4EE9A

Crystal structure of the rbcel1 endo-1,4-glucanase
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
321
structure length
321
Chain Sequence
SVDLIGINVAGAEFTGGKLPGKHGTHYFFPPEGYFEYWSEQGIHTVRFPLKWERLQPSLNAELDDVYASLVDDMLDQAKENDIKVILDVHNYARYRKKVIGTEDVPVSAYQDLMERIAKRWQGHDALFAYDIMNEPYGSADKLWPAAAQAGIDGVRKYDKKRPLLIEGASWSSAARWPRYADELLKLKDPADNMVFSAHVYIDEDASGSYKKGPGKDFEPMIGVKRVEPFVNWLKEHGKKGHIGEFGIPNDDERWLDAMDKLLAYLNENCIPINYWAAGPSWGNYKLSIEPKDGEKRPQVALLKKYAAKDNCSDFGPAKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
publication title Three-dimensional structure of RBcel1, a metagenome-derived psychrotolerant family GH5 endoglucanase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 119
structure length 321
sequence length 321
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ee9A00
2D20A 2NT1A 1A47A 2J77A 3W26A 3PZGA 3O6AA 1ZBWA 1V03A 3B9AA 5E9AA 2ZUNA 2XFYA 2DPEA 5FOOA 3BXWA 1WNOA 2WMJA 3VIMA 1XSIA 1K9TA 4BS0A 1HT6A 1UH2A 5LA0A 4Z2GA 1CTNA 2BNJA 3B8SA 1EGZA 4AY1A 3WDPP 4X0VA 2PWEA 3M07A 2A3HA 2DT0A 3N13A 3AXIA 1XHGA 2Y24A 3SEPA 4PYSA 4P7NA 1X6NA 3ARQA 2YIHA 5A6SA 1CGUA 3CZ8A 1OWQA 3WF4A 1HX0A 2D1ZA 1CGWA 3WH5A 2C0HA 2Y2WA 5A6MA 3A6OA 1B3WA 4V28A 1EQPA 4IISA 2XGBA 4FLRA 5A8PA 4DWSD 1ISWA 1W1TA 1GJWA 1NOWA 4U2ZA 1B30A 4B15A 1CLVA 2YL8A 4RL3A 1CXEA 1OINA 3K46A 1J0JA 1Z32X 1GVIA 3VGGA 2YOCA 4CD6A 1KGXA 1VFMA 2WC7A 3OGSA 4CN1A 4ZXLA 4CVWA 3ZSSA 3AIQA 2VTFA 1MW0A 4V2XA 1G94A 3VD3A 3L4YA 4DWSC 1MWOA 1JDCA 1J0KA 1Q6GA 2NT0A 4J3TA 2CHNA 4Y7EA 2YL9A 5IFPA 1W9PA 1JZ7A 2PWHA 2X0HA 1KCKA 1E0VA 1E4NA 3L4VA 4PMXA 3EMZA 4HOWA 1GW1A 1WDSA 2FDMA 2ZUSA 1WDRA 1I75A 1VFFA 1HJWA 4AZHA 1BPLB 1XD0A 2IXVA 1UZ1A 3WEOA 1E6XM 2PB1A 3WUFA 4C7DA 5IDIA 5CXPA 4QFUA 2ZUWA 3WNKA 1HKKA 3BH4A 3OGVA 2J8FA 4PSRA 4WF7A 1CXLA 2OYKA 1I1XA 1C8XA 4AXNA 3UG3A 1UWRA 3FW6A 2YBUA 4PMZA 2WC3A 3AS2A 4IPNB 5EB8A 4U5KA 3CZJA 3VTRA 1NH6A 1CGVA 2UY5A 3ZR6A 4BZYA 5I77A 1HKIA 3TONA 2DH2A 1NM9A 1VIWA 1ODZA 2XVNA 3BCDA 2G4FA 1OSEA 3AMKA 1B9ZA 4NI3A 3KEHA 1BGAA 3GYCA 5KZ6A 1RH9A 4PSPA 1JYWA 4MADA 4ACZB 1E40A 2J7CA 3LPPA 4PTWA 4XZBA 3WNLA 1UOKA 3W38A 1SR0A 2JF6A 3MKKA 1FA2A 2VURA 1LL4A 1EH9A 4GO8A 1OB0A 3UG5A 1OIMA 3CZGA 2VQUA 3CZEA 1UH3A 2GDVA 4AZCA 3VD9A 3VNZA 1E15A 4GI8A 1F4AA 2E8ZA 4WSJA 3ARSA 1VAHA 3W27A 4CKQA 2EO7A 4CN4A 3VDCA 1GUVA 3CUJA 3NCOA 1UH4A 4QP0A 2RGMA 2VVNA 2O9RA 1DWGM 1W1PA 3ZOAA 2V3GA 2Y8VA 2OWCA 2CPUA 2QMKA 2Z1KA 5AY7A 3T2OA 2J62A 1HP5A 2J79A 2VZUA 1LG2A 1GOOA 3PTKA 5KEZA 4HU0A 2VCAA 4WIWA 2D0GA 1L0PA 3DYOA 1J0IA 5F7UA 1FP9A 5A2BA 2PWFA 3SCPA 4WSKA 2WAGA 1TCMA 3GXDA 1KWGA 4AZBA 1H0IA 1QPKA 2WVVB 1HJVA 4AISA 3L2MA 2VRQA 4PUEA 1W1YA 5LYRA 5E6YA 4AWEA 3IAQA 4MNKA 2QMJA 3OLGA 3POHA 1V3KA 1E3XA 1XD1A 4XZWA 1JD7A 3F4VA 2XIBA 1B1YA 4ZE5A 2ZUMA 1IT0A 3W28A 2BS9A 5BXPA 1TZ7A 4M1RA 1XH1A 2WMGA 2BXZA 2EPOA 3U57A 2WMHA 4XX6A 1JF6A 4X9YA 3WNMA 2AAAA 1LG1A 2OWXA 3T0DA 1CDGA 3I3BA 1B2YA 3VIHA 2G3MA 1CECA 4WJXA 1J11A 1PX8A 1HKJA 2XVPA 3QOKA 2D2OA 2ZUUA 1JAEA 2CYGA 2J7EA 5GQBA 5JUVA 4IUGA 5GPRA 4MDOA 3M46A 4KRUA 2ZX5A 2YA1A 2WHKA 1HNYA 5E0CA 1KBBA 4FLSA 4P8XA 4TOQA 3SCQA 3W6LA 1IZKA 3EDKA 2CHOA 3G6MA 1V3IA 1US2A 5EFFA 1E55A 3NYDA 1KQYA 5FD0A 3WDRA 3WN6A 3VD7A 2WC4A 3W29A 1NP0A 3RM9A 4J3VA 3LPFA 3WF2A 3ZJ8A 1C91A 5HPOA 2DDXA 2J7BA 4BCEA 4S3KA 1JXJA 4J27A 5CZKA 3ECQA 1JD9A 1JI1A 3VGBA 5HDRA 4KH2A 3IJ7A 3SCUA 1JZ5A 3B9EA 3S6TA 2V3DA 1A3HA 2ZX6A 3AYSA 1R87A 3EYPA 2VO5A 3OLIA 5D9PA 4FF5A 1JDAA 4MB4A 1R7AA 1E9LA 3BAJA 4GPNA 4UFJA 1UKTA 3POCA 3WUGA 4JFWA 1KGWA 2YKKA 4MB5A 1IV8A 3PZ9A 2VZTA 2FHFA 1XRVA 1GPFA 1HIZA 1KXQA 4DM1A 3ARWA 2F8QA 3WQVA 5BXTA 2E9BA 5M3WA 1KFWA 3M6DA 3O2LA 3SCNA 2YDQA 3BMVA 5A8NA 1E72M 1DHKA 2VCCA 1E70M 4Q7NA 4U3AA 3WMSA 1V3JA 4JFSA 5E6ZA 3CIVA 4H2CA 3PZVA 4ZEPA 3OGRA 2JF7A 2XG9A 4BQ2A 1C92A 1J12A 1SFSA 3AZRA 2OLHA 1V02E 2J4GA 3ZJ7A 2YA0A 1Q6FA 2A3CA 4IPLA 3PN8A 1OGGA 5CPSA 3PBGA 1E3ZA 2XSAA 3NIYA 3KZSA 1W2PA 5D9NA 4WKFA 6CGTA 2YLLA 4M24A 2EPMX 3ARXA 1AQ0A 1XCXA 3AQUA 2ZXDA 3DYPA 4W93A 1UWIA 4M81A 1Q6EA 3WF3A 3RMEA 1DEDA 1GHRA 5I24A 4MAVA 1MYRA 2ESCA 3TTOA 1EOMA 4B9YA 1UR9A 2HISA 3KL3A 1US3A 4GZJA 1TA3B 1EOKA 4OKDA 2FGLA 3N18A 1QHPA 1JIBA 3U7VA 2ZXQA 3MMUA 3RIKA 1W3LA 4A4AA 5A95A 4UZUA 3OLEA 3J7HA 4A3HA 4F79A 3ZJKA 3W37A 3HN3A 1OD0A 4JL1A 2EBNA 5A2AA 4D1JA 3ZT6A 1NARA 1QHOA 1AQMA 6TAAA 2OYLA 4CUCA 1VBRA 1OBAA 3E1F1 1O6IA 3I3DA 2VT0A 4MJ4A 3WH9A 1MW1A 2B31A 4K68A 2XHYA 1E0XA 4R27A 1FH7A 5I79A 1EDTA 4KGLA 1UZ4A 2D0FA 8CGTA 1UR0A 3UESA 1DWAM 1H5VA 2WVTA 5A1AA 1PZ2A 2UY2A 4FLOA 3NDYA 5BYWA 5M5DA 3TTSA 5FL0A 1QW9A 3MSGA 3CZLA 1NP2A 2WK2A 5A6KA 3IANA 2WWCA 3T2QA 4CCDA 2A3AA 3A4AA 2D3LA 3GXMA 3SUWA 4AEFA 2WW5A 1TA3A 4HMCA 4P8VA 2D3NA 2VX5A 3PHAA 2WB5A 1UHVA 4D6GA 4UQBA 4PUDA 3VGHA 4LXFA 3VD4A 1CPUA 1KXTA 4W8BA 4RE2A 4Z2HA 3VINA 3AMDA 1EO5A 1G5AA 1W3KA 1ESWA 2WM0A 3GNRA 1NOFA 2X0YA 4JFTA 1XYFA 2E3ZA 2G3JA 4KRTA 1PEZA 3VKKA 1C90A 3O9NA 4CD7A 5A6BD 4OOZA 4DWSA 4F9JA 2FHBA 1G01A 1H41A 2WVUA 3FAWA 3FN9A 4PTVA 5IHRA 1LWJA 3BAIA 3N15A 1B90A 2WHJA 3CPUA 3OIHA 1W3JA 4TVDA 1K9EA 2Y4SA 3ARUA 5CJ5A 3PTQA 4OBRA 