3W2MA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-183
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-183.
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2mA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2mA01
3HG2A 3C2EA 4JX6A 2C0AA 4BWLC 3E49A 1KM6A 4JDYA 4WZHA 3KVMA 4O1AA 1OF6A 4NJIA 2FPTA 1JRBA 3NO5A 4MYXA 3NQDA 1IXOA 2FPVA 2H3DA 4JTUA 2CLHA 3B0PA 4ALDA 4LV9A 4EF9A 1A5AA 1D3HA 4FO4A 1EUAA 1E51A 2JKEA 3DFSA 3USBA 3L0KA 3NR0A 4DXVA 4IMFA 3NL5A 3QMTA 4ZVJA 1FXPA 1TQJA 1G67A 2OT0A 4OT7A 1I45A 3BGGA 4JXCA 1WX0A 3MP4A 1VYRA 2BTMA 5HJLA 2HSAA 2R8WA 4MZYA 4Z1AA 3W2UA 3MI2A 1UB3A 2DZXA 3NQCA 4K38A 4BR1A 1TYGA 2QDGA 1RVGA 1YDVA 5KZDA 3W1XA 2WO5A 4DBDA 3NZRA 5FEWA 3S1VA 4UMCA 3KRSA 4GE8A 1HUVA 1LOLA 3UWUA 5AC6A 1MEIA 3LTYA 4GXMA 4JN6A 5D2XA 4BFAA 4PC8A 1TV7A 5D32A 3G1YA 3G3MA 5D33A 1M6JA 2YPIA 3DFTA 3C61A 3E02A 3NQ2A 4ML9A 2EHHA 4M19A 1IIGA 2E77A 2G96A 2CLIA 2XN1A 1LRNA 1TPDA 1LLZA 2EGZA 1AK5A 1YLVA 3LI1A 3R12A 1Z42A 3WJYA 1U83A 1VCVA 3GDTA 2QCEA 5HWMA 4TIMA 4MJMA 1R2RA 2DZUA 3TMLA 3GXNA 1SQ7A 3BGJA 2I14A 1CW2A 2ZCGA 3P80A 4RKAA 4XKYA 1IXQA 1TPVA 4FNQA 3Q37A 3W2JA 3C8FA 1EWDA 1YXYA 4AH7A 4GUIA 2CU0A 2R94A 2ZZ4A 4A2RA 4YL2A 4ORIA 4X3ZA 2YR1A 3LHYA 3HPSA 1S3HA 1TCDA 3OVRA 2QF7A 4RLIA 5BNKA 4FF7A 1K8ZA 3KFTA 3SJ3A 2V2DA 2E68A 4O54A 4DPPA 4IX0A 4JR5A 1ADOA 2ZFAA 4RK8A 1PCKA 3WJXA 1SSDA 3W7IA 2EF9A 2XN2A 4DQWA 3EWXA 4OBTA 1MO0A 2GVLA 5IBXA 2BZNA 4O12A 1NVMA 1TJRA 4A22A 3M1ZA 3N9RA 4O1CA 4ONVA 4UIOA 2XN0A 4GRSA 3P61A 1VCFA 3GZ3A 4WY0F 2TPSA 3RMJA 4PCFA 3ZFHA 3ZS4A 4PODA 4PL1A 4AB4A 2ZA3A 5LNUA 1ZAIA 3FKKA 1SSGA 3MWAA 2YX0A 4ICNA 2VEIA 3WK3A 3SW6A 1TO3A 4GC4A 4UFIA 4YCOA 3QF0A 3PB0A 4MJZA 3MYPA 3PG9A 1L2UA 4OV9A 2NX1A 3HF3A 1FWWA 5CPOA 3W88A 1NEYA 4L4MA 4WXZA 3DFPA 2ALDA 3W1RA 3I68A 4HNVA 4GFSA 3NDOA 4CCEA 1MXSA 4FB7A 5D2WA 1LTDA 1FWTA 4Y8FA 5G1TA 3PUEA 3R5EA 3CIWA 4LNYA 3G22A 3W85A 1DBTA 2BLEA 5AYYA 2WSRA 2AAMA 1ONRA 2ZRZA 4UMAA 3S5NA 1B4KA 1U5JA 3EX2A 4X22A 3BW3A 5HUOA 1M7PA 5LSMA 5FEXA 2RH9A 2BX7A 1X8FA 5HR7A 3UNDA 1WQ5A 4N9BA 1RPXA 2ZRVA 2NXGA 3SY5A 4BI7A 1DL3A 1I2NA 5E1QA 3MJYA 2C18A 4O11A 4O19A 4EF8A 4Y9AA 3I7RA 3AO0A 6TIMA 2NXIA 4O0KA 3ZWSA 3NQAA 4POCA 3R2GA 3CEPA 1N8FA 5CZTA 2YCEA 1VQTA 5K4ZA 3MO7A 1QWGA 1R2TA 3S9YA 2A5HA 1SZGA 3BLIA 3M41A 1R2SA 1L9WA 1A5CA 4NT0A 2E5DA 2GQAA 3TSDA 3LERA 3SR7A 3LHZA 5CZJA 1SO3A 1T99A 1ZAJA 1OX6A 4AXKA 5BMWA 2ABBA 3O05A 1FX6A 4LC8A 1HG3A 3S5ZA 1V5XA 3PBYA 4HIBA 4IMEA 3L9CA 1O5KA 4ZQMA 3HGSA 1JR1A 1NSJA 1VZWA 4FNRA 3GAKA 3M5VA 2A7PA 2ZQ0A 1VLWA 5C55A 4GUHA 3DENA 3L68A 5ABTA 4HNTA 3CIXA 3HPXA 5DY3A 3W76A 3TJXA 1VGAA 4FIRA 5AHMA 4A21A 1ZNNA 2A6LA 1F73A 1MSSA 2A1YA 1HL2A 3HB9A 4UC5A 2J88A 3O63A 2X30A 1WAUA 1LBMA 3EX1A 2V82A 3GDMA 1O95A 1FDJA 3QSRA 4OU1A 3RNDA 5IBXC 3C2VA 1RQHA 4LU0A 3W7JA 1WA3A 2NWSA 2LLEA 3PS7A 4KFOA 5D2VA 1QPOA 1K7EA 3NXFA 4HSOA 3ABSA 3G24A 3A5FA 4WQ6A 2HMCA 3IVSA 4QIUA 4JTKA 3PC0A 2NUYA 2P10A 5D37A 1W5OA 4MVAA 4AMAA 4JX5A 3GDRA 4ZL1A 1K02A 3A5VA 3DGRA 4QQ3A 3O6CA 3MYOA 3KAOA 2TMDA 3N2XA 3GIYA 3W6YA 1GTEA 1I2OA 4MFDA 2QR6A 1NF0A 4PEKA 1JUEA 2B4GA 3G0UA 2WKJA 4PH6A 4XQ6A 3THQA 3JR2A 3AJXA 3O1NA 4YLWA 4N6FA 3W22A 2YYTA 4U4MA 5AN7A 1ME7A 1RQEA 3QW4B 4AEOA 1ICQA 1YDNA 1YTKA 2JBMA 1H50A 3NOEA 4RV8A 2EAWA 1W54A 2VENA 1FCUA 5EL1A 1DKWA 3QQ0A 3A9IA 4UCGA 3FS2A 4PA8A 1P0KA 2H8XA 5F4SA 2A0NA 3EB2A 1RZMA 1F74A 4WUIA 3NVTA 3Q94A 4ZQNA 4FNUA 3CLMA 1QPNA 1Y0EA 2QUVA 4BF9A 5LZLA 3NYZA 4YXGA 3S1UA 3W7RA 2V81A 1TRIA 4R34A 5K4XA 2BSLA 5F2LA 1B57A 3HOJA 3M6YA 3IRDA 1ALDA 3P8IA 4YMZA 2Y7DA 3NM3A 5D09A 2NLIA 3UZJA 1QR7A 4CCCA 4ZQPA 3IVTA 2WSYA 2HS8A 4NQ1A 3LV5A 1EEPA 1KBIA 3W7DA 3LBMA 4CQ8A 3QEZA 3W7PA 3DXIA 2GJNA 2JKPA 3ZWTA 3W83A 1HO1A 3RLVA 4R53A 4UTWA 5BW6A 1GVSA 2VOMA 2QJGA 3SZ8A 3UY7A 1KBJA 3FJ6A 4ZQOA 4CCDA 3EWZA 5G2WA 3LHVA 1O60A 2Z1BA 2B7QA 2ZA2A 3L2IA 4AWTA 2JKAA 5HULA 3PM6A 3ATZA 4K39A 5FEPA 1XL9A 3UZ5A 1DQXA 4CNOA 1X1ZA 1UUOA 1KFEA 4LUIA 3LXCA 3G1HA 1TQXA 3CWOX 1GG1A 1OFEA 4JY8A 3QH2A 1KM0A 2VEMA 1EPXA 1LOSA 1PS9A 1VPXA 4JIQA 4OHQA 5F2MA 3HG3A 1NFBA 1RV8A 3G0SA 5FF7A 3EX4A 3HO8A 4O28A 4OWGA 3W1PA 4Z1CA 2E6FA 3EX3A 3G0XA 2A85A 4MZ8A 1AG1O 2YGYA 3GXPA 4MZ1A 2E5BA 2J9XA 4NNCA 2V2HA 3OBKA 3UWVA 2BXVA 3DAQA 5LNRA 3CWNA 3C4UA 3ABOA 1SZNA 4HNNA 5FF2A 1SZFA 2CLOA 1KTBA 1LDCA 1WBHA 3LLDA 1OFAA 1JCXA 3EWUA 1OX4A 4N9CA 4AHQA 2H8ZA 3IIVA 4JGDA 1VHNA 3MBDA 3NEVA 1F7BA 3W7GA 1ZENA 1OYCA 1HO4A 3I7QA 3KVJA 4NZFA 2QUTA 1KM3A 3KOFA 1VH7A 1EIXA 2Y7EA 8TIMA 2VEPA 2P0OA 3HG5A 3VE7A 1V7YA 3HMJG 2QCNA 2QCDB 3PULA 3WJZA 1F6KA 5FF3A 4DF0A 2A4AA 5I3GA 3TSBA 5D30A 4JD4A 3P84A 4RZ4A 3L5AA 4NUWA 1UCWA 4QAIA 3JS3A 3O8AA 2EPHA 3SFKA 3TROA 1Q6LA 3NPWA 3QM3A 1DHPA 1H7PA 1TIMA 1W31A 1WXJA 1H7WA 4JICA 3W75A 2CW6A 3GVGA 1G4TA 1KM1A 4LVAA 3B04A 3RF9A 1VHCA 2QEZA 4E0CA 3MMTA 5I3KA 2WNZA 1H60A 1K8YA 2Y7FA 1TPEA 3W2KA 2GUUA 2HTMA 3V75A 3LRMA 1UBSA 3F4NA 1LCOA 1QNVA 1JCMP 3QQ1A 3G8RA 2C6QA 3IIXA 2Q3RA 2C14A 4I7WA 3U8GA 1NF7A 3DI1A 5I3JA 3S5OA 3PY2A 4LRTA 5LKYA 1QFEA 2VEKA 