4NQ1A

Legionella pneumophila dihydrodipicolinate synthase with first substrate pyruvate bound in the active site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
289
Chain Sequence
MFSGSIVALVTPMRNDSVDVHHLRELVEFHIAKGTHALVAAGTTGEAGTLSHSEKLLVIKTVIEQAKERVPVIAGTAMNATKDCIELTQQAMEYGAHAALIMTPAYIKPTQEGLYLHYSHIAQSVAIPIILYNVPGRTACDMLPETVARLAKISNIIGIEATGQMTRLQQILRLCEGSIDVYSGDDLTAAQWLLSGAKGVISVTANVAAKLMAKMCDLAMDDDQAGCLRIQEQLMPLHELLFVESNPIPVKWAMKKMGLIGGELRLPMTELSEKHHQALEKVLKNLELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
publication title Legionella pneumophila DHDPS: The First Case of Non-Lysine Inhibition in a Gram-Negative Pathogen
rcsb
source organism Legionella pneumophila
molecule tags Lyase
total genus 104
structure length 289
sequence length 290
chains with identical sequence B
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2013-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nq1A00
1GWJA 3IIPA 5LNVA 3E12A 3G1XA 4TO8A 3TSMA 3LBMA 3QEZA 2BXVA 3MI3A 3DFNA 1YXYA 1KV8A 2A85A 4EVZA 3S8HA 3GK0A 3P80A 1LDCA 3PUOA 1YPIA 5AHMA 1RV8A 1TPDA 3V75A 2FB2A 1FCUA 1ZY9A 2XFWA 4O50A 5KSWA 4XWUA 5CPMA 5J5RA 3E0IA 3NL3A 5HQEA 1KM0A 4XTIA 2PRMA 4KWWA 1OFPA 5AHEA 1TQJA 2GVLA 4O12A 3NM3A 2Y89A 3DHDA 3LHUA 1E51A 3W07A 4LWWA 2CFFA 1PHQA 3IIZA 1EUAA 3NZ1A 2ZA3A 3TV8A 3UXAA 4Z1CA 4E0CA 3GVGA 3LXBA 4RV8A 4C1LA 1F74A 5F1VA 4WD0A 3YPIA 5G4EA 1B57A 4MZYA 5A8GA 1Q6QA 5AB3A 1TPEA 1ICSA 3B05A 4O54A 2C13A 5EMUA 5DCDA 4EWND 2V30A 1KTNA 3BGGA 4K7YA 3HG5A 1H7WA 4ADSA 5SWUA 1ZNNA 3HGRA 3STCA 2ZRUA 3A5VA 3NL2A 4GBUA 3QZEA 5LNSA 1G7VA 3B4UA 5I3IA 4PA8A 2AAMA 3TAKA 5D37A 1TPFA 4GUJA 2FIQA 1G6CA 2R14A 4S2BA 2G97A 4HSOA 4WUIA 3WFAA 4UTTC 4O1BA 4NUWA 2VEKA 1O95A 1X6UA 3G24A 1OYBA 3LOTA 4IX0A 4O53A 4DEFA 4IPJA 1WX0A 4JDYA 3NO5A 4TU1A 1LBMA 2WNZA 2OX1A 5KZDA 2QJIA 1TPVA 3W2MA 2QJGA 5LNUA 1SUXA 4DF0A 2B7PA 5C5YA 1VPXA 4K7VA 3L0NA 1MSSA 1XM3A 3QF0A 3CQ0A 2VC6A 5C2XA 2JKPA 4RJEA 1TJRA 2P10A 3BW3A 4LC6A 2YSWA 3NQ7A 4JTUA 2ZZ1A 4M7SA 3GDKA 2GJLA 5BW6A 5L6UA 1SO3A 5FF3A 2VELA 4LOCA 4DPQA 1ZAIA 3IGSA 3HIJA 3DH7A 1H60A 2E6DA 4O16A 3E02A 1BEUA 1F5ZA 1TTPA 2J27A 1Y0EA 1IXNA 2RFGA 4U4MA 2P1FA 4CQAA 4L4LA 3P67A 1Z41A 4N2YA 4ZVJA 4K6AA 3BPWA 3E49A 3NNTA 2QR6A 1K02A 3PY2A 3KFTA 1X1ZA 3IVSA 3PAJA 3FFSA 4X9SA 1C8VA 3G1SA 1SZNA 1DBTA 4UTTA 2Z0IA 1RVGA 4WOQA 4N9DA 4UFHA 2PURA 4M5PA 1TPUA 5KMYA 2Y7GA 4MY8A 1J5TA 4NJGA 2YFNA 4Z0JA 5CSRA 4S1FA 2DJLA 2VFFA 3W7OA 5HINA 3C52A 4LVFA 4AF0A 2CLOA 2JBMA 4N4QA 1KFLA 4CCCA 2WO5A 3BK0A 2AQWA 3STEA 1XUUA 4JS3A 4NX0A 1JQXA 5G4WA 4PL2A 3N9RA 4E2DA 4FX8A 2GOUA 2P0OA 1G67A 2B7OA 2QUUA 1OFAA 4NQ1A 1MZHA 4K37A 1ICPA 2HTMA 3O1NA 4ADUA 4ML9A 4MUZA 4JEQA 3QW4B 4XKYA 4H3DA 4OHQA 3ZWSA 1OX4A 1OVDA 3CHVA 1EPXA 1K7FA 2ZRYA 3ELFA 4FNUA 4QSHA 3MUXA 4O17A 1VQTA 5D32A 3UNDA 3ZFHA 3STGA 4O8RA 3HF3A 4UR7A 4JD4A 3L2IA 5LGXA 4OGZA 4Q32A 1F05A 1LRNA 3NM1A 3P82A 4JYEA 4NZJA 3PS7A 4ORIA 3MBFA 3A23A 4UTHA 3WJZA 4LS0A 2WKJA 3GNNA 4PH6A 1KM4A 4N9CA 3VCRA 1OK6A 3V1PA 1N55A 2QAPA 3M5VA 2CZEA 4TMBA 1K7EA 3CWNA 4BFAA 4U28A 3EWUA 1KFBA 1FWWA 3VKJA 2C18A 1M5WA 2ZFAA 1GT8A 1F6KA 1B4KA 1KTCA 2FDSA 3LXAA 4R7JA 2WOQA 2G96A 4E2BA 4AWTA 5T26A 1DQXA 1MEHA 1FX6A 3A24A 1H5YA 5AHFA 4MZ1A 3G1AA 3N2MA 3M47A 3GXNA 3W85A 2C6QA 3TKFA 4EIVA 1FY6A 5CKSA 4MYAA 3I7RA 2W6RA 3GAKA 3PG9A 2A2IA 4PC8A 3TSBA 2Q8ZA 1WA3A 4YCOA 1JVNA 3MYOA 1PL9A 1OK4A 4FEZA 2C19A 1XBYA 3CC1A 3PBVA 2A21A 3B0VC 3PB2A 4ZQRA 1TCDA 3QMTA 3EX2A 3W7PA 2NZLA 2FPVA 1FCBA 1RD5A 4CNOA 1A5BA 3FJLA 1WBJA 2ZZ7A 4DBDA 2YW3A 3U2OA 4AAJA 2PCQA 4OWGA 4GNJA 2X1TA 2YYTA 5TBOA 4CNPA 1H63A 1QO2A 3O05A 1EB3A 2JK2A 3TQ0A 3EXSA 2NX9A 2Q3RA 3TQKA 1W5OA 3MHGA 1YTEA 3PBUA 4FXSA 3DGRA 3EKZA 3M7WA 3O6CA 1SQ7A 3W1XA 3W2JA 3HPXA 3TU9A 2JGYA 3QM3A 5HJLA 3GKFA 2HSAA 4DO4A 3MWAA 2ISVA 1AL8A 2X1RA 1HO4A 1TPC1 2XN1A 5FI8A 1DJQA 1OX6A 1W0MA 3A9IA 4Q4KA 3R5EA 2ATSA 5HWMA 1G7UA 3BLEA 4FF7A 4KWVA 3F03K 1UCWA 1M7PA 4O4VA 3CWOX 1TPH1 6ALDA 1XDLA 3BVJA 3G18A 2GJNA 3O15A 2ABAA 3MI6A 2RH9A 5TIMA 1JCMP 2VKZG 4Y96A 1FDYA 5BOOA 2V8ZA 3PWAA 4N4PA 4JTKA 1ZAHA 3QPYA 1RPXA 5CPLA 3LHYA 2QCEA 3EWBX 4ZL1A 4TR9A 4D2JA 4OV4A 4M6PA 1FCVA 3RFAA 1A5CA 3GZ3A 1O5KA 4QITA 3TW7A 1G4TA 1UUOA 4XBKA 1BWLA 4O1AA 1D3GA 1VHCA 5DCBA 3VE9A 4CCDA 2BWGA 1R30A 1PCWA 4Y6GA 3HPSA 1ADOA 5TQLA 3BV4A 3IVUA 2ZZ6A 3LDVA 2GVGA 1H61A 1P0KA 1O94A 1SR9A 2V5BA 3Q58A 3MJYA 1L6WA 3W7NA 3GDMA 4PODA 3SZ8A 1ZAJA 3TFXA 3P81A 3G8EA 1NF0A 5EL1A 3WJWA 4JIPA 5H91A 3WK2A 4CCEA 3CB8A 2QDHA 2ISWA 4RX0A 3LLDA 2A1YA 2CZFA 2X16A 4FHAA 5G2HA 1TV7A 2ZZ3A 5DELA 3OEXA 1QO5A 1H50A 4BI6A 2Q3OA 2A7PA 3S9YA 3PB0A 2A5HA 2J9XA 3W1UA 1XUZA 4AEOA 4O11A 1UUMA 3LI1A 4NJJA 1GVFA 2E5DA 1SO6A 2Y70A 3FYOA 4UTJA 2V5LA 2GPTA 4JYDA 3QJAA 4K38A 3DKJA 1B3OA 3KAOA 1QPRA 3UWQA 2H3DA 4O10A 1A5AA 3DZ1A 3W1NA 1TRDA 4O15A 1W3NA 1VR6A 4JICA 5D2WA 5D02A 1IIGA 4X22A 4RZ6A 2C15A 4Z08A 5LGZA 3NOEA 3PBYA 3TC7A 3W1AA 4QQ3A 2FQIA 4QAIA 1RQHA 5BRBA 3LI0A 5CZJA 4MPQA 4FNTA 2FTPA 3GDLA 3UPWA 1TREA 4XQ6A 4LVDA 4WOZA 5LHEA 3W7IA 4A2RA 4N9EA 3HGOA 5AOUA 2ZZ2A 5G2WA 4ZMGA 4AH7A 4UIOA 4AHQA 3LHVA 4A3UA 3IRDA 