1UA3A

Crystal structure of the pig pancreatic a-amylase complexed with malto-oligosaccharides
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
publication title Crystal Structure of the Pig Pancreatic alpha-Amylase Complexed with Malto-Oligosaccharides
pubmed doi rcsb
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ua3A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ua3A01
1E6PA 2GUYA 1IZJA 4OBRA 4F9JA 3LX9A 8A3HA 1OCQA 3SUTA 5IFTA 1E3XA 4KRUA 5E0CA 5EB8A 2ZOXA 1JZ2A 1CLXA 4JHOA 2DSZA 4W7UA 1LF1A 4FNRA 2AOSA 1QW8A 1GOWA 1VFMA 1HXJA 2EPLX 1XD1A 1TMQA 2CBIA 1UWSA 1GUVA 1V08A 3VMOA 2BY3A 3HG2A 4ATLA 2JIEA 3FXYA 5M17A 1ODZA 3W26A 3SCOA 2VRKA 4NZFA 4HOWA 1CXKA 2J62A 3VD5A 1JDAA 3WH6A 3WEOA 4D6HA 1DWIM 3ZM8A 1FH7A 4W7VA 1WO2A 3VIPA 4P8XA 1VFUA 3H53A 3S5ZA 2GJPA 1US2A 2WSPA 2GK1B 3RO8A 3IJ9A 4A3HA 1V6YA 1JAEA 2EPOA 1EO5A 3D5HA 3I3EA 1ZS2A 1EHNA 3AZRA 3WF1A 3LXAA 3FNDA 1EIBA 1JYXA 2EXOA 2VRJA 3WDIA 2WCSA 1GONA 1NWSA 2J7BA 3GXNA 1U33A 1UQZA 3U7VA 2OLHA 4IISA 3WSUA 4J28A 1LLOA 2YL8A 1UR0A 3BAXA 2XN0A 3CZGA 1V0MA 4M1RA 1XC6A 4MAZA 3CLWA 3PTKA 4B15A 2C0HA 4OOZA 3FHAA 2WVVB 1TQTA 5ABFB 2A3CA 3PZOA 4QAWA 3VO0A 3HG5A 1BG4A 4LPCA 1UHVA 2UWFA 1F4AA 2WZHA 3NJ3A 4AD1A 2WNWA 2J7GA 1US3A 3OLEA 2PI6A 4MNLA 3U5YA 3SCUA 2DSVA 1QNPA 3WD4A 2FYVA 3NDZA 5A8QA 1R7OA 2QLYA 1GOOA 3KL0A 1O6IA 1AQMA 1J12A 2ZE0A 5I3DA 4UQCA 4N42A 2FGLA 5A6AA 3WBEA 1J0KA 5ABHA 1VEMA 1BF2A 1QI2A 2ZXQA 3UERA 4HMCA 3LPOA 1JZ8A 5A95A 1X1NA 3CUHA 4CD4A 2XUCA 1V3HA 3GXIA 3EJRA 2ZX7A 4LYQA 1KBBA 4D6GA 1XV8A 2W61A 3PZUA 4PSRA 2OW6A 4UQEA 1B3WA 5IFPA 2WANA 2ZX9A 3CZKA 3F5KA 3DHUA 1E1EA 3ZMRA 2VX4A 4AMCA 5BCAA 4UQ9A 2G41A 2YLAA 7TAAA 3AJ7A 2BVTA 4HOZA 3UR8A 2BFGA 1Q6FA 5FD0A 3OG2A 3RPMA 3CZLA 1R47A 4YHGA 4HA1A 4ML4A 2X1IA 1GQLA 1GVYA 1J0YA 1WZLA 1ZBKA 2QMJA 5AYBA 2WWCA 3VIJA 2XN1A 4AEFA 3EMZA 5I2UA 1WPCA 5CLTA 4CCCA 1LG2A 3UG5A 3AISA 4NRRA 4WLCA 2J25A 2EJ1A 3ARRA 2QMKA 1UH2A 5BRQA 3HU7A 1PZ2A 1UYQA 3ZSTA 3PN8A 4DUVA 1K6AA 2CBVA 1BSIA 4H04A 3ZJ6A 4XZBA 3AIBA 1BGAA 1NARA 2E3ZA 1BLIA 5I77A 1QBAA 4J3SA 4NX0A 4TXEA 2J7CA 3WH8A 3ARPA 2EO7A 2WC7A 4ZXLA 1PIGA 2V3EA 4W85A 1DWJM 2X05A 1CXFA 3W37A 4IPNB 1E15A 2F1BA 3BLPX 3D4YA 3WUEA 3EJPA 3DDFA 3CUGA 5I24A 1HN1A 1QBBA 1FOBA 4OOUA 4UR9A 3WELA 2OWWA 4HPHA 3BLKA 1X6NA 4J27A 4AISA 1WZMA 2CBUA 1CXLA 3W6LA 1MW0A 1ZL1A 3WD2A 1I75A 1LL4A 2EPKX 3UCQA 1JI2A 4Z2GA 5FL1A 4GI8A 2WB5A 3AHYA 3L4UA 1OM0A 1KBKA 3GNOA 3AIQA 2WSKA 3WKZA 5JBEA 4OJYA 4QCFA 5IXEA 1FHLA 3DYPA 3ZJ7A 1J18A 2Q8XA 2AAAA 2CIPA 1V6VA 4PMXA 1ZBCA 3APGA 3THCA 1JFXA 1GQIA 5GPRA 1HWWA 5KEZA 2WMIA 2VZTA 4PMUA 1DHKA 6CGTA 3A24A 3CIVA 3AOFA 5JIPA 1J10A 3W29A 4P8UA 3VNYA 3WBAA 2OSYA 4X9YA 4CD7A 4PMNA 2EPMX 2YA2A 3VIIA 1XGZA 4F79A 2YBTA 3B9EA 2ESCA 3THDA 1PEZA 1UD5A 4WJXA 2CBJA 5CPSA 4B3KA 4KMQA 4BS0A 4QLJA 4U5IA 4CUCA 1JL8A 2C8NA 3ZT5A 1WDSA 5A3HA 2CKSA 3AHXA 1EDTA 3J7HA 4LYRA 3VD4A 5A1AA 3OA5A 3GXMA 3ARQA 3PBGA 1EOMA 4NXSA 1HJUA 1TVPA 2WZIA 4URIA 5BROA 5JBFA 1TQVA 4WSJA 5A6KA 5CGTA 1UA7A 3GXFA 3UETA 4W7WA 4OBSA 5A6SA 1UZ4A 1JXJA 3VTRA 4GQQA 3KL5A 3AS0A 2VVSA 1HJXA 4TX8A 1UWRA 2XVLA 5BXRA 2WMHA 2G4FA 5BXPA 5D4YA 3L4YA 3NSNA 4AIEA 1LWHA 4FNPA 1QVBA 4DO5A 3TTYA 4WK9A 2J75A 3O6AA 2OYKA 1BGGA 1O7AA 3RMEA 4DWSB 1JZ4A 3II1A 2JEQA 5HNNA 5KZ6A 1JYWA 3VILA 1GVIA 1PIFA 2E4TA 1FP9A 3D51A 3WH9A 3PZGA 1NM9A 1JGIA 2BNJA 2VT0A 3TONA 4P7NA 3K1DA 4L4OA 2OWXA 2FH6A 3CV5A 3CZSA 5HBFA 5A2AA 3FHQA 1KTCA 2J47A 2ZUWA 5FOOA 3SURA 5EFFA 4W5ZA 3WDRA 1OIFA 1EXPA 3VUPA 1UD3A 1W9UA 3WMCA 3MSGA 2ZUNA 3WFLA 2DH3A 1SMDA 2WCGA 3GDBA 2XGBA 2CXGA 2XIBA 1E6NA 3FAXA 3N18A 4UFHA 7CGTA 1V02A 1OT2A 1R86A 3W4RA 1E40A 2J74A 4WKAA 4XV0A 3DX4A 3ECQA 1JI1A 2D0FA 3A3HA 1R85A 3IAQA 3ZT6A 2XVNA 2IXUA 4NI3A 1KXQA 2OSXA 4AD5A 3PZTA 4PTXA 4AYSA 1CBGA 1FA2A 1V6XA 2W91A 3BCFA 6A3HA 1JD7A 3NYDA 3WY4A 4H7VA 1TUXA 3OZOA 4C7GA 1V3MA 2F1AA 4AZ6A 1SYTA 1VF8A 1JZ7A 1XH1A 3F4VA 3ZT7A 1KGXA 5FL0A 4ZFMA 1OGSA 4U31A 1KXHA 1KQZA 1B0IA 3VM5A 2WLZA 3GZAA 2WC3A 4HZ7A 4AIUA 3NDYA 5A8MA 5GNYA 2OSWA 3AHVA 1E6SM 1QWUA 3VIMA 3VIGA 1YQ2A 4UFLA 1W9PA 3RILA 4BQ4A 3LXCA 1BYDA 2GJRA 2A3HA 1E55A 4UOJA 3RDKA 4OZOA 2DIEA 3LRMA 3GM8A 2WZEA 3RM9A 3WEZA 2JF6A 4AZCA 7A3HA 4JHZA 5EBAA 4UFKA 1CPUA 4CD6A 4W8LA 5A8OA 4JZ5A 4E8DA 1XCWA 4HP5A 5E6YA 1ZJBA 5LA1A 4AMWA 2NW0A 2YDRA 3W0KA 4TVUA 3PZVA 1E0VA 5HPCA 2YA1A 5E6ZA 2DSUA 1JZ5A 4M24A 4GINA 1QI4A 3DX2A 1HKJA 1V6WA 4GPNA 1XH2A 4AYGA 4HTYA 3G6LA 1PPIA 4U3CA 3T2OA 3FN9A 2YA0A 4HOXA 4AD4A 4MB4A 3HN3A 2VQTA 3VDBA 1O7DC 1E3ZA 4PMRA 2F7PA 2FH8A 4Z2IA 2FHFA 3GTNA 3OBAA 1OT1A 2X2IA 5DMYA 2UY5A 3CZ8A 3EDJA 2XFYA 3LMYA 4BF7A 5D9NA 2YBUA 2VC9A 3W53A 4W93A 2W62A 2GVYA 2A3BA 1GHRA 4FF5A 3WENA 3WY3A 2FGZA 3WD3A 6TAAA 4CN6A 4JIEA 2NT0A 3BAJA 1EQPA 1QNQA 4GQRA 2YKKA 1GW1A 3VMPA 4X0NA 3BSGA 3AIVA 3AYRA 1RH9A 3VSVA 2XJ7A 1E5JA 3MUZ1 3VVGA 3WDQA 1YHTA 1V6UA 3OIHA 2PF0A 2EQDA 3AROA 1FH9A 3I3DA 4ZENA 4P7LA 3GYCA 3A5VA 1CTNA 4K68A 4D6JA 3WF3A 3CHFA 3I3BA 4MB1A 4D6DA 3LPFA 3BC9A 1F4HA 1CGWA 1GNXA 1KR1A 1KR0A 4AD2A 1E0XA 3AFBA 1KGUA 1NP2A 