3W2MA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-183
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-183.
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2mA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2mA01
3TNOA 1TYGA 4KFPA 5C5YA 2QCCA 4QIUA 5D30A 1C8VA 4GNJA 1JCMP 2WSRA 3KHJA 3LXBA 2F84A 2AQWA 4O14A 2YGYA 3B05A 5ABTA 3W71A 2NWSA 4MUZA 2BXVA 1JUEA 3IIPA 4TU1A 4O4VA 2F7FA 2TRSA 4ZVJA 3USBA 2WNNA 1GVQA 1VYRA 3UYCA 4O1CA 3QQ1A 3TDFA 4NNCA 1ZENA 1G67A 5D33A 3HMJG 2DJLA 3P62A 3W6YA 5G5IA 2V2HA 3SGZA 3TK7A 3W7QA 1HUVA 2BZNA 3UPBA 4MYAA 4NNAA 3CIXA 3GDMA 3DH7A 2QF7A 4O52A 2PURA 5H91A 1LZOA 2YXGA 2Y7DA 5I3JA 4M7TA 3VI2A 1F74A 1XDMA 4JYEA 1GPWA 4QITA 1GT8A 3VCRA 1WBHA 2NX9A 2R8WA 3NQ6A 3E96A 2E6DA 2JKAA 1H51A 2ZFAA 3EWZA 3DI1A 3TV8A 3DKLA 3LGEA 4IX2A 3W7HA 1SW7A 1HG3A 3CC1A 2BSLA 5AC7A 3TAKA 1XBYA 4ORIA 5LZLA 1BKSA 2UV8G 4LNYA 3SGUA 1W0MA 1BWLA 1XUUA 2VKZG 1SZNA 1UBSA 4O0KA 3CEPA 3ELFA 3W83A 3G22A 1OX6A 2EAWA 2PC4A 2HTMA 2CLKA 3PG9A 5DBUA 4RXGA 4DBEA 4Z0JA 1FWNA 2AAMA 3NQMA 3PUDA 4YCOA 5KTLA 5FF3A 3TFCA 1TTIA 3HPZA 3W1QA 1VLWA 2YW3A 4WD0A 4DELA 3QC3A 3M5YA 4E2DA 4I7VA 1VYSX 4AEOA 1OFQA 4FNSA 4BK9A 3PUEA 2GVJA 1GTEA 2TMDA 3W22A 3G0XA 3W7LA 5EA9A 1FXQA 2NWRA 3P67A 2VFEA 3NPXA 4XBKA 2CFFA 3PVFA 4BWLC 4RR4A 2Q3OA 3UWQA 3NOEA 2Y85A 4M6VA 5DBTA 3N9RA 5FF4A 1J4EA 3W2KA 5KSWA 1K8YA 1L9WA 1KLZA 3W75A 3HG2A 2GQ9A 2JGYA 4X22A 2E5DA 5CPLA 1ICPA 2FPTA 2QDGA 4Y8FA 2JBMA 2OCZA 2ATMA 1LYXA 2VFDA 2ZA3A 3KRUA 1MXSA 5G4EA 1BWKA 3L9CA 4MOZA 4YMZA 1H1YA 3MP5A 3WFAA 5IBXA 3N14A 1JUKA 4TX9A 3TA6A 1NAL1 4ZQRA 3LBMA 5K2ZA 3A5FA 1IIGA 2ZZ5A 3QEZA 1GG0A 1KTCA 1PS9A 2V5LA 1N55A 4R53A 4JTHA 4UFIA 1SZGA 1FCVA 4YL2A 2YR1A 3BW2A 4UMCA 1DJNA 4Y6GA 4K6AA 2NUWA 4UTMA 1OVDA 5EMUA 4L4LA 4ZQCA 3C56A 2QCEA 3TW7A 1LRTA 2JGQA 3NZ1A 3QSRA 3LRMA 1QDSA 3PUOA 3MI2A 5DLCA 3TMQA 1W31A 5AB3A 5FF0A 4JYDA 1M5WA 1XBZA 1K02A 4AF0A 4X3ZA 1RR2A 2QCLA 2ZRZA 3KAOA 3OA3A 5DCDA 5AYXA 4QNWA 4LVDA 1OYCA 1BEUA 1GOXA 4NT0A 3MJYA 2YZRA 3W73A 1B4EA 1YXCA 3TQKA 2GQ8A 4LVAA 2E77A 3ATZA 2A85A 2FTPA 3MWAA 4JTJA 4DF0A 3DFTA 1KM2A 1NSJA 4LVBA 2IQTA 4UCGA 4FO4A 1EWEA 5K4ZA 3H53A 3BLIA 5BMXA 4TO8A 4QAIA 5IM51 4NXKA 1I2QA 1VQTA 3ZFHA 1VCGA 3LTYA 3QMTA 3TXZA 3W1TA 2CZEA 2VFHA 2QAFA 1H63A 2PCQA 3A5VA 2ZA2A 3W87A 4K39A 2NUYA 4DEFA 3MP3A 1TPFA 2E6AA 1UCWA 3S0CA 1WDWA 3BW3A 2CLIA 3RK8A 2FB2A 3HO8A 1AL7A 4JTKA 2ZRYA 3C2EA 1KTBA 3H54A 4PL1A 1R2RA 4DPPA 3W7MA 1IXQA 1OFPA 3JS3A 1W5QA 4G1KA 1VPXA 2H90A 3W72A 1TO3A 4Z1DA 3QW3A 1ZALA 1JRBA 5LGXA 3S5NA 3LBCA 2FPVA 3BG5A 3W1MA 1AW2A 4M19A 3C2RA 2TPSA 3MHFA 5CSSA 2WQPA 3NPVA 4OWGA 1K7EA 2BLEA 5E1QA 1M7PA 1JR1A 2PRMA 1DJQA 3E02A 2FDSA 3ABSA 3KXQA 2QR6A 1R47A 4Z1BA 1SU5A 3WK2A 2JK2A 1YDNA 3FLUA 1R2SA 5FI8A 2Q8LA 2HS6A 2E09A 4WXZA 3GIYA 1ME9A 2H3DA 1PVNA 4RK8A 3RLUA 3LI0A 4U28A 2EGZA 1D9EA 3GDLA 1ZAHA 3MMTA 4JTEA 3LHUA 1ZJIA 3KX6A 1QWGA 1RV8A 3U6WA 2X1UA 1ADOA 3P8IA 5TBOA 4MKNA 1IF2A 1G4TA 5AYYA 2QCDA 1GJPA 3QFEA 3P5ZA 5D05A 2ZZ2A 2FPYA 4BI5A 1QOPA 1GVRA 3G8EA 1H60A 3QMSA 3PWAA 4NJJA 2FQIA 5HINA 1JCLA 1VH7A 3C2OA 4YWIA 1A53A 4LW7A 4TMCA 1WBJA 1FDYA 3E0IA 3KVJA 5FESA 3S9YA 4B5NA 1H62A 1NEYA 2ABAA 1SO3A 3P80A 1Y0EA 2CU0A 3O05A 1KBIA 1V7YA 1KM0A 1VGAA 2ZA1A 3T4CA 5K4XA 1G4SA 1TIMA 5BW6A 1JRCA 1H7RA 5LHEA 3P82A 1JCXA 2C6QA 3UNDA 2Z6IA 1FWWA 1X1ZA 5G1TA 1DBTA 5D04C 3W1NA 1YPIA 4IPJA 5C2XA 2EHHA 1TPVA 2Y88A 2VFGA 1QNVA 2J9ZA 3NL5A 2KZHA 3GB6A 1F2JA 5KITA 3EWBX 5LNSA 1H7PA 2E6FA 1U5JA 3C2FA 5J5RA 2VC6A 4LV9A 1QOQA 1RVGA 3C3NA 4EF9A 4O57A 5U4NA 3LOTA 1H7OA 2ATSA 5BRBA 3S5OA 1LRNA 2WSYA 1VHNA 5F4WA 1XBVA 4JX6A 4JIQA 4FNRA 1RQEA 3CLMA 5DN1A 3EB2A 3U2OA 3KRSA 4RV8A 4OU1A 2QUVA 1J5TA 5G4WA 1A5BA 1W3NA 1L2UA 2ZBTA 2Y70A 4O28A 5HQEA 4MLJA 5G1YA 4MYXA 5AHEA 3HG4A 3O6YX 2J24A 1G69A 3HQ1A 5KINA 1XDLA 4A2SA 3O6CA 5HWMA 5HULA 1VJIA 4JD4A 2E68A 1S5VA 3B0PA 3L5LA 1N8FA 2V81A 4I7UA 2XN2A 1OFAA 1EEPA 4LT9A 1W56A 4GUHA 4MVAA 1JQVA 3S1UA 1THFD 2DU2A 1DKWA 1JJKA 3W7IA 3SFKA 3W2LA 4DPQA 1EWDA 3SW6A 3NGJA 1TPEA 1TV5A 2C13A 4O10A 4MLRA 4ZMGA 4IX0A 4DXVA 1YDVA 1QPNA 2RH9A 1YADA 5DCBA 5D2XA 2NXGA 1CX9A 2NXIA 3EKZA 4JX4A 1FWSA 1F7BA 3QZEA 1YXYA 2DZPA 3W1XA 1KFEA 4O13A 3M16A 5EKYA 4NX5A 3QMRA 1Q6RA 4GXMA 5TQLA 1SO6A 2HS8A 1FWRA 3U8GA 3W7OA 2QCGA 3GX9A 2YFNA 4N02A 1OYAA 5LSMA 4PL2A 5A5WA 1B57A 3IGUA 3M43A 5EY5A 4P61A 3O15A 4FXRA 1OK6A 3TSDA 1S3HA 3TMLA 3M5ZA 4ZQOA 1XL9A 4Z1AA 1F6KA 1OFBA 3F4WA 2NV1A 4LRSA 3OBKA 1KW1A 3KVLA 5LGZA 3G1HA 2A7NA 3THAA 4M5PA 1SSGA 4DF2A 2O7SA 5KZEA 4C1LA 5AC8A 3NR0A 1F76A 2V2DA 4NJGA 4E2BA 2Y7GA 3UZJA 2ABBA 3BGJA 3SSJA 3NO5A 4O0ZA 1Z41A 2WNZA 3FKKA 1YXDA 3E49A 4IJBA 1SFLA 2P0OA 2ZZ1A 3NXFA 1ZNNA 4UTIA 3L67A 1HFBA 3W70A 4K38A 5K3VA 3FKRA 4MPQA 4N4PA 4IOTA 1VHCA 2V30A 4AH7A 6TIMA 3F03K 2OT0A 1MO0A 3EWYA 2A7RA 1PL9A 3NQEA 4IXHA 4EIVA 4IMFA 1J2WA 2G5WA 5DXXA 1LOSA 4ADSA 3QSTA 2JKPA 3NVTA 2W79A 3KFTA 3T40A 4GUIA 2CLMA 1G4EA 2XN1A 3LTSA 3M47A 4CCCA 1G7VA 3DZ1A 4JDYA 4EWND 4RLIA 2GUUA 2X1TA 3Q94A 4XBSA 1N7KA 5HR7A 3W2JA 