4EE9A

Crystal structure of the rbcel1 endo-1,4-glucanase
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
321
structure length
321
Chain Sequence
SVDLIGINVAGAEFTGGKLPGKHGTHYFFPPEGYFEYWSEQGIHTVRFPLKWERLQPSLNAELDDVYASLVDDMLDQAKENDIKVILDVHNYARYRKKVIGTEDVPVSAYQDLMERIAKRWQGHDALFAYDIMNEPYGSADKLWPAAAQAGIDGVRKYDKKRPLLIEGASWSSAARWPRYADELLKLKDPADNMVFSAHVYIDEDASGSYKKGPGKDFEPMIGVKRVEPFVNWLKEHGKKGHIGEFGIPNDDERWLDAMDKLLAYLNENCIPINYWAAGPSWGNYKLSIEPKDGEKRPQVALLKKYAAKDNCSDFGPAKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
publication title Three-dimensional structure of RBcel1, a metagenome-derived psychrotolerant family GH5 endoglucanase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 119
structure length 321
sequence length 321
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ee9A00
3PZTA 3AXIA 2XVLA 3MMUA 1V6WA 4K68A 5JBDA 4J27A 1DWGM 2F61A 1WNOA 2XIBA 3AS3A 2QF8A 2D0HA 5ABHA 1ODUA 7CGTA 2WSPA 2ZUTA 4ACYA 1M7XA 1VBUA 4D1JA 2E8YA 1DTUA 1EDGA 1RP8A 2X0HA 5I6SA 3GXFA 1HVXA 5BXRA 5A8QA 1UD3A 3MV01 2YL8A 5I78A 2DH2A 1A3HA 1I75A 8CGTA 4LX4A 2J77A 3NSMA 4WKAA 4B16A 4ZE4A 3WNMA 4W86A 3WBAA 2D0GA 3L2MA 1EO7A 2J7HA 4QLJA 1QNOA 3CZKA 3OIHA 5DEZA 4AZIA 1MQPA 5CPSA 1HP4A 4UCFA 2OYLA 3VMOA 4AW7A 1XHGA 5C70A 4HU8A 4EANA 1UWRA 1H49A 2JEQA 1HF6A 1XH1A 1EDTA 4L4PA 4HMDA 4PMYA 1R7OA 3MANA 1QI0A 4EAMA 4Z2HA 4TXEA 4CD8A 1H09A 4Z2IA 5CJ5A 5JIPA 2FDMA 2QPSA 1BGGA 4KH2A 1TZ7A 2A3AA 1CXEA 2BS9A 2GFTA 2FH8A 2QMJA 4ZFMA 1BVZA 3WFZA 1MVYA 1WKYA 3OGVA 1R8LA 3GNPA 5AC5A 3A47A 5CSYA 3CUGA 3AMKA 1U30A 5M5DA 2DT1A 4M82A 3M07A 2CBJA 4YHEA 2G3NA 3WH8A 1M53A 1LWJA 2J7DA 3OLDA 5ECUA 1XD1A 1WB0A 3VD3A 3WUBA 3AHZA 2J75A 3L4VA 1BHGA 4C7DA 1JAKA 3WF0A 2EPNA 1UA3A 3VGHA 4BQ2A 2VT0A 1GQIA 2GK1B 1EO5A 1PPIA 1VRXA 1E5NA 1E43A 2ZIDA 2PWFA 5EBAA 4BZYA 3CPUA 2BY0A 3GM8A 4P7LA 4C7GA 4PTVA 4W8LA 1HX0A 1JZ6A 2BVDA 1UD5A 3AROA 3GBEA 1NOWA 4HOWA 1G5AA 2V3FA 3WNKA 1W1TA 3K8LA 2D1ZA 2WVVA 4IISA 2VVNA 1HJQA 1KWGA 4BF7A 4UQEA 3VGEA 3VIPA 2XGIA 4UOZA 3L2LA 3ARUA 2W63A 2GJRA 5CPTA 2F8QA 4PCTA 2J7CA 4JKLA 4XX6A 4V28A 4BCEA 1HP5A 5AY7A 3LPPA 1YQ2A 3KL3A 2Y8VA 1UWIA 1LQ0A 1W1VA 1N82A 5M03A 1HL8A 5FCZA 1FH9A 3CZJA 1XV8A 2GDVA 2EEXA 2XSAA 3BAIA 3N11A 4QFUA 2J8GA 3T08A 4FMVA 3N1AA 2CERA 3GNRA 2WVTA 1XSIA 1LL6A 3GNOA 7A3HA 1GNXA 3T2QA 5E6YA 4UTFA 3UG5A 2E40A 3N04A 3VDHA 4JZ5A 4P7QA 3VDCA 1CPUA 3F5JA 1KQYA 1IZJA 4OBSA 3DC0A 1JAEA 1U33A 3CHDA 4U3CA 1S46A 4TUFA 3AI0A 1QI5A 5M17A 3TA9A 3THCA 3HU7A 5EB8A 7TAAA 3VM5A 5LYRA 3L4XA 4TTGA 3SCNA 1OB0A 1NOFA 3FNDA 3DHPA 4WF7A 1WZMA 4MB5A 2VZTA 2CPUA 3LPOA 3CHEA 4Z2KA 3B9AA 4H04A 2J62A 1J10A 2WW5A 4URIA 2OWXA 5HPOA 1H1NA 4EK7A 3LPGA 1FHDA 3ARPA 4UQBA 2ZXQA 3TTQA 5A6JA 2WBKA 5A6MA 1V3HA 1XYZA 4H8UA 2FHFA 1OIMA 1JYXA 3BAWA 1FP8A 1YHTA 3APGA 1DWIM 4ML4A 3GZAA 4MNKA 4L4OA 4GZIA 5EMYA 2C8NA 1M01A 3WD4A 1ISYA 1H11A 3M7SA 4TX6A 3EDJA 1XC6A 2EQDA 2J47A 1BYBA 2V3DA 4NRRA 3HJEA 1JXJA 2XM1A 1MXDA 4PMUA 3POCA 3VO0A 1J01A 4FK9A 3AZTA 1XCWA 3OZPA 4DUXA 3BMWA 3WNLA 1A47A 3BSGA 2G41A 1W32A 3N17A 3QR3A 2EPOA 5GNZA 1DWAM 1EHNA 1E4IA 3NDZA 4OBRA 3WSUA 5A2CA 3WDPP 1QNPA 3EMZA 2NT0A 1XCXA 4CKQA 3GDBA 4AEEA 4DWSD 4HMEA 1WO2A 4B3KA 3ZR6A 2CITA 3K8KA 5IHRA 2YL6A 3L4ZA 1C3FA 4JKMA 1W2PA 3WFLA 4GI9A 5F7UA 1D3CA 3VUPA 1SMAA 2XPKA 4HMCA 1UD4A 3SCPA 4AD0A 1V0KA 4AZ5A 1TVPA 1E3ZA 4PSPA 2ZX7A 5E9AA 3G6MA 4UR9A 1EXPA 1JYNA 2ZE0A 1D2KA 4HA1A 4IM4A 1LWHA 3CUFA 4X0NA 1CWYA 4LPCA 3VIKA 1ITXA 4CD7A 2GSJA 3WEOA 2XGBA 1BAGA 4CU7A 2VVSA 2XVNA 1ECEA 3ZO9A 1K6AA 4AZHA 4J3SA 2W91A 3VGGA 3PZIA 3ZR5A 5BXTA 3BAXA 2D3NA 4JL1A 1CXLA 1CGYA 1OGSA 3UG4A 4TVDA 5LA2A 3U7BA 1XGZA 3VDBA 1JD7A 4NRSA 1TA3B 1VF8A 3PTQA 5FL1A 2YDRA 4J28A 2WVVB 1HJVA 1M03A 3MMWA 3NIYA 1W9DM 3ARZA 1J0YA 2AOSA 1ZB5A 1JZ8A 3PZOA 2D20A 5I0DA 3PBGA 4AIOA 2XTKA 5CGMA 4BQ3A 4YN5A 2WXDM 1XYFA 3M6DA 4J3VA 3ZJ8A 3ZT6A 4CCCA 5LA1A 4FLQA 5DMYA 4W85A 2GK1A 4XZWA 2WNWA 1VFOA 4W7VA 1JD9A 1GOIA 1OT2A 1UD2A 2BNJA 3DYMA 1ZBVA 1CGWA 1I1WA 1V0MA 3AFBA 1V03A 1SYTA 5CSUA 3JUGA 4HA4A 2JEPA 4UFMA 3ARSA 2PBGA 4FF5A 4AWEA 2ZXDA 1WDSA 1AQHA 8A3HA 1E40A 2UY5A 2FHCA 3W82A 3MMDA 1PIGA 1J18A 3PZGA 2OWWA 2J79A 1V6VA 1CXIA 2VQUA 2D22A 4B9ZA 2VJXA 1V3MA 4JIEA 1WDRA 1ZL1A 1EIBA 1NARA 4CN4A 1QOXA 2WHKA 4RL3A 4LYQA 4OOZA 1GZJA 1VB9A 2DSWA 1BG9A 1JXKA 2ZX8A 3UCQA 1E6RA 1E4MM 4J3UA 3WDRA 4EE9A 1HKJA 1C8YA 2DPEA 1PBGA 1EQCA 1QNQA 4MDOA 5KZ6A 4PMXA 1JNEA 4D6GA 5CLWA 2C0HA 1K9DA 2RGLA 2CXGA 3WL1A 1J12A 1H0IA 1GQLA 5GPRA 1WAWA 3AIVA 1E6QM 3AIWA 4W7UA 1W2VA 1FFRA 4MJ4A 1C93A 1PAMA 3LPFA 2O92A 5GNYA 1WZLA 3ALGA 1EQPA 3W6MA 5CG0A 4W5UA 1ZS2A 1AVAA 1UR1A 4WK9A 2PBOA 3BC9A 3OGRA 1EOMA 4S3JA 4W5ZA 2XWEA 4ZENA 1AMYA 1GOOA 2JE8A 1JF5A 1GCYA 1KGWA 3D5HA 4UZSA 4OJYA 2VX7A 4GXPA 2VCAA 1CYGA 3BAYA 2XVPA 5IFTA 2G4FA 1TE1A 1HXJA 3N15A 1WCGA 1VFFA 2UY3A 2YIHA 1J0KA 3AZRA 4JFUA 5HBFA 1TFVA 3DYOA 1VIWA 1VENA 3RO8A 3VMPA 5IXEA 1AQ0A 3UEQA 1UZ4A 3DYPA 2OYKA 1BYAA 1PX4A 3SEPA 4ATLA 5DF0A 3WN6A 3TP4A 2JALA 3VGDA 2XSBA 3L4UA 3VD7A 1DHKA 3BXWA 3WDJA 2ZUNA 1IZKA 3AOFA 4W8AA 3WIJA 1R86A 3NSXA 2Y5EA 5D9OA 1JNDA 1MWOA 1UG6A 