4NQ1A

Legionella pneumophila dihydrodipicolinate synthase with first substrate pyruvate bound in the active site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
289
Chain Sequence
b'MFSGSIVALVTPMRNDSVDVHHLRELVEFHIAKGTHALVAAGTTGEAGTLSHSEKLLVIKTVIEQAKERVPVIAGTAMNATKDCIELTQQAMEYGAHAALIMTPAYIKPTQEGLYLHYSHIAQSVAIPIILYNVPGRTACDMLPETVARLAKISNIIGIEATGQMTRLQQILRLCEGSIDVYSGDDLTAAQWLLSGAKGVISVTANVAAKLMAKMCDLAMDDDQAGCLRIQEQLMPLHELLFVESNPIPVKWAMKKMGLIGGELRLPMTELSEKHHQALEKVLKNLELI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
publication title Legionella pneumophila DHDPS: The First Case of Non-Lysine Inhibition in a Gram-Negative Pathogen
rcsb
source organism Legionella pneumophila
molecule tags Lyase
total genus 104
structure length 289
sequence length 290
chains with identical sequence B
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2013-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nq1A00
3W7EA 1WA3A 4O0ZA 1H7RA 4DF0A 3NO5A 3NPVA 4O11A 2ZRXA 3A9IA 2GJNA 4O18A 2QCHA 1TPVA 4OE7A 4A3UA 1XKYA 3Q37A 4BWLA 2IQTA 1T0OA 2VFHA 3G1XA 2CLIA 3V75A 1A5AA 4JTUA 4O19A 4IMEA 3AO0A 2QJGA 3R5EA 1SO6A 2Y7GA 3YPIA 5E93A 5D2TA 4JX6A 1SW0A 3NQFA 4RJEA 4UTMA 3GNDA 4ONVA 4Z1CA 1XC4A 5LNUA 2BWGA 3HQ1A 3ABQA 4JXCA 1G6CA 4FXSA 3W76A 5LKYA 1G7VA 1XCFA 4IMFA 3RNDA 1QCWA 4N9EA 4IPJA 4S1FA 3C52A 4O50A 3W7IA 3R13A 3HGJA 3UYCA 2TYSA 3PM6A 2ZA2A 1F05A 3NDOA 3PB2A 4UTWA 3N14A 3M0ZA 1KBIA 4U28A 3W1XA 2CZDA 2X16A 2HTMA 4MYXA 3ZWSA 2A2IA 3JR2A 3P62A 1R2SA 4JYFA 4HSOA 1YDVA 4JTJA 3W6YA 2G95A 4GNJA 1LRNA 1UBSA 1QO2A 1H61A 1XBYA 2VFGA 1OHLA 4LC6A 5L6UA 2ZRZA 1OJXA 4O8RA 2Z6IA 2FPTA 5DCEA 4QNWA 3NL5A 4C1LA 2B7PA 1OFRA 3LOTA 5KTLA 1OYBA 3QW4B 1JQVA 2WOQA 4YCPA 4JX5A 3ABOA 3KVLA 5E0KA 1F6KA 5AYYA 1OFPA 4WD0A 2A21A 5BMXA 4A2SA 1VHNA 3E02A 1SZNA 4DELA 3W7HA 3RU6A 1GTEA 3DAQA 4NXSA 1LORA 2Y62A 3MHFA 3O63A 2Y85A 2NUWA 1LZOA 5K4XA 3P81A 5T26A 4PODA 3P8IA 1NEYA 1SZEA 4UC5A 5DCBA 2ZYFA 3W73A 1AK5A 3M5XA 3O06A 1OX4B 3HPXA 1IIGA 1L6WA 1I8JA 3U8GA 2BZNA 3MHUA 2A0NA 4O10A 2ZBTA 3LXBA 3LLFA 1TJPA 2PURA 3KRZA 3M16A 1FWWA 4WQ6A 2QCEA 5HWJA 1O94A 1DHPA 1ME7A 3DFNA 3LBCA 3G24A 5LNSA 1HL2A 3S5OA 1VR6A 2JK2A 5D05A 2OCZA 5F4SA 2X30A 1MXSA 1VH7A 2H6RA 1EA0A 1C9DA 2ZZ7A 1TRIA 3GXPA 2ATSA 3GR8A 3H55A 3GB6A 3G8EA 4XTDA 1QOQA 3GXNA 3HG4A 3EKLA 1DOSA 3TJLA 1H62A 2BXVA 1DORA 2FQIA 3OBKA 3EWUA 4ORMA 2NZLA 2V82A 1ZAIA 3DENA 5F2GA 1IXNA 2A4AA 3PBVA 4Y8FA 1YDOA 4ZVJA 2R8WA 2YPIA 2ZA1A 4AVFA 3CM4A 3T78A 3CEUA 3G18A 4JNMA 4JDBA 4R7JA 3S1VA 3SGUA 5I3FA 2XFWA 4FIRA 4UR7A 3PG9A 1SZFA 2ZRWA 4O4WA 3BGJA 4PA8A 3IRDA 3SJ3A 1QFEA 4LT9A 4XBKA 3NQ2A 3G1VA 4AEOA 2DORA 1EEPA 2FDSA 1JUEA 1KA9F 3NXFA 3BLIA 4JTSA 4HNTA 4RR4A 1GVSA 1JUBA 5F2LA 5EMUA 3GYEA 5H91A 3TR2A 1C8VA 2A7PA 2VXNA 3G8RA 3THQA 2YX0A 3EWBX 2C13A 5DBUA 1AMKA 3LCFA 1LTDA 3OVPA 5DLCA 5CSSA 4AWUA 1ZCOA 1LOQA 3WJSA 3DFSA 4XBSA 1TTQA 4FNUA 2I9EA 4MIMA 3LV5A 4GE8A 3W7DA 5KINA 3MBDA 2OX1A 3S6DA 2Z6JA 1H60A 2V2CA 1JRBA 1UUOA 2Y70A 2G5WA 2E6FA 4JY8A 2AGKA 4QITA 1VYPX 2E09A 3IGXA 3LV6A 4PCFA 5K2ZA 2FTPA 2JGYA 3ELFA 4OT7A 2EAWA 3BARA 5D38A 4N9CA 3MYOA 3PAJA 3GDTA 1KTNA 3W75A 4FB7A 2HS6A 2ZTKA 2GOUA 3LDVA 3M5VA 3NVTA 4BF9A 3LHZA 5BMWA 3P5ZA 1RV8A 3W84A 5K9DA 1VHCA 5HR7A 1KM3A 3W2LA 1Q3NA 4UNLA 4AWTA 1N8FA 4O1CA 1B9BA 3W1NA 4K8EA 3S5ZA 3IGUA 2P10A 3QQ1A 2VFIA 4KFPA 3EX1A 3W1AA 4E0CA 4Z1DA 4ICNA 5EA9A 1U5JA 3CHVA 1KM4A 5HINA 2ZFAA 1FDJA 3CWNA 3LXCA 5DBTA 3N9SA 3HF3A 3N2XA 1RVGA 3NPUA 3STGA 3W1TA 4ADSA 2P0OA 3A22A 3PR2A 1QPOA 4PFMA 2PC4A 4CNNA 4L4LA 4MY8A 1FCQA 3IIPA 4IWWA 3WFAA 4FEZA 2ZTJA 4N4QA 4UFHA 3P8JA 3L5AA 3BG9A 4XZ9A 2B7QA 3TQVA 1XXXA 3NGJA 1W5MA 4PL2A 8TIMA 1JVNA 1ALDA 1ZFJA 3W7LA 5LHFA 1Z44A 1EP3A 2J9XA 4QIUA 1TPWA 4NZFA 1HO1A 5FF0A 3N34A 2FPYA 3TROA 3KFTA 4NU7A 1OX5A 3W3OA 2A6NA 1W5PA 2Q3OA 1QNVA 1DJQA 3TFCA 3UWZA 1H7OA 2VFDA 3KVKA 3LCLA 3IVTA 1TPEA 1DL3A 2PE4A 2QCDB 2EPHA 2WQPA 4Z0JA 4CNOA 5BNKA 3N9RA 2Y7EA 3TSMA 3NQ6A 5HQEA 7TIMA 1K3UA 4FIQA 1QPNA 1XDLA 4AH7A 4LVAA 3R89A 2V30A 3SZ8A 1VYSX 2YSWA 3BK0A 2WPBA 1G4PA 1YPFA 3GKAA 3Q94A 3LHYA 4JS3A 4LC8A 1V5XA 3HBLA 2CLFA 2YXGA 2QCNA 3VNDA 1H7NA 3RMJA 3LTPA 3GLCA 1F74A 4LVGA 2EF9A 3TQKA 1OFEA 4M6QA 3QMTA 4I7WA 1S3HA 3W1QA 3E96A 5LSMA 1WDWA 3HO8A 3ABRA 2WNZA 1LOSA 1F73A 1LBMA 3DFPA 3SR7A 1HFBA 2C6QA 1OYCA 1WBHA 3TMLA 2EHHA 4UMCA 2ZZ1A 1TIMA 3QSTA 3O6DA 3DHFA 5CPNA 1YXYA 2B0MA 4NVTA 1BWLA 1F7BA 1SO4A 2ISSA 4UTWC 1KTBA 3NQ8A 3GXTA 2DZXA 3CPRA 4AHQA 3OG3A 5AN7A 3PSWA 2R94A 1OFOA 4NQ1A 3WK2A 5K7JA 3DHDA 3QW3A 1EP2A 3EEGA 3W2UA 3IIVA 5D03A 5AB3A 1ZJIA 4YLWA 3WJWA 3WK1A 3N2MA 5I3IA 3K30A 3S1UA 1OVDA 2TMDA 4WZHA 1JCJA 4LVFA 4ZQOA 4PTNA 1O95A 1OX6A 4MLRA 3EKZA 4HPXA 4PC8A 1SFJA 1G69A 1ZAJA 1LRTA 4MKNA 4UCGA 2J6XA 4JTFA 3SW6A 1TTJA 5G2WA 4MLJA 2OJPA 1IIHA 3KOFA 3PC0A 4AWSA 4K37A 2EGZA 3CWOX 1H51A 1RD5A 1MSSA 4RLIA 3M6YA 3DU0A 3G22A 5K9XA 3HGOA 1FXPA 1HG3A 2X1SA 3P67A 2C16A 2WSYA 3UWUA 1FDYA 3PB0A 3OVRA 4CLMA 3S9YA 2VEMA 3EWZA 1ML1A 2J9ZA 4RCXA 4N9BA 1TTIA 2QUVA 4UIOA 1NF7A 5IBXC 3P84A 3M1ZA 4IX0A 1QPQA 3W7RA 3HPZA 4ZMGA 1DQWA 3C3NA 5KITA 1EUAA 4Q33A 