1L8NA

The 1.5a crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1, complexed with 4-o-methyl-glucuronic acid and xylotriose
Total Genus 278
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
278
sequence length
675
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRWWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-D-GLUCURONIDASE
publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 278
structure length 671
sequence length 675
ec nomenclature ec 3.2.1.139: Alpha-glucuronidase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1l8nA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1l8nA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1l8nA03
5A6MA 2E0PA 2WWCA 1V0KA 4V28A 1UWIA 3SCVA 5CJ5A 3CTTA 1TMQA 2VQUA 2CITA 2OSXA 3MKKA 3EDJA 1BPLB 3EBVA 4GXPA 2CHOA 1DWFM 1C7SA 1JAKA 3G6LA 2ZX8A 1J12A 4TTUA 1QI2A 1NOWA 2J8FA 1UG6A 2WZEA 1CGUA 1QI5A 4JKMA 5A8OA 1OIMA 1W3HA 3ARUA 1C7TA 4PMXA 2WVVA 3GNOA 5DT5A 2VJXA 3WQ8A 1V3LA 1CXLA 4UFJA 4AZCA 4JFUA 3SIMA 4HOWA 3UR8A 3WNLA 2OSWA 1L8NA 1PBGA 3KL5A 3OGSA 3VDAA 8CGTA 1E4IA 4KWUA 2CERA 1R86A 4FF5A 2C7FA 4P7OA 3VD9A 4MDOA 4EKJA 3ZJKA 1ODZA 3PZUA 1V02E 1H1NA 3IAQA 4W5UA 1GORA 2BFGA 5A6LA 3ARXA 3AIQA 4JZ5A 2CIPA 1LL7A 2XJ7A 1E5NA 1WCGA 4JFVA 1CYGA 3ARPA 1FH8A 3WD4A 2W61A 4DUVA 3PN8A 1UWRA 2VL4A 3AZTA 2WMJA 1XSIA 1E6ZA 1IZKA 4ZXLA 3ZT5A 4KRUA 3WDPP 1UD2A 4MB3A 2AOSA 3GH7A 2ZWZA 3KL0A 2CKSA 3O2LA 3T0DA 4PEEA 4XZWA 3SUSA 1V3KA 3SUTA 1JDAA 4PN2A 2QMJA 1JD9A 3BC9A 3VGHA 3A3HA 4ZENA 1E40A 3WDRA 4HMEA 1UD4A 3EDFA 3TONA 4PMZA 1KXVA 1E9LA 4PTXA 4YPJA 2ZE0A 3PZGA 1WDRA 4K68A 3SURA 4M1RA 1W3JA 1E4NA 5ECUA 3VGGA 2GJXB 5IDIA 3WQWA 1UKPA 4GI6A 1BGAA 1R8LA 2IUZA 1EQCA 3W24A 2EBNA 4S3KA 2IXUA 3K4AA 1I1WA 5ABHA 3AMDA 2O92A 2Y24A 1OSEA 1DTUA 3LPFA 2W5FA 4MPKA 4WF7A 1MVYA 1BYCA 3PTMA 4AZHA 4QLLA 1JNEA 1OT1A 2DPEA 4W7UA 3RJYA 4HA1A 1KWKA 4KH2A 1OBAA 1JDDA 1XC6A 2UY3A 2J74A 1A47A 4MTVA 2XTKA 4AIEA 1CNVA 1GOKA 1UH4A 4M82A 4W84A 1EDGA 1U33A 2AAAA 4Q22A 1M53A 5JIPA 2WPGA 3PZNA 2YA1A 1KGXA 1EGZA 1WPCA 3WD2A 2QLYA 1YHTA 2ZX7A 4U5IA 1QPKA 1BLIA 2PWDA 4OBSA 3WELA 4CVWA 3POHA 1YQ2A 2ZXAA 4JKLA 2X05A 3BAXA 2WM0A 1JFXA 1XHGA 4W7VA 1FP8A 2J78A 2G3JA 1UD5A 5BRQA 5GNXA 4CCEA 3W28A 1VFOA 4P7NA 2BXYA 2G4FA 4X0VA 2CBVA 2VZOA 4UFHA 1C8QA 3VINA 1V3MA 1G94A 1HKKA 3WF4A 1TA3B 4PTVA 4HZ6A 3B9EA 2OSYA 4P8UA 3SUWA 5FD0A 4C7FA 1UWQA 4D6EA 3SCNA 3NDYA 3GBDA 5HPCA 1PX4A 3WDHA 3OZOA 5CLTA 5ABFB 2Y4SA 3NSXA 3L2MA 5IHSA 2WCAA 1HVQA 4J3WA 1WDSA 3MS8A 3KZSA 1PIGA 1GVIA 4ZE5A 3VIOA 3AMLA 3K8KA 2WVTA 2YIHA 5CLWA 3CUFA 1B3ZA 1GQIA 2XM1A 4JHZA 1BG9A 3CIVA 3CPUA 4GZIA 6TAAA 1FP9A 1BYAA 1B9ZA 3L4VA 1P6WA 3WH6A 2G41A 5AY7A 2CEQA 1EOKA 2E8ZA 2J7DA 1EHAA 3W38A 1XCXA 1J0HA 4CD6A 1W9DM 4CVUA 1UH3A 2VURA 3FXYA 4Z2GA 2G3NA 2WK2A 1G5AA 3CUGA 1G9HA 1DEDA 2WW5A 4B15A 3GXDA 3BAYA 2W92A 2W4XA 1MW2A 3ARVA 1H09A 1U2YA 1VJZA 2VQTA 3L4YA 4HOZA 1F4HA 2J7HA 5D8ZA 2YJQA 1W1PA 3GXMA 1JZ5A 2J7FA 2VCCA 3D5HA 4J3TA 3GM8A 3HJEA 4W85A 5CGTA 3ZJ8A 4CN4A 2XGBA 2YOCA 3VIFA 4QLJA 4XX6A 5A2AA 3VILA 2JEPA 1K9FA 2J7EA 4AD3A 1OCQA 1HP5A 2J8GA 3AI0A 1E4LA 1UHVA 4X0NA 2OLHA 3RIKA 4P7RA 3SCOA 1KQYA 3UR7A 1UKTA 3MV11 3T0AA 2D23A 2WHLA 3A6OA 4E2OA 1V3JA 1B1YA 9CGTA 2MANA 2A3HA 2VX4A 2PWEA 1HN1A 1WNOA 4H2CA 5FKYA 1KGUA 1OGGA 3A4XA 4R27A 3M07A 4HU8A 1E3ZA 4BQ2A 2PC8A 4JCMA 3WH5A 1E15A 2CBIA 1FFRA 4OIFA 1DWHM 2E3ZA 1ESWA 4J3SA 2Y8KA 3A47A 2GJPA 2C8NA 1EXPA 1KBKA 1AQHA 3ZQ9A 3W6MA 1PEZA 5A6JA 2EPMX 1H0IA 5CPSA 4OUEA 1E6XM 2WZHA 1DP0A 1MW3A 5A2CA 4P7QA 3UG4A 1GOQA 5DMYA 1JZ3A 2DQXA 1E6NA 2J79A 2ZXQA 3VIJA 3FHAA 5E0CA 4XUYA 4FLRA 2DH2A 2WC4A 2J25A 3UG5A 4W7WA 4CU6A 1KWGA 2WSKA 1CGYA 1J9YA 5LYRA 4TTGA 1H11A 4TVCA 1XGZA 2DIJA 4M80A 1W32A 2BV9A 1W1VA 4F66A 1Y7VA 2XSBA 4UFMA 1VEMA 2FH6A 2ZX9A 2VRQA 1W2VA 1MW0A 3K4DA 1D2KA 3PZMA 4GQQA 3BH4A 4WKAA 4W5ZA 3VKKA 1KR1A 1QI4A 1B3VA 3AFBA 1TR1A 3W26A 4CGTA 3ALGA 3I3BA 1JG9A 1E73M 1UD8A 2BHUA 2GFTA 5AC4A 2GDVA 4OZOA 4GZJA 4ATWA 4ACYA 2J4GA 5BXPA 1WDPA 3BCDA 2OYMA 1NWSA 5JBDA 4M56A 1J18A 3PBGA 1PZ3A 2EJ1A 2GJRA 1BGGA 5A8QA 1XYFA 2JEQA 1FHDA 5A95A 4W8AA 4JIEA 4U2ZA 4LPCA 4L4OA 1GZJA 2WVSA 1E1FA 3SCRA 1E71M 4Z2JA 2X2YA 1K9EA 4R5EA 4ZE4A 2CCRA 3GH4A 2QV4A 3SCSA 3OZPA 3CO4A 4QP0A 5DT7A 1H4PA 1JXKA 3WEOA 3VIGA 4D6IA 3WH9A 3N17A 5M3WA 3NSMA 1NP0A 3SCQA 3WD0A 2VNCA 3FNDA 1GQLA 2GDUA 4PMOA 1QNQA 7A3HA 4JAWA 4NF7A 4Z2KA 4Y7EA 1W3KA 3AS3A 1LL4A 2XFRA 5BCAA 3AHYA 2VRKA 1ITCA 1OINA 3DYMA 5E6ZA 1H0GA 3ZMRA 2WB5A 1JYVA 5JUVA 3M6DA 1UQZA 3WY1A 1CBGA 3WUGA 3AHXA 2W62A 1GPFA 4WKFA 2AMGA 3JUGA 2DEPA 5I23A 3BSGA 3DECA 4ZXOA 1E0XA 3L4TA 5E70A 3CUIA 1B31A 1E5JA 3OG2A 2J7GA 1ECEA 3WEMA 2EO7A 3I3EA 1HNYA 1FHLA 1XH1A 1V08A 1CXEA 3CHEA 2JALA 1UR9A 1J0JA 4MB4A 2XPKA 1NWTA 2XG9A 2E8YA 3VIHA 4HTYA 1PJ9A 4ACZB 3CHCA 3W53A 4L4PA 1UD3A 1QNRA 3WF2A 1GONA 2VX5A 1W9XA 4GINA 4GPNA 1X6NA 4DM2A 3W81A 1VEOA 3AYSA 2PF0A 5CG0A 3IJ9A 1N82A 3M7SA 1JZ4A 1BVNP 4N0RA 1ZBVA 4OOUA 3AROA 4RE4A 3UESA 4J3UA 3PZVA 5A1AA 1ISVA 2DT2A 3L4XA 1MXGA 3PTQA 2DDXA 1OD0A 1H5VA 4MDPA 4P8WA 4KRTA 3AISA 4H7VA 