3LI1A

Crystal structure of the mutant i218a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGAIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3li1A00
4G1KA 2CWNA 1VYSX 4X2RA 3S0CA 3W1TA 5F4WA 1Q3NA 2V2CA 3NVTA 4JR5A 5D2VA 3P8JA 4NX0A 3HBLA 3GZ3A 1J4EA 1DORA 1Z48A 3E96A 3TKFA 3FJLA 3TIMA 3ABOA 3IVUA 2E5CA 1DKWA 1K8XA 1GG1A 5D2WA 4R53A 1W5PA 1KBJA 2YGYA 2AAMA 3WFAA 1KFJA 1KLZA 3R13A 3M5XA 1SPQA 3P80A 1H7RA 1TPDA 2BXVA 4GUFA 4UNKA 3W7EA 2VEIA 3N19B 2ZZ6A 4LRSA 5AYYA 1G4EA 2JGYA 4NJKA 1VR6A 4FX8A 2A21A 4M7SA 1OHLA 1J2WA 1JQVA 1QMLA 2QR6A 5I3JA 3QYQA 2EAWA 1LTDA 3QFEA 5DBUA 2ZRWA 1DOSA 1Z42A 2VEKA 1S5TA 3GDKA 3DFPA 4ADSA 1KA9F 2WO5A 4AEOA 3NPVA 5C54A 5FEXA 4HPJA 3C3NA 3O07A 4NJJA 1AW5A 1FBAA 3TV8A 2B0MA 3ZS4A 4MPQA 5LHFA 4ZZ9A 3UWWA 1K7FA 5HJLA 3WJSA 4JTGA 1XBYA 4WY0A 3P82A 2DZTA 4CNNA 4ZQRA 3BO9A 4FNRA 3Q58A 1VH7A 4UNLA 1LLZA 2H3BA 3NQVA 5CZSA 3JS3A 2RH9A 4QISA 4BWLA 1W5NA 2H8XA 2O7QA 3GX9A 1JCXA 1ZAJA 5K4ZA 1RQBA 2ZTKA 3DHDA 3B4UA 1VCVA 4UR8A 3G1DA 3GK0A 1XBXA 3KVJA 1SO6A 1MEHA 2FPVA 4DF0A 1TQXA 4UIOA 4O0ZA 4ZQNA 3W1PA 2HSAA 4PH6A 4A2SA 1EWDA 5AHEA 4N6FA 3LCGA 3GAYA 3O6CA 4CNPA 3O16A 2DZWA 4FO4A 5KITA 1JCYA 1CW2A 4JTHA 1VCGA 3F4WA 1TTPA 1DQWA 5HNRA 2GPTA 5D33A 3UD6A 4O4WA 4YWIA 3G1HA 4MJZA 4CQAA 3PVFA 4MFEA 3W7QA 4IPJA 3W73A 4MUZA 1W5QA 1OVDA 2ZRZA 1JCNA 4XUGA 2QAFA 1FCQA 1WBHA 1M6JA 4DXVA 1XCFA 3W7CA 2Z6JA 1NF7A 3W88A 4B5NA 2ZCGA 3FS2A 4K6AA 3TSMA 2I9EA 3T40A 4GJ1A 5G1YA 4ALDA 1DBTA 3EWBX 4PFMA 2ISVA 3ZR4A 5K2ZA 4UUIA 3SJ3A 4AHPA 4MIMA 3M5ZA 4IOTA 3ATZA 4FNTA 1ICPA 3DI1A 1TJRA 4AF0B 1TPWA 3HPXA 2PC4A 2TPSA 1VYPX 3SW6A 1VLWA 3EXSA 5F2LA 3NXFA 1A5AA 3WJWA 1AW1A 2JK2A 3E12A 5AFDA 1W0MA 2Y7DA 4JYFA 1OABA 3W1NA 4QM1A 3CC1A 5HQEA 1VQTA 3L67A 1NEYA 3GVGA 1XFBA 1LOSA 3STGA 4LRTA 3UWVA 3G0XA 3BV4A 4XWUA 5G2WA 2ABAA 2BZNA 5DN1A 3FOKA 5LNUA 5I3KA 1W8SA 5DY3A 1DHPA 1SW7A 4YCPA 1EUNA 3G0UA 4MZYA 3LX9A 1IGSA 2Y89A 3DU0A 3KVLA 1YDNA 3PC0A 3E0IA 5K7JA 3QF0A 3G0SA 1YPFA 1ZALA 4WUIA 2V82A 3W1AA 2GVJA 4RXFA 5CPNA 4NNBA 1THFD 1GVQA 1YDOA 5FF7A 3GYEA 4HNVA 4KWWA 4NNCA 2Q8ZA 1FCUA 4LUJA 3W70A 1Y0EA 1IXQA 2VELA 1L6WA 3LB0A 4TMCA 1FX6A 1GVSA 1JR1A 3PB0A 4WJEA 1TV7A 3C2VA 3KFTA 2WPBA 4UFLA 2ZYFA 3VI2A 3W23A 4JTJA 5FF3A 2PRMA 5L9FA 1FWRA 1V7YA 2FTPA 1P1XA 3W7OA 5LNVA 3W7NA 3A22A 1SUXA 3GAKA 1KM0A 3M1ZA 4IUOA 3G18A 3HG5A 1W37A 1QAPA 2VEPA 1X1OA 4JIPA 3VE7A 2TYSA 1ZAHA 5D38A 3C6CA 3O6DA 1SZNA 1C29A 3KVMA 1TQJA 4DQWA 4JY8A 4ORMA 5I3GA 3HG3A 3UZ5A 4KFPA 8TIMA 3TE9A 2E5BA 5HINA 2ZA3A 4BI6A 2QCCA 4NXSA 4AWSA 1VHCA 1Q6QA 2YYTA 3C2OA 3TFCA 4D2JA 2E6DA 1UJPA 4LVBA 1UUOA 3NQ6A 4JY9A 1PIIA 4LUIA 2OX1A 5KMYA 1ICQA 1PHQA 3DBPA 4ML9A 5TIMA 1H7WA 4CCDA 4O0KA 1EB3A 3N9SA 3GXPA 4ONVA 4M5PA 2C0AA 1I4NA 4JS3A 5LNWA 3STFA 1OX5A 3NNTA 4RLIA 1EIXA 2J6XA 2Y6ZA 3M7WA 3DAQA 1LORA 3LI1A 1G6CA 1WA3A 2X2GA 1CX9A 3W2MA 1RQEA 1PVNA 3FA5A 2RFGA 3I7QA 3TQVA 2EHHA 3AO0A 3TC7A 3GDRA 1LYXA 1ML1A 3R8RA 1PL9A 2P1FA 3GKFA 1K7XA 4H4IA 3GIYA 3QQ0A 2VFHA 4XTDA 3EX3A 5LSMA 3ABQA 2NXGA 1FXPA 3TFXA 3WK3A 3ZWSA 4JEQA 5HWMA 5G5IA 1OYAA 1UUMA 1ZCOA 1GVOA 3IIPA 3QM3A 4WOZA 4DO5A 2Z6IA 3S5ZA 4GFSA 3CHVA 3PR2A 5HUOA 3A21A 2ZZ5A 2YXGA 1P0KA 4LU0A 3RF9A 2QCHA 2CLEA 5CSSA 3W74A 3INPA 4MYXA 3EWYA 3O6YX 4R33A 3L5AA 2ZRYA 4O54A 1JJKA 2ZZ1A 1EPXA 3LHZA 2CLMA 3CM4A 1OYBA 1R30A 4CCCA 3LHVA 1O5KA 1XDLA 1HTIA 5CG7A 1KFKA 3G1SA 3P84A 3OIXA 2C19A 2A7PA 4UTTC 4UTWC 1OF6A 2WSYA 3G1YA 4LC8A 3W84A 3W7MA 2GOUA 3NDOA 2X1UA 4Y90A 2JBMA 3QC3A 3M5VA 1OX4A 5AC7A 4UTMA 2NWRA 4Q4KA 2W79A 4LVDA 1TMHA 2Y62A 3T55A 4N9DA 3FKKA 3BW2A 1W31A 1LM1A 1B57A 4GBUA 2GQAA 3MI3A 5IBXA 1JRBA 2WNZA 3M0ZA 3EEGA 2CZDA 2XN2A 4XBSA 5CZJA 4LWWA 3IRDA 2V9DA 2NX1A 2DU2A 3CWOX 4EWND 3W22A 3PG9A 3NG3A 4MZ8A 3OEXA 1OF8A 3M44A 1FY6A 3P5ZA 4RCXA 2QF7A 5F1VA 3W72A 4I7WA 3M16A 5EKYA 1EWEA 3NM1A 4CNOA 3R5EA 4LT9A 3G1XA 5KZMA 2OT0A 2QCDB 5E1QA 3A23A 3A5FA 4FNPA 4DF1A 5HWJA 3W1RA 2P0OA 4S2BA 3L0NA 5EMUA 3N9RA 3EWWA 2R14A 1GZGA 4M7TA 4O12A 3IVTA 5HR6A 3KXQA 5D30A 2C13A 3F4NA 3WJYA 1VYRA 3N3MA 2PCQA 4RKAA 4E38A 3CTLA 3P67A 3VKJA 3BG3A 3HGSA 4OV4A 5EY5A 5HWNA 4JYDA 1ME9A 3S5NA 1QPOA 4OE7A 1YYAA 5D02A 3WK2A 1GT8A 1Z41A 1TPC1 2CLIA 4S1FA 3IIVA 5AHNA 4O52A 1QWGA 3PULA 2QUUA 4AAJA 4MKNA 4TIMA 4PC8A 4MLJA 3PUEA 1VJIA 3T78A 3W7IA 1HFBA 2O7SA 4O28A 1K7EA 3H53A 2GQ8A 3CPRA 3NL2A 5C2XA 5C6MA 4UR7A 1JQXA 3W71A 2JKEA 4NXKA 2GVLA 3P62A 3W7DA 1ICSA 3ELFA 2JKPA 1MXSA 2X1RA 5DCDA 1SO5A 5SWUA 1F6KA 5DXYA 3I7SA 4KFOA 3CT7A 1ME8A 4FNSA 4Z0JA 1EX5A 4HNUA 3EWZA 1N55A 5BNKA 4JTFA 3DZ1A 3CQ0A 3EX4A 4MZ1A 4BK9A 1H7PA 3QMSA 4QNWA 3MYPA 4DBDA 2A6LA 1SZFA 1G4TA 4AVFA 1XL9A 2B7OA 2Z1BA 2H90A 1GTEA 1SO3A 3PBVA 5D2TA 4TMBA 3DENA 4H3DA 3DKJA 1UB3A 1OFAA 3LTYA 3S5YA 4IWWA 2DZSA 2YFOA 5D09A 4PTNA 4HIBA 3PUOA 2BSLA 2JGQA 1NAL1 3EXRA 3W2KA 4UC5A 1TTJA 3L0KA 1W3IA 2CU0A 2RDTA 2RKXA 5CZTA 4UCGA 1FWSA 3G8RA 5DCBA 3BGGA 4IPIA 4UFHA 2DZPA 4BF9A 2PE4A 4Y8FA 4K7VA 1H5YA 3OVPA 4O11A 3JR2A 2QKFA 4UMBA 2ABBA 1S3HA 3SFKA 4GRSA 2FIQA 3P81A 3UY7A 4CQ8A 