3W2MA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-183
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-183.
rcsb
source organism Trypanosoma cruzi
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2mA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2mA01
1A5AA 2WKJA 4MIMA 1VH7A 2E6FA 4QISA 4I7UA 3IIPA 3TNOA 5D2YA 5KITA 1NVMA 3AO0A 3NNTA 4KWVA 3INPA 3ELFA 4JTTA 1JCNA 4XBSA 3EKLA 4OWGA 5K4ZA 3C8FA 3OHIA 3LRKA 3W83A 4LU0A 3ZS4A 4IPIA 2O7SA 4RV8A 5D33A 3G1AA 3P62A 4BFAA 3NQEA 4P61A 1SUXA 1W0MA 4IUOA 5AC8A 3W85A 4JIPA 4NJHA 3NZRA 3G1VA 4WQ6A 1EIXA 3W2KA 5A8GA 2TRSA 5FF0A 3W7GA 2JKPA 4YCPA 4WOZA 3EX6A 5F4XA 1J4EA 2ZFAA 5HQEA 5ABTA 4O8RA 1VHCA 5U4NA 4DPPA 4MY1A 5CSRA 5HUPA 5HUOA 1BEUA 3S42A 2EHHA 5LKYA 2JKEA 2V5LA 4HKPA 3LCFA 3M5ZA 4AWSA 1MSSA 2WJZA 2ZDRA 5U7SA 1ICQA 5IM51 3OA3A 1YXDA 1P1XA 3G8EA 5HWNA 3HG3A 1OYAA 1IXQA 1TV5A 3L5MA 3TIMA 3SJ3A 3IGXA 4K37A 1VCFA 2B7QA 3I7RA 1L6SA 4AH7A 4ZMGA 5HR6A 3TQVA 1EWEA 1S3HA 3DHFA 4O14A 1TRIA 4QM1A 1FCUA 3R2GA 4E38A 3I7SA 4BI7A 2PC4A 2A6LA 3MI3A 2QCDA 2J9XA 3AJXA 3NQ2A 3O6DA 1YTKA 1RR2A 4PC8A 3P5YA 5LGXA 3CWNA 1WQ5A 2NUXA 3P82A 4HNUA 3LCLA 3F4NA 4GWEA 4K6AA 2DZWA 3F1QA 5EKYA 1RPXA 4R34A 2ZTKA 3FEMA 4CQAA 1OFAA 3S5NA 2C15A 2C13A 3LB0A 1NF0A 4XZ9A 3DFTA 4I7VA 3M47A 4EVZA 3LBMA 3NL2A 2H8ZA 3GVGA 1D9EA 2YW4A 3KX6A 2QCLA 4NU7A 3LHYA 4XTIA 4JTFA 4X2RA 4GUGA 3IRDA 3IIZA 2OJPA 2QJHA 3RU6A 5IBXC 4JY9A 3JS3A 1PVNA 1ZCOA 3CT7A 3IIOA 4EF9A 1GWJA 4FHAA 3I6RA 3IVTA 3QYQA 4A3UA 3GXTA 4UFKA 5TQLA 3HB9A 2IQTA 3GLCA 3RLUA 1Y0EA 4LRTA 1KLZA 3QSTA 1WOBA 2TMDA 2YDAA 2ATSA 1G4PA 4O52A 3SY5A 2F7FA 4JTIA 1HUVA 2A21A 1OX4A 1I2OA 4HNVA 4ML9A 5C6MA 5LGZA 2Y7EA 4LVGA 3W1MA 4PH6A 3GR7A 3FYPA 1OYCA 1D3GA 1EP2A 2HMCA 3HGOA 3DHDA 1B9BA 3O63A 3SR7A 1LOLA 3A9IA 1A53A 5LNRA 5G1TA 3HGSA 3HOJA 1FWWA 2H6RA 3EXSA 5H91A 4D2JA 8TIMA 2BX7A 1L9WA 5D2TA 3VKJA 1M6JA 1VCGA 4BF9A 3W1AA 4O1DA 4WD0A 4AHPA 1W3NA 3W2JA 4KKXA 4E0CA 2VOMA 1JCMP 5D02A 1YPFA 4Y8FA 3UY8A 1XDMA 1QOQA 1MXSA 1OFDA 3PB2A 1NAL1 2WSQA 2BWGA 1Q45A 3NEVA 1DORA 4O17A 3S5YA 2V82A 4RCXA 2C0AA 2H8XA 1K8XA 5DN1A 3G8RA 1I4NA 3N34A 1F2JA 1JUKA 1KA9F 1GTHA 4LC6A 1Z48A 3O07A 4PEKA 4HPJA 1Z42A 3TMLA 3W1QA 1N8FA 4A29A 1OFBA 5F1VA 1ML1A 3QW4B 3G1DA 3UZJA 2ZYFA 2NX1A 2B4GA 1TO3A 3WJSA 1B4KA 5I3IA 1YDNA 2KZHA 5EBUA 2E77A 3LHZA 2NV1A 1EUNA 2O7QA 4ZZ9A 1TJRA 1XBVA 3QRHA 2W6RA 4RX0A 5HWMA 2CZFA 4JR5A 4JS3A 4JYEA 3RNDA 4C1KA 2I14A 5D05A 4HIBA 4AB4A 4MJZA 4GXMA 3N2XA 3IIVA 3LTPA 4W9TA 1TPB1 1GVQA 2ZCGA 1XL9A 1T96A 2ZZ1A 3SZ8A 4FIQA 2GQ9A 2JK2A 3U2OA 1F6PA 1TQXA 4NQ1A 2H3DA 2BTMA 4EIVA 4TIMA 5CG7A 3TSMA 1TMHA 4CCCA 5D09A 5E0KA 1VYPX 2NXIA 3W1XA 4JTJA 1RZMA 4IXHA 1HFBA 1BTMA 2ISSA 2CW6A 3PAJA 1U5JA 2FQIA 2ZZ6A 1W3IA 4RXFA 1FXQA 1SU5A 4LY8A 3G1SA 4S2BA 2GQAA 5G2WA 1FUYA 1HG3A 1PE1A 2EAWA 3G0UA 1DJNA 4ZQNA 2NLIA 1GOXA 4H3DA 3B04A 2V2HA 1O95A 3W6YA 1YADA 2OT0A 1FQ0A 4O15A 3C2RA 4UMCA 1JCLA 3G3DA 1QCWA 2QKFA 1J2WA 5I3GA 3N14A 3O6CA 3GZ3A 1G4SA 1R30A 1SW0A 3WFAA 2A1YA 4FNRA 4FX8A 2FPVA 1RD5A 1IGSA 3UXAA 2QUTA 3OVRA 3S8HA 3TKFA 4Y90A 2GOUA 4O16A 4C1LA 4MZYA 3DAQA 2Q8LA 3UWQA 2ISVA 4FNQA 3S1UA 2XN1A 1LOSA 3CQ0A 2QAPA 1QPQA 5DBTA 4XKYA 3C61A 3UXDA 4RJEA 4UMBA 1Q6LA 5FEZA 5KMYA 2BXVA 2Q8ZA 1W8SA 4YXGA 3HGJA 2C16A 2DJXA 3NQVA 2PRHA 1LROA 3UWUA 3KRSA 1JCJA 4JTUA 4NJGA 4XTDA 3VI2A 2YPIA 2CWNA 1OK6A 4BK9A 3S1VA 1WYIA 5I3HA 1HO1A 3SGUA 3UWWA 1G6CA 3STCA 4QJ1A 5KSWA 2YYTA 1IIGA 4Y96A 3M0ZA 3TROA 2Y62A 5CPLA 3B0VC 1PV8A 4QNEA 1U83A 3EWUA 4MZ1A 4CLMA 3EKZA 4XBKA 1T99A 2FTPA 5FEPA 4GUJA 4Z0SA 1ZFJA 1B4EA 1P0NA 4CCDA 4O28A 2CZ5A 3P7YA 4DF0A 2DJLA 1DQXA 3W9ZA 4N02A 1JQXA 3NL6A 5I3KA 3B8DA 1NFBA 1W31A 3C0JA 1W5MA 2QDHA 5DY3A 5HWJA 3RLVA 2QF7A 2YZRA 1QOPA 5AYZA 1G4EA 2YSWA 3PWAA 3W2UA 1TPH1 3MP5A 3MI2A 3DH7A 4MOZA 2VEPA 3BV4A 1X8FA 1GG1A 4ORMA 4NJIA 1OG0A 3BW2A 4UTUA 3NQAA 1I2PA 1H63A 4CNNA 1VPXA 4UTTA 1X1OA 1RVGA 2XFWA 4K8HA 3T7VA 5I3FA 1QR7A 1MO0A 3W7MA 3BLFA 1L6YA 5AYXA 3T55A 1KFLA 3E02A 4O12A 3FA5A 5D37A 1SZNA 2CLFA 1WX0A 2C18A 2V5BA 5TBOA 3THQA 2X2GA 3HJZA 4LUIA 3DFPA 5D32A 3M44A 4AEOA 1N7KA 1JJKA 3M1ZA 3PULA 2ZRYA 4O1CA 3LM7A 1O94A 3W84A 3W1NA 1GTEA 1EWDA 4N9BA 3ABRA 1SSDA 1OF6A 2G95A 3W2MA 2QCNA 3RMJA 3GDKA 4JX5A 3W7NA 1KTBA 3H54A 4MKNA 2Y7FA 1YPIA 3P74A 3QF0A 3C4UA 2YXGA 3LERA 1FDYA 2ZRZA 3L5AA 4NX0A 1XBYA 4MYXA 1WA3A 3P84A 4CQ9A 1A5SA 1O5XA 4LRSA 3M43A 3WK0A 2X30A 1WDWA 5KTLA 3M7WA 2I9EA 4XUGA 3KVKA 3RK8A 3TMQA 1SR9A 2FFCA 3QMTA 2Y89A 1W3TA 3BARA 1IF2A 1XC4A 1DV7A 3W7PA 3TJXA 4QIUA 5EYWA 3IGSA 3GYEA 1KTCA 2NX9A 4TO8A 3W86A 4ZL1A 4Q32A 1MEWA 3L5LA 2A5HA 1K03A 3UQNA 2OMAA 1JCXA 2GQ8A 4JTLA 1SO6A 2VFFA 1F76A 5D2XA 4O11A 3MWAA 3M16A 2GVGA 4JTHA 1K02A 3NGJA 1SW3A 2HS6A 3UD6A 2UV8G 3DFNA 1NF7A 3C2EA 4O13A 3DKJA 1KFBA 4GNJA 2CLOA 4RKAA 1KM2A 2QDGA 3E12A 1H7OA 1O4UA 3KVLA 1DHPA 1QMLA 4NNBA 4JDBA 4FB7A 4S2CA 2ZZ3A 1GVRA 4MY9A 5LNUA 1X7FA 4IX2A 3TW7A 1QNVA 3S0CA 1F05A 3W72A 4AXKA 2V8ZA 4MLRA 3EX3A 2EF9A 3GDRA 3TDFA 3P8JA 4GUFA 4AVFA 4FXRA 2B7OA 4Q4KA 3QPZA 4TMBA 