1L8NA

The 1.5a crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1, complexed with 4-o-methyl-glucuronic acid and xylotriose
Total Genus 278
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
278
sequence length
675
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRWWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords ALPHA-D-GLUCURONIDASE
total genus 278
structure length 671
sequence length 675
ec nomenclature ec 3.2.1.139: Alpha-glucuronidase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1l8nA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1l8nA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1l8nA03
3CUFA 4CD6A 5ABEA 4NZCA 2ZUUA 4P7NA 1PPIA 1JZ4A 3VM5A 5I24A 3WL0A 1LWHA 4EK7A 1K9FA 2FGLA 3UERA 4JFUA 4LYRA 1UD4A 1GOKA 1HVXA 1JZ7A 2WNWA 3LPPA 1RP8A 3EDFA 3AZSA 1KXTA 2B31A 3OGRA 1W9UA 2V3FA 1DWAM 1R87A 1A47A 2OSYA 1LF1A 1UUQA 2VL4A 3AOFA 3ALFA 3AXXA 3TONA 3VIIA 1DWFM 1B3VA 2YIHA 5A6LA 2V3GA 3VIMA 3DYOA 1PX8A 1JZ2A 3AIBA 2OYLA 1JAKA 1HNYA 1JYVA 1KQYA 3AIWA 1W2VA 5A6BD 1J0ZA 4UOJA 3WL1A 3MV11 1S46A 3MMWA 4AIOA 2GDVA 2VX5A 1HIZA 3LPOA 2CBVA 4R5EA 3WELA 3WF0A 3WQ4A 1RPKA 4HPHA 3PBGA 4K68A 4D6CA 3N9KA 1Q6GA 1QW9A 3T08A 2Y2WA 4OKDA 3WMSA 2J62A 5C71A 2XGBA 3WUFA 4PTVA 1J0KA 4WKHA 5A8OA 2Y8KA 3IJ7A 1PAMA 5I0DA 1B3YA 1XYFA 4F9JA 1KGXA 4F79A 4PTWA 4GKLA 4MB1A 5A6KA 4UQBA 2FH8A 1HJSA 1BYDA 3NDZA 1G0CA 4WKAA 5DT7A 5GNZA 3EDJA 4EE9A 3GNOA 1AQ0A 2PBOA 2WC3A 3AMLA 1HJVA 1PEZA 1XCWA 3SCNA 1QHPA 1E6ZA 1BYAA 5E09A 1E43A 5IDIA 2BY0A 3S2CA 1B1YA 1NH6A 3T09A 2HISA 1GNXA 2BY1A 4Y7EA 3B8SA 3A4XA 2XJ7A 1PX4A 1K9EA 1JYXA 2WMIA 4W5UA 2VCAA 4FF5A 2G3IA 3T2QA 4BA0A 4W5ZA 4AZ7A 3WFZA 1XH0A 3IJ9A 3L2MA 4X9YA 2NW0A 1XSKA 1E4LA 2E0PA 1UWSA 4KGJA 3WMCA 3VU2A 1V03A 3QR3A 4U5KA 2OSWA 1MQRA 1GQJA 2A3EA 2W91A 3FN9A 1PZ3A 3VO0A 2V5DA 4AD4A 4D6JA 2J8GA 2PWFA 4MAZA 1BTCA 1QNQA 2DSKA 4DM1A 4MNKA 3AFBA 4E2OA 3CZ8A 3K4DA 4L4OA 3RJYA 3HMCA 2CEQA 3K8LA 3AIQA 3BH4A 1J0JA 1KQZA 3WQ6A 2DIEA 1OSEA 2EO7A 2CKRA 3WDJA 2E40A 2QF8A 2VRJA 2O9RA 5D9OA 1H0IA 4X0NA 2F61A 4P8UA 1ZU8A 2WMGA 2XIIA 1UKTA 4JKKA 1UD5A 1E4IA 1WCGA 1UKSA 5I5RA 2MANA 4AXNA 3CHCA 3WNKA 5E70A 1VEOA 4TUFA 1E3XA 1E6RA 1JGIA 2VC9A 1KWKA 3KL5A 1E15A 3FNDA 3W37A 3WNPA 1E6NA 4P7RA 3T2PA 3SUVA 5GPRA 3GH4A 1TFVA 2CKSA 5E0FA 3ARUA 1XD1A 1TZ7A 2XSBA 3CH9A 5FIPA 2XYLA 1JNDA 4HU8A 4CD7A 3AS0A 1DHKA 1WNOA 4JCMA 3WD2A 1VFFA 2YBUA 3UCQA 1KBKA 2GVYA 4QP0A 3U7BA 2WMIB 3SEPA 2EPMX 2YOCA 1RD6A 1GVYA 3OG2A 1OT1A 1FOBA 1E55A 4N0RA 2ZXAA 1UZ4A 1XCXA 5A94A 3RCNA 4B16A 3ARQA 4OZOA 3ZIZA 2WBKA 3EMZA 2VCCA 4UQCA 3VD3A 3ZR5A 3BAIA 2XUCA 2ZUTA 4LX4A 4D6IA 2XFFA 3AIRA 5BXTA 1ISZA 1X6LA 2W5FA 3AYSA 3L4ZA 1OM0A 1W9BM 5FKYA 2GSJA 3F5LA 4YHEA 1B3WA 2J77A 3AMCA 3KZSA 1G5AA 2W67A 2J79A 3VDBA 1MW2A 2DT2A 4JCLA 2WMHA 2DEPA 4C7FA 5BXSA 5BWFA 3DHPA 1HP5A 1VRXA 3MV01 3PHAA 1KGWA 4GO9A 5AYIA 1WDPA 3FHAA 2V3EA 1GONA 1QNOA 4WSKA 5BRPA 1GQLA 4TTGA 1BVNP 2PWEA 2JFEX 4PYSA 4ACYA 3ZQ9A 3WDRA 1EQPA 1ZL1A 4MAVA 3UR7A 3M46A 4PTXA 2YLAA 2QPSA 4MPKA 2EXOA 2VRKA 4GQQA 1H2JA 5A8NA 2ZUWA 2ZOXA 5D9PA 4MB4A 1M53A 2G3NA 3GM8A 1LL7A 3ZR6A 2DSZA 1E4NA 5GNYA 2J7GA 3WBEA 5EFDA 1GHSA 2WB5A 5FL1A 1JXJA 3B9AA 3EDKA 1TCMA 1KXHA 2OYMA 3VTRA 4OBSA 5ABFB 4GO8A 1OIFA 4C7GA 4AZIA 4HMDA 1C7TA 1EDGA 4PEEA 1Q6CA 4CVUA 3QHNA 3A3HA 1Q4NX 2VR5A 3AIUA 1OGSA 1HF6A 1QHOA 3ZT5A 2FDMA 3A4AA 4CVWA 4ZFMA 3UETA 1UKOA 4H7VA 4J3VA 1GPFA 4UOQA 1XH1A 2W63A 5M17A 1GQKA 1TE1A 3DC0A 1B9ZA 2YKKA 4Q7NA 1W3LA 4DUWA 1CLXA 2EQDA 3W81A 1JL8A 3RDKA 2WZHA 2QMJA 3VKKA 5A8PA 4UZUA 4ACZA 3VILA 5ABHA 1TR1A 2VX4A 1ZBCA 3UESA 3VGDA 3WENA 1BVZA 2QMKA 1RH9A 4AIEA 4M1RA 3AHVA 2EPOA 3N11A 1YHTA 4ZXLA 3MS8A 4JFWA 2E4TA 4AZCA 3HN3A 3NCOA 1H41A 2BHUA 2WZIA 3ZSTA 1UG6A 3TP4A 1QI4A 3RJXA 2VX6A 4QLKA 4QCFA 1DTUA 5I78A 1HKKA 4W7UA 3AISA 1UD3A 2CHNA 1FHLA 3SUUA 1MWOA 1CZ1A 3AZTA 1WPCA 4PMYA 1W9VA 4GZIA 2FGZA 3T0AA 4GZEA 3GXFA 3BC9A 3W6LA 3VDCA 1GUVA 4OOUA 1W3JA 2VT0A 2DDXA 5I3DA 3AMDA 3WDQA 4W7WA 1JF5A 3GTNA 2VURA 3VMNA 1ZBVA 2WHJA 1U2YA 1CXIA 1AVAA 5JIPA 1VJSA 1QBBA 2CHOA 3W53A 1CGUA 1W3HA 3VNYA 1B0IA 2GUYA 1CECA 4LYPA 3HJEA 2YA1A 3PTQA 4CU6A 4AEFA 1E72M 5CPTA 2XM1A 1WDQA 2DH2A 4F66A 1NARA 1V6UA 2QV4A 3ZJ7A 4HU0A 4JL2A 1V0KA 4NRSA 3WD0A 3BLPX 4W88A 1W91A 5BRQA 3ALGA 3GH7A 4WJXA 2CBIA 3GH5A 3NIYA 4BQ4A 2XVKA 1GORA 4UQ9A 4WF7A 2CCRA 3PZOA 3ZMRA 1H0GA 1LG1A 4QCEA 2AOSA 5ECUA 4GXPA 4KRTA 1ISXA 3VX0A 3BAXA 4MB3A 3II1A 3N15A 4TXEA 3WUBA 1ZS2A 1SMAA 3BCDA 1I1WA 2WSKA 3PZVA 4TTUA 2V3DA 3SCUA 1RP9A 4PMOA 1GHRA 3WIJA 1HP4A 3CLWA 1KB3A 4WIWA 2W4XA 2IXUA 3UEQA 2J74A 3VD9A 2DT0A 3WD1A 3CTTA 3PTKA 3AIVA 4W8LA 3EDEA 1BG9A 1I75A 4D6HA 1UYQA 2X09A 3TTSA 3W26A 4GINA 4MNJA 1OGBA 2DPEA 3W24A 3ARRA 3DHUA 1C8YA 1HVQA 2A3BA 2ZX5A 2XSAA 4KWUA 2ZE0A 4UZSA 3WF3A 3WQWA 1GOMA 5DFAA 2ZX6A 4NRRA 2XGIA 4F8XA 1BHGA 1EXPA 5CGMA 4KH2A 1VEPA 4HP5A 3WH5A 2VZSA 3ARTA 1CXKA 2BNJA 3W4RA 3A47A 3IAPA 1KCKA 4A3YA 3ZJKA 5E6ZA 4HA1A 2J8FA 4M24A 5DEZA 5KZ6A 1G94A 1V0LA 2D1ZA 5JBFA 1VB9A 2G4FA 4M80A 1FP9A 2VZVA 3MUY1 1ECEA 4D6DA 1UZ1A 2CETA 1J0HA 1H09A 