3W2MA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-183
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-183.
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2mA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2mA01
3VCRA 4TMBA 3GDKA 3FIGA 3PSVA 5DXXA 3M5ZA 2Z1BA 2FIQA 1ZALA 3EX4A 5K4ZA 3E9AA 4LS0A 5U7SA 3DH7A 1JCXA 2YSWA 3LBCA 1K8YA 3DFOA 3RLVA 4E2DA 2BXVA 3MI2A 2J6XA 3TFCA 4XTDA 1QR7A 1JCLA 3ABOA 1TO3A 1OK6A 4JN6A 3CEPA 1GG1A 4JXCA 2ATMA 3LCXA 3IGXA 4GUGA 1RZMA 4AHPA 4IXXA 2ISVA 1PL9A 2QCMA 4NJKA 3VE9A 3C2VA 3W85A 3NPXA 1DQXA 3W7KA 3W84A 1GEQA 2NXGA 3DKLA 3CEUA 5EYWA 3G24A 5I3HA 3TH6A 3TU9A 3W1AA 4CQAA 2CLFA 2VFHA 2Y7DA 4CCDA 1W5OA 1OG0A 1LROA 3PM6A 3MI3A 5FF7A 2O7SA 4UMBA 2CLMA 1TPUA 1I45A 1UUOA 2WPBA 3NYZA 1XBZA 3SGUA 4TR9A 5BW6A 1TRIA 3W70A 3R13A 1GOXA 5FEWA 1JQXA 1HFBA 3R8RA 4EWND 4N9EA 3M41A 4GXMA 3B04A 4HPJA 1EWEA 3MMTA 3N2MA 5DXYA 4I7UA 1KM1A 4HNVA 2CLIA 1YTKA 1LCOA 2G97A 3L21A 4WOZA 3LHTA 2EKCA 2QCHA 3EWZA 4NJGA 3W6YA 1I2NA 4O57A 4Y96A 3LLFA 4QM1A 1KFBA 5F1UA 4YXGA 2GQAA 5CPNA 3A5FA 3BVJA 1WBHA 2B7OA 3T44A 2A6LA 4ZMGA 1P1XA 1G7VA 3EWYA 3FYOA 4LVFA 3M7WA 2ZBTA 1E51A 2ISSA 3RLUA 1OFRA 5TQLA 1KFCA 1K8XA 1OYAA 3G1HA 1TQJA 1JUEA 1KM4A 2X30A 3BARA 3DFPA 2XN2A 3W83A 3W7DA 1Y0EA 2C14A 4N9BA 2YPIA 3BG3A 3NQFA 1G4PA 3S1XA 3W1LA 3CPRA 2QCFA 4Z1CA 3IEBA 2YYUA 1LBLA 2A1YA 3KVJA 4YL2A 1S3HA 1ZNNA 3UWUA 1MEWA 1DJNA 3EB2A 3PB0A 1TTIA 3NPWA 1OVDA 3LHWA 2A4AA 3MBFA 3C56A 1O4UA 1OF6A 4FX8A 2QEZA 5IM51 1BWKA 1AMKA 4YLWA 1H1ZA 2QDGA 3IVTA 4O54A 5AHNA 3N14A 1U83A 1LLZA 4JY9A 4PODA 2RFGA 3PBWA 5D30A 2BSLA 2BTMA 1GWJA 4DBEA 4U4MA 4UTLA 3NQ7A 4XBKA 4LT9A 4NU7A 1DBTA 3HPXA 3FKRA 1C29A 3DXIA 2Y6ZA 4OT7A 3HG3A 1X8FA 4IPIA 1VQTA 3W1UA 5EBUA 5C6MA 1K7FA 5EA9A 4MY9A 2EHHA 3LDVA 5DLCA 3WJZA 4N2YA 4O1BA 1TRDA 2WSYA 2Y88A 4IPJA 3NG3A 5K9CA 2HSAA 5HR7A 3QW4B 3QSTA 3WK0A 3Q2DA 1OX4A 2E09A 3W23A 2NWRA 3ATZA 1TIMA 3LB0A 3C6CA 1FWRA 4KFNA 4NVTA 1N55A 4WUIA 5DCBA 1O5KA 3BGJA 4GFSA 4XQ6A 4AHQA 3DENA 2NLIA 1YDOA 4ZQRA 4DPQA 1KFEA 2OT1A 2Z6IA 5L6UA 2E5DA 2P10A 3P8IA 3TR2A 4NXSA 4UTWA 2OMAA 1H7XA 5DN1A 5EL1A 5LNSA 5CZ0A 3UWWA 1EWDA 4K8EA 1X6UA 3BO9A 7TIMA 3S0CA 4DO4A 1KFJA 1H5YA 3TUUA 2ZA1A 3TJXA 4WQ6A 2OJPA 5DY3A 3FOKA 4NJHA 4IWWA 1LRNA 4PL2A 1D9EA 3PC0A 4X3ZA 4ZQOA 2A7RA 5D02A 2JGQA 5CZJA 2NZLA 2ZFAA 3UXDA 4WY0B 1VH7A 1C8VA 3PG9A 4RZ4A 1X7FA 4EOUA 2A5HA 2JKEA 2HMCA 3GAYA 3LXBA 3STEA 3WK3A 1NF7A 4JY8A 1WYIA 2C18A 3LBMA 5HWMA 3TQKA 1KFLA 4M6PA 3NR0A 4KKXA 5AHLA 2NX3A 5F4SA 3LRLA 3CQ0A 5AN7A 1RD5A 4J9JA 1W5PA 4Q33A 3Q58A 3I7RA 1XUZA 3CU2A 4HIBA 2YGYA 3EXSA 3NL6A 2VFGA 4DBDA 4KWVA 1H7WA 1VHCA 2NUWA 2HS8A 1OFOA 1I2OA 2C1HA 3H54A 1JJKA 4LWWA 1WAUA 4JTKA 4IMFA 4O17A 5CSRA 2Z2UA 5A5WA 3GX9A 2QUVA 2TPSA 1IXPA 1RQEA 3JR2A 3KHJA 4HNTA 4K8HA 3TROA 3GK0A 1VRDA 3UWQA 2W0UA 5DCDA 4MZYA 3LHZA 1GQNA 4K7VA 3NOEA 4JTGA 1OFPA 3CWOX 1FWNA 3THAA 2A7NA 4PC8A 1B4KA 1QMLA 3CIWA 4Z0SA 4L4MA 4AH7A 4MUZA 1FCVA 1VYRA 1H62A 2DU2A 3EWXA 3NPVA 4K36A 4U28A 4RZ6A 2DZWA 3W2NA 1B4EA 1SO6A 3G22A 5AHEA 3NL2A 5KSWA 3HB9A 5AC6A 1AW5A 5TIMA 4AF0A 3TK7A 2C16A 1K7EA 3L0KA 4TIMA 1OABA 3LTYA 4ZQNA 4UTWC 3LRMA 1QCWA 1QPQA 1H50A 4ML9A 5LSMA 3R89A 1RVGA 5LNUA 1IIGA 1SPQA 3QQ1A 3EKZA 1JR1A 2A7PA 2E5CA 3CM4A 1LORA 4I7WA 4P61A 4Y8FA 3TIMA 2CFFA 1BEUA 3H55A 2G5WA 2V2CA 4RZ5A 2DZTA 1M7PA 1XCFA 3C2EA 5AHFA 5BMWA 4JTSA 1OFDA 3ANYA 1Q6QA 3BK0A 3GDMA 3PS7A 3QYQA 3MWAA 5I3KA 5I3GA 2FB3A 1HTIA 5HNRA 3P74A 1H1YA 3U2OA 1MO0A 4UTJA 4BFAA 4PFMA 4UCGA 5I3FA 3R12A 2VEPA 5J5DA 2VELA 5ABTA 2GOUA 4NQ1A 1SSGA 4OU1A 3G0UA 3UNDA 3KFTA 4NZJA 3E49A 5KTLA 3QM3A 3LCFA 3G1FA 1R2SA 5F2MA 1N8FA 2QCGA 5K4XA 4QITA 1XBXA 3LCGA 3MO7A 1VYSX 3G1AA 3L2IA 4N4PA 4IQLA 4PEKA 5HWJA 4LVAA 1S5VA 4C1LA 3KX6A 4E0CA 1YPFA 2CLEA 4XKYB 4DXVA 4PTNA 3ABQA 2GPTA 1YXDA 3NAVA 4M6VA 3MJYA 3W86A 1W5QA 2X1TA 4O4VA 1C9DA 1QO2A 4PCFA 3G0XA 3PUEA 4JX4A 3IIOA 4LC6A 3GXPA 1JUBA 3T4CA 2H8XA 4IGHA 1QOQA 2FTPA 2WV8A 4UTKA 4A22A 2ATSA 5FI8A 2B7QA 4JTIA 1TQXA 3M47A 3SFKA 4ZZ9A 3TFXA 1GZGA 4IMDA 3NQEA 3PF3A 4WZHA 2FPYA 4O0ZA 1H51A 5KZEA 4ORMA 1JCNA 4X22A 4E2BA 5K7JA 1D3HA 1JUKA 5AC8A 1IGSA 5EPDA 1I2RA 1OFAA 1FCBA 3O05A 3GKFA 1SO4A 3L0GA 3MW7A 2ZA2A 1FXQA 4JTHA 3TW7A 2O7QA 2YW4A 1LRQA 3KRSA 2R8WA 4IMCA 1QWGA 2QUUA 3ZS4A 3NO5A 3DI0A 1RV8A 3EX3A 1GVOA 3RMJA 4A21A 4LRSA 1D3GA 5EMUA 3IRDA 2AGKA 2C13A 3O6CA 1QO5A 2PE4A 3S5ZA 3H53A 3PBUA 1JRCA 2UV8G 1W5MA 3MYPA 3W72A 2C19A 2GUUA 1A50A 4L4LA 1YXYA 2ZA3A 1Q6LA 3DFSA 1KM3A 4N4QA 3KRUA 1TPC1 2QJGA 3LXAA 4XUGA 1TPVA 2VKZG 4POCA 1KV8A 5D38A 3W3OA 3G1SA 5J5RA 3GVGA 3UY7A 1GJPA 1W3IA 2B0MA 3MUXA 4BR1A 1B9BA 3EWUA 5KZMA 4PL1A 2RKXA 2V30A 3CC1A 1FBAA 1I8JA 4W9TA 3T78A 1WA3A 3HPSA 5K3VA 5D2WA 4AWTA 4JR5A 1Q6RA 5CKSA 1TJPA 5D2YA 4TX9A 2R94A 1UASA 3IIXA 1R2TA 3INPA 3O06A 2OX1A 3MBDA 3D0CA 1EA0A 2TSYA 5G4WA 1KA9F 2CZEA 2QAFA 4NXKA 3UZJA 1WBJA 2J88A 5F2GA 4R33A 2H90A 4YWIA 3WJWA 4RJEA 2BLEA 3W1QA 3P8JA 4AXKA 3DKJA 4MFEA 4GUJA 3TXVA 3UWYA 3NQMA 1G67A 4LS1A 1ICSA 4O50A 2V5LA 3TC6A 3NM3A 