1UA3A

Crystal structure of the pig pancreatic a-amylase complexed with malto-oligosaccharides
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
b'QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Crystal Structure of the Pig Pancreatic alpha-Amylase Complexed with Malto-Oligosaccharides
pubmed doi rcsb
molecule tags Hydrolase
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ua3A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ua3A01
1JYXA 2WWDA 3DDFA 1E5JA 1DWHM 3RDKA 3A5VA 1E40A 2X2IA 2YFOA 1VEPA 2PI6A 3N15A 1HJUA 3WQ4A 1C8QA 3CV5A 3VINA 4NRRA 3PZTA 2ZE0A 4YN5A 4UQEA 2YIHA 2W4XA 1PIGA 1CXEA 1AQHA 4AC1X 2D1ZA 3F5KA 1NOWA 4KRUA 3UESA 2PWHA 1UZ1A 4U2ZA 3FN9A 1VFOA 3GXTA 1JZ2A 4TOQA 1UH4A 3GZAA 3MS8A 4M80A 5I78A 2QMJA 4JCMA 1ZB5A 1HJVA 4S3JA 4AISA 3PZQA 2JIEA 1UR8A 5BROA 5FD0A 4MB4A 1M04A 4U3CA 1AVAA 5A8QA 5CG0A 4NRSA 4PMNA 2J75A 4Z2LA 3WY3A 1KXVA 3L4VA 1QBBA 4CN1A 3CZKA 2V38A 1IZKA 1WPCA 1ECEA 4BQ2A 3KLKA 4JHZA 1TUXA 2WZEA 3U5UA 3D52A 1MQPA 1JXKA 2J8GA 2XVGA 1QVBA 4GI9A 1GOOA 2E40A 4U31A 4MNMA 1E72M 3CZ8A 3POHA 4AZ7A 1BVZA 4JAWA 4MB5A 1GQKA 3VGFA 4PEEA 4QLJA 4HOXA 2W62A 2XVPA 4P7RA 1V0LA 2ZICA 5A8MA 5CGMA 1E6QM 3TP4A 5HNNA 1UQYA 3PZGA 4PTVA 2WW5A 3A23A 1VFMA 3VIMA 3BAJA 3BMVA 1OINA 3LMYA 1WNOA 3NSMA 2V3DA 4JHOA 4XZBA 5A6MA 2D0GA 4S3KA 3W27A 2CIPA 2VMFA 4HP5A 1VBUA 5I6SA 1QI0A 2CITA 1CGUA 3SCTA 1GOKA 2BXYA 4UFMA 1GZJA 3W6LA 1OWQA 1ISWA 3VNYA 2J62A 4AZIA 1CXIA 2JF6A 4M8UA 2A3AA 4QCFA 4W8LA 1B90A 4V2XA 3B9AA 2ZUNA 1B3ZA 3ZO9A 2YBTA 3VX1A 1QNRA 3NCOA 3CLWA 3AISA 2CHOA 1BSIA 4DUVA 4PSRA 3VKKA 3ZJ7A 1Q4NX 4ATLA 4OKDA 1HKIA 4PMXA 5ABFA 3BVVA 2ZWYA 3EJUA 1U2YA 1VFUA 3N04A 2AOSA 3AS1A 1D7FA 3T09A 5BCAA 2WMKA 5LA2A 2XPKA 3VSTA 2GJXA 2WLZA 1UA3A 3IJ8A 4FLOA 5I23A 3WD4A 1VENA 4TVDA 1UYQA 3ZJ8A 4HA3A 2GJRA 1ZJBA 3ARUA 3W53A 1UOKA 3FHQA 3H53A 5TD4A 7TAAA 3BLKA 4OZOA 3HMCA 3BVTA 4L4OA 4Q7NA 1XCWA 1RPKA 2GUYA 1GJWA 1YHTA 1XH0A 1W9VA 3UG4A 3UCQA 1W9PA 2XN2A 2WKLA 3M6DA 1W3KA 5JBDA 1FA2A 1JF6A 1C90A 4D6JA 1U30A 1B1YA 1UKSA 4JL2A 2Z1SA 1Y7VA 5C71A 1UWIA 3WENA 1R75A 3SCNA 2BHYA 5EFFA 4TX8A 4WJXA 3JUGA 5CPSA 3WIJA 3RO8A 1I1WA 1UWTA 1X6NA 1B2YA 1MFUA 4ATDA 3PZIA 3I3EA 1R47A 3WNMA 1HTYA 2XVLA 5E0CA 3T0AA 3AZRA 1DWFM 3QGVA 1J10A 1UWRA 4F9JA 4W7VA 4E4PA 3WD1A 1R8LA 3VIPA 2DT2A 3UR8A 2X0HA 4E8DA 2OSYA 4P7NA 4U3AA 5I24A 2WBGA 5LYRA 3DHUA 4M29A 2ZUUA 1BLIA 4W5ZA 4CVWA 3MUZ1 3AROA 3II1A 2MANA 3IGUA 6A3HA 2GJPA 4FNPA 2F7QA 1OIMA 1KB3A 1HP4A 1TQUA 3ARWA 2PWDA 1UWQA 3HU7A 3OIHA 4C7DA 5GNYA 4J3UA 2G4FA 5FOOA 2OYMA 2HISA 4W86A 3FHAA 3CUFA 4JFVA 2BHZA 3PZMA 3EMZA 2DT1A 1H4PA 1LL7A 3VDCA 4RE3A 3ZT5A 1BYCA 3AZSA 1V3KA 2FH8A 1FH8A 2WVSA 3AXXA 1JDDA 3KL3A 2X09A 2OWCA 3RJXA 3AIVA 4PMRA 3BXWA 3SUTA 4D71A 1PAMA 3WQ8A 1UA7A 3BAYA 2ZIDA 4KMQA 1KTBA 3IAPA 1LWHA 5EBAA 1E71M 5JIWA 5HOSA 1O7AA 3LRLA 3ARQA 1J0KA 1C91A 1D3CA 1VFFA 1XD0A 5CZKA 1ODUA 4AZCB 1NARA 1NM9A 1QWUA 5HDRA 2ZUWA 1GNXA 1MXGA 2JFEX 2EJ1A 4UQBA 3EBVA 4AD3A 3ZSTA 1NWRA 2DGAA 1V0MA 1JZ7A 1TZ7A 5IFTA 1VJSA 3T2QA 3WBEA 4D6FA 2OLHA 4RL3A 2EPMX 1UKPA 4BQ4A 3EJPA 3KL0A 4AZCA 1EO5A 1HJXA 4FNUA 3AMDA 4YPJA 2J7FA 3GH5A 5A6BA 1W2PA 4QP0A 4V27A 1V0NA 1KR0A 3VSUA 3WF0A 1GCYA 1OB0A 2J4GA 1R33A 2XSBA 1W1TA 4P8VA 3TTSA 4GZJA 3VD9A 4KGLA 1XC6A 4U33A 2A3BA 1OGBA 2XJ7A 2VJXA 3WMSA 5A69A 3HZ3A 4AWEA 4AMWA 1L0PA 3AHYA 2DIEA 2VX6A 4QLLA 1PJ9A 3CHCA 1F4AA 4WIWA 2YOCA 4KH2A 2GFTA 2Z1KA 2X2HA 2BY2A 1CEOA 1W91A 1W9BM 3CIVA 2WLYA 3APGA 3WDJA 1AQ0A 4BA0A 1G0CA 5EB8A 3ARPA 2FYVA 3PZ9A 3AS3A 2CCRA 3D5HA 1H1NA 3A4WA 2UY5A 3A4AA 3N13A 1VBRA 9CGTA 1W9UA 4HTYA 4AIUA 5IDIA 2VOTA 4D6IA 4PUDA 5DFAA 1ZBKA 1QI4A 3SIMA 3OA5A 2WCGA 3H54A 1UR9A 4F9DA 1VB9A 3AIEA 2VVSA 3FW6A 1HL9A 3L4ZA 3DDGA 1J0IA 1LL4A 3VX0A 3RM9A 5M3WA 3DX0A 4AZ6A 2FH6A 1A47A 3SURA 2VRJA 1NP0A 1QPKA 4OIFA 3CC1A 2VO5A 3BCFA 3WUGA 4X0VA 1GONA 1KR1A 4FLRA 5AYIA 5A6SA 2BY1A 1W3JA 4D72A 4TXEA 4CD4A 2BVTA 3VTRA 3UEQA 2WSPA 1ZBCA 2QLYA 2CBVA 2XFFA 4UFKA 1X6LA 4NX0A 1QNPA 4WSKA 3SCSA 3BAWA 1E73M 2XWEA 3ARXA 4DO4A 2G3MA 2F7PA 3SCOA 2V3FA 5IHSA 3GXPA 1GHRA 4PBGA 4PMOA 3W37A 4AD4A 3AIQA 2ZUTA 5FKYA 3F5LA 4BS0A 1M7XA 2WYSA 1DEDA 3CH9A 3WNLA 4JFSA 1QNOA 1OSEA 2E0PA 3WH5A 1KGWA 5HXMA 1TR1A 1JXJA 3HG4A 1WCGA 4OUEA 2Q8XA 3GBEA 1UR1A 2YA2A 3WL1A 4W85A 4B16A 3N1AA 2ZUSA 2J7BA 2OWXA 1ZS2A 1PX3A 3CO4A 1GOQA 3VGGA 4RE2A 4HPGA 5BWFA 3NDZA 2WMHA 2C8NA 1E1FA 4AZBA 1PX4A 3OLDA 3CPUA 1TVPA 4ZENA 2NT0A 3CHFA 3EDKA 3AI0A 4PTWA 1QNQA 3WD2A 1E1EA 3VDHA 2YL9A 3LPPA 1JDAA 1WZMA 4CN4A 3NSNA 4HMDA 4MDPA 3GXNA 3A3HA 1OIFA 3FAXA 1E4IA 1B31A 3I3DA 3W0KA 2DSVA 3DX3A 4X9YA 2O92A 4AEEA 3H55A 5DT5A 1XH2A 2XIBA 3WDHA 4PUEA 1V3IA 4F66A 3WY2A 2OSWA 1UD2A 4OBRA 1XSJA 4M24A 1O7DC 1BAGA 1QHPA 3ZMRA 4MNJA 1HVXA 4TTGA 1EO7A 2VL4A 3G6MA 4AD1A 1B3YA 3AIBA 2EAEA 2BFGA 2PB1A 3CZEA 1JYNA 1LF1A 4D6HA 2CPUA 1GOMA 3OBAA 4Z2GA 2EPLX 3W4RA 1JG9A 2OWWA 3AOFA 3L4TA 4DM1A 2PBOA 1Q6DA 1BGAA 3DYMA 1MXDA 1HJQA 3DX2A 3VD7A 4WKAA 3OLIA 1CXHA 2FDMA 3MI6A 2ZX6A 1UKOA 2PWFA 2C0HA 1H0GA 5A3HA 3S6TA 2VNCA 4MPKA 5JUVA 4QCEA 3UERA 3AIWA 