1Z32X 5A6SA 2J25A 4KRUA 2JALA 5E9AA 2VZTA 4CCCA 4HZ8A 4W7VA 5CJ5A 3FAXA 4Z2IA 2J47A 5AY7A 5D4YA 4TVUA 3UG5A 1UR4A 1WDSA 2DQXA 2WLYA 1VBRA 1EQCA 5I2UA 1VENA 1W9PA 2JIEA 4LQ1A 3QOMA 4BQ5A 3VIOA 4D6EA 3SCWA 3FW6A 1J12A 5CQ1A 3N18A 4PUEA 4UTFA 1G01A 4KGLA 3GNPA 1D2KA 4MJ4A 5DT5A 5GNXA 3ZSSA 3TTYA 2VX7A 1OINA 4E4PA 3CZKA 3W0KA 3EYPA 3BSHA 3ARZA 3WKZA 4H04A 4OJYA 1EH9A 4FK9A 3OLDA 5CG0A 5M03A 4HMEA 1PIGA 2F2HA 2WC7A 3PZQA 4MDPA 2VRQA 3GXDA 2WMKA 4WK9A 1JDDA 1VAHA 2WXDM 4PMVA 3POHA 1CWYA 1NOUA 1GJWA 4QLJA 4JHZA 1XC6A 4GQRA 2BVTA 2ZIDA 5CPQA 3THDA 2NT1A 3KE0A 4URIA 1NOWA 5JIWA 2Y4SA 2VZOA 1OT2A 1Q6DA 4AMCA 1N82A 5ABGA 3HU7A 4HOWA 4AIUA 1BG4A 1V0NA 2WANA 4BZYA 1NM9A 3W38A 3AHZA 4YHGA 5CLTA 1K9DA 2VTFA 3WY1A 3CZLA 2XM2A 1E9LA 4U2YA 4IM4A 2PWDA 1OD8A 1BFNA 3VIHA 2WCGA 2ZUNA 1CDGA 1FFQA 1IV8A 3BAKA 2ZXBA 1JDAA 3FAWA 1WZMA 3F5JA 5A6JA 3T2OA 1HL8A 1HKIA 1TUXA 1DWIM 1SFSA 2XFYA 1SR0A 3WNNA 4ATDA 3AHXA 4AISA 2X0YA 2XG9A 2V5CA 1DWJM 1H4PA 4UFMA 3MUZ1 1HXJA 4RE3A 5HDRA 2Y8VA 3WNOA 3AQUA 1H1NA 1DEDA 3VX1A 3WF4A 2CYGA 1EHAA 1VEMA 1FHDA 3PN8A 1BYCA 4YN5A 2EPLX 2E8ZA 3BXWA 4AYSA 2PB1A 4CGTA 3L4VA 5IFTA 1CGYA 3CGTA 4J3UA 1HJXA 3T0BA 5BROA 1VJZA 3RO8A 3VD4A 1QOXA 2W92A 5DO8A 1XHGA 1K9TA 1ZBWA 2BV9A 1OBAA 4AD0A 1KR0A 1J18A 2XVNA 1J9YA 1PX3A 6A3HA 3K8KA 3VNZA 1R7OA 2WWCA 3I3EA 4AD2A 3AYRA 2DIJA 3W25A 1I1XA 1XV8A 1BF2A 1UWTA 1LLOA 1BLIA 3GBDA 4WKFA 4CN6A 4IISA 4MNMA 1B30A 1E0XA 1AQHA 4QFUA 4HOZA 1O6IA 1V3KA 1EGZA 3T0DA 5BXPA 2D22A 2EPNA 1KWGA 3UG3A 3I3DA 2EJ1A 2D3NA 4UFLA 3QGVA 1H49A 4JHOA 2WLZA 1W3KA 2G8ZA 1R7AA 1EOMA 1KGUA 1LJYA 2VOTA 4UCFA 1VBUA 1M03A 1Y7VA 2PBGA 4MNLA 2YL5A 1WE5A 1KBBA 1CXLA 1MW0A 1JF6A 2PWHA 1UD2A 1UR8A 4CUCA 1ODZA 5C8BB 5D9MA 4H41A 4UQAA 3AMGA 1JD9A 5GQBA 1GQIA 2WKGA 4A4AA 4U33A 3CUJA 1F4AA 4P7OA 2D23A 2W66A 2C7FA 2DSUA 2O92A 3VMPA 1GOIA 2CIPA 3NDYA 2JEQA 3MSDA 3CPUA 3E1F1 3WD4A 2G3MA 3CIVA 5HXMA 3VM7A 4CKQA 4MTVA 4DWSB 4AC1X 1VIWA 4KMQA 1V3IA 2CITA 1LL4A 4W84A 4B15A 1Q6EA 1JI2A 4UQEA 3ZM8A 4RE4A 3W28A 4ZE5A 3OGSA 2RGMA 3WH9A 4DUVA 2G3JA 1G9HA 3K4AA 3L4YA 2J7EA 1C92A 5HPCA 1OCQA 4H8VA 3WDPP 1EIBA 2WMJA 3DYPA 4BF7A 4PTMA 2GJXA 4PMRA 3POCA 4AZ6A 4JFSA 5I77A 2CBUA 3VIKA 3LMYA 3O9NA 5LA1A 2BVDA 4PRWA 1W32A 1O7AA 2VO5A 1R86A 3L4TA 3ZOAA 1C93A 3AI0A 4D6FA 1QI0A 1CXHA 3SCQA 3WN6A 5JBDA 1B2YA 2CXGA 3U5YA 1E5JA 2X1IA 4PMDA 3ZO9A 2W61A 1LL6A 5I23A 3NYDA 1B3XA 1E0WA 4YPJA 1SMDA 5HOSA 3GZAA 3CMGA 4BQ3A 4FLRA 5EFFA 3L4XA 1WB0A 4IPLA 2BY2A 1HJUA 3PZUA 3AXIA 5A6MA 4HA4A 1E70M 1ZJAA 4AZHA 1XSJA 1B31A 4NSBA 1PIFA 3PZGA 3A6OA 1GOQA 2GJRA 4HZ7A 3GBEA 1QNRA 2ZICA 1EO7A 1UWRA 4UR9A 5CXPA 2BS9A 2VQTA 4PMXA 5A8MA 3QOKA 3AS1A 3ARWA 4QAWA 5E0CA 1NQ6A 1LWJA 3CUGA 4UFIA 1JIBA 1W9DM 2VR4A 2D3LA 4D1IA 3KEHA 1W1TA 1CIUA 3N04A 4U31A 5A95A 2YJQA 2ZX7A 1J11A 3VOCA 3CUHA 3WDIA 1C8XA 1QNSA 3K46A 5CPSA 2ZWZA 4AD1A 1V0MA 2YDRA 2YA0A 2BHYA 2VJXA 2YL6A 2ZWYA 1MVYA 2QPUA 2ZX8A 4Q22A 2XWEA 3WF2A 3MUAA 5F7UA 1CYGA 3CBWA 4A3HA 5EMYA 5A6BA 1B90A 1US3A 5LA2A 2G41A 2YL8A 1V3HA 4CU7A 2OWXA 3D5HA 3M7SA 2WWDA 4DUXA 2WVSA 5TD4A 1GW1A 3VDHA 3CZEA 3LPGA 4XZBA 1K6AA 2PC8A 1J0IA 3BLKA 1PBGA 2WC4A 2VVSA 1XSIA 5BCAA 1E6SM 1EHNA 1CXFA 1D3CA 4PMNA 2YDQA 7A3HA 4U2ZA 2IUZA 3MKKA 2CPUA 2X8RA 4MJ2A 5CZKA 4PSRA 4J28A 4CCDA 1UQYA 3QHOA 3N17A 3S6TA 3VGEA 4CN4A 4D6GA 4P8XA 4H2CA 2OWCA 1DWGM 5AC5A 4UFKA 4U3CA 2J7BA 1BSIA 2WCSA 3SCRA 2D0FA 2YA2A 1UHVA 2WZEA 1CGTA 2BXZA 1B3ZA 4IUGA 1HN1A 3BMWA 4UOZA 3EMQA 5CSUA 1QI3A 2FHFA 2XHYA 3MO4A 1LG2A 2D0HA 2ESCA 1WZLA 3G6MA 5KEZA 1HKJA 3WBAA 3A4WA 2OYKA 3WNLA 2AMGA 2WVVA 1UKPA 4Z2GA 1HT6A 4AW7A 4M8UA 1UWUA 1HKMA 1GZJA 4IPNB 4UNIA 3AS2A 1UKQA 1M7XA 4V27A 3TOPA 3AZRA 1BGAA 3VIPA 1E4MM 4XB3A 1US2A 2UY4A 1JFHA 4PCTA 4J3TA 2GJPA 4PMUA 3FY1A 3OIHA 4LXFA 2TAAA 2UWFA 3VIGA 1W1VA 1MFUA 3D3AA 5CLWA 2QHAA 4FLOA 2X05A 1PJ9A 3BAWA 3PZ9A 4LPCA 1TA3B 3W82A 4DM2A 1UWIA 3OBAA 4OOZA 4P8WA 4PSPA 3G6LA 1BAGA 1GJUA 2DGAA 1UH4A 5A69A 1FH8A 4ZENA 1MW3A 4AD5A 4J3WA 3O6AA 2E9LA 2JIWA 3APGA 4AWEA 1UR1A 5A2AA 4UFHA 2O9PA 3AXHA 1JZ6A 2PI6A 4H8HA 3VPLA 1JI1A 3VUPA 2CERA 3WFLA 5FL0A 4GI9A 3I3BA 2DH3A 2XVPA 3SIMA 4QLLA 3OGVA 3PZNA 4HZ6A 2A3HA 1E1EA 3TTOA 1NWTA 2J78A 3WEMA 4J27A 2IXVA 4GZJA 1QVBA 3VMOA 1P6WA 1VF8A 3SCSA 1NP0A 2GFTA 1NWSA 3WQ5A 3VD7A 1WZAA 4N42A 5A3HA 1JZ3A 1E71M 4OUEA 1W2PA 4Z2LA 5CSYA 3VD5A 4LYQA 1JXKA 1ZJBA 2JEPA 5FD0A 5E6YA 5M5DA 1KXQA 3PZTA 1W1YA 4FLSA 2XIBA 3SUWA 2BY3A 1HJWA 1W9XA 1V6YA 1ISVA 1CGWA 1V02E 2GK1A 1OWQA 3DECA 7CGTA 2YL9A 4HOXA 3RMEA 4GIAA 2YLLA 3BGAA 4EANA 2OLHA 2O9TA 2VI0A 3WQ8A 4B9ZA 3WEOA 2PWGA 4H8UA 4D72A 1OGGA 3L4WA 4J3XA 4ATLA 3MMDA 5LYRA 4W85A 4CD4A 4B9YA 1AMYA 3VGHA 2DSWA 2ZXDA 1JYWA 2QLYA 1V3JA 3WMBA 4QDMA 1EDQA 4LGXA 3RM9A 1NOFA 1UWQA 4V28A 3AMKA 4C7DA 5C70A 3ECQA 1HX0A 1UR0A 4DWSC 3THCA 3OZPA 1UR2A 3BSGA 4AD3A 4ML4A 1LQ0A 3F5KA 1CXEA 1E3ZA 2GDUA 3CMJA 4BQ2A 1EA9C 2WMFA 5BYWA 2OSXA 5FOOA 3CUIA 1GOWA 3ARVA 1TA3A 1OD0A 3WQVA 4GI8A 1UQZA 2E3ZA 1JNEA 5ABFA 3B9EA 2ZUMA 1QBAA 3LPFA 3VGFA 3SCOA 1DP0A 3SCVA 3AROA 3IJ8A 1CLVA 2E8YA 1M01A 5D9NA 2WYSA 5D8ZA 3VIJA 1R8LA 