1L8NA

The 1.5a crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1, complexed with 4-o-methyl-glucuronic acid and xylotriose
Total Genus 278
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
278
sequence length
675
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRWWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords ALPHA-D-GLUCURONIDASE
total genus 278
structure length 671
sequence length 675
ec nomenclature ec 3.2.1.139: Alpha-glucuronidase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1l8nA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1l8nA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1l8nA03
2ZUMA 3ZSTA 5E6YA 3VD3A 2WAGA 3BAJA 2OSYA 5A6MA 3L2LA 1Q6FA 3UG5A 3RM9A 2BY1A 5A95A 1H3GA 2AMGA 4LYPA 1AQMA 3CHDA 3RO8A 3WQ8A 1WP6A 4TXEA 3OBAA 1UH2A 4CVWA 3VD7A 5IXEA 3WMCA 3POCA 3F5JA 2EBNA 3VINA 4J28A 4OJYA 3GXMA 3VIMA 3UETA 1CXHA 3EMZA 4BA0A 1CGVA 1CTNA 4U2YA 1B3ZA 4EKJA 3PHAA 3ZJ7A 2VR4A 4PMNA 2VZUA 3HJEA 4HA3A 3ZT6A 3KE0A 4CU7A 1QOXA 1BTCA 3EMQA 1AQHA 3O2LA 2VVSA 4R5EA 2GSJA 2FH8A 2FHFA 1ZL1A 4PUDA 3WUBA 1E0WA 3PZVA 4ATDA 1PX4A 4JIEA 2OSWA 3CHCA 2VRJA 3THCA 2WZHA 1JDAA 1EIBA 2D2OA 3EDEA 3BMWA 2W62A 2XVLA 1GCYA 3VUPA 3SCPA 3DYOA 2PI6A 1UD8A 2DQXA 1NWTA 1TE1A 1UKPA 3L4WA 1SMAA 5HXMA 3IJ7A 4PMYA 6CGTA 3POHA 1V0KA 1SFSA 2XPKA 2E0PA 3DECA 2CHNA 3VVGA 5A6JA 5FIPA 1NWRA 4UR9A 2EEXA 2Y5EA 4ZENA 4F9DA 4AEFA 3SURA 4GI9A 3U7VA 2CEQA 1OCQA 2RGLA 1ITXA 3WEMA 1HKJA 1BHGA 7A3HA 4OUEA 3ARQA 2X09A 1CECA 4CU6A 2QPUA 1BLIA 4W8BA 3CTTA 1JF5A 3VMNA 1RP8A 1J9YA 3N18A 3WF2A 3UG3A 2UY2A 3ZOAA 2X2YA 2WC4A 2VCAA 3WNPA 3IJ9A 1KWKA 4U3AA 3QHMA 4JCMA 2Z1KA 5BCAA 4MNJA 4P7LA 4GZIA 3N11A 2D0FA 2D24A 5CPSA 1N82A 3T08A 3SCOA 2CCRA 3W6LA 3M7SA 3GH5A 5A2BA 1E70M 5HPOA 1W1VA 1LF1A 4CD5A 1GOWA 3AIRA 4TVCA 3SUTA 1EQCA 3CZ8A 4BS0A 3GXIA 1TMQA 3WBEA 3DC0A 1J01A 4NI3A 1ZBWA 1W1TA 1VBRA 1EDQA 1UWQA 3WFZA 3MS8A 3WH8A 4PYSA 4H8HA 1XD1A 2EPKX 2DT3A 3CMGA 5EFDA 2RGMA 3AMKA 1UZ4A 4CKQA 3OGVA 4H8VA 2YOCA 1WKYA 1HKKA 2D0GA 1U30A 2XYLA 3B8SA 3MV11 5ABFA 2O9PA 5A8NA 2EO7A 4J27A 1B90A 4BF7A 3MSGA 1UHVA 1GW1A 2WVUA 3AS1A 2WMIB 2G3IA 1W32A 4LYRA 5BXSA 2J47A 2J7DA 4ML4A 1GQLA 3N04A 4WLCA 1UA3A 4ATLA 1VEOA 3CUIA 1WZAA 1Q4NX 1JIBA 4UFJA 3T2PA 2WPGA 2GJXB 4PMOA 3SCNA 5CGTA 1HP4A 3OZOA 4UFLA 3BH4A 2WCGA 3VPLA 1UWSA 3GTNA 8A3HA 1BYAA 2YBTA 3WDHA 5I77A 2WC7A 2V5CA 3RJXA 1MXGA 1CLVA 3L4XA 3ARYA 1CZ1A 1M7XA 2J8FA 1ISVA 3PBGA 1SYTA 2GDVA 2BHZA 1RPKA 5FD0A 2ZWYA 3S2CA 4W7WA 4WK9A 5HDRA 5A6BA 2WZIA 4XZWA 2XFFA 3W24A 1FFRA 1W3JA 2UY5A 5CLTA 1R85A 5A6SA 3GXFA 4LPCA 1BAGA 1Y7VA 4JFTA 5I3DA 4L4OA 1V3KA 4F66A 2ZICA 1H2JA 5M3WA 5A94A 4AISA 1GONA 1JFHA 1BFNA 3B9EA 2ZUSA 3NYDA 3A4WA 4Q7NA 3WN6A 2WMKA 3A4XA 3NIYA 3UG4A 5AYBA 4ZXOA 1E6QM 4H04A 1W3LA 2CPUA 1JD7A 2OWCA 1SR0A 5ABFB 3ZR6A 4J3UA 3AOFA 2W5FA 3CZLA 1W9XA 4S3KA 2XVGA 4AIUA 1GOMA 2V38A 2ZX5A 5CSUA 3AIVA 4M80A 1GOKA 1F4AA 2C8NA 3FW6A 2CKRA 3W29A 1EOMA 2WCSA 2MANA 5F7UA 2XSBA 2VURA 4E4PA 2GJRA 3WELA 1KCKA 1W9UA 4GPNA 1W9VA 3KEHA 2E9MA 4B3LA 3VDCA 5EFFA 1ODUA 1E4IA 1Q6CA 2DH2A 4JKLA 2J77A 2C7FA 4N42A 2CXGA 4J3TA 2OSXA 5HNNA 2CBIA 1VBUA 2ZX8A 1ZBVA 4ACZA 1FA2A 1CNVA 3L2MA 1KGUA 3VD4A 5LA0A 5D9OA 3IAQA 1G1YA 1Z32X 1OGGA 5A3HA 1SMDA 5E70A 1EA9C 3CZGA 2G4FA 2OLHA 1ECEA 3W26A 2YBUA 2ZXDA 4RE4A 4GO9A 2WHJA 1CGWA 1W9PA 5FKYA 1CXLA 4AMCA 1UKOA 3VGEA 1ZU8A 1IZKA 1QI4A 5A2AA 2VQUA 3VMPA 4UFKA 1FHLA 3CO4A 3SCWA 4W5ZA 3BAIA 1K9EA 1M04A 4H2CA 3SCVA 1B3XA 3ALFA 2EPNA 4HU8A 2JE8A 3WF0A 3WF4A 2FH6A 4W8AA 3ZT5A 3I3BA 3VIOA 4EANA 1GOQA 3PZGA 1BG9A 4W93A 3AIBA 2WHKA 4P7OA 4CGTA 4C7DA 1GZJA 4JHOA 2WBKA 3AHXA 1MW1A 3FNDA 2XVNA 4P8XA 4CD8A 4B16A 4AEEA 1E5NA 2QLYA 1UD2A 4HMCA 3HN3A 3I3EA 1C7TA 2O9OA 4PEEA 3RCNA 2PC8A 4H41A 3WNNA 2PF0A 1VFUA 1HF6A 3L4VA 4C90A 1PX8A 2X0HA 3QOKA 1J0KA 2WBGA 2WMFA 3GDBA 1B9ZA 4QAWA 5A8MA 2F61A 1ISZA 5I78A 3CUJA 1JI1A 2GJPA 4OIFA 5ABGA 3WF3A 4AD3A 2DPEA 1QI0A 3MMDA 1B2YA 1KFWA 2YDQA 3VGDA 1CXFA 3TA9A 1TVNA 3W4RA 4XX6A 2W63A 2XIIA 4URIA 1TVPA 2Y24A 5E0CA 2ZUTA 2QPSA 1JD9A 3MKKA 3MU7A 4HTYA 3N13A 4AD0A 4MAZA 1KR1A 1D2KA 3U5YA 1J0HA 4LYQA 2J25A 5ABHA 1V03A 2DSVA 5BXPA 3N12A 4U31A 4NRRA 4U33A 3QOMA 3M46A 2VT0A 1PIFA 2X1IA 4PTWA 4AZGA 1FH8A 1V6YA 1B3WA 4MB4A 4UOZA 1UQYA 1H0IA 3CBWA 3WDRA 3VMOA 1V0NA 1UWUA 4PMQA 5LA1A 1M53A 3SUWA 3ARVA 1WZLA 5KEZA 3EMCA 4E2OA 1I1XA 3EDKA 1ESWA 1M01A 2OYLA 3IANA 6A3HA 3T0AA 1XSJA 5I24A 4H8UA 3A47A 4WSKA 3GM8A 5D8WA 2DSUA 4ATWA 4PCSA 1ODZA 1UR0A 1VIWA 1W3KA 1VJZA 4WF7A 1E9LA 1W9DM 2JFEX 5GQBA 1LWHA 1OBAA 3PZ9A 1KXVA 1ZBKA 3BXWA 3AXIA 3N9KA 1UR2A 2FGLA 2XWDA 4IM4A 1G0CA 2W91A 3BCDA 5LA2A 2QMKA 1HXJA 2E4TA 3W6MA 4M81A 1CXKA 2G3MA 2WCAA 3WNKA 1CDGA 4FLRA 2PWHA 3AMGA 1XYFA 2VX5A 1E6ZA 2J62A 5E0FA 2QHAA 4YHGA 1PZ2A 4KWUA 1V0MA 1VB9A 2Y8KA 4W7UA 4CCEA 2JEPA 4NRSA 3LPOA 1JGIA 4AC1X 3GBDA 1XV8A 2PBOA 3NUKA 4GO8A 3OLEA 1IZJA 1KB3A 3BAKA 2NSXA 3TTSA 1QPKA 4D6EA 1E15A 3ARZA 2BY0A 2VMFA 3WQ6A 1OT2A 1NARA 4MADA 1B31A 2B31A 2CKSA 4P7NA 4BQ4A 2ZIDA 3SCSA 1J0YA 2WWDA 4CN1A 4E8CA 1JZ7A 2BV9A 3UERA 3WQ4A 1KGWA 