1MW2A 5IHRA 3KEHA 3QHNA 3WELA 1TFVA 2W92A 3EDEA 2WPGA 4H8UA 1GVYA 3WN6A 4IPNB 3QHOA 3BC9A 3ZJ6A 3L4UA 3CUHA 4QAWA 4CU6A 1PPIA 3WDQA 4EK7A 4MB1A 2VX5A 2GDVA 1SZNA 1BFNA 2YDSA 1J0HA 4EE9A 3LPOA 1KWKA 2WVVA 1UD8A 3O2LA 3LPGA 4JCLA 4PCSA 3TA9A 4CUCA 4UQCA 2CYGA 1E56A 1DHKA 2D20A 1E6NA 4Z2KA 3MMDA 5BXTA 1V3MA 1W1YA 5D4YA 3AHTA 3VOCA 4ACZB 1MW0A 2D0HA 1PX8A 1WKYA 4NSBA 5I2UA 1KGXA 2VZVA 4LYRA 1E0XA 4K68A 3RMEA 3HG5A 3WMCA 4JFTA 3RILA 1NP2A 3VIJA 3NUKA 1JL8A 3GNPA 5A6BD 5I79A 4YHEA 3VGDA 1I75A 2WHLA 3THCA 5CXPA 3SUVA 3AMCA 2VX7A 1T0OA 1OT2A 3WDIA 4ACZA 2DEPA 4OBSA 3RM4A 4F79A 5ABFB 3LXAA 1FHLA 2VQUA 4QLKA 5A2BA 4QFUA 4AIOA 3EYPA 3WQWA 4J7RA 4N0RA 1Q6CA 2WNWA 2F7OA 1SFSA 3OGRA 3AHVA 2GJXB 3ARTA 3VIOA 1QX1A 1J01A 3UR7A 3OZOA 5D8WA 1B9ZA 1JF5A 1DP0A 3AYSA 3GTNA 2CERA 3NIYA 2VURA 6CGTA 3RM8A 3WD0A 1JZ6A 3CHDA 2F1BA 4MTVA 2WBKA 4NZFA 1J12A 4ZEPA 5E1QA 1MW1A 4PMVA 1K9EA 3SCWA 2BVYA 1PIFA 3GDBA 3ZOAA 4MJ4A 2BY0A 2VI0A 4W7WA 1JNDA 2WB5A 1CTNA 2ZXDA 3S5YA 5BXSA 2YKKA 3OGSA 4DUWA 2J74A 3BVXA 4OOZA 4W8BA 1US3A 1JIBA 2X8RA 3THDA 3WFLA 2YDRA 2WSKA 1LJYA 4W8AA 2D73A 3MKKA 2JEPA 2V5DA 1J9YA 4AD5A 1H41A 4PMUA 3E1F1 1E6SM 4BZYA 2O9TA 2ESCA 2V3EA 1X1NA 3DX1A 1K9DA 2XSAA 3WNNA 3MANA 5A2CA 3K4DA 4FF5A 4GI8A 3VGBA 4GQRA 3FNDA 3MSGA 1HN1A 1M53A 3CBWA 4CD8A 1DTUA 3EJQA 2VZUA 3MMUA 1C7SA 2A3CA 3W81A 3PTKA 4M82A 1W1PA 3MMWA 1TCMA 5DF0A 3RJYA 5CPTA 4R27A 1JZ5A 1G94A 2E9LA 3ZT7A 4E8CA 3CTTA 2JEQA 1ZU8A 1UZ4A 4UFLA 3AHZA 1P6WA 3D4YA 3WQ6A 3A24A 1OCQA 4HA1A 2X05A 1R85A 3QOKA 1E9LA 1EHAA 2EEXA 1EQPA 1JNEA 3DHPA 1LQ0A 2W67A 4FMVA 1V6XA 4ZXLA 1XGZA 2YL8A 3WEOA 1K9TA 1Q6EA 4DUXA 2CKSA 5A1AA 2WCSA 3MUAA 2VC9A 3IJ7A 1XV8A 1I1XA 1WE5A 1WO2A 2BHUA 3WNKA 2DT0A 3WY1A 1OGSA 4UR9A 1PZ3A 1ZJAA 3D50A 3N17A 1NWUA 4P7QA 4Q22A 2EADA 1IT0A 1IV8A 2IGTA 2G3JA 2G41A 5A8PA 2OYKA 2WKGA 1W1VA 4TTUA 4PCTA 2BY3A 2D24A 1WZAA 1JI2A 5M03A 3WF3A 4A3YA 5D9MA 1NOFA 3PZNA 4PMDA 1UH3A 1HF6A 3A47A 3ZM8A 4AMCA 3BSHA 2DSUA 3K8LA 3T0BA 3U5YA 4PSPA 4GPNA 3S2CA 1E6PA 3AMLA 4PTXA 5HPCA 4J3SA 1LL6A 2EACA 5E6YA 2J7CA 3J7HA 3L4WA 4H7VA 3WQ5A 3BLBA 2UY4A 1RD6A 4LYQA 2XTKA 4CCDA 1C8XA 3UG5A 1W9DM 3GNOA 2XUCA 1MVYA 1XRVA 4W88A 2TAAA 1AQMA 3TV8A 4AYGA 2O9OA 3VIGA 4GIAA 2PWEA 4GQQA 4IM4A 4HOZA 5DT7A 3WUEA 4XUYA 4HA4A 5E0FA 3UG3A 2FGZA 1XSIA 3K8MA 3CZNA 1RH9A 4W93A 4MB3A 3SCPA 1R34A 2OW7A 4B9ZA 2WHJA 4CN6A 3W24A 4PMYA 2WXDM 1ISXA 5HBFA 5D9NA 3MSDA 3FY1A 3BAIA 4Y7EA 4CD7A 3O9NA 3SEPA 1UD5A 2XN1A 4BF7A 2YLAA 5ECUA 2XG9A 1CGWA 2EQDA 1ESWA 4UOJA 1GOWA 2UY2A 2WMGA 1DWIM 5M5DA 4W84A 3ECQA 7A3HA 4J3XA 4L4PA 5E9AA 1BTCA 4IPLA 1N82A 3AYRA 3VSVA 2O9RA 4FNTA 1OBAA 4HPHA 3WH6A 3TOPA 1CECA 3AXHA 4TVUA 2DH3A 1M01A 2XYLA 4LYPA 2F18A 3LRKA 4JKKA 2VUYA 2CBIA 1UG6A 4P8XA 3WD3A 1B3XA 5A95A 3HJEA 3VD3A 1V02E 1FP9A 1BYBA 2J7DA 1NQ6A 2YLLA 1JAEA 1LWJA 2WZIA 5ABGA 1Q6GA 4MDOA 4ZE4A 5ABEA 1VAHA 2E3ZA 4W7UA 2JIWA 1B30A 1ZBVA 1TMQA 1EQCA 2OYLA 4MNLA 5BYWA 4J28A 4B9YA 1CENA 3ARRA 5CJ5A 3U7BA 3CZSA 3RCNA 2OSXA 1E15A 1GQIA 1H3GA 4M56A 3AZTA 4GZEA 5D9OA 1XYZA 2YDQA 4EANA 2BV9A 4PN2A 5DMYA 1CLVA 2ZX5A 2W63A 1GPFA 5CSYA 4Z2HA 2QHAA 1V03A 3BAKA 2VT0A 2ZX8A 2F8QA 1MQRA 2PBGA 5FCZA 4DWSA 3WUBA 1WDPA 1KQYA 3SCVA 2VRKA 3AICA 1V6UA 2BVDA 2A3HA 1YQ2A 4TUFA 3GBDA 3KZSA 4NZJA 2G3IA 1G01A 4ZE5A 2EABA 2JF7A 1UQZA 1BGGA 3N12A 1R7AA 1LLOA 3AMKA 4FNQA 1MW3A 3N11A 2EPKX 4HZ7A 2IXVA 1DWGM 2J47A 3EJTA 2E9BA 3U57A 1XYFA 5A6KA 4UNIA 1UR0A 5GPRA 3AFBA 3RIKA 3DYOA 1W32A 4J3WA 2D3LA 1KXQA 2WMJA 2ALWA 2ZXBA 5BRQA 1HL8A 1UD6A 1V6WA 1TQWA 4ZFMA 4LGXA 3WF1A 1RP9A 1JZ8A 4AXNA 2C7FA 1WB0A 1QI3A 4DM2A 2VCCA 1TA3B 3CZGA 4MAVA 4PMQA 1E55A 1V0KA 1OM0A 5C70A 3BVWA 4JZ5A 3WEMA 1KWGA 1FH9A 2OW6A 3WY4A 1TQVA 1E0WA 4HZ6A 1SR0A 2GDUA 1ISZA 1CNVA 3F4VA 3N9KA 5FL0A 1C8YA 2IUZA 2Y8KA 4AZGA 1BVNP 3KWXA 4LXFA 1GORA 1TA3A 7CGTA 1K9FA 8CGTA 3IANA 4J3VA 4RE4A 2JE8A 2WM0A 1TQSA 4GINA 1WDQA 2WVTA 4IUGA 4FNRA 3GXMA 2DSWA 4R5EA 2WC7A 1H5VA 4PMZA 1WP6A 3ARVA 1GOIA 1JD7A 1CZ1A 2VZTA 4C7GA 1H09A 1B0IA 1EDGA 1E4NA 3EMQA 4A4AA 1DWJM 1ZL1A 1V3LA 4EKJA 4KGJA 2FHBA 1WDSA 3A21A 3AXIA 1KFWA 3OG2A 3HG3A 1PS3A 2F2HA 1V08A 1H0IA 4ZXOA 1JZ4A 1EOKA 5A6AA 3K1DA 4UQ9A 1OD8A 2QPUA 4Z2IA 2J7GA 3VIFA 2D3NA 2AMGA 4CGTA 5LA0A 3IAQA 1BYAA 3BVUA 1ITXA 3T2PA 1CDGA 2DH2A 2XFYA 4MJ2A 5I0DA 5KEZA 3AS2A 4W89A 1CBGA 3NYDA 4NXKA 1VEOA 1KXTA 4W5UA 3T2OA 2CESA 3K8KA 2QF8A 3VM7A 5EFDA 3VGHA 3QOMA 1KCKA 1HIZA 4D6CA 1J18A 2UY3A 4H8VA 3A6OA 3M07A 2ZUVA 3BUBA 2JALA 2WVVB 2WZHA 3A4XA 4ATWA 2J25A 5IFPA 2AAAA 1NWSA 4WF7A 2DPEA 1VIWA 3MV01 4CCCA 4P8UA 2F1AA 3HN3A 3WEZA 3VMPA 5I5RA 3OB8A 1WDRA 3K4AA 4DO5A 1K6AA 1HP5A 3BUDA 1CXFA 3VUPA 2XGBA 1VF8A 2VZSA 4P7LA 5I77A 1WZKA 3T0DA 4KRTA 1XD1A 1J0ZA 2Y2WA 2WWCA 2FGLA 1E3ZA 1ZBWA 3MUIA 1FHDA 2NSXA 4B3LA 1MFVA 3CUIA 3TTYA 5E70A 3TTQA 4NXSA 3EDFA 4FNSA 3W82A 4LQ1A 4CU8A 5GNZA 4UZUA 5A6JA 1JFHA 5FL1A 5F7UA 1R87A 2GK1B 1EA9C 3WH7A 4XZWA 1ITCA 4H04A 4NI3A 1BG9A 1ISYA 4JFUA 1V3HA 3PN8A 1HNYA 4U5KA 1HJWA 4M81A 4UTFA 3VIHA 5CLTA 1CGXA 5M17A 3BH4A 1KXHA 3VMOA 2VR4A 1GW1A 1QHZA 3S5ZA 1OGGA 2XN0A 