1UA3A

Crystal structure of the pig pancreatic a-amylase complexed with malto-oligosaccharides
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
b'QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Crystal Structure of the Pig Pancreatic alpha-Amylase Complexed with Malto-Oligosaccharides
pubmed doi rcsb
molecule tags Hydrolase
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ua3A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ua3A01
4GPNA 4AZ6A 2VX6A 3ZSSA 4DUXA 2BXYA 3WFZA 1ZJBA 1QVBA 4CD4A 2YDRA 4CCEA 3LPPA 2X0YA 1AVAA 2NT0A 3TTSA 4J3XA 2WBGA 1YQ2A 2D73A 3ZQ9A 3VSUA 4KMQA 2FH8A 6TAAA 4KRUA 2BHUA 2CHOA 3CUJA 1D3CA 3VINA 5M5DA 1H0IA 2XVLA 1XGZA 3D4YA 4FNPA 5KEZA 2JALA 1C90A 4GZJA 5FL1A 1VAHA 1HN1A 4D1IA 4D6JA 4XB3A 2F8QA 4CD8A 2WKGA 1U33A 5IXEA 1MQQA 1VFMA 4B3LA 5CJ5A 4R27A 1RPKA 1ZL1A 3SCUA 1VEMA 1XSIA 4B9ZA 1BG4A 1XCXA 3VO0A 3DYOA 2F18A 1DWAM 5A8NA 1LG2A 3PZMA 4F9DA 3ZJ7A 3WH6A 4J28A 1FOBA 4ZFMA 3IJ9A 4XV0A 3BVTA 3A4XA 1MVYA 3VU2A 1JZ8A 2JF7A 3W4RA 4PSPA 1QI5A 3BXWA 3SCTA 2YL5A 4JKLA 1CGTA 1Q6DA 3O2LA 2Y8VA 2D1ZA 1C91A 4GO8A 1K9TA 4DWSB 3CUGA 3U7VA 2VCBA 1GOIA 3UR8A 4AZ7A 4D6FA 1LL4A 1CXFA 3EMCA 3VD4A 2X1IA 4YN5A 3LRLA 1KTCA 4JKKA 4AW7A 3QOKA 3ZOAA 2YOCA 4AZ5A 5DO8A 1XSKA 3T0DA 1TA3A 3GTNA 1E0XA 2WB5A 2E0PA 4AIOA 1UQYA 3CV5A 1RP8A 3WF2A 2JEQA 5IHSA 1D7FA 2CESA 5D8WA 2C0HA 1CZ1A 1NOFA 1ZBKA 2WW5A 3FXYA 3D50A 1OT2A 1UWTA 1QI3A 4HZ8A 1E3ZA 2DH2A 1HJQA 2XSAA 4PSRA 4E4PA 4WF7A 1JI2A 1SFSA 2A3HA 1UD6A 1K9DA 4NXSA 1K9FA 2ZX6A 2XVGA 2VCCA 1W2PA 1QW8A 4JFUA 3SUVA 4RE2A 1UWUA 2A3AA 3MUZ1 2XIBA 4DWSC 1CGWA 4UFMA 4UQBA 1UD8A 3FW6A 1OGBA 1TUXA 4OUEA 4R5EA 3WMSA 3BVUA 4LXFA 1YHTA 1S46A 3WBEA 2XVPA 3BAYA 3GH7A 1CECA 4MDPA 5EB8A 4U33A 2EADA 4YHGA 5FL0A 4ATDA 1C8QA 1HL8A 3FN9A 3VDBA 3BCDA 1OINA 1UWQA 4M80A 1E1FA 3WY1A 5JBFA 1PX3A 3S5ZA 1M04A 5CG0A 1FHLA 2OW6A 2GVYA 3AHXA 3LRMA 2VQUA 1JF5A 3A4WA 1OSEA 2WCGA 1R34A 2ZX9A 1X6NA 2YIHA 3GH4A 3CMGA 2ZOXA 4IUGA 1JYWA 3BGAA 4IISA 2CPUA 4RE4A 3F4VA 3WDJA 2XIIA 4JFVA 1JG9A 5A8MA 3MV11 3QHOA 1O6IA 2VURA 1ITXA 1TQSA 2O9RA 3D51A 3WMCA 3BUBA 3K1DA 1F4AA 4U5IA 1JI1A 4HOWA 3CPUA 2J47A 1QPKA 3WH8A 3W37A 3GXTA 3AHZA 3TA9A 3VPLA 4J27A 1W9PA 3F5LA 1FP8A 1E1EA 1GHRA 1FFRA 2XHYA 3I3EA 1G94A 4ZXLA 2ZUVA 2AOSA 4PTVA 1GOWA 4UCFA 4UFJA 2X05A 1HP5A 3B9AA 2NT1A 2CCRA 2ZXQA 4GQQA 2EPNA 3CH9A 3HU7A 1BGGA 5IDIA 1KGXA 4L4OA 4ML4A 1E4LA 1UWSA 3AISA 3ZJKA 1EA9C 4WKAA 3EJTA 2WCAA 2GFTA 2BY1A 2DDXA 1EQPA 3MUAA 4CU7A 4TVCA 2VZTA 1I1XA 4NRSA 1CLXA 4W93A 1VEPA 2YDQA 4IM4A 3LXBA 4FNRA 4PMXA 5E6ZA 5I6SA 3AIBA 5BXRA 4OZOA 4XZBA 4LPCA 1E73M 1KR1A 3SUUA 1E4NA 4W89A 1OIFA 2WZEA 3G6LA 5FOOA 3EYPA 1C3FA 3HG5A 5A8PA 1CBGA 1JZ7A 3W6MA 4D6GA 3BLBA 3N11A 3TTOA 5JIWA 4LYQA 2WMHA 2F1BA 4FNSA 2FGZA 1BVZA 2J75A 2XGBA 3UG4A 3NSNA 3EDDA 7CGTA 3VKKA 2ZX8A 3A5VA 1HJVA 2CBVA 2J7GA 5ABGA 1QWUA 4F9JA 3SCRA 1V6XA 2BY2A 4CVWA 1R47A 4CN1A 3BAXA 1V0KA 4D6HA 2BVTA 4N42A 4V28A 5AY7A 1UYQA 3N04A 4W88A 3BAWA 1FFQA 5A6AA 4AZIA 3KL0A 2G3NA 2PF0A 3O9NA 4H04A 1E55A 3AIUA 1MQRA 4QLKA 2V3EA 3QHNA 2J74A 1UWRA 3GBEA 4J7RA 1FH7A 2ZIDA 3VSVA 2D23A 3VNYA 4MAVA 1M03A 1LF1A 3DYPA 5GQBA 4Z2KA 3WF0A 1XSJA 1BAGA 2EXOA 2XPKA 3ALFA 1GONA 3SCWA 2XTKA 2GJXA 2ZXDA 3VMOA 3ZR6A 5LYRA 2XN0A 2FH6A 1GUVA 1EOMA 2WMIB 1E9LA 4JKMA 1U30A 3N18A 1C8YA 1B3VA 1UKQA 2DT1A 5BCAA 4HMCA 3OB8A 5I77A 1W9VA 1TFVA 4UQEA 4J3UA 4QP0A 1KGWA 3K8LA 4ZE4A 4JFSA 5BXSA 1FH8A 2D0GA 5EBAA 1IZJA 2XVKA 2FGLA 3UERA 2BY0A 4BQ5A 1UH3A 4HOXA 3NJ3A 5CPSA 3WKZA 1JIBA 1QNSA 1J18A 5A2AA 3FY1A 2V3DA 4K68A 1J9YA 3UESA 2WZHA 5IHRA 2ZICA 5A8QA 3CHCA 3GDBA 3A4AA 2J62A 4MNJA 2YFNA 2D22A 1H11A 3U5YA 1JFXA 5DFAA 4ZE5A 3BUIA 3HMCA 5DT7A 5BYWA 3EBVA 1VB9A 3CO4A 4AZGA 2QPSA 2DIEA 4M56A 3M46A 4A4AA 3NSMA 2CKSA 2ZXAA 3MUIA 3W26A 3WBAA 1ECEA 4HP5A 3RO8A 3BMVA 3BC9A 1PIGA 2E8YA 1ZBWA 4QFUA 1GW1A 3CHDA 3ZMRA 4UFKA 4WSJA 3HG2A 5E0FA 2W66A 2EEXA 1CYGA 3CZJA 2WMFA 3MUY1 3GXNA 3LPOA 3BUDA 2QPUA 2O92A 3BVVA 1WE5A 3RCNA 3SUTA 3ZSTA 4FNTA 1V03A 3SCNA 4AY1A 3AIEA 1VBRA 5FD0A 4OJYA 4ZEPA 3N12A 3CMJA 3WNLA 3NCOA 2G3MA 2ZUUA 3A23A 5I23A 2ZWZA 3GNRA 7TAAA 3AFBA 3SCPA 3MSDA 2WCSA 2VRQA 1NP0A 1J10A 1JZ4A 5FKYA 1B1YA 1HJXA 3D4ZA 4JL2A 3AXHA 1BTCA 2GSJA 2ZXBA 1WAWA 5DT5A 4PMOA 3HN3A 1JXJA 3MV01 1WP6A 1XRVA 4E8CA 4TVUA 3WUBA 1GJWA 2D3NA 1UD5A 3AXIA 1I1WA 2VOTA 3ZIZA 1KWGA 1B3XA 1EDQA 5ABFB 3L4UA 1HKKA 3ZT7A 1WNOA 4CCCA 4M29A 4Y7EA 3VTRA 3AIQA 1GPFA 5I5RA 1HP4A 4AZBA 1JZ2A 1Y7VA 4MB3A 3ZR5A 1LL7A 2X8RA 2WWCA 2PI6A 2NW0A 2XM2A 1BVNP 3DX3A 2DQXA 2YDSA 1PAMA 1PBGA 1LJYA 4NSBA 3DDGA 3IAPA 2GDUA 3VIFA 4KGJA 2V38A 1VJSA 4MADA 3WEMA 1CXLA 1V3IA 3EMQA 2EPKX 1J01A 4U3AA 4IPLA 1W91A 3SEPA 1EHAA 3VGBA 1CPUA 4KH2A 3VIGA 1TG7A 2JFEX 5I3DA 3ARSA 1O7AA 1TQTA 5A2BA 3W6LA 1PEZA 1SYTA 2F7QA 5HPOA 4BA0A 1KR0A 2PC8A 4DM2A 2BHYA 2G41A 2EAEA 3AOFA 1W3KA 2O9PA 4UR9A 1U2YA 4X0VA 2EJ1A 3DX0A 5DEZA 5AC5A 1CGYA 5M03A 4YPJA 1WZKA 1PPIA 3WH9A 5D8ZA 5LA0A 2YL9A 2D2OA 5C8BB 2J25A 5CGTA 2J7FA 3AHTA 1QHOA 3CUFA 2WBKA 3AS2A 2QLYA 5ABFA 1C7TA 5BWFA 2EBNA 1SMAA 3WQ4A 1UR0A 