2PI6A 4PUDA 1MQRA 2O9RA 3WUEA 4HPGA 2ESCA 1OGBA 4H41A 2XYLA 3QGVA 4H8VA 2DSWA 3PZIA 4B16A 2FGLA 5FCZA 3EDDA 2DIEA 2DT0A 4NRSA 4QFUA 1J01A 1W9BM 2J62A 3KWXA 2W91A 1AVAA 1ZJBA 3WDJA 1QOXA 1UZ4A 2CBJA 1ZJAA 3AIBA 3ZOAA 4UNIA 2WMFA 3LMYA 7CGTA 1ZS2A 2FGZA 3MUZ1 2BY0A 3W27A 4F9DA 1TG7A 1EDTA 4URIA 1BHGA 1DWAM 4PMDA 3CUJA 2OYKA 1X6LA 3VIMA 3TTYA 4M81A 3WF0A 5IXEA 3UERA 1NOUA 2A3BA 5D9MA 2XFYA 1M03A 3A4WA 3ARRA 1M7XA 3WIJA 4HU0A 4E8CA 3VO0A 5FIPA 2WYSA 2VCBA 2DSVA 3VGEA 1QHOA 1E6SM 1JFHA 1C90A 4DWSD 1HJUA 3MUY1 4W86A 3BAJA 2Y8VA 3WNKA 1LLOA 4IUGA 4HOXA 4MNKA 1LG2A 2D24A 4JL1A 1W9VA 3ARZA 1V03A 3VTRA 1CXIA 1GOMA 3OB8A 3AS2A 3OLIA 3EMCA 4RL3A 5TD4A 3B8SA 3WN6A 1EOMA 2UWFA 3TTQA 4MADA 4DUXA 3VX0A 4W87A 1ZB5A 2VX7A 2CPUA 1QNSA 3VGDA 3W25A 2WAGA 2GSJA 4PMUA 1E3XA 2Z1KA 3GTNA 4F8XA 3VNYA 3IAPA 2O9TA 4GZEA 2XGIA 3AIWA 4AXNA 4NRRA 1JGIA 4C90A 5BXSA 2BVYA 3OLEA 2WMIA 1EO7A 5A6BA 5HDRA 2YKKA 5BXRA 2WSPA 1BYBA 1Q6DA 4D6HA 2JE8A 6A3HA 4AW7A 1EH9A 1X1NA 5CSUA 3VGBA 4FLOA 3WUBA 3ALFA 4Z2IA 4EE9A 1R85A 4JCLA 4WSJA 2WCGA 1IZJA 1HXJA 2Z1SA 2ZOXA 3UG3A 5GNZA 3W4RA 1HVXA 1KR0A 4UQ9A 1W2PA 4GI9A 3ZR6A 4H8UA 4DWSA 3N13A 4HZ7A 3VD7A 3PZOA 5A6AA 1VBRA 4BZYA 1CTNA 2UY4A 3ARYA 1Q6GA 4AISA 2DH3A 4RE2A 1XH0A 2V38A 3VDBA 2WZIA 2WC3A 1Q6EA 4AWEA 4LX4A 2WCSA 1XD1A 3QHOA 1V6UA 2CKRA 2WNWA 2WANA 4NSBA 3T2OA 2BVDA 3W82A 5LA2A 3AMGA 3A4AA 2IXVA 4BQ3A 3W29A 1OWQA 2E4TA 4A4AA 3RM8A 4AEFA 1UWUA 1JAEA 4LYPA 2OWXA 3IK2A 4PRWA 1W1TA 4W8BA 5I77A 4D6CA 4WKHA 3AHVA 3GH5A 2B31A 3VIIA 2RGMA 3QHMA 4AD2A 3RM9A 2J47A 3VIKA 2WBKA 1PIFA 1PPIA 1AQ0A 3CUHA 3WNOA 1WKYA 2ZUNA 4JHOA 3ZJ6A 1RH9A 3T2QA 1JF5A 3MMUA 3AJ7A 3CH9A 1KCKA 4CCCA 2VR5A 2DSKA 1HJWA 1JDCA 2EPOA 3NIYA 3LPGA 1VFUA 5A8NA 4UQEA 4TXEA 1V6XA 3VIPA 1XD0A 3CHDA 4D72A 1IT0A 2VT0A 2QF8A 2DT3A 2YL5A 4QCFA 2DSZA 2W67A 4HMDA 2F61A 4UQDA 1TZ7A 2ZWYA 5LA1A 2EPLX 1CZ1A 4UOZA 3WFLA 1D7FA 5E0FA 2VTFA 1C91A 4CCDA 3N04A 5A2BA 3LPPA 1E70M 1J0YA 2WMGA 3T2PA 1WAWA 1HJQA 2Y5EA 3SUUA 1SFSA 3ARSA 5I79A 3EMZA 1JI1A 2YLLA 1ZBCA 4YN5A 2D3NA 3AXIA 1J10A 5JIWA 4DUWA 1V02A 4J3XA 1KXQA 3FHQA 2DT1A 3NYDA 1JL8A 1KQZA 1HJXA 1EDQA 4AZ5A 5FL1A 2VZTA 2BXZA 2BS9A 4KGLA 1UKQA 4J7RA 3FAXA 2VCAA 4FLSA 3T0BA 4WSKA 4GO8A 2GK1B 2NSXA 2DSUA 1DHKA 2VZSA 4UTFA 3J7HA 3CBWA 4CD4A 3AMCA 4D1JA 3CZEA 3FY1A 4U33A 2PWGA 4PTMA 1R7AA 3DHPA 1FH7A 2FHBA 5IHRA 4UFIA 3NUKA 1NH6A 4MB1A 2XVPA 4B3KA 1HF6A 1R7OA 4ML4A 2VZVA 1ODUA 2WMHA 3BAIA 3PZ9A 4LGXA 3OIHA 3B9DA 4PMNA 2W63A 3EYPA 3MU7A 1AQMA 1WZLA 1I1XA 4HZ8A 1KBBA 3U5UA 4AZIA 1XRVA 3MMDA 2A3EA 4AZGA 3L2LA 1E43A 3CZGA 3EMQA 4M8UA 1SMDA 3OGRA 1TE1A 3VD4A 2ZICA 4AMCA 2EEXA 4PCTA 4TOQA 3WQ4A 1BVZA 1HKMA 4TX8A 3WKZA 1H41A 2JFEX 3RJXA 4GIAA 4V2XA 2PBOA 4MAZA 2X8RA 4AEEA 5DEZA 3L4UA 1E6PA 3E1F1 1XV8A 4B9YA 4KGJA 5EB8A 2BHZA 2YLAA 3FW6A 5DFAA 1FOBA 1NWUA 1TVNA 2UY2A 3G6MA 3BSHA 2YA2A 5D9OA 3APGA 4F9JA 1FH9A 1VB9A 1BSIA 3PZTA 2YL6A 1G01A 1ZBKA 2E9LA 1WB0A 1UD6A 1TVPA 4M24A 3WQ6A 1XCWA 1KGWA 1QI0A 3WL0A 2CESA 1JZ8A 1V3IA 2QHAA 5JBFA 1E6QM 1UZ1A 1JZ2A 1XH2A 1JZ6A 3VDHA 3WMBA 4YHEA 2G8ZA 2NW0A 3PTKA 2VOTA 2VZUA 4GKLA 1C8XA 5IFTA 3BMVA 3AZSA 3D3AA 3AYRA 1IV8A 1TCMA 4GQRA 2WVVB 1ISWA 3U7BA 5F7UA 1US2A 4BQ5A 2YA0A 4AZCB 4FMVA 1ZL1A 1W9UA 2J7CA 3ZT7A 3CGTA 2V3FA 2JF7A 2ZUSA 5CSYA 1WP6A 4HA3A 2RGLA 1KB3A 3W37A 2XWEA 3VU2A 5KZ6A 3CLWA 3K1DA 3VM7A 3AZRA 3N11A 1JZ7A 3WMSA 4DM1A 2WHJA 4C7DA 3F5JA 2XIIA 1CENA 1B3XA 4F79A 3GBEA 4UFLA 2G3IA 2VUYA 1H49A 4A3HA 2ZUUA 1C8YA 1CPUA 1DWIM 1SR0A 3AICA 3AOFA 1E0VA 3GNPA 1GUVA 3BGAA 3VX1A 3SEPA 2HVMA 1V0LA 1B2YA 5C8BB 3BAKA 3VUPA 3ZO9A 4B9ZA 1UWTA 2WVUA 1HL8A 4OJYA 1J11A 1BFNA 3CZKA 4Q7NA 3GNRA 3KE0A 3WBAA 1C92A 3BLPX 4Z2HA 1JI2A 1GOWA 3F5KA 5M03A 2DGAA 1ISYA 1DWJM 1E6RA 1HJVA 3FAWA 4W93A 1NOFA 4BCEA 3VMNA 3AHTA 4BQ4A 2XHYA 2VRJA 2ZUMA 5HBFA 2WLZA 4WLCA 3NSNA 4H8HA 3UETA 2XM2A 1JXJA 3MMWA 5E6YA 2JF6A 5D8WA 3QOMA 1V6YA 5A8MA 1M04A 1WZKA 2FH8A 4YHGA 4DWSC 3RM4A 2YL9A 3AIEA 1UOKA 5E9AA 1HIZA 2XVNA 5EBAA 4PSPA 2ZX6A 4CD8A 3MUIA 4J3VA 5BXTA 5CQ1A 5I3DA 4WIWA 4LYRA 3TOPA 1V6VA 4U31A 5DF0A 3N15A 3NJ3A 4AD4A 4AZBA 1E55A 2WMKA 2CNCA 3VNZA 2VO5A 3ZR5A 2CYGA 3DYOA 3L4ZA 2EXOA 1KXTA 2D0FA 1QNPA 1DWGM 1B3WA 2YDRA 1MFVA 4JL2A 3WSUA 2X09A 4OBRA 3AS1A 3N18A 3TP4A 2NT1A 2WMIB 3T08A 4CKQA 1CLVA 1E56A 2BY3A 1B30A 5A6BD 1GJWA 3VD5A 4UCFA 5A6KA 1SMAA 3TTOA 4D6JA 1H3GA 3WDQA 2YL8A 4RE3A 5IFPA 1UQYA 4P7LA 4OKDA 4E4PA 2ZIDA 2G3MA 5CGMA 1ISZA 3LPOA 1NM9A 1WZMA 2E40A 4PYSA 2JIEA 4P8XA 2OWWA 4PTWA 4ACZA 1G0CA 4Z2LA 1C3FA 3SCTA 3ZJ7A 3U57A 2VI0A 4GO9A 2D0HA 2XVKA 2V5CA 3VOCA 4DWSB 2ZUWA 3WH7A 1V0MA 2ZUTA 3RO8A 1J0ZA 2PB1A 3IANA 1CIUA 3WF3A 1W9PA 5CXPA 3W6LA 4D6GA 2BVTA 4CUCA 1UR1A 4MB5A 1GNXA 2WC7A 1JD7A 1WO2A 3GYCA 1OT2A 3UCQA 3VD3A 2CXGA 2VVSA 3SCUA 1GOIA 4TUFA 5HNNA 1MXDA 1KFWA 2GUYA 5LA0A 2F8QA 5M17A 3ARTA 3U7VA 1M01A 5D9NA 3ZSTA 2WWDA 4AC1X 1UR4A 2HISA 4CD7A 1CXHA 1PZ2A 5ABGA 4UOJA 3AXXA 1CGVA 3WH8A 2ZX5A 5D4YA 4ATDA 1JF6A 5C70A 1OD8A 3OBAA 1O7AA 2V3GA 1HKJA 3QOKA 2X1IA 2UY5A 4HMCA 1UH2A 1QI3A 3RDKA 2V3DA 3NCOA 4AIOA 4UZUA 2QMKA 3WNNA 1UA3A 4AIUA 2XVGA 