3NPXA 4YCOA 2NWSA 1XDMA 4C1KA 2TRSA 4OGZA 3W1MA 4Z08A 4GC4A 3LGEA 3SSJA 2H3DA 1PE1A 1S5VA 3FYOA 3FJ6A 4RZ4A 2YZRA 3QSRA 2DORA 4HSNA 1KTCA 3OA3A 1GQNA 1AK5A 3USBA 3LM7A 1FWNA 3S1XA 2YW3A 3C61A 3N34A 3UWQA 5TQLA 3U2OA 4ICNA 5KZDA 5CPOA 4O17A 1AMKA 1FXQA 1G7VA 2Y88A 3BGJA 3TMLA 1ZENA 3TK7A 3CIXA 1NF0A 1T8XA 1QPRA 3G3MA 3I65A 1IXOA 2DP3A 3GXNA 3CU2A 3HGJA 4XKYB 2R94A 1EEPA 3UZJA 5LGZA 3BW4A 4JTIA 3EXTA 3UQNA 4OHQA 3ATYA 4NJIA 1JUBA 4HNTA 3KRSA 3FFSA 4IJBA 2NUWA 3LBCA 2YSWA 1D3GA 1V5XA 1ZJIA 5KTLA 1R2TA 3GR7A 1Q6LA 1KM6A 1LRTA 3NZRA 3OBKA 3VE9A 3MJYA 3NL6A 1XUUA 1TB3A 3UWYA 4FXSA 1G4SA 4Q33A 4LV9A 1OFDA 5BMXA 4U28A 2ZFAA 3W85A 4EF9A 4GUHA 4BWLC 1WOBA 1Q6OA 4GXMA 1M5WA 1FQ0A 1LBLA 2QDGA 2WV8A 3GR8A 3PWAA 4A21A 1YLVA 5IM51 3LXCA 4O14A 2X16A 3RNDA 3P5YA 3PF3A 4RX0A 3Q37A 2VENA 3MI6A 4JN6A 1EA0A 1I2PA 1F74A 2OJPA 4PL1A 4O18A 4LS1A 1L2UA 4AWUA 3GDMA 3Q2DA 1G7UA 4GNJA 4DBEA 3RFAA 5ABTA 3TSBA 1TV5A 2D73A 2B4GA 3CEUA 1XBZA 3LHWA 4HKPA 2V2HA 3U6WA 4IMEA 4IMGA 4ZVJA 3MHUA 4X9SA 4JXCA 1MZHA 2OZ0A 4MY1A 3STEA 4Q32A 1A53A 2QUTA 1I2OA 4A2RA 4UTLA 2CLOA 4LV4A 3T7VA 5LGXA 5C5YA 1VHNA 3GLCA 1VGAA 4NZJA 5D04C 4NNAA 5J5RA 3BG9A 1MEIA 4UTHA 2B7QA 1KM3A 3RLVA 1WAUA 2PRHA 4MOZA 1LOLA 1QDSA 4BR1A 1RPXA 3W07A 1S5WA 2WKJA 1MO0A 1IIGA 5H91A 3HIJA 3R12A 3NA8A 4JD4A 3T44A 4ZQCA 1TPUA 1OK6A 3PG8A 3LCHA 1R2RA 3TR2A 1W1ZA 1D3HA 2ZZ3A 2W6RA 3SR7A 3UY8A 3TSDA 3W7PA 3D0CA 4QITA 3BLFA 5CGQA 4HSOA 4UTKA 4UTWA 4O16A 4I7UA 1SZEA 3NPUA 4A3UA 4DELA 1WQ5A 3UYCA 1FCBA 3W1XA 5K9CA 2NLIA 5E93A 1MEWA 1SSDA 4LVFA 2I1OA 3HQ1A 5L6UA 3LRKA 1F05A 2AQWA 4QQ3A 2CZEA 3W1UA 3M6YA 3W83A 2E68A 5K9DA 1X6UA 4OBTA 1HUVA 1W5MA 4O53A 3EX1A 2QCGA 1L6YA 1VS1A 3Q94A 3DXIA 1NFBA 2ZTJA 3N2XA 4N9BA 4XTIA 5HULA 1XBVA 1GJPA 3PS7A 3HPSA 3C8FA 4ZQMA 1WDWA 3G3DA 4UTIA 1DV7A 5FF4A 1OK4A 2PRLA 3KRZA 5U7SA 3RU6A 3S5OA 3TAOA 3EWXA 3PBYA 2YFNA 4DF2A 5MHBA 1KM1A 1TTQA 4MFDA 4MJMA 3TU9A 1LP6A 3F03K 1OFPA 5D37A 3R89A 3MHGA 1O5XA 5EYWA 3L68A 3LERA 3FLUA 2FQIA 1OJXA 3FKRA 1TRDA 4LOCA 5U4NA 3P74A 2PURA 1PCWA 3PBUA 3M43A 1AL8A 3FIGA 3O1NA 5AHFA 3TAKA 3UPWA 3TROA 3MBFA 3B8DA 3H55A 1M7OA 3UXAA 1H7XA 1U5JA 1K03A 3DH7A 4UFJA 2G5WA 2NUYA 3KOFA 1OFRA 1A5BA 1P0NA 2WSRA 1H1ZA 1GTHA 3MWAA 2ALDA 1VPXA 3E02A 4RJEA 2ZRXA 3LXAA 3MP3A 3PSWA 4ZL1A 1Z44A 4QIUA 3DI0A 4A29A 1O95A 3NQ7A 1JULA 2GJLA 3BLEA 4K7YA 1D9EA 2HS8A 3DFOA 3TJLA 3N73A 1TYGA 4EOUA 4UMAA 4NUWA 5KSWA 1B4EA 1N7KA 1PCKA 3PUDA 5I3HA 4FEZA 4POCA 4O1BA 4FHAA 2XN0A 3KRUA 5I3FA 2I14A 2A7RA 1IXPA 3EB2A 5HUPA 2A85A 1I45A 3MBDA 1ONRA 2QJIA 4WX2A 3P7YA 4ZQPA 3CLMA 3G1VA 3WK0A 3IIXA 3LRMA 3MMTA 2J9ZA 4HT3A 5AC8A 3YPIA 2F7FA 1A50A 4BI7A 3W7KA 1IIHA 1O94A 4AHOA 3SZ8A 2P10A 4KKXA 2FJKA 1JCMP 1K02A 3NQMA 4O19A 2ATMA 2NV2A 4IX2A 3G1AA 3NQFA 4EVZA 3NQCA 2G96A 1AL7A 5A8GA 3HJZA 4DPPA 1YDVA 1SW3A 3W76A 5EA9A 4TX9A 3LHYA 5F2GA 3GDLA 3M9YA 2RHGA 1W56A 1HL2A 3AJXA 1LRNA 3K30A 2V5LA 4R34A 3W1QA 5LNRA 4OQVA 1J5TA 2YW4A 1H7OA 4BFAA 3S9YA 3DHFA 3GNNA 3KHJA 4LY8A 1SU5A 1RD5A 1XUZA 4Z1AA 5FEWA 1H7NA 3LCIA 4P61A 1AW2A 3HGOA 1N8FA 3QZEA 5KINA 3N2MA 3DFSA 3MO7A 4MYAA 3QW3A 1JCJA 1EP2A 1KM2A 1FCVA 1LDCA 2ATSA 2C3ZA 1UBSA 5G2IA 4KFNA 4WQ6A 4GE8A 1EP3A 5F4SA 3L0GA 1JUKA 1G69A 4XQ6A 4RR4A 2Y7EA 3RLUA 3PM6A 1TRIA 4KWVA 3M47A 2XFWA 5K4XA 2NX9A 4JDYA 3RMJA 3L5LA 3HGRA 3H54A 3EWUA 3M41A 5DCEA 1QCWA 2FB2A 2OMAA 2A4AA 1FWWA 2DJXA 1KFEA 2X1TA 4PEKA 1QO5A 4UFKA 4WZHA 1JVNA 3LV6A 1H1YA 2VXNA 2A1YA 3IV3A 4PODA 1JCLA 2BWGA 1OFQA 2R91A 5D05A 3U8GA 1L9WA 2CZ5A 1BEUA 4Z1DA 2V5BA 3VNDA 1LZOA 2ZA1A 5C55A 3W1LA 5F4XA 2TSYA 3QJAA 3HG4A 5HMSA 1DJNA 3IGSA 4PA8A 1KLYA 2QCNA 3R2GA 5CSRA 1MSSA 4RXGA 1G67A 3JRKA 5AOUA 1WBJA 1NSJA 1WXJA 1FDYA 3I6RA 5TBOA 1TIMA 2QJGA 2FLIA 2IQTA 3PBWA 2E6FA 2NXIA 4GUGA 4IXXA 3LLFA 1C8VA 1SO4A 3QQ1A 4JX4A 3KX6A 3TC6A 4MLRA 2C15A 5LNSA 3MYOA 1OYCA 2C6QA 2WJZA 1KFCA 3ABSA 3UNDA 3I68A 2EPHA 1LOQA 2NUXA 3WK1A 1F7BA 4DEFA 1TCDA 1YTEA 3LCLA 4AWTA 5DELA 3QPZA 4JIQA 4R7JA 1TV8A 5EPDA 2V0TA 4WXYA 4O15A 3BLIA 3UXDA 1YADA 1M7PA 4N9CA 3PSVA 3MUXA 2QEZA 4M6PA 5AYZA 5I3IA 3MW7A 3QH2A 3SGUA 3W6YA 5DBTA 1B9BA 2VFGA 5IBXC 2X30A 3WJZA 2FPTA 1YPIA 2Y7GA 2C18A 1EP1A 3KVKA 4NJHA 3HG2A 3NEVA 1PV8A 1W54A 7TIMA 4PCFA 1E51A 4K37A 1TPFA 3W7LA 1OX6A 3LOTA 1LBFA 4I9AA 4UMCA 4Z1BA 1R47A 2Y61A 1QOPA 3L9CA 3LHTA 4YXGA 1LROA 1QPQA 3WJXA 1TJPA 1QPNA 2OT1A 4N4QA 1QFEA 4PL2A 4IMDA 4A22A 3LHUA 2CLKA 3EX6A 4LVGA 4ADTA 5FF2A 5FI8A 1WV2A 2QJHA 2Y70A 4UTJA 4AMAA 1K3UA 2B7PA 3O63A 1W3NA 4S2CA 5CZ0A 4O8RA 2YR1A 3BG5A 4CCEA 3A9IA 3IIOA 2QDHA 3V1PA 1H51A 3B06A 3MP4A 2Y63A 2DJLA 4JNMA 4IMCA 1JRCA 1XXXA 1WX0A 3ZWTA 3MHFA 3IIZA 4OU1A 3CWNA 5BOOA 2YDAA 3TXVA 1O60A 2Q3OA 3UWUA 3BVJA 4NU7A 5LHEA 6TIMA 3LV5A 5AN7A 3EX2A 2ZZ7A 3CB8A 2HTMA 5CPLA 1GYLA 1YXYA 3TJXA 3C2FA 3ABRA 1GVFA 3LCXA 3EKLA 3P8IA 3LCWA 3NL3A 5AHMA 2YPIA 3ANYA 3S6DA 4K39A 2GQ9A 2ZA2A 3W9ZA 1KTNA 4E0CA 1K8YA 1BKSA 1FDZA 4AHQA 5BW6A 4TR9A 1TPB1 4QJ1A 3S1UA 3TCEA 3B05A 3QMTA 5D32A 4RV8A 1QOQA 1W5OA 2TMDA 3NQ8A 3E49A 4U4MA 1O4UA 