1L8NA

The 1.5a crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1, complexed with 4-o-methyl-glucuronic acid and xylotriose
Total Genus 278
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
278
sequence length
675
structure length
671
Chain Sequence
b'GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRWWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-D-GLUCURONIDASE
publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 278
structure length 671
sequence length 675
ec nomenclature ec 3.2.1.139: Alpha-glucuronidase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1l8nA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1l8nA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1l8nA03
5ABGA 2CYGA 4R27A 1J18A 3ARVA 2ZWZA 3KL3A 5A2CA 1I1WA 1GVIA 3N9KA 3OZOA 5LA0A 4YN5A 4Z2JA 5GNYA 2E9MA 3W26A 1NH6A 1UG6A 4B3KA 1GORA 1UH3A 1VIWA 4UFIA 3WBEA 1M03A 1W1VA 2BVTA 1OWQA 3ZJ7A 2O9OA 2Z1SA 3WNLA 1VBRA 3RCNA 1B30A 2OSYA 4GINA 1HN1A 3EDJA 1EOKA 1HVXA 1ISWA 3AICA 3NDYA 3BCDA 3UEQA 1V03A 4PMRA 1G5AA 4TOQA 1UR8A 5M5DA 3SCPA 3VX1A 5GNZA 1QNPA 3ARXA 3OG2A 4PCSA 1V3KA 4AYSA 1UKOA 3RO8A 1QNOA 2VZOA 1TVNA 3MMUA 1X1NA 3MV01 5IHSA 3A6OA 3O2LA 1ISXA 1JDDA 4AISA 2VVNA 1C8XA 5BROA 4CU7A 4IPNB 5I79A 4WKFA 3BSGA 2YL8A 3MU7A 4N0RA 3SCOA 4OJYA 2D2OA 2WVUA 4NZCA 2YL6A 1BYDA 4LPCA 5A3HA 5JBEA 1XYZA 4C7GA 4DUWA 4CN1A 3ARRA 3MUIA 4URIA 2WNWA 3UG5A 4UQEA 4YPJA 4MADA 1MFVA 1E0VA 4DUXA 1XCXA 3K46A 5DFAA 5IHRA 3OGRA 3SCSA 3IJ8A 4J3XA 4TX6A 4P7LA 1CYGA 5A6JA 2OSWA 4GQRA 3B9EA 1VEPA 2Q8XA 1DWGM 2EO7A 2VQUA 5FOOA 3GXMA 3ZJKA 3VUPA 5A6KA 1JXJA 1X6NA 4AWEA 3DC0A 4UOJA 4C7DA 2J47A 2J4GA 4W89A 3WQ6A 2GVYA 1W2VA 1PZ2A 3DHPA 2J7BA 4EK7A 2J79A 1V3MA 3MSDA 4WF7A 3T2QA 1QI5A 4D72A 2CBVA 3NUKA 5TD4A 1V6XA 3QGVA 3OLEA 4Y7EA 4FLSA 4AD2A 4B15A 3AMCA 3WMSA 2ZX9A 4CKQA 2ZWYA 1XHGA 4UZUA 3TTYA 3VKKA 1E0WA 3GZAA 4AMCA 2BY3A 4PMZA 3L4TA 4PTVA 1FH7A 1W9UA 4AIUA 5CG0A 1MFUA 2Y5EA 4DUVA 3W24A 4JCMA 5A94A 1VEOA 2D3LA 4B9YA 2WCSA 1UWUA 3F4VA 3SCQA 3IAQA 3AYSA 3BSHA 2A3AA 1BYBA 5D9MA 1OGBA 1QBAA 7CGTA 3WELA 3WF4A 3CIVA 3WH5A 3EDFA 2Y8KA 4KWUA 4UTFA 1NQ6A 1BGAA 1CXIA 4JZ5A 2J7EA 1HP4A 5CZKA 3U5UA 1FP8A 3GNRA 4CD7A 1EHNA 4UOZA 3WUEA 3VU2A 2WSKA 2ZUTA 3W28A 2QPSA 3PZVA 2UY4A 4GZJA 5A8OA 3B8SA 4UOQA 3MANA 4FK9A 1EA9C 2VX5A 4U5IA 2GFTA 5I3DA 1UKQA 1VFFA 1FH9A 2XJ7A 2DSKA 1VBUA 2CKRA 3WDRA 3CO4A 3VIJA 5AY7A 3CUJA 2YA1A 1IZKA 1WDQA 1GOMA 3VIOA 2VRJA 4TTGA 3VDAA 3T0BA 3L4UA 4Z2KA 4XB3A 1IV8A 2VX4A 1H0IA 3BAWA 2D0HA 4L4OA 5EFFA 3W6MA 1HT6A 1RD6A 1KXVA 4YHEA 5CGMA 1UD5A 1ZJBA 1OBAA 1BAGA 1W1TA 1ISVA 1OCQA 3VX0A 4UFLA 1K9EA 3EMQA 4UQBA 2B31A 1JD9A 4CD5A 1B3YA 1CGTA 3NIYA 2WMGA 3A3HA 3NDZA 1J0YA 1QNQA 1DWJM 1AQMA 1W3JA 2ZXDA 3EDEA 4PMDA 4LXFA 5C71A 1W9XA 2XTKA 2GK1B 2BY1A 2WM0A 2WZHA 4BZYA 1C8QA 4EANA 3M46A 4W8LA 3PZIA 3PTQA 2ZE0A 1RPKA 1OD8A 4MB1A 4E8DA 4AY1A 1HL9A 1WAWA 4AC1X 3E1F1 1UWTA 1BF2A 4FLRA 2VRKA 3N1AA 3BAXA 2JF6A 2WVTA 4EE9A 4UZSA 4RL3A 5CPTA 5A8MA 2EQDA 2VT0A 3WDJA 1KCKA 2YDSA 1PPIA 3AXIA 2A3HA 1V6YA 3EMZA 2RGLA 4KRTA 6TAAA 4HA3A 2X0YA 2VCAA 3LPPA 3W82A 2E8YA 4GO8A 3VTRA 4QCEA 2VURA 4P7OA 2G3MA 3AXXA 3SIMA 4RE2A 2W63A 2W4XA 4ATWA 3VILA 2G4FA 1CGXA 2UWFA 1K9TA 4ACZA 4R5EA 3EDKA 2VL4A 3VIFA 4PMVA 1HJUA 1M53A 5C70A 4FMVA 1GJWA 2XFFA 3WL1A 4DWSA 5FL1A 2FGZA 3N13A 1UYQA 4PCTA 1J0JA 1KXHA 3RJYA 4M24A 1JZ2A 1CXKA 2PWEA 3VGFA 3WD2A 1NP2A 2VRQA 2QLYA 3FW6A 3BH4A 2VZUA 3SCUA 3WNKA 3VDCA 2FDMA 1ZJAA 4UFMA 1ZBVA 1ISZA 4WJXA 1XCWA 2YIHA 4XX6A 2WMFA 4KRUA 1GQIA 4P8XA 1OGSA 4PTWA 1M04A 1QBBA 2X8RA 2ZUVA 3VD3A 4JKLA 3I3EA 3ZT7A 3MS8A 4MPKA 3N18A 4HPHA 1VFMA 5CSUA 4Z2GA 4JIEA 4J28A 2Z1KA 5GNXA 1VJZA 4ZXLA 5I2UA 3THDA 4D1IA 1DEDA 1XC6A 4KH2A 4E4PA 3AIWA 5CLWA 2PBOA 1PIFA 2WVSA 4M29A 2CEQA 2F2HA 4PMYA 1GQKA 4JFUA 3ZO9A 2CESA 2WYSA 2XVKA 4AD0A 4F9DA 1QI4A 2YBUA 5D9OA 5IXEA 1HJSA 8A3HA 3WENA 2VR4A 2DSWA 2DT2A 4WSJA 1BYAA 1CNVA 4KGJA 2WHMA 3CH9A 2DIJA 4BA0A 1PZ3A 1EDTA 2G3IA 1E55A 1NWRA 1C7TA 3MMDA 5FD0A 1B90A 4D6CA 2CKSA 2XSAA 1ZB5A 1QI0A 4LYQA 1P6WA 1EDQA 2Y24A 1QI2A 3WQ8A 5A8NA 2XSBA 3G6MA 3AHZA 2ZUMA 2C8NA 2VZTA 2J77A 1CXFA 2XWDA 4JFWA 5ABHA 2ZX6A 3THCA 1EO5A 3T2PA 4BS0A 5A8QA 1BGGA 1EQCA 2F61A 4PYSA 3F5LA 1OIFA 3SCNA 4E8CA 4WKHA 4H8VA 3M07A 4HOZA 4QLJA 3VM7A 1XRVA 3BXWA 3ZSSA 4J3TA 3AIQA 3VIPA 4H8UA 4TVUA 3VOCA 4AZIA 3POCA 2WC3A 3UR7A 5AC5A 3FHAA 1U2YA 3VIIA 1J0HA 1VEMA 4B16A 4E2OA 1SMAA 3UERA 1MXGA 2QPUA 2W91A 3SUSA 3J7HA 1MW0A 4M80A 3UCQA 2PWHA 4W86A 3VVGA 3PZTA 3VIKA 5D8WA 1JFHA 1V0KA 3WD4A 2WVVA 2NSXA 1E6XM 2G41A 5FL0A 4OOZA 2VZVA 2JEQA 1E1FA 1XH0A 2YDRA 3WEMA 1KR1A 1W32A 2XGBA 1XSJA 1XSIA 3WNNA 4OZOA 3LMYA 4Q22A 1YQ2A 5AC4A 4D6HA 4XUYA 1V0LA 1UR9A 1KXTA 3GBEA 1ZS2A 2EXOA 4MNKA 7A3HA 4ML4A 4KGLA 5LA1A 1WDPA 1E15A 3WIJA 3LPOA 1SMDA 3OLIA 3GNOA 4MB4A 3UETA 4F79A 1U30A 4OOUA 3KE0A 3TP4A 3N04A 3SURA 3SUUA 3QOKA 1E6PA 3WH8A 5A6BD 2VCCA 1EOMA 1EIBA 3WSUA 2FH8A 3CHCA 3IJ9A 1R7OA 2BXYA 3PZMA 1CZ1A 2VNCA 1HKKA 6A3HA 3WF1A 1EO7A 1CLXA 1J0ZA 1HF6A 4L4PA 1C8YA 2E3ZA 4PRWA 4J3SA 3SEPA 1GOOA 1EQPA 1E5NA 3ZM8A 3WF0A 