLA 4DUVA 4Z2GA 3QHNA 4I9MA 1SW7A 4RX0A 3A21A 3GNNA 1E0UA 2VKZG 4XAPA 2IW0A 5HBFA 2YGYA 4CCCA 4AHOA 1RJRA 1WAUA 1BEUA 3LCIA 3VUSA 4NRRA 1K9FA 4RNIA 1O4UA 5I3FA 4OU1A 3TYDA 5GNZA 4QE5A 1B57A 4HU0A 1H7PA 3AO0A 5I3KA 4ZQMA 2VCAA 1XWYA 4UBPC 1I0BA 1QI0A 3QW4B 2NXHA 2BVWA 2NQZA 4ZTYA 1XIGA 4AIUA 3WBXA 2B7QA 2G50A 3BXWA 1RY8A 1LF1A 2PE4A 4IMGA 5SWUA 3SFKA 3GTHA 5IOBA 2BDQA 3ZVHA 3B0PA 1KNWA 3UGRA 2VEMA 5AHLA 1YQ2A 3DHUA 3WUEA 1BRLB 3QN3A 2AAAA 3ARRA 4PRWA 2QJIA 2NQLA 3M46A 3V35A 3Q2DA 1W1A1 2B7OA 2OQHA 1F6PA 2A79A 5MKGA 3USZA 1YDYA 4L61A 2XWEA 1WDSA 1VLIA 4W8LA 1J96A 2WZMA 3UWVA 2QCEA 4AB4A 4ZCWA 2VEKA 2MANA 4H83A 2E1DA 1FQ0A 4ORMA 2YCLB 1V0LA 1FCBA 2FDSA 4AD5A 3BAXA 1PX8A 2R24A 4I6VA 1NQ6A 1F2JA 3W70A 2HNEA 1E15A 2DP3A 4Q4OA 1ISZA 5AVHA 3NEHA 4IPNB 3EDJA 1GVYA 1JL8A 5D32A 8A3HA 2HVOA 4XAYA 3OPSA 3M0JA 4S3FA 2R1PA 1GOOA 4QSFA 3E49A 4ADSA 3RLHA 2PGFA 3P61A 1OCJA 4GVIA 2J13A 1W1IE 3UG4A 4JCLA 3N2CA 3LHWA 4PTDA 1XPGA 1CGYA 1XUZA 2O9RA 2YDAA 1LQ0A 2Z1VA 2R1NA 1OFEA 1XR2A 4FR1A 3VILA 4S3AA 3KLLA 4S3GA 4E5TA 3C8FA 1M9HA 1UMYA 3BW3A 4FSAA 4YIWA 4PL1A 1Q6OA 2WO5A 3STCA 1M68A 1PJ9A 1JZ7A 2Z6IA 1EXBA 1H7WA 3S9YA 1SO6A 3U0HA 5H8MA 1R8LA 1E4NA 2ZZ4A 3LTPA 1ZPTA 3FXYA 5DLCA 4WDUA 4X9YA 5AZ0A 3U7VA 4Y9PA 3TC7A 3VDHA 5IHSA 3TW6A 2GGEA 2AMGA 2REQB 2ZE0A 2FJUB 1V6XA 2D0HA 3XIMA 1UQZA 2BVYA 1SQ7A 2PDJA 4R85A 4IFKB 1FOBA 1OGGA 3RHGA 1BXBA 1EF3A 2QCMA 2VCBA 1P1XA 3D46A 5G1YA 8TIMA 5AKQA 1XIBA 1RK5A 2QUNA 4UTKA 1H5VA 1IR1A 3DG7A 3GDTA 1O1HA 5DQPA 3WF3A 3EXRA 1G7UA 3JR2A 4V2XA 5LZLA 1RBLA 4DF1A 3DFYA 2GJXB 4GUJA 4UFMA 3PK7A 2VM8A 1VEOA 4WDWA 1XF0A 3O0FA 3B4YA 4E8GA 4IQDA 2X1IA 1AL7A 4RXGA 4ZQCA 4NRSA 1BD0A 5ENLA 1E73M 4FR6A 2CFFA 4K68A 4UWMA 1VS1A 4LSBA 4GH1A 4D8LA 1JIBA 2G0WA 3SJNA 1JZ5A 3W7IA 4X2PA 2CITA 3VZYA 5CPQA 4I7WA 3DI1A 1TV5A 4CD5A 1FCQA 2ACRA 3RX2A 4UFKA 4C1LA 5CPNA 2J6VA 3WJWA 4LVBA 