1L8NA

The 1.5a crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1, complexed with 4-o-methyl-glucuronic acid and xylotriose
Total Genus 278
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
278
sequence length
675
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRWWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-D-GLUCURONIDASE
publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 278
structure length 671
sequence length 675
ec nomenclature ec 3.2.1.139: Alpha-glucuronidase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1l8nA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1l8nA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1l8nA03
1OGBA 2VX7A 1R7OA 5HPCA 1WB0A 3N04A 4CD8A 1J0YA 2VX5A 1GJWA 2VCCA 2D23A 1UUQA 3TA9A 4XB3A 5A8NA 1Y7VA 1ECEA 3WEMA 2J7DA 2DIJA 4PMQA 3U5UA 1J11A 2ZX7A 1RH9A 4DWSC 2JFEX 3AZTA 3WMBA 3WD1A 3ARVA 3AICA 4J3UA 5I5RA 1ZS2A 1WZLA 1IZKA 3D5HA 1V6WA 1W1PA 2ZICA 4E8DA 2V3GA 3OGRA 5E70A 2FDMA 5KZ6A 1V08A 3PZ9A 3JUGA 1GPFA 4BQ3A 4CN1A 2V5DA 2YBTA 1K9FA 1EHAA 1EO5A 2XVKA 3GH5A 1DHKA 1CXLA 3BAKA 4JL1A 2O9TA 8CGTA 3DYPA 3WDPP 4UTFA 1MQRA 2J47A 4AD5A 4EE9A 5A8QA 1W1TA 2J77A 4LYQA 1GHSA 5GQBA 3L4WA 3WH6A 3WFZA 3F5KA 2QPSA 2WKLA 3W0KA 3MANA 3WBEA 2V3DA 2XWEA 2WHKA 3ARZA 5IFTA 4W8BA 4JCMA 4JIEA 3WF0A 4PTVA 2EO7A 1QVBA 3ZT5A 1K9TA 4AZIA 4H04A 5A1AA 2ZUSA 1LL4A 4OJYA 2CETA 2G8ZA 1WO2A 3WEZA 5FCZA 2VZUA 4Y7EA 4ZXLA 5CZKA 4MAZA 1V03A 1CLXA 4QCEA 4PMZA 3WF1A 2G41A 1UWSA 3BAYA 4HZ7A 2WMIA 1E6ZA 4GO9A 1C7SA 1FA2A 3UR8A 4H8VA 1QBBA 1E9LA 3CMGA 4XZWA 2PWEA 1E1FA 2WSPA 5LYRA 3UETA 3B9DA 4QP0A 3K8LA 1TFVA 5M17A 1M03A 3SCNA 4MTVA 2ZUVA 3ZO9A 3NIYA 1UD5A 2DT0A 4QAWA 3NDYA 1XSIA 4CU7A 3NYDA 2Z1KA 1UQZA 2FHBA 1B3ZA 1ISVA 1RP8A 4M56A 2X1IA 2ZXAA 4W5UA 1H0IA 1ODZA 4JKLA 4KGLA 1VEPA 1OGGA 2WLZA 3ARTA 1X6LA 3K8MA 3ZR6A 3O6AA 5HNNA 3T2PA 4E2OA 1E4MM 3BAXA 4R27A 3EBVA 4UNIA 1OB0A 2GFTA 2FHFA 3W37A 2YL6A 3ZM8A 4LGXA 3VDAA 2VO5A 1HKKA 2YKKA 5HXMA 5LA1A 1PZ2A 5I3DA 2NT0A 4PUDA 2YDQA 4GI8A 1V3HA 1TA3B 3RJXA 1GZJA 1XH1A 2XGIA 1JFHA 2XM1A 3AIBA 1UYQA 3THCA 2W91A 3NCOA 1BHGA 1NH6A 2GK1A 4UFIA 1W9VA 3HJEA 5A8PA 2WAGA 1GQJA 2A3BA 2VZTA 3VM5A 1OM0A 4XX6A 3CO4A 4XV0A 4AEFA 1CENA 2EEXA 1E71M 1VENA 3NDZA 4RE4A 4CGTA 4N42A 3WH8A 3TOPA 2GJRA 1D2KA 4WSKA 1CBGA 3EDEA 1Q6EA 2WMFA 5D9NA 5A94A 1FHDA 4MDPA 3K46A 1E3ZA 1EDGA 1KGWA 2ZIDA 1SYTA 1IZJA 3CHFA 1HIZA 2BV9A 5A6AA 3RCNA 2J7CA 6A3HA 1JZ3A 5A6MA 2YOCA 3EMQA 4TVUA 2ZX9A 4KGJA 5BWFA 2X0HA 3VDBA 3AOFA 2FGLA 1J18A 4Q7NA 4B3KA 2D0FA 5M03A 3CPUA 2J78A 1QW9A 1V02A 2VUYA 4J3VA 1L8NA 1HJSA 1E3XA 5EB8A 4M8UA 5DO8A 3EMZA 2ZX5A 3WQWA 1KXQA 1QNPA 4C90A 2VJXA 2PWFA 4JFTA 1QBAA 5D8ZA 3W38A 1ZL1A 2WCSA 1JXKA 1ZBVA 2DPEA 3ALGA 3SCOA 1W3KA 2W4XA 3AROA 3DHPA 4FMVA 4EKJA 1W91A 5EFFA 3VPLA 4FLQA 3VMPA 1VEOA 2EPKX 3PZUA 4J3WA 2O9RA 4XUYA 3VMOA 5C70A 1U2YA 1S46A 1BYBA 1CWYA 3T0BA 2VT0A 5IHRA 1AQ0A 3CHDA 4WK9A 1B1YA 2E3ZA 4FLOA 2BFGA 1GOOA 1RD6A 1BYAA 2JF7A 2XJ7A 5CGTA 2QF8A 3J7HA 3WUBA 1M04A 3W27A 4OKDA 1HXJA 2J25A 2XVNA 4J28A 4QLLA 3QGVA 2XPKA 3OLEA 3AIRA 2DGAA 3NSMA 1GOWA 2YA1A 4UQEA 1CIUA 2W92A 3BH4A 2D3NA 3MKKA 2WHLA 5I77A 4CD4A 1GHRA 3S2CA 4MJ4A 4PMYA 1KXTA 1P6WA 2E8YA 3BMVA 4TOQA 3OLGA 1CPUA 1VFOA 4AZGA 1ODUA 2OLHA 3WDQA 1QI0A 1HL9A 1W3HA 2Q8XA 2WMJA 3B9EA 3N11A 5ABEA 1LF1A 1Q6CA 1XYFA 4CD6A 3RM4A 4P7NA 1LL7A 5BRPA 3VX0A 3D3AA 1OIMA 4KMQA 2QLYA 3ZJKA 1CGYA 1UWRA 3AXHA 2J75A 1H41A 1L0PA 4E4PA 3WF2A 2ZOXA 4A4AA 2X2YA 1OBAA 3WEOA 3BAWA 1PX3A 3W25A 3BSHA 5AC4A 4TTGA 3VMNA 4PBGA 2UY2A 4PUEA 3A47A 1W3LA 3GXMA 2EPLX 2GDUA 5A3HA 4U5KA 4HZ6A 5CSYA 1HJVA 3WDJA 4FK9A 4AZCB 3PZMA 3BCDA 1QHPA 3RIKA 1E72M 2PWDA 1EO7A 5BYWA 2WC3A 2VC9A 4Z2JA 1G1YA 4UZUA 5FIPA 4MB4A 2AMGA 2OYLA 4KRUA 4B9YA 3SIMA 3CUGA 4IISA 5EBAA 3TTQA 1D3CA 1W32A 4BZYA 3UCQA 2WHMA 2PF0A 4Z2LA 3EDFA 4BQ4A 4PRWA 4DUVA 2GUYA 2BVTA 3FAWA 4ZE4A 2EPNA 3UG5A 1DWAM 2YA0A 3UERA 4P8UA 2WMKA 4JZ5A 2D2OA 3CZGA 1C7TA 3MUAA 2XTKA 2XIBA 3EDDA 2V3FA 4CN6A 1X1NA 1BAGA 4PSPA 3O2LA 2G3JA 4CCCA 4CU6A 1ITXA 1V3JA 3CH9A 1MW0A 2UY5A 4HOWA 4UQAA 1JDAA 1BSIA 2DEPA 1XH2A 3AYSA 3AXIA 4TX6A 1JYWA 3WNPA 2E9MA 2WMGA 2ZXBA 1JDDA 3VGBA 3QHOA 4AIEA 3AHTA 4X0NA 4PMUA 1F4AA 4OOZA 3WL1A 4WKHA 3AMCA 1A47A 4OOUA 3VD4A 2CITA 2CBUA 2WC7A 4IPNB 3BAJA 3SUWA 1IT0A 1NOWA 2BXYA 2E0PA 4AD1A 3QOMA 5I6SA 2BS9A 4D6FA 2G3MA 3OB8A 1XHGA 2ZX8A 3IJ7A 1B0IA 1EGZA 1UR0A 4BA0A 3PTKA 1FH9A 2CHNA 2WANA 1Q6FA 3BC9A 5A8MA 1QPKA 2BY3A 2BHUA 4BS0A 3PN8A 1UH3A 3U57A 4P7QA 1HJQA 2YDSA 3ZMRA 2PWGA 5CXPA 5A6JA 1GCYA 2IXVA 1CTNA 2UWFA 4CVWA 1GW1A 1KGXA 1QNQA 3PZGA 4HP5A 2OSWA 3WUFA 1TG7A 3SUVA 1BVZA 3E1F1 1C8YA 3N9KA 3WD3A 1OCQA 2WWCA 4UCFA 4M1RA 3NSNA 1JI2A 2Y8KA 1WDQA 3VM7A 2VR5A 1FHLA 5ABFB 3BLPX 1BG4A 3CMJA 3VIKA 2JIEA 3WD0A 3AS3A 2VZVA 2XG9A 3N15A 3KL5A 2FGZA 1E6NA 3VU2A 3WMCA 4ATWA 1OSEA 4QLJA 4HOZA 1CGXA 4HOXA 4BF7A 1MYRA 3SURA 1CXHA 2WCGA 4AD3A 5E0FA 5A2AA 1UKSA 2FHCA 3WDHA 2BNJA 3GXFA 3RMEA 2BVYA 3BGAA 4W7UA 1J0KA 2JE8A 5FL1A 1B3YA 4J7RA 1EOMA 3POHA 1KR1A 2EXOA 3OZOA 4D6GA 3MMDA 1E5NA 1MQQA 5I2UA 1JNEA 