1CGVA 4WIWA 2BS9A 4U31A 3FAXA 3ZOAA 1JI2A 1UQYA 5A1AA 3IANA 4MDOA 3ARSA 5M17A 4CVUA 3PZ9A 4MTVA 3WD1A 1Q4NX 3U5YA 1ISYA 1KCLA 1E71M 3VNZA 1NOUA 3CZEA 3AHTA 3RPMA 4BQ4A 2WZIA 1VFOA 1PBGA 3WDIA 3KL0A 3L4XA 3TOPA 4W5UA 8CGTA 4QLLA 1AMYA 1XH2A 2MANA 4WK9A 3K4DA 2W62A 4W85A 1CXEA 3BAKA 2NT1A 3GDBA 2XUCA 1FHLA 1L0PA 4ACZB 4EKJA 2CETA 1S46A 1ESWA 5JBDA 1BSIA 3GH7A 4Z2LA 2OWXA 2GUYA 1FFRA 4D6GA 1HNYA 4K68A 3WNPA 5HPCA 4DWSB 1QHOA 4JKKA 5JUVA 2UY3A 1XGZA 2JE8A 4RE3A 4JAWA 2E9LA 4UQCA 5I5RA 2ESCA 1UD3A 1GOWA 2WK2A 1I1XA 1W91A 3IAPA 4M56A 2AOSA 5JBFA 3CPUA 4CN6A 1E6RA 1UWIA 5DT5A 3SCRA 1R7AA 3A4WA 1V6UA 1VJSA 4P8UA 3KZSA 3CMGA 2FHBA 2BXZA 1MQPA 3WUFA 1UKPA 3WDHA 3FY1A 1TVPA 1SFSA 2NT0A 3N15A 5A69A 3BAIA 4JCLA 3ZQ9A 2DT3A 1JYVA 3PTMA 2ZIDA 1XD1A 2YA2A 3M6DA 5ABFA 2XIBA 4LQ1A 1NP0A 2J7GA 3O9NA 3GM8A 1U33A 1OT1A 5E9AA 4UFJA 1E4NA 3K4AA 2XM1A 1IT0A 3L2LA 4FLOA 2Y8VA 1UWSA 3DYPA 4UFHA 3S2CA 2CHOA 1B3ZA 5BXSA 4RE4A 2CBIA 3AI0A 5A8PA 4MNLA 1ZL1A 3VMPA 3WN6A 1L8NA 2DT0A 3PZOA 2HISA 3ARUA 1KGXA 1DWIM 1BFNA 1V0NA 4JL2A 5CPQA 1M7XA 1E56A 2FHCA 2GJPA 2VX6A 1WZAA 1JYWA 3AIEA 1Q6DA 5DO8A 1GOKA 3AS0A 2OYMA 5A95A 2Y2WA 3WNMA 5E09A 3L4WA 3UESA 3JUGA 1NARA 3PBGA 1QNSA 4JL1A 4W84A 1V3LA 4AZCB 7TAAA 2JIEA 2VTFA 2D1ZA 2GJXA 1CWYA 3BGAA 4PEEA 4C91A 2YLLA 4AZ7A 4TVDA 5BCAA 2WBKA 1E3ZA 3AHXA 1UR0A 3AHYA 3MV11 3NYDA 1OIMA 2DT1A 5HPOA 3AMLA 5M03A 3VD5A 1WP6A 2VMFA 1HVQA 1LF1A 2WPGA 1SYTA 4AIOA 2WVVB 3AZSA 1XH1A 2J75A 3CUHA 3QOMA 3ZJ6A 1A47A 2WSPA 5IDIA 3ZSTA 1ZBKA 3F5JA 4M1RA 3MO4A 4ZXOA 3AJ7A 1E40A 2ZUSA 3VMNA 1H1NA 1DTUA 2AAAA 1OD0A 3I3DA 1W2PA 2V3DA 1J11A 4D6IA 5BRPA 2OYLA 1AQHA 1C3FA 3KEHA 1YHTA 4TX8A 3CBWA 1E0XA 3K8MA 2XYLA 1CGYA 4CCEA 2WMJA 2WKLA 4F8XA 4UQDA 3DYOA 2ZICA 1CXHA 3BMWA 4V27A 4W8BA 5E6YA 1FP9A 1UOKA 3WY1A 4AEFA 3SCWA 3WD3A 4IPLA 3DECA 4PMNA 5CLTA 5BXPA 1JD7A 3GTNA 1W3LA 1CDGA 1UD8A 2VX7A 1MQQA 2EBNA 4HMDA 1J10A 3CUIA 1C92A 3IK2A 2YA0A 4JFVA 1KXQA 2WAGA 3APGA 1MYRA 3WF3A 1QHPA 3CHDA 3GXIA 3NJ3A 4NF7A 1MW1A 1OT2A 3MUZ1 1B2YA 3SCTA 1H0GA 1J01A 2VVSA 3PN8A 4U2ZA 3D3AA 2YL9A 4QCFA 4N42A 4HZ8A 4Z2IA 3AZRA 4XZBA 4GPNA 2OWWA 1B1YA 1GPFA 1KBKA 2J7HA 1D3CA 2BNJA 2WHKA 2ZUWA 3ZR6A 2XVGA 2XWEA 2JIWA 3UG3A 3A4XA 5GPRA 4HTYA 1CEOA 1H41A 1BTCA 4CVWA 1W9PA 3I3BA 1F4HA 3W4RA 4A4AA 2A3CA 3IJ7A 2WWCA 4C7FA 4WKAA 2BHZA 3FHQA 4AD5A 4U3CA 1Z32X 1CXLA 1TA3A 2WCGA 4H7VA 4OKDA 1N82A 3W25A 3EYPA 3L4ZA 4XV0A 4UNIA 3LPFA 3ARZA 3VGHA 4D6FA 2EPKX 3WEZA 2XFYA 4PMUA 2WMIA 1CTNA 3RDKA 2VOTA 4DWSD 2YDQA 1F4AA 4CD6A 2BVDA 1ODUA 1UA3A 3AFBA 1KWKA 4AZGA 3WDQA 2E0PA 4H41A 4A3HA 4PMQA 1JF5A 1DWHM 1TG7A 5KZ6A 4GI6A 3ARTA 2D23A 4J27A 4PBGA 6CGTA 1US2A 3CGTA 1CECA 3UR8A 2XG9A 5A6MA 4HOWA 1VAHA 3ZMRA 1D7FA 2WB5A 3WFLA 1JGIA 3AIVA 1VB9A 3BAJA 3VPLA 3WQ4A 3NSXA 5HXMA 4JFTA 1JZ5A 1OGGA 2ZXQA 2BFGA 5ABEA 1JYNA 1XSKA 4HZ6A 4QFUA 4D6DA 2ZXBA 3RILA 5A6AA 1O6IA 3BLKA 2WC4A 1HXJA 3ALGA 4AZBA 2V5CA 3OGVA 1DHKA 3MKKA 2JEPA 3OB8A 2XPKA 1CLVA 1V08A 3CZLA 3ZJ8A 1UH4A 2W66A 2WCAA 2XFRA 1C7SA 3VM5A 2J7DA 3II1A 2DDXA 1G1YA 4F9JA 1MVYA 2DSZA 1E4MM 3AISA 3OIHA 1W1PA 1E3XA 5IFPA 3VINA 1HKMA 3VGDA 4TXEA 1E6NA 3VD4A 3CMJA 1TUXA 2CPUA 1WZMA 1LLOA 1JL8A 1TE1A 2OLHA 3VIGA 2J74A 2WMHA 4PN2A 3W6LA 3VGBA 3TA9A 5DMYA 5LA2A 1E6SM 3GNPA 4HP5A 4W5ZA 1KB3A 5I6SA 3VDBA 3T2OA 2A3EA 2UY5A 1LL7A 1CBGA 1PEZA 5FCZA 1V6WA 2D0GA 4W88A 2YOCA 4W93A 4BCEA 5KEZA 2DIEA 4GO9A 3OZPA 4D71A 1AVAA 4V28A 5LYRA 3WH9A 1QVBA 3VIHA 2D22A 4AD4A 2GDUA 1MXDA 2BHYA 5CJ5A 4HMEA 1QI3A 1UKTA 2WC7A 4W7WA 3ZR5A 2VZSA 3WQ5A 3WMBA 3WDPP 5FKYA 3W53A 3VD7A 1OM0A 4UQAA 1B3VA 2GDVA 2IXUA 4AZ5A 3AXHA 1OINA 3PHAA 2TAAA 4D6EA 1KBBA 2GJRA 2OWCA 1ECEA 2WBGA 1TZ7A 4ATLA 3F5KA 2ZXAA 1GZJA 2PB1A 1UHVA 5M3WA 3WF2A 1C93A 1JZ8A 1J0IA 1UR2A 3WD0A 1G9HA 4TVCA 3CHEA 2PC8A 1XV8A 4PMXA 5E70A 4X0VA 1GONA 1NWTA 1JZ4A 4EAMA 1UWQA 4DWSC 1HJWA 3WH6A 1WKYA 2DSUA 4S3JA 2PF0A 3WUBA 2AMGA 1J9YA 4M82A 4S3KA 1H4PA 1R86A 3CZKA 1VENA 2WKGA 2DSVA 4W87A 1H11A 3CZ8A 4HA4A 1J12A 4ZE5A 1X6LA 1ZU8A 1VF8A 1V0MA 5CPSA 4UFKA 2XHYA 4ZFMA 4NRSA 4AEEA 1BQCA 2WWDA 3T08A 4OBRA 1E1EA 1JIBA 4MNMA 3D5HA 4PSRA 2VI0A 5CGTA 1UZ1A 4MB5A 1JFXA 1VRXA 2X1IA 3RM9A 3CZJA 1MWOA 1A3HA 2JFEX 3N17A 3U7BA 2JALA 4CUCA 1B31A 1NOFA 2BHUA 2G3NA 4M81A 1E73M 5BWFA 4HZ7A 4JKMA 4P8VA 3VGGA 1LWJA 1JAEA 1BYCA 2E4TA 4GIAA 4U5KA 2CBJA 1JZ7A 4HA1A 1UR1A 1TA3B 3ARYA 1H5VA 5CQ1A 4HU8A 4CN4A 1V3IA 3FXYA 3EMCA 3PZQA 2QF8A 3SUTA 1WPCA 5D9PA 3ARPA 2O9TA 1M01A 2WMIB 3OBAA 3QHOA 3MMWA 4CU8A 2VR5A 1JXKA 1PX8A 2O92A 3GH4A 1JI1A 1CIUA 3AROA 1IZJA 1D2KA 3PZNA 3GH5A 1UUQA 2V38A 3L4VA 1V02A 3MSGA 5A2BA 2V5DA 3L4YA 2BY2A 5DF0A 1JZ3A 1V3HA 3HN3A 1WNOA 1LG1A 3AHVA 2FH6A 4JFSA 1BPLB 1NOWA 2V3FA 4UCFA 5HNNA 4AW7A 5I0DA 2ZX5A 2WHLA 1LL4A 1KR0A 1QHZA 1GCYA 1WO2A 4AZHA 5E0FA 3PZUA 3M7SA 3K1DA 3CLWA 2J62A 3AMDA 4OUEA 2D3NA 5D8ZA 1J0KA 2G8ZA 3AS3A 2XVPA 4X0NA 5D9NA 3VMOA 5A2AA 1JNDA 2D20A 3LPGA 3AMKA 1KWGA 3TONA 1W3KA 3MUAA 4BQ2A 1PIGA 2J8GA 3AIBA 2BVYA 2X2YA 1RP9A 3B9DA 3A47A 4P7RA 4Q7NA 1CGWA 4HMCA 4CU6A 3L2MA 1HKIA 3S6TA 1DP0A 3AMGA 1ZBCA 4NRRA 1KFWA 1B9ZA 1Q6EA 3TTOA 