3CH0A

Crystal structure of glycerophosphoryl diester phosphodiesterase (yp_677622.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
GMIQVPASFDIQGHRGCRGLLPENTIAAFTKALLLGVTTLEFDLVISKDNRVVVSHDTFFHHEITMMVDGEDVTEANEKNFNLYAMNYADIKEIDVGMKTHPRFKSQKKVPAVKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNIDHPNIALFCDLVVAEIKKAHITDRFTLQSFDVRALEYMHSQYPDIKLSYLVETKGTLKKQLEKLSFTPAVYSPDVTLVSKKDIDAAHKLGMRVIPWTVNTKEEIETLISLGVDGIITDYPDLFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycerophosphodiester phosphodiesterase
publication title Crystal structure of glycerophosphoryl diester phosphodiesterase (YP_677622.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
total genus 91
structure length 272
sequence length 272
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ch0A00
3I10A 5PTDA 4R7OA 3MZ2A 4I9MA 4S3GA 4Q6XA 3V16A 3RLHA 3NO3A 1T6MA 1QASA 3EA1A 3CH0A 3PTDA 4RW3A 4RV3A 2ZKMX 3H4XA 3KS6A 2OTDA 3EA2A 1DJIA 5T91A 2OR2A 4RW5A 4GNKB 1DJHA 2PTDA 2PLCA 3QVQA 2ISDA 1AODA 2OOGA 5T9BG 1ZCCA 2P76A 1XX1A 2PZ0A 4I9JA 3QR0A 4I8YA 3RLGA 3QR1A 4F2BA 1T8QA 1DJGA 2FJUB 3KS5A 4F2TA 1O1ZA 1PTDA 1YDYA 1V8EA 4F2UA 5T9CE 4QJ4B 3L12A 3V1HA 1QATA 1VD6A 3OHMB 3EA3A 7PTDA 4PTDA 3H4WA 4QJ5B 1GYMA 1DJXA 1DJWA 1DJZA 2F9RA 1DJYA 2O55A 1PTGA 4I9TA 4I90A 4QJ3B 6PTDA 3V18A 4OECA
chains in the Genus database with same CATH superfamily
2IW0A 3SGUA 3CTLA 2FIQA 2Y7DA 2PDGA 5D2WA 3CV7A 3QKZA 1TFVA 4XTDA 3B8VA 3M0KA 1UWTA 3PS7A 2PWHA 4GXMA 5CPOA 2RGMA 3TN6A 2RDTA 4AVNA 1QI2A 1MDLA 3VIGA 3SFKA 3TJIA 5BOEA 2XINA 2GVYA 4LWWA 3BQ5A 3R0UA 3AICA 5E0KA 4ZBCA 1X7IA 1K4GA 5CC5A 4PMJA 1E0WA 3SW6A 2OPJA 3W00A 3VNJA 4E6MA 3S9IA 3SUSA 1PHWA 5K9DA 4FX6M 1VYSX 2NXIA 5L9FA 3NL6A 3L9CA 3AIWA 1DJGA 3NEVA 1B30A 4D2JA 2Y70A 3EB4A 3V0SA 1XWYA 4G5DA 1XYZA 4Q4OA 1FHVA 4Z0JA 2B7NA 3LY0A 1XLIA 5AKQA 2DH2A 2OZTA 3ITCA 3URQA 4AZCA 2HISA 4B4FA 3O06A 3OG3A 3PUEA 2FZMA 1BFNA 1N8IA 3R8GA 4MB1A 5A2AA 2CLHA 3AROA 5AC5A 3TMLA 3BJSA 2ZUVA 5EBAA 1TZ9A 4JZ5A 4C7FA 3JU2A 3IJ9A 4WF7A 3PY2A 5F4XA 4CQAA 2GPTA 2DORA 4QGCA 2ZUUA 3Q45A 4B91A 2QCCA 4RK8A 5I06A 2J7BA 4WDTA 4INFA 1TIWA 2XFRA 3VKKA 1XICA 2WXDM 1QK2A 1UH2A 4LNCA 1UP3A 1QOPA 2G50A 1UMLA 2Y24A 2YL9A 3WMLA 1E6SM 4GQRA 3ZLFA 5IFPA 1RSCA 1VAHA 3AIUA 3GFZA 4XKMA 1F8MA 3JRKA 1Q6EA 3GFXA 3E12A 2H9AA 3BG3A 3GH7A 3SN0A 4UTWA 4RDVA 3EKGA 5IBXC 4C6LA 3TKFA 4WUIA 3P5YA 4BI6A 2Z1WA 4M6VA 4J9JA 3NJ3A 5AB3A 4AIBA 3IAQA 4HZMA 4QNWA 2VTFA 2YDQA 2PDYA 2VEIA 4W8LA 2NVCA 3GS6A 5IRPA 3NAVA 1XCXA 3DIPA 2EPNA 1EXPA 5BW6A 4B5UA 1V6YA 2J66A 2Z6JA 4PE8A 3RPDA 3PZNA 4C5YA 3EA3A 4OUEA 4HPJA 5C9XA 3D46A 1RVKA 2GVLA 3LCHA 2ZA3A 4QJ5B 2B7PA 1JR1A 3GG0A 3OQ8A 1GVYA 2MANA 3E9AA 5HPOA 3ARQA 4LJ3A 1HL8A 5GJMA 3STFA 1AQ0A 4O8RA 4C65A 4YU1A 2QUNA 5FJPA 2XVKA 1NFBA 4QQ3A 4Q4QA 4PTNA 4BQ2A 4UTHA 1PX4A 3OJGA 1D7KA 1A53A 1ZBKA 2PU0A 4K8HA 3CAWA 3E2VA 3PF3A 5U4NA 1Z9AA 3WDPP 4JCMA 4UOZA 4ACYA 4JKKA 3PTMA 5A8MA 3TYUA 4J35A 4EF9A 3S6OA 3DBNA 3QQ0A 3CL7A 1S2CA 4HNCA 3VDAA 3QQWA 2QNEA 3NR0A 4KEZA 3H26A 1WBJA 3ZJKA 1TKKA 2F84A 2GOUA 3ARXA 5DELA 5CPQA 3LMZA 4GVFA 5EGRA 3P74A 3CUGA 3TTYA 1TYGA 2AL2A 3NQ8A 1VEMA 1RALA 3EWWA 4PCTA 3NPWA 3L5MA 3PANA 1V7AA 3L12A 3G1SA 4I8DA 2PFHA 1KLYA 4TUFA 9CGTA 1F9CA 4NXKA 3M0HA 4GH1A 2JK2A 1XUZA 1DQXA 2Y8UA 1RP9A 3DG6A 4ZZ9A 5HBFA 1NOUA 1ZRQA 4TV6A 2XM2A 4E2OA 4LXFA 4WDXA 1P7TB 3CQKA 1W6TA 5C0QA 4ZO8A 4UCFA 2GVJA 6XIAA 2DZTA 2ALRA 3S5YA 1JUKA 1C91A 2JF7A 2X09A 2YL6A 1MEWA 4MDOA 3CZKA 1S1PA 3CC1A 4R9XA 2FLIA 4NJIA 1GQJA 4DO6A 3P0WA 4DYKA 2VEKA 4F0LA 3DFTA 2J62A 4JTEA 2CNCA 4S2CA 4KRUA 4LCRA 4RNJA 1VEOA 5CPLA 3LBOA 4CU7A 4HNVA 3C2FA 3UW6A 3SCPA 4GUIA 3CH9A 1K8XA 3AISA 3N04A 3N3MA 2PP1A 2X1UA 4FXFA 5J04A 3W73A 4ZXOA 1RR2A 4TO8A 5LA0A 3HV9A 1XV8A 5KZEA 3ANUA 4KEMA 7A3HA 2GQ3A 4O4WA 1MNZA 1QATA 4FEZA 4J3VA 1E0UA 1KCXA 5DCDA 3AIVA 5AZ0A 3VOGA 3RPMA 4RNIA 4GKTA 4LALA 1WDDA 4GIRA 4GI6A 4ICCX 5I5RA 1S2WA 1CGTA 3M0IA 3QV6A 5AC4A 3LTSA 3W23A 3U4FA 3AS2A 3S2LA 4WY0A 3MWAA 1VRDA 2ZFAA 1RA0A 4HTBA 3WLNA 1V6VA 1REQB 4IIDA 4OVXA 1AH3A 4QDWA 2WMJA 4QRNA 3RIKA 3ARSA 3GC2A 1LWIA 3W75A 1W8GA 4QITA 5FACA 4LX4A 2BXZA 3UETA 4AH7A 3M9YA 2LLEA 5LYRA 3NFUA 1I2NA 2QJGA 2XUCA 4EWND 5DT5A 1A5BA 1HKWA 1HGWA 4WIWA 3VABA 4HK7A 3NZPA 2VRJA 4IFOA 3VMOA 5I23A 3TQ0A 4QDMA 1P6BA 1T99A 3W1AA 2XZ9A 2Z26A 2G3JA 4L4PA 4UFIA 2ZX8A 4I7WA 2C0AA 4ZQCA 3MUAA 3D3AA 3WKZA 1CXIA 2XWDA 3QLDA 3PTQA 1WXJA 3IAPA 3DFNA 3WDHA 3UA3A 3T2PA 3WIJA 3GNOA 4N02A 5EMLA 1CLXA 3ATYA 1BVZA 5HNUA 2QJNA 3WEMA 4FNRA 4B2DD 5XIAA 4H6QA 1EJTC 4JKLA 3TZNA 1PZ2A 4MNMA 2DVXA 4JOMA 1J0ZA 2ATMA 1PYFA 4MNKA 4OU1A 4MFEA 2FPVA 1P0NA 1RZMA 1LBFA 3GH5A 4PB3A 2QZRA 1QPNA 3Q58A 3MMWA 3ABOA 4TV5A 1EJ7L 2ANUA 1D3HA 1A5UA 2YXOA 1E43A 2WSPA 1O5RA 4B16A 3GU9A 3CT7A 1VHNA 1R3RA 1WDRA 2FHCA 4XZWA 3CWNA 1XH0A 3WF0A 2DW6A 2JF6A 3GR7A 2FGLA 3UA4A 4BS0A 3TJLA 4J3WA 2IKJA 2ZTJA 1V3HA 3I7SA 4Z42C 1GORA 1DYSA 4WHBA 1OG6A 3ZR5A 2WSYA 2XTKA 1WE5A 4ZQMA 5BWAA 3BCDA 2P3ZA 5JQ9A 1JXJA 2J4GA 3P8JA 2PWVA 1QO5A 3CZ8A 3K2GA 3C2OA 5M1TA 2AGTA 3WQDA 2GGIA 3E5PA 3VKAA 5C70A 2NSXA 3M0LA 3TQKA 3CUFA 