2ZWZA 5HNNA 3CMGA 1PPIA 1WAWA 2J7FA 1Q6CA 3W53A 4BQ5A 4PN2A 1CXHA 2E9LA 3AS1A 4GIAA 1TVPA 4XB3A 5A3HA 3VPLA 5CLTA 3VMOA 4HZ6A 3WIJA 1FH8A 3BLPX 2WMIA 3IK2A 4UR9A 2FHCA 3WBEA 2FH8A 3W24A 1UQZA 2QV4A 1QNPA 2XUCA 4YHEA 1RP8A 2ZXBA 1QNQA 1EDQA 1GOKA 2JFEX 2VX4A 1R85A 3CUHA 3VIIA 3FY1A 2D24A 4Z2JA 2BY3A 1AVAA 2VOTA 1JZ3A 3II1A 1TR1A 3WQWA 1W2VA 1LLOA 4HA1A 2GK1A 1BG9A 2WPGA 1VEOA 4AD0A 4CCEA 2VNCA 4S3JA 2YDSA 4AZCB 1MW3A 1HJXA 4UFHA 1QW8A 3AHYA 1L8NA 1OGSA 2VUYA 1GOMA 4PEEA 1U2YA 3WNNA 2J7DA 1DWHM 4PMNA 1Q4NX 2JALA 3VIGA 3BGAA 5CSUA 3K4AA 2XVLA 1RD6A 3WDHA 1SYTA 5BROA 3VUPA 3VM5A 2VX7A 5BRPA 3GNOA 1W1VA 2CBUA 1ZBVA 4XUYA 5IFTA 5FKYA 4TVCA 1PJ9A 3PZMA 2D0HA 4PMQA 1E43A 4PCSA 4OUEA 3T0BA 1BVZA 1CLXA 1N82A 2W66A 1JG9A 1C93A 4H04A 4UOQA 4AZGA 3MUIA 1HN1A 3BAYA 2VZOA 1KXVA 1ITXA 5BXSA 1MW2A 1E6SM 4W7WA 3RO8A 1LJYA 1KCLA 1VRXA 4PBGA 3MMDA 4EE9A 2ZWYA 1GCYA 2BFGA 2J78A 4OZOA 3RPMA 7A3HA 2A3BA 1PIGA 3RCNA 9CGTA 1QBAA 3MANA 1W9DM 2CKSA 1JNEA 1FFRA 1HXJA 2UY4A 5DO8A 3GH7A 1DWFM 1J0YA 3SCVA 2CKRA 1NWRA 1CGTA 2BHUA 3FAXA 1C7TA 4Z2KA 4D71A 4AEEA 1BQCA 4U2YA 3W81A 2BVYA 2VQTA 3WUEA 3WDIA 1V6YA 2BY0A 5D4YA 3WH7A 3ARTA 3UG4A 4JKMA 4D1IA 1LL6A 2WVSA 1VJZA 3AXXA 3WH6A 3SUUA 1UD3A 3RJYA 4AIUA 4W5ZA 5FIPA 3F5KA 5TD4A 3EMCA 1V0MA 1W3HA 3VX1A 3VGEA 5CPQA 4HP5A 5CGMA 4TUFA 3F5LA 5HOSA 2O9OA 4MDPA 3VILA 4CN6A 5LA2A 3S2CA 4H7VA 5EFDA 5AC5A 4W89A 4LYRA 4FK9A 2CEQA 2VZSA 2PWGA 1W9BM 1IZJA 2VRKA 2VMFA 1EO7A 4LQ1A 5E0FA 2X05A 5CLWA 1E6RA 5M17A 3RJXA 2YJQA 1HJUA 3I3EA 4WKAA 3VGFA 4E8DA 3WQ4A 2VCBA 3SCTA 3HMCA 4NRSA 4NRRA 2VJXA 4FLQA 1BF2A 4D6CA 1AQHA 1SMAA 3BLKA 3OA5A 4E2OA 3MUZ1 3WDQA 3M7SA 4N42A 2GJRA 4B3KA 1E5JA 4J28A 2XTKA 3A47A 1CENA 3VIFA 4AIOA 1DWIM 1EQCA 1VB9A 2XM1A 1VBUA 5CQ1A 5HPCA 1JAKA 3NUKA 1JL8A 1MQRA 4LX4A 4UFMA 3WQ8A 3WNPA 3VO0A 3D5HA 4M8UA 3WD1A 2YDRA 1J01A 3NJ3A 1X6LA 5A6LA 1GQLA 3WY1A 3DECA 4HA4A 4QCEA 3G6LA 3AS0A 2WSPA 4MTVA 2XPKA 4AD1A 5DFAA 2ZXAA 1JF5A 4AC1X 5A8MA 4PMYA 1CWYA 2VRJA 4W8AA 4GO9A 3WEMA 4W8LA 3AHVA 4QLKA 4QAWA 2WBKA 4BF7A 3PZOA 4JFVA 2XWDA 2AOSA 4CGTA 4OOUA 1G9HA 1J0HA 3UR8A 4TX6A 3MS8A 1OT1A 3WD3A 3LPGA 1YHTA 1WZMA 3THDA 5A94A 1KR0A 1JZ4A 2PF0A 2GJPA 1E1EA 4P7LA 1GJUA 1GOQA 3UCQA 5BRQA 3WDJA 2YA2A 3RM8A 1J9YA 5D8WA 4QDMA 2QPUA 1XH0A 4UCFA 1EIBA 4GI6A 1P6WA 1E6PA 3TTQA 2ZIDA 1E1FA 4Z2IA 1QI3A 4GI9A 4XV0A 4W86A 1LQ0A 3PZUA 4X0NA 3U5UA 3AIUA 1HL8A 2G8ZA 4CVUA 5AYBA 3A4WA 1XSJA 1ODUA 1OIFA 2WHLA 5A6AA 2XVGA 3IAPA 4QLJA 4D6EA 2GUYA 1GORA 1GOIA 1OGBA 2JEQA 4HMDA 4F8XA 3SUVA 1XV8A 5D9MA 1V6UA 2W63A 1SMDA 1ZJAA 4LPCA 2BVTA 3L4WA 3GM8A 2V5DA 2WHMA 3WL1A 1V0LA 2MANA 2ZX9A 5I0DA 4ZFMA 4P7OA 2VX6A 1MVYA 4PTMA 4MAZA 5GNZA 4E4PA 2RGLA 4H8UA 4PMRA 2X2YA 2GSJA 5C8BB 1BYDA 2W62A 3VNYA 4PMOA 4YN5A 4KGJA 3GZAA 2E4TA 1WP6A 4D6JA 1XH2A 1FHLA 1E73M 2IUZA 2Y5EA 5DEZA 3ALGA 2G3NA 3W6MA 1VFOA 3ZM8A 1BAGA 1H3GA 2JE8A 4EK7A 3APGA 4JKKA 1PBGA 1TVNA 3ZMRA 4NSBA 2ZE0A 2DT2A 2J25A 3PZTA 1H0GA 5GNXA 1OCQA 2VC9A 2WMKA 5ECUA 3MU7A 1LF1A 4DUVA 4E8CA 4CU8A 2WWDA 3WQ5A 4LYPA 3VVGA 1UG6A 4ATLA 3WKZA 3ZQ9A 1WPCA 4DUWA 1PX4A 2C7FA 2XFRA 4FMVA 4M80A 3AS3A 1V6VA 3MV11 3BAWA 1XGZA 4P8UA 4W88A 1HL9A 1WB0A 3CGTA 3ARVA 1Q6DA 3WMCA 1W9UA 4DWSB 3ARZA 3L4UA 1V02A 1WDPA 3QHMA 3UR7A 5GNYA 2YLAA 3SCRA 2EQDA 3AIRA 4HMEA 5JIWA 5IHSA 1NOUA 5I78A 1QI5A 2DSUA 4D6DA 2DSZA 2WKLA 3ZJ6A 3EDEA 3GNPA 2J75A 5E70A 1TG7A 4B9ZA 2NW0A 2CITA 4W87A 3W25A 4WLCA 3RILA 5I23A 3WF1A 2YL5A 1KWKA 5HXMA 4CD4A 5EBAA 3WD2A 4LYQA 4ATWA 3KL5A 2WMIB 5A8QA 2F61A 4UFIA 5A6BA 3W0KA 3WFZA 2GDUA 1JGIA 3A3HA 2QPSA 2PC8A 4U5IA 1WE5A 3U5YA 1FP8A 1O7AA 2IXUA 4UQEA 4CD5A 1UKOA 4HOZA 1XYZA 1JFXA 2FH6A 3BCFA 2EJ1A 1UD2A 3K1DA 1H4PA 4GZIA 4JIEA 1LWHA 1WZLA 1E4IA 1UR4A 1CZ1A 2CXGA 4ZE4A 2GK1B 1EDGA 4UFKA 3K8KA 1CNVA 1R86A 4A3YA 3BSHA 2GJXA 1JI2A 1YQ2A 2WZHA 1UA3A 4JCMA 3OZOA 3WL0A 1B3ZA 1UYQA 2UWFA 3DYMA 1HVXA 3EDFA 4AZ5A 4EKJA 1CXFA 1XC6A 1E6ZA 3AICA 1TE1A 1WDQA 4MNLA 3WFLA 1OD8A 4W84A 3HU7A 2GFTA 3KWXA 4PMUA 3WBAA 1GQJA 1W9VA 2DIJA 4YPJA 1KBKA 1J10A 2JIWA 2FGZA 4QCFA 4YHGA 3N04A 3VMNA 1DTUA 3JUGA 3AI0A 3GXFA 1H11A 1QHZA 4DM2A 2YBTA 1UD5A 3U7BA 2WLYA 3N17A 4GXPA 3AMLA 4V27A 2VI0A 2DQXA 4MNJA 3T2PA 4AD2A 5JIPA 1E4LA 2NSXA 4AZIA 3N12A 1OM0A 4D6HA 1B3VA 3VU2A 1B3YA 1CGXA 2OSXA 3VIOA 2CBJA 1JZ6A 4QLLA 3QGVA 4U33A 3K4DA 1FFQA 1KGUA 1UUQA 2OYMA 2BY2A 2O92A 1MFUA 4AMCA 2E8YA 4J3XA 2CESA 4D72A 2WKGA 1UD4A 3VIPA 2W61A 4CD8A 1ISXA 3SUSA 4B3LA 4JL2A 3D3AA 5C70A 1U30A 3QHOA 2VL4A 3VX0A 2Q8XA 4PCTA 5I5RA 1JZ2A 1JZ8A 5M03A 3VOCA 3LMYA 4M29A 3K8LA 1HP4A 5BXRA 1D3CA 3VIJA 2O9PA 1BFNA 3QR3A 1MFVA 2E0PA 3EDJA 1BYBA 3T08A 1E56A 2JEPA 1CXIA 2W91A 3L4ZA 4RE3A 4HPHA 1E6NA 3EBVA 4UQDA 4N0RA 5DF0A 3VGDA 2XGIA 4HU8A 3VDHA 3SUTA 3UERA 3WD0A 1QVBA 1VEMA 2DEPA 4HZ8A 4AIEA 2DGAA 4GINA 4BQ4A 4JAWA 1ZBCA 1GZJA 4JHOA 1G0CA 4JCLA 1KR1A 4Z2LA 1JNDA 1WCGA 2QHAA 4NZCA 3NSMA 3AHXA 1Y7VA 3N11A 3SCWA 2F2HA 1ZL1A 2UY3A 3GBDA 1UA7A 4J3UA 1K6AA 1CYGA 4R5EA 3ARYA 1M53A 2J47A 3AHTA 4ZENA 1VEPA 1EHNA 1BG4A 5EMYA 2PWDA 2WCGA 1UWSA 1VJSA 3WQ6A 4DUXA 4MB1A 2EPNA 3AIWA 1CGYA 1GOWA 4UQAA 1WZAA 2GVYA 