3CH0A

Crystal structure of glycerophosphoryl diester phosphodiesterase (yp_677622.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
GMIQVPASFDIQGHRGCRGLLPENTIAAFTKALLLGVTTLEFDLVISKDNRVVVSHDTFFHHEITMMVDGEDVTEANEKNFNLYAMNYADIKEIDVGMKTHPRFKSQKKVPAVKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNIDHPNIALFCDLVVAEIKKAHITDRFTLQSFDVRALEYMHSQYPDIKLSYLVETKGTLKKQLEKLSFTPAVYSPDVTLVSKKDIDAAHKLGMRVIPWTVNTKEEIETLISLGVDGIITDYPDLFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycerophosphoryl diester phosphodiesterase (YP_677622.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Hydrolase
molecule keywords Glycerophosphodiester phosphodiesterase
total genus 91
structure length 272
sequence length 272
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ch0A00
3QVQA 4F2BA 1PTDA 3PTDA 1VD6A 1XX1A 3CH0A 2OTDA 4I9TA 1T8QA 3EA3A 4QJ3B 4GNKB 7PTDA 2OR2A 1DJZA 4R7OA 5PTDA 3QR1A 4RW3A 1QATA 1DJHA 1GYMA 2FJUB 4I90A 4QJ4B 4RW5A 3OHMB 3V1HA 1T6MA 3QR0A 1DJXA 4F2UA 6PTDA 1AODA 1V8EA 4OECA 4S3GA 3EA1A 3H4WA 3RLHA 3KS6A 4RV3A 1DJWA 4I8YA 2O55A 2P76A 3RLGA 2ISDA 1PTGA 1YDYA 2OOGA 2F9RA 3H4XA 4QJ5B 3NO3A 1DJIA 4PTDA 4I9JA 4I9MA 3KS5A 1ZCCA 5T9BG 1O1ZA 3MZ2A 4Q6XA 2PLCA 2PTDA 5T9CE 1QASA 2ZKMX 3I10A 4F2TA 1DJYA 5T91A 3V16A 3L12A 2PZ0A 1DJGA 3EA2A 3V18A
chains in the Genus database with same CATH superfamily
1DOSA 3A22A 4E8GA 1ZBWA 4GC3A 4EF9A 1HT6A 3PZMA 3WDQA 3MV01 2OMAA 1EUAA 4TVUA 1IZKA 3WG6A 3RCMA 5DT7A 2OQHA 3AXKA 2PWHA 4OFCA 3V7PA 4LYKA 1TUXA 3NR0A 4DNMA 1PDYA 4P8XA 1O94A 3Q65A 1H1YA 2J77A 2R1PA 4JTUA 3DHPA 4CUCA 4IPPA 2DVXA 1AJ0A 1QHZA 1EWDA 5G4HC 2ZTKA 2CLFA 1OX4B 4J2PA 1OCBA 2EKGA 5T9BG 3N2TA 5D05A 2XH7A 3LM7A 4O28A 4CGTA 4MGGA 3BJFA 1BVWA 4MDPA 5D8WA 1SR0A 2QDGA 4PODA 5C71A 1NP0A 3H21A 3MYOA 1XRFA 3ALGA 5I3FA 3GSMA 4GXPA 5F2LA 3DFNA 4CU6A 3U48A 4CQBA 4F0MA 1ZBKA 1XSJA 1TZ7A 1K6WA 1RQEA 1TX2A 1NOFA 2G96A 4H3DA 8TIMA 6A3HA 2V3EA 1SM9A 2ZWYA 5JBDA 4M5PA 4KEZA 3RU6A 3TXVA 4M51A 1EOKA 5C6MA 4JKLA 5LGXA 3A4JA 1HKWA 1K8CA 3U9IA 3B0VC 1AG1O 3L2IA 2J79A 5FEZA 3H2MA 5E9XA 1Z69A 2WXDM 2J47A 3CAKA 3H2EA 2ZVIA 3FVDA 3TNOA 1JDDA 2J8TA 2YLAA 5FF3A 3R2GA 4UQBA 2EF9A 2WJFA 4FIQA 1VFLA 3EEZA 5KTLA 3OIHA 4E6MA 3IJIA 1C90A 1EDQA 1EXBA 2FZNA 1A3HA 3C2YA 4UFLA 3REQB 4B91A 5HNTA 1XX1A 1ZHAA 3ME3A 2D2GA 1W37A 4GJ1A 2IXUA 2ZX6A 3NL5A 5G2IA 4MHBA 4UOQA 4QCFA 4QITA 2BTMA 1TV5A 2B7OA 3CTLA 2XPKA 3MWAA 3CQJA 4ZO7A 3GXTA 1XQLA 7A3HA 1TWIA 2PRHA 3M6YA 3HPFA 4H6RA 4K39A 1ISYA 1XPGA 3RM4A 1VRXA 4UXDA 3RMEA 4GGHA 4ZTYA 2ZTJA 4AEEA 1A0DA 2Y61A 3U5UA 3WH5A 5A69A 4DHGA 1EP3A 3H12A 5CPTA 1H0GA 3UWWA 1GUVA 1E71M 5CQ1A 4QFUA 2B7QA 3AIQA 1XS2A 2POTA 2HVOA 2GVLA 4N9BA 3G1VA 4WKHA 2ATMA 4LJ3A 1X1OA 2YXGA 1ADOA 3WMLA 5FACA 4KFOA 1CXKA 3EAUA 2DV0A 2JIEA 2J4GA 3KVLA 2H6RA 1SO5A 5G4EA 1IF2A 3QYSA 2WMIA 1CBGA 3M5YA 4UFIA 3QZ6A 3GVVA 1FWCC 2C1GA 3VM5A 2OEMA 2EEXA 3B9DA 4GKTA 4AZCB 3W72A 1EJVC 5EMUA 2DT1A 2PGWA 1AW1A 1MDLA 4NY2A 1EQPA 4TO8A 1WDDA 3UXAA 2CIPA 5DCBA 1M3UA 3OHMB 3MHFA 3CUGA 4EACA 1HL9A 1L0PA 1EHAA 4Q7BA 3KBJA 1DJIA 2OU4A 4JN8A 2BV9A 4LYPA 4KW2A 2FH6A 3S1UA 4IP7A 3E0LA 3C2RA 4IIGA 2AMGA 2VEGA 3IUDA 3UG4A 1CYGA 4DWSB 3T2PA 3BO9A 1TTQA 2OZ8A 2QCNA 1AODA 3MUIA 4MYAA 3SSJA 3THCA 2XM2A 1UD5A 1EJWC 4IIFA 4E5TA 4R88A 2YXXA 1A0EA 3B0PA 4DX3A 4UR7A 4GXWA 3VNMA 5PTDA 2XVPA 4Z2LA 5C2XA 2J7DA 3ZLHA 4D6DA 1W3TA 3ZLFA 1TO3A 4D6CA 3O0FA 4W8LA 4ZEPA 3TR9A 3PZUA 3WSUA 2HVMA 1QASA 2QLYA 4LBUA 4N7QA 3DEQA 3LQLA 3R94A 4WY0A 2WMIB 4B90A 1ME7A 5E93A 2A3CA 4QR6A 2ODOA 4S3GA 3UA4A 2PGFA 3UG8A 1HGYA 2XH4A 1JI1A 2FHFA 4AD5A 1HUVA 3IJLA 4F2TA 3GW3A 2DUXA 1VC4A 4XTIA 1PYFA 4QJ3B 4R7JA 1E0WA 4R7OA 1AQFA 1HGWA 3RM9A 1XKJA 1A5NC 4QAIA 3E0FA 3TTQA 5E70A 4PMVA 4JQ3A 4H01A 1ZGDA 1W17A 4EF8A 4C6JA 4UTJA 2OZ0A 4OV4A 4Q8VA 4AEOA 5EBAA 4KESA 3F4WA 4QG6A 3NL6A 4C6OA 1H7WA 3EOSA 1RBOB 3BGJA 4MY9A 4K1WA 3E2VA 1ODUA 1U22A 1EPVA 4PCPA 2GL5A 1O95A 2NWSA 3P2VA 2PGRA 3FKKA 2GFTA 3FA5A 3CQ0A 3GG1A 1ECQA 4KQNA 2A21A 5HR6A 4DBWA 5C55A 1HVQA 1A50A 1QWKA 1XR2A 1R3YA 4RDWA 2X1UA 4UC5A 4FA3A 1UH3A 3REQA 4HVXA 3BLPX 3OEXA 4H9UA 5DO8A 1WKYA 3SCTA 3UF9A 4WGHA 1W9XA 1QBBA 4OOUA 1E9LA 1XD0A 3W7MA 4MJMA 2VFEA 3NM1A 2OWWA 4WY0F 5CC5A 2WCSA 4YTTA 1NFPA 1DQWA 5EPDA 4EIVA 3HFYA 4D6JA 3ZT6A 3MTWA 4B9YA 5M2FX 2V30A 2W3ZA 3HG2A 3RO6A 3FHQA 1L6YA 3VFCA 2BODX 3R89A 4DJED 4NNAA 1OQFA 2EXOA 1M5WA 1W1VA 1VYRA 3LD5A 2BS9A 2MUCA 3E0IA 3QQ0A 5GPRA 4ZTXA 2GUBA 4XBJA 3C3NA 3S3GA 1H7RA 1T0OA 2JE8A 3DKJA 2ZC8A 4WEVX 2FFIA 2HK1A 3GC4A 4QGCA 3VKDA 2CHOA 3T1GA 2R6OA 1XRVA 4IXHA 4KWUA 4PTDA 5IFTA 4R53A 2R82A 3MO7A 3RUBL 3RLUA 1TV2A 1OABA 3QTGA 3SURA 4MPKA 1VD6A 3W73A 2FIQA 3VDGA 3C86A 4UZSA 4CD6A 1E3XA 2ZUNA 2EAWA 2PTYA 5CPMA 2R1NA 4MWAD 1RV8A 3UWEA 1G67A 4MFEA 1PTGA 1Q65A 1FWTA 5I07A 4J3SA 4UFJA 2PDYA 3SCSA 2OTDA 3B8SA 3FSTA 3LERA 3P8IA 3MBDA 2FZDA 3CB3A 2FGLA 3FFSA 3BXWA 4EX4A 2J13A 3WLIA 2PDKA 4DPPA 4ZR8A 4YMZA 3KE0A 4NVTA 2R1LA 3FV9A 3CUFA 2WVVB 1JPHA 2Z28A 5E0KA 2IKJA 1E0XA 4GVHA 2B81A 1RP8A 2YYUA 4WK9A 3OLIA 4YU1A 3AHZA 4C6PA 4GH3A 5AY7A 3W1PA 3MSDA 5BOEA 1QW8A 3ECQA 2AL2A 