2J27A 1NSJA 4FX6M 4JTHA 2GVGA 4HKPA 3PUDA 3STFA 4DF1A 5AC6A 3EWWA 1SR9A 2Y63A 2CLKA 3NL3A 1VS1A 4UMBA 1MEIA 3O07A 3THAA 4QISA 5AHMA 5F4WA 2BTMA 1MZHA 3NM3A 2C0AA 3MUXA 2Y89A 4NNAA 2A85A 1L9WA 3P5YA 2W6RA 5F2MA 1XL9A 3BO9A 3GR7A 3TC6A 3W07A 4ALDA 1UB3A 4IXXA 1SO3A 4ZZ9A 4FF7A 1UCWA 4LS2A 4YCOA 2NXHA 3FA5A 4DF2A 2H3BA 3TNOA 4M5PA 1TPFA 2EKCA 1CI1A 3SI9A 4UTTA 3CIWA 1DQXA 2ZRYA 2F7FA 3IIXA 4UFKA 4NXKA 1OFDA 1KFBA 3UD6A 1B3OA 5I3GA 1AW5A 3FFSA 3NNTA 3A5FA 1R2RA 1GVOA 4NJJA 3LCGA 2QCLA 1J4EA 5G1YA 2CLLA 4ADTA 3LCXA 2BSLA 1M6JA 1KFKA 1YADA 2E5BA 4RXGA 3ZWTA 3NQDA 4TR9A 1SFLA 3GX9A 5EPDA 3CT7A 4M6VA 1TV8A 4N6EA 2Y88A 3LRLA 3SFKA 4U4MA 5D02A 1K7FA 4QAIA 3C2VA 3GKFA 2E77A 2O7QA 4UR8A 2WKJA 5C54A 1NF0A 5G4WA 3INPA 1T8XA 4C1KA 3O6CA 3DH7A 4KFNA 1ZAHA 1YDNA 1M5WA 2V81A 3TW6A 1LLZA 5LHEA 4M7TA 1OF8A 3I68A 3WJXA 1H50A 5K3VA 3PUEA 1P0KA 2QDGA 2A6LA 1CW2A 3HG5A 3KVJA 1WX0A 1L2UA 5AC7A 5IM51 2PRLA 2RDTA 3W7NA 4UTHA 1L6YA 1PV8A 4MZ8A 4UXDA 2CLEA 4LRTA 1R2TA 1OFBA 3B04A 3L65A 3MO7A 4LW7A 5CZ0A 3IVSA 4O12A 4BFAA 3HIJA 3LCWA 2VEPA 3LBMA 3RFAA 5FF4A 1FUYA 4DO5A 1XUZA 3LTYA 1EP1A 3IIOA 4LUIA 1I2RA 1VJIA 5CZTA 3P60A 3TAKA 2FB2A 3C6CA 2JKAA 3UWQA 4FNRA 3F03K 5EKYA 1W56A 4JTTA 3NQEA 2Y61A 2AAMA 1CX9A 1C29A 2ZRUA 4O54A 3HOJA 1KV5A 1X1OA 1KM5A 5KZDA 4CNPA 5LNVA 3W7PA 1THFD 1GEQA 4XTIA 3UXDA 1DVJA 2C14A 2DU2A 5DXXA 2GVJA 2RH9A 4NJHA 5DN1A 4NNBA 3GZ3A 3NOEA 3QQ0A 3SECA 4FNSA 3F4WA 3FLUA 2PCQA 5CPOA 4WOZA 3JRKA 1K03A 4AF0A 5CG7A 1YTKA 3LCIA 4GXMA 3QH2A 1FWTA 3W1UA 4EWND 1OFAA 3TXZA 3MHGA 1JCXA 1VRDA 4GUHA 4NX5A 3S1XA 5A8GA 3B06A 1UUMA 2C15A 2Z1BA 3C2OA 1MO0A 3N3MA 2ZCGA 3GDKA 1SW3A 2NLIA 1SQ7A 3EWYA 3DGRA 4RZ5A 4M7SA 1EUNA 5K4ZA 3BLEA 3NQCA 3LERA 3TQ0A 2Y6ZA 1O5XA 3A24A 3Q2DA 4X22A 4UFMA 3TV8A 1P1XA 4B5NA 2V5BA 3G0XA 3MP3A 2QCMA 1LM1A 1IXOA 3QMSA 3VE7A 5DY3A 3M7WA 3NEVA 3C61A 3I6RA 4JIQA 1LBLA 3M5ZA 3EX3A 3E49A 1F76A 1XI3A 2DZWA 4HSNA 1JULA 2ZDRA 3A5VA 3BGGA 3S5YA 1TV7A 3HGSA 3OHIA 1TQJA 2E5CA 4WJEA 1T96A 1FWNA 1GZGA 4EVZA 2V8ZA 3S8HA 1TV5A 3HB9A 3TE9A 3TW7A 3WJZA 3L66A 1GG0A 1BEUA 3KX6A 2YW3A 5D2WA 4LNYA 3G1SA 4DQWA 3OA3A 4ORIA 3QPYA 3PG8A 3G1AA 4H6KA 1W3NA 3TH6A 5K9CA 5D30A 3EXTA 4YL2A 2TSYA 3KXQA 1O5KA 4WUIA 4AAJA 4N6FA 4FXRA 5I3HA 3UWYA 1IGSA 1SU5A 4AHPA 3G0SA 1K8ZA 3LHUA 3GVGA 4FX7A 1YLVA 3EX6A 3STCA 2RHGA 3UY7A 4K7YA 3P74A 5SWUA 1WBJA 2ZQ0A 2E6DA 1PHQA 1H7XA 2E6YA 1YXCA 5F1UA 1S5TA 3MWAA 3IEBA 2X1RA 1KLZA 1PVNA 5FI8A 3EXSA 2Y7FA 3SGZA 3TC7A 1D3HA 3FS2A 1UJPA 3FIGA 4OV4A 1YTDA 4MVAA 1QR7A 3LTSA 1XDMA 2CFFA 3W72A 5HJLA 5G2HA 2NWSA 3L0GA 4GUJA 3W88A 2HS8A 1D9EA 5TQLA 1PCWA 3E0IA 1AW2A 3OEXA 5FF7A 3DI0A 3KHJA 3MW7A 4NUWA 2A5HA 3FJLA 4LS1A 3U6WA 1KM6A 3BW3A 4Z1BA 1FCVA 3GAKA 3W23A 2DZVA 3O6YX 1JQXA 3QMRA 3KVMA 3BW4A 1RR2A 1P0NA 2J24A 1K7XA 2Q8LA 3TSBA 2H8ZA 1ZHAA 1I4NA 1I2PA 3NQVA 2ABAA 1SZGA 1V7YA 1W1ZA 2ZA3A 3VKJA 4GBUA 3V1PA 1KFLA 1W37A 2G96A 3G1YA 1GT8A 1K7EA 4UUIA 4OGZA 1X7FA 2QDHA 5AFDA 2F84A 4GUIA 4Q4KA 2V2HA 1PS9A 3DFOA 4GJ1A 1TO3A 2YZRA 3GNNA 3UPWA 2DZTA 4J9JA 5AHLA 3NQGA 5G5IA 4O1AA 1QWGA 1A5CA 3EX2A 3FYOA 3EWXA 3MI6A 2ABBA 1VLIA 3QRHA 4BWLC 1A53A 3PBWA 2ZZ5A 1GYLA 5D2VA 3IVUA 2PRHA 3OIXA 1GYNA 4QM1A 1TPC1 1ICQA 4AXKA 3EXRA 4CCEA 4IMDA 3ZR4A 1I45A 2FIQA 3M41A 1SSDA 1FBAA 3LHVA 1KFJA 1F6PA 4JYEA 1GG1A 4NNCA 3DXIA 3W7CA 2GVLA 1WXJA 4FO4A 3W22A 4TMBA 4O28A 3GIYA 3HMJG 1WOBA 2YFNA 3WK0A 3BW2A 3M47A 1FDZA 1DKWA 1K02A 4EF9A 3R12A 4XKYA 2NV2A 4UTJA 5AHEA 3T40A 2H90A 3FOKA 4OV9A 2NV1A 3W1RA 4BI6A 2WO5A 3W1PA 2OZ0A 1Z42A 3ZS4A 2HSAA 2OT1A 6ALDA 3G1FA 1Q6LA 5FEZA 3U2OA 2YDAA 3CC1A 5HR6A 1KLYA 4ZL1A 3MI2A 2VEIA 4LWWA 4HT3A 1RQBA 1ONRA 2Y7DA 2CZ5A 3IV3A 1XBXA 2E68A 2VFEA 4PL1A 4XQ6A 5D32A 4OHQA 1EX5A 2GQ9A 2GUUA 2J88A 3VCRA 1GVRA 4EIVA 1OK4A 3W85A 2YW4A 2VELA 1SSGA 3HG2A 2KZHA 1VCVA 1Q6QA 5G1TA 1S5VA 3LM7A 4I7UA 1VZWA 3KRSA 1HUVA 4K36A 2J9YA 4JTKA 1KFEA 2VEKA 2V9DA 4O52A 4WX2A 3LGEA 3DFTA 3MYPA 1GOXA 1NVMA 1TPUA 3LHTA 3L2IA 4PEKA 3NQMA 4HPJA 4RV8A 3B0PA 1F5ZA 3HPSA 4Y6GA 3C0JA 3HJZA 4MY1A 2FFCA 5BRBA 4O1DA 4DBDA 5FF3A 3NL6A 3NA8A 3W1MA 5I3KA 4P2VA 3UXAA 1QMLA 2YYTA 1B4EA 4E2BA 3PY2A 2YCEA 3TKFA 3ATZA 4DEFA 4ZQRA 4MPQA 1AL7A 1AG1O 4TO8A 3B0UX 3CEPA 4YWIA 4RXFA 1B4KA 4X9SA 4L4MA 3L5MA 1W54A 1TSIA 2YYUA 3TDFA 3DKLA 1YYAA 5J5DA 1B57A 1W31A 2QR6A 3STEA 1VCGA 2C19A 4JEQA 4LTSA 3LLDA 5AYXA 3VI2A 1Z41A 2CU0A 2WSRA 4IQLA 2W79A 3C4UA 1VPXA 3E12A 2GQ8A 5C5YA 5KSWA 4CCDA 4WY0A 2ZZ6A 4YMZA 1W8SA 4HNUA 1I2NA 1Q45A 1W5OA 3BLFA 3BG3A 4TX9A 3UWVA 2RDUA 2FJKA 1ZALA 5F2IA 5HULA 1FWRA 3NR0A 1IF2A 3A23A 3ABSA 4DO6A 3RK8A 1DV7A 5HMSA 1YTEA 1GWJA 3LCHA 1GVQA 4LRSA 1NFBA 3NPXA 3MI3A 4H3DA 1Z48A 4X2RA 1A50A 4E38A 1Y0EA 3R8RA 4IUOA 3FKRA 3W7JA 3Q58A 2X1TA 3FKKA 5G4EA 4HNVA 4O53A 4RX0A 2BX7A 1QO5A 3CTLA 3E9AA 4QQ3A 3AJXA 3CIXA 4CQ8A 5I3JA 5AOUA 4TMCA 1FQ0A 2DP3A 3P61A 1TPDA 4GUFA 1SW7A 4Y90A 2QJIA 4KKXA 1JJKA 2WNNA 3PS7A 4IXHA 4K39A 2QCFA 4O17A 2CWNA 3D0CA 3MP5A 4K7VA 5KZMA 1GPWA 4CQAA 1QAPA 1FCBA 3N19B 3ANYA 3C8FA 4HNNA 3CB8A 5J5RA 5DCDA 4TU1A 5MHBA 1TYGA 4DPPA 1XBZA 2D73A 2Q8ZA 5CPMA 3I65A 4FNTA 1P5BA 2GJLA 2WJZA 4DPQA 1MEWA 1H5YA 4UTLA 