3LI1A

Crystal structure of the mutant i218a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGAIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3li1A00
1RV8A 1I2OA 1ZENA 3NOEA 5D09A 1YPFA 3CIXA 3VCRA 3PF3A 4IMCA 3G0XA 2RKXA 1WYIA 3PULA 3O05A 3W85A 3ZS4A 4JEQA 4JIQA 4JTGA 1ICQA 4S2BA 4E2DA 4Z1BA 1FDJA 5BMWA 3RK8A 2GPTA 4RLIA 3LXCA 5AC7A 1MSSA 1KW1A 4K8EA 3ABSA 2V5BA 1HUVA 5H2ZA 1OF6A 1KM6A 5CPOA 3G24A 3K30A 1XUUA 4LTSA 4OV9A 1XC4A 3TV8A 4TMBA 2PCQA 1V7YA 4JXCA 5AHEA 3UNDA 3W76A 1AL8A 4JTJA 1FCQA 3NG3A 1HTIA 3C61A 5F2MA 5C54A 5H91A 3HB9A 4P2VA 1TQJA 1PVNA 1HO4A 3R89A 1VH7A 4DO6A 4FEZA 5DCDA 5C6MA 1OFBA 3JRKA 3MBFA 1DVJA 4JX4A 5EBUA 2VFDA 1QR7A 2HSAA 3NO5A 1TTJA 3CB8A 1F73A 2WOQA 1EP1A 4HSNA 1JCLA 3UWQA 2GQAA 1F76A 5KZEA 3L5MA 2ZZ3A 3STEA 3FKKA 4I7WA 2OCZA 3N34A 3M5VA 4W9TA 2W6RA 3SI9A 1JCYA 1H62A 2V0TA 3G1HA 4WX2A 4AWSA 2EGZA 4QSHA 3PG9A 5G2IA 4NNCA 1GJPA 4CCEA 5LNUA 3DFQA 5AHFA 5D38A 1F7BA 4Z08A 3MI2A 4JYDA 2VOMA 4CNOA 3KVJA 1IXPA 3NA8A 2ZFAA 2B7QA 2ISSA 1PCKA 1N7KA 4N6EA 1QFEA 2RFGA 4IPIA 2PURA 4LW7A 5FF2A 4ZQPA 2BLEA 2ZRZA 3O6DA 5EKYA 2E68A 3Q94A 1XUZA 2H3DA 1I2PA 4GRSA 4CQAA 3HOJA 2WO5A 4WUIA 2YFOA 5FF3A 2B7NA 1F6PA 2Y85A 2TPSA 2CLEA 3LCXA 2FPYA 5HULA 4L4LA 4KWVA 1SZEA 4N9DA 1BKSA 4HPXA 3CT7A 4UIOA 1FCBA 4GUHA 2OJPA 2X2GA 3ATYA 4O52A 4QIUA 1ALDA 2RDTA 1X6UA 3P8IA 2GQ9A 1QAPA 8TIMA 5AC6A 3G22A 3W7MA 2Y61A 4CNPA 3W1MA 1LYXA 2XN1A 4LOCA 4RCXA 4QNWA 4RXFA 1PHWA 2NV1A 3KRZA 1FWNA 2F84A 4QAIA 2E6FA 3O06A 3HG3A 4Z1CA 3HO8A 2KZHA 2ZA1A 1KFCA 1SW7A 3IEBA 1T0OA 4JY8A 3W73A 1LRQA 1Q6LA 4UNLA 3W1AA 2VKZG 2ZBTA 3GDRA 2FQIA 4IMFA 3WK1A 5KTLA 2VEMA 4YMZA 1DBTA 4O11A 4BFAA 2B4GA 3LI1A 2NX3A 2VFHA 2QCFA 1HO1A 1QDSA 4C1KA 1ZFJA 1IGSA 2BX7A 2WSRA 4ML9A 1H5YA 2GQ8A 3P84A 5TIMA 3LHZA 2PRHA 4XBKA 3SIZA 3T44A 3KHJA 4O8RA 1XBXA 1H7PA 1FDZA 4JD4A 1A5CA 3CTLA 3W7KA 1VGAA 4AAJA 2WSYA 4EIVA 1ZALA 4RZ4A 3QC3A 3NPUA 2YGYA 3L21A 3GXTA 2I14A 3A24A 2J88A 3TMLA 4O54A 4HN4A 2ZRVA 5HJLA 3HGOA 5ABTA 3QMTA 2C16A 3IVSA 4IOTA 3W7RA 3GAYA 2QUTA 4UCGA 5LNVA 5A8GA 4AEOA 1I8JA 1JUBA 1PS9A 4NZFA 4M5PA 4UTIA 1TQXA 2R8WA 5HWMA 2X1RA 4MUZA 4O10A 5LHEA 4GXMA 1C9DA 2CW6A 2I9EA 1W1ZA 4CQ9A 2A85A 1TO3A 3EKZA 4PC8A 4DF2A 4AHPA 1TPH1 4IXHA 3QSTA 3FYPA 3EX6A 3O1NA 3W7NA 4DPPA 4HNVA 4O12A 2QDGA 3N9RA 4LNYA 1N55A 4R7JA 2DZVA 3W72A 3UXDA 1DHPA 3IIZA 1LTDA 1LDCA 3IGSA 2QCEA 3IIVA 5D04C 3STGA 5C2XA 2TYSA 5FEZA 1UBSA 4MOZA 4JY9A 4NJKA 1VC4A 3L9CA 4UMCA 1VYRA 1FDYA 1I2NA 1WOBA 4JTEA 3U8GA 3LDVA 4OWGA 3S5OA 3TE9A 1RPXA 1I45A 4EF8A 3NL5A 1Z42A 4YCOA 1THFD 1TPDA 1KA9F 5AFDA 2XFWA 2YXGA 3PBWA 1NF7A 1W3TA 3NM3A 2AQWA 3TAOA 4JYFA 3O63A 2ZTJA 3HG5A 4BWLC 1Q6QA 2Y88A 1GVRA 3C6CA 3M43A 2BSLA 3RF9A 5D2YA 3BLIA 3OA3A 1FWTA 4MVAA 4WOZA 4A3UA 1TIMA 3UYCA 3TIMA 4ALDA 2DJXA 4JYEA 3A21A 4XUGA 3B05A 1XBVA 5K3VA 2FTPA 2Q8ZA 3A22A 4MY1A 1EX5A 1PIIA 3UXAA 3LTYA 4N02A 1EP3A 3BLFA 2JBMA 1KM3A 5CG7A 3NZ1A 3W2KA 1TTPA 2OT0A 5G5IA 4DF0A 2QUVA 3L68A 4PH6A 3N9SA 1LCOA 3F4NA 3EWYA 5CZSA 5KINA 1W3NA 3S1WA 1WAUA 4TU1A 3NNTA 1T96A 4H3DA 4LC8A 3DH7A 1RVGA 5CZ0A 3MBDA 1I2RA 3C4UA 5BW6A 1C29A 1P1XA 4WD0A 3TFCA 4O15A 5LGXA 1ZY9A 5CKSA 4CCDA 1LOSA 1EEPA 1YTDA 2EKCA 3H53A 2RDUA 6ALDA 3EX1A 1WOAA 2Q3OA 1MEWA 4O1CA 4LVDA 3TNOA 4N9BA 3P74A 5DN1A 3G1DA 1JQVA 2YW3A 5HR6A 4BWLA 3EWBX 1P5BA 3NDOA 3GDKA 1OJXA 1GVQA 1DORA 2X1UA 3BK0A 3B8DA 3QW4B 2NUYA 2BZNA 2QAPA 4JDYA 2VXNA 3TFXA 5D32A 1WA3A 4ICNA 1JCMP 4K8HA 2WSQA 4NXKA 3ZWTA 2ZZ1A 1F6KA 3W7DA 2WNZA 1OFQA 1VCGA 1TJRA 4PCFA 3EX4A 5L6UA 3DENA 1YXYA 1JJKA 2YX0A 1L9WA 3V75A 2NX9A 3PUOA 1QMLA 3U2OA 3PBVA 3TQKA 1LRNA 4LRSA 5FEXA 2A1YA 3DBPA 2GJLA 4O1DA 3IIXA 4CCCA 3L65A 1XDMA 2PRLA 1JUEA 5K9XA 1K7XA 1UUMA 6TIMA 4UTTC 4X22A 4FNPA 4DF1A 3MHFA 3B4UA 3NR0A 4UFIA 3LCGA 3LI0A 4OU1A 1SSGA 4JICA 5LKYA 2PRMA 1SFLA 3PUDA 3NQ8A 3O07A 1WXJA 1FBAA 2J6XA 3UZ5A 2BXVA 3SECA 5LNSA 3LCWA 1VQTA 3EWZA 5C55A 3SGZA 4K6AA 3NZRA 2V2HA 5AHNA 3HPXA 5CSRA 5F2LA 1A53A 3S6DA 1OFAA 3W84A 4Y90A 1H7RA 2Y62A 3IV3A 1O94A 4FO4A 1GTEA 4Z1AA 3MUXA 4NX0A 2QAFA 4KWWA 4NZJA 3NM1A 3M9YA 1J2WA 1GVSA 4EWND 1X7FA 3IGXA 1JUKA 5IBXA 1VYPX 4Z1DA 1JRBA 3DHDA 5L9FA 3S5ZA 3W7QA 1GZGA 3LLFA 1KM2A 3DU0A 3LHYA 1OFPA 3Q2DA 4K7YA 3O15A 1GT8A 1AW2A 4UC5A 3BGGA 3TA6A 5J5RA 4XKYB 3E49A 1PHQA 3RU6A 3IVTA 4FNRA 2AAMA 1XCFA 3OVQA 2GJNA 4EF9A 3HF3A 2FIQA 5DY2A 4QNEA 1G67A 2CLOA 1YTKA 3N73A 5K9CA 2FB2A 3C3NA 4LUIA 3FIGA 3F4WA 1RZMA 5LZLA 3KVMA 1O5KA 1O4UA 1GVFA 1D3HA 1QPNA 1TPEA 1LBLA 4M6PA 3W7LA 1G4PA 2G96A 3FA5A 1KTBA 5E1QA 1AL7A 3BO9A 3GVGA 1YDVA 3I7RA 1L6WA 1YTEA 5D02A 1KTCA 4JIPA 4AVFA 1TTQA 4NJJA 3S42A 4UTMA 2OT1A 2QUUA 4PL1A 3CU2A 1X8FA 5D37A 3I68A 4LVAA 1GTHA 3BW3A 5GVJA 1B4EA 4N9CA 2NLIA 3ABQA 3QEZA 1KBJA 3W87A 3GR7A 1SSDA 3NPVA 5I3JA 3NL6A 4UFHA 1VJIA 1ZJIA 3OBKA 1HG3A 2Y63A 5EL1A 1TSIA 5LHFA 1A50A 5AHIA 3SY5A 1T99A 3NXFA 3S5YA 4ZL1A 2A6LA 3MJYA 3S8HA 2CLLA 4DQWA 4O53A 3P82A 3MHGA 4QITA 4PTNA 3GXNA 4GBUA 2ZRWA 1YDOA 2E77A 3WJYA 1ME9A 4UTJA 3MP3A 1XL9A 1K8YA 3MWAA 4MYXA 4DBEA 1K7FA 