5I6SA 2CETA 1K9FA 3CUGA 5FL1A 1BLIA 2G3IA 1M04A 3WH8A 5A69A 1BYAA 1D7FA 1M01A 3WD4A 3W82A 3SIMA 1NWUA 1R8LA 4BQ3A 1MQQA 2O9TA 4HA3A 4GZEA 4CCCA 2JIEA 5AYIA 1EA9C 5HBFA 2DH3A 3WEZA 2BVDA 3PZIA 3OBAA 1FHDA 4H41A 1XSKA 1GONA 2EPKX 4AD4A 2W92A 1QNOA 2Z1SA 3L4XA 1VF8A 1W91A 1UR2A 5BWFA 1M03A 3ZSTA 1VENA 4EANA 4GKLA 3L2LA 5ABGA 1CXKA 3ZO9A 1JYXA 4Q22A 2DT3A 4WKHA 1NQ6A 1QBBA 2CBVA 2WNWA 4IM4A 2CBIA 2PBOA 1E71M 2DT1A 2WXDM 2CCRA 1UKQA 4W5UA 1TFVA 3VIKA 5JBDA 2E40A 1UWTA 1UKSA 1EHAA 3WF0A 3BMWA 2EXOA 2XFFA 2ZX8A 2BV9A 3FXYA 1DWJM 3AIBA 2WZEA 3CMJA 2AMGA 3FNDA 3WENA 1MQPA 5ABEA 3MSDA 1FOBA 3EMQA 3UEQA 2V38A 1I1WA 3CBWA 4UQ9A 5E09A 3MUAA 3K8MA 3N1AA 1BTCA 1JFHA 1C8QA 2EPLX 1EXPA 2WYSA 4ACZA 3AMCA 3OB8A 1H49A 3DHUA 1U33A 4B16A 4TTGA 5DT5A 3AXHA 2OSWA 4J7RA 2V3FA 2WBGA 3CHEA 2WCAA 4JHZA 4W7UA 2VVSA 4MJ2A 2PBGA 2X8RA 1JYVA 1UWUA 2WZIA 2C8NA 3BAKA 1B3XA 3IJ8A 2TAAA 4M82A 4OJYA 5CG0A 7CGTA 1ITCA 4F9DA 4UQCA 5AC4A 4L4OA 5FCZA 2XVKA 1V6WA 2XJ7A 1ZS2A 3A4XA 4OIFA 3GTNA 4U3CA 3KE0A 1XCWA 1C7SA 3OG2A 5A2CA 3ARPA 1BYCA 1V08A 3ZR5A 3PTMA 3SCOA 4PMVA 1J18A 5ABFB 5DMYA 1JXKA 1HKMA 1TMQA 1JYNA 3PZQA 1GVYA 1TUXA 3CHFA 2CIPA 2ZICA 3VD5A 2J7HA 3VM7A 3T09A 2WVVA 1QI2A 1QI0A 3FHQA 3DHPA 1ECEA 2DSWA 3B9DA 3BC9A 3OZPA 3BAXA 2X09A 4HPGA 4P7QA 4UFLA 3T0AA 4KMQA 1HVQA 1C8YA 1GQKA 4KWUA 3MO4A 1E5NA 4ACYA 3OLDA 4P8WA 1H1NA 2Y8KA 3GH4A 4D6FA 3AFBA 5D8ZA 4H8VA 3CUIA 3AZSA 5JBFA 4HZ7A 2ZX7A 1R7OA 3UETA 2W4XA 3QOMA 5A6JA 2E9MA 4J3SA 1ZBKA 2W67A 3GDBA 4HOXA 2XIIA 3PZNA 2XWEA 4CU7A 2HVMA 2OWWA 1S46A 1W9XA 1M7XA 1KB3A 1KQZA 1D2KA 1V0NA 2DSVA 1AMYA 1G1YA 4JZ5A 4UZSA 3NSXA 2VR5A 1UR8A 1JDDA 4AD3A 3AOFA 4JFUA 1X1NA 4TVUA 4C7FA 4D6IA 5CPTA 2A3EA 1H09A 1OT2A 1UD6A 3AYRA 5ABFA 1ZB5A 1B31A 4ML4A 2ZUVA 1FH9A 1K9DA 1BVNP 2G41A 3WMBA 3DC0A 3L4TA 1HJQA 6A3HA 3CZKA 1GHSA 1KXHA 1RP9A 1RPKA 1PZ3A 3AIVA 3N9KA 5D9OA 1CBGA 3MMWA 2XYLA 1HF6A 1CEOA 4AW7A 4URIA 4BA0A 2WLZA 1B0IA 4AZ7A 3GH5A 4PMDA 5CGTA 3AHZA 3TTYA 1V3MA 2QF8A 2XM2A 1PX3A 4UOJA 4L4PA 5A8OA 4UNIA 4NF7A 1E6QM 4MPKA 2J7GA 3TP4A 1E4MM 4GQQA 2D22A 4GQRA 3RDKA 2WMFA 3CHCA 5C71A 4AD5A 1E0WA 2DSKA 1PIFA 3ZIZA 3MV01 5DT7A 2QLYA 3GXIA 1V3HA 3WUBA 5CSYA 7TAAA 3THCA 4AZ6A 4UTFA 1ISVA 2WCSA 5I2UA 3KL0A 1WKYA 3AROA 3VDBA 4TX8A 2D23A 1NWSA 2DIEA 1ISYA 1QNRA 3IJ9A 3NDZA 4EAMA 3CHDA 4H8HA 3AISA 4LGXA 2PI6A 3WSUA 3SURA 4WK9A 5I3DA 3AIEA 1BHGA 1ZU8A 2OSYA 1UKPA 1ZJBA 4AYSA 2GJXB 4MNMA 4F66A 3EDDA 8A3HA 3ALFA 4U31A 4C7GA 1MXGA 2V5CA 3NSNA 3ZT5A 4ZXOA 4J3WA 1J0ZA 3HJEA 2VR4A 2ZOXA 1WZKA 1QNSA 3QHNA 3FHAA 3AMGA 4JKLA 3F5JA 1MXDA 4ATDA 1UR1A 3TOPA 2CNCA 1UWQA 2EEXA 1GQIA 1UQYA 2BHZA 4M56A 1LL7A 1GNXA 4PTXA 3TA9A 1V0KA 3AJ7A 1ISZA 4TXEA 3W4RA 3CLWA 3RM4A 2YL6A 1H2JA 1F4HA 4P7RA 3BSGA 2VZVA 2WANA 3WNOA 3CO4A 3AZTA 1V3LA 4MB3A 4PRWA 2J74A 4TTUA 1WO2A 4RE4A 3VMPA 3WELA 5IXEA 1VFUA 4OBSA 2ZUTA 5ABHA 5JBEA 1HJSA 2W5FA 3ZT7A 1BGGA 2X1IA 1PAMA 1NWTA 3SCSA 3GBEA 2XSBA 5LA1A 1QOXA 2J8GA 1CIUA 1BSIA 1UD8A 3VDAA 3CTTA 2BY1A 4UOZA 3CUFA 3MUY1 4W7VA 2V3EA 4CU6A 1QI4A 1DP0A 2CERA 3CH9A 3ARRA 4HTYA 3LPOA 2WSKA 1C3FA 2BHYA 2BXYA 4W85A 5BCAA 1W32A 1V6XA
chains in the Genus database with same CATH superfamily
3W01A 3PY2A 4H6RA 3N29A 2DVUA 4JN6A 1YNPA 3O6AA 3L2IA 5E9AA 5I7GA 2DPEA 3VCCA 2C0AA 2H90A 1WNOA 2V81A 5AN7A 3QM3A 1UH2A 3N2CA 1CTNA 2YCJA 3B8SA 1I9CB 2NQLA 3WCZA 2Y24A 5C9ZA 3H2OA 1XI3A 1X6NA 1M6JA 2FZMA 3PBUA 4WZHA 3LCGA 4DZHA 3TTEA 2WSYA 1QDSA 2QCDB 1DXEA 3DBNA 4ZL1A 5LIWX 4H00A 1TPUA 4IIEA 1EQPA 1OK6A 2HRWA 2XGBA 4FLRA 5A8PA 3FJ6A 4EVZA 1VRDA 3MP4A 3OJGA 5LNSA 4GQ0A 4GC4A 2YL8A 5FJUA 1J0JA 3ID7A 1GVIA 2QCFA 1VFMA 3OGSA 3C2EA 2FLIA 1Q13A 1X97A 1KA9F 3L4YA 3U2CA 4DWSC 3W23A 2H8ZA 1J0KA 1Q6GA 2NT0A 4DJEC 3TV8A 1AL8A 3GSMA 1KCKA 1E0VA 1E4NA 1GEQA 4JEQA 3TYEA 3EMZA 4HOWA 5LXEA 3V0SA 1AD1A 3HQOA 4RDWA 3NPVA 1I75A 1HJWA 4AZHA 1WA3A 3TQ0A 1UZ1A 3H4WA 4GHRA 3W07A 3TU9A 1OYCA 5IDIA 4QFUA 4JICA 4CEUC 4RKAA 5FF7A 4YJ5A 1WXYA 4PSRA 1HKVA 3NL3A 5C0QA 5LSMA 3FW6A 4PMZA 4AEOA 3UVAA 1NH6A 3KOYA 3ITCA 5HULA 4UNLA 5I77A 5EGRA 1HKIA 1ODZA 4F2UA 4ENLA 2YFNA 2H9AA 3AMKA 2XZ7A 5REQA 1SZNA 3CH0A 4WJ8A 3KLLA 3JU2A 5CH9A 5E9XA 3NQ8A 4ACZB 3W38A 4H9TA 4GUHA 1FWTA 3MKKA 3R5EA 2OLSA 4G56A 1EH9A 4LVFA 1A49A 1OB0A 1IXPA 4NXSA 2X1UA 3H54A 3W1QA 2QDHA 2I16A 5EKYA 1E15A 4G9PA 1RJQA 3I6TA 3MUXA 3V35A 2NX9A 3ARSA 4YWSA 1K4GA 4CNSA 3RLGA 4DJFD 3VDCA 1PE1A 3B8IA 3N2MA 1FWJC 2VVNA 2O9RA 3C2OA 1O4UA 2OWCA 2CPUA 3EKGA 1WDWA 2PGEA 4WHBA 5KEZA 2DV0A 4WIWA 1FWBC 1L0PA 3SCPA 3K13A 4DO5A 4AZBA 2VFEA 2GQ9A 2I14A 3FEMA 3GNNA 2WVVB 3LSBA 4AISA 3GVVA 3M64A 5CJMA 2VRQA 2REQA 1U1JA 4GGHA 5LYRA 5E6YA 3IAQA 2QMJA 5I3KA 3OLGA 4ORMA 1FXQA 5DMLA 1JD7A 2YZRA 3LEPA 2A21A 2VP8A 3F4VA 4ZE5A 3V3WA 1NEYA 4IQDA 4L9ZA 3H22A 5EYWA 1EZ2A 1MUCA 4M1RA 2EPOA 1YTEA 3EPMA 1JF6A 2GZXA 2HQAA 2VC7A 3MHGA 4B92A 3EA2A 5IOBA 3M16A 4ZQOA 1FHUA 3MWAA 3TN4A 2Y8UA 1C9DA 2G3MA 3H2AA 3MTWA 4MY1A 4TQTA 1XIBA 2ZUUA 2CZEA 1PDYA 2PRHA 3NG3A 3CMFA 1FWWA 3N4FA 3G0UA 1WKDA 5CGQA 4DQWA 4IQLA 3QV8A 1J93A 1PS9A 1K03A 1HNYA 1LQAA 2NQJA 3WQCA 3PUDA 1KBBA 1YPIA 3C8FA 3W6LA 1IZKA 3UZZA 