3LI1A

Crystal structure of the mutant i218a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGAIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3li1A00
4LRTA 5H91A 3DFNA 5DLCA 1KLYA 2A21A 4GUFA 5HR7A 4DXVA 3GDKA 1XFBA 4CQ8A 1EP3A 3W7NA 3UNDA 1FCQA 2PE4A 2RDWA 1DV7A 1Z44A 4YCOA 1G4PA 3G8RA 4UFMA 1QO5A 2VEPA 2YDAA 4O19A 1VGAA 4MOZA 1DBTA 1FWWA 1SW3A 2C3ZA 2YYTA 3MWAA 5G1TA 4GRSA 3GDRA 3TFCA 4ML9A 3FEMA 5A8GA 4PH6A 4LVFA 4K7YA 4BR1A 1MEIA 3F4WA 1HFBA 1I2RA 3V1PA 2HMCA 2CLKA 3MBFA 1ZFJA 2Y63A 2OMAA 4NQ1A 2VC6A 2QDHA 3NDOA 3O05A 1XUUA 2V82A 1BWLA 1GG0A 4O4WA 1TB3A 5E0KA 3M7WA 3TE9A 4FEZA 1LBFA 1KTNA 3VCRA 5CG7A 4UNKA 4FNRA 3OHIA 4CCDA 1B4KA 2V2CA 4O15A 5EMUA 2ZZ6A 4UTKA 5HULA 3QW4B 3N3MA 1KTCA 2E09A 1KM4A 5A5WA 2V5LA 4LS2A 5TBOA 2ZRXA 3W7HA 4DBDA 1LLZA 3TC6A 1KM2A 2QJIA 4PEKA 1AK5A 1LM1A 5FEWA 1L6WA 3DHFA 3QPZA 4N4PA 4HPXA 1TV5A 1YLVA 4OBTA 5G2HA 4JIQA 3NA8A 4FNUA 5FI8A 1SZFA 3B05A 1GVRA 3PB2A 1DQXA 4KFPA 4IMCA 3G0UA 3QMTA 2FQIA 2G96A 2QCDB 4N6EA 3BW3A 2WO5A 4JIPA 4IWWA 4EF8A 1OX5A 2V30A 3IEBA 3LHUA 5U7SA 2P0OA 4QITA 3O1NA 3HGJA 3EX2A 3EWZA 3RMJA 1QAPA 3VFLA 2ZRUA 5AYZA 3L0NA 4N9CA 3P82A 3C6CA 1O5KA 2NUWA 3NQCA 4L4MA 1FUYA 1ZAHA 3TNOA 2E6YA 1GVOA 2PRHA 2Y7DA 1W5PA 4QJ1A 4M5PA 4O1BA 3M0ZA 1IXOA 1VLWA 3NPUA 2CFFA 4AHOA 4UXDA 3NQ6A 1GYNA 3I68A 3AO0A 2GUUA 3I7SA 1A53A 4IMGA 5FF0A 3DBPA 3ZS4A 3DFOA 3C3NA 3P5ZA 1EPXA 3N14A 1O5XA 2X2GA 5DCDA 4NZFA 2GVJA 4IX0A 3W7IA 4YL2A 4MIMA 3L2IA 2GJNA 2FFCA 3S5YA 4FX8A 3H53A 3BW2A 4FIRA 2H3BA 4J9JA 4LVGA 1LDCA 1Q6LA 2NUYA 3GDLA 3IIOA 2B7OA 3EWXA 1WOAA 3W1RA 1IIGA 3W2UA 3F03K 5LNRA 1WDWA 4ZMGA 1DKWA 4O8RA 3B8DA 3UZJA 2YPIA 3CWOX 3CB8A 3LRKA 1TYGA 4PL1A 4UR7A 1AW2A 1VPXA 1E51A 4WY0F 4RZ6A 5LGZA 4LOCA 2Z0IA 2RHGA 3GZ3A 1L2UA 1P4CA 3CEPA 5EL1A 2QCGA 1QPNA 5AHIA 3CHVA 3GLCA 2V81A 3O8AA 1FDZA 1LRQA 3C2FA 2J6XA 4ZQRA 5HMSA 5EBUA 3DU0A 3EXTA 1ICQA 4E38A 1OX4B 1OFAA 4UTHA 4IPIA 1TQJA 2A85A 2A5HA 4QISA 3KRZA 4OT7A 4NX0A 2JBMA 2YX0A 4ADUA 3G1YA 1TTPA 1XBYA 3S42A 4FNQA 4UMBA 1WAUA 1B3OA 2W6RA 3PWAA 1OYCA 4DO5A 3NPVA 1GZGA 1ADOA 1G69A 3L0GA 2RFGA 2BTMA 3PVFA 5AFDA 2QEZA 4RZ5A 4BFAA 3BV4A 5I3GA 5F2IA 5D37A 1SZNA 4FHAA 5G2WA 3SY5A 1F7BA 3JS3A 5KZMA 5LSMA 4FNTA 1I2QA 4R53A 2VFIA 2RH9A 1H63A 1GTHA 3NQ2A 4JNMA 5HR6A 3FS2A 3O16A 4DELA 5F2LA 1K7XA 1OJXA 4O1DA 1U83A 5HQEA 5F1UA 3PBYA 4GUHA 2IQTA 2GQ9A 3PUEA 4GWEA 1MEWA 3I65A 1L6YA 5D32A 1FDYA 1YXCA 2WSRA 3OEXA 3KRUA 3KVJA 4CQAA 3S5OA 3UYCA 2NWSA 1GWJA 4XBSA 3MYOA 5DCEA 2WJZA 2CZFA 1TPUA 5TQLA 2RDUA 3PULA 1WYIA 2O7SA 2ABBA 1AL7A 4O14A 5F1VA 4JICA 4IXXA 3S1VA 2QCCA 1EEPA 3PG9A 3RF9A 5D33A 3C56A 5DXYA 1FCBA 1KBJA 4JD4A 3CC1A 2A7RA 3W2LA 3MBDA 4FNSA 3VKJA 2XN2A 1GG1A 3NQAA 1F6PA 3ABQA 2VENA 3NZRA 1EX5A 2GQAA 4EVZA 4MZ1A 5CGQA 3CM4A 1T8XA 3W22A 1R2RA 4P2VA 3THAA 1LROA 3ABRA 3GVGA 1S5TA 1TPC1 4LV4A 3RFAA 3LX9A 4HNVA 2X1RA 3A5VA 5LKYA 3LDVA 3L5MA 1G6CA 1QCWA 5G2IA 4UC5A 3TDFA 2V8ZA 1QPOA 3LCGA 2B0MA 2NWRA 2JGYA 5DXXA 2NX3A 1OF8A 4TX9A 4H4IA 2WOQA 5FEPA 2QAPA 4CNOA 3W7MA 4JS3A 4UTUA 1GEQA 3UWQA 5I3HA 1KM1A 1OFDA 4MUZA 5HINA 4RLIA 3N9RA 2ZTJA 5E1QA 1S3HA 1GTEA 3W7QA 3NAVA 3ZWTA 2WQPA 4JTEA 1PV8A 3SR7A 1N7KA 3F4NA 3W1UA 3PAJA 3TW7A 4DO4A 5C6MA 4MJMA 4OHQA 3STCA 3KOFA 1HG3A 3PBVA 4XQ6A 3G0XA 2BLEA 3P7YA 3C2EA 5K2ZA 3H54A 2Y89A 4NXSA 4OV9A 3W7KA 2V5BA 3MP3A 3DAQA 4O52A 4O57A 1W31A 3PM6A 4UFLA 2WSYA 4FX7A 2B7NA 4AHPA 5C54A 2QR6A 3EB2A 1VCGA 3M6YA 3YPIA 4JX4A 3Q58A 3KVLA 1QPQA 2GVLA 1OG0A 5AHEA 1IXNA 1KFEA 4DBEA 1HO1A 2VFHA 1V5XA 3ABOA 3DFSA 1O4UA 4Y90A 3HPSA 4WOQA 1WQ5A 5CZSA 3CLMA 7TIMA 1V7YA 4K6AA 3EXSA 3SW6A 4TMBA 1G67A 3PB0A 3BG3A 3TSBA 1D3HA 3A24A 3CEUA 4IGHA 4JDBA 4NXKA 1KFCA 3M5VA 3RNDA 2C0AA 3UWUA 3KVKA 3P67A 4AMAA 3S6DA 2DZUA 3SFKA 5K9CA 1YTKA 5D2YA 1IXPA 2R8WA 3GK0A 5F2GA 3LXCA 3O63A 4Y8FA 1XC4A 1O95A 5HWNA 3SIZA 5G5IA 2H3DA 1WBHA 3PY2A 3N73A 1B9BA 1RR2A 1VH7A 2BXVA 3TMQA 4NVTA 4O1AA 4WD0A 3RK8A 1VHCA 5EY5A 4C1LA 1O60A 3GKFA 3W2NA 1F2JA 1R30A 3OVQA 1FXPA 5DY2A 1TPFA 2HS8A 1OFRA 2X1TA 4O0KA 3A22A 3W7RA 2OT1A 3EKLA 2CZDA 1LLWA 5HNRA 1YADA 1A50A 1WBJA 3LI0A 4LTSA 1UUOA 4LVDA 3G18A 3TJLA 3HPXA 4O53A 3W23A 1S5WA 5AYXA 4E2BA 2GVGA 2YR1A 3M47A 2QCEA 4IXHA 5TIMA 4MLJA 4NU7A 4WXYA 3QSTA 2PRLA 3PS7A 2RDTA 4X22A 4K37A 2WPBA 5BMXA 1JRBA 3HGRA 4K38A 4N9EA 4PC8A 4UTWA 1TSIA 3IIXA 3MI6A 3B03A 3P80A 4JYEA 2GPTA 3VE9A 1OFQA 1C9DA 1DJQA 3IRDA 3KHJA 2C16A 2R91A 3TXVA 3MMTA 1TTQA 1HUVA 3Q2DA 1ZJIA 1P1XA 2E1DA 4N2YA 2G95A 2B7PA 3HIJA 3BARA 2OJPA 3QQ1A 5K9XA 3W70A 3WJZA 5KINA 5KSWA 3HG2A 3KVMA 3INPA 4DPQA 3FYOA 1H7RA 2ZRYA 4GUJA 2FDSA 1FY6A 5BRBA 4ICNA 3GB6A 4I7UA 2ZA3A 3PC0A 4M7TA 5J5DA 3GX9A 1RQHA 5BW6A 1JCLA 5D30A 5U4NA 1VRDA 1YTEA 1A5AA 4I7WA 1SQ7A 3SGUA 1Z41A 3HGOA 2ZRWA 1BTMA 4O28A 2R94A 1QOQA 1JUEA 5D2TA 1D3GA 3W84A 3P5YA 4OV4A 1H61A 1GYLA 2Y7EA 3HG3A 3FIGA 3ATZA 5DBTA 1VQTA 1XKYA 3TH6A 6ALDA 3B0PA 1TREA 3WK1A 1KM3A 2UV8G 4N4QA 1ALDA 3LXBA 4GE8A 2DZTA 1VJIA 3W87A 1GT8A 2FLIA 3EWYA 1EP1A 4DO6A 2HSAA 4NNBA 3T44A 3W1LA 4KFNA 3W07A 3W83A 