3LI1A

Crystal structure of the mutant i218a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGAIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3li1A00
5I3FA 4ONVA 2DJXA 3PS7A 1WXJA 1TJPA 4JY8A 3KXQA 2C15A 5CZTA 2VFHA 3G0SA 5DBUA 1HUVA 5FEZA 3HJZA 4LRSA 3LRLA 5DCDA 2FQIA 2NWRA 5AYZA 3W84A 3R89A 3QMSA 3BLFA 1VQTA 2V2HA 3HOJA 3STCA 3TNOA 4UTIA 4O50A 2Y62A 4FXRA 4LC6A 4LS1A 4E0CA 3N2XA 4LT9A 2PC4A 1TPEA 5FF4A 4IX0A 1YADA 2DZUA 3QYQA 1R2SA 2C3ZA 4NZFA 2WNZA 3W7PA 3CEUA 3N9SA 2R91A 3EXRA 4FX7A 3LM7A 5CKSA 5K9XA 1QR7A 3C3NA 4RZ4A 2CLLA 3I6RA 2VEPA 2X30A 4XZ9A 3S1UA 4P2VA 1NAL1 1JR1A 1KM2A 2VFEA 3DI0A 4UMAA 1YTEA 1BWLA 1X8FA 3W1RA 1W8SA 4JTSA 3PG9A 2CLKA 4RCXA 1S3HA 4MY8A 1O5KA 1WYIA 3P8JA 1G7VA 1OX4A 2C1HA 4QM1A 1VGAA 3MI6A 3C4UA 3CC1A 4A2SA 1FCUA 5L6UA 3GR7A 2QDGA 4PC8A 3B0VC 5EPDA 1OYAA 1SSGA 3VI2A 1TPDA 1OYCA 3KOFA 2OT1A 1YYAA 3A24A 4JX4A 3QQ0A 5HWMA 3GAKA 4BF9A 3GDLA 3TH6A 3W1UA 2Z0IA 4IUOA 3T55A 1Z41A 4D2JA 3DZ1A 3EXSA 4O52A 1HFBA 3V75A 3O07A 3G1XA 1EEPA 3G24A 2NUXA 2V8ZA 2B7OA 4HPXA 1TTQA 4LVGA 3MWAA 3IV3A 1JCNA 1K03A 1OK4A 5J5RA 5CPLA 1M7PA 4U28A 5TQLA 4OU1A 3TXVA 2J24A 3FKRA 1Z44A 5LNUA 4HKPA 4ADSA 1LRTA 3HQ1A 5C54A 4ZVJA 2H6RA 1TTIA 2JKEA 3P5YA 1GQNA 2ZA3A 1QPRA 4LRTA 1UASA 3C6CA 4ZZ9A 3NM3A 2WPBA 2CZFA 3L68A 3OG3A 3G22A 1EP2A 3F03K 4K37A 1EX5A 2QAPA 2R14A 2HS6A 1WOAA 3S9YA 3MW7A 1RZMA 4FHAA 4HIBA 2Q3RA 4R7JA 4LUJA 1XDMA 3LCLA 1D3HA 1CX9A 1W3NA 4A29A 1SU5A 3WK0A 3C61A 4JX5A 1KBJA 3O05A 3EWYA 3IGXA 4YLWA 1Z42A 2WKJA 3P84A 3HGRA 3QEZA 3NQ2A 4X9SA 1LOQA 3A22A 1SZNA 3GK0A 3LX9A 2X16A 2E6YA 4XQ6A 3PAJA 3W83A 4CLMA 4IXHA 3W85A 1GPWA 2J9XA 2JKPA 2BZNA 5BW6A 5AB3A 2P1FA 4MY1A 4M6QA 1OX5A 1OF8A 3SR7A 1SW7A 3HPSA 2J6XA 4NJHA 3G1SA 3ZS4A 3GDTA 4O1BA 3TW6A 1IGSA 3PUDA 1LLWA 3LBCA 4CQ9A 1QWGA 1U5JA 1DBTA 1IIHA 3L66A 5CSRA 3GR8A 3GNNA 1L2UA 2GQ8A 1OABA 2V2CA 3KVMA 4Q4KA 1HG3A 1MXSA 2VEKA 3ABRA 3U8GA 1KFJA 2QCLA 4Q32A 1BWKA 1KM0A 4POCA 3W07A 4TX9A 1ZFJA 2X2GA 3ABOA 3NQDA 2ZZ3A 8TIMA 2QUUA 3DFTA 2C18A 2A6NA 1L6WA 2CLIA 2B7QA 1WV2A 3C2FA 3C0JA 4Z1CA 4JDYA 3H53A 3P82A 4JYDA 5F1VA 5FF7A 5D02A 3MI2A 3P62A 2QCDB 3G1AA 4TIMA 3NL2A 3UWWA 2EHHA 4LTSA 3CHVA 3C2RA 3O63A 3WFAA 1P1XA 2HMCA 4FNRA 3QFEA 5EBUA 1MZHA 2WSRA 3M44A 3GZ3A 4AEOA 3IIZA 3UZJA 3W87A 3DU0A 3NPUA 4NNAA 1I8JA 1K8YA 3W7QA 4GBUA 3DAQA 4NJGA 4UMCA 2A7NA 5K4XA 3NQAA 3W7MA 3L21A 1GYNA 1J2WA 3Q37A 1ZJIA 3PB0A 4AAJA 4OV4A 4XKYB 4ICNA 3TFXA 5KTLA 1AK5A 1LOSA 2E09A 4QQ3A 3W1MA 1TPVA 4FNSA 4S1FA 1FCQA 3GDRA 3LHZA 4O11A 3W86A 4LOCA 3CIXA 3M6YA 5G2IA 5LGZA 3LGEA 5AC8A 1XBZA 2GVGA 1EUNA 3TMLA 4EVZA 2Y7EA 4AHPA 4LNYA 1I2QA 2ZCGA 3PY2A 2A1YA 4FF7A 4JS3A 4HNTA 3PBVA 2ISSA 4FX6M 4BWLA 3BVJA 2P0OA 1Q6QA 1C8VA 3FKKA 1KM5A 1LBLA 1PHQA 2Y63A 3I68A 1W56A 3EKLA 4PCFA 3NPXA 3UZ5A 1KW1A 1M6JA 2ZZ5A 3K30A 1UB3A 2TRSA 4NJIA 3S42A 3SGUA 3A5VA 3STEA 1XUZA 3NEVA 1XM3A 3EWWA 4UTTC 1SQ7A 3T4CA 1WQ5A 3P61A 1SO3A 4TMCA 1OFBA 4DELA 1YDOA 3MYOA 4E2BA 5D38A 1JVNA 1NEYA 2ZDRA 4ZQMA 2Q3OA 3W7GA 1ICPA 4WQ6A 2NUWA 1QPOA 3UNDA 2BLEA 4O28A 4UFKA 4ADUA 4MJMA 2DU2A 4LVBA 1XUUA 1W31A 4GC4A 1LLZA 3G0XA 2QCMA 5H2ZA 2YYTA 3GXTA 3KRZA 3W23A 3TUUA 2W79A 4H6KA 4M19A 2E77A 3OVPA 3BW2A 2J9YA 3WJZA 4E38A 3NA8A 5IM51 3MP3A 1XBYA 3NL3A 4NX5A 4UNKA 2PRMA 4A2RA 4K38A 1W5MA 2H90A 3LTYA 4AF0B 2Y7FA 5DN1A 3QM3A 3GKFA 5EMUA 1N8FA 1ICSA 3LCIA 5G2WA 3W7OA 1OHLA 2QCNA 2CLFA 1H7PA 3G1VA 1PE1A 4IPJA 2E68A 2OT0A 2NZLA 6ALDA 1VYPX 4M5PA 3NG3A 1XFBA 4OQVA 4OT7A 1TCDA 4QITA 5I3IA 3LXBA 3R12A 5EYWA 5KZDA 2Y7DA 5G5IA 1OFEA 3EXTA 1BEUA 1JQXA 3ABQA 4O12A 1K3UA 2ZZ1A 3CT7A 1BKSA 3PBYA 3FOKA 5DXXA 1LTDA 4K36A 4XBSA 1QOQA 3DFPA 4O16A 2GQ9A 1Z48A 1JJKA 1LRQA 1NSJA 3A23A 2PCQA 1TMHA 3BV4A 4P61A 2A7PA 4TU1A 3FFSA 4UFMA 2GJLA 1EB3A 2HSAA 2V82A 2OX1A 4PH6A 3G0UA 4MFEA 1TPFA 2FB3A 2A85A 1IF2A 4N6FA 3N14A 1E51A 4JTIA 1I2PA 4A3UA 1KM3A 3LLDA 1OK6A 5LKYA 1SO6A 1VZWA 4RXGA 1QCWA 5DY2A 5BRBA 4FNQA 4DXVA 2Q8ZA 2ZTKA 2ALDA 1GEQA 1RV8A 3L5LA 3LXCA 3MMTA 3TW7A 3S5OA 1NF7A 4MZ1A 2RFGA 1M7OA 1KLZA 3EEGA 3P5ZA 4LC8A 3Q58A 3M5VA 1DJQA 1PIIA 2H8ZA 3CB8A 4Z1DA 4DPQA 3THAA 4CQ8A 2HTMA 3UYCA 5DELA 3N3MA 4HSNA 1LM1A 3EX3A 1TTPA 4CNPA 3IIPA 3HBLA 4NZJA 1VC4A 4Y8FA 4WY0A 1D9EA 3CEPA 1B57A 3NQFA 5AOUA 3NQMA 3UY8A 3NPWA 4NJKA 1RQBA 4A21A 5TIMA 4NU7A 3QMRA 1HL2A 4Y6GA 3PUEA 4N02A 3TC7A 3QSTA 3CTLA 1K02A 4AWUA 1XI3A 3IVUA 1SW0A 3OIXA 3FJLA 5IBXC 1R47A 4YWIA 1QMLA 2Z6IA 1RVGA 2CLMA 3LCGA 1YPIA 3LOTA 3W9ZA 1K7FA 5G1YA 3UQNA 1LOLA 1YDVA 4WOQA 1VJIA 1MO0A 1EPXA 2JBMA 5DCEA 3NQ7A 2Y85A 3L65A 2YX0A 1WA3A 2WOQA 4O0KA 2FPVA 2ISWA 3MI3A 4JTEA 3W7HA 5E0KA 1Q6OA 2B0MA 3S5ZA 4RKAA 3NR0A 4JTUA 1S5VA 2WQPA 3O06A 3LLFA 4RZ5A 3ANYA 3EX4A 2ZZ2A 2C6QA 1ONRA 2FLIA 1KM4A 1WBJA 4Z1AA 4BI7A 5CPOA 5BOOA 1F76A 2ZZ6A 4O10A 2ZTJA 1DQXA 5DLCA 1FQ0A 1KA9F 4H4IA 2OMAA 5LHFA 3I7RA 2QUVA 1G4SA 3BW4A 3GDKA 3E02A 2YW3A 4FO4A 3HPZA 1AL8A 4JTTA 3GVGA 2YSWA 4FNUA 2PRHA 3G18A 3U2OA 4JD4A 1KFBA 2BWGA 4GUFA 4BWLC 4QAIA 2C19A 2QCHA 4OWGA 3TKFA 2FFCA 1ZCOA 3NQGA 4I7WA 3L5MA 