3T78A 4HU3A 4ERIA 2B81A 1KQYA 3SSZA 3STEA 3V18A 3MMTA 3WN6A 1PKMA 4XSMA 1NP0A 4LALA 3RM9A 1TE6A 2HK1A 2G37A 2ZRWA 4DF1A 3P7YA 4BCEA 2Z28A 3ATZA 2YGYA 2Z27A 4J27A 4GJIA 2XIJA 3EB4A 1B57A 4YCOA 2PRMA 3SCUA 1JZ5A 1VGAA 5U4NA 3FFSA 3WK0A 3LRKA 4LB3A 4EPBC 3RXZA 1R87A 3BW2A 3M0IA 3QZEA 3EYPA 5D9PA 3LCXA 4EPKA 1AH4A 5G2WA 1AD4A 3A3WA 3EXTA 1R7AA 2D69A 3U6WA 4MPQA 4UFJA 1UKTA 3POCA 1KGWA 4RUBA 4YTTA 5HNRA 1IV8A 1B54A 3PZ9A 2HVOA 4LV9A 3IARA 4L9XA 3HFTA 5D2YA 1WX0A 3ARWA 2VWTA 3N2XA 3ITGA 1PYFA 4UMBA 2E9BA 4YNGA 3SCNA 2YDQA 1A0EA 5A8NA 2QNEA 1YADA 5CZTA 1E72M 1JRCA 2VCCA 3OOQA 1E70M 1P6CA 3CV7A 1V3JA 1RA0A 3LLXA 1A5CA 5E6ZA 3CIVA 1VCVA 1FHVA 1DJYA 1RXOB 3PZVA 3OGRA 2JF7A 4JYFA 2XG9A 1C92A 3NL5A 4NKCA 3ZJ7A 4WUIA 2CZFA 3PN8A 3RPDA 1GT8A 3PBGA 4KFNA 3TYDA 4AMAA 3EX1A 3LI1A 5HNTA 2YLLA 5DMMA 5MKGB 2FB2A 4E4FA 3C0LA 2Y1HA 4HSOA 1AQ0A 4NQ1A 1HO1A 1XLMA 4W93A 4MKNA 3GVWA 1UWIA 3DZ1A 1GOXA 4M81A 1Q6EA 1GHRA 1P0NA 4MAVA 1MYRA 2ESCA 5TNVA 4BI5A 3S0CA 3O6CA 4F0RA 4B9YA 1UR9A 2POZA 2VD9A 2IPWA 4XVEA 2QAFA 1TA3B 3R0UA 1QOQA 4OKDA 4JTJA 3N18A 2ZXQA 1YBQA 3H7VA 3KRSA 1ZAJA 5J8LA 4AIBA 3W37A 3HN3A 4JL1A 2PDFA 5A2AA 2Q01A 3ZT6A 4MKSA 1AQMA 4HBKA 1OX4B 2DVXA 6TAAA 4CUCA 2XU2A 3KP0A 2OLAA 4JS3A 4EPEC 1O6IA 5CPLA 3T4WA 3NGJA 4RLIA 3CL6A 3WH9A 3LERA 3DG3A 1IEIA 4K68A 3E0FA 4F4RA 4GUJA 3HBLA 2QCGA 4I5XA 2LLEA 3V0UA 2WVTA 2WSRA 3WJYA 3FYYA 4H4IA 2FTPA 4IICA 3IS4A 3DX5A 1DJQA 3M6YA 3S4TA 3HOJA 5BYWA 2C3ZA 4H6KA 4DRSA 4NG3A 2CLMA 4ADTA 1UWAA 3CZLA 4CNUA 4V33A 3R10A 5IRPA 3T2QA 3A4AA 3C0SA 4AEFA 1GZGA 4QNEA 4P8VA 1XYCA 4B5NA 4AWUA 3USBA 1KXTA 1R2SA 2IPJA 3PSWA 2P10A 1DHPA 1EO5A 1G5AA 1TPC1 3E0LA 4A3RA 5H2ZA 2X0YA 4Y9OA 2PLKA 3QYSA 3HPZA 2G3JA 1GG1A 2JGQA 2V0TA 4OECA 4S2CA 4F0KA 3LXBA 3CL8A 3KHDA 1W1B1 4PC8A 3FAWA 3W1PA 5HUPA 3UWEA 3S9IA 6TIMA 3N15A 2WHJA 3CPUA 1IR1A 3SI9A 5CJ5A 3IJ6A 1PPIA 4RCXA 4QE5A 3MI2A 1SZFA 4A35A 5F1VA 4AU0A 1NIUA 3RX3A 2C1HA 3H55A 1QUMA 3W53A 1XQKA 4BQ5A 4O0ZA 1YDYA 3HG2A 3QYQA 4XB3A 3EWUA 1EGVA 3VMOA 1FH8A 4Y2WA 2WMIA 5K9DA 2UZ9A 5EA9A 5J04A 4KT2A 1JPIA 3DFOA 3W24A 3CYVA 3N34A 2QV4A 4XTIA 2ZCGA 3QEZA 1QNPA 5DELA 4ZTYA 2ZVIA 2ZXBA 4HHHA 3QR0A 4ALDA 2JFEX 1R85A 3IPWA 3VIIA 2D24A 3S9YA 3O06A 1JCNA 1F3WA 2V2HA 1BTMA 4JTFA 2HBXA 3DIPA 3TJ4A 2C19A 3H2NA 1VEOA 4AC7C 2YDSA 5FSDC 1MW3A 3HQNA 4NYYA 3AHYA 1O68A 1OGSA 5F1UA 1U2YA 2HTMA 4OT7A 5I02A 5XIAA 1OG6A 2VYOA 5CSUA 4IIBA 3SRFA 3HMJG 1SYTA 3VUPA 5BRPA 3GNOA 2WO5A 2PDXA 2CBUA 4JN7A 3VE9A 3G2GA 3G22A 3CV2A 4I8DA 3M0JA 1LBLA 3UA4A 3W86A 3GVRA 4GACA 3T0BA 3O0KA 1UP3A 4WDUA 4UNKA 1JG9A 1AQFA 1JPKA 2I57A 4H04A 4KS0A 2ZDRA 4UOQA 3HB9A 3BAYA 1AK5A 1KXVA 4BWLA 1E6SM 1OFOA 1RPXA 3RO8A 1LJYA 3WBXA 4RW5A 3MMDA 3U9IA 3THQA 1XCFA 3U2OA 1MXSA 4OZOA 3NQEA 1QASA 7A3HA 1PIGA 4JY9A 1MZHA 3FYOA 1JNEA 1QNVA 2POTA 2UY4A 5DO8A 3RLVA 1BWVA 3OPSA 3VI2A 1NVMA 2CKRA 3GC4A 2BHUA 4AVOA 3CAWA 1BSLA 3MO7A 3QKZA 2Z2AA 4AEEA 1BQCA 4U2YA 2NSOA 2V67A 3LSCA 4JKMA 1K02A 3W85A 3GIPA 2VWSA 4LTSA 3SN4A 4YVVA 1VPXA 1R46A 3QY6A 3RJYA 1XLLA 3QV6A 3F5KA 2FPVA 1DPMA 3TJIA 3VGEA 4B90A 1FBAA 2R1MA 4MZ1A 4NJKA 4TUFA 3F5LA 4U10A 4C6BA 1TV3A 3VILA 1FDJA 5LA2A 3U8GA 4C6DA 3S2CA 4H7VA 1S3HA 4UTTA 2E68A 4EPDC 1GG0A 4LAMA 1I2PA 4UTMA 1GPWA 1JQXA 4R7WA 2QXWA 1IZJA 2VRKA 1E9IA 3PFMA 4WJEA 1ZGDA 5CLWA 1E6RA 2OTDA 3UJFA 2YJQA 4ZODA 1HJUA 5IDZA 4WKAA 2OGJA 4C90A 1EUAA 1TZZA 2VCBA 3WQ4A 5T91A 4Z17A 4NRSA 2P50A 4QBXA 4D6CA 1AQHA 1FKWA 7ODCA 1M65A 2IQ0A 5HJXA 4LUSA 3M7SA 3P3BA 2GYIA 1TTQA 4J28A 4NI8A 3WK3A 2KAUC 1CENA 4AY8A 2E1DA 1PTAA 4LCSA 2PDWA 1EQCA 3T0CA 3WLMA 1VB9A 1WQ5A 2XM1A 5LXXA 2QAPA 3MUCA 2Y7GA 4OUIA 2XN1A 1MQRA 1B9BA 4LVAA 4UFMA 3WQ8A 5LHEA 3WNPA 3VO0A 1LLZA 3D5HA 3EPOA 5H6HA 1PWLA 1GQLA 3DECA 4QCEA 4I9JA 3G6LA 3AS0A 3NAVA 3OYZA 2ZQ0A 2ZXAA 4MZ8A 4JIIX 1ADSA 2VRJA 1W0MA 4BY3A 5B7ZA 3GW0A 4D8LA 2HS6A 2GL5A 1U22A 3UWQA 1WXZA 2WBKA 1WDDA 3BZGA 2VENA 5JQ9A 4MWAD 3V5FA 3MS8A 1L2QA 3RLUA 3WD3A 3T55A 4WXZA 3V7PA 3RCYA 5A94A 2NV2A 5CBJA 1JZ4A 1TMLA 1TWDA 2GJPA 2PU1A 2XSXA 5DRIA 3E02A 3EOEA 3PUEA 1DL3A 2OEJA 5BRQA 3GDKA 2YA2A 3HFYA 5D8WA 3L5AA 3ZWSA 3G77A 3OA3A 3C4UA 1EIBA 4WGHA 1DJHA 3F4NA 3TOYA 1TX2A 4NJHA 2Y63A 3TTQA 1QI3A 4YMZA 1LQ0A 4C6IA 1EIXA 1ONXA 3AIUA 3BOXA 4CVUA 5A5WA 3A4WA 2BG5A 3TFXA 3P62A 4MUZA 2J24A 2WHLA 3WJXA 4O16A 4E5TA 2FMNA 1T8XA 4IP7A 1LRTA 1OGBA 1DE5A 1WV2A 4F8XA 2ZZ3A 4XAZA 3MCMA 4PRRA 3GG7A 1LOLA 4JXCA 2Y6ZA 1SFLA 1SMDA 9XIAA 2BVTA 2NX1A 4A22A 3EKZA 3WL1A 4ICMA 1EC7A 3L5LA 3EWYA 4LVBA 4PTMA 1XIGA 3LTYA 5GNZA 4O10A 3NA8A 2X16A 3VXGA 4NZ3A 3VNYA 2OOGA 2ZTKA 3B06A 1QPNA 3C2RA 3NPWA 3VKBA 4D6JA 5DEZA 1FHLA 3R8GA 3ALGA 3W6MA 3T0TA 3FYPA 4HNLA 2MNRA 3UJRA 4EK7A 3QRHA 1UPMB 2INZA 3APGA 4JKKA 1TVNA 4NSBA 2ZE0A 1FY6A 3G1AA 3SFWA 4NU7A 1U5VA 1P1MA 2WMKA 2Z6IA 1VBJA 4XKMA 4MMWA 1RAKA 4MHBA 2HK0A 3DC8A 5AC8A 3L12A 1RD5A 1IF2A 8RUCA 3WKZA 3L21A 2C7FA 4HQVA 1TPH1 5ABTA 2C13A 4JIQA 3T8QA 1OVDA 5MF5A 4O11A 3SBFA 6XIAA 1XGZA 4P8UA 1HL9A 3SQSA 1TV8A 1NY1A 1AODA 4TV5A 3KOFA 4RJEA 1WDPA 4JHMA 3FX4A 1OCBA 2YLAA 1PKLA 1TB3A 1JPMA 1NOUA 2WOQA 4QDWA 3JS3A 3S9ZA 4Q8OA 4UTWC 4GYJA 1BKHA 