1GVFA 3DFQA 3P61A 1JCJA 1VYPX 3LERA 5BOOA 3BGJA 4OGZA 5AC7A 3G24A 4NJHA 2DJLA 3P74A 5D02A 3GAKA 4PL2A 2FPYA 1O94A 3BVJA 1G7UA 1FBAA 4XKYB 3P62A 3G1VA 3LHWA 3TAOA 2NZLA 1YDOA 4UTMA 2Y7FA 2JKPA 4FX6M 3DGRA 2A7PA 2GQ8A 3W2MA 2Y85A 5F4SA 1SU5A 3W1AA 4CNPA 2QCFA 2YXGA 4CNNA 3STGA 3TKFA 1TIMA 3OVRA 3B0UX 1K8YA 2ZA1A 3TW6A 2O7QA 3N34A 1HTIA 4GNJA 1TV7A 3ABSA 4RZ4A 3MW7A 1TO3A 4HNUA 3QM3A 3NZ1A 1JVNA 2G5WA 3Q37A 1LBMA 4JTJA 2ZZ4A 3U2OA 1KM6A 1SFJA 2Z6IA 3NEVA 3DHDA 2PURA 3LCHA 4JEQA 5G1YA 2CLEA 2XFWA 1C8VA 3IIPA 4CCEA 4DF2A 1DVJA 4RV8A 1JULA 3NL5A 3PBWA 4YCPA 3TC7A 1GOXA 1ME9A 1JCYA 1X1OA 2JK2A 3HQ1A 3DI0A 3R13A 3QH2A 4WY0A 4BWLC 4LT9A 1VC4A 2DP3A 3TSDA 3BLEA 1MEHA 3GR8A 4JTIA 4FB7A 4CQ9A 4WXZA 3G3MA 2X30A 4AF0A 4EIVA 4ALDA 3LGEA 5FEZA 1J5TA 2LLEA 1RQEA 1EWEA 1DHPA 3KXQA 1ZENA 3QSRA 4Z1CA 2DZXA 3FFSA 4O13A 3TR2A 1KW1A 4NUWA 4RR4A 2EAWA 2XN1A 3A9IA 2NLIA 3NQFA 3ZFHA 1F74A 2DZPA 4Z08A 4JYFA 4XUGA 5F4WA 3GDTA 2DZVA 1NF0A 3MYPA 4IX2A 2CLFA 5EPDA 3T55A 2EHHA 3MO7A 4LS0A 2NXIA 5K9DA 5EKYA 4ZVJA 2C15A 4E0CA 3SZ8A 2F84A 3LM7A 4RKAA 1H7PA 4X3ZA 1GPWA 5CPOA 3HGSA 4ZQMA 3SI9A 4PCFA 3B0VC 3HF3A 4JY8A 2FPVA 3T40A 4N9BA 5HUPA 4ORIA 4HKPA 3LLFA 3QEZA 4EWND 1W1ZA 2C6QA 3G3DA 4MFDA 1EA0A 4O17A 3CQ0A 1OFOA 1WOBA 4JXCA 1DJNA 3BG5A 1W8SA 1AW5A 4WUIA 4E2DA 1KTBA 4ZQOA 1EP2A 1RZMA 5IM51 2ZTKA 1VLIA 3GXTA 1QWGA 3P81A 2E77A 2A6LA 3G22A 4MZYA 1OABA 2YZRA 3MHFA 4S1FA 1QFEA 1EWDA 1WXJA 3TIMA 3IGXA 2OCZA 2D73A 3NQ8A 4XZ9A 2FB2A 3MUXA 4PA8A 3NL6A 2NV1A 4GXMA 4TMCA 2E68A 3O07A 1HL2A 4A22A 3LHZA 2H8XA 4HNTA 3OBKA 3FKKA 2J27A 1IGSA 3E12A 3QFEA 1F6KA 5LHFA 3AJXA 4O1CA 1AMKA 3E96A 3UY7A 5LHEA 2YYUA 4HPJA 2JKAA 1K03A 2NX1A 1FWNA 3W7OA 4AWTA 4O16A 4A2RA 4ZQPA 3GXPA 1W5OA 4XBKA 4DPPA 1FWSA 3G1SA 5L9FA 3SGZA 5CPNA 5CKSA 1BEUA 2X16A 4JR5A 3LTPA 3M9YA 4LU0A 1JCMP 5D05A 1MXSA 2ZZ5A 4A21A 3TX9A 1OHLA 1MZHA 5I3JA 5J5RA 3WK3A 5K4ZA 1LP6A 3OVPA 5HJLA 3L67A 3B06A 1FXQA 5AC6A 5FEXA 2ISVA 1NVMA 1AG1O 3WJXA 3DI1A 4LC8A 2Y6ZA 3L9CA 4YXGA 3L5AA 1QO2A 5IBXA 2QCHA 2Z2UA 1Z48A 5AHLA 3HMJG 1KFLA 1J4EA 2WNZA 1P5BA 2ZFAA 1SUXA 1PE1A 2NV2A 2Q3OA 4CCCA 2Y88A 1G4TA 4JTTA 3QRHA 3OIXA 3N2MA 4EF9A 3S0CA 1WV2A 2E6FA 3G1XA 2J9YA 4XTIA 3NYZA 4C1KA 5D2VA 3P8JA 2ABAA 2EGZA 3L68A 2BZNA 3B4UA 4P61A 5CSSA 2AAMA 4Z0SA 4K36A 2QJHA 1LBLA 2HTMA 5AN7A 1QR7A 3WK2A 1G4SA 2NXGA 4OWGA 2PC4A 5C5YA 2VOMA 2B4GA 5AHNA 2ATSA 2ZBTA 4UNLA 3I6RA 1XBXA 5SWUA 1XBVA 2F7FA 1UJPA 1VHNA 1PCKA 4H6KA 3G1DA 3O6CA 2DU2A 1SR9A 1Z42A 2X1UA 4O12A 1F05A 1UBSA 1X8FA 3EX1A 1KBIA 1KFJA 4NX5A 4YWIA 4Y9AA 5G4WA 3RU6A 1YDVA 4GFSA 4I9AA 4U28A 3S5ZA 1VZWA 3U8GA 4JX6A 5H2ZA 4AB4A 1I4NA 2AGKA 3GDMA 4UIOA 3WJYA 3DKLA 1YYAA 4YMZA 4IMEA 4JTSA 4LV9A 4A2SA 1YXYA 3O06A 3T78A 3QMSA 1SO6A 4L4LA 1QMLA 3TQ0A 3LHTA 3UY8A 3HO8A 4UFHA 3MJYA 1VS1A 1OVDA 1W3TA 3K30A 3MI3A 1BWKA 4NJIA 3USBA 3R8RA 4WX2A 1FX6A 3BO9A 1GJPA 2VELA 2OZ0A 5D04C 3NVTA 2ZCGA 4MY9A 3IGSA 2ZQ0A 3BLFA 3RLVA 1KM0A 4RXGA 3UPWA 3QYQA 2JGQA 3MHGA 2WKJA 1P0NA 1SPQA 4GUIA 3LXAA 3GR7A 4FXSA 1OFBA 1JRCA 1TV8A 1K3UA 2E5BA 3BGGA 1LYXA 3C61A 1YPFA 3M43A 3NQVA 1DOSA 3IGUA 1L6SA 1KV8A 2OX1A 4GBUA 3W6YA 2BWGA 2VFFA 4LVBA 4GC4A 4HNNA 1TJRA 2QUVA 1JQXA 2ZYFA 3TCEA 4UTTA 4LW7A 6TIMA 1KFBA 3LV6A 3W7JA 3S1XA 1XDMA 1IF2A 1T96A 4FF7A 5D2WA 2FPTA 2E6AA 5L6UA 2ISWA 4UTWC 1RV8A 5AOUA 3E02A 3KAOA 2ATMA 3M5YA 3EKZA 3TA6A 4O11A 2QJGA 3ZR4A 3UXDA 3UWVA 4R7JA 2C19A 3W74A 3CPRA 3W3OA 4HSNA 1T99A 1A5CA 1H51A 4EOUA 4PTNA 3M16A 3C52A 5FF3A 4NT0A 1R2TA 2QCLA 5HWJA 3UXAA 3HG5A 2CZEA 5K7JA 1YTDA 3THQA 2VEIA 5DELA 4O0ZA 3I7QA 2WNNA 1RPXA 2I14A 1H50A 2YGYA 3EWBX 1FWRA 2CLMA 2DZWA 1Q6OA 2P1FA 4FO4A 3EXRA 1H1ZA 3LV5A 3MP5A 1XUZA 2E6DA 4JDYA 1JUBA 4BF9A 3TQVA 1TPDA 3C2RA 3NQGA 2CW6A 2XN0A 3C8FA 3PG8A 3I7RA 2NX9A 5DCBA 2NXHA 1P0KA 3W2JA 4K8HA 2Q8ZA 3KRSA 1THFD 1ZAIA 2CZ5A 2Y61A 2ZZ2A 2I9EA 1OF6A 3G1HA 2YFOA 5D09A 3LI1A 4W9TA 3S5NA 1QOPA 1W56A 2FJKA 3EWWA 1M6JA 4MY1A 1S5VA 1SO4A 2H90A 5DY3A 4BI7A 1SO3A 1A5BA 4JN6A 4LRSA 3CIWA 3MI2A 3VE7A 3CWNA 2FIQA 2C13A 4BI5A 3FOKA 2E5DA 2BSLA 3WJSA 1FCVA 1R47A 3LRLA 5KITA 3S9YA 2Y62A 2QCDA 1PS9A 4M19A 4D2JA 3R5EA 5MHBA 2ZZ3A 1H7XA 3C0JA 1LORA 2TSYA 2YFNA 3TXZA 4UCGA 2CLHA 3CIXA 5LNUA 3L5LA 4ADSA 4Y96A 3KX6A 4AXKA 1X7FA 4IUOA 3S1WA 3NM1A 2ZDRA 3FJ6A 1R2SA 4FXRA 2W79A 3E9AA 3W76A 3NO5A 3KFTA 3UZ5A 3W1MA 2EPHA 4QM1A 3LCWA 1X1ZA 2EF9A 3T7VA 1KM5A 5FF2A 1XI3A 1ICPA 4UTIA 1SZGA 3EEGA 1I8JA 2FB3A 1TRDA 5KZDA 3W9ZA 3LHYA 1LRNA 1C29A 4POCA 5ABTA 2J88A 1JQVA 3BPWA 3NQMA 4QNWA 3W7GA 1XCFA 1UB3A 1TMHA 5LGXA 3GAYA 5HWMA 4O54A 3O15A 4WZHA 1QNVA 4XWUA 2YCEA 2Z1BA 1W5NA 3GKAA 4IOTA 4BI6A 3TSMA 3TUUA 1BKSA 1D9EA 1RD5A 2C14A 1TJPA 5FF7A 3TV8A 3L0KA 4Z1DA 3W86A 1SW7A 3NPWA 5AHFA 1B4EA 4OE7A 4UTLA 3NG3A 4X2RA 4MYAA 1JUKA 4ZQNA 1JJKA 4HIBA 1RQBA 1G7VA 1TTJA 2WSQA 4A29A 3S1UA 3CU2A 3N19B 1WX0A 3BW4A 3UD6A 1OYBA 3W1QA 4NZJA 4UFKA 4ZZ9A 4R34A 1KV5A 3HPZA 1SSDA 3S8HA 5AB3A 3ANYA 1WA3A 2ZRZA 3LHVA 1PHWA 3GYEA 1TQXA 3LCFA 2Q3RA 3PUDA 2PCQA 3LB0A 5K3VA 1I2OA 3FJLA 4LWWA 