4NQ1A

Legionella pneumophila dihydrodipicolinate synthase with first substrate pyruvate bound in the active site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
289
Chain Sequence
MFSGSIVALVTPMRNDSVDVHHLRELVEFHIAKGTHALVAAGTTGEAGTLSHSEKLLVIKTVIEQAKERVPVIAGTAMNATKDCIELTQQAMEYGAHAALIMTPAYIKPTQEGLYLHYSHIAQSVAIPIILYNVPGRTACDMLPETVARLAKISNIIGIEATGQMTRLQQILRLCEGSIDVYSGDDLTAAQWLLSGAKGVISVTANVAAKLMAKMCDLAMDDDQAGCLRIQEQLMPLHELLFVESNPIPVKWAMKKMGLIGGELRLPMTELSEKHHQALEKVLKNLELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
publication title Legionella pneumophila DHDPS: The First Case of Non-Lysine Inhibition in a Gram-Negative Pathogen
rcsb
source organism Legionella pneumophila
total genus 104
structure length 289
sequence length 290
chains with identical sequence B
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2013-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nq1A00
1HO1A 4O1CA 5CG7A 3CIXA 1KM4A 3TXZA 3UY7A 2V0TA 4CLMA 3GB6A 4O1AA 2E5DA 1O5KA 2YW4A 2QUTA 5K9XA 2G5WA 3CT7A 3GKAA 3LI1A 1RR2A 3KFTA 1QNVA 1S5VA 3L9CA 3UZJA 4A2RA 1EWDA 4EIVA 1CW2A 2YX0A 2ZRVA 5CPOA 1JQVA 3IGSA 3ATZA 2DZXA 2X2GA 3JS3A 3NPXA 3W7IA 2EPHA 2Y88A 5D05A 3TMQA 4O1BA 3B04A 4NXSA 3HGRA 1W8SA 2H3DA 2JKEA 4Y9AA 3LGEA 4ZL1A 3ELFA 3QPYA 5CSSA 3Q58A 4MPQA 2YYTA 2Y7GA 2CFFA 5KITA 5AC6A 4LVAA 4X3ZA 3IEBA 2EAWA 3DAQA 4QIUA 4MLJA 3UQNA 5T26A 4YCOA 2QUUA 3DFQA 3BGGA 3P61A 3VNDA 4HSOA 3W1TA 4FNTA 1ICSA 4P61A 3S42A 1AW5A 1ME7A 2O7SA 5A5WA 5HWMA 1A5CA 1VLIA 4IJBA 1H60A 4NUWA 2PRHA 1VHNA 3TC7A 1LROA 4DBDA 1MEIA 3HGJA 4HSNA 2QCFA 5KZMA 3ABRA 5BNKA 1XKYA 3NVTA 1KM1A 3MP4A 1Z44A 2E6FA 3TSBA 1QAPA 4NNBA 4UTWA 1RQHA 3RMJA 1VC4A 1L2UA 2ZBTA 3G0XA 4I7VA 1VS1A 1ZAIA 2HTMA 4IXHA 3EX2A 4UTUA 3STFA 5HMSA 3NQEA 2EHHA 3NQ8A 3O6DA 3QQ1A 4JX5A 4CCCA 1JCYA 1QPRA 4RLIA 3M5XA 5DY2A 3NL2A 1IXNA 5FF3A 4C1LA 4ZMGA 1LORA 1NAL1 3ABSA 2ZRWA 3PUEA 2VXNA 3LLDA 1OX4A 4O4VA 1D9EA 5EL1A 1W0MA 1ADOA 5DCBA 2YZRA 2Z0IA 3TJXA 4ORIA 5D2YA 4JEQA 3P80A 2TSYA 1XFBA 5FF4A 3QZEA 1EIXA 3SECA 1Q6OA 1RPXA 4NJJA 5I3FA 4CNNA 3PSVA 1M7OA 1LOSA 2EKCA 2LLEA 1F2JA 5D2TA 4A29A 2GJLA 1KV8A 1TRDA 3EXTA 2F84A 4AWTA 3EX4A 2XN1A 2QCDA 3NM1A 3L5AA 4FEZA 4GC4A 2E5BA 4MZ8A 5F1UA 3TK7A 4BWLA 1OVDA 3EX1A 3N14A 4QM1A 2ZRZA 2NXHA 3ZS4A 5CPMA 2YPIA 4YLWA 3DI0A 5HR6A 3DXIA 4FHAA 3UNDA 4NJKA 3CPRA 2ZA2A 2WSYA 3UPBA 4O53A 4FF7A 1TTPA 2TMDA 3GAKA 2W0UA 3GDLA 4UNKA 3NO5A 5DBTA 4N6EA 3B8DA 3BG3A 3KX6A 3LBCA 5AYZA 5IBXA 4LUJA 1OFPA 3O63A 3H53A 4R7JA 4AVFA 1TTJA 2QUVA 1K7EA 3P60A 3B05A 2Y85A 4FNSA 3DFPA 1L6WA 3C2OA 4LU0A 3B0VC 2QCGA 3HPXA 2DJXA 2QEZA 2ZZ5A 2E09A 4MFEA 4K6AA 3DHDA 4K7VA 5A8GA 3MI2A 3CWNA 4LRSA 1KV5A 4D2JA 4WQ6A 3NQMA 3OVPA 1WXJA 2IQTA 1CI1A 2J9YA 1B3OA 1B9BA 5KTLA 2ZRXA 4LWWA 1DQWA 1ZAJA 3TE9A 2NX1A 1PHQA 2TPSA 2QCEA 1B4KA 3ZFHA 4UC5A 2GQAA 3LTYA 4UMBA 1Q45A 2E5CA 3QC3A 3TX9A 4XBSA 4HNVA 3DBPA 1OX4B 1YDNA 2GVLA 2R94A 4RZ4A 5D32A 3W7EA 1QMLA 5K7JA 4CNPA 5KMYA 4ZQPA 2NLIA 4XZ9A 2VFGA 3O05A 2V2DA 1TPWA 3NL5A 3R13A 4QSHA 5F2IA 4DBEA 4PEKA 3T40A 3G8EA 3GIYA 3GLCA 1RQBA 1ZAHA 1OX5A 3UWYA 4NNAA 3EWUA 2VOMA 2J9ZA 3G1AA 4MY9A 1FDYA 3A5FA 4LS0A 5BW6A 3NR0A 5G4WA 4NU7A 2QCDB 1TPH1 3IIVA 1DHPA 5LNWA 2QJIA 1N7KA 1XDMA 3MHFA 4UFHA 4GWEA 4UTMA 2Q3OA 4IUOA 5K9CA 2Y62A 1VYRA 1HFBA 3M0ZA 3TA6A 4EOUA 4WOQA 1SZEA 1W5OA 3LCWA 3W07A 2YCEA 4TR9A 4CQ8A 4FX6M 2JBMA 2FPYA 3WJWA 1LZOA 4MJZA 3G1YA 5LHEA 2HMCA 1KTNA 1FDZA 4PTNA 1F7BA 4JY8A 3WJYA 4LUIA 3P62A 3O06A 2FPTA 2VKZG 3GKFA 5TQLA 3M5ZA 1K3UA 4Z0SA 1OFQA 1GG1A 3W7QA 3MI3A 1VLWA 4UFKA 3H54A 3WJXA 1QWGA 4JX4A 1XUZA 3CEPA 4JTHA 3STEA 2VEPA 4OE7A 3W84A 1DL3A 3LLFA 2NWRA 1G4PA 3G18A 3TV8A 1VGAA 1X8FA 4UTLA 3PWAA 4LC6A 4UTJA 1SSDA 4BI6A 1S5WA 4UFMA 4MY8A 4ZQCA 1TPUA 3W7KA 4X9SA 3WK0A 3CC1A 1DBTA 3R5EA 4JD4A 3S5YA 5K3VA 3NA8A 3BVJA 1SR9A 5C6MA 4O13A 4JYFA 2V81A 1N55A 3CTLA 4HIBA 3R89A 2P10A 4XBKA 4YXGA 1H7NA 1JRBA 1TV5A 2QAFA 1T96A 3IVTA 5AHFA 4Q4KA 5HULA 2OMAA 1MXSA 3IVUA 1OF6A 1QOPA 4MYXA 5EKYA 2J9XA 3GX9A 4UR8A 2FTPA 1WV2A 2YFOA 1AG1O 3VFLA 4B5NA 1NEYA 4JTSA 1HTIA 2C0AA 3PM6A 3SR7A 5AHMA 4RV8A 4WOZA 2GQ8A 4AF0B 3O16A 1ML1A 4GUIA 4DO5A 4CNOA 3WK1A 1OHLA 5BRBA 1XI3A 2CZDA 1VYPX 1HG3A 1WBHA 4LY8A 3PR2A 1U83A 3G1XA 1KTCA 3USBA 3FKKA 1MO0A 4QISA 5BOOA 3MYOA 3M16A 1W5NA 3NAVA 2JGQA 4EVZA 3W1NA 5HINA 3FFSA 4LVGA 3QEZA 4KFPA 1D3HA 3LB0A 4Z1CA 1TSIA 3KXQA 5CPNA 4FIQA 5H91A 1XDLA 2NUWA 4TMCA 2VFDA 3NPVA 3NM3A 3PG9A 1JCMP 4DF2A 4HHPA 4RCXA 2RDWA 2NZLA 3MI6A 4AB4A 2V8ZA 3VI2A 1QO2A 4W9TA 4N6FA 1I2RA 5EY5A 1X1ZA 3T4CA 3LCHA 2DU2A 3PSWA 4ZZ9A 2C3ZA 1CX9A 2ZZ7A 2Z6JA 4UTWC 3TJLA 5D33A 3T7VA 1O60A 4BF9A 4XUGA 5L6UA 4Z08A 4XTIA 2R14A 1UCWA 4RJEA 3W1AA 3T44A 1TPDA 1FX6A 2D73A 3L68A 1EUAA 1T99A 1VYSX 3IIXA 4BR1A 5AB3A 4IX0A 2W79A 3TXVA 1Q6RA 2BXVA 5DXXA 2A0NA 3DFSA 2V30A 4KKXA 2NUYA 4JS3A 3P8IA 1L9WA 3BLEA 5HJLA 4O57A 5EA9A 4AWUA 4WY0F 2V9DA 1K02A 3CU2A 2B4GA 4LS1A 1N8FA 1IIGA 2XN2A 3QJAA 4MVAA 1I45A 1SSGA 1KFLA 4K8EA 1DJNA 3TQKA 1H1ZA 3TSDA 4N9EA 2ZZ2A 1GVRA 3Q94A 1BEUA 1Z42A 3LCXA 3GZ3A 1J4EA 2FJKA 4O4WA 1X7FA 3BLFA 5DELA 3LHYA 2JGYA 4X2RA 1SO4A 4BWLC 