3CH0A

Crystal structure of glycerophosphoryl diester phosphodiesterase (yp_677622.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
GMIQVPASFDIQGHRGCRGLLPENTIAAFTKALLLGVTTLEFDLVISKDNRVVVSHDTFFHHEITMMVDGEDVTEANEKNFNLYAMNYADIKEIDVGMKTHPRFKSQKKVPAVKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNIDHPNIALFCDLVVAEIKKAHITDRFTLQSFDVRALEYMHSQYPDIKLSYLVETKGTLKKQLEKLSFTPAVYSPDVTLVSKKDIDAAHKLGMRVIPWTVNTKEEIETLISLGVDGIITDYPDLFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphodiester phosphodiesterase
publication title Crystal structure of glycerophosphoryl diester phosphodiesterase (YP_677622.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Hydrolase
total genus 91
structure length 272
sequence length 272
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ch0A00
4RV3A 3RLHA 2ZKMX 4F2TA 5T9CE 3PTDA 1VD6A 1AODA 3L12A 4I90A 3OHMB 1ZCCA 3QR0A 4OECA 1DJXA 3MZ2A 3KS6A 4Q6XA 4QJ5B 1XX1A 4RW5A 2OTDA 5PTDA 1O1ZA 2F9RA 4R7OA 3EA2A 1GYMA 4I9MA 2OOGA 2P76A 7PTDA 1DJHA 3V16A 2ISDA 3H4XA 1T6MA 3H4WA 1DJGA 1T8QA 5T91A 1V8EA 4QJ3B 2PZ0A 3KS5A 3EA3A 3RLGA 3V1HA 4PTDA 3V18A 2O55A 3I10A 1PTDA 4F2BA 4I8YA 4I9JA 4F2UA 4RW3A 3QR1A 1PTGA 2OR2A 2PLCA 1QATA 2FJUB 2PTDA 1QASA 1YDYA 3EA1A 1DJIA 1DJZA 4I9TA 3CH0A 1DJWA 4QJ4B 3QVQA 6PTDA 4GNKB 4S3GA 1DJYA 3NO3A 5T9BG
chains in the Genus database with same CATH superfamily
5MHBA 3BLKA 1IXNA 2E40A 4QITA 4RE0A 7XIMA 4LCQA 1AA1B 2G4JA 3I3EA 3W73A 3CIXA 2HBXA 2ZBTA 2V2CA 1YXYA 4HU4A 4K8HA 4Q8PA 1MW2A 1S3HA 1TPWA 1XIDA 4AD2A 1ZALA 1ML1A 4KERA 5CJ5A 2BTMA 4KEMA 4C1KA 4OVXA 3CB3A 1FHVA 4V1XA 1S2UA 2INFA 4L5ZA 3GRIA 5G1MA 1JI2A 3WK2A 3PBYA 1YTKA 2ZICA 1T6MA 2FPTA 1Q3NA 5T91A 1MNSA 1YDOA 4Y8EA 1RK6A 2ZRYA 3GH7A 3W1PA 1EJRC 1TG7A 4WXZA 3UESA 3A3HA 2DH3A 2P1FA 1S38A 2QMKA 7ENLA 4QG8A 3FHAA 5DMYA 4IQDA 4L9ZA 3TNBA 2FH8A 3U5YA 2OR2A 2R91A 1LBFA 1UR2A 3OO2A 1NDVA 5FEPA 3KUMA 4R34A 5FF2A 3MP4A 2VGIA 4NJHA 1CZ1A 2DVUA 4MVAA 3P0WA 3VO0A 1ONWA 3BK0A 3W75A 1K70A 2E68A 4JTQA 2MNRA 1GNXA 1YEYA 8XIMA 4XKYB 4ZB0A 6PTDA 4AW7A 3B0XA 2H8XA 4C5ZA 4HZ7A 3T8QA 3OVQA 2IUZA 5A8MA 4H7CA 2DZXA 4YNGA 2QXWA 3U48A 4I3GA 2OZTA 1VB9A 1BSIA 3UZXA 3B4YA 1Y65A 3MCOA 3ALFA 1A0CA 3K4AA 2GPTA 5HOSA 3MS8A 2Y8VA 4EP8C 1V0KA 3TC7A 1VIZA 3CTLA 3AU2A 1MFUA 4NF7A 1G9HA 2QAFA 3W88A 3MUCA 5BRPA 2BV9A 1T41A 4WY0B 1J0YA 4FOKA 1MQPA 5CC7A 4AEEA 5BCAA 4A29A 3IWPA 2QIIA 4JTEA 1UBSA 3SN1A 2EPHA 3M5ZA 4ICMA 2P8BA 2INEA 1CPUA 4UTUA 1ZJIA 1E0XA 2WOQA 3G24A 4PR4A 4JD4A 5KZ6A 5EMLA 2CBIA 1QTWA 3ZLFA 3UWVA 4JFTA 3C2VA 2WMGA 1KB3A 5EB8A 3V0SA 4PC8A 4AB4A 1B57A 1W3TA 3O07A 4N0RA 2J77A 1U30A 4IJCA 1VFSA 2W67A 3CASA 1G4PA 2E9LA 2OZ0A 4B5WA 1ZS2A 4AEOA 3WQ4A 1TYGA 3SJ3A 1TTJA 2BFGA 1REQA 3GK0A 3AQUA 2G3IA 3KZSA 3F4WA 3L23A 5K9XA 1Q6OA 1XBYA 4Q33A 2Z6IA 3AHXA 1E6RA 3PZMA 1XHGA 3WMSA 2YFNA 3R25A 4HPXA 1UIOA 1IR2A 3GBEA 2VO5A 1W91A 1ZJBA 5DN1A 1AL8A 4CGTA 1JCYA 3T4WA 2JGYA 1I8JA 1HT6A 3KVKA 1XIIA 5ABEA 2QJIA 5HNRA 3SGGA 1JPDX 4K37A 4RW5A 2ASHA 5FJRA 1H41A 3ELFA 2YDSA 3II1A 4ZSTA 1IEWA 3GYCA 3NQ2A 3S3GA 5DMNA 5F2LA 4ZOBA 4B4FA 4HB7A 2J6VA 3LMZA 3W82A 3WQ8A 1ISZA 1B4KA 3WF1A 3EWBX 3R8GA 5FCZA 2GLKA 2VCCA 5G4HC 4B4HA 1RXOB 4L1WA 3WLOA 1BWVA 3VGFA 3DKJA 4RE2A 3V5CA 3K2GA 1ZP3A 3SB0A 1MXGA 3LM3A 1W2PA 4NASA 3BC9A 1L9WA 2G3MA 3N4AA 3WLLA 4HSHA 2PRLA 3DIPA 4L6HA 2P0OA 1L6FA 2FGZA 3MP3A 4O15A 2WWCA 3W2MA 3W84A 1WO2A 1W54A 2A6NA 2FLIA 1PHWA 2INZA 3NM1A 1EGMA 3OTRA 3C6CA 2BLEA 4GH1A 2PI6A 1TTQA 2WZEA 1OFDA 2POZA 4AD0A 4LQ1A 4XZBA 2GQ9A 3H2MA 4IOTA 3PZVA 1YIXA 3V0TA 2V9DA 4MB4A 4DZHA 5I09A 5D9NA 1A5OC 1KKOA 1VJZA 3RM4A 4W7VA 4DJFA 3TDFA 4J3VA 5FSEC 2ISSA 1XD1A 2QCGA 1MWOA 3OYXA 1HJVA 2OTDA 2PWDA 4A3YA 8XIAA 4NX0A 4ZOAA 2YBUA 4HHLA 3SUVA 9XIAA 1EHNA 3TKFA 4IX2A 5KETA 4AFYA 1GYMA 4L6OA 2NV2A 1CGTA 3SIZA 3ARVA 3S9YA 4FB7A 2WNWA 3WO8A 2PDPA 1K8XA 2VC6A 3LN3A 4UFIA 3T08A 2XH7A 1V02A 4GK8A 2RJHA 3PR2A 3B9EA 1XFBA 3CPRA 1AQHA 1DBTA 4JQAA 2HEJA 4MZ1A 2EKGA 1UR9A 2XN0A 1VFHA 4D71A 4PCFA 3WD4A 2FVMA 3ANVA 5GJNA 4Z0JA 1H51A 1YDYA 1OFEA 5D2VA 1R38A 2C79A 4C6IA 5DXXA 2OEMA 3CS2A 4RPQA 1J10A 3EMCA 1Q6QA 4LVGA 3UXDA 2DGAA 3G8RA 4WOQA 3UZYA 3OIXA 1FFQA 2DT0A 4ZGYA 4JKLA 2F6XA 2BODX 3CZ8A 4J3TA 5D02A 2XZ9A 2XN1A 5AC4A 3N29A 1MW3A 2WM0A 1SJCA 3W2NA 3AYSA 3AALA 1XUZA 3B0YA 1NFGA 4Q6XA 3THQA 1CTNA 1XX1A 2ZXBA 3DFOA 4ZQOA 4QLJA 1JGMA 2W9MA 2F6UA 3KRUA 4HMDA 5LKYA 3IJLA 1FWWA 1C8YA 1RCQA 4I9MA 4M0XA 2WCGA 4O4VA 2PB1A 1SZGA 3LS9A 1JAEA 3WY1A 1NEYA 3O06A 4AHOA 4FOUA 2WVTA 1QNVA 4F79A 1TV5A 2QJNA 3PP7A 4YPJA 1LP6A 3C4UA 3S1GA 1DHPA 5HNUA 2E5BA 3WBEA 1F3WA 1VFOA 4GQRA 3IUDA 4G7EB 3VILA 3WF3A 4K38A 4WIWA 1Z48A 5AC8A 1J79A 2GL5A 1Q13A 1G67A 1SSGA 1XPYA 2PDIA 3NDYA 4PYSA 3HG5A 4B5NA 2Z2UA 4GI4A 2Q01A 5A8OA 2QS8A 1OFBA 1OWQA 1IZCA 3LZ3A 4DHGA 4HQVA 4YIWA 3QOMA 4MWAB 1XYCA 2OSYA 3MI6A 1K8ZA 3HFYA 6ALDA 4UFJA 3W7JA 1XFCA 2X1RA 3BLFA 3VNMA 4WR3A 2D2GA 1TTPA 1SW7A 3VA8A 2DFAA 3LYEA 3IJ6A 2ISFA 3U4FA 3RX3A 3S83A 4JFWA 1RVKA 3WQ6A 1UKPA 3AO0A 1CWYA 1IWPA 3B8TA 1UYQA 3GNPA 2J9ZA 2HCVA 1VS1A 3MKVA 2ZXAA 4QDWA 1WKEA 5BXPA 1SZEA 4J2PA 2FTWA 4W8AA 