3PG8A 1Q6QA 2DZUA 1TQXA 1HO1A 4UIOA 3C0JA 1F05A 3LRLA 2E1DA 3FYOA 2G97A 3A21A 4FX8A 5A8GA 1KA9F 3IGXA 1H7XA 3CTLA 1O60A 3OVQA 3BW4A 5G2WA 3ABOA 4JGDA 3WJWA 3W1UA 1ONRA 3LV5A 2EKCA 4R34A 3UZ5A 3W2NA 5EPDA 3NL3A 5IBXC 3GR7A 2CZDA 2ZTJA 4ZL1A 3W07A 1W37A 3I68A 3C52A 5F1VA 4EOUA 1WA3A 4HPXA 2VEIA 3R5EA 3SI9A 1PCKA 1QFEA 3RFAA 3HF3A 3MW7A 4AVFA 3IIOA 3JRKA 3HB9A 1FBAA 3QRHA 4E0CA 1AG1O 4JTUA 3WK3A 2WKJA 5D2WA 5KZMA 3LHZA 3VE9A 1A5SA 3PC0A 4BR1A 3C4UA 4UFHA 3NA8A 1PCWA 1WXJA 2ZZ6A 1K3UA 3GYEA 5D2YA 2O7QA 2R91A 1A5AA 4XTDA 4FNQA 2BTMA 2X1RA 3O1NA 3G1VA 1XFBA 4O16A 3NM1A 5HMSA 2NV2A 3LI1A 3M9YA 3MI6A 4GUGA 3LTPA 3O06A 1RD5A 2CLOA 5D2VA 1JCYA 1L6YA 3HOJA 3CU2A 5L6UA 1EP3A 5K9DA 3MBDA 1UUOA 2CLEA 3W86A 1LBLA 1WAUA 3N73A 1EP1A 4N6FA 2OZ0A 4WXYA 4O18A 3TQVA 4LRTA 3TC7A 4P2VA 2G96A 1M7OA 3SJ3A 2YCEA 3OHIA 3ZS4A 4NXSA 1SFJA 4GRSA 3UWWA 4ZZ9A 1LRQA 3GLCA 3THQA 2CZ5A 1TB3A 3BO9A 1RPXA 2LLEA 3GVGA 2VELA 5J5DA 3UWVA 2J27A 1OG0A 1DQWA 3TJXA 2Y89A 2J9YA 4A29A 3G3MA 3KOFA 2E5CA 4H3DA 4KFNA 3LHYA 5AHMA 2HMCA 1PHWA 3HJZA 1NVMA 3IVSA 1PV8A 1C29A 4O4WA 3CM4A 3BLFA 4PH6A 3LRKA 1WOAA 3NDOA 4IPIA 3IGSA 4H6KA 3LHTA 3W7CA 3FA5A 3M7WA 4TIMA 4X2RA 1O94A 4LC6A 4JTTA 4S2BA 1H5YA 1KLYA 2FB3A 3ANYA 4Z0SA 5HNRA 3G1SA 3QPZA 1LCOA 1L6SA 4UXDA 3FJ6A 2VOMA 1OFOA 2EF9A 3N3MA 3GAYA 1S5WA 2ZQ0A 3CT7A 1ZAJA 3I6RA 3PULA 5EYWA 4O11A 4PODA 1ALDA 5FEZA 3TR2A 2Z6JA 3DHFA 4RXFA 3SR7A 2GQAA 1R30A 5TIMA 4HNTA 3G0SA 5FF2A 3QF0A 1H1ZA 3GAKA 1JVNA 4GWEA 1QMLA 4N2YA 4WOZA 3RNDA 4ADTA 1TMHA 2ZZ7A 1R2TA 4N4QA 4ZQMA 1FX6A 2DZTA 4JR5A 3PBWA 4HSOA 4UFLA 3LLFA 3RLVA 2RDTA 1AW1A 4L4MA 4I9AA 3G1YA 1L6WA 2Z1BA 3G0UA 1TRIA 3IIVA 3L21A 5AN7A 3R89A 4JS3A 1PIIA 7TIMA 5F1UA 4W9TA 1I2PA 1FDZA 3IIZA 2QAPA 4HNVA 2J9XA 2GOUA 4R33A 4WUIA 3P7YA 3UY8A 2ZRUA 5CZJA 3SY5A 1YYAA 2NLIA 3STFA 3TH6A 2QCHA 2GJLA 1I2OA 1TQJA 4BWLA 4KKXA 4ADUA 3QJAA 3NQ2A 4FX7A 5C6MA 4LVGA 4MY8A 3PS7A 2TYSA 3UWYA 1TRDA 3TFXA 4LUJA 2NXHA 4Y96A 3CIWA 1KM6A 1SO5A 4Q33A 2QCDB 4Z08A 3WJXA 3CB8A 1XUZA 5BMWA 3LB0A 2A2IA 1HO4A 2Y6ZA 2WOQA 3LCFA 1MZHA 1DHPA 3CHVA 4DO4A 2QUUA 1WOBA 3W85A 5I3FA 3L0GA 4AF0B 1P0NA 4OT7A 3SZ8A 3S8HA 3MHUA 3I7SA 4IGHA 4OV4A 4IUOA 3A22A 4N9CA 5K7JA 5DY3A 1F5ZA 2YPIA 4FNUA 1EUAA 1ZCOA 3NYZA 3G8RA 5HWJA 1FXPA 2AGKA 5HR6A 3N2XA 4AHPA 4IMGA 4ORMA 1LTDA 2VFFA 2A1YA 2DORA 4JTLA 2XFWA 1TCDA 2D73A 2QJIA 4PA8A 5U7SA 3MYPA 3B06A 4O1BA 4CCEA 1AMKA 5MHBA 3IEBA 3NQCA 4LS2A 5D03A 4GFSA 3BV4A 4K8HA 2V5BA 1UASA 3W84A 3R12A 3BPWA 4C1KA 4ONVA 1LLZA 3GNNA 5FF7A 1X7FA 4QISA 4Q4KA 3LCGA 1KFJA 2H8XA 4A21A 3BG3A 5LNWA 4XUGA 3TW6A 2OX1A 4UFKA 1XXXA 4KWVA 4WOQA 2WV8A 4LVFA 1KM5A 1JUBA 3UD6A 3BVJA 2P10A 1ME7A 1JCJA 3VNDA 5E0KA 5AHNA 2NX1A 1DQXA 1A50A 3ZWTA 2CLHA 2VEMA 3W7KA 4FX6M 4KFOA 4CQ9A 1RZMA 1OX4A 3G1DA 3UY7A 3KVMA 3HPXA 1E51A 4FNPA 4EF8A 1SW3A 2ZZ4A 3EXRA 4FXSA 2A7PA 3BLEA 1ICSA 3F1QA 3I7RA 4EVZA 3TJLA 3NZRA 1H7NA 3GDTA 2QCMA 1TPWA 4WJEA 5HJLA 1QO5A 2QUTA 4K7YA 4O19A 1TTPA 3MI3A 1I4NA 3PY2A 1G4PA 1EB3A 4FNTA 2R94A 3W3OA 2WNQA 4AMAA 2I1OA 4HPJA 1LBMA 2BWGA 4ICNA 1KBJA 4O54A 5LNUA 3F4NA 5D02A 1GVOA 3P8JA 2Q3RA 2V2CA 1I2RA 3HBLA 3W7JA 3T44A 1C9DA 4JICA 2ZCGA 3W1LA 2QKFA 1XM3A 1EUNA 1Z44A 3T78A 4PFMA 5F2MA 3PSWA 4AB4A 4WZHA 3NL6A 3O8AA 4UR8A 3LM7A 4OV9A 3N34A 1NFBA 2ZDRA 3P84A 3FFSA 4MJZA 1SUXA 3LXAA 4AHOA 2EPHA 5D38A 4UTTA 3JR2A 2B7QA 3C61A 4BI6A 2YFOA 1SO4A 1ICQA 3CPRA 3TCEA 4AAJA 4KWWA 4UNLA 1DL3A 1VS1A 3I7QA 3B4UA 4HKPA 2DZVA 2QJHA 4MJMA 2BX7A 4JY9A 1MEWA 2CWNA 4M7SA 3O16A 1CW2A 3NPUA 2B7PA 5SWUA 1GEQA 3W7RA 5HWNA 4ZQPA 1DV7A 4IXXA 1QR7A 2QCNA 3MUXA 4NQ1A 2XN0A 3ZWSA 3NQAA 3UXAA 4IMDA 3DI0A 3G1FA 4OE7A 4UTWA 1W1ZA 1CI1A 4HN4A 3FIGA 3TIMA 3M44A 2PRHA 1W5OA 3W1RA 1IXNA 3DXIA 3PSVA 1TV8A 3O6DA 3DU0A 2H8ZA 3PBYA 3E12A 3LXCA 1W54A 3IRDA 1FCBA 5FEPA 3HGOA 4AWTA 1IIHA 1KFKA 1T8XA 3GNDA 2V8ZA 4UC5A 1TPH1 3L65A 5HUPA 3ZR4A 4CNNA 5D2TA 5DY2A 4JTSA 3OIXA 4AXKA 4HHPA 2ZTKA 1VLIA 3CWOX 5DCEA 1F73A 3TE9A 4X9SA 1WX0A 3HGRA 4MFDA 4LWWA 3G18A 1S5TA 4DO5A 4DF1A 1D3HA 1OFDA 1QAPA 3A9IA 4WY0F 1ML1A 3ATYA 3EXTA 3P61A 4IMEA 3MYOA 3W7EA 4OQVA 1QO2A 4MZ8A 1U83A 1B9BA 4BI7A 1XC4A 3Q37A 2WSQA 1OYBA 2RDWA 4LV4A 4MFEA 1W3IA 3INPA 4N6EA 4FB7A 1I45A 3WJZA 5I3KA 5I3GA 4Q32A 2WJZA 4MZYA 5DELA 4BFAA 1GZGA 2V0TA 3B03A 4XZ9A 2ZRVA 3Q58A 4O1AA 3N2MA 2FJKA 4BF9A 2QCFA 3M0ZA 2VEKA 1QCWA 2ISVA 3BGGA 5LHFA 5C55A 4N9DA 4Z1CA 4YCPA 1VZWA 2VENA 3PBUA 1X1OA 2YW4A 4AWUA 3YPIA 2NZLA 4UR7A 5F2LA 4UTJA 3L0NA 4CCDA 4FF7A 1PHQA 4K7VA 1XBXA 4JEQA 4GC4A 4GUFA 4POCA 2JKEA 1DORA 3DFPA 4O17A 2B4GA 1FY6A 1VCFA 3B0UX 1TPC1 3NQ7A 4XKYB 1T99A 1D3GA 4JX5A 1K8XA 1QPOA 1P0KA 3O63A 2NUXA 1TJRA 3CEUA 5AHIA 5D37A 3V75A 4K37A 5AFDA 1AW5A 3OVRA 4M6PA 4CNPA 2OJPA 1ZFJA 4UFJA 4GJ1A 4PTNA 1OABA 3S42A 3STEA 1G6CA 4HT3A 2H6RA 3GDKA 4HIBA 3EX2A 5T26A 6ALDA 4CLMA 3C8FA 3G24A 4NVTA 2Y63A 4JDBA 2CLLA 5AHFA 4XTIA 5LNRA 5BNKA 4JXCA 3GR8A 1QPRA 1TPDA 4IWWA 3BARA 3LLDA 3L0KA 2WPBA 4UFMA 2YYTA 4A22A 3TQ0A 1SQ7A 3HGSA 4LOCA 4K36A 3NL2A 3T7VA 3W2UA 5L9FA 5E93A 2WO5A 3LERA 