5A95A 4N0RA 1CDGA 1MXGA 5DT5A 4PTMA 4MAZA 4WKHA 4MNMA 2XJ7A 1JYVA 3F5KA 1WDPA 2XG9A 5A6KA 4UQ9A 4W7WA 2EJ1A 4HZ7A 1EOKA 1QHZA 2G3JA 4F8XA 1SR0A 1CXKA 2DSZA 3AHYA 2ZUWA 3PHAA 1W1YA 3G6LA 1PX3A 4BA0A 2ZX5A 3IAPA 1G9HA 2GJPA 4PBGA 4XV0A 5AC4A 4TVUA 4D6JA 2HISA 3W29A 1E55A 4HOZA 1E4LA 3I3BA 1G94A 1C7SA 3W28A 1W1PA 1W9VA 3BSHA 4PMVA 3T0DA 4AMCA 1UR4A 4UFHA 3AHXA 3QHOA 4JKKA 4CD6A 4CN6A 3S2CA 1KWKA 2IXUA 3VNZA 4TVCA 2VURA 1VJSA 2WSKA 1KBKA 4U33A 2WAGA 3CHFA 1GPFA 3J7HA 1E72M 4UOQA 2ZICA 1JDCA 1TVNA 4ZE5A 4ZEPA 2D23A 1FH8A 2CBUA 2VZOA 5BRQA 1V02E 3AHVA 4V2XA 4MTVA 1MW3A 2PWHA 2YA1A 5HDRA 4Q22A 2XUCA 4GZEA 1V0LA 2WK2A 1ISZA 3SCWA 1BPLB 3OGSA 1E70M 1E9LA 1ISWA 4W89A 4A3HA 2WMGA 3ARTA 4DUWA 6CGTA 2JIWA 1E6XM 4ATWA 1TA3A 3WUGA 3QOKA 4CU6A 4B9YA 5IDIA 1OD8A 4AY1A 5JBFA 1Q4NX 4D72A 1VEOA 1OSEA 4W88A 3IJ7A 5JUVA 4KGLA 1W9PA 2VRKA 2V3GA 2CNCA 1F4AA 2GDUA 3L4YA 3RM4A 1UOKA 5A8NA 2E8ZA 2WC3A 3AMGA 1CGTA 3BAJA 5E09A 1W91A 1UZ1A 4OOUA 3T09A 4PMQA 1J0IA 4J3TA 3SCSA 4AD3A 2WMIB 4XUYA 4MB1A 1H3GA 1QW8A 1OGGA 4UFLA 1J9YA 1QBBA 4W8BA 3OBAA 2WYSA 4CU8A 3NUKA 1MW2A 2XYLA 2WM0A 4PCSA 1C92A 3AXHA 3WD3A 3BLPX 1CTNA 5E0CA 3WF4A 3BCFA 1WPCA 1X6LA 1F4HA 4AZ6A 3GH7A 2WVSA 1XH2A 9CGTA 1Q6FA 3GTNA 2V3EA 2VI0A 2HVMA 2B31A 1CENA 5BXSA 4TOQA 1HJWA 2E9LA 3WNPA 5D9NA 1VJZA 2ZOXA 4B3LA 2CKRA 2VC9A 1FP9A 1GUVA 1EDQA 1IT0A 1IV8A 5A6SA 3WQ5A 3WELA 1OGBA 2ZUSA 3GYCA 2ZXAA 3QHNA 3AMLA 1HNYA 3A3HA 4CGTA 5E70A 5CPQA 1G0CA 1ZBKA 2JFEX 2Y4SA 2BV9A 4A4AA 1QW9A 2QLYA 5ABFB 1JZ7A 3ARWA 4X9YA 3WL0A 4P8WA 2E0PA 3WUFA 3ZSTA 4CD4A 1VAHA 4JCLA 2ESCA 3U57A 4GQRA 4F9DA 2DEPA 4AZCB 2DT2A 1Q6DA 5D4YA 3PZVA 5DFAA 4R27A 1RP9A 5BROA 2BVYA 1KXTA 1RPKA 3UESA 5A6AA 3WQ6A 3LMYA 1UYQA 1VBRA 4UNIA 4PMDA 5I5RA 3F4VA 3FN9A 1RH9A 3KWXA 1TR1A 2EPLX 5A69A 1JZ3A 1ZJBA 3B9DA 3UR7A 2O9RA 2WMKA 1J0HA 1E1EA 1ODZA 3U7VA 3SCTA 2A3HA 3ZOAA 1H5VA 3WUEA 2W92A 3I3DA 5A3HA 4QDMA 2CESA 3TOPA 4U5IA 1QNSA 3FW6A 5I79A 1W9BM 4XB3A 2C7FA 1KXVA 3OLIA 3GXIA 4PMNA 4DWSA 2O9OA 1GJWA 1Q6CA 2ZUVA 3VIHA 3OLGA 1MQRA 2DGAA 4CN1A 1UH3A 1GVIA 1VEPA 4E8DA 4KGJA 1EGZA 4LYPA 3WY1A 2WB5A 1NH6A 5FOOA 2E9MA 2WANA 2E9BA 3BLKA 2BY1A 3AMCA 1E4NA 1PX8A 3TTSA 1VFMA 4HTYA 3AQUA 3IAQA 4NF7A 3TTOA 3EDKA 3ZM8A 3TONA 5I77A 2WZEA 4JHOA 5AYBA 3W81A 1KCKA 3ZJ6A 1O7AA 1WDQA 4AIUA 1JDAA 1U2YA 2CIPA 2UY4A 3AIEA 1B3XA 3AS0A 1E56A 3IJ9A 4WIWA 3SCOA 3ZJ7A 1PIFA 2VOTA 5BXPA 2O9PA 4WLCA 3SUWA 3AIRA 4N42A 3UERA 2GJXB 4OIFA 1HN1A 3U5YA 2OSXA 3WDQA 2OSYA 3K8MA 5BRPA 5EFDA 4AD1A 5DT7A 1GVYA 5E0FA 3VINA 2WVUA 1W9XA 4QCEA 2A3BA 2WC7A 1NOUA 3CUJA 3K46A 2PF0A 2WCGA 4D1IA 3EYPA 4WJXA 1FOBA 1KXHA 4UOJA 1UR9A 4AEFA 3D3AA 1UA7A 2ZWZA 3HN3A 1BF2A 5EFFA 5I2UA 1QHPA 4PYSA 3MUIA 2VCCA 5C8BB 2NT1A 5CGTA 4JAWA 2CCRA 2CEQA 4W93A 4XZBA 4CD5A 5A8MA 3N9KA 2BHYA 2OWCA 3UR8A 4QLKA 2J7GA 4MNJA 2J7BA 1JI2A 4D6DA 4H2CA 3SUTA 5LA0A 4PTWA 3WNOA 2UWFA 3RDKA 3OG2A 3L4WA 1OD0A 3CO4A 2J4GA 1KCLA 1OBAA 4D6IA 3VIJA 1UKQA 1G1YA 4FLOA 4UFKA 6A3HA 2JIEA 4GZJA 1CNVA 2O9TA 1MFVA 2WZIA 1HVQA 2YLAA 1PEZA 2DT3A 2NW0A 3W4RA 2V5CA 4JFVA 3SUUA 4MPKA 3MS8A 1BFNA 1E5JA 2VL4A 1Q6EA 1I1XA 3DECA 1OWQA 1GQKA 3VGFA 1H41A 3ZJKA 1FH7A 3MUZ1 5ABEA 3WF3A 1B3ZA 3WMBA 5JBEA 2WMJA 3CZEA 1DWHM 3W25A 2DQXA 3EMQA 1UHVA 3U5UA 2GVYA 1V02A 2YBUA 2WZHA 5D8ZA 4U3AA 3NDYA 5A94A 1C8QA 1HJUA 1NWUA 3AZSA 3CZGA 3RJXA 4U5KA 2WLYA 1TG7A 3WENA 1UKSA 3AYRA 1EH9A 4GI6A 3W26A 2ZX9A 2VZUA 5HXMA 4NZCA 1XSJA 4AXNA 2CKSA 3RM8A 3QOMA 2XHYA 3MSDA 1US3A 5A6BD 3K1DA 2WMIA 2EXOA 1C91A 3E1F1 4HA3A 1BTCA 2VMFA 2PWGA 1B0IA 3W0KA 4QCFA 4H41A 3VM7A 3FHQA 1B3WA 3GH5A 1C8XA 3W53A 1KGUA 3AIQA 1LG1A 3WQ8A 3WEMA 3KE0A 3WEZA 3WD1A 1R7AA 4AYSA 3RJYA 1J0JA 5FL0A 2VR4A 1XRVA 2D3LA 3CUIA 4M56A 4JFWA 1C90A 4DUVA 3K4AA 3RM9A 3WDHA 2G8ZA 3M46A 1UWQA 1W3KA 3AISA 1ITCA 2CHOA 4PMRA 3ARXA 2WCAA 1QBAA 4P7RA 1JZ4A 1KR1A 5ABGA 5A8PA 2WHMA 1JFXA 2XIIA 3A4XA 5C71A 1H0GA 2V38A 3NJ3A 4NSBA 4D6FA 2YKKA 3RILA 1SFSA 4Q7NA 2TAAA 2VRQA 4PTXA 1CEOA 2WKLA 4DWSB 4GKLA 4MADA 4YPJA 1US2A 2WKGA 4BQ4A 3SCQA 5ABFA 3AMDA 3N18A 1QI2A 4ZXOA 4GO9A 1GW1A 4RE3A 4HU0A 3AHTA 3W27A 1VEMA 3N13A 4AZCA 2BVTA 2BY2A 1UWUA 1WZAA 3CBWA 2WMFA 1CBGA 3OLEA 1NWTA 4RE4A 2WMHA 1L0PA 1UD6A 3RIKA 1ZJAA 2YDQA 4U2YA 3VGBA 4F79A 4QAWA 3VTRA 1DP0A 2WC4A 3IJ8A 3VIMA 4UQDA 2PC8A 4HOXA 4PSRA 1DWJM 1FHLA 2VCBA 4WSJA 1JG9A 2F2HA 3UETA 4U31A 3ZSSA 3AJ7A 3PZMA 4M80A 2J74A 4W84A 3PTMA 2X05A 4QP0A 3ZT7A 2DSVA 4AISA 1B9ZA 3KEHA 3RPMA 1P6WA 2VO5A 1UH2A 4FLRA 3UG3A 1B2YA 4PMOA 1RD6A 1JL8A 1R87A 4IPLA 4PMZA 1NWSA 2YDSA 1ZBWA 4Y7EA 1Q6GA 2AAAA 2RGMA 1Y7VA 2FHBA 3EDFA 1QVBA 4S3KA 3PZUA 4LXFA 4EKJA 3ALFA 4CVWA 1BYDA 2CETA 2PWDA 2VZVA 1CGVA 3GH4A 3O2LA 2VQTA 2J7EA 3CIVA 4UFIA 3THDA 3BGAA 3CMGA 4Z2JA 3WF2A 3WH9A 4MJ2A 3NSNA 2VX6A 4BS0A 4GIAA 1MYRA 2BXYA 1UH4A 2GUYA 1GHRA 2VX5A 4F9JA 1K9TA 2DT0A 3B9EA 1HKKA 3BAKA 4AD4A 3VMNA 4GINA 4JFTA 2GJXA 1V3IA 2PWEA 2MANA 4AIEA 3MUAA 1CLVA 5FKYA 1GOKA 3FAXA 3VPLA 1OCQA 1CZ1A 1DWFM 3B8SA 4MAVA 3O6AA 1E6ZA 1M04A 3II1A 2BHUA 3TTYA 4GI8A 3CMJA 1X6NA 1HKMA 2QMKA 2BHZA 4H8VA 4FLSA 1MQQA 1W3HA 3AXXA 3VIOA 1GOQA 4MDPA 3I3EA 1X1NA 