3WMCA 1E43A 1G01A 1UKSA 3A4AA 1JDAA 1RH9A 1GQJA 5DT7A 3SCVA 1JZ6A 4UQ9A 1BVZA 1WDSA 1EH9A 3RM4A 4AZ6A 1EHAA 3HMCA 1VFUA 1R8LA 2PWDA 3CZGA 1ITCA 2X09A 1FFQA 3QR3A 1GJUA 1V02E 3QHNA 1LL6A 1MQRA 2FGLA 2WHJA 5GQBA 4H8HA 4QAWA 1E5JA 2QHAA 4GI9A 1B3WA 2E40A 2YBTA 5FIPA 3EDDA 2ZX7A 3OGSA 2PWFA 4P8WA 4QDMA 1PJ9A 3W81A 3VDHA 3ECQA 3WUGA 1QPKA 3CTTA 3VIMA 1E4LA 1XD0A 1UD2A 4GZEA 1WE5A 3VO0A 1GHRA 3AIRA 3WQVA 3WNOA 4J7RA 2BY0A 2OYKA 1B0IA 3W29A 1KGUA 2J78A 2CCRA 2C0HA 9CGTA 3QHMA 3GYCA 1GW1A 3AYRA 1TMQA 2IUZA 4H2CA 5C8BB 1AQ0A 3WQWA 3BC9A 2W5FA 1I75A 4UR9A 3W0KA 1UWRA 5JIPA 1NWUA 1O7AA 3U7VA 4BQ5A 3AZTA 4J3UA 3CUGA 1GVYA 1ITXA 4IUGA 3N12A 3FNDA 4IM4A 4CGTA 2ZUNA 2XIIA 1BG9A 1JYXA 4GQQA 5HBFA 2DEPA 1UZ4A 1EDGA 1PAMA 1ZBWA 4MDPA 2E8ZA 2EPNA 3NSNA 2VUYA 2X0HA 4J3VA 4X9YA 3BAYA 3U57A 3BLPX 1JNEA 5D4YA 3RMEA 2WANA 1BLIA 4HPGA 3KWXA 1V3JA 4MJ4A 4PUEA 2BV9A 4AD3A 2CXGA 4B3LA 1EXPA 1OB0A 4LYRA 2GSJA 3POHA 2J8FA 1W9VA 2QMJA 4AIEA 3ALFA 2DH2A 4ZEPA 1TFVA 2DH3A 2VC9A 1WDRA 2PBGA 5EMYA 1UR4A 1W9DM 3FAWA 1UD4A 3SUVA 1C91A 4P7QA 3RM8A 4NI3A 4GXPA 1GNXA 4MJ2A 2D24A 4CD8A 1NWSA 1R87A 2IXVA 3OLGA 1C90A 2EPLX 3KL5A 4QP0A 1Q6CA 4PSPA 3RIKA 1MW3A 3VNYA 4DM1A 4LYPA 2CHNA 1E6ZA 4YHGA 1SR0A 1TR1A 2CITA 3WKZA 2VJXA 4OBSA 3AOFA 4D1JA 3K8KA 2XGIA 1QW8A 2G3JA 3ARQA 3OLDA 2Y4SA 1B3XA 2FHFA 4MB3A 3TTQA 3HJEA 4CCCA 3NSMA 3WH7A 5HOSA 2XVNA 2WXDM 1K6AA 4QLKA 2W92A 4U3AA 4DM2A 2EJ1A 3AQUA 4ACYA 4AXNA 1E70M 2XVLA 1LG2A 5CSYA 5BRQA 3VGEA 1UQZA 4U2YA 1WB0A 4PUDA 4CD4A 1E72M 2A3BA 2YLAA 4U33A 1EGZA 1E9LA 2V3EA 4AD1A 1PX4A 2QMKA 1W3HA 3AIUA 3T0DA 4P7NA 4A3YA 1UD6A 4JHZA 2CNCA 3WL0A 3AS1A 1FA2A 4FF5A 2O9RA 4LX4A 4XZWA 2C7FA 4TTUA 3W27A 1BHGA 1KQZA 3BCFA 5CXPA 5BYWA 5IFTA 3DHUA 4KMQA 5ABFB 3OA5A 3N11A 1H49A 5BXTA 2V3GA 2XM2A 1Y7VA 2DQXA 5ECUA 4BF7A 5F7UA 2YJQA 4B9ZA 1HIZA 1GUVA 2PI6A 4M8UA 4W8AA 3EBVA 3PZGA 4PMOA 5I78A 4ATDA 1K9DA 3ZT6A 1W9BM 4IISA 2J25A 4MNJA 1XYFA 3O6AA 1LWHA 1WCGA 2QV4A 2W67A 2E9BA 1HJXA 3WBAA 1GHSA 1DWFM 1K9FA 1WZLA 2J7CA 3T0AA 5HDRA 2VO5A 3DYMA 4W7UA 1H09A 2CIPA 3SUWA 1WZKA 1HP5A 3CHFA 4FLQA 2ZX8A 3UG4A 2OSXA 1Q6FA 2WLZA 1E6QM 1LQ0A 2VCBA 2NW0A 3WFZA 2ZUUA 2GJXB 1Q6GA 5JIWA 3AS2A 4MAZA 3ZT5A 4CCDA 4TUFA 1CPUA 1US3A 5AYBA 1DWAM 3GXDA 2JF7A 4W7VA 2EPMX 4HU0A 5A6LA 1V6VA 2WLYA 4AZCA 3WEOA 3W38A 1UA7A 1QW9A 2UY2A 2EEXA 2WZEA 4PTMA 4MAVA 3ZIZA 2CERA 2J7FA 3G6LA 3W37A 2F8QA 3CUFA 1HJVA 1R85A 2ZOXA 1MW2A 4F66A 2D0FA 1JDCA 4GZIA 5EBAA 1HL8A 1ODZA 5I77A 1UH2A 2PWGA 4C90A 2YKKA 5E0CA 2X05A 1HX0A 3GBDA 2WW5A 3PTKA 4D6JA 1RP8A 1LJYA 1CENA 1G94A 4Z2HA 5I23A 2WMKA 4OIFA 4NSBA 1JG9A 5BXRA 4J3WA 4GKLA 4H04A 1NM9A 1GOQA 1TCMA 5EB8A 4V2XA 3BMVA 2VQTA 1HJQA 4WSKA 1H3GA 1QOXA 3FN9A 2CBUA 3RJXA 3ARWA 3HU7A 1BVNP 2YL5A 1KQYA 3B9AA 1W1YA 1JF6A 4GI8A 4ZENA 1FHDA 1OSEA 3VD9A 3T09A 4HOXA 1PX3A 1H2JA 4LGXA 2HVMA 1GOIA 5DEZA 4PTXA 2O9PA 3MUY1 5AYIA 1HKJA 5EFDA 2EPOA 3NCOA 1FH8A 4ZE4A 1E4IA 1KGWA 5A6BA 5A6SA 1FOBA 1G0CA 4JHOA 1GQLA 1JAKA 2RGMA 1CGUA 5E6ZA 2DGAA 2W61A 4BQ3A 1BG4A 5I24A 2DPEA 3TTSA 2GK1A 3GXFA 3K8LA 4WLCA 1QNRA
chains in the Genus database with same CATH superfamily
4QSFA 3GTHA 4R27A 3S6DA 4LUIA 4IIEA 2QCEA 1I1WA 4AUBA 3M6YA 4YU1A 3TJXA 4RZBA 4UFIA 3LHUA 3T55A 1M03A 3WYZA 1W1VA 1TZ9A 2BVTA 4IP5A 3ZJ7A 1VBRA 3RCNA 3GHUA 4K37A 4Q8TA 1EOKA 1NQKA 5D02A 1ISWA 3W86A 3AICA 4A8RA 3UEQA 1ADOA 1GVRA 1G5AA 4TOQA 1WXZA 3GNDA 3CV7A 2YW4A 3RFAA 2AL1A 1FWHC 3S5ZA 3OVGA 1JDEA 3SBFA 3COTA 4G9PA 2VZOA 1TVNA 3MV01 3MB9A 3C86A 4NZJA 1YTDA 2R82A 1JDDA 1C8XA 4IPNB 1ZPTA 5I79A 2B7QA 2WZMA 3GR7A 4NVTA 4QJ1A 2YL8A 3MU7A 4N0RA 3VUSA 1F6PA 1YKWA 2HTMA 4UCGA 4DUWA 4UTUA 2Y5JA 2E6DA 4UQEA 4MADA 5C9RA 3M5VA 3QQWA 1XCXA 5T26A 5DFAA 5F2GA 2VC6A 3GK0A 4QE1A 2Z00A 2FGBA 3SCSA 1UPMB 4J3XA 4TX6A 7REQB 4P7LA 5A6JA 2OSWA 4GQRA 4GXMA 3PWIA 3O8AA 4GKTA 4MIMA 4LF2A 4PRRA 3NQMA 1FBAA 3IUDA 4C7DA 3OHIA 4W89A 1LQAA 2YCKX 3PJUA 3NQ2A 2C6QA 4E3VA 1QNVA 3FVDA 4DI9A 3QGVA 2X40A 3OLEA 4Y7EA 4Z0JA 3WMSA 2ZX9A 3AWOA 3N25A 4UZUA 3N4EA 3GZAA 5EPDA 4AMCA 1FH7A 4AIUA 4XZMX 2QCNA 5LIXX 4FX7A 3KZPA 4JCMA 1NDZA 3ZLGA 2D3LA 4B9YA 4CLMA 4ZFCA 4R34A 3UJFA 1OZMA 3ATYA 3P67A 4H6RA 1PKYA 5G4EA 2P0IA 3BSHA 4LTSA 3GNXA 3WF4A 5I07A 3WH5A 3DFYA 1W1A1 3EDFA 2Y8KA 3U2OA 1BGAA 4JZ5A 5JQ9A 1HP4A 4UMBA 1EJVC 4CQDA 3WUEA 3W28A 1G4EA 2QPSA 4LUTA 4K8HA 4LUJA 4BY3A 1PKMA 1NDYA 3A22A 4AXKA 4U5IA 1FH9A 4O13A 2I16A 4H7CA 4MGGA 3V0UA 4MKVA 3WDRA 3QPZA 3CC1A 4FOKA 3VIJA 4XUGA 1WDQA 4IOTA 1IXOA 3YPIA 1IV8A 2R9RA 4KEUA 4DF2A 3QXBA 1XJBA 5EFFA 5I3JA 3BOFA 2WSQA 2Z1WA 4IUOA 3VZYA 4HHHA 1ZJBA 3DFPA 3EB2A 1BAGA 2V81A 2X42A 4UFLA 3R0UA 3UWEA 1M6JA 4CNPA 1XLGA 4C60A 1F3EA 5AHFA 4YTUA 1K9EA 1L6WA 1J79A 4A6GA 3LXAA 4RW5A 4WDUA 4DJEA 4DO5A 2WMGA 3A3HA 3WLOA 1E9IA 1XBYA 2OG9A 3NDZA 4JIHA 1DWJM 3WJWA 1AQMA 4REQB 2ZXDA 2JKAA 4Q7IA 1EJUC 5H8UA 1F8IA 3ORWA 2BY1A 5CZ0A 1AA1B 2R14A 4ILSA 4XD6A 5LNSA 3PTQA 3FDKA 3B0PA 5LIUX 1CI1A 1OD8A 4AY1A 1WAWA 5CZSA 3E1F1 2I5QA 4IP4A 3QYQA 1QXLA 3TUUA 4S3FA 2EQDA 5C55A 2VT0A 1RVKA 1R47A 4MLJA 1DJYA 3W85A 1TTQA 3H2EA 4KWSA 3MTWA 3STEA 1C9WA 2OQLA 2VEIA 3C2YA 