5F2IA 3LCFA 1KFEA 5D2YA 3FLUA 5D05A 4M6VA 4RK8A 1MEWA 3PUDA 2J24A 4K36A 4AXKA 4CNNA 1WQ5A 3NPWA 1VYPX 2VFIA 2NUXA 2W79A 4DF2A 2E09A 2I14A 1X1OA 1JQVA 3G8RA 1ZCOA 3LV6A 4DQWA 5AC7A 3G1FA 4IMEA 5LZLA 1PE1A 3GDRA 1LOLA 4NXSA 5D33A 2E68A 4A21A 2VXNA 3HGJA 4GUHA 4UTIA 3WJXA 4O4WA 3C2RA 3NZRA 1FWRA 3W71A 3F4NA 5KINA 5DBTA 4QJ1A 1FCQA 2YGYA 1U83A 3DFSA 2QCGA 1OF8A 3B06A 4B5NA 1N7KA 4A29A 3LV5A 1SW3A 1GG0A 5HNRA 2OJPA 3NG3A 3OVQA 4RKAA 3Q2DA 1Z44A 3BW2A 2WPBA 5K3VA 1FWSA 4WY0B 5BMXA 4YCPA 1I2OA 1TB3A 3S5YA 5K7JA 5AHIA 1HFBA 3RLVA 4LNYA 2QCHA 4M7TA 1KFJA 3NQ2A 1Q45A 2LLEA 1DV7A 1DL3A 2Y7FA 3F4WA 3NVTA 4NXKA 4XZ9A 1TYGA 1AK5A 3C56A 4HPXA 1I2QA 4LT9A 3W1LA 2QJHA 3W84A 5KZEA 4R33A 4L4MA 1TQXA 4GUIA 4JTJA 2OMAA 4Y9AA 2H6RA 1HO1A 4MJMA 4MY9A 2ISSA 3C2OA 3GR8A 5DXXA 2DZVA 2F84A 4ONVA 5FEXA 3SECA 3TROA 2V0TA 3DENA 4WX2A 4Z0SA 4CQ9A 4QIUA 3NQ8A 1I2PA 1SPQA 2XN0A 1YDNA 1EIXA 3I68A 3EX3A 4ICNA 5D2VA 2EHHA 1VZWA 3NPXA 3VI2A 1XL9A 3GKAA 1XDMA 3LCGA 2BX7A 4Q33A 3UWWA 1TTQA 3L0GA 1KBIA 4MFEA 4PL1A 4NJIA 2EF9A 2W0UA 5GVJA 5EPDA 1M6JA 4OT7A 2Y88A 1KFCA 2B7QA 4O28A 4N02A 4R34A 1ME7A 3CTLA 3DHFA 1HTIA 3CT7A 1FBAA 3W2LA 2RDTA 2A7NA 1EUNA 2BZNA 3W1PA 2ALDA 1Z48A 1GEQA 4FNSA 3GLCA 4IMCA 4JDBA 4XUGA 5KTLA 1WOBA 1TRIA 3SJ3A 3NR0A 3TDFA 1K3UA 3NPVA 1DJNA 5AC8A 3IIXA 5LKYA 4LU0A 1K8XA 3T78A 3C2VA 1YADA 3SGUA 1NSJA 1IXOA 4ZQCA 4FO4A 4CQ8A 2Y7DA 3FKKA 3SR7A 2OZ0A 1KM1A 3EWYA 4IMDA 4I9AA 2FLIA 1TV5A 1W31A 3Q94A 3H55A 5F4WA 2NXHA 3NXFA 5L9FA 3W2KA 1LRTA 5DN1A 1TTJA 3W1TA 1W1ZA 3NGJA 1V7YA 4UR8A 1UBSA 2Y61A 2ZQ0A 1QFEA 3NL6A 1KM3A 5CPNA 4LS2A 5LHFA 3WJYA 2FPYA 2CLLA 4UMBA 1QNVA 3KRZA 1LROA 1L6YA 4AB4A 4RZ5A 5HUOA 3EWWA 2QCLA 1G4PA 1V5XA 3FA5A 3HG4A 4OBTA 4QNEA 5G1TA 4LY8A 2WNNA 4LC8A 4WJEA 3PBWA 4GXMA 3W75A 1ZALA 3HOJA 1NVMA 3DU0A 3QW3A 3LCHA 3C3NA 1GYNA 2I9EA 4PCFA 4MY1A 3W7KA 1SSGA 4FB7A 4C1KA 2DU2A 3OIXA 3M44A 1Q3NA 4GFSA 1EEPA 3TW6A 1MO0A 5AYXA 3PVFA 5G2IA 5U7SA 4GUGA 3W2UA 1PCKA 5FEPA 1UJPA 2V81A 1T0OA 4IUOA 3CIXA 2YCEA 3M1ZA 3W7RA 2AGKA 4IGHA 3NQCA 1DOSA 1WXJA 2DJXA 2G5WA 4UTLA 3HBLA 3T55A 1S5VA 1K7XA 2QCDB 3BARA 2YPIA 3OG3A 3LRMA 2E77A 4DELA 3NQAA 1Q6RA 2V2HA 4DXVA 1CX9A 1ZHAA 3JS3A 3LCIA 2FJKA 3N9SA 3I65A 5BMWA 4UFKA 1PS9A 3BG3A 3HG2A 4JTSA 4P2VA 3ATZA 1RZMA 4O13A 3RU6A 1PV8A 1QDSA 1SO4A 3O16A 3I7QA 4FIRA 1IIHA 3G1DA 4UMCA 2R94A 3SGZA 4HNUA 3SW6A 4M6QA 4YXGA 2I1OA 3THAA 2R91A 3P7YA 4FIQA 3L67A 1VJIA 5DY3A 1EP2A 3S1VA 2VENA 2ATMA 3S0CA 3L5AA 1QWGA 1IGSA 5A5WA 3TE9A 4JTIA 4PEKA 2HMCA 3QSTA 4I7VA 1WAUA 3MP4A 3FEMA 1LOSA 3KVLA 3L21A 1TPWA 2Y7EA 2GQ9A 3R2GA 3W22A 2R8WA 3W7QA 1OHLA 5HR7A 3B03A 1K8YA 2C3ZA 5CZ0A 2JGQA 4NJKA 4UFIA 1XI3A 3DFPA 5HWJA 1J4EA 1OFOA 4UFMA 1TSIA 1N8FA 1UASA 3R12A 4UTMA 4WY0F 1R47A 3GXTA 1LBLA 3VNDA 4MLRA 4UTUA 4O52A 4LRSA 1GTEA 4PTNA 4MKNA 2F7FA 2V2CA 1F76A 4G1KA 4LRTA 1UB3A 1NFBA 2WSRA 5HR6A 1EWEA 3SY5A 4POCA 3LTPA 3ABQA 3ZR4A 4TIMA 5IM51 2NXIA 3GXPA 2ABBA 1BWKA 3L66A 1O4UA 4GRSA 2NUWA 4AHOA 1OFBA 3HGSA 8TIMA 3LTYA 5CPOA 1VLWA 3DBPA 1JRBA 3P61A 4JYFA 1VRDA 3NQFA 5K9CA 1JUBA 2NV1A 2J6XA 2C1HA 3NDOA 2FFCA 1A5SA 3KVJA 1IXQA 3WJSA 1KM5A 3CU2A 1P1XA 1X8FA 2VFEA 5H2ZA 1B4EA 1J2WA 3M43A 4IPIA 3W7EA 3OBKA 3QYQA 2NLIA 4AHPA 3K30A 2O7SA 1AW5A 3QQ1A 1YTKA 1AMKA 1JJKA 4KFNA 1SZFA 1PVNA 3P8JA 1MXSA 1AW2A 3UXDA 5K4ZA 3C61A 5EKYA 1C9DA 3FKRA 3DXIA 5D38A 1LLWA 2TYSA 4IOTA 1YLVA 1A53A 3C4UA 2YDAA 4JGDA 3O6YX 2DP3A 3QMRA 2EPHA 3EXRA 5AN7A 4GC4A 3W2NA 1ZJIA 3B8DA 2TMDA 2CU0A 4IX2A 1GVOA 4WXYA 1H7NA 5HULA 4CLMA 5KITA 4FX7A 3L5LA 1W56A 1OABA 3T4CA 2D73A 3SSJA 1DVJA 3W7CA 3BLIA 3ANYA 3IGXA 1WBHA 5C55A 4AMAA 1K8ZA 2BSLA 3S5NA 4NT0A 2A7RA 5KZMA 5ABTA 3T40A 1PHWA 1EP3A 1KLYA 2QUVA 3TC6A 2FPTA 1GZGA 1XKYA 4UTKA 5FF4A 4RXFA 3GB6A 3PUEA 1LYXA 1W3TA 5HUPA 5F1UA 2ZRZA 2IQTA 4Z1BA 3HQ1A 3LERA 1G69A 3OA3A 4AF0B 1HUVA 2VEMA 5CG7A 3OVPA 1H7XA 2H8XA 2RHGA 3PSVA 4NNCA 4JTFA 2E1DA 2Z6JA 3G1HA 1SFJA 1D9EA 4MFDA 3BGJA 3CEPA 3KVMA 4JY8A 3LM7A 4ORMA 1P5BA 1CI1A 2WJZA 2QCCA 1O5XA 3IV3A 5LSMA 1XBXA 4XKYB 3OHIA 3W74A 1CW2A 1WDWA 1OX4B 4GJ1A 5BNKA 2ZTJA 3AO0A 1L6SA 3R13A 3UZ5A 1EWDA 4H6KA 4Y90A 3QSRA 4HKPA 2X1SA 2E5BA 3TJLA 1I2NA 3LHTA 2YZRA 4DO5A 4EF8A 3UWYA 1T99A 7TIMA 2J9ZA 1H1YA 3KX6A 5C54A 2Q8LA 5F2MA 3NQGA 2J88A 3MBDA 1F6PA 3C6CA 1QOPA 5I3JA 5U4NA 4XTDA 4NZFA 1JRCA 2DZUA 2TSYA 2EKCA 1SU5A 2OT1A 3TA6A 3EB2A 2E5CA 3KHJA 3CLMA 3EXTA 1ML1A 2GQAA 3FJ6A 2QUTA 3D0CA 1R2TA 5EBUA 3CPRA 4MLJA 4RZ4A 3S5OA 3IGUA 3CEUA 1TV8A 1H7PA 2QCFA 1JCJA 5CZTA 1QPOA 4FNQA 3MI2A 3EX4A 4HPJA 2QF7A 3B04A 4BK9A 2NWRA 3TSDA 3MHUA 1Q6OA 4JTEA 4P61A 1FQ0A 4WQ6A 3IIVA 5I3KA 4ALDA 2NXGA 5K9XA 3DFTA 4PFMA 3G1VA 3OVRA 5FEWA 2ZTKA 2WQPA 1YXCA 4DBEA 3STFA 3H54A 3LLFA 3E9AA 4TX9A 1DQWA 4FX6M 4HSNA 3BO9A 3A21A 3BG9A 5AYYA 4DO6A 3F1QA 1LZOA 3HPZA 1SZEA 4GUFA 4KKXA 1VS1A 1FWNA 2CLMA 2CLIA 2CLEA 3LHWA 3HJZA 3LTSA 4NVTA 5DY2A 1ME9A 3I6RA 2KZHA 4BI5A 1XBVA 2J9YA 4MZ8A 3CM4A 3W7JA 2PE4A 2EAWA 2ZBTA 4NU7A 2V9DA 3UYCA 1I2RA 1YPFA 2CW6A 4M19A 3UWZA 2TRSA 3TXZA 3S1UA 1I8JA 4HNNA 3KOFA 3LXCA 3KRUA 1LRQA 2ZZ5A 1LBFA 2Y63A 3HG3A 2V82A 3W7DA 2O7QA 4E38A 3HMJG 1SO5A 5AFDA 2WNQA 