4LF2A 3BMWA 1W5QA 2VOTA 1UQYA 5AZ0A 3W7EA 3NYDA 4MWAC 1TPB1 4Y9PA 1LTDA 2Z1KA 1A5KC 1YQ2A 4GXPA 4B90A 3F2DA 3P8IA 3MZNA 2VZOA 3LTSA 5DO8A 2VOMA 5I00A 3W29A 3TYZA 5C70A 4FXSA 5LNWA 1XW8A 3R10A 4H9VA 4UR7A 3FCPA 1QPQA 4C6QA 5CLTA 4PMUA 4W7UA 1S2CA 4WRHA 4ZVJA 3R94A 1W9BM 4QJ1A 3SRFA 3I7QA 3WFZA 4AHPA 1XIFA 3BGGA 3GO2A 5C2CA 3BAWA 2XTKA 3FY1A 4PBEA 4XTDA 1GUVA 4O0QA 1NWUA 3VOIA 1B30A 4ADSA 1W9XA 4J5NA 3VU2A 3FVMA 3OG2A 3LERA 2WO5A 2ZC8A 3EB3A 1W9UA 1Z69A 1A50A 4CQDA 1U22A 1YHTA 4NNAA 3TP4A 3A4AA 7REQB 1P0EA 2Y88A 2ZKMX 1O5KA 1M7XA 2CHNA 1MW1A 4GUFA 3LCIA 3FS2A 1RZMA 4PEEA 4I90A 3NSXA 2DSUA 1R5YA 2RKXA 1B1YA 3A12A 1Y5VA 3UA3A 3SSZA 2OT0A 3G1SA 2HQAA 1IT0A 1A3HA 3PUOA 3QF0A 1CNVA 1O60A 5M3WA 1QAPA 4G9PA 3O05A 3ONBA 1PDYA 2D0HA 3L4XA 1PKNA 4GO9A 3NZ1A 3WLSA 3ARYA 4F40A 1OC6A 1TVLA 4Q7NA 3OGRA 5IHSA 1BG4A 4YTTA 3H7RA 4DM1A 2Q8ZA 1OGBA 2VJXA 1XH0A 1SMDA 5SWUA 2H8ZA 1UJPA 2PWUA 1OZQA 1TELA 5FJTA 1TV8A 1VLWA 3VE7A 2GJXB 4L1XA 5TBOA 2HS6A 5I79A 3M0VA 3W53A 3VD4A 3F7JA 4CN4A 4IX0A 1PZ1A 2PLJA 2NQLA 3PNZA 1VENA 1TSIA 4N42A 2IQDA 5AKQA 4REQB 5EMUA 3A13A 1ITQA 1W56A 4FNSA 3BAXA 4B91A 1KFCA 4OOUA 1O66A 1I2QA 1C8QA 4CU6A 4XZ9A 4QM1A 1E0TA 3GFZA 5AN7A 5T9CE 1BF6A 3GXDA 1F74A 1U5HA 5E0FA 2QJJA 2ZC1A 4ATDA 4KCUA 4KCVA 3BZJA 4GVGA 4PUMA 2J78A 4WSJA 3N19B 4C6OA 3SCVA 2X40A 4EAYA 2Y7FA 1C9DA 2R1KA 1ZP4A 3TYAA 3AU6A 2A6LA 2F6KA 4PMOA 4O1AA 3K30A 3NG3A 1Q6DA 5H6HA 3QSRA 3VPLA 3IJ8A 1OY0A 2KX9A 3H4WA 2QF7A 4FNTA 3B9OA 3BVJA 4HPJA 4IP4A 1LG1A 4IICA 3BCDA 3O7UA 5CH9A 2YL9A 4AD4A 3WLKX 4W88A 4GI8A 4I8YA 1E55A 2OO6A 2ALDA 3G1DA 1HKVA 3W7CA 5RUBA 2WV8A 1TX2A 2Z6JA 3EWCA 2ZZ7A 4DIAA 4C1NB 5AHMA 3VZZA 1VJIA 2GGJA 5AYYA 2DPEA 1G4SA 3WJXA 1JRBA 1D3HA 3HU7A 4HBKA 4CNOA 3RK8A 3EWWA 4ZA0A 4MJ2A 4D2JA 3VOCA 4Q4PA 1PTAA 3GM8A 1IEXA 1OX6A 3V75A 1AW2A 3IIVA 4F9JA 1ZENA 1B4EA 4RE3A 1VBGA 3I4EA 2YW4A 3PSVA 3NQMA 2HPIA 3NEHA 2PEVA 1YPFA 1A5SA 3L7RA 5HMSA 3G77A 1E51A 4PUEA 3QSTA 1GHRA 3RUBL 2ZUTA 4JTSA 1DL3A 2XSXA 2OQYA 3GXTA 5FAGA 1YNQA 2WMFA 7PTDA 4FF5A 1HIZA 1S39A 4XKMA 2O4QA 5CBBA 2W4XA 2QCLA 3TU9A 3UBPC 3WLRA 1XR2A 5LZLA 5FF7A 2HNEA 1W5NA 1WBHA 1I45A 2V81A 5DCBA 3QEZA 3UR5A 1Y0EA 4X3ZA 3L65A 4BZYA 3ANUA 4AIEA 2GSEA 4G1KA 1P6WA 3C0JA 4HKPA 5E93A 4ES4A 1FWDC 4NZ4A 2VURA 4WY0F 3RDKA 1XLHA 3QBUA 3N14A 4ACZB 3WX7A 1VRDA 1U2YA 2WAGA 4BI5A 1H5VA 4XAPA 3AC0A 4P8WA 1EJVC 1E40A 3DCPA 5FESA 4JQ2A 1F61A 3EZ4A 2WZIA 3TV8A 4LCSA 4HPNA 3E0IA 1AQFA 4BWLC 3TOYA 1K8CA 4QG9A 3WMLA 3ZVHB 2XDFA 3UCCA 1PZ2A 3LPPA 1SPQA 3W26A 2WVVB 3W2KA 1WUFA 3ITVA 4XD6A 1UIPA 3RIKA 3EOEA 1LQAA 3N3TA 3FJLA 4ZFCA 1HP4A 2WM1A 2CKRA 2PWGA 5C0QA 1S1PA 4JIHA 4BF5A 4Z0SA 4I5UA 4PUNA 1Q65A 1XF0A 4JR5A 1Z42A 5XIMA 2BS9A 3JW7A 3DN5A 1JUKA 1DJHA 3IJIA 3DBPA 3TXVA 1RLCL 2ZUMA 3UG4A 1RUSA 5GNYA 3AZTA 1TV4A 1BD0A 3OA5A 4F0RA 2WZTA 2VR4A 3KEHA 1K6AA 3MKKA 2ACQA 1MNZA 2FHBA 4QE4A 2OQLA 3KFTA 4AVFA 4DNHA 1FWHC 4GE8A 4CNNA 1K03A 2X7VA 1QI0A 2WBGA 4JL2A 3U8GA 2VDHA 1GK8A 4L65A 3ZWTA 4U28A 1V6TA 4OV9A 2EPLX 1KW1A 5HK4A 3M5XA 1JPKA 4WUIA 3NNTA 3JUGA 3QN3A 3DHDA 5D04C 3ENLA 3WDRA 3FAXA 4K6AA 2R82A 4P7RA 4PCPA 4FR6A 3H2OA 1GPFA 1XC4A 4NZ3A 5CPMA 2GJRA 5K3VA 2VZUA 4IMCA 1BKHA 1P7TB 1GVOA 2QCEA 2YA1A 1OCNA 4JTKA 2IKIA 3UERA 3VE9A 4LFYA 4A3QA 3CV1A 4BA0A 4D6JA 4PBGA 3DHUA 4O11A 3POCA 1JAKA 4CN6A 1E6ZA 3N73A 1VCVA 3WL0A 4XKYA 1C7SA 1TPEA 3U9IA 4FP1A 4Y9MA 1W9VA 4AD1A 1G7UA 4L56A 4MF4A 3O9NA 2Q3OA 1SVDA 1X7IA 1G01A 3SGZA 2WK2A 4R7JA 1KQZA 2ZADA 1XLAA 1O5XA 5CCZA 3T1GA 3DI0A 1QPOA 2CEQA 5JUVA 3C2RA 4BY3A 4JTAA 1RCXB 3E3HA 3IJ9A 3ES8A 2PDXA 5I3DA 5EBUA 1WBJA 3VNYA 4UXDA 2P10A 1RJPA 3EKLA 3WH7A 4WY0A 3SN4A 1XUUA 5AC6A 4RPPA 3MI2A 2UWFA 2WNNA 3B9AA 3GDKA 2WJFA 1BVZA 3H7VA 4HTBA 4ZXLA 4L4PA 2C13A 3GZAA 5CKSA 3R8RA 1UR0A 5HJXA 2OODA 2XH4A 2VHLA 1RLDA 3SN0A 3W83A 3WK0A 1PHQA 3S4TA 1F73A 4MY9A 3TR2A 2YYUA 5I3KA 4OUIA 1FRBA 1MEHA 4S38A 4LUYA 4LRTA 3TAKA 1CYGA 3B9DA 3WQOA 2CZDA 1UOZA 3ZFHA 4I8DA 1KGXA 4QNEA 2B7QA 3EMZA 3GKFA 4L61A 1WPCA 2B7NA 3ABOA 2PLMA 1S2WA 1Q8AA 3VFCA 5LIYX 1YXCA 1GZJA 2Q6ZA 1W3IA 4MMWA 1WCGA 1UKOA 4PULA 4KMQA 1X38A 1TQXA 4DYKA 4ZB5A 5F1VA 3H2CA 3LLDA 3PZ9A 1Q6GA 4ZO8A 2Y70A 1OYAA 3EWUA 3MYOA 5L6UA 4DJEA 2C19A 3QZAA 1QFEA 2GZXA 3HFTA 3A3WA 1YRRA 2GDUA 3PZQA 1X1ZA 1SM9A 2WZHA 1QNRA 4DO4A 1H60A 3NQVA 1V3HA 1DJZA 1TPC1 4JTDA 2X16A 3CH0A 5E0CA 4HZ8A 3L2IA 4HYWA 3IAQA 3GDMA 3KHJA 4ALDA 1T7LA 3VIIA 1QI4A 5C9XA 1HQTA 1UZ4A 5IRPA 2YL6A 1ZBKA 3UG8A 2D2JA 4YTQA 1YTDA 4MPKA 5HA7A 2PPGA 5A8GA 5LSMA 4IIGA 2VMFA 3MDWA 4IZGA 1AJ0A 4JN8A 3HPSA 4NY2A 2ONEA 2NVCA 5AHFA 1XLJA 1NDZA 3UZ5A 3NCOA 3ZJ6A 4FZIA 2YLLA 1YNPA 1B3OA 2PU0A 3M0MA 4KFNA 4LSBA 3SY8A 2BVYA 1V0NA 2UV8G 1QCWA 3NSMA 3REQB 5A2BA 3SW6A 2EAWA 3WMCA 3H4XA 4LWWA 4C6FA 1DJGA 1RQHA 4N9CA 1BTMA 1E15A 3M16A 4UTJA 1EF3A 1E43A 4BEQA 2Y7GA 5IOBA 3BE7A 3WBWA 4M19A 1PTDA 2E5CA 4WJ8A 4JYEA 4CD8A 4RW3A 2NT0A 3RN6A 3W00A 2QV4A 2VP8A 4A3RA 1LRQA 4GD0A 3AXKA 3P7YA 4NVTA 3LBMA 3EOLA 5C9ZA 4DUWA 1SZRA 3IGXA 3EKZA 1XIJA 3U7BA 3IPWA 2GDQA 1JCMP 4D8AA 1J5TA 3FDKA 3S6DA 1EFZA 1ZBWA 2WYSA 3HJZA 5TNVA 1E56A 4CN1A 1G69A 1OGSA 4WDXA 