3LI1A

Crystal structure of the mutant i218a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGAIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3li1A00
3QC3A 2QAPA 1TPFA 3QSTA 1KBIA 3ZWTA 1XUUA 3G3MA 3TQVA 5D09A 3R13A 1EX5A 3B0VC 3LXCA 4FNUA 2ATMA 4HNVA 1LDCA 1QDSA 1FXPA 3S1XA 1SZGA 3LGEA 1PE1A 1QFEA 3G0UA 1KFJA 2WNNA 2B7PA 3NQDA 3C8FA 4TU1A 3NEVA 2ZRXA 1SSGA 3CEUA 2Y70A 3DH7A 3PM6A 3UPBA 3EWUA 1VR6A 3GXPA 5FF2A 2HTMA 3A24A 2NUXA 1PCWA 1KLZA 5CZJA 4DEFA 4UTUA 2OT0A 1EPXA 3NQCA 1NSJA 3FIGA 2WOQA 4XUGA 4AWSA 3S1WA 1XDLA 1YDVA 2V81A 3FFSA 3GIYA 1G6CA 1W5MA 4GUJA 3UZJA 1TRIA 1TO3A 4LV4A 1OX6A 2Y62A 3EKLA 2G5WA 5EY5A 1FXQA 1XBYA 4UUIA 3P81A 2DJLA 3VE7A 3A5VA 1H61A 3R8RA 3GVGA 3LCLA 1WDWA 4R34A 4RLIA 3QRHA 3I7RA 1TPVA 2ZTJA 3G1XA 2FTPA 1ZAIA 4LV9A 2YR1A 1KA9F 1TSIA 5FEZA 1P0NA 3I6RA 5G1TA 5D33A 5FEPA 3MWAA 1DV7A 2RFGA 2HSAA 3W22A 3QFEA 3RLUA 3HGJA 1RZMA 4WUIA 3N34A 5CZ0A 4DF2A 1ALDA 1SW0A 1WOBA 2C18A 1JCJA 4MY1A 3FS2A 4I7WA 3G3DA 4M19A 4OV9A 4AHPA 3I7SA 3AO0A 5DXYA 2VENA 4JYDA 1EWDA 3NPUA 1ME7A 1XBVA 2OZ0A 5C55A 1PHWA 3W2JA 2WSQA 4EWND 5EPDA 3C2VA 1F5ZA 2E5CA 5G5IA 1GG0A 3E02A 3DHFA 1BTMA 1C29A 2ZRWA 5J5DA 4IWWA 1VJIA 4GJ1A 4JYFA 3HG2A 5K7JA 3T40A 1JCLA 3NQ7A 2OMAA 1GQNA 3I65A 5CGQA 1G4PA 1S5VA 3KFTA 4OQVA 1THFD 1HTIA 3MHUA 4RZ4A 4UTIA 1GYNA 2GUUA 1JUEA 3S1VA 3LV5A 1K03A 3JR2A 1U83A 2DJXA 5KZMA 1Z48A 5U4NA 4FNSA 3ABSA 5J5RA 4N4QA 1IXNA 1C8VA 2A6LA 5C2XA 4MLRA 1ZAHA 5A5WA 1TPUA 1CI1A 4JX4A 4O1AA 1IXPA 2NUYA 4AWUA 1PCKA 5HMSA 5FESA 3W88A 2CU0A 3MHFA 4O12A 2JKAA 4KWWA 3M16A 3NNTA 1LLWA 5IBXA 1L2UA 2VFHA 2JGQA 4GRSA 4RV8A 3O63A 3NQ8A 5LNVA 1LZOA 2OX1A 3U6WA 5AYZA 3KOFA 1RPXA 2A5HA 5D2XA 3CC1A 2R8WA 1TJPA 3W7MA 1SO6A 5D2YA 2ZA2A 2PRLA 1JQXA 1OF6A 3MBFA 2A1YA 1EB3A 1K02A 5EMUA 4QIUA 4IQLA 3OVQA 2WNQA 2JGYA 3Q2DA 2CLOA 4X22A 1P1XA 3WK3A 1DKWA 1VLIA 5AHLA 1QWGA 2QKFA 3PAJA 2YDAA 2WV8A 4JTHA 1H1YA 1KM1A 4YWIA 4O57A 3L2IA 4ZQMA 1T96A 2Q3RA 1ZHAA 1GVSA 3F4NA 1OFRA 5G1YA 1IXOA 4M6VA 1H7WA 4I7VA 4LTSA 3W1MA 1O5KA 2H3DA 4BWLA 3W1NA 4A22A 4NXSA 3P80A 1RQBA 4ML9A 3QF0A 2CLMA 4ZL1A 4NJJA 4E0CA 3SGZA 3HIJA 4UTHA 4DO6A 3ABQA 4O50A 4A2RA 4HNNA 1I4NA 4ADUA 2V5LA 1WAUA 4RXGA 1FCQA 4W9TA 1QO2A 4U4MA 3P60A 2ZTKA 3EXRA 2GQ8A 4NQ1A 4LVFA 2Q8ZA 1G69A 1W5NA 2QJGA 3GYEA 5FEXA 4RXFA 2E6AA 3TKFA 1G67A 3G8RA 3SI9A 1VC4A 3FOKA 1ZENA 2FPYA 4ZQRA 1GPWA 3ATZA 5FI8A 1F76A 3NPWA 2FQIA 1P4CA 1YPIA 2A6NA 2C13A 5K9DA 2CW6A 4JTTA 3IIZA 4RCXA 1Q6QA 1YADA 3PUDA 5L6UA 4C1LA 1ME9A 3T78A 4UMBA 4FXSA 4Q33A 4NXKA 3IVTA 2P10A 3NL3A 1L6SA 5BOOA 3MBDA 3W74A 3WK2A 4JS3A 4CNPA 3QQ0A 1JUBA 4UC5A 2C14A 1E51A 1B4KA 2YFNA 4S1FA 2E6FA 1F6PA 1IIHA 3HOJA 2XN2A 4WY0F 2GJNA 3EWYA 4DF1A 2ZDRA 3DHDA 1LBFA 2FDSA 1TPH1 3O06A 3SGUA 3DXIA 4XBSA 4MOZA 1J5TA 1H62A 2W6RA 4PL2A 1KFEA 1AG1O 5C54A 1A5BA 4B5NA 3BG5A 4DO4A 1TV7A 4MZ8A 5AHMA 4WQ6A 4N02A 1TQJA 3H55A 4Y8FA 1EP2A 4WOQA 4MPQA 2WKJA 1BKSA 3GXNA 1FY6A 5EL1A 4IXXA 3BW4A 3UNDA 3INPA 3P84A 3N2MA 5IBXC 1TPB1 3MYPA 4Y6GA 4AF0A 2FPTA 4OGZA 3WFAA 1TTPA 1AMKA 3HPSA 4WD0A 3QYQA 1RVGA 1KTCA 4N9CA 5AOUA 1QPQA 3QW4B 4X3ZA 1RV8A 2QDGA 5KINA 3A9IA 4H3DA 1SPQA 3L21A 1ZALA 2I14A 1FCUA 2WO5A 1F2JA 3TC7A 2R91A 4MZYA 1UUMA 4NNAA 1SU5A 3W3OA 4R7JA 4UTWC 1KM6A 5EKYA 5F2LA 4IGHA 2YGYA 4E2BA 2QCLA 4K38A 4AH7A 1TB3A 3DU0A 2C6QA 1K8ZA 4JTLA 2NV1A 2V82A 5D32A 4XTDA 3PS7A 4N4PA 4BWLC 2BSLA 4UIOA 3PB2A 3TAKA 3QQ1A 2ALDA 4L4MA 2RDUA 1H7RA 3NQ6A 1H7NA 1I2QA 4O18A 1AW5A 1H51A 3NL5A 5LNSA 4ORMA 3HPXA 4X9SA 3W7PA 1WV2A 2ZZ5A 2XN1A 3HB9A 2J88A 1LM1A 5G4WA 3HMJG 3W86A 1FDYA 3Q58A 1FWSA 5CPLA 4JTJA 3L9CA 4O15A 1TRDA 4BFAA 2QCNA 1R46A 4L4LA 4Q4KA 2VEKA 1ZJIA 5LHFA 3P8IA 4O19A 1GEQA 1OK6A 1N7KA 5FF7A 3NQEA 4NNCA 2H6RA 3DBPA 2X30A 3KVJA 4CQ8A 5BNKA 2ISVA 4UR7A 3USBA 1OFPA 3TK7A 4UNLA 1KLYA 2YCEA 3LCFA 4QM1A 2RKXA 1NF7A 2Y6ZA 3ABOA 1SFLA 4WXZA 4BI6A 4Q32A 1G4SA 4NJHA 4A3UA 3L66A 1VYRA 2QR6A 3G24A 1EWEA 1TQXA 2J9ZA 1MEWA 4JICA 1UBSA 1TCDA 4IOTA 1IF2A 4FX7A 5K9CA 3W7KA 3RFAA 1KM4A 4PEKA 3DENA 3KAOA 4MJMA 1W0MA 1EUAA 2A7PA 1AL7A 3CTLA 1SZEA 1Z44A 3LCWA 3G18A 4OE7A 3GXTA 3TC6A 4IX0A 4WX2A 1GJPA 1UB3A 1ZNNA 2B7NA 3LERA 3TW6A 3W1TA 5HWMA 2CLHA 2H90A 5F4SA 4A29A 3MJYA 2ZQ0A 2E09A 5AFDA 3CT7A 5CPNA 4O8RA 2GQAA 2VFFA 4PH6A 3LRKA 3N2XA 3G8EA 1I2RA 1HFBA 3H54A 4NJGA 1LRTA 1OVDA 4LVBA 3ANYA 3PBUA 3UWYA 4O17A 1OABA 4WY0A 2E6DA 3M43A 4NT0A 3E49A 3LLDA 3E96A 1R2SA 3M44A 2WJZA 3EX6A 5AHIA 4O1DA 3RLVA 4ZZ9A 4CQ9A 2CLKA 4Z1CA 1I2OA 1UASA 1X6UA 3I7QA 1KFCA 1GWJA 5HWJA 3WJZA 4HNTA 3P82A 4OHQA 3TNOA 3W7JA 1VQTA 2XN0A 1OX5A 1YTEA 3F03K 3CEPA 4EOUA 3LRMA 3V75A 4IMFA 4EVZA 1ICSA 3CIXA 2BWGA 4XKYA 3FKKA 3GX9A 1MSSA 3LBMA 3LLFA 4AVFA 1H63A 3NQ2A 1QOPA 5AHFA 3HPZA 4O52A 4BF9A 3FYPA 3CWOX 5K9XA 4O4VA 4TO8A 1SW7A 4NJKA 2D73A 2W79A 1ONRA 1TTQA 1W56A 1XXXA 3W73A 2KZHA 1U5JA 4LVGA 2GVLA 3CIWA 4GWEA 4QNEA 4N6EA 2HS8A 1DHPA 4KWVA 3U2OA 1MEIA 1B57A 1YXYA 4N9BA 1OYBA 1S5WA 3NQVA 4LY8A 5AC8A 3UY7A 2X1TA 3LX9A 4JTUA 3LCIA 1FUYA 4WJEA 1UJPA 3A21A 2ZA1A 3G1DA 3HG5A 2Y7FA 