2NXIA 2C18A 3NEVA 4BI6A 5F4XA 4IPJA 3TUUA 3TC6A 3L5LA 4K38A 4NQ1A 3PR2A 2XN0A 5G1TA 2DZTA 2FDSA 3GX9A 3DFOA 2ATMA 5CPMA 5LNWA 5I3GA 2CZEA 3LBCA 1M5WA 2YZRA 4JDBA 4TR9A 4PA8A 1AMKA 1H50A 2Q8LA 1MZHA 1E51A 3IIPA 5HUOA 1OYCA 1SZNA 2J24A 3C2OA 4Q33A 3ZR4A 3KAOA 2X16A 4FIQA 4Y96A 4A2SA 3A23A 3UY7A 1PCWA 3PG8A 2YR1A 3GIYA 1TB3A 4Q4KA 2RHGA 4MZ8A 1R46A 4ZQOA 3M0ZA 4RXGA 4AXKA 4MY9A 3BG5A 4YXGA 1H60A 3DI0A 3BG9A 4RK8A 4LV4A 1VLWA 3W3OA 4FXSA 1U83A 3FS2A 3MI6A 3TJXA 1M6JA 3EB2A 4BR1A 1YXCA 2YYTA 2HS8A 1BWKA 4O57A 3DXIA 3JS3A 3DFNA 2CLIA 3W1RA 3GK0A 4FNUA 1RQEA 3P80A 1DOSA 2QCMA 4UTKA 5CGQA 1YYAA 1XDLA 1SO4A 2V2DA 2VFIA 1TPUA 4HIBA 4M7TA 2P0OA 1RR2A 3LXAA 3PWAA 1VRDA 2FB3A 3DHFA 3H55A 3R12A 2A7PA 4L4MA 4JTTA 3CHVA 1HL2A 1TYGA 3HG2A 1HFBA 1LM1A 2YYUA 4LS1A 3G1SA 4ZQMA 3GDLA 1G6CA 5AYZA 2QR6A 1QO5A 3G1AA 4PEKA 3HGSA 3W2MA 1NAL1 1OF8A 5FF4A 2Y7EA 1ZAIA 3RLVA 4X9SA 3G3DA 3P61A 5D03A 5E93A 2QKFA 3ATZA 2LLEA 3KXQA 1GOXA 2QDHA 1JRCA 1ICPA 4TX9A 5KZMA 2J9ZA 4K37A 1SPQA 4DELA 2C13A 3STFA 3M16A 2CLMA 4I7UA 5DBTA 2B0MA 3SJ3A 2QJGA 1LRTA 4O16A 4GJ1A 1V5XA 1K8XA 3DFSA 2WV8A 4Y8FA 4IMDA 2YFNA 3UWUA 4U4MA 2ZZ5A 1ZHAA 1H7WA 1P0KA 3GAKA 3BG3A 4JGDA 1F05A 5HR7A 3DZ1A 2R94A 3C2EA 4UR7A 2QCDB 2CLHA 4IX0A 1H63A 4JTUA 1NSJA 1R2SA 1QPOA 3S9YA 4XBSA 2RH9A 3UZJA 3W2UA 5DCBA 4FF7A 4LU0A 1OX4A 1VCVA 1LORA 5F4SA 2VEIA 1FQ0A 2OMAA 2NV2A 3R8RA 4LVFA 1N8FA 2C0AA 3CEUA 2V5LA 3R5EA 3DKJA 3THAA 2YDAA 3WFAA 1S3HA 3YPIA 3QF0A 4UFJA 3GKFA 3QPZA 4IMEA 4ORIA 3OIXA 3LX9A 1S5TA 3GDTA 1EA0A 3IVUA 2DU2A 4MFEA 4QJ1A 4FB7A 5HMSA 5AB3A 3KFTA 3C2FA 1K8ZA 3GNNA 4OV4A 2C1HA 1WDWA 2X1SA 2QCDA 2A5HA 3S1XA 2CZDA 4BK9A 2QCNA 1A5BA 4FNQA 2ABAA 4JNMA 2J9XA 4ADUA 4ORMA 2A2IA 1XI3A 1P0NA 2ZZ6A 3L66A 3LCIA 4UFKA 2WKJA 1LLZA 2CZ5A 1W5OA 1QCWA 1JVNA 1J4EA 5T26A 1PE1A 1OVDA 2VEKA 3CWOX 4X3ZA 4B5NA 3HMJG 1TPWA 3D0CA 3CLMA 1DJQA 4Y9AA 3M5YA 1LP6A 1B3OA 2ZQ0A 4JR5A 3EX2A 4RV8A 5AYXA 4FIRA 2YSWA 2CLFA 4H4IA 4DO5A 2CFFA 2ZRYA 1Q45A 3TR2A 5LGZA 1Q6OA 3M44A 3OHIA 1TPC1 3W86A 1TV5A 2Z2UA 3NQEA 2FPTA 4IMGA 1DQXA 3EXTA 5K2ZA 2PC4A 3T40A 4O28A 5LSMA 1SUXA 3L0GA 3NQ2A 2QCHA 3VE9A 4O0KA 4JX6A 4Z0SA 1FCVA 5BNKA 3AJXA 1W3IA 2A0NA 4MKNA 2ATSA 1TTIA 4HNTA 1KM0A 3B0VC 4N4QA 1OYBA 3O8AA 3T4CA 1R2TA 4UNKA 3Q37A 2VC6A 5F2GA 5DXXA 1A5SA 3G18A 3L0NA 1IXQA 2OZ0A 3QMRA 2I1OA 4ZMGA 2Y7GA 4NNAA 3OEXA 1D9EA 3W1LA 4IX2A 4AF0A 3DKLA 4MJZA 4JTKA 3W70A 1GG0A 4AHOA 1K03A 2DZWA 2B7OA 3UWYA 1LOQA 3TCEA 2FJKA 3W2NA 5D2WA 2J9YA 1TRIA 1G69A 4UXDA 1S5WA 4OQVA 5C5YA 3LTSA 5I3IA 1W54A 4LUJA 4XTIA 1NEYA 2E6DA 4KFPA 3HIJA 4HNUA 3TK7A 1SO3A 5I3FA 1JCJA 2G97A 3LRLA 1R47A 4RZ5A 4JTIA 4N6FA 3B04A 3W1XA 5IBXC 5G1YA 2GVGA 3MYPA 4RZ6A 3LHUA 2NUWA 3S1VA 5HINA 1VPXA 4JTLA 3LRKA 1OHLA 3I65A 4O50A 4KKXA 2NWSA 3CIWA 4UTLA 1KFLA 3P62A 2BWGA 2ZA3A 3TH6A 1XKYA 2C14A 3TSDA 3W6YA 3CWNA 3LBMA 4LVGA 1VHCA 5EY5A 4E38A 3NQVA 4A21A 1S5VA 4WOQA 3TMQA 3BW4A 4GNJA 4TO8A 2NXHA 2A6NA 3W83A 1W31A 4XWUA 3HQ1A 1SZGA 4QISA 5AOUA 4UMBA 3EXSA 1TPFA 5BMXA 3THQA 3AO0A 4ZZ9A 3TX9A 3C2VA 2WQPA 5K4ZA 1B57A 2WNQA 1H7NA 3SR7A 1VLIA 1W5PA 1VZWA 2A4AA 3H54A 3TQVA 1XBZA 1Q6RA 5HNRA 4TIMA 4IXXA 4MLRA 2J27A 2H90A 1GQNA 3KX6A 3HJZA 3W7PA 3NPXA 1GYNA 1KM5A 2ZCGA 3E0IA 3VFLA 2GVJA 4M6QA 1FUYA 3BV4A 1Q3NA 1I2QA 3N2XA 3NL3A 5HUPA 1ZNNA 4YLWA 4FX7A 3SW6A 1F2JA 3SSJA 4UMAA 3HBLA 3ABRA 3L0KA 3W7HA 3HGRA 1H61A 2E5BA 2FLIA 5FEWA 1KBIA 5KMYA 3UWVA 1W8SA 5AHMA 1EIXA 2DZUA 5BRBA 3MO7A 5DCEA 4MYAA 3LGEA 3PBYA 3NAVA 3TW7A 3DGRA 4GFSA 4IGHA 2Z0IA 1Z44A 4NT0A 1T8XA 4O13A 3MYOA 3LRMA 4ADSA 3UQNA 3GYEA 2CU0A 5AC8A 3L2IA 3P8JA 3W07A 3LCHA 1ME7A 1ZAHA 5I3KA 3M7WA 1UJPA 2TRSA 5EMUA 4S2CA 4O18A 3O6YX 3P5YA 4ZQNA 4ZQCA 3MP4A 3G8RA 4UFMA 1EUNA 2C3ZA 2FFCA 3C8FA 4XTDA 4HPJA 1VR6A 3A5VA 2DZSA 3UWZA 1DV7A 3UWWA 3PS7A 3UPBA 2GOUA 3M5XA 2BTMA 1R2RA 4ADTA 4CLMA 4FNTA 4PFMA 3W9ZA 3R2GA 1SO5A 5CPNA 4J9JA 3TQ0A 5DELA 3M6YA 2VFEA 2JGQA 1JCXA 1EUAA 2YW4A 2ZZ2A 3T7VA 3W22A 2E5DA 3WJXA 3GZ3A 5KSWA 5IM51 3STCA 3LV6A 3M47A 4LS0A 2H8ZA 3HG4A 4UTWA 4Y6GA 1KM4A 3GLCA 3USBA 3W1PA 1W56A 5I3HA 4XQ6A 3N3MA 3M1ZA 4FX8A 4NU7A 2ISWA 1WV2A 3I7SA 5HWNA 3LCLA 3W75A 3LB0A 3UD6A 4U28A 2V9DA 3GKAA 3OVRA 1K3UA 1UUOA 1LBMA 1QWGA 3B0PA 5F2IA 3I7QA 3LV5A 3NQ6A 3G1XA 3QQ1A 4UTHA 3ELFA 2NXGA 5K9DA 3PY2A 5D33A 2NWRA 2ALDA 1KLZA 3LHWA 3LXBA 3MP5A 3TROA 3GR8A 1GEQA 3RLUA 2QJIA 1KFEA 2YPIA 2V2CA 1DL3A 1DJNA 4MJMA 1KTNA 3IIOA 1K02A 4AWUA 5G2WA 3PB2A 2ZZ7A 5KZDA 2E5CA 5CPLA 4GC4A 4PODA 5EA9A 3W88A 5FI8A 4MZ1A 1FCUA 3SZ8A 5FEPA 5J5DA 1GWJA 1VHNA 3FKRA 1W0MA 3VI2A 3B03A 3EWUA 2Z6JA 4DXVA 2B7PA 1KM1A 1W5MA 4MIMA 3NGJA 5DXYA 2WJZA 4YCPA 3FFSA 3MI3A 3W74A 3BVJA 4C1LA 3W7IA 3L67A 1G7UA 3O16A 1H51A 1YXDA 4R34A 3ANYA 1OK4A 4QM1A 3PAJA 2IQTA 3G1YA 1ZCOA 3HPSA 4LVBA 2NX1A 1GG1A 3GXPA 1LZOA 4AWTA 5F4WA 1IXOA 2R91A 3QMSA 3F03K 4JTHA 3W7GA 2V82A 5KITA 3DI1A 3HGJA 2E09A 4R53A 4H6KA 4WXYA 5HWJA 1IXNA 4K39A 3TW6A 1B4KA 1K7EA 2YCEA 1TRDA 4CNNA 1FWSA 1A5AA 3NQGA 3W1TA 2DP3A 2P10A 3P67A 2A7RA 1G4TA 3CEPA 2QJHA 4E2BA 