4JX6A 1G4SA 4Y8FA 2JKAA 2YFOA 5AC6A 3LCWA 4JY9A 2UV8G 2CLFA 3GAYA 5G1YA 4A2SA 3T7VA 1K03A 1QPQA 4W9TA 1WYIA 4RXGA 2A6LA 1KA9F 1VLIA 1VYRA 2H3BA 3LRKA 5AYZA 1FDJA 1ONRA 4LUIA 3TMQA 1F73A 1XCFA 4IXHA 4AVFA 3S1WA 4YWIA 1A50A 3ABOA 2VFDA 4JX5A 4O0ZA 3P5ZA 1OX5A 4RR4A 4OV9A 3FS2A 3EWXA 4IWWA 5DCEA 4LTSA 1VYSX 3PF3A 4LUJA 3IVTA 1GVQA 1GQNA 3BW4A 3W1RA 1W5QA 4HN4A 1XXXA 5AHNA 4ADTA 1ICQA 3C2FA 3B0UX 3RMJA 5K9DA 2QCNA 3QPZA 3UY7A 3O06A 3N73A 1JUEA 2X2GA 2Z6IA 3LRLA 1FUYA 5HMSA 3LHZA 3KRSA 1QOQA 2DZPA 3DAQA 1OFRA 4JXCA 4NNBA 5C6MA 1FXPA 4NJHA 5E0KA 3TCEA 1KV5A 4QNWA 1EA0A 4JTTA 3M5YA 3M5ZA 3MP3A 3VE7A 4R53A 2PRHA 1KBJA 3LCLA 5I3GA 1WOAA 1OG0A 4QISA 1SZGA 3ZS4A 3UQNA 4YMZA 1GYLA 1GJPA 1QR7A 1B9BA 2DZTA 4LV4A 3MYPA 2RKXA 2B4GA 1QAPA 3GIYA 1LORA 3THQA 1TO3A 3EKLA 5CZSA 4FNRA 3N19B 4BF9A 1VCFA 1Z42A 3P5YA 3VFLA 3LB0A 3LBCA 4LV9A 3SIZA 5MHBA 1GTHA 3HO8A 4UFLA 3TIMA 5FEZA 5EY5A 1AL7A 1VGAA 4MYXA 2EGZA 3E96A 3EX6A 2B0MA 1PIIA 3MW7A 2C14A 3O6DA 5D04C 1TJPA 3S5ZA 1EX5A 3TMLA 1T8XA 4O18A 3TXVA 1P4CA 3GX9A 2YW4A 2OCZA 4LS1A 1X7FA 3M41A 4KFOA 3C2EA 2B7NA 1OYCA 1AW1A 2CLKA 1SSDA 2YXGA 3T44A 3S6DA 1L2UA 4OE7A 2G95A 1W3IA 2VFGA 2YR1A 3KXQA 1QCWA 3I7SA 3PM6A 5F2LA 1EP1A 2VEPA 1JCXA 4BI7A 1I4NA 5D09A 4UTWC 3DKLA 3G0SA 3P60A 3W88A 3W7MA 1LOQA 2RDUA 1F7BA 3QQ0A 3M5XA 3QC3A 1SW7A 3NEVA 3NQ6A 3NQVA 3GR7A 4RCXA 1I45A 3W87A 1W5PA 1OF6A 2NWSA 2BLEA 4WZHA 4UNKA 1GOXA 2ZRWA 3TK7A 1RQEA 4UCGA 4BWLC 2NX3A 1SW0A 1KFKA 5F4XA 3P74A 3L9CA 3ATYA 4ZQPA 3HB9A 3RF9A 1GVRA 3NQEA 4EF9A 1YXDA 1YDOA 2E6YA 3FYPA 1W37A 5E93A 2E6FA 2NX1A 1W5MA 3W23A 1HG3A 2GUUA 2PRLA 1R2RA 2DZSA 3UWUA 2VEIA 1DHPA 3N34A 2HS8A 3P8IA 2E6AA 4JTHA 1H1ZA 1W54A 1MEIA 3G22A 4JTGA 1VHNA 1OJXA 2Z2UA 4YL2A 5D2XA 3QRHA 2ZRVA 4MIMA 4IQLA 1GVSA 2DZWA 3G0XA 1KM6A 3LGEA 2C0AA 3TAOA 1ZENA 2ZDRA 4A22A 1JCNA 1S3HA 2H8ZA 1DORA 4JR5A 5F2GA 3FOKA 4S2CA 1IXPA 3TNOA 3W72A 3W83A 2C16A 4UTWA 3RLUA 4UXDA 3R8RA 3W76A 4I7WA 1JR1A 2QDGA 4MOZA 3NPUA 1YTDA 1KTBA 4Z1AA 2HS6A 2NV2A 3L5MA 4WY0A 3ABSA 4FNPA 3LCXA 2DORA 2Y62A 3N3MA 3DI0A 5FF2A 5E1QA 3W3OA 2VFHA 3UWVA 5FESA 3TUUA 3N14A 4ZQNA 5I3HA 2A6NA 1XFBA 4O1CA 3SI9A 1NF7A 3BLFA 4JTLA 4BWLA 4HT3A 1AG1O 4LVAA 3PULA 5DXYA 3U6WA 4DPPA 4JIQA 4QM1A 1OFDA 5AHLA 1OYAA 3NL5A 1QMLA 2X1UA 5D2TA 4GE8A 2ZA1A 5IBXC 3W7HA 1M7OA 3IIOA 4IXXA 5I3FA 1G4EA 2DZXA 4WXZA 4IMGA 3PC0A 4KFPA 3W86A 2A4AA 5K2ZA 1ME8A 3EEGA 1NEYA 4O57A 1QPNA 3QFEA 3GYEA 4I7UA 4IMFA 3W7LA 4OU1A 3TJXA 3MO7A 2WV8A 4EOUA 5EYWA 2CWNA 2RDWA 1SFLA 3INPA 1W8SA 1BTMA 3MP5A 5K4XA 2WSYA 3TFCA 2XN2A 3B0PA 1H7OA 3M6YA 2ZRXA 1NAL1 2PC4A 3CIWA 4N6FA 4YLWA 4AWUA 1RQBA 1HL2A 4H4IA 1LP6A 4N9BA 4ZZ9A 1F2JA 1JCLA 2QEZA 2TPSA 3M0ZA 3O8AA 2FB3A 3ZWTA 3W6YA 2JKEA 1OFEA 2WSQA 3EWZA 5D03A 1TIMA 2A0NA 3L0KA 2VOMA 1C29A 1LTDA 4JNMA 4HHPA 5G5IA 2GVJA 2YYUA 3DFQA 3GNDA 5J5DA 1BKSA 1LCOA 1XBZA 3W9ZA 3A22A 1VCGA 4O0KA 1ALDA 4LVBA 5HWNA 1THFD 2Y6ZA 4J9JA 3N2XA 4MVAA 3MHFA 3JR2A 5CGQA 1S5TA 5DLCA 5FF7A 3A5FA 5IBXA 3TH6A 1FXQA 1U5JA 4O19A 3BG5A 3PR2A 4JX4A 1L9WA 1O60A 2ZZ4A 5F4SA 1VC4A 4HIBA 4LVGA 3TR2A 4K39A 1GG1A 4X3ZA 3G3MA 3P62A 3W70A 6TIMA 2CLHA 1XC4A 2QKFA 1D3HA 4UUIA 4HNVA 1LLZA 3O07A 3W73A 5LNWA 2CZDA 4UNLA 2QCMA 3NA8A 4UMAA 4AWSA 1H51A 1JUKA 2ZCGA 3C0JA 3M16A 4HNTA 1LM1A 3GDTA 4K8HA 4NNAA 4TMCA 4JN6A 4BR1A 5FF0A 3NQDA 3UD6A 4UC5A 2Y85A 3AJXA 1WV2A 3WK3A 3WK1A 4LW7A 1VH7A 1T96A 5CSSA 3R89A 3S42A 3ABRA 4RLIA 3DI1A 3UZJA 1YDVA 4O1DA 4ZQOA 1IF2A 1JULA 4X2RA 1R46A 3UY8A 1TPB1 2H90A 1KW1A 3USBA 3S1XA 3MMTA 3PG8A 3W7GA 4UFJA 5EA9A 1ZFJA 3RNDA 1YYAA 3SFKA 4N6EA 2YX0A 3L65A 2CZ5A 3NAVA 4FXRA 3G1YA 3TX9A 2X30A 1FDZA 3QMSA 1R2SA 2V2DA 2Z1BA 1OFQA 4XBSA 4K8EA 3TQVA 3G0UA 3RK8A 3L68A 2OT0A 1KLZA 3M9YA 3NQMA 1Q6LA 4Z1DA 3U8GA 1GPWA 2QCDA 1VCVA 2BTMA 2NUYA 4O14A 4NX5A 3P84A 3Q37A 3O63A 4OQVA 3W1MA 2ZA2A 1RR2A 1TMHA 2GQ8A 4GWEA 1DKWA 5DBUA 2ZYFA 3PSWA 4ZQMA 3DFOA 1P0NA 1KM2A 3JRKA 4IJBA 3W1QA 3QH2A 5D30A 3LX9A 1FWTA 4MJZA 1JCYA 1H7RA 1S5WA 3FIGA 3G3DA 3UPBA 1TTIA 1H62A 3EX1A 3NYZA 3WK0A 3C8FA 2QAFA 1W5NA 3KVKA 3IEBA 5LNRA 4DF1A 3H53A
chains in the Genus database with same CATH superfamily
2IUZA 3GH5A 1GWJA 3IIPA 5LNVA 3DYPA 4TO8A 2VWSA 3WMBA 5LA1A 3AIRA 3GWQA 3EOEA 1YXYA 1KV8A 3P6LA 4EVZA 4XB3A 2MNRA 3MCMA 3BC9A 4G9PA 1V03A 3TYCA 3V75A 3ITYA 3RGTA 4PMZA 1ZY9A 4QEHA 1PO9A 4DAIA 2F2HA 4NYYA 1V7AA 3NL3A 1ZU8A 2CLPA 1CXLA 4O12A 2GVLA 3UPMA 1AJZA 4NG3A 3F5LA 1K6AA 3VOGA 3KEHA 3TYEA 2JQXA 2ZA3A 1T41A 4IGMA 1IZCA 4H9TA 4RV8A 5C9WA 1F74A 4WD0A 3M7SA 1B57A 3BZGA 1Q6QA 2D0GA 4PUMA 1XLKA 1JPHA 2Z7GA 1MZRA 4EWND 1UH3A 1KTNA 4ADSA 2R1PA 1B90A 3A5VA 4IIGA 4GZIA 4PMXA 1G7VA 5I3IA 4PA8A 3U0HA 5DQPA 2WCGA 1GONA 1TPFA 2FIQA 3SO7A 1G6CA 3QQWA 4UOJA 2G97A 4WUIA 2ZUWA 3S2JA 4NUWA 1ZB5A 4I5RA 1X6UA 2W61A 3CAVA 4IX0A 4ZO9A 2OGJA 4TU1A 3TR9A 2OX1A 1OADA 4LALA 5KZDA 2QJIA 4JL2A 4DF0A 5ABFB 1VPXA 3W82A 1MSSA 3CQ0A 3MQTA 4EX4A 3K8LA 2Y24A 2A3HA 3BW3A 3H2MA 4OTKA 3RO8A 2YSWA 5C70A 1EJRC 2PLMA 2BHYA 2QJNA 3GDKA 4DJED 2D3LA 5L6UA 4DPQA 2YCKX 1FVPA 4O16A 1BEUA 3VMPA 4U33A 4L64A 1F5ZA 1TTPA 2J27A 4PFHA 4CQAA 4FZIA 4L4LA 4K6AA 4U2YA 4CEUC 2ZOXA 