1J10A 1UR9A 4CCEA 1E6QM 1C90A 2VQUA 5IHRA 4XUYA 2A3CA 2YDSA 2E9BA 4PMQA 3KL3A 3U7VA 1MFVA 4HMCA 4MADA 3ARYA 4OBRA 4B3LA 4W8BA 1A3HA 1V3MA 4XZWA 4DWSD 3QHMA 3KWXA 5A8QA 4ZXOA 2F8QA 1VFMA 4M56A 5AC4A 3ZJ8A 4EKJA 3WH7A 1X6NA 2O9OA 5A2CA 3L2LA 1FA2A 1IT0A 1XRVA 2X0HA 3ARSA 1M04A 3WEZA 1GOOA 1OB0A 2XWDA 2WCAA 2WVTA 3DYMA 2FHBA 3JUGA 4TX6A 1WZKA 2UY3A 1TG7A 2NSXA 2ZX9A 8CGTA 3U5UA 4U5IA 4B3KA 2J7DA 3ZT6A 2XVLA 3EMCA 4HTYA 4RL3A 3WD3A 3CHFA 1H11A 1CNVA 4CD5A 4ZE4A 2WSPA 5EB8A 3RM4A 1WP6A 1FH9A 1CEOA 3N13A 1UH3A 2VVNA 1XYZA 1XH2A 1EDTA 2D0GA 2NT0A 4PUDA 4Z2HA 3N1AA 4AZBA 3ZT7A 3GDBA 3NUKA 1TMQA 2WAGA 2V38A 1IZJA 6CGTA 1JDCA 2X2YA 5M3WA 3MSGA 3SCPA 4W8AA 3OLIA 2AAAA 5HBFA 2ZXQA 1JD7A 3UR8A 1XD0A 4JKMA 4ZEPA 1C91A 4JZ5A 1WDRA 1MW1A 4J3SA 3W27A 3WH8A 1E6XM 1CENA 2ZUSA 2RGLA 1V6VA 3VGBA 3ARPA 3L4UA 1UOKA 1EOKA 1BPLB 5HPOA 5JBEA 1WAWA 3GNRA 3MANA 3EDDA 4M81A 3NSXA 1UD6A 2FHCA 4FMVA 1QHZA 4DWSA 1BGGA 1UA3A 4HA3A 4PBGA 1H5VA 1X1NA 2YBTA 1KFWA 1SYTA 2HVMA 3RM8A 2Y5EA 4ATWA 2VNCA 3VDAA 1JAEA 1E0VA 3OLGA 1MXDA 1BYBA 4CD8A 4X0VA 2JE8A 1H3GA 2VMFA 1JFXA 5IFPA 4HPGA 1NP2A 2J7FA 4D1JA 1EO5A 2DSVA 1MQQA 1GCYA 7TAAA 1JYNA 2UY2A 3WH6A 4PCSA 1UA7A 2WVUA 3VINA 4WSJA 5HNNA 4E8CA 2Z1SA 1G1YA 1IZKA 1ITCA 3TTQA 4BCEA 1WO2A 4P8VA 1CPUA 3WDHA 4JKLA 2WHLA 1JG9A 2FH6A 3CO4A 3MU7A 3BMVA 3AHYA 3WF1A 3MMUA 4JAWA 3FXYA 4W89A 3WUEA 2E9MA 1QI5A 3W6MA 3TA9A 3N12A 2XPKA 1FP8A 5A2BA 1WKYA 4OIFA 4W86A 2WKLA 1YQ2A 1V02A 3CHEA 1V6XA 1BQCA 1QW8A 2WHMA 1J01A 1E73M 2DT3A 2JF6A 1CGXA 1F4HA 1ISWA 3NJ3A 3OA5A 3MUIA 1NWUA 9CGTA 4XX6A 3WSUA 1UH2A 3BCFA 2A3AA 4PN2A 3PTMA 1L0PA 4NI3A 3J7HA 4M29A 4GI6A 2WK2A 1D7FA 2D2OA 4TVCA 2VUYA 1MYRA 2J7CA 3CHDA 3IAQA 2WBGA 4AEEA 1ESWA 3AIEA 3SCTA 1V6WA 1QI2A 4GPNA 4PMZA 1KXVA 1TVPA 2EBNA 1C8QA 3CZJA 4MDOA 1E56A 5EBAA 5AYBA 4J7RA 1ZB5A 1GVIA 3W29A 3ARXA 5A1AA 4L4PA 2XVGA 3K1DA 4FLQA 3RPMA 5JUVA 4S3JA 3FHQA 1R85A 4W93A 4U3AA 1AQMA 2BFGA 3OLEA 1CBGA 1ODUA 4JFVA 1JZ8A 4ACZB 1J0YA 1C3FA 5BXRA 4M82A 3F4VA 2BHZA 4CN1A 1PZ2A 3U57A 8A3HA 3K8MA 1HL9A 5DMYA 1QNPA 4WLCA 3M6DA 1DWHM 4TX8A 6TAAA 4BS0A 1U30A 4E8DA 3NSNA 2XFRA 4NF7A 4AY1A 1L8NA 3SUSA 4Z2KA 2VCBA 2WPGA 3PZIA 4C91A 4XV0A 3KL0A 3PZMA 4F9DA 1UD8A 2CBJA 3SURA 4R27A 5A6AA 4AZGA 5IXEA 1CGVA 5CGTA 1JZ5A 3AJ7A 3RIKA 2CNCA 4UQDA 1HJQA 3AHTA 1V08A 4P7QA 3AICA 1E5NA 1FH7A 2VZUA 1MXGA 1ISYA 4TOQA 3WUGA 1E6PA 2WHKA 3AS3A 2PF0A 4TVDA 4EAMA 2WVVB 1MQPA 2WM0A 3OZOA 4RE2A 3VVGA 1NWRA 1Q6FA 3UG4A 2WW5A 3WNMA 2D24A 2DT1A 3VIFA 4JIEA 4D71A 3M07A 1ZBKA 3SUTA 5LA0A 1ITXA 1V3LA 4JFTA 1VFOA 3GYCA 2GJXB 1QPKA 2OWWA 1U33A 2W62A 2J4GA 2J7HA 2XTKA 2C8NA 4UFJA 3CZGA 1CTNA 4JL1A 1KR1A 5I79A 3NSMA 5I6SA 5IHSA 3ZJ6A 1KCLA 5FCZA 2Q8XA 2ZUVA 2EEXA 4CU8A 2C0HA 2UY5A 3B9DA 3IANA 3GXMA 2BXYA 2J75A 3O2LA 2GK1B 2CESA 3OB8A 1W1PA 4AZ5A 2Y24A 4W87A 2D20A 3BAYA 2Z1KA 1E40A 1C7SA 4AZCB 2EPKX 4S3KA 4C90A 1TVNA 3BAJA 2JF7A 1XGZA 5DF0A 4V2XA 3VGGA 4Z2JA 4P7LA 1VFUA 4MB5A 1FFRA 3EBVA 5D8WA 2BVYA 3GXIA 1E1FA 3IK2A 1OIMA 3RILA
chains in the Genus database with same CATH superfamily
5ABEA 1VPQA 3KTSA 2R9RA 3C8NA 1JZ4A 3TROA 1JRCA 1A5NC 5I24A 3ZWSA 4DBWA 3C2OA 4V33A 2XIJA 4PB3A 4RV8A 3F4WA 1JZ7A 4FSAA 1OX5A 4DHGA 3NQFA 4JPGA 3MHGA 1GEHA 1J5TA 1KTBA 1A47A 2Q01A 1UUQA 3PF3A 1R3VA 2VGGA 4L56A 3GDRA 1ZNNA 4W9TA 3VFLA 1XF0A 2A6LA 2YIHA 3S42A 2V3GA 4US5A 1JZ2A 2OYLA 3W1QA 1JAKA 5DBUA 2JGYA 4QJ1A 3QV7A 3HV9A 4UOJA 1KRAC 1J96A 3TC6A 1Z42A 3MMWA 3B0PA 3WCZA 5HUOA 1EBHA 3RYSA 3WF0A 4XQ6A 1P1MA 2YCIX 1FX6A 1S2VA 4M51A 1TV2A 2J88A 1QK0A 3CB8A 3WMSA 3WYZA 3WQPA 3TOYA 3R0KA 3IWPA 4WKHA 3MW7A 3IJ7A 4A6GA 1XYFA 4A05A 4PTWA 1F76A 4QNEA 4UQBA 1HJSA 4YJ5A 3PULA 2YFNA 4L7ZA 4EE9A 4OV4A 2PBOA 1Q5MA 2REQA 5CGQA 2WC3A 3PPGA 3AMLA 1TJ2A 3BZGA 3CB3A 1QHPA 1BSLA 3XIMA 1AMKA 1E43A 3T09A 1GNXA 2QJGA 2DFAA 4H6RA 4DXKA 4WDXA 4A3RA 3OHMB 2R91A 1P48A 4W5UA 1SZEA 1PTDA 3VNIA 3NYZA 1F74A 3TCEA 1SZNA 1ZQ5A 3WFZA 3V18A 4O4VA 3IJ9A 4GI4A 4X9YA 1XSKA 1LBLA 2CZDA 2V63A 3M0XA 4GZ7A 3WMCA 4L4MA 2P1FA 1YNYA 5CJMA 1EC7A 1MQRA 1GQJA 4JTJA 4UBPC 3UFYA 1M41A 4D6JA 4AQLA 1PS9A 4EP8C 4RZBA 1JCNA 2UZ9A 3PFRA 4R53A 2REQB 5C0QA 4O11A 1XLGA 4EF9A 3K4DA 3BSMA 2QUTA 2R6OA 1UPPA 4UB9A 3RK8A 2EGZA 3S1GA 3BH4A 1J0JA 1KQZA 3WQ6A 3UGRA 1OSEA 4KS0A 1U1HA 3WDJA 3IK4A 1WUFA 1XG3A 1ZP3A 4LSBA 2VRJA 4XVEA 1H0IA 3UWVA 2UV8G 4X9SA 3NWRA 4X0NA 2WMGA 4PUUA 1XRTA 3NG3A 1UKTA 4WDTA 1UD5A 1E4IA 4DPQA 2FTWA 3W1XA 4KWOA 5G4WA 4YYFA 1IT7A 1SO5A 4ENLA 3GD6A 4RUBA 4MSSA 1KWKA 5C2XA 3MCNA 1DQWA 2Y7EA 2G95A 3WNPA 1J5SA 3GWQA 3SUVA 1VKFA 4C6QA 4CEXC 5E0FA 1TTPA 2OCZA 3CH9A 3IJLA 4TO8A 1JNDA 4HU8A 2NV1A 2GVYA 4QP0A 1FDZA 3ITGA 2TRSA 2TYSA 4UXDA 1DHPA 1SZRA 3OG2A 3ITLA 1OT1A 3MHFA 4XBJA 3R8GA 2ZXAA 5CC5A 3ZS4A 2GGHA 4NNCA 4B16A 3U2EA 4OZOA 3ZIZA 3CHVA 2XUCA 4E2DA 4MWAB 3NXLA 3HPFA 1PUDA 1QUMA 2Z7GA 1X6LA 5BXTA 3L4ZA 2A7NA 3TLQA 3A3WA 3W7DA 2IKHA 1Z8AA 3KZSA 1O4UA 1DXIA 2C19A 1L6FA 2IQDA 2ZZ6A 1D7KA 5HULA 3UJEA 3DHPA 1J6OA 5DY3A 4AX6A 4GO9A 3VXGA 3A4JA 1WDPA 3FHAA 3IVTA 2V5LA 1XI3A 2IS7A 4WSKA 1GQLA 5BZAA 5TF0A 1BXBA 3ZQ9A 2CLEA 3LYEA 1EQPA 