1XC6A 1NOFA 1W2PA 4TXEA 1W1VA 4A3YA 4M81A 1HJUA 1JG9A 2J7FA 3AXXA 1Q6DA 2YL8A 1WP6A 4UR9A 4S3JA 2QPUA 3SCRA 4PEEA 5I78A 1BG9A 2WMHA 3LMYA 4HPHA 4TVCA 3VKKA 3GTNA 1EH9A 3CZEA 3ZT7A 3DHUA 4C91A 2J8FA 1QI4A 1LG1A 5A6SA 2WNWA 1J0HA 1UWIA 4B16A 1XH0A 3AHYA 1J12A 3PZVA 3AS1A 2XWDA 3DYMA 1SMDA 1V6YA 2Y2WA 1GOQA 2VCBA 1HT6A 4AYSA 1K6AA 3ZOAA 6CGTA 3TTSA 2DSKA 3N17A 1ZU8A 4L4OA 3WH7A 3OIHA 3VIHA 1Q4NX 3TP4A 4EK7A 1GUVA 3IJ8A 3VIGA 1J0IA 1B9ZA 4P7OA 3PZNA 4AWEA 4CUCA 4MNJA 4FLSA 1R85A 4B15A 2A3EA 2YBUA 1TA3A 3M6DA 2YLAA 3MSDA 4GO8A 1E56A 3L4ZA 3AIVA 5A2BA 3WD4A 2O9OA 2WVSA 1BGGA 2W5FA 4D71A 2V3EA 3UESA 3RM9A 4AISA 1H2JA 5GNYA 1AVAA 4WKFA 1V3LA 1MXGA 1W9DM 4WLCA 2CERA 4BCEA 3WNOA 4F79A 2C7FA 4YHEA 2F8QA 1CDGA 3SCPA 4Q22A 2HISA 2BHYA 2XSBA 3VGEA 3A3HA 1JNDA 1UA3A 1JXJA 1N82A 5CPQA 3WUEA 1IV8A 4PTWA 1EOKA 2HVMA 3MO4A 3KL3A 2BY2A 1K9EA 4YN5A 1E6RA 2XVLA 1R87A 3WFLA 3VIJA 3AHVA 2NW0A 1M53A 2OSXA 1H3GA 4TTUA 4JL2A 2OSYA 3KL0A 1PIGA 2ZE0A 4P7LA 1KWKA 1XCXA 2TAAA 4A3HA 2WBGA 1GJUA 3W6LA 4NF7A 2FH6A 4H41A 1GVIA 2O9PA 2Y4SA 1JD7A 4JAWA 3WH5A 1V0KA 4GKLA 4UQCA 1UD6A 5AC5A 4AEEA 1US2A 1NWSA 3W28A 1WDSA 1PJ9A 1UD2A 2WYSA 1H49A 1GNXA 5CSUA 1E4LA 2Z1SA 4MB5A 3VTRA 1EIBA 1G5AA 3AYRA 3TONA 4F66A 5GNZA 2BY0A 3QHNA 5FL0A 1HJWA 3ZIZA 3QR3A 4JFVA 4K68A 3PTQA 4UOQA 2W66A 2GJXB 5BXTA 4CD5A 1JZ7A 2J62A 2UY4A 3K1DA 4M82A 1B3XA 3UG3A 1GQIA 1KQYA 5JBDA 1KQZA 1NP2A 3LPPA 4GPNA 4IM4A 3I3BA 1VF8A 3FN9A 1UKPA 1JF6A 1ESWA 2CBJA 2ZUNA 1TZ7A 3EDKA 1E6SM 4GZIA 1HJXA 1VEMA 3N18A 4NSBA 2IUZA 2VVNA 1UWUA 5BCAA 1QNRA 4X0VA 1AMYA 4MNMA 1V6UA 2EJ1A 4E8CA 4W87A 5C8BB 3AISA 4W8AA 1ZBCA 3ARYA 4JFSA 1VB9A 3AIWA 2ZUMA 4FF5A 1UH2A 4C7GA 2QMJA 2GDVA 1E0XA 1JYNA 3ARPA 5CJ5A 1CECA 3FAXA 4QCFA 1H4PA 2J7GA 3HN3A 3ZT6A 3CUIA 3VO0A 1MW3A 2W63A 1ISXA 3K8KA 4PMDA 1NWTA 2XFYA 3VIIA 7TAAA 3AS2A 3RDKA 3BXWA 1NQ6A 5LA2A 4ACZB 1G9HA 4NRRA 3GNOA 4PMXA 1KXVA 3VIPA 1VRXA 1US3A 4EAMA 1NWRA 3WELA 1QI2A 3T2QA 1VBRA 2PBOA 1EHNA 4PMOA 3VD7A 3ARSA 4MB3A 3N1AA 1GVYA 2B31A 2ZUUA 1UR4A 2VQUA 3BAIA 3WSUA 1W3JA 2DIEA 4AZCA 3FHQA 1E6XM 1C92A 4PCTA 1AQHA 2OYKA 4CCEA 3VD3A 3WDIA 2IXUA 1KCLA 1B3WA 5FKYA 1EA9C 4BQ5A 3HMCA 1HKIA 2E40A 4V2XA 2VRQA 3HU7A 5E6YA 3T09A 2O92A 2WB5A 1V6XA 3PZIA 1DTUA 2E8ZA 3T2OA 4M80A 4X9YA 1UKQA 3ZQ9A 1J0ZA 2WSKA 1HKMA 3MMWA 2E9BA 3VIFA 3WNNA 3CTTA 2GVYA 3ZSSA 4JCLA 4HMDA 2VVSA 1UA7A 4D6HA 3FHAA 5JBEA 3VUPA 1UD4A 4JKMA 1FOBA 4GZEA 3MUIA 2VOTA 1VIWA 2ZX6A 4U3CA 3OBAA 3VNZA 5I23A 4GINA 2VURA 1UKOA 2CXGA 4B3LA 2VNCA 4CKQA 3GNRA 5JIPA 1TVPA 4AZ7A 4CU8A 1UZ4A 4OBSA 2XYLA 4PSRA 1JZ5A 4F9JA 1NP0A 3U7VA 4DM2A 4GI6A 3EDJA 5EMYA 4AXNA 4CVUA 1PZ3A 1PX8A 3WF3A 5DT5A 5AYIA 5BXSA 1V3MA 2DDXA 1LWJA 4V28A 3CZ8A 1CZ1A 1JAEA 1OD8A 1OD0A 1B31A 3GBDA 3BCFA 3GH7A 1E4IA 1M7XA 2VRKA 4U2YA 3IAPA 3WN6A 3MV11 3GDBA 4ZEPA 1WDRA 4UQBA 2XIIA 4PN2A 5D9PA 1TVNA 4D1JA 5M5DA 5LA0A 2XGBA 5JBFA 4P8VA 3T08A 4WF7A 2FH8A 1WZKA 5CLWA 5AY7A 2YA2A 4QDMA 4M29A 1NARA 3EMCA 1GQLA 2X8RA 3PZTA 1XD0A 2J7EA 1A3HA 3WENA 4V27A 1DWHM 4OZOA 2CBVA 1I1WA 2DQXA 1V3IA 3FW6A 4LQ1A 2GSJA 2J7HA 2DSWA 1XSJA 3ARXA 2YIHA 3FXYA 5A95A 3LPOA 2DSUA 5ABFA 1JZ8A 3GYCA 1XV8A 3AS0A 1TMQA 2G3IA 1MFVA 1QI3A 1QNSA 4AZ6A 3PTMA 3L4TA 5E9AA 2WVUA 3G6LA 4ML4A 4GXPA 3LPGA 2BVDA 3VVGA 1UH4A 3WMSA 2XFRA 2A3CA 2WZEA 2Y5EA 2J7BA 4HA1A 3VILA 4MDOA 1LG2A 3AJ7A 4PMNA 4PMVA 3UG4A 1CGTA 1FH7A 2WHJA 1KFWA 1YQ2A 2VZOA 2QHAA 3GXDA 3SEPA 4U2ZA 3VDHA 1CLVA 3MUZ1 1EQPA 3MS8A 2VTFA 4BQ2A 5D8WA 1ZBKA 1ISWA 3ZJ7A 4AC1X 2D3LA 4C7DA 3OG2A 4RL3A 4U33A 1EDQA 1E5JA 1W2VA 1UZ1A 3TTYA 5A6KA 1SFSA 2X09A 1MVYA 1MWOA 3F4VA 4ATLA 1PEZA 3U7BA 3MV01 3M7SA 4DWSB 2CPUA 1JAKA 1BGAA 3WQ8A 1VFMA 1E0VA 1XYZA 2DSVA 2D0GA 3AMGA 5DEZA 1B30A 3L4UA 5GNXA 3NJ3A 4KRTA 2C0HA 1PBGA 2XSAA 4RE2A 1QHOA 4W5ZA 1V0LA 3RPMA 3EYPA 2PC8A 3SCUA 1GOIA 1QI5A 1WZMA 3GH4A 2W67A 4S3KA 2YDRA 3T0AA 3RM8A 5CPTA 4PCSA 1JF5A 5A6LA 4W85A 1NM9A 1SR0A 4NRSA 1OINA 5JIWA 1JI1A 3BLKA 1KWGA 3T0DA 2DT1A 5CLTA 4LX4A 3TTOA 4AIUA 2WPGA 1CGWA 4W84A 5E6ZA 1QHZA 3G6MA 4HZ8A 1JDCA 1DEDA 1LJYA 4MB1A 5I79A 4CN4A 1W9BM 1C90A 2WM0A 1DWFM 1WCGA 2CCRA 5IFPA 1RP9A 2WVVB 1EQCA 4TUFA 3WUGA 2CYGA 5BXPA 1H5VA 1LLOA 2D20A 3AHZA 4PTXA 5BRQA 1VAHA 4ZENA 3SCVA 1H09A 3ZJ8A 4AD0A 1LL6A 2J79A 1HP5A 3SCQA 3SCTA 3OA5A 3OLDA 4H2CA 1U33A 4W89A 1Q6GA 4JHOA 1CXFA 1MW1A 2VX6A 3KE0A 3MMUA 5HPOA 1E1EA 4W88A 2PI6A 2YLLA 4HA3A 1U30A 3GZAA 3IK2A 1HKJA 1AQMA 2J8GA 1I1XA 3F5JA 1G01A 2AAAA 3WF4A 3II1A 3WNLA 4UQ9A 1E4NA 2VQTA 2VRJA 5BROA 2D0HA 4D6DA 3WBAA 1G0CA 2YL9A 1FP8A 4HMCA 1Z32X 2UY3A 2EPOA 4AMCA 2V38A 4ATDA 1WAWA 3PZQA 3MUY1 1SMAA 2DSZA 2OYMA 3AQUA 3M46A 4P7RA 4MAVA 1CYGA 2X05A 3WKZA 3QOKA 4Z2HA 4XZBA 5ABHA 2F2HA 5TD4A 1TUXA 3L4VA 3K4DA 3BMWA 5IDIA 3RJYA 2BHZA 2J4GA 3WL0A 1CGVA 4B9ZA 5I0DA 4EANA 4UZSA 3VGFA 1E43A 1WKYA 3POCA 3DECA 5A6BD 1QNOA 1W1YA 4WKAA 2VI0A 3MSGA 2JALA 2VCAA 4NI3A 1FFRA 3N13A 2YL5A 1LQ0A 2XUCA 3QHMA 3VX1A 1ISZA 5D4YA 1R7AA 3L4XA 1JZ4A 1H11A 1V02E 1XSKA 1BPLB 3GNPA 1J01A 1XRVA 3GM8A 1WNOA 3UR7A 4URIA 1MW2A 2GJXA 2VZSA 2PBGA 2ZWYA 3AHXA 3ZJ6A 3WIJA 4IPLA 4MNKA 1VFFA 4UFLA 