1J0IA 4U3CA 4CD5A 4CU7A 3CZLA 3MV01 1GQJA 5KEZA 4N42A 1UKOA 1B3YA 1E72M 1S46A 1JYNA 3CZ8A 2A3AA 1NQ6A 3WENA 3B9AA 3RILA 3ZM8A 1EQPA 1LWHA 1A3HA 4CN6A 3N12A 3BMWA 1US3A 4J28A 3BXWA 3K8LA 3AXHA 3ECQA 1J0KA 1BTCA 2TAAA 2FHCA 1MWOA 3WL1A 5HXMA 5BRPA 5GNYA 2WHMA 3UEQA 4KMQA 4LQ1A 2WHKA 5I2UA 1CGXA 5AC5A 4GI8A 1Q6CA 5JBEA 3BCFA 4MNJA 4PMVA 1WE5A 3N9KA 3PZQA 4HP5A 1VJSA 1WZAA 3DHUA 4LYQA 1VEPA 3WFZA 3GZAA 1GW1A 3AQUA 2XUCA 1R87A 1LJYA 1WDQA 5EFDA 3W0KA 4UOQA 2BNJA 3VPLA 1OB0A 2WBGA 4AD5A 4D6FA 3S2CA 4ZFMA 5CZKA 3WNMA 1CGTA 1EA9C 3BAWA 3QHNA 5DO8A 2W66A 2GJXA 2J75A 2YBTA 5BROA 1BG4A 5BYWA 3OGVA 2O9OA 3VDCA 5CPQA 5A94A 1LWJA 1E0WA 1JYXA 1B90A 1KCLA 4JFWA 4B3LA 5I6SA 4FLQA 3O6AA 2O9PA 1K6AA 1RD6A 2VR4A 3HU7A 1EHNA 2WKGA 1VBUA 4X9YA 2V3EA 1E4MM 2PWFA 4EAMA 4CN1A 3VM5A 5BWFA 3GXIA 4JFSA 2D20A 2ZUVA 4W88A 1XYZA 2XVLA 2WLYA 3MANA 8A3HA 4FK9A 1UR8A 1PAMA 4WK9A 4PMYA 3F5LA 1VENA 2EPNA 1VAHA 1UWSA 1JYWA 1CGWA 3WD1A 2XWDA 1Q6FA 1V0NA 1QHZA 3PHAA 3WUFA 1D3CA 4TX6A 4W89A 3AIRA 3BLKA 1RPKA 1HJSA 2F2HA 1MYRA 3WQ5A 5EMYA 3L4WA 2VX6A 5CPTA 5I24A 1QBBA 1V6WA 1CDGA 4QCEA 1VIWA 2XFFA 2D0GA 2QPSA 2XSAA 6CGTA 1TA3A 2D22A 4J27A 3SUVA 1H2JA 3QR3A 2YBUA 4NI3A 3RCNA 2FHFA 3AIVA 5FL0A 1UR2A 3WDIA 3HMCA 3ARWA 1VF8A 5D9PA 5I78A 1QVBA 1GOOA 2X0YA 5ABFA 1W91A 3SCPA 2EPKX 1LL6A 1GJUA 3ARQA 1UYQA 3II1A 3KEHA 1QNOA 3CHFA 1VRXA 3GDBA 4UQBA 1MFUA 4AZ7A 3OA5A 5M5DA 2Y2WA 3HN3A 2V5DA 3DYPA 4UQCA 1GHSA 4PCSA 4OOZA 5A3HA 4PBGA 4BS0A 1LQ0A 4W8LA 4BA0A 4V27A 1CXFA 4XB3A 3OLDA 3WD3A 1TFVA 5A8PA 1Z32X 3WNPA 1B0IA 3OLGA 1HT6A 4QDMA 3U5YA 4IISA 1KXHA 1RP9A 3VMPA 4P8VA 1V3HA 3AS0A 2Q8XA 4AD0A 3MUAA 1HX0A 5I5RA 4UQAA 4C91A 4XV0A 1Q4NX 2GVYA 1C93A 1W3LA 5E09A 3IJ7A 2E9BA 3M46A 4IM4A 2X0HA 2OWCA 4EK7A 5FOOA 3TTSA 1FFQA 4PSRA 1RP8A 1MW1A 3VVGA 4C7GA 3T09A 1QW8A 4UZSA 1UA7A 2D3LA 2CHNA 2ZXBA 2YDSA 4HPHA 3DC0A 1LF1A 4WJXA 4AYSA 1OIFA 4JKKA 1EIBA 2A3CA 1CECA 2BY2A 3MO4A 3WBEA 4U3AA 4D1IA 1CXKA 3AIUA 4MJ2A 5C71A 5ABEA 2D1ZA 2NT0A 4UR9A 3SCWA 1F4AA 1L0PA 1UR0A 3AHZA 3CMGA 4MNLA 3IJ8A 1U30A 5A6SA 4AY1A 3F4VA 3N1AA 2VC9A 2WXDM 1BAGA 1ZBWA 5GQBA 1GHRA 1OGSA 4MJ4A 4IPNB 3WMCA 4E8DA 3FN9A 1BYDA 1XSJA 3ZIZA 3GXFA 1LG1A 4AD1A 1GVYA 1EO5A 2GK1A 3AMKA 4PMQA 3WF1A 1PX8A 1K9DA 1QBAA 3WQVA 4AZ6A 3MSDA 1SYTA 4D6DA 2BY1A 1VFMA 4U2YA 2QPUA 4QAWA 4M29A 1BF2A 3THCA 1W1YA 2BHYA 4A3YA 1NP2A 2EQDA 2XIBA 1PX3A 2J7BA 3ZT6A 2PWHA 1HL9A 4BF7A 2CBUA 1UKSA 1QW9A 1I75A 3RMEA 3O9NA 2OYLA 5HOSA 1CEOA 5HPOA 1VFFA 2PBGA 4LXFA 3S6TA 2CETA 5GPRA 4MAVA 1O6IA 1OM0A 2VMFA 4TVUA 2WKLA 4JFTA 2D2OA 4UFKA 3POCA 3KL3A 3VMOA 1NARA 1QHPA 2C0HA 1TUXA 1CWYA 1E1EA 4ATLA 4EANA 3K8MA 4D71A 2FDMA 4PUEA 4IPLA 2J77A 1FA2A 1HP4A 4S3JA 4QLKA 1K9TA 1ITXA 3CMJA 1MQPA 1ZU8A 4NZCA 5AYBA 3WEZA 1GQKA 1BQCA 3I3DA 4ZEPA 1NWRA 2YDQA 3VGFA 4CU8A 1ISXA 1GCYA 1CLXA 4PMRA 5I0DA 4H04A 1MQQA 3K46A 2E9MA 1JNDA 3CZJA 1HKIA 5EFFA 1XSKA 2ZXDA 3MSGA 3TA9A 4TVDA 3NDZA 4U5KA 4XZBA 1AMYA 2JIWA 2VVNA 5A69A 1G1YA 3EDKA 4MNMA 1JIBA 3EDEA 1UUQA 3RPMA 3THDA 4HA4A 7TAAA 3ZSSA 5AYIA
chains in the Genus database with same CATH superfamily
4O28A 3PULA 1TMQA 1W1A1 2VQUA 3BTNA 2CITA 3QJAA 3MKKA 4MLJA 1XIHA 2CHOA 2Y8UA 1JAKA 1I0BA 1AD1A 3G6LA 2HK0A 4E2VA 4HHPA 3R12A 1OVDA 2E6AA 1J12A 4R7WA 1OYAA 4IQJA 2WZEA 2QGHA 1CGUA 1KLZA 4I9TA 4IMEA 2NQZA 2F7FA 3TW7A 3EX4A 4AZCA 3UYCA 4HOWA 5L6UA 5DXYA 3S4TA 3WNLA 2VEPA 4GYJA 4XZMX 1PBGA 2POTA 3KL5A 1FVPA 4S3AA 1E4IA 1R3SA 3BICA 1OZMA 4FF5A 1R47A 3VD9A 4BF9A 3XIMA 4XUGA 1ODZA 1V02E 4UMAA 3IAQA 2HVNA 3GNNA 4RZBA 4AVOA 5A6LA 3AIQA 1V6TA 4XIAA 4JZ5A 2CIPA 2XJ7A 1WCGA 2QCDB 4JFVA 4FZIA 1Y5XA 2PTZA 2VEIA 2W61A 3R89A 4K1WA 4G6CA 1UWRA 1K4GA 3AZTA 2E77A 4E38A 4XVEA 1GVOA 1TTJA 5E93A 2AKMA 4Q8NA 3HGOA 4MB3A 2A5HA 3GH7A 1M7OA 2YPIA 3G1AA 3KL0A 4AF0A 2BLEA 1TV4A 3SUTA 1Z7AA 1E40A 4KFOA 3FEQA 4QR6A 3DFTA 4LWWA 1FWRA 2AQWA 3TONA 3KCJA 4NYUA 4K39A 1KXVA 3VKBA 4YPJA 3RU8X 3KTSA 1TWDA 1FCUA 2G3FA 3SGUA 4M1RA 1TUFA 4F2BA 2GJXB 4KW2A 1CB7B 1UKPA 1WBJA 4AUBA 1BGAA 5LKYA 1RALA 3T81A 3NL5A 1IZCA 2EBNA 1RSCA 3UCDA 3K4AA 1I1WA 1XL9A 3AMDA 2Y24A 2BBFA 1OSEA 2ZRXA 1ZAJA 3A64A 4A8NA 1H7PA 4MPKA 2ZDRA 4H3DA 3PTMA 4L61A 3B04A 3L65A 3W1TA 1FWAC 1T5AA 1QRQA 3O3RA 2XN2A 3OBKA 3S2LA 3GHSA 1KGXA 2ISDA 4KWSA 1EGZA 6TIMA 4XBJA 3SECA 1YHTA 3BLDA 3E96A 1P0KA 4U5IA 4PB4A 2A6LA 1BLIA 3GW3A 3WELA 3W1MA 4CVWA 4FAMA 2QAFA 2ZXAA 4JEQA 4JKLA 2WM0A 1JFXA 1XHGA 2ON3A 1W1B1 6REQA 2Z29A 1UD5A 2OODA 1SW7A 3AO0A 3OU8A 3UJRA 2PGRA 2VZOA 1XGDA 3JS3A 3SI9A 3VINA 1EP2A 1G94A 1HKKA 3WF4A 1GEHA 2GGHA 4PTVA 1DQWA 3UBPC 1A4MA 4QQ3A 2OU4A 3NDYA 1Q85A 3MHGA 3ICJA 5ABFB 1VYSX 1QOQA 1R9YA 4F0LA 1GT8A 3A3WA 1F6KA 1S38A 1A49A 1XKYA 3HQ1A 1IWAA 1FCVA 2QCMA 2WVTA 4GYFA 6TAAA 2R1KA 3M5XA 3E12A 4DZHA 2G41A 3LXBA 3A13A 2J7DA 3G2GA 1XCXA 3G1FA 4HNLA 3P62A 1T7LA 1PYFA 5LIKX 4BWLC 1VQTA 4Z2GA 2G3NA 1G5AA 3CUGA 1DEDA 4NZ5A 1H7RA 2FTWA 4IL0A 4B15A 5CPNA 4A8IA 2JK2A 4MJZA 1U2YA 2VQTA 1VJZA 3M0VA 1S3HA 3L4YA 4DELA 2YJQA 1W1PA 4HPNA 3CB3A 2XU2A 3RFAA 2J7FA 1JZ5A 1XLFA 3UY8A 3D5HA 4J3TA 3SY1A 4BJHA 1ZCCA 4NY2A 5CGTA 4B90A 4WCJA 5BMWA 