1GYLA 4E2DA 4WJEA 3MYPA 1FXPA 2FIQA 4MY1A 2YYUA 5I3GA 4DQWA 3W7OA 4E2BA 4FB7A 4LVDA 3VCRA 3QM3A 2VEIA 4GNJA 5GVJA 5CZJA 2H3BA 2X16A 3P5YA 1H5YA 3QF0A 3TW6A 1T0OA 3I65A 4LRTA 3GK0A 3L66A 2ZZ3A 1R30A 3UXAA 1DKWA 4WXZA 5HWJA 3W1LA 4M6QA 1OX6A 3QW4B 3THQA 5IBXC 1ZHAA 2GVJA 3P67A 5FF0A 1YADA 3CB8A 3IIOA 3DH7A 1NF7A 3C6CA 1GVSA 2TYSA 4I7WA 3Q37A 2RH9A 4NX0A 3KAOA 2C15A 4YWIA 3GYEA 3TAKA 1KBIA 1KW1A 1TQXA 1SFLA 1TREA 4JDBA 1SPQA 1PCWA 3C0JA 3B0UX 2ZTKA 2TRSA 5K4ZA 4GFSA 1GPWA 3IGUA 4QQ3A 1H51A 4MZ1A 3C4UA 3L21A 2QJHA 4JTEA 3K30A 5FEXA 2GJNA 3EEGA 4O10A 3EWXA 3S1VA 1PE1A 3PB2A 1PCKA 4K8HA 2J88A 3NG3A 4CQAA 3CM4A 1A5SA 3G1DA 3NQAA 2FB3A 4UXDA 1WBJA 4IMFA 1K7FA 2C14A 3HG2A 1ZFJA 4O12A 3NQDA 3TKFA 1A5BA 4O54A 4JTIA 5LSMA 4H3DA 4DXVA 1OFBA 2DJLA 1WAUA 4O16A 3TUUA 1TIMA 2WSQA 3E12A 3L5LA 2BWGA 3LBMA 3PS7A 2VENA 2JKPA 2Y7FA 1TYGA 4FXSA 4OWGA 3W2JA 3P81A 4UTKA 4HPXA 3NXFA 3NL6A 2XFWA 2V5BA 1JUEA 1IIHA 3M5VA 1SUXA 3LOTA 4IPIA 1EA0A 3VE7A 5AHLA 4NJGA 4OQVA 3LM7A 5CPLA 1Z48A 3BLIA 1SZFA 5DBUA 2ZCGA 4Y90A 5FEWA 2QAPA 2Y70A 1SZNA 4IWWA 3UD6A 1KM3A 3RLUA 2A21A 4O19A 1VH7A 1XC4A 3JRKA 4RK8A 2HS8A 1H7OA 3P74A 3U2OA 4JTKA 1QPQA 5TBOA 5CSRA 1ZALA 2ABBA 4LVBA 4NQ1A 4LW7A 2CLLA 3UZ5A 5LNSA 3BG9A 1AMKA 3SY5A 4OBTA 5D02A 1I8JA 4Z1BA 3W23A 2WKJA 1TJPA 4RXGA 2V5LA 2G97A 3STGA 4AWSA 1TPVA 1GT8A 2ALDA 2EGZA 3DFTA 1GQNA 5FEPA 3CEUA 3O07A 1JUBA 3H55A 2NXGA 5KINA 4WY0A 3W2NA 2Z1BA 3LTPA 3TH6A 1VZWA 1LYXA 2J6XA 2C6QA 3F4NA 1H7WA 1TO3A 1I2PA 4PL1A 2I14A 1SO3A 3W2UA 3W7GA 4IMCA 3N9SA 1XL9A 2EF9A 3W73A 1LCOA 5CZTA 2DZTA 3RLVA 3G0UA 1F6PA 2VC6A 1PL9A 2A6LA 2FPVA 3NEVA 3O6YX 3TDFA 4LC8A 1P0NA 4O8RA 1FUYA 2GQ9A 3G1VA 4QNEA 2BLEA 1KA9F 4M19A 1KM0A 1KTBA 2ZFAA 4JX6A 3Q2DA 3TFCA 3SZ8A 2ISSA 2A4AA 1KLYA 4OT7A 2YR1A 1PIIA 4JNMA 1GOXA 1XBZA 4NJHA 3R2GA 5AFDA 3YPIA 3W88A 2H8ZA 1A50A 3MW7A 5IM51 2FB2A 4GUHA 1WOBA 1PS9A 2UV8G 4O28A 3TQ0A 1OK6A 4PODA 3EWWA 1JULA 1VQTA 3I7QA 1J2WA 1OFEA 4UCGA 3LI0A 3DKLA 3DZ1A 1LBMA 4MJMA 1QOQA 3ZWTA 4HNNA 4EF9A 3LHUA 3INPA 2CZEA 3KRUA 3PB0A 3KVKA 1EX5A 4Q32A 4XKYA 1AL7A 4UTTA 2C1HA 3UPWA 3AJXA 1LRTA 4Z1AA 3L2IA 4IMEA 3S1UA 3BO9A 2DZSA 3S5OA 3LV6A 4ADUA 1W3TA 1KM2A 3KOFA 2VELA 5CZSA 3HB9A 2YFNA 1TRIA 1W1ZA 4IMDA 2ZZ6A 1NSJA 5K2ZA 4Y96A 2CZFA 4UMCA 3LHTA 4ALDA 3GR8A 4R53A 3W2LA 1W3NA 1G7VA 2A7RA 3CQ0A 3W72A 3BARA 3PF3A 1GZGA 3W1PA 2CLOA 1I4NA 3LCLA 1C29A 6ALDA 2OZ0A 3DU0A 2NV2A 3W1QA 5DN1A 3LRMA 3N73A 5CZ0A 4NX5A 1KFBA 2CLMA 4S1FA 1SO6A 3MP5A 5BMXA 3HG5A 3HIJA 3EKLA 3BGJA 1VCFA 3FYPA 4O15A 2WSRA 4JTFA 4WY0B 4OV4A 5DY3A 2PRMA 3RF9A 3IRDA 3QFEA 1YXYA 1LP6A 4WUIA 4Y8FA 1F73A 3NQGA 1EEPA 4C1KA 4K36A 3FJLA 1JCLA 1G69A 1A5AA 3EWZA 1IXQA 2QCLA 4ZQNA 1F76A 1OJXA 1WYIA 2BX7A 1H61A 2AQWA 1TB3A 5HUOA 5DCDA 3EB2A 1HL2A 4H4IA 1DJQA 1TV8A 5HNRA 3EXSA 4FNUA 1IGSA 3KVJA 3MWAA 2B7PA 3A22A 1VCVA 5HQEA 1I2NA 1BWLA 1W3IA 4DF0A 4BI5A 4K7YA 3FKRA 1H7RA 2GUUA 2PRLA 4M5PA 1HUVA 3IV3A 3CLMA 4Z0JA 4JTJA 5MHBA 3FIGA 2B7OA 1SW7A 1ONRA 2OCZA 4GUJA 1OFAA 3G1FA 5I3KA 2CLFA 1AK5A 1RZMA 2ZA3A 2CW6A 3L0GA 4O52A 1QR7A 3M43A 4PFMA 5AHIA 1KFJA 2Z2UA 5AN7A 3IIPA 5G1YA 3W7LA 2H90A 3FOKA 3W7MA 3PUDA 1K03A 5CGQA 1GG0A 4RZ5A 1KBJA 4XKYB 4J9JA 3LTSA 1XCFA 1G6CA 5ABTA 2C16A 3MO7A 3UY8A 1YPIA 3P84A 1DOSA 5D30A 3C61A 4UIOA 1O94A 1K8ZA 3W1XA 3QH2A 1H62A 3OA3A 2QCNA 4ICNA 3S6DA 2ABAA 4GJ1A 4N9CA 1V7YA 4BK9A 5LNUA 1FDJA 3N3MA 3PBYA 3S8HA 3TQVA 5K9DA 3M5YA 1XXXA 4OGZA 1UBSA 4JIQA 1JRCA 4O1DA 3LXCA 1MEWA 4CCDA 2E6AA 1EP2A 3L65A 2JKAA 2ZRUA 3W76A 1YXCA 1YTDA 5DCEA 5FF2A 3GDTA 1P5BA 2VFIA 3MJYA 3TR2A 1OFOA 3MP3A 1LDCA 3TMLA 3MMTA 1R2RA 4R34A 3W6YA 4MZYA 2NUXA 3W7DA 4A22A 5FI8A 4A2SA 3QPZA 3E49A 3FS2A 3G3DA 1TQJA 4DELA 1FWSA 4JXCA 3DFOA 3S1XA 1FWRA 1LBFA 3NL3A 4AMAA 1YYAA 3A5VA 3UWQA 2ZA1A 1T8XA 1TPFA 4WX2A 1GVOA 5F4XA 2QJGA 3I68A 5DXYA 4OU1A 4S2BA 4AXKA 1XBYA 4UNLA 1IXOA 2ATMA 4DO6A 2GVGA 5F2MA 3MHUA 2ZZ4A 2OT0A 3F03K 3GVGA 3NNTA 1G4SA 1K8XA 1ZENA 4H6KA 3UWZA 5AYYA 4I9AA 3W9ZA 2ATSA 2A5HA 3U6WA 5AHNA 4KFNA 4UFIA 2C13A 3BG5A 2ZTJA 2PURA 3DFNA 3W83A 3C2FA 4UR7A 4MUZA 3EWBX 1ICQA 3SW6A 4MLRA 3VE9A 1LLZA 3ABOA 1BTMA 1OK4A 2X1SA 3O8AA 1SZGA 1UUMA 2B0MA 3TSMA 1BKSA 1D3GA 2CU0A 2B7NA 3OBKA 4PC8A 1EUNA 4N9BA 3W7RA 1H50A 1LOLA 5D2VA 2W6RA 2ZDRA 1XUUA 1FCUA 2P0OA 2AGKA 3CWOX 2A85A 5C2XA 1WX0A 1IF2A 3DHFA 1FWTA 3KVLA 4NVTA 2JK2A 3FYOA 3VKJA 2X1TA 3L0KA 1OYCA 1MEHA 1JCJA 3C56A 4G1KA 2PE4A 3O6CA 1S3HA 3C2EA 2FQIA 5D2XA 4YCPA 4ORMA 4HT3A 5U7SA 2NXIA 3HO8A 1DVJA 1L6SA 3HG3A 3GNDA 4ZQMA 2CWNA 1H7PA 3SJ3A 4GUGA 5D38A 4AHQA 3JR2A 3LERA 2QCCA 4NZFA 4RXFA 1QCWA 2C18A 3E9AA 3MBDA 3A21A 2CLEA 4N02A 4UTHA 4KWVA 2XN0A 1TTIA 1B57A 3EX3A 1OF8A 3GDKA 3QSTA 3F1QA 1B4EA 3HQ1A 3THAA 4U28A 2V2HA 3NPUA 3HGOA 1U5JA 3SI9A 4MYAA 1LTDA 2WOQA 5I3HA 2VEMA 3LHZA 2ZRYA 1WDWA 2OX1A 4OV9A 1KLZA 3V1PA 1GJPA 1TCDA 4QAIA 4YL2A 2YDAA 2E77A 4LV9A 3S5NA 2CLKA 3PUOA 3W3OA 1L6YA 1RV8A 4UTTC 1VCGA 1EB3A 3A24A 1ME8A 5KZEA 1WA3A 3MUXA 1LRQA 3DGRA 3OIXA 1A53A 3TROA 3W70A 2FFCA 4PA8A 3W71A 2BTMA 1GVFA 2WJZA 5BMWA 1UB3A 4LNYA 1ZY9A 1VHCA 3E96A 3S5ZA 3N2XA 3W75A 4PH6A 1TPB1 1G67A 3W74A 3LHVA 6TIMA 1GTEA 