1UA3A

Crystal structure of the pig pancreatic a-amylase complexed with malto-oligosaccharides
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Crystal Structure of the Pig Pancreatic alpha-Amylase Complexed with Malto-Oligosaccharides
pubmed doi rcsb
molecule tags Hydrolase
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ua3A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ua3A01
1HKIA 1CEOA 1QBBA 1HJWA 4P7QA 1V02A 4TOQA 5F7UA 1A3HA 3CZSA 3EJPA 2W67A 2ZE0A 1HXJA 2JE8A 3AFBA 3RO8A 1H4PA 2E8YA 3I3EA 1YHTA 4P8WA 4PTXA 1W1YA 2WMIA 1MWOA 5FCZA 3IANA 3W28A 3UG5A 3CGTA 1Q6GA 1UR8A 4C7FA 2WMFA 3CZEA 1CENA 1TA3A 4UQDA 2J47A 2A3HA 1P6WA 1H0GA 1PS3A 1ISXA 4JL2A 1VFOA 4XZBA 4HA1A 1CIUA 3CV5A 1ZBKA 1BFNA 2UWFA 3PZTA 2GJXA 4HU8A 1KGXA 1V03A 3ECQA 5HPOA 1HKKA 3WD4A 3PZOA 1G9HA 2YA2A 1K9DA 3BLBA 5A2AA 4BQ3A 5A6LA 4UFHA 3PN8A 4HZ7A 4BQ4A 2UY2A 1Q6EA 3MUAA 1HIZA 4B15A 7A3HA 2ZUTA 3SCSA 5ABGA 2W62A 5JBDA 3OGRA 5LYRA 4A3YA 4GO9A 5BXTA 1E4LA 1BQCA 5BXPA 3M07A 1M7XA 4U2YA 5C8BB 1UQZA 2GUYA 2X0YA 3D51A 2JIWA 3VM7A 3MV01 1MQRA 3WENA 4FK9A 1HKMA 2O92A 3AMLA 1HT6A 3AYSA 2VQTA 1W9VA 5C70A 1V6YA 2A3CA 2OYLA 4Z2KA 3N12A 2F7RA 1J0JA 1V6UA 4JFTA 5E0FA 3L4WA 2WKGA 1ISWA 4EK7A 8CGTA 1W91A 2W91A 1YQ2A 3EMZA 4AZIA 4R27A 1EHAA 2XYLA 3VUPA 3A21A 2CIPA 3IAQA 2J7DA 1G1YA 2J7GA 3DDFA 3CUIA 2WM0A 3EYPA 4GXPA 2WB5A 4XUYA 3GZAA 4MJ4A 3B9DA 5AC5A 1TQWA 3DHUA 1H2JA 1NQ6A 3DYOA 3LPPA 3AHTA 2VNCA 4CCCA 4QLKA 1GHSA 4PBGA 5ABEA 1NOFA 1UH4A 3A4XA 1X6NA 1ISZA 1EQCA 2D24A 5A8PA 1B1YA 3DX3A 3LXBA 1EGZA 4ML4A 2IXVA 2X0HA 3MMUA 3A4AA 2PWHA 3TTYA 3CBWA 4OJYA 1JAEA 2X2JA 4HOXA 2O9OA 1V0NA 2WHJA 4QLJA 2YL8A 1WZLA 2DT0A 2WVVA 1QHPA 3CHCA 1VJSA 3RMEA 4NZJA 1GOMA 3QOKA 3M46A 1EO7A 2VX7A 3WL1A 2J7FA 5IXEA 3WH7A 3WNLA 1V6XA 4LGXA 1B90A 4AY1A 3SUWA 4AD3A 1JAKA 4V2XA 1B9ZA 2V5CA 3WL0A 3AS1A 4H8VA 2VRJA 3KLKA 1J9YA 5HXMA 3M6DA 1W9BM 1JNEA 4RE2A 1H49A 4LQ1A 3VMNA 1JNDA 3B9EA 1UKSA 3N11A 2VZUA 3WY3A 1GOQA 5CLTA 4URIA 1GW1A 2X1IA 2C8NA 2G3IA 3CMGA 2XIBA 1C93A 4MNLA 4TTGA 1JL8A 3T0AA 1G01A 3CO4A 3WF0A 2ZUWA 2PWGA 4V28A 1KQZA 2WMIB 3G6MA 3DYMA 1KXVA 2FE0A 2IGTA 2J25A 5I5RA 1OT1A 1US3A 2XGIA 5C71A 1G0CA 4MTVA 3IJ9A 2XFYA 3ARUA 3SUTA 2EAEA 1TA3B 1CXKA 2BNJA 2TAAA 1HJSA 1E73M 2VCBA 2VQUA 1LWHA 2X09A 3SCRA 1R46A 4NXKA 2ZICA 1UWTA 1CGUA 2G3NA 3W0KA 4CD4A 1PJ9A 1QBAA 1EDGA 1PZ2A 4CN4A 3FAWA 4H04A 2VRKA 1TVPA 2AOSA 2GJXB 3VDBA 4CGTA 3BVWA 1G94A 1OT2A 3W27A 1JYXA 9CGTA 3FY1A 4W84A 2FGZA 3THDA 5EFDA 1EDTA 1AQMA 4V27A 5FKYA 5BRQA 3GBDA 5JBEA 1A47A 3LRKA 4JIEA 3OGVA 2XIIA 1QI4A 4PSPA 3GXPA 2FHCA 3RM9A 1QNQA 2WK2A 1JIBA 