4NQ1A

Legionella pneumophila dihydrodipicolinate synthase with first substrate pyruvate bound in the active site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
289
Chain Sequence
b'MFSGSIVALVTPMRNDSVDVHHLRELVEFHIAKGTHALVAAGTTGEAGTLSHSEKLLVIKTVIEQAKERVPVIAGTAMNATKDCIELTQQAMEYGAHAALIMTPAYIKPTQEGLYLHYSHIAQSVAIPIILYNVPGRTACDMLPETVARLAKISNIIGIEATGQMTRLQQILRLCEGSIDVYSGDDLTAAQWLLSGAKGVISVTANVAAKLMAKMCDLAMDDDQAGCLRIQEQLMPLHELLFVESNPIPVKWAMKKMGLIGGELRLPMTELSEKHHQALEKVLKNLELI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
molecule tags Lyase
source organism Legionella pneumophila
publication title Legionella pneumophila DHDPS: The First Case of Non-Lysine Inhibition in a Gram-Negative Pathogen
rcsb
total genus 104
structure length 289
sequence length 290
chains with identical sequence B
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2013-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nq1A00
3O6DA 3ZS4A 2OMAA 4RKAA 1KFEA 3MHGA 4S1FA 3TR2A 1R2TA 3KXQA 1IGSA 4FNRA 4A2SA 4NJIA 4YLWA 3MBFA 4UTTC 2J27A 4MUZA 2CLMA 4R53A 1JRBA 2P10A 2VFFA 3HBLA 1FWNA 1PIIA 1FDYA 5I3IA 1KTCA 3SR7A 3ZWSA 5D37A 3U8GA 4NX0A 3TSMA 2ISWA 1I45A 2CU0A 2CLOA 3S6DA 4POCA 1OFRA 4NU7A 5CPLA 3STFA 1H7OA 1ZAIA 5AC6A 2ZTKA 3UWVA 2DU2A 2WSQA 3W2KA 3S5NA 1A50A 3EWWA 1UUOA 2Q8ZA 3P5ZA 4FNSA 3QQ1A 1K8ZA 5F1VA 4UC5A 1GVOA 2GVLA 3S1VA 1H7WA 5D2TA 4RV8A 3N34A 3PBYA 4KWWA 4DF0A 4ICNA 1ME8A 2ZA1A 4S2CA 4O0KA 3HMJG 2ZRVA 4AF0B 3S5YA 5AHIA 2Y85A 3W7IA 3VCRA 2PURA 3KRZA 1LBLA 3HQ1A 2H8ZA 3W73A 1GG0A 3HOJA 3L66A 2FTPA 5F2LA 1BTMA 1OX4A 3QMSA 2F7FA 1RQEA 4P61A 5EYWA 3PF3A 3N9RA 4JICA 4KFPA 4NT0A 3G3MA 3W7GA 4JYFA 4LRTA 4ADTA 3W1MA 4WOQA 3I6RA 1FDJA 3B0PA 3CC1A 2EF9A 4LY8A 1EIXA 1T99A 4NJHA 4UNLA 4UFIA 1N55A 3INPA 1YDNA 3W22A 1JCXA 3GZ3A 5I3JA 1KM2A 4FF7A 2C14A 1IF2A 5LHFA 4HN4A 3EX1A 2QCFA 1YXYA 2G5WA 3W7NA 3F1QA 3O6CA 3PBWA 3EKLA 3NEVA 1GVQA 5TIMA 5LNVA 3LI1A 4N2YA 4OHQA 2YR1A 4PL1A 2VFHA 1W5NA 1KM3A 3Q37A 4IX2A 3PS7A 3WJWA 2NWSA 4E2DA 3GKFA 1K7EA 4JXCA 3IGXA 4H3DA 4IOTA 1OFDA 3NL5A 4ADSA 4M19A 1ADOA 3GR7A 2BLEA 2X16A 3G1SA 2J9ZA 2WOQA 5EPDA 1JJKA 5D09A 1H7PA 3CIWA 5LNSA 5G2HA 1LLZA 3QFEA 4H4IA 3B8DA 1U5JA 1S3HA 3BV4A 2ISSA 3KVMA 1NSJA 2QF7A 3S0CA 1G67A 4ZQRA 4Z1DA 4FXRA 2QCDB 4GWEA 4LS0A 1HG3A 1JUKA 1RQHA 5K3VA 4O1BA 3LXCA 4K39A 4O57A 3P62A 2NX1A 3IVUA 5TQLA 1A5CA 1L6WA 4N9CA 3TQVA 3FJLA 3W7DA 1XM3A 1NVMA 2PE4A 4XQ6A 2FQIA 4N02A 4FB7A 3UPBA 3OVRA 3B4UA 3C52A 4Z0JA 1XL9A 5E93A 4DO5A 3GR8A 1EP3A 3MI2A 2C13A 3R8RA 2CLHA 4LS2A 5EKYA 1H1ZA 4EIVA 1PE1A 1LORA 2NUYA 2V0TA 2QUVA 4GFSA 4ZZ9A 1HUVA 5D2VA 4JTHA 3M5YA 4LW7A 5DELA 3NA8A 5KZDA 3FYPA 5EL1A 3STEA 3NPUA 3QYQA 1C29A 2O7SA 1W5QA 5G4EA 2B7QA 3LCIA 3LV6A 3PC0A 3EXRA 2E5BA 3QC3A 4DF2A 5L9FA 2DZPA 1HL2A 3CTLA 3B03A 4Y90A 1GVRA 1GQNA 3GLCA 4O19A 2A6NA 4M5PA 1L6YA 4AVFA 4MY8A 5U4NA 5J5DA 3BLEA 3DGRA 2VEKA 1KM5A 2E5DA 5KITA 2RDWA 4GBUA 3S5ZA 5C2XA 4AWSA 1JCMP 4WZHA 3NQDA 4N4QA 5G1TA 1XDLA 3NPWA 4LRSA 5GVJA 1QAPA 3LM7A 2ZDRA 2UV8G 3TFCA 2Y7DA 4RX0A 1VYSX 1HFBA 1KM4A 3W7EA 5I3FA 3U6WA 1GEQA 5I3KA 4AMAA 3STGA 2ZZ2A 4A21A 3MUXA 3GDKA 1GVFA 3ATYA 3O1NA 2QDGA 3F4WA 2YFOA 4TX9A 4Z1CA 3W1QA 2OT0A 4GUGA 2EHHA 3L21A 2NWRA 1QPRA 1K8YA 1SU5A 3T44A 1TTQA 4O4VA 4NNBA 5HQEA 1CX9A 1RPXA 5KINA 3MI3A 3EWZA 3S5OA 5AC7A 3OHIA 4RK8A 1WOBA 4UTMA 4GUIA 1GTHA 1W3NA 4GC4A 1ZFJA 1VRDA 4S2BA 3NL2A 4YWIA 4Z1BA 3OVPA 4U4MA 5G1YA 4PL2A 3QJAA 1HO4A 5BMXA 1KV5A 4WXZA 3TKFA 3W7JA 4BF9A 4CCCA 3DI0A 2Y7FA 3HG5A 1W3IA 1FCVA 1YPIA 1VCVA 3P8IA 4QJ1A 1V5XA 3EX2A 1SW7A 3BVJA 1TPWA 3VFLA 4UFLA 2QUUA 4O28A 1FWTA 5FEZA 3TUUA 1FCUA 5D32A 1KFKA 3E9AA 4M6QA 2A4AA 3GAYA 3GXTA 5F2IA 5D30A 1FWRA 1DVJA 5G2IA 4UTWA 4ALDA 2J9YA 3QW4B 1VGAA 4JEQA 3DH7A 3UY8A 1AL8A 3MJYA 2PRHA 2TPSA 2LLEA 5AC8A 4GNJA 1YTKA 1SZGA 2JKEA 4OGZA 4AHQA 3OVQA 1O5KA 1JULA 2ZZ7A 3U2OA 1F76A 2H3BA 3LHUA 2A5HA 3I7RA 4Y8FA 2RDTA 2QAFA 5D2YA 4XZ9A 1H7NA 3M1ZA 4I7WA 3R89A 3O6YX 3LCXA 1NFBA 3USBA 4QISA 1K7FA 3C0JA 1VHCA 2B0MA 1U83A 4Z1AA 3PUDA 1EP1A 1ML1A 3QF0A 3GXPA 2B7NA 2QJIA 3P84A 3B04A 3HPZA 3PSVA 3PB2A 2Y7GA 4GUJA 3T78A 3UY7A 2HSAA 2V5LA 2NUXA 1TPB1 2QCNA 3BW4A 2TMDA 2PC4A 3W1RA 1OABA 3W7RA 4WOZA 2WQPA 3MP4A 1KBIA 2H90A 2EKCA 3G8RA 1UBSA 4UIOA 1NEYA 2V5BA 5D04C 5L6UA 4ML9A 4N9BA 3TNOA 4Q32A 1ZAJA 2ZZ5A 3BG9A 2P0OA 3DFNA 1XDMA 5F4SA 3M47A 4O10A 1THFD 3C2VA 4O14A 3TU9A 3BGJA 2E6FA 1XCFA 2TSYA 2CWNA 4K8EA 4EF9A 4K36A 4TIMA 1M6JA 3KOFA 3GIYA 2FB3A 1KBJA 4ZQCA 1S5VA 4A29A 1Z42A 3PBVA 3IIPA 3C56A 3HB9A 4LS1A 4UFJA 2FFCA 3BLFA 4EWND 4JX4A 3MHUA 3UZJA 1P0NA 1F73A 4XWUA 2DORA 5K9CA 3N9SA 3OIXA 1X1OA 1IXOA 4ZL1A 4PA8A 1H7XA 3ABQA 3STCA 1Z48A 1TJRA 4IMEA 1QPQA 1TPDA 5BW6A 1CI1A 3NM3A 5HJLA 1W56A 3I7QA 3NOEA 4H6KA 1ZAHA 2GQ9A 2QAPA 3NVTA 3R12A 3TC7A 4XTDA 3TX9A 2YW4A 4RXGA 5K2ZA 1O94A 1WDWA 3QMRA 3W1UA 2CZFA 3C2EA 3MWAA 1FX6A 5CZ0A 1XUZA 2WO5A 1I4NA 1K3UA 3VE7A 4XTIA 3TFXA 4LVDA 5KTLA 3CPRA 5KMYA 2CZDA 3MYPA 1FCBA 1UUMA 2E6DA 3WK0A 3LXBA 3BPWA 4JYEA 2NUWA 2WV8A 3B06A 4QM1A 5AOUA 1YTDA 2VC6A 1TV5A 3CQ0A 4O0ZA 5MHBA 4TMCA 3VKJA 2TRSA 4UTTA 4HNVA 3LGEA 4WQ6A 2FJKA 