4RPQA 4MAVA 2YB4A 3M46A 2YLAA 2QPSA 4MPKA 2EXOA 2BTMA 4NAFA 4YU1A 4MF4A 1H2JA 2PDYA 2EPHA 3GK0A 5F2GA 2DZTA 5D9PA 1M53A 1PYFA 2QDEA 3ZR6A 2DSZA 3KBJA 5AKQA 4JTEA 3C2EA 5EFDA 1FDJA 4DO6A 5DN1A 1JXJA 3B9AA 1H51A 2ZA2A 4OBSA 1C7TA 4PEEA 1Q6CA 3N4FA 3W7QA 4DJFD 4GBDA 4PRRA 3P93A 3AIUA 2FDMA 1V79A 1K3UA 3UWYA 3EXSA 5CSSA 3EWUA 4CVWA 4INFA 4UOQA 2W63A 5M17A 1TE1A 2F6UA 3FJ4A 1QTWA 3VE9A 3VK5A 3OQ8A 4DUWA 9XIAA 3IVUA 1L2UA 3OOQA 2PLKA 3HGSA 5H6HA 3RDKA 3OP2A 2R8WA 3KDOA 4IGNA 3VKKA 3GY1A 1MXSA 1NF0A 4AHOA 3TQVA 3SO7A 4H3DA 4LUTB 4F0SA 2P88A 3W6YA 5C2CA 3WQFA 2PRMA 3AHVA 3RU8X 3S0CA 3EWYA 4LF2A 3IJ6A 2B7PA 4C6NA 5LXXA 3HN3A 1H41A 3O07A 3ZSTA 2XZ9A 4QG6A 3IJIA 3RJXA 6XIMA 3LENA 5I78A 1MNSA 2CWNA 3OYZA 2CHNA 8TIMA 4H19A 3GC4A 5BNKA 2NLYA 1BKHA 2DDXA 5I3DA 2EG6A 3PNUA 3WDQA 3NGJA 1YXCA 4HCLA 1JF5A 3GTNA 2WHJA 5JIPA 1HW6A 5K9DA 2CHOA 3SN1A 3W53A 1CGUA 1OQFA 3EOLA 1CECA 2X2GA 1XLBA 1IF2A 3PTQA 3KVJA 4JIPA 4AEFA 5CPTA 3L65A 4LUSB 2DH2A 4IGSA 3CV6A 1D3GA 2O56A 1Z69A 3CU2A 4UCGA 3ALGA 4FHAA 1PCKA 4WJXA 3NIYA 3MP3A 1M5WA 3AU2A 1TWDA 2CLIA 3BVJA 1KA9F 1RA0A 4QCEA 2ZZ2A 1F8MA 3BLDA 4KRTA 1BRLB 3UG8A 3BAXA 4MB3A 3N15A 3STGA 3WUBA 3BCDA 3A12A 2V3DA 4PMOA 1ZPTA 1ZAHA 3CLWA 2GQAA 3DN5A 4Z1AA 2W4XA 5M1TA 3DGRA 3PTKA 1XKYA 1FUYA 4D6HA 5K3VA 4GINA 2C16A 4MNJA 3DHUA 2PAJA 1W1ZA 2VFIA 1WDWA 2ZX5A 3RF9A 2OGYA 2I1OA 5CZ0A 5LNVA 2OQLA 4ZO9A 5HWNA 3WF3A 4E3TA 1XX1A 3CXOA 4NRRA 1EXPA 2PUZA 2VZSA 1Y0EA 3ARTA 2BNJA 1UW9A 3LHUA 2FZBA 3DZ1A 3SY8A 3A9IA 2EF9A 1KCKA 2PZNA 3ZJKA 2J8FA 1LLWA 3UCDA 3UVIA 4GH1A 3UWWA 1RSCA 4WY0F 2D1ZA 3MSYA 3W23A 4HD5A 1EJUC 1VB9A 3MUY1 4D6DA 3FCPA 1DIOA 1J0HA 3PP7A 4O28A 4O8AA 2DZXA 4FI4A 2JALA 3MQTA 4PB4A 3H4XA 4HZ8A 4W7VA 1GWJA 9RUBA 3FAXA 1IHIA 3UG5A 5FF2A 2WLYA 1FWNA 2G3FA 5T8GA 3REQB 3VIOA 1T40A 1TB3A 5D04C 3SCWA 3TMQA 3FW6A 4N6EA 2OQHA 2VWSA 4IGMA 3W7OA 4NYUA 4RW3A 1D2KA 1NDZA 4F2TA 1B9BA 5EPDA 1OINA 4LCRA 4E4PA 5D38A 3CZKA 3ARZA 1N8IA 1EH9A 4FK9A 3S9YA 3W1PA 4P5UA 4R88A 1V4YA 1IGSA 2QR6A 3GXDA 4RDVA 2ADAA 3BTNA 4PMVA 3POHA 1CWYA 1NOUA 1W1B1 3W1UA 1XC6A 2ZIDA 2QCDA 3WLJA 2ZZ7A 4HB7A 3PM6A 3H6OA 3CQ0A 3TN5A 3H7UA 2NXHA 3R11A 1BG4A 3V3WA 4K3ZA 2EKCA 4OE7A 1ICPA 1NM9A 1N8FA 4ZQPA 3O8AA 3AHZA 4M1BA 4O53A 4YHGA 4AHQA 3D47A 3GB6A 2C18A 3TTEA 4OU1A 3CZLA 5DMMA 3W1LA 5CBBA 1E9LA 5IBXA 4IM4A 1OD8A 4S1FA 2G4JA 3BAKA 1SO4A 2PGFA 1M7JA 5A6JA 2WZTA 1DWIM 4DAIA 1EJVC 1SFSA 2XFYA 2FLIA 4ATDA 4EOUA 2X0YA 2XG9A 2V5CA 1DWJM 1HXJA 1SZGA 4RE3A 1FVPA 3H8AA 3CASA 1BXCA 2Y7DA 1JPMA 2Y8VA 3WNOA 3GR4A 3UY7A 3VX1A 1RV8A 3KRZA 3E9AA 4GH3A 1VEMA 3PN8A 1IEXA 4YN5A 2E8ZA 4ERAA 4H2HA 4CGTA 1W5MA 1R2SA 3LV5A 4DN1A 4K37A 2FJKA 3TZNA 3N29A 5AHIA 5EA9A 2PP0A 2G97A 3T44A 7XIMA 1OX6A 4J3UA 1OEPA 3CJPA 5BROA 1VJZA 4M3PA 2J8TA 2PP1A 4LVFA 2Q8LA 4R7OA 4ZFCA 1XHGA 1K9TA 1ZBWA 3W1AA 1EIXA 1JGMA 3MWAA 3NDOA 3TCSA 4UTHA 4OECA 1GGOA 1SU5A 5HQMA 4Y9PA 3VNZA 1R7OA 3BLEA 4RZ5A 3TQPA 4Z1YA 2DIJA 4LY8A 4IHCA 1WA3A 2Y7FA 4WSHA 3DIPA 3CEPA 3B8TA 4HJWA 4WKFA 4IISA 3BG5A 3M0VA 3EAUA 1QO5A 1RJPA 4HBKA 4CNTA 7ODCA 2GZXA 2Z29A 3PWAA 4LALA 2YBVA 3UVAA 4XZ9A 1R47A 4HOZA 1V3KA 3SAZA 5BXPA 2D22A 1YKWA 2EPNA 2VEIA 3UWUA 2EJ1A 1DJQA 2ZZ5A 3E02A 4UFLA 4FS9A 3T4CA 1H7WA 4JYFA 3CAWA 4DJEC 3KTCA 1Y7VA 5REQA 2YL5A 1TWSA 4QIUA 3SW6A 1CXLA 1KCZA 2ACSA 3NAVA 1JF6A 4K38A 5DXXA 2VEFA 5FF3A 3N2XA 1NFBA 4CUCA 2HPIA 2I5IA 2HE8A 4H41A 4REQA 3H12A 5GQBA 1GQIA 1RK5A 3KOYA 4U33A 2D23A 4KFPA 2KZHA 4G56A 3C3UA 4B5XA 3UCCA 1KRCC 3N9SA 5JU6A 2DUZA 3E1F1 4AVNA 5LIXX 2QGYA 4FR6A 4MTVA 3EEZA 1MDRA 1IEQA 4L65A 1LL4A 4W84A 2PGEA 4B15A 4DF2A 1Q6EA 3ZM8A 4C1NB 4ZE5A 2R1PA 2WJDA 3OGSA 4C1KA 5FESA 3WH9A 2E28A 3K4AA 3L4YA 1FQ0A 3ATYA 5JQ9A 3DESA 4V15A 3RITA 3WDPP 3DYPA 5AHLA 3POCA 3OW1A 2NVCA 4B5TA 4B5SA 5AVNA 2A1YA 1O7AA 1I4NA 2I5QA 3ZOAA 3QQ1A 4R34A 1O95A 3HGJA 1WUEA 5E1QA 3W2NA 1QI0A 4KCTA 4DYKA 1CXHA 3U5YA 3ZO9A 3NYDA 1NJJA 4MOZA 4YPJA 2C71A 1HKWA 1I2RA 4BQ3A 2ZDSA 3PWGA 1DTNA 5EFFA 3L4XA 3NL6A 1EWDA 2OVLA 1T5AA 2HTMA 1F05A 2BY2A 2JKEA 2QPXA 2GGIA 5A6MA 4I9TA 1ZJAA 5FSEC 1Q6RA 1XIJA 4NSBA 2GSEA 1VFSA 1LUCA 2WV8A 4QDPA 1YYAA 5C5YA 5D02A 1AW2A 4PBFA 3UJSA 3V0SA 2Z0IA 4UR9A 4QS6A 2BS9A 5A8MA 3UNTA 5AB3A 2CLPA 3FA4A 2XISA 5E0CA 3BE7A 2OT0A 3PBMA 4Q6JA 4Q32A 1W1TA 1BWLA 3N04A 4JTAA 3WK0A 4KEMA 1KM3A 5A95A 3QQWA 3VOCA 3URAA 3K46A 4JTCA 1V0MA 3KAOA 4FXFA 5I03A 3MJYA 1SSDA 3FGCA 2ZWYA 3LK6A 5BRBA 3E0WA 2QPUA 1B5TA 2KX9A 2ZX8A 4MLJA 4A3HA 4LUJA 3UA3A 2HXTA 3QKEA 5REQB 1B90A 1US3A 1B4EA 2YL8A 4FX7A 3M7SA 3VDGA 1SW7A 5A8GA 4Z1DA 1PXGA 1GW1A 1SW0A 3BG9A 4NZFA 3SSZA 4XZBA 4ICCX 2PC8A 1PBGA 4IQLA 3ZVHA 1EX1A 4GYPA 1XSIA 1F2JA 3UP8A 1Q85A 3BJFA 3BGJA 3BWWA 3E96A 4QE5A 3MKKA 3SECA 4Q8QA 4TMBA 3GAKA 4MJ2A 5CZKA 1YBQA 4CCDA 1UQYA 3AC0A 3N17A 3QV9A 3E2RA 4H7ZA 3B0UX 3W71A 1BSIA 1TPEA 1IZCA 4NZ4A 1NQKA 3SCRA 2D0FA 4HHLA 3C2YA 3GHUA 3S8HA 1R0MA 1LRNA 2V30A 1AD4A 1HN1A 3BMWA 5CSUA 3GHRA 2J66A 2XHYA 3FDGA 3W7HA 2D0HA 1PE1A 3UPBA 1JR1A 1HKJA 3A4WA 2OYKA 1ADOA 3WNLA 1QWGA 3KWSA 1UKPA 1JCMP 1HT6A 4ZB2A 4LAOA 1UWUA 3M44A 2V5KA 4HNCA 3B40A 4L9XA 4UNIA 1TPUA 