3ZSSA 2ZOXA 3U57A 2ADAA 3N9RA 1JCLA 1T7LA 1JRBA 4OIFA 4UBPC 3W7KA 3H53A 5EKYA 3HGSA 4W89A 2Z7GA 4NZ5A 2CKRA 2HNHA 3DHDA 2ZUMA 3E0WA 3CQHA 2EPOA 3KUMA 1SMDA 4NZ4A 1AJZA 2ACSA 4JICA 1TIMA 2ZA3A 5BXRA 1B3ZA 5LNUA 1JCMP 2CXGA 2V3FA 2VP8A 3CIVA 4LBRA 1WBJA 3VD9A 3CHVA 1RCXB 4NAEB 2CW6A 3PWGA 1JNDA 1BWKA 3FA4A 1XLIA 1JPMA 4Q4KA 3VDHA 4PL2A 4JIQA 4BQ3A 2G3IA 1UOKA 3FEMA 3H23A 3UXKA 1ESWA 3EWXA 1S3TC 1UQZA 3K4DA 3MJYA 4H9TA 4XD6A 1X96A 4Q3MA 3A4XA 4Y2WA 3UERA 1V0LA 3GU9A 3XISA 1G01A 1OIFA 2QF7A 1AQHA 1JNEA 4XD5A 4MB3A 3HTWA 1OCQA 4D8LA 5J5RA 4L9YA 3E38A 1KWGA 4C6IA 3UJRA 1QK2A 3BL3A 4GY7A 1YNYA 5BOOA 4JCMA 1QUMA 2QHAA 3VU2A 5FEPA 3F5JA 1VCGA 4PR4A 1P48A 4S2BA 4BI7A 4J27A 4HA1A 2VL4A 1K1DA 4FHAA 1I2NA 1YDVA 4YYFA 3IV8A 3GVGA 3QV9A 4LWWA 1YTEA 2YPIA 3HM7A 3KOFA 5SWUA 3WJWA 4DVOA 1I2RA 2JGYA 1KR0A 4B9ZA 3P5YA 2G3JA 3VIPA 4D6GA 4EP8C 4N9DA 4XZLX 1KFJA 1QW7A 4XAGA 2J6VA 5JMUA 1KFBA 2WKGA 4BI6A 4IMCA 8XIMA 2CEQA 4XV0A 4FLSA 1BVNP 3CEUA 3F2CA 1FP9A 2JKAA 4AYSA 3BH4A 3G0XA 3L4TA 4PMYA 3W7OA 2F2HA 4GQQA 4P8UA 1UC4A 3UBPC 4IOTA 1KFEA 3PG8A 3STEA 1W1PA 1IT7A 3TW7A 1NQKA 2VI0A 1XYMA 2BOFX 4ZQOA 2B4GA 3W2KA 2DZBA 4DJDA 1AH4A 1B54A 2EHHA 5I5RA 3CMGA 4AY7A 5H6HA 4GBDA 3WH8A 1SSGA 3I4EA 1PSCA 2CYGA 3G1SA 2YA2A 3W25A 3VNKA 2OSYA 1E6RA 2HXTA 4YCPA 3AZSA 1UR9A 4L56A 1Q66A 1W2VA 3MCMA 5AZ0A 5AHMA 2YCJA 3HQPA 3BAWA 3BUVA 4PUEA 5LIYX 2Q6ZA 2VD8A 3V75A 1Q8AA 1A5UA 1TX0A 3NSMA 2NX9A 1JZ2A 1ISXA 2ZWZA 3AHXA 2GDUA 1AD1A 3CZGA 5LIXX 3OVGA 4ORMA 4W5ZA 1T99A 1SW3A 1TSIA 4LEFA 3RRXA 4EPEC 5FD0A 3IPWA 3KP1A 2Q8LA 3L9CA 1TELA 3BAYA 1CLKA 4XUGA 1JQVA 1P0EA 4H7CA 3VCNA 4FNUA 1RPKA 1EF3A 2QEZA 2G97A 4PUMA 4ML9A 1EA0A 3V36A 2GGHA 3AZRA 1D7KA 2XN2A 2NLIA 5TD4A 3BAXA 3O1NA 2PRMA 3SRKA 1IEXA 4WVXA 5XIAA 3TLQA 2ISSA 3EXRA 4ERIA 4UMCA 2NW0A 2JFEX 1XIGA 1OC5A 2PUZA 4Q6XA 1V0MA 1B0IA 3H54A 3LBMA 1P6WA 3EOUA 3ATZA 1XGDA 4HYRA 1OM0A 4O19A 2NT0A 2WNZA 4MNMA 3NO5A 3NEHA 4M7SA 3S8HA 1EQCA 3W7GA 4S2CA 4R27A 1HFBA 3TONA 2WANA 3V5OA 2D1ZA 3GKFA 4IPLA 4B5TA 4JS3A 3KLLA 3T40A 3M0LA 2VMFA 3AXMA 1Y8BA 3T9PA 2QDHA 3IK2A 3ZWSA 3T08A 2QUMA 3OA5A 2F2KA 4QJ1A 1QVBA 2NQ5A 2YL5A 3CV7A 1E73M 4GI9A 4LYQA 2OT0A 3FXGA 2VRKA 4Q22A 4GI8A 3ITOA 3T8QA 1CLVA 2XIBA 4DI9A 4YVVA 2BOGX 4XBSA 1IEVA 2JK2A 1F74A 4F0SA 3SCWA 3TQKA 3CTTA 1Q7ZA 3RO8A 3QR3A 4GLEA 4M82A 2FJUB 2E1DA 1GNXA 3Q67A 5BXSA 4GGBA 5AC4A 3S2MA 2VNCA 1TB3A 2G0WA 3GG7A 1K70A 2RDWA 3ZJKA 4S3KA 2OLHA 3AXXA 4UMAA 3VIKA 4DM2A 2PFHA 1WO2A 3B40A 3DKLA 4IMEA 3WBAA 4GKLA 4PUKA 5IM51 2VX5A 4CVUA 5BZAA 3PJWA 1ZCOA 1TVPA 5TBOA 3ARZA 3IIXA 3LK6A 2A4AA 5DX7A 2WB5A 4H1ZA 4F0LA 1B3YA 4BJHA 4ZQMA 3IIOA 4Q4PA 3MHUA 4WQ6A 1ZBVA 5FSEC 4HP5A 4FIRA 4F0RA 3W0KA 2DZSA 4YCOA 3E0VA 5LNSA 2G8ZA 2O55A 4HA4A 2OQYA 1VZWA 1AZ1A 1UIPA 4GUIA 1J4EA 4AVNA 4R34A 3A9IA 3ITCA 5D02A 1IWPA 4LUIA 2G3NA 4TX6A 3UD6A 3WLKX 2WVSA 4F2UA 3GQYA 5L6UA 1XLDA 3QV7A 4ZCWA 3GDRA 5FOOA 3SRDA 5HULA 1EDGA 4IXXA 2OLSA 4EAYA 3CV2A 3WLPA 1OYBA 1UC5A 3TMLA 3LXAA 3MI6A 5AVHA 2XINA 5M03A 3QY6A 5F4SA 4FXJA 4U5KA 3P8JA 3W07A 3P7YA 1GT8A 4HNOA 4KMQA 4PMJA 1XSIA 3KVJA 3IVTA 5FCZA 3W7IA 5IHSA 1S3HA 2E6DA 4F4RA 1JJKA 5K9CA 4GC4A 1RQHA 1QI5A 2CPUA 1QHPA 4GVFA 2CLKA 5E0FA 2AQVA 1ENUA 3M0MA 5FSDC 1GHSA 4DXVA 1LL7A 1DYSA 3FDGA 4AHOA 2WSRA 3PZVA 4LAZA 4J3TA 1LL4A 3NSNA 3OLEA 2RDUA 4KBXA 4UTKA 2FVMA 3IGUA 3WBEA 2YYTA 5CPOA 5CJMA 4X9YA 2NXHA 4WY0B 2IW0A 5DQPA 2IXVA 1GWJA 3TYAA 3DC0A 2CLHA 3FVMA 3GHTA 1YE4A 4HU8A 1EJRC 1ZRQA 1A5LC 3FNDA 1WE5A 2BXZA 4TMBA 3NYZA 5LIUX 1Y65A 4PMNA 3EDKA 4J1OA 3NGJA 1EKOA 1C8YA 1EB3A 1MEWA 1OGBA 2INEA 1PKMA 4CCDA 1OFDA 3LSCA 4MAZA 5ENLA 2EBNA 3IANA 3NO1A 4DO7A 4LVGA 1VFOA 3N3TA 5A8PA 3O6DA 1Q5MA 1Q2RA 2GLKA 2DZTA 4JDYA 4Z0SA 4YTRA 4CQ9A 1WAUA 4H6QA 2WHLA 1EIBA 3BJSA 5DY3A 2O9TA 3SADA 3PC0A 4DLMA 2W91A 4WHBA 5A6JA 4LC8A 3SFWA 3GVRA 4XTDA 5G1YA 2E4TA 1AUSL 3R8HA 4N02A 2PLJA 3DYOA 4RDZA 2OYLA 2PLCA 3LPGA 3V5CA 1C91A 3ZOAA 4AYGA 1IGWA 3WBWA 1DJXA 1XPYA 3VMNA 2IUZA 4C7GA 5ECVA 2RGLA 5D2YA 1REQA 4HK7A 1SFJA 4E0CA 3W1AA 4IIBA 2WMJA 3CHEA 2DZVA 2P1FA 2F6KA 3BG3A 5HJLA 4MZ1A 1V02E 2CBIA 1AMKA 3INPA 1A4LA 4D8ZA 4R9OA 5K3VA 2CLPA 3TMQA 3S1XA 1T6MA 3AS0A 1K4GA 4DJFC 5AKQA 2XG9A 3P6LA 5K7JA 4XB3A 4L1XA 3OBAA 3AISA 2Y4SA 3M0HA 3FJ6A 1GORA 3G3DA 3HPXA 4WCJA 6REQB 3SI9A 2R1MA 3PB2A 4MSSA 2QZRA 4Q8TA 4KCTA 3WMSA 3MVTA 2TRSA 1Z44A 3TTYA 1GOIA 2Y8KA 3OTRA 4OBSA 2BGNE 2FZ9A 3UETA 3KDNA 2G4JA 3NZPA 1JD9A 3RAOA 3WD1A 2YCKX 2BY1A 1I2QA 4LUYA 2YBTA 1XBZA 4DO6A 3L4XA 1OVDA 3NZ1A 1B57A 4IFOA 2QGYA 2Z2UA 4KWSA 3M0YA 4DF0A 4PSPA 1GOQA 3UVAA 4EK7A 3ONBA 1XD1A 2YBVA 3LRKA 3PJUA 3VOGA 1LYXA 4HOZA 4K7VA 3JR2A 1PHQA 1UKOA 1Y5VA 3FEQA 1LWHA 1M01A 2Z1WA 4GISA 1ZSXA 4CQDA 2C71A 1G5AA 1SSDA 1WAWA 1W9VA 2WOQA 3GXPA 1OYCA 2O9PA 2FPVA 4U3CA 2ZADA 4PULA 4C6DA 4LTSA 4UTWA 4XK2A 3S6DA 1MUMA 3WNNA 3B9NA 3KBWA 1J8VA 3LRMA 1FP8A 1O6IA 2EPHA 4L6HA 4S1FA 3APTA 4C6EA 3W01A 5DCEA 4DAFA 1UP3A 4ZQNA 2PLMA 3LBOA 3NQGA 2D2OA 1UZHA 1QO2A 2D0GA 4JIIX 4LB3A 3VE7A 1NOUA 3BW3A 1IQ8A 2PP0A 4PB3A 4JAWA 2GJXB 2HEJA 3CO4A 1LOQA 2ZZ6A 2QJMA 2G5WA 3NOEA 1V6WA 4GHRA 2FZMA 1LJYA 4CU7A 