3SCVA 1RD6A 1E43A 3O6AA 4W87A 4AD2A 1GJUA 4UOJA 1FP9A 4U31A 1OGGA 1TA3B 2OW7A 3NDZA 2VVSA 4BQ4A 2BV9A 9CGTA 3MMUA 2XG9A 3F5JA 4WK9A 3APGA 3RM9A 4D6CA 1EH9A 2WHMA 3CZEA 5M3WA 2VQTA 3I3DA 1E6XM 2XSBA 3ECQA 4V2XA 5HBFA 5A6JA 2QMJA 2DSKA 3PZOA 3AS0A 1C8XA 1OD0A 4U2ZA 4Z2HA 5JUVA 1JYVA 4JIEA 1VRXA 1ZBCA 2WC7A 1DEDA 4URIA 3KL5A 3EDKA 2OYKA 4JFWA 3OA5A 3SUSA 1R46A 2JIEA 2XUCA 3BH4A 3AZRA 4S3JA 3VIKA 1XYZA 3VGGA 2YA2A 1GQJA 1KGUA 3WENA 2XN2A 2JE8A 4NF7A 3WD2A 3A24A 1HXKA 2FHFA 4GXPA 1HJWA 5I79A 3DECA 3DHPA 1UR2A 1UA7A 4P7LA 2IXVA 3DDFA 3CGTA 3RILA 1E5NA 1CXKA 3RDKA 2G3IA 5A3HA 2J8GA 3RPMA 1OCQA 4PMQA 1KQYA 4HTYA 3N13A 1E6RA 2RGMA 3LMYA 3AJ7A 1VIWA 1GORA 2IUZA 4F79A 2ZUWA 3CZNA 3PZGA 1KCKA 3S2CA 8CGTA 2VRJA 3SIMA 3SUWA 3WD4A 3OLDA 2ZX7A 2FE0A 3EMZA 2CXGA 5A6BD 1GVIA 1HJUA 3E1F1 3A22A 4RE3A 3WUFA 1PIFA 2DSWA 2XYLA 4B9YA 2WLYA 5KZ6A 3K4DA 3GXPA 3ZO9A 5I24A 4BS0A 4BQ3A 3UG3A 2C8NA 4DO5A 5ABEA 2VMFA 1GOKA 3CC1A 4FF5A 5DF0A 4HMDA 4UQCA 4CN6A 2XFYA 3WQ6A 3OZPA 2GJPA 2DT0A 4BQ2A 5TD4A 3PBGA 3ARRA 5EFFA 1US2A 4H2CA 1E72M 1H49A 4P7QA 4ACZB 1DWHM 1JDDA 2F7PA 1UKPA 1CGXA 1UR9A 3UCQA 1TZ7A 4CN4A 3G6MA 3WUEA 1IZKA 4CD6A 3ARZA 1HKMA 2J8FA 4UQDA 3U7BA 2J7DA 2WHKA 2MANA 3VD7A 5GPRA 3CBWA 1BQCA 1AQ0A 2AMGA 3TTQA 2DT3A 4W8AA 1RH9A 3WNKA 1HL9A 2YBTA 4QLLA 2E40A 4W7WA 1E5JA 4AYSA 3WSUA 3GNPA 2GUYA 1LL6A 1VF8A 5M17A 3WH7A 5C70A 2WSKA 3VM7A 5FCZA 3WL0A 2FHBA 4B15A 1TR1A 1LG1A 2V3FA 3W29A 3HG4A 4DM1A 5D4YA 4P8VA 5A6SA 1MW3A 3IANA 2RGLA 3ZJ6A 2VTFA 2O9OA 1R7AA 1R87A 2JIWA 4BCEA 1VENA 4N0RA 1E6ZA 2F7RA 4FNQA 2QMKA 4ZXOA 3WF1A 4AISA 5BROA 3BAJA 1L8NA 1KXTA 2OSXA 2HVMA 1OGSA 4ACZA 1EOKA 3VGFA 2DEPA 4JAWA 4WLCA 5CLWA 4QDMA 2BXZA 4HU8A 4PMRA 4JHZA 3VX0A 3B9DA 3RIKA 4S3KA 3RJYA 2UY5A 3BSGA 3K4AA 4CCDA 2GJXB 3GZAA 3WDRA 4UOZA 2Y8KA 3NIYA 1UD2A 4H8UA 3PTQA 2CERA 5CZKA 3L2LA 3L4WA 5CXPA 3ZJ8A 3T0AA 4FNUA 4Z2IA 4JFTA 3UEQA 1GOQA 3PZIA 1XD0A 3L2MA 3OIHA 1DWFM 2CBUA 6A3HA 2BS9A 3WY3A 2W4XA 4Z2GA 2DSZA 4TVDA 1GHSA 4MB4A 2VZUA 3HJEA 2VCAA 4GKLA 3POHA 1PZ3A 2QHAA 3WH5A 3WFLA 3B9EA 2BVDA 3ARTA 4F8XA 2VRKA 4FLQA 2DT2A 4AIEA 4Z2JA 3VD9A 2X2JA 1AQMA 4GINA 3AZSA 5HNNA 2V3GA 3KE0A 3OBAA 2BFGA 1QI2A 5A69A 3RJXA 4BZYA 5CLTA 3DC0A 3OLGA 1TE1A 1ISWA 4W86A 1WKYA 2UY4A 2DPEA 3BMWA 3VIOA 4GI6A 3LX9A 5A6KA 3D52A 3MS8A 2VI0A 5LA1A 2FYVA 4X9YA 4LYPA 4MNLA 1AQHA 3DX1A 1K6AA 1CGUA 3J7HA 4PMUA 1WZMA 3NYDA 1UH4A 1K9EA 3QGVA 2BNJA 4MB5A 1T0OA 4JCLA 4J3SA 4LYRA 2WM0A 1CNVA 2J7EA 1UH2A 3AICA 1C7SA 1V3JA 3WEZA 1WZAA 3WY2A 2ZUNA 2YL6A 3GXIA 2J77A 3DYMA 3MANA 3CLWA 3W25A 4GIAA 1V0MA 1CGVA 1KCLA 5FIPA 1E40A 2PWHA 1G0CA 1J11A 1QHZA 2OWXA 1VFUA 3NUKA 3S6TA 4W5UA 1R7OA 2XGIA 1NOUA 2PBGA 3AIVA 3UR7A 3WD3A 5CSUA 5JIPA 4DWSD 5A95A 1W9UA 1X6LA 3BSHA 1WZLA 2WVSA 3ARPA 4MAZA 3FAWA 3K8KA 1E6SM 3K8MA 5E09A 4PUEA 4UFLA 1GOMA 4WIWA 3U57A 3M7SA 3WF3A 1WCGA 2V5CA 4FK9A 3OGSA 1R86A 5HXMA 1GZJA 1HF6A 1XH0A 2Q8XA 1VFOA 3MI6A 6CGTA 3BLKA 5BRQA 3GH5A 1EO7A 2WC4A 1NM9A 3WQ5A 2OSWA 4CKQA 3VGHA 5BRPA 1ISXA 4HA1A 1OIMA 1V0NA 1BLIA 2WPGA 3L4XA 1QBBA 1BSIA 3EJQA 1JAEA 2YKKA 2WANA 1JF6A 1SR0A 4W8BA 1VFFA 3ALGA 1J0YA 4A3YA 1KQZA 3VX1A 1PS3A 1J0IA 1VEOA 3N9KA 2J78A 1FHDA 4NXKA 4W84A 2F61A 1QBAA 1QNOA 1CIUA 2ZWYA 2FHCA 4HA4A 1BHGA 5A8OA 3AIWA 2VNCA 4HZ6A 3CZSA 1Q6FA 3AQUA 4KWUA 4F66A 2ZUTA 1CENA 3MKKA 4AC1X 3AS1A 1E6QM 1BF2A 2Z1KA 2CIPA 2E4TA 3MMDA 3NSXA 1CWYA 1MFVA 1BGAA 2WXDM 5HPCA 1QOXA 1OB0A 4AD4A 2PWEA 1ITCA 1DP0A 1BYBA 3PHAA 3L4ZA 3AXXA 3AROA 1P6WA 4PBGA 3TP4A 3BVXA 4AEFA 4WKFA 3GXFA 3MO4A 2YLAA 1Q6EA 4TTGA 4B3KA 3DX4A 2WNWA 4PMYA 4PTWA 2VT0A 1DHKA 4IPNB 4AWEA 3VD3A 1MWOA 2CNCA 2CBIA 3M07A 1KBBA 4UQ9A 3BAIA 2XWDA 1US3A 4MTVA 1BYDA 4PMNA 3EJRA 2O9TA 3CHFA 1LLOA 2WVUA 3PZTA 1JNDA 4C7GA 4OIFA 1V6YA 1NWUA 1CEOA 1PX8A 3HZ3A 3OLEA 7A3HA 4OBRA 3VM5A 3BAKA 3VMPA 4AEEA 1MW1A 1NH6A 2W62A 1NWRA 3WMBA 4HOZA 3N15A 3W82A 1BPLB 1JYXA 1W9BM 3WN6A 2B31A 1NARA 1UZ1A 8A3HA 2EPMX 4GQRA 2F7OA 1B9ZA 2DSVA 1H41A 1KXHA 2W61A 1MXDA 1EDTA 4AD3A 2YJQA 3KEHA 4OOZA 3VNZA 2VX7A 5EFDA 2WHLA 2QV4A 4AMXA 4L4PA 1E4MM 4C7DA 2PB1A 1V08A 1HWWA 3IGUA 1O7DC 1V6WA 2TAAA 3WD0A 1TQVA 5E6YA 1CXIA 1GCYA 2A3BA 3VUPA 3AMGA 3HG3A 3EJUA 4AD0A 4HPHA 4DO4A 1ISZA 3WNPA 4LGXA 3H54A 1DWGM 5AYIA 4H41A 1V3MA 1Q6GA 2WLZA 3SURA 1V6UA 1H2JA 1B3ZA 4TOQA 2OSYA 3T2OA 2XFRA 2C7FA 3ZT5A 3VOCA 3CZGA 4P8UA 1W1TA 3WL1A 4MPKA 1H1NA 1ISYA 2PBOA 4UTFA 5A94A 4J3TA 4WSKA 1OT1A 5E9AA 3D3AA 2ZUMA 3BCFA 2W92A 3T2QA 5I78A 4NRRA 1UOKA 1R75A 4P7OA 1V3LA 2ZUSA 4TTUA 1JZ6A 4CD5A 2WMGA 2EPOA 3EDEA 3LXCA 4U2YA 1E0WA 1GQIA 1B3YA 5D9MA 1QWNA 4UNIA 3I3BA 4Q22A 1JZ5A 5JBDA 2W91A 5I2UA 5EMYA 1JYNA 3MSGA 3WELA 1V02A 1J0ZA 4UZSA 1WDQA 4M1RA 3K46A 2VVNA 2EO7A 2WAGA 2ZX5A 1UKSA 1EIBA 2VZVA 3AMDA 4WJXA 3AMKA 4D6EA 1TVNA 3S5YA 1N82A 1QNQA 1XHGA 3T2PA 2X09A 5A1AA 3LXAA 3WDPP 3VD5A 1JL8A 4EANA 4XZWA 1LQ0A 4GZEA 3AI0A 4DUVA 5CGMA 4WKHA 3UETA 2VJXA 1H4PA 3IJ7A 1QW9A 1E6PA 3F5KA 2Y24A 1J12A 3H55A 2XJ7A 1EHNA 3II1A 1ZS2A 4MJ2A 1C92A 3WIJA 3FNDA 1JDAA 1V3HA 1CLVA 4HZ7A 2E9LA 3W28A 1PX4A 1B31A 2DSUA 2W67A 4PEEA 4LQ1A 