1SQ7A 3LHUA 4UUIA 3NDOA 3PUEA 1MEHA 3S9YA 4A2RA 4O53A 1KM1A 1FBAA 1DKWA 3BG3A 1EP3A 3CTLA 1H5YA 3RFAA 1M5WA 3EEGA 4FEZA 1LCOA 3EXRA 3W3OA 1TTJA 4M7SA 1QPRA 4YCOA 1GYNA 2AAMA 3G0SA 2JBMA 3N73A 4UFLA 5D04C 4O4WA 4O57A 3TC7A 2TYSA 3QSRA 3TFCA 5CZJA 3NZ1A 1B57A 3WK2A 2FPYA 2E6DA 5G2IA 4FNUA 4IMCA 1LBFA 4JTGA 3LLFA 1W54A 3NA8A 1UUMA 3NQ7A 3STFA 3LHVA 3N2MA 5DY2A 5BMXA 4ZVJA 1OF8A 4UTHA 2QJIA 4H6KA 2Q3OA 2A6NA 2CLHA 1I2NA 3BG5A 3EX1A 4O0ZA 1SFJA 1QPNA 2GJNA 5L6UA 4JDYA 1KBJA 7TIMA 4N6FA 1D3HA 1S5TA 5F2LA 3MMTA 1SW7A 3LLDA 3NVTA 1AG1O 2X1TA 4EF8A 5T26A 3M5YA 2Z1BA 3IGUA 5DCEA 5LSMA 2QEZA 1W56A 3NOEA 1GVOA 1ALDA 4ONVA 3BGJA 4DELA 3EX2A 1W5OA 4Y6GA 5F4WA 5EY5A 3WJZA 4WXYA 2Y63A 2A85A 4CNPA 1XBZA 3TW6A 1ICSA 2WQPA 1KFEA 3DGRA 3C6CA 1G4TA 3O15A 4N9CA 2RDUA 4N2YA 1TRDA 2R8WA 1HL2A 3ZWSA 4WUIA 5FF4A 6TIMA 2VENA 3VFLA 2H90A 3E96A 2VEMA 1FWRA 2XN2A 1CW2A 3WJXA 4IOTA 1XM3A 4AF0B 2JGYA 3NM3A 1ZAIA 4UTJA 2TSYA 4CQ8A 1KBIA 1LBMA 4EWND 4UXDA 3MJYA 1LOQA 5F2IA 4LC8A 3LI0A 5G4WA 2Z6IA 1S5VA 2G97A 1QO2A 1ZAHA 2NUYA 2E5BA 3TFXA 1AL7A 3WK3A 1G7VA 4LWWA 3BO9A 2FJKA 4GE8A 4MPQA 1LTDA 3GNDA 3UNDA 4HSNA 1JR1A 3FOKA 4UR8A 5DLCA 4DEFA 3L68A 5G2HA 3W76A 1UB3A 4JIQA 5FF3A 3LHWA 2C19A 4YWIA 3GKFA 3H55A 2V81A 1JCYA 1LRNA 2Z0IA 1LORA 4PFMA 3O06A 4ZQOA 4KFNA 4U28A 2WSRA 4WXZA 4GUHA 5CZSA 1W5NA 1WAUA 3KHJA 3Q94A 2BSLA 2YR1A 5EA9A 4N4QA 2ZBTA 5FF7A 2NUWA 4Z08A 4LS1A 4M6PA 5AN7A 5AC7A 4OHQA 5HNRA 5D2VA 4R53A 2TPSA 2ZZ2A 5AHFA 1L2UA 4UFHA 1C29A 1LZOA 1ZJIA 5KZDA 3NPXA 1PCWA 3TC6A 2YW3A 1V7YA 3GXNA 2F84A 1LRQA 1YYAA 1KM6A 1MEIA 4NZFA 3MBDA 1FXPA 1UJPA 4NXSA 5DXXA 1XCFA 5CPMA 3N9RA 1F6KA 1RV8A 2RH9A 1XFBA 4KFOA 3S5ZA 1FCBA 1F7BA 4JYDA 3SGZA 4JTKA 4UFJA 3OVPA 3KVJA 1CX9A 3HMJG 4BWLC 5AHNA 5G5IA 3NM1A 5AB3A 1PCKA 2Y6ZA 3P81A 5IBXA 1R2TA 2J6XA 3NPWA 4RLIA 4LT9A 1TTIA 1X6UA 2WNNA 3GDLA 3GR8A 3MYOA 2NXHA 4JTSA 2EKCA 1XBXA 3N9SA 3CC1A 5HULA 2VC6A 2Z2UA 3N19B 4IMEA 3C3NA 4IQLA 4ADUA 5LNWA 1K8ZA 3QH2A 2ZZ4A 5FEWA 4MY8A 4UCGA 2DP3A 2FB3A 3IEBA 4DO5A 3M6YA 4NNAA 1TREA 3JR2A 3TAKA 1DL3A 3E49A 2C3ZA 3LTYA 2EGZA 3NYZA 3M5VA 3LRLA 1FCQA 3NQ6A 3TAOA 4UTKA 3IVSA 2ISWA 5AHIA 1GZGA 2WNQA 1FWSA 3BG9A 2P10A 5F4SA 2V9DA 1RQHA 2DZTA 3EB2A 2P1FA 3PR2A 3A21A 1V5XA 4N9DA 3V1PA 5D03A 3PY2A 2NWRA 1FCVA 3FLUA 2HSAA 3TK7A 3DBPA 4HN4A 1YDVA 3PC0A 1W5PA 1GQNA 3KFTA 1K7EA 4NXKA 4TX9A 1Q6QA 3U6WA 3L0NA 4BR1A 5GVJA 1NSJA 1WBJA 4ICNA 1C8VA 2Y88A 4QITA 5CGQA 4HSOA 4RZ6A 4OQVA 5BMWA 5C2XA 3EWWA 3TCEA 1VC4A 2PURA 3OVQA 3KRZA 1X1ZA 2ZRVA 4UFMA 2ATMA 2FLIA 3O6YX 3HPSA 2J9YA 3KXQA 4LVBA 4FO4A 3PBUA 1FDJA 3VCRA 3W7EA 4N6EA 3WK1A 4R7JA 2GVJA 1VR6A 2QAFA 3EWXA 2FPTA 4QQ3A 4Z1BA 1H7PA 1H62A 3PSVA 4LS2A 3W7DA 3LDVA 1DQWA 1QPOA 3HBLA 3L0GA 3FIGA 5LHFA 4WJEA 1YLVA 2RDWA 4UTWC 3W2NA 3TJLA 4RZ5A 3VE9A 4LV9A 3LGEA 4DF2A 3KRUA 2JGQA 5DCDA 1Q6OA 1SO5A 5AC6A 1KM3A 1OFEA 1M7PA 3LXCA 1QAPA 2W0UA 2HS8A 3FKKA 4HNNA 3PBWA 3TE9A 4AHOA 1ADOA 3UPWA 1PS9A 3GDTA 4DXVA 3TUUA 3GKAA 2J24A 5KINA 2Y61A 2ABBA 4I9AA 3W7KA 1Z44A 3DI1A 4IXXA 4MYAA 4O1BA 3W70A 1OX5A 4Z0JA 1KV5A 4GC4A 2VFIA 4K7YA 1H1YA 1BWKA 3D0CA 1XXXA 3R8RA 3VNDA 4POCA 3DI0A 4MVAA 2V2CA 1TCDA 4XWUA 3MP3A 3NXFA 1F5ZA 1F74A 3WJYA 3QMSA 3PBVA 1KM0A 3BGGA 1ONRA 1VS1A 3TH6A 5E1QA 3UZ5A 2GPTA 4JYFA 3THAA 3JRKA 5DELA 5AFDA 3S1XA 1AW2A 2YCEA 4ALDA 3ABQA 1HO4A 4PL1A 2ZRUA 4JY8A 2ZA1A 1DJQA 3L65A 2CZEA 5DBUA 1IXOA 2V2DA 3MP4A 1VRDA 2ZRWA 1TSIA 4M5PA 2V30A 3BVJA 3LBCA 3STEA 4I7WA 4CCEA 4TU1A 3QW3A 3PS7A 1RQEA 1ICPA 4K7VA 2AQWA 3B0PA 1AMKA 2W79A 3HF3A 3HG4A 3MUXA 2RHGA 2WSYA 2RKXA 2VFEA 4K38A 1LBLA 1OK4A 1ZAJA 2OCZA 1TPC1 3A24A 4M6QA 2PRMA 3CIWA 3QQ0A 3SSJA 2QCMA 3I7QA 1ZHAA 4WY0B 4P2VA 4NZJA 3B06A 1M7OA 1VHNA 3A5VA 3TSDA 1LM1A 1OFQA 5FESA 3DZ1A 1JRBA 1XUZA 2VEIA 1UASA 3QMRA 4LVDA 4DQWA 3TXZA 1TIMA 4JTEA 3S6DA 3SECA 1EPXA 4L4MA 1P5BA 3B4UA 3QJAA 1A50A 5AOUA 2ZZ5A 2DZUA 2X1RA 1JULA 4N4PA 5K9DA 5LNVA 4IJBA 2A7PA 3W23A 1TTQA 2XN0A 4UMAA 1A5BA 4MLJA 3CM4A 5LHEA 3ANYA 2GVLA 3DXIA 3IIXA 3QQ1A 4Z1AA 3W22A 4JGDA 4GJ1A 1LDCA 3GAKA 3SW6A 3W07A 2DORA 2DZVA 3OEXA 4RK8A 3V75A 2I1OA 3STGA 4OU1A 1RQBA 3GX9A 3NQGA 4UTMA 3QEZA 4DF1A 2FIQA 3SI9A 2ABAA 2GUUA 3GK0A 2NX3A 1I2RA 3P60A 1K7FA 3ZR4A 3NPUA 1KFCA 4JX4A 2H3BA 2Q3RA 3DENA 4JX6A 1JUEA 2YYUA 4XQ6A 4K8EA 3MHGA 5AHMA 2CLMA 1R2SA 2PE4A 1BKSA 2QUVA 2Y7GA 4NJKA 2X1SA 3CB8A 5G4EA 4LS0A 2QCHA 5K7JA 4FIRA 3LCWA 4OV4A 3ABOA 1THFD 5BOOA 5AHLA 4N9EA 1WXJA 5EL1A 3TXVA 4NX5A 3OIXA 2WNZA 5K4XA 1W37A 4EOUA 3LTSA 2YGYA 4HNTA 1UBSA 3UWVA 5J5DA 4JEQA 3LI1A 1GVSA 1T0OA 4UC5A 2ZTJA 4DO6A 1DVJA 1OYBA 1QDSA 2DZSA 1OFRA 3W1RA 3W7QA 3DKLA 3PM6A 3W88A 1VZWA 3W1LA 2QUUA 3TU9A 2QCCA 4AWTA 1WV2A 3B03A 1ZALA 2G96A 3E9AA 1JUBA 5C54A 1TB3A 6ALDA 2VELA 1KV8A 3CEUA 3KVMA 5SWUA 4KFPA 5BW6A 3W7IA 2B7PA 4L4LA 3NQ8A 1F73A 2E68A 1AW5A 3CEPA 4Z1DA 1TQJA 1VYRA 2Y7DA 4HPXA 3R5EA 3MW7A 4FNTA 2EPHA 2GJLA 3NL3A 4X9SA 5J5RA 1Q6RA 3LXAA 5AHEA 2E5CA 3I68A 3TSBA 4AF0A 1O60A 4WX2A 3DFSA 4FNSA 3IVUA 1IIHA 4S1FA 2Y70A 1DBTA 4UIOA 4CNOA 3FKRA 1KFKA 3PUOA 4NJJA 2RFGA 