4E0CA 3N2MA 1IIGA 1OX4B 4LV9A 3NPWA 5AHLA 4UFLA 5D2XA 1KFJA 2X30A 1KV5A 5K7JA 1J5TA 4X2RA 3QQ0A 1ME8A 1WQ5A 4EOUA 3QYQA 2H8XA 3LLDA 3PB0A 1OFRA 4DBDA 1AW1A 1UCWA 2ZDRA 3F1QA 4O17A 4FXRA 4EVZA 4XZ9A 4LC6A 1RQBA 4GUIA 3PSVA 1QNVA 1G7VA 2ZTKA 1M7PA 3S0CA 4BI7A 3NQ7A 1XM3A 4NX5A 5MHBA 5E0KA 4R33A 4UTUA 4ONVA 1XXXA 1SFJA 1WX0A 2Z6IA 3QM3A 4YWIA 1YADA 1TV7A 1OG0A 3C2RA 2VFFA 5CZJA 4Q32A 3FLUA 2D73A 1BEUA 4GWEA 3N14A 1I4NA 4ZQRA 1W5QA 2F7FA 2Y7DA 3W7JA 3WJWA 5FF7A 3PC0A 1QPRA 3LHVA 3FOKA 3KVLA 3LTPA 3I6RA 3TKFA 3JR2A 4WXZA 3SGUA 1TPVA 3GNDA 4GUGA 1KLYA 5TQLA 5F1VA 3BPWA 1NF0A 2OX1A 4OHQA 5G4EA 4Z0JA 3R13A 2O7QA 3E12A 4PL2A 1GVOA 4LT9A 2HMCA 1IF2A 4BI5A 4WY0B 5DY3A 5EYWA 3O6CA 2QCCA 4K7VA 4GUJA 5D30A 1EWEA 2G95A 1DQWA 3OG3A 4OBTA 2VFGA 3QFEA 4NJHA 3KOFA 4DO4A 4N2YA 1RQHA 1H1YA 5DLCA 1OX6A 1FWRA 5D05A 1OFDA 3E96A 3TSMA 4HT3A 1O60A 4O0ZA 3V1PA 3HPZA 3W1QA 3TU9A 3M5ZA 4WZHA 4IUOA 4LWWA 1Z41A 5K4XA 5D2VA 4LS2A 1MO0A 2QCGA 1LLWA 3CC1A 4UUIA 4JTSA 2CZFA 1QOQA 4MFDA 5BOOA 2CWNA 3W1UA 3B06A 1D3GA 3T55A 4RKAA 1Y0EA 1FY6A 2Y70A 1SW3A 2W79A 3FJ6A 1BWLA 3NQMA 2GVLA 4O14A 1H1ZA 4WY0A 4AF0B 5SWUA 3RFAA 1WBHA 3FYOA 2DORA 1SR9A 2E6YA 1CI1A 4M19A 3LM7A 3ZWSA 3KRSA 4WJEA 3W7EA 3FEMA 1O95A 1OFEA 3TSBA 3G1FA 3P81A 4I7VA 2ZZ4A 1LBFA 3IRDA 4FHAA 4GUFA 3L5AA 3C56A 1FWWA 3EWXA 2NUXA 2AGKA 4M6VA 3DAQA 1KV8A 3C52A 3G3MA 3EKLA 2JKAA 5LNRA 4K36A 4KFOA 1G4SA 4FX6M 4NNBA 1B9BA 4LRTA 4AH7A 2TMDA 3BGJA 2Q3RA 1TJPA 1P4CA 2VEPA 3CQ0A 1H7XA 3W7OA 2ZYFA 1AG1O 1F5ZA 1FXQA 1MEIA 1JR1A 2RDWA 4NXSA 2W0UA 3RNDA 1VCFA 3EWWA 3B0UX 3TJLA 4RR4A 1OFOA 2E1DA 1OK6A 1BTMA 1U5JA 3LCFA 1OABA 1EWDA 3SFKA 3TXZA 3WK3A 1L6YA 2O7SA 3QJAA 5EPDA 1GYLA 3E9AA 3LOTA 3P7YA 3E02A 4JX5A 3W7CA 2V81A 3G1VA 2H6RA 4HHPA 4RJEA 4IQLA 3GDMA 3W71A 2JGYA 3RMJA 2HS6A 2DZXA 2Y6ZA 3QSRA 4N4PA 1YDNA 4A2RA 1LROA 1QPQA 3S1UA 4O4VA 1XFBA 3W2JA 4BF9A 3OVPA 5U4NA 1PL9A 2JKPA 4MY8A 1FX6A 3QH2A 1ADOA 3MW7A 2DZPA 3QPYA 2V30A 3IGUA 2PE4A 2ZA2A 1UB3A 3WJZA 3C0JA 1W37A 4LY8A 2H3BA 1MEHA 4YL2A 2VENA 4OGZA 1UASA 3EX3A 1C8VA 5CSSA 2E6AA 1WBJA 1TPB1 4G1KA 4HSOA 1G4EA 3S5NA 4KFNA 3WK2A 1M7OA 1KFKA 4WQ6A 5FESA 4RX0A 1XBYA 5HQEA 2V8ZA 1SO6A 1JULA 1EPXA 1TREA 1ICSA 3BARA 4S1FA 3QZEA 4NJGA 4JS3A 4O1BA 1SQ7A 2C6QA 1R30A 4P61A 3EEGA 2DJLA 3ZFHA 3TAKA 1X1ZA 1CX9A 1GPWA 1ML1A 3MHUA 3A5FA 1IIHA 3NQAA 3A9IA 3QRHA 1SZFA 5G4WA 2EF9A 3VNDA 3KVKA 1TV8A 1JCNA 1KFBA 1MXSA 4D2JA 2VELA 1O5XA 4FNSA 4AHQA 1TMHA 3PVFA 3LERA 1X1OA 4NVTA 4IWWA 2EPHA 4POCA 3LHTA 1OYAA 1EB3A 3NL2A 4JN6A 2JKEA 2NZLA 1DKWA 4I9AA 3BLEA 1ONRA 1W5NA 3PSWA 2R14A 1OX5A 2CLKA 1ZAJA 2C15A 1CW2A 3PM6A 3VE7A 5DBUA 3DFPA 1F74A 2ZRXA 3KRUA 3T78A 5D2TA 4OT7A 1JQXA 4A29A 1QOPA 3NQFA 2X1TA 2P1FA 5TBOA 2TSYA 3EXRA 5AYYA 4MLJA 4UTWC 4IJBA 3INPA 3TXVA 3W2LA 3FJLA 3TC7A 3WK0A 3CPRA 1QO2A 3Q58A 3UY8A 2WPBA 2A21A 3N19B 1SW0A 4HNNA 3ABOA 2JK2A 4UTTA 3QW3A 4O4WA 7TIMA 1AW5A 1NVMA 1Z48A 2A7NA 3NQDA 4MPQA 2XN2A 1L2UA 3VKJA 3WJSA 2G5WA 5G2HA 2ISVA 4WY0F 3G0UA 4NUWA 3G0SA 5U7SA 3DFTA 4O1AA 1VS1A 4OE7A 1NFBA 3NVTA 3TDFA 2QCLA 3W23A 3PBUA 4JTFA 3PUEA 3CM4A 4GE8A 2Y7FA 3G8EA 4QQ3A 4TMCA 4A22A 2EHHA 5F1UA 4O19A 4AB4A 1YLVA 1AK5A 1L6SA 1TCDA 4HKPA 2Z1BA 2UV8G 3U6WA 2GUUA 3UPWA 4DEFA 4M7SA 5CZTA 1RD5A 3NQCA 5FF0A 2ABBA 2FPVA 2Y89A 2ZRUA 4UR8A 4NJIA 3GB6A 5AN7A 1FXPA 4AMAA 2WNNA 3P5ZA 4XKYA 4MZYA 3NYZA 4DPQA 1H7OA 3W1NA 3M41A 1VYSX 2EAWA 3MMTA 1LOLA 2QF7A 1SU5A 2HTMA 3P60A 4ZVJA 4CQ8A 1YPIA 1EP2A 5A5WA 2C19A 2QEZA 3BW2A 4N9EA 1PV8A
chains in the Genus database with same CATH superfamily
4L65A 3AYRA 3G5EA 1T6MA 5IRPA 4YVPA 3PF3A 4IMCA 4I5RA 3PP7A 4JTGA 4S2BA 3OP2A 1POKA 1XSIA 4Z1BA 4GJIA 4H7ZA 2GPTA 4AC1X 3E2QA 1MSSA 2J74A 3ABSA 3AIRA 2V5BA 3EPNA 4MAVA 1P7TA 5CPOA 1B3VA 1KXTA 3FX4A 1XC4A 1DTNA 3MS8A 3CTTA 1V7YA 5A6LA 3HV8A 4I6VA 1XG3A 2UY3A 4JIHA 3NG3A 2GK1B 3GY1A 4Z17A 4F79A 4XG1A 5F2MA 5C54A 4DUXA 1EPVA 1TQJA 3EKGA 1MMFA 1PUDA 3KL3A 1HO4A 3WQDA 3R89A 3UNTA 1W1B1 5FL1A 3IJ7A 4JKLA 2YBUA 3CUJA 1HZYA 2VFDA 3VIPA 1TTJA 2A3LA 1V79A 2HCVA 1RBOB 2PEVA 3K5XA 1ISZA 1UR4A 3P3BA 2WOQA 1EP1A 3O0FA 2V5JA 2DIKA 3FKKA 3N34A 1JDAA 4C6DA 3TJIA 3G1HA 4WX2A 5CPQA 2YIHA 3NSMA 4QSHA 1Q6GA 3SCQA 5LNUA 3R7MA 3DFQA 5AHFA 2CETA 4Z08A 3F4DA 1IXPA 4GKLA 2B7QA 1PCKA 1Y5WA 3R8GA 4N6EA 3H4XA 3SFWA 3GDBA 4RE4A 4IPIA 4Q8VA 4LW7A 5IDZA 3ZJ8A 2ZRZA 5XINA 1I2PA 2PGFA 3V36A 2WPGA 2WO5A 4ZE5A 3CAVA 4GYJA 2Y85A 1GPFA 2TPSA 2DW6A 1MXGA 2CLEA 4X2PA 4L4LA 1IR2A 3UZXA 1MNZA 4M80A 1KR1A 5AKQA 2X2GA 4IJCA 3ATYA 4O52A 1LQ2A 4QIUA 2A3AA 1VENA 1X6UA 3P8IA 1DJZA 4A3YA 3RM8A 1UIPA 5AC6A 2D3NA 3D3AA 4CNPA 4KESA 4GISA 1UG6A 4LOCA 1FWNA 2F84A 5H8UA 4Z1CA 4HYVA 1SW7A 4GCXA 1CTNA 3AISA 1CIUA 4UNLA 4JFSA 3TZNA 3WNMA 2VKZG 2VURA 2ZBTA 4B3KA 3L23A 2FQIA 3EDFA 4AIBA 2PTDA 1JYNA 1H41A 2NX3A 1TV3A 2OSXA 3CV6A 4C1KA 2I56A 2WSRA 1H5YA 5CJ5A 1U1HA 4CNSA 3GIQA 3PZMA 4XBKA 4D8AA 3FDKA 3T44A 2XWDA 4GGHA 4O8RA 4ZSTA 2CKRA 4I3GA 1LT8A 4AAJA 2WSYA 5A1AA 4EIVA 3GG8A 4RZ4A 3QC3A 3NPUA 2X0YA 2I14A 3CUFA 4E2VA 3TMLA 4HN4A 3WQWA 