1HO4A 3LCXA 1ML1A 3NR0A 1OX4A 5EA9A 3G1FA 4AWUA 4QAIA 3UWZA 5DBUA 1PCWA 4KFOA 5BMWA 1ZNNA 1W5QA 2ALDA 2VFEA 4H3DA 1SW0A 4MJZA 4QIUA 3M41A 1H7WA 2Y7GA 3W1XA 3NOEA 3QJAA 5CZ0A 4X9SA 2AQWA 2R14A 1LOLA 1NFBA 3W1TA 3DXIA 3LBMA 4FIQA 3WK0A 1K8ZA 3GNNA 1ZALA 1A5SA 4IQLA 1L9WA 4IPJA 4IMDA 1LRTA 1N8FA 1I45A 3SECA 3NQEA 4ADTA 3L21A 1UUMA 1JR1A 5LZLA 1LOSA 4BWLA 3PUOA 4HN4A 3PBUA 1CW2A 1K7FA 1PIIA 1Q3NA 3HG4A 1G4EA 3ZWSA 3NL3A 3LLDA 4KWVA 4ORMA 3BLIA 1YDNA 4RJEA 5EYWA 3W71A 1H5YA 1ZCOA 4O10A 2V9DA 2VXNA 2CWNA 5C55A 3E49A 1H7OA 4JTHA 4GJ1A 3NM3A 4FNPA 2QUTA 3HJZA 3PF3A 3QMRA 5CSRA 1QDSA 3P84A 4JGDA 4B5NA 5E93A 4M7SA 2PRMA 3QF0A 3STEA 1OK6A 3GNDA 4MVAA 1TPVA 4WOZA 4WY0B 4UR8A 3L65A 1CI1A 1ZAJA 3W1NA 4LS1A 5AC8A 3M44A 4HHPA 4N9DA 1MSSA 4QNEA 3NQ7A 4K7VA 1W0MA 1VR6A 4AF0B 3W75A 3QC3A 4MY8A 3TAKA 1F73A 3O6DA 1TPWA 3UQNA 2ZRVA 3B04A 1XM3A 5CPMA 1OFEA 1TRIA 1XDLA 4RCXA 1VCVA 2QDGA 2A6NA 1IIHA 4UTJA 3C2OA 3W7CA 1FDJA 4TR9A 5AYYA 4Z1AA 4M6VA 2QCNA 3FLUA 4ZL1A 1ZY9A 4JTLA 3DH7A 5HUOA 2QF7A 4LUIA 2J9ZA 4NJJA 1SSGA 4UFIA 3TFXA 1KFKA 3TQKA 3IVTA 1EUAA 4TU1A 1M5WA 5K4XA 2TMDA 3JR2A 3W73A 1YXDA 4GUGA 2RKXA 4JTFA 3QPYA 4Q33A 3D0CA 3UWYA 1AL8A 3LCIA 3PSWA 5F4XA 2E5CA 1M7PA 1K7EA 3EX3A 4O4VA 5IBXC 1F76A 4XTDA 2QAFA 2ZA2A 1J2WA 1DORA 5KZEA 1N55A 1OFPA 2Q8LA 4LC6A 1UCWA 3W7LA 4AVFA 4MFEA 2DORA 3H55A 3N2XA 3NQDA 4R33A 4AHQA 4QSHA 4Q32A 1EUNA 2FTPA 3CT7A 5KTLA 4JTGA 3W85A 1X6UA 4JYDA 1Y0EA 2DZSA 3G8EA 2YW3A 4AWSA 3U6WA 5BNKA 1K8XA 3V75A 2A0NA 1I2PA 3A21A 1OK4A 2VEKA 3NPXA 3DZ1A 5KMYA 2KZHA 1T0OA 3M5ZA 2WNQA 3LTYA 2TPSA 5F2MA 5D2XA 3MP4A 1U5JA 4QQ3A 3EX4A 2W0UA 4TIMA 4JX5A 1ZHAA 3IV3A 3M5XA 3O6YX 4UMCA 4AH7A 3STFA 4NJKA 3R12A 2X1SA 4O50A 1PL9A 4LY8A 1ME8A 5FESA 3FYPA 3LCLA 4LUJA 1R46A 4TO8A 5I3KA 3HOJA 1OYAA 3TROA 1IXQA 1KLZA 3HBLA 4AAJA 4Z0JA 3P60A 3GIYA 4JY9A 1W37A 3E0IA 2P10A 1YPIA 3UWWA 3QQ0A 2ISSA 4IMFA 4DQWA 1GVSA 8TIMA 2Y70A 1DL3A 5D03A 3NGJA 3LTSA 4HT3A 2GOUA 3P8IA 3A5FA 3LRMA 5CPLA 1RVGA 1DQWA 3N9SA 3GXNA 4IJBA 5DN1A 3SJ3A 4U4MA 5FF4A 2GJLA 3TMLA 1JCNA 2B7QA 3L66A 3M1ZA 2A4AA 5D38A 4LVAA 2BX7A 1LCOA 2TRSA 3ATYA 3Q94A 3IVSA 5C2XA 1GVQA 3C4UA 2J24A 3NXFA 4KWWA 1EIXA 2H8ZA 3FKRA 4ONVA 1SFLA 3SSJA 3IIVA 4HSOA 4Z1BA 1UASA 3JRKA 1NF7A 1H1YA 4S2CA 2VEMA 1NAL1 1K02A 2I1OA 1FCUA 3BK0A 5I3IA 3NNTA 2CLOA 4NNAA 1VYSX 1SO5A 1Q45A 3DFTA 2V2DA 4DF1A 2JKEA 1H60A 3EX6A 2DJXA 1VYRA 1Q6QA 4N02A 2Z6JA 4UUIA 4PODA 1XBZA 4MLRA 1MO0A 3TJXA 3W2KA 2VKZG 3PSVA 4Y6GA 3QW3A 3LOTA 3TK7A 1NEYA 2QKFA 3A23A 2V0TA 2HS6A 4RX0A 3WJWA 3OG3A 3BG9A 4MPQA 4M6QA 4MKNA 4LNYA 4UTTC 1TPB1 4WQ6A 1M7OA 2EKCA 2A2IA 1EB3A 3EWUA 1KA9F 1W3IA 3R2GA 1FWTA 3IVUA 4UFJA 2TYSA 2J9XA 3T4CA 1W5MA 1NSJA 2CLIA 1ME7A 4WJEA 4K8EA 1FQ0A 3W1PA 2G97A 1TCDA 4I7VA 1H7NA 3VNDA 3TU9A 4PFMA 1W3NA 4KKXA 3W7DA 4AEOA 2V2HA 5LNSA 1TTIA 1LOQA 4M6PA 5I3FA 4Q4KA 2QCMA 2QUUA 3G1AA 3RLUA 5G4EA 1TPEA 3VI2A 1ONRA 1H62A 2ZZ7A 3W7EA 1VCFA 2WV8A 5GVJA 3W72A 1OX6A 1AW1A 4NJGA 4DF0A 3CTLA 1B57A 2OT0A 4MYXA 3R89A 4NNCA 5CZTA 2H6RA 5AHMA 3UPBA 4O18A 4N6FA 1LTDA 2VFDA 4CLMA 4K39A 4G1KA 4DEFA 3WFAA 3F1QA 3DFPA 3DKJA 3W7PA 3W88A 3FA5A 4ZQCA 1XXXA 1TPH1 4OU1A 2YW4A 2ZZ1A 5CZJA 1ICSA 4RXFA 1JCXA 3DENA 4JTUA 1I2NA 4JTKA 1W54A 2C1HA 3HB9A 1XL9A 1CX9A 2VFGA 4A3UA 3QZEA 4YLWA 1LZOA 1QPRA 1SZEA 4MZ8A 5T26A 3ELFA 1F5ZA 3NL2A 2C18A 4BK9A 3C2VA 3G0SA 2NUXA 2YSWA 1PVNA 1GQNA 4XKYA 5LNVA 5LNWA 4RK8A 4UMAA 3LBCA 3IIZA 3PR2A 1Q6RA 2CU0A 2CLLA 2A7NA 4OQVA 2A1YA 3MHUA 3OA3A 1PHQA 4S2BA
chains in the Genus database with same CATH superfamily
4LRTA 4TV5A 5H91A 4REQB 3RXZA 3CZLA 1KLYA 3OODA 4GO9A 1VJZA 3A13A 1XFBA 1BF6A 5BXTA 1XIIA 4MJ4A 4JHZA 4AIEA 4JQ1A 4L9ZA 4WGHA 4KMQA 5DQPA 3V18A 4DI9A 2GLKA 5J8LA 1XLJA 1WDPA 2GOKA 2POZA 1Z44A 1G4PA 3G8RA 2YDAA 3N13A 4H04A 5FJIA 3WDRA 4H8HA 2AQVA 2OLHA 5G1TA 1W2PA 5A8GA 4F40A 5CPQA 3WF4A 3AYVA 1ISYA 2OTDA 3RO6A 1AD1A 1P0DA 3CHCA 4BR1A 1MEIA 3VZZA 1HFBA 3VTRA 4BQ5A 3V1PA 4TX8A 3H7UA 3BSMA 4PB5A 1ZFJA 1E9LA 4IT1A 2QDHA 1XUUA 1BWLA 4O4WA 8XIAA 5AKQA 2JEPA 1IHIA 3H24A 3TE9A 1LBFA 1DIDA 5I7GA 2ZUWA 4AD2A 4LFYA 1R3SA 1B4KA 1BVWA 3EAUA 5HULA 3MMDA 3N3MA 1KTCA 4LYQA 5CG0A 2VC9A 1EYEA 1ITUA 3TC6A 4HZ7A 1AK5A 1LM1A 4AZHA 2JQXA 1TV5A 4OBTA 1HL8A 2V67A 3SCNA 1GVRA 4IL2A 4KFPA 3VUSA 3UFYA 3G0UA 1OGSA 4UOZA 1AQMA 2B81A 2OOFA 2GJPA 2G96A 2GSJA 3EB3A 4D71A 3E2SA 3LPPA 3EPNA 5C2CA 5U7SA 4G1NA 4XZWA 2P0OA 3EWZA 4JFSA 3RMJA 3VFLA 2XWDA 4GIEA 3P82A 2NUWA 3TN3A 3TNOA 2PRHA 5A6BD 2Y7DA 4ERIA 2HPIA 1IXOA 2GGHA 3AS2A 3SRKA 3KS5A 4UXDA 1GYNA 3I68A 4BCEA 3VYLA 4IMGA 1ONXA 3DBPA 3DFOA 1UG6A 1U22A 3H26A 4H9UA 2CXGA 3N14A 3C2YA 3WO8A 1UYQA 2VGBA 3WD3A 3I3DA 2GJNA 2FFCA 2Y8UA 4P7OA 3S5YA 1UMLA 2VJXA 1V6XA 1XLLA 4FIRA 2YBVA 3AIVA 1Q6LA 3GDLA 3GXFA 4PBFA 2QDDA 3EWDA 3IIOA 1IIGA 4GYPA 1M7XA 5E5CA 1S5MA 1VIZA 1IR1A 3ALFA 5M3WA 2WMIB 4UR7A 4X63A 5DT7A 3A4XA 2IKIA 2GVYA 3HV8A 1XRTA 4RZ6A 2P76A 4LOCA 2G3MA 2RHGA 2PLMA 3UETA 3WLIA 1Z7AA 1L2UA 1P4CA 1WZMA 2VX4A 3N11A 1VEPA 4GINA 1MRAA 3GLCA 3F4CA 2J7HA 1FDZA 4BF5A 