3AS2A 2W0UA 3H55A 3TOPA 3AZRA 3TUUA 1R2RA 1BGAA 1Q2RA 1LCOA 4R9XA 4QNWA 2UY4A 3PPHA 4J3TA 2GJPA 5FJOA 1C8VA 2HE5A 2NWSA 2P0IA 1UIOA 4LXFA 2TAAA 1MDLA 1K1DA 3PZ9A 3W82A 4DM2A 4LAZA 1UWIA 3OBAA 1Q13A 4RKAA 1Y65A 3HQPA 1RY8A 1GJUA 1TCDA 1YPIA 1TSIA 3HG2A 3RU6A 1UH4A 5A69A 3EWXA 2Y6ZA 4AD5A 4J3WA 3TAOA 2PWUA 3MI3A 5CAKA 1UR1A 1XR2A 3APYA 2HJPA 3H2FA 3V75A 5A2AA 3WZ0E 2Q09A 3I6TA 4OGZA 2PI6A 1O12A 4FX8A 5KSWA 4BFAA 5CBIA 3VUPA 2ZQ0A 5FL0A 1ZUAX 3N19B 1TMHA 2TODA 4CNUA 2A3HA 1NWTA 2J78A 3TN4A 5EY5A 2TMDA 2IXVA 2QZRA 1H50A 5LNSA 4A8NA 3PNZA 3LZ3A 1GVQA 4IT1A 4JS3A 1NWSA 3LDVA 1ME9A 3WQ5A 1OYBA 4O54A 4Q8VA 5C55A 4N42A 1AODA 4Z2LA 4OUEA 1W2PA 5FD0A 2GWNA 3AXMA 2HS6A 2XIBA 2PDGA 2BY3A 1W9XA 1P1XA 4LB4A 2GK1A 3GU1A 1GYMA 2DP3A 4D8ZA 2X7WA 4JBRA 3LHZA 4Q8OA 1XKJA 4XIMA 3WQ8A 4B9ZA 1RVGA 4MKVA 3WEOA 4H8UA 4HU3A 2V9DA 3S2LA 3CWHA 2YXOA 4B9YA 5MKGA 4DZAA 1VR6A 1XWYA 2ALDA 4H4IA 2QLYA 1S5WA 3WMBA 4QDMA 5ENLA 3H54A 5FACA 1NOFA 3RHGA 3AMKA 5C70A 5E9XA 4GKTA 1HX0A 2VFDA 3QSRA 1G4EA 3C0SA 1US0A 1E51A 3LCGA 3EWZA 4I3GA 1H7PA 2OGJA 2XH0A 1CXEA 1GK8A 3CMJA 3TN3A 4BQ2A 3RX3A 4IJRA 3B8WA 2A6NA 2YXGA 1GOWA 3ARVA 1A5BA 1TA3A 3G3DA 3FK4A 3NQBA 2Z4GA 5TNVA 3PK7A 5ABFA 3VKAA 3KLLA 3UZXA 2V6AA 3WK2A 5DCEA 3OJGA 3LPFA 3VGFA 4DJDD 2Z26A 3SCOA 3LTYA 1OFEA 5F4XA 4Q8UA 3IJ8A 4BF5A 1M01A 3F2CA 4LUSA 5D8ZA 2BASA 1J10A 3H53A 1E6QM 1CB2A 4BI7A 2VQUA 2A3CA 2YDSA 3EXTA 1PCWA 4NAFB 4HMCA 4LCSA 3ARYA 2ONEA 4X61A 2VC5A 4B3LA 4W8BA 3CPRA 1V3MA 3GDKA 1IYXA 3NNTA 2JK2A 4I8YA 2VEKA 2A85A 4PCNA 1U1JA 1FA2A 4O13A 2X0HA 4NX0A 1OB0A 3LTSA 1BF6A 1XLCA 2WVTA 2FHBA 2IMRA 4BEUA 4NNBA 3S9IA 2QCLA 3MBDA 3FGCB 2EHHA 3ITCA 2F84A 3GKAA 2XVLA 4RL3A 3U8GA 3RLGA 2AKZA 3F2DA 2WSPA 1KM2A 4E4UA 3O15A 1WQ5A 3URNA 1VYSX 1VP5A 1EDTA 4L61A 2D0GA 1XW8A 4REQB 5CBJA 4Y96A 3GQYA 2CC0A 1EUAA 2Z6JA 3GDBA 1Y5WA 2X41A 2I9EA 2V38A 3JZEA 2X2YA 4N4QA 3RCMA 1MRQA 1EA0A 4GQ0A 1I0BA 2AAAA 1RQHA 1JD7A 1IR2A 3UR8A 4JKMA 5H8MA 1YW1A 3PBYA 1T7LA 3ZZ1A 3CL6A 4J3SA 3W27A 1JUKA 2JBMA 3WH8A 1M6JA 1E1CA 4R3UA 2RGLA 3VGBA 4ZOEA 3NO5A 4OT7A 1EP2A 1EPVA 5JBEA 3SGZA 1G67A 4UNLA 3GNRA 4E3VA 3T8LA 2FB3A 2I17A 3PJUA 1I2PA 1W17A 4DWSA 2YBTA 1SYTA 2VEGA 3RM8A 2Y5EA 4NJIA 3L9CA 3VDAA 4MWAC 3APTA 1E0VA 1MXDA 4S38A 4WXYA 3QMTA 1AW1A 1H3GA 1BXNA 2VMFA 2E67A 3G0XA 2J7FA 4D1JA 1SM9A 1EPXA 1AL7A 2UY2A 4PCSA 2XH2A 5H8UA 1UA7A 1QFEA 4XKYA 5HNNA 2Z1SA 5DMNA 4XKMA 3ES7A 1F3EA 2NQHA 4BCEA 1WO2A 4QEHA 4NZJA 3ANUA 2V2CA 2WHLA 3TE9A 4CQ9A 5CPLA 3SQSA 3QSTA 3IGXA 3MMUA 4C6DA 2GVEA 5XINA 1IR1A 3N12A 2VOMA 1QNVA 5A2BA 4OIFA 5BMXA 4YTQA 1V02A 3CHEA 4BI5A 4FIQA 1PKNA 1K8YA 5F2MA 1R3TA 2WHMA 4JTQA 1E73M 1WXYA 4HSOA 2P0OA 1O5RA 1WKDA 3G1YA 4MM1A 4CQCA 4XX6A 1EXBA 4ZBCA 1UH2A 3E2SA 1YE4A 2IPGA 4PL1A 1L0PA 4S3EA 5FJPA 3QMRA 1VHNA 2ISFA 4TVCA 4HPXA 3ZLGA 2CFFA 1TELA 3CHDA 5AC6A 2OG9A 2A7RA 2YW4A 1GKQA 4E8GA 1MEIA 3W7NA 3O7UA 1QI2A 3ABXA 1W5OA 4PMZA 1KXVA 1TVPA 5EBAA 1C8QA 3CT2A 4J7RA 1GVIA 3ARXA 3EB4A 2ZADA 3E0LA 5KZMA 3G1VA 4HN4A 3RPMA 3VYLA 2Y85A 4QJ4B 3QPEA 4NQ1A 4U3AA 2F6XA 1AQMA 3LM7A 3H70A 4ACZB 1JZ8A 4FXSA 1JULA 1J0YA 4QJ3B 1PKYA 4CNOA 4CN1A 2BHZA 1PZ2A 8A3HA 2NX3A 3LRLA 2V8ZA 4WR3A 2MUCA 4QJ5B 3O05A 3HG4A 3TKFA 4E8DA 4GNKB 4NF7A 3LBOA 2CZ5A 2ACQA 3SUSA 1GG0A 2V81A 4S3FA 3LTPA 3W22A 4ZGYA 1UD8A 1TWWA 1XRSA 1IEWA 4HN8A 4ALDA 3UBPC 3C0JA 5IXEA 1KV8A 2AL2B 1SO6A 3MA8A 3LHWA 3UJFA 3AICA 1ISYA 4TOQA 1E6PA 1RLCL 1UOZA 2HBXA 2PF0A 2Y7GA 3WLPA 1A0EA 2WM0A 3UXKA 1JPDX 1EGMA 1Q6FA 1TPDA 2CWXA 2ZRUA 3GVGA 1DXEA 1IWBA 2D24A 1SFJA 3NA8A 2QGHA 6TIMA 1V3LA 3W9ZA 1VFOA 1VZWA 1OFAA 1VYRA 3LCFA 3LXBA 1VCVA 2ZFAA 1UWAA 8XIAA 5TBOA 3CZGA 1D8WA 1LBFA 4C6KA 3UWQA 2ZE3A 4I6KA 4LANA 3NSMA 3NOEA 3ZJ6A 3JU2A 2ZUVA 4GUGA 4LOCA 4WUIA 2J75A 3KBMA 2GK1B 1W1PA 3MHUA 3MUCA 3BAYA 1E40A 4Q8NA 3OVQA 4MKSA 2EPKX 2OJPA 3CYJA 1IXOA 1TVNA 4QSHA 4IOTA 3DAQA 1XGZA 5DF0A 3MY9A 1XLHA 3VGGA 4Z2JA 4TV6A 3QY8A 4L1GA 3EWCA 3C4UA 4MB5A 3BW3A 1FFRA 1YIXA 2PDHA 4AU0A 1IE7C 3CQIA 3DUGA 2YCJA 4Q4PA 4P7NA 1PPIA 3LQLA 3VM5A 1SFLA 3WLIA 3CNYA 1X8CA 3UERA 4GGHA 2CLKA 3FFSA 2W3ZA 4LYRA 2H6RA 3S5YA 4GNJA 4ZMGA 3LPPA 3AZSA 1KXTA 3OGRA 2V3FA 4Q8PA 2BGNE 8RUCA 2OSYA 1KBLA 1H1ZA 3AOFA 1JJKA 3AXXA 3TONA 4UWMA 2O7SA 1DWFM 1KFEA 4M6QA 4B90A 3FEQA 2Y89A 2XINA 5HWJA 1HNYA 3HG3A 2Z1WA 1RZMA 3QV8A 1JYVA 2H3DA 1TV7A 3AIWA 4ORMA 5A6BD 4LU0A 1LT7A 3O0FA 1FXQA 3PSVA 3NZQA 1IWAA 4Y2WA 5DBTA 1M9HA 4IPPA 1P4CA 4L6OA 2CBVA 3WELA 2Q6ZA 3WQ4A 3HQNA 1B3OA 3L0KA 1TWZA 2OZ0A 5D2VA 3N9KA 3H2AA 1QW9A 3GLCA 3T08A 2J62A 3SGGA 3S47A 5C71A 1Q8JA 3MBFA 5A8OA 3VI2A 1MRAA 5I0DA 2NUWA 1FHUA 4AUBA 4F79A 3KP1A 4GACA 1YDYA 2FH8A 3CAVA 3KS6A 1AH4A 5DT7A 1J79A 3EDJA 1AQ0A 1TWIA 1XFCA 3STFA 4DRSA 3WJYA 2PP3A 2RDTA 2ZKMX 2FTPA 1S2WA 5LNRA 5IDIA 2BY0A 1NH6A 1Q65A 2HISA 3B8SA 3A4XA 4UMAA 1QRQA 2WMIA 1LDCA 3AXKA 3MC5A 3P8IA 3VCRA 2FGBA 4W5ZA 2X1TA 1XH0A 3QC0A 2NW0A 5CH9A 1E4LA 2E0PA 3ZYZA 1XLKA 2X40A 3QR3A 2OSWA 3ITOA 2A3EA 4H9TA 3K1GA 4UTTA 3FN9A 3NQ2A 1PZ3A 3VO0A 2QCGA 2V5DA 4HKPA 3SIZA 4AYGA 1F6KA 1J93A 1BTCA 4R85A 3UPWA 4DM1A 4X22A 2DW7A 3GTHA 4LVAA 3CZ8A 