3A3HA 5GNXA 1B3WA 4D72A 1JD9A 1W1VA 4PCSA 4CGTA 1H09A 1E0VA 5CQ1A 3WDQA 3WNMA 2WVVB 4EKJA 1MW0A 2F1AA 5D9NA 1G9HA 4QCEA 4W7UA 3VGDA 2WYSA 3CZ8A 1UASA 4NZFA 1UZ4A 2VR5A 3VSTA 5GNYA 3IAQA 4M8UA 1Q6CA 3GNOA 4BF7A 3GXMA 4W7VA 4J3WA 3TONA 3QHMA 1ODUA 4PTMA 2IGTA 4HPGA 3ARQA 2Y5EA 2D0FA 2EPLX 2JEPA 1TQUA 2WMJA 3FAXA 1JNEA 2WC3A 3W24A 1E3XA 3T08A 3WQWA 1MXGA 3SCSA 4B16A 2CITA 2VR4A 1B2YA 5GNZA 1HTYA 4M82A 1OD8A 2VC9A 3CTTA 2ALWA 1H0GA 3T0BA 2YFOA 3OG2A 1E6NA 4V27A 5ABHA 4W8LA 1E56A 3RM4A 3WD1A 1B0IA 3QR3A 3OLIA 4H7VA 3D5HA 2OYLA 1BYAA 1XD1A 3AIRA 3KL3A 2QF8A 4J3VA 4FLSA 2EQDA 4ATWA 1FA2A 5HOSA 3IJ8A 1KWKA 1W2VA 4DWSA 2WK2A 3BUQA 3PN8A 4CU8A 4H8VA 2YL8A 4JCMA 3FHQA 2WVVA 3KLLA 3BLPX 3CZKA 4E8DA 4H8HA 2X2YA 2D0HA 3WQ8A 1ESWA 1ZBVA 1HX0A 4AMCA 4QAWA 4UFIA 3GXDA 3VDHA 3H53A 3WQVA 4MB1A 4Q7NA 2D20A 2HISA 3VIPA 3VIMA 4FLOA 1CTNA 4MNKA 2ESCA 2VUYA 1UR8A 3THCA 4JZ5A 3T09A 1GQLA 2A3EA 1WO2A 4W5ZA 3NDYA 3GYCA 3CUHA 1B90A 4AZHA 4OBSA 2AAAA 1UA3A 3W38A 2WWDA 2J7CA 3AMLA 2UY2A 1Q4NX 1SMDA 1M7XA 4FMVA 2A3CA 1HKJA 1CXHA 5A2CA 2VX4A 3VDCA 1PJ9A 3TTYA 2FDMA 3WDHA 2GJRA 2F2HA 4ACYA 4EAMA 3PZ9A 3JUGA 2XN1A 3L4YA 4YHEA 4UQAA 1E71M 3ARVA 3VGEA 2Z1SA 4MNMA 2OWWA 4AIUA 4TX8A 2E3ZA 3BUPA 1TQWA 4PRWA 1PZ2A 1ODZA 1KTBA 3SCOA 1W3LA 1IT0A 4D1JA 4TXEA 4UZUA 5CSYA 1OBAA 4KGLA 4EE9A 1QNPA 1XH1A 4PMZA 1G01A 3PTMA 2G8ZA 1H3GA 3W0KA 2UY3A 3THDA 5ECUA 1F4HA 4W85A 1JAKA 1H5VA 1AMYA 1V02E 4M24A 4CVUA 3TV8A 3VIJA 1E4IA 1W1PA 1CDGA 3MMWA 1W32A 2WMKA 2YLLA 3LRKA 3W81A 1HIZA 4GI9A 5A6MA 4NZCA 1ZB5A 5C71A 3A21A 2E8ZA 3AS3A 4QCFA 3M6DA 1D2KA 2VX5A 2XM1A 2BVYA 3RM8A 1KBKA 1EDGA 2PWDA 1X1NA 4PUDA 1G5AA 4QLJA 1R33A 1UHVA 1EO5A 1QI4A 1JZ3A 5IFPA 1KB3A 3W27A 1MYRA 4M81A 1V3KA 3AHYA 1XYFA 2V5DA 4XUYA 3W53A 3L4VA 4GI8A 2J7BA 4OOUA 4ZENA 2G4FA 1EGZA 3EDJA 1VJZA 4HU0A 3L4TA 3GM8A 1KXQA 1C93A 4JHOA 3PZUA 5AYBA 1MQPA 3AZTA 3FHAA 2G3JA 5AC4A 4NI3A 3CIVA 3DX2A 1UR4A 3TOPA 2OLHA 4P8WA 5E70A 1KXVA 1DWIM 4PMDA 3WF4A 3VDAA 1UKOA 2X2IA 2D24A 4FLRA 3ARWA 1HVXA 2XWEA 4AD5A 3KWXA 4HMEA 1JDCA 2D3LA 1E15A 4XX6A 1G1YA 1UKTA 3U5UA 1CXEA 2Y4SA 2DGAA 2VZOA 5CPTA 1QI0A 3UG5A 4PMVA 2CBJA 3ARUA 1JFHA 1XV8A 4AXNA 1WB0A 3PZQA 4HA3A 1UR1A 1UG6A 1J0HA 5IFTA 1XH2A 1R8LA 3GBDA 4TUFA 3WUGA 4LX4A 1TCMA 2CYGA 1GOOA 1NQ6A 5BXPA 1DTUA 3CUIA 4CUCA 4Z2LA 3OGRA 3LPFA 1UQZA 2DH3A 5D9PA 3KLKA 1XC6A 4UOQA 2VL4A 3ZT6A 1B30A 1M01A 3RMEA 1EXPA 2WKLA 1SZNA 1I75A 1L0PA 1TMQA 3WY4A 3SCQA 4P8XA 1VBUA 4P7RA 3EDFA 3PTKA 4E2OA 2YBUA 4AZCB 1NOWA 1OM0A 3ARYA 1NWSA 2WVTA 3WNOA 4PYSA 2PWGA 4U5KA 2W63A 3N1AA 2X0HA 2J4GA 1HKIA 1OWQA 4PTXA 3CZLA 4MDOA 5DMYA 2EACA 1JGIA 5CPQA 5HDRA 2WHJA 1DWJM 1W3JA 3MU7A 1UD3A 2BY3A 2CETA 3WDIA 2WMIA 2WZIA 1V6VA 2GK1B 2EABA 1W3HA 2Y2WA 2WSPA 3OZOA 4D6DA 3PZVA 1LWHA 4TX6A 2DIJA 3BVWA 2JF6A 1WPCA 3VMNA 2XFFA 3KZSA 4X0NA 5A6BA 4GZIA 1ZU8A 3CHEA 1J0JA 2J7HA 2PWFA 1A47A 1WDSA 1HNYA 1MW2A 2GDVA 3POCA 4AYGA 3WEOA 1GNXA 4UFHA 1W1YA 2E9BA 4KRTA 3DHUA 4D71A 3N17A 1WDRA 2X2HA 1KFWA 2VZSA 4C7FA 1NP2A 2J79A 1W9XA 1J0KA 2OYMA 5F7UA 3B8SA 4U3CA 4AZCA 4NZJA 4DUWA 1ZJAA 1BYCA 2CHNA 2UWFA 5JBEA 1QNRA 1FH9A 4EK7A 4AMWA 5E1QA 2YA0A 4MJ4A 3EJSA 1UD4A 3AYRA 3PZNA 1JD7A 3VVGA 1NWTA 1A3HA 2W5FA 2CKRA 1UWIA 3LPGA 4CD7A 3IK2A 1V0LA 2IXUA 1EQCA 3A6OA 1MFUA 5A6LA 2GK1A 3AHVA 1QX1A 4NX0A 1ISVA 4AD1A 3EJPA 5I0DA 1QHPA 1XCWA 3QOMA 1JXKA 3VILA 3WNNA 2VO5A 2YA1A 2ZE0A 5LA2A 3ZM8A 1LWJA 1HVQA 1R85A 5E0CA 4PCTA 3A47A 4PN2A 1BFNA 2XVNA 4P7NA 2CEQA 5D9OA 4CU6A 1HT6A 1WDPA 3OGVA 1TVPA 4OKDA 1UUQA 2NSXA 1HXJA 1RP9A 1GVYA 1BG9A 3AYSA 1IV8A 4JL1A 4GO9A 1Z32X 3AMCA 4A3HA 1GQKA 2OWCA 2E9MA 1HJSA 5BXTA 1E70M 4DO6A 2BHZA 3ARXA 3VIIA 1W9DM 3VIHA 4ATLA 4D6IA 4OGZA 1M53A 4RL3A
chains in the Genus database with same CATH superfamily
4GY1A 4K0OA 1PWLA 2CIIA 2ZONA 1WHPA 1ONRA 4MWAA 1Z9SB 4RW5A 2ZZ4A 1KGCD 4B9JA 1BJ8A 4PJXA 2VDOB 2CSPA 4ZQCA 2NUTA 1KACB 3FQUA 5KEZA 4ENED 4MLIA 1KJ3L 2Z6FA 1IAKA 2VM4A 2EC9U 3D87B 3IGKA 3TZFA 3QDMB 2DQIH 5CJ5A 2FJUB 1XSOA 4FZIA 1XGUA 4ZTOH 2XIQA 1MI3A 2QEZA 1A4KA 1LG2A 3VFUB 1QK0A 2AZAA 5LIWX 1RUQL 1BJMA 1AO7E 3UR8A 1TCDA 3VQ1C 4URTB 2JIXD 4QRPD 3BH9B 4X42A 5AVSB 3QDGE 3MCOA 3L3JB 4L65A 3P3SA 1JXDA 3V1PA 4CNSA 2NZ9C 3FDGA 4HAFA 3MJ6A 1TQBB 2J66A 3QCUH 2JEQA 1R5WB 3IIZA 1XGRA 2XSAA 4C56B 1SFSA 4K3JH 1KJMA 1DQMH 3OKDB 4Q6KA 2D2HA 5FYJD 1GVQA 3QK0A 1QRNB 3CE1A 1UWUA 4MMWA 4PY8J 4LDEB 1WFMA 4DETA 2G9KA 3UBFA 2O61A 3GBLA 4M5SA 2FBJL 3L9RA 1YNLH 2X4NB 5LCVL 4H4IA 4JM2D 4BSJA 5L2KD 5HWMA 2DBLL 3LKPA 2VZ1A 2NUXA 4IUGA 4HK0A 2VIRA 4L3AA 3PL6A 2J12B 3GBMH 3V52L 4TVPH 1XLAA 1PLGL 3SBWA 1DVFC 4F2FA 3VG9C 4ADSA 1HWGB 5DURD 3W37A 3GXTA 1DFXA 3H4FA 4GUIA 4Y1AA 3MYOA 2P42B 3FQRA 4YAQB 3MLSH 2X4QB 2PW2A 5GZOD 5KSAB 3B9AA 2AK4D 3PABB 3CDYA 4M62H 8FABA 4FCHA 1IGTB 3B5GA 5K9QI 4OLWH 3CIXA 1FYHB 5CBJA 5T1LD 2FSEA 2ISFA 1RJPA 3TEXA 3NO3A 3BZFA 4NJHA 5BQ7B 3MGTB 5IQ9B 4F24A 4Q8QA 7PTDA 2F54D 3P77A 4XZBA 5LGJA 4TVPD 1F3WA 2K8MA 1IEBB 2HUHA 4ZT1A 3VB8A 1NOAA 5HHME 1E51A 3O11A 2X89A 5F96L 4LYQA 1EIXA 1KEML 3NPWA 1J48A 2XGBA 2ZVIA 4PLJD 1CB4A 1T83C 