4AB4A 4FNPA 4ZQPA 2VKZG 4OBTA 2B7OA 4RZ4A 3PSVA 4UTIA 3I7RA 2W0UA 5FESA 4DO4A 5DY2A 3W83A 2QF7A 3T7VA 4ZQCA 2V5LA 5FEPA 1JCLA 1F2JA 1GTHA 2NUXA 3NAVA 3QFEA 1ZNNA 1OYAA 2E5DA 1KTCA 3DFQA 4GWEA 3LXAA 3GDLA 5CZSA 4CQ9A 1SUXA 2VFFA 3FYPA 1TCDA 1M7OA 5D33A 1JR1A 2VOMA 4GRSA 1XBVA 1LP6A 4LV9A 1ZENA 4Z08A 4YXGA 1D3GA 4FHAA 2TPSA 4H4IA 4W9TA 1VYRA 3NYZA 3DI1A 5DELA 1FY6A 2NWRA 1G67A 1N55A 2YR1A 5G2IA 4JY9A 4MZ1A 4JTGA 5EL1A 4O16A 3LX9A 5EYWA 1XFBA 3L0NA 2A7NA 3QF0A 1ME9A 1BKSA 1KV8A 1H63A 3O16A 2H8XA 1TQXA 1LROA 2UV8G 3I7QA 4MYAA 5KZEA 4LU0A 1OK6A 5CSRA 3W7MA 4JGDA 2VC6A 1W3TA 3EB2A 2DJXA 1FX6A 2PRMA 2B4GA 4JDYA 3HG3A 4OU1A 3MJYA 4WXYA 3W2MA 3LRKA 4AF0B 1R30A 3ATYA 1K8YA 4O13A 3T55A 3M5YA 2FB3A 1TTPA 3CU2A 1DBTA 2E6AA 3W87A 1VC4A 5HNRA 1A5BA 4BI5A 3L9CA 1OX4A 3W71A 4RZ6A 1LDCA 3NQAA 3TX9A 2P1FA 5D09A 4HIBA 2QAPA 5IBXA 4O1BA 1YXDA 3NZ1A 3CQ0A 5EBUA 1R47A 2FLIA 3P82A 1M7PA 5KMYA 4O14A 1VQTA 2CZEA 3B4UA 3QM3A 3W74A 2XN0A 1Q6RA 3S5NA 4IMGA 3CLMA 3NPWA 5U4NA 4IX2A 1LCOA 1LOLA 4ZQNA 3W7KA 4WY0F 3NZRA 4S2BA 3QYQA 5D04C 3M9YA 2QAFA 4O57A 2OMAA 4QNEA 3R2GA 1A5SA 4A29A 2NXIA 3MP4A 1TPH1 2OT0A 4LY8A 5AYZA 4JX4A 2FPVA 2QEZA 3TAOA 4R33A 3UNDA 4IOTA 4O0KA 2X1UA 3G3MA 5AHNA 1QDSA 3G0UA 3IGSA 1EIXA 4N2YA 3I7SA 4MFEA 2DZSA 5FEWA 3W2JA 1W5QA 1G4TA 3M44A 1VCFA 3O8AA 4PH6A 1AW1A 2DJLA 4IGHA 1LYXA 1ICPA 3L21A 3G1HA 3N73A 3QPZA 3EX4A 4UFLA 5HWMA 1H7WA 1EB3A 1Q6OA 2CLOA 5HUPA 4NJGA 5GVJA 5HWNA 2ISVA 2Z0IA 4XWUA 3C2RA 1R46A 1RPXA 2HMCA 4MJZA 3O1NA 2XN2A 3TIMA 2ALDA 2V0TA 3A21A 3DKJA 3G3DA 5C6MA 3F4NA 5FEXA 2NX9A 4LV4A 4TIMA 4WXZA 5LGZA 2ZZ4A 4MFDA 4JR5A 1LRQA 3H54A 1PL9A 2QJHA 4NJKA 1WYIA 1MEHA 4NJIA 1O4UA 2QCCA 1DJNA 2G97A 4K8HA 1PIIA 3DBPA 1RQEA 2C1HA 5F4XA 2QUTA 2CZFA 1E51A 2NX3A 1X1ZA 3FJ6A 4DXVA 2AQWA 3C2FA 4NZJA 3BG5A 1VGAA 3WK3A 2NXGA 2CLHA 5FF2A 2A1YA 1SPQA 1TRDA 1BWKA 1WOAA 1GQNA 1TJRA 2WV8A 1KBJA 3UZ5A 2X2GA 3PULA 4AMAA 3LB0A 2JKPA 5HUOA 3PBUA 1PCKA 3O15A 1EWEA 3IIZA 3PWAA 1UASA 3UPBA 5D2XA 2DZUA 1VLWA 1J5TA 4JTIA 3W70A 4FX8A 4A21A 4JD4A 1TMHA 4EF8A 3QC3A 4RKAA 1K8XA 4MY9A 2I14A 1W3IA 2XN1A 1HO4A 4JICA 3W7QA 1PE1A 3KRUA 3TMQA 2R14A 3T4CA 2DZPA 4N9DA 4X3ZA 3GDMA 3TU9A 1S5WA 3L68A 3PF3A 4HHPA 4UNKA 1W0MA 3WJYA 4CCCA 5L9FA 3NL2A 4DBEA 3GAYA 3L67A 4NT0A 5CPLA 4Z0SA 2C3ZA 5AHIA 1J2WA 3W86A 4R34A 4UTTC 4GUGA 3BPWA 3NG3A 1QPRA 4LVBA 3S0CA 1KFCA 3B05A 4D2JA 1KW1A 1H1ZA 3BV4A 5CKSA 3O05A 3M43A 4Q32A 2QKFA 3NM1A 4AHOA 3UWWA 2QCDA 1TPB1 4JTEA 1GVFA 2GQAA 3PUOA 3SY5A 1ADOA 1W5NA 2RFGA 2VENA 3VFLA 3F1QA 5CZJA 4UTUA 3W9ZA 5BOOA 3HGRA 5TIMA 1IXQA 4UMAA 4KFOA 1OF6A 4UFJA 4XKYB 1PHWA 4M19A 1YPIA 3S1WA 4I7VA 2H3DA 3KAOA 5U7SA 4BR1A 2TRSA 3P80A 3W7GA 2CW6A 4Z1AA 1WAUA 2WNQA 4ZQMA 1G4EA 3MBFA 2R91A 3TSDA 1I2OA 4WOQA 4RK8A 4JTLA 3ZFHA 4BK9A 5A5WA 1LBFA 4O15A 1KM2A 3SIZA 2ZZ2A 2RKXA 4ADUA 3C56A 4E2DA 4QJ1A 2ZZ3A 4HN4A 2B7NA 3B8DA 3H53A 2I1OA 3B03A 5H2ZA 2NUYA 4OQVA 3USBA 1ICSA 4POCA 1ZY9A 4A22A 2BLEA 1IXPA 5AC8A 3VE9A 4UFIA 5DXYA 3W2KA 3PVFA 1G4SA 2YGYA 3LI1A 3TCEA 5BW6A 1T99A 3QJAA 5F1VA 2O7SA 3NQ7A 1WQ5A 2V2DA 2JKEA 3RF9A 1OABA 2C18A 3L0KA 4QSHA 1H7PA 1HTIA 4MOZA 3QSRA 3TK7A 2NX1A 2JGQA 3G1DA 5ABTA 5LNWA 3GK0A 4O4VA 3QEZA 4OWGA 1XUUA 2ATMA 4GC4A 3TUUA 3BVJA 1FWSA 4IJBA 2RDWA 1G7UA 4GFSA 4P61A 2GPTA 5D2YA 1TB3A 5EY5A 4ML9A 2A7RA 3LRMA 4BI7A 4KWWA 2CLMA 5C55A 3B0VC 1NAL1 4R53A 3UY8A 4IMCA 3SSJA 1LLWA 1GJPA 1EPXA 3TA6A 1XM3A 1U83A 3RLVA 1O60A 4Y96A 1ME8A 1L6SA 4K6AA 1I2QA 1AL8A 4Y9AA 1BTMA 1RZMA 2Q3RA 4MZYA 3T44A 3S42A 3RLUA 4LOCA 4K38A 2ZRVA 4JYDA 4A2RA 3GDRA 1FXQA 1H1YA 3PBYA 5CGQA 3W2NA 1JUKA 2Z2UA 4M6PA 1KM1A 4LVDA 1OG0A 3LHWA 3TXVA 4LUJA 1KM0A 5LGXA 3MMTA 4LS0A 4FNQA 2QUUA 3TJXA 4WY0B 4JN6A 1EWDA 1RQHA 3LI0A 4JIPA 4EOUA 3JS3A 4N4PA 5D37A 5AHFA 1JCYA 3OVQA 4N02A 4MJMA 3DZ1A 3C2EA 1TREA 4G1KA 4IPIA 1WV2A 3UZJA 1OFQA 4S2CA 1SO5A 1P4CA 4KWVA 1QOPA 1JCMP 3QZEA 3L5LA 5LZLA 1X6UA 3FEMA 5C2XA 1N7KA 2JBMA 3P7YA 1X8FA 2WSQA 1JCNA 2LLEA 4XUGA 4I9AA 5LNRA 6TIMA 1JRCA 4NX0A 2YFOA 3W1LA 3UQNA 3W7OA 1FCUA 2ISWA 4MUZA 3TFXA 2E1DA 2QCGA 4UTKA 5TBOA 5E1QA
chains in the Genus database with same CATH superfamily
5JIPA 5I0DA 4QEEA 3GHSA 4U33A 4PR4A 2ZRXA 1XYAA 4IIDA 2OSWA 3LPFA 3EDKA 4A3UA 2IQTA 2VFHA 4URIA 3V75A 1EF2A 4JTUA 3GTNA 3LQLA 3R5EA 2J7HA 2QJGA 4WEVX 3UA3A 3E2SA 1TR1A 3DYPA 5D2TA 2VC9A 4JX6A 4UTMA 4Z1CA 1XC4A 5I06A 3HQ1A 1S1PA 2XWDA 4FSAA 4L65A 3OP2A 3B8UA 3GHTA 4OJYA 2X0SA 5TD4A 4KEZA 4IPJA 3LS9A 4PUDA 3CPGA 4WSHA 3BJSA 3R13A 3UYCA 3PM6A 2QUMA 4PE8A 2PLCA 3PB2A 2J79A 1VD6A 1KBIA 2HTMA 2R1KA 2XWEA 4M3PA 3P62A 1R2SA 3T42A 4RUBA 1YDVA 4JTJA 1LRNA 3KS5A 4IPPA 1H61A 3S4TA 5A6AA 1OHLA 4LC6A 5L6UA 5ABGA 3ALGA 2ISDA 3M46A 4C1LA 1OFRA 1W9PA 3QW4B 5EMYA 3T0DA 1IGWA 1V03A 3LZ5A 3MQTA 4MDPA 3VNIA 5E0KA 2CBIA 5I03A 3VK5A 3UEQA 5H6HA 2WJFA 1XG3A 3W7HA 5LIYX 1V3MA 3RU6A 4JFWA 3DAQA 1LORA 3P93A 3WIJA 3UVIA 4DBUA 2R82A 5K4XA 2BFGA 3P81A 5T26A 2VX6A 4XZHA 3O06A 3DCPA 1IIGA 3VFCA 1I8JA 2V5DA 3LLFA 1OQFA 4A8IA 1Y5XA 2PZNA 1H0IA 2QJMA 1BKHA 1O94A 5DFAA 1EO5A 2FKPA 4XZLX 3E1F1 3B8IA 1UR3M 4L4PA 2ZZ7A 1TRIA 3GXIA 3GR8A 4X61A 3GB6A 4BCEA 1XC6A 4XTDA 