3C2FA 4ZGYA 7ODCA 4ZQRA 2Y2WA 4R5EA 5EBUA 3DU0A 3EXTA 1OFAA 4WGXA 1TQJA 2Q09A 2ZUNA 1E4LA 4OT7A 1M03A 1OINA 2CESA 4QAWA 4IG2B 1X96A 3QTPA 4QS5A 4J3XA 1ADOA 2QEZA 4RZ5A 1Q85A 3ARPA 5F2IA 4GA8A 3DDMA 3TONA 2XIJA 3SY5A 4FHAA 5KZMA 2ZIDA 3JS3A 5LSMA 1CGWA 1I2QA 2GQ3A 4ZXLA 4R53A 4RDYA 2J77A 2ZUMA 5F2LA 1K7XA 4O1DA 1H1NA 1FWCC 2PDPA 5F1UA 1KBLA 4YU1A 3PBMA 3T08A 4CUCA 1ZLPA 4GWEA 2PLJA 2WVVA 5D32A 2PU1A 1FDYA 3B40A 3MKKA 3TLQA 4X60A 1HKWA 1GWJA 2OGJA 4XBSA 3EB4A 4AZ7A 3MYOA 2WJZA 3HQPA 2PDKA 2RDUA 1V0NA 1HJXA 2O7SA 2ABBA 3II1A 2VGGA 2D24A 4IXXA 1PEZA 3V0UA 2O4QA 3C56A 4MADA 4DM1A 5FSEC 4JD4A 3V0SA 3NQAA 1F6PA 1TVNA 4BHYA 1EDTA 3OZYA 4MZ1A 3GU1A 1N2VA 1YPXA 1H09A 2OPJA 1MW3A 1ZB5A 1CGUA 4US6A 2HV5A 2BGNE 1UW9A 4B2DD 4C6BA 4TTUA 3WUEA 1LROA 3APTA 1S5TA 3FK4A 4LV4A 3RFAA 3LX9A 3RR4A 4HNVA 1QBBA 3LDVA 1WB0A 4E6MA 1QCWA 4UC5A 3C3UA 2NWRA 3QY8A 2WZTA 4MKVA 2NX3A 4H4IA 2PFHA 2QAPA 3TNBA 2FFIA 2WMJA 2XU2A 1AVAA 4MUZA 2ZTJA 4HK7A 3NAVA 2WQPA 4AY1A 3F2DA 3SR7A 1N7KA 3BJTA 2IQDA 4IP7A 4OHQA 3STCA 1PKLA 1DJGA 3QY7A 3P7YA 3C2EA 1XW8A 2AKMA 3AI0A 3CJPA 3LSBA 3PTDA 2V5BA 3DAQA 4CU8A 4LALA 1ELSA 4PMOA 2GL5A 3GC5A 3I4KA 2PCEA 3E2VA 3BOLA 3RDKA 4DBEA 4GG9A 3WQPA 4HJWA 3NURA 4MDPA 2D3NA 1O4UA 2WC3A 7PTDA 3VNLA 5CZSA 1C7SA 1Q6CA 1EHNA 1W6TA 2HVNA 4EP8C 1V7YA 4K6AA 3EXSA 5LA0A 1D3HA 1NIUA 1RAKA 3IRSA 4JDBA 1KFCA 3IS4A 3L4ZA 3RNDA 3H7VA 4XG1A 4V27A 3KVKA 1P43A 2CC0A 3LM3A 4JHOA 3S6DA 3VIIA 2J7BA 3R25A 1J12A 4J35A 1IXPA 3PTKA 2OFJA 4HVXA 3VNMA 3OLDA 3W6MA 4Y8FA 5HWNA 1RR2A 4DJEA 1XIGA 4S3AA 3ARQA 4NVTA 3RK8A 1VEOA 1O60A 1PJ9A 2EJAA 3FW6A 1E0WA 1DQUA 1R30A 1RBOB 1PX4A 5DY2A 3WENA 4XO6A 1D8WA 1WO2A 4Z2GA 1OFRA 4C65A 4LUTB 1RJRA 3A22A 4O0KA 2OT1A 3EMCA 1Q6EA 1LLWA 4LBRA 1A50A 3LI0A 3G18A 3VABA 3HPXA 3W23A 5AYXA 4E2BA 5DO8A 3M47A 5TIMA 1XLFA 4WXYA 2XPKA 4R9XA 1DEDA 3R0KA 1ESWA 4K38A 4NILA 3SCOA 4N9EA 5JXQA 1TSIA 4JYEA 5A6MA 4HNLA 4XD5A 1JPIA 3IRDA 1XYAA 4RE4A 2XUCA 3KLKA 3TC3A 4HOZA 2R91A 3TXVA 3MMTA 1QUMA 3WKZA 1UR3M 3UP8A 2GGEA 2IPFA 3MUCA 3ID7A 2HQAA 5CBBA 3HG2A 2E67A 1E40A 4JAWA 4DPQA 1QI0A 4Z2LA 3AIWA 2XH0A 5FOOA 3WNPA 3PZTA 5J5DA 2HZGA 1CGVA 1QNPA 1XYBA 1Q6DA 3GX9A 1A5AA 1SQ7A 4ZOEA 3IJLA 2ZRWA 4QG9A 4MNJA 4NZ1A 1TMQA 4ERGA 3MCOA 2OLSA 1H61A 4DN1A 2Y7EA 3FIGA 4NSBA 1DJXA 3AS3A 1E5NA 5BOFA 3PHAA 3I3BA 5LA2A 6ALDA 1NOWA 3FNDA 1KM3A 2NT1A 3NCOA 1ALDA 1ZUAX 4GE8A 5ABGA 1GT8A 1S1PA 4L6DA 3W07A 2VX6A 3DFQA 2J8FA 4CD6A 1EIBA 1GGOA 3GE7A 3G24A 3P74A 5D02A 1KNWA 3GAKA 6CGTA 4PL2A 1JZ2A 1SR0A 1QPKA 1UKQA 4WSHA 2FPYA 1XQKA 2Z1KA 3CAKA 4BF7A 3OBAA 4XKYB 3N18A 4J3UA 3N25A 3TAOA 4Q8MA 4Q8OA 4U3AA 1ZQ5A 4NI3A 4DLMA 1K6AA 4R88A 3PZGA 4H7CA 3DGRA 2XVGA 3MV11 3E0FA 3ZSTA 3W1AA 2I5IA 3QHOA 2QCFA 3RR1A 3VMOA 1OCBA 4LB4A 1S2CA 3STGA 3CUJA 3TKFA 4OUEA 3WH9A 1TIMA 2HK1A 1K8YA 4J27A 3TW6A 4HZ6A 1HTIA 2C7FA 1TV7A 1LBMA 2DW7A 3M0MA 3U2OA 2YLLA 2H9AB 1HX0A 2Z6IA 3LCHA 4I5UA 2XFWA 3ITLA 1UR8A 3IIPA 3Q4DA 1DVJA 1Q6GA 4L1XA 4QCEA 5ENLA 4BEQA 3DHPA 3PBWA 3TC7A 3WYZA 1LF1A 3S83A 2P5NA 3L23A 1W1B1 1YDYA 3BV7A 1GQKA 1Q6FA 3R13A 5E9XA 4WY0A 4LT9A 2VZUA 3KWSA 1F3WA 4W85A 3R79A 4MKSA 2NV9A 1UD2A 3GVWA 4WXZA 5I24A 1TX0A 4AF0A 1XLAA 4NRSA 3LGEA 2PDQA 1J5TA 2AMXA 2LLEA 1RQEA 1YBQB 2Y5JA 3VX0A 3TR2A 3HPFA 4LAUA 1RSCA 3CPUA 4IZGA 2VCCA 4FLRA 4JYFA 3GDTA 1ZJAA 3B9DA 1CIUA 4IIHA 1CNVA 2PDHA 4ZVJA 4JL2A 2DQXA 3LM7A 1H7PA 4LAOA 1TX2A 3HGSA 5CAKA 5JH2A 3IUDA 5AYIA 3MKVA 4FLOA 3T40A 4Q8TA 2IPWA 4N9BA 5HUPA 3ME3A 3G3DA 2X7VA 1BYAA 4MFDA 2XHYA 4O17A 1AD4A 5IHRA 1OFOA 2CHNA 1M3UA 2VVSA 1DJNA 4B5UA 4WUIA 1KTBA 4ZQOA 1V3JA 1JF6A 4WRHA 1TV4A 1JYNA 1XKJA 1SZRA 4GH1A 4JIEA 2JALA 1WXJA 2HROA 2XIQA 4XZ9A 4B5SA 2FB2A 4PA8A 1WDQA 1JDCA 1V02E 3OB8A 4WDXA 1E6XM 1M41A 2E68A 4HYWA 4B92A 4YNGA 4QG8A 2J27A 3E12A 4ZOCA 1F6KA 1OCQA 3AU6A 5FAGA 4O1CA 1WKEA 3GS6A 3E96A 5LHEA 3AXMA 2JKAA 3W7OA 5BXPA 4A2RA 1RCQA 4ZQPA 3GXPA 3PK7A 1FWDC 1KXHA 1XR2A 5L9FA 3UYIA 1XIEA 3CQHA 1PO9A 4MWAA 4LU0A 1T41A 4GNKB 4GIRA 1LP6A 3OVPA 4AC1X 3SUTA 3L67A 1JI2A 2DSKA 1DWJM 1A5KC 1EXBA 1Q8AA 5FEXA 4H1ZA 1NVMA 4HZMA 3DI1A 3AROA 3L5AA 1F3EA 5AHLA 3AAMA 3SUVA 1SUXA 3CO4A 2PZ0A 2NV2A 3KS6A 3V7PA 1E1CA 3MO4A 1VFSA 3CUFA 2D3LA 3DYMA 3T05A 4PMZA 4IPPA 1MXDA 5D2VA 2ABAA 1DP0A 9XIAA 1LBLA 1GVEA 2HTMA 5AN7A 2QPUA 4NG3A 1IWAA 3WLHA 1S2WA 2O9RA 3ITTA 2B4GA 3D5HA 2ATSA 2ZBTA 3WQ4A 5SWUA 4AEEA 1RVKA 1A5MC 3RILA 4D6DA 1NELA 3EX1A 1KBIA 1BQCA 3URNA 4YWIA 2XIOA 1VBGA 3N6JA 4Y9AA 1YDVA 4DJDC 4ZO9A 3ZJ6A 4I9AA 4WSJA 4B3KA 2AGKA 4GMEA 1BKHA 4AX6A 4K68A 3ZMRA 1UD6A 3ZR6A 3UGRA 2SFPA 4A2SA 4I9TA 1YXYA 2HNEA 3WQ8A 3TQ0A 2UY3A 2HNHA 2RUSA 1VS1A 3MJYA 3H2AA 2OU4A 5C9WA 3K30A 3MI3A 1BWKA 3RYSA 3USBA 1HXJA 4Z2HA 1HZYA 4HU8A 2BASA 1FX6A 5D04C 2ZCGA 5A8QA 1UQZA 4MY9A 5EB8A 2ZQ0A 4GIYA 3BL3A 1KM0A 5D8WA 3IPWA 4QBXA 3MHGA 2NSXA 3GR7A 4S39A 1OFBA 2NQJA 4GJJA 4C6OA 3C61A 2W5FA 1XIBA 1YPFA 2WSPA 1DOSA 3NIYA 1L6SA 3W6YA 3SEPA 4DWSA 4ZCWA 4GC4A 3ABXA 3TCEA 1I9CB 1L0PA 3USZA 4LW7A 6TIMA 3FY1A 1KFBA 1LT8A 3W7JA 3S1XA 1NDWA 2D69A 