3W1AA 2HSAA 3TKFA 3NQGA 4UTWC 3P81A 1NF7A 3RU6A 1KM4A 3G3DA 3UPWA 2NX3A 2RFGA 5D09A 2CZFA 4AHQA 1IGSA 1M6JA 1LDCA 1GG1A 4IMCA 5AYZA 5K9CA 5I3IA 1KTNA 5F2IA 3IIXA 4NX0A 2GJNA 1OJXA 2ZYFA 3IV3A 2C18A 4UMBA 4UTHA 1FCUA 3W1PA 4TMBA 5I3HA 2A0NA 1ME8A 4LUIA 3MP4A 1TSIA 3LCWA 3A23A 1O5KA 2C1HA 1X6UA 2I9EA 2ISSA 4A2RA 3D0CA 3EWXA 3L5AA 1OX4B 3PB2A 1GYLA 3NQDA 1YTEA 3EEGA 2VXNA 1KV5A 4UMAA 2V82A 1H7WA 3NQVA 4FIQA 4O50A 3LDVA 5AC6A 3S5YA 1I2NA 3A24A 3W74A 4WQ6A 1TPUA 4OBTA 1JULA 5FEXA 1Z48A 5CGQA 1W5PA 4GBUA 2I14A 8TIMA 4R7JA 2PRLA 4Y9AA 3UQNA 3EX4A 2OMAA 3AJXA 3QPYA 1T0OA 1GYNA 3GXNA 2ALDA 3LCXA 3LHWA 3TX9A 2G95A 2PE4A 2YDAA 3EXSA 4RZ6A 2B7NA 1KFLA 3WJSA 1EX5A 1SZFA 3M1ZA 4QM1A 1UB3A 2R14A 3R2GA 4PCFA 3S1WA 2RKXA 1Q6OA 5K9XA 1YTKA 3HG3A 4JTFA 1O4UA 4JN6A 4A3UA 1B4KA 3LHVA 3STCA 4O8RA 4O12A 2RDUA 4H4IA 2C15A 3HIJA 4I7WA 3S1VA 2B0MA 3W23A 4LU0A 3E9AA 4UTTC 2C16A 4NZFA 1H50A 3RF9A 1LP6A 3B04A 5F2GA 4ZQNA 3G1AA 2RHGA 1W3TA 4S1FA 4RZ4A 3GZ3A 1SR9A 1YDOA 1GVSA 1VC4A 4JY8A 3ABQA 1W5MA 1W8SA 3SECA 3NQFA 1YTDA 5C54A 2DZWA 3L2IA 4AWSA 3GKFA 2C3ZA 1PE1A 1TREA 2A4AA 2FFCA 2J88A 4LS1A 2DP3A 2Z2UA 3NAVA 2J6XA 3W88A 4UNKA 3TSBA 1K03A 3M6YA 3DFQA 3QH2A 4WX2A 1GVFA 1SPQA 2DZXA 4MIMA 3FOKA 4LY8A 4RX0A 1ZAIA 3O07A 2A6NA 4N9BA 3H55A 3DGRA 4OHQA 1WQ5A 1NF0A 4NU7A 3WJYA 3PBVA 4K8EA 3V1PA 5G2IA 3KRZA 3I65A 1W5NA 3UWZA 1LOQA 5H2ZA 1AK5A 3FYPA 1OFEA 3P5YA 3KVKA 3NG3A 1KFCA 5G2HA 1MEHA 1OF8A 2Y61A 4RKAA 2E5BA 1KFBA 2Y7FA 1FDJA 3NPWA 3LCIA 2X30A 1TTQA 5CSRA 4LS0A 2TSYA 1UJPA 3DENA 3N19B 1VRDA 3NNTA 1K7FA 2ISWA 4XWUA 5CZ0A 1IXOA 5HUOA 2A5HA 4JIPA 1Z42A 1V5XA 1EA0A 3FJLA 5BOOA 4NZJA 4FIRA 2P1FA 1SW0A 3PR2A 1QPQA 4U4MA 1VCVA 5AHLA 3DFOA 3K30A 3WK0A 1K7XA 4O1DA 1OHLA 1K8ZA 3TC6A 1P5BA 3W76A 2H3BA 3NQ8A 1RQBA 2FLIA 3M5XA 4NNBA 3OEXA 1AL8A 2Q8ZA 4DQWA 2A21A 3CWNA 3P60A 1T96A 2GVGA 4HNNA 5F4SA 3BK0A 5EBUA 4M6QA 3IVTA 4DBDA 1I8JA 3M5VA 4CQ8A 4D2JA 1VYPX 2W6RA 4IQLA 3RMJA 3W7NA 3PF3A 5CZTA 3OVPA 3N9SA 5CG7A 3VKJA 1H61A 3TXVA 3W9ZA 1GTHA 1SSDA 1GQNA 3G1XA 1RQHA 3NM3A 1OK4A 2C0AA 2GVLA 1O95A 4O15A 1WYIA 1HL2A 1XCFA 2ZZ3A 1JQXA 4ALDA 2QEZA 1YLVA 5LKYA 3QM3A 1ZY9A 4QSHA 5GVJA 3S6DA 3CQ0A 5D32A 3ABRA 4CQAA 1LM1A 3IVUA 3M41A 2X2GA 3L5MA 3LV6A 4E38A 3L66A 2E6YA 3QYQA 3OG3A 3GK0A 1LOLA 3GKAA 3SIZA 2Y62A 2X16A 4RZ5A 2VFIA 3TROA 3P74A 5DXYA 5CKSA 5KMYA 3TUUA 4NJHA 3DFNA 3FS2A 3STGA 3EX3A 4CNOA 4JYFA 3FEMA 4YXGA 3EX1A 4S2CA 1FQ0A 4NUWA 1X8FA 4HSNA 4XQ6A 1SZEA 4ML9A 3S1XA 4NJKA 4GUJA 4Y90A 5CPMA 2ZRWA 1A5CA 2OT1A 3W7DA 5LNVA 3EWWA 4PC8A 3GXPA 1TTJA 3EKLA 5FEWA 3DKJA 4WY0B 1IXPA 1GWJA 1P1XA 1P4CA 2ZRXA 1OFRA 1KM3A 4JNMA 1ZHAA 3S5ZA 4UTLA 3LCHA 4DO6A 3HPSA 1EP2A 1Q6LA 2C19A 3AO0A 3LCLA 4MY1A 5F4XA 4JTGA 4WY0A 1Q3NA 3UXDA 3R8RA 3PAJA 3TU9A 1LLWA 1B3OA 2GPTA 1G7UA 1Q45A 3VE7A 4GE8A 2YYUA 3EX6A 1DVJA 3T55A 1VR6A 1EIXA 3VFLA 2V9DA 1FUYA 2FIQA 1BTMA 4PEKA 4UTUA 2QJGA 2YSWA 3B8DA 3C2VA 1XI3A 1JCNA 1TPB1 3B0VC 3PB0A 3PM6A 3MBFA 1OX5A 4LTSA 4TR9A 4QJ1A 2QDHA 2X1SA 4FHAA 4O53A 1WV2A 3MHGA 3W7GA 3L68A 1TV7A 3DBPA 5EL1A 3NEVA 1LBFA 1KV8A 3HG5A 3MO7A 1LROA 5CPNA 4HNUA 4NJIA 3QQ0A 3LX9A 3DAQA 3HGJA 2Y7EA 4RJEA 3BG9A 4RCXA 4QQ3A 4MY9A 1R46A 2YX0A 4FEZA 1YPFA 4UUIA 4QNEA 4JTIA 1TJPA 2W0UA 1XKYA 3DFSA 2CW6A 2CLFA 3UWUA 4J9JA 1FCQA 4OGZA 3DHDA 4LC8A 2DZSA 2VEPA 1HTIA 1F6PA 1UUMA 5CZSA 1MEIA 2A6LA 3W2MA 3GDRA 1LORA 4MZ1A 4YLWA 3TAOA 3Q2DA 3GXTA 2B7OA 1MSSA 1EPXA 3EWUA 3R13A 4N9EA 4UTKA 2Z0IA 3TSMA 3W7PA 3QW4B 5CPOA 1KM1A 1O5XA 1FWTA 5AOUA 3C6CA 5KZDA 2C14A 2DJXA 4XKYA 1DOSA 1OF6A 3WK1A
chains in the Genus database with same CATH superfamily
3A6OA 1KXQA 4KFPA 3WLSA 3LGDA 3WDJA 3WEOA 5D30A 5AC4A 3OTRA 1C8VA 4GNJA 3OQ8A 3PZ9A 3E2QA 2YGYA 2WHJA 1LG2A 5E09A 2BXVA 2HPIA 3MUIA 3CZGA 3VNYA 1VYRA 3UYCA 2HJPA 2J7DA 2AL1A 4MJ4A 1TV3A 1W9XA 3P62A 2V2HA 1QOXA 3SGZA 3D47A 1OCBA 3CZ8A 3CIXA 2OGJA 3GDMA 2QF7A 1W2PA 3NFUA 3TN4A 5I3JA 2ON3A 3TTOA 4JYEA 5IHSA 3NQBA 5AYBA 3QKEA 3NQ6A 2MNRA 2JKAA 1BHGA 1C3FA 1H51A 3DI1A 2V67A 3IUHA 2PDLA 4EPBC 2L5HA 2BVTA 4GI8A 3PZVA 3AIUA 4DAFA 2EXOA 1XBYA 2OLSA 4E8DA 2O9RA 4LNYA 2C7FA 3SGUA 2E3ZA 1NOWA 1P7TB 4MWAC 4O0KA 4AYGA 3GD6A 2DT0A 2CLKA 4RXGA 4YHEA 4Z0JA 1TUXA 3GC5A 1DQUA 3MDUA 1JFHA 3WQ6A 2YCLB 2PU0A 3TJ4A 3IV8A 3TFCA 1TTIA 2G8ZA 3HPZA 3W1QA 1UIPA 4KS0A 4KIEA 2WC4A 3V18A 4DELA 3OG2A 4I7VA 1VYSX 4FNSA 5C2GA 3ALGA 1GTEA 2TMDA 1VJSA 3G0XA 4H41A 3W7LA 5EA9A 3NPXA 4HK7A 4BWLC 4G7EB 1CGWA 4ICCX 2Q3OA 3UWQA 5HANA 1U1HA 2WAGA 1SFTA 1B3WA 1UIOA 2VEFA 4E8CA 3PPCA 3CMFA 4P7RA 5DMNA 4AXNA 3CYJA 2G37A 1YNYA 1K8YA 4MB5A 1VF8A 3W75A 2WWDA 4M80A 1BPLB 4HNOA 4X22A 2E5DA 3GM8A 2VDGA 2JBMA 3KBSA 1E73M 4I6KA 2VFDA 1UR8A 1QRQA 4K1WA 5CSUA 3H7VA 3L9CA 2AMGA 1H1YA 4B3ZA 2XM1A 2QMKA 1JUKA 2WZTA 1WKDA 1NAL1 4ZQRA 1JDDA 5GQBA 1QBBA 4F3HA 2CPUA 3TC3A 1IIGA 2ZZ5A 3QEZA 4HPHA 1KTCA 2A79A 4R53A 4JTHA 1MXGA 3AZSA 1SZGA 1FCVA 2YR1A 4UTMA 4L4LA 3SQSA 4NAEA 3C56A 2PD9A 4X0VA 2QPUA 4IF2A 3AIWA 3SCQA 5DLCA 3O6AA 1ZZMA 2PMQA 4B2DA 1GOKA 4M6UA 3U3HA 2ZRZA 4KGLA 1CCWB 3OA3A 