4NRZB 2POTA 4C6CA 1QVOA 1DVUA 3CZUB 7PAZA 4BZ2A 4JHAH 3ROLB 4AXWB 3FQXB 2DYSB 2K3HA 1M7DA 4FXKC 3S8HA 2CH8A 4LFHD 5C86A 4M1DH 3VXOB 4NEHB 1XRSA 3HPSA 2APSA 1FAIH 2DWDB 4J39A 1M03A 1WA3A 4WDTA 4WWKA 1EFZA 1GONA 2XQBL 4GY7A 5LYRA 2XN0A 2ZNXA 4D9RD 1NKRA 4RH4A 4YX2H 1NLDL 5T1DL 1IAIM 3CSBA 1FCCA 3WO3B 1G7VA 3QQWA 4E5XA 3VXUA 1ZCRA 3QWRD 2VWTA 2YB4A 1DCEA 5CFAA 2XVKA 5D2LB 3UERA 4YDKH 1O7SA 4BQ5A 3WKNA 3H7BA 4HOXA 1P0SE 2WJ5A 3A6CL 4I7UA 4NKIH 1QNSA 3KVDD 4GBXB 1UOLA 5ES4B 3ZE1E 5FUCC 3UESA 1GZQB 3FTGB 5IKCB 1R19A 4F7TA 5A8QA 1UZ6F 2NV1A 4S2BA 4IOIA 3EKZA 3N40F 3X1EA 2D22A 4HPYH 2IFFL 1HGWA 3MJ7B 3DURA 2HTKD 3OJDA 3FMGL 1OF2B 4EF8A 4JM0A 3HMCA 4M56A 2DN7A 3M46A 1PG7X 3MUIA 2XNAA 3OHIA 2P52A 4ZUTA 3E6EA 3XISA 3QSKB 1QJWA 1G7IB 3HS0C 3CZJA 5D03A 4UYQA 4HUKB 3RCNA 3DPBB 4OJYA 4PJAE 4M1CD 4UWQB 4BZ2H 5EEYA 3GNRA 4EUPH 3RITA 5B4MD 3AFBA 5ICXA 2NW2A 1FJ1A 2A9MH 3D4ZA 2B2XH 2X7WA 5C0GA 5A40E 3OKEA 3SJNA 3U3HA 1WP6A 1S3HA 3ES7A 4UR8A 4OIIL 2D3NA 1DR9A 3T3PB 3ES6B 3HE6D 2VISB 1QO2A 4W9DC 4KKAC 1UCBL 4Q6IA 1G43A 2YDSA 5GRWA 1SUJA 1ZANL 4C90A 5I76B 1LP9E 3BXNB 4MVAA 3QDAA 3ARGA 4P2AA 1M9WA 4U3AA 3G8RA 4AGMA 3VIGA 2VXTL 1EBPA 5IVNA 1RJLB 3VI4B 4YTRA 2BHYA 3MJWA 4ZFZB 5DEZA 3FYEB 5KVFE 4D8AA 3U6XS 2P7TA 1K7FA 3TNMA 4HFUH 5FGBA 4R7JA 2F08A 3MJ8B 1OTTD 4XAPA 1KC5H 3RWJA 4F27A 3WEBA 5B38G 4EZJA 3WJMB 2Q09A 4Q4PA 2HE8A 3FTWA 4NWTH 1E4XH 4NQEA 1TA3B 2F7FA 2DMCA 1KGCE 4HJEA 4ZUVA 6PAZA 1MIML 2XPGA 2AABL 2HS8A 4PUWA 1TJMA 2E7BA 1G4RA 2ATKB 4A7GA 4NBXB 4CLMA 4DJFC 3QS2A 4XCFH 4C6IA 2HVKA 1CLOL 4MDIA 3M86A 3SUSA 3AZRA 2RHGA 2YA2A 3RWHB 3LEYH 3PBVA 4Y19A 3OMIB 4BFIB 3EBIA 3QEHB 3ZYOA 4DKFH 2WJZA 3DTDA 4GMTH 4OLYL 1Z9MA 5DRZB 5A3HA 1KJ2L 3O0RL 2EDDA 1B4TA 4S2SA 3X12A 4HTYA 3MLZH 3KRUA 3V75A 4QRPE 1MDTA 5F7BA 3PZGA 4UV7H 4LCYA 1QFWH 2A6IB 5DHXB 1N8ZB 4J12A 3S5SA 3TO2A 3WUWG 1JNJA 2FD6L 1SPQA 5EDXA 4F58L 3ZO9A 1PZ0A 4QM1A 3IE9A 3IXAB 3UXIA 2CDEA 5DUJA 2C1GA 2CZNA 4F33A 1ZHNB 4IRZH 2UVEA 5D7SL 3OAUL 4CBPA 3PBGA 3ANVA 4P7QA 1UR9A 4QRQA 3BHBB 3X13A 2DQCL 3CSTA 1QG3A 3GAYA 2A3TA 4JZOA 3VD7A 5L2KE 1AQ0A 2R4RH 1HJBC 1YSOA 2A6JB 4I2XB 4RGMB 2IPWA 1LL6A 1CD8A 4NSKB 3OMNB 2A7NA 5KYXB 4GFSA 4JFQA 2QKIA 4H1ZA 2XTSA 3EH3B 2IFGA 4Y4FA 3WKPA 3MFFA 2Z6IA 1XB6A 4O17A 4PGJA 2IKGA 5AW4B 2DLEA 1EOKA 3VGFA 2DEPA 1S5NA 2BXZA 3MKVA 4YR6B 3KR3H 4OV5A 2ZD0A 3RIKA 4S3KA 3T1GA 3WDRA 3KOWA 1J05A 2A77H 3ZL4H 1RJQA 2C9AA 2VLJA 3KYOA 2Y7MA 1FWSA 1XIWA 3MRBB 4LCIH 3IFNH 3I6RA 2WINB 2N3JA 3WG6A 4YYFA 4TQPA 2LW3A 4TVDA 2FJSA 3DLQR 6ENLA 3IGFA 4RAUA 3DUUA 3BP5B 3QYCA 3DX6B 4IBWA 2VFHA 5C9ZA 3TFKC 5H4ZA 3OF6D 3TN0A 1RZPA 2WP3T 3D52A 1NBVH 3REWB 4PRID 5I1KH 3I75B 3SJVA 3U83A 1OX4B 3CDZB 1ZLWK 2YBGA 2YQGA 1OANA 5HHPB 5I19H 2VABA 2P1YA 3GXIA 4ETQA 2XXMB 3MNVB 4YTUA 5TH2B 2DV6A 4DY1A 4D9RE 4X6DF 4ODSH 2J8TA 4PRDB 3OOQA 5I1LB 3TBVA 4MBRA 5DJ0A 1BVKB 1TFHA 4UQ3B 2IQAA 4XCYB 5L4MA 4DWSD 3ZTNL 2YPLB 1BZ8A 3AO0A 5HYEA 3MHUA 1WXZA 3LRHA 4JG0L 1XUZA 1PHQA 3RCMA 3G9VA 3KPLA 1XZWA 4HUUA 2Y3NA 2ZRUA 4MYXA 2V5KA 4HPOH 4ZUUB 2IWGA 2ENQA 3FU7B 3CQHA 2ZTKA 4NZ3A 4ZMXA 4L05A 4CKQA 3VFSB 1V0NA 4UT9A 3L4XA 1BSIA 3EJQA 5SWUA 2QQ6A 1YRRA 2CLKA 3S97C 5IHWA 3SYOA 2IQ0A 5F2FA 5L0QC 3MYJA 2V2TA 1NC4A 4OZGF 2XWBB 3RUGE 2AEPL 4QF1B 1QTPA 1CWYA 1IT9L 4R84A 3MY9A 1QD0A 4UTBA 3GZQA 4PJIB 1E28A 2ZXCA 1Q6EA 3FUNA 3VUAA 5T5NF 1Z6KA 1DHKA 3CLEL 3M07A 3PJSB 4I85A 5CEWA 1X5JA 1YDPA 5IHUL 3DJZA 3QZWG 3W00A 3GNNA 3R11A 4QPEA 4OIFA 5HGAB 4KQ3L 3KCWA 2CU0A 5JO5B 3VM5A 1YNTA 4ONHA 1GG0A 4N2GA 3GK0A 1W0WB 3N4FA 4ORIA 3C6LC 2DY3A 1H41A 3ELQA 4K38A 3SPCA 1OHZA 2WHLA 4JNMA 4XMVA 3ZO0A 1Q0XL 4BZ1H 3FPYA 4BEQA 3TZVC 4TLKA 4LOCA 3T6XA 3TYZA 1TJXA 3RE0A 4F7PB 3TO4A 2VLRD 2APBA 2KZWA 4AENB 1FN4A 5AVQB 3B37A 2YMXH 3LEVH 3Q6FB 2RKXA 1GW9A 3CZGA 5HYJB 1H1NA 3D3AA 2Z34A 3BCFA 3RVXC 2H3BA 2Q3OA 4QHLB 1TEFA 4Q97A 1U8QB 2PDJA 4DIAA 4UTUA 1B3YA 4UB9A 4GNKB 4FZ8L 4AYMC 4I9XA 5KS9E 2XX0A 4LV9A 2NDFA 1GYLA 3FL7A 2VZVA 3Q1EA 4WJXA 4D6EA 1J9SA 3VSQA 1VPOL 2VQ1A 4UTBH 1XW8A 3AI0A 3E0FA 3VAEA 1MWAA 3V16A 3BJTA 2Y63A 2NW3B 4WV1B 2FZNA 4QJ3B 2O5XL 4N2MA 2IALA 4NNBA 3M45A 4FJYA 3F65A 1WAAF 4WFHD 2P3EA 1P84K 3THAA 4MUZA 5IM51 3N2OA 1OAXL 1SYSB 2FPYA 3CZ8A 4UCGA 4L4TA 1Q6CA 1I9JH 5MI0B 3UJJL 1LO3H 2J2ZA 1YEWA 3VTAA 5DS8A 2VR3A 3FAXA 3T4AA 3W24A 5AZEH 1MXGA 4R5XA 4Y5VA 2K0RA 5D7EA 3SFKA 3VAVA 3QJUB 3WG7B 4R8WL 4DTGH 4LL4A 2MSPA 2W1NA 4H7VA 4ZTPL 2PXYC 1H0DA 3PYCA 1L9SA 3KL3A 5LGYA 2A73A 2EDTA 3WXWH 2ZP8A 3KM8A 2HX7A 5GZND 4UM9A 1AGCA 3FVMA 3FHQA 5KZCD 3VXMA 3UC0L 1JEZA 3W7JA 4AWSA 4H8HA 3ARFB 1QTSA 1P1ZB 1OG6A 5T3ZD 2NNAB 2MTPA 3HC4H 2IH1B 5HI4C 3UVIA 3HC0B 4P5UA 4MNKA 4XVTH 1YN6A 1ADWA 4G8GB 4U1LB 3AMLA 3HQOA 1AD1A 2XYCA 4FMVA 3B4UA 2GJ6B 4GB9A 2P5EB 4G70B 2F2HA 3DEQA 2VDHA 1E71M 3SO5A 3TBYA 3RNQA 2B4CL 1KTBA 2Y5TA 4UNKA 4DJDA 1QNIA 2R39A 3PTMA 2UY3A 3Q8CA 2HXUA 3WJLC 1SOXA 3DG7A 5IFAL 1G7PB 3F2LA 4QNPE 4NZCA 5C71A 4LAQH 4ZSOA 4P3WA 3DARA 3BDXA 1HXMA 2YSSB 3GJEA 4TV3A 2F19H 4R7WA 2A4AA 4YXKL 3PWVB 2CJUH 3UZWA 4G8EA 1JWUB 4XO5A 3SSZA 4YHZH 4ZENA 4UTWC 1HCYA 