1T96A 3LENA 4V2XA 1R7OA 3O3RA 4H83A 5AOUA 3M5YA 3EKZA 3OTRA 4Q4RA 1OGGA 3VU2A 4R7JA 2J7EA 4UQAA 5D9OA 1A5CA 2PF8A 1H51A 3T0TA 3FSTA 3M16A 2BBFA 1R2TA 2QCLA 2W62A 3B8IA 2Y4SA 3GH7A 2CZEA 4MPKA 2YA1A 2BMBA 4GNVA 1JCTA 3I7QA 1RPXA 4P8XA 2YGYA 4L5ZA 4RNHA 3S5SA 3A4WA 4IFRA 3MP5A 1XUZA 1J6PA 3W6LA 3GVRA 3TQVA 2OZTA 2VL4A 1J0ZA 3NQGA 4KCWA 4M1RA 2WC4A 5BROA 3P93A 3I7RA 4AW7A 4KRUA 4Q6JA 4HGXA 4P8VA 1DHKA 3S2NA 3IANA 2CZ5A 3FJNA 3KOXA 1JZ7A 2ZUTA 3TTSA 2F2HA 4N7QA 1X97A 1W56A 2UY2A 1NJJA 2WSKA 4DBSA 4JIIX 3IJ9A 2VWSA 1A5BA 2RGLA 4I9MA 3V0TA 4BI5A 4GI8A 2E5DA 1VFFA 4ZO7A 2DPEA 5KITA 2OKTA 3ITVA 3ANVA 4YYFA 3C0JA 3U48A 3T4WA 1C8XA 3L5LA 2VTFA 4AXKA 5GNYA 3K4WA 1A80A 2PGWA 2BVWA 2W79A 3E9AA 5I79A 3W76A 2REQA 2JIWA 4B3ZA 3KFTA 1W1PA 3UZ5A 3W1MA 4GD0A 4PYSA 1X1ZA 3SIMA 4M51A 4HK5A 4GYJA 3OJGA 2G4JA 2X41A 4C6EA 3EEGA 3P0WA 1TRDA 5KZDA 4D6HA 2CBIA 1FHDA 3LHYA 1C29A 4JNYA 2J88A 1LG1A 3TJIA 3BPWA 1IYXA 4QNWA 4IISA 5LGXA 4FZIA 3WCZA 5HWMA 4O54A 4WZHA 2XIIA 4EXQA 4Q22A 3WNOA 4IOTA 4BI6A 3TSMA 4PUNA 3TUUA 3FGCB 3NJ3A 4ECLA 1TJPA 1XISA 1ZCCA 4UTLA 4AQLA 1DXFA 2ACRA 2YCIX 5CC6A 1JJKA 4DB7A 1TTJA 4A29A 3R6IA 2PDIA 3VGDA 3GR4A 3UD6A 1OYBA 1RPKA 4BZYA 4GKTA 3W1QA 1RALA 4UFKA 3RM9A 3ANYA 1WA3A 3M46A 5DMNA 1TQXA 1E9ZB 1V3MA 3U4FA 1I1XA 1XSIA 3AJ7A 1XLKA 4J3ZA 3E6EA 3V1HA 3GIPA 5K3VA 4LEFA 3RHGA 4TVUA 3K4AA 3N6QA 1YNPA 4H01A 4FF5A 4UTFA 1VFOA 2VDHA 1M1BA 1RUSA 4IL0A 4KFOA 1DTUA 1LUCA 3LPFA 3HURA 4P7LA 5HPCA 2YBTA 2Y7GA 4OOZA 3QJAA 5CZ0A 4X9SA 1VFTA 2AQWA 2R14A 1NFBA 3W1TA 3WK0A 4PE8A 5HJYA 3JW7A 1ZALA 3AHXA 1I1WA 1SJAA 1UKSA 1DJYA 4IPJA 1IT8A 3SECA 4ADTA 1UUMA 4E3TA 1JR1A 3G77A 4HN4A 3ARRA 3HG4A 1G4EA 3VPLA 1R85A 3NL3A 3UVAA 3AXXA 4F9DA 3RPDA 1Q66A 4KWVA 5ECVA 1TG7A 1R3TA 4RJEA 4X2PA 4OBSA 4O10A 2V9DA 2VXNA 5IRPA 2CWNA 2FYMA 4LX4A 4R85A 1H7OA 3WFZA 3NM3A 2QUTA 3O9NA 3QMRA 1KRMA 4RNFA 5GJPA 4M7SA 1OD8A 1FHUA 3GNDA 1RA0A 4MB1A 4FXJA 3L65A 4P8WA 1HJVA 1KCKA 1CI1A 3TR9A 4LS1A 3W37A 2YL5A 3M44A 4N9DA 2CXEA 3VIGA 3NQ7A 2V3GA 1W0MA 3MKCA 3W75A 5XIAA 4C5YA 4OOUA 3OLGA 3UQNA 3BAJA 1XM3A 1BWVA 4HPGA 2XVLA 1XDLA 2W27A 4F0RA 5C7HA 3IK4A 3NFUA 4TR9A 5AYYA 4Q4QA 1RP9A 3WN6A 4JTLA 1HGWA 2QF7A 3T42A 1IEVA 2J9ZA 4LUIA 3TFXA 2HJPA 3TQKA 3GG1A 1EJ7L 1M5WA 3T1GA 5EGRA 1B2YA 2TMDA 1AH4A 1B3YA 4C60A 4NZCA 4DZIA 4GUGA 2OSWA 4JTFA 5JBEA 5E0CA 3NO3A 3BLOA 1VENA 1K7EA 2G4FA 3EX3A 4AIBA 4O4VA 4DBUA 3UCCA 4W86A 5KZEA 1N55A 2Q8LA 1KQYA 2WMHA 4LC6A 5XIMA 1TVPA 1NWSA 3NQDA 5ABFA 2Z7GA 4QSHA 1N8WA 3CMFA 5TF0A 1OC6A 1XYMA 1E6ZA 3VIJA 3G8EA 4DJDD 4AWSA 3K13A 2A0NA 3TN6A 1I2PA 1OK4A 1BYBA 3CUIA 5IOBA 3T6CA 1MVYA 1T0OA 3THDA 5FD0A 2G8ZA 3B0XA 4TIMA 4A4AA 4JX5A 1ZHAA 1XLIA 2OB3A 4UMCA 4AH7A 1SFSA 1L6FA 2PBOA 3R7MA 2FHBA 5CH9A 1JZ8A 1VFHA 2FVMA 5FESA 2W4XA 4PSPA 2VNCA 3R0DA 4LNCA 1A47A 1ISVA 3FA4A 4C6QA 2Z4GA 4EPDC 1OYAA 4HCHA 4WK9A 3E0WA 4A05A 3T81A 1EF3A 5D03A 3NGJA 3BCDA 2GOUA 5CBIA 3LRMA 4O1FA 3WD2A 1PKMA 5FF4A 4J3SA 2A4AA 5D38A 2BXYA 1LCOA 1BTCA 1PZ0A 3C4UA 3NXFA 4FA3A 1ZP3A 4KRTA 3OYXA 1SFLA 4NZ3A 4HSOA 4ZE5A 1UASA 1KGXA 5T8GA 3VIMA 2VEMA 3BK0A 3PWIA 1TMLA 3PNZA 2OYKA 2VR2A 1YRRA 3BLLA 3GHUA 9CGTA 2WKGA 3EX6A 1V93A 2Z6JA 3MSDA 1XPYA 4UUIA 5HNNA 2VWTA 1I0BA 1MO0A 5ECUA 3URAA 2XINA 3BE7A 4W7UA 2ZXAA 1XDJA 1NM9A 1BG4A 3UA4A 4RX0A 3OG3A 2CIPA 2Y24A 3CIVA 1EB3A 3ITXA 1U1UA 2AAAA 1KA9F 4BEUA 1W3IA 4UCFA 1Q2RA 4I8DA 2W63A 1CLVA 3SDOA 1NSJA 3T4CA 1TCDA 1H7NA 3VNDA 1VIWA 1RY0A 3A3HA 1E0TA 3WSUA 3MUAA 2CERA 3R10A 3ISIX 1JF5A 4NZ4A 5E09A 3QC0A 1UKPA 5MF5A 4Q4KA 4NASA 4HMNA 2RAGA 3RLUA 4KEUA 3WF1A 1UR0A 3N04A 3NYDA 1FWBC 5HDRA 1CXIA 1KR1A 3W72A 1OX6A 1ZZMA 2HWGA 4JFVA 2ZXBA 1XG3A 5A6JA 3SUWA 2H6RA 3GNOA 3MVIA 3UPMA 4HSHA 4O18A 4CLMA 1EHAA 4G1KA 2XSXA 1FP8A 4E4UA 3DFPA 5CEWA 3W7PA 3G6LA 4MHBA 3FA5A 3GTIA 5FJUA 3CZKA 1TPH1 3U2ZA 3N9KA 2ZZ1A 5CZJA 1JCXA 2HDJA 1YEYA 2RGMA 4JTUA 3MUY1 4NYUA 1CX9A 5JUVA 4CVWA 2VFGA 2AL2B 1EC7A 1AFSA 4DLFA 4IFOA 1FWEC 3E1F1 2XYLA 4L7ZA 3TYCA 1F5ZA 3FXYA 3RM8A 3N6HA 2YL8A 2AGTA 2QYGA 1XLGA 5GPRA 2PDFA 2YSWA 1ZJHA 1NQKA 4D6EA 1GQNA 4KBXA 2CLLA 2A1YA 2F9RA 3OA3A 1PHQA 4LANA 3QV8A 2A21A 1VBHA 3B3DA 7XIMA 3UNTA 4GUFA 4DXVA 2WVTA 3B0YA 1POJA 2WCGA 5HMDA 1NDZA 1W1A1 2PE4A 1QHOA 2RDWA 5FIPA 4GY7A 1DV7A 1B30A 3M0IA 3PZQA 4YCOA 1B54A 1QO5A 4O19A 3VIKA 1CXEA 1VGAA 1REQB 3MUZ1 3ANUA 1DBTA 1FWWA 4QR6A 2IKJA 2YYTA 4GRSA 1ONEA 3GDRA 3LD5A 4UWMA 4DUVA 1F3XA 3PPGA 4NP7A 4S3GA 4K7YA 3F4WA 1I2RA 1XYLA 3B8UA 3MBFA 3MC5A 3VM7A 2OMAA 1VF8A 4NQ1A 4GI6A 2V82A 1GG0A 1TB3A 5E0KA 3M7WA 1NOUA 4FEZA 2PTWA 1D7KA 5I09A 3VCRA 1QI5A 4UNKA 4L65A 4AU0A 3VZXA 1MW1A 2ADAA 4DBWA 5AVNA 2OODA 2ZZ6A 1PBGA 3M0JA 3TOYA 2ISDA 2GDUA 3HQOA 2E09A 1ZP4A 4BY3A 3EOEA 2V5LA 4HPHA 4LS2A 2P8CA 3D3AA 5MKGA 3DHFA 4KH2A 3WF0A 4JIQA 3WNKA 5DX7A 4FNUA 2IPGA 1DQXA 2XH4A 4D6CA 4IMCA 1S46A 1B3WA 3O6AA 3IJ7A 3CGTA 2Z7KA 4AZGA 2QCDB 4N6EA 3WFLA 5AVHA 4F0KA 4JIPA 3BDKA 4IWWA 4J2PA 3IEBA 3LHUA 4QITA 3O1NA 5HANA 1G01A 3AMDA 1X7IA 2PEVA 2BB0A 3CZJA 1TJ0A 3BZJA 1O5KA 4L4MA 1ZAHA 2IMRA 3HM7A 