1E3XA 4QNWA 1OYCA 4IT1A 4CCZA 3CUHA 2YZRA 1MNZA 1JPIA 2CWXA 2ACRA 3TQKA 4DLFA 3N1AA 4PUWA 2E77A 3MWAA 2IQTA 3GC4A 4UCGA 3BLIA 4TO8A 4NXKA 2C91A 4C6MA 1XLJA 1WKYA 3LTYA 5JH1A 3U57A 2CZEA 4XKMA 1NOFA 4K39A 2BHZA 4M0XA 4ZTYA 4EK7A 1QVBA 3VIHA 3S0CA 4PR4A 1O6IA 6A3HA 4U5IA 4GG9A 1QXLA 3REQA 2WCGA 1NWTA 2CLIA 4S3KA 1QNOA 4IH3A 4JTKA 4PL1A 3W7MA 1IXQA 4BEQA 4G1KA 4R7OA 1UD2A 1VPXA 3W72A 4Z1DA 4GXWA 1B31A 5LGXA 3S5NA 3LBCA 2FPVA 2GDUA 3W1MA 1AW2A 2F6UA 4WSHA 3C2RA 5FCZA 4OWGA 2SFPA 4DBSA 3S9ZA 1O7AA 3IAPA 4LB3A 4XO6A 3CHFA 3E02A 1W9PA 3KXQA 3DUGA 2DIKA 4B5TA 4UTFA 4Z1BA 3FLUA 5FI8A 4F40A 4ZOEA 4WXZA 4S3GA 5I02A 3GNOA 4RK8A 1ZGDA 2GK1A 4G2DA 3L7RA 3H2FA 1X7IA 4JTEA 3LHUA 2Z4GA 3VGFA 7ODCA 1ADOA 4AZ6A 3UA4A 2PZ0A 4MB1A 3QR3A 4UQDA 3O7UA 1DJWA 3IUDA 4A8IA 3P5ZA 4J27A 1XRTA 2FPYA 3WLIA 3GC2A 4L6HA 4HMCA 3S4TA 1VH7A 3JZEA 4LW7A 3WFLA 5HNTA 4HK5A 1FDYA 4G8TA 3DECA 1BLIA 3S9YA 2J7BA 4MNLA 4JFUA 3TLLA 3O05A 1KM0A 5E0CA 1VGAA 3H21A 1G4SA 1TIMA 4Q7IA 5BW6A 1XV8A 3BOLA 4NI8A 3P82A 4FP1A 1UWIA 3QZ6A 2DZBA 2EG7A 4OBSA 4QTGA 4O1EA 4LXFA 1DBTA 5D04C 3GH4A 5CLWA 2Y88A 2VFGA 1QNVA 4HNLA 2KZHA 5KITA 1QNSA 2E6FA 4BHYA 1HKJA 4EF9A 1L0PA 4XAFA 1US0A 3CQKA 1SM9A 3KBJA 3A3HA 1LRNA 2WSYA 3HV8A 3VFCA 1FRBA 1QW8A 3KW3A 3H7UA 3CLMA 1GQIA 3EB2A 1XLGA 4XSMA 2MANA 4KBXA 3CBWA 2OYMA 1MUWA 3RGTA 2J8FA 1YHTA 2J24A 2OKTA 3HQ1A 4A3QA 1C8YA 3LMYA 5HWMA 5HULA 1VJIA 3L5LA 5C2CA 1N8FA 2V81A 4I7UA 4B5VA 1OFAA 1EEPA 1EGZA 4IM4A 1W56A 4GUHA 4MVAA 1JQVA 5LXEA 1ZUAX 1THFD 2DU2A 3UJRA 2BHUA 1JJKA 1FWBC 4C7GA 3ME3A 5LIYX 4MLRA 5JBFA 2PD5A 3WY1A 4IX0A 1QPNA 1YADA 4MNKA 5M17A 3AHXA 1FWSA 4GZEA 5FA5A 3DESA 3WDHA 1LUCB 3ANVA 2CZVA 3OZPA 3QYSA 4WVXA 1J0IA 3AIQA 5C7VA 3AMLA 3E0LA 2HS8A 3U8GA 4LBUA 1HL9A 1V08A 1V7AA 4N02A 3T05A 1DJYA 3QY7A 3WF3A 1XG4A 2J7FA 3CJPA 3KBNA 3WBYA 4JL2A 2VO5A 1B57A 4XZWA 4WDXA 1I0DA 2WZHA 2GGHA 3W82A 1OK6A 4V2XA 4QS5A 3TMLA 2P3EA 3QC0A 4ZQOA 1XL9A 3AS0A 3TWBA 2NV1A 3VDGA 5GJMA 1V6TA 5LGZA 1FOBA 4IIGA 4PTXA 5DT5A 3WN6A 5FSEC 1TFVA 1HNYA 3PJTA 5E70A 3H12A 4L6DA 3UZXA 3KL3A 1DWGM 2BP1A 3CZJA 1G5AA 2WJDA 2JF6A 4AQLA 5IXEA 2YIHA 2O9OA 3ZVHB 3SSJA 1PX4A 3FKKA 6XIMA 1BSIA 3V4BA 2OGYA 4UTIA 3UCCA 4K38A 2VZUA 4D6DA 3DC0A 3FKRA 1A5LC 4IOTA 2Y8KA 4AH7A 4R88A 5I77A 2OT0A 4ERIA 4IZGA 1KXVA 1MO0A 2ISDA 1RJPA 4EIVA 3NQEA 5DXXA 3A64A 1JXKA 1LOSA 1EDQA 1N2VA 3QQWA 4XVEA 5FJUA 5AY7A 2GZXA 1SGJA 2MUCA 2VVSA 1M7JA 4QSFA 1G7VA 2D3NA 1OGBA 2E8YA 1N7KA 5E9AA 1Q6QA 4HCLA 2YBVA 1BYCA 3LRLA 4CKQA 4HZ7A 1NM9A 2V3FA 4EANA 2G97A 5GJNA 1AD1A 4ZODA 5A8GA 4B5XA 4RNFA 1BXNA 1KA9F 5I03A 4OIFA 3QLLA 1MWOA 3OVQA 1JZ2A 3TNBA 1JI2A 1TELA 4Q4SA 3ABOA 3LV5A 2EKCA 4R34A 2TODA 3H24A 5CCZA 3KDOA 2DSKA 3W07A 1XRVA 1YE4A 4CVWA 3PWIA 3MMDA 4B15A 4EOUA 4HPXA 3L4VA 4XD5A 5GJPA 4LY4A 1PCKA 1QFEA 1UR9A 3RFAA 4AVFA 4WKFA 3JRKA 1K9DA 2OO6A 3ARXA 1AG1O 3E0WA 3RX4A 3WK3A 2WKJA 3VUPA 3AYSA 1B0IA 4RE2A 3VE9A 1SJCA 1A5SA 3WQVA 4C6FA 3WQPA 1WXYA 5H8PA 3GHRA 2GUYA 1PDYA 2BTMA 2X1RA 1VBRA 4CEUC 4QJ4B 2POTA 3M9YA 2BY1A 5BXRA 3MI6A 1Y5VA 1R7OA 2PCEA 2YL9A 3O06A 1U1JA 1O5QA 2WM0A 1L6YA 4MNMA 3N6HA 1XIIA 5K9DA 2NQHA 3B8WA 1PSCA 4Q4MA 4EP8C 3GXDA 4UZSA 3GUWA 2D2HA 1EP1A 4N6FA 2OZ0A 3TQVA 4LRTA 3TC7A 4HMEA 1PKYA 1M7OA 3JU2A 2WNWA 3OHIA 4NG3A 5FAGA 2WMFA 4D8AA 4U10A 2DUZA 3LN3A 3UWWA 2BY0A 3CAKA 1LRQA 1XIHA 4J3ZA 3P3BA 2OX4A 3BO9A 4DUVA 2VELA 1VPQA 3T8LA 1DQWA 3TJXA 2J9YA 4IGNA 4H01A 4FK9A 3VZZA 3EWDA 2ZC8A 4AC1X 1J96A 2R24A 3K4WA 1LWHA 3CAQA 2WYSA 1PHWA 5JBEA 1NVMA 3IVSA 1PV8A 4V1XA 4H6RA 3CMGA 4PH6A 4REQA 4LAMA 4GLEA 1PWMA 1KNWA 3NDOA 3W26A 4PMRA 4Y9OA 1QW9A 2XSBA 3FA5A 1RA5A 4TIMA 5D9OA 2DW6A 3N3TA 4LC6A 4A4AA 3VMOA 4D6GA 1UD3A 3ANYA 3SBFA 3G1SA 1ISYA 2PODA 1LCOA 4UXDA 4QBXA 1UWSA 3WBAA 4O11A 3LG3A 3WLPA 3IK2A 1IZKA 3BCFA 4UQ9A 1X39A 3G0SA 1JVNA 4IGMA 2E25A 4DAIA 4BKNA 2ZZ7A 1R2TA 3QBUA 4ZQMA 3MUY1 4UFLA 4XVDA 3LLFA 4Q7BA 3WELA 1SMDA 4L4MA 2BASA 2OVLA 3GS6A 4ZOBA 3R10A 5FJOA 4ZXOA 1U33A 1H0IA 1X6LA 4D6FA 3R89A 4JS3A 1PIIA 4F0HA 1XRSA 2WVTA 2J9XA 2GOUA 4MPKA 4R33A 1R3VA 4WUIA 1CXFA 2ZRUA 3VA8A 1A5MC 2Z29A 3STFA 3TH6A 5A8NA 1I2OA 4FX7A 2X05A 4BQ3A 1XLAA 3IWPA 1BF6A 1XP3A 2G50A 1SO5A 2GQ3A 4NZCA 4Z08A 2A2IA 2NV9A 3DCPA 1QU4A 1DHPA 4A8NA 1RY8A 5FJIA 4DUXA 3W85A 2VI0A 1P0NA 3NGFA 3SZ8A 1H49A 3AZRA 1NH6A 4IUOA 3OODA 5K7JA 2YPIA 4FNUA 1EUAA 3U2EA 5IFPA 1W1TA 5HR6A 3APYA 4LUYA 3GU1A 1BSLA 4EXQA 3AHYA 2GJRA 3GHSA 3B97A 3DC8A 2PDMA 2WMKA 3MJMA 4O1BA 8RUCA 1AMKA 5D03A 4K8HA 1FTXA 2UWFA 2V5BA 3R12A 3WZ0E 4C1KA 1LLZA 1X7FA 3GH7A 2PDKA 1RAKA 3FVDA 1E43A 5LNWA 4XUGA 3AISA 3TW6A 3H7RA 2NSXA 3BVJA 2P10A 2FVMA 3M0JA 1QNQA 5AHNA 4PFHA 3QV7A 4W8BA 3L4TA 3TN3A 3W7KA 3MUZ1 2ZADA 4FX6M 5DT7A 4KFOA 3AWNA 3G1DA 1OX4A 3UY7A 3HPXA 3MO4A 4HA1A 4EF8A 1AJZA 3I7RA 3KM8A 1KCXA 1H7NA 5HJLA 3CPUA 4WLCA 4K7YA 3AU2A 3BJFA 3MI3A 3OO2A 1TZ9A 2R94A 5A8PA 3W3OA 2VC5A 3WD4A 3QGKC 1NTHA 1XRFA 8A3HA 2W91A 4Q3MA 3U9IA 4KESA 1N82A 3SO7A 3CMJA 3SUVA 1I2RA 5T8GA 3DG7A 3T44A 1GHSA 1C9DA 4PMZA 3FJ4A 4QLLA 2XJ7A 5ABFA 1EUNA 1Z44A 