4EE9A

Crystal structure of the rbcel1 endo-1,4-glucanase
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
321
structure length
321
Chain Sequence
b'SVDLIGINVAGAEFTGGKLPGKHGTHYFFPPEGYFEYWSEQGIHTVRFPLKWERLQPSLNAELDDVYASLVDDMLDQAKENDIKVILDVHNYARYRKKVIGTEDVPVSAYQDLMERIAKRWQGHDALFAYDIMNEPYGSADKLWPAAAQAGIDGVRKYDKKRPLLIEGASWSSAARWPRYADELLKLKDPADNMVFSAHVYIDEDASGSYKKGPGKDFEPMIGVKRVEPFVNWLKEHGKKGHIGEFGIPNDDERWLDAMDKLLAYLNENCIPINYWAAGPSWGNYKLSIEPKDGEKRPQVALLKKYAAKDNCSDFGPAKAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
publication title Three-dimensional structure of RBcel1, a metagenome-derived psychrotolerant family GH5 endoglucanase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 119
structure length 321
sequence length 321
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ee9A00
1A47A 1C92A 4HZ6A 3UG5A 2E40A 3OIHA 4BQ2A 3CO4A 1TMQA 3L4YA 3WQWA 4BA0A 1JG9A 1I75A 2MANA 2BVDA 5E9AA 4MJ4A 1UUQA 1QBBA 1V6UA 5CGTA 3AS2A 1VEMA 1GHRA 1H3GA 1GHSA 3F5JA 1KGUA 2D0GA 2XVKA 3WQ5A 4RE2A 4J3WA 1W3JA 2FDMA 4AZIA 1EDGA 2WVUA 5JIWA 1K6AA 3ZIZA 3CUJA 1WPCA 1LG2A 5M5DA 3RJXA 5TD4A 4GZJA 3RCNA 3SCSA 1C93A 4AD5A 3CZJA 3PTMA 1QNOA 1CNVA 4PEEA 1B0IA 3OLDA 1B3VA 3GXDA 2WW5A 2WZIA 2BHUA 2EPLX 4MPKA 2PBGA 3RPMA 4AD3A 4KGLA 1W32A 3N15A 1W3KA 3AQUA 4FLSA 4UQEA 4F66A 1V0NA 3EDKA 4IPNB 3VTRA 4HMEA 2BHZA 5CJ5A 1YQ2A 5I24A 3AMDA 5A2BA 4J7RA 4LQ1A 2OYMA 2X0YA 4D72A 4ZENA 1IV8A 1MYRA 2WM0A 1PIGA 4WK9A 4JHOA 1G9HA 1J0ZA 4YN5A 4JKKA 1ISYA 2WB5A 2W67A 3CUGA 3T08A 3T2PA 4KGJA 4E4PA 1V6WA 2VX7A 1A3HA 2ZX5A 3K8MA 2ESCA 4PCTA 2AAAA 2G3JA 1BF2A 2W5FA 2FH8A 3W82A 5CXPA 1XH1A 4AZCB 4Z2HA 2VRKA 4JHZA 2EQDA 1B30A 3CHDA 3WF3A 4L4PA 1BG4A 3EDDA 3WN6A 2ZWYA 3PZGA 2E0PA 4AW7A 1KXQA 1BGGA 1UWTA 4JFVA 2DSZA 1D2KA 1B2YA 2XJ7A 3BLKA 1JIBA 4J28A 1OT1A 4PMYA 2GJXB 3M7SA 4TX6A 2WMJA 1OBAA 1EGZA 1B31A 2D24A 5IHRA 1VFMA 5JBDA 1DTUA 4CU6A 1UZ4A 1ITXA 1EDTA 1CGTA 1JI2A 1UD4A 4CVUA 4LYPA 1R7OA 1WDRA 2PWGA 2OYLA 1NP0A 1VENA 3W29A 1WZMA 1VIWA 4R27A 1UOKA 5BYWA 4TVDA 3UR7A 3A4AA 3CHFA 3M46A 2ZUTA 1V6XA 3FNDA 4M8UA 2JEQA 3MS8A 4Q22A 2RGMA 3ZQ9A 1G01A 1KQZA 1ZJAA 3AI0A 3QHNA 4BQ4A 2EXOA 1QPKA 3KEHA 2DT2A 2J7GA 5C8BB 4UQAA 1FOBA 6CGTA 3DYMA 1EQPA 3I3BA 1OB0A 1NWUA 3TOPA 1HJWA 1US2A 1VJSA 4PCSA 4TVCA 1E6PA 2XM2A 5I77A 2C0HA 3WQ4A 2PI6A 3ZOAA 5BRPA 1EHAA 2WKLA 3HU7A 4HA3A 4P7LA 5ABEA 1GZJA 1SMAA 2ZWZA 2BV9A 1QNQA 4M80A 3AHZA 3WELA 5I2UA 2BY1A 4AZ7A 1OGSA 4IPLA 1K9DA 5KEZA 1QI0A 3VNZA 1OSEA 3LMYA 1Q6GA 4D1IA 3MANA 1C90A 2D20A 5GNZA 3WIJA 5BXTA 1KB3A 1OT2A 3QHOA 2DT0A 3FN9A 3TTOA 1EO5A 1R86A 1HVXA 1HP4A 2XVPA 2IXVA 1NM9A 5I79A 3ZJ6A 1QW8A 3AMLA 5EMYA 4ATLA 3RMEA 3K4DA 1UHVA 2YDRA 3B9DA 3VGDA 3J7HA 1RH9A 3BCFA 2WVVA 5A95A 1WZKA 1BYDA 4GINA 2QMJA 3GH5A 1BYBA 4PMNA 1E6RA 2VVNA 3WF2A 1ZBKA 1GOWA 4JFUA 2ZUSA 3SEPA 1CXHA 1WO2A 2E3ZA 2GJPA 3SCQA 3UCQA 1LJYA 2HVMA 4QAWA 5FL0A 3OGRA 4P8VA 4UQDA 1BAGA 2ZX8A 4UZUA 4MJ2A 2IXUA 4UTFA 4PBGA 1NOWA 2V3GA 2VUYA 4AZCA 3K4AA 5A94A 1OM0A 1G94A 1UA3A 2YL9A 1PAMA 3THDA 2V5DA 4HMCA 3VOCA 2VVSA 2CERA 1WAWA 1ISVA 4X0VA 3W26A 2UWFA 1CGWA 4HA4A 1HXJA 3U7BA 1OWQA 3DC0A 2CIPA 2GUYA 4AD2A 1OIFA 1UD3A 5CLTA 3O2LA 2XUCA 3RM9A 1UKTA 1MXGA 1CXLA 2G3IA 3EBVA 2FH6A 5E70A 3WEOA 4C7FA 4DUWA 1E6SM 1AMYA 1F4AA 4KRTA 1BFNA 2D0FA 4NI3A 2A3BA 3VD3A 3GH4A 2J8GA 5E6ZA 2PC8A 1HL9A 5D9MA 3ARVA 1E0WA 7CGTA 3UR8A 2VI0A 2CBIA 3W53A 1HJUA 3W37A 4WSKA 1GOQA 2VT0A 2YJQA 5D9NA 1AQHA 3D3AA 4EKJA 3AIWA 5AYBA 2EPOA 5I6SA 2QPUA 4W5ZA 1H0GA 1W3HA 2E8YA 1VEOA 3NCOA 1J11A 2WHLA 3RM8A 3BAKA 2ZX9A 2QV4A 3MMDA 2NT1A 4QLKA 1NP2A 1GQIA 3MMUA 1PZ2A 5LA2A 3SUTA 2XPKA 2NT0A 3BAWA 1JZ2A 5A6BA 4H41A 4E2OA 4M82A 2VC9A 4M56A 2X8RA 4CD7A 3II1A 4M81A 2VZOA 2J75A 1PX8A 3AXIA 1J12A 2WCSA 5ABGA 1VRXA 2QHAA 3PTKA 3FHAA 3GZAA 1JZ6A 2B31A 3T2QA 3VIIA 3VDCA 2EEXA 4UOQA 5FIPA 2DPEA 5EFDA 4MB1A 1BYAA 1W9XA 2O9RA 1M04A 1E5NA 2J74A 2CCRA 3N18A 4EK7A 3WBEA 1CENA 1W2PA 1O6IA 2DSWA 2ZIDA 5DT7A 3MUY1 3APGA 2X2YA 3N12A 3U5YA 4D6HA 5HXMA 1D7FA 2GJRA 1JYVA 3ZT7A 4GO9A 3N1AA 2CITA 5CQ1A 3WEZA 4AZ6A 3WH9A 2D3LA 1V3IA 3WUGA 1U2YA 3MUIA 3AMKA 1JFHA 1AQ0A 1H1NA 2VNCA 3GXIA 2QLYA 2XGIA 3IK2A 1E4MM 1UQZA 4BQ3A 5EB8A 4AZGA 3E1F1 3WF0A 4H8UA 1ZBCA 1I1XA 2DSUA 1JFXA 5BROA 4WF7A 5A8PA 1LF1A 4JCMA 4OIFA 4ZE4A 1BQCA 1CTNA 2ZICA 4JFTA 4W7VA 3TTYA 1BLIA 3VIMA 3PTQA 2OYKA 1V3JA 4P7RA 1UA7A 4MDPA 1W9BM 2ZOXA 2W91A 1W1YA 1AQMA 5GPRA 1ITCA 3IAQA 3PZ9A 3SCTA 3MSDA 3T0BA 1C91A 1W9PA 1Q6CA 2IUZA 1HP5A 3OGVA 4IM4A 2C7FA 1IZKA 1OGGA 2YL6A 4CVWA 1UR4A 3PZNA 3W4RA 2DDXA 1J0YA 2D23A 1C7SA 1DWGM 5ECUA 4PMUA 3CGTA 3WL0A 1H49A 3WD0A 3D5HA 3ZMRA 1XSJA 3UETA 1QOXA 1CLVA 4LXFA 3G6MA 1Z32X 1JXJA 3U5UA 1SFSA 1MXDA 2VX4A 1HJVA 1X6NA 5BXSA 1XSKA 3WNOA 1UWIA 1TFVA 2VO5A 1MQPA 4LYQA 3MMWA 4PTMA 3W38A 1CLXA 1E5JA 3WH5A 3BXWA 2WC3A 2WVTA 1R7AA 1CXFA 1E3XA 3AOFA 3CTTA 4OZOA 3WD3A 1CBGA 1V6YA 2OLHA 3IJ8A 4QCEA 1E6XM 4R5EA 1LL6A 1E9LA 2XHYA 1Q6EA 2JF6A 1GW1A 1QI2A 1MW2A 4ZXOA 2WVSA 5EBAA 1E1FA 5EFFA 5CG0A 2WC4A 4D71A 1FA2A 3VU2A 5A8NA 1QI5A 3ZJKA 1EO7A 4JL2A 1UWSA 3AZTA 4U3CA 4PRWA 5FD0A 1KFWA 1ZS2A 