1UWTA 3WNPA 4AIOA 3GXPA 1W3KA 2YDQA 3T0DA 5BRPA 2QPUA 1H09A 3W6MA 1ISZA 1E6XM 2BY2A 1BYCA 4GKLA 1C8XA 1TQWA 3A22A 3VM7A 3WMSA 1MYRA 4IUGA 1HJSA 3BSHA 4YHEA 2GDVA 1MWOA 1E71M 1VAHA 1TQSA 1HL9A 3A23A 3WN6A 4GZJA 2GK1A 2WC4A 3WUBA 4XX6A 3T09A 1QI0A 1MXDA 1KB3A 1AMYA 3AS3A 4F9DA 1AVAA 5IDIA 1V3IA 4NXKA 3PZMA 3ZIZA 2X09A 4HU8A 2QF8A 3WL1A 1VRXA 1PX4A 5JUVA 3VGBA 1HXKA 1JF5A 2VZUA 2V3DA 1UWUA 4PEEA 4KH2A 3D3AA 1VEOA 3B9DA 5I79A 4D6CA 1LJYA 1SFSA 5GQBA 2WVVA 2J7HA 5ABFA 5I78A 1OSEA 1HVXA 1MW1A 3IANA 3SCPA 3VD3A 1UH3A 1UD4A 3AMKA 3U7BA 1PAMA 3WY2A 4PMZA 2ZWYA 3PZIA 5A6BD 2B31A 2FE0A 2V5DA 1TCMA 5I0DA 3RJXA 3W25A 1JAKA 3WQ4A 4J3UA 4LQ1A 1VFOA 1G5AA 1OGBA 4L4PA 1UD2A 1R87A 3U57A 4KRTA 4IPLA 5A6JA 1M01A 1E4LA 1UD6A 1C92A 1V0KA 4EK7A 4HA4A 2CERA 2D20A 4Z2LA 5M03A 5E1QA 1HKIA 1E72M 2ZUVA 1D2KA 3NUKA 4DWSC 2JIWA 3BAKA 3CUJA 4P8WA 2XN2A 2ZUTA 2WXDM 3AHZA 4JFWA 3RJYA 2XTKA 1HIZA 3BVUA 4GZIA 1CGUA 3BAYA 3MSDA 1OINA 2E8YA 2XVGA 1D3CA 2W63A 4OKDA 1V3LA 4QFUA 3DDGA 4JCMA 2X8RA 3M6DA 2XVPA 3HZ3A 4AZBA 3BUBA 2WKGA 3WFZA 1EA9C 2BVDA 3K46A 3L2LA 3TV8A 3AXIA 2Z1KA 4BQ3A 3SCRA 1K9TA 4P7OA 1IV8A 4MJ4A 4CN4A 4J3WA 2D73A 4CU6A 3OZPA 3LRLA 5CPTA 1UR1A 2BXYA 4W84A 2F7QA 2E0PA 5ABGA 1RPKA 3EJTA 3SUSA 4QDMA 2RGMA 3WDJA 2GJXB 4FLOA 3AYSA 4MNJA 1W3JA 1HJWA 3ARSA 1E6QM 5IHRA 3TTOA 3FAWA 4CCDA 2WHKA 3EMQA 2J77A 1UOKA 3WNMA 3CHCA 5CGMA 5HDRA 3NIYA 1BG9A 1E70M 3LPPA 1G9HA 2BHZA 3BAWA 1VENA 4V2XA 1PJ9A 3EBVA 4GXPA 4D72A 2CYGA 4MB3A 1CEOA 1J11A 3MMUA 1AQ0A 2O9TA 4H41A 1VEPA 4AZHA 2ZXBA 2WHJA 3BMVA 2BHYA 2WMJA 4AZ7A 1ZB5A 3WUFA 1PBGA 1GCYA 1KWKA 2C7FA 1GQJA 2CHOA 3U5UA 5AC5A 5EFDA 1XD0A 2XWDA 2BHUA 2WKLA 4HMEA 5D8WA 2V5CA 1U2YA 4HZ8A 1M53A 1N82A 1CZ1A 3AXXA 3S2CA 2JALA 4PBGA 2WVTA 1B3XA 4TTGA 1B2YA 4AZ5A 4CVUA 3FY1A 1LG1A 4BQ2A 3EDEA 2Y24A 3ARWA 4ZEPA 2CESA 2BVYA 3ALGA 4U2ZA 1BVZA 2VZSA 2EADA 1VBRA 2VX7A 3FW6A 5HXMA 4DM1A 4R27A 1VB9A 1W91A 2PWDA 2ZXDA 1MQQA 1R7AA 1H3GA 2OYLA 2WMFA 3TP4A 5JBDA 4PMQA 1E6ZA 3WF2A 1CGTA 1CYGA 1ODUA 4AD3A 2UY4A 2VR4A 1J9YA 2J7DA 4KGLA 1WDPA 4W8AA 3WH5A 4BZYA 4HMDA 1LQ0A 1QWNA 4CGTA 1HKKA 3WNNA 4EE9A 1JDDA 2D23A 2YFOA 3ZOAA 2QHAA 2BY0A 2DQXA 1CIUA 5DF0A 2WCAA 1FHDA 3WQ8A 3K8LA 3MUY1 3PZ9A 3VIHA 1TVNA 4F8XA 1HJQA 2BXZA 2O92A 4FNUA 1JYNA 4QLKA 2G3NA 4UCFA 1UKQA 2DSKA 3UEQA 1B3YA 3MI6A 1A3HA 1WDRA 1L0PA 4C7DA 4ATWA 1J0HA 2VR5A 1BQCA 4YPJA 1I1XA 4NF7A 1VJSA 1NQ6A 4GO8A 2VZOA 3VSTA 2A3AA 3LXBA 2VQUA 4DWSA 3MS8A 3N13A 1V02E 1TQUA 4CKQA 1FFRA 3POHA 4GZEA 2F2HA 5E9AA 4PTVA 4GI9A 3VDAA 3VX0A 2YJQA 3VDCA 1WZKA 3SUUA 1JF6A 1SZNA 4W88A 1J0ZA 1NWTA 1UR4A 2EBNA 1W3LA 4RE2A 5E0FA 3M46A 1KXTA 3SCTA 4OUEA 4LYPA 4XB3A 4ZE4A 4AD0A 1QHOA 4B9ZA 3MV11 3CO4A 4CD5A 2CPUA 1CGVA 3T0BA 3ALFA 5CLWA 1Q6EA 3ARVA 4CU8A 3DECA 3OLIA 4PMDA 1V3JA 1KXVA 3W28A 2J8FA 2W92A 4D1IA 4PTMA 3LRKA 2D0GA 2XVKA 1XYFA 4W89A 3BUQA 2XM2A 4JFUA 2YFNA 4MDPA 2YL6A 2FDMA 3IGUA 3CUIA 3H54A 5FIPA 5DT7A 1ISVA 1HP4A 4EANA 3SCVA 1HX0A 1J0JA 3IK2A 1QPKA 1DEDA 3KL3A 4ACYA 1OGGA 2WBKA 1E56A 1WDQA 4MADA 3ARYA 5I6SA 1XRVA 3ZJKA 1LWJA 1R33A 2Y8VA 1MXGA 1MW2A 4M80A 3T2QA 1TA3B 1E4NA 4A4AA 5BXTA 5HOSA 2ZX6A 3WY1A 4JKMA 2WHMA 3VIOA 3BLBA 3GXDA 4AMXA 1SR0A 3N12A 3WD0A 4JFTA 3A4XA 4LXFA 1U30A 1C7TA 2JFEX 2D2OA 3HJEA 4PSPA 5E70A 5CXPA 4AZGA 4ATDA 3OGRA 3UG3A 3L4VA 5GNZA 5A94A 5D9OA 4B16A 1ISWA 1E6RA 1XHGA 1XH0A 3UR7A 1MQRA 4E8CA 1AQHA 1M7XA 3BXWA 3ZR5A 4R5EA 4EAMA 4ZXOA 2E9LA 1NWUA 3AIRA 3QHNA 4FLSA 2QV4A 1QOXA 1K9FA 1UKPA 4XUYA 3CPUA 4MJ2A 3GNRA 3WMBA 2VUYA 4P8VA 1E4IA 2Y5EA 4BA0A 2YIHA 2G8ZA 3PZQA 3TOPA 3H55A 3WH7A 2VURA 2XPKA 3AQUA 2ZUSA 1C90A 1G1YA 4NZCA 1V03A 2XIIA 1GZJA 1UQYA 3W82A 5A8NA 2DT3A 5DT5A 4UQDA 1C8QA 1C93A 2XGIA 3DX3A 3CZEA 1B9ZA 4W86A 1EHAA 3AIUA 1W1TA 4H8UA 1XSKA 1CECA 2X2YA 3W81A 4QCEA 5M5DA 2V3FA 2J79A 3VU2A 5I23A 3WQWA 2O9PA 8CGTA 2GSJA 2XYLA 3VKKA 1H0IA 2X2HA 1UKTA 3ARZA 2EABA 4QLLA 1JG9A 4M8UA 2TAAA 4MTVA 3SUVA 3A21A 3A47A 1CGXA 4MB5A 3DYOA 1J0IA 1CDGA 2X0YA 3ARTA 4FNTA 1ITXA 4KGJA 3WUGA 2WVSA 4U33A 4UFMA 2VJXA 3OGSA 4M82A 1V3KA 3ZR6A 4PCTA 3EDFA 1ZBVA 3ZJ8A 1L8NA 2HISA 1Q6CA 1GOIA 5CQ1A 4JAWA 3DHPA 1SMAA 3BVXA 1Q4NX 2PWGA 2ZICA 1XSIA 1UWQA 1EDQA 1QI5A 4LGXA 5AC4A 1QNOA 1OD8A 1CXIA 1WAWA 1UH4A 2IXVA 1K9EA 3RM4A 3TTSA 4UZUA 1CNVA 1G0CA 3A6OA 3EDDA 2ZUMA 2ZWZA 1ISYA 4UOZA 2E9MA 1GHSA 4AC1X 2PBGA 1OB0A 5EMYA 5LA0A 3WNLA 3L4XA 4C7FA 1KFWA 4Z2KA 4Q7NA 4Z2JA 3TA9A 2QPSA 2AMGA 4BCEA 1KCLA 2W4XA 2ZXAA 5DO8A 5HPOA 4FK9A 2VO5A 3UESA 4CD8A 1VIWA 3WNKA 4TUFA 3VSUA 1LL7A 1NWRA 5LYRA 4Y7EA 4GI6A 1A47A 1VBUA 3VX1A 4UTFA 4DO4A 1UASA 4RL3A 1JZ6A 3WF4A 2VZVA 3GH7A 3NSMA 2WVUA 4GIAA 2DT2A 3MMDA 3AMGA 3BVVA 2F8QA 3W24A 4NRSA 2YL5A 5TD4A 1ECEA 3IJ8A 1UZ1A 2DSWA 1ESWA 2YOCA 4OGZA 4UQAA 3QR3A 4D6IA 4UFJA 1QNSA 1QHPA 1B30A 4AWEA 4NZJA 3CZNA 5CPQA 3WQ5A 4WIWA 3AXHA 1E43A 1T0OA 2X2JA 2DT1A 2BY1A 2WW5A 5ABEA 4TVDA 2FHCA 1UR2A 1ITCA 3W38A 3EJUA 1C7SA 1UA3A 3BVTA 3M7SA 2XHYA 4Z2HA 1EOKA 4HPGA 2VVNA 4B9YA 1TZ7A 4AXNA 1R75A 4M81A 3WF0A 2PBOA 2D24A 3GXTA 1HJVA 2BV9A 5D9PA 2DT0A 2WWDA 4JFVA 3KEHA 2WYSA 4UNIA 