1KFLA 3QMTA 3NL5A 3P8IA 1TRIA 4YMZA 3W3OA 1IIGA 1W54A 1GTHA 2D73A 4N9CA 3P74A 3BLEA 4O18A 2VENA 5LNVA 3EWXA 3B0UX 3O6YX 3TC6A 1ZAHA 5LNRA 3QSRA 2V30A 3FYOA 2IQTA 1THFD 4KWVA 1FWSA 4JTFA 3PM6A 4PFMA 3WJWA 1K7EA 3BK0A 4RR4A 3SFKA 5K4ZA 3DKJA 1KFKA 3HO8A 4MLJA 4N4PA 3LTPA 3UXAA 3W2JA 5FEXA 5D2VA 5AHLA 3UXDA 3W1LA 3R5EA 2VFGA 3BGGA 1G4TA 4JR5A 1H51A 4AH7A 1IXQA 3G8EA 3TQKA 2ABBA 3GAYA 4O53A 3RLUA 1NVMA 3FJ6A 3SECA 1A5CA 2F7FA 2ZRYA 3DFQA 3EWUA 2NXIA 2O7SA 2DORA 2JKAA 1JRBA 2A7RA 4Y96A 3T44A 1O5XA 3ZFHA 5CG7A 4BI6A 1HTIA 2Z1BA 1LBMA 3LERA 4K6AA 2ZFAA 3Q94A 1NFBA 3G3MA 3A9IA 4BFAA 3W7LA 4ZQPA 4YCOA 3AJXA 5E93A 4JDBA 4JTGA 1A53A 4A22A 2AGKA 3DHDA 5BMWA 1F73A 2WJZA 1OX6A 2TYSA 5AYXA 4GRSA 1VCVA 3TJLA 3TQVA 5HR7A 3MYPA 2J27A 3B05A 1G4EA 2BX7A 2NX9A 1VCGA 3W7JA 4O1CA 1PCKA 2A6LA 4R34A 3TDFA 3VNDA 1WDWA 3SY5A 1GOXA 1RR2A 2DZTA 3IVTA 1VHCA 4AWSA 4QSHA 3S0CA 1OFQA 1KTBA 2VKZG 1ME8A 1L6YA 5FEWA 4HSOA 4IGHA 1O4UA 3HGSA 1W5PA 3NZ1A 1CW2A 5LNSA 5EL1A 1FCVA 1YXYA 1IXNA 3IEBA 4PL2A 4EWND 2LLEA 2X1TA 2QDHA 2YGYA 4N9DA 1QOPA 3MP5A 1ZAJA 2E5DA 3C2EA 1ML1A 1T0OA 2YFOA 5FEPA 5I3KA 1MEIA 5EA9A 4K7YA 3ATZA 3C8FA 3KAOA 3SZ8A 1TREA 3GB6A 2GVJA 1KLYA 2WSYA 3RMJA 3PULA 1ZY9A 4JIPA 5EY5A 3LRKA 1M5WA 4PODA 2KZHA 2QR6A 3S5YA 3W22A 4WOZA 5LHEA 3G8RA 1D3GA 3U6WA 4IPIA 3DBPA 3DH7A 3TJXA 3OBKA 4R33A 4GUHA 5HQEA 2ABAA 4DO4A 1GJPA 2E5BA 4U4MA 3W1TA 2ATMA 4M6VA 4JXCA 3PR2A 4O0ZA 2ZRUA 4AXKA 5HUPA 3GIYA 3TFCA 1J4EA 1K8XA 5F4WA 5U4NA 5HULA 4K8HA 1KTCA 1ME7A 3W70A 3VE7A 3W7KA 1SZGA 1K7XA 3NZRA 3UY7A 1QPNA 4Z08A 5KZEA 4UC5A 3NL6A 3M9YA 3PVFA 3D0CA 5F2IA 2WO5A 3JRKA 4JTKA 3KHJA 2FTPA 4PL1A 4JNMA 3R8RA 1XBVA 2G97A 4QNEA 3LCFA 1H1YA 4AWTA 1JUEA 1R2RA 1CI1A 1TIMA 1KV5A 4NXKA 1A5SA 1L9WA 1T96A 2E1DA 3IIOA 2EPHA 5HWNA 4NXSA 3O15A 5AHNA 1B9BA 1ZAIA 4HPJA 1KTNA 3UWUA 1X1OA 1YLVA 2QKFA 3NM1A 3P80A 4CNNA 2R94A 5BNKA 5C5YA 4ZQRA 2VEIA 3QRHA 4EF9A 1T8XA 4QJ1A 4XBKA 5KMYA 4MOZA 3TCEA 1F6KA 1XC4A 3PWAA 4I9AA 5D2TA 3DFOA 3A21A 2NUYA 4O15A 1QPQA 2B7NA 5D30A 1KFEA 2VC6A 3BG3A 4ZQCA 4I7VA 1ADOA 3TQ0A 5HJLA 2G95A 2YZRA 1OFRA 4JIQA 5HNRA 4O4WA 2G5WA 4WY0B 3TROA 5CZJA 1QO2A 3W1XA 1TPB1 3NGJA 1F74A 3LCWA 3N2MA 3NO5A 4MYAA 2WNQA 2B4GA 3B06A 2P10A 1R2TA 6TIMA 3PBUA 1EWDA 1J5TA 1JCYA 4UFJA 2VFIA 2RDUA 4IMEA 5KITA 5F4SA 1UJPA 3EX6A 3L9CA 4PEKA 1OFAA 2NXHA 2YCEA 4WX2A 3KVKA 2FDSA 1X6UA 4LV9A 3QF0A 4ORIA 1MEWA 1SFLA 4MZYA 3INPA 3EWZA 3T7VA 5GVJA 1DKWA 1Q6LA 3LB0A 2V9DA 4PTNA 1LDCA 2ZA1A 2UV8G 3M5YA 3S1XA 2X1UA 3QC3A 3QQ1A 4UTJA 1VLWA 4UTKA 5DBTA 1G7UA 1WAUA 1SZFA 4CCDA 3M41A 3OEXA 2Y7GA 5C2XA 4GFSA 3CPRA 1A5BA 2CFFA 1VH7A 2J9ZA 4UMBA 2YPIA 4WD0A 2WNNA 4E2DA 3FEMA 3GLCA 5G4EA 1G4PA 4Y9AA 4FNTA 2QJHA 1FDJA 2VOMA 1LORA 4O13A 4WXYA 3MBDA 1AW5A 2RHGA 3B04A 3MHGA 1LROA 2XN2A 3SSJA 3LDVA 4MIMA 3TMQA 4OE7A 4ZQOA 1DL3A 1QNVA 2Y61A 3LV6A 4KKXA 3GKAA 2V81A 3P60A 3TE9A 2Y89A 5I3JA 4LW7A 1LYXA 1X1ZA 4BK9A 5AYYA 3M47A 3HG5A 4UFHA 1F5ZA 2GUUA 3DENA 1F05A 2GOUA 1DQWA 3S8HA 1Y0EA 1P0KA 1KV8A 4FIQA 3S1WA 3B4UA 4TR9A 3UPWA 2DJLA 5LNWA 2YYUA 1OX4B 1IXPA 3QW4B 4MVAA 4MY9A 4DBDA 3LI0A 4GJ1A 1VR6A 2EGZA 4AHOA 2HS8A 2Z6JA 5K3VA 3W71A 3PBWA 2OJPA 1OG0A 4ML9A 5E1QA 4GWEA 1HO4A 2ZQ0A 1PCWA 4IQLA 2GJNA 5CZ0A 2OCZA 2X1SA 1FUYA 3FYPA 4O57A 5H91A 5U7SA 3QW3A 4RLIA 1FDZA 3G1YA 3NOEA 1GZGA 1LCOA 3NDOA 2NLIA 4MYXA 3UWQA 4XWUA 1ZALA 3ELFA 5CPNA 5AN7A 1AL7A 3NAVA 4ORMA 1W5OA 1VS1A 2PRLA 1G67A 3P7YA 4N9EA 4Z1BA 2H3DA 3NPVA 5AFDA 4RJEA 5C6MA 3W7CA 5G2HA 1W3IA 3EB2A 3W2MA 1JUBA 3W76A 3N73A 3LV5A 1FWRA 3JS3A 4IMDA 3SI9A 5LSMA 3HMJG 3W2NA 5A8GA 4S2CA 2NWSA 3G3DA 3E12A 5KSWA 3MBFA 3MO7A 3TR2A 5K7JA 2RKXA 2Y88A 3DXIA 5D33A 2CZEA 2ZRZA 2H8XA 2ISVA 4CCEA 3W1NA 2NV2A 2QCEA 1TPUA 3QZEA 3BARA 2ZRWA 3GYEA 1RQEA 1F2JA 4IJBA 3CWOX 3B03A 2A0NA 4N4QA 2QCGA 5K9CA 4OGZA 5HUOA 1O95A 2YDAA 4FB7A 2E6AA 3CM4A 3HPXA 4NX0A 3SGZA 5KZMA 4O54A 1JULA 4HNNA 3W75A 3W7NA 4FEZA 5AHEA 4FIRA 3GDMA 3F4NA 3E0IA 1EIXA 1KM1A 3LHTA 2YXGA 3BG5A 4UTUA 1O94A 2XN0A 4JYFA 1DJNA 3KVLA 4DBEA 4WY0F 4KWWA 1RD5A 2Q8LA 4X3ZA 1SSDA 3KRSA 5D03A 1KBIA 4LWWA 2QCFA 1P0NA 3DFNA 3LHWA 3M5XA 4NNBA 5DXYA 5D2YA 4UNLA 2ZZ7A 5AHFA 4DEFA 5T26A 2V2DA 4AVFA 1ZHAA 3BG9A 1GVQA 3JR2A 3ATYA 3OA3A 4AB4A 1VPXA 5FESA 3RK8A 4I7UA 4J9JA 4K39A 4JEQA 3W1PA 3H54A 1GVFA 2A21A 1VCFA 2CU0A 1PL9A 3FA5A 2EF9A 4O4VA 2YR1A 4GUGA 4DF1A 3HG3A 3LBMA 3DHFA 2DZWA 4DQWA 1XDLA 1FDYA 3NQ8A 1PS9A 1UUOA 4AMAA 2C14A 3A5FA 3ZWTA 1ZENA 3HB9A 2Y70A 3PSVA 1QFEA 1W5QA 3EWBX 5HMSA 3ZR4A 1H60A 3TAKA 3PSWA 3T40A 3OVRA 1FWTA 4GXMA 2BSLA 3BGJA 1GWJA 1SW3A 2V5BA 4MKNA 3TSMA 3SW6A 1HO1A 2NX3A 1DHPA 2TPSA 2OZ0A 3HG4A 2I9EA 1DV7A 4NT0A 1A50A 4L4MA 2PURA 3NXFA 5D37A 3HGJA 4MFDA 1LZOA 4AF0A 5FF2A 1OFDA 4X22A 4G1KA 1U83A 3WK1A 3KX6A 3S1VA 4NJJA 2QUTA 3DI1A 1PVNA 3E9AA 4OBTA 1GG1A 3USBA 1G69A 1TV5A 1XCFA 1W1ZA 1H7RA 4WUIA 2GVLA 4NNCA 1UUMA 4TO8A 5F2GA 4LVAA 3M43A 2VXNA 1KFCA 1WX0A 3TAOA 3W1AA 4H3DA 4UTTA 1I2OA 4R53A 3W2UA 1YDNA 2I1OA 2J88A 4O8RA 3BLIA 3PF3A 2ZA2A 4BI5A 2YW4A 5FI8A 1WBHA 5F4XA 