1CLXA 2XWEA 1QHZA 2VCBA 1GQJA 2DT2A 3AMDA 4AWEA 5I0DA 1JG9A 4HZ8A 1B1YA 2A3EA 2XHYA 3EDJA 4D6IA 2J7EA 2WXDM 1V0LA 1NM9A 3SCUA 1V3HA 5A1AA 1JDCA 3QGVA 2J74A 2VX7A 4BZYA 2CBJA 5CGMA 1J0JA 1G94A 1ISWA 2VI0A 2WM0A 5E09A 3JUGA 1LG2A 1MWOA 4R27A 1XCXA 1BG4A 5I79A 3B9DA 5GNXA 2ZX9A 2VX4A 2J7CA 1JNEA 2J79A 3WD3A 1W2VA 3W53A 1WE5A 3WH6A 1JZ6A 5EMYA 4Z2KA 2ZUUA 2YA1A 5C70A 4DUVA 4Z2JA 2E9BA 4UQAA 4CVUA 5FOOA 2XVPA 5BWFA 4MB1A 3WNMA 1QI5A 4U5KA 2YL8A 4N0RA 1OSEA 4F79A 3CHEA 2YL6A 4DM2A 2WB5A 3T2QA 1FH9A 4P7RA 2VRQA 1QI3A 2VZOA 4X0NA 4UQEA 4QP0A 4MNKA 4AZ6A 1OGBA 2AOSA 4IUGA 2NT1A 2EXOA 1J0IA 2XG9A 1NOWA 1B0IA 2GK1A 1PAMA 3KWXA 3ARRA 4AZCA 3VDHA 4UZSA 2XGBA 2YIHA 2YLLA 2D0HA 4CD7A 4PMUA 1AQ0A 1OIFA 2VC9A 2IXVA 1G01A 4D6CA 2GVYA 4HA1A 3RIKA 3OLIA 2WMJA 4WSJA 3ZIZA 1DWGM 1MFUA 1W1PA 4W84A 4TVDA 2JIWA 3ZT7A 3PZQA 4CCCA 2UY3A 1R7OA 2BVDA 3SEPA 1H49A 3FAWA 4KRUA 3WEZA 3L4ZA 1O6IA 4FLQA 3WIJA 1UD5A 4AZIA 2ZUWA 2XTKA 1QI2A 3W81A 3K8KA 1L0PA 5AC5A 1GPFA 1V6WA 2O9RA 3SUSA 2E40A 1EGZA 3WQ5A 1PJ9A 2J7GA 1EXPA 3TTYA 1DWJM 3HMCA 3N1AA 4J3SA 3MUZ1 4AD5A 1FH7A 1K9FA 2OYKA 1TUXA 1KQZA 4CN6A 3AIQA 3MUIA 3A4AA 7TAAA 1KBBA 1HJXA 4GINA 4CCDA 3LPFA 3WEOA 4ZE4A 3BSHA 5D8ZA 2Y8VA 1UYQA 1LQ0A 2ESCA 4C7FA 1DWHM 4YN5A 2GDUA 4U2ZA 1NWSA 2V5DA 3AJ7A 4DWSC 1KCLA 1U2YA 4GI8A 1J11A 2XM2A 4JZ5A 1UH4A 1XHGA 4PMDA 1US2A 1B30A 1ZJAA 5FCZA 1H1NA 1V08A 2BS9A 1HL8A 1UD4A 3WNOA 1C8XA 1E55A 2ZE0A 1UWRA 1XH2A 3AICA 1UA7A 3MUAA 5IFPA 4FLSA 3RPMA 1JYWA 5I6SA 1OD8A 1BQCA 1QVBA 4KH2A 6TAAA 1VAHA 3ARUA 1HVXA 4M24A 4PTVA 4PN2A 2PWEA 1EO5A 3SCTA 3AIUA 4UNIA 1WZKA 2CBVA 3FHAA 1IT0A 3FXYA 4AY1A 1TG7A 2WANA 1JXKA 1FP9A 1V6UA 4W86A 5A6LA 5CLWA 4UFMA 5A6AA 4MB5A 1DWAM 1AVAA 2CYGA 1KXQA 4UFHA 1LLOA 4MPKA 3CUFA 1I75A 4P8VA 3VTRA 4H7VA 4A3YA 4OBSA 2FDMA 1E72M 2G3NA 1QHPA 3NSXA 5C71A 1NP2A 4ZFMA 1JI2A 1W2PA 4J3XA 4L4PA 2WSPA 1E6SM 1K9TA 2BXZA 1MFVA 4PMVA 2A3AA 2J7BA 3B9AA 1H11A 2V3FA 3WENA 4AIOA 4D71A 3QHNA 4YHEA 1LL4A 4AXNA 3G6MA 3PZTA 2D20A 1C92A 1EHAA 1GHSA 4TOQA 1CENA 3KL0A 3UEQA 4P7QA 3A3HA 1JAKA 2JIEA 4W8LA 2OWXA 2ZXBA 3OA5A 1ZBCA 3UESA 4F8XA 3UR8A 4WJXA 5IHSA 2XSAA 3FHQA 4JFSA 2F8QA 3W28A 4MTVA 3BAYA 1FOBA 2PB1A 1UKSA 4GZJA 2FHCA 3WDPP 1HP5A 1TR1A 1OIMA 1RP9A 1XCWA 3OLDA 3NSNA 4B9YA 1C8QA 3RM4A 1G9HA 3AYSA 1BPLB 1BF2A 1JXJA 1WDPA 4ZEPA 1C90A 2UY4A 3AXXA 3PZNA 2E8YA 2BHYA 5BRPA 4EE9A 2D1ZA 3UR7A 1NOFA 5C8BB 1WNOA 3ECQA 2JEQA 3VOCA 4BCEA 4UTFA 2X0YA 3O6AA 3EBVA 4V27A 4M29A 3T0BA 4D6HA 5A2CA 4Z2HA 3AFBA 4UQBA 1KR0A 1ZB5A 1V6VA 3WD2A 1JYXA 2VUYA 1E1FA 4AZ5A 1GJUA 4D6FA 1QW8A 3GH4A 1MVYA 3NDYA 4XZBA 3ZR5A 1JZ8A 2ZWZA 2W92A 1C91A 4GZEA 1V6XA 2CITA 3OB8A 3SUVA 4W7VA 3CUHA 5ABEA 2VZSA 5JIPA 5M17A 4DUWA 3MUY1 5M03A 1HT6A 2CIPA 4KGJA 1EQPA 1CXEA 2XFRA 2WNWA 2J7HA 1C3FA 4MAVA 3AS3A 4X0VA 3WKZA 3WSUA 4IPNB 4QLKA 4B15A 1MW2A 1X6NA 3K8LA 1BGAA 1E5JA 4B3KA 1BVZA 4TTUA 3A6OA 3WBAA 2W66A 4OOZA 5D9NA 3T0DA 1OT1A 3I3DA 3OZPA 3AHTA 5CJ5A 3ARPA 4NF7A 4GXPA 1LG1A 1CYGA 2CETA 5I23A 4UFIA 2HVMA 5CZKA 3K8MA 1A3HA 3GNRA 4CD4A 1JZ3A 3PZOA 3AMCA 1J18A 3BMVA 4DM1A 1WPCA 4XV0A 3AS2A 3AHVA 2DIEA 3J7HA 1OWQA 3F5KA 3S6TA 1M03A 2VO5A 5FL0A 1GUVA 1E71M 4HMDA 5JUVA 1HJQA 1CPUA 2F2HA 5DEZA 4RL3A 2GFTA 1CBGA 5CQ1A 1ITCA 1UWTA 1UKTA 1MW3A 1E4MM 1VRXA 3VIIA 3ZJKA 3KL5A 3M07A 4UQ9A 4OZOA 3WMSA 2QMJA 1B3VA 2D23A 5JBFA 3EYPA 2PWFA 2WK2A 1V3IA 4UZUA 3AYRA 2EPLX 2ZOXA 3L4TA 4FF5A 4HMEA 1GVYA 1TFVA 2O9TA 3VD9A 4QLLA 5LYRA 3WH5A 3FAXA 3K46A 4XUYA 1PEZA 4PSPA 4JFVA 1E3ZA 2Z1SA 2E8ZA 3F5LA 3DYPA 3VIHA 1DWIM 2VJXA 3VM7A 1OGSA 3E1F1 2DEPA 1VFFA 4E8DA 2WSKA 3PTKA 1VENA 4QCFA 1S46A 1JDDA 2BFGA 4FLOA 1UH3A 3L4YA 4J3VA 2GJXA 1MQQA 1WZMA 4NZCA 1EHNA 1MQPA 5DT5A 1CIUA 1LJYA 3K1DA 4CUCA 5CPTA 4Z2GA 8CGTA 3UCQA 3AS0A 3D3AA 2Q8XA 1P6WA 1C7SA 4ZE5A 2BXYA 3W0KA 7CGTA 2WYSA 4UCFA 2J78A 1GVIA 3WD0A 3AMLA 1CGTA 5HBFA 2V3EA 1VFMA 5IHRA 1R87A 1MXDA 5CXPA 1HJWA 1PX3A 1QNQA 3MSDA 1U33A 4JAWA 1HN1A 4C91A 1RH9A 5BXTA 1WB0A 3TONA 1BSIA 3VDBA 2C0HA 3WNLA 2WLZA 5D9MA 5ECUA 5IFTA 4ACZB 5AYIA 3OLGA 1FHDA 2IUZA 2NT0A 2WC3A 3WUFA 1OM0A 3PZUA 2GUYA 2JF6A 2W67A 3ARXA 4AZCB 1KGXA 1WDRA 5CG0A 3VIKA 4GQQA 3SIMA 3VGBA 3OGRA 4JFWA 3ZJ8A 4FK9A 3KZSA 2V3DA 4U3CA 2WW5A 2XGIA 1W9BM 4AD1A 2D3LA 1DHKA 4CD6A 4KMQA 3WL0A 1HL9A 4DWSB 4TTGA 5CSYA 4OKDA 3AISA 1JL8A 2PBGA 1GQIA 1F4HA 3DYMA 4NSBA 2X8RA 5EBAA 4W87A 3LPPA 2TAAA 3THDA 2DT1A 4GKLA 4LGXA 1V02E 4HU0A 4JCLA 3BLPX 3MO4A 1H41A 2BNJA 3K4AA 1H09A 3VO0A 3QHOA 1MYRA 1E6NA 4IISA 1UG6A 4AZBA 4JFUA 2BVYA 4M1RA 3W37A 1UR8A 2CERA 4MJ4A 1UZ1A 2E9LA 4JHZA 1VEMA 2FGZA 1EDTA 3PN8A 3AI0A 3VIJA 1DWFM 3NSMA 4C7GA 1NWUA 1EH9A 4QFUA 4A3HA 3U7BA 3SCQA 2J4GA 3GZAA 1PZ3A 4W88A 4ACYA 2A3CA 1GHRA 2VOTA 3LPGA 3CIVA 3WH7A 4J3WA 4AZ7A 2DIJA 4PBGA 5DF0A 2G8ZA 3BLKA 4JKMA 3N15A 1GOIA 1KXHA 1OB0A 3VNZA 1AMYA 3VGGA 2XVKA 3NCOA 2Y2WA 1HNYA 4AIEA 2BY2A 4KGLA 4BQ5A 4PMXA 1QHOA 4UOQA 4GQRA 2YL9A 3ARSA 4DUXA 1UWIA 2CNCA 4XB3A 5JBDA 3KL3A 4M56A 4Y7EA 1OINA 4V2XA 1PBGA 1L8NA 3W38A 2VTFA 2VCCA 1HJVA 5BRQA 3K4DA 3MANA 4UQCA 4HP5A 4MDPA 3VKKA 1JZ2A 2CBUA 3EDDA 3CZJA 2VVNA 4RE3A 