1GVRA 3RLHA 3NPUA 1X39A 2CLOA 3V0UA 1BYAA 4H9XA 1E0VA 4JIEA 3PULA 2XWEA 4M81A 1VD6A 3SSJA 5CGMA 3WNPA 1UROA 3MANA 1HFBA 3M0HA 4DB7A 3WBAA 3KVMA 3WLHA 1UW9A 3LG3A 3AXMA 4FIRA 4TO8A 1WNOA 3BCFA 4US5D 2XFWA 2FKPA 3EX2A 3K46A 3B4UA 4YXGA 3IV8A 1O5QA 5PTDA 3EPOA 4GXWA 2QEZA 3A4WA 4HA0A 5CEWA 1GWJA 1R7OA 1PIFA 2BWGA 3JS3A 4X60A 2IQ0A 3W7MA 1KBKA 2V63A 4O1BA 1ZZMA 3QZ6A 2L5HA 1K9EA 3E12A 4NXKA 2XJ7A 4E8DA 3QFWA 3OP2A 3RCMA 3W71A 4IXHA 4GISA 3UVAA 1Z7AA 3SRHA 3UU0A 2VCBA 5GJPA 3SCPA 1M3UA 5KZDA 1PEZA 2PWFA 4H8NA 4TVUA 4RK8A 3TQKA 4L80A 1CBGA 2YCKX 1BWKA 1LWIA 2XIOA 4ZTXA 3MI3A 1I1WA 5DMLA 3GIQA 4HU3A 3NL5A 2WHMA 3H21A 1NQ6A 2HNHA 2JKEA 3RRAA 3RX2A 4A8NA 1DJYA 2DZVA 3KBNA 5ABHA 3KL5A 2G3NA 3GXMA 5LHEA 3PB0A 1I4NA 1YX1A 3OGSA 4G7EA 1IR1A 3F5JA 2OZ3A 2XIBA 4D6GA 3G6MA 2HZGA 4EX4A 1OGGA 3L12A 3BAKA 3URQA 3CAQA 1XBXA 2VDGA 4RUBA 5JBDA 2ZX8A 4ATWA 2BX7A 2NQ9A 2ZWZA 4MWAA 5I6SA 4W8BA 3WUGA 4AY7A 1QRQA 2PGFA 3UA4A 4AX6A 3AISA 2FPVA 4LB4A 2WKLA 4OUEA 2IKHA 4TX9A 1ECEA 2OQHA 3WH5A 3FGCB 4DBUA 1I0DA 2OB3A 3WNKA 1IIHA 2ACRA 4JTJA 3EBVA 2E6AA 1EUAA 3CM4A 1Q8JA 3HGOA 3IIZA 2XN2A 3ARZA 2PP1A 2J47A 4V27A 4G56A 4LPCA 2HROA 1EYEA 2REQB 3MQTA 3GZ3A 1UD6A 3KBJA 3NTYA 3E2VA 2A7NA 1HO4A 4C6EA 2J6XA 3MPGA 3O0FA 1PB0A 3S2CA 2VC5A 5CQ1A 1RY8A 4ML4A 3W24A 5K9CA 2QUVA 1GEHA 3HPAA 4V33A 4B5XA 2WCSA 2J74A 2ISVA 1D7KA 1A53A 3CZLA 2IXVA 1J0HA 2ATMA 2D0GA 3NQAA 4RV3A 1X6UA 3TJLA 2AL2A 4CCEA 3RHGA 1J9YA 4JICA 5EPDA 5AECA 2E4TA 1BEUA 1K7EA 3QHNA 3DGBA 4C6BA 4CQ9A 4FNUA 2VX5A 1FHLA 3DI1A 3ERPA 3FDGA 1T96A 1XD0A 4WKFA 1D9EA 4U2YA 2R14A 3CEPA 2VVSA 4MLJA 4R5EA 2XSAA 5JXQA 4H9TA 3QV6A 2XPKA 4W86A 5FF0A 1W5OA 1WDRA 4ERIA 3UXIA 2DZPA 7REQA 2PDUA 4EPKA 1VFUA 5LNVA 4GZEA 2BOGX 4FX7A 1K4HA 2D3NA 1GJWA 3NQDA 4O13A 3VMPA 5K4XA 2X2YA 3PZIA 4MKVA 3TYCA 4Y8FA 2X09A 1DHKA 5HNTA 2YZRA 4M1RA 3GXNA 1PSCA 3TEVA 2CWXA 3TN4A 3VVGA 3ITXA 6TIMA 4ZE5A 1CIUA 3IIXA 4EWND 3VIPA 3QFEA 1BYBA 3GW3A 3TTYA 5JVLA 3VI2A 1OQFA 3OIHA 1EEXA 1DJIA 4PMJA 3N9SA 4NILA 3GR8A 4HOZA 1E0UA 2DT2A 1UD4A 1OJXA 2ZCGA 3H7UA 4WGHA 4ORMA 3NDZA 4FIQA 3CH9A 1FKXA 1WZMA 3FKRA 3UJSA 2Z24A 1PPIA 4HOWA 3VM7A 2A85A 3MKCA 2ON3A 4LBRA 1W1A1 2GJXA 2Q02A 3PAJA 1NVMA 2UBPC 1OYCA 4E3TA 2J62A 3UXKA 5H8UA 1SMAA 3SCRA 1ZCCA 1UA7A 3W2JA 4IF2A 4XIMA 3ITTA 1UASA 4S3DA 2YDAA 2CXGA 2XSBA 2YCLB 4REQA 4ZOCA 3ATZA 3STFA 2YGYA 5EFFA 1WZAA 1H09A 4S3KA 4G2DA 2GUYA 1W9PA 5EBAA 1VQTA 1H7WA 5D32A 1W2VA 3CV6A 4TMCA 4XAFA 4O1CA 3BJFA 1GVEA 4OBRA 2F84A 3GNOA 1ONEA 1M6JA 4GX9A 1EJWC 2HVNA 3UYCA 1TR9A 2W3ZA 3BO9A 2WSYA 1SU5A 1GVFA 1F6KA 2V5LA 2QPXA 4FHAA 4FO4A 3AS1A 4EF9A 1XRVA 1BXBA 4P8XA 3TQ0A 3ZOAA 3VDBA 3UJEA 1X8CA 2G50A 3ARUA 1XGEA 2E1DA 3CWOX 3C2EA 2E09A 1VYSX 3TQPA 3W7KA 4GNKB 1Q85A 3AZSA 3J7HA 3QGKC 3U57A 3RO6A 4DZIA 4HK6A 4ROQA 4DX3A 3UWYA 2VX6A 1WYIA 2A2IA 1XIHA 4HCDA 2HXTA 2OOFA 4Y9NA 2ZWYA 1EDGA 3N9RA 1LYXA 3T9PA 4HK7A 3M0ZA 2DJLA 3PWGA 3KDOA 3C56A 4ZB2A 4D6IA 4X63A 4EANA 5B7ZA 4Z17A 4UUIA 1AW1A 3PPCA 4MDOA 4WVXA 4C1NA 1QNQA 3QXBA 3GTXA 3PJUA 4GI9A 4MYXA 4R88A 3EDEA 1XC6A 2ZE3A 2WSQA 1ME8A 1RPXA 2XM2A 4RL3A 4GBDA 5LNRA 1DIDA 3AIQA 1SGJA 3TCEA 4LVBA 2V2HA 1N7KA 2QDGA 1DVJA 1NDWA 3WG6A 4HNLA 3EOOA 1K9FA 3GU1A 1UD5A 3O63A 5CC3A 3CUIA 3TTQA 3TJXA 3WF0A 4HA4A 3W86A 5BOOA 4JHOA 3KP1A 3VDAA 3STGA 4AIBA 4KIRA 1V08A 3PG8A 2BGSA 4P7QA 3VNZA 1PTGA 2Y8UA 2FYMA 1NAL1 1Q7MA 1R2SA 4F8XA 1EUNA 3QV8A 3TE9A 3Q4DA 1UWQA 1V79A 4U3CA 4KWSA 4BWLA 4DVOA 1JYXA 3A22A 1HVXA 2WJZA 5AFDA 2P3ZA 4PUJA 1UKQA 3FEQA 5A5WA 1AK5A 2ODOA 4QEEA 1C9WA 2FMOA 1MZRA 3I3BA 3IS4A 3VKAA 4ACZA 1JZ5A 1CGWA 3BLPX 3M0KA 4DNMA 2PDMA 1UMYA 4GYKA 1YXDA 5D2TA 2G96A 3S6TA 1ISYA 3AXXA 4K7YA 1KRMA 2X05A 5BXRA 3ZVHA 2B7OA 3D0CA 5DY3A 3CIWA 4Y90A 5FJUA 1A5MC 1FWEC 3F4CA 3PF3A 5JIWA 2WVVA 1GQNA 1JZ2A 3R79A 3G1RA 5CGTA 2E5DA 3WJZA 1W8GA 3EA3A 2GQ3A 2BZNA 4C60A 1J2BA 1IT7A 3K4DA 1N8IA 4US5A 4HK5A 3H12A 2WQDA 1RBLA 2NQJA 3EEGA 4O53A 5I23A 3I3DA 3QQ1A 1RBOB 2BHZA 2I14A 1FWTA 1LT7A 1B3WA 3VNIA 4DJDC 2ZIDA 2OGYA 2WMJA 4GABA 4S2BA 3PZOA 4CD6A 1TQJA 3HQNA 3MBFA 3PC0A 1ODUA 2BDQA 2YW3A 3TYBA 3CZKA 3CO4A 1F4HA 4PBFA 1H3GA 3BW2A 1ZHAA 3EPMA 1FKWA 3LEPA 1KFEA 1DKWA 3B0PA 3WF4A 4MY8A 3PANA 3THDA 3MMTA 4GO8A 2CZFA 1YYAA 4DELA 4JYFA 3CUXA 5C8BB 4M29A 3PHAA 1LT8A 1B3XA 3GR7A 1M5WA 4ROPA 2PUZA 3B8IA 1DIEA 1MQQA 1EIXA 3SJNA 4QSFA 1QW7A 2F8QA 2QQ6A 1XRSA 3HA1A 4LBUA 1BQGA 1GEQA 3EA2A 3PSWA 3QH2A 2YBTA 2Y7EA 3LQLA 1P7TA 5AYXA 5REQB 1FFRA 5AHNA 4AVNA 1ZJHA 3C52A 3QYSA 4NP7A 1W1PA 1UWUA 3A5FA 1G7VA 2GSHA 4GX8A 1GORA 3FW6A 4E8GA 4DYJA 2VFFA 2B7PA 3BARA 1U83A 4N4QA 4ZOEA 2O55A 4LS0A 5CG7A 3IV3A 4DXVA 4MKNA 2VFDA 1ODZA 3EDKA 4I9JA 8RUCA 1NDYA 2VC9A 1WA3A 1CENA 3IGUA 2FJUB 3TTOA 1A5LC 1E6SM 3L4UA 4LOCA 1QHZA 2GGHA 2O9TA 2PDQA 4MNLA 2WC4A 1CLVA 5FSDC 1ZAIA 4RNIA 3AWOA 1EPVA 2EKCA 3VKBA 4EXBA 3ZJ8A 2J4GA 3L4YA 3ARPA 5C55A 4J3XA 1FP9A 2WHJA 3VUPA 3S9ZA 1OD0A 3UW6A 3AROA 3NYZA 3LTYA 3UCQA 1QHPA 3FAWA 4Q4QA 1OC5A 3NPXA 1H49A 1K3UA 3G8EA 3WDHA 4YVPA 1JF6A 1NWRA 2CPUA 4O19A 4PRTA 2OSXA 2TMDA 5A69A 3CL6A 4UQBA 4RNJA 4O10A 5C6MA 4Y2WA 4PSPA 1O7AA 1S2TA 3AIWA 3EWXA 1FH9A 