2ALDA 3PSVA 3VUPA 1UA3A 2D3NA 3M6DA 5LA2A 2DZAA 1KRMA 4KPLA 2WCSA 2ZTJA 4LF2A 3TXZA 3AMDA 1XH1A 3ZJ7A 3UXDA 1A47A 2V6AA 4N4QA 2H90A 7REQA 4LUSB 3GQYA 3MHFA 2Z1SA 4KCTA 5MHBA 3OB8A 3MB9A 3S8HA 3LTSA 2H6RA 2A3CA 4OQVA 1VBGA 5AYYA 4NJKA 1QI4A 4PUJA 4ACZA 3EOLA 2ZC8A 1DWJM 4F0MA 3TJ4A 2YL9A 1FH9A 1AG1O 4C5YA 3K5XA 2PA6A 2VOTA 4D2JA 2YDSA 1J0ZA 3HG3A 4C65A 2QVHA 3T2PA 1US3A 1TV7A 1WBJA 4YU1A 3GNOA 5F2LA 1G6CA 1PX3A 4GD0A 3PAOA 3JVAA 4S2BA 1Q6RA 4ZZ9A 1UPPA 1XLLA 4B5XA 3A22A 3KVKA 1S3TC 1E43A 4OJYA 1KXHA 3V4BA 4KIRA 3ABQA 3FA5A 4PC8A 5JBDA 3PJTA 1BQCA 4QX4A 1E4IA 3KRSA 2GOUA 2G96A 1I6NA 4Q32A 1QNVA 2X0SA 2V2DA 1WB0A 3C2FA 3W01A 3W7NA 2PDIA 1BXNA 5D05A 3SUWA 3FOKA 4L5ZA 2EJ1A 4NZ4A 3N2OA 4E4UA 3GXDA 1TJRA 1CGVA 4UMCA 4XB3A 2JEQA 4PMOA 1R3RA 2G3JA 4JTJA 1LLWA 1J12A 1VEPA 5C7HA 3P0WA 3OZOA 1PYMA 3FA3A 1YIXA 1H51A 2O9TA 3GDKA 1ZY9A 3W2JA 3GS6A 4XZIA 1WCGA 4MVAA 2ODOA 1XYCA 4AZCB 5AYZA 4B5VA 2OSYA 2GVGA 4GE8A 3VTRA 1F6KA 3I4KA 1EWDA 1BXCA 3IAPA 4Q7NA 3QMSA 3CUIA 4MNJA 3TYCA 5CPMA 3ZLGA 1NFBA 3BV7A 1RA0A 3NQMA 3GDRA 5D04C 2WB5A 4JQ2A 1REQB 4O1EA 4UTLA 5CG7A 1XH2A 1V0NA 4XK2A 1R3WA 5K2ZA 4FOJA 3ITYA 4FOUA 4QJ4B 4DUWA 2P10A 5LKYA 4RE2A 4IXXA 1GCYA 4PMRA 3MP4A 4Q6XA 4IG2A 3NOEA 4JTAA 2PEVA 4EXBA 2WKGA 1P0KA 3L65A 3RXZA 3L4YA 4CQDA 4OWGA 1BYAA 5A6BA 4DJEC 1DVJA 4GBDA 3S5YA 5FD0A 5D37A 1A49A 1PPIA 1RZMA 4ERAA 3KX6A 4IP7A 1VRXA 2QJHA 2PB1A 3RLUA 3T40A 4AQLA 4EXAA 4OV9A 5BOEA 5KETA 3BJTA 1ML1A 4ZO7A 3UG3A 3DECA 5HQMA 2VC9A 4R7OA 2PS2A 3DEQA 2Y8KA 4XVDA 1Z6KA 3AIBA 3T8LA 1S38A 3W9ZA 3SSZA 4KFPA 4OFCA 2YCKX 3SURA 3O6YX 3WNMA 1CGXA 3TV8A 1LWIA 1SO5A 5DN1A 3PFMA 1S5NA 7TAAA 4XAFA 1LWHA 1UZHA 1KRAC 1GOIA 1O5KA 4BJHA 3CHEA 1D2KA 2VDGA 3SGZA 3LPFA 1S1PA 2Q8XA 3UERA 4GZ7A 2VFHA 2C79A 5BXSA 2OGJA 1F4AA 2YW3A 4DN1A 2HK1A 2RDWA 3MQTA 2VRJA 5AC5A 3G5EA 2W6RA 1OYCA 4F9JA 4FK9A 1NDWA 5KMYA 2OWWA