1SQ7A 3W7JA 1K02A 1TREA 3RF9A 5H91A 1UCWA 3C0JA 4ALDA 4BF9A 4H3DA 1W56A 4O18A 4RXFA 4K39A 3W1PA 3CHVA 3STFA 6TIMA 1FCUA 1X1OA 4AWSA 3K30A 4GE8A 4B5NA 1K3UA 3NL5A 3FYPA 5AHMA 1K8ZA 1KM2A 2PCQA 2P0OA 4TU1A 1I2QA 4ZL1A 4ADSA 3W75A 2GVGA 2Q3RA 4M6QA 2ZZ1A 1RQHA 4K7YA 4MPQA 5FF4A 3FJLA 1JRBA 1A5CA 3C2RA 1VGAA 5HMSA 3M16A 1KTBA 4UMCA 1YXCA 1JCYA 1P0KA 2CLLA 4DEFA 4UNKA 1QFEA 2VFFA 5G1YA 3NQCA 2NUYA 2R14A 3DZ1A 5AYXA 1EB3A 4FHAA 4FIQA 4NZFA 5D37A 3N73A 1UJPA 3LX9A 4MZ8A 4QISA 5F2LA 3L5LA 2FPTA 3W7LA 4FXSA 4XZ9A 2NX1A 2E77A 5E0KA 2J24A 3TAOA 4O16A 4O0KA 5FF3A 4FX6M 3SZ8A 3L5AA 1S5WA 4FXRA 4ORIA 5EY5A 1TPH1 3BLIA 4OQVA 3C3NA 2WQPA 4XWUA 3KVLA 3E02A 5FEZA 3GNDA 3GDRA 5G2HA 3HGSA 3E0IA 3GYEA 4OV4A 3A21A 2E6YA 1OFQA 3GAKA 4PH6A 4YCOA 4YMZA 3QH2A 4JICA 1SFJA 2VEKA 1W37A 1PVNA 4QJ1A 3W9ZA 4Z0JA 3QMTA 1ZENA 1W1ZA 1BKSA 5E1QA 3O15A 1M6JA 1YPIA 2BX7A 3SSJA 1OF8A 5AHIA 4MIMA 4Y6GA 2ZZ5A 3W7RA 4JX5A 3JS3A 3HQ1A 1IIHA 3B4UA 3DHFA 1KM6A 2ZZ7A 2V2DA 4LVBA 3UY8A 3EKLA 1AK5A 1KM0A 3N2XA 1H7NA 3NEVA 3ZWSA 1PS9A 4DO5A 3UQNA 3EEGA 1F6PA 4RV8A 2ABBA 4DF2A 4R53A 2ZZ3A 1YLVA 1XDLA 1OK4A 5T26A 4XBSA 1Q3NA 2Y62A 1W54A 2C0AA 3V1PA 3UPBA 1W8SA 1NEYA 3RFAA 5BNKA 3KRZA 5HULA 3QMRA 3LV6A 3FEMA 3DFQA 5AB3A 2HTMA 4JD4A 2DZXA 3W76A 3FFSA 5DBUA 3GKAA 3EX2A 1F76A 4LTSA 2ZCGA 3W7OA 2Y70A 1B3OA 3CB8A 4GWEA 4UFMA 5G2WA 3B03A 4S2BA 3PWAA 5MHBA 3R2GA 3A22A 5KINA 2F84A 3HIJA 4O15A 1KW1A 1PHWA 1IXNA 2CLHA 4HKPA 5LNRA 3Q94A 3LCIA 1A53A 1SW3A 4NJJA 3W7PA 3GZ3A 4JIPA 4LC8A 2H3DA 4H6KA 3N3MA 4JYFA 4RXGA 2OT0A 4O12A 1Z44A 4RX0A 4CQ8A 4FEZA 2GJLA 1OX6A 4JIQA 4NX5A 3PY2A 1SUXA 4CLMA 4BI7A 3G8EA 1GVSA 4IXHA 2V5BA 3S1WA 1SW0A 4OWGA 3M5XA 2YXGA 3S8HA 3A5VA 1I2PA 2ALDA 1KM5A 4BWLA 2P1FA 5F2IA 5FEPA 3OHIA 3BG9A 4TMCA 1ME8A 2JKAA 4EIVA 1VHNA 4GNJA 3O6YX 1VCVA 4QSHA 5D09A 1CI1A 3I68A 1ICPA 1B57A 3PVFA 2H3BA 1ZFJA 3V75A 3PBVA 4ICNA 3MP5A 5IBXC 1LDCA 4M7SA 2Z0IA 1DKWA 1AL8A 5HQEA 3W7CA 3GR7A 2J27A 3BW4A 3ZR4A 4DPPA 4UFLA 1LLWA 3I65A 2XN0A 3TX9A 1LZOA 4ZVJA 3IIZA 4NNBA 3G3MA 4JEQA 5LKYA 2DJXA 3GXNA 3W2MA 2QCNA 4GUHA 4ADUA 4P2VA 2LLEA 3F4NA 3TC7A 2CZFA 3L66A 1PCKA 2E6DA 1TTJA 1ZY9A 2BZNA 3CIXA 2WNZA 3M0ZA 3FKKA 1TTQA 3NQDA 2QUTA 4QQ3A 5LHEA 3KVKA 4HNUA 1FCQA 1A5AA 4JS3A 1QPOA 3HG2A 4LUIA 5SWUA 3NQAA 2RDUA 3NZ1A 2V82A 2NXIA 3N9SA 4FX7A 2AQWA 2G96A 4O1CA 2FLIA 1UBSA 2QJHA 1T8XA 3L0NA 1NVMA 1TV5A 3NQ2A 2A85A 1VC4A 1L6SA 1HO1A 1F73A 2CW6A 3PG8A 1SU5A 1GYLA 1XI3A 4AF0B 2RDTA 4R7JA 3M6YA 1Z41A 2QF7A 4GC4A 3LHYA 1K7XA 3IGSA 5DELA 1QPRA 3LHVA 3O16A 3W71A 1VLWA 2E5BA 2YCEA 3LI1A 4ONVA 3C2OA 2WKJA 2Q3OA 4M19A 2QCDB 2Y7GA 4N6EA 3P62A 3W2UA 1MXSA 1WXJA 5FF2A 4N6FA 4UTTA 4BI5A 1G7UA 3S5NA 4A3UA 3L65A 3SGZA 3VNDA 4CNPA 3OVPA 2NV2A 4GUIA 5BMXA 3HG4A 3LXCA 5G5IA 4UXDA 2X16A 4EVZA 1WOAA 2HS6A 1ZAJA 3DBPA 1DOSA 1H60A 1LTDA 1VJIA 2W6RA 3SI9A 1A5BA 4YCPA 2PURA 4FB7A 1F5ZA 4FNQA 2EAWA 3IIVA 3M9YA 3IIPA 5DBTA 1TPEA 3TSDA 1ZCOA 3BW2A 3S1UA 3DGRA 1FQ0A 4I9AA 4UTUA 5FF0A 4LVDA 1SSDA 4HSNA 1F6KA 3W7EA 1VS1A 4GBUA 5F1VA 4IX0A 3F4WA 3A23A 4AWUA 1RPXA 1FWSA 2EPHA 4RCXA 1QDSA 3NDOA 5CG7A 2PRHA 4ZQCA 3W1NA 5AC7A 3W2LA 4IJBA 3ATYA 5F4WA 2V2HA 1W3TA 3S5YA 1NF0A 3TQ0A 2Q8ZA 2JKPA 1R46A 3QMSA 2PRMA 1DORA 4S2CA 2OZ0A 3NQ6A 1HO4A 4FO4A 1VYPX 3C8FA 3TDFA 1Q45A 2Y85A 3KAOA 4KFOA 3NXFA 2V0TA 3NA8A 1XBYA 1GT8A 1GVFA 4O11A 5CZSA 3UD6A 5EKYA 5AYZA 3TXZA 4JTUA 3LV5A 3BW3A 4OHQA 5A8GA 3QJAA 4UUIA 3LCHA 1T0OA 3GLCA 5I3IA 1J5TA 3W07A 3WJSA 3W1TA 2Q8LA 4Z1AA 3OIXA 2WOQA 3KXQA 1FUYA 3M43A 4O1AA 5AFDA 6ALDA 1ZHAA 2ZZ6A 2I1OA 3JRKA 2NXHA 2Y63A 2YFNA 1FDYA 2A2IA 3GXTA 3MYOA 2A6NA 3HGOA 1QNVA 2B7PA 4JYEA 3WJYA 2E6AA 1EP3A 3G1DA 3DFTA 1LOSA 4FNSA 3WK1A 3MHFA 4LV9A 1YADA 3U6WA 1OFEA 3W1RA 4UTTC 4G1KA 1WV2A 5CPMA 4AAJA 3NPUA 4JTLA 1QOPA 3TJLA 3TSBA 4LNYA 2QCCA 3W7HA 3S6DA 3ZWTA 1ONRA 3EX6A 3G1YA 2ZRWA 1V5XA 2C15A 4JTTA 4N9DA 5K9XA 3LTPA 4HPXA 3W87A 2QJIA 3TCEA 4JDBA 3NM1A 4WY0A 3QFEA 4EF8A 1MEIA 4H4IA 2E6FA 1W5NA 5D2TA 3SY5A 1PIIA 4QAIA 3HF3A 4O4WA 1KFKA 4Q32A 5E93A 1BTMA 4N9CA 1VCGA 1T96A 1NSJA 2ZYFA 1LRTA 1ML1A 2GJNA 3MHGA 1YDVA 2OCZA 2R91A 1FWTA 3C52A 4Z08A 3QQ0A 1YYAA 3DAQA 3G0SA 1XDMA 3TQVA 4LVGA 3N9RA 2QR6A 4LU0A 2ISWA 2VXNA 3N34A 1SW7A 5F4XA 3BV4A 5AYYA 4PA8A 4MJZA 1PCWA 3LOTA 5C55A 4A2RA 4HSOA 3TMLA 4WJEA 3PBYA 1NFBA 1F7BA 5LGXA 4D2JA 4S1FA 1VZWA 2VEMA 3L9CA 3SIZA 3B0PA 3THQA 1HL2A 4O14A 1XBVA 3I6RA 3P5YA 3HG5A 1DJQA 4HNNA 4UR7A 2V9DA 1O94A 4R34A 1JULA 1JQVA 4I7VA 3GR8A 3EXTA 3USBA 3TA6A 3NQGA 2WNNA 3LHUA 4K6AA 4FNRA 3PAJA 1J2WA 4Q4KA 4RLIA 2X1SA 4O52A 1DV7A 4JGDA 3B0VC 1XM3A 1W0MA 5HR6A 3SECA 3A9IA 4FNPA 3W73A 3HMJG 1YTDA 4ADTA 2X1UA 4KFPA 3OBKA 5KZDA 2VOMA 3B8DA 4ZQPA 1R30A 3DI1A 3W7NA 3B05A 1JVNA 4Z1DA 4CNNA 2DZVA 4QNEA 4MZ1A 3P84A 3QF0A 3FLUA 2ZZ2A 1ZJIA 4K37A 1ME7A 4BK9A 1GYNA 2CWNA 4CCCA 1SR9A 4O19A 1XUUA 1H63A 3L67A 4A29A 1F74A 3W2KA 1ME9A 5TBOA 3CWNA 3EXRA 4MJMA 1KLZA 3R5EA 1TV7A 1TPFA 5G4EA 1G69A 2QKFA 2XN1A 3P5ZA 4NNCA 1OYCA 3EX1A 1H7RA 5BOOA 5GVJA 3W7QA 2A21A 3M5VA 3GDLA 4NJIA 5D33A 1H61A 