1R30A 3FJLA 1H7OA 3PR2A 1PHQA 3TSBA 1KM5A 1TPDA 4I9AA 5D2WA 3TJLA 3LXBA 1H7PA 3W6YA 2EHHA 1MZHA 4AMAA 5K3VA 1QPNA 4NZFA 1W37A 4KFNA 3UD6A 3MI2A 3W2UA 2ZRYA 3B4UA 4LT9A 2VEMA 2G96A 4E38A 3BK0A 5K4XA 4UNKA 4NX5A 2Q3OA 4LUJA 1FWTA 2A0NA 1G7VA 1NF0A 2V2CA 3EX2A 4XZ9A 4NX0A 3NL2A 4O53A 3S6DA 4ZQOA 3SECA 4FX8A 5FF0A 2XFWA 3M5ZA 5HUPA 3SY5A 4JGDA 2IQTA 5AC7A 2GQ9A 3SR7A 3C2RA 1SZFA 1DQXA 4Z08A 2PRHA 4RK8A 2QAFA 4LC8A 4DF0A 1OYCA 3BVJA 3NPVA 3RNDA 4UMCA 3BLFA 3LDVA 1QMLA 4Y90A 1WBJA 4CQAA 4K36A 3W7CA 3QM3A 1DVJA 4HIBA 1LLZA 4E2DA 2CLIA 1A5SA 5HNRA 4FB7A 2UV8G 3STGA 3W7IA 3HO8A 2E1DA 3UWQA 1PV8A 2I9EA 1FWRA 3BPWA 2X16A 3ZFHA 4O1BA 3W1RA 2V8ZA 5D2TA 5TIMA 3TR2A 3VE9A 5D02A 2AQWA 1GVQA 4XQ6A 4H4IA 1L6YA 1LOQA 3B05A 1GYLA 2V0TA 3O1NA 1KM2A 1X7FA 4KFOA 2GOUA 5TQLA 3TQ0A 1SO5A 4O54A 3G0XA 2YW3A 2CWNA 3KVMA 1IIGA 4JXCA 4PA8A 3KRZA 3ZWSA 3LTYA 2WQPA 5I3FA 2G95A 3W71A 3TMQA 1ML1A 2J27A 7TIMA 2QJHA 4O4WA 3PF3A 3TQKA 2NX9A 5CZSA 3TE9A 3M1ZA 1YPFA 3B8DA 5G2IA 5BW6A 3UWVA 1O4UA 3L5LA 3BV4A 2V9DA 3KXQA 3LM7A 5F1VA 1ZAJA 4IMDA 5CSRA 4AF0B 2VEPA 4U28A 3A5FA 1YXDA 4UFIA 4Z1DA 4QQ3A 2WPBA 3S5ZA 5L9FA 5KTLA 1VZWA 2BXVA 3W7RA 2FLIA 5EA9A 2GPTA 5AHNA 3FA5A 1H50A 2BZNA 1OX4A 5AHEA 3RMJA 1SFJA 3MP5A 3IV3A 5CPOA 2B4GA 2NX1A 4MFEA 3THAA 3JS3A 4PL1A 3W2MA 3OEXA 4HSOA 2Y85A 2Z6IA 4Z1BA 4HNUA 4MLJA 4M6QA 1Q3NA 4PCFA 1I8JA 3Q37A 4RZ6A 5LGZA 3PBVA 3EWWA 2I1OA 1W1ZA 3BLEA 1F7BA 2VFDA 4JX5A 1VCGA 2JKEA 3FYOA 2E68A 4HKPA 5GVJA 4XBKA 3MI3A 2JKPA 4FXRA 5HR7A 3GAYA 1W5QA 3KVKA 5C6MA 3TJXA 3GAKA 3PSVA 1LROA 2TRSA 1LOLA 2NX3A 2QF7A 1XL9A 3SW6A 1JCYA 1QCWA 1X8FA 3IIPA 3N19B 3C56A 2EGZA 3R2GA 4K7VA 1ICPA 3TROA 4DPQA 3VNDA 3PY2A 3P5YA 1P0KA 4ZQNA 2DZPA 4AXKA 3G1AA 5DN1A 1DJNA 3HGOA 3AJXA 4TR9A 1W54A 2ISSA 3C0JA 5KSWA 4KKXA 1I45A 1Q6OA 4YXGA 3GDKA 2AGKA 4JN6A 1YTDA 4K39A 1OFQA 4MY9A 1XUZA 5I3IA 1VLWA 1VH7A 1A5AA 2WNZA 3LI1A 4DELA 1RQEA 1WOAA 5BMWA 4UXDA 5LSMA 5D2VA 1IGSA 4K8EA 1B4EA 4G1KA 3G1YA 5D04C 3DKLA 5HWNA 1EEPA 1W5OA 3TXZA 4NJIA 2BX7A 1S5TA 2ZZ4A 1W5PA 3QMRA 2GVGA 3W7OA 2VC6A 3TW7A 4FNPA 4RJEA 1JULA 3SSJA 1D9EA 4JY8A 5BRBA 1KTNA 1VYPX 4JTEA 3OIXA 4MKNA 1Q6LA 3NL6A 4ZVJA 5MHBA 1OFEA 5AYXA 3N3MA 2NUWA 4FX6M 4I7UA 5KZDA 4AAJA 1F6KA 1VRDA 3EXSA 2VELA 2PE4A 4FHAA 3GNNA 8TIMA 2RDWA 5DCEA 2TMDA 4LU0A 1O95A 4ORIA 1H7XA 3DI0A 1TYGA 2DU2A 3O6DA 5I3GA 2C3ZA 4O14A 2Z2UA 1YTKA 3S5YA 1ICQA 3SJ3A 1RD5A 2JBMA 4O16A 1GVOA 3P7YA 3UQNA 2B7OA 5F2MA 3IEBA 3W2KA 3WJXA 3TUUA 5F2IA 3M7WA 1XC4A 3P8JA 3CM4A 1FCBA 4PC8A 2PCQA 2QDHA 1B3OA 2DORA 5TBOA 5AC6A 3ABRA 3L0GA 3R5EA 3C61A 3FKRA 2NWRA 2V2DA 3Q94A 6ALDA 4GFSA 2EAWA 2Z6JA 2ZZ6A 2Y63A 3IIOA 1AL8A 4O0KA 3NVTA 3WK1A 3TU9A 3KVLA 4RX0A 1YLVA 1TV8A 1K7XA 2DZVA 1VHNA 1UCWA 1A53A 1J2WA 4TIMA 2C1HA 3L68A 4J9JA 5D37A 3EB2A 4BR1A 1KBJA 3TV8A 3E9AA 3M5VA 4Z1AA 1PVNA 5LKYA 4N9DA 4WY0B 3A23A 1XCFA 3EX4A 1NAL1 3B03A 3M47A 5DY2A 3V1PA 3OG3A 3HQ1A 4K7YA 2FIQA 1K8XA 1SSDA 2GJLA 1PIIA 3M6YA 1EIXA 4O28A 4AHOA 2OT1A 2ZZ7A 4UTLA 4YMZA 4UTMA 4POCA 1KV5A 2PRMA 3PSWA 3W1PA 1ME8A 3BARA 2C19A 1OF8A 3QMSA 3SFKA 4CCCA 1OFAA 3O07A 3STCA 3W83A 4FEZA 1HL2A 2YYTA 3W7DA 4GC4A 4QNWA 1JRCA 1OX4B 2CZDA 4RR4A 1B9BA 1VGAA 5FF4A 2ZYFA 2EF9A 4JYEA 4Y96A 3TDFA 4MY8A 2J24A 2GVJA 1KM3A 3KHJA 3C3NA 1QR7A 1JVNA 2G97A 2C0AA 3BLIA 1JR1A 4A2SA 3MO7A 2E6YA 3UZ5A 1EP1A 1C9DA 2NV2A 3SIZA 4O11A 1YYAA 3U8GA 4HPXA 1V5XA 1F73A 2CLLA 5SWUA 1KFLA 1I2NA 4MYAA 5DELA 4MUZA 2ZCGA 5FF3A 3N14A 1SZNA 4WOZA 1QNVA 2H8ZA 3W2LA 1FDJA 1NVMA 2QUUA 4RKAA 2TYSA 4DBDA 3B04A 3GB6A 1F74A 1WA3A 1JRBA 5A8GA 3B0UX 3L5AA 4JX6A 3VKJA 5AYYA 1Q45A 5I3JA 1KTBA 1KV8A 3B0PA 1FBAA 3O16A 4JDYA 3TMLA 3PC0A 2Y88A 3LHVA 2YYUA 2QCDA 3P5ZA 3G0SA 4BI7A 3DZ1A 2RH9A 1MO0A 3TH6A 2X1UA 1M5WA 3IGSA 4OWGA 1OYAA 1GT8A 3N73A 2B0MA 4GBUA 5HQEA 2NXHA 3TFXA 4WXYA 4TMBA 5U7SA 4UTJA 3LBCA 4S2CA 3GKFA 2F7FA 4EF8A 3TSMA 1JQVA 3W1AA 2VEIA 2J9YA 3G1FA 4TMCA 5BMXA 5DXXA 1L9WA 3ZR4A 3NA8A 4RZ5A 3O15A 3W75A 3UWZA 3T55A 2ZZ1A 4PTNA 3WJYA 3UY8A 3W1XA 3QPZA 4LUIA 3S9YA 1T99A 3MP4A 3LHYA 4JTSA 5IM51 3HG3A 3M9YA 1J4EA 1FWNA 1KW1A 5CKSA 2A2IA 3R89A 1JCNA 1RR2A 4JD4A 4HHPA 2ZRVA 3W9ZA 3OHIA 3N9SA 1LCOA 5F2GA 4CNNA 5CG7A 1X1OA 5G2HA 2DZSA 4MIMA 4K37A 3EX1A 2NLIA 2CFFA 4ADSA 4CCEA 3D0CA 3EWXA 1T8XA 2Y89A 1PL9A 2DZTA 1TTJA 1TV5A 1VCVA 3QJAA 3O6CA 3TIMA 3R12A 1LP6A 4R53A 3L65A 1XI3A 3ATYA 3PULA 4ADTA 2ABAA 3PVFA 4GE8A 3GDTA 4UFHA 4UTTA 4UMAA 4EF9A 3IGUA 4N9EA 5AN7A 3NAVA 5H91A 2Y7GA 3GDRA 4GUGA 4AB4A 4YLWA 3YPIA 1FQ0A 3FEMA 3W84A 4HPJA 3LI0A 2VFEA 4JTIA 1SO3A 4UFMA 2H3BA 3RF9A 3CQ0A 1XKYA 3HG4A 4FF7A 1K3UA 1DOSA 3W1UA 2QCDB 2YX0A 4LNYA 2YXGA 1K7EA 2DZUA 3C4UA 4DBEA 1W31A 3GR8A 1EUNA 3VI2A 2ZBTA 4NVTA 4LS1A 3FJ6A 3B06A 3BO9A 3NQFA 1FDZA 2ZRUA 4AEOA 3W23A 4FIRA 1SR9A 3HGRA 3M5YA 4IPJA 2Q8LA 4Z0SA 2QJIA 2NXIA 1PS9A 3LTSA 3S5OA 1N8FA 4LOCA 6TIMA 1A50A 2TSYA 1KM0A 3CLMA 4IMGA 3PBWA 2VXNA 3G1VA 3DFQA 1W3NA 4MVAA 4GNJA 2CZFA 4JEQA 2HS6A 3HJZA 1HUVA 1H60A 1DQWA 3TX9A 3TSDA 3PUOA 3JRKA 3WJWA 5CZTA 4H6KA 5G4EA 4JY9A 5DY3A 