4JTTA 4C1LA 3FEMA 3L5AA 2FPTA 4IJBA 1OFAA 5AYYA 3MO7A 5G2WA 3TAKA 3ANYA 4JY8A 2OJPA 3W7PA 1RZMA 4N6FA 5ABTA 3A21A 4W9TA 3L0GA 2QCLA 5KZEA 6ALDA 3N2MA 1JQXA 2J24A 2CFFA 2Y63A 1XKYA 3GB6A 1TPH1 3NO5A 2V2DA 3PY2A 2W79A 3NPVA 3W1AA 4N9DA 4MPQA 3E96A 3HG3A 3NPXA 4BI7A 3PG9A 3QM3A 5CZJA 1LOQA 1EX5A 3GYEA 3LBMA 2C1HA 1TREA 1OYAA 4JTEA 1GJPA 3IV3A 3TJLA 5D38A 4QQ3A 1TIMA 4ORIA 3WK2A 4JIQA 1QFEA 2Y89A 2ZZ3A 4MYAA 3UQNA 3TV8A 3W3OA 1MEIA 1VHNA 4JS3A 5HWNA 4MIMA 1LTDA 2ZA2A 5F2MA 2E09A 1VJIA 1C9DA 2VFDA 2G96A 1TPEA 1DJQA 3NQ2A 2ALDA 3UZ5A 4R33A 1L9WA 3N14A 1I2OA 1EA0A 5FEPA 1ICSA 1LROA 1LCOA 1JCJA 1LOLA 4G1KA 3L67A 2VEMA 3P61A 3IRDA 1FQ0A 1F6KA 3W83A 2A85A 4NXSA 1IXQA 4YCOA 3NQGA 3QPYA 3LCHA 1PL9A 3UWYA 3LCGA 4IMGA 4BR1A 3W23A 1K03A 2V8ZA 1RD5A 3LHTA 4O50A 1OF6A 4MJMA 4JTIA 4RCXA 3FFSA 2DZTA 3A24A 3GVGA 2C18A 3O06A 4DPPA 4AH7A 3W7KA 3TMQA 4JYDA 5CKSA 2FB2A 4QITA 4JD4A 4O16A 3LV5A 4HT3A 4A2RA 3MW7A 3I65A 1XBXA 5LHEA 1F6PA 1DORA 3AO0A 2NV1A 1JUEA 4NVTA 5D03A 3T55A 1TQJA 1LP6A 3W76A 4FX7A 4U28A 1TTJA 1P0KA 3BK0A 3PVFA 5D02A 4M7TA 4LC8A 2R8WA 4UCGA 1RQBA 2X1UA 4R7JA 3CT7A 2YX0A 2D73A 2YYUA 3KVLA 1SZEA 5E0KA 2C19A 3HGRA 2YCEA 1WV2A 3GK0A 4LOCA 3G1VA 3LHZA 3TDFA 3LHYA 2XFWA 1I8JA 5DBUA 4OV9A 5FF4A 3W1NA 1W5PA 2ZRZA 3KVJA 4O54A 4TMBA 3BLIA 3TW7A 5DY2A 3PB0A 2J9XA 5HUOA 1WX0A 3HG4A 3M5ZA 4BFAA 3BARA 4NNCA 3TAOA 2QCEA 5KSWA 1SO6A 1VLIA 1G7UA 1O60A 4MYXA 1ICPA 2TYSA 1KLYA 1M5WA 4UFMA 1W5OA 1WA3A 1HO1A 1FY6A 3CM4A 1FXPA 2C0AA 1IXPA 1GVSA 3N3MA 3IVTA 3KAOA 4XBSA 4OBTA 1I2NA 3W1LA 1RV8A 1FWSA 1Q6RA 4QNWA 2YYTA 5D05A 1QO2A 3W86A 2GJNA 4D2JA 3L5MA 3BGGA 3RU6A 1TRIA 4XKYB 2ATMA 2CW6A 4RJEA 3LBCA 1H7RA 5F4WA 3UXDA 5EMUA 1AW2A 1TO3A 1KFCA 5CZSA 1VC4A 4N6EA 3NNTA 3DFSA 1OF8A 3O16A 3E02A 2RHGA 4GJ1A 4UUIA 2W0UA 3NDOA 4IMFA 4P2VA 3PM6A 4LT9A 1MEHA 3EWYA 1OK6A 3JS3A 4WY0F 1W54A 3UWQA 3KX6A 2P1FA 4DO4A 3PAJA 4K7YA 4QSHA 1N7KA 1RR2A 4NJGA 3UPWA 1JCNA 1KLZA 4YMZA 3C3NA 2OX1A 3LXAA 4MZYA 2H8XA 4AXKA 2V9DA 3HGJA 4FHAA 2QR6A 3CWOX 3P67A 3PSWA 1W37A 3QRHA 1QPNA 5LZLA 2XN1A 4FNTA 1SZFA 1OFEA 2Q3OA 2X1TA 5DLCA 2Y61A 2WJZA 1FUYA 4OWGA 3B05A 2NX3A 3W88A 1QR7A 2XN2A 3TMLA 2RFGA 1B4KA 1SW3A 2B7PA 3H53A 4O1DA 1YLVA 1ALDA 1R30A 5C55A 3N2XA 5HMSA 4O1AA 3HPSA 2HTMA 3O15A 3W2LA 3WJXA 1PHQA 3LI0A 1B57A 2V30A 2YFNA 4RXFA 3G22A 4FNQA 4QAIA 1R46A 3NQ8A 1DL3A 2E68A 3W2NA 3ABRA 1KW1A 3C61A 1TV7A 3L2IA 3LB0A 3N19B 3SZ8A 5FI8A 4PODA 5DXXA 2E6YA 3W84A 4OU1A 4CNOA 5DCBA 1F2JA 3PUOA 2X2GA 1SPQA 2YSWA 2GQ8A 3A5FA 5CG7A 5FEXA 1G4PA 3KRUA 2CLLA 1QMLA 2WSRA 2YDAA 3Q2DA 1XI3A 5FF2A 1YPFA 4KWVA 5LNWA 1YYAA 1OX4B 3CHVA 2BWGA 1CW2A 3ELFA 1EWEA 5D2XA 2ATSA 1SSGA 1DBTA 4DF1A 1SFLA 4WY0A 1Z41A 2E77A 1LOSA 1TQXA 2JKPA 1JQVA 3W7MA 2RH9A 1H5YA 5U7SA 3W75A 3MI6A 4MZ8A 4N9EA 3GX9A 3HGSA 1TPVA 5C54A 3G18A 1TTIA 2NXGA 5G4WA 2BZNA 1O95A 4LUIA 3W7HA 2FDSA 5A5WA 3K30A 3DAQA 2ZZ4A 2ISVA 1EB3A 4CQ8A 1XFBA 2B4GA 2Y70A 5D33A 4JTUA 3W85A 5AHNA 5K9DA 4BWLA 3P74A 3H55A 1YXDA 3D0CA 3TQKA 3O05A 2ZRWA 4HSOA 5CPOA 4DXVA 2CLEA 1JCLA 3M9YA 1VPXA 4O8RA 2VEIA 3LRLA 4IXHA 1VLWA 3LLDA 1H51A 3NQ7A 4K38A 3W2JA 3HG2A 3WFAA 4L4LA 3DFOA 5DBTA 3NR0A 4X22A 3NAVA 3P81A 1DV7A 4UMBA 3N73A 1ZHAA 3CIXA 3W7CA 1QOQA 5IBXC 1P1XA 1W8SA 1BEUA 1TYGA 4UTLA 1Q3NA 2V2HA 1VYPX 3ZFHA 2VOMA 3UWWA 2C6QA 1X6UA 3NL3A 4JX6A 4RR4A 3E12A 3EWXA 1AK5A 5FF0A 1H62A 2VELA 3CU2A 1UASA 1MEWA 2A2IA 3LCFA 4HSNA 5FF3A 2H3DA 4GE8A 1W5MA 2BXVA 1Q6LA 2XN0A 4MFDA 1T96A 1GZGA 2ZTJA 4M6PA 4X9SA 1Q45A 2VENA 3RMJA 1ZY9A 2JGYA 2RDUA 4JIPA 4CQAA 1JR1A 2GOUA 3NXFA 3RF9A 1D3GA 4B5NA 2I9EA 3HIJA 5K7JA 2AAMA 4IQLA 3HPXA 1I2QA 4QIUA 1QPOA 4X2RA 1YXCA 3HJZA 1YDOA 5BMWA 5I3HA 1SW0A 4MVAA 4UTUA 3SGUA 1JCYA 2BX7A 1ME9A 3O63A 1QWGA 3TXVA 3QPZA 5LNRA 5FEWA 4JDYA 1YADA 3CEPA 3QSTA 5C5YA 2WNZA 1M7PA 2VKZG 4LVFA 1LRQA 4WUIA 3WJZA 3PBUA 3F4NA 3DKLA 3FS2A 4JTLA 1TPC1 3P82A 1XBVA 4JN6A 3FA5A 1QCWA 3L9CA 3WK3A 5G5IA 3ZWTA 3HGOA 1XXXA 3G3DA 4PH6A 3SI9A 3W72A 3DU0A 1VCGA 2YGYA 2ZRXA 1S5WA 2Y62A 1B4EA 1W1ZA 4NZJA 3NQ6A 3FOKA 3DFTA 3M0ZA 3HO8A 3SJ3A 5AFDA 1Q6QA 3IIXA 3GKAA 1K02A 4UTKA 4O18A 4AAJA 2QUTA 5LKYA 2Z0IA 4EVZA 1MO0A 5E1QA 5DCDA 1PS9A 4X3ZA 2A7PA 3Q94A 3T40A 1OYBA 4WX2A 3M7WA 4Y6GA 4TO8A 3W6YA 1VYRA 3TROA 4Q4KA 3EB2A 3EXSA 4GUHA 2GVJA 1UCWA 4NX5A 4DPQA 1WOAA 3NQMA 1LZOA 3RNDA 2HS6A 4KFOA 1H50A 2ZA3A 2Y7EA 3FIGA 1TJPA 1R2RA 4PCFA 1DHPA 4IWWA 4JTFA 4WY0B 3UWUA 1A53A 3C6CA 3GDLA 3I68A 3ZR4A 3GNDA 4DELA 5H91A 1KFLA 4BI6A 3F03K 4FNUA 2YZRA 1XC4A 3G1FA 1SR9A 1Z44A 4MFEA 1ZCOA 1OHLA 3G1DA 2YPIA 2PCQA 3C2FA 3W1TA 4IUOA 3L0NA 3MBDA 4FX8A 5TBOA 3W74A 4WJEA 2KZHA 1QO5A 3MYOA 1VS1A 3DKJA 3DZ1A 4JTKA 5IBXA 5EBUA 1AL7A 3IVSA 4R34A 4UMCA 1VZWA 4LWWA 2V81A 4Y96A 3G0XA 3KVKA 1K8XA 3SECA 4I7UA 1TV8A 4LC6A 2J6XA 1AW5A 2FPVA 3W2UA 1A5SA 2I1OA 3JR2A 1EUAA 3OG3A 5K4XA 3G1AA 3G0SA 3GDMA 5DN1A 5F2GA 4XUGA 1PCKA 3NGJA 1C8VA 3A5VA 1KV8A 4GRSA 2BTMA 5CGQA 1JVNA 1I2RA 3C2RA 2QKFA 4ZQMA 4O1CA 2EGZA 4MLJA 2ZRYA 2OCZA 3QEZA 2QCDA 2ZFAA 2DZXA 2VEPA 4EOUA 2VFIA 3LCLA 4LV9A 4LU0A 4DQWA 5DCEA 3TXZA 1J4EA 2R14A 3M5VA 5CPNA 3P7YA 4A3UA 3LRKA 2CZ5A 5LNUA 3M41A 2YXGA 1FWWA 3I7SA 