1GJUA 1HT6A 2WMGA 3L4TA 5A2BA 2VL4A 2J78A 2G3JA 1E1FA 4LX4A 1H0GA 4MPKA 1UKSA 4D6EA 2PWEA 1QNRA 3QOKA 1UD8A 1JNEA 2XG9A 3HMCA 2JF7A 2EAEA 1H11A 4FNQA 2CNCA 3CHEA 4PRWA 3SEPA 4D6FA 4UOQA 2JE8A 4GO9A 3BVWA 3N17A 3VGHA 4RE3A 3CMGA 2J7FA 2YL9A 1HTYA 4AEEA 4PN2A 1R8LA 4UZSA 3BGAA 5ECUA 3IJ7A 1QHZA 5FKYA 3HG4A 2YLLA 1HL8A 4ZE5A 1IZKA 2DGAA 3OLDA 5AY7A 1WZAA 1D7FA 2EACA 1P6WA 1GOQA 2D3LA 4JKLA 1JFHA 2GJXA 4W5UA 2Y2WA 3NSXA 9CGTA 1W32A 2OYMA 1NH6A 1UWIA 1E4MM 3IAPA 3SIMA 1BTCA 1JDCA 1G01A 3AIEA 3N04A 4WKHA 5LA2A 2IUZA 1UR8A 2VRQA 1TFVA 4AZIA 3CH9A 1HVQA 2E8ZA 2ALWA 2ZUUA 1HKMA 3PTMA 2F7RA 1EGZA 3EYPA 1H1NA 4H2CA 3MMWA 1BAGA 1G94A 3D50A 3MV01 3VGDA 1QW9A 3ZQ9A 1WE5A 1K9DA 5C8BB 1V0LA 2RGLA 2Y8KA 3QGVA 2XM1A 3UG4A 1NOWA 3AMCA 4DUXA 3EMCA 5I5RA 1DTUA 1BHGA 1W1PA 1ZBWA 1PS3A 4TVCA 4MDOA 1BFNA 4HZ6A 3VIFA 3F5LA 1B1YA 3CGTA 4IM4A 4P7RA 2D3NA 1CLVA 3NCOA 1UKOA 2PC8A 3VD9A 2BS9A 3KZSA 4W8BA 2UY3A 2G3MA 2WPGA 2XWEA 2OW7A 3MU7A 1HNYA 3VD7A 2EEXA 3VINA 3EJSA 2WLYA 3ARXA 4WF7A 2XFRA 3M07A 3OLGA 3B8SA 1DP0A 1NP0A 3N1AA 4J3XA 4AW7A 3CMJA 1Y7VA 2JEPA 5A8PA 3MO4A 3PTQA 3BMWA 3JUGA 4WKFA 5A69A 2V3GA 1M03A 1EH9A 1W2PA 4H8VA 4CU7A 3KWXA 4YN5A 3AMDA 5C71A 1Q6GA 2XSBA 3GH5A 5D9MA 2E9BA 4TTUA 1KGWA 2ZX8A 1XCXA 2DIJA 1HF6A 3VOCA 3W27A 5BXSA 2WK2A 2VMFA 2W5FA 1W9VA 3MUIA 1B31A 3WL0A 1KWGA 3DYMA 3VNZA 3MUAA 2F18A 4XZWA 4MNKA 1B90A 4FMVA 1R46A 2ZX5A 2CEQA 4V28A 2CITA 3MANA 3AI0A 1V0NA 3K4AA 3K8KA 3A4WA 1W1VA 3S6TA 4BQ5A 2W67A 4CCEA 5CJ5A 4FLQA 3ARUA 1H41A 5A6MA 1UUQA 4JCLA 4UFIA 4J3VA 4S3KA 4FLRA 3A4AA 4PCSA 2WMIB 1E9LA 3POCA 3BUDA 2PB1A 1C8YA 2X0HA 3KLKA 3QOMA 4MNMA 1C3FA 2VI0A 4D1JA 3AS1A 1FFQA 2CHNA 1DWGM 3BCDA 4H8HA 2VCBA 4DO6A 5C70A 3KE0A 1BPLB 3N15A 1WNOA 4F66A 1JIBA 1BYAA 2OWCA 3VPLA 1KCKA 1PX3A 2V38A 2Z1SA 1DWHM 1W2VA 4HA3A 3BUIA 1WCGA 1B3VA 5CG0A 3VMNA 3T0AA 1OBAA 1E73M 1RD6A 1E0WA 4V27A 3PZNA 3CUFA 1DWFM 1GOKA 4HU0A 1ZU8A 2GFTA 4RE4A 4U2YA 2WBGA 3VIKA 4CN1A 1XSJA 1GORA 2CETA 3SUWA 4DM2A 5FCZA 1W1YA 4PYSA 4AY1A 1HP5A 3WD1A 3SCSA 3GBEA 3DX1A 5DFAA 3WQ6A 2NT1A 3D52A 5JIWA 4B3LA 2VTFA 1TE1A 5BWFA 1IT0A 1J01A 4D71A 1DWAM 3G6MA 2DEPA 1MW3A 1H2JA 1H5VA 1FP8A 3K4DA 1WP6A 3WNOA 1VJZA 2MANA 4TOQA 3PHAA 3BUPA 3K8MA 3WIJA 2VCCA 3E1F1 2XFFA 3RCNA 4KWUA 3OGVA 3QHOA 2FHBA 1Z32X 3VGEA 4JL2A 4UQBA 2XSAA 1H49A 2J4GA 3WEMA 2WMKA 4PMVA 5A6LA 1TA3A 3CC1A 5IHSA 3CTTA 4E4PA 5CSYA 1NOFA 1W3HA 1GOMA 4E2OA 2F7OA 3BH4A 2IGTA 2G3IA 1CXEA 2CKRA 5BYWA 3AMLA 2D0HA 5F7UA 1ZJAA 3EDKA 3GH4A 1JZ3A 3N9KA 1QX1A 2VNCA 1M04A 4ACZA 1QI3A 1MVYA 3DX0A 1MQPA 5GNXA 3EJQA 3GNPA 4ACZB 4QP0A 4X0VA 1OIMA 2EPNA 4W87A 1MFVA 1OWQA 4JFSA 1X6LA 2DPEA 1S46A 1Q6DA 1BVNP 4S3JA 3AZTA 4CVWA 4J7RA 5AYIA 5D8ZA 2UY2A 3SCNA 3F5JA 2Y4SA 2WHLA 3CHDA 3SCQA 1ISXA 4P7QA 1FH8A 2E40A 2A3EA 2DDXA 3T2PA 1CXHA 5A6BA 1WB0A 3B9AA 2ZIDA 2CCRA 1I1WA 4PUEA 4PMYA 1JYVA 4PMOA 3D4ZA 4MAVA 1LL6A 1NOUA 1XYZA 2DH2A 2D22A 5M3WA 2O9OA 3VDHA 2O9RA 2NSXA 2WM0A 3TTQA 3AICA 4NSBA 3AHTA 3BAIA 1GJWA 3VGFA 3ZSSA 4U5KA 4M56A 1BYBA 4U3AA 1KTBA 1JD9A 1W9BM 2VX5A 4AZCB 3WQVA 3RM8A 4A3YA 1GPFA 1PX8A 3RIKA 2PWHA 2VOTA 3WDHA 1UG6A 1H4PA 3AS2A 3T08A 1JXKA 3S5YA 1GQKA 2J8GA 3MKKA 4JKKA 2F61A 2PWFA 4Q22A 1TR1A 4PTWA 1B3ZA 5DEZA 1W9XA 3CBWA 1CGYA 3OB8A 3KLLA 1EO7A 1RP8A 4N0RA 1W9DM 1E5NA 3CZJA 4OIFA 1UR9A 3VGGA 3L2MA 3AZSA 2GDUA 4EKJA 4JL1A 1OD0A 3DC0A 2YDSA 4DUWA 3AIWA 1CENA 1MFUA 2W66A 3GBDA 3LPGA 3QHMA 5E09A 2WAGA 1KQYA 4DWSD 3N11A 5CZKA 4J3TA 3HG3A 2VCAA 2VX6A 5A2CA 3O2LA 4TX6A 4FNSA 1JNDA 3L4ZA 1C91A 3SCWA 4PUDA 2J7EA 1R34A 1WKYA 1EDGA 1EQCA 3WDPP 3ZO9A 1PZ3A 1VFFA 3O9NA 1CWYA 1TG7A 3L4WA 1RP9A 4WSKA 2HVMA 4M29A 5CSUA 2D1ZA
chains in the Genus database with same CATH superfamily
3MRNB 3GNNA 1XXDC 2JJTA 3BH8A 1Z9NA 4XT1C 3FTGB 1KB5A 1E3XA 4GXVL 4E42B 5EB8A 2HMID 3GVQA 3NQ8A 1VGKA 2AOSA 3C9NA 2CM5A 1TJGH 2CCLA 3S5NA 3JWOC 3IFOB 4Q4MA 1YEDB 2W3ZA 3OBKA 1RSFA 1E2WA 4DYKA 3IWUA 3QQ3B 4B4HA 5F89A 3LN3A 1WO2A 4WUUA 3QNYB 4N9DA 5EZLA 3HZVA 1US2A 4WRLA 5FKAA 1G9NC 4XNZB 1JDFA 3PPFA 3WF1A 3VOGA 1FORL 2R1WA 5DD3H 4P4KD 1DVXA 4TSAH 1XCTB 1T2QH 4LLUB 1E9PB 5DHDA 4BXSV 1JGVL 4PJIF 2OX1A 1TSHA 3L9YA 3OG6B 3HZMB 5BQ7A 5C0BE 1RH8A 3PZOA 4L3EB 32C2A 5E94B 1UHVA 2EKGA 3VXRB 2QTEA 1VFAB 4S1DD 1EUAA 2F74B 2PI6A 4LCYA 4XHQA 5JA9A 2ICSA 4R2GD 1O6IA 1EEPA 5DJ0A 1SGJA 5I3DA 3QJFB 1J0KA 1RURH 4JDBA 5I16B 1X5MA 4GRWF 5KYWA 5I0XA 1ZHAA 5D1ZC 2XN9E 1YNQA 4FAMA 1RIUL 4TM9A 4BFEA 3CLFH 1ZALA 2ENQA 5DQ9B 1E1EA 1CF1A 5ACZA 2WJ7A 3Q65A 2NY7H 1TUPA 3HFML 1F41A 1LEIB 3WKML 5IKCB 2BFGA 2WNGA 3ZVIA 3QZWG 4N28A 5IHUH 2D7MA 5KANG 1ZBKA 4NBZB 2BGNE 1FCVA 5KW9H 5CSZB 3B3IB 4QRAA 2J55A 2F9BT 3EGJA 1I1CA 4QY8A 4S1RL 5AEAA 3C52A 3KPMA 4NZTL 1IWPA 4G43A 2EUZA 2X4TA 2VDQH 4JREB 3MZ2A 1BJ1H 2UYLB 3SDCC 3WIAA 3S36X 3TEYA 1QBAA 3KJ6L 3BT2L 4ZXLA 3WLPA 1DWJM 1LQAA 2Y7NA 2HJFB 4TQ8A 3D4YA 5I1AB 3PUGA 1NJ9A 4AUYA 4UR9A 2R1YB 1YEIH 3RL1A 3H6JA 3VWKA 3AT0A 3NFUA 4PGEA 5EORH 3OKMA 3H22A 3HLAB 2FL5A 3APMA 1OTTC 2R1PA 4ZZKA 3WKZA 3T3PB 1U58A 4QCFA 2VSDA 4DZIA 4KKXA 1K5WA 4PGJA 4GH1A 1ZBCA 