3H24A 3RJYA 2A21A 1H7OA 3HMCA 4FALA 2CEQA 1UPMB 2EO7A 4AC7C 4MWAA 2CKRA 2DJXA 5HK4A 2QF8A 3EX2A 2GGJA 2O9RA 1MUWA 3BV4A 2AAMA 3MCOA 2OOFA 1DQXA 2F61A 1RR2A 4P8UA 2FPTA 2XIIA 3TNOA 4LEFA 5DRIA 1OFPA 3PTDA 3SY1A 4AXNA 1R3WA 4ZTYA 3WNKA 1UJQA 1E6RA 4BI6A 2VC9A 3N73A 2E68A 2XZ7A 3MUXA 1KBJA 4DI9A 2XH7A 3E0IA 2PTWA 2J24A 3L23A 1EEPA 1E6NA 2CU0A 4X60A 4H00A 2BGQA 3T2PA 3CL8A 3NO1A 1TFVA 1LYXA 4XIAA 3B4UA 3UR2A 3LOTA 4H83A 2XYLA 1DIEA 3MB9A 3F03K 1GVSA 3ES8A 1VFFA 1KBKA 4F4RA 2WMIB 4GA8A 1LQ2A 4H01A 1RD6A 3S1VA 4UMCA 1GVYA 2GL5A 2INFA 1FWFC 1E55A 1N2VA 3O3RA 1A5UA 4N0RA 4ERIA 1RAKA 3QMSA 1ELSA 5A94A 3OVGA 1K7XA 2ZUTA 1QAPA 4D6IA 3SQMA 3QFEA 1PSCA 3CUXA 1ISZA 3AYSA 4XKYB 5DX7A 1W9BM 5HANA 1QXLA 4PFMA 3LU2A 2J77A 3AMCA 3Q37A 2XIQA 3P3BA 3W76A 2W67A 2Q8ZA 1O60A 5HMFA 2V0TA 4Q4MA 1FWHC 1KTCA 5D09A 4C7FA 3H2MA 4DB7A 1HP5A 2C1HA 2P5NA 3TR2A 1EC8A 1GONA 4LCQA 4IICA 4TTGA 4PUMA 4PYSA 5DLCA 2PEVA 1ZL1A 3WDRA 3PBUA 5EYWA 3UR7A 4IXXA 1XGEA 3DEQA 4E2BA 5A8NA 1UMLA 2G3NA 1P0EA 2FMOA 4J4KA 3SJ3A 3TVAA 2Y62A 1QO2A 3R58A 2J7GA 3WBEA 2WNNA 1NFGA 3UZ5A 1GHSA 1VGAA 1JEZA 3TNBA 2WB5A 2GPTA 1BTMA 1W1A1 3C61A 1KXHA 3M1ZA 1ICQA 5CC3A 3W2KA 2QKFA 1OIFA 4L80A 1VQTA 3HTWA 4QM1A 2XGZA 3E3HA 4V1YA 4Z0SA 1XYBA 2VR5A 3LCWA 2CZFA 3PG9A 3E2QA 5EMKA 1I2NA 4GX8A 2ATSA 2B7QA 1GPFA 5BW6A 3BANA 4PGLA 1GQKA 3DC0A 3W85A 1B9ZA 3HJZA 4NT0A 1AZ2A 4DF0A 1SUXA 2V2HA 3UZWA 1CLXA 2AQVA 3ONBA 1ECQA 5I3JA 2H90A 1JL8A 1RXOB 1TPFA 2DVTA 4EX4A 2GQ8A 3GVVA 5T91A 1OJXA 3VILA 5ABHA 1TR1A 3NEHA 1ZBCA 1KM0A 4Z08A 3WENA 3L67A 4XZMX 5AC7A 2PU1A 2PPGA 7TIMA 2P3EA 2QDGA 3DFTA 4FNRA 3GG8A 1YNPA 3RG6A 2D73A 1LM1A 3T81A 2E4TA 4RDYA 1SPQA 3NCOA 3EKGA 1UG6A 2A5HA 2OLAA 4QLKA 2PRHA 1WYIA 1DTUA 3P60A 1HKKA 1Z3NA 1MMFA 1UD3A 3SUUA 1FHLA 1EFZA 1SJBA 3C0QA 3LNPA 3CQHA 1W9VA 1FDYA 4ZO8A 2BZNA 2P10A 1RCOB 1VPXA 1IIHA 3T0AA 3UGVA 4OOUA 4ZQOA 2NXIA 3BUVA 4W7WA 1A5CA 4RX0A 3VMNA 2VURA 1K77A 1VJSA 3NQEA 3W84A 1XRFA 1L6SA 1H7RA 1FBAA 1W3HA 1HL2A 1TTJA 2GUYA 4LYPA 3WBWA 1OC7A 4CU6A 2QCFA 3LSCA 1KLZA 4GQGA 2WM1A 4F66A 4JL2A 1QK2A 1EJSC 1V0KA 4P02B 4A8IA 3ABRA 3L12A 3P81A 1QJWA 3HM7A 5DMLA 1C29A 4UQ9A 1GORA 2XDFA 4LV9A 1T96A 1KFCA 1UB3A 3SRFA 2PC4A 4WGXA 5RUBA 2YXXA 2AOSA 2YX0A 4IX0A 4KKXA 4AWSA 4O1EA 2O7QA 3VX0A 4R9OA 3QV6A 1RBOB 1SMAA 4QGCA 4O16A 4Y8EA 4NL1A 1GHRA 1IEIA 1X96A 3R0DA 3WIJA 1VD6A 3DBPA 7REQB 1H1YA 2E5BA 1EYWA 2IXUA 3UEQA 2J74A 4NU7A 4HA0A 3VD9A 3CTTA 3AU6A 4RNIA 5EJZB 1DKWA 2OELA 2X09A 4O1CA 5FF4A 2DPEA 3GVQA 3FIGA 1ADSA 1JPKA 1HVQA 2W27A 2A3BA 3B9OA 1RK6A 4DJED 1KC7A 3CV1A 2F2KA 4UZSA 3QLLA 1A50A 2TPSA 2Z25A 4H8NA 2RKXA 4F8XA 1BHGA 4KH2A 2WSRA 4HP5A 5CZJA 3UU0A 1CXKA 2I57A 3N6HA 3ISIX 3W4RA 2D2GA 2OX4A 3TJLA 3VAVA 4A3YA 3SJNA 4M24A 3VOIA 3C3NA 1EX5A 1VJIA 5JBFA 2G4FA 4M80A 2VZVA 3GTIA 4IIHA 2VC6A 2CETA 3HOJA 2QVHA 4XD4A 4NY2A 2J25A 1XBXA 4EPEC 1QCWA 4M7SA 4UR7A 2GVJA 2J47A 4CNNA 5D4YA 4G7FA 4GXMA 4YNGA 1WDSA 2VEPA 3PBVA 1EQCA 1W9PA 2JIEA 4D6EA 5CQ1A 4ROPA 3N18A 4UTFA 3NQGA 1XG4A 3HURA 3ZSSA 4JQ4A 1YNQA 5LIKX 1RBAA 1XDLA 4D9PA 3E5PA 3GO2A 1UJPA 3WKZA 1GEQA 1UBSA 4OJYA 4MGGA 3OLDA 5M03A 1GOXA 4HNNA 4KIEA 2F2HA 1QPOA 4MDPA 2WMKA 4LWWA 1ZJIA 5H8PA 1VAHA 2WXDM 1XM3A 2NX1A 3N4EA 4JHZA 4LT9A 4Q8MA 2BVTA 3GNXA 2NT1A 3V5FA 1CX9A 1OT2A 4DQWA 4GLEA 3OVRA 4IMDA 4K8GA 5ABGA 4UTWC 2Z6IA 5B80A 3GKFA 4AIUA 5AZ0A 4C1NA 3S6OA 5K7JA 3W38A 3U2ZA 4O1DA 1G6CA 3ZFHA 5CLTA 1K9DA 3DC8A 3WY1A 3EA1A 4BF9A 3LERA 4EF8A 3H4GA 4L9ZA 1BFNA 4PUJA 4IZGA 3CV2A 4UC5A 2HK1A 4UNKA 4LV4A 4M5PA 3O1NA 1JCTA 3FAWA 1WZMA 1X97A 2OEJA 4ZQCA 3F5JA 1Q45A 1HL8A 1TUXA 1H7XA 4AFYA 1SR0A 3KVLA 5F4SA 3SRDA 4GY7A 4RE0A 4AISA 4LS1A 2WJFA 2ZRVA 4LBSA 4UFMA 3NPUA 3MUZ1 2E7FA 2ACRA 3CMFA 3LQGA 4ZCWA 1EZ2A 2RAGA 1DEDA 3WF4A 1Z6KA 1U5HA 3T78A 1XDJA 1BYCA 1ONXA 3PB0A 5FSDC 4AYSA 3RXZA 3HQOA 1K8ZA 1ZCCA 3N3TA 4GOAA 6PTDA 1YDOA 2HEJA 1HJXA 3QKZA 3W01A 3RO8A 4XWUA 3VD4A 4YLWA 2W92A 3P7YA 5DO8A 2NV9A 2BP1A 2INZA 4WOZA 1OBAA 4AD0A 1KR0A 1J18A 3MCMA 3BARA 6A3HA 2VC7A 1W8SA 4FX6M 3I3EA 5AYYA 1QR7A 1I1XA 1UWTA 3MYPA 4PUWA 2H8XA 4IP4A 1E0XA 1QPNA 3NQMA 4QFUA 3DFYA 1EGZA 3BLOA 1P6BA 1KWGA 3UG3A 1RALA 2GVGA 4JHOA 1BWKA 1G4PA 1W3KA 2IPWA 3ABSA 1F9CA 1R7AA 3KS5A 1KGUA 4UCFA 1VBUA 1MNZA 3T8QA 3G77A 1A4LA 1VRDA 5D30A 2R24A 4H6KA 4PRTA 3WLQA 1Q8AA 4PE8A 4O1FA 3GYEA 1G7UA 1ME8A 1UD2A 5G5IA 3W2MA 5KMYA 5D9MA 4UQAA 2WKGA 4A4AA 3N2MA 2FTYA 2W66A 2DSUA 3VMPA 1GOIA 4NKCA 1DIDA 3NDYA 1LWIA 3XINA 3MSDA 2PE4A 2E09A 2G3MA 1TJ0A 4CKQA 3IJQA 1UP2A 4AC1X 1VIWA 4KMQA 6XIAA 4O52A 1V3IA 4CQDA 2CITA 3CTLA 4K39A 2C1IA 1LORA 3G5EA 4UQEA 1HG3A 4RNJA 2ZZ4A 5HAOA 3RN6A 4DUVA 2G3JA 2XIOA 2J7EA 2JKPA 4IMEA 3SI9A 3QW3A 4H8VA 4PUNA 1ML1A 3EPNA 2GJXA 4PMRA 1OCJA 2QT3A 4JFSA 5I77A 2LLEA 1OC6A 4PRWA 4RW5A 1W32A 2VO5A 5MKGB 5F4WA 1C93A 3M0LA 3W87A 1RVKA 5K2ZA 3KCLA 4DZ5A 4JTFA 4GVIA 1YPXA 1YX1A 3SZ8A 3Q65A 2QUVA 1E5JA 2HVNA 3O16A 2E6FA 3AJXA 4PMDA 4FXJA 5I23A 1Q7ZA 3VA8A 2QUMA 3CMGA 3I65A 1LROA 4IPLA 1XQLA 4XD3A 2NUXA 5I09A 3ABZA 4HA4A 1E70M 1AUSL 1PKMA 1B31A 3QZ6A 1L6YA 3PZGA 4XTDA 1DBTA 3GBEA 4JYEA 3R6IA 3MKVA 