2A85A 5FEWA 3MW7A 1TREA 3CPRA 4GUHA 3FLUA 1TPEA 4QITA 4IX2A 4O10A 3NOEA 1BEUA 2RHGA 3KX6A 4JTGA 3HF3A 4JR5A 5F4XA 3PG9A 1TJRA 1LTDA 2YFOA 1VPXA 2Y7EA 4NZJA 1QOQA 5HR6A 5K2ZA 2A7RA 5KITA 3MP3A 4NUWA 1QPOA 3BGJA 4DPPA 2VKZG 2W0UA 4IPIA 1DJQA 2QUVA 3C2EA 4N2YA 1O60A 3BG9A 1LORA 2CZ5A 1N55A 1OFDA 2BLEA 2A21A 4IUOA 4MZ1A 3LOTA 4ZMGA 2ZA3A 4JDBA 1FX6A 1GOXA 1AK5A 1LOSA 2R14A 1LBLA 3W85A 3DFNA 3O6YX 4JNMA 3DFOA 5DCBA 1M7OA 3CB8A 2O7SA 3CU2A 4ZQCA 5HUOA 1ADOA 5D38A 2R94A 2CLFA 1TMHA 4PFMA 1SUXA 2WSYA 4HT3A 2ISWA 5E1QA 4UTTC 3GLCA 3GNDA 3W7LA 3UWWA 1TPWA 4LC6A 4JIQA 1LBMA 1ZCOA 3K30A 2E77A 3S8HA 2YZRA 4M6PA 3TAOA 2OCZA 2ZRZA 2WSRA 3LHZA 4K6AA 3LCXA 3STEA 2V5BA 3H53A 1SW3A 3L0NA 2Y7DA 4C1KA 1NFBA 1AW2A 3S42A 2FJKA 2OJPA 1DORA 4NU7A 2A7NA 4ONVA 4IMCA 3WK0A 5DBUA 1WX0A 2QCFA 3BW3A 3E0IA 1JCXA 3BG3A 2QCCA 3F4WA 1WYIA 3NDOA 4FIQA 4X2RA 4A21A 3C2OA 1MEHA 3NZ1A 3F1QA 3L67A 4M7SA 3TXVA 3A22A 5LNRA 2NWSA 4LS2A 3W7EA 4D2JA 4MJZA 2YSWA 1H5YA 1QAPA 3EKZA 3NQAA 5H2ZA 3QMTA 3WJSA 3S0CA 4LS0A 4LVAA 4OV4A 3IIXA 3N9RA 4JTKA 1KFBA 3MUXA 3LRLA 3LXAA 3W72A 4ZQPA 3W1QA 4XWUA 5LNUA 1GTEA 4LVDA 5D30A 1MXSA 3P61A 4MYXA 4LWWA 5C5YA 3UXAA 5F4WA 2V2HA 3ELFA 5CSSA 4OT7A 3OVRA 3W07A 3GDLA 4GUFA 3HGSA 2TPSA 5F1UA 4QSHA 4ALDA 5DLCA 4CLMA 3LTPA 1JCMP 2C15A 3MI6A 3MYOA 2EPHA 3NQMA 3T44A 5D05A 3PB0A 4YL2A 4AHQA 1G4TA 1WXJA 1FWWA 3VFLA 1GVRA 1Z42A 4EIVA 1ZFJA 4M7TA 3EWZA 2V30A 2VFGA 4NNBA 3THQA 4UR8A 1W3IA 5EYWA 3OVPA 1YDOA 1NEYA 4YCPA 1OK4A 2QEZA 2O7QA 3M5XA 1YXCA 4HN4A 2ZFAA 3L0KA 1OFOA 1R2TA 1D3GA 1M7PA 1VS1A 4IXHA 2QCMA 3EXTA 1GVFA 2E5BA 3P62A 1P5BA 2ZZ3A 3UPWA 3UXDA 3W76A 3OA3A 2QCGA 2YW4A 4CNOA 3IRDA 5I3HA 4XKYB 2QCHA 2QUTA 1O5XA 1I2PA 2AAMA 1HO1A 2HMCA 3BGGA 3PBYA 3MHGA 1LYXA 3M0ZA 1SQ7A 4P61A 3RU6A 2Y61A 1XFBA 4FNRA 5I3KA 1TPC1 2NZLA 1X1ZA 2DZWA 4IMEA 3UWUA 2ATSA 4DXVA 2RDTA 2FB2A 3NM1A 4O13A 2FB3A 4Y9AA 1VHCA 1Z41A 1OG0A 1JUKA 4DQWA 2Z0IA 4OBTA 5HJLA 1EA0A 2J9XA 3KRSA 4GXMA 2FPVA 3S5NA 3LHWA 5G2WA 1VCFA 2ABBA 2JK2A 1OFBA 1VYSX 1IXQA 2QCEA 4FNQA 4XTIA 2DZXA 1DBTA 2E5DA 2DP3A 3DGRA 4R33A 4TX9A 3EWBX 4YCOA 3EEGA 3IVSA 1W8SA 1XM3A 4O0ZA 3L5MA 3TA6A 3IIVA 4JTFA 3P74A 2LLEA 4OU1A 1V7YA 1O94A 5HULA 5D03A 1XDMA 1GZGA 1BWKA 3S1UA 3HBLA 5DCDA 3G1HA 4UCGA 2C16A 3O8AA 3P67A 3KRUA 3NQGA 5KMYA 5AB3A 4UFKA 5HINA 1LRQA 2J6XA 4QJ1A 2EKCA 3QH2A 4IJBA 3IVUA 4UTKA 4BK9A 3TCEA 4HSNA 3ZS4A 2H8XA 3W87A 4ICNA 3DFPA 3GKAA 1UUOA 2P1FA 4MFDA 3NO5A 1EP3A 2CZEA 3C6CA 3LHUA 4KFPA 3DFSA 5LHEA 4K8HA 4UFJA 1K7FA 2X1SA 1GG1A 3GZ3A 3NR0A 3E12A 3QZEA 2FFCA 2F84A 2ZZ2A 1S3HA 4UTWA 3EX3A 5LNWA 3VCRA 4Z0JA 3QW3A 3NXFA 2X2GA 4FNTA 2BTMA 3C2FA 1XBXA 4M5PA 5KZEA 1TTIA 3QSRA 5CPMA 1HO4A 4GUIA 3DKJA 3W7NA 3TFCA 1YDNA 3W2NA 5E0KA 2A4AA 1KFKA 5EBUA 1HG3A 1L6WA 4FO4A 5ABTA 1XBZA 4QISA 4JIPA 3T7VA 2NXGA 3PUEA 3LB0A 3OBKA 2CLEA 3DAQA 3G1SA 1OJXA 4UFLA 1CW2A 3QPYA 4S2BA 1F05A 4LRTA 3GR7A 5K4ZA 3CHVA 1Q6RA 2VFIA 5T26A 1FCVA 3DI1A 1K8YA 1W3TA 1QO5A 5DBTA 4AWTA 3I68A 1T0OA 2PURA 4WZHA 2X1RA 1H1ZA 4BI5A 3NG3A 1CX9A 1OHLA 3PWAA 2YPIA 2VOMA 3RK8A 1AW1A 3NYZA 3T4CA 3NZRA 1SO4A 4CCDA 3GK0A 3C52A 2PC4A 1A5CA 1GTHA 3NM3A 3SZ8A 3LHTA 1M6JA 2P0OA 3UYCA 1BWLA 4LW7A 1RQHA 3STFA 1QPRA 1ZY9A 3W7QA 3GDMA 4P2VA 3NGJA 3LCHA 3W7HA 3O05A 1WBHA 1G7UA 1R47A 3BW2A 2B7QA 3DFTA 3CWNA 3LV6A 3PG8A 3M41A 1WQ5A 3W1LA 5LZLA 3QEZA 4PODA 3W70A 1LRNA 2Z1BA 4QAIA 5E93A 1TIMA 4O1CA 3NPXA 3LCGA 1JJKA 3MMTA 3W7GA 1D3HA 1DL3A 1G4EA 1R2RA 1Y0EA 4LRSA 4DO5A 3IGXA 4N6FA 3G22A 5LGXA
chains in the Genus database with same CATH superfamily
4G1NA 4G56A 1XSJA 3BCFA 3G3MA 2ATMA 1QDSA 1FXPA 5AYBA 3S1XA 3LLXA 3VIGA 4IPLA 4MKSA 4DBSA 1XYZA 2ZRXA 1JG9A 1SMDA 4CGTA 1E4MM 3Q45A 1O12A 1IT0A 2J78A 3LG3A 2OYKA 1R87A 1EPXA 3NQCA 1T40A 2QIWA 3S1WA 2Z1XA 1XRVA 3RO6A 1XIHA 3UZJA 1TO3A 4LV4A 4DZ5A 3EKLA 1QNRA 1REQA 3V1HA 1XS2A 4MF4A 4BJHA 2DJLA 3VE7A 3A5VA 4HMCA 1H61A 4J3WA 3S9IA 4Q6XA 1J6PA 1ENUA 3QRHA 4WKFA 4TVCA 1ZAIA 3CL8A 5G1MA 1LWJA 3T08A 1P0NA 3I6RA 1XLAA 4F0HA 5G1TA 3WF1A 4FAMA 4ZFCA 3QN3A 4KESA 3MWAA 5HAOA 2HSAA 1M3UA 1UH2A 1XISA 2VUYA 3RLUA 3CHEA 3FX4A 2XG9A 1ALDA 3CZGA 1UQZA 2AL2A 2C18A 1H0GA 2DH2A 1R3YA 4H9UA 4HGXA 4JYDA 3T9PA 1ME7A 2HNEA 3NZGA 4Z2KA 3HA1A 4BS0A 3B8VA 3W37A 2E5CA 2YL8A 1XLLA 2XSBA 4MADA 1BTMA 2WZEA 3CO8A 1EC9A 3NQBA 4ERGA 4GJ1A 1CTNA 3K8MA 3WNPA 1JD7A 3HG2A 1JCLA 1YNYA 3FVDA 2OMAA 1JYWA 3AXMA 4F0KA 1KNWA 4JHOA 1VFSA 2F6XA 5T8GA 1GYNA 5A2BA 1PX8A 4RE2A 4OZOA 3S1VA 3N18A 1K03A 3JR2A 1E6SM 1U83A 5KZMA 1EJXC 1UZHA 5J5RA 2CZVA 2EQDA 4DWSA 3W6MA 1TPUA 4QE1A 2PWHA 3KL0A 3EDJA 3THDA 1RA0A 3L4WA 5FL0A 3MHFA 4O12A 4IL2A 4A35A 1LLWA 1TWZA 2QMJA 4KRUA 1LZOA 2OX1A 3U6WA 5AYZA 4IJCA 1RPXA 3TR9A 2PWUA 3CC1A 1SO6A 2ZA2A 1OF6A 2QDDA 4E4FA 5EMUA 4EP8C 1OZQA 5H1WA 3OVQA 1ZLPA 1HJVA 3Q2DA 1GVEA 1PKMA 3B0XA 2VGIA 4X22A 3ZQ9A 1P1XA 2O4MA 1XCWA 3OLEA 3PAJA 2WV8A 4JTHA 4YWIA 2G3NA 2PWGA 1T96A 1OFRA 3U7BA 1IXOA 1H7WA 3W1MA 2H3DA 1EOMA 4NXSA 3P80A 3QF0A 4DRSA 4E0CA 4DLMA 3BANA 3SN4A 1W1TA 4UTHA 1TE1A 4ADUA 4E2OA 2V5LA 5F7UA 