4EOUA 2V5KA 4KCWA 3WD0A 2C14A 1NJJA 5DT5A 2JEQA 3CNYA 4OBSA 1TE1A 3ZM8A 2DQWA 2VEPA 5XINA 4FR1A 2J7EA 4MFDA 1T8QA 2WXDM 4K7VA 1GOXA 3NZQA 1Q63A 1VF8A 1F3XA 3GD6A 3LXAA 3NQ6A 5T26A 6XIAA 3M0JA 4PMYA 1JNEA 1TWWA 3RAOA 2PRHA 4X0NA 3GFYA 1CX9A 3M7WA 3MY9A 2EHHA 3W7NA 2J75A 3CJPA 3A47A 2PLCA 4PGLA 2FFIA 4GNJA 5DCEA 4Z2JA 3GVVA 4GZIA 4DF1A 1CGVA 4DO5A 3N11A 1ISWA 5GJMA 1XISA 1RH9A 3WK3A 1E1CB 3S5NA 2QDDA 5CAHA 1H0IA 2R6OA 1YE6A 3TONA 4LVDA 4FXFA 2DZTA 4PUKA 1P6BA 5G4WA 4XZWA 3MB9A 4NJIA 3ZSSA 3W72A 4J40A 1W6TA 3EWYA 4HJFA 5LNUA 2WZMA 1P1XA 2BY2A 3TROA 3KS6A 4U33A 2PS2A 3WQEA 2CZEA 1A3XA 3RMEA 1H1NA 3K1DA 2PGRA 1X96A 3HIJA 4O52A 4M3PA 2A3EA 5CPLA 1GQKA 1L6YA 3IGSA 3WDQA 1Q4WA 1GOQA 1KLZA 1ZU8A 4IMEA 4R7WA 4GCXA 3O16A 4GI6A 2QCHA 2CITA 1KM6A 2Z25A 5BZAA 2R1NA 1DWJM 5BU6A 1V0LA 2FMNA 3T0TA 2E6YA 3O6AA 4UZUA 5A6JA 3BQ6A 5CJNA 4PFHA 4YHGA 1OABA 1R3TA 4X0VA 1EXPA 3S46A 1NH6A 4ZQNA 3DC0A 5JQ9A 1XRTA 3REQA 2VD9A 1E6PA 3C2OA 2E3ZA 2G0WA 4O1FA 1L2QA 2WSPA 5G2IA 2ZVIA 1TTIA 5BMWA 1VJSA 4GQ0A 4F9DA 3VINA 3B03A 4Q4KA 2JEPA 1ZY9A 1F6YA 1SJDA 2RAGA 2ACSA 5HQLA 2QF8A 3GKAA 1OFAA 3UJ2A 3RYSA 4GPNA 2PD9A 2V5BA 1O95A 3N13A 1A5CA 4W5ZA 4QG6A 4AD3A 3NGJA 1HN1A 3DAQA 2GWGA 1Q6RA 2XWDA 3CQHA 3JVAA 5DY2A 4RCXA 4RZ6A 3HGJA 1K4GA 3QPYA 2MUCA 1IYXA 5HUOA 3IANA 2OFJA 4DJDD 1BXCA 2X1UA 4A05A 1FWFC 1HTIA 4OQVA 4ZFMA 3E96A 4HZMA 1S5VA 3WFAA 3I4KA 3W7DA 1CXLA 1TJRA 5HUPA 1O12A 2WW5A 5A8QA 4XB3A 4ASTA 5FF3A 1JZ4A 1FCUA 3KS5A 2B81A 3QPZA 1KM5A 2I5IA 1BFNA 3I10A 1JCLA 2UY3A 2WLYA 4UTLA 3TW7A 4YVVA 3GUWA 3NVTA 2ZUNA 3UWEA 2C0HA 2NQHA 5GQBA 1PBGA 1QXLA 1C92A 3UQNA 1G5AA 3LX9A 3SGUA 5JBEA 3LOTA 3PNUA 3A3XA 3UJFA 3AMCA 1N55A 4EAMA 3AIUA 1WE5A 3BW4A 1J01A 1IEQA 1OT2A 5I2UA 4S3GA 1KWKA 1JYWA 5FL1A 1N8FA 3E74A 3S1VA 5AVHA 3HMJG 3VZYA 3PY2A 4CCZA 1CECA 3PS7A 1TRIA 3I7RA 1US0A 1TWIA 3S1UA 3WJSA 3GC5A 1QW8A 1I6NA 2VR2A 2VEMA 5A8NA 2GK1B 3HO8A 3VAVA 1FX6A 4XD3A 3LGEA 4BQ3A 3LCGA 3DH7A 2DZWA 3AYVA 4JQ3A 4S3CA 5HDRA 3NZPA 1FVPA 3E2RA 4LT9A 4FAMA 2YX0A 4C6CA 4JTFA 3ISIX 4Z1CA 3F2BA 4LUTB 4ML9A 3DEQA 3LV5A 2GVGA 1KGUA 4Q8MA 3OLIA 1GYLA 2NLIA 1KKRA 3NEVA 3M43A 2WC3A 4XD4A 2O7SA 4Q7IA 2NWRA 4HMNA 5HINA 1HL9A 2FB2A 4K8GA 2I57A 4Z2IA 1TREA 3BICA 2XISA 2XU2A 3SI9A 3N3MA 1GQJA 3G18A 1H1YA 1HVQA 3WZ0E 3DHFA 4LVFA 4A6GA 4IPJA 3W6YA 3CUZA 2XVPA 1JJKA 1K7FA 4AISA 1RA5A 5JMUA 1WDPA 3U2EA 2PZNA 2QJGA 4WHBA 5B80A 1UMLA 3O6DA 2GUBA 3SUSA 3CGTA 3PWIA 3ABZA 3LU2A 4I7WA 4BQ4A 4DF2A 2C7FA 3MA8A 3GVGA 1UWIA 2ZRWA 2REQA 3M9YA 1G4TA 4JZ5A 3NQ8A 2TODA 1E5JA 3RG6A 5ENLA 2OWCA 2OVLA 3MHGA 4MTVA 1OFQA 5XIAA 5HWJA 4E3VA 2PCQA 3ZR4A 1JZ3A 4HT3A 2NT1A 4OWGA 5A94A 5CSYA 4QGCA 3WQWA 4Z1AA 5TIMA 1V0MA 2G5WA 1NFPA 1R3VA 4IMDA 5FEZA 4ADUA 4PB5A 4I5XA 1ZL1A 5D9PA 3PBGA 1I2OA 4QE1A 4Y7EA 2DZBA 3R0UA 3DFNA 3L0GA 4K2SA 1L8PA 1E73M 2OO0A 2Y5SA 3LZ5A 1WXJA 3G6LA 1KCLA 2Z27A 3O6YX 4BFAA 5FOOA 5C9WA 3LUTA 1XIGA 4AWSA 3WLJA 3E5BA 5C54A 4NYYA 1SW0A 1KCZA 2EF9A 4QEHA 1QU4A 1FDYA 4OZOA 4W8LA 1CT5A 3OVPA 1TVNA 1TPVA 4JTIA 4YYCA 3OB8A 4YWIA 4P2VA 3KBSA 4GQGA 3B97A 2FVKA 1E3ZA 4IIDA 1XLIA 2F61A 1XYZA 1OIMA 1LM1A 4PUWA 3QR3A 4IMFA 3TZFA 3G1HA 2PDLA 2R1LA 1QPKA 1GYNA 4C6DA 3VIKA 3G1YA 3PTQA 4M7TA 4UTTC 3FOKA 3FJ4A 3CZJA 2FTYA 1VEOA 4L9XA 2BG5A 2J27A 4YN5A 4P7LA 1XYAA 2VX4A 1Z3NA 3HM7A 1XINA 4Q8VA 4GVHA 2YL5A 4AXNA 3LD5A 3IVTA 2VKZG 3WF2A 4GGHA 3WQPA 5K9DA 2YCLA 5E5CA 5E70A 2HJPA 1Y8BA 1FWCC 1W3LA 2OYLA 2XGZA 1GKQA 1WKYA 1DWAM 3BJTA 2H3BA 1J12A 2WKJA 4BHYA 2I5GA 2ZXDA 3S2NA 3DESA 4X61A 4XO6A 1B54A 7TIMA 3DFPA 4YTUA 4UMBA 2Z1WA 4P7OA 5EL1A 5LNSA 3TQVA 3GTHA 5CLWA 2X0HA 1L6GA 4LB3A 4WGXA 4WKHA 3QVQA 1C7TA 3W7GA 1AJ2A 3HMCA 2EPOA 2NXGA 4KRTA 2DZSA 3SM0A 3GG8A 1YTEA 3HN3A 1XWYA 4E4PA 5CAKA 3QM3A 1JCXA 4RR4A 2OMAA 3DG3A 1R3YA 4MY1A 1XSIA 2BXZA 5C2XA 1Z32X 1ME9A 5FL0A 1JDFA 3NWRA 3MSRA 1QBAA 1EO5A 1WOAA 4QTGA 1XGZA 2NX1A 4MB1A 4TX8A 2IPGA 1Z6KA 4KGLA 3QGVA 4X22A 6ENLA 4CVWA 2G8ZA 4NG3A 1MMFA 2BSLA 3VTRA 4HPGA 4LC8A 1HL8A 4FLOA 2V38A 1K77A 5DX7A 3IUHA 4YLWA 1ONXA 2ZX5A 1WP6A 3QC3A 1IQ8A 2Z00A 2H9AB 5TF0A 4O0ZA 1CLKA 1VP5A 1XI3A 1X1OA 3ANYA 1JDAA 4CCCA 4HN8A 4W87A 1M68A 3GH4A 1BF2A 3EB4A 3QW3A 1EZ2A 1WUEA 4QHRA 4D6DA 2CKSA 1RA0A 1IHIA 3VNLA 4LW7A 4E2DA 2RHGA 5DRCA 4UFMA 3D5HA 3ZXWA 5I3JA 4I9TA 4BK9A 2D1ZA 2Y5JA 1Q6LA 1XYLA 3C3UA 2CETA 1A80A 2WVSA 1KFLA 2QPSA 3N2OA 4Z42C 5E0KA 1HW6A 3M0XA 1O6IA 3ARQA 3L4WA 2E67A 2VYOA 3LCFA 2NUWA 4JX4A 4IIBA 1PCWA 3MO4A 3BSGA 4UC5A 3VNJA 2QJHA 3MVIA 4YYFA 2HK1A 4EPDC 4UQCA 3BURA 1XYBA 2Z26A 2D69A 2CLIA 3HV8A 1J93A 3RPTA 3LPFA 4J3SA 4BI7A 2GWNA 3S42A 4ZZ9A 2YJQA 2QGYA 4RZ5A 3FN9A 2XIQA 3HV9A 1O1ZA 1ZSXA 3E5PA 3RCYA 4C7GA 3IAPA 1V03A 2NSOA 2P76A 5A95A 4DUXA 2RFGA 3LNPA 3KP0A 4K39A 3P6LA 1RJRA 5IFPA 4ILSA 4PMVA 1LLZA 3IK2A 1S5TA 4AMCA 2YZ5A 1RP8A 3GXIA 1M9HA 3BPWA 2YPIA 3E0FA 4POCA 3VABA 2UZ9A 2E6FA 5U7SA 1US3A 3FV9A 3HPXA 2PDCA 1GQIA 4TMBA 2Z2AA 3W70A 3UXAA 3SBFA 4DJDA 1SFLA 1E3XA 2I9UA 1WAUA 2YOCA 1HZYA 5D9OA 4LNYA 3QV9A 1UH2A 4KW2A 1DJWA 2HTMA 4RKAA 2Z1XA 4DZAA 2HK0A 1TUXA 4J3WA 1H4PA 1A47A 2FH6A 3AXIA 4Q4SA 5D8WA 3JU2A 2DIJA 2ZZ4A 5KZMA 