1ITBB 3OZMA 4P2YA 2Y06H 1DJQA 3PAOA 3PQYB 3TIDB 1DQVA 3FO9A 3I85A 5TDOB 4H9TA 1PCSA 3Q5TA 1KB5H 2CHRA 3NP3A 5E4IA 1IQDB 1TZZA 3AFLA 4BQ8A 1WDSA 3EPNA 4M7JL 3HPJB 1XIEA 4A8NA 5LDSA 3GEWB 2YAPA 4IGSA 2OXGB 4WVXA 4MX7B 3ZQWA 5L9DL 5BXPA 2E6YA 4QHKI 1BAWA 4JFXA 3S9DB 4CC1A 1ZLWH 5FX3A 1NVMA 4PR5B 1KCRH 2YMXL 2ED6A 4M4RA 3TNMB 3HF3A 2X4OA 5C9WA 3CV5A 3QC0A 2GGGA 2OXHA 1JV5A 5A2AA 3Q9PA 1YYML 3BGJA 5E6IA 2EEFA 3VUPA 1FIGH 4Y4FB 3LIUA 3WFLA 1RIHH 3O0RL 3NCYP 3O1NA 5F9JB 1AMXA 5HPMA 5ANMB 2PXYA 1JI1A 2OZ3A 3A3HA 3MCLH 3Q3GA 4HHAA 3DX9A 5B1BB 5BZDB 2X4NB 3VJ6A 5EWIL 2AJUL 4R9OA 4P3WA 4AH2B 4IMDA 4YSAA 4XRCB 3ABKB 4NQ1A 4XO3A 4PD4K 1NF7A 4JFFD 2QR6A 3F4VA 5IB4A 2X16A 3NTYA 4Z7NF 1U91B 3PBUA 2DZPA 2APFA 1DQJA 1TQCB 1T7ZA 2WN2A 5D7SH 4RKAA 3COOA 2P10A 4UFLA 4JPVL 1GK8A 2AKRB 2BBFA 2VDGA 4W9JC 3RM9A 1QK0A 4JPQA 4ZO8A 3V4UH 2F6AA 3C8FA 4C6EA 1OQFA 1OHQA 3D33A 4GINA 1TTIA 5LN4A 1YDVA 4FQXC 2VLMD 5AYUH 3LCYA 3TW6A 3MROA 1HH6A 4EVZA 1WWWX 3JBG7 4G1MB 3E5PA 2C3GA 4BF7A 4JZOA 4ZL1A 5GGSY 3D0VB 4GSDL 4PBDA 4OLWL 5HMDA 5TGBA 4FI4A 3FULA 3RYMA 3GMQB 4DVRH 2AJZB 4CN6A 4R7LA 4IHOB 3BAJA 4LU0A 1S5IL 4M6MH 4X0NA 2RKXA 4BKLA 4WUUE 1NDVA 1GAFH 1WBXB 3VVGA 1A6VL 3UXDA 4YXGA 3WLLA 2ICES 1IGSA 3P3UA 3KBNA 4UTHA 3G1XA 2Q2EB 3H2AA 5DU7A 3D3VD 3EFDL 2K6YA 2VC2L 2XNAB 2APTA 4Z9KB 3Q45A 5IB3A 1OX4A 4CA4A 4J4PA 3T0DA 2Q1EA 1V93A 1E65A 1MKFA 4WW2C 4GW1A 1IKNC 4PJGA 3JUYA 4WY7H 3A22A 3HG1D 3DSFL 3UOAB 1E4XH 4HUMB 4JTLA 1I1AB 5CILL 3G8EA 2I24N 1SOXA 3GHBH 4GMSL 1V3IA 3OW1A 3P3SA 2DZXA 1OCWH 1XUZA 3K6OA 2BVQB 2VDPH 3VGBA 3PGCB 2PYED 1FWDC 4XISA 4JYEA 2NY0D 1VEOA 1ID2A 4NIKB 4GRLC 1HW6A 4L64A 1M7PA 1SFSA 4Q4EA 4WI3A 3RITA 3CYVA 2UZXA 4GKOA 4L8DB 4PMZA 2PETA 4NNPH 2JVUA 4RAUA 3GDMA 1IZCA 3EYVB 4J3UA 2ALDA 2ZRZA 1CDYA 1CFTB 4JR5A 1E9IA 1FBIL 3HC4H 2XSKA 4KKBC 2FEJA 5KZDA 3TA3C 2A7NA 4MJ5B 3BAKA 9XIAA 4LC6A 1L6SA 4K9EH 1HHHA 2O4MA 1AG1O 4GZIA 3ZE0B 2VJ8A 3N6QA 4C6FA 4JCMA 3HZ3A 1EA9C 4YVVA 4BQ3A 1IV8A 2J1KA 4WUIA 3V5DA 3QTGA 4S39A 1XW8A 2QSCL 2NQLA 2ICWA 2DBLL 4CC4A 5ECVA 1XB8A 3HBQA 1IBDA 3EJTA 1YEFH 1KT2B 4FG0A 1NBVL 4MJID 2WHKA 1T1YA 3EMQA 5IG7B 4M0XA 4BKTC 1U92B 1LYQA 1E70M 3PAVA 1PJ9A 2BC4B 3APNA 4YXHH 1JTTA 4Y1AD 1FZKB 1G87A 4YVXA 1J11A 3UJTL 5JQHC 2Q76B 4NUGH 3WUFA 3WAJA 2FZDA 3Q94A 3S36L 1GQJA 1YE6A 3II3A 1WICA 3S1WA 2ATMA 2G4JA 1P9MC 3MLUH 4AZ5A 3WK2A 3HGRA 5JQIB 4CVUA 1HZHH 1GTEA 3ZL2A 5C1MB 4QHPA 2H8XA 2XWBB 1KGJA 1W91A 3HRZA 4PI0A 4FFZA 1R7AA 1JXDA 4PMQA 1EV2E 1UVQA 3NYKA 3CFDB 4ZFZB 1J5IA 4MYXA 1J1PH 4AQEB 1M05A 5IJVA 4PB5A 4H13C 3I6GA 5T3ZL 3ULUL 4X6DA 2D23A 4IOFC 2W9MA 1ZVYA 1ZPLA 4FNUA 4KUZL 4GHRA 1TLMA 4L5FL 3MI6A 3R5EA 1TUFA 1MJ8H 4HBCH 4OTXL 2ZAIA 3VNJA 5HQMA 1A3LH 1R3YA 2MOVA 3QI9C 4PG2A 5JOPE 3CFQA 2GQ3A 4WEUD 4GI9A 1H6FA 1YEGL 5DGRA 4DP5X 1EHLL 3SUUA 4BDVA 1NWTA 4WUKL 1Q1PA 2R0WL 2PDLA 3GG1A 2E27L 3MP4A 4HPOH 1EJ7L 3VRLF 4CEXC 4CD5A 3CO8A 1YBQA 1PDKA 4WI8A 4OB5H 1HEJC 5JXEC 2E7MA 3RX2A 2H3XC 2HKFL 1A9BA 2HNHA 3EB2A 2PTDA 5DT7A 1U93B 1S7VA 4GOSA 3SE4A 1EEZA 4HCFA 3WFEL 1ETA1 1HX0A 3IK2A 3Q01A 1I60A 1OHZA 4HCIA 1MCPH 5DCCA 1L2UA 1TV2A 4IUOA 1H15A 1YEWA 2OK0H 4JQVC 2Y8VA 3BPLB 4GIRA 4M80A 3GE7A 1E4NA 1K02A 4A4AA 5BXTA 1MNSA 4HWBL 4X5WB 2VDOB 4JFTA 4JVPA 2BS71 2BODX 2NXHA 4NO0B 4F9PA 3ZIMA 5MEPA 1XLHA 5KSUB 1YAZA 4PRNB 5C6MA 2VGFA 2J13A 1YKWA 2PC4A 3BI9X 3VTTA 3U7WL 5LNDA 3EYFA 3QV8A 3LEVH 2AJSL 4ZXOA 2FDSA 1GOGA 3EYQD 4Q4PA 2QV4A 4K73A 1K9FA 2FIQA 5LBVA 1YDYA 4MJ2A 1KJ3H 4RV3A 3GDRA 2VLRA 4K37A 5FK9B 3K6SB 3P2TA 4AZUA 4E3VA 3OZLA 4ENEC 4A2HA 3RB7A 4QO1A 5CINL 2DT3A 1HILB 3IDXL 4IRSB 4UT6A 2I9UA 2LTQC 5TE6H 3O16A 2X38A 4APQC 1XIWC 2J66A 2GK0A 4FPSA 1T0PB 3EJYC 3P9LB 3CVHB 3VI4B 5F3HB 3DV4A 1SJEA 2Y22A 5BUAA 4PJGE 3WLBB 4U7SA 4FFZH 1J7VR 1XL6A 5INCA 5GHWL 3G5YB 1OE1A 3QXAA 4RCXA 1DLHB 4H88H 3T0CA 1D7KA 4ZYKB 1R3HA 1FY6A 3SGDH 4QRPA 1JK8A 1MFMA 3I75A 5C0RL 5AN7A 1UENA 3PTDA 2XIOA 3WN5B 1HWGB 5DK0A 2QEJA 2VWEC 5FKPA 1IL1B 3HRPA 3TWCH 3HC0B 1XKJA 3LA4A 1F56A 1VLXA 2W4XA 4BELD 2HV5A 4Y7EA 5TK2A 4C4KT 2VL5B 4PRHA 5D8JH 4HWZA 5ITFB 3C2YA 4Q4SA 3E3HA 2BM3A 4XI5D 4F93B 1CCZA 4LEXL 1TTPA 3IJ8A 4O14A 4K3EH 4OUUB 2ICCA 2MPAL 2WUBH 3D69A 4NAQA 1CTOA 3UZQA 1O0VA 1BZ8A 3A4DA 3CZNA 4MWAB 2PP3A 4H8WC 2GOKA 2XG4A 3GSVA 4OGAD 3QFGA 4Z0XB 2R4SL 2J8OA 4Y2DD 4KMTL 5B38A 3RP1A 2H6OA 1ADOA 2WTOA 4J3OF 3MDJA 4ERSH 1DVUA 3IRSA 4HPGA 1B88A 4JMNA 1TZ7A 3N85H 4M81A 1HJVA 3KEHA 1JULA 5DJ8A 2Y70A 1FV1A 3O3UN 3CL6A 4B9CA 4PJXB 4PRPD 2YD2A 3RHWF 3C0QA 4U3SA 4BK8A 2WZPD 4ORIA 4DZAA 1H11A 2CNCA 3V2AR 2Z28A 1FZMA 1B9BA 1AI1L 2FMOA 4P5TD 1QHZA 3RVWC 1HEZA 2PDXA 3STPA 1Y0EA 1P0EA 1J8HB 4RX4A 1FCUA 2IUZA 2VRQA 7ODCA 5D70H 2E77A 3E49A 3RDJA 3CEPA 5EZOH 3QQNA 5T1DH 5KS9F 2PGEA 1VZIA 5BRZA 3N0PB 3IDGA 5J9PB 5EZIL 1WE5A 1PZCA 4AI7A 2OR9L 4LGSB 5I5RA 3ABSA 2XHNA 4TVCA 4UT6H 4MDOA 4Z7UF 5CEZE 4GEIA 2GWGA 5GS1C 4JGDA 2ESVD 5HJXA 1H7WA 1D9KD 2A85A 3NRPA 2XWEA 3VD7A 1NAKL 1MDRA 2EEXA 2FLMA 4PB3A 1MJUH 2G0LA 2DUXA 5AKQA 5KG9A 1Y6NR 1Z9PA 5C71A 4YFDB 3ZQXA 4G1EB 1ACCA 1CFBA 1HF6A 1IGIH 5B3JF 