3QY6A 4KF1A 4QCEA 4PTNA 2FPTA 2W63A 2QJMA 4LS0A 1DVJA 1OCJA 2KAUC 2G4FA 4FIRA 2Y0FA 4ACZA 1MSSA 3DAQA 2QGHA 3WLNA 3URQA 2VL4A 1TR9A 4WY0F 4XTIA 5MF5A 1HJUA 3JU2A 4N6EA 1SJDA 3T0TA 1D9EA 1A5BA 2XFFA 3ONBA 4DWSA 5K7JA 2FGZA 4N9CA 3U4AA 4A2SA 4N4PA 4PCTA 3IVUA 3RJYA 1YTKA 1XFBA 2PWEA 3VGFA 3W22A 1HG3A 4PUUA 3BH4A 4KFPA 3F03K 6REQA 2FDMA 1ZJAA 2ISVA 4ES4A 3H2OA 1RR2A 1XCWA 4XX6A 1GQIA 4C6OA 5K4ZA 2X8RA 3B8TA 3VD3A 4JKLA 3C5QA 3MS8A 1OX4B 3N18A 2Z1KA 3CEUA 2CZEA 4ZXLA 3THDA 3IGXA 4GCXA 3ANVA 3G0SA 4KH2A 1OEPA 4WDTA 4NAFB 1PIFA 2QAPA 2CEQA 1H63A 2IQDA 2CESA 3P5YA 1XIHA 2XVKA 4MKNA 1QI4A 8A3HA 2DT2A 2RKXA 1BYAA 1CNVA 3EA3A 3CH9A 2A4AA 4O1FA 1EDTA 3TA6A 1KBJA 2BWGA 1NWRA 1QI0A 4MFEA 4LYQA 4DYJA 4LWWA 1EDQA 2OODA 3WQ8A 3TQ0A 3CWNA 3N2OA 2L5HA 3HOJA 3B03A 4PR4A 1CW2A 4QS5A 4JFWA 1EO5A 4HHLA 4DB7A 1TX2A 4ZQCA 2CZFA 4LB4A 1GVOA 1OABA 4F2TA 3M07A 4H00A 2PCQA 1EZ2A 4QLJA 1XRVA 3BXWA 4XK2A 3ZSSA 2QIIA 2QUVA 1XIGA 2I17A 4WGHA 4AG0A 4AZIA 1HW6A 1SSDA 1XGDA 3FHAA 3TN4A 3TWBA 5D2YA 1K77A 4G1KA 2ZTJA 1QT1A 1XINA 2FZ9A 2W91A 4GUGA 3MUCA 3L12A 3FKRA 1R5YA 4JTKA 1V0KA 4BJHA 4LVDA 4EF9A 3N2TA 3DENA 4IZGA 5FL0A 4DX3A 3BTNA 7XIMA 1UROA 2HROA 2YDRA 1H51A 3ID7A 4UIOA 2AGKA 1VGAA 3RLVA 3LMYA 5J8LA 5DRIA 3V18A 5LA1A 1WDPA 2BVWA 3BW4A 1K03A 1XISA 3LPOA 1FKXA 2FFIA 1E1CA 1K1DA 3VE7A 3GNOA 3MHFA 1U30A 1FUYA 3LGDA 3LU2A 4WX2A 1RD5A 2OFJA 3WH8A 4JTRA 4RCXA 3VNKA 5K4XA 3L9CA 3PZMA 2DJLA 1R3VA 1CZ1A 1KRAC 3S2NA 1AL7A 1XQLA 5E1QA 5EMLA 3WF1A 1CLXA 1J0ZA 1C8YA 4KPLA 4J3SA 1GOOA 4PB3A 1EQPA 2ATMA 4FNUA 4E38A 2V69A 1EC7A 1EJXC 3TK7A 3C0SA 3B4UA 5A1AA 4MDOA 3BL3A 1XLDA 1O12A 1SJAA 4MTVA 3AWNA 1Q4NX 1XBXA 4NP7A 1ISYA 3FEQA 4LU0A 3TW7A 3O0FA 4QLLA 6TIMA 2ZTKA 1W3IA 2ZE3A 4K1GA 2PP0A 4C6DA 3K4DA 4NKCA 1CXEA 3TSBA 3NQVA 3LNPA 4YNGA 1L0PA 1C8VA 4EKJA 4I5UA 1BSIA 2OWXA 4D6GA 3F7JA 4GIEA 2ISSA 5AKQA 3GTIA 4XBJA 3M0KA 2E9LA 1S5WA 4E4UA 5I5RA 2ESCA 4DZHA 5DBUA 2WK2A 3IAPA 2AOSA 4YLWA 2REQA 1JUBA 1R3SA 5C0QA 4YWIA 3A4WA 4XD5A 1EF3A 2V82A 4NL1A 2BXZA 1V7YA 4DBEA 1W56A 3W88A 2XSXA 3KVMA 3WDHA 3QTPA 5HWMA 4K7VA 5EKYA 4LH8A 3U0HA 1SFSA 3NZ1A 3PTMA 1XYCA 2ZIDA 2YCLA 2YA2A 4WOQA 2J7GA 1YYAA 4CQ8A 1OT1A 2XM1A 1RJQA 3L2LA 4FLOA 4Q8VA 1UWSA 3C3UA 4BWLA 3PWAA 1X8CA 1RK6A 2CHOA 5I09A 5BXSA 2CBIA 2QCCA 1QRQA 4XD3A 4MNLA 3QMSA 1G69A 5CPMA 5H91A 3VFLA 4LY4A 2HISA 1JCJA 1DWIM 1M7XA 1QOQA 2AL2B 4JICA 1XLCA 4WY0B 1OCBA 4AX7A 4GJIA 1JYWA 3AIEA 1Q6DA 2HS8A 3PJWA 2OYMA 1OK4A 3WNMA 4IWWA 4NXSA 2VYOA 2D1ZA 3T07A 3WLKX 1CWYA 1Z48A 1D3GA 3DCPA 4TR9A 4BK9A 2CWNA 4C5ZA 1OIMA 5M03A 4TV5A 3VD5A 4O1AA 4QM1A 1HVQA 1LF1A 2PGEA 4ZQMA 4MMWA 4AIOA 4AVFA 4Z42C 1EBGA 2EAWA 3E2RA 1MMFA 3PJTA 3AXKA 1DJHA 3E0IA 3BJSA 1AZ1A 4M1RA 1AFSA 1M1BA 2ALDA 2VC5A 4B92A 3KTSA 4C1LA 2CLPA 4ERAA 2PSNA 1FXPA 4ZVJA 1OD0A 3I3DA 1W2PA 3VKCA 1GKPA 4RV3A 4D6IA 2OYLA 3LYEA 4I8YA 4KEZA 3PS7A 4TX8A 5FF3A 2RUSA 4O4WA 1E0XA 3RPDA 4R9XA 2ZICA 3DFQA 3LDVA 4L61A 2FB3A 3SN4A 4DJED 4IPLA 3TYZA 5BXPA 1W3LA 3BGJA 4Z1AA 4HMDA 3IK2A 4JFVA 2YA0A 3VCCA 1NVMA 3APGA 4Y8EA 1MYRA 3WF3A 4NF7A 4L9XA 1Q2RA 1OT2A 2D73A 1RBOB 1H0GA 2VVSA 1SUXA 4JHMA 3D3AA 4OVXA 4N42A 1KM2A 4GPNA 4XZIA 2A5HA 3H22A 1GPFA 1KBKA 1BXNA 4ORMA 3GKFA 4Q8MA 2WHKA 3HTWA 1BTCA 2POTA 1W9PA 3ZVHA 3M41A 1PTDA 3GZ3A 3R6IA 4DPQA 2QJGA 3V0SA 3FHQA 1XYMA 2WNQA 4AD5A 2FJUB 1S2AA 1KFKA 1TA3A 4H7VA 4ZO7A 1KD0A 1J4EA 3R79A 4D6FA 4C6NA 1B4EA 4HIBA 6XIAA 3WEZA 1WUFA 4EPDC 2HZGA 1FCBA 2O0TA 3NL3A 4DWSD 2B0MA 2HK1A 2BVDA 3ISIX 1Y5XA 3MBDA 3W1QA 4M6VA 2G37A 3WDQA 4KRZA 1DWHM 4K7YA 1TG7A 1IGWA 4JIRA 4J27A 3FA4A 4S3CA 3CB8A 3IGSA 3CGTA 3MQTA 2VGIA 3UR8A 2YBVA 1O5QA 4A35A 4JN6A 2X1SA 1VAHA 4O14A 3ZMRA 1D7FA 2WB5A 1F8MA 2DFAA 3AIVA 1VB9A 3BAJA 3VPLA 3WQ4A 3NSXA 3CPGA 5HXMA 2ZXQA 4HZ6A 3LCLA 2ZA3A 3BLKA 3BJFA 4LEQA 1PE1A 1WOBA 2Z29A 3ITGA 4DO6A 3SIZA 3EAUA 5IBXC 4B4HA 3GU2A 2HEJA 1CLVA 1V08A 1WKEA 2IPWA 2YFNA 3CZLA 2WCAA 1LRNA 4ZO8A 3FA3A 4JNYA 2Q01A 1J2BA 3T9PA 3SY1A 2DSZA 1AZ2A 3AISA 3M5YA 1YDYA 3A23A 3CUXA 5IFPA 3VINA 3C56A 2XIQA 1LORA 3DH7A 5CG7A 1GG1A 3OEXA 3ME3A 3U3HA 3EWUA 3VD4A 1ZAHA 2NSOA 3CMJA 5XIMA 1GVEA 5GJMA 1Y5WA 5MKGB 1XLIA 1E6SM 4LS2A 3MVTA 4O54A 3TJIA 1NDWA 2A3EA 1B54A 5KETA 1BD0A 4UTHA 2C16A 1G4SA 1PEZA 1BWKA 5FCZA 2PFHA 4O0QA 2YOCA 3CQIA 5KEZA 1FDJA 1F2JA 4Q4QA 5D2TA 4AWTA 1AVAA 4R7OA 2OU4A 3DERA 4HYRA 2HPIA 4NIRA 1BRLA 3H7UA 3TC3A 4JIIX 4KQNA 1F9CA 2BG5A 2PLJA 3LV5A 4D9PA 2F38A 2VZSA 3I6RA 3WQ5A 1L6FA 3WMBA 2C15A 3VE9A 1VFTA 1KW1A 2GDVA 4ONVA 3GHRA 5B80A 4JTFA 2NV2A 4E8GA 4ATLA 1Q13A 3F5KA 2ZXAA 2GUBA 5M3WA 3W07A 4HN8A 5CPOA 3EOSA 4RPPA 4S38A 4TVCA 3WLLA 1XV8A 3UQNA 3KVLA 1GONA 1AJ2A 4GISA 4EAMA 5C2GA 4H9TA 2PTZA 4MG4A 3TLLA 3CT2A 4GH3A 1V51A 2AGTA 4K6AA 3DESA 3CZKA 1VENA 2DSVA 1B5TA 1H11A 3CZ8A 2P53A 4HA4A 4EWND 4XAZA 1J12A 5C2XA 4V1XA 1UR3M 1X6LA 3N34A 2TPSA 3NQFA 1WOAA 3T08A 3B9NA 3R8GA 1C29A 4HKPA 2VI0A 4ERGA 3PB2A 3LRKA 1UZ1A 3RM9A 1JFXA 1K8YA 2ABAA 3GFYA 4ALDA 3STGA 4C6FA 1A3HA 1DIEA 1WUEA 2JFEX 3U7BA 2JALA 4CUCA 1DE5A 2BHUA 1XF0A 4HZ7A 2YXXA 2B4GA 1V79A 3KOYA 3MDUA 3IPWA 3PC0A 4GBUA 4GIAA 4ZSUA 2QVNA 