4LUSB 2BHUA 4DWSC 4AVOA 3E6EA 1S39A 1F3XA 2GQ3A 1DORA 2FQIA 3OBKA 4PTDA 1UZHA 1IXNA 1EHNA 3LY0A 4B90A 3VUPA 1YDOA 3S6OA 2YPIA 4ZGYA 3CM4A 3VC5A 4GOAA 2WLZA 5TF0A 3CEUA 3G18A 4JNMA 3SUVA 2XFWA 3T05A 5BXSA 1T6MA 1SZFA 4O4WA 1R9XA 4PA8A 4LJ3A 2Z2BA 4S3KA 3UJSA 3N9KA 1QFEA 4LT9A 3REQA 3NQ2A 2DORA 4ZO6A 2FDSA 1KA9F 1GVSA 1JUBA 4W7UA 2VDGA 2VXNA 3WLIA 5BRPA 3EOOA 3PBGA 3LCFA 1LTDA 3OVPA 3SSZA 4F40A 1LOQA 1SFSA 3WJSA 3SY1A 4JKLA 4FNUA 2ZX8A 3W7DA 2OOFA 1DIEA 5A6BA 2E09A 3IGXA 4PCFA 5K2ZA 2JGYA 4OT7A 2J4GA 2QT3A 3NZPA 4PMOA 2BASA 3PAJA 2XVKA 5HOSA 2FZBA 2FVLA 4UOQA 1WZAA 4LUTB 4YYFA 4BF9A 3PN8A 3E3HA 5BMWA 3W84A 4D1IA 1VHCA 3VXGA 4F9DA 1Q3NA 4UNLA 3TA9A 4K8EA 3QTGA 1NARA 3QQ1A 3IARA 4KFPA 3EX1A 3W1AA 4C6FA 1LL6A 2HROA 1U5JA 2XVPA 1KM4A 5HINA 1GCYA 4EPEC 2WYSA 1B3WA 4HMCA 1JDCA 3G6MA 4M51A 1FCQA 1EBGA 3WFAA 3S5SA 4G2DA 4BHYA 5BU9A 4AZ7A 3GZAA 3TQVA 3KBWA 3VC6A 5HNTA 3N25A 2Z7KA 1UD4A 8TIMA 3VA8A 1NWSA 1OZQA 2PDXA 3RJXA 4ZTXA 1Z44A 1I9CB 4QIUA 3BCDA 3UBPC 1Q13A 3W3OA 4LAUA 3TYAA 4W5UA 1W5PA 1DJQA 3UWZA 1G01A 1E4IA 3KVKA 2F6KA 3LCLA 3H21A 4D72A 4FLQA 3W27A 3UJRA 1OZMA 4ZENA 4DZIA 4JHZA 3TSMA 4B5WA 2XIMA 1PTDA 1E1EA 5HQEA 7TIMA 1BYDA 1K3UA 2XH0A 4AH7A 1QATA 1IEWA 3ES7A 1EBHA 2V30A 1VYSX 4GZEA 4GIAA 4R7OA 3WLNA 4L7ZA 2W91A 2P76A 4YVVA 5DMLA 3WYZA 3LHYA 4LC8A 3IUIA 3HBLA 4GH1A 4W89A 2QCNA 3VNDA 1NJJA 1A5LC 2EF9A 4ENLA 1Q8AA 3VOHA 3H8AA 4S23A 4I7WA 4US5D 4NKCA 3KZPA 2YCLB 1O7AA 1WDWA 2WNZA 3IK2A 1XX1A 1OC6A 2PFHA 2Y1HA 4CVUA 4Z42C 3TMLA 8RUCA 1LG1A 2ZZ1A 3BUVA 5HJYA 4PYSA 5FSEC 2VCBA 2D24A 3VZZA 2XGBA 3OG3A 4MAVA 5AN7A 2R94A 1OFOA 3UJ2A 5BWAA 3S6TA 3OOQA 3E74A 3EEGA 1SZRA 4LBUA 3NXLA 1OEPA 4YLWA 1JXKA 2HWGA 4MB3A 4WJXA 3K30A 2TMDA 4LVFA 1J93A 1LUCA 4MLRA 4I9TA 2XSBA 2D2GA 2I5GA 4PC8A 1G69A 1AA1B 1V02A 4MKNA 2J6XA 3PTKA 4QS5A 1IIHA 3KOFA 1UKSA 2EGZA 3CWOX 7ODCA 3GS6A 3M6YA 3DU0A 3T8LA 3G22A 4L61A 1NWTA 5CPTA 4J2MA 2FGZA 4AZCB 1FDYA 2J7CA 3AIEA 5E09A 1H11A 1UR2A 1TUXA 4HPGA 2I5QA 2VEMA 3S9YA 3DIPA 3B3DA 1ML1A 3WMBA 2QUVA 4G7FA 3QZ6A 1PXGA 5H8PA 5IBXC 3P84A 3M1ZA 3QYSA 5E0FA 1P6BA 1JZ8A 2JQXA 1EL3A 5BXPA 1DQWA 3GXMA 2ZC8A 4JFTA 5HMEA 2J27A 3UGVA 4JL2A 1UPPA 5EU9A 1J0JA 2GVGA 4DF1A 3MKVA 3AXHA 2R1NA 2Z26A 1BPLB 1VS1A 3URQA 3O07A 3OVGA 5FJIA 4QISA 3ZMRA 5F4WA 3R7MA 2A3LA 1Q7MA 4O1EA 1M01A 1UR0A 2C0AA 3MY9A 3CYVA 5F2MA 4C6BA 3CUGA 2GWNA 3HFTA 4CN1A 3GH5A 3QOKA 3QPEA 2NQ9A 2OKTA 4DF2A 1R3YA 2VOTA 4O8AA 3WDRA 1KO0A 1CI1A 2BGNE 4N7QA 4DB7A 5I24A 3IIXA 9XIMA 5I3GA 3KBNA 1CZ1A 4W84A 1XYCA 2ZUNA 1R2RA 1GVOA 5XIAA 2NLYA 3LCGA 2QCLA 5HPOA 3FK4A 3ARUA 3H26A 1ZJHA 2BSLA 1KFKA 3SCVA 1YADA 4MSSA 3CZLA 4HOXA 5EPDA 1GOWA 1IHIA 3CT7A 3WUGA 4NIRA 4PUMA 3E0FA 3NWRA 3LRLA 3SFKA 4U4MA 1GONA 4GYPC 2QMKA 5T9CE 4QAIA 4UR8A 2DW6A 3RAOA 5C54A 1JCTA 4PUWA 1BSLA 1OD8A 1XFCA 3VD3A 1HF6A 4JNYA 1RAKA 4KFNA 3KM8A 4RDYA 1GK8A 4M7TA 1MW2A 4H2HA 1M3UA 1OF8A 4PZVA 3ZLHA 3NOYA 2I7GA 3SCTA 2XSXA 1CW2A 4YVXA 4QGCA 5AC7A 5IM51 2PRLA 4MB1A 1WDDA 1TWDA 3GU1A 2RDTA 4UTHA 1L6YA 1TZZA 1V3LA 4UXDA 3VM7A 3VIGA 2OEKA 1OFBA 3B04A 3L65A 3D6NA 4GIYA 4LW7A 1XKJA 4ZFCA 5JUVA 1WKDA 4A8RA 1UUQA 3LBMA 1FUYA 2C0HA 3CUZA 3BAJA 1I2RA 1VJIA 3F2CA 4DJFC 1JIBA 2F2HA 1SMDA 3P60A 2O92A 2FB2A 2JKAA 4FNRA 4QROA 3F03K 1YMYA 4B2DA 1ELSA 1E3ZA 1FOBA 4TX6A 3TC3A 1KM5A 5HNUA 2E7FA 6ENLA 4JFVA 1V4YA 4H9TA 2NW0A 1WB0A 1DVJA 4FR1A 2DU2A 3MVTA 3PZQA 3SECA 3HFYA 3I6EA 4WOZA 1F07A 2FH6A 3LSCA 4HJFA 5JXQA 5CG7A 4I5XA 4W87A 5C2CA 1BYAA 1FTXA 1CYGA 2PTZA 1OFAA 3MHGA 3V4BA 2HNHA 4C6OA 3WFLA 4AIBA 3B06A 2C15A 3C2OA 4NYYA 4J2PA 1SW3A 5DMMA 3DGRA 1EOKA 1Q4NX 3H2FA 5K4ZA 4CQDA 3TQ0A 1NP2A 2UY3A 2J25A 1TVPA 4B5NA 2VWTA 1PJ9A 4B91A 3RM9A 3MP3A 3RM4A 1R9ZA 1JYNA 4HPHA 3M7WA 3NEVA 4KEUA 3MUCA 1K1DA 1LBLA 3U5YA 3ONCA 4QX4A 2QV4A 3UF9A 4HSNA 2DZWA 2BVDA 3BGGA 1TWZA 2BGSA 1TV7A 4WJEA 2PWGA 3RITA 2E0PA 1AVAA 1M1BA 4XIMA 2YW3A 5D2WA 4KETA 1VFOA 4FOJA 4Z2GA 1IE7C 4DQWA 4L80A 2NVCA 1W3NA 6A3HA 4AAJA 3UWYA 2G4JA 2OYMA 1CB7B 1SU5A 2V6AA 4JNZA 5I23A 3GVGA 5HDRA 4Q4QA 1R86A 1ECEA 5CQ1A 4L9ZA 3E5BA 3TTYA 1WBJA 4H9ZA 1H2JA 1E6NA 5E9XA 4I5UA 1YXCA 5CLTA 3MWAA 1DTUA 1H4PA 2X1RA 1PVNA 1RJPA 2Y7FA 2P8CA 1I1WA 1MXDA 1MZRA 3FS2A 4UWMA 3FIGA 3CZ8A 1H3GA 1XDMA 1E9IA 1PB0A 5G2HA 2NWSA 3L0GA 4GUJA 1DTNA 4LPCA 3VGBA 1UH2A 4QTGA 4GFIA 4JTCA 1A3WA 4G56A 3MW7A 4NUWA 1REQB 1KBKA 5DMYA 2AL1A 2XFYA 3ZJ6A 4QCEA 1FCVA 3GH7A 3SQMA 1JYWA 3KVMA 3A13A 1RR2A 1K7XA 2Q8LA 2H8ZA 2PEVA 3NQVA 3B8SA 1R3RA 1W37A 3WBYA 2G96A 1RJQA 1IZJA 3KBSA 3LM3A 4PMUA 3KCLA 3PTQA 1DEDA 1V8EA 2AL2A 2QDHA 1XPGA 1QNSA 1PS9A 3DFOA 3USZA 3UPWA 2YZRA 3GNNA 2DZTA 3R6IA 4U2ZA 3EX2A 3FYOA 3MI6A 1VLIA 1NIUA 4L1GA 3PBWA 1RK6A 1W9BM 1V3KA 2GSHA 1V6VA 4F0MA 4B4HA 3CUJA 4IMDA 1EJVC 3H4XA 1SSDA 3LHVA 1E1CB 1KFJA 4JYEA 1GG1A 3ORWA 2ZUTA 4NNCA 3DXIA 8CGTA 2GVLA 8XIMA 1TA3A 3GIYA 4FF5A 3HMJG 5LA1A 2OVLA 1X6NA 3WK0A 1TVLA 4RNHA 3BW2A 4RE0A 2VDIA 4CD6A 3CO8A 3ISIX 4B9ZA 3T40A 3V0SA 3STPA 3FOKA 2NV1A 3W1RA 3WQDA 2WO5A 1U2YA 2FDMA 2WMFA 3WQPA 1PDYA 3BAWA 5T9BG 1RH9A 1UD8A 4D6EA 3G1FA 5FEZA 2YDAA 3CC1A 3FY1A 4DJFD 5BXTA 2VEIA 3MMUA 4IIBA 7REQB 4QJ4B 2IPJA 2Y7DA 