1KGUA 3CBWA 2WZHA 3WQ4A 2NT1A 2CKSA 4D72A 1TCMA 2VMFA 2XHYA 1BFNA 4HU8A 2E4TA 3L2MA 2WMIB 4DWSD 1PAMA 4D6EA 1C93A 3N12A 1ZJBA 1EXPA 3OGVA 1X6NA 3BSGA 2Y24A 2RGMA 1UOKA 3LPFA 1JGIA 3WQ6A 1OWQA 2BXZA 1V3KA 5BXRA 3MU7A 1DWJM 4MADA 1C8QA 3FNDA 4AIOA 4AD2A 4OUEA 4UFHA 1UHVA 1HP4A 4ZE5A 3ZR5A 3CZLA 1UWTA 6TAAA 3FY1A 1JYVA 4U5IA 2OWCA 5M3WA 3A4AA 4F9DA 1O7AA 3VOCA 4D6IA 3CGTA 1GONA 4U3AA 1V0MA 4P8WA 3GBEA 3VGDA 3W6MA 1TE1A 1WZAA 4ACZA 2WCAA 4DUWA 4IUGA 1TR1A 1GOKA 1HF6A 1MQPA 1WDPA 4M24A 2OWWA 3RILA 2JEQA 3I3DA 4GI9A 1HVQA 1DWIM 2PWHA 4TVDA 1BTCA 5D9MA 7A3HA 3APGA 4AD4A 3AI0A 2CESA 4PYSA 3OLIA 4UOZA 1I75A 2PB1A 3ARQA 3KWXA 3L2LA 2QMKA 4LXFA 1XGZA 4W7WA 3DC0A 4DUXA 2XFFA 3SCWA 3WNKA 1GOMA 2E9LA 5A69A 1WPCA 3IJ9A 1HVXA 3A6OA 3I3EA 1B2YA 3WD2A 2GK1B 4LYRA 1E73M 2VR4A 3CIVA 4HPGA 4LYPA 5I24A 4YPJA 2WWDA 1UR2A 3VINA 1GORA 4W93A 1KR0A 2CHOA 1W9UA 3S6TA 1CNVA 1KXHA 4LPCA 4AZHA 4GZJA 2G3NA 1J9YA 5CPSA 5AYBA 3KEHA 4MJ2A 1BF2A 3CLWA 4HMEA 5FOOA 1VJSA 1UD8A 1FH8A 4JFWA 1F4HA 4L4PA 2CIPA 1NOUA 3ARRA 4MPKA 4KH2A 3ZSTA 4W7VA 4F8XA 1J0JA 4H7VA 4UQDA 1UD3A 2RGLA 5E09A 5C71A 2DT2A 3IANA 4PMRA 5E0CA 2DH2A 3WQVA 4UFJA 3WQ5A 2ZWZA 3ECQA 2ESCA 4CD7A 1UR8A 1ZBWA 1C91A 1KB3A 5A8OA 5DMYA 2A3AA 3L4YA 3PBGA 3M07A 1QW8A 1HX0A 1UR1A 4QLKA 1JL8A 1XD1A 2OWXA 1FP9A 3OZPA 1E6QM 3SCSA 4DM1A 2D22A 4J3SA 1OT1A 1VJZA 4OIFA 3AZSA 3W4RA 4D6CA 1J10A 2EQDA 3WDRA 2JF6A 3WH9A 1VBUA 5HDRA 2CNCA 5EFDA 1QOXA 5IXEA 1HNYA 5HBFA 1M01A 1E55A 3NUKA 5CG0A 2NSXA 3AIUA 2ZXQA 2JIWA 4UFMA 1V6VA 2XVGA 5DF0A 2J74A 4J27A 2F61A 2XM2A 1HN1A 5F7UA 4HA4A 1MXDA 4N0RA 3VNYA 4QFUA 4FLRA 4H8UA 7CGTA 4GIAA 3CUFA 5ABGA 2CKRA 3DYOA 2ZUWA 4W86A 3VD9A 1CXEA 5KEZA 2W62A 1W9PA 3ARUA 2WBKA 4R5EA 1O6IA 4W8LA 2ZXDA 3KZSA 2EPMX 5ECUA 4ACYA 1ZB5A 1DP0A 2ZUTA 2WVTA 1KCKA 3AFBA 3F5LA 1XCWA 3U5YA 1ISYA 4ZXOA 5A6BA 1UQYA 1PPIA 2CBIA 2DT3A 5D9OA 3WY1A 3O9NA 1OGSA 3CZKA 4CCDA 1B3VA 1LWHA 2WZIA 1E40A 3IAQA 4UOJA 3VGGA 1JFXA 1K9DA 4AW7A 4J3TA 1R8LA 2WW5A 1JZ2A 1UR9A 3AMLA 1CXKA 2A3HA 1JYXA 1WE5A 1MFUA 3AIEA 3SUSA 2Y8VA 3CHEA 1CGUA 2G4FA 2D1ZA 4C7FA 5HOSA 1D7FA 2XVPA 4JKKA 3VIOA 3SUTA 3VD5A 2V5CA 3W81A 5DT7A 2D24A 1UWQA 2DH3A 3VDCA 2VX4A 1JD9A 4AZBA 3W26A 3WNMA 4Z2IA 1BYDA 4P8XA 4HTYA 4MNLA 1UG6A 1PX4A 2VL4A 3B8SA 1BYCA 3VIMA 4DWSA 4NZCA 2WKGA 5GPRA 3CUHA 5FD0A 2AOSA 5IHSA 1ZJAA 2GJPA 4JHZA 3CZJA 2WK2A 4AZ5A 1JZ6A 4WJXA 4AY1A 2JEPA 5DFAA 1BLIA 4H8HA 1E15A 2C8NA 1B90A 1G94A 2WC4A 3GXIA 3AMKA 2WLYA 2QV4A 1GQKA 2X0YA 4OBRA 1FFQA 4KWUA 5A2CA 4D1IA 2MANA 1OT2A 1YHTA 3K4AA 1W9XA 1BQCA 5JUVA 3VGHA 5CGMA 3ALFA 3W53A 3AIQA 1C8XA 1OIFA 1UKTA 3PHAA 1BVNP 1CXIA 4ZFMA 1ITCA 1HL8A 3W24A 4Z2GA 3AZRA 4HU0A 3PZOA 1JIBA 1H0GA 4RE3A 4GQQA 2WVVA 4WSJA 2W61A 3SUUA 1RPKA 1KBBA 3THDA 8A3HA 5CQ1A 1E0WA 3UEQA 1C3FA 3ARWA 1H1NA 1DWGM 4WIWA 1VFUA 1PIFA 4TX8A 3W29A 3CUJA 4YHGA 4D6JA 1NWUA 2YJQA 4JFUA 3AMDA 4Z2KA 2BY1A 3OGSA 3B9AA 4PTMA 1KBKA 4GQRA 3CHCA 3A4WA 3NSXA 9CGTA 2WXDM 3A4XA 3W82A 1EDTA 2CEQA 1E6PA 1E70M 1R86A 1V0NA 2EBNA 4UFKA 1CEOA 4J3XA 3RO8A 4U31A
chains in the Genus database with same CATH superfamily
1OGBA 4F0KA 4R9XA 4CD8A 3P84A 3U2EA 1MUWA 4MSSA 3LDVA 4C6FA 3TNOA 5A5WA 3H22A 1ECEA 2HTMA 2DIJA 4LCSA 3G0SA 4G7EB 1KA9F 2JFEX 3NGFA 4JTFA 3AZTA 4CNUA 3P8JA 4RNIA 3AICA 3OYXA 2PWUA 4JDYA 4JQ3A 1SU5A 3D5HA 2PPGA 1V6WA 1W1PA 2ZICA 1A5OC 2V3GA 1FVPA 3FDGA 3KVMA 3GYEA 1GPFA 5HINA 1K9FA 1EHAA 1MO0A 1EO5A 4B90A 3GH5A 3DFYA 3KAOA 2FZMA 1CXLA 4JL1A 3LCFA 4N4QA 2O9TA 4UTFA 4JYFA 3FKKA 5A8QA 2CLFA 5FJOA 3L4WA 1I2RA 3DCPA 2PDBA 4L9ZA 5D05A 7XIMA 1OG6A 4A21A 1A5NC 2WHKA 3HQPA 2PE4A 1S2WA 4F2UA 2EO7A 1QVBA 4L65A 1K9TA 2CETA 2ISFA 2G8ZA 3LUTA 5FCZA 4Y7EA 3R58A 3C56A 4GQ0A 5DBUA 2OEJA 4QCEA 4PMZA 4AAJA 4H01A 6TIMA 5D03A 3T9PA 3WF1A 2JKPA 2G41A 3BAYA 3EA1A 5DMNA 4HNTA 3UR8A 4H8VA 3B8WA 2REQB 1N8FA 3CMGA 4MWAB 4ZB0A 2QKFA 5LYRA 4L6OA 6PTDA 1E1CB 2O7SA 2D2JA 1VIZA 5TQLA 2R1PA 3KDOA 4US5A 3BJTA 4JGDA 4YL2A 2CLHA 4YTSA 3QC3A 1XSIA 4FX8A 5D2WA 3L9CA 2Z1KA 1UQZA 1RP8A 2X1IA 1H0IA 4JKLA 3ORWA 4KGLA 5JU6A 2A1YA 4WDUA 2GGJA 4E5TA 1P4CA 3Q67A 2W79A 3T2PA 3G1AA 1OFRA 3WLKX 3BAXA 3U2OA 3EBVA 3N4EA 1OB0A 2GFTA 4GNJA 3WBWA 2YKKA 1PZ2A 5JVLA 4QJ4B 4Y9OA 1SFLA 4C6NA 1Q6OA 4W9TA 5H2ZA 1XH1A 1HG3A 1JCNA 3PWGA 2H3BA 1NH6A 2GK1A 4UFIA 1J2BA 1NFPA 3HJEA 4PC8A 3UZ5A 1W8GA 4HZMA 4U4MA 5A8PA 3WQFA 1KBJA 2JGQA 2YCJA 1P0KA 3VM5A 1D8CA 1XQLA 1SZEA 3CO4A 3P0XA 4XV0A 3PUGA 4AEFA 3IJLA 4DEFA 2HDJA 1E71M 1VLWA 1H51A 3NDZA 4YTTA 1OFAA 3TOPA 2GJRA 4J3ZA 3CK5A 4WSKA 4O1CA 2V2CA 4H4IA 1Q6EA 2WMFA 3THAA 3S2NA 5A94A 1FHDA 2BGNE 3JZUA 4F4RA 1XISA 1E3ZA 3BSMA 3S2LA 1KGWA 2YX0A 2RDUA 3RCNA 1GKRA 4B92A 3OOQA 1Q6LA 2QPXA 3EMQA 4KGJA 3VZXA 2BSLA 3WBYA 4BJHA 5D32A 4IICA 4M6UA 3NZQA 4PB4A 3OIXA 1UPPA 1BEUA 1A0DA 1XXXA 3ITGA 1L8NA 1HJSA 2V5KA 3M44A 1KXQA 1QNPA 4WRHA 3TQVA 1P6CA 3LYEA 4GVFA 1MSSA 4JBRA 4FP1A 5I09A 2ZBTA 3PANA 3ALGA 3EKGA 2BP1A 2W4XA 4JTDA 1KM5A 4EKJA 1W91A 2QAPA 4UMBA 4ZOEA 3NO1A 4NJKA 3WLLA 4XUYA 1AQ0A 5IHRA 3CHDA 4RZBA 4JN6A 4WK9A 3V5CA 1WBJA 2BTMA 1Z48A 1FHVA 2XSXA 2WM1A 4FLOA 1RD6A 4ZQCA 2VFEA 4GH1A 