2YOCA 4L9YA 3VIFA 4QLJA 3VILA 4JD4A 1K9FA 2O55A 2J8GA 1E4LA 4X0NA 2J27A 4FNSA 3EXTA 2QUNA 3QFEA 1EX5A 3A6OA 1L6WA 5A8GA 4ZQPA 5JU6A 2A3HA 1LQAA 3W2KA 2NLYA 2J24A 3UVAA 1JUKA 3P61A 4JCMA 3WH5A 2OLAA 1SR9A 4OIFA 1TV7A 1R9ZA 4XZLX 2IQ0A 3APYA 4W4QA 2C8NA 1EXPA 3L23A 4EXAA 4NU7A 1KBKA 1O1HA 3N34A 1P0DA 1J96A 1H0IA 4OUEA 1E6XM 2AL1A 1MW3A 3ANYA 1OJXA 3VNDA 4ZO8A 1JZ3A 3QM3A 4IGHA 2DQXA 1E6NA 2WZMA 1KC7A 1WOAA 5E0CA 4UR8A 1OYBA 2DH2A 3TQVA 4N7QA 2XISA 2WSKA 2E67A 3GVRA 2X1TA 1CGYA 4YIWA 1H11A 4GD0A 2OO6A 1W32A 5C2XA 4HK6A 1J5TA 2CZDA 5KMYA 4UFMA 3WQEA 1VEMA 2FH6A 3FYOA 5LHFA 2VRQA 1W2VA 5LNUA 4GQQA 4WKAA 3CB8A 1W3IA 3A21A 3O06A 3BL3A 4ZB2A 3HV9A 3FDKA 4UTLA 1JG9A 2J9ZA 3U2CA 3SY5A 2BHUA 1E1CA 3LUTA 2GFTA 3V5CA 5AC4A 3M0MA 2EG6A 4AU0A 4R33A 2J4GA 2Z6IA 1WDPA 3W1RA 4M56A 2GJRA 4X2PA 4V1XA 1XLGA 4U2ZA 4O50A 3R6IA 1GK8A 4RDYA 2YW3A 3I7RA 4IOTA 5D38A 1K9EA 4R5EA 5DMLA 2PDPA 3O1NA 4IF2A 5EBUA 1S3TC 1TWSA 4HA0A 1GTEA 1GJPA 4TIMA 3TN6A 3WEOA 2ASHA 3DBPA 4ICCX 3RPDA 3SCQA 4LF2A 2VNCA 2QPXA 3FNDA 3WJZA 3FJ6A 4A3RA 4HHMA 3W7DA 2IPWA 3WCZA 1KD0A 1ZLPA 1ZJHA 4A35A 3C8FA 3ITOA 4Z0SA 1LL4A 5BCAA 1YW1A 3AHYA 4P5UA 1NFBA 1ITCA 1PVNA 3UPMA 4J1OA 3TYDA 4YCPA 4GI4A 1HUVA 3O05A 3QKZA 1UQZA 3TYZA 3UJFA 1HGWA 3WUGA 2W62A 3ZXWA 1GPFA 3PFRA 3FX4A 2ZZ5A 3BSGA 2C1HA 5DBTA 1L9WA 2ZE3A 1ECEA 4GXWA 1K77A 3WEMA 2EO7A 3SGGA 3QQ0A 3QY6A 2QJMA 1Q65A 1FHLA 3CQHA 1K7XA 5FEZA 5ECVA 1J0JA 1REQA 1NWTA 3VOIA 3ZZ1A 5EY5A 3MUCA 3W53A 4L4PA 1UD3A 1JCMP 2VX5A 4GKTA 4HD5A 4MYAA 4R9XA 1R38A 3WLLA 3IJ9A 5E9XA 3EXSA 4Y2WA 4PULA 1TX2A 4DJFA 1ZP4A 3AROA 4RE4A 3UESA 3RITA 2YB1A 1ISVA 2DT2A 3DDMA 3LNPA 4LS1A 1MXGA 4HKPA 3ZYZA 2DW7A 1PDZA 4P8WA 3QYQA 4KRTA 2PI6A 2PLCA 4MF4A 1QW7A 1XIIA 3SSZA 1CX9A 3HPZA 4UR7A 4MWAC 2E5CA 5GJPA 3QGVA 2PAJA 5HJXA 1VFSA 3TSMA 4C6OA 2DIEA 2DT0A 4UTKA 1K8ZA 3TW6A 3W76A 4XTDA 2GGGA 1Z41A 3B4UA 3N2TA 1Q66A 3KWXA 3K30A 2W91A 4LV4A 3WDJA 1QOXA 3CAKA 4Q3MA 1EZWA 2E6FA 4EACA 4RNFA 2Y1HA 3G0UA 4HN4A 2C6QA 3LHTA 1FKXA 3IEBA 5A5WA 2BY0A 3P2VA 3IARA 1R3TA 4F9DA 2C13A 2E6DA 1EWEA 2P88A 1RZMA 1N2VA 4REQA 1P7TA 1DWAM 2OZ0A 4PMDA 2OYKA 1X6LA 3TTYA 4M81A 3WF0A 5IXEA 1XJBA 5D9MA 3GTIA 1LT7A 5CPOA 1G4TA 4B2DA 3ARRA 1CT5A 4XZHA 1K02A 2QQ6A 4FXFA 3OO2A 4JHMA 4N9EA 3VGEA 2ANUA 4NX0A 3KAOA 2DFAA 2AGKA 1JFHA 4QRNA 1TWWA 1KFKA 3MY9A 2JKEA 4DWSD 3VOHA 1VCGA 2OCZA 4W86A 3BAJA 3I4EA 3TC7A 1JDEA 3WNKA 4IT1A 1EXBA 3NG3A 5XINA 4FNTA 2OPJA 3FXGA 3AC0A 4XG1A 2PDIA 3CWNA 4RL3A 3SFWA 1G4SA 1PHWA 3COTA 5DRCA 1RQHA 2UWFA 1ZZMA 4ZBCA 3OW1A 4MADA 1BRLA 2VX7A 1JVNA 3W02A 3VGDA 5I06A 2WAGA 2BXVA 4PMUA 1QK2A 4ERIA 3IAPA 4GZEA 3VYLA 2RAGA 4NILA 4AXNA 1ME8A 1WX0A 3GYEA 2BVYA 4LANA 1MEIA 2FVMA 2P53A 3IUIA 5BXRA 1Q6DA 4FIRA 5GJNA 2JE8A 3ITLA 3KFTA 3PUDA 2VEMA 4WY0A 3NWRA 4FLOA 3OG3A 2YCEA 4WSJA 3V5OA 1HXJA 3QPYA 3UG3A 3W4RA 5DY2A 1X98A 1N8WA 4TU1A 4O13A 4GI9A 4LVDA 4WXZA 1GZGA 5A6AA 2ZRWA 2QIIA 1PWLA 3ARYA 2BZNA 4LVBA 3IJ6A 4RE2A 1Q6EA 1P43A 4LX4A 1YEYA 3EOUA 4N4PA 1V6UA 1KM4A 2WNWA 2WANA 3MBFA 3A23A 2IW0A 4S3FA 1T41A 3RM8A 3ANVA 4LYPA 2PODA 1F3TA 4R88A 4D6CA 1J6PA 3AHVA 3D47A 3GLCA 3F4DA 3P6LA 1VIZA 1W5MA 1PIFA 1AQ0A 1SO3A 3CUHA 7ENLA 1G6CA 2INFA 1RH9A 3MMUA 4TX9A 1LDCA 3AJ7A 3CH9A 3G77A 3W86A 4FI4A 2XZ7A 5KETA 1ENUA 2P0OA 4DIAA 2ISWA 1I4NA 4MZ8A 2Q02A 5A8NA 1XLDA 3RGTA 1L6SA 4HSOA 3CHDA 1IT0A 2Z0IA 4Y9MA 2DT3A 2IKJA 1AA1B 1TZ7A 2ZWYA 5LA1A 3DHDA 3QTGA 4HYWA 4LB3A 2BODX 1WA3A 5FAJA 3WFLA 3STCA 1D7FA 5E0FA 1DJZA 1TPEA 1C91A 2YCIX 3MYOA 3KRZA 1H1YA 4ZQMA 2WMGA 4MOZA 5DANA 2Y5EA 1A5AA 3ARSA 3LK6A 5I79A 2VGGA 2YLLA 1ZBCA 3NR0A 2OVLA 4UMBA 1BWVA 5JIWA 5LIUX 1V79A 1QR7A 2BGQA 2DT1A 2Z6JA 2NWRA 3S8HA 1HJXA 1EDQA 4AZ5A 5FL1A 5E5CA 2BS9A 2ZCGA 4KGLA 3WK3A 5LNWA 2ZRUA 3S1VA 4WSKA 1WUFA 2AKZA 1I8JA 1O12A 4CD4A 3AMCA 4D1JA 1ADDA 3CZEA 3WLSA 3FY1A 4KIEA 3HV8A 1R7AA 5G4HC 2FHBA 5IHRA 2QVHA 2XVPA 4JY8A 5F4WA 2VZVA 5HULA 3TA6A 4O1CA 2FZ8A 1PZ1A 2GQ8A 3F1QA 3NQDA 1GYMA 4LGXA 3ZS4A 4PE8A 4IXXA 1AQMA 1WZLA 3NQ8A 4AZIA 1FWJC 5BZAA 3VUSA 3N2MA 2OFJA 1TELA 2ZICA 2PPGA 2CZFA 1ONXA 4TOQA 1BVZA 3WKZA 3M7WA 3OVPA 2QDHA 3RLUA 4ZOBA 3H2OA 2PBOA 4JIIX 4AH7A 4MAZA 5M2FX 3E2RA 4AEEA 5DEZA 3L4UA 5HMFA 3OQEA 2DZXA 1RVGA 3OQ8A 4KGJA 1FOBA 2UY2A 4M0XA 5D9OA 3PR2A 3APGA 4HGXA 4F9JA 1FH9A 1VB9A 4H2HA 2H9AA 2YL6A 2E9LA 1WB0A 1IYXA 4QXIA 2C15A 3NQ7A 3A4JA 5J8LA 1R30A 5LNSA 1A5UA 2CESA 2ZBTA 4LC6A 2QHAA 3W7PA 2BOEX 1JZ6A 3WMBA 4DZIA 4E8GA 5KZDA 1RJPA 3WQOA 1VGAA 2X2GA 3C2VA 4WSHA 3U48A 5IFTA 2WJEA 1IV8A 2X42A 2YCKX 4EF9A 5F7UA 3ISIX 3W7RA 1US2A 4Z1BA 2YA0A 4AZCB 1VCVA 2PDXA 4FS9A 3KHJA 1ZL1A 5DQPA 3MI3A 1XYCA 3CGTA 1XDMA 2V3FA 2BG5A 5FJOA 1JCJA 2V82A 3LQGA 5HANA 4LBRA 1XRFA 2QIWA 3N25A 1KB3A 3O6CA 3VU2A 3PJTA 3CLWA 3K1DA 3VM7A 2ZRYA 3WMSA 2PTYA 4HQVA 1VJIA 3RK8A 2FIQA 3PS7A 3L2IA 3GR8A 4UFLA 2X40A 4H8NA 1M9HA 2OB3A 4A3HA 1C8YA 2PDGA 2CWNA 2VFHA 5FF3A 3P0WA 2NSOA 2F6UA 3MW7A 5T26A 3PWAA 3VX1A 2VD9A 1B2YA 3W7OA 5K4ZA 5CZSA 1UWTA 2J6VA 4C6NA 3UNTA 3KE0A 5D30A 4Z2HA 3GDKA 1S5TA 5D37A 1E6RA 1HJVA 3FAWA 3WLPA 3NZRA 4I7WA 1NOFA 1W0MA 1EB3A 2ZVIA 5FAGA 2KAUC 3LU2A 