1KM6A 3LV5A 3P82A 2Z6IA 4GE8A 3NQCA 4UTIA 2A2IA 1QPNA 3M9YA 4IX2A 4TX9A 3NQ6A 1ZNNA 3R12A 2WNNA 4FIRA 4NZJA 5EPDA 1ME9A 1VR6A 2DZWA 3PY2A 4L4MA 5AYXA 4FNQA 3E02A 3LCIA 2R8WA 5HR7A 1W56A 3G1HA 4DO4A 3TCEA 1MZHA 3SIZA 5E93A 1GYNA 3QYQA 4HNUA 2X30A 3PG8A 2HS6A 1GEQA 1FWNA 1SW3A 2DZVA 3ABQA 5HWNA 2BSLA 1AL8A 3NQ7A 4IOTA 3W22A 4ADTA 5D2WA 5G2HA 5KSWA 2A7NA 3I6RA 3N9RA 4POCA 3R8RA 8TIMA 2ISWA 3HJZA 3TFXA 1TTQA 3B06A 1FWWA 1FBAA 1W5QA 3IVSA 4RKAA 1F5ZA 2O7QA 3UWUA 1JVNA 4UMAA 3W87A 5D09A 4DPPA 1W31A 1OYAA 3N34A 2RDUA 3HMJG 3RU6A 4LOCA 5SWUA 4HPJA 3W1UA 4GXMA 4ML9A 1YTKA 5D03A 4Y6GA 2R91A 2E6YA 3PULA 3CIWA 1KFEA 1PVNA 1ICPA 3P8JA 2QF7A 3HOJA 1G4TA 1VPXA 3EWYA 5F4WA 4N2YA 3ATYA 4GRSA 3M1ZA 5C54A 3FA5A 3IGXA 1PHWA 3W2MA 3WJZA 1KFKA 4X22A 4Z1DA 1M6JA 2DORA 1E51A 4A3UA 3HF3A 3DKJA 3NGJA 1PV8A 2DZPA 4HKPA 1BWKA 4JYDA 1AW2A 1X6UA 2VFHA 3GXTA 4LVFA 4E38A 1QDSA 4CQ9A 1FXQA 5LNRA 3O1NA 5K4XA 3C3NA 5HUPA 4IQLA 3N2MA 3W7JA 1W54A 5D04C 1FQ0A 5LGXA 4EWND 3GAYA 5G4EA 4FNRA 1WQ5A 2C19A 3HG4A 2Q3RA 3M47A 2YGYA 2I9EA 4MOZA 4TU1A 4IMGA 3V75A 1JUKA 1I2OA 3SGUA 2WO5A 5LGZA 1V5XA 2WQPA 3OG3A 3QQ0A 2G96A 4JR5A 2QDHA 4WD0A 4UFLA 1QPOA 3BV4A 4NT0A 5D37A 4QJ1A 3LX9A 1FCVA 2PC4A 3FEMA 3UWVA 5AOUA 1HO4A 4JYEA 2DZUA 1DV7A 4ADSA 3L67A 3S9YA 1WOAA 4ZVJA 1EP3A 4BI7A 1JCXA 1AW1A 3W7CA 1YDOA 4DPQA 3LDVA 3KRZA 1TV7A 1S5TA 3TW7A 1YLVA 3SSJA 3WFAA 3IIZA 5J5RA 3LXBA 2WNZA 2X1UA 3EX6A 2H8XA 1YXDA 3QW3A 4S2CA 5FF7A 1EP1A 3OVQA 1ALDA 5LHFA 4UUIA 1RD5A 5E1QA 5J5DA 2YXGA 2OT1A 1OYBA 1Q6LA 4XTDA 2PCQA 3L0NA 1LBLA 3HGSA 4N4PA 3W2KA 3W7PA 2I1OA 4JTUA 1H7XA 3ZWSA 2QR6A 4GBUA 1OFRA 2RKXA 3G1SA 4O50A 2WV8A 4KWWA 3G8RA 2ISVA 3G3MA 1Q6QA 3UWWA 4KFOA 4HNTA 4M7SA 3MBFA 1RQEA 4BFAA 4FNPA 1I2QA 3TIMA 1UJPA 5U4NA 1Z41A 1SQ7A 5C55A 4AF0A 1G4EA 1H1YA 1OG0A 3NQFA 3NQ2A 1RVGA 3S1WA 2NV1A 1OABA 1YTEA 4IPJA 3GXNA 2YSWA 4PL2A 3EKZA 1UUOA 3HBLA 4DEFA 1XBVA 4JICA 4JN6A 1K8YA 3PVFA 3TNOA 1VRDA 2VFFA 1Y0EA 3KVMA 3E0IA 2J24A 3FLUA 5F2LA 1LRNA 3TAOA 5LNVA 2ZZ1A 3BW2A 3QMTA 5FESA 2GOUA 3G22A 3W7NA 4AH7A 4TMBA 1C9DA 1FCBA 3ANYA 4ZQRA 2E68A 1O95A 1DQXA 2ZYFA 4JTGA 1SFJA 3LRLA 2QDGA 1GVQA 3A9IA 1GTHA 2RDTA 3B03A 3O15A 3F4WA 3S0CA 4FX7A 3NYZA 5CKSA 3GR7A 2P1FA 4TO8A 1C8VA 1JCNA 3C2RA 3ZR4A 1O5XA 3KHJA 3BW4A 4FXRA 3CHVA 4O0ZA 4YMZA 3PAJA 2AAMA 3WK2A 4O17A 3M6YA 4K38A 3BK0A 2QCHA 5EBUA 3OHIA 5F4SA 1O4UA 3C52A 1W37A 1VJIA 4NJIA 5I3JA 2QKFA 1JJKA 1F05A 4NNCA 1NF0A 3QMRA 4O0KA 4Q33A 2GPTA 4ZQOA 4JDYA 2X1RA 1R46A 2A6NA 3AO0A 1SO5A 1X1OA 1F74A 4JY9A 4L4LA 3B0PA 4JTTA 4O18A 5G2WA 3MHGA 3W1MA 3LRKA 2QCMA 3N19B 2A1YA 3G24A 3RK8A 5G5IA 3OEXA 2V82A 4N4QA 5L9FA 2B7QA 3NZRA 4ONVA 3W85A 3NQVA 3GXPA 2FDSA 2ZQ0A 1P4CA 3NZ1A 4A21A 2YW3A 3TU9A 4DF1A 1IXPA 1OFDA 2G95A 1R47A 1TMHA 1G7UA 3P5ZA 2VEKA 3BPWA 3I7RA 3RNDA 1R2SA 2Y6ZA 5G1TA 4PCFA 4IXXA 1FCQA 4AAJA 3PC0A 3W86A 3KRSA 3WJSA 3W7HA 3LHWA 1TJRA 3C2VA 1M7PA 3M7WA 2CLIA 4LS2A 4HN4A 2F7FA 2NX3A 4UFJA 1J5TA 1KFCA 4M7TA 3WK3A 2CZ5A 3P7YA 3EXRA 3LCGA 1JQXA 5DLCA 5LKYA 3M44A 1F6KA 2HSAA 3HPZA 4XQ6A 3NDOA 3SFKA 4TIMA 4JIPA 2NWSA 4JTLA 4R33A 4AEOA 2V2CA 3QMSA 1FY6A 1K7XA 3NOEA 3L5MA 4QITA 3D0CA 2OJPA 5C5YA 2Y63A 1XBXA 4LT9A 3G0SA 4M6VA 3STCA 4O11A 5F2GA 5FEZA 3C8FA 3GDRA 3LXAA 2CLHA 3LCFA 2E6DA 2VFEA 4JGDA 3NPWA 4I7UA 4MIMA 3TC6A 4NXKA 2Y89A 1M5WA 3W1RA 4GUFA 2E1DA 4P2VA 3SGZA 1QFEA 1ZJIA 4CCEA 5LZLA 4O14A 4MKNA 4EF8A 1EWEA 5AHEA 2BZNA 1NFBA 1YDVA 1UASA 5AC7A 5G2IA 3QSRA 4FO4A 1SU5A 4MFDA 1EPXA 3UXDA 3PBUA 1NVMA 1GWJA 2FLIA 4E0CA 1TPEA 1KM5A 2H6RA 7TIMA 3T78A 1H63A 3QRHA 4RR4A 4LTSA 4QNWA 4IGHA 3B4UA 2Y7EA 1P0KA 3DI1A 4K37A 3HPSA 5EMUA 3PBWA 1YPFA 4WXYA 1P1XA 4U4MA 4AHPA 2WPBA 4FX8A 1DORA 4RZ6A 1THFD 5EYWA 3GDMA 1Q3NA 2KZHA 5TIMA 1LLWA 3M41A 4OHQA 5KZDA 4N9DA 3PBVA 1SW0A 2Q8ZA 3GNNA 4M6PA 2Y7DA 3DENA 2A7PA 1TPC1 1ZCOA 3T55A 4AHOA 3BW3A 2NX9A 2WNQA 2RFGA 3UYCA 2RHGA 1R2TA 2J27A 4XWUA 4LV4A 1JR1A 5AC8A 1W5MA 3U8GA 3I7SA 3A23A 1XM3A 5H2ZA 3OVRA 1QO5A 1MSSA 1LOQA 1W5PA 4WZHA 2Q8LA 2Y61A 3RFAA 4K39A 3FJ6A 2DP3A 5F1VA 4RX0A 5I3IA 5E0KA 1LM1A
chains in the Genus database with same CATH superfamily
1HO1A 4GNKB 4H6RA 5CPQA 3TXZA 4BJHA 4O1AA 5CBJA 3DN5A 1GQLA 2O9RA 3N13A 1KR1A 4HD5A 3D6NA 4HU0A 4S3DA 3L9CA 3UZJA 1EWDA 1CW2A 5M03A 3ITCA 4Q8WA 4WKFA 3ATZA 2X2GA 3IJ7A 3VOCA 1OC6A 3H23A 5HQMA 3E0FA 5ABGA 2EPHA 2Y88A 2CXGA 2WVVA 3B04A 3HQOA 4GQQA 2H3DA 1JZ8A 4H8HA 1TCMA 5AC4A 3QPYA 2FDMA 3OGVA 2XINA 1CIUA 2Y7GA 3IGHX 4LVAA 4X3ZA 5BXTA 4D8LA 2ZUNA 3L4WA 1DIKA 3LEPA 4FA3A 2VEFA 1R6WA 1C90A 2GK1A 3P61A 1XG3A 4P8VA 2ZIDA 1EJXC 5HWMA 3ZYZA 4IJBA 1H60A 3LNPA 4DBDA 3GVRA 3HGJA 4NF7A 3I6EA 4GBDA 5BNKA 5KZMA 1XKYA 1HKMA 1QW7A 2INZA 3KL0A 1V4YA 3RMJA 3WH7A 2HTMA 4RNIA 4UTUA 3O9NA 3O6DA 3OQEA 1QPRA 4Z2LA 5DY2A 4XAPA 1E1EA 1KKOA 1PZ1A 1UBPC 3NL2A 4C1LA 2F8QA 4ZMGA 1NAL1 1OB0A 1TVLA 4TTGA 3WQFA 1OX4A 4IIBA 1JXJA 4O4VA 1MW0A 1ADOA 3OLIA 3TJXA 3BOLA 1BHGA 3LK6A 4V2XA 4JEQA 4AUBA 3WD2A 3B9NA 2Z24A 3R4IA 4GZEA 2ALRA 3OBEA 3GNOA 5I3FA 4CNNA 3SRFA 4I5XA 1XIHA 2PDYA 4KIRA 5D2TA 4YTSA 1AZ1A 4A29A 2ZVIA 1TRDA 3EXTA 3EX4A 4HPNA 3NM1A 5I5RA 4F40A 3E38A 4GC4A 4ZE4A 