4XO7A 3JZEA 4GE8A 4QJ4B 4NNCA 2V9DA 5CAHA 2W67A 3CZKA 2QMKA 4I3GA 1RY8A 4L7ZA 3OLGA 1EYWA 2JIWA 1UHVA 3HBLA 3UPBA 4HZ6A 4TIMA 3VYLA 1KV8A 1NARA 3PJXA 2PTDA 4UQAA 3K8KA 2X7WA 4IISA 1DJGA 1TR1A 5C8BB 3W1XA 1X6LA 1J0KA 4YPJA 3PAJA 2PDLA 1US2A 4TV5A 3W2MA 4UFHA 4KWWA 3ARWA 5EMJA 5F2GA 4QDWA 3WEOA 2YJQA 1TV8A 1FVPA 2W9MA 1R8LA 1TWSA 4NUWA 3OA3A 1K9TA 2RJHA 1ICSA 2C16A 4EKJA 5C2GA 4XVEA 1XWYA 4QLJA 3P5ZA 4AVFA 4ZSTA 2PDXA 2PDJA 3WEMA 5D8ZA 3GFXA 4IMGA 1RBLA 2EPNA 1VFMA 3NQBA 2NQ9A 1XBYA 3VX0A 2VKZG 2GSEA 1XF0A 3QZEA 1EJSC 4H9ZA 3EWYA 3C8NA 5LA1A 1E5NA 1TMLA 4B3KA 2QJNA 2YX0A 1H60A 3A23A 3RIKA 3DFQA 4MY8A 4BHYA 1L8NA 2FLIA 4PC8A 3TN6A 1D7FA 2NSOA 1UWQA 3W1NA 3BCDA 4DI8A 1JYXA 4X63A 4JOMA 2YXOA 3SDOA 3MKVA 2WHJA 3EX2A 3W3OA 1F73A 1DWAM 4W7VA 1EGMA 4AISA 4FNPA 4MJ2A 1VCFA 1V77A 1GYLA 3EBVA 1XG4A 5CBIA 1QI0A 4PE8A 1G4PA 2ZFAA 1CGXA 1JCTA 3WQ6A 1U2YA 4AB4A 2F8QA 3GX9A 3WJZA 3D3AA 3ZIZA 1MWOA 2HE8A 1VBJA 5CSUA 4Y9AA 4LBSA 2QJJA 1F3XA 3AIVA 3I4KA 2X41A 2XSAA 4H9XA 7REQB 2OELA 5JIPA 3Q94A 3TJIA 3VA8A 1YX1A 5DMNA 2YZ5A 1G0CA 2WCAA 3GRIA 1JGMA 3W37A 2CU0A 2V3DA 4D6EA 2E3ZA 1D2KA 3QMSA 1V3KA 3KBVA 3A21A 1ZAIA 3E6EA 2GOUA 2NX3A 1V79A 5IOBA 2FTWA 2PWFA 2QDEA 1Q63A 1XIFA 4JKKA 4AEFA 3IUIA 4DO5A 3L65A 5AYZA 1IEIA 1QNPA 3HQOA 2G50A 1VHCA 1PVNA 5C7VA 3IRSA 3MCOA 3QQ1A 2QT3A 2WVTA 1HTIA 1WA3A 4BQ5A 2V5LA 3FGCB 4TOQA 1ZPTA 1DQXA 1XLJA 5L9FA 1RALA 4A3UA 1ZJAA 2I5IA 5I3HA 3CJPA 3OB8A 4Z1AA 1Q45A 3WLRA 4XSMA 4LCSA 3R8GA 3LNPA 4O18A 4WDUA 1X39A 4P8WA 3NNTA 1KCZA 1GZGA 2ZZ2A 3LZ3A 3EGJA 4RK8A 3MZ2A 3FN9A 1GEQA 3JU2A 2C0AA 3NPXA 3DI0A 3OBKA 1W2PA 4P7NA 4Y7EA 1CECA 1CT5A 4JNMA 3ABQA 4ACYA 3F4NA 4Y8EA 1SFTA 4MDOA 3IJ8A 3G1RA 4GINA 1FA2A 3VILA 3GXMA 1XSKA 1ISWA 1DORA 4CNSA 2X0SA 2WKLA 3W7PA 3V0UA 3WZ0E 2BZNA 2ZXAA 4GX8A 1JUBA 1GQJA 1V8EA 4LCQA 4XAZA 4A22A 2W5FA 1DL3A 4RNIA 5CGTA 4E2BA 5DN1A 4E38A 4CD7A 2P88A 8CGTA 3EKZA 4ACZA 3G8EA 3VNLA 7ENLA 2QPXA 3H55A 4H4IA 3W70A 4JYEA 1QOQA 3JW7A 4JQ2A 4PFMA 3HV9A 1VRDA 3TTEA 2OEKA 4ZOCA 1G1YA 3QN3A 4NZ3A 3UY8A 1GQLA 1UWTA 3R6IA 3NL2A 5BMWA 1JCYA 4CN4A 3NZGA 1S5VA 4RDVA 5HWJA 3THUA 4NASA 1UMYA 1HZYA 3KP0A 2FB3A 2C0HA 4ATDA 3SUVA 3E12A 3IIVA 3CM4A 1X6UA 1ONWA 3N2XA 5KINA 3W83A 1WNOA 3QPYA 4JD4A 4WR3A 4YWIA 5I09A 4P8VA 5TQLA 5HMDA 4YYCA 3GBEA 7REQA 3BMWA 3SFKA 2CZVA 5I3IA 3RK8A 1EJTC 3KZSA 3A3XA 3C56A 4PMRA 3OGSA 1LF1A 4M1BA 4EPBC 4L1GA 4HHLA 3W6LA 1F2JA 1LT7A 1PKYA 2CWNA 3L0GA 2AAMA 3FJLA 4ONVA 3G24A 1RVGA 1W5QA 2WNWA 1ZB5A 3Q2DA 2J8GA 3AALA 2G4FA 4KRTA 3K5XA 4O50A 2OZTA 4UFKA 1LM1A 4L6DA 4UNLA 1V3JA 3N9KA 3B9OA 4S3EA 2X05A 1C92A 3GWQA 3WQFA 5BXTA 4PB5A 4PMQA 1HN1A 3K46A 2QCLA 4GVGA 1Q13A 3IUHA 1A47A 1I6NA 1V08A 3DHUA 2ALDA 2YL9A 4DWSA 3GVWA 2XIJA 3M0IA 3URQA 3UGVA 5D9MA 3LI1A 1S2TA 5HUPA 7TIMA 2WPGA 4HCDA 2AAAA 3LENA 3P84A 1JZ7A 5CJNA 1L6GA 1Z32X 1X38A 4GNKB 2HPIA 1US0A 1XFBA 2VZOA 4HU3A 1U1HA 2XIIA 1M9HA 4J4KA 3QMRA 1JDAA 5BMXA 3GNDA 4QE4A 3H2OA 4AZ6A 2FHCA 3UZJA 4UNKA 1Z48A 2RKXA 4NAFB 1TJPA 3TIMA 1LT8A 4BWLC 3DYMA 3GR4A 3SIMA 1DP0A 1PX8A 2ZUSA 4WKAA 4X2PA 3CU2A 2R8WA 1NDZA 3FHAA 2WW5A 4H2CA 2QCDB 3TAOA 3L7RA 4GNVA 3WFAA 2Y7GA 2VGFA 3LZ5A 1UJPA 1KFKA 2OO0A 3SCOA 2XU2A 5AFDA 2OYMA 2HV5A 3G1XA 3FS2A 3CZ8A 1UD4A 5I02A 2XVNA 2CCRA 3VINA 2YW4A 3LHTA 4HNLA 5C9UA 4JQAA 2BLEA 5AZ1A 3IV3A 3F4CA 4KKXA 1JZ5A 1AFSA 2DSWA 3PTMA 2XH0A 1PE1A 4S38A 5C5YA 5A6AA 4LX4A 1MW2A 1XDJA 4YLWA 5D09A 4UIOA 4L1WA 4WJ8A 1CPUA 3GDLA 5I03A 1SJAA 3TJXA 4H8HA 3IJ7A 4B5VA 1QI4A 3F1QA 3KS6A 1N8WA 2EQDA 4B2DA 1WXZA 1ZP3A 2VDGA 4ATLA 2XGBA 4JFVA 4LUSA 4CD4A 3BOLA 3TX9A 3R1ZA 3U0HA 4OT7A 4DBSA 4RPQA 1M04A 3M7SA 4UZUA 1TG7A 2ONEA 3WD2A 1OF6A 1P43A 3KHDA 2ZUVA 3BDKA 4S3BA 4ZB5A 4YS1A 1TA3A 4OHQA 3LXCA 4ROPA 2FZ8A 1LRTA 1QOXA 4DYKA 1TTPA 3MPGA 3P60A 2E7FA 1H62A 3AZTA 3PUGA 4YTQA 1WUEA 3VGHA 2OB3A 3QZAA 2ON3A 4XD4A 1ITXA 4O1CA 3H8AA 3G1HA 3JRKA 3BZGA 1S2VA 1KRAC 1PZ2A 4DWDA 3RNDA 5BU6A 1IXPA 3G22A 1LLOA 3KBNA 2W0UA 3A6OA 4YXGA 2YA0A 4ZSUA 3G1DA 1QT1A 1GVRA 3BV4A 3U2OA 4BEUA 4RX0A 1IGSA 3PBUA 2WK2A 2NV1A 6ALDA 4RE2A 4PCFA 4HU0A 4NT0A 1YLVA 2ZDSA 3WNOA 2QCFA 1IT0A 3MUZ1 2CLIA 3H22A 3UGRA 2PP1A 3EOOA 4QEEA 4LAKA 4B16A 2CXEA 1V5XA 3QSTA 3PG9A 3UWVA 3VNZA 2H3BA 2J24A 3BLLA 4DZ5A 2XTKA 4AHPA 4H7VA 3CHDA 4A6GA 2RAGA 1BHGA 1I2PA 1IR2A 1DWHM 4YJ5A 3N2MA 1KCXA 2J62A 3W7LA 3L0NA 4Y8FA 4HTBA 4ZODA 4Z1DA 1WQ5A 4FXFA 3O8AA 5I0DA 1P4CA 4FOKA 1TCMA 4NZFA 1CZ1A 3DGRA 3VIOA 4N4QA 2UY2A 3DGBA 4MJ4A 4DJDC 3VGFA 4GXMA 5H8MA 3AAMA 4GQRA 5AHNA 5HPOA 1F6PA 1ZAHA 2Z27A 1DPMA 3LHVA 1QBAA 5FA5A 3O6CA 3UPWA 1CEOA 2Z1BA 3CWHA 3O06A 4M8UA 1WKFA 3UWZA 3BGAA 1K6AA 4U3AA 1P0KA 5LNWA 4Q8OA 1D8WA 2FHBA 2Y8UA 4JNYA 5ABFA 1GVFA 3AIBA 2XN0A 2WC3A 3EXSA 3M6DA 1OK4A 2R91A 2B31A 2OGYA 5A8MA 3TVAA 3WNMA 2WJZA 4UUIA 2Z7KA 3SRFA 4Q33A 3T4CA 1VGAA 5DBTA 3RX3A 4YL2A 4E2OA 1R3RA 3SUWA 1SZRA 2XISA 2DZPA 2FMOA 5C2CA 1IIGA 4RNJA 1TV4A 1X7IA 3E5PA 4E2DA 1LBMA 2I16A 3SCQA 4MB5A 3FAXA 3FX4A 3RM8A 1YMYA 1T40A 3GD6A 4MAVA 5F1UA 3FAWA 7PTDA 5KZDA 1OY0A 2E9BA 3KWXA 3B0UX 1AH0A 2HNEA 4M19A 4HCHA 1MXGA 5CSSA 3P14A 4IQJA 2QVNA 3O15A 3UCQA 2AQOA 2ZRVA 