3SDDB 3RWIA 2ZZ4A 1E0TA 4K3JH 2F18A 3ARDC 4IDJH 4MNKA 4FMVA 1V0NA 5F4WA 2W67A 1PVHA 1PZUB 2LLNA 3W9EB 4QTFA 5EMKA 3E2RA 2ZBTA 3NJJA 2D03L 3V0VA 3CSFA 4QKXB 4FAAB 3PUEA 1IEBB 5DHVH 4G9DB 3AS1A 2XLLA 1LUCB 4EQ2A 2Z7ZA 1HJBC 1LK2B 5JPMA 3LKRB 1LD9B 2W9LA 4LSRH 4AGQA 5HHQB 2I7GA 2LT9A 5ADPL 5T8IA 4ML9A 4XVTL 3GWJA 2HG5A 3OPZH 4AB4A 4CNSA 5I07A 1E0WA 1A02N 5J0BA 1IGCH 1ZU8A 3DGCR 1CE6A 3VB8A 3QHZL 5LAXB 2OPCA 3LKOA 2JKEA 5KSWA 1GGBH 4FTDA 2ACRA 1HNFA 4WI5A 3EIFA 3S3BB 2VTFA 4GAJH 3GRGA 3P4LA 3V4PA 3ZYIA 1J01A 2DEPA 4AQAB 3BQUB 4KKNA 5C0QA 3CASA 1MHHA 3LI1A 2GTZA 4XP1L 1H49A 1M9WA 1X7IA 3N1PC 2VLRE 3QDJD 1NOFA 1N8ZB 4NO2A 5DVPA 4DPQA 5FUCC 4HIJA 2GUOA 5IMOB 3W1RA 1XBRA 2ZP0T 3ABQA 3FO0H 2Y7QA 1TO4A 4YQXL 5CKAA 4JFSA 1MNZA 1S46A 2K1MA 4PJBF 2PLJA 3W3BA 4E6MA 3C5ZD 4DLMA 2B59A 5IROA 2A3TA 5J11B 3QPKA 4QMEA 2CWRA 4FXKC 4TV6A 1UWYA 4KRMB 5MENA 1JYVA 4YNYA 2RFXB 3GIQA 1JPTL 5HVHB 3TS8A 2O9OA 1MRCL 2WQRA 1IQ8A 1U8KB 3PL6C 2Y2YA 4QRPE 4OLVH 5HI5D 5CKSA 3CV1A 3BXNA 3GSQB 2O5ZL 3BCJA 2PWHA 3WDHA 4EZMA 2VP8A 4AX3A 3GM0A 1KCVH 3QRGH 1P7QB 2Q86B 5CM1A 1B3ZA 3LKPA 1NIAA 2NY5H 4LSSL 1OK0A 2VLJB 1RHHB 3BP7B 5EEUA 2DWYA 4UTTA 5FGRA 2QPDB 3DC0A 3VYPA 4PRHE 3FRPA 1SHXA 1NDWA 5F2GA 4X6BA 5DC4B 1U5HA 3NEOA 3DFNA 4Q8OA 2ZUXA 2WBJD 5DDHB 1JK9A 3NSYA 3HM7A 2WSQA 1AE6L 2WTPA 3N14A 4JTDA 2XA3A 3QNZB 3M47A 3V0DA 2FB4L 3ELFA 1A6ZB 2VDMH 3FH7A 5E0CA 4I1RA 4ZW6A 4WV1A 1NPNA 1JPFA 3IM1A 3W56A 3AQDA 2EPLX 2G3ZA 1XD1A 3RY6C 1GYUA 2BY3A 1RJYA 2WXNA 1V7MH 3DROB 2AKMA 1A1NA 4NZFA 5HP5A 4EZKA 4HSCX 3GO1H 1NANI 1MVUB 5I76B 4ZB5A 3WLNA 4M1DH 1FH7A 4QSHA 3B7TA 1M1XA 5I0YA 1E0UA 4OFVA 2ZZ6A 2FFCA 5FDWA 1I4FA 2GK1B 2VFHA 2ARWA 2OMUB 3W84A 2EPOA 1ELSA 4M5PA 5JHLL 3NPZB 1KULA 1O9ZA 2ZXEB 3WTYA 2EXOA 3LU2A 1DBML 1CR9L 2OLAA 4FEZA 1S6NA 3V4PH 3QDGB 5FYLH 1UR0A 1QTYT 3BRDA 1PD0A 1SUJA 2DM2A 4IMAA 3HPLA 3PHOA 5AVZB 3ZKNC 3D48R 1XF4A 2PPAA 1Z44A 4LCCB 3TR9A 5BRZE 2Q8AL 4WFHD 4P2CG 4GQZA 5GSVA 4ENZA 1GOOA 3KL0A 3MZNA 2FLRT 2ZE0A 4UQCA 3Q2WA 5BVJB 5HVWA 1BW8A 3ULVH 4RGND 3UR2A 4XVJL 2O5YL 2YZ8A 5DJCA 3DHMA 1LE5B 3RGVB 5HD8C 3QUXB 1PHWA 8RUCA 4M43L 5FIEA 3T9WA 1REQB 7TAAA 3WIFB 1SEBB 4HOZA 3D39A 5EOTA 5CSBA 4OTKA 4D8AA 1VADA 4MAUL 1BGXH 2EILB 3DJTA 4AY8A 1INDL 4JZJA 4AEFA 1PKQA 2SFPA 5JMOC 3P7YA 4B92A 1WD9A 1TJHH 3B43A 2WOYA 2OX5A 1KY6A 3PN8A 4Y2NA 4JPIA 4JAMB 3WIHA 1LQBC 3O3DA 4XB8A 1HL5A 5I77A 4PCFA 3MJGX 2V30A 4ANVA 4RESB 1DDHA 4NN7C 4YZWA 2NQCA 3EWXA 1QBBA 2HJKA 3OZ9L 1J1OH 4GKSA 5DMGD 4HFWA 5DRZA 1CL7I 1I75A 3GSWB 4LLWB 1QR1A 1BFVH 4LMQE 2WNQA 1JI2A 5FL1A 3TOYA 1FAKT 1H3VA 3L4UA 1KRBC 5HHVH 1JPST 2WSKA 4BZ2A 5HMFA 1HJCA 4NQDA 4ADTA 1AKJA 3SY0B 5KEZA 4KTYA 1A7QH 5GS0H 2VM8A 4PJ8B 4X9YA 4CD7A 2DIBA 1ICQA 1WFNA 3HJZA 4B90A 1U8HA 5A3HA 2VAJA 3TJXA 4LPUA 2EDOA 4YDIL 1FI8C 3L68A 5EEZA 3GXFA 4OBSA 3IJHB 4XNQB 4N90D 4GQQA 4IS6B 3JWDH 3L5MA 3BP6A 3RWFB 2EEBA 3LEPA 4BWLC 3NL2A 4KROC 3WZ0E 1G7PB 3TYFB 3F2CA 4L37A 5D7JD 1H7NA 4XQ6A 5A8GA 2LR4A 3RX3A 5KZMA 3SKUD 3GVWA 6REQA 2R29A 2OWXA 3ULVE 4CEUC 3ITVA 2A7BA 4JTIA 3GZKA 3TO4B 3BLDA 1OIFA 1EXPA 2ZCZA 4RMWA 2NUPB 2ZUNA 2WCGA 3QNXB 4G8FA 4JTFA 1DL3A 2GSIA 1XF3A 3W4RA 4WCYL 4HVXA 1SZRA 5ELIA 1FNGB 4GKNA 2WJDA 1RPUA 1L6XA 1P7KA 5HJBA 1GYAA 3JTTB 1JJUA 1SJCA 3MACL 5IREA 3T2NH 1INEL 2FWSA 4EXPX 3RE0A 2DQGH 3QUZA 3WQGA 5E9DA 1QFWH 4N2KA 5F96L 3PPGA 1MNNA 3RL2B 1XGYL 3NO5A 1BYNA 3VM5A 2WLZA 5A8MA 3IMTA 1S5VA 4PD4J 3L1OL 3O2VH 5I82A 4BQ4A 2P45B 3LXCA 4Z1DA 1TYRA 3D18B 3IIOA 4MJ6A 4C58B 2MOQA 4L8BB 2XV0A 2E7DA 1F90H 2ARJQ 5K9OB 1F4XH 3WIHH 4R2GB 3NR0A 3SDAD 3NQEA 4GPNA 4U3CA 3ZHDA 3FN9A 4G9FD 1NU5A 5CZVH 3KRZA 4X61A 4I9AA 5FAGA 1AQDB 1KLFA 3MLRH 3TFBA 1E9OB 2ON3A 1E27B 1S3HA 2OZ4L 4AEIL 3WENA 3WXWL 5I1LA 5BNKA 2A1WH 1JNHA 3MRFB 5IJBC 2BVUA 1E1CA 4JYDA 2H1PH 4PTUB 1IEIA 2UWEF 4PJDA 2P5PA 3CQJA 5LIXX 3SE8H 4P8QA 1V6UA 6PCYA 4JRFA 3NDOA 3TPUA 2EQDA 3S6CA 3QS3A 4W4OC 3OJ2C 4RLDA 4ZO9A 1NMBH 1PY9A 4X9FA 1NGXB 2MQGA 2O56A 1K4CA 4LS2A 1EL3A 2H7WA 4XMLL 1UWTA 3FS9A 3H9SB 5JPNC 4GG6F 1H09A 1W72B 2BY2A 4L9DA 4U6HB 5HJYA 2G0KA 5DSCA 4FQLH 2Y1YA 4YHKL 3BPCB 4DGIH 1U8CA 4YPGB 2GC4C 1E0OB 1NGWB 3TU6A 1PAZA 4A3UA 2DMKA 4DAFA 4MM1A 5AHMA 5C9JB 3MCG1 3H7RA 4NXKA 2P43B 2F58H 3B2DC 1FWIC 2CDFB 3CH1B 2VZUA 4R7VA 1IEHA 4HN4A 3HAEG 3JVAA 3DKJA 2CRMA 5HUPA 4QHKJ 3IWVA 1JQXA 3AMKA 4LBEA 4IBTA 5LGYA 4GWEA 3D39E 5I0DA 1JAKA 1F2XK 2FLBT 4WTQA 1AJZA 4L4PA 1Z5HA 4IPLA 1FNHA 3ESVF 5KYXB 2V9UA 3NCBB 1PKQE 2NCEA 2QZ5A 4DQAA 4K2UL 5E1QA 1S8DA 2WMPB 1J05B 2FT6A 3WEBA 4D3CH 4AX6A 1KZYA 3RJYA 4LKCB 2W0KA 3UP8A 3V5CA 5HDQH 1PZ5B 1VKFA 3QY7A 2BVDA 3L66A 4POUB 1MRDL 4W81A 1M2VB 3P8IA 1MPAL 2QULA 3UQNA 4YSOA 1ZANL 3NGBC 3SUSA 4IFOA 2RGMA 3QUKA 4FHBD 2JJVA 5IR1B 3TTOA 4I9WD 4PY7A 3KR3L 3S0CA 5HDRA 1JRHI 3MWAA 5JUEH 4RDVA 1BXCA 4GBDA 2PWVA 4C6NA 4BM7A 4WDUA 2W0FA 5DRXB 4E2BA 1KN4L 1EC7A 1YN7A 4QJ1A 2IOIA 3ZUNC 3MHGA 2QQ6A 3R25A 5CGYD 3T6WA 1POJA 2YMOA 4KIEA 4LESA 3AXXA 3S2CA 4PBGA 1NGQH 1IBBA 1QZ1A 3K6IA 2M8XA 4FR1A 2PTVA 4FZEH 3P6LA 4GLRI 4JFFB 1NC4A 3B2VH 5G1YA 4YCPA 2VH5L 4P46A 