2CZ5A 1XBXA 2E68A 4XQ6A 1IWBA 3HZ3A 4OHQA 1EX5A 3R58A 4Q8WA 1QT1A 1EFZA 1ZU8A 4P8VA 4RZBA 4IFKB 3W85A 2D0GA 2VELA 1SSGA 3ZSSA 2KZHA 3CMFA 1MUMA 4CNTA 3AS0A 4I7UA 1VZWA 3FVDA 3KRSA 3T07A 1Y8BA 1KFEA 1E5NA 4O52A 4WX2A 3LGEA 3DFTA 1ESWA 3MYPA 1GOXA 4L56A 4LBSA 3EPMA 3JVAA 2UY4A 3FXYA 4RNJA 1FH8A 4RV8A 2DUXA 3B0PA 1F5ZA 4Y6GA 1KGUA 4AIEA 2PCEA 4KQNA 4UQBA 1HNYA 1A80A 4B5SA 3UXAA 4E2BA 1E0XA 1E43A 4ZQRA 4MPQA 5JBDA 1XCXA 5LIWX 3ARXA 3QQWA 3L5MA 4YTTA 2W66A 2YYUA 1FHVA 3VD9A 3TDFA 4GISA 1YYAA 5J5DA 3BJTA 4D6IA 2WMIB 4HBKA 4HMNA 3BLKA 1S38A 3AS3A 4JEQA 3LLDA 4JIHA 4C60A 3VI2A 1A0CA 1ZLPA 4JQ3A 3WNPA 4PRRA 4IQLA 4HJWA 4IM4A 3E12A 3C4UA 1VPXA 5EMMA 1J8VA 1OCJA 4GD0A 4UZSA 2QF8A 2JEQA 1YIXA 3E0VA 4WY0A 5LA0A 3TYDA 1I2NA 1GW9A 1UBPC 1EDTA 2R6OA 3UWVA 2RDUA 1J12A 2UBPC 5F2IA 3VOCA 1C7TA 5HULA 4TTGA 1E0WA 5KEZA 5HMSA 1GWJA 3RO6A 3V7PA 1IEXA 3OZOA 1Z48A 2Z24A 4AZIA 4QLLA 1JDEA 1ZL1A 2INEA 5I5RA 1JXJA 3W7JA 4J28A 2X1TA 3N2OA 5G4EA 4RX0A 2BDQA 4ZSUA 3R0KA 4CQ8A 5I3JA 4TMCA 1FQ0A 3L4ZA 5C9UA 3H2OA 2WNNA 4IXHA 2Q09A 4K39A 1Z89A 4GQBA 3O7UA 1WDPA 3FAXA 4RNIA 1GPWA 5XINA 1QAPA 3ANYA 5J5RA 1VFTA 4GQGA 4JFSA 4B5VA 4TU1A 5MHBA 2Q8ZA 4FNTA 1P5BA 3KWXA 4L64A 5DX7A 1JPDX 2W62A 4OBTA 3PSVA 1ITXA 3I7RA 2GGJA 3W83A 2V5LA 4DYEA 1F2JA 2DQXA 1Q4WA 3RDKA 2NUXA 3GU2A 3DFQA 1KRAC 3LXAA 3GDLA 5CZSA 2VFFA 4YTUA 1TCDA 5D33A 2PI6A 3AWNA 2PDKA 2VOMA 5AYBA 5EMKA 3U7VA 4H4IA 3DI1A 5C9ZA 4MUPA 1N55A 1IEQA 5G2IA 5CJ5A 4HGXA 4JTGA 2D2HA 3MSDA 1UOKA 4KH2A 1GORA 1N2VA 2CZVA 3QF0A 4X60A 1D8CA 1KRCC 3V0TA 4LU0A 5CSRA 1NFGA 3K4DA 1FX6A 4OU1A 4BY3A 3W2MA 4WXYA 5CC7A 4OUIA 4AF0B 3NTYA 3CU2A 5HNRA 1VC4A 4QBXA 3L9CA 1BXNA 2ZWYA 3WQWA 4G1NA 1OCBA 3NQAA 5E6ZA 3TX9A 2QAPA 4O1BA 3NZ1A 3O0KA 3NIYA 3BMVA 3CQ0A 3AISA 3W38A 1M7PA 1C8XA 4LYRA 1BGAA 2V68A 1TX2A 2XN0A 4LAKA 3FHAA 3BOLA 3VGEA 1DWFM 1XIMA 1LOLA 3W7KA 1I6NA 1QNQA 4LUSA 2D3LA 1CGXA 4CD7A 5ABFB 4AYSA 4MB5A 4TV5A 1XQLA 2QAFA 3L23A 1AH4A 2Q02A 2W63A 3R2GA 2YXXA 4AW7A 3ARQA 4PB3A 3MP4A 3NVDA 4HK5A 2VWSA 4GKTA 4U2YA 5C7HA 1OWQA 4S3JA 4JX4A 9RUBA 1ONEA 5FACA 1BSIA 4GVHA 4IOTA 3G3MA 5AHNA 2CHOA 4MWAA 2WZEA 3IGSA 1EIXA 1F8IA 1WKYA 4JL1A 3N17A 4KT2A 4M81A 4NZ1A 3ZSTA 4P8UA 1NELA 4IP5A 1X6LA 4PH6A 1B2YA 2ZXQA 3ITLA 1LYXA 3N73A 2G4FA 3T4WA 3EX4A 2ZX7A 5HWMA 1EB3A 2WANA 1Q6OA 3EGJA 1TE6A 1AJ2A 1KXHA 1XDJA 3AALA 3T81A 2XSAA 2Z0IA 2QJNA 1R46A 1GW1A 2WVSA 2XN2A 3TIMA 2ALDA 2DSVA 2DQWA 3F4NA 4LV4A 1QOXA 4WXZA 1TELA 1WDRA 2NQJA 3H54A 2I5IA 4DLFA 1E70M 1PL9A 3AXIA 4QJ5B 4K8HA 3IJ6A 3KBJA 1RQEA 2CCRA 2RJHA 4AD3A 2QUTA 1E51A 2EJAA 2AQWA 1VGAA 4KCTA 1E3XA 1RCXB 1PKLA 5E0CA 3M0VA 2NXGA 5J04A 5FF2A 2A1YA 3EA1A 1YNQA 1GEHA 1SPQA 3OW1A 1FWBC 3GNPA 3GUGA 4MHBA 3AQUA 2X2GA 3QXBA 5HUOA 5JH2A 5ENLA 3O15A 4IGNA 2V5CA 1PDZA 3IIZA 2J74A 2E9LA 1UASA 3UPBA 5D2XA 1JYXA 1NOFA 2E4TA 4DIAA 5LXXA 3W70A 4FX8A 4H9XA 1TMHA 3UG8A 2W5FA 3QC3A 4RKAA 1K8XA 4EXBA 3GTXA 1EZWA 1W3IA 3B0YA 2DZBA 2JF6A 2PODA 1LWJA 4N9DA 3OLDA 2XZ9A 5L9FA 2HBVA 3VO0A 3ZJ8A 3L67A 4NT0A 5CPLA 4Z0SA 5E9AA 1FWAC 1PWLA 4ZFMA 3W86A 1T8QA 2OTDA 4R34A 3AZSA 2HK1A 3BPWA 3VABA 5A6BD 3S0CA 1GOMA 1KW1A 1EOMA 1EJRC 1TZ7A 1XV8A 3UWWA 1XRTA 3MS8A 4H2CA 3WY1A 2OSXA 1GVFA 2RFGA 2VENA 3VFLA 4AMCA 1JZ7A 1GOIA 2PBOA 1NOWA 4XKYB 1VPQA 1R85A 5A6KA 3P14A 1PHWA 3GVVA 4FPSA 4M19A 3S1WA 3P80A 1PKMA 4CEXC 1P6CA 3MBFA 5ABEA 4ERGA 3ZFHA 1FWJC 3DC0A 3LMZA 1AQHA 5TAOA 2ZZ3A 2IQ0A 2YB1A 4OQVA 2YCLA 1ZY9A 4A22A 2BLEA 4N42A 2IKIA 3AU2A 3NO1A 2E8ZA 3TCEA 2O4QA 5BW6A 2EKGA 2O7SA 4DM2A 2C7FA 1WQ5A 2V2DA 2BY2A 1CXIA 2NVAA 3BSGA 3TONA 3WNKA 1HTIA 1JDFA 4ZE4A 2HXTA 1ZCCA 3ES8A 4W7WA 3TK7A 2Z4GA 4D1JA 2IMRA 3KL5A 3VIJA 3GK0A 3W6MA 2INZA 4GC4A 4IJBA 2EG6A 4GFSA 1UW9A 1C91A 5GJPA 4FOUA 3NDZA 3A3WA 5FKYA 5I77A 4ML9A 2IPGA 3HV8A 4AISA 2G3JA 2CLMA 3GM8A 4IMCA 2YCIX 4RE3A 1EPXA 2GJPA 2CXGA 1XM3A 3RX2A 1DJYA 1I2QA 2H9AB 4QDMA 1BTMA 2Q3RA 1VJZA 3EKGA 5EB8A 4LQ1A 3CAKA 2YOCA 1QI4A 1S2CA 3GDRA 3PBYA 5CGQA 3VZYA 1BYBA 4LVDA 3TXVA 4Q4OA 4XSMA 1C3FA 4AZCA 4AX7A 3UR5A 1EWDA 4QLKA 1RQHA 2WPGA 2EPLX 1TV3A 1MRAA 4JN7A 3WBEA 2PWVA 2ZKMX 2XJ7A 4N02A 1LLOA 3DZ1A 1A0EA 4G1KA 1ISWA 1XYZA 4IPIA 3QV9A 1OFQA 2W61A 3WBXA 2VQUA 1VJSA 3A64A 3QZEA 2ZE0A 4XUGA 3CH0A 4I9AA 1JI2A 4PCNA 3VDBA 4PUNA 1UH3A 3SCUA 3LLXA 3UQNA 5F7UA 4CU8A 4DYKA 4HP5A 3WBWA 1IT8A 1J10A 2OGYA 5E1QA 3W7EA 4EPKA 3CL7A 4J3WA 4O0ZA 2DY3A 3MT1A 3NO5A 3NPVA 1Q6FA 2WXDM 3VX1A 5HK4A 3VCNA 3TTEA 2QCHA 1TPVA 2XM1A 4OE7A 4ZXOA 2MNRA 1EH9A 3G1XA 4IMEA 3ARZA 3NEHA 3YPIA 4S3BA 1SW0A 1KKOA 1I60A 4ONVA 5JVLA 1C8YA 3EOSA 1XLJA 4S39A 3BQ5A 6XIMA 2BWGA 3SCOA 4JXCA 1G6CA 4FXSA 5LKYA 3JW7A 1S2AA 4PBGA 4FALA 1LWHA 4GI6A 1TV4A 1T7LA 2WJDA 1XLGA 1QCWA 2J7DA 4HPNA 3TN5A 3C52A 4V2XA 4O50A 2DW7A 3NDOA 4UTWA 4CU7A 4GZIA 3M0ZA 3C0LA 2CZDA 2X16A 4MYXA 1UHVA 3JR2A 2MUCA 4GGHA 4NP7A 4W93A 4W5ZA 4QP0A 3W6YA 4GNJA 3UESA 1XJBA 2G41A 1QO2A 4A3YA 1A5UA 3FYYA 5DCEA 4QNWA 2JEPA 3CJPA 2B7PA 3LOTA 1OYBA 2PDFA 1JPKA 2KX9A 1WZLA 1ZP3A 4OOUA 1J79A 3KBMA 3ABOA 1MQQA 3AMDA 1J96A 1OFPA 3QTPA 4EXQA 1JZ3A 4A2SA 3U2ZA 1R8LA 1VHNA 1SZNA 1HX0A 4DELA 4GO8A 2O9PA 1GTEA 2ZXBA 1JZ4A 3WQOA 4TOQA 3B9OA 