2ZUUA 1WE5A 2V5DA 3WD0A 3WMCA 2Z1SA 3GBDA 1KR0A 4J3WA 2J78A 2XVGA 2X1IA 4RE2A 1ISVA 1WP6A 1LF1A 1LJYA 2OYMA 2W67A 3VIFA 5CQ1A 2YJQA 1J0ZA 2DDXA 1KB3A 2D24A 2OLHA 4P8XA 3NYDA 3MUY1 2IUZA 2G3MA 2YLLA 3CLWA 3VX1A 2E4TA 2VRJA 5A8OA 2DIEA 3RMEA 4MB4A 3WQWA 4HPHA 3IANA 3ZIZA 3EDEA 2XFYA 2E3ZA 1XSKA 2X8RA 3FY1A 1B3VA 3O9NA 1E0XA 2Y8KA 1GJUA 3PZQA 6TAAA 2X2YA 2YBTA 2FH6A 3A4AA 4PN2A 2Y2WA 2ZX6A 1UKOA 2FGLA 4PRWA 1E0VA 4PUEA 3VD5A 5BCAA 3WQVA 1B31A 4KRUA 1JIBA 2WHLA 4MB3A 3BH4A 4X0VA 5D9PA 1ISXA 5DO8A 3VDAA 4QLLA 4KRTA 2EO7A 4V27A 1E15A 2YOCA 3BMVA 4IPNB 4H8HA 5D8WA 1W9UA 2DSUA 2QV4A 3KL0A 4CUCA 4ACZB 1K9EA 3N12A 4AC1X 2VNCA 3AYSA 5TD4A 5A1AA 1Z32X 4PEEA 3GXDA 5HNNA 1E6PA 4AD2A 5FD0A 4WSKA 1V6UA 5FIPA 4DM2A 2UY2A 1WZKA 2CHNA 1FFQA 1KGXA 3T0AA 3WNNA 1BYCA 2EBNA 3W24A 3KL5A 2X0YA 4UQCA 4HZ6A 1HKIA 2WWCA 1CGXA 3GXMA 4IUGA 4UQAA 4KWUA 3MO4A 2QPUA 2CBIA 1QI3A 5IFPA 2PI6A 1D7FA 2D0FA 2DH3A 4HZ8A 1E6SM 3EBVA 3CZLA 1LL7A 1QPKA 3CTTA 1E73M 3VILA 1E1FA 2A3EA 1UQYA 4PUDA 2CBVA 1ZBCA 4W87A 3ARYA 4YHGA 4AZ7A 3ZQ9A 1UWTA 2X09A 1J11A 5A6LA 1LL4A 2Q8XA 1HJSA 2EPMX 4E4PA 2DSKA 1B1YA 3VIGA 5A2BA 1TCMA 2D2OA 3HMCA 3WF1A 1CXHA 3EDDA 1UQZA 3PN8A 3SCVA 4M24A 5CXPA 5I3DA 1O6IA 1CIUA 3EMCA 4OZOA 3WMSA 1UKTA 1TUXA 3PZNA 4JL2A 1ESWA 4U2ZA 2YA2A 4AD5A 4TX8A 3VKKA 5I23A 1R85A 5KEZA 1E3XA 4AZBA 3VD4A 1K9FA 1TMQA 4E2OA 2XVKA 2EPKX 1PZ2A 5CZKA 3SCRA 4DWSC 2WLZA 1E71M 3PTKA 4JHZA 5GQBA 3CUHA 2VZSA 1UUQA 1MW0A 1HIZA 1W3JA 1JDDA 1GQJA 3F5LA 4CVUA 1V6XA 3OZOA 3KZSA 3CH9A 4LQ1A 1UKPA 1H4PA 1PJ9A 2J25A 1EHAA 3MV11 4WKFA 1UR2A 3VIIA 2NSXA 3FAWA 4F66A 1JFHA 5BYWA 3SCUA 1JF6A 4OKDA 4LGXA 1B90A 4TTUA 2VR5A 3SUVA 1JZ5A 2WHJA 1UR0A 1LG2A 4Z2GA 2J8FA 4H7VA 5M3WA 1OT1A 2JF7A 2WCSA 4UZUA 3ARVA 1KFWA 3VD9A 4CCDA 1BLIA 4M1RA 3NCOA 1OM0A 1LLOA 2YL9A 2PB1A 3WBEA 4C7FA 3L4TA 2BFGA 1HJXA 1BGAA 1DEDA 1KXQA 1CLXA 4JFSA 2Y24A 4GO8A 3K4DA 1HL9A 2VTFA 5A2AA 3VU2A 3CHCA 1BVNP 5AYIA 3CGTA 1JZ2A 2ZUMA 2CYGA 3AICA 3WH7A 1QHOA 5D9MA 1V3JA 2XFFA 4OUEA 2W4XA 4R5EA 2ZXBA 3S6TA 3DHUA 4A3YA 2G3IA 4D71A 1QI4A 1B30A 5CLTA 3ZT5A 3W38A 1EA9C 3ARRA 2JF6A 2YA0A 4P8VA 3SURA 3MKKA 3RCNA 1FA2A 3SUSA 3T2OA 2DIJA 1BSIA 1MFUA 1W3LA 4D6CA 2VX4A 1CGUA 1SMDA 4P8UA 3AIBA 4BQ5A 1V3KA 1V08A 1V0NA 3ECQA 3MU7A 3OA5A 1KQZA 3FHAA 2W62A 3VNYA 3WD2A 5A6BA 1JGIA 4MNLA 1OIFA 2OSWA 2WWDA 3T0BA 3FXYA 1QNRA 1L8NA 3QHMA 4GQQA 1V3LA 2VUYA 4E8CA 3ZMRA 1NQ6A 4DM1A 2J7FA 4AZGA 3BCDA 4CCEA 1XD0A 4ATDA 1HT6A 1OINA 1VFUA 3A4WA 2W5FA 3SIMA 3VVGA 2W66A 1AQMA 2W61A 1E0WA 3WDIA 4M8UA 4GPNA 3AS1A 1H2JA 2IXVA 2Z1KA 1CECA 5E6ZA 1JYWA 4P7NA 1B3YA 1CXFA 3CZ8A 1NM9A 1GONA 2XM2A 4Z2LA 2A3CA 3T2PA 4J3XA 3AIUA 3QGVA 1NP2A 3ARQA 4D6EA 1G01A 4ZXLA 5HOSA 5GNXA 5BWFA 1UD8A 5HPCA 1C7TA 1E6NA 1V6YA 3WH5A 2XFRA 3WKZA 2QHAA 3IK2A 3A6OA 4NI3A 3W37A 4KMQA 3AS2A 3MSGA 1NP0A 4JCMA 4ACZA 3W6LA 2WPGA 1GOWA 4LYRA 2ZWYA 1XH0A 3VOCA 1BG4A 1MW1A 1BQCA 4M81A 4HP5A 4J7RA 3VX0A 1ZU8A 2XWDA 4B15A 1UWSA 1KBBA 3PZ9A 2FGZA 5I24A 4D6HA 4HPGA 1GORA 2BXZA 1GOMA 3WH6A 4P7OA 1UR8A 5IHSA 1JI1A 2YL5A 1PZ3A 4M29A 3WQ4A 2WBGA 2BY3A 3POHA 1GHSA 2AMGA 4UFJA 3OB8A 1NWRA 5JIWA
chains in the Genus database with same CATH superfamily
3PZTA 3IGXA 2HWGA 4K68A 2E09A 2A5HA 4GY1A 4P5UA 3UP8A 1RVKA 4BWLC 4FXFA 3DDMA 3RHGA 5ABHA 1YTEA 5LXXA 3WJXA 1DTNA 1EDGA 3CAWA 5I6SA 4O50A 1UD3A 2CLKA 1LRNA 3MV01 4QGCA 3AWOA 2DH2A 1EXBA 4IMFA 3WLJA 4RDZA 3KP1A 4LX4A 5ECVA 4B16A 4ZE4A 3U6WA 1GT8A 2QZRA 3ITOA 5C9RA 1EO7A 7REQB 6PTDA 1DPMA 4LEQA 2HBXA 2OYLA 1XHGA 1H60A 3W7JA 3NEHA 4MLJA 3W23A 1BVWA 3C0SA 4HMDA 3T44A 3KVJA 4GIYA 3CMFA 2XZ7A 4GABA 3HPXA 3GVVA 2ZC8A 1H09A 1WXZA 4KRZA 5LIYX 4Z2IA 4O28A 3V16A 3WLRA 5B80A 1O66A 3OODA 1TZ7A 2BS9A 1ME8A 2QMJA 4WDXA 4DO6A 1BVZA 3WFZA 1MVYA 2ABBA 2DVTA 4JQAA 4N7QA 3AMKA 5J04A 1U30A 2QT3A 2DT1A 4S3BA 4QJ5B 2OZ3A 3DKLA 3WH8A 1DYSA 2FPVA 3FYYA 1QK0A 4GYJA 3WLIA 3WLQA 1LWJA 1UPMB 3EWYA 5ECUA 1XD1A 5CBBA 3UR2A 3B05A 2ZRUA 2P53A 3SW6A 1BHGA 1DIEA 1S2VA 3KHDA 2NQ9A 1EUAA 1Q45A 2VT0A 3G1SA 1VRXA 1E43A 2FQIA 1VHCA 3S1XA 1CI1A 4ZVJA 4JTUA 3P67A 1D3HA 2O0TA 3V3WA 4W8LA 1UD5A 2FKPA 3PWGA 4GYPC 3WLOA 4CQBA 2V3FA 3IUDA 1F6YA 3IIXA 3U2CA 4HHPA 2D1ZA 4IISA 1HJQA 3LCHA 4HK7A 4BF7A 1UP0A 4UQEA 5GJMA 2XGIA 2YBVA 4TO8A 1LOLA 1WXYA 4IFKA 3NZ1A 2QJJA 2F8QA 4LUIA 5I00A 4C5ZA 1XG4A 4BCEA 3LPPA 4AWTA 4DJEC 1FCVA 1QPQA 3WLKX 1J6OA 1LQ0A 3QN3A 1N82A 4M7SA 3E0IA 5M03A 3ITYA 4V1XA 2Y7GA 3OYXA 3T4CA 2F6KA 2GDVA 4AY8A 3B8TA 2EEXA 1DQWA 2QULA 2VEKA 2RFGA 2J8GA 4KIRA 3T08A 4DBDA 1JCYA 1LL6A 2OT1A 1GNXA 1XBXA 5K4XA 3BW2A 3I6RA 3UG5A 5AYXA 1KM2A 4F4RA 4NI8A 2ZZ5A 4PL1A 4JTFA 1UASA 1CPUA 2OZ0A 4Y96A 5I3IA 3ES7A 3LEPA 4HN4A 2FMNA 3UR5A 4TUFA 1U83A 3M0ZA 1EL3A 5M17A 3TA9A 5HNRA 4GGHA 5HULA 3NNTA 1EC8A 3GTHA 3R12A 4MWAB 1FCUA 5LYRA 1S39A 4ROQA 2BSLA 2Q3OA 3IUIA 5AECA 3INPA 4MMWA 3VCRA 4F0RA 2VELA 2OWXA 5AHLA 3LPGA 1FHDA 3E02A 3TTQA 1QAPA 5A6MA 1TYGA 3S2MA 3E9AA 4H8UA 3E5BA 1XP3A 1OIMA 2YCIX 4OUIA 1FP8A 4B5TA 1DWIM 1DOSA 1X7IA 2XIOA 3EZ4A 4DO7A 3DG3A 3OO2A 3UJ2A 3G77A 4HNVA 1NDWA 2VEFA 2YW3A 4KCVA 4RW3A 1ISYA 1MO0A 3M7SA 4JTTA 1YW1A 4NXSA 1TPVA 