2LVCA 2QCDA 1IBGL 1H3GA 3GRBA 2IDCA 4Y4KC 1VYSX 5F97E 1J9YA 5DBTA 4BZYA 3KS0H 4GH3A 5C2BH 4NQVB 3WJSA 4RUBA 1OFOA 2RDWA 3WNNA 2J88L 3QZWB 2XWTA 3LNPA 2BX5A 4AVHA 2NR6D 4HETA 1JPSH 3D0LB 1F3DH 1JYNA 4TSCH 4Z1YA 2Z29A 5TQ0H 3P9WB 4NNYA 1Q38A 4HSAC 3LGEA 3L08A 2JKXA 5LQBL 3Q2DA 3HA0A 4CKVX 2YW3A 2W07B 2G4GA 4LSVL 3AGWA 3VCLB 3QBTB 3V9FA 3B9KD 3SKMA 5I1DB 2V63A 5DMIL 2H0FA 4HV8B 1AGBB 3IT8D 1CGVA 2XINA 5D30A 3V7MA 5L8KB 4M61A 1ZXKA 4Z3GA 3LRKA 5IEHB 2YZRA 4O2EA 5E9DE 1F11A 3PAYA 4M7KH 4LAMA 2LAGB 3DX8B 4LZKA 4I2XB 2FRGP 3D3VB 4JR9L 4LVGA 4HK6A 3QJRB 3OJDA 3T71A 3O3AB 2YZ1A 1E9QA 3L5JA 1N5YH 2JMRA 4Y89A 2QGHA 4F2BA 2I57A 3DGBA 3HG1B 5F1UA 2FIRT 4YEEA 2V8MA 3VIOA 1ENUA 4K94C 4F7MA 3MRPA 3V36A 3KOYA 3N12A 5I0VA 3QCUH 2DLHA 1JUKA 5JLZB 4BFIB 1HXMB 3HKZA 5IB2A 1IO4C 3I74A 7FABH 3VG0L 3QN3A 2PYEB 5C0IB 1AQHA 4NRXB 2NY0B 2OR2A 1N64L 3BIAX 1HQ4B 2ZSVB 4NAFA 5HYQB 3QHNA 3ZLFA 3CPUA 3A9IA 1TQXA 4F27A 3PZQA 3TOPA 3B1TA 5FW6A 1BZ9B 1MFBL 3RIAK 4JDTH 3LZFL 4PJDE 2BCKB 2Z0IA 3MV9D 2ACSA 5ITBH 4M03A 3BE1H 2ALAA 5M5DA 1ZA3A 3PPCA 2EDXA 1MCKA 2D31A 2GSJA 3IDNA 1KG0A 1KTDB 3JWNC 3BARA 1CDGA 3IJSB 2ETWA 3PB2A 3GJFB 4U33A 5L4MA 3ZR6A 2UZPA 1OX5A 4DX3A 5CQ1A 2V4LA 1SMAA 2CK0L 1XZ0A 4PWHA 3BP4A 1MUJB 2IQDA 4EPSA 4MJIB 1EZWA 4UYPA 4ZPTA 3N4EA 3DKLA 3DURB 1JPKA 4F0SA 4M62L 4HKJA 3V0WL 2IXQA 5G5IA 2BDNH 3KLAA 3MOBL 5INDB 5EH1A 2PP8A 4YMPA 1T0NB 3DOSA 3U4EB 3KH4A 3V7AG 4RWYH 4C6IA 1RIVH 1A0CA 3WF4A 2VEFA 3ZVHA 1W80A 1UM4L 1LM8V 3UJRA 1UZ1A 4ALAC 2RR3A 3WL9A 1B4JL 5FAJA 4GAYB 1EJTC 4C55A 3FDKA 4WTZG 3Q37A 3N42B 2RQ8A 1DBBL 1YE4A 3AXHA 4W9DC 1R3QA 1YJDC 4ZFOB 3UDWA 3EUUA 4NHCL 1KTLB 3ITTA 3L3OA 4OZHF 4FP1A 3MV8D 5E1AB 5B7MA 2ADYA 4K8EA 1OF2A 1CMOA 1V7NH 3ZY7A 3EWWA 4TPRL 4HCRA 2QZQA 2O93L 3BP5B 1OY0A 1Z2KA 4W9CC 5GSRA 3MA7B 3ARFB 1Q4WA 2DVTA 2PUZA 3C6LB 2P49B 4D9RD 3KWVA 2XT1B 5IW1B 1MLCB 1WBYA 3ZRFC 2YC1B 2DWDB 3OLDA 5EO1A 6PAZA 3EHBD 1H3XA 4IBLT 4DVBA 4H0GA 3QAZC 4GQBA 4AIBA 2ITDA 4LASH 4W5UA 1ZVSA 3MRGB 5IESH 4BF9A 4XBPA 1E4MM 1BTCA 1Z5LA 3LNIA 4Y5XB 5CU9A 4WO4B 4H2CA 3MMWA 1Q8MA 4K8RL 1PZSA 4LYKA 1CDCA 2GQHA 3CIXA 4OGXH 4KX7A 3EYOB 4DXXA 2YS4A 3A13A 1ZBWA 5AVUB 1ZGLM 2D7NA 1GA2A 3NCOA 2E5BA 1RPQA 2V2WB 2OSLA 1IEXA 3DX7B 4GAFB 1ME8A 3FSWA 3T1GA 4ONHB 4N6RA 5I6MA 3B8SA 5E5UB 4LHUD 4C56A 2MKLC 3BMWA 5CUSH 3ATEA 1KTKE 1CE1H 1W2PA 4OU3A 1I7ZA 4XVSH 5DEGA 3F84A 3Q2VA 4XHJC 3ABLB 3TBTA 1KCBA 4V1DD 4NN5B 2JJWA 2VMFA 3QQ4A 3SRHA 1QKZL 2J27A 1N67A 2OMTB 5CD3A 2Z92B 1H6EA 1Z6KA 4GXUN 5A6MA 2PTUA 4E3TA 1CI1A 5IBLD 1DHPA 1HG3A 3MHUA 2NY6C 3KCJA 1L0XA 1C3FA 4R3UA 4ERAA 4D9LH 3OYZA 2FX7H 3QPQC 3BCDA 2O55A 4IIQC 2ZOKB 5C2GA 4KY2A 3LHPH 2LU4A 4KRZA 1ACYH 1I82A 1A65A 1A9EA 2AEWA 3LS9A 2EG8A 2VXVL 5FO2A 4LPXA 4RA0C 4V27A 1Q9OA 4AENB 3LVTA 2FATL 1KEMH 5CZXC 4RXGA 2ZXWB 4IK7A 3KXFD 1ONEA 4P04A 5DVMA 2N4IA 5KMYA 3TASA 4OLUH 3MLSH 2FYMA 3RWDA 2C3VB 1VCFA 2N0MA 4L1HA 4Y4HD 1FWRA 2OMAA 3SFKA 2DMHA 1OFRA 3QCTL 1IT0A 1X1OA 4MA3B 1UB5B 3EKCA 4FNLH 3L3JA 4HCRH 3RCNA 1I9JL 2HPTA 4OJEH 5PAZA 4PMVA 1KJVB 5KJ4A 1BM7A 3CSYB 4MTMA 4YSUA 1L6WA 5F7EL 3ZYOA 4E2OA 3WQEA 1SBSL 3B6SB 3OWRA 3AMLA 1H6UA 3GH4A 1AXTH 2VNCA 3PGFL 1ZLEA 2DZBA 5EMMA 3SGZA 1F1DA 4FA3A 3S5SA 1N3NA 2CO6B 5FSDC 4YHLH 1V7YA 1BVNP 3CC5B 4UUJA 3SCQA 4O11A 2A3EA 2IPUK 4LGPB 5CZRA 4PUEA 3W3OA 4HSOA 4JM2D 4NP7A 1AZBA 5BMFH 2C26A 2C1PB 2YD7A 3BJLA 1JGUL 4IBYA 5FGSA 4KMLB 2NSXA 3DVGB 3AICA 1G6CA 1U3HC 1XZWA 2JKPA 3EOOA 3DMMC 4PRPB 5IQMA 3PBYA 3GSOB 4J2MA 4WGVB 1UG6A 3KYKH 4HIHB 5GGUB 2F61A 1LDPL 4QDGA 4BUQA 4Q8VA 4ZQMA 4P5TB 1KM0A 3L0GA 3BQVA 5IFAL 4HUVA 4DF0A 4EN3C 3K2MC 1XTMA 2L8AA 4DY1A 4MKSA 4OZ4B 4Y7MA 3HMXH 3VFNB 4W9GC 2PCPB 1EDGA 1FQ9C 3K72A 4AV0A 1NFDA 3ZO9A 4M6UA 5F7FA 2Y5JA 1IU1A 2XXCB 4IQHA 4M29A 3ZZSA 2D1ZA 3BKJL 3GWQA 1XBXA 4K2SA 4FQ2L 4EXAA 4XBGA 1J96A 2ESVB 2B4CH 2YPLA 1DOSA 1NSNH 2Y7DA 1D9KB 4AQ1C 3F7VA 5D1XC 5HHOD 3CDGB 2ABAA 1GUVA 1QLFA 4H9UA 3WLIA 4WVRA 4XGZA 2BP0B 1YECL 5TFSL 3SGJA 1JDAA 1WBZB 2QCLA 3L5WA 4O18A 1HINL 2J8UA 4A35A 4HIIB 4LUSA 3FBQA 2XACC 1OC6A 3O3BB 5E23A 3B97A 3CQFA 1SJHA 2KYIA 3LLXA 1NCDL 1MWAL 1AHMA 1OM3L 2XN0A 3CZGA 1V0MA 4N4YB 1XC6A 1GKRA 3SPIA 4IRJD 2OJZH 4JJ5A 2QIWA 4P23A 3HI1A 4MNQB 4YTTA 3MNWA 4HUWA 2O4QA 3NCMA 3CBRA 3B34A 2PRMA 1WC7B 5FYJD 1QFHA 3HS0C 5F7LB 4X22A 3X11A 1TO5A 3UAJD 4CQ8A 3FS2A 4AYBA 1TZGH 4FCHA 3IGSA 1S3RA 1A5FL 2KX9A 4D6GA 3HIZA 2W61A 5FJOA 2DZUA 4O2CA 3ZMRA 3FZUD 2VX4A 1TPVA 4C56E 2AQNA 4ZQKB 1R47A 4HA1A 3CFJB 5I18L 1BWVA 2EDNA 2FUTA 3KBEA 2WWCA 1X3DA 3FPYA 2AXWA 3IIZA 3KOZA 1R1CA 5D04C 3BZ5A 4M02A 3F7RA 4MJZA 3OHXC 5C97A 4DUVA 3QDJB 1XG3A 3ZJ6A 4XZBA 2ZWSA 2OL3B 5CHNA 2AK4A 4UAOC 2QGBA 2WOBA 2A21A 1YPIA 3T5WA 5C0AD 1YX1A 1JZFA 2Z9TA 4HGKC 5DK2B 3VQMA 2F19H 4HPHA 2R56H 2O4EA 1MN4A 1WZMA 4UINH 1YN6B 3C5ZB 3A12A 3C60D 2FIKB 1WD8A 4Z2GA 3X1EA 1EPFA 4JFPB 2OAAA 3O4LB 2XKNB 3PM6A 1KCSH 2V6HA 2WTRB 5IBXA 4RMRA 4NHVA 1V6VA 5EN3A 2WMIA 4H8NA 3GMMB 1HXYB 3GBMH 3PREA 2HT3D 4HB7A 4F8LA 2YA2A 3HEIB 5IK3A 2FUQA 3JTBA 2X12A 3BUVA 4J2PA 2BWIA 4C4KO 2GOUA 4KRNA 1PG7X 3QH2A 