3DFHA 1XIBA 3EXRA 4Q8TA 5DMMA 4LVFA 3OTRA 2YA2A 3WQCA 1ZJBA 3PTQA 4ZCWA 5FEXA 3S2MA 1SM9A 1G67A 4GZEA 1QNSA 5FOOA 3WELA 2UY3A 2FPYA 1QOXA 3BTNA 4WKHA 1YPIA 2A6NA 3SCVA 2BOFX 1EGZA 3BGAA 2AGTA 2ONEA 1Q6QA 1JZ5A 3CBWA 3PUDA 3WD2A 1AH0A 1ME9A 4HB7A 4D6CA 2A3LA 4IP5A 3LUTA 3NL3A 1RP8A 2OGYA 4H6EA 4JS3A 1RY8A 3V0SA 3FA3A 4Q8UA 4IP7A 1B4KA 1XSKA 1Q8JA 1IIHA 4AISA 3K46A 4WY0F 4UCFA 1TELA 4YTSA 1MQQA 1DYSA 3GH5A 1TPH1 3DYOA 1X96A 3SGUA 3WQ4A 3QZ6A 1J5TA 1H62A 4PL2A 1EC7A 3DUGA 4LCQA 1A5BA 4MAVA 3BG5A 2VC7A 1TV7A 4HU0A 2VR4A 4YTRA 3GXNA 1NIUA 2VURA 3CZLA 3EMQA 3BW4A 3P84A 3PWGA 1TPB1 3MYPA 4Y6GA 4AF0A 4C6FA 1AMKA 1UWSA 3GTHA 2OPJA 3PPFA 4LAKA 1XINA 4BY3A 1RVGA 4V15A 1C92A 1QPQA 1BGGA 1E3ZA 4KWOA 2QDGA 3WD1A 1XW8A 1A5UA 3A3HA 4UTFA 2WO5A 1JEZA 2R91A 3L2LA 2WM1A 5I03A 4R7JA 4IJRA 4DX3A 4F0SA 3FGCA 1M65A 4M1BA 4E2BA 1UA3A 2QCLA 4B16A 2PODA 3DU0A 2ZKMX 3OLGA 4JN8A 3KCLA 4C6MA 2V82A 3PS7A 3PZMA 1UWIA 4BWLC 4UIOA 3TAKA 3QQ1A 4O18A 1TV2A 1H51A 4UQ9A 1FDYA 1OM0A 4S3EA 5CPLA 3WZ0E 4QCEA 3NDYA 3O6AA 5C7HA 5C2CA 1Q6FA 3RRAA 5LHFA 4D6IA 3NJ3A 4U2YA 3BLOA 4GPNA 5FF7A 3SCQA 3RPMA 2X30A 1GOWA 1U5VA 1U1HA 1FHVA 4MB1A 3MTWA 2YCLA 1ESWA 3W27A 5I06A 1OQFA 2WPGA 1S2CA 4UNLA 2Z7KA 1KLYA 1Q2SA 4QEHA 2YCEA 3LCFA 4EK7A 3MKCA 3U3HA 2Y6ZA 3ABOA 4EE9A 4AVNA 4Q32A 3M0JA 4HJFA 4TTGA 4DAFA 3GTIA 3VKBA 4MMWA 3PJWA 4YJ5A 4HMEA 3L66A 2CERA 3TN3A 3VOGA 3G24A 4DWSB 5HMEA 1EWEA 1TQXA 1UBSA 3EDKA 1TCDA 5K9CA 4B3ZA 1W9PA 4PEKA 4OECA 3LQLA 3VOFA 3KAOA 3MSYA 1XF0A 4MJMA 2OEKA 2QV5A 4RDVA 1SFSA 3NO3A 3UFYA 3AZSA 4GVHA 3BJSA 4S3KA 1UBPC 4WX2A 1UMLA 3GXDA 2B7NA 3TW6A 2H90A 4A29A 4DNMA 3F5JA 2ZQ0A 4ZEPA 5A6LA 4DUOA 2P8BA 5AKQA 4RW5A 3AMLA 1MUWA 1TUFA 2F61A 4RV3A 4PH6A 2VTFA 3A3XA 3VM5A 1R7AA 1YHTA 2XH0A 4DY1A 5H8PA 3WLHA 1WDDA 4AYSA 1IR2A 4HNLA 4AX7A 4WY0A 2E6DA 2PAJA 3ZLGA 3R0DA 3LLDA 1R0MA 4NZCA 2XM1A 2WJZA 1RK5A 3EDDA 1FWDC 3KBJA 1AA1B 1MZRA 3RLVA 4Z1YA 2VR5A 4GD0A 1I2OA 4YN5A 1UASA 1X6UA 4I6KA 3WLRA 3UVIA 4F40A 1J5SA 4ZFMA 4LEQA 2PTZA 4D6DA 3WJZA 3REQA 3TNOA 3W7JA 3M4HA 1HF6A 4J40A 4EOUA 1FKXA 3V75A 4EVZA 4LALA 1SVDA 4IT1A 1MSSA 4M1RA 1PKNA 1T41A 4P7LA 3CWOX 4O4VA 3FY1A 1N8IA 4TO8A 4XZIA 4AZIA 1RA5A 3PNZA 3AS2A 2G37A 3A4WA 3V5CA 2OEMA 1XYBA 4F9JA 1TTQA 3IANA 3W73A 3BMWA 2KZHA 4LBSA 4GWEA 1UQYA 4QNEA 3TYEA 3KWXA 2WCSA 2HS8A 2FVMA 3U2OA 3TP4A 2FHCA 1B57A 2WC4A 3GH4A 1GW1A 3A21A 1SJAA 2ZA1A 3G1DA 4GLEA 2YL5A 1UR1A 3TSBA 1PYFA 3GXIA 3USZA 1H7PA 4XZLX 3W6YA 1QPNA 2FZ8A 2J62A 2WC7A 4W8AA 2WBKA 2OFJA 3WQFA 3HQPA 2FVLA 2NVCA 1KXHA 4Y8EA 1E56A 1XC6A 2G96A 3AISA 4E38A 5FAJA 2R1LA 4NX5A 2Q3OA 4RDYA 3FGCB 4XZ9A 1JPIA 1A3WA 4B2DA 2HV5A 1U2YA 3ARXA 5J04A 4QFUA 2Q6ZA 3ALGA 4MWAB 2DY3A 3M5ZA 1V0NA 4JGDA 1BTCA 1EKOA 1VKFA 4AZCB 1E9YB 4DF0A 3UG8A 3NPVA 2BS9A 4UMCA 1BKHA 3W7CA 2OZ3A 1FH8A 3OODA 4E2DA 2XIMA 4JQ3A 4QS5A 1CB7B 1JL8A 1S3TC 3W7IA 4YWSA 3KOXA 1BYDA 3GC2A 2OO0A 1F8MA 2HZGA 3F7JA 2X16A 1Q4NX 5C8BB 3NIYA 4B4HA 2AMXA 4K1WA 2V3GA 3AJ7A 1LOQA 1GYLA 3MCNA 2EJAA 4R3UA 3O1NA 1VJZA 4KFOA 1CGXA 3UZXA 6TAAA 2CWNA 2ZX8A 4K68A 1IIGA 3OLIA 4JXCA 4PA8A 3KRZA 3W25A 3ZWSA 1ZPTA 1HIZA 3UXLA 5I3FA 1W6TA 4MWAE 1AMYA 1IZJA 3TW9A 7TIMA 3CAWA 4O4WA 2QGHA 3PF3A 4KW2A 1PAMA 3B8DA 2X8RA 2AKMA 1O4UA 3L5LA 3LM7A 5F1VA 1UMYA 3KXQA 2HVNA 1ZAJA 4IMDA 4A05A 4AF0B 2VEPA 4EX4A 2D3LA 4ZOAA 2P88A 4UFIA 3AUJA 3WLQA 1AFSA 3ABZA 4Z1DA 2X09A 4PB3A 4Y9PA 2EPLX 2WPBA 4LBUA 1JZ2A 1TJ2A 3MZNA 5KTLA 1VZWA 4QTGA 3BE7A 1XLFA 3FA5A 2BZNA 1OX4A 4YS1A 1SFJA 2R9RA 5BRQA 2EJ1A 5CPOA 1MVYA 3UJRA 2XH4A 2CCRA 4PCFA 4M6QA 1I8JA 4RZ6A 3U2CA 2I1OA 2PDMA 4XUYA 2PLKA 4JCMA 4V33A 4F2UA 2X40A 3HFYA 2HE5A 4KCWA 3CQKA 3MI3A 4UNIA 2JKPA 4HOXA 1C93A 3GAYA 5C6MA 1PO9A 1EGMA 3B8SA 1P1MA 1XL9A 5HANA 2PP0A 1KQZA 1QCWA 4FPSA 4PR4A 2E4TA 3R2GA 4K7VA 2IKIA 5EB8A 3VNDA 3P5YA 1P0KA 4HTBA 1DJNA 1V3KA 2A3AA 4TXEA 2ISSA 1ZL1A 1QTWA 3IV8A 3QV7A 3ANVA 2AGKA 4HBKA 2RJHA 1XICA 1XUZA 2DUZA 1VH7A 3GG8A 2I16A 2V5KA 1WOAA 5LSMA 4PRRA 4G1KA 4H7ZA 2BX7A 1U1JA 3E2RA 2WLZA 1S5TA 3SO7A 3UGVA 3HN3A 3QMRA 4J2PA 2ZVRA 5D4YA 1XYCA 4MB4A 5FJUA 4IG2A 3ZJ8A 4AU0A 4Z2GA 1EC8A 1ZBCA 3DOPA 4MJ4A 4MWAD 4JY8A 5BRBA 4B5TA 4KT2A 1KTNA 2GGEA 1Z69A 1HJQA 3DECA 4IM4A 4JNYA 3GFXA 4BQ2A 3SUTA 3TYAA 3CAQA 4M24A 1F6KA 3EXSA 4W85A 2VELA 4C91A 3DFYA 4EPEC 2VCBA 1F3EA 1BG4A 8TIMA 1RJQA 4ORIA 4PMQA 1TYGA 4CD5A 1KQYA 1ODZA 3O6DA 3PTDA 3UQNA 5F2MA 3W2KA 4D6JA 4FSAA 1S2VA 1B3YA 3M7WA 1XC4A 3P8JA 3UETA 4AZBA 1CIUA 4PUEA 4PC8A 2QDHA 3OZOA 5ECUA 1V6YA 2OWCA 1F4AA 2V2DA 2WWDA 3Q94A 3UNTA 6ALDA 4NG3A 2A3CA 1E6QM 1LT8A 1XIIA 2ZXBA 3NVTA 3TU9A 2D24A 1OC5A 2FHBA 2ZE3A 2XVLA 2GDUA 3H12A 3VDBA 4JFSA 3IWPA 4TIMA 4M0XA 5D37A 3EB2A 4BR1A 2DSZA 3ITYA 4DO7A 1M9HA 5LKYA 1BWVA 1XCFA 3ITOA 3B03A 3T2OA 3HQ1A 4U3CA 5BWAA 2GJLA 4TTUA 1PIIA 3M6YA 4AHOA 1OD0A 3DG3A 4YMZA 4S38A 1MDLA 1TKKA 5CXPA 1KV5A 4DJEC 2PRMA 3GQYA 4DJEA 4BF5A 3SFKA 5JBFA 1MXGA 3AS0A 1QBBA 2WQDA 1VFHA 1OX4B 2CZDA 5FF4A 2ZYFA 3JZUA 2EF9A 3QQWA 3QGAC 4X2PA 3TDFA 2I17A 3KHJA 5DMLA 5RUBA 1QR7A 3MO7A 3SIZA 