4RR4A 1QO5A 2C14A 3G1XA 4DBDA 3KAOA 2E6AA 3F03K 3NR0A 2AGKA 3G1HA 4O18A 1VLWA 1T8XA 1VCVA 3S1WA 3CU2A 2WO5A 2QCDB 4WZHA 3G22A 4Q33A 4A21A 4A22A 3TQKA 4X22A 3NPVA 4E2DA 3NL5A 1GVFA 3C2VA 5H2ZA 5CSSA 4JNMA 3ZWTA 2FDSA 2ZRXA 1TV8A 5D38A 4IGHA 1SSGA 2Y85A 1EP1A 3LV5A 5C5YA 3LRMA 3NG3A 5C55A 1PHQA 1KFJA 1GT8A 2NXGA 2WPBA 4LW7A 1SFLA 1JQVA 2VKZG 2B0MA 4QNWA 1PHWA 2ZA2A 3O1NA 3T78A 1LLZA 2CFFA 3UYCA 1KTNA 1UUOA 4GBUA 1EB3A 4LV4A 5F1UA 3R89A 3CHVA 2OZ0A 3UWYA 1JRCA 3A5FA 1XI3A 3FJLA 1VYSX 3G0XA 1I8JA 4NUWA 3USBA 1GG0A 1KW1A 3L0KA 3MHFA 1UCWA 2PRLA 1OFPA 1K8YA 3KOFA 1H7NA 3LCHA 2P0OA 1SZGA 2VFGA 3G3MA 1Z41A 3NAVA 1TPVA 4JXCA 4DBEA 4ADTA 5BNKA 4TMCA 3B05A 4IWWA 4X3ZA 3W7JA 3M5XA 3G1FA 1R2RA 1SO4A 4IX0A 2X1UA 4O19A 4OBTA 1OX4B 3LV6A 5DCBA 1G67A 3ZFHA 4OGZA 1B3OA 1YTEA 1IXNA 1K7XA 2QCGA 1OFOA 4ZQMA 3OBKA 4MJMA 3RF9A 3PUDA 4UTLA 5LNSA 3I65A 3NO5A 4M7TA 2R91A 2OX1A 4AWUA 1OVDA 3S5OA 1O5KA 2DU2A 1FX6A 4O1AA 2QCFA 3W7LA 1N55A 3HG2A 1YXCA 3UY7A 4QSHA 1H61A 2BZNA 2JKAA 4LVAA 1C9DA 1LRTA 3U8GA 3T4CA 4O4VA 4YL2A 3OG3A 3PG8A 4Y9AA 3GIYA 3BLIA 1FWNA 1P4CA 4NT0A 1QFEA 5FEXA 4ZQPA 1OJXA 3NQDA 1GYLA 3W74A 3M41A 2R94A 4IMDA 1XUUA 3W1PA 1J5TA 3QC3A 2FB2A 4IMGA 3O8AA 1NEYA 3QFEA 3MYPA 1SZEA 1TTPA 4UFIA 5FI8A 2E1DA 5HMSA 1GJPA 3EWZA 3G1YA 5F2GA 4M6VA 2VXNA 1TPDA 2QR6A 1H1ZA 4UTIA 4BI6A 3EXTA 2VFDA 1E51A 3NQFA 4DPQA 4OT7A 3PBYA 2VFHA 5D30A 2ZZ7A 4R33A 4G1KA 2J9ZA 5TIMA 3PF3A 5HR7A 3PVFA 4U4MA 2WV8A 3B0UX 2CLIA 3CWOX 4WY0F 2PCQA 2DZXA 4E2BA 1OX6A 3LCGA 4ORIA 3L2IA 1TPWA 2A7NA 3IV3A 3PB0A 5K9XA 5CPNA 4ZQCA 4PTNA 5EPDA 3W7OA 1KLYA 1H7WA 2ZQ0A 3W1UA 2A0NA 1ZY9A 3Q58A 5K9CA 1QWGA 4UTTC 3P67A 1ME7A 4K36A 2A4AA 3LCIA 1SPQA 3T44A 1GPWA 3W2LA 3QM3A 1HTIA 3EWBX 4JD4A 1EEPA 2D73A 3BW4A 5E93A 3YPIA 3TA6A 3WJWA 3R13A 3PG9A 1FWTA 4OE7A 4K39A 4FF7A 1TPEA 4WOQA 3H53A 4JICA 1GEQA 1R47A 3HPZA 5F2MA 3CLMA 2ZA3A 5LZLA 5CKSA 5D2WA 4J9JA 4PCFA 2E09A 4YMZA 2LLEA 3A23A 3P61A 1L6WA 1K3UA 1WBHA 5CZ0A 4BWLA 5DXYA 4KWWA 1G69A 5KZEA 4ADSA 1H7RA 3CPRA 4UNKA 3UPBA 1MZHA 1BWLA 1SZFA 4FXSA 5K3VA 3R12A 3ABSA 2C6QA 3DU0A 3MBFA 4XKYB 4FNPA 4MFDA 4DO4A 3TV8A 4ZQRA 4LOCA 1PIIA 5BRBA 3LXBA 3TQ0A 3O05A 4O0KA 1ME8A 3HIJA 4GUIA 2A7RA 3GXPA 5A5WA 2C1HA 2V0TA 1ZNNA 3W7CA 3BLEA 1XKYA 1LP6A 3LHTA 4YLWA 5L9FA 1KM4A 4UR7A 5FF2A 3P80A 3L66A 1Q3NA 2Z6JA 4OV9A 1H60A 4RZ4A 2CZDA 3LX9A 1YXYA 1YDOA 3VE7A 5CZTA 4PL2A 5G1YA 4LNYA 3NQMA 3MHUA 1TPFA 5CPOA 3G24A 1ME9A 3Q37A 3C2FA 5HJLA 2G5WA 3K30A 1CI1A 1TYGA 1R46A 1TJPA 3L9CA 1TPUA 3SIZA 3W7RA 3FFSA 3GB6A 1DOSA 3W75A 1EUAA 3UWZA 4MZ8A 4RXGA 4M19A 2BLEA 3N3MA 4QAIA 3EX4A 1AL8A 3L21A 4MFEA 1LLWA 3Q2DA 4AAJA 3C56A 1H50A 3W73A 1IXPA 1AW1A 3HO8A 3MI6A 3HGRA 5I3JA 3LCXA 5EMUA 1VQTA 3L67A 3G18A 3SFKA 4MUZA 4AMAA 4A2SA 1TV7A 1W1ZA 4TR9A 3HQ1A 3BW3A 3W71A 1I45A 1XDLA 4NNCA 3DFOA 3W87A 2CLKA 5HINA 4PA8A 2VEKA 4WY0A 3C52A 4HHPA 1H7XA 4NVTA 1I2QA 1OHLA 2X16A 1VGAA 1H51A 2J27A 2HTMA 3C2OA 3T40A 4UNLA 1FDZA 3HG5A 5KZMA 2RDTA 1FY6A 2CU0A 4FX6M 3GAYA 3FJ6A 3W1TA 4PODA 2NV2A 3QPYA 3EWYA 3BK0A 3ATYA 1VJIA 1SO3A 4AHQA 4LTSA 2B7NA 1EA0A 1LYXA 4H4IA 3TR2A 1ZENA 3FYOA 4O54A 4O50A 4UTWA 3NQCA 4IPJA 5K2ZA 3FS2A 2E6YA 3ATZA 1W5QA 4IMFA 4HT3A 5MHBA 1AK5A 2OT1A 1YTDA 2J88A 3MO7A 3HPXA 2WOQA 3W7HA 2DZPA 1JVNA 4B5NA 3P5ZA 3P8IA 2QJGA 2ALDA 1PL9A 2CLLA 5AYYA 3O16A 3PSWA 2E5DA 4LUJA 2CLEA 4O10A 3TX9A 1A5CA 4FX7A 4LVFA 4JN6A 2R14A 1P0KA 2YFOA 1WOAA 4GFSA 2QCEA 2YX0A 3BPWA 2YFNA 4BI5A 1S5WA 1KM5A 2A2IA 1G7UA 1OABA 3LOTA 3GNNA 3CIXA 3DFQA 4Z1CA 1EX5A 3E0IA 4GRSA 3F4WA 1VLIA 3QZEA 3M9YA 2NWSA 2NZLA 3A22A 3GDMA
chains in the Genus database with same CATH superfamily
4DXKA 2RJHA 2QV4A 4UQDA 3BJSA 1RSCA 4I7UA 1YBQB 3SRKA 2PLMA 3H21A 4JFSA 5FCZA 1IEIA 3UT0A 3AO0A 3NNTA 4KWVA 3INPA 4RE4A 1WKEA 3VGGA 2F8QA 4TVUA 4XBSA 1KBBA 3WLSA 4V28A 1DE5A 3MSDA 8XIAA 5D33A 3G1AA 3P62A 1YRRA 2ZC1A 3BJTA 4AZGA 2ZXBA 1UA7A 2GQ3A 3W85A 2Z2AA 3NZRA 3G1VA 4WQ6A 3QQWA 3W2KA 3SCTA 2JKPA 4YCPA 4WOZA 1J4EA 4YS1A 5ABTA 4O8RA 5U4NA 4MY1A 1PIFA 3U2EA 5LKYA 3GBDA 2V5LA 4HKPA 2Y4SA 3O6AA 4L4OA 1Q7ZA 5IM51 1E9YB 2PFHA 5IHRA 4QG9A 1XF0A 1Y7VA 3IGXA 3I7RA 3H4GA 1A5NC 1L6SA 4D6EA 2NVAA 4C6OA 4ZMGA 3UVIA 4EXAA 1J0JA 1E1FA 3AIEA 3DHFA 4O14A 4R88A 1FCUA 2FDMA 3R2GA 1E40A 2OQYA 3TC3A 1UMYA 1T6MA 2J9XA 3GW3A 1R6WA 2AKZA 3NQ2A 4AD5A 1YTKA 4PC8A 3V0TA 3CHFA 4ZXOA 2NUXA 2BY0A 4R34A 2GK1A 2ZVRA 4KW2A 4UZSA 4I7VA 5DT5A 1IWBA 4J7RA 2PDYA 3NL2A 2H8ZA 1D9EA 4E2OA 4NU7A 3UWEA 1WXYA 3N6HA 5T9CE 2BXYA 4JTFA 4GUGA 3RU6A 2OJPA 4EACA 1W1VA 3JS3A 1ZCOA 3WQGA 4EF9A 1SR0A 2WZMA 3I6RA 3QYQA 1MMFA 3GXTA 3COTA 2CYGA 2PD9A 3HB9A 3H6OA 3VDGA 4P7RA 2HE8A 3QSTA 1WOBA 1JD9A 2ATSA 3LK6A 1G4PA 1PTAA 4O52A 3URBA 1EO5A 3QBUA 1NARA 3WUEA 4DAIA 1OX4A 1I2OA 4HNVA 1OG6A 3L2LA 4LVGA 3E1F1 3VKCA 3IJ8A 3WMLA 2D1ZA 2HMCA 3HGOA 1E1CB 2Z00A 3AQUA 3VD7A 4K1GA 3SURA 3TZFA 1GZJA 1A53A 1YNQA 1MW2A 4B5WA 3HGSA 4EAYA 5KETA 1WDDA 2H6RA 4D2JA 1V6XA 4E8CA 3W02A 1A5OC 2WVVA 5LXEA 1M6JA 3CZJA 4LPCA 1E0UA 1VCGA 3VNZA 3QR3A 1CGUA 2VOMA 3GUGA 4GI4A 5CPSA 