4Z0SA 3UWZA 3GDRA 3CEUA 3PR2A 3NQVA 2X1RA 3S42A 4HNUA 1PV8A 5HWMA 4NNAA 4EF8A 3FLUA 3DHFA 1OFPA 1NF7A 2B7OA 4NXKA 1GPWA 4UTWC 1SQ7A 1QNVA 5FESA 4JTSA 4PEKA 1TRDA 3V75A 4UNKA 3TA6A 3T4CA 3JRKA 1SO3A 1XBZA 3GDTA 3IIZA 3V1PA 5SWUA 4IMCA 1J5TA 3S9YA 4C1KA 1GYNA 5FF7A 2JGQA 1TPUA 2V82A 2I14A 3EXTA 7TIMA 1FDZA 4IX0A 2DP3A 1L2UA 5EA9A 3OBKA 5I3GA 1WAUA 4PTNA 3LLFA 4LVBA 4K6AA 2Y88A 1SFJA 3TSDA 1ZENA 4ZQPA 1O5XA 2X1SA 5F4XA 3G0UA 3IIVA 2IQTA 1ME7A 4IPIA 3W07A 4MY1A 3BG5A 3DHDA 2NLIA 3LX9A 4JTJA 4BWLC 5KZMA 3CWNA 1EPXA 3P8JA 5HINA 2NX9A 4JNMA 3C2OA 3RK8A 5LSMA 1IIHA 3OEXA 3C4UA 2G95A 3ABOA 4NQ1A 3PUEA 2G97A 3G1XA 1FXQA 1G4SA 4LVAA 4FO4A 1T8XA 1OVDA 1H61A 2QCCA 5HUPA 4QNEA 1TSIA 2WNNA 1GWJA 4HPXA 2WPBA 2ZRUA 3WJYA 4ZVJA 4DBDA 1JRCA 4AHOA 2DJXA 1KFJA 4XKYA 1G4EA 3E0IA 4UFKA 1NF0A 2Y6ZA 1B9BA 2Z1BA 2DZWA 3GXNA 3LRMA 1DJNA 2ZYFA 4CNNA 1QDSA 1WBHA 1S5TA 5HNRA 3P60A 3RLVA 1VQTA 1IIGA 2E1DA 3O07A 3THAA 3FKKA 1KFBA 1X1ZA 1G4TA 1FCQA 2AGKA 1AMKA 2VFEA 4IGHA 4MY9A 4FXSA 2A1YA 3DBPA 3TJXA 4UMAA 4M6VA 2H6RA 4MLRA 1VH7A 5A8GA 1LBFA 3LTPA 4CQ9A 3LERA 4HIBA 4LTSA 3MMTA 3G24A 3SSJA 1YTEA 2GJLA 1GG1A 4RLIA 1E51A 1OX5A 1LLWA 3QH2A 4I7VA 3LTYA 3A9IA 3QMTA 1A5BA 1EUNA 4PFMA 4RZ5A 2F84A 3G1YA 2YW3A 4O53A 4BI5A 4LV4A 3P80A 2Q8LA 5C6MA 1R2SA 1LDCA 1YDVA 1K7XA 1F05A 3QW3A 3SGZA 5AYZA 4MKNA 1WBJA 4HKPA 3C8FA 3S8HA 1D9EA 4I9AA 4TR9A 5K9XA 2GVGA 4AHPA 4CCEA 3NQCA 4Q33A 4UTIA 1FBAA 4GXMA 3BO9A 8TIMA 1G7VA 3YPIA 3IIOA 3PG8A 4K7VA 4TU1A 2JK2A 1SO5A 2GUUA 4AB4A 3NZRA 1PHWA 4JGDA 1M7OA 3G1HA 3TQ0A 1R47A 3M16A 1KM6A 3BW3A 4NZFA 3W2MA 1OG0A 3L65A 4MOZA 3A22A 3DENA 5AB3A 5HR6A 4NJKA 4UFHA 1EWDA 4FIQA 1XBYA 3CB8A 2ZZ1A 3TH6A 1T0OA 3KRSA 2PRMA 3IEBA 5H2ZA 4UTHA 4DO6A 1I2PA 3SFKA 3NM1A 3VI2A 3VE9A 5LGZA 2VFGA 3TSBA 4J9JA 1V7YA 4ZQNA 4NUWA 3UNDA 4O11A 3NYZA 3S1UA 2A0NA 1KM1A 1X8FA 1DKWA 4KKXA 1W0MA 4O52A 4BK9A 2JKAA 2X30A 4WD0A 3OA3A 3TIMA 5CPMA 2C3ZA 2DJLA 4ZMGA 3QZEA 2C16A 5LGXA 1BWKA 4DEFA 1ZALA 3FJ6A 4JX5A 4NJJA 2Z2UA 4OV4A 2ZBTA 3W71A 3BW2A 1NAL1 3MP5A 3FKRA 2A21A 3B0VC 3PULA 3TE9A 2BSLA 3KFTA 2HMCA 3QSRA 2QEZA 4CCDA 2DZVA 3M43A 5BNKA 3W87A 1W3TA 4GUFA 4YCPA 1LM1A 3LCWA 3SY5A 1KTNA 2DZUA 3NL6A 2GQAA 4AEOA 4RZ4A 1GYLA 3W9ZA 4HPJA 1OK4A 3O8AA 2RKXA 3Q58A 1GOXA 3E49A 4PC8A 3DI1A 5BOOA 2EPHA 1VR6A 3TCEA 1MSSA 3H54A 3M44A 1ZJIA 1P5BA 4ZQOA 2FLIA 3NQEA 4UR8A 5DY3A 4XBKA 4ONVA 1OFOA 2FIQA 3W7LA 1TPFA 2DZSA 1H1YA 4N4PA 4CLMA 3THQA 3NQAA 4K37A 2JBMA 3RLUA 3IGUA 4FX6M 1X7FA 2ZQ0A 1Q6OA 3RFAA 2OZ0A 4JR5A 1GTEA 2NV2A 1WXJA 2CLIA 3EKZA 4IXXA 1QOPA 2WKJA 1OFQA 1AG1O 4HNNA 1TTPA 4AF0A 4YXGA 3LDVA 3EWBX 4E38A 1ZNNA 1SO4A 4O17A 1H63A 1MXSA 4YL2A 1PCWA 1W31A 3B0UX 3LHVA 3TC6A 5HR7A 1XUUA 1OX6A 3PWAA 3QQ0A 3LOTA 2Z6IA 2C15A 2E5CA 4K8HA 1EEPA 4JDBA 3G8EA 2A7RA 4M7SA 1KA9F 1MZHA 4HHPA 2J88A 2R91A 2Q3RA 3L5LA 3W1PA 3R13A 3CLMA 5DXYA 1KM0A 1LRNA 1DQWA 3LTSA 4FIRA 2O7QA 1B3OA 3EX3A 2ABAA 2ZCGA 3MHFA 4O4WA 3WJSA 5CSRA 1BWLA 2CLKA 3R2GA 2AQWA 1J2WA 2W6RA 1D3HA 3NG3A 4IPJA 5BRBA 3M5XA 3SIZA 3A23A 5AN7A 5AHMA 1A5AA 1WYIA 4MJZA 3KHJA 1LYXA 2HS8A 3TK7A 1N8FA 5K4ZA 2Z6JA 1F7BA 2A7NA 3NQFA 1JUBA 2R94A 4CNPA 4IMDA 3MP3A 2FPYA 5J5RA 3L0KA 3EX6A 1VCFA 1LRTA 1TB3A 2QJHA 2QJGA 1Y0EA 3ATZA 2QDHA 5CZTA 3W7QA 3EX4A 1IXNA 3W70A 1L6SA 3S1XA 1G6CA 4AWUA 4OT7A 3FYOA 1GT8A 1TMHA 4JTGA 2ZZ6A 5AHFA 3HF3A 3NZ1A 2GPTA 4E0CA 1SZNA 1OJXA 2CZEA 3UYCA 3DFQA 5HULA 3EEGA 1O4UA 1AW1A 3WK1A 1DQXA 4OQVA 3L68A 4OE7A 4MZ1A 2PRLA 3M6YA 2E6AA 6TIMA 4LNYA 2A6LA 3ABSA 2WNQA 1PVNA 1H60A 4L4MA 1P4CA 4FEZA 1ICQA 3GAKA 3SW6A 2V2CA 4A22A 1TCDA 2NXIA 3IGSA 1BKSA 1ONRA 4KFNA 3VNDA 1UJPA 4RZ6A 2CLFA 3AJXA 4UXDA 3S1WA 4O13A 4AWTA 4LVGA 5IM51 1KTBA 2NZLA 3GNNA 2EAWA 4HNTA 1HTIA 4Y9AA 4UR7A 1OFBA 4O15A 5F1UA 5T26A 2NXHA 1OYCA 3BG3A 1F5ZA 1WQ5A 5AHLA 5AYXA 2QCGA 5CSSA 1F74A 3R5EA 3UXAA 3W7OA 4LUJA 5AHEA 2QCMA 5HWJA 1UB3A 3LHWA 4E2BA 3P5YA 2QCHA 1SSDA 3DFPA 4ORMA 2WSYA 4Z08A 3EWUA 4DBEA 4UTJA 3TW6A 5D2WA 3UD6A 2ABBA 1G69A 3W1XA 1DOSA 3DXIA 4O12A 4JY9A 2OT1A 5EY5A 3T7VA 1SUXA 2VXNA 4ADUA 1LBMA 1EP2A 4WXYA 4FNPA 1RVGA
chains in the Genus database with same CATH superfamily
3ZS4A 2OMAA 1KFEA 4ICMA 3SDOA 3NJ3A 4WSHA 3CQIA 1IGSA 1LWHA 1PTDA 3W81A 2J27A 1REQB 2HZGA 4MGGA 4R53A 2VFFA 3HBLA 2PDLA 1FDYA 1KTCA 4AYSA 5CC6A 3U2EA 1R0MA 1I45A 2PI6A 3VIGA 4TTGA 4C65A 4NU7A 5CPLA 5ECUA 1ZAIA 3UWVA 1WKYA 2WSQA 3PZUA 1ZUAX 1UUOA 1B90A 3A3XA 1MUMA 3QQ1A 3UXKA 3FSUA 5F1VA 2GVLA 4E4PA 1P1MA 3H2CA 1WXZA 3N34A 4J27A 3EOUA 1ME8A 2OZTA 1XIDA 2ZRVA 3MANA 1W2VA 3R79A 4HNCA 2MANA 3W7IA 1LUCB 1AFSA 1RXOB 2PURA 3KRZA 5EMKA 2PU0A 2P76A 3VUPA 4HTYA 1GG0A 1R85A 3GVQA 5F2LA 3ARPA 4KFPA 3G3MA 5IRPA 3W7GA 2FZ8A 3I6RA 1FDJA 2PGRA 1QATA 4ILSA 5ABFB 2HEJA 4LY8A 3K2GA 4NJHA 4AG0A 3INPA 2IPJA 5JUVA 3GZ3A 3QR0A 4FF7A 4Z2JA 1AH4A 3DG6A 3V18A 4HN4A 2R24A 4NI3A 2QCFA 1I0BA 4BA0A 1YXYA 1ONEA 4YTTA 1XR2A 4D6DA 1RBOB 5JBEA 5TIMA 3BJSA 2D2JA 4N2YA 4AIUA 2PDWA 1OINA 1ZJBA 2WQDA 1PTGA 1DWAM 1LL4A 2NVDA 3PS7A 3DIPA 4J35A 3WJWA 2OWCA 3N4AA 3GKFA 2VC5A 3AZRA 5CEWA 2PLKA 2XHYA 2CITA 4IOTA 4Y2WA 2WYSA 3ICJA 4GGHA 4M19A 1QI5A 4F0SA 3GR7A 4L80A 4QRNA 