3EOOA 5CGTA 3L21A 2BB0A 2X16A 4XAGA 3WUBA 3LD5A 1S1PA 3W27A 2HJPA 1LBLA 2HE5A 2J25A 3G8RA 2XVNA 3E96A 4J28A 4QLLA 3QV7A 4A8LA 1J93A 3AIRA 3EWCA 4QJ3B 4MWAD 2Z0IA 1TIMA 3LBMA 3P74A 1CIUA 2P8CA 2W92A 3R8GA 3BH4A 3MKKA 2WHLA 1BWLA 4CD4A 2GJLA 3RR1A 5BOEA 2OU4A 2PEVA 3CH0A 1P6WA 3OLGA 3VNLA 5HK4A 1FHUA 2DJXA 1EJWC 2OLHA 3ZVIA 1W1IE 2BOGX 2Q8XA 2WMJA 3GTIA 4ORIA 4O1EA 2R94A 4ZGYA 5ABEA 4P7NA 3VX0A 1YADA 2G3FA 3TYCA 1MZHA 1CGYA 3MT1A 4Y8EA 2DZVA 3NM1A 1OY0A 2I5QA 4A4AA 2CZ5A 3S0CA 3WEOA 5D38A 3GS6A 1PX3A 1IYXA 4M6QA 4TTGA 3TN5A 3STPA 1R38A 3TJLA 3FKRA 1W3LA 5CSRA 1JR1A 3CWOX 3TCEA 2EPLX 4U5KA 1HJVA 4BHYA 4KBXA 3BCDA 1P1MA 3W1NA 1HFBA 5BYWA 2WC3A 4HK6A 5KZDA 2D73A 3IWPA 5FIPA 4GX8A 2IPWA 2AMGA 2OYLA 4E2DA 1EB3A 4PUWA 3TSMA 1PE1A 5CGQA 3HF3A 1RZMA 1HKWA 2F6UA 4XISA 3UCQA 3EWWA 2PSNA 4LB4A 4V33A 4ZQPA 4FAMA 3UG5A 3UERA 4YCOA 4IQDA 4H6RA 1C7TA 4L64A 2XIBA 3EDDA 1IEWA 3UBPC 5F4XA 4CCCA 1AJZA 3F2CA 2C1IA 1ITXA 3DENA 1V3JA 3CH9A 3PPHA 4HOWA 4O11A 3SQSA 3EWZA 4ZSUA 1BSIA 2DEPA 5BW6A 1JEZA 1XH2A 3AYSA 4TX6A 5G2IA 4V1XA 1HO4A 1DL3A 1DORA 4Z1BA 3Q65A 3CEUA 5LIUX 3VD4A 2ZFAA 4P2VA 2CITA 1ZGDA 3W88A 1YPXA 4XAYA 3BAJA 1K70A 2CWNA 4ICMA 1NOWA 1GWJA 2G3MA 2ZX8A 3DKJA 1RBLA 2OZTA 1OYAA 3GTHA 5T9CE 3T42A 5MHBA 5RUBA 3PTKA 3MY9A 3GFYA 3BC9A 4AIBA 3GC2A 4IJBA 2BY3A 5H91A 3U57A 2PDFA 1HJQA 2IXVA 5C9UA 2PDIA 2C1HA 3GG1A 3WUFA 4HP5A 4NASA 3SUVA 1Z6KA 1BVZA 3G1DA 1XIBA 1C8YA 3GHRA 1J5SA 4M1RA 4O8AA 2FDSA 2Y8KA 1TPH1 1JCXA 3KUMA 5HQEA 4CLMA 4K36A 4IOTA 2O55A 2V6AA 2VZVA 3W2NA 3KWSA 3DG7A 4NAEA 2E5BA 3N15A 4N7QA 3S1WA 3VU2A 4ATWA 2E25A 1RA0A 1OJXA 1CGXA 4GY7A 4HOXA 5AHLA 3SURA 3U3HA 4AD3A 2IPJA 2PDPA 1UKSA 3GXFA 3RMEA 3GU1A 2QF7A 1L6YA 3OQEA 1FKXA 1KM1A 4W7UA 3DG6A 4LH8A 2PLKA 3POHA 3UPMA 1O94A 1RVGA 3LXAA 3MMDA 5JH2A 1R3SA 4TR9A 4F0RA 2QUNA 3UGVA 3DFQA 1XYLA 1FRBA 4DO5A 3V0TA 3VKJA 3OU8A 2G95A 3I4KA 4UR9A 4BWLA 5I78A 3LMYA 4HPHA 1XIDA 3GTNA 2P50A 4LW7A 3ZT7A 3DHUA 2J8FA 1LG1A 1FWIC 4O54A 4HPNA 3I7SA 3AS1A 4JTEA 1RV8A 2Y2WA 3UZYA 1GOQA 1TPUA 3E6EA 4AYSA 3ZOAA 4QJ5B 4NJIA 2VKZG 1A5SA 3QV8A 4IUOA 1J6PA 1UR3M 2OEMA 2MNRA 4P7OA 5FAGA 4GQGA 4KQNA 9RUBA 4AWEA 1XDLA 1IXPA 3W2LA 3DDMA 2ACQA 2CHRA 3MSDA 3SJNA 4MFDA 1ZAJA 3WD4A 1TPDA 3A22A 1PWMA 4D71A 4AISA 2V0TA 1G4SA 5HUPA 2YW3A 3H7VA 1RXOB 4WKFA 1V3LA 1EJXC 1W9DM 4WLCA 2CERA 2QULA 4OUIA 1FWHC 4GX9A 5C7HA 1JCLA 3SCPA 3W22A 3HG5A 2HISA 1H63A 4DJFD 4XVDA 5HR6A 5C9WA 1IV8A 4LOCA 2AMXA 1K9EA 4JEJA 1PIIA 1TREA 1NVMA 1ME8A 3WFLA 1K8CA 2KZHA 5H8PA 4GYPC 1DOSA 3VIJA 3B06A 2NUYA 3S3GA 5I3JA 4TTUA 4WXYA 1LROA 3HB9A 1PIGA 1QW7A 2ZE0A 1X6UA 1EC7A 2TAAA 1GJUA 2Y8UA 1H61A 4H41A 1GVIA 2Y4SA 1JD7A 4OFCA 3C2VA 1OX4B 4PGLA 4O1DA 4REQA 3PB2A 1PJ9A 5CSUA 2W6RA 2NQ9A 4MB5A 1EIBA 1G5AA 3AYRA 2QUUA 1OCNA 4MUPA 4WY0A 3TOYA 4QGCA 4I8DA 3LCHA 1YBQB 1RAKA 1OC5A 3I6EA 4S3FA 1TB3A 4V1YA 4O12A 3EA2A 3PTQA 3MHGA 1JZ7A 4IGSA 3UXDA 3BQ6A 1KLYA 2UY4A 4M82A 1XPYA 1GQIA 1Z41A 5KZMA 1KQZA 1NP2A 1FWJC 4GPNA 3GHUA 4IM4A 1Z9AA 3IACA 3UFYA 3BLEA 3D47A 3FN9A 3V5FA 1JF6A 3EDKA 1HJXA 4A3QA 1C9DA 5DRCA 4X60A 3IGHX 5KSWA 1QNRA 4RDYA 4UXDA 1E0UA 1FWNA 5CZTA 5AHEA 4MNMA 4ONVA 4E8CA 3AISA 4JFSA 2GGIA 4DLFA 2ZUMA 3LTYA 4NZ4A 3H8AA 4ZOBA 4UCGA 4Q8WA 1JPDX 1E0XA 1GVFA 4JQ2A 1JYNA 3UNDA 3OO2A 2ISWA 2HS8A 3ARPA 4KETA 1CECA 2Y0FA 1H4PA 3HTWA 3EX3A 2OFJA 2YCLB 3VO0A 1MW3A 1RUSA 1AZ1A 2WJEA 3TYZA 4IMFA 3DGBA 2EG7A 5T9BG 4O19A 2ON3A 1G9HA 4HNVA 3GNOA 1VRXA 2DP3A 1NWRA 2EHHA 3T2QA 1VBRA 4PMOA 3VD7A 1MZRA 1DJGA 3WQGA 3N1AA 3S6DA 1R9XA 2PTXA 3MVIA 1GVYA 2B31A 1EXBA 3U4FA 2DIEA 1E6XM 4ROQA 2X0SA 1L2UA 3O63A 3CAVA 2J8TA 3CB8A 2YZ5A 8XIAA 1KCLA 1B3WA 1TX2A 1XPGA 1IZCA 1XLLA 3RF9A 2GSHA 1HKIA 2E40A 3ITXA 4JX6A 1JPHA 5E6YA 2E28A 2O92A 1WXZA 3K2GA 5LXXA 1IIHA 3PB0A 3ZQ9A 2Z6IA 1SZNA 3DBPA 3IK4A 3MMWA 3BG9A 3N2MA 4RUBA 1UA7A 3QYSA 1XUZA 3MBDA 5JBEA 1OZMA 1TUFA 1VFTA 4C5YA 2POZA 1VIWA 2OOGA 4ES4A 1UP0A 3VNZA 2VURA 3PSVA 2Y5JA 2CXGA 4L7ZA 1MEIA 4B3LA 3B8UA 1XUUA 2XIQA 2V5BA 3W6YA 4OBSA 2XYLA 1JZ5A 2GGGA 4DM2A 4C6PA 3Q58A 4GIYA 1F74A 4AXNA 3GTXA 3W2UA 4CVUA 3ISIX 3LCIA 1K1DA 5AYIA 4YJ5A 1LWJA 4S23A 1CZ1A 4XKMA 1A5BA 2INFA 2NVAA 3BCFA 3GH7A 3G24A 2VRKA 2Z29A 3DEQA 3VOJA 3V35A 3OVGA 4N02A 2XGBA 2PDHA 4ENLA 3T08A 1R3VA 2FH8A 1WZKA 4H8NA 1G4EA 2I1OA 3E49A 5CLWA 2ICSA 3M9YA 4PFHA 3T6CA 3DOPA 4ADUA 4OT7A 4DF2A 1NARA 3EMCA 3URAA 2A79A 3COTA 2E5CA 2J27A 5KZEA 2J7EA 2CBVA 1V3IA 3GXPA 2P8BA 3KHJA 1T40A 4LQ1A 1DHPA 3NR0A 5H6HA 1TV4A 3O05A 3RG6A 3FXYA 3KS5A 1X8FA 5C0QA 3LPOA 4GG9A 3GD6A 3W76A 2DSUA 5ABFA 1RPXA 4C6KA 1XIIA 3AS0A 3GU2A 2G3IA 1XG3A 3QRHA 5CBIA 4HCDA 4ML4A 1AFSA 2NV1A 3QLDA 2DZSA 3HGSA 4B5SA 3KCOA 3SR7A 2BGQA 3TZFA 4MDOA 3SAZA 3AJ7A 1OQFA 4PMVA 3UG4A 2BG5A 1FH7A 4HPJA 3KM8A 1QPOA 3SEPA 2ZRZA 1CLVA 2OT0A 3QR0A 1CX9A 1H7XA 1C9WA 5FJTA 5D8WA 5MKGB 3C0SA 3A23A 2D3LA 4RL3A 2BVWA 2E1WA 3LENA 1E5JA 2VDHA 1M41A 4M3PA 2DZXA 3BLFA 3TTYA 4DF0A 2WV8A 2XDFA 1W5OA 2HNEA 4GY1A 1MWOA 1Y5VA 1OFOA 3QMSA 2R1LA 5B80A 3B04A 3EPMA 1BGAA 2VEPA 2ZC1A 1VFMA 1E0VA 1XYZA 4JR5A 1TMLA 3KTCA 2D0GA 3AMGA 3L66A 2FPVA 2XSAA 2YXXA 4C6LA 