2X7LB 5EMLA 2CKSA 4WW2F 4P3DB 5DEJA 1KYOK 3LY6A 3ARQA 2JGQA 3GSNA 1KCUL 1OAYL 1L6YA 5AG8A 5H4ZA 4RDQG 2PCYA 3ESUF 1R5YA 2XVLA 3WLQA 2QKFA 3FQUB 3KM1A 3AWFA 3MJMA 2P42B 4M4PA 2A6KB 2CH8A 4JN1H 3R8HA 1C29A 1GVIA 3OAYH 2PTYA 1OALA 1TJ0A 4MQTB 3SJNA 4GD0A 3SSJA 3Q9QA 3EXSA 5J89A 1FCGA 2C1OA 2WBJB 4MMZC 1CD1B 2I32A 4O58H 4ALDA 4IJ3B 3QEUB 2DORA 1AHWA 5PTDA 2PLTA 4AZ8B 2X44D 1V8HA 3LD8C 1SMDA 1OO2A 2VN4A 1C5BL 3S47A 3FAXA 1HE8A 5CPNA 3B5GA 4ZFGL 4KZEH 3DX4A 2HWZL 1I2PA 3FB7B 4K1GA 3ELAT 5T26A 4UXDA 3BDYL 5DD0H 3LVEA 2AV7A 4E2DA 5ERWA 1RQHA 5EBMA 4Y9NA 1H8NA 1E5UI 2GYSA 3VFSA 3V4VB 4EDWH 2PFHA 1EEYA 1LEKB 5AZ2H 5MI0B 3S2AA 3NQGA 4XBSA 2CLHA 2AZAA 4U31A 4AUUA 2ITEA 4HZ7A 4B9JA 3PP3K 2OSWA 4HS8H 2WAHA 5JHMA 5CU5A 4QG8A 1XBZA 1KBVA 3OHIA 3GUTA 4F58L 2GITA 5ESVB 3LRMA 3QJOA 4HX1A 2M26A 5F9WC 5DJDA 2IDQA 1NFDE 4KJQC 3EPMA 2X1PA 5FGCB 3O8XC 2BG5A 5HJLA 2IQ9L 5AVVB 4HTYA 3D7PA 4AY0A 1RA0A 3KCOA 4RGNB 4JY6B 4IU3A 3SY8A 2YPLE 2UY5A 1J1XH 3RWEA 1AP2B 4ZUVB 5D02A 2GFBA 1OVZA 4W93A 1IGMH 1IGJA 1RZKH 4MA8H 4PS3A 4ZTPH 4Z77B 1EQPA 3R4DA 4R6UA 3NEVA 1KPVB 5HHME 3MRNA 2CDEB 1Q8JA 2NUXA 4IIHA 2J8UE 2QEZA 1G0YR 2DKMA 1ETZB 1TVHB 3FTGA 1JHKL 1XB3A 4E42A 3UBHA 4G82A 3IEBA 3IJQA 5BU9A 1MFDH 1WV2A 4PJAB 2YAMA 1KR1A 3IFOA 2YOAA 1YEDA 3LQMA 3O07A 3GXPA 2YUWA 3GSNH 1W3KA 3QQ3A 4DN3L 2RMNA 5DHVA 3EBAA 5DD5H 2WWKT 1A6AA 2Y07H 4GNKB 3QNYA 2FGWH 4OLZH 4H6QA 1NMAL 3FQ4A 3MSPA 3AS3A 4F9DA 1QWKA 2EXYC 4HALA 5DURD 4N22A 3ZIZA 1XCTA 2EVHA 4LLUA 3UVAA 3T4CA 3QLDA 3CN0A 1UWUA 4BGDA 4MHHI 1E9PA 3GK8H 1XIDA 3RZCB 3HZMA 5LUMA 3C56A 3S3PA 4L3EA 3ATFA 2NZ9C 5E94A 1FPTL 3VXRA 1VFAA 4EIBA 2WQVA 3MPCA 1PAMA 2F74A 4Q3MA 2B31A 2FE0A 1TT6A 3AU1B 3ABRA 4NOBA 3LBCA 5HVFB 1M01A 3QJFA 2QGCA 1WBHA 2LU3A 1M3JA 3L5XH 1DQDH 2AEPH 3B8TA 5I16A 2GABA 3P9MB 3MAWA 3PR2A 2NXZD 3O8AA 2QDDA 3BE7A 1QYGL 4Z1PA 4B2DD 1E4KA 1DJZA 5BUGA 4XE5B 5DQ9A 4E9VA 3C0LA 4O02L 1K7EA 1LEIA 3N3EA 2AK4E 3EBIA 2WKGA 5IKCA 5D7JB 3TV8A 4R5VA 2F7QA 3L12A 3KBWA 7PAZA 2C9PA 5LXGH 4MNJA 5CSZA 3B3IA 5B8CC 1EMTH 3S2JA 1E90A 3FXIC 4IMEA 3NIYA 2GSHA 2DB8A 4GZ7A 3DESA 2UYLA 4B9PA 5FF4A 4RQQB 1AQ0A 4KQ4L 2O9TA 3A67H 3O6KL 3NCEB 3IRPX 2HJFA 5IJKA 4X6DE 3R06B 5HDLA 5I1AA 1S7XB 4MMXB 1IT8A 2R1YA 1REIA 2H9GB 2XPGB 5EU6D 3VWJD 1AH0A 4YWIA 1K85A 2PU0A 1BIHA 5KWYC 3HLAA 4DELA 2CKBB 4CILA 4TX9A 2Y24A 4DJEA 3PK7A 2BVYA 2H2PC 2A6IB 2EADA 2VX7A 1GYWA 1FQ0A 4TOYL 1PKOA 1E6ZA 3PQYA 1FJ1B 1WT5C 3TIDA 4KGLA 3T6CA 2IMRA 1G7QB 4PUUA 5TDOA 4HCLA 3QYNA 1IQDA 5HTSA 3V4BA 4RNIA 3UO1L 4E41D 4FG4A 4NJAL 3HPJA 1PG7L 4JGJA 3H3KA 1MFEH 4NUWA 1DBAH 2OXGA 3ALPA 2WBXA 2CLZB 4AGLA 2XQYG 3WU1A 3FCUB 2DSKA 3PY2A 3SDAB 4MX7A 1UJ3C 4G9FB 3FUJA 1J8VA 5I3KA 4JTHA 4IG2A 1FFTB 4HNLA 2V6AA 2WIMA 2Z34A 1TQUA 4PR5A 4GZEA 2F2HA 3DKHA 2C91A 3VDAA 3GW0A 3TNMA 4DP0X 1VDGA 4I8DA 5L2KD 2VFDA 2AEQL 4PJ9B 4H0LC 2CU9A 1TTBA 3VYOA 4Y4FA 3EO9H 2AXHA 5F9JA 5JXAH 3FH8A 4BA8A 1XGDA 2IF7A 2XM2A 5ANMA 2FDMA 4U6VL 1UA6L 2YD5A 1EJOL 2UUDH 5F7WC 1PZBA 1NPUA 4HJJL 5BZDA 1VGEL 2X4NA 3FQYA 4ZTXA 4GYKA 3TF7C 4XNUH 3KRBA 3T9PA 4AH2A 4JQ4A 6TIMA 5FYKL 4I48B 4XRCA 4MADA 1OSZB 1LWJA 1DO5A 3T2QA 3BVDB 1UMYA 4S0HA 1HFUA 4NP4L 3KNBB 5GISH 4DF2A 4IXHA 1C7TA 2TSAA 1U91A 3LQAH 4FXGB 4YIWA 3CPLB 2YAFA 4RMUA 5F9AC 1G9MH 3F64A 4EAMA 1T6WA 4H6KA 4HJIA 4F7EB 1OB1B 3GZQA 5K69A 1PLGH 1SVBA 4G6KL 2A1YA 4IKJA 2G8ZA 3UTOA 4YJZL 2XIIA 4HK7A 2AXFB 2W94A 2XZAH 1TVLA 3CZEA 1P6BA 3AIUA 1FCCA 3H21A 5AHNA 4G1MA 1CECA 2JJSC 4GAGL 3GI9L 2IVFC 2O9PA 5CKGA 2Y89A 4EAYA 5D71H 3D0VA 3PSVA 4M00A 4X80L 3VD1A 3O2DL 2NSOA 1EJVC 3GMQA 2AJZA 2F6XA 4MBOA 4IHOA 3IGAB 3VA2C 4M82A 1QFOA 4O12A 2HISA 1GOIA 4OQVA 1WBXA 3DHPA 2H6PB 3E0VA 4P5KB 5KYYB 3IJYB 1CXIA 4AVIA 1AD0B 3TTSA 1CNVA 1MFCL 5J13C 3I2CL 1GHSA 3RPDA 5DD1H 2XNAA 3P81A 3RY4A 3A6CL 2KDGA 2VXSL 2Y36L 4L3EE 2WB7A 2E46A 3VXRE 3QJXA 3WNKA 4IIZA 2I26N 4OCWH 3MXWL 2YAEA 3B06A 1S3KL 1Z9OA 3FCPA 1I1AA 3PPEA 3RXZA 3TQ0A 2R0LL 3TNOA 4KXAA 2J8HA 1RUAL 1MF2L 2BVQA 1IE5A 5CG7A 4DBDA 1JHTB 3PGCA 2YOCA 3CH0A 4UQAA 1MEHA 3WHE1 1O6TA 5T33L 2X6CA 4Z7VF 1C5CL 3FB8B 4PM1A 2WV8A 2PTWA 1GGCH 4GUPB 1KMGA 2FHCA 1UR2A 2NY2D 4L8DA 4RGOH 3R8RA 5C5YA 3DIDA 3OB0H 3EYVA 3KHOA 2XHYA 1CFTA 4C6OA 4XD5A 3HB3D 3U4AA 4YVNA 1IM9D 6FABH 1URLA 4F15C 2WWDA 5G4MA 2DF3A 1DUYB 2PRHA 3C3NA 4MJ5A 2V7HB 3HI5L 4KESA 1H19A 5F1KC 4D6EA 3EPOA 2Q8BH 2IPTL 1UD8A 3LQGA 4XX5A 3C2AL 4FG6C 1MZZA 1ET7A 5KJRL 2HFEB 3KLHC 3GVRA 5GJNA 1DORA 3MLTB 3FUMA 5DRCA 1R8LA 4HJEA 5ECUA 3B9KB 2CJUL 4N2FA 2FEDD 3WMQA 1KT2A 3ROLB 4AEHL 2GBAA 4KQ3H 1O5QA 2FLIA 3IAPA 5IG7A 3SIMA 4XOEA 1U92A 4N6FA 3WS6C 2DTSA 1ADQL 1NUGA 3T3PE 1HKMA 4JEJA 2BC4A 2WQDA 2QAFA 1FZKA 2E5EA 1ICPA 4WOQA 3HAEB 5DFVC 3G9AB 3A9BA 1UWGH 3T3MB 2Q76A 3ZHLA 5MF5A 3PQYE 3ZTEA 3QGVA 4RPPA 2LFGA 1I1YB 1YEJL 1SPQA 1AH1A 3NCFB 4KQ0A 1PCWA 2JKJA 2KDYA 2UY3A 1ZLSL 4A7QA 3VINA 4F7CB 1MRFL 3UZEA 2XWBA 1DIKA 1TITA 3CMJA 1OJXA 3S37H 3QJHB 3P11L 3REWB 3CHPA 3W73A 5C54A 2BSTB 2XOTA 1MREL 3CFDA 4ZFZA 4JLRA 1NMCC 4AQEA 3PGDB 3W74A 2WK2A 3GLDA 2W5FA 3U2ZA 2JB5H 4M6VA 3MUIA 4S3CA 3EWCA 