3TSDA 1PV8A 1TQJA 3VE9A 4IXXA 1FCBA 1K8ZA 2E5CA 3IIVA 2NV1A 1EWEA 1P4CA 3L0GA 4IMGA 4DO6A 3CU2A 4N9BA 3V1PA 3CLMA 3TK7A 4C1KA 4EIVA 4W9TA 2QJIA 1FX6A 3M0ZA 5DCBA 4YXGA 4IMCA 1TPH1 3HG2A 4L4LA 5HINA 1B4KA 2F84A 1DORA 2AQWA 3L67A 1XBXA 4KFNA 3R13A 1SR9A 1OJXA 1YTKA 3BO9A 4JX6A 3PC0A 4O14A 4AHQA 3M7WA 3VFLA 1SO4A 5F2MA 2FB2A 2CW6A 1JCJA 1TB3A 1UCWA 1W37A 4UCGA 3L0NA 2FPTA 1EA0A 1N7KA 3GX9A 3LHUA 5D2WA 1W0MA 1SPQA 4Q33A 4YL2A 3TV8A 1ME9A 3SIZA 3VKJA 4LY8A 1GVRA 3W2KA 3OHIA 1KM6A 3NQEA 4IWWA 3SJ3A 3F4WA 4CQAA 4LVFA 3VCRA 2QJGA 4K8EA 4XTDA 3TU9A 1VLIA 3O6DA 4JY9A 2DZSA 1AW1A 1QO5A 3W7RA 3P67A 3UWYA 5FF0A 4EOUA 3NQVA 4OHQA 2A2IA 4Z0JA 2H3BA 2XN1A 1QDSA 1T99A 2ZBTA 1TJRA 5KINA 2O7QA 1VYSX 3E49A 1TTJA 1VYRA 4BR1A 1OFOA 1TV7A 1I45A 4QISA 1C29A 1LP6A 4WZHA 5K2ZA 3Q2DA 4O19A 4LS2A 5AHMA 4K7VA 2W0UA 2JGYA 5I3GA 3W88A 4WXZA 5AC6A 2I14A 3CWNA 3STFA 3THQA 3EX1A 1SFJA 1GG0A 4RV8A 3MUXA 1FBAA 4QIUA 5CGQA 4HNUA 1BTMA 1FXQA 2VFFA 2FPYA 3RF9A 2EKCA 4UUIA 2V5LA 3MJYA 3UD6A 1GVOA 3QH2A 2RDWA 3KFTA 3M5ZA 4UR7A 3N19B 4GUJA 5SWUA 3BPWA 3RFAA 4JYEA 1JUKA 3TSBA 1OF6A 1QAPA 3I7SA 3GNDA 4CNOA 2JGQA 5L9FA 2WV8A 4HT3A 4DO5A 4NUWA 1B3OA 4XUGA 3FLUA 4UTWA 3ABSA 1H7OA 3UWVA 4MJZA 1AW2A 1IXOA 1TQXA 4ZMGA 3DGRA 1NF0A 3WJXA 2A5HA 4MLRA 2YFNA 1N55A 4S2BA 4GE8A 3DKLA 1SO5A 2DP3A 3LHVA 3IIXA 2TSYA 4GUIA 5G1TA 1Q3NA 2FIQA 4NVTA 4RX0A 1L6SA 4UTHA 5K9DA 3MHUA 1WOBA 5IBXA 3QPYA 5EKYA 3L5AA 5F1UA 3FS2A 2QEZA 1AG1O 3C52A 2GPTA 1FXPA 4UFLA 4FNPA 1TV8A 5D32A 3H55A 3M16A 2C13A 3KVJA 3LI1A 3G1FA 1SUXA 2VELA 4LS0A 4DF0A 2TMDA 4LUIA 1TPWA 2WSQA 3T78A 3W7DA 4UXDA 4JICA 1H63A 3KRUA 1I2RA 3NYZA 4JTHA 3YPIA 1YPFA 1EP3A 3HF3A 1H5YA 4NQ1A 2EAWA 5F2LA 4WJEA 2NX1A 4X2RA 3IGUA 1V5XA 1MEHA 3W6YA 4LV4A 2NXGA 3B0PA 4EF8A 3STGA 4IOTA 1GVSA 3LRMA 2RDTA 1GT8A 3WJSA 1R30A 1Q6RA 5DY3A 3G1HA 3N9RA 3IVSA 1DVJA 5HWJA 2PE4A 4XTIA 3EX2A 3PUOA 2E6DA 3ZWSA 3IRDA 2BXVA 1H7NA 1ZNNA 1H61A 3TX9A 2CWNA 3C56A 4KFOA 3O6CA 4M7TA 4UTLA 3NQ6A 1OVDA 5BMXA 4IX2A 1FY6A 4Y90A 3UPBA 4JN6A 2R8WA 4LVDA 5ABTA 5CPMA 5J5DA 1G6CA 4JTLA 3HGOA 2Z2UA 1F6PA 4MUZA 3PB2A 1FWWA 2CLOA 3CQ0A 3WK3A 2RH9A 2QCCA 1AMKA 3EKZA 1Q45A 1DOSA 3O16A 1X7FA 3R2GA 1P5BA 3GXPA 3W2LA 2CLEA 1W5NA 2A4AA 3IGSA 3L2IA 1JCXA 4RZ6A 4TMBA 4KFPA 1TO3A 3QJAA 2QF7A 3W7EA 3W73A 1GTEA 1TPC1 1H7XA 2DZXA 4ZQNA 3E96A 1VRDA 3CIWA 3RLVA 4HHPA 3PG8A 5G4WA 2CLHA 5D2XA 1ICQA 3W1QA 2ZZ4A 1ALDA 1FWNA 3NVTA 5CSSA 3G1DA 2FJKA 4OV9A 4B5NA 1S5WA 3W7IA 3TIMA 1EP1A 1B4EA 3F1QA 5LGXA 3L0KA 3LCHA 4ZL1A 3DFSA 5C55A 4DF2A 1TYGA 5TBOA 3LCXA 3MHFA 1UBSA 1JCMP 2X1RA 2ZRXA 4QNWA 1S5TA 1JQVA 3HIJA 5AHIA 3M1ZA 4N2YA 2QAFA 2CZDA 1TRDA 3LHYA 1A5AA 2VEMA 5FF3A 1RQHA 1C9DA 1H1ZA 1XL9A 5A5WA 4UIOA 2JK2A 5D04C 4LU0A 5CZSA 2QCDA 4HNVA 1EUAA 3NQCA 3W74A 3B8DA 1V7YA 1PHWA 1I2NA 2DZPA 4O1DA 3P81A 4MPQA 4IMFA 1LRNA 1TSIA 4JTJA 4UFIA 3S6DA 2C16A 1XXXA 3TA6A 4UR8A 5HR6A 2AAMA 2VFDA 1OYBA 3BW3A 3I65A 3WJYA 4HN4A 4RK8A 1XKYA 4N6EA 2ZRVA 2G96A 4M7SA 2W6RA 5D09A 2XFWA 1JCLA 1VHNA 3W72A 3AO0A 3LXAA 3RNDA 4MZ8A 2ATSA 2Y6ZA 1MSSA 3WK2A 4JGDA 1YTDA 4PA8A 4XKYA 4UTMA 2CZ5A 5AC7A 3QPZA 3S5NA 5I3HA 3O1NA 3GXNA 3C2OA 3NNTA 4YCPA 4Z0SA 1OFPA 3TXZA 2E6FA 4ADTA 2DZVA 2GQAA 4GNJA 3OVQA 4UTWC 3N34A 1H7WA 3C2VA 5D05A 1F7BA 4FX8A 1R46A 5MHBA 1SZEA 1YXDA 3O8AA 4C1LA 1H50A 2V0TA 3MP4A 4O1AA 3I7QA 4DPPA 3LTSA 1W3TA 4ALDA 3FIGA 1O60A 1LBFA 2C0AA 4RXFA 3RU6A 3UWZA 7TIMA 4FXSA 1GYLA 1I4NA 2B7PA 4CCCA 4O17A 2ZYFA 1YXCA 1RPXA 1H62A 5LZLA 1JRCA 2BTMA 4M6PA
chains in the Genus database with same CATH superfamily
3KM8A 3PS7A 3UNTA 4URIA 1JZ3A 5CCZA 4W84A 5CZTA 4CD6A 4GH1A 3G0SA 1RJQA 4HPGA 3GHRA 5FEZA 2VL4A 4K68A 1ITCA 2PBOA 2HEJA 4CU7A 4J3WA 1VQTA 2V2HA 4M6UA 3ARYA 4UTIA 2OVLA 2Y62A 3HQOA 3GH4A 4XO7A 5FF4A 1VBRA 2ZX5A 2BOGX 3V5FA 7PTDA 4IX0A 2C3ZA 3G77A 1E40A 3V18A 3W7PA 3RM4A 1EJUC 4FX7A 1ZB5A 3B40A 5K9XA 2AAAA 2GYIA 2VEPA 2X30A 3S1UA 4P2VA 1V0KA 3MS8A 3BURA 4UMAA 3T8LA 1YTEA 1X8FA 4PRTA 1NU5A 1W8SA 1E4NA 2X42A 2CKRA 1O5KA 1WYIA 3P8JA 2BXYA 3DECA 3HPFA 2DGAA 2PA6A 3MI6A 4AIEA 3C4UA 3CC1A 1FCUA 4W5UA 5L6UA 3VKDA 3FAXA 1SSGA 2XH7A 4HNOA 2ZC8A 5H8UA 3QQ0A 1B9ZA 1UMYA 3T08A 3QBUA 2PDHA 2RGMA 2ZXAA 4D2JA 1C9WA 4O52A 1HFBA 3V75A 4NRSA 2POZA 4HYWA 5CQ1A 3GU1A 4HPXA 3W26A 3IV3A 1UZDA 2Q8XA 4OU1A 1US3A 3UJFA 1KRAC 4DJFD 3SQLA 4WDTA 4PRRA 2BHYA 5A69A 4LUTB 1LRTA 3HQ1A 1E5JA 1TTIA 1GQNA 1X98A 4J3ZA 4RUBA 4LRTA 4Q8OA 3C6CA 4ZZ9A 3OQEA 3NM3A 1TR9A 4ROQA 4R7OA 1HJSA 3VOJA 2CZFA 1JD9A 3OG3A 1GW1A 3CHFA 3ICJA 3BMVA 2QAPA 2R14A 3N15A 3TN4A 1OT2A 2A3EA 4R7JA 3VILA 2OSWA 2ZVRA 6ENLA 1SU5A 4C6MA 3FJ4A 1W91A 4IF2A 4HHHA 3P84A 3NQ2A 4XO6A 5C71A 1XLAA 4K1WA 2X16A 2E6YA 3D5HA 3W85A 2BZNA 1ZJHA 2JF6A 4L7ZA 3HPSA 3TEVA 7REQB 1VFFA 3ZS4A 1FP8A 3QLDA 3TW6A 1IGSA 3KS5A 4GACA 1Y5XA 4CQ9A 3U7BA 4Z2IA 2EPMX 5CSRA 4IM4A 1QU4A 1J10A 5I24A 1JYWA 2V2CA 2HXUA 1YKWA 4Q4KA 1HG3A 1MXSA 3MUCA 1WP6A 1Q7MA 4H83A 1ZP4A 4UQEA 1SMDA 3O0KA 1N8IA 3O7UA 3NQDA 4CQCA 4BY3A 5C9XA 2B7QA 1WV2A 4DZIA 3WMLA 4JDYA 1GNXA 1IWAA 3R58A 5F1VA 