4DBUA 3UT0A 4GJJA 2VQTA 4K8HA 5C9XA 2O4MA 2RFGA 1P43A 1NQ6A 1W9DM 2PDUA 3F1QA 1YEYA 2D3LA 3CH0A 4M0XA 4AWTA 5TIMA 5PTDA 2RH9A 3GAYA 3N6QA 2ZWZA 4L9YA 1HKVA 2QJNA 4US5D 1SJDA 5LIYX 4GYFA 2XFWA 3G8RA 1POJA 1XL9A 3V0TA 3R79A 3WF2A 4U4MA 2RJGA 2AL2A 3NVTA 1S5VA 4Q8WA 2NVAA 5EMYA 1BVWA 2FYMA 1Z89A 4RNFA 2HBVA 2G41A 2YCEA 2ABAA 4CU7A 2Z1XA 4DNHA 3D5HA 5T9BG 5AVHA 3M41A 1K6AA 1DORA 4JTDA 4JTSA 2WO5A 3NFUA 3TJ4A 2VVSA 1EHNA 1D3CA 1UUOA 3GHTA 3HZ3A 3HGRA 3N14A 4F2BA 1M7OA 4RNHA 2DZAA 4ZTXA 2VD9A 3QHOA 2FPYA 4H2CA 4POCA 5AC5A 4JQ1A 3BMXA 3C5QA 3V1PA 2WCSA 9XIMA 4MFDA 4JDBA 1S38A 2A4AA 1UHVA 1Z41A 2BXZA 3NZRA 5XIMA 1B3ZA 4IUGA 2FHFA 1LT8A 3MO4A 1LG2A 4E2VA 1DJXA 4V1XA 3WBAA 4AVFA 5AECA 4QROA 1N7KA 4ZSUA 2AMGA 4JTUA 4ROQA 3QH2A 4JQ3A 3EZ4A 3HPSA 3LCIA 4AW7A 2CLMA 1K4HA 1XLAA 4WX2A 3MO7A 2OKOA 4TQTA 4PCTA 4HG6B 3OIHA 2P76A 5CPNA 3OG3A 1MFUA 3D3AA 5CLWA 2GYIA 3BAWA 4LPCA 2DJLA 2VFGA 4QQ3A 5CC6A 4ES4A 3GIYA 4YCPA 3G6LA 4TX9A 2DGAA 5AC8A 4JEQA 4QQUA 2PTXA 4GC3A 3BQ5A 1MW3A 3I6EA 3O6AA 2JIWA 4AWEA 4XK2A 5LHEA 1P7TA 1M65A 2X16A 4U28A 3ABQA 4IUOA 4ZVJA 2O9PA 1ZP4A 2Y1HA 3W1RA 5BOFA 1LZOA 4ZO6A 5CZTA 3GW3A 4JQAA 4OTKA 4GI9A 4H7CA 3KM8A 2DH3A 1S3HA 3PZNA 4HZ6A 4QITA 1F07A 1QVBA 3E49A 3VMOA 1VF8A 3B04A 3OBEA 3BCJA 3SCSA 2GFTA 2JKAA 3S2JA 4DYEA 1YDVA 1KFKA 4A2SA 3VD5A 4LYQA 4S39A 5E6YA 4LC6A 5M5DA 1WOAA 4NZ3A 3PZTA 1TV3A 1CGWA 2NXGA 2PFHA 2YL9A 5I3FA 3LD5A 4GIAA 3UYCA 3TFXA 2ODOA 2CZEA 2OLHA 2WJZA 3E38A 3HV8A 2Y0FA 2PWGA 4D72A 1OGGA 3L4WA 2PDNA 3MMDA 5LSMA 5E93A 3WLKX 2DSWA 2QNEA 4RLIA 4WQ6A 2A7PA 2E1DA 4LGXA 4Y6GA 1GKPA 3MP5A 4C7DA 4V28A 4K6AA 1KLYA 3B8UA 3KFTA 5D05A 4JNMA 3Q4DA 4O14A 3OZPA 4AD3A 3BSGA 4ML4A 4L1WA 2V5JA 2GDUA 3M0YA 3LG3A 4GUFA 1VIZA 2WMFA 1O5XA 1CLKA 3QGAC 5FOOA 3SR7A 1ZCOA 3H2OA 1S1PA 4GI8A 2PDPA 2E3ZA 1THFD 5HMSA 2ZUMA 4GIRA 2PGRA 2IPFA 1ZJHA 1E9IA 3SCVA 4IF2A 1CLVA 4QISA 3F4CA 2FVLA 1K7EA 3G1AA 1C90A 1NEYA 1QPRA 1XUUA 1NFPA 4ZOBA 1ZZMA 2ABBA 4ZR8A 2VENA 3NL5A 3C0LA 4HMNA 4DJFA 3KL3A 2C14A 4EPKA 4IFKA 1OADA 4X63A 1M3UA 3QHMA 1H60A 3YPIA 1OCNA 1Z44A 4EKJA 1X6NA 4N9CA 3A64A 2QXWA 4ZQMA 3PJWA 5A2CA 1XRVA 1IT0A 1W3TA 4LAUA 1GOOA 2FDSA 4GFIA 2XWDA 1WZKA 2UY3A 3S2MA 3DHDA 1EKOA 1NAL1 4GGBA 4QXIA 2ZX9A 4G6CA 4R33A 1VHCA 3EMCA 4KWWA 3WD3A 4RZ4A 4NHVA 3WLHA 5EB8A 2O0TA 2Z24A 3B97A 1XQKA 1XH2A 4AIBA 1J8VA 3MZNA 2XN1A 3CS2A 4Z2HA 1BEUA 4I6VA 3ZT7A 4JTHA 5FEZA 3BOLA 1VS1A 1YLVA 4AX7A 3MPGA 4LW7A 3ITVA 3B06A 1O94A 3MVTA 5G4HC 2P8CA 4IIEA 3OTRA 2X1SA 5EJ1B 4XTIA 1DJNA 1XYLA 5FI8A 3EGJA 1XD0A 3V7PA 5B7ZA 3QPYA 3H21A 2PD9A 4JZ5A 1WDRA 2QCDB 1MW1A 3R4IA 3NXFA 1TV8A 1DYSA 4MKNA 3ARPA 1XLIA 2ZTKA 3WLLA 1EOKA 3RX2A 2Q71A 4NI8A 3EDDA 2NQZA 3FYOA 5I02A 1QHZA 2FFCA 1UA3A 1TPWA 4PBGA 2R14A 1X1NA 1KFWA 1NY1A 1XIEA 1VPYA 4CD8A 4GJIA 3TAKA 3QYQA 4L4LA 3T9PA 2OU4A 4KW2A 5IFPA 1NP2A 4LVDA 2A0NA 3DG7A 3P5ZA 5IBXC 1MQQA 7TAAA 1JYNA 4D8LA 4GIEA 4G7EB 1X39A 1FWGC 1S2CA 3EOEA 3SSJA 4G1NA 1G1YA 4Z42C 2X1UA 4F0RA 3TTQA 3DENA 4KEVA 4P8VA 4RV3A 4JX6A 4GVGA 4JKLA 1JG9A 2FH6A 3CO4A 3MU7A 2ZRYA 4FOKA 3GR7A 3FXYA 4W89A 4WD0A 3OODA 3WUEA 1WV2A 1QI5A 3W6MA 3LGGA 3W00A 1EJRC 2IKJA 2C6QA 2NQLA 3W7EA 4F0LA 3KCJA 1WKYA 1L2QA 3VKJA 1YQ2A 4YL2A 4FB7A 3G1SA 3W72A 4DBSA 1BQCA 3W86A 3PJXA 4FR1A 2JF6A 4RK8A 3PPCA 1CGXA 3TJXA 3OA5A 1FWBC 9CGTA 2A3AA 1TRDA 3TXVA 3PTMA 4QR6A 1XIHA 4CQAA 3WBYA 3J7HA 3TV8A 4M29A 2WK2A 2VUYA 3WK1A 2J7CA 4R7WA 3G3MA 4M7TA 3THAA 2WBGA 4BHYA 3VKCA 3S83A 2FPVA 2QDHA 4ADTA 2B0MA 5F1UA 2ZBTA 3VCCA 4YXGA 1ZB5A 5L6UA 5A1AA 1Q7QA 1S5NA 3GG7A 1I6NA 3K1DA 1J2WA 4S3JA 3INPA 3KBNA 2OFJA 1TYGA 3TN6A 3OLEA 2E6DA 3NOYA 4PULA 4C6PA 4A29A 4X3ZA 3WMLA 5BXRA 3F4VA 3STEA 3T7VA 3LEPA 4DVOA 3K8MA 1HL9A 1TZZA 2G5WA 3TW6A 5DMYA 1Q6LA 4WLCA 1JPHA 4TX8A 6TAAA 4I5RA 1U30A 4Q7BA 4FO4A 3NSNA 4GYKA 5HR7A 3RCYA 4AY1A 5C2GA 1L8NA 4IMCA 1AH0A 2VCBA 3PZIA 3JVAA 5HQLA 3KL0A 2CBJA 2E6YA 3ZXWA 2EJAA 1OFOA 4ZZ9A 4WRHA 2HMCA 4MFEA 3AJ7A 1A5OC 2ZVRA 1E0TA 3ERPA 3RFAA 3RIKA 3GVRA 5MF5A 1R9YA 3V36A 1P0BA 1FH7A 3T6CA 2VZUA 3K5XA 2WHKA 3S2NA 3R2GA 1HQTA 3AS3A 4TVDA 4HJFA 3MVIA 3OZOA 4RE2A 1NWRA 4O19A 2XSXA 2YCLA 4JIIX 4NJGA 1XC4A 2ZVIA 2WW5A 3QFWA 3LXCA 3MYOA 1SW3A 4HNOA 4CNPA 1ITXA 3GYCA 2GJXB 1QPKA 3W7IA 4F40A 3MJMA 3A24A 1P5BA 1DJZA 2XTKA 5IM51 3L5AA 4AB4A 3QZAA 3IRSA 4JL1A 2OMAA 5I6SA 3SBFA 5IHSA 1KCLA 5FCZA 2QAFA 1VFHA 1LUCB 1QW7A 3S5ZA 4MPQA 3O2LA 2ANUA 4AZ5A 3KVKA 2Y24A 4W87A 1A49A 3O6CA 2Z1KA 4GQBA 1QT1A 2C91A 1EJ7L 4IJCA 3BAJA 2JF7A 3DFSA 1R38A 4K7YA 4A8LA 3M0ZA 4WGHA 3RPTA 3IK2A 3IIXA 4CD6A 3UR5A 1L6GA 2FZ9A 4RDWA 3JR2A 2ZUUA 3ZLFA 4TIMA 3IUIA 2Y5JA 3LY0A 1DPMA 1LWHA 4Z17A 3PFMA 7PTDA 1PYMA 4EK7A 1YPFA 1K9FA 1Q66A 3P8JA 4YTSA 1X8FA 3P14A 5G1YA 4E6MA 3M5XA 3B8DA 2NV2A 2WNWA 1RP8A 3EDFA 2IKGA 4H9UA 1TPB1 4YWSA 1W9UA 1KFLA 1EEXA 1DWAM 1R87A 3HO8A 3WJZA 1LF1A 2VL4A 3ALFA 3VIIA 2FVMA 1LOLA 2BOEX 3UXAA 1B3VA 3UA4A 4GK8A 1XBVA 3IS4A 3VIMA 1PX8A 3AIBA 2ZRWA 2Y63A 1KQYA 2MNRA 4Q3MA 3NL3A 4AXKA 3MV11 3R1ZA 1S46A 3DG6A 2B7OA 2VX5A 5HA7A 3G18A 4GMEA 3BW4A 3PBGA 4KQNA 3UW6A 3FYYA 4JN7A 4DY1A 2Y2WA 4OKDA 3IV8A 4MJMA 