3CYJA 3WDIA 1UHVA 4M3PA 1K9TA 4QJ1A 3WLSA 1W1VA 3GBEA 1A5OC 4XV0A 4O1BA 4W7WA 3NQ6A 3AO0A 2GUUA 4JBRA 1U1HA 3I7SA 4E4PA 4F2BA 1EGZA 3AYRA 5I23A 5DF0A 5HNTA 4PMYA 1VFLA 4WEVX 4Q7IA 3N12A 4ZBCA 3BLDA 3TLLA 4YL2A 3L2IA 3IUHA 1EBHA 1CEOA 5A69A 4XSLA 3CMJA 1B31A 3BW2A 4C6KA 3PJUA 3PJWA 3FVDA 4Y9OA 4HD5A 2BHUA 2B7OA 1WOAA 3HV9A 1WKYA 1ZSXA 2E9MA 3P14A 1WDWA 1ISZA 4ZMGA 2GYIA 1XH2A 3LRKA 4PSRA 3HPAA 4IQJA 2BY2A 1VPXA 1WKFA 4F0SA 2CHRA 5BXSA 4J3TA 4LCQA 3SY8A 3MB9A 3B9AA 1QPNA 1LRQA 4O1EA 3N29A 1UC4A 1F4AA 1KFWA 1NFGA 3KRZA 4JKLA 3UR8A 3G1YA 1TTPA 4PUEA 1XBYA 3CO8A 3GYCA 3ZJ8A 1WAUA 1B3OA 5CSYA 1OYCA 3NPVA 1GZGA 3AMLA 4GABA 2BTMA 5AFDA 3BV4A 2ZVRA 1UOZA 3ALGA 3Q67A 5G2WA 1MI3A 2PTDA 4RE2A 3VGHA 4WKHA 4KF1A 2RH9A 1GTHA 1LL6A 3NQ2A 5HR6A 3TQPA 3O16A 1OJXA 5EMLA 1V03A 4P7NA 1RXOB 3PBYA 4GUHA 1YHTA 3PUEA 3WBXA 5DANA 3S4TA 3DC0A 3OEXA 4XAPA 2PUZA 2BP1A 5DCEA 5FJRA 5F1VA 1ZPTA 1V3IA 1G5AA 1F8IA 2NLYA 5FJTA 1EEPA 1WE5A 1XIHA 3OA5A 3E0VA 4C7DA 2A7RA 3MBDA 4FNSA 3FSUA 3HFYA 4Y9NA 2FZBA 4C1NA 1A3WA 1BPLB 2J8TA 1UWQA 3CM4A 4IFKB 1HKJA 1T8XA 3W22A 4U5KA 2NVDA 3OU8A 1A0DA 1H4PA 1KWGA 3A5VA 1GNXA 3L5MA 1G6CA 1UP3A 3R8HA 1TWDA 2VVNA 3MDWA 1EXPA 5C7VA 1GCYA 1OZMA 4I9JA 1GOWA 4FOJA 3WLKX 1OF8A 4TX9A 5FEPA 1MZRA 3W7MA 4JS3A 1V6TA 3UWQA 5H1WA 7TAAA 1TUXA 4RLIA 1GTEA 3VD4A 2P53A 3RUBL 3F4NA 3W1UA 3PAJA 4DO4A 5C6MA 4MJMA 1HG3A 4TX6A 2BLEA 3H54A 4NXSA 4OV9A 3MP3A 3ZQ9A 2F6UA 4O52A 3OLEA 3O0FA 3PM6A 3VIFA 4GKLA 4AHPA 5C54A 3EB2A 5C9RA 1CWYA 2XZ7A 5A1AA 3UZWA 1QPQA 2GVLA 2Z26A 1CGYA 1J01A 1HO1A 2OG9A 3ABOA 1VKFA 3DFSA 5JMUA 2C79A 1EO7A 3HPSA 3AZRA 1WQ5A 2GJRA 1WXZA 3RO8A 1MMFA 4TMBA 1QNOA 3BG3A 3TSBA 1NDVA 1MNZA 1P6WA 1F6YA 3M5VA 4PUKA 1IEQA 1R3QA 2P8BA 4V15A 4UQCA 2UZ9A 3BICA 1TZZA 4Z2KA 5K9CA 1YTKA 1MUWA 4HHLA 4RE0A 4MWAE 4L64A 1UWIA 3MQTA 1PZ1A 2R8WA 5IFTA 3GK0A 5C70A 5F2GA 3OHMB 3O63A 5C9XA 1QI2A 2H3DA 1WBHA 3PY2A 4ILSA 5G5IA 1B9BA 3LA4A 1VH7A 1AQFA 2PDXA 3TMQA 2F61A 2IKHA 1EQCA 5EY5A 1EYWA 1VAHA 3UCDA 1GQJA 3GKFA 1E71M 3J7HA 1JFXA 3KP1A 1J79A 5EBAA 3I6EA 4QLLA 2ZX5A 3EKLA 3LZ5A 2CEQA 4HHHA 3GH5A 1POKA 4W8BA 5D8ZA 1UUOA 4LVDA 1S5WA 4AD3A 2QCEA 1JXJA 3T0BA 1PZ3A 2PRLA 2RDTA 4X22A 2D22A 1GOIA 3W27A 4UTWA 2BV9A 2GPTA 3SCVA 2YB1A 1XRSA 2Y5EA 2C16A 4GZEA 4G5DA 2CCRA 4EWJA 2ZADA 1E0XA 3Q2DA 1ZJIA 3RMEA 1JZ5A 2QS8A 3GG8A 2B7PA 3HIJA 2OJPA 3LLXA 1A49A 1GOKA 3QQ1A 4RUBA 1K1DA 2F2KA 4INFA 4Z17A 1UPPA 2WWDA 2VRJA 1WDDA 3INPA 4CD8A 3XINA 3FYOA 3T2PA 4MMWA 2WB5A 1H7RA 3S6OA 1RLCL 4GUJA 1JYXA 1FY6A 5BRBA 3RCMA 4EX4A 4M7TA 2PDGA 3F4DA 4ROPA 1J96A 4AISA 1VRDA 4I7WA 1Z41A 3VINA 2R94A 1QOQA 1JUEA 1QK2A 3S46A 1D3GA 3W84A 4YVVA 4OV4A 5FCZA 3PZVA 1GORA 1KWKA 1GYLA 4LF2A 3HG3A 3WUFA 5DBTA 1XFCA 4ENLA 1L6GA 1VQTA 3VKAA 2QJNA 2V5DA 1VBJA 3WK1A 4N4QA 4U10A 2HBVA 2DZTA 3B4YA 1VJIA 1XYCA 3W87A 2DVUA 4NNBA 2TODA 4US5A 3GHSA 1PUDA 3W83A 3OLIA 1OC7A 1VYPX 4HCLA 5AC7A 1KQZA 1E0VA 4D72A 4HHMA 3BVJA 1G7UA 3WH8A 3UESA 1TJ1A 1J9YA 1R3VA 1ZL1A 1NWUA 2TAAA 2NZLA 5BXRA 1YDOA 4UTMA 2JKPA 3UXKA 4FX6M 4DRSA 2PZNA 2FZMA 2Y85A 7REQB 1DJZA 4CNPA 1V02A 2YXGA 4FLQA 3RIKA 3OVRA 2ZA1A 4XBJA 1XV8A 3KWXA 1OB0A 4HTYA 2L5HA 2PU0A 1F61A 1QT1A 4JTJA 2ZZ4A 3RN6A 2PGRA 3W82A 3WY1A 1V6VA 1XLMA 3RCYA 3UR5A 5CGMA 3DHDA 3AZSA 1XH1A 3QHMA 4H41A 1PKNA 4JEJA 3COTA 2UBPC 3NDZA 2V3EA 4GJIA 4TVDA 5FL0A 1X1OA 5BWFA 1NTHA 3OPSA 4DAFA 1KO0A 2JK2A 1XGZA 2NW0A 3QH2A 5HPOA 4BWLC 1Q7QA 6PTDA 1SGJA 2O4MA 3K2GA 4GYPC 1VC4A 2DP3A 3BLEA 3BLPX 4FB7A 1Y5XA 3KRBA 3G3MA 1HL9A 3EOSA 3R43A 1MWOA 2V3FA 2XVPA 1LJYA 1EWEA 3H2OA 1DHPA 5AZ1A 1ZENA 5HJXA 3FFSA 4O13A 4I3GA 4RR4A 2EAWA 2GK1B 3G1RA 4ZO8A 1NP0A 2XN1A 2NLIA 3CL7A 4KPLA 3T0CA 2BNJA 2QT3A 2Y1HA 3ZFHA 1F74A 2WHMA 3FEQA 4XUGA 5F4WA 1NF0A 2FH8A 2CLFA 5EPDA 2EHHA 3IJ8A 4GIAA 4W93A 4J1OA 1XIFA 1JG9A 2NXIA 1HIZA 3MDUA 5EKYA 3SZ8A 3EA3A 4RKAA 5BOEA 3IGHX 3GD6A 3THUA 5HATA 3CV1A 1K9DA 3CB3A 3ZIZA 4B4FA 1GKRA 2FHFA 3AIBA 1Y65A 4H00A 3S6TA 1WKDA 1MNSA 3LLFA 3VDBA 4B9YA 1EA0A 4RL3A 1UZ4A 3CQ0A 1LQ0A 1LUCB 4E2DA 3UVIA 1EP2A 4EPKA 5IM51 3GXTA 3NXLA 3QZAA 2R1KA 2PDWA 4A3HA 4DJFA 4MZYA 3DG3A 3MHFA 2DZAA 1KGWA 2WJDA 4S1FA 4G7EA 1XQLA 2NQZA 3TIMA 3NQ8A 2RJGA 1NU5A 2PMQA 1OG6A 3OZMA 3O07A 5AYBA 2VT0A 2XFFA 1TA3A 1R3RA 4A22A 3RM4A 3LHZA 4HNTA 1NWTA 3OBKA 5M17A 3QFEA 3LGDA 2V3DA 1DJWA 3AJXA 3NSXA 1AJ0A 3ZJKA 4S3FA 3UY7A 2GSEA 5KETA 2NX1A 1FWNA 4AWTA 3SCUA 4RNIA 2QPXA 4DPPA 3G1SA 1RBAA 3CT2A 5M2FX 4CCZA 1PZ2A 4BQ4A 2BOEX 5CPNA 4AD5A 2X16A 1UR1A 3B9OA 3M9YA 5D9MA 1C3FA 3LPOA 1T7LA 4F9JA 5I3JA 1WXYA 4JQ2A 4D6GA 1C91A 5K4ZA 3VNKA 3WQEA 1EH9A 2VI0A 1V6YA 4IJCA 4FR1A 5AC6A 3JUGA 2ISVA 1AG1O 3L9CA 2PTZA 2XWEA 2J13A 2Z2UA 3HMJG 1OSEA 1S1RA 1J4EA 4H9VA 3VNJA 2Q3OA 1G4TA 3C0SA 4JTTA 3GDBA 3QRHA 3SCTA 5FAJA 3N2MA 3S0CA 3N2BA 2E6FA 4LAKA 4R7WA 2J9YA 4FK9A 4XTIA 5D4YA 4C1KA 2ICSA 1A5LC 2WW5A 2HE5A 3P8JA 1EQPA 3VMNA 5TD4A 4W88A 4P61A 2AAMA 3CS2A 3K5XA 4Z0SA 2QJHA 2ZUVA 3ZLGA 4GK8A 1QR7A 3T07A 3MUIA 2YIHA 7ENLA 2AL1A 2Z1SA 3VK5A 1S2UA 4EACA 1XBVA 2F7FA 1UJPA 2GJXA 2I5QA 