4U2ZA 4YHGA 1NQ6A 3VDHA 1OINA 1W3LA 1XRVA 2YDSA 1M7XA 5BRQA 3GXFA 4UFMA 1W9UA 4JZ5A 5CPTA 1EDQA 7A3HA 1W2VA 1GVYA 2ZUNA 5A8MA 3O9NA 1TR1A 1N82A 4JCLA 5A6AA 4U5IA 5A6MA 4DUVA 1AVAA 4B16A 3POHA 3G6LA 4QP0A 3SCVA 3W27A 1E56A 2XVLA 1E55A 3VM7A 3VIKA 2HISA 3KWXA 1XYZA 4HZ7A 2Y8KA 1G0CA 2DSVA 2XFFA 2XM1A 3CBWA 1E40A 1WZAA 1WB0A 3EMZA 4CGTA 1V02E 2JALA 4CN4A 4F8XA 3FW6A 1ISXA 2WK2A 1HT6A 4LPCA 4Z2JA 1XCWA 3VGFA 1H2JA 3AS3A 1GJUA 3QOKA 2WWDA 2WVVB 3RM4A 1ESWA 5AC4A 3CHEA 1VFUA 3BAJA 3WD4A 2CYGA 1JF5A 1PJ9A 3AIVA 2A3HA 2CNCA 3OLIA 3AICA 1FH8A 2D3NA 1NARA 3VM5A 1UD2A 4PMZA 3PZQA 5AY7A 5BXRA 1FH9A 2XVNA 3ZT6A 1KQYA 2CESA 3AZRA 4U3AA 2CHNA 4ZFMA 2FGZA 4B9YA 1KGWA 1P6WA 2XWEA 1ODZA 3VIOA 3EDJA 5FCZA 1DWHM 2WMFA 3K8LA 3IJ7A 4M24A 4OBSA 3VO0A 2XVGA 2DT3A 1LQ0A 2CKRA 2W63A 1PEZA 3MUAA 2YIHA 3MKKA 3WUFA 2CEQA 1J0JA 3ARPA 2E8ZA 4WKAA 4EANA 3SCWA 2W62A 1J0IA 3M6DA 3CZ8A 5JUVA 1W9VA 1LWHA 4U31A 1UG6A 1JYNA 1GOKA 2VL4A 4WLCA 1E72M 5CZKA 1BTCA 3AIRA 4ATWA 3O6AA 3EDEA 5A6BD 3VIHA 3A3HA 4KH2A 4P8UA 2G41A 5M17A 3PZMA 2VZVA 3OGSA 4PTXA 4W7UA 4AC1X 4PSPA 5DEZA 4X0NA 1KCKA 4OOZA 4P8WA 3DECA 3AXXA 4HPHA 2G3NA 1MWOA 3WNNA 3SIMA 4CCDA 1H5VA 5E0FA 3VNYA 4AMCA 1MW1A 2Z1KA 4XX6A 4UQBA 1JGIA 2XSBA 4HP5A 3UG3A 5HOSA 4AZBA 4AD1A 4PYSA 1W1TA 3ARWA 2GK1B 4J3TA 5A6KA 6A3HA 2PWFA 1XD0A 1XV8A 3WF4A 3NJ3A 3VGEA 3AFBA 1CYGA 2Y2WA 1V02A 1KXTA 2WPGA 1FP8A 4PN2A 4PMQA 3DYPA 1GNXA 5GNYA 1VJZA 3QHMA 2G3MA 2CKSA 2CHOA 2YA0A 1B3ZA 4P7OA 3TTQA 3VD9A 3RO8A 1E0XA 4TTUA 5DMYA 3QGVA 1DHKA 4QLLA 2BXZA 3ZSTA 5A2CA 1H41A 2BVTA 3WFZA 1E73M 3ARYA 2WCAA 3FY1A 3WEMA 3AYRA 3TP4A 5IXEA 2PB1A 2VQTA 3BGAA 1CZ1A 5LYRA 2WHJA 1X6LA 2Z1SA 2CPUA 1B3WA 2PWHA 4EE9A 1JXKA 1GOMA 3BMWA 3ZO9A 1C8XA 1QHOA 5A6SA 4HZ8A 1NOFA 4OUEA 3VD5A 5I5RA 3AS1A 4IISA 1BVZA 2WANA 3CZGA 3SCUA 2XFRA 1VF8A 4ZXLA 2J77A 4QDMA 3VMNA 5ABHA 1UKOA 3ARRA 3UEQA 2D1ZA 4N0RA 1GPFA 1GONA 1HJSA 2Y4SA 3N17A 4AZ5A 4LX4A 1FFQA 2GDVA 2E9BA 3FAWA 4J27A 1C3FA 1UR2A 3L2MA 3WNKA 9CGTA 1JYXA 2XTKA 1DEDA 3DHUA 4D6JA 2JF7A 5HNNA 4TXEA 4PMVA 3B8SA 2VCCA 4XUYA 5DF0A 2BY0A 2O9TA 1UR9A 4JKMA 3VD7A 3S6TA 4LYRA 3ZR5A 1CEOA 4WIWA 1H0IA 5M3WA 1V0KA 1LG1A 3WH6A 3K1DA 3VDAA 2YLAA 4ACZA 2WMHA 3GNRA 3IJ9A 3ZM8A 2J47A 1ISZA 3SUSA 5A6LA 3OBAA 2ZXBA 1M01A 1W91A 4FLOA 4MADA 1WKYA 2J25A 1EXPA 3F4VA 2ZUWA 4DUXA 1W9DM 2WZHA 8CGTA 2NW0A 1E4LA 3AZSA 4CU8A 3VGHA 4E8CA 1G5AA 2G4FA 1E0VA 1JL8A 3VKKA 3BC9A 2BFGA 2E9LA 3AIBA 3K46A 2O9PA 3ALGA 3BMVA 4BQ5A 4GZIA 1V3KA 3AHTA 4HPGA 3THCA 4OKDA 1HKMA 1E71M 2WHMA 1E3ZA 4CU7A 3AHYA 2YL8A 3N04A 4W8LA 2PF0A 2WCGA 2XSAA 1GOIA 2V38A 4MB3A 3OLEA 2BY3A 3AIEA 4XB3A 4B3KA 4HOWA 2VCAA 2YKKA 3F5KA 4JFWA 3VINA 3FAXA 2WSPA 4UFLA 4HOXA 4WJXA 1Q4NX 2XG9A 1D3CA 2GK1A 2ZX7A 2VOTA 2GDUA 1GUVA 2F8QA 4L4OA 4MNLA 1JDDA 2WMKA 4GPNA 3VUPA 4PMRA 1V0MA 1CGVA 3WENA 3L4TA 4GIAA 4CD4A 3WMSA 1GVIA 1MW0A 3CLWA 2C8NA 3NDYA 1WCGA 4GI6A 3CZEA 2EPNA 2D2OA 5E09A 1UH3A 4H7VA 3AIUA 5JBEA 1DWAM 5BXPA 3VIFA 2VR4A 1JAKA 4CN1A 3MSGA 2E4TA 2PWDA 3OZPA 3UG4A 3IAPA 2WXDM 2Y8VA 4MB5A 4CKQA 1L8NA 1GQJA 1F4HA 4U33A 5HPOA 1H11A 4PUEA 4AZHA 1FHLA 4MNJA 1JDCA 4CD6A 1VFFA 4UQCA 3ZSSA 5IFPA 2F2HA 1JNDA 4GO8A 4W5UA 8A3HA 1Y7VA 3PN8A 4FMVA 1C8YA 1EHNA 2ZX6A 4BF7A 1ZB5A 3WDJA 5AYIA 2J8FA 5E0CA 4QFUA 1XD1A 1KBBA 1KXHA 5M03A 1M53A 3SURA 3KZSA 1KBKA 5CLWA 1Q6DA 5BWFA 1XYFA 3SCOA 3BSGA 4AY1A 2DT1A 3BAIA 4A4AA 3WNPA 2O92A 4FLQA 4N42A 1UQYA 1UWUA 1FP9A 3BLPX 3AMGA 1EOMA 1UZ1A 4TUFA 3L4VA 3BAXA 1FH7A 1G1YA 3GBDA 1KCLA 3MV11 2UY4A 4Z2GA 2DGAA 2YBTA 3UERA 4DWSA 4UQ9A 3WMBA 5C70A 1XGZA 4GQQA 1MFUA 1CXIA 1FHDA 2D0HA 4GZEA 3GTNA 1CGUA 5JBFA 1DP0A 2VZUA 3BAYA 2EBNA 4GKLA 1HX0A 1H09A 2EPMX 4BS0A 4ML4A 1V03A 3WBAA 2DIEA 3A6OA 1K9EA 3SUVA 1JZ7A 1R8LA 3W28A 4CN6A 4CUCA 4U5KA 1V3HA 1WE5A 2JE8A 2DIJA 1M03A 3LPFA 2YLLA 5I78A 1CECA 6TAAA 2WLYA 4J3UA 4BCEA 3EMQA 2CBJA 3EMCA 3NSMA 1YHTA 2VR5A 1XHGA 3AMCA 4W84A 1HJQA 1QBAA 1SMDA 3AJ7A 1GCYA 5FKYA 1ZBWA 1UD6A 2UY5A 2DQXA 3WD2A 1R87A 4P7QA 2OSWA 1QW9A 2OWXA 1CDGA 5BCAA 1KR1A 4A3HA 1HVQA 2X09A 2J7BA 2GVYA 4HU8A 1IZJA 2A3EA 3EDFA 4V28A 4X9YA 1NWSA 5IDIA 3W81A 5E6YA 5I23A 1UD8A 4MTVA 2QPSA 1ZL1A 1JI1A 3VDBA 1J10A 2WNWA 1PZ3A 1H4PA 3WFLA 4HOZA 1HNYA 1JDAA 1PX4A 1B90A 1J01A 5CPQA 1IT0A 2W61A 4UCFA 3PZTA 5ABFB 4F9JA 1CXKA 2JIEA 5D8WA 2WBKA 2OWWA 1J9YA 1ISWA 1TE1A 2TAAA 4W7WA 3ZJ8A 5C71A 3T0DA 4MDOA 2WWCA 1TG7A 2VCBA 3WD1A 4UR9A 2CETA 5A6JA 3TONA 1LWJA 4MNKA 3ZJ7A 4MB4A 3SUWA 3WH7A 1XC6A 5JIPA 1ECEA 1WDQA 2YA1A 2V3DA 5KZ6A 3AS0A 5D4YA 4D6CA 4ATDA 5A8OA 2WZEA 1HKJA 1QHPA 1ZJBA 3WDQA 2OWCA 2CBVA 1WP6A 4K68A 4AXNA 3NSXA 1HF6A 2BNJA 1NWTA 3AXHA 2X0HA 2Y5EA 3NDZA 4DM2A 2JIWA 1J18A 4Z2LA 3FXYA 1MQQA 1ZU8A 3S2CA 1PIFA 3VX0A 1BYCA 1LL7A 2BHYA 1JNEA 1E43A 1QNRA 1C7TA 1BPLB 2QMKA 2GSJA 3LPOA 5CPSA 3W6MA 3N13A 3SCNA 2W66A 1V3MA 5D8ZA 4U2YA 3WH8A 3MU7A 2WMGA 3CUHA 5A3HA 1RPKA 3T0AA 2J7DA 4JL1A 3KL0A 3BSHA 5F7UA 1UH4A 4D6EA 4GQRA 3U7VA 3CHCA 4NZCA 2YBUA 4UZSA 3QR3A 1BHGA 1E6ZA 3NUKA 3NSNA 4ACZB 4RE3A 3GH7A 5CSUA 2CXGA 3A4XA 1HN1A 5IHSA 2XIIA 5A69A 4TVUA 3L2LA 2J78A 3HJEA 1TA3B 4RE4A 4YPJA 3GNOA 4AEEA 2ZUUA 2JFEX 