3M16A 1KD0A 1KM4A 4Y9OA 3DHFA 2XGBA 4IP5A 1SQ7A 3WUFA 4PTVA 2F38A 3DDMA 1J0KA 1PAMA 4JIHA 2BDQA 5C9WA 4F9JA 1EP3A 1GYNA 4MB1A 5A6KA 3DFNA 3TX9A 1BYDA 1G0CA 4WKAA 3ATZA 3GNOA 3H2EA 3DFHA 1HJVA 3KOXA 3G22A 1E6ZA 1IXNA 5E09A 3M0IA 3S2CA 1B1YA 3T0CA 5KETA 4RCXA 1YMYA 4PZVA 3SN4A 2VCAA 4FF5A 2G3IA 4B3ZA 4MG4A 2VFHA 4BA0A 4NJHA 3GIPA 3G0UA 1V03A 3M5YA 3XISA 2GGEA 4AD4A 1TQXA 2J8GA 1QNQA 3AFBA 4E2OA 3URBA 1W0MA 5FF7A 4L4OA 2QCCA 2B4GA 1VLIA 3QTPA 3O06A 5LIUX 3CAKA 4LNYA 3MWCA 3K8LA 2XIMA 3AIQA 2DW6A 4DEFA 1TPH1 1C9DA 3GX9A 2W79A 1LQAA 2GGGA 1GQNA 3TC7A 5FJRA 1GVEA 1RLDA 4Q33A 2VYOA 4FXRA 1PDZA 4JKKA 1UP0A 2G50A 5C9UA 2DZWA 3IGUA 5I5RA 2NSOA 1V51A 5HR6A 3VFCA 1KTNA 1VEOA 4TUFA 1E3XA 5E0KA 3ICJA 1K03A 5DXYA 1E15A 3VOHA 3QC3A 3I7RA 2ASHA 3PWIA 4DWDA 3QEZA 3VNMA 4WZHA 2CKSA 1TZ7A 2X7VA 4LF1A 3W7RA 4CD7A 1WOBA 4PA8A 4JCMA 3WD2A 2GJNA 2YBUA 3U7BA 4MY8A 2EPMX 2YOCA 3BURA 1T8QA 1FKWA 2POZA 1FOBA 4DJDC 2NQ5A 3EWWA 1JDEA 3NM1A 3MTWA 4KFOA 1XCXA 4JTIA 2J6VA 2E77A 4JTRA 5G2HA 2WBKA 4UQCA 2VCCA 2Z00A 3VD3A 3GC5A 3ZR5A 4LX4A 1CI1A 4HQVA 4Y9NA 2Y5SA 2W5FA 1A5MC 1DOSA 3M6YA 5FKYA 2GSJA 3F5LA 5U4NA 4PEKA 3VABA 1B3WA 2H9AB 3AYTA 3A13A 3PAJA 3CV7A 1G5AA 3RLVA 3VDBA 3CO8A 1MW2A 2DT2A 4GBUA 5XIAA 2ACUA 3U2OA 2VKZG 1L9WA 2DEPA 3D3FA 1W5PA 5BWFA 3IUDA 3MV01 3PHAA 4ZO7A 5AYIA 3W74A 2V3EA 4O12A 4GUIA 3NQCA 1DIKA 2V69A 5BRPA 1OF8A 1BVNP 2PWEA 5MHBA 3D6NA 3TW7A 1FCBA 4HPNA 3RR4A 4GQQA 1TTQA 2ICSA 2QCMA 4ICMA 3TLLA 1R3RA 3GM8A 1LL7A 3KOZA 5C54A 1BWVA 3I68A 1E4NA 2QULA 1OVDA 3EDKA 4AEOA 5ABFB 4XD5A 4C7GA 4AZIA 2QJHA 4HMDA 1FKXA 2WZMA 3LZ5A 3ANVA 1EDGA 4HNLA 2DZBA 4CVUA 1R30A 1Q4NX 4XBSA 3GE7A 2AKMA 1HF6A 1QHOA 4LY4A 5JH1A 3IIPA 3W83A 1K8XA 4I9MA 3A4AA 2Z7KA 1YDNA 5K4ZA 4ZFMA 3UETA 2FB2A 5FJJA 3IGSA 1UKOA 2G96A 1A5KC 4L1XA 2YW3A 2Z1BA 2YKKA 4AWUA 4UTUA 3Q45A 3UJ2A 3KDNA 3W81A 2I9UA 2VP8A 2QMJA 3E0FA 3SM0A 5A8PA 4UZUA 2OOGA 4HCDA 1Q63A 1LP6A 2X0SA 3QY6A 3V5CA 4HU4A 3UESA 4NJKA 3PUDA 3PUGA 4OWGA 2YZ5A 3VGDA 3TYCA 4I5UA 1X98A 6ALDA 1RH9A 1EWEA 4AIEA 4LRTA 1XIDA 2EPOA 3N11A 1YHTA 4WCJA 4AZCA 3KXQA 3T40A 2WZIA 5CJNA 1QI4A 3G8EA 2L5HA 2VX6A 4B4HA 4WVXA 4E4FA 4W7UA 2ZC8A 1MWOA 1MEHA 1CZ1A 3GSMA 1WPCA 5E5CA 3P5YA 4JNYA 4GZIA 2FGZA 3DFOA 4FF7A 2PSNA 3GXFA 4M19A 3W6LA 4CQBA 3BZJA 3P61A 4PC8A 3NQAA 3KRUA 2QUUA 2VR2A 1KFJA 4C6JA 3CT7A 1OHLA 1BQGA 3T0TA 1ZBVA 1CXIA 4GC4A 4BWLC 1QBBA 4IMAA 1RBLA 3IRDA 1UASA 4HYVA 3VNYA 1NELA 3HJEA 3OPSA 2YA1A 3V16A 3BLLA 1PTGA 1V6UA 2QV4A 3M4HA 3ZJ7A 4HU0A 1Y5XA 4IMGA 4NRSA 3ABOA 3BLPX 3GH7A 2QJJA 3KRSA 4BWLA 3GH5A 4BQ4A 2XVKA 4WF7A 2OXNA 3HGOA 2QCHA 3GG0A 1H0GA 2QDDA 3EX4A 3GIQA 1FWJC 5ECUA 4GXPA 1ISXA 2OZ8A 2VGFA 3QBUA 4DBDA 4TXEA 3OBKA 1ZS2A 1XLEA 4TTUA 1I1WA 3M5ZA 3QYSA 1RP9A 1HP4A 2IW0A 3TA6A 4ERGA 1RD5A 2DT0A 3WD1A 1N55A 3AIVA 2I14A 2FZMA 1I75A 1UYQA 3L66A 4IFOA 1Y8BA 5HJXA 1X1ZA 2QS8A 3W24A 1U5VA 4HK5A 3C2RA 1C8YA 2BOGX 4GRSA 3JZUA 4BY3A 2PWVA 4ZOAA 2PDJA 1PDYA 1GOMA 5DFAA 5HNTA 3FA3A 2XGIA 1VEPA 4CQ8A 4Z1BA 1DVJA 2BSLA 3WH5A 3U9IA 1UBPC 4K1GA 4IFKB 1KRBC 3HMJG 4EACA 5E6ZA 3B9NA 1OX4A 5DEZA 5KZ6A 1G94A 1V0LA 4N2YA 3N25A 3OEXA 2AL1A 1FP9A 3LCXA 1UZ1A 1M7PA 3VNJA 1H09A 1Z32X 5A6SA 1HFBA 4KRUA 1F5ZA 2W6RA 4DX3A 3FS2A 1K6WA 1UR4A 2DQXA 4NG3A 1VBRA 3QR1A 4YWIA 4I8DA 4J9JA 4BQ5A 4LQ1A 3QOMA 2BX7A 2GJLA 1S2TA 5LGXA 5D32A 1J12A 4JY8A 4GD0A 1IQ8A 1T0OA 4KGLA 5JH2A 4L6DA 3LUTA 1FWDC 1VFLA 3KRBA 3E0VA 5JXQA 1TIMA 3EYPA 4DUOA 1WKFA 4LUIA 3W7CA 5CG0A 2OO0A 4HMEA 1PIGA 3PZQA 2WC7A 4LJ3A 3UXLA 2VRQA 3CIWA 4F2UA 2OLSA 1R9ZA 2C3ZA 4WK9A 1JDDA 4GQRA 2Y88A 2QCNA 3QTGA 3THDA 4GHRA 3KE0A 3GFZA 4HZMA 1NOWA 5JIWA 2OEKA 3NPXA 3P82A 2BGSA 4HOWA 3R12A 1V0NA 2WSQA 1Z48A 3SQLA 4BZYA 2ZA1A 1TKKA 4GWEA 3VUSA 1F61A 2GOUA 4O1AA 2PWDA 3I7SA 3E5BA 4AG0A 3VIHA 2WCGA 3C86A 1P7TB 4C1LA 2ZUNA 1FFQA 1IV8A 2Y8UA 2ZXBA 2VUNA 3VCNA 4E38A 1MSSA 2NZLA 1QASA 1AA1B 2VELA 1IWPA 3WNNA 1ZY9A 3KW3A 3AHXA 2PCQA 1XPYA 1H4PA 1L8PA 5HDRA 1A0CA 4XZLX 2INEA 1EHAA 4WXZA 1FHDA 1JCYA 5I06A 4H9XA 3KTXA 4MZ8A 2EPLX 5LIWX 3H23A 4ASTA 1K70A 5IFTA 3CGTA 3DCPA 3RGTA 3TYDA 3T0BA 5C7HA 3M9YA 1QOXA 2ISSA 5T9CE 1TV5A 3PUEA 3P2VA 2BV9A 4M6VA 5C6MA 5L9FA 1GYLA 3IUHA 1J9YA 3P0XA 1PX3A 2ISDA 1OFRA 3DKLA 5LGZA 2WWCA 1WBHA 1S2AA 3W25A 4I9AA 2ISWA 1BF2A 4EWJA 1LLOA 3HPAA 3C2VA 3LRMA 2YYUA 2AGTA 5C9ZA 3GBDA 4XO7A 1FWWA 4J2MA 1EJXC 3W7MA 3H7RA 2WQPA 3TEVA 3VZYA 1O6IA 3T0DA 1N8WA 4PUKA 1EJTC 3N2BA 5GVJA 2D3NA 1JCXA 3MI6A 3QGVA 4DF1A 5HINA 3TMLA 3DOPA 2V67A 2G8ZA 1E9ZB 4P61A 1FY6A 2CXEA 3P74A 2ZCGA 1V6TA 2PBGA 3CL7A 4MNLA 1NU5A 2PDXA 7REQA 3FOKA 4XAFA 4HNVA 3W2UA 4IWWA 5GJPA 3U0HA 2CLHA 3NQ8A 1ODZA 5KTLA 2FVKA 5C8BB 2RDUA 4FNUA 4JTGA 1NSJA 4OV9A 1JD9A 2YZRA 3G24A 1F4AA 3EEGA 4P7OA 5AFDA 1XYMA 2QAPA 2C7FA 2O92A 4N9BA 5AHMA 4GUHA 1OFDA 4WOQA 4JX5A 2JEQA 1UC5A 3L2IA 4R7JA 5KZEA 3CPUA 3PB2A 3WD4A 1RQEA 2VEMA 3VM7A 4B2DD 1IIGA 1JI2A 4L6HA 4RE4A 2GQ3A 4EXQA 3WX7A 2OTDA 2GLKA 2QF7A 1ITQA 1G9HA 1C92A 1W5QA 1OCQA 3EOOA 1EIBA 4G8TA 3QJAA 1JQVA 3H4WA 4WJ8A 3U4FA 2PDCA 2X1RA 4BF7A 1EJWC 3VIKA 3FV9A 4QEEA 1HUVA 5LA1A 2BVDA 1R86A 3EA3A 3L4TA