3OG3A 3TSMA 1LM1A 4LUJA 4K7YA 3TKFA 3N2MA 1X7FA 3ELFA 5H2ZA 3TC6A 2NV2A 3LGEA 4B5NA 3T4CA 2DU2A 5HUPA 4CQAA 3F03K 2O7SA 4OGZA 1D9EA 3W3OA 1KM2A 3EKZA 3GDLA 4O4WA 3JRKA 2V2CA 4GUFA 4QITA 4UTWC 2WNQA 2UV8G 4LVGA 5HR6A 4Q4KA 3TA6A 3TW7A 3OEXA 2OMAA 4AAJA 4RJEA 2YXGA 4ADTA 4Z0JA 3HJZA 3YPIA 3N14A 3S5YA 1KFKA 4LVDA 1TV8A 4WJEA 3TIMA 3I65A 4O52A 3QMRA 1KTCA 3W1MA 4UTTA 4IX2A 1W8SA 1TPH1 3DHFA 3CT7A 1GZGA 1OABA 1PV8A 3E12A 4NJKA 3HPZA 4KKXA 3TX9A 1I2QA 3CQ0A 4CNPA 4QM1A 1EB3A 2A7RA 1GVFA 3N73A 2Y88A 4MUZA 3THAA 3R8RA 1RQBA 3NQEA 3IIZA 3L5MA 4UUIA 4UTUA 3LRKA 5C6MA 4DO4A 3W7QA 1ZFJA 1I2RA 2A6NA 1SFJA 1EP2A 3TNOA 2CLEA 2ZYFA 1KFBA 4TMCA 3BLFA 5IM51 3GXTA 4JTGA 3KVLA 3HG4A 4DO5A 4R7JA 2C13A 1XUUA 3LCIA 3EWWA 4PTNA 4JY9A 3PUOA 4LVBA 5HMSA 2DJLA 2YYUA 1L6SA 3S0CA 4K6AA 1W5PA 1W3TA 2VELA 3P82A 4HHPA 3MHFA 5FF4A 3QJAA 4IPIA 3FKRA 4FNPA 1HTIA 4WY0A 1A5SA 3LX9A 2P1FA 3G18A 1G4PA 2Y62A 3S1XA 2YDAA 3W87A 5AHFA 5DELA 1B4EA 4EVZA 1OFDA 2GQ9A 1IXNA 2WPBA 1PL9A 1Z44A 1IGSA 2VFHA 3W7EA 3LCFA 3DI0A 5L9FA 1OK4A 3DU0A 1VC4A 5BMXA 5AYXA 1OFQA 4O15A 1A50A 1H1YA 4UTJA 1GWJA 4OV4A 1BKSA 1H7NA 5EMUA 3MI3A 3UYCA 1KW1A 1Q6RA 1WDWA 5LNSA 2RDTA 3RK8A 2RDUA 2H3BA 3R89A 4FEZA 4K36A 1FY6A 5F4XA 1W5QA 2RKXA 4PL2A 3UY8A 1OHLA 3EEGA 3W1NA 1GVOA 3W1AA 1KLYA 3C0JA 5D02A 2E6DA 1K8XA 3W1LA 4NXKA 3NL2A 1XKYA 3HIJA 2GVJA 4JEQA 1JCJA 1F76A 1PHWA 3OVPA 3PWAA 4Y96A 3G1AA 1D3GA 1Z48A 3NQFA 1QMLA 2V5BA 4NVTA 4FXSA 4O10A 3I7SA 3GX9A 3G1VA 3LRLA 4ZMGA 5KMYA 1VYSX 5TIMA 3LHWA 1K7XA 1AW5A 3CM4A 4HN4A 4O1DA 1KM4A 2ATSA 2DJXA 1KTNA 1FCBA 5HNRA 1YXCA 4UTTC 3TU9A 3WK0A 3N34A 3TE9A 4I7UA 1FCVA 3B4UA 3P67A 3CTLA 2GQ8A 2ABAA 1YYAA 2W79A 4N6EA 5KTLA 3BPWA 1BTMA 2Y7GA 2YSWA 1XC4A 3O15A 4IXXA 3M16A 2PRLA 3SI9A 4LY8A 2W0UA 5T26A 1TTPA 3Q58A 3LBCA 4A29A 3W7HA 3Q2DA 3QC3A 3K30A 2V0TA 1IIHA 3E96A 2QJHA 4EOUA 1JVNA 2PRMA 3NNTA 4NXSA 4IMDA 3CU2A 3INPA 3KHJA 3QFEA 1YPFA 5SWUA 2FPYA 4RR4A 1N7KA 5LGXA 5HWNA 4JTFA 2VFFA 4O8RA 5EYWA 1EUNA 3VE9A 2WOQA 1XBVA 1IXPA 2JK2A 5I3HA 4DEFA 3IIOA 4HSNA 5FEZA 2Q8LA 4NNAA 4UFKA 4Z1BA 5K3VA 4UNLA 5KZMA 1AW1A 5C54A 2XFWA 4XBKA 3NA8A 1GG0A 1G6CA 4XTDA 3DKLA 4G1KA 5F2GA 2NZLA 4XKYB 1SO6A 3LDVA 3QMSA 2Y70A 1ZAHA 4JTLA 1KM5A 4C1KA 3NL6A 1G7VA 1YADA 5F2IA 2J9ZA 1JQVA 4MFEA 3W70A 1OJXA 1R47A 3S6DA 2F84A 1T8XA 3LCWA 4XZ9A 4LS0A 2TYSA 3N9SA 4XWUA 2GOUA 4A2SA 3FOKA 1CI1A 3BARA 1ZHAA 1WBJA 2NUWA 3BW2A 3G1XA 4UTMA 3M9YA 2ZA1A 1DORA 4FX7A 4EWND 2ZRUA 5CG7A 3W2MA 3B0VC 1F5ZA 4IPJA 4AF0B 1H63A 5G1YA 1VRDA 4YWIA 3FIGA 4E2DA 3NQMA 5FI8A 1GJPA 2V8ZA 3DHDA 4O0ZA 1TTIA 1G4EA 4LV4A 5AFDA 1LYXA 3P8JA 1OVDA 3PB2A 3P60A 4UR7A 2DZWA 3MP5A 3LOTA 3B06A 2YW3A 2Z6IA 2QCCA 4NX5A 1H7XA 5AB3A 4M6QA 2QAPA 1N55A 4S2CA 1ZY9A 1W37A 5CPMA 3IIPA 5E93A 1VS1A 3FYOA 2RFGA 3PF3A 4P2VA 5LHEA 1XDLA 2QCLA 1BWLA 4IJBA 2WJZA 5HWJA 2FTPA 1I2PA 2QAFA 4GUGA 1SW7A 4C1LA 5U7SA 1MEWA 3C3NA 3TXZA 4JX4A 3MUXA 1F2JA 3FLUA 3QPYA 3O6YX 3W7OA 4DBEA 2AQWA 1KFCA 2C19A 4IGHA 4N4QA 3LHUA 3G1SA 2H90A 3IGUA 4DF2A 4JTHA 1XBYA 1VJIA 1LLWA 5DCEA 3R13A 4WD0A 1W3IA 4UNKA 1ICSA 3QYQA 3CB8A 1LZOA 1DQWA 4MOZA 3TR2A 2GPTA 2TSYA 1EP3A 5AYZA 4YCPA 4N2YA 2W6RA 3UWYA 1VYPX 2PE4A 1QDSA 4LWWA 1NAL1 2ZBTA 3NL3A 1P5BA 3C52A 1G7UA 4ZZ9A 3EWBX 1Q6OA 3N3MA 3SIZA 5C2XA 4JTEA 2O7QA 3STGA 3LB0A 1TRDA 3T7VA 4H4IA 1JCLA 2HS6A 4DF1A 3TQ0A 3BK0A 4MY8A 4Q33A 4S2BA 2X1TA 3CC1A 4HT3A 1QAPA 3UWQA 3ABQA 4CLMA 2C1HA 2NUXA 4M7SA 1VR6A 4O1BA 1L6WA 3P62A 4K8EA 2B0MA 3P5YA 2D73A 4NZJA 3NPUA 2VFGA 3TC7A 1GEQA 1O5XA 4UTHA 4UTIA 2ZDRA 1TMHA 4NJHA 3ANYA 1OFOA 3T78A 1FXQA 3LTSA 4TMBA 2GJLA 3HGJA 2QCGA 1XM3A 3GNNA 2JGYA 5I3FA 2C15A 2FFCA 1C29A 3PSVA 3EX6A 3G1FA 1TSIA 4FNSA 4OQVA 1FDYA 3P81A 4RZ6A 2OCZA 2QUUA 2R14A 2AGKA 2ISSA 1TV5A 3M5ZA 5A8GA 3UPWA 3TQVA 3H54A 1B9BA 4JS3A 3C6CA 3T44A 2ZZ7A 2YFOA 3A24A 1G69A 3M5YA 5KITA 2CLFA 1HFBA 3A21A 4O13A 1GQNA 3NGJA 3STEA 1K3UA 1TREA 2C16A 3TQKA 3HGRA 4O14A 4U28A 1FWRA 3TH6A 4MKNA 1LROA 1XXXA 2Y61A 2QCFA 5C5YA 4L4LA 1UJPA 1XUZA 3W7LA 4IUOA 3EXRA 3IGSA 2B7OA 1JUBA 1DV7A 4P61A 2WSQA 2Z6JA 1TPUA 3GLCA 5D04C 4LRSA 5AHIA 1A53A 1GOXA 2J24A 4FIQA 1X6UA 3BG5A 1M5WA 3GB6A 4RX0A 3NM1A 2A21A 2ATMA 1JCYA 1P0NA 3S42A 4QISA 3LV6A 4TO8A 3O16A 3IVUA 1XCFA 3MHGA 4MIMA 5EA9A 2ZRYA 3LCXA 1QO2A 4JNMA 2ZZ1A 3W7NA 1OFPA 3NG3A 4QJ1A 4TX9A 3GKFA 3M5XA 5F1UA 5AC7A 1H7RA 2ZTJA 3PBUA 4AHOA 3EXTA 3KVKA 4FNTA 4J9JA 3MHUA 5L6UA 3MBFA 3NAVA 1KLZA 2Y89A 4UTKA 2QCMA 1W0MA 3GK0A 1I4NA 4IQLA 4Q32A 1GPWA 1F05A 3WJWA 5K7JA 5H91A 1TPWA 1LP6A 3BG3A 2CZFA 3TDFA 1UUMA 2OZ0A 2VFDA 3M0ZA 3GNDA 4I7VA 1R30A 1LRQA 3S1WA 2FB3A 3VNDA 2DZSA 3TFCA 1DJQA 1FWNA 4O50A 1GVRA 1OF8A 4GJ1A 1H7OA 2F7FA 3NQ7A 3I6RA 3S8HA 1H62A 3DH7A 4MY9A 2FJKA 5DY2A 3BVJA 5AC8A 4XTIA 1OK6A 2J27A 4NX0A 3ZR4A 1TPB1 3FYPA 4O4VA 5TBOA 3LTPA 1KA9F 1TTQA 2NXHA 1YDOA 1SW3A 3WFAA 3O07A 1DJNA 1BWKA 2NX9A 4MYAA 2I9EA 3VFLA 1LORA 5G5IA 1FBAA 3W86A 3B0UX 2R91A 3WK2A 1C8VA 2V9DA 4FX6M 5FF0A 3UWWA 3HQ1A 5D2YA 4HPXA 2ZTKA 3PBWA 5AHLA 4NJGA 1C9DA 2E1DA 3UXAA 3U6WA 1QOQA 5K9XA 1OX4B 