1DWGM 2XUCA 4EAMA 4WKFA 2YIHA 2JEPA 3WMSA 3OZPA 3WH9A 4ZENA 3OZOA 4PMUA 2RGLA 3BUDA 2DQXA 4HMEA 3MUY1 1PEZA 5I77A 3GXTA 1TE1A 3ARTA 1KWKA 1GUVA 1NWRA 2F1AA 5M3WA 3DDGA 1U2YA 4Y7EA 1WP6A 2W4XA 3WF3A 1BVNP 1LJYA 5M5DA 3A23A 3GXIA 2HISA 1DWHM 1V3JA 4TVDA 5A6BA 3B9AA 2VX6A 2YKKA 2JFEX 2WXDM 2E4TA 2EPKX 4J3UA 3WMBA 3U5YA 4BS0A 5DEZA 3BAKA 4S3JA 4CD6A 3KE0A 2WW5A 1RP9A 1BTCA 2EPLX 5A6JA 1JZ6A 2ZUVA 5AY7A 1W9XA 5BWFA 4ACZA 3D50A 2G3MA 3WKZA 4UNIA 4E8CA 3A24A 2OW7A 3WQ5A 5BRPA 4W5UA 4PEEA 1UD3A 4QFUA 5A6BD 1DP0A 1QHZA 5M03A 2JIEA 1PZ3A 3AS2A 1E0WA 1AMYA 1E3ZA 4JCLA 1FP8A 3N18A 1FHLA 5I3DA 1KQYA 1CGWA 3CZJA 4QLLA 2XVLA 5CGMA 5GNXA 2YL5A 2V3GA 5GNZA 2D3LA 1CECA 2OSYA 1GOWA 3U7BA 1OWQA 4H8HA 3WEMA 4DO4A 2YOCA 4BCEA 2V3EA 2XWDA 2ZIDA 1W9PA 3ARXA 4MNKA 5A3HA 5DMYA 3WD0A 4GPNA 1BAGA 1UH2A 3OB8A 3ARQA 1GOOA 2CKRA 1QI3A 2WVVB 1HX0A 3AXIA 3VO0A 3BSGA 2WYSA 4AWEA 1CYGA 3A3HA 2EABA 1UUQA 1OSEA 2E40A 4ATLA 1JYNA 3EJUA 2WWCA 3L2LA 4W89A 1VEMA 3PZQA 5DF0A 4HA3A 3SIMA 4Q7NA 3PZUA 3OGSA 4D6HA 3NSNA 2G41A 1LG1A 2DH3A 4NZFA 5HNNA 2ZX5A 1GJWA 3WELA 2WC7A 4HU0A 4TX8A 2WKLA 1QWNA 3VGFA 2FH8A 3WMCA 3II1A 1ZL1A 1B3ZA 1LWJA 2BXYA 3VTRA 2X2HA 3PZIA 3BMVA 3VSUA 4AW7A 1WZAA 1FOBA 2VL4A 2WBKA 3GYCA 1UD5A 3RPMA 1UKOA 4AXNA 3EDDA 4AIUA 3L4YA 3AZTA 1E5NA 1FH9A 3RIKA 3O9NA 1TQTA 2X05A 3WQWA 4F9JA 2J74A 4TTUA 4AEFA 1ITXA 2HVMA 4BZYA 1I1XA 1MQQA 2Y24A 4IM4A 1R7OA 1ZBVA 2EBNA 3ARYA 5D8ZA 2XVKA 3HG5A 3ZT6A 4U3CA 4KH2A 3BVVA 2GVYA 2ZX6A 3UG3A 5CPQA 2EPOA 3VGEA 1H0IA 1J01A 5A1AA 1GCYA 3T0BA 1K6AA 2V5DA 3ZOAA 1JZ8A 3VSTA 3FN9A 5D9MA 3RILA 4WSJA 4DWSA 3BAYA 1OIFA 2O9PA 4J3WA 4WIWA 3WFLA 2WZIA 2JF7A 4CN6A 1CLXA 3WDRA 3DX4A 3FW6A 1I1WA 4W5ZA 5CSUA 2F7PA 3BAWA 3ARRA 4PUDA 4WSKA 4D71A 1C8YA 1XYFA 1NH6A 2QPUA 2D0FA 2FHFA 3CUJA 2Y8VA 1KXQA 2D73A 1U33A 3K8MA 1K9FA 2XVNA 1JZ4A 4B3KA 3AHVA 3BAJA 2ZUNA 2VUYA 4DWSD 1JI1A 2VTFA 3OA5A 2EADA 1QNSA 4IPLA 4BQ5A 3CUHA 3MO4A 2C7FA 3HG2A 5I6SA 2W66A 4D1JA 3WNKA 5M17A 1CXLA 4Z2JA 3BLKA 3FXYA 1JXJA 1R8LA 4UZSA 1V6VA 2XPKA 1PX3A 4AZ5A 3MKKA 1OD0A 2DIEA 5CGTA 1KBKA 1GHRA 1UZ4A 2ESCA 4DUVA 2VRQA 1DWFM 4K68A 1V08A 2A3BA 1KTCA 1MQPA 3WD2A 1VBRA 5CSYA 2XVPA 3A4WA 4MNMA 3FHAA 4YHGA 4FLOA 3ARWA 4UOJA 1J0HA 4U31A 1VFMA 1UWQA 4WF7A 4OBRA 3BC9A 1XH2A 1JZ7A 1R75A 4DM1A 1HJUA 5E09A 4FNUA 3VIIA 4TVCA 4ACZB 4HPGA 1I75A 1B2YA 1EH9A 4GI6A 4AC1X 1DTUA 4UFIA 1QOXA 3GH4A 1V3MA 3RDKA 2G4FA 4HZ8A 4H7VA 4W7UA 4C7GA 1LF1A 3WDQA 5AYBA 2BY3A 3GXMA 3LPFA 2YBUA 1ZB5A 3IJ7A 5EMYA 1KTBA 3HN3A 3HG3A 4J3SA 1RD6A 4CCDA 1CXFA 2FGLA 1V6WA 3VD4A 2Y2WA 3ARSA 3SCTA 4D6DA 3VU2A 4H8UA 2WCGA 2JF6A 1CXIA 