3TK7A 4UR9A 4BWLA 3CHEA 1UQZA 1DXEA 3N14A 5FL1A 4QM1A 2ZRZA 2HNHA 2NXHA 3U2ZA 5CPMA 4IIHA 4TVCA 4XZNX 3FEQA 3EAUA 4FHAA 4JQ3A 2ZA2A 4KRUA 1BRLA 1BF6A 4FF7A 4QBXA 2IUZA 3GAKA 3SCWA 4M6UA 4UNKA 4JQAA 5ABEA 4YVVA 1XLGA 5DBTA 2Q01A 3KX6A 3SDOA 2J78A 5F7UA 1FOBA 1OCBA 2RJHA 1TTJA 4UNIA 3P60A 3B05A 2X09A 4PN2A 3UG5A 1VF8A 4FNSA 3QZAA 3C2OA 4LU0A 2QCGA 2VR4A 4H6QA 4C6DA 1UA3A 2E09A 1FWEC 2VX5A 4Q4OA 4MFEA 5A8GA 1E0XA 1E56A 4CVUA 1CI1A 1UYQA 3UU0A 2ZRXA 3E0LA 1ZAJA 2PDKA 4S3AA 4V28A 2R6OA 4H8UA 2QCEA 1BPLB 1QI2A 3UA3A 4UC5A 5C71A 3LTYA 4UMBA 1Q45A 4XX6A 4EK7A 1P6WA 4XBSA 1A5MC 1BD0A 2CBUA 1IEXA 1UHVA 2DSUA 4DM1A 4Q8QA 2IPFA 4CNPA 4ZQPA 2QMJA 3O05A 2V2DA 4R3UA 1KNWA 2JEQA 3R13A 2OZTA 1XP3A 4HK5A 4PEKA 3T40A 3UWYA 1BSLA 2P50A 4NNAA 4AXNA 3GFXA 3S9ZA 1MXDA 3SN1A 3G1AA 3IACA 1Q13A 4LS0A 5BW6A 2QPXA 2IPJA 4CNSA 3KCOA 1K9EA 3VX0A 1E1FA 4KETA 5CJMA 3E2RA 3O3RA 5BXRA 2QJIA 4HU3A 3I3BA 1VJSA 1RJPA 3BMVA 4ZTXA 4IUOA 5LIKX 2Y62A 1VYRA 1S2AA 1CYGA 1MDLA 1TZ9A 4EOUA 4UQAA 3LCWA 1FWGC 4R5EA 2G3FA 2FPYA 3MO4A 4KH2A 5LHEA 1MRQA 4B3KA 3PTMA 4PTNA 1PX4A 2Z2AA 3MSGA 4IL0A 4GPNA 1K3UA 4R88A 4JIEA 1E5JA 2Z1WA 3LG3A 1Q66A 3DC0A 1Z3NA 3LM3A 1Q6FA 1V0KA 3UXLA 3GBDA 4OE7A 3L2LA 3LLFA 2NWRA 1QW8A 3G18A 3TV8A 4UTLA 5AKQA 3PWAA 2V63A 1QNPA 5ECUA 5A2BA 4OECA 3N25A 3WLSA 3ZT5A 2BVDA 2FGBA 4I9TA 3R0KA 5IHSA 2X0YA 1MRAA 4JD4A 1TMLA 3VIKA 1SR9A 1DWAM 4NYYA 3PZUA 3FY1A 2NQLA 3R89A 3E0WA 4WEVX 1H7NA 1TV5A 2QAFA 1T96A 4FMVA 3UG8A 4K3ZA 1Q8JA 3M0IA 2OMAA 3T09A 1MXSA 5H8MA 1OF6A 1QOPA 5G1MA 1XRSA 2H9AB 1GORA 1G01A 2R82A 1OD8A 3ORWA 1RPKA 4WK9A 4B5NA 1NEYA 1HTIA 5DMLA 3PM6A 3SR7A 1M01A 1NDVA 4ACZB 1XIIA 3R11A 4RV8A 4KQNA 4AF0B 2HISA 4GUIA 3XISA 1UH3A 4CNOA 1OHLA 2BHUA 2CZDA 4XV0A 1L8PA 1ESWA 1HF6A 4V1XA 3FKKA 3BV7A 5A8MA 3FHAA 5BOOA 1I0DA 3M16A 3MYOA 2WHMA 6REQA 3NAVA 2PBGA 4I8YA 5HINA 4LVGA 1A5NC 4KFPA 3GXDA 5CPNA 2D20A 3LPGA 4FIQA 3VGBA 1XDLA 2VFDA 3BQ5A 4DF2A 5HNNA 3SCTA 3ZVHB 3MU7A 4RCXA 4IGSA 3MI6A 4ZO8A 1LWJA 1NWSA 2V8ZA 4GYPA 1SJCA 1AODA 2QPUA 4W9TA 3H2AA 4GKLA 4RW5A 5EY5A 1TUXA 3PSWA 5A6MA 3ZLHA 4JBRA 1T5AA 1H5VA 3GHSA 1MFVA 3TJLA 2NVDA 2OQYA 1K6WA 4XUGA 2CHNA 4R7WA 4JN7A 1UCWA 3W1AA 1TZZA 1Y5WA 1AH0A 4MB4A 4GKTA 2BXVA 5E6ZA 4JS3A 2XHYA 3P8IA 4PMUA 2QXWA 3BLEA 4KCVA 4ZR8A 1JPIA 5EA9A 3GVQA 3UPMA 3WLHA 3VOFA 1QNQA 1M65A 2DGAA 2B4GA 3AALA 2OSWA 1BF2A 2FZBA 4W4QA 1GJWA 3T08A 1IT0A 1DJNA 3WY1A 3TSDA 1E6QM 1GQJA 2ZZ2A 4AIBA 4MUPA 1MVYA 3WLNA 3TYEA 1OGGA 1A5UA 4B2DA 2FJKA 5DELA 3CMFA 3S3GA 2PUZA 2BHYA 4X2RA 3V5FA 2OB3A 3N3TA 3TTQA 1JPMA 3MYPA 1CB2A 1FXPA 4M0XA 4CNUA 4MY1A 2REQB 4E2BA 2WZMA 2XH4A 3PJWA 2DH3A 5CG0A 2BMBA 1H5YA 3I65A 4LRTA 3GK0A 3HA1A 3L66A 2SFPA 1BG4A 3NGFA 3B9DA 5HWJA 4M6QA 1OX6A 4Z17A 1J0HA 2PLMA 3THQA 1ZHAA 3P67A 2VWTA 3IIOA 4V1YA 3C6CA 3URAA 3MTWA 1KXQA 4I7WA 2VQTA 1A3HA 3EDJA 1KBIA 8CGTA 1X38A 3HU7A 3AHXA 4I9JA 4QQ3A 1H51A 2ZVRA 3WNPA 1Z6KA 5FEXA 1RSCA 2PU1A 2FZMA 3EWXA 1QPKA 3AXXA 3NG3A 3CM4A 3ZM8A 3EDFA 4DRSA 4QLLA 4IMFA 2GL5A 1XICA 4O54A 4Y2WA 1WAUA 2ZXQA 1TIMA 4OOZA 4G7EA 4B5UA 4PUEA 1XD0A 4QAWA 4H9YA 4LEFA 2Q8XA 4G5DA 5D8ZA 3W2JA 1U5VA 3A64A 1HN1A 1XRVA 4LX4A 3PFMA 1J0KA 2GDVA 3VUPA 3BSMA 2V5BA 3CH0A 1SUXA 4IPIA 3VE7A 8A3HA 5AHLA 2UY3A 5HAOA 4NJGA 4OQVA 3V16A 2DSZA 3UCCA 5I78A 2CEQA 4IWWA 1KM3A 4GIYA 2A21A 4PUWA 4Z2KA 1K6AA 2Y2WA 3SCRA 1M03A 3GIQA 3AOFA 4LW7A 1LL7A 4XUYA 4H7VA 1XLKA 3BG9A 3SAZA 4OBTA 2HZGA 1TJPA 2PWVA 4RXGA 4LYRA 5C9RA 1XINA 3OO2A 1DPMA 4TV5A 1GT8A 1Q7MA 4L9ZA 1AJZA 1U22A 1O1HA 2PF0A 4GZJA 2HRWA 3H55A 3IUHA 4WY0A 3W2NA 2Z1BA 3IARA 3TH6A 1SGJA 3UJFA 1I2PA 2PDQA 3QOMA 4PL1A 2I14A 4IMCA 3N9SA 5CZTA 3MT1A 4LCRA 2WVVB 3WQVA 3RLVA 1KCLA 1GW1A 3G0UA 1PL9A 2CZVA 3AU6A 1P0NA 4PCTA 1FUYA 4QNEA 4C6PA 1KM0A 3SZ8A 2PDWA 1EJWC 2VC5A 1PIIA 1VFLA 2VD9A 5AFDA 1PWLA 1DJWA 1A50A 5IM51 2FB2A 3TQ0A 1OK6A 2PDBA 1VQTA 1OFEA 3NSMA 2YA1A 1QVBA 4UTFA 4HZ7A 4L5ZA 1V77A 4D72A 1V02A 4GCXA 3B0YA 3LHUA 2CZEA 2ZWZA 3TLLA 4NASA 1AL7A 4QP0A 4PMVA 1EGVA 3AJXA 3OGSA 4LGXA 1E9ZB 1KWKA 3Q65A 3BO9A 2DZSA 2ZICA 3S5OA 3LV6A 4ADUA 1W3TA 2G0WA 1F3TA 4Q8TA 2OQHA 3NUKA 4IMDA 2ZZ6A 3AIWA 1AQHA 1NSJA 2CZFA 2XIQA 1PSCA 1LWHA 4XSMA 1JG9A 4HU4A 3RCYA 3W2LA 3TN4A 3V3WA 3WF2A 3CQ0A 2PF8A 3QHOA 3GTIA 1C29A 2D0HA 4G6CA 3DHUA 4DYJA 4A8IA 4Q8PA 3LRMA 1ZBWA 5CZ0A 1PKYA 4NX5A 3S5SA 3VAVA 5A2CA 3NJ3A 3OIHA 3AMGA 1SO6A 4S1FA 2R1NA 3TN5A 1KQYA 3MP5A 3B8IA 4GX9A 3WDIA 4UWMA 1HZYA 3HG5A 3HIJA 5A69A 3BGJA 1PIGA 4JTFA 1DJIA 1PKMA 4REQA 1D3CA 2CHRA 3GHRA 1EEPA 5D9PA 4C1KA 4B5XA 3FJLA 3AICA 1A5AA 3KL3A 4NP7A 3IJQA 1V7AA 2BX7A 4O0QA 4DB7A 2AQWA 1TB3A 2G3MA 3EB2A 3BLLA 4H4IA 3UR5A 3VPLA 1TV8A 3EXSA 2EKGA 5M5DA 3KVJA 4XAYA 3CZEA 5HQEA 3CQKA 2BVYA 3FKRA 4JTJA 4B5SA 5I3KA 4JKLA 1RZMA 3B9EA 2ZA3A 5HK4A 3RLGA 2CW6A 3V18A 4O52A 4PFMA 3SJNA 3CMJA 1V3KA 3WLLA 3F5JA 5AN7A 4LBUA 2P8BA 2XIJA 5G1YA 3WDPP 3ZLGA 3PUDA 1C8XA 4RZ5A 1KBJA 4GNVA 4D9PA 1FWAC 5GJNA 4HNLA 5I3DA 1YPIA 2FVLA 2XPKA 3PNUA 5AZ0A 1NIUA 2Y5JA 3QH2A 3GFYA 2PLJA 3BQ6A 1UKQA 4QHRA 2D2HA 5MKGA 4Q7NA 5LNUA 1BSIA 3ZR5A 3PBYA 3WBWA 4XAFA 3SY8A 3RO6A 2OPJA 4OGZA 3L7RA 4GQBA 3RLHA 4AVNA 2O92A 3SO7A 