1UB3A 1OX6A 4B9ZA 4YXGA 2NW0A 2A7NA 4DB7A 5I23A 2J6XA 3QLDA 4CD4A 4FIQA 3GR4A 5K4XA 1VJIA 3KL5A 2VFGA 3DUGA 5G1YA 5I03A 3UW6A 5A8QA 5A6BA 3W88A 4H7CA 3CXOA 4XO6A 2QCLA 1SSGA 3BGJA 2F7FA 4F2BA 4A3UA 4QJ5B 1KW1A 3QMSA 1LWIA 1T5AA 4CNPA 2GGIA 1UD2A 4WVXA 2AL2A 4DHGA 1TIWA 1AJZA 3AC0A 4ZB0A 1EB3A 1F74A 1F3XA 1JPHA 1E4IA 1UR4A 1CZ1A 4HT3A 1TV4A 3KS5A 1X8FA 1E1CB 1TELA 4NAFA 3K8KA 1CNVA 1DIDA 1R86A 3N4EA 3UU0A 4A3YA 1DQUA 2DJXA 1UA3A 1F7BA 3HPXA 3WL0A 1UYQA 2UWFA 4HN8A 3RRAA 1HVXA 4Z1YA 1CXFA 5AZ1A 1R9YA 1E6ZA 1GGOA 1WYIA 4MNLA 1RLDA 3PJWA 3WFLA 2PCEA 4MIMA 4QG6A 2J9ZA 3WBAA 2DIJA 4K7YA 2NV1A 4YPJA 4NAEB 4QEEA 3JUGA 4E3VA 3AI0A 1FWDC 3EKLA 3G1VA 4O8AA 4DI9A 4V27A 3UWYA 3LXCA 3T2PA 4AD2A 4D6HA 2Y61A 1ITQA 3VU2A 1B3YA 2OSXA 4L4MA 1RVGA 2NLYA 1XC4A 3MY9A 3QGVA 3KTXA 1FFQA 1K7XA 2BY2A 4IQJA 2NQHA 1IWPA 5AYZA 3B8TA 1T40A 4JL2A 5C70A 1U30A 5I5RA 1NU5A 1LOSA 3VOCA 3LMYA 4M29A 4O28A 3K8LA 2ANUA 4DI8A 1HP4A 5FEWA 1W5QA 3TMQA 3EDJA 1BYBA 3T08A 2X1SA 3PPFA 3L4ZA 3COTA 3KM8A 4UQDA 1VLIA 2BXVA 4RDVA 3BZJA 5AECA 3FKKA 2FVLA 5JXQA 2D2JA 4QHRA 3SUTA 3WJZA 3WD0A 1QVBA 4HZ8A 5AHLA 3V4BA 4IL0A 3TYZA 4BQ4A 4QR6A 3VOFA 3GR8A 4NZCA 3NSMA 2MUCA 1Q5MA 1LDCA 3NNTA 3BPWA 3T42A 2F2HA 4LUYA 4R5EA 1FCVA 4KPLA 3OBEA 5U7SA 1MEIA 3UZWA 1YE4A 3W7RA 3H21A 3H53A 2V5JA 3B8DA 3I10A 3RRXA 3ANYA 1BD0A 2WCGA 3VZYA 3PS7A 4I7WA 1WZAA 3V16A 4C6OA 2GVYA 3CUGA 4H6EA 3PJXA 4HK6A 5A69A 4JTHA 1NWUA 4BQ3A 2JIEA 5HBFA 4NNAA 3PJTA 3OBAA 4NY2A 1FRBA 3EB3A 1XSKA 1X39A 4HHMA 3EXSA 3MW7A 4WOQA 1GONA 1ONEA 4AD4A 1R3WA 1V6TA 3O63A 4B4HA 1GTHA 1EYWA 1VFLA 2Z1SA 2PDCA 4DWDA 3DFTA 1W91A 1UR2A 1M03A 4LNCA 4BEQA 1H61A 5ABGA 4R33A 4NZ5A 1JYXA 4MWAB 1RCOB 5DXXA 4DBDA 1NQ6A 1I0BA 1QBBA 2WNWA 3URBA 1ZUAX 3EX4A 2V6AA 2W3ZA 3BANA 3GRIA 3KCJA 2DT1A 6REQB 2CCRA 3JVAA 3PNUA 3NQ2A 3FSUA 3VIKA 2E40A 1UWTA 3GNXA 2PDBA 2FPTA 2Z1WA 3GTIA 3SSJA 4G8TA 3FXYA 3AIBA 3B0YA 3GTHA 4LB4A 1TIMA 3IGXA 1MQPA 3MSDA 3E0IA 3NZQA 4N02A 3UEQA 3FLUA 4XBKA 1AZ2A 2GQ8A 2WM1A 3KDOA 3DU0A 4GXMA 5E09A 2YYTA 2WJEA 4YVPA 4IX2A 3MUAA 4HMNA 2OT1A 4R3UA 1LCOA 1BRLA 4TIMA 3OB8A 3DHUA 4JTKA 5FEPA 3BARA 1KTNA 4ROQA 1V8EA 3CHEA 1JCMP 1H63A 5CPMA 2X8RA 2E6FA 2BGNE 4JTIA 3HGJA 2ZVRA 4Q8PA 2HROA 4OJYA 1ITCA 4Y9MA 4UQCA 4L4OA 2XVKA 1V6WA 2XJ7A 3T81A 3A4XA 4OIFA 3UJSA 4DPQA 4OQVA 1XCWA 2YYUA 5LIUX 2QR6A 5A2CA 4RZ4A 3N2BA 1SW0A 4ZCWA 3HV9A 1HKMA 1TQXA 3C2FA 4IG2B 3CHFA 1PHQA 1Q65A 3M44A 3VD5A 1O66A 2J7HA 4O14A 2PTYA 3M0MA 3PAJA 5DY3A 1T96A 2DSWA 4YTRA 4DJDC 2DUZA 5F2IA 2OZTA 1HVQA 6ALDA 4ACYA 3MO4A 1E5NA 3KUMA 3QFEA 4OBTA 3V1PA 3QKEA 4H8VA 4G2DA 3TROA 1UP0A 1ZBKA 5CC5A 5TF0A 4RPQA 3TCSA 2PTZA 1KB3A 4FO4A 3UVIA 3UWUA 4JQ1A 4OWGA 1P48A 1GVFA 4ERGA 4JZ5A 4TMCA 5LGXA 1Y5VA 1XBZA 3KAOA 1Y5XA 3AOFA 3VC5A 1ITUA 2A3LA 4C7FA 4FEZA 4MSSA 1H09A 3WLHA 3OW1A 4N9DA 2EHHA 1Q6OA 1XR2A 3ONBA 2QKFA 1UUMA 3HQPA 3EA3A 3N19B 1W1IE 2HDJA 3R12A 3WMBA 5ENLA 4DELA 3DC0A 4UTUA 4GYPC 2TRSA 2GLKA 4L9YA 2WJDA 2P88A 3LQGA 3LHUA 1S5NA 1A0DA 3M5VA 1RPKA 3N9KA 4C6PA 4URIA 2YCIX 5FSEC 2NQZA 2WLZA 5CSSA 3W7QA 4C1KA 1P0BA 2FKPA 3AHZA 1V3MA 2XM2A 4GFSA 4GD0A 1U5JA 3WBYA 4UNIA 1G4TA 1E6QM 3AU6A 2PC4A 4AX7A 5CZSA 1E4MM 1KM5A 1GVRA 2D22A 3N6QA 4GQRA 4NT0A 3RDKA 5HQMA 5C71A 1E0WA 2DSKA 2RJHA 3MV01 5DT7A 2QLYA 3WYZA 4A8NA 1T7LA 4YIWA 4AZ6A 4UTFA 2P1FA 3CU2A 2OZ0A 3NM1A 2BLEA 3AROA 4PFMA 3VDBA 4IFRA 1ISYA 3CHDA 2V5LA 1FCQA 3RK8A 4O4VA 1DIOA 5BOEA 3IJQA 4FNQA 2H3DA 1JEZA 4F66A 3EDDA 2PTXA 4R53A 3IGHX 4K39A 4ROPA 3QFWA 4C1LA 4GNJA 3TW6A 1M5WA 1DVJA 3HJEA 2ZOXA 1POJA 3AYTA 1QNSA 3BV4A 3AMGA 4L80A 1UR1A 4UTIA 2I1OA 1SZRA 3TOPA 2CNCA 2EEXA 2YB4A 1UQYA 1RK5A 1TWIA 2PEVA 3UBPC 3W7NA 3CLWA 3NO5A 3RM4A 3BSGA 1MNSA 3CIWA 1EC9A 3WNOA 4X61A 3GKAA 1CB2A 5IXEA 3MCOA 2HZGA 4OBSA 2E6YA 2HPMA 3PVFA 2ZUTA 3NZRA 5JBEA 3ZT7A 3PWGA 1BGGA 2OQHA 4E4UA 3M9YA 2FZNA 3IJDA 1QO5A 3APYA 4ZR8A 4FNRA 5LA1A 4ZQRA 1BSIA 1UD8A 4W7VA 3S6DA 2F2KA 1QI4A 3STFA 4ZZ9A 3CH9A 3ARRA 3GU1A 1M41A 5KZMA 3G0SA 1C3FA 1DV7A 2BXYA 4W85A 1X8CA 2NT1A 1A47A 3W26A 3PZGA 1KLYA 3HG5A 3S2LA 5HINA 1PZ1A 1IWBA 3GW3A 5GJMA 4O1EA 4IL2A 1EPXA 2FVMA 4JTCA 2Z7GA 2ZRYA 2X7VA 4QG9A 1K9TA 1HT6A 5D2WA 5LA0A 2XH0A 4IFOA 1RY0A 1EGZA 4Q8MA 3EB2A 3URAA 5G4WA 4GVHA 5G4HC 3N13A 3AXIA 4GC3A 2CXEA 1P7TA 2Z1BA 4L65A 3S2JA 3VNDA 3ZLHA 1VS1A 5A6SA 2YIHA 4JDBA 3CZ8A 2ZZ7A 2D1ZA 4AFYA 1CGWA 2GVEA 1XLHA 2C0HA 2Y2WA 3WBWA 4KF1A 3R58A 1B3WA 2X1RA 4IISA 4IGHA 3PBYA 4E0CA 4DWSD 1EJSC 4JX4A 4U2ZA 4B15A 4DJED 1PKYA 3IWPA 3VGGA 1DXIA 1FX6A 2YOCA 3DBPA 4CD6A 1KGXA 3IGUA 4EAYA 3ZSSA 2PDPA 1MW0A 4ZO7A 4LWWA 1QATA 4PL2A 3E2SA 2XFWA 3G1XA 2PAJA 3QW3A 4XAGA 2PSNA 3N2OA 2NV9A 5IFPA 3OU8A 3RHGA 1JZ7A 2QDEA 2PWHA 4JX6A 3LCFA 5BOOA 3EOSA 3BO9A 5CAHA 3L4VA 4PMXA 1BQGA 3CJPA 2FDMA 3BURA 1A3XA 4NUWA 3W1NA 4N2YA 4DLFA 4I90A 1KRCC 4GLEA 1BPLB 4FAMA 4DXXA 2IXVA 1U1UA 4ONVA 1YNQA 2PB1A 4O15A 4RPPA 2ZUWA 5BOFA 2YR1A 3OVGA 2FJUB 2I9UA 3BH4A 3OGVA 1W5NA 4DXKA 4L1WA 3GG8A 1I1XA 1C8XA 4AXNA 3UG3A 1UWRA 1Y65A 2VFIA 3AS2A 4IPNB 2QCDA 4RV3A 1CGVA 1LTDA 2ZYFA 2EF9A 2IQTA 3BCJA 4US5A 2DH2A 1NM9A 2XVNA 3D0CA 3C3UA 5HR7A 1JCJA 1A5LC 