4KCUA 3QJAA 3WF1A 2O4QA 1JD9A 1W5QA 1B90A 3QEZA 2I5GA 4EX4A 2VEFA 1XPYA 3TNOA 1DIOA 3MSYA 3WFAA 1TR9A 3HPZA 2H3DA 5HUOA 1UR8A 2DZUA 2VZUA 1EC8A 1ISZA 3MSRA 3W70A 3LLXA 3VCCA 5AHIA 3ZJ8A 3LI1A 3CUXA 2XJ7A 4DO5A 4CQCA 3WH9A 1GK8A 2XDFA 1KTNA 4K38A 5HOSA 1O60A 3UR2A 2OYKA 4B9YA 3A4JA 5D2XA 1XGEA 2NT1A 3NPUA 5CJNA 1VBRA 3H2NA 4DJFC 1S46A 2ZX9A 4IGMA 4C5ZA 1BYAA 1HKJA 4UTTA 4X61A 2OOGA 5EFDA 2XSBA 4ZB2A 3CZGA 4NZ5A 5TAOA 3MDWA 4JIEA 1RH9A 2YLLA 2FVMA 3AWNA 3BW3A 1RCOB 3KBVA 3NUKA 1S2TA 4NAFA 2ZUSA 5I24A 4G1KA 1V8EA 3H7UA 2WJFA 3UWWA 2D20A 1BXCA 2VR2A 3H2EA 2YX0A 3GNDA 1CB7B 4LBSA 2QMKA 3VVGA 2QUTA 2WC7A 2I14A 3FKRA 2VR5A 1XQLA 2HS6A 3LZ3A 4H83A 4IPIA 4MPKA 2WJZA 2XG9A 4JTGA 3W1LA 3G3MA 4LVAA 4D6IA 4KIRA 4MYAA 4R7OA 9XIMA 5K3VA 3SY1A 2DJXA 3MUCA 3L66A 1QBBA 1EIBA 1NARA 3OZPA 1W3JA 2A85A 4YMZA 2HVOA 3MSDA 3ZWTA 2CFFA 4RV3A 2OVLA 3IIVA 4J2MA 1F5ZA 1E1FA 3BICA 1IXQA 2EO7A 2E77A 2BY0A 2FMOA 2OO0A 1K8YA 1HZYA 3NA8A 1E6PA 4PRWA 2WSKA 1ZCCA 3W4RA 1CI1A 1BTCA 1QVBA 1P0EA 2PDKA 2ZXDA 1U1JA 5JMUA 1C7TA 3CHEA 3LTYA 1XLMA 3NO1A 3R7MA 2WMGA 1NDVA 4ICNA 4S3BA 5JBFA 1O7AA 3A4WA 1EF2A 2VUYA 3VNLA 3HFYA 2TRSA 5IDZA 3S5ZA 3GZ3A 4ECLA 3U2OA 5D38A 1XHGA 4XZLX 3OYXA 5DEZA 5TBOA 1GONA 4U5KA 4D6GA 4O53A 3G3DA 1GVEA 3SGGA 1OCQA 4DB7A 2PWFA 1OFEA 2DUZA 1I2RA 4AX6A 1AD1A 4I9TA 4QBXA 1EHAA 1THFD 4GQBA 4QJ3B 3U57A 4WJ8A 4X2RA 1S2UA 2QCEA 5I3DA 4I5UA 4WX2A 3TYAA 1JCJA 2WMIB 4XBJA 1UWAA 4GZ7A 1LWHA 4ZSTA 4KPLA 4GYKA 3UYCA 3N6HA 3CQJA 2WKGA 1E70M 3NURA 3GW0A 1D3GA 2X40A 3VD5A 2I5IA 2ZCGA 4HMDA 1BTMA 4UFMA 2VD9A 2JKAA 2VD8A 1XBVA 2KZHA 4E0CA 4M29A 1V51A 4AISA 4A2RA 3OLIA 4GJ1A 1GPWA 3A12A 1GVQA 1EKOA 1KFEA 3I6RA 2XH2A 2V5BA 3Q94A 2GJXA 2PZ0A 4HCDA 3QQ1A 2OSXA 2XIBA 3PAOA 2YSWA 1B3WA 2DW7A 2AKMA 4CD7A 2J74A 1CTNA 3QTPA 3T40A 1NM9A 5CBJA 5CZTA 4DJEA 5EBUA 1A0DA 3G1VA 3WYZA 1RBOB 2TMDA 3LD5A 2QQ6A 3T0TA 3E3HA 3MV01 3SUWA 2Y4SA 5FAGA 4LNYA 4J2PA 1CGYA 4E8CA 2YGYA 3FEQA 5AHNA 2WZHA 4V2XA 4US5A 1E5NA 4F9DA 2QMJA 4LPCA 4AWSA 4LFYA 4QEEA 3M44A 1BEUA 4MFDA 3L4UA 3WLJA 1TA3B 4Y9OA 1V3LA 4LGXA 1C92A 2ZADA 4JBRA 3PBWA 4D8LA 2G3FA 1XSJA 2VVNA 1F76A 4M81A 4Q8NA 2A7NA 3OGVA 5DXXA 2GDQA 2DSZA 1M3UA 1SSDA 2XN1A 2VKZG 5CG0A 4AZ7A 2C13A 1RP8A 3PHAA 2DFAA 3T42A 3N2OA 1LLZA 2VFFA 1W1B1 1VBUA 3GVRA 2GUUA 2ZWYA 3KCOA 1E9ZB 1TB3A 3IRSA 2OR2A 1EGZA 4W7UA 2EPLX 3CO8A 3VMPA 4YJ5A 1MDRA 2VZTA 1JDEA 3OVRA 3NM3A 5EMMA 3EB3A 2FFCA 4RNFA 1GOQA 1IWBA 3G77A 3UZWA 4V1YA 1GQKA 4UQCA 4PC8A 1MNSA 3WY1A 1Q7QA 1ENUA 1PTDA 2CXEA 1GKQA 1R2SA 4G1NA 3REQA 4DZIA 1OADA 3KDNA 3LHZA 4M1BA 1WB0A 1S2AA 1IQ8A 1PDYA 1T8XA 3FJ6A 3ZFHA 1HKKA 1J10A 2DUXA 2WB5A 4CQ8A 1E4NA 3P0XA 3YPIA 2A79A 4Z2GA 4LANA 2FYMA 3WL0A 1E4LA 3EX6A 3LGGA 3M07A 4GBUA 3KLKA 3JZEA 4H7CA 4BEQA 4JICA 5HATA 1BHGA 3NNTA 4GACA 2QCGA 4KRZA 1SU5A 5KTLA 1VFSA 1QNOA 8TIMA 2PDFA 5D9NA 4XWUA 2E5CA 4AWUA 1EQCA 2OX1A 4BK9A 4IFKA 1JDFA 1UQYA 4KCVA 1I1WA 1LUCA 3U2CA 3ZVIA 2AQOA 3KL5A 3T8LA 5T91A 4JFUA 7TAAA 3M5YA 4FR6A 3BARA 3PC0A 5BXTA 3WX7A 4FZIA 4HPHA 3O6AA 1X97A 4ZQRA 3TN5A 4U3AA 2W63A 5C7HA 2YDSA 1OYBA 2C8NA 1VFLA 4F0KA 3C61A 5LNUA 1LOSA 4EPBC 4JIPA 3T08A 4UQEA 1EDGA 1VIZA 2GQ8A 1RQHA 3W7GA 4LVGA 3TP4A 5CBIA 4LYQA 3GUGA 3BAIA 3R0DA 5I3HA 4XO6A 2L5HA 4DWSA 2YBUA 1V02A 1ONXA 3N73A 3VM7A 1G01A 4W5ZA 5E6YA 3CWHA 1H4PA 2C1IA 4DO7A 2BS9A 1C8VA 3CGTA 3SCOA 2RDWA 3DC8A 3K8LA 4LUYA 3MMUA 3EGJA 1UKSA 3EOLA 4UNLA 1XC6A 1GOOA 2Y5EA 3DECA 3VAVA 3N14A 4DHGA 5DBTA 1C9DA 3SIMA 5C2XA 1Q5MA 2ZDRA 4K36A 1TPEA 3ELFA 5FJRA 1AW2A 2FZBA 2RUSA 1XINA 4XSLA 2HJPA 2A7RA 2FQIA 4P2VA 7CGTA 1E3ZA 1IXOA 2NV1A 4HPNA 5FF7A 2ACSA 3LMYA 3PWGA 3NDYA 4FHAA 3TR9A 3GTIA 3A47A 4PODA 4WEVX 3WFLA 3POCA 3G1RA 3IGSA 3VDCA 1EL3A 3IVUA 2ISVA 4HA4A 2PI6A 1JAEA 1KGUA 3OGSA 3W2KA 3CM4A 5T9BG 2J78A 2XVNA 4NZCA 4V28A 1OFRA 3NXLA 4FOUA 3T8QA 1WOBA 1SFLA 3SCVA 3AYVA 4J3XA 1GKPA 3W7CA 2MUCA 3F5KA 4C6JA 3UXIA 1DV7A 4MF4A 3WUGA 3FYPA 3SADA 3DHFA 3ZSSA 1VQTA 4MIMA 5G1MA 2QF7A 4L65A 1VS1A 3H55A 3M64A 3II1A 1YRRA 2EGZA 3SRKA 4LAKA 3UJFA 1FCQA 3FN9A 3ZR4A 1B2YA 4MZ1A 2NT0A 4ADTA 1DQWA 3H4GA 3VDHA 2OZ8A 3GHTA 1UASA 2Z0IA 4S3AA 5C7VA 4OJYA 4HSOA 2ZE0A 2IKIA 5EFFA 1QO2A 4ZFCA 3PTDA 2C1HA 5BYWA 1BD0A 3LS9A 2H3BA 1PXGA 2PDLA 2WPGA 5BXSA 4NJKA 4ES4A 1PIFA 3FDGA 3LRMA 1ME8A 2INEA 1UCWA 3JR2A 4H9VA 4YTUA 6REQA 3GVGA 5CLWA 3B9OA 1XLBA 1EJSC 4JYDA 5AOUA 2ZUWA 2OG9A 2XN2A 1HFBA 3CS2A 2CBIA 1RJPA 4M6QA 1R3QA 5ABTA 3UNDA 2TODA 4IIEA 1Z42A 4P7QA 4HMEA 3T0DA 4ERGA 5F2LA 4L61A 4JFSA 2GJNA 1HKIA 3VILA 3M6DA 1O5XA 3V1PA 1B3ZA 5GJNA 4XAPA 4RZ5A 4GPNA 2ZRYA 2ZZ7A 4NJJA 3DZ1A 1R3VA 3ATZA 2RGLA 5AFDA 5GNYA 3BMVA 4XK2A 2O9TA 1G7UA 3EDDA 1B54A 4LUSB 3EKZA 4W8BA 3EWZA 3G8RA 3TDFA 5FA5A 1K9FA 4GUGA 1E6XM 2XPKA 4Y9MA 2PZNA 5I09A 4DF1A 3LNMA 2E9BA 1GUVA 2Z1XA 4J28A 3CB3A 2WSQA 3OGRA 4RZ6A 3LBCA 2RJHA 3W7DA 1W8SA 1XLLA 4HT3A 1XXXA 1RVGA 3LLDA 4A3HA 4R5EA 3LCGA 5M17A 1BYDA 2PPGA 1OB0A 2Z1VA 2A21A 1DIEA 1P1XA 1V0LA 4K8GA 3DESA 4KEVA 5CZSA 4A3YA 4IZGA 5K2ZA 1B5TA 1GOWA 4U4MA 3LUTA 1L8NA 2J24A 3M0ZA 2EJ1A 4WVXA 3UZJA 3GTXA 3SR7A 1TE6A 1KBIA 3TMQA 2IKGA 1E15A 4L6HA 5BZAA 3GVQA 