2OWWA 3WG6A 2JKAA 3VKBA 1YXCA 5FF2A 2E1WA 5E70A 5GNXA 3UGVA 1BXCA 3TR2A 3TWAA 3I4EA 1OIFA 5GJMA 2X05A 4MZYA 3W6YA 2NUXA 4A22A 3WL1A 1CGYA 4H8VA 2UY2A 4A2SA 3QPZA 1TQJA 2ESCA 1NELA 3S1XA 4TV6A 1LBFA 3RAOA 4AMAA 2W27A 1YYAA 3WDJA 1C9WA 2VEGA 3KTCA 2ZX8A 3UXKA 4WX2A 1GVOA 1QASA 2QJGA 1DWGM 4OU1A 4S2BA 4AXKA 2QV4A 3P3BA 2VURA 3JUGA 4IGMA 2J8FA 5ABFB 1HJXA 1YNQA 4GGBA 4GI4A 3NNTA 1YIXA 5JH2A 5EGRA 4X63A 4HTYA 5CJ5A 1ISVA 4I9AA 3W9ZA 4UFIA 4DYEA 2C13A 3BG5A 2ZTJA 3C2FA 1IR1A 3CUGA 1GHSA 1WDPA 4QJ4B 4YTQA 3LZ3A 7REQB 2QF8A 3O8AA 1SZGA 4AZGA 1AJ0A 4PC8A 4S3EA 4W93A 4XVDA 3ARSA 3W7RA 3IUDA 5LXXA 1LOLA 3M6DA 4DWSD 1FCUA 1REQA 4YS1A 2AGKA 4HK7A 2ZUUA 4NVTA 2X1TA 4IGNA 2VT0A 1OYCA 1MUCA 1R5YA 1TIWA 3C2EA 2FQIA 1WKEA 1BXNA 1V3LA 1XYZA 4GH1A 3TWBA 3HO8A 1L6SA 2PBOA 3GNDA 4Q6JA 2J7FA 1P7TA 3JR2A 2QCCA 3HURA 4LAMA 4NZFA 1A0DA 3MBDA 4JTDA 6REQB 1DEDA 3V35A 2W62A 3WF4A 1OF8A 3F1QA 1B4EA 3CQJA 2GJPA 1JXKA 4M1RA 2V2HA 2J7HA 3NPUA 3AMDA 5HOSA 1LTDA 4FF5A 3N18A 2QW5A 3A4WA 5HPOA 2ZRYA 1E1CB 1DYSA 1TCDA 4QAIA 4YL2A 2HPIA 2E77A 1V6YA 3WH8A 2E28A 1RV8A 2G3IA 3TTOA 7TAAA 2D2GA 1NDYA 2FHFA 4UQDA 3IRSA 3DGRA 1JEZA 2ZX9A 4LF1A 5JBEA 4Q3MA 1B31A 1GKQA 4PA8A 5A6LA 2DIJA 3NSXA 4LNYA 4US5D 1HKWA 1VHCA 3CUJA 4CD7A 5XIAA 4S3CA 3LS9A 1K4GA 3J7HA 1GUVA 3W74A 5GJPA 3LHVA 3WYZA 3AAMA 4IIEA 1G5AA 1GTEA 1KM6A 4L9YA 4NI8A 2Z6IA 3M07A 2PSNA 2PMQA 5A8QA 2A2IA 2X40A 4IX2A 4TX9A 1Y5XA 3NQ6A 1IEQA 4NZJA 2DZWA 2CBVA 2EG6A 2VVNA 1QNOA 1UR2A 1BQCA 1XG4A 5T91A 1ZQ5A 2OGJA 3WIJA 4ZO7A 1MZHA 1EJRC 1E71M 2PAJA 1SW3A 2VVSA 5M3WA 3C3UA 4M29A 1FWCC 4PBFA 4BY3A 3NQ7A 4IOTA 3W22A 4LB4A 4ADTA 5D2WA 1OSEA 3CV6A 4TTUA 4POCA 1UP0A 3HJZA 4MJ4A 4F8XA 1FWWA 4M81A 1W5QA 2OZ3A 4RKAA 2O7QA 1RK6A 3EZ4A 3E0VA 1Q65A 1J6OA 1JVNA 4UMAA 5D09A 3GFZA 1OYAA 1G94A 3HMJG 2DSWA 3W1UA 3JW7A 3H22A 4ZFMA 3EDKA 3RIKA 3PULA 2PDPA 1ICPA 3IANA 5FAGA 2WVTA 1OY0A 1PHWA 3W2MA 1I1WA 1T40A 3WJZA 4DJDA 3NDZA 3WLIA 1M6JA 2YDRA 5C9ZA 1PV8A 3H4GA 4RNJA 2DZPA 3FNDA 3R43A 1BWKA 2W63A 2VFHA 4J7RA 3BJTA 3TR9A 4JTAA 1QDSA 4CQ9A 3C3NA 4CQDA 3G5EA 3BANA 1KRCC 4Q8VA 3MSDA 4PMYA 2I5GA 3GAYA 4X9YA 3GQYA 1DJYA 3AZTA 2PI6A 3M47A 2VZTA 4MOZA 1EF3A 3WF1A 3V75A 1JUKA 1I2OA 2QULA 3VOJA 4CKQA 5C9XA 3SQLA 2WQPA 3A9BA 3VDGA 3OG3A 4U5KA 8RUCA 1UOZA 1V6XA 3E5PA 2G96A 4JR5A 4WD0A 4IMAA 3RDKA 4UQEA 3BV4A 2PC4A 2FH8A 5AOUA 2R1PA 1DV7A 2A3CA 4ADSA 1ZS2A 4GVGA 1JDCA 1JCXA 1W2PA 1PDYA 1Z9AA 4XB3A 4DPQA 3LDVA 1J0JA 4M3PA 3WENA 1EXPA 1TWZA 3RPTA 1KC7A 3GVVA 1YLVA 4AZBA 3SSJA 3CPGA 2QT3A 1B54A 4MDPA 2XFFA 4S2CA 3UP8A 3N29A 2BP1A 1V02E 1J93A 1RD5A 2OT1A 1EF2A 1OYBA 1Q6LA 2BODX 2PCQA 1LBLA 3W7PA 4A8LA 2I1OA 3ZWSA 4F0SA 1YBQA 3URQA 2Z25A 3KE0A 3COTA 4PMDA 4U3AA 3E74A 3G8RA 4B4HA 1Q6QA 4C1NA 4KFOA 3EDDA 4M7SA 3WQ6A 1F9CA 4E2OA 3PZVA 3UWEA 1UC4A 4V33A 2PLCA 4AMCA 1H1YA 4JCMA 3XINA 2VGBA 3NQ2A 2OODA 1RVGA 2QIIA 4QLJA 3S1WA 1YTEA 4DLFA 3A4JA 1VPQA 4JICA 3JZUA 2VFFA 1Y0EA 2XWEA 2J24A 5F2LA 4GG9A 3T8QA 1O6IA 3FDKA 3QR1A 2DV0A 2BOFX 2VRJA 5LNVA 5BYWA 2XM1A 3EMZA 4CEXC 3FHQA 4ZFCA 1KXVA 4TMBA 4X60A 4NKCA 2VGIA 1R3QA 3W6LA 1O95A 4E3VA 1DQXA 2BOEX 5AC5A 2QDGA 3A9IA 3SFWA 2ZKMX 3F4WA 1VBHA 2V6AA 1R87A 2FYMA 1GYMA 1EX1A 1X97A 5CKSA 3M0MA 3C86A 2P1FA 4TO8A 1C8VA 3ZR4A 3KHJA 3CHVA 4YMZA 4ZXOA 4O17A 1XLEA 3PZTA 3BK0A 1M3UA 1WZAA 3CQIA 1JDFA 5EBUA 3RILA 1XLFA 5F4SA 1O4UA 3CGTA 4NJIA 4KESA 5GPRA 3MS8A 3UZXA 2QKFA 3TZFA 1JJKA 1F05A 1X6LA 1NFPA 2E67A 4Q33A 2E9BA 4LQ1A 1R3RA 2A6NA 1X1OA 3VC5A 3B0PA 4JTTA 5FKYA 3MHGA 3SCVA 3N19B 1AQMA 3PAOA 3EGJA 4KWUA 3AISA 3OEXA 1V79A 2PGEA 4H1ZA 3WEOA 4M24A 1VFFA 3NZRA 3SN4A 3TYZA 8XIMA 1XLJA 1IWBA 2WCSA 1P4CA 4CN1A 2VUNA 4DF1A 1W1IE 4Y9MA 2G95A 1TMHA 3P5ZA 4W8BA 2VEKA 5FJPA 1GZJA 7PTDA 2E3ZA 4XBJA 4H41A 3QXBA 4XKMA 1R9ZA 3WEZA 3KRSA 4M82A 3W7HA 2CLIA 5CGMA 1J5TA 4AZ6A 3WK3A 3P7YA 3EXRA 3VOHA 1F6KA 3H4WA 4Z42C 1EO5A 4XQ6A 1E55A 1H3GA 3ABZA 4TIMA 3SFKA 2NWSA 4JTLA 4AEOA 1EJSC 3WDRA 3NOEA 5JBDA 5I02A 1NP2A 1XBXA 1E15A 3IJLA 3WQEA 2Z00A 4LH8A 4EXBA 3U2EA 1TR9A 3C8FA 4P7RA 5B7YA 4AFYA 2O56A 2J25A 3GG7A 2E6DA 4JGDA 3NPWA 2OEJA 2BASA 5EMYA 3OU8A 1EEXA 2Y89A 4GUFA 2RDXA 2QUMA 2TAAA 2B31A 1RBOB 2VUYA 4CCEA 5LZLA 4XAGA 4S38A 3MUAA 4MKNA 2BZNA 2GGHA 1FVPA 1NFBA 1YDVA 1B9ZA 1TWWA 4MFDA 1EPXA 3UXDA 2WSPA 2OZ8A 1TPEA 5FIPA 7TIMA 3NVDA 3QRHA 4RR4A 3KS6A 2NQZA 1O7AA 4MB1A 1B2YA 3PBWA 4NSBA 3MZ2A 4AHPA 1ITQA 5H6HA 1V0LA 1DORA 3PJUA 5EYWA 3GDMA 1OT1A 5TIMA 1UQYA 1F4HA 3SSZA 3PBVA 4AISA 4YYFA 4DAIA 3GNNA 2XSBA 3LPOA 1B1YA 3ZLFA 1ZCOA 4AHOA 2NVCA 1R3WA 2WNQA 3AS3A 2J27A 2NT0A 4LV4A 5AC8A 5H2ZA 3OVRA 1LOQA 3UXIA 3U48A 4QCFA 5REQA 1ONEA 1XLIA 4PMJA 4D6JA 4K39A 2DP3A 2QHAA 7CGTA 5E0KA 1LM1A 1A3WA 2GGIA 3LQGA 4HA4A 2F2KA 3CIXA 1KM4A 3LN3A 4KEVA 2E5DA 2YW4A 2E4TA 2QUTA 4CU8A 4OBRA 5XINA 4MWAD 3GKAA 1RR2A 1QNVA 3VNKA 3WLQA 1LT7A 4FOJA 5BRPA 4A2RA 1EZ2A 2XVNA 5CPOA 2WVUA 3L4VA 2DZXA 1UG6A 3JS3A 3S4TA 2EG8A 4WCJA 6TAAA 3VVGA 3W7IA 2WQDA 1R7AA 2VQUA 3HGRA 1OBAA 3U2CA 3N1AA 4ZL1A 3K4DA 3TONA 4PFHA 1CXLA 1E6ZA 4DLMA 5KITA 4YTRA 4KCUA 2WMGA 3DAQA 4QIUA 1P6CA 3N2CA 2DQWA 3BGGA 4HSOA 3QVQA 3W1TA 4P61A 1ICSA 5M17A 3U9IA 