1IZJA 2GK1A 2Y5EA 2DDXA 2RGLA 3VNZA 2Y24A 3VIKA 3GNRA 1HWWA 5I3DA 2ZX9A 4B15A 4B3KA 4V28A 1WZLA 4UFIA 5D9PA 1KBKA 4AZ5A 1CGVA 2CBUA 3OLEA 2PC8A 2XIIA 4LPCA 1CLXA 3AIUA 4CCEA 2CHNA 4GO8A 3VMNA 3D3AA 1JZ3A 2YL6A 1QBAA 4XV0A 3VILA 5CLWA 1Q6FA 3F5JA 2XM2A 1OT1A 3IJ9A 3ZQ9A 3WFZA 1E6RA 2VRQA 1V02A 3I3BA 5DEZA 4D6GA 2BXZA 1C7TA 1D2KA 4JL1A 5E6ZA 1E6ZA 1QW9A 1EDTA 5A8OA 1AMYA 2VX4A 2ZUMA 3BLPX 1QOXA 1XCXA 3RPMA 4AD0A 4KWUA 3PZUA 1KTCA 5BXRA 3GXFA 3NJ3A 5IXEA 2QPSA 1HX0A 1J11A 3CGTA 1FH7A 4TVCA 2IXUA 4UFJA 5JBEA 4JKMA 3ZIZA 1FFQA 1Z32X 1JD9A 1US2A 2WCAA 1R7OA 2HVMA 2GVYA 1SMAA 2X0YA 2F7RA 3AJ7A 3LXCA 3BGAA 3IK2A 2WAGA 3GH4A 5DO8A 1E70M 2VVNA 2YL5A 3PTQA 1GQLA 1CYGA 3GXDA 4PTMA 4UCFA 3DECA 3VDBA 3GH7A 4JKLA 1J0JA 4DO6A 1UUQA 2YA1A 1LG2A 1PEZA 3B9DA 3BSGA 5BRPA 4TX6A 5A8NA 4FK9A 1G1YA 3BUPA 4N42A 2G8ZA 4PRWA 4DWSD 3VIIA 5CPQA 1BHGA 3SCQA 3L4XA 4NF7A 4C7FA 1XSKA 4URIA 3HG2A 1HXKA 1DWAM 5AY7A 3SCUA 1JAKA 4UZSA 3W28A 5BXPA 3A22A 3WNOA 3PTMA 1PBGA 4AMXA 3U7VA 5KZ6A 1JYWA 3ZSSA 2ZXAA 3GYCA 2XVKA 3ARZA 2D2OA 2W66A 4OGZA 5CQ1A 1ISVA 4UQAA 4OOUA 1FOBA 1UR2A 3DX4A 3L2LA 3D51A 3L2MA 1BG4A 3OGVA 5JBFA 3BCDA 1NH6A 3WKZA 4BQ3A 3BMWA 2YBUA 1MWOA 2A3EA 2ZXQA 3CZJA 1JFXA 4ACYA 3CHEA 3VPLA 1CGTA 1A3HA 1ODZA 1G5AA 1W2VA 4UOQA 1XH1A 2WANA 1JGIA 2WC3A 1CPUA 1O6IA 2W5FA 4CVUA 2CXGA 3LX9A 2WHKA 2NW0A 1GJUA 4U5IA 1U33A 1CIUA 1FP8A 2PF0A 3SUUA 1SMDA 4CKQA 3BUQA 3G6LA 1VJZA 4CD5A 1E4MM 5ABHA 2YFNA 4UQDA 2G3NA 4J3TA 3WUFA 3L4YA 1CWYA 1L8NA 1VEMA 2WMIB 4FLQA 1VRXA 3CUJA 3NSXA 3EDDA 3DC0A 1TVNA 4AIEA 2CNCA 1UWSA 4HOWA 1GQJA 2D22A 1V6YA 4EAMA 2NT1A 1EGZA 3CUGA 2WHMA 2J7HA 4GZIA 3AHXA 1C93A 2X2JA 3N18A 3CZLA 3SUWA 4JIEA 3ZJKA 4GI6A 1HKMA 1R86A 2WMIA 3EDJA 1UHVA 3ALGA 5EMYA 5A94A 3CMJA 2WK2A 2WVUA 4IISA 3MV11 1HVQA 1W9XA 2J8FA 2CKRA 4MNKA 1E4LA 2PWGA 1UASA 1OD0A 2EBNA 2DIJA 1F4HA 4H41A 1PZ2A 3LXBA 4H2CA 1EXPA 1S46A 1BPLB 1E43A 4NZCA 1GUVA 1EHNA 3VO0A 2Y4SA 3UETA 1EDQA 1W3HA 2XHYA 4W87A 4HZ8A 5GNXA 3WDRA 1NWTA 4XB3A 3WMBA 3W26A 1B3VA 1MQQA 3WBAA 1G9HA 4M1RA 1C92A 3TONA 5A6LA 2CBJA 1LG1A 3T08A 2E9MA 3VD4A 2J78A 3QR3A 1W3LA 2UWFA 1BYDA 2W91A 1EIBA 2BS9A 2V3GA 3WL0A 4ML4A 1XHGA 2EXOA 2E8YA 1EOMA 3TTOA 4J27A 1RP8A 1QW8A 1MYRA 4H8HA 4FLSA 3W38A 2CEQA 2FHCA 4GKLA 4AYSA 1HKJA 5D8ZA 5GQBA 1KGUA 4UFHA 4F8XA 4BQ5A 2XFRA 3M7SA 2DSZA 5CSUA 4D6EA 4AZHA 2X2YA 3W29A 2E8ZA 1JYVA 4DWSB 1HXJA 1JI1A 1KQZA 3SCRA 1GHSA 4A3HA 3GM8A 3KL5A 3ZT6A 3W25A 3LPFA 1E6XM 1E5NA 6TAAA 4JFWA 3OZPA 4CU7A 2E4TA 3PZOA 2F61A 1TQTA 3VM5A 4AW7A 2J79A 3WQVA 3KLLA 2VCAA 3WF2A 5AYBA 3WNPA 1HJSA 3EJSA 4D1JA 4AY1A 1KBBA 1HKKA 3ALFA 5FIPA 3KE0A 2XM1A 1SYTA 3GXIA 4P8WA 2WMFA 2ZWZA 4WSJA 1TE1A 4WKFA 4U2YA 1H11A 5A2AA 2O9PA 1E0VA 2D23A 4MADA 3ZR6A 1NOUA 4CD6A 2QMKA 3LRMA 3B9EA 5LA1A 3MO4A 2J77A 2XWDA 1CGYA 3PZVA 1JDCA 4HMEA 3WDPP 3WH8A 2W61A 2XVNA 3D4ZA 3VU2A 3O6AA 3CMGA 2VCBA 3MU7A 3PHAA 3FXYA 4X0NA 1FFRA 3SUSA 2GSJA 2RGMA 4Z2JA 3FAWA 2Y8VA 2ZX7A 2EPNA 2DSKA 2D0FA 4AEFA 2EPOA 4HMCA 4D1IA 5JIPA 4E2OA 1QI2A 5C8BB 3W6MA 1UKQA 4P7OA 5CGTA 1H49A 3PBGA 4BCEA 3K46A 4LX4A 1QI5A 8A3HA 3VDAA 3EJRA 3B8SA 4WK9A 1KCLA 2ZOXA 2XGIA 1BF2A 2FE0A 1EH9A 3ARYA 2VQTA 2BNJA 1QWNA 3QHMA 3AIRA 2VR5A 1CXLA 1QHOA 3BUIA 3POCA 1UH2A 3VGEA 1J0YA 1V3JA 4GO9A 1B3WA 3DYPA 4AD2A 4OJYA 3WSUA 1R46A 1GVIA 3MUY1 2V5CA 1H2JA 1HT6A 2VZOA 4DWSC 4HU0A 1WAWA 2DQXA 2X1IA 1TG7A 2DT3A 2YA0A 4D6DA 1CXKA 1M03A 4HU8A 3OLGA 3AQUA 4YHGA 5E09A 4XX6A 3BAXA 3AS0A 2WC4A 3WH9A 1UKTA 5AC5A 2EO7A 4WLCA 1UD3A 1UWUA 4PYSA 3ARSA 5HPOA 4WKHA 3ZR5A 3AMGA 4MAZA 2VTFA 2B31A 4QDMA 1UD4A 4GXPA 2CETA 1BQCA 1QNSA 3M46A 2YJQA 4UOZA 1V6VA 1UR4A 3VVGA 1C3FA 1E3XA 3VD5A 3WF4A 5AC4A 2QV4A 2FHFA 3EMCA 2J7EA 3NDYA
chains in the Genus database with same CATH superfamily
2WOQA 1Z3RA 5CZXC 2WWDA 3DDFA 3D0LA 1E5JA 1DBBH 4ZOBA 1F5WA 4JQ2A 4NM4L 2YIHA 5DFVC 3JV4B 1E30A 1IAOA 1LUCA 1YXDA 2NW2B 3OYXA 3G1VA 3AW5A 1VFOA 2PYEA 1E4XL 4Y2DB 4QS6A 3V0EA 2Z8WC 2X4RA 1UR8A 3OP2A 5I02A 4PV9A 3IDGA 3BP4B 1KXVA 3IJHA 5F9DC 1HZKA 3IS1X 5LB1A 2FO1A 4ZSTA 1H7RA 3W7IA 5DURB 5KITA 3W11D 3EYSL 1RERA 4YK4C 4G6ML 3F65A 5FHBL 4QLJA 1QPRA 1BRLA 2G5BB 3BESR 4L3EA 1DLHB 4LF3B 1PUDA 3RWJB 4KRPD 1CUOA 4L80A 1TZHB 1VFMA 2Z7UA 1ACCA 3TJEH 1NICA 2ADAA 2CIPA 5AUMB 2VW7A 3IF1A 1MRFL 4WWKD 2H3NB 3TXVA 5H37H 5EOTA 4ADIA 1W37A 1CXIA 2P10A 4V2XA 4Z7QF 4NPYA 4PW3A 1QRND 1W0WA 1V79A 2CHOA 2PR9A 1WAUA 3TS8A 2IDCA 3OA3A 2NY7H 2AJSH 1EXBA 2J12B 3R8GA 4C4KO 4NRXA 1L0XA 2XPKA 3A3YB 3MSPA 1P2CA 2WLZA 3WD4A 1ZQ5A 2QDHA 5BUAA 4B95C 1YHPA 1XGDA 3AY4C 5TD4A 3MGTB 4U0RC 2IH1B 1ZA6A 1WJ3A 2P3YA 1F1AA 3O11B 1FA2A 1FV1B 4I8DA 4N26A 3JWDL 1LLAA 3F85A 1KB5A 1WBZA 4OZGB 3GO1L 3UJTH 1VFHA 5IJVA 5C09B 2XVLA 2RGSA 2ED7A 3TBWA 3WD1A 5JIQA 2YAPA 1CICD 4IMGA 2B5IB 4H4NA 5C08E 3U0TB 4MASA 3ZY7A 4O02L 1IM3B 3FU5A 4C7DA 5CCHE 3NM3A 2WWKT 3QYQA 4GGHA 1H9DA 1LOQA 3MVIA 4KJYA 1HYSD 3L3DB 3NSFA 4YZFF 4Z7AA 3AXXA 4X99B 4FQJH 4L4TA 2QJHA 3UL4A 1VBHA 1DE4B 1R3KA 1URIA 4L1HA 1XGTA 3LEYL 2ZIDA 1OCWH 1RJZA 4MD4B 1JF1A 5EUOE 4JPQA 4IF2A 2PPEA 4JG5A 2RR3A 4AUJA 2BCKA 