3VIPA 1EZ2A 3W83A 4KWVA 3UVAA 2V5KA 4X0NA 4IMDA 3B8UA 2FJUB 4UQ9A 3V4BA 8XIAA 2E4TA 3VI2A 3M5ZA 2E7FA 3W02A 4FALA 4DJDA 2WZEA 3V1HA 1JF5A 1K8ZA 4DUXA 4WLCA 5JH2A 4UMBA 1QNPA 4EXBA 4M3PA 4CQDA 1X1ZA 1SO3A 1S5TA 1DJXA 1EO5A 4FLOA 4HK6A 2GZXA 1K7XA 3HOJA 3AWOA 3O05A 4MG4A 3WDRA 4YLWA 3USBA 1N82A 4O0ZA 1DQUA 2P1FA 4DELA 3VKDA 3WJZA 2YA2A 4IF2A 5K9XA 4UTUA 1AW5A 4DYJA 1EA9C 5AYYA 4K37A 4W84A 2ZYFA 1UZ1A 2HSAA 3OLDA 4V15A 5A8PA 3C6CA 4P8UA 1WX0A 2GGJA 1OK6A 4H00A 1WKDA 4PSRA 3NQBA 4NX0A 4C1NB 4D8AA 4NAEA 3GY1A 1FKWA 3A3WA 1JULA 1ADSA 3NXFA 4LT9A 5HWMA 5I78A 1H41A 3HG3A 3RJYA 2CBVA 3WD4A 4H2CA 1IR2A 4E4PA 3C2YA 3HQPA 4AZIA 5FF3A 3CUIA 3WQPA 3TSMA 4NF7A 3GIPA 1UQZA 1GPFA 1K6AA 1MW0A 4MJZA 2RH9A 5E09A 3UWEA 5BWFA 3FGCA 1FWTA 1HKMA 3A6OA 4MPQA 1I8JA 3V0TA 5M03A 4O0QA 3ZXWA 2GLKA 1XKJA 1KO0A 1FCUA 4QXIA 2D0GA 1J6OA 5XIMA 3WLPA 3ZT5A 1NQKA 1XS2A 2Y5SA 3M46A 4GKLA 1NVMA 4M8UA 2VFDA 2FHFA 3GVVA 4JL2A 5CH9A 4GBDA 1TTJA 3WK3A 2ZUNA 2QS8A 3SRHA 4WKAA 2VOTA 3PZMA 1XIGA 1X38A 3ARYA 3HGSA 1VJZA 1JIBA 4AAJA 2D2OA 1PZ0A 3OVGA 4AB4A 4P8VA 2YYUA 3BOXA 1OX5A 2ZOXA 1UD2A 3PBUA 2PGFA 2X1RA 2WNZA 1JQVA 2OXNA 2Z7KA 1G67A 4AZ6A 5BRPA 2OMAA 1E4MM 1VFOA 1H7NA 1Y5VA 1FFRA 4XZHA 4F48A 3W37A 1PL9A 1J0IA 3THUA 1QUMA 4GABA 3NYDA 1EGVA 1VFUA 3R4IA 2Y62A 4KT2A 1BWKA 2DSKA 3TN4A 1TPVA 1R30A 2XH0A 3EEGA 2ABBA 1FWSA 2XM1A 4A21A 5CZJA 4ASTA 4A2SA 3QHNA 1RQBA 5EU9A 4C6IA 1EWDA 2GVEA 2CLPA 5CGQA 1W3NA 5CJMA 3S46A 4E38A 3PP7A 1FY6A 1CNVA 3AHZA 3VD3A 1Q66A 3UJSA 2CU0A 5I3JA 2WKJA 3VX0A 2NVDA 3ARWA 3HBLA 2WJEA 2CIPA 2GJPA 2J13A 4LYRA 1HO1A 2QPUA 4O19A 4AVFA 4Z0SA 3IIOA 4H6EA 1VCFA 4Z1DA 4C6QA 4MAVA 1H49A 3C8NA 4KEUA 4O52A 3NG3A 1E56A 1IWAA 4PGLA 4A8RA 1G0CA 2A3AA 4PUJA 2C7FA 1TJPA 1ISYA 4L6DA 1W3TA 1IF2A 2YXGA 2H9AB 3W1QA 5EMYA 1J8VA 4N9EA 2V6AA 1G9HA 3LGEA 1Z7AA 3SGZA 3N34A 3A9IA 1TRDA 3TEVA 5HNRA 3QC0A 4IT1A 4J4KA 1KGWA 3TIMA 4MJ4A 5BU9A 3RK8A 2VFGA 3QSRA 1F74A 4HN8A 1FHUA 1YX1A 3VZXA 1BRLA 2YCIX 3M0JA 3D3FA 3NL3A 4KFPA 2WMKA 3W2NA 4YCOA 2X7VA 3KTSA 2PLJA 4JNMA 3S9ZA 2X1SA 4ILSA 2DSVA 3T2OA 2GQ9A 2XVLA 1JQXA 4HZ8A 1O5QA 1KM5A 2J8GA 3BGGA 1BWLA 1XKYA 5E9XA 3WNPA 2A2IA 5H1WA 1AQMA 1TWWA 3CLMA 1VLWA 3DFQA 1SMAA 1DJWA 1CB2A 3E0IA 5H6HA 1DP0A 1CWYA 5LIWX 1EBHA 3BW2A 4HTYA 2WNWA 3L4VA 2YW3A 1K7EA 1BXBA 1ME7A 4NILA 4IFRA 3BLEA 3I3BA 4P7LA 1CLKA 4O50A 1UA3A 1LRQA 3N4EA 4YPJA 5EB8A 3GDLA 1I0DA 1WXYA 3QYSA 3N2BA 2J8TA 3MVIA 4QIUA 3D5HA 4OFCA 4CCZA 3RN6A 4AZHA 2DZAA 4Q8WA 4AXNA 2CLFA 2G37A 1U83A 3UXKA 4TX6A 4Y90A 3SJ3A 3L4WA 1GJWA 1OFQA 1MUMA 4W4QA 4FB7A 2VX6A 1B31A 1VCVA 1CX9A 2AL2B 1HG3A 1R3YA 1UJQA 5HPCA 4MOZA 2BVYA 3LTPA 3C2EA 4BWLA 2EXOA 4WGXA 4GYPC 2F7FA 1NELA 2PDIA 4GRSA 1XM3A 3GB6A 4CNPA 2I17A 1JUEA 2V38A 4UFKA 5DT7A 2D22A 1KNWA 2QLYA 3GYEA 3VIHA 3CV2A 3KCJA 2O0TA 3ZOAA 3BSMA 1OIFA 4HNNA 3T05A 3TFXA 5C9UA 1W54A 1FH9A 2OKTA 5AN7A 3PNZA 1P43A 4XUYA 1ITUA 5G4HC 1TPUA 3VOCA 1KM6A 2BFGA 1N8FA 3WL1A 2GQAA 1ESWA 5HQLA 3O0KA 3NGFA 2ISFA 5LNRA 3NQ2A 3OLEA 4H9ZA 1VH7A 2Z28A 5J5RA 5A8QA 1QI4A 2FZ8A 4O13A 1OIMA 2HMCA 1KFBA 1U5HA 1QT1A 1LWJA 2WANA 3TZFA 1EH9A 1QW8A 3PVFA 3T44A 3L4XA 1LTDA 1QPKA 2EAWA 1BPLB 4D72A 5HMFA 5HXMA 3KVMA 4DBSA 4Z1BA 3MJMA 1N2VA 3EXTA 4OV9A 2Y6ZA 3CEUA 1BYBA 1IXNA 4QLJA 4GO8A 4C1LA 3ZVHA 3N17A 4O54A 2HK0A 3M5VA 1PX8A 1KRCC 4G8TA 1OGGA 4MDPA 3SO7A 3N4FA 4QSHA 3SAZA 4TX9A 3W1TA 3Q65A 3E96A 4GINA 1EIXA 4A05A 2CHRA 3QZAA 3CHVA 1F4AA 3BOLA 1XBZA 1VD6A 2D1ZA 3USZA 1KLZA 3SCNA 3BCFA 1NIUA 4YHEA 2WLYA 4GX9A 3C3UA 1V0MA 4GGHA 4WY0B 4ZXLA 1H2JA 3GTHA 4XQ6A 3MS8A 3WQCA 2I9EA 3DUGA 4WOQA 2AQVA 2HNHA 5HR6A 3S6DA 3ES7A 5D2TA 4YCPA 3IARA 4GIAA 4HYRA 3WMBA 2DU2A 3FA4A 2C6QA 4LAUA 5K4ZA 1LT7A 3WJXA 2G3IA 3IUHA 3W26A 4Q4MA 4H6RA 3HU7A 4HD5A 3MO7A 2OWXA 3WDQA 3PFMA 3CQ0A 1JCYA 4AIOA 1W91A 2VHLA 3CXOA 3GG8A 5FJJA 1MZRA 3W9ZA 1TPC1 1Y65A 1GKRA 3F4VA 5BRBA 4PL2A 4GXPA 1H11A 2OKOA 4GO9A 4Q8OA 1FCVA 3GDBA 4H9TA 4AC1X 1MXSA 4I5XA 4L9YA 2VZOA 3QGAC 1GEHA 3ARZA 5I02A 3HQNA 5T8GA 2Z2AA 1H3GA 3KBNA 4GG9A 1YXDA 4UFJA 3KS5A 4IQLA 2ZX5A 1YTDA 2A3LA 2ONEA 2Q6ZA 3GR4A 2QXWA 1J5TA 1S5MA 4K7VA 3K30A 4YYCA 4ACZA 1LG1A 4LUTA 2HBXA 1L6WA 3TA6A 1O94A 3N25A 4CKQA 3DENA 2ACUA 4MJMA 4D8ZA 3OHIA 1GYMA 3MHUA 5D2VA 3CUJA 1J4EA 2A6LA 1S2VA 1B9ZA 3U9IA 3NIYA 1H63A 3TSBA 3W29A 3TC7A 2BZNA 1HXJA 4AF0A 1LOLA 2HV5A 1Z69A 4GVIA 4OUIA 1W3KA 4Y8FA 3VOJA 3WEOA 4F0RA 1JGMA 2EF9A 4PL1A 2WM1A 3WG6A 1ZSXA 2W67A 2DZSA 4UQBA 3A4AA 3RF9A 1E0XA 1OM0A 4OOZA 1IIGA 3ME3A 1F2JA 4BA0A 3UWQA 3VNMA 3QV9A 4JX6A 4PMYA 4AEOA 4O1CA 2J25A 5CXPA 1SM9A 1C8YA 2YBVA 2XZ7A 2HS8A 3P84A 3PAJA 4WOZA 3WQFA 4ADUA 2E09A 3R89A 3CUHA 1Y5XA 1E71M 3JW7A 3TYDA 2NX1A 3QHMA 4NL1A 1OFDA 4UOQA 1ML1A 2ZTKA 3HGOA 3VZYA 1GWJA 3GVWA 1LDCA 3MA8A 1H0IA 2ZX7A 5IBXA 1ISVA 4F2TA 1RA5A 4UR8A 5BXRA 2NQ5A 3MUZ1 1HJQA 1PCWA 3DI0A 2I1OA 4PCSA 4GC3A 1H1YA 4GVHA 1PO9A 3ID7A 4FOKA 3LG3A 4HB7A 1Y0EA 1FBAA 3WQ6A 1XH1A 1LCOA 1YDVA 2VZSA 1W9BM 1EFZA 3T7VA 1YQ2A 2PDHA 3VDBA 4ZO7A 1FWCC 3H2MA 1TPDA 3PSVA 1FP9A 3WH8A 2BY2A 4JAWA 1MFVA 1TQXA 5G2IA 1R86A 3ABZA 3KP1A 3DFSA 1KM1A 2ZUTA 4XKYA 1RJRA 3WQOA 1QHPA 4LB4A 1KWGA 