1T96A 4O1AA 1GG0A 1PS9A 1VRDA 3TNOA 1VLIA 3S8HA 1I2QA 2DZVA 5F1UA 4AXKA 4FX6M 1OFBA 1QO2A 2W0UA 1HO1A 4K8EA 5K9XA 3ZFHA 4UFMA 1I2RA 4WXZA 3NOEA 4DO4A 1VZWA 3FEMA 3W2JA 1X1ZA 2CLLA 2ZZ2A 4LW7A 3HO8A 3RK8A 4CLMA 1LCOA 5G4WA 1GOXA 4FNQA 3SIZA 3O8AA 1P5BA 1TREA 4JTUA 1U83A 2C16A 2G97A 3THQA 1SQ7A 1F6PA 1BWLA 1TPVA 1LLWA 2E77A 4IXHA 4M6QA 3LTPA 1F73A 2RDUA 1SSGA 2WSQA 2ZDRA 3HPZA 1KFLA 4WY0B 1DQXA 3NPWA 3DFTA 1GVRA 5EBUA 2E5DA 1JUEA 2E09A 4J9JA 3LCFA 2ZZ4A 3GNDA 2GJNA 3TDFA 4UTUA 4QNEA 4NJGA 4NT0A 1T99A 3N14A 3UWZA 5GVJA 3NL5A 4JICA 1B4KA 1OX4B 1Q45A 4JTSA 3CIWA 3TQKA 5LKYA 2G95A 4JTKA 4ZMGA 4O50A 4DO6A 2FB3A 2A6NA 2NZLA 2BX7A 3NQEA 1CI1A 3TX9A 3TA6A 1HG3A 2VEMA 4NZFA 2H6RA 3W75A 3VFLA 1RR2A 4O4VA 4AF0A 3LI0A 3SGZA 5D2XA 1SW0A 3VCRA 1XI3A 3LRLA 2V8ZA 1Q6RA 3W87A 1B3OA 1KV5A 3W7RA 2VKZG 4AH7A 4W9TA 3F1QA 3HF3A 1XKYA 4GUJA 2ZRVA 3BARA 4FIQA 1L6SA 3G1FA 3V75A 3M5YA 1QR7A 2B7NA 4N4PA 4WD0A 4Y6GA 4N02A 3TXZA 5LZLA 2Y7FA 4O1CA 4JX6A 3OHIA 3W7GA 2QAPA 2BLEA 3BW3A 1UCWA 2R8WA 1KTBA 3S42A 1DVJA 2C1HA 1BTMA 4JTLA 3DFQA 4BI5A 3W3OA 1IF2A 2J27A 3B0PA 3CEPA 3QEZA 3W2UA 2CFFA 2FDSA 4L4LA 3NQ2A 2FFCA 4WY0F 2A0NA 4RK8A 3QSTA 4MY8A 2VFEA 2KZHA 4OV9A 5AYXA 2A5HA 1KBIA 2AGKA 4TU1A 3BK0A 2ZQ0A 3TUUA 2YYUA 4FB7A 2QCEA 4X22A 1H60A 4IQLA 4HN4A 2GUUA 3OVQA 1OG0A 2J24A 1X7FA 3NAVA 4X3ZA 1ZNNA 2WQPA 3W2NA 1SFLA 5BRBA 5J5DA 4H6KA 4NVTA 3QRHA 1ZY9A 2VOMA 4JYEA 4N9EA 1IXNA 1FUYA 1F5ZA 3B0VC 1UASA 3S1VA 1RVGA 3O06A 4O1DA 1H50A 2E6AA 1RQHA 4GUIA 2F84A 4O13A 3L21A 3IEBA 2DZUA 2NV1A 4JTTA 1GYNA 3GXTA 3OVRA 2LLEA 1G4PA 4JX5A 3TW7A 2QCMA 4IGHA 1GPWA 1ADOA 3A5VA 3SY5A 3L2IA 3TH6A 2CZFA 1GWJA 1TPEA 4GWEA 2DZXA 5AHIA 4MY9A 3O15A 4AB4A 3SI9A 3UPBA 4RZ6A 2Q8LA 3DGRA 4N2YA 1W3TA 2BTMA 3C2RA 3IGUA 4CQ9A 1F76A 4TO8A 1SR9A 1R2SA 4XKYA 3QPYA 5G1TA 1RZMA 3PB2A 4JGDA 5F2MA 2VFFA 5AHLA 1SFJA 4EF8A 3GDTA 3LTSA 1PHWA 1YXCA 1KM5A 1FWTA 5AB3A 4FIRA 4NX5A 3OG3A 5FEZA 3P60A 1T0OA 1K8ZA 1YTKA 5T26A 1KM4A 5DXXA 1VC4A 1ZFJA 2A2IA 3NQAA 2VFIA 2H8ZA 4WOQA 3NR0A 4ORIA 2HS6A 3E9AA 5D03A 4HHPA 4UXDA 3NYZA 5DLCA 3HOJA 1HO4A 4NQ1A 4M6VA 3C0JA 1KW1A 2RDWA 2QCFA 1DL3A 4O57A 4K8HA 3W86A 4LTSA 3LLDA 1EUAA 1OFEA 2E6YA 3B03A 1YTDA 2CLHA 3SECA 3STCA 1XC4A 2ZRUA 5HR7A 1H62A 4EIVA 2JKAA 2EKCA 4HNNA 4IMFA 5FESA 2ISWA 1OFOA 1TPH1 1P4CA 3FYPA 4LNYA 2YX0A 5CPMA 4XZ9A 2ZBTA 3QW4B 1WYIA 5EL1A 3T4CA 2QCLA 4L4MA 3I7RA 3L66A 4JTEA 4P2VA 1BWKA 3BPWA 1H61A 4OT7A 3NZ1A 4YL2A 3B0UX 3W2LA 3LBMA 2HMCA 2QCDA 1TO3A 2GVGA 1FDJA 2Q3RA 3O05A 4RZ5A 4Z0SA 3L5MA 1ZHAA 1TSIA 2YCEA 3MI2A 4LC6A 1X8FA 3KAOA 2V2DA 3PY2A 2VC6A 2NXHA 5G4EA 3A24A 4HPXA 1F2JA 4LS2A 2UV8G 4MVAA 2Y85A 3TMQA 2OCZA 5G2HA 3NGJA 4XBKA 2NX3A 2J9XA 3QMRA 4E2DA 4UFIA 3GKAA 3DFNA 2Z0IA 1GEQA 1QNVA 5F2IA 1I8JA 3TW6A 4Z1CA 4FF7A 1ZAIA 1YXDA 3NM3A 4ADUA 2CW6A 3GB6A 2E1DA 5KZEA 5E0KA 3EKZA 4E2BA 1ALDA 5DY2A 2EGZA 3C4UA 5BMWA 4C1LA 4M19A 3THAA 3LDVA 4OWGA 4Y9AA 1A5CA 3G8EA 1LRQA 3G24A 3LXBA 1LBMA 3HB9A 3W7JA 4LS0A 4QSHA 4FX7A 5FF0A 4N6EA 1ME7A 3L65A 3C56A 2XN1A 1VCFA 1NVMA 6ALDA 4FNUA 3IVSA 2J9YA 1WOAA 3C52A 4K36A 4Y96A 3S1WA 2ISSA 4YLWA 5AC6A 3DKLA 1R46A 3HMJG 2V81A 3W7HA 4QAIA 3P61A 1RV8A 2QUVA 2X1SA 2V30A 4K38A 2A7NA 3NQGA 3NO5A 2FPYA 4IX0A 2CLFA 1XM3A 3MP5A 4JDBA 2EF9A 5A5WA 4FXRA 3PAJA 2C14A 2WNQA 1KV8A 2WNNA 4YMZA 5H2ZA 1TTIA 3NQDA 1I2NA 2Z2UA 4ZQOA 3G22A 2VFDA 3TQ0A 4I7VA 1AG1O 4UTTA 2WOQA 2J88A 5CKSA 4DPQA 4O10A 5K3VA 3C2EA 1SZGA 1C9DA 1A5SA 5FEPA 1H63A 1KFBA 5D2YA 4LVAA 3B04A 3IGXA 1DJQA
chains in the Genus database with same CATH superfamily
1DE6A 1W3JA 4XIAA 3P2VA 3VDCA 5FJUA 3NVTA 4JR5A 3P8JA 3VOCA 2VX7A 1HKKA 3HBLA 3E3HA 5GJPA 1J4EA 4HMCA 3ABOA 3CJPA 2FZNA 2NQ5A 3RITA 4A3HA 4I5RA 4PMYA 2GDVA 4CVWA 4QJ4B 1KBJA 1CNVA 2XPKA 4E2VA 3N29A 1KFJA 1KLZA 2QMKA 4Y2WA 4LX4A 3P80A 1H7RA 4XX6A 2BXVA 4G56A 1U1JA 4KEMA 4DZIA 2W67A 2O9PA 4IFOA 2QJMA 3OP2A 3GWQA 1QMLA 5HDRA 3KCLA 3H2EA 5I3JA 3QYQA 1E3XA 2EAWA 3QFEA 5DBUA 1EQPA 1AVAA 2YIHA 4ADSA 4YN5A 3W37A 1CYGA 4GD0A 3NPVA 4AEOA 4S3JA 4HPJA 2W92A 2PGEA 4IQJA 1FBAA 2W61A 4GCXA 5LHFA 2WC3A 4JTGA 1PX8A 2XGZA 1UQZA 3WLIA 4AWEA 2BNJA 4JCMA 4IFKB 5CGTA 1JEZA 4U31A 3JS3A 2RH9A 3E0WA 4BWLA 2H8XA 1JCXA 1ZAJA 5K4ZA 1Y5XA 1RQBA 3ZZ1A 3OGVA 4QXIA 4IMAA 5DF0A 2VURA 2F38A 1SO6A 1YNQA 2GZXA 1TQXA 3JVAA 4Q8WA 4O0ZA 1VBUA 2AKZA 3ORWA 4ZQNA 3N25A 5CJMA 4PH6A 1EBHA 2XINA 1EGZA 3NQBA 1EWDA 2WWCA 3NJ3A 4N6FA 2VUNA 1OINA 3UXIA 5A8PA 3MJMA 4AEFA 1VCGA 1J5SA 5HNRA 3UD6A 2NT0A 3MUY1 4Y7EA 3B8SA 4QG9A 3W7QA 4MUZA 3MUZ1 1W5QA 4KPLA 4MKVA 2ZRZA 4P7RA 4XUGA 5MF5A 1WBHA 1M6JA 4DXVA 1XCFA 2Z6JA 3VK5A 5DT5A 3NCOA 3VD9A 1NF7A 2KAUC 1MFVA 4XSLA 2W5FA 4CU8A 5H8PA 3TSMA 1XPYA 1GQIA 3L23A 3IJ8A 4F0MA 2NSXA 2OYLA 3SN4A 4IOTA 4FNTA 1ICPA 1SVDA 3FNDA 1CGTA 1TPWA 1GJWA 3GBDA 3DIPA 1VYPX 4ACZA 1VLWA 5F2LA 1JFXA 5GQBA 4X9YA 1SFTA 4JYFA 1CTNA 2HBVA 1NJJA 3T2QA 1XLAA 1ZQ5A 3D3FA 1RK6A 1XFBA 1LOSA 3CUZA 4LRTA 5REQA 5G2WA 3BAKA 4MJ4A 1W8SA 5BRPA 1SW7A 4YCPA 1DJGA 4NILA 1L8PA 2Y89A 3DU0A 1KO0A 3N13A 3PC0A 3H4WA 4WUIA 1Q6CA 