3TC7A 2V3DA 4NRRA 4NP7A 2GLKA 2XM1A 4MZ1A 3ZYZA 1J01A 2X1SA 3AZTA 4FK9A 3BMWA 4PUKA 1JCNA 3Q65A 1O5KA 3N17A 1S2CA 1KM6A 2EPOA 5GNZA 1DWAM 1JCJA 1E4IA 5A2CA 4WVXA 4LBSA 3WDPP 2PP3A 4X61A 4AG0A 4BF9A 2DW7A 1WKDA 4HMEA 3MKCA 1Q3NA 4OWGA 5IHRA 2YL6A 1P1MA 2Y6ZA 1W2PA 3WFLA 2YW4A 3S5OA 2Y88A 1OG6A 1D3CA 1XBZA 1SMAA 4AD0A 3H8AA 2GGHA 2P8CA 2PZ0A 3CASA 1OFOA 3G6MA 4AF0B 2ZE0A 4AX7A 4IM4A 3CUFA 4X0NA 1CWYA 2FTWA 3UJFA 4CD7A 4MIMA 3EWBX 3DFPA 2Z26A 3D0CA 3WQCA 4CU7A 1YIXA 5LXEA 2DVXA 2VVSA 5DX7A 3IGHX 3SBFA 1XICA 2CLPA 1GZGA 2RUSA 4JDBA 3ZO9A 1MRAA 5BXTA 3VCCA 3MZ2A 5DN1A 1CGYA 2BLEA 3SADA 3VDBA 4A22A 1TA3B 1UBSA 2YDRA 2WVVB 1M03A 3NIYA 1X39A 1WQ5A 1W9DM 4J5NA 4FB7A 1ZB5A 1TPB1 3TYDA 3HQ1A 2YGYA 4B4HA 4WDTA 4PA8A 4AH7A 1XLFA 3G5EA 2PDMA 2WXDM 3A5FA 4LYKA 4J3VA 5LA1A 4NJHA 1QPOA 1YNPA 3EPNA 3UWUA 1MEWA 3OP2A 2D2HA 1VFOA 4W7VA 1S1RA 1JD9A 1OT2A 5EYWA 2DV0A 4XD3A 2POZA 3W01A 3GNXA 1I1WA 2J6XA 5B7YA 3CK5A 1BKHA 2Q01A 2ISVA 4MZYA 4Y8FA 1LCOA 3GG8A 3ARSA 4FF5A 2ZXDA 1K3UA 1E40A 2ANUA 3SRDA 3MMDA 1PIGA 2YR1A 1A5CA 3QY7A 2OWWA 3JS3A 1V6VA 1V6TA 1WAUA 1V3MA 3V5OA 1FY6A 4JTQA 4XUGA 1QOXA 2ZRYA 2WHKA 4RL3A 3KVKA 1YBQB 1KFEA 4UTUA 1VB9A 2CZFA 2GPTA 4G1KA 1TPEA 2OO6A 4J3UA 3R8HA 5EBUA 4EE9A 3VKDA 3WJYA 4LW7A 1EQCA 4ZQPA 4MDOA 5KZ6A 1Z41A 5CLWA 3CB8A 1PCKA 1RA0A 3EOEA 2W3ZA 3TXVA 1H0IA 1LBFA 4HHMA 3W74A 1Q66A 3ABOA 1GTHA 4KESA 4IXXA 2JKPA 3C0LA 1GKRA 1FWJC 1FFRA 1KNWA 3TH6A 3LHTA 1PAMA 3LPFA 5GNYA 3ALGA 1YMYA 1ZS2A 2I5QA 4A6GA 1EP3A 4A21A 5I3KA 1VP5A 4B5WA 4W5ZA 5RUBA 2JE8A 1GCYA 3UNDA 1SR9A 3WLHA 3OQ8A 3D5HA 4O12A 4OJYA 1EEXA 2VCAA 1CYGA 3UXLA 3D47A 4CQAA 3N15A 1KBJA 2I9EA 3W1NA 1WCGA 4HYVA 4BJHA 3ZS4A 2YIHA 1J0KA 4DHGA 2P0OA 4O10A 1MRQA 3VMPA 3RU8X 3DYPA 4NIRA 1PX4A 1BD0A 3WN6A 1RLDA 5FEWA 1F8IA 2HXTA 2GVJA 3L4UA 3BXWA 4JY8A 5IBXA 4F0HA 3COTA 1RJRA 1TQXA 4NQ1A 1XS2A 3PF3A 4YWIA 1R86A 3T8LA 3NSXA 5D9OA 1JNDA 3P8IA 1W3IA 3A22A 3LBMA 1FXPA 3TW9A 1MXGA 4DPQA 2Y1HA 4I9TA 2V2DA 4R9XA 4PBEA 2OCZA 2XG9A 1NIUA 4W7WA 2EJ1A 1UC5A 4IIEA 4G56A 4C6FA 4RV3A 1UP3A 3L2IA 2DSZA 2VUNA 3W84A 1F5ZA 1QTWA 1V4YA 4D6JA 1J5TA 1O95A 1E55A 4EIVA 3I3BA 4LUTA 3W28A 1W1PA 2QIIA 3APYA 4AMCA 1QXLA 2H6RA 1GZ1A 4CD6A 4G8TA 3KAOA 2ZA1A 1Z9AA 4A3QA 3WK3A 2P50A 1KWKA 2TMDA 5BZAA 2VURA 4C90A 1M5WA 1HUVA 1VLWA 1FWGC 1ZJIA 4DXVA 2HNEA 5AOUA 1JDCA 1CX9A 4ZEPA 1FWRA 3CAQA 1V7YA 4XISA 4V2XA 1SJAA 1BXCA 1MW3A 4ZQCA 2YA1A 5HDRA 2OB3A 4Q22A 4GX8A 2XUCA 4IMAA 3SCWA 1BPLB 3OGSA 1E9LA 4W89A 4A3HA 3PWAA 1XGDA 2BZNA 2PLJA 3ARTA 1ZPTA 4DUWA 3MYOA 5HR7A 4QIUA 4O11A 3FOKA 1ONWA 1Q4NX 1OSEA 4W88A 4HD5A 2ZTJA 4KGLA 3MI2A 1KA9F 5C2XA 4MJZA 2V3GA 3LRKA 2GDUA 5K2ZA 3I7RA 4OGZA 2Y5JA 2WC3A 4R7JA 1CGTA 1MI3A 4Q8QA 3A21A 1O5QA 5HUOA 1J0IA 4AD3A 1QW8A 4L80A 3NPXA 3ATZA 3RGTA 1FWHC 1P43A 4KEVA 4E3VA 3NUKA 1MW2A 2XYLA 1KM3A 3AXHA 1NY1A 4XWUA 3WD3A 2Z1VA 3T81A 1U1UA 1P0KA 1AUSL 2F7FA 3BCFA 1WPCA 2NVAA 2VKZG 3NQFA 4EWJA 1Q6FA 4JQ4A 4BY3A 3UU0A 1DE6A 3UPWA 2VGGA 5BXSA 3G1RA 2E9LA 2GQAA 3GHUA 3PFMA 5D9NA 3LCGA 2VC9A 1GUVA 1IT0A 3G0SA 3WELA 4G7EA 4J3ZA 2ZUSA 3KVMA 1H51A 3GDMA 1G6CA 3GX9A 1VR6A 4XBSA 1HNYA 3A3HA 5E70A 3KCJA 1AFSA 1P1XA 3P61A 1LRQA 2A2IA 2QLYA 5ABFB 4X9YA 3HPSA 2QJIA 3DFYA 4P8WA 3HF3A 1VAHA 4JCLA 2ESCA 3W1PA 4H6QA 4GQRA 2WZMA 1PVNA 3TN4A 4MG4A 5D4YA 3IRSA 1GEHA 3PZVA 5D2YA 4R27A 1RP9A 3QKEA 4IIHA 1AJ2A 4HNLA 3UESA 3QR1A 5A6AA 3E3HA 3O63A 3IIVA 2HXUA 5I5RA 3F4VA 2VGIA 3FN9A 3AO0A 2EPLX 3B9DA 2RDXA 5C9UA 2O9RA 1FDYA 4J2PA 3RLVA 1ODZA 1E0UA 8RUCA 2A3HA 2RAGA 2W92A 4QEHA 5F1UA 4PUJA 3TOPA 1OC6A 1QNSA 2WQDA 1QO5A 2XIMA 3PWIA 1SFJA 2C7FA 2J9YA 2ZUVA 3UQNA 3CEPA 4A2RA 4B4FA 1UH3A 2BWGA 1L6YA 2C14A 1EEPA 3L23A 3CC1A 1XI3A 1EGZA 4EAYA 1HGYA 4RPPA 2WANA 3AMCA 5TF0A 4JTHA 3DC8A 3TTSA 1IEXA 2F38A 3T07A 3K1GA 5D32A 5FJRA 3GD6A 3AU2A 1L6FA 3KW3A 3BJSA 2WZEA 4JHOA 5AYBA 3BMXA 2P88A 1U2YA 3IJ9A 1E56A 3OA3A 4FSAA 1SO6A 5HATA 1MNZA 4NZ1A 4N42A 1K03A 3UERA 1PO9A 1V51A 1XIJA 4OIFA 4FX7A 4XAPA 1QPNA 4KCWA 1X97A 4GHRA 4HNOA 4AD1A 1XYLA 1KRMA 1VKFA 2Y61A 4QCEA 2WC7A 4DZHA 5I09A 2AQOA 3S5SA 3TJIA 2DZXA 4B5XA 2E5BA 3VKCA 1W5NA 4NZJA 2WCGA 4PUWA 1IXPA 3EYPA 3STGA 2ZRVA 3PBMA 4UOJA 1NSJA 3H4XA 2PLKA 2J8TA 4HB7A 4S2BA 2PDBA 3R8GA 2LLEA 3HN3A 4JICA 1BF2A 5EFFA 5I2UA 3NOEA 5HWMA 3KDNA 2NT1A 4JAWA 4CD5A 3N9KA 2BHYA 2OWCA 1KRAC 1SO3A 1LYXA 2J7GA 1JI2A 4H2CA 3SUTA 5AVNA 4S38A 4PTWA 3KZPA 3OG2A 3SRKA 2C71A 4O0QA 2J4GA 1Q6LA 3A9BA 1Q6RA 1TRIA 1G1YA 4TR9A 4UFKA 4O1EA 3CL8A 4NAFB 1TO3A 2WZIA 2YLAA 5LNVA 5J8LA 3SUUA 4PODA 4MPKA 3ENLA 3RFAA 3BV7A 3GS6A 4ADSA 1BQGA 5E0KA 3DECA 3NPUA 1H41A 3ZJKA 1YNYA 3Q94A 4I3GA 4S3FA 3WF3A 5JBEA 5C7VA 2WMJA 4WHBA 3W25A 1VBGA 2F2KA 2RH9A 4IIBA 1WUEA 3U5UA 4EOUA 2YBUA 2OELA 4IF2A 2WZHA 1EF2A 5D8ZA 3NDYA 2VGFA 4MZ8A 1UOZA 1C8QA 1HJUA 3T7VA 3CZGA 4JR5A 1UKSA 1EH9A 1HO4A 3W26A 2J9XA 2DIKA 3WMLA 4B91A 2VC5A 3RM8A 2XHYA 3EEGA 3MSDA 1K8XA 4QTGA 2FZDA 1C91A 3E1F1 1BTCA 4QCFA 4H41A 3GZ3A 3VM7A 1B3WA 3R2GA 3SN0A 3AIQA 1LUCA 3EXRA 4H8NA 4UB9A 3KE0A 1OFAA 3WD1A 3BG5A 4GCXA 3VFCA 2I16A 3H53A 3RJYA 3N2BA 5IDZA 4IMCA 1Q5MA 2D3LA 5AYZA 4DUVA 3K4AA 4H9YA 2G8ZA 