4F2UA 2AMXA 4WKHA 1UH2A 1I60A 1I9CB 2PRHA 1VHNA 1MEIA 3H2EA 1GPFA 1F3WA 3NVTA 1KM1A 2E6FA 2I7GA 3PJXA 4UTWA 1HX0A 1VBJA 2ZBTA 1P7TB 4IP7A 1CB7B 4I7VA 3OZPA 2XFRA 3EX2A 4HMDA 1JPHA 5A6BD 4GYFA 3UESA 3CTTA 4JX5A 1O12A 4IM4A 3PZQA 4RLIA 4DZ5A 4QX4A 1IXNA 5FF3A 1FWJC 1IWAA 3PUEA 2VXNA 1C7SA 4C5ZA 2FFIA 1GVYA 1W0MA 4W5ZA 1NOFA 1DXIA 1LL4A 4ORIA 2XUCA 4AIEA 3HFTA 3U5UA 3N4FA 3EMQA 2TSYA 4PB5A 4PRWA 4F2BA 1XFBA 5FJUA 1EIXA 4XZHA 5CCZA 3LY0A 1LOSA 1UZ1A 1F2JA 4J3WA 2GJLA 3IAQA 4DUVA 1KV8A 2EG7A 7ODCA 2F84A 4AWTA 4QTGA 2XN1A 4Q8NA 4M80A 4FEZA 3PBMA 1DTUA 3K46A 4ZA0A 4Q7BA 2WM1A 3MANA 5HMFA 2YPIA 1UD2A 2IMRA 2NSXA 3DIPA 3CPRA 1OADA 2WBGA 2WSYA 2DUXA 4LB3A 2X7WA 1XGDA 2G50A 1TTPA 5EU9A 3KTSA 2W0UA 3T4WA 2JALA 2PPGA 3B8DA 3MV01 5IBXA 2W61A 1OFPA 2EPMX 3O63A 2OG9A 2QUVA 3R0UA 1K7EA 2CNCA 4NAFA 3M0XA 1GKRA 1L6WA 3GNRA 3B0VC 3AMLA 4HGXA 1XQKA 4N0RA 3BAKA 5BZAA 3QV9A 4CD6A 4K6AA 3MI2A 1WXZA 2JIEA 4LRSA 1KV5A 5IRPA 1VFMA 4IQEA 5EB8A 4FR1A 2AKZA 1B3OA 5KTLA 4NILA 5J8LA 1QK2A 1M1BA 2NX1A 1IEIA 1QU4A 3MC5A 3AZRA 3TX9A 3DBPA 2GZXA 4QDPA 3H2OA 4EAYA 4DWSA 4RZ4A 1QMLA 2WMKA 1GVEA 2VFGA 3FA4A 1TPWA 3NL5A 1MUWA 3WBXA 5F2IA 3MCNA 4DBEA 3KW3A 4UQCA 3K5XA 1OX5A 4F3HA 4JIRA 1EOKA 1PAMA 3EWUA 2VOMA 2J9ZA 3DC8A 4KIEA 4J3SA 3NR0A 4L80A 4NU7A 2QCDB 4RUBA 3IIVA 1JF6A 3SQSA 1KGUA 4GVHA 4NZ5A 4FXFA 4DJFA 2VCBA 4ATWA 2Q3OA 4ENLA 1Q2RA 5K9CA 4WJXA 1GQKA 1J0IA 3URBA 1HFBA 3M0ZA 1U1HA 1ODZA 3HV8A 4I6KA 4LEQA 4QQUA 3W07A 2E9LA 3T0DA 4FX6M 3WJWA 1LZOA 1N8IA 3G1YA 4ZB0A 2HMCA 4PBEA 1KTNA 1F7BA 3WJYA 2PFHA 3P62A 3AMCA 1KCZA 1TFVA 4Z0SA 3PPHA 3W7QA 4C6MA 3L4UA 3GDBA 4UFKA 2AKMA 1BVNP 4XZLX 2BY1A 4IIGA 1B90A 1XCWA 3NEHA 3W84A 3CHFA 2DVXA 1G4PA 2JIWA 4G7FA 3ZT7A 4E5TA 1SSDA 1AUSL 3VIIA 4MY8A 1TPUA 1E3ZA 3GU2A 5KEZA 4D6EA 3S5YA 5K3VA 3ITTA 5C6MA 4JYFA 2V81A 3EPNA 1E9LA 4YXGA 3D3AA 4DUWA 5AHFA 1YBQB 5HULA 4MYXA 2J9XA 2VRKA 3VD4A 3GX9A 4UR8A 2HQAA 2YFOA 3GXIA 4C1NB 3VKDA 3VFLA 3LENA 4S3GA 1BGGA 2Q09A 3L2MA 1EYEA 3R58A 5AHMA 4HB7A 1W9BM 4ZSUA 2QNEA 1HP5A 4QROA 2ZE3A 1TX0A 1VP5A 4EXQA 3FA3A 4K2SA 3WK1A 1PYFA 4XVEA 1VYPX 1WBHA 2QJMA 3PR2A 1KTCA 4WJ8A 4Y9OA 3RO8A 3ITVA 4EVZA 4D71A 3FFSA 3QEZA 4Z1CA 1TSIA 4OKDA 4GHRA 3K8MA 4Q4PA 3GXMA 2WPGA 1EO7A 1A80A 3VI2A 2VX6A 3VYLA 1I2RA 4LUTA 1X1ZA 4ZZ9A 4NAEA 2VZOA 4HSHA 1Q7QA 3EEZA 2C3ZA 2ZZ7A 2Z6JA 4PMZA 1HJWA 3H4XA 5ECVA 5E5CA 2F2HA 3OLDA 4LBSA 3T2PA 5L6UA 5JMUA 4XTIA 2R14A 2DW7A 3B9OA 1BFNA 2D73A 3SCNA 3L68A 1PZ0A 3U57A 5AVNA 1EUAA 1T99A 1VYSX 4M8UA 4BR1A 5AB3A 4IX0A 2VM8A 4JNZA 4ZB2A 2W79A 5LIXX 5DXXA 2V3FA 4KKXA 2V30A 2DQXA 3THDA 2I57A 4HZ6A 3UNTA 2IKGA 2Q6ZA 3VXGA 4AWUA 3BE7A 4WY0F 1FTXA 5JU6A 3CU2A 3E1F1 4LS1A 1N8FA 2XN2A 3QJAA 4MVAA 1I45A 3OBAA 3T9PA 1SSGA 5XIMA 3FYYA 2POTA 1BQGA 3TQKA 2BGNE 3Q94A 1GVRA 5HJYA 3AXIA 1DIDA 2X42A 5E0CA 1M7XA 1Z42A 5IDZA 3WD4A 3MCMA 3MVTA 1ONWA 1S38A 2JGYA 3DG7A 3RM4A 4BWLC 1KQZA 2GJRA 2W91A 4WJEA 2QLYA 3GH4A 4FB7A 1NDZA 3UETA 3O2LA 2XVGA 3VCRA 2KAUC 2H3BA 1LQAA 1NQKA 3TW6A 1T0OA 1FA2A 2WMFA 2WW5A 1DKWA 1UD6A 2VD8A 2CHOA 1YADA 1Z89A 1NF7A 4ZOBA 3OZYA 4S3FA 3Q37A 2RH9A 2C15A 4YWIA 1L6FA 3GYEA 1QHOA 3QV6A 1GOWA 3B97A 1TREA 4GXWA 2QGYA 3C0JA 2ZTKA 1W6TA 2XU2A 3H26A 4WR3A 1O5QA 1YE6A 2PU0A 4AZCA 4KS0A 4JTEA 1TV4A 4JEJA 5A8OA 1J2BA 4AY7A 4DUXA 1FFQA 1W17A 4K8HA 3RHGA 3B8SA 3S46A 1BG9A 3U4AA 4MMWA 3L12A 1AFSA 1WBJA 2Z7KA 4EACA 1SR0A 1TJ1A 3ARWA 3TKFA 4J4KA 2PWUA 1A5BA 1KRAC 4DIAA 1CBGA 1EJVC 2VJXA 2DJLA 3H7RA 4S23A 3REQA 3CL6A 3WUBA 5D8WA 4QXIA 4YTUA 3TVAA 1M53A 3E2SA 2D3NA 3A6OA 3PS7A 2Y7FA 3W6MA 3TZNA 1XGZA 3P81A 1QI5A 4HPXA 1L8NA 2XFWA 2E40A 5I09A 2C1IA 3VX1A 1Q7ZA 1UR0A 5FA5A 1JDAA 5CPLA 1SZFA 4KWOA 2ZCGA 3CZGA 5FEWA 4F4RA 3L23A 3AYRA 2I17A 1CDGA 2QV5A 3UD6A 2D1ZA 4A35A 4O19A 3TP4A 4HOZA 1JCTA 2DIEA 3VIMA 2PGRA 4JTKA 3V0SA 5CSRA 2ABBA 3EOUA 3THUA 4JAWA 3KBVA 5HJXA 4OUIA 3RX3A 3OYZA 1W9UA 1AMKA 2PDUA 4PUUA 3RU8X 1GW9A 1W1TA 5D02A 1I8JA 2HJPA 2Z7GA 2DDXA 1DE5A 4F0MA 3W0KA 2V5LA 1Y7VA 3BJSA 2XGZA 2ALDA 1BTCA 3DFTA 1XLAA 3HM7A 1GQNA 3CEUA 1JUBA 2NXGA 1LQ0A 3SRDA 3QR0A 3VGFA 3LTPA 1S39A 1LYXA 3RPDA 1UR4A 1WDRA 3F4NA 1ZZMA 1TO3A 3ICJA 3W7GA 1W1VA 3W37A 3W73A 4UOZA 1GOQA 1O5RA 3VC6A 1F6PA 2A6LA 4LC8A 3AWNA 4O8RA 3G1VA 3II1A 3GTFA 4M19A 1NDWA 4LF2A 3TFCA 3Q2DA 4NRSA 4P7NA 2UBPC 5A95A 2E25A 4JNMA 3W38A 1NQ6A 1GOXA 4NJHA 3R2GA 4K1GA 3YPIA 4IPLA 3W88A 1I6NA 2H8ZA 3MW7A 1OT2A 1PS9A 3VGDA 2UV8G 4O28A 4XSLA 4PODA 4P7OA 1ELSA 3AIRA 4H6EA 1W32A 4UCGA 4P8WA 4MJMA 4L1XA 1QOQA 1YQ2A 1NTHA 4EF9A 3PB0A 3KRUA 1HT6A 3KVKA 2NQ5A 3WL0A 2ACUA 4XKYA 3BAXA 2C1HA 1RCXB 1LRTA 2C1GA 4JQ2A 3TJIA 2W4XA 3PZGA 2VELA 5CZSA 5AZ1A 3FV9A 3QYSA 5K2ZA 4W7UA 4Y96A 4NIRA 3LHTA 4CVWA 3GR8A 1A47A 4B4FA 4AZ7A 1OC5A 2QJNA 3PF3A 9XIMA 2CLOA 4GYPC 4S3KA 4I6VA 3AXHA 2OZ0A 4XD6A 2IQDA 3R79A 3HPFA 5CLTA 5BMXA 5DX7A 3EWCA 3EKLA 1X1NA 1C92A 3UR7A 2VMFA 3U7VA 2VRQA 3KBMA 2XZ9A 3RF9A 3IRDA 3RM8A 1LP6A 4Y8FA 2Y8VA 3AYTA 1EOMA 3VMPA 5HNTA 1G69A 4XZMX 4ZQNA 4XD4A 1OJXA 4U5IA 1UWIA 1H61A 2VWSA 1QHPA 1MZRA 4Q8MA 4GQGA 5DCDA 5DANA 1HL2A 2DFAA 5HNRA 1F4AA 2XZ7A 2XGBA 1Z32X 3VIOA 4FNUA 1IE7C 3MMUA 3CO8A 2PODA 1SMDA 