3TFCA 3L9CA 1ALDA 1B9ZA 3SIZA 1LQ2A 5T9BG 3P61A 3CT7A 3KEHA 3E5BA 5KZ6A 4PSPA 3HTWA 1D9EA 3WNLA 2B4GA 4LBRA 1SR0A 3GDTA 3M5XA 4I9TA 5K9CA 2OO0A 3QR1A 1OIMA 1XWYA 4MY8A 1ONRA 3CZEA 4YTQA 3VD9A 4HSHA 4F0LA 4O57A 3M0YA 1JPDX 2E1WA 4WSJA 3R25A 1UJQA 3W27A 2EO7A 1TKKA 3QLLA 1GUVA 1UH4A 3ZOAA 3LHVA 3B40A 2V3GA 5G2HA 3M47A 1V93A 2J62A 3SADA 3MHUA 4DAIA 4E6MA 4HU0A 4N4PA 4UR7A 4FNTA 5AVNA 1EC8A 1FP9A 2PWFA 2CFFA 4WSKA 2WAGA 3GXDA 1QPKA 1HJVA 3L2MA 2PMQA 4K8HA 1TCDA 4O12A 3CPRA 4MNKA 3UP8A 2ICSA 1LRNA 3CO8A 3ZLGA 5LGZA 4XZWA 3E0VA 1KFLA 1Q66A 1UC5A 2ONEA 3GKFA 3PPGA 2XIBA 4KBXA 5EY5A 3MCNA 2ZUMA 1A50A 4C5ZA 2JGYA 3ITVA 1XH1A 3MBFA 5D2XA 1M3UA 1TPEA 3DHDA 1QOPA 1GVSA 1ZLPA 4KFOA 1LBMA 4C1NB 3EX2A 1LG1A 2OWXA 3I3BA 1W1ZA 2OZ3A 5JH2A 4AUBA 4KIRA 2FTYA 4KW2A 2QQ6A 5C5YA 1Q7ZA 4WJXA 3MI6A 1PX8A 1QPRA 2XVPA 2D2OA 4FNPA 5GQBA 1RBLA 3REQB 3R2GA 3U4FA 1ZPTA 4I9AA 1YMYA 4IP5A 5GPRA 4MDOA 4NXKA 1O5KA 3SRDA 3Q94A 3LN3A 3FVDA 4FLSA 3SCQA 4AHOA 1DBTA 2CHOA 1X1OA 3NL6A 1E55A 5FD0A 1TJPA 3WDRA 3RAOA 2WC4A 4J3VA 2D73A 4YS1A 1WBJA 3ZJ8A 4RZ5A 2ACQA 5HPOA 2DDXA 2J7BA 2O56A 1TVLA 2G97A 3C2VA 5JMUA 2FYMA 3ECQA 2NWRA 1OFEA 4GJJA 1JI1A 1QJWA 3BLDA 3S5OA 1A5AA 4CQ9A 3B9EA 1JR1A 3S6TA 1JUEA 1A3HA 5I06A 5CKSA 3WLNA 2C1IA 4Z1CA 2VO5A 3OLIA 1JDAA 4MWAC 4R7JA 1V79A 3QQWA 1XIJA 2ZDSA 3QV7A 1E9LA 4AHQA 1XIMA 4O8RA 4JFWA 4X9SA 2YKKA 1QFEA 3VCNA 1HQTA 1L6WA 2VZTA 3W2MA 1XRVA 2WJFA 4LU0A 1GYMA 3IUIA 1GPFA 4N9CA 3NQ7A 3RFAA 4C91A 2YCKX 3GDLA 1XKYA 2F8QA 2Y7FA 3WQVA 5BXTA 5J5RA 5F4XA 3F4WA 2DUXA 3NM3A 1RY8A 3M6DA 3O2LA 3BMVA 3LZ3A 3BQ5A 4NASA 4U3AA 3WMSA 2C15A 1GZ1A 2W0UA 2RFGA 1TO3A 5XINA 4B5UA 4M5PA 3P2VA 4BQ2A 1J12A 1S5WA 1SFSA 3AZRA 2ZTJA 2Q8LA 2A3CA 2Q71A 4PUJA 4TR9A 1XKJA 2OODA 1E3ZA 3W2LA 5L9FA 3NIYA 1W2PA 4HK5A 1W5OA 4D9PA 4M24A 5J5DA 3N14A 2EPMX 4XZIA 4Q8UA 5AHIA 3PBVA 1YEYA 3RMEA 3M5ZA 4AF0B 3LS9A 5I24A 3PK7A 3W7IA 3TTOA 1EOMA 3AUOA 2EG8A 4ADUA 4PFHA 4DNMA 2FGLA 3GG1A 1JIBA 3U7VA 3RIKA 1CT5A 4KCUA 5A95A 4NIRA 3J7HA 4QAIA 4IX0A 2ADAA 1SW7A 2QVNA 2EBNA 1O1HA 1JCLA 3GLCA 1VBRA 2TYSA 3NR0A 3OHIA 4FALA 1MW1A 3LHYA 1WOAA 3TSBA 4Z0SA 2B31A 2BMBA 2XHYA 1E0XA 3BK0A 4ZOAA 5I79A 1IHIA 4KGLA 1UZ4A 1HUVA 3WQGA 4UCGA 1UR0A 1OADA 3UESA 5XIMA 5A1AA 5D32A 1IGWA 4IGSA 4QG8A 5MKGA 3LNMA 1XDJA 3NDYA 4W9TA 4N4QA 1ZHAA 1QW9A 4YL2A 3LTPA 5D03A 3IANA 2DZBA 2VFFA 5AFDA 1FWNA 4XIMA 2IKJA 2WW5A 1TA3A 4HMCA 4WQ6A 2VX5A 2YXGA 3QSTA 3F4DA 1WKEA 1UHVA 4PUDA 3BICA 1P43A 4LW7A 2VEFA 3HIJA 2XN0A 3AWOA 3M1ZA 5LHFA 3VINA 3AMDA 3WLRA 4GA8A 1ESWA 1ML1A 2WM0A 1NOFA 5RUBA 3GAKA 3LRLA 4FS9A 3LENA 3IRSA 1MEWA 1S5TA 2E3ZA 1PEZA 5IM51 3KCLA 3UNDA 4JTAA 3NQBA 1J8VA 2X41A 4QSHA 4F9JA 4ASTA 4O1BA 4PTVA 2ZRXA 1B90A 3OIHA 3DHFA 3ARUA 2Y4SA 5HNNA 3CMGA 1WAWA 4C6CA 3LM3A 2OR2A 3SN0A 1O5XA 2PDLA 3AS1A 3VOJA 4GIAA 1W8SA 1PVNA 2B0MA 3OO2A 5A3HA 5I07A 4XTDA 3O16A 3DN5A 3QBUA 4HZ6A 3WIJA 3BLPX 3GE7A 2FHCA 1FQ0A 2FH8A 3WBEA 2R91A 4NILA 3GDRA 4C6KA 1RP8A 1MSSA 1QW7A 2VM8A 5H8MA 4UTJA 3HURA 4FX8A 4Q4QA 4Q8TA 1TR1A 5D37A 3WQWA 1W2VA 4NL1A 3G8EA 1LUCA 3KDNA 4JY8A 2GK1A 3FS2A 5CC7A 4AD0A 3TSDA 2VNCA 2PPGA 1XICA 4UFHA 3N73A 3UPWA 3F1QA 1L8NA 3KTSA 2Y62A 2VUYA 1GOMA 4PEEA 3WNNA 2GPTA 3EX3A 1SFTA 1UZHA 3JRKA 1N55A 2YDAA 2WQDA 2J7DA 2NXIA 1Q4NX 3VIGA 3BGAA 1F8MA 3WDHA 5BROA 3W76A 3R94A 2BSLA 1T41A 4HPXA 1QAPA 3M0LA 3DFNA 1FWHC 4TVCA 4GIEA 3PZMA 1TRDA 3RF9A 2D0HA 1E43A 4PCSA 4AHPA 1GWJA 3UJEA 1N82A 4A2SA 2W66A 2VOMA 2R9RA 1C93A 2X1TA 1LBFA 3MUIA 1HN1A 4DJFA 2G95A 5BU6A 2DZUA 3UZYA 3SGUA 1ITXA 3W7GA 2JBMA 2VGIA 2QJNA 1KCLA 3MP3A 1VRXA 1AW2A 4EE9A 2ZWYA 1KBLA 3B03A 4QXIA 3T40A 3RPMA 2BP1A 5CPOA 3WQEA 1QBAA 1EJRC 3QF0A 3QMRA 1HXJA 3W22A 2O55A 4FR1A 3SCVA 1NWRA 3FAXA 2OKTA 1TUFA 4H01A 3W81A 2PD5A 1ME7A 4IF2A 2BY0A 3QC3A 3T07A 3ARTA 3UG4A 3W71A 4QIUA 1VJZA 3AXXA 4MWAE 4W5ZA 1F3TA 5TD4A 4JD4A 1K6WA 1KM3A 4FB7A 5CGMA 1OF8A 1TPFA 1I60A 4QX4A 3RX4A 5EFDA 5AC5A 4KWWA 1XLKA 4W89A 4FK9A 3AAMA 3AYVA 5FEXA 1W6TA 4O53A 1UW9A 4LS1A 2VMFA 2OOFA 3R89A 1L6GA 3HA1A 3NO1A 1XIIA 2CLEA 3EWBX 4E8DA 4PGLA 1VIZA 4EIVA 3HMCA 1VHCA 1BF2A 4ES4A 1SMAA 3BQ6A 4K36A 2YPIA 3BLKA 3SM0A 3IJIA 4E2OA 5C54A 3MUZ1 1VCGA 3WDQA 3S5YA 1E5JA 4DVOA 2NUYA 4GMEA 2ATSA 3VIFA 4AIOA 2WNQA 5EMLA 4GNVA 5HPCA 4WD0A 1ZFJA 4LX4A 3W7MA 1ICPA 3A9BA 4M8UA 3WD1A 2X30A 3AUJA 3WY1A 1TZ9A 5C55A 1KM0A 2WSPA 4MTVA 2DIKA 5EPDA 3JZUA 2D2HA 1JF5A 2ATMA 1U83A 1GK8A 3WEMA 4W8LA 1RLCL 4QLKA 4QAWA 3D47A 1IYXA 2NVAA 3PZOA 3RR1A 4HTBA 4GYPA 3WQFA 1G9HA 3UR8A 1LOQA 1OT1A 4I7UA 3THDA 2Z25A 3SGGA 4M7SA 2PF0A 2W79A 3CAVA 5HWMA 4ZQCA 1XS2A 1JCYA 3LX9A 1GOQA 3QTGA 3UCQA 4DXVA 3NFUA 1J9YA 2QPUA 4Y9AA 5FJOA 1XH0A 2W27A 4UCFA 3U3HA 3E6EA 3LHWA 3UZ5A 1P6WA 3QMTA 1ADDA 2XINA 2ZA3A 1E6PA 1XYBA 4GI9A 4W86A 5KITA 2Z0IA 4ZBCA 1HL8A 3C0QA 1OHLA 3IIXA 4HSNA 4TMBA 2ACSA 2XVGA 1TTPA 4QLJA 2GUYA 2TSYA 3R0DA 1IT7A 4LAZA 1GOIA 4Q4RA 1W3NA 3LRMA 5D9MA 1V6UA 4JTEA 1AMKA 3B4UA 1ZJAA 3IIOA 1OC7A 1I4NA 4LPCA 2DW6A 1Z7AA 2R14A 2G4JA 5C2CA 4Y9NA 1NAL1 1XLFA 3GM8A 3L4WA 4M0XA 2O4QA 1EF3A 3LUTA 4RE0A 2MANA 3LCIA 3FJ4A 3ITLA 4JTRA 4E4PA 2RGLA 3FGCB 4D8AA 4LRSA 3Q45A 