4AIZB 1J5TA 3MUAA 5KVEL 2CITA 2A9DA 2WJZA 4G7SB 1UUQA 3KWWB 1OANA 4HCDA 2AQRA 3HNSH 4FLRA 3WV0A 1GZHA 3MV9B 4ELMF 1FIEA 3HPSA 3MLXH 3E8UL 2GHZA 1Z9AA 2P4AB 3EYUH 3H2MA 5ANME 4IMKC 4H8HA 5FYLE 2VCBA 3KE0A 2JQZA 3QQ1A 4JHVA 1WNOA 3VE7A 3KPNB 4X4XB 1SLVA 2O5XH 3NIGB 4ODSH 1EFQA 3VFOB 1ID5I 3AC0A 1G6RB 3TYBA 2BIMA 1MNUH 2ZPKL 4XCFL 4OM0H 1OBAA 1E73M 1JFQH 2XRAL 3T6ZA 3JWOL 2Z93A 1G1OA 3NQDA 3SUWA 3SO3B 5BJTB 5L6UA 3V52L 3F00A 1K8ZA 1DSYA 2P50A 1TE1A 1U93A 4DB7A 3M41A 5I1EH 3Q05A 4JDVB 2BJMH 4ABUA 4POYA 1WP6A 2FT7A 3GHSA 1VYRA 1W0YT 4HNOA 4AQOA 1V5XA 4UQBA 4QROA 2ATSA 2J4GA 4MXWH 3B0PA 5MENE 3D46A 4AVFA 4E4PA 4X5WA 1BQLH 2GHWB 3VI3B 3SE3A 4RH4A 2DAVA 2QHRL 2CKRA 4NO0A 2BERA 1LRTA 3F8UB 3GIZL 5GIRB 1QI3A 3KYOB 5KSUA 4FR6A 3UJFA 4PRNA 1WFOA 2CHZA 3IRDA 3CU1A 3KDMB 1ORSB 5F44A 3HUJF 4C1NA 3N06B 4XNBA 3W2NA 4W68A 3D08A 3B3DA 2FBJH 2WINB 3VXQB 3KPRD 3A4EA 1T6BX 3W11C 1CWVA 1ZRUA 4KHTL 5TK4A 2AITA 5ABAA 4BSVB 5FK9A 4FSAA 4JFHE 4JPWL 4P4KB 3SZ6A 4PMOA 3D4ZA 2R0ZH 4OI9A 2MJWA 1KIPB 1HILA 4Y90A 4IRSA 2WLNA 1XBVA 1ZNNA 1PYFA 2NXYC 5DBUA 3FQXB 4JY4B 1E3FA 1IB5A 1A2YB 3KCWA 3PAZA 1T3FB 4NN6B 5F70A 4OF0A 1QMLA 3S5YA 3P9LA 2V5YA 2PCFB 3CVHA 3VI4A 1KM3A 5F3HA 1PW3A 1RVFL 1S5MA 2J5LB 3CBWA 4N0RA 1JZGA 3WLBA 1W9DM 4Z95H 1BZQK 4R4BB 3AZSA 4S11A 3G5YA 3EHBB 4YDLC 2HUHA 5AB2A 3KP1A 1SXBA 1DLHA 4DZBB 4ZYKA 2HS8A 5C9UA 1LBMA 2CIKB 3QUHA 4I8YA 3PG8A 1C91A 4UQIM 3WN5A 4KPHH 1IL1A 3BKCH 3P0YH 3HC0A 3LZRA 4APXB 4RGMC 1PZ3A 4FYQA 4QF1B 3NQBA 4A3QA 4WI6A 2YSWA 4YTUA 2KZHA 5JYMA 5IFTA 4FMKA 1JUBA 1A5SA 5IFHH 2B08A 4XG1A 2V5LA 2VL5A 3E9UA 3RLUA 2NQJA 3D06A 4B5ZA 5ITFA 2QKIB 2RACA 1YAIA 4FFYL 1KV5A 4N3UA 4PRIA 1RMFH 1SFDA 3S1GA 4E4FA 3FXYA 1ODZA 2YSTA 4KV5F 4C60A 3SCOA 4LHUB 4OUUA 1GZPB 2OULB 1AJ2A 1X5LA 4I3RL 3WH6A 2B7QA 4MWAA 3ZE0E 3EJCA 4O1EA 4AYDC 3NH7L 4R90H 4W7VA 1H0DB 3FUNA 4QS5A 4V1DB 1AY1H 4O57A 3C0JA 5B3SB 4Z0XA 3I9GL 3AXMA 1URZA 4KCWA 4XAWH 1GONA 1Y5XA 3QRBA 1SDAB 5EKYA 3TVAA 2Z00A 1SEQH 3EYSH 4PJXA 2DYRB 4PGLA 1F4AA 1TG8A 4NO5B 1IC5H 4HFUL 2YQ3A 1EZ2A 4Q8UA 2VDOH 1XR9B 3GIPA 1PSCA 2WXPA 1C9SA 3ZDZE 2F84A 3SGEH 1I9IL 1IXNA 1N0XH 3MYZA 5B1CA 1VEMA 1NINA 5D7IB 5CZ0A 4HMCA 1J8HA 2CZVA 3CLEH 2XUCA 1H7OA 4WWPA 3FTVA 5BV7L 4OFIA 2PP1A 3N4AA 5I5JA 5IFPA 3KXFB 5E8OB 3H8AA 4FULA 1RVGA 1AK5A 4X9IA 3UCCA 3UA4A 3WSQH 1NWPA 4G11A 4HJ0C 5BO0D 1TZ9A 3UR8A 4YTQA 3NJNA 5J9PA 3G1FA 3CD4A 5F9OL 4Y4HB 1GQLA 4KY1H 4PJ5D 4MWFB 1KC7A 3VIJA 1W1B1 4Q8TA 3QC3A 2QSQA 1ZHBB 1LG2A 5K9QG 3QEGH 2AJXH 2Y6SC 3P40A 1FKWA 3MT1A 4JB9H 2G5WA 2GIXA 4NQDE 3H2WA 5DVLA 3L45A 4WGXA 3CVHH 4DEPB 4WK4B 3L67A 3ARPA 1EGJL 4IPNB 5FHAL 2F1BA 4WEBH 4G1EA 5BZWB 2FVNA 1XX9C 2VSMB 4KERA 3SDDA 2A6JB 2ORBH 4FJYA 3L4CA 2D8KA 3W9EA 5CWSB 3FYIB 3LHTA 3THCA 3VKDA 2AABL 1FCQA 5B4MD 3QSKB 3EWDA 1J10A 5I3GA 2DEWX 2QJNA 4XMPH 1IEBA 4G9DA 1DSFH 4F7TB 1LUCA 2C4XA 4KMQA 2XX1A 4QLJA 2YCEA 1LK2A 3MYJB 3LKRA 3SN1A 1LD9A 2NY4C 4XOAA 5HHQA 3VD4A 1HCFX 1CF8H 2HUEA 2Q10A 1GZQB 5DMMA 4MYAA 1JRCA 2A5UA 3QO1B 3OVPA 3DZ1A 4M3PA 5AC7A 4HN8A 2FZ3B 5LAXA 1KYOJ 3RMEA 1PCKA 4I85A 1X98A 3CAFA 3CFBB 1QUNB 3G9VA 2VN5A 4KEVA 1J87A 4L3AA 4AQAA 3BQUA 5A2JH 5LHDA 3EO1B 3KLQA 1UD3A 1W9UA 2YQGA 1JCVA 3MSGA 2ZZ1A 1L3WA 2B3IA 2CZDA 4N0FB 3U30C 1MY7A 1F9CA 1N8ZA 3N41B 2O72A 3WEAA 4DKFL 2P88A 1ZSHA 5F4XA 5IMOA 3T0VA 4LOCA 1F6YA 4JQIL 4IKKA 4AMKH 2AQTA 1XR2A 4OIBA 5DCDA 2POZA 3OSKA 4DKTA 1CBGA 2Z8VC 1R3TA 4MXQD 1D5IL 1FA2A 5AB3A 4LCIL 4PWJA 6A3HA 1KPRB 4HAKA 1KF9B 3RX9A 5KJ7E 3WEXB 1V3MA 3MOAL 3WFDH 3K30A 4NNAA 3VI4E 4FFVD 1PZAA 4QXGH 5HDBB 4I0PD 2PSNA 2OZTA 2RFXA 5FWQA 3J8F7 4URKA 2FZ8A 4QNPF 1RULH 3HS8A 2CU0A 3AHVA 3GW3A 1U8KA 1TV4A 3OR6B 4PN6A 5H2ZA 3GZPA 3GSQA 1YEYA 5ADOL 2DI9A 1FAIH 1FWSA 1RY8A 2GEQA 4OFYA 4DPRA 1P7QA 2Q86A 4H20L 1AO7D 2EIEA 2B5IB 1PBYA 4NJJA 2VLJA 1RHHA 3UZVB 3BP7A 2HVBA 3URNA 3MLVL 1I1RA 1DVSA 2YA0A 2VDNB 3VDBA 3LCFA 3ULSB 4ES9A 4LHUG 1PY0A 1OP5K 1ZDSA 4GAAA 3QMTA 4PRIE 3BHBB 2IGFL 3K80A 3MRHB 4A6GA 4K8GA 3ZTJG 3OGCB 3VZZA 5DDHA 2XQBL 2ADGB 4LU5L 4Y0GA 4MWAE 2PF6A 3AIVA 1RH9A 1MCOL 4FEMA 4J40A 3TYCA 3QNZA 4I90A 4EWND 2IMMA 1A6ZA 1VYPX 3UZWA 1F05A 4D7BA 4H5SB 1QLEL 4P7LA 2EG6A 4TMPA 3KS5A 3V1PA 4D6DA 3VQLA 4Y1AB 3RJOA 3TU9A 2ZJSL 5SWQB 3NQMA 1HHIB 3DROA 1THCA 3G6AB 2A77H 2YDQA 5BRPA 4PJXE 1Q2RA 1MVUA 4B5TA 1IAKB 4H9XA 4IUGA 3D0AA 1SN2A 2UV3A 1G7UA 2CLOA 2GK1A 4WU7B 4MGGA 3MGTB 2WC4A 3H3BC 1SW7A 2OMUA 3WK0A 3MRKB 5J6SA 1W5MA 2X09A 2QF8A 3WOVA 5DRWB 4NQUA 4HXBL 1J8HE 3S3GA 3QDGA 1DIOA 3SDYH 2SEBB 1N26A 2WOQA 3FYOA 3D3AA 4D6CA 3IDUA 4E9YA 1XGRB 3PWUB 2R1KA 4PW9A 4KWVA 1WUEA 2R82A 1HVXA 3UBXB 4KNQA 3AUJA 4P2OC 3V6ZB 3RUGF 2YPKB 5AB9A 4FD0A 2HBVA 3CV2A 4LCCA 3ZS4A 1B3IA 5A6BD 2EG7A 3SECA 4BIKA 5E9XA 1OSPL 3U57A 1TQBB 3QIWC 1U2HA 4G3YL 5I8OL 2EJAA 5BVJA 3X12B 5EY5A 3I68A 1ILUA 4Z2LA 1IGYB 2HVJB 5DA4A 4F1SA 1D2KA 1JZJA 3GC5A 3S8FB 2XZCH 3RNQB 1OC7A 3IRZA 3BVUA 1LE5A 4WTWA 5AOJA 3MSDA 5U4NA 3QUXA 1YPXA 2P5ED 2YPVL 3EGXB 2XZQH 5EMJA 1REQA 1OFEA 2WXIA 3WIFA 1SEBA 2XVPA 3BUBA 1HCZA 3O0FA 4YXKH 4HF5H 4X7FC 3DETC 3B7SA 4HYTB