4H3DA 1QPQA 1TB3A 4O53A 3W23A 3W1QA 3VKJA 4AHPA 3C2FA 4CNNA 1W1ZA 2X1SA 2DORA 4BI5A 2ZZ3A 5D2TA 3O6DA 1EP1A 1QCWA 2NV1A 5A5WA 3EKLA 2J6XA 1L6YA 4KFPA 3TAKA 4UFHA 1Z41A 5DN1A 1H61A 3L66A 4IMGA 1FCQA 4ADUA 4H6KA 4QSHA 2CLMA 4KWVA 1THFD 1JULA 2DZVA 3HBLA 2X16A 4KFNA 4O57A 3PUDA 4BI6A 1XBXA 3NZ1A 3STFA 2EKCA 3VI2A 1WOAA 1YTDA 2DP3A 3MI6A 2JGQA 4K37A 5DXYA 2VC6A 3W2NA 1JRCA 2ZZ2A 4LS1A 3B05A 3W1UA 4NNBA 5CZSA 3W07A 3C2OA 3PG8A 5G2HA 1TJPA 3TXVA 4AF0A 3H55A 1VLIA 1SFLA 4LVFA 4AVFA 4JDBA 1XDMA 1MZHA 2IQTA 3TUUA 3STCA 2OJPA 3PSWA 1DVJA 3W7KA 1P4CA 4FX8A 1H5YA 6ALDA 4WXYA 1S5VA 2QDHA 2ISVA 4LT9A 3DFQA 1GYNA 3L0NA 2OX1A 4K8HA 2VXNA 1FWSA 2DZPA 5CZ0A 3TW6A 3KX6A 3D0CA 2GVGA 2RDWA 2Q3OA 3TCEA 3A22A 2CZ5A 1AL7A 4MY1A 2A7NA 3M47A 2B7NA 1BEUA 3V1PA 3NQ8A 1SPQA 2E09A 3TFXA 4MLJA 4FHAA 1B3OA 4Y90A 2WQPA 5GVJA 1Q3NA 3TJLA 2FDSA 2FQIA 3M7WA 5HQEA 5AHEA 2CZDA 4UXDA 5E0KA 4AWSA 1AW2A 3O06A 3W71A 3F1QA 3T40A 3M44A 3QZEA 3RU6A 5EBUA 1EA0A 5LHFA 4LC6A 4E2BA 5F4WA 3IEBA 3WK1A 1ZJIA 3G3DA 1W56A 3DFOA 4EIVA 5FESA 4UFMA 2YFNA 3GAYA 5D03A 4UTLA 4Z08A 4RCXA 5BRBA 2X2GA 4LTSA 5KINA 3W2LA 3W74A 1OX5A 3W7MA 1ME9A 3PVFA 3PBVA 3LCHA 1F6PA 5G2IA 3U2OA 3CHVA 2Y85A 1JCNA 5CSSA 1OYAA 4KWWA 3H53A 1FQ0A 4GWEA 4JTSA 3LXAA 3UWZA 4I9AA 5DCDA 3TV8A 4M7TA 1K03A 1H51A 2H6RA 1W5NA 1MEHA 1SZEA 4ZQRA 4Z0SA 3KRUA 4BK9A 3LHTA 2PURA 5DBUA 4O17A 4S1FA 2FIQA 4ORMA 2RHGA 1I8JA 2Y63A 1S5WA 1SO4A 3UQNA 4WOQA 3FFSA 2CLKA 3C2RA 3GYEA 4DPQA 4JTIA 5G4EA 1T0OA 1DOSA 5LGZA 4UFLA 2G5WA 2C3ZA 1EWEA 3L21A 4Y6GA 4WY0B 3A23A 4MLRA 2CZEA 3QRHA 3BO9A 1WV2A 2QCHA 3DZ1A 3T55A 4RZ5A 3IGXA 3LXBA 3SSJA 4JIPA 1PE1A 3QW3A 2OT1A 2BWGA 2NX3A 3L0GA 5EPDA 2V5LA 2V30A 1GVQA 3TMQA 3LCLA 1WOBA 1CX9A 4QNWA 5CGQA 3OHIA 3TAOA 4NU7A 3PR2A 1QOPA 2QCDA 4HPJA 1ZCOA 1KFJA 1XFBA 5DXXA 2YW4A 3EWYA 2ZRXA 3CEUA 5KZEA 5CKSA 3SECA 5LNWA 4GUJA 4OE7A 4WOZA 3ATYA 1SU5A 5J5DA 1AL8A 2B7PA 1O94A 1PHQA 2TRSA 2CFFA 4O16A 4W9TA 1ICPA 1OFBA 1KV5A 1TTJA 4DELA 5DLCA 3OA3A 3GKAA 1PCWA 1ZALA 4HNUA 3WJSA 3UXDA 3BV4A 4RXFA 3LLFA 1LBLA 2ISWA 5G4WA 2WV8A 3W72A 1ME8A 2E6YA 2NWRA 3OVQA 2Z2UA 3L5LA 1P1XA 3P74A 1RR2A 3NQ6A 4RXGA 4E38A 5KSWA 3NQVA 2Q8ZA 4LOCA 4N9DA 1GYLA 4BWLA 1A5BA 5K9CA 4N02A 4N4PA 1SR9A 4JTTA 4AWUA 4XBSA 2G97A 5D05A 5EKYA 2G95A 5J5RA 1WYIA 3BG9A 1OFRA 1T96A 3OIXA 2X1UA 4IWWA 2DZTA 2E5CA 3EXSA 3DFNA 4X2RA 2FB2A 2WNNA 3W7CA 2J9YA 3ABRA 1JUKA 3UD6A 3BW4A 3SGZA 3P7YA 4JYFA 3VCRA 5BOOA 5MHBA 1YTEA 4JYEA 1PVNA 4IMCA 4UMBA 5EY5A 1G4SA 4TU1A 4MPQA 3G1DA 3QPZA 1Q45A 3W1TA 4IOTA 5U4NA 4NJJA 4D2JA 2PC4A 1JQXA 4TR9A 4LW7A 3F4WA 3W84A 1YPIA 5K9DA 2QKFA 5TQLA 4WX2A 1FUYA 3KRZA 2Z0IA 4GNJA 3NPXA 1TPFA 1SO5A 1Q6QA 2ZZ6A 4JTJA 1XI3A 5AOUA 3FJLA 3W9ZA 1GTHA 3LM7A 4N9EA 3KXQA 2FLIA 2VFIA 4UFJA 3RLUA 3HGOA 4ZQCA 5I3IA 3C56A 4R33A 5CSRA 1GT8A 1J2WA 3QSTA 4O18A 3FA5A 1IF2A 5HINA 4QNEA 1KFLA 2Y6ZA 5CPNA 4DO6A 1J4EA 3TK7A 1LRTA 1O4UA 4JYDA 1J5TA 1LBFA 1XBZA 3GR8A 1QPRA 2ZZ5A 1OG0A 4IXHA 4XUGA 5CPLA 3IV3A 2VFEA 4HKPA 1JJKA 1X1OA 3BLEA 1W3NA 5D38A 1VCGA 1SUXA 4Z1DA 4LS2A 4A3UA 3P5ZA 2CLLA 1K7FA 1ML1A 3GR7A 4ADSA 5DBTA 4FXRA 5F1VA 3L67A 4K7VA 4PFMA 2CWNA 4M5PA 2E6AA 3NQGA 4X9SA 3CPRA 3NPVA 3SGUA 1H1ZA 2KZHA 1AMKA 4M6VA 1OYBA 3RFAA 1LOQA 2VKZG 3E9AA 5DCBA 3GDKA 1W5MA 1EX5A 2PCQA 5LNVA 1SW0A 3B03A 3LI0A 1TPC1 3G8EA 2A2IA 1KV8A 3LCGA 2ZRWA 3L65A 5K2ZA 1RD5A 3E0IA 2QJIA 1M7OA 1QO5A 7TIMA 1S5TA 3MW7A 3PAJA 3N19B 1FDZA 1PIIA 3MP3A 1R46A 5AHNA 3W73A 1UASA 3DBPA 4M6PA 1YXDA 4GBUA 4UR8A 3UPBA 3DKJA 2X1RA 2I1OA 2PRHA 3B8DA 2YZRA 3M43A 3FEMA 4CQ9A
chains in the Genus database with same CATH superfamily
3QR3A 3CBWA 3VGGA 3AU2A 4R7WA 5KEZA 4H7ZA 4JDYA 3KVMA 1QK2A 2ADAA 3ARQA 2FPTA 3UEQA 1IXOA 1F3TA 4FSAA 2VUNA 1EA9C 4LV9A 4EF9A 1D3HA 3BH4A 2ZICA 5A8QA 1TZZA 1C8XA 1JNDA 4Y8EA 1QI0A 4IMFA 4NIRA 4KS0A 1RLCL 1G67A 3BAXA 4NYUA 4C90A 2ACUA 1LJYA 2WYSA 3EMCA 2R8WA 4MZYA 3WNNA 3MI2A 4OJYA 1UB3A 2O56A 1DWAM 3NQCA 1WKDA 2OQHA 4BR1A 4BJHA 2QDGA 2ZX6A 2CBJA 3RDKA 2V67A 3KBJA 2P3EA 1LOLA 4JQ2A 4Q8PA 2QT3A 1E6SM 4ZOAA 1O5RA 4IH3A 4INFA 2WHKA 1MXDA 1G94A 3RCMA 4KRZA 3G1YA 5I6SA 1OZMA 1UKOA 3N13A 3DFTA 3FGCA 4ML9A 1J9YA 4Q8WA 1Z89A 3E1F1 3AWNA 1LRNA 1LLZA 4KW2A 3AMKA 4F2UA 1JZ8A 5A2BA 4H2HA 4P7LA 3QVQA 3RGTA 3TCSA 4TIMA 4J7RA 4MAVA 2BOEX 3WUEA 1CW2A 1EGZA 4XKYA 1GYMA 2PEVA 2PS2A 3N4AA 3GG1A 1TPVA 3KL3A 1YXYA 4AH7A 3ITYA 3W53A 2R94A 3RR4A 4A2RA 3ARXA 2YR1A 3LHYA 4XKMA 3OVRA 4RLIA 4L64A 4GXWA 5C0QA 1KRCC 2REQB 3AXMA 4G7EB 1TV3A 3DYOA 4TV5A 4RK8A 2ZFAA 4M8UA 3WJXA 1LQ0A 2R82A 2BY3A 2EF9A 4HK7A 1NWRA 4MJ2A 4OBTA 2R9RA 4A35A 3VMNA 3AHTA 1H1NA 2GVLA 4HOWA 3SURA 4ZGYA 1A49A 4X60A 2QV5A 2NQ5A 1UH4A 2OOFA 4KCVA 3N9RA 4Q3MA 1JYWA 4ONVA 4BKNA 1JDDA 1KWGA 4GRSA 2D2GA 4QDPA 3CT2A 4JN8A 4US6A 3EA1A 3GZ3A 2P50A 4KWOA 1UKPA 3RMJA 3F5KA 2PDWA 4PL1A 1EZWA 4X0VA 4E8DA 1T8QA 3GHSA 2NW0A 4V2XA 2YX0A 1FWJC 2VEIA 1VD6A 3W29A 2QIWA 4UFIA 3WD3A 3DX5A 3QF0A 3FYYA 3PB0A 3HF3A 3FVDA 3W88A 4WXZA 1A3XA 3DFPA 2ALDA 3W1RA 4JKKA 2FZ8A 4Q4PA 4FB7A 1YKWA 2WC7A 4GH3A 4B9ZA 