2ZRVA 4S3GA 5ABTA 1VJZA 3QMTA 2AL1A 4AD2A 4H6EA 2HBVA 2QUTA 4AEOA 1PS9A 1JI1A 3KDNA 4O10A 3PZIA 1V0MA 4GXMA 2CW6A 1XYMA 3B9NA 2WMJA 1I1WA 1Z3NA 4IUGA 4AYGA 3EX6A 3W7NA 4DPPA 3OIHA 3N9RA 3VU2A 3BJSA 4BEQA 4R7JA 2DZVA 3E38A 3ERPA 3IIZA 1LTDA 1F4HA 1LDCA 4ZFCA 3ZVIA 1OEPA 1PDZA 3STGA 4D1JA 2HK1A 3H2FA 4MOZA 4L9ZA 3N6HA 4JY9A 1E0UA 3VIHA 4UMCA 4H1ZA 1OCQA 4JTEA 3S5OA 4ASTA 3H26A 5HPOA 3NXLA 3LYEA 3WFZA 2YXGA 4RNFA 4ZO9A 3TAOA 4JYFA 3O63A 3PPCA 1GKQA 3CQJA 4BWLC 1Q6QA 2Y88A 3GU2A 3RF9A 3RR4A 3BLIA 1B3WA 5CBJA 4XUGA 3CASA 4AVNA 1REQA 5K3VA 3CAWA 1EX5A 3NIYA 2OQYA 3MQTA 1K6WA 3E6EA 4RE3A 4N02A 3BLFA 1C93A 4AEFA 1KM3A 1UD6A 3HQNA 5FJTA 5G5IA 3II1A 3IANA 3LNMA 4PH6A 4NRSA 1H11A 3F4NA 3S1WA 4H3DA 1IEQA 1OCBA 3EYPA 1Q8AA 4LC8A 4FLRA 1BVZA 5LA1A 5BW6A 1P1XA 2DT1A 2YBVA 2WVVB 5HATA 1LOSA 3MMWA 2XYLA 1YTDA 2G8ZA 1WOAA 1RJQA 4LVDA 3TNOA 1OB0A 3UPMA 3G1DA 5I09A 4QE4A 4M24A 5JVLA 1TIWA 3SQLA 4HZ7A 3NJ3A 1E9IA 4LBSA 3EOEA 1GVQA 3QW4B 2WZMA 3VUPA 4JDYA 3WQ8A 1XD0A 4S3BA 2OSWA 1WA3A 4ICNA 3B9AA 3IK2A 3QV6A 1KBBA 2HROA 4K8HA 2WSQA 2ZUTA 3T9PA 4H8NA 8A3HA 2WNZA 4BQ3A 3MDUA 1J6OA 5L6UA 3GNRA 2YX0A 2G37A 1GQKA 3H70A 6TAAA 2GDUA 3WBYA 3DBPA 1UP2A 1UKTA 4CCCA 5JH2A 3CL6A 3L65A 4HU4A 3ITTA 4F2BA 3AMKA 1D7KA 4HGXA 3AYVA 1K7XA 1YMYA 4X22A 1W3JA 5LYRA 4FNPA 4DJEA 3MHFA 2YDRA 3VOFA 1MFUA 3LGDA 4J27A 4UFIA 3SRKA 2GZXA 3UFYA 5XIMA 3DECA 1SFLA 4HQVA 4F9JA 4QG9A 2WC3A 3MUY1 5B80A 1F9CA 1FBAA 4IG2B 1A80A 4IL0A 2F8QA 2BXVA 1CBGA 1XIDA 4HMEA 1F3WA 3SGZA 2OTDA 1SZRA 5AHNA 4QJ3B 3HPXA 1OQFA 1A53A 1OFAA 4JIRA 3IV3A 3H8AA 1O94A 1SJDA 4IL2A 4CD8A 3MUXA 3OZOA 4KWWA 2YJQA 4NZJA 1J2WA 2CXEA 2FZNA 3CMGA 4H01A 3OTRA 4Z42C 5D8WA 5FAJA 1CB7B 3Q2DA 3O15A 2YCJA 1GT8A 1XIIA 5J5RA 4DI8A 2ZX7A 4JN7A 1ITUA 1M68A 4Z2IA 3O0KA 2AAMA 2RJGA 4XZHA 2R9RA 3OVQA 2GJNA 4AD0A 3GFYA 1FOBA 3C86A 4QNEA 1LG1A 1XLLA 3LS9A 1YTKA 4D6GA 3QV9A 2FB2A 3C3NA 4LUIA 1RBAA 4HP5A 3PZGA 4LYRA 3UA3A 3KVMA 1O5KA 1QPNA 4W5ZA 1G4PA 3FA5A 3SCTA 1ITQA 2WVTA 1KWKA 3GVGA 1YDVA 3CJPA 1XFCA 2XGIA 4PUKA 5I5RA 3RCNA 3LY0A 4AVFA 4C7GA 4NJJA 3S42A 2PWVA 2GFTA 4W4QA 3HJEA 3QHMA 3N4AA 3RCMA 1QI5A 2VGFA 3FGCA 3WLMA 4OECA 3CGTA 3NPVA 2QPSA 5BXRA 1V3JA 3NL6A 4UFHA 2OYLA 3W37A 2PP0A 2V6AA 3C0LA 1DJYA 2J66A 1T99A 3NXFA 4DNMA 4GKTA 2CLLA 2PP3A 1E0WA 4HA1A 4TVCA 1WAWA 1XH0A 2WJDA 2W27A 3GXNA 4NYUA 4RDWA 5T91A 2E77A 3EAUA 3WJYA 4H00A 3JU2A 1XL9A 1K8YA 4DBEA 4W85A 3LD5A 4JFVA 1ZCCA 3WLHA 4BI6A 2PZNA 3QOKA 5BOEA 3L5LA 4K38A 2WLZA 2DZTA 1J0JA 2V38A 4PMNA 2HE8A 4HNCA 3GX9A 4US5D 5I06A 2WAGA 3HQOA 2EXOA 5LIKX 1M5WA 4XZIA 4W88A 5MKGA 3GHTA 3KHDA 4TR9A 4R7WA 3RJYA 4HTYA 1OYCA 1QI2A 1SZNA 4GCAA 3BOXA 2Y2WA 2R1LA 3ID7A 4PUNA 3V5CA 2CNCA 3ITGA 3HPFA 3WYZA 3UY7A 5JUVA 3EDKA 3A4AA 2YR1A 4GNKB 4HMCA 2DSUA 2RHGA 3OLEA 1XIMA 2WHMA 2E7FA 4HOXA 3M0ZA 1Y5XA 1UKPA 3F7JA 3WN6A 1EOMA 4R7OA 4AXKA 2QGHA 3LBOA 2QDDA 1VLWA 1TVLA 4FXSA 3LU2A 4PCPA 3CXOA 2D0GA 3MI6A 4IFRA 4CU6A 1W9BM 1R38A 4BR1A 3W25A 2HS8A 1W3LA 3KBNA 3BQ6A 3UCDA 3V16A 3GK0A 5EBAA 4PRWA 1RQEA 5HMEA 4A8LA 1BQGA 1O12A 5A6MA 4GINA 1B2YA 1YYAA 1PIFA 4J3WA 5C9RA 1AFSA 5D8ZA 1YBQA 3N18A 2VFIA 1TPUA 1HIZA 3RN6A 1R7AA 2PDQA 2QZRA 3GR4A 1UH4A 3VFCA 3LXAA 3BH4A 3R11A 3DHFA 2A7PA 2OR2A 3OVGA 3THUA 4EPDC 4PMZA 1EQPA 3MTWA 1PX8A 3HG2A 1HFBA 1LM1A 3BAJA 4ZQMA 4X0VA 3GUWA 1W3KA 2AQOA 1UWIA 5BWFA 3G1AA 1X1NA 1NAL1 1P0DA 2Y7EA 1NWTA 3G3DA 1MXDA 5H6HA 3IAQA 5D03A 3EA1A 7TAAA 2CXGA 1GOXA 2XG9A 1JRCA 5KZMA 1SPQA 4DELA 2H9AB 3ISIX 1YDYA 4FI4A 4KRZA 2Z29A 4NRRA 2V3EA 1DEDA 2D2OA 4O16A 2E0PA 3DFSA 2O4MA 4AZBA 2YFNA 4DNHA 3EPOA 3FHQA 1XYCA 4B9ZA 1C91A 3GAKA 4XV0A 3BG3A 4NI8A 4QBXA 4QR6A 2QCDB 1RA0A 1A5NC 2PD5A 4HMNA 3OGVA 1XRVA 1H63A 1XH1A 1R2SA 3ORWA 4XBSA 4L4PA 3C0SA 4EPEC 1ISYA 1FH9A 4PYSA 5ABFA 3AMCA 1LORA 1FQ0A 2J78A 3BMVA 2VI0A 1EDGA 3T0BA 1XYAA 4ZR8A 2YDAA 4U3CA 1J11A 3OO2A 1IGWA 1EO7A 1YX1A 4ORIA 3OIXA 3EWDA 5EFFA 3ZQ9A 4QJ1A 1TWIA 4YJ5A 5HMSA 3C2FA 2EJ1A 2OZ8A 2C1HA 4PMQA 1ZP4A 3E5BA 1WXYA 1UUQA 3O6AA 2ABAA 2CBVA 2YXXA 2PZ0A 5BZAA 2ZZ6A 3L66A 1S1PA 4IFKB 1LLZA 1OC7A 3PFMA 9RUBA 4YVVA 4B2DA 4O1FA 2CITA 3BSHA 3LG3A 4HOWA 4B5NA 4AU0A 5IFTA 2AL2A 3UR2A 1TKKA 4JQ2A 4Y9AA 1LP6A 1B3OA 3LZ5A 4ZOCA 2YSWA 4H4IA 3AICA 2XGBA 4GI8A 3T42A 3ITLA 4LYPA 2Q71A 3M44A 4GIYA 4DYJA 4LFYA 1TPC1 4E6MA 4P7RA 1DQXA 3EXTA 3SUUA 2O9RA 3V1HA 1B9ZA 4UQDA 4JFWA 1NARA 1SUXA 4LPCA 3LPFA 3VNYA 4AMCA 5BNKA 3E2RA 3AJXA 1HGYA 3VM7A 1AQFA 1KM0A 2ZICA 2WCGA 3U4FA 1R2TA 4UNKA 4C6QA 2XGZA 5F2GA 5ABEA 1K9EA 3IUHA 4NG3A 3QMRA 3L0NA 4RUBA 4J1OA 3WEOA 3R0UA 1QNOA 5HDRA 3CL7A 1Q66A 2FJKA 1GHRA 3W2NA 3MV01 3CQHA 1TRIA 1G69A 4UXDA 2BP1A 4BHYA 3EEZA 1S5WA 2ZX9A 3WLNA 2WZTA 4KFPA 5FKYA 3DC8A 3BWWA 2YCIX 3ECQA 4I6KA 3IJIA 4N6FA 4EX4A 2NQZA 3B04A 3W1XA 1GORA 1MVYA 1XQKA 1P0BA 4TV5A 2GGHA 4L4OA 4TVUA 3CO8A 5M5DA 4ENLA 1E6QM 2WK2A 4JTLA 3LRKA 1CXIA 3THCA 1KFLA 4DBSA 2BWGA 4EAYA 3CV2A 3WUEA 3TSDA 3VVGA 1EGVA 1E9YB 1VHCA 2HPMA 2PF8A 2PF0A 1H1NA 2IQ0A 4L9XA 2QJNA 3BL3A 4WOQA 1I0DA 4QEEA 3BW4A 3IGHX 4GNJA 2NXHA 