3DG7A 1KCKA 2A4AA 4GG9A 1E4IA 3STEA 4IPPA 4DBSA 1ZUAX 2VM8A 3APTA 1X7FA 3C8FA 1KTBA 4FNRA 4PODA 2H3DA 2W61A 4AZBA 2DIEA 3QLLA 3AUOA 4BCEA 2PC8A 4IGHA 4LALA 3CZGA 2Q71A 2CLLA 3P5YA 4RNHA 4PH6A 3R58A 1X98A 4H41A 3GAKA 2XFRA 2VT0A 3D47A 3DYOA 2OX4A 4NJGA 1YLVA 1YBQB 4ECLA 1UUMA 3C2FA 3B3DA 2ISDA 4KWWA 1JUEA 2V5CA 4MJZA 3W7HA 3LI0A 5CZTA 3V5OA 1VPQA 2YA2A 4TQTA 4JN6A 4LX4A 4HZ6A 1IEVA 1KBJA 4Y9OA 4C5YA 5H8PA 4PA8A 4MLRA 4PCSA 2G95A 2J25A 2IPWA 3H2AA 2BASA 4ATLA 1MSSA 1FCQA 2ZTKA 3DKLA 1QW9A 4R27A 4S3BA 1UD3A 5REQA 3UGRA 2PDFA 1MW0A 3IARA 4GVIA 3FIGA 3B8UA 3WK1A 2DSKA 1W1TA 3KCOA 3GG1A 1W17A 2O9OA 1EJSC 4ADTA 3N6HA 4NZJA 3OLEA 4UFHA 1TRDA 5KZEA 1KRCC 1BPLB 4IT1A 1W0MA 4LUIA 4AIUA 3TVAA 3MT1A 3W1MA 4O50A 2PBGA 4IFOA 3VXGA 2HBVA 5I78A 4TX6A 2CBVA 1SO4A 1RD6A 3W1NA 1O1HA 1VEPA 4L9YA 4TOQA 4FF7A 1SQ7A 2YXGA 1BAGA 1VBUA 2YSWA 3SO7A 3RO8A 2HVOA 3GW0A 4IJRA 2RDTA 1R2TA 1OM0A 3EXSA 3WDJA 3BH4A 3S2JA 3WLPA 4GRSA 1UHVA 5FI8A 1YE4A 4KEUA 3DFHA 1MRAA 1Q6EA 1R30A 3MVTA 3D3FA 2X1IA 8TIMA 1JEZA 1LROA 3VKKA 2VZVA 2PZ0A 2DU2A 3BW3A 1OCJA 3YPIA 4GZJA 1XCXA 1KM4A 3PBMA 4N9EA 1WXYA 1XLGA 3BXWA 5D33A 1J0ZA 2JK2A 2POTA 4WDUA 2OELA 3T09A 4ZODA 3AICA 1XJBA 3TJIA 4ZO7A 4M6UA 3LXBA 1FH7A 3GFXA 4B16A 3VMOA 4E2BA 3V3WA 1QDSA 1V3JA 3G2GA 4XIAA 5AZ1A 1IIGA 1NARA 4MADA 4NUWA 3W9ZA 3CQJA 5J5DA 1QMLA 3G5EA 5LA1A 2YCJA 1O94A 4J3UA 4HCHA 4ZL1A 4DAIA 5KSWA 3QY7A 3WNLA 2VXNA 1W1IE 1MUWA 1LLOA 3A5VA 3MWCA 4KEVA 1E1CA 4O0KA 5F2IA 3BG5A 4HMEA 3CL8A 4NZFA 1JIBA 4GQQA 1OCBA 3SY5A 3M64A 4JQ1A 3NIYA 1L0PA 1WDQA 3RMJA 3CLMA 3T7VA 4F48A 2ZZ5A 2XZ7A 4IWWA 2SFPA 4A2SA 4PUUA 3RILA 3CZEA 4A8RA 2OKTA 1WQ5A 4YL2A 4F0MA 1ISXA 1UC4A 4JFUA 2NUXA 5BU9A 1TJ1A 3W74A 4PL2A 2JIWA 2C6QA 1UD2A 2QUTA 3U7VA 3AWNA 1QNPA 3RU6A 2EG8A 4CUCA 4D72A 1MXSA 4QS6A 3Q2DA 1HJUA 3ZLHA 3G1FA 2OKOA 3B8DA 3CHEA 3KCLA 3JR2A 5DELA 2IPJA 3ITYA 4UTKA 1B90A 1PZ3A 1SFTA 3UPBA 4WOZA 1EBHA 4H6RA 2WB5A 5CPSA 1G94A 4E2OA 2A3HA 3MBDA 2D20A 2QNEA 4TXEA 4F2TA 3CIVA 4BKNA 3T0AA 4LAMA 4HJWA 1EJXC 4M6QA 1WZKA 1E71M 2FVLA 2WANA 3R13A 1E5NA 3VX0A 4DBDA 4OOZA 3BOXA 4W7WA 2QT3A 3MUZ1 3W7IA 3HTWA 3VD5A 1GVQA 1JGIA 1KFWA 4HOXA 3N2XA 1S5WA 3MSYA 3PFMA 1R46A 2NV9A 3BQ5A 5FEXA 5F2GA 4P8VA 2V0TA 3UR8A 5IFTA 1PAMA 1JRCA 5IM51 4ZMGA 4Z1YA 4DRSA 3PJWA 4Z2GA 1HKWA 4J35A 4PFMA 2JF7A 4R85A 3WDPP 1DJNA 4QJ3B 3QMTA 5A6KA 2VGFA 1QT1A 5LA2A 2BHYA 1PX4A 2OZ8A 3BTNA 1DXEA 3CPUA 2VGGA 5HMFA 4MUPA 5HNNA 1MEIA 4HYRA 3LLFA 2VWSA 3E0VA 5D2XA 3UZZA 3MYPA 1TKKA 3NQFA 3R6IA 4F0KA 4E2VA 3S1XA 2XINA 4HU0A 3IIPA 2V67A 3W2UA 4JCMA 3VGBA 3TC6A 3A6OA 1J5SA 2CW6A 1ADSA 1SJBA 4GH3A 3W1RA 2C3ZA 2JIEA 3N4EA 3GLCA 4JFVA 4XUYA 3FYOA 2C0AA 3O0KA 3BSHA 3ITOA 2OGJA 4JTLA 3QKZA 1Q4NX 3MMDA 4UQEA 3UR7A 1IF2A 3HQPA 3QW4B 1M7OA 1E4NA 3KRBA 4JIPA 3DOPA 1AJZA 3W25A 3WLTA 2VNCA 4JTRA 4MFEA 1GOOA 4LC6A 1B2YA 5ECUA 1FCVA 4BF7A 1XYFA 4H83A 2ICSA 1SZFA 1GJUA 3LI1A 1R0MA 3K8LA 1HJQA 4Z2KA 1NU5A 2OT1A 2OXNA 1QVBA 4H9UA 3SCQA 5K4ZA 6XIMA 3KE0A 1B5TA 1KC7A 3FFSA 1NP2A 1G6CA 1PX8A 4HNOA 1BRLA 1LWJA 3P14A 3TWAA 3A23A 1IZKA 2GK1A 5E9AA 1Q2RA 3GNXA 3WBXA 1VFMA 3QR1A 1FWSA 4X9SA 4AX7A 4GFSA 1KM1A 2BXYA 1HP5A 4PZVA 1D7FA 1TMHA 1XPGA 3NUKA 3FSUA 5L9FA 3MC5A 4LUTA 5D30A 4ENLA 3VNKA 1QWGA 2VQUA 1GGOA 2R94A 1KM2A 3CMGA 1YDVA 2J24A 4GIYA 3AMKA 1Q6CA 1B9BA 1FWNA 1KCXA 2R1MA 4KS0A 3W6LA 1DXFA 3VKDA 5E6ZA 3IACA 2VC7A 3B05A 2J9YA 5AHEA 5D05A 4U10A 2BB0A 2QLYA 1F76A 1DWHM 1ICQA 5A6LA 3CC1A 4IM4A 4H8UA 3TLQA 3GXFA 3CO8A 4E38A 4H6KA 1LL6A 5CZJA 4S39A 1JYVA 3ES7A 4DM2A 4TV6A 3KTCA 2Z29A 2TYSA 1L2UA 4Q7BA 2AKZA 2J8GA 3PZNA 3TNOA 5MKGB 4FALA 4J27A 1Z41A 1VH7A 3URBA 3OEXA 4B5UA 3UCDA 1TWDA 2AMXA 5HR7A 4D1IA 2B0MA 3TSBA 1H2JA 4ERGA 4XBSA 1VPYA 4LTSA 4G7FA 1MEWA 1W3KA 3MWAA 1JQXA 2OPJA 2VEIA 4JHZA 2PTXA 3HQ1A 3NQBA 3E1F1 1OX4B 5LHFA 5ABTA 3MSGA 4WLCA 5BROA 5HMDA 4A22A 1FDJA 3ITCA 4FPSA 1WX0A 1UC5A 5FAJA 3U3HA 1I75A 1S1RA 3EWZA 5I03A 1R3WA 5FA5A 3S47A 2E7FA 4RJEA 1XH2A 4LJ3A 3GIYA 4D1JA 3N6QA 1EBGA 1KXTA 1K1DA 3QJAA 4AYGA 1SYTA 4WSKA 5E9XA 4R9XA 3WLMA 4HVXA 3INPA 2QCMA 5BOEA 1UZDA 5FJIA 5IDZA 3G1AA 5KITA 4UTTA 2IXUA 3ZJ7A 2EG6A 4JIRA 2QUMA 4UQDA 3KXQA 1DPMA 2ATSA 2HMCA 3BUVA 1A5AA 4C6PA 3UWWA 4QDMA 4PMXA 4IFRA 3WKZA 4Z2LA 3AIVA 5A6SA 4UTHA 3PJTA 1XCWA 1ZCOA 1EQCA 1E72M 3WJYA 3RCNA 4CNSA 4HU8A 1C29A 4AZGA 5AOUA 3I6TA 2JBMA 1A4MA 3CWNA 5EU9A 3N25A 4IQEA 4GNVA 3M44A 3RF9A 1UWAA 4KGJA 3V18A 5EMMA 1JYNA 3RNDA 1FXPA 3P60A 2VFHA 4MB3A 4UMAA 4O8RA 4XBJA 5A6MA 3ZZ1A 3ICJA 4W9TA 2P3EA 4C91A 1UWRA 3W3OA 1RV8A 2RGLA 3LPOA 5AB3A 3EX1A 1R9ZA 2PCEA 3QMRA 3UPWA 1UP3A 3AIRA 3W1UA 4OBTA 3DX5A 1OF8A 1P5BA 2CLMA 1R47A 3SAZA 5HPOA 3QOKA 4S3AA 1RHCA 3BWWA 3FXYA 1ISVA 2AGKA 3XIMA 1UR8A 4H01A 4LYKA 2QVHA 3SUUA 4IIHA 3QV7A 3QYQA 1ZGDA 2CBUA 3MV01 3THAA 1H7PA 3IJQA 2CWNA 3ZYZA 2Y62A 3UNTA 5DT7A 2Y7DA 3GHSA 1N82A 1XLMA 1POKA 1PVNA 3UPMA 4WDWA 1XXXA 4XG1A 4RZ4A 3M5YA 1PUDA 1OYBA 3NURA 1AUSL 4MDPA 3WNNA 4PN2A 1KR0A 3PAOA 3PTMA 4XTIA 3WEZA 4AF0B 4IIEA 4B5TA 2DZUA 4KWOA 1DXIA 3GNNA 3QRHA 1CXIA 4H1ZA 1CXEA 1U5VA 2BBFA 3M0YA 4PTXA 3IVUA 1EF2A 4JAWA 3VD9A 1JNDA 1VPXA 3P67A 