3D6NA 2AGTA 2PDGA 1M9HA 4FNPA 4X2RA 3T0AA 4JHMA 1SW7A 3T40A 4PCSA 1JF5A 1EWDA 3GHSA 1UBSA 4TIMA 3NQDA 4C6OA 4AY8A 5CLTA 4LX4A 3GW0A 2I16A 1CGWA 1PTGA 4XZLX 3GRIA 1V77A 5C7VA 4L1XA 4HZ8A 1JDCA 1IE7C 1DEDA 3UWYA 2IQ0A 3H2OA 1W9BM 2PP3A 3F4NA 3DH7A 2GZXA 4UMCA 1O4UA 3LRLA 4JTHA 3SJ3A 1T8XA 1EQCA 2PURA 2D20A 4PE8A 1B5TA 2VC6A 3ZJ8A 5ABTA 3W87A 3OA5A 4DJEA 4J2MA 4UTWC 1Q6GA 4JHOA 5U7SA 3RLVA 1DQUA 3F7JA 2HMCA 2POTA 3ICJA 1QDSA 1U30A 3N2BA 1P5BA 1HKJA 3MKVA 4FNSA 3LHZA 5REQB 5FEPA 3WF4A 3II1A 3QC0A 4FNTA 4UQ9A 2CLPA 1L9WA 2F7FA 2V8ZA 4HMCA 1Z32X 3C2FA 4AMCA 1N55A 2QJIA 3E02A 3UY8A 2Z00A 3HPSA 3M46A 3BANA 3BO9A 4MAVA 4P7RA 3MI6A 4AWSA 3A5VA 4AQLA 1VPXA 4UTLA 5CG7A 1AA1B 5TD4A 3FVMA 3DBNA 3W9ZA 1SFJA 3AWNA 2GUUA 2BHZA 4AMAA 1U1JA 5HMEA 5I0DA 5K7JA 4RX0A 1Q8AA 2QCDB 3GFXA 4C6CA 1YXCA 1E43A 1BKSA 4HJFA 3GVWA 3RMJA 3WLOA 3DECA 5A6BD 1KFEA 1QNOA 3UCDA 2QJGA 4Z0JA 4KWSA 1TTIA 5C9ZA 2RHGA 4US6A 2YL5A 1LQ0A 6REQB 1ISZA 4GFSA 1LQ2A 4I7VA 1FWEC 3R8HA 1R7AA 4Q33A 1ME7A 1JZ4A 4IQJA 4LUTB 1BPLB 4D8LA 3GNPA 1J2WA 1TZZA 5F1UA 4JTLA 3TLLA 1EP1A 3UR7A 2VZSA 2PBGA 4PTNA 5G1YA 3WIJA 4A8RA 1VFFA 4JTQA 3SFKA 1KV8A 5HQMA 4D72A 2XHYA 3CO8A 4JYEA 3OJGA 1MDRA 1A5KC 5EL1A 4IF2A 2PMQA 3CJPA 1RBOB 3V75A 1PAMA 4D6EA 1MXSA 1EXPA 3OGVA 2CZDA 3C61A 2Y24A 1JGIA 2X1RA 5FI8A 3M5VA 3H4WA 1EYWA 1R9ZA 2X41A 4PRTA 5BXRA 1DWJM 3FNDA 3W2JA 4AD2A 4EPDC 4OUEA 2FB3A 4ZE5A 4UTIA 3H24A 1UWTA 1JYVA 3A9IA 3NVTA 3MKCA 3CAWA 3BG3A 4P8WA 3GBEA 4RPPA 2WCAA 4LANA 1MQPA 4GC3A 4LT9A 3I3DA 4Y9PA 1PHQA 4I9AA 3H2NA 3NQEA 3H7RA 7A3HA 4XSLA 1R2SA 3APGA 4Q7IA 3TXZA 1YTKA 3W70A 5LNUA 3VDGA 3E2QA 3M0ZA 2O7QA 3KCLA 4ZL1A 4TQTA 4MKSA 2PWVA 2ZQ0A 3LEPA 2XFFA 3WNKA 2E9LA 5A69A 3IJ9A 2PLCA 2PFHA 3A6OA 4XZHA 3FEMA 3CIVA 3QEZA 1W3NA 2P53A 4W93A 1KM0A 1W9UA 1GQNA 4YXGA 4AZHA 3MI3A 2G3NA 3CV2A 3KEHA 2CLMA 3CLWA 1FH8A 2CIPA 5XINA 1OYCA 4KH2A 1T7LA 4H7VA 3AXKA 1TVLA 2DT2A 3IANA 4JTSA 3QKEA 5E0CA 2DH2A 3ECQA 1UR8A 5DMYA 2Y7DA 4H9VA 1ZFJA 4GYFA 3N4FA 2QVHA 3G18A 1JL8A 1T99A 1XD1A 2PGWA 2R9RA 4HU4A 3H55A 5D09A 4Z42C 3N6JA 3B8VA 4UWMA 1J96A 2QNEA 2YFNA 2QJMA 4QIUA 2RDTA 2QIWA 3AYTA 3O6DA 3RN6A 1J10A 1RCXB 5HUOA 2J6VA 5HDRA 1M5WA 3LCXA 2CNCA 1EPXA 4Q4MA 4QQ3A 4ZODA 1GT8A 4C6BA 3HV8A 2ZXQA 1ZUAX 4AWTA 5G5IA 4J27A 1YPFA 1KM2A 1U5JA 1HN1A 4HA4A 3CT2A 3NQBA 1TE6A 1VYPX 4O1BA 3DYOA 3UXKA 4CEUC 4R5EA 2VFIA 2R24A 3SECA 3KZSA 3V18A 2BASA 1DP0A 2YW4A 3LGDA 4UMAA 2VEMA 1XCWA 1ISYA 3LGGA 3G1YA 3HPAA 1A5UA 1SZGA 2CBIA 3WK1A 3IIVA 1YXDA 5D9OA 3PPCA 3W73A 3TW7A 1B3VA 1PKLA 3H2EA 4G5DA 1LWHA 3S8HA 1T5AA 4UOJA 1JFXA 3TMLA 1K9DA 4J3TA 4LUSB 4ZMGA 1Q7QA 3F2DA 3EGJA 1XLCA 1JZ2A 1UR9A 3CHVA 3HURA 3GC4A 3SUSA 5LGXA 2Y8VA 4ZOCA 3IUDA 2BOFX 2G4FA 3C2EA 2YCIX 5IBXC 4JKKA 2C0AA 4HHPA 3EWDA 3W81A 3FX4A 1AQFA 2DH3A 3LV5A 1EF3A 4Z2IA 4P8XA 3NDOA 1E9YB 1TPVA 1UG6A 2VL4A 4L4LA 3B8SA 1BYCA 5BNKA 1WUEA 2WKGA 2PS2A 5GPRA 2AOSA 3GIYA 1ZJAA 1PKNA 4IXXA 4JHZA 2WK2A 2XN2A 3GY1A 3PFMA 1YYAA 3VNIA 3PPFA 1PHWA 3L12A 1VYRA 2V2DA 2FFIA 2Y5SA 4EXBA 2WLYA 1S2VA 4GCXA 3FYPA 3TH6A 4LNCA 1ENUA 1ONXA 4D1IA 5C9RA 5DXYA 4LRSA 3EOUA 3DGRA 4LUJA 1VPQA 1W9XA 4LFYA 1BQCA 3NEVA 3VGHA 2NXHA 5CGMA 4CNSA 1C8XA 4Q7BA 1HL8A 4LRTA 2IPGA 3OVPA 2X30A 3L5AA 3WG6A 1KBBA 2ZRUA 1E0WA 4HT3A 4AF0B 3NAVA 3UEQA 1G6CA 3NXLA 1FCBA 4IMDA 2PDKA 4AEOA 4WIWA 1NEYA 4TX8A 1NWUA 2YDAA 3ONCA 2BZNA 3AMDA 1RD5A 3MMTA 4RE0A 3OGSA 3B9AA 1XINA 1KBKA 3CHCA 4C1NA 3MP5A 3NSXA 2OJPA 4GE8A 4NAFB 1GTHA 3CV1A 1EP3A 1K02A 3UZJA 4L6DA 4JICA 2OKTA 3EPOA 1EJVC 2VDIA 2B81A 3HQNA 1TPWA 4YLWA 4J3XA 2OR2A 4QHRA 3WCZA 1W17A 2VX7A 3IRDA 3W1TA 3LY0A 5AECA 3HG3A 3RGTA 3FSTA 4N6EA 3HO8A 4FIQA 4LALA 4FB7A 4HYWA 4C6IA 1XCFA 5A8NA 4GJIA 2J7DA 4PMQA 2WZMA 3BOLA 3ITVA 1JJKA 1V79A 4A6GA 3WMBA 3DFOA 2DZTA 1BRLA 3MYOA 3ARVA 1GW9A 5T26A 1XIFA 2FDMA 5BMXA 4DUOA 2PD5A 1TRIA 5HNRA 1A5LC 1UJPA 2V5DA 3ABRA 3AJXA 2XVKA 3TC6A 2OQLA 4R53A 5DCEA 1F61A 3KDNA 3DXIA 3WDPP 1MQRA 2J47A 4AD5A 2J77A 2RAGA 4LYQA 4DI9A 4AX7A 1DXIA 2Q8LA 5H8UA 2XWEA 3ARZA 5IFTA 4H7CA 4JIEA 3WF0A 8RUCA 2FVLA 4AZIA 4HHMA 1DJZA 1LL4A 1MRAA 4OJYA 3IGXA 1FWFC 4C1KA 5DN1A 1TV3A 4EOUA 2H6RA 4MAZA 1HO1A 4ZO6A 4HZ7A 1UWSA 1TQJA 5F2GA 1KW1A 1XBYA 4GABA 4RZ6A 3V0SA 1EX1A 1SFTA 4QE4A 1E1FA 3BLLA 1LT7A 2ANUA 3KFTA 1TFVA 3O3RA 3QM3A 1GOXA 1JUEA 5BOOA 3G3MA 3UR5A 4JYDA 5C54A 3NDYA 3F1QA 4M56A 3EX6A 4S3EA 4W5UA 1JGMA 1LUCA 4K7YA 1OGGA 4JOMA 4H9TA 1X6LA 3ZR6A 1W6TA 3ATZA 3OTRA 5HNNA 5HWJA 3T4CA 4HVXA 1UOZA 2VC7A 4UNIA 2B4GA 3W37A 2YL6A 1Z44A 4LGXA 2VO5A 5HXMA 2QCMA 5LA1A 3F4DA 2NT0A 3B97A 5HANA 5I7GA 3TJIA 2C79A 4YU1A 1TA3B 3LV6A 2MUCA 1GZJA 3NL5A 2VFFA 4O15A 2XM1A 3AIBA 4XKYB 3BUVA 3UD6A 3RX3A 3VOHA 3SFWA 3L65A 4JIPA 1KLZA 5CC6A 3MCOA 3NA8A 2D69A 4Q4OA 3H54A 4CGTA 3KLLA 3WH8A 2FYMA 1MRQA 3WK0A 1I9CB 3GWQA 3EDEA 4LU0A 1DXEA 5D9NA 3NZPA 4HA0A 3K46A 4GISA 2RJGA 4IH3A 3RLUA 2GGEA 1SYTA 1CW2A 1DJQA 5A6AA 3NXFA 4ZO8A 3BK0A 4IIDA 3PSWA 3OHMB 4TVUA 4IGHA 5BWFA 5HAOA 1I2OA 4GUIA 1KFJA 4B3KA 2PZNA 2D0FA 1VFHA 3CQKA 3F4WA 5M03A 2J78A 4A3RA 1QW9A 2VUYA 4JN7A 4ERIA 5EB8A 3TFXA 4YIWA 3B40A 2VJXA 3NOEA 