4C60A 5I3DA 3WDPP 2PU0A 1IQ8A 2PWGA 1TX0A 2A3CA 5A6BD 4H41A 5CPSA 4FS9A 3NL2A 4LTSA 3CHVA 2WVVB 1FFRA 3N29A 2NVDA 4B5XA 3NVDA 1HP5A 6PTDA 3DU0A 3NPUA 3QR1A 1EC9A 2PDQA 2XVGA 4GBUA 4AD5A 2E1WA 3NQAA 4IJCA 2DUAA 2ZX7A 1IR1A 4PMOA 1M9HA 1GYNA 1J2WA 3B8SA 4KWUA 4HOXA 3SCOA 4AAJA 2D2HA 4EACA 3A3HA 1LJYA 3VD5A 5KTLA 4CEXC 4H04A 1BWVA 4QQ3A 3KOXA 2ZWZA 2AQVA 3CIXA 5LGZA 4AC7C 3LGEA 2GVGA 3LS9A 1TJ0A 2O56A 3UA3A 2Y7EA 4JBRA 3PUGA 3RILA 2ZCGA 2X2YA 3NCOA 4FF7A 1L6GA 2ISSA 4ASTA 3AXXA 3K2GA 1PHQA 4PCFA 4KEZA 3DIPA 1F3XA 4HA4A 2OO6A 3UZ5A 1S2VA 4GQQA 4NJIA 2J7DA 3B9OA 3WD3A 3NEVA 3W82A 2G3NA 3NOYA 2PP1A 4NY2A 3T4CA 1K77A 1WE5A 4FLSA 1SO3A 4PB3A 3LYEA 4DELA 2CXGA 5C9RA 1NEYA 2ZDRA 1KNWA 3BCDA 1IR2A 1S1PA 1AVAA 1XUUA 2VZUA 3LPGA 2OYMA 3G0XA 4ZTXA 4KEVA 2QCMA 3KCOA 3W23A 4M19A 4GGHA 5D8WA 1PZ0A 2PRMA 4A2RA 4K38A 1CXHA 1HQTA 2H90A 4AF0B 2Y7FA 2J7EA 2XPKA 1EHNA 1UR9A 5EMUA 1ICSA 1OZQA 3LCIA 5BYWA 3WF2A 3ARUA 3TTEA 2OEJA 3APTA 2VZSA 1VBHA 2J74A 2OT0A 1XIMA 3CUIA 4C5ZA 2BY3A 1FHVA 1V3IA 4F40A 1UOZA 4S3AA 1BEUA 2J7BA 1EJXC 4O12A 4MHBA 2AQOA 3CT7A 1TWWA 4Q8NA 1ZJAA 3LA4A 1UC5A 1LTDA 1QOQA 1V79A 1BVZA 2WMFA 2PLKA 1JJKA 5FOOA 1JPIA 4EPDC 1AD4A 2PCQA 4IGMA 4P61A 2A7PA 4Z42C 3C0QA 1EB3A 4GIYA 2OX1A 3G0UA 4XZMX 1IF2A 5M2FX 1PZ2A 4JTIA 1C3FA 1I2PA 4WKFA 3IPWA 1KCKA 4WKAA 1KM3A 1M53A 5LKYA 3EDEA 2C8NA 5DY2A 3AXIA 5FSEC 3D47A 5IHRA 3TZFA 3AS3A 1UKPA 1YE4A 4IIFA 3ZJ6A 3EEGA 4LC8A 2NQHA 1YNPA 1J0IA 4Z1DA 1J93A 4CQ8A 3FV9A 2EPOA 2IPWA 1LM1A 1TTPA 1UW9A 2R24A 3HBLA 4Y8FA 4WY0A 1D9EA 3CEPA 4UQCA 4Q8VA 1O5QA 3AU2A 5AOUA 3GW3A 5MKGB 5TIMA 1MQQA 2NQLA 2P8CA 3MTWA 2OQLA 3PZVA 4N02A 1KCXA 2DSKA 5GNZA 1XI3A 1TX2A 3M4HA 2IXVA 2R1NA 1BSIA 1RVGA 2CLMA 2OFJA 3LCGA 3LOTA 1K7FA 5G1YA 4ACZB 8A3HA 5B7ZA 3BZGA 3WBYA 1QHOA 5DCEA 1OIMA 3NQ7A 4L1XA 1WA3A 3RPTA 4O0KA 2FPVA 4JN7A 4R85A 1ITQA 2IPFA 2WM0A 4F2BA 4JTEA 1I60A 1Q6OA 3S5ZA 4GMEA 4C90A 3NR0A 1QHPA 4PMQA 2ZZ2A 1KM4A 1RH9A 1OADA 2F8QA 3QKZA 3B0XA 5CPOA 5HNUA 5DLCA 1FQ0A 4H4IA 2OMAA 3I7RA 3LNPA 3L7RA 1S2CA 3HPZA 3GVGA 3ID7A 2I5IA 3WD4A 1W9BM 2CESA 4JD4A 4MB3A 3OA5A 1MW1A 4GUFA 4BWLC 1GZ1A 3KUMA 3P93A 3KDNA 4I7WA 1ZCOA 1EGMA 1EXBA 3NQGA 3L5MA 1KFLA 3P8IA 4PBGA 4YMZA 1W54A 1GTHA 3LBOA 3RITA 3USZA 3KP0A 4P7QA 1QASA 1ZAHA 1XLGA 3T2QA 5LNRA 1TWDA 4MJ4A 4QJ4B 4DZ5A 2V30A 2IQTA 1I6NA 1ODUA 4PFMA 5JQ9A 3WJWA 3SCRA 3WQ8A 2AL2A 3DKJA 4EAYA 1KFKA 3TTSA 3LTPA 1IEQA 4FALA 1XIIA 4S39A 1EDGA 3L23A 5FEXA 1WZAA 5D2VA 2XIQA 3UW6A 5XIAA 1IXQA 3G8EA 5EMJA 3TQKA 3GAYA 3RLUA 4AC1X 3HV8A 1A5CA 2F7FA 2PF8A 1FOBA 1F3TA 2A7RA 3ZMRA 4BI6A 2W62A 1XYFA 3WUFA 3G3MA 1JDCA 4E8CA 1DE6A 3W7LA 4YCOA 3AJXA 4QJ5B 1XC6A 1LL4A 1E6RA 1TE6A 1YNYA 5BMWA 3VD7A 3TJLA 2J7HA 2SFPA 1RBLA 3B05A 4HZ6A 4LANA 4O1CA 3VO0A 3KP1A 3N04A 3MSDA 1PO9A 1QK2A 3KL0A 2WQDA 3WL0A 2A6LA 1Q7QA 1QVBA 5AVNA 3SY5A 4S3DA 1VHCA 2Q09A 1XLIA 1A47A 1DJGA 1R3WA 1OFQA 1ME8A 4HSOA 1O4UA 1JNDA 1IXNA 2WMJA 4PL2A 2X1TA 2QDHA 2YGYA 6REQA 3H12A 5TD4A 2WVUA 3C2EA 3LG3A 3KCJA 5I23A 4W7VA 4F4RA 2YCIX 3ATZA 3KAOA 4Z2HA 3BAJA 3SN1A 2ZUWA 3MSYA 3PULA 1ZY9A 4DLFA 3N17A 1TVPA 3S5YA 4WOZA 4M1RA 4F0LA 1F4HA 2PGFA 3U6WA 2XSXA 1J11A 3GFYA 3NURA 3DH7A 3B9DA 1R8LA 3NFUA 4NAEB 3OBKA 3BLLA 2ACUA 5C2GA 4R33A 4GUHA 3WQFA 2ABAA 3KL5A 4JAWA 2OELA 1GVIA 4TXEA 3WQ5A 3CMFA 4XAPA 1CLVA 4TQTA 3EB4A 3MMUA 2ZRUA 1HW6A 3FGCA 5HPOA 1K8XA 3CQIA 5F4WA 5U4NA 4DBWA 3UG5A 4GX8A 3W70A 1JAEA 3VE7A 1UA7A 4M0XA 2WHMA 2JIEA 1PKLA 2OZ8A 1XSKA 3CQKA 3LK6A 3M9YA 4JZ5A 4LQ1A 5REQA 4W87A 2Y1HA 1EH9A 4PL1A 4JNMA 2QPUA 1XBVA 3VGDA 1H1YA 4OVXA 2YOCA 4LYPA 2BVYA 2G0WA 2WC7A 2QMKA 1B54A 2EPHA 1XIDA 3K4AA 3QVQA 3O15A 5AHNA 5ECUA 1ZAIA 1NOFA 4NILA 3JZUA 3UWUA 1X1OA 4TTUA 1PKMA 3RAOA 1BVWA 5C5YA 3SUTA 1US0A 1AD1A 3QRHA 4EF9A 1QI4A 1UD6A 1Y5VA 1B3ZA 4XBKA 3TCEA 4I3GA 2UY5A 4I9AA 4MKVA 2NUYA 4WGXA 4G7EB 2VC6A 1ADOA 3KZPA 1X6LA 1J0ZA 2G95A 1OFRA 4LCQA 4O4WA 5CZJA 1QO2A 2XWEA 3W1XA 1TPB1 3NGJA 5HJXA 5JH2A 3VTRA 2CXEA 3N2MA 3NO5A 2B4GA 2BMBA 3LZ5A 2FHBA 2VZTA 1GOMA 5CSYA 2H9AA 4UFJA 4QHRA 1XLEA 4G8TA 5KITA 3N13A 1UJPA 3KVKA 3SCWA 1X6UA 3CHEA 2BGQA 1ONEA 2DQWA 4RE0A 4IZGA 3I3EA 3OU8A 3REQA 2BBFA 2ZA1A 2UV8G 3URNA 2EXOA 2WHJA 2POTA 1UH4A 3ZLHA 2X1UA 4XIMA 5A6TC 4P7LA 1G7UA 1T5AA 1TZZA 1LG2A 1WAUA 2DSUA 1SZFA 5LIKX 2FH8A 3OIHA 3OEXA 4F9JA 3QGAC 3DC8A 4AZGA 3QHMA 2J9ZA 4LBUA 4Y9AA 1W3LA 1JPDX 1WXZA 2VOMA 1LORA 3MBDA 1AW5A 2Z7GA 3MHGA 1K6AA 3NDZA 2XN2A 1HL9A 1WAWA 3NWRA 3KBMA 3LDVA 4ZQOA 2PAJA 3LV6A 4KKXA 2ZUMA 4CD8A 4C6LA 3P14A 2V81A 4BZYA 4WR3A 3ITVA 5EFFA 4WJ8A 1F5ZA 3APYA 2GUUA 3A4JA 1P48A 1Z7AA 2DZAA 1BLIA 5CBJA 2VDHA 1KV8A 3UVAA 3WUBA 5HPCA 3DEQA 2VDIA 3B4UA 1OX4B 2G41A 4LBSA 4DBDA 4KERA 2VR2A 4MY9A 4LY4A 1VR6A 4FLQA 3WNKA 3W71A 3PBWA 3UPMA 4PUEA 2RUSA 3S3GA 3CHCA 4IQLA 4PSRA 4A3QA 2GJNA 3WDQA 2QQ6A 2YDRA 1J12A 1FUYA 3W27A 1QWKA 1W1PA 4KGLA 4L61A 3G1YA 3H2OA 5GPRA 3EMCA 3NDOA 3EEZA 2NLIA 4NHVA 3VUPA 4MYXA 3TOPA 2VT0A 4XWUA 1ZALA 3ELFA 4C7GA 5AN7A 1JAKA 3DERA 3NAVA 1W5OA 2WMGA 3ES7A 1VS1A 1G67A 3P7YA 4N9EA 