4RUBA 1YYAA 1R3RA 1W9UA 1UW9A 1P0EA 1Q7QA 3G6MA 3T0DA 4ERIA 1FDJA 1NVMA 4W7VA 2QUUA 4Q4PA 4DBDA 3GB6A 1F74A 5A8GA 2EPMX 4AD4A 2BXYA 5AYYA 1Q45A 5I3JA 1JFHA 1KTBA 2AQVA 2PDBA 1C8QA 2GGGA 3UR7A 2IPFA 3PC0A 2Y88A 3RPDA 3KUMA 1UOKA 4YYCA 3G0SA 4BI7A 2RH9A 1MO0A 4N0RA 3VD3A 3E1F1 2R1MA 2IXUA 3TYCA 1CXLA 1QJWA 4EWJA 1E6PA 1GT8A 1XH2A 2B0MA 1BF6A 1BVZA 5HQEA 4TMBA 2W5FA 1YBQB 4GI8A 3VGHA 2F7FA 4EF8A 2RAGA 2VEIA 5DXXA 1UWQA 3V5OA 3IJQA 2Y5EA 1RXOB 4H2HA 2CXEA 3UWZA 1ZJAA 1Y5WA 2OO6A 3M0HA 1Y65A 4FR1A 2DT1A 3WJYA 3VCCA 5CSUA 2PS2A 2E9MA 2ESCA 4H9YA 2WVVB 3S9YA 1PKYA 3LHYA 1A5MC 4PTXA 5IM51 1XG3A 2HK0A 1XRTA 1MW0A 5CKSA 1QUMA 1JCNA 4JD4A 4HPGA 5I07A 6ENLA 1ITUA 1LCOA 5BYWA 3NWRA 2C1GA 3AXHA 3SN0A 2CFFA 2OKTA 8XIAA 1PL9A 3H26A 1FWHC 1LL4A 2DZTA 5CJ5A 1TV5A 4ZSTA 1BYBA 3QJAA 4HCDA 4KH2A 3NSXA 3U9IA 2F38A 3PULA 2GGHA 3PVFA 4UTTA 2HXUA 5AN7A 1QW8A 4DWSD 2PLJA 2Y7GA 3B8WA 4JL1A 1VBJA 4ZENA 3T0AA 4YLWA 4Q8NA 3WLSA 1EDQA 4UFMA 4AD2A 3WD0A 4EPBC 1KGUA 4GXWA 1K3UA 4GQGA 2QCDB 3UERA 2YXGA 3AALA 3WUFA 2DZUA 4L5ZA 4UQDA 3K8LA 2UY2A 2X0SA 3KRBA 2BXZA 3GR8A 1EUNA 3VI2A 1DTNA 5C0QA 4NVTA 3NQFA 3W23A 4FIRA 1TWIA 4D6HA 2E40A 5DO8A 3PFRA 1WUFA 1PS9A 3LTSA 4IMGA 1EFZA 1S46A 2VXNA 4XIAA 3DFQA 4B92A 1W3NA 1U1UA 4ACZB 3HJZA 4GKLA 3TX9A 1UJQA 2DPEA 5ABFA 2MUCA 5CZTA 3CUXA 5G4EA 4S3FA 1PIGA 1XJBA 2GZXA 4XZWA 4J3XA 1TREA 1J0KA 4GUHA 4W8BA 2WZIA 1TPEA 2HXTA 3N11A 3GM8A 4B9YA 3PZGA 3NOEA 4ZODA 3NDZA 2HCVA 4IIHA 3POHA 2OVLA 3MWCA 3QHOA 4F48A 2Z28A 2VKZG 2W0UA 4JQ4A 1Y7VA 5A69A 4GCAA 1LLOA 3VPLA 3URBA 1X97A 1NDZA 2CZ5A 5I24A 2IKHA 4GY7A 4ZMGA 5JMUA 2ZA3A 4JDBA 1TUXA 4IIBA 1LOSA 2R14A 2GDVA 4U5IA 3JU2A 2Z7GA 3OGSA 4FLRA 2O7SA 1JZ8A 3CU2A 2R94A 1HGYA 3VZZA 2V6AA 3OBAA 4HT3A 4CUCA 5EMYA 2JFEX 3UWWA 7REQB 2H9AA 1ZBKA 1LBMA 1XD1A 1ZCOA 3H2CA 1FVPA 3K30A 1Q6CA 4WR3A 1J0YA 3TAOA 4F0LA 2OCZA 2ZRZA 3RMEA 3LHZA 8RUCA 4DM1A 2VD9A 1SW3A 3PJUA 2PDNA 5B7ZA 5D9OA 2OJPA 1DORA 1IEWA 4NU7A 2A7NA 4IF2A 2PZNA 3WK0A 3G6LA 3LYEA 5DBUA 1EQCA 1A3XA 2QCFA 3E0IA 1QHPA 1YEYA 4PULA 3RCYA 1QWKA 4W88A 2X42A 1FWFC 3TXVA 1XGDA 4D2JA 4Q8MA 3IK2A 4AD3A 2HVMA 2YSWA 1MYRA 5CC7A 1H5YA 2PGEA 2WMIA 3NQAA 3WJSA 4OV4A 2OOGA 3WF4A 1XLGA 4X61A 3MUXA 2VGFA 3N3TA 2MANA 4YNGA 4ZQPA 1NP2A 1R6WA 2PP1A 4Q3MA 3QKZA 5C5YA 4WKAA 3HGSA 1GPFA 4QSHA 3LQGA 4CLMA 4JFVA 3LTPA 3B9NA 4IH3A 1EF2A 3VNZA 1JCMP 2EPHA 7ENLA 2PGWA 5D05A 2HROA 1TR1A 1CGYA 1GVRA 1P6BA 4M7TA 4JHZA 4L9YA 1B3VA 3EWZA 1JGMA 3K1DA 5A8PA 3IUDA 3THQA 4UR8A 1O6IA 1W3IA 3SY1A 2O0TA 3OQEA 4EKJA 1YDOA 1NEYA 4HVXA 3SB0A 4KEUA 1AJ0A 6CGTA 1EJRC 2QT3A 1YXCA 5AVHA 4HN4A 1OC7A 2IQ0A 3L0KA 3ZSTA 1R2TA 1VS1A 3EXTA 3P62A 4LX4A 3VO0A 4MSSA 4Q8OA 3W76A 2F8QA 3OA3A 3VDGA 3U2ZA 4KRZA 3KBNA 4QE5A 4V28A 1I2PA 3XIMA 5E5CA 1CT5A 3BGGA 1QI3A 4JTDA 1SQ7A 2ZE0A 3I6EA 3RU6A 1XPYA 1UR0A 2NZLA 2VMFA 4IMEA 3UWUA 4DXVA 2FB2A 3NM1A 3WFZA 3K2GA 4F66A 4Y9AA 2DSVA 4IFOA 2CC0A 1IGWA 2X7VA 5HJLA 3CMFA 2X1IA 4B5SA 1TVNA 4NAFA 3VOHA 1VYSX 5C2GA 2IXVA 4HU3A 4XTIA 2OX4A 1DBTA 2BHZA 1V4YA 3WUEA 3ZIZA 1CXHA 4TX9A 4QLJA 4QSFA 1Z8AA 4JTFA 4OU1A 5HULA 4J7RA 3GUWA 4H04A 4UCGA 2HVOA 1TG7A 3KL3A 3TTYA 4XAFA 5HINA 3CWHA 3FCPA 4JPGA 1LRQA 2J6XA 3QH2A 3IVUA 1AD1A 4BK9A 1HW6A 1SFTA 2EKGA 7PTDA 3WN6A 1P43A 3GKAA 4B9ZA 2REQB 2P1FA 3JZEA 2WHLA 2Y8KA 3L23A 3L4UA 1ZQ5A 1JD9A 1XD0A 3L2MA 4JKKA 4IZGA 3GZ3A 1OIMA 3AWOA 2FFCA 2I5IA 3H2AA 4UTWA 2DUXA 5HQMA 2QUMA 3QW3A 4C6LA 4OBRA 3TYZA 3NXFA 4DAIA 1XBXA 3MDWA 1NFGA 7REQA 3QSRA 4WDUA 1KCKA 3MS8A 2GFTA 2XH2A 4YVVA 3W2NA 5E0KA 1E73M 2E28A 1B30A 4PTWA 4AXNA 4FF5A 1HG3A 4FO4A 5ABTA 1XBZA 2GUBA 3VNYA 2ZVIA 4GABA 1E4IA 3EEZA 2CLEA 2BHUA 3UXIA 1OJXA 4XX6A 3QPYA 4LRTA 4HCHA 5K4ZA 1YNQA 1FCVA 2PI6A 3AIWA 5C70A 4AUBA 5DBTA 1QO5A 2J8GA 3RHGA 3BAXA 2RGLA 1OZMA 2ADAA 3BV7A 1QI5A 3D47A 3IAQA 4GI6A 2Z25A 3FYYA 5A8OA 3AXKA 2PTXA 4G5DA 3B3DA 4CCDA 2FDMA 1GTHA 3WDPP 5AZ1A 3MB9A 1ZY9A 3B9EA 1DIEA 1B2YA 3T8QA 5KZ6A 4QGCA 3DEQA 3WLNA 3W7HA 2R1NA 5LA0A 1IQ8A 1ISVA 1R47A 3N4FA 3DFTA 2B7QA 2IKJA 3OO2A 1WQ5A 3O7UA 3W1LA 5LZLA 1VPQA 5ECVA 4PUNA 3M0KA 1JPHA 2D1ZA 2NSXA 2EXOA 1UH3A 4O1EA 3W7GA 1D3HA 1DL3A 4JKLA 4NI3A 1DJHA 5KETA 3VGBA 4YTQA 1C8YA 3M7SA 3ZWTA 1TPFA 4AZCA 3W02A 1XUUA 3TQVA 5D09A 1X1NA 1DWFM 4FNUA 3F4CA 4CKQA 1LDCA 1BVWA 3KTXA 3VIOA 2XIJA 2B7PA 1PZ1A 3MKKA 2BMBA 3NEVA 1SSGA 2G4FA 2Y70A 3DH7A 1VR6A 3WNNA 3VNMA 1PDYA 3LK6A 2PDLA 2A3EA 5JH1A 1ADSA 1AD4A 1NSJA 3QOMA 3FIGA 1ISXA 2WOQA 4XUGA 4AWSA 4C6DA 3IUHA 2E67A 3HU7A 2G5WA 5EY5A 1FXQA 1JFXA 3P81A 4FALA 1Z6KA 3FJ4A 1ITXA 1I0DA 3R8RA 3BLDA 4HU4A 3IJDA 3GVGA 3LCLA 5CG0A 1A4MA 3I7RA 2ZTJA 3G1XA 1UD6A 3AU6A 3BWWA 4L7ZA 1KA9F 1JNDA 5HOSA 2FVKA 1TSIA 3CB3A 1E0UA 1XIDA 3E5BA 1EXPA 5FEPA 3UF9A 1DV7A 1J0IA 2ZDSA 3RR1A 1RZMA 4RE4A 4WUIA 3N34A 5CZ0A 4K1GA 4DWDA 1SW0A 3TQPA 1WOBA 1JCJA 5M3WA 3C8NA 3G3DA 2VENA 4DUWA 5I3DA 3NPUA 4KCVA 2OZ0A 5EGRA 1F5ZA 3OYXA 3E02A 4C6KA 4OOZA 1C29A 2XIBA 3IARA 5J5DA 4IWWA 1VJIA 4GHRA 2WK2A 3W29A 3QOKA 3WLMA 1A49A 5K7JA 3T40A 3CNYA 2ZX9A 1GQNA 3I65A 6PTDA 1G4PA 1EJVC 