3L4TA 5D1QA 5D1ZA 1KFCA 1L0YA 2A4ZA 3TCTA 4Z7NE 1IIHA 5LO7A 4NI3A 4CSZA 1CTOA 1CB2A 1FRGH 3QH2A 3A3XA 2D9CA 2XLLA 5DJZB 4PRIE 4GRWH 5C54A 5BS0D 4QX4A 2D3LA 3DXAD 1OLZA 1CXEA 2Y4SA 4K07A 2WWMC 4YHYC 4JPIB 1CD9B 2NUPB 3I6KA 1RK1A 4FXGB 3CH8A 3LZNA 2DM4A 1S1RA 3FFCB 3OBKA 4G3YH 4X9FA 3PHQB 1E27A 2UY6B 1U8IB 2NY2D 5D72H 2VAJA 2EIKB 5D9PA 5FEXA 1CBJA 3M7FB 3ZT6A 1S39A 5E6ID 3E3HA 4L61A 3E6HA 1HKWA 3PAYA 3BJSA 4OQTL 2PWGA 3V5FA 2XG4B 4IRSC 2Z64C 2OTWB 4N87A 4K7YA 3GNXA 4E2VA 4ML9A 5B21A 5HHXH 1OAQH 2DPKA 5EUOF 2PRMA 5BZAA 3WDIA 2BGNE 4ERAA 2YC1A 3RHGA 3GSWB 1XS2A 5BZWA 1U58B 3Q94A 1NDYA 2F5BH 3WHE0 1FFNA 3KZSA 4X0NA 2WKJA 4L8SA 1JULA 3A64A 4KO9A 5DEFA 1A0QH 2FNWA 5J3HC 3EWYA 3FSVA 4A35A 3BN3B 3CAFA 4Z7UF 1CFSB 3SE9L 4IFKA 3R4RA 4JLRB 2VZSA 4NQCA 1TTJA 2C15A 5HDOA 1PKQA 4PYGA 1RURH 3D0VA 1QNZH 3S5LA 1FH9A 1D5ZA 1SW3A 3IRCA 3VE7A 3O6DA 1CDYA 1H1YA 1XH3B 4IS6B 2CKRA 1V0LA 3R0DA 4P4KC 4LY8A 1GW6A 3TGXA 1YEDB 4TNWK 4AD1A 5I0DA 3N44B 3NAVA 2H3XC 3KDOA 4IHOA 3S4SG 2DKMA 1KXQE 2XG5A 2JVUA 1SOSA 5D2TA 3IVSA 3ABSA 1WDPA 4M1BA 3MCYA 4WI6A 1SO6A 4X4KA 4JS3A 4C5ZA 1M3IA 3T2NL 5E5MA 1DBJL 4XNMA 4DZBA 5EBMB 3T4WA 2GCYA 4G59C 3C6SA 4PJ7B 1G7UA 5HNTA 2VLRE 3WJXA 4OFPA 4RGNE 2FPTA 4L80A 5I1EH 1WOBA 1JN6B 1T1YB 5TQ2L 1ROWA 1ETZA 3IT8D 2J1YA 4YHML 1K02A 2CHOA 5IB2B 4GG8A 3NH7H 1IKFL 3V5KB 2WJ7A 2WNZA 1QBLH 3MLWL 3ZTCC 5ENWB 1XR8A 2N7BA 4CMHC 1P6CA 1OC6A 4LP4A 4PWIA 1MQQA 4QXGL 2DD8H 4EPEC 1RPKA 4GHRA 5FW6A 3SCUA 2F6XA 1PL3A 2GABA 5TTRA 2DM7A 4LVHC 2RCSL 3W7KA 1SDYA 2R0WH 3MSYA 3H2CA 3GRWH 2RDTA 3IUHA 3BEWA 5I17B 2VCBA 3G3DA 4GY4A 3PUGA 4OKVA 3PVFA 2XU9A 3CVDA 1FVCA 3T0DA 4WFHE 2PYEA 2MH4A 2ENJA 1KIUA 3O16A 1A7RH 5I2IB 4U3HA 5MEQB 1S5MA 3L65A 1DXEA 2R4SH 2P47B 3L7FB 4XZHA 1E0UA 1IC7L 1YRKA 1XYLA 1N2VA 4Z7WE 1W2PA 1FSKC 1RUSA 3WX7A 3QH3B 2XIBA 1OGBA 4IICA 3O6LH 4GAGL 3N6HA 4XXWA 1BG1A 4NLHA 4U1MB 5BRZB 2ERJC 35C8H 4AIZB 1NDMB 2K6ZA 2N1KA 1HL8A 4IIHA 2D2GA 3BVNA 4LHUG 4M80A 2C7UB 3N43F 3T0EC 3FA5A 3GZKA 5DHDA 3IRZA 3AG1B 4FQCL 4YLWA 3SGKA 2FO4B 1D2PA 2XIDA 1DVSA 2BOCA 3HFFA 3CMGA 4I9AA 2Y5SA 4R9HA 2P5WE 4G5DA 3S1GA 5A8MA 4FEIA 5I5JA 2DFAA 4EPBC 3WCZA 2EE9A 3TC6A 4L8BA 2YPVA 4FCAA 1NKOA 2OT1A 3RVTD 1PYMA 2O9RA 1F74A 5T3ZE 1XIDA 5KANG 2PTUA 4F5CA 1QATA 3PCYA 2CCLA 1XDMA 4HH9B 5CJ8A 1G94A 2FO8A 3OJMB 5JXAH 3W84A 4NASA 2BW5A 4PJ8C 1Q1JL 2FEJA 3IB4A 3NTYA 3O9WD 3VA8A 3P74A 1E4LA 3Q8FA 4DK6A 1E7VA 4XMUA 2UZYA 3IFLL 4OLUL 5CUSH 4GACA 5FKPA 5T5FH 2E5DA 4IGHA 5JPMA 2IDCA 4PYHA 1RK5A 4NO3B 1Y8BA 3NZRA 4HJSA 1S7VA 4KI5C 4QHPA 1KR1A 1E4NA 3EHBB 3QZ6A 1A6AA 1BZQK 4ZMWA 3ETSA 2AKRA 4GABA 4ONGL 1IGIH 2ZX8A 2WLKA 2OK0H 1ZMYA 4WXZA 1S5IH 4DZ8B 4C47A 4KJYB 1AKJA 3WHE1 4K7PX 4A2SA 2NXZC 5EUKB 4LC6A 3ULVE 2PUQT 4M43H 3WLBB 4FADA 1SW0A 4AZIA 3KL0A 1MQRA 4JPSA 2Y22A 2MNRA 3L3KA 3FEQA 4YXHL 4JRYA 3RAJL 1JPIA 4V33A 4NO2A 1MHEB 5GS0C 3RBGA 4A66A 4Z2KA 5IVXE 1BAGA 2GOKA 2E27H 1S7WA 4O28A 3NGFA 3DERA 2YXVA 4GW4A 2FQIA 3ZR6A 2WLLB 3NIFB 5HATA 5BS0E 3M6YA 4P04A 2P3ZA 5DS2A 5EU7C 1KLZA 4I9JA 1OAZH 4OIAA 4HKBB 5KSVB 3IBOA 3ASWA 4PHXA 4ISVA 3BGMB 2BSSB 2I17A 1JHKH 1ICTA 5CPSA 3L95A 3TYFB 2OX5B 4JN8A 3FFOA 5A5WA 2L3BA 4NENB 2HRPH 1O7VA 4LYKA 3TV3H 4W9LC 3FONA 3D09A 3RWFA 3BW9B 1LO0L 4LCUB 1GGTA 2DWSA 1MFBL 2Y36H 1AO7A 1KPVA 2VDPB 5GISH 1GYAA 3EGJA 3EFDH 1E4KC 4XP4H 1DV7A 3SR7A 3QFJE 4JKWA 4K2UL 4GAJL 1A6VL 5E0FA 1L3NA 3NESA 2WMFA 2IDUA 2XZZA 3LPOA 1KSRA 4DHGA 2QPUA 3VFOA 3VFNB 2WQSA 4H0IA 5K39A 1X4ZA 3AALA 4L29A 1T5WA 4AWJC 1TJ2A 1MZZA 2YCEA 2R2HB 1DBMH 1FHNA 4H6QA 2OMWB 3QNXA 3SZ8A 1MAMH 3HN3A 1T1XB 5HGBA 3KJ4B 5ECVA 1BQKA 3HO8A 4X3ZA 5JIMA 5C09E 5D8JH 4OM0L 1EEZB 5KITA 1AR1B 1ZVHA 3W3OA 2Q71A 1ND0A 2J1XA 4DPCX 4YMPA 3VU1A 1ICQA 3QIBB 1PAMA 2Q20A 3VFTB 3MQIA 1XIHA 2A3LA 3B4NA 4JTTA 4EOWH 3VIFA 3WD5H 3DESA 4ZMTA 3EMQA 5GRUH 4DGIH 3GM0A 2YXOA 5ELIA 1X9QA 1NWPA 4KH2A 2ICEA 4Z3JA 3HZVA 3D1MC 9XIAA 1U2YA 2FNBA 4QT5B 1NBCA 5M03A 2TODA 4XVUC 4BD4A 4Q8PA 4MNGA 1KM6A 1YBQA 3IDXH 4KZ0A 4Z7VE 2JKEA 3KNBB 2NY5H 2ZQKA 2XSXA 4JO5A 3P81A 5AKTA 5T3XE 5KVEL 3CD4A 3LKOB 3SCVA 4ORGA 3EX6A 3UMTA 4EXPX 2VDQB 3EOBA 3UWQA 2PLCA 4U31A 2NQ5A 3S5NA 1RQBA 2Z7ZA 4FYSA 2F58H 1EH9A 5I1IL 1RJRA 1N59B 3I3DA 4OD2A 4A21A 5EIVA 4W9CC 2CO1A 3TS8A 2EXWD 5DCCA 4U2ZA 1VFHA 4BE5A 4A29A 4AF0A 3PUDA 1VESA 4K7PY 4OUUA 3FOLA 3EDKA 4Z0BH 1FORL 3A3YB 1TZHA 2B16A 5INDB 5BMFL 3D0LB 4KMTH 1DL7L 3EYVB 2VLMD 4LUJA 4L18A 1FDLH 2NTFA 2WXGA 5DQ9B 4KDTA 4YZWA 4A38A 5ILTH 3X2QB 1AZVA 4JPGA 3SKNB 5D1XB 2HE5A 2J8GA 3QDGD 2QGCA 1S3TC 3V0AC 4YVNA 2GBAA 3D3VB 3DSFH 3CZNA 4N2CA 3V18A 5J13B 5JZ7D 1ZVNA 25C8H 3M41A 5EC1A 1FGNL 3NFSL 3EXLA 3O41B 3A22A 4RE3A 3N5AA 3G5XB 1XGYH 2KLRA 1BLNB 3CG8A 5DRXB 1RIHH 5IGXH 2Q86A 1IEWA 5FS5A 1P4BH 1YDVA 3MKGA 5JHLH 1JPMA 5CZSA 4AEHL 2R0ZL 1AGEB 1Q9KB 2XWJA 1AW2A 3F62A 4K37A 4FR1A 1HKMA 1UP3A 3U7BA 2XVBA 2BIHA 3MV9B 3RYSA 2LLGA 3MV7A 5BV7C 2VLLB 3RF9A 1ZTMA 3EO0A 1U42A 3PGDA 4Z7AA 4G1KA 4PJCF 3WNKA 4QLLA 1T2XA 4IIEA 4FABH 3F5WA 3VM7A 1U5JA 4B15A 3TYDA 1JPFA 4I0KA 1DE4B 4UDUA 4DM1A 4FR6A 1YMMB 3CVIH 2O9OA 4M3JA 