1PB0A 4L56A 2GDQA 3W7CA 3S2NA 4JL1A 1F3EA 1W9XA 3VZZA 1H41A 1U33A 3W2MA 3W76A 3WQ6A 1W1TA 3JS3A 4IMDA 4Z2LA 2BG5A 3W2NA 2YDQA 4MNJA 2G3FA 3ECQA 3TR2A 2DIEA 2CZEA 3CQHA 3T07A 2ZRZA 5CC5A 1YBQB 5HNNA 2ZRWA 1C8YA 1DXEA 4IJBA 3CWOX 2J6VA 1A0DA 3B03A 2R1LA 4QCFA 2CBIA 4J28A 3CM4A 2PD9A 4WDXA 4O54A 4HNNA 4B90A 1GOQA 2ACRA 4FIRA 2D0FA 1EIXA 1RVKA 2VC5A 1KC7A 2PDGA 5M17A 4DBEA 4WJXA 3V0SA 3PBGA 4US6A 1CB7B 4IIGA 3PNZA 4LAZA 3CAVA 1KBIA 1E9YB 4QROA 3DFNA 2ZUUA 2CLPA 3LHWA 1ISWA 3S2MA 2IPGA 3K8MA 3S9IA 5CG0A 2ZZ7A 4GIRA 1XH1A 2V2DA 1ZHAA 5LIWX 2D3LA 2BASA 3ATYA 1QOXA 1K9DA 5FESA 4J9JA 3WNOA 4JEQA 3W1PA 2V5JA 2AOSA 2CU0A 2W27A 3SJNA 3MDUA 4HNLA 3DDMA 5I2UA 1OT1A 4DQWA 1XDLA 1P7TB 4MPKA 3KL3A 2C14A 3ZWTA 3HB9A 2OQYA 4I90A 1Z3NA 2Y70A 4QEEA 2ZVIA 2BY0A 3FSUA 3VXGA 4DIAA 1GWJA 4ZOBA 1SW3A 1NIUA 3SW6A 1ZPTA 3Q45A 2OZ0A 2HVOA 3TVAA 1DV7A 3AHXA 4NT0A 3BCFA 1A50A 3NXFA 2E9MA 6CGTA 2WMIA 1U83A 4V2XA 1R7AA 2VD9A 1H0IA 4HD5A 2ZXDA 3DI1A 4H9TA 2QMJA 2J77A 1PVNA 3E9AA 3SUVA 3AXMA 2W3ZA 4AZCA 4KIRA 3VNYA 1RA0A 4JTRA 3WKZA 1XDJA 4GCAA 1UUMA 4NNCA 2W4XA 5F7UA 4DJEC 4PMDA 3UWEA 3M43A 5DFAA 3WH9A 3OGSA 2RJGA 2Z28A 1YQ2A 1A3XA 5AVHA 4K1GA 3RRAA 4H3DA 3UJSA 1EIBA 2I1OA 4PN2A 1XYCA 4C6PA 1MDLA 5F4XA 3MKKA 4XISA 1BG9A 4IXXA 1K8ZA 3SDOA 2E5CA 3IIVA 5AZ1A 2BGSA 3M0YA 1PPIA 3HJEA 4IP4A 2Q02A 1UWAA 1OCJA 3TK7A 4C1KA 4EIVA 4PCTA 2QJIA 4J40A 5DCBA 3WLKX 4YXGA 2F84A 2FVMA 4OIFA 1MW3A 4JQ3A 3MDWA 2BVDA 4WIWA 3BO9A 4JX6A 1BYAA 3PC0A 2AKMA 3VFLA 3AIUA 4KEUA 1JDAA 3DG3A 4JHOA 4UCGA 4Q8QA 2YCLB 4C7FA 1W0MA 1F3WA 4J1OA 2CITA 2REQA 1R3QA 2Z1WA 4YL2A 3W2KA 4DY1A 3PK7A 1W9VA 3N2OA 4LVFA 4WKHA 3VCRA 3H2NA 3TU9A 5FA5A 3C3UA 3LPOA 4JY9A 1DWAM 1GVEA 5FF0A 3CB3A 1HP4A 4CNTA 4EOUA 1EO7A 1XH2A 1VEPA 3EGJA 4XKMA 1W3HA 1XYZA 1TJRA 3VKAA 1PSCA 5A8NA 2GVYA 4H6EA 1C91A 1JZ7A 1OFOA 4QISA 1I45A 5K2ZA 4O19A 1QHZA 3CMGA 1UYQA 1JZ2A 2JGYA 1KR1A 3W88A 5AC6A 3H7UA 3ARVA 4PCPA 5T9BG 1KB3A 1GG0A 3AHZA 4H9MA 1POJA 1I9CB 4LBRA 1BTMA 1FXQA 2VFFA 2FPYA 3RF9A 3H8AA 4GK8A 4JIIX 1AA1B 4H7VA 3QH2A 3TONA 4DB7A 3TA9A 4UR7A 2BXZA 3N19B 1IZCA 4NSBA 3SADA 1RA5A 1UR1A 2OWWA 3UF9A 4PB5A 4UZSA 3R8HA 5HJYA 1VEMA 4AIUA 2INZA 1O68A 4NUWA 2HJPA 4INFA 4UTWA 1KRBC 3UWVA 1TQXA 3AMGA 3B8WA 1NF0A 3ANVA 1CLKA 1NTHA 2C1GA 1VEOA 2VWTA 2D2GA 4P8XA 1SO5A 2A79A 3GSMA 5DMNA 1OB0A 3HU7A 1KQZA 1P6WA 1L6SA 4L5ZA 1CGVA 1L0PA 5F1UA 3FS2A 2QEZA 3PWIA 3HZ3A 2GPTA 4H7CA 4QJ3B 1FXPA 5D32A 1TV8A 4X2PA 3VMNA 2ZDSA 3LI1A 3WSUA 2WLYA 1H11A 2GSEA 4GKTA 3K13A 3T0AA 1TPWA 5E6YA 3GNOA 4JICA 3CNYA 2D3NA 3KRUA 4JTHA 1EP3A 3FW6A 4DX3A 1H5YA 3T81A 3ENLA 4WJEA 4DWSC 4G56A 4XD4A 1AZ2A 4C6EA 3ZT5A 1V5XA 4DJFA 5FJIA 3NYDA 4EF8A 2PEVA 3TYZA 2O92A 4Y7EA 3MUY1 4IOTA 3E1F1 3R8GA 5DY3A 1QNPA 1M01A 4WSHA 1V0MA 4HB7A 4H9YA 1DVJA 5FJTA 3WLSA 1HT6A 4L1WA 3ONCA 4LUTA 1BGAA 3EX2A 5IDIA 1EZ2A 3PUOA 2E6DA 3ZWSA 1HF6A 2MNRA 3C56A 4IL2A 4M7TA 5C8BB 4UTLA 1UKQA 2PWVA 4PMNA 1IZJA 2GGGA 5JMUA 2GQ3A 1M68A 4LVDA 2DH3A 4RW3A 4EE9A 2Z2UA 1F6PA 1N8WA 4H6QA 4XVDA 1AMKA 8XIMA 2DVUA 4KPLA 4TVCA 3R2GA 1ZBVA 4UQDA 1V0NA 3GH5A 1JCXA 4RZ6A 4TMBA 1TO3A 3W73A 4HYRA 4LAMA 1H7XA 2V3EA 4PCNA 4ECLA 4FI4A 3CIWA 3BE7A 5I07A 3PG8A 5G4WA 1WDRA 2DIKA 7REQA 5D2XA 4F3HA 1TVNA 3SQMA 3M0XA 3MWCA 3H23A 2FGBA 4H9UA 3BOFA 3GVRA 4A35A 4U2YA 5GJMA 2CEQA 3ALGA 4TUFA 1CXEA 3G1DA 2JF7A 1QT1A 2XVNA 3WUEA 1JDDA 2VZVA 3CUFA 3OLGA 2WCAA 3WNPA 1EP1A 1PZ1A 1B4EA 1BSLA 1SYTA 1AH3A 2AL1A 5LGXA 4JCMA 1MMFA 3LCHA 2ESCA 4ZL1A 3DFSA 5C55A 2ZE0A 1TYGA 2Z25A 1ECEA 5LIUX 5A2BA 2PP0A 3D3AA 3MKVA 1E71M 1S5TA 4DHGA 1JQVA 1MNSA 3K4WA 5A6BA 3M64A 2DUZA 4IPLA 3M1ZA 3UBPC 2VEMA 5FF3A 1H1ZA 1XL9A 4KF1A 1E0TA 4PMXA 4R9OA 2JK2A 2NQZA 3EWDA 5JVLA 3I10A 3TN5A 1M41A 3N6HA 3E5PA 1V7YA 1PHWA 4QS6A 1ZS2A 2WVVA 4JTJA 1FH9A 1XXXA 3SQSA 2J47A 2Z1KA 2GJRA 2PTZA 2AAMA 2XIJA 4TTGA 9XIMA 3ONBA 1EOKA 1XKYA 3R79A 2ZRVA 2WC3A 4CD5A 1VHNA 3JUGA 1XRVA 2E9BA 3S9ZA 1MSSA 5E70A 5C9ZA 3VIIA 4PEEA 3WK2A 4JGDA 1QATA 4IP7A 1R3RA 4PA8A 3G6MA 1EJRC 4UQAA 5AC7A 2XH0A 3TQPA 4P5UA 3W29A 4ZXOA 1GOOA 5AYBA 3C2OA 4Z0SA 2QS8A 3W6MA 2OU4A 2IS7A 1GKPA 1W3KA 2O4QA 4PMRA 4JOMA 3URAA 3N34A 4OUEA 4P8WA 4A8NA 4IQDA 1R46A 2DZBA 3VNJA 1WNOA 5BZAA 1NFPA 4C5YA 2V0TA 3MP4A 3I7QA 1XYMA 3FIGA 2ACQA 3BMXA 3UWZA 3RCYA 7TIMA 4ICMA 3T8QA 1DJXA 3O2LA 1KXTA 4GGBA 4IQEA 3G5EA 4MB4A 3SRKA 5JBEA 2Z00A 3M6DA 2VP8A 5IDZA 3TYBA 4GY1A 4S3EA 3BH4A 1YW1A 5E9AA 4LRSA 3LRLA 4GCXA 5DCDA 2FQIA 3W84A 3R89A 3HA1A 3HOJA 3STCA 3TNOA 4O50A 2KX9A 3ITCA 4LC6A 4Y8EA 3N2XA 4HCLA 4LT9A 2HVNA 4ZODA 3N4AA 1TPEA 2WK2A 4N42A 3BAWA 4YNGA 3UERA 4HN8A 4NZFA 3KDOA 3M0LA 4MGGA 3CEUA 2G37A 1VJZA 3EXRA 4L4OA 5CH9A 1X96A 4EP8C 3AIBA 1UPMB 5DX7A 4XZ9A 1RPKA 3RCNA 4C6FA 3BAXA 1A5UA 1PX8A 2VFEA 2D22A 4IPPA 3W1RA 3PPHA 3GNPA 2GL5A 2PDYA 4JTSA 4HQVA 3B9EA 3MU7A 3N9KA 1PZ3A 4MY8A 5AKQA 4RDZA 5H1WA 3VIMA 2ZUTA 4ZR8A 5A3HA 3SY8A 4J3XA 4GIAA 3T4WA 2YL5A 3AHVA 4A2SA 4A3RA 1NQKA 5D9OA 4WCJA 4PC8A 3MZNA 3VI2A 1W1VA 2OT1A 4QEHA 1YYAA 4JX4A 1G5AA 5HWMA 4HJFA 3GBEA 3W1UA 4W8LA 1Z41A 