2X16A 3RCNA 4MB1A 3WLMA 4C6MA 5D09A 1H7PA 5G2HA 1LLZA 3Q45A 2VGGA 3QFEA 4H4IA 1U5JA 1S3HA 3LGDA 3CAKA 5C0QA 4JQ1A 3KVMA 2QF7A 3S0CA 2VDHA 4H9TA 1ZLPA 4D6FA 2J7CA 2QCDB 4FXRA 1R3QA 5K3VA 1PTAA 4K39A 3WDQA 1VFUA 5TQLA 1L6WA 4M24A 4NP7A 3TQVA 3W7DA 1PKNA 1NVMA 5I03A 5D9MA 3FJNA 1RK6A 4QS5A 4AZGA 3OVRA 4QFUA 2BHUA 4H6RA 3GR8A 1KRMA 1QI2A 1GOQA 3TOYA 3CJPA 3LNPA 2ACSA 3FDGA 1JDDA 1EKOA 5C2CA 3NURA 1PYMA 5J04A 3M5YA 4XAYA 2GJPA 3NA8A 5EU9A 1XQKA 5EL1A 3NPUA 2VUYA 3GNXA 1PSCA 4KIRA 3LCIA 3L12A 4JKMA 3EXRA 1HL2A 3CTLA 3ZXWA 1S2TA 4I8YA 2QPXA 3GLCA 4O19A 4NSBA 4F0HA 4ML4A 2E5DA 3B0YA 3CPGA 3AAMA 4DVOA 3KBJA 1JCMP 1JI1A 4J3ZA 4X61A 5G1TA 1XDLA 1T41A 4W88A 4KRUA 5GVJA 3LM7A 3T0TA 4FLRA 2Y7DA 3BH4A 4HD5A 4RNIA 1FOBA 3U6WA 4DJEC 1GORA 1E73M 1F4AA 2WHJA 4LBSA 3STGA 1HJUA 4HJFA 4A21A 2X2YA 1UUQA 3MUXA 3I3BA 3AHTA 3SY8A 1GHRA 3EA3A 4WR3A 5BXTA 4GNKB 2QDGA 4PUDA 2OT0A 3VTRA 1EC9A 4LXFA 1CZ1A 1K8YA 1TTQA 6ENLA 5I06A 4X0VA 5HQEA 5EFFA 3MI3A 3QKZA 3VX0A 3S5OA 2J4GA 5AC7A 4RK8A 3A3HA 1HGWA 4UTMA 1W3NA 2J47A 1IR2A 1U1JA 2PDNA 3LBOA 3WF1A 3OVPA 3XISA 2MUCA 3QJAA 3ARZA 5BMXA 3BAXA 3TKFA 3BUVA 1X96A 4DJFC 4EPDC 4DUWA 3QV6A 1FH8A 2RJGA 2Y7FA 4GI8A 3ZT6A 3HG5A 3AS3A 3WNPA 1U1HA 4LEQA 4N0RA 4P7NA 1X7IA 1JXKA 3UJFA 1SW7A 4A8IA 4QG6A 2NQ9A 1KQZA 3F2BA 1NQ6A 1HW6A 4K3ZA 4KH2A 4CU8A 3E9AA 1LJYA 1FFRA 2IUZA 5M03A 2ESCA 5CC3A 1DVJA 2JQXA 2J9YA 4JEQA 1TVPA 3MJYA 2PRHA 4DO7A 2AL2A 1S46A 4GNJA 3U48A 1SZGA 3GXMA 3N04A 3TJ4A 3TVAA 1O5KA 3MWCA 2H3BA 2I56A 2FTYA 1BF6A 3P3BA 2A5HA 2ZDSA 1H7NA 5A8PA 3O6YX 3LCXA 1EO7A 1K7FA 4TUFA 2OQHA 3LENA 4HPHA 1VHCA 1H3GA 1AJ2A 1ML1A 3QF0A 1AQFA 3GW3A 2QJIA 3P84A 1I60A 3PSVA 1PUDA 2KX9A 2Y7GA 4KRZA 3UY7A 2I5QA 2V5LA 4ZSTA 1R86A 1R9XA 2WQPA 3MP4A 3R8HA 3G8RA 4JZ5A 4DZHA 4UIOA 4ATWA 1NEYA 5L6UA 2Y8VA 2ZZ5A 3DFNA 4LBUA 4YPJA 3M47A 1RY0A 1XCFA 2TSYA 4GZEA 4GVFA 4EF9A 1FP9A 2V63A 3VCCA 3ARVA 4FOKA 1JDEA 1M6JA 1KBJA 1LLOA 1Z42A 2PDGA 3IIPA 3PBVA 1O5QA 3HB9A 3BICA 1NQKA 3ZLHA 3MHUA 5KETA 3F4CA 1P0NA 2O55A 3TWAA 2QULA 3N9SA 3QFWA 1HNYA 3EB3A 4C60A 3W02A 4HA0A 2HDJA 4GACA 3VOIA 1WDPA 3MMWA 1TUXA 3WDJA 1DJZA 3PTDA 5BW6A 3MU7A 1ECEA 3LZ3A 4R9OA 1MVYA 3NM3A 3APGA 2GQ9A 5FKYA 2V69A 3NVTA 3KBNA 3TC7A 4NG3A 4RXGA 5K2ZA 1O94A 4A8LA 3W1UA 2CZFA 3MWAA 5JU6A 1XUZA 1OD0A 2XH2A 4J3WA 2CBVA 4QAWA 1K3UA 2OEJA 4AX6A 4FS9A 2CZDA 5CJNA 1PWMA 3DERA 3OA5A 1DXFA 4B91A 1YTDA 4PCNA 2VC6A 4IFRA 4O0ZA 5MHBA 3QGAC 3VKJA 1EZ2A 1BXBA 2G37A 1LL7A 2WC4A 3MC5A 4IJBA 4QS6A 1UA7A 2RAGA 4RZBA 1CECA 2PDKA 3ISIX 3L7RA 2VMFA 3RRXA 2PGEA 3BSGA 3L0GA 4I9JA 6ALDA 2Y5JA 4L6HA 4RW5A 1JQXA 2J24A 4F9DA 3GB6A 2F6KA 2ZUVA 2AL1A 1J0YA 2AGTA 2PS2A 2XSAA 1TX0A 4MSSA 4P8WA 4BI7A 1EX5A 3LBMA 2GFTA 1OYAA 3KDNA 1EXPA 1GJPA 4DHGA 3K8LA 1Q6FA 3BAKA 1QFEA 2ZZ3A 4MYAA 3TV8A 1CGUA 4XZHA 3K4AA 3BTNA 3H2AA 5F2MA 2E09A 1C9DA 1DJQA 1I2OA 2QJJA 4GO8A 5FEPA 3URBA 3WQPA 4OIFA 1Y8BA 4LUSB 3HM7A 1LOLA 3L67A 2VEMA 1ZBCA 1F6KA 1XLBA 3WF3A 5DT7A 3LCHA 1PBGA 4J1OA 3CL6A 3W23A 2XWEA 1K03A 3LHTA 5LIWX 3VAVA 3FW6A 4MJMA 3N1AA 3QYSA 3FFSA 3O06A 2GQ3A 1ISWA 3AICA 4H9MA 3URNA 5CKSA 4JD4A 4O16A 3LV5A 3MSRA 1UD2A 1JUEA 4NVTA 3T55A 1MFUA 3ITYA 4NHVA 3PVFA 2XFYA 2P3ZA 3MKCA 3CT7A 2D73A 3V5CA 3GFYA 3KVLA 3H7UA 1BVZA 3AIUA 4KPLA 1UH4A 4IICA 3G1VA 3LHZA 1ZSXA 5DBUA 4OV9A 1AZ1A 3F4DA 1CLKA 2REQB 3BLIA 3OOQA 1F9CA 5HUOA 1WX0A 1K77A 3TN3A 3BARA 4IPLA 2QV4A 5AYIA 1O60A 3PZQA 1M5WA 1WA3A 4EP8C 2VDGA 4AD4A 3V7PA 3HQOA 3CM4A 1FXPA 5IHSA 1GVSA 3N3MA 3VIJA 4OBTA 1I2NA 1Q7QA 1RV8A 1FWSA 3DX5A 4R7WA 2E3ZA 2CEQA 1LG2A 2GJNA 4D2JA 1BG4A 3BGGA 3UBPC 3EMZA 4RE3A 4XKYB 4B92A 3L4WA 5F4WA 3UXDA 1XLEA 5CZSA 4N6EA 4LFYA 3ZJ7A 3KS6A 2J7EA 4UUIA 1O1HA 2E40A 4FPSA 4W7VA 1KC7A 1Q63A 3R11A 1UW9A 1Z3NA 3G6MA 1UJQA 2WZIA 4K7YA 1RR2A 4NJGA 3AMKA 1JCNA 4IM4A 3C3NA 4OUIA 2OX1A 2J75A 4AXKA 4GI9A 3CWOX 1I75A 1W37A 4H2HA 3L4VA 4FNTA 3UG4A 4MDPA 1OFEA 3WD1A 2X1TA 3GU1A 2Y61A 3NSMA 1FUYA 2Z1VA 1E6ZA 5GNZA 2NX3A 4W89A 4L4OA 3A4XA 3UPMA 2RFGA 4TV6A 1SW3A 2XVGA 2WZHA 2OYKA 1ALDA 5HMSA 3S1GA 4JTRA 2HTMA 3WJXA 4LCSA 2YFNA 4RXFA 1R46A 5A2CA 1RP8A 3N4FA 3NQ8A 3W2NA 1QI4A 1S2WA 1KW1A 3ABRA 3LB0A 3N29A 4JHZA 1PIFA 4UOQA 3MPGA 2E6YA 4MKSA 3W84A 5BRQA 5DCBA 4WJ8A 1RCXB 4N42A 2DSVA 2GQ8A 3A5FA 1NOWA 3KP1A 1V0NA 2AQVA 5M1TA 2GK1A 3KRUA 1QMLA 4TVUA 6REQA 1R3YA 1XI3A 1KO0A 2PPGA 4KWVA 2OSXA 3HPAA 1XYCA 1CTNA 2BY0A 1OX4B 3UU0A 1CW2A 3ZJ8A 4ZXOA 1QW7A 2HVMA 1GOWA 1FH7A 5D2XA 1VBUA 2XM1A 4WY0A 1Z41A 4A3RA 5LXXA 2E77A 1JZ3A 1LOSA 1XLGA 2JKPA 4I6VA 4LAKA 3EA2A 3QZAA 3W7MA 1FKWA 4MZ8A 2QLYA 3PBGA 3HGSA 3HZ3A 4MTVA 4PRTA 2OO0A 3OZOA 3QLLA 2BZNA 2FZ9A 3K30A 1WZAA 3AUOA 1LF1A 1EB3A 2YL8A 4D6CA 5D33A 3W85A 3ES7A 4PBFA 3H55A 3OG2A 1A5OC 4HSOA 1NDYA 4JEJA 4O8RA 4K38A 4PB3A 3T42A 1X38A 3HG2A 2GDUA 3DFOA 3GNOA 5G4HC 4BQ3A 4P7LA 4DXXA 3L4ZA 1R87A 1KXHA 3QLDA 2QW5A 5IBXC 2PP0A 4BQ2A 1W8SA 2GGIA 2DH2A 3AXMA 1H09A 4MWAB 2PWFA 1R3SA 3H2MA 2V2HA 4GQ0A 3RO8A 2PWVA 4QLJA 2VOMA 4PR4A 2HVNA 2OZ3A 1YE4A 3UWWA 1X6UA 3EAUA 1EL3A 3WO8A 1H62A 2CZVA 1UASA 2A2IA 1XLFA 2QXWA 1Q6LA 2XN0A 3ZSSA 4MFDA 2XVKA 1CGYA 2QJNA 2VCCA 4M6PA 4I5UA 3RMJA 1YNYA 1SYTA 