4G6CA 5BMWA 4G56A 1T99A 3IV8A 1RV8A 2OGYA 4HU8A 4MWAA 5JXQA 5FEZA 3LK6A 3W23A 1YE6A 1LP6A 1W6TA 3LERA 4Q4RA 5TQLA 3OBAA 4LRSA 4N9DA 1QWKA 5CBIA 4JTIA 4A3QA 4H83A 1D2KA 4ZGYA 4IFRA 1UUQA 4GFIA 2CLMA 1UZDA 2V5DA 3L4YA 2BY2A 1QO5A 5DF0A 1JZ3A 1LT8A 2IKJA 3QW4B 2F2KA 3HN3A 1LG1A 4RZ4A 3AHVA 3GAYA 3UT0A 3LHWA 2JK2A 5HNNA 1CB7B 2QGYA 4GABA 3PG8A 2WHLA 1KR0A 1BWLA 4O18A 4EACA 2OPJA 4AZHA 2VFDA 4CEXC 1GGOA 3IACA 3VOJA 3PZUA 3M7SA 3D47A 3K1DA 3CLWA 1TIMA 3SRKA 4GX8A 3AMDA 4FALA 4OUEA 2D3NA 5D8ZA 3KBSA 5HATA 5D9NA 3Q67A 5A2AA 1JNDA 5FF4A 5SWUA 1J93A 1KWGA 4JGDA 4Q4SA 3MUAA 3WLSA 1EB3A 4E2VA 4MZ1A 1N2VA 4LBRA 4HMCA 1A0CA 4YTSA 4ROPA 1XLAA 3S6TA 1DP0A 1ZBCA 4IL2A 3M1ZA 1E43A 2C18A 1KV8A 5HMEA 3G1AA 5DT7A 1TKKA 4CCZA 3NQCA 3QV7A 3HMCA 1TJ1A 1R8LA 4LANA 3TC7A 3LSCA 1ITCA 1RXOB 2X1TA 4MZYA 4Q8UA 2Z6JA 2YPIA 1YBQA 1EEXA 1E5JA 3EKZA 2E40A 2YBTA 3NZQA 5HINA 5FIPA 4LNCA 4PUNA 3OGSA 2Y62A 4P8WA 4IJBA 3TOYA 1DXEA 5FF2A 3VDHA 3W81A 3C4UA 2BMBA 1S2WA 1JPHA 2NVAA 3ECQA 4OBTA 3RCMA 1E4LA 3GUWA 2OQYA 1UD2A 3CEPA 3GXPA 3P7YA 7PTDA 3THAA 3FJLA 3WNOA 5FJJA 3V5FA 2OYKA 4GYJA 3W29A 1HKWA 3K5XA 5JMUA 1S1RA 1X6UA 3GYCA 3LCHA 1GW1A 4QG6A 3N73A 1TMQA 5C8BB 1EF2A 4MWAC 3MY9A 2NLYA 1ZQ5A 2XN2A 3C0JA 4CQBA 2VELA 4ZTXA 4UR9A 2NLIA 1DQXA 1TQJA 4X2RA 1SPQA 1P4CA 4BQ5A 2Q8LA 1GVYA 4Y9OA 4ZA0A 2QT3A 1W31A 3VNJA 3S3GA 3GVVA 1PAMA 2E8ZA 5AC6A 1Z3NA 4J3VA 4DAIA 3U57A 4E6MA 1VJIA 2PWUA 4PBFA 5DMNA 1W3TA 5LNVA 2WANA 2E5DA 4AMAA 4X60A 1V3JA 4PUEA 2BV9A 4AD3A 4B3LA 1EXPA 3LHZA 2GSJA 3E0LA 3SAZA 4GYFA 3Q37A 2QMJA 2DH2A 3HO8A 3WJXA 1EJWC 3NQ8A 4JTJA 3O0KA 3M0MA 4P7QA 4NI3A 3W7NA 1TVLA 3NO3A 4FO4A 1GNXA 4MJ2A 4CD8A 1UP3A 1NWSA 1S39A 2X1UA 4XBSA 2YZ5A 1C90A 1LBLA 3RIKA 1GOXA 3WJYA 5HAOA 1E6ZA 4YHGA 1TWIA 4XKMA 2WZTA 3TX9A 1QW8A 2HNHA 3ARQA 3OLDA 2PDCA 1UP2A 4DRSA 4Z1CA 2FHFA 4MB3A 3HJEA 3W1TA 5HOSA 5CC7A 3GKAA 4JQ3A 4MHBA 1NY1A 5LNRA 2BOEX 1KFBA 4AXNA 1EEPA 4R85A 1WV2A 3HM7A 5H2ZA 3JS3A 4C1KA 2A85A 3IIXA 5LZLA 1WB0A 2D2JA 1EJSC 1OFAA 1R0MA 1KM0A 2A3BA 2YLAA 3W7EA 4TMBA 1EPXA 3PPFA 3S5SA 4EX4A 1PX4A 5DN1A 4AY7A 4JHZA 3WL0A 3AS1A 3C8FA 3R43A 4FF5A 1O5RA 4LX4A 4XZWA 5F4XA 5EMUA 2C7FA 3DUGA 3WQGA 1F3XA 3GIYA 3H54A 3VZZA 5EMJA 5BYWA 1TJ2A 1H49A 3N11A 3QW3A 5TAOA 1K8XA 4BF7A 5LIKX 5H8PA 1IEIA 2YJQA 4B9ZA 3E5PA 1GUVA 4M8UA 4W8AA 3EBVA 1KM3A 1F73A 3PZGA 1ML1A 3QGAC 4HK5A 8XIAA 4ATDA 4PUWA 1W9BM 2IKHA 3EWWA 4MSSA 2J25A 4MNJA 3FYYA 1LWHA 3S1XA 1OF6A 3LCFA 2QV4A 2W67A 3NURA 1XG3A 2YYTA 4PFHA 1HJXA 3S1WA 1GHSA 3LHYA 3BPWA 1DWFM 1WZLA 3BV4A 4IIFA 1XUZA 1A5CA 3L68A 4W7UA 3OYXA 1VHCA 1HP5A 3TC6A 2W3ZA 1FWEC 2PTYA 1L2UA 1Q6FA 3HF3A 4JIPA 5DLCA 2NVDA 2NW0A 1UBSA 2H3BA 3NEHA 2E1DA 4MAZA 4S2CA 4HK7A 4CCDA 4Q32A 1XFCA 4KETA 2ZC8A 3IIZA 4NZ1A 2JF7A 1Q5MA 1V6VA 1IHIA 2PDQA 4AZCA 3W38A 2DZBA 2GGGA 2GJLA 3B0YA 5D30A 4S3GA 3BZGA 3N29A 3W37A 2C19A 3O6CA 4YXGA 3NDOA 1R85A 1MW2A 3PFRA 4F66A 2CZ5A 2XU2A 1VQTA 4FNQA 4UTJA 1P5BA 1UJPA 5EBAA 3QKEA 4RW3A 4MFDA 1HL8A 4FXJA 4IGHA 2A2IA 5I77A 1T96A 1W54A 3PNZA 5E0CA 1HX0A 2VDHA 2GPTA 3GXTA 5ABTA 1RP8A 4WD0A 3LGGA 2Y5SA 5T9BG 1SO4A 4OFCA 1B3OA 5I23A 4GQ0A 2QUTA 2AKZA 2DZVA 4M19A 3DFTA 3L21A 5EB8A 5FJPA 3BMVA 1NFBA 4DIAA 1HJQA 3M0ZA 2YR1A 4WSKA 1EKOA 3FN9A 3BQ5A 2PDJA 1QJWA 3EKGA 1BVNP 3E02A 4GI8A 4Y9NA 3CO8A 1MEIA 1XQKA 3BGGA 2HVMA 1TMLA 5AZ0A 3W73A 3ANYA 4PTXA 2O9PA 3W72A 1HKJA 1KRBC 1V77A 1XWYA 2NWSA 4PH6A 1E4IA 5A6BA 1FOBA 1JAKA 3CH0A 2RGMA 4Y90A 2EPHA 1CGUA 5E6ZA 1OYAA 1DHPA 2XIMA 1BG4A 3DFSA 5AHLA 3GXFA 4CQAA 3RLGA 5ABGA 1W3NA 1TSIA 3H70A 3QR1A 1VFLA 2HQAA 2ZWZA 4KCUA 1GVIA 1QTWA 3OZOA 5LA0A 2XINA 4MWAD 3UR2A 3UJRA 1VIWA 4QQUA 3S5YA 4RNHA 1O68A 3H2CA 3P8IA 4GC3A 3G5EA 3BMXA 1HVXA 3L2IA 1FX6A 1RJPA 3BCDA 4PMRA 4QDPA 3NQ6A 5M5DA 1E0TA 3VX1A 4A3RA 1UIPA 1EPVA 3OG2A 3OU8A 3GU1A 2F84A 2FDSA 4AYSA 1UKOA 1PTAA 1W17A 1QNOA 2I9EA 1PZ0A 2Q3OA 3MMUA 1X1NA 2QCHA 3WK3A 5IHSA 4QEEA 4LF1A 2PAJA 3O2LA 1IR2A 1ISXA 4JTCA 3W2KA 2VVNA 2R1MA 1O95A 4GI4A 2R91A 4TQTA 2R1PA 2FJKA 2O4QA 1MEWA 4OJYA 1O5XA 1POKA 3E2SA 5I00A 3TSDA 1ZCCA 2YL6A 2ZRUA 1BYDA 3EX4A 3T8QA 5AVNA 1XLLA 1L6SA 4QROA 3MJMA 4C7GA 5C54A 2HXUA 3ARRA 2PRHA 4URIA 2OEJA 1K70A 2WNWA 4QQ3A 2CLKA 1MFVA 3KWSA 1S5MA 2PDFA 5I3IA 4DUXA 5IHRA 1A5UA 1AODA 4FS9A 3BOLA 4H9MA 3B9EA 1VEPA 2Q8XA 3UPMA 1DWGM 2EO7A 2VQUA 5FOOA 3CB3A 3GXMA 4RZ6A 1DE6A 5CZJA 1MUCA 3VUPA 5A6KA 1JXJA 3HB9A 1A0DA 4QG8A 4QR6A 2J47A 2J4GA 1REQA 3UYIA 3DHPA 4EK7A 1W5QA 2E68A 3MSDA 4RPQA 3R25A 2PD5A 5I7GA 3FK4A 1V6XA 1EGMA 3NXLA 5LNWA 5TBOA 5D05A 4AD2A 4GUJA 3AMCA 4E2BA 1R38A 2BGSA 4N2YA 4CKQA 5BOOA 1FWAC 3WBWA 3EKLA 3STPA 5I3GA 3VKKA 3R8HA 2P50A 3PPGA 3HIJA 4PMZA 4PTVA 4PA8A 4DUVA 2V68A 1U1JA 3ZS4A 3N6JA 1UWUA 5C6MA 4NG3A 3AYSA 4B5TA 1BYBA 5D9MA 1OGBA 4HD5A 3R94A 3TSMA 3CIVA 1OG0A 2VFFA 2NWRA 4KWUA 4UTFA 3TIMA 4UC5A 1DJIA 5CZKA 2QPXA 1G7VA 4GE8A 4CD7A 4B2DA 2VFGA 4I7UA 4R9OA 4GZJA 1FDZA 2C1GA 3GHTA 4XWUA 2OVLA 4WR3A 2IKIA 1QOPA 1EA9C 3KM8A 5I3DA 1UKQA 2VOMA 1VBUA 5AY7A 4AVOA 3M47A 3IJIA 4YCOA 3HPFA 3VDAA 4TTGA 3L4UA 4Z2KA 1MRQA 3EEGA 3B9OA 3UZYA 1SW7A 2DZWA 2TMDA 4L4MA 4A29A 3GHSA 3WLMA 