4JFTA 7ODCA 5D8ZA 3O7UA 3W38A 2Z1WA 3KRUA 3R7MA 4AX6A 2GPTA 1JXKA 2DPEA 4O52A 3SCOA 1W3KA 4FMVA 5LGZA 1B54A 1VEOA 5I07A 1XLJA 4KEMA 1D3GA 1S46A 1CWYA 3T0BA 2VT0A 3Q37A 2BFGA 5FSEC 1GOOA 4QQUA 1SQ7A 5AOUA 1CCWB 4LAMA 4HNLA 1FDZA 4OKDA 3G1HA 1IR1A 3EKLA 4JTUA 2XPKA 5J8LA 4Y9NA 1DJIA 3NSMA 4I9JA 5HNTA 2A7NA 2VD9A 3SI9A 4AHQA 1SJAA 4MJ4A 3M0MA 1OFEA 3G77A 4DBDA 4UR8A 2E8YA 4M5PA 1POKA 4AZGA 1ODUA 1ZSXA 5KETA 1VQTA 5AB3A 3N19B 4XZMX 1W3HA 4G2DA 3FYOA 5G4WA 1LF1A 1Q6CA 2QCLA 1XYFA 4CD6A 1LL7A 5BRPA 3D3AA 3VKBA 3W23A 4IPIA 3KBVA 2ZRYA 3QTPA 2J75A 2HK0A 4GLEA 4DYKA 1LP6A 1PSCA 1EJSC 3EB4A 1OBAA 2AL2B 3BAWA 3O15A 4ZR8A 1KRAC 3HPZA 4I5RA 2UY2A 4JTGA 2DZPA 3BLIA 4JX4A 1Q3NA 4J5NA 3GXMA 4E3VA 1HW6A 2GDUA 5A3HA 4HZ6A 1V93A 4FK9A 1IGWA 1QTWA 1SVDA 3CU2A 1QHPA 2PWDA 1OABA 2G97A 3LSBA 4RXGA 1P48A 1G1YA 4UZUA 4JQ1A 4RW3A 1FX6A 5DX7A 4G9PA 3A9BA 3G1XA 2BODX 4ZBCA 5EBAA 1W32A 4QG6A 4BZYA 4NZ1A 1U22A 4DUVA 2BVTA 4ZE4A 3OVRA 5CBBA 4MZ1A 1YW1A 2ADAA 2EPNA 2ZA3A 2GQ3A 3HGJA 2YA0A 4P8UA 2E67A 2XTKA 2FKPA 4RZ5A 1FQ0A 2YZRA 3U9IA 2ACRA 4IHCA 3GXNA 1TPEA 1LBFA 3EXTA 4CU6A 4HYRA 3PS7A 5FEXA 2PDCA 1FWAC 4UQAA 4LWWA 4NQ1A 3C0JA 3CPGA 3MTWA 3S5OA 4MF4A 1JYWA 3T0CA 2H90A 4M1BA 2ZXBA 2TYSA 5TBOA 3VGBA 1B3OA 4L5ZA 3R5EA 5EMJA 3QHOA 4AIEA 1KM6A 3XISA 2QR6A 3IGUA 4O10A 3B0YA 1DE6A 2IW0A 3LNPA 4OOUA 3IJDA 1AW2A 4FI4A 3PK7A 3PULA 2Q71A 1UIOA 1GJPA 4OTKA 2WO5A 4B91A 2E0PA 1WUFA 3OB8A 3IJ7A 1P0BA 3CV7A 2PLMA 3UNTA 4Q8VA 2QCFA 4G7EA 2QDEA 3DU0A 2CHNA 2WANA 3DHFA 4X63A 5T91A 3LHVA 5A8MA 3M43A 1QPKA 1M1BA 3BDKA 5FESA 1J6OA 5A6JA 1CTNA 3BLDA 2UWFA 4CVWA 4N9EA 4WGXA 3HG4A 1GW1A 3W01A 5FF0A 3IARA 1NAL1 1TG7A 4LBUA 5AYXA 4PUUA 1OCQA 4UCFA 3R0KA 1YXYA 1FHLA 2PTZA 2WZTA 3BLPX 2ZYFA 3MYPA 3CMJA 4UB9A 3VIKA 4Z0SA 3VNDA 1Y5XA 3AS3A 4AVOA 2XG9A 4N9CA 5BU9A 2FGZA 5A6TC 1E6NA 1TPFA 4BEUA 4QLJA 1L6WA 3LHYA 3UJ2A 2WCGA 1XFCA 4HK5A 5A2AA 4BKNA 2BNJA 3HPFA 1PWLA 4EXQA 2VEFA 2BVYA 1TTQA 4IMAA 3UP8A 2JE8A 4GUGA 1KR1A 4J40A 2EXOA 3OZOA 3SBFA 3PJTA 2E6AA 4OV9A 1MQQA 2ACSA 3A3XA 1XC6A 2E6FA 4TXEA 1W3IA 4A3YA 4R9OA 3E0LA 1GYMA 4M81A 3GVQA 4GXMA 4JTIA 1TV2A 3VOIA 1LZOA 1JG9A 1WOBA 2FTYA 3XINA 4MWAA 3SRDA 1E1CA 5FF7A 3AWOA 2DZBA 4HHHA 1S3TC 3CZEA 3KVJA 4MYXA 4C91A 1QI4A 2YYUA 5A6SA 3FJ4A 4X61A 3TN3A 3URBA 1Z42A 3OA3A 3PBMA 2ODOA 5C2CA 2XWDA 3NQFA 1ICQA 3NYZA 1ZY9A 4JNYA 2DSKA 3N17A 3GR4A 1ZU8A 4L4OA 3WH7A 4HQVA 3W1RA 3S6OA 3TP4A 1GUVA 2IS7A 3VIGA 4GUFA 4YVPA 4OU1A 4WDWA 1QCWA 2VEIA 4FLSA 3GKAA 4Q8PA 2PRLA 2YBUA 3B8DA 2YLAA 4GO8A 1E56A 3EXSA 3L4ZA 1US0A 5A2BA 5I3KA 4Z1AA 2HE8A 3RM9A 4QM1A 4PULA 1GPWA 3TN6A 3NPUA 1HQTA 3WNOA 1QPNA 3AAMA 4XZ9A 3PUDA 4BCEA 2HSAA 4I5XA 2F8QA 3CPRA 2BHYA 2XSBA 3OVQA 1UA3A 1W5QA 4JDBA 1M6JA 3AXMA 5K9CA 2HVMA 2ZE3A 4DF1A 5I03A 1XW8A 2DFAA 4EVZA 1QWGA 1E6RA 2XU2A 2XVLA 5CZ0A 3QSRA 4YTRA 2R8WA 4FX6M 1XG4A 3FA5A 3TJXA 2DVUA 4JL2A 1NF0A 2OSYA 2JKEA 1H7WA 4IFRA 4FR6A 1KWKA 1TJ0A 3IV8A 3PUEA 3HBLA 2VWTA 1XL9A 3UZXA 2E09A 3TC3A 4JAWA 2HS6A 4A22A 1RQEA 1UD6A 3TC7A 3EKZA 1X7IA 4K8GA 3IJIA 3EB3A 1Z8AA 1US2A 1XBXA 5E0KA 4QX4A 1I0BA 4FNQA 4X3ZA 1GNXA 3LM7A 1E4LA 4S2CA 2QGYA 3TONA 4F66A 2JBMA 4XAZA 5GNZA 3ME3A 1PL9A 3QHNA 5FL0A 1HJWA 3ZIZA 3TQKA 3RITA 5DY3A 5BXTA 4CD5A 2Z1VA 3K1DA 3T0TA 1YLVA 1B3XA 1KQYA 5E9XA 1RLDA 2EKCA 2Q6ZA 3I3BA 4NX0A 1AJ0A 1UKPA 1K7FA 1K4GA 3N9RA 2Z2AA 1VEMA 4FPSA 1DJYA 2OXNA 1T96A 1XICA 5FJUA 4HPXA 5E1QA 1C29A 2F84A 2AKZA 4L6HA 5D37A 2Q3OA 2EJ1A 4GGBA 2DZWA 1DYSA 3ARYA 4CCZA 3LTSA 4Y9MA 1VB9A 3W2MA 2CU0A 2QCCA 4B3ZA 4LV4A 1ZALA 2KAUC 2F2KA 3W7CA 3RX4A 4PUKA 2J7GA 4I9MA 3DAQA 3ZT6A 3IGSA 3CUIA 3C3UA 3GB6A 4PMDA 1NWTA 2C13A 3VIIA 3Q4DA 7TAAA 3RDKA 4NRRA 4O0ZA 4EAMA 1EUAA 5LNRA 3GVVA 1EHNA 4OECA 1O5QA 3H23A 3B0UX 1I2QA 1Q4WA 4QSFA 3RPDA 3TE9A 1UR4A 2C14A 1IIGA 3GNDA 3BAIA 3WSUA 5CH9A 3D3FA 1CB7B 1C92A 4UNLA 1AQHA 3H2AA 3UGRA 1PTDA 1OFPA 3BV4A 2R14A 1EA9C 4BQ5A 4V2XA 3T09A 1EC9A 4X22A 1JPIA 1F05A 1YNQA 2NXIA 2WB5A 3EB2A 3E0IA 4O14A 2E8ZA 3TYEA 2VOMA 1HKMA 2NUWA 3GU9A 1V7AA 1SGJA 3ATYA 2GVYA 4JIIX 4JCLA 4NNBA 1IT7A 4D6HA 3FHAA 5CEWA 3VUPA 3ZLFA 5BMWA 1RY0A 4GZEA 4LBSA 3MUIA 4HSHA 1DKWA 2GWNA 3G2GA 8TIMA 3P60A 3B0VC 1IXQA 2DVTA 3GDRA 1W5MA 4FS9A 4XBKA 3R11A 5FA5A 2VNCA 2GVJA 4HIBA 4CKQA 3GNRA 5JIPA 1TVPA 4AZ7A 4H7ZA 2PD9A 1NP0A 4Y2WA 4JXCA 4D2JA 4Y96A 2OQHA 4WZHA 5EMYA 1VP5A 3U0HA 4IIFA 3KBMA 1PZ3A 1PZ1A 4EP8C 4V28A 3CZ8A 1JAEA 1OD8A 1B31A 3ABSA 1UW9A 3IAPA 3WN6A 4DJFA 3TN4A 3CS2A 4L9YA 4UQBA 1QWKA 3VA8A 3P67A 5LA0A 1QK0A 2A7RA 2ATSA 2X7VA 1T0OA 4KS0A 5AY7A 4ZCWA 3VZZA 2XH4A 3FJLA 4R7JA 4V27A 1I1WA 2DQXA 4NJHA 3V7PA 3FW6A 1NQKA 3W1PA 2GSJA 1B4KA 1BTMA 3O07A 2DSWA 4AY7A 3N73A 5FSDC 3ARXA 3USZA 4TO8A 4ZFCA 4GBUA 3P5YA 3GYCA 2C19A 1U1HA 1LOLA 4JY8A 5E5CA 3ZS4A 4AZ6A 3PTMA 3G6LA 3HFTA 4Z1DA 1XM3A 2BVDA 4OWGA 3SGGA 2A3CA 2Y5EA 2J7BA 4H9MA 4PMNA 1JQVA 3O1NA 1CGTA 3R79A 2HV5A 4QR6A 3GTFA 2PGRA 1O12A 2VZOA 2QHAA 5U4NA 3VDHA 3MUZ1 2XISA 3INPA 3R8RA 1D8WA 4GVGA 2VTFA 4BQ2A 2NUXA 3QGAC 3TA6A 1ISWA 3ZJ7A 1H7NA 4QSHA 1Z7AA 3OG2A 4QS6A 4U33A 1ZPTA 1EDQA 3PVFA 1RK6A 2GOKA 5HNUA 1XIEA 3CIWA 4DYEA 