3HJEA 2BODX 1YPFA 4Y8FA 5B7ZA 2DSKA 4JEJA 1XKJA 1V6TA 3DN5A 3UY8A 1E0WA 1XDMA 4DBWA 3HQNA 1K77A 3EA1A 1DORA 5I7GA 5BRPA 4QE5A 4O17A 3AS3A 2V82A 4U2YA 3VKAA 2C0AA 1L2QA 1K8XA 3T08A 4WKAA 3N34A 4L80A 1KA9F 1V6VA 3FA3A 1XLDA 3TMLA 3W1QA 3TEVA 4H8NA 1A5KC 4GZIA 1P6BA 4XO6A 3AIBA 3VDCA 2B4GA 3MV11 3V5CA 1E55A 1I75A 5I3IA 1WAWA 4GQ0A 1EUNA 3LD5A 3KBNA 4RX0A 3RNDA 4AB4A 3N2XA 3LTPA 2PTYA 2UY5A 1XIFA 1PUDA 2ZZ1A 1BQCA 4XKMA 1DIOA 2F6XA 2BTMA 6A3HA 9XIMA 4JTJA 1RZMA 4IXHA 1Z9AA 1BTMA 2CBUA 4MB4A 4QJ3B 4M8UA 3DECA 1PJ9A 3G1SA 4S2BA 2V3FA 3BICA 1DJNA 3ANUA 4ZQNA 4PMYA 1TZ9A 3KP0A 4H3DA 4IFKA 1Z32X 3B04A 3TYCA 1XJBA 2IPWA 1BF2A 3FGCA 4YVVA 1O95A 5AYBA 1YADA 2OT0A 4UQEA 1JCLA 3G3DA 4MB5A 5I79A 4XUYA 4DLFA 3D47A 3EMQA 3QPEA 3T2PA 5I3GA 3AOFA 3N14A 5BYWA 1VFUA 3O6CA 4C91A 1TR9A 3CUGA 4NF7A 2FPVA 3WO8A 1Q63A 3S8HA 3TKFA 2VGFA 1PWMA 2GOUA 4HJFA 1ENUA 4C1LA 3W81A 5KEZA 4PMXA 2Q8LA 1EDGA 4HQVA 1NOWA 1SJCA 3WMBA 4DI9A 1QPQA 1L6FA 2UZ9A 3C61A 2Z26A 4RJEA 4L1XA 5FEZA 2UY2A 1UR1A 2Q8ZA 3HGJA 3OLEA 1BWVA 3AXKA 1QHZA 3KRSA 3SRHA 3A3HA 1JCJA 1AH3A 3S2LA 4AIBA 2YPIA 2X0YA 3CUXA 1OK6A 2XWEA 4C6MA 5M03A 2WLYA 4NRRA 4MNJA 4Y96A 3M0ZA 3TROA 3B0VC 3P93A 2Y8KA 4QNEA 5EMLA 1PDZA 3UFYA 3BSMA 2PF8A 3KBJA 1KRBC 4PFHA 5ECUA 3M4HA 4CCDA 4I9JA 1R87A 4DF0A 4OOUA 3GG8A 3C0QA 1M68A 3W9ZA 4N02A 1SMAA 3MC5A 2OELA 3NL6A 1OB0A 4GACA 2WSPA 1W5MA 2QF8A 5DY3A 4C6CA 1QOPA 3PWAA 1TPH1 3NO1A 2IPFA 3K8KA 3DH7A 3BOFA 5IDIA 1E1EA 1GG1A 3VM7A 4NJIA 1OG0A 3TTOA 4LAUA 5HDRA 1XPYA 4ACZB 1EJWC 4CQDA 4V33A 1VPXA 1I60A 3ZVHB 3UETA 4K8HA 5A94A 4DWDA 1LWHA 4HPNA 1L6YA 2D22A 5AYXA 1MQRA 1KFLA 3E02A 3CGTA 3N1AA 1XW8A 3EDKA 4JTAA 1WX0A 4B4FA 5TBOA 2QPXA 1F3XA 1FWBC 1TVLA 4AEOA 4D9PA 1CB2A 1ZJHA 4ZR8A 1OINA 1PB0A 3ZJ6A 2G95A 3STPA 3W2MA 2QCNA 1U2YA 3H54A 2XFYA 2WZHA 2OWCA 3P74A 3QF0A 4JIHA 2YXGA 1FDYA 3LG3A 4MYXA 4CQ9A 3FV9A 1F8MA 2JFEX 2O9TA 2X30A 3N29A 2L5HA 2I9EA 3QYSA 3T81A 1W2PA 3KVKA 3RK8A 1S2AA 2PDPA 3TMQA 3A4JA 1NDZA 1PAMA 1W3TA 3BARA 1GW1A 5A3HA 2OKTA 3KS5A 3W7PA 1Q6FA 1UH3A 3IGSA 2NX9A 3W86A 4HNOA 1F07A 1ZBWA 3UQNA 1J5SA 1S2TA 1SO6A 4C1NA 1Z8AA 3MWAA 2GVGA 2EPOA 3UD6A 1MWOA 2G3IA 3C2EA 4O13A 4GNJA 4OUEA 4KIRA 3OZYA 3WG6A 2QDGA 4YJ5A 3KVLA 4NNBA 1GVRA 4MY9A 4IX2A 6XIAA 3H2MA 3ZJ7A 1ZJAA 2HBVA 1HGWA 2PWVA 4JQ3A 3GDRA 1HKJA 3H2CA 1I6NA 3P8JA 1W6TA 1UR0A 2B7OA 4BCEA 2YL5A 2XVGA 2OPJA 4UZUA 1XLFA 4B2DD 1AQ0A 3SY1A 4MSSA 3ITXA 3S9YA 1V03A 2JIEA 1DIEA 4A2RA 3B9OA 1YMYA 1DKWA 1EP3A 4WF7A 4FEZA 1LCOA 1XLKA 3W3OA 3EXRA 3ZJKA 2DQXA 4RPPA 5BZAA 2ADAA 3ALFA 2Z25A 3N73A 5CZJA 4Z2HA 3WK2A 2FPYA 4FNUA 1LBFA 3BCDA 3LLFA 1UUMA 2GLKA 3N2MA 5J8LA 5BMXA 3VIMA 3W27A 1ITQA 1XIDA 4H6KA 1F61A 2Q3OA 5D9MA 2VVNA 2VX4A 2OSXA 1D3HA 1WPCA 5F2LA 3TVAA 5FAGA 1UJQA 3LLDA 2X1TA 3NVTA 4EF8A 2Z1BA 2FTYA 4CD8A 1IT8A 3CUHA 3O9NA 3GZAA 2IMRA 1AZ2A 4GYJA 2QJMA 4ONVA 4U3CA 3SCOA 3EX2A 3NFUA 1W3KA 4AUBA 3FJNA 2PU1A 2W4XA 4MKSA 4NILA 1IEVA 3WQCA 1PPIA 3PPHA 4GBDA 1DE6A 4LBRA 4N2YA 1AD4A 2ZX9A 2IKHA 2R8WA 1QU4A 5HNTA 3TTQA 1EYWA 2VZVA 1TWIA 3E96A 1FWRA 4NASA 4P7OA 3NOYA 5TF0A 3GHTA 1RAKA 3NM3A 2P5NA 3C8NA 4UTJA 1RLDA 1V0KA 1PKYA 4H8HA 1LBMA 1LOQA 2GYIA 5G4WA 1S5VA 2FZMA 3C86A 4REQB 1O66A 2QW5A 4LWWA 3R1ZA 2X0HA 2XGIA 3GNDA 4O8AA 1JR1A 4B3KA 3W6MA 3T2OA 3AIUA 5CBIA 2G37A 3AYSA 3MU7A 3GH5A 1V08A 2E4TA 3AWOA 1EOKA 4BQ2A 1V3LA 2VX7A 3ALGA 1JCYA 1Q7MA 4YIWA 2Z0IA 2C8NA 2J7HA 2REQA 2XM1A 3Q94A 4L6HA 3CQJA 4LSBA 3SADA 3U3HA 3UZXA 2QXWA 5FF7A 2NUWA 3SEPA 4LS1A 1AVAA 5HNRA 1KRAC 1E15A 3ME3A 4PMOA 1C29A 1OCNA 4I5XA 5KZDA 3TC6A 3IJ9A 2F84A 1LRQA 1YYAA 1MEIA 3OPSA 1P6CA 2FHBA 1XCFA 3N9RA 4DX3A 1MNZA 3UU0A 4H7ZA 2BVDA 3SGZA 2HCVA 4JTKA 4UFJA 3OVPA 1CX9A 1ADDA 1A4MA 4BWLC 3DCPA 5FSEC 4YTRA 2PGEA 1XLIA 4LT9A 3T4WA 4FR6A 3MYOA 1RH9A 2R9RA 3GXDA 4JTSA 2YCLA 2WM0A 1U22A 4C6QA 3EPMA 4IMEA 2F9RA 4US5D 1M04A 3WIJA 2VD8A 4KRUA 4UCGA 1ZTVA 2DP3A 3HV8A 3IEBA 4KEUA 1R3TA 3SCQA 2C3ZA 1YX1A 1V3IA 3C2YA 3ISIX 4CUCA 3WQDA 4KWSA 2EGZA 2EO7A 5DRCA 3OBEA 1V77A 3LRLA 1FCQA 1HVQA 1HKMA 3TAOA 3RCNA 4UTKA 3IVSA 5AHIA 1FWSA 2PI6A 1RQHA 4GIAA 1QI0A 2P1FA 2ZIDA 1V5XA 1J93A 5D03A 3OQ8A 3WUFA 4G8TA 5HNUA 2QIIA 2FYMA 4MWAB 3KFTA 4TX9A 4R27A 3U6WA 2GUBA 5FJTA 3KZPA 5GVJA 1WBJA 1ZSXA 3BGAA 4PUJA 3H7UA 3H26A 4OQVA 4NAEA 5BMWA 4WSJA 3B8VA 2PDIA 5A6BD 1X1ZA 4UFMA 2GDVA 2FLIA 3HPSA 1QXLA 4IJCA 4F2TA 2PDCA 1DTNA 3PBUA 1FDJA 4N6EA 3I3DA 4B90A 2WM1A 3QVQA 1VR6A 3E74A 3CLWA 1DQWA 3P0XA 4H1ZA 4P5UA 3FIGA 3HQOA 2PDNA 3MANA 2G3MA 3ZSTA 3ZYZA 1GVEA 1F8IA 4IIBA 3ONBA 1XC6A 3L4UA 3JZEA 2Q09A 2GDUA 1JYVA 1DIDA 4DF2A 2DH3A 3K4AA 5C70A 2EBNA 2YDQA 5DCDA 1Q6OA 1XLHA 3NDZA 4H2HA 4UCFA 1KM3A 1OFEA 4E6MA 4C60A 1JZ4A 2PDGA 2RGLA 2HS8A 2CLPA 1ADOA 1UROA 4US5A 4IXXA 3DI1A 3O0KA 1M1BA 1EZ2A 2VFIA 3FAXA 1VPQA 1BWKA 3D0CA 2PU0A 4KCUA 1GOMA 1NP0A 1UP0A 3DI0A 4MVAA 2V2CA 3WQ8A 2ISFA 1ISVA 2OYLA 4YTSA 2O4MA 3NXFA 5M17A 3DFYA 4GQQA 3WJYA 1VBUA 3QY7A 2CXEA 3BGGA 1VS1A 3BLOA 3ZLGA 2HVOA 2GPTA 1XRSA 1ZP4A 3THAA 1H2JA 2YCEA 4ALDA 2PCEA 3ZT5A 4PL1A 3BMVA 1UZ4A 1DJQA 3GVWA 