4E3TA 2WQDA 2WLZA 1ONWA 4H8HA 4FX8A 3UA3A 3P67A 5CC7A 1JXJA 3MMWA 3YPIA 3WO8A 4ERGA 3GG7A 3OVQA 1M04A 1WZKA 3BW2A 4DWSC 3AIEA 4R9OA 5EBAA 1Y65A 4CD8A 2CLHA 3SQLA 3NTYA 2NXGA 4LTSA 4WIWA 3B9NA 1XIEA 3IIOA 1V6VA 4HNTA 2WMKA 2CNCA 3UNDA 3ZR5A 1R6WA 1KXTA 1QNPA 1B3WA 3TE9A 3MDUA 3C6CA 3AS1A 3LHZA 2B4GA 3CHVA 2GQ3A 1XIBA 3I7SA 4C5YA 1Q13A 3MSYA 2G95A 1JQVA 3H21A 1CLVA 1PYMA 3VD5A 1Z42A 4J2MA 4UCFA 1SMAA 2I17A 1FDYA 4D6JA 4AY7A 4E4PA 1UPMB 2YX0A 2G3MA 1ISZA 1IHIA 3P84A 2WQPA 1WOBA 3L67A 4IMCA 2OWWA 4ACZA 4Z2LA 3KDOA 1C3FA 3SCTA 2V5CA 4O11A 3WH7A 2ZUTA 1UUOA 1J0ZA 4ZA0A 1CIUA 5AHFA 4GCAA 4Q8MA 4WVXA 3VCCA 5JXQA 3XINA 4LAUA 4CUCA 3K5XA 1OF8A 1UR1A 4MB5A 4DJDD 1L6GA 1LRTA 1JD7A 3BDKA 2POZA 2QVNA 4LUJA 3UVIA 3SCUA 2OT0A 1GOIA 1TJ1A 1TWZA 1VFHA 2E68A 1O94A 1OK4A 2F8QA 3B4YA 3ARTA 3U7VA 5DY3A 5D9NA 3ZSTA 2PZNA 1SO4A 2WWDA 4AC1X 2HISA 4CD7A 1CXHA 3RMJA 1CGVA 5C70A 3OBAA 4O18A 1O7AA 2V3GA 3EA1A 1HKJA 4IQDA 5CG7A 3HPSA 2UY5A 1I6NA 2WPBA 4I5UA 1YBQB 1TB3A 3LV5A 2C1IA 1HZYA 1QNVA 4N42A 1UKOA 5C2CA 3R8RA 2VEGA 3HOJA 1S5WA 2J9YA 1IWBA 1E0UA 3S5NA 1US3A 5HAOA 3BXWA 1KM2A 3EPOA 2HE8A 1F3EA 3WL1A 3W7HA 5AKQA 4OVXA 1XGEA 2Q8ZA 2WHKA 3MP5A 5I2UA 3Q4DA 3HBLA 3W7EA 2PGFA 1Q6CA 5FF0A 3N73A 3PZQA 1WAUA 1WZAA 1MUMA 1YADA 1K7EA 1VEPA 1ZY9A 1O68A 1XLAA 1N7KA 3D3FA 5EFDA 2PWVA 3E2VA 3QV8A 3VPLA 4YU1A 3Q2DA 3H70A 1IEVA 4D6FA 3LBMA 3S2CA 1H60A 2OOGA 5CZKA 3W7KA 1YDYA 3TC6A 3QYSA 3QHNA 3R58A 3U2OA 1TWIA 4A22A 2YBTA 1KW1A 1VBJA 5DMNA 3REQA 1XP3A 3USZA 3VDCA 3V3WA 1JYXA 5F2MA 3DG7A 3L12A 4BEUA 1OF6A 1TVLA 1IGWA 1PKLA 1VRDA 3O6AA 1K6AA 4OT7A 3BOXA 1YRRA 3MTWA 1BXCA 4X9YA 1DE5A 3BJFA 5CBIA 4MZYA 3KX6A 3NNTA 3KVMA 3SRKA 1F3WA 1KV5A 5BWFA 1UZHA 2V8ZA 3PVFA 4W88A 2PDKA 1G7UA 3FK4A 1TO3A 8A3HA 4X22A 3DI1A 3QVQA 1PAMA 3L0NA 1YPFA 1VENA 2EPNA 4I5RA 4LNYA 3BG5A 2QXWA 3WD1A 3BOLA 1KKOA 4QGCA 1QPNA 2I14A 1SZGA 1D3CA 1XG3A 3WLMA 3AIRA 4QG8A 4G56A 3CL8A 5G2HA 1AUSL 3NPXA 2HNHA 1RPKA 3A12A 3KBNA 3I4KA 3WQ5A 1SO6A 2CC0A 3M5VA 5G4EA 3LTYA 1QBBA 1V6WA 1CDGA 3WFAA 1VIWA 2XSAA 4ZOEA 4J27A 3SUVA 3QR3A 2NV1A 5ABTA 3EOSA 2ATSA 1DORA 2FHFA 3QH2A 4MY8A 4ZO9A 5I78A 9XIMA 3LGEA 1W91A 4LUSA 4O4WA 3SFKA 1LL6A 3ARQA 3L68A 2GGIA 2GOUA 3UWYA 4LAZA 5LGXA 3HFTA 3OP2A 3OZYA 5M5DA 5C7HA 4FA3A 4HNVA 2Y2WA 2V5DA 4ES4A 4B3ZA 4JTQA 4DY1A 1XLEA 2A1YA 4M7SA 4CNOA 1LQ0A 4W8LA 4ZTYA 3WD3A 3M5YA 3OLGA 5I07A 4IISA 3KP0A 2IKGA 4RK8A 1JQXA 3TTEA 2Y70A 4MZ1A 3BQ5A 2I9UA 4RX0A 4C6KA 4UQAA 3TEVA 2QYGA 4XV0A 2GYIA 3LNMA 4E4UA 4JR5A 1G4EA 3M46A 9RUBA 4IM4A 4Q8VA 4LRTA 4F3HA 1K70A 2PCEA 3RR4A 5FOOA 5AHLA 3P14A 4PBFA 1MW1A 3A3XA 3HGRA 3EX1A 4RPQA 4DZ5A 1FKWA 1UA7A 2D3LA 1F2JA 2CHNA 3UGVA 4JTEA 5HNRA 1LF1A 2P1FA 4WJXA 4AYSA 1OIFA 4I3GA 2I16A 2A3CA 4U3AA 3TKFA 3HO8A 1L0PA 4INFA 3LN3A 1EF3A 1OZQA 3S2NA 2DVUA 2H90A 4NKCA 3AHZA 3CMGA 1U30A 4BWLA 5I3GA 1RCXB 3PNUA 3N4AA 1GHRA 4J40A 4PB5A 4MJ4A 2O4MA 2X0SA 2EKGA 3TSDA 1BYDA 1E0TA 1LG1A 3MI2A 2YCLA 1OCNA 4KPLA 2SFPA 4B5NA 4AY8A 3NDOA 1VFMA 4U2YA 3V4BA 1J93A 4MFDA 4OTKA 2BHYA 3PWGA 1TTPA 4QSHA 3TYEA 3ZT6A 3DFPA 1S2WA 4BF7A 2C14A 1QW9A 5FF2A 3GG8A 5HPOA 2G96A 3H2EA 3S6TA 5GPRA 1JPIA 3H7VA 1DIEA 2VMFA 1MUCA 3TNOA 4JFTA 4IMDA 2PDQA 3ZWTA 1ICSA 3POCA 3MJMA 3VMOA 1TUXA 3AAMA 1E1EA 3TR9A 4ATLA 2Z28A 4D71A 2FDMA 3TN4A 3A5FA 4PFMA 4IPLA 4LCRA 3W84A 4FX6M 3N14A 4L1GA 1FA2A 2EJAA 4QLKA 1ZU8A 3BW3A 3GS6A 1OY0A 5D05A 4A8LA 4X3ZA 2YFNA 3THQA 5I3IA 1PTDA 3VGFA 3LY0A 1ISXA 1GCYA 4TV5A 3SRHA 1W3NA 3M0XA 3DKLA 1XSKA 4WGHA 2ZXDA 3MA8A 1NTHA 3TA9A 3KOZA 4XZBA 3NYZA 4DAIA 2QCHA 1M7JA 1RUSA 2HE5A 1VP5A 3V18A 3E5BA 4GA8A 3LZ5A 2CZVA 2WSYA 5A6MA 3HB9A 2WWCA 4V28A 4G7EB 5CJ5A 4DBEA 2FGBA 3UYIA 4FXRA 1ITUA 2EKCA 4RW5A 4K38A 1DWFM 1BXBA 1XYMA 7XIMA 4GVIA 3EGJA 4TTUA 1XYBA 2PDFA 4YL2A 2NQHA 1UG6A 2A0NA 3CPGA 4EXQA 3MPGA 4JKMA 5A8OA 1ONEA 3QR0A 1C7TA 4DJDC 2O56A 1EKOA 1BRLB 2QCGA 1CXLA 4UFJA 3SIMA 2G5WA 3B9OA 2CERA 3DFHA 3T55A 3MC5A 4IGSA 3VOFA 4EKJA 1TV3A 3IWPA 1U22A 4WHBA 3PZUA 2CLOA 1AMKA 2X16A 4GGHA 4Q4SA 1GORA 4NXKA 3WX7A 4FIQA 2X7VA 4LCQA 1H7XA 3M5ZA 5D33A 1XFCA 1E5NA 3DC8A 1CYGA 2GLKA 4WY0B 1JPKA 1L2UA 3PUGA 3SDOA 5EA9A 2VL4A 3ABOA 3O15A 2WMJA 1XSIA 1E6ZA 1IZKA 4NAFB 3FKKA 5I3HA 4ZXLA 4KRUA 3WDPP 1UD2A 2AOSA 2BGNE 1AW1A 4LAMA 3O2LA 4PEEA 4XZWA 3SUSA 3GG1A 1V3KA 4KWWA 4PN2A 2QMJA 4HN8A 1UD4A 3WBXA 3EDFA 5LIWX 4PMZA 4PTXA 1E9LA 1TQJA 4JYDA 4HPJA 2ZE0A 3Q37A 3PZGA 4K68A 4IPIA 4P02B 1W3JA 1E4NA 5ECUA 1DIOA 3FS2A 2ICSA 3WQWA 1UR3M 1R8LA 2IUZA 3W24A 2PRHA 1UC4A 1IIHA 5CEWA 1ZRQA 1UUMA 3TC3A 4DAFA 4ZO6A 1MVYA 3C2OA 1GWJA 5U4NA 1OT1A 3CUXA 4LUIA 3OJGA 1TSIA 4W7UA 4HA1A 1KWKA 1I60A 4N2YA 1OBAA 3C3UA 4CNUA 1XC6A 1UJPA 2EG7A 2UY3A 4IWWA 3WJYA 4MTVA 2XTKA 3DXIA 4RKAA 2Z2AA 2QJJA 1LZOA 5EMUA 1LOLA 3FSTA 2Y89A 4M82A 2OEMA 1U33A 3IS4A 1D3GA 2AAAA 4Q22A 1M53A 1B54A 4ORMA 3PZNA 3LBOA 1FX6A 1U1HA 1UIPA 2QLYA 2Y6ZA 3E38A 3GVQA 2PU1A 4Q8UA 3CIWA 3PWIA 1QPKA 3SR7A 6ALDA 1EBGA 5C9XA 1FP8A 2G3JA 4MWAA 2KZHA 5GNXA 1MNSA 2XZ9A 3LOTA 3CLMA 1TZ9A 3IGXA 4Y8EA 4H9YA 3FKRA 3PF3A 4UFHA 1C8QA 4O4VA 4XAYA 5LXXA 2DZPA 3TXVA 3BLLA 4GFSA 3S47A 