4BZYA 3CPUA 4Z2IA 3CH9A 2ZE0A 1XCXA 4XV0A 2X05A 2D22A 5I0DA 4GXPA 4W89A 1E70M 3LPPA 1J0KA 3DYOA 3BCDA 2A3AA 1DWJM 4YHEA 3ALFA 2XFYA 3PZOA 3PZIA 1CWYA 1UKQA 5A1AA 1O7AA 3WDHA 1EIBA 1RD6A 1HIZA 2J7FA 3VIPA 2VRQA 1B9ZA 1KWKA 3I3DA 5HDRA 2AMGA 5AC5A 2PWEA 4HA1A 4NSBA 3GBEA 2J62A 1OCQA 3N9KA 4D6FA 3GDBA 2ZUVA 3PBGA 2FHFA 2DH3A 1WDSA 4AEFA 1CGXA 4PSRA 4D6GA 4OJYA 2Y24A 3PHAA 3WL1A 3OZOA 1JZ4A 3ARQA 1XH0A 1E6NA 1QNPA 3K8KA 1QVBA 2XIBA 3OG2A 4KRUA 1E6QM 1UH2A 2J7EA 3KL5A 3RIKA 1LL4A 2VRJA 3CUIA 3W25A 3WSUA 5IFTA 3AISA 1TVPA 2E9MA 3UESA 1GJWA 3A47A 2WMIB 4F9DA 2ZXAA 3ZR6A 1E1EA 4JFSA 4PMOA 3GXMA 1HKKA 3B9EA 5ABFA 4PTWA 5FOOA 4E8DA 1TUXA 2VJXA 1PPIA 2DEPA 1JYWA 2CBUA 3VGGA 4AD4A 5GNXA 4AIEA 2OSXA 1KXVA 2V3FA 1ODUA 3NYDA 3WUEA 4F79A 5FL1A 3U57A 1B1YA 2W92A 4MAZA 4IUGA 1PX3A 2VMFA 1BVNP 2WAGA 1V6VA 4DM1A 4HMDA 2UY3A 2VURA 3ARTA 4FF5A 2AOSA 1XSIA 4UFKA 4Z2KA 3OA5A 1UR1A 4HTYA 4P8XA 4AIOA 1JZ8A 2XWDA 4MNMA 1EA9C 2EPKX 1WDPA 1JD7A 3AIQA 4DWSD 1V3LA 4W8AA 1UKSA 3T09A 3VMOA 1QI4A 1JAEA 1Q6FA 3FHQA 4W8BA 2A3CA 3CZKA 3OB8A 1RP9A 1US3A 3ARXA 1B3XA 4QCFA 3N11A 3L4UA 1VEPA 3WF1A 3OLGA 2VZSA 3ARUA 4JAWA 4UNIA 3M07A 4S3KA 4AD0A 2BS9A 3MUZ1 3TTSA 3VILA 3VX1A 1UR0A 1CXEA 4D1JA 1QHZA 4GI9A 2VZTA 2Q8XA 4CCEA 3VGBA 5D9OA 4DWSB 3SCPA 3CUFA 2WLZA 4TOQA 2J4GA 2BVYA 4WKFA 3VD4A 1UWRA 1E4NA 3ARSA 3RILA 4M1RA 1TA3A 2F61A 3RDKA 4J3XA 3SUUA 4AWEA 1CGYA 1KR0A 4JKLA 4AYSA 4ACYA 4A3YA 4CD8A 2XGBA 1MW3A 4AIUA 1VBUA 3NIYA 3A4WA 1TCMA 4HU0A 3QOMA 3VMPA 3L4ZA 4NF7A 4CCCA 5DO8A 4KMQA 1KGXA 2GJXA 3W6LA 4UOZA 1CPUA 7TAAA 3GYCA 2WSKA 4LGXA 4URIA 4W87A 3B9AA 3WMCA 1TVNA 3WQ6A 1OGBA 1W1PA 3F5LA 5HPCA 2VTFA 2YA2A 5HBFA 1HKIA 1CIUA 1WZLA 5D9PA 1RP8A 3I3EA 2J79A 2ZUMA 1J0HA 4OBRA 3ARZA 2FGLA 3POCA 2O9OA 2BXYA 1NWRA 2ZXDA 5GQBA 2BY2A 2WC7A 1TZ7A 5DT5A 4XZWA 3ECQA 2DH2A 1EQCA 1K9TA 4PMXA 4ZEPA 4FLRA 1L0PA 2VX6A 3WKZA 4J3VA 1FFRA 2VX5A 2EJ1A 1EOKA 1VBRA 3KE0A 3WDIA 1JD9A 3LPGA 4M29A 3HN3A 1E4IA 2WMIA 4W86A 3WQ8A 2WHKA 2XYLA 4OOUA 1OIMA 1U30A 1C8QA 1UKPA 3WDPP 2G8ZA 4UFJA 3VIJA 3WY1A 2JEPA 3BH4A 3IANA 1UD5A 1GOOA 2EO7A 3L4WA 4XZBA 2YDQA 4B9ZA 3W0KA 4QLJA 2WYSA 3GM8A 4UOJA 2OSYA 3W24A 4MAVA 1VAHA 1GORA 4W88A 2VQUA 2NSXA 4NRRA 4W93A 3AROA 5A8QA 1JZ3A 4W85A 1BSIA 2GFTA 3KL3A 4H04A 2J7HA 1B3YA 1GQKA 3WDRA 4WSJA 2DSKA 1DWFM 4UFIA 3SCRA 2FHCA 3AHVA 1U33A 3AHXA 4TX8A 3AYSA 1ZBVA 4P7NA 1KWGA 4TTGA 3MO4A 1E15A 3L4XA 4Y7EA 1I1WA 4CD5A 2QF8A 4WKHA 4H8HA 1QNSA 1UR8A 4V27A 4D6IA 3WNMA 3VPLA 2ZXQA 1MVYA 3WQVA 2J7CA 2YOCA 1EH9A 4S3JA 1S46A 5CSYA 1QI3A 2UY2A 5LA1A 1W1VA 4D6DA 3GNPA 1MQRA 1K9FA 2FHBA 1JZ5A 3CMGA 3JUGA 3CMJA 4PTVA 5A2AA 3CZLA 4C7DA 5DFAA 1VFOA 1GQLA 3RJYA 3ZT5A 3WUBA 5CGMA 4JIEA 1V0LA 1UWQA 1BG9A 3PZVA 4B3LA 4B15A 1X1NA 2W4XA 1SYTA 4H8VA 4EAMA 1HJXA 4PMDA 4ZE5A 3T2OA 1JF6A 3PZUA 1OD0A 3WNLA 4UFHA 3HMCA 4DWSC 4PUDA 3MV01 4H2CA 2YL5A 3DHPA 4FK9A 1BGAA 1NH6A 2WBGA 1OD8A 1NOUA 3VIGA 1V08A 1WNOA 1R85A 5LA0A 2V5CA 4V2XA 2PBOA 3CIVA 3VVGA 2X1IA 1PBGA 4GI8A 1LLOA 1DWIM 4RL3A 3TA9A 4J3SA 1VB9A 4AISA 4KWUA 1HL8A 1UYQA 2V3EA 2WKGA 1MFVA 1XH2A 4Q7NA 5I3DA 2RGLA 3EYPA 4C7GA 1SR0A 4NRSA
chains in the Genus database with same CATH superfamily
2B81A 4HZ6A 1VC4A 1ICQA 3S6DA 1ZCCA 3RAOA 2GZXA 1A5LC 4Y8EA 4E3TA 3WQWA 4BA0A 1JG9A 1I75A 2BVDA 5E9AA 3DHDA 1OYAA 1QBBA 3MB9A 3TN5A 3AS2A 3AU6A 1DVJA 1G4EA 2ZZ5A 3LI1A 1TKKA 1H3GA 1I6NA 5J5RA 4RE2A 1W3JA 1L6YA 4QGCA 1K6AA 3KCLA 1KBJA 4IZGA 5CC7A 1LG2A 4GZJA 3SCSA 3CZJA 3PTMA 3G3MA 2H9AA 4CEUC 3GXDA 4L4LA 2WW5A 4HHMA 4MPKA 1RCXB 1TB3A 4G1KA 4AD3A 3LBCA 2WNNA 3UU0A 1IGWA 4S3FA 1JCMP 4IPNB 4S3BA 3VTRA 1YQ2A 5I3IA 3P74A 4LNCA 3H7UA 4K8EA 3PAJA 3UR5A 1PCKA 4ORIA 3M0HA 1PIGA 1G7VA 3MP4A 1N8IA 4KGJA 2VX7A 2G37A 4S1FA 3URBA 4NAEA 4DZ5A 4PCTA 1RZMA 4B5SA 1BF2A 3MYPA 2W5FA 2FH8A 4GK8A 1XH1A 4Z2HA 1VIZA 1XCFA 3PB2A 4RCXA 3RLUA 2EQDA 2AAMA 3M4HA 1DJNA 2AQVA 3CHDA 3WF3A 3SY5A 3LBMA 1BG4A 2BTMA 3RN6A 3KCJA 3PZGA 1OX6A 3LCLA 1BGGA 4JFVA 2DSZA 1D2KA 2XJ7A 1JIBA 2QCMA 3RHGA 1XLDA 5CBJA 4J28A 3QTGA 3UY7A 2OPJA 4PBFA 3SFKA 3TJIA 5AHEA 3V0TA 4CQBA 3LXCA 3HG2A 3M7SA 4H9MA 2E6AA 4KRZA 2P0OA 2J27A 4IFKB 5CPOA 2G5WA 1EDTA 2I9UA 1P7TA 5I06A 3KS6A 4UTIA 1WDRA 2PWGA 3QVQA 4MIMA 1VENA 4CNTA 3P84A 3NZPA 1WZMA 1VIWA 4B5NA 3RLVA 1V6XA 5FF0A 4YJ5A 2ZA3A 4E4FA 4Q22A 3ZQ9A 2ZCGA 1XIIA 3XIMA 1W5PA 1ZJAA 3RU6A 4EPDC 1QDSA 1TV5A 4UQAA 5HMFA 3TOPA 4NNBA 1VJSA 4PCSA 3TWAA 2C1GA 3N34A 1RSCA 2PI6A 5BRPA 2WKLA 3GHUA 3HU7A 5CG7A 5ABEA 4JTGA 1GZJA 1SMAA 4K36A 4L6OA 1QNQA 2W9MA 3IIVA 1UBSA 3MMTA 3HFTA 2BY1A 2KX9A 4LC6A 4XKMA 2AQWA 2V9DA 2QKFA 3GIYA 3P5ZA 1UZDA 3I7RA 3AU2A 4LBUA 1C90A 2D20A 5BXTA 3L0GA 3I65A 1BKHA 3QFWA 3NG3A 4MZ8A 5F2GA 3ZJ6A 1XQKA 1QW8A 5EMYA 1JDFA 5FF4A 1TO3A 3K4DA 4GIEA 1H50A 4LEQA 3J7HA 1RH9A 4XAZA 2WVVA 5A95A 2Y62A 2VXNA 3WX7A 4OU1A 3QSTA 1E6RA 4JXCA 1R3VA 4PL2A 1ZBKA 1GOWA 4JFUA 2ZUSA 3W23A 2E3ZA 1EFZA 1LJYA 3G1YA 5FL0A 4PBEA 2ACRA 3E02A 4UQDA 1BAGA 4D8LA 2ZX8A 4MSSA 4ZO7A 4UTFA 2QDHA 3WLHA 2V3GA 3IUDA 2DW6A 3TN6A 5A8GA 3NQGA 1O5QA 1PAMA 4HMCA 3VOCA 2CERA 1PDZA 4CNNA 3KOWA 2UWFA 5TF0A 3IIPA 3U7BA 2V6AA 1TPH1 3S1UA 