1QPNA 4LLVB 1T2QL 3L5XL 1B5TA 4HCLA 1XCQA 4UM8B 2GPTA 3VXSB 5XINA 3AXMA 4R3SB 1S2TA 4G7SB 2BRRL 5DUBA 4P2QD 2NY4C 2GK2A 4IMGA 1K6WA 3BPNC 3P1VA 2JTYA 4Y5XA 2IAND 1R3QA 2W27A 4Z2IA 2EGZA 3BP7A 3N42F 3PZIA 3AITA 4W6YB 3QFGA 2WP3O 1DWFM 5HHMD 2CBUA 2GC4C 2WQPA 1VA9A 5AVWB 5EN2A 2DWEB 5F89A 4XC1L 2VZUA 4BI6A 1LP9A 3QCTH 1B4RA 3AZSA 4PLKD 4WUKH 3PFMA 3M1OA 2REQA 5A69A 1T4WA 4ZB5A 3DC0A 5I73B 4W86A 1WKYA 3F2CA 4NCC2 2XACC 3B5HA 2Y6ZA 5LKYA 3NQ2A 3QJSB 2EYSB 1LP6A 3CWNA 4PBVC 2O6CA 5C7XH 2IJ0C 4R2GB 2P5NA 1VZGA 2FQGA 4KJPC 4QRUB 1UUOA 1A7QH 2KKQA 2EDFA 4J3SA 1V3JA 5DMGD 4Y2DD 3LKSA 3ALPA 3BEVB 1I1YA 3W25A 2Z93B 4F1SA 3SJ3A 1J11A 1S7SA 3H4GA 3WK2A 1S2UA 4YWIA 3VRLF 2FWLB 4KX8A 1GGCH 3OAZK 4TUJA 1J6PA 3HR5B 1X5GA 3BSHA 5G5DB 3K8KA 3QJHA 2VGLM 1GH7A 1SNRA 1L5GA 2DQHH 3SQBB 1GOMA 2IDQA 5C9UA 4OZIB 1R86A 1RIUL 1GXEA 3BLKA 3AWFA 1JV5A 4HJWA 1VERA 2OMBA 3BKML 1TZIA 2EKSB 3W5MA 1A3LH 3DIFA 5LXVA 2ZADA 4MA8L 4OM1L 5DEGB 5F21B 3GIZL 5IV2B 1UUMA 1SJVA 4M7KL 2DQGL 2JIXA 2CO7B 2Y1VA 2Z91A 5HNRA 4EDXB 2CJTA 1KFLA 4NO0D 1UPPA 4W4NA 2FHCA 5KSBF 3CZSA 3QNYA 3SGJA 4O0QA 2NTSP 2BSTB 3FQYA 2R1XB 3P9MB 1BF2A 4YJZL 3MMDA 1IC4L 3RYMA 1BGAA 5PCYA 5D2NA 5DT1L 3D46A 1IXPA 1MEHA 5IROC 1G4SA 4LQFL 1E90A 1HZYA 7PCYA 4PZVA 2YUWA 2R6OA 1EXHA 1MWOA 2MFNA 5MEOA 1FBAA 2QGHA 2CKBL 3INUL 4UQ9A 2XWDA 1US3A 4EACA 1O5KA 1KULA 3BMXA 1FKWA 3WQPA 5KINA 3GHSA 1CDIA 1MREH 4L3CB 4WX2A 2WZPD 4PB3A 1FFTB 2A6KA 4RDBA 1MW1A 1TMHA 4JM2A 5L2KA 1O6VA 4XD5A 1MXDA 3R7RA 3WLQA 2CBOA 3DUHA 2QDWA 4BGLA 4IWWA 3RTLA 2PB1A 3LEPA 2XISA 4MSWA 3UH8A 4C4KT 3ML9A 1CQKA 5AC7A 3AMGA 5CIPB 1BQHA 1FWCC 4K3DL 1B3ZA 1CLCA 5GZOA 4NERA 1TPWA 1FG9C 2AK4A 1VD6A 3R1GL 4F8OA 3IJQA 3MNWB 1OE3A 3C75A 1L6FA 1CFBA 5T1LA 5IEKB 5E4OA 2PZNA 1ZAIA 1EP1A 3GMMB 4MRCA 3MBEC 1E0WA 3OVUB 2V67A 2F54A 2W91A 1SHSA 4NZUH 4S1RL 1MFEH 3AMDA 5EH1A 3HA0A 3UTOA 3PV6B 3ZTDC 3NN8B 5LNDA 1FBIL 1GS8A 4PVLA 1LQ0A 4NNPH 3D39A 2NR6C 3MRPB 3E8UL 5FYJH 1QW9A 3H55A 2VLME 4NHUA 3W1UA 2XJ7A 1A7NH 3MA7B 1I0BA 3AUVA 4DNHA 4Z8FH 2BP8A 3S8GB 1CLVA 4PGZA 4QITA 3PF2A 4PJDB 4V1YA 1UWEL 1WWCA 1FNEB 4M1GL 1ZGDA 4HLJA 4EKJA 5K9KA 5CBEB 1WICA 5EZJB 1IZCA 4L0PB 3G5EA 5GNYA 5CD3B 3MMEB 3ZKNC 2QJIA 4IJ3C 1CL7I 5DQJA 4YLBA 4LEXL 3UEZA 4Y1TA 2YKLL 4MQXD 4P2RA 4GI4A 3PJWA 3RHWF 1DQLH 3PWJA 4MS6A 3RIAK 1XD1A 3G1FA 4MBOA 1DSYA 3AXLA 2MQGA 3S3SA 5E9DB 4JNZA 1YYLH 3VQ2C 3VCLB 3GMNB 2GFBB 1XFPA 1RHHB 5I66A 5E6SB 4JDVA 4GXMA 4XX5A 2C4FU 3H53A 3WQVA 2D20A 1SO3A 3STCA 3VZXA 1I7TB 3L68A 4JZ5A 2DZPA 1GQLA 1PV8A 3NDYA 3ISRA 4KKXA 1F8MA 1X7TA 3P0WA 4AZHA 1CMOA 2WWDA 4LV4A 1PEWA 5HHVH 1ICSA 3W57A 1P7TA 4FG6D 2WM1A 4ZMYA 3E0VA 4A63A 2H41A 4ZYKA 4EAMA 3L4YA 2OZ4L 1DLHB 5EZLB 4MNMA 4Q8VA 2UZXB 3SYAA 2WV3A 4ZPVA 4UZUA 1A21A 4LVBA 4FL4C 1QACA 4P2QE 3C60C 3VIJA 1BBJA 1ACZA 1L6YA 4HHLA 3HE6A 4K71B 2IANE 1W1IE 1ICPA 2E8ZA 3NFNB 2UV8G 3EH2A 1NUDA 3UYRL 4ZAKB 4D0CB 4XVSH 5IFPA 5DSCA 1V05A 3GR8A 1JS4A 1CZ8H 3UP6A 3H4XA 4EUPA 5K9XA 4Q14A 3CIVA 4N9BA 1DO5A 4L1HA 4BSWB 2AQPA 1WBHA 5EV7A 5FK9B 3W1MA 2ADFL 2AQQA 3H56A 4C8XA 4KK8D 2IVFC 1UROA 1G1YA 2A2IA 4BCYA 5F3BB 3OKOB 1R9ZA 4NDMB 5F0JB 1OX6A 3NR0A 3GB6A 1TQCC 4N5EC 3IJEA 3S6DA 3LHUA 1R8LA 1E9OA 1MH5B 1A4MA 2CYGA 1ZY9A 4Z2LA 4XT1C 3NZHH 4JHMA 3W56A 3QNZB 1GYCA 3TT3H 2G4GA 2N7SA 4FQJH 5I6XC 3ZMNA 3WY4A 4PP1C 1LXMA 3ONBA 3EYUH 1A5LC 2GJZB 1V93A 2X6CA 2ARWA 2XV3A 3B2VL 4QDPA 3QJTB 2NXYD 3VC6A 4D7PA 2EIZB 1B0WA 4MZYA 2XZAL 5AHEA 1J4EA 1V6VA 2EABA 3D4CA 1MFCH 4JQXA 4D6DA 3PUOA 1QT1A 4TX6A 5B8CC 5E00A 5D7JD 3LDBC 2BMKB 3NQAA 3S9YA 3ESNA 3BE1H 3A4EA 1UC4A 2EE6A 1QPQA 3IDGB 4O10A 1HNYA 3BI9X 4L37B 4P5SA 1WDRA 1TVHB 2WIMA 4FMKA 3SPVB 2V9TA 4ONVA 3UAJC 1K8DB 1VHCA 5F7HA 4XMTA 1XG3A 5F7UA 3RGVD 3BWAA 3WXVL 2OMZB 1B54A 1CFTB 4PI0A 2XI9A 1RK0A 1EB3A 3RZCC 3LPGA 3LQLA 5I00A 5E8DL 3S5OA 4LU5H 3BG5A 1QX1A 2Z1VA 4LSRH 4I4WA 3APMA 1L6GA 3VILA 3GB7B 5BOPA 3IDJA 2IS7A 3FB6B 4M3HA 2DDQL 2ADGB 2C3XA 4I3RH 2PD5A 2D3VA 4N68A 4PJ6A 4WUIA 2NNCA 3IETB 4IRZA 1AH3A 1LK3H 1TREA 5EORH 4YE4L 1ZHLB 3B03A 1UATA 3S37X 1OFAA 3CSYA 4KKPA 4XO7A 2I7GA 1I8IA 3LPPA 1A6ZB 1X9LA 3BKYH 4UR7A 1G9EA 1ML1A 2AJYL 5IBLD 4JGDA 2EH7H 3T7VA 1B4JH 4GA8A 3SE3C 3TVMD 2WOQA 2LHAA 1YEFL 1UT1A 1Z9OA 2ZRVA 4OD1L 4E9QA 2UXTA 3MO7A 1AHWB 1GAFH 3SDAB 1MEIA 4DNLA 2P4AB 1DWAM 1O1ZA 3S1WA 1FXPA 4QBXA 5CLZA 1V5JA 2Z0IA 3ABGA 2P53A 3I9AA 3JWDC 3FEMA 3W4RA 1DJGA 1PTAA 1M2OA 1I1AD 3MUXA 3VD4A 4O02A 4QNEA 5CD5C 1O6SB 4HALA 2E6DA 1IFGA 3RGHA 3I4KA 2AMUA 3K91A 1A1OB 5KZEA 3UPWA 1MF2L 4PRIA 5IB3B 3WF2A 5CEXB 2H32A 4Y16B 1I1CA 3D50A 5AEAA 2A83A 2EDYA 2BIOA 4E4PA 1WBZB 3P0VL 2Z4TA 2A3HA 1JRBA 1VFBA 4L4VB 5CM1A 3SUVA 5FGCB 3FW6A 1NBZB 3CYJA 4OUEA 4TU1A 4NQSB 1MPAL 4GSUA 4YDZA 3V0TA 3LHPH 4YHGA 1BWVA 2ESVD 3TWYA 4XAKD 1QR4A 3DRQA 1LYXA 3ASNB 4PMJA 5D6CA 3EBGA 3S5ZA 5JHAA 4M9OA 1M42A 4LEOB 5HJ3B 1R38A 3G6JE 1NCDL 4XHQA 1BQLL 4LFYA 4GW5B 3PU7A 5E94A 3NIGF 5FAGA 5CPLA 4RE4A 3LH2L 4X6CB 1ITXA 2MQ0A 3QWOA 1BVOA 1F4AA 3K1DA 2ALRA 3W7GA 2KLSA 3WE6A 4P46B 4OY9A 3QIWC 4PGCB 3VWJC 2C9SA 1E1EA 5H94A 4XXDB 5D2WA 1N5AB 1HE8A 