4O11A 4FZIA 1SFLA 3UWWA 1KXVA 3IRDA 5DY3A 1AH4A 3TLQA 1UD5A 3R0DA 1OBAA 1W1TA 2OKOA 1ISVA 4XBKA 1TV3A 3VX0A 3UZXA 3JRKA 3EMQA 3NIYA 5C9XA 2WQPA 2EG6A 5TNVA 3W87A 3E9AA 1QNQA 3UPWA 3CMFA 1XIIA 3EDEA 3VNMA 4PMDA 4B5SA 2X2GA 4LXFA 5C71A 4JQAA 3NNTA 4HYWA 2ATSA 3M5XA 4JTLA 2WZHA 1EBHA 3TJ4A 4EANA 2P3EA 4W8LA 1OYBA 4MB1A 1HL9A 2F6XA 2CZVA 1UWTA 5AHNA 3OZMA 4FLRA 1FWWA 1H7PA 4X61A 2JF6A 1GVFA 1Z44A 4RL3A 1EP1A 3TYDA 1P6BA 1W1B1 4UTWA 3UF9A 3WDJA 4ENLA 5LGZA 2G50A 2YDSA 1PPIA 1POJA 3AXIA 1X8FA 1V6YA 3EMZA 2RGLA 3UWUA 6TAAA 1P7TB 1XIEA 1SW3A 2X0YA 3LPPA 4DJDA 5AN7A 2HCVA 4LBUA 2VURA 4P7OA 5D38A 3W1UA 3SIMA 1PVNA 3QKZA 5D2VA 1F76A 1VS1A 4ATWA 3VILA 5LKYA 2DORA 3MDWA 4MYAA 3NEVA 3EDKA 3QBUA 5HA7A 4HNCA 2LLEA 1JCMP 3F4DA 3VIFA 1M53A 1X39A 1UMYA 3OBKA 4GVHA 4F4RA 5FL1A 2GLKA 1A50A 1UYQA 3I4EA 1Q7ZA 3B8DA 1J0JA 4N02A 5FSEC 1CXKA 2QCMA 1DIKA 1QATA 3E5BA 5REQA 4RLIA 1LT7A 4AU0A 3LZ3A 3FXGA 2WMFA 4P8XA 4RNIA 3B0VC 3ITXA 2ZUVA 1D7KA 3ZT7A 4ROQA 5EL1A 4AVNA 3CWOX 1VFMA 2Z1VA 4Z2GA 5GNXA 1XIMA 4QITA 1DEDA 3NQEA 5AYZA 1XC6A 1PSCA 3AIWA 2Z1XA 2WVSA 4UXDA 2F2HA 4MYXA 3AC0A 2WYSA 4M0XA 3SY5A 4F9DA 2YBUA 3UA4A 5IXEA 3O15A 4RV8A 3SGUA 5AC7A 4KGJA 4Q8NA 1RALA 2G3IA 4PCFA 1E55A 1C7TA 4D6CA 2CKSA 3DKJA 1ZB5A 3N19B 4R7JA 1P6WA 1EXBA 3MUXA 3VXGA 1GVQA 3PP7A 3G6MA 3AHZA 2J77A 3RGTA 3LEPA 2ZX6A 1OYCA 5A8QA 1BGGA 1EQCA 4PYSA 3K30A 3DOPA 5BRBA 4GIRA 3SCNA 4LCRA 4E8CA 3QMTA 4LBSA 3W74A 2FLIA 3WK0A 4HOZA 3RLHA 2PU0A 3UP8A 2GVEA 4L6HA 3EOLA 3DFOA 3UR7A 3W6YA 5LNUA 2R6OA 3RX3A 3UNDA 1F05A 1JCXA 4B16A 1MXGA 4X2PA 1MW0A 3UCQA 2OQHA 4ZB0A 3VVGA 1XKJA 3P93A 5D8WA 1JFHA 3GW3A 4GK8A 3WD4A 2WVVA 2NSXA 1EFZA 1E6XM 1IT8A 3W7RA 2G41A 1MEHA 2PZ0A 4OOZA 1FCVA 2PGRA 3WEMA 1KR1A 1W32A 2VD8A 1XSJA 2XGBA 1JR1A 5HWJA 3B8IA 4DJDC 2UZ9A 4DJFC 1QPRA 3W2JA 2DW6A 3R4IA 1FQ0A 3FJ4A 3GE7A 3MO7A 1SSGA 4FHAA 2EGZA 1PYMA 1UR9A 1KXTA 2EXOA 2JGYA 5D03A 4KGLA 1UOZA 1LYXA 1E15A 1LCOA 3G1VA 3NZPA 3WIJA 3LHTA 1T8XA 1RLCL 3OLIA 1S2UA 3QPEA 3MMTA 3KE0A 1Q7MA 3U48A 3QPYA 1YPFA 3EWDA 1XPGA 1E6PA 5A6BD 2VCCA 1UC5A 3GRIA 1DOSA 4G1NA 3WSUA 1XGEA 2HBXA 2FH8A 5U4NA 2GWNA 4FSAA 5AC8A 2CLHA 2PURA 2QJIA 2AQWA 1AG1O 1R7OA 3UGVA 2VNCA 1HKKA 1EO7A 1HF6A 3O05A 2Z2UA 2E3ZA 4PRWA 1R9YA 2J9XA 3AXMA 1E5NA 3NQGA 1XLHA 5T9CE 3I65A 3PTDA 3ZOAA 1JCYA 3T7VA 1AD4A 1UQYA 1M7OA 3IANA 3ARSA 3M16A 3WD1A 1SR9A 1Z41A 1OFDA 1E71M 4O8RA 3VCNA 3RU6A 3CIWA 3VNZA 1EP3A 2OZ0A 4OTKA 2WZIA 3WDIA 3KL0A 3L4XA 3TOPA 2WSYA 5I06A 1AMYA 4O0KA 4BKNA 4CQ9A 1W5NA 2B7OA 9XIMA 1FHLA 2VXNA 1I45A 2Y7DA 3VNIA 2CETA 5JBDA 3GH7A 3ITLA 2AQVA 4M3PA 1Z7AA 1LZOA 4P2VA 1TX0A 3URAA 1HNYA 4K68A 4JKKA 2C1IA 4JAWA 1XI3A 1UD3A 4QTGA 4RK8A 4M56A 1W37A 2XFWA 1MNZA 1EYWA 1UWIA 5DT5A 3SCRA 2R8WA 3KCJA 3XISA 4R33A 1V6UA 2V5LA 3KZSA 3CMGA 3IK4A 1UKPA 4JY8A 2ONEA 1K8ZA 3CQHA 3N15A 4F40A 5A69A 1IEWA 3M6DA 4LQ1A 1NP0A 3GW0A 5E9AA 3AALA 4Z08A 1OFPA 4Y9AA 4HPNA 4UMCA 1H61A 1A5AA 3LBOA 5J5DA 1QASA 3NM3A 5CBJA 3BCJA 4B90A 2I7GA 4B5VA 1KRCC 3AI0A 4ZTYA 4LB3A 5I3KA 4I3GA 2BODX 3I6TA 4HU4A 1TELA 1ZL1A 1S3TC 4O52A 3VMPA 3WN6A 2NX1A 1FWBC 4GIYA 3PZOA 3ARUA 3M0JA 1VCGA 1BFNA 4L1GA 4O15A 4HJWA 4OGZA 4Z1YA 3NL6A 2GJPA 1WZAA 3M0IA 1GOKA 3KBNA 5A95A 4GLEA 1Q4WA 5E09A 3L4WA 3UESA 1NARA 1UUMA 1QNSA 4I5XA 1J6OA 4AZCB 2VTFA 4HG6B 4B2DD 4U4MA 3SN1A 4PEEA 1KTBA 1WQ5A 4KBXA 5CC3A 1YDOA 3AHXA 1UR0A 5AB3A 3AHYA 3NYDA 2ISFA 2JKEA 2DT1A 3I6EA 4WDXA 3DG6A 4EVZA 4LEFA 3AZSA 1XH1A 3HG4A 3BE7A 4IMDA 4JNZA 3ZSTA 3MO4A 4Q3MA 1FCUA 1FWCC 5HANA 1E40A 3VMNA 3A9IA 4HNVA 2AAAA 3VA8A 3SQLA 4I9AA 4ICCX 1M3UA 4EWJA 1C3FA 3KEHA 4AB4A 3IUIA 2XYLA 1DYSA 4CCEA 2WKLA 3DYOA 3BMWA 3L23A 4V27A 5E6YA 4RDYA 4FNTA 3GG7A 3UJ2A 4EXBA 1DBTA 4V33A 1UWAA 2ISWA 3CAWA 3FGCA 1QK2A 1CDGA 1UD8A 2VX7A 3ELFA 1N7KA 4XVDA 2UBPC 4F3HA 3FDGA 3VYLA 4FNPA 3UY8A 4MJZA 1B2YA 2ZRWA 3SCTA 1FVPA 2INFA 4KESA 3GD6A 3PN8A 4U2ZA 3EX6A 5HUOA 5HULA 4QCFA 3OP2A 4EPBC 3SGGA 1JDFA 1Q7QA 2I9UA 1U83A 3PANA 1XS2A 2BNJA 1K7FA 3LBMA 1W0MA 2XWEA 3M64A 5GPRA 2YB4A 3NTYA 2PLKA 4DYKA 3KOWA 3I3BA 1RLDA 4M6UA 2A3CA 4DJDD 4A22A 2WWCA 4DJFD 2HE5A 4Q4OA 1U5HA 1TPC1 2ZCGA 4WKAA 2NV1A 1KKOA 1ITQA 2PDYA 4U3CA 4DXVA 1XIFA 1BQGA 1ONEA 1TUFA 3MVIA 4EXQA 1CXLA 3TXZA 3HMJG 2WCGA 4OKDA 3L4ZA 3JW7A 3ARZA 1E9ZB 4XAPA 3ZLFA 3CAVA 2A79A 1SZGA 1TRDA 3T8LA 1O66A 3MI3A 2VOTA 1TPUA 2IPJA 4CD6A 1RQHA 1ODUA 1ADDA 3B06A 1KWKA 3H7VA 3MCNA 5DX7A 5JVLA 2E0PA 4H41A 4A3HA 4PMQA 1VPQA 1FWJC 4GI6A 3ARTA 2PRMA 1CECA 4BFAA 5IOBA 4O12A 2FIQA 1PWLA 3O63A 4F2UA 4IJRA 3IWPA 3GC2A 3N2BA 4R7WA 1ONXA 4WGXA 4KWOA 5IM51 4OV9A 3P5ZA 4RXGA 1AK5A 1K4GA 1JYNA 1XSKA 3BUVA 2ZXBA 3RILA 2GGEA 3ALGA 4ZQOA 3OGVA 4M51A 3FX4A 2FZDA 2XPKA 2TYSA 3C8NA 3PUOA 1C7SA 3LD5A 4PODA 4F9JA 1MVYA 3R12A 3OIHA 1DJGA 1IIHA 4POCA 1A49A 3LV6A 4LAUA 5HWNA 4WXZA 1P48A 5EGRA 1ICQA 3OBEA 3AAMA 1LLOA 1TE1A 2OLHA 3G1FA 1H7RA 3FV9A 2J74A 2WMHA 5K3VA 2D2HA 5LA2A 3GNPA 4LVBA 4HP5A 1TQXA 3PM6A 3IEBA 4ZQRA 1KB3A 1RQEA 3VDBA 4XQ6A 1RA5A 1OFOA 4O16A 3OODA 3QVQA 2D0GA 3TE9A 3NA8A 2P8CA 4AWUA 1ONWA 3RX2A 3A3WA 3M0VA 4FP1A 1KM5A 1R3TA 4RR4A 1WKDA 1YNQA 3LG3A 2FVLA 1QPQA 