3IAPA 2BVTA 4D6DA 2VQTA 2ZX6A 1EOKA 2XM1A 3VIPA 2CHOA 1KQYA 1GOOA 1WDQA 4HPGA 2J8GA 3WY1A 1JZ5A 2XIBA 1FFQA 5GNYA 5E6ZA 3VILA 5I5RA 5JIWA 1V3LA 2EPOA 3ZSSA 3IK2A 4PRWA 5BYWA 2DT0A 3IJ8A 2WHLA 1GJWA 3RM8A 4AZHA 3CLWA 1CXIA 3WMBA 1CGYA 4M82A 4ZXLA 5M5DA 1CWYA 4QDMA 1E1EA 4W5UA 3BSGA 3CGTA 1O7AA 1FP8A 3ZJ6A 4PMZA 1VFOA 1QBAA 2EQDA 5BXRA 4MJ2A 2A3HA 1QNPA 1UR1A 1XH1A 4TVUA 3VIFA 2JF7A 2WKLA 1GORA 3AQUA 4Z2LA 3VD5A 3CH9A 1EO7A 2YDSA 3F4VA 5DFAA 1KWGA 2VRKA 4PSRA 1WAWA 5AC4A 4QLJA 1JF6A 4D72A 1J0ZA 3WDQA 3T2OA 5AY7A 2ZUVA 4AW7A 1B3YA 2EPMX 1ISXA 1CGUA 1XC6A 1XSKA 5DMYA 2QF8A 1PPIA 4D1IA 3ALGA 4CU8A 5HOSA 1LL6A 1R7AA 3CPUA 4P8UA 3QR3A 3W27A 2DSKA 4PUEA 1W3HA 5A8QA 3HU7A 1NH6A 2BHUA 5D9PA 3NDZA 1E4LA 2YL5A 3WDJA 4Q22A 2G41A 2AAAA 5EB8A 1HKMA 1OD0A 1UOKA 3WF1A 1HKIA 3SUUA 1XGZA 4JKKA 3NJ3A 3GYCA 4UOJA 3GNPA 5A6KA 1DTUA 2XJ7A 2PWGA 3WUEA 1UR4A 1ZS2A 1R86A 3TOPA 4WKFA 1GNXA 1Q6EA 1BYDA 1QBBA 3SCRA 5E9AA 1WDSA 1D3CA 5IDIA 1JYNA 4PTXA 4LXFA 1E73M 5A8PA 1JNDA 2ZXQA 1J10A 2FHBA 2DH3A 2YA2A 3ZO9A 2D22A 2W4XA 3ARWA 4M8UA 4EK7A 1QNOA 3PTMA 1CEOA 3AXHA 3ZQ9A 1I1WA 1VJSA 2DSWA 1IV8A 1NP0A 1TCMA 1XSIA 1E6XM 3WFLA 4LX4A 5TD4A 1HVQA 3RJYA 4MNMA 3OG2A 4P8WA 3FY1A 3VIGA 4RE2A 4AYSA 2WKGA 1NQ6A 4D1JA 1X6LA 4HZ6A 2VZTA 1E3XA 4EAMA 3AIEA 3WH9A 4HZ7A 1E0VA 2QV4A 4A4AA 3AIWA 1QNSA 2IXUA 2WWCA 3AHZA 3MMWA 4HOXA 2ZXAA 1MW0A 3AZTA 3CMJA 4HOZA 3LMYA 2ZX7A 3U5UA 1Q6DA 3PZMA 1LWJA 2YDRA 2WVVB 1UQZA 1W1YA 2XUCA 1E0XA 1Q6GA 1ZJBA 2WVTA 2WVSA 4AD2A 1W91A 3APGA 4UQDA 3BCFA 3VDAA 1HIZA 1V02A 4TX8A 1UD3A 3WUGA 4DWSA 4PMRA 4TUFA 3AZSA 5D4YA 3O9NA 3ARTA 3WQWA 2VZVA 1JZ4A 3GBEA 3VNYA 1YHTA 3II1A 5CPQA 3VU2A 4PCTA 2VX6A 1XD0A 3CZEA 2A3BA 4AD4A 4U5IA 5A8OA 3TTQA 5HPCA 3GXDA 4GI6A 1NOUA 3BC9A 4GIAA 1YQ2A 2ZUNA 1LL7A 4S3JA 1US3A 3VM5A 2YLAA 3CUGA 4DWSD 2OYMA 1JAEA 1E6RA 3VGHA 4KRTA 3WQVA 2Y4SA 4PTMA 1KXTA 2G3JA 5KZ6A 3OGSA 1VF8A 3DHPA 1PIGA 2V3GA 1H5VA 4CN4A 2CESA 3PZIA 4W89A 2GK1B 2O92A 4TX6A 2E3ZA 1QW9A 1E56A 4WKHA 1C8YA 1HJUA 1BYBA 3GH7A 1XYZA 3D5HA 3MV01 3N17A 2JALA 3M6DA 2DSZA 2J7FA 3VX1A 2VR5A 3T09A 3TTOA 3DHUA 3WL1A 4F9JA 1E6PA 3WDIA 4JL1A 5GPRA 1DP0A 1V3JA 1VEPA 1G5AA 1WO2A 4QCEA 2NW0A 4B9ZA 3AHYA 3FN9A 4BQ3A 2UWFA 2D3NA 3RMEA 2EJ1A 2J75A 3RILA 3BGAA 1HX0A 1H4PA 1E43A 1TZ7A 4D6JA 2WMHA 5BROA 2VL4A 3VX0A 2DDXA 2WZEA 2WLYA 4JL2A 4Z2IA 1H0GA 1EDGA 1K6AA 3WD1A 4J7RA 3W25A 2YKKA 1E40A 3CZKA 1UD6A 1V3MA 3ZMRA 5DO8A 4D6GA 3AZRA 5FL1A 3CHFA 1JYVA 1R8LA 4K68A 1D7FA 2DGAA 3G6LA 1GQKA 1TA3A 4WKAA 1TA3B 1JFXA 4MB3A 5GNZA 2XFYA 4OBRA 3PTQA 3MMUA 1QNRA 1BYCA 2OWWA 2WVVA 2YA0A 1XH0A 2PWDA 4V28A 3U57A 1ISYA 4OOUA 5A6BD 2W61A 1DEDA 2HISA 1CGXA 4YPJA 1X1NA 3GNOA 4HPHA 1UR9A 4X9YA 4WIWA 4LQ1A 3BAXA 1BVNP 1UKQA 1RD6A 2X05A 3VGFA 1K9DA 1XRVA 4FMVA 4HOWA 2WMGA 1E4NA 2BY3A 2VNCA 3AROA 4MDOA 3L4UA 3TP4A 9CGTA 1WCGA 3WD4A 5A69A 3ZM8A 1HJSA 3OIHA 2WMIA 4BQ2A 4MNLA 5I2UA 4W85A 4HA4A 4IPLA 3RDKA 2YJQA 1BGGA 5DT7A 3EDFA 1J12A 5JBEA 1KBKA 1A47A 1C93A 3W82A 2WHMA 3BAWA 1MQRA 1UUQA
chains in the Genus database with same CATH superfamily
1XLJA 4CEXC 5A6MA 3UG5A 3TYZA 4A6GA 1L6WA 2AMGA 2J8TA 5D30A 3WQ8A 4FXRA 1YE6A 4Q8TA 5BNKA 3OBAA 3VD7A 3U2CA 2EBNA 3VINA 3VIMA 2VEGA 5G4WA 3QKEA 4MY8A 5DBUA 3TNBA 1FHVA 1CTNA 4JYDA 1YPIA 1B3ZA 3MYPA 4IZGA 4KIRA 4PMNA 3CQ0A 4GE8A 2J6XA 4Q7IA 3DAQA 3VE9A 2PDWA 3ZT6A 3KE0A 4CU7A 3FJLA 3TKFA 3EMQA 1AQHA 3O2LA 4R5EA 1P1MA 1BWKA 1ZL1A 3T44A 2XFWA 2ZVIA 3U8GA 2OSWA 3N2OA 1TPVA 1JDAA 2QVHA 2W62A 2GGHA 3VUPA 5G5IA 2X1UA 3DYOA 4IICA 2PI6A 5SWUA 2AMXA 1TE1A 1UKPA 3L4WA 4X63A 3MZ2A 1FDZA 3OHIA 4EOUA 3NL2A 6CGTA 1JUBA 2GGEA 2DFAA 2PLMA 1IEIA 3POHA 4J35A 1V0KA 1EX5A 4OV4A 1SFSA 2QUTA 2W79A 3SSJA 2INFA 4DLFA 5A6JA 3H2CA 4UR9A 2TYSA 1TPC1 4ZB0A 2Y5EA 3U7VA 2RGLA 1ITXA 3WEMA 2PSNA 3QLLA 4N02A 1V7AA 1EJTC 1BHGA 2Y63A 3HQOA 4CU6A 1JF5A 2G97A 3VMNA 1RP8A 4WR3A 1E1CA 3ZOAA 2X2YA 2FQIA 2VCAA 1WDWA 3WNPA 1YBQB 5BCAA 4DZHA 4P7LA 4HVXA 1LOSA 4NJJA 3HFYA 3W6LA 3PBUA 1E70M 5HPOA 2GDQA 2PDUA 1OFPA 4TMCA 3R13A 3CZ8A 5CPOA 1F76A 4UTLA 2HNHA 5LNRA 3WBEA 4HPJA 1W1TA 1VBRA 1VGAA 3IUHA 3UR2A 3R8RA 3DFTA 3UYIA 4Z17A 4L9ZA 4F48A 2IKGA 2DT3A 2VC7A 4YU1A 1UZ4A 4G9PA 3OGVA 1IXOA 4E4FA 4KWOA 4AWTA 2YOCA 1V51A 4YVVA 1TVLA 2J9XA 1HKKA 4AY7A 1G4SA 3MV11 3WQGA 7ODCA 4J27A 2YCLA 5AHLA 3P60A 3SO7A 1XDMA 1Z48A 3G8EA 2FZDA 3W1RA 1W32A 1XBYA 3NXFA 3N04A 4XZHA 4ATLA 3CUIA 4GA8A 1Q4NX 4UFJA 4IIDA 3T2PA 2YDAA 3SIZA 2ALRA 5E5CA 1TIMA 2XGZA 3SCNA 1ZP3A 4JS3A 3VPLA 4R53A 3CNYA 3R10A 1BYAA 4K38A 4JPGA 4GJJA 2WC7A 3E74A 3E6EA 1CLVA 1UB3A 2RAGA 5AYXA 4JQ3A 2V63A 3U2ZA 4PB4A 1M7XA 1H51A 1EJUC 5HJXA 4W7WA 4WK9A 2IW0A 4XZWA 1PCWA 3W24A 1ENUA 2UY5A 2PDPA 5CLTA 3SM0A 4GCAA 1AW1A 3VYLA 3GXFA 4LPCA 1Q6QA 4LCQA 4Z1BA 4L5ZA 3DG3A 4JGDA 4JN8A 3NM1A 1OCJA 1V3KA 3D0CA 3M0JA 1S3TC 1BFNA 4MLJA 3NYDA 3WN6A 5AYBA 3LGEA 4MKNA 4ADTA 2CPUA 1EF3A 1RPXA 2FMNA 1T8QA 3ZR6A 3ABRA 4Y2WA 3AOFA 1S1RA 1W9XA 2E1DA 1GYNA 1OX5A 5CSUA 5J5DA 5C2GA 3AIVA 1M7OA 4JBRA 4M80A 1K8XA 1F4AA 1LWIA 2C8NA 2CW6A 4F0HA 3FW6A 3N3TA 5F7UA 4E4PA 1KCKA 3TWAA 4B3LA 2YR1A 3VDCA 3GVVA 1LROA 