3TR9A 4GG9A 2CIPA 1LUCB 4QEEA 1T6MA 1OCNA 2G3IA 5E70A 4LFYA 4C7FA 3M5VA 4OECA 2Z1XA 1VBGA 4LW7A 1A80A 1VHCA 4NI3A 2QT3A 4AC7C 1RQBA 3VD3A 3WLPA 2ZYFA 3GH4A 1XIJA 5E6ZA 1HL9A 5D9MA 1E0WA 5BOEA 3F2DA 2W79A 3K30A 5LNSA 3G3DA 4IMGA 3W37A 3DDMA 2C13A 2VT0A 5B7YA 5D9NA 2W27A 3E74A 3C6CA 1J2BA 3D3AA 5K4XA 3BJTA 5AYBA 1Z42A 1O5RA 3VNJA 2E8YA 1U1UA 4XD3A 1WUEA 2D2HA 1J11A 1JUBA 2WHLA 2ZX9A 3UZ5A 2QGYA 3IIZA 4QLKA 3DFPA 3SUTA 2CZDA 3QEZA 2XPKA 2NT0A 5CJNA 3BAWA 1S2VA 1X6UA 3A9IA 4AHPA 1QK0A 1XISA 1G67A 2C1IA 1TV3A 3S47A 4CD7A 3II1A 5CEWA 4M81A 2H8XA 3GE7A 5EYWA 2POZA 3O8AA 2QHAA 4J3ZA 3T4CA 1EC8A 2EEXA 4MB1A 3G1DA 3KVKA 1W9XA 2O9RA 4F2TA 2TYSA 1E5NA 1H63A 4ZB5A 3W1LA 3WBEA 1W2PA 4F40A 2DSWA 2ZIDA 2NQLA 3MUY1 4UTWC 3N12A 5D30A 4XZIA 1GVOA 1TREA 1ONWA 2CITA 3ABOA 3WH9A 3HQPA 3FEQA 3WUGA 4Q8OA 3MUIA 4YU1A 2VD8A 1SJAA 3LHVA 1E4MM 3R0UA 1G69A 4AZGA 5JQ9A 4NZJA 3MVIA 3SRHA 3W7PA 1FWHC 3T05A 1I1XA 1XGEA 2DSUA 4KS0A 4OUIA 1CTNA 2FVMA 4W7VA 3TTYA 2Q8ZA 3VE9A 4HU3A 4NAEB 3WLLA 3QLLA 3O16A 5BW6A 2FZDA 1JRCA 4M0XA 1BXBA 4FF7A 4K8GA 1TR9A 4DUOA 4Q32A 1C91A 1H7OA 3N3MA 4NJJA 3KRUA 2A3LA 1ZGDA 1PTGA 2IKIA 3ZXWA 1AA1B 4R7OA 1X7FA 5HULA 4JYEA 4IM4A 1SR9A 2XH2A 1IZKA 3EEGA 3PZNA 4OFCA 4B5XA 2OQLA 2BASA 3W4RA 4UTTC 2D23A 3NQ2A 1EJUC 1C7SA 1DWGM 4PMUA 1OX4A 2R91A 1H49A 3D5HA 1XSJA 4LAOA 1AJ2A 5EY5A 1Y5VA 3COTA 3JW7A 2QIWA 1Z32X 2Y88A 3TJLA 1O60A 1HJVA 1XSKA 3DESA 2O56A 5AHNA 4NIRA 2I16A 4INFA 3UXLA 3U48A 3W38A 4AYGA 1R7AA 1CXFA 3UR2A 4GYPC 4M6QA 3O06A 4OZOA 4GZ7A 3IJ8A 4C6EA 4MLRA 1LL6A 2J13A 1E9LA 3OBEA 4QSHA 3OQ8A 2NQZA 1KV8A 2WVSA 2HMCA 1HUVA 1FA2A 3LU2A 3PK7A 4WHBA 3UQNA 1FKWA 5A8NA 4AY7A 3LN3A 3ZJKA 3MCMA 2CZ5A 1WKFA 2FPVA 4U3CA 1A49A 3M0JA 5FD0A 1KFWA 4WZHA 1MO0A 1OFPA 1XRVA 1Q13A 2OTDA 4UFMA 2CXEA 4ZR8A 3G1RA 4JZ5A 7A3HA 4A8RA 5TAOA 3RYSA 5A8MA 3SJNA 2I56A 4RDZA 4WXZA 2V5BA 1AUSL 1OYBA 4Y2WA 4XTIA 3WJSA 2HISA 2A6NA 1XYZA 4HZ7A 2Y8KA 2QDGA 2HROA 1SW0A 2XM1A 4MLJA 1WB0A 2FYMA 3GB6A 1V02E 2ODOA 3EPOA 5D2VA 4LPCA 1XCWA 3C8NA 3VGFA 1R38A 3GFXA 4LCQA 1GJUA 3PTDA 3NVTA 1AJ0A 4DF0A 2WWDA 2WVVB 3RM4A 4I9JA 1PJ9A 2IPGA 4UMCA 3NO3A 3AICA 4EAYA 2DUAA 3A12A 1NELA 2ZRYA 3QPZA 4HNUA 2GLKA 3TQ0A 3NQ6A 4POCA 4PTNA 3ZT6A 2HNHA 4ERIA 2VFGA 1K8XA 2CHNA 4Q4OA 2XWEA 3VIOA 2ZA1A 4CQ8A 4DYJA 1JCXA 4M24A 1EF3A 1XIMA 3H2NA 1W31A 1PEZA 3SAZA 3NPVA 3C5QA 3Q58A 3WUFA 3VI2A 3HURA 3N6QA 4EANA 3SCWA 3NXLA 1F61A 2QCHA 4FPSA 3TAKA 3VA8A 1LWHA 5HQEA 3REQB 1UG6A 4R88A 3EOUA 3O6AA 2XZ9A 4P61A 3EDEA 3G0XA 3A3HA 3DAQA 4QE5A 1Q7MA 5FJIA 3GX9A 3PZMA 1RJPA 1EWEA 3OGSA 2H90A 1KBIA 4XISA 3MKVA 3LLFA 1KCKA 4E8GA 3CB8A 3IIXA 2G3NA 5G1MA 3VNYA 4XX6A 2TMDA 2O7SA 3E0LA 3QBUA 1P48A 3IUHA 4PYSA 3HQOA 2PZ0A 1EBGA 4QNEA 4R7WA 4J3TA 6A3HA 3AFBA 1Y8BA 2OX4A 3IGUA 3TCEA 4PB5A 1IT8A 3QRHA 2CHOA 4JTKA 2CLLA 1S5WA 1KKOA 3NL6A 4GH3A 4V1XA 3L23A 3PJXA 3SM0A 3VD9A 3KOYA 3W9ZA 1E0XA 4O4WA 4ICCX 4NZ3A 2AMXA 2I57A 4UMBA 2BVTA 1BXNA 4MGGA 3H12A 3FY1A 3AYRA 3A3XA 1LTDA 3Q4DA 3KWSA 1X6LA 1XDLA 2Z1SA 2CPUA 2FB2A 1GOMA 8TIMA 3ZO9A 1IIGA 5A6SA 2DUXA 1NTHA 3W2KA 3VD5A 5I5RA 2IMRA 3AUOA 1BVZA 2VC6A 3UD6A 1LRTA 3CZGA 4S3CA 1VF8A 1VCVA 5LXEA 2GGGA 3VMNA 1EPVA 4TO8A 1UKOA 4AG0A 2PDBA 3GUWA 3N4AA 4HSNA 1HJSA 2Y4SA 4AZ5A 3HQ1A 1XP3A 4X2RA 1SGJA 4J27A 5K3VA 4F0HA 3WNKA 3DGRA 4C6KA 3I6EA 9CGTA 1EL3A 2PRMA 4PUMA 2AGKA 3DXIA 1UOZA 2BY0A 3CV7A 2O9TA 3S6TA 4HPJA 1ITQA 2QJGA 1LG1A 4MY8A 3WH6A 2DZTA 3VDAA 4TR9A 3WLNA 4QHRA 3MW7A 1CX9A 2V63A 4HTBA 1RK6A 4H00A 2GOUA 3BQ6A 3W7QA 4YWIA 3UXDA 4DUXA 2AKZA 4I6VA 4E8CA 2HNEA 3NQ7A 3VNMA 1FCBA 3BC9A 3AIBA 2E9LA 4JEQA 1RA0A 3K46A 4W9TA 3NPXA 3BMVA 1UC5A 2XH4A 3VXGA 4OKDA 4IIDA 1YADA 2VFEA 4J35A 2YL8A 4Y90A 3SN0A 3IJIA 2XSAA 2OEMA 1NQKA 2BY3A 2ATSA 3EWWA 4XB3A 4LBRA 2YKKA 4NASA 1LOSA 3FAXA 2WSPA 4UFLA 1TJ0A 4HOXA 4BEQA 5JH1A 5E1QA 1Q4NX 3B4UA 3ABXA 4ES4A 3MZ2A 3ATZA 3OBKA 2GDUA 3WLIA 4J1OA 4DI8A 1JDDA 2E68A 4MWAE 5I3JA 4PMRA 1IWBA 1XINA 1JQXA 2GWNA 4IT1A 1YTKA 3CLWA 3NDYA 4GI6A 3CZEA 3KW3A 5E09A 4ROPA 5TBOA 3LTYA 1QWKA 1CB7B 4PRRA 3MBFA 5AECA 5JBEA 1DWAM 3UA4A 1PVNA 4GYJA 4ICNA 1NDYA 2PCEA 4GD0A 3WK3A 4PH6A 6REQA 4CKQA 5MKGB 4U33A 2QPXA 5HPOA 3C8FA 4HN8A 1DIDA 4B90A 4ILSA 4UQCA 2Q09A 1JNDA 2NZLA 8A3HA 3ZLGA 3GC5A 4MKVA 1TPFA 4FMVA 4RK8A 1J6OA 1T96A 3WDJA 5AYIA 5LXXA 3O0FA 3P67A 5E0CA 1ICSA 1PO9A 3NM3A 4R9OA 1GTEA 1W3IA 1V8EA 5CLWA 3NQFA 3W6YA 3W7HA 1KM6A 3CASA 4A4AA 5H8PA 2P1FA 4M7SA 4H9UA 3WNPA 5H2ZA 2O92A 3K2GA 4R9XA 4N42A 2CWNA 4JTUA 2Z24A 3BVJA 1EUNA 1FWIC 5F4XA 1ME9A 4QIUA 4O0QA 5C9RA 1XRFA 2GVGA 1J4EA 2JQXA 3HB9A 4Q8VA 3JVAA 3GBDA 3A5FA 4B5VA 3KBWA 2DGAA 3UERA 4RW3A 4KCUA 3GG0A 3PFMA 4S3AA 1O1ZA 4E6MA 2QW5A 4ZO6A 2QJIA 3DG3A 3RNDA 2DV0A 4GOAA 5JBFA 3GAKA 4GKLA 1HX0A 1XI3A 4BS0A 4ML4A 2C79A 1K9EA 1JZ7A 1R8LA 2Z4GA 4MFDA 4KFOA 1V3HA 2JE8A 4XSMA 2DIJA 2V0TA 2UZ9A 5G4HC 5EA9A 2RDXA 1VS1A 6TAAA 4JHMA 4GLEA 1XRSA 1GYNA 1Q2SA 1B9BA 3W7DA 3AMCA 1M65A 4EX4A 1HJQA 3T78A 3BICA 4FNSA 1UD6A 1B5TA 3WD2A 4P7QA 1QW9A 1KV5A 1UB3A 4A3HA 1HVQA 1A0DA 1KTCA 3KS5A 5RUBA 3VKJA 1IZJA 3CAQA 3EDFA 1RJQA 1Q85A 3MCOA 5DCDA 5IDIA 1MXSA 4UTKA 2B0MA 