3OZYA 3DZ1A 1CGYA 2WLZA 3EXSA 1RLCL 3MV11 2NSXA 1GZJA 4U5IA 3G1XA 1EEPA 3R25A 1JD7A 2NUXA 2A3AA 2V8ZA 2B7OA 1FWCC 2X8RA 3J7HA 1E15A 3PPCA 1OK4A 1M7PA 1XLDA 3OTRA 1ZL1A 3TXVA 3FKRA 2WVSA 4WSKA 3WEZA 1DWHM 2DSZA 5LNUA 4F2UA 1DIOA 3EPNA 1LG1A 3BSGA 3P5YA 2JKEA 3F2CA 1QPRA 2QHAA 2YKKA 2QLYA 4A8IA 1Y65A 2WPBA 1X39A 2P50A 2EPKX 4J3VA 2I17A 1EX5A 4OOUA 2E0PA 3POHA 3MSGA 1QBAA 2PC8A 4MAVA 1XPYA 1EYWA 3MW7A 1RZMA 4HIBA 1A4LA 4LUJA 1GW9A 3V0UA 4GY0A 3C61A 4JX5A 1OGGA 3IGXA 3KW3A 4YLWA 3ZLFA 1Z42A 2Z1XA 3QTPA 4GHRA 2QVNA 3H4GA 8RUCA 4QG6A 4X9SA 1LOQA 4L6DA 1SZNA 4XQ6A 1OSEA 1GPWA 2JKPA 1TIWA 5BW6A 4AD1A 5AB3A 3ERPA 1DPMA 1OF8A 3SR7A 4MB1A 3GDTA 1JZ5A 3IANA 3LBCA 3IJLA 5BXRA 3MV01 1DBTA 5LIYX 1SGJA 3QHNA 2ZC1A 1A4MA 3GY1A 4PMYA 3KVMA 3ABRA 4Q4PA 2RAGA 1PWLA 1BWKA 5TF0A 1YPXA 3VZXA 3W07A 3KTCA 4TX9A 3F5KA 2X2GA 4ZOCA 3WEOA 4MWAD 4WEVX 4LH8A 8TIMA 2C18A 2A6NA 4UOJA 4BQ3A 3C2FA 3F2DA 4AIBA 3H53A 4QDWA 2XZ7A 3V7PA 1B0IA 1W9PA 1QW9A 2I9UA 5D02A 3MI2A 3ANUA 1C8QA 5FIPA 3P62A 3L12A 1KCZA 3KOZA 3C2YA 1UR0A 1X1NA 3O63A 4FNRA 2WSKA 5EBUA 4UTFA 1CGUA 4BQ2A 1E9ZB 3UZJA 2OYKA 2D0HA 4NNAA 2J8GA 4XIAA 3AWOA 1DWIM 1KXQA 3EMQA 4NJGA 1RAKA 3ZXWA 1W1IE 1Q5MA 2X7WA 1AQFA 3VYLA 1V77A 3THCA 4PTMA 2F61A 3ARWA 4GI8A 3IJ8A 4HPNA 4H7ZA 1E6ZA 1AK5A 3W1MA 1NOWA 1OBAA 4FNSA 4S1FA 2EBNA 1DTUA 1C90A 2VTFA 5AC8A 1XBZA 3WF4A 4DNHA 4XD5A 4AHPA 4AX6A 4LNYA 2ZICA 3PY2A 1HN1A 4JS3A 2WJFA 1W3JA 4E2OA 4OUIA 3BVJA 1Q66A 3ZO9A 3CUZA 3FKKA 4C1NB 4V27A 3VC5A 1KM5A 3AROA 4UCFA 1W56A 2BOEX 3ZR6A 3OG2A 2E25A 3VDAA 3S42A 1K8CA 3SGUA 2C7FA 2GGIA 4DVOA 3STEA 3GHTA 3MMDA 1FFQA 1FWJC 4UTTC 1SQ7A 3AUOA 3P61A 3K4DA 1JZ4A 5A1AA 1VD6A 4D6CA 1DXIA 2Q3OA 3W7GA 1ICPA 5A6LA 3U4FA 4YJ5A 1QPOA 3UNDA 2GDVA 4HZ8A 3MZ2A 4ADUA 5EGRA 4EANA 3IV8A 3WMSA 4HYVA 3AIRA 1YX1A 4CU8A 2D2OA 1LLZA 1Q4NX 1JPHA 2VGBA 2P5NA 3H22A 1M65A 2YYTA 3GXTA 3KRZA 4NL1A 4NASA 3TUUA 2W79A 4H6KA 5BOFA 2E77A 3BWWA 3OVPA 1Q65A 2UWFA 3WJZA 4E38A 1RXOB 3WO8A 1GPFA 5I7GA 2NVAA 3TJ4A 3SSZA 4B4FA 2PBGA 3LTYA 1HKKA 5DQPA 4H8VA 1N8FA 4YTUA 2ZOXA 5G2WA 2YB4A 2O9OA 2YBTA 2QIIA 7A3HA 2E68A 4B15A 1QRQA 1VYPX 4J35A 4X0NA 4CD7A 3NG3A 4OQVA 5CEWA 1TCDA 4QITA 3LXBA 1CDGA 4S3GA 5KZDA 2Y7DA 3PZGA 1WDSA 3ABQA 3KBNA 1BKSA 3PBYA 2G3MA 3VOHA 4XBSA 4O16A 3UZYA 2GQ9A 3AIEA 1IEWA 1A5OC 4IL0A 1JPMA 1NSJA 1TMHA 4S38A 4TU1A 3HV9A 4ZFMA 4MFEA 1TPFA 1K4GA 2A85A 4Z17A 3ALFA 3N14A 3W81A 4WF7A 1OK6A 3KRBA 3NSXA 3WQEA 4QG8A 4FNQA 4TV6A 1S1RA 2J8TA 1GEQA 1RV8A 3L5LA 3MMTA 1R38A 3SN0A 2VNCA 1TZ9A 1X97A 3AYTA 1E73M 1OY0A 1AUSL 1V6XA 3GO2A 3VOFA 4G7EA 2I5GA 3THAA 2A3HA 3FDKA 3UYCA 3N3MA 4HSNA 5ENLA 1BQCA 1RUSA 2QGHA 3URBA 4OTKA 2VWSA 1X38A 4B3KA 2BB0A 4G5DA 3VM7A 3M0JA 4NF7A 4AZ5A 4IQJA 4A21A 4YTTA 4NU7A 1AQHA 5GJNA 4XSLA 3RO8A 4HOZA 3CAQA 1P6BA 3TC7A 3QSTA 1E6QM 1UKTA 1CXIA 3HPAA 5JIPA 3PBMA 5IBXC 1KWKA 4ZB5A 2JQXA 1R47A 1PUDA 4MUPA 3LSCA 1A3WA 1LQ0A 1YDVA 4HPHA 3EPOA 1RALA 5ABGA 1VJIA 1EPXA 3L65A 2YX0A 1MVYA 2WOQA 1E3ZA 3S2LA 5HQLA 3MI3A 1Q13A 4YU1A 5E0KA 2GUBA 3SN4A 3O06A 3BLOA 4I9MA 1CXKA 3W4RA 1CECA 2ZKMX 1XLCA 4H9ZA 4ML4A 1ONRA 2FLIA 1WBJA 3UR5A 1NDVA 4I9TA 6A3HA 1F76A 1NWSA 4B3ZA 3O9NA 2XSBA 5M5DA 4O10A 2ZTJA 4CNUA 2V3FA 1KA9F 3GNXA 2QUVA 3TN3A 1G4SA 3E02A 4FO4A 2Z1SA 4JTTA 4IG2B 4FNUA 2PRHA 5LYRA 3U2OA 2BWGA 1XFCA 3QFWA 2I56A 3GRIA 3LQGA 1TRIA 1W6TA 4KRUA 3SCPA 1IIGA 4O18A 2E4TA 3TC6A 3GHSA 3QSRA 2OX4A 4C7DA 2X0SA 1XINA 1THFD 4KBXA 5JH1A 3BK0A 3SFKA 4REQB 4MLJA 3VCCA 3HFYA 2HVMA 1BYDA 3MA8A 5I06A 3R11A 3UCCA 4KEMA 4GD0A 1A5KC 1Q85A 3CPGA 3OLEA 3CLWA 5ECVA 4GKLA 4O53A 2J78A 5CPTA 2QPSA 3FJ6A 2V3GA 2ICSA 1OZMA 2ZRYA 3DFQA 4XZBA 2NXIA 1I0DA 3RX3A 4LAUA 4MJ2A 2GUYA 5CG7A 2XGZA 1LBMA 2ZFAA 3Q94A 4HA3A 1UROA 3A9IA 4U31A 4MWAC 3DHDA 4LUYA 2XINA 5AYXA 4BEUA 1VCVA 3TQVA 3U5UA 2V5KA 3MYPA 1Z69A 2VCAA 3VFCA 1YBQA 4RPPA 2G4JA 3KS6A 3I6TA 1Z6KA 3RN6A 1PEZA 1G0CA 4LYKA 1FHDA 1OCNA 5DMMA 3IVTA 1XGZA 1JXKA 4AWSA 5HQMA 4QSHA 3SM0A 4W7WA 2VKZG 1L6YA 5FEWA 1RCXB 3UA4A 3COTA 1W5PA 1CW2A 1R9ZA 1WKDA 4XZLX 2OOFA 2DVXA 4N9DA 1QOPA 3ITGA 3MP5A 4YYCA 2YFOA 5EFDA 3KOYA 4ZOAA 1PDYA 3CUXA 5JIWA 1TELA 1RY8A 1KLYA 4QG9A 4P7OA 3RMJA 2NQ5A 3AQUA 1N2VA 5EY5A 1M5WA 4QAWA 4BQ5A 3WLTA 1QBBA 1P0EA 2QR6A 3W22A 1RCOB 3G8RA 5D8ZA 2OODA 1EEXA 1D3GA 1XX1A 2DW7A 1KBKA 5CJNA 2PD5A 1RD6A 4AZIA 3TJXA 2CBUA 1KRCC 3N6JA 4C6CA 3WLLA 3LZ3A 2NT1A 2W67A 3WQGA 3DG6A 4JXCA 1EO5A 2HPIA 4AXKA 3TFCA 1J4EA 4QXIA 3JU2A 4JFTA 1LWIA 3KWSA 4C6IA 1ME7A 2AKZA 3ARRA 3W7KA 1SZGA 3D6NA 2DSWA 3NZRA 3UY7A 1QPNA 2FDMA 4UC5A 2PDIA 3NL6A 4OJYA 3NXLA 3EOSA 2WO5A 3JRKA 4JTKA 4QTGA 4JQ2A 2V38A 1A5NC 5IFTA 3NUKA 1JUEA 4NXKA 3E0LA 1A80A 2E1DA 4ENLA 1ZBKA 4C6DA 3IIOA 5A8OA 4QE4A 3CO8A 3T0TA 2QDDA 4HPJA 3LMZA 3BJFA 1YLVA 4Q8PA 2R94A 5BNKA 2P53A 2J4GA 1TV2A 3GVWA 4RE4A 5I79A 1T8XA 3MC5A 4HA0A 2NSOA 3IS4A 1XC4A 3I4EA 4ATWA 1V6VA 1QPQA 3BG3A 4JL2A 3TQ0A 2Q71A 3WQDA 3TYDA 4JIQA 3T1GA 2G5WA 2WNQA 5HOSA 3RPDA 2P10A 5HMFA 1JCYA 4Q4QA 4IMEA 5F4SA 3L9CA 4PEKA 2XFRA 1TWZA 2CHOA 1XLBA 2NXHA 4PMUA 2PPGA 