3NXFA 1N2VA 1D3GA 3SN1A 4GY0A 3VC6A 3HPXA 4YU1A 1YDOA 3WL1A 3DBNA 3M7SA 1ECQA 3SGUA 3MVIA 1JCYA 1US0A 3GY1A 3MUCA 1E0XA 3WFZA 4FALA 3QPZA 4TVDA 5LNRA 5I2UA 1AQ0A 1DTNA 1UROA 5C5YA 1M7PA 3RPDA 2ZC8A 1LRQA 1ELSA 1SJAA 3MT1A 3WNLA 3DC8A 4DB7A 3HQNA 3T8QA 1V6VA 3G3DA 4PH6A 4C6NA 1WAWA 5AZ0A 4JFUA 1B4EA 1W1ZA 3NQ6A 4US5D 1UPMB 3M0ZA 3HO8A 3SJ3A 3CPUA 5C8BB 2DVUA 3IIXA 4EE9A 3CZKA 3VM7A 1W1A1 4AAJA 2QUTA 3QY7A 4RDWA 5LKYA 1J0JA 4X3ZA 1SZRA 4WX2A 1VYRA 2JIWA 1EOMA 5ECVA 3EB2A 1W9DM 5E09A 1UCWA 4DWSB 1H50A 4G2DA 4E4FA 1HGYA 4WY0B 3WUBA 2J79A 3GDLA 4PZVA 3ZR4A 4KWSA 2RUSA 4FNUA 4BI6A 1XC4A 1Z44A 1ZCOA 3G1DA 1HZYA 3C2FA 1YBQA 3EOSA 4WJEA 1YMYA 6XIAA 5IBXA 5EBUA 3GZAA 1UZDA 1UH3A 3IVSA 4UMCA 4XZIA 3CASA 2BV9A 1AMYA 1FHLA 1K8XA 1AW5A 3AYVA 3W2UA 3S9IA 3DG3A 3MDUA 5CXPA 3OG3A 1UR1A 4DNMA 2OQYA 2YXOA 4XUGA 3OZYA 1RVKA 1UOKA 1ZJAA 5ABFA 3GS6A 2BTMA 3JW7A 4F2UA 2EGZA 2ZRYA 2BP1A 2OCZA 4Z2LA 2VEPA 1EQPA 1F4HA 4EOUA 2VFIA 3FGCA 3NWRA 1OCQA 4LU0A 5HQMA 4AIEA 2YBVA 2PTYA 1BVNP 3REQB 2R14A 3LPPA 3PP7A 1S2VA 3ITOA 3M41A 2HXUA 3T0BA 3CEUA 2WHLA 2O0TA 1B5TA 1FWAC 1PV8A 3THUA 1IQ8A 5EFDA 1MI3A 4NXKA 3UR5A 1IEVA 4LGXA 1SR0A 3ANUA 5GJPA 3TA6A 3T4CA 4LAOA 3IJ7A 3JRKA 4HZ6A 1XIFA 3V1PA 4IMCA 1M1BA 4GQGA 1POJA 2WZEA 4PUUA 7TIMA 1G1YA 1OGSA 4Q7NA 1V08A 2WVUA 1WAUA 2Y4SA 3LLFA 4AZ6A 4K6AA 2Y88A 3TSDA 3TYAA 3H2FA 3JU2A 5MKGB 1XINA 3I4KA 3HV8A 3BL3A 4JN8A 2IQTA 5FJRA 1ME7A 4EKJA 5BRPA 3PK7A 1E72M 2WVVB 3LX9A 1EPXA 1XH0A 6A3HA 3U57A 1AUSL 1XRFA 1ITCA 5C9UA 4QGCA 1DJWA 5BU9A 3KBVA 1CXLA 3BLOA 2G97A 2XISA 2PDMA 1TE1A 1FXQA 4FO4A 1H49A 3T05A 4B9YA 5HUPA 2QCCA 4D6GA 4QNEA 5HXMA 2WNNA 4OUEA 1GQIA 2E8ZA 4ZTYA 3WJYA 4ZVJA 4DBDA 5DMNA 1KFJA 4XKYA 4LSBA 1XGEA 2Y6ZA 1IGWA 1DJNA 4KCVA 3Q65A 4HU3A 1J18A 3CXOA 3KDOA 4NAEB 1M9HA 2J7DA 1YW1A 3AMGA 4GY7A 1J9YA 3L4UA 3GTNA 2D23A 4FXSA 3SURA 5I00A 4YS1A 1UKQA 3NSNA 3B0XA 3KE0A 1W91A 3UNTA 5GNXA 2INFA 4MLRA 3UEQA 1V02E 5A8GA 3LERA 3MMTA 3G24A 1OCNA 4RLIA 4Q8OA 1XYMA 4NY2A 4ERIA 1OX5A 4I7VA 4UCFA 3ZOAA 2VZUA 3WDIA 5D8ZA 2J66A 4PFMA 2ASHA 3G1YA 4BI5A 4O53A 4LV4A 4OKDA 3P80A 1XP3A 4JFSA 3GRIA 4TV5A 1DIKA 1DPMA 2QPSA 1JF6A 3NZQA 1E9LA 1OM0A 4XO7A 4AQLA 1EO5A 4PSRA 5GJNA 2CKRA 1XCWA 4TR9A 2O4QA 5K9XA 2GVGA 1SM9A 4CCEA 3OLIA 2TAAA 1JGMA 4UTIA 2JEPA 1FBAA 4QJ5B 2C7FA 3RLGA 1W17A 2QUNA 3V0SA 2JK2A 4DUOA 3ARYA 4AB4A 4QLKA 4GFIA 4JGDA 6XIMA 4QEEA 2YLLA 5JQ9A 3MZ2A 3M16A 3VOHA 1UKOA 3CMFA 2CNCA 3L65A 5I7GA 3WEOA 4KWUA 4QE1A 4E4UA 2WJFA 3RITA 3TH6A 1B3XA 4GVHA 3KOWA 2AOSA 4BQ5A 2FHBA 4JFTA 1I1XA 1V3MA 3OPSA 1RJRA 3A12A 4FR6A 3QV8A 3VE9A 3UZYA 4ACZA 5LGZA 2PGWA 3RMEA 3AALA 1V7YA 4FI4A 4ZQNA 3RO6A 4DYKA 2P5NA 1GOIA 4O11A 3TYUA 4YN5A 4WKFA 2V3EA 2A0NA 3FEQA 1UR2A 1DKWA 1V6XA 4BK9A 5CPMA 1GOOA 2C3ZA 2Z1KA 1FVPA 2DJLA 4CEXC 1TJ0A 3QZEA 1BWKA 4DEFA 3VNZA 3EZ4A 4FA3A 3KL0A 5ENLA 3W71A 3MP5A 3KEHA 4ZA0A 2BY1A 3B0VC 3KCOA 2QZRA 1V8EA 1XGZA 3IS4A 3TE9A 1HVXA 3WQOA 2BSLA 3F5KA 3KFTA 4GJIA 2HMCA 3ZVHB 1GKRA 3QSRA 4GMEA 5A6BA 4XD5A 1LM1A 2ZKMX 3CL7A 3N15A 3L2MA 2NVAA 4GKLA 1V3LA 2DZUA 2W92A 4HZ8A 4MAVA 1U5HA 1E4IA 2OSYA 4AEOA 1K1DA 4ZFCA 5A6BD 1GYLA 4HPJA 3WH9A 4RL3A 1OK4A 2REQA 3O8AA 4S3BA 4DWSD 2RKXA 3TYEA 3SQLA 3GUGA 1TWZA 3HMCA 3UETA 1AZ2A 1VR6A 3ES8A 3T2OA 3RUBL 3VYLA 4GIRA 2PFHA 1FWDC 3NQEA 4XBKA 3ZZ1A 3I4EA 2DZSA 5I07A 3THQA 3RLUA 3IGUA 1UWQA 1WXJA 3UVIA 4IXXA 1H5VA 4QDPA 2WKJA 1UWSA 2FHFA 6PTDA 2X0YA 1AG1O 1XICA 3SB0A 3H4XA 1MXDA 3W0KA 2VGIA 2QDDA 5E9AA 4E38A 1ZNNA 4KERA 1H63A 3VO0A 3B0UX 3ITVA 3LHVA 3TC6A 2PDQA 5HR7A 1WCGA 4Y9MA 3QQ0A 3LOTA 4INFA 2C15A 2E5CA 3VVGA 4C7FA 3SCRA 4IPPA 3G8EA 4BS0A 1E6PA 3AHVA 4QJ3B 1PPIA 5IFTA 2VUNA 3L5LA 4XX6A 4LF1A 2BVTA 2O7QA 4JKLA 2ABAA 1W8GA 2CLKA 2GDVA 2AQWA 1J2WA 3M5XA 2P50A 4UQCA 3S2CA 3KHJA 1LYXA 2HS8A 1UZ4A 1ONXA 4M8UA 3ABZA 5I6SA 3LLXA 4PFHA 4DJDC 3WBAA 4YTRA 4H83A 1OB0A 2FDMA 1E70M 2QDHA 5CZTA 3W7QA 3R7MA 4J2PA 5EGRA 1XLKA 1XS2A 2YDQA 3CQHA 3P14A 5I3DA 1G6CA 4X60A 1TMHA 2VZVA 2V6AA 5AHFA 3E2SA 4J3UA 3P6LA 3KZSA 1SZNA 2CZEA 1AW1A 1A5UA 3L68A 2HRWA 4BZYA 3M6YA 3R8GA 2E6AA 1Q6CA 4XZBA 3ABSA 1PVNA 4L4MA 4HMEA 4HVXA 4JCLA 4FEZA 3SW6A 3GAKA 2ZX5A 4XZWA 3VNKA 3IGSA 3H12A 3AXIA 2CLFA 3VMPA 1REQA 5T91A 3GNNA 3WBEA 4HOWA 4GVGA 3BLLA 5T26A 1UR8A 4JN7A 1Q2SA 1WQ5A 5AHLA 4IIEA 1XD0A 2G50A 2QCGA 5CSSA 3UXAA 4C6OA 5LIXX 1YBQB 4D9PA 3T0AA 3W7OA 5AHEA 2POZA 1UB3A 4Z1YA 4E2BA 3P5YA 3DFPA 4ORMA 2WSYA 4UWMA 4H19A 2HNHA 1DE5A 5D2WA 4PTDA 1G69A 1DOSA 4EXQA 1SUXA 4FOJA 4XKMA 3GHUA 1LBMA 2G4FA 3KTCA 2WPGA 4WDUA 4ZOBA 2GJRA 1RVGA 3M07A 2RGMA 1L2QA 1TMQA 2G0WA 4H2CA 4GCAA 3QOKA 1J96A 3O6DA 1YQ2A 3L4XA 3TR2A 1I0DA 4PUKA 4FNRA 4NJIA 2P53A 4V1XA 4YLWA 3MBFA 4UTTC 1A0DA 1Q2RA 3TLLA 2CLMA 2XGZA 1W3KA 1PIIA 1BYAA 4C6DA 2YCLA 2AL2B 1MW1A 4O1EA 4CQDA 5H1WA 5D9PA 4HNOA 1QTWA 3A13A 3WQFA 4P7RA 2CLOA 3WQCA 4B3KA 4YVXA 3SADA 5AC6A 1H7OA 4YHEA 3UYIA 2ZTKA 3I3EA 3PANA 3II1A 3S5NA 3TLQA 3EWWA 1IWBA 3P5ZA 4FNSA 5DF0A 2DZAA 3DFYA 1GVOA 1YEYA 4BHYA 2IXVA 5H8MA 1LUCA 2ZA1A 4S2CA 4ES4A 2PDPA 5C71A 2Y85A 2OWWA 3GC4A 3EPMA 1XSJA 1RK5A 1WKFA 1CGVA 1LBLA 2H9AA 2VWSA 3UZZA 2H8ZA 3W73A 4LB3A 2FTPA 2NSOA 2QIIA 