1HJSA 2XVLA 1I2NA 1BWLA 3SUWA 5I23A 1CECA 4C6LA 5CPSA 3M7SA 1N82A 3S1GA 2PRLA 3C0QA 4QDMA 2DUZA 4J5NA 3CLMA 3SIMA 4Z0JA 1NP0A 1TVPA 4E8CA 2B7OA 2F6UA 2VTFA 1AK5A 3CYVA 4CD5A 3AS2A 1QR7A 4MWAA 5AHIA 1KFJA 2Z2UA 1HJUA 1R3YA 1K03A 3LQLA 4CD4A 3VDCA 2QS8A 4C90A 1GG0A 4AD1A 1XLHA 1NOWA 2C16A 4DVOA 3P84A 4GVIA 4JOMA 3AYVA 4INFA 3WQ8A 5D30A 4LAKA 4DJEA 3OVGA 3BXWA 3LLXA 4D6DA 4IQJA 3UZWA 4DNMA 3P14A 2QCNA 4HCDA 3MWCA 3S6DA 4GJ1A 2V3DA 2FJUB 2V5CA 3N3MA 1ZCCA 4RE0A 3TQVA 3M5YA 3A3WA 1HJVA 4JIQA 3LXCA 2E6AA 2XM2A 3PZNA 3L65A 3WDQA 4J35A 3WEMA 3W29A 2ZRUA 3W76A 3QC0A 3S83A 3GDTA 2VFIA 3VKCA 2G3JA 2WWCA 3AUOA 2MUCA 3NDYA 3FAWA 3LD5A 2QUNA 2PDFA 1HJQA 1XSIA 3E49A 4Q8UA 3G3DA 1E0TA 3W00A 3DFOA 5HQLA 2UWFA 2R1KA 2O4QA 4H2HA 3A5VA 3UWQA 2ZA1A 3T81A 1T8XA 1TPFA 4BF7A 1P6BA 5F4XA 2QVHA 3H12A 2X0HA 1R86A 2QMKA 2RAGA 1BYAA 3QPEA 4JHMA 2ZZ4A 3O0FA 1S2TA 3EKGA 2ADAA 1B30A 1K8XA 3SCUA 2W92A 1ZENA 1HVQA 4ZXLA 1EJUC 2A5HA 3U6WA 4HHMA 5AHNA 4KFNA 1QXLA 3R0DA 3M0LA 4UR7A 1AJ2A 3EWBX 1ICQA 4GMEA 5HDRA 3VM7A 6A3HA 1TE1A 1UUMA 3TYCA 5BWFA 3SBFA 1YMYA 3VIGA 3RJXA 5FSEC 3EB3A 1XH2A 1ITXA 4IFRA 4EANA 5D2VA 3GS6A 2HROA 3DYOA 1MYRA 4ERGA 1E4MM 2P0OA 3GRIA 4XZBA 1QHZA 3CWOX 1ZBCA 3QR3A 5C2XA 3DHFA 3KVLA 3VKJA 3L0KA 1WCGA 2PE4A 1CGVA 2FVKA 5D2XA 4ORMA 1A5LC 4HT3A 5U7SA 2NXIA 3KTXA 4I9MA 2WAGA 3GC2A 1POJA 4AHQA 3LERA 5DF0A 2PDGA 4RL3A 3NFUA 1QCWA 2JFEX 3E9AA 4PUKA 3OOQA 4N02A 2J6VA 4UTHA 4DY1A 4ACYA 4ICCX 1B57A 3GDKA 3VKKA 4U28A 3K2GA 5EMLA 3HGOA 1CLXA 3SI9A 1PXGA 3ES8A 3UR8A 4NZ4A 3AC0A 5I3HA 1Q8AA 2VDHA 3V1PA 1GJPA 3KBSA 4D6GA 3KEHA 3A3HA 4P7QA 4U2ZA 2FKPA 1WE5A 1RBLA 2CLKA 3PUOA 3BMWA 4UZUA 3MUXA 3MDWA 3WLJA 1LRQA 2J74A 2PWFA 3OIXA 1A53A 3TROA 3W70A 4L64A 2FFCA 4GIEA 2O0TA 2NQHA 1UH4A 1UB3A 3F5LA 3E96A 3S5ZA 1SFSA 3NYDA 3OLGA 5GNZA 2XH7A 3OTRA 4Z2GA 6XIAA 4W88A 4CGTA 5CC5A 1QPNA 3M9YA 1ZNNA 3R12A 4W86A 2BB0A 4PTWA 2G4FA 3BOFA 1K9DA 1LUCA 3KZSA 3C0LA 3VABA 3WQPA 4PBGA 1VFTA 1QUMA 2D2JA 2ZE0A 5EMMA 4IQDA 4B3ZA 2PD5A 4KCWA 3AZSA 1WKFA 2P3ZA 2INFA 1XF0A 3ABQA 5HWNA 1Q4NX 4IFKA 4N7QA 3CYJA 1HKKA 2VP8A 1AL8A 1QTWA 4HVXA 3AI0A 4GVFA 1SFTA 3PWGA 2ISWA 2OYKA 4BQ3A 3B06A 3IVSA 3S2CA 1F5ZA 1C3FA 5A8PA 3EWDA 1JZ3A 2GDUA 1R3SA 4DPPA 3N34A 2PWDA 1J0YA 1ZB5A 4JZ5A 2A3EA 3RU6A 5SWUA 1FRBA 3W53A 4GXMA 1WZKA 3WBYA 2GSJA 4PCPA 3VD7A 5D03A 1J0ZA 2R91A 2V3GA 4E4PA 5A2AA 3CIWA 3H24A 3KOZA 5FJRA 1PVNA 1B0IA 3TN3A 3VNIA 3P93A 1DP0A 4ES4A 2VGGA 3M1ZA 1MFUA 4YWSA 3FA5A 1VD6A 4ZO9A 3MKCA 3AHZA 4Z1DA 1X6NA 5A94A 1EKOA 3CV1A 3TYUA 3T8LA 4JYDA 3KUMA 3GXTA 3UVIA 1CXFA 1VBUA 1VFHA 3LSCA 4CNTA 1PJ9A 1TG7A 1FXQA 5LNRA 3UGRA 4CEUC 3W25A 4H9UA 4DYKA 2ZXAA 1F07A 4ZOEA 1GHRA 4PUMA 1XYFA 1WB0A 4FNRA 2ICSA 2VDIA 4H00A 4MNLA 3L4XA 4R9XA 2WO5A 5FD0A 3QQ0A 4H9TA 3P2VA 5D9MA 4FR6A 5D37A 4QJ1A 1RHCA 3LX9A 1ISWA 4AY8A 4JYEA 5I7GA 4HJWA 3L67A 1WOAA 1L6GA 3W7CA 4XK2A 2B81A 1ECQA 5BOEA 5IFTA 4G2DA 3ABXA 2GSEA 1VB9A 3FGCA 2WNZA 1S1PA 1OIMA 3NCOA 2ODOA 2KX9A 2DZAA 5FF7A 1EP1A 2CBJA 3WUFA 2AL1A 1W1PA 4UUIA 2R1MA 2C79A 2GSHA 2PTDA 3FDGA 4WDXA 3HGSA 4N4PA 4GBUA 3R6IA 2VNCA 2ISVA 4KBXA 3S6TA 3SUUA 5I00A 4WRHA 4FXJA 1I2QA 1UJPA 4GINA 1B3VA 4Z2IA 5C55A 5HBFA 5I0DA 1OG0A 3ISIX 2GQ3A 3NQFA 4A8NA 4IUGA 4N42A 3N4AA 3TJ4A 2NV1A 4IPJA 3GXNA 1MWOA 1K9TA 5A6AA 1S2UA 1XBVA 4DEFA 4B92A 3PANA 2GOKA 2W3ZA 3TNOA 2GGJA 3GTXA 2HXUA 3KVMA 3FLUA 3H2CA 5RUBA 4LFYA 3QLLA 3TAOA 2AGTA 1E6XM 4CCZA 1OD0A 1V08A 5CGTA 3W7NA 2E8ZA 4K1WA 2AL2A 2E68A 5LA0A 5LYRA 1XW8A 1SFJA 3BAJA 3CUXA 3LRLA 2GWGA 4H8NA 1JZ6A 4AC7C 3HN3A 1T41A 3M4HA 4FX7A 4DXXA 3NYZA 3GR7A 3R7MA 1JCNA 1QNSA 4JPGA 5A8NA 4FXRA 4O0ZA 2GUYA 4DM2A 5IDIA 3PAJA 2PWEA 2BHZA 1RCQA 3M6YA 1LG1A 1CGXA 1YEYA 4J3XA 5CAHA 1ZBVA 3OHIA 3VNZA 2POZA 4C6NA 3QN3A 1NF0A 3VNJA 3UERA 3AROA 3QMRA 4GO8A 4ZQOA 1VIWA 4MWAE 2X1RA 3TCSA 3AO0A 3TOPA 4H01A 4JY9A 4O18A 2QCMA 4F0LA 1KWGA 1QOXA 3OG2A 2V82A 4C5YA 4N4QA 2HPMA 2GJXA 1VFSA 2BS9A 3NQVA 4MNMA 2PP3A 1MW3A 1HGYA 3NZ1A 4OUEA 2YW3A 1TKKA 5A6JA 2ANUA 1UR3M 1OFDA 1H09A 3I7RA 4W8LA 1OCNA 1US0A 2Y6ZA 4XZWA 4C60A 3NXLA 4EE9A 3TYAA 2HBXA 1VFOA 4PTMA 3WJSA 3LU2A 4HNCA 1H1NA 3LHWA 3CL8A 2W67A 1TJRA 1PKNA 5BROA 4LS2A 2F6XA 2IQ0A 3OYXA 3GC4A 2WZIA 2GFTA 2OKTA 3EA2A 4L9XA 4M7TA 4UBPC 1UIPA 5DLCA 1NWTA 3M44A 2Z29A 5A6SA 2WHJA 2HSAA 2OQLA 3HPZA 3D5HA 3M0HA 4JIPA 1A4MA 3HPAA 1K9FA 3I10A 4DNHA 1K7XA 2VCAA 1HKIA 4QITA 2OJPA 3IS4A 2HK0A 4URIA 3STCA 4IHCA 2OYMA 3PN8A 5FEZA 1WAWA 3DFYA 2CLHA 3S6OA 1HQTA 1XYBA 2WMIB 4E3TA 3WMCA 4I7UA 4MIMA 4A3RA 1W3JA 3POHA 1BWVA 3G77A 1QFEA 4EF8A 1EGMA 3ZJ8A 4Z2HA 1FHDA 3UJRA 3AXMA 4AY1A 1UASA 5AC7A 4GZIA 1OEPA 3KCJA 4FO4A 4D8ZA 1KKRA 3MVIA 4F79A 2FLIA 4E0CA 4DWDA 2H6RA 1A3XA 1RAKA 3BLPX 3B4UA 1JZ2A 1P0KA 3WNOA 1RXOB 3HPSA 5EMUA 2O9TA 1YPFA 3PZMA 1P1XA 3B8VA 4DJDC 3FJ4A 1UWSA 2WPBA 4DBWA 2AQVA 4RZ6A 1YX1A 1XPYA 5CC6A 3BCDA 2KZHA 4R27A 3WUGA 5KZDA 3RYSA 4N9DA 3WLTA 1SW0A 3CAQA 4M6PA 1E4NA 5AYIA 4J3UA 2A7PA 3E6EA 3GUWA 4FLOA 5EMKA 1W1A1 4F9JA 2NX9A 1PWMA 2RFGA 1DJXA 3S9IA 1DIOA 3B4YA 1W5MA 3U8GA 3I7SA 3A23A 1YPXA 3MUZ1 3CUIA 3BSGA 1MSSA 1W5PA 2NQJA 4RZBA 2BVWA 4RDWA 4EPDC 1EGZA 4S39A 4RW3A 