2OOFA 3H7LA 5IDIA 3QUML 3VJ6B 5EMMA 1N19A 4P61A 3LZLA 2ZKHL 2FJFA 4ODVL 4I0PD 4O02H 3MVIA 1HHIA 3EKGA 2V8MA 1MFAL 3LI0A 1D3HA 3W86A 5E6ZA 4K7FB 1C16B 4P59H 5J06A 2CLOA 3QQXA 4DPRA 4JIPA 2H32H 3LNFA 1E73M 1A1MB 1OIFA 1UACL 3T3MB 3US9A 3ZE0B 2GJJA 5AB2A 5FEZA 2HSAA 2VM3A 3V6OE 3PP4L 5C9RA 1GPOL 1I31A 2XTJB 4MAYB 3FK3A 2NYYD 4IXHA 4N2LA 1AACA 1GGIH 5ABGA 3TXZA 4YBQD 3DDMA 4YHKL 2I9TA 4YGAB 2B5IC 1UYQA 3DFPA 4LPTA 4I88A 3BT0A 4H04A 1YAIA 3MLTB 1GVSA 4XMZA 4YWSA 5DK2A 1LQAA 2J74A 4J7RA 3L0KA 1DE5A 4WGVB 4IHCA 4HIJA 1YEIH 2XPKA 4Q0XH 4LKCB 2ENSA 1X5XA 4HWZA 2CUHA 5DJ2A 2X1QA 1C8YA 2GVEA 4JTFA 4HMCA 1YUHB 4QEHA 4G7VL 1Q6OA 2Z25A 4LPWA 3SSJA 3ZLFA 3VKCA 5LAXA 2X4UA 2HN7A 1EGJL 4K9EL 5F7AA 5ICZA 3ZKMD 2Z31B 4HLEA 4F7KA 1KENL 3Q2DA 5E99H 4BZ1A 1I8KA 1YXYA 1YNKH 3T40A 4BXVA 4MJJA 2D9QB 5J8LA 4A68A 5IQMA 1H11A 3V5OA 3O4LB 1H7XA 4DQWA 4AZGA 4KUZH 2HPMA 3BMVA 3LSCA 3BC9A 5HPMB 5JQ9A 3C3NA 4DWDA 2VMDA 3U7YH 4A67A 1OZTG 4UFKA 4XE5B 3HAEB 5I6MA 1KDJA 2MOGA 4RV8A 3MZ2A 2UWEB 3U30B 4OAWB 4HIHB 5EO9A 3F7VA 1VLIA 3NZSA 4FN0A 4TLUA 5D32A 3MSDA 3KOZA 5K9OB 3UU0A 4U1SB 1SDAB 1EWHA 5JOPE 2WO3B 3IRPX 2INFA 3AUWB 3AXHA 3NFPB 1QSEA 1A22B 2XFWA 2GSIB 3WHXA 4PMOA 4XPFH 1JXJA 1FV1A 3WUBA 5EEVA 4DN3L 4QDGA 4N8VG 2A6DA 3LNMA 1YPZB 3UNDA 4P05A 3A4JA 5GZNA 3TQ0A 2IPKB 2ID5A 5KW9H 3CCHB 3VNMA 2GUOB 5D96B 3D18A 4EI5D 2V38A 5JQHC 4HHAA 4ZW8A 3K72A 3WFCL 1GHFH 4LVEA 1LO5B 1SXAA 1DBAL 3VRIB 1ZHAA 1ES0B 1ZA6A 4BA0A 1I9CB 4DM2A 3BWUC 3MHFA 3LOTA 3NZ1A 5C3LD 4KKLD 4YPJA 1EP2A 1HEJC 1ZPUA 2DLFL 1HEHC 3NK4A 4UNLA 4DVBB 5EU4B 2MOQA 1S9WA 2HFTA 5BJTB 2HH0L 3MAWA 4F8QA 3ZHDA 1P4UA 1QFOA 2AJZA 1UR0A 1FNSL 4RGND 4LUYA 3EKLA 4UOJA 4G7YH 5AVHA 2Y1HA 4WK9A 2C3GA 2ZUYA 1R1CA 3INOA 3OBEA 1N2RB 2G4EA 2RUSA 4HB7A 1G0XA 1SJHA 1XDLA 3GHRA 2GVJA 3H85A 1N7ML 3OQ8A 3V4VB 2UXVA 5I1HL 4MXWL 3DX9A 3ECVA 3ITOA 4KHXH 3MLVH 4YDIL 1XI3A 4RAVB 4N6RA 1W3NA 4JFHD 2ZSVA 4S1SH 8PAZA 1UWXH 2IXVA 3RILA 1CXKA 2G3IA 4NC2B 3LCYA 3RPKA 3ARBB 5SX4I 1GGBH 3Q05A 8CGTA 2OM5A 1DBBL 4H26A 2XV2A 4BKLA 4L1GA 4YYCA 1WAPA 2YS4A 4XPGL 1DANT 4G8IA 3UDWC 4ZMLA 2B0SL 2AJXL 3DXAA 3B04A 5T3ZH 2BGSA 3WLRA 3FCTB 5IVOA 1E0OB 1A9BA 1MCOL 5ABEA 3OG6B 4LPUA 1KT2A 2X42A 3BWUF 1GOFA 2XFYA 5HI5D 3WN5C 1EBHA 2AW2A 1G7LB 3V0FA 3HURA 4N4QA 4DHLA 1O9ZA 2ESVE 4X5XB 1JDDA 4XAKE 3RL2B 1S2VA 2APFA 3LGEA 4IPPA 4P49A 4WW2C 5K93A 2EYRA 1W72A 4WUUB 4UTAL 1DJQA 2AMGA 2P5WD 3YPIA 1MCPL 4W8AA 1Z7AA 1RH9A 15C8L 1DVTA 2WXFA 1XIEA 1OOAA 3QHFL 1HYSD 1TZOA 1YEKH 1T3FB 2YAEA 4OZ4B 1N5YH 8XIAA 4C6OA 4TNVK 3LV5A 2WBJC 4XISA 1RZJL 4BF5A 1DIOA 3WF1A 1G9MH 3SODB 1MCEA 4HKZA 4PJBE 3WIIL 3TA3B 3ULVH 3THUA 3QQ4B 1H5BB 2PCEA 2J43A 1AOZA 1FHGA 5D93C 3GSVB 2H6UA 1WDWA 2RDWA 4Y7MA 4LCCC 3RNDA 4IKJA 3L2LA 4AM0B 3UEQA 3P3UA 3QQ1A 1F86A 3RTQA 1F73A 3NWRA 3TN6A 3HI6H 3UZJA 1R9YA 2VWEE 1X8FA 3EGDA 5I82A 4UTTA 4ZI8A 2X4SA 4RZKA 3CTLA 4A2GA 3GI8L 2V37A 4M8VA 2UYLA 2C1PB 3GLZA 4PJEE 1JVLA 1VS1A 3ULVD 5TAOA 3TSBA 1ISWA 1E50A 2KT6A 4L9LA 3PF3A 2VI0A 3VFWA 4Y4KB 3NYDA 1V7YA 1CL7L 1W72H 4GKOA 4R90L 5HHOD 5HA7A 3QGVA 3HE7D 1EEQA 1LDPH 4WW2F 1G7MA 3AICA 4YJ5A 4HKPA 3AU1B 4MJID 2Y9RT 4DF9A 4HGMA 4E6MA 4LSSH 3FSUA 2QLVB 4FYRA 1I4FA 3RL1B 3F3HA 5SWZA 1ORQA 2WVSA 1IT7A 4GG6E 2I16A 3PQYB 2Q8AH 3W0WE 4P3DA 4DI8A 4ELDA 4MOZA 3GH5A 4X5RA 3ARDB 2HVOA 2WC4A 4U6HA 5LB1A 4Y88A 2OSWA 1FZJB 4HV8A 1MLBB 4CQBA 1WGVA 4MJ6A 5EA0H 5IIEA 3QFJD 2HJFA 3MJYA 2ZWYA 4ZOBA 4Z7OB 2QHRH 1IJNA 3AIWA 3LCGA 3UBGA 3M1CA 4KWUA 5EBWA 3KCOA 3VH8G 3C6CA 1DN0A 3LYEA 4HETA 2YHGA 3O4OC 3GGWA 3NGJA 2E4TA 4IRJC 3AVEA 4LHUD 1XQLA 1MWAL 2WXDM 3QZEA 1BYBA 2XH4A 3CH1B 2H6PA 5IHHA 4FP8L 4ELME 1SJEA 3TX4A 4C1KA 4IPNB 5C09D 2EPHA 4ZA0A 1KBBA 3GRWA 3ZWSA 1RZIB 2P0OA 4C4KO 1L0QA 1M7OA 4PGBB 4H8PA 4MKVA 4R0LC 3UJFA 5AW0B 4QRTA 4AEEA 4ADIA 1KCWA 4IIQA 2GGJA 4YSDA 1NFDB 5LUMA 2LT9A 1TPUA 3S9IA 3SBQA 4MCMA 1U93B 4PG2C 2YSTA 1HGYA 2J6EL 3SDCD 4Z9KB 2Q6WA 3VFPB 3MB9A 5JORA 2TAAA 1ET7A 2HKHL 2DVUA 2OL3H 3ULUL 2J8UB 4HPHA 4JTUA 5E23A 4RA0C 3WFDL 1K4DB 1XJBA 5AYIA 1V3MA 4BUQA 1E8WA 1T7VA 3DA0A 1ILSA 1MJ8H 1T5XB 1BX2B 3SO3B 5T3XD 3VOCA 4QYOB 1EMTH 3L3OA 3U4BH 3GSUB 5A94A 3UW6A 2IPUG 1MFDH 5LBSA 4RRPM 4WO4C 4Q4RA 4R53A 4MKTA 3TK7A 3LM3A 4JY9A 3HI5L 4U2YA 1QW7A 1NGYB 4OZHE 1QWNA 3FUKA 1JZ5A 4XZLX 1WDQA 4JFZH 2IAMC 2UX7A 2W9EH 2AQTA 1F00I 3FRUA 3IUIA 1J1OH 3KPSE 3VD5A 1NTDA 4FX8A 4DUVA 4APQC 3MBXH 4WKHA 3IJ7A 4ZCWA 4MJ2A 5FECB 3FNDA 4FQHA 1ZEAL 2E9LA 3GMQB 4Z0JA 4JFHE 1UOZA 1B31A 5ISZB 3E1ZA 2W67A 4K3HA 5T5FA 1JD9A 1HO1A 4CGTA 4AQEB 4UDTB 5ID0A 1RZ8A 4RNHA 4F9LC 2OZNA 3RQ3A 4O1CA 4Y4HD 4JREB 4ALAL 1BQRA 3FT3A 2FWUA 3KPRB 2OZ8A 1Q0YL 5AVXB 4QHUB 4LBEB 3UMNA 4LVAA 1R3KB 1RR2A 4XMPL 3RX2A 3F8UB 4BM7A 5AVRB 5ESVB 3GSOB 4OVXA 4R4BA 3RM4A 3WD1A 2BWGA 4F8LA 1YG9A 2F1EA 3D48R 3UBXI 1ML0A 4J3VA 4FLSA 1X4XA 1KB5A 5I6PA 3EG9B 5ANMB 4H8VA 4E9LA 4S3AA 5C6TH 5LBSH 3CZKA 5FJJA 3VXRA 2YLKA 2XKNA 3D85B 1MUJB 3QLDA 4HPXA 4AHPA 1FO0L 3GDKA 4RFOL 1UR8A 3EWDA 3QY6A 3NOIA 4AKQA 5CPOA 1NQBA 1RSFA 3OEXA 3KPOB 2HVNA 4DELA 3LCWA 2EVGA 2JCCA 4W9HC 5DJCA 2QS8A 