1BKHA 3H26A 2F7FA 4V28A 3LU2A 4JHMA 3H70A 3PF3A 4CU6A 4JICA 5BOFA 4GI4A 2PF8A 2R6OA 4LRTA 3AXHA 3W1MA 5AKQA 4WOQA 4GCXA 3BOFA 1A0CA 3CC1A 3CV2A 1FWFC 1KXTA 5DRIA 3WQWA 4UFIA 1KBKA 3OLGA 2W67A 4S3FA 1MQRA 1IF2A 3D47A 4LX4A 1XIMA 2G5WA 3AWOA 2PD5A 5HATA 4GYJA 3EKLA 1P6CA 2ZXDA 1OBAA 4GG9A 3M0KA 3WCZA 3LI1A 2VWTA 2FVMA 2YR1A 4HOXA 3DOPA 4E2DA 3C2YA 2XVPA 3UERA 3PHAA 4H3DA 1OFDA 1HP5A 2G3IA 4A3QA 2BLEA 4D71A 4U2YA 3CUGA 2WOQA 5EPDA 1JJKA 3B8DA 1XFCA 2ISSA 2FTWA 4OBRA 4XO6A 4ZQRA 3JZEA 4UNIA 4LS0A 1ISVA 1SMAA 5HAOA 1UBPC 4O57A 3P62A 2GDQA 3IVUA 3T08A 3SCUA 4N9CA 3H24A 2PE4A 4B16A 4FB7A 3WNMA 1UHVA 2EPOA 1RALA 1DP0A 3UPBA 3R8RA 1NDVA 4M1RA 1PE1A 4JKKA 2V0TA 4GFSA 1HUVA 2ACQA 2WMJA 1XJBA 4H8VA 2P8BA 1W1B1 4LW7A 5DELA 3FXGA 4AIBA 1QRQA 1TCMA 3CQKA 5KZDA 3ME3A 3GG8A 3STEA 3WSUA 4GI6A 2O7SA 2ZWZA 2Y2WA 2PLMA 5CSUA 5G4EA 2B7QA 3VILA 3LV6A 1S5NA 3BMWA 4ENLA 4GLEA 2WBKA 3QC3A 4DF2A 2DZPA 4Q8VA 3B03A 1RLDA 3FV9A 3KP0A 4KT2A 4L1WA 5M3WA 4HK5A 1T6MA 2A6NA 2G3NA 1L6YA 3S6TA 3BLEA 2KAUC 1JD7A 3FXYA 1OY0A 3T81A 3NPWA 1QAPA 1XIEA 2ZDRA 1JZ8A 2O9PA 4U5KA 3ANVA 1HFBA 3W7EA 4F48A 1BAGA 1GEQA 3UJEA 1UMYA 1GYMA 1CBGA 4JTCA 4B9ZA 2ZICA 1KGWA 2EG6A 3C86A 4GUGA 3S2NA 3DCPA 4LUYA 3S2JA 3VINA 1UZ1A 4FP1A 1A4LA 2NWRA 1B1YA 4QSFA 4O4VA 1Z9AA 2FJUB 1CCWB 4ECLA 2DY3A 1WOBA 1JYWA 1EDQA 1ZFJA 1VRDA 3OHMB 4S2BA 4AIOA 4Z1BA 4YVVA 5G1YA 5GQBA 4X2PA 1X39A 4I9MA 1KV5A 1NDWA 2V68A 3SO7A 3DI0A 2FKPA 1W3LA 3RRAA 1JDAA 3JZUA 4JIIX 1W3IA 1VCVA 4WHBA 2ZUSA 3SY1A 1TPWA 1SGJA 3VFLA 1R8LA 2ZX6A 1QI0A 3O0KA 3OGVA 4DZIA 2YBTA 3GVVA 4GD0A 2A4AA 3GAYA 2BHYA 1FWRA 5G2IA 1TFVA 4UTWA 4DBUA 1W9PA 2OLAA 3DH7A 3UY8A 1AL8A 1P7TB 5AC8A 1B54A 1JAEA 2FMNA 2PD9A 3E74A 5CZKA 5AC5A 2BOFX 1JULA 2ZZ7A 4B5VA 2ZC1A 4A05A 3LHUA 1OGBA 1GVEA 5HOSA 2DEPA 4I7WA 3M1ZA 4XZ9A 3OZPA 4LH8A 1XSKA 1JYVA 1NFBA 2VGBA 1LWIA 1B3ZA 2VQTA 4DJDD 1G5AA 1FWIC 1EP1A 2J8TA 4KBXA 3K46A 4S3AA 3B04A 3HPZA 3SRKA 5HANA 4GUJA 4DJDA 3T78A 4OVXA 3SCPA 1TPB1 2PC4A 3MKVA 2H90A 1Y5VA 2W66A 1GZ1A 3OBEA 5D04C 3VPLA 1N8WA 2OKOA 3TNOA 3KW3A 1DWIM 1XDMA 4FXJA 3GBEA 1M65A 1IEQA 4QLLA 2GJXA 1E4MM 4K36A 4TIMA 3VDHA 1TWWA 2X7WA 4EXBA 3RILA 4A6GA 2FB3A 4PCPA 4ZQCA 2PLJA 3NOYA 3R4IA 3GFXA 1ONWA 4LS1A 4ZTXA 3MV01 2AQOA 3WEZA 3WLJA 2BS9A 4OTKA 3AUJA 3ITXA 1Q8JA 1RHCA 5A6LA 1F73A 1NP2A 4XWUA 4PRRA 2DORA 4MDOA 3VD3A 1X1OA 3PZNA 4IIGA 1CXHA 4PA8A 1H7XA 4U2ZA 3MV11 5LYRA 2V5CA 2WC3A 1XISA 3ENLA 1TPDA 3WF2A 4Y9NA 1CI1A 6REQB 3I7QA 3TN6A 4ERGA 3NOEA 4Q6JA 2SFPA 5MF5A 2YW4A 3EEZA 2OLSA 1JGIA 2H9AB 1FX6A 3CH0A 1WKDA 3VE7A 3UA4A 2A3LA 3GG7A 3AIEA 1R3RA 4LVDA 1PWLA 3T0DA 2PGFA 5KMYA 4Q4RA 3MYPA 3WK0A 4JYEA 3IV8A 2G41A 3WG6A 2NUWA 1VAHA 1E0TA 3AYSA 2PA6A 1TV5A 3A4JA 3CQ0A 1FWHC 4PUNA 2WKGA 2TRSA 4BF7A 2QNEA 3T09A 1NM9A 3L5AA 2FPTA 1EJVC 3E1F1 3MO7A 3TAKA 3ANYA 2OJPA 4N6FA 4W5UA 1CNVA 1FWBC 2R1LA 2QCLA 5KZEA 3N2MA 2I5IA 5I0DA 2CFFA 2Y63A 4HU8A 1TPH1 2V2DA 2VR2A 3NPVA 3ARWA 1QW8A 4MPQA 1TR1A 3HG3A 4H7VA 2BY3A 3WQ5A 3U9IA 1TZZA 1JZ4A 3GYEA 3IV3A 3TJLA 4QQ3A 4QP0A 3SUTA 4ORIA 3WK2A 4JIQA 1VRXA 3UQNA 1J0ZA 1MEIA 5HWNA 2XIJA 1V3IA 2ZA2A 4DZAA 2ALDA 3NQ2A 1L9WA 3RDKA 1EA0A 5H8PA 3MUIA 1JCJA 1E6XM 2DSKA 3P61A 2PC8A 2I17A 1T8QA 2EPLX 5A6AA 1V51A 1BHGA 3W83A 4DBWA 4LAMA 4IQEA 3NQGA 4MNMA 1MZRA 4IMGA 4BR1A 1RD5A 4D8AA 1OF6A 1Q8AA 2DZTA 2C18A 2OOGA 3LS9A 4DPPA 4DXKA 1FHDA 4IQDA 1L8PA 4JYDA 3N9KA 3N11A 2FB2A 4QITA 3GXIA 3VCNA 3ARUA 1F6PA 2Z2AA 3AO0A 5D03A 3WN6A 2VP8A 1TJ2A 1LP6A 3W76A 4FX7A 4U28A 3V5OA 1TTJA 2ISFA 2R8WA 4I5RA 1RQBA 9RUBA 1H2JA 1ZPTA 2DH3A 4GYKA 4GVIA 4QCFA 2HXTA 4AD5A 4E5TA 3PPGA 5CJ5A 2WW5A 3K8KA 3LHYA 2XFWA 3TDFA 1I8JA 2HV5A 1W5PA 3H23A 3W1NA 4HOZA 4O54A 2VRJA 3TW7A 3ZVHA 5DY2A 2J9XA 3HG4A 3TYBA 4NNCA 2JALA 3QHOA 1S1PA 3TAOA 2VL4A 1UP0A 2Z1WA 1ICPA 1W9XA 2DT1A 4CVUA 5M17A 1HO1A 4IG2B 1K9DA 1JIBA 2PDBA 4Z2IA 4E8GA 3KAOA 2XDFA 2CETA 1AQHA 4QNWA 3V4BA 3RM8A 5ABEA 2PWHA 1TJ1A 4W7UA 3RU6A 1TRIA 1MYRA 1IHIA 2CW6A 3I10A 3LBCA 4RNFA 1H7RA 1AW2A 5FJJA 1VC4A 1A5LC 2E8YA 3NNTA 2RHGA 2VRQA 4GJ1A 5BXPA 2EXOA 4P2VA 1V77A 1OK6A 2AKMA 4A4AA 2HCVA 2DSZA 2QMKA 3KX6A 4NRSA 1GKPA 3AS1A 4DO4A 5DX7A 1E6QM 1KLZA 4C90A 4Q8WA 1IV8A 1PX3A 2V9DA 5HA7A 5C9ZA 1H0GA 3PSWA 8XIMA 1XIIA 3S6OA 4Q8MA 1QPNA 3IJLA 5DLCA 3WY1A 4MJ4A 4OWGA 3GC5A 2FZNA 3BV7A 3W88A 1ZP4A 4B5SA 4OECA 1H0IA 3Q4DA 5BOEA 1YLVA 4HHMA 1J8VA 3N2XA 3E2QA 3HPSA 1TX2A 2DQWA 5CGTA 1PHQA 1XYAA 1B57A 2FZMA 2V30A 2HBVA 3ZM8A 1DL3A 3WBWA 2E68A 3S9ZA 1W9UA 3N19B 2IPFA 4PODA 5DXXA 4PUWA 1QVBA 3PUOA 4L9ZA 2YSWA 3WMSA 5CG7A 4RUBA 5FEXA 1G4PA 1TZ9A 3CV1A 2YDAA 2BB0A 4GA8A 3FVMA 1A3WA 4KESA 4W7WA 3GHRA 4D6HA 1YPFA 1V03A 3H22A 4ZOEA 3CH9A 4C6JA 1YYAA 2BWGA 4MWAC 5FD0A 4QE4A 5LXEA 2VHLA 1DBTA 1SFLA 4LQ1A 3OYZA 3UZXA 2WKLA 4IG2A 1JQVA 3PBMA 2PB1A 1H5YA 4L64A 3MI6A 1TELA 3HTWA 3WLKX 1TPVA 3VU2A 3C3UA 5G4WA 4Q7BA 2HQAA 3U2CA 2ISVA 4CQ8A 1ZL1A 4JTUA 2XIBA 2OQLA 4GXPA 4WSJA 5K9DA 1YXDA 3SGGA 4CGTA 3O05A 1OWQA 4NZ5A 1F3TA 2ZRWA 2HE8A 2CLEA 4I6KA 2VEIA 3LRLA 3S5SA 3LLDA 3OW1A 1RA0A 3WFAA 5B80A 5DBTA 3NR0A 3LUTA 5CBBA 3P81A 4Z2HA 2FH6A 4HN8A 3CV6A 1VBJA 2Y5EA 3W7CA 1QOQA 5DQPA 3WLHA 