4OQVA 1THFD 4GZ7A 2YLAA 3MHUA 3GWQA 3L4YA 2OELA 2GUUA 4N42A 3KCJA 3LV5A 5CCZA 3DCPA 4NI8A 1Z48A 4ZE5A 4FNSA 3ABSA 4N4QA 1IXNA 4XKMA 3VNJA 4MLRA 3UA4A 2JF6A 1Q7MA 3NSNA 1CI1A 1J6OA 1PCKA 3EOSA 2AL2B 2XIOA 4NSBA 4MGGA 4U31A 1REQB 2A5HA 4H7VA 4UWMA 2R8WA 1TJPA 4F0MA 4TOQA 3MBFA 4GYPA 1W9BM 3UGRA 2WNQA 4OVXA 4PUDA 2JGYA 4PCTA 2V5DA 4AVOA 1DKWA 1VLIA 5LA2A 1QI0A 2YDAA 2Z24A 3D5HA 4QDMA 3ECQA 3GNRA 2BBFA 3EA3A 2NVAA 3ICJA 4LF2A 5G1YA 1B1YA 1GKQA 4M6VA 3BOXA 4BWLA 4XSMA 1RQBA 2IKGA 4A2RA 4HNNA 1I4NA 2V63A 1XLKA 4RXGA 1WAUA 3WLTA 1QO2A 4LUYA 3RX2A 2QLYA 1UA7A 4TX8A 2DVTA 3UWEA 3ITXA 4LSBA 4NQ1A 2QJGA 3CASA 3EOEA 1S2AA 4RXFA 4KCUA 1XFCA 3G8RA 4QG8A 2JIWA 3SI9A 3TJIA 3FOKA 3F2CA 2XVGA 4AW7A 1GPWA 3ATZA 3NPWA 3THCA 2F2HA 2J6VA 4HYRA 1LUCB 5K9DA 3WQWA 2CW6A 1I75A 3WIJA 1SJCA 3V0TA 1YADA 1OBAA 3KZPA 2CEQA 3VINA 3T78A 3TC3A 1FFRA 2ZC1A 4FXSA 4Q33A 4NXKA 3GO2A 3IVTA 2P10A 5DANA 3MBDA 1V3IA 1PTDA 3ZR5A 3QQ0A 2Z1WA 4UC5A 1MUCA 3LPPA 1E51A 2YFNA 5DF0A 3UR8A 3KWSA 3IJLA 4CNUA 4KIRA 4DF1A 2ZDRA 5EU9A 4ATDA 1WAWA 1LBFA 1EO7A 3IAPA 4G7EB 3DXIA 4XBSA 2HK1A 3WQGA 3L4VA 4FOUA 3TN4A 2Q8XA 4MZ8A 5AHMA 4WQ6A 3SRFA 4N02A 4DNHA 3T0TA 4WOQA 3VIPA 3VGGA 5T9BG 3AIQA 1JDAA 2BY0A 5EL1A 4AD1A 1AQHA 2EPOA 4GY0A 5H8UA 5IBXC 2XINA 3WO8A 2FPTA 1TTPA 3I3EA 1PWLA 5M17A 3HPSA 3QYQA 3V7PA 1KTCA 3QW4B 3SSZA 1RV8A 1WDPA 5KINA 3A9IA 4KCTA 5PTDA 4H3DA 3VZXA 3IS4A 1SPQA 3BMXA 1ZALA 1PUDA 1BXNA 1FCUA 1F2JA 2O9PA 1UUMA 1SU5A 4UTWC 3ZO9A 1KM6A 3OZMA 5DRIA 4AH7A 4I9TA 4NKCA 4KEMA 1JZ7A 1QVBA 4N4PA 4F0RA 3TVAA 1V0LA 3PB2A 4IGMA 4L4MA 2RDUA 1H7NA 4XD3A 3VX1A 1AW5A 3NL5A 5LNSA 2ZX7A 3HPXA 1A0CA 4I3GA 4X9SA 1WV2A 2ZZ5A 2J88A 1LM1A 5G4WA 1NOWA 4WSHA 4AX6A 3AI0A 5BRPA 4JTJA 1XPGA 4BFAA 2QCNA 3E2QA 1ZJIA 4O19A 2H6RA 1F61A 1PX4A 4W87A 2D0HA 4BQ5A 4HYVA 2RGMA 2PDKA 2OOFA 3QC0A 3USBA 4FLOA 4DYJA 3ONCA 1DWGM 4CD6A 4HMDA 4BI6A 1PZ3A 1Q6GA 2VX4A 1R8LA 4A3UA 2GL5A 3PZUA 2QR6A 4K2SA 4JTCA 2J9ZA 4V1XA 1MEWA 4JICA 3VNIA 1IF2A 1UWTA 2YL6A 2HWGA 1KM4A 1W0MA 3CTLA 1AL7A 1ZGDA 3LCWA 3G5EA 3TC6A 4JTQA 1RUSA 4IIFA 3RITA 3LERA 2NQLA 5F4SA 3MJYA 4H8HA 3CT7A 1B0IA 1EDTA 3LRKA 4AFYA 3AS3A 4GVGA 4NJGA 4LVBA 4JHMA 3ANYA 3AMGA 4WIWA 2XWEA 1DWHM 1FWJC 2W9MA 3E96A 1R2SA 4QX4A 5AHIA 2DSUA 2ACUA 2CLKA 4Z1CA 3MZ2A 5IHSA 5JH2A 5HWJA 4HNTA 3P82A 2ASHA 4Q4OA 3T09A 1YTEA 1UWUA 3F03K 3PZQA 2GSJA 3NSMA 1UWRA 4XKYA 5TNVA 4HZMA 5AECA 1H63A 4GQRA 3RCMA 5G4HC 3KS6A 2V67A 1UD2A 1D8CA 1A5OC 1SJBA 1Z7AA 4BF9A 4P8XA 1W9XA 2UWFA 5K9XA 1RCXB 1XCXA 4UOQA 1W1IE 2Z4GA 1SW7A 4NJKA 3ITCA 1W56A 2ALRA 2WSKA 2WHJA 1PWMA 1H0IA 4A3RA 1U5JA 2GVLA 4N6EA 4KWVA 3OGVA 1GOOA 4R7WA 2P50A 3AHTA 4WHBA 3CV2A 1S5WA 4LY8A 3VIHA 5FJPA 3AIEA 2GWNA 3UY7A 3EPNA 1TMLA 3EZ4A 3LX9A 4JTUA 1UJPA 3GUGA 1PKLA 1R30A 2Y7FA 1H7OA 3PR2A 3ARUA 1NQ6A 1T8QA 4I9AA 1W3LA 2WVSA 1EGVA 4AMAA 5K3VA 2YBVA 3I4KA 4KFNA 4X9YA 3MI2A 4PN2A 3W2UA 4GNVA 3QY7A 3B4UA 4LT9A 2EBNA 3GC5A 2GWGA 3WLJA 4UNKA 3VFCA 3FVMA 4JIEA 2YA1A 1R7OA 3GC4A 4L9XA 3TZFA 3S6DA 4QRNA 3PZNA 1E1EA 4ZQOA 3SECA 5FF0A 3WF0A 4H9ZA 3M0VA 2XFWA 2F6UA 3VMPA 2IQTA 3SR7A 3QR1A 3E0FA 3TWBA 4Z08A 2PRHA 4CD7A 4LC8A 1OYCA 3ARYA 3BVJA 1KRMA 3BLFA 1QMLA 4Y90A 4ZO7A 1NTHA 4CQAA 3VUPA 3BSMA 3TYBA 3QM3A 1DVJA 1GGOA 1LLZA 4H01A 2CLIA 1C9WA 2GJXB 3S83A 1JXJA 1YPXA 1POKA 1LQ2A 4GYPC 3OGRA 1FWRA 4O1BA 4E2VA 2V8ZA 1UG6A 5TIMA 2POTA 3VE9A 1ZS2A 2G3IA 1TE6A 4ZR8A 1UP3A 2PD5A 1GVQA 1CXEA 1L6YA 3B05A 3MSGA 2V0TA 3HJEA 1BG9A 2PU1A 5FJJA 1X7FA 1CXIA 1F6YA 1IE7C 3NO1A 1T5AA 3TWAA 3G0XA 2YW3A 3KVMA 6XIMA 4DJFD 4WJ8A 1W1VA 4DZAA 3LTYA 1IWPA 4HK6A 2WQPA 3TMQA 1TMQA 1ML1A 3IUIA 2J27A 1BAGA 3TQKA 3SN1A 1UKTA 2VVSA 1YPFA 1WDQA 1BFNA 1NWSA 3UWVA 1TX0A 1ITQA 1A3HA 2E0PA 3P93A 1UH4A 3FJNA 3U5YA 4ZO6A 4BEQA 1ONEA 3A5FA 3KTSA 1WKYA 1FWCC 5L9FA 1WXZA 1B54A 3D3FA 2OXNA 3W7RA 2Y1HA 1NH6A 2GPTA 1HL9A 1R3WA 5C9WA 1EJSC 3IV3A 3GS6A 2B4GA 1DIDA 3THAA 3U4FA 3JS3A 3UJ2A 4QLKA 4HNUA 4MLJA 4LY4A 1Q3NA 4MWAA 3OG2A 4MWAC 5HMDA 5ABFB 3H21A 1VCGA 4E4UA 3UZZA 4QQUA 2XH7A 3KOYA 2V3FA 3GG0A 5HATA 2NV9A 3UA3A 4JIRA 1JI1A 4XBKA 2FMNA 3VIIA 2WLYA 4ILSA 3ME3A 2O55A 5CGTA 1LOLA 2NX3A 3LNMA 3K8KA 3RAOA 2QF7A 1H3GA 3SW6A 1JCYA 1X8FA 3C56A 2OLSA 1XGZA 3TROA 4DPQA 1XYAA 3E0LA 3MUCA 4L56A 4JQAA 4ZQNA 2D3NA 3G1AA 4D9PA 4DZIA 3HGOA 1U30A 1W17A 3AJXA 4GK8A 4TR9A 4E4PA 1J0ZA 1I45A 4J2MA 1Q6OA 4YXGA 4JN6A 2WNWA 1YTDA 4IUGA 4YYFA 5I3IA 4YHEA 3WCZA 1TR9A 5A6AA 5D2VA 4AG0A 1L8NA 5D04C 3DKLA 1EEPA 4H1ZA 2J79A 2Y24A 2ZZ4A 4Q7NA 1KCLA 3W7OA 4C5ZA 1WXYA 3UG3A 1PDZA 3WUBA 5HA7A 1HX0A 3MV01 1JULA 1D9EA 1EL3A 4JTEA 1UWAA 3OIXA 1BF2A 2PBOA 1BQGA 4IGNA 2WVTA 4ZVJA 1W3KA 2JF7A 1R3VA 5MHBA 2OWXA 1OFEA 2W27A 3BCJA 3N3MA 4FX6M 4I7UA 3ABXA 5KZDA 3UG4A 2VCCA 4AAJA 1NARA 3KW3A 4J3VA 2B81A 2UY4A 1O1ZA 1H7XA 5A1AA 3DG6A 2DU2A 3ANUA 3U5UA 4IP4A 4O14A 1US2A 3GVVA 2JBMA 4O16A 1GVOA 2B7OA 1EO5A 3IEBA 4QG6A 1XLJA 2CWXA 3TUUA 5F2IA 4KPLA 1J12A 1EHNA 3SY8A 2OR2A 3U48A 5DEZA 4DUXA 3QHMA 1CGWA 2NWRA 4H8NA 1MRQA 3OJGA 4LUSA 4PMNA 2Y63A 3IIOA 1Z89A 4XBJA 4RX0A 4GG9A 