1OYBA 4IX2A 3F03K 2WSQA 5CGQA 5HUOA 2H8ZA 4JNMA 4LW7A 4UFIA 3G18A 1RR2A 1P5BA 1VCFA 1EUNA 3G3DA 1OX5A 1MZHA 1TV8A 3QW3A 4AB4A 2D73A 4GUFA 3PUOA 2V8ZA 3RU6A 3C4UA 4JYDA 3LI0A 2DP3A 3WJXA 1ICQA 3W7IA 2Y89A 4HHPA 4WXYA 2I14A 2DZSA 3G8RA 1GTEA 3UWVA 3G1XA 2DZUA 1FDZA 2X2GA 3F1QA 1SZNA 1IXOA 1Z48A 3P80A 5DY2A 1SZGA 2CU0A 3GB6A 1L9WA 4RR4A 3W1MA 4UNLA 3FA5A 4Z1BA 4XKYA 2E1DA 1DVJA 1O5XA 5BRBA 2YR1A 3VKJA 3P81A 4MY1A 4NNAA 4RKAA 4UTHA 2AAMA 1F2JA 3BPWA 1TMHA 2G95A 2DJLA 1YDNA 3HJZA 5U4NA 1OJXA 2X1RA 2WO5A 3UYCA 1MEHA 3HGRA 1OX4B 3ZFHA 1QPNA 3TAKA 1KTNA 5CZTA 5LZLA 4LV4A 4OE7A 3OA3A 1YTEA 4HN4A 1CW2A 3G1VA 5AOUA 2FQIA 4N02A 2RHGA 5IBXA 3PUDA 1PHQA 1TTPA 3UWZA 8TIMA 1UB3A 3VI2A 3MHUA 1FY6A 2C6QA 4WXZA 3C61A 3A24A 1RQBA 4TO8A 1CX9A 2DZPA 3QRHA 4DO6A 3SW6A 1FXPA 2I9EA 1WDWA 3I7QA 4AHOA 1R47A 3NNTA 1WX0A 3QZEA 4BWLC 3E96A 1PE1A 1VR6A 4OGZA 1W3NA 3ABRA 3HO8A 4K38A 3LM7A 4MYAA 2DORA 3W74A 5HWNA 1L6YA 2PRLA 1TPDA 5D03A 2YDAA 2B7NA 1KBIA 2VFIA 3CT7A 1GTHA 2ZDRA 3Q37A 4AMAA 1FX6A 2VFEA 2ABAA 5LGZA 1ZAHA 3MP4A 4RK8A 3P7YA 2JGYA 3S5OA 4OV9A 3LGEA 3LTSA 1DQWA 2TYSA 3M1ZA 2QCDA 4GJ1A 5D32A 1TCDA 4MOZA 4IOTA 1IXQA 3P60A 1XC4A 2ZTKA 5D2VA 1GG0A 2VC6A 1EPXA 1QAPA 3EWWA 2GVJA 4MLRA 5D2XA 2QDHA 3W88A 1LBFA 2NV1A 2YX0A 3NZRA 5D05A 3S9YA 4LOCA 2TMDA 5KMYA 3HPZA 5LNWA 2FJKA 3LCWA 4FIRA 2J9YA 1UUMA 3QC3A 1AG1O 1Q6OA 1G4SA 3B0UX 2CLKA 2WJZA 1JCMP 3HOJA 4WD0A 2Y7FA 4O13A 1SFLA 1GVQA 4IMEA 5G1TA 4CQ9A 3TE9A 3DU0A 3P61A 1VLIA 3E12A 4LY8A 1TB3A 2GQ8A 3UXAA 4AVFA 3AO0A 5H2ZA 3TKFA 1GPWA 1MSSA 2YFOA 3OVQA 1O60A 3SR7A 1SZFA 1EUAA 3QPYA 4QNWA 1AL7A 1G4TA 5D04C 3BG5A 2PC4A 2YW3A 5LNVA 4OBTA 1JCJA 1P4CA 4UFKA 3GDTA 1J4EA 4DQWA 5L9FA 3T40A 4JTEA 1LBMA 3LLDA 4HT3A 4GRSA 2J9XA 2J9ZA 3WK2A 1ZAIA 2ZRUA 3UZ5A 2NUXA 4KWWA 3W7MA 4MY8A 1KBJA 3S42A 2ZTJA 4LS2A 2E68A 3OVRA 4UC5A 4UFHA 1ALDA 1H7OA 1LM1A 3M44A 2C3ZA 2RH9A 2YZRA 1HG3A 1IF2A 3QPZA 1Z42A 1M7OA 4UIOA 1XFBA 1BWLA 1FWWA 4MLJA 1EP2A 4FNUA 4M5PA 1M5WA 2FDSA 1N7KA 1OHLA 3PULA 3BLFA 4O10A 1WOBA 4E38A 2VEIA 2NWSA 3WFAA 2YYTA 4CCEA 4BI6A 3IVSA 1AW1A 5I3JA 2GQ9A 1K03A 4UFJA 3MP3A 2ZRZA 1G6CA 4JTJA 4WOQA 4DELA 4QIUA 3L68A 3STGA 3OG3A 5FESA 1H7PA 1EEPA 4UR8A 3S1VA 3U8GA 4X2RA 4NUWA 2FPVA 3NL3A 2CZDA 3O07A 4O28A 3T7VA 4Y9AA 3O6DA 3ELFA 3TV8A 3VFLA 2ZQ0A 2QCEA 2CZ5A 1R2RA 3GNNA 2ZRYA 2B4GA 3ABSA 5CPLA 3SJ3A 2CLOA 4O1DA 5G2IA 1HUVA 3UPWA 2V81A 3IVUA 3FS2A 2WSRA 3GIYA 4NX0A 1EP1A 3BLEA 2GVLA 2Y7EA 4FF7A 3TSMA 1KTCA 2H6RA 1DL3A 3P67A 4ZQMA 4A2SA 1TPB1 3B06A 3DFNA 1S5TA 4LUJA 4IMGA 5HUPA 1OFBA 3CTLA 2NX9A 3RK8A 3STCA 3KVMA 3HBLA 1XL9A 5KITA 4XTIA 3W2JA 1A5SA 1XXXA 1PV8A 3PB2A 1LYXA 3IGUA 3DHDA 1LOQA 3QSRA 4WY0F 1EIXA 4UMAA 4O53A 1P0NA 3TMQA 3NQVA 5K9DA 1F05A 3BGGA 3HGJA 3O63A 2QCLA 1W31A 2W79A 4FNTA 3MI6A 1SZEA 1TPWA 3T55A 2EGZA 5HJLA 2VENA 1V7YA 1KLYA 1THFD 2QAPA 2JK2A 3LRKA 1LOLA 2TRSA 3L5MA 3TNOA 4AEOA 4JX6A 5DCEA 2XFWA 1G4EA 2VFDA 1ADOA 4UTMA 3EWBX 5C5YA 1KV5A 1SO5A 1TYGA 4JTFA 4MFDA 1I4NA 2WNQA 1WQ5A 3O1NA 3LERA 2Y61A 3NQ8A 3NVTA 5C2XA 3TW6A 4MKNA 4NT0A 3I7SA 3IV3A 1T99A 2Z6JA 1XKYA 3VE7A 2FFCA 4LRTA 1L2UA 3O8AA 5LHFA 3RNDA 4O8RA 5HINA 4DF1A 1LP6A 4MVAA 4EF9A 4IUOA 2ZRVA 4X9SA 1VPXA 3AJXA 2KZHA 1TSIA 2ZZ4A 1FDJA 2EF9A 2RDWA 4M7TA 3KOFA 4JDYA 3LCLA 1EX5A 3W7GA 5CPOA 5FEXA 3P82A 5K2ZA 1AW2A 2ZRXA 1O95A 1SO3A 3OEXA 4DF0A 1NAL1 3NGJA 1X1ZA 2FB2A 3CLMA 3W22A 2BWGA 3C2FA 4CNOA 3PSWA 5CSSA 4C1KA 1TJRA 3FJ6A 2IQTA 2F7FA 4UTIA 3QEZA 4Y90A 1L6WA 2A0NA 4WX2A 1U5JA 3W1XA 2JBMA 3M5YA 3N19B 1DHPA 4MYXA 3YPIA 1GVRA 3PR2A 5C54A
chains in the Genus database with same CATH superfamily
3VCRA 3GDKA 4MF4A 2O9RA 1WDQA 4MNLA 3E9AA 5U7SA 2EPLX 3DH7A 2FZ9A 4XO6A 3UJFA 3WLRA 3LA4A 4QG8A 3SDOA 1H5VA 2OPJA 1OCBA 2XH0A 4MDOA 4ZE4A 3MI2A 2J6XA 3WELA 4XTDA 1GW9A 3WH9A 3WQWA 4A3QA 1F8MA 3VOFA 5A3HA 4OECA 1CGTA 1RZMA 4Z42C 3WMLA 2YJQA 4IXXA 5A1AA 1XLIA 3BZGA 3P2VA 4H00A 2BHZA 2XSXA 1DQXA 4O1FA 3W7KA 3TNBA 3DKLA 1SGJA 3TU9A 3DHPA 3W1AA 1MDLA 1W5OA 1E4IA 3KLLA 3OLGA 3M4HA 1LROA 3MSRA 5B80A 2X0HA 3AHXA 4TX8A 1XSIA 1WZMA 4Q4SA 1A4LA 1PTDA 1X97A 1XBZA 3CNYA 3W70A 1I1XA 3S83A 4H8NA 4HP5A 4DJDC 2XPKA 4EWND 3RX4A 1EWEA 3AALA 1UMYA 3N2MA 4RDVA 3EWCA 1U2YA 4ZXOA 1ITCA 3L21A 3VDGA 5EFFA 4OIFA 3EWZA 4NJGA 4O57A 2VX5A 3LLFA 5F1UA 2G41A 2CESA 2OYKA 3GFXA 3BVJA 5ABHA 3T44A 2A6LA 4RE2A 1P1XA 1JF6A 3EWYA 3UJ2A 4IF2A 2WLZA 5TQLA 3FHQA 1DJXA 3G1HA 1OC5A 3M0KA 4BQ3A 1GK8A 4BQ5A 1WUFA 2X30A 1QNQA 4XZLX 3MVIA 3W7DA 1M65A 4N9BA 2YPIA 4GIEA 4WLCA 2QCFA 4GVIA 4GFIA 1A4MA 4V1YA 1ZNNA 3H6OA 5J04A 3NPWA 1E5JA 2BVDA 2DVXA 2BFGA 3MBFA 4GK8A 1VFHA 1O4UA 2I9UA 1KGXA 3GH7A 1TWDA 1OF6A 4FX8A 5XIMA 3POHA 2X7WA 4W87A 1F9CA 5DRIA 3H2EA 2WYSA 3M46A 4E3VA 4JY9A 1E1EA 3PZTA 2GGIA 1REQB 3WD2A 4DBEA 3ES7A 2PLKA 3KTCA 2OWXA 2WMJA 3URNA 4XBKA 4UZSA 3WLIA 3HPXA 3DC0A 3DXIA 1AH4A 1A5LC 1VQTA 4GI4A 4W7WA 1K7FA 5ABGA 5DLCA 1V6UA 3BAYA 3WEZA 1F3TA 1TRDA 2REQA 5MKGB 4IHCA 1XDJA 3B8TA 2CKRA 3W23A 2PWUA 4REQA 2J7DA 4QEEA 5DEZA 1FWIC 3NYDA 1Y5WA 5JU6A 4WUIA 3WNPA 3BH4A 