3M46A 1WYIA 1YPFA 1WX0A 4QNWA 1JZ4A 5ABGA 2WHMA 2H90A 3ABRA 4X60A 3A4XA 2QUUA 1U5VA 2FZNA 2V38A 1VFSA 1TZ9A 3MDWA 3RILA 2BTMA 3SY5A 3Q45A 1KFCA 2OG9A 3OIXA 1ADSA 1A53A 3O05A 1US2A 2WKGA 2IPJA 3AHTA 1Z42A 3DG7A 1MDLA 3N13A 3RLHA 3PTDA 1UWUA 1L6GA 1JJKA 1CBGA 1Z89A 2D2GA 2WMHA 1IR2A 1UD6A 4B92A 1ZJAA 3E2SA 4F0SA 3IJ8A 2X1UA 1B4KA 3G8EA 4RDWA 1VCGA 3S46A 1FHLA 4REQA 2DU2A 2F2HA 3UETA 2R1LA 1W54A 5DANA 3PZMA 2NQLA 2NXIA 3GIPA 5IBXC 4I6KA 3RK8A 1J5SA 4QP0A 4JTIA 4WDWA 5JH1A 4J35A 4NUWA 4Z1CA 1P6WA 2VO5A 2Z2UA 1KV5A 4FLRA 3T42A 1H5YA 1TE6A 3Q58A 1JL8A 1R87A 2VENA 3H2CA 4A8RA 5DMNA 4IPLA 5XIMA 4PMZA 2YDSA 5BMXA 3CIXA 2AAAA 2RGMA 4HK5A 1GK8A 3GKFA 3A9IA 3H2AA 1YXDA 3THQA 4H6EA 3N14A 4CVWA 2FIQA 1IGWA 3C2VA 1CGVA 3BW4A 4NZ4A 3CIVA 4ZBCA 3H6OA 2YCJA 3MSRA 3WF2A 4LY4A 1Y0EA 1VD6A 5HQMA 3NSNA 1MYRA 3G3DA 3N2TA 4O15A 3L65A 2DT0A 4H19A 4RDYA 1R3RA 3VNDA 1HKKA 3SRFA 3VMNA 3F4DA 4HJWA 1ZTVA 2V30A 2MANA 4LRTA 2HRWA 1YLVA 2XZ9A 1CLVA 1GOKA 4B3ZA 3EWCA 3FAXA 1DWFM 3B8SA 3O6AA 1E6ZA 3II1A 2BHUA 5DBUA 2PFHA 3GVGA 1PSCA 3W7RA 2BHZA 4Q8VA 1IEVA 1NFBA 1GOQA 1WKFA 2PRHA 2G4JA 2PDGA 1JR1A 4HNNA 3FDKA 3O16A 3RLGA 3WD0A 3R11A 4US5A 1KR0A 1Q8AA 4S1FA 4XZMX 9RUBA 3W2KA 1JPDX 4PGLA 1YRRA 4RE2A 4QJ3B 3ITXA 3BW3A 1ISVA 1WP6A 2G50A 2X2GA 2O7SA 2D24A 1XUUA 2IUZA 1UB3A 2G3MA 2YLLA 4XZLX 3CLWA 1R3VA 3VX1A 2E4TA 4NKCA 4EXQA 2DIEA 4MB4A 4O13A 4Q4SA 2ACUA 4HPHA 4ZO8A 2OVLA 3ZIZA 3EDEA 2XFYA 1RSCA 3SY8A 4Q6XA 3FY1A 4GJIA 2W6RA 2E1WA 1GJUA 3PZQA 3SDOA 2X2YA 4PN2A 4FNUA 4O1FA 2ZX6A 1UKOA 2FGLA 4PRWA 4TMBA 4GG9A 3I65A 4IWWA 5BCAA 1YPIA 4MB3A 1DHPA 3BH4A 4XBKA 2V5KA 3S83A 3P93A 3HZ3A 4QLLA 4Y9PA 1EX1A 2EO7A 5JQ9A 3S4TA 3USZA 4N9CA 5GJNA 4H8HA 5D8WA 5G1TA 1PTDA 5HJYA 2HPMA 3U2EA 2HV5A 4Y9AA 5LNSA 3THAA 3C2YA 1K9EA 1SJCA 2VFDA 3N12A 1G67A 3AYSA 1JPHA 3UD6A 3IJ6A 5A1AA 1HGWA 2W0UA 5LZLA 4IGSA 5FEXA 1XLEA 3GFZA 4I90A 4AD2A 4GBUA 5FD0A 2CLEA 3N2XA 2UY2A 4XAYA 4A8NA 1FFQA 1MSSA 3WNNA 1GVSA 3LHZA 3ZLFA 2GJNA 4I9JA 3GXMA 1U5JA 4ADTA 4IJCA 4HCLA 2QEZA 3IJQA 5FJIA 5IFPA 4JDYA 1D7FA 2VXNA 1QPKA 1DJGA 4J2MA 2A3EA 4PUDA 3ARYA 4IMEA 2SFPA 3JR2A 3UPBA 3ZQ9A 1E51A 1LL4A 3U3HA 2PDCA 3VKJA 4B5SA 1HJSA 1IIHA 1DJHA 4E4PA 4O17A 4IG2A 1K8ZA 2XINA 4NX5A 2NV9A 3IARA 3SCVA 4LF1A 1ITQA 5CXPA 4QRNA 1A5MC 2QR6A 2XU2A 4QDPA 1B5TA 1UKTA 3PJTA 5AZ0A 1XUZA 3L9CA 2C18A 1P5BA 3WO8A 3VKKA 4LBRA 1CCWB 1TMQA 4RR4A 1M7PA 4YCPA 3LSCA 2QXWA 4GFIA 3PTKA 2J27A 4O52A 3P5YA 3MB9A 5BMWA 4AHQA 1MW0A 1HIZA 1SW7A 1W3JA 3BQ5A 1V6XA 3KZSA 3CH9A 1UIPA 5CBJA 2GGGA 1EHAA 2I1OA 3JRKA 3REQA 3VIIA 4RE0A 1N8FA 3WJSA 2B7QA 2ISFA 1E1CA 4JTSA 2VFGA 1B90A 1VRDA 1JZ5A 1YE6A 2ZKMX 3GYEA 4DNHA 1OT1A 2JF7A 3HO8A 1BRLB 3USBA 4UZUA 1KFWA 1AW2A 3V0SA 2PDWA 3LBCA 4XAFA 3TOYA 4NG3A 4IQEA 3KXQA 1FCQA 3OVGA 4S23A 1KXQA 2Y24A 1M1BA 4LALA 2R82A 1DJXA 1E9ZB 1HL9A 2Q09A 1BVNP 1PYFA 4NJGA 5F4WA 5AYIA 1JZ2A 3RAOA 2PDLA 3HQPA 3G18A 3MVTA 3TW6A 2XFFA 4OUEA 2W4XA 3DHUA 1VYPX 4A3YA 4DJDD 3CV7A 3IVUA 1FRBA 5KSWA 3E6EA 4BI5A 3RO6A 1EGMA 2E77A 3W38A 3NFUA 3ABXA 3ARRA 3C3NA 3P80A 1GG0A 4WDUA 5LIWX 4EACA 3SURA 5DCDA 3SUSA 3TK7A 3T2OA 1BSIA 1MFUA 1W3LA 3IS4A 2HDJA 2VX4A 2QCNA 1SMDA 3CUZA 1UJQA 3T8QA 4BQ5A 1V08A 1V0NA 4C6NA 4V1YA 4DB7A 3H55A 2VHLA 1OIFA 3M9YA 1ADDA 3UZXA 3S1WA 4H4IA 1TIMA 2PCQA 4UTJA 3JZUA 4QG6A 4AZGA 4NILA 4CCEA 1XD0A 3GK0A 4I7UA 3VVGA 1H63A 5D2WA 4O1DA 3BVJA 4MF4A 2W66A 1P7TA 4LY8A 2VC6A 2W61A 2DW6A 1D8WA 3WDIA 4I5RA 2IXVA 4GUGA 4Y2WA 3GNNA 3C4UA 5E6ZA 5DELA 3OQEA 4KERA 1HL2A 2XH0A 1IHIA 1Q7QA 4M19A 3BURA 5F2LA 1OEPA 1KFKA 1NP2A 2IQTA 4IOTA 1ALDA 1E6NA 4HVXA 2XFRA 2A7NA 2QHAA 3A6OA 3IK2A 3AC0A 2QIWA 1O1HA 3W37A 2XSXA 2Z1XA 4KMQA 3MSGA 5H2ZA 1NP0A 3YPIA 1RPXA 4ACZA 2F9RA 2EJAA 3W6LA 2WPGA 2ZWYA 4CCZA 1IZCA 4HP5A 1ZU8A 2TPSA 2V63A 1DJIA 3IVSA 4B15A 2GGEA 1OCBA 2OOGA 4D2JA 1XG3A 9XIMA 5I24A 4D6HA 1EKOA 2Z1WA 1EJTC 4OV4A 4P7OA 1PUDA 1UR8A 5LGXA 1PZ3A 2YXXA 4GVFA 1ADOA 4UFJA 3T40A 1AL7A 4ZZ9A 4QM1A 2V81A 3NZQA 2V8ZA 4YYFA 5EL1A 2WNZA 3TIMA 1H50A 3C8NA 5JBDA 1DWGM 4XO7A 2F61A 1WNOA 2XIBA 3AS3A 1ITUA 2D0HA 4Q8MA 1ODUA 7CGTA 4JTAA 4C1LA 2GL5A 1VCVA 2OX4A 2CWXA 4LUJA 3SQMA 4AY7A 4D1JA 1RP8A 5I7GA 5BXRA 1EPXA 2YL8A 4NT0A 1BXBA 4H9VA 1GVOA 2TYSA 3WBYA 3UY8A 4HHHA 3ANYA 3MWCA 3M0VA 4WXZA 5DCEA 2OQHA 1I75A 3O07A 3G2GA 3M47A 1D8CA 3M41A 4NZ5A 3SN1A 5JXQA 3WBAA 2D0GA 2J7HA 4O14A 3W1XA 3CZKA 1QCWA 5DEZA 4AZIA 2R6OA 5CPSA 1HP4A 4UCFA 4AW7A 5C70A 3SB0A 1FWAC 1UWRA 3NL3A 3MY9A 4H00A 3WQOA 3TFXA 3I7QA 2JEQA 5LHEA 2ZE3A 4JEJA 1K70A 3I4KA 1XH1A 4L4PA 4PMYA 1QUMA 4EAMA 4TXEA 4LB4A 3BUVA 4NAEA 5CJ5A 1AJ0A 2A3AA 1CXEA 4UTWA 3UXKA 2GFTA 1XIGA 2WNNA 3OGVA 1OFRA 3O8AA 1A5OC 3A47A 1XIEA 3CUGA 4FXRA 1M3UA 3QC0A 1NVMA 1XYBA 4B2DA 4M82A 1PZ0A 1Q6OA 2CBJA 1XLMA 1M53A 3V36A 3C5QA 2ZZ2A 1PIIA 3F1QA 3GDRA 3OZYA 4QE5A 2J75A 3L4VA 5AHMA 3UYCA 3LERA 2ZTKA 2NX3A 1UA3A 3W6YA 4GNVA 5CSRA 2C13A 1GQIA 2GK1B 1EO5A 1BSLA 4NX0A 2PWFA 3CPUA 4FAMA 4IXHA 1O4UA 1AODA 4P7LA 3C2EA 1JCTA 2QCDA 3GR4A 4D8AA 2BVDA 1RQHA 2ZCGA 3GBEA 4GQGA 4HOWA 5D2VA 1G5AA 3AXMA 3K8LA 3MP4A 2BMBA 2Q8LA 2H3DA 3B0PA 1KWGA 3VGEA 3WJZA 2PODA 2GQ8A 