3CEUA 4LRSA 3DN5A 3BO9A 4ADSA 1HNYA 5D33A 1B90A 1FCUA 1GVRA 1N8FA 3E6EA 4LB4A 3DFQA 2JIEA 2PLMA 2WBKA 1J9YA 2V5JA 4KPLA 4XO6A 1N55A 3RFAA 4IFRA 2F84A 4LVGA 1T0OA 4H19A 5LGXA 4MZ1A 4MDOA 1ZJIA 2QJNA 1J2WA 3U4AA 5A6JA 4D2JA 1CLKA 1BQGA 1LWJA 4WX2A 5FEWA 4AWTA 4GRSA 5JIPA 3OJGA 1WDQA 4LYKA 3AS0A 4ATDA 4FXJA 1HKJA 1QHPA 1ZJBA 4H01A 1MZRA 1WP6A 4AXNA 3UZYA 4EPKA 3TW6A 3UYIA 1MQQA 4O8RA 4BI5A 3VX0A 3P93A 3LTPA 3LXAA 3D3FA 4RNHA 3GG1A 5HJYA 3N14A 1JNEA 1E43A 3R0KA 3GAYA 1BPLB 3MBDA 3N9SA 5CPSA 7ENLA 5C9ZA 5IRPA 4JTJA 5H8MA 4LAZA 4WR3A 4DJED 3QR1A 5A3HA 1UCWA 3T0AA 1FVPA 4WD0A 4OT7A 3BSHA 4BKNA 4O52A 3EKGA 4GQRA 3U7VA 5CPNA 3NGJA 3QR3A 1E6ZA 1IEVA 3NSNA 1GVQA 4RE3A 3GH7A 5CSUA 1XUUA 2CXGA 3EZ4A 4QRNA 3TV8A 1QU4A 2XIIA 4TVUA 2J78A 4DXXA 3T8QA 4KEVA 3ZWTA 3CPUA 2FJKA 3WLOA 3DFSA 4XV0A 2X05A 4O19A 5D05A 3KRSA 1U1JA 1S38A 3IVTA 2EG6A 2ZTJA 2A3AA 1DWJM 2RDWA 3ALFA 4OE7A 3S83A 2FMOA 1EP1A 3R12A 5XINA 1MMFA 1XKJA 1W37A 2GGEA 1XKYA 1AW1A 3MKCA 4US5D 5PTDA 1OCQA 1TIMA 3PBGA 4G9PA 4WUIA 3EPNA 3CL7A 1WDSA 4B2DA 3P2VA 4FNQA 5HWNA 4ZMGA 4D6GA 4OJYA 5EU9A 2GUUA 3PHAA 4RZ5A 3S1VA 4ZA0A 3WL1A 3ARQA 3SY1A 1VFHA 5CZ0A 4NJGA 3I10A 4KRUA 1NFPA 2E6YA 2BXVA 5F4SA 3WSUA 2I5IA 3AISA 4MY9A 2BSLA 5HNTA 5D2YA 1R47A 5F2IA 2CZEA 3W83A 3IIOA 1S1RA 5ABFA 3GXMA 3PVFA 3FK4A 5F4WA 4HNCA 4XBKA 3IGHX 3CLMA 4I5RA 2VJXA 1JJKA 3IJDA 1HL2A 2DEPA 2HPMA 3VGGA 5AHFA 2UV8G 5GNXA 1KRCC 4AIEA 2OSXA 6REQB 1KXVA 1ODUA 3NYDA 3QV6A 3U57A 4MAZA 1YXCA 1TWDA 4IUGA 2IKJA 3ARTA 2AOSA 1LLZA 3KP0A 3CL6A 2XWDA 4NZ4A 1V7AA 3AALA 1EA9C 2EPKX 1JD7A 4DWSD 5A5WA 4W8AA 3B05A 3LHZA 3GIPA 4IIGA 2ZVRA 3MI3A 4W8BA 3U2ZA 5DRCA 4GUJA 1O12A 3MWCA 3ARXA 5G2HA 3L4UA 2QXWA 3W1XA 1VEPA 2CFFA 3OLGA 4R33A 2UBPC 3ARUA 1GKRA 2PU0A 1H5YA 1SFTA 4S3KA 3EX4A 1V93A 1UR0A 4HIBA 5IOBA 4MWAD 3UY8A 1IIHA 1XL9A 4CCEA 3TXVA 2BVYA 5D02A 4QAIA 1E4NA 1HZYA 3RILA 3VKAA 1TA3A 3FJNA 4BHYA 2BZNA 2PRLA 1TTIA 2V68A 4LS1A 4ACYA 4CD8A 4AIUA 1MW3A 1IEXA 2BOFX 3NIYA 1TCMA 3C61A 4HU0A 3DEQA 1TRDA 3B8IA 1I2QA 4KMQA 4W87A 2B7QA 1VLIA 3UG8A 1OGBA 2J6XA 5HPCA 3NQAA 1CIUA 3V18A 1V79A 1RP8A 2HK0A 1J0HA 3F1QA 3ARZA 2FGLA 3C2OA 3POCA 4ZGYA 4GMEA 2O9OA 1O5XA 4DJEC 2BXYA 1P6CA 3CC1A 5DT5A 4XZWA 1REQA 1R30A 1K9TA 4NT0A 1MUCA 4FLRA 2P5NA 1FFRA 1EOKA 3WK0A 3W7IA 1JD9A 3QY8A 3QMRA 2ZVIA 3EKZA 4YYFA 4QEHA 2QAPA 3ITGA 4OOUA 1C8QA 5CPLA 5HUPA 3ZLHA 2G8ZA 4UFJA 4N02A 3E2SA 1R2RA 2XIQA 1PL9A 3BH4A 4PCNA 2OT0A 2A7NA 4DJDA 1ZPTA 4FIQA 4MAVA 4GNJA 2VQUA 4JY8A 2NSXA 2PURA 2H3BA 3AROA 3GVQA 2PTWA 4X63A 1RQHA 2ON3A 4H6QA 4B5UA 1EX1A 5AHMA 4Q8WA 1DL3A 1DWFM 3AHVA 1U33A 3FJLA 4P7NA 1DIEA 1E15A 2VOMA 2H3DA 1I1WA 1CW2A 2AL1A 5DCBA 4WKHA 4FNTA 4MUZA 3EB2A 2Y0FA 2YFOA 1DJYA 1KFKA 2X40A 3DZ1A 5G1TA 3WNMA 1H60A 2FIQA 5LNRA 4ENLA 4ZQRA 2C18A 3NYZA 4S3JA 4AFYA 3T55A 2JKAA 1GVSA 4C1LA 3OG3A 3IV3A 1WBHA 5D37A 7REQA 4JDBA 4Q4SA 4D6DA 3TNOA 1OC7A 4AAJA 5D2WA 3PUDA 4YTTA 1DIKA 1R2SA 1VFSA 3M16A 4F0SA 4DRSA 2E6DA 4PTVA 5A2AA 3E96A 2WJFA 5DFAA 1YNYA 1PYMA 3ZT5A 3R0DA 3S9YA 3ICJA 1UJQA 1BG9A 3PZVA 3LTSA 4C6JA 1A5OC 3TQKA 4B3LA 4H8VA 4RPPA 1KKRA 3TYDA 3T2OA 1AL8A 2BGSA 4JX4A 4DWSC 1D8CA 4PUDA 4H2CA 3WLJA 4J9JA 4DBWA 3GTFA 4RNIA 1VZWA 1WNOA 5LA0A 4LCSA 2X1IA 1FUYA 1PBGA 4IIBA 3VZYA 4GI8A 1DWIM 4RL3A 3TA9A 4C6OA 1W54A 2FLIA 1GKQA 4QR6A 1YE4A 3V75A 3S4TA 3GC4A 1VB9A 3WQPA 1UYQA 5CC3A 2WKGA 2Z1VA 1M6JA 4Q7NA 5I3DA 4MWAC 3EYPA 3USZA 3ENLA 4C7GA 1F6YA 3TC3A 3T42A 1W1ZA 1C92A 3W85A 4E0CA 4QNWA 4ZSTA 3OIHA 4BQ2A 3CO4A 3WK2A 5JH2A 4Z1BA 5B80A 1SW7A 1PCWA 1YPFA 1K7FA 4IGMA 2MANA 4FR6A 5CGTA 4G6CA 3TLLA 4MKSA 4I7WA 4O4VA 1VEMA 4FX7A 4ZQNA 5GJPA 1GHRA 4LF1A 4HCDA 2D0GA 2XVKA 4IQEA 4IMFA 4J3WA 3MY9A 4AZIA 1ADDA 5JIWA 1XUZA 1T5AA 4XAGA 3ZIZA 3DU0A 3R11A 3CUJA 1WPCA 4JBRA 3QC0A 3BQ5A 3M0YA 4JY9A 4LB3A 4MPQA 3BSMA 4NNCA 4NX5A 1B3VA 1H1ZA 4O50A 2WZIA 3V7PA 3BLOA 3RPMA 4KGLA 4XBJA 1W32A 2BGQA 4UQEA 4F66A 3EDKA 1XLBA 3GR7A 1AQFA 3NURA 1JCLA 4JR5A 1A5BA 4GUHA 3TROA 4N9CA 3AMDA 1OCJA 3VNIA 5F1UA 1XR2A 4DO6A 2X1UA 2X0YA 4ZENA 2WM0A 3NM1A 7ODCA 4JHOA 1G9HA 1JUKA 3VOGA 2P10A 4REQA 2W67A 3W73A 4A35A 3RITA 2QCCA 1V6WA 2ZX5A 1YNQA 3K8MA 2ESCA 3HV9A 4AB4A 5C7VA 3W82A 5T91A 3LERA 2QF7A 1YE6A 3RPDA 1POKA 2VRKA 1SFJA 3VKDA 2H6RA 4ZL1A 3S3GA 2HCVA 3M0MA 3BOLA 4M6UA 5C0QA 3RX3A 3GQYA 3I68A 2VKZG 3IRSA 2E0PA 2B7OA 4AW7A 3OU8A 4CNSA 1GZGA 3ZVIA 3H8AA 4HN4A 2C91A 4X61A 4E2BA 2PCQA 2G50A 3UNDA 2PGFA 3STPA 5U4NA 1IE7C 1ELSA 4O57A 1EP2A 2WMJA 3QM3A 1OBAA 2FZMA 1TQJA 4YTQA 2V2DA 2D24A 1VFMA 5JBDA 1DTUA 2HJPA 4CU6A 2PD5A 2RDUA 1ITXA 1CGTA 4RNFA 3W7CA 4CVUA 4O28A 2OYLA 3DFHA 3S5OA 1GOXA 4QQUA 1UOKA 1T99A 4GX8A 3UR7A 3M46A 2ZUTA 1REQB 2E67A 3N2BA 4M8UA 4G7FA 2V30A 4AIBA 1KQZA 4F2BA 2Z6IA 1UR3M 3LQGA 4MZYA 1XG4A 2EXOA 1QPKA 3KEHA 2FJUB 2L5HA 5LHFA 6CGTA 2CLKA 3C3NA 4O8AA 3B0UX 4Q6JA 3EA1A 1NWUA 1X98A 1IF2A 6XIAA 4UTHA 3CT2A 3ZOAA 3QY6A 4P7LA 2Q8LA 4QSFA 4M80A 4O1DA 4PRTA 3H2EA 4NG3A 2Q6ZA 2JGQA 4JD4A 2ISSA 2VELA 3W00A 3OZYA 3GHSA 3LMYA 1Q6GA 4LUTB 2VC7A 2YB4A 2XIJA 2OZ0A 2HPIA 3NZRA 5GNZA 4MYXA 2E1DA 2REQA 5HJLA 4TIMA 1OT2A 3FN9A 1R86A 2XVPA 3KP1A 1SVDA 5G5IA 