3W29A 2A6NA 4REQA 3W83A 1N82A 1E6PA 4JTCA 1JZ7A 6XIAA 1TPFA 3URBA 3TX9A 2WQPA 3PPHA 2WNQA 3SR7A 4QP0A 2DT2A 3M6DA 3H6OA 3VZXA 2A4AA 3SIMA 4AW7A 4DZAA 3VDBA 3W7PA 1RVKA 3B4YA 3LZ3A 3L4WA 4M6QA 3BV4A 3BSMA 1W1IE 1Q3NA 1NM9A 1QNPA 3S6TA 2PDYA 2SFPA 4UMAA 2J6VA 2RUSA 3HGRA 5A6TC 2PWDA 5FEWA 2WVSA 2OWCA 3UXIA 3RO6A 2DZUA 5BRBA 3MO7A 5DCEA 1W3HA 2GLKA 2ZX5A 3TW7A 4GFSA 2VVNA 4DJDC 1PWMA 4NT0A 3A64A 1T8XA 4O13A 3MYOA 1UMLA 3TOPA 3UQNA 2PGRA 3WEZA 4PB4A 3P8JA 3GRIA 1UD8A 4R88A 4ZO6A 1ZS2A 2VYOA 1L6GA 3SY1A 1ZAHA 2WANA 4MNMA 4G1NA 1XIBA 5EMUA 4S2CA 3A13A 3GU9A 3AALA 3O6YX 3MP4A 3QN3A 1EUNA 2VGBA 3KBWA 2Y8VA 1VR6A 4MHBA 4TOQA 1EO5A 1DV7A 2V67A 1DXFA 2BTMA 1R2RA 2WJEA 1UPPA 4CLMA 3VC6A 4DZ5A 5EMMA 3R2GA 1SO5A 3ZM8A 1UA7A 4WCJA 2VFEA 3H21A 4E8CA 1JCXA 2J77A 4HJFA 5KSWA 5IM51 1SM9A 1M7XA 2QYGA 3E5PA 1Y7VA 1HKWA 3KS6A 4XD5A 1LQ0A 3I4EA 1QW7A 2AGTA 2NQ9A 3TTOA 4OJYA 4A8RA 3W1PA 1W56A 2ISWA 5C8BB 3D6NA 2QLYA 4GD0A 4DJFC 5HWNA 3LCLA 1EL3A 2C7FA 3OVRA 1XJBA 3R43A 3KLLA 2O56A 4DIAA 5BCAA 3N11A 3O7UA 4AZCB 4Q8PA 3ELFA 1HJUA 6CGTA 1ZSXA 4Y7EA 7PTDA 1DHKA 3V4BA 1XLFA 4J2PA 1WE5A 4D72A 3CHDA 1FHUA 4J3UA 3LXBA 5CH9A 3TROA 4AQLA 1IT0A 1GEQA 1DL3A 1F8IA 3RJXA 5I03A 3TN3A 3OZYA 2DUAA 4D8ZA 1E1CA 2GOKA 8XIMA 1BYCA 3UW6A 3K4WA 4GNVA 3N4FA 1UOKA 1NWRA 4JIEA 4GC4A 6REQB 1RCQA 1V4YA 5J5DA 3FKRA 4X63A 3KTSA 5DXYA 3DYPA 2C71A 1ITXA 1XYBA 4C1LA 4B5WA 3QR3A 1WUEA 2J25A 5EFDA 4R34A 2IQTA 1EJVC 3M0XA 3U0HA 3G1YA 1DIEA 3USZA 3HPSA 3PZVA 1JDFA 4CD7A 4LVBA 3WLTA 3P14A 4H9ZA 2YL6A 5TNVA 3GXPA 1LZOA 3D46A 3A6OA 2VGIA 2OEMA 4YU1A 1FP8A 1FKWA 3QMSA 3W7GA 2ZXBA 4FOJA 1RAKA 4B2DD 3VNKA 1SMDA 4JHZA 4K39A 2R1NA 1CGUA 1F8MA 2VR2A 3HTWA 3N17A 4CNNA 9XIMA 1FWSA 4IPPA 2DP3A 2P10A 3P67A 2A7RA 4QHRA 4L1GA 4W8LA 5LIXX 3RIKA 2EQDA 2PCEA 3FN9A 5FD0A 3GM8A 4LV9A 3C0QA 4UFLA 1R3YA 2CCRA 5D2XA 1H5VA 5K7JA 4EOUA 1UD3A 3CWHA 2YCLA 2H8XA 5MF5A 3IJ8A 3LLDA 3PB0A 1AW1A 4EANA 3CLWA 4LC6A 4GUIA 2Z00A 2ZTKA 4M56A 4HPHA 1MW2A 1XM3A 3ZYZA 5MHBA 3POHA 1GW1A 4UTUA 4ONVA 3B8WA 1HKVA 2Z6IA 4YWIA 1YADA 1TV7A 1OG0A 3C2RA 4MB5A 2VFFA 2FKPA 4Q32A 3WF0A 3FLUA 2D73A 3QPEA 5H8PA 4N42A 4M29A 4QDPA 5D9MA 3CHCA 1W5QA 2Y7DA 3QYSA 1XQLA 3WJWA 5AVHA 1POJA 3KVLA 3LTPA 4WDWA 2WZIA 3TKFA 1XLDA 2ZVIA 2CKSA 1KKOA 1KLYA 4HU0A 5F1VA 4B5TA 2OX1A 5G4EA 3FAWA 4JHOA 3LSCA 3F2DA 2BHZA 4LT9A 1MWOA 4XSLA 1CNVA 3M0LA 4LAOA 3TC3A 4O8AA 3O6CA 2QCCA 4K7VA 4GUJA 3G2GA 4KWSA 3AHTA 4AIUA 4K68A 3OG3A 5DEZA 3QFEA 4DO4A 5E5CA 4N2YA 4JN8A 5HXMA 1R8LA 4J7RA 1OX6A 4PSRA 1FWRA 3OZMA 5GPRA 3V1PA 3M5ZA 4WZHA 4LWWA 4LS2A 1MO0A 2QCGA 3T0TA 4LYQA 4UUIA 1VFTA 2FJUB 4JAWA 1M41A 4RKAA 1Y0EA 2ANUA 5E9XA 5C2CA 2W79A 1CEOA 3AS0A 4E3TA 3RRXA 1B0IA 4AF0B 3BUVA 3VX0A 1SR9A 4PCSA 3GC5A 2Z1XA 3ABZA 3CUXA 3GYCA 1UZ4A 1OFEA 4NP7A 4PTXA 4AXNA 2WJFA 4I7VA 1FFRA 1LBFA 4HMDA 1SR0A 1KV8A 3VMNA 3C52A 3EKLA 4GQQA 2JKAA 5LNRA 1BLIA 1KRMA 2YOCA 3PANA 1SJBA 4K3ZA 2PTYA 1CGVA 3CV7A 1V03A 1EGMA 2PDLA 1FXQA 1Q6DA 3TYAA 1L8NA 1GKPA 3VKCA 1MEIA 4ZTXA 3B0XA 2RDWA 3RNDA 1D8WA 2ICSA 4V15A 1JI2A 4RR4A 5GNZA 1W1A1 3TTSA 2QULA 4Q7IA 1BHGA 4PUWA 1BTMA 2G3FA 3KWXA 1Q4NX 3SFKA 2JF6A 2XIOA 1B31A 1L6YA 2FZ8A 2QUMA 3P7YA 3W7CA 2IKHA 5E9AA 4IH3A 4XAPA 3AXHA 2VZUA 3G1VA 2H6RA 1ISVA 2FTYA 2C1GA 2V3FA 3RMJA 4TX8A 3QSRA 1KXHA 2ZC8A 4N4PA 1LROA 4HJWA 1XLJA 3S1UA 3W2JA 4BF9A 2BY3A 2REQA 5U4NA 3MY9A 2JKPA 5M03A 1T8QA 1Q7MA 1AODA 2YDQA 5LXXA 4AZ7A 3GH4A 2PE4A 1BFNA 1PPIA 3C0JA 4LY8A 1LG2A 1MEHA 1UASA 1O1ZA 3V5OA 5CSSA 1TPB1 1XLHA 1QWKA 1EJWC 3R6IA 4L7ZA 4C60A 5CAHA 1XBYA 2V8ZA 3WX7A 5JH1A 3UGVA 4S1FA 1YE6A 3UA4A 4NJGA 1FFQA 3WD4A 3GO2A 2VZSA 3PNZA 1X1ZA 1UR3M 1GPWA 4Q8TA 3MHUA 4IM4A 2XVPA 1IIHA 3A9IA 2JE8A 1UR2A 3S47A 1J2BA 2WWDA 3WF3A 1DWJM 2XIBA 6XIMA 1X1OA 3BMXA 4H2CA 4QROA 2IKGA 3LHTA 4JN6A 3BCDA 4KPLA 4E8GA 3WDHA 3IRSA 4I9AA 3BLEA 3K46A 1ZAJA 3MPGA 3N2CA 2ZXAA 1Q13A 3PM6A 2WMGA 5DBUA 3WD2A 4FMVA 4QSFA 2WMHA 3AMDA 4N0RA 3WL0A 5JXQA 2TSYA 4ZCWA 4ROQA 4H7CA 3PPFA 1MQRA 5I23A 1QHOA 3NFUA 3FJLA 4GXPA 3TC7A 3WK0A 3Q58A 3UY8A 4YWSA 2VWSA 1OCNA 3NUKA 1JPKA 5FJOA 3TYBA 1GOKA 2DIEA 2A7NA 1FWBC 4C6OA 2UY4A 2ZX8A 4F8XA 5M2FX 3PZOA 3PZ9A 3BAWA 1J0ZA 1VS1A 4E5TA 4FPSA 4KF1A 4H9XA 3W01A 4JTFA 3ZVHA 3CM4A 2X42A 1JD7A 4A22A 1ADSA 5F1UA 3ICJA 3H2CA 2C0HA 3KCJA 1WDQA 4WDXA 2JALA 3U6WA 2GUUA 2Y5SA 3PJXA 2PS2A 1RD5A 4ZB5A 1GKRA 4S23A 2BGQA 2Y89A 4NJIA 3GB6A 1E9ZB 4ICMA 1YW1A 4H9MA 5C70A 2BNJA 2WNNA 1A0EA 3M41A 1VYSX 2EAWA 3S3GA 1LOLA 1SU5A 2HTMA 1IZJA 1EP2A 3LUTA 4QLKA 3SN4A 2QEZA 2G0WA 3W82A 1W1PA 1TVPA 2P76A 1ZENA 1BSLA 5D09A 1YPFA 3G0XA 2RKXA 1UJQA 3ZS4A 4JEQA 1VFHA 3PBMA 3ZLFA 5EMYA 4OFCA 4RE2A 2QHAA 3ZOAA 1VF8A 3THDA 3QZAA 1R87A 2PPGA 3LXCA 5AC7A 4W87A 5H2ZA 1J96A 1Q6CA 3WD0A 4Q7BA 4OV9A 1LUCB 4ZEPA 4TMBA 1DWAM 3TA9A 3T2OA 1ECEA 3VIJA 4JXCA 5AHEA 3W76A 2YL5A 1FCQA 3M0MA 2C79A 1NY1A 2PWFA 5H91A 3NOYA 1UD2A 3WDIA 3K13A 1PVNA 2UBPC 4YYCA 4GZIA 1TWZA 4A8NA 3VDAA 1QPKA 2GJXB 2VOTA 3MBFA 4W89A 4A6GA 3WNPA 1AJ0A 3BGAA 3TYDA 4FAMA 4F0MA 2OLAA 1JCLA 3UWQA 1V3IA 1RPKA 