1NY1A 5J8LA 3GXIA 4IPJA 3HV8A 3QBUA 3QGKC 1TV7A 3UT0A 3LG3A 2A6LA 3S42A 3L4WA 3LMZA 5E0CA 4C6MA 1HNYA 2CBUA 1I0BA 3IJ9A 4H6KA 1WOAA 5A2BA 1XP3A 1KTBA 1IR1A 5GNYA 5HXMA 4CQCA 5A8QA 5IFPA 1Q6CA 4M3PA 2V81A 3UXLA 1NFBA 5JH2A 4Q4MA 2QV5A 2V8ZA 1ZU8A 1V6VA 2PDCA 4L4PA 1O12A 4JL2A 4A4AA 3KS5A 5JU6A 2P3ZA 1UBPC 4AZIA 1OFAA 4IPNB 2GJNA 1XDMA 3CUXA 3OGRA 4QTGA 2FGBA 5C54A 3RYSA 2WYSA 2J25A 4MPQA 3TV8A 4TVDA 4C60A 1QNRA 1FWRA 4Q4OA 4AWUA 1S5TA 1W3JA 1QK0A 1SVDA 4MUZA 1QHOA 4RL3A 3UZXA 1PBGA 1F6KA 3BSHA 3ABSA 4YN5A 2QKFA 4ZENA 3PZTA 2I9UA 1XIHA 2ISVA 4WGXA 2V3GA 3LA4A 1J0ZA 1JUEA 4PSRA 2ICSA 3UYIA 1ISZA 1VPYA 2D69A 2Z2BA 1M03A 2X1RA 3GDKA 5M3WA 3STCA 4D2JA 3M44A 5AOUA 1XV8A 1KTNA 4AC7C 1OCNA 1X7FA 4CN1A 5CGMA 2R94A 4CEXC 4JFTA 1HVXA 3OYXA 4KFPA 4FF7A 4J28A 2PRLA 5CGQA 2Y5SA 4AD0A 3R10A 4ZZ9A 2WMGA 1F6YA 3CMJA 4AWTA 3CV1A 3L2LA 3PTDA 3LMYA 1YPFA 2V2CA 1HKJA 2VC6A 1A3WA 1T8QA 2I14A 1EP1A 3OODA 4RNHA 3QOKA 1X8FA 1H11A 4DXKA 3CS2A 1WBHA 4O8AA 3MVIA 3WQ4A 5A94A 1ELSA 4WOQA 4TX8A 4I5RA 3N4AA 1WV2A 4P7RA 5IDZA 1OFPA 4HSNA 3G8RA 4FLQA 3PZQA 4Y9NA 5JUVA 1E6SM 1TR9A 1HJVA 2BVYA 3PZNA 1UWRA 4HSHA 4PRRA 4GFSA 3P0WA 2VUYA 3AS3A 3GNXA 4QJ5B 1MW1A 2QAPA 1BTMA 1GZJA 3VO0A 3LGEA 2WZHA 2OSWA 5DFAA 2O0TA 3WDPP 4JPGA 2BGQA 3T2OA 4QS5A 1YE6A 3WQCA 2RFGA 2H9AB 3N9SA 1K7EA 1WDRA 3NCOA 3SECA 3UZWA 4JY8A 1OG6A 2Y7EA 3WQ5A 1F5ZA 3A9BA 2XVGA 2YL8A 1J2WA 2UWFA 4J3XA 2EJAA 1OX5A 2WJEA 5DEZA 3H24A 1E1EA 3AXIA 2E09A 5EBUA 1W91A 3ZR5A 2EG6A 5HJXA 5I3GA 4QDMA 3HN3A 3O07A 4C65A 3QPEA 1F76A 3WUGA 1ZCCA 4XZ9A 1Y5WA 2Z26A 3W1LA 3TEVA 1QNOA 2WBGA 3LPPA 1XG3A 3LCLA 3EXTA 1NWRA 4QROA 3ZJ7A 3FJ4A 4W7UA 3G1FA 3B03A 1J12A 1HJUA 3ISIX 5FAGA 1ML1A 1DIEA 1NWSA 1MNZA 3URAA 3BLIA 1UROA 1XM3A 4NIRA 3GC2A 3DYPA 3GXNA 1W5PA 2GSJA 1PB0A 1S2WA 3G0SA 2AOSA 3VM7A 1HIZA 4IFRA 3T2QA 2GGEA 2HISA 1TIWA 3O0KA 5E6YA 3BZJA 1RJRA 3WDIA 4O1FA 4PUWA 1B4KA 4FOUA 4W84A 4DWSC 3RDKA 3UNDA 3NQAA 3GLCA 1X1ZA 1I60A 4AX6A 3OG2A 5GVJA 3UNTA 2WM0A 2IPGA 3DFPA 1T8XA 1ZQ5A 4GO8A 3EB2A 2P3EA 4UMBA 4PUUA 4IQEA 4H9MA 2HMCA 4R9XA 4A8NA 4XQ6A 2VCAA 4UOZA 3TA6A 2PWUA 2VVNA 6ENLA 4GZEA 4L64A 4US5D 5EGRA 3F5LA 3VKBA 2PDFA 1BTCA 3CYVA 2A0NA 1I75A 3DFOA 2D3LA 1WUFA 5U7SA 4JFSA 4BEQA 5HMEA 3OQEA 2FKPA 3SQMA 3NTYA 1RHCA 3I7SA 1HKVA 4DUWA 1J0JA 2ACQA 2VEMA 3G5EA 4J3VA 4JTSA 2OJPA 1RK6A 3MA8A 1ZJBA 1BGAA 1EDTA 1F8MA 1K8ZA 2CNCA 2BMBA 1HXJA 2PSNA 3T07A 3AOFA 2ZRZA 5D2VA 2BHYA 5FF7A 2JF7A 4Q32A 5KETA 3C4UA 1DWFM 3EOLA 1SZFA 1SMAA 1TRIA 4REQB 3T44A 3RPMA 2V2HA 4CVWA 3CT7A 3W71A 1M41A 1L2QA 5EFDA 2ABAA 5CG0A 4PMDA 4GIYA 1SJBA 3QC3A 1KW1A 1A53A 4GUFA 1GVIA 4MOZA 3AMLA 3I3DA 2O92A 1JZ4A 1VQTA 3G18A 4LSBA 1NVMA 3WH7A 1H5YA 1NQ6A 4RW3A 5JVLA 4YHEA 1TQJA 3C0SA 3DN5A 1EFZA 4HMEA 1K9FA 2X1TA 1LZOA 1IE7C 5T9CE 2HS8A 1RZMA 1VJSA 2QCMA 3R79A 1YXCA 4GUJA 3SCVA 4IGHA 1TPH1 4ZB2A 2Z1VA 4LALA 1MUCA 3RR4A 4R33A 6REQA 1UPPA 4US6A 3GG8A 3SJNA 4LPCA 2DEPA 4XAFA 4O8RA 3TFCA 4WSHA 1IT8A 4QCEA 4LOCA 4S3FA 4WRHA 3QHNA 4GWEA 2ZX9A 2WBKA 1PO9A 3SEPA 1UZDA 3CWNA 3EWZA 3TFXA 5I06A 1VJZA 5GQBA 3WFLA 1XC4A 1ITUA 3PFRA 4Q6JA 3U2CA 4M6UA 1EC8A 3C2EA 3GFZA 3DBPA 5K9XA 1JL8A 3BPWA 3TYEA 1H1ZA 4UCGA 2E40A 5BWAA 1EBGA 2W92A 2QS8A 5KZ6A 1LQ0A 1KCLA 5C9WA 2GVJA 4PRWA 4XUYA 1DWJM 1Q6GA 2Q8XA 5DY2A 1B30A 1OFQA 3BW4A 3UXIA 4MTVA 4Z1YA 5C0QA 3PVFA 4GYKA 4V27A 3MDUA 3IIPA 3PPHA 4QSHA 1OFRA 3T8LA 1W56A 4TXEA 3COTA 4GYJA 1QOPA 1I0DA 4GBUA 3ZYZA 2V0TA 1UUOA 1HX0A 1J2BA 2HXUA 4ZB0A 2Z1XA 2V5DA 1VFFA 2PD5A 1IXOA 5HNNA 1LQAA 4BY3A 1A5KC 3AHVA 1QU4A 3C0LA 1V03A 4OECA 1P0BA 1QDSA 3AC0A 1CWYA 1YTDA 2QUTA 2ZQ0A 4KIRA 4AAJA 5H91A 3AJ7A 1PWMA 3OGVA 4FXSA 3I6EA 4HJFA 3TNBA 3WBYA 2Z25A 4IIDA 4GX9A 3AHTA 3M46A 1KQYA 1S2AA 4GIRA 4HU4A 3W75A 2VC9A 4HBKA 4JXCA 3RLGA 4QS6A 5K4XA 1E72M 2NWRA 2I5GA 5I7GA 4LW7A 4D1JA 3QY7A 2F6UA 5FESA 3ZWTA 3WYZA 3IAQA 3GS6A 1RK5A 4RW5A 3W1RA 3B8TA 3VC6A 5CBJA 5A6KA 5H8PA 2WCGA 4OWGA 2Z1KA 1E56A 1HL8A 1KM4A 4OUIA 4TUFA 3VGEA 3KCJA 4FR6A 3S1WA 4PMOA 4EXAA 1U5HA 3S2LA 5BCAA 3CPRA 3FJNA 3NSXA 4LGXA 1LLZA 3HQ1A 1ECEA 4M29A 1CDGA 1F7BA 4UTWC 3NDZA 4J7RA 1I1WA 1UCWA 1CENA 1QMLA 3KCLA 5J04A 1KGWA 4N9CA 2VRJA 4MKNA 3S47A 4HPGA 2W27A 3EZ4A 3NPUA 4PEEA 3N25A 2ZUTA 5HUOA 2C18A 1RD5A 4RV3A 4UTHA 1I45A 2AMXA 2I17A 4Z2GA 3NDOA 5GJNA 4XBKA 3MKCA 4Z0JA 5AC8A 3CUIA 3CAWA 3BCFA 3ELFA 3WELA 3HURA 3HG5A 3R11A 3RCNA 1QXLA 4BQ4A 4IIHA 1Q4WA 1K03A 2J88A 4U31A 2XH2A 3WL0A 5ABHA 3GKAA 2VEKA 1VPQA 4IG2A 1VYSX 1HKKA 2QJHA 2V5CA 1GKPA 3TP4A 2YDSA 4MB4A 5LKYA 3H2FA 3LHUA 4LS2A 3HU7A 5E6ZA 3CPUA 4OUEA 4QAWA 1E4IA 3YPIA 4K7YA 3GZAA 3DFSA 1S38A 1CLXA 2OODA 2IQTA 3TDFA 1B3XA 4QNWA 8A3HA 4JDBA 4RKAA 4F8XA 2A3HA 4WXZA 5CXPA 2XHYA 5DF0A 5FF2A 2V2DA 3NFUA 3I68A 1WZLA 1R2SA 3ARYA 1QO5A 2C13A 3VIIA 5C7HA 3LHZA 2Z1SA 3MB9A 5A1AA 3KLKA 2NUXA 3A24A 3ITTA 5HQMA 1SO4A 3NURA 3L4UA 5RUBA 2ZZ7A 3S46A 9CGTA 2YGYA 1HKMA 1J18A 4QQ3A 4NJGA 3EWDA 4D8AA 1TPFA 1OJXA 1DXIA 2BGSA 3QFWA 1LTDA 1G4SA 2Y89A 2OPJA 2ZCGA 3GTXA 2AQWA 3O05A 4E8CA 1XLLA 4I8DA 4GMEA 1H2JA 2C6QA 4Z1CA 1WOBA 3CHFA 3VMPA 2OG9A 2X40A 2BP1A 4O14A 4AIEA 3GXFA 2ZRYA 2ANUA 4FO4A 