4EXQA 1NIUA 4X9SA 1V3MA 2QDDA 5C8BB 1VJSA 4PYSA 1FWEC 3VIFA 1J18A 1EH9A 2BDQA 4W88A 3TC3A 3WZ0E 5XIAA 1OCQA 4MY8A 3BMXA 4Z0JA 3WNMA 2VFFA 3W7OA 3AXKA 4N4QA 1N2VA 3BSMA 2WO5A 3BK0A 2AQWA 1F61A 1XUUA 4FR6A 1JZ7A 4PL2A 5M17A 2D0HA 2HBXA 4GZJA 2UY5A 3FSTA 4PE8A 1CXFA 4HOWA 4K37A 4ADUA 4ML9A 2RGMA 2XFYA 5FJIA 3ZWSA 4NY2A 3ITLA 5A8QA 3ELFA 3MJMA 3MUXA 3V5FA 5T9BG 1W1PA 4YTRA 5CGMA 3HF3A 4UR7A 4D1JA 3VGHA 4JYEA 4ORIA 2W92A 3LPPA 3N3TA 1A5OC 4N9CA 4G7EB 1E0WA 1Q63A 4I9TA 1CCWB 3PZNA 4TMBA 3AYTA 3CWNA 4BFAA 2OSYA 2W91A 4KCUA 1PDYA 3VKJA 1N8IA 4WLCA 1OD0A 1B4KA 1ODUA 1R7OA 2YBVA 4R7JA 1E9ZB 3CO4A 4JCLA 5GJPA 4LCRA 3MSYA 1MEHA 3U5UA 4CGTA 3BLOA 4LUYA 4MZ1A 3G1AA 3WMLA 3GXNA 4EIVA 4L1WA 4B9YA 5CKSA 5ECVA 2W6RA 1POJA 4MUPA 3PG9A 4PC8A 1OIMA 4C6MA 1XYLA 3E0WA 1NWUA 4B3ZA 2VX4A 1QPKA 4GISA 2Q8ZA 2VZTA 1WA3A 4NZCA 4E6MA 1GOKA 1UQYA 1CXIA 2C19A 5I00A 3CC1A 3OGSA 1JDDA 1PAMA 2PAJA 1HVQA 3EGJA 1XH1A 3IUHA 1JZ3A 4ZSUA 1FCBA 1BXNA 4F0LA 1A5BA 1TZ7A 2YW3A 3U2OA 2RJHA 1IEQA 2J66A 4CNPA 4J27A 1H63A 4MB3A 1OWQA 4XAFA 2PA6A 3A3WA 3CPUA 1EB3A 4TVCA 2HZGA 4ENLA 3STPA 2W66A 3DGRA 3WH9A 3ZT6A 2JGYA 3QM3A 1E43A 3WD0A 3VDGA 3CUIA 1BYBA 3GKFA 4UQCA 3MWAA 1ODZA 1HO4A 1P1MA 4GYPC 4LAMA 1W3KA 4Z2JA 4CNUA 3A9IA 3LNMA 4Q4KA 3R5EA 2YLLA 2ATSA 5E6ZA 3UCQA 4JKMA 4LANA 4IGNA 1XDLA 3AXXA 3G18A 1RAKA 1PBGA 1R3YA 2VKZG 1FDYA 4Y96A 1UIOA 3BCFA 1JD9A 2WHMA 5FSEC 2QCEA 2PDIA 2X09A 1HGYA 3EWBX 4KMQA 4ZL1A 1OGGA 8XIAA 3OZOA 4QITA 2X0HA 3TW7A 1UUOA 2PDMA 2OX4A 1FH8A 4AQLA 4D71A 1ITCA 4CCDA 4HN8A 3GTXA 2EQDA 4S3AA 3HPSA 4TTGA 1ADOA 2G3FA 3S6TA 2Z2BA 3IVUA 3KBJA 1XIMA 1A5LC 1LQAA 5BYWA 1G01A 1V6YA 1CPUA 3V18A 3WNLA 3VUSA 3W7NA 4GYPA 4L5ZA 3SZ8A 1GZ1A 3A3HA 4AZ6A 2P3ZA 4RPPA 2QUNA 3P81A 1XPGA 1RCOB 3VMOA 3G8EA 1QBAA 4CCEA 1Q4NX 2HV5A 1Q7MA 3VKBA 2QDHA 3BAIA 4C6IA 1MW2A 4RX0A 1KO0A 4WCJA 5E9XA 3F4DA 5IFPA 4F2UA 3B3DA 3OEXA 1H50A 5C2CA 4B3LA 1MFUA 2VT0A 2Y5JA 3PB0A 3W1UA 2G0WA 4O11A 4QQUA 4QLLA 3LI1A 3TCSA 4ROQA 1GVFA 4LF1A 2YDQA 2V5LA 1BSLA 4JYDA 2BVYA 3DKJA 4MWAD 2XH4A 3VZXA 1S5NA 3EPMA 4XD5A 1W3NA 3CUZA 3DX5A 5D02A 1BF2A 1IIGA 2VM8A 3O7UA 3R79A 3NOEA 3VNLA 1JEZA 1M03A 3TC7A 4GGBA 3GRIA 1LF1A 2FQIA 4QAIA 5BRBA 2Y8VA 5JBEA 4F3HA 2FTPA 2HVOA 4XQ6A 8A3HA 4JEJA 5LHEA 2GK1A 4A2RA 4N9EA 3KDNA 3HGOA 5AOUA 1EDQA 2YL8A 4AHQA 3GG7A 3IRDA 1KFEA 4EPBC 3IUIA 1A0EA 1CYGA 2J24A 1Z6KA 2XZ7A 4K36A 2DQXA 1V3IA 4QP0A 4F0RA 3LV6A 4NI3A 4B4FA 4XZHA 4IMEA 3WQ5A 1NQ6A 1Y65A 3OYZA 1LOLA 1EOMA 3C8NA 4GUHA 4D8AA 3DDMA 4C6NA 2G3JA 2RJGA 3I6EA 3VPLA 4Q8VA 3W71A 3F4NA 4G7EA 4ZODA 3TLQA 3D3AA 3PUGA 1U83A 4C65A 2QCGA 4DXXA 4W86A 4IIEA 3DG3A 3LV5A 1YNPA 2J74A 4FOKA 3TYDA 2X2YA 2WPBA 4CKQA 1FWSA 3UF9A 5BMXA 3F2DA 5AHIA 1Q6GA 4JQ4A 3UGVA 4HQVA 1ZL1A 3R0DA 2NSOA 4LNYA 4E8GA 3QOKA 3K46A 3MS8A 1REQA 5I79A 3NVTA 5DT7A 1J9YA 3CPGA 2WZTA 4HPXA 3HFTA 3WLQA 2G50A 5I2UA 1TWWA 4R33A 5HNTA 4L4MA 1SZRA 4GUIA 3IGHX 5GNYA 4CCZA 4M0XA 2D1ZA 3T81A 3C2OA 3U5YA 5DXXA 1B31A 2FGLA 3NQ8A 1I2PA 2J47A 1KB3A 3D3FA 1RA5A 3EX3A 1A5UA 1EGMA 1JNDA 1VZWA 5C2GA 2WYSA 4YNGA 4DBWA 1KBIA 1X1NA 2QGYA 4MFEA 3EMCA 4NJIA 4GY7A 4D1IA 4JN7A 1M6JA 3L4TA 1C7SA 3QR1A 1KFCA 3DESA 5FL0A 2GWGA 2PTZA 4DUOA 1QNSA 3DHFA 3OTRA 1QI4A 1HKVA 4AU0A 1FOBA 3TYZA 3BJSA 3JU2A 1JZ6A 1GEQA 4JDBA 5KTLA 5CSUA 3UGRA 3SJ3A 1UR4A 2HEJA 2EKGA 3NPVA 4ZOCA 5LKYA 4LU0A 3A6OA 3SGUA 1UOZA 1NSJA 1W1IE 2AL2A 3N9KA 1KBBA 2Y7DA 2XGBA 3ARPA 3FKKA 3LD5A 3LSBA 3AHYA 3GC4A 3BDKA 5LXXA 4X0VA 4PMNA 3UG8A 3UR5A 4GQRA 2VQTA 3LA4A 1W31A 3TW9A 4KS0A 1KD0A 1X6LA 1XLDA 3VZZA 3CQJA 1J10A 1EJSC 5F4WA 3W28A 3NXFA 3VNIA 2HE5A 5L9FA 3W2KA 1LRTA 2ANUA 1CXKA 1HP4A 1TTJA 4CEXC 3W1TA 1DIDA 5LIUX 4EP8C 1KWGA 4QAWA 3KOWA 1A0CA 2OLAA 3FX4A 3WO8A 3UXLA 2VO5A 4H7CA 2GGHA 1SJCA 3M4HA 1UWAA 3AWNA 2ZC1A 2J7HA 4WRHA 3SUVA 2HNEA 1V5XA 3HG4A 2PGEA 1A5MC 4WJEA 1VIZA 2ZUSA 2Y0FA 3VZYA 4PCFA 4GCAA 4CNSA 3B8WA 4FB7A 1AH0A 3OIXA 3GQYA 3M44A 3KZSA 1EXPA 1MWOA 3VM7A 1F3EA 1K1DA 2GUBA 3FJ4A 3NOYA 4J28A 2PLCA 4GUGA 3W2UA 2PDCA 3EWDA 3CHDA 2FFIA 1MW3A 3M1ZA 3W7RA 1DOSA 1WXJA 2G5WA 4Z1YA 5A6LA 1S5VA 4J3ZA 3U7BA 4HYVA 3KUMA 2Q09A 3OG3A 5GJNA 3WKZA 2GGGA 2E77A 5FJOA 3NQAA 2WC7A 1JFXA 4UB9A 2ZX9A 1A5KC 3R10A 5BMWA 1PS9A 3HG2A 1XDJA 4O13A 3VDHA 1QDSA 2WBGA 2R94A 2XIIA 1QXLA 1B0IA 1ZQ5A 1OZQA 1WDRA 3P7YA 5E9AA 1VJIA 1EP2A 1O1HA 1T5AA 2ATMA 4HJFA 3COTA 1AFSA 4GO8A 5JH2A 2Y5SA 4JTIA 2VZSA 4X2PA 1R5YA 2VC9A 5A6TC 1XLHA 1X39A 5REQB 1YIXA 3JW7A 3QSTA 4UOQA 1WAUA 2ZWZA 3MP4A 3CZEA 4KW2A 1LOSA 2OZ3A 3L21A 3LLXA 2INFA 4GIRA 2GQ9A 3W7QA 3URAA 3Q4DA 5HR7A 3KP0A 3UWEA 2DIKA 1IYXA 3WUGA 4NJKA 3WEZA 2CHOA 2P50A 3SUWA 3R12A 2F6XA 2WSKA 2XVNA 3MUAA 1LBLA 1XIGA 3VNDA 2W67A 5EMJA 2F7FA 3TVAA 4L9ZA 4WDWA 4UTFA 1H41A 2WSRA 3MKKA 4E5TA 4POCA 4Q3MA 2BY2A 4Y7EA 2YCLB 4TIMA 2FH6A 4AC1X 3UA3A 1I9CB 4MAVA 4US5A 1YPXA 3PWGA 3T09A 4AHOA 4NZ1A 1CGWA 2EEXA 8TIMA 4FOJA 1XW8A 1JRBA 4JYFA 1VFMA 3NQFA 4ERAA 2FFCA 1GKPA 3SCSA 3WEMA 3KVJA 2XG9A 2DT3A 3PBMA 1X7IA 1J2WA 2AL1A 3ZMRA 1MXGA 3K30A 2P0IA 5C9UA 5C9RA 3GTFA 1AW5A 4QCFA 1UUQA 1JJKA 1I0DA 2XPKA 4DLMA 2PWDA 3EYPA 2OSXA 4BF7A 1AW2A 5EMKA 3KBVA 3U9IA 3AIBA 3O3RA 