5F2MA 5M03A 4OIFA 4CQCA 1LDCA 5CZ0A 3ECQA 2YR1A 1PE1A 5HMEA 3ZLGA 4NKCA 3W7PA 2JFEX 2AAAA 4DPPA 5TAOA 5BOFA 1I2RA 5DMMA 5JBFA 5MF5A 3HQOA 2H9AA 1RALA 1D3GA 5LIUX 5DRIA 8A3HA 2QCCA 3HPZA 4M8UA 2ZQ0A 1GONA 3ATYA 4CD7A 1P6CA 4H9YA 1CW2A 1A4LA 3NQGA 4BEUA 6TAAA 5DLCA 1L6WA 4OECA 4JTGA 3TAOA 2GQAA 4ZR8A 5D9MA 3P74A 4KH2A 4NNBA 4G1NA 3VIHA 1GOWA 3P93A 4AWEA 1WOBA 1IEIA 2NW0A 1SO5A 2E8ZA 2W91A 4QDPA 4ZQRA 4WF7A 3EGJA 4EIVA 3E2SA 3ZR6A 3AFBA 4Z1BA 3W37A 4CQBA 5FKYA 2ZRUA 1S46A 4JGDA 4W5UA 5CC5A 2I1OA 4L4OA 1AVAA 3OZOA 1S2VA 1OINA 4JKKA 3R0KA 1O68A 3MJMA 3N1AA 1BGGA 1HG3A 5A2AA 3GVWA 1WKFA 5DQPA 4H7VA 2PDYA 3CEUA 1H62A 2NUYA 3RPDA 4YU1A 3O1NA 4S23A 4IUOA 2A3AA 2G3JA 1NELA 2XVNA 2Y6ZA 2C15A 4LNCA 3BAIA 3SCSA 1CI1A 2ISWA 3HG3A 1HUVA 1RAKA 4L7ZA 5I06A 4GA8A 1J2WA 4DUVA 4B3KA 1H1ZA 3KW3A 1OEPA 3SFWA 3L4VA 4E4FA 1CGYA 2W66A 3KAOA 3OBAA 4AUBA 3E02A 2FDMA 2X2GA 2XHYA 1GHSA 2P53A 1Q2SA 7TAAA 4UR9A 4XSMA 1QJWA 2FZ8A 1V5XA 3W1TA 4QQUA 2ZOXA 5CSRA 2DSZA 1SFSA 3ZSTA 2GOUA 3UJRA 4IIFA 4DAFA 1PZ0A 3CTTA 3B0UX 3F4DA 2IMRA 3EOSA 3LHYA 3DFSA 4FLSA 1FQ0A 3GSMA 1K02A 3BLDA 1XQLA 4LCRA 4UFKA 4U5IA 4GCAA 1KQYA 1PV8A 3FJNA 4L4MA 1WV2A 4I6KA 3AYRA 4MWAE 3OJGA 3WYZA 4ICNA 1CGUA 3S9IA 4QLKA 3VOJA 4H2CA 1NFBA 2MANA 3N34A 4XZNX 5CSSA 3CHCA 2V30A 2DEPA 3L2MA 4IUGA 3W1LA 4Q8WA 3VDCA 3FA4A 4GZ7A 4AY8A 1YKWA 4JTHA 3GY1A 1YBQA 1U1HA 3TW9A 3VC5A 1UB3A 3B8WA 1RD5A 2J8TA 2J7BA 1ITUA 4PMZA 1VFFA 1LRNA 4JFSA 1EDQA 3CMJA 4DZ5A 2Y89A 4BS0A 3GTNA 4XZLX 4K1GA 1EHAA 2A5HA 4O12A 4H9MA 3A4JA 3M4HA 1GT8A 1KA9F 3I6RA 2HE8A 4DO6A 2DT1A 2I5QA 2YB1A 5IBXC 2BGQA 2XG9A 3WLIA 4RLIA 3WLQA 4UNKA 4IG2B 1C91A 4G5DA 1KO0A 1NWSA 2GVLA 1SR9A 5DBUA 5CPOA 2YA0A 4JTCA 3VGDA 3PBUA 2EXOA 3JZEA 3PM6A 3BDKA 1SO3A 3N6JA 3PFRA 5I07A 1NSJA 3DFQA 1IWAA 4OGZA 2ZYFA 4P8UA 2CIPA 2QULA 1R9XA 5KTLA 1MYRA 3D6NA 4IGNA 3OLGA 4B3LA 4GJJA 3SR7A 2FHFA 1ADOA 4INFA 5D38A 4AH7A 1Y5XA 1EWDA 2HWGA 4NYUA 3AS0A 4Q4RA 2CU0A 2RDXA 4RE4A 3CUFA 1OT1A 1VKFA 3LV6A 4LGXA 1XSKA 2GGIA 3VD7A 4JNYA 4ZCWA 1GW9A 1LG2A 3SUWA 3RPMA 3PPGA 3VDGA 1E1EA 3G1VA 3LRLA 4JY8A 2VR5A 2Z7KA 3S6OA 5FD0A 2FZNA 4GBUA 1IV8A 1OIFA 2EEXA 3FSTA 3KZPA 3KX6A 3N17A 4WJEA 3DZ1A 5AHLA 3WQCA 2C1IA 1WZLA 4IP7A 3RR1A 2VENA 4M5PA 2OEKA 1TZ9A 3N2MA 1W5MA 4NNCA 3IUIA 1GPWA 1J96A 3HB9A 1BYDA 2A1YA 2J79A 1RY0A 4NZCA 3WQVA 3TW6A 1ZJAA 3SCOA 3LHUA 1Z89A 1PS9A 4AVOA 3S2MA 1OX5A 3EWDA 3U2CA 1M65A 3A9BA 2NQ5A 2BXVA 4GY1A 3MU7A 2FFCA 1VBRA 2FQIA 1EC9A 3TCSA 1UPMB 3W23A 1KV8A 3APGA 4J7RA 1Q45A 5CSUA 5D8ZA 4IL2A 2J8FA 4TU1A 4YS1A 4R3UA 1JR1A 3EEZA 4IISA 1JULA 4W84A 1JXKA 3W07A 1E6QM 1DV7A 3USZA 3LK6A 2QKFA 1P0KA 1XCFA 1VHNA 1XM3A 2CNCA 4CNTA 2EBNA 4GXMA 1M03A 3TYDA 1VR6A 2RDUA 2O4MA 4JBRA 1UUQA 3W6MA 1BGAA 1XKYA 4ONVA 4N9BA 5AC7A 2E1WA 1R8LA 5BWFA 1JCJA 1LZOA 3VKJA 1VEMA 2ABAA 2A3BA 4GFIA 3QY6A 4CVUA 2DDXA 1QPRA 4Y96A 2AKMA 5EMYA 5KINA 4QROA 4S3EA 1QHOA 2VRQA 4P5UA 3EOUA 3UG5A 3B40A 3GQYA 4EK7A 3CQ0A 5HATA 5D2YA 1F3TA 4DJEC 1XBZA 1XDMA 3HG4A 2Q09A 1H61A 4M56A 1DIKA 4UTFA 5CPNA 2YXXA 1EJ7L 1LRTA 1OFPA 3TIMA 3UWZA 3CK5A 4XAGA 3CLWA 3WDIA 3FXGA 2V69A 4Q8OA 5A6BD 4GGBA 3TR9A 3UT0A 1AG1O 1OVDA 4W4QA 2W5FA 3MZ2A 5HAOA 2JALA 3F4VA 4Q8UA 3UWUA 2HS8A 4MUZA 3H2NA 3LHWA 1UKTA 4NT0A 4N4PA 1WAWA 4DO7A 2OEJA 1J6OA 1RVGA 4HNCA 1X97A 3UP8A 4U3AA 3LB0A 3POHA 4FSAA 4GVFA 4UR8A 1H11A 5CG0A 4EVZA 5AVNA 5F4WA 1R86A 1JDDA 3NAVA 4U31A 3T81A 2BHUA 3ID7A 4K36A 5M5DA 4QP0A 4DI9A 3WIJA 3PTKA 2HV5A 3GTFA 1FWGC 3ITLA 2DQXA 2HDJA 4URIA 1HKIA 4GYJA 1AZ1A 3GDLA 4KT2A 4TR9A 3BV7A 1M01A 4AYSA 2NQZA 3UZJA 3ZT5A 1X1NA 5TQLA 1T0OA 1DWIM 4PTWA 4IFKB 3TYEA 1A5UA 4WCJA 2NZLA 4B15A 3NZRA 4GLEA 2HXUA 3GDBA 4FLQA 1DIOA 1WB0A 2WNZA 2OSWA 2OU4A 4UTMA 3CL7A 1K6WA 1VCFA 4JX6A 5AYZA 3AXHA 1PL9A 1NF0A 4DEFA 4JXCA 1E6XM 2H6RA 1G1YA 1FDZA 4PTNA 2ZTJA 3LBCA 3WNMA 3SQLA 1UD8A 1W1B1 3H23A 2XH0A 3LMYA 1A3WA 2E25A 1UUOA 3W27A 3W22A 1DQWA 2PD5A 5HJYA 5I3HA 1JVNA 4EXAA 5DF0A 3ME3A 4W89A 3MUY1 2JQXA 1AH3A 2UY2A 2XFFA 4EPBC 3H55A 4FS9A 2Z1VA 4P61A 3E6EA 3QKEA 3AJXA 4HA1A 1BLIA 3CUJA 5JH1A 3OZPA 3BOLA 3C0QA 1LBMA 2EPKX 4DF0A 3USBA 1F8MA 3MSDA 3VDHA 3QHOA 1JZ8A 2X8RA 1H7XA 5LGXA 3PUDA 5D37A 1C8VA 1UH3A 4LRSA 4D6CA 3ITGA 5HR6A 1EC8A 2PDNA 2DP3A 2J88A 4NZ1A 1H50A 1GTHA 4TV5A 1TIMA 4JDYA 4XZHA 1V6VA 1BHGA 1TFVA 3LCXA 4ACYA 3EDJA 2NSXA 3QQ0A 1PKMA 2TSYA 3E0LA 4D8ZA 4UWMA 1XQKA 4RDWA 4RNFA 2ZUSA 1W3HA 3M5VA 2BMBA 2NWSA 3NVDA 3MMWA 1KBLA 5A2CA 2AL1A 1XGDA 1QO2A 2I16A 4ZO6A 4H4IA 5DBTA 4UTWC 2IQTA 1TA3B 3OZMA 2V3FA 2YDQA 3THUA 4X9YA 4Q32A 3OLDA 3FNDA 2HSAA 1O5RA 4PEKA 1BSLA 1XICA 1F9CA 1A5NC 2VZSA 1QOPA 2X41A 3C61A 5J04A 3SCUA 2I17A 1ECQA 7CGTA 1I1XA 3W7RA 3RITA 2Z28A 1GOMA 3P0XA 4J9JA 2Y0FA 7ODCA 3GWQA 4TIMA 3W2LA 3NSNA 4E8CA 1V8EA 3OGVA 4KIEA 3BLIA 3AI0A 7A3HA 4C6NA 3T44A 4JL1A 1CXFA 1W37A 4PTDA 1V77A 3GC4A 2XIIA 5CXPA 3QPEA 4CLMA 4JDBA 4EE9A 5A3HA 4A8LA 2D2OA 4DWSB 1R9YA 3HURA 4ZTYA 3PZGA 5T8GA 2DSVA 5MKGA 3RLUA 3T2QA 2W6RA 4LV9A 3SCTA 4KQNA 5DFAA 4HSNA 2ACUA 1LORA 4R33A 1FWAC 4HNTA 3FLUA 4FOJA 5ABGA 1NQKA 3RR4A 2AL2B 3VCRA 3TN3A 2VEKA 3TXZA 3A4XA 1HO1A 1TV2A 4K1WA 4O1DA 