3PZIA 1W1YA 3QJAA 4IICA 4J35A 4QP0A 4DB7A 3PSVA 3PWIA 1US3A 3I7QA 1KXTA 4LF2A 4BFAA 1EZ2A 3E49A 3N6QA 3VCCA 3T6CA 4W4QA 1QPNA 1P1XA 2DUZA 1C9DA 1QFEA 3WF3A 5CZSA 3N18A 4GG9A 3VTRA 1UASA 4HZMA 3DFYA 3TK7A 3ARTA 3O3RA 2VQUA 4HPXA 1V3MA 2ZZ1A 4I7UA 3SY8A 3EX1A 4XG1A 1H7XA 3MSRA 1L9WA 3NQ6A 4ALDA 4ZL1A 3NQVA 3VD4A 3C0JA 1XLHA 1D3HA 3WD4A 2NLYA 4K8GA 2ISDA 4CCEA 4FPSA 4MNLA 5HATA 3P81A 4HYWA 5BWFA 5CZ0A 5AC5A 4O15A 1OX4A 3VOFA 5CJ5A 1C7TA 4WJXA 3VOJA 1AMYA 4GFIA 3WH9A 3DG3A 2Z29A 3G0UA 5EA9A 3ABXA 3VPLA 5BRPA 1JYWA 2FGZA 5H2ZA 3PBWA 4F0KA 3OZPA 3KBSA 1FUYA 2QDDA 1UBSA 3T81A 4AVOA 1EWEA 2KX9A 3QVQA 3XIMA 3VD3A 3WDRA 4O0ZA 1EEPA 1K4HA 2VOMA 2BG5A 4XKYB 1QPRA 4OE7A 2EG8A 2R9RA 4JFWA 4B3ZA 3FA3A 3DX5A 3NVDA 4GIAA 1R30A 3VGGA 1MFVA 1MZRA 3HGJA 2JEQA 3QLDA 4F3HA 4PL1A 3W2LA 1JCXA 4QE5A 4GI4A 1PAMA 4O0QA 4A8IA 3CIWA 4M81A 4KF1A 1QI2A 1PEZA 4DN1A 1ODZA 3ARSA 2NVCA 3CH0A 1DV7A 4C1LA 1CX9A 4A3HA 2ZRXA 9XIAA 3M41A 3HB9A 4D6IA 4PH6A 5C9RA 4LS1A 5JIWA 2EPKX 5I2UA 7XIMA 3GU2A 3WX7A 2D2JA 2GWNA 3LGGA 4JIRA 4N9EA 2XFRA 3MQTA 5KZMA 2J7HA 3THQA 5D04C 5CKSA 5FJUA 5HANA 1G4EA 3W1UA 2PTZA 3WJXA 3CASA 3UJSA 1G6CA 2WLYA 4IMDA 3T05A 1WCGA 3DUGA 1DJNA 2DW7A 4NHVA 4NYYA 3CUHA 3SCPA 1K02A 1U33A 4OQVA 1VEPA 3C2FA 4W93A 4POCA 4IMFA 4O1AA 5D4YA 3EMCA 4HGXA 4AMCA 1Q85A 1GJWA 3VIFA 2VCCA 2W6RA 2A3EA 5BROA 3PUDA 1YXDA 1NELA 4REQA 3P0XA 3LNMA 3AFBA 4XKYA 3G77A 3M5XA 2W62A 1QRQA 4HSOA 5AYBA 2Y2WA 3B9EA 2PWGA 4CEUC 3GH4A 4DIAA 2ASHA 3ZR6A 4HTYA 2X1IA 1TKKA 5CCZA 2C15A 2YCIX 4PUNA 1EO5A 3B0YA 1B5TA 4DWSD 4I9JA 1V7YA 4HK5A 1JULA 3GFYA 1EF2A 1NWUA 3ZZ1A 2FTYA 3CB8A 1D3CA 4B5SA 3UR2A 3MUY1 4HOWA 1Z89A 3SW6A 3WK2A 4RNFA 1P6BA 1E43A 1KM0A 5KSWA 3LSBA 2E0PA 5TF0A 5G5IA 3SIZA 1TUFA 3LXBA 3H70A 4FOJA 4Y6GA 2CKSA 3RPTA 1VPXA 2PDMA 4PBFA 2PDUA 2V63A 5REQB 1FOBA 2Y5JA 3FW6A 7TAAA 2G3MA 4MNKA 3LYEA 1L8PA 1UR2A 2Q02A 5GJPA 3DERA 3T55A 4ICNA 3PFMA 1X6NA 4IPIA 2ZA2A 1PDZA 3U5YA 3LB0A 3WH6A 1QATA 4LUTA 2I1OA 4Y9MA 1UPMB 1R3TA 4DYJA 3EWWA 3RMJA 2VZTA 1YXYA 3O16A 3H4XA 3W74A 1S5MA 1XIEA 3NXLA 3LV6A 4KRUA 1MRAA 2WC7A 1YKWA 5IBXA 2JF6A 2PD9A 2WHKA 1BRLB 4X0NA 1KBIA 4Z42C 4CKQA 4LB4A 1OGSA 3ES8A 4G1KA 1ME9A 5M17A 4UCFA 3MZNA 2WVVA 4X2RA 3S2NA 1M7OA 1DWIM 3H4GA 2X2GA 3G1AA 3GC5A 4AIUA 1EYEA 3CH9A 3RXZA 4KFNA 1KRMA 3E02A 1M65A 1MVYA 3QR0A 4TV6A 2VX7A 1AQ0A 3VK5A 3W81A 5D2WA 1CXFA 4GYPC 2QUUA 1VB9A 1ZS2A 3VZXA 2ZA1A 1FFRA 1S39A 3UVIA 3A3HA 4H8VA 4DLFA 1CXEA 3F4DA 5FF0A 3EWCA 5J5DA 4Q8QA 2XVKA 4QE1A 3MT1A 1YRRA 4WDTA 3AJXA 5HINA 4P2VA 4AZCA 1E4NA 3MUXA 1XBVA 2XDFA 3U2EA 5U4NA 2PZ0A 3W1TA 4TR9A 1ONRA 1M7JA 3SJ3A 3ITVA 3AICA 5F1VA 4ZFMA 4BF5A 1FKXA 2D20A 2EJ1A 2VXNA 2GDQA 1E9ZB 4RE0A 4L80A 5TIMA 2AL1A 4DEFA 2H8XA 1UA3A 3SSZA 3MWCA 1KM2A 4Q7IA 4MF4A 2HE5A 3HF3A 5A8OA 1R2TA 1DXFA 4XX6A 1C3FA 1JAEA 2VR5A 4NQ1A 4OBRA 3VUPA 1AH3A 1AZ2A 3A4AA 4IL2A 3I3EA 1UWAA 5TAOA 4N6EA 4HPHA 3ZM8A 2E28A 3W00A 3QW3A 2XIQA 8RUCA 5DMMA 5CPSA 3P74A 1F9CA 1J6OA 3K8LA 1YBQA 3TC3A 2DZWA 3V0TA 1SYTA 1W9PA 3E96A 4GQ0A 2FDMA 4HNVA 1V6TA 3DENA 2HRWA 4RE3A 1WPCA 1MFUA 4DYEA 5D03A 3CUZA 1JF5A 2GUUA 1ME8A 4FR1A 3WNPA 1ITCA 1VFUA 3TN3A 3TXZA 4XZBA 1OC6A 1PXGA 1AL7A 4H2HA 4ZXLA 3N1AA 2ZE0A 1XJBA 2QULA 5HMSA 1FCVA 2GJXA 2J7GA 4S3AA 4UTMA 2WSYA 1F3EA 3RF9A 4CU8A 4NILA 1U5JA 2Y0FA 2V69A 4KWOA 4PCNA 3EKLA 1JDCA 1LORA 3GTHA 3GAKA 3TYBA 2Y62A 5G4WA 1XDLA 5HK4A 5FL0A 3MP3A 1JXJA 1OHLA 5I6SA 3SR7A 3VXGA 3WQOA 2HQAA 3UCCA 3T4WA 4IM4A 1FH9A 4D72A 1S5NA 3W6YA 1OD8A 2SFPA 4EVZA 3TSDA 2QF8A 2OYKA 3VX1A 1GTHA 3WO8A 2NSXA 3ZJ6A 4AUBA 2XJ7A 3CV6A 4HYVA 5I77A 2DQXA 3AS1A 3B04A 3OZMA 1XYLA 1XCXA 1OD0A 1R5YA 2J74A 1SFLA 4ZO8A 1H4PA 4KCWA 1H5VA 4EXBA 2PS2A 1UWUA 1H49A 5I3DA 2WMKA 3UY7A 4RR4A 5C9ZA 3TTSA 1FH7A 3BLFA 2XZ9A 5EY5A 1R85A 1RCQA 2J9YA 5G1TA 4W8BA 3GR8A 4GCAA 4U4MA 1O5QA 2WMFA 1JYNA 3EMQA 1UR8A 5CLTA 4DUOA 4JHOA 1Y5XA 1FWGC 1EGZA 1WZKA 4ZXOA 4LAUA 2KAUC 1XICA 4ZVJA 4ECLA 1C8QA 5IHRA 3AXHA 1JZ8A 1MNSA 3LU2A 4JTDA 1KWKA 4RE4A 3RX2A 4U2YA 1KR1A 1GZ1A 4GNJA 5K2ZA 1QPQA 4ZBCA 3LQGA 1QCWA 3JUGA 1YYAA 1E55A 4JIHA 5A5WA 4MWAE 4B4FA 1Q6RA 4MNJA 1GQIA 3RJXA 4HPJA 4WOZA 2TSYA 4DQWA 1BGGA 4ICMA 3WLNA 1KA9F 1E1CA 3DESA 3GDTA 1OGGA 5E09A 5IBXC 4HA3A 1OZQA 2VOTA 2XIMA 3PANA 2XGZA 3EPMA 1PL9A 4GRSA 3QHOA 4WDWA 2HDJA 4FP1A 3SGGA 3UZYA 2A7NA 1ICQA 4M1RA 3SQSA 2HK0A 4N42A 1E9YB 2QIWA 2WNQA 4HHMA 2UY3A 4K2SA 3CT2A 1U30A 5GJMA 2IPWA 4NRRA 2WM1A 5JH1A 2YB4A 1O66A 4HOXA 3VNDA 4H41A 4A05A 4HMNA 4DZAA 5CAKA 3A12A 2QYGA 3POCA 3ITGA 5HAOA 2LLEA 4O1EA 4ADTA 3ZLGA 2VEIA 3A4WA 3HIJA 4AMAA 1EIXA 2OWCA 3AO0A 1KXVA 2PODA 2DSZA 3CAVA 3A13A 1W1TA 3BGGA 2FH8A 3WJSA 1VP5A 3ICJA 4DM1A 3L12A 4BI5A 5E1QA 3MMUA 4HNNA 1V4YA 1R7AA 4PFHA 3IGXA 2O4MA 3W85A 4GYFA 3GTIA 3CUJA 4P61A 2VGGA 3QY8A 3EDEA 1E4MM 2PDWA 4MJZA 1SZNA 1RAKA 2H90A 3VZYA 2YDQA 4HA0A 1BWLA 4JNZA 3DU0A 1Q2SA 4AZ5A 4WD0A 4G7EB 4URIA 4JKMA 2J7FA 3TLLA 3TYDA 2YCEA 2W4XA 3QH2A 4UQEA 1XIJA 3IJQA 1L6FA 3VABA 2HS6A 4LS0A 4KS0A 4B5WA 1MO0A 2OKTA 3DC8A 3NG3A 3GYCA 2VGIA 3GNPA 3W6MA 1Q7QA 3CGTA 3U6WA 3I6RA 1CI1A 1GEHA 3V16A 3OVRA 2IQDA 2FB2A 3CL8A 4WDXA 3K4WA 