1HF6A 2YJQA 2WMGA 3WSUA 3VM5A 4P7OA 1MW0A 4W8LA 3ALFA 1SR0A 4JKLA 4B9ZA 3QHNA 1H41A 3GNOA 1QI2A 1EHNA 4UQAA 1UWRA 3F5LA 4B9YA 4BQ2A 1C3FA 1BYAA 3W6LA 1NOWA 1E9LA 4U3AA 3PZ9A 1VB9A 3BUQA 2ZWYA 2WMHA 4B16A 1TUXA 1TQUA 3ZO9A 4HTYA 3AJ7A 1PIFA 1RH9A 2CITA 2W63A 4PTVA 6TAAA 4MB3A 1HN1A 1MXGA 4PMRA 2XM1A 1QW8A 1PBGA 2IXUA 1LL6A 1WZKA 3W24A 5JUVA 4PMXA 2PBGA 1JFXA 2WSKA 2Z1SA 4J7RA 3L2MA 3KWXA 3WQ4A 4M81A 1TG7A 2OYKA 4YPJA 1E4MM 3QOMA 3K1DA 5FL0A 1UWIA 3WD1A 1J18A 3LXCA 1E6ZA 3CPUA 3VVGA 1KGWA 1E6NA 2OSXA 4QCFA 3ZQ9A 2ZX8A 3CZ8A 3MS8A 1CXEA 1CZ1A 2BY2A 1VFFA 1MFVA 4PMNA 3UESA 1E56A 2NSXA 2EPMX 1MW3A 5A6AA 4GO8A 1B31A 2VZOA 4AMCA 4JAWA 1HXKA 3AXHA 1CGVA 4JL1A 2QPSA 1UA3A 4CKQA 1GQLA 3S5YA 3ALGA 1BYBA 1V0KA 1TQVA 1EOKA 4QCEA 5A2BA 3GM8A 2BS9A 4Z2IA 3FAXA 3K4DA 3UR8A 1FA2A 4KRTA 3VKKA 3EDEA 4M1RA 1QNRA 4LYRA 3WH6A 3BAXA 3OLDA 1J0IA 1QX1A 2YLAA 5JIPA 5FD0A 3TA9A 4N0RA 1E4IA 3K8LA 3EMQA 4QP0A 1WKYA 2DSVA 4Q22A 2CPUA 5LA2A 1UQYA 2CYGA 2CCRA 1VJZA 1VAHA 1HP4A 2J8GA 3H55A 4CN1A 4XX6A 4MB5A 2EJ1A 1E5JA 1F4AA 4AEEA 3A5VA 4AZ6A 5HOSA 4B3LA 1OB0A 1XCXA 4MPKA 1JFHA 2Y4SA 1SYTA 2O9TA 2YL9A 2E9LA 3ZJKA 3PTMA 3WQ8A 5A6KA 3W29A 3CHEA 1E70M 3AICA 1NARA 3W4RA 2J7BA 5D8WA 4ZE5A 1DEDA 1OM0A 2J7CA 1GQIA 2BXZA 4NRSA 3S5ZA 1LG2A 1B3VA 3WUEA 1ZU8A 3GXDA 4GZIA 3WUBA 2J7EA 4TUFA 3U7VA 1XH1A 1HL8A 2Y5EA 3CZKA 1LL7A 3MSDA 3VNZA 3TOPA 4DM2A 2WHLA 3K4AA 1V0MA 2CKSA 3ZJ6A 3D4YA 1KXTA 5DFAA 4JFSA 1JDAA 1U30A 1Z32X 4D6IA 1UKTA 2PWEA 4P7LA 1GQJA 1ODUA 3VGDA 3UEQA 2PWFA 4KWUA 3DECA 1TZ7A 3D5HA 1D3CA 3CZGA 2VJXA 4HA4A 4AYGA 2YBTA 3EJQA 2BHYA 1GZJA 1UYQA 3AOFA 3LRMA 2WPGA 3WF4A 2J78A 1LLOA 2OW6A 2WMKA 4U33A 2FH6A 4W8BA 4KGJA 3U57A 2JALA 3VIHA 1ZBCA 1OBAA 3WBAA 1C90A 3HZ3A 3ZSSA 1FFQA 4QAWA 3WDPP 1O7AA 3CHDA 4W86A 3WEOA 1OINA 1UD6A 4WLCA 3A22A 3MU7A 4X9YA 3WEZA 2AMGA 1E1FA 2F7QA 3KL3A 3AMKA 2BV9A 5ABHA 2E9MA 1WDQA 5IFTA 3RCNA 5CPTA 5I24A 3ZR6A 1V0LA 5GNYA 3VDAA 4DUXA 3W38A 1ZS2A 3VD3A 4MAZA 1QWUA 1HL9A 3ZJ7A 1F4HA 4E4PA 3LXAA 1E0VA 1R7AA 4FNPA 3WDJA 2CBVA 2WC4A 5A8MA 3SCUA 2VOTA 2X2YA 1Q4NX 3WF2A 2A3EA 1UKPA 3VIGA 2VC9A 4KGLA 1UASA 1OGSA 2WZHA 2YA0A 3VPLA 5TD4A 2V3DA 2XGBA 3VIMA 1PX4A 1E40A 5A6MA 1H09A 4LYPA 4HP5A 1DWJM 1J10A 1E55A 4RE4A 1LL4A 2WVUA 1GPFA 1W1TA 1PPIA 2JEQA 2QF8A 4ZFMA 3AIQA 5I78A 5D9NA 2CBIA 5I0DA 2V38A 3A6OA 3O2LA 2EQDA 3H53A 1GOIA 4CUCA 1KGUA 1W2VA 2QHAA 1BGGA 1GOKA 1NOUA 3W82A 3AIWA 4X0VA 2PB1A 3VD5A 1SZNA 2D22A 2ZUMA 3WFZA 3EJTA 3EJSA 2DT1A 4MAVA 1KR0A 1KXHA 4PMZA 5BXSA 2WHKA 4M56A 4CVWA 2WMJA 1BYCA 1AQHA 4WKHA 4MDOA 4NF7A 1B3XA 1H5VA 1ITCA 3IJ8A 1PIGA 4IUGA 3BAIA 3MSGA 3AMGA 