3K8KA 4WX2A 4D72A 4GA8A 2PFHA 2YCLA 1UWTA 3E2RA 5A6SA 3QF0A 3PJUA 4MF4A 3H4WA 3AUJA 1W9DM 4MZYA 3INPA 1F07A 3LB0A 1F8MA 1F61A 3JVAA 5EMYA 4PTNA 2PDFA 5DRIA 3DFYA 2D69A 1NWUA 3PTDA 4FLOA 4W4QA 1CNVA 3WQOA 1Q63A 3S1XA 1VFSA 4LX4A 3QC3A 1UD8A 1SJDA 2FGLA 1UR8A 5J04A 3TW9A 1VLWA 4UTKA 5DBTA 5G4HC 1VBGA 5D9NA 3W37A 3M41A 4Q8MA 3VNKA 3CL6A 4UMBA 2YPIA 4WD0A 2WNNA 4E2DA 4O1EA 7ENLA 2QJHA 1FDJA 3GXDA 4B3LA 3B04A 3UGRA 3SSJA 3GC2A 3DYMA 1XGEA 4MIMA 3TMQA 4R27A 1QNVA 2Y61A 3P60A 5BROA 2Y89A 4QLLA 1X1ZA 3V5CA 2WWCA 4BK9A 5AYYA 3HG5A 3GR4A 4UFHA 3DENA 1GEHA 1DQWA 1Y0EA 1P0KA 3BQ6A 2Y24A 3DHUA 4FIQA 3S1WA 3VNLA 3UPWA 2DJLA 3HFTA 5HNTA 4RNHA 3LI0A 4AHOA 2HS8A 5K3VA 3STPA 3HTWA 1OG0A 4ML9A 1OQFA 5A2CA 2ZQ0A 2C0HA 3S2CA 2OCZA 5FKYA 5FL1A 3VDHA 4LYRA 1O1ZA 1FDZA 1ZBCA 4YS1A 3B97A 3H24A 1GZGA 3L4ZA 3UXKA 3KCLA 4XV0A 3UWQA 3WMBA 3PZIA 4L64A 3NSNA 2YL8A 2INFA 4KWOA 4ZFCA 5JBDA 3A64A 4Z1BA 5AFDA 3NPVA 4RJEA 5KEZA 4ROPA 5G2HA 1CWYA 2ACSA 4PZVA 3GFZA 3LV5A 4XAFA 1C7TA 3SI9A 2QUNA 2DFAA 1XICA 2UY4A 3OHMB 4IIHA 2NWSA 3G3DA 5LIXX 3MBFA 5K7JA 2RKXA 5BCAA 2VHLA 3W1NA 2EO7A 3QZEA 1W2VA 2HWGA 3B8VA 3BARA 1GKQA 4CVWA 1ITXA 4LJ3A 2HROA 4GQBA 4A3HA 2YDAA 3KHDA 4FB7A 1E72M 2WJEA 3WUGA 4W85A 4NX0A 5KZMA 4NZ4A 4FEZA 4LCSA 4KWSA 1XLMA 3GDMA 3LNMA 3KWXA 1KM1A 4QQUA 3PWGA 1WZMA 3BG5A 5EMLA 3LSBA 2QYGA 2D0GA 1RD5A 1UR3M 1SSDA 4FR6A 4W86A 3L2LA 4XZNX 2OSXA 3LQLA 5D03A 1XIEA 1P0NA 3MQTA 1XD1A 1R6WA 3M5XA 1E4LA 5IRPA 4NNBA 3MUAA 1HGWA 4UNLA 3A3WA 2WZTA 3UP8A 3ZR5A 3BG9A 3JR2A 1V08A 1BD0A 2IXUA 3WZ0E 3OA3A 3VX1A 3B8TA 1VPXA 5TAOA 1XQLA 4K39A 4LGXA 1GVFA 2PU1A 3FA5A 2EF9A 3FVDA 5CGMA 4QLKA 4DJDD 1KBLA 2DZWA 5I00A 4K2SA 1FDYA 3NQ8A 4PTWA 1DWGM 1E4MM 3NZPA 3TR9A 2R9RA 3PSVA 3V4BA 3OYXA 1W5QA 5E9XA 3EWBX 4NAFB 3ZR4A 3T40A 1FWTA 4GXMA 4GQ0A 1HO1A 2NX3A 3HG4A 2OR2A 3JW7A 1RCQA 1WUEA 3AHTA 1BRLA 3SCUA 3H70A 4MFDA 4DXKA 5FF2A 4JFUA 1WB0A 3WK1A 4MAZA 4NJJA 2QUTA 1XG4A 3USBA 3UESA 3L4TA 1TV5A 1XCFA 1EJWC 1H7RA 1Q6EA 2GVLA 4CEUC 3FJNA 4S23A 3A6OA 3WDHA 3D46A 2VXNA 1WX0A 4L4PA 3W1AA 2A3BA 3CYVA 4UTTA 3GVVA 3W2UA 1YDNA 5CJMA 1ISXA 3ES8A 1QW8A 3A13A 3GG8A 4ICCX 4FA3A 1PV8A 1V03A 3DYOA 5JBFA 5E0CA 1CGXA 3GYCA 4DO6A 1ZZMA 2NQJA 1RSCA 2AGTA 1BTCA 1R85A 3FEQA 3CASA 2DT1A 5HINA 1B4KA 1DORA 1XBXA 1PIGA 3R13A 1OJXA 1R3YA 5FJJA 2UY2A 3QPEA 1KXVA 5F2MA 2CW6A 1TB3A 3H7VA 1UCWA 3L0NA 1R9YA 2FPTA 3AS1A 4AZ7A 4QE5A 1A0CA 3LHUA 1FWBC 4DXXA 3O6AA 2CYGA 3DC0A 2DVTA 4Q33A 1HVXA 4GX9A 3VKJA 1XHGA 2GK1B 1GHSA 3RYSA 3NQEA 4EKJA 4XZIA 5T91A 4CQAA 3LU2A 3SEPA 5A6JA 2PGWA 1TUFA 1WKYA 4XVEA 5HK4A 1V6TA 2IPJA 4NZ1A 3NQVA 1R87A 1G94A 2A2IA 2H3BA 3MKCA 3H6OA 2IW0A 3LENA 1QDSA 1WZKA 2XN1A 2O9PA 4BQ4A 5AZ0A 1VYSX 2IUZA 2R1PA 1LP6A 4WZHA 3Q2DA 2ZUSA 1EGZA 4J4KA 4LS2A 5AHMA 5CGTA 3T2PA 4K7VA 2W0UA 2ADAA 3SRHA 4IPNB 2XGIA 3STFA 3HQNA 3THQA 4EPBC 1SFJA 2G50A 4FLRA 4RV8A 1E9LA 1FBAA 4KH2A 3SBFA 3THDA 4A4AA 4DYJA 1ELSA 3KTSA 3R0UA 3VIPA 1LL7A 3N3TA 5CGQA 3WMCA 3TYAA 4HNUA 3OO2A 1KGUA 3URQA 3F4VA 3VIKA 2V5LA 3AC0A 3MJYA 1GVOA 1REQB 3M5ZA 3S83A 4GYKA 1QAPA 2RDXA 4CNOA 2XSAA 3P6LA 1AJ2A 4HT3A 1K9FA 1B3OA 1NM9A 2OWXA 1CTNA 3FLUA 3ABSA 4MJZA 1AW2A 2G4FA 1IGWA 4ZMGA 3SB0A 1R3TA 1ZBWA 4L9ZA 4HU4A 2VX5A 4CN4A 5AC5A 1RK5A 4GQRA 1GGOA 4Y9OA 4S2BA 4GE8A 2VURA 2FHFA 1FWEC 3PAOA 2TSYA 5K9DA 2XVPA 1WOBA 5IBXA 4AY1A 1NDYA 1T6MA 1UZ4A 3DX5A 3C52A 2VOTA 2VD8A 3RU8X 4E8GA 2DT3A 1EHAA 4UFLA 3WBAA 4DYKA 2PDJA 3GIQA 4E6MA 3G1FA 3SIMA 2DW6A 4QSFA 4LS0A 2TMDA 1CEOA 3BLDA 2WSQA 3W7DA 4UXDA 1AFSA 1J6PA 5EMKA 4J3UA 3YPIA 3BJTA 4YVVA 1VPYA 3QGVA 4X2RA 2PTXA 4YWSA 1E0UA 4BJHA 1XLHA 2NXGA 1HJVA 2VVNA 3STGA 1M7JA 1GVSA 2RDTA 1GT8A 1NP0A 3WJSA 3F5LA 4AFYA 3B9NA 1R30A 1Q6RA 4U33A 4CNSA 3N9RA 3L4YA 4UQBA 1AODA 1LL6A 1IWPA 1RJRA 1EJSC 2J25A 1H0GA 3GH7A 3E5BA 3TX9A 5BU6A 3R4IA 1JIBA 4QCEA 2BDQA 2OTDA 5BMXA 1VF8A 3N4FA 4S3KA 4IX2A 4W5ZA 2X0YA 4JQ4A 4Y90A 3UPBA 1VP5A 2OEMA 2GLKA 2R8WA 5ABTA 4JTLA 2J8FA 3WY1A 2CLOA 2P3EA 2RH9A 4HK6A 5B7YA 1DOSA 1P5BA 3GXPA 1M04A 1W5NA 3PN8A 1V3JA 2IKHA 2VI0A 3PP7A 4BS0A 2E8ZA 1U1HA 3L2IA 4KMQA 1XIJA 2XDFA 3QJAA 1JG9A 4C6KA 1GTEA 1ADDA 1P0BA 3UZWA 2YIHA 5HA7A 1X7IA 3BCJA 1F4AA 4W8BA 4AX7A 2CLHA 2Y8VA 1AQ0A 1HGYA 1ICQA 4QP0A 3LY0A 3GTXA 1VPQA 4PMJA 2ZZ4A 1ALDA 2Z1VA 2PMQA 3VX0A 4DUOA 1QUMA 2FJKA 1S2TA 3F1QA 1A0EA 2DH2A 3TP4A 4MWAA 1K9TA 3ITOA 4DF2A 1D2KA 2AL2B 3W38A 3WQ4A 3MHFA 3GIPA 1K9EA 4HCHA 4QNWA 3EKGA 2Y5SA 3VUSA 3V36A 4L6OA 9CGTA 2XIIA 3FY1A 1T7LA 5HMEA 2Y8KA 5CLWA 2YA1A 4N2YA 5IHSA 2QAFA 2CZDA 3OPSA 1A5AA 1R3VA 1RQHA 3NGFA 2PF0A 4UIOA 3GXFA 3WF3A 2GJXB 4LU0A 4HNVA 4ZB2A 1B5TA 1EUAA 3W74A 3B8DA 1I2NA 4O1DA 3P81A 4MPQA 1V93A 1LRNA 4I9JA 1TSIA 2O0TA 4UFIA 1TV3A 3TA6A 5MF5A 3OB8A 1UBPC 3DG7A 5HR6A 3ZT6A 2PP3A 4YTQA 4RK8A 1XSJA 4PUDA 2G96A 2VCCA 3AXKA 3VGBA 3ITTA 4RDWA 1L8NA 4XAYA 5G1MA 3VIOA 5HAOA 1YTDA 1EBGA 3LMYA 4RNJA 2WZIA 2OO0A 3VKKA 4UTMA 5BU9A 1BXNA 3ZZ1A 2ALRA 4PFHA 5I3HA 3WN6A 3GXNA 4PRWA 4JCLA 4YCPA 1W8GA 4ZA0A 1EQCA 3VIGA 1ECQA 1XYBA 2DQXA 2FMNA 2DZVA 4ADTA 