5CJ5A 1QI3A 1UKTA 3LA4A 3C6CA 3PAOA 4W7WA 3ZR5A 4IIHA 4JEJA 3L7RA 1UCWA 4HCLA 3LCWA 4JN7A 4AZ5A 1IZCA 2A3LA 3LS9A 3QH2A 2TAAA 3SJNA 3LQLA 2MUCA 4NNAA 4HHMA 1YXDA 5G4HC 3PNUA 1OF8A 1XRTA 2C1HA 5C5YA 5CSRA 1GZJA 2I56A 2Y63A 5B7ZA 2NVCA 1C93A 2Q6ZA 4JR5A 3O6DA 2FYMA 1OFRA 3LX9A 3TW6A 4YCPA 2ZVIA 1S5VA 1X1ZA 2PC8A 2FVKA 3IS4A 4IFKA 1I4NA 1UWQA 2FTPA 2HMCA 1TV7A 3R11A 1WKYA 1UPPA 4S3JA 2PF0A 4L9ZA 2GQAA 1XG4A 1J9YA 2RAGA 4KWVA 1H4PA 1P1XA 4O0ZA 5T91A 4PB5A 2YCEA 3Q45A 3EX1A 2SFPA 2OLAA 3N9SA 3CYJA 1O94A 1VF8A 1V0MA 5LXXA 4UFKA 3UPBA 2XHYA 4ZFMA 3EOOA 2PWVA 4NRSA 5F2MA 2WWDA 1E1EA 3SI9A 4MNMA 4IGMA 4MB5A 1VRXA 4JNMA 3CZJA 3W01A 2FZ8A 4YL2A 2ZDRA 1TJRA 1P6CA 3STCA 4UWMA 4IMAA 4P8VA 2BOGX 3U9IA 1LWJA 4ZL1A 1JAEA 4B91A 4DYEA 1BYCA 1JRCA 4U5KA 1HL2A 4E5TA 5KINA 1V3IA 3FXYA 4ZCWA 2FZNA 3PZQA 3UNTA 2QF8A 3ZLHA 1T8QA 2O9TA 2WJFA 2WMIB 2VR5A 1JXKA 2QDEA 2J8TA 2ZYFA 4EPEC 4LRTA 1JI1A 4B5NA 1IZJA 3PZNA 5CPLA 3GH5A 1TCDA 2V38A 1U5JA 1OX6A 4A3UA 3V3WA 3W7CA 3K2GA 1Y0EA 1TWSA 4NZ4A 1WNOA 5T8GA 3HGSA 3T0CA 2FH6A 4JFSA 3KBVA 4L65A 1NOWA 2V3FA 3GO2A 4UCFA 4AW7A 5I0DA 1OCNA 1JQXA 4IIGA 4JBRA 3RUBL 1LL4A 2PU1A 1IWAA 4MLRA 5CCZA 1ONRA 1RUSA 3V36A 3TAKA 3OJGA 3OHMB 4QJ3B 1OVDA 2J62A 1F61A 4JPGA 4ORIA 3H2AA 2GSEA 2IKGA 2HPMA 5ECVA 3VMOA 3LMZA 2A7NA 3C2VA 3AJXA 4NAEB 3LPGA 2V5JA 2PDMA 5F2LA 3CWHA 3QZ6A 3QZAA 4BQ2A 1WDWA 4EPKA 4ZOEA 3N2CA 4FXFA 1RP9A 1CB2A 3KTXA 5HQLA 3UVAA 4MWAE 2Y6ZA 4KW2A 4CU6A 1HKIA 1HO1A 5JU6A 1TPDA 4O53A 3AMGA 3BLEA 3TTOA 3VK5A 3WQOA 3DN5A 3LUTA 4UTTC 2V2CA 2OLSA 3SSJA 1G01A 1GQJA 1VPYA 3TU9A 1JZ6A 2VEFA 3TN3A 1XLJA 3LTYA 3WLTA 3T40A 3CZGA 2QYGA 1FFQA 3UA3A 3RR1A 3QHNA 2FGLA 5GQBA 3RMJA 3Q4DA 3SO7A 3PBUA 4CNSA 2QHAA 1B3WA 1JUKA 1VKFA 1I60A 1PHQA 4QDMA 1PJ9A 4X22A 3HPXA 4C6IA 4TMCA 2IW0A 4YVPA 4NYUA 3U2ZA 3VIMA 3DG7A 3EOEA 4GZEA 1WE5A 1GHRA 3AIRA 5XINA 4JTSA 3WQVA 2OOFA 4J7RA 2BY0A 1Q6QA 3S46A 4O28A 5CBBA 1RPXA 5A5WA 3MI6A 1KGUA 1I2NA 2ZDSA 3PAJA 4TO8A 9CGTA 5F4SA 2GZXA 3AYRA 2IUZA 4Q8QA 1EWEA 1ICPA 1LM1A 5AHIA 4GVFA 4WUIA 1O1HA 2Z6IA 3APYA 1UWRA 5JIPA 3IV3A 4HNTA 4GUIA 3U7VA 1WX0A 3B05A 3IIVA 3UWYA 4IUGA 3FNDA 3FFSA 4GQQA 4UTIA 1Q6OA 2DEPA 4KCWA 5F1UA 4OV4A 1EDGA 1NSJA 1TZZA 4Z1DA 4NHVA 2Z1BA 3NSNA 3SY8A 5CAHA 3P74A 4X9YA 3W2MA 3V0TA 3BK0A 4GYPA 3RMEA 4HPGA 5GJNA 1TPH1 3KWXA 3WQDA 2FTYA 2CXGA 3T6CA 2E6AA 3NO5A 2JKPA 4LYRA 5EJZB 1GKQA 3E96A 1W9VA 5HJYA 4GX9A 3ALFA 4GG9A 2VC9A 1DORA 1WDRA 2EKCA 3TYUA 3FAWA 3SUVA 1J5TA 1FWGC 3RM8A 1XYAA 1M5WA 2HK0A 3SADA 1XC4A 1K02A 2IXVA 3NL2A 2PDWA 1IE7C 4QP0A 3KL5A 1Q6CA 4PSPA 3CASA 2RJGA 4MKSA 3VNYA 4AC7C 4HHPA 2BBFA 4DM1A 3TR9A 1G7UA 3E12A 2Y89A 3AOFA 3G22A 1ZAJA 5BOEA 1YDNA 5G1TA 3ITYA 5AECA 3H53A 3WH7A 4GY0A 2WXDM 2VUNA 2XH7A 2MNRA 4U3AA 4D8LA 4P00B 3DDMA 4ZOAA 2EJ1A 3NPXA 1ZALA 1E70M 2XVLA 1SVDA 1AJZA 1GTHA 2V0TA 3UVIA 4K38A 1RQBA 4PUDA 4HVXA 2X0SA 3S9YA 2ZZ5A 4R53A 3P81A 4ECLA 3HPZA 3MHUA 3T0DA 2QCGA 4A3YA 3DZ1A 3UZ5A 2O9RA 3B0XA 3VOFA 3W27A 4LVFA 4DVOA 5CXPA 3A13A 3DHUA 3ABXA 1LLWA 1NAL1 3S8HA 2GVJA 3QV8A 2XZ7A 4L64A 4OE7A 1IF2A 7REQA 3DFHA 2QZRA 1I2RA 3EB3A 4IISA 2ZBTA 4MF4A 3O6AA 1EIXA 1WCGA 2VKZG 5E93A 3WBAA 4Y96A 2ZRYA 1T7LA 2J7CA 3CL8A 5HDRA 2VO5A 2O4MA 3GAKA 4UR8A 1ZRQA 1EA0A 4LUSA 1WZKA 3KCOA 1S2VA 3RK8A 1NF0A 2QXWA 3TNBA 5D09A 3BLDA 3A3XA 1LWIA 4DZAA 2PLCA 1VHNA 2X1RA 2C0AA 2QV5A 4GYPC 3HQNA 3QTGA 1Z9AA 3WFZA 4A2RA 2QR6A 1E51A 2GYIA 1Q6GA 4IMEA 4G7EB 2DY3A 1US3A 3DG3A 3UGRA 4KKXA 3GYEA 3GXDA 1TREA 4W7VA 4HU0A 3QFEA 2ZRVA 1RK5A 5TF0A 1Q66A 3IGHX 1HUVA 1MXSA 3EXRA 3RXZA 1GW9A 1H7OA 2QW5A 3VC6A 1TPWA 1FWDC 1FWFC 4WEVX 1P43A 2E5BA 3U2CA 2CERA 4XD4A 3W7DA 3CUFA 1M65A 2Z28A 2ZOXA 1GQNA 4PL1A 4GZIA 4TU1A 3KLKA 1K3UA 4L56A 1ODZA 4C90A 3UFYA 2OT1A 2WW5A 3PTKA 4D6JA 1BKSA 1LJYA 1PV8A 4FNRA 1S5NA 1B4KA 1GZGA 2PCEA 4WJ8A 3INPA 4LVGA 4IG2A 1JG9A 4J3WA 4XO6A 4GKLA 4H04A 1NM9A 1GOQA 4IPIA 2EHHA 4NZFA 4BF9A 5LHFA 2DVUA 4M1BA 4S39A 3G2GA 2EG8A 2R1NA 4G5DA 2GOUA 3IJDA 1H3GA 2GVGA 5FAGA 3GR4A 2B81A 3HPAA 4US6A 3ARWA 4DUOA 4M6PA 1RCQA 2YFOA 3RPTA 3B9AA 2ZA1A 1W1YA 3S4TA 3REQA 4ZENA 3G0UA 3USBA 5AYYA 1OSEA 4IPJA 3DHFA 4KFOA 1GOIA 5DEZA 1JPMA 1Q3NA 2V2DA 4AFYA 1FH8A 3R1ZA 1ZJHA 4NILA 4ZE4A 1MRAA 3TWAA 1KGWA 4REQA 4GUHA 5A6SA 4JHOA 3U6WA 3B3DA 3S0CA 2P0OA 2W61A 3GX9A 1QK0A 1EJRC 1IWPA 5I24A 3TTSA 2CYGA 3RLUA 2Q02A 3VNLA 1L9WA 3K4WA 3MSYA 4L80A 5A2CA 4YN5A 4O1CA 5GNYA 2E9MA 4K36A 1AD1A 4GQBA 2GGHA 1I2OA 3ZFHA 5DXYA 3N9RA 1VIZA 3A21A 2Z2BA 2O9OA 2Z1SA 2PDXA 2Z27A 3WNLA 3M44A 1B30A 4L4LA 4Q4MA 5C9WA 1SFTA 3S1VA 3SN0A 1ZENA 2BASA 3NDYA 1FWNA 2W79A 1V03A 3BQ6A 5CGQA 1UR8A 3B8WA 3L67A 2ICSA 1ZNNA 1V3KA 3GDKA 3RO8A 1K8CA 3VKDA 1PZ1A 3A6OA 1HZYA 4GJ1A 5BROA 1PTGA 3W7HA 4WKFA 3CXOA 1TPB1 5I02A 3FLUA 4GY1A 2WVUA 4DF1A 4LPCA 1HKVA 5E9XA 5JBEA 1XYZA 4CN1A 1H1ZA 3MUIA 1PO9A 4JTUA 1TTJA 2OEKA 2W6RA 1E0VA 5HJLA 1IIGA 2NQHA 1HFBA 4YYFA 1OX4A 3LOTA 1CYGA 3V5OA 1P0BA 3FCPA 3NM1A 2R94A 1J6PA 3NOYA 4NY2A 1NF7A 2CLOA 1X6NA 3G1SA 4FX6M 4I9JA 4NAFA 4AWEA 4R3UA 1Q6LA 1XLEA 4WSHA 3WQ6A 1I8JA 1W2VA 1PZ2A 4DBDA 1KRMA 4ZB2A 2C71A 1DXIA 3MA8A 4WF7A 3T2QA 