1JI2A 2J8FA 4YN5A 1CPUA 3UETA 4JFWA 2CBUA 3VX0A 1E6PA 1UR9A 1W3KA 3W26A 1JF5A 3LRLA 1US2A 1RP8A 3L4XA 4DUWA 1UA7A 1C92A 4GZEA 5BROA 2CETA 4AMXA 1QHOA 1PX8A 1JGIA 3FNDA 5CLWA 4Z2HA 2EO7A 2ZXQA 1WCGA 3EBVA 2GSJA 2G3JA 4MNJA 3CZLA 3NCOA 3NUKA 4W8AA 4UOZA 4ACYA 2GJPA 5D9PA 1KWGA 1BYDA 1Y7VA 3MUIA 5I79A 1BVZA 3E1F1 3BH4A 3NIYA 2GK1A 2X2IA 3AIVA 4FNQA 4AYSA 1WPCA 3DX0A 3D52A 4KMQA 2WVSA 1MVYA 1C7SA 4LXFA 5IHSA 3VIOA 2ZXDA 1EO5A 3UCQA 4FLQA 4A3HA 3NYDA 2ZX9A 3F5KA 4GQQA 3VIJA 4D1IA 1CNVA 2ZX7A 2VR4A 3CTTA 1UR2A 1FH8A 3T0DA 1QPKA 3GNPA 3PTKA 2V3FA 1WZMA 4UQBA 3BCDA 1W1PA 4PRWA 3WH8A 1H11A 1V3HA 2XJ7A 1GVIA 1CLVA 2PBOA 2BFGA 3MI6A 2D3NA 1TR1A 1XSKA 1JZ5A 1OIMA 5LA0A 3OLGA 3IAPA 2F7OA 1C7TA 2C0HA 3AIRA 5IHRA 1HJQA 4CVUA 3CHFA 3AHYA 4AD0A 3AIBA 4D6GA 3O6AA 1Q6DA 1VF8A 1X6LA 4RL3A 3CH9A 3T2PA 3LMYA 2MANA 3N04A 3KEHA 4FNRA 5KZ6A 3VIKA 2DSKA 4UCFA 2DT2A 4KRUA 1FHDA 5HPCA 4IISA 2YA1A 3ZT5A 5CXPA 6A3HA 1KCLA 2OWWA 1E0XA 1V3KA 4P8VA 4OZOA 2VCAA 3VGHA 4JKMA 4TXEA 1BGAA 6CGTA 4UZUA 5A95A 3QR3A 1B30A 3OIHA 4PMYA 4ATWA 3SCQA 3L4UA 5HDRA 4ZEPA 2VZSA 4P7RA 4M8UA 3VSVA 4P8UA 3AIEA 3WNPA 1T0OA 2XFRA 3SEPA 3BGAA 3BSHA 1WDSA 5A8OA 3PHAA 1M53A 1XSJA 2WLYA 2NW0A 2Q8XA 4UFKA 1OGGA 3AHZA 4AD4A 2YFNA 5DT5A 4NX0A 4PUEA 4Z2LA 4WK9A 3UERA 1CWYA 1E6RA 2J77A 3JUGA 4NRRA 1E72M 3WN6A 3MMWA 4AD5A 2WAGA 5A8NA 1TCMA 4ATDA 1DHKA 1JD7A 3VNYA 2XSBA 4MDPA 4AZBA 1AQ0A 1HTYA 2WSPA 1MXDA 3N17A 2E9BA 1SFSA 2J4GA 2ALWA 2XFFA 4HOWA 3TP4A 1N82A 3MMDA 1JYVA 4W87A 2DT3A 1IT0A 3GTNA 2YDQA 3AI0A 1NM9A 4M29A 3GXNA 3ZSTA 2XM2A 4PSRA 2XVGA 3W37A 4HMDA 2VZTA 3W81A 3VMOA 4JHZA 3W6MA 3AMCA 1ESWA 2D23A 2WBGA 1CTNA 2CBJA 2DSUA 4W93A 2PF0A 4JZ5A 4ZE4A 2W92A 1M01A 4FLRA 1L0PA 1XHGA 3PZNA 3KL5A 2D1ZA 1W9UA 3W53A 1IV8A 1E1EA 3AIUA 3BVTA 3EJRA 1MFUA 1QNOA 3HU7A 1WDPA 1JDDA 2D0HA 1C91A 1G5AA 3DC0A 2GDVA 1W9DM 3KL0A 1J12A 4P7NA 3VDCA 2X8RA 2O9RA 1EIBA 2OYMA 4U2ZA 4FNSA 2B31A 2BHZA 1AVAA 1FP9A 4F66A 2E8ZA 3VD7A 4EANA 3CIVA 3OBAA 1QI5A 4PMQA 4D6FA 1R34A 1FFRA 3IGUA 2J75A 4AIOA 1QW9A 3LPOA 2CHOA 1GONA 2PC8A 2GK1B 1KCKA 3SCWA 2PI6A 2ZWZA 3WH5A 3GBEA 3U5UA 3L4ZA 4C7DA 7TAAA 3GH5A 4U5KA 3PBGA 2YDSA 2W5FA 1Q6CA 3HMCA 4D6CA 3AS0A 1R85A 3WF1A 1EXPA 2NT1A 1H3GA 1O6IA 4HPHA 1XD0A 4JKKA 4EE9A 1QNPA 1V02E 1WE5A 4PN2A 4HZ6A 1L8NA 4DWSB 1ECEA 1GNXA 3SCNA 4LYQA 3EDKA 3ZR5A 3D3AA 2QMJA 5IDIA 1E3XA 1XH0A 4CD7A 3I3DA 5I2UA 2ZXAA 1UOKA 8A3HA 4FNTA 2XSAA 1JG9A 4PYSA 7CGTA 5D4YA 2RGMA 3WY1A 3AZRA 4UFLA 3DX2A 3GH7A 1KFWA 1MYRA 1ISVA 5FOOA 2EACA 5FIPA 2ZOXA 3AQUA 3WQVA 4AZ7A 3QHMA 2GJRA 4DWSC 3DHPA 4HOZA 1BHGA 2QMKA 1OD8A 2VZVA 2Y8KA 1HJVA 4AIEA 