1ZL1A 3F5JA 4S3FA 1XC6A 3BGJA 1QNRA 3ITXA 1XLKA 4GFSA 4DBUA 4H8HA 2OZTA 2DT2A 3CUIA 1F8IA 3ABXA 4DPQA 1ZLPA 2OT1A 4RV3A 1G5AA 3TR2A 2FJUB 1R3SA 4FF5A 4K8EA 1GOWA 2BOEX 3BO9A 5A94A 4WHBA 4FA3A 1H5YA 2WAGA 2OJPA 3L4WA 1D9EA 1R3WA 4X3ZA 3EPNA 2JGQA 5CZJA 2NZLA 3U0HA 2E9LA 1KR1A 5ECVA 4YTTA 4EOUA 3BTNA 3LXBA 1NM9A 4JY8A 4EPBC 1WYIA 1YIXA 3UR8A 4M6PA 2XWEA 1WXZA 3DUGA 3VINA 3LRLA 5AN7A 5IFPA 1GHSA 3RYSA 1E1CA 1PYFA 2VI0A 3BMWA 3OA5A 4HIBA 5C9RA 4KWVA 3NURA 1H7WA 3LGDA 2NUWA 4GX9A 3H54A 1JJKA 3TZNA 1WAUA 3APGA 5A5WA 3GX9A 1OB0A 1NQ6A 2TPSA 3LU2A 1E0UA 3XINA 3OZPA 2GDVA 5G4HC 3UP8A 2PLJA 4HNTA 4BKNA 4C5ZA 4ACZB 3SFWA 2CZVA 1GQNA 3RPMA 2J75A 1FWNA 4PC8A 1B4KA 4L4MA 2PGFA 4MUZA 3IK2A 1FCVA 2DU2A 4HA0A 1LF1A 1EC7A 4U28A 2GOKA 3VM7A 3N4EA 2J6VA 1IV8A 2FKPA 5AHEA 2ZX5A 3U9IA 3R0DA 5EGRA 4KERA 1VP5A 3OW1A 1K7EA 4ZQNA 4TV5A 1HT6A 2PDHA 2GJRA 5I0DA 3CUJA 2YBTA 1AH0A 2YXXA 1TZ7A 3AMLA 2A7PA 1XRFA 4IL0A 5CSUA 2P50A 4J3VA 4PMJA 4AIUA 4QXIA 4IQJA 1QRQA 5AHFA 2PWFA 4HPGA 1HW6A 4JTSA 5GJNA 5KZ6A 3VOJA 3OIHA 5DQPA 3RLHA 4ZB0A 3VGHA 3QGVA 4V2XA 4IP4A 5I3GA 2FB3A 3SCRA 1Q4WA 3S2JA 3P74A 1H1YA 3U2OA 1MO0A 4BFAA 5I3FA 3R12A 4BCEA 1J79A 1UZHA 5ABTA 2GOUA 4NQ1A 2DUZA 3E1F1 2BY0A 1SSGA 2QDEA 3UNDA 1E6NA 3E49A 4D6EA 3QM3A 4ZO6A 4S3GA 2PWHA 1YMYA 3E74A 1AMYA 3VIPA 1XBXA 1F3WA 3LCGA 4KQNA 2XVLA 1UIOA 3G1AA 3L2IA 1E4MM 2F6KA 3GIQA 2R82A 4KBXA 2PTYA 4PEKA 2QGHA 1QHPA 1RALA 4Q4PA 5JXQA 1C9WA 5HWJA 4LVAA 3KX6A 4MJ2A 7XIMA 3ABQA 5I06A 1YXDA 3GBEA 5BXRA 1R5YA 3G0XA 3PUEA 3IIOA 4PUUA 1JUBA 3T4CA 1KXQA 2WMFA 3FSUA 5A8NA 1QOQA 2HISA 2WV8A 3BAIA 2W4XA 1PDYA 1VJSA 1QBAA 1GZGA 3NQEA 3SQMA 1A80A 4WZHA 5KZEA 3GH4A 2WVSA 3M0JA 1CENA 4MMWA 3MKVA 3VZXA 3GHTA 3CAWA 4B9ZA 2DPEA 3FY1A 4W4QA 3CV2A 1UBPC 2C0HA 2Z27A 3MW7A 4XSMA 3QPEA 2R8WA 3W27A 2XSAA 1QWGA 2WQDA 2QUUA 3PZVA 1LQAA 3NO5A 4XD3A 3DI0A 3MV01 1ITXA 1RV8A 3RXZA 2C7FA 2Y24A 1DJIA 3U5YA 2VWSA 4LRSA 1D3GA 4WKFA 2I16A 3IRDA 4GA8A 3S4TA 3S5ZA 3H53A 3RILA 3WDIA 1A50A 4P5UA 4L4LA 1WDRA 1YXYA 2ZA3A 3DFSA 1JD7A 1KM3A 2HVMA 2QJGA 2SFPA 3LXAA 3PWIA 1TPVA 2CXGA 4KCTA 1OGSA 2VKZG 3MA8A 3QY7A 2DH3A 3UY7A 2Q8XA 4XZNX 4AX7A 2RKXA 1F07A 3U48A 3T78A 4AWTA 1Q6RA 4JFVA 1V6WA 5CKSA 3A4AA 4TX9A 4GZIA 3E0VA 2NT0A 2XH4A 5EFDA 1PYMA 1EJVC 1XYZA 4GD0A 1S2VA 3D0CA 1RXOB 3TCSA 1KA9F 8CGTA 4UWMA 3LNPA 5IDZA 1KCKA 2QAFA 3AMGA 3WNOA 1QI2A 4A8RA 3NWRA 3P8JA 4IGNA 3DKJA 3THUA 4GUJA 3TXVA 1XLBA 3AHTA 1JD9A 2CBVA 1OZQA 3PAOA 3TC6A 3GNRA 2R1PA 3W7JA 1K02A 1TREA 2WBGA 2OODA 1S2CA 1UCWA 4AY7A 5HOSA 5ENLA 4Z17A 2GGGA 3W1PA 1E4NA 4OOZA 4NKCA 2G3JA 3BXWA 2I17A 3K30A 1K3UA 4NAFA 4JN8A 4Q8QA 2HPMA 1ONWA 1K8ZA 1KM2A 4TU1A 3EDKA 3H21A 4OVXA 1A0CA 4ADSA 4W8AA 3RPTA 2Q3RA 4Q4OA 3K1GA 5GJMA 2QYGA 3FEQA 4JCMA 1RQHA 4C6DA 4MPQA 2EJAA 5FF4A 1JRBA 2YOCA 2DY3A 1A5CA 3UR7A 4BJHA 3RX3A 3M16A 1ZS2A 4UNKA 1P1MA 2AL2A 3KOZA 1M53A 1QU4A 2R14A 3ERPA 3ZZ1A 3DZ1A 3CK5A 3C0LA 3R1ZA 2OLSA 5HNNA 3WH6A 3N73A 4MZ8A 4HA4A 4FXSA 4DUWA 4WIWA 3TAOA 3NDZA 4O0KA 3SZ8A 3L5AA 1XQLA 1TPH1 3SY8A 4OQVA 2WQPA 2I56A 4C1NA 2HK1A 3GNDA 3GDRA 3NJ3A 1UWTA 3I4EA 3WH5A 1UUQA 4RNFA 1BWVA 3ARVA 4JKKA 3HGSA 2VNCA 4Q8WA 2C91A 3KBSA 3TA9A 3RM8A 1CDGA 4EKJA 3QH2A 4JICA 3W0KA 2VEKA 4C6FA 4YIWA 4W86A 4M8UA 4DBWA 4ATWA 1UH4A 3QMTA 2WWDA 1W1ZA 1M6JA 3B40A 4HZMA 1ZZMA 1DWJM 1OF8A 3L4TA 1W2VA 3JS3A 4CN1A 1KM6A 1XYMA 3IACA 3ARRA 3CL8A 2QIWA 1XIHA 1H7NA 3OB8A 4PBGA 3ITOA 4GABA 1PS9A 4P7LA 3FN9A 4UZUA 2PBOA 3ARUA 4R53A 2ZZ3A 4XBSA 1Q3NA 2C0AA 3UPBA 3O0FA 2XISA 3H7UA 1O12A 1XH1A 4KWOA 3LV6A 1OCNA 5M17A 2HTMA 5HAOA 4JD4A 2DZXA 4M29A 4Z2IA 1PTAA 3EX2A 1CXEA 3T08A 3VOGA 4L6HA 1EQCA 4ZGYA 1W3KA 3UZXA 5MHBA 3VDCA 5KINA 3HIJA 1XIJA 4JQ1A 2GGEA 1XLJA 4FLOA 2CLHA 3IARA 4H01A 3LMZA 5LNRA 4GI6A 2DT3A 2WC7A 4DJEC 1V6VA 3WLJA 2REQB 2H3DA 4H6KA 1G01A 4JYFA 2CITA 1QW8A 4GOAA 4C6NA 1Z44A 4RX0A 1OX6A 5DANA 1EF2A 4CLMA 5C9ZA 2ZUMA 6A3HA 1AUSL 2NVDA 3BL3A 1RJQA 2PSNA 1ISYA 5FEPA 3BG9A 3VVGA 3S3GA 4DWSB 1ME8A 1VHNA 4OOUA 1FHDA 1NFPA 3GO2A 1MUWA 4CQDA 3UESA 4A8IA 3PBVA 1TELA 4ICNA 5IBXC 1DKWA 5HQEA 3ZLHA 3BW4A 3ZR4A 4DPPA 4Q8UA 5CC5A 2ISFA 3E0FA 2IXUA 2QHAA 3IIZA 2WANA 3QQWA 1C8QA 3G3MA 2DSVA 5LKYA 1J2BA 3R58A 2V6AA 4HOWA 4P2VA 1JPKA 5C0QA 4FS9A 3W4RA 1CXFA 1ZY9A 2G3IA 1AQFA 2POZA 3AHZA 4B3ZA 4DJFA 4YYCA 2WNZA 1OGBA 3PJWA 3FKKA 4IGMA 1EBHA 3H4XA 4HNUA 1QPOA 5SWUA 4LUIA 5GNYA 2RDUA 1BGAA 3NZ1A 2V82A 4PCNA 3SEPA 2G96A 4O1CA 4G5DA 2V5JA 2QJHA 3NQ2A 1T8XA 1EDTA 1TV5A 3FAWA 3ARTA 3E6EA 3ITLA 2J4GA 2ZUSA 1VC4A 1F73A 2CW6A 3PG8A 2C1IA 1GYLA 1XI3A 2QF7A 4D6IA 4XIMA 4ZENA 4GC4A 2V68A 1QPRA 3LHVA 4DZHA 1BRLA 1VLWA 2DT1A 2E5BA 4ONVA 3LI1A 3E38A 2VZSA 5I3DA 2Q3OA 4N6EA 2Y7GA 2FDMA 3E2QA 2HEJA 1HGWA 1XW8A 1L2QA 2WSKA 3WFZA 3S5NA 3T42A 3L65A 2F61A 1J8VA 1AD4A 1KKOA 1JAEA 4TVDA 3ARWA 4DLMA 5BMXA 3HG4A 2XFRA 1XCWA 4UXDA 4YHEA 2J74A 4GBDA 3DBPA 3GC2A 4XK2A 1H60A 2FVLA 1PKLA 3SI9A 3T07A 1JPDX 3K1DA 1UR2A 1Z6KA 2YBUA 3IIPA 1O6IA 5DBTA 1TPEA 4AXNA 3N1AA 1ZCOA 3BW2A 3DGRA 4I9AA 2E28A 2PBGA 1E1FA 2XYLA 1SSDA 3BGAA 1VS1A 