1VBHA 4HZ6A 4PUJA 2QULA 3SUWA 4S2CA 3B0PA 4PC8A 1UWQA 3SJNA 4D6EA 5C9UA 2PA6A 3GBDA 4Z17A 3KS6A 3CXOA 5CLTA 5K4XA 2QCLA 4DJEC 4JN7A 4DXKA 2WCAA 4PL1A 3CEPA 1S5MA 4J3WA 1AG1O 1DTNA 2PP0A 4IFRA 4LVAA 3VIOA 3VNIA 4JDBA 2PZ0A 2XM1A 4JHZA 4H00A 4C6QA 2W27A 2XN0A 1P6WA 5AY7A 4YWSA 3QF0A 2E8ZA 4YVPA 4LOCA 4JTAA 1SSGA 1J0HA 4CD6A 1W9DM 1UMLA 4ADSA 1UH3A 2ZZ1A 3FXYA 5G1MA 4V15A 4JTGA 3W74A 3TV8A 4HK7A 3GXDA 3QEZA 4G5DA 3GFYA 2W4XA 4NNAA 1NIUA 1QAPA 4ZMGA 3GXMA 2XIQA 1FWHC 2A21A 3LRMA 4CN4A 3FV9A 2HXTA 2RJGA 2JEPA 3SIZA 1ONRA 3MVIA 3T8LA 4AEOA 2ZA1A 3W7MA 3AI0A 3NM1A 2C16A 3RIKA 3MV11 3T0AA 3RPTA 4NNBA 4AMAA 9CGTA 3QGAC 4M1BA 2VX4A 2PWEA 2GL5A 4HJFA 4H2CA 4UWMA 5T9BG 3A4XA 1W5PA 4MUZA 2GSEA 2PEVA 1WYIA 1QK0A 4BQ2A 4LUTA 1E15A 4JY9A 3W2NA 3PP7A 1A5CA 4PUMA 2VC7A 3Q67A 3AUJA 1DWHM 5FEWA 4L6HA 4Z08A 3A47A 5B7ZA 1T96A 1N8FA 3W6MA 1PEZA 3BJTA 2PDHA 3RLGA 4GG9A 2WZHA 1U1UA 2QNEA 3UG4A 3NFUA 1NDWA 3CT7A 4QE4A 1RJQA 4JXCA 3VIJA 4F0RA 3FHAA 4E4FA 3RX3A 4FLRA 5C9RA 4Q4KA 4TMBA 3UG5A 4W7WA 3M9YA 1KWGA 4OE7A 4EIVA 4NNCA 3W1LA 3NEHA 4R53A 5LYRA 4LS0A 3HQOA 1XGZA 3TZFA 1RAKA 2BV9A 4HZMA 3MMTA 5C9WA 2HTMA 3K4DA 1W8SA 3VKKA 2WJDA 1QI4A 3H2FA 1B3VA 3AFBA 5EKYA 1TR1A 3W26A 1ITQA 3PBUA 1S2TA 5IBXC 5DCBA 4GZJA 3HZ3A 3O63A 4ACYA 2P3EA 5BXPA 3NA8A 3BCDA 1EC7A 2O4QA 1Z44A 3ENLA 5A95A 4W8AA 4LPCA 1RJRA 2WVSA 4HSHA 1VS1A 3W7JA 1SGJA 3MBDA 5CPMA 2FYMA 2QV4A 3PAOA 5DT7A 1Y5VA 1H4PA 3VIGA 4DF2A 2DVTA 5M3WA 4DYEA 2I5GA 1WXYA 3M41A 2ZA3A 2YXXA 3UY7A 3TZNA 5LIYX 3LTPA 1QNQA 1US0A 1O5RA 4FX7A 4JAWA 4NF7A 4PEKA 4Z2KA 1R5YA 3E5PA 3NQ6A 3UZZA 1L6YA 3AS3A 4GVHA 3SSJA 4ZQNA 3WK1A 4LY8A 4HJWA 2VRKA 1OINA 5DCEA 5E6ZA 1H0GA 3C2EA 3QRHA 2WSQA 4C6LA 1Q8AA 1JYVA 1LROA 3M6DA 4UC5A 4B5TA 4IMAA 3WY1A 3W1XA 1NDYA 4CQ9A 2TYSA 3IV3A 1KFJA 1BKSA 2AMGA 4KT2A 5I23A 3OPSA 1Z6KA 2D2HA 3GRIA 3E0IA 3HQPA 2PGEA 3TAKA 3N2BA 4KEZA 1B31A 4A3QA 3MZNA 3L66A 3F2DA 3I3EA 1HNYA 3Q45A 1GTHA 2PTXA 2NUWA 3VNJA 1V08A 3RYSA 3CHEA 1TMHA 3TCEA 3P8IA 4MB4A 2C71A 1B4EA 2E8YA 3VIHA 1PJ9A 4ACZB 3FGCA 4ORIA 3WF2A 3CNYA 3SAZA 4MKVA 1I2QA 4GINA 3KRBA 4IXHA 1EJSC 3DKJA 1X6NA 5HQLA 1ZALA 1EJWC 3W81A 2Y7EA 2R94A 3SJ3A 5FJPA 1V8EA 1FBAA 2V63A 3M7SA 4DWDA 3EWBX 1ZBVA 4JNZA 1JEZA 5A1AA 4AX6A 2EG8A 1VD6A 2J88A 2DDXA 4WZHA 4MDPA 2ALRA 3AISA 3CAQA 2O9RA 2QF7A 3ZFHA 3PG8A 2DORA 4UTUA 4H41A 4I8DA 3E74A 2E5DA 4IJBA 2DSWA 4S23A 4KS0A 3GVVA 5LGZA 3ANUA 3KTCA 4XKYA 5CC5A 4QFUA 3T42A 5AZ0A 3N2OA 1FWTA 2J62A 1TTIA 1S5VA 1UP3A 4PMJA 4KQNA 3AIBA 3SRFA 5H2ZA 3LMYA 4Z42C 4X60A 3S1UA 3I6EA 7CGTA 1Q2RA 3BV4A 3W27A 3WJXA 3SN1A 3T9PA 3MCMA 3BGJA 3KDNA 1BHGA 1EJVC 3VIMA 4CEUC 3T1GA 3UERA 1NOUA 1WBHA 3PK7A 3MYPA 3F2CA 2QW5A 1Z3NA 1KCXA 3WIJA 4HU0A 1AODA 5FIPA 1W3TA 3GXNA 2C79A 2VCBA 3KTXA 1JUBA 4NI8A 3U6WA 4A6GA 3SY8A 4H6EA 1E6SM 2L5HA 1PUDA 1RK5A 3EWYA 4LB4A 4M6QA 1C90A 3AWOA 3CK5A 3MUY1 3C2YA 2VWTA 1KTBA 4JYFA 2Y8VA 4IX0A 1J5SA 3Q65A 1U5JA 3F4WA 4IUGA 3QMSA 1FWBC 1JPHA 4MNKA 4YCOA 2E25A 1OEPA 2D24A 4JL1A 5XIAA 4Q32A 2NWSA 3VTRA 4JX4A 1KA9F 4EPBC 3B8SA 3PB2A 4HNUA 4OHQA 3ABQA 1PHQA 4G8TA 3MP3A 4DUXA 1LTDA 4JTKA 1QOPA 2IKIA 1QNSA 4K8EA 2PDWA 4M5PA 1U83A 4IG2B 5U7SA 2YGYA 3GTNA 3O07A 1HFBA 3VNYA 3W72A 3HJZA 4F48A 3AIWA 3SADA 3ES8A 3GC5A 3DFQA 1H7OA 3UU0A 2XIJA 4M7TA 1F74A 5A6BA 3H2AA 1A5SA 2WSPA 4L6DA 1XLMA 2Z2UA 3W22A 1RV8A 1X1NA 5CSUA 4QX4A 3IGUA 2CLKA 3VGBA 3WUBA 3ALFA 4EE9A 4GIYA 3G0SA 1R85A 5BOFA 2CLPA 5C7VA 2WCGA 1ZPTA 2RFGA 3V0UA 2ZOXA 4JTHA 2VC5A 3W85A 4UQ9A 4QEEA 4L9XA 4DWSA 4GMEA 3QKEA 3VD7A 1NF7A 1Q6GA 4UCGA 2REQA 2DW6A 4DBUA 2WZIA 3TN5A 1J79A 4KESA 4YYFA 4BI7A 4GFIA 4GVFA 2IQTA 2D2JA 1FWEC 2WCSA 3DAQA 1XD1A 4LUSB 4DUOA 4NSBA 3OIXA 4AG0A 3A4AA 3KZPA 2IXVA 3W29A 4B92A 1OWQA 2E4TA 2W6RA 1X96A 2XFWA 1KM1A 2PF8A 3BG9A 4NUWA 4AEFA 2OX1A 2PGWA 3IK2A 4O17A 4PRWA 4W8BA 1WDDA 3IJLA 2B31A 1OX4A 2RGMA 3RM9A 2J47A 1KTNA 3VIKA 1NVMA 1QTWA 2DZVA 2XGZA 1PPIA 4I7UA 1XF0A 3BLOA 2ZC8A 4IGMA 4JHOA 3G3MA 3T2QA 1KCKA 2VR5A 2GVEA 2HROA 2DSKA 3GB6A 1KFCA 3PSWA 3NIYA 2E7FA 4JTIA 5C2GA 5LZLA 1DPMA 4TXEA 4JTSA 1XD0A 4D72A 4Y96A 3ABRA 3OBEA 2QF8A 4PCFA 4UQDA 2Z00A 2EPLX 1CZ1A 4UOZA 1M65A 1PS9A 1GQNA 4Z1DA 1R3YA 3W70A 2ZTJA 3VC5A 4S3CA 1J0YA 3BQ6A 4L1XA 1SUXA 4DPQA 3OZMA 1SFSA 3UPWA 4UTJA 1JI1A 2OZ3A 1MDLA 3DCPA 3AXIA 3UJEA 1J10A 4DUWA 1V02A 1NDZA 3ABZA 4CQ8A 3NYDA 4MHBA 1YTDA 3S1XA 3G1RA 3MWAA 1WKDA 4Z1AA 3FAXA 3T0BA 4GO8A 1QMLA 2NSXA 1NF0A 1DHKA 2DSUA 2ABAA 3QBUA 2Y7DA 4DO4A 1A3WA 2EAWA 4QBXA 1OC7A 4U33A 4B5UA 3DHPA 1FQ0A 2WNZA 1A5LC 4O57A 1QO5A 1NH6A 3NUKA 5HQMA 4JTUA 4ML4A 2YXOA 1ODUA 1VYPX 4H1ZA 4M19A 3BAIA 4L1WA 1Y8BA 4AC7C 4QAIA 1I1XA 4HZ8A 4ECLA 1KBBA 5F2GA 1EJUC 3S3GA 2A3EA 3ABXA 3CASA 3NURA 3UWZA 1XLJA 1FWCC 1PE1A 3G1DA 2EEXA 3UR5A 4US5A 1V77A 1FUYA 4GIAA 3QMTA 4I8YA 2ACSA 4IIEA 4L6OA 3N4FA 1R46A 1ZFJA 3CV1A 2VKZG 4IIGA 3DENA 1EF2A 2YYUA 2EHHA 1XV8A 4N4QA 2HBVA 1JGMA 2YLAA 3FW6A 3QMRA 3UJ2A 2CU0A 2YA2A 3UXKA 4GLEA 3PZTA 3STPA 4HTBA 5BWAA 1G01A 1UD6A 3W7CA 2C19A 5A6TC 1KGWA 3ITXA 2ISFA 4F2UA 2ZKMX 3QC3A 3H8AA 1JZ8A 3QV9A 3TSBA 1UZ1A 1UPPA 2QCFA 4DJFD 5F1UA 3M64A 4YHEA 