1W1ZA 2EJ1A 1OX4A 5I02A 1KTNA 4KBXA 3ZQ9A 4N02A 1XLEA 4L4LA 3AIEA 1GOKA 1PJ9A 1QOQA 5I3GA 5F4XA 3WSUA 1EZWA 3HGRA 2OJPA 1T8XA 4O17A 5CZKA 5EGRA 3T2OA 3KL0A 3BSMA 4HP5A 4DWSC 3NQEA 1AH0A 4IHCA 1D8WA 1PWMA 4V28A 3BZGA 1SO6A 2QAPA 3F5KA 3DU0A 3TA9A 1UG6A 2OOGA 2R1PA 2PDBA 3I6EA 1E9IA 3L5MA 3L66A 4TTGA 4LYQA 2VD8A 2C1HA 4N9DA 4DJED 5H8MA 3V35A 4GJIA 2PRMA 1AD1A 3G3DA 5LIKX 3L67A 1K8YA 4NI3A 3AMDA 2PC4A 3H22A 4A35A 3KWXA 4GUGA 2W63A 5FJJA 1THFD 4AWTA 1T5AA 2Y61A 3OBKA 1KTCA 3VUSA 4IH3A 3M0IA 1AFSA 4QCFA 2V5JA 3W28A 3MCNA 1NWTA 4MG4A 4MM1A 4FEZA 2ZUWA 5H91A 3URNA 3LGGA 1B3VA 4AQLA 3LHTA 3UYIA 1R2RA 3A21A 1EQPA 3HGSA 4QR6A 4YCOA 4HGXA 3L0NA 1E4LA 4S3JA 3B8VA 1PO9A 1DWFM 3BG9A 2D22A 5U4NA 5T9BG 3WD2A 3S1WA 2YIHA 2GSJA 3WH8A 1JXJA 1W8SA 1TE6A 4JIQA 1RQEA 2QDHA 1RBAA 1UA3A 4B9ZA 3LSBA 3SADA 3NFUA 1EO7A 3ZMRA 4JCLA 1KXVA 1XP3A 2ZA3A 1TPDA 4XZMX 3UNDA 4C90A 1KRBC 1KM3A 2ABBA 3EDFA 4O54A 1J0KA 2DVTA 5A6AA 2VCAA 4MYAA 3T55A 4KFPA 2RDWA 4WKAA 4UQAA 1MQRA 3GUGA 3DBNA 2V2DA 5ECVA 3PJXA 3NOYA 1NOWA 1OK4A 3PPFA 1X6LA 1RJQA 3NO1A 1H7NA 4F2BA 3DFTA 2UY4A 1TCDA 1XBVA 4NJJA 2E8YA 4DLMA 5H2ZA 3ARSA 4GY7A 1QNSA 2D0FA 4AF0A 3F5LA 2AQVA 5LXEA 4XQ6A 1J11A 4FLRA 2E77A 2VRJA 3UY7A 1F7BA 2OLSA 5CGQA 4PB3A 3WFLA 2Y24A 1DP0A 2DSWA 1OHLA 3AOFA 3CPGA 4JEQA 3S8HA 3E49A 4UCFA 1XS2A 1EWEA 3P80A 1X8FA 3T2PA 2PSNA 2ESCA 5J8LA 3T4CA 3LTPA 1XIMA 2A7PA 4QJ5B 3R7MA 2QGHA 3U6WA 4MSSA 1OFOA 1MI3A 3W81A 1W3NA 2VQTA 4O16A 4V15A 3S2LA 1UR1A 4IPNB 2O7QA 4LAOA 4JTUA 3ARXA 3NPVA 2GDVA 4JNMA 3L2LA 2OLHA 1KV5A 3SRKA 1NOUA 1Q5MA 5A6BA 3G0XA 1EL3A 2XYLA 3SIMA 1T40A 4RDYA 3O15A 3JZUA 1JPIA 4LEFA 1V7AA 4PCTA 4U2ZA 1B9ZA 4DBWA 3IRSA 3W1QA 2J7DA 1OBAA 3LHZA 3MHFA 4S2CA 4Q8TA 5I0DA 3FHQA 3RM8A 2GJNA 2QZRA 3AS2A 4HNNA 2DIKA 1XLBA 4LYPA 2FJKA 3CAKA 1UOKA 9CGTA 4HTYA 2Y4SA 3S5YA 2UY5A 4XISA 1I0BA 4HA3A 4CD5A 3C8NA 2DZAA 4AZCB 3COTA 2BOFX 1B3ZA 3CHDA 1RPKA 1L6SA 5EYWA 2OYKA 2ZRVA 4U4MA 4GACA 1H5YA 2TPSA 4B5VA 3O8AA 1XIBA 1XLKA 3UF9A 1I60A 3H2FA 2GVYA 2XVLA 1E0WA 5GPRA 5F7UA 3K8KA 4MWAD 6REQB 3OODA 3KBVA 1VYRA 4UNLA 2DT3A 1Q7ZA 4FX8A 1YW1A 2E28A 2Q8LA 3LHVA 3OQ8A 1LF1A 3SEPA 3KTSA 4DBEA 1JD7A 4LAUA 3MUAA 3W76A 4GC4A 3FEMA 1POJA 4LXFA 3F03K 3V16A 5C5YA 3WCZA 4NX5A 5FF4A 3NL2A 4O8AA 2ZZ6A 2GOKA 1KRAC 3AS3A 3LGDA 4QX4A 3PN8A 3T0BA 4C6LA 1R3RA 4LS1A 1FXQA 4XUGA 1QI2A 3ALGA 3ZT7A 1D2KA 2A3LA 5HWNA 4MJMA 3G3MA 2CC0A 4I5RA 2Z7GA 1LUCB 3T05A 3VCCA 2X0YA 2PGWA 1WDDA 2VVNA 3AYTA 3C3NA 4OJYA 3WUEA 4DWSD 4NZ5A 4BJHA 3LQGA 3PBWA 4RZBA 3GBDA 3KDNA 4H8HA 3W38A 1OD8A 3E2QA 1AZ2A 3ABSA 2YYTA 4BQ5A 3WH9A 4LVAA 2VGBA 4JTTA 2PLKA 3S5SA 1P0BA 4D6HA 3R8HA 2NLYA 1EP3A 2XM1A 2BY1A 4JX5A 4H2HA 3H26A 4ICCX 1KXQA 3W7QA 4PRWA 3VIMA 3G0SA 5IBXA 3VGGA 1OCQA 4JNZA 4GMEA 1EXBA 3QR0A 1JZ7A 1CGXA 1KBIA 2J9XA 3APYA 5FJOA 3SECA 3NZGA 4GIEA 4R53A 4M51A 2Z4GA 4EXQA 3AMLA 1EA9C 4CNPA 3EYPA 1UPPA 4B2DD 1W9DM 1ZBVA 4Q8NA 4Q3MA 1NOFA 1TZ7A 3V1PA 4NSBA 1J8VA 4ERAA 1FWIC 2ZE0A 2I56A 3BV4A 3BLLA 4Q4MA 1E9YB 4GC3A 4PMNA 1U1UA 4IQJA 3Q67A 4IG2A 3AHVA 1FWRA 2ZDRA 4QRNA 1WDWA 2GVJA 1G0CA 2NVAA 4QQ3A 2D23A 3EKGA 1F4AA 2DW6A 5E09A 1ZAJA 2WCAA 2FGBA 3WL1A 4RDVA 1P1MA 3SDOA 1V6YA 3Q37A 5E6YA 4JIIX 2RUSA 1FP8A 4XX6A 1M41A 3I7SA 3G1XA 1HL2A 4D6FA 3KLLA 2H90A 3TH6A 1CLXA 1TIWA 1AH4A 3WN6A 4IMAA 3E38A 3ZT6A 4WX2A 1SZNA 2VUYA 1P48A 4LY8A 2GJLA 5GNZA 3VKCA 1YPXA 4WD0A 3NR0A 3WD3A 4AWUA 1RK5A 3KHDA 4LUJA 3RM9A 2PGEA 3S5ZA 2HE5A 1F3EA 1XIEA 1TZZA 1HKKA 3KM8A 4IMGA 4EPEC 3CYJA 3CT7A 4XWUA 3CHFA 2Q8XA 3O2LA 3L68A 4MNMA 3KRSA 2OWWA 3DYMA 1IXOA 2PURA 5BYWA 2VRKA 2LLEA 2VZTA 4MOZA 3RJXA 3CUGA 3GG7A 2BGNE 1JFHA 5D09A 3C86A 3DGRA 2PTDA 3C0LA 3Q94A 4X2PA 2A21A 3AMGA 3GTIA 1TV7A 3RLVA 3B8SA 4C6MA 1J0IA 2JKAA 4UOZA 4TVDA 3FYPA 3GU9A 2QJMA 2VELA 2WWDA 3W4RA 1QI3A 5BW6A 2BY3A 2V6AA 2ZUVA 3W87A 2GGEA 3N2BA 4GQBA 2OYMA 4U5KA 1FCBA 5HBFA 3FYYA 1LOQA 3M0LA 5H1WA 4BQ2A 3OHMB 2ZX7A 2DV0A 1KM0A 1IGWA 1UCWA 4KFOA 3R4IA 1W32A 2X0SA 3TA6A 4JS3A 5C9UA 2ZZ1A 4FXJA 1XLLA 3E0WA 4E5TA 3M6DA 1JI1A 2O9RA 3LCLA 2JKPA 4C6JA 1TPH1 3E9AA 5A1AA 3WD1A 1SSDA 1SW3A 2B31A 2E9MA 2EQDA 1H7OA 5I24A 1V6XA 4DXKA 4UB9A 1PCKA 4WEVX 4I9AA 2GVEA 4FA3A 1HXJA 6CGTA 5CBJA 1KWGA 4CKQA 2Y1HA 1ITCA 4NHVA 5HQMA 3ZR5A 4PCNA 1WXZA 5F1UA 2F7FA 2GGGA 4AZ7A 4KEZA 3CU2A 5FIPA 4M24A 5BMXA 3IJDA 2V3EA 3RRXA 1W1VA 1ZAHA 4K68A 2ADAA 2FZ9A 1VHCA 1U5JA 3H70A 2CFFA 3CHVA 1BWLA 3THCA 3R1ZA 4OKDA 2X1SA 2YLAA 4LUSB 2ZZ3A 4HMCA 2TAAA 4UBPC 4K8EA 3MV11 3VIGA 1F6PA 2DUAA 1HKMA 2VDIA 5AYIA 2QDEA 1B31A 2YFOA 1GZ1A 5F4SA 2IKJA 3OQEA 4KRZA 3M46A 5M1TA 5I77A 4D9PA 4D6EA 4DXXA 3WEOA 2PBOA 3M7SA 3M1ZA 4IFKA 3KOWA 3T42A 2ZX9A 3I65A 2CHRA 2EO7A 2OCZA 3UWQA 3KVJA 1JDEA 3MO7A 1F5ZA 2GFTA 4GYPC 4J1OA 1ME7A 1PYFA 3LPGA 2A7RA 4MNJA 3HJEA 3ABRA 3NA8A 4J2MA 4N7QA 1JG9A 3IEBA 4NAFB 1KR1A 3AJ7A 3KTXA 2PDWA 4CU7A 1ONRA 1E6NA 3EX6A 1JDCA 3UD6A 1DQXA 1MZHA 3N2CA 1XLCA 4NJKA 2YB4A 3AHZA 3FGCA 4QIUA 3C2YA 3EX3A 2A3CA 2YCIX 4DUOA 1JPMA 1EGVA 3R89A 3KLKA 1TMQA 2V8ZA 2PU1A 1KFBA 2C1GA 3LSCA 5CJMA 3QMSA 2CCRA 3CXOA 4IPIA 3UFYA 1KLYA 1EIBA 4JPGA 3BAYA 3TTSA 4HSOA 1QI5A 4O1EA 3Q65A 2JF6A 