4FX8A 1TV3A 3BVJA 4J3WA 2QAFA 4MVAA 3CWOX 1O5XA 2PGEA 2DU2A 1R9ZA 1A5CA 3OVPA 4KCUA 3MYPA 1GOOA 4DZIA 1J0IA 5GNXA 4B5NA 3PULA 2GK1B 1NU5A 3FCPA 4AH7A 4DJEA 1G9HA 1HL2A 5ABTA 4KRZA 3KL5A 2WWDA 1TPC1 3LS9A 1JPKA 4ZMGA 2ZKMX 4DO4A 4AXNA 4DBDA 1FBAA 2DP3A 4TVCA 3CYJA 1JAKA 4I6VA 5LIWX 3Q37A 2PPGA 2JKEA 2O56A 1UR1A 2E8YA 4JTGA 4HHPA 1VIWA 4E4UA 1KFCA 1JDFA 4G5DA 1W3NA 3UYCA 3TYZA 1ZLPA 1THFD 3M9YA 1YBQB 4JYDA 4XZHA 4JBRA 3LX9A 4K37A 4IWWA 1LBLA 3M07A 1JD7A 1IXQA 5A2CA 1GOMA 1TTIA 4ROQA 1EJ7L 4I90A 4LXFA 5D9NA 5CBBA 1Q8JA 4Y90A 3EA1A 3NUKA 2FJKA 2QJIA 4Q8NA 5EMMA 1QTWA 3C61A 2E5DA 4HQVA 4GCXA 4XSLA 3ZT5A 5I78A 2POZA 1MW0A 1FHUA 4H8NA 5AC7A 3BWWA 2QCDA 4U28A 2ABBA 4MMWA 1RA0A 5BW6A 1N55A 1PPIA 4UTIA 3QQWA 3AQUA 3BV7A 3HMCA 4PUJA 2ZBTA 3RFAA 4A35A 6XIMA 3NQ8A 4A21A 1FXPA 3DAQA 1Q6LA 4NP7A 3VIJA 1QPKA 3RLVA 2YL6A 1JQXA 3KTXA 4X60A 1KRCC 4E4PA 4UR9A 5DCDA 1BSIA 1SJCA 3HG4A 1Q7MA 4YVPA 4XAYA 4HHHA 4E8DA 1QAPA 1BG4A 1DTUA 5DT5A 3B4YA 3B8IA 3PBYA 2WNNA 2ZX8A 1JZ6A 3C2OA 1R86A 3AU2A 1L2UA 1GJPA 1YEYA 2X30A 2IKHA 1MSSA 2RHGA 2R14A 1PZ0A 3P61A 2GJRA 2UV8G 5I3JA 1OBAA 2E8ZA 4RCXA 4IIEA 4ZE4A 1DJWA 2R24A 2XYLA 1SJDA 2QW5A 3LEPA 3PNUA 1DJQA 1E1FA 3CMFA 3UG3A 3TR2A 1TWDA 3CC1A 4KH2A 3B8DA 2VEPA 2AGKA 1KBBA 5A6TC 1GOXA 1PYMA 1Q4NX 1GVEA 3SN0A 2CLLA 1LOSA 2XVLA 1GGOA 1R3QA 3S6OA 1R3VA 2UZ9A 3WLOA 4B5XA 4PEKA 3B0XA 3VCRA 4QBXA 1NOWA 3M5ZA 5FEXA 1J01A 3FOKA 4CNPA 4KEMA 5DXYA 3WF2A 4HZ7A 1J9YA 2C8NA 4B5UA 3F2BA 1N82A 3DOPA 3NAVA 1BLIA 3N13A 3UP8A 3M47A 5D2TA 3WD0A 2CETA 3VGBA 5A6MA 2D0FA 3N2OA 3VDAA 3WMBA 1Z3NA 4GYPA 1BRLA 2JGQA 2P53A 4ZFCA 1YIXA 2V68A 3F2DA 4IQDA 4RLIA 3QYQA 3W2NA 4JQ1A 3BK0A 1AW2A 1XQKA 1FTXA 4GACA 3ZO9A 1P1MA 4INFA 3WLSA 3TH6A 2C1HA 1WZAA 2REQA 1FWNA 1EC9A 2JEPA 2VYOA 2WWCA 1NWTA 3VD7A 5A6LA 5CSRA 1KM6A 4R3UA 1RJPA 5DXXA 4P5UA 1OB0A 3N17A 3LPFA 1TWZA 2RDXA 3QV8A 1M7XA 2ZZ5A 2CWXA 1VBRA 3IVSA 4AD2A 3S5NA 2E77A 3SO7A 4S39A 3I65A 3T7VA 1T41A 1MYRA 4G7FA 1ZL1A 1FDJA 1P0NA 3ZQ9A 2OKOA 3LN3A 1TMHA 1HO4A 3E2QA 5HMFA 3LV5A 5FJTA 1E6NA 3P3BA 4IJCA 2EGZA 3GVQA 1QNSA 1PIFA 4B92A 1F3TA 1RA5A 1KXHA 4A3RA 2X09A 5EMKA 3L5MA 2F61A 2WC4A 3QSRA 3VKJA 4DY1A 2PDNA 2H9AA 3ZVHA 3UU0A 2YFOA 1DIDA 2VDIA 1A80A 3BG5A 5EU9A 1J11A 3KVMA 3O63A 1NSJA 5DRIA 4JCLA 4WKFA 1EBHA 4QLLA 3MV11 1RJQA 1TZZA 3PUEA 2EPLX 2GSHA 2ESCA 2O7SA 4JX5A 2A6NA 1KTCA 2OOFA 4NJHA 3GDBA 4PGLA 2BVWA 3BARA 2V38A 1F61A 3OPSA 1JPIA 2D23A 3ANUA 1W5NA 4ZO9A 1RLDA 1OINA 1J5SA 4NRSA 3HO8A 2GQ8A 4E2VA 5F2IA 1YW1A 3QOMA 1FWFC 3GXDA 4FX7A 3NQ2A 2DVUA 2CESA 3PP7A 4Z2JA 3WNLA 3W22A 3QHMA 3ES7A 1FWHC 3H7RA 4JQ4A 4QG9A 3SCNA 3USBA 2C14A 2WZIA 4GZIA 2INFA 3W26A 3WIJA 1OEPA 4B3LA 4Q8MA 2QCHA 3HPZA 4AY8A 4BF7A 4WUIA 4BR1A 1KBKA 2X8RA 1AL8A 3SM0A 2P0IA 5F4XA 1HJSA 3DHFA 5BRQA 3IVUA 1VFTA 3H2AA 1AQMA 1QI3A 2ZRWA 5CEWA 1UD2A 9RUBA 4R5EA 1GKRA 2DUAA 3THDA 2OSXA 1H7PA 3B4UA 1U83A 4FLRA 2CHRA 1PCKA 3K30A 3RR1A 4JN7A 2DZUA 2OT1A 3VZZA 5CZKA 4C91A 3LHYA 1TPUA 1GHRA 4Q8PA 3LPOA 4UFMA 1N2VA 2PTWA 1UJQA 3VOHA 1T5AA 1RH9A 5HWNA 4NNBA 4J2MA 2VFFA 3W82A 5FJOA 4BWLA 3B05A 3GDMA 4LC6A 2NV9A 1JF6A 4GABA 3A3WA 4LV4A 4XISA 4WXYA 3AUOA 3S1GA 2P0OA 1RQBA 1TPEA 3LRLA 3APYA 1QW9A 1HW6A 1X98A 1LWIA 1RPXA 2ZE3A 2RUSA 2A2IA 3QC0A 3C6CA 5JBEA 3D6NA 4M6PA 1ADDA 3R13A 1UOZA 4FNQA 2WJDA 4ERAA 5LA2A 2AKZA 2A3LA 3LCIA 4PTMA 3L0KA 1YDOA 2TMDA 4OV9A 1GQKA 3DG7A 3KRUA 4NZ1A 3O9NA 4P7OA 1OCJA 4MFDA 1CNVA 1SZEA 3N4EA 2ZUWA 3ZVIA 3V1PA 4Y96A 3SUSA 1TE6A 3S5YA 3KZPA 1CW2A 4I7WA 1UWIA 4LCRA 1OT1A 1BYDA 3RPDA 1Q6QA 1FWDC 5CC7A 1R3WA 1DXEA 4W86A 3FGCA 2D24A 3U2ZA 2BVDA 3P82A 1NDVA 3O2LA 4IX2A 5ECUA 3M0JA 3ZXWA 4Q8UA 4HZ8A 4QRNA 4PTWA 4V28A 4ENLA 3TN5A 2YZRA 2YA1A 1VFHA 5A8NA 2JBMA 2W66A 3T0BA 1XIBA 4PCTA 1PKLA 1N8FA 3AIUA 1V6UA 5AVNA 3MDWA 1H7OA 2RDTA 2Y6ZA 1VKFA 2W63A 3T42A 5D32A 5K9DA 3QPZA 1HQTA 1O5RA 1Q3NA 1EUNA 3VDBA 4HN8A 2QXWA 3MUAA 1AVAA 1TZ9A 1LG1A 4OOZA 3ARUA 1FCBA 4CNTA 1EOMA 4O52A 5FJRA 1LBFA 4NJKA 2ZYFA 1GVQA 1W1B1 1KRBC 3GBDA 2QNEA 4L4LA 4LAOA 2VR2A 3S5SA 4CNUA 3GY1A 1ONXA 4NL1A 2J6XA 5CPLA 1HJXA 2IMRA 2ZX7A 3W29A 1GW9A 1EP2A 4QXIA 3TWAA 2E25A 1G69A 1K8YA 4UB9A 2Z6IA 2BWGA 4B2DD 3CQKA 4G1NA 2CC0A 4MYXA 2XZ7A 1JIBA 5LXXA 2GK1A 2VO5A 4Y9OA 4LQ1A 3KAOA 2J7EA 3M16A 5DMYA 1BFNA 1OFEA 3SN4A 4EXQA 4V1YA 4F48A 3WLMA 2FVKA 3W76A 3W88A 2WHMA 5FIPA 4DJEC 4JYFA 4FXRA 4NG3A 1LG2A 2A85A 1WYIA 1REQB 3R25A 4A29A 1J10A 2W79A 1ZFJA 1EH9A 3FIGA 2EPMX 1PJ9A 1G7UA 2Q71A 4BKNA 2XM1A 1MQQA 2GVEA 3SBFA 1MEHA 1YPXA 4PRTA 3NQDA 3JZUA 5IRPA 1QNQA 1B1YA 3BMXA 4MY1A 1VFSA 1TQXA 1PIIA 2J9XA 4DRSA 1SGJA 2DT0A 3PN8A 3A47A 3DECA 4JIPA 1JFHA 3MKKA 1H09A 1QR7A 1H1NA 3BLOA 3AIRA 1S1PA 3QRHA 1XISA 2Q3OA 3GK0A 1H3GA 3BG9A 2VFIA 5F2MA 3V35A 3LCHA 3VC5A 2PCQA 1J96A 4KT2A 3RHGA 4A3QA 1S5WA 2G95A 5MKGA 3L5AA 3VKAA 3WLLA 3MW7A 3TJ4A 1SPQA 4DJDD 2NZLA 3IJ6A 3MMDA 2E67A 3PK7A 3PBVA 3WK1A 4BA0A 2YDRA 1WDQA 4L9ZA 3R0DA 4IT1A 1ZJIA 4FF5A 5F4WA 3ZMRA 3EB4A 3MUCA 3S83A 3L68A 3KTCA 2OLAA 5HNUA 5I23A 3U4AA 1ALDA 1AK5A 3KOXA 4NZJA 3STGA 2OEJA 3MANA 2D22A 1W3LA 3KVKA 2PWEA 2VFGA 4GOAA 1EJUC 4K6AA 3G3MA 4U10A 1E51A 