2V2DA 3MP4A 4IG2B 3RO8A 1Z89A 2V30A 3AMKA 1AD1A 2XISA 4I7WA 3R94A 4UTFA 5A6BA 2AQWA 7XIMA 3OZPA 1C7SA 1B0IA 1BVZA 4PMVA 4W4QA 4L4PA 1PKMA 4RNHA 4PR4A 4K38A 1LBLA 5E5CA 4W87A 4C6IA 1GORA 4M6QA 3QLLA 2QCMA 4P2VA 3WDIA 4CN1A 3MS8A 1LM1A 4H6EA 1EJXC 5E09A 2XM2A 4J3ZA 1V79A 2VEIA 1UASA 3S6DA 1C9WA 1REQB 4NRSA 3NSMA 3SECA 4L4MA 2DT3A 3AHYA 2WHKA 4B4HA 1E6ZA 2DZUA 1JULA 4AX7A 3OW1A 3PJTA 1GK8A 5K9DA 1GUVA 2DT2A 4OJYA 2XN0A 3W23A 1Z7AA 8A3HA 1GHSA 1A5BA 2ZUMA 3ANYA 2BHZA 3DXIA 2PSNA 2VCBA 3W22A 1LDCA 3T07A 4GLEA 2RGMA 1J01A 3FHAA 4GKLA 5FJUA 4GH3A 4HA1A 3NQGA 3GHRA 4I5RA 3SI9A 2YIHA 5LYRA 2GUUA 3REQA 4J1OA 1FFQA 1UKTA 3RJYA 3NPUA 3EAUA 2IPJA 4W8AA 4I90A 1JUEA 2YYUA 4RDWA 2X42A 4AX6A 4XD5A 1TMLA 2IPGA 1TA3B 1W9DM 3CB8A 3BJFA 2QCHA 4DUXA 4OV4A 5ENLA 3QKZA 3AIVA 5EL1A 1KKOA 4W88A 3TXVA 1QHOA 3OIXA 5G1MA 1J8VA 1L8NA 1CGYA 1PEZA 3Q65A 4PTMA 1R7OA 3IAPA 1NWSA 4JEQA 1W9PA 3DX5A 4DO6A 1VPYA 4G1NA 4RW3A 2DZSA 1F3WA 2YDSA 1OFRA 3W7QA 3FYYA 5H1WA 3PK7A 1VZWA 4BF5A 3EDJA 3UXKA 2QCCA 2PDLA 2NQJA 4F2BA 4J4KA 3E9AA 2VELA 3GE7A 7ENLA 3CEUA 5SWUA 3PPCA 5BW6A 1TCMA 1XFCA 3DBNA 2E68A 1BYBA 5LA0A 2IQDA 1VYRA 3CK5A 3TN5A 4HPXA 3MUZ1 4DN1A 4RZBA 3VKDA 5J5RA 1Q6RA 3ITVA 2D3NA 3U2ZA 4OBSA 3VIHA 4EAMA 3OLIA 4Q22A 4FNSA 3IVUA 1IIHA 1GQLA 4UIOA 4KETA 1TZ7A 4Z17A 3PUOA 4NJJA 2WXDM 4I8YA 3SCVA 2XIJA 4Q6XA 4AZ6A 4F8XA 4WKHA 1TV3A 1S1RA 1VCVA 4KGLA 1DTUA 2WZIA 2WO5A 4WZHA 3II1A 4X22A 3HPAA 3W28A 4FPSA 3NL5A 3TWAA 5AKQA 5H2ZA 4QCFA 1QPKA 1XLGA 5D38A 2GK1B 1QT1A 3WD0A 3A47A 3NG3A 3CQIA 2VP8A 5BROA 1JZ7A 3WLKX 1UR3M 1B3ZA 2WPBA 3ITOA 4LW7A 3CV2A 3PZIA 3N13A 3BAXA 4JQ1A 1YNYA 2VKZG 1PHWA 1QW8A 1LLZA 3LSCA 1KTNA 7REQB 5F1UA 1V3KA 1WNOA 3A5FA 3NSXA 1XI3A 1I8JA 4NUWA 3USBA 1GYMA 3VOIA 1MRAA 3A4AA 1KW1A 1UCWA 1RPKA 2HEJA 2PRLA 3E38A 4ZTYA 3IJ7A 1K8YA 3GVQA 3FCPA 3KOFA 4NI3A 4HZMA 4JFUA 3TN4A 3VOFA 3SUSA 1TR1A 4NZ5A 3E2QA 1JL8A 4WVXA 3F5LA 1EO7A 5BNKA 1UUQA 3B05A 2O55A 4X3ZA 1S2UA 1OX4B 3ORWA 3TQPA 3UJ2A 2DT1A 1G67A 4OGZA 3UESA 1IXNA 2QCGA 5CC3A 5BWAA 3U48A 3ITLA 3LENA 2HXTA 1R9XA 1X7IA 2FZNA 5AC5A 4J28A 5LNSA 3GNPA 4INFA 4AIEA 1J0IA 2OX1A 3S5OA 1GGOA 4GGBA 4O1AA 4OTKA 3G2GA 3W7LA 1N55A 3HG2A 1QUMA 4DVOA 4QSHA 4Q8OA 4IL2A 3BC9A 3BANA 3O0FA 2JKAA 1OT1A 1CTNA 3ARXA 2PZ0A 2FZDA 3T4CA 2WVVB 3GWQA 3OG3A 1EDTA 3BLIA 2INZA 1WKFA 5FJPA 2DIEA 2XGBA 1GYLA 4I6VA 3RPTA 1MZRA 1I1XA 5IDZA 3WD4A 3IV8A 3W1PA 1J5TA 1QNRA 2J7CA 4IMGA 2GUYA 3O8AA 4W93A 3MYPA 1R3SA 3PHAA 4UFIA 5I03A 3BLPX 2E1DA 3AISA 2OEJA 3EWZA 1E0XA 3TWBA 4HYWA 3EXTA 2MUCA 4Q4RA 1JZ8A 1E51A 2OEKA 4OT7A 3NZGA 3K2GA 4WK9A 2FJUB 3OTRA 4G1KA 4LUYA 2J9ZA 1R3VA 3TP4A 3PF3A 4U4MA 3B0UX 1UR4A 1OGGA 2GGHA 3LCGA 4ORIA 2GGJA 2YA0A 3IV3A 1A4LA 2OVLA 1Q6DA 4PTNA 1KLYA 2OOFA 4IPNB 1MW3A 3IWPA 3BOLA 3F2DA 1PDYA 4UTTC 1VFOA 3P67A 4X61A 3KE0A 1ME7A 4AWEA 1WDSA 1EJVC 2J77A 3ENLA 1O5RA 4JD4A 5DO8A 1H4PA 5EFDA 3TA6A 4LAKA 4IFKB 4TTUA 1FWTA 2VDIA 4BQ4A 3FGCB 3SCSA 3H53A 2PWHA 4JICA 1R47A 3VDAA 2V5KA 1AODA 2BG5A 5I2UA 2LLEA 3P61A 4DRSA 4LFYA 4Y9NA 1WBHA 4DZ5A 1KRMA 4BWLA 5DXYA 3MSRA 2OR2A 3WMCA 1G69A 4AZHA 3MMUA 1TFVA 4IQDA 4F0HA 1H7RA 3SJNA 2ZX5A 3V36A 3GQYA 1TUXA 2NVCA 2VWSA 3ABSA 3DU0A 3MBFA 1W9BM 1JDEA 4ES4A 3ITGA 4E2VA 2C1HA 4RNJA 4C6LA 4YTTA 2QJNA 4WDTA 3LHTA 2VO5A 4YLWA 1UC5A 2Z6JA 4RZ4A 1R5YA 3KWSA 4M0XA 4QXIA 1YXYA 5CZTA 1H0GA 4I9MA 3FN9A 3QZ6A 3MHUA 4R5EA 5DFAA 4DHGA 4GJJA 1ME9A 5HJLA 1CI1A 3GB6A 3W75A 5GJPA 1EUAA 1BRLA 4RXGA 2BLEA 3M0MA 1AL8A 4MFEA 4AXNA 2VUNA 4LX4A 5FJOA 3MI6A 1AW1A 3KDOA 4GI6A 5EMUA 3N3TA 3RLGA 1S46A 4A2SA 4TR9A 1GJWA 3W71A 4FZIA 1BG4A 1E9ZB 5I09A 2ZUWA 2VEKA 4WY0A 1PWLA 4XG1A 4NVTA 2X16A 3AYVA 1VGAA 1TMQA 2HTMA 1FDZA 2AMXA 4QLJA 1BGAA 4FX6M 3W1TA 3QPYA 2XZ7A 3EWYA 3ATYA 1VJIA 4LY4A 4PMUA 1LYXA 4DJDC 4ATWA 4WR3A 3GW0A 1GOKA 1MXDA 1JXKA 4IMFA 4HT3A 3UPMA 5MHBA 1KBKA 4DUWA 2UWFA 2O92A 3CS2A 1MXGA 4IH3A 3R0KA 2IKGA 2PDFA 5EMYA 4JN6A 3ARWA 1E6SM 1P0KA 4WJ8A 3BPWA 4JZ5A 4LGXA 3HV9A 2Z1XA 2OSYA 1G7UA 1GOIA 1A0EA 4Z1CA 1EX5A 3PZ9A 4QG6A 3MB9A 4GRSA 2WKLA 3M9YA 4GK8A 2NZLA 2CBIA 3MUIA 2DY3A 2E6FA 4QISA 1M65A 5HNNA 1IT7A 3IIPA 1BLIA 3F7JA 3SRFA 5D2YA 1YEYA 3VMPA 1OZQA 4HPGA 4JTTA 1JCNA 1GQIA 2YL9A 4C1NB 4DJED 3W83A 1FVPA 4FMVA 1YE6A 4LU0A 1R3YA 4IPIA 3SM0A 1UYQA 4RV8A 1R85A 4EK7A 5AC8A 2VRQA 4JIPA 1H0IA 2DDXA 2WW5A 2HQAA 3WLIA 3TYDA 2XVNA 3W7GA 5HQEA 1W1IE 4P8XA 3WLPA 1RXOB 4Y8EA 4JQ4A 1VHCA 4LNCA 5CSRA 5HUPA 3L12A 5HUOA 4IIGA 3IK2A 2JKEA 3RDKA 3M5ZA 3HU7A 1MSSA 5U7SA 3PZTA 3QN3A 4PUNA 1EGMA 2BGSA 3N2OA 3L5MA 1JZ6A 5A8PA 3SJ3A 2R1PA 4ZA0A 2EXOA 4WCJA 2FHFA 5HJXA 3N17A 2CNCA 4XSLA 1EWEA 1GOOA 4IPPA 4E38A 3I7SA 3IACA 2YB1A 1YHTA 3MI3A 4LCRA 1HKKA 1WKDA 4DJFC 5JIWA 1HT6A 3M0HA 4EPKA 2D0HA 2OLHA 4GWEA 5EKYA 2DZWA 5JBEA 1RPXA 1B90A 4IGSA 3S5NA 2C15A 2OZTA 4EVZA 1C91A 3GVGA 1K9EA 3KX6A 5CC6A 4OFCA 2V5CA 1MI3A 3K1GA 1IEWA 4CU6A 4X2RA 1ELSA 2QJHA 3FY1A 3IIOA 3VUSA 3IVTA 4Q7NA 4UFKA 4W8LA 3LUTA 5TQLA 2IQTA 4QAWA 3RLUA 2NQHA 2X7WA 1FP9A 1UHVA 2YDAA 2HNEA 1LF1A 3CAVA 1P0DA 1PZ0A 4XBJA 5C6MA 3FSUA 5LGZA 