3UGVA 3M6YA 4LAKA 1HJWA 1VYPX 5BRBA 5A8PA 4DLFA 1ZNNA 4UTWA 4AHQA 3P61A 1RCOB 3IIOA 3F2CA 3WH6A 1GW1A 1FUYA 1S3TC 2OG9A 1IGSA 3NGFA 4PL1A 1ICSA 1CDGA 1V3KA 3DERA 3WNOA 2PMQA 4V1YA 4AZHA 2YKKA 3B04A 1TB3A 1JZ6A 4LAZA 1K9DA 2F38A 3EDDA 1GG1A 3ZJKA 2O92A 3BMVA 2C18A 3CQIA 2R24A 3F1QA 4P7NA 5AYBA 2Y8KA 1M7PA 2WSRA 3LCHA 4R7OA 4B5SA 3TN6A 2V82A 4XAYA 5DANA 3KBMA 1A5BA 4H3DA 1CB7B 4WSHA 1HNYA 3UETA 1VBHA 1BG9A 1EJUC 3LM7A 4ZQPA 3O3RA 4L1GA 3BMXA 3TOPA 3WLNA 1TA3A 1KFJA 1UP2A 4NIRA 3IRDA 1XH1A 3VOHA 2Y63A 4PTMA 1E4MM 2YXOA 3OZYA 4DWDA 4YHEA 4RDZA 3GHRA 5E1QA 3L5LA 1ITXA 3CB8A 1LOLA 4IGSA 4MAVA 4F0LA 1KNWA 5DCDA 3STPA 2G41A 1MDRA 4E4UA 3TX9A 1H7RA 2XGIA 3PZTA 1OFRA 2B4GA 3NJ3A 4QJ4B 4B9YA 4JEJA 4LS2A 2CLPA 3VMNA 4ZO9A 1DQUA 3UZWA 1AQMA 4C7DA 3NOEA 2EJAA 3DG6A 3LCWA 5B7YA 2FPYA 1XDJA 4LH8A 1NM9A 4CD4A 3TMQA 1JPHA 1S2AA 2ZDSA 4DWSA 1UQZA 3SUTA 3QZEA 2PAJA 2PF0A 2VFIA 1JCNA 1LL4A 4Z1DA 1F05A 3AUJA 2ZXQA 3S0CA 2VUNA 1V3MA 1VCGA 1Z44A 1DYSA 2NX9A 3NPWA 3ORWA 1V3LA 1VAHA 2RH9A 3OVRA 4CCDA 3FKKA 3OHIA 3LRKA 1RP9A 2D24A 3KVLA 4JQ4A 1XL9A 5ABFB 1GKRA 3R2GA 1PIIA 2V3DA 3DC8A 4GY0A 4UMCA 4ZE4A 5I3FA 2KZHA 3MHUA 3B0VC 1ALDA 3W0KA 5JH2A 1C3FA 3EB2A 3MMUA 2RGMA 4AMAA 4B2DA 1TPUA 2QMJA 2PDGA 2J7GA 4IXXA 3HOJA 4Q4OA 3VOGA 1V93A 2C71A 4GKLA 3KCJA 3TMLA 1HF6A 1O4UA 3SRDA 1IXPA 1J6PA 1KXHA 4L64A 3W7OA 3DDMA 3FJ6A 2W79A 4PUDA 2QVNA 5C7HA 2WC7A 4ZXOA 3A24A 1QO5A 2WMIB 4AZIA 3H54A 2G97A 4F4RA 1T99A 2ZA1A 1R7AA 3PTDA 2DW7A 5AHIA 3DECA 1TR1A 4RX0A 3OPSA 5I5RA 1DJXA 8CGTA 3IK4A 1TWSA 1XRFA 4XD5A 4ZSUA 3P82A 3LNMA 3BJSA 2WMKA 3URAA 1MO0A 4J3ZA 3CQKA 1VFLA 3W85A 2QCDB 4DQWA 4WK9A 2ZZ2A 3BGAA 3N4FA 2WBKA 4ZBCA 4DI8A 4OT7A 1V3IA 2WQPA 3WBYA 1ZLPA 1F2JA 3GVRA 1XV8A 1XLFA 5HJLA 4AD5A 2BVTA 1GVSA 1VLIA 1V02E 4C7FA 1HJXA 4C65A 1QPNA 4H6EA 4YTRA 1RQBA 2WPGA 5FJPA 4NAEB 1EH9A 2X1TA 4ZQCA 1GCYA 4KWUA 4JYDA 1NP0A 4UTIA 4XZIA 3U2OA 3VOFA 3G0UA 4KWVA 4I7VA 1ZFJA 3AZRA 3BGJA 5IXEA 2FTPA 1UR4A 4KF1A 1JL8A 3TZNA 1JCTA 4FI4A 3G22A 4S3FA 2AAMA 4IGMA 4EACA 4AIOA 2QCFA 3OA3A 2G4FA 3GX9A 4RXGA 2C91A 3W7LA 4PTVA 1QOXA 2D3LA 1AMYA 5D03A 4D8LA 2ZVRA 4GINA 3GC2A 4KETA 2DJXA 3LY0A 2VL4A 3VIJA 4O57A 1TPFA 3D3AA 3V7PA 1TUFA 4DYEA 1OF6A 1GVYA 4GUJA 2NV1A 4ZENA 4CQ8A 1XSJA 1JF5A 4LU0A 1LQ0A 2E0PA 3B9NA 3F4NA 4A8IA 1EPXA 2ZA2A 3D46A 2CHOA 3NL6A 4KESA 1LL7A 4G6CA 2R9RA 1FOBA 3WEMA 2EG7A 4N2YA 4YJ5A 1DE5A 5CPTA 4F0HA 4QISA 1E9LA 5LYRA 2QCNA 3ABQA 3MTWA 2P8CA 3H6OA 2ZRZA 3DHPA 1BYCA 2G37A 4AAJA 4DN1A 3HF3A 3NXLA 4OTKA 4AC1X 3RLGA 3AHTA 2VEFA 2VX7A 3CV2A 3ZVIA 4F2UA 3UR2A 2FIQA 2IS7A 1J4EA 3IGHX 2Y5EA 1W5PA 3R5EA 1KGWA 1VFTA 4OV4A 1GOIA 3LLXA 3NO5A 4TUFA 2Z1SA 1XDLA 4JKMA 3UVIA 4LBSA 3FA3A 1CEOA 3UY8A 2CESA 3WJWA 3DXIA 3NO3A 1KD0A 3KOFA 4XSLA 3EMQA 3NM3A 4H19A 3NQCA 2PWEA 5EFDA 1P4CA 3L4ZA 2WLZA 5G1TA 1N2VA 2R8WA 4PSRA 4UCGA 4O14A 1MUMA 4B92A 3BAJA 2XGBA 4M6PA 4UOJA 2XFYA 4Q8QA 4TVCA 4NQ1A 4BR1A 1IE7C 1C90A 2XH2A 4H04A 4AZCA 2D73A 1TJ0A 4W85A 3K8MA 2NX3A 1DE6A 2FZBA 3ZWSA 1GTEA 3KL3A 3GHTA 4QFUA 4CEXC 4H6QA 3OG3A 1XG4A 2FZMA 1L8NA 5C7VA 5G4EA 3VIFA 4C1LA 3LRMA 5TD4A 6REQA 3P62A 2PF8A 4NRSA 2IKGA 1PIGA 3VM5A 4I7UA 1OK6A 3HG2A 4MKSA 4UIOA 3WQ5A 2CBJA 3L4TA 3C5QA 3QGAC 2VI0A 2I7GA 5C71A 3LA4A 4O28A 4MB5A 4OU1A 1U33A 4A21A 3AAMA 3M47A 3GH5A 3U4AA 2WMHA 1TMLA 3N15A 4KKXA 3RGTA 1E1FA 4GKTA 4GUHA 1GQLA 1VC4A 4MHBA 1EX1A 3N04A 3R11A 3TFXA 4WZHA 4XK2A 1XG3A 4YWSA 4JN7A 4K3ZA 3W1AA 1HKJA 2BY0A 3FA5A 3K1GA 2P5NA 1LUCA 2Y85A 2YCEA 3BG3A 2P88A 3CBWA 4S1FA 2WNQA 3Q45A 1V6UA 3WUFA 3GHUA 5LIWX 1IT8A 2QR6A 4W93A 1TJ2A 4AXKA 2HPMA 1NF7A 4GHRA 1P0NA 3CT2A 2ZFAA 1WKDA 2FB3A 4XVEA 4MZYA 3GG0A 4AG0A 4XV0A 1FHUA 3VFLA 1J0JA 4EKJA 3OW1A 1BTCA 2WHLA 4IP5A 1HX0A 3W1XA 5G2HA 1QK2A 4RV8A 4L6DA 1REQB 4R9OA 3T78A 4Z08A 4MZ8A 1I2NA 4F3HA 3VIOA 1RSCA 2EPMX 3TWBA 2OWXA 2CLKA 1ZBCA 4HYVA 4HCLA 3BCJA 1C8XA 3EPNA 3MP5A 1R87A 2O56A 3PG9A 2PTWA 2QUNA 3GIPA 2PFHA 4HNUA 3PWAA 3H24A 4FMVA 3CWHA 2QYGA 2J7CA 4AEFA 3M41A 4UQ9A 2QW5A 1FTXA 2PTYA 3WELA 1US2A 5G5IA 3CV7A 3P5ZA 3PZUA 2XIMA 4IPLA 5HPCA 1U1JA 2HRWA 1LJYA 1Z8AA 1ZPTA 4XVDA 2A79A 4EF8A 3I68A 3PUEA 5JIPA 2IPFA 3OBEA 1UP0A 4IJBA 1C93A 1M04A 3NDOA 1OG6A 3L21A 4QE5A 1X6NA 3HBLA 2FDSA 1BVNP 1WDSA 4MNKA 5DEZA 1ENUA 4Y9AA 2XUCA 5HWMA 3C0SA 4AU0A 2I9EA 4DY1A 3CUHA 1B3YA 5CZSA 3V5FA 1HGYA 2YL8A 4O4WA 5HQEA 1BKSA 2CXEA 1JUBA 2VFGA 3TK7A 1PYMA 1FWJC 3ARTA 2V5DA 1SUXA 2E6DA 1LBLA 4I6VA 1OADA 1ELSA 1GKPA 1P43A 1W3JA 3GXPA 3LXCA 4WXYA 2BP1A 3MCMA 1TX0A 1A0EA 1VRXA 4M80A 1B0IA 4YTSA 1GG0A 3P3BA 3HZ3A 4NRRA 1JD9A 1ZQ5A 4NI8A 2EPNA 4LF1A 2WJDA 3ZIZA 1PXGA 2CLHA 2XVGA 3K4WA 4H7ZA 1YPIA 2GUUA 3EAUA 4MPQA 1Y7VA 2A0NA 4GWEA 2J7HA 2CZVA 3VGHA 3QLDA 2DUZA 2GYIA 2XIJA 3GE7A 6A3HA 2PA6A 4GIAA 4KPLA 1V51A 2WHKA 4MIMA 3T07A 2PP0A 1EC7A 5K2ZA 2PWHA 3KBWA 3U2ZA 1UZHA 9RUBA 2V68A 2G3FA 4DJFC 1EJTC 2J66A 2PODA 1BXNA 3ABXA 4B3ZA 9XIMA 1MFVA 1UR3M 4WQ6A 1OB0A 1CCWB 3TJ4A 1VZWA 3R12A 3GDRA 4E0CA 4GOAA 5AY7A 3ONCA 3KOYA 2PE4A 4H00A 1J18A 3SQSA 5LGZA 3K5XA 3LBOA 3SFKA 2OX1A 2FHCA 1QBBA 2DUXA 1PDZA 4LEQA 5HANA 1FHDA 2BOEX 3PBVA 3FK4A 1SR0A 3O6CA