3STEA 4YS1A 4I7WA 2OCZA 4MDOA 4U33A 3KCOA 1JCYA 2XH4A 4S38A 4IGSA 4YTTA 1WCGA 1EA9C 2ISDA 3RPMA 3SQSA 5G2IA 4NNCA 3VIOA 4CCEA 4LEFA 3T09A 3UCCA 3MKCA 3AAMA 2GK1A 1F7BA 4FXFA 3MI2A 4JYDA 2VOMA 3KVJA 1TMQA 4B3ZA 2XVLA 3M0HA 3NA8A 2QQ6A 1BYAA 2ZFAA 3TYUA 3VA8A 1N7KA 2RFGA 5FF2A 4ZQPA 2QJMA 3M0VA 4GRSA 4CQAA 1TCMA 3HOJA 1YIXA 4WUIA 2YFOA 5FF3A 3E3HA 2FPYA 5HULA 2WNWA 1BKSA 1FCBA 4GUHA 1ALDA 2W63A 2DV0A 4LAKA 1QAPA 8TIMA 1LL4A 3G22A 3C3UA 3W1MA 3OG2A 3HM7A 4RCXA 2IXVA 1US3A 4QDWA 2VEGA 3B9DA 3NTYA 3O06A 1TJ0A 3ARRA 1E0TA 3REQA 1XGZA 1T0OA 4JY8A 3T0DA 1Q6LA 3W1AA 7REQB 4DM2A 4X9YA 3RCYA 4FA3A 1DBTA 4O11A 4BFAA 3WMCA 3LI1A 2VFHA 3NYDA 4M1RA 1IGSA 2BX7A 3P84A 3LHZA 1CLVA 1ZQ5A 2GDQA 3SIZA 1FDZA 4JD4A 1L8PA 1A5CA 3CTLA 4C1NB 1RSCA 1UZ1A 3S9IA 2YGYA 3L21A 4OIFA 2J88A 3G6MA 1BYBA 3G6LA 1TWDA 1ADDA 4YNGA 4CN4A 2BGNE 3VIFA 5LNVA 4UCGA 5A8GA 3AHXA 2X05A 2GDVA 2WHLA 5HWMA 3DGBA 2X1RA 1W9XA 1I9CB 1W1ZA 4DF2A 5I78A 3VOJA 1EBHA 1PYMA 3FYPA 2YBTA 4LANA 4WF7A 4YTQA 4O12A 2QDGA 1TZ7A 2ALRA 1N55A 4ZB0A 3W72A 3UXDA 4KRUA 1DHPA 1OWQA 3IIVA 5D04C 1E6NA 2XVKA 3WDRA 1QHZA 4GC3A 3KL5A 1DWFM 3N04A 3F5KA 2A3BA 1I2NA 3TE9A 1RPXA 1I45A 3AYTA 3VNIA 3WL1A 3IUDA 1THFD 5H8MA 2XFWA 5HBFA 2PDBA 5A8NA 1OBAA 4JBRA 1C8QA 1R7OA 1AQHA 2WM0A 3HG5A 1UH2A 3C6CA 4WOZA 1TIMA 1XIHA 1QOXA 3UYCA 2DJXA 4LBRA 1S2AA 5CAKA 1CGTA 3B05A 3ZMRA 1UWTA 3GTIA 4MY1A 5JBDA 2CC0A 1NWUA 1BAGA 1KNWA 4R27A 3LTYA 4B92A 1UWRA 3T1GA 1NWSA 4EXQA 5CG7A 3NZ1A 3W2KA 2EPKX 3CBWA 4B9YA 4DF0A 4Z1YA 3JW7A 3N9SA 3EWYA 1W3NA 1S2UA 4HK6A 3T8QA 5HK4A 2I16A 3DH7A 3C4UA 1O7AA 4WD0A 3TFCA 5I2UA 1HL9A 1HJVA 3MSDA 1EEPA 1UHVA 3BLLA 4AY8A 1VBHA 4KEMA 1T5AA 3PFRA 2OO0A 3L7RA 3P74A 3UBPC 2PWUA 3NGFA 3GBEA 2YW3A 1K8CA 4BWLA 1X97A 1CLXA 3NDOA 4HU3A 1OJXA 2Q01A 3BK0A 4IHCA 4GI4A 2QDEA 5D32A 3WF1A 4GLEA 1J79A 4NXKA 2ASHA 1OFQA 4TQTA 2HVMA 3EX4A 1RCXB 1YXYA 3PUOA 2DGAA 3QKEA 1QMLA 3PBVA 2A1YA 4XZLX 2WLYA 3T08A 3GNOA 2WMKA 3SB0A 5K9XA 1JUEA 3VAVA 2J8FA 3SGGA 1K9FA 6TIMA 4P7LA 1H4PA 1UR1A 1FRBA 4DF1A 4I5XA 2E28A 2J7HA 2HJPA 1TELA 5AC5A 1BRLB 3L4TA 1SSGA 5LKYA 2OG9A 2PRMA 4I9TA 2GGJA 3NQ8A 4QCEA 1JAEA 3UZ5A 5LNSA 3LCWA 3M46A 3EWZA 2QXWA 3BZJA 4DB7A 4K6AA 1W2PA 4I8DA 3PHAA 1B30A 1JPHA 3GVVA 1VBGA 4Y90A 3Q45A 3T4WA 1EJSC 4FO4A 3QR0A 2NSXA 2BOFX 1R3SA 4GBDA 4NX0A 1XDJA 1BXBA 1US0A 1DTUA 1GVSA 1AMYA 1OZQA 1R9YA 4EWND 1V3HA 1CGXA 1RHCA 4Z1DA 3TEVA 4OZOA 3W7QA 1FWGC 1GZGA 3LLFA 1W1VA 3VIGA 3DU0A 4XIMA 1GJUA 2DH3A 4S3DA 3LHYA 2JIWA 3IK4A 9XIAA 1T40A 4Z2KA 3F4VA 1CPUA 5D9PA 3BGGA 4PMRA 1A3WA 3C8NA 4XKYB 3E49A 3A4JA 1PHQA 5CPTA 3IVTA 5BOFA 3GFZA 1AA1B 2RDXA 4EF9A 3V5FA 1XS2A 3HF3A 4AVOA 5DY2A 2CLOA 4G8TA 4RPQA 5K9CA 2G3MA 2DVXA 3FIGA 4URIA 3U2ZA 3WY1A 2EEXA 3H4GA 1O4UA 1D3HA 5DQPA 3BZGA 1UZHA 1QI3A 2G96A 2D0FA 3BANA 1KTBA 5E1QA 1AL7A 4GZEA 5E6ZA 3I7RA 3ZJKA 5J04A 2F38A 3SO7A 4X61A 2BOEX 2OT1A 4MWAE 1P7TB 1UD5A 4PL1A 3DERA 5GVJA 3ABQA 1ZZMA 4H8HA 1WP6A 2PD9A 1DIKA 5I3JA 2IPJA 4Q4PA 1ZJIA 3OBKA 1KCLA 1HG3A 3AXMA 1XIJA 3XIMA 5AHIA 2DZAA 3P6LA 3SY5A 3MJYA 2INEA 5HJXA 4Z2JA 4LCQA 3P82A 4QITA 4ACYA 4ROPA 4B16A 2ZRWA 3UERA 3V7PA 4UTJA 3OZPA 3MP3A 3MWAA 4MYXA 5I02A 1R3WA 2TAAA 3KW3A 1K7FA 1CXKA 4B5SA 1NOWA 2A3CA 3CPGA 3NEVA 1UMYA 4GIAA 3FVMA 4IPJA 3RRAA 1XLBA 1JYVA 3TC6A 1IEWA 4UWMA 2UZ9A 3B9OA 2ATMA 3KEHA 5CPMA 5I79A 3UZZA 2CZEA 3LBCA 3UJSA 1Z69A 2Q8LA 4MF4A 3OBEA 4Q33A 3H12A 3ZR4A 2XPKA 4ATWA 4FIQA 1YQ2A 2G50A 2J47A 3A23A 4XO6A 2OQHA 3PG8A 4IGNA 4ZOBA 4Y2WA 3S2MA 2XZ7A 4RXGA 3VYLA 5A2CA 1G0CA 2ONEA 3BG5A 3DI0A 4RK8A 1FTXA 1U83A 2G41A 3RLGA 1CENA 3FNDA 2QS8A 3AWNA 3BLKA 1E0VA 1M6JA 2NVAA 1TZ9A 4LF1A 4Q7NA 3CHFA 4O57A 2BASA 2FZMA 3RX3A 2V5DA 1GQJA 3W1RA 3P80A 1ECQA 2J7BA 3AHZA 2Z1SA 2AMXA 4UTKA 2VZTA 4B3LA 2V2DA 3MSYA 4U2YA 4CN6A 2PLCA 4M7TA 5B7ZA 3PWAA 1HW6A 3H55A 4GHRA 3TTQA 3R12A 4JTTA 3CHVA 3ONBA 4K8GA 4ML4A 2YYUA 5CXPA 1G6CA 1QO5A 5DMYA 3W2MA 5IHSA 1JL8A 5FF4A 4X9SA 5KEZA 2GL5A 4YHGA 4ES4A 2QKFA 1WKDA 1EDQA 1NOFA 4B5UA 3ATZA 1JFHA 2LLEA 2D3LA 2XIIA 3KZPA 2QDHA 1ICPA 2OQLA 4K37A 1PDYA 3NCOA 1EJXC 3WNNA 2CLMA 1A5UA 2QJGA 3D5HA 4C6JA 1TJ2A 4H41A 1J5SA 1K8XA 1FKXA 3MDWA 4GIEA 3ARQA 4Q4OA 3UVAA 3BOFA 4U4MA 5CLTA 4AX6A 1H7WA 2E4TA 1P0KA 1O5RA 3EB3A 4XIAA 2R94A 1A3HA 1GOQA 2CLHA 4IX0A 1CDGA 3V3WA 1XIEA 1QPOA 3WNKA 4KCWA 1W9VA 3EWCA 3N1AA 4C6PA 1I60A 3W2UA 3H2EA 3UZWA 1OX4A 1PJ9A 5FOOA 4FOUA 1VCVA 1XWYA 3MVTA 3U3HA 2CHOA 2OMAA 4Q8WA 1TA3B 2DQWA 3CUGA 4H6QA 2V5LA 2H9AA 2Y1HA 1GOWA 4ZOAA 2KAUC 4XO7A 3WFAA 4GY0A 1T7LA 1Z8AA 3QF0A 4UFJA 3NDYA 3NEHA 3GKFA 1AH3A 3C2YA 1REQB 3LX9A 4GMEA 3SUSA 5CSYA 4FB7A 3KFTA 3GNNA 4OV4A 1V3LA 1RUSA 1WDWA 2X1SA 2QCDA 2CZDA 4BK9A 2QCNA 2J9XA 3NZPA 4M81A 1P0NA 3LCIA 2CZ5A 3E0VA 1W5OA 1QCWA 3DG6A 2ACSA 1JVNA 3VNZA 1J4EA 1PE1A 3WBXA 4I9JA 1OVDA 3CWOX 3WMSA 2OU4A 2XIMA 3CLMA 4GJJA 2MUCA 3E0FA 4JR5A 4XAZA 4NAFB 4BCEA 3UZYA 3AIVA 5AYXA 1PXGA 1GZJA 3O9NA 2CLFA 3VPLA 3VCNA 2ZRYA 1Q45A 5LGZA 1Q6OA 2X41A 2TODA 1XLCA 3W86A 4YTRA 1TV5A 3NQEA 1Q65A 3OYZA 3W38A 1A0DA 4WSKA 2PC4A 5FIPA 