4JKLA 4JTQA 3RRXA 3ZLHA 4J3TA 2CBIA 2QVNA 2ZX8A 1ZBVA 2V69A 3PG9A 3HGRA 4DHGA 5BOFA 3EWXA 3W72A 3ID7A 1AW5A 4JTFA 1UR3M 1K8YA 1OGGA 2IMRA 4B5UA 1ECEA 3VFCA 3WLLA 4D8ZA 2YBUA 3KRSA 2ZXDA 4RE4A 1V6TA 4GY1A 1W5PA 1W9PA 5FKYA 5I3HA 5REQA 1CXLA 2V5LA 1RCQA 3HQPA 5EMUA 1ZU8A 1QI4A 4XZ9A 5BWAA 3VMPA 1XKYA 4FX6M 3BAIA 2G5WA 2IPWA 2JQXA 3C2RA 3WF0A 1BQGA 3I3BA 1JDEA 2DJXA 4QNWA 1BG9A 4CGTA 4JNYA 4GKTA 1EP2A 5I3FA 4FPSA 2WBKA 2ZA3A 1ZFJA 3FNDA 2XVNA 4Y8EA 1E5NA 4F2TA 1BSLA 4O12A 4O52A 2O9OA 4HHHA 4O18A 4PEEA 3CL6A 2F84A 1VFUA 1ZAHA 3K4WA 1AG1O 4C90A 4PCNA 2X0HA 4KQNA 4HCHA 4QAWA 1ISZA 1XBZA 5I78A 2WM1A 1X6UA 4OIFA 2X40A 3U4FA 3PPFA 3HPXA 1O60A 1B2YA 4KCTA 3VGDA 1F05A 3SN0A 4DBWA 2W63A 3PJWA 3MTWA 1WDDA 3MKKA 2VGFA 3QTPA 3FSUA 4AD0A 4JX6A 3B8UA 4LYQA 1XFBA 1XLGA 2J25A 4XTIA 3UWZA 5BXPA 1Q45A 4U33A 3GDLA 4CNTA 2QUUA 2VT0A 4XZLX 3W07A 3FFSA 1T41A 1UQYA 3LLDA 3WDRA 4HU3A 2FZBA 4H6QA 3CLMA 3H23A 4IGNA 3VABA 3ARVA 1WZLA 1RXOB 1FWAC 3GK0A 2R9RA 1Z7AA 4QRNA 3LHTA 2B7QA 1DJIA 2CLEA 3T0AA 4RNJA 2BXVA 5I24A 1EC9A 2NUWA 4E4UA 2DSUA 1ODZA 5JU6A 4N9CA 1DE6A 1E9LA 3C2EA 1SO6A 2VELA 2ZKMX 4IXXA 2PRMA 2XWDA 1QOQA 2W91A 2QMKA 1XWYA 4JDBA 2E4TA 3W6MA 3KCOA 3GC2A 2QNEA 1CDGA 4HNLA 1MDLA 2VX5A 1EBGA 3UQNA 2PDMA 3EWZA 3CUXA 2A21A 4CCEA 1N55A 4NRSA 1JGIA 3RX3A 3P14A 2PBOA 4GO8A 3OLEA 4UUIA 3TTSA 3RX2A 1OT2A 1QUMA 1AUSL 5FF2A 1W3IA 1EJ7L 4BQ4A 2ZIDA 3KUMA 2PGFA 1R9YA 4FNUA 3SCSA 1J0YA 3B0UX 2FPVA 4FAMA 4CN1A 2AQWA 3G1SA 1DJQA 3N6HA 1UP2A 4M7TA 2XWEA 1A50A 2VCBA 3VC5A 3VCCA 3CPRA 2B81A 3COTA 3IGSA 3T1GA 1NM9A 2NV2A 3JVAA 1V3HA 4QAIA 3GVQA 4FNRA 1R3VA 4R33A 4OV9A 2GYIA 5DMLA 3GTFA 3STGA 5CZSA 4R27A 2XDFA 4IIEA 3WLTA 4QEEA 5I79A 5GNXA 3WD3A 3W53A 3WH6A 4F3HA 2DZPA 2YA1A 5LXEA 1W1A1 2E9BA 3GUGA 5FOOA 3I65A 4O14A 4U5KA 2HK1A 1OSEA 3CHEA 4Q4RA 3T2QA 3BANA 2QJGA 4I6VA 3W7PA 3WZ0E 2E77A 2QJNA 3QR1A 3RCYA 4DYJA 3M0IA 4HQVA 1UBSA 4MWAB 4MNKA 4AZ6A 1OGBA 1KW1A 1J0IA 2XG9A 4PUWA 3AYVA 2PDFA 4DBUA 4HBKA 3KWXA 1KO0A 4M6UA 4AZCA 3VDHA 4E38A 4YWIA 2R24A 2YIHA 2YLLA 4PMUA 1XLHA 3SW6A 4DQWA 2YB4A 2NX9A 4HA1A 3W9ZA 1W1PA 1GVQA 3GFZA 1TRIA 1PXGA 5BMXA 1R7OA 2J9YA 3PUDA 3ZWTA 2X1TA 2GGGA 6ENLA 2ADAA 4GIYA 2BOGX 3L7RA 4FLQA 3GTIA 1RBOB 3SGUA 4AZIA 3WLMA 2XTKA 1QI2A 3LLFA 1L0PA 1RJRA 1VC4A 5G1TA 1E0TA 2GSEA 2EGZA 1CW2A 3ITGA 3I4KA 5DCDA 4H7CA 3GE7A 1JULA 3S5SA 1K9FA 4OECA 3AIQA 5K3VA 3A4AA 1T8XA 4GINA 3STCA 1YLVA 4GCXA 4CCDA 4LUJA 4ZE4A 3BSHA 3ELFA 4J5NA 5HNUA 2YCJA 2TMDA 2Z1XA 4LS1A 2Q6ZA 1W1IE 4LEQA 3O6DA 5HR7A 1Z69A 3PFRA 3NGJA 3T81A 3S1WA 3NGFA 3QJAA 4UCGA 1BF6A 4GYFA 1DXEA 1VBJA 4GQGA 1TV4A 4JICA 4DZIA 3HTWA 1YBQA 2IS7A 4PMDA 3W00A 4AX7A 4NI8A 5FA5A 2NSOA 3THUA 3EPOA 2D73A 4XO6A 1C8XA 2ZE0A 1XPYA 3AICA 3RPMA 1BQCA 5D37A 2PCQA 4NZ1A 5DY3A 1IZCA 4PTVA 5HUPA 2A85A 2IPJA 3SCTA 2CLKA 4IP5A 1WZKA 4S3GA 1WXZA 3R25A 2WANA 9XIMA 4JQ1A 4MB5A 1DWAM 1SW7A 4UFHA 2CLFA 1H60A 1LUCB 1P5BA 4MPKA 1P0NA 4C6OA 2RJGA 3O06A 4G1KA 4P8VA 3LX9A 3UJEA 1OK4A 3QMTA 4A3YA 3KLKA 5KMYA 1E72M 4XD5A 4AX6A 4WEVX 4LNYA 5C71A 4ZFMA 2VGBA 3VNJA 2C18A 2Z0IA 3PPHA 4QBXA 4V15A 3M0HA 2V81A 4L4PA 3ZR4A 5HINA 2DUZA 1G7UA 1ICPA 2RHGA 4PUKA 5EGRA 4ZOEA 1OC7A 3CC1A 3G3MA 1EGVA 1LL4A 2CZDA 2PDIA 4JX4A 1C92A 1EHAA 4XD3A 1IXNA 4OHQA 2DVXA 2OZ3A 3KS5A 4RXGA 4TOQA 3FGCA 3LRLA 2VDHA 1N7KA 1K03A 4P7QA 3H55A 5K9XA 4QE5A 4V33A 1JAKA 2JIEA 4Y9AA 2XN2A 2VEPA 4HSOA 3N2MA 2UV8G 2ZXBA 3OA5A 3MBFA 3G22A 3ORWA 1B3OA 4F8XA 4WJXA 2XSAA 2G50A 5AHEA 1XIMA 3OTRA 1I2PA 3G1FA 3TN4A 3TK7A 3L5AA 2DVUA 3W2MA 3FEQA 4GZJA 4MWAC 1SPQA 1HP5A 1EC7A 1RP9A 1XCWA 1ZGDA 4E5TA 4B9YA 3VC6A 4RR4A 1TX0A 3OA3A 4XUGA 1QWKA 4WXZA 3RM4A 2XSXA 3BE7A 4R7JA 4L1XA 1JXJA 2X7VA 3AXXA 4F0SA 1Z44A 2VYOA 3FXGA 5BRPA 2PGWA 4EE9A 1EZWA 2D1ZA 3UR7A 3C0QA 5C8BB 3NA8A 2GQ9A 1E0UA 3AYTA 4A29A 3P84A 1LP6A 3T0BA 5A2CA 4Z2HA 1AFSA 1PDYA 4UQBA 1M1BA 2VUYA 3NQEA 2WQPA 4X61A 1JZ8A 3RCMA 4Q8NA 1H7WA 1V6XA 2V2DA 2HCVA 3Q2DA 5D2TA 3SUVA 1PDZA 3TTEA 3CUHA 1KFEA 4DUWA 3K5XA 3F4CA 2RFGA 4LS2A 1EQPA 1VFHA 3NZRA 3KDNA 5D32A 3GNDA 3WKZA 3WSUA 2E6DA 3IUDA 4US6A 1MW2A 1WQ5A 3IVUA 1X6NA 1OFDA 1I0BA 1AH0A 3H2NA 4B3KA 1BVZA 2Q02A 3WBAA 2W66A 4H8NA 5D9NA 3EZ4A 3V0UA 4NF7A 5I23A 3N6JA 4MOZA 3DHDA 5CEWA 1IR1A 1A4LA 4CD4A 3GNRA 1PSCA 3RR1A 2NQLA 3BMVA 2ACQA 4XV0A 1CCWB 2OZ8A 3HV8A 4C1NA 3E12A 5HR6A 3F5KA 1DYSA 5FL0A 5K2ZA 5JUVA 3CV6A 3KP1A 2V0TA 3B8VA 2CLMA 4CQBA 3NQ8A 2C13A 4IX0A 3OU8A 1FWBC 1B57A 4KWWA 1P6BA 3IJLA 4C1KA 1ITCA 3K1GA 3C0SA 2PLCA 4LV9A 1K7XA 1UWTA 3GAYA 1ZRQA 3VIIA 3KL5A 1XLFA 3M07A 3UZYA 1EWEA 3TN3A 3EYPA 2PWFA 1BXNA 4GRSA 1POJA 4LH8A 5DMNA 3L4TA 4RW3A 4LAOA 1EA0A 4KEVA 3FAXA 1US0A 2ISDA 4X2RA 1Q8AA 2A3LA 3GR4A 2DZAA 3M7WA 1OCBA 2CZFA 1PEZA 4DZAA 1SM9A 4FP1A 3F5LA 3VIHA 1DWIM 1OGSA 3WCZA 2DEPA 3A4JA 2WSKA 4QCFA 1S46A 4J3VA 1UH3A 2QULA 2GJXA 1WZMA 1NF7A 1MQPA 5DT5A 3WG6A 1CIUA 3K1DA 4CUCA 5CPTA 4K1GA 3UCQA 4JIQA 1P6WA 4O1AA 3PSVA 1ZAIA 3W0KA 1FXPA 2P8BA 2VDIA 1GVIA 3KVKA 4BWLA 3LZ5A 4XKYA 3CYVA 1VFMA 3N2TA 3FKKA 4FF7A 1MXDA 5CXPA 1HJWA 2G0WA 4Z42C 1QASA 3GNNA 5BXTA 4N7QA 4A3RA 1WB0A 3S1GA 4HCLA 3WNLA 