4YS1A 3ZVHA 1XLHA 2GJLA 4HG6B 4H6QA 2NW0A 3PTKA 2VOTA 4LC8A 3AZSA 3UWQA 1Q8JA 1TCDA 3QW4B 4KETA 3IUHA 4WX2A 2OGJA 4PUKA 2QR6A 4PH6A 2JF7A 4O0KA 5CSYA 5LNVA 1WP6A 2ABBA 3T4CA 3CYJA 3WQPA 1QASA 3W37A 2XH4A 2NUXA 1R2TA 3H23A 3UGRA 4Y9AA 2PDBA 2P50A 1Q7QA 4DM1A 2WHJA 2FQIA 1B3XA 2KX9A 3W2JA 1EJTC 3GBEA 4XD5A 4A29A 3URNA 2FMOA 2VDGA 3W2UA 1H49A 4XO7A 3CTLA 2E09A 1SVDA 5LIXX 3VOGA 3AICA 4XWUA 5FACA 3W7IA 3UXDA 4KERA 2F6KA 2GVGA 1F76A 1GUVA 2HVMA 3H6OA 5F1VA 4CNNA 5C8BB 3BAKA 3VUPA 4B9ZA 1HL8A 4OJYA 1BFNA 2NV9A 4Q7NA 3GNRA 3DEQA 2PTWA 1FRBA 3WBAA 4B2DD 4YNGA 1JI2A 2A2IA 5M03A 1ISYA 1DWJM 1IR2A 1KM0A 3AHTA 1M68A 3B0XA 2NX9A 2WJZA 4H9UA 3WZ0E 4WLCA 1MDRA 1SZFA 3UETA 4I9JA 4MY1A 2Q01A 1CCWB 3TXZA 3WBYA 3IV8A 4KBXA 1K4HA 1M3UA 4WJEA 2G50A 2YL9A 4JBRA 3QR1A 2ZX6A 4NAEB 3MUIA 4J3VA 4QDWA 1L8PA 5CQ1A 4RCXA 4LYRA 2FZDA 3TOPA 3TJIA 4U31A 5DF0A 3N15A 3K2GA 3NJ3A 1E55A 2RDXA 3BPWA 4TQTA 3C0SA 3VNZA 4ONVA 2VO5A 4B91A 5FEPA 3DYOA 3L4ZA 2D0FA 2V2HA 2YDRA 4YTRA 1MFVA 4JL2A 2X09A 1BQGA 3H4WA 2IQDA 2ZVRA 3RRXA 2WMIB 4CKQA 2BY3A 2QS8A 1B30A 4C6BA 2ZQ0A 1H3GA 2YL8A 2YW4A 3ID7A 4RE3A 5FI8A 4P7LA 1OX5A 3PUOA 4H9TA 2NVAA 1XWYA 4X9SA 4Q7BA 3RRAA 2E40A 2JIEA 2G4JA 1SFLA 4P8XA 2XH7A 3LCXA 4PTWA 4FSAA 2W79A 2INZA 5BOOA 2D0HA 2XVKA 5D09A 2HSAA 4QROA 3RO8A 4ZSUA 1I2OA 4C6FA 3GAKA 4GABA 2H8XA 3IANA 3THUA 1BVWA 1W9PA 3W6LA 2BVTA 2OEJA 4HCDA 3TW9A 4YTTA 3SQMA 4FOJA 1TJ0A 2GWNA 2HPIA 1WO2A 3UCQA 3C2FA 4KFPA 3BUVA 2CXGA 2VVSA 2QZRA 3CQIA 4P2VA 4HCHA 5HR7A 3S5YA 1KFWA 2GUYA 5FJRA 5LA0A 1TPH1 3P3BA 1PTGA 2VWSA 1M01A 1RR2A 1Z9AA 3USBA 1XCFA 2VGFA 1H51A 3WLOA 4ICNA 2QJHA 1AL8A 4MGGA 4S1FA 4JX6A 4JN8A 4HBKA 1AH4A 1Q45A 1OYCA 1LORA 1JF6A 1DIDA 4FNRA 1OD8A 2FVLA 3STGA 1TJRA 1A0EA 3TOYA 3QOKA 1QDSA 4HMCA 1QI3A 3RDKA 2V3DA 2OQLA 5KITA 4UNLA 4AIUA 3ZLHA 4U3CA 1HL2A 3CQ0A 3E0WA 4JICA 1UBSA 1AZ1A 3K4WA 2TRSA 1NQ6A 5EMKA 3B9AA 1VR6A 3CYVA 3ZM8A 1QUMA 2D2GA 3BMWA 1FXPA 1J0KA 3H2CA 2YZRA 2FHCA 4R34A 4FNUA 5HXMA 2R1PA 5BRPA 8RUCA 5C54A 2WHMA 4IIBA 4I6VA 1RHCA 3EX6A 5AC5A 3QV7A 5JBEA 1T8XA 3BCFA 4PMVA 3FJLA 1WE5A 3N9KA 1G69A 4DJDA 4HP5A 1EC8A 5HWNA 3LXCA 1VJSA 3M0IA 3WFZA 4AHQA 3AQUA 1R87A 1JRBA 1EBHA 5I7GA 1WDQA 3W0KA 4UOQA 4RNIA 1OB0A 4IIFA 1IEIA 1KM3A 4ZFMA 7PTDA 1CGTA 4LUTB 3BAWA 2DUAA 2FPTA 2GJXA 5J04A 2X1SA 3OGVA 1TV2A 2YBVA 3FOKA 3LG3A 1E0WA 1B90A 3GQYA 4JFWA 3W73A 1K7FA 4O16A 4OUIA 1EC9A 3I6TA 2VR4A 2YZ5A 3TVAA 1FDJA 5AVNA 2G97A 2B7OA 2QGYA 2GGJA 2V3EA 1E4MM 4FHAA 3N4EA 5AC7A 3GFZA 4GACA 2PWFA 4EAMA 4ADTA 1ALDA 3R25A 1YTEA 1SU5A 3ES7A 4NASA 4JFSA 3EB4A 3RCYA 3L0KA 2XVLA 3MANA 3WQDA 4FEZA 1UR8A 2PDYA 3M16A 4PMYA 1UWSA 1JYWA 1A5KC 1QHZA 5FF4A 5JQ9A 3L7RA 4TX6A 3E0VA 5BW6A 2I57A 4XKMA 3GTFA 1FWDC 3L4WA 5I24A 2FZNA 1S1PA 3MCNA 3QZ6A 3QTPA 2XFFA 2D0GA 5DRIA 2C3ZA 1B9BA 4KCUA 1LRQA 4HCLA 1FDZA 3G18A 2DUZA 4QJ3B 4PRTA 3AXMA 2VGBA 1ZJIA 5I02A 8XIAA 3ARWA 3NPVA 3ONCA 1GOOA 5ABFA 1IT8A 2EPKX 2R82A 3V5FA 1XLIA 4JQ4A 3II1A 5AFDA 1QNOA 1AFSA 3GUWA 3MT1A 1MFUA 1EEXA 5C5YA 3TDFA 3URBA 1YDVA 4J2PA 3N9SA 2ATMA 1PV8A 4OOZA 5A3HA 3MHFA 1X8FA 4PBGA 3OYXA 1CXFA 1THFD 1XG4A 5PTDA 4H19A 3TYUA 2WKJA 1TFVA 4XZIA 1P48A 1F3XA 1B0IA 4K37A 4JTDA 1KFLA 3HTWA 3S5OA 1V3HA 2Y5SA 3AS0A 2Q8XA 3MUAA 3EEGA 3QW3A 1AH3A 3IIPA 2GVYA 5MF5A 3NPUA 3HURA 3GKAA 2OWCA 1UP0A 3K13A 1W54A 4GXMA 3H12A 3HQNA 1RP8A 4O1FA 2FFIA 4DJEA 3CU2A 4UZSA 3V36A 2TPSA 2GVJA 4LBSA 2HDJA 2GUBA 2YDSA 3W87A 3DC0A 2Q8LA 1OFDA 3ME3A 1O5KA 2ZDSA 4RV3A 1EIBA 2NQ9A 1CECA 3TUUA 1X7FA 4D1IA 2F6XA 2OKOA 3AIUA 4UIOA 5C71A 4HK5A 3TWBA 2D1ZA 3FGCB 2NT0A 4JEJA 1FWIC 3SCWA 2VEKA 3ORWA 3WBWA 1NJJA 1UR0A 3DUGA 3MP4A 3B0UX 3EKGA 4GHRA 5H91A 3IJ8A 1IQ8A 2GZXA 5A6SA 4AY1A 3N1AA 3M0HA 4ROPA 2VC9A 2A3LA 3WMCA 2P8CA 4A2RA 1XSJA 4ZO7A 3GXFA 4UXDA 3LERA 4AD1A 2VP8A 4XSMA 3AMKA 4RZ6A 3WF1A 1K9DA 1SYTA 1XQKA 1X1OA 4L4MA 4QAWA 3THCA 4A3YA 1NP2A 2G37A 1PX3A 2J7BA 1W37A 1HL9A 1EFZA 1UKSA 1I75A 2I56A 3O9NA 4HB7A 2OYLA 3C0LA 3RMEA 3O6YX 2PSNA 3NQGA 1CEOA 1RBAA 3D6NA 1VFFA 2PBGA 3G24A 1OCBA 3NGJA 4LYKA 4LXFA 3A24A 3IRDA 5CSRA 4BKNA 2OX4A 5FEXA 4Y9OA 1UZDA 3JU2A 2PDCA 1O66A 1NARA 1CW2A 3JW7A 4S3JA 3CMJA 1MQPA 3WEZA 2OG9A 1BQCA 3I3DA 4F0KA 2YDQA 1FCBA 1CLXA 3MKCA 4XD3A 1MQQA 1Q3NA 5FJIA 1JNDA 1FWGC 5EFFA 1XYLA 3E3HA 4KEMA 4ZB5A 1A5MC 3NDZA 1A80A 4U5KA 1LT8A 2IPJA 4DEFA 4MNMA 3VKAA 1JIBA 2DZAA 1UUQA 3RPMA 3THDA 7TAAA 1G67A 5AYIA 1ICPA 5D32A 1BD0A 3NL6A 4Q8TA 2OSXA 3EDJA 1BPLB 4Q8OA 4S3EA 1VC4A 4O12A 1ZCOA 4PRRA 4HNCA 4EXBA 2VFFA 3BMXA 3EZ4A 3E02A 1QPQA 3C86A 3GX9A 1ADOA 2FB2A 2FLIA 4JQAA 3S9YA 1X39A 3RN6A 4PMXA 2WVVA 5DT5A 2VJXA 2PDUA 5IBXA 5CBBA 3BURA 4JFUA 4RXGA 2J6XA 4TO8A 1X8CA 2RDTA 4GUGA 5I03A 1OX6A 1WV2A 3VDAA 1R86A 2C7FA 4P7OA 1RVKA 4MDOA 3TR2A 4WGXA 2AQOA 3S5SA 4QM1A 1KM6A 2O0TA 4W5UA 2Z1VA 2BFGA 3ARXA 3OVGA 3ONBA 1LL7A 3ARPA 3FEMA 1FH8A 3IACA 4DUVA 3PN8A 4MVAA 5HATA 3NGFA 4D8AA 1YX1A 1D9EA 4B5SA 1RD5A 2ZWZA 1J8VA 1X97A 3T0DA 2VOMA 4AXKA 3EWCA 1F7BA 3BC9A 3VGHA 3H2MA 2OJPA 3WDRA 2VGIA 2F38A 1RCOB 4HMEA 4MG4A 4S3BA 5TQLA 3VFLA 3NZQA 3KBVA 3P93A 3WJSA 3FJNA 3D0CA 3DFYA 1WDRA 4RNJA 1JUEA 