3LGGA 4M0XA 3WH6A 1SVDA 1NQKA 3ARXA 2P5NA 2QCHA 5I6SA 4JX6A 3UETA 4Z0SA 3O3RA 3M64A 3MKVA 1W3IA 5BROA 2A0NA 4HNTA 3WCZA 4N4QA 1TX2A 3O8AA 3W4RA 4JKMA 4XX6A 3WD1A 3Q37A 4GZJA 4A3RA 5FJPA 3RR1A 4NZCA 4G56A 4ZMGA 3H7RA 1D7FA 4OOUA 3RPTA 1FHLA 4NNAA 3OEXA 2VDIA 1GG0A 1OGGA 4JNZA 4AHOA 2B7OA 1K4HA 1J9YA 1QW9A 3ARTA 2J9YA 3A9BA 1JNEA 1ISWA 3MVIA 3VZYA 4OQVA 4FXJA 3AZRA 2O55A 3WBAA 2YA2A 4XTIA 1E9LA 2E6DA 4S3FA 3TP4A 1BTCA 3TK7A 4A8IA 1SO3A 3GZAA 5I3FA 4KWOA 3LRLA 1R47A 4RZ5A 2ADAA 4FR6A 3BICA 3WLQA 3CT2A 5A8OA 2XHYA 4RZ6A 2X0SA 3LHUA 5DANA 2D2GA 1V6VA 2VDHA 1OHLA 3CIWA 4UTLA 1OCJA 5GJPA 3TH6A 4LBUA 2C14A 1TJ1A 1NFGA 3UG5A 3WLRA 3PUGA 3ITCA 3MKKA 4E38A 4EK7A 3SCPA 4A21A 1S5VA 4F4RA 2O0TA 1TV2A 3SQMA 4TO8A 4GQGA 4XWUA 4Q3MA 1QHPA 3MB9A 3HQ1A 3TYEA 4QISA 5AOUA 4IP5A 3AIUA 5BMXA 4ZZ9A 4C65A 1EBGA 1H7NA 1W5PA 2ZIDA 2EJAA 2YXOA 7ENLA 2I7GA 2DUZA 5M1TA 1XW8A 1Q6RA 2D23A 5HNRA 2J27A 2H90A 4PMDA 1GQNA 4KS0A 2ZCGA 1DJGA 2DSZA 1FUYA 4AUBA 3MV11 3NL3A 4ZBCA 1ZNNA 4OOZA 2PGEA 1R85A 3SW6A 3GQYA 3MC5A 3GXIA 2VEFA 2FLIA 2OELA 3N12A 4D6CA 1KBIA 3UWVA 3FGCB 1W2VA 3CV1A 5AHMA 2V69A 2GVEA 4DBUA 3R4IA 3DCPA 3WH7A 1B90A 1GOIA 2Z0IA 1Z44A 4AIEA 4KMQA 4Y9MA 2QVNA 4IPNB 1U30A 5AC8A 3UEQA 4WGHA 3L2IA 3W07A 2AQVA 4ACZB 1ME7A 4WHBA 1JNDA 3H7VA 4R3UA 3M7WA 3QGVA 4Q6XA 2TRSA 4O18A 3P5YA 4GGBA 4G9PA 4UFMA 4CNTA 3RHGA 3WUBA 3H2OA 4KGLA 2WHKA 2FFCA 3C8FA 4HPJA 3L12A 1IWAA 5A3HA 4U2ZA 2D2JA 3UWWA 3UPBA 1NDZA 2F6XA 3UXLA 5MKGB 1K70A 5JU6A 4PUUA 3GG1A 2DW7A 1AQ0A 4FNTA 3W9ZA 1ZB5A 3J7HA 5DELA 3M6YA 4MNKA 5EGRA 1EUAA 1KGWA 3T7VA 3ARSA 4QJ4B 1TZZA 3STCA 3RG6A 1V93A 2AKMA 4LS0A 4D8LA 3BJFA 3HG4A 4UTWA 4DJDA 2ZWYA 1ENUA 5I3HA 4FLOA 4XQ6A 2OEKA 4NU7A 1WV2A 1M7JA 3GTXA 1K1DA 4UB9A 1AD4A 3ME3A 7ODCA 4C6BA 4KETA 5LA2A 1QWGA 3TTEA 4YN5A 3I7QA 4HU8A 3BLDA 3GU1A 1WO2A 2PDWA 4CD4A 3MJMA 2OSYA 4GVGA 2G3IA 4MMWA 3PY2A 1VKFA 2J7EA 3VIIA 3VCCA 4Y8EA 1MUCA 2CBUA 1BPLB 1KLZA 3CZJA 3L4YA 2X8RA 1EXBA 4GA8A 2F6UA 2QIIA 1J8VA 1PAMA 4MJMA 3IIOA 1O68A 2ESCA 4L5ZA 3PB2A 4QFUA 2OXNA 1S46A 4DY1A 4GPNA 4PODA 4DAIA 5EA9A 3W88A 9CGTA 2XH0A 1RJPA 1RK5A 5A8PA 3VI2A 3B03A 3EZ4A 5LIYX 2B7PA 1KM1A 3RLHA 4DJFA 5ENLA 1XRSA 3K4DA 1XV8A 1QT1A 1XLEA 2WJZA 1BXCA 4HSHA 3FFSA 3W74A 3L67A 1EC7A 1Q6EA 1RCOB 1G7UA 8CGTA 1H51A 4QM1A 4GX8A 4HYRA 5CSUA 1LL7A 4F0HA 1JZ8A 1ZUAX 1UPMB 2Q09A 3BOLA 4X60A 1JGMA 1GG1A 4AWTA 4S3AA 5F4WA 5LA0A 2VRQA 2X1IA 1WZKA 3NVDA 4D6JA 2V82A 1KQZA 4F2TA 3DI1A 3HGJA 1UQYA 2E09A 1XD1A 1B3XA 3UJ2A 4WXYA 1IXNA 1QK2A 2HVOA 1A5AA 3W1TA 3QHNA 1SGJA 2W66A 1IIGA 4PBFA 1Q7QA 5ABFB 5AHLA 1V6TA 2R24A 4AZGA 1J5TA 4X2RA 3QQ0A 1UW9A 4HYWA 3VDHA 4AY1A 4DBDA 3T0AA 1UCWA 3CMJA 3F1QA 4FXRA 4EVZA 3FYYA 1M7PA 1OC5A 4E3VA 1U5HA 1XPYA 5E0KA 3OHMB 2D1ZA 2X40A 5A6SA 2CPUA 4L61A 3KWSA 4PZVA 3S5SA 1BEUA 3WF4A 1PX3A 1J18A 2I5QA 2F7FA 4LNCA 4UZSA 3WQ6A 3ARUA 1EF2A 3LHVA 4JL1A 4NZ5A 1BQCA 3H24A 3PWGA 3VD9A 1HP5A 1VEMA 3GNDA 3BPWA 2PUZA 4L80A 3RYSA 3WUGA 2OWWA 3MANA 4RNHA 2Z7KA 3SURA 1BF6A 5C7HA 3R13A 2O7QA 2VMFA 5I7GA 2XM1A 3OYXA 3BCJA 1KBKA 1F61A 3ES8A 2P50A 5EYWA 2IQDA 3AYSA 3OGSA 1DQWA 3WBWA 1WPCA 3WQGA 1UZDA 2WXDM 2JF7A 3M0YA 1RQHA 4RPPA 5A69A 3DIPA 3V35A 4L9YA 1O60A 3HPZA 3W1QA 3TU9A 4QJ5B 5K4XA 5D2VA 2WBGA 4LAUA 1Q8JA 4CVUA 4MFDA 2AAAA 5CGTA 1BD0A 4W84A 3DUGA 1BWLA 3NQMA 1GYMA 4TXEA 1H1ZA 3F5JA 5SWUA 1FH8A 2DORA 1VIWA 3LM7A 1FWFC 4X0NA 3AXXA 3ZWSA 4C6IA 3W7EA 4Q4SA 2QT3A 2YB4A 2PWHA 4FHAA 4H19A 4GUFA 3N25A 1JCTA 1IEIA 1FWWA 2AGKA 3DAQA 3DN5A 4U31A 3N2OA 4WJ8A 3CH9A 3TN5A 4LRTA 2ZE0A 1PO9A 1P4CA 3CQ0A 3W7OA 3UVIA 4CQCA 1IYXA 1EFZA 3IARA 2PGWA 3SUTA 2W0UA 3B0UX 4H8UA 3KBJA 1H09A 4BEUA 2BHYA 2RGLA 5I77A 3LCFA 1V8EA 3QJAA 4C6EA 5EPDA 3E9AA 2YA1A 3NURA 2I9UA 4JX5A 2DFAA 3I3DA 3MCMA 1F3XA 4XZMX 4REQB 3BC9A 1PTAA 1V0LA 1HXJA 4RJEA 4IQLA 3GDMA 3RO8A 3W71A 4ZODA 2JGYA 4PUJA 3BDKA 1G5AA 5G4HC 1V02E 1X6NA 2FVKA 3TNBA 4A2RA 4DWDA 2JEPA 2ACUA 3E0LA 4DBWA 4JOMA 4ZFMA 3NSNA 2DZPA 2QNEA 3QPYA 1UR9A 1XKJA 4JQ3A 2GGEA 2V30A 1S39A 2ZA2A 1TUFA 3WJZA 1W37A 1JZ2A 4AZHA 3CNYA 4ICCX 1WBJA 1E6RA 2WCSA 3QTPA 3WK2A 1M7OA 1KFKA 3FDGA 4FLSA 4WQ6A 3TYCA 1JULA 1ICSA 3PZUA 4IFOA 2BMBA 2EG8A 4G7EB 1R30A 4DYKA 1MNSA 2J62A 4P61A 3MZNA 4FOKA 4L6OA 3ZFHA 1CX9A 4FP1A 3QRHA 1H0GA 3DFHA 3TN6A 4PB5A 3KVKA 2AKZA 3R0DA 1MXSA 2O9OA 4AZ5A 2VELA 3SM0A 5CC7A 1O5XA 3WEMA 3IAPA 2GJPA 1TMHA 1HVXA 4NVTA 3S46A 2EPHA 1EB3A 1DKWA 2XH7A 4KCTA 2Z4GA 4HD5A 1A3XA 2F2HA 3PSWA 2R14A 4QDMA 3AMGA 2C15A 2GUYA 1CW2A 4WLCA 3VE7A 1FWJC 2CERA 4C6CA 4J3TA 2ZRXA 1IR1A 4H7VA 4HNLA 5TF0A 3NQFA 2X1TA 2P1FA 3N15A 3EXRA 3FA4A 4MLJA 3UYIA 1W1YA 3BE7A 3INPA 1WNOA 2Z1WA 3ZT7A 3CPRA 3TOYA 1O1HA 1SW0A 3ABOA 3VKDA 2X7VA 4QEHA 4UTTA 3PK7A 1Z48A 4DJFD 2WC7A 3NQDA 4S3CA 2XN2A 3VKJA 2V5KA 3HMCA 1IE7C 3P2VA 3G0UA 3G0SA 1UYQA 4KBXA 2P3EA 3FXYA 4AWEA 1VEOA 2QCLA 4HCHA 4QS6A 5B7YA 4E8DA 4GE8A 4TMCA 2EHHA 4DZHA 2Z1BA 3UU0A 5GJNA 4M7SA 5CZTA 1ODUA 4HA4A 4EPKA 4GYFA 3NQCA 5FF0A 2FPVA 4UR8A 4DHGA 1VEPA 1MRAA 1BF2A 3W1NA 5AZ0A 3P60A 4ZVJA 4CQ8A 5A5WA 