2I1OA 5D9MA 3TJ4A 1LT7A 4XKMA 1IIHA 2IUZA 4NAFA 2PDQA 4M51A 4K7VA 4NIRA 3WUFA 2VFEA 3ARXA 4PB3A 4AZCB 1KGXA 5I00A 1VCVA 5T9BG 2VGIA 4X3ZA 3SIMA 4JX5A 3VGBA 4JFWA 2OZ0A 2OG9A 5CPNA 3UXAA 1QO2A 3LK6A 4EXAA 4AD1A 1VCGA 1DHKA 3UR5A 1DXIA 3M44A 1P4CA 2O55A 4GUGA 5CSYA 3ABQA 3W23A 3AISA 2PBGA 3QW3A 1F4HA 2X8RA 4RZ4A 1WKFA 4W87A 2HPMA 2TAAA 3TXZA 4GKLA 5G4EA 1SO3A 4HU0A 3P5ZA 4KCWA 3ATZA 1VP5A 3G0SA 3UXIA 3CQKA 4NG3A 3QHOA 3VKBA 1OG6A 4FA3A 3OPSA 2W27A 1L6FA 4M1RA 3PFMA 1ZLPA 3PJXA 1GPWA 3G1DA 3OOQA 3PUEA 4RZ5A 2GVEA 3PN8A 3AI0A 5DBTA 3UA3A 4EIVA 3MPGA 4X2PA 3SCQA 1MNZA 4GHRA 1NEYA 3KBNA 3FJ6A 2A3CA 1GHRA 2WQDA 4PC8A 2Y7DA 4XD6A 2DIJA 4PBGA 3MHFA 1OYBA 4JKMA 3N15A 4U4MA 4IP4A 4LV4A 1SSGA 4ICNA 1FRBA 3ONBA 1UBPC 3VGGA 3PK7A 2TODA 5F4SA 1EPVA 4BQ5A 1SVDA 2QCGA 3OVGA 4XWUA 3HMJG 2HVNA 2UBPC 4L1WA 1PTGA 1X96A 1UWAA 3CIXA 4DUXA 3H4XA 1UWIA 2PDKA 4FNPA 1OABA 2QQ6A 4XB3A 1IEXA 4LWWA 2X30A 4AYGA 3GHSA 4Y7EA 1KCXA 1L8NA 3H2MA 1AK5A 3O6CA 2ZRXA 4WY0A 4ZOBA 3NG3A 4ICMA 1CI1A 4M5PA 1BRLA 3OQEA 5GJPA 1JPIA 5AVNA 2H3BA 1RLCL 3SN4A 3VIPA 3ZLGA 1W8GA 4DJDC 3THQA 2QUVA 3EKZA 1GOOA 2I5GA 3WY1A 4LSBA 1I2NA 5CC3A 5E6ZA 3HG5A 1HTIA 3TQPA 4V1YA 4IMGA 3SZ8A 3IJ8A 2WHLA 3PJUA 1W17A 1CGYA 3GDTA 2A7PA 4RX0A 3EPMA 1MRQA 3BICA 4QDMA 1EEPA 3V35A 3H4GA 1T0OA 2J66A 2NV9A 4O8AA 3ZJ6A 2FKPA 1YXYA 1VFOA 3ZYZA 4EPDC 3BARA 4TU1A 2EQDA 1VYSX 2QGYA 3HGOA 3SRKA 1UR1A 1XH1A 2WKLA 3IRSA 4Z2LA 4ONVA 3CH9A 1EO7A 3PVFA 5DFAA 4PSRA 4NQ1A 3LS9A 1J96A 5AC4A 2V8ZA 3DBPA 3CWNA 3EKLA 3T2OA 1OFBA 2ZUVA 3FOKA 1B3YA 4DVOA 1XC6A 5DMYA 2QF8A 3ALGA 1WKDA 3W1AA 4XG1A 1TPH1 4QXIA 1LL6A 1R7AA 4L65A 3V5FA 1V8EA 2IQDA 2Y62A 1HL2A 3MSRA 1NH6A 2BHUA 5D9PA 3HO8A 3M0XA 1E4LA 2QCCA 3URBA 2D2HA 1OD0A 1UOKA 4QSHA 1TWZA 1VFSA 2CLLA 3GNPA 5A6KA 2YW3A 1KFKA 5H8PA 2Z00A 4JYEA 4S3DA 1YDOA 1GVOA 5AKQA 4DJFC 4WKFA 3SCRA 1QBBA 4QG6A 1O95A 1WBJA 3EEZA 4LW7A 4PTXA 3EOOA 3P6LA 1TMHA 1J10A 2POTA 3E2QA 4JD4A 2DH3A 5CSRA 2D22A 2DZSA 1T6MA 3ITVA 4M8UA 4EK7A 4WX2A 3ZQ9A 3URNA 1F74A 1IV8A 1TCMA 1E6XM 5TD4A 3RJYA 4R9XA 4P8WA 5LKYA 1JDFA 4LTSA 1NQ6A 5FEWA 4D1JA 4HZ6A 2VZTA 1RZMA 4DY1A 2QDEA 1R2SA 4ADUA 3WH9A 1MSSA 5J5RA 4HZ7A 3EB3A 3AIWA 4A4AA 2IXUA 3CEUA 3CMJA 1OEPA 1Q6DA 1F3WA 2VKZG 4FNTA 4Y9OA 2WVVB 1TO3A 1OF6A 2QCNA 1ZJBA 2HPIA 3NFUA 3TJXA 3UPMA 3EWWA 2WVSA 3U4AA 3W1PA 1EXBA 2QDGA 2WV8A 4TUFA 5D4YA 4HHPA 5PTDA 2VZVA 1GEQA 4NAEB 1K4GA 3I7RA 4C6PA 2BGQA 3GX9A 5HWJA 5FF0A 2A3BA 4AD4A 1FWRA 4MPQA 5A8OA 4GH1A 3TTQA 1FWWA 3CU2A 1US3A 5KITA 3TW7A 1LDCA 2OYMA 1JAEA 2Q01A 3M47A 1XS2A 4ZSTA 4PEKA 2KZHA 3RR4A 3CV1A 1FWEC 4I3GA 3DHPA 2PDHA 1DJGA 1J8VA 4HYRA 1PIGA 2V3GA 6XIMA 2CESA 3PZIA 5I06A 5F4XA 1S5NA 1WA3A 2PDGA 4TX6A 4WGHA 4LUIA 2O7SA 4WKHA 2QT3A 3V18A 1HJUA 3GH7A 5HNRA 4WRHA 4XSMA 2OU4A 3G1HA 1DJNA 3PWIA 4C5ZA 2WKJA 3DFOA 2DSZA 2J7FA 2FJUB 2VR5A 1SZRA 3SY8A 1E6PA 3WDIA 4JL1A 3S2MA 2BP1A 4DEFA 3EX2A 1KNWA 1GYMA 4HK6A 4M19A 4PODA 4X22A 4HJFA 4E0CA 3G1AA 5IBXC 3SFWA 3VOIA 4G7FA 3RMEA 5K9DA 1O94A 2C0AA 2EJ1A 2J75A 2EKGA 3BGAA 3GW3A 4Z1DA 4F2BA 2ZZ2A 1H4PA 1SZFA 1EBHA 2WMHA 3N34A 1JPKA 4FOUA 2WLYA 5C9XA 4XVEA 4I8DA 2BG5A 2RH9A 3QN3A 4UTWA 4ERGA 1OQFA 4S38A 1V3MA 4AH7A 4A05A 1X8FA 1M7JA 5DO8A 4L6OA 2HNEA 3CTLA 4F40A 4MFDA 4C60A 1GQKA 1TA3A 4Q4SA 4NU7A 1JFXA 4JTUA 4MB3A 5GNZA 2X16A 2XFYA 4FR1A 4OBRA 3PTQA 2ATSA 3LI1A 1XM3A 1ZSXA 3QZAA 1ISYA 4QROA 4TIMA 2W61A 1DEDA 4YPJA 4IFKA 4IG2A 4X9YA 2ISFA 1KLYA 3H2AA 1UKQA 1Q2SA 2X05A 3VGFA 2WMGA 4ZVJA 1L9WA 3L68A 4KESA 3O0KA 4MDOA 4E3TA 2GL5A 2HEJA 4CEUC 5FJOA 1XXXA 3TP4A 3QY8A 3WK3A 5IM51 3QPZA 3WD4A 5A69A 4JY8A 4MNLA 3EKGA 3C2OA 1S5WA 4IPLA 2NVDA 2V5BA 1A5AA 4S1FA 5JBEA 2PD5A 3IGHX 3SI9A 4LB4A 4XAFA 3W82A 2WHMA 3S5YA 1UUQA 1U1UA 3PWGA 2FTPA 2ZUMA 3ZSTA 5I3KA 1Q6FA 1Z42A 1PZ1A 2YFOA 4QHRA 4WVXA 2QF7A 4MF4A 4MVAA 2H3DA 3RO8A 1WOAA 4TXEA 4UMAA 3WMCA 3GAKA 3UGRA 4O0QA 3LTSA 3TMQA 3LNMA 5FF3A 3R2GA 1TUFA 3UETA 2ACUA 4H9XA 2VENA 4CCZA 4ECLA 3AAMA 3QV6A 4RLIA 1W3TA 3ZJ7A 2VZUA 3FA3A 4AF0A 3MP4A 3RYSA 4HA3A 3IACA 3FA4A 1QOXA 1F6YA 4Y96A 3KBVA 2PTDA 4E2BA 2EG6A 3G1XA 1NFPA 1JPMA 3PZVA 1PX4A 3CHCA 3THCA 2WZHA 3W2UA 1A0CA 3BMWA 3EDEA 2XVLA 4KCUA 4M0XA 1C9DA 3SCPA 1UD8A 2PRHA 1NWTA 4ZB5A 3W7DA 4RDWA 5K4ZA 3NQBA 3GKFA 2OTDA 5EMJA 2JKPA 2OOFA 5F1VA 4LCRA 4CLMA 1D8CA 3DECA 3QC3A 3SDOA 2EEXA 1XIGA 2DIKA 3QV9A 3T6CA 4G56A 4M1BA 3TOYA 3SURA 2CEQA 2HZGA 3B06A 1IT7A 4C6LA 3C56A 3EA2A 5U4NA 1UMYA 3PY2A 3PC0A 4YMZA 1OFRA 7A3HA 1AA1B 2WNNA 2DZUA 4OUEA 3ARQA 1H7XA 4W8BA 4AVOA 2ASHA 1XUUA 5HWMA 5C54A 4KRZA 1TV3A 3WF2A 3UG3A 1KBLA 3UW6A 4R3UA 1BVWA 1KWKA 4ORIA 4JCMA 5U7SA 1N8IA 2D0FA 2D24A 3EWUA 3T08A 3U2OA 2EPHA 3GD6A 4CD5A 3AIRA 1UIOA 1EQCA 3GXIA 3TW9A 1TYGA 1TMQA 1WKEA 1J01A 5TIMA 2YCEA 1SFTA 3BOLA 1VFLA 4LCSA 3RRAA 5FSEC 3T9PA 3WH8A 1QWGA 4PYSA 2Y70A 4H8HA 1XD1A 3CMGA 1LLWA 2RGMA 1ZCCA 3DI0A 2CLPA 3I10A 2BMBA 5KSWA 1IEVA 2Z27A 5AHNA 5F2GA 1WKYA 3LCLA 3DFHA 3RLHA 4P61A 1XGDA 3TROA 2WVUA 4GYKA 3A24A 2G3IA 3VNMA 4LYRA 6PTDA 2J47A 2J7DA 4ML4A 4PB5A 3W7KA 3WK0A 3DXIA 1YKWA 4XZIA 1WZAA 1LYXA 4ZTYA 4ORMA 2WPGA 4MM1A 3S5OA 2GJXB 