1XLKA 5F2MA 1ZJHA 4WZHA 4AB4A 3VD3A 3O8AA 2FGZA 4UR8A 4EPDC 4HSHA 2XVPA 3WLHA 3BTNA 2ZUVA 1SO4A 1ICQA 3CPRA 5FL0A 2DZAA 1DL3A 4ZO7A 3WKZA 3B4UA 1OB0A 1UP3A 1RP9A 4J2PA 3QZAA 1XR2A 4IFKA 1GEQA 2WC7A 5FACA 1KGUA 4QCEA 4ENLA 3BXWA 3MSGA 4NQ1A 4KPLA 4Q8NA 4DJFD 5DMLA 3UXAA 3VZXA 4IMDA 2Y5EA 3DI0A 4A8LA 4L4OA 1FKXA 4AEEA 4UTWA 1CI1A 4YVVA 4Q4QA 2DVXA 3FIGA 2J8TA 1FKWA 3W1RA 2F38A 1Q85A 1TV8A 3WD2A 3DU0A 4C1NA 1XD0A 3LXCA 4B9ZA 1W54A 5FEPA 5M5DA 4M3PA 3HGOA 4AWTA 1KFKA 1RCXB 1W9UA 2V8ZA 3L65A 2PDBA 4UCFA 3ZR4A 1Q2SA 2G0WA 5D2TA 2ZWZA 3UR8A 5GNYA 5ABEA 4AXKA 1XYAA 4ATDA 1Q6GA 2ZTKA 1VLIA 1S2CA 3AMDA 1F73A 1EX1A 2HROA 4LWWA 4ZSUA 3TZNA 1S5TA 1S3TC 2YZ5A 3TYAA 4DO5A 3GXFA 1Q4WA 2HISA 4KRTA 4ZE4A 4J3TA 4IMEA 1Z9AA 1KGXA 3AJ7A 5A6AA 3RLHA 2PTYA 1US3A 1J9YA 4OQVA 1QO2A 2RDWA 4CN1A 4LNCA 3INPA 3UP8A 2VQUA 5DMYA 3VC5A 3H2EA 3NO3A 4H9UA 4BEUA 3L12A 1TG7A 2WJZA 4MZYA 4PCPA 3B03A 1S2VA 2PDQA 3RPTA 3ITYA 1EFZA 2ZRVA 3SRKA 1IEWA 5A94A 4H9YA 1BGAA 4O1AA 4QDWA 3M0ZA 1GOWA 4XD6A 1UWUA 4JFTA 2ISVA 5KEZA 5LHFA 5C55A 3AWOA 4N9DA 1A0DA 4OOZA 4JHMA 4GMEA 2J7CA 1X1OA 1TV2A 3W02A 3VKDA 3EAUA 4UR7A 4GKLA 3U48A 3UG5A 1QI2A 4YPJA 2HXUA 1PHQA 2XIMA 1AODA 4POCA 4S3CA 3DFPA 2OWXA 2HPMA 1J93A 3H2AA 1V0NA 1UKPA 4C6DA 4ZO8A 3ARSA 1JZ8A 1TJRA 3CEUA 4L9XA 4K37A 5AFDA 2ZC1A 4NAFA 3VU2A 3QTGA 1G1YA 2VYOA 4XZHA 7PTDA 1OABA 4GQGA 1RUSA 4HT3A 2H6RA 3GDKA 4AZGA 1IR2A 6ALDA 1E15A 2V69A 3M6DA 4WJ8A 1HJQA 4NVTA 4JDBA 5CEWA 1QPRA 4UQBA 1MDRA 3L0KA 4GVHA 1L2QA 4BS0A 1SQ7A 1TMLA 4GXPA 1QTWA 3T7VA 1HW6A 2PSNA 4ASTA 2PWUA 2PWEA 4HNCA 3RU6A 3PJXA 4MADA 1UPMB 1S2AA 2NX3A 3WLTA 1PPIA 4MB3A 1ZQ5A 4AHQA 3H2OA 1LDCA 1R9YA 4LYKA 5K9CA 1XC6A 5I3IA 2A3LA 4NX0A 4HVXA 1OEPA 2HRWA 2GJNA 5GNZA 3QOKA 1K4GA 1FCUA 1UKQA 4TV6A 3KLLA 3LCWA 3LUTA 2C1HA 1EO7A 3BOFA 4CQBA 4H6EA 3D0CA 1KQZA 3L5AA 3WUFA 3T0DA 1F3EA 4GI4A 4URIA 5HMFA 3HM7A 2UY5A 3NQDA 3EEGA 4UMAA 2Q01A 2WVVA 4YU1A 3SN4A 4ZGYA 4I8YA 4O50A 2P53A 5H8MA 2B31A 4XO7A 1PZ3A 2I5GA 2OOGA 1TPUA 3FY1A 1JGMA 3VTRA 2XH7A 3PZNA 4W93A 3SEPA 2PRLA 3EX4A 3BJTA 4NY2A 3GHTA 3UETA 4GQBA 2FHCA 3LHWA 2PE4A 4XIMA 4JTRA 4RZ6A 2DIJA 2WQDA 3VM7A 1OGSA 3VOGA 1EX5A 3R2GA 3S1WA 2RKXA 2XFRA 3URBA 3HG3A 1TZZA 4JTFA 1QNRA 1XCWA 2FHBA 4DJFA 3VIIA 2W67A 4JKLA 2RDUA 3IAQA 3HIJA 4YS1A 3XINA 1FH7A 4TUFA 1LL6A 4LU0A 4NZFA 4EXBA 3B04A 3WEZA 4RDWA 4ZQNA 1W3TA 3GUGA 5DEZA 2Z2BA 4KCVA 5HXMA 6REQB 1YTDA 3SQLA 4AWSA 2C3ZA 2O9TA 1YBQB 1SJDA 2NQ9A 2DP3A 1EEXA 3NAVA 4UNKA 3TSBA 4Z17A 4WX2A 4EAMA 3GE7A 3B8SA 1MUCA 2QJMA 2FMOA 1ZAIA 3O07A 4V27A 4ZFMA 1AMYA 1DP0A 2WJEA 4RW5A 1FWFC 2UZ9A 3N4EA 1NF0A 3OOQA 1XYZA 3PBVA 5G2IA 5CC7A 3KRZA 3I65A 3FYPA 4PMVA 3NG3A 3SIMA 5G2HA 4RKAA 1KFBA 3AYRA 2X30A 1HT6A 2EPOA 3DENA 3GTFA 1CECA 4H9XA 3NNTA 5CZ0A 1XLHA 2A5HA 4Q8UA 1ONXA 1EA0A 1VP5A 4I9JA 5EMLA 3ZLHA 1BD0A 1QPQA 4U4MA 1VCVA 3K30A 3RX3A 3WK0A 4HP5A 4X2PA 1BWVA 2GGGA 2PGWA 1MZRA 4HTBA 4KETA 1WZKA 1T40A 1AL8A 3KUMA 5CC6A 3CWNA 3P60A 1T96A 2CBIA 3FAXA 4HBKA 5F4SA 1FHVA 1BQCA 1QHPA 3UNTA 4M6QA 2F9RA 1I8JA 2DH2A 4XG1A 3RMJA 3FGCB 3W7NA 3PF3A 4US6A 3VD7A 1LL7A 3WDIA 3OVPA 4BA0A 1GTHA 2GVLA 3BSHA 1O95A 3MSRA 1WYIA 1XKJA 3ARRA 2G4FA 3ONCA 4LGXA 2QEZA 4MJ2A 3QM3A 3S6DA 3NIYA 2ISFA 3DYOA 4PTDA 3L5MA 4E38A 2DFAA 3OG3A 3GK0A 3HQOA 1GVYA 1RK6A 3DFNA 3FS2A 1E71M 3STGA 2NQJA 3EX3A 4E4FA 3EX1A 5MKGA 3ONBA 1AH3A 4S2CA 1FH9A 1ZBCA 3QVQA 4ML9A 4WSKA 1H09A 3AHZA 1RLCL 3GXPA 1ISZA 4LALA 2QDDA 1IXPA 1P1XA 4KRZA 2OELA 4DN1A 4XK2A 1ZHAA 4UTLA 4DO6A 5T9BG 1YQ2A 3ITVA 1Q6LA 1TA3A 1UP2A 3LCLA 4MY1A 2A3AA 5F4XA 4WY0A 3VE7A 2VD9A 4U31A 4YTSA 3IUIA 1DVJA 3OB8A 4DLMA 3T55A 1VR6A 2HNEA 2V9DA 4HHLA 5HPOA 1BTMA 3GTHA 2I16A 1DWJM 4PEKA 4UTUA 2QJGA 1IT8A 4OKDA 3WQWA 2YSWA 4Q22A 2ZICA 1EC7A 4IFRA 1JCNA 3A3WA 2HE8A 1CNVA 2WBKA 3PM6A 3MBFA 4GCXA 1KCKA 3MHGA 1E4NA 3W7GA 5F7UA 1TV7A 2GVYA 4LYPA 4GO9A 3NEVA 1KV8A 4Y9NA 5CPNA 2XM2A 3TYDA 3EMCA 2OTDA 5H1WA 3DAQA 3HGJA 2CXGA 2Y7EA 3UGRA 4RCXA 4MMWA 3U5UA 4M1BA 1XLLA 2CW6A 4L64A 1Z89A 3BMXA 3DHDA 2DZSA 1F6PA 1MEIA 5I0DA 2A6LA 1LORA 4FALA 3ITGA 4JAWA 5IHRA 1JPKA 3TAOA 3GXTA 1MSSA 1TR9A 2WCSA 4EX4A 3EWUA 3R13A 2ZX6A 4HHMA 4TX8A 1JI1A 3E2RA 3OYXA 4F9DA 1O5XA 1Z7AA 2ZUMA 3F5JA 3C6CA 3QHOA 2C14A 4DWSC 2YBTA 2I9UA 1DOSA 1W8GA 2PU1A 3RM4A 4HQVA 3TNOA 1TYGA 2P5NA 3OYZA 2BFGA 2EJ1A 3VDAA 4JFSA 3LY0A 3GNRA 5BOFA 2G41A 3CUJA 1KO0A 2NWSA 1TCMA 3UVIA 2F7FA 2TRSA 4ZVJA 2WNNA 1PJ9A 4PTMA 3OP2A 4O1CA 3QQ1A 3TDFA 8CGTA 1AQMA 3W6YA 1OZMA 2Z27A 5TD4A 1OZQA 1KRBC 3R94A 1T7LA 3LGGA 3PK7A 3WQGA 2Y7DA 2CBJA 5A6BA 1MW3A 3VI2A 2Y0FA 1OBAA 1F74A 1XDMA 1GPWA 1TR1A 4FR1A 3TEVA 1GT8A 4GISA 3VCRA 3E96A 3D3AA 1NFGA 3EWZA 1E1EA 3TV8A 2JIEA 2J66A 3AQUA 3LGEA 2BSLA 5AC7A 1FFRA 4JCMA 4GJIA 3MU7A 1W0MA 1ISXA 1XUUA 1UBSA 1AUSL 2D0GA 1IEIA 3O3RA 4M29A 1IYXA 3G77A 1WKFA 3GY1A 3B9EA 3BICA 2EAWA 3G22A 1NP2A 1K6WA 1EH9A 5DBUA 2FGLA 3RHGA 3DYPA 4FR6A 2VCCA 1VLWA 3NSXA 4WD0A 3QC3A 5AZ1A 3PUEA 2GVJA 4GH1A 3W22A 3P67A 2VFEA 2REQB 3H6OA 1SYTA 3NOEA 3WLJA 2Y85A 2GJXA 4M6VA 1U30A 5DBTA 3N9RA 5FF4A 4QX4A 