1SPQA 1PZ3A 3N9RA 4PMUA 4RLIA 1F3TA 3ISIX 4K1GA 1OCJA 4K7YA 3L65A 5G5IA 2W27A 4O18A 5FSEC 3UZ5A 4JTKA 2REQB 4AZGA 4M7TA 1IEXA 3HQOA 3SM0A 3EXSA 2HE5A 1ICSA 1T8QA 2CHOA 1UZHA 3RO8A 4AD2A 3MI6A 3W2JA 4R7JA 4K8EA 4XVEA 1H0GA 3W7QA 2ZZ5A 1QXLA 4ZQOA 4EAMA 1IXPA 2OWWA 3EAUA 3WJWA 4QAWA 1UD3A 5BRQA 2B7OA 1YDNA 2PU1A 3C52A 2POZA 4WD0A 1JXKA 2J9YA 1NY1A 4FNUA 3W74A 5HULA 4DUOA 4EANA 3PBMA 2VXNA 3SIZA 4MUPA 2YBTA 1N8WA 4KERA 4O17A 4C6NA 3N2CA 2WJDA 5A1AA 3LCLA 4NI3A 4KFOA 3EA1A 3P3BA 5D4YA 2P3EA 3UJEA 3AUOA 4KFNA 3WDIA 3H8AA 4I5RA 3W7KA 1WPCA 4GI8A 2E5DA 2HPMA 3SN4A 3WBEA 1OC7A 3V3WA 3CEPA 3JZUA 1PAMA 5CG7A 3AALA 4L4MA 1RJQA 2IXUA 2O92A 3AU6A 3ZQ9A 5JH1A 3W85A 2DIJA 3WBAA 2ZRZA 4C7DA 1FWNA 5AHLA 1HJUA 5K7JA 1ITCA 2YDRA 3C0LA 2PLMA 2QDHA 5M5DA 1ICQA 1UMYA 1MO0A 3KBJA 2QCNA 2A4AA 3A4XA 2P0IA 3U5YA 4PBEA 4JFTA 4KMQA 4PUWA 3UG4A 4BF7A 4ZGYA 4DLFA 5FJUA 1UPMB 4XIMA 4MWAD 1YKWA 2UV8G 3E5BA 3W7MA 4QM1A 1UOZA 2Q8LA 1BVNP 3V5CA 1UJPA 5AHEA 2CKSA 3CIWA 3IEBA 4Q6JA 4D1IA 1KXQA 5U7SA 1Q6DA 1XLDA 4CEXC 4UOJA 4O1EA 2E0PA 3EWBX 1US3A 1Q6FA 1QNRA 3W1XA 3F03K 3T1GA 4CGTA 2DIKA 3GXPA 3W84A 1CXEA 4Q22A 5HK4A 4BQ4A 5DF0A 4AU0A 1SJBA 2UY5A 4LB3A 4J7RA 2VI0A 1YPFA 3FSUA 3LA4A 4LSBA 2XSAA 4IICA 4GNVA 3DFPA 3K4DA 3PZIA 1TZZA 3ABXA 1C7SA 2GJXB 3FJNA 1RBAA 1A3HA 2R82A 5C9WA 3WENA 3IK4A 5EPDA 1TPH1 1EQPA 3S2CA 1GOKA 5HANA 2PTYA 4FX8A 3CU2A 1B57A 1W5OA 1ODZA 4J3SA 3EKLA 3LX9A 3U8GA 4BQ3A 1T5AA 2EPKX 2Z29A 2YOCA 3PJUA 1YNYA 1XDJA 1JEZA 3BMWA 1EB3A 3AHTA 2VX5A 3HG2A 3TYBA 1ZZMA 2QGYA 1DXIA 1PV8A 4NG3A 3E49A 4Z17A 2PCEA 5BNKA 2BASA 4BZYA 3B8TA 3IVSA 5F2IA 4XX6A 4MNLA 4IISA 2X1IA 4N6EA 3R8HA 5LHFA 4FLSA 3LERA 2X30A 2WMFA 2W66A 2PTXA 1TUXA 2O7SA 2P5NA 2ZBTA 3MBDA 1U33A 2X0YA 2AGKA 2JIEA 2C18A 4MTVA 3QPYA 3BXWA 3GD6A 5ABFB 5A8OA 4L1GA 5J8LA 2FH6A 1RXOB 1RLDA 2QR6A 2ISDA 5TF0A 1XRTA 3VPLA 4P61A 4PUUA 3WLHA 4RPPA 3CT2A 4B5VA 4CU6A 4J3UA 3FA3A 1SR0A 1TV4A 3NQVA 1QI3A 3LK6A 5AYXA 4UFLA 1A5SA 5RUBA 1XYCA 2BODX 4O12A 3B40A 2ZRUA 2VEGA 4EWJA 3BTNA 1BGGA 2PRLA 1Q7MA 1SZNA 4A3QA 4F3HA 1HP5A 3OEXA 3WK0A 4UTMA 2A3CA 3VGHA 3T55A 3L4TA 1NOWA 4U10A 5ABHA 1UG6A 5LKYA 3T0BA 1QHOA 2QHAA 3DDMA 4IGHA 4P8XA 5J5DA 3EPNA 1DJZA 3HB9A 1YEYA 4QJ1A 1DJYA 1NJJA 4XO7A 1VRXA 1XYMA 3AXHA 3POHA 3PPFA 2VC7A 4Q4RA 3BV7A 3URBA 1XG4A 1OSEA 2G97A 4IGNA 3BJFA 4MLJA 1FKXA 5JU6A 2YA0A 1UB3A 2ZIDA 3THAA 3UJ2A 1TO3A 1KM4A 5AHFA 1LUCB 1ZBCA 3HPAA 7ODCA 1IGWA 2JE8A 1TV5A 5F7UA 4DPQA 2Y1HA 3N9KA 1P7TA 4KWUA 2YA1A 4IMEA 3NOYA 4C90A 3ALGA 2OFJA 4E3VA 1HIZA 2OQHA 3BURA 5LNVA 2OO6A 4PUKA 2VDGA 4REQA 2NLYA 3FJLA 4D6JA 4IP7A 5GQBA 1PJ9A 3NZQA 5EMKA 5LXXA 1SO6A 4PUDA 4QS6A 3A5FA 3CHDA 4WK9A 1FDZA 1FWHC 1W9DM 1JRBA 2BWGA 2QKFA 1UUMA 3LEPA 1OINA 4DJFA 3ARVA 1F3WA 3R94A 4IP5A 4KH2A 2CERA 3L67A 1H51A 3EOSA 1TX0A 1KTBA 4H7ZA 3TQVA 1V0KA 2QF8A 4DWSB 4A8NA 3NDOA 2PD9A 3ITVA 3TN3A 5A6BD 3IJLA 2YFNA 1QW7A 1DEDA 3S4TA 2H8XA 4NNBA 2H6RA 4O1FA 4DI8A 2NV2A 1OGBA 3L7RA 1A0CA 1PTAA 3CMJA 2IPJA 4HHHA 4JIIX 4FF7A 5IHRA 2OB3A 4Y6GA 2FGBA 5DXYA 2J7HA 2QV4A 1Q6LA 8A3HA 4OECA 1VFTA 2WNNA 4N9BA 1EP2A 5KITA 4DZHA 3SCWA 4NP7A 2IXVA 2V3GA 1RCQA 2PRHA 4UR7A 4HZ7A 3UCDA 4OBRA 3VOFA 3OBEA 3HG5A 3NO3A 3W2MA 4O57A 4DI9A 3CB8A 4MKSA 3ORWA 1M7XA 3BZJA 2F6UA 1NWUA 3NQ7A 4K68A 4AWTA 4AWEA 3HV8A 3BCJA 3TOPA 2FTWA 5AECA 1KR0A 4I9AA 1CGWA 1NF7A 2FDMA 3F4DA 5CAHA 3BLPX 4PMDA 3UWZA 1HJSA 2CWXA 4WQ6A 1DPMA 3RPTA 4LRSA 1ONRA 2RDXA 5KZMA 2X2GA 4JS3A 4MKVA 2VDIA 2FVLA 3OVPA 1V02E 2TSYA 3GU2A 1AL8A 3QV7A 1AZ1A 4ALDA 3H6OA 3RR1A 3M0XA 4URIA 3UPBA 3ZLHA 4EPDC 1Q13A 4LU0A 1A47A 5CLTA 3PZTA 4LVBA 3GQYA 3NYZA 2VQTA 3C0SA 1JI1A 3S83A 2GSJA 3FAXA 3W7EA 4F0MA 1HL2A 3S2NA 4GY7A 2ZVIA 4NRSA 1ZAJA 1E0VA 1QCWA 2YIHA 3RMEA 1SR9A 2QT3A 1IHIA 2W0UA 1A80A 1JPHA 1XLEA 3TCSA 1YLVA 3A24A 3G0UA 3B4YA 4HYVA 4QEHA 1W3LA 1IT8A 3CBWA 3GHRA 4G56A 4U3CA 3W2LA 4FS9A 2H90A 2P0OA 1O5KA 1GG0A 3UF9A 2BDQA 3FW6A 6REQB 2BBFA 2VO5A 4P8WA 4A3UA 2D73A 5H8MA 4FX7A 3WNKA 1E9LA 3FHAA 3QV8A 4IHCA 3KBSA 4NNCA 2ZC8A 2B81A 5A2BA 3MTWA 3Q4DA 1Q2SA 4RV8A 3GX9A 1X6LA 3TW6A 4GUJA 3PUDA 3W7PA 4QS5A 3MHFA 2DQWA 3URAA 4TMBA 1ZAIA 5FEZA 3VO0A 4MKNA 2Z1SA 4UTIA 2E6FA 3VUSA 3GXIA 2VGBA 1RY0A 1FCBA 4K39A 1JGIA 3VGEA 3HTWA 1VJIA 3MVTA 2ZZ1A 3SY8A 1FTXA 2VVSA 3W24A 3WEZA 3O9NA 2CXGA 3LGDA 4PUMA 1HL9A 4Q32A 4N9DA 3DAQA 5FJOA 4GE8A 3DG3A 1DIKA 1WZMA 4Y96A 3EPOA 2Q02A 5D05A 2D3NA 4F79A 1NEYA 3S2JA 3KEHA 2G4JA 3ARTA 1P5BA 1K1DA 3C5QA 4AVOA 4ZO6A 4ML9A 4ADSA 1JDCA 4GH3A 4U31A 3GSMA 4E8GA 3GXTA 1Q4WA 5ECVA 5C6MA 5CC6A 2F38A 1KFLA 4L1XA 2WVVB 4KW2A 2OZ3A 4PMNA 1H7RA 1IWPA 3QLLA 3W1PA 1RHCA 4YTSA 5KSWA 4GD0A 1JYWA 3ZO9A 2G4FA 2TYSA 2NQZA 3GIQA 4Y9NA 4HIBA 3QHOA 4LBRA 3VIJA 3AFBA 3CPUA 3KBMA 1GOMA 4CN1A 2ZC1A 4W8AA 3BW4A 2E6AA 4F4RA 4R27A 3DX5A 1SFJA 3GXFA 1JI2A 2J6XA 3N12A 1M01A 1LBMA 1UBSA 2G3NA 3NOEA 3IANA 1W56A 4XSMA 3FXGA 2XYLA 1FRBA 3FJ4A 3UG8A 3KXQA 1A4LA 3RU8X 4B5WA 1FWBC 5DY3A 1KKOA 3MKVA 1DL3A 3SUUA 3KAOA 3DU0A 4ZQNA 4ZTXA 4ZB5A 1SJDA 2O9PA 4M51A 5AYZA 1EGMA 1N55A 4Q8QA 2AAAA 1I60A 3TW7A 3OW1A 4WJXA 4O4VA 4RZ4A 1KCKA 1DJNA 3P5ZA 3L4YA 1QU4A 2WBKA 