4M1BA 3VXGA 1B1YA 3QZAA 3WQFA 1DHKA 2ZXQA 1C9DA 5D38A 4ZB2A 1A53A 3C4UA 4U5KA 2YDAA 4LEQA 3QMRA 3ARSA 5AN7A 4GC4A 2CU0A 4KWUA 4LXFA 2BY0A 1H7NA 2D22A 5HULA 4CLMA 5KITA 3AZTA 1X97A 4IIFA 5LYRA 3SSJA 1DVJA 3IS4A 3DG6A 3ITVA 3V1HA 1K8ZA 3WN6A 3N2CA 3VGFA 5ABTA 4GKTA 4C7FA 1KLYA 2QUVA 1S2CA 1GZGA 1HKJA 4UTKA 4EXAA 4RXFA 5KZ6A 1B3YA 4KCTA 5GNZA 3GB6A 4E3TA 1X8CA 3PUEA 2VJXA 1LYXA 1JI2A 2ZRZA 4R7WA 3HQ1A 1P48A 1HUVA 2VEMA 5CG7A 3OVPA 5ABHA 1UHVA 4BEUA 5DFAA 1UD3A 1V6WA 2E1DA 3G1HA 3MTWA 1D9EA 4GIEA 3CEPA 3KVMA 4JY8A 3ZIZA 3GBEA 3GSMA 3KWXA 4Y2WA 2DIJA 4XKYB 3OHIA 2G41A 3PPCA 3QHMA 1WDWA 3VKAA 1ISVA 2A3EA 3UZ5A 6A3HA 1PZ1A 2V63A 4ILSA 3AIQA 4DO5A 5DT5A 3TJIA 3UWYA 3PFRA 2PDLA 3POHA 2IPGA 2O55A 7TIMA 2PDKA 2Q8LA 4H9ZA 1OBAA 3P0XA 4G2DA 3MV11 4ACZA 1PWLA 3SRHA 3EB2A 3HTWA 2GSEA 2AMXA 4L80A 4XV0A 2GQAA 3V4BA 2XVPA 3SB0A 2Y4SA 3WD3A 1R2TA 5EBUA 4MLJA 3WLMA 1X38A 4OKDA 3CEUA 3VIPA 3ZLGA 3L4WA 2W5FA 2FZ8A 4WVXA 3EX4A 4CU7A 3TSDA 1BVWA 1W6TA 5J04A 4P61A 1FQ0A 2OB3A 4OUIA 3DFTA 3G1VA 3OVRA 2ZTKA 3WF3A 1IT0A 3STFA 2TAAA 3PZOA 4QGCA 1WKDA 4TX9A 2JEQA 1D8WA 4HPHA 1DJYA 2VDIA 3A21A 5AYYA 1JPMA 4BZYA 4YHGA 2J77A 4NVTA 3TNBA 1ZJHA 1XBVA 4MJ2A 3CM4A 1WB0A 3EZ4A 4JHOA 1AH4A 3FA3A 2HVNA 4NU7A 2V9DA 1I2RA 1YPFA 3L23A 4M19A 3BANA 3UWZA 3S1UA 4HNNA 5TAOA 4A35A 3QC0A 4W8AA 2Z25A 4YTSA 4QLKA 3HG3A 2V82A 4E38A 1SO5A 1GNXA 3DERA 2WHLA 4JX6A 1TELA 2YFOA 2EG6A 4JY9A 1FA2A 1D8CA 2CLFA 5G1YA 5JIWA 1TG7A 3OZYA 1ZP4A 1E6QM 3R11A 3RN6A 1HKMA 2IQ0A 4GBDA 2A6LA 2XGIA 1EO5A 1F8IA 2Y5EA 3LRKA 1FDJA 2PU0A 1XCFA 1YE4A 5MKGA 1KKOA 2WM0A 1F4HA 3GO2A 3ABOA 1R3RA 2J8FA 2CXGA 1N82A 2J25A 1DJZA 4OV9A 4ZB0A 2BODX 3NSNA 1S38A 4IWWA 1BVNP 5DCEA 4EWJA 3AZSA 3G77A 1GQNA 5A8NA 3EDFA 2BXZA 4ADTA 3LK6A 3B0UX 3RMJA 3TOYA 1Q6EA 5K9DA 4I6VA 3QPZA 4PB5A 2VZUA 3RITA 3N73A 4F2BA 1RBAA 1PTAA 1KRBC 2VX7A 2QHAA 1JYXA 1QOQA 1FWBC 1TUFA 2DZPA 3N2OA 3DAQA 1OFRA 3ZSTA 2OQHA 2FZNA 4Q8MA 1GOMA 4NF7A 3SURA 4DB7A 5HQLA 1FXPA 1KV5A 3LSCA 5EB8A 1SM9A 3H2AA 1SYTA 3RRXA 2GGJA 2C7FA 3LCLA 5I3GA 1WOAA 1SZGA 4YMZA 3VDCA 1S39A 1B9BA 3MCOA 2RKXA 3FCPA 2B4GA 1ADDA 1QAPA 1TO3A 3EKLA 3FY1A 3V35A 3N17A 1EOKA 3VFLA 4NAFB 2PDQA 3SIZA 1QNRA 4HPGA 1GTHA 1E5JA 4UFLA 4C6QA 1Q8JA 4H41A 4MYXA 2BFGA 3MW7A 3SCTA 4B9ZA 4GZ7A 1TA3B 1KRAC 1TJPA 3PJTA 3TMLA 2ZE0A 1BD0A 4WEVX 1W3JA 2V5DA 1JGIA 3FK4A 4M29A 3GX9A 4NKCA 2OCZA 4QS5A 1F9CA 3M41A 4C5YA 1P0EA 5CG0A 1J01A 4PMYA 2VC7A 5LIKX 1AW1A 2Y8KA 1JG9A 1SSDA 1FWJC 3F4VA 5E6YA 1K4HA 1OGBA 3ES7A 7PTDA 3DYMA 1DJHA 1OCJA 1L2UA 2G95A 1ONXA 3OYXA 2DW7A 1FH9A 3KXQA 1EP1A 3DGBA 2HJPA 2OXNA 3EWCA 2POTA 3XINA 3W88A 1K6WA 1IR2A 2RDUA 1X6NA 3M5XA 3QC3A 3GR7A 2NWSA 4HBKA 2ZRWA 4PRTA 3R7MA 1UWTA 1RQEA 3M07A 3KL3A 1BWVA 3WF4A 4GMEA 1RHCA 1LL7A 3TLLA 3TYAA 1S2VA 1C93A 4ZQPA 3HB9A 3RF9A 2CESA 3N11A 2E6YA 1OQFA 4PMUA 1W37A 2D2HA 1RCQA 2E6FA 3QFWA 2GUUA 1LQ0A 2PRLA 1BHGA 4R7OA 3OVGA 3UWUA 2HS8A 4JTHA 1MEIA 1Z7AA 2IMRA 1OJXA 5CJNA 4OBRA 4PB3A 1U33A 2JE8A 3CUGA 2WQDA 1ONEA 4Q4PA 1GVSA 1ZJAA 3QHOA 2XFRA 2QJJA 4GFIA 1ZENA 4A22A 1JCNA 3TN5A 1S3HA 4QE5A 5F2GA 3TN3A 3FOKA 1KGXA 4WDTA 2PZNA 3VUPA 3GU9A 1D3CA 4D6FA 3L5MA 4WY0A 4FNPA 1J0YA 4DM1A 3AHVA 1U1UA 3N3MA 3W3OA 5FESA 2WC3A 3FA4A 3HQOA 1J0KA 2VEFA 1NF7A 3BLFA 3GTHA 5DXYA 4GY1A 4LBSA 3ZO9A 2UZ9A 1NP0A 4JIQA 4QM1A 2VD8A 1VBUA 2DQWA 1L8NA 1RXOB 3KOXA 5IBXC 2PLJA 3W7HA 3WLKX 3AHTA 1QTWA 3PN8A 4WXZA 3AMCA 3PC0A 4F79A 3W86A 2A4AA 5BXRA 5K2ZA 1NEYA 4O57A 1QPNA 1I1XA 3GW3A 3RJYA 3TJXA 3AU2A 2WV8A 4EOUA 2CWNA 2RDWA 1SFLA 1BTMA 3MP5A 1UR2A 1A5NC 3VNMA 4H1ZA 1H7OA 2JF7A 3H22A 3AROA 4AWUA 3CIWA 1GQIA 3CMGA 1R6WA 3VKCA 4H4IA 4N9BA 3PTDA 4GQGA 3O8AA 3RPTA 1MI3A 1HKKA 3ZWTA 1OFEA 3BCJA 4BHYA 4W85A 6XIMA 4A8LA 2QJMA 1EDTA 1WXZA 3GNDA 3E1F1 4P7RA 1XBZA 1DP0A 4V2XA 4HHHA 2DFAA 4O0KA 3DYOA 2GUYA 4HB7A 1CECA 4LH8A 1R3WA 3VYLA 4HOZA 2C1IA 5JH1A 5IBXA 4FPSA 5JBDA 3KL0A 4AIBA 4U3AA 5CBJA 3MSRA 2ZZ4A 5F4SA 3LPFA 4K39A 1HW6A 1XLLA 4M1RA 1EYWA 2CLHA 3APTA 4JQAA 1W9UA 1D3HA 1G9HA 5C7HA 1LLZA 4DHGA 1BLIA 3TOPA 3AS1A 3B8VA 3JZUA 2QCMA 2Z29A 3UJEA 1ITQA 3TTYA 1H51A 3H4GA 3OO2A 3C0JA 4HNTA 3SRDA 4CN1A 2P8CA 1PEZA 1M41A 4NNAA 4TMCA 4HZ8A 4AVNA 3UYIA 3NQDA 4UC5A 2Y85A 3AJXA 5BRPA 1HXJA 4AY1A 4NZ4A 5CSSA 3R89A 3CV2A 3ABRA 1MQPA 3UZJA 3WDQA 5CSYA 2P5NA 4O1DA 1IF2A 3H2EA 3N2TA 1TPB1 3USBA 3S1XA 3KDOA 3MMTA 3K8MA 5EA9A 5CPTA 3EEZA 4TQTA 3L65A 2CZ5A 5I7GA 3NAVA 1RD6A 5HBFA 1S3TC 2F9RA 1ADSA 6REQA 3S47A 1JXKA 1FDZA 3AXIA 4XZWA 3TQVA 3G0UA 2IPJA 3L68A 5CH9A 4LUTB 1XV8A 4YN5A 3U8GA 1PKLA 4U31A 2PI6A 1VB9A 3AIUA 2GQ8A 1M04A 3S4TA 4GY0A 4ZQMA 3H21A 3FGCA 4GQQA 4IJBA 4AVOA 1GHSA 1WDDA 1FWTA 4GOAA 4MJZA 5C9XA 1JCYA 3SUTA 3G3DA 2WLYA 4EANA 2QAFA 1NWTA 3VNZA 5CPQA 5JQ9A 3O9NA 3E12A 3V16A 1ZCCA 1LJYA 4GQ0A 3TSMA 3QEZA 5F7UA 3WMCA 1MXDA 2A85A 2V3GA 5MF5A 3WLRA 3RR4A 1J0IA 1X96A 1LDCA 1YPIA 1RV8A 1TPDA 1FCUA 2XFWA 1PX3A 1LWHA 1T40A 4O50A 2QV5A 3N6JA 4XWUA 5HQEA 2PRMA 5AHEA 2OWWA 1UKPA 4FF5A 4LWWA 3NZ1A 3K5XA 4A8RA 3R58A 4Z1CA 3LXBA 5M1TA 2D69A 3VDAA 4MZYA 1E1CB 3WLJA 4QG9A 5EMUA 2V30A 4V33A 4US5D 4QROA 2QNEA 2Q6ZA 1ZNNA 1M68A 2ZRUA 3BLLA 3NL2A 7XIMA 3QY7A 