3SY8A 3BLKA 3WH9A 1L9WA 3NEHA 3NSNA 4G9PA 4IPNB 2VRKA 2QW5A 1ICPA 3FW6A 3MMWA 4B9YA 2OCZA 4IIEA 5ABFB 3QLDA 1QWKA 2PZNA 4WCJA 4WHBA 3VIMA 3KRUA 1DIEA 3DYMA 2ASHA 3N25A 1E0TA 4KWOA 5IBXA 4KCTA 3N14A 5HJYA 4TX9A 3TA6A 5I23A 2GLKA 4E6MA 3N9KA 1MYRA 3S9IA 3DIPA 2VL4A 3RLGA 3WLMA 3W38A 3V1HA 3EOOA 3KL5A 3S6OA 1PS9A 1N55A 4YL2A 4AISA 2VZSA 4K6AA 2NUWA 4ZQCA 1BYDA 3TW7A 5C9ZA 2AKZA 2JGQA 2D1ZA 1XYLA 3PUOA 3R7MA 3MI2A 2OU4A 2FZMA 4FLOA 5AB3A 4XAPA 5MF5A 4C65A 3N15A 1WDQA 1H2JA 1ITQA 1B3ZA 3KL0A 5CPTA 4AX7A 4BJHA 3DX5A 1GOXA 4UNIA 4NT0A 2ACSA 3G6MA 4R7WA 1AQFA 5BWAA 4G7FA 3K4AA 1B4EA 4KCWA 4GY1A 3ATZA 1VPYA 2X7VA 5BROA 5CC5A 5JBDA 1T41A 3L23A 1WDSA 4PE8A 4FO4A 1EWEA 5K4ZA 1E0WA 4QAIA 1HKVA 1I2QA 3UXKA 4DZIA 1WDDA 1VCGA 3E1F1 1O1HA 3QMTA 2QAFA 3ARZA 1ITXA 2I5IA 4QS6A 2ZA2A 1VFTA 2OR2A 3MP3A 2E6AA 1UCWA 1W1B1 1BGGA 1UPPA 1Q4NX 3PTQA 3ZJKA 1KCLA 3KOWA 3ZVIA 2PGEA 1MI3A 3HO8A 4NHVA 3HN3A 1KTBA 3JS3A 2H90A 2V38A 2CERA 3WO8A 4B5UA 1JRBA 2XUCA 3LPFA 3BG5A 2A3EA 3EGJA 3NPVA 3DFHA 1UWTA 3PBGA 2PWGA 1JR1A 2PRMA 3T0BA 2FDSA 3AALA 4LX4A 4PMUA 2QR6A 2V3GA 1XPYA 1R47A 1SU5A 3WFZA 1YDNA 1EJVC 2IPGA 2Q8LA 3O0FA 2V68A 3GIYA 4INFA 2EJAA 1PVNA 1POJA 3RLUA 4C6KA 1YPXA 2EGZA 1MFVA 3MMTA 5C8BB 3E2SA 3KX6A 3EA1A 3GFZA 1JPHA 1QK0A 1I60A 5C0QA 1G4TA 4ZOAA 1NWUA 1GJPA 3QFEA 1H3GA 3PPHA 2VZVA 1XYFA 4PZVA 3MDWA 5J04A 2BXZA 2D23A 1HKIA 3MSYA 1UQZA 3TONA 1A53A 4TMCA 1WBJA 1ESWA 2OOFA 2PLJA 4F0MA 4ICMA 3E0IA 1TJ0A 5FESA 1EO5A 3VNMA 1H62A 1UC4A 4YTUA 2PFHA 1NEYA 1SO3A 4HB7A 4RW3A 4C7FA 1K1DA 2UBPC 2CU0A 4GFIA 1ENUA 1KBIA 1V7YA 4XZBA 2VEGA 1YNPA 1Z3NA 2ZA1A 3T4CA 2KAUC 4Q8TA 4LAZA 4I6VA 1E4LA 3H2CA 1PIFA 1FWWA 2QF8A 5G1TA 4US5D 4IPJA 1TPVA 3P6LA 3NL5A 2VGIA 2W61A 5LNSA 4XX6A 1U5JA 5J5RA 2VC6A 1XDJA 4DO7A 4LV9A 3RDKA 1RVGA 2ZX9A 1H7OA 5BRBA 1Q5MA 1FHUA 4TVUA 4PMNA 3UR5A 1XBVA 4JIQA 4GYKA 2Y24A 5A95A 2XTKA 4H8VA 4OU1A 2QUVA 1J5TA 4XZLX 2QV5A 2Y1HA 1W3NA 5C71A 4D72A 2Y70A 3I10A 2J13A 4O28A 1VAHA 1I1XA 5AHEA 1PX3A 4OJYA 3BE7A 5FOOA 5KINA 3TTEA 3VOHA 3RILA 4GGBA 4A2SA 3O6CA 4JD4A 1S5VA 4Y2WA 3KWXA 1AA1B 3ITXA 2XN2A 1BXBA 4LT9A 3RX2A 2OPJA 3S1UA 2Z1KA 1UD8A 3UXLA 3W7IA 3SFKA 3T8QA 3WUBA 3OPSA 4J5NA 1QASA 2QVHA 2C13A 1XGEA 3D3FA 1ODZA 4CD7A 4F9JA 5DCBA 2Q02A 1PKNA 1CX9A 3HPFA 1F7BA 2J62A 3BLDA 1TX2A 3VIPA 3W1XA 4H9MA 3AHVA 3A47A 3QMRA 1Q6RA 1JZ4A 5JIPA 1DWHM 2FHFA 3B3DA 3W7OA 3IJ8A 2QCGA 1OYAA 3KOYA 5LSMA 4DUOA 3S2LA 4H00A 5A5WA 3M43A 5EY5A 3TSDA 2X0SA 3GG7A 1S2WA 3WDPP 2XIQA 4PRWA 1CB2A 1F6KA 2JFEX 3F4WA 3OBKA 4GIEA 2VM8A 3KVLA 2E9BA 4PSPA 4M5PA 6ENLA 1SSGA 4DF2A 1PO9A 2GK1B 3FN9A 4AZBA 4M56A 3FK4A 2O7SA 3LSBA 1X98A 5AC8A 4PCTA 1BXCA 1R87A 1X97A 3WYZA 3M0LA 1CWYA 2JQXA 2OZTA 3BGJA 3NO5A 2WNZA 1HVXA 1YXDA 1SFLA 2P0OA 4W4QA 4PUEA 1ZNNA 3AFBA 3OU8A 4TTGA 4HGXA 5I78A 2X42A 3EDFA 3WQOA 4H8HA 1DJZA 5A2AA 4DNMA 4IHCA 2CITA 2NT1A 3EWYA 5C7HA 4IXHA 2ONEA 1J2WA 1KBLA 1UD4A 2ESCA 4LAUA 3KFTA 3CK5A 1RBLA 3LYEA 3SB0A 3NYDA 4DHGA 4MTVA 3LTSA 1VEPA 4DJED 4JDYA 2OSWA 2GUUA 1S2UA 1E0VA 2O92A 3Q94A 4XBSA 4LCQA 2WZEA 5HR7A 3T08A 1CT5A 4PRRA 3G5EA 4UIOA 2OQLA 3H8AA 1F05A 3SRHA 4W8LA 1HQTA 3OQEA 4FX8A 3A21A 2WKLA 3NSMA 4W5ZA 2XFYA 3IGXA 2OEJA 2AKMA 2GSHA 4BZYA 4KERA 2PP1A 5GNXA 2PTZA 4MKVA 3S2JA 4L5ZA 3AMKA 1C8QA 3PAOA 3W1UA 3UZ5A 3VD9A 3M0IA 3WLNA 4ZL1A 1C7SA 2DT3A 4J3SA 3SY1A 1CXKA 3C52A 2CNCA 3SI9A 1JEZA 1VB9A 3HF3A 3IIOA 1FBAA 3LENA 3S1GA 4U33A 3C4UA 3CL6A 1JNEA 1LT7A 4XZMX 1FWDC 4UB9A 3WLKX 1WXJA 3KOZA 1E0UA 3GYEA 3W53A 4HOWA 2O7QA 2R91A 3G1VA 3AIEA 2NV2A 3LI1A 1CDGA 4IJCA 2JEQA 1V77A 1V3LA 3BSMA 1W1VA 3CGTA 3AHTA 3CU2A 1CGXA 5TAOA 4J3VA 1UUOA 3HZ3A 3CT2A 1LBLA 2DDXA 4ROPA 4WXYA 2DV0A 4O18A 3ZVHA 4DBUA 2J8GA 1OC6A 4NXSA 1E6ZA 3JUGA 1Q8JA 4E2VA 3VZYA 2DSZA 1IEVA 4ZZ9A 3N2BA 2EEXA 5I3DA 2VVNA 3THQA 1UR2A 2BNJA 2CZ5A 1RPXA 3XIMA 3GH5A 4QE1A 1FP9A 1GKRA 3EOSA 1OG0A 3CH9A 2PPGA 1RBOB 1JZ5A 3G3MA 3R1ZA 2X0HA 3LHYA 1E70M 3B0YA 2HMCA 3T1GA 1UUQA 1V6YA 4O4WA 3BLFA 4B4FA 2AGTA 1WOAA 1OINA 1Y65A 4L1XA 3EKGA 4IPIA 1UD6A 3M7WA 3N2CA 3VGDA 4XISA 1MNSA 1H5YA 3KE0A 4C6LA 2VCAA 1FWJC 2AL2B 1S1RA 2FB3A 1HIZA 3QPZA 3PZMA 2VOMA 3WNMA 1EYWA 4UOJA 1S5WA 4OECA 2ZQ0A 3H2MA 5JMUA 3I6RA 1PWLA 1KWGA 4PODA 1ALDA 3N18A 4DI9A 1AZ2A 2Z6JA 3N11A 2ZUSA 1R30A 5TIMA 4HNTA 1HP5A 4H19A 1H1ZA 4J3XA 4ADTA 4IIFA 3M0HA 1XH0A 4D8LA 2DZTA 3MWCA 3SCTA 3RLVA 4NKCA 1FWGC 1A3WA 2POZA 3G1YA 3GVQA 5D8ZA 2QULA 1BRLA 1V0MA 1DEDA 4V28A 3PPFA 5AN7A 5F1UA 4W9TA 1FDZA 1XSIA 1GZ1A 4ZENA 3P7YA 2D2OA 3UY8A 4IP7A 2HVNA 5RUBA 1TQJA 4ADUA 3OZYA 1HJVA 4LVGA 2NVDA 4IQJA 4NILA 4MY8A 5I09A 4LUJA 3TW9A 1KM6A 1BVNP 4WDWA 2PDWA 2QCDB 2JF7A 3CB8A 3MVTA 1HO4A 2Y6ZA 2DIEA 4DO4A 4O8AA 2E9MA 1XG3A 3A4WA 3VKBA 1E9YB 5JVLA 1E55A 3S8HA 1HKMA 2Z28A 5AYIA 1JXJA 3VIOA 2YLAA 2Z26A 3A22A 4H04A 3ZR5A 4BQ5A 3LMZA 5DY3A 4JIRA 1XPGA 1ZCOA 2R9RA 4PRTA 4U2YA 4I9TA 5BRQA 3VIFA 2GOKA 2AGKA 1RPKA 3N2XA 3CWHA 4MSSA 4AHPA 2VFFA 2A1YA 2V6AA 1UWRA 3NCOA 3UCDA 2XFWA 4DWSA 3II1A 1EDGA 2QJIA 1RLDA 1KXHA 5MHBA 4ZOCA 4NP7A 4GFSA 1OY0A 4ACZB 4ECLA 