1TV8A 5LNWA 5CPOA 3EJPA 1U2HA 4NNPH 2ZONA 5BXFB 5LGZA 3LSOB 2Y3AA 4JFEA 3GG1A 3X11B 3ZYIA 1CVRA 5EEZA 4FEZA 3BX7C 3WF0A 4JQXA 2CDFA 1RK1B 4HT1H 4ELKB 3I10A 4FR1A 1OTTD 4EUPG 3IJYA 2X4NB 3C8FA 1OC6A 5CD3A 1BQRA 3IGSA 1XGRB 1PIIA 3GFYA 4J6IA 2VX6A 5HHMD 2VJ8A 4KH2A 1XIDA 1Q72H 1TZAA 4J4KA 4V33A 3UBGA 1G0CA 3JWNE 5KZEA 2NVAA 4MLRA 3AS3A 4JM0A 2X87A 2EICA 3UCCA 2E5CA 2I5GA 5F1VA 3O06A 3QDJE 1XVSA 2QHRH 4OUIA 3K6SA 4JRFA 3EG9B 3O7UA 2ENPA 1U3HB 2DY3A 4B9CA 2GI0A 3L7EB 4DYJA 3MBWB 5E51A 4X0VA 4FFWC 4Y19E 4QQUA 2ZRVA 4AGPA 5GS1B 3FGCB 2I56A 3VTRA 4M51A 4H00A 1TJPA 4NOBA 3FUKA 5DUPH 1A3QA 3UWZA 4JYDA 1J5SA 4IQJA 1AJ7H 1OAXH 1Q7QA 3ZDXE 4WI2A 3R0KA 1F86A 5C0BD 1VCBC 4BSWA 2CO7B 4U1LB 3RUGA 2B0SH 4U49A 1WC7A 2IG2L 2JH2A 3UO1L 4XNXH 3OAZH 1VGKB 1Q1JL 4A2GA 1YY9C 2XGZA 1UXWB 4OI9A 1WUEA 3NDZA 3ITVA 3B0VC 1EBHA 3U2JA 4BV1A 1G7VA 3CFUA 3CHFA 5DO2D 3DEQA 1QNQA 2W0PA 3HZMB 4Z7WA 1HAWA 5IFAH 4O57A 2B1OA 1WXYA 4GXVH 1GG0A 4QXVA 3AREC 1WD9A 3D69B 2XQYG 4WEBL 5E8DH 4LARL 1LT7A 1M7IB 3QDME 2OSWA 3PL6A 1KBGH 5MHSE 3OQ3B 3ZL4L 3S6CA 1LO0L 1XWVA 3LB6D 1IF2A 2CHDA 4IBVA 2ZRYA 1T89A 1G6RA 1IE5A 3HCVA 5FOBA 1WAAF 3OR7A 4M1DL 4XVEA 4XXDB 1GOMA 1MFEH 3GHUA 1JCLA 3MXWL 4G80B 1XF3B 3OX8A 3MV8A 4O2EA 2A0LD 3RG1C 2BP5M 3QIUB 5HDBE 4B41A 4KWVA 4A2HA 1EERB 3DPBA 4IH3A 4HTBA 2BNRE 1BOYA 1MW2A 2Z4GA 2HX8A 3EO9L 4LPVA 3V9FA 4OR1A 3WXWH 4D0CA 5I2IB 2UWEE 5CZRA 2EXWD 4QAWA 4C6OA 4FS9A 1FNHA 2R69L 1OQOA 3MGOA 4KXZH 4WZHA 3CAFA 4MA7H 4TPRH 3DVNB 3W84A 3EWDA 2OL3B 4NQVB 3V6BR 3ILQC 4JCLA 3VE0A 4JK0D 5F9JB 4FKEA 1GZPA 1MO0A 4MXWL 2DW7A 1PX8A 4G8IB 3ZMEA 1K6QL 4K71C 3T0EA 5EO0A 1IGJB 2A74B 2C9PA 4QDGA 1EHLL 3NO1A 3PSVA 3FSAA 3QCVL 4NG3A 5FHAL 5BV7L 4Z7UB 1M05B 5KWYC 4HCHA 1BLNA 2YO3A 1HIML 3TEUA 1C1EL 3QJQB 1JGEB 4X22A 1J01A 2E09A 1B9ZA 4PB4A 2VGIA 4FULA 3DSFH 4J2QA 1KXQE 2VLKA 2QDEA 3GMRB 4HU2A 2E6YA 1YBQA 2BVYA 3TOYA 1BTMA 1KGJA 5KINA 1ZSHA 4ETQA 1PTAA 2BP8A 4W8BA 2G0KA 3ASOB 2LR4A 3HE6B 1SYVA 5L6YH 4NO5A 3GFUA 5B3JE 3NPXA 3L1OH 4HQQL 3TVMD 3H26A 1EAPB 4P5KB 2VDKB 4QDPA 2A6NA 4RWYH 4WD0A 3PQYD 4NO0A 3OPUA 4NQCE 5IGXH 3OJDA 4ZBJA 1HCVA 1F3DJ 4YDZA 4Q8VA 3MRJB 2WN3A 3NQEA 4DUXA 1W72H 1KJ3H 3LEPA 2ZG1A 3S2LA 5DTFB 3V5KB 3TO2A 4NOFA 1FWSA 3IJEB 3QUXA 3VZXA 5EEXA 3M0ZA 4JS7A 4IBWA 4GT0A 4WI0A 3QRBA 5J04A 4JQ4A 2BY3A 3WF3A 4C57C 1OYAA 2ZOUA 3A47A 5DJCA 4TSCH 2A6DB 5D93C 2QEJA 4MHHI 3K8LA 3DIFB 5HGBB 1OGTA 3C12A 4HETA 3CV6A 3GTIA 1X3DA 5GGVL 4FOJA 4GUIA 3DO7A 3IEAA 4UC5A 3QCUH 1BGXH 3CFCH 4Z7OF 4A29A 2E74C 4JJHA 5IT2L 2A83A 3OKOA 1L9NA 5F7HA 3OSVA 2VP8A 4IQEA 1MQ8A 3RPIB 4WY0F 2Z0UA 1NMCB 5F7EL 1KM1A 2KS0A 2K70A 4WJKB 3SCPA 3QQ4B 2K1MA 3U1SL 3WBYA 3SJVB 5JORB 1PJWA 1QA9A 3VWKD 5JOEA 3FY1A 1UWAA 2WB7A 3SCMB 2YLAA 1OD9A 5M5DA 2Y3NA 3EPNA 1OBAA 4S2CA 4HPHA 4IJCA 1QSFE 1ANUA 1UG6A 3OKEB 1RZ7H 5IJBC 1TJXA 1Q5MA 4UQ3A 4ODSH 3PJXA 2D7PA 4W7UA 5H2ZA 3JV5A 1XDTT 3UJRA 3STBA 4N9DA 2IPGA 2R56H 4N87A 2Z2UA 2P48B 2CCVA 3GC2A 1JOIA 1NCAH 1L5GA 4O58H 3SECA 5JW4M 2ZX8A 3WFBL 4AQ8C 3U48A 4IJ3C 3I6KA 5EC2A 2B15A 2A3HA 1JZEA 5AEAA 2DDQH 5FO8B 2JXMB 4P57B 4MSWA 4GG6F 1RSYA 2HG0A 3BURA 1EJXC 1L7IH 3DJRA 1R2SA 2W0UA 3F7PC 4UUJB 1ZHNA 4KMTH 2VCOA 4F2MA 4WXZA 3S9YA 1MW3A 3MLXH 3EFFA 4UNIA 3ARGB 5GPRA 2YC1B 3VXSD 3B9KA 4WFFD 1COBA 3TEYA 3CNKA 3CN4A 1Q8AA 2A3LA 1I1AD 4PY7A 4S1QL 1JZ8A 2N0KA 1NGQL 5HMEA 3LTSA 1I8AA 3RX2A 4WRLA 1CBVH 4I9XA 4DM2A 1AXSA 3CVHB 2MKLC 5IHBA 1V0KA 3TYUA 2VKWA 3KMDA 4YO0B 5G4HC 3B37A 4MD0A 4NUWA 1TQVA 3ZDZE 2AJYH 2HROA 4PRPB 3WIFB 1YNYA 1XTLA 3KLHC 4N3TA 4IBYA 2H26A 4AJ0A 1HOCB 3NCJH 2K3TA 2W65A 1FWFC 4F5CA 1RUSA 4OM0L 1XGQB 5AW0B 3CB8A 3L9YA 3U4EA 5ITFA 1MNZA 4YHZH 3UZEC 1JD7A 2VZTA 1YX1A 1IEAA 4X6CE 3BP5B 3BK0A 3V1HA 3NA4A 3PPGA 2JI1A 2Y07L 1GS8A 1J9CT 1H0IA 2HDJA 1D5ZA 3W7LA 4QHLB 2QZ5A 2HFGH 3T6VA 2IFFH 4K7PH 2DW6A 1ZLUH 5DVOA 4DAGL 4O1BA 3S3BB 4HXBL 1MI5D 1VEOA 4ELMF 3D85D 3QSTA 3CLEL 3VGHA 3A4EA 3VRIB 4YCOA 4JAMB 4XCEA 2EYTA 3D18B 3M07A 4MNQA 4JGDA 2TODA 2WVVB 1XIJA 5IFPA 2MIZA 2LVCA 3BKCL 4JFQA 5EMJA 2R23B 3IDIB 4HUWA 5D2LE 2RQEA 3MRPB 1H7OA 2XGBA 4NP9A 4P7LA 1PMYA 3UPWA 2YXXA 2Z6FA 1J0ZA 3HNSL 3UP8A 1MHEB 2NX9A 4OQTA 4ERSL 2BRQA 5BRZE 3E8UL 1AZCA 3OKKA 4Q7BA 5E70A 4Q0XH 3SYCA 3FO1B 4CAGA 4AH2B 5A6JA 1JFHA 2NYYC 2DQJL 2QL1A 5EOCL 1XYAA 3NL3A 4IU2A 3P6LA 4LUYA 3MX0A 4JPSA 3LN5B 5IZ7A 3H9SE 3MTRA 3KOYA 3RL1B 2NLIA 1P4IL 2GK1A 1A2YB 4JW3A 2GEQA 4WFGD 1F13A 3SW6A 4B3KA 5E23A 1DXEA 5JHLA 1J9RA 1EO8H 3GS6A 4JFPB 4R7DB 1HSBB 2QTVA 3D9AH 3GSQB 1WYIA 1FGVH 3FFDB 5C07D 3RVXC 1IJNA 3QEGL 4PJHF 4KBXA 3CSYA 3WXVH 4IRJD 3CPGA 3IGLA 1GZ1A 3LV5A 5F88A 4L3CB 3KLAA 1I8IA 3VI3A 1FH7A 5EFIA 4JKMA 2XXMB 1Z32X 4GG9A 4MCZA 1X7IA 4NJAL 2HJPA 2A7NA 2DPKA 3S3CB 3QZBA 1CK0H 4L48A 4XAGA 4K8GA 1LG2A 3TJPA 4DP2X 4BKNA 3CHXA 3MA7A 3DUGA 3L4XA 3KCPA 4QTFA 2GYIA 4NF7A 1XSKA 1W6WA 1RVFL 4URIA 4FJZA 2GEEA 3O4LA 3NQDA 4KOBA 2Q5BA 3BZDA 4BFGA 1CE6A 1ZCRA 4HUUB 3A22A 1K2DB 5JOFA 3TESA 5AB3A 1HL2A 25C8H 3KXQA 1SGKA 4PJFF 4OV9A 3GUTA 3EX3A 2X6VA 3OPZH 1Y6MR 3QMRA 1KPVB 3KX6A 4BQ3A 3BMWA 5AB0A 1KELH 4Y4KD 