2RDTA 2W63A 2J7CA 4JKLA 4XX6A 2OLSA 1QW7A 2A4AA 7PTDA 2Y8VA 1HL8A 3W7DA 4RDVA 3CZJA 3BAIA 3N11A 4NZ3A 3N1AA 2CERA 5PTDA 2CHRA 3F03K 3GNOA 4FOJA 3T2QA 4IUOA 3W85A 2E40A 1EYWA 3W02A 4DRSA 2OMAA 1AD4A 3F5JA 1OYBA 4OBSA 4U3CA 1QI5A 1EJWC 1UBPC 5HQEA 3VOJA 3I7SA 3THCA 4Z1YA 1AQFA 2CU0A 7TAAA 1XLLA 4Q7IA 1NOFA 4YLWA 3AUJA 1WZMA 3RMJA 2CPUA 3LPOA 4RK8A 2J62A 4URIA 4ORIA 3VYLA 4XZIA 5HPOA 1QOPA 4EK7A 3ARPA 3CO8A 3BV4A 2ZXQA 3QY6A 1TPC1 3W71A 8TIMA 1V3HA 2PURA 3GB6A 4RV8A 4LUYA 3MP3A 2FLIA 3GC4A 1JYXA 4UUIA 3BAWA 1IQ8A 3APGA 2Z2AA 3LV6A 3GZAA 4L4OA 3B0YA 4C1NB 3LLXA 2C8NA 4YVXA 5DRCA 4GIRA 2PP0A 1XQKA 3GIYA 1H11A 3K30A 4ZQRA 1A49A 2R14A 2J47A 3QY8A 4HPJA 3LLDA 3ONCA 1JXJA 1DXIA 1XF0A 4PMUA 2ZRZA 3VO0A 3OZPA 2HS6A 2X7VA 1A47A 3BSGA 1EWEA 5H8UA 1RY8A 4FP1A 3RLUA 3QR3A 1R9XA 2PA6A 2NWSA 3BCJA 1L2QA 4DBSA 1FWNA 2NT0A 2A3LA 4R7OA 1JULA 2V2CA 4IQLA 4HT3A 3GDBA 1DQXA 3UGVA 1C3FA 2R8WA 4GI9A 4YTTA 4JOMA 2IPFA 2XPKA 7REQA 3SCPA 1V0KA 1TV5A 1S38A 3GTXA 4AZ5A 1TVPA 3NZRA 3E74A 1E3ZA 4IIGA 4UR9A 3XINA 1EXPA 1JYNA 3CWOX 4LPCA 2RHGA 3C2RA 2NVCA 1LORA 2DORA 5LSMA 5CPNA 2XVNA 4CNPA 2WSRA 4NASA 1S2TA 3ABQA 1MMFA 4I9AA 4AZHA 3NR0A 3ZR5A 1WA3A 4CLMA 1CXLA 4TVDA 4PB5A 4ZTYA 1RA5A 5LA2A 3VA8A 1VF8A 1R3TA 4O1CA 4J28A 2H8XA 5L9FA 3T4WA 2V5LA 2ATMA 3MMWA 1W3TA 3ARZA 3HGSA 3V0UA 4WX2A 5BOOA 2WPBA 3APTA 1HKVA 1JCLA 1JZ8A 4DJDC 4IFKB 2XH2A 2XTKA 4L1XA 3V75A 3PVFA 4FLQA 1Q13A 4F0MA 3B4UA 1FBAA 3MW7A 4YJ5A 3AU6A 1K4HA 2X7WA 4XZWA 3R0UA 3H23A 3A3XA 1CGWA 2C3ZA 2A85A 1V03A 3DEQA 3EX6A 2REQB 1EA0A 3WBXA 3JUGA 3ITTA 1XIBA 2PBGA 3SGZA 1H1YA 2QYGA 4C6DA 1AQHA 4BF5A 1F2JA 1PL9A 3MYPA 1FHVA 2OQYA 3LB0A 3W82A 3BLEA 2J79A 3FYOA 2NV2A 5E5CA 4KWWA 4GZ7A 1C9WA 1VFLA 4HGXA 4L5ZA 1NARA 2DSWA 1G4SA 1E6RA 3W1UA 1GYNA 1M7OA 2DPEA 1XLDA 3EB4A 4ZFCA 1VLIA 1J2BA 1W31A 2FVLA 2X16A 2GVLA 2H3BA 2CXGA 3A3WA 1RBOB 1ICPA 1ZJHA 5GPRA 2NXHA 4GVHA 1YDVA 5HMFA 2FVKA 3A13A 1E6QM 2YCEA 3AIWA 3GWQA 2H9AA 3TVAA 3LCLA 1SVDA 4MJ4A 4IGNA 4XZHA 3TMQA 3TAKA 3TFCA 3ZZ1A 1DKWA 4HCHA 3ZWSA 3V5CA 1AVAA 3DH7A 1ZAJA 4MWAA 4H01A 4ZENA 3PSVA 3S6DA 4ZTXA 3DFTA 3BICA 2CLFA 2A21A 3TYUA 4JTKA 1QU4A 1TE1A 1HXJA 2V9DA 4IGHA 1PYMA 1KO0A 4JFUA 3UGRA 4JQ2A 1DORA 3W3OA 3W7MA 1VIZA 4DBEA 4KBXA 3SAZA 1BYAA 3BL3A 3TYEA 3SM0A 4XO6A 4DQWA 4AIBA 1PHWA 2JALA 3VGDA 3KRZA 1DHKA 3WLNA 2CWNA 3TR9A 1UMLA 2VYOA 1FWFC 2WNQA 3A23A 5MHBA 1IZKA 4QNEA 4H3DA 3WIJA 4L7ZA 1L9WA 3W7CA 5LGZA 3NM3A 1RBAA 1LTDA 2FVMA 1XRFA 1UG6A 2G37A 5T8GA 1W3NA 4MGGA 3P2VA 4PTMA 4UMBA 1Y8BA 2XJ7A 3C2OA 1P0BA 3FJLA 4G9PA 1Q6QA 2E6YA 1JPIA 2Z0IA 2Z2BA 3ABZA 3TKFA 4AHPA 1CXKA 3AHYA 3PHAA 1W1YA 4GRSA 5BW6A 1XR2A 4JTDA 4BA0A 3FIGA 3QW4B 4NY2A 5FSEC 1W1B1 2VFHA 1G9HA 3KBWA 4PBGA 4AVOA 5M1TA 1SUXA 2QUVA 1E4LA 1G94A 1M9HA 3LXCA 1TPDA 3BSHA 3N2MA 4PMVA 2F6XA 3H2FA 4UFHA 1DXEA 5REQB 4DVOA 4CN6A 2PU0A 3W7HA 3WLLA 4Q4KA 4QHRA 3BLOA 2ZZ3A 2YFOA 4UTWC 1VJSA 1IEQA 3NPVA 2P3ZA 4U33A 3CHFA 1NELA 4Q4OA 4GUIA 4GH1A 3J7HA 2HBVA 4AF0A 4G1NA 4P2VA 3PBVA 3SFKA 4N4PA 3QPYA 1GYMA 5C2CA 1UZHA 2OJPA 1FH8A 4PBFA 2CBUA 3LOTA 2VZOA 3LTPA 4F0KA 4MY1A 5JVLA 1V0LA 2WK2A 4NYYA 1E70M 1ISWA 2WMGA 4AXKA 4PEKA 1IIGA 2PWUA 4GJ1A 1E6XM 3B8IA 3NGJA 1TA3A 3WUGA 3QOKA 1OD8A 1GVFA 3T78A 5JUVA 3IJ7A 4ZMGA 4WY0F 3L21A 3GXNA 2WSQA 1F4AA 3ABSA 3V0TA 1W5PA 1ONXA 1C29A 1XLAA 1ONRA 2HS8A 2E5DA 1UOKA 5A8NA 4L6HA 1MUWA 2AAMA 1TJ0A 4DX3A 1OGGA 4MKSA 4UFLA 4X9SA 3WLSA 1QBBA 1EX5A 1ZNNA 3TCEA 1EJRC 3S9YA 1CLKA 4PCSA 1C92A 4JD4A 2R91A 1K7FA 3OZMA 3WF4A 1X6LA 3NM1A 4AZ6A 1IT7A 5HWNA 9CGTA 3GTNA 4XAGA 1M68A 5CEWA 1OK4A 2VD9A 4PCFA 1HJWA 3GDLA 4TIMA 4XQ6A 1A80A 3NQEA 4DWDA 2VFIA 1H7OA 4HU3A 3W86A 2BX7A 4ZO9A 2CLOA 3W75A 4LCSA 5FJPA 4GXMA 4AWUA 4LWWA 4W4QA 2ZXAA 1Q65A 3F7JA 1PWMA 1EC7A 2FZMA 4EWND 1GGOA 3L66A 1JZ7A 5HUPA 2JGQA 3KHJA 4CD4A 5KZMA 3HG2A 1NDVA 3B4YA 2FB2A 4AZCB 1KV8A 2CLHA 2X30A 2QKFA 2G95A 3EEZA 1SU5A 5E9XA 2R1MA 3HJZA 3WQ6A 4C6KA 1AJZA 1UYQA 1UUOA 5A69A 3PBUA 2WMKA 1J0HA 4DAIA 2GWGA 3LBOA 1SFLA 1H5VA 1F6KA 3NQ6A 4QDMA 1W5QA 2CESA 3NG3A 4PUMA 3GU1A 3CQJA 2I5GA 3OLIA 3S47A 4GQ0A 1U1HA 1OFBA 4PMNA 4DWSA 3EX1A 3PPFA 4HMNA 3OLGA 4LAZA 1MQRA 2HK1A 3R7MA 3VABA 1T8XA 2AQWA 4LYPA 4NHVA 4GX9A 1NH6A 3MWAA 2QNEA 3QJAA 5FOOA 3LDVA 1YDYA 4JIRA 5AYYA 2P0IA 1E4NA 1PX8A 4LUTB 2TODA 1SPQA 3VZXA 3A4JA 1L2UA 4V33A 3IAQA 3FA3A 3OVPA 3TTOA 3TONA 3BG3A 1S5WA 3W81A 1NDYA 4KCUA 3UG8A 1JDAA 4AIUA 3AIEA 4DN1A 3NEVA 2C16A 5J5DA 3OW1A 5BXPA 5I3JA 1S3HA 2GJXB 5K9XA 2QPXA 1F9CA 3C86A 3WDQA 5BRPA 1JQVA 1TSIA 4US6A 3TNBA 4DUOA 5DT7A 4L6OA 1JRCA 2WVUA 5CPOA 1W9XA 1KTBA 2A3BA 3BLDA 1NOUA 1Z69A 2PDJA 3K46A 3GNDA 5EKYA 4D1IA 1R3YA 2G96A 1FWCC 1FOBA 1ZGDA 3D3AA 3PG9A 4PYSA 3MUIA 3GAKA 4IIFA 2EPHA 4XSLA 3ITCA 3QFWA 4F2UA 4WQ6A 4W93A 3VDGA 2Z6JA 3UR8A 1EB3A 4I7VA 5CPMA 2JK2A 2NQJA 1DJYA 2BXVA 4ONVA 3RDKA 3IV3A 3L4WA 3MKVA 3CO4A 5FF2A 2RKXA 1KCLA 1YPXA 5C2GA 1FWDC 6A3HA 4S39A 1F61A 1HVQA 1PEZA 4FXJA 3IJIA 3W4RA 3MS8A 1E5JA 4DZAA 4TMCA 3BSMA 1GQKA 3VGFA 2HE8A 3GKAA 4XD4A 3CZEA 1KD0A 2DQXA 3Q37A 2GVYA 2OFJA 3G1DA 5A94A 2YB4A 4LNCA 2ZADA 1KBLA 1Q7ZA 3HTWA 3GIQA 3RJXA 4C60A 4HSNA 5KMYA 