3KP1A 3R5EA 1UMLA 5AYYA 3G22A 4Q4OA 2J8GA 1JZ2A 5C9WA 2ZWZA 1ONRA 3CQIA 4E6MA 3S5NA 3VD4A 3EX2A 3BW3A 5HUOA 1M7PA 3UGVA 1IWPA 4HVXA 5FEXA 2BX7A 3LGGA 3R4IA 3PWGA 2PWUA 4HA0A 1I2NA 2C18A 1SJDA 4H8NA 4DZIA 1EYEA 1Q7MA 2NXIA 4UWMA 2HDJA 1HIZA 1K77A 4CEXC 2XUCA 4N0RA 2YCEA 5K4ZA 4BA0A 4WSKA 1CNVA 3S9YA 4CD6A 1R2SA 1L9WA 2QDDA 3N1AA 2GQAA 3TSDA 4FLOA 4QSFA 5JQ9A 5CC6A 1SO3A 4MG4A 1ZAJA 2R1NA 1MFUA 2ZXAA 1BXBA 1IZKA 4E4UA 3ITCA 3D3FA 1V5XA 4G2DA 1TR1A 2VC5A 1JFXA 5GJMA 4ZQMA 2OYKA 4FNRA 4S3GA 1YNYA 1LLOA 1EBGA 2A7PA 2ODOA 2OWCA 3EOEA 3SEPA 4GABA 3GZAA 4X2PA 1VGAA 2V3EA 2VRQA 3QTPA 4A21A 3L2LA 2A6LA 2YL6A 4QJ4B 1OM0A 3EX1A 1LBMA 1P0BA 4DX3A 2ANUA 4M1BA 1BYCA 1LWJA 3H4XA 3ENLA 4OU1A 1TWSA 3RNDA 4PMVA 3W7JA 1S2TA 4KERA 4KFOA 1S2AA 5D2VA 3AAMA 3NXFA 4HSOA 2V3GA 3A5FA 4WQ6A 3MU7A 4KRUA 2GDUA 3PC0A 3WNMA 4D8AA 4JX5A 3R79A 1AVAA 2V68A 1QNRA 4GYJA 2H9AA 4N42A 1X96A 3O0FA 3HA1A 3WYZA 3MYOA 3KAOA 3EDEA 2PU1A 3TOPA 2Z25A 3R8HA 3C0QA 4Y9MA 2B4GA 4W88A 1EXBA 3VFCA 1FTXA 4HQVA 2D1ZA 4JNZA 4YLWA 2QGHA 2YYTA 3ERPA 4U4MA 1ME7A 2XFFA 1RQEA 3ARWA 3WMLA 2PTWA 1E6NA 4ZO6A 1W54A 2VX6A 1FP9A 5M5DA 4W8LA 1LT7A 1V0LA 4UCGA 3KW3A 1KNWA 3A4XA 1B3WA 3NVTA 3OBEA 4FNUA 3CLMA 1Y0EA 4BF9A 5A3HA 4ATDA 4F0RA 4BHYA 3V16A 1BYDA 5K4XA 3TNBA 5F2LA 3M6YA 3QC0A 3WQOA 3WQDA 1A3WA 2Y7DA 4TOQA 3UZJA 2VZSA 2GVYA 4CCCA 2XM2A 2HS8A 3LV5A 1KBIA 2XIJA 5MKGB 2NSXA 2GWNA 4UTWA 1JD9A 2VOMA 3EA3A 7CGTA 9XIMA 1KBJA 3TONA 1E4NA 2PFHA 5G2WA 1O60A 2B7QA 1RP9A 4GIEA 3PM6A 2PWEA 1XL9A 5DF0A 3BLKA 4HJWA 1DQXA 2BGSA 3GG8A 3G1HA 2W62A 1DJYA 1EPXA 1PS9A 1VPXA 3QY8A 3UZZA 3HG3A 2VRKA 2GWGA 2OLAA 3G0SA 3HO8A 1RJRA 4O28A 1MYRA 3GW0A 2E6FA 3GIPA 1S2UA 3G0XA 4S38A 3NTYA 3TR9A 1YE6A 2IPFA 1K4HA 5E6YA 5PTDA 3DAQA 1OC5A 4H2CA 1KTBA 3LLDA 3RPMA 1HJXA 4N9CA 1H0IA 3OVGA 2VL4A 3MBDA 4LGXA 1IZCA 1HNYA 1ZENA 2MUCA 1UJQA 2Y7EA 4CVWA 5KETA 3G2GA 2YL9A 1FHVA 3HMJG 3ZLGA 1BSLA 4PMJA 3PULA 3WJZA 4OBSA 4DF0A 2A4AA 5GNXA 1LQ2A 2QPXA 5I3GA 3WNOA 2G3MA 4AWEA 5D30A 3L5AA 1H3GA 3WDIA 4MWAB 1UCWA 2NT0A 3JS3A 4J40A 4QJ3B 3NPWA 2FGBA 1RVKA 2CW6A 3GVGA 4LVAA 3B04A 1NWSA 3MMTA 5GNZA 2WNZA 4GQRA 3W2KA 2YLAA 4DWSB 4F66A 4DM1A 3CQKA 1UROA 4WKAA 3V0TA 1QNVA 3AZTA 3G8RA 1L8PA 4HA4A 2OPJA 4LYPA 2GDQA 2Q3RA 3CUIA 4HNCA 1NF7A 1E0VA 1XRFA 3DI1A 4HHMA 5I3JA 3PY2A 2XZ9A 2DVXA 3B0XA 1QFEA 3A4AA 2UZ9A 2NV9A 1D8WA 1DIKA 1REQA 4K7YA 3T6CA 5T91A 3B3DA 5GQBA 3LGEA 4UOQA 5HUPA 1GUVA 3F03K 1O5QA 4OGZA 3GDLA 1Y65A 3JRKA 3B8WA 4GUFA 4HMCA 2DIEA 3RLGA 2WNQA 4DNHA 1PJ9A 4IQDA 2UV8G 5HR6A 2OMAA 4KWSA 1EX1A 4RJEA 4Z0JA 3HJZA 3N14A 1Z9AA 1TMQA 4Z2KA 2OR2A 4F0HA 3TIMA 3ORWA 1H41A 1Y5VA 3I65A 4O52A 4EP8C 4UTTA 3APYA 4TTUA 1TA3A 1EJWC 1XLCA 1E71M 3N4EA 1VEPA 4WKHA 5DRCA 3E12A 4NJKA 3HPZA 4GQGA 6CGTA 3BUVA 4CNPA 1EB3A 2A7RA 1KB3A 5FJPA 2Y88A 1TUFA 3T4WA 1CLKA 4OTKA 3DESA 3R8RA 3AMDA 4FALA 3TN3A 1F3XA 4GQBA 3DYMA 3AFBA 4DO4A 1I2RA 2A6NA 2DSUA 3TNOA 2A3CA 2DY3A 3WMCA 4TMCA 3RRXA 1U22A 3GXTA 5BWFA 3KVLA 4ZTYA 4DO5A 1XUUA 1IT8A 2JQXA 3DYPA 4M24A 3U2EA 3G77A 1J0JA 3W0KA 3P82A 3MHFA 3H21A 1V6YA 2Y4SA 2PZNA 5BXTA 3ISIX 3NFUA 1D8CA 3QJAA 2BODX 3CLWA 1X6NA 3WDHA 3LK6A 1AODA 1V6VA 2PDPA 4FA3A 5AHFA 5DELA 2Z1KA 1HT6A 3DUGA 1XYMA 2VFHA 3W7EA 3UJ2A 3DI0A 1OK4A 3H2CA 3GH5A 5BMXA 4AUBA 1EH9A 2WLYA 4OV4A 5EMUA 5F7UA 1EF3A 5LA0A 5DQPA 3T2OA 1KW1A 4GJJA 7ODCA 1X7IA 2RDUA 4M3PA 2FYMA 3R89A 4K36A 4GCXA 2WBGA 4A3RA 1GQIA 3CTTA 3EEGA 3W1NA 2YL8A 3W1AA 1KLYA 5D02A 2GGJA 2J7FA 5A6TC 3W1LA 1E0XA 2AL2A 1RK5A 4NXKA 1XKYA 3HIJA 1UP0A 2CETA 4KIRA 2GL5A 3FA4A 5I7GA 1PHWA 3TTQA 3HMCA 2F38A 5ABHA 3G1AA 2Q01A 3QTGA 4NVTA 4O10A 5IDIA 3I7SA 2BVWA 3LRLA 1E0WA 1VYSX 2E1WA 4LQ1A 2AOSA 4ICMA 5A6BD 2A3BA 4NI8A 1K7XA 4O1DA 2DJXA 1B90A 1UMYA 1VJZA 3ZLHA 3GYCA 3QV9A 2VCBA 1YXCA 3VKCA 3GRIA 3TE9A 1E4IA 3I10A 2FDMA 4WGXA 3B4UA 3CTLA 2GQ8A 1YYAA 3WLPA 3AHYA 2YA2A 4B15A 1BTMA 3CWHA 4RDYA 4H9YA 3M16A 1V77A 2W0UA 2NT1A 3NO1A 5T26A 4AY7A 3Q58A 3LBCA 7TAAA 1D7KA 3W7HA 3Q2DA 3T0CA 1NWUA 1IIHA 4DUVA 3E96A 2QJHA 4EOUA 2PRMA 1K1DA 3FCPA 3INPA 2FPYA 1BAGA 1N7KA 4L9XA 4EAYA 5LGXA 1RAKA 4JTFA 4O8RA 5EYWA 1KBLA 4MDPA 2F2KA 3PNZA 1SGJA 5I3HA 1GNXA 3TYBA 2VP8A 1NFPA 4L56A 1EGVA 1PKMA 5K3VA 3AUOA 5KZMA 1ZB5A 4XBKA 1ODUA 2WLZA 1FWHC 2GJXB 4J4KA 3LEPA 4WDUA 4G1KA 1OADA 3IS4A 3QMSA 3SM0A 4GIYA 1XIGA 4MFEA 3W70A 1R47A 2F84A 3VZXA 1XV8A 4C7DA 1DJWA 1UWAA 2TYSA 3N9SA 2C7FA 2I5GA 1EKOA 4AD1A 3A3WA 4PBFA 3CQHA 3BW2A 2DQXA 3FDGA 5EMJA 4IIGA 2CHOA 3M9YA 3VNZA 4TUFA 4EWND 3B0VC 1F5ZA 4OKDA 1PEZA 1UD2A 3FIGA 4OOZA 2FH8A 3AS0A 3WQ5A 2W67A 5XINA 4O0ZA 3GIQA 4OOUA 3MY9A 4Q7BA 4URIA 1G4EA 4V1XA 5AFDA 4H6EA 3E2RA 3P8JA 5DANA 1OVDA 4CN1A 4P5UA 3P60A 4A05A 4UR7A 2DZWA 3WDPP 5DT7A 2A3LA 1HKKA 9XIAA 3MP5A 4XZMX 4DJDD 1FA2A 3BZJA 4G1NA 2QCCA 1I60A 4C60A 5JU6A 3H2NA 3T05A 1ZY9A 1HJUA 1F07A 1S2CA 2JEQA 3ALGA 1E43A 5A6MA 3TYCA 2QAFA 1NELA 3CMJA 4HA1A 1SW7A 1V0NA 4Z2HA 5CEWA 1MFVA 3PZ9A 1SFSA 5U7SA 3A64A 4MWAE 3E5BA 3MUXA 2J47A 3AJ7A 1F2JA 4DAFA 4DWSD 3IRSA 1GVIA 4IGHA 1QXLA 4CQBA 2H90A 1OY0A 5DCEA 