3VINA 3M7SA 1R86A 5AC4A 1VBUA 1UHVA 3MANA 3L4VA 4PCTA 1IZJA 4JFUA 4DO6A 3WD3A 3NDYA 3KLLA 2WWDA 4GQRA 1E71M 1NP2A 1C8XA 4A4AA 3N1AA 4E8DA 3B8SA 1OCQA 1WB0A 2VX5A 5ECUA 2F18A 1VIWA 1EQPA 2UY4A 3VX1A 1UWUA 4AZGA 1J11A 4M82A 3LX9A 1R33A 3OLEA 2QV4A 4NSBA 4W88A 3EDFA 2FYVA 3T2OA 1E15A 2WLZA 4AMWA 4W7WA 2DPEA 1WDRA 1OGBA 5HBFA 1C8QA 4CU7A 3N9KA 3PZGA 2VVSA 2GDUA 1BG4A 1VEPA 3A47A 2WHMA 3CMJA 3BUIA 4AISA 5A94A 3QGVA 3THCA 1SMAA 5ABFA 2DGAA 5E0CA 3VIPA 5EB8A 2OWXA 3EMCA 3AZSA 2VO5A 5GQBA 4BF7A 2ZUUA 3N13A 3NDZA 3F4VA 1HNYA 4U5IA 1J0ZA 2XTKA 1UD4A 4OKDA 3BVUA 4PTMA 3WIJA 4BA0A 4AZCA 1V3IA 2W61A 3RJXA 1TFVA 4GKLA 5I23A 1JF6A 4Z2GA 3N15A 1MW1A 1UZ1A 2WCAA 3WNMA 4F79A 4P8XA 2VURA 1JZ3A 1XCWA 3NSXA 5DT7A 2F2HA 2J62A 3VDHA 3PZMA 1D7FA 3H54A 2YL6A 4YHEA 5D9OA 3NSMA 2ZXBA 3BVXA 1B3YA 2DH2A 2WCSA 1NWUA 2XWEA 1UR0A 5JBFA 1HVXA 1MW2A 4JCMA 3SUUA 5GPRA 1UD8A 3VMPA 3RJYA 1DWAM 1FH7A 2BY1A 2E0PA 3SURA 1W2PA 2AAAA 4IPNB 4MB1A 2E3ZA 2VVNA 4L4PA 4NXSA 3HG4A 3ZMRA 4UQ9A 1EOMA 1UR1A 2J7HA 3BXWA 2OWCA 3OLIA 3J7HA 2BVYA 5CQ1A 1HP5A 3AHXA 4F9DA 1E43A 5IFPA 3T2QA 4OIFA 1XYZA 2IUZA 3POHA 5E9AA 3DYPA 2ZUSA 1EDQA 1UWSA 1DWIM 4JHOA 3FHQA 1M03A 2DDXA 3GNRA 5FL1A 2CERA 2CEQA 1W32A 4L4OA 1X1NA 1B3WA 1JYWA 2YLLA 4OOZA 4NZCA 1KBBA 2CNCA 1LQ0A 1BLIA 3BMWA 3MUZ1 3ARZA 3CLWA 4J28A 3WDIA 4M80A 3I3BA 1VRXA 4J3XA 3K46A 3NJ3A 1JDCA 3POCA 2XN1A 1UG6A 3BUPA 4PMVA 3S2CA 4W85A 2G8ZA 4PMDA 2EXOA 3TV8A 1HKJA 1WAWA 3KZSA 4UQEA 4EKJA 1SMDA 2J79A 4DO5A 3ARVA 1QI0A 4MJ2A 2VI0A 1O7DC 2F61A 3K8KA 1BG9A 1E4NA 3VOCA 1CGYA 4XB3A 5BCAA 3WY4A 4QDMA 1BF2A 3ZT7A 4JFVA 2DSZA 2UY5A 2VX4A 1XV8A 4OBSA 3SUVA 4XZWA 3BUBA 3HJEA 1W3LA 3RM8A 3WBEA 2VT0A 4R5EA 5CJ5A 4GI8A 2EEXA 2OSWA 4WJXA 1PAMA 4N42A 2CHNA 3DX1A 1ZJBA 5AYIA 4RE3A 2F8QA 1GORA 5E70A 4GIAA 3AROA 5A2CA 4CCEA 4NI3A 1Q6FA 3APGA 1E6XM 2WVTA 1W1VA 4J27A 1BPLB 1ISYA 1K9TA 1UR4A 1XC6A 1KB3A 1WO2A 4HMCA 3UG4A 1JD9A 4H41A 1QVBA 1GJUA 1R87A 5KEZA 3AXXA 4ZXOA 2OLHA 5A8QA 1UD2A 3SUSA 1HJXA 4XV0A 4TX6A 5A69A 1J0KA 5CG0A 1HWWA 3WNNA 1D2KA 4PCSA 3WY2A 2VMFA 2UY3A 2YDRA 3SCOA 2DSWA 5CZKA 5E6ZA 1W3JA 4E2OA 1WNOA 4AZHA 4D6JA 4CU6A 4FMVA 3WNOA 2D2OA 4W7VA 1K9EA 1EA9C 1ZBWA 3S6TA 2XN0A 4CD5A 2PWDA 4TVUA 4D72A 3AMDA 4PMOA 4MADA 2D20A 3W25A 1R47A 1GVYA 3LPGA 3BLPX 1S46A 3SCPA 4UFMA 1CDGA 3BCFA 5ABFB 2DIJA 2WANA 4UOQA 4OUEA 3WDHA 3VGBA 1NWTA 1VEOA 4M24A 2D0GA 2WZEA 4OGZA 2CXGA 1E6SM 1CXHA 3ARPA 1H1NA 2F1BA 3AYRA 4LX4A 3GXFA 2CESA 1XSIA 2A3AA 1B0IA 4AZCB 2YFOA 1CGTA 1CBGA 1V3LA 1IZKA 3VD9A 4CD8A 1JXKA 4AD1A 4FLSA 3WQ6A 2GFTA 1GQKA 5EBAA 4J3VA 1XRVA 3TONA 3OG2A 3CUFA 3PTQA 4J3TA 