3LENA 3V36A 3APTA 4UC5A 5DCBA 1US3A 3RHGA 3SQLA 4AC7C 4S3AA 1OX4B 2VGIA 5CBJA 3GNRA 4R88A 2PURA 4M56A 3M16A 5HWJA 3LBCA 3G24A 4AY8A 4GCAA 5LNSA 1HL2A 2JK2A 2X30A 1VH7A 3EOLA 4W85A 4AZGA 4O1FA 4CD8A 3N6HA 2JALA 4GVIA 2ATSA 1CTNA 2HNEA 3H55A 2Z1XA 1CIUA 2P53A 2WW5A 1HW6A 1KCXA 4HVXA 3R25A 1WUEA 3BAIA 3EKLA 1H62A 3FSTA 4H41A 2BXVA 3E5PA 3PFMA 3GIPA 1EJ7L 2NZLA 2V82A 3DENA 1YBQB 4JIRA 1V3JA 3N6JA 2A4AA 3PBVA 4IQDA 4Y8FA 2XIJA 1FRBA 3GFZA 4U5KA 3T78A 1MNSA 4R7JA 1OGGA 5I3FA 4FIRA 4GJJA 4UR7A 4WIWA 3PG9A 1W1VA 1UKQA 2UY5A 2X42A 5G4HC 3SJ3A 1VFHA 1DQUA 3G1VA 1EEPA 3RX4A 4GKLA 4JTSA 2VR4A 1F6YA 5CSYA 3ZOAA 3T9PA 4H00A 3E0LA 4P7NA 5EMUA 2YB4A 3TR2A 2YBUA 5C9XA 3G8RA 2J78A 4W88A 3THQA 2YX0A 4A05A 3AOFA 3AAMA 3W24A 1OINA 4YHEA 1V0NA 1TTQA 2GVEA 4B2DD 2DT3A 3W82A 1Q5MA 1UMLA 2Z6JA 1H60A 2V2CA 2Y70A 2G5WA 4JY8A 4QITA 2F8QA 4LF1A 2PDMA 4DXKA 1U22A 2FTPA 1ZJAA 3ELFA 4NG3A 2NQ5A 1OC5A 5I02A 4OBRA 3V0UA 3B0XA 4FXJA 1MYRA 4IPNB 3THCA 1MDRA 3VIMA 5K9DA 3CB3A 5HR7A 3I10A 4RV3A 1Q2SA 4TX8A 2P10A 2J7FA 2VFIA 3WF1A 4D6CA 3M0IA 2W4XA 3BOFA 4HMDA 4Z1DA 1W2VA 4UQ9A 1FDJA 1XLHA 3LXCA 5DBTA 3RJYA 2BY3A 3N9SA 3HF3A 3N2XA 1M9HA 1RVGA 3NPUA 1ISXA 2P0OA 3PR2A 4PFMA 4TXEA 5HA7A 1A4MA 4CNNA 1H09A 4L4LA 3KCJA 3L5AA 2OEMA 1GZJA 3BG9A 1YE4A 4QXIA 1XXXA 4IP4A 3AHYA 1UC4A 4PBEA 4Q6XA 1ALDA 1ZFJA 1W2PA 2ZICA 2J9XA 5A6LA 1TPWA 3N34A 2FPYA 2Y8UA 3TROA 1PBGA 3GBEA 2FGBA 1E6PA 2Z29A 1QNVA 5B80A 1REQA 1H7OA 3BCFA 3H7RA 3CBWA 3MUZ1 3SN1A 2E3ZA 4D8AA 1TPEA 4F2TA 4MADA 2WQPA 4Z0JA 4ZOCA 1B3XA 2IQDA 3D46A 5BNKA 5LYRA 3D47A 4Y2WA 3AS2A 3NQ6A 2D22A 4TVCA 1LQ2A 3AC0A 3R0DA 4JIEA 3SEPA 1W3HA 5JBEA 4QFUA 3R89A 5HNNA 4ZB0A 4U3AA 2X7WA 2VVNA 2YSWA 3BK0A 1PZ1A 3FA3A 5D9NA 3N4AA 1PAMA 1V5XA 2XH2A 1CXHA 3KTCA 1GVEA 2YXGA 3DFHA 3LTPA 4JN8A 2JF7A 1F74A 1KQZA 4LVGA 3TQKA 1Q66A 2BHZA 1OFEA 1PIGA 2WHLA 1S3HA 3TJ4A 3W1QA 3R0UA 1F73A 1V0KA 2C6QA 1OYCA 1KRBC 6CGTA 2EHHA 2IPWA 4ML4A 1E1CA 2E28A 3VDGA 2J7EA 3DHFA 5CPNA 1YXYA 2J66A 2B0MA 1KFWA 3A4JA 4NVTA 1BWLA 1F7BA 1SO4A 1OGBA 3GXTA 1UJQA 3B9AA 1CNVA 4AU0A 3CPRA 4I8YA 1KBBA 4I9JA 3AZTA 1D8WA 2FTWA 2O9OA 5CEWA 2PDWA 4NHVA 2PGEA 1HGYA 4WZHA 2VD8A 1JCJA 1HVXA 1OX6A 3EKZA 4O0QA 3TP4A 3UERA 2ON3A 1SFJA 3A4WA 7REQA 4KWOA 5G2WA 3MCNA 3K1DA 1QTWA 3PC0A 4AWSA 3H4WA 2D23A 4K37A 3ONBA 3DERA 1H51A 4RPQA 3UA4A 3WNOA 4E8DA 4HSHA 4GQQA 4IFKA 3RPDA 1HIZA 3BAKA 2QIIA 4OFCA 4IUGA 2ZVIA 3BLDA 2WSYA 3R11A 3CGTA 3G6LA 1QPKA 1IWPA 4GZJA 3OVRA 5KETA 3O0FA 4CLMA 3H70A 4RCXA 4ICMA 1NWRA 1NF7A 3K8LA 4PTXA 4PTWA 3UCCA 4L5ZA 4PMJA 1QPQA 3BURA 5RUBA 2HVOA 4NYUA 4ZMGA 1W3LA 5KITA 3C3NA 2PB1A 2OO0A 3TEVA 5MKGA 4MNMA 2C1GA 3P2VA 5CPQA 1JF5A 1IWAA 6PTDA 4YWSA 4ZSTA 1DYSA 2REQB 1BVZA 1UQYA 2WMIA 2PLKA 3CT2A 2P0IA 3P5YA 1XL9A 2WMJA 4PB5A 3A4AA 3BO9A 3GR7A 3TC6A 4ALDA 1EA9C 4IXXA 1AUSL 5A6TC 4ZZ9A 2X8RA 1UCWA 5D9MA 1M68A 1Z9AA 4AX6A 2NXHA 2E40A 2H3BA 4M5PA 1DXIA 2EKCA 1XGEA 3UWEA 1BGGA 5HJXA 3VNJA 2GJXB 1J0YA 1AW5A 3E2VA 3FFSA 2O9TA 4TTUA 3A5FA 1SMAA 1E9YB 4JTQA 4XO7A 1J4EA 4ADTA 1P0BA 2E5BA 2VHLA 4TR9A 1SFLA 2AMXA 2P88A 1XRSA 5AZ0A 4R5EA 3LPPA 3KL3A 3N29A 4CNSA 2RUSA 4A6GA 3ZR6A 1ZP4A 2CETA 3BH4A 4H9UA 3PTDA 3ITGA 1J9YA 3E2RA 2E77A 2O7QA 1PZ3A 3VIIA 1NF0A 3WL0A 5G4WA 4ERAA 1A49A 3O6CA 4LCSA 3DH7A 1E5JA 2V81A 1R3SA 3DDMA 3TW6A 1AODA 1LLZA 1V6YA 5CBIA 1VAHA 4LCQA 1H50A 2QIWA 5K3VA 2QDGA 4EAMA 2P3ZA 2D1ZA 1XRFA 2OODA 4KRZA 3L4WA 3W7NA 4QE4A 1XP3A 1PV8A 4MZ8A 1T40A 1V51A 4PULA 1R2TA 2OZ3A 3C3UA 2ACQA 2B81A 2DSUA 1SGJA 2BP1A 5CZ0A 3IVSA 1TMQA 5MF5A 4O12A 3HIJA 1E71M 5FF4A 2JFEX 1D3CA 2PWHA 2HV5A 2GGIA 2VX4A 3VPLA 3R8HA 1NDWA 3VTRA 4XAFA 2AAMA 1AD1A 1VENA 4O54A 2BNJA 1UWAA 4WK9A 4R7WA 2DH3A 5LNVA 3VGDA 1OT2A 4NAFA 1IZCA 1THFD 2VEGA 3KHDA 3MSGA 5T91A 1UD5A 4NNBA 4H1ZA 1M41A 3KL0A 4FNSA 1O68A 1K9EA 2OG9A 2PCQA 5CPOA 3UJFA 3V18A 3WEZA 2VTFA 1K03A 4AF0A 4Q8TA 1XIFA 3LCIA 4C5YA 4H9YA 5DO8A 4ZTYA 4EWND 4KCVA 3FHQA 2Y8KA 2VD9A 1JCXA 5M1TA 1VRDA 3IJDA 3WQ6A 4NX5A 3H2MA 5A8GA 3OIHA 1CEOA 4C6MA 1MO0A 2ZCGA 3S2CA 2NLIA 3EWYA 3LYEA 1XIHA 4Q4PA 3VIOA 3PZVA 1EUNA 3NQCA 1HGWA 1IT7A 1DJWA 4W8BA 2PA6A 4X22A 1W9DM 5I07A 3MKCA 3U4AA 1WE5A 2FHCA 3EA2A 2QCMA 4F0KA 3F2BA 3WLHA 3QMSA 3VE7A 1CCWB 5ABFA 3AICA 3LEPA 3E49A 2GDQA 2PTYA 2XIBA 1R38A 1CXEA 3B9NA 3HGSA 3F4VA 3KOXA 3H2CA 4X9YA 2E5CA 1FWNA 1GZGA 3R8GA 3S8HA 3WJZA 1GG0A 2D0FA 2XIOA 2L5HA 4GX8A 3ZVHB 5DF0A 3FGCB 3G1SA 1J0ZA 3G1AA 4H6KA 4D71A 5H1WA 2HXUA 1EJWC 4YL2A 2TSYA 3KXQA 1DJGA 4WUIA 5JH1A 4N6FA 5JBFA 3POCA 4AHPA 1Q7ZA 3U9IA 4IFRA 3UY7A 3WQ8A 2ACRA 2PS2A 2FZDA 5SWUA 2E6DA 3FN9A 2E6YA 4YVPA 2PTXA 5A8MA 4DJEA 2Z28A 5F1UA 1S5TA 1VBJA 3B8TA 1KLZA 3BV7A 3PTMA 3EXSA 4PMZA 1XS2A 4CD5A 3LG3A 3RU8X 1D3HA 1S2UA 4PTVA 1AZ2A 4LALA 3R1ZA 1EJUC 3SO7A 2WJEA 4OV4A 1YTDA 3RPMA 4C6NA 3LTSA 4XV0A 4A4AA 2DUAA 2J8GA 3QR1A 4GI8A 2BG5A 4HQVA 3OEXA 2OGJA 1S3TC 3QHMA 1WCGA 2OWWA 1R87A 4MWAD 3SCRA 3A3XA 4Q8MA 2POTA 4ZO8A 4Z1BA 2OU4A 2V3FA 3W23A 2DZVA 3BW4A 3U57A 4HOZA 4DI9A 1P0NA 4QHRA 1I4NA 4PBFA 1SZGA 3C2YA 1W1ZA 1FH7A 3VKJA 3V1PA 1KFLA 4RW3A 2Y5JA 3ITYA 3LUTA 4HTBA 4HA1A 3KOYA 2X0YA 2Y0FA 3VX0A 4DUXA 3GH4A 5KZ6A 5AFDA 