4WD0A 4NRRA 3AISA 3N04A 1PTAA 3KCLA 1V8EA 4I3GA 1UD3A 1WZLA 1ZZMA 5AKQA 1XIDA 1EP3A 5AYZA 3K8KA 2QVHA 1W1YA 4LH8A 4ZO9A 4PCNA 3AS1A 3N2TA 3RYSA 1ISVA 1YE4A 1WCGA 4UZUA 2GSHA 3GG0A 3EWBX 4Q6JA 1Q6OA 3SIZA 4IICA 4JTEA 3LB0A 3MJMA 3DFHA 1ZQ5A 1TRDA 1BG4A 4F9JA 4H4IA 2HS6A 2VO5A 4IJCA 3BK0A 4WK9A 4AZ5A 1MW3A 3I4EA 3UWQA 3WLMA 4CLMA 1WDRA 1QBBA 5BU6A 4WHBA 2PDQA 2B0MA 3NPUA 1GQJA 1TVPA 4MB1A 1GEQA 1QHOA 4XO7A 3WQCA 2ZDRA 4H00A 4NJHA 2D0HA 1R38A 4NP7A 1JDCA 4TMBA 3E74A 2ZC1A 3B0YA 4AC1X 5I3FA 3NOYA 3AXKA 2FH6A 3FW6A 4OQVA 1G9HA 2WMKA 3O6AA 1HKVA 1S2WA 4RZ6A 2OCZA 1QI2A 1NJJA 3QHNA 2ISSA 3T07A 5A8GA 3UPWA 4ACZB 5I09A 2D23A 4JS3A 2Y0FA 2WMJA 3E6EA 1WP6A 2YFOA 1XINA 1ECQA 5KITA 5A6JA 1WUFA 1HFBA 4MWAC 3SFWA 3S6TA 3STEA 1HP4A 3PK7A 3BMXA 2FMOA 3OLIA 1EJRC 2ALRA 3T2PA 5BOEA 4U28A 1FWRA 1GCYA 4GPNA 3ZMRA 3K4AA 4MKNA 4XG1A 4W5ZA 3WG6A 3O9NA 1F6YA 1XF0A 5C5YA 3L7RA 1UJPA 4L4LA 5C9XA 4LALA 3W7LA 4IUOA 3EXRA 4FLSA 1SMDA 4W7WA 2B7OA 1EF2A 1A0EA 2BOFX 3IGHX 1DTUA 4WGHA 1KR1A 1A53A 1TCMA 3T8QA 1GOXA 2J24A 3V5OA 1UIOA 3R11A 5BOFA 1TZ7A 1YDYA 1ZCCA 1M5WA 5I79A 1S3TC 3MKCA 4C5YA 1EZ2A 5D8WA 4H8VA 5REQB 1BVNP 1P0NA 3A4JA 3S42A 5T8GA 5EBAA 4GI6A 3O16A 3A3HA 5I5RA 3LCXA 1PDYA 5F1UA 1XQKA 3S5SA 5CG0A 1SVDA 3KVKA 4FNTA 3MBFA 1XLDA 4B90A 1NIUA 3LBOA 4UOZA 1W0MA 4E2OA 1I4NA 1A5LC 3WJWA 2VX7A 1WDSA 1P7TA 1TPWA 3BG3A 2CZFA 3TDFA 3CAQA 1UUMA 2OZ0A 3KHDA 4I90A 2ON3A 3NUKA 3KP0A 1IYXA 1R30A 3RMEA 1U1HA 1IEIA 1DJQA 1TE1A 1H62A 1OZQA 1XR2A 1UKQA 2J27A 3T1GA 4NX0A 1TPB1 4FOUA 4FR1A 5GJNA 3UT0A 1YDOA 1C90A 1BWKA 3EKGA 4MYAA 3WIJA 3QOKA 2FMNA 3VDHA 1C8VA 4FX6M 2X41A 4K2SA 1W1B1 3UWWA 3NEHA 3LUTA 2ZTKA 4XVDA 5AHLA 3S2NA 3L2MA 3URAA 4JQ3A 3KLKA 3UXAA 1FWDC 5JH1A 4X0NA 4O53A 1TB3A 3I3EA 2PTZA 1UW9A 4AD5A 3ZQ9A 4J27A 4HHLA 1H49A 1X39A 3KL5A 3W23A 2FZNA 4CNNA 1W1ZA 2IMRA 2G3NA 2DORA 2ZUUA 1QCWA 4GIRA 1L6YA 1O68A 4YYCA 4KFPA 1Z41A 1V3LA 5DN1A 4C6MA 4IMGA 2TODA 3VMPA 3APGA 3PZQA 3JUGA 1THFD 2DZVA 3HBLA 2YDSA 2XVNA 4O57A 3PUDA 4BI6A 3S9IA 1XBXA 3NZ1A 3GC4A 3VD5A 3TWBA 4GI8A 4JOMA 2ZXDA 2OTDA 4JTAA 2YXOA 5CZSA 3W1UA 4NNBA 1EEXA 3PG8A 1TJPA 4DYKA 4QRNA 1SFLA 1V6TA 4E8CA 4JDBA 3RJXA 3TUUA 4ZO7A 4DBWA 4AU0A 1H5YA 6ALDA 1UH3A 4H9TA 4K8HA 2VXNA 1FWSA 2DT3A 1FWEC 3D0CA 3TCEA 2OKTA 4AX6A 4LBUA 4MY1A 4D1IA 3COTA 4FR6A 3N18A 2CBVA 3V1PA 3L23A 3NQ8A 4B3ZA 3N6QA 3KTXA 2X8RA 1JNEA 2HK0A 3AIWA 2O9TA 2X2YA 1JPHA 5E0KA 3GHRA 4US5A 3UERA 2GUBA 3QZEA 3ZZ1A 4HPGA 5LHFA 3M0XA 1XP3A 4E2BA 1Q5MA 2PWDA 2V3FA 3CL7A 4EIVA 3LM3A 5FESA 4PRTA 4JNYA 2YFNA 2G37A 1FFQA 3VNJA 4UTLA 1F61A 2E0PA 1A4MA 1RHCA 1CCWB 2HPMA 4LTSA 1Q63A 4A3YA 1MNSA 1PIFA 3SCPA 1OX5A 4RZBA 4UQAA 4ZE5A 2P88A 3KDOA 3UCQA 5G2IA 3U2OA 1QNOA 3CHVA 3TZFA 5CSSA 1OYAA 4DZ5A 4JTSA 2NQLA 3EMQA 4O1FA 3BLLA 3SCTA 2G50A 1H51A 2H6RA 5D9PA 4Z0SA 1OGGA 3AYTA 4S1FA 3AYRA 3B9AA 1GW9A 4ORMA 1S5WA 3EOUA 3H4WA 4WOQA 4EANA 3UFYA 3FFSA 3IACA 5IDZA 3GYEA 3UG4A 4U5IA 1XLHA 2NVDA 3RR1A 1VP5A 4LFYA 2C3ZA 2WZTA 3A23A 1MWOA 1X6LA 2WNWA 3BO9A 4K1WA 3T55A 6REQA 1ZGDA 1GGOA 4JIPA 3QW3A 2PGWA 2NX3A 4S3FA 3LCLA 2X0YA 4U3CA 1F9CA 2PWGA 3OHIA 3T08A 2VVSA 1EPVA 1HJQA 1QOPA 3FSUA 4WSHA 3UZWA 1M53A 2Y2WA 5DXXA 1B9ZA 1MDRA 3R0DA 3RILA 3CEUA 4Z2IA 3M0KA 4HU8A 1JXKA 4OE7A 5J5DA 3CUGA 2DDXA 2B7PA 1O94A 1VB9A 3NDYA 4GIAA 4KQNA 4HA3A 2W9MA 1ICPA 1TTJA 5DLCA 2XSBA 3UXDA 1WDDA 3BV4A 1AMYA 1LBLA 3F5JA 1MMFA 4MSSA 1ME8A 4XD5A 2E6YA 1JZ3A 4GBDA 4WKFA 1RR2A 1M41A 3SN4A 2D24A 5KSWA 1LL4A 4LOCA 3UP8A 3U48A 1A5BA 4KCTA 2ZUMA 3WLQA 2WC4A 4JTTA 4AWUA 2G97A 1KD0A 5EKYA 1OFRA 1S1PA 4IWWA 1XGEA 2E5CA 3EXSA 4X2RA 3DFNA 2FB2A 2WNNA 5A1AA 1JUKA 3KOXA 3OGSA 5G1MA 4LNCA 2V5CA 2OYMA 4QG9A 5HNUA 4MKVA 1YTEA 1KRMA 4IQEA 5EY5A 2AQOA 3MKKA 3UYIA 1U5VA 3QPZA 4FXFA 4HCHA 3U5UA 5EB8A 5DMLA 5U4NA 4NJJA 1EJSC 1JQXA 4TR9A 2VURA 4LW7A 3XIMA 2YBUA 1BVWA 5FL1A 4RE0A 4YVVA 3EOOA 5K9DA 2QKFA 5C9RA 4XZNX 4GNJA 1TPFA 1AFSA 4NF7A 2ZZ6A 1PZ1A 1EC8A 1MRAA 3WQPA 3KXQA 3N2OA 1RCXB 3RLUA 2OGJA 3HGOA 5I3IA 3C56A 1GT8A 2DVUA 4RPPA 5CPNA 1J4EA 3AC0A 1O4UA 2EO7A 3MZNA 1XBZA 2ZZ5A 1UR1A 4TXEA 4OECA 2HWGA 3IV3A 5GJPA 3NZGA 3M64A 2BVTA 3ZSTA 2EQDA 4S39A 1JJKA 1X1OA 2O9PA 3BLEA 1Y5XA 1W3NA 3JZUA 4TTGA 5D38A 3MSGA 1SUXA 3P5ZA 4HZ6A 5DBTA 4AX7A 2H9AB 4PFMA 2KZHA 3FAWA 4Q8TA 3VDGA 3RFAA 4IIBA 1LOQA 4Q8NA 4DY1A 4GGBA 4XZLX 3N2BA 3WUBA 2WCAA 1ZSXA 2PCQA 1K9TA 3N12A 1SW0A 4QQUA 3LI0A 1TPC1 3G8EA 1OCQA 2ZRWA 4B2DD 5K2ZA 3E0IA 2POTA 1FDZA 1PIIA 2WSKA 1VFUA 3UETA 3RM8A 4W86A 3DBPA 3DKJA 4F4RA 1M04A 4HD5A 3BCJA 3M43A 1ITUA 1JFHA 4IUGA 4H9VA 3C2EA 2C0AA 3E49A 1KM6A 4HP5A 4S3CA 6TAAA 2WWCA 2H3DA 3AS2A 4JTUA 2CLHA 4ALDA 1A5AA 3NDZA 1UR2A 1E51A 4G9PA 2JKEA 4IPPA 4D9PA 3CQJA 3DFSA 4DXVA 2IKIA 1S46A 1FXPA 2DGAA 2OT0A 4JXCA 1PKLA 1WX0A 3MP4A 3SO7A 3UZYA 3PTKA 3W2UA 4L6HA 2VR4A 4AZCA 4QLJA 3CAKA 4MB3A 2OQLA 1YDVA 3W1XA 4DBDA 3NZRA 2PDLA 4S3AA 4UMCA 3KRSA 1FH8A 4L4PA 3RM9A 3LTYA 4GXMA 4I9MA 1J96A 4ZB2A 4JN6A 3ARYA 1TV7A 3F4DA 3T2QA 5D32A 4AFYA 1OEPA 3VDBA 2YPIA 4L4OA 3E02A 1IIGA 1US0A 2G96A 2CLIA 2XN1A 4JTRA 