2W62A 3EGJA 3S1VA 5FA5A 2DZAA 3TXVA 4F48A 1YXCA 1E73M 1B5TA 3UXLA 5CSRA 1VFOA 4FPSA 3XISA 1Q6QA 3INPA 3PZTA 1H0GA 1TJ1A 3LA4A 3GUWA 1U5HA 3CS2A 5ECUA 4O0QA 4NNBA 3CC1A 3NVDA 4F0HA 3AU2A 3W1UA 4LYPA 4QTGA 2Q09A 3VVGA 2HMCA 4P5UA 4PUUA 4JR5A 3NTYA 5D38A 1PX4A 2PTWA 2XFRA 2QUNA 1V6VA 3BAWA 5T9CE 3O1NA 2AKZA 1Q6DA 4RNFA 3L4UA 3W7KA 3Q65A 3UR7A 2ZFAA 1XBXA 2GVJA 3AIRA 5JIWA 3MT1A 5I78A 2ZZ4A 2DSUA 2DZWA 4FX6M 2DSZA 2WKLA 3GNPA 4XK2A 3LV5A 3RILA 2YL5A 3HM7A 3GIYA 3E49A 2WMIB 1SUXA 2Z1XA 3WFZA 2GDUA 3A3HA 3TAKA 4U5IA 1O60A 1AH0A 3BOLA 2PZ0A 1O7AA 2IXUA 4BR1A 1I2QA 1S2UA 3L0NA 1VHNA 1QRQA 4HPJA 4INFA 3GC5A 1L2UA 4YYCA 3BCFA 1KKOA 2W9MA 2I9EA 3K1DA 1H4PA 3ELFA 1PUDA 3GXTA 1WZLA 4JIEA 5D02A 3UYCA 2CXGA 4MUPA 1L6FA 3W7DA 4MLJA 2YXXA 3EEZA 2F9RA 4Z1BA 3UZXA 1EJ7L 1QXLA 3BSHA 2WJZA 5LNUA 4S3AA 1PCKA 2WZHA 2WV8A 1B3ZA 1XLGA 3DYMA 1PO9A 1Z44A 4AZ5A 3AICA 3DXIA 1WDQA 3APTA 4W84A 1IWAA 3HU7A 1LP6A 1GQJA 3ERPA 4H9MA 1J10A 2JIWA 1IXOA 4QCFA 2FGZA 1L8PA 3N04A 1TQJA 4REQB 3PAOA 1DTUA 3W74A 2PP1A 4O18A 5BWAA 5IBXA 3EWWA 1UD5A 3MVTA 5FJJA 3N17A 3THUA 1UUOA 3FOKA 1TTIA 4GXPA 5FAGA 1DIKA 2DQXA 3LYEA 3PSVA 2NSXA 3H2FA 2BODX 1B3VA 1I45A 2CBJA 1JZ6A 4QLLA 4U33A 3W1MA 1KFCA 3DFSA 3I68A 1MFUA 1ZCOA 4J3XA 4D72A 2J66A 4UB9A 3PUGA 3Q58A 1ISXA 1EX1A 3GHRA 1J6OA 2VL4A 3LLDA 4PCTA 3VA8A 1JZ8A 3GS6A 4WDWA 4GVFA 1ECQA 3TJLA 2JQXA 1E1CA 5BXRA 2O9PA 1KBJA 1BFNA 4G5DA 1MFVA 4Q4KA 1E56A 5M1TA 2YCLB 1E6NA 4PMJA 5EMUA 2Y5SA 3NQ6A 4KEVA 3VGDA 2XGIA 2GVGA 5AVHA 3FKRA 2VEPA 2RAGA 2I5GA 2RHGA 2E5CA 2Q3OA 5HQEA 3UERA 4AIEA 1F6PA 3NXLA 4GINA 4FXSA 4NAEA 4KERA 1KR1A 8XIAA 3ITXA 1WCGA 2QHAA 4PB3A 1XG3A 1MZRA 3IV3A 1XRTA 3N11A 4HA0A 4X60A 3S5ZA 3GBDA 7TIMA 2UV8G 1CYGA 3ARYA 3LBMA 3QQ1A 2PD9A 5HWNA 4J40A 2RH9A 3AWNA 1EHNA 1UWSA 2EPNA 2KZHA 3H6OA 4UQAA 3DFHA 2CETA 1VCFA 2QUUA 1NFGA 3B0XA 1BLIA 4QGCA 2E28A 4CNTA 3WH8A 3W82A 4H9YA 1MQQA 2O9TA 4J4KA 4GZEA 3TR2A 1DJWA 4AXKA 1EA9C 3WEZA 3T44A 4LSBA 3PF3A 4TU1A 2EPKX 3CIXA 3L4XA 1VF8A 3OVQA 5BWFA 3ZSTA 1VENA 4EANA 3TYAA 5D33A 2NUXA 1SO6A 2E6AA 4WKHA 1S2VA 1KM6A 2CBVA 1KC7A 2CBIA 5GVJA 4H7ZA 1TREA 3F4CA 1V51A 1XX1A 4W5UA 2QW5A 1TFVA 3FK4A 1JCXA 3ABQA 1EHAA 4HJWA 1JGMA 1TPB1 3BMWA 4LANA 2EXOA 4R9XA 3MYPA 1YXYA 4XWUA 2XDFA 1DWJM 2WZEA 2XH4A 1YDNA 3O6DA 4N9BA 4AWSA 2AMGA 3FNDA 5ABEA 2AKMA 1EZWA 1OFPA 3EMQA 1Z69A 1R6WA 2V38A 1I1WA 3CBWA 3RLHA 4GG9A 3JZEA 3W3OA 3LBOA 3W7OA 2GDQA 3TN6A 1EJVC 1SGJA 1UASA 4E2DA 2WYSA 2Q8ZA 2NXHA 3AMCA 4NX5A 1XGDA 4EACA 3N9SA 1E9ZB 2CZDA 3EPNA 4LOCA 4C6FA 1YTDA 3HG3A 3GWQA 3KXQA 3G1SA 4TTGA 1RSCA 3AXHA 2OSWA 4HNCA 2V3FA 5AHMA 5JVLA 2VVSA 5H91A 4H6QA 3M7WA 4MWAA 2WZIA 3BAKA 4RNJA 1KO0A 3B3DA 2TAAA 2A0NA 4M82A 7CGTA 2GVLA 4F9DA 1J5SA 3T05A 3CPGA 3URNA 1QCWA 5AC4A 5FCZA 3H4XA 6REQA 4U3CA 5FJTA 1ZCCA 1NDVA 2VDGA 2DQWA 1RALA 3OG2A 4GBUA 1ADOA 1V4YA 3ARPA 3E12A 1V08A 4DJDD 3PTMA 1J18A 3ME3A 5ABFB 1JXKA 2FFIA 5T8GA 1DJZA 1JYNA 4JOMA 2CIPA 3TK7A 2Z1VA 2FZ9A 3VM7A 3EWCA 1QI0A 4MF4A 1ECEA 4OFCA 2R1PA 1D3GA 1DJIA 1R38A 5DY2A 4HPGA 4UFLA 3T0AA 1GQKA 2Y70A 4AX6A 3OLDA 3OTRA 2Y8KA 4D6FA 3AFBA 1G4SA 3AZSA 2BOFX 1FUYA 1UR3M 3U48A 4UIOA 5EMKA 3UETA 1ME8A 3QOMA 2A79A 2E9MA 2PA6A 1EWDA 4J3SA 3W2KA 1GKQA 3NQAA 4CU7A 2HVMA 3BL3A 1S46A 3FV9A 4KEMA 1KQZA 4PZVA 4XKYB 3ANUA 2DSVA 3H70A 1G1YA 4HB7A 3TH6A 3GG0A 3VCRA 4RNIA 1Z48A 3P5YA 4LC8A 1CI1A 1JDDA 3R1ZA 2FZDA 5BRBA 4JFUA 1CB7B 4IH3A 2A3EA 2ALDA 1XISA 1F8IA 1UD6A 1C8VA 4S23A 1G4PA 3AYRA 2GSHA 4M6PA 3LY0A 3UJ2A 1Y8BA 3LU2A 3W1LA 1N8WA 4IG2A 4H3DA 6A3HA 2QDDA 1KXHA 1RP9A 1Q7QA 4IMCA 4LYKA 3AIVA 4POCA 4XZLX 3MMWA 1XM3A 3W02A 2XYLA 1HF6A 3QY7A 4LEQA 2R8WA 1R3YA 2PDIA 4V1XA 3VNMA 4A3QA 3L23A 1B0IA 4IP4A 3E2RA 1ICSA 1IIHA 3DI1A 2QF8A 3S2NA 3KBNA 1PX3A 3HPSA 4H9XA 3U0HA 4L4PA 4XVDA 4MPKA 1EL3A 3W00A 1YIXA 3NOEA 3TP4A 4J9JA 4B5VA 3CHCA 1PIFA 3BG9A 2Y7EA 4WY0F 3GXIA 1TJ0A 1W1A1 4G1KA 5CSYA 4C5YA 5TQLA 7TAAA 1EBHA 2AL2B 1E51A 5I2UA 1WKYA 2QPXA 1A5NC 1Z6KA 4Y9PA 1XYMA 3AISA 2PI6A 3SURA 1SM9A 5I3DA 1BHGA 4UXDA 2OSYA 1ZJBA 4AYSA 4MNMA 3ZR4A 3GY1A 4BF5A 3ALFA 1IEVA 1PKNA 3MDUA 2V5CA 3ZT5A 2RUSA 4ZXOA 1J0ZA 2A7PA 4KIEA 5GJPA 3TUUA 4F0SA 4JKLA 3CAKA 4FR6A 2OT0A 1IXQA 4GH1A 5AB3A 3TSMA 4M56A 2BHZA 3STCA 1V0KA 2X42A 5FF2A 4O1CA 3AJ7A 2ISVA 2VEGA 4L56A 3W7LA 1ISZA 3VC6A 1H2JA 1F4HA 1S5MA 2WANA 3FIGA 4MB3A 4TTUA 4B2DA 3TQVA 1WO2A 4RE4A 3VMPA 2PF8A 5KSWA 2CLFA 2G5WA 2Y0FA 4Q4PA 1XPGA 1PAMA 4DIAA 3QJAA 3SQMA 3GBEA 3W7EA 1QOXA 2J8GA 1EP2A 4R85A 4US6A 4C6LA 3CUFA 5C9WA 4HK7A 3VNJA 4CU6A 2IQDA 3G1FA 1DP0A 2CERA 2PGFA 1C29A 4WGXA 3UG8A 3SR7A 3PPCA 2BHYA 5BCAA 2VD8A 1V6XA 4DBEA 2QGHA 1OYAA 2ZC1A 5BNKA 1ZBWA 3SAZA 3TMLA 1V03A 4DYKA 3B9AA 4Z1AA 1FWSA 4Q7IA 1R3TA 4WOZA 3K2GA 2ZUNA 2XFYA 3MSYA 4HD5A 5FOOA 3PTDA 5EMMA 4IPPA 3VIMA 1J2BA 1XSIA 4BS0A 3W73A 3CL7A 2HJPA 1FKXA 1I0DA 2BNJA 4HNUA 4X0VA 4KCTA 3URQA 2DT0A 3LHTA 1XHGA 1X7FA 4H9ZA 1UP2A 3SEPA 4P7NA 2GWNA 3WJSA 1UMYA 4LVDA 1EF2A 4O52A 4AVNA 1ONWA 1OWQA 3WF4A 5TAOA 4FNUA 4JTLA 3BW3A 1DYSA 5A6MA 3A6OA 4V28A 1G6CA 3F2BA 4ZSUA 3FA5A 2XIOA 1LT8A 1ISWA 4KESA 1CLVA 4RL3A 1CXEA 1OINA 2WC7A 1REQB 4ZXLA 