3OA5A 2X0SA 3PJXA 2O56A 1WDQA 1KQZA 1JNDA 2CZEA 1Y5WA 3E2RA 4GFIA 5C2GA 2A5HA 5LGXA 3NWRA 4YNGA 4LQ1A 1VFHA 2FB3A 3E2QA 2BNJA 4FXSA 5DRIA 3UU0A 4PTXA 3RHGA 1Q6CA 2PLKA 5CAKA 1YMYA 3FIGA 3SECA 1IEQA 1NDYA 2BGSA 5C5YA 5KZ6A 4E5TA 1BKSA 3OYZA 1V93A 4GJJA 4A22A 2TAAA 3LHWA 4WY0F 2XFWA 4NZ4A 3BLOA 1XSKA 2PDQA 4I6KA 4JTAA 4YN5A 5A8GA 4PTVA 4ZEPA 3L21A 1V3MA 1U1HA 2PF8A 4W5UA 4M24A 4JTCA 4GY1A 5AVHA 2HCVA 1L8PA 4AYSA 1NTHA 1F8IA 1W5NA 4JQ3A 5DQPA 4PCNA 2XVPA 1XYBA 1UZDA 3GLCA 5PTDA 2ALDA 2QULA 3GDTA 4OV4A 3TLQA 3TC3A 3B05A 3ZIZA 1WXZA 3O63A 3KFTA 3PBVA 4XV0A 3CZJA 4QCEA 3P67A 1OYAA 3EDFA 1V6WA 1GVRA 4N4QA 3DEQA 2FTYA 1LQ0A 2Y89A 2E3ZA 1X6NA 3CYJA 1J93A 3H4XA 4CNOA 3NQMA 3R79A 1V4YA 4E3TA 4B5NA 2OJPA 2W92A 4BI5A 1NU5A 3ZS4A 2G3MA 3EXRA 4RXGA 5FEPA 2P88A 4PA8A 1MUCA 2CZFA 2EPHA 4PUEA 2J88A 3QTGA 2XWEA 1PHQA 1R6WA 4PMQA 5FF4A 5D9MA 4K6AA 1R2RA 1KA9F 1D2KA 2Z24A 3KLLA 1V6UA 4ROPA 1ZB5A 3ZMRA 1Q3NA 3U6WA 4H41A 1KC7A 1M68A 4DYEA 4RE3A 3UCCA 3AIQA 4AEEA 1IIHA 1YTEA 1EJRC 4NNAA 3GE7A 1RK5A 1VBJA 1G1YA 2I9UA 3WQWA 2W91A 5IDIA 1A5KC 3MCMA 4XD6A 1Z8AA 4W86A 1RLCL 2OCZA 4GYFA 1I1XA 4WSKA 1R3TA 5F4SA 1SJAA 3OIXA 4XZ9A 5FF0A 4IXXA 4KIEA 4KRTA 4FNQA 1D9EA 3GIYA 2J9ZA 4QG8A 1HW6A 3DYPA 1O95A 1UD4A 4JGDA 2FKPA 4AY8A 4PMXA 1ZGDA 2R1PA 3DC0A 4Q33A 3CYVA 2A7PA 1UR2A 1ZJBA 1R85A 1WKEA 2XIOA 4CN4A 3PUGA 1JCTA 1ME9A 1TA3A 4GOAA 1RQEA 2YPIA 1E55A 1GVFA 3MUXA 4KESA 1P4CA 4HSHA 3N2MA 4HU3A 3TQPA 3P7YA 2PODA 3OG2A 3ZT7A 3FK4A 3T6CA 1S38A 3W0KA 1BRLB 1EDTA 5D04C 4D6CA 5E1QA 3EOUA 3K5XA 4AY7A 3TYZA 1U22A 4J3ZA 1VYPX 3IUDA 3EDJA 3WQ4A 5A6JA 1T96A 3L2MA 3T4CA 2QIIA 4HN4A 2X16A 1YDYA 8RUCA 3CASA 5TD4A 1KBJA 2DQXA 2VOMA 2B7QA 4KCTA 3ARPA 3OIHA 2W61A 4B5XA 3MDUA 4IIBA 4CNSA 1WKFA 4ZL1A 4E2VA 2CCRA 1L9WA 1JUBA 2VM8A 1TVPA 3HA1A 4MNJA 3OVQA 5IHSA 1AA1B 2G41A 3B97A 1G4TA 4IX2A 2AMGA 2PDPA 2BY3A 3B0PA 4CCCA 3BAJA 4N9CA 3FHQA 3V18A 3PK7A 1YDOA 3QPEA 1P6WA 1Q8AA 3P82A 4H2HA 4DBWA 5C8BB 4FLQA 2YCKX 4UBPC 4DM1A 2YYTA 2Z1KA 3CZEA 1O4UA 4QX4A 2OX4A 1H5YA 1JDDA 1UWSA 1PWLA 5D02A 3DI1A 1JDAA 1WZAA 1JF6A 2OLSA 1F6PA 4JPGA 3CMFA 4JTDA 1D8WA 1ZS2A 5EKYA 5IM51 4UXDA 1J9YA 5D09A 2DP3A 3KVJA 3VIIA 3CHCA 4NY2A 3RXZA 4PEKA 3BLKA 4WSHA 3NSMA 3A9BA 3U7BA 4KGJA 3VD9A 3TH6A 2PTZA 3BVJA 2VNCA 4DXXA 1J2BA 1K77A 1F4HA 3CPGA 2WLZA 2H8ZA 3WUFA 2ICSA 5LA1A 2EG6A 2Z7GA 4RX0A 2OGYA 4MB4A 3BGJA 3CK5A 3SB0A 1ZP4A 3W82A 1XC4A 4ZENA 4ORIA 2E8YA 3UWYA 1MI3A 4XBKA 3F2BA 1HO4A 4PN2A 2ZXBA 4JTRA 1QMLA 2JIWA 1XDMA 1KFWA 3UPMA 3GTNA 3PWIA 2NV9A 3RM8A 4DPPA 3HG4A 4D6HA 1WYIA 3INPA 2YL8A 1QPOA 7REQB 1JCNA 3EWCA 2ZQ0A 3P61A 1SGJA 2Z25A 2YW4A 3T4WA 2FHBA 2PD5A 3E02A 3L0KA 2PTWA 2D0FA 2J27A 1T41A 1SJCA 1R8LA 1QNSA 3PSWA 4GVGA 4ERAA 4CVUA 1W9VA 4YWIA 3JS3A 2XIQA 5E0FA 1LF1A 1E1CA 3WLIA 3G1DA 1MQRA 1SZRA 2IQ0A 3MHGA 1A3WA 1GQIA 1DHPA 1QOXA 3QYQA 1LROA 3F4CA 1A5NC 4YTQA 1PKNA 2BHYA 1SW0A 3T9PA 1J0HA 4XAZA 1KRAC 1B4EA 4LS0A 1Z89A 4C6CA 3VCNA 3W88A 9RUBA 4BHYA 1FWAC 2DSUA 3W7LA 3IIZA 1W3HA 2RKXA 3SQLA 5A6LA 2ASHA 1SFSA 3R10A 4QE1A 5EMJA 3SEPA 3UR5A 3WH7A 2NX9A 3GW3A 2X0HA 2QDGA 3KVLA 5HQMA 1C9WA 2WK2A 4LTSA 2VWTA 3FNDA 4NJHA 4QE4A 4M5PA 5LIXX 1MVYA 4DBUA 1GNXA 5A6SA 1M1BA 3CQHA 1GQLA 3R5EA 1FWFC 2QV5A 3MB9A 3W72A 1EJWC 3B4UA 2E6YA 5C2CA 2VT0A 3O07A 1T40A 4H1ZA 1D7FA 3CQIA 1BLIA 1ISWA 4BJHA 2R91A 2O7QA 2WCSA 1AG1O 2CBUA 5AY7A 3T09A 1H60A 3CH0A 1BF2A 3Q37A 3BLLA 4PTMA 3DHDA 2ZKMX 3QY6A 4QG9A 3S8HA 1YTKA 1YBQA 1OABA 4QLKA 4C6KA 2NWRA 2OT0A 3B8IA 4H8VA 3I68A 3P80A 3TJ4A 4ZE5A 2Q3OA 3UR7A 5LHEA 3S9YA 4F8XA 3O6DA 2PP0A 3S5OA 1VC4A 1CCWB 3H53A 4AHPA 4DJED 3PR2A 2J47A 2QGHA 3LLFA 7ENLA 4NRRA 4E4UA 3TVAA 1XD1A 4ACZB 3ITXA 1G6CA 4YXGA 3UYIA 4US5D 3NSNA 1AL7A 3B06A 4HQVA 2V3DA 3LNPA 4RDZA 2KAUC 3T0CA 3RYSA 2XGBA 2NVAA 4FSAA 3DYOA 4AYGA 1LP6A 4CVWA 4DLMA 2QJMA 5T26A 4LYPA 3V36A 3ECQA 3EX3A 3MYOA 3VGBA 3GZAA 3MMDA 4IJCA 2IPFA 3NDZA 4JTSA 1J01A 4Q8PA 3I7RA 1A5MC 1US2A 1AFSA 3CUZA 5M3WA 3IVTA 2C15A 2WCGA 1HX0A 4LUSA 3GHUA 2GK1B 3DBPA 4LAOA 2XISA 3U7VA 1EPXA 1F3EA 3BK0A 1S5VA 1LL7A 3VD4A 4GJIA 3WF4A 2WOQA 1Q6GA 1EEXA 3H24A 4L64A 2GUYA 3QVQA 1UBPC 4D1JA 2PGWA 3H70A 1B3OA 1F7BA 1V5XA 3ES8A 1RK6A 5M2FX 1VP5A 3HM7A 3DN5A 1E6NA 4GFSA 4EIVA 1FXQA 2V9DA 4Q7IA 3W7HA 3SDOA 3LRLA 1SO4A 5HDRA 5BOOA 4HNTA 3T07A 3VIMA 1CXKA 3LCWA 4PH6A 4YVPA 2EG8A 4LS1A 4Q4SA 4JTUA 5KZDA 2OELA 1VBHA 1F05A 2PDNA 2JBMA 3QMSA 2BHZA 1GOXA 1GZJA 4GI9A 4UFHA 4S3EA 2QUUA 4HHPA 1I0BA 5FAJA 4W85A 3AXKA 2OSYA 1E72M 3EMZA 9XIAA 5IOBA 4PBFA 4US6A 3VKBA 4A29A 1MEHA 2ACQA 3H2OA 5CQ1A 2VX4A 4ONVA 2ZRWA 1CEOA 2O9OA 1P0KA 5BU6A 1GVSA 1XCWA 2GJRA 1PX3A 3QPZA 4Q6XA 4JTLA 2PWDA 1FDYA 3KHDA 1OZMA 1W17A 3GXMA 2NQJA 1GVIA 3HURA 2ISSA 4XKYB 1LLWA 1WP6A 1HN1A 3O8AA 5MF5A 2CC0A 3IK2A 2YJQA 1OFBA 3ARRA 3FXYA 3RFAA 2G5WA 3QFEA 1W0MA 3QGVA 1LORA 5BOFA 4A35A 1OX4B 3ICJA 4HOWA 3WZ0E 3BSHA 2J7FA 3LPOA 5HJLA 3E6EA 4JXCA 4UZUA 3P81A 2QCDB 2HNEA 2YZ5A 5HJXA 1CW2A 1MRAA 3IGHX 4DWSD 5AYBA 3TCEA 3K8KA 5MKGB 3EOOA 3PBYA 1UPPA 1PPIA 4HYWA 1KTCA 3O6CA 1Y8BA 2GYIA 4L5ZA 2CETA 3OHMB 2HEJA 4ZQPA 5ECUA 4GYPA 3O0FA 3SCRA 3QGKC 2DVTA 2FZ9A 