1NDVA 3AIUA 2HNEA 1J01A 1AK5A 4ERAA 3GQYA 1TV2A 3LI1A 3R12A 2XWDA 2XFYA 1U83A 1IR1A 5HWMA 4MJMA 1R2RA 3GXNA 1UIPA 3P80A 4DJEA 4RKAA 4DYJA 1NOFA 1IXQA 1X98A 3W2JA 4U31A 1EWDA 4NI3A 1B31A 4UQ9A 4LAZA 4Y7EA 2PA6A 1EQPA 4ACYA 3HPSA 4GZJA 5HMDA 3IUHA 1UBPC 4CD4A 3RXZA 3WLSA 1B3ZA 2B81A 3KFTA 1C7TA 3B8UA 1XPGA 2DH2A 2V2DA 3P2VA 4O54A 1ADOA 1DXIA 1HF6A 4PULA 1SSDA 1Q6DA 1XRSA 4ECLA 1RSCA 3EWXA 3VIGA 2QXWA 1QI4A 1MO0A 1E1EA 5IBXA 4J1OA 1OIFA 2Z7GA 1EO5A 1RCOB 3M1ZA 4XISA 3AIEA 1NM9A 3P61A 2OYLA 3WKZA 1REQB 3W82A 1P0DA 4WY0F 2TPSA 4FZIA 3ZFHA 3ZS4A 1VFOA 5ABFA 2Y24A 4PODA 5CSUA 4AB4A 5LNUA 1NWTA 1SSGA 5D8ZA 3SW6A 4GC4A 4YCOA 1POJA 3QR1A 4MJZA 3MYPA 4OV9A 2DIJA 4L4MA 3UVAA 1HP5A 3I68A 4HNVA 4GFSA 4CCEA 2ZVIA 3PUEA 1E4LA 4LNYA 3W85A 1DBTA 2J75A 4BF5A 3EDKA 2ZRZA 2XPKA 4UMAA 4PMNA 1W9DM 4X22A 1PYMA 1SFTA 3MQTA 5LSMA 3OW1A 1TA3B 3WZ0E 1Z69A 1QWKA 3W27A 1X8FA 3RO8A 2X7WA 2OWXA 3GO2A 4Y9AA 5LXXA 6TIMA 1UG6A 4O0KA 1CPUA 3ZWSA 3MANA 3NQAA 1N8FA 5CZTA 4DZHA 1OBAA 7XIMA 5E70A 2XVKA 2F2HA 3N29A 2CHNA 5CZJA 1T99A 4YVXA 5BMWA 3HN3A 4IM4A 3FA3A 1CBGA 4XV0A 1BQCA 4JTDA 3L9CA 3WQ6A 5E9XA 3VGHA 2ZQ0A 3GXDA 2DUAA 2YCJA 5ABTA 4HNTA 2PD5A 3HPXA 5DY3A 3W76A 3TJXA 3K5XA 5CLTA 4JCLA 4OUIA 1K4GA 5AHMA 4JN7A 1F73A 3CH9A 1ONEA 3IWPA 2ZXBA 2Z1WA 3LQLA 2DIKA 3KBMA 3O63A 2W4XA 2V82A 4IFKA 3GDMA 4CD7A 5FKYA 4C6LA 1O95A 1Q13A 4DAIA 4NZ3A 1BXNA 4LU0A 1WA3A 4FOJA 2WZIA 1POKA 1O1HA 3BZGA 3QLLA 2VJXA 4WRHA 1UZ1A 3MO4A 1WDQA 4AZ6A 1HJSA 3H7VA 3G24A 4QIUA 4JTKA 5D37A 1W5OA 4MVAA 2CNCA 1M65A 1K02A 3T81A 4EX4A 3A5VA 4Q7IA 3QV6A 3O6CA 4QQ3A 1JYNA 5HMEA 3IUIA 2EPOA 1NP0A 2TMDA 3GIYA 3W6YA 3TC3A 3JW7A 2QR6A 2AL2B 4PEKA 3EB3A 3EPMA 3G0UA 2OZ8A 2WKJA 4Y9OA 1GOMA 3THQA 3M0MA 5AN7A 8XIMA 3QW4B 4WVXA 3TW9A 4UQBA 1ICQA 2B31A 4IIEA 1YDNA 2JBMA 4AYGA 1H50A 1UA3A 3AICA 1A0DA 2VENA 1FCUA 1DKWA 3TEVA 3L4ZA 2H8XA 5F4SA 4R85A 1F74A 4WUIA 4F48A 3Q94A 4ZQNA 3PFMA 1QPNA 2QUVA 3NYZA 3VU2A 4YXGA 2IKHA 2WANA 3AOFA 3W38A 1TRIA 4R34A 3VABA 1Q7QA 2PODA 3OYZA 1W1IE 2BSLA 1GJUA 3QXBA 1U1JA 4GVIA 4MB5A 4PB3A 1YIXA 1ALDA 4M80A 2XH4A 3P8IA 4YMZA 1UH2A 5D09A 1TFVA 4ZQPA 3GW3A 3LBMA 2VRJA 4PYSA 2AGTA 2D2HA 5CAKA 1WZKA 3ZWTA 1GVSA 3SZ8A 3UY7A 2DVTA 3FJ6A 4ZQOA 2OO6A 4CCDA 3EWZA 5CBJA 4HSHA 5JIPA 2JKAA 4FPSA 3DG7A 1TQXA 4MMWA 1OFEA 4JY8A 1W1TA 2OOGA 3NGFA 2P5NA 3BMVA 5F2MA 1XRVA 3WQFA 1NFBA 1SJAA 3KM8A 5FAJA 3H8AA 3EX3A 1TMLA 4MZ1A 3REQB 3RX2A 2J9XA 4NNCA 2V2HA 2BXVA 1WB0A 3KZSA 2VI0A 3CWNA 1RA0A 1PKYA 3CB3A 3C4UA 1ZBKA 1SZNA 2PP3A 2OZ3A 3ABOA 1XLFA 5FF2A 2VR5A 4MUPA 1PSCA 4QS5A 3EWUA 1OX4A 5DO8A 2H8ZA 3IIVA 4HBKA 2DH3A 1R3WA 3NEVA 3VIHA 1DP0A 5DFAA 3DG6A 1F7BA 3F4VA 1FWAC 3M4HA 2CXGA 3EPOA 3KVJA 4L9YA 3KOFA 1V7AA 8TIMA 2P0OA 3HG5A 3VE7A 1OD8A 3KDNA 4ZBCA 5FF3A 4DIAA 3P0WA 3P84A 3GNXA 4RNFA 2Q09A 5HMFA 4QAIA 2EPHA 4HNOA 1WXZA 3USZA 4REQB 2XISA 3QM3A 1DHPA 1H7PA 1TIMA 1WXJA 1H7WA 3ZR6A 3W75A 3AZRA 4PMUA 2OODA 2XM1A 4NAFA 3RF9A 1VHCA 2QEZA 3NYDA 1EC7A 4E0CA 3C3UA 4HU4A 5I3KA 2Y7FA 2JALA 1TPEA 4HK5A 2GUUA 3V75A 3LRMA 3IARA 1CGVA 2FZ9A 1S39A 2ZIDA 3GTNA 4WDWA 3VKBA 4GYPA 1JCMP 2C6QA 4DLFA 1ZTVA 1NOWA 4LRTA 2Z28A 3OG3A 3R94A 4ZO8A 1J5SA 1LM1A 3TLLA 1R7AA 4HTBA 1X7FA 2GGIA 2I7GA 5H2ZA 1JI2A 4GX8A 3TC6A 1IEXA 3R7MA 1PXGA 4B3LA 3SUTA 3C0SA 3LSCA 4RDZA 1D9EA 1KM2A 2EG8A 4J5NA 1UC5A 4UTWC 4HNLA 4LVGA 3TA6A 3TW7A 4AAJA 2YXGA 3PN8A 4ADTA 1GJWA 1W91A 3TN6A 2ZKMX 1Q4NX 3URBA 1KFKA 4DI9A 1QT1A 1ONWA 4LVDA 1CGUA 3WBWA 2I16A 3L4WA 1CB2A 1FKXA 1O12A 4CD5A 1W8SA 1TPH1 3DHFA 2PF0A 3L4UA 2JE8A 1I6NA 3FVMA 2ONEA 3MS8A 4XAPA 3CQ0A 5CSYA 4QM1A 1GVFA 4A8IA 3N73A 3F2BA 3THAA 2GLKA 1RQBA 2PSNA 3BURA 5EU9A 5BU9A 2BY1A 3IIZA 3L5MA 1XCXA 4HOZA 2YB1A 5I03A 1G0CA 2OX4A 1ISYA 1EP2A 1VIWA 3BLFA 5IM51 4JTGA 1KXTA 3H6OA 2EJAA 2JF6A 1K70A 3GTXA 3EWWA 3K8MA 1DWIM 4JY9A 4LVBA 1YNPA 3Q65A 3NSXA 2YYUA 1OCNA 4R9OA 2W61A 3S0CA 1I1XA 4GINA 1W5PA 3LSBA 4HHPA 2G3JA 4KRTA 3GHTA 4C1NA 3H22A 4ZENA 2GJPA 4PBEA 1HTIA 4IIFA 2P1FA 4BY3A 1G4PA 3PP7A 1I1WA 4EVZA 2ZVRA 1IXNA 3GDBA 3J7HA 4QEHA 3GVQA 1Z44A 1RY0A 1QI5A 2FTWA 1V3IA 3LCFA 3ARZA 5L9FA 3DU0A 4O0QA 5ABGA 5AYXA 1OFQA 3DHPA 1A50A 1H1YA 4UTJA 4IISA 3WH9A 5A6SA 6XIMA 4LAKA 4YVPA 5CGTA 4XSMA 1Q6RA 5HXMA 5LNSA 3RK8A 2O0TA 4KEZA 2H3BA 1VRXA 4FEZA 3CAVA 1FY6A 5F4XA 1W5QA 2RKXA 1R8LA 4F0MA 3WBXA 1KKOA 3VM7A 4G6CA 4JEQA 7REQA 4EWJA 4WJXA 4CU7A 4M6UA 3W26A 1QMLA 2V5BA 4FXSA 4B4HA 3KS6A 1CXHA 3G1VA 4RL3A 2DW7A 4JTQA 3LHWA 1AW5A 3AMLA 4HN4A 1EJVC 1V79A 4Q8UA 3WY1A 4UTTC 1LQAA 3TU9A 4GZIA 3WK0A 3TTYA 3VC5A 2Q02A 1FCVA 4W89A 2ABAA 3U2CA 4F0SA 3B9DA 5KTLA 3LGDA 5C71A 2YSWA 2Y7GA 3O15A 3UCCA 3FEQA 3AIQA 4QG8A 2QUMA 3UG8A 5FSDC 4GH1A 4W5UA 1FWBC 2G4FA 2DSKA 3W4RA 3NNTA 4NXSA 4PUMA 4Z17A 3W6LA 3KL0A 5HWNA 2ZX9A 1AD4A 2OU4A 2VX4A 2X05A 4M0XA 1XBVA 2QGYA 4PMDA 4I8DA 4TX8A 4DEFA 2E8YA 3IIOA 2Q8LA 1ZL1A 4Z1BA 4C6DA 2OVLA 3CMGA 2ZADA 5BCAA 1DWGM 2XFWA 3WMBA 3OQ8A 5JBEA 1G6CA 1P6WA 1CXFA 2W27A 3VUSA 2IXVA 3S9ZA 1SO6A 3LDVA 1E55A 4XUYA 2Y70A 4C1KA 2XGIA 4NZ4A 2EBNA 4C6JA 5F2IA 2DPEA 4Z42C 