4C6FA 1JDDA 1X1NA 2R9RA 3VZXA 3VNMA 1UIPA 4UB9A 3VD4A 1THFD 1G5AA 1UWSA 4FF5A 4AX6A 5FF7A 3GYEA 4HNVA 4NNCA 2OVLA 2REQA 2AKMA 1J6OA 1O12A 1Z8AA 3UU0A 1CENA 1Y0EA 1IXQA 1XICA 5FAJA 4F2BA 3LB0A 1FX6A 1GVSA 3NZQA 1TV2A 1ZPTA 2VT0A 3TYCA 1TV7A 2E28A 4HCHA 2ZYFA 3RX2A 3W23A 2PRMA 5D8ZA 2VDGA 5M17A 2OWXA 1SUXA 2GGJA 3T42A 4LBUA 4IUOA 1TV3A 4AX7A 4IHCA 2VEPA 4JIPA 3VE7A 2TYSA 1GKQA 2GDUA 2W4XA 1TJ2A 1CIUA 3R4IA 3O6DA 3EA3A 4ERIA 1TQJA 4JQ1A 4IF2A 3ZJ8A 1EGMA 4V1XA 3TE9A 5A6TC 2ZA3A 3ZSSA 1ESWA 3IJ9A 4JHOA 4NXSA 4AWSA 1NIUA 1VHCA 4FALA 1Q6QA 4H8NA 3C2OA 5BWAA 1V08A 2E6DA 2R24A 4GZEA 3MKKA 1UWIA 2Z28A 1X6LA 4ICCX 4FSAA 5I79A 5TIMA 4CCDA 3CYVA 4M5PA 5DMMA 4YTTA 3WUGA 7ODCA 4JS3A 4J3TA 5LNWA 3U2CA 2R1KA 4IZGA 3STFA 1EIXA 1ZS2A 3FA4A 3SADA 4JFSA 3CK5A 5HMFA 1D3CA 3R6IA 2X2GA 3W2MA 2RFGA 5A69A 3AO0A 2DEPA 1PL9A 2P1FA 4MNKA 3PWIA 2FVLA 2VR2A 1AODA 4ENLA 1FXPA 3ZM8A 4IGMA 4N7QA 1HL8A 5JVLA 4EXBA 5CC6A 3PR2A 3TLQA 4OUIA 3A21A 4P5UA 2ZZ5A 4CVUA 1CCWB 1U30A 1P0KA 3BAJA 3TTQA 2QCHA 4V2XA 3W74A 2ZUWA 3K4DA 4AZ5A 3O6YX 4RDYA 3U5UA 3AXHA 1R0MA 3TWBA 2A3LA 1PIFA 2G4JA 3VAVA 1H3GA 3CM4A 2O4QA 1OYBA 1R30A 3LHVA 1J12A 4GY7A 1HIZA 5HJXA 4BY3A 5EMYA 5C2CA 1R3SA 3P84A 3OIXA 3MVIA 2C19A 4UTTC 1OF6A 2ISFA 2RDXA 2DGAA 3W84A 2QS8A 3QC3A 3KBMA 4R3UA 1OX4A 4GQQA 2VR4A 1V8EA 4H1ZA 4P8WA 1W31A 4GBUA 4Z2HA 1KR1A 3AIQA 3AS3A 5RUBA 3UNTA 3MI3A 3WO8A 3R25A 4UZSA 1POJA 4L56A 2CZDA 3QZAA 3H2FA 1U22A 1JAEA 2JE8A 4JFUA 1E43A 3MMWA 5FSDC 3IS4A 3OEXA 1CGXA 1OF8A 5EKYA 2QUNA 1EGVA 4PUJA 2Y5SA 3B8UA 2A3HA 3WUEA 1PWMA 3A23A 1MVYA 3H7UA 4DF1A 5HWJA 2P0OA 4HNLA 5EMUA 2YOCA 2PDMA 4LQ1A 4O12A 1GEHA 4HCDA 5HR6A 3BOXA 3CL8A 2J7HA 4RKAA 4A8LA 4E38A 5B7YA 1F4AA 3P67A 3OGSA 2Y24A 5EY5A 5HWNA 3W01A 1QPOA 4OE7A 1YYAA 5D02A 3VO0A 1HN1A 4S1FA 3IIVA 4IQDA 1PX3A 1QWGA 1PPIA 4TIMA 1LWIA 4BHYA 3EGJA 4MLJA 1VJIA 1GCYA 3FVDA 1KGXA 3WUBA 1JQXA 1KWKA 4C6OA 3S3GA 3VNJA 3W7DA 1UD8A 1ICSA 4UQCA 3IJ6A 5DXYA 4KFOA 1ME8A 4Z0JA 5BNKA 1G94A 1TWSA 3BANA 4Q3MA 4MMWA 3DZ1A 4CUCA 3CQ0A 3EX4A 4W5UA 1H7PA 4DBDA 2A6LA 4AVFA 1G4TA 2FHFA 4OOZA 1XL9A 2H90A 4QP0A 3GG8A 3PFMA 1GOQA 4LAOA 5C7VA 1VFHA 3DENA 3LTYA 3BOLA 1PKNA 4HZMA 4H6RA 1BG9A 1Q2SA 1WUFA 1AQMA 2JGQA 1XYAA 3CV2A 3TQPA 4DLFA 5I7GA 1E0UA 3PZOA 1W3IA 2CU0A 1GONA 2RDTA 2W9MA 5CZTA 1FWSA 3BGGA 1T7LA 3PZUA 3E1F1 3VDHA 4BF9A 3OZYA 3OLGA 4BF5A 5E09A 1H5YA 3AIRA 4UMBA 1UA3A 3UR7A 1S3HA 3P81A 3WL0A 3CUFA 2WXDM 2NWSA 2OO6A 4OGZA 1PE1A 4RNJA 1ENUA 3GVRA 1MXDA 3FYOA 3K8KA 2DORA 3B0YA 1AQFA 3K8LA 3OA3A 1QTWA 3USBA 1FWNA 1TKKA 3C61A 1TMLA 4QAWA 4M82A 4O17A 3WUFA 3BL3A 4IPNB 1AMKA 1M03A 3BGJA 2NLYA 3TK7A 4A3RA 1FWCC 3G3MA 4PUDA 4JTQA 2DP3A 2WHMA 3BGAA 3CTTA 4HTYA 3HGJA 4PTXA 1FWHC 5A6MA 3AIBA 4Q7IA 1FH8A 3ITXA 4TTUA 3SQSA 3WNNA 2JF6A 1RBOB 4NJIA 1GOOA 3I6EA 3FFSA 1D3GA 1W17A 1R2TA 3T6CA 3ZJ7A 3OBKA 3NL6A 4M80A 1XUUA 4C6EA 1QK2A 1E0WA 4FXSA 4Q33A 4LV9A 1CXHA 1OFDA 3A4AA 2XFFA 1DTNA 1GHRA 2EKGA 2VD8A 4L4OA 4UQDA 4IP5A 2ZE0A 1H2JA 2QDGA 3QY7A 3W6LA 3KP1A 1UZ1A 4H6QA 2IKJA 3LXCA 4O14A 3WLOA 3PF3A 5A6BA 3MI6A 1QRQA 4CEUC 1VB9A 1EJSC 3PAOA 1AUSL 3GDMA 1JDCA 2BXYA 4ILSA 1BWVA 5ABTA 4IGNA 3A4XA 1NOFA 5IOBA 1R38A 2Y8KA 4FI4A 3PPFA 2XM1A 6REQB 2X7WA 3U6WA 1WZLA 2D22A 1MZHA 2OZ0A 4S38A 1XLKA 3STEA 1P48A 4A2RA 4LV4A 1HKIA 3T7VA 1GVYA 3GLCA 1VGAA 5ABHA 2XH0A 3PZMA 3VZYA 3E6EA 3ARYA 1WAUA 2ODOA 5CH9A 4BR1A 1RPXA 2WKJA 3PJTA 1MO0A 2G4FA 2RUSA 1OM0A 4WDUA 4JD4A 1RPKA 3PG8A 5GJNA 1D3HA 2F6XA 2W6RA 2PB1A 4TVDA 4YIWA 3MV11 4QITA 1V03A 4O16A 4I7UA 4WVXA 3NPUA 3ZVHB 4IIHA 3W1XA 2NLIA 1IT8A 1MEWA 2DQWA 4I5UA 3GM8A 4K3ZA 4RV3A 2PDIA 4GGHA 2CZEA 1Z7AA 4QQ3A 3W1UA 3EKGA 3MTWA 1EDGA 1EYEA 1WKDA 1X6UA 4L64A 4M29A 4O53A 1W5MA 1ZP4A 2QCGA 3CZJA 1UZDA 2BGQA 3DXIA 1ZRQA 2J7FA 2PUZA 2OWWA 3U5YA 3SCWA 4GQRA 4XV0A 4S3DA 3RU6A 1C7SA 3TAOA 5MHBA 2V38A 4YU1A 1TTQA 4MJMA 2BGNE 3WD4A 3PNZA 4C7DA 4CKQA 4U3CA 1JYNA 3MHGA 5FJRA 3FLUA 2V5CA 1V6VA 5C9WA 3A9BA 4P8XA 1O6IA 1EF2A 2WVTA 3FN9A 4LOCA 3P74A 2PURA 3PBUA 1RJPA 4FXJA 5A6SA 5AHFA 5MKGB 2VRKA 1YNPA 3PFRA 3B8DA 4I9TA 1K03A 2DVXA 2O56A 2VX6A 1CEOA 1H1ZA 1ZLPA 4PMOA 6REQA 5IRPA 3T08A 1OGBA 4LY4A 4PMNA 3ZYZA 3LXAA 3MP3A 3DX5A 3VMNA 5E5CA 4QIUA 2XWEA 1RSCA 3NQ7A 2D0GA 2FHBA 2R82A 2VI0A 1DJYA 4LUTB 4UMAA 5KSWA 1B4EA 1N7KA 1LG2A 2GGGA 3PUDA 4AY7A 4O1BA 5A8MA 2J4GA 2YLLA 4NAFA 4PCNA 1AMYA 3UWEA 4TVUA 2I14A 2A7RA 3EB2A 2A85A 3UR5A 1ONRA 4WX2A 3P7YA 3KOYA 4XK2A 3CLMA 4ZQPA 4LH8A 3MMTA 3KOXA 2J9ZA 4NL1A 4C6BA 2IPJA 4EE9A 1EBGA 3KHDA 3Q45A 4GGBA 3WD3A 1XYZA 1K02A 4O19A 3AMGA 3MV01 2PMQA 4ZOEA 3NFUA 5A8GA 1E6SM 3T9PA 3HJZA 4Q8OA 4DPPA 1YDVA 1W2PA 1HJWA 3LZ5A 5EA9A 4TX9A 3E0VA 2CLPA 1IZJA 4NAEB 4CD8A 5F2GA 3EOEA 1DXIA 3HA1A 1W56A 3F5JA 1N8WA 1HL2A 2OEKA 1LRNA 5LNRA 2YBVA 3AIWA 5C9UA 3PZTA 1EIBA 1XQKA 3MQTA 4OQVA 2PZ0A 5BOFA 3EZ4A 3QQWA 3GNNA 1M68A 3KHJA 2D3LA 1N8IA 1XUZA 5FEWA 2BVTA 1MI3A 1C7TA 3TWAA 1CGUA 1UC4A 3QZEA 5KINA 4HU3A 3R10A 3MO7A 2QXWA 1JCJA 1KM2A 1LDCA 2ATSA 3PZIA 3BLDA 2J78A 5G2IA 1JL8A 2XSAA 5F4SA 3SUTA 