1SFSA 4AC7C 3I7RA 3S1VA 3TU9A 6XIMA 3U7BA 3MV01 1B4EA 2CPUA 3DFPA 1HL2A 1CT5A 1TWSA 2DSVA 3RXZA 2YGYA 3L4UA 3NJ3A 4KWVA 3E0WA 1PBGA 4RE2A 1QHOA 3O6CA 4S3GA 3RPMA 6ALDA 3SCUA 1QI5A 1WZMA 4S3KA 2YDRA 5HWNA 4HNNA 4LSBA 1WKFA 1FKWA 4JEQA 5CPTA 3S1XA 5LIKX 3M0LA 2QJNA 3EX2A 2JQXA 1SR0A 2UBPC 5JIWA 1IF2A 4ZQNA 2ZRVA 1JI1A 3CYVA 1YDVA 1KWGA 2PDYA 1XLAA 3T0DA 2DT1A 3OW1A 3TTOA 2HXUA 2WPGA 1RQHA 3H2MA 1DE5A 1LJYA 4Q8UA 2CLIA 4GA8A 4MB1A 1C90A 2WM0A 5IFPA 3UA3A 3TQ0A 3FEQA 2WVVB 4TUFA 2CYGA 3MZ2A 4YVXA 5BXPA 1H5VA 1XIJA 3NGJA 4ICCX 5BRQA 1VAHA 3H2CA 2DQWA 3KHDA 1ZP3A 4AD0A 1VC4A 4FIRA 1Y0EA 3SCTA 2GVEA 2Z25A 3OLDA 4H2CA 3G1SA 3HGRA 1CXFA 1MW1A 3UWUA 5HPOA 2OLSA 4I7WA 1TR9A 2PI6A 5CPMA 4HA3A 3GFZA 1UIPA 1K8ZA 2QIIA 2E6YA 2NX3A 1J79A 3BW2A 1VS1A 2AAAA 1ONRA 3WJWA 3WNLA 3QV6A 3GSMA 3GG7A 4PEKA 2VRJA 5G4EA 4D6DA 2R82A 4QG8A 3SN4A 1WQ5A 4ASTA 2AL1A 2GYIA 2HROA 3S5YA 3WK3A 2Y89A 3MCNA 3QOKA 4HK7A 1YEYA 3QQ1A 2F2HA 3EWXA 3NZGA 4UTTC 3L4VA 5IDIA 3NZ1A 1F7BA 1AD1A 3KVKA 4RV8A 4EANA 1ALDA 4UZSA 4XK2A 4A05A 4IZGA 3C86A 3W7MA 1OX4A 1WKYA 5AYYA 4P02B 4O18A 3M41A 2JALA 2VCAA 3KRSA 3QHMA 1SZFA 2YPIA 3PPGA 1NDZA 5LIYX 1H11A 1XSKA 2QCGA 2Z27A 4MFEA 2IMRA 1YBQA 3M0YA 3BL3A 4URIA 1QT1A 5C55A 1XLEA 1MW2A 1XBVA 1W37A 4PUMA 3NWRA 3N2OA 3ABXA 1TWZA 4MZ8A 3NPWA 2V69A 4IPLA 2QYGA 1R3QA 5B7ZA 1EUNA 2WZHA 3O0FA 4GK8A 4TMCA 2V2HA 4QXIA 3LHTA 4F2BA 1JUKA 4O4VA 4MHBA 2FQIA 2WMIB 3EOEA 1C93A 2W3ZA 3N12A 2OVLA 1ZJBA 2E5DA 2RGMA 3ZLGA 3WQ6A 4Q6JA 2BXZA 4GYKA 1S2TA 4MADA 3OG3A 4KIEA 1R3WA 1HP4A 3Q2DA 4FO4A 2YCLA 3KP0A 4F9DA 3VOCA 4D6IA 3CGTA 1EX5A 4U3AA 3VGDA 1S5VA 1TE1A 1WZAA 2QCHA 1F2JA 1W0MA 4AH7A 3BE7A 1WDPA 2Z7GA 3RILA 1VJIA 2JEQA 4L1GA 3PWIA 2J6XA 1F9CA 4OBTA 4BI7A 1HVQA 2HPIA 1HZYA 1BTCA 3H53A 3S9YA 4S3CA 2BBFA 3E12A 2RH9A 4AD4A 2CESA 4PYSA 1IEQA 3VKDA 3L2LA 2A7PA 5HJXA 3DC0A 3MW7A 1AD4A 4AVFA 1RLCL 3RRAA 1HVXA 1JPMA 3CAQA 4E6MA 2ALRA 4Q8TA 1A50A 4HPGA 1RQBA 5I24A 4YPJA 1Q8JA 2PDJA 2WWDA 3DFNA 3S42A 1UR2A 3VINA 1GORA 3B9OA 1KR0A 1KBIA 4RDZA 3S6TA 1UC4A 4XQ6A 1R6WA 3NQ2A 1J9YA 5AYBA 3W1XA 2CLLA 3EWYA 2QJHA 3SGZA 5FOOA 1VJSA 3D0CA 2NQ5A 4JFWA 5G2WA 3W72A 2WNQA 3ARRA 4LCRA 4FOJA 4W7VA 2QUTA 3P8IA 4DBSA 4GRSA 4PMRA 3N29A 3WQVA 2R1KA 3NFUA 4YYCA 4JD4A 2ZWZA 1EC8A 4CD7A 4AHOA 1ZBWA 1KB3A 4H9YA 4MPQA 4LBRA 1UR1A 4K8HA 4TV5A 4NNAA 2GSEA 2OWXA 4YS1A 1FP9A 1UBPC 3EWBX 5LHEA 3ABQA 5DMLA 2DVXA 4QJ1A 3E74A 4HN4A 4J3SA 1F6YA 4OIFA 1OT1A 1VJZA 2E1DA 4D6CA 3W86A 3B4YA 1ZHAA 3WH9A 1VBUA 3BGGA 3WX7A 4E3TA 5EFDA 3U4AA 1QOXA 5EMKA 1F3TA 3T8LA 3UWQA 3IJ6A 2QW5A 4YWSA 4KEVA 3PR2A 3O06A 4UFMA 1F3XA 2XVGA 3QFEA 2J74A 3FIGA 1UP2A 1MXDA 4N0RA 1FWGC 1A5CA 4ERAA 1B57A 4GJJA 4LEFA 2A2IA 2QDHA 3IIOA 1ICSA 1W9PA 2QV5A 1O6IA 3ITCA 4W8LA 5ECUA 3L23A 4ACYA 4AB4A 4JTRA 1KCKA 1NDVA 3LLFA 2VXNA 5A6BA 4E38A 1PUDA 1UQYA 3W07A 2CLOA 3P2VA 1AH3A 3O9NA 3REQB 1OGSA 2WZIA 3NQ6A 2C91A 5IDZA 1R8LA 2FPYA 3AMLA 3QR1A 3KZPA 4MVAA 2A3HA 1FTXA 4PB5A 3ITYA 2OCZA 5J5RA 3CHEA 1XLMA 2VGGA 2D1ZA 5MKGA 4C60A 4C7FA 5HOSA 1D7FA 5F2IA 3VIOA 3P62A 4GXWA 1LCOA 1XF0A 2D24A 1UWQA 4EPBC 1ML1A 4Q8OA 1NDYA 1SW0A 3WNMA 1BYDA 1PX4A 3MP3A 2J88A 1GKPA 1MNSA 4GKTA 4LUYA 1G7UA 3VIMA 2H9AB 1TV8A 2FJKA 1W5NA 3FXGA 2G37A 3CXOA 2OZ3A 2WQDA 2VEGA 5DELA 1EJRC 3PNZA 1A4MA 1BLIA 4H8HA 1E15A 3SN0A 4NZJA 1G94A 3GXIA 3AMKA 4BI6A 2C71A 1FFQA 1KRMA 1XBZA 4P61A 4FXRA 5A2CA 4HBKA 1YHTA 1VCVA 5GVJA 2C18A 3CWNA 2IPFA 3QPZA 5KITA 1UWAA 3ALFA 3W53A 1LT8A 1UKTA 3PHAA 3KW3A 4XZNX 3LU2A 1V7YA 1CXIA 4ZFMA 3CB3A 3TK7A 4BF9A 4Z2GA 4ILSA 4RE3A 3VE7A 3PTDA 1ELSA 4NZ3A 1F73A 1RPKA 8A3HA 4L4MA 2VGBA 2HEJA 1S5TA 1Q2SA 3QMRA 3CC1A 4YCPA 3QF0A 3W7IA 1YRRA 3GR7A 2YJQA 3WLIA 4JFUA 2Y63A 4Z2KA 2BY1A 3BJSA 4O0KA 4PCNA 4ECLA 2X42A 2XH2A 4FXSA 1A53A 1DJWA 1TX0A 1XKYA 5I00A 5REQA 1R86A 3NQAA 3KBSA 4QBXA 1CEOA 3UPBA 4U31A 3BW4A 4JX5A 1MI3A 3STFA 3BGJA 3C6CA 1QK2A 5K4XA 3N04A 1J0YA 2VX5A 5F4WA 1GJWA 5BWAA 2QT3A 2EJAA 5CJNA 4E4FA 3ZZ1A 2D23A 3IIPA 4XD6A 1UUQA 1LDCA 2XGZA 3BV7A 2B7NA 1Y7VA 3WEMA 3P0WA 1O95A 2NV2A 4LUIA 3PP7A 3B0PA 4L9XA 1RH9A 1KRCC 4DWSC 2NWRA 3IVUA 3WD1A 1KKRA 2QCDA 4PUJA 2DZUA 3ERPA 4J3UA 4AXKA 1DIOA 1IZKA 4RKAA 2FVKA 3CQJA 3DC8A 3OGRA 3P61A 5E70A 5KZ6A 2YXOA 4BQ3A 4CN1A 1LQAA 2YBTA 4RDVA 6REQA 3UJFA 2FJUB 4DELA 5CPNA 3BAKA 3APTA 3FCPA 3I7QA 4R33A 3DYPA 4FA3A 1WAUA 4LUTA 4CNTA 2OGYA 4CNPA 1W1TA 3VC6A 3WH6A 4MKNA 3WFZA 3F5KA 1WA3A 4LVBA 3JR2A 3W0KA 2V3DA 3V1HA 4W8BA 4PTVA 3KP1A 3LLDA 3R12A 1UJQA 3ZT5A 2BMBA 4H04A 5A1AA 1JPKA 3LTPA 3WEZA 4ZXLA 5CZKA 4PRRA 3KOFA 4FEZA 1V03A 4G56A 5D04C 4ZO7A 5HMDA 5G1MA 1E6ZA 4GO9A 1C7SA 1FA2A 3H12A 1QBBA 3G0XA 5D2XA 2V5JA 1SSDA 2PWEA 1X97A 2WSPA 3UETA 1LRQA 3K8LA 1P6BA 5M17A 1D7KA 1M03A 4MTVA 1EP2A 1ADSA 6XIAA 1UD5A 2DT0A 1REQB 4CU7A 3IRSA 3NYDA 1TELA 3LB0A 2FHBA 1B3ZA 1ISVA 3TIMA 2TMDA 2ZXAA 5AYZA 2NX9A 9XIAA 2WLZA 1HGYA 3O6AA 3M7WA 4ADTA 1UUOA 2I56A 4R27A 2GVGA 4XVEA 4PZVA 4RK8A 3N4AA 3ZM8A 4PCPA 3G8EA 3VDAA 1SZRA 1C8VA 1DBTA 2X1TA 3RCYA 2QGHA 4BK9A 3QYQA 3M0KA 4L56A 2ISVA 4IFKB 4UTKA 4GI8A 1V3HA 3RJXA 3QW3A 1S39A 1G7VA 2XGIA 4ZO9A 1UYQA 2W91A 