4JTKA 2QV5A 4PMOA 5E9XA 1GWJA 3ISIX 1HP4A 2I17A 2QIWA 2Q71A 1ME9A 2X7WA 3KBJA 2YBTA 3ABOA 2ISWA 3RJXA 1X8CA 3UYCA 1Y5VA 3L4XA 3DFPA 4PUNA 3NM3A 3PNUA 4AG0A 3THAA 1TELA 2GDVA 4FEZA 4GUHA 2BHZA 1RPKA 2ZWYA 2Y0FA 3MVTA 1VZWA 1IT8A 3HOJA 4MMWA 3E49A 4UTWC 2GQ3A 5EBUA 1R46A 2R6OA 3P61A 4J3ZA 4FR6A 3SN1A 1F6KA 5A94A 4NHVA 1JFHA 4LUTA 2ZUSA 4Q7NA 1ZJHA 1IWAA 2VGGA 4B5TA 4H04A 2PTWA 2OWCA 1SR0A 3PM6A 1XIJA 3KLLA 1B5TA 5TQLA 2JKAA 3VK5A 3KHDA 3W7GA 1KTBA 1FWJC 1THFD 1EJVC 3NPVA 2YXGA 5JMUA 4L9YA 4IQJA 1EOMA 2MANA 2XSBA 5IDZA 3WELA 5EFFA 1ODUA 1PTDA 4DBDA 1RBLA 1TPUA 4N42A 2OSXA 4JQ4A 1G4TA 4LJ3A 2I16A 4ACZA 4C1LA 2GOUA 4N9DA 1CNVA 3VD4A 5ENLA 1SMDA 3AXKA 5E70A 3CZGA 2Y1HA 1VCFA 3SADA 1CGWA 5H8MA 4AMCA 3UJFA 1UKOA 3HG4A 3VGEA 2PRLA 1IZKA 4Q8PA 5AHFA 3SCWA 3V36A 1B3XA 3ALFA 2AL1A 2FH6A 2HXTA 3W2KA 4W8AA 2P10A 3ZT5A 5ECVA 2RJHA 4EANA 3PZGA 3M0LA 2WHKA 4C7DA 1XGEA 3BDKA 1O5XA 4JHOA 2HK0A 3EX4A 2O4MA 1MW1A 4QJ3B 1LUCA 3HA1A 3CWHA 4MWAD 3I3EA 4B4FA 4MWAA 2QR6A 4Y90A 3RMJA 2VEFA 4JNZA 3NAVA 4PH6A 4IMCA 1FVPA 4H9TA 1F8MA 2HROA 2NXIA 4AUBA 3F2BA 3GDBA 4AHQA 1JI1A 2GJPA 3WF3A 1KBJA 5HATA 2DPEA 4LYKA 2ANUA 3IWPA 5ABTA 1S2VA 1TVNA 5HUOA 2DW6A 1OC6A 1TVPA 1XCFA 2HXUA 4QTGA 2NLYA 2QPSA 2NQ5A 3MU7A 2OEKA 4HTYA 4UMBA 1JQVA 1I4NA 2HQAA 1D8WA 1UJQA 2E1WA 3N12A 1F3TA 1M68A 3UWYA 3QOMA 1FUYA 4INFA 2CZEA 2FTYA 2X1IA 1REQA 5C7HA 2PTYA 2FJKA 4PTWA 3WK1A 3TC6A 1FH8A 4IMDA 2E09A 4JTGA 4MB4A 5EL1A 1OADA 3UA4A 5I3IA 4WHBA 3ANYA 3QTGA 3SUWA 2O56A 3DUGA 3ATYA 1YADA 1I1XA 2GUBA 3EDKA 3Q45A 3MT1A 2NLIA 1P6CA 3TSBA 3VDGA 5HMEA 2F6KA 3GM8A 1S5VA 4PCSA 4H83A 5HMFA 4UBPC 5I03A 2VXNA 4WF7A 3E3HA 1KXVA 1ZBKA 4TO8A 3HGSA 3EOSA 3N3MA 1PCKA 5FJPA 5LA2A 1HXJA 4LANA 4O15A 3YPIA 3TW6A 4BF9A 1EB3A 4JN6A 4M81A 5MKGA 3ITTA 3SRDA 4B5VA 4IXHA 3TNOA 3AMGA 3IARA 4YHGA 3B40A 1OX6A 3N2BA 4Q6XA 1Q3NA 3TLQA 4DXKA 3LPOA 1OY0A 4AC1X 5KETA 3DBNA 3GBDA 1XV8A 4Q8QA 1KB3A 2NSXA 5AOUA 1QPKA 5TNVA 2BY0A 2VMFA 1TQXA 4DIAA 2YXOA 3LG3A 1GK8A 4P7NA 2ALDA 4HKPA 7ENLA 3E0WA 4HT3A 3MWAA 4C6QA 2WWDA 2Y6ZA 1ZHAA 4YTTA 3QPYA 1DQXA 8RUCA 3L23A 3GIPA 3B8WA 3AMDA 3OHMB 5I0DA 1GVEA 2XHYA 3EOEA 4HPXA 2G3FA 3MI3A 1V0LA 3FIGA 3TSMA 3QGVA 2BGNE 2J74A 2VX7A 3TWBA 1EEXA 4F4RA 4BFAA 5CGMA 2R82A 5G4HC 1ISWA 5T26A 5KINA 5DCEA 1LG2A 1XCXA 1ITUA 3HQ1A 3M0MA 3RAOA 3C6CA 2ZX9A 1G4EA 3FGCB 3BO9A 3L5LA 3A64A 3N6QA 5C70A 4DUVA 2Y7GA 4UQAA 5T9CE 4BI6A 4CVUA 1J5SA 4HNVA 1Z6KA 5DXYA 1H7NA 4DI9A 3CT7A 3UWEA 1XLLA 4MB1A 3KBSA 1MO0A 1S39A 4HNCA 3EXSA 4AVNA 2YL6A 4JTLA 3QC0A 5D2WA 4P7RA 3LI0A 4ES4A 1P7TA 5T8GA 1BEUA 4HK7A 3QLDA 4IUGA 2DZXA 3ARRA 5FJIA 4PE8A 1R2RA 4UZSA 2XGBA 3KVLA 2OGYA 2IXVA 3H70A 3A23A 3ZVHB 4D6CA 3RO6A 2GVYA 2ISVA 2V5JA 1Q6OA 3OLIA 3MC5A 4GACA 4HYWA 4WSJA 3ZIZA 4I9MA 1F9CA 1MFUA 4W84A 1FHUA 2JIWA 3ZT7A 4CCCA 2UY3A 3S83A 1PYFA 3TV8A 3IIXA 3L4ZA 3T05A 4GUJA 1I60A 1VPQA 3W81A 3K8KA 3HPAA 4Z1YA 1IF2A 4HSHA 5DANA 5J04A 1V6WA 2OO0A 2YYTA 1VRDA 2E40A 3LBMA 3WQ5A 1PJ9A 4YCOA 1DWJM 4N4QA 1X39A 2Z6IA 1XBXA 3PF3A 1I2RA 3BSMA 1HJXA 4L80A 7XIMA 2INZA 3Q94A 3DFSA 1XJBA 2WSQA 3A5VA 3LB0A 1Y5XA 1SFJA 2H9AA 2XIMA 1TWWA 1Y65A 1OFAA 2ESCA 3C3NA 4U2ZA 4IH3A 3LRKA 3B0PA 3C4UA 4KWSA 3RGTA 1XINA 4ZCWA 1Q8JA 2XM2A 4NJIA 3TYEA 3PP7A 5FCZA 2BS9A 1PIIA 4DZ5A 3KM8A 2V30A 3CUZA 1NJJA 4PL2A 3RPDA 1UWRA 1K3UA 1XH2A 5IFPA 3WLSA 3OBKA 3N4AA 1SJAA 1TCDA 3WLRA 3ARUA 1HVXA 2PWEA 4NAEA 1HGYA 1K1DA 4Y8FA 4UNIA 3BW3A 4ZTXA 1AMKA 3LCIA 3LZ3A 3S2LA 2YSWA 3FXYA 3GSMA 4DI8A 1FP9A 4O50A 4C6JA 3NQAA 3P81A 3F2CA 4GMEA 1AVAA 3DC8A 2CYGA 4OBTA 3N29A 3VTRA 4K7YA 1RQHA 2X2GA 5HJLA 1PKNA 1LQ2A 2A7RA 1LORA 1NP2A 5EYWA 1QK2A 4M7SA 5CSSA 5IBXA 2WSPA 3WJSA 1K9TA 4FOJA 1GVFA 3N9SA 4PMVA 4WDTA 1K8ZA 2Z4GA 5LNVA 1H11A 4JHMA 3WENA 4AIOA 2EJAA 4Q8OA 4GI4A 4YHEA 1AL7A 5FJTA 2D20A 1H1YA 1TMLA 4RNFA 4WDUA 1F7BA 4DBSA 3CV2A 4W8LA 2OWXA 4MKSA 4B5NA 1ZBCA 3UR8A 3KRUA 5LNSA 4JFSA 1O1HA 2F8QA 1TPEA 3LUTA 3FSTA 1FOBA 3M5YA 2ABBA 4N6EA 3HFTA 4A3QA 3LSCA 3OJGA 1IYXA 3PG8A 4E8GA 4KEMA 4GNVA 1S2CA 3QW4B 1FWCC 4RPQA 2ACRA 1C8QA 1XLEA 2H9AB 4OUIA 3I6RA 1BPLB 7REQB 3WLKX 4K3ZA 2E8YA 5FI8A 2BWGA 1WNOA 3ECQA 4F0MA 1UOZA 3O6AA 3UWUA 4M29A 3AFBA 1KR0A 3FA5A 1JYXA 3CEPA 5LXXA 3WMLA 3N2XA 1OX4A 4D6FA 1QW8A 3GH4A 1FCUA 4FX8A 2PGEA 4L4MA 3NDYA 3ZR5A 2W92A 1K77A 2OEJA 4GZEA 4JQ2A 3OB8A 3CB3A 4W7VA 5ABEA 1P7TB 2YB1A 1UC4A 4OE7A 5M03A 4MY1A 2CIPA 5C2XA 3CL7A 1CXEA 3PJTA 2WNWA 1ZQ5A 4HIBA 2G4JA 4MAVA 3AS3A 4RW5A 4TV5A 2WSRA 4IPNB 3WO8A 2XH0A 3KAOA 3OG3A 4OOZA 3O1NA 1UJPA 2DUXA 4OGZA 4DYEA 3GUWA 3H2OA 2J24A 3QVQA 1OT1A 3I3DA 1MDRA 3JRKA 3ARPA 1LG1A 3G8RA 4KPLA 5CZKA 4HTBA 1WXYA 1A3HA 3W74A 5RUBA 3AHVA 1Q85A 4DLMA 3G5EA 3J7HA 1OWQA 3P82A 4MZ1A 1PKYA 2VO5A 1MUCA 1TE6A 3TYBA 4AHPA 3L65A 4J9JA 4QEHA 5DQPA 1CPUA 5DEZA 2H8XA 2ZDSA 5CAKA 2WOQA 2OT0A 1CBGA 5CQ1A 1OK6A 5MF5A 4PGLA 4ZQRA 4LEFA 5D02A 3E38A 1VRXA 3S46A 3ZJKA 3L0GA 3WMSA 1B3VA 3RLUA 1XICA 2QCHA 5HMDA 1XYBA 1W8SA 4UZUA 3KDOA 2ZOXA 4HMEA 3C8NA 1GVYA 1TFVA 4A3UA 1MUMA 1O5RA 1RQEA 4QLLA 5LYRA 1U5JA 4LUSB 3K46A 3L67A 4XUYA 4HB7A 3WFAA 5C7VA 3TFXA 4JFVA 4CNUA 1KM1A 