4PUEA 1CXKA 4BKNA 4UTLA 3MQTA 4F40A 4Q8PA 1CGXA 1Q3NA 3ARRA 1XCXA 4YHGA 5A8OA 2CBUA 4ZE4A 5I23A 2C6QA 4JX6A 4RR4A 2VZOA 3E12A 2ONEA 2E67A 3QKEA 3Q67A 2VELA 1HX0A 3CAVA 1MEWA 1ZJHA 1FRBA 3BOLA 2HPMA 2ZXQA 4GE8A 3VFCA 1WPCA 4FMVA 1EJWC 5FJOA 1T96A 2ZTJA 1Q45A 2VENA 2BGSA 2WANA 1LQAA 4JIPA 4CQAA 2GOUA 4R7OA 3RF9A 4PGLA 4DNHA 4B5NA 5K7JA 2AAMA 1I2QA 3CUHA 5HBFA 3B9EA 2ZX8A 4D8LA 3ZMRA 1LT7A 1B9ZA 4UQAA 4WGHA 1PDYA 2JEQA 1SW0A 3CB3A 4HCLA 1GOMA 3L2LA 3TZFA 3TXVA 1QNQA 2ON3A 4JDYA 3QSTA 1B3VA 4LVFA 2DW7A 3DKLA 2XG9A 4JTLA 1TPC1 1XBVA 4JN6A 5IDIA 5DMYA 3WK3A 2F2HA 3L9CA 5G5IA 3HGOA 4ZO9A 2DV0A 3SI9A 1VCGA 2YGYA 3GW0A 1U1UA 3VDGA 3GDBA 1S5WA 2Y62A 3N12A 5AFDA 3L23A 1K02A 1XIJA 2W9MA 2WMHA 4EVZA 1MO0A 3MA8A 5FCZA 5DCDA 1IR1A 3HURA 4C6EA 2A7PA 4AEEA 4IFKB 1RJQA 4M29A 4TO8A 4Y6GA 2DT2A 3EB4A 3EXSA 1SFSA 5BCAA 4GUHA 2GVJA 4M81A 4DPQA 4RNJA 3VGGA 1LZOA 2GGJA 2HS6A 3CZGA 2ZA3A 4PTMA 3PAOA 1DHPA 3GIQA 1V0MA 2YCLB 5GNYA 3C6CA 4YYCA 1K9FA 1B0IA 4HA1A 5H91A 1AA1B 3F03K 1ZZMA 2YZRA 3G1FA 4F0LA 4MFEA 1W32A 1R3TA 2DIKA 2PCQA 2WHKA 3BAWA 4H7ZA 3WLIA 4IUOA 3B8IA 4FX8A 3W74A 3MYOA 1VS1A 4ICCX 5EMYA 4JTKA 3W6LA 1E56A 2I7GA 4JIRA 4HGXA 3VM5A 4ZFMA 3TEVA 3OJGA 3KVKA 3SECA 2QIWA 3PPHA 5MKGA 3JR2A 3WEMA 1DJXA 1L8NA 3G1AA 3G0SA 1GZJA 3GDMA 4AUBA 2CKSA 4LCQA 1RLCL 3GTIA 1R38A 3B3DA 3A5VA 1DJHA 1TA3A 3C2RA 2CBJA 3BAIA 3TJIA 5FL1A 2HROA 3QEZA 4H9VA 2J6VA 2PTDA 4V15A 3SRFA 3H7VA 4I9TA 3PZMA 4LV9A 1KQYA 3E2VA 3RGTA 4P7QA 1J4EA 2ZVIA 5CPNA 3GG0A 3CMJA 2CZ5A 2W4XA 4Z0SA 1Q66A 2IKHA 4BJHA 4HNUA 4NNAA 3RN6A 1BFNA 4L5ZA 3WBYA 1OFPA 1E0UA 3CL8A 4GZ7A 4XZNX 2BASA 1A5NC 1TRDA 2CHRA 1WZMA 4GABA 1SO3A 4MADA 3IIZA 2QS8A 2EPKX 3S9YA 4XISA 4FF5A 2JGQA 3AJ7A 2I14A 1QOXA 4IX0A 1R7OA 2NQHA 3MSDA 1P48A 5HNUA 3OBKA 2YBUA 4AX7A 1EJUC 1TIWA 4S38A 3POCA 1VBGA 4ACYA 4G8TA 4MHBA 1AH3A 2Z1SA 4PTNA 1ZENA 3VZZA 4KRTA 2G3JA 3WQDA 4HHHA 2HWGA 2X1SA 3G0UA 2NV9A 3IIVA 5CGMA 1AQMA 4IIFA 3RJYA 2XWDA 2WNWA 1HKWA 5KZMA 1F8IA 2VR4A 2NX9A 4JNMA 5FJIA 3IJIA 2WLYA 5LSMA 1IIHA 1NOUA 3OEXA 3MTWA 2EEXA 3ARTA 4HCHA 1BYDA 2JF6A 4AWEA 4NQ1A 2VJXA 4LVAA 5C2GA 3B9OA 1T8XA 1H61A 1GWJA 4HPXA 2WPBA 3U4FA 4AZIA 1JPKA 1JRCA 4AD0A 3OVGA 1QBAA 5CBIA 5HPOA 3VIFA 1UYQA 1NF0A 4C1NA 2UY4A 2ZYFA 1O6IA 2YCIX 4ZCWA 2E25A 3RLVA 1VQTA 1CDGA 3BXWA 2EO7A 3THAA 1G94A 3FKKA 3QR3A 1G4TA 1QPKA 2A3HA 2PTXA 4LUTB 3TTEA 1VP5A 2VFEA 1S39A 4MY9A 3LQLA 1T7LA 2A1YA 3TJXA 1XIGA 3GD6A 3ITCA 1HL9A 2INEA 1LBFA 1NOFA 3LTPA 2OB3A 2I57A 5G1MA 5HMDA 1GG1A 1E51A 3SCNA 1V6WA 3LTYA 3QMTA 1A5BA 3WENA 1EUNA 5LIUX 3MJMA 1NFPA 1ZCCA 2Q8LA 1NP0A 2E28A 1R2SA 1LDCA 1OC7A 1A80A 4MB3A 3CHEA 5AYZA 4MKNA 2GL5A 1PZ2A 1VBHA 1OADA 3QZ6A 4PMOA 1XG4A 3SRDA 1XF0A 3WFLA 2OOFA 4I9AA 4ZO6A 2Q01A 3WNOA 4YWSA 3GR4A 4UTFA 3NQCA 4L61A 5BROA 3C0QA 5H6HA 5E0FA 2J77A 4Z2GA 3BO9A 1EBHA 3YPIA 3OLEA 3IIOA 4I90A 3UR7A 3E0LA 5E0CA 3NZRA 3G1HA 3KWXA 7XIMA 2Y5SA 1W1YA 4L6DA 1R47A 1EGMA 2D1ZA 3BW3A 3HFYA 4XAFA 4MOZA 5BWFA 3DENA 5AB3A 3R0UA 4F0KA 4ERAA 4CD5A 4NJKA 4UFHA 2J7BA 3IANA 3CZ8A 3EOLA 2UY2A 3O3RA 3TN4A 3KRSA 1KBBA 2PRMA 4DM1A 5HJXA 4DO6A 1I2PA 4AFYA 3VI2A 4KS0A 3M0HA 4Y8EA 2O4MA 3ZLGA 4CQCA 4AY7A 1J0IA 1GK8A 4E8DA 1WZLA 4IPNB 1W0MA 3K1DA 2X30A 3GM8A 4ATDA 4J3TA 3A3WA 3LD5A 2FVKA 4OZOA 4ZMGA 2IMRA 4GX9A 5A6KA 1ZALA 4JX5A 1DQUA 4QCEA 2J74A 4MWAE 2J8FA 1NAL1 1ZS2A 1U22A 2OODA 2A21A 1UWIA 4G5DA 4ZR8A 1F3XA 2J8GA 3TTSA 4NAEA 5T8GA 3R0DA 1AJ0A 2PWEA 2PDUA 4DYJA 1XDJA 1E1CB 3RAOA 3LCWA 4LYRA 3GNPA 4ZB5A 4UB9A 3VGDA 1KTNA 3NL6A 2WWCA 2GQAA 4XG1A 2OX4A 3UG5A 3WDRA 3W9ZA 1RAKA 2DPEA 1Q13A 3AOFA 2PEVA 2OZ8A 3UESA 2EPHA 2PWUA 2RGLA 2WSPA 3CHDA 1RUSA 1L6FA 3H54A 2D3LA 4R27A 5AVHA 4XD3A 1TE6A 4P5UA 1UR0A 5HMFA 4Q4QA 3SCSA 2FIQA 3DUGA 4IZGA 1TPFA 4V2XA 3I6EA 4N4PA 2QT3A 3NQAA 5A6MA 3GH4A 2ZQ0A 3RFAA 2OZ0A 4I5XA 4JR5A 3WQVA 2YCJA 2CLIA 4NAFB 1V6UA 2W3ZA 2VX6A 4REQB 1E55A 3D3FA 2DSWA 1MXSA 1PCWA 5A1AA 4CUCA 1OX6A 4FAMA 2NQLA 2Z6IA 4M7SA 1JD9A 4J3XA 4URIA 1MZHA 4HHPA 1XV8A 2J88A 2Q3RA 3R13A 3GTHA 5DXYA 1EC7A 1JFXA 1B3OA 2YIHA 1W6TA 1BQGA 2CBIA 1W9BM 3EX3A 4O4WA 4NZ3A 1ITQA 1D3HA 4U33A 3AC0A 3A23A 2YJQA 2YB4A 4MJZA 5H8UA 5I02A 1N8FA 1CXFA 3GTFA 2A7NA 2X40A 3LM3A 3O0FA 4IMDA 3MP3A 3DG7A 3EX6A 2QGYA 1EJTC 1YX1A 3WQ8A 1CENA 1Y0EA 1OC5A 4JIHA 2G4JA 2BBFA 3LNMA 3U0HA 2BXYA 4QQUA 3EX4A 2G3MA 4OT7A 3RX3A 4HP5A 4ROPA 3HF3A 4E0CA 3DFHA 3DFQA 5HULA 4U3AA 3EEGA 1O4UA 3AIQA 4PBGA 1DQXA 4OQVA 4MZ1A 5HNNA 4K8GA 2CPUA 4LNYA 4NL1A 3T4WA 2YLAA 3QGVA 5CAHA 4AISA 1TCDA 2NXIA 3FN9A 1QJWA 2V67A 1XYLA 4DLFA 1ONRA 1ZBKA 1UJPA 3AJXA 1M3UA 4UXDA 3S1WA 3D46A 4LVGA 1XQLA 2NZLA 2EAWA 5ABHA 1C7TA 1OFBA 1QASA 5F1UA 1OYCA 4CNTA 2QPUA 3FNDA 1F74A 1PDZA 1Q4NX 4NRRA 1C8XA 1CB2A 3ZT7A 5HWJA 3LHWA 4EWJA 1M41A 4BEQA 1R5YA 2X0SA 1UZHA 2OFJA 3EWUA 4DBEA 3GIPA 3ZJKA 3WMBA 2ABBA 4CN1A 1JDFA 1RBLA 1WKEA 4PE8A 2HPIA 1O5RA 3DXIA 4MKVA 1S2UA 5EY5A 4HQVA 2OGYA 1BQCA 1A5KC 3QV7A 1EP2A 4FNPA 3RCYA 1V7AA 4IJRA 4Q8QA 3ARSA 3F2DA 4F2BA 4RKAA 3MHGA 4DWSC 2MNRA 4LUTA 4LALA 4S1FA 2PMQA 1J6PA 4XB3A 1R2TA 3ALGA 2WM1A 2YA2A 4U31A 4PMZA 4MUZA 1UOZA 5IOBA 2CWXA 1FWNA 3DDMA 3VIMA 3SR7A 3ZWSA 3U8GA 