4LB3A 2G75B 4DJED 3ARVA 3BUPA 2BSDA 1HESA 2R23A 3EJCA 4TXEA 4PMFA 4R97C 2W6RA 4ZX4A 2G8ZA 1TVBA 5DJ8B 4K8HA 3OHXB 2Z7KA 2Z92B 5I1CH 1HINH 2BS8A 5CU9A 5HDQH 3TV8A 5AOKA 1ECQA 1TTQA 1A0DA 3IUDA 2YPKB 3KVLA 3TJPA 1Y5XA 4M5ZL 4GH1A 3SDXA 4PUDA 4G6FB 1RZQA 1B0RA 2P24B 4YCPA 2R1LA 1XYFA 3MTRA 1BXUA 3RLHA 2DQTL 4GKNB 1EFXB 3QVAA 4REQA 4UOW1 3L5IA 1KB5H 1NIFA 2PURA 1W8NA 3T8VA 3DX2A 3GU1A 1IKOP 2OLHA 1U92B 3OO2A 2Z27A 4QUOA 3R19A 4ZO9A 3CV1A 4KPLA 2GOUA 5HHOE 3PDOA 3UZEA 3DCPA 4PJHB 3MV8E 5CPTA 4ZO7A 2CBJA 4MJIE 1K85A 4OGAD 4PWKA 4S0TD 5REQA 1RV8A 3VG0H 1Q8AA 5IFTA 3CEUA 3WUGA 4G7EB 1TCMA 4YH6A 4H1LG 4I7ZC 3P4OA 1JZJA 1M71B 1S5HB 2OFQA 4ZFOA 2DH3A 1TV4A 4KHTL 1FYTB 4PJGF 1ET5A 3B9NA 1Y65A 5IMOB 2WQUA 3PTKA 2PWUA 3FT1A 5CKSA 4IOFD 2FX9L 5G4WA 4I18A 2QSCL 3CZLA 3P84A 4PY8I 5KYWA 2XRAH 5C0CE 1NIDA 2OMYB 4IGBB 1E1CA 1LCOA 3QDGA 3QM3A 1JGEA 5IQNA 4M48H 4MMZB 1ZNNA 3IVKB 3EJYD 3VMNA 4CC4A 5DDHB 4PTUA 4J1OA 3NL5A 3QO0A 4GPVA 3UXLA 1S7RB 5CP7B 4UFHA 3T0WA 5INCA 1KO0A 4KROD 2L4OA 4GVFA 1ANUA 2W94A 2CALA 4XIMA 1D6VL 4LPXA 2V2DA 2NSQA 2H9GA 3BQUC 2FJGB 4XBKA 2XETA 4L4MA 1U5VA 6XIMA 1A3HA 3NZQA 4XVDA 3DG3A 3QBTB 2ITEA 3VGAC 1B0GB 4LLUB 1V77A 4J35A 2D31A 4JFEE 1ADDA 5DZ9A 4AV4A 1JCMP 4D9PA 1AI1H 1MCWW 2YA1A 2DTMH 2DUXA 2W65B 3CVHB 5CBAA 2J6WA 2Z8SA 5E0CA 5DRNA 1BFNA 4IBVA 2RMNA 2AP2A 2DP3A 3APCA 3ILEA 3B1UA 3LD8C 2Q9OA 1IV8A 3W23A 1NAL1 4Z3EA 2YBRA 1W9DM 1EV2E 3VIHA 4OGZA 1ZGLA 5HDBE 4F8TA 2GSMB 5JHLA 2GT9B 2DKSA 2J9ZA 3CFDB 4DUXA 1BKHA 3CM4A 4S38A 3WFZA 2HCZX 4PJ5D 4CCEA 3AY2A 1GIGH 3TTSA 2YCLB 2XFXB 2D7MA 3AY4A 4N2YA 2ZBTA 3HFMH 5CJOL 5AHLA 5M5DA 1K4GA 2YPVL 2HLAB 3ME0A 4MWFB 4CSPA 4ZB2A 4NHCH 4FNPA 4GKSA 1D7KA 4GZJA 3O1NA 4K8RL 2XV6B 4C6NA 1EWDA 4X9SA 1T20B 2IANA 4QRSB 4B3LA 5DHMC 3EYQC 4B0MB 4N02A 1E4XI 2PGFA 3QA3A 3QUZC 5IEHA 3N3MA 3DHFA 4IMLA 3ZJ7A 3DGDA 2QVHA 4KJWC 4JM4L 1TEYA 2Y6SD 3FDWA 3SCTA 4JKLA 3S0PA 1Q6DA 2ADJA 1OAJA 3OKNB 1PKMA 3VI3F 3P80A 3D2TA 3M0IA 2WY3B 4D6FA 1CXFA 2OQJA 1M68A 1KTCA 4XBGB 1YZZA 3CC5B 3QOKA 2V82A 5DO8A 3MRKB 3L12A 5FF2A 3V6ZA 5EU5B 3QR2A 4UAOC 5F1UA 2E0PA 4KXBA 4BWLC 1MY7A 4QE1A 3FB5B 2FQFA 4AZUA 3TEUA 4EN2A 2PDWA 3CHVA 3U2EA 4HISA 4LEQA 1IFRA 1MSPA 4HQQL 4Y2DA 3O2WH 4HKXB 3G1HA 1NMBH 1UMYA 3MUZ1 3VG9B 4M6NL 5DELA 2Z35A 4AH2A 1QFWI 4R5EA 4J2MA 5KG9B 5BO1H 4F2EA 4Q4KA 5T26A 3P0YL 1J1XH 4UV4L 1F45A 2XZ7A 3L7EA 4AKPA 4DCQA 3MACH 4N26A 2VW7A 2EF9A 4RX4D 4RNIA 2GSGB 1UZGA 3D5OF 5T1KD 2J72A 4ABQA 1FFOA 3AQDA 4I5BA 7REQB 1I3RA 4S1QL 3RX8A 3F4CA 2VDIA 2HX8A 3FT2B 4A05A 4ZTEA 5E7FA 5EOCL 1B4LA 1JMXA 3P8IA 3L9BA 2YAOA 3HRZB 1FP8A 3LBOA 2ZUQB 3IVTA 1K5NB 1YA5A 4P9MH 3DV6B 1LEIB 3FHEA 4PJAA 1AGDB 3S3JA 1AJ2A 3P9WB 4GYBA 4OGYH 3LNHA 3QJAA 4ZNEE 3NQ7A 4TVCA 4Y2OA 4CILA 1H9VA 4JFYB 2YEZA 1IQDA 4FXKB 3GYEA 3TH2T 4FFVD 1GYNA 2GBTA 3LZRA 3KXFB 4G9FB 1WQVT 1IHIA 2C1OA 4R34A 3SUUA 2VDGA 4PUMA 4XNDA 4Q4QA 3EYPA 1IGCH 4F80A 1SM3L 4O4YL 4DO7A 3UFYA 2FGZA 4YFLF 2J75A 3C2VA 1LZOA 3GLAA 2WZPA 4JTSA 4JN1H 4JY5L 3E2HB 4Z7QF 2VEPA 3D12B 2FUTA 2HJKA 2V5YA 4N42A 1UVQB 4IEFB 1FFQA 3S35H 3O9NA 1TTAA 3Q2VA 3VW3L 3KDNA 2D23A 3GU9A 3GUWA 3PAZA 1OK0A 3AWGA 4UU9B 2ORBL 5GQBA 1B4KA 3SCWA 3QDME 2F8IA 3VMOA 3ELFA 5C7HA 3WJJC 1U30A 2ETWA 3VNIA 1AJ7H 4X4XA 3AACA 4OSUL 4F91B 1N12A 2WWKT 4J3UA 1UB3A 2BG5A 2CLRB 3IFPB 4ZPTA 2OX4A 3TWCL 2PP8A 1RXOB 3HS0B 1YY9C 3QRFM 3TA6A 4AB4A 1YC7A 1NC2B 5DD3L 4IBUA 5AVZB 1KCBA 1JFXA 1NAML 2QVFB 4C56E 1E9YB 1I4NA 3EWUA 2WTPA 4EJ1C 5SWQB 4QGCA 1QRNE 3QUKB 4A7UA 3HG2A 2W66A 3MQTA 4QRPA 3MUY1 1XLIA 3GXNA 1TQJA 1O9WA 1Q0EA 1D5BA 2WNQA 1PVNA 5LNGA 3FT9A 4FNTA 4JPVL 1E2VA 4JRFA 2YPIA 4AH7A 2H26A 3WNLA 3KPTA 5I23A 4IDJL 3LN3A 5HUOA 4GXVH 1RA0A 2KMWA 4FX5A 4H8WL 4RCXA 4IH3A 2GSJA 3QJOA 4AEIL 5KVFH 3N50A 4B3EA 3HNVL 3BISA 4XPHL 4E8CA 2VOTA 4E0RB 2QCDA 4AZ8A 1HUVA 2O0TA 1AY1H 1JPSH 1JPGB 2W9MA 1IGFL 3F2BA 2FTAA 3QIUC 3L08A 3HRPA 5KN5B 3EH5B 1NUNB 1L9WA 4AVJA 2DZXA 1GZHA 1P5UC 4ZTXA 4HU3A 1W91A 3T0XA 5GSRA 3HNSH 5EEWA 1DQDH 2G41A 2VDNH 2O9PA 4XNQB 2C4XA 4NC1E 1I3GL 1AL8A 3R79A 3ESOA 2R56H 4HNOA 5C3TA 1VCBC 4OECA 2Z9TA 3IJHB 5HMFA 1UZ8A 5JNYB 1C9DA 4HMNA 4NWUL 4AK2A 3W73A 1C7TA 3QMSA 4H00A 2WQDA 2AF2A 5FO9B 3N6JA 2VD8A 2OLAA 1FLRL 4PJ5E 1SR9A 1HZLA 1NMCC 2Z1BA 4PUBL 4KMLB 5IR1B 2GQ9A 1OYCA 2VVSA 4BQ4A 4WCJA 3IMSA 1VH7A 1RZGB 3V5HA 3Q37A 4GMSH 1AQKH 3ZK0A 3VXQB 1ACYH 1C8XA 1CFVL 3ARED 4WI5A 2YQBA 4MLJA 4URIA 2C9RA 5EDSA 2OYKA 3JV6B 1A5NC 3GJFB 1TCRB 2ICSA 3ECBA 1DN2A 1DZ0A 3VGGA 5E8EB 5F4XA 3QY8A 4X8XA 3TYBA 5HQMA 3G3LA 4LSPH 1IYXA 1N55A 3BUYB 3AG3B 5I16A 5IQ7L 5J5RA 1BFOA 3CFBB 5B38A 1DDHA 4PMQA 2MHAB 1HL2A 4P2VA 4FP1A 2JXMB 2VRJA 5CZ0A 5D2LE 1T6MA 1I9RH 1NL0H 5DMKB 3VQLA 2XYLA 5J0BA 2Y1AA 5I6KA 2ATPA 1TETH 5GRZA 2X1WL 3GXPA 4X6DB 4Z76B 5HHNB 4GISA 2FX8L 5EF2A 1INDL 3S2AA 5I1DB 3KBWA 1MIEL 2O7SA 4XD4A 4NKOB 4DGVL 1XWVA 3QWRA 4G6AD 2R1MA 5GGSY 2LFGA 2E6YA 5MERB 1CGXA 4Q8BA 4P2OB 2HXTA 3BD5A 3TEVA 1KCSL 2VDLB 1ETB1 4L6HA 5KJ7E 4NQDB 2Y2TA 3W39A 5L4JA 3NIDF 4XCNB 3ZKQD 1CN4A 3NABL 2E40A 4HF5L 1E5JA 3WUWA 1NFIA 4P8VA 1QNVA 1MW3A 2RGLA <