1H49A 4IUGA 1OGSA 3W1MA 3GR7A 1BYAA 4KRTA 2DSWA 4D8LA 3KCJA 2D2GA 3O63A 3SR7A 2ACSA 4PSPA 4QLKA 5LNRA 1KCZA 2Z29A 4HOWA 1FWWA 3KCLA 2YL6A 2PDHA 4XVDA 5DT7A 3P3BA 3VAVA 5CC7A 1L9WA 5D2TA 3PUGA 3EA3A 4IICA 4WD0A 4KKXA 4E0CA 3WLMA 4MB1A 1LQAA 5D02A 4U31A 1MXSA 3VNKA 3WENA 1NAL1 4XV0A 1Q45A 1R86A 4HGXA 4LJ3A 2WHJA 4E8GA 1A5LC 4P7LA 1I4NA 5HATA 1F2JA 1GTHA 2D20A 2REQB 4DWSD 4AZIA 5F1VA 1VBGA 4B5SA 1B1YA 3WJSA 1XLEA 1HF6A 3DC8A 2E77A 3LHZA 3QRHA 1CIUA 5HWMA 4JS3A 1EXPA 3O7UA 5D05A 2YBVA 3QHMA 2ACQA 4GXMA 3IIVA 1HGYA 3LPOA 3SCNA 1TPB1 4GCAA 3UR8A 2GQ9A 2ZUNA 1TQXA 4M1BA 4EIVA 4TIMA 3TSMA 4A4AA 4CCCA 5E0KA 1VYPX 2NXIA 2WMKA 6CGTA 3MSGA 3E2VA 4W5ZA 2CW6A 1CXHA 3PAJA 1U5JA 2W5FA 3M0VA 2ZZ6A 4H8VA 5FJIA 1FXQA 3S1GA 3PWIA 4HTBA 4QP0A 5G2WA 1FUYA 1HG3A 1P6WA 2EAWA 1F4AA 2YCLB 3RM4A 3BL3A 1B54A 4J2PA 2A3CA 5M1TA 3MSYA 1MQQA 1TJ2A 5LXXA 1C8XA 2ZVIA 3W6YA 2FZBA 3CZEA 4G7EA 2QKFA 3IRSA 1G4SA 4MM1A 1SW0A 4KWOA 3UXAA 3WQPA 3NO3A 2QUTA 3OLGA 2VR5A 4GX8A 3A3XA 1YNPA 3UEQA 4R9XA 4DM1A 3S1UA 4HYRA 1LQ0A 5EMKA 3UXDA 1Q6LA 1FA2A 3UBPC 4YXGA 4DXXA 1XLMA 4MMWA 2QULA 2DJXA 1LROA 3EGJA 2ASHA 1EF3A 3UWUA 4F66A 2PEVA 3CO8A 5A8QA 4JTUA 1FWJC 3VI2A 3VILA 3ZVIA 4NAEB 1HO1A 1G6CA 1LLOA 3STCA 3E2SA 3WYZA 2YYTA 1IIGA 4RNFA 1JFXA 8XIMA 1U83A 3EWUA 4IPLA 3T0CA 3EKZA 2FTPA 5FEPA 1DWIM 1MUWA 4EANA 1ZFJA 1B4EA 4O28A 2CZ5A 1JEZA 1JF6A 3P7YA 1DQXA 4K3ZA 2DSZA 1JQXA 4YTQA 3H4WA 4PE8A 1W31A 3C0JA 4RW5A 3QY8A 2YZRA 1JPHA 1HL8A 2YSWA 3AHZA 3LYEA 2WB5A 1IE7C 3L7RA 4GYPA 1EOMA 1Y65A 1DWGM 4MOZA 4OKDA 2VEPA 4QJ5B 4ORMA 4X9YA 3BW2A 1E5NA 5CPQA 4UTUA 1CB7B 4PMRA 5C9XA 2OLSA 2G0WA 4GI8A 4KCTA 1I2PA 3SUUA 1GONA 2VQTA 2ZC8A 4UTTA 2BBFA 1X1OA 1RVGA 1QR7A 4PCNA 3W7MA 2XSXA 1A3XA 4IF2A 3GC4A 2Z28A 3T55A 2GSEA 3WD2A 4B92A 3OQEA 4P8WA 4O12A 1Q8JA 5JU6A 3NJ3A 4JHZA 2V5BA 1EPVA 2X2GA 3B9EA 1SVDA 1IR2A 3EMCA 1MDLA 5D32A 5I5RA 5A2CA 1N7KA 1JJKA 1AH4A 3QV7A 4ECLA 3LM7A 3W84A 4S3KA 2YBTA 2VGBA 2E40A 3ABRA 1OF6A 3GDKA 4JX5A 2DW6A 3TTEA 2Y7FA 3LERA 1KGXA 3NGFA 1EIBA 3IANA 5BOEA 4TV6A 3VU2A 4NX0A 4J3XA 1WA3A 4TUFA 3M43A 4HU3A 4ZCWA 5KTLA 1UR8A 3M7WA 3PTQA 4XUGA 2CIPA 3PZOA 2W62A 1L8PA 2FFCA 2YKKA 5DX7A 2Y89A 5GQBA 3CZ8A 1VBJA 1FOBA 4Q6JA 4XB3A 1IF2A 1XC4A 1DV7A 1KTCA 4TO8A 1BHGA 4ZL1A 3N18A 4UQAA 2YA1A 5FJJA 1MEWA 4H01A 2NW0A 2PTZA 1K03A 2OMAA 1E3XA 2GQ8A 4V2XA 2W91A 1WDQA 1K02A 3OJGA 2MANA 1S5NA 3DFHA 1NF7A 3DKJA 1KFBA 3ABZA 4XD3A 1V6YA 1QMLA 3DG6A 4MKVA 3GG0A 4FB7A 2ZZ3A 1AJ2A 1QNVA 1F05A 2Z4GA 4DYEA 1RP8A 4HOZA 4B5XA 1JGMA 5EMMA 3ABXA 2AKMA 2V8ZA 4MLRA 4YWSA 4QX4A 3U5YA 3TDFA 1NIUA 3IJDA 5EBAA 3S3GA 3VOGA 3I4KA 1TZZA 3W00A 1BG9A 1KB3A 3KRBA 3BMWA 2VC7A 4YVPA 1U5VA 3NDOA 3PUEA 1VKFA 3I10A 3UVAA 4BY3A 1FBAA 3BG3A 1VEOA 1H5YA 2QNEA 2CXGA 3RFAA 1EEXA 2QV5A 3DYPA 4GVGA 3REQB 4M7SA 1Y5WA 2CETA 5CLTA 3BQ6A 4ZB2A 3WLHA 3URQA 4AU0A 1YPXA 3E0VA 4U5IA 3G0SA 2JBMA 1VIZA 4UFLA 5D04C 3TC7A 4DJDA 3QSRA 3AS0A 4AVOA 1B57A 3TJIA 5G2IA 3NA8A 1W54A 4EPEC 1T5AA 4B9YA 4DIAA 3WQOA 3BAKA 1AQMA 4S3CA 3LHVA 3GO2A 5C7VA 1IWPA 1KC7A 2CLHA 4O0ZA 1SFJA 1JXJA 1QPNA 3MMTA 2D23A 3WBXA 3BQ5A 3T42A 3TN3A 3CIVA 3SCRA 1UKSA 3VCNA 2XIOA 3UA4A 4XZLX 4FXJA 1ALDA 1CXEA 1OGBA 5G4HC 1SJAA 3MA8A 4Y6GA 5HMEA 3WBAA 4GYKA 3VVGA 5TAOA 2A85A 4X63A 4GQBA 2ZKMX 3GFZA 1KFEA 3DGRA 4RDZA 2RDUA 1TRDA 4MHBA 1DWAM 4WUIA 5FF4A 4CD7A 4MADA 3VFLA 1EHAA 2VEMA 2XN2A 4D8AA 1IQ8A 3CV6A 3R4IA 3WJXA 3T6CA 4LQ1A 4HYVA 5D8ZA 4XAYA 5CEWA 3LI0A 2Z6IA 2WCSA 3TFXA 1BSLA 1G7VA 1XLAA 1RBOB 2BOEX 1IWAA 3PZQA 1XQLA 3UNDA 1BXCA 1A0CA 3FOKA 2YCJA 5DLCA 2DUAA 2GVYA 3L68A 3WQVA 4JIQA 5FF3A 3F4VA 3ONCA 3VYLA 2V3DA 1VBRA 2C19A 2V81A 3RUBL 2D2HA 1K4HA 3GR4A 4LUTA 1LRNA 4S3DA 4L61A 4PFMA 3VGBA 4HJWA 4U28A 2WSRA 4GUHA 5CZSA 3KHJA 3ID7A 2BSLA 2WVTA 3FJ4A 3GTHA 1VP5A 1LL7A 1ZCCA 2VT0A 2ZBTA 1JPMA 1H09A 1VF8A 2OODA 5AC7A 5D2VA 2ZZ2A 4AW7A 5H8UA 4UFHA 3S6OA 3UXLA 1LZOA 1ZJIA 2BGQA 3NPXA 1EL3A 4GYFA 4JN8A 1V7YA 1UPMB 2I56A 1RCXB 1KM6A 4NZFA 5E70A 4NXSA 3C0SA 2CZVA 4KFOA 1FCBA 3CH9A 3HN3A 1F7BA 3N4FA 4EX4A 3W38A 1UOZA 3XINA 5AHNA 3NM1A 4MB3A 2YL8A 3BH4A 5AB3A 4XISA 3SQSA 2J6XA 1TTIA 2WNNA 4WDWA 2XWDA 3GDLA 2ZWZA 4ASTA 4D8ZA 3N9SA 5HULA 2VC6A 3N19B 4IQLA 5LNWA 4YNGA 1K8ZA 3ZLFA 3I6TA 3UCCA 4OBRA 3RHGA 4MY8A 1XYMA 2FB3A 4DO5A 1NFPA 1H5VA 2J7EA 3M6YA 3TAKA 1TREA 3JR2A 1KR1A 2A3HA 3R8HA 4ZE4A 4I3GA 3K8MA 4GCXA 3NYZA 1XRVA 3RLHA 3VD3A 3LY0A 3AXHA 6XIMA 2WNQA 3BG9A 5F4SA 5M3WA 1RHCA 4P7QA 3NDYA 4N9DA 4Z1YA 4M81A 2NWRA 1FCVA 3FLUA 1XIMA 2HSAA 1W1PA 1I1WA 3DBPA 1W5PA 3QGAC 1K7EA 1X1NA 1TUFA 3WD3A 3L0NA 4Q8WA 1JCTA 3CQHA 3W0KA 4A8RA 3HQPA 1NELA 4WHBA 2FVMA 4H7VA 4AISA 4DY1A 5C2XA 1E43A 3EWWA 3TCEA 1VC4A 2DPEA 1SJDA 1PO9A 3USZA 4FO4A 4WSHA 4CVUA 2J47A 2ISDA 4HU8A 1FKXA 3OIHA 3WK1A 4R7JA 2GVJA 2C91A 3EWXA 5JXQA 1H7PA 1H62A 4G9PA 2Z1SA 1J2BA 4XZMX 2WMIA 3MZ2A 4B91A 1XYAA 1YLVA 2B31A 2RDWA 4UTWC 4C6PA 4WGXA 4JIRA 2Q71A 2EPKX 4LV9A 2P76A 3KRUA 2JGQA 2ALRA 4MAZA 2HK1A 3CL6A 4RNIA 2W0UA 4PGLA 3U5UA 2FFIA 2P8CA 2J24A 2Y61A 1Z44A 4MYAA 2BY1A 1OX5A 4Z0JA 5JMUA 2P53A 