3OLDA 3SCSA 3K8LA 4ONVA 3IJ6A 3MZNA 5CQ1A 2H8XA 3ZXWA 3TA9A 3BG3A 1R8LA 1W17A 3OBAA 1NARA 4KWVA 4WOQA 1E9IA 4LVFA 4PMYA 3UD6A 1W3LA 1A5UA 1R3RA 1ZPTA 2NX1A 4W5UA 1A50A 4F0SA 2VEMA 3FXGA 2E67A 4PB4A 4JQ4A 4CQ9A 1RZMA 4FNPA 3TR9A 1SW3A 4MF4A 2ZZ4A 3EXRA 4FXSA 2A7PA 2WLZA 3BLEA 1VIWA 4JKKA 1ITUA 1EOKA 3NZRA 3E0FA 4WJEA 3LQGA 2J79A 4REQB 2F2KA 4QG9A 3FX4A 4AMAA 4GABA 4HPJA 1KBBA 3URAA 4V33A 3F4NA 5LA1A 2PWHA 1A5NC 3HBLA 1E72M 3R58A 9XIAA 4JICA 3VM5A 5HJXA 3W1LA 2DQXA 1K77A 3TJIA 1XM3A 1MXDA 4JIHA 3AMGA 4PFMA 2O55A 1DYSA 3AIBA 3NL6A 6PTDA 1A5KC 3EA3A 3LM7A 3MV01 4OV9A 3N34A 1NFBA 1S39A 4MJZA 3L4ZA 1XJBA 3LXAA 3I3EA 5D38A 2CKRA 3C61A 2GGEA 2YFOA 4JHZA 1EF2A 2FZDA 3ZJ8A 4FLRA 5CSYA 4JQAA 4AAJA 2JE8A 1MUMA 3ARUA 4DM2A 2E7FA 3I7QA 2IKJA 3WQ4A 1V3HA 2DZVA 1MEWA 4M7SA 4WKHA 2FFIA 4NYYA 3P0XA 2VR2A 4GOAA 3ZJ6A 1CW2A 2B7PA 1R6WA 3MB9A 1S1PA 3W7RA 4IXXA 2IUZA 3M07A 3ZSTA 2XN0A 3BAYA 3L2LA 4E4UA 2FZNA 3CQJA 4FF5A 1D8CA 2GDQA 2FTYA 1HX0A 4KEUA 3WL1A 3FYYA 3TIMA 2Z00A 1W5OA 3C86A 4PYSA 3DXIA 3PSVA 4IICA 1G9HA 2H8ZA 3PBYA 2TAAA 3S2MA 5CGTA 3V0UA 3BLOA 1FCBA 3GG8A 3PN8A 1KKRA 2GL5A 1L6FA 3BCDA 3AI0A 3LK6A 1FH8A 2XG9A 3OIXA 2QDEA 1A47A 4AIOA 1R3WA 4Y8EA 3W27A 3RIKA 1WX0A 4H2CA 2DUAA 2V5DA 4FI4A 1Q8AA 3G18A 4A35A 1QAPA 4ROQA 3A4AA 4GIAA 4JTAA 1ML1A 3PWGA 4FSAA 4W86A 2D2GA 3P61A 3WQCA 3MYOA 3W7EA 1GNXA 3VXGA 4IUGA 4MZ8A 5EMMA 1B9BA 4GQQA 1XC4A 3Q37A 1A0EA 1OYBA 1ISVA 2FZ8A 4I5UA 3FHQA 4LQ1A 1SFSA 3P2VA 2BV9A 4FPSA 1V4YA 5A6KA 4Z2KA 2NT0A 2D0FA 4PB3A 1IHIA 1QCWA 3VGGA 4PTVA 2WPGA 1VZWA 4D71A 2GFTA 5F2LA 3VO0A 3S5SA 3L0NA 4FF7A 4H83A 1RHCA 1VBUA 4JEQA 4GC4A 4OUIA 3L4YA 2JKEA 4MUPA 3A13A 4LAOA 3CO4A 1NDWA 3NQ7A 4XKYB 4DI8A 5AVHA 1RCOB 5AKQA 3LLXA 3WL0A 4DZAA 1J0JA 4NF7A 2WKGA 3CL7A 3LU2A 1LUCA 4PTNA 3S42A 1SR0A 4MB4A 3STEA 3EMQA 1K70A 1G6CA 3OBEA 4GNVA 1R3YA 4GINA 2VC7A 1P0DA 2PUZA 3T07A 3G24A 2W9MA 3PBMA 2Y63A 3OGSA 4XTIA 5LNRA 3PTMA 5BNKA 4CVUA 4JXCA 3HA1A 3BARA 5HNNA 2YYTA 2IXVA 3TQ0A 2EKGA 4LOCA 4K36A 1O68A 2WC3A 3NL2A 3W2UA 3LERA 2WHLA 3W1AA 2QXWA 2HSAA 3CV2A 4UTWC 3P81A 1NF7A 1KM4A 2PDFA 5C9RA 3G3DA 2WCAA 4GJJA 3KBWA 5D09A 2QUNA 4Q4OA 1WB0A 3GW0A 4PGLA 5T91A 5AYZA 1KTNA 4RV3A 2J6VA 1XHGA 3PHAA 4HA4A 4L56A 4LF2A 1Q6EA 3N2TA 4TMBA 4XD4A 2A0NA 1ME8A 2BGSA 3VNJA 1UZHA 4LUIA 3LEPA 2RDXA 3A23A 3BAIA 7ENLA 3CQHA 1ZBWA 3B8VA 4N42A 3IRSA 3FJNA 3QXBA 2YL6A 5CBIA 2Y4SA 3JVAA 1D3CA 5EGRA 3H4WA 3PB2A 2YCLA 2P0IA 1GYLA 1KV5A 1SZRA 1KBKA 3LNPA 1XS2A 3S5YA 3W74A 1UR3M 3AIRA 4WQ6A 1JULA 5FEXA 5CGQA 3VOCA 3VAVA 1W5PA 4GBUA 1XH1A 2WBGA 4Y9AA 3ABXA 2GVEA 3GXNA 3TX9A 2G95A 3EXSA 3GW3A 2B7NA 2AAAA 3WJSA 1SZFA 3M1ZA 1JDAA 1EZWA 4PCFA 4GX8A 3DHUA 5FAJA 4A3UA 1HJXA 4DXXA 2EG8A 1B4KA 3LHVA 3H22A 4O12A 1J2BA 4LYQA 5PTDA 5I79A 2IQ0A 3PZTA 1TV4A 1XLMA 3E9AA 1H50A 5AZ0A 3RF9A 3P0WA 4J4KA 1L6GA 1H4PA 3S2NA 4X9YA 3BUVA 1POKA 4B91A 4RZ4A 4HCDA 3ARWA 4R5EA 1OT2A 3CV6A 2QUMA 5FL1A 3N13A 1SR9A 1GVSA 1VC4A 4JY8A 3ABQA 1TUFA 4M8UA 2DZWA 3GKFA 1JL8A 4OFCA 2PGFA 1PE1A 1TREA 2A4AA 1D7FA 4GO8A 2Z2UA 3GZAA 4Q8QA 3QV6A 5JUVA 3V5CA 2ANUA 3M6YA 1A3HA 3QH2A 4IP4A 1OCJA 3BMWA 1SPQA 2IPJA 1OADA 5A3HA 3FOKA 1IZJA 4LY8A 2JEPA 4S23A 2A6NA 4N9BA 1DWIM 1YW1A 3DGRA 3GHUA 1XLCA 1WQ5A 3GIQA 1CPUA 1KRMA 1W5NA 4U2ZA 1AK5A 4J40A 3KTCA 3KVKA 5HDRA 1W3HA 1MEHA 2XSXA 3RJYA 3IARA 2E5BA 4KRUA 4JNZA 2XSAA 3ZR6A 5CSRA 4LS0A 1W91A 1FHDA 1UJPA 3A9BA 3N19B 3W28A 2WVVB 4JIPA 4HOXA 1VFLA 5CBJA 3WQDA 1ZCCA 3SCNA 2Q8XA 3GVVA 3USZA 1IT7A 1E4IA 3TC6A 2H3BA 2ZUTA 2FLIA 4AZ7A 4GY0A 1YIXA 3OGRA 2Q8ZA 4DQWA 2A21A 4HJFA 2ZUNA 5EBUA 3EB3A 1E6PA 4DBDA 3MANA 4TX6A 4D2JA 3UGVA 1E1CA 2BY2A 5CZTA 3IJ9A 4YIWA 3VKJA 2H9AA 1HKWA 3G1XA 1RQHA 2C0AA 3RMEA 1BYBA 4PUJA 4RPPA 4O15A 4HYVA 1HL2A 1XCFA 3BQ5A 1PAMA 1CXEA 4WSJA 1WPCA 1ZY9A 5C9UA 4AY8A 3HTWA 5D32A 5BWFA 4W85A 3ITOA 4CD6A 1DIOA 1LM1A 2X2GA 4QHRA 5A2BA 1YX1A 3L66A 2Z1SA 4PUDA 2E6YA 4GD0A 3B9NA 1J0ZA 1EC8A 4V15A 1LOLA 1QK2A 4A6GA 2X16A 2OB3A 1CLVA 1YBQA 1UP0A 3TUUA 4FXFA 1Y8BA 4XV0A 2BGNE 4W8AA 1GOMA 3DDMA 1ODUA 3A4XA 4E8GA 1FQ0A 4KCUA 1X8FA 4HSNA 4XQ6A 2CCRA 4IQEA 4HMNA 1OIMA 4GK8A 4NJKA 4GUJA 2HBVA 3GTNA 2OT1A 3EWWA 2WM1A 2WW5A 3DKJA 4RZBA 4AG0A 1GWJA 4KT2A 5G1MA 3OHMB 3NVDA 2ZRXA 1F07A 1OFRA 4JNMA 5CPQA 3S5ZA 3LCHA 1XF0A 1XH2A 4C91A 2BVDA 1Y7VA 4DVOA 1Q3NA 1WDRA 3H2NA 1WCGA 3R8RA 4L7ZA 3Q4DA 1B3OA 3BAWA 4GE8A 3TTQA 1I0BA 3F4CA 2FIQA 3B8DA 1NWSA 5A6SA 1TPB1 1JDCA 3MKVA 3PB0A 4TR9A 1OX5A 4LTSA 2ZIDA 2X1SA 2YDRA 3VIKA 3HMCA 4O53A 1M7XA 1LL4A 4JQ3A 4RDZA 1I6NA 2ZDSA 3LBOA 2XVLA 2CEQA 4S3EA 1XCXA 1AQ0A 1J79A 3QQ0A 5IDIA 3B9OA 4RJEA 2Z1VA 3BG9A 4QQ3A 4MY9A 4NASA 2V3EA 2YX0A 4FEZA 3T42A 3N12A 2AOSA 4KGJA 1YPFA 2W63A 3U5YA 2W0UA 3PJUA 2IMRA 1C9WA 2EPLX 1FCQA 3TYBA 4FS9A 4LC8A 3ZIZA 3SADA 3VILA 1UUMA 4I90A 2P76A 2VWTA 3GG0A 1DXFA 3W2MA 4YLWA 2WSPA 3G2GA 3TQPA 4U3CA 3WLRA 3ZSSA 1PXGA 3VOJA 2W66A 4CNTA 2Z0IA 4YNGA 2YCJA 3W7PA 5HMEA 4NZ4A 1XLEA 5AOUA 4PUUA 8XIMA 1VJZA 3T2QA 1F61A 3Q45A 3WD3A 1Q66A 3WK1A 3UCQA 3T9PA 3V0SA 5DQPA 5IOBA 1C93A 2I5QA 1JAKA 