2C19A 4H04A 3ALGA 3BW2A 2O92A 4U3AA 3CIXA 1UR0A 1HF6A 1WZAA 5T9BG 4IIDA 1PWLA 3W85A 4GI6A 2WQDA 4E2DA 3TQPA 1FDJA 5BMWA 1GVIA 4C6FA 2BODX 1OINA 4RLIA 4ZA0A 1KW1A 2WW5A 4K8EA 1ONWA 2DVUA 1TUXA 5DRIA 1DYSA 2XUCA 3K30A 3TV8A 3UXKA 1GEHA 3VKAA 2Y5JA 3UNDA 4HZMA 3VD5A 4FSAA 1UKQA 3OPSA 1HTIA 1UD4A 3BCFA 3C61A 1AD1A 3DEQA 4W93A 4P2VA 3DYMA 4IIHA 1VH7A 2FGZA 4FEZA 4DO6A 1A47A 2C91A 3SEPA 5C6MA 1OFBA 3JRKA 1W17A 1DVJA 4L6DA 4WRHA 1QR7A 2HSAA 3NO5A 3EMQA 3QFWA 3MA8A 3QBUA 3GBDA 4F0SA 4HSNA 5KZEA 3ANUA 3L5MA 1QK0A 3IUIA 1P48A 2F6KA 4JQ1A 3M5VA 3SI9A 2V0TA 2YCLB 3GG0A 4US6A 4F66A 1JDCA 4AWSA 1QRQA 3PG9A 1GJPA 4D6IA 3VILA 4CNOA 2AMGA 1X98A 2Y8UA 1QFEA 2PURA 5EKYA 4M6UA 4U5IA 2E68A 3Q94A 1XUZA 3RGTA 2GJXA 2H3DA 2HNEA 2FVMA 4W8BA 4WGXA 1QBBA 1A5OC 1F6PA 3LCXA 4XD6A 2R6OA 4N9DA 1E1EA 3PNUA 2OJPA 4TX6A 3QOMA 4G5DA 2FYMA 1W32A 4XZBA 1SJCA 3EOSA 3W7MA 2Y61A 4R9XA 4NL1A 4RXFA 1PHWA 2NV1A 3KRZA 3GWQA 2E6FA 3QV8A 2ZWZA 1ELSA 3HO8A 3GW3A 3HFTA 1XRTA 3N6QA 2ZA1A 1KFCA 3IEBA 4P8WA 1CCWB 4QRNA 1LRQA 3GDRA 4NSBA 3T0CA 1OG6A 5CGMA 2VM8A 1HO1A 3CMFA 1QDSA 1IHIA 4UOQA 2GQ8A 4UQAA 1KXQA 5LXEA 1KXVA 3IWPA 4UQCA 5I07A 5G1MA 4LUSA 1L2QA 1ZALA 3KUMA 3POCA 4EXAA 3GXTA 1DJHA 3A24A 4O54A 4GVIA 3WBEA 5HJLA 1TVNA 3HGOA 3H23A 1M53A 4UCFA 2C16A 1Q85A 3WDPP 3W7RA 1E3XA 1S2WA 1I8JA 3IJ9A 4UTIA 5DMMA 2R8WA 2W91A 3A3HA 2VT0A 4GH1A 5LHEA 2HV5A 2I9EA 4M51A 1AJZA 1TO3A 2A85A 2EPLX 1RY8A 4WIWA 3F2CA 2Y8KA 4PUEA 1TPH1 4KEZA 1FWDC 1DE5A 3QSTA 4AG0A 4LNYA 3BQ5A 1ESWA 3TVAA 3V0SA 4HOZA 3WQ5A 4XD3A 3PJUA 3DYOA 2FZ9A 1QI0A 3GTHA 3LN3A 2TYSA 3OQEA 3KBSA 1UBSA 1E15A 1E4LA 1VC4A 1VYRA 1WOBA 3AS2A 3QGAC 1UKSA 2PDHA 3NL5A 2FGBA 4YCOA 4DJED 2DDXA 4J2MA 1QVBA 1KA9F 1EOKA 3N2BA 3WQ4A 3PBWA 1W3TA 1US2A 2AQWA 4OBSA 2CESA 4HTBA 4MVAA 4NAEA 4A3UA 1AZ2A 3U5YA 2XSBA 3TIMA 4ALDA 1XBVA 4MNJA 2FTPA 2Q8ZA 3A22A 5C9UA 3LPGA 1ZRQA 2REQB 2JBMA 1J10A 2EPNA 1RD6A 1N8WA 4H9UA 2XTKA 3L68A 1DJWA 1PX4A 4V2XA 1LCOA 4OKDA 5KINA 1E56A 4GYPC 4A3QA 3NQBA 4TU1A 3NNTA 4H9YA 1LLOA 2P0IA 1UH3A 3MBDA 5BRPA 1I2RA 3I3BA 2PDMA 1QU4A 4O15A 1ONXA 1ZY9A 4MWAA 3H53A 1RA5A 2DZBA 1FP9A 2RDUA 6ALDA 3ITOA 3EX1A 1B1YA 1C92A 1MEWA 2WBKA 4F48A 4H2HA 3FJNA 1HQTA 1X8CA 4N9BA 2CBJA 2QGYA 5DN1A 5HR6A 3AZSA 3EWBX 4E4FA 2PSNA 3M0IA 3RX4A 4I5UA 1DORA 2EPOA 1H49A 3B8DA 3ZSSA 2GUBA 4ZENA 4YVXA 3H4WA 3WD3A 3WKZA 1X38A 2VNCA 3NSXA 1WZLA 3W26A 1F6KA 1AH0A 4CD5A 4XBJA 1VCGA 4B4FA 1GGOA 1JJKA 2VCCA 1L9WA 2WYSA 3BAIA 4M3PA 3TQKA 4AZIA 1LRNA 4QS5A 1BGGA 2J79A 1DE6A 4Q22A 3IIXA 1PTDA 2QPXA 4ERAA 3IPWA 3WLLA 1BSIA 2PDJA 1XDMA 3EA2A 1UUMA 3TYZA 4J3ZA 2PAJA 4D6DA 2VJXA 3F2BA 4JHMA 1PSCA 3NR0A 3ZIZA 4R85A 3LI0A 4OU1A 2J7CA 2AOSA 5CJMA 4GO9A 5HJYA 4LGXA 2WVUA 2J6XA 3SECA 4QLJA 2R1MA 1VQTA 1KFWA 2HZGA 3ARYA 2V2HA 3NZRA 4LF2A 4N7QA 4E2OA 3RM4A 3S6DA 4GO8A 1NDVA 1H7RA 2Y62A 3ABXA 1XR2A 1GTEA 3ZVHB 3COTA 3IGXA 3SBFA 3KS5A 5IBXA 1JRBA 3DHDA 5L9FA 4LALA 1P6BA 4MB4A 1HP4A 1EHNA 3FSTA 1KGXA 3L2MA 1AW2A 1JD9A 4Y9PA 1PZ3A 4JQ4A 2Z2BA 3RU6A 4RDVA 4C7DA 2FIQA 2CHRA 3T6CA 1G67A 2QF8A 3TW9A 3N73A 3S9ZA 1X6LA 4TVDA 3F4WA 3N2TA 4IIEA 5LZLA 3VMOA 2FHBA 1OT1A 4FR1A 3QXBA 3VGFA 4M6PA 3KOWA 5JIPA 3U7VA 3KRBA 1GCYA 4DXKA 5CG0A 1YTEA 2HWGA 1KQYA 3VGBA 3VXGA 1TTQA 3UJRA 1B3YA 2QUUA 3AI0A 1R9XA 3CU2A 3I68A 1B4EA 3QEZA 3SCOA 1SSDA 2PDCA 4LXFA 5D4YA 3FSUA 1XINA 1GHSA 2E9BA 2ZE3A 5EL1A 1TSIA 5LHFA 1XGDA 1U5VA 2A6LA 3S8HA 2NQLA 3JVAA 1BG4A 1NH6A 3B8SA 4O53A 3MHGA 2G3JA 4PTNA 3QY7A 3N9KA 4GBUA 3U7BA 5AZ1A 1ME9A 2PDPA 2NXIA 4F0RA 5EU9A 2C18A 3AHYA 3TUUA 3MMDA 4NQ1A 4JTDA 4W86A 3KZSA 5BU9A 5HA7A 5G1TA 4PCNA 2VVSA 2Z26A 3VM5A 3GH7A 2FDSA 4XZWA 4DWSA 2KX9A 4D6FA 2O9PA 5I3GA 4JDBA 4PA8A 1OZMA 1H50A 4AEEA 3N6JA 3IIPA 1E51A 3KOZA 5HUOA 4GX9A 2J24A 3W24A 2X16A 4A2SA 1WKYA 3BTNA 3S2NA 1KB3A 3GVWA 1TWSA 1YNQA 2P88A 2WKGA 4LX4A 3U4AA 3FCPA 1AUSL 2VHLA 4JTQA 4UR9A 4QQUA 4YXGA 1H60A 2BS9A 4F2UA 3TLLA 1A5LC 3K8KA 3EB2A 1YXCA 3URNA 3KTCA 3SDOA 1HKKA 1TR9A 2CZVA 3JS3A 4JFUA 3DFNA 3CYVA 4FNUA 3REQB 1DOSA 4KIRA 4WDTA 4GY7A 4PTVA 4W5UA 3WQVA 5CGQA 2OODA 3IS4A 3N29A 1T41A 3GTFA 1M04A 4HIBA 1GNXA 1GOMA 2HNHA 2P0OA 2BHUA 1RR2A 1VRDA 4E4UA 1P1MA 3GD6A 5A6AA 5FJUA 5CPSA 4RV3A 1HL2A 1TYGA 1UC4A 1RP8A 2V63A 4A35A 1DP0A 4LS1A 3G1SA 4CD6A 8XIAA 3GDLA 4IIGA 1JYXA 2QR6A 5J8LA 1U22A 4PEKA 3HGSA 4B90A 1OF8A 2YA0A 1R9ZA 5A6JA 3DOPA 3HZ3A 4G6CA 4BJHA 3CZEA 2ZADA 3CO4A 1D3CA 1TFVA 1ZP3A 4WKHA 4KT2A 4QGCA 4TX9A 2VUYA 1LF1A 1OGSA 3QR1A 2XVGA 2C13A 3K8MA 3STFA 4US5A 2P3ZA 2R1KA 4I7UA 5CLWA 4O1EA 3SJ3A 1MDLA 1TE1A 1LRTA 4GJ1A 1V5XA 1DXIA 3QQWA 4Y8FA 4IMDA 1LWIA 3HV9A 4PSPA 2ZZ5A 1EJ7L 2CYGA 1OM0A 5CJNA 1F3TA 1VPYA 3APGA 1NP0A 5CC5A 2FDMA 4JGDA 2Y0FA 2Z28A 5EMJA 4JTUA 4MWAD 1V7AA 1NSJA 3CZLA 3WMBA 1UP0A 3UZJA 5DCBA 4LU0A 1OADA 3W6MA 2NV2A 3EGJA 1N8FA 2C0AA 3CEUA 2OOFA 3SN0A 2VZOA 2Q8XA 1ZTVA 3DKJA 3EB4A 2Y24A 1S3HA 3YPIA 3IJLA 5HQMA 1S5TA 1EA0A 2DU2A 2PA6A 5CZKA 5AB3A 4B5XA 2E67A 1EYWA 2A5HA 2JEQA 2VO5A 3GXFA 2ACRA 2NSOA 3SADA 2Z1VA 4FNQA 3E74A 3IACA 3H2NA 4PBGA 4JNMA 4EAMA