2ZXAA 2DZVA 2YCLB 4XISA 5FKYA 4WRHA 1UCWA 5GNXA 2VR2A 4J9JA 3NUKA 2QPXA 1KBJA 4CVUA 3E9AA 3GBEA 3M5VA 3KZSA 4N9DA 4WY0B 3A23A 1NAL1 4GINA 4CN1A 1K8XA 1EIXA 2DW6A 4O28A 3RUBL 1RCQA 1B90A 4DXKA 5A94A 1EX1A 3M0YA 3BARA 3P0XA 3QMSA 1OCJA 1B5TA 1HNYA 4CCCA 1FHDA 1KKRA 5B80A 1KB3A 3O07A 3STCA 3W83A 1K6WA 1V77A 1HL2A 4HNOA 4RDZA 3U4AA 3CPUA 3NVDA 4GC4A 4W7WA 5BU9A 3MUAA 4FA3A 2O9OA 3FDKA 3L4TA 4LXFA 3WQEA 4XB3A 4Y96A 4DYEA 2GVJA 2Z27A 3C0LA 2DIKA 5I6SA 3EOOA 3BC9A 4GX8A 2G97A 1QW9A 1EP1A 4WSKA 3UZ5A 1V5XA 2YIHA 1V8EA 5SWUA 4GIRA 4KWUA 4MYAA 5DELA 3N14A 3W2LA 2PUZA 2POZA 3QZAA 2TYSA 4D72A 1NM9A 1WA3A 4LUTA 4Q4RA 3AIUA 2OWWA 3RRXA 1RLDA 2ACRA 5ABHA 4JX6A 3SUVA 4V1YA 3VKJA 4RNIA 1DE5A 5JUVA 1KV8A 3WF3A 3UXKA 5HK4A 1OGSA 4JDYA 4NILA 3BUVA 3S4TA 1E72M 3UW6A 1M5WA 2VRQA 3IGSA 4OWGA 2YXXA 3WDJA 3TFXA 2PDPA 3LBCA 2H9AB 3URQA 1IEIA 3N2OA 4F4RA 3W1AA 3G1FA 5BMXA 1E4LA 1Q65A 2EG8A 3NA8A 4P7QA 1XLBA 1KCXA 1XP3A 1PPIA 3VXGA 2ZZ1A 2YLLA 1C90A 2FTWA 4UOZA 2ACQA 1A47A 2J47A 1T99A 2HPIA 2NQ5A 1FWNA 3AMCA 3P14A 5EBAA 7A3HA 3R89A 2ZRVA 4MIMA 2J25A 2RUSA 3CTTA 2E3ZA 3AIBA 2VT0A 1GOIA 4JIIX 1SR0A 3GVRA 5I02A 1VCVA 1JF5A 2W63A 3R43A 4QE4A 3GTFA 5DQPA 2OSXA 3MU7A 4UMAA 3GHUA 1S38A 4EF9A 4N9EA 3NCOA 2WC3A 4FI4A 1AH4A 2R1KA 2KX9A 4IPPA 4PTDA 3H7UA 4GUGA 1JAKA 2AMGA 2J7BA 3YPIA 4E5TA 1FQ0A 3A64A 3FEMA 2VFEA 2VQTA 1Y5VA 2OG9A 3OZPA 2H3BA 2YBUA 2HDJA 1XKYA 3HG4A 2VVNA 3W1UA 2YX0A 3N6JA 1K7EA 4P7RA 1XLHA 4DBEA 2VJXA 4AMCA 1E15A 2X41A 2ZBTA 3LGDA 3ZJ7A 4C6IA 4IPNB 4AD5A 1SR9A 4PCNA 4XVEA 2Q8LA 4Z0SA 2X0HA 3MCMA 1MNZA 1A50A 5HXMA 5IDZA 1KM0A 4S39A 3CLMA 2V3EA 4H8VA 3PBWA 1FH9A 4GNJA 1W3JA 2CZFA 1K6AA 4JFWA 3CL7A 2DSWA 1DQWA 5FL1A 3TSDA 3JRKA 1XSIA 2J8TA 3Q65A 3RLGA 3CGTA 2ZADA 2DW7A 2IMRA 2XJ7A 3UZYA 4IL0A 4XVDA 5DMNA 1DP0A 3AROA 3VGDA 3WH5A 1RBOB 4O10A 3VCNA 2QGYA 1BEUA 3HF3A 5A95A 1TJRA 1LTDA 2FFIA 1V02A 2Y7EA 3AAMA 5BOEA 2A7RA 5KITA 3MP3A 4NUWA 2Z00A 5CLWA 3EOUA 1UZ4A 3V16A 5C9RA 2IQDA 3UEQA 4IPIA 1DJQA 2G4JA 3VILA 1YKWA 2QUVA 5EMMA 4A8IA 4N2YA 1AJZA 2WMFA 2WVUA 4V27A 1KKOA 3VNKA 3BJTA 1T6MA 5CC6A 1OFDA 4R88A 4BQ3A 3PJXA 4GH1A 3AOFA 4MKVA 3VYLA 1P0DA 1GOXA 1MQPA 3GD6A 1LBLA 3EA1A 3POCA 1GCYA 3CMGA 4JNMA 1EJ7L 4XSLA 4Q4QA 5HUOA 5D38A 1HXJA 1TWDA 1VJSA 1TMHA 4PFMA 1PJ9A 1P7TB 2PDHA 1BSLA 3IK4A 5I5RA 3GNDA 3W7LA 2CBVA 4LC6A 1XIFA 4JIQA 5DMYA 4S3AA 4IQDA 3H23A 2Y8UA 2D69A 2PWFA 4S3CA 3OHMB 2XSAA 3NXLA 1C7SA 1FKWA 2E77A 3S8HA 4M6PA 2WSRA 2VRKA 3LCXA 2C1IA 3VD5A 4OOUA 2V5BA 2QHAA 3L0NA 2Y7DA 1Y8BA 4C1KA 4FP1A 5CJNA 4PBGA 3VKCA 1E6RA 1GORA 1U33A 2XFFA 1WX0A 1LWIA 2ZX5A 1S39A 1JCXA 3BG3A 4C7GA 1BRLB 4GIEA 1WYIA 2VGGA 3NZ1A 4G7FA 4I5UA 4Q8QA 1I60A 3A47A 3F1QA 5XIMA 3GHSA 3IACA 3LU2A 3W7EA 1QI4A 4MJZA 1JDCA 3H70A 3VZYA 3OZYA 2HE8A 2FZMA 1H4PA 5H2ZA 3S0CA 1ONWA 4JTKA 3W72A 3W1QA 5LNUA 3B97A 1GTEA 1ZBWA 3E3HA 4ASTA 3WNOA 2ZWZA 1PTGA 4BQ4A 1A0EA 1U5HA 1Q6EA 5H8MA 4ROQA 3GSMA 5LA1A 3W07A 3GDLA 2TPSA 5F1UA 5GJMA 1X38A 3LMZA 2BVWA 3P0WA 1WKFA 1JYXA 2WAGA 3WLIA 2OTDA 3MI6A 3LEPA 3NQMA 3VGEA 3ZT5A 1VBHA 4AHQA 3M0LA 5EFFA 4GYJA 2BB0A 2G41A 5D9PA 1Z42A 3OQ8A 4R7OA 1ZFJA 2BY3A 3ZLHA 3LPFA 1DJXA 1QHOA 1PIFA 5C9ZA 3SIMA 4WEVX 2OGJA 1E0TA 4YCPA 5I0DA 2QEZA 1GJWA 2O7QA 1FHUA 3M5XA 4UQAA 1Q8AA 4M6UA 4NAEB 4P7OA 1PX3A 1W91A 1AZ1A 2PDCA 2QCMA 3R0KA 2E5BA 4G2DA 2BY2A 2JIEA 3UXDA 2D23A 3MUZ1 4CNOA 2YKKA 3C2YA 1Q4WA 5GPRA 3N9KA 1HO1A 2A3BA 4JBRA 1O68A 3O3RA 3MHGA 2GUYA 5I3KA 2Y61A 2W67A 4FNRA 5CPTA 1TPC1 3QLLA 1H49A 2JEPA 4QJ4B 3PPCA 1JUKA 4DQWA 2Z0IA 3WMSA 2BHYA 1UUQA 1UR8A 1EA0A 2J9XA 3LHWA 5G2WA 1H11A 2ABBA 2JK2A 1OFBA 1V6WA 1IXQA 3KE0A 2QCEA 4KETA 3W38A 2XVNA 2DP3A 3DGRA 4WGXA 3EWBX 2OLAA 1OCQA 1XM3A 4O0ZA 3VIMA 3WBAA 2LLEA 4DJED 3PTMA 3FSUA 2FGZA 4A4AA 1O5QA 1BWKA 2OZTA 4QR6A 3S1UA 3HBLA 3G1HA 2C16A 3P67A 5BXTA 3KRUA 1W1PA 4IG2B 4UFKA 4C7FA 1VFOA 3SJNA 2VQUA 3AMDA 4LUSB 2EKCA 4IJBA 4UTKA 2H8XA 3W87A 3WNMA 4ICNA 1AZ2A 1KGXA 2PD9A 3NO5A 5M5DA 1AH3A 2VRJA 2G8ZA 4Z2HA 1OY0A 2CZEA 3C6CA 4HA3A 5HMFA 3LHUA 3MKVA 4KFPA 5C9XA 4UFJA 4CQCA 1K7FA 1BVNP 4IISA 1POJA 3ITVA 1Q5MA 3E12A 3MVTA 3WBYA 1HZYA 3EX3A 3K4AA 3SCRA 1HVQA 2CYGA 1J0JA 4Z0JA 4B91A 3H2NA 4IIEA 4H00A 2X2GA 1GQLA 2BTMA 1PTAA 5CPMA 1HO4A 4GUIA 2PGFA 4C6QA 2IW0A 4C5YA 1KFKA 1H2JA 1RVKA 3T7VA 2PWEA 5BCAA 2O56A 3QPEA 3ITGA 1G5AA 1YE4A 1F05A 4UZUA 1Q6RA 1V03A 2VFIA 3TTEA 3L4XA 3R8HA 2PDWA 1W3TA 3I68A 2Y0FA 3ARVA 5A6BD 4WZHA 1H1ZA 3V0UA 1CX9A 1DJYA 2D22A 4M81A 2JEQA 1XYFA 2YPIA 4HZ6A 4XIMA 1GHSA 3RN6A 3S2JA 4L6HA 2VOMA 4EXQA 4HPHA 5LIKX 2OB3A 1F9CA 1IT7A 1XH1A 2PC4A 4LAMA 4GI9A 4LW7A 2QYGA 1RQHA 3STFA 3LNPA 1V6TA 4CU8A 1P48A 5DT7A 2DT0A 4P2VA 4CNTA 1EA9C 4DJDD 3NGJA 4CN6A 1WBHA 1G7UA 1UD3A 3CWNA 1W3HA 1V08A 2QJNA 3M41A 4HZ7A 4A8NA 4NYUA 1LRNA 4EXBA 3OVGA 1TIMA 4B5WA 3LCGA 3GYCA 1XIMA 4W84A 3WEOA 2EO7A 1Y0EA 4LRSA 3IGXA 2UBPC 1JF6A 4RW3A 1ECQA 4WLCA 1UPMB 1EJUC 3QSTA 3R13A 3EPOA 1EX5A 1QK0A 3AYRA 3B0VC 2G3FA 4HNVA 4L6OA 1X39A 1A5LC 3LGEA 3MA8A 1QFEA 1R9ZA 3G0UA 3FHAA 3RYSA 3NQDA 1E6NA 2Z26A 