3ISIX 3PM6A 5DT7A 1EJVC 4JDYA 1WDDA 3RMJA 3L5LA 1XIBA 3EWUA 3M41A 1QCWA 2FB2A 1NWTA 1FWWA 2A4AA 2A79A 1W91A 4PEKA 1QO5A 1KGWA 4WZHA 2J74A 3SGGA 3QYSA 1W1YA 3SN0A 4X2PA 1PTAA 1MUWA 3WQPA 3J7HA 1OFQA 1BYCA 1EOKA 5HJYA 3QBUA 3BLPX 3GVWA 1DPMA 2F9RA 3NDZA 2XFRA 5C55A 2TSYA 3QJAA 3ABXA 4I9MA 4PA8A 2QCNA 3R2GA 5CSRA 1MSSA 2ZC8A 1W9UA 3SCVA 1WXJA 1FDYA 4NZ4A 1AJZA 2YL5A 1TIMA 1MMFA 1ONEA 1B3WA 4RE0A 3PBWA 2E6FA 2NXIA 2I16A 4IXXA 2QZRA 2WANA 2OLAA 3KX6A 3TC6A 2AAAA 4A35A 2C15A 3G6LA 3P0WA 4MPKA 1EOMA 1RY0A 4O1EA 1KFCA 3ABSA 3UNDA 4L9YA 3SB0A 3MDUA 5I07A 1NARA 4AWTA 4JIQA 5EPDA 2V0TA 1YEYA 1BYBA 4WXYA 3PSVA 5I3IA 2EO7A 4L1XA 3UR2A 5DBTA 1B9BA 3HPAA 3NUKA 3WJZA 2CCRA 2FPTA 6ENLA 2IPFA 4PYSA 1EP1A 3KVKA 3GHSA 4NJHA 4F9DA 1SFSA 3NEVA 4WIWA 3H2AA 3Q4DA 4M24A 5LIXX 4HHHA 4L4PA 3W7LA 1XH0A 4LFYA 3FXGA 4B2DD 4YTRA 4Z1BA 4QGCA 2V3GA 2Y61A 1XGZA 3LHTA 4YXGA 2VNCA 4YVXA 1YNYA 2JFEX 1QPNA 3QGVA 3WDQA 1QFEA 5ECVA 1CPUA 1KFWA 2CLKA 4ZE5A 1WV2A 4KEVA 1E70M 6XIMA 1OGSA 1W3NA 4S2CA 4QCFA 3FHQA 3IIOA 2QDHA 1H51A 2Y63A 1GQJA 4DX3A 3UJRA 2WNWA 2CHOA 1JRCA 1NFPA 3DC0A 2WVUA 4NAEA 2ACSA 4HCLA 4GZIA 4JFVA 1IHIA 1WX0A 1E5NA 3LG3A 1O60A 2Q3OA 1RCXB 2QIIA 3BVJA 4NU7A 1PYFA 5AN7A 1KC7A 3BCFA 2IPWA 1PDYA 3KRBA 1KXHA 2I56A 2IKHA 3ABRA 4PMXA 3LCWA 1UC5A 3QY6A 3AXIA 2X41A 3PTMA 3CZKA 5DRIA 3W9ZA 3W6MA 3EWCA 1K8YA 1BHGA 1FDZA 4WLCA 2VEGA 3CZGA 1GW9A 3QV6A 4ACZB 1C93A 5JBEA 1QOQA 1F61A 3NQ8A 1OGGA 2CC0A 4JCLA 1VRDA 1FTXA 1RCOB 4ZBCA 2WC4A 5F1UA 4Q8UA 1QO2A 2W0UA 1N2VA 5BOEA 1Q5MA 1MNZA 3AMCA 1E4IA 3FEMA 4OJYA 1ZJAA 4O0QA 3W2JA 4HZ6A 1WAWA 3RK8A 3WFZA 2EG8A 3SIZA 4FNQA 3I4KA 2C16A 3RR1A 5XIMA 4YTUA 5IFPA 2YDSA 1LLWA 1OD0A 4LYRA 4PRRA 3VOFA 5CAHA 1POKA 1GGOA 3DFTA 1JUEA 4UTUA 4NJGA 4NT0A 4PMUA 3N14A 3UWZA 5EBAA 1US0A 2UY3A 5J04A 3CIWA 1ELSA 2G95A 3CL6A 4DO6A 2VGIA 2DZBA 2A6NA 1WZAA 3SAZA 1CI1A 1S2UA 1HG3A 3A6OA 1BPLB 1F3WA 2H6RA 2GYIA 4O4VA 2O9TA 1KV5A 3W7RA 2VKZG 1XLLA 4AH7A 1PZ3A 5CBIA 4JHMA 5BWFA 2BODX 2ZRVA 1GPFA 1YE6A 3DG6A 5DEZA 4C6JA 2PODA 3UP8A 1OCBA 4W4QA 2B7NA 4B92A 2G50A 3VOIA 2Y7FA 5G1MA 4I6VA 2BLEA 3BW3A 1UCWA 1KTBA 1RA0A 1MW3A 4W5ZA 3DFQA 1K9DA 2J27A 4LXFA 3CEPA 3W2UA 1DIKA 4L4LA 2A0NA 4RK8A 4HU8A 2ONEA 1KXVA 2XGBA 2A5HA 1KBIA 3G77A 2YYUA 4FS9A 4FB7A 1E71M 2VZVA 4K1WA 2UBPC 1UKSA 2QCEA 3HQPA 4IQLA 1UQYA 1HQTA 4YVPA 1V0KA 3T07A 4GC3A 4WEVX 2C0HA 1KBLA 2A3CA 2DUZA 3OVQA 3UZXA 2CEQA 1X7FA 1BLIA 1ISWA 3AZTA 1ZNNA 2WQPA 3W2NA 5BRBA 1RXOB 4H7CA 1CECA 4NVTA 2NVAA 2OLHA 1ZY9A 1XDJA 2VOMA 4B90A 4N9EA 1FUYA 2J75A 2VC9A 3W53A 3S1VA 1RVGA 2GGHA 5TNVA 4GUIA 3VKBA 4O13A 3L21A 2DIKA 4MTVA 3Q67A 2DZUA 1E6ZA 4IM4A 3OPSA 1PYMA 4W86A 1FKWA 1KWGA 4PMQA 4MF4A 5A2BA 1BVWA 3TH6A 2GUBA 1GWJA 1TPEA 4MY9A 1NWUA 3O15A 3DG3A 3VIKA 3SI9A 3UA3A 2X40A 1W3TA 2BTMA 3T1GA 1F76A 5G1TA 4PCPA 5F2MA 1NP2A 3KWXA 2OEMA 1DIEA 3T8QA 2PTYA 3GDTA 2E1WA 2Z7GA 2G37A 1KM5A 2DPEA 2JEPA 3WMLA 4URIA 3I3DA 4EX4A 1YBQB 3N4EA 3VNIA 1YTKA 3KM8A 1KM4A 5DXXA 1VC4A 2I5GA 4GACA 2BP1A 1M3UA 1VJSA 4WOQA 3NR0A 4GI9A 2HS6A 5D03A 4HHPA 4UXDA 4WKHA 1OCJA 4X0VA 3C0JA 1KW1A 2Y8UA 4O57A 3M6DA 2WMHA 3U3HA 1QW8A 2FFIA 3LLDA 3B03A 3EOLA 2XIQA 4IT1A 3VCNA 1YTDA 1EDTA 3WX7A 3SECA 2ZXAA 1TZZA 5HNNA 4C6MA 4PMRA 1H4PA 4UQ9A 4HNNA 4IMFA 5FESA 3L2LA 1TPH1 4XZ9A 2ZBTA 3A3WA 4IL2A 2QCLA 3I7RA 5IHRA 3L66A 1FWBC 3GH5A 3B0XA 5DX7A 3W0KA 3GU2A 3BPWA 4PSPA 3NZ1A 4DJFA 3W2LA 2VVSA 2HMCA 4YYCA 1TO3A 5FJOA 3U2ZA 1CXIA 4RZ5A 4ZFMA 1Y5WA 4KWSA 3KAOA 1VP5A 4ROQA 3SSZA 2NXHA 1TCMA 2YA2A 1I0DA 2YB4A 4MVAA 2Y85A 1JNDA 2XVGA 1BD0A 2VDIA 3T4WA 1A0CA 2CHNA 4HBKA 3QLDA 2C1IA 2J9XA 3QMRA 1CLXA 4E2DA 3DFNA 2Z0IA 1OC6A 6TAAA 1QNVA 5F2IA 4ZENA 1A4MA 3TW6A 1AJ2A 2DQXA 1BF2A 3CUIA 1PKMA 4L65A 2WKLA 3GB6A 3H7RA 5E0KA 1ALDA 4BZYA 1US2A 3CMFA 1V02E 3C4UA 4Z2GA 1RAKA 1UD4A 4F2TA 3LXBA 3G24A 2WBKA 3GDBA 3BE7A 5FF0A 4US6A 3VMPA 2QULA 3RX4A 4A8RA 1NVMA 2DW6A 1PB0A 1U33A 2Y5JA 2Z1WA 4YLWA 5CC5A 2NV9A 3W7HA 1ISYA 2V30A 1E1CB 4Q6JA 4D1IA 1K6WA 2YKKA 1ITQA 4WR3A 2ZC1A 1QWKA 3BUVA 3H22A 2ADAA 3MVTA 3PAJA 2C14A 2X0SA 2WNNA 1LL4A 1MQPA 4E5TA 2Z2UA 3TYBA 1Q6FA 4K1GA 4WSHA 4H2CA 1X97A 2O4MA 4I7VA 2BBFA 4M3PA 1K6AA 2AQVA 1AG1O 1VBRA 4UTTA 3TW9A 3OB8A 1EC8A 4UBPC 3CQIA 1UKPA 5CKSA 4DPQA 4MG4A 4AG0A 3IK4A 2UY2A 1C9DA 5FEPA 3L4UA 3AMDA 1MWOA 2Q6ZA 1UOZA 3IGXA 3OYZA 1ZSXA 4AD5A 4MJ2A 2CWNA 3F4VA 1JDFA 4X2RA 3TTYA 3S0CA 3W1TA 1YDYA 2V2CA 3HZ3A 1G1YA 3OJGA 1DORA 4C6PA 3E96A 2ZXDA 3TIMA 5AECA 4PRTA 9XIAA 2E5CA 1C3FA 3MKVA 3RPMA 1XSIA 3ARVA 3M0HA 1K8XA 1YIXA 4J3UA 1AH3A 3RN6A 3VINA 2OKTA 2PGWA 2YGYA 2AAMA 2XIOA 1XH2A 3R13A 1GKRA 2MANA 4J40A 3IJ7A 2VEIA 2DSKA 7PTDA 5A6JA 4C5ZA 2ZZ6A 1G4EA 5BU9A 2P0IA 2OGJA 3R7MA 1JQVA 4AUBA 3GD6A 2VEKA 4KCUA 1R3YA 4LB4A 3T0BA 1A5MC 3O07A 2WJDA 5EB8A 2NQ9A 4MPQA 4GHRA 3GTHA 1KD0A 5HJLA 3IWPA 3WJSA 3LPFA 3SUVA 2DZTA 4FNRA 2P5NA 4TQTA 3WLPA 1ITCA 3Q58A 3LPGA 4KCWA 3NQVA 1H11A 4HNOA 4HA3A 3UG5A 3GX9A 1W32A 2ZTKA 3B4UA 1M04A 4ACYA 4UR8A 4R85A 1UPPA 3G1DA 3GK0A 5BYWA 1MEHA 5CLWA 3W1PA 4E8DA 2CKSA 2IPGA 1C9WA 