4UXDA 3QR0A 5E93A 4JICA 3N73A 3AMLA 2R82A 2PGEA 2VGIA 2YGYA 2YDRA 1QT1A 2FZNA 3EWDA 3B8UA 4JQ4A 3F2CA 3T4WA 2PDMA 1JR1A 5KMYA 1RLCL 3V5OA 1WO2A 2GJPA 3SCQA 3UCQA 2HVMA 4GFSA 4Q4RA 2GGHA 1UIPA 2W3ZA 3LNMA 7REQB 2GDQA 3OYXA 5IM51 5G1YA 4GNKB 1MDRA 4BF5A 1SSGA 5SWUA 4AZCA 1FWJC 3MHUA 3HGSA 1F3WA 4L1GA 3W01A 4NXKA 4EOUA 3FIGA 1DJZA 1ISVA 3FYPA 3M0IA 3SQMA 3W26A 5HAOA 4WQ6A 2P8BA 4Z08A 3L5LA 4K2SA 1OWQA 3DC0A 2QVHA 3T9PA 2GUYA 1RR2A 3QQ1A 2XUCA 4JX6A 3RM9A 2XN1A 1VPQA 3N4EA 3EBVA 2FH6A 1XFBA 4DUWA 1D3GA 3BZGA 2X7WA 1DBTA 1F4AA 1DXEA 4U4MA 1YDYA 1FWCC 2J8GA 4LTSA 7CGTA 4NZ1A 3QV8A 2CBIA 1HJUA 4IMEA 5DN1A 1KA9F 1F2JA 3L0NA 4WSKA 1GOQA 2YBVA 2I1OA 2EG8A 1YX1A 4PB3A 1ENUA 1I2PA 5LIYX 3AIWA 1EGVA 4HK7A 4L1WA 1PWLA 4W5ZA 2PLCA 1W3HA 3KLLA 1VEOA 3NCOA 3CV6A 3RM8A 3BAKA 4LALA 1RUSA 2QV4A 3MMDA 2NT1A 2ISWA 3BJFA 5LA2A 4JIQA 4WDXA 4RUBA 5I02A 5A6BA 3O05A 3W88A 1MNZA 2G3FA 4WDUA 4UTJA 4PFHA 1RD5A 4DXVA 4M56A 3TN4A 2X8RA 4EPEC 1TCDA 2J75A 1EJ7L 3GR8A 2BX7A 4DO4A 2VEIA 1JZ6A 3PJTA 4UOQA 5FIPA 5EFDA 2OU4A 5LIWX 1HQTA 2O7QA 2DORA 1EJWC 1QO2A 2RJGA 3LGGA 4K3ZA 3CYVA 2J74A 3TYBA 4N7QA 5DMNA 2NWSA 5DT7A 1Q7QA 2I5GA 3MA8A 4IGNA 1KRMA 3RO6A 3GVWA 5HXMA 1JQVA 1R3SA 2GJRA 4DX3A 4GO9A 5HK4A 4GUGA 3MDWA 1U2YA 3NNTA 3EB4A 3AMKA 4HT3A 1JFHA 2VNCA 2CLOA 2QLYA 2POTA 2E5DA 1ZQ5A 4BQ3A 3WF0A 1P0DA 4H8UA 2YW3A 2PDPA 5GJMA 1HFBA 2OGYA 5BROA 3QZAA 4WF7A 1RLDA 4REQB 5A8PA 4ZE4A 1BQCA 3Q67A 2ZICA 1OX5A 3HGOA 3PTQA 2OYKA 1V3JA 2O55A 1UA7A 4DNMA 2W91A 4L6DA 1ITUA 1W1YA 5DELA 5H6HA 3IAQA 3ITXA 4GYFA 1OADA 3NQEA 3T0BA 4ROQA 3G2GA 1HP5A 2C15A 4BR1A 4AU0A 3V16A 3ABSA 2PP1A 3IV8A 1OGGA 4CVWA 3KDNA 1TPC1 4FNUA 4JTTA 1F3EA 3S2JA 4GYPA 5ECUA 3RGTA 4R53A 1KFCA 1ZCOA 2YXGA 3VAVA 5EGRA 3CAWA 1HKVA 3WLKX 1QOXA 3IK4A 4I3GA 4FI4A 4LXFA 3DBPA 1TUFA 1YDNA 4BF9A 1JXJA 2V5KA 1SFSA 3SRKA 4CQAA 5J04A 1R3RA 1MXDA 5BMWA 5BXSA 3T1GA 1PSCA 1TFVA 1E9IA 2PZNA 2VO5A 1T8QA 3MMWA 2ZTKA 5EMMA 2PLKA 2MUCA 3LCFA 4K39A 2DU2A 3VOHA 2OOFA 1E3XA 3CTTA 4RNJA 3ZVHA 3H21A 4C1NB 1WQ5A 3HPXA 1U5VA 4BY3A 4Q8NA 3SN4A 2XHYA 3KVMA 1Q6EA 1QI2A 1FHUA 4ZXOA 3TJ4A 5AB3A 1X7IA 3DKLA 3W71A 1A5KC 4EF9A 4D71A 2DZUA 3NEVA 8XIAA 3VU2A 4IL0A 2NQ5A 3DFNA 4B5WA 1QI5A 4IX0A 4JTQA 4DXKA 3DIPA 5AN7A 3LX9A 3MCNA 3PPHA 3AZTA 3SSZA 4PRWA 3RG6A 3WJXA 4U2ZA 4YHGA 3VDHA 2VHLA 3W74A 4BWLC 4D9PA 2IW0A 2XN0A 1VKFA 1M7XA 5FAGA 2J9ZA 1XLMA 1EDQA 1W2VA 2CLHA 1GVYA 4OGZA 3IJQA 2OZ3A 3O9NA 1P4CA 5CSSA 4GJIA 1F07A 4LUIA 4B16A 3R5EA 1PB0A 3AWOA 3W27A 1E56A 2ZC8A 2XVLA 1QAPA 5CZJA 3VM7A 1NEYA 3VIKA 5C9XA 2V2CA 2REQB 2WJDA 3W70A 3TE9A 1XYMA 4M5PA 4IJRA 2JALA 1Z8AA 3FW6A 2OVLA 1ISXA 2WK2A 1TVLA 3UWUA 3AS3A 2YYTA 3FX4A 1ML1A 1ESWA 3CHEA 1VFUA 3WD4A 2YCKX 2A3HA 1NAL1 3VNKA 4XVDA 4UTMA 4KWSA 2DZAA 3LRMA 1KNWA 1NARA 3VM5A 4GY1A 1UD2A 4PMZA 5FEXA 3NL3A 2QDDA 1PUDA 2XVNA 1UBPC 2QIIA 4JX5A 2C6QA 3H2OA 4NAFA 2PUZA 1ODZA 5DXXA 1X39A 4TMBA 1DWHM 5E5CA 1X1ZA 1JVNA 3C0QA 3IJ7A 4OBSA 4Q33A 2XVGA 3VFLA 3KRBA 2WSYA 1HW6A 2CKRA 2EPHA 2YIHA 1XLAA 1GVFA 2CEQA 4K1GA 3D0CA 3PR2A 3GU1A 3ARPA 2FTYA 1CB2A 2R9RA 4HSOA 2CZFA 4Q8TA 1J0IA 3OODA 3WCZA 2QUNA 3V5FA 1OZQA 3MT1A 3AXKA 4IG2A 3LK6A 1GOKA 2VL4A 3W7RA 1A50A 2AGTA 5CZKA 3AIRA 4UBPC 3VIHA 4QDPA 3UZXA 5B7ZA 1PIIA 4PTXA 4A3QA 2ACUA 5DQPA 1XLEA 2HBVA 4OOZA 4HU4A 3DECA 3GTXA 1R3YA 3SIMA 1JGIA 2XSBA 1T41A 2EKCA 1XIHA 3N2TA 3UJFA 3NQDA 2YW4A 2OXNA 3TYAA 2GK1B 5A6KA 1XV8A 2YSWA 2TRSA 3TSDA 1CYGA 1JUEA 3T7VA 3GS6A 1FP8A 4PN2A 5DY2A 3UZWA 4K38A 2DUZA 2PU1A 1XYAA 4LBSA 5GNYA 3THQA 4L65A 3QHMA 2PWUA 1B3ZA 2INFA 2Q3OA 3UJ2A 2ADAA 1WKEA 4GX9A 5H91A 1DHKA 3ZSTA 5A2CA 1H41A 3WFZA 1H7PA 1E73M 4GBDA 1FWBC 4ADUA 3ARYA 2PAJA 1GT8A 1B3OA 2FZBA 2WCAA 3WEMA 3WBWA 4KWOA 3FEMA 2VC5A 5IXEA 1P0KA 3NQCA 3CV2A 1V7YA 1CZ1A 4MG4A 3W1TA 2WHJA 2HZGA 3LSCA 3SQLA 3BMWA 2GQ9A 1QHOA 2GQ8A 3GXTA 3N6HA 1A3XA 4Z0JA 1NOFA 2GGJA 1DKWA 2VEGA 4GYKA 4FALA 5ABHA 2A5HA 5CC5A 3W1AA 2G97A 4ZOAA 2J66A 3UEQA 4XSLA 4N0RA 5REQB 2C1HA 2PDGA 3SECA 3N17A 3W3OA 1AW2A 4JIHA 3WLMA 2PDWA 2FFCA 3S1XA 2PDNA 4PMVA 3RMJA 2VCCA 3VD7A 3TR2A 4LYRA 4TX9A 4WIWA 1EJRC 2YLAA 1TRIA 1AZ2A 4F0MA 3GXNA 3ZM8A 4LV4A 2FPTA 3LLXA 2ZXBA 1M01A 1O1HA 3MSRA 4UR7A 2J25A 3APTA 4XIAA 1W9DM 3UJEA 2WZHA 8CGTA 1E4LA 4HZMA 4H83A 4CU8A 3VGHA 3KOFA 1G5AA 1SM9A 1WYIA 3R13A 4A2SA 2A79A 1RY0A 2BFGA 3RF9A 3DBNA 3ALGA 1KM0A 4BQ5A 4GZIA 3FJ4A 4GVIA 1XC4A 1WXYA 2PDLA 5T8GA 4DIAA 1E71M 1XXXA 3N04A 2XIMA 4YIWA 4HNNA 2DZVA 2V38A 3ANYA 3T0CA 2YCEA 3N4FA 3OLEA 1THFD 1OFDA 3AIEA 3F5KA 4Q4QA 1T8XA 4E3VA 1VHNA 4WJXA 3EXSA 1U5JA 1DJGA 4CLMA 4UUIA 3BOXA 2WZTA 1GUVA 4KEUA 4G2DA 4MNLA 4AEOA 2WMKA 1SFLA 2W0UA 1M1BA 4UC5A 2DZBA 3FGCB 3OEXA 3WENA 4AVFA 4CQ9A 4GIAA 4CD4A 3WMSA 1U1HA 1MW0A 3P3BA 4GQ0A 4DJFA 2DVTA 2HWGA 5GJNA 2QGHA 2VENA 5HINA 4JTCA 2VR4A 4IJBA 3T44A 1KM5A 1LRNA 3OZPA 5U7SA 3UG4A 2WXDM 3CMFA 3ANUA 1LQAA 4IFOA 4KESA 3NXFA 1H11A 1K02A 3W7EA 2ZDRA 1VFFA 3ZSSA 3U0HA 2F2HA 4C6IA 2V82A 3A4JA 4L64A 4GO8A 4ZO8A 4EIVA 4B92A 1E1CA 2J9XA 3GKAA 4PE8A 1C8YA 2ZX6A 3PG9A 4KKXA 2EJAA 3KVLA 3W7MA 2J8FA 3HPSA 2I7GA 2F2KA 4WCJA 4DEFA 5M03A 2WZMA 4WRHA 4B4HA 3QPYA 