2OG9A 3F4WA 1A0DA 4AWUA 1RPXA 4HYRA 4NSBA 4S3DA 4PGLA 4N0RA 5CG7A 4ZQCA 5A6JA 3W1NA 3CQIA 3W2LA 2Z26A 1L0PA 1NWUA 2NQJA 1YNQA 2ZUWA 2V2HA 1W3TA 3NXLA 4Q8OA 4C6OA 3KBVA 3PP7A 2JKPA 1P48A 4W7UA 3C8FA 2OVLA 1BHGA 1AA1B 3NA8A 3WCZA 4H1ZA 1K9DA 3AS3A 5EKYA 5AYZA 4DLFA 3CAKA 1K9TA 4IM4A 4W88A 3QJAA 5I3IA 1J5TA 4M1BA 3M43A 3KOYA 4V15A 2DIKA 4UTFA 1ZHAA 4NHVA 4MPKA 2I1OA 1PDZA 2OKTA 3T81A 1FDYA 3TJ4A 3ES8A 5BXSA 3N2OA 1QNVA 1XLHA 2B7PA 4DAFA 2J7FA 1LOSA 3MHFA 3LQLA 2E1WA 4R27A 2ZUVA 1E9YB 3C0QA 2GJXA 4AAJA 3OODA 2ACSA 1IEWA 3S6DA 4WJXA 1ONRA 1J18A 3EX6A 4D9PA 4MDPA 1BTCA 2ZRWA 5G1MA 4AX6A 2E6FA 1W5NA 3SY5A 3RIKA 4QAIA 1DJWA 3GHSA 1KFKA 3VIIA 4N9CA 1T96A 4ZOAA 1A47A 1HKWA 1LRTA 1E3ZA 2GJNA 3MHGA 3EBVA 1YDVA 2IW0A 2R91A 4I90A 2OX4A 1YYAA 2WJDA 4LBRA 2FVMA 1XYLA 1PWMA 1G94A 4C7DA 3QR3A 3OQEA 2QVHA 3WBEA 4M51A 3AIVA 4PA8A 1I75A 3LOTA 3L23A 4A2RA 1NFBA 4D2JA 2IPJA 1Q8AA 1UD2A 3SIZA 4F0LA 3B0PA 4O14A 1XBVA 3I6RA 6TAAA 3D46A 4UR7A 1K6AA 2Z7KA 4R34A 2QNEA 2KAUC 4I7VA 4A3RA 3USBA 2JF7A 2OQHA 3H2FA 1KQZA 1X39A 2CEQA 4LEQA 4DM1A 1DV7A 1UW9A 1UWRA 2PD5A 3B0VC 1W0MA 3CB3A 5FJRA 8XIAA 1BSLA 4ADTA 5KZDA 2VOMA 4ZQPA 3R0KA 4MZ1A 3P84A 4YVPA 1H3GA 1D8WA 3KWSA 4F40A 3CAVA 5E6YA 1ME7A 2XG9A 4PTMA 2GDQA 3IUHA 4O19A 3MKCA 1H63A 4HMEA 4H19A 1KKRA 1F74A 2HBVA 4AC1X 2EO7A 2VZVA 2PZNA 4MJMA 1R38A 4H9ZA 2NVCA 5G4EA 3R5EA 4X0VA 1UKOA 2QKFA 1ITQA 1O5QA 1H7RA 3C2YA 4QDWA 1TR1A 5CH9A 4U3CA 1B3WA 3W7QA 1EDGA 5MKGA 1J11A 3AXMA 3FA4A 5CJMA 3CZKA 2F6XA 2AQVA 2ASHA 1NOFA 3KZSA 3O2LA 4L80A 4X60A 1XKJA 1RR2A 1VCFA 3SRKA 3AXHA 2FZBA 4AB4A 2ZC1A 1XIMA 3ZJKA 1E9ZB 3KWXA 1UH2A 3LI0A 3WJXA 5H8UA 3URQA 2OZ3A 3SRHA 2XDFA 1BXBA 3VIMA 2BXZA 3N6QA 4UQ9A 4WDUA 4PB3A 2NLYA 2FTWA 4A8LA 2I14A 3CS2A 4CEUC 3UCDA 1Z48A 3P80A 2X1IA 3WMCA 2CU0A 1HIZA 4K68A 1KFWA 5DT5A 1E6QM 4Z1BA 2EPNA 2HWGA 1JGMA 1BF6A 1UOZA 2YR1A 1VB9A 4HVXA 4MY1A 1KRBC 4NNAA 1E72M 4L4OA 2AAMA 3BPWA 1TA3A 1S2TA 2V38A 5DT7A 1WKDA 3AS2A 1MQPA 5BU9A 3APYA 2X1RA 3BLLA 4GZEA 3HGRA 1OX4B 1KTNA 2YCIX 4C5YA 3VX0A 5A2CA 4MHBA 1GKRA 4OUIA 2RHGA 4AD5A 5HQMA 3PUDA 1TJ1A 1PHQA 3VI2A 1FFQA 2C6QA 2ZX8A 3C61A 3QRHA 1CLVA 3M0LA 4K2SA 1IT7A 1PO9A 1UPMB 4V28A 3UW6A 1JI2A 4UCFA 2CC0A 4AHOA 1R47A 3C5QA 1W9VA 3NNTA 3R6IA 4PR4A 4TXEA 3RHGA 4OGZA 4MYAA 3LM7A 4ZA0A 1L6YA 2BOFX 4LF1A 1KBIA 3U7BA 3GNPA 3CT7A 4GZJA 2PD9A 3Q37A 1R6WA 4AMAA 4H6RA 2PPGA 2VRKA 3AISA 3SN0A 3GNOA 2JGYA 3S5OA 3M1ZA 2QCDA 1TCDA 1XINA 5CZKA 3R7MA 2B31A 2ZTKA 4BZYA 1FHLA 2VC6A 1QAPA 3UA4A 2GVJA 2ZUTA 2YX0A 3S9YA 2P0IA 4G1NA 4GO9A 2ZXDA 4YNGA 1XIEA 3LCWA 4FIRA 1Q6OA 4QSFA 1Q13A 3WYZA 1X6LA 3MT1A 3LPGA 3H8AA 4ZB5A 2WJZA 1JCMP 2OR2A 2Y7FA 1ZBCA 1GVQA 3TE9A 3DU0A 1KXTA 2PLMA 1AFSA 4AVFA 5A6KA 2VGFA 3EKGA 5H2ZA 3QTPA 2YFOA 3SR7A 3N6JA 1EUAA 3KS6A 4AIOA 3GU1A 3QYSA 4OZOA 3N18A 4OBTA 3KLKA 1JCJA 4UOJA 1W1IE 3BC9A 3CT2A 4MB1A 3T40A 2V69A 4JTEA 1LBMA 3PFMA 3WDHA 3DHUA 4AEFA 3TOPA 3W7MA 4MY8A 4U2ZA 3AICA 1A49A 4UC5A 3EPOA 4UFHA 1ALDA 1F6YA 1H7OA 1LM1A 2MANA 3EA1A 3QV8A 2WVVB 3QZ6A 3GC5A 2YZRA 1IF2A 4UIOA 4WKAA 1PZ2A 1XFBA 1BWLA 3GVVA 1J0KA 1CB7B 4HPHA 1IWBA 4M5PA 4NZ4A 1WO2A 3ZT7A 2NWSA 3QGAC 5EMKA 4YWSA 5I3JA 2GQ9A 2POTA 1EF3A 1V4YA 3LSCA 3RR1A 4JTJA 4YPJA 3OHMB 2CIPA 4GYFA 3L68A 3STGA 2IPFA 5IHRA 1QATA 2NW0A 2DSUA 1CGYA 4UR8A 1KCZA 3PZNA 3GQYA 3NL3A 2AMXA 4H9TA 1PJ9A 1PIGA 5F7UA 5A6BD 1R2RA 4HZ7A 1Q6CA 2ZRYA 5CPLA 3ABSA 3SJ3A 2CLOA 4O1DA 3TWAA 3AROA 3UPWA 1US3A 4D72A 3BSGA 1BXCA 5LXEA 3GIYA 4NX0A 3VO0A 2GVLA 1FHUA 4FF7A 4MB5A 3TSMA 3LNMA 3PTDA 4PEEA 1CEOA 1TPB1 1S5TA 1R86A 5DMYA 4HYWA 2NX9A 2CETA 4XTIA 5FD0A 3W2JA 1XXXA 1XISA 3PB2A 1LL4A 1R85A 1LYXA 9RUBA 2PZ0A 1LOQA 1EIXA 4UMAA 4E6MA 1AQMA 3BGGA 3WQ4A 2QCLA 1W31A 1TPWA 4RZBA 2EGZA 1V3KA 2A3HA 4H83A 3LLXA 3BANA 1LOLA 3KDOA 3FJNA 3QV6A 4E8DA 2VFDA 3VD3A 1ADOA 4JFUA 1DXEA 2PDYA 5C5YA 2YCLA 1I4NA 2ZVIA 3LERA 4J3UA 2YKKA 2QT3A 3KP0A 3NVTA 3A64A 3PZOA 3TW6A 2FTYA 1WPCA 1UP2A 3S5SA 2FFCA 1EJWC 3KDNA 4ZSUA 1TKKA 4XZBA 4O8RA 1FKXA 5A6SA 5AZ0A 3I4KA 4X9SA 3SURA 2D23A 5FJJA 2J7EA 3AYRA 2ZZ4A 4HU0A 3TQPA 4M7TA 3KOFA 4JDYA 4LAZA 3P82A 2HDJA 3W53A 4DF0A 1C93A 1GVEA 1FKWA 3NGJA 4TVCA 2Y1HA 1TV2A 1CGVA 2FVKA 3R11A 2BWGA 1MVYA 3CV6A 4CNOA 4PMVA 4NF7A 4EPEC 1K1DA 1L6WA 1U5JA 3W1XA 2PDGA 1CIUA 1PKYA 4MYXA 3PR2A 5BU6A 4TMBA 1GOQA 1EL3A 1H41A 1H2JA 3VMPA 1XPGA 4F2UA 2Z1BA 4F2BA 4I6KA 5K4ZA 1VEMA 4LS0A 2OU4A 3PTKA 3QY6A 1JCXA 4CGTA 3LBCA 1TE6A 3TWBA 2Z1WA 3ITVA 3WZ0E 3EWDA 1J0HA 1VBRA 1JCLA 3V4BA 4F3HA 3TTSA 1UD3A 5BXPA 1TO3A 2WHMA 1OK6A 3NOYA 1P7TA 3CEPA 2ATMA 4GUGA 2QCMA 3ID7A 3VE9A 3W85A 3NPXA 1B3XA 3PPCA 3PHAA 3EMQA 2V5DA 4MB4A 1GEQA 2NXGA 1HKVA 3CEUA 1N8IA 2CLFA 2O7SA 2CLMA 3REQA 4EPDC 1I45A 2YL6A 2E9BA 1H1NA 3SGUA 4TR9A 2HVNA 1GOXA 1UP0A 3OPSA 1JQXA 2VEGA 2BY3A 3CLWA 3B04A 5EMMA 4HPJA 1HKIA 4TTGA 1P0EA 1UA7A 1KM1A 4HNVA 4RPQA 4IIGA 3EOOA 2CNCA 2F8QA 4QJ3B 1S5NA 2YDSA 1BYBA 1JZ5A 3L2LA 3W6YA 3QTGA 1MZRA 1KCLA 1MW3A 3I3DA 3A5FA 2B7OA 5HMDA 1ZJAA 1BG9A 1PKNA 1MW1A 5CC7A 3G77A 3M7WA 2J79A 1E51A 1EDQA 3BICA 1VEOA 1TV3A 