5EMJA 3W81A 3UERA 2DZWA 3FVMA 2ZUMA 3RPDA 2OEJA 2ZX8A 1TTPA 1DQWA 3AMKA 3C86A 1KBBA 4RZBA 1E4NA 3G1HA 3PVFA 4MFEA 1PDZA 4LNCA 1XH1A 4U2ZA 1JCNA 3SFWA 2QAFA 4MWAA 3W7CA 4LCRA 5FL1A 3VA8A 5CSYA 1HVXA 4B5NA 3FS2A 4ALDA 3EWBX 4PFMA 2ISVA 4CQCA 2ZX5A 1TWDA 1QI0A 4UUIA 4AHPA 3M5ZA 1VRXA 5BROA 3PZQA 3HPXA 4ZB2A 3T0TA 4H8UA 2PU0A 4E2OA 4XZHA 4TX8A 3CV7A 3NXFA 3WMCA 3WJWA 1OC7A 1VENA 2C8NA 1W0MA 1P6BA 4UWMA 1VQTA 3L67A 3CIVA 2PLKA 1QI3A 2C1GA 1NEYA 2INEA 4ERGA 3WY1A 1Q4WA 3GVGA 3STGA 3DOPA 4XWUA 3B40A 1R7OA 4JN8A 4JIRA 5DN1A 5LNUA 1JZ4A 3THUA 5DY3A 2Y0FA 5REQB 4P7OA 1E1FA 1YRRA 3G0UA 4JTCA 3LX9A 2PGRA 2WQDA 1YDNA 4GK8A 3E0IA 1GORA 4V27A 1SJCA 1MYRA 3QF0A 3R11A 4BQ4A 1UWAA 1J01A 4RXFA 4IJRA 1YDOA 3SDOA 4J2PA 5JU6A 1HF6A 1L6WA 1DHKA 1KCZA 5CG0A 2DZAA 1V3HA 4AYGA 4DAFA 3V7PA 5FL0A 1GOMA 5FF3A 5L9FA 4ML4A 4EPEC 3UCQA 2FTPA 3W7OA 3HQNA 3W7NA 5A2CA 3A22A 1AA1B 1KM0A 1YE4A 3GHRA 4ECLA 3G18A 4Z17A 1ZU8A 2NQHA 1QAPA 1QI2A 1X6NA 2WSKA 1ZAHA 2E8ZA 1TVNA 1EC9A 2CBIA 2R6OA 3C6CA 1J10A 1C29A 2Z2AA 3WF4A 3TYZA 1TV4A 1FFQA 3QXBA 1B0IA 3SCNA 1BKHA 4YS1A 3MKCA 1P1MA 2YYTA 3TFCA 4D2JA 1BYAA 4LVBA 1UUOA 4JY9A 1PIIA 4W85A 3S2JA 4LUIA 2OX1A 1ICQA 2PS2A 4ML9A 1W9XA 2OELA 4ONVA 4XB3A 5DMYA 4C6DA 1OX5A 2Y6ZA 3DAQA 4GJIA 3VMOA 1G6CA 2VQUA 4HB7A 1WA3A 1UZHA 5T8GA 3UXLA 4FP1A 3VNKA 1PVNA 1Q63A 4HJWA 2UWFA 5CC3A 1QNPA 3SRFA 3I7QA 3TQVA 1J18A 1J0KA 3M0KA 2DV0A 3GKFA 1K7XA 3GIYA 3CH9A 1RP8A 3EX3A 4XAGA 3V5FA 5BZAA 1JNEA 3ABQA 2NXGA 1Z9AA 1K9FA 2YL9A 3KL3A 4WDTA 4JEQA 1UUMA 4OTKA 2ISDA 1TA3B 4RNFA 3IIPA 3SCQA 1HP4A 3S5ZA 3CHVA 4QR6A 2FHCA 1UWUA 4IGSA 2YXGA 4LU0A 3W82A 2CLEA 3GYCA 3V0UA 4XD6A 4W89A 3EWYA 4IIEA 4AD1A 4O54A 4KEUA 1TG7A 3AHZA 1JJKA 3B9OA 1EPXA 3LHZA 2CLMA 1LJYA 2DY3A 1H5VA 2ICSA 3RM4A 1QPKA 2PGFA 4CCCA 1UMYA 1HTIA 5CG7A 3OZPA 1ECQA 3BQ6A 3LENA 3VGEA 3ZJ6A 1UD3A 1UR1A 4DBSA 4DJDA 1XLEA 4LC8A 5GJMA 3EAUA 3NDOA 3P14A 3A3HA 2X1UA 2JBMA 1OD8A 4R5EA 5EFDA 5AC7A 2NWRA 4LVDA 1TMHA 1QJWA 3T55A 4HYRA 4N9DA 4HOZA 2YLAA 1JF5A 4NKCA 1H0GA 2XIJA 1XYBA 3H24A 4F4RA 2PLCA 1BVZA 3EPOA 2CXGA 3N3TA 2PD5A 1JRBA 2VC7A 3EEGA 1T41A 3RM8A 2PDCA 1NH6A 5CZJA 4LWWA 2XWDA 1WB0A 1R8LA 2V9DA 2NX1A 1NDVA 2DU2A 1V3KA 4L7ZA 3CWOX 3RU8X 3PG9A 1Q4NX 3BH4A 3M44A 1FY6A 3P5ZA 4UTFA 2QF7A 4I7WA 1I6NA 1ODUA 1TVLA 1N82A 4KBXA 1B1YA 5C7HA 3UJEA 4QS5A 2OT0A 3WFLA 4HA1A 3CHDA 4MDOA 3EWDA 4Q8TA 1O68A 3H12A 4EANA 1PTDA 3RIKA 1FHDA 1F8IA 3F4NA 3WJYA 2PEVA 3N3MA 3CTLA 3JZEA 4PUMA 4J2MA 5LA0A 3HGSA 4OV4A 3BOFA 3RCNA 1VEOA 1UKOA 3FCPA 3UA4A 4C60A 1KCLA 1Z41A 2CLIA 3TTSA 4Z42C 3PULA 4AAJA 2XZ7A 4MKNA 3T78A 1JZ5A 1T5AA 1OCQA 6XIAA 3WEZA 8RUCA 3NL2A 3CPRA 3NVDA 3PZVA 5C6MA 3PHAA 4UR7A 1W3LA 4AZGA 2VZSA 2CBVA 2OQYA 2WC7A 1E56A 2X1RA 5DCDA 5SWUA 5HAOA 5DANA 3CT7A 3ZT7A 3RO8A 4NP7A 1N55A 1MW1A 1YW1A 1IWBA 3SCRA 1MUMA 3VKAA 4AD2A 4GVFA 3GW0A 1SZFA 2B7OA 5HXMA 4TMBA 4XZWA 1EYWA 3S5YA 4IWWA 4EAMA 3DBNA 3BAXA 2IS7A 1BRLA 3GQYA 3QV8A 1H09A 3PUOA 4HIBA 1NAL1 3T2PA 4ZGYA 4QDWA 3M0LA 3L0KA 3G8RA 2J8TA 3WLJA 3LGDA 4IPIA 4LGXA 2PE4A 4L6HA 3N11A 2IXUA 3OVPA 1W3KA 1Z69A 4P7LA 2Y2WA 4H2HA 1PBGA 3E5PA 4GRSA 2P76A 1XDMA 4D8LA 3SSJA 1OEPA 2YZRA 1XRVA 3WH6A 4GVHA 4HZ8A 1LUCA 4KRTA 1CDGA 2VGBA 3S1XA 4PFHA 3VM5A 1IEXA 3VGDA 2BGSA 1S1RA 4EXAA 3THCA 2J47A 1EC7A 3LA4A 2QDEA 3G2GA 3CQKA 3IRSA 5HQMA 1M9HA 2J7BA 1FXQA 1G7VA 4HU0A 2XG9A 3CIXA 1VFTA 1NF0A 1W1IE 1T8XA 1EQCA 2QJJA 1VF8A 4IP7A 1IXOA 4QJ5B 2JIEA 3ZMRA 3N15A 1WCGA 2G3JA 2BY3A 2Z1SA 3LU2A 3V5CA 2VEFA 3FDKA 2W66A 4JTIA 3EXTA 1S39A 3ITCA 3GG0A 3ATYA 1FKXA 1PEZA 4IJBA 2NUWA 2YSWA 1V5XA 5KTLA 5A95A 2ZX9A 1KM6A 3NZRA 2WMJA 3QV7A 2AMXA 1Z89A 1TWIA 2VGGA 2D24A 3WLQA 3RM9A 3QKEA 4LYKA 1WKYA 5XIAA 1G4SA 2W27A 4PB5A 4ZXOA 4EF9A 2DT0A 4GYKA 3UCCA 1WOBA 2WCAA 3AALA 3BSGA 4GXMA 1RLDA 1OIMA 3QR0A 2OYMA 3GR8A 5HPCA 5IM51 3P6LA 3CBWA 2X16A 3FGCB 3Q37A 3SUSA 2HEJA 2VENA 4JN6A 4UZUA 1EA0A 2OJPA 4PL1A 2J77A 3HURA 1L2UA 3WLLA 2DUAA 3Q2DA 2WCSA 2HVMA 4W88A 4DBEA 2PWUA 4BEQA 1TV5A 4Q4MA 1XBZA 2WLYA 3LHWA 3LK6A 4HKPA 2V2HA 1W9VA 1BYDA 3UZWA 1JXKA 2BVYA 3POHA 4IMEA 4QEEA 4JXCA 1BTCA 3DUGA 4DAIA 4NHVA 4UTLA 1A0DA 5C5YA 1VHNA 1PWLA 2Z1KA 4NZJA 1A80A 2ZUTA 3BG9A 1MEIA 1BXNA 4AZCB 3T0AA 4RNIA 1KM3A 2PRHA 1R9YA 1XQLA 3CLWA 3S6OA 3GTXA 2E8YA 3OG2A 1IIGA 1A5LC 4LYPA 4FOUA 3R12A 3NA8A 4G1NA 4WKAA 3T44A 3THDA 3TR2A 4GNVA 3QFWA 2OSYA 4DIAA 3UY8A 3TSDA 2INFA 3CZEA 2XSBA 2VGFA 2PWFA 3DYOA 3ZR6A 1KR0A 3W00A 4HSOA 4GCAA 4DJDC 2FZBA 1PAMA 1TZ9A 1WQ5A 1O5QA 4PR4A 2OSXA 3I10A 5KEZA 2D1ZA 1Q7QA 3VOJA 1F05A 4HMEA 3H7VA 1QATA 1DQUA 4KW2A 1E9IA 4S3GA 5K9DA 4CU7A 1SJAA 4MHBA 3EX1A 4JIIX 4MSSA 4LB3A 3Q94A 3ICJA 3N2XA 3URQA 4F0LA 2HVNA 4XTIA 1XBVA 4X61A 1XRSA 1GJPA 3PS7A 3HPSA 3TA9A 3C8FA 4ZQMA 2DIJA 1NFGA 3KBNA 4J3VA 1K4GA 1KM1A 4I90A 3EDFA 3TU9A 4U5KA 2XH2A 3F03K 2ALRA 2R1LA 3F4CA 1OFPA 4GINA 2XYLA 2PDQA 3R89A 4C65A 3LERA 3FKRA 3RYSA 1MQRA 4H9MA 1PCWA 3M43A 3TROA 1QK0A 1XCXA 4K2SA 4HK6A 4KIEA 1M7OA 1Z3NA 3UXAA 1UIOA 4PN2A 2G5WA 3TVAA 4F3HA 4LCQA 1OFRA 4QJ3B 1P0NA 3MWAA 4M6UA 