1XCFA 1HG3A 2AL2B 4A8RA 2Y85A 3WQ8A 4NI3A 1F05A 3HZ3A 1RBAA 4IH3A 4HMCA 1H51A 3A64A 4PZVA 3TE9A 2GUYA 3AS2A 3PSWA 2BASA 2VELA 3WL1A 1XUUA 3UR5A 1GKQA 2VT0A 3SZ8A 4WSKA 3U8GA 3XINA 4F9JA 4O0KA 4P7QA 4LNYA 3S9YA 1NEYA 4GH1A 3VNYA 4XVDA 1XBXA 2V82A 3APGA 1FWSA 1MXSA 3QW4B 1IZJA 2C79A 2P50A 3C8FA 3LCWA 3SGZA 5HBFA 2ZC1A 3ID7A 2O4QA 2Y88A 3TC6A 2JKPA 4GQGA 2QPSA 2QCEA 3GUGA 3AIWA 5JXQA 5BRBA 3G6MA 4I9TA 1RSCA 4S23A 2DJXA 4AD3A 3ITXA 1TFVA 3TQ0A 1MQPA 2DVTA 3PS7A 1JRCA 3IGSA 3VD5A 4DJFA 1OX6A 4WJEA 1VAHA 1W9BM 1P5BA 5D38A 1SUXA 2V6AA 2PCEA 1H7NA 1V3IA 3N29A 2PEVA 4HNUA 2GGIA 1XYCA 5HJYA 3W1MA 4HIBA 3N34A 3P93A 5GNZA 2I57A 4LRTA 4F40A 3EYPA 5T26A 4DBEA 5CC3A 1GYNA 1GOKA 1UYQA 1L6WA 5ABGA 2E9MA 4OZOA 1LL6A 3STFA 5EMYA 1Q6FA 1UD3A 4G2DA 1NF7A 5DELA 1FWEC 3B06A 2MANA 1IWBA 2A79A 1XIIA 3LTPA 1UIOA 6CGTA 1WXJA 3EMZA 1OIMA 1B3VA 3WJYA 1DE6A 3N2CA 4DF2A 3ERPA 4O54A 1JDEA 1FRBA 4JTRA 4C6BA 4IX0A 4MLRA 1XH1A 1GQNA 4EAMA 7CGTA 1H63A 3B9AA 3D0CA 4L4OA 2PBGA 4AZBA 3MMTA 1FXQA 2VCBA 3GW0A 4XKMA 5HOSA 1JYVA 3L21A 3BLKA 5CG7A 3ZS4A 4KGJA 2OO6A 4RUBA 3AU6A 1PWLA 1E4LA 3UZZA 2IS7A 2P10A 1B2YA 2PWVA 4MUPA 1AJ2A 3WUFA 1OFBA 3HGRA 5T91A 1Z7AA 1LDCA 3GH7A 3CXOA 5CC6A 2UY5A 1TWWA 1XIMA 4JTIA 3S6TA 2HBXA 4JIEA 3N11A 3WLTA 2PURA 1L6SA 5D33A 4AD4A 3M0VA 4X0VA 4PA8A 4WF7A 2G41A 5JBFA 1IV8A 4BCEA 4C7FA 1OADA 3MS8A 2UBPC 2DIEA 2GJPA 1KLYA 2Y8VA 3PBMA 4DF1A 3IJDA 3LTSA 2PTXA 3ENLA 2IPFA 4CNNA 1NP2A 4M80A 5D2XA 3EPOA 2A1YA 4RXFA 2REQB 5FJJA 4C5ZA 1TVNA 3ARRA 1IEWA 3K1DA 3QLLA 4I5UA 1FCUA 4M6QA 4RV8A 3HPSA 1EGVA 3SY1A 4WIWA 2YCLB 1TJ1A 4LNCA 4TU1A 2WZEA 3GB6A 2VFDA 4TX9A 3VMOA 1FH8A 3NEVA 3OP2A 4YVXA 3BLDA 4GY1A 3WQEA 4UQCA 3TWBA 4CCZA 3D46A 1XLGA 5MF5A 2I56A 4DXXA 4K8HA 1GVOA 1SO6A 2AKMA 4O17A 2J9ZA 4IUOA 5CZTA 1LRQA 4W85A 2VENA 4UTTC 1KO0A 1A5AA 1S46A 5BOFA 1R7OA 5HA7A 2OGJA 4ZE5A 4AIBA 2ATSA 4NSBA 2GOKA 4AXKA 3V3WA 3R0UA 1JGIA 2V67A 3WY1A 1E6QM 5FAJA 3MP4A 4MZYA 1E40A 3WEZA 1QWGA 3F5KA 5I00A 1BSLA 1XH2A 3WQVA 1W0MA 1W9DM 2GWGA 1DEDA 3TCSA 2X7VA 2FQIA 4QEHA 1RUSA 4N0RA 1XLMA 1WKEA 3TOPA 2FDSA 2XIOA 2Y1HA 1YHTA 1UP0A 4RXGA 4DUXA 1OC7A 4BS0A 3R4IA 5CZJA 1A5OC 4GJJA 3TQPA 3MU7A 5CLWA 1CB2A 4NU7A 1R0MA 4J5NA 4QM1A 2PMQA 1A5BA 5AHIA 2B0MA 3C5QA 4IJBA 2D0HA 4NI8A 3P62A 3T0TA 3I7RA 3N14A 3L5LA 1UZ1A 5HNRA 2BXYA 3LLDA 1EA9C 5DBUA 4QDPA 4W87A 4IG2B 3FXYA 4U2ZA 4AF0B 4ADSA 4GUHA 2PDIA 4GIEA 1XRSA 1ZY9A 4IGSA 3EX6A 2ZRUA 4H19A 4CN6A 3BICA 4HD5A 4O57A 2PA6A 4H9YA 3OZYA 4Q4SA 2WSPA 3KL3A 2BY2A 1LQ2A 1VYPX 4CD5A 4UR8A 4NXKA 2XFFA 2PB1A 4M6VA 1R9XA 1S1RA 3BOXA 2BDQA 1KGXA 2BOEX 2DT2A 3EDJA 4M56A 3OW1A 3QTPA 3GAYA 4RZ6A 1JXKA 3NIYA 1K9EA 3WF1A 4ACZB 4FK9A 1LROA 3TQVA 2B7PA 3W9ZA 1H61A 1KV5A 3HPAA 1UP2A 3ABZA 5AYIA 1CIUA 4KPLA 1ZTVA 4H8UA 1J0HA 2VDHA 2PP3A 2D2HA 4OU1A 9XIMA 2ACRA 4BK9A 3UWYA 2OR2A 3V0SA 3EWUA 4UNIA 1K8XA 5G1MA 1MRQA 3IACA 3GNOA 1DHPA 3UFYA 1IHIA 3BAJA 1PCWA 1YDYA 4CD8A 4O4WA 2WV8A 2GQ9A 4GD0A 5HWMA 3UR7A 3CL6A 3TZNA 4K1GA 2I7GA 5LA0A 3WDHA 1TMQA 1KCKA 4HKPA 3W53A 1B3WA 2YSWA 1BWVA 4GJIA 1Q6EA 5LGZA 1VF8A 2VC7A 3PNZA 3R5EA 4YHGA 1A3XA 4I9AA 5AHFA 4NX5A 3NQFA 4A2RA 4HPNA 2ZDRA 3UR8A 2DIKA 3GIQA 4Z17A 5K4ZA 1EJXC 1GONA 4RZBA 3VOCA 3USZA 1KD0A 1X1NA 4GZJA 2X42A 1IYXA 3W2UA 2E6YA 4PUDA 4JL1A 3HJZA 4C6FA 4EPKA 4LY8A 3WLQA 1CB7B 3C52A 3S1VA 1FWAC 2DW6A 3S5ZA 3WQDA 2E68A 4X9SA 3GH5A 1PV8A 1WDPA 3EPNA 1JPDX 4GO9A 4H6EA 4I5XA 1KC7A 1K7FA 2HPMA 1GJUA 5LZLA 1IXNA 4JHZA 4K36A 3GZ3A 3TA9A 4LF1A 2PBOA 3WQPA 1V93A 3PAOA 4O1DA 3Q4DA 1N7KA 4FSAA 3CNYA 3BQ6A 4JR5A 2GVYA 2QQ6A 1ONEA 4A8LA 1JI2A 1Z41A 1BQGA 3V5FA 1ISVA 2CZFA 3NQEA 4RZ5A 2VC5A 1E6PA 3SRHA 5FF4A 3NQMA 2ZVRA 2BXVA 2HJPA 3AYSA 5TNVA 2F84A 1S2UA 4PBEA 3W87A 3FYOA 4DBUA 1BXCA 4B15A 4UTLA 3PTKA 1KNWA 2DGAA 4UTTA 1GW1A 3EKGA 2NUWA 1ZUAX 1WB0A 4DPQA 3TYUA 4J3UA 2BHZA 2HZGA 2WLZA 4FB7A 5HQLA 4GQBA 3PBGA 3LM3A 3RITA 1B4EA 4ZQRA 2BBFA 5AC6A 2DZXA 2D73A 1F4HA 3HGOA 3SCUA 2TPSA 3W7QA 2NX1A 4MIMA 1EEXA 1K3UA 4ES4A 4KCVA 1RR2A 1E1CB 1EX1A 1TRDA 1V6XA 4BQ2A 5H1WA 1P7TA 1E9IA 1HKIA 3UESA 3ZVHB 4F0HA 5D9OA 3PHAA 1A4MA 3GU1A 4LANA 3N3MA 1N8IA 1UB3A 2P5NA 4HMDA 3L23A 1G4TA 2DFAA 2E6AA 3VNIA 3ITYA 1V7AA 3WN6A 4H9VA 1IWAA 4S3JA 3KOYA 1B31A 2ISWA 3QMTA 4KEUA 2QUNA 1KM1A 3NXFA 4OJYA 3WLHA 2HVNA 3E1F1 3BC9A 3L67A 2ZUUA 4M0XA 4C7DA 2J7CA 1VBHA 1XYZA 2CZDA 3CL7A 4WSJA 4FAMA 1GYMA 3NDYA 1GPWA 4I6KA 2VZVA 4IMAA 1LUCA 1XC6A 3STPA 3LLXA 2WO5A 1A49A 3GIYA 5I79A 1RLCL 4MKSA 2C19A 1D9EA 2CLOA 3L4YA 1W1A1 3T09A 1MW3A 3V18A 4C90A 4ZQPA 4HT3A 4QSFA 5AECA 1F3WA 1EC7A 1OSEA 4LVBA 3EOEA 3VFLA 2Z0IA 1F4AA 2VR4A 3IIZA 2V5KA 4M24A 3WDJA 1NF0A 5DMLA 4NF7A 1IEQA 3T78A 4AD1A 1EO7A 2MNRA 4P7LA 4XD3A 3L2MA 3W7JA 3II1A 3UEQA 4UQDA 3DXIA 3OZOA 2A3BA 3PJTA 4AZGA 4W5UA 3RLHA 4DELA 2Y70A 2Z4GA 5CPQA 4ZQCA 1UKTA 3ITLA 2PDQA 4PYSA 3PZGA 3WFZA 2P8BA 5FL1A 1XGZA 2OZ3A 3NVTA 3N04A 4AHQA 3LBCA 1EL3A 3NGFA 1TJ2A 4C1NB 4CQAA 1SW7A 1V51A 2YFNA 2EG7A 3AWOA 1JUKA 1O1ZA 3NWRA 3BURA 5H8UA 3O7UA 4JEQA 3TW9A 4LYRA 1W5OA 3TW6A 2Z00A 1LUCB 4JTTA 4LH8A 4S3DA 2NVAA 2IQ0A 3UG5A 5LHFA 3N6JA 1VBUA 3H4WA 2WKJA 2P76A 3UPMA 