1Z42A 4O12A 1F05A 1UBSA 1HKVA 1X8FA 3GTHA 1HVQA 1PX3A 4YTUA 2YZ5A 3CUHA 3WDQA 4RPQA 3QLDA 1V0LA 4AZCA 1M04A 2Y0FA 3KOYA 3U8GA 4E4FA 4JX6A 3RJYA 1QW8A 3RX3A 5FJOA 4NAEB 2IXVA 4AFYA 4M8UA 3WD4A 4FMVA 4GLEA 1V8EA 3O06A 2PDYA 4GZIA 2YA2A 4HN8A 3LHTA 1TE6A 3UY8A 3HO8A 2DY3A 1GOMA 2VHLA 1W3TA 2D1ZA 3B8SA 1BRLB 4AZ5A 1JI1A 4F2UA 1S5NA 2DUXA 3EMQA 5CBJA 5PTDA 3URBA 3IGSA 2FKPA 3VVGA 4DJEC 3RLVA 3NEHA 2VQUA 4A6GA 2WKJA 5G1MA 1QRQA 3VGBA 3KDNA 3TWBA 4CEUC 1SPQA 3LXAA 3DYOA 1JRCA 2E5BA 3BGGA 2VGFA 2O9OA 4R3UA 3V4BA 2DIEA 3IGUA 4UZSA 2AKZA 3BANA 3DG7A 1XD0A 4PMQA 2BWGA 2VP8A 1IZKA 3W24A 4HNNA 1Z8AA 3EA2A 3E74A 2ZYFA 4UTTA 3BJFA 1XDMA 1IF2A 1J18A 4U5IA 3GG7A 4LQ1A 4REQA 2VX7A 3L4WA 3H22A 3FX4A 5L6UA 5REQB 1A5UA 1RV8A 2X1IA 3KDOA 4B91A 3KAOA 2ATMA 3EZ4A 1D3CA 3ZR4A 1UWRA 1QTWA 3UXDA 4CGTA 4FOKA 2C19A 2BY3A 3W3OA 3HA1A 2EG8A 4HSNA 1T99A 2PB1A 5E6YA 3EOUA 4EK7A 3C52A 5CGTA 2HK0A 5FF3A 3BAWA 3MMWA 4EKJA 3SFWA 4GGHA 3THQA 2PAJA 3RX2A 5DELA 4Q8NA 5DRIA 6TAAA 1H50A 4B5XA 4XAGA 3EWBX 5B7ZA 2I9UA 3EXRA 2J47A 3LV5A 2HCVA 4AUBA 4OIFA 4H6QA 2E6DA 2PA6A 1JNDA 3ITGA 2OYMA 5H8MA 3B9NA 3VDHA 4JNZA 4LYRA 1R9XA 4GYKA 3WD1A 3K8KA 3LMZA 5DCBA 9XIMA 1ADSA 3LUTA 3A3WA 2VO5A 2ZZ2A 3VKKA 1XRFA 2YFOA 1TE1A 3NDYA 1O5QA 2FJKA 3S3GA 4I6VA 1SO4A 5DY3A 3ZVHB 4BI7A 1SO3A 4JN6A 2X09A 3MI2A 1XLHA 2KAUC 3FOKA 4ML4A 1QK0A 2Y62A 4PCSA 1PS9A 4M19A 3WBEA 2ZVIA 2ZZ3A 2YFNA 3TXZA 4UCGA 2X0HA 4CD4A 1BVZA 4WJXA 4Y96A 3KX6A 1NP2A 4IUOA 2ZWYA 2ZDRA 5I78A 1R2SA 4ICMA 2J7FA 4Q3MA 4S23A 1LWHA 3TOPA 1BSLA 3OO2A 3ICJA 1ICPA 2OO6A 4UTIA 1SZGA 3KL0A 1GK8A 5HNUA 2YCJA 1FHLA 1S2AA 1H11A 4HU4A 2YCLB 1Q4NX 1LRNA 5ABTA 1J8VA 2FGBA 3DOPA 1XCFA 1UB3A 1TMHA 1FP9A 4IIBA 4LCSA 4ZENA 4F0HA 1US2A 2V5KA 3O15A 2UY4A 3UJFA 3CH0A 2Z1BA 4QRNA 4C6DA 1BKSA 3ARVA 1HT6A 2C14A 4DNHA 5FF7A 3W86A 4Z1DA 4OE7A 4I8YA 4Q7NA 4MYAA 1JUKA 4ZQNA 4IIGA 2DFAA 4HIBA 4S3JA 1G7VA 2WSQA 2E40A 2WMIA 3N19B 3GW0A 4AD1A 4ZZ9A 4R34A 2A3HA 1MUCA 5AB3A 3K46A 2W92A 2JF6A 1LG2A 1PHWA 3GYEA 3REQB 2Z28A 2Q3RA 3PUDA 1RH9A 1HO4A 5CJNA 3CHEA 1ML1A 1UD8A 4LGXA 4AWUA 1UD3A 3UWZA 5DBUA 1UP0A 4MJZA 1W9PA 3NO1A 5IDIA 4IG2A 5CJMA 3NOEA 2X2YA 4H9XA 3UT0A 4QQUA 4EXAA 3LBMA 4FIQA 3UW6A 3QGVA 1OIFA 1QOXA 3BLKA 3N2OA 1L9WA 3E2RA 2PDJA 3NQEA 4J2MA 1LOSA 4BWLA 3PUOA 1SJCA 1Q3NA 3IJ6A 1JPKA 2BOGX 1O68A 3BQ6A 5KZ6A 3C0LA 1D8CA 3W71A 1W9XA 1H5YA 2FTYA 2MNRA 3E49A 3FA3A 4JTHA 4JIRA 3HJZA 1TWIA 1T8QA 4Z2IA 5CSRA 1L8PA 3MSGA 4JGDA 2PRMA 1JDDA 3STEA 1OK6A 4MVAA 4QDPA 1TPVA 2Z25A 4PULA 4WOZA 3OIHA 4V1YA 4DNMA 3CHFA 3H4WA 4HHPA 5IFPA 1MQQA 3RPTA 1VR6A 3CV2A 3O6DA 1TPWA 4CN4A 1XWYA 1OFEA 4AY7A 5M1TA 4RCXA 2D20A 1VCVA 2XGZA 1M01A 1IIHA 2VYOA 2VR4A 4UTJA 1FDJA 4S3EA 1LLOA 1S3TC 1PXGA 1EGMA 4MWAC 2QCNA 3FLUA 4ZL1A 1ZY9A 2E28A 3DH7A 2VZOA 4M6UA 4D1IA 4M0XA 1P7TB 1SSGA 1XG4A 4UFIA 4N0RA 2PDCA 1R9YA 4CEXC 4CN1A 1WUFA 5DMLA 3Q65A 3WD0A 2QQ6A 3JR2A 2ZC8A 3GQYA 3W73A 1H0IA 3N4FA 3NSMA 3QPYA 4Q33A 3D0CA 3UWYA 2G3IA 4Z1YA 5F4XA 2ALRA 3PSWA 2E5CA 4B90A 4QHRA 4HZ8A 3ZXWA 2ZA2A 1DORA 3U4AA 4G6CA 2IUZA 4MUPA 4UOJA 4ZB2A 4NZ5A 5HQLA 3QR1A 3LY0A 2DORA 3OZOA 3N2XA 1GHRA 1EUNA 3L4UA 1TVLA 4OVXA 3W85A 1DXEA 4JYDA 4MTVA 2QDEA 1RJPA 1WCGA 3U6WA 4AZ6A 3V75A 3FHAA 2I5GA 2X40A 4U3CA 3QBUA 4KERA 1XIMA 2WNQA 3LTYA 2TPSA 1EZ2A 1U5JA 1EJUC 2Y5SA 4MM1A 2POTA 1KR0A 3RRAA 1PL9A 1ME8A 2CETA 3RLGA 2WZIA 4LUJA 5I3KA 2DDXA 1A4LA 4LUSB 4LH8A 1IXQA 3HBLA 4AAJA 2QUMA 2C0HA 4Z0JA 3UGVA 1E9YB 3KCOA 4XZHA 3K1DA 1HF6A 2DZBA 4DZ5A 3U7VA 2BFGA 4DJED 2BHZA 3PAOA 3VD7A 1O1HA 2ISSA 4IMFA 4DQWA 3HFTA 1OIMA 4HT3A 4JCMA 1W17A 3W81A 4Q4OA 3SN1A 1DQWA 4HTBA 2WJEA 3KLLA 3SJNA 1KD0A 1ODZA 5DN1A 3SJ3A 4HYVA 3ZO9A 2GJLA 2B7QA 3L66A 1HN1A 1SYTA 4LVAA 2BGSA 2BX7A 2Z2AA 2TRSA 3ONCA 3Q94A 3IVSA 1AH3A 3RAOA 2PWFA 4IQDA 1EIXA 2DEPA 3SM0A 1WP6A 2XFYA 2WHJA 3FKRA 4Q4PA 2F38A 3U0HA 1PWLA 1R3WA 3SSJA 1F07A 2EPOA 4AZIA 1NF7A 1H1YA 4LUTA 3AXHA 3H23A 1NAL1 2I1OA 4A35A 1BLIA 3VIPA 1FTXA 1EJTC 4XVEA 3DFTA 4GBDA 3GWQA 5BRPA 4PCTA 4A8RA 5CCZA 3GSMA 1E43A 2OWXA 3ARUA 1DIKA 1Q6QA 4XZMX 1UH4A 1XBZA 4FOUA 4MLRA 2IKGA 3TJXA 1ITXA 4M80A 4JFWA 3H70A 2QKFA 3GUGA 2OELA 3A23A 4DWSC 4HYRA 3BG9A 4MPQA 4LEQA 2GGGA 4J28A 1MFVA 3ZZ1A 4UFJA 1TZ9A 2TYSA 3PZIA 2CLIA 3WL0A 4HMCA 5FACA 4GCXA 1UA3A 3BMVA 3BURA 5LNSA 3MPGA 4KT2A 1VPYA 1LOQA 4M6PA 4WF7A 3AMGA 1XJBA 4A3YA 5A2CA 4GI9A 2QUUA 1Q4WA 1YIXA 4W5ZA 5G4EA 3CAVA 2BDQA 2ZZ7A 3W7EA 3LPGA 1VCFA 3FVMA 3P6LA 5T9CE 3WH6A 3QVQA 1TWWA 2DT2A 3WH7A 1AW1A 4KRZA 4QXIA 4MYXA 3PJXA 2GWNA 2VDIA 3V5OA 4N6FA 2VFDA 1V4YA 3N1AA 4HU3A 5IXEA 4BQ2A 3W88A 3F7JA 1XXXA 1EBGA 1X6NA 4OU1A 4DWDA 1OC5A 3UWEA 5DT5A 2Z1XA 1RCXB 5JBDA 3PBGA 2WVUA 1UWUA 4AMCA 5ABEA 4JQ4A 2OEJA 4RE3A 2XM1A 1LZOA 1PWMA 2OQLA 2P88A 3D3FA 1SZEA 2XZ9A 4MZ8A 4NAFB 3QFWA 3ELFA 3RG6A 1CLKA 4BK9A 5A95A 3G0SA 1GW1A 1UR9A 3LGGA 2X05A 1QNSA 2BY0A 4XKYA 4S3DA 1X1NA 3LBCA 2FDMA 2CU0A 4OQVA 2A7NA 5I3DA 1SZFA 3WNNA 4ACZB 2X0YA 3DFNA 4IGNA 1CT5A 5HR7A 4CQ8A 1CGTA 1EP3A 3UNDA 1W3KA 1A3HA 1E1FA 1AQ0A 1AQHA 4LF1A 2VEPA 