3C0QA 4NL1A 3ZVHB 3NCOA 3TSBA 4IIBA 4DXKA 1XLFA 1BKHA 2WAGA 2RKXA 1OM0A 4XX6A 3PG8A 1EKOA 3W7JA 1AZ2A 1CENA 2A3LA 1R2TA 1DPMA 4RE4A 3S2JA 1TWIA 3N2XA 4F2TA 1QMLA 3BZGA 1D2KA 3CQHA 3SRFA 1EDGA 4WHBA 5AHNA 4KCWA 3DZ1A 1IZJA 2QDDA 5CPOA 1BWVA 2YOCA 2ZX9A 4F0SA 2DUZA 5JXQA 1J18A 4Q7NA 3C5QA 4OE7A 4JNZA 1V02A 4J3VA 3T8QA 5DANA 1E3XA 5DO8A 4WOQA 4C90A 2D2HA 4DXXA 2J24A 1SSGA 1ZL1A 2DJLA 2WCSA 3C52A 3AC0A 3WJYA 1GGOA 3DHPA 3DG3A 4GZ7A 4QAIA 3A5FA 4IG2B 5D2YA 3VPLA 3DI1A 3SADA 3QV9A 2EPKX 2PGFA 2FLIA 1AODA 4J3WA 2O9RA 3W3OA 5C70A 4GVIA 2FZBA 5AC7A 1B1YA 4IP5A 4NG3A 1GTEA 5H8MA 2JF7A 2XJ7A 3GVRA 3GK0A 3TR9A 4PL2A 4JY9A 5FAJA 3S46A 3KOZA 3GW3A 3NQMA 4DQWA 5A8GA 3SQMA 3DHDA 1HXJA 4N4PA 3VUSA 3U8GA 4ORMA 3SZ8A 3EZ4A 2X1UA 2OQYA 2YA1A 3LXBA 4UQEA 1S2UA 3BOXA 5I77A 1GHRA 3S2CA 1TZ9A 1PDZA 1JRBA 2XIOA 4K37A 4LUSA 1R0MA 4TOQA 3VC5A 5L9FA 1AH4A 2H8XA 1CPUA 5FJIA 7ENLA 3B8IA 3OP2A 3WDQA 1GVOA 1QI0A 4B2DD 1IEXA 3QY7A 3B9EA 4CNNA 3N11A 1RK5A 3JU2A 3EOSA 1XRTA 4KMQA 3ZJKA 3UF9A 1G69A 3AXHA 3I6RA 1H41A 4E4PA 1QPQA 1RR2A 2ZOXA 3TWAA 2X2YA 4G1KA 5K4ZA 3W25A 3BSHA 5AC4A 1DJHA 2ZADA 3VMNA 4PBGA 4FXJA 3A47A 5FJRA 3FGCB 4JTAA 3WZ0E 4AZCB 5EJZB 4P5UA 4IIHA 3RIKA 1E72M 1TWDA 1EO7A 4U10A 3T44A 1VZWA 4AHPA 4Q8NA 1O5XA 1R30A 4Z2JA 3MI2A 2IQTA 4MY1A 4MB4A 5CJMA 1I6NA 4KRUA 4B9YA 2Q8ZA 3CUGA 3U6WA 3KBJA 1D3CA 1MEHA 4ZQOA 4F3HA 1XR2A 1Q63A 1TTJA 2PF0A 2WHMA 3R43A 3RYSA 4BQ4A 3MUCA 4PRWA 2GUYA 1ZNNA 1XLDA 3TW6A 5LNSA 3CQIA 3CEPA 1IXOA 1DWAM 4PR4A 2ZC8A 4JZ5A 3CZGA 3MUAA 3W1UA 1FWBC 1LRTA 4I9TA 4DJDD 1M7PA 2YB1A 2V9DA 3ZXWA 3TCSA 1X1NA 3O2LA 2G3JA 4AF0A 3CASA 3N6QA 1ZAHA 3UWEA 3M0VA 2GJNA 3AXIA 2W0UA 3KLKA 2E9MA 2WMGA 1JCYA 3QN3A 4B5TA 2QS8A 4NAFA 2XN0A 3AHTA 3QPYA 4X0NA 4PMUA 4I90A 5FF3A 1F4AA 4MKVA 4OOZA 2EPHA 3DN5A 3VFCA 2NV9A 4WKHA 3AMCA 1A47A 3TR2A 5F2MA 1DJXA 2CBUA 2WC7A 4IPNB 3DERA 2BXYA 4AD1A 3QOMA 3M4HA 3SRKA 1XHGA 3MDUA 1EGZA 1UR0A 3DI0A 1TKKA 4LVAA 2ZTJA 2XFWA 3LK6A 3QW4B 3G5EA 3M0IA 1OCBA 3HPXA 4P7QA 5CXPA 1L8PA 5J04A 1KGXA 3PZGA 5D2VA 4IFOA 2Y1HA 1GEQA 3N9KA 1NFBA 2WWCA 1PVNA 2QUMA 5I3GA 4JIQA 3NSNA 4W4QA 1JI2A 4RZ4A 2VR5A 3VZYA 4GD0A 5H1WA 2NZLA 1DQWA 4K1WA 3MJYA 4GBDA 3WMCA 3P93A 1X38A 1OSEA 1FWDC 2P3EA 1MYRA 2OO6A 4HSNA 1H7RA 2KX9A 1JCTA 2FHCA 4IIGA 1QPRA 4PB3A 3W75A 1HKVA 3BGAA 4E4UA 5FL1A 1QRQA 1KCZA 1TJ2A 4EPEC 4GYPA 1NOFA 1W2PA 3GNXA 1W1VA 4FR1A 4WOZA 5HR7A 3OHIA 2VEKA 1GG0A 2J7FA 3AXXA 2LLEA 3RK8A 1Q6DA 5JQ9A 3GG0A 4TMBA 3P7YA 4DAFA 1R5YA 1WP6A 2CW6A 2VHLA 3MBFA 1BG9A 1ZLPA 4XBJA 5L6UA 4JQ4A 3SO7A 4DX3A 1UWIA 3AHYA 2Y88A 5DQPA 1V6YA 1XLIA 1TTPA 2VCBA 1K6AA 6CGTA 1YE4A 3TROA 1OX6A 2I7GA 3UJEA 1EGMA 1QOPA 2ZZ7A 4DB7A 3VIHA 3L7RA 4EK7A 3UZWA 1T8QA 1J0IA 1B9ZA 2ZVIA 1XLHA 4CUCA 5IM51 2A3EA 2QEZA 1TA3A 3M6DA 2GQ9A 2A5HA 2NVDA 3AIVA 5FEWA 2ISDA 2O9OA 3C2YA 4XKYA 2WVSA 1SPQA 4UTMA 5EGRA 3UESA 3NPXA 5AZ0A 5GNYA 4K1GA 4DLMA 1WKEA 4F0LA 1TV7A 7TIMA 3RCMA 1MXGA 3FV9A 1A4LA 4UBPC 4B5XA 1CDGA 4Q22A 2VWSA 3A3HA 1JNDA 5CPQA 3WUEA 2WNNA 4DY1A 1V51A 4S38A 3MO4A 2WJZA 4YN5A 3C8NA 4FZIA 3SN1A 5D33A 4AG0A 1RY8A 1LBMA 2GGHA 3LM3A 1GEHA 1GVSA 1M53A 2OSXA 1XYCA 3TLQA 3V0UA 3M5YA 2C3ZA 3WLMA 3DFTA 3IIXA 5C6MA 1UZDA 5DCDA 2WBGA 4NF7A 4LC8A 1AL7A 3VKAA 4BWLC 1R46A 2O9PA 3B0XA 3TKFA 4NNCA 4D8ZA 5AC5A 4AUBA 3TYDA 4IXHA 3H4XA 4ZOAA 3Q45A 1GKQA 4C65A 4DRSA 1WDSA 2WSRA 2ABBA 5TIMA 3L0NA 2I17A 3CT7A 3VOGA 2Z1SA 3W00A 3VTRA 1LWIA 5C5YA 4LCQA 3CUZA 1A5MC 1P0NA 2OTDA 3TMQA 4IMEA 1H62A 4UOQA 3STEA 2W66A 2GJXB 3HIJA 1OC7A 2PDNA 3QGKC 3F4CA 1BSLA 3UG3A 3UU0A 4XG1A 5JBDA 3L0GA 4XIAA 2CZFA 1F76A 2PDQA 2IQDA 1AH0A 2VD8A 3WMLA 1ZAIA 2PDWA 3VCCA 4U28A 5EMLA 1ESWA 2CBJA 2ZUNA 3R10A 4GUJA 4IGNA 2IUZA 1U83A 3ZR4A 2VVNA 1TV5A 1UWUA 5BCAA 3KX6A 7REQB 4X0VA 4N6FA 4OVXA 4K7VA 2B7OA 3LGEA 1O66A 3G1RA 2VFDA 4W87A 3QTGA 3CQ0A 1UH2A 5F2LA 5BZAA 2BOEX 3H26A 1FCVA 3W83A 1F07A 1A0EA 3S1UA 2QXWA 3VNKA 3FAXA 2EAWA 5CJ5A 4QCFA 4ZSTA 1H1YA 2FPTA 2W63A 3I6TA 3N3MA 2XFYA 4R85A 1SO5A 2XZ9A 5LA2A 4ACZB 2AL2A 3W1MA 3VIPA 3WELA 3NL3A 2PBOA 4H9ZA 1F8IA 3GLCA 4KCUA 2PCQA 2VQUA 3V1PA 5G1TA 1W3JA 3FHQA 3G0UA 4PCTA 2OYKA 4CCEA 1GYNA 1MUMA 3QZ6A 3L5MA 1TCDA 3VD3A 2YB4A 3WDIA 2P5NA 2IXUA 1ZCOA 5FKYA 5K9DA 4CQDA 3HMCA 2VRQA 3HU7A 4E2VA 3CTLA 4LAUA 1V6XA 1Q7ZA 4DN1A 4Q4KA 3LZ5A 4H9XA 4XBSA 3T2OA 1UKQA 3W7OA 1J0ZA 4HNOA 4KFOA 4ZQRA 1ITQA 2E9BA 3OODA 4C6EA 3BARA 4O28A 4HD5A 3MCMA 5T8GA 4DVOA 4HMDA 3RHGA 2VVSA 2QUVA 2J13A 3R0UA 1UD4A 4JKMA 1IEVA 4A8NA 2ZX6A 4U3CA 4FHAA 1WDWA 1Q66A 4PUNA 1S38A 1E0TA 4GIEA 3BMXA 1UZ4A 1X7FA 5CZJA 4F9JA 1OADA 1W5PA 4O8RA 3U7VA 1EEXA 1SW3A 4GI6A 1YPIA 2Z24A 3WJZA 3PY2A 3WF3A 3IPWA 5DT5A 1WXYA 3QH2A 5BXSA 1V3MA 2DDXA 3CUXA 1TJRA 2X7WA 1P43A 1ADOA 4HN8A 3NPVA 4P00B 4U2YA 1J8VA 3FA4A 2ZA2A 4LY8A 1WDRA 4G7FA 2XIIA 4PN2A 3C2RA 1LOQA 1TVNA 3MSYA 3HOJA 3WLTA 4J1OA 4MYAA 1WYIA 3LA4A 4P8VA 4WF7A 1NJJA 1QJWA 2YA2A 1MMFA 4M29A 2X8RA 2V5LA 3PZTA 1HUVA 3UZZA 1XD0A 3L0KA 1EF2A 2FFCA 3WENA 5I3HA 2C15A 4RR4A 2O0TA 2J7HA 2GOUA 2AKMA 1XSJA 2YIHA 1K8XA 2EKGA 3H7UA 1JZ8A 2VYOA 1XV8A 4WGHA 3BJFA 3STGA 1R2RA 3FSUA 4C5ZA 1QNSA 3GUGA