1VYSX 5GS2H 3M1BB 1JFXA 5JQ6H 1N6VA 4S1DD 3ULVH 1SY6L 5HQEA 3MRCA 5CZXD 2WC3A 4NC2B 5DFVD 4Z78A 4PVMA 2YAHA 3L4YA 2XN9D 1K6WA 1E6JL 4HCIA 1A22B 2XPYA 3V7AG 4NUGH 3NO3A 4FX7A 3N4EA 3R89A 1AO7D 3AHXA 1C93A 2VDMB 1IR2A 3GDLA 2GBAA 3RX9A 3N9GL 3D33A 3LCWA 5ECJE 1E4LA 5T1MB 4MX7A 2EE2A 2X0UA 4Z3FA 2VE6B 3TCTA 3H1ZA 5SWSB 4LLVB 3U7YH 2ICEB 1NWTA 3F2LA 3MUCA 2WXOA 1GA2A 5IW6B 4MZRA 4DYEA 1C92A 1BZ9B 1LG1A 3CDFA 2ICSA 2AEPL 3MLTB 5HI4C 2W91A 4HCRH 1EIBA 1V27A 4BFJA 1MJJA 2R1YB 4JQIA 3RWDA 4HC1H 1EC7A 3RITA 4MXVF 3B2VH 3LENA 2VDRL 3MRKB 5FJTA 5DUBB 3KCOA 5CSUA 5FYJL 3TCSA 1F3RB 3WJYA 3OKLB 3S37X 1Z66A 5E9NA 1BQHB 4YHOH 2ZP9A 1VP5A 3FMGL 4M8VA 4UOW0 3WUWA 2OTUA 1PZ5B 2F61A 4D0DB 5C1MB 1H5BA 4OCSH 1RZFH 1WA0X 5IKCA 3RWEB 5GIRB 1HESA 4MMXC 1W1ZA 3S2NA 1H3PH 5D6DC 3HMJG 1CGYA 1EX0A 1IX2A 2QKIC 1PCSA 3WEAA 1OFRA 4GEIA 2X1OA 1B0WA 1XIWC 1INDL 1U8IA 2H3XC 1D5IL 4E41D 5D2TA 1PGRB 4F91B 2V63A 1VFLA 4YVVA 1AD9A 1EB3A 3FLUA 1F1GA 4X4YB 2C3VB 4IJBA 4OAWA 2CRYA 4LRNH 3K46A 3BVNA 1KJ2L 3VDAA 2CZEA 5GJTH 1SGJA 2ZE3A 3ZYZA 6TIMA 3U1QA 1KBVA 1CXLA 3KH4A 4WCYH 2DP3A 5I09A 5B7ZA 1RK5A 3MNZA 4LNCA 2PR4L 3AXLA 3CT7A 2IXQB 1SJEB 1WYJA 2EXTA 3PLYA 2DQXA 4NIYE 3SN1A 2AXJA 3MHUA 4XP9L 5A2IH 2K4AA 4TU1A 1M03A 3P0WA 2R91A 4Z0BL 3VXUA 1F8MA 3MLYH 1DUYA 3ZUCA 4JOMA 4PYSA 5LAXB 1I2NA 3MCKB 2UUDH 3AMGA 3Q94A 2V7NA 4OLVL 2C4FU 2CETA 1F02I 2GJJA 2DQHH 3BKYL 1DJNA 3G6DL 5J57B 3KYKL 1OAYL 4UOZA 1Z7JA 4JANA 3G5XB 5FFOA 5FUCE 2VYOA 1J8HD 2ZOKA 2X2IA 3N15A 1CFVH 1J2WA 1TNMA 3ZBMA 1VDGA 1FCVA 1Q63A 2PWHA 3GXTA 1UZ6E 4KT2A 3MS8A 2VM9A 3HA0A 3LN4B 2Q01A 5CPMA 4AISA 3P81A 3NJXA 4JFZL 3ABLB 3UXDA 4PCPA 1T4KB 2J6XA 3MRFB 4G8GA 2OA9A 4ESKA 5C54A 3J27A 1B3OA 3KLKA 3TNBA 1H15A 1AC0A 3NQBA 1YPIA 1QVBA 5LBSL 5DN1A 4HWEH 2PAJA 3V1PA 1UR3M 3TLQA 3P80A 4EXQA 1YNTB 1DN0B 2QSCH 2WXPA 3ES6B 2VH5L 4FFWD 1O94A 1OC7A 5IQMA 4WNJA 4FQ2H 4NKIH 5I1IH 2PDGA 1GOKA 2I5QA 3RURA 4WW2B 2P46B 5ABTA 3MJ7B 3C9NB 4AZIA 4M8UA 4MLJA 2C34A 3NQFA 2CSPA 1U8LB 2C4XA 2R2EA 2ZWYA 1K5NB 3B83A 5GSVB 1AZBA 2WLNA 1YY9D 4YE0A 1A5KC 3LM7A 2D7QA 3MSYA 5J1AB 3P4OA 2DWEA 1UB3A 4BFKA 4YEEA 3BVTA 1DFBH 1NAML 3ECBA 1W9PA 4DT2A 4D6JA 4WVXA 3HVDA 2Z1SA 5KS9F 3YPIA 4JDEA 3LH8A 4WUUD 1UWTA 1AHWC 4PB0L 4JFXB 3Q9QA 3AZRA 3FUFA 5DK0B 5DJ0A 3TYFA 5GHWH 1X5AA 3ARED 1MEHA 5IHHA 1SW0A 4I5BA 5CCKH 3GGWB 2APWA 3MC0A 4B5UA 2E7LC 4KHXH 3V4VL 4M62H 1YLVA 2NV9A 3IGUA 4FNPA 2F7QA 4LVFA 3M5VA 4J3UA 2IQ0A 3DKLA 1E28A 2CIIB 3U46B 1UM6L 5I76B 4TV3A 1YLBB 3QO1B 3T9PA 2VISB 5BS0A 2CCLA 5EYWA 3STFA 1HYRC 4Y5VC 3AZSA 1V3KA 4MM1A 4PBEA 4KTDH 4GBUA 2CO6B 5GJSH 2H9AB 4DPRA 4JFFD 2BJMH 3WFCH 2ZUWA 2JFEX 2J8HA 2ZA1A 1N5YL 2HT3C 1DBAL 1JGLH 2I07A 1XBDA 2ATSA 3SJ3A 2QPFA 2V5JA 3ILQD 3KL0A 1S78C 1HQTA 4X9GA 2Z31C 3TPKA 4GSRA 2JTDA 5GZNC 3D05A 1LLZA 3QJSB 2Z7KA 4CNNA 1BMGA 3CC5A 1IGYA 4V1DA 3H2FA 1EXGA 4XCCH 2CGZA 1EA0A 5C0QA 4ZBCA 2Y5TB 1INQB 3EWXA 3D87B 4XPTH 2UY5A 1F76A 2EDNA 3EA1A 5C7HA 1KCWA 1W9UA 3O6ML 5KN5B 4D6IA 3ZYOA 4PWGA 3N55A 4YMZA 1SJVA 3UXLA 3L4ZA 3RM9A 2APXA 3ZU8A 1IUZA 5KSWA 5H8UA 1PKYA 3TV3H 4ZA0A 1GONA 5I17B 3UTQA 3ZDYE 4OZFH 3VFSB 3KGSA 3UU0A 4JTJA 1GEQA 4B5VA 2VDHA 2R6OA 4YWGH 3TJ4A 1NLDH 3L9RB 1YNLL 4PS8A 2XWEA 3MUJA 3VXRA 5BW6A 1Q0XL 4YUEH 4OE7A 4J8RB 4B6ZA 3D0VB 4O0KA 5ALBL 1R5YA 4D0BA 3RGVC 5GGTL 5I1DB 1S7RB 2Z0BA 5CIPA 3JTBA 2CDEA 4P5MA 1ZSDB 2QT6A 3LERA 2I9LB 4OD1H 3RX3A 1TR1A 3GMQB 3X2QB 4PMFA 2H8XA 3GHBH 3RPDA 3NFNA 3VGGA 1ADQA 5CJXC 4NX5A 1ACZA 1NFBA 3H0TA 4OZHE 1DVTA 2VLRB 2Z35B 1TV3A 2GFBB 3RVUC 4L4TE 5CGYC 5AVXB 5CJOL 4N2YA 1G1KA 1QFWL 4YHIB 2A9CA 3CUXA 1Y65A 5C0AE 4D8PB 3DX3A 4EN3C 2OLAA 2O93L 4Y5YB 1FNLA 3D08A 4Z5RB 5I6PA 3TA3B 4QRNA 4BI7A 2PW2B 3U4FA 4BSVA 3ZKSD 2PTTA 5D6CA 1WTLA 5C0RL 4IL0A 4FERA 4RSVA 5DS8B 2Y62A 1WIOA 4KHTL 1DO5A 3D4GA 1JHLL 5E1AA 1AGBB 3KVQA 3B7UX 1IC5H 1FLTX 4RLDA 1OADA 1IXPA 2BS71 4L1GA 2OWWA 1FVDB 4WKAA 1WBXB 5E4IA 4ZMXA 4PJ9C 3CQIA 4NNBA 2HVKA 3PB2A 2HLEB 3CL7A 2X7WA 3OOQA 4GIYA 5C3TA 3LHZA 3GMNB 3RRAA 2VSMB 2REQA 1SO4A 2KC0A 3R10A 3QUKA 2IALB 4L18A 3DOPA 1W72B 1BFNA 1FQ9C 1MCOH 3MRRB 3RWGB 1YN7B 4LE8A 2PCQA 3LPOA 3O2LA 4WSHA 5J1SC 4WI7A 3CZFB 2FJFA 1DHKA 1MIMH 2FX8L 5KTEH 4DXVA 1K8CA 3TQKA 4FQQA 4CSTA 3L3HA 1VKXA 1KGXA 4PJCE 1IB5A 4HJ0C 3WMCA 2OKMA 3NACL 1P4LA 4HUVB 5E2VH 5I79A 1I75A 4IRZH 1XDMA 3ATAA 4ACZA 2D3JA 2PRLA 1A0QH 1RJCA 1NOAA 5FJJA 3ARDA 5JMRA 1L2QA 4FZ8H 2F8VA 2D2HA 4WZ9A 3QSKB 3SY5A 2NW3A 2EIKB 4KTEH 2F54B 3QYSA 3WD0A 4QYOB 3UBFA 4L6HA 3MFFB 1L9MA 4XPGL 1IFRA 2IPKB 5G4MA 4BWLC 5FEWA 3DFPA 3TA4D 5F1NA 3NQ2A 1ZLSL 1MCPH 2PO6A 3O0LA 2PDKA 2YQGA 3VXNB 3WFLA 3K30A 4AD5A 1BZOA 1ODAA 4DF9A 1AIFA 2EH7L 4FF5A 2CBTA 3TTEA 4R0LA 1ONEA 4LEOB 3WJLC 2I5YH 1T99A 4G2DA 4P06A 4AG0A 5D72L 3MNWA 5DMKA 4L6OA 1GTHA 3O3AB 3S46A 2Y1VA 5CC6A 4F7EA 1T21B 4ACTA 3DTXB 3N1GC 2ZBTA 4QF1B 3GNNA 1MWAA 3BG3A 4YTSA 3TIMA 1EQPA 4QXGL 4B5WA 4PV1C 4GNKB 1TO4A 1Q6EA 3RRQA 2YCJA 2CKSA 2PP9A 2P5WD 3MBDA 2QQKL 2BHUA 3SBWC 5TDOB 3VJ6B 1NWUA 3KM2A 2IH8A 2EADA 1IT0A 2JI2A 5TE6L 2G41A 1B0GB 4RV3A 3Q5OA 3LV3A 4FXFA 4XVJH 2EXSA 