1A5CA 4TVUA 1LL4A 5GPRA 3RJXA 2Z27A 4GCXA 1ZQ5A 3FEMA 4Q7BA 3G0SA 1XIJA 2PAJA 3TX9A 1JG9A 4HSNA 3THQA 4ATWA 5ABGA 1V08A 1M7OA 1XBXA 2GSEA 1WDWA 1X6UA 4OHQA 1F3XA 2FDSA 3VDGA 4H7VA 1ITQA 5DCBA 4P5UA 2OTDA 2DSWA 1VPXA 3G0XA 4RW5A 2OEJA 2BLEA 5LA2A 3C86A 5BMWA 1BYCA 4AD5A 3PG9A 4KGLA 3SSZA 3QFWA 3NZRA 1JCXA 1TWIA 2NWSA 5A3HA 1W2PA 2ZRXA 3RCYA 1WDSA 4M1RA 4TIMA 2QAPA 4HJWA 2VFIA 4ATDA 4EPKA 1PKMA 4IL0A 5HJYA 2CLEA 4IPPA 3KX6A 1EEPA 4C6PA 3RX4A 1KCLA 2E68A 5C55A 5HNNA 1JPMA 3AIBA 1ZNNA 5D33A 1G94A 2XU2A 1UH3A 1QPQA 4KWSA 1H7WA 3UNTA 1KM0A 3EX4A 4YTRA 1X1NA 2Z4GA 3WLRA 4H8HA 3BO9A 4JYEA 1AJ0A 2XIIA 2QEZA 4WGHA 4AHQA 4S3CA 2QCHA 1SYTA 3PFRA 5HMDA 2QVHA 5TIMA 3GTFA 2OU4A 4JYFA 1A49A 3FAWA 4JY8A 1VPYA 1TJ2A 3APYA 2WYSA 2YXXA 4V1XA 2EPOA 2CZDA 3MANA 4PSPA 3VE7A 2XSXA 4X3ZA 3AMKA 2P50A 3HO8A 1EJUC 1TELA 3TW9A 4DF2A 1TQJA 1SW3A 1FUYA 1NQ6A 3AXIA 4NKCA 3WH5A 4DBDA 3KVKA 5E0CA 1AMYA 3F5JA 5DX7A 4AUBA 1XISA 1PCKA 4CD5A 3H2AA 5CSYA 3CPRA 3WH6A 1DWHM 4CD6A 2NQLA 1VFFA 3MU7A 1ZENA 3KP0A 1E3XA 2Z00A 5CKSA 4I8YA 3FA5A 4PMVA 4XTIA 4C6FA 3RLGA 4LRTA 4Z1CA 1ITXA 4B9ZA 3U0HA 4ICMA 4C6MA 4GISA 4MWAB 2PDBA 3WD3A 1QAPA 1GHSA 4JN8A 3WQEA 1KCZA 2E67A 3FVMA 1SUXA 4IP4A 1W3IA 2Y85A 5DMMA 4YIWA 1B4KA 4R7WA 4RZBA 1BWVA 2BTMA 3BWWA 1H1NA 2ISWA 3GKAA 4NHVA 4MY1A 1GYNA 3KOFA 1FWIC 3ZZ1A 1K6WA 3AIRA 3ABRA 4W9TA 5K9CA 3SCUA 4Q8UA 1EPVA 4NZJA 3LU2A 2DEPA 1IEVA 1B9BA 2V0TA 4JHZA 4U5IA 3AUJA 1UKTA 4R85A 3GG1A 3MYPA 1S3HA 3EDEA 4ERIA 1R87A 4OTKA 3DKLA 3ZWSA 1XBYA 2BVTA 1T6MA 2B0MA 1OX6A 2PDWA 3B04A 4JHMA 1CBGA 3RNDA 1BVWA 2WAGA 3F2DA 4K2SA 1UD8A 4MZYA 3DYMA 3AZTA 4ORMA 3BLIA 1K9DA 1R2TA 3ENLA 3VGFA 2PB1A 5G2HA 1KXTA 1W1ZA 2NUXA 3R2GA 1KXVA 5AHMA 3OZOA 1J12A 3L0GA 3M4HA 1DE6A 3K1DA 2VURA 3SQSA 4IX0A 1OBAA 1DOSA 1QPRA 4DJDD 1W9XA 3BOFA 4WDWA 3QKEA 2CLLA 5D03A 4P7RA 4UIOA 3EEZA 2J7EA 4X0VA 1O1ZA 2J77A 4RDWA 1TTQA 4MGGA 3E74A 4O1AA 1XRFA 2WZIA 4QG6A 3LPPA 2D24A 4GI4A 4HHMA 5TQLA 2E1DA 1BQCA 2AL1A 4EACA 3PJWA 5E6ZA 1W32A 5I00A 4L1WA 4BY3A 1EBGA 4NYYA 4MSSA 5D8ZA 3STCA 3PULA 1DORA 2UY4A 2O55A 1WUEA 1V3JA 4HA3A 3NGJA 1BKHA 4G6CA 4PB5A 1RBLA 4LCSA 2BB0A 4GYJA 2VGIA 4MB5A 2X1TA 3KZPA 2X42A 4TQTA 1WZKA 4W7WA 2BG5A 3WCZA 4JQ4A 3PWAA 3WLLA 2XHYA 4TR9A 4Z2IA 3BANA 1TVNA 3BMXA 4DAFA 1U30A 1A4MA 2ZICA 3AU2A 3VZZA 4IIGA 1CENA 2Q01A 2CEQA 3CJPA 4GNKB 1KRBC 4IG2B 1VGAA 1FX6A 3HPXA 4REQB 1UHVA 3ITLA 4PRRA 4C6OA 2OSWA 3WQ5A 3N6JA 4L4OA 3EZ4A 2IMRA 4TXEA 4CCEA 3VE9A 2NSOA 1XYLA 5BROA 5H8UA 3CLWA 4F2BA 2J9XA 3MO4A 4FIQA 3SUVA 3VNZA 2J75A 1EC7A 3UEQA 2W62A 1I2PA 2YL5A 3IUIA 4W89A 4CUCA 3K8MA 1HVQA 3G22A 4O1BA 3TFCA 2VDHA 2WO5A 4O14A 1CGVA 1C3FA 2JEPA 3EX1A 4JTFA 4FK9A 1V7YA 3BGAA 2XGIA 1GJUA 5D9OA 3AI0A 2VGFA 3CWOX 4EVZA 3PBGA 3KRUA 3SZ8A 1G4PA 4HVXA 4N7QA 1VCGA 3PB2A 1O12A 3W22A 4R3UA 2OGJA 1VF8A 3MW7A 1FVPA 1GZ1A 1XGDA 4XVDA 1M5WA 3NL2A 3SY5A 3GC5A 5FEXA 3LBMA 4GWEA 3VK5A 1E6ZA 2NUWA 4DVOA 2V3FA 4NJGA 3A13A 2V67A 4NX5A 3UZYA 1UKPA 2ZXQA 3EMCA 5F1UA 3XISA 3BG9A 1UP2A 3A5VA 4MAZA 3RILA 4RL3A 1XX1A 1E5JA 1OC6A 3A23A 1OFAA 2X41A 1F73A 2WW5A 2YKKA 3HGJA 3E0LA 3PZQA 3GK0A 1ONEA 1UR3M 2J7GA 2CPUA 3HJZA 3H54A 3RRXA 2E40A 4W7VA 3TA9A 4MWAC 3N15A 1FDJA 3RX2A 3T0AA 1K3UA 3UWVA 1NAL1 3FV9A 2KX9A 4H9YA 1RD5A 3Q67A 5FCZA 5C54A 4ZE4A 1JCLA 3BH4A 4MADA 1UUQA 4AZBA 4AX7A 1W5MA 4PMZA 3B8DA 3C2VA 4N2YA 2PGRA 1Q4NX 1SZFA 2PE4A 4NSBA 1KFJA 4D6FA 1ZBWA 4B5TA 3CV1A 1Q2RA 4WDUA 3FSTA 1I4NA 1YW1A 3H21A 2D2HA 3IV8A 3S3GA 1NP0A 3AOFA 4FPSA 2CBJA 1B3YA 3RRAA 3LQLA 1NWRA 3PB0A 4L6OA 2CLMA 4HNLA 1EUAA 1OCNA 3G1AA 3RO6A 5I7GA 1M7JA 1E6QM 3KS6A 4XZMX 4IMCA 1R7OA 3FYOA 3NVTA 1GTHA 4PMRA 2UY3A 4AFYA 2DY3A 1XLJA 1RPXA 2VELA 2R24A 4JX5A 2INZA 2J7CA 2VCAA 4JN7A 4X63A 2GVGA 3N19B 1C8XA 4AZCB 4FOJA 4QLLA 4Y9AA 5DY2A 2DZPA 2V69A 3MV11 4AZ5A 1V0NA 4FR1A 3MKCA 1CXLA 3RX3A 2I16A 2VC5A 1XIIA 4H8UA 1EZWA 1T0OA 3GAKA 1MXDA 4GQ0A 1JFHA 1GZGA 2VP8A 2Z2UA 3KWSA 3PUOA 4M7SA 4GUHA 1E51A 3T78A 2QJJA 1XLFA 3DHUA 4G7EA 1ZJHA 1KR1A 2YR1A 5CEWA 1OFOA 3K4WA 2DT0A 4CNUA 3G6MA 3H23A 4GCAA 3U5UA 2WV8A 1FWGC 3NZGA 3K13A 1Z32X 1XIFA 2YLAA 4KWWA 3MI3A 4PR4A 3TWAA 5GJPA 2VFHA 5SWUA 2QUVA 2AKZA 4XZBA 2WCAA 3MMTA 4NASA 4B2DA 1VEPA 3KOWA 1H1ZA 1RUSA 3OLGA 5LIKX 3FOKA 1UR4A 2ZZ6A 1XYFA 2XVGA 3GU1A 3TV8A 3AIEA 3TUUA 1XW8A 4PB4A 1Q7ZA 1XP3A 1OFPA 1T7LA 4MYXA 2JKEA 1RV8A 3SFWA 2RHGA 4OZOA 3VM5A 4OBTA 1UKQA 3O15A 3R11A 1DJHA 1CIUA 1FHDA 2R9RA 4O15A 1C90A 2W4XA 4KS0A 3MBFA 4Q8MA 3VA8A 3I3DA 2VL4A 1JYVA 4IOTA 2GDVA 4M19A 1ALDA 1OT2A 3WQ8A 3NQ6A 4EE9A 4ZFMA 1UA7A 4N42A 3W28A 3LCXA 1K8CA 2QCMA 4I9JA 3QR0A 1V03A 4IWWA 1VJSA 2Z6IA 4HPXA 2FH8A 1EO7A 2OEKA 1OD8A 3OTRA 3IJ8A 4L4LA 5L6UA 2C0HA 2I56A 3FCPA 4LAMA 2IPGA 4JNYA 2V30A 4JQ2A 3TNBA 4OE7A 4U2ZA 3N9SA 2REQA 3GH4A 3GXDA 1ADOA 2V5CA 3P62A 4EXQA 1SO5A 1UIPA 4LYKA 1R9ZA 3LPGA 2QCLA 1BXNA 2WSRA 5ABEA 3N29A 3L2LA 2BGQA 3HGRA 3KE0A 1CGUA 3ONCA 3NSXA 3OOQA 1TMLA 2ODOA 2HZGA 1IR1A 1UWRA 2JFEX 1V79A 3AHYA 5FL1A 1P0BA 3WSUA 1TCMA 4RE0A 1J0KA 4XAFA 1NFPA 1A0EA 3WNOA 4LUIA 4JFVA 3W1UA 2X2YA 5MHBA 4FNTA 3SUTA 2CYGA 3I4EA 4RE2A 3KL3A 4IQEA 1O66A 5A6AA 1CXFA 