3EPMA 1VBUA 7A3HA 4HA3A 4MOZA 1SW3A 2C3ZA 3SQMA 3F4VA 1IEIA 3MWAA 3TFCA 2QMJA 3FEMA 4PH6A 3BXWA 1E6RA 4JN8A 2QULA 1XH0A 1E6PA 2H9AA 1XIJA 5CC3A 4LBUA 3A47A 4R9OA 5B80A 2GDVA 3M0LA 3TYAA 4KWOA 2VC6A 2RDXA 1F4HA 1QWKA 1W1YA 2PI6A 4YIWA 2FZNA 4MDOA 2XM2A 1KTNA 5CG7A 4FS9A 4Q8PA 4JL1A 4V1XA 3ARZA 3AMKA 5EMUA 5I0DA 4AD0A 4WDTA 3KHDA 1KM4A 5TBOA 4IUGA 4M1BA 2DV0A 2QJIA 4L56A 1L6WA 3DBNA 4HPXA 5EFFA 4D8LA 1YE4A 1YBQA 5G2HA 2PWVA 5FI8A 3B05A 3T2OA 3R0UA 3QMTA 2Z24A 2HEJA 3BW3A 2WO5A 4PEEA 4EF8A 2V30A 3DFYA 4MB3A 4LCRA 4X9YA 4UQDA 3HGJA 3EX2A 4GQGA 5H8PA 1NARA 2ZRUA 2WWCA 5AYZA 3TTOA 1XRVA 2DUZA 2CHOA 1FUYA 2D2JA 1GVOA 3PWGA 4M5PA 1PYMA 4GVIA 3A6OA 4ZOBA 3JU2A 1VLWA 3EMZA 1Z89A 3NPUA 4AHOA 2JF7A 1A53A 2QXWA 5FF0A 3W26A 3C3NA 3P5ZA 1EPXA 4NZFA 2GVJA 4IX0A 4V33A 5LIWX 4MIMA 2O55A 3OZPA 2W61A 3KM8A 4FSAA 4M82A 2VC5A 4FX8A 3SAZA 1VB9A 3H53A 4MAVA 4J9JA 4LVGA 4P7RA 1LDCA 1P6CA 4ATDA 2ON3A 2I57A 3N4AA 2OVLA 3EWXA 4RDVA 1N8IA 4MWAD 1CECA 4A8NA 3F03K 1DKWA 4O8RA 1I60A 3UZJA 2YPIA 3CB8A 1W3HA 4KIEA 1JDEA 5DMMA 2EPMX 3WH5A 1TWZA 3FCPA 1E51A 4WY0F 4AYGA 5LGZA 4AWEA 4PMUA 1J0KA 5EL1A 5TNVA 1RJQA 4LY4A 1OQFA 2DH3A 4KIRA 2JFEX 2V81A 3IV8A 3N2CA 2J6XA 4ZFCA 3UBPC 3PN8A 1FFRA 4RPPA 3CUXA 3VDCA 1ICQA 4E38A 4F4RA 1OX4B 2B31A 1M68A 2D2HA 2EG6A 3OGVA 4HMDA 4NX0A 2JBMA 2YX0A 2E0PA 4FNQA 2W6RA 3N4EA 4GQ0A 4DO5A 1HJUA 4JFTA 1FRBA 4GFIA 2A3CA 1MQRA 1G69A 3L0GA 1JPMA 3PVFA 3ZT5A 5LIYX 5T9BG 4BFAA 5I3GA 6REQB 4M24A 4Z2JA 5IHSA 4HQVA 5D37A 4C6JA 1F7BA 5HAOA 1XCXA 2QNEA 3MSRA 1KRBC 2Z29A 4ZFMA 4JNMA 2WZHA 3TYBA 3FS2A 5CXPA 1U83A 2E7FA 5HQEA 1MDLA 4PR4A 5A6AA 2IQTA 4DM2A 2GQ9A 2VCBA 1L6YA 1VRXA 4K2SA 1YXCA 2WSRA 3KRUA 4CQAA 2GVEA 2PDBA 4NRRA 3UYCA 5JH1A 2E8YA 4PB4A 3KOWA 4FALA 3WQDA 2J7DA 5TQLA 4GZ7A 2ASHA 4JICA 5CAHA 2R1MA 3RF9A 4D8AA 5D33A 3V36A 5DXYA 2YDRA 1KBJA 4RW3A 2OQHA 3G6MA 3W2LA 3VKJA 2XN2A 3I6TA 3FDGA 4ICCX 3ABQA 3BAIA 2VENA 4LJ3A 3NZRA 3GIQA 3BZGA 2GQAA 3F5LA 1M9HA 3D6NA 2HXUA 5CGQA 5XINA 4YYCA 2O0TA 1C9WA 1BXBA 3GVGA 4EAMA 3OBEA 1F9CA 3WLTA 4E8GA 2X1RA 3H2EA 3B8WA 5LKYA 3BOFA 3U5UA 5G2IA 3TDFA 3SADA 3VXGA 4AXNA 2V8ZA 5DXXA 3LQLA 2G41A 1UROA 3PNUA 4CNOA 4UTUA 2A3BA 1SFTA 1GEQA 5CZKA 5T91A 1KM1A 1OFDA 5HINA 4DWSD 3N9RA 5JIPA 1S3HA 3W7QA 3ZWTA 4WR3A 3DHUA 4XZNX 1PV8A 3EOLA 2IS7A 1VD6A 3LMYA 3RU8X 2R82A 5AY7A 1GVIA 1GVYA 4XQ6A 1UZ1A 3G0XA 1AZ1A 1S39A 3W7KA 4O57A 1G9HA 1MXGA 1W31A 4UFLA 2WSYA 3BCJA 2FTWA 1EJVC 3M0VA 3CBWA 2B7NA 4M56A 1GONA 5FJJA 3YPIA 1TV3A 4JX4A 1DIOA 3WDPP 4F8XA 4QDMA 1RK5A 1QJWA 4W7VA 4J3VA 1OG0A 4PUMA 1IXNA 1KFEA 2J25A 3NVDA 3LNMA 2VFHA 1V5XA 5J04A 4QTGA 4Y90A 3R1ZA 2PDNA 1WUEA 4XZIA 3CLMA 1XYZA 7TIMA 5BRQA 4KEVA 3PB0A 1E4MM 4ATWA 5A8MA 1OADA 2WK2A 1WZLA 2WZEA 3A24A 1FFQA 4NXKA 4FLSA 1K9EA 2C0AA 5ABHA 2FGZA 1I75A 1H41A 1EJWC 3P67A 4AMAA 1P0BA 3ARYA 1RCOB 5D2YA 2OSXA 3GBDA 4GO8A 1KCZA 2QGYA 3QGKC 4PTMA 1S38A 3LXCA 2JEQA 2WAGA 1U5HA 2PTYA 3N73A 2Q8XA 2DT3A 2CKSA 2PC8A 2BXVA 2PD5A 4O1AA 4WD0A 2DQWA 3AS0A 1VHCA 1CDGA 4Q7BA 4GPNA 4C1LA 2DH2A 4NKCA 3W38A 4WKFA 1P6BA 4WSKA 5C9UA 1H5VA 1FXPA 2MANA 2YOCA 3GUWA 1TPFA 2HS8A 1R9ZA 3ES7A 3AYTA 2HXTA 4WIWA 2CZDA 1EC8A 1WBJA 1BHGA 3V3WA 4S3CA 4O53A 1KCXA 3AHVA 2YR1A 1X38A 1HNYA 4MLJA 4ATLA 4ZODA 3PS7A 1FWAC 2WPBA 2PWHA 5BMXA 1JRBA 1WPCA 2XDFA 2XVNA 3HGRA 1FOBA 4PC8A 2ZE3A 3UEQA 2FZDA 3B03A 4UQEA 1ZJBA 3KHJA 4EXBA 1B9ZA 2C1IA 4HP5A 4OUIA 1HUVA 2E1DA 4N2YA 3BARA 5K9XA 3WJZA 5KINA 3BMWA 5KSWA 3T8LA 3KVMA 3WQ5A 3IJQA 3PZNA 1UUQA 3WZ0E 1EJXC 3GB6A 4W8AA 3PC0A 4ZEPA 1EZWA 1J0YA 1JCLA 5D30A 2CPUA 1YTEA 3JZEA 3M6DA 4CD7A 1I0DA 4O28A 3H7RA 4IH3A 2D0GA 5I06A 4Y7EA 4HA1A 4CU6A 3FGCA 3WBWA 2YL9A 3GO2A 2OR2A 3AHZA 3ATZA 4WVXA 2P50A 5C2GA 1ADDA 2VD9A 3EEZA 3B0PA 1TREA 3HQNA 3TVAA 3LXBA 4GVGA 3KEHA 4GXPA 3C0QA 4CQDA 2FLIA 4DO6A 4RNJA 3T44A 4KFNA 5CQ1A 4QJ3B 5BOOA 6A3HA 2DJLA 1E15A 4JPGA 2ACSA 1E72M 4IIFA 1FBAA 3VKBA 2CBJA 3P62A 1J5SA 1V77A 3G1VA 3LHWA 3P3BA 2QV4A 4C6LA 5LYRA 4D9PA 2Y7FA 2ZDSA 3GTXA 3VFCA 1I6NA 8A3HA 3W2MA 5A3HA 1DWAM 5F4SA 6XIAA 4K3ZA 4C7GA 3BJSA 2QF8A 2G3NA 1B3ZA 3WLJA 2HVOA 4ZXOA 1JNEA 1UQYA 2DUAA 6ENLA 2OGYA 4XZBA 2O7QA 4GNJA 1CZ1A 4QJ4B 4RZ4A 3MW7A 3QM3A 3NZ1A 2G5WA 4QEHA 3CL6A 1SFJA 2PURA 4JEQA 5G1YA 1C8VA 5HA7A 3CZEA 4QG6A 2QMKA 3NL5A 3TYUA 4YCPA 2BG5A 2EG7A 1GOXA 3PPCA 1ME9A 2EJ1A 3HQ1A 1FVPA 1IR2A 4ASTA 3XIMA 2HBXA 3IJIA 1N82A 4H7ZA 1XCWA 4QJ5B 3GR8A 4JTIA 4CQ9A 1BF2A 4JTRA 3S2CA 2BOFX 2X30A 4MB5A 3KW3A 4EIVA 4ALDA 3POCA 5EMKA 3VOJA 2AOSA 1WNOA 1EDQA 3A9BA 1DIEA 1FWIC 2DZXA 4G9PA 4Q8WA 2E4TA 1KW1A 3W25A 1U2YA 1TUFA 1R0MA 2HVMA 5CLWA 3NQFA 1BQGA 2NVCA 2WHLA 2DZPA 4Z08A 2DZVA 3DGBA 4X61A 5DRCA 5BWAA 1RP8A 3TYDA 2WM0A 3MO7A 4FXFA 2XTKA 4LS0A 3WQWA 4E0CA 2PBGA 3GZAA 3UR7A 4IICA 2PGFA 4X3ZA 4LSBA 5CPOA 3UJSA 3SI9A 3PPFA 5HXMA 3HU7A 4PCFA 4B4HA 3HF3A 3NSNA 4PZVA 2FJUB 2VUYA 4ORIA 4HKPA 3C8NA 3WG6A 5BZAA 4EWND 2C6QA 4GACA 1WOBA 4JXCA 3QKZA 3OYZA 1BD0A 1HP4A 1O5RA 3WMBA 1VLIA 1QWGA 3P81A 2DGAA 1J11A 3G22A 2ZOXA 3EDEA 2YZRA 2WMKA 5A6BA 2PWGA 4A8IA 3IGXA