1CYWA 1TTRA 1Z9SA 3HHSA 1WCQA 3BSHA 4ODWA 2AQRA 4L9YA 3J07A 4MQXC 2YX0A 4IDLA 5DT1H 3OXSB 1W3TA 1KOAA 1FG2A 3TZFA 2ZC1A 3DUSA 1BBDH 3THAA 2BX5A 4JDTH 3U2SA 4P2RB 2AK4A 2XTKA 1W9DM 1GGBH 1A6ZA 2ZJSH 5EU6D 4FTDA 3UAJC 4ZUUA 5AD0B 4D9RE 2ADFH 2NYYD 3QJTB 1FVEB 3SPVB 1JVNA 3XISA 1MRQA 1CLOL 1NDMA 1HTIA 1BZ7B 1NFPA 2DI9A 5SWZD 4ZS7H 2H45A 2E7BA 5J13B 2QVIA 3TQPA 4XWGL 5EZIH 3K2GA 2JB6B 1DJYA 4LU0A 4TNWF 3E3QE 4JEJA 2RJMA 1MG3C 4X7TB 1TYRA 4HNOA 4AZUA 1RIHL 1CE1H 1P0BA 3CPRA 3UJSA 4PJDA 2GY5A 5GZOA 5AHLA 3FK4A 1RY0A 2BMKB 3K2KA 4G1EB 5CJ5A 1LDSA 1KEML 4I8YA 3R11A 1XUZA 3O4OB 4H88H 2OV0A 4FMKA 1URLA 1N18A 4PGCB 2DU2A 2F8QA 2CDGA 2PBGA 4DAFA 4ONGL 4TUFA 2DWXA 2IGLA 2G3IA 1I1CA 3LH9A 3LCXA 2PF6A 3QGKC 2DWYA 3RU8L 4JZOA 3B43A 4TIMA 1DWGM 3JYBA 2DZVA 3QAZC 5AKVA 3LHPL 1W32A 3JZEA 3G9VA 2C3XA 4DBDA 4KY1L 1MCNA 4PREB 4ZFMA 3U83A 1QO3B 4WU7A 2FEDC 5I19L 5J6GB 5U4NA 4QHMB 5EMKA 1AAJA 4HJJH 4NYLB 1TEGA 2CLRA 1TA3B 3VXQA 5HVWA 2YWYA 4U6TA 4JZ5A 3WEMA 2AJXL 2DLTA 4QG6A 1HZHL 4AM0Q 4NZUH 1K9FA 4RRPA 2QBWA 4NP4H 2DZEA 5M95B 4YXKL 1BQLH 3FTGA 4HHLA 2IKGA 1W1A1 3I9AA 3C6LA 5DCCA 2GSHA 2WV8A 4TNWK 1H09A 4FDWA 1SO6A 1ME7A 2BCMA 3HG3A 3UBXG 4TMCA 1V08A 3PNWA 2IADB 2QPUA 3ZFHA 3V0UA 1AY1H 3T1FB 1LBMA 4EEEA 3MYJB 3BI9X 2V5BA 4BZ1L 4KUZH 1EXUB 2ZFAA 4XMKL 4O14A 3A6OA 4FYRA 1YDYA 4MTMA 4N7QA 1RZJC 1TJIL 5B38A 3CQFA 1QLFB 4G9FB 4CC0A 4BBWA 4CCCA 3QZWG 3Q6GL 1J5TA 3IMWA 1CN4A 4NENA 2PW1A 3HV9A 4ZOAA 2MNJB 4LLMB 3BGFB 2R83A 3L5XH 5JIKA 3ARFA 2E6FA 4R88A 3Q01A 2WOBA 3TNNA 3ZO0A 3UYRH 1BG9A 3EUDA 1HJWA 5JMUA 2J24A 2AV1B 2CM6A 4D7PA 3LS5H 3ZR4A 2V69A 3INOA 4D9QD 2Y5EA 3WL9A 1BAFH 2FIKB 2OP4H 2ED8A 4K7FA 4F2ME 2YPKB 3FT3A 4H9TA 5DXYA 1QPXA 5CZSA 2JWYA 2ZZ7A 4XP1H 3GHEL 1W31A 1FORL 4MYPA 1BFVH 1JZ3A 4NRZA 3UTSA 5CLWA 2ZCLH 4FQ1L 4KEUA 1XIWD 4L5FH 2PDMA 2CW6A 3EO1A 1C7TA 4IRSB 4MOZA 3IPBA 4RAUB 5HDOA 1A4JA 1OAQH 3E02A 3L5MA 1GGIL 3OHXC 4KPHH 4E9RA 5KG9B 1BD2A 3DIVA 4S23A 1SHSA 3A4FA 4Q89A 1E6OL 3GH4A 4FABH 5DO8A 5ANMB 1Z2KA 3PTQA 2NY1C 2B4CC 4HA0A 2F19H 4PJBE 3GUGA 1IGTA 4DO6A 3WGUB 4MZ2A 3L68A 5LN4A 1T04B 3W3OA 3B9DA 4I4WA 2J1KA 4KJWC 3BDBA 5BRPA 4R4BB 4GXFA 3RWCB 4GAAA 4G1MB 3SCQA 4F57L 5E94A 4C7FA 1KCRH 1MLBA 3NO5A 1G7PA 4P5UA 3WV0A 2J56A 1RUQL 4U28A 1I2QA 4I9TA 3N1PC 3CT2A 4HKXA 2AV7B 1D9EA 1I85A 5GGQH 3EXRA 4M93B 2O5XH 4TKWA 3L2LA 5INDA 2A3EA 4MNQE 2Q3RA 2C9RA 3BJTA 1SM9A 2EEFA 1G5AA 4XCYB 3FZUC 1HW6A 1EZLA 1CB2A 4GBXA 1KBLA 3D6NA 3KPRD 3EGXB 3WK1A 3L45A 3ESUF 5HPMA 4KBPA 3ISIX 1CFSB 4FEIA 3ML9A 3HQOA 1E4MM 4JTUA 5DZOA 4NGHH 2YFNA 3P3TA 4A7TA 1JGVH 3QRFM 2W9DL 3NSXA 1UUMA 3QM3A 1K3UA 3C8KB 5HHQB 3CUGA 2YEVB 2JKWA 3FQWB 3QQXA 1AJ2A 2K6ZA 1A1OB 5I1GH 4JIEA 4R9XA 1HKMA 2ID5A 2CBPA 1UCBL 1Y0LB 1PG7W 4IISA 2J8FA 4F0HA 1I7RA 4C58B 3C60A 1EGJH 2PWGA 3LIZH 2XFGB 4NZRH 2WUBH 2OX5A 5BZXA 3LKSA 2OPCA 1EPFA 4DY1A 4W87A 5C9ZA 1G9HA 4HIIB 4TR9A 4M6MH 4HYRA 2CBJA 4B92A 1JZGA 2FJUB 2DZPA 3NIDF 4OBTA 3TDFA 4JRXD 2BSRB 5BZWA 1TJGL 2JK2A 3MJ9A 4NN7B 2BNQD 4Y1AD 5IEHB 2XFRA 5FUZH 5F8QC 2QIIA 2NLJB 1HXJA 3E8VA 1KQZA 3P60A 1DVSA 4RX4D 2EIEA 2ACUA 1XS2A 4FXTA 3IDYC 2O61A 4BEUA 3T4WA 2DZTA 2Q6WB 5B8CC 1Y18A 2X5PA 3MOBH 2QULA 2AXFB 5HHVL 2RKXA 4N0YL 3HGJA 4U4IA 4AW4A 4CD6A 1EJTC 2GOKA 1TPWA 5LDSA 1SZGA 1C5CL 1E4KA 4DPPA 2OMXA 1LOLA 5F6HJ 4GSXA 3WTXA 3M0XA 1G7QB 4AL8L 3PHAA 3IPFA 1OCRB 2YK1H 4AQ1A 1ZWIA 2MPVA 3GJFK 3SKMB 1JPIA 5I73C 1DCEA 2QUNA 3LSCA 4D1IA 1LEKB 2YGPA 1ZT4B 3DDMA 3OZ9H 1E9YB 2RFGA 1FL3A 2XQYK 4BCEA 3MGAA 4J40A 5IB5B 3KVDD 1T1YB 5TH2A 4WK9A 3SN6N 5I8CA 1T7ZA 5DHVH 3BUVA 4UT6L 4LSSL 5MEQA 4YR6B 4JFYA 5B21A 2J8UA 2G60L 3LTYA 2F6AA 3GSVB 1NCWH 1AQKL 1AXTH 5IQ9A 4WXYA 2FEJA 3TN0A 1H2JA 4F7MA 2LTQC 1TG7A 2YAQA 2BHFA 4PLNC 4JQ3A 4EX4A 3HE7A 5G5DA 2OMVB 2G2PA 4I9WE 4RA3A 2EEDA 5BMWA 3RWIB 4XX6A 4I9MA 4LSRL 1NINA 4NAFA 5MERB 5LNDA 3ZR5A 4KIEA 5E4OA 2HT3D 1P5VA 3I6LE 4ONHA 1I1FB 4E9LA 4BDVA 5JXQA 3PWLA 5T1LB 1S78D 2Z31D 3WF4A 3F1QA 2HE5A 4YHML 3C2EA 3HGOA 3KLDA 5GZND 2X1PA 3KPTA 2YCIX 5D7LB 2A9MH 3CV5A 1P5BA 1GR7A 4YN5A 2HVJB 2W4XA 3RF9A 5DC2A 3QWQB 3D1MC 2QPDB 2JJVA 3H3BC 3W0WE 4KKAD 4F8NA 3Q6FB 4M80A 2QMJA 2OXNA 4F7TB 3OKMA 3TBYB 3QC3A 2LLEA 2KHAA 4NRSA 5ILTL 4KKCC 3L4VA 1OFPA 5EBWB 4YTRA 4QJ1A 3D52A 3RVTC 3SDAA 2X1RA 1ZV2A 2ISWA 3POHA 1SLUA 3TUUA 3B7RL 1UJPA 2BIOA 2KLSA 3BRFA 3IK4A 3TP4A 4FHAA 4LT9A 1SJXA 2JIXB 4FAAB 4XZBA 1IVLA 2YN3A 5A6MA 4N68A 3WLIA 1RCXB 1WH0A 2IPTL 4XP4L 4GMSH 4UFMA 4WTWA 2QQ6A 4JTQA 1I2OA 2J62A 2VEKA 1QNZL 4QCFA 3EOBB 3HN5A 35C8H 1XFPA 3FRPA 3RGVD 3NEOA 2JJTC 5AKTA 3UTTA 1ONRA 2OK0L 2WNQA 4ODHH 4R97B 3N04A 4CC1A 3AS1A 3X14A 4B5SA 1DSFH 5DI8B 5IK3A 3QDGA 1GMIA 4UAHA 3VQLA 1Q0YL 4Z77A 5TE7L 3H3PH 4A3UA 3H7BB 1JPGA 3W53A 4P5TC 2Y6SC 3BT2H 4KO7A 2Q2EB 1S7SB 1R24A 2GUYA 3CUPB 5M1TA 2I7OA 4K8RC 4X6DB 3RVUD 3DRTA 3BLLA 2OPJA 3PREA 4MG4A 4HHAB 1Y8BA 2PD5A 3C0SA 3FHEA 3MRIB 2YD2A 2ADIB 3CXDH 1IEXA 1W5PA 3PPSA 2GKIA 5EB9A 3B03A 4G7SB 2HMIC 3T0AA 4EN3D 4A2EA 1UT2A 5CLXA 3RPKA 4KROC 4K9EL 4MQSB 3FFSA 5HHOB 3S6OA 2AL1A 3LKQB 3IIPA 5IY5B 1DZBA 5J8LA 4X4ZA 3AROA 1JFQL 