2CHRA 1UMLA 3GD6A 3WKZA 3MMDA 1JUEA 3BV7A 3GG8A 1ADDA 1OQFA 3DFPA 2XN2A 1Q65A 1G4PA 4DZ5A 3THDA 3IEBA 3BMVA 2A1YA 1ENUA 4YL2A 2UY2A 4QX4A 3ZLGA 2BGNE 3PB0A 1TTIA 1OVDA 3LHWA 3UF9A 1PB0A 4ERGA 3XIMA 4HZ6A 2XVGA 2J7HA 3BOLA 1H1ZA 1UR0A 3N14A 1US2A 4KEMA 4PODA 3UJSA 3HQOA 3WDPP 4DJEA 4MAZA 4U4MA 5CAHA 3NQ7A 3GVQA 3N2TA 5HMFA 4URIA 2O9PA 3RRXA 1XYBA 1OD8A 1UH3A 4OT7A 4OBSA 3HG3A 1KO0A 1LT8A 2ZWYA 2WZTA 5BOEA 3LDVA 4A8NA 4O1BA 3S6OA 4IPJA 3NG3A 1IHIA 2E7FA 3ZQ9A 5HR7A 3WK0A 3ATZA 3M0XA 1TIMA 4PUJA 4PUNA 4PRRA 3FV9A 4NVTA 1XPYA 2FZ8A 5DCBA 3W6MA 1O5KA 4Z2HA 3RCMA 5A2AA 2QDDA 4B3LA 2ZWZA 3BOFA 4ZQRA 2DSZA 1FWJC 2Z6IA 2G3MA 5L6UA 4PMRA 1PX8A 2E5DA 3P8IA 3VMNA 4UTWA 4C6PA 1H7XA 5DN1A 5EL1A 1EWDA 2EG6A 1JDAA 1X6UA 1YKWA 2UWFA 4J1OA 2XIOA 4H9XA 1JFXA 2INEA 5DY3A 4IWWA 1LRNA 4O1EA 4PL2A 3PC0A 4ZQOA 4ICCX 5CAKA 3MTWA 1LG1A 4JTAA 3W38A 1PPIA 1TE1A 3UXDA 4WY0B 1VH7A 4AY8A 3CASA 4RZ4A 1X7FA 5I2UA 3QV9A 3T0CA 3DG6A 2JKEA 3WEOA 2HMCA 3RGTA 5DMLA 4KKXA 2NX3A 3D47A 5F4SA 3IJIA 4GVHA 4J9JA 1W5PA 4Q33A 2G4JA 3CU2A 1AJZA 1WB0A 2ZXQA 2YGYA 3EXSA 4GY7A 2H9AA 2HS8A 1OFOA 2WZIA 4LWWA 3E2SA 4JTKA 4O17A 5CSRA 4XAFA 1V3MA 1LL6A 3GIPA 3RCYA 1RQEA 5HBFA 4S38A 3AHVA 1Y65A 4HPNA 4K8HA 3GK0A 2EKGA 3L4VA 3IGHX 4XAGA 1OFPA 3WLSA 2Z1SA 3CIWA 4Z0SA 4AH7A 4AIBA 1M01A 3NPVA 4XO7A 4K36A 3OO2A 2DZWA 3W2NA 1O1ZA 1AJ0A 2YCJA 4QG9A 4Z2KA 4R85A 4LCRA 4JQ4A 1E6SM 4ERIA 5I07A 1OINA 4TIMA 3LRMA 1QPQA 1H50A 3K8MA 3CXOA 5LSMA 1J12A 4YN5A 4XAYA 3WUGA 4NYYA 4IFKA 4P61A 3CUHA 4Y8FA 5H6HA 3TIMA 3GU9A 2CFFA 4PTDA 1BEUA 4ZO8A 4G8TA 2V2CA 4RZ5A 1M7PA 1XCFA 4DJDA 3EOLA 4MADA 2INFA 3ANYA 3C0SA 3BK0A 2XJ7A 1BKHA 5I3KA 1J9YA 1M1BA 3SCOA 4IP7A 3MQTA 3CUGA 1FWBC 5HNRA 1Q7ZA 3KL5A 4WDXA 2L5HA 4UTJA 3NQBA 5DO8A 2VELA 3OGSA 4MG4A 4PB5A 2O4MA 2P53A 4KRUA 1DE5A 4W89A 2QUNA 3G0UA 4R3UA 2IKIA 3KFTA 3ZR5A 2YBVA 3LCFA 5F2MA 2G0WA 4JIIX 1QVBA 2ZC8A 6CGTA 3ITGA 5FKYA 5K4XA 2Z29A 3MO7A 1SMDA 5CBBA 3KBWA 4N4PA 1LQ0A 1E71M 2XHYA 3WQGA 1S5VA 1XJBA 4C1LA 4E0CA 1YPFA 2CLEA 3EDFA 2J7GA 3NAVA 4M6VA 3MJYA 2X1TA 1C9DA 4IIHA 3SCWA 1HJUA 4JX4A 5A8OA 2H8XA 2VTFA 4UTKA 3MDWA 4W5UA 1TQXA 3M47A 3SFKA 3TFXA 4I8DA 2F2HA 4YS1A 4DZIA 1JCNA 1W1VA 4X22A 5K7JA 5HPOA 1D3HA 2YCKX 1JUKA 5AC8A 3IJ8A 1IGSA 3O05A 2VZTA 3GKFA 3L0GA 4JTHA 3WH7A 2YW4A 1GPFA 2ZVRA 5C2CA 3ZS4A 1M03A 3MUY1 3EX3A 2DDXA 1IQ8A 4GACA 4BEUA 4ATLA 3D3AA 1QO5A 3VIJA 5CGTA 4IPPA 1A5OC 4GNVA 1L6GA 4ZTXA 2PUZA 2UV8G 3MYPA 4TQTA 2C19A 1SZRA 2WHLA 1IZCA 1Q6LA 4Q7IA 2XIQA 1D7KA 4XUGA 1T6MA 4GGHA 3W3OA 5J5RA 3ZMRA 4KIEA 4W84A 3RJXA 4AMCA 3MUXA 4BR1A 1B9BA 1WAWA 5KZMA 3VUSA 4J2MA 2WZEA 3AIBA 3UG4A 5K3VA 3SN4A 4D71A 3L7RA 2Q6ZA 4IZGA 4AYSA 5D2YA 3GH5A 1UASA 1Q66A 2PAJA 3O06A 4WSJA 2OX1A 3MBDA 1VF8A 9CGTA 3SM0A 3V16A 5G4WA 4P7OA 2O56A 1F61A 5DX7A 4XD6A 2J88A 5F2GA 2BBFA 4R33A 2H90A 1B2YA 4RJEA 2BLEA 3W1QA 4MFEA 3VIOA 4AZ7A 2W5FA 4US5D 4O50A 3NM3A 1SQ7A 3AIWA 3LUTA 4NL1A 4J28A 1NP2A 4EE9A 3NEHA 4ALDA 1RY0A 4O18A 3VM5A 2AL2B 4RXFA 1NOUA 3U3HA 1E40A 1K9FA 1CCWB 3MV11 4GHRA 2Z2AA 1I2QA 3QKEA 3V36A 3B0XA 2H9AB 2ZZ1A 3W00A 5JVLA 1ZBWA 2YLAA 3FJLA 1E1CB 3LS9A 3C2RA 1CB2A 3QLDA 1KTBA 1YXCA 1JCYA 3BZJA 4DEFA 2AQOA 4CCZA 2DVUA 2OSXA 5G1YA 1TMLA 3NQCA 4XIAA 3LYEA 4KPLA 1EB3A 1OD0A 4FIQA 1XP3A 3WQDA 2QULA 5A6BA 3PK7A 4QISA 5IDIA 4GQGA 5E0KA 1TUXA 2J24A 4DJDD 2VJXA 1S5WA 4ORIA 1V7AA 5D8WA 4QLKA 1I60A 4F48A 3C3NA 4XWUA 5AKQA 3KVLA 3E02A 4ROQA 3MY9A 5G2HA 4DYKA 3U4AA 1KXVA 7ENLA 4I5RA 2VX6A 1OFQA 3OLIA 3U4FA 4YMZA 4AG0A 4HU3A 1SFJA 4TV6A 4HZ8A 3HZ3A 4FXFA 1S5MA 3UEQA 2GGHA 2HXUA 4DXKA 4UQEA 1V0NA 2IKJA 3A3HA 1E9IA 1US0A 3MDUA 3W7RA 5XINA 2BHYA 3DHFA 2ZZ7A 5FJOA 1VFFA 3EKLA 2XFYA 3VDBA 3N2XA 1DTNA 1XQKA 3NEVA 2HCVA 3ZWSA 3MMWA 3UQNA 3WLHA 4RV8A 4GINA 5C9UA 4DF2A 5A6TC 1XWYA 3BSMA 1YLVA 5T26A 1OK4A 2Y62A 3IWPA 3QY8A 1NEYA 3MUIA 1UKPA 5BNKA 4GISA 1J93A 5EMJA 3QMRA 3PJTA 4H7ZA 3FEMA 3UG3A 3AYVA 4LTSA 1VIZA 1Q6EA 3W7OA 4UQBA 1B3OA 4PMZA 4GWEA 2D2OA 4UFMA 2FMOA 2EXOA 1JDFA 4S2BA 1V3HA 1HJSA 1X1NA 3BJFA 3AUJA 3A22A 1RA0A 3SN1A 1KW1A 4IGSA 1PHWA 1JL8A 3Q94A 3WQ8A 1A53A 1XIGA 4RL3A 4U10A 3SCQA 3GZ3A 4JIPA 2CLPA 4G7FA 3KBMA 3N3MA 5HJYA 3MO4A 4GYKA 3WFLA 2IQ0A 4FEZA 2OLHA 3DN5A 4NX5A 1FOBA 4HMNA 4BI7A 3G8EA 3WENA 1U1HA 1W9UA 2W92A 2V5BA 4IXHA 2PDWA 5BWAA 1SW0A 3TN4A 4IP5A 3S8HA 2O0TA 3A5VA 4BWLA 2P1FA 5F2IA 1E0XA 3OHIA 1R0MA 3L4ZA 2FZMA 3VAVA 4C7GA 4P8WA 4EIVA 1VCVA 1SVDA 5D09A 1E0VA 4OKDA 3VNYA 1CI1A 3I68A 1ICPA 1B57A 3FNDA 3PVFA 4CNTA 4AFYA 3CZGA 4XBJA 1H09A 3O9NA 2Z0IA 1PZ3A 1HXJA 2R1NA 2VC5A 3CUFA 3GR7A 3WNNA 3TC3A 4UFLA 1LLWA 2GLKA 3I65A 1VFTA 3DBNA 4ZVJA 3P0XA 4NNBA 3V5CA 3AU2A 3QBUA 2HK0A 4ADUA 1O66A 3F4NA 2QUMA 3TC7A 4J3SA 2CZFA 2WK2A 1MWOA 4HNCA 2E6DA 3BCDA 1NQKA 3MS8A 3SUTA 1TTQA 3VNZA 1J96A 5LHEA 2QVNA 1QPKA 3IV8A 1PAMA 4FX7A 4GYPA 3LY0A 2FLIA 1XLDA 3L0NA 1NVMA 2J62A 3ZVIA 5C7HA 1WDPA 1L6SA 1SU5A 1U22A 4NAEB 2RDTA 3O3RA 1G9HA 1JG9A 1K7XA 3LHYA 3EB4A 4B3KA 3BAXA 1GOMA 4PMQA 4M19A 4Q8VA 2TODA 3ZO9A 4N6FA 3DYPA 1ZB5A 4ZO7A 1E73M 4MSSA 1G7UA 2PDBA 