2F9RA 4JGDA 4LUSB 1ADSA 1UD6A 4EE9A 3FLUA 3W7NA 4DUVA 1J5TA 1V02A 2PAJA 3B8WA 2DPEA 4FZIA 2C91A 1YPIA 1E0TA 1IIHA 7ODCA 3E9AA 3NQCA 4N6FA 4AFYA 3M4HA 3CAQA 4IP5A 4ADUA 1E0VA 2QCGA 1K7XA 1MMFA 3CLMA 5A6BA 4E3TA 4UOJA 3U7BA 3H2NA 4AF0A 3S9IA 4O53A 2DH2A 1W6TA 2DIJA 2PDGA 1NFGA 1BQCA 1LRNA 4NKCA 3OOQA 3CBWA 5DLCA 4JY9A 1KBJA 4XZWA 4AQLA 2F7FA 5FEWA 2PC8A 2XFWA 1OYAA 1ZENA 1RXOB 2CFFA 3O6AA 3WK3A 2YW3A 4Y9PA 3ZSTA 4IF2A 3KRBA 1QJWA 3BAKA 4LVAA 1ZALA 1PKNA 1HO1A 1BF2A 4ICCX 4H04A 5KZEA 2PDHA 2VFHA 2CITA 3W27A 3WCZA 4RDYA 1C29A 3QR1A 2GVGA 2E1WA 2BSLA 4QISA 3IS4A 5MHBA 1UKPA 3THAA 4PMZA 4X3ZA 1NJJA 1ZZMA 3W23A 3KOZA 1NTHA 3URBA 3BLEA 1M6JA 2ZXQA 1W32A 4NYUA 2PF8A 5A2AA 3TU9A 1VEMA 1BVZA 2R1KA 4O1BA 4D6FA 1XYFA 4DAIA 2O7QA 2NXGA 1ZAJA 3MC5A 4W7WA 3NM3A 8XIAA 3UWQA 5AYYA 1MQRA 2H3DA 4X61A 4Z08A 3LDVA 1WDWA 2WSKA 3C2VA 1E3ZA 1W31A 4G56A 2HROA 2A7RA 1F07A 2ZZ4A 2E5BA 4L65A 2WAGA 1CXLA 3S2CA 4H00A 4MWAA 1SR9A 1XLEA 1YNPA 1CGVA 1D3GA 2PF0A 3SUTA 4B4HA 1XIDA 3M64A 1YDNA 5FJPA 1GG1A 1M68A 1WKDA 1R3SA 1FHDA 3A5VA 3AMCA 3GIPA 4C5YA 1BEUA 2BHUA 2NQLA 2ZXDA 4X22A 3TAKA 2HWGA 3W7CA 3IARA 1EHNA 2DDXA 4J9JA 3SGUA 3UZ5A 2HSAA 3R12A 2VRQA 3WF4A 4XZNX 4K68A 3ANVA 2OVLA 1NDYA 1UH4A 2GZXA 4R85A 3AROA 4Q8WA 1S2CA 3F4VA 2J8FA 1V0NA 3AI0A 4FMVA 4ATWA 4RPPA 4QIUA 4JTHA 3I10A 2XGIA 3RGTA 3QGAC 1VIZA 1LLWA 2GGJA 5EFFA 3QXBA 4ZGYA 1J79A 4KWVA 3LTYA 3BTNA 1U1UA 1FWJC 4OTKA 1V3HA 4HK6A 4HN4A 2HBVA 1SZGA 2WPBA 3KWSA 1W8GA 1W9UA 3PM6A 1CXIA 4C6NA 2VZUA 1B3OA 3P80A 1TA3B 1BKHA 3E5BA 4JTJA 3EA3A 3N15A 2VURA 1DWGM 4ERGA 1JVNA 1R47A 4FI4A 1JEZA 1TVLA 3TCEA 4ZA0A 3AMGA 4G9PA 2XUCA 4I9MA 1FWBC 3SB0A 2DQWA 3HQNA 2X16A 4IUGA 1HJQA 4Z2IA 3QEZA 1C8XA 3TTOA 1KFWA 1MUWA 3VE9A 3K13A 1TJRA 3BW2A 1M1BA 3KXQA 1HP4A 2QCCA 5C70A 2TYSA 4O13A 1XFCA 4XZMX 3T0AA 2BVTA 4UTFA 4KEVA 3W7DA 2PE4A 3H2CA 1GPFA 2Q09A 3B3DA 4XZIA 1XLFA 3FYYA 5A3HA 2CHNA 4F2BA 3S5OA 5BU9A 2PU1A 1V3LA 4W88A 4LFYA 1NAL1 2ISFA 3SUUA 3ARPA 4C6KA 4IL0A 5AN7A 1WXYA 2OQLA 3KOWA 5D9PA 3H7VA 3N73A 3WD3A 5A8GA 4C1NA 4L61A 3M0ZA 3M0KA 3CO8A 4LT9A 4R7WA 1KFLA 2VWTA 2OXNA 2JQXA 1I4NA 1ICPA 2GPTA 3J7HA 4TMCA 4W8AA 1W54A 1R87A 1CXHA 3GHUA 2Q01A 3AUJA 3PZOA 3TUUA 1R38A 2QGHA 4GA8A 5AHLA 4JTAA 1GVYA 3AYTA 4GPNA 2C1IA 5CPNA 1DQUA 2GQAA 1BXNA 2ALRA 1Z6KA 2VQTA 3GHRA 3WKZA 2WMHA 3RX4A 3PPCA 2J78A 3ARQA 3VKCA 1LOLA 1QNVA 3E3HA 4PN2A 4GVIA 1BG9A 5FJIA 3MJMA 3PPFA 3KCOA 3PZ9A 5G2HA 3K2GA 2NQHA 1DJZA 2YOCA 3CZJA 1KGUA 2NQZA 5XINA 3VIHA 2FVLA 2VJXA 3IEBA 2NT1A 3R8RA 1DBTA 4JN6A 5EL1A 3EX4A 4PTXA 5LIKX 3LCXA 2OX4A 3HA1A 1U1JA 3GTNA 4J3ZA 1WDSA 1FKWA 5I24A 4FS9A 2BY3A 4PTNA 4V2XA 1PX4A 3M0XA 3OJGA 4LU0A 1DVJA 1EPXA 3EWBX 1KQZA 5DANA 2FPTA 2DZAA 3GR7A 2XSXA 1XW8A 2QPUA 2DJLA 4OKDA 1XLKA 1VR6A 3ALFA 3HG3A 5D30A 4GK8A 4JHMA 3OIXA 4JTEA 5C9XA 4PCSA 3NO3A 4NAFA 3K8MA 1MI3A 4EOUA 1Q6DA 1XLCA 2YR1A 3IAPA 2G37A 4MWAB 1DHKA 3N6HA 3OLDA 3MCNA 1G7VA 2VX6A 5FKYA 2ZIDA 1XRTA 1UZ4A 3W38A 4L9XA 3IRDA 4HCLA 3MI2A 2QVHA 2J27A 3VNJA 1W3KA 1XLAA 4L4MA 4IGNA 4FLOA 1VH7A 3NQ7A 3GUWA 3ORWA 1POJA 1DIOA 1PHWA 3LLFA 3EA2A 2YCLA 1NM9A 4CLMA 4H83A 2C3ZA 3NYDA 4Z2HA 1QPOA 2VD9A 3PY2A 5A95A 4F79A 5JQ9A 1FWIC 4O11A 3EDDA 2ZZ3A 4YIWA 1M7PA 3LI0A 5A6SA 1AW5A 2OWXA 3N19B 1PTAA 4GI6A 1DJYA 1O60A 5CH9A 2E6FA 4PB4A 4WLCA 1VHNA 1XHGA 1KKRA 1I9CB 1Y0EA 4YNGA 5ABFB 4UQ9A 4ZOAA 3UJFA 1MZHA 1I2OA 1RY0A 2ACUA 1J93A 1TPWA 3WUEA 3G2GA 4V33A 3KEHA 1LCOA 4MADA 3P67A 2YBUA 3ABOA 1UUQA 4PMUA 5AB3A 5BNKA 3AYRA 3FK4A 3UCDA 2IPJA 1UW9A 1XINA 2Q8ZA 4MKVA 2XWEA 2BFGA 1R9YA 3VVGA 3T0CA 5ABEA 1JZ3A 4A3YA 4LRSA 3EX3A 1NH6A 4NX0A 1A5SA 4JTLA 3W1QA 3VDCA 1UR0A 1KXQA 3E2SA 2WQPA 3KDOA 2CZ5A 3G6LA 2VHLA 2XN1A 4JX6A 5G2WA 1Q6OA 1Z8AA 2BY0A 2IKIA 4O10A 4JTQA 5EB8A 3NA8A 1J0YA 1GOWA 3ZR4A 3UXDA 3E2RA 1OWQA 4QLKA 3I3BA 2J75A 1JG9A 2VWSA 4QQUA 4FALA 3W4RA 4AIOA 3MHGA 3L4VA 2FPYA 2E9LA 4S3CA 3NPWA 3BSMA 3VOIA 6TAAA 5HQEA 3T0DA 4XO6A 2X1SA 2FFCA 4FX6M 1O1HA 2Y5EA 3CZEA 5KITA 3SN1A 3M7WA 2FYMA 3PTQA 1FFQA 6PTDA 4LAMA 2X2YA 1E0UA 1TJ0A 3DBNA 1UG6A 1EXPA 4DZHA 3N12A 1B90A 3R58A 4IP4A 2NXIA 2NUYA 1GK8A 5LYRA 3UJEA 1SU5A 1PZ1A 2BB0A 4JFUA 1MXDA 3AMKA 1GG0A 3NJ3A 5LSMA 3UJ2A 1SQ7A 4MZ8A 4HJWA 4C6QA 4MM1A 1ZNNA 3FDKA 3RILA 3BOFA 4ZOEA 4OVXA 1Z9AA 2Y63A 4US5A 5M5DA 3VKKA 1FCQA 3PB0A 4C1KA 1VLIA 2VM8A 5E5CA 2WQDA 4NZCA 1PX3A 3DZ1A 1P0DA 1XCWA 1KM5A 1CTNA 3DI1A 3UWUA 3CK5A 2CLMA 3TSBA 4C6LA 1O7AA 4I7VA 1UQYA 3DCPA 4OGZA 5MKGB 2PDPA 2Y7DA 2PLKA 4YTUA 3RCYA 3B8UA 1WP6A 2DORA 2J66A 4D1IA 1FDYA 1FDZA 4AZHA 3SQLA 3W7RA 2X0HA 2Z24A 4LUTB 3KRZA 4RZ4A 3BE7A 5EMLA 4PBGA 4Z2KA 4WX2A 1CCWB 3W86A 1ITQA 2QJGA 2XSBA 4E4FA 3NOYA 3C3UA 4W9TA 1BAGA 4IFKA 1NIUA 4I8YA 1KM3A 1EZWA 4C6CA 1UMLA 5LXEA 4Z1BA 2DSUA 3MSYA 3ARVA 3OHIA 4NJIA 1KKOA 1GTEA 3FSUA 3WLJA 1XI3A 3TJLA 5LNVA 1R46A 3R7MA 1UWSA 3GE7A 1H50A 4CQ8A 4ORIA 1BPLB 3KFTA 3RU8X 3G1YA 1OFOA 4ZOBA 4XIAA 3VUSA 3WK0A 1YQ2A 3Q58A 1D8CA 2NQJA 1V0KA 4MG4A 2INZA 2BX7A 1P7TB 2TAAA 1K9DA 3W24A 3GYEA 3PUOA 4NXSA 3WF0A 2J7BA 1TREA 4FNSA 2PI6A 4GZ7A 3LHWA 3BQ5A 1E15A 3OU8A 1JCNA 1DTNA 2QV4A 1CGYA 2JALA 1GVSA 3JVAA 4MWAC