1JZ6A 4H6EA 1PTGA 5AVNA 1VPXA 2PTZA 2PDKA 4ZL1A 1Z44A 1NWSA 4A29A 2P8BA 3GC2A 1FWEC 4HP5A 1D9EA 2HS8A 3DFOA 4EOUA 3KL0A 3EB3A 5J8LA 4WGHA 4POCA 3OLEA 1E9YB 4GIRA 4FHAA 2XN0A 5I3FA 2DT2A 5AYIA 3P93A 3G1VA 2F7FA 3A3XA 4E8CA 2P10A 4P8VA 1QHZA 2HQAA 1G9HA 5FA5A 3KTCA 4P7NA 4A4AA 3QC0A 4PMJA 3NQCA 4CNUA 1SW3A 3NYDA 4ZR8A 4KWOA 4IJCA 3MO4A 1P0EA 1XLHA 2V5LA 1MRQA 5AZ1A 4IL0A 1XRTA 3UZZA 4RDZA 3S2MA 3AROA 4BFAA 3S9YA 3VGGA 3DHFA 4LY8A 1SU5A 1XHGA 4Z1AA 1H7NA 4US5A 4LSBA 3LCIA 4P61A 1AW2A 3WNOA 1N8FA 1W2VA 3N2MA 3DFSA 3OODA 5LIWX 4E3VA 1UBSA 1RY8A 2VCAA 3F2BA 1ISXA 3MZ2A 1E6NA 2ZOXA 1JUKA 5BU6A 1E72M 1GKPA 4AQLA 4DNMA 3GIPA 3M47A 3VPLA 4R9XA 1S2VA 5CSUA 5AY7A 3B9NA 2HISA 3HGRA 5DCEA 2D20A 3EMQA 4IIBA 4CD6A 3G5EA 1X96A 2DJXA 2WJEA 1VBGA 2G3IA 3N4FA 2HV5A 5C70A 1F8MA 4Z2KA 1JVNA 2ZKMX 1BEUA 3CAKA 3W1LA 4S3AA 5F4XA 1CLVA 3BSHA 4A6GA 2P3EA 5DMNA 4AZBA 3N6HA 3T05A 1G67A 3VNLA 4I6KA 1NSJA 3I6RA 2B81A 2QJGA 2FLIA 3UEQA 2IQTA 4C7GA 1E6QM 3LLFA 4NAFB 3QQ1A 4GYPC 4JX4A 4NY2A 1SR0A 2PDWA 3VTRA 2PDXA 1XLMA 2CXEA 2VO5A 3GVQA 1OYCA 2C6QA 4XUYA 3I68A 4DN1A 1CXKA 1SJBA 2WZTA 4DEFA 5IFTA 1YTEA 3LCLA 5DELA 3K46A 5KZ6A 3WQDA 3L4ZA 4X60A 4D6IA 4LBRA 3A47A 1M7PA 3MUXA 5FJIA 4UQAA 2XTKA 1V0MA 5AYZA 7REQA 2C71A 4D6JA 5IBXC 2X30A 3KL5A 2C18A 3R43A 1KKRA 1W54A 1GZ1A 3S2CA 7TIMA 1E51A 4GX8A 3KEHA 4ZOCA 1LBFA 4XVDA 4I9AA 3OOQA 2OXNA 3L9CA 2GFTA 1MFUA 2OT1A 1DJXA 2QPXA 4N4QA 4DM1A 2GQ3A 4IMDA 3ZOAA 4A22A 3LHUA 4LVGA 5T9BG 5FI8A 2HCVA 4UTJA 4A8IA 2VTFA 4O8RA 3QGKC 3BG5A 4CN4A 3V1PA 4Q4OA 2DJLA 4JNMA 4QLKA 3N4AA 1DEDA 4Q4SA 2PDBA 5D8WA 3MMUA 1WXYA 1XFCA 1XSKA 2XGIA 3MHFA 3ALFA 3IIZA 5A6AA 2ZIDA 3E5BA 1KNWA 2OWCA 3TXVA 4D8AA 3N1AA 5LHEA 1TJ1A 3LV5A 3TZNA 1GYLA 1YXYA 2YCJA 3C2FA 4IISA 1GVFA 3LCXA 2VQTA 3KLLA 1RJQA 4QE1A 5AHMA 2FKPA 3ANYA 4KCVA 3S6DA 4PGLA 4PMDA 2GQ9A 2ZA2A 2IXVA 2D3NA 4JQ2A 3DESA 2BY1A 1UWRA 4C1NB 2YBTA 1B3XA 2Z1VA 2HE8A 3B05A 1I9CB 1CB2A 1LLOA 3LUTA 1T96A 4IUGA 2OQHA 4IG2B 1MXGA 3P0XA 2RGMA 3S8HA 1C8YA 1I2QA 1DJZA 4ZB5A 4R88A 4FX6M 2VVNA 3AXKA 3GZAA 1HO1A 5HBFA 3E2VA 3ZLHA 4AVNA 2GJPA 2G3NA 3MT1A 2G3MA 1IWAA 4E3TA 1ZP3A 3AXXA 2CLLA 4LW7A 4CLMA 3NURA 3PTDA 1GOXA 1HGWA 3O8AA 4EAYA 1J0ZA 3M0JA 1YX1A 1F4HA 3R58A 2E77A 1XV8A 3BLKA 1F73A 3HPZA 4WY0B 3PTKA 5I03A 1DQXA 1BQGA 3COTA 1NOUA 1GVRA 3R79A 5EBUA 1LQAA 2E09A 5I78A 2G41A 4RPQA 5HATA 3GNDA 2GJNA 4CD5A 3VUSA 4QDMA 3MSDA 5ECUA 1J0YA 4AZIA 4JICA 1B4KA 1OX4B 3WCZA 4AEEA 1OBAA 5GNYA 5LKYA 3N12A 3SQLA 4TV5A 2FB3A 2NZLA 3LY0A 1UROA 2BX7A 3NQEA 3TX9A 3TA6A 2IKIA 4NZFA 3W75A 1R85A 4AF0A 3LI0A 4JFTA 5D2XA 1SGJA 2V8ZA 2JALA 2X2YA 3CT2A 3DEQA 5DQPA 2BY0A 3F1QA 3WQ6A 3KOWA 1L6FA 1W8GA 4FIQA 4REQB 3ZQ9A 1ZJHA 2O0TA 3R0UA 4Y6GA 1JPDX 2BMBA 2EPKX 3OHIA 2QAPA 3ID7A 4GY0A 4DXKA 1XF0A 2F2KA 1BTMA 4YHEA 1UR8A 1IF2A 2CFFA 4WY0F 3NQ2A 2DT3A 2FFCA 3CYJA 5GNXA 1DXFA 4MY8A 5CBBA 2KZHA 4B5VA 4DHGA 5MKGA 3BK0A 5EMMA 2ZQ0A 5I24A 2OYKA 4HZ7A 2YL8A 1GHSA 3FHAA 2Q01A 1H60A 3MCMA 4HOXA 2SFPA 4GQBA 4KEZA 2VD9A 1OG0A 4FLRA 1ZJBA 2FJUB 2E3ZA 1DWAM 3MDWA 1I75A 1MZRA 1TWZA 3C0SA 4XAYA 3V16A 3O06A 3H4GA 1S1PA 2E6AA 1RQHA 3SCOA 4H41A 4BF7A 3GNOA 5TD4A 2BY2A 1XD0A 3WLHA 3IEBA 1GYNA 3GXTA 2LLEA 1G4PA 4JX5A 3U57A 1CT5A 1ADOA 3U7BA 4H7ZA 3HPFA 4S39A 2V6AA 4GWEA 2DZXA 4IG2A 5AHIA 4KT2A 1IV8A 3UPBA 1IZKA 4PRWA 4RZ6A 3DGRA 1E0TA 3C2RA 1R2SA 5AKQA 4XKYA 1WDPA 1ZBCA 2V68A 2VFFA 2Z7KA 2ASHA 1PHWA 1YXCA 3WN6A 3ARUA 2J66A 2PFHA 2D69A 1FWTA 1HL9A 4FIRA 4ZSUA 4UOQA 4NX5A 1ZBVA 5FEZA 1T0OA 3N18A 3BMWA 2FZ9A 5JUVA 2J25A 4LALA 1H0IA 4PEEA 1ZFJA 2J7EA 2VFIA 1XLGA 1AQHA 4H9VA 2E9LA 3KS5A 4TOQA 1KQZA 3HOJA 3K1GA 2FZMA 4PUNA 2RDWA 2JEQA 3W86A 4LTSA 1R3QA 3WH9A 1XS2A 2FMNA 3UVIA 2ZRUA 1EJWC 5HR7A 2GVEA 2EKCA 1EF3A 4B15A 3SM0A 1JPKA 3C0QA 1I1WA 3FAWA 1P4CA 3FYPA 2WMIA 3RILA 3T4CA 1WYIA 3JU2A 1OWQA 4B5TA 2IQ0A 1PUDA 1MW2A 3S4TA 1BWKA 2EPMX 4OT7A 1HKVA 3PBGA 3AWOA 4YHGA 4C6CA 1W9PA 2HK0A 3O05A 4S3BA 3L5MA 4DJEA 1TSIA 2YCEA 3QHNA 1OZQA 2NSOA 3WSUA 1X8FA 3WF0A 4NASA 4DYEA 7REQB 4MNMA 4CQDA 1HJSA 3VYLA 2UV8G 5PTDA 2H9AA 3TMQA 2PC8A 3PJUA 3U4AA 5G2HA 1TZ7A 3NGJA 3E0LA 4JTDA 4AD3A 1MDRA 4BA0A 1M41A 4XBKA 5I77A 2NX3A 4G9PA 1YMYA 1GEQA 4XAZA 1I8JA 4DBWA 1XSJA 3NM3A 4ZOBA 2NVCA 2ACRA 4J28A 3EKZA 4E2BA 1RUSA 3RR4A 5I2UA 3WZ0E 5BMWA 1BVNP 2IUZA 3RDKA 2CETA 5BXRA 1LBMA 3HB9A 1M7XA 4FX7A 5BRQA 3GU1A 1HP5A 1NM9A 1Q66A 4P7QA 3ARZA 2P88A 1VFOA 3ERPA 1ITXA 2BVWA 3IVSA 4JQ4A 2ACUA 2R1PA 1WOAA 3C52A 1R5YA 4Y96A 3S1WA 4WJ8A 3N9KA 2AOSA 5AC6A 2Z29A 3DKLA 2GSHA 2OB3A 1LG1A 2V81A 2W63A 3VU2A 1RV8A 2QUVA 4K38A 3NO5A 3BWWA 2WYSA 1F3TA 2CLFA 5CEWA 1ECEA 5M3WA 2BDQA 1XIGA 3ABZA 5A5WA 3RO6A 2WNQA 2HNEA 2EPNA 3RAOA 1KRMA 1XIIA 2GL5A 3G22A 3MCNA 2VFDA 4W7UA 3GTNA 4WGXA 3WLSA 1E6PA 2J7CA 3RGTA 4PTVA 4HTBA 3EA1A 5KETA 2ZVIA 2XJ7A 2E7FA 2CIPA 5AVHA 2GJRA 2W62A 5K3VA 1SZGA 4I8DA 1HW6A 1KFBA 5D2YA 3WELA 2VP8A 4LVAA 3B04A 3SRDA 3BJTA 3C5QA 2WWDA 5TAOA 1DJQA 2HNHA 4G1KA 2PWGA 1VYSX 1Q3NA 5D2VA 5C9XA 1GK8A 3GZ3A 1Z48A 3FJLA 4A8NA 1KRAC 2CHRA 5LXXA 