3W7PA 4J3ZA 1TRIA 4D72A 2CBVA 1T40A 3NUKA 5TD4A 1HO4A 4B15A 4MOZA 3PWGA 4H6EA 5DANA 1ZHAA 1DQWA 1XHGA 1L8PA 2OX1A 3EWZA 3THQA 3L4TA 1QPNA 1W9UA 1BWVA 4HA0A 2CLFA 3OVPA 2YDAA 2Z2AA 4A05A 5A94A 4QBXA 1VEOA 2A6LA 2WCSA 3FEMA 3OTRA 1A5NC 4BHYA 4DHGA 2A3AA 2H6RA 1QBAA 7CGTA 3WELA 3L65A 4ERIA 2GSHA 2DZAA 3C0QA 1NQ6A 2J7EA 2VGBA 1FCQA 1M7JA 3G18A 1Q45A 2BLEA 1EHNA 1K7XA 2WSKA 3PZVA 2G95A 5A8OA 3ITTA 4XAYA 4FK9A 2VX5A 1SZRA 1XCFA 2CU0A 2OR2A 1VFFA 2PTDA 4MUPA 4HNOA 2DSKA 4OQVA 3CO4A 5IBXA 3CUJA 2YA1A 3OQEA 1IZKA 3LRMA 2NX9A 3W1AA 1JEZA 3VIOA 2VRJA 3G1HA 7ODCA 4JX5A 3T0BA 5H8MA 3OO2A 1XW8A 2D0HA 4L4OA 2O7QA 4I9MA 3A5FA 3W6MA 4UR7A 1C9DA 3BZJA 1HT6A 2ACRA 2DW7A 3P0XA 3WJZA 4EAYA 1RD6A 2FMNA 4I9TA 3GY1A 2X7VA 5CGMA 3DI1A 3USZA 1F5ZA 1OCQA 4GVIA 2TODA 1A4LA 3V35A 3WK2A 4X63A 5FJTA 3OA3A 1JD9A 1B3YA 1CGTA 3VNDA 3GDLA 3FIGA 1W1ZA 3HQPA 1LROA 1J0YA 5LSMA 4RZ5A 1MO0A 5FEWA 4J9JA 2ASHA 1GZ1A 1Z42A 1F6KA 2HDJA 1W9XA 3GTXA 2QJHA 2GK1B 1O60A 1AW5A 2F6KA 3QSRA 2ZE0A 1XIJA 1YXCA 4E8DA 1BF2A 5E0KA 3BAXA 5IDZA 1TJ0A 4V1YA 2PA6A 3FSTA 4UZSA 2QCLA 1QO2A 1KCKA 2VEKA 2ZZ1A 3G3MA 3R7MA 4JTAA 1PCWA 4HZMA 4EOUA 2ZQ0A 2VCAA 4YJ5A 3W82A 2PDHA 2DV0A 3E0WA 4ZBCA 1N8WA 3WQFA 3VTRA 2P8BA 4TV6A 2G3MA 3AXXA 4H6KA 3LI1A 2W4XA 1SZFA 4D8ZA 2UWFA 1CGXA 1UMLA 1K9TA 4J2PA 3QMRA 2P10A 1VR6A 2P1FA 2VEPA 4NX0A 5C70A 4FMVA 1GJWA 3LLDA 2KX9A 1KXHA 5EYWA 1ZFJA 4RNFA 1JZ2A 4UBPC 1NP2A 3OW1A 2VRQA 2QLYA 3P2VA 3SCUA 4MJMA 4QS6A 3P80A 3VDCA 3G1RA 4UFMA 4G8TA 1ZBVA 3CNYA 2BB0A 4WJXA 3U2EA 3QEZA 4C1NA 4JN8A 1M04A 1P0KA 1QBBA 3GWQA 8XIMA 1XLKA 3I3EA 1T5AA 4MPKA 4HPHA 2OB3A 4JIEA 5JH1A 1VJZA 4XIMA 4D1IA 3CL7A 4GYKA 1R2SA 3SRDA 4NJGA 5CLWA 4M29A 4C6JA 4JFUA 4HU3A 1GT8A 3HV9A 1EJ7L 3T78A 4AD0A 5G1MA 3PPCA 3C2RA 4GGBA 5BNKA 1SZNA 3S1GA 2WHMA 2DIJA 1PZ3A 2QF7A 2XN1A 1B90A 4GCAA 2IPFA 3UXIA 2Y24A 5CJNA 5A8NA 3N4FA 3TYAA 3C52A 3NPVA 2Q71A 4WY0A 1CXFA 2E6FA 2XWDA 5ABHA 2HXTA 1TPEA 1A4MA 4AY8A 3OVRA 3QZEA 4J2MA 4JS3A 3AIQA 3VIPA 4H8UA 4TVUA 1A5KC 3POCA 3ITOA 2P88A 5AC5A 3CT7A 1U2YA 1JCTA 1J0HA 3GC4A 1VEMA 3CV1A 2V30A 2V63A 3KDNA 4E2OA 3PK7A 1A53A 3DEQA 3UERA 4DY1A 3J7HA 4LUTB 3T81A 4U10A 1DXFA 4M80A 1AH3A 2PWHA 3NZGA 3E2QA 3MKVA 4KS0A 4BR1A 2HVOA 3ABQA 1AJ0A 3GU9A 1J96A 3BLIA 3JR2A 3SW6A 1ENUA 1E1FA 4DQWA 4PFMA 2NUXA 3PUEA 3AYTA 5AC4A 2CLEA 1IEQA 4D6HA 3NFUA 1V0LA 3GBEA 1YMYA 4JQ4A 1TTPA 1ZS2A 4MNKA 7A3HA 4ML4A 1EJTC 2ZZ7A 4QEHA 4JQ2A 4IPPA 1GYNA 4JYDA 4F79A 3F4WA 1NFGA 5KZEA 3T44A 3BICA 3NQBA 3SUUA 4MVAA 5HR6A 3W7IA 4LYKA 1EOMA 3MHGA 1EIBA 4DLFA 1JJKA 3KOZA 1OJXA 2H9AA 4Q4PA 1DJZA 2BXYA 6A3HA 3ITCA 4E3TA 3RCYA 3TEVA 3TJLA 3SEPA 4IP7A 3S2MA 4DBWA 1KV5A 4M7SA 1UJQA 3CL6A 3NXFA 4FOUA 4YVXA 2RH9A 2OCZA 4U31A 1JI2A 3WQEA 2A1YA 2FMOA 4GC4A 5AHMA 5BOFA 1PIIA 2E77A 1KTCA 3H7RA 1ZLPA 3E49A 3U5YA 1KCLA 3R13A 5M2FX 1NOUA 4S2BA 3AHTA 4BQ4A 1UUOA 2JQXA 4ZQPA 4BI6A 3FJ6A 4W5UA 2O55A 4WK9A 2A0NA 3T42A 1YW1A 1N8FA 2NT1A 1TJPA 3W2NA 4ACZB 4H3DA 3F1QA 5KZMA 1P0EA 1S46A 5EBUA 1FFRA 4HBKA 5HPCA 4DWSB 2Z7KA 5JUVA 2OXNA 2V6AA 1XGZA 2JE8A 4RE3A 5FAJA 3SRFA 4UQCA 1OK6A 1J8VA 1A0EA 3TQPA 1I1XA 3QJAA 5JBFA 3CPUA 2CW6A 4B5WA 4HNNA 3BOXA 1R6WA 1E6RA 6REQB 3EXTA 1R7AA 4AQLA 2VHLA 1BXCA 3A64A 2FPYA 2FHBA 1EX1A 1EUAA 1MQPA 1MDRA 3FY1A 4LOCA 1WKFA 1TVPA 3S9ZA 1QUMA 3TN5A 2TSYA 1SJCA 3F4NA 4JCLA 3ZQ9A 2DT3A 1YADA 1JYVA 2GDQA 3SGZA 3UXAA 3GM8A 1E4NA 2QQ6A 3QLDA 3QF0A 1WBJA 2Y8VA 3G24A 3H23A 3DYPA 1S2CA 2O7SA 3NWRA 4C65A 4LUSB 2F9RA 3XINA 3P14A 4H4IA 2DT0A 1EL3A 3MP4A 1KGXA 3MT1A 5CPQA 3UY7A 1E56A 2FHCA 2PMQA 2HNEA 1M41A 1GYMA 5MKGA 1H7XA 4B5UA 5DO8A 4IMFA 3AS0A 3NVTA 4PB4A 3QR0A 1PDYA 4H9YA 1SJBA 3PBGA 4JL1A 1EC8A 4J5NA 3URBA 4CQCA 2JIEA 5DCEA 1A80A 2GJXA 3BGAA 4EP8C 1S38A 1SM9A 2NQZA 2E1WA 2YLLA 4AZ7A 1SQ7A 4AH7A 5BCAA 1E3ZA 2QCFA 1LBMA 2Z4GA 3FJNA 3MV11 3TKFA 4HTBA 3CQKA 1ZP4A 5HPOA 1P1MA 3AMLA 4LSBA 3F2CA 4NT0A 5D2XA 5E5CA 3LLXA 2VENA 1WP6A 3M0XA 1Q63A 5HK4A 2W9MA 3PB0A 3CAQA 2J75A 4Z17A 3CUHA 3QOMA 1A47A 2Y7GA 1AL8A 3QQ1A 3F5JA 1VBJA 1FTXA 1VFHA 3O07A 4DBUA 2I57A 4H8NA 2ZUSA 4IG2B 4YVVA 4NNBA 1X98A 1GK8A 1H1NA 1FKWA 1DTUA 2V3DA 1LUCA 5AVHA 2E6YA 2X41A 1YHTA 1RY8A 1QPOA 4EIVA 2ON3A 2FPVA 3K8MA 3QV6A 3LCGA 3HG2A 1CXHA 1E1CB 5K9DA 1AQFA 1FP9A 4ZO6A 3WY1A 3AO0A 4JDBA 2PZNA 7TIMA 3REQB 3WD3A 4PMNA 5CLTA 3LY0A 3GTNA 1PCKA 1MQQA 2DZPA 5H1WA 1J10A 4F2BA 3CUIA 1C92A 1KXQA 4NZ5A 1RY0A 1QHPA 3GXIA 1MW1A 5FESA 4XKYA 4PGLA 1J01A 3GVGA 3STFA 2XH2A 3PUGA 3LHVA 2EJAA 4Z2IA 3VKAA 4XZBA 2OWWA 4NUWA 3I68A 4HPXA 1PDZA 4AHQA 4X9SA 5HNTA 4NX5A 3NAVA 1D3CA 3ZR6A 2XVGA 1XICA 2JIWA 4HTYA 3G77A 1SO6A 3EX2A 3W4RA 4A4AA 3IJ7A 1E9YB 4DO4A 4C7FA 4XG1A 4Q8WA 3DIPA 2V9DA 3CK5A 4K8EA 1Z32X 1LRQA 2V5KA 1OC7A 1N82A 3D3FA 3S5OA 3UXKA 3W25A 1X7IA 1RVGA 4XV0A 2A6NA 4UNIA 3LPFA 4F0SA 3W02A 4A21A 5KTLA 2D69A 3PBWA 1CTNA 2YDQA 3TV8A 1LTDA 1JPDX 4FA3A 3AFBA 3KP1A 3HURA 2INEA 1X1OA 2ALRA 4Q7BA 2YSWA 1AMKA 3SRHA 1ZZMA 1IQ8A 3Q65A 2D2GA 4WJEA 5A6MA 1LDCA 3U8GA 5HQEA 3WFLA 2REQB 1TWDA 3BSMA 3CJPA 1JZ5A 2BFGA 5ABEA 1CCWB 1LBFA 1IEVA 5A6AA 4RDWA 1V93A 2VP8A 3RF9A 3PBMA 3W1MA 1WAUA 1HXJA 2VFEA