3B4UA 1ESWA 3QOMA 3TAKA 3II1A 1MUMA 4S2BA 1J6OA 3KTSA 1FWIC 1Q13A 4I90A 2WMKA 3DHUA 1PKNA 1RH9A 4JKLA 1FHUA 3PHAA 3G24A 3ITTA 3FVDA 4IPJA 1XJBA 1R7AA 1LBMA 3CV1A 2WNZA 3T0TA 1PUDA 1TPVA 1X98A 2QULA 3W2MA 3OGVA 4LPCA 3WBWA 3IUDA 3W25A 3QF0A 4ZR8A 5C2XA 3WCZA 4RJEA 1TJRA 2P10A 3AALA 5M5DA 3UZWA 3NQ7A 2PD9A 1MYRA 1OCNA 2GJLA 3ANVA 5BW6A 1SO3A 2VELA 3L4ZA 2HE8A 3HIJA 1H60A 2E6DA 4KT2A 3E02A 1QJWA 2QYGA 1W1YA 1XYAA 2WJFA 2P1FA 3P67A 3KBWA 4N2YA 3E49A 7TAAA 3PY2A 4UQDA 5I24A 3KFTA 4X9YA 1X1ZA 1OGSA 1O66A 1SZNA 2BGQA 5FOOA 1PXGA 3F2CA 1RVGA 4UFHA 2C79A 1W9XA 3HM7A 1QI0A 1K9TA 1KRCC 1V3KA 1EC7A 4DXKA 4NRRA 1EHNA 1O7AA 3C52A 4XAGA 4LVFA 2CLOA 2JBMA 1KFLA 4CCCA 1DXEA 1A3XA 2PDJA 4NX0A 2HROA 1JQXA 1XCWA 4PUEA 2NQLA 3RYSA 2XVLA 3VOCA 5IRPA 2GOUA 4HTYA 4GYFA 2QUUA 1FWCC 4ZE4A 1MZHA 1C91A 1NDVA 3CL8A 4RDYA 5A6BD 4JEQA 4WKFA 1XD0A 1OX4A 1FWDC 3WDJA 1XH2A 1ZUAX 2ZRYA 4FNUA 4QSHA 1EA9C 4O17A 5D32A 1E0XA 4I3GA 1UP2A 3RUBL 4JD4A 2OEJA 4OGZA 5HANA 2EXOA 4HA1A 2WKJA 1KM4A 1KXTA 2X1IA 3KOYA 2V38A 3KRBA 1N55A 2QAPA 1IV8A 4HD5A 1GT8A 3R8HA 1Q6FA 4C6LA 4RNHA 3A24A 1VEMA 1POKA 4FSAA 4L65A 3RLHA 2DVTA 4MYAA 3I7RA 4LUTA 3GAKA 4N0RA 3EDEA 5DMYA 1W9BM 1ZS2A 3AWOA 1J2BA 3S2CA 1ISXA 4JL1A 1E4MM 2ZUTA 1XD1A 4HMEA 5EFFA 5DX7A 2O56A 1CXEA 1E9YB 3PB2A 1TCDA 3TTEA 1HN1A 3R4IA 3WQ4A 2E67A 3QMTA 4LYQA 2QVNA 1IWBA 1RD5A 2PWHA 3FJLA 1Q4WA 1WBJA 2ZZ7A 4DYJA 2PCQA 1IT8A 1UR0A 2X1TA 4R3UA 4J7RA 5TBOA 4C6PA 4IT1A 1XFCA 4A3HA 4IGSA 4OJYA 4U10A 3I4EA 5HATA 5JXQA 3TQ0A 2NX9A 3MHGA 4FXSA 3ARWA 3BWWA 2HISA 4JQ2A 4WGHA 1J0JA 2Z1WA 3TU9A 3EOSA 4C6EA 2P88A 3QKZA 2HSAA 4IF2A 2ISVA 2X1RA 1BQCA 1ONWA 1TPC1 3PZMA 5A6SA 2XH0A 3LM3A 1ZLPA 1DJQA 1W0MA 4H9UA 5HWMA 1G7UA 4KWVA 3TWAA 5I6SA 1UCWA 1TV3A 1TPH1 4KQNA 2A3CA 1S46A 3MI6A 4BKNA 2RH9A 1UQZA 4E4FA 1XSKA 3UJFA 4N4PA 6PTDA 3QPYA 1VP5A 3LHYA 2H9AB 3PJXA 4S23A 3GZ3A 3ZVHA 1Y5VA 1BWLA 3ARYA 1DJWA 3A4WA 4PMDA 3VE9A 3WLOA 3QHNA 4DJEA 3I3EA 1UC4A 1UD4A 3AHZA 1VIWA 2ZZ6A 4FK9A 1XRSA 1E6NA 3UESA 4W7UA 3MJYA 2ALRA 3GDMA 4FLRA 4R88A 3E2RA 2WLZA 1ZAJA 4MWAB 3TFXA 2XSXA 1F3WA 2NT0A 1H0IA 3WK2A 3POCA 1WPCA 2VZVA 1UPPA 2A1YA 4EPEC 3MPGA 3VIMA 1H2JA 5AECA 3GE7A 4PRWA 4S3DA 4LX4A 1IEVA 2A5HA 2J9XA 4AEOA 3MANA 4NJJA 4XK2A 4LY4A 1SO6A 1W9DM 2I5IA 2JIWA 3QTPA 4MKSA 1B3OA 2BGSA 3KAOA 3LPOA 2H3DA 1XLCA 4P8VA 1A5AA 1Q2RA 2D23A 1IHIA 4A05A 1GQLA 2HCVA 3AMLA 4RZ6A 2C15A 4RV3A 2QPXA 5HJXA 3W1AA 3SJNA 3O0KA 1E9LA 4ATWA 1JAKA 5CZJA 3MMWA 1W1TA 3LQLA 3F2BA 3GDLA 1KFWA 5BU9A 4F0MA 2VNCA 4DUVA 1DPMA 2DPEA 3B0YA 5G2WA 4F40A 2WHKA 2XFFA 5F2IA 4C6FA 3L4UA 1AODA 2WMJA 5AY7A 1JD7A 3PUDA 1RPKA 5GQBA 4CNNA 1Q5MA 1XYCA 1EGVA 1XWYA 1S1PA 2VFIA 4BQ5A 2W79A 3WNPA 2E09A 2I14A 1X1OA 3G8RA 5ENLA 1UD2A 2FZ9A 1LWJA 4H01A 3AU6A 4NXSA 2INZA 2E68A 1KXVA 3WJXA 3MDWA 2NQZA 2HBVA 4WHBA 4O4WA 3C2RA 4ZOBA 1FWRA 5DBTA 3WL1A 1FCQA 2YGYA 3DFSA 3B06A 4G56A 1LWIA 1N7KA 4TXEA 1GOQA 2WMIA 3OVQA 3F5JA 1KWKA 5K3VA 4RE2A 1TR9A 2PDHA 5K7JA 4H6EA 3QGAC 1IEIA 1SJBA 2XZ9A 1KFJA 1GZJA 2LLEA 4JIEA 1DL3A 4DX3A 2WKLA 4QCEA 3SFWA 4XZ9A 1WZMA 3AFBA 4LT9A 2QJHA 2DEPA 3ZR6A 4YWSA 4JTJA 2OMAA 1HO1A 1DJGA 2FMNA 3EOUA 1XIDA 1CLKA 3ABXA 3SECA 3RG6A 3TROA 2V0TA 4CQ9A 3THCA 1SPQA 3GU2A 2XN0A 3CZ8A 2NVCA 1E1FA 1EIXA 4ICNA 4AIEA 3VI2A 3GKAA 4DYKA 1YNYA 3B8SA 3S3GA 3LCGA 1R9YA 3UWWA 1TTQA 4Q8NA 1XF0A 1VFTA 2EF9A 3PJUA 1W91A 2GOKA 2B7QA 1K8CA 4O28A 3VM5A 4N02A 3K4AA 5HOSA 4GNKB 3CT7A 1FBAA 3UZXA 4PTXA 3W2LA 2A7NA 1E56A 4IP4A 2CIPA 4CQBA 3W1PA 2ALDA 1Z48A 1WOBA 1TRIA 4F48A 3NR0A 4GABA 9XIAA 1GVIA 3TDFA 1K3UA 5AC8A 1UMLA 1A3WA 3BSGA 3ARVA 3C2VA 1YADA 4C7DA 3WQCA 4FO4A 4H6QA 1LT8A 2JFEX 2OO0A 1BSIA 5D9PA 3UVAA 2FLIA 4GHRA 1TV5A 4XBJA 1NU5A 1RP8A 1E5NA 2OFJA 4QLJA 1W1ZA 2PWVA 3CV7A 4UR8A 5A6MA 1UBSA 2GJPA 1D7FA 3BZJA 3NL6A 4LS2A 1MVYA 4NZ3A 1TV4A 4UMBA 2OEKA 4OECA 3WUBA 3RCYA 3EBVA 4JCMA 1L6YA 4RZ5A 3I4KA 1AUSL 1G4PA 4WSJA 3VX0A 3FA5A 4QNEA 4OBTA 5FJJA 2UY3A 1V0NA 1RP9A 2MUCA 2WNNA 1ZBWA 2J6VA 2NLYA 5FAJA 3W75A 1JDFA 1W17A 3CL7A 3LCHA 4HHMA 4PBGA 4Q7IA 2WK2A 4LQ1A 1SSGA 2XH7A 1E6ZA 3GC2A 3DG7A 4L9YA 3N4AA 3WUEA 5E5CA 1HNYA 3SCPA 5G2IA 4KPLA 1AJ0A 3HQPA 1UJPA 1T0OA 3HZ3A 4BS0A 4IGHA 2GQ3A 4UTLA 3UETA 3HBLA 3A47A 4LYKA 1ZPTA 3T55A 3NO3A 5LA0A 1V51A 2BNJA 2REQA 3DECA 2V2HA 2VR4A 3L2LA 1YRRA 1ZHAA 4HJWA 2FJKA 5H1WA 3H26A 5H8MA 4FLQA 3VC5A 5ABEA 1QW7A 4UFKA 3K8KA 1H5VA 3BG3A 2P76A 3QPEA 2E8ZA 4XIMA 1SO4A 1ZJBA 4QR6A 4QG6A 1HT6A 3WH7A 2CITA 4C5ZA 3THAA 3TA9A 5DY3A 1VFOA 3K1GA 3S1VA 4PMJA 5A1AA 3L5AA 1QWGA 1UZ1A 3OLGA 5CQ1A 3WLPA 2HRWA 1CEOA 2WZMA 4DZHA 4I7VA 3QZ6A 3CUJA 4QJ3B 3T07A 1QW9A 2Y7EA 4HU4A 2RUSA 3R2GA 1GK8A 3W22A 1OHLA 3B03A 5FJRA 3OA5A 4Q8PA 5CZ0A 5A6AA 4GI9A 1DXFA 4UFIA 3DFPA 1Z3NA 4UFMA 2OKOA 1ECQA 1NFPA 1TSIA 4UTMA 4IQDA 2PBOA 4PB4A 1R47A 4PCSA 3IJLA 3CHCA 4LRSA 4PTNA 2D3NA 3HA1A 1F76A 4G1KA 4LRTA 1UR9A 4JFWA 3SY5A 5LIXX 1O68A 3SCVA 1CGXA 3ABQA 1VPYA 1I6NA 1RCXB 4DZAA 1XH0A 2G4JA 4HA4A 1CDGA 4KCWA 4GRSA 4GYJA 1SR0A 5M3WA 4J4KA 3T9PA 1DWAM 5CPOA 2NVAA 3AXHA 3P61A 5CC3A 5K9CA 1JUBA 2RAGA 2J6XA 3NDOA 3EDJA 1A5SA 1IXQA 3WJSA 1X8FA 5H2ZA 1WUEA 1B4EA 4IPIA 4GNVA 3OBKA 