3S6DA 3VIKA 4NL1A 4XZ9A 1TIWA 2WJDA 4S3JA 4HTYA 3FOKA 3EA2A 1CTNA 1CI1A 1WBJA 3G1XA 4V33A 1DORA 4FX7A 1EOMA 1HGWA 3LG3A 1H63A 1AQHA 1NARA 4YWIA 3QFWA 4AC7C 4E2DA 1QJWA 2C71A 3R43A 2PDUA 4D6IA 4NYYA 3T0TA 3ONBA 1GJPA 4G56A 1XYBA 2V8ZA 4AZIA 3VK5A 4X63A 2Y5SA 2PLJA 4Z2LA 3DCPA 4HN8A 1TTIA 4UTFA 3KEHA 2IKJA 1J0ZA 3VVGA 3LOTA 3B06A 1TUXA 1H7XA 5AB3A 4EACA 2QAPA 1N55A 4L7ZA 4NZ5A 2Z1VA 4WSJA 4KETA 4PB4A 3IIPA 5E93A 2OEJA 3CPUA 4LUSB 3TVAA 4P2VA 5LHEA 3GTIA 3CGTA 2CKSA 1ZUAX 5HWJA 3IV8A 2FTPA 1UUQA 2PLCA 1MQPA 3VA8A 3C5QA 3II1A 3HFYA 3BSHA 2XVPA 3FLUA 2WW5A 3O6YX 2J78A 3QPYA 4DBEA 1XIEA 1KFCA 1T6MA 3G1SA 3IGUA 1EDTA 4L80A 3E5PA 2WJFA 3R13A 1W3IA 3WLNA 2VDGA 4HPHA 3QYQA 2GPTA 3V5FA 1V02A 4YCPA 4KF1A 2F6XA 3OJGA 3ZT6A 2PE4A 1XD1A 1QDSA 1NAL1 1VBUA 3WD1A 3A9BA 2RUSA 1NQ6A 2HISA 2ZUWA 3D3AA 2G8ZA 2KAUC 1G7UA 2NLYA 1J93A 1JPDX 1QBAA 2UY5A 1JDEA 1JCLA 4DF1A 4ERIA 4LBRA 3EEZA 1UYQA 1OT2A 1L6WA 3CHDA 5B7YA 4NZJA 2OKOA 3HFTA 1O5XA 3TC7A 3GG7A 3G6LA 5HAOA 1OFOA 3T78A 5ECUA 2GJLA 5I3DA 2QCGA 2JGYA 1VIZA 4AIOA 4F0KA 3WLKX 1TV4A 3FNDA 6REQB 2YBTA 1FDYA 4GX9A 2W66A 3ARPA 2VTFA 3SRHA 1S2VA 2OWWA 2AGKA 2PBGA 4KWUA 2GYIA 1Q4WA 3BGAA 1B9BA 1NOUA 2HVNA 1KC7A 3M5YA 3SY8A 1Z7AA 4YS1A 2CLFA 2QPSA 3NGJA 3BOFA 2HXTA 1VBGA 4EE9A 4FS9A 4O14A 3VCNA 3UW6A 5M3WA 1AJZA 3HQOA 1LROA 5FJUA 2OLSA 1KR0A 5HQLA 2QCFA 1R86A 3E0FA 4F2TA 1J0YA 3UR2A 3V18A 1JEZA 5AZ1A 3EBVA 1JUBA 1OD0A 2DFAA 1DV7A 5D9OA 2WSQA 4W84A 2Z6JA 3UXLA 5AHIA 3L4TA 4FIQA 1HJVA 4PR4A 1V3HA 3RN6A 3DEQA 3WQGA 4D6DA 3AYVA 4JKMA 3IJQA 3MHGA 1XCFA 4MIMA 4AIUA 5EA9A 3PTMA 1P6BA 4JNMA 3W7NA 1OFPA 2XH0A 3NG3A 4QJ1A 5AYBA 3LPGA 1H7RA 5TD4A 3CZKA 1GEHA 5L6UA 4F79A 1KLZA 3QLDA 1O7AA 3WF0A 4UTKA 2QCMA 1W6TA 4Q32A 3MDWA 1F05A 3P14A 2BV9A 4HHHA 2VMFA 2VFDA 2Y8VA 1EJXC 4M29A 3WL0A 2OFJA 3THCA 2ZDSA 2VYOA 2VGFA 3WEZA 3PPGA 1F3EA 2F7FA 3CK5A 3I6RA 5DY2A 2FJKA 3BVJA 3KS5A 4TV6A 1Y8BA 3FYPA 4O4VA 5TBOA 3LTPA 3ZJ8A 2BVYA 1UPMB 4I9TA 1OGSA 3GTHA 5IRPA 2XH7A 2YL5A 1FBAA 5IXEA 3W86A 1MI3A 3L12A 2R91A 2ZX8A 1UR8A 2X1IA 4KEUA 3HQ1A 5D2YA 1Q2RA 4NJGA 1C9DA 3LZ5A 2VD8A 2OSWA 1E56A 3V4BA 2E1DA 3OB8A 3EDJA 3U6WA 3JVAA 1QOQA 2FZMA 1B1YA 1XGDA 2E9LA 1IV8A 3W1QA 4AHPA 3C2FA 2IPGA 4BI5A 1B5TA 2ZZ3A 5D2TA 1EP1A 4XSLA 2QHAA 2F61A 2IW0A 4UFHA 2ZXQA 4YHGA 2QW5A 4PSPA 1P1MA 1H61A 3L66A 9CGTA 1FCQA 2GQ3A 1C9WA 3BAWA 4KWVA 3TYEA 1QASA 3MC5A 2EEXA 3CUJA 1YTDA 3MI6A 2JGQA 4FI4A 2TAAA 3U4AA 1HN1A 4HZ7A 3B05A 2UY3A 4AF0A 4UZSA 3PZNA 4AZBA 1TX2A 4LVFA 2WMGA 4L1XA 2IQTA 1JPIA 1PKNA 1H2JA 3PSWA 1R3YA 3W7KA 1N8WA 4WXYA 5A6BA 4Z2GA 3WLLA 3L0NA 2CBUA 4WIWA 4AG0A 5TF0A 4JIHA 3KX6A 1R85A 3DIPA 5LIXX 2XU2A 4MJ4A 3QOMA 3KOWA 4F2BA 2CZ5A 3BE7A 4EPKA 3PHAA 2B7NA 1VBHA 4L6DA 4V28A 3FXGA 4B5XA 5FJTA 4FHAA 4Y90A 3PZVA 3HZ3A 1GKPA 3PFRA 1AZ1A 1Q3NA 3TJLA 1EC9A 3M7WA 5HQEA 4DNMA 2CZDA 3A12A 3MPGA 4UXDA 1J0IA 4AWSA 2WAGA 1US2A 1CXEA 3T40A 3M44A 5LIYX 3RU6A 3POHA 5EBUA 1BG9A 2PDYA 1MQRA 3RCNA 1CIUA 1O6IA 3W25A 3G1RA 3VIFA 3EDDA 3MCMA 4MADA 4RUBA 2RGMA 5MKGA 1DQUA 3HJEA 4RCXA 5BRBA 3M0IA 1E6QM 4IMAA 2IQDA 3W2LA 2RGLA 1W2PA 3LCHA 3PBGA 2OG9A 4CEUC 4DBUA 4H7VA 2Y85A 3AXXA 1FQ0A 2WZHA 2DZBA 3FX4A 4M7TA 3ZJKA 1A5OC 2Z1XA 3VTRA 1MEHA 2PDJA 2W92A 4IGSA 3SCWA 4BK9A 1UKTA 2XGBA 4IP4A 4GY0A 5DBUA 4R7OA 1H11A 4H6QA 2UY4A 2CLKA 4E3VA 1O1ZA 3OGRA 5G4EA 3SSZA 1UOZA 3GE7A 4ZODA 4UFLA 1EWEA 3DECA 1AJ2A 4WY0B 4MLRA 3QRHA 1WV2A 4ES4A 1Q6CA 3E0LA 1ZU8A 3IGXA 3LXBA 2WKGA 1ADDA 1PE1A 4DUWA 3MUAA 1PX4A 2CYGA 5FIPA 4CQDA 1XSIA 5EPDA 4J35A 2V5LA 4DJDA 2YLLA 5I0DA 3BANA 4QNWA 3QHMA 1W3HA 2WVTA 4KMQA 3CHCA 4JAWA 3UZXA 2YW4A 3EWYA 4W85A 1XLGA 2YDRA 5EGRA 3CL8A 5CKSA 2I17A 4GUJA 1G1YA 3LA4A 3ATYA 1MQQA 1AL8A 2TRSA 2ACRA 3AIVA 1FHDA 4DWSA 1QATA 1RA5A 1ESWA 1OFBA 3ZOAA 2E4TA 4DELA 4LANA 3OA3A 1W1A1 2BG5A 1ITQA 2QJNA 2BVDA 4HNUA 4RXFA 3LLFA 3SQSA 1YHTA 5G4WA 4PRRA 3W6MA 1ENUA 3W72A 3T0AA 2V6AA 5CPTA 2NWRA 3TOYA 1RPKA 2Z2UA 1KFWA 3ZLFA 2J7HA 4UOJA 4CNSA 3P74A 3C86A 1IT0A 1A5KC 4E38A 3EGJA 4PGLA 4BWLA 4N02A 2HBVA 1SR9A 4GKTA 1XIFA 3NCOA 3B9EA 5D05A 2IKGA 2G95A 5J5RA 1WYIA 3QGKC 2BHZA 3OIXA 5T9CE 2JEPA 1C3FA 3W7CA 1WE5A 4JFTA 3ABRA 3SCQA 1CXIA 5D4YA 3P7YA 3VCRA 4TU1A 4HJFA 4NY2A 3G1DA 3WNKA 4CN6A 3VD3A 4IOTA 4O8AA 4AVNA 1PO9A 4D2JA 2AQVA 4XZBA 3SQLA 3B97A 4GK8A 2QNEA 3UNTA 3F4WA 1YPIA 5JBFA 4WX2A 3KRZA 2CIPA 3NPXA 4J28A 1OCBA 1Q6QA 1XI3A 3W9ZA 1GTHA 5DMYA 1VBJA 4PB5A 2FLIA 4PSRA 1MUWA 1FH7A 5CSRA 1J2WA 2PP0A 4UQEA 1IF2A 3CL6A 3KOYA 4IFKB 2Y6ZA 4DO6A 2JF7A 3UJEA 1LBFA 1OG0A 4NKCA 3WEOA 1Z8AA 2FHFA 1OG6A 1L0PA 4HZMA 1VCGA 4DLMA 1WKFA 1BVZA 1ML1A 3BOLA 3GR7A 4ADSA 5HPCA 1DJGA 3WEMA 4JL2A 4M5PA 4QJ5B 3TJ4A 3ITTA 4C65A 1AMKA 3LPOA 3BAJA 1OYBA 3WLOA 3OZOA 5I00A 1E1CB 4JQ4A 3GFZA 1MNZA 3RIKA 3E9AA 1EDGA 4E4FA 2PGFA 1OC6A 1J18A 7PTDA 4K3ZA 5JH2A 3B03A 3LCGA 2A2IA 1LG1A 3L65A 1RD5A 2QJIA 1M7OA 1UR0A 5A6LA 4F3HA 2BXYA 1R46A 1GZJA 3BLDA 3EMZA 3GY1A 3PZGA 3DC0A 4UR8A 3WF4A 1AQ0A 2X1RA 3UJRA 1ISZA 1QI3A 4CQ9A 1CGXA 1T5AA 3BICA 3IJ9A 4V15A 1OF6A 4NJIA 3F5LA 1JRBA 1Q8AA 