3VIMA 1FWGC 1GG1A 1ADSA 4R53A 3KBJA 5FIPA 4YWSA 1PZ1A 3M5XA 1SPQA 4FOKA 4B3ZA 1DIOA 4A05A 4GUFA 4UNKA 3RUBL 3W7EA 3U2EA 4XO6A 1BSIA 2J7GA 4E4UA 2JGYA 4NJKA 4FX8A 2A21A 3KDNA 2J7DA 4M7SA 1OHLA 3IJDA 1YQ2A 3AU6A 1EL3A 1LTDA 4YYFA 1ZCCA 2ZRWA 4MWAE 1Z42A 1S5TA 4ZO7A 3GDKA 4OOUA 4UOZA 3BMVA 2VCCA 2WMFA 3WEMA 3VKKA 4NJJA 3FGCA 2B0MA 4ZZ9A 3UWWA 1NY1A 4HHMA 1XBYA 5CZKA 1TA3A 4CNNA 2C79A 4ZQRA 1UKQA 3BO9A 3OW1A 3L4XA 1LLZA 2H3BA 4EPBC 5CZSA 2G8ZA 4KH2A 1W5NA 4RE3A 3GC5A 1XCWA 3DHDA 2R1NA 4Q8MA 3CQHA 3KVJA 2Z1XA 2FPVA 4NRSA 4DF0A 4UIOA 1FVPA 2DSWA 4NYUA 4DJED 1J0IA 1I60A 5AHEA 1YBQA 5XINA 2E4TA 4A3QA 3GAYA 3O6CA 4MNJA 1IEQA 4OBRA 4FO4A 5KITA 1UW9A 1ZL1A 1JCYA 1CW2A 4JTHA 3WH5A 1XINA 5D33A 4O4WA 4MJZA 4IPJA 3W73A 4WSKA 4NF7A 3TJ4A 2P53A 1FCQA 2QHAA 2WVVA 1IQ8A 2E40A 4JKMA 3TNBA 4LUTA 2ZCGA 1X98A 2I9EA 3T40A 5G1YA 1DBTA 2VWSA 4L9ZA 3HQOA 2O9RA 1L6GA 5K2ZA 3SJ3A 4MIMA 3PZ9A 3KBWA 4J27A 4ZTXA 2PP3A 1BG4A 4NIRA 1R9XA 3ITOA 1KBKA 5JQ9A 4AF0B 1NP0A 3AYSA 3N2BA 2PC4A 3WBAA 2ZUSA 1D8CA 3PP7A 1FWAC 3TZFA 4HYVA 1AW1A 2JK2A 3LLXA 5AFDA 4KCTA 1OABA 3AS0A 4JQAA 1C91A 4DYKA 2DW7A 4EPKA 2XH7A 1JPIA 4L6OA 3UWVA 2QMJA 3BV4A 1J79A 2ABAA 2BZNA 3FX4A 5I3KA 1DHPA 4OIFA 3UFYA 4Q8VA 3AYRA 1J0JA 5E70A 1UZ4A 4MZYA 1TR9A 1FHLA 4J4KA 2X0YA 3KVLA 5AC4A 1IR1A 3CZ8A 3BZGA 3IGHX 1CZ1A 1EJUC 1A3WA 2V82A 2GVJA 2X7VA 5CPNA 2Y8VA 3BLOA 4NNBA 4A3YA 1K9EA 1GVQA 5ABGA 1B5TA 2Q8ZA 4CCZA 2I5QA 3AHVA 5FCZA 5CJNA 3W70A 2VELA 2DVUA 2OPJA 5I06A 4F8XA 4J3ZA 4GI6A 1JR1A 3PB0A 5ABEA 2WPBA 1RP9A 4DNHA 1PKYA 4HA4A 4XVEA 1FWRA 4AYSA 3K1DA 1P1XA 5LNVA 2WK2A 3GAKA 1XIFA 4EPDC 4IFKA 3LN3A 1XJBA 4ZE4A 3M1ZA 5T91A 3HG5A 1VFUA 1W37A 1X1OA 3OBAA 2L5HA 3POCA 4KRZA 3IUDA 1OG6A 2BHYA 4BS0A 2PDPA 3GH4A 5GPRA 4HYWA 3FY1A 1W1PA 4W87A 3GE7A 3HG3A 1UYQA 4KFPA 3FYYA 4MUPA 4DYJA 4BI6A 4Y9MA 3PK7A 1VIWA 1JF6A 2QGYA 4I3GA 3NO3A 2YA1A 1M53A 5HOSA 1PHQA 4RPPA 4L80A 4LAMA 3M64A 3UVAA 1PZ2A 4O0KA 4ATLA 4CEXC 1DWFM 3N9SA 2QIWA 3GXPA 1JIBA 1I4NA 2V5KA 3SCPA 5FJPA 2JIWA 5JH2A 3NNTA 1FWDC 3ITLA 3LI1A 4XD5A 2V3FA 2TODA 1D8WA 3R94A 4F40A 1CX9A 3SCSA 1RQEA 3FA5A 4QBXA 4DLMA 2EHHA 4EP8C 1H49A 2HE5A 4D6FA 3R8RA 3CUGA 2J13A 4H4IA 3QQ0A 3CHFA 1SJDA 1XIJA 3LSCA 3GW3A 3TFXA 4CQBA 5FSEC 5HWMA 3W28A 1D7FA 2WM0A 1TELA 3S5SA 3CMJA 4NG3A 3QM3A 4WOZA 1KRBC 1XG3A 1FWFC 2XH4A 2PDNA 2PP0A 2OOFA 1NQ6A 4IQEA 3RF9A 3M4HA 4Q22A 4HVXA 4MYXA 3AJ7A 4R33A 1AFSA 1H41A 4W8AA 4L61A 3L5AA 1OIFA 4MWAD 1QHOA 2ZZ1A 5A6LA 3QTPA 4ROPA 4WDWA 1S2AA 1B2YA 2DDXA 2CBUA 3UJFA 3GU9A 3T81A 1P6WA 1XDLA 3G1SA 2FVKA 1M65A 4AD4A 1TMQA 2WSYA 3G1YA 3W7MA 2GOUA 5M5DA 3SY1A 4Y90A 4GG9A 1E9LA 1ZBWA 3M5VA 2W79A 5H8UA 2Y62A 3A12A 4KMQA 2F6UA 3FKKA 4DRSA 3BW2A 5ABFA 1QT1A 4WJXA 2Q8XA 2QLYA 3B8VA 2GQAA 4HA0A 5CPQA 3N2CA 5C9RA 5IBXA 2WNZA 3CXOA 2XN2A 4XBSA 3AWNA 3I3BA 1B30A 4IICA 3C0LA 1QW7A 4IPPA 4Q6XA 2EQDA 2VDHA 3REQA 3LMYA 5TF0A 1B9ZA 4ES4A 4EWND 1A5OC 3W22A 2PDJA 3NG3A 4MZ8A 2X0HA 5CC7A 4C90A 3W72A 5LIUX 1EWEA 3EDKA 4CNOA 3U7VA 3R5EA 4LT9A 2MNRA 5E1QA 1DJWA 4ZOAA 3A5FA 3DYPA 3ZSTA 1TIWA 2D2JA 5D9PA 4F0SA 3L0NA 3N9RA 3EWWA 1GZGA 4M7TA 3IVTA 3ARSA 2HDJA 4L9XA 2C13A 1VYRA 3BXWA 3FDGA 4U3AA 1ME9A 3CO4A 3NO1A 3M7SA 5HQLA 1S2TA 3WK2A 1AJ0A 1GT8A 1TPC1 3HFTA 2XVLA 5AHNA 2VL4A 4O52A 4Z2JA 2HWGA 3W7IA 1EKOA 1HFBA 2O7SA 4O28A 1K7EA 3H53A 3FA3A 5H6HA 2JKEA 2WB5A 3CAQA 3N2OA 3BJFA 3H2NA 2JKPA 1OCNA 3NOYA 1SO5A 4KIRA 2DH2A 3L4WA 2OOGA 4FNSA 4XD4A 1EX5A 1CLKA 4MZ1A 5CCZA 4TTGA 3CH0A 3QMSA 3CL7A 5DRCA 4MB5A 3PBVA 3NTYA 4H3DA 3DKJA 1UB3A 2DZSA 4PTWA 3GC4A 4WCJA 2BSLA 1WP6A 3WKZA 4AW7A 3BICA 3AIEA 1WXZA 1TTJA 3QTGA 1O66A 4UCGA 5DCBA 3WL1A 2GOKA 4Y8FA 3LZ3A 3VM7A 1VFMA 4MWAB 1C92A 2QKFA 2HPIA 3RLGA 3K4WA 4BQ5A 3SFKA 2FIQA 4YPJA 2ZDSA 4D9PA 1L0PA 4YCOA 2J79A 2TRSA 1EJXC 3W1MA 4Z08A 4GC4A 3EMCA 4EWJA 3S83A 1S5VA 4RZ4A 3QSRA 1V77A 1KTCA 3OTRA 4FA3A 1GQNA 1AK5A 1E40A 4GXWA 3NZPA 1C90A 2HBXA 2YW3A 4MNLA 1WO2A 5TQLA 3GFYA 3U2OA 5HANA 3R0DA 5KZDA 5CPOA 3IUHA 4JNYA 1WNOA 3WD0A 2W3ZA 2Y88A 3TMLA 4G5DA 2OFJA 3LM3A 1QPRA 1SMAA 3I65A 2PDHA 1TFVA 1Q8AA 3GXNA 3CU2A 4C6NA 3ZVIA 1ZGDA 1EEPA 1ITUA 4W8LA 2W91A 4IIDA 3EB4A 4QFUA 3VIOA 3UQNA 1JUBA 1Q7ZA 3KRSA 4QQUA 1ZJIA 4U5IA 4J1OA 1LRTA 3TCSA 4REQA 3MJYA 4PBEA 5CLTA 2Z27A 1JYVA 1V93A 1TB3A 2V3EA 3UWYA 1IR2A 4B5UA 1ADDA 2ZFAA 4U28A 4XBJA 2DSZA 3W85A 4PBGA 1EHNA 3B8IA 1FP9A 4BWLC 4JOMA 4B16A 3NEHA 4HMDA 1Q6OA 1TX0A 1M5WA 3M0IA 3S2NA 1FQ0A 2WV8A 3PWAA 4A21A 1NTHA 2XZ9A 3IAPA 3SBFA 4GNKB 1VBHA 1BGAA 4RX0A 4KETA 4QSFA 6PTDA 2HROA 3UYIA 1D7KA 4LS1A 1HJXA 1PKLA 4AWUA 2HPMA 1G7UA 2AMGA 3TSBA 2B4GA 2ZXBA 3CEUA 2E0PA 2O55A 4GBDA 2EXOA 3T8LA 4AZCA 4LF2A 1O5RA 3L4YA 3D6NA 3PPGA 4ZVJA 1VEMA 2GSEA 2YL6A 1K4HA 3AI0A 3MHUA 5FJTA 4X9SA 2HJPA 1K8CA 4Q32A 1I2OA 2GK1A 7TAAA 5D04C 5J5RA 1AD1A 2B7QA 4I9JA 4F0HA 3A64A 1P0DA 3RLVA 4MOZA 5FKYA 1X39A 3KZSA 1QDSA 4XZBA 1ISVA 4M1RA 1S5WA 2QVNA 1OT1A 5H91A 3HIJA 4MKSA 1OK6A 3LCHA 4JTRA 1J6PA 1W1ZA 5IDIA 3WQ8A 3SR7A 3W7PA 3LQGA 2Y1HA 4JEJA 3L7RA 3BLFA 3S9ZA 4MB3A 4UTKA 1YPXA 3KW3A