2QJIA 3BUVA 2I56A 2WZMA 3AIQA 3L0GA 4ORIA 2PWUA 4HN4A 4H8NA 1MWOA 1JDCA 3SY8A 1W3IA 3DFYA 1CW2A 6PTDA 4I8YA 1SPQA 1GW1A 2E25A 4UC5A 1RA5A 2I5IA 4CQDA 1FCUA 3VABA 3UPBA 4RNHA 4KEUA 3GVQA 3WEOA 3WK1A 4C7DA 2ACUA 3RPTA 5CXPA 1IR2A 1HKKA 3KTCA 3VFCA 3KFTA 1CXLA 3O7UA 2OYKA 3RUBL 3WQDA 1R3VA 5EB8A 3VTRA 1SJBA 1YPXA 2CWXA 4XSLA 3ZR6A 4BZYA 1R47A 5DCDA 1EJUC 3TONA 1AL7A 2B7NA 3TYBA 1S3TC 3T9PA 1OFAA 1KM1A 1IEXA 3W84A 4O13A 3S8HA 1JYWA 3MP5A 1BRLB 1H51A 1E40A 4PTWA 3EEGA 1LORA 2JF6A 5HATA 1DOSA 2FJKA 1LL4A 5CBIA 3MYOA 1DQXA 3I7QA 1BF6A 3UG5A 2H8XA 1RJRA 1Z3NA 3CZGA 4AZCA 3S1WA 3VNZA 1OEPA 3G5EA 1X96A 4GI8A 3W75A 2E8ZA 4Q33A 1XJBA 2QZRA 4I9MA 1VAHA 1NTHA 4Y8EA 1MDRA 3W6YA 4CN4A 4EXBA 2RGMA 1XIFA 1DWGM 3IUHA 1UROA 2Z1KA 3MI3A 3T2OA 3L66A 1HP5A 3B4YA 2J79A 2VZUA 3GFXA 1LG2A 1GOOA 2GQ3A 7ENLA 2VCAA 1ELSA 3VNKA 2PDNA 1GJPA 3DYOA 1EUNA 3HG4A 4IPIA 5F7UA 3SJ3A 5A2BA 1XPYA 4BWLC 1TCMA 1F76A 4J2PA 1PB0A 1KWGA 4KKXA 3MJYA 1S39A 1OABA 1SW3A 3T8LA 1XFCA 2ISFA 4NP7A 4KRZA 1VFHA 3HV8A 4PUEA 1MI3A 1W1YA 1V3KA 3EX6A 4UTHA 4HU4A 3KS6A 3QN3A 3S42A 2OELA 1IT0A 2PRLA 3O07A 3W28A 1K77A 5BXPA 3MWCA 1AUSL 2BXZA 2AL1A 3BTNA 3TN5A 3U57A 4MM1A 3KBSA 1S38A 3IUDA 3WNMA 1CDGA 1GW9A 1B2YA 4FOUA 4PL1A 3I6RA 2GGHA 3VIHA 1CECA 4DO7A 2PDGA 3QOKA 4WRHA 1JAEA 4S3CA 2CYGA 2J7EA 4UTTC 4IUGA 3OG3A 1P5BA 2Z7KA 2WHKA 4GWEA 3OZYA 4Z08A 3I7SA 1TJRA 5E0CA 4TOQA 1RV8A 1EX5A 1KFBA 2PLJA 3P67A 5EFFA 2TPSA 1PL9A 3USZA 3W1RA 4GIYA 3W29A 3F2CA 3S83A 3VKJA 2O7SA 3A5VA 3CASA 4IIHA 4S3KA 4ZQPA 1JXJA 5CZKA 2V68A 3VGBA 5HDRA 3D3FA 4KH2A 3IJ7A 1W56A 4DAFA 4K7VA 3NQGA 2V3DA 3PJUA 5JH1A 5KMYA 3QW4B 2ZX6A 1VPYA 2R1KA 5LKYA 3GUGA 3UF9A 3RYSA 3HPAA 4FF5A 3UY7A 1XDMA 4C1NA 4MB4A 5BZAA 3BAJA 2FB3A 4GPNA 3TWAA 1WBHA 3WUGA 2IMRA 3T4CA 3KWSA 4JQAA 3DOPA 6XIMA 3REQA 1L6YA 2GUBA 4X2RA 3SRKA 3AO0A 4L6DA 1YLVA 2FHFA 4CQCA 2BB0A 4JIRA 1HIZA 4DM1A 4XD5A 2PFHA 1JUBA 2VDHA 3IVSA 2ZA2A 1QWGA 3G0XA 1DHKA 1KFKA 2NQ5A 4B5SA 3FXGA 1KD0A 2ZA1A 1KTBA 3ZVHB 4H2CA 4CLMA 4PB5A 2FGBA 3TYUA 2YX0A 2OLHA 4X63A 1V02E 2YA0A 1Q6FA 4IPLA 1OGGA 5CPSA 2OMAA 1UBPC 1Z89A 3WLSA 3ENLA 5GJNA 3S46A 5D9NA 6CGTA 3ZZ1A 1GEHA 1OQFA 3ARXA 3PR2A 1VQTA 1XCXA 3CQKA 3AQUA 2ZXDA 1QT1A 3TX9A 2IKIA 4JTUA 1G4EA 2FPYA 5EMJA 2ZRZA 3WF3A 3CT2A 5CPNA 3P74A 5H8UA 4MFEA 1Z8AA 2HISA 3NQCA 4L61A 3BMXA 4GZJA 1VBGA 2QUVA 5LZLA 3VZXA 2ISDA 3MMUA 1W3LA 4A4AA 3ZYZA 1R3QA 4GZ7A 1TJ2A 3OLEA 2PGRA 3EXRA 4P2VA 4A3HA 3M0XA 1EEPA 2PTDA 5BU9A 1KV8A 1Y0EA 4JX5A 3SW6A 4D1JA 3MZ2A 1WAUA 1AZ1A 3UYIA 2ACRA 2OYLA 5MHBA 1OBAA 3VDGA 3E1F1 1VR6A 2P53A 3A3XA 3I3DA 4M6UA 1WKFA 2VT0A 4FZIA 2F6UA 3MJMA 7REQB 2KX9A 4FF7A 3TNBA 3W2NA 1DWAM 2ZKMX 3TZNA 1PDZA 3PANA 3H26A 2OCZA 4MKVA 1HGWA 2UY2A 1PV8A 3TTSA 5FL0A 3MSGA 2WK2A 3S5SA 5A6KA 4AF0A 4CCDA 2A3AA 2D3LA 4LS0A 1YYAA 2ABAA 2D3NA 1JULA 4GCXA 1XW8A 4JIPA 3PHAA 2WB5A 3R43A 3VGHA 4LXFA 4ZQMA 2XGZA 3L67A 3VD4A 1CPUA 2RDXA 4RE2A 3G24A 4J1OA 1TR9A 1W3KA 1XLJA 3P5ZA 3GNRA 3ITTA 3R79A 2ZZ2A 3G1RA 3C86A 2Z2UA 3LCHA 4Y8FA 1GVQA 2XN2A 2CZVA 2G96A 3O9NA 3FDKA 4DWSA 1UC4A 3A12A 4B2DD 2IPFA 1VPQA 4DJEA 1HG3A 2FHBA 5KTLA 3FN9A 5IHRA 3BAIA 1ZY9A 1RQBA 4TVDA 1SR9A 1W3JA 1K9EA 2QCNA 3PTQA 4DN1A 3NZ1A 1A80A 2AAMA 4PE8A 1SJDA 1CXHA 3B0UX 2QDGA 2C16A 1R9ZA 5G1TA 4L6HA 4JTTA 4GY7A 3VPLA 2TMDA 2BWGA 5CLTA 3IGSA 3IK2A 4GISA 4UR9A 4G1NA 4WX2A 2OGYA 4HNOA 2OPJA 3V5OA 2GGJA 3GAYA 3LV6A 1H1YA 1Q2RA 4KCVA 1QU4A 2QVHA 4LAKA 3DGRA 4WY0A 1EDQA 4GI4A 2Q6ZA 3CUHA 4AYGA 3KOZA 3TEVA 1KFJA 1EKOA 4Z2JA 2BY3A 1H7WA 1I2RA 3GHTA 1AVAA 1MMFA 5AOUA 1JZ3A 1VLWA 5K4ZA 1VD6A 1W8GA 3GU9A 3IEBA 4HA1A 1BG9A 2WPGA 4S3JA 1HJXA 1QW8A 4CQAA 4WDTA 4EXQA 5LNVA 5AYYA 3AJXA 4D2JA 1RK6A 3I7RA 4E2VA 1XUUA 1DWHM 4LBSA 2JALA 4PMNA 4Q6JA 3K4AA 5F2GA 4I6VA 1RD6A 1YKWA 3A22A 1TWWA 3V0TA 3LOTA 1W1VA 2INFA 3G3DA 3NQDA 2DUAA 3G3MA 3JW7A 1BXBA 5C6MA 1LRQA 4XUYA 5FKYA 5FESA 4Q7BA 2P5NA 1PJ9A 1UIOA 5EBUA 4PMQA 1DKWA 3E2QA 4YTSA 4HHPA 1F73A 3SFKA 1BVZA 1JUKA 1CLXA 4DF0A 1H7OA 3E38A 3STPA 3P84A 4BKNA 4HNVA 4ZVJA 2IPGA 1YTKA 1R3RA 4AZGA 1XRSA 1MW2A 3RU6A 4W7WA 3EWXA 4PBGA 1S5VA 5CEWA 2BFGA 1S2WA 2J88A 3TR9A 4DZIA 2A3BA 9CGTA 2ISWA 4PRTA 1FFRA 4JTDA 3GTFA 1DWFM 4UUIA 2XH7A 3IACA 4RZBA 1J0YA 2H3BA 4AG0A 3LHZA 2CHRA 2QF7A 3DG6A 5LIXX 2BVYA 3HO8A 3WDIA 2QUMA 4A6GA 1R2TA 1XLBA 3A13A 4LEFA 2WVSA 3WH6A 3MSRA 3SUUA 4LY8A 2HXTA 4PUNA 5FIPA 4GNKB 4N6EA 3EMCA 3TVAA 5F2LA 1I6NA 3VX1A 1K8ZA 5CPQA 2O9OA 3UT0A 4CN6A 4FOJA 1MRQA 3VOIA 2E7FA 3LK6A 4S2BA 3NZGA 4LYRA 5HJLA 2BGSA 2PWGA 1W9BM 1EO7A 1Q45A 1XLEA 4R7OA 4J35A 4E38A 5DCBA 1XLCA 2FMOA 3VGFA 3SCTA 1DORA 2GSEA 4FLQA 4MFDA 1POKA 2B7PA 3KX6A 1K8YA 3OA5A 4L5ZA 2RKXA 1RQHA 4JQ4A 1MEHA 2X2GA 4F3HA 1XF0A 4N42A 4GY0A 3IIVA 2GJRA 4XISA 2G50A 1NDYA 3NQFA 3IIPA 2XTKA 3QY8A 3RNDA 5KZEA 1VBUA 1J79A 1JAKA 1KKRA 3C8NA 5FI8A 1JL8A 4FIRA 3LNPA 4QNWA 5DCEA 4B3ZA 3NJ3A 1J01A 3D6NA 4A2RA 2WQPA 1FDZA 5A6LA 2QYGA 1N7KA 3BWWA 2XPKA 4AD1A 5DFAA 1RR2A 4QRNA 4AC1X 5C9UA 1CWYA 1OG0A 2E67A 4BI7A 3AHVA 4JFVA 3ZVIA 2AOSA 4CGTA 3SB0A 1J0HA 3KRUA 4TX6A 4NJIA 3LPGA 4ZO8A 1DE6A 1UIPA 1WZMA 1YHTA 3E96A 1UJPA 3EWDA 5KZDA 3UXKA 4ECLA<