2GJPA 1OIMA 4IBSA 1UWQA 4NUQA 2BSTB 4N8VG 2BZDA 5DQ9B 3PDOA 3EEGA 3QYMA 4CW1B 2Q7AA 5E2UL 3QLLA 2JQAA 3EMZA 1R38A 4HD9A 3UX9B 1QWHA 4ALAC 4PJ9D 5IVXE 3VSQA 3E0GA 3FFCD 1F3EA 4IDJL 1N8ZB 1SEBA 1E71M 1FAKT 3ARQA 1O7AA 4WW1B 5HDRA 1GZHA 2RCSH 3CIQA 4UQBA 1NANI 1A5LC 3HG1A 3IRPX 2RJGA 4DF1A 1N68A 4FHJA 2FEEI 1EO5A 3O6LL 1E2ZA 2VDOL 1KLUA 2WYIA 1W2PA 2AQOA 3M64A 2QCFA 4MRCA 1KIRB 3RTQA 3ZE2F 1OAUL 3ID7A 4HJ0D 4HBCL 4GOSA 1RBOB 2YYTA 4LLDB 1MF2L 1A7QL 4K9JA 3OZKA 5J1TC 1LYQA 2ROXA 1I9EA 4KK9C 4Y4FC 2DQTH 5DMIL 3HB3C 3WDJA 3SDDC 5EEUA 2EDMA 5EDXA 4ZTYA 4A8NA 1PAZA 1E4WL 4M61A 1R3QA 4NQDE 3H3KA 4AY0A 4JO3L 4A7SA 2DQCH 2XKUA 1W54A 1XBZA 3SY0A 1BFTA 3QQDA 2WZPD 5ICYB 5HVFB 5IHUL 4ABUA 1IC4H 3BZJA 3NZ1A 4QWWC 1UR9A 4IIQB 1RUMH 2LW3A 4XVOA 2B59A 1P1VA 4OIFA 4FI4A 3G6JA 4FLRA 5A6SA 4AQZA 3CIWA 4YHYB 1DQMH 1OAKH 3NIGB 4Q6XA 4ZO6A 2CK0H 1KIUB 3QMSA 3OF6D 2EKCA 4NX0A 3TCLB 1ADOA 2BWGA 1QO2A 2C9VA 1IFHL 2EDHA 3PF3A 1MFDH 3GEFA 4EI5B 1A9VA 2F53D 3CH9A 1ZAHA 3WNLA 1OSEA 3RVVC 1XPGA 1EP3A 3FQ2A 2WUCL 2BX7A 4DP6X 5DJ6B 1UFUA 4H1LH 4OUEA 1F90L 1BQ5A 4PGDB 3BPNB 3ISRA 1C9DA 3VFOA 4I0PA 1KT2A 1EVTC 4OM1L 5E99H 2H32A 5BS0E 3EOAA 4UM8A 2WMHA 1WD8A 5KYUB 1I9RL 2VN5A 1VERA 1XGUA 2OKOA 3GIVA 2BDQA 1XB6A 1MCFA 1E1EA 4FA8A 4BYHA 5J11C 2DI8A 3WK3A 1AUSL 3B04A 3W0KA 5D2NA 2CAKA 3FT9A 3DO4A 4PJEF 4MQXD 5ESQB 5L9DH 5L8JB 4M0XA 4IFKB 4J5VA 2FZDA 1M7DB 4NFBA 1SVDA 4NJKA 4HK7A 3QN3A 1VCFA 1OM3H 2AERT 3OGCA 3PWNB 3V5HA 1PZSA 3HFTA 4FRWA 3UAJD 2VELA 4ADGA 4DB7A 3IDUA 3TYEA 2FX9L 3V0IA 3OW1A 3NJIA 5JYLA 1HHGA 3TFKC 2FK9A 1U95A 3S6TA 1FPTL 2YD4A 2V8ZA 5D7IF 1GXEA 2D2GA 1MQKH 2AGTA 2XX0A 1UTDA 4E9VA 4KFPA 3S4TA 1J8RA 2X4TA 3VG0H 2DEYX 3PWPB 3TA9A 4AEOA 3UWYA 2QQQA 3AU0A 3P74A 4PN6A 5KYYB 4KNTA 4JZJB 3GDCA 3MMDA 1V3MA 3VOCA 3HAEG 1DE5A 2JQZA 5LXVA 4K68A 4G5ZH 4Y1SA 4DCQA 1Z0NA 4HX1B 3Q4DA 4LCCA 4X60A 2FCBA 3TWCL 4PULA 3NZSA 3QG6A 4APQC 4ETYA 1MI3A 3VXRE 3VCCA 3GG8A 1RZKL 3KXFA 5K1JA 3FH7A 4F79A 1FHLA 1PWMA 3S2MA 4PJIB 4QLKA 2G50A 3MKVA 1E1CB 4Y8EA 1Q6CA 2A6KA 4AENA 2WNWA 4NO2B 5E4EB 1T5WA 3C2AL 4ORMA 1V8HA 4PGBA 1DP0A 3PWJB 4PRBA 1REIA 1GYVA 1M7OA 1BXNA 3ZLHA 4HLEA 4QEGA 5EO9B 1J12A 2KZ1B 4HPOL 1ETZA 1E4HA 2WB5A 3JW7A 3GTHA 4FPSA 2QADC 4NKDA 1F6PA 1RFDL 2FEDD 2AXGB 1MCWM 3O3BA 4NUJA 5DHXB 3W76A 5H4ZA 1G9MC 3WJXA 1P7KA 5IW3A 5DK2A 2HZHA 3F7LA 1SSDA 3GSMA 3K4DA 3GXUB 1N10A 4FQPA 2Q3OA 3SKUD 1YUHB 2JCCA 4FXGA 4PLKC 5TGBB 1LBLA 4HIJA 1A21A 3VWJB 1DTUA 4PA8A 3PTKA 4R27A 1JZ5A 2BLFA 1IGML 3VXOA 1O6VA 4UDUA 3PWUB 4K5MA 3MNDA 3B1TA 2YSSB 5IVZA 3G0SA 2PPAA 4ISVB 2BVPA 3A24A 4U6YA 3T3MB 2J5LC 2GWGA 2Z7YA 3T6WA 1EHAA 1NJJA 3W2JA 4FMVA 3WS6C 4IPJA 5CUSL 1O5KA 3B1UA 2YL8A 5JHDE 3HFFA 4DW2L 5KSVB 4ILDA 2ICCA 4X6BA 3L3OA 4UTIA 4X7SL 5K39A 2WKGA 5JHMA 1W0MA 4YHKH 1A14L 1MRDH 1PLBA 1PZBA 1QABA 4JLRA 4HFWB 1FO0B 3ESVF 2WXJA 2DORA 2IPFA 3KUMA 4R7XA 1U91B 1U8JA 3CVDA 1M2VA 5F8RC 2ITFA 3EJCA 1T20A 3P0YH 4CA4A 5CPNA 1A0EA 2H1LM 2EC9U 3T2LA 2VR8A 4TVPD 4CCDA 3GB7A 2R1WB 4HXAH 4RAVA 3STZA 4XO8A 4W88A 4MS6A 3FB6A 1W8NA 2NX5A 4UIOA 3C6EA 3HMXH 1BXVA 4KQ3L 4Z3JA 4M1GH 5D9NA 2Y8UA 2P8PA 2H8ZA 4GYFA 2EQDA 1GOWA 2NTFB 3TT1L 3F7VB 1N82A 4AV0A 3KDMB 3UFIA 1QFPA 4Y9CA 4TVUA 2X2GA 2RBLA 4LYPA 1CCWB 3T6CA 3E38A 2XIOA 4GXUN 1T2XA 2ODHA 4PFMA 2CO4A 1NBZB 3MUGB 3WEXA 3HR5A 1ZT1B 1IIKA 1QBLH 4F7PB 1EAOA 4RW3A 2WZIA 3RFRA 4ZE4A 1L8PA 4KI5F 2QJDA 1TKWA 5ADPL 2ENSA 1PYWB 4MNLA 4J28A 2HRWA 1NFAA 5E8OB 1USQA 1H3GA 3GSUB 4XD5A 3QI9C 2R1XA 2YAEA 2EDXA 3KPMB 1E5UI 1KPUA 4LVHB 6FABH 1OGAB 3W72A 1TQXA 5CC5A 2NY1D 5FSEC 3GVRA 1HWGB 2Y0SA 3LLDA 4KJWD 2X1XR 3GI9L 5E93A 3A6CL 4E5XA 1ND0A 3KYAA 3N11A 3GY1A 4PPTA 2IQ9L 1N26A 1NEPA 1R3VA 1KUMA 4UTCA 4KX8A 1OY0A 5BRQA 2QUMA 3WO4C 4YSRA 4DN3H 1S5TA 3BPCB 2DYPA 4FFZA 1K3ZA 3JR2A 2L04A 4ZUVB 4KY2A 4MAUL 4LCWB 5D1QB 3HZVB 1NU5A 1P6BA 2PZ0A 2Z7GA 2ZUXA 2PDUA 4HKJA 4ZQTA 1QKZH 3Q2LA 4LEXL 1XCQA 4CMHB 1KDIA 1M4KA 2J1ZA 2NVCA 1P7QB 1P9MA 1ISZA 2Y7QB 5E95B 3HZYA 1RUPL 3FZUD 4DKEH 1ZGLM 1BVNP 1YRRA 1J5DA 3CLFL 4XX5A 4XXWA 4J3VA 2OZ3A 3TZNA 2FO4B 2CLPA 4GABA 1A4KB 1WDQA 3S96B 5IRPA 4UTAA 2M83A 2QQLL 3PSWA 2ZWKA 2VR3A 2TMDA 4JHMA 3UGEA 3UMTA 1LO2H 5L2KB 4QKXB 3CMOH 3IUHA 3DBSA 4ZXOA 1N64H 1DBMH 2ATKB 2MRYA 12E8H 2D3NA 1KA9F 4Y89A 3HGRA 4N25A 2CUAA 1E9ZB 1IM9A 1PKQA 1SXAA 1KCKA 4OU3A 1XZ0B 4H8VA 2BGSA 3NFPB 1CB7B 3G5YB 1DVFA 1A5FH 1UOVA 2ITCB 4PJDE 4LSVH 3DXAA 1JDEA 3D09A 3GHPA 3VUPA 2RFXB 5I1JL 3EHBC 2C16A 5MENA 4UOW1 3IGFA 4OUOA 3NGBB 1MFVA 5CF3A 5CINL 1NUGA 4YBHA 2OTWA 1HHJA 3TW6A 3LUTA 3W82A 1RI8A 3WQOA 5LQBL 1SXBA 1WFMA 1MFBH 1CL7H 3T6QC 5C0DA 4P4RB 1U21A 4O2FB 3V6FA 1TTQA 5AZ2L 5J12C 1UC5A 3MRHA 4CMMA 5M17A 2VLMD 3MFGB 3BH4A 2RGLA 3DURB 3N50A 4LEEA 3TAKA 1WBYA 4ANUA 2YMXL 4IOSA 5ECVA 4G7RB 3QHZH 1SDDB 1AS6A 5DD3L 1DQIA 4Q6KA 1ZVNA 1J1PH 1KB5L 3MV9A 3BGMB 3I3BA 2GJ6D 1OYCA 1J86A 3BJFA 2GGEA 2WZMA 1E6ZA 1PLGH 1AMYA 2QSTA 4WY7L 2D03L 2V67A 2QJGA 1IJ9A 3GXFA 1JPSH 4MJID 1KTKE 3UZVB 1US2A 4O11A 2X6CA 1NOLA 2AEIT 3IK2A 1M57B 2Y25A 2DQEL 3R06A 3W7HA 5LGHH 2AXHA 3K4ZA 4LSQH 1X96A 2FSEB 