4PTWA 3AS3A 3ZM8A 3CUGA 2QLYA 3QHOA 3T09A 3TTQA 1JZ2A 3MV11 5A6SA 1UH3A 3RM4A 3T08A 1XGZA 3VILA 4ZXLA 4LPCA 5BXRA 2BVDA 5LA1A 2Z1KA 2BVTA 2XN2A 1CGXA 3IK2A 5EFFA 2XG9A 4UFJA 1TMQA 4FF5A 2WNWA 4GI9A 2VR5A 1RPKA 2VCCA 1NP0A 4S3KA 3D4ZA 1ZJAA 3VGGA 2FDMA 3AISA 5JIWA 1KR1A 5E6YA 3F5JA 4CU8A 1ODZA 2NT0A 3GDBA 1BSIA 2BY0A 1VENA 1W3HA 3SCVA 3TTOA 4AD2A 5E1QA 1TVNA 2BHUA 3EDJA 1XD1A 1HVQA 4GZJA 2WC3A 1M04A 3WUGA 5CPSA 3TTSA 3WUFA 1NWSA 3PZVA 2XHYA 4UTFA 1TQSA 2DEPA 3G6LA 3ZIZA 4UQCA 3VIFA 2EPNA 1J0YA 1UKQA 5BYWA 2FHBA 4F8XA 3L4TA 5DO8A 3CC1A 4X0NA 4D6EA 4GINA 3UR7A 3CZNA 1VFUA 1E6QM 4UR9A 4WKAA 4H2CA 4OOUA 3ZJ8A 4MB4A
chains in the Genus database with same CATH superfamily
1T1ZB 4HHPA 5D71L 2JKNA 4QF1A 5CBAB 2W67A 4WX2A 4GH7B 2FNBA 2IIJA 2A0LC 1YA5A 2GSEA 2Q20A 3D39A 2WMFA 4RNFA 5T5FL 1DQDL 3S48A 5EO0B 2HS8A 1VRDA 3DOHA 1VFOA 2BP3A 1CIUA 3QZOA 1U8JB 3RIFK 5KVMC 2DZEA 2DLFH 5L2KB 3WCZA 2Q7YB 5EOTB 2P8BA 2ZT9C 1I8UA 3OMIB 3ETBF 4CMMA 4M6NH 1OG0A 3V7AG 3PZOA 3E9UA 3ULUF 2OEMA 4FF9A 1JRCA 4AQ8C 1HHIB 5HDBB 1AS8A 3K2GA 3ZLQC 3GF8A 1ACCA 3N73A 5ABGA 1KFBA 5JBDA 3OGRA 5BXTA 1ND0B 3CQ0A 1M7XA 2BJMH 1C1EL 4XXCA 5C8BB 2HG0A 4G83A 3GQFA 3ZKMD 3UG8A 4S3CA 1AFSA 3GSQB 3G6DL 9RUBA 1QFEA 4WDXA 4X9HA 2FJFA 5BVJB 3RTQD 5AZ2H 2J9ZA 4Q8OA 2OYLA 5CGYD 3GZQA 3PWJB 4Q58C 4WWOA 2FKPA 2N7SA 5D2LA 3DXAB 3A21A 1OFBA 3HLAB 3IIPA 4IJBA 4R7LA 1OKEA 1R2RA 2AV7B 1QK2A 3IDJB 3NQKA 4AX6A 2ZYFA 2VXVL 3TNBA 2VWEE 5GSRA 2G37A 4OCNC 4YSPA 4PBGA 4OLWH 1FCQA 5ABEA 5FIEA 1NOFA 3Q5TA 5AW5B 3UIYA 2D24A 3WMQA 2E09A 5KSAA 3AADB 4XCNA 4N4PA 2MPVA 3UJJL 1T5XB 4NQTA 4LNRA 1H6UA 1QHPA 4NNPL 2N01B 2ONEA 2J7FA 5IXEA 5LGZA 2O6EA 1U95B 1MY5A 3BI9X 3GYRA 4R2GC 3G0SA 2OA9A 3O9WA 3UBGA 2DU2A 4YDLB 1D2PA 3G1RA 1BWLA 3N11A 4LAMA 3W9EA 1JULA 1XIWA 3VRJA 3I2CH 3NQCA 4G7VH 1CS6A 4WCYH 1GYWA 4KW2A 5DUJA 5CJOH 1I8IA 2BS71 3WFBH 4JR5A 1R46A 1UWTA 2PAJA 4IRZL 4XNMA 1OSYA 2JELL 1IO4C 4CNIB 3SYCA 1FWAC 1SF5A 3F6JA 4X5QA 1AQMA 2GQ3A 3EB2A 3N9GL 2E6QA 3GBDA 3Q9QA 2XQYA 1QI4A 4PSPA 2D03H 1LO0L 2XUCA 2YLHA 3TWYA 3P5ZA 3X17A 1T83C 1PCXA 2ZF9A 5EZIH 3FT3B 5D7JD 2AL1A 1W5OA 3MJ8B 1XBRA 4CMHB 4Z1CA 2O56A 5GRUL 2A7NA 1KPUB 3B8TA 4XUGA 3B9AA 5H37A 5JHAA 4JTKA 2AJYL 4XO8A 2JFEX 2WXDM 2QVTA 3BDYH 3HC2A 3N43F 5IB1A 5ICYA 2A7PA 2OMBA 2CLZA 1AG1O 3UADA 1JPEA 1A21A 3SSGA 3ITVA 4ACZA 3IJYB 5D32A 3AJXA 4ES9A 3A24A 2R14A 4I8DA 1DVFB 5BRPA 4HX1B 4IK6A 4TLTA 1QRNB 3ZE1F 3MNVB 2ACUA 1E0WA 1UVQA 1RL1A 5IKCA 3D46A 1KQYA 2DBLL 1LQ2A 4TMBA 2Y61A 3O4LE 1NGXB 1XS2A 2IPTH 4MMZA 3UCRA 3RAJH 4YIQB 1CYGA 4LP4A 3TEUA 5C9WA 4Z7UA 4EXQA 1FGNH 1GPOH 2I27N 2HFEB 