2YA1A 3I6TA 1FP8A 3SGZA 1VRXA 1XLLA 3VNDA 4PE8A 4GUIA 4CN4A 1EA9C 5G5IA 3UCQA 4YTUA 2HROA 4LUSB 2WCAA 1LTDA 3LEPA 2W6RA 3KTXA 4I3GA 4YCPA 2PURA 4IT1A 4FNQA 1XLEA 3UG5A 2EAWA 3BJTA 4MKSA 3WNLA 3S1UA 4UTUA 1A0EA 2A3EA 1Z89A 1VFLA 4B5UA 4N7QA 3M07A 4WR3A 2GSJA 4IX0A 1N2VA 3A23A 4DUXA 2X42A 1FWSA 3U5UA 4J3XA 4RCXA 1FH8A 4F9DA 4MWAC 4L61A 3NDOA 2PRHA 3GW3A 3HN3A 3WBAA 3IJ6A 3ZSTA 4KEUA 1VFMA 4TUFA 4I5XA 4Y7EA 3IRSA 3QMSA 3F2CA 2OZ0A 3NQ6A 1HO4A 1VBUA 2GL5A 1Q45A 4XB3A 1J0IA 3OU8A 1EZ2A 1GT8A 1IR1A 1KB3A 1GVFA 4IH3A 4INFA 4O11A 2WMIB 3TXZA 2BHUA 1JZ6A 3BW3A 1WZKA 1EOKA 2Z2BA 4IIEA 4UUIA 3LCHA 1J0JA 1XRSA 3WJSA 4Z1AA 1OGGA 4HHLA 4BY3A 4D8ZA 6ALDA 2ZZ6A 2Z1XA 4BA0A 1HP4A 1DWAM 2Z24A 1UD4A 3GXTA 3SQSA 3SCPA 2A6NA 3SUSA 3LK6A 4JYEA 3WJYA 2E6AA 4HJFA 3G1DA 5MF5A 1V03A 4H7VA 3RUBL 4LV9A 3U6WA 4D6FA 2DQWA 1GYMA 5DMNA 4ZEPA 5CPMA 3OP2A 3CHDA 3TJLA 2XH2A 3SAZA 3TSBA 2WKLA 4IMAA 3H2NA 1C8YA 3AFBA 1KD0A 2VVNA 3LTPA 3W87A 4E4FA 2OSYA 1MEIA 3A3WA 1R9ZA 1W6TA 1PIIA 4Q7BA 3T0DA 2YIHA 5E93A 4OTKA 4ENLA 2PF0A 1NSJA 5LIYX 2WBKA 2OCZA 4Z08A 5HNUA 3C52A 4IIDA 4YVXA 5HNTA 1XDMA 2R1MA 1D7FA 3N9RA 4DUVA 4DXXA 1UYQA 3ZYZA 1BF2A 2EPMX 4FI4A 4KGLA 1AQ0A 1KR0A 1OZMA 3N34A 5ABFB 1SW7A 4KETA 3BURA 3WUBA 5JH2A 4BEQA 5CJ5A 3LPOA 5C55A 4HSOA 1UR9A 3GWQA 3PBYA 5LGXA 1OBAA 5H8MA 3L9CA 4Q6XA 2DIEA 1HL2A 4HU4A 4HK6A 3OYZA 4HNNA 2D0HA 3BMXA 3SGGA 3TP4A 3OZYA 1O94A 3H23A 4NI8A 2ESCA 1JQVA 1WKYA 3R10A 1IYXA 4JTDA 3TA6A 3FW6A 2WNNA 4K6AA 2OELA 2W66A 4Q4KA 2JALA 4WCJA 1GKQA 2J8FA 1XM3A 1E6PA 2BXYA 1P43A 4QLLA 3W73A 2O9TA 2OGYA 2PS2A 3CQJA 3RPDA 5JIPA 3DEQA 3B8DA 1TWWA 2P3EA 1GZ1A 4PCTA 3VOIA 3W7NA 4CNNA 3SUVA 4F4RA 1OC7A 3V18A 2DW7A 4AZ5A 1ZJIA 4QAWA 3F4DA 1K70A 3KCLA 2BNJA 2V67A 3JZEA 1XUUA 3TOYA 2QIIA 3L67A 4A29A 2GUBA 3HFTA 4BS0A 4HK7A 3A4XA 4DY1A 2E8YA 1ME9A 3EXRA 1KLZA 1TV7A 5E0FA 1BQCA 3OQ8A 3N4FA 5BOOA 2A21A 5I02A 1FWHC 1UG6A 2VVSA 3WNMA 2YXOA 4RUBA 4D6JA 3FXGA 2C1GA 4D8LA 1OYBA 2QJJA 1NJJA 3OG2A 3VKKA 1C91A 5CGQA 4GLEA 2G50A 2H8ZA 1RLCL 4UFIA 1PSCA 1P5BA 1EUNA 1OX5A 1MZHA 2YZ5A 4Q8PA 4B5WA 1W1PA 4CD6A 3GU2A 4JYDA 2DP3A 4PSRA 2DT0A 4KRZA 3H24A 1HL9A 1YNPA 2Y89A 1LUCB 1W17A 2X09A 1FDZA 3F1QA 1XGZA 5DY2A 1L9WA 1WXYA 3FK4A 2BOGX 4FOUA 5E0CA 5C2GA 2BGQA 3F5KA 2E1DA 4EXBA 2DVTA 1DVJA 1SYTA 5BRBA 3AYSA 3VOHA 3VKJA 1MQQA 1DP0A 4IFKB 3ZOAA 2G95A 1OJXA 1XIDA 2WO5A 5JBFA 3UERA 1RLDA 3SRDA 3BOXA 1IWAA 5C7VA 4QE1A 1FTXA 5LZLA 4LV4A 1JYNA 1XLAA 1ZJBA 2QS8A 3UGRA 1HL8A 3FCPA 1X96A 1UR1A 1CW2A 3Q65A 1GZJA 2PU1A 3N13A 2XU2A 3UWZA 5LA1A 3UZWA 5FA5A 8TIMA 3AI0A 1UB3A 2WNWA 1FY6A 3A24A 1RQBA 4IUGA 3W6LA 2DZPA 3VDAA 4PMDA 1ISWA 3SW6A 1WDWA 3I7QA 4NY2A 3H2MA 1OT1A 4QJ5B 1PE1A 1VR6A 3ABRA 1UR4A 1A5NC 4FLRA 1EJUC 5D03A 2B7NA 1UP3A 3V1HA 3ZJ8A 2VFIA 2TAAA 3UXIA 1GTHA 2ZDRA 2ZXBA 4LUYA 4CD4A 2PODA 5LGZA 3CZJA 1Z8AA 3R79A 3T2OA 5D8ZA 1WKEA 1ZAHA 3AYTA 1HVXA 2XZ7A 2E4TA 3AC0A 3LTSA 1DQWA 1AQHA 1QNOA 3ALFA 3AIEA 4FMVA 3RDKA 4IOTA 4JIHA 4R7WA 2A3CA 1QI4A 5D2VA 1DEDA 3VNMA 4E5TA 3EWWA 3QHOA 3OOQA 4MLRA 5CC3A 3W88A 2NV1A 3NZRA 1JAKA 1KWGA 4FOKA 4LOCA 1W9BM 1P0DA 4NAEA 7CGTA 3DESA 3FYYA 1BYCA 4Q8TA 2WMGA 4QTGA 2D2JA 1V3LA 2WC4A 4S3AA 3HOJA 5CG0A 1IZKA 3GTFA 4IMEA 4CQ9A 1GQIA 2FHFA 4IPNB 1VLIA 1TB3A 3AO0A 1PKMA 1H0IA 2V3GA 4ZBCA 3QPYA 3QHNA 4Q4QA 2PC4A 2YW3A 2I5IA 4GPNA 5A6MA 3GDTA 3AU6A 4FP1A 3LLDA 4GRSA 3WK2A 1XLGA 5FL0A 1KBJA 2ZTJA 5IHSA 3IPWA 4RNHA 4LX4A 2VWTA 2DIJA 4FR6A 1U30A 1GJUA 5I09A 1T7LA 1KBLA 4CD7A 5LIWX 3M0YA 1RK6A 2P8BA 3CZLA 2FYMA 1M7OA 1GNXA 1FWWA 1BVZA 4MLJA 4FNUA 3MB9A 1TVPA 4HHMA 5DRCA 2FDSA 3VABA 6REQA 4FSAA 1KRCC 3AIRA 1V0LA 4G6CA 4TTUA 3GUWA 4O10A 4KWSA 4Q4MA 1WOBA 1IEIA 3WFAA 2XVPA 3IUIA 1A5MC 1FHVA 3WBXA 3V7PA 2ZRZA 1G6CA 1QHZA 4MWAB 1ZGDA 4WKHA 4DELA 1QI0A 4QIUA 3IS4A 3ZT5A 5FESA 1XLFA 1LG2A 4H9VA 2ZX9A 1EEPA 1M3UA 2WMHA 2VC9A 4FPSA 1HGYA 4CU6A 2FPVA 2CZDA 1VPQA 2VX7A 4XUYA 3T7VA 4Y9AA 4YU1A 1C90A 3LGGA 3DG3A 4JTRA 2JQXA 4N42A 4I9TA 4NG3A 1UKQA 3FDKA 1P0BA 2Y4SA 2D3LA 3VFLA 1A5KC 5LIXX 4LFYA 2CZ5A 4DWSA 5H8PA 1XRVA 3GS6A 1PZ0A 5LXXA 3FS2A 3WQOA 3R0UA 4S3CA 5T9BG 1T41A 3DFNA 2X7VA 2RJHA 4LUJA 2X05A 3B8VA 3RK8A 1MUCA 2J8GA 1XL9A 3JZUA 4L65A 3WLQA 2Z25A 4JCLA 2PDIA 1SJCA 3CMFA 1H4PA 1W1YA 5D9MA 3JW7A 4FNTA 1DIEA 3EOUA 5HJLA 3JVAA 3TNOA 4JX6A 5DCEA 1GQKA 4PUMA 4DX3A 4MWAA 1S2AA 1XYFA 1PIFA 2ODOA 3TVAA 1E6XM 1QXLA 4H9YA 2BODX 1WQ5A 2Y61A 3VD9A 5C2XA 3Q45A 1EGVA 1T99A 2Z6JA 2BB0A 3OGRA 5HDRA 4JHZA 2DUAA 1Q6DA 3T0BA 1JZ8A 1MNSA 1LP6A 2ZRVA 4U2YA 3ARPA 3AJXA 4H8UA 2PCEA 3KP1A 4L6OA 2PDJA 2RDWA 2IKHA 4PMNA 3B9OA 1JDDA 1JFHA 3LCLA 5CPOA 3PNZA 1AW2A 1KRMA 1O95A 1NAL1 3FXYA 3UWEA 3NSNA 1P6WA 3CLMA 3W22A 3CZEA 4J2PA 2XIIA 2UBPC 4C1KA 4GVFA 2Z28A 1UKSA 2IQTA 2F7FA 4UTIA 3QEZA 4QP0A 4Y90A 2A0NA 3QVQA 4WX2A 4U31A 2JBMA 1RBAA 1DHPA 1TWSA 2Y8KA 1TX0A 2V3DA 3PSVA 4C6EA 4Y9PA 1OC6A 2FIQA 3Q4DA 4A6GA 4QE4A 4XG1A 4LCQA 3DFOA 4E2DA 5TNVA 1ODZA 5JBDA 2BXVA 1GQJA 1UWAA 1EEXA 3TFCA 1QR7A 2MUCA 1JNDA 2IKGA 3RG6A 2XWDA 4DN1A 5LIKX 2VURA 4JXCA 4XD4A 2DH2A 3LCXA 