1UXMA 5TBOA 3GDRA 2AP2A 4RV8A 3N2XA 1VESA 5CP7A 2KAUC 5B7MA 5C0CD 3WAKA 3MTWA 2N01B 5DJZA 3OVQA 3KHOA 3TIEB 4LFHG 1P69B 3UJEA 1YRKA 5HK4A 5IREA 4JR5A 3SGKC 1ZFJA 4XGZA 4P9HL 1O5PA 3QEQB 3TJHC 2FJHA 3UAFA 3CH0A 2FRGP 1GYMA 1KGCD 1A0DA 1H5YA 3B7YA 3ENLA 1T2QL 4ABQA 4GW5A 3WTSA 3GT6A 1W6TA 4PRID 4CDGC 3VPLA 3OAUH 1ODZA 3MLSH 2GC7C 1VFAB 2CLZA 1RZIA 1X5FA 4CVUA 4LAUA 2CBMA 2PYEE 1AL8A 3U3HA 1Y5VA 2J57A 1TLMA 3RY6A 3BUQA 1VJZA 4LSBA 2FLBT 1EGMA 4JM2B 4UIMB 1VEMA 4ZMPA 5FKPB 1XRFA 2YEZB 5GGSA 4AE1A 2D22A 3QJHB 2NT1A 5IQ7H 1MUWA 4JDZA 3D3VB 2XZQL 4OVXA 4LUTB 3EDJA 1P7BA 4KKCD 1UHVA 3CMJA 3G1DA 5CWSB 1W9XA 1SDYA 4ZMTA 1R5WB 4Z7VA 2HCVA 1YEJL 3RVTD 4FQLL 2J4WH 2DIJA 3FA5A 4KDVA 3FQNA 4L3EE 4Y7MA 3Q0HA 4PJGB 5D1ZC 1LO3H 3QULB 1ADDA 4B91A 4OIIL 2IAMB 4UB0H 4HZ8A 3KZPA 3QIBC 3RDTC 1B3VA 1MQQA 1F6YA 3HRZA 5AL8A 1W3LA 1NAKH 3PP4L 1DEEA 4F0KA 4P4KC 2GIYA 3SO3C 1XHGA 4XBPA 3QV9A 2NXGA 3HI1A 4K73A 1UWEL 4BQ5A 3M7SA 2P47B 5AC8A 1IBDA 3OB0H 5C7ZA 2E9WA 3CUZA 1HU8A 2VXSL 4JQ1A 3GM8A 3RA7H 3LPFA 3HPJB 1B4JH 1PY0A 3BPOC 1HJSA 2NXYB 4AY1A 4P5TD 1M41A 1DUZB 2Y6SD 4XPFH 4O0QA 2O5YL 4XCFH 3WGVB 3JTTB 3HC3H 1ZANL 3FJ4A 3QS2A 1TE1A 1YEHH 3INUH 3L95B 3SKNA 2CHXA 5GSRA 3Q9PA 1D7KA 4MDJA 4XOEA 5T5FA 2BSSB 2HMID 4XBGA 1GYUA 4Z2JA 1KFJA 1XMWA 4KROD 1OPGH 2XG5A 3M44A 4E2OA 1GW6A 3CBKB 5ICZB 2EEBA 3HNTH 1U83A 1Q8MA 1UKQA 4WQ6A 1H49A 2WYTA 4OLWH 8A3HA 1SQMA 3NPSB 3DX8A 4H9MA 3S37H 1T6WA 2A9NH 3SPHA 1UEYA 2LHAA 1B4KA 3U2ZA 1PTGA 3QHMA 5HYJA 1G6RL 3KPPA 3TZVC 4XSMA 2V6HA 2KUTA 5EPDA 1J0YA 1LDPL 3VXMD 4BK9A 4Y9FA 4DWSC 3KVMA 5EF0A 3W1LA 4GP8B 5HJDA 5IWLC 2G2RA 1F5ZA 3NFUA 4XISA 2RA1A 1QQDA 3C5JA 4GIOA 43CAA 4X98A 4C6QA 1SYSB 2VTFA 4H26B 1UD4A 4JFEE 3KG5A 4DVBA 4QNWA 1EGVA 5GGRB 3G04B 3M46A 5EUOF 3APYA 1NF0A 3ZN6A 3EXTA 4XP5H 5AKSA 1D9KA 2WKJA 4MRBA 3RJOA 2WSRA 4MKTA 3S35L 1YTEA 1EZ2A 1M6OA 2ZE0A 5ESAB 4OT7A 4L56A 1SZEA 3KPOA 2YCEA 2J6EA 2D1ZA 3BLOA 3G0UA 1VYRA 4N90D 3LJ3A 1NCGA 3VCNA 4N2CA 1TPUA 4KK9D 2EIJB 3H2OA 4PBXA 5B3SB 3HB3D 1CURA 3SDDD 1UWGH 3C6SB 5CSGA 5CBAB 2C3WA 2NW2A 4Z2LA 4MLSA 4U3SA 3EFDH 4Q6YA 3VA8A 4Y2DA 5D8JL 3DUUB 3F4DA 1VADB 4M6PA 5CKSA 2EE9A 3APMA 3LQZA 1UC4A 1F8TL 2QDWA 4QWWD 4JAWA 1LE9B 3E0WA 1SF3A 2ZICA 3V9EA 5CGMA 1E6QM 1FCBA 1N3NB 4HPYH 1VHCA 5FGCB 3NSMA 3S34H 4MSSA 1BREA 2JELH 1F8IA 5I6SA 4FJYA 4GSDH 2G5BA 4LF3A 4JN7A 3RWJA 1TZHA 4RA0C 3ZKMC 4CGUB 3RUGE 1B3ZA 4KWSA 3TC7A 1JWUB 2H3NA 3DMMB 3RVVD 2B77A 5CBEB 2CUIA 4YX2L 1EWDA 1AD0B 5D4QA 3NDZE 3ZDXF 2ZNXA 1UOKA 4ORZC 4C55A 1YNKL 4PWHA 5FO7B 4OHQA 4Q7NA 1RPKA 1F3JB 1YHTA 1J87A 4L9LB 1Z6JT 4Z7WE 4CADA 3RZCA 4GVGA 5JBDA 4CNTA 1JF6A 1UKSA 4JL2A 2WGXA 4GKSB 4OKVB 1BX2B 5B39G 1X97A 5AENA 2E59A 3IWUA 3DIPA 4FG2A 1N8OE 3FQTB 4OZIB 3I3EA 4HCFA 3ICJA 3VKDA 2COVD 3KLHD 1DBJL 3O11A 2HUHA 3F4WA 4QIRA 5IVNA 2P1FA 4U3AA 4OZGA 4KV5E 3MHFA 2WCPA 3II1A 4K0OA 4PS4L 2MJWA 4HJGB 3SDXA 3MV8E 2VUNA 3U0TA 3UWVA 2YMOA 2OYMA 4FLHA 4ZSUA 3OIXA 1IM3A 3QORC 5C9JB 2W27A 3M0HA 2E6DA 1BF8A 5B7YA 1U1UA 3BPWA 4OLEA 4WJG3 2ACQA 4RGOL 3GWJA 3H2CA 2Z00A 3TFKD 3WCYA 4LPYA 4LRIC 3P3RA 1VH7A 2HKAA 1DVQA 5HOSA 3IRCA 4NT6B 5HDBF 4X99A 4ZFGH 1NWRA 2O6CA 5KSAC 4WOZA 4WWKB 3AO0A 3IJSB 4JMXA 2OVLA 2OLHA 4MD4A 3CZUB 1UKPA 5F2FA 1JZDC 3OZMA 1PSKL 5KSUA 1S9YB 3ABRA 1QPPA 2UWEF 4YSAA 1A5BA 2IDFA 1QRNB 1D8CA 5ICXB 3Q58A 1DJGA 3T0EE 1PQZA 1KR0A 3JWNG 1K8XA 3JWOL 2J4GA 2OZ8A 3UWUA 4P8VA 3NABL 15C8L 2P45B 5BXFA 4R26L 2F68X 5IBTL 5JPMB 2YLHA 3LSOA 2ZOLB 4IS6B 4APQD 4H0IA 5A69A 3HZ3A 3ATBA 2R2CA 3LHYA 3S9DB 4QLLA 1PJ9A 2K7QA 3QSRA 1WFIA 4XRCA 2X4NA 5MP6H 2FX7L 1TU2B 2VLJB 4U1HA 1AQ0A 3DUHA 2HE8A 2VLKE 1R3IH 1H1NA 1G9NL 4H9ZA 4KF1A 2Z91B 4DLMA 4OV5A 3RVXD 4DWDA 2AKRA 3OA5A 3NH7L 2WCGA 4DWHA 1C5BL 2OMUB 4XNYH 2VVSA 2K45A 3DDGA 5LNUA 2QADD 1TQJA 3L66A 1T1XB 4ZQKB 4GWEA 3N41F 1CICB 1IMHC 3VFGL 5SWUA 1KBPA 2FD6H 1QPKA 3QY7A 4N6EA 1H6FA 3EG9A 3FXGA 1U3HA 3O3UN 2Y7SA 3AB0B 2OJPA 2WAQA 2WXQA 2YBRB 4PLKD 2VDNH 4LSDA 1ZE3C 4NJHA 1ZEAL 3SCSA 3H4GA 5TQLA 2W3ZA 1RLDA 4CVXB 4YFLI 4PMOA 5GS1A 1TWIA 3GTFA 3VAEA 2X44D 4ZQMA 1FYTD 4GP5B 1O95A 3BUYB 1NMAH 3GJFH 4Q2ZA 2OYPA 5LIYX 3CFIC 3IJIA 1UT9A 5AAWA 2OWXA 1NM4A 2NQ9A 1HC1A 1ORSB 5HHXH 2CO7A 4W6WB 4U1LA 4HUNB 1GOQA 2YD7A 4JDVB 5FCSH 3NCXA 2Y5SA 5CZVH 1EZVY 1VGKA 1A5UA 2J9YA 1XMEB 2WLLB 2PE4A 2G3XA 1UXWA 4Z76B 2YL9A 5I66B 2AFNA 3RHWF 2DSVA 2Q86A 3V5CA 1PF3A 3CL8A 4M3JA 2NY2B 3NAAH 1K7XA 4EDWH 3HG1E 3HZMA 1BQGA 1V3IA 5ADOL 1QHPA 1GKRA 5CG7A 1B3YA 4CEUC 2MCPH 4B9GA 5LXXA 5GS3A 2C4FT 3OBAA 3ZE1E 4OQTL 1N70A 1KCBA 2R7EB 2CBQA 2YB4A 4UTBA 2XBTA 4PJAF 2C0HA 4YHPB 3WCZA 1S7XB 1IARB 4AB4A 1XF3A 3VACA 4NJGA 5C7XH 3UY7A 3KEHA 2G9KA 4KKRA 3KBMA 4LHUG 3QHOA 4DELA 3ALPA 5HI4D 3CN1A 5DUMH 1OAZL 1XB3A 5JHLL 4YXLH 4L3AA 3TAOA 3UP1A 4QOKB 3WO8A 1TJHL 4JBSA 1PYFA 2LV4A 3JT0A 5IJKA 1EJRC 1G9EA 3CNYA 1XYBA 2OG9A 5C0BB 2FB4L 5E6IB 3BZEB 4XZIA 3NRFA 1R3JB 2PRMA 4FG0A 3QI9D 3CIXA 4O2CB 1AFVL 3KPQA 4RZCA 2KDYA 1KFAL 3SDCA 4ZSOB 5A6BD 1YYMH 5F9JA 3O2WH 1CFQA 4X6FB 3WQWA 4O5LL 3P30L 2H8PB 2A74A 4RMUA 4QRPB 2FT6A 5D8WA 4O15A 3KBHE 6CGTA <