3C8FA 4TU1A 4C6EA 1A0DA 1EBHA 4JTAA 3UPBA 3GXPA 4UB9A 2HTMA 2D0GA 3CV6A 2WB5A 3KBWA 4HA0A 2OSWA 2JE8A 3ZVHA 4B3LA 3QY6A 1VIWA 3B9DA 3FFSA 1G6CA 5GJNA 5CEWA 4GUJA 1OX6A 2Y62A 3H4XA 4UUIA 3B9OA 1S2TA 1R3SA 5JIWA 5JBEA 3GHRA 3WLPA 4GGHA 3UCQA 1WDWA 2PDJA 1TPVA 2W62A 2YCIX 3SRKA 4OFCA 2FTPA 4LV9A 2YR1A 1G01A 1X8CA 5FEZA 4PMVA 6A3HA 3B8UA 2RFGA 2WXDM 1UIOA 3QFEA 3W22A 5CPQA 3A4JA 1VF8A 2C91A 3AC0A 3HPFA 4DF2A 4Q6JA 2XGZA 2VDGA 2Y2WA 1A4LA 1J96A 4MY1A 4K3ZA 4PSRA 4M19A 3H4WA 3I7SA 5DXYA 2DUAA 3QR0A 3ITTA 3AYTA 1YQ2A 4AEEA 4L1XA 1XBVA 4J1OA 3FV9A 3W2JA 5G5IA 3O2LA 2Z1VA 4BCEA 1F07A 1RSCA 2BVTA 4LF1A 4NZ3A 4Z2JA 4AY1A 3AXXA 3PZVA 1E0VA 3B4YA 1UHVA 4JYFA 1M01A 3CQHA 4I5RA 1X7IA 1S5VA 3KFTA 2XVPA 1HTIA 1DJIA 4D6FA 4G8TA 1Q66A 4UTIA 1FA2A 3D6NA 1JYVA 1J01A 2OQYA 1UKOA 4G6CA 1JUEA 2DJXA 1BD0A 5U4NA 1F4HA 3UJFA 4A3HA 1C8VA 2A6LA 5C2XA 3BLLA 4EAMA 1ZAHA 4XAZA 4YVPA 3SRDA 2YB4A 5I00A 4O1AA 2NUYA 4AWUA 2DIJA 3CHCA 5HMSA 3FW6A 2JKAA 2Y8VA 4KWWA 3FA4A 4AIUA 1HVXA 3MT1A 5IBXA 3PWIA 1OADA 4QAWA 2NT1A 4GRSA 4RV8A 5LNVA 3WQPA 3GXMA 4G7EA 2DH3A 5D2YA 4PUUA 4AZ6A 2A1YA 1K02A 1X6LA 1EHAA 4IQLA 3ZVIA 3R0UA 2CLOA 3ARZA 3VIFA 3WK3A 1F3TA 1H1YA 1W8GA 3HMCA 4O57A 3L2IA 1V6UA 2Q3RA 3SCUA 1C3FA 1ZHAA 4LBRA 4JIHA 4LPCA 3KOZA 4I7VA 4LTSA 1NWTA 4A22A 3LPOA 4ML9A 3WL0A 4ZL1A 1IV8A 1R3TA 3SGZA 1OIFA 1UIPA 1CXKA 1M41A 2NVDA 3P60A 4MHBA 2CIPA 1J79A 2GQ8A 1KXQA 2Q8ZA 3GY1A 4IFRA 1G69A 1W5NA 3OB8A 2E6AA 3AWNA 3FXGA 1RHCA 2VEGA 3L4ZA 4GMEA 3SURA 1V02E 4ZQRA 1EJTC 3VDCA 3FXYA 2VL4A 5FI8A 1F76A 1ISZA 2FQIA 3WY1A 2ICSA 2C13A 4JTTA 3IIZA 4RCXA 1TWSA 4C1LA 3OIHA 1XG4A 3TTQA 2FHFA 1M68A 3F2BA 2GSHA 1L6SA 2DVXA 3MUIA 3W74A 3WK2A 2E8ZA 1VBUA 1JUBA 4C6BA 3NGFA 1UC4A 4AWEA 4Y9NA 1MMFA 4ZXOA 1L2QA 4S1FA 2E6FA 2QS8A 5TF0A 3HOJA 2XN2A 3UCCA 3EWYA 4QJ5B 3HV8A 1OC6A 5E0FA 3DG7A 2FDSA 3CHFA 3O06A 2RJGA 3AYSA 4MOZA 1KR0A 2W6RA 4PTMA 1KFEA 4Z2IA 2J77A 1WP6A 2VUNA 2QPUA 3JW7A 4LH8A 3KP1A 3N2TA 4H9TA 1TQJA 3H55A 4OJYA 4Y8FA 1EP2A 4MPQA 3PTKA 1FY6A 3QV9A 3MC5A 1XQKA 4IXXA 3N2MA 1K4HA 3RILA 4FS9A 2XSXA 4AY8A 3R11A 4R9OA 1UR4A 3S2NA 1M04A 3DGBA 5AOUA 2V5CA 4X3ZA 1RH9A 1B3ZA 3L21A 4MNLA 3CAKA 4ZB5A 1HKMA 3TC7A 1CNVA 4MZYA 2QJJA 3E0VA 4LCSA 4NNAA 1O7AA 3W3OA 3GBDA 4IGHA 2YGYA 1TB3A 3T8LA 1WZLA 4NF7A 3S1GA 2ZOXA 1LWHA 1EQPA 5D32A 4I9JA 4XTDA 4JL2A 1MQRA 1M03A 2ALDA 1CECA 1H7RA 2ZIDA 3KBVA 4J35A 4DYKA 1KXVA 4ORMA 2OQHA 3TN6A 3HB9A 2XN1A 1QBAA 3HMJG 4C1NA 2W3ZA 3VMOA 3Q58A 3MY9A 1AQ0A 1R46A 4Q4KA 2J13A 5FSEC 3P8IA 1E5JA 4MB3A 1GEQA 4IIGA 1OK6A 2ZWYA 3DC8A 1S1PA 3DBPA 2WMJA 2WANA 4YHGA 2YCKX 5A6SA 3KVJA 3CXOA 4CQ8A 1US3A 3H2EA 1EZ2A 2OU4A 4UR7A 1YIXA 4ZSUA 3TK7A 4EANA 4QDPA 4QM1A 2RKXA 3BOLA 4WXZA 1SFLA 4W86A 4DN1A 1UR2A 1BRLA 1G4SA 2FZBA 3CH9A 4WCJA 4NJHA 3AUOA 4F9DA 4NRRA 2PCEA 3FK4A 1VYRA 2DT3A 4UZSA 2GVEA 4NIRA 4AIEA 2J7DA 4IOTA 3VOIA 4FX7A 4XV0A 3RFAA 3MO4A 4KEVA 4D1JA 4REQB 4GX9A 3VNLA 2QVHA 4DJFC 1EUAA 3H2OA 1R38A 1Z44A 3T0CA 1WB0A 3QFWA 4OE7A 3GXTA 1RY0A 3AMKA 3CZJA 4IX0A 5HWMA 4H2CA 2E09A 3WLKX 5AFDA 2WHMA 2CNCA 2I7GA 4O8RA 2GQAA 2VFFA 3G8EA 1PB0A 3TZNA 1DQUA 1PBGA 1MFVA 3H54A 4S3GA 5I78A 3PBUA 3UWYA 1BYCA 4O17A 4CU7A 3M44A 2WJDA 1ODUA 4FOKA 4A8RA 1LL7A 4B5UA 4CQ9A 2YDSA 4P8UA 2PF0A 3I7QA 1GWJA 3M0MA 4OHQA 1VQTA 1OX5A 3V3WA 1KCZA 2XGBA 5REQA 3LRMA 2KAUC 4IMFA 1OEPA 1SGJA 4QEEA 2BWGA 3APTA 3LBMA 2FJUB 2I5QA 1G1YA 1HT6A 3LLFA 4LYQA 4AVFA 3NQ2A 5AHFA 1QASA 2PU0A 3KP0A 5E0CA 1KBBA 5A2CA 5CPSA 3SAZA 1ONRA 3Q4DA 1XXXA 4GQBA 1BPLB 2V5JA 4PGLA 4U2ZA 3CIWA 2XUCA 4RNFA 3H2MA 3GNPA 1DHPA 2J7HA 2VZSA 1NP0A 4M56A 2CETA 3RU8X 5HNTA 1V3MA 1YXYA 2QPSA 4PBFA 3NQVA 2WYSA 4P5UA 3LCIA 3AHXA 2UZ9A 4PE8A 3CL6A 4ML4A 3QXBA 4GJJA 5DT5A 1PHQA 1G0CA 1TPDA 3KEHA 5D2WA 4C6CA 3TJLA 3LXBA 4OKDA 1MZHA 1P7TA 1W37A 2SFPA 1V0MA 3UD6A 4I8YA 2W61A 3WQDA 2PPGA 4Y9OA 2VEMA 3BK0A 5K4XA 3KL5A 2D0FA 5CLTA 2V2CA 3EX2A 3MCOA 3NL2A 1R9XA 3PNUA 4O53A 3WMLA 4FX8A 3CK5A 4D6EA 3BMVA 3VA8A 1O5RA 4QXIA 3KBMA 3APYA 5AC7A 2GQ9A 3TLLA 3W26A 1OGBA 1WUEA 3LPGA 4FOJA 4GZJA 4RK8A 2QAFA 2BVYA 3AQUA 1LQ0A 3WH6A 5I79A 1GHRA 5LYRA 3S6TA 3LDVA 1WBJA 1ONXA 1E70M 4K36A 1VBGA 4HIBA 2XFRA 1CCWB 1A5SA 5HNRA 3R25A 2E9BA 4GIAA 3TEVA 2UV8G 3STGA 1J11A 1VEPA 2BASA 2E1DA 1A5KC 1PV8A 1MRAA 4ZTYA 3ZFHA 3JUGA 3R94A 4GACA 3TR2A 1TV4A 5D02A 2AQWA 3BLPX 1E6ZA 4XQ6A 2D2HA 3SM0A 3GR4A 2V3DA 1GOKA 3TQ0A 2I57A 4O54A 2INZA 3LBOA 3W81A 1XDJA 4S3DA 1NQKA 3W71A 2G50A 2C79A 1UZ1A 1DXEA 4L6DA 5G2IA 5BW6A 2E8YA 3BV4A 2V9DA 2Q09A 3S47A 4GIYA 5CSRA 2DQWA 3DIPA 3N29A 3PANA 1YXDA 4C6PA 3DYPA 2GOKA 3SUUA 4QQ3A 1XRFA 3S5ZA 4AZHA 5IOBA 2BXVA 2F9RA 5EA9A 4JFUA 5FCZA 3S9ZA 3RMJA 3CZEA 5H6HA 3MDUA 4PRWA 5E70A 4L1GA 2W66A 2PA6A 4MFEA 2NX1A 4XZBA 3DHUA 1JZ3A 2NQJA 4PL1A 3OEXA 4HSOA 2Y85A 4YU1A 2Z6IA 4Z1BA 2QW5A 1NWRA 3Q37A 3PBVA 3EWWA 3A13A 1W1ZA 3BLEA 4Q22A 4FXFA 1ISYA 3ZYZA 2VFDA 1ZP3A 4JX5A 1FFQA 4L80A 4XD6A 3FYOA 3STPA 4HKPA 4QS6A 5GVJA 3H8AA 4R5EA 3OA5A 1DIOA 4FXRA 5HR7A 1GJUA 3KVKA 3GAKA 1XIGA 3PSVA 1LROA 2TRSA 4O0QA 1ZRQA 8CGTA 3EDFA