3EWCA 4GJ1A 1TO3A 1NWUA 4J9JA 1RALA 5AHLA 4QE1A 2UWFA 1GYMA 4O1AA 1Y5VA 2EQDA 2E8YA 1A5CA 3QRHA 2QDEA 5D2VA 2PRHA 1GYNA 1VEPA 3QLLA 4HU4A 4CCEA 1TJ0A 4H6QA 1V77A 3M41A 1FBAA 1SR0A 4ZEPA 1UZ4A 1YQ2A 4FO4A 3W22A 1OB0A 2MANA 2FHFA 2FGLA 4LAZA 2QULA 5M5DA 1FP8A 4J3XA 3UG5A 1MUCA 3RILA 4P7QA 3EPNA 2QGHA 1FDZA 1DKWA 3ZT5A 4EF9A 2P50A 4XKYA 3GG7A 5AHEA 4DUVA 3HU7A 4ZOEA 5FSDC 4BI6A 3W1PA 4AVNA 2VT0A 2VO5A 1Z42A 3DGBA 3EDFA 1HKMA 3ZS4A 2HSAA 4BQ4A 1BXCA 3M0KA 3VDAA 4XAYA 4ZL1A 1ONXA 2GK1B 1CLKA 2XM2A 4QLJA 2Z27A 4EP8C 2UY2A 4DRSA 3UVAA 4Z1YA 1TG7A 1L8PA 2GUUA 5IFTA 2BODX 1S46A 4EIVA 1OK4A 4CD4A 3HG2A 4IP7A 1VCVA 5G1TA 3JZUA 4S3GA 1HUVA 4UBPC 1VIWA 4JTKA 2V9DA 4G8TA 3IAQA 2ZC1A 3WDHA 4LCRA 3LHTA 5IRPA 3WUBA 3NQMA 4P8WA 1HJQA 4AZHA 4HPJA 4LFYA 2Y8VA 1EQPA 5BRBA 4HCDA 5FF3A 3NL6A 3NA8A 3GTIA 1IZKA 4P2VA 2W9MA 3MZNA 4KS0A 4WCJA 3TKFA 3ATZA 3OODA 1ZBKA 3S2LA 3TQPA 4F2BA 3CEPA 4C6LA 3VM5A 1B4KA 1JGMA 2AOSA 3GTFA 3DKLA 1EYWA 1EC7A 4M82A 1N8IA 3STEA 1VCGA 2C19A 2AMGA 4C7DA 1JEZA 4KCUA 3BC9A 2CU0A 1J18A 5C5YA 1GKQA 3KZSA 4J4KA 3ITCA 3QHNA 4CCDA 1ZPTA 1US0A 2ZZ6A 4YMZA 4CQBA 4GG9A 3Q45A 1W5OA 3BLFA 3H2AA 3RN6A 4NF7A 1FWRA 3NR0A 5ECVA 1IF2A 2WC3A 3VOJA 3ZYZA 3UXKA 3SUUA 2OEJA 4KF1A 4NZCA 3LCHA 4XZIA 2WZHA 4CVWA 2IKHA 2PGWA 1NFBA 4XVDA 1XIEA 1UR9A 4X2RA 4IMAA 4M29A 4ECLA 1Z7AA 1ITCA 3R8RA 4QEHA 2XIQA 3FKKA 4HNVA 4O53A 3HA1A 1QUMA 4E3TA 3E9AA 3VUSA 3RCNA 4PUKA 4REQB 4L6HA 2QNEA 2DP3A 1BYCA 4GUFA 4KKXA 1DWJM 1Z6KA 3CH9A 1JJKA 2GUYA 4I3GA 1W9UA 2CWNA 2G50A 3D0CA 4ZOBA 5KZMA 2Z7GA 4CQAA 3N12A 4Z2HA 1Z8AA 1FCBA 1N82A 3BZGA 3LGGA 2BBFA 1TYGA 4DPPA 3CAWA 1XBZA 1W9VA 5CPMA 2GJLA 2WJZA 1MEWA 1L2QA 4ZQPA 4UTIA 2W0UA 5FESA 4DO4A 1F4HA 2HCVA 3S2JA 1GTHA 2XHYA 4GWEA 2VZTA 4XZMX 4YNGA 1JR1A 1C7SA 1POKA 1L6GA 4GRSA 3QHOA 1GHRA 1XBVA 4DBWA 4LV9A 4HYWA 1ZENA 4Z08A 4YXGA 1D3GA 4FHAA 2TPSA 2XINA 3ARPA 1MI3A 3BL3A 4UQDA 3NYZA 5DELA 2NWRA 3WQCA 1JPMA 1XHGA 1G67A 2YR1A 3MA8A 1XYMA 4JY9A 2BOFX 5DRCA 4JAWA 3QN3A 2PU0A 3K8KA 3ALFA 3LK6A 5BRQA 1XFBA 1ME9A 1BKSA 1KV8A 2E67A 3W4RA 4QDWA 4RDZA 2UV8G 4J5NA 3S47A 4MYAA 3OHMB 1SM9A 5JIWA 3VOFA 1W3TA 4MNKA 5M3WA 3ABZA 2VRQA 1K8YA 3BSMA 3T55A 3M5YA 3HN3A 1TTPA 2FB3A 1DBTA 2GL5A 3OPSA 3TYCA 1P0DA 3SUTA 4AG0A 2VM8A 3PZGA 1M53A 1OX4A 2HK0A 4H8HA 3FNDA 4RZ6A 4H7VA 1A5NC 2YLAA 2WSPA 1NOUA 2P1FA 1GPFA 2YL8A 1IR2A 4PUEA 1R47A 5KMYA 4A3HA 2CZEA 2V5JA 3B4UA 1EDQA 4WVXA 3W74A 4I5RA 4HHLA 3S5NA 1BXBA 3NPWA 3WQ5A 4F3HA 1LCOA 3OA5A 4ZQNA 3WF2A 4IQJA 2OZTA 3SFWA 2A3CA 3BANA 4D9PA 5CG0A 1UP2A 1ODZA 2OMAA 4QNEA 4MWAB 3HMCA 1ZRQA 4A29A 1TWSA 3U2CA 4ATDA 1YBQA 1EYEA 5AYZA 3CZEA 3UP8A 1PKNA 3TAOA 4F8XA 1PTAA 4O0KA 2CKRA 2VZVA 3K2GA 4R85A 3BOXA 4N2YA 2DZSA 5FEWA 3W2JA 1G4TA 1HQTA 2D2JA 2WC7A 1D7KA 2DUZA 3B4YA 2QW5A 2DJLA 4IGHA 3G1HA 4ACZB 3UCQA 4B3ZA 2GLKA 2CLOA 3ZXWA 3TOYA 2VZUA 4XWUA 4NZ4A 3N2CA 3IK4A 4MJZA 2VVSA 5GNZA 5C6MA 5FEXA 2WM1A 4C6JA 3WELA 4MFDA 3BMXA 4JR5A 2Y4SA 3BTNA 2QJHA 2ACUA 2XZ7A 1AFSA 3QZAA 3W00A 1O4UA 1DJNA 2G97A 2IS7A 4GACA 2GGHA 1EJSC 2PBGA 3MMWA 3TZFA 4IJCA 3BG5A 3L7RA 3CHCA 2RDXA 2FHBA 3N18A 4XD4A 1V7AA 3SGGA 1PIFA 2OPJA 3NYDA 3H23A 5HXMA 1CXLA 5DANA 4X2PA 4JIIX 1UOZA 2OOGA 1XR2A 2WV8A 3FJNA 4GVFA 1A5KC 3LMYA 2ODOA 3PULA 1BWVA 4L6OA 5CLWA 1QI5A 1KB3A 4GY0A 3WLMA 5EFDA 3PWAA 2ZUUA 2WZMA 4QG8A 1W17A 3WLTA 4JD4A 1GOQA 4NL1A 4MY9A 1US2A 2PD9A 4DI8A 4XAGA 3QV8A 3W7QA 1TWIA 3KRUA 2R14A 1QVBA 3B9EA 1UWIA 4EX4A 3CL8A 3Q65A 2D0HA 2PAJA 3PF3A 1W0MA 3WJYA 4CCCA 1HJXA 3NL2A 3AMKA 3GUWA 3EYPA 1J5SA 5AHIA 1J2WA 3MTWA 1Y65A 5HAOA 5FL0A 2BOGX 4B4FA 2Z1WA 2HVNA 1KFCA 4IFOA 3T09A 1UP0A 4WGHA 3BV4A 1HJUA 3K1GA 1PWMA 1VKFA 3AS1A 4IIEA 3VMNA 4JTEA 3F2DA 3PUOA 4IT1A 1J0KA 1QHPA 1ZGDA 3HGRA 1IXQA 1EHAA 4KFOA 1OF6A 1QNOA 2OQHA 1YPIA 3V5OA 4D8LA 3VD4A 4HN8A 3W7GA 3WQVA 2BVYA 2WNQA 3ARVA 2FZNA 1ZSXA 1XH1A 4ZQMA 1QI2A 4M1BA 2HE8A 3THDA 1WKEA 2WHJA 1NQ6A 4JKMA 5A5WA 1LBFA 4O15A 4PSRA 2VX7A 6REQB 4ZB2A 2ZZ2A 2RKXA 4E2DA 5CC5A 1M65A 3EEZA 4HN4A 3B8DA 4LYPA 3WH7A 4AQLA 3NSMA 5H2ZA 4FXFA 1KQYA 1ICSA 3ITTA 3USBA 4GYJA 2DGAA 3W2KA 1G5AA 3PVFA 2WZTA 4JOMA 1G4SA 3KDOA 1W3JA 2YGYA 1PZ0A 2ZOXA 3QJAA 5C2GA 2CBUA 2DPEA 3HURA 3NQ7A 4H9VA 3RF9A 1OABA 1H7PA 1DPMA 1FWHC 3QSRA 4L9YA 4US6A 3SCNA 4Y7EA 2I57A 3CTTA 3G1DA 3ITVA 4AIOA 5LNWA 1K4GA 3AMGA 2ATMA 2RDWA 4LY4A 4P61A 2YCJA 5A6JA 4PN2A 2GPTA 4QJ3B 2WVVA 4BI7A 4KWWA 5C55A 3B0VC 4R53A 1LLWA 2AQVA 1GJPA 3A12A 3U0HA 4IHCA 3RLVA 4Y9NA 1ME8A 3AMLA 1L6SA 4BS0A 1AL8A 3ENLA 3PNZA 1SJBA 1O5RA 1MNZA 3QV7A 3AIQA 1FXQA 1H1YA 2EO7A 4ZB5A 3WNNA 4RNFA 3AU6A 2Z2UA 4M6PA 1KM1A 1OG0A 2D3NA 4IIGA 3SBFA 1E1FA 4PFHA 4LUJA 1KM0A 4S3CA 3KCOA 3N11A 4KIEA 4XISA 3CLWA 4MNJA 3TJXA 4D6FA 5IFPA 4JIPA 3F4CA 1FWEC 2D20A 5AHFA 4H8UA 1E4LA 2TODA 1FP9A 3BICA 3C2EA 1EO7A 2VI0A 2Q6ZA 1SJAA 2PSNA 1M03A 1KNWA 4KWVA 1NU5A 1JCMP 4TV6A 3UW6A 3L5LA 5C2XA 3LGDA 3P7YA 4GYKA 1R3WA 5LNRA 1JCNA 2LLEA 1JRCA 4I90A 5BU6A 2YFOA 1DIDA 3W7OA 1FCUA 4MUZA 1XWYA 2E9BA 2REQA 3PBMA 1DJIA 5TBOA 4MM1A 3OLGA 5CC6A 3UJEA 1QBAA 2ZX9A 4DF0A 4O11A 3SN4A 5M03A 3A9IA 2GJNA 2XYLA 4AD4A 4C6EA 4O18A 2PDNA 1XKYA 4ZA0A 4QRNA 3PZIA 3OQ8A 