4OIIL 3NSNA 5EHFA 5D6CA 4DKEH 4ZB5A 2A9BA 3NM3A 4EVNA 3BKJH 2PWUA 3VXSD 2QIIA 3DKLA 2HRLA 4KIRA 3GYCA 2VL4A 3RHWK 1ZQ5A 3HQOA 1I9RL 1UD5A 3U4AA 3L16A 3DG6A 5FECA 5FYKH 3T3MF 3MA7A 4L9LC 4AEFA 3FT9A 2XN9A 1OP9A 3N1FC 4UQ2B 1X97A 4Y4KB 3HR5A 5AKVA 4K1WA 4YMZA 1W72B 5I26A 3UG3A 1GCYA 5LWYH 3S36H 5T1JA 1K6AA 3WO4B 2EGZA 3D6GA 4JG9A 3D6NA 3CASA 2OZNA 2BVPA 3FW6A 2XZAL 4UIOA 2F7PA 3BAWA 3PNZA 4WSKA 5AVYB 3Q06A 4D0CB 2KI6A 5IRPA 4B3KA 3GVGA 1JGDA 4M6ML 4IPIA 4WFHD 1Q0EA 2HTKD 4DWSD 3VFTB 4IJ3C 1YECH 2QS8A 1Q9LA 3UTQB 2ENSA 1I8MB 1TUPA 3VUSA 3IGSA 4GG8A 2FZ9A 5HULA 2LFEA 4AZ5A 3BYYA 4JO1H 1UZ4A 2VRQA 4UTBL 3ITCA 1AZRA 4NAJA 1UACL 1KT2B 4OBRA 2P8LA 1JZ7A 4IIQC 4BKSC 1R75A 2E28A 1UJQA 2MNUA 2FT6A 2Y36H 4RGOL 1EH9A 1CL7I 1YY8B 3SZ8A 4NKOA 2B1HL 5HINA 3TO4B 5FJTA 3QUXD 2OMNA 3QRBA 1ONQA 3WJJA 5EZLB 1U8IA 1ES0B 1V6WA 3QDJB 1IC4H 4BK5A 2YEVB 5F9JA 1ETA1 4DQOH 2YJQA 4JAMB 5I8EA 4GH1A 1MW0A 3IPWA 2P53A 5JQIB 1RIUH 1Q1JH 4B9ZA 2ERJC 5DRWB 3GMOB 2EXYC 1BF6A 2WQUA 3B9KD 5I66B 1VB9A 2WOYA 3WJMB 2K1MA 4Q8MA 1S2AA 4B16A 3SSZA 4P2QA 3KVKA 1EFXD 4H8QA 3M6YA 1KGJA 3SZKC 3C5SB 2YSSB 2OMTB 4Z7WF 3W24A 1W8NA 4PWKA 1IBGH 1PKMA 4P2CG 3BGGA 3GO2A 5IVXA 1ZGLM 4HGKC 4ZUUA 5FC9A 3IACA 4JGMA 2GWNA 5LIXX 1ZHNB 4FYQA 3QBUA 2DWDB 2ZX8A 1WEJL 5JXAL 3TMQA 2EVJA 5FHAH 3QUMB 5EU4B 4R4NC 4GO8A 1XPYA 3Q44A 1CGVA 3BL3A 3LTPA 3NA4A 1GAFL 3RNKA 4W9ZA 3T05A 1EOKA 3MRBB 1PHWA 4ZAKA 3RMJA 3EDEA 5C07B 3A67L 1ML0A 3BAXA 3GS6A 1ZT4B 3ZTNH 5KETA 2X0UA 2DEWX 5CP3H 3L54A 1MRFH 2CO3A 4S3EA 2C3VA 3QPKA 5B38G 1B5TA 1H6TA 4WTWA 3EO0A 5BZDB 3LNHA 1JGUH 2HXUA 4OW6A 3STLA 4ZMNA 4WWKA 3N91A 3KG5A 4X4ME 2AXJA 3BJSA 3PTMA 1CR9H 3G04B 2VLJB 4J3OD 4QRAA 1ZLPA 3AICA 3ANYA 3GTHA 3LQMA 4L8DB 1T66D 4M9PA 1SM3L 3IFNL 2J7CA 2BLEA 4NRSA 4NKDB 5EZJB 1KIPB 3B1TA 4YHIA 5GS1C 4TUFA 4QRBA 1A7QH 5T3XL 4TLSA 3WFAA 3TT3H 3ETTA 4DM2A 3D4YA 1LT8A 5C5YA 1GMIA 4R6UA 4C6NA 1R3TA 5AKTA 3DECA 4MD4B 4HIXL 1G7IB 4PJAE 5G5DA 4ZXBD 2R9HC 1HE8A 2D31B 1KGYE 2FVMA 5F3BB 2BWIA 1F1DA 4UDUA 1HCVA 5LHDA 5FO8A 3HZ3A 1TE6A 2JI1A 4FOJA 1W0WB 2KZWA 1KFJA 3PANA 1N5AA 4WLCA 4JG0H 3O4LD 3KCOA 4G8FA 3MRRA 1BZ7A 1AD1A 1PFCA 4OFKA 5CKAA 5F7MC 2FCBA 5CLXA 4YPGA 1UQSB 3U1SH 3ZJ7A 3OP2A 5EU3B 1BZDA 3MOAH 2VSCA 1OC5A 4KK9D 5J1AA 3TFKD 1Q4NX 3WF2A 5I6NA 3FBQA 4UTAA 4WW1B 2Q86A 4QRQA 2BOCB 2R8WA 3VIMA 5EBUA 5F7LB 1YY9C 4AVIA 1OALA 4PCFA 5EZOH 2OKMA 3K30A 5I78A 5GGTL 3OHIA 5FYKE 2R23B 2NSQA 5C7XH 5IJBC 4O51B 3KP0A 2VKWA 1L9PA 4IU2A 1SFTA 1E9PA 3AIWA 3L21A 1XGYL 4HKXA 1BWWA 1HH6A 5D1QB 3OBEA 1S7UA 3MA9L 4KTEH 4APQD 2QSTA 4IGMA 3MRFA 4LZKA 1OSPL 3CS2A 5LCVL 4B2DA 