2ZX9A 2VZUA 1XSJA 4G7EB 4GC4A 3LRLA 1G4EA 1OX4A 5A6BD 1TX2A 2V5BA 4L56A 2D73A 4HA3A 1B0IA 3KLKA 3OVQA 3W0KA 2DJXA 3GH5A 4MY8A 1N8IA 1SO4A 4IGMA 4DLMA 3T9PA 1RZMA 3WEMA 3WEZA 4KIEA 1F74A 1WKEA 4AYSA 4A05A 3KTCA 3WG6A 3G1XA 5FL0A 1NF0A 4M56A 1C90A 1MEHA 2E5CA 2ALDA 5H8PA 2XN1A 2QUNA 2NLIA 1FHUA 1DJQA 3QLDA 1K7EA 2FPYA 4JX6A 4PMRA 2WCAA 1QBAA 3PSWA 1F05A 5A8PA 1JFXA 2XIIA 1AG1O 4FR6A 4ADUA 3FS2A 4D6FA 3KCOA 1AH0A 1OF8A 4LV4A 5BU6A 3M0LA 3RX3A 4PTXA 2C19A 3UVIA 4GISA 1IEIA 4MADA 5ABFA 3U9IA 1G4TA 4ZXOA 3UF9A 3W2MA 1VC4A 3ZVHB 4HU0A 1VEMA 5LIXX 2V68A 3CBWA 1A5LC 3IGUA 4BFAA 2YSWA 3U0HA 1NWTA 2A6LA 4NNAA 4RX0A 4Z0SA 2YDQA 3VGBA 1SZNA 1R2RA 1DP0A 2WC4A 1UP2A 4HCDA 4PSRA 4C6PA 3S1UA 1DWJM 3VAVA 3XISA 2VCBA 3TCSA 4U31A 4F2TA 1NF7A 3R13A 4M3PA 4Y9OA 3PTMA 3HFTA 1QT1A 5F1VA 3ZT7A 1FXQA 2DSVA 3RPMA 1NTHA 1UR3M 1B2YA 3I4EA 1TTJA 3C3UA 1W1A1 1ZBWA 1EZWA 3CJPA 1SGJA 1X38A 4S3KA 4IP7A 3LS9A 1KM1A 4OE7A 3TAOA 1TR9A 3BGAA 3WH9A 4N9DA 3EA1A 1VHNA 3SGGA 4GIAA 2BXYA 3KBNA 2XFWA 4U4MA 3KBVA 1G7UA 1KM0A 1HO1A 3UNTA 3B9EA 4DAFA 3QVQA 3KM8A 5H8MA 3DBPA 1V3IA 4AIEA 3VFLA 3L68A 4K7YA 4NZFA 3VPLA 2OKOA 2GQ3A 3LXBA 1M04A 3PUGA 3TTYA 1GVEA 4UXDA 4KKXA 3ITVA 4H8VA 1KTCA 1SW3A 2HMCA 4FLSA 4WXYA 4KW2A 4MDPA 3I3EA 3VE7A 4LOCA 4UMAA 2V5DA 1XDJA 3S2NA 3WMCA 1V79A 2Z1SA 3QSRA 5D2XA 4IP5A 1O5RA 4UTIA 3NDOA 2J78A 2VP8A 2XVGA 1A3XA 1S2WA 4Q8OA 4NXKA 5CPLA 3GXPA 5CQ1A 2PTXA 1R2SA 3TQPA 1X96A 3I10A 2OLHA 3MUY1 2VRJA 1H61A 3WQWA 1D7KA 1I2PA 5I07A 2E3ZA 1L8PA 2PEVA 1E0XA 4NAFA 2Y8KA 2OEJA 3R0KA 2FH6A 3A4AA 1LUCB 4XD5A 3WCZA 3TSMA 2QCHA 3VD5A 1ZZMA 2WHLA 4LC6A 1KW1A 2F6UA 4IZGA 4KRTA 5CZ0A 1SZFA 4UTLA 2W79A 5DXYA 2R1NA 3F2BA 2DSUA 4Q4PA 1I0DA 3NPWA 1K1DA 3KOYA 4R34A 1KKRA 2IKIA 4CUCA 3TYCA 4R7WA 1EC9A 5ABTA 3BWWA 3W76A 4K38A 4HN8A 2EKGA 5HNNA 4ZSTA 1H7XA 1V6UA 3NXFA 1LOQA 4DM2A 3E49A 3VOHA 3HGOA 1KGXA 5HNTA 3IEBA 1BYCA 4ECLA 2EBNA 3GR7A 3T55A 1VCFA 4IUGA 4HU4A 4ALDA 5C5YA 4UC5A 3QBUA 1QI3A 2QAPA 1SSDA 2DH3A 4HZ8A 2VEGA 2PDHA 1DJWA 3CTTA 5AHNA 1P4CA 1E1FA 4GC3A 1ZBCA 5F4XA 4W87A 3ANUA 4AZ7A 4Q8WA 1UWTA 1J11A 4NJJA 2BGSA 3WX7A 2Q71A 2HVNA 4WUIA 4XIMA 4JYEA 1GG1A 1KFBA 5A2BA 1TCMA 3ZWTA 1CXHA 3N3MA 3D3FA 1AZ1A 1UQZA 5A5WA 4EF8A 4H9MA 3OYZA 5I3DA 2DUAA 1O6IA 3MCNA 3M5XA 2DZSA 3KS5A 2H8ZA 3NGFA 4OZOA 3OBKA 5CBIA 2VR2A 3PZNA 3WQEA 3W7QA 3WLTA 3Q4DA 1EJVC 3CL7A 4U2ZA 2YA2A 2E6FA 2GGJA 4TX8A 2XVKA 2YYUA 2PMQA 4DWSC 1UMYA 7XIMA 3DXIA 3CUHA 4MKVA 2VZSA 2DZWA 2ZRXA 3B40A 1OYAA 1JDDA 3OZOA 4RJEA 4OU1A 4Y90A 1UKPA 1H4PA 3H24A 4M6UA 1PKLA 1C8VA 4GA8A 3ERPA 3W7LA 4PCNA 3SUVA 2B7PA 1DBTA 4H7VA 5M3WA 1QWKA 4IHCA 2WCSA 5I3GA 4KWVA 4J40A 4DEFA 3VD9A 3R94A 4AC7C 1OM0A 5I3FA 2QCCA 3L0GA 4C7FA 3SFWA 4J1OA 3QR0A 4Q7BA 2OEKA 1LDCA 1DEDA 4ICCX 1H7PA 1VJIA 3DERA 4O57A 1AK5A 1P0NA 4IPIA 2VTFA 1DL3A 3CHCA 3G1VA 2ZUMA 3FDGA 3AICA 3WH7A 3Q2DA 5D30A 1QHOA 1O60A 3L67A 1ENUA 2GQ9A 2YZ5A 3C56A 3IWPA 4R5EA 3S6TA 3NA8A 5D38A 1EBHA 2G3IA 2R94A 3EOSA 2PGEA 4D71A 2VC7A 3M0JA 5CLTA 3TLQA 1VFTA 3H7VA 3SSJA 1J93A 3IACA 4H6RA 4RLIA 4ZQOA 3LCXA 3N2OA 3I6TA 2B7NA 1W8GA 4B5UA 7ODCA 5C9WA 5FF0A 4MM1A 3AIBA 1V3KA 2PLCA 3OA5A 2Y62A 3FHAA 3MVIA 2EF9A 1NDZA 2A6NA 3H2EA 5F2IA 1F73A 3T0BA 3FXYA 3GUGA 4C6CA 5HWJA 4FIQA 1L8NA 4Q6JA 3QHMA 1V3LA 2FTYA 4LB3A 1DVJA 3TQVA 2J7FA 1X7FA 5CC5A 1OINA 1VFUA 1FWSA 3LK6A 3GQYA 2AQVA 2PSNA 3TSBA 1QATA 3RXZA 4M8UA 3IV8A 4GPNA 3AS1A 4N6FA 1CECA 4ZCWA 5EMMA 2Z1BA 4RPQA 2YZRA 4HQVA 4HKPA 4GY0A 1NM9A 2XM2A 4Z2LA 4LVDA 2GSHA 3S1VA 4J3XA 3T2PA 4L61A 3VOIA 1KM5A 4D6EA 1RK5A 4X2PA 1G01A 3TN5A 5GNXA 5BWFA 1UD8A 1ZAIA 4N9EA 1V6YA 3FFSA 2V69A 4LC8A 4NI3A 4QAIA 1S2AA 1A0EA 4DJFA 4IFRA 3R89A 2JKAA 1F3WA 4OVXA 1BG4A 1MW1A 3DBNA 4K8EA 3STFA 3M64A 2P10A 4UR8A 4QBXA 3FVDA 2XWDA 3W2LA 5G4WA 1MZHA 4LTSA 3WH6A 4QQUA 4BWLA 2RJGA 1H7WA 1R3SA 2BY3A 2HQAA 2OU4A 1GHSA 3LUTA 2BASA 4O53A 2C79A 3N6HA 2RJHA 5JIWA 2QCLA 3AXIA 3PBWA 1RCQA 4J27A 4QDWA 4KWSA 2NXGA 2WSPA 5BOFA 1XINA 1RXOB 4H7CA 1T0OA 2Z28A 3SJNA 3CV1A 3GC2A 1M7XA 4JY9A 4UTTC 3QXBA 6XIMA 1OADA 5G2HA 1ZALA 2X0HA 3HV9A 3GXFA 5A8QA 1U5HA 5K9DA 3TUUA 2AL2A 2CLIA 3DHFA 5D04C 4Q8TA 3HURA 3REQB 1GTEA 4GNKB 8CGTA 5HAOA 3NSMA 3BOLA 3WNMA 1E1CB 1XIFA 4ZODA 4W86A 3W7PA 4DF1A 4KFPA 1HQTA 1MQPA 2HZGA 2NWRA 3EOUA 3DI0A 3L7RA 4HPNA 3VMOA 1ZENA 3W70A 4LH8A 4H9UA 1HF6A 4UNKA 1JPKA 2NLYA 3MANA 1XGEA 1QI0A 5D05A 5FEZA 3GG1A 2X1RA 5JIPA 1UWAA 2NX1A 3EX3A 2FDMA 3WK2A 1BGGA 2I56A 4KH2A 5EY5A 3VUSA 4J9JA 4XIAA 1R3QA 2FH8A 2L5HA 2DFAA 3MP5A 4OHQA 4ZFMA 2XH4A 4FO4A 1WKYA 4WOZA 3GNPA 5AC5A 1AH4A 3LI1A 3PPCA 3TXZA 4JN6A 4L4LA 4D9PA 4H9TA 4C6QA 4Z0JA 2J7DA 4V15A 2VFFA 1BRLA 5EMKA 4DYEA 4GVIA 2OODA 1QFEA 3OLDA 2CZDA 2FYMA 3VD3A 3WUBA 3AHZA 4GYPA 2BBFA 1W6TA 2EPNA 1MNSA 3LRMA 2J6VA 3VGHA 4BQ2A 4MFDA 3KBJA 1DJNA 1PPIA 1E5NA 3R6IA 2ZIDA 3TJLA 1IEWA 3B9NA 4FALA 4YYCA 4PTVA 3L5AA 1HX0A 3L5LA 1SSGA 3AROA 1NOWA 3WNKA 1NQKA 4RZ4A 4DJEA 2VVNA 4XBJA 4YTSA 1TB3A 1NJJA 4UOZA 1P6CA 3LZ5A 3ID7A 1N2VA 1XQLA 2DVUA 3ARUA 1J8VA 5CPTA 4PCTA 3C8FA 3GVQA 1HP5A 3SECA 1YQ2A 4QG8A 4WY0B 3QPZA 3CB3A 1UWIA 1W1VA 3JZEA 2CZ5A 3PC0A 3QV6A 4G2DA 