2PCQA 3ABSA 3U0HA 3APTA 1YNQA 3A9IA 4WDTA 1OX4B 1YXCA 1V4YA 4CNTA 4WQ6A 5D2YA 1OHLA 3PY2A 3LCGA 3CH0A 2W5FA 4L7ZA 3RU6A 1BYCA 1Y0EA 4QLLA 1JNEA 3W2LA 3UT0A 4JQ2A 1XYAA 3IIXA 1I0DA 3FA5A 1A47A 3F4NA 5F4SA 2ZZ3A 1NFPA 2BGSA 1UH4A 4W84A 1I9CB 3EEZA 3JR2A 4X63A 5JIPA 2VDIA 3MB9A 2XSXA 2JKAA 1WPCA 1F8IA 5DELA 3WD2A 1ELSA 2OELA 4ZZ9A 1EP3A 2UZ9A 2PWDA 3VNKA 4RXFA 2QT3A 3POHA 2X05A 1P0EA 2BTMA 3BAXA 2PE4A 1A53A 4W7VA 3T05A 2PP1A 3KVLA 3MHUA 5IM51 1VFOA 4P7NA 2BXYA 2RUSA 4HVXA 2V67A 4S3GA 2HZGA 1V3MA 3QXBA 1TA3B 2OSYA 5FD0A 1OFRA 1XBVA 1K3UA 1DJHA 1P0NA 3SCNA 4RLIA 5HPCA 1QO2A 1PX4A 4QJ4B 2R1MA 5MKGA 5D03A 5K9XA 3KOFA 4LBUA 3L2MA 1SFTA 3MS8A 1DQUA 2V68A 5AVHA 1PIGA 3MSRA 1GVIA 4ZE5A 4DO5A 3LD5A 5FJTA 3TN3A 5DLCA 5CLWA 1B3ZA 1S5NA 3GNXA 2NX3A 4JTRA 1BG9A 4US6A 4GZIA 1BYAA 3L4VA 1KRCC 4KWOA 1EOKA 1VZWA 1EHAA 5E0KA 3ERPA 3W38A 5KZMA 4IFKB 4WJ8A 4GUHA 4CQAA 2VURA 4D8LA 3B40A 4YWIA 2WK2A 1G9HA 2HCVA 1DJIA 2C0AA 4NX5A 2W92A 1MW2A 3ARVA 1H09A 3C2RA 1I2RA 1IEXA 3C4UA 4HOZA 3GXPA 4LAOA 2J7HA 2PMQA 5D8ZA 1H50A 5LXEA 5AC8A 2VCCA 1J4EA 3GM8A 3HJEA 4ICMA 4NJIA 3GUGA 4ZOCA 2AL2A 4W85A 3ZJ8A 4WUIA 3H2NA 4Q8QA 3LHVA 2XGBA 1FTXA 3HG5A 4MFEA 1POJA 4XX6A 5A2AA 4AD3A 2J7EA 1OCQA 1B5TA 1PDYA 4WDXA 1S2CA 3EWZA 1UHVA 4AHOA 5LSMA 1FWNA 3PNZA 3DU0A 4JQ3A 3SCOA 1KQYA 1VFTA 3UR7A 3T4WA 3CJPA 4C1NB 4E2OA 1V3JA 1B1YA 2MANA 2VFDA 3AXKA 4LJ3A 1KGUA 1OGGA 5C9ZA 3WLKX 4HU8A 2AGTA 4YLWA 1E3ZA 2PC8A 1EPVA 4X61A 2CBIA 2NQ5A 5KZEA 1FFRA 2CW6A 1S1RA 3NVDA 4J3SA 2GJPA 4NT0A 3ZVHB 3KLLA 1DKWA 3ZQ9A 4DYKA 4NJHA 1T8QA 2OXNA 2F84A 2HPMA 3FFSA 3HGJA 5CPSA 4EWND 3G0XA 2I5IA 2YB4A 3B0YA 2E6YA 4P7QA 4GIRA 4K6AA 1GOQA 4GH1A 3QY7A 5DMYA 1MRAA 2QDDA 2ZXQA 4XUYA 3V0TA 4C6CA 4L4LA 2WC4A 2J25A 1E51A 3TNBA 1J9YA 6XIAA 4TTGA 3PBMA 4TVCA 1XXXA 4EPDC 3LX9A 3MI6A 1W1VA 1Y7VA 3PZMA 2AQVA 1D2KA 3BH4A 4W5ZA 3NPWA 3L21A 4N6FA 2XIOA 1QFEA 1H61A 2AMXA 3ALGA 3I3BA 1UP2A 1E73M 4D2JA 2A7RA 4L64A 4O1AA 1MMFA 4OU1A 2OYMA 1NWSA 4HPXA 3PBGA 2W3ZA 5A8QA 3P74A 3VKDA 3HM7A 4BFAA 5CPLA 4KEVA 2HWGA 4L4OA 2NVDA 2QCNA 4ZE4A 2CCRA 2TODA 1N55A 3GH4A 4E3VA 1PL9A 3SCSA 3EKZA 3OZPA 3CO4A 4QP0A 1JXKA 4D6IA 3WH9A 3N17A 4E6MA 5DBUA 4ZB0A 1NFGA 1RA5A 3PJXA 3WD0A 1SFJA 5BNKA 1GQLA 2GDUA 2VENA 4HHLA 3W7QA 2PRMA 2WSRA 1W3KA 3EKLA 1EIXA 3EX2A 2XFRA 4LNCA 1JJKA 1Z8AA 4JIRA 5HINA 3ITTA 3TX9A 4RZ5A 2PLKA 2PLJA 1ME9A 3ZMRA 2J13A 1V7YA 1ZSXA 2PUZA 5JUVA 3EB3A 2VDHA 1W56A 1CBGA 3AHXA 3TK7A 1ZAIA 3EWDA 3JUGA 2DEPA 5CH9A 1VFLA 3DECA 4WXYA 1E0XA 2ALDA 3UZYA 3L4TA 1LRNA 3CUIA 4RDWA 4LSBA 3Q58A 3BJSA 2J7GA 3VDGA 3GDLA 4G7FA 1F8MA 3LI0A 1XH1A 3NO5A 2QJIA 2OR2A 1UR9A 5T9CE 3EA2A 3LLXA 2ACRA 1S2VA 1DJWA 2P0IA 1VHCA 1QNRA 1NQKA 1W9XA 3H53A 3IVTA 4Q4OA 4DM2A 4AF0B 1XUZA 3GFXA 2PF0A 4GUJA 1N82A 1OC6A 1JZ4A 1BVNP 4N0RA 3SB0A 4C1LA 4NZ3A 4OOUA 2UBPC 4F2TA 4AIBA 2UV8G 3PZVA 3GNDA 3L4XA 3PTQA 3F4CA 4AFYA 2CXEA 4GJ1A 1Q63A 4H7VA 3S9IA 4XSLA 2FPYA 5CBJA 3B03A 3LLFA 3WUEA 3QLLA 1EP1A 3ATZA 4LT9A 2XYLA 4I90A 2PDJA 3HPXA 3ITVA 1YLVA 2PD9A 1A0CA 3PZIA 4B16A 1FXQA 5FCZA 1W5QA 3NAVA 4E2BA 1J01A 1W9BM 4GISA 3DGBA 4BI6A 4Q4MA 3BK0A 1TJ2A 4YTSA 5C55A 1AVAA 1ZJBA 3LHYA 1UC5A 1UZ4A 2CBJA 4LW7A 3LSCA 2WMFA 3CT2A 2IMRA 1WDWA 2HQAA 3W01A 7REQA 6XIMA 4HT3A 4QNEA 2FGZA 3TIMA 2ISVA 1TG7A 1EDTA 4C6DA 4URIA 4HMNA 3CUJA 2BASA 4QJ5B 1UJQA 3EWWA 3LYEA 3R0KA 3A4WA 4KRZA 3V1PA 1XDJA 3W7LA 1M7XA 1V93A 3VO0A 4EPKA 2WYSA 6REQB 1XISA 4C6JA 4JIHA 4MWAD 1A5OC 4GYPC 2FJUB 2GWGA 3GU2A 4H4IA 1KCZA 1OCJA 2QDEA 4DVOA 3P82A 1GVRA 4HSNA 5JH1A 2R8WA 2Q3OA 2VC6A 1SQ7A 4V1YA 4XAFA 1LLOA 1JR1A 5DCDA 4JTCA 1LG2A 4IHCA 2PP3A 3CO8A 1W9VA 3DERA 3ARZA 1V03A 1CXIA 4YVXA 3EMCA 1W1ZA 4A05A 4P61A 5TD4A 4RZ4A 3WN6A 3TTQA 3PC0A 1XS2A 4WEVX 3VX0A 2DZTA 4PL2A 4RUBA 4UTTC 8XIMA 4JS3A 1HKVA 2DIKA 4FOUA 2CPUA 3A9BA 3W25A 2GSJA 3M47A 3K1GA 5JMUA 1KKRA 1H5YA 3VCNA 2HRWA 5G1YA 1KLYA 5C6MA 4NRRA 4PUUA 1JGIA 1K8YA 4C90A 5BXSA 3OLEA 1EO7A 4N9CA 3H24A 5FESA 4PGLA 3NQCA 1P6BA 3P8JA 4GQ0A 3B05A 3PG9A 6A3HA 1SSDA 1K6WA 1XLKA 4Y8FA 3CAVA 3GIQA 5RUBA 5EMLA 5EJ1B 4JCLA 3R8HA 1RXOB 4IMFA 1GEQA 3WJWA 1IZJA 2Z1SA 5GNZA 5K2ZA 4FNQA 2GQ9A 1UOZA 1QPOA 1XFBA 4G9PA 1W2PA 3ZR6A 3SW6A 4H8UA 4XO6A 3N13A 3PZOA 1VBRA 1CTNA 1DIKA 4AISA 4BEQA 1YMYA 2DH3A 3VDBA 3LGGA 4QG9A 4CNPA 2XH2A 3L5MA 4XZ9A 3QHOA 3MQTA 2OMAA 4A3UA 2FTYA 3T2OA 1TR9A 3W82A 5LA2A 4OFCA 3BZJA 1VCFA 4A4AA 4GYKA 3TWAA 5GJMA 3VAVA 4EOUA 1P6CA 3NQAA 4RE0A 4JPGA 3WK0A 3IJIA 4NYYA 4NJGA 4V33A 3WNOA 1WKYA 3UXAA 2ZUNA 3ZJ6A 3WQFA 4CCCA 3PUEA 4EF8A 1YBQA 1Z89A 1F73A 3VIPA 3INPA 1XUUA 2X7WA 5H6HA 2VT0A 1AW5A 3GWQA 1OABA 1U5HA 1EGMA 2NXIA 2YL5A 4QCFA 2W67A 4HMDA 2F61A 3G1YA 1S2UA 2Y63A 3VI2A 4PTNA 4ERAA 2VTFA 3R0UA 1QXLA 2R24A 3QLDA 4IJRA 1RBLA 5A2BA 4GK8A 1E70M 4IUOA 2GGEA 5K9DA 3T2PA 3EAUA 1QPRA 4PUWA 3LB0A 1B3OA 1E1CB 4Y90A 3HG3A 3EMZA 3T40A 3N6JA 3QC0A 3IIZA 1VBGA 4ASTA 3S1WA 1EYEA 3MKVA 4O1EA 1TE6A 4J3XA 4LAKA 3KLKA 2CLEA 3O16A 1JL8A 2P10A 1KQZA 3OTRA 5DMMA 2VZTA 3NEVA 2BXZA 3TQKA 1WKFA 5CC3A 1UKQA 4J7RA 3GC4A 1TQXA 3NQ2A 2HVOA 4FLSA 1OFQA 1T6MA 1EPXA 2ADAA 4GC4A 1B57A 3T7VA 4ZTXA 3UWWA