4DYEA 3PUGA 4WGXA 3PPFA 1XYFA 1BSLA 1B4KA 3G8EA 1BXCA 2DT1A 1A5MC 4AVNA 3BGGA 1MRQA 4MMWA 5ABTA 4FLQA 4ZVJA 4YXGA 4CNOA 4NAFB 1TMLA 2OQHA 1RBAA 3LHWA 3BLPX 4I9AA 3INPA 1KCZA 1ZALA 1UZ1A 4TUFA 3UWQA 4S2CA 2P3ZA 1XQLA 1FQ0A 1LOQA 2Z7KA 2YPIA 3GZ3A 4DQWA 2BODX 3ONBA 4DF2A 3MV11 2YBTA 2PDJA 3WMBA 4DNHA 4YVPA 3BUVA 5CSRA 1DOSA 2V81A 1MFUA 1CXIA 3YPIA 4GUIA 4PR4A 3ITTA 4GZEA 1CGUA 4ZB0A 4IG2B 3BJSA 4YYCA 1FDZA 4XVEA 3R79A 2EPMX 4ZB2A 1V03A 3WBAA 2DIEA 4CUCA 3EXRA 2BWGA 1XYBA 3MDUA 2YLLA 2R8WA 1H7XA 1OC6A 3KM8A 3EA3A 4X22A 4MUPA 3EMQA 4DZHA 3NSMA 1YHTA 2ZZ6A 3P0WA 4TU1A 1Z48A 3O3RA 3PY2A 1TTQA 4UR8A 2UY5A 4LJ3A 3HO8A 4JTDA 3M5XA 2OZ8A 2CZVA 1K1DA 2J7BA 3Q65A 1UPPA 2GVYA 3MPGA 2A3EA 2JBMA 4X60A 1SSDA 4X9YA 3VC5A 3EWBX 1J6PA 5C6MA 5E6YA 4MTVA 1GPWA 2QPSA 1J10A 3CUXA 3L21A 1PZ3A 4AHQA 3HA1A 3UWZA 1EA0A 4QISA 4HOZA 1PXGA 1RBOB 3A21A 1IT0A 2BLEA 4LVFA 1LOLA 1WX0A 1CXKA 1SZEA 4PA8A 2OWWA 4Q4MA 3MHGA 2F6XA 1TE1A 1UP2A 3H54A 1UIOA 3C0JA 1F74A 2RUSA 2WWCA 2FTPA 3BG5A 2CETA 1TWZA 5LIXX 3TONA 4MNKA 1JCNA 3ZJ7A 3WH7A 5D32A 3B9OA 3TSMA 1RA5A 2YXXA 5FJUA 2OELA 3URAA 5CPMA 3WDQA 3S2NA 3UPMA 3H26A 5CAHA 4K68A 1NWTA 2X0HA 3MJMA 3FXYA 1OY0A 3CK5A 4O1CA 3BLIA 1BYCA 3F03K 4OWGA 1DJQA 4K7YA 1TPUA 4DPPA 1PKYA 1SPQA 1EUAA 4XKYB 3RPTA 1C7TA 3G22A 3LPOA 3W6MA 1K7EA 1Q8JA 3N13A 5E0KA 3W1RA 2DJXA 7XIMA 3WJYA 1XJBA 4N9BA 2Y8UA 3WH8A 1LDCA 2WMGA 1RPKA 2HSAA 1RK5A 5BU6A 4JL1A 3KL0A 5F7UA 3W7NA 4ZSUA 4M19A 2BOGX 3VK5A 4NZCA 1G7UA 3NUKA 1KO0A 2VDHA 4DBSA 5T9CE 4YPJA 3GNOA 2ZZ3A 4LUJA 4GFIA 1S2TA 3FDKA 2ZE0A 1DIOA 2D22A 4XZMX 5I0DA 1G4PA 4GVGA 4W89A 2HVOA 3LPPA 1BRLA 3L9CA 3NOEA 1Q63A 2IPFA 3GXPA 1F8MA 3LLDA 4B3ZA 3B8VA 2XH0A 3PZOA 5MHBA 3PZIA 3Q45A 5A1AA 1K6WA 3PANA 1O7AA 3KZPA 2NQHA 1B9ZA 5C55A 3T07A 2AMGA 4HB7A 3NFUA 3URQA 4NSBA 2J62A 3GDBA 1CT5A 3GVRA 2FHFA 2ALDA 3QKZA 1CGXA 4GC3A 4NX0A 1U5HA 3PBWA 1OG6A 2NVCA 2Y24A 4E5TA 3OZOA 1JZ4A 1XH0A 4WDWA 3GDKA 3K8KA 1QVBA 3WLRA 3W7KA 2I5QA 1E0TA 3QV7A 4UCGA 1E6QM 2YZ5A 4N9DA 2NXIA 3EWUA 1LL4A 1U22A 5IFTA 2Q01A 1TVPA 3M5ZA 4XZHA 4DHGA 3NO1A 3NQVA 2WMIB 5LGZA 4F9DA 3ZR4A 3CYJA 1P6BA 4PMOA 3UPWA 1M7OA 1TV2A 5BRBA 3TIMA 4HYWA 4E8DA 1OABA 2R14A 3I6TA 3W2NA 1BEUA 3LOTA 2OO0A 1EKOA 4XAFA 4AD4A 2RKXA 2Z2BA 3EEZA 1B1YA 4DY1A 3C0SA 3TUUA 1L8PA 2OO6A 1PX3A 2VMFA 1BVNP 1V6VA 3DENA 5LZLA 1EB3A 3MI2A 4FF5A 3TXZA 1XSIA 4O0ZA 4UFKA 3F7JA 3W75A 1E1CB 1UR1A 4HTYA 4GGHA 1JZ8A 5DMMA 1KRAC 4AX6A 4AVOA 5K9CA 1WDPA 2QVNA 2NVDA 4L4MA 3CV1A 2I17A 4IWWA 2PSNA 3H55A 1B54A 4RDVA 1QI4A 2YCJA 1Q6FA 3FHQA 1UMYA 1HGYA 2A3CA 3URNA 2AKMA 3TMQA 2AL2A 4HK5A 3KTCA 2VZSA 3CM4A 3WBXA 3MUZ1 3IRDA 2ATMA 5DMLA 4JIIX 3VILA 4Q4PA 3VX1A 1UC4A 4Q8QA 2C14A 1S2AA 5F2MA 5D9OA 1L2UA 3Q37A 4PEKA 3SCPA 4TV6A 3THAA 4HCHA 1GW9A 3ARSA 1VP5A 2F61A 2P50A 3RDKA 4J3XA 3QXBA 4JKLA 4AYSA 3VCNA 2R1KA 4I5UA 3HIJA 4EXQA 4DVOA 3MSYA 3A4WA 2PPGA 4WGHA 3STFA 3QOMA 3VMPA 3EWZA 4NF7A 5DO8A 2GJXA 4UOZA 7TAAA 1M7JA 3CHVA 2WQDA 4URIA 3TU9A 3PJUA 3WMCA 3JR2A 4FXRA 3QPEA 4A8IA 1G4SA 2YA2A 1T7LA 4JQAA 2NQJA 3I3EA 2ZUMA 3CU2A 3RUBL 1KM2A 2QUTA 5AC7A 1RPXA 1NWRA 2WC7A 4C6BA 3KX6A 2DZXA 2NXGA 2GGIA 1F9CA 4K1WA 1YDVA 3WJZA 2VX6A 1L0PA 3WKZA 2EJ1A 2PTZA 1VBRA 3MJYA 3WDIA 2ZQ0A 1S5VA 4F48A 1TWWA 1J96A 2VEFA 4UTLA 4M29A 3NZGA 3QFEA 3WQ8A 3WDPP 1UKPA 3E38A 3PULA 3OZMA 2PDYA 3WY1A 2JEPA 3MHFA 1ME7A 3S2MA 3BCJA 4XZBA 2YDQA 4QLJA 3S46A 3GM8A 3N2OA 2YFNA 1OF8A 1FWSA 3B06A 1VAHA 4NRRA 4N6FA 1IXNA 1A0EA 2GFTA 2H9AB 3LM3A 3GR4A 4H04A 2J7HA 1B3YA 3M44A 4UFIA 3SCRA 1KFLA 4IOTA 4JN7A 4TX8A 4BK9A 1ZBVA 2QJMA 3MO4A 1ZRQA 1DXIA 3L5AA 1FWEC 4J2PA 3L12A 1QNSA 1TV7A 2J7CA 2YOCA 1GWJA 1S5TA 2DZPA 5I07A 1EH9A 3SO7A 5CSYA 3D6NA 1RJRA 1QI3A 3H4WA 4FB7A 2Z29A 1XLFA 2UY2A 3UW6A 5LA1A 2PTYA 3GNPA 1DQWA 4LRTA 1JRBA 5I3HA 2QEZA 3LCXA 4WVXA 4LANA 3CMGA 4YTSA 1IXPA 3FKKA 1RHCA 1QOQA 4NHVA 1WV2A 3ATYA 2HK1A 1EWDA 2FTWA 3CZLA 3AAMA 3FVDA 2ABAA 5K2ZA 1GQLA 1QPNA 3RJYA 3FOKA 4B2DD 2DZWA 1A5SA 4K6AA 1TV4A 1TPWA 2JKEA 3TC7A 5HMEA 4B15A 1V77A 1X1NA 2W4XA 1UW9A 1SYTA 2H8ZA 3CQKA 3NQBA 4ZE5A 1JF6A 1OD0A 4UFHA 3KUMA 3C4UA 4JEJA 4G7EA 4O1EA 1VGAA 2YL5A 2R1MA 4JTRA 1NH6A 1OYCA 4OBTA 4DI9A 1R85A 4RXGA 2GJLA 2V5CA 4I7UA 1EC9A 2PBOA 1XS2A 1PZ0A 1P7TB 2PDKA 4ZQOA 5BNKA 4S3DA 4J5NA 2XSXA 4J3SA 4JQ3A 2R1NA 2YDAA 1X96A 1XH2A 2RGLA 4LUYA 1OEPA 1FWGC 1LT7A 1A47A 3L2IA 3FA5A 1WOBA 3OHMB 4GJJA 3B04A 1TMQA 1FY6A 3MWAA 4RR4A 4YCOA 3FDGA 2RHGA 4IIFA 4WOZA 2A7PA 3SSJA 1GEQA 1V6UA 1O68A 1IEQA 3S5YA 3PSVA 1GHSA 2VWSA 3B8TA 3F5JA 3UZJA 1KGUA 1LQ2A 4Q3MA 4A05A 3H7VA 3R43A 1EDGA 5FJRA 4I6KA 4RZ4A 2OOGA 5FF7A 4I9MA 5LHEA 4GQGA 5M5DA 2QULA 5TD4A 2XFWA 3ITYA 3LB0A 3GWQA 4O11A 3C52A 4AD5A 1KLZA 1QNOA 1CNVA 1B0IA 1LWIA 2BHUA 2XN2A 5EKYA 1JPKA 3GD6A 3IVSA 3N15A 3AQUA 2CW6A 3QY7A 2RJHA 4OV9A 1P0EA 5CJ5A 5I24A 3JZUA 5A2BA 3BW3A 3KFTA 3UGVA 2OYMA 4JNMA 4LAUA 4MOZA 4XAPA 5KZDA 1IV8A 2AL2B 1MYRA 4WK9A 3EB3A 4YN5A 4HPXA 1ISYA 2IQ0A 2WB5A 3T2PA 1LBMA 3T08A 4E4PA 3ZWSA 2VP8A 5EPDA 2AAAA 2G3JA 2Y7FA 3PNZA 4Q7BA 4PFMA 3G1HA 1X8CA 4JHZA 1SO6A 2J8TA 4YVXA 1GGOA 5D09A 1B30A 4L4PA 5EMJA 3EDDA 4GACA 1EYWA 3BWWA 2Z7GA 