4H2HA 1UWAA 1JCMP 4MWAE 2ALRA 3LXBA 2IPFA 1UR1A 3MT1A 4O14A 1KQYA 3B05A 4IIDA 3GVRA 4MUZA 1JUEA 4TU1A 2C1IA 2Z7GA 5FKYA 1E6SM 1P6WA 3GTIA 2YA2A 3WDRA 1BTCA 4DYJA 1W1PA 1F3XA 2DJLA 4OTKA 1HUVA 2BZNA 4MYAA 4NNAA 1TIWA 4AFYA 3G6LA 4O52A 1XSKA 1LZOA 1V6WA 2VR4A 2YXGA 3MMUA 1EF3A 3WBWA 4MAVA 3WUEA 2X0YA 3CTTA 3M0XA 3N4FA 4QITA 3R8HA 2O4QA 2NX9A 2VDHA 3AXXA 2ZFAA 1YNQA 3DKLA 4DX3A 2NQ5A 3W7HA 2WMHA 1HG3A 3CC1A 3KCJA 4FZIA 6TAAA 4ORIA 1OC5A 1DJHA 2A3CA 4WDTA 4MWAD 3RR4A 5HK4A 1S2TA 3NDZA 1SZNA 2PF8A 4PB5A 4MAZA 3W83A 1OX6A 2PC4A 2HTMA 3PG9A 1EHNA 1FWNA 1LWIA 3LQLA 2AAMA 3NQMA 5E6ZA 3PUDA 1HZYA 5KTLA 3PZGA 5D9MA 2INEA 1GONA 3QGVA 7REQB 1TE6A 3QPEA 4F0LA 1BVZA 4E2DA 4GPNA 1EJSC 2J4GA 4BK9A 1XGZA 2CHRA 2FVLA 1AD4A 4MGGA 3OZMA 1M9HA 2EG6A 1IQ8A 2YL5A 2QVNA 3WNLA 2RAGA 4XBKA 3W6LA 2CFFA 3I3DA 3PVFA 3S3GA 3WNPA 4RR4A 5CXPA 2AMXA 4E4PA 2BS9A 3OZOA 2BOGX 1VEMA 1M1BA 3W2KA 3VINA 5KSWA 4HU8A 1LQ2A 3QR1A 1OSEA 2P3ZA 3HG2A 1ONEA 2GQ9A 2JGYA 4W7WA 3APTA 3K46A 4Y8FA 1ECEA 3RCYA 1RA0A 2ATMA 1EXBA 4AC7C 4G6CA 1LYXA 2OYKA 3BV7A 1MXSA 3N2OA 1ZP3A 1VBGA 2GWGA 4MOZA 1CTNA 4YMZA 3MP5A 3WFAA 1HL8A 4LUTA 4IG2B 3GSMA 3UJFA 1X1NA 3M46A 4DZ5A 4D1IA 2WMIA 1GG0A 3KHDA 1FWAC 1J0KA 3B0XA 1YE6A 2V5LA 4UFIA 3CV1A 1XICA 4UMCA 2YCKX 5EMUA 1NU5A 3LZ5A 4OZOA 1F9CA 3NZ1A 3QSRA 1CYGA 4Q8OA 3SUTA 1ADSA 3K8MA 1O12A 3TMQA 4HU3A 3B8UA 5A6MA 1M5WA 4BF7A 1K02A 4AF0A 4X3ZA 1RR2A 3MA8A 2QCLA 4W89A 5TF0A 3KAOA 5AYXA 4LVDA 3JW7A 1BEUA 2GGIA 3W73A 3U0HA 3ZT7A 4LVAA 4LJ3A 3TP4A 2FTPA 4JTJA 1WP6A 3GVWA 3OLEA 1KM2A 4CD8A 5IM51 1J10A 1VQTA 2FH8A 1WUFA 3V7PA 3ZFHA 4D6IA 3DN5A 1VFFA 3W1TA 2VFHA 1H63A 4AY7A 3A5VA 1TWWA 3W87A 5FJRA 3UZYA 4DEFA 1AQHA 1TPFA 2C71A 3VIJA 1WDWA 3BW3A 1DE6A 3MZ2A 1UQYA 3RK8A 2FB2A 1ECQA 2ZRYA 3C2EA 3W6MA 1OFPA 4CU8A 3E74A 1ZALA 4M24A 4M19A 3MHFA 4GIYA 5CSSA 3VMNA 3QY6A 4ZSTA 3R0KA 1DJQA 1JNDA 4WK9A 4GZJA 2QMJA 2XVGA 2R6OA 5M3WA 2J77A 2D2JA 1NDYA 3LI0A 3THDA 3EOLA 1UJQA 4U28A 4XUYA 1E6QM 3GDLA 1KCZA 4QE4A 1QWGA 1RV8A 3U6WA 4FOJA 2OLAA 3E6EA 1D7KA 5TBOA 3I4EA 3TZFA 1IF2A 4H8UA 3MSDA 5AYYA 1UH4A 4ZO6A 4I5XA 3SCRA 4A3YA 2VX5A 2D20A 4BI5A 2QGYA 3IGHX 1GVRA 3OGVA 3VCNA 5HINA 2C79A 3KS6A 3NO1A 2VNCA 1MW1A 4JN8A 2P50A 1D8WA 4A05A 1CXIA 1UYQA 5ECVA 1EIBA 3LZ3A 2O56A 2OYLA 3M0VA 3TYCA 3P80A 1Y0EA 3R8GA 1GCYA 3AC0A 2VRJA 2RGLA 2ZX8A 5D8WA 3NOYA 1EJTC 5K4XA 1H7RA 5LHEA 3XISA 4X61A 4AD1A 2PDPA 2C6QA 2Z6IA 4S3JA 1X1ZA 3R6IA 1XIJA 3W1NA 4UBPC 6XIAA 1E3ZA 4Q8VA 1GKQA 3WQ8A 5M1TA 3WMLA 1NP0A 2J9ZA 3BQ6A 3QOMA 4MG4A 1F2JA 1VFUA 1KGWA 1ZBKA 4MDPA 4PCSA 3RITA 4GZIA 3NURA 5LIXX 3S5OA 4S3BA 1VHNA 3ITLA 5F4WA 4C6CA 4FNRA 1RQEA 2I57A 4LUSB 1JIBA 1J0HA 4PBGA 5BYWA 1FP8A 5G4WA 1A5BA 5J8LA 1L2UA 2UY2A 1IR1A 4G1NA 4ZB0A 3EMZA 4JHOA 4X0NA 1BQGA 1XDLA 3GU2A 4GVFA 2VURA 4GYFA 3AS3A 3HPAA 3UF9A 3GQYA 2E68A 2VOTA 3QFWA 4HHHA 4ZXLA 3KP0A 2DEPA 4JFWA 3WH8A 1Y5XA 3W2LA 4DPQA 1EWDA 3SW6A 1TPEA 4YHGA 4WF7A 4AZCB 3BDKA 4DXVA 2RH9A 3EWCA 5D2XA 3BURA 1UKTA 1UMLA 3EKZA 4JX4A 3CHCA 3QZEA 4ERGA 2DZPA 3M16A 2YDQA 1MW0A 3UA3A 5EKYA 4NX5A 4OOUA 3E5PA 1SO6A 3UJSA 3WEMA 3IGUA 2XWEA 2XINA 5DO8A 3VVGA 4Q4PA 3O15A 1UC5A 1S3HA 3M5ZA 2V3DA 1GW1A 4Z1AA 4LRSA 4K68A 3K2GA 1C90A 2A7NA 3DGBA 2R1PA 4PSRA 1Q63A 1ZBVA 5A6LA 1C91A 1UA7A 5KZEA 4C1LA 4L6OA 3NR0A 2V2DA 4IMAA 4E2BA 2Y7GA 4DWSD 2BOEX 2ABBA 2Y5JA 3WENA 2BODX 3E49A 2ZZ1A 1TMQA 4AU0A 1HFBA 1GORA 3W70A 1FFQA 2W27A 2OFJA 4N4PA 4ES4A 1J8VA 1I75A 1VHCA 4CN4A 1V6XA 2V30A 6TIMA 3F03K 1R3QA 2E9LA 1XLDA 2XU2A 3HQPA 7CGTA 4JN7A 4Q6XA 1EDTA 3TTYA 4E3TA 4B92A 2A7RA 3AICA 1PL9A 3KTXA 1TWDA 2G5WA 3VNLA 4HJWA 2W79A 3NVTA 3VPLA 4GUIA 1JF6A 2NVAA 2FVKA 3M47A 4CCCA 2OWWA 4EWND 4RLIA 4DZHA 5A69A 2ZXBA 3ARVA 2J7GA 1GVIA 1EBGA 3RAOA 3PG8A 4KWUA 1TQXA 1HO1A 4EPEC 1CGVA 2FDMA 3TWAA 4CD5A 2IW0A 3FYOA 2OWCA 2WK2A 3WX7A 4AZHA 4UOZA 4IP5A 4AIUA 4LAKA 2HVOA 1O60A 3BW4A 5G2WA 3CZEA 4HZ8A 4JGDA 5E6YA 1ONRA 1GKPA 1JZ7A 1P0EA 5I5RA 1Y5WA 3NL3A 5IBXC 2CZDA 3RJXA 1VBJA 2ZTJA 3W4RA 3VD5A 1W37A 4IFOA 1W3KA 3I68A 3U7BA 3C0SA 3CUZA 3R5EA 4B2DD 2YA1A 3MW7A 4D8ZA 3HB9A 3QRHA 4E0CA 4JTUA 3T09A 1PTDA 3LHZA 3BAKA 3SUWA 4JFVA 2P88A 4GHRA 1PCWA 2ZZ6A 3FNDA 4JTCA 2BGQA 4ATWA 4L61A 5D2YA 2IPWA 1VKFA 4XTDA 1A5AA 1PIGA 4FNQA 3WMBA 2QNEA 4QG6A 1XFBA 2B81A 5HMSA 1EXPA 1QW7A 4GUGA 2VDIA 3UERA 3LTPA 4PUKA 1JGIA 1RD5A 1JCYA 3RM9A 1XFCA 5L6UA 1EP3A 3MBDA 2CLEA 3W86A 3UXIA 5ECUA 1O5RA 3Q65A 3ERPA 2IKIA 3K13A 1UWQA 3MQTA 1V3JA 3THUA 4C7DA 3SJ3A 1CLKA 2YCIX 4D6EA 3MV11 1LJYA 1TVPA 4GRSA 2PWVA 3GLCA 1TB3A 4KH2A 2LLEA 3GVGA 1J12A 1PZ1A 2P8CA 5BU9A 4H9ZA 1R9XA 4GCAA 2YXOA 1K6AA 1V6VA 4QR6A 3GNXA 2YB1A 4QFUA 6CGTA 4WKAA 2VUYA 2Y89A 4A29A 1JPMA 2ZX5A 2V5KA 3KOFA 2E5CA 4KFNA 5AHMA 3WUGA 2Y8VA 1BYAA 1QI0A 1XLBA 4L4PA 3CM4A 1W1A1 3LRKA 1MQQA 1OD8A 2HVMA 3D5HA 3V16A 3FHAA 3QTPA 3IGSA 3NJ3A 3TTSA 3S83A 3LHTA 3W7CA 5LYRA 4BF5A 2OSXA 4X2RA 3AMCA 4JTTA 3BWWA 3R43A 3B8IA 3O9NA 3NUKA 3HV9A 5HNRA 1B30A 2GJXB 3WF2A 1KRAC 1L6SA 3FJ6A 1WUEA 1OFOA 2BB0A 3N3MA 1WO2A 3GAYA 1XGDA 1K4HA 2ACQA 5CAKA 3PULA