3H4WA 3P3BA 8RUCA 1EJ7L 1F3XA 2R24A 2WCSA 3E0FA 1SZFA 1K9FA 1PVNA 3P8JA 5IFTA 3FAXA 2VC5A 3UXDA 5K4ZA 3W4RA 2VR2A 4CNTA 3EB3A 3WL0A 1OT1A 2TYSA 1R3QA 5A8MA 4CD7A 1UP0A 4CD6A 2EPHA 2OG9A 3GYCA 3EXRA 3OIHA 4JFSA 4AX6A 3W2NA 4MKVA 4WXYA 4YVPA 1NARA 4W7WA 3GH4A 4MTVA 3NDZA 3L5LA 1C7TA 3UA4A 3MUY1 5EMYA 2O9OA 4AYGA 2D73A 3BLIA 2QPSA 4AMAA 1TMQA 2BSLA 3S5NA 3IJ7A 4NT0A 5KZMA 1SGJA 3T40A 1PHWA 4IFKA 3TC6A 1XKYA 4E2VA 3GDBA 3L2MA 1EF3A 3URBA 1TCMA 1UP3A 5HUPA 3LERA 4TV5A 1G69A 3AIEA 4Q7BA 5A69A 3OA3A 3WQEA 1H7XA 2ZUMA 3WQPA 4YVVA 5A95A 3OLEA 4NNCA 2GGIA 1XKJA 1SFJA 1GW9A 4MFDA 5HPCA 1PPIA 4ORMA 3S5SA 1P5BA 1CI1A 1WXYA 2WJZA 2FTYA 4XAYA 3IV3A 4L56A 1LUCA 4IPPA 3U2ZA 1XBXA 4R9XA 5BNKA 2O9PA 3PZTA 3S2MA 4Z2KA 3AO0A 1L6SA 1MRQA 1Q66A 4H6KA 3GNPA 2E5BA 1W2PA 4NASA 5A6KA 1CXHA 4EF8A 1A47A 1T99A 1NDWA 2J9ZA 3ECQA 2DSZA 3S9ZA 4PTWA 1R3TA 3ZJ8A 2W27A 2J88A 1Z8AA 3MBDA 1F6PA 2OEMA 4LCSA 3MUIA 3VMNA 1W3LA 1XR2A 1JRCA 4ZXOA 2EKCA 4H83A 2J13A 1HJUA 3CH9A 4RW3A 4URIA 3ABZA 1S1RA 1L8PA 3SRKA 3FJ6A 2D2JA 4OZOA 2HXUA 3BJTA 1OC5A 5FJUA 5CZTA 3KOZA 3CT2A 3ICJA 3IAQA 2PTXA 3AYSA 3D47A 4R85A 4DBSA 3WQWA 3EB4A 4IL0A 2NXGA 1XLGA 4DWSC 4PFMA 1U1JA 3WLTA 5CXPA 2QIIA 3ARUA 1YXCA 1LL6A 4DBEA 3H54A 4IHCA 3I6TA 3KCOA 4UQBA 3QY6A 1UWQA 4HSNA 4ERIA 3BO9A 1PSCA 3F1QA 3HPZA 4JIHA 3PJWA 4FS9A 1FHDA 2QW5A 4LF2A 4KKXA 2CLMA 3ANUA 3L4YA 3LTSA 1E40A 4LYRA 1W1VA 4WKHA 4TOQA 2J9YA 2EJAA 1QNPA 3W27A 1E9IA 3W7JA 2EAWA 1RVKA 2PDPA 3HQNA 4UZUA 2I7GA 1XLBA 1E4LA 2O0TA 4MB4A 3TN6A 3HJEA 1RALA 2FYMA 3B8IA 1SMAA 3TXZA 4HU0A 3KRUA 4NILA 2ZZ5A 1YEYA 2O7QA 3IJDA 3MVTA 5AFDA 4WDUA 2WNQA 2DUZA 2BHZA 4HCLA 3PZQA 4KRZA 3VCCA 1NWRA 2FGZA 1CIUA 2IW0A 1AD1A 1Y8BA 3GAYA 2VVSA 3T7VA 2XSBA 4NL1A 4FR1A 4W9TA 4YIWA 1A4MA 1J93A 1WE5A 7REQA 1VLIA 2VEGA 3EOLA 1ONRA 4WF7A 4LUIA 4IP7A 3HMCA 3KCJA 5HNNA 4AZCA 3ID7A 1UH4A 4ZB5A 1YNQA 2CHNA 4HA0A 1PB0A 1XRTA 1JPIA 2VFDA 3LGDA 2QGHA 4JX5A 1H09A 4O0ZA 3L12A 3FS2A 2ZADA 4D8ZA 4LTSA 1XYZA 5HAOA 5C0QA 1VYSX 1OB0A 3MC5A 3BW4A 2GDVA 4B5SA 1W5QA 4HN4A 1NQKA 3HURA 3CZGA 1ICQA 3C2FA 4NZ5A 2QCNA 3O06A 1QK0A 1V4YA 1JUEA 3DC0A 1FUYA 3LHZA 1KR1A 4XZLX 2VCCA 4JXCA 4DM2A 4NNBA 2ISFA 3PANA 4EKJA 4NJHA 4V28A 3B9AA 4ZCWA 3RRAA 1EA0A 3MVIA 4JTTA 4Q22A 4L1GA 3GZAA 2PRHA 2D2GA 1OC7A 4A3RA 4B5VA 4QISA 4INFA 4EACA 3UQNA 1KRMA 4AZ7A 3V5CA 3BSHA 4JTAA 4MNMA 1LORA 3THQA 1V77A 2O9TA 2WB5A 4FNRA 1VCFA 3B9EA 3CBWA 4GO9A 4LV9A 3QV7A 1CLXA 4K1WA 2X05A 4GGHA 4R27A 1AL7A 1VGAA 4ZO6A 3EX6A 3HV8A 3O6DA 2ZX6A 2F2KA 5D04C 1W9VA 4Q8UA 3UXIA 4C6OA 3N12A 5AVHA 2XWDA 3S5ZA 1P0DA 1EX5A 4JIRA 2GZXA 3TXVA 1P4CA 4O8AA 4LGXA 3P0WA 1LLOA 2V5JA 2V5CA 5GNXA 4DLFA 1XLFA 3C2EA 1WZLA 2GK1B 1QHPA 1QI3A 3NURA 1V79A 4M8UA 1FFRA 1ENUA 4OE7A 1D2KA 2DVXA 4O0QA 3W38A 1XHGA 1QCWA 3I7SA 4HNCA 5F2LA 4JPGA 2VEPA 3EAUA 1I4NA 3GW0A 4AZBA 4XD4A 1F7BA 3QQ0A 4L61A 3NEVA 3NQ6A 3CK5A 2R9RA 2XH2A 3W87A 4RDVA 1OF6A 4WZHA 1CENA 4FXJA 4Y9PA 3TK7A 1JYVA 4KEVA 1F3TA 1SW0A 3AS2A 2JALA 4GPNA 4DNMA 2DIEA 3NQEA 5DF0A 1YDOA 4QSFA 4GX9A 2NX1A 2Z26A 4IIHA 1R2RA 2YA0A 2VEIA 4HMNA 1OZMA 2E6AA 1H1ZA 1REQB 2BBFA 4JTGA 3PZ9A 1GPFA 3K2GA 4J3UA 2XTKA 3QRHA 2VVNA 2ZRVA 4MIMA 5BXSA 2DZWA 3G0XA 3IJ9A 1KM6A 2C0AA 2WZEA 2O92A 2NT1A 2ZDRA 3HV9A 1DORA 2WCAA 3R1ZA 1XYMA 2VRJA 3VA8A 4X0NA 3TNOA 3W72A 3RLUA 3CB3A 3R8RA 3T08A 4AD0A 3VGBA 1Q85A 4I7WA 5AYIA 1W8GA 3TYBA 2F6KA 5G1MA 2W9MA 2AQOA 2HS6A 1GYMA 1ZBKA 1HJVA 3UWVA 3V0UA 1NY1A 4IISA 5CJMA 4HT3A 4JKKA 4DPPA 3NO1A 4X63A 5CPSA 4PMQA 5HMEA 3QV9A 2X1UA 3KBSA 3WBXA 1M7OA 4DUWA 2WM1A 1G4EA 2DZXA 3ARQA 5A94A 3PTQA 4R9OA 2WC4A 2O4MA 3EEGA 2PF0A 2DSVA 3QFEA 4AZIA 4WGXA 4I7UA 4ERGA 4OU1A 3MO7A 3MDUA 4X61A 2X42A 2MANA 1K77A 2CBJA 4BQ3A 2AL2B 5I23A 1HJSA 3B0PA 3NCOA 4LYPA 4ATLA 3M6YA 4PTMA 3NSMA 4N6FA 2PC4A 2ZKMX 1RQBA 5A8OA 3ZJKA 1JDEA 3M0ZA 1R9XA 2CEQA 5FA5A 4PCTA 3FW6A 3SY8A 1TJ2A 3EWZA 3EDKA 4JTRA 1TIMA 4FA3A 1C29A 1G0CA 2BVWA 1TJ0A 4NYUA 4ZBCA 1BKSA 1LCOA 4AC7C 2IXUA 2GDUA 2F6UA 4EPKA 2GYIA 1ALDA 5HWNA 3WBEA 2QVHA 2CCRA 5DLCA 2FZDA 2DH3A 3A5FA 3E38A 4D6CA 3N13A 4KERA 2IS7A 1U5JA 4O19A 4DNHA 4IFOA 1L9WA 2J7DA 4HIBA 4AYSA 1GG1A 3G3MA 3P62A 2VP8A 2NSXA 1BAGA 3B97A 2QKFA 3V0TA 3KHDA 3EA3A 5BZAA 2Z28A 2CZDA 1YMYA 1IWPA 2PDFA 3IRSA 5ECUA 4AD1A 2VQUA 4NAEA 4OVXA 4K8HA 1NWSA 3RX4A 4BR1A 1ITXA 5FF0A 2AAAA 1UA3A 3UJRA 3WK3A 4LW7A 1VH7A 3AMGA 2I5QA 4IICA 6CGTA 3S42A 2G4FA 2BHUA 3AOFA 2IKHA 2V6AA 2PP3A 3CWHA 4ZQOA 1H4PA 3F7JA 1LG2A 3UCCA 1R46A 3UY8A 1Y5XA 4IM4A 4TX6A 1ZFJA 3RNDA 4KIEA 2G37A 3H7VA 4FXRA 4MMWA 4GVGA 3ZM8A 2J79A 4ATDA 3V7PA 1KCZA 4HPNA 3N29A 2V2DA 1JPKA 1OFQA 1MNZA 4DAFA 4QDMA 3WDHA 1JYNA 1F07A 1H49A 2DSKA 3RK8A 3KLLA 4CQCA 1XLJA 3M9YA 3T2OA 1AZ1A 1EJXC 1Q6LA 1PIGA 5HK4A 2QCDA 3WSUA 3V36A 4O14A 4NX5A 4OQVA 3N15A 2EG7A 3W1MA 1JZ2A 1QBBA 1TMHA 4GWEA 3REQA 3NQBA 1DKWA 4XD3A 2ZYFA 3PSWA 4BCEA 3DFOA 1P0NA 1KM2A 3TZNA 3MB9A 4BY3A 3W1QA 1P0BA 3KE0A 3SEPA 2FHCA 1S5WA 3VOIA 1TTIA 3EX1A 2UBPC 3C8FA 4XUYA 3RX2A 1W5NA 3IEBA 4DF1A 3KS6A 3DXIA 4XVDA 2JF6A 5BXTA 4BJHA 1TE1A 3LBMA 2WVUA 2BXVA 2G3NA 2OWXA 2BP1A 3MI3A 4H9VA 3DFNA 1XYFA 4KIRA 1FP9A 1FKWA 4JFTA 3VINA 1AZ2A 