3AO0A 3EOEA 4U31A 1SO6A 2Y7GA 3WEOA 3NSXA 2GJXA 3GNDA 1S2TA 1P7TB 3OGVA 2OXNA 5LNUA 1WPCA 3W76A 3HQPA 3W81A 4IMFA 3B97A 1TFVA 2PGFA 4N9EA 3RRAA 5AY7A 3XIMA 4D6GA 4EPBC 2BXYA 3MMDA 1E9LA 3W7IA 3W37A 2ZA2A 3PUGA 3N14A 4UTFA 4U28A 3W1XA 3CYJA 4LGXA 1NM9A 3ZWSA 2A2IA 4JYFA 5D4YA 3LD5A 2G95A 1J6OA 3W25A 1CB2A 3FCPA 4O8RA 2Z6IA 4NSBA 3FEQA 4HA0A 4K3ZA 5KTLA 3NURA 4FAMA 1JQVA 2X05A 1BRLB 3QFWA 2XUCA 1AQMA 3KVLA 3HTWA 1DJHA 3CS2A 2VCCA 4BF5A 4FK9A 2A21A 4WD0A 5FJPA 3U7BA 1TE1A 5BMXA 3POHA 4Q8UA 4BQ2A 1UWTA 4RPPA 3WQ4A 4NXSA 2Y62A 4W86A 4EE9A 3O63A 1FWFC 4QG6A 2Y85A 1LZOA 3K4WA 3RRXA 1GKPA 4S38A 2NVDA 3P8IA 1SZEA 4PCPA 4XAPA 3BLOA 1XLMA 3HPXA 3GXDA 4XUYA 4K1WA 3TN3A 3U8GA 2BZNA 3MHUA 4B92A 3LXBA 3SURA 1XGDA 4PB4A 1FWWA 4WQ6A 3PZOA 1QU4A 1ME7A 1P43A 1E56A 1PX8A 2HQAA 4HU3A 5D05A 4GINA 2OCZA 1MXSA 1C9DA 2QVHA 4IGSA 5CGMA 3GXPA 5EFFA 2WCAA 1T5AA 1S1RA 4JBRA 5A95A 3GXNA 1NP0A 3GRIA 1B9ZA 1DOSA 3VNMA 3TJLA 4Q3MA 3LNPA 3U5UA 3EWUA 3GFXA 1ZAIA 5F2GA 1PYMA 3N04A 4WLCA 3PAOA 2R8WA 3WLPA 4PRTA 2YDQA 4JDBA 1CGWA 4IIHA 3S1VA 4F2UA 2ZRWA 1E15A 3K46A 4L4OA 3BGJA 3IRDA 1K9FA 3WL1A 3NXFA 3BLIA 4RR4A 2IXVA 4GYFA 5F2LA 1F3EA 2P8BA 1XD1A 1J01A 3S9ZA 2BB0A 2D69A 1CBGA 1XYLA 1WO2A 2Z1VA 2OLHA 3EWBX 1GJUA 3WD1A 5DBUA 2OWXA 4AXNA 4AWUA 1ZCOA 3AHXA 2HE5A 4LSBA 4I6VA 2GYIA 2I9EA 3LV5A 4GE8A 5KINA 3MBDA 2OX1A 4DAIA 3S6DA 3F7JA 2C79A 2E6FA 4GYPA 3ZR5A 1FKWA 2FJUB 2ZUVA 1VYPX 1K9DA 1XD0A 4C6CA 2ZX5A 2WBKA 3BARA 7A3HA 1CPUA 2INFA 3MYOA 3EMZA 3GDTA 3GXFA 3W75A 4FB7A 3N1AA 3ZVHA 2HS6A 3AFBA 3FGCA 1TCMA 3LDVA 3M5VA 3NVTA 3AIVA 4V28A 3VD5A 4DZHA 3LHZA 1UP3A 1RV8A 3TWBA 4L1WA 1KM3A 1XICA 3NZQA 1N8FA 3CPUA 3BZJA 3S5ZA 4K68A 4CQCA 3IGUA 3I4EA 1W1B1 4E0CA 4ICNA 1SJCA 2HISA 1E9ZB 3CQKA 1ADSA 2VMFA 2Z1SA 3CWNA 3T2QA 3VOIA 4ROQA 5CJMA 2PC4A 3SJNA 3VNKA 2YA2A 4MY8A 3AYVA 3IIPA 4IWWA 3TVAA 4DZ5A 1NDZA 2ZTJA 4UFHA 1A5OC 2O0TA 5AVHA 4XZ9A 2B7QA 4AC1X 3NGJA 1OSEA 4AFYA 4CUCA 1W5MA 1ISVA 1QJWA 3G77A 1ISYA 1MMFA 1VBGA 4ZCWA 1EC9A 3W7LA 7XIMA 5LHFA 1X97A 1XGZA 3I3DA 2BGQA 3AIUA 3KBVA 1RY0A 4WKHA 4NZFA 1HO1A 3P6LA 5FF0A 3M6DA 3CUIA 1P48A 2CITA 1RLCL 3KOWA 3SQSA 3GG8A 2W3ZA 2Q3OA 1O1HA 3OYZA 3TFCA 2CBJA 4MKSA 1QASA 2VZOA 1RD6A 3DN5A 1DL3A 2PE4A 1HP4A 2QCDB 2EPHA 4YTQA 4NRSA 4J27A 2R9RA 2V63A 3QGAC 2X7VA 1XDLA 3URAA 1W6TA 4LVAA 3IWPA 1YRRA 2WPBA 3GIQA 1H41A 4XIAA 3Q94A 4L6DA 1RCQA 3GLCA 2AAAA 2J8FA 3ZIZA 4DJED 4ZODA 3L2MA 4M6QA 3BDKA 5A2BA 3E96A 1LBMA 3DFPA 2ZUSA 4GPNA 1I0DA 1WBHA 3VOGA 1MW1A 4UMCA 3QSTA 1LT8A 3O6DA 1UWSA 1M7XA 3GC4A 4H19A 1EDGA 2DZXA 1KWKA 3EB3A 3PPHA 4ATLA 2WCGA 2X2YA 4AHQA 4DUWA 4WKAA 2ZDSA 1E4MM 1AQFA 1XLEA 4NQ1A 3WK2A 5K7JA 3TOPA 3VU2A 3WG6A 3ABXA 4C6KA 1EP2A 3W2UA 5D03A 2ZIDA 1ZJIA 3B8VA 3WJWA 3WK1A 3N2MA 3T1GA 5I3IA 4PRWA 5FJTA 3S1UA 1DWGM 4ZQOA 1GQJA 1XIJA 3GVRA 2EPKX 4Z2IA 4EKJA 3DG6A 1ZS2A 2GK1A 4IL0A 1ZAJA 4JTFA 1KCKA 4BJHA 1S2WA 2DVUA 4MLJA 1BD0A 2OJPA 3PFRA 5IHSA 3TLQA 1QXLA 1W1YA 3GY1A 3V16A 1MSSA 4RLIA 3THUA 1UPMB 3KUMA 1QBBA 1KCLA 5K9XA 3HGOA 4QDPA 1HG3A 1B54A 2OLSA 4OOZA 1E6XM 1D2KA 3P67A 2C16A 1H49A 4JPGA 2PDBA 2IKGA 1XSIA 3MUY1 4GIRA 3ARSA 4WDUA 3EWZA 1RCOB 1YEYA 1TTIA 2BY1A 5MKGB 4IX0A 3MPGA 1WNOA 1KBLA 3HPZA 2R1PA 2PLMA 3DC8A 1EUAA 4UZUA 4Q33A 1SJDA 4AWEA 3O6AA 1NSJA 1UR4A 4YTRA 3PUDA 5GJMA 3L2LA 1LQ0A 2ADAA 2CLKA 3NL3A 1RA5A 4UMBA 3IJ9A 1JAEA 1MEIA 3THAA 2ZWZA 3M0YA 2BTMA 2XFRA 3NM3A 3G5EA 2E9MA 4Q7BA 3V3WA 1IR1A 1L9WA 2A85A 3FX4A 5A8PA 4J3ZA 3PNUA 3W07A 5HQLA 5REQB 4XSLA 2XVLA 1SYTA 1U1UA 1UZDA 4LS2A 1LF1A 4GHRA 2GSJA 3ECQA 4UTTA 1X8CA 3CIWA 3JZEA 3TTOA 2F7FA 4XKMA 3UD6A 3GG0A 1B3OA 3NNTA 4F0RA 5DT7A 1UKTA 1EX1A 4DXXA 1AZ1A 1DXEA 3GHUA 3A9BA 3V5CA 3ZZ1A 2WSKA 3LCXA 1M6JA 3L4XA 3SCQA 3ZWTA 3TLLA 3J7HA 3URNA 2X09A 1RY8A 3OGRA 1TV8A 1ODUA 1QI0A 4S3FA 3AYRA 1IYXA 1K7FA 1DE6A 3R10A 4NRRA 4PMYA 4REQA 1R3TA 2WKJA 1JF6A 1F4AA 1T8XA 2C8NA 3QKZA 2PPGA 3GC5A 1M5WA 5I78A 5LHEA 4YN5A 2CEQA 1LL4A 3HG5A 1WX0A 3ZT7A 2PDIA 3ZJKA 3OZYA 1HL9A 3VMPA 3A47A 5HMFA 1EEXA 2E25A 4CNUA 4IH3A 3WD0A 4LRTA 4F9JA 1E55A 1W1IE 4B16A 1E6ZA 2VRJA 4BFAA 3LCWA 1YE6A 4DO5A 1UWUA 1EP1A 4LUIA 1G0CA 2VR5A 1PEZA 1WP6A 3TAKA 2HBXA 4HHMA 1W56A 4NAFB 5LXEA 1CX9A 1FWGC 1C29A 3ZO9A 2ZRUA 3RMEA 3HOJA 4EANA 1V6WA 1X1OA 2YA0A 3W7PA 3UETA 1E73M 3UXDA 2C14A 5DXXA 3ICJA 4NJHA 5DN1A 5AZ1A 1WZMA 1X98A 3GZ3A 1I75A 3R94A 2ZE3A 3MO4A 3BCJA 3O9NA 2ZUWA 3JRKA 4HMEA 1XYBA 3L4VA 1YTKA 2G3IA 1BVWA 4LAMA 4MPKA 3QH2A 2ZXAA 1FWTA 3W1UA 2X41A 4OTKA 4R27A 1ZUAX 5B7YA 4GUHA 1I1XA 1RVKA 2Z1BA 4GA8A 1R9YA 3N3MA 3HM7A 3GDKA 4KRTA 3M0MA 1SQ7A 3CXOA 4FA3A 1JD7A 4RZ5A 3VIPA 3BLEA 3AIWA 4NAEA 1O5XA 3A24A 3ANVA 1R5YA 3P0WA 1BG4A 4DVOA 2CXEA 2V5BA 3BE7A 4WDXA 5CXPA 3G0XA 1LM1A 3XINA 1IXOA 2WKGA 3UZZA 5DY3A 3C61A 4JHMA 3GO2A 4FZIA 4UOZA 2BVWA 3M5ZA 4E2VA 3EX3A 4Q8OA 1OC7A 4GZ7A 1KR0A 1OADA 3OJGA 5C7VA 3A5VA 3SCWA 4G5DA 3CV7A 1TQJA 1RP9A 1T96A 3T0CA 3CHFA 3HB9A 4DLMA 3L66A 1XSJA 2Z25A 4KIRA 3D3FA 3NSNA 4LNYA 4WGXA 3CZGA 1Q8JA 2DIEA 3OA3A 4ORIA 3QPYA 3L4TA 3UR2A 5D30A 3VYLA 2CESA 2WBGA 3EXTA 3VDHA 5GNYA 5CH9A 2QPUA 4ACZA 4FXRA 2CNCA 3AXKA 1IGSA 2GJRA 1K8ZA 3RCYA 3EX6A 1GOOA 2RHGA