4MWAE 2PDFA 2EJ1A 4AHPA 3QC0A 4NJKA 2OOFA 3C2VA 4JFWA 4HBKA 2ZOXA 5EMYA 5A8QA 3G2GA 3KZPA 5T8GA 5EYWA 3G24A 1V93A 4JNYA 3TH6A 4NIRA 4CQAA 2VFHA 1OG0A 1J5SA 3MI3A 5FF7A 3ONCA 3F5LA 4UMBA 1POJA 2W67A 1TPUA 3CUZA 3WF1A 4QEHA 2PDMA 2CBUA 2AKMA 4H8VA 3NYZA 4GCXA 4ZOEA 5FEWA 1HFBA 3KEHA 3BLOA 2FFIA 3M41A 4GXMA 4PCSA 1W3LA 3T09A 4I7UA 2XM2A 3TN5A 3CO4A 3FDGA 1DTUA 1NFGA 4LBSA 4WOZA 1DWFM 3D6NA 2QCHA 1I2NA 4IJRA 1D2KA 1E56A 2GQAA 4HYVA 4YXGA 4EXAA 1JCTA 4Z2GA 3PPGA 4ZMGA 1G7VA 1GORA 4ATDA 2ISSA 2VCBA 1OFRA 2D24A 1KFCA 1K8XA 1OYAA 1TQJA 3FVDA 4H9UA 1ZPTA 3B9EA 1RAKA 1KM4A 4S23A 3W83A 2DGAA 1DWHM 3O7UA 4AD2A 2QXWA 4Z1CA 1Q2RA 1LBLA 3KVJA 1UZ1A 3DDMA 3UWUA 4E2OA 3T1GA 4E2VA 1MEWA 1TIWA 1DJNA 2RAGA 3EB2A 1LL7A 3HV9A 3TYAA 3BDKA 1LT7A 3U57A 2A4AA 3C56A 3GNXA 1W9DM 4BF5A 2WCGA 4IPLA 3VPLA 1D3CA 1PZ1A 2YA0A 2QEZA 1IT0A 1E43A 1AMKA 4YLWA 2QDGA 5AHNA 4QLJA 3NZGA 1U83A 3N17A 1WDSA 1LLZA 3SCUA 1XG4A 2RFGA 3PBWA 5D30A 4E8GA 3CQKA 1GWJA 3QLLA 4UTLA 3VD4A 4IQDA 3UZZA 3GBDA 3TTEA 4LT9A 4NU7A 1DBTA 4CUCA 1ZQ5A 4AU0A 3O0KA 2CWXA 4LF2A 5A6AA 1FWDC 2Y6ZA 4M3PA 1X8FA 3ZT6A 4IPIA 4X63A 3DOPA 5EBUA 5C6MA 5EA9A 3WQPA 4MY9A 2QMJA 1R8LA 2CBJA 4L56A 2WZHA 2Y88A 3GHRA 1Q7QA 5K9CA 4H7CA 2WVUA 1JDEA 3QSTA 3QW4B 1JPIA 3Q2DA 3NO1A 4LJ3A 1YDYA 2NWRA 2WSPA 3GZAA 4EX4A 4DO7A 1QI3A 3LB0A 3C6CA 2VP8A 2ZX6A 1QNPA 2G8ZA 4ML4A 4A3YA 3J7HA 1B31A 3RR4A 2QV4A 5CJNA 2ZKMX 4NAFB 1ZBKA 2NLIA 1KFEA 2P10A 2E25A 4EAYA 2OMAA 3OZOA 5LNSA 1M04A 1O68A 2ACUA 7TIMA 3S0CA 1B30A 1P6CA 4KESA 1KFJA 3TUUA 2ZA1A 4WQ6A 1M68A 1ZSXA 1DIOA 2CPUA 4W8LA 5D02A 2HE5A 4H2CA 1A3WA 3WUEA 3EMCA 5GPRA 1XIFA 3STPA 2ZFAA 1I9CB 2QW5A 4GQQA 1L8NA 2E67A 1PBGA 2ALRA 2A5HA 1VPYA 2C79A 3WIJA 3S46A 3WK3A 1DWGM 2C18A 3LBMA 5HWMA 3TQKA 1KFLA 2BY1A 2GSHA 2HV5A 2DZAA 3I7RA 1ZP4A 2JF6A 5A8PA 3NL6A 2VFGA 4GNKB 2A79A 3VA8A 4C7FA 1VHCA 4ZOBA 3BWWA 2IQDA 3PJXA 3VKDA 3ISIX 4IMFA 2Z2UA 3AZTA 2VGGA 2QUVA 3MWCA 3RO8A 2W91A 4Y9MA 3BUVA 3B8IA 3SUUA 3PPHA 5C9XA 4MJ4A 3UWQA 4B5SA 2W0UA 4MZYA 3LHZA 4K7VA 3NOEA 3QR0A 3CWOX 3THAA 2A7NA 4B9YA 3GY1A 3AS1A 4MUPA 1VYRA 1H62A 3EWXA 5EU9A 5E9XA 2RDXA 4RZ6A 4A05A 1B4EA 5HXMA 2OYMA 1EHAA 3NGFA 3OGVA 3NL2A 3HB9A 4LGXA 5AC6A 3M0VA 3TK7A 3WUFA 2C16A 1W2PA 1GW1A 3L0KA 1OABA 2VMFA 3LTYA 4UTWC 3WD0A 1I0BA 1QCWA 1QW7A 5AY7A 4E3TA 2HJPA 2PDQA 1UOKA 5CPQA 1RVGA 1V77A 1JGIA 1IIGA 3AZRA 5E70A 1DJHA 3EKZA 1AH3A 1LORA 4JAWA 2G5WA 2DZTA 1NWSA 3C2EA 3UU0A 5BMWA 1OFDA 4AIEA 3E2RA 1Q6QA 4FXJA 3KL3A 3R43A 3GDMA 3MWAA 3PS7A 3MU7A 1V6TA 1IGWA 4PMOA 4YTRA 3CL7A 4UCGA 4DJFD 3VD5A 1DJGA 2GVEA 3A12A 2ANUA 2PMQA 1ADSA 2BGSA 3PZ9A 2KX9A 2NQHA 2V3EA 1JIBA 4Q8MA 3PBMA 4NZJA 1XGEA 5KTLA 4GQ0A 2OYLA 2GQ3A 1HF6A 1R2SA 2D22A 3M6DA 1N8FA 3RN6A 3WD1A 2XZ9A 4QITA 1TZ9A 4IQLA 1TA3B 1GJWA 3GFYA 3CO8A 4PULA 3LM3A 4XAZA 3HQNA 3VNJA 3KOXA 4CQBA 3CAQA 4XKYB 4DXVA 2GPTA 3PZQA 5ECUA 3VGBA 3W86A 1W5QA 4O4VA 2PTWA 4LC6A 3GXPA 4IGHA 2ZUNA 4JTQA 3VOCA 4AZCA 5CXPA 1W3JA 3NVDA 4A22A 3APTA 4JTIA 4ZZ9A 4IMDA 2FPYA 3QXBA 1H51A 1SR0A 4REQB 4P8VA 3TONA 3BAJA 1FWFC 1CPUA 2FGLA 1I2RA 2JEPA 2AGTA 2MNRA 4NASA 1OEPA 4LUTA 3PANA 5BXTA 1JDCA 3TW7A 2O7QA 1LRQA 3KRSA 1B90A 4IMCA 1O7AA 4I8YA 2HVOA 1E9LA 4IIBA 1GVOA 4A21A 4Q6JA 3O6CA 1M9HA 2PE4A 2PP0A 4M1RA 1JRCA 1JYVA 3SCSA 1W5MA 4KWUA 3VCCA 3W29A 4CD8A 7TAAA 5HK4A 5PTDA 1HX0A 4W5ZA 2X8RA 5JBEA 3KRUA 3VKAA 1DXIA 3NUKA 2VC7A 1BGGA 2IMRA 1Y8BA 4POCA 1BLIA 3G1SA 3M0IA 3GVGA 3H26A 1GJPA 1W3IA 3WLPA 1HJQA 2IUZA 1KGUA 2V30A 2UY4A 1GONA 4D6HA 1FBAA 1I8JA 3LG3A 3HPSA 3HQPA 1EFZA 2C71A 3HJEA 4JR5A 4AEEA 1EO7A 1TJPA 2Z1VA 4UOQA 4MM1A 2PWDA 1KXHA 3IIXA 1R2TA 3WQVA 3ZVHA 1SJDA 4ECLA 4ZO9A 4NILA 4C60A 2PB1A 2TSYA 1G0CA 3TTOA 3WQ6A 2CZEA 3K4AA 1GHRA 2AKZA 1RY8A 4NXKA 1NDYA 2G4FA 1WBJA 1TV4A 4YWIA 3T05A 1KBBA 3L4YA 2HPIA 3UWYA 4K3ZA 2VGBA 4R9OA 3NQMA 1G67A 1LWJA 1ICSA 3E3HA 3V35A 3NDYA 3RF9A 3BAWA 2NQZA 5H91A 3C0JA 4KCVA 3NFUA 4NZ5A 4MKVA 1W56A 1D8CA 3EDDA 3R94A 4K39A 1Q5MA 1B3YA 3STFA 2FH8A 3BLDA 6TIMA 2OFJA 1T8QA 1Y5XA 3BQ5A 3SIMA 3FYPA 5AHMA 3CHEA 1V3JA 4XZIA 3W75A 2GVGA 1Z69A 1S2WA 3VC5A 3S9ZA 4M6QA 3ABZA 4M6UA 1F4HA 4K7YA 1X7IA 4QE5A 1Q6FA 1DJYA 2YA2A 3FX4A 3KW3A 5HMSA 5AVHA 4PBEA 1HQTA 3ZR6A 3I3BA 3F4CA 4UMCA 1QFEA 2WWCA 2VFFA 2RUSA 3B3DA 1X98A 4NRSA 3SY1A 3EZ4A 2OSWA 4FLSA 1BYAA 5M5DA 4NZFA 3II1A 1B5TA 1B0IA 3BE7A 1UJPA 2FPTA 3W7LA 4XZ9A 2QGYA 4PSPA 3MSYA 1TG7A 4O16A 5FF3A 1QASA 3LMYA 4GG9A 4C91A 3U7VA 2XGIA 4EACA 1O5RA 3IJDA 4ZODA 1KBKA 3PNUA 2ONEA 3E0IA 3GYEA 4US6A 1XSJA 2AAAA 3CWHA 2NV9A 2F9RA 4JZ5A 4YCOA 3CJPA 4JL1A 1W37A 4QJ1A 3B4YA 4Z0JA 4OFCA 5DMMA 3SBFA 5E1QA 4ERAA 1YPIA 3AIQA 4MIMA 8RUCA 5XIAA 3AS0A 4Y6GA 1FH9A 2ZZ5A 5M1TA 2DEPA 4JX5A 2V2DA 4GC3A 3UY8A 1KM0A 5IFTA 3PZUA 1DWIM 2VCCA 3MC5A 3AOFA 4EANA 1DHKA 2EPOA 4DO5A 3EEGA 1F6PA 4DZAA 2ABBA 3VKBA 4B5XA 1S3TC 1XDLA 2J66A 1EQPA 3V0UA 3V1PA 1W8SA 3TYEA 3RFAA 2AL1A 3KRZA 5I79A 3N9KA 3DFQA 2GJXB 2G3NA 4KCWA 1GEHA 5REQA 5DBUA 3GKAA 3NTYA 3LBOA 2ZCGA 3T2QA 2Y70A 5BCAA 5I03A 4F9JA 3CB8A 4ZOCA 1MDRA 2NSOA 4PMXA 1S38A 5TAOA