3ARSA 1H1YA 2WC3A 2UBPC 4DZIA 3VNDA 4ZO9A 3ARYA 5I0DA 2PDQA 3OHMB 1FFRA 1W8GA 2XYLA 1F5ZA 3B8WA 1F74A 3PBVA 1KM0A 1OY0A 1CDGA 3H4XA 4WDXA 1ONXA 3DHPA 1UWTA 4JYFA 4Q4PA 3WBWA 2YXOA 3S1XA 3VM5A 1PYMA 1XYBA 1HO4A 2ZRUA 4JY8A 4MWAE 4HK5A 4ICCX 5A6TC 2ZRWA 1DWHM 1LQ2A 4M5PA 4XZIA 1J79A 3JUGA 4NYUA 3TLQA 2EJAA 2NQLA 4XZWA 3W4RA 3BVJA 4NP7A 1FTXA 1RJQA 2D2JA 2QUNA 1K1DA 1BRLB 1RQEA 1ICPA 4K7VA 4LAMA 2W79A 1E70M 1E73M 1J0KA 1ODUA 1VFMA 2IW0A 1YDYA 3HF3A 3A13A 3MUXA 1EQCA 3NEHA 5AVHA 4ROPA 4H83A 4U5KA 5CJNA 3ARPA 1ZAJA 2X2YA 1TPC1 2MNRA 3QQ0A 5H8MA 4ZB5A 2NQ5A 3I7QA 1FP8A 4WY0B 1JI2A 4DUVA 3VCCA 3WFZA 3A5VA 3TSDA 4UOZA 1OFQA 3T05A 1OCJA 1XUZA 4HCHA 2Q01A 2VVSA 3I4EA 2CBVA 4FLRA 4LVDA 1X6NA 4LF2A 3TXZA 4JTEA 5A6SA 3LQGA 2KX9A 3QJAA 1A50A 2W63A 2C0HA 4C6DA 1K6AA 2HPMA 4N4PA 1DWFM 3K1DA 4QHRA 4F0LA 2A7PA 1TTQA 2PBGA 2Z7GA 4QS6A 4ZOEA 3W6LA 3CM4A 4GNKB 2E9BA 3SW6A 3W07A 1BQGA 4ILSA 4XAPA 4ZSUA 3V75A 4OU1A 3MDWA 2WWCA 5CSYA 4DF1A 2FIQA 3LZ3A 2NVDA 4Q8UA 2NX3A 3P60A 2J7DA 3RR4A 2EPLX 5AY7A 3WLQA 1GVYA 3W24A 3V0SA 1WKYA 2XVPA 4LUSB 2XINA 4JX4A 2H3BA 3EB4A 3MHGA 5AHMA 2CLMA 4J2MA 2NT0A 3V1HA 2Y7GA 1X97A 1KRCC 4NJKA 1EH9A 5G4EA 4Q7BA 5K7JA 3NUKA 3LCWA 3ABOA 4LEQA 1THFD 2GWGA 3AWNA 4H7CA 4JCMA 2OYMA 1GVIA 4PUEA 3LTSA 3N25A 4HNTA 3IJLA 5J5DA 2PLJA 4YU1A 5C0QA 2FKPA 4KMQA 2PWGA 1KGWA 4UC5A 1DVJA 4Q3MA 1OYBA 4QGCA 4M6UA 1VJSA 1C3FA 3VGEA 2VUYA 2QUUA 4J3TA 1HJSA 1UWSA 3U7BA 3TU9A 4H41A 1BTCA 1D8CA 1WV2A 2ZXDA 3B03A 3GIPA 1UG6A 2C79A 2GOKA 2V5JA 4B5TA 1J18A 4Q8NA 1S1PA 1CYGA 4DUOA 2F2HA 1MDRA 2B7PA 1E6XM 4D6FA 3KCOA 2HZGA 1BKHA 1QNOA 2GFTA 4DNMA 2E9MA 1QBAA 1F73A 1ZZMA 1AW5A 4Q8PA 1S3TC 2PTDA 1TQJA 2PDUA 4KPLA 2Y7DA 3R5EA 3QTGA 4FLSA 3F4CA 3WQFA 3WLOA 3EA2A 3I68A 1HP4A 4AF0A 1O60A 1UPPA 4GINA 4RUBA 3I6EA 1KFKA 4LANA 4L64A 2C14A 5FA5A 1TIWA 5JH1A 3WMSA 3G1HA 1O5QA 9RUBA 1VLWA 2YB4A 2YBUA 4A21A 3URNA 4CCZA 2VTFA 4HA0A 1UOKA 1DEDA 4E2DA 7REQA 2YJQA 3KL3A 1V7AA 2WBKA 3H70A 4ERIA 5CSSA 4Y9MA 3ZWTA 1HJUA 1XYZA 2ANUA 2XH2A 5C55A 3R0UA 4JOMA 5A2BA 2NXGA 1RBLA 1SFLA 1UWAA 2GWNA 3T78A 5FD0A 2CFFA 3M0KA 5DRIA 1EQPA 4LV4A 4D6CA 3RU8X 3H23A 3HURA 3NURA 4AZ7A 1FHLA 3WBYA 3G0XA 3MHFA 3HM7A 3WH9A 3SCWA 2JQXA 2OKOA 1CT5A 4CEXC 3LCHA 4FOUA 1AZ1A 4ZOCA 3I3BA 1TPVA 3VIJA 3SUVA 3UF9A 1ZUAX 4H6QA 3GNXA 3W7JA 3VMNA 4H9VA 1H11A 2ACUA 4IX0A 5DCBA 1GOWA 1VJZA 2NV9A 3RF9A 3PUDA 3QGVA 4QDWA 4IFRA 4F9JA 2FHCA 3NXLA 3PTMA 4AWUA 3IK4A 1ECQA 3RITA 4AY8A 5IHSA 3UY7A 2NT1A 4AQLA 1H61A 2BZNA 2PUZA 4YL2A 3S2MA 3R43A 3HFYA 1VEMA 5ABGA 4ZQPA 3NQDA 3CQKA 3M41A 1QATA 1KXVA 4FS9A 5B7YA 1PX4A 2OO0A 3FX4A 5CZKA 3VTRA 4MJ4A 4AFYA 3S5SA 1CLXA 3WD1A 1PTGA 1SZEA 5FI8A 3H2EA 5HMSA 2PWEA 1GJPA 3DESA 5FAJA 4C7DA 4KIEA 4M6VA 2VXNA 5M2FX 1TPDA 1V02A 3LLXA 5LIWX 1H1ZA 4BI6A 3NQFA 1FWDC 2DSVA 4ERAA 2ZZ7A 1RALA 4QROA 3V7PA 3QOMA 3VX0A 4NZ3A 3SSZA 3PZNA 3PVFA 1JPIA 2WV8A 3KOYA 3L4XA 4WY0F 2DVTA 2ZUSA 3WUBA 1JAKA 4Q4QA 3F2CA 2IKIA 1JYNA 3AXXA 3N9KA 2A7NA 2CHOA 5K9XA 5GJNA 2JALA 3SUWA 3MJMA 1H7WA 1E9LA 1VBHA 3W1UA 2ZUTA 1ZY9A 1NOFA 1UZDA 3SCUA 3P14A 3M64A 3GM8A 4K36A 1SPQA 3CV1A 1GPWA 1E4NA 3TYUA 3OU8A 1HXJA 2G41A 4LBSA 3R13A 3PG9A 4U3AA 1P48A 1EBGA 1QRQA 4XK2A 3E5PA 1GEQA 3GY1A 1M7XA 4NG3A 4G7EB 3CBWA 5D2WA 1O68A 4PCFA 2E09A 4YMZA 4XIMA 1XWYA 2CCRA 5ABEA 3OB8A 5D9NA 3GUWA 1SGJA 1W17A 3L2MA 3CZLA 3GYCA 4FXSA 5C2GA 3R12A 1MYRA 2ZXQA 2G8ZA 1XIJA 4FNPA 4QSFA 4ZQRA 1BYDA 3LXBA 4O0KA 3ES8A 5A5WA 3WLRA 4CU7A 2V0TA 1M01A 2P88A 1UD5A 3FHQA 2A79A 4UR7A 2VEGA 3P80A 5FF2A 1RY0A 3EOUA 1U33A 1YDOA 1SFSA 3VE7A 3S9IA 1E71M 3GC5A 2G5WA 3P6LA 1R46A 1TJPA 4CEUC 3L9CA 2WVSA 3SIZA 2OG9A 1KQZA 3NZPA 2WSKA 1P1MA 4XAFA 3UWZA 5CGMA 3UG5A 4M19A 3S6TA 1V6WA 3Q2DA 5XIAA 4XO7A 1FWGC 2E28A 1VQTA 3BCJA 4HCLA 4MUPA 1S5MA 3G18A 2P3ZA 4MUZA 1ODZA 1Q13A 3HQ1A 2CLKA 5HINA 1UR2A 4IIFA 1H7XA 1B30A 1I2QA 1OHLA 1O7AA 4ZEPA 1H51A 3BZJA 3C2OA 3OBAA 3T40A 4UNLA 4HNLA 1FY6A 3KOWA 1T40A 3FJ6A 5D9OA 3LEPA 3QHNA 4HHLA 3M07A 3R0DA 4AHQA 2B7NA 1BXNA 1OT2A 1ZS2A 5CJMA 3FYOA 4UTWA 1ITUA 4IPJA 2E6YA 4S3FA 1W5QA 1AK5A 3LM3A 4HHHA 4PMNA 4AD3A 3M0JA 3P5ZA 3XIMA 1OCQA 2QJGA 2CLLA 3GXMA 3RX2A 5AYYA 2E5DA 2CLEA 4A6GA 3KUMA 1Q2RA 3WSUA 3ITYA 3TX9A 1A5CA 2V63A 1J96A 2XIMA 1E6RA 4RL3A 2CHRA 1PSCA 4BI5A 5IOBA 2ACRA 3W29A 4DYJA 3LOTA 3CIXA 4IJRA 5A8MA 3E0IA 3GVRA 2QDEA 5EFFA 1A5SA 3MKVA 2HBXA 1VFFA 4L6OA 1RVKA 1BAGA 3H2OA 3VINA 5LA1A 1B3XA 3LMYA 3RN6A 3GS6A 5KITA 4UR9A 4DBUA 4A3YA 5C9WA 3ELFA 3PZVA 3FW6A 4F3HA 2YLLA 3EKLA 4OWGA 5K4ZA 3C8FA 1A47A 1G0CA 3OHIA 2F38A 3LRKA 4QCEA 3ZS4A 4L6DA 4UNIA 5XIMA 3NWRA 3B0XA 1K9DA 3FXYA 4H9XA 2EJ1A 4K1WA 4AY1A 4P61A 1SUXA 1XSKA 4IUOA 3DG3A 4A3RA 4JTDA 6PTDA 3VIOA 2FH8A 5A8GA 1W3LA 1YKWA 1QI3A 5FF0A 3RG6A 4L9XA 3EX6A 2ZFAA 3BE7A 1CLKA 4RDYA 3ZZ1A 4QR6A 1BEUA 3S42A 3VIGA 2EHHA 3S46A 3I3EA 4AWSA 2WJZA 1ICQA 1UD2A 3RAOA 2E9LA 2ZUUA 1KXQA 1P1XA 3B8UA 3G8EA 3UZYA 5HWNA 2BVTA 1IXQA 3MMWA 1TV5A 1FH7A 2VZSA 5AZ0A 1KD0A 3Q45A 5CBBA 4K37A 4Y9OA 3CNYA 4D1JA 3TQVA 3ZIZA 1S3HA 3LS9A 1TRIA 4JL1A 2PC4A 3AHTA 3AJXA 