3F4WA 1DIKA 3TZFA 3NURA 4LEFA 4OTKA 1TTQA 2XSAA 4A35A 5LKYA 5BU9A 4QFUA 3P7YA 3GNRA 3TDFA 2WVTA 3QV9A 4C5YA 7A3HA 4MWAE 5E6YA 1W0MA 3VDHA 2Y7EA 4JZ5A 1FWTA 3NQAA 1MDRA 1QNVA 5DY2A 4GOAA 5H91A 1GQNA 3UJSA 1KQYA 2XN2A 1IZJA 4ERAA 4PULA 1XXXA 1U33A 3G1YA 3S0CA 3AI0A 2IPGA 3P5ZA 3MJMA 5EMJA 3HU7A 3ZLGA 5K4ZA 1JGMA 3VM5A 4A2SA 4TTGA 1PB0A 2ISWA 3VOFA 3LM7A 5CAKA 1OB0A 4Q4RA 2FZBA 3BJFA 3FNDA 4WF7A 4DY1A 2Q6ZA 3KFTA 2VZTA 3RCMA 4LBUA 3CHEA 3MBDA 1T96A 3B9AA 4H04A 4Z2KA 2WW5A 4Q33A 3SR7A 1OC7A 3PP7A 4UQBA 5A6JA 2WBKA 1S2UA 1I2QA 1UJPA 3QFEA 2KX9A 4JX5A 3E0VA 4M6QA 1ECQA 2DJLA 2PGFA 3EWXA 4ZOCA 2X42A 2JGYA 3RPDA 3S5YA 2FHFA 4LAMA 3UZYA 4YS1A 4O4VA 1YHTA 3QGAC 4XKYA 2ONEA 4GZIA 5EMYA 4FXSA 1XX1A 2QCFA 4GJJA 4K8HA 1M01A 3O6YX 1X98A 2Y85A 3EDJA 4WEVX 1XC6A 3QTPA 2PDUA 2PLMA 3JVAA 1XIIA 3HJEA 1MXDA 2VOMA 3POCA 3GUWA 4DUXA 3WNLA 4B5VA 4QROA 2QCEA 5CJMA 1EHNA 4OBRA 2A7PA 1RR2A 1THFD 1QNPA 5AKQA 1XCXA 4OQVA 4X3ZA 3BARA 4AEEA 1WO2A 3K5XA 2ZZ7A 3ZR6A 3PS7A 4LCRA 1M6JA 3L4ZA 4IX0A 2ZYFA 1FWBC 1RJPA 1YEYA 3CLMA 3DG6A 3OEXA 1QRQA 5F7UA 3MJYA 4L6DA 3FJ6A 4Z17A 2Z6IA 3QZEA 2RDUA 4B90A 1BF6A 3HB9A 4QJ1A 3DFOA 3MUCA 5HMEA 3UWQA 3QZAA 3M0MA 3HQNA 5D03A 3VIKA 1ITXA 4QX4A 1BAGA 3PR2A 3A24A 4NJKA 3OHIA 6TIMA 1VPQA 3G1HA 1ECEA 1K6AA 4MYXA 3VGGA 4O0ZA 3BAXA 2D3NA 4JL1A 3N34A 4I7WA 2Z7GA 5KITA 3W1RA 4E2DA 3UG4A 1ZHAA 3U7BA 1I0BA 3PTQA 3S3GA 1HJVA 3QQ1A 3S6OA 4DF0A 1K77A 4HIBA 3W87A 4MVAA 3E0WA 3FSTA 4GYKA 2D20A 1S5VA 1WOBA 4IFOA 2WM1A 3PBGA 4AIOA 1LBMA 3TQKA 4YN5A 2QJNA 3NL6A 3QMRA 1VGAA 1XYAA 3ZT6A 3M6DA 4CCCA 1XIMA 1K02A 2KZHA 3NL2A 5DMYA 4W85A 3S5NA 2GK1A 5A8GA 1R38A 1UD2A 2BNJA 3EXTA 3E2RA 3DYMA 1ZBVA 2QVNA 1KCZA 1US0A 3AFBA 1SYTA 3KVLA 3O3RA 3TV8A 4K1WA 1Q2SA 1OX5A 4HA4A 4UFMA 3OG3A 4AWEA 2FHCA 4FX8A 3WYZA 1TV2A 4B9ZA 2VJXA 4JIEA 1XYMA 3HMJG 1ZL1A 1TWZA 1TZZA 4LAOA 4FHAA 2XDFA 3U2OA 1FTXA 4LYQA 1Q8JA 1GZJA 1JXKA 3CV6A 1E4MM 3B03A 2BG5A 3PG8A 4ZOBA 3PPGA 4I6VA 4DO5A 1HKJA 1C8YA 3LM3A 1PBGA 1QNQA 1JNEA 4D6GA 3DFQA 3S42A 2YYTA 2C0HA 1K9DA 4GH3A 4RUBA 3WL1A 1R3WA 3R8RA 3AIVA 4JIQA 2INFA 4W7UA 3NVTA 3FKRA 3THUA 1W5MA 1C93A 1Z3NA 1XM3A 2HEJA 5H1WA 1EQPA 2FFCA 4UR7A 4W5UA 1UR1A 2PBOA 3OGRA 3AXKA 4S3JA 4GVGA 2XWEA 1AMYA 2PRMA 3S2JA 1JF5A 3BZJA 3RR1A 3GR8A 1OVDA 4UCGA 3LG3A 3S1GA 1V7AA 2VX7A 3WJWA 4GXPA 4AQLA 3BAYA 3CYJA 2D2JA 2XVPA 5IFTA 2G4FA 4H6KA 3W9ZA 1ZCCA 4OT7A 1J2WA 3M44A 5HBFA 2Z27A 1TFVA 4EPBC 3DYOA 1EGVA 2HVOA 1VIWA 1VENA 3EA2A 3M16A 3RO8A 4K2SA 3RX2A 3MSYA 1AQ0A 3UEQA 3UXAA 4DIAA 1UZ4A 3NO5A 3WK0A 2VEMA 3FA4A 3N9SA 3RNDA 1TPWA 2OYKA 4ATLA 3GVWA 3TP4A 3VD7A 3KRSA 3W1MA 2PP1A 3SQLA 4C1NA 3AOFA 4W8AA 3OPSA 1DIOA 3W7OA 3GO2A 4K8GA 5A95A 1RCOB 2QJMA 4WD0A 1XBYA 2V6AA 5DT5A 4HHLA 1XISA 1RAKA 4MAZA 4H9XA 5U4NA 4DBWA 1JYVA 3F5KA 1WDPA 3PUEA 3HBLA 4UQ9A 4GACA 1A4LA 4ZOEA 1OX6A 4HZ7A 4KEUA 2DZAA 4F8XA 1SR0A 3G6LA 1PX3A 2ZX5A 3IAPA 4ZQMA 3FGCB 2GJPA 4XV0A 3R0DA 4TVUA 1PS9A 2PD5A 1W9VA 2OOFA 3T0DA 8XIMA 2EG6A 4LU0A 3QHOA 4GK8A 3T0CA 3LTSA 3PJWA 1Y5VA 3VNZA 4TVCA 3C61A 2WSKA 2R1PA 2WAGA 3QTGA 3CV2A 1GPFA 5G5IA 1LLZA 1J6PA 5C54A 2EAWA 1E72M 1VPYA 2ZICA 3D46A 5HQLA 1F3XA 3WQGA 3UZWA 2CXEA 3P8JA 3AHVA 2Z7KA 2PWHA 3G0UA 4GZEA 4M0XA 2C0AA 1C9DA 4IQDA 2E6AA 1T41A 3GE7A 4FNSA 3CPRA 6CGTA 3RU6A 5I02A 4B9YA 4AY1A 3R79A 5JBFA 1EJUC 9XIAA 2BP1A 4YNGA 1W9PA 1F3EA 4C6BA 3FKKA 2GZXA 3L4YA 2DZBA 1OC5A 2ACSA 2PE4A 4I5XA 3DIPA 2E8ZA 4EXBA 3AMGA 4JNMA 4US5D 3F2DA 2YB1A 3T09A 4PMQA 2WMIB 3UBPC 5FSDC 1J9YA 1OK6A 1PKMA 1XLGA 1S1PA 2OGJA 3OBAA 2WYSA 1GOXA 3KTSA 5AB3A 1PTGA 4CU8A 3DFHA 2WM0A 2VDIA 1M7JA 3BLPX 1CTNA 3CYVA 4O8RA 2PDPA 5E0CA 4ES4A 2REQA 3CQKA 3DFSA 2WVSA 1XH2A 1TWDA 1GYLA 2H9AB 4S3EA 1ME9A 2V3EA 4LCQA 4YVPA 3SI9A 4E4UA 1DIDA 1E9YB 2B31A 4S2CA 3EX2A 1REQB 3WNPA 4X22A 3GXTA 4U28A 1VJZA 2ZOXA 4WRHA 2CKRA 3WK1A 3BGJA 3HG3A 3GFXA 1EDQA 1R9YA 2E25A 2YCLB 2YXOA 2G3FA 3LI0A 1IV8A 4Y9NA 5LNRA 3WQ5A 2P5NA 4PRTA 1OGBA 3TC3A 5CCZA 3UCDA 2FB3A 3KTXA 3GYCA 1YNQA 5HNUA 5C9XA 5CPQA 3E0FA 3W7GA 1G0CA 2Q02A 2JFEX 4JTJA 5DCBA 3G1FA 3ITLA 3NVDA 4CQDA 1GEQA 3AAMA 4MSSA 3WL0A 5HA7A 1UUMA 4WOQA 3B8DA 4WZHA 2DEPA 2DT2A 1Q6DA 5G1YA 4XZ9A 2PDXA 2BVYA 1KXTA 3TWAA 1RPKA 3N3TA 3QSTA 4QG9A 1VBRA 3LGEA 1FCBA 3HV8A 4C65A 4DNMA 3KWXA 3XIMA 3QZ6A 1JZ3A 2QDHA 3SCTA 4ZR8A 1S5MA 3ZOAA 3I3DA 1ZRQA 4AX6A 4DYJA 3FW6A 4BI7A 5I79A 3E2VA 4XB3A 3NO3A 2PRLA 4H1ZA 4LUSB 2O9OA 1GJWA 3FEMA 2HSAA 3VIHA 4GLEA 4CN1A 1XIDA 2QV5A 1EUNA 4F0LA 1VEPA 4E8DA 4DO4A 2INEA 4JIHA 4LAUA 2GDQA 3TMLA 2E9MA 3G0XA 2BY1A 4XD6A 5EGRA 1L6WA 2ASHA 1EYEA 2RDWA 3UCCA 3H2NA 3EDKA 1A5NC 5I77A 1DXFA 5KZEA 2PDYA 2YPIA 1WDQA 1VQTA 2CIPA 4WIWA 2Y0FA 4CQ8A 1B3OA 2QUTA 3NXLA 1B9BA 3M1ZA 4BHYA 2O9PA 4WLCA 3SUWA 3TA6A 2Y63A 3FYPA 1HN1A 3U5YA 1RLCL 2OSYA 3K8MA 4HTBA 1XDMA 1GVYA 5E0FA 3LGDA 3VINA 5GJPA 5DMLA 3GC5A 4PTNA 3W83A 3BZGA 2PF0A 2E28A 4IH3A 1RBLA 4AEFA 1UA7A 3O1NA 4FNQA 4LS1A 4Z1BA 5HINA 2VCCA 3C6CA 5REQA 2Y8UA 3NL5A 5JU6A 3M6YA 4E8GA 3AYTA 5A8MA 1R47A 1R9ZA 4S3AA 5LA0A 3LX9A 3HQOA 2QJHA 1QMLA 1SZEA 1OD0A 4IICA 4JTEA 3RCYA 3UZZA 4GZJA 1CNVA 1MFVA 4C6LA 1V5XA 1TTPA 3PFRA 4JN7A 2DT3A<