3S8HA 3GK0A 2OODA 4H9XA 3PUOA 4ZO7A 5AHMA 4IG2A 3UFYA 4M24A 4F0SA 3SN0A 5KSWA 5CPMA 5J5RA 3E0IA 4IFRA 1KM0A 1WDQA 4KWWA 5KEZA 1GJWA 1TQJA 2Y89A 3DHDA 3BGAA 2WWDA 4JBRA 1XGZA 4WK9A 1EUAA 2WVVA 4HNOA 4H9YA 3UXAA 1UG6A 4E0CA 3GVGA 4ACYA 3YPIA 5G4EA 4GYKA 5A8GA 3U48A 5AB3A 3B05A 1ICSA 2XVGA 4I9MA 2C13A 1YHTA 5DCDA 1KCXA 3BGGA 4K7YA 1EBGA 3HGRA 4JHMA 3STCA 3M46A 3LZ3A 5LNSA 2FGBA 4Q4RA 5D37A 1QW8A 4GUJA 2YCIX 5RUBA 5E0FA 2R14A 4HSOA 5T9CE 3ARZA 3CUXA 1KBLA 3WFAA 4UTTC 4O1BA 1FHVA 2VEKA 1BRLA 2OOGA 1O95A 3GD6A 4TUFA 3WF0A 1OYBA 2HNHA 3H2OA 4O53A 4QJ5B 1XLEA 2O4QA 1WX0A 2D24A 5B7YA 4KWSA 1R38A 1TZZA 1JIBA 3CS2A 3AC0A 1Y7VA 4MM1A 5HXMA 4AMCA 2QJGA 1SUXA 4B92A 5C5YA 1XRVA 1XM3A 2VC6A 4XISA 1FP8A 3BE7A 2BOFX 2JKPA 3V3WA 4S3KA 4XAPA 3UG3A 3SADA 1XX1A 2ZZ1A 4M7SA 2WHJA 4LOCA 3SCUA 4GI6A 1R0MA 3IGSA 3DH7A 2ZE3A 1XISA 1HL8A 1NDYA 2NQHA 4B90A 2OPJA 3VGGA 1IXNA 5BRQA 1KCKA 2PPGA 1Z41A 4NP7A 4ZVJA 2O9RA 2QR6A 3T0CA 5BXPA 3IVSA 1QK2A 4ML4A 1C8VA 4MGGA 1MW1A 4UTTA 4EE9A 1US3A 2PF8A 2Z0IA 4WOQA 4N9DA 3RILA 3IARA 1SVDA 1UR3M 1TPUA 5KMYA 2Y7GA 1VFLA 1CBGA 2INEA 4H00A 2J7EA 2YFNA 3GFXA 3H7UA 5HINA 3ORWA 4H2HA 4AF0A 3GBDA 2E4TA 4IJRA 3STEA 3KM8A 3PBGA 3N9RA 4I6KA 3KP1A 1OFAA 4ACZB 5IHSA 1BYCA 4KETA 4RZBA 1ICPA 3W6MA 3O1NA 4B3KA 5J8LA 4MUZA 4M56A 1ZGDA 1BKHA 3BL3A 4UWMA 2PWFA 2E28A 2GJXA 4OHQA 3CIVA 4FALA 1EKOA 3S9IA 3SBFA 3STGA 3R0KA 3OZPA 4O8RA 3N2BA 4MDOA 4AEFA 5GJMA 1EEXA 4K68A 4ASTA 4Q32A 4WJ8A 1F05A 1Q8AA 3P82A 4NZJA 4Z2IA 3MBFA 3A23A 4LS0A 4PH6A 1VKFA 5CCZA 1OK6A 3V1PA 2HWGA 1V8EA 3UCDA 4U28A 3AYRA 2VI0A 3EWUA 1OINA 3TJ4A 1JZ5A 1XCXA 1V6UA 1Q2SA 1M5WA 4CD4A 2X0YA 4P8UA 1P6BA 4CUCA 1KTCA 5CAHA 1R86A 2PSNA 5H8PA 3N1AA 3AIWA 4AWTA 5T26A 3XISA 1FX6A 1H5YA 5AHFA 4O1EA 2X40A 1XP3A 1HX0A 1LL4A 1HKIA 1TX0A 5FJPA 4BA0A 2DT0A 1J12A 1FY6A 1Q7ZA 2J8TA 1UKTA 3VD7A 1FH7A 1UPMB 3AS3A 3MSDA 4F0KA 2A2IA 1QI5A 2GJRA 1R87A 4YCOA 1JVNA 3VIOA 3GNOA 3MYOA 1PL9A 1OK4A 3GTNA 4FEZA 4QXIA 2A21A 3ZLFA 3B0VC 1UZHA 3R43A 3BQ6A 1R8LA 3BUVA 3CAKA 1PZ2A 1CGTA 4H19A 2FTWA 1UWUA 1B3XA 3NZPA 3BLDA 1EX1A 4TX8A 3M0LA 2FDMA 4CNOA 4GI4A 2WNWA 4DBDA 4OWGA 4GNJA 4HK7A 2YYTA 3C0QA 2ACRA 4HYWA 1QO2A 3O05A 3JVAA 2XHYA 3LBOA 4REQA 2BB0A 3BTNA 4PMOA 1XG3A 2E40A 3EXSA 2Q3RA 5MKGB 1E0UA 1W5OA 3PBUA 1KNWA 3EKZA 3M7WA 3TP4A 3O6CA 1XGDA 3VOHA 1XICA 3W1XA 3N6QA 3W2JA 2ZXDA 1L6GA 2J75A 4DWSD 1ZP3A 2WJEA 3WDPP 1OD8A 2PP0A 3H4XA 4HZ7A 4IIBA 4QJ4B 4M3PA 5XIMA 2VGFA 5BROA 3ZOAA 4S3FA 3GU1A 1SMDA 1DIEA 1S2AA 2Q8XA 3H70A 1PIFA 5KETA 3ZLHA 4KH2A 1U5HA 3EA2A 3OQ8A 4O4VA 1P7TA 3CWOX 6ALDA 4QRNA 1EZ2A 3AMKA 4QS6A 1TUXA 5CLTA 1JCMP 1UA7A 2V8ZA 3U4AA 2EG8A 4JTKA 1ZAHA 1RPXA 1S2WA 2QV4A 2RGLA 5CPLA 2E0PA 5DANA 4TR9A 4D2JA 3RFAA 4M6PA 4H2CA 1H3GA 1O5KA 4FOUA 3SUUA 4UR9A 4GI8A 4RL3A 4YVXA 4XBKA 2JEPA 4O1AA 1D3GA 3SCQA 3H8AA 1AMYA 5DCBA 2BWGA 2PDNA 2HK1A 4PSPA 4AISA 3MCNA 1PCWA 4Y6GA 1FHLA 3BV4A 2FZMA 2EPLX 2GVGA 4PCNA 3VK5A 5EBAA 1P0KA 5M2FX 1E1EA 3QR3A 1UIPA 1O94A 4YU1A 3L7RA 1KR0A 4PODA 5HQMA 3LYEA 8XIMA 1NF0A 5EL1A 1Z69A 4QE4A 3ONBA 3CB8A 2QIWA 3M0JA 3LLDA 2OTDA 5AZ1A 1VFHA 4H8VA 4FHAA 5G2HA 1TV7A 2ZZ3A 1MQQA 1ZBVA 5DELA 1QO5A 3WUFA 1YBQA 2A7PA 1XUZA 2FVLA 2PCEA 3ZJ6A 3H6OA 3S1GA 3FYOA 4GINA 4K38A 3RJXA 3K4DA 3KLKA 3DZ1A 5A6BA 1I75A 4JNYA 1TRDA 4O15A 4ZOAA 4JICA 5D2WA 2VDGA 3SY1A 5HPOA 1NTHA 5LGZA 4KWOA 3VNYA 3Q67A 3ALGA 1U30A 3LGGA 4QQ3A 1RQHA 3LI0A 1BPLB 4MPQA 4FNTA 1TX2A 4B2DD 4HMCA 4LVDA 1WDSA 4WOZA 3NZQA 3W7IA 4DUXA 1DIKA 4ZMGA 4AH7A 1E6PA 4UIOA 3LHVA 5D2YA 3D46A 3FLUA 3O2LA 5D05A 4RK8A 2ZX5A 2GGEA 4AXKA 1WQ5A 5EMLA 2DV0A 1VBGA 4DF2A 3P14A 1JQVA 1EF2A 1ZCOA 5AC7A 1PYMA 3G1FA 4GVHA 5LZLA 3NWRA 1VBJA 1EPVA 4A21A 4P5UA 1HKWA 2ON3A 3GG0A 1JI1A 5KINA 2DGAA 1OF8A 3T4WA 3QV6A 4A29A 1SW3A 1GG0A 3O6AA 2A3BA 2OJPA 1GHRA 2VUYA 3OLDA 4JTDA 3Q2DA 1CLVA 1Z44A 3BW2A 1GVEA 4WY0B 5C71A 1TB3A 3S5YA 1HFBA 1E71M 3RLVA 3M0HA 4LBUA 5FCZA 4D6HA 4M7TA 4J5NA 1DV7A 4JTCA 2Y7FA 3F4WA 4ZTYA 3VCNA 1AK5A 3C56A 5CLWA 4C7GA 1C92A 1MMFA 3W84A 5KZEA 4PGLA 3PZUA 4FXFA 1TQXA 2E7FA 3KS5A 4MJMA 2ISSA 3R25A 3GR8A 1PTGA 5T91A 2UWFA 2VOTA 4HVXA 4C6BA 4S3BA 5D2VA 1VPQA 3QN3A 3NPXA 4C1NA 1XL9A 3RLGA 1VD6A 1XDMA 2BX7A 4Q33A 3L0GA 2ZC8A 3SDOA 4PL1A 5EPDA 3IJIA 2Y88A 4F66A 4XZBA 1TJ1A 4HZMA 4H7ZA 4R34A 4W89A 1ME7A 3CTLA 2YL6A 3WQ8A 4HYRA 2WWCA 5A8PA 2RDTA 3NXLA 1EUNA 2ZX8A 4FNSA 4IMCA 3TWBA 1UD5A 1DJNA 3IIXA 4AEEA 3WD1A 1LG1A 1K8XA 3T78A 3DFYA 3M0XA 2CHRA 1O1ZA 4GVIA 2X41A 4FAMA 2YDSA 4HTBA 4PUUA 1KM1A 3IACA 3QY8A 4IMDA 3IAPA 4I9AA 3PAOA 2GFTA 3PP7A 2WVTA 3S83A 3ENLA 3G6LA 3Q94A 2XU2A 3MZ2A 2HVMA 5DN1A 1TMLA 1HJWA 4C6CA 1UBPC 4HCDA 4LUSA 1XC6A 2Y61A 1E15A 3QBUA 3AICA 1J0HA 1QFEA 4W84A 3OG2A 3WJYA 2CBIA 2FPYA 2D20A 3A4JA 3FNDA 1QNVA 1LROA 2DSUA 1E0VA 5HUOA 3ZT5A 5BOEA 3THDA 3AI0A 4Q6JA 1XIHA 1Z32X 5G1TA 4LY8A 3FSUA 2I9UA 4LC8A 3PBWA 4GXMA 1DWIM 4WR3A 3C3NA 1GYNA 2I9EA 1AH3A 1EBHA 3GR4A 1US0A 4MY1A 2XIMA 3W7KA 4NI8A 2DU2A 1RBLA 3UR7A 4GFSA 3APYA 4OOUA 1BG4A 5AYXA 3DN5A 3HPFA 3QYSA 1U1HA 6REQB 5LIWX 4LAKA 3UNTA 3C86A 3VIHA 4IUOA 3EA1A 3CIXA 3U2CA 2YCEA 3BAKA 4S3GA 1K9DA 3IJ6A 3LY0A 1C8YA 4L1XA 4H8UA 3LRMA