1EDGA 5GJMA 3TSMA 4FLOA 4GQQA 1UWUA 3WLNA 1OFRA 3LG3A 3STFA 2Z25A 2HVOA 2DU2A 3W4RA 1OC6A 1ZGDA 1Q4WA 4AZHA 1K8ZA 4UC5A 4NIRA 3S1VA 1H7WA 4RV8A 3PBYA 4B5UA 4Q4PA 3ZR6A 1UWAA 1XW8A 4AF0B 3S5YA 3EPOA 2YOCA 4UBPC 1EXBA 4TVCA 2QVHA 4D1IA 3BURA 1EBGA 2HE5A 3HQ1A 1CXEA 5I24A 3ID7A 3WF0A 3HOJA 4HNLA 1BXCA 1OX4A 1PB0A 3QMSA 1RQEA 4GK8A 3N9RA 1KRAC 3RJXA 2IKGA 2UY5A 4DLMA 3REQA 3W26A 3WNNA 2XGIA 1VPQA 1ZU8A 2EF9A 5EB8A 3SJNA 4J4KA 2QF8A 1JL8A 1JCXA 2PODA 2PZNA 5I3JA 1KM2A 1MQQA 4R5EA 5LHFA 4XK2A 3EX1A 3W7NA 3EKGA 3F1QA 2Z27A 3O6CA 4G7EB 4LANA 1YPXA 5JMUA 5LNVA 1QI3A 4OHQA 4F2TA 1B3WA 1Q7MA 3QQWA 4BY3A 4E3TA 3OBAA 3Q37A 3WLSA 2W91A 1GHSA 5A6JA 4HMCA 4JXCA 3CUFA 3NL5A 4ADSA 1MFVA 3M0IA 2J9ZA 4NASA 3SUSA 4MWAA 4J28A 3CIWA 5LNSA 1GGOA 4JL2A 3SCTA 4D72A 3CV7A 3WX7A 1G67A 3V35A 1HG3A 1JUKA 4S3GA 1RQHA 3IWPA 2DDXA 5BU6A 1CLVA 7CGTA 5FAGA 3EYPA 1A5CA 3FJLA 7A3HA 5FJTA 3CQJA 1XYZA 2JF7A 4XQ6A 2FQIA 4NILA 1TWSA 2D22A 3B4UA 3CNYA 4Z0JA 2C13A 1CGWA 2CLHA 4P8UA 1US2A 3MCMA 4EIVA 1LORA 1XLCA 4ZOAA 2NUYA 2QUVA 2FZBA 3ZLFA 2CCRA 4RE4A 2E1WA 1WUFA 1BVWA 3CTTA 8A3HA 2POTA 4FR1A 3QYQA 1W5QA 4B2DA 1QHZA 3PC0A 4JIEA 5LA2A 4M0XA 2DUAA 4Y90A 4QG8A 1CGTA 1GVRA 3BGAA 4NYUA 1FFQA 1TV2A 1VJZA 1GQNA 3C0LA 1XLIA 4MY8A 4EACA 5U4NA 5J5DA 5KITA 4AW7A 3AU6A 2RDWA 1QHPA 1XGDA 2VX5A 4AWSA 3WBXA 1RA5A 3NQDA 2R82A 4N4QA 4ZE5A 4PMUA 4LRSA 5C7HA 2UV8G 3TFCA 2Z26A 1NELA 5JVLA 4IFOA 2EQDA 1KM4A 3H2EA 3RIKA 3VIPA 2ZZ2A 4XZLX 2J25A 3LK6A 3ATYA 1GKQA 2X0HA 3F4WA 4TX9A 2ZE3A 4KGJA 2F38A 1UPPA 3W1QA 4L7ZA 2EHHA 5I09A 3L21A 3A4WA 1QPRA 2WC7A 4AZ5A 4NNBA 4K68A 4CN6A 3N13A 4KF1A 4HK6A 1OG6A 3R43A 3OHIA 3M0LA 2XZ7A 3QR1A 4GUIA 1GTHA 4CCZA 1MMFA 3U5YA 4PCTA 3B97A 3XIMA 2VEFA 3NL2A 4DJFA 4CNUA 2GOKA 3W53A 3FVDA 6TAAA 3NZGA 5XINA 3AHZA 4WXZA 5TF0A 3W7JA 1L0PA 4BF9A 2CESA 4CCCA 3OLDA 2OELA 5B7YA 3CWHA 3RCMA 5DT5A 1SJDA 4B5WA 4HHLA 1FCVA 1YPIA 2XH7A 4QJ1A 3EX2A 1UD5A 4DI8A 4UFLA 2QUUA 4O28A 3WUGA 1FWTA 3UR8A 5FEZA 1EHAA 2VZSA 2ZXBA 2VCBA 1B31A 1FCUA 5D32A 1QXLA 3UCCA 3E0VA 1O66A 1UC5A 2FVLA 3GXTA 5D30A 5F2IA 3QHMA 2D2GA 4ALDA 2VR5A 4XAPA 2R1KA 1NWUA 3IUIA 2QV5A 2TPSA 2WCGA 1YTKA 2JKEA 4GYPA 4PULA 1RJPA 3NGFA 5JBFA 3U2OA 3RHGA 1J93A 3E2RA 3LYEA 2YDRA 3BJFA 4Y8FA 2RDTA 4WDWA 3GXDA 5D2YA 4KMQA 1POKA 2WCSA 4JCMA 3IUDA 3USBA 4JNZA 3QXBA 2B81A 3C0JA 3IK4A 1S3TC 3C5QA 4JNYA 2B0MA 4WDXA 4A3YA 3SSZA 3GXPA 5FIPA 2B7NA 4C7DA 2GUYA 2VC7A 3HPFA 1EQCA 1ZBVA 3F5JA 1M03A 4PB4A 2NUXA 4J5NA 3AIWA 2QCNA 4S3CA 3BW4A 3W1RA 4GPNA 1KBIA 2EKCA 2WMIB 1UBSA 2V5BA 4ML9A 4N9BA 4Q32A 1ZAJA 3BG9A 2P0OA 3IACA 2BGQA 3TU9A 3BGJA 2E6FA 2CWNA 3FA3A 4EAMA 3G1RA 4W8AA 1XLJA 5AY7A 3FGCB 3RXZA 1RY8A 5D8WA 3KOFA 5DANA 1S5VA 3GTXA 4A29A 1VFOA 4IP5A 2FH8A 3IAPA 1WB0A 3AXXA 3C56A 3W37A 5FOOA 4IQJA 3H2NA 4UFJA 1UR9A 1EJSC 5A69A 1A3HA 3VIHA 3VD9A 4LUSA 3UZJA 4NYYA 2ACUA 3WD4A 2L5HA 2Z7KA 3DHPA 4GISA 5E5CA 3RLHA 1ZBWA 4GIYA 1IXOA 4ZL1A 1TZ7A 1PIGA 1C90A 3ABQA 4HA4A 3PTQA 1TJRA 4IMEA 2VX4A 2HNEA 3EA1A 2IKIA 5HJLA 1W56A 5RUBA 1PX4A 3CGTA 3LPGA 3SQSA 1XLLA 1ZAHA 5EBAA 4H8HA 3VOJA 1WDWA 3QMRA 4U3CA 5REQB 2ZUTA 2QGHA 3C2EA 1JPHA 2WO5A 3PJWA 5A2AA 5KTLA 5HK4A 3SFWA 1CEOA 1FCBA 3BPWA 2PBOA 4DWSA 2WV8A 1WE5A 3B06A 4QM1A 4B3ZA 3AISA 1W1IE 4TMCA 1EA9C 4HNVA 5HDRA 3WD3A 3OIHA 4JTTA 4PMVA 3FEMA 2VM8A 4GH3A 4ZEPA 1XRTA 1OFAA 4H6EA 3BCJA 5AYYA 1QHOA 1RZMA 3M64A 4DUVA 4C6FA 2RDXA 4F3HA 3AZSA 4H9XA 4Q8UA 3PY2A 3NO5A 5M5DA 2W79A 3W1AA 4N9DA 1PKLA 3SAZA 3E96A 4S3KA 3QTGA 3NPXA 2WWDA 3BCFA 1QNOA 3PG9A 2PWDA 5CZJA 1LOQA 2C1HA 1DHKA 3MMUA 5AYBA 3UVAA 5D38A 3V0UA 4B90A 1TIMA 2EJAA 2Y89A 2OG9A 3W3OA 3P0XA 4PMDA 4MIMA 1L6GA 4H1ZA 1VJIA 2G96A 3KS5A 4R33A 4CD7A 3N14A 2UWFA 3H6OA 5DO8A 1CLXA 3IARA 2NVCA 3NDZA 1HF6A 1FQ0A 2Y24A 4V1YA 7PTDA 1W9VA 1KCXA 1KKOA 1HJWA 4IISA 4NXSA 3W6MA 4CQBA 1IXQA 3QPYA 3W24A 1QK2A 1J11A 1PL9A 3UWYA 3LCGA 2Y8KA 1ZRQA 3TR9A 4CVWA 3K1GA 4S39A 4JTIA 2WVTA 3A24A 3GVGA 2PUZA 1V79A 4JTAA 4HT3A 4A2RA 3MW7A 1WXYA 4GNVA 1XBXA 4GC3A 3MMDA 1DORA 3AYRA 4C6PA 4L4PA 1TQJA 2XH0A 4WKAA 1P0KA 3BK0A 4HSHA 4F66A 4M7TA 4LC8A 4UCGA 3TP4A 3W28A 4PMNA 4C1NB 2F9RA 3E6EA 3TCSA 2X1UA 4HU0A 1TA3B 2YX0A 1IZJA 3WMCA 1SZEA 5E0KA 2R1MA 1WV2A 3GK0A 4LOCA 4US6A 3ITGA 3KVJA 2NQZA 3FHQA 3MVTA 4TMBA 5ABGA 2BG5A 4IJCA 4LYKA 3IK2A 3GUWA 1CT5A 2QCEA 5KSWA 3PN8A 1SO6A 5BYWA 1VLIA 3APTA 4MYXA 2TYSA 1KLYA 4UFMA 1WZKA 1W5OA 1EX1A 1FY6A 4G1NA 1UWRA 1NWTA 1A49A 1IXPA 1WUEA 4GYFA 3U7BA 3W1LA 4J2MA 3QTPA 1IT0A 2GWGA 1Q6RA 4DIAA 2YYTA 5D05A 2QJMA 3W86A 1V02A 4Y7EA 3WNKA 1E0VA 3L5MA 4PTVA 4RJEA 3B4YA 4AZCB 2GK1B 3DFSA 1DWGM 1OF8A 3O16A 4REQA 4RW3A 3WYZA 1UR3M 1TR9A 1MEHA 3EWYA 3JS3A 4WY0F 2V5KA 1XG3A 3CZEA 1EYWA 2X1IA 2P1FA 4GY1A 2OU4A 5F7UA 4AD2A 4YMZA 2QQ6A 3FDKA 4MZYA 2HK1A 1MUCA 2DQXA 4FHAA 2QR6A 3P67A 1XKJA 4EK7A 1DE6A 5LZLA 2XN1A 1K8CA 2ZE0A 4C6LA 1SZFA 1SFTA 3FAXA 2Q3OA 1HQTA 3KLKA 2D69A 3KOXA 3LPOA 2CXEA 3B40A 2J78A 1QR7A 3FAWA 3TMLA 1B4KA 1X97A 4O1DA 4S3DA 3O15A 3W2LA 4IHCA 1I1WA 4QAIA 3L2IA 3SZ8A 5D4YA 1XRSA 3ZYZA 1VFTA 3VNJA 3F2CA 4JFWA 4R85A 1X98A 4CNOA 4OU1A 2X2GA 3NVDA 3KWSA 1DWFM 2CLLA 3AROA 3Q2DA 4AD3A 3M0MA 5HNTA 5A8NA