2E8ZA 2AQVA 4IFKB 3MWCA 4LS0A 2VJXA 4F0LA 1TJRA 1TTIA 4ZQOA 4K1WA 1MQQA 2PS2A 4L1GA 4NZCA 1RJPA 4U28A 5DRCA 1JEZA 4ZE5A 7CGTA 4UTMA 3AMLA 2GWNA 3NVTA 5HBFA 3M5XA 1JCXA 5D2VA 1VD6A 4O54A 1S2TA 1QNQA 4ROQA 2PU0A 4JAWA 1HN1A 3GW0A 4ZGYA 1WYIA 5CZ0A 3VDBA 2OGJA 2VFGA 3XINA 3F2DA 4KCVA 2ZDRA 3N2CA 5BOEA 1DL3A 5ECUA 4A22A 1Q65A 1BXCA 1K02A 5B7ZA 1FHDA 2NT0A 3E9AA 1HW6A 1EFZA 1KV8A 1A5UA 2ZA1A 4TR9A 1OM0A 3BOXA 1W3NA 3VOHA 5LNUA 1HKWA 4RDVA 5CG0A 5C55A 3VIKA 3CQJA 4MSSA 1AH3A 3ZJ8A 3BOFA 1Z41A 3A21A 4MJZA 1UC5A 2PLJA 4FK9A 3KZSA 2V3DA 5BOOA 2Z1WA 4B92A 2OQYA 4U3CA 2WW5A 4IQLA 2D3LA 4KMQA 3WL0A 1G69A 1G4PA 3TAKA 4C6IA 3DYMA 2VUNA 4NSBA 4S23A 1AL8A 2VC5A 4B4HA 3LPPA 3IPWA 4Q8WA 4F0KA 1H41A 4GFSA 3VO0A 1E6NA 4IISA 3RXZA 1YPFA 2BVYA 4GIEA 7PTDA 1ZALA 2CERA 2OCZA 2QJMA 2E9LA 1VEMA 3QSRA 3LQGA 2ZRZA 2FGZA 1EDTA 3BPWA 1DWFM 3F4NA 3NSMA 3QQ0A 2PP0A 2AKZA 2J6VA 2J4GA 3GZAA 4WOQA 2PWVA 2VOTA 4MUZA 3LPGA 4Z0JA 3WH7A 4J3WA 3Q67A 3GB6A 1DHPA 2ZQ0A 1Q7ZA 3V1HA 3LERA 1QO5A 1KXHA 3W85A 4YTUA 3L66A 1OB0A 1JVNA 4UTTA 3H2EA 1RBAA 1HNYA 2DQWA 4KGLA 4PMXA 3WQDA 3LEPA 4GQRA 1NFGA 5C5YA 4WGXA 2BBFA 4NJHA 3KS6A 4O10A 1EUAA 1Q13A 3NZQA 3KL3A 4WQ6A 4M56A 1H7RA 3DG7A 4LUTB 1XIIA 2VTFA 2VCCA 4XTDA 1HJVA 3ABSA 4IOTA 1PYMA 3K4DA 4UQCA 2OKTA 3MANA 3QRHA 4HP5A 3LXCA 3EDDA 4O57A 3CZJA 5H2ZA 2FYMA 2PODA 4RE3A 3IAPA 2BVTA 4D6DA 2VQTA 5AC6A 2ZX6A 2XM1A 1EYWA 2CHOA 1E9ZB 4XBJA 2PEVA 4JIHA 3TYAA 2FIQA 1EYEA 1FFQA 3UZJA 3VILA 1DOSA 3S8HA 1IGWA 3HG2A 4GBUA 2DT0A 3MKVA 3RM8A 4DB7A 1FCQA 1LBLA 3WMBA 3ABXA 1OYCA 2VC6A 4WY0F 4ZXLA 3RFAA 5M5DA 1CWYA 2PTXA 3DGRA 5AHMA 1E1EA 4IGMA 4W5UA 1HZYA 3CGTA 1O7AA 2CU0A 2QIIA 1JUEA 3VNIA 3APTA 3W86A 2A3HA 1QNPA 4H01A 4AC7C 1FDYA 1KFCA 3W87A 4JTEA 3GLCA 3F4VA 3NZGA 3KTSA 1KWGA 3CO8A 3IIZA 1GTEA 1WAWA 3UNDA 1JF6A 3PB0A 1XLMA 1BWVA 2PZ0A 2ZC8A 3WDQA 3TH6A 4G8TA 5AY7A 4DF1A 4IWWA 4DPQA 3T0TA 1CGUA 1XSKA 1A0EA 3TR9A 4DN1A 1MEWA 1JPHA 4KIEA 5TAOA 4CU8A 2PAJA 3GIYA 2FVMA 1VLIA 3VKJA 2DSKA 2BOFX 3AUJA 1HO1A 4ZSUA 1TV7A 3WBXA 3NDZA 3H7RA 5AECA 2YL5A 4K8EA 4O1CA 5DX7A 3KOWA 4PUMA 2J88A 3WF1A 1HKIA 3SUUA 3KW3A 2HE8A 3MYOA 3HIJA 4NJGA 3UY8A 2XJ7A 4BEQA 4QISA 1R86A 3DIPA 2QCDA 1BYDA 4OFCA 4X60A 2XN1A 4LXFA 1DIOA 1OVDA 4JXCA 3D3FA 4AU0A 4J4KA 3H21A 1SJBA 4WD0A 2GVGA 1GVRA 3B9NA 3PTMA 1CEOA 1VJSA 2OODA 4C1NB 2DSWA 1VYPX 1XSIA 1X1OA 2REQB 1HVQA 4MNMA 3F4DA 3VIGA 4GJ1A 4RE2A 2WKGA 3RU8X 3CXOA 3S5ZA 1E3XA 4QQ3A 1U1HA 3IJ6A 2NVCA 4EAMA 2C79A 4G2DA 1E0VA 1VFTA 5G2HA 3MMWA 1H63A 1L6YA 4IX2A 3RHGA 5EMKA 3TZFA 1SZNA 3RPTA 1Y5WA 1UQZA 1ONEA 2XUCA 1XG4A 3LYEA 3PANA 4ZQPA 3APGA 4UQDA 2OFJA 1V02A 4TX8A 1VLWA 3GYEA 2HJPA 3O9NA 1OZQA 3TMLA 3ARTA 1S2AA 5FACA 5FF4A 3S9ZA 4GK8A 5CPQA 4PCTA 1AW2A 4FO4A 4FXFA 1XW8A 4H6EA 4UTUA 3LLXA 5HPCA 2DW7A 3GXDA 4KWVA 4GXMA 4YJ5A 4A35A 1YQ2A 2IQTA 1LL7A 2Z24A 5LGXA 3VM5A 3B04A 4DWSD 4G6CA 4IT1A 3PSWA 2ZBTA 1VHCA 2GWGA 1FCVA 4PTMA 2G3JA 5KZ6A 1JCYA 4XIAA 3OW1A 3V75A 1TKKA 2PGRA 3O07A 3E2VA 3M6YA 4MUPA 1E56A 8TIMA 5HQEA 1XYZA 1TJ1A 2E5DA 1TPDA 4Q4QA 3MHUA 1L8PA 1KTNA 5BW6A 3M6DA 4YVXA 3REQB 4NYUA 3W7OA 2OEMA 3TTOA 1C29A 3V5OA 3H26A 4XK2A 3WL1A 4YNGA 5GPRA 1DP0A 3QH2A 3C8FA 1V3JA 3E0IA 1VEPA 1G5AA 1X1ZA 4BHYA 4RXFA 2NW0A 4B9ZA 2A2IA 3WLNA 2QKFA 5CC7A 1XIFA 3AO0A 4BQ3A 1QPRA 4GVIA 1TB3A 4I8YA 1D3GA 3K13A 1QPNA 1YDVA 4NKCA 4NZJA 3EA1A 1TZ7A 2D2JA 4HK5A 1H50A 8XIAA 4WUIA 4KEZA 2WZEA 5D38A 2KX9A 3CWOX 4JTRA 1K6AA 4J7RA 4WXYA 2YKKA 1E40A 4NY2A 4CQDA 1SR9A 4QS6A 5FL1A 3CHFA 2YCKX 3PBWA 1R8LA 1H7PA 2XISA 2C91A 1T99A 3NOEA 1YE4A 4FI4A 1BYCA 2OWWA 4REQA 2J9ZA 2DZTA 3R0KA 3LN3A 3UPBA 1XH0A 4NUWA 1UZDA 2HISA 1CGXA 3B8TA 5D03A 1ZCOA 3GNOA 1UR9A 1X98A 1KM6A 2WJDA 1ICSA 4H1ZA 2A7NA 1K4HA 3MQTA 1K9DA 1XRVA 3ME3A 4DNMA 1KM0A 3QZ6A 3BCJA 3E2RA 1WCGA 1F6PA 3DG6A 4UTJA 2QUNA 2WMIA 5I2UA 3PPGA 4HA4A 2BB0A 1J4EA 3FYYA 2YJQA 5DT7A 1J12A 3H7UA 4H7ZA 1A47A 1C93A 2Q8ZA 4O4VA 4X9SA 3UBPC 5D05A 2F9RA 1XFCA 4JTCA 3SY1A 5E6YA 4ROPA 3W83A 2OSYA 3NQDA 1CT5A 1XYMA 2BY1A 1H3GA 5EMMA 3FDGA 2V6AA 3CHDA 2MNRA 2ZFAA 1WP6A 1UH2A 3POCA 2PCEA 4UB9A 4OJYA 3GXMA 2NX3A 2P3ZA 3NPUA 3GY1A 2IKJA 3NQ7A 1CXHA 3JR2A 4GWEA 4QR6A 4AXKA 4U2YA 3L2IA 5REQB 4AWSA 1QT1A 1SFLA 3HJEA 2C1HA 1KRBC 4POCA 6ALDA 3LV5A 1SGJA 1BTCA 1HG3A 4B5SA 4FOKA 3CYJA 1LRTA 3DFYA 4JR5A 2GSJA 4PUDA 3WUBA 4ATDA 4JIEA 4PZVA 1LOQA 1EIBA 4C6BA 1ZJIA 3PULA 4MZYA 2IKIA 2VP8A 1GCYA 1FXQA 3LHUA 4QJ1A 4E2VA 4R7OA 4LVAA 2FZ8A 5DN1A 1SMAA 5HXMA 5D2YA 3NQ6A 5IOBA 4PMYA 5EIYB 1LT8A 3WBYA 2Y61A 4AMAA 1RCOB 2PP1A 1O4UA 2XPKA 3TR2A 4DXXA 3B0VC 2E0PA 1LTDA 3O0FA 2CHNA 2NZLA 5FIPA 1NWRA 1D3HA 3QPEA 4H19A 1L2UA 4AEFA 3HPFA 4GI9A 1OYAA 1EUNA 2CHRA 4NX0A 4GQBA 1ZPTA 5G1YA 1ZY9A 2VEIA 2R1PA 1CECA 1J2WA 3C5QA 2QPUA 2L5HA 4L61A 1J9YA 3N18A 3PPCA 1DQUA 2WC4A 1YTEA 3LCHA 4KS0A 1HGWA 1R38A 3RX4A 1A5OC 3N11A 4GZIA 1J79A 4HZMA 4IJBA 1N82A 4GABA 4KKXA 5CPSA 3M7SA 2ZTJA 1JR1A 3GH5A 5A2BA 3V0SA 1J6PA 3SUTA 4W9TA 1QMLA 4V1XA 1EDQA 1UWQA 4NZFA 3WFZA 3MS8A 1EF2A 4FHAA 3BLOA 4D9PA 5KZMA 4S2BA 2RDWA 3L0NA 5HNTA 2A1YA 3BTNA 5I7GA 3AMKA 3OP2A 4CKQA 3UD6A 4UNKA 3KOZA 