4MJ2A 3LXBA 4X2PA 5I6SA 1XI3A 4WSJA 5LIYX 2BXVA 2RDUA 3MWCA 1ONWA 1JZ3A 4FIRA 1ZBVA 3MUIA 4IL2A 4R33A 5HA7A 3KOYA 1H09A 3ZJ6A 3U48A 1YPIA 4AC7C 1G4EA 3IIPA 2E25A 3AHXA 2JALA 3UERA 4XZIA 1UC4A 3AO0A 2VJXA 2D23A 3F5LA 2QVNA 3NPVA 4H19A 4XISA 1JRCA 1KXHA 4F9JA 4LUJA 4OWGA 4Y7EA 1W1YA 1ZFJA 1WV2A 4R53A 1H7PA 2HXUA 3RR4A 4L9XA 5F4WA 1SMDA 3CHFA 3GYCA 3F7JA 2WMHA 3PJTA 1QI5A 3OA3A 1PVNA 4HNOA 3CO4A 3GHSA 3XINA 1QRQA 1Z6KA 4ZVJA 2C79A 5AZ1A 1L6YA 1DIDA 1WBHA 3KOXA 1XF0A 3G1XA 4K3ZA 1ELSA 2OWCA 3TAOA 1G5AA 3EWYA 3M6YA 2V5DA 4CEUC 1XIBA 3TTSA 5D9PA 3OZYA 3QF0A 1LRNA 4A3RA 1XLKA 3QOKA 4GUFA 4ZSUA 1G4SA 3NCOA 1J5SA 1YE4A 1VZWA 1TWDA 2YDAA 2P76A 3GM8A 4WCJA 2PDXA 2DV0A 3THDA 5D30A 1YIXA 2CKRA 2DZBA 1UWQA 1W5PA 1R47A 3VXGA 6ENLA 5H8PA 3FYYA 4HNUA 4E2BA 4XD5A 1HKVA 3WBWA 4F2UA 4RXFA 1BAGA 3HQ1A 4I3GA 4AMCA 3OBKA 3SCSA 1KD0A 1S5NA 2XFYA 5H91A 1OJXA 4RUBA 4ZCWA 3GNNA 3WNNA 4H3DA 1NF0A 1SVDA 4GA8A 4QISA 2F9RA 4K1WA 3SQMA 3R1ZA 3W81A 4U2YA 2Y2WA 1EYWA 1BGAA 3W71A 3TK7A 1M65A 1QR7A 3GWQA 4XIAA 3RUBL 2HE8A 4S3FA 2X8RA 4I9MA 5G2WA 1R7AA 3UY8A 3EOEA 1PZ1A 3B0UX 1Q8JA 4UMAA 3IS4A 1R38A 4UTWC 1BSLA 4JQAA 3W7NA 5REQA 3TAKA 3HMJG 3R0KA 3MCOA 3VC5A 4ZTYA 1TPWA 4D6EA 3RG6A 3L68A 3C0QA 4QNEA 2NXGA 4GLEA 2P10A 3WF2A 1KQYA 5DLCA 3LM7A 2GJLA 4GHRA 4HKPA 3E0FA 4WKFA 2DIEA 2XGZA 4JFWA 1BG4A 3DFHA 3EB2A 1UP0A 3B8SA 4EK7A 3UD6A 4JD4A 5A94A 3V35A 1LL6A 5DO8A 4PFMA 3L2IA 4HCHA 4E2DA 2FGZA 2DPEA 3S42A 4Q4KA 3HPSA 1XIMA 1KRMA 1WKYA 1ZU8A 1EJXC 5ABFA 1EX1A 3ABSA 3GRIA 3S1UA 4BEUA 1J6PA 2WC3A 6CGTA 2OLAA 3K1GA 1GYLA 3W1RA 1US0A 1JPIA 1M6JA 1XFBA 4UNKA 1H7XA 1AQHA 2Y8KA 2A3EA 3S1XA 3CAQA 5DRCA 4TU1A 1YADA 3UZXA 3IACA 1PKYA 5DANA 1XR2A 4J40A 1TPFA 4H04A 1DKWA 2FVKA 5CPTA 1PS9A 3PNUA 3QN3A 4HMNA 3W1MA 6TAAA 2ZUMA 4A8IA 3F2CA 5AC6A 3AAMA 4MUZA 3WJSA 5AC8A 1JZ4A 4Z1AA 2VWSA 3PG8A 3BAKA 4S3KA 2C14A 3QC3A 4O16A 5ENLA 4MY8A 4Y8EA 2YCLA 2R1LA 4UTLA 3M47A 3M0MA 1XPGA 2D3LA 2YCJA 2C1GA 3MP4A 1LZOA 2QPXA 1UOKA 4IPLA 3VNYA 1R3SA 3LRKA 1AZ2A 2Y7GA 1XLAA 4DZ5A 4HP5A 3UXLA 3OODA 3DKJA 3H2FA 4ZO9A 1FH8A 1TX2A 4H01A 1JZ8A 4FP1A 4QAIA 3P6LA 3VIOA 4MM1A 5EA9A 1WCGA 2Y5JA 4IPJA 1JZ7A 5C9RA 3NZ1A 1QI0A 1VBGA 3N18A 3NL5A 1QFEA 5A6KA 5FSDC 3UWUA 3WBXA 4DEFA 4RJEA 4M6UA 3L5AA 3WQGA 4IQJA 5A6TC 1OHLA 3AYSA 3H4WA 5G1YA 3B3DA 1QNQA 5GNXA 1HJXA 5CBBA 4HPGA 2ZZ3A 1FWWA 2FB2A 4JDBA 3Q2DA 2J8FA 3TXVA 3N1AA 3AXMA 3TTQA 2V5JA 4NZFA 1XQKA 2HTMA 1Q6QA 3OBAA 3MZNA 4RPQA 3UGRA 3LZ5A 1GOIA 3LI0A 3AMCA 1XSIA 3QBUA 4NIRA 3OZMA 3W3OA 3V16A 1W31A 1DTUA 4LVDA 4IPNB 4UZSA 4BCEA 2WZMA 2F6XA 1GHRA 4N4PA 5EYWA 3B03A 2P8BA 2ZDSA 1UYQA 1QK0A 5E93A 4GGBA 2JQXA 5F2MA 3UGVA 1DWJM 4AD3A 1E1CB 4QSFA 2SFPA 4AD1A 3CZLA 4NAFB 1ODUA 4IUGA 4CD8A 4M82A 1MUWA 1CXHA 3MQTA 1KBKA 1OZQA 4B3KA 2GWGA 3M0VA 2E6DA 5DMNA 3NM1A 1MFUA 4CQ9A 4DBEA 1DWGM 2F61A 3EBVA 3D6NA 5H2ZA 2JGQA 3AYTA 3VX1A 4TTGA 3ARUA 1FFQA 2UWFA 5CGTA 2WBGA 2OQYA 1JZ6A 4OOUA 5A5WA 1FWDC 1U5VA 2QPSA 1XDLA 2DVUA 1X7FA 2INFA 1ICPA 1DBTA 1J2WA 3BL3A 2PC8A 1I75A 3IRDA 1HUVA 2PCQA 3EMQA 2V8ZA 4B3ZA 1MWOA 1OC5A 4EP8C 5I3KA 1ECEA 2YB1A 5F2GA 4C1KA 4F40A 3AC0A 3HFTA 3S47A 3C56A 2GGGA 5DBUA 1I9CB 4HA0A 4ZMGA 4MY9A 1KM2A 1WOAA 3EYPA 1HT6A 1A5LC 2F8QA 1S3TC 1KFKA 3R25A 5GVJA 4LC6A 1BQGA 4YVVA 1ZTVA 1JVNA 3KRBA 4ML4A 3NQEA 4O11A 1YBQB 1QWGA 2NZLA 2VRQA 1YE6A 4CN6A 4WRHA 4JTTA 2WHKA 4OIFA 5JXQA 3I7QA 3U4AA 3WDJA 3NQCA 3PTKA 1J79A 1UR0A 1NSJA 4UQDA 1X1OA 3GNXA 5KINA 2VC6A 3A3HA 2QDEA 4UR9A 4AIUA 1Q6OA 3GDKA 3KBWA 4EPEC 5FOOA 3OQEA 1GJPA 2IUZA 1RAKA 2EHHA 5CCZA 2WZTA 3N4AA 2WQDA 2PWUA 2AMXA 3BJTA 2A6NA 1WDPA 4IQDA 5DN1A 3M41A 4A8LA 2C71A 3S1VA 3WNLA 3N6QA 1DWAM 1WZLA 1IZCA 4AIEA 4F0SA 1ZHAA 3R58A 4GZEA 3SRFA 5JVLA 3G6LA 1SFTA 3WMSA 2HRWA 1JL8A 1H5VA 1DJQA 2G96A 1XYAA 3GR8A 4DX3A 4UQAA 1SZGA 2PF0A 2GSHA 3ABQA 2O9RA 4RCXA 5E70A 1QNVA 1QWKA 2WVUA 3HMCA 1KFCA 3S0CA 4MWAE 1QW9A 4JCLA 4JDYA 3QXBA 3HJEA 2HXTA 3WF3A 1TV7A 3O6YX 2Q09A 4CLMA 3G24A 3RCNA 3VINA 4PYSA 3W6LA 1QASA 1TJ0A 1PB0A 5A8NA 3DGRA 1HJVA 2FMNA 4JX4A 4O28A 4QROA 1DJIA 2HPIA 4RR4A 3LOTA 3KUMA 2PTDA 1IE7C 3EWXA 3WLMA 4BF5A 4JN6A 3VIKA 4AG0A 1WQ5A 1GW1A 1LQAA 3EX2A 3UESA 3LV6A 2CZVA 3STEA 1OD0A 3OU8A 1JPKA 5TNVA 3N13A 7XIMA 4TTUA 2PURA 2WVVA 2WWDA 2WM0A 3E1F1 3B9EA 2VR4A 3QMTA 1P6CA 2WNQA 4HU4A 1JZ2A 4S3DA 4R34A 1SW7A 2DT2A 2J6VA 8CGTA 2JGYA 3MC5A 4NZ3A 5HWNA 1AW1A 1VFMA 1VPQA 1TE1A 4UCGA 3COTA 2G95A 3DGBA 3VOIA 4C6DA 3U2ZA 1FOBA 2B4GA 3WLTA 4GIEA 5LNSA 2BGNE 5B7YA 3UQNA 4C7GA 1AVAA 1E4IA 2BOFX 4AMAA 5I3FA 3CTTA 2VZVA 4PCFA 3AS0A 3W7OA 1TUFA 1E9YB 2BXYA 3K4AA 3G5EA 4QR6A 3DFOA 4AY1A 1SZEA 2BOGX 2IQTA 2V2HA 3M7SA 1Q45A 4RNHA 5BMXA 3W38A 4NU7A 5E5CA 4UTTC 4U28A 1HTIA 3P8IA 4UTJA 1W1PA 4YVXA 1NFGA 4KQNA 4XG1A 2WHJA 2PWGA 1OCBA 4QQUA 1UR9A 2WWCA 5EL1A 3BG5A 1M41A 4TMCA 3MKKA 3P14A 2W5FA 3LHVA 4S3JA 2NLIA 3REQB 3WLKX 4LEQA 4UTFA 2C3ZA 4B4HA 3IJIA 2WVSA 6ALDA 2PS2A 5IXEA 4DJFD 3AS3A 3SI9A 3UG5A 4M80A 2CESA 5LSMA 4OGZA 4FXRA 3G2GA 1W37A 1FP8A 1DXFA 3JUGA 1NP2A 5I2UA 3LSCA 3BLDA 3M16A 1TRIA 1PUDA 4OT7A 1ZJAA 1OY0A 3VFLA 3CIVA 5A69A 8XIMA 1QJWA 3MJYA 1F6YA 2D0HA 3L23A 3VTRA 