1GZ1A 5CG7A 6ENLA 3UY7A 2V0TA 4CLMA 3GB6A 1O5KA 4GGHA 4ZCWA 3ARPA 1JZ7A 4NZ1A 4DUOA 3NSNA 1PKLA 3N04A 2WC3A 2G5WA 3LI1A 3KFTA 1S5VA 4O1EA 3LMZA 2ZRVA 1TWDA 4AEEA 4KW2A 3GD6A 3GR4A 4B90A 1E4IA 1AH4A 3NPXA 3R25A 2PTXA 1P0DA 5D05A 3KCLA 1KBBA 3TMQA 1RY8A 4O1BA 3ARZA 4NXSA 2X2YA 3DDMA 1W8SA 2YDQA 1VBRA 2JKEA 1BYBA 4Y9AA 3ZOAA 1HNYA 3LGEA 4TXEA 3UCQA 7ENLA 3ZIZA 2CFFA 2YCKX 4QGCA 1FP8A 4JQ4A 4UOJA 3UQNA 5T26A 3DFQA 4C65A 3KL5A 4ILSA 3S42A 1AW5A 1ME7A 4YNGA 2O7SA 3SADA 2YLLA 5LIYX 3RCNA 4NUWA 4J40A 3TC7A 3W01A 5DMYA 1KXHA 4L6HA 1JYWA 3MP4A 3MY9A 3V4BA 3TSBA 1Q4WA 1QAPA 4HMCA 3ARTA 3B8WA 1H49A 4IJRA 1VS1A 1ZAIA 5T9CE 3STFA 2WB5A 1NM9A 3NQEA 2EHHA 2WJDA 3NQ8A 3QQ1A 4ZGYA 1LJYA 3M5XA 3N4EA 3ID7A 1TUFA 2E7FA 2WCGA 1ONXA 1LORA 2ZRWA 4PTDA 3GTNA 4AU0A 4BEQA 2DT3A 3CH9A 1D9EA 1P0EA 3WH5A 2DPEA 5DCBA 2YZRA 2Z0IA 2D3LA 5DO8A 5D2YA 1PPIA 2X41A 4PYSA 1AH3A 3QZEA 1Q6OA 1RPXA 2BY0A 4NJJA 3BGAA 4WSKA 1M7OA 2EKCA 2LLEA 4GK8A 2VHLA 4QEEA 5D9NA 1WDQA 3K13A 3DGBA 1HL8A 2E5BA 5D4YA 5F1UA 1X8CA 3ZVIA 2DVUA 3EB4A 4IISA 1EYWA 1VRXA 3EX1A 3KBNA 3A12A 3ARXA 3ZS4A 5DMNA 5C2GA 4YLWA 3DI0A 3ARUA 3DXIA 4NJKA 3OB8A 4JL2A 1JYXA 1UR8A 3UPBA 4H83A 3C2YA 3M64A 5FOOA 2QGHA 3NO5A 5AYZA 3LBCA 5BU6A 3D47A 4LUJA 2GK1B 3N15A 3H53A 4Q4SA 1D7FA 2Y24A 3F7JA 4QEHA 3PTQA 2GWNA 3VZZA 2IKJA 2J13A 3QBUA 2WMJA 5H8PA 3DFPA 2G3NA 3CXOA 3V0UA 4IFKB 2FHBA 2E9MA 2ZZ5A 3TYDA 1DJHA 3DHDA 1UPMB 3CWNA 4B5TA 1F3XA 3NQMA 1BXBA 2UY5A 3VA8A 2IQTA 2OXNA 2J9YA 3GZAA 5DRCA 2PS2A 3O0KA 2V5KA 2GVYA 2TPSA 3ZFHA 3AHVA 5DMMA 2VO5A 2H9AA 2E5CA 2R24A 1OX4B 3NQBA 3H8AA 1YDNA 2GVLA 3FSUA 5D32A 3W7EA 2XDFA 4ACZA 1CTNA 1W9VA 2NLIA 3CNYA 1UMYA 5C8BB 4C7DA 5E9XA 3G8EA 1RQBA 1ZAHA 3GLCA 3VIPA 1KCXA 4AQLA 3VD9A 1C8QA 3M0KA 3SUVA 5JBFA 3IUIA 1TA3A 4ZBCA 2Y5SA 5G4WA 3AIQA 4HYVA 1TPH1 1GOOA 5BOFA 1DHPA 4H9XA 1UROA 2VOTA 3ZMRA 2PA6A 3WMSA 3MHFA 1FWDC 4UFHA 3RGTA 4UTMA 1Z8AA 1S2CA 4S3BA 2FGLA 3TA6A 2XSXA 4WOQA 1P1MA 1SZEA 2YCEA 2JBMA 5CC7A 1FWFC 4MJZA 3ZVHA 3SN0A 3PWIA 3UVAA 1O68A 1BRLB 4JY8A 4LUIA 3O06A 2FPTA 2VKZG 1V6VA 2WLZA 3M5ZA 3CO4A 5I24A 1GG1A 3THCA 1EC8A 3TTYA 3MDUA 4KEMA 3H54A 3C0SA 3DESA 3KDOA 1IV8A 1QWGA 4JX4A 1IEWA 3CEPA 4JTHA 3STEA 2VEPA 3W28A 3WQCA 1DL3A 3PP7A 3M0JA 2PTZA 2OWXA 1VGAA 2OLHA 1E3XA 4LC6A 3BLKA 4UFMA 5JIWA 4ZQCA 1XFCA 3UJ2A 3W7KA 4PB4A 1KR0A 1N2VA 3N17A 1JPDX 4E4FA 3BVJA 2UY4A 5JXQA 4O13A 1N55A 2WWDA 3CTLA 4HIBA 3V0TA 4XBKA 1S5NA 4Q4KA 3IJDA 1WKDA 2F61A 3IVUA 5EKYA 4B16A 1PO9A 1RP9A 2FTPA 1DWHM 2BVTA 3KZPA 3EPOA 3T42A 1AG1O 4JTSA 3OLEA 1XC6A 4UOQA 2GQ8A 1D8WA 1F6YA 2O55A 1ML1A 1E73M 1E72M 1J9YA 5BRBA 2REQA 1XI3A 5E6YA 5ENLA 2HE5A 3ZQ9A 4AVOA 4H9ZA 4HYRA 2CWXA 4LY8A 3QV8A 3WQWA 2OOGA 2BG5A 3IK4A 4GY1A 3G1XA 4EPKA 1XWYA 1MO0A 4HA1A 3L4TA 1XIBA 4QISA 1WZMA 3KLLA 3S47A 2V3EA 1D3HA 4MADA 4ZODA 5H91A 3WBAA 2NUWA 4TMCA 2ZX6A 3NM3A 3PG9A 5H8UA 1JCMP 1VEMA 2HBVA 3V7PA 3JZEA 5I77A 4AB4A 4N6FA 3ZSSA 3NO1A 1CX9A 4UTWC 5D33A 3FW6A 3T7VA 3NOYA 4QDWA 4BF9A 3VDBA 3MSRA 2A3BA 4P8UA 4LCQA 4AZHA 4RJEA 4QR6A 3T44A 2A79A 4GQRA 3GIPA 1B3ZA 1K77A 4ICMA 3GO2A 1R9XA 2ZX7A 1XLLA 3TXVA 2A0NA 3DFSA 2NUYA 5CH9A 4XIAA 2ZADA 1L9WA 2PEVA 4J2MA 4H9MA 1GNXA 3DX5A 2EPNA 3NTYA 1K02A 2PZNA 1IIGA 2CLPA 1QNRA 4Y9PA 1KFLA 2ZX5A 1M7JA 4K8EA 1H1ZA 4ZOAA 3GVWA 1XV8A 4N9EA 3N2BA 1HGWA 2V69A 4F2TA 3LCXA 3GZ3A 1POKA 1EHAA 1X7FA 3ECQA 3LHYA 3WN6A 1FP9A 1SO4A 1GYLA 4EPEC 1JGMA 2FIQA 2YYUA 4X0VA 8XIAA 3W7OA 5PTDA 1CT5A 2VEIA 4OOUA 3SUTA 5GVJA 2FGZA 5CZKA 2X16A 1NY1A 2P88A 3OA5A 1GK8A 3EBVA 1B3XA 2HVMA 3SUSA 2WVSA 2ZZ3A 1R30A 2DUAA 3UXAA 3W1LA 4H9VA 2PD9A 2AAAA 5IBXC 2GVJA 1V51A 4H2CA 5FF0A 4Q22A 3W4RA 1RA0A 2IKHA 1GVSA 1LF1A 2TYSA 2GLKA 2Y1HA 3F2DA 3TAKA 2PDCA 4MSSA 3AS1A 1SFLA 1SPQA 1E4LA 2PB1A 3U7BA 4GYJA 4B9YA 3IGUA 4MZ1A 3C4UA 5HXMA 3L21A 1UOKA 2QJHA 3K30A 4HTBA 2GJNA 3EEGA 4MHBA 3S1VA 3PB2A 1PCKA 3A4XA 4CQAA 3CS2A 3G1DA 3NQAA 2FB3A 3Q67A 5EFDA 3GUGA 2C14A 2PP0A 3HG2A 4O12A 1E9IA 4QFUA 1F8IA 1GVIA 1JI1A 4U33A 5JQ9A 1R3TA 1RD6A 4YIWA 4O16A 4DI9A 3TUUA 1AMYA 4XZIA 3AS0A 4DWSC 2BWGA 4WGHA 3LBMA 2VENA 2JKPA 4U3CA 4FXSA 1WO2A 2D24A 3ZT6A 1CPUA 3CASA 3W81A 4PRTA 2YBVA 3NL6A 2D22A 3TA9A 1JUEA 4XD5A 1IIHA 3M5VA 1FHLA 3A4AA 3LOTA 4WDWA 3WLPA 4FALA 2NQ9A 1BVZA 1GCYA 2MANA 2VR5A 3VIJA 4O8AA 9CGTA 1S2VA 5DBUA 4FAMA 4Y90A 2ZDSA 2QAPA 2Y70A 4DJFC 3FN9A 4IPPA 2EBNA 3RLUA 7XIMA 3UG3A 3K1DA 4KRTA 1EQCA 1YW1A 4KMQA 4RK8A 1UWTA 4HPGA 4F9DA 1QPQA 5TBOA 1ZALA 4PUJA 2HXTA 2CLLA 2XIMA 3UZ5A 2EQDA 4KERA 1FHUA 2YIHA 4XO7A 3OHMB 5HATA 1HP4A 3W23A 2WKJA 3R8GA 1QI3A 1TPVA 2EGZA 4ASTA 3I6TA 4C6IA 3O07A 1R9YA 1AVAA 3WD0A 6XIMA 2F9RA 2XIOA 3CL7A 1BYDA 1VZWA 2J6XA 2C6QA 3KOWA 4IICA 3ZXWA 1Q6GA 3AQUA 1XPGA 4HN8A 3W2UA 1UMLA 1XL9A 2EF9A 4OIFA 1DWJM 3GH7A 3WZ0E 4LYKA 2VC6A 3NEVA 2FPVA 3WNNA 1QW9A 4HQVA 2GQ9A 2QQ6A 3ALFA 4FP1A 4JX6A 1EFZA 4L1GA 1KLYA 4OT7A 1XBZA 2BGQA 1VEPA 3FXYA 4G7EB 2OSYA 4GUHA 1VKFA 3AHTA 1JULA 3I7QA 1J2WA 2Y8UA 3BOXA 3DZ1A 1LBMA 1JDDA 1Q6DA 2EO7A 3ZWTA 3KP0A 1KGWA 1MNZA 2J8TA 1EX5A 4Q32A 1QBBA 4UTTA 4X2PA 1V3HA 4Z1AA 1RA5A 2OX4A 3L2IA 3R1ZA 3S1UA 2QJJA 3T0AA 2CESA 3M46A 1KM2A 4D6HA 3KOFA 4WSJA