3WCZA 2FPVA 2XG9A 1DWFM 4FMVA 5CAHA 4IG2A 1TJ2A 3CZLA 4FO4A 5E09A 1P48A 1EUAA 1TWDA 1UP2A 1CLVA 3USBA 3FY1A 1V03A 3NL5A 3LS9A 3QMTA 3DC8A 1R7OA 3IJIA 1MUCA 1QPKA 4OT7A 1C7SA 1I45A 3BGGA 4Q4MA 1VYRA 1JF5A 1L6GA 4ZFCA 1BHGA 1U2YA 4YYFA 3WH5A 3PJWA 1NDZA 5C2GA 1XCWA 3ITGA 4K38A 1UP3A 1IHIA 1RVGA 3N17A 5KZDA 5A6AA 3G6MA 4GXPA 4GE8A 2I5QA 2I57A 2POZA 1CXKA 3N25A 3UWUA 1MEIA 2FGLA 5D2XA 4GCAA 3FV9A 1FH9A 1W1VA 3GFXA 2BY0A 4QP0A 3G3MA 1M6JA 4JFSA 4EK7A 4XK2A 3C0LA 3C61A 3NQ2A 4L9ZA 3TN5A 4NASA 3WSUA 4XVEA 2E77A 3WFLA 2IPWA 1VFSA 3ES8A 3Q45A 3MSRA 4MF4A 4UB9A 4GA8A 2XIQA 1Z42A 4PMRA 1W2VA 1UPPA 3IAQA 2QCEA 1F4AA 3R25A 2DZUA 1X38A 2PDIA 4H8HA 1Q6FA 5CBBA 3AUJA 4A8NA 3LQGA 3QGVA 3Q37A 3S2JA 3C8FA 1VFMA 4HU0A 4P8WA 2ZZ4A 2E28A 4FLRA 1DJIA 1JAEA 4ORIA 4YL2A 1V0KA 2DT2A 2QF7A 5BNKA 3THDA 3K13A 4FF7A 2VZVA 1KBKA 4H9MA 3SJ3A 4PN2A 1TWZA 3M0VA 4DPPA 4RDWA 2W63A 1R3VA 4IX0A 1PCKA 3KOZA 4DQWA 3EWCA 2WVUA 1S5NA 4WR3A 1E4MM 4O12A 1W9UA 2Q8XA 2ESCA 1BYAA 2CC0A 2OQYA 1TJRA 4A22A 4O1CA 3M0HA 4R3UA 1C91A 1TVLA 3TA9A 4UIOA 2XN0A 4AMCA 2PB1A 3BOXA 2PPGA 4YIWA 3W37A 3R58A 2D20A 4LXFA 5FJRA 4LPCA 4OFCA 4KCUA 1HX0A 4QEEA 3QY6A 4C6IA 4UCFA 2ZA3A 2ZUVA 2WHLA 3FKKA 3MMDA 1EFZA 1EXPA 1TO3A 3AI0A 4QR6A 3PG9A 1L2UA 1LWHA 2NX1A 1FWWA 3MUIA 4FF5A 2PMQA 3ALFA 2Y8UA 1G5AA 4QBXA 1UWUA 4H9ZA 4IGNA 3NDOA 1MXSA 1D7FA 4W8AA 5D2WA 3ARUA 4Y8FA 1IGWA 2G3FA 2BLEA 4KEMA 2Z26A 2WSRA 1DIOA 4TVUA 3TP4A 4P7QA 1B4KA 1W3JA 3HQNA 2J7DA 3VNLA 2PDNA 2PU0A 1WDPA 2FHBA 3VNYA 2RH9A 5HR7A 2FTYA 1RPXA 2WXDM 2NXGA 3SY5A 4BI7A 4HYWA 1DL3A 3OZYA 3MJYA 2X0SA 2ZWYA 4O11A 4O19A 4LB4A 1V51A 3AO0A 4LCQA 4DJFD 5C70A 4MTVA 2PZ0A 4POCA 3R2GA 3QV8A 3BAKA 2BMBA 1QWGA 1R2TA 2A5HA 1SZGA 3BLIA 3M41A 1A5CA 3QY7A 2PGRA 1WKEA 3HPAA 3LERA 3LHZA 2VOTA 1OX6A 2INEA 4AXKA 5AECA 3M7SA 3K46A 3O05A 3U57A 4DJEC 1EJ7L 1AH4A 2G0WA 1JPKA 3GVRA 3S5ZA 3ZVHB 4HIBA 3HGSA 1WZAA 2HEJA 1IWBA 1VZWA 3DBNA 1VLWA 3A47A 1UWQA 5C55A 3DENA 3U7BA 3WL1A 4GISA 4GO9A 4C1NB 3CIXA 2X09A 2CHRA 2ZE3A 4D72A 1ZNNA 1MSSA 2A1YA 1HL2A 3HB9A 2R24A 4UC5A 1T41A 2J88A 2X30A 2OEKA 2KX9A 4BF7A 5I2UA 3AXIA 1XIIA 2O92A 1FDJA 5IBXC 2E8ZA 3C2VA 2VCCA 2NWSA 4CCZA 1X97A 4DXKA 1QPOA 1K7EA 5E0FA 4D6HA 3ABSA 4OZOA 1NP2A 2HMCA 5GPRA 2P10A 4EXQA 2EPKX 4F40A 1GOOA 4IIHA 3ARTA 1WAWA 3M46A 1UWIA 3FHQA 4GY1A 2XIBA 1G01A 2WHJA 3VD9A 3GR4A 1GTEA 3P6LA 1I2OA 4MFDA 1OWQA 7REQB 3WNLA 1EIBA 4XQ6A 1RY8A 3O1NA 4N6FA 3W22A 3WF3A 3PZMA 5HATA 2F6UA 1XH1A 3WFZA 1HKIA 3A9IA 3FS2A 1P0KA 4MWAD 1RK6A 1RZMA 1DYSA 2CWXA 4CNUA 4ZOBA 1V6UA 5REQA 5HDRA 2J25A 2GFTA 3B8IA 3W7RA 2V81A 3CUHA 2VNCA 1B57A 1T7LA 3SB0A 2JFEX 1JZ4A 3U3HA 1FFRA 3IVTA 5HA7A 4NQ1A 1XLIA 1QU4A 3W7DA 2P3ZA 1A3HA 3DXIA 2JKPA 3NJ3A 1HGYA 3RAOA 3W83A 1HO1A 1B30A 1ZBCA 3RLVA 4R53A 3QBUA 4RNJA 2QJGA 1A80A 4M56A 3ME3A 2QVNA 3LHVA 2ZA2A 1QNQA 3ATZA 2XTKA 4CNOA 1X1ZA 1KFEA 2D2JA 4LUIA 3KTSA 4BZYA 3CWOX 4DN1A 4YTTA 1KM0A 3LLXA 2VEMA 4G7FA 2J7EA 1BFNA 3WN6A 4JIQA 4OHQA 1XYFA 4NZCA 1RV8A 2DUZA 2Q6ZA 3ARVA 1UD4A 1VKFA 1NQKA 4PUNA 2A85A 1AG1O 3GXPA 3SBFA 4BEQA 5LNRA 1XFCA 3U0HA 4HNNA 2CLOA 1LDCA 1WBHA 2YA1A 4IP7A 1CEOA 4GACA 4XAZA 1XH2A 3ABZA 4B5SA 4I5XA 4DM2A 1LUCB 1VHNA 2F8QA 1ZJHA 1W9BM 2C0HA 1XLKA 1UC4A 4PCSA 3W7GA 1WUEA 1HO4A 1E0UA 4B2DA 3BDKA 3UU0A 3SUWA 4NZFA 2QUTA 3I3DA 1VH7A 1EIXA 4EPEC 4J2MA 1V7YA 2WMIB 2QCDB 1F6KA 3H2OA 3GD6A 4W87A 4JD4A 2P8BA 4GQ0A 4NUWA 1M03A 4E5TA 4JEJA 1W9VA 3W24A 4GI9A 3WLRA 3SFKA 5FACA 4Q8OA 3BCFA 4PTDA 1W31A 4JICA 5EFDA 5FJOA 3RJYA 3WF2A 1KM1A 1KRBC 3TQPA 1Q8JA 4AY1A 1H60A 5C9UA 2HTMA 3WX7A 4W93A 1LCOA 3CV7A 1OB0A 3EOSA 1S38A 3MZ2A 1GKQA 3DERA 4H04A 2YKKA 1J12A 4I7WA 3U8GA 4PUKA 3S5OA 1E1FA 2OEMA 4GVFA 4KCWA 1KKRA 5LKYA 4C6PA 4H1ZA 4PCPA 1XKJA 4DUXA 2A3EA 3TKFA 3N2MA 3VDAA 3E0VA 2VZOA 1XQLA 2NV2A 2DU2A 3VILA 2O7SA 1AH0A 2CITA 4QITA 2FZBA 4Q4KA 4WCJA 3S83A 4C7FA 4J3XA 4C5ZA 3GNRA 1TJ1A 4JFVA 2J8TA 3S5YA 2P53A 3GXMA 3BSMA 4WJEA 3H7UA 5HNTA 3QMRA 1KTCA 1R3RA 3W1MA 3CASA 1BF2A 4C6OA 3MA8A 2YCKX 4NAEB 2PWHA 1OABA 1PV8A 3EB4A 4ROPA 3BJFA 3IJDA 2D0GA 2DT1A 1I2QA 1C8YA 2WQDA 4XAYA 3AU6A 7A3HA 4AW7A 3EZ4A 3OU8A 3R0KA 3PUGA 3GC2A 4MUZA 4XIMA 3PBMA 3VNMA 2MANA 3GM8A 1ZS2A 3NQEA 3K1DA 1PZ0A 3R8GA 4UUIA 4UR9A 4UTUA 1YEYA 3ZM8A 3BL3A 3N4FA 3RX4A 1SFJA 2ZYFA 1KFBA 4S3DA 5AZ0A 7ENLA 3GS6A 5DMNA 1GVYA 2Q71A 1ISWA 3MTWA 4R7JA 4D6CA 3LCIA 1V6WA 4PTNA 3PUOA 2OO0A 1L6SA 3MV11 5A8PA 4NHVA 5C7HA 1W3TA 2HXUA 3HPFA 1KXHA 4A3QA 1AD1A 1E0TA 1H0GA 3G18A 3S1XA 3UR8A 3VKKA 2PGEA 4RE2A 1B4EA 3SN1A 2GQ9A 1PL9A 2YXXA 1IGSA 3T09A 2BBFA 3MB9A 1CXLA 3U2ZA 4GYPC 2J8FA 1VC4A 1DIDA 2WHMA 3SCSA 3RRAA 4O15A 1C8QA 5MF5A 1H7NA 3PANA 2BHYA 1WDWA 3UPMA 4WDXA 5CCZA 2OZTA 4B4FA 4I6VA 3NO3A 2E9BA 3UY8A 3CNYA 4ASTA 1TWWA 1ZPTA 3M0LA 2CEQA 2WWDA 2RJGA 4YN5A 5CC3A 2GVJA 3VKAA 3UR5A 2CCRA 4GOAA 3OVPA 1HZYA 1WPCA 2J13A 4Y96A 3IK2A 5BYWA 5CJNA 5KMYA 4ENLA 5TIMA 1UR4A 1AUSL 3CM4A 2ATSA 1BTCA 2GGGA 1KTNA 1FCBA 3VXGA 2J7CA 8A3HA 1KXQA 1JDAA 2W79A 4N6EA 3ZYZA 1QUMA 4LY8A 2HRWA 4ATWA 1J11A 1OQFA 3KCJA 1TTPA 5M1TA