1K9TA 3NQDA 3STGA 4X9SA 2I57A 1MZHA 3B0XA 2W3ZA 1R9XA 1D3CA 4IFKB 1MSSA 2DZWA 4J5NA 1E40A 3A21A 3ITOA 4LS2A 1LBLA 4EXAA 3URNA 4LVFA 3KM8A 3AJXA 1R46A 2VC9A 4GXWA 4FI4A 1HP4A 1XIDA 4ZOCA 2XH4A 4DUVA 3MZ2A 3E0WA 1E1EA 3VFCA 3M5XA 3GNRA 4XUGA 1WAWA 4L7ZA 1TR1A 1S1RA 3AJ7A 1AMKA 1B3VA 2DDXA 2WKLA 3C2RA 5HAOA 3TLLA 3ALFA 4DIAA 1F6KA 3C0JA 3PPGA 4FA3A 2R1KA 1J18A 2XH7A 2WVTA 5K4XA 3CIXA 2XFFA 1E0TA 3AYRA 3IGXA 2O4MA 3UVIA 1HJWA 4JQ1A 1TCDA 3W07A 4NXSA 1OYCA 1R3WA 3T81A 3VD7A 1AJ2A 1PSCA 1Z48A 4W88A 4Z2HA 2BHUA 4X9YA 4P7OA 5LIUX 4TX8A 2XIJA 3QY8A 5T9CE 4IH3A 4F66A 3L4ZA 3W7RA 4PTWA 1PDZA 2C91A 1FQ0A 3SCTA 3SBFA 3NQAA 3R12A 3EPMA 3UT0A 1E9IA 3RITA 3UBPC 3GG7A 1UC5A 1TTIA 2A0NA 2DZXA 1ADDA 4FLRA 4DWDA 2R1NA 1AUSL 1XLHA 4LEFA 1G69A 1PTGA 5DCEA 2ADAA 1J0JA 4CU8A 5BXPA 4FXJA 5G4EA 4O8AA 4OBSA 1EC9A 1EP3A 1KGXA 3ITTA 5G4WA 1TREA 1O68A 2MNRA 3EWUA 2P8CA 5FKYA 1Q63A 5HNTA 1VYRA 4LY8A 2NUYA 2QUMA 2YFOA 5LGZA 2Q3RA 5LNWA 1MEIA 1TV3A 3WLQA 5FESA 4FNPA 1PKLA 2R14A 3HIJA 1TJRA 3TONA 1REQA 1GGOA 1W1VA 3N3TA 2VENA 5LZLA 3SN1A 1ZPTA 1XL9A 4UNIA 4U33A 4W87A 3UP8A 2RJGA 3GXNA 3KDOA 4CQBA 3VU2A 2D2GA 4GIYA 4XZNX 4DJEC 4M56A 3HZ3A 4ENLA 3WELA 3UY7A 4HK5A 2ZXAA 3IJ7A 2VCCA 3LPFA 1X8CA 2PUZA 1L2QA 4GNJA 4WXYA 1CGXA 3QSTA 4EOUA 1HGYA 3VKCA 1JPDX 1M7PA 4E8DA 3TSDA 1LRTA 2Q71A 4LF1A 5CPMA 4WJEA 1TPB1 1UWUA 2VCBA 4ZB0A 4A6GA 3FX4A 4UUIA 5JIWA 2HBVA 4B5SA 1K7FA 4C60A 2W9MA 5D37A 2BMBA 2FTPA 1R9YA 1B1YA 3CMGA 5FI8A 3BAYA 3G18A 2E1WA 3N2TA 3H22A 1YXYA 1GTEA 1KBLA 1TTPA 1D8CA 1JNEA 3B0YA 3OP2A 2PA6A 1I6NA 1FA2A 4JR5A 3W76A 2Y7FA 3FLUA 1ZCOA 1Q65A 2BX7A 1W1A1 2FZNA 2ZWZA 5I77A 1A3XA 3IJQA 4RW3A 1IGSA 1WUFA 4EAYA 1W1TA 1KKRA 3W25A 4UWMA 3P93A 4BQ5A 4LV4A 5FJIA 3AMGA 1XRVA 2DT1A 3WQVA 3LSBA 5A2CA 2JEQA 2QDDA 5HR7A 1K4HA 1J0YA 2HK1A 1JAKA 3KCLA 2P53A 4HOZA 3J7HA 1RY8A 2PP3A 1CLVA 3MT1A 5C71A 2ZZ2A 3I4KA 1JFXA 5E9AA 4BKNA 3G1FA 4KKXA 1VENA 4AXKA 4FMVA 3GUWA 4YHGA 1J96A 2EEXA 1F07A 1EDQA 2GWNA 3UCQA 1PBGA 1UROA 7PTDA 3RU6A 3HF3A 3KRSA 3LQGA 2Y0FA 1V77A 4QP0A 3MCNA 3WK2A 1YXCA 1X39A 4PMOA 3LCIA 4ZODA 3ZM8A 3TXZA 5DMLA 1HNYA 4FAMA 3VMNA 1Q85A 3MUY1 3F4WA 1XIEA 2IS7A 4ZOAA 1EOMA 3D0CA 3S1GA 3QZ6A 4GC4A 3O3RA 1HF6A 1R0MA 1UUOA 4BI7A 2CHNA 3RGTA 4CNTA 1X96A 3GNPA 4WKHA 1UKOA 1FH7A 2A1YA 4Y9PA 2NXHA 1WNOA 2ZE3A 1CT5A 3JVAA 3QR3A 3VYLA 1IZKA 2NW0A 3LYEA 4H9UA 7REQA 2FPYA 2POTA 1CDGA 5HUPA 4HHLA 1NOFA 1A5OC 4DWSC 1KV8A 3TE9A 4IMFA 3WBYA 4JEJA 1KB3A 2HVNA 3OPSA 4BFAA 3TC6A 5F1VA 5A95A 1C93A 4S23A 7TIMA 5CC3A 1AH0A 3MP5A 2RAGA 3WFZA 1IT7A 3GKFA 4MLRA 1OQFA 3OB8A 2E9LA 3FFSA 4Z08A 1IT0A 4DXKA 3BLFA 5FF2A 4BF9A 4GX8A 4KCWA 4KETA 1W9UA 2D2JA 1UR1A 1H61A 5D8WA 5A6MA 4RDYA 4NAEB 5XINA 4LCQA 3DH7A 3KTCA 1U1UA 1XFCA 4LAZA 2E8ZA 4GZIA 4M6PA 2ZVRA 3ZT6A 1XIHA 2R8WA 2RFGA 3PZUA 1QHZA 2QAFA 1L0PA 3UFYA 4WXZA 4V27A 2HQAA 3DXIA 1WAUA 2VUNA 1Z44A 2V81A 1IZJA 3W01A 4L56A 4OQVA 1U2YA 2OODA 3LXCA 3FY1A 2FZDA 3FDKA 3QMRA 3FGCB 3EDKA 2HVMA 3GO2A 2FPTA 3P60A 3VKJA 1M04A 2VEMA 1A50A 1TMHA 4XAYA 3PZVA 1POJA 4UC5A 3F1QA 2PBOA 3G1HA 1GCYA 4ROQA 1QTWA 2B31A 2UZ9A 1EOKA 3DFYA 3WUEA 1ZP3A 1L2UA 1DHKA 4S38A 2Q8ZA 1VB9A 3C8FA 3KHJA 3T2QA 5HQEA 1FWJC 2EKCA 1TMQA 4Y2WA 4M0XA 4DO4A 3BE7A 2IPWA 1VKFA 2R94A 1OWQA 2YB4A 2EJAA 5DMYA 4PUNA 1QOQA 2I5QA 3I6EA 1AK5A 5EY5A 3RLVA 4CCDA 4JY9A 3APGA 3GFYA 4WR3A 1ZLPA 4X60A 2AAMA 4HJFA 1TZ7A 4GK8A 1OEPA 2F6KA 3DERA 2PBGA 1UWIA 4IMGA 1I2QA 2OLHA 2W79A 3BAXA 5FD0A 2WC4A 4B92A 3STPA 1TSIA 2J7DA 1EF3A 2WMIA 5IFTA 3TYCA 3LDVA 5AYIA 4XB3A 5HMSA 4O10A 4YTTA 1S39A 1P0DA 4JEQA 3W7JA 1V6TA 1EHNA 5AVNA 3AZRA 2GGEA 5CC7A 1QDSA 4ATLA 3CL6A 1GG1A 3B9AA 3BV4A 2VQUA 5LXEA 2FJKA 4RE4A 4HU0A 3P2VA 2D69A 2BV9A 3TJXA 3QY7A 1MW2A 2VFEA 1KWKA 1L6GA 5B7ZA 3SURA 1TJ1A 2V5LA 4TVCA 2GK1A 3VUPA 5I0DA 3L0NA 2Y8VA 2WHMA 4PFHA 4G7EB 1L6FA 4L9ZA 3MI2A 1KM3A 1I2OA 4QJ4B 3H7VA 2AQWA 4N0RA 4IJRA 3B9DA 3IIXA 1XG3A 4J1OA 4KBXA 4EF8A 2CZ5A 1OVDA 2GL5A 4MZ8A 1YNPA 4PTDA 2V2DA 1ZUAX 1BSIA 2GOKA 3K46A 3DOPA 4LOCA 2TPSA 2PMQA 3S5NA 6PTDA 4AEFA 4XD3A 1U5JA 2CLIA 1DE5A 2V63A 5KEZA 1R5YA 4GQQA 3LN3A 3TROA 3PM6A 1PIGA 3IJDA 3M7WA 3RLHA 1M9HA 3R8RA 3AZSA 1W2VA 4PCPA 3W7IA 2OT1A 2ZA2A 2WHLA 1VLIA 1MW3A 3VNDA 1TVLA 4R9OA 3I6TA 3EA2A 1C8QA 2PGEA 3VGDA 3UZZA 2EG7A 2UY2A 2A3BA 2PDJA 4NYUA 3TU9A 3W6MA 4H8NA 2DT3A 5KETA 1AODA 3E2SA 4IIHA 4C6EA 2R6OA 4J27A 4DJDC 4XBSA 1JD7A 2BVDA 4JIHA 3SSJA 1OT1A 4N6FA 4YYFA 1K02A 4ZR8A 1FHLA 3CAKA 4QFUA 4B90A 3WUBA 1NWSA 3B0VC 1V3KA 1LLOA 3BAWA 2C19A 3I3EA 3FVDA 4RKAA 4UTKA 4Q8TA 1SSGA 1SQ7A 1OX4A 1WA3A 1MRQA 3UXAA 1TV2A 3MY9A 4PBGA 2QCDA 3WN6A 3CV6A 2OEMA 4S2BA 1PIIA 4S39A 1J11A 3VCRA 3XIMA 4DUWA 4F0HA 3FS2A 5KMYA 5CGMA 4ZA0A 1EP1A 5CSRA 3TOYA 1EJVC 4JKMA 4I7UA 1FXPA 5MKGA 3KW3A 4AD4A 4S3GA 4QDPA 3RCMA 5CSUA 3S2MA 4J3TA 4G9PA 4GZJA 5C9ZA 2GUBA 2VYOA 3C3NA 2G8ZA 4UB9A 2R1MA 2W6RA 5FL0A 3GDRA 4AW7A 1X98A 1EA0A 5D2YA 1EXBA 3I65A 4HGXA 4PULA 3O2LA 2F2HA 5EMUA 1TG7A 1H62A 1E73M 2QIWA 3TR2A 1N7KA 2PSNA 3AHVA 3U2EA 3NTYA 4NI8A 5JBEA 4TOQA 1KW1A 2HROA 4S1FA 3DG7A 1Z41A 4D9PA 3CNYA 3NQFA 4FF5A 3KZSA 2VGGA 3QR1A 1MQPA 1DWIM 3E0VA