1K1DA 4C6QA 2YLLA 4UTWC 1E6XM 4TX6A 3C2VA 1EXPA 1TWSA 4HBKA 1XCWA 5MHBA 1GJWA 3TOYA 2W66A 3BV7A 5H8MA 1SZEA 3MY9A 4C1NA 1YXDA 4C1LA 1QNSA 1ADSA 2FHCA 1LBFA 2C0AA 1Q8AA 1LQAA 4A6GA 3ISIX 2HBVA 2ZYFA 4B5TA 1RPXA 3FCPA 1H62A 5LZLA 4GVFA 4DZHA 3U4AA 3A4WA 4ONVA 2DJXA 1Q2RA 3C8NA 1WXJA 1FWFC 3KXQA 3NSMA 2IQ0A 2VFHA 1TVLA 1PYFA 1W17A 3HJZA 1HKMA 1JPKA 5H6HA 2NWRA 5AYZA 3QMSA 4CU6A 4JIEA 2VO5A 3N25A 3KOWA 3FGCB 4FXRA 4LS1A 4E0CA 4DJFC 2OKOA 5AYIA 3KZSA 2E7FA 4QDMA 3QYQA 3CHDA 2PDUA 4Z1YA 3N9SA 1UD5A 5XINA 4YVXA 3IJDA 1EF3A 5REQB 4LAKA 3N2BA 1O12A 4MNKA 4EX4A 1QR7A 3C3NA 3H2MA 3FNDA 1HXJA 3NDYA 4OOZA 3OGVA 1JR1A 1KM2A 1BWLA 5ABHA 1LUCB 4ATDA 3WNLA 2YXXA 2X41A 3QR0A 1UOKA 3PG9A 2CLKA 4RCXA 3RPMA 1S3HA 1V3LA 1UR2A 1Q6CA 4R7WA 2HRWA 2HBXA 4QM1A 1VGAA 1I0BA 4LUSB 2IKJA 3GR7A 2QDGA 1OYAA 2W9MA 4D8AA 1OYCA 2GWGA 3WH6A 3A24A 5LA2A 2PWUA 3WD0A 5PTDA 3T55A 1J0JA 1KBBA 3CUGA 2X09A 1E70M 4B2DD 1IT8A 3O07A 4DZAA 1DJYA 2WVTA 3G24A 1OEPA 4IH3A 1QI2A 3MO4A 2J66A 1JCNA 5J5RA 1JZ8A 4JTQA 5CPLA 4U28A 5DMLA 5TQLA 1DJZA 2H9AB 1UUQA 2OG9A 2J24A 1KCLA 4U2ZA 2BS9A 1JDFA 4HKPA 4ADSA 1JNEA 4ZVJA 4QS5A 3M7SA 3VIHA 2UZ9A 1D3CA 3RMEA 2FZMA 4J27A 3PFRA 3PPGA 2Z27A 1EP2A 3F03K 4K37A 3E74A 5HMDA 1WOAA 2Q3RA 1HJUA 1XDMA 2WCSA 1ENUA 1DWFM 3LCLA 1D3HA 2PI6A 4PUNA 4A29A 3WK0A 4I8YA 3EWYA 3VD9A 4OBRA 4AG0A 1ISYA 3HGRA 3BLKA 4MDOA 2NW0A 3A22A 3GK0A 2PUZA 3LX9A 3RX2A 1SMAA 4KIEA 2PDKA 3OP2A 4IXHA 2J9XA 3BXWA 2YA0A 4NIRA 2P1FA 4MY1A 4JTAA 4NJHA 3M07A 1TFVA 3IAPA 1BG4A 4HTBA 3PUDA 2CHNA 1UIOA 3BOLA 3GZAA 1QWGA 2XG9A 2XFYA 3JZEA 1IIHA 1DP0A 2O9RA 1L2UA 1IT0A 1XIHA 4EAMA 1OABA 1PIFA 3E2VA 3AFBA 4A3YA 2PDPA 4KGJA 2CWXA 4LF1A 3FA3A 4GLEA 3ZJ7A 1KM0A 4IG2A 4POCA 1WCGA 3TTOA 3ABOA 2ZZ3A 3LD5A 2QUUA 3DFTA 3QV7A 1A5MC 2CLIA 3C0JA 3RIKA 1MRAA 4I5UA 3DUGA 4O1FA 3N18A 1WKFA 2QCDB 2XVKA 4PUJA 4LXFA 5DANA 3G1AA 4TIMA 3M46A 1KFWA 3UWWA 4OECA 3CAKA 1T40A 3CAWA 2HMCA 3QFEA 1MZHA 3M44A 1ONWA 1UZ1A 1JF5A 3SRDA 4LCRA 4Z2JA 3W7QA 4LFYA 2HDJA 1WDPA 1PTAA 3WLIA 1AH4A 1VKFA 3TJIA 3UXLA 1ZJIA 2Q01A 1Z8AA 2Y5EA 1YHTA 3CO4A 3TFXA 3CH0A 2E09A 1TPVA 1CENA 4ZTYA 4O11A 3W86A 4Q8TA 5G2IA 2YZ5A 5DT5A 1Q8JA 4EVZA 1AZ1A 2BGNE 1V3KA 1I2QA 2FJUB 2A1YA 4HNTA 3PBVA 4D1IA 4FX6M 2P0OA 3KBWA 2GJPA 1LBLA 3R6IA 4IHCA 4Z2GA 3NPXA 3WCZA 1RBOB 4UNIA 1KW1A 1M6JA 2VQUA 1OC7A 2ZZ5A 4GABA 2TRSA 2CHRA 4GZIA 3UJ2A 1DHKA 4UWMA 4DM2A 1XM3A 3H2FA 3EWWA 2UBPC 4AEEA 3M0KA 4ZSUA 1WQ5A 3RHGA 1Q6FA 3QV9A 4JIHA 4TMCA 1OFBA 9XIAA 3PZUA 3MYOA 4E2BA 1JVNA 1POKA 4F0SA 4WQ6A 1V0LA 2OQHA 2ASHA 1I1WA 2WZHA 4O28A 4AUBA 3UR7A 2DU2A 3FXGA 3T0CA 1W31A 2OLHA 1DJWA 2V3DA 3TCSA 1XWYA 1KWGA 3KLKA 4V1YA 5CJ5A 3C5QA 1E0VA 2WKLA 2J9YA 3NA8A 5IM51 3MP3A 7TAAA 2Z29A 1JDEA 1J0KA 3M0IA 3CPUA 3GNRA 3NTYA 4NX5A 2QGYA 3VNZA 3CYJA 5I03A 1MW2A 1I75A 2WMIB 4CQBA 3GE7A 1XG3A 4YHGA 1CCWB 1DXFA 3W7OA 1OHLA 3WQPA 2CLFA 1R0MA 4Q7NA 4KRZA 1QXLA 2I57A 1PE1A 1CXLA 3BLPX 4IPJA 2NZLA 6ALDA 3QTGA 1JGMA 2JFEX 4H00A 4OBSA 3WG6A 1XFBA 2PDMA 4G9PA 4OT7A 5A6AA 2ZX8A 4D8LA 5EYWA 5LXXA 3KEHA 1L8PA 1OFEA 1MXDA 2CKSA 3EXTA 3IJ7A 1JQXA 5A8MA 1K3UA 1TWIA 3FOKA 2PWFA 4K36A 1JZ6A 4E4FA 3BTNA 4F2TA 3OOQA 3DN5A 4HHLA 2D20A 3FFSA 2HQAA 3QXBA 2GJLA 4S3FA 1OM0A 3TYUA 5XIMA 1GOIA 2FB3A 3H26A 1NELA 1HX0A 3B8UA 3BGAA 4D9PA 4A3UA 2CIPA 3LLDA 1DJIA 4V15A 1SO6A 1E1CA 2Q8ZA 4K3ZA 3AMCA 2ALDA 4BF5A 3LXCA 3WDJA 1NF7A 4NZ5A 1M7OA 1J5SA 1KLZA 3P5ZA 4JEJA 3M5VA 1PIIA 2H8ZA 4TVUA 1UD3A 4ZCWA 3CB8A 1OC5A 2VX7A 3QV8A 4DPQA 4HP5A 3CV1A 4NYUA 2REQB 3EAUA 1XF0A 4B5WA 3IIPA 4AD3A 3QOKA 1TG7A 1VC4A 1B57A 3NQFA 4KQNA 4DNMA 4NJKA 3QC0A 4Y9MA 4RE3A 1V3MA 4MNLA 3QMRA 1MWOA 4KT2A 4Y6GA 2DT2A 3ZVHB 3RJYA 2HNEA 3TLQA 3IVUA 1SW0A 3OIXA 3FJLA 5BXSA 4JTCA 1QMLA 2PDNA 3NZGA 4ACYA 3FXYA 4WOQA 1MO0A 2Y85A 3ZJKA 5A8QA 2OOGA 3ARTA 3HQPA 3T2OA 4LB4A 4ERAA 3WF0A 2D23A 2VVSA 2WCGA 1H3GA 1OD0A 3BAYA 4L80A 5T9CE 3LEPA 4JTUA 1S5VA 3PZ9A 3CZGA 3LLFA 4RZ5A 2C91A 1BAGA 3EX4A 2E9LA 2C6QA 4Z1AA 4BI7A 2ZE3A 3A4AA 3AYSA 4GYFA 1TMQA 1U5VA 3EYPA 3BW4A 2YW3A 5M3WA 2YB1A 3G18A 4JFWA 5FL0A 1PWMA 3A3XA 3T0BA 2QCHA 2FFCA 3E2SA 2C79A 3GW0A 4I6VA 3QKEA 2NV9A 3QMTA 1ZP3A 1XH0A 2QV5A 4X60A 4N9CA 3P74A 1MUWA 4TVDA 1D8CA 2J75A 2VJXA 3FYOA 5LA1A 1FWHC 2EJ1A 1FWSA 3IK4A 3PM6A 2WC4A 4RR4A 5K4ZA 1KGXA 3HO8A 4Y9NA 2CETA 3BQ5A 3UXAA 5ABFB 3W2JA 2Y5JA 2GVEA 2ON3A 3L4UA 1EPVA 5AHLA 3UXDA 3R5EA 2VFGA 3BGGA 4JR5A 1H51A 1E6PA 1O7AA 1PKYA 3ZVIA 1B3XA 2VR5A 1TZ7A 1MZRA 2ABBA 4A05A 4BKNA 2DUXA 5HANA 4ZO6A 2GFTA 4M8UA 4ZB0A 1GOWA 1K70A 4FXFA 3IJIA 4DO7A 3WQVA 1C8XA 4PUWA 5C70A 2JKAA 4ZGYA 5DMYA 1O5XA 3ZFHA 1FA2A 1XV8A 1FKWA 1HTIA 4B4HA 3PJWA 1LT8A 4L6HA 4XB3A 4RE2A 4HMCA 4BFAA 3CS2A 4ZQPA 1UWRA 2AGKA 4RPQA 4GRSA 4B5VA 4DUXA 4Q4RA 2J27A 1MI3A 4AMCA 2W5FA 1EJVC 3W7JA 2DY3A 4OZOA 3WQCA 1PCKA 4R34A 1V02A 5C0QA 3VNDA 1WDWA 2PB1A 1GOXA 1SJCA 1NWRA 4QR6A 2DZTA 3RM9A 3SGGA 1XSIA 3WFLA 1YNQA 1KTBA 8XIAA 3QY6A 1OGSA 3W53A 1TCMA 4DM1A 4IGHA 3UJRA 5LNSA 4GYPC 5EL1A 1FCVA 5C9UA 1UC4A 2LLEA 3U0HA 3UCQA 3I6EA 1ZAJA 4LSBA 3W24A 1Y8BA