1UWTA 1JDEA 4F2UA 1QWGA 1B2YA 3O15A 1MEIA 2HRWA 4C91A 2GJXB 1O94A 1EGZA 3CIXA 1B31A 1M41A 4RKAA 4LSBA 3GIQA 3A5VA 3KDOA 2WJZA 3PS7A 1JI2A 1UD4A 1XDMA 4F3HA 4DJDD 3ISIX 4J4KA 4HNLA 4R27A 3VOFA 5BYWA 4TVDA 3CHFA 4L9ZA 3WZ0E 3FNDA 2JEQA 1Z41A 1MZHA 2RGMA 3ES8A 1G01A 1KTNA 2GVEA 2HDJA 1DQXA 3AI0A 3QHNA 4BQ4A 4TMCA 3TZFA 1HO1A 4CCZA 3MI6A 3RX4A 3DYMA 4S23A 1EQPA 2V67A 1OB0A 5HQMA 4PULA 1HJWA 1US2A 4IMAA 1E6PA 2XM2A 2C0HA 3WQ4A 1R6WA 2GSHA 4TQTA 4HA3A 3V36A 2ZWZA 3EOSA 2NUYA 4C5YA 3P6LA 3AHZA 5AHLA 1SUXA 3WELA 4IPLA 4DAIA 3HGJA 3VNZA 1OSEA 4QQ3A 4A3UA 2PGWA 3MANA 5KSWA 1DXFA 3R94A 1EO5A 1HVXA 3ES7A 2IXVA 5I79A 4B5TA 4ATLA 3RMEA 4XK2A 1HO4A 1UHVA 3B9DA 4FX6M 3VGDA 1BYDA 4GINA 1SJBA 3HM7A 1BYBA 3LXBA 3PC0A 2VVNA 4H9YA 8XIMA 2HVNA 3SEPA 2R94A 3ABRA 3GG7A 3P7YA 4WSHA 4QAWA 1HKWA 1I9CB 3OGRA 3FA4A 4P8VA 4H8NA 4HHLA 4Y9OA 2GPTA 2Y6ZA 5K4ZA 4UZUA 1ZSXA 3LCIA 2BVWA 2BOEX 4PB4A 2VUYA 5A94A 1OM0A 2B7PA 1S39A 2YL9A 5DX7A 1L6WA 1OFAA 4LVBA 1YTEA 4HBKA 3NL5A 1CGWA 4HA4A 4GIRA 1HXJA 1NDWA 2WO5A 4HNTA 1UD3A 3O2LA 1UKTA 1CXLA 1OX4B 3BGJA 3WEOA 3NQ8A 1I2RA 1E6SM 3FSUA 3BTNA 3W7JA 5KZMA 4KRTA 1BFNA 4IGSA 1K8ZA 4RXFA 2A3BA 1V4YA 2D73A 2DIKA 1E9ZB 1L2QA 2OCZA 5FSDC 2VFDA 4IFKA 3W53A 1XIEA 2Z6JA 3L65A 3APYA 5BWAA 1AQHA 3EGJA 4G5DA 4LT9A 4DN1A 4IL2A 2EPOA 5I6SA 1H0GA 4C6MA 2GWGA 4NYYA 3M6YA 2ZRWA 1XIGA 2IKHA 1VFTA 1Q6QA 1XLJA 3GHRA 4RDWA 4WOQA 1JZ2A 3GTIA 4H41A 4LY4A 4M82A 3C86A 3G1AA 1RQEA 3GDMA 1GK8A 3P5YA 3RLGA 3S6OA 4GBUA 3EOOA 1PX8A 3LG3A 3AXIA 3HG3A 1J12A 5ABGA 1VRXA 1W8GA 3FHAA 3VIIA 4HKPA 3QZEA 5HNRA 1BYAA 5EBUA 3I4KA 1M04A 4I9TA 2INZA 3GO2A 2CCRA 3N18A 1CCWB 1Q4WA 3WG6A 4Y8FA 4EK7A 5C7HA 1EJTC 1CENA 1O6IA 2OQYA 2W6RA 5M1TA 4QG6A 4IPPA 4LF2A 3U5YA 4D6HA 4A3RA 4NU7A 1ZAJA 1DJXA 3N25A 3PWGA 1A0CA 1NFBA 5CQ1A 3WEZA 4AZ6A 2D3LA 2ZDSA 4ERAA 4QTGA 3OIXA 4EXAA 4Q6XA 3DCPA 1W8SA 3MVTA 1AQ0A 1H1NA 3GXIA 2R1PA 2ZZ7A 3S9IA 2VFFA 2XGIA 1JPHA 1C8VA 3R8RA 3GFYA 1MEWA 1OK6A 4Z17A 3N29A 1ZBCA 3NAVA 1JFXA 2Z27A 1LF1A 4OIFA 4JFTA 1DQUA 5KINA 3K4WA 3VUSA 1Q6RA 4P7RA 3UVAA 3TK7A 3CAVA 1W9BM 1AQMA 3U2EA 4Z1CA 3M0XA 3SCTA 5K7JA 5EMLA 1PWMA 2VGBA 4S3EA 4QE4A 1Q6CA 2Z26A 4DLFA 3BG9A 1ZZMA 3DHFA 1UR4A 4F0KA 2DDXA 1TMHA 3BLLA 1W1A1 3CGTA 4B91A 3WD0A 1SQ7A 1GZ1A 1EIXA 1CLVA 1JULA 4FO4A 3UZZA 3I6RA 2VX4A 4DO7A 1I2OA 4FNRA 1CLXA 2ZKMX 1E5JA 3KBNA 3BXWA 3WH5A 2WC3A 2ZZ2A 5JU6A 3C2VA 4BWLA 1TSIA 3WD3A 1CBGA 1H61A 1V6YA 2OLHA 1OFOA 2PTDA 3PNUA 3UXIA 1W0MA 1P0BA 3E0IA 4A8NA 4ONVA 1GW1A 3WFAA 5CBBA 2F7FA 1E1FA 5EFFA 1TZZA 4KIRA 1XICA 3UBPC 3GW3A 1B57A 2V8ZA 3IUIA 4KCWA 3QN3A 4MF4A 1EO7A 4M51A 4TV5A 3LGDA 3OP2A 1UWSA 4IXXA 1ZS2A 4L80A 3UWEA 5AC6A 1S3HA 3W7OA 1W3LA 2HXUA 1F6KA 1W9UA 4HSHA 1JEZA 1TR1A 4XWUA 1SJDA 4JCLA 2NVAA 4U5IA 5A6MA 4DUVA 1AVAA 4QP0A 2OT1A 3SCVA 2P76A 1BKSA 1Y5WA 1E55A 3EX2A 3KWXA 5JMUA 1XBYA 2XFFA 3CBWA 1E40A 4IIHA 1F73A 5J5DA 1K8YA 1YPXA 4CN4A 4F8XA 1DJHA 3WO8A 1HT6A 4Z2JA 1H2JA 4KFPA 1ONXA 3QOKA 4FXSA 1T40A 2CYGA 2INEA 4ECLA 5EMKA 4IP7A 3AIVA 1XLLA 1GG0A 2CNCA 1QMLA 3ABZA 3CL8A 2D3NA 4J40A 1L6SA 2G95A 3P0XA 4L6HA 3PZQA 5AY7A 1A4MA 1KLYA 3MQTA 1FH9A 2OODA 1ONRA 2ZBTA 2A85A 4U3AA 2VM8A 1OHLA 3KBMA 4ZFMA 2FGZA 1KGWA 1P6WA 1A4LA 3TCSA 5LNVA 2CLIA 2WMFA 4HD5A 3LY0A 4R7JA 2DT3A 1KBLA 3MUAA 2A7RA 3MKKA 1J0JA 4LUSA 3U8GA 2E8ZA 3IEBA 3W1UA 4KFNA 1X1OA 1K70A 2NV1A 4PGLA 3M6DA 4WJ8A 2DY3A 3CZ8A 4FAMA 1FTXA 4IPIA 4U31A 1JYNA 2VEMA 2EKGA 1ADSA 4ATWA 3TNBA 5A6BD 3CPRA 3AXMA 3OVRA 4P8UA 5AVNA 3QQ0A 3SADA 4LAKA 4Z1AA 2NV2A 3BOFA 3WK1A 1FBAA 4H9VA 5DEZA 2V69A 4X0NA 3B0YA 5I00A 3B4YA 1FKXA 4LS2A 3AXXA 4HPHA 1MWOA 4ZBCA 3WNNA 4CCDA 5E0FA 1MW1A 3BV4A 4HP5A 3N3TA 3H23A 2HS6A 1DV7A 4GE8A 1W1TA 5J8LA 3W2MA 3SN1A 2PWFA 1XD0A 3WF4A 4E2VA 5L6UA 1C9DA 4GCAA 3P81A 4KT2A 3LCGA 2FQIA 3KAOA 1W56A 3G24A 2Y2WA 4I7VA 1KXTA 2QR6A 4Q8MA 1XBZA 3DYPA 1GNXA 3MUCA 2CKSA 4Y9NA 2YA0A 4GQBA 4P7OA 9RUBA 3RO8A 3QGKC 1H1YA 2MNRA 1YKWA 5DCEA 5DMYA 3TDFA 3TKFA 2BXZA 1NSJA 5IDZA 2R6OA 5EMUA 4HVXA 1J5SA 4IH3A 3PBUA 1KFEA 4S38A 3TP4A 3BGAA 4OHQA 5LYRA 5FJPA 3V1PA 4EE9A 3NDOA 2G4JA 3CWNA 1C8XA 1RV8A 1OG0A 4ML9A 3D47A 3N9RA 4HZ8A 1O66A 1OK4A 3G8RA 2GUBA 4OUEA 3R58A 2P88A 4JYDA 3T0TA 3AS1A 4IISA 1I45A 2ALRA 4FSAA 4YL2A 2OJPA 2XFRA 5HQLA 2J77A 2E5BA 3ORWA 4QDMA 3WQOA 4MFEA 4GJ1A 3NGFA 4O1BA 1JGMA 3ARRA 3S9ZA 2D1ZA 1GPFA 1K77A 1BF6A 4R85A 1GONA 4GCXA 3TW9A 3FAWA 1MDLA 2WKJA 1C3FA 4HNVA 5C54A 2E6FA 1YLVA 1YNPA 4RZ6A 4D6JA 5HUOA 2QDEA 3RK8A 1A53A 1ADOA 4XUYA 1A5CA 3T40A 1UR9A 1CEOA 1TV8A 3TZNA 2DFAA 1R46A 2QUUA 1V0KA 5KITA 5DBTA 2DZSA 3GNRA 4HK6A 1WOAA 2J47A 3SUSA 5A6LA 4AWSA 5AZ1A 1GQNA 1KCXA 5F1VA 1P5BA 1WKYA 4MADA 5G4EA 1EXPA 3REQA 1ZJHA 3F4VA 2ZUWA 4HYVA 3AZSA 4XBSA 1AW5A 2HS8A 3R6IA 1E0VA 2NX3A 3VKKA 3DKJA 4O14A 3TH6A 4UB9A 2Y1HA 3HV8A 4JTFA 2OGJA 3GW0A 3AHTA 3BV7A 3M7WA 4GKTA 4XO7A 1M5WA 4R3UA 3E9AA 1XYCA 1N2VA 1E3ZA 4CU7A 4N6EA 3RX2A 4WY0F 2PF0A 4GIYA 1F7BA 3JZEA 3QYQA 1A5NC 5KZEA 3D46A 4B3KA 1DJIA 4HOWA 4LY8A 4G1NA 5XIAA 4WY0A 1R3TA 3MC5A 4A21A 1AD4A 1SZNA 3CS2A 1D3CA 4KF1A 2PEVA 3LCWA 1K4GA 2VOTA 4FZIA 2X7VA 3M0VA 4Y6GA 3AYVA 2F8QA 4L4OA 3M