3WNLA 2VZTA 3T0BA 4AYSA 2HVNA 3BXWA 1ISXA 2O0TA 3O6DA 3TTSA 1RR2A 3HPFA 3P5YA 1WQ5A 1PZ3A 4QE4A 3LCLA 2OGJA 4K6AA 4R9OA 4ZFMA 4CQAA 1QTWA 1OFAA 2VMFA 3EB3A 3LA4A 4AD2A 1XH0A 2C13A 3L23A 4DO7A 1DJIA 1NF0A 1XIHA 3DFTA 4OUIA 2OQHA 2ICSA 4JL2A 4W7UA 3LBMA 2I57A 5D8WA 3EPNA 4W5UA 5IXEA 1ECEA 3V5FA 1AFSA 4NHVA 3AZRA 4E3VA 1C90A 3IRDA 5IBXC 5FKYA 1FHDA 1PVNA 1FWHC 5E6ZA 4A3UA 4EE9A 4MWAD 2Y24A 1ZQ5A 1KLZA 2TMDA 2QDDA 3SY5A 2F7FA 1IZKA 2A21A 4CD5A 1Y8BA 1GZ1A 4PN2A 4ML9A 4PYSA 4JN7A 4IT1A 4HN8A 3T09A 4JAWA 1XGEA 3N04A 3BV7A 2J6VA 3K4WA 4B2DA 3EMZA 2RAGA 3A9IA 1RA5A 2ZX8A 3SGGA 1TJ0A 4NZCA 1J11A 3RXZA 3B97A 1V8EA 3HOJA 4Q7IA 4J5NA 4C7GA 2H9AA 5C71A 3EXSA 4DYKA 1TJ1A 3AYTA 8TIMA 2BX7A 4M3PA 1XICA 3WLLA 2GZXA 2QHAA 2VJXA 4AHPA 1W3NA 3W2JA 3RCMA 4ZBCA 3CL8A 2V3EA 1JCMP 4TXEA 1Q4WA 4AZCA 2VQUA 3H2NA 4JIEA 2VC5A 3N12A 4LYQA 2R1MA 3PB2A 3TYEA 1E9IA 1NWUA 1ISYA 1UWRA 5I24A 3S5YA 4RCXA 4ERGA 1IZCA 1J0ZA 4S3BA 4LUTB 3WUGA 4CN6A 4LC6A 1Z48A 4PEKA 1FWCC 1N8FA 4A29A 2WMJA 1OFBA 3R25A 4MNMA 3VIFA 3UZJA 3WCZA 1Q66A 1TO3A 1B4KA 5CBJA 1YDNA 5EBUA 3MZNA 3ITTA 1YW1A 2X40A 1E4IA 2O7QA 3RM9A 1MW1A 1TJRA 4ZZ9A 3BAYA 2CZFA 3OVGA 4C1KA 4HIBA 1ITXA 1VFHA 2QPUA 1RJPA 2J4GA 3MUAA 1T96A 3KWXA 3SZ8A 1Y5VA 2YOCA 2PD5A 5BXSA 4ZO7A 3U2OA 1F6PA 4NQ1A 2H3DA 4ZO6A 1P43A 5DMNA 1TMHA 1V4YA 2AL2B 1EC7A 3F4DA 3W1XA 2OGYA 3BDKA 1SMDA 1P0EA 1HFBA 2PA6A 2ISSA 5AZ1A 1W3IA 4LY8A 1B9ZA 1J9YA 2GQAA 1DPMA 3MMDA 3G0UA 2OO6A 2GVEA 2CBJA 5I6SA 4PUDA 3OODA 1UD4A 4HCDA 1FQ0A 3C2RA 4UMCA 4D6HA 1NP2A 1S2WA 4JIIX 2J75A 4HTYA 1J2WA 1R30A 1XIEA 4XX6A 3WFAA 4FNRA 4FX8A 1RD5A 1IGSA 2A3BA 3QV6A 1V3MA 1AMYA 4GXPA 5MF5A 3R7MA 4O16A 1PBGA 4MZYA 2D3LA 3WDQA 3R11A 1B3YA 1LOSA 2QAPA 5DBTA 1E6QM 3LN3A 4FLOA 4GZEA 4UMBA 2Z1VA 4JPGA 1TE1A 1FKWA 1W8SA 3E0WA 1N8WA 1U1HA 2C16A 4GPNA 2PRHA 3SUTA 1CWYA 2FGZA 2WANA 4P7NA 1UW9A 5GPRA 2CWNA 2DVUA 4F4RA 1M03A 4JTCA 2PWDA 4BK9A 1IT0A 2R1NA 5I3HA 4JKMA 3T9PA 2QUMA 3SGUA 3UWWA 1NDVA 4L1GA 5KSWA 2FGLA 2E0PA 4PBEA 1QW7A 4S3EA 2Y62A 3LNPA 4O1FA 3WH6A 3B9AA 3ZO9A 1VFTA 1XGZA 4C90A 3EDFA 4CLMA 2WMFA 4XBKA 1T99A 2WNWA 3L4ZA 1K4GA 1R9ZA 1V6UA 4Z0SA 2Q8XA 1P0NA 5AVNA 4I8DA 4CQCA 1C8QA 4C6BA 2WMIB 2ZX7A 4RE0A 3B8DA 3WL0A 1FHVA 1VENA 3B9DA 5HWJA 3E0FA 5AYZA 1G4EA 4PB4A 3W2UA 3MP5A 2AL1A 2C1IA 5CQ1A 2DSUA 1J6PA 2EQDA 2PPGA 3AMCA 4Q8VA 5ABFB 3GDBA 5A6JA 1SFTA 3NQAA 3MT1A 1TE6A 4EXBA 3MCNA 2ZX6A 3T7VA 4PCTA 1MO0A 4EPBC 4E4FA 3FK4A 1FRBA 3KTSA 2OEMA 5D37A 1RCQA 2CLFA 2WQDA 4Q8TA 3TYZA 2C18A 2ONEA 4GISA 5I78A 3THQA 3HJZA 1N8IA 5A8OA 4GQRA 3M44A 1JD7A 3CV7A 3PFRA 2X41A 2ZRYA 1O94A 3M7SA 3VNMA 3W1NA 3KW3A 1EWDA 1UQZA 4N9BA 1SSDA 1PX3A 3RMJA 4ML4A 1KTBA 3PPFA 4NY2A 2YLAA 2QLYA 2J7GA 3KZSA 2RDXA 2HISA 3P84A 3F5KA 4DZAA 1O5XA 5HPCA 1S39A 4JTRA 1IR1A 2AAAA 1SR9A 2SFPA 2GL5A 2VGGA 5A2AA 1NTHA 1UIOA 1RY8A 4QIUA 3LQLA 3GYEA 1KR0A 3VUPA 1JCXA 1LG1A 4JQ2A 4Q4SA 2VFFA 3XISA 5D2XA 2GGEA 4LAOA 6REQA 2QT3A 3M16A 4JTHA 4G7FA 4R85A 3AJ7A 2Y0FA 3WNNA 3AC0A 3NGJA 2VM8A 1SW3A 2HS6A 3GTXA 1EGZA 1J0YA 3DFNA 4KEZA 4UQCA 3GTNA 1KM2A 4MJ2A 3VMOA 1GCYA 1H7OA 2EEXA 1O4UA 2ESCA 1NU5A 4KS0A 4S2CA 1V0LA 1B5TA 2GGIA 1OIFA 4J35A 3CAQA 4S23A 1JYXA 3QLDA 4AXKA 3EDEA 2BP1A 2CKSA 1LJYA 1TWWA 1XG3A 4ZB0A 5A6MA 4FXRA 4MPKA 1XIGA 3E3HA 3IJ6A 1UD6A 4BQ3A 3GIQA 3B9NA 1HKVA 4JCLA 1QNQA 4UUIA 5A6KA 1L6GA 1E4LA 3RIKA 4O53A 2HK0A 5HAOA 1RA0A 1TX0A 4DJEC 3WDRA 2WYSA 1M5WA 1TTJA 3NQBA 4B9ZA 5H8PA 1QPRA 4M51A 4IGMA 4WSKA 4YCOA 1OC6A 1OM0A 1A5MC 4JHMA 4ATLA 4O4WA 2NSXA 2E8YA 1P0BA 2TYSA 3E0LA 4MDPA 3AAMA 3LPGA 2D24A 3NZ1A 2E6DA 3QKEA 3BTNA 4IMCA 2W27A 3NQ7A 3WY1A 5EB8A 3JZUA 4GO8A 2YA2A 4G5DA 4K2SA 1O12A 3VABA 4KCWA 3DYMA 1I2NA 3EX1A 3N4EA 3LGGA 1A0DA 1M3UA 4H8UA 2DIJA 5L6UA 4JDYA 3VDBA 4N6FA 3GXIA 3UZWA 1XSJA 1S5TA 1KCKA 2I17A 4GZJA 1SW7A 3VOCA 5DCEA 5LSMA 3AU6A 3HMCA 5LIXX 4TX6A 4FOJA 1GVOA 4DELA 3C5QA 1W5OA 5EY5A 1NY1A 4CNPA 1QVBA 5C7HA 3TW6A 2WQPA 4YN5A 3VPLA 3QC0A 3O15A 3WFLA 1KBLA 1HL2A 3PBGA 2PGWA 3ZWSA 6TIMA 2VENA 4BHYA 3IPWA 1CW2A 3CTTA 4IOTA 1XM3A 4AF0B 2JGYA 3WKZA 2E1WA 2BY2A 4CQ8A 1T7LA 1K70A 4EWND 4UXDA 5F2IA 1FH9A 4M56A 2G97A 1EXBA 2NUYA 2E5BA 1Z69A 1AL7A 3WK3A 3WNPA 1UBPC 2CWXA 2FJKA 3KOXA 1WUFA 4MPQA 4C6EA 2XH0A 1WB0A 1I0DA 1E5JA 2WWDA 3KHDA 5G2HA 2F2KA 3W76A 4JBRA 1UB3A 5DQPA 5DANA 1XG4A 1HKIA 3GKFA 3H55A 2VR2A 1JPKA 1NOUA 3A9BA 1LORA 4GI9A 1W1B1 4ZQOA 4WXZA 1W5NA 4W84A 1WAUA 4F79A 3BSGA 2YR1A 3IS4A 3WEMA 3L4YA 3T0DA 5AN7A 4OHQA 2TPSA 3QTPA 4DI8A 5AHFA 1L2UA 4XSMA 2CITA 1PCWA 3DERA 1L0PA 4DNHA 1AJ0A 2NQ9A 3EYPA 2YW3A 3GXNA 1RUSA 1CXIA 2PC8A 3MBDA 2NQZA 1XLJA 5DXXA 3TTYA 3UZZA 5CPMA 2RH9A 3S5ZA 1OZMA 4ACYA 1X39A 4XD4A 4IIDA 2GGGA 4L65A 3P81A 5IBXA 4J3SA 1HJXA 2VZUA 2VL4A 3V18A 2DEPA 4DWSC 4HNCA 4HK7A 1JF5A 2EKCA 1XBXA 2AQOA 3CUJA 4S39A 3GNOA 3VZZA 2Z2UA 3C3NA 4UB9A 4ICMA 2HJPA 5A95A 2ZZ4A 4KESA 5FEWA 4RE3A 1OIMA 7ODCA 4RE2A 3TJ4A 1DL3A 2PDKA 4H6RA 3VOJA 4GGHA 4OZOA 3M5VA 2ZWYA 3NQ6A 4QEEA 4GKTA 1MNSA 3JVAA 4A35A 3BCFA 1GZGA 5HOSA 2P10A 2V9DA 2HV5A 2P50A 3RM8A 2DZTA 3EB2A 4KEMA