2P1FA 2PE4A 4H8VA 1RV8A 1YYAA 2D0GA 4EVZA 4ZR8A 4LF1A 2EO7A 1QRQA 2VD9A 2V68A 3BQ5A 3NQ2A 3OBEA 3GIQA 4BR1A 2Z2UA 1GQLA 4WLCA 2PDLA 1REQB 3W70A 5E0KA 3MDWA 1XF0A 3TUUA 1JIBA 4AVFA 2VWTA 4N9BA 1YDYA 3GG0A 3OZOA 3AWOA 2P5NA 4DWDA 3DFNA 1IEQA 4AHOA 4L6DA 8A3HA 1K8CA 3ZS4A 3WDHA 5I77A 1I0DA 3MSYA 2V5CA 2E68A 2GLKA 1TV2A 2WJEA 1FWNA 1IE7C 3H22A 3ARYA 4GVHA 2J8FA 1ISVA 3PBGA 2PD9A 2AAMA 3T07A 4RNIA 2I57A 2DY3A 3S2CA 5HDRA 5CC5A 3PBMA 3QYSA 4O17A 1E9YB 3GNXA 2XFFA 3UNTA 1FFRA 1W3JA 5FF7A 1TTPA 4DAIA 2R1MA 1R85A 5A6SA 1TQJA 4IJRA 2Z6JA 1BAGA 1Y7VA 2CWXA 5I3DA 4L4OA 4F66A 1JUKA 1H2JA 1ZTVA 5M3WA 4B2DA 1GONA 4MGGA 5G2WA 1S1PA 3A4WA 4LY8A 2VEKA 2WMKA 4ZZ9A 3A4XA 3NIYA 5CBBA 3SAZA 4J40A 1W3LA 5L9FA 5ABFB 3TXVA 2Y7FA 4J3UA 2FZMA 3LENA 2W5FA 4S3KA 2XVGA 3GG1A 4AIUA 2A6NA 5I3JA 2DP3A 2ZX5A 5MKGB 1U22A 5F4WA 4HMNA 2CKRA 2W0UA 3W29A 2ZRVA 2GJRA 1W9UA 1W9VA 3KEHA 3EAUA 1E4IA 5EMLA 2DH2A 5AHIA 2C6QA 1YEYA 2J77A 2J13A 2C7FA 1IXQA 3RF9A 5HULA 5M1TA 3R43A 4J1OA 4NXSA 1I2OA 3VNLA 4US5D 1YIXA 1RALA 1KGUA 5CJMA 1XR2A 5LA0A 3QEZA 5D9OA 3KOFA 4CQAA 1G1YA 1Z32X 1CB7B 4IL0A 5A3HA 1IXPA 2XN0A 4LOCA 2G4FA 2OLHA 2VM8A 2WHJA 1MEHA 1QAPA 1W54A 1XBVA 4EXQA 5A2AA 2VQUA 1XIBA 4FNSA 4UFKA 1FHLA 2ICSA 4HCDA 4I7WA 3ITLA 1M04A 4H2CA 1T40A 3VNDA 3CT2A 2EPNA 4HU8A 2JE8A 3WF4A 3T55A 3VIOA 5HAOA 5JQ9A 1GOQA 5T91A 3GZ3A 4KT2A 4P7OA 4H6RA 1GZJA 2NQ9A 2FB3A 3W7CA 5XIMA 2ZYFA 3AHXA 3NOYA 3K30A 4P8XA 3LCFA 3HBLA 4CD8A 4AEEA 2ZZ3A 1TRDA 2QLYA 4HMCA 1C7TA 3FEMA 1EJWC 3LM3A 4H41A 3LCWA 3WNNA 2PF0A 1HF6A 4DJED 1RR2A 3JZUA 1J0KA 3W01A 1X97A 5IRPA 1B9ZA 3WJYA 2GVLA 3CUJA 4ERIA 4NILA 5ABGA 1MMFA 1QI0A 4KFOA 3MMDA 4FNQA 1KFWA 1CXFA 4HU4A 1TPB1 3TA9A 1T96A 4FALA 2E67A 3PB2A 1SJCA 1VQTA 2XIIA 4HSNA 4DBEA 2Y24A 3VXGA 2E5CA 5E0CA 2ZUTA 1JD9A 2GOKA 4GVFA 1PB0A 2WPBA 3N13A 1AZ2A 1QPOA 2QDHA 1SZGA 1D2KA 1DIDA 1DXFA 4I5UA 3U5YA 1S5MA 3OODA 1I45A 5I02A 3K2GA 1V03A 2VDGA 2I56A 4AAJA 4U31A 3Q65A 2NXHA 3M46A 1P43A 4FXSA 1RCXB 2XH4A 3LBCA 1V6YA 1B3WA 3A5FA 2OZTA 1H0IA 3CBWA 1ALDA 3VUSA 1V0NA 1UWUA 4B5XA 5LA1A 1M53A 3SY5A 5KEZA 1O1ZA 4E2OA 1AZ1A 3BL3A 1IHIA 1ESWA 3A3XA 4DO5A 4LAZA 1VPXA 3IANA 4XKYB 1YNYA 3PNZA 3EXTA 4K6AA 3LOTA 2RDTA 4H8UA 2V82A 3CM4A 4LVGA 4WSKA 5D8WA 3EX6A 4DNHA 4ATWA 1UR0A 3GTHA 1W3KA 3KZPA 4TV6A 2JFEX 4QSFA 4LUSA 4DO7A 5GQBA 1N2VA 1LWHA 3TU9A 9RUBA 1OBAA 5EPDA 3GDMA 3BXWA 1RHCA 3AXIA 5CKSA 1UR2A 3CAWA 1Q66A 1S38A 4IM4A 1G0CA 1QU4A 3BCDA 3RITA 2G3MA 4IFRA 4CQ8A 3WNKA 2PWHA 5D2XA 1XYFA 1GKPA 1E6ZA 2J62A 2QHAA 2H6RA 4AEOA 1V0MA 1VB9A 2Y8KA 1A5MC 1DE5A 6REQA 2GJLA 3VFLA 1XYAA 4LVBA 1GG0A 3RUBL 3NPWA 2I5IA 3OO2A 5CAHA 1E15A 1ELSA 3IK4A 4GOAA 4DJEA 1NARA 2B31A 1EC8A 3C3UA 3UWVA 5KZDA 1EP3A 5HQMA 3P74A 3TQKA 3HZ3A 4LU0A 4A8IA 3BWWA 4I9TA 3C52A 4EXBA 4E8CA 1U5VA 3UERA 3WQ4A 1PUDA 3W02A 2B4GA 1QHZA 3DU0A 3RN6A 1JG9A 4HZ8A 1B1YA 7TIMA 5LNWA 5FSDC 3EDJA 4D6IA 2J7EA 2WXDM 4G5DA 1KCZA 1A5LC 4PUUA 3U3HA 2BX7A 2Y7EA 3O8AA 3VKCA 3V5CA 1KM4A 5KTLA 1J0JA 1G94A 2WM0A 3GR8A 5E09A 3S1XA 3B9DA 3UF9A 3B4UA 2J7CA 1JNEA 3R8HA 1WE5A 1JZ6A 4GY7A 5CJNA 1Q63A 5EMYA 3IJIA 5AYZA 4A2RA 4FXJA 3BK0A 1R30A 3FVMA 1ZZMA 1QK0A 5BWFA 2OLSA 1ADDA 2HDJA 1PHWA 4I7VA 2YL8A 4N0RA 4F79A 2DZVA 4DM2A 2VRQA 3HM7A 2Z28A 1QI3A 1BTMA 1F2JA 5LSMA 5C9RA 1TWSA 2AOSA 2EXOA 3SRFA 2ZRUA 3P0XA 1VKFA 1XLCA 4IG2B 3IEBA 3KXQA 1U1JA 4JQAA 1XL9A 4CD7A 4QS5A 1IQ8A 3NL6A 3QY6A 1GOXA 2FFIA 3TA6A 1G01A 2F6UA 1HKVA 1QNVA 4LVDA 3RIKA 3O05A 1DWGM 4IPIA 1X7FA 3QZEA 4A8LA 4TVDA 1WV2A 4GXWA 2PDBA 4H4IA 4DPPA 3PZQA 4PFMA 2KAUC 1JRBA 3ITOA 1RK5A 1H49A 1YNPA 2BLEA 3NL3A 4KRUA 4HN4A 2VFFA 3WIJA 2FPYA 1UD5A 2ZUWA 3LNPA 3KWSA 1FWHC 4LBRA 2FDSA 1LBMA 4QM1A 1JGMA 3SUSA 1EGZA 3N4EA 1EXPA 1XYCA 3HMCA 1FH7A 2OYKA 1ONRA 4CN6A 5DXXA 3E96A 2D69A 2XH7A 3MUIA 2I14A 3BG3A 1KBBA 1UCWA 1RUSA 1HO4A 4QNEA 2FPTA 3LPFA 3UWQA 3NEHA 4S3CA 3KP0A 3P80A 3VZYA 3VZXA 5D8ZA 2Y8VA 1UYQA 4A8NA 5C9ZA 3W7QA 4YN5A 2GDUA 3VKAA 3T78A 4H9MA 3R11A 2GSHA 3TYCA 4ZO8A 4DWSC 1KCLA 4GI8A 1KFBA 1UH4A 4D8AA 3UVIA 1US2A 1B30A 1ZJAA 3C2YA 4GLEA 3GTXA 3PBVA 4HG6B 2D2GA 4PULA 1HL8A 1L2QA 4L9XA 3LGDA 1E55A 1VR6A 3DENA 1JYWA 5I6SA 2PPGA 1QVBA 2PTZA 4KH2A 2ZZ6A 1VAHA 3S0CA 2DZWA 3HJZA 4PN2A 3A9BA 2INEA 1I6NA 1PHQA 3MBDA 1NDVA 4HA0A 2CBVA 3QF0A 3FHAA 2HS8A 3GQYA 1IT0A 3QMRA 3TX9A 1TG7A 1JXKA 4W86A 5A6LA 5CLWA 3KTCA 1DBTA 7REQA 1PWMA 3CUFA 4LT9A 3ES7A 3QV7A 3IIPA 4O28A 2QCFA 4Q4KA 2YCLB 3VCNA 1QHPA 1W56A 3CAKA 2HVOA 4O1EA 1JI2A 3S47A 2BVWA 1AH4A 1O68A 2VFIA 1ONWA 4TMBA 1E6SM 3CAQA 3BURA 4NJKA 1LCOA 4QG8A 2A3AA 2J7BA 3B9AA 3NZ1A 4D71A 5J8LA 2FGBA 5GVJA 3UXLA 5C9WA 1CENA 3FV9A 4ZOAA 3A3HA 5F2MA 3UESA 5HWNA 5IHSA 3GXPA 3FHQA 1ME8A 3GVGA 3IS4A 4XIMA 1NDYA 3BAYA 5F2LA 1UKSA 1A5CA 1TTJA 2PU1A 3HQNA 2WZTA 1TPWA 4ASTA 4H00A 2FHCA 1P0DA 3USZA 3E2SA 2PF8A 3IGXA 3BLIA 2V2HA 3OLDA 4PFHA 4Z0SA 2QCMA 2HRWA 3M0ZA 4EP8C 3SQSA 3AYSA 1BF2A 2Z25A 4ZEPA 2HSAA 1C90A 3G1VA 3S5NA 2ZA2A 4WZHA 3UPWA 4JYFA 2JEQA 3V1PA 4DJDA 2X0YA 4O1FA 5DRIA 3LDVA 4ZOCA 2OQHA 4GISA 1V6VA 3WD2A 1H62A 1XX1A 4AZ5A 1GJUA 3P5YA 3CHVA 1T5AA 1B9BA 1C91A 1XP3A 3OYZA