4J6RH 4XNXL 4YN5A 4OM1L 4AEHL 3VX0A 1W3KA 4IOTA 2IGFL 2R7EB 4PGJA 3MRDA 1CL7H 5CLWA 4ZW6A 1NBYB 3TZVB 3LZRA 1A3LL 4WHDA 2V8ZA 4ENED 2PTVA 2C26A 2P24B 1WAUA 3FCGA 4JFZH 2JKPA 3KR3H 3FUFA 3RI5K 5SX5H 2FJHA 2DL9A 4NDMB 3ZDXF 5HHOB 2DJXA 2DV6A 4IBQA 1JZIA 4PH8A 3FRUA 1E0UA 2Q3OA 1AGFA 3RP1A 5JYMA 4GQQA 5BUAA 2VLKB 3GB6A 1UB5B 4Y5XA 2PDWA 3FOLA 3CN0A 2BSLA 4UV7L 12E8H 5D1ZC 7XIMA 1FNEA 2P4AB 4OLXL 5LA0A 3OJDB 4PW4A 4K2UH 1JXFA 2FSEA 2X6BA 4NAEB 3KGTA 3EZJB 3ZPDA 4P2YA 4JZJA 4F8QA 4QDPA 5AW4B 4HZLB 1DO5A 1KCUL 2FATH 3QWRD 3C4UA 4O10A 1BBJA 3W9DB 1WBXA 2QT3A 2O72A 4FXGA 1QFWL 4NCC2 4D0BB 4OCSH 1AQ8A 3TCSA 2NNCA 2AJSH 1FCGA 2VDGA 4PJDF 1B30A 2ICEB 3GDTA 5BQDA 1YKWA 2VDLL 3WNPA 3QP3A 3O6DA 3SEPA 3TEVA 2H8XA 2AK4B 4K7PY 4Y9GA 1TQCC 4Y2OA 1KEMH 2Q8XA 4ZW3A 2XA8H 2OO0A 2GAZA 3J2PA 1MWAA 1NVMA 1L7TH 3SO5A 1WOBA 3W76A 3ENEA 2YXFA 3FTVA 3I6RA 1JP5A 1AQ0A 4O4YL 1HTYA 4IRSC 3JYCA 4KQ3L 5IHWA 3TP4A 1I3GH 3ZYOA 5JR1L 2K9FB 3TC7A 1EEZA 4DKFH 3GO1H 2Z34A 4QWWC 5CN2A 1ZLSH 3WBXA 1ZNNA 3MYJB 5EPMB 1H6EA 4MM1A 4I2XA 4PN6A 4HWEH 4IEFB 4PSRA 4AQ1A 2HJPA 2QJDA 1XO8A 4WXZA 2GGEA 3SDDC 1W9UA 2IANB 1NFIA 3IK4A 3LV3B 1W80A 2D0HA 2J8UF 2FWSA 5DD1L 3MO1A 1PWMA 2OYMA 3L5MA 4MWFB 3JWNC 4HSCX 2Q8BL 3BZEB 1U6AH 3C0LA 4LC6A 4EANA 4L8CA 2BP0B 1KLFB 4ZT1A 5DXXA 3SCWA 1IBHA 2FEDC 4P4KC 2EKSB 4PUNA 2W8CA 5FEPA 2R8SL 4Y8DC 2OTDA 3SBWA 5I19L 4N2NA 1SXAA 5DZVA 4HZ6A 3VAEA 2AQRA 1BXNA 1OARL 3DV6B 4KKBC 3D3AA 4NZ4A 4CD7A 3PJLA 1X3DA 2K4WA 1MYRA 1ISVA 4IKNA 1LK3L 4NQDA 3PY2A 3C5ZD 3OSKA 1DCLA 4Z6AT 5HJXA 4FFVC 3RDTB 4ONFH 5AC4A 1N55A 3BURA 3P4OB 3UVAA 4A2FA 4JFUA 4R2GB 1QEXA 3US9A 1LHZA 4C57C 1S9XB 3OLEA 1FO0L 3LKNA 1D5XB 1C8QA 4XCFL 2QUVA 2JCCA 1N3NA 5GJPA 3S88L 2VN4A 3X13A 4UU9B 2OP4H 2QADC 2RH0A 1BKSA 5E00B 2NYYC 4Y9CA 3BVNA 1Q72H 3EHBD 3GFXA 3QUZA 4JFEB 5T1LB 2OJPA 3EYFA 4GKLA 1KYUA 2DQJH 4IRJA 1BQGA 1LDSA 1XISA 1JNNL 1UWEL 2HJKA 3EAUA 4V1XA 1UR0A 4ETQB 4K94L 1J1OL 1KW1A 4A38A 4JR9H 2GOKA 4PJIB 3HUJB 4GC3A 4DRSA 4NXSA 5FYKD 4KJWD 4CNNA 1DBAL 4YXGA 3J7HA 2R27A 3OXRA 1M1XA 2R1YB 4RA0C 2OMZB 1MNSA 1TJ0A 1GS6X 2AEPL 3K4ZA 1DWIM 3ZVHB 2K9UA 1L7IH 4OFDA 2EIMB 1Q63A 2FGBA 1KFEA 4J3XA 2HRWA 1X44A 3GSOB 4BJLA 1FTXA 1IWBA 1A1OA 2J8HA 4LU0A 2BNRB 3P73B 5K7JA 5BJTB 1DBBL 4QNWA 5CGBA 2ADGB 1J79A 3PHOB 1Z3NA 1LE5A 4LUJA 4JY5L 4QDMA 2GVLA 4KXAA 3EWZA 4H9YA 1BRLB 3TJ4A 5E6IC 2ZRYA 3ARBD 3EG9A 4KXZH 2Z4QA 3C3UA 3MHGA 5F1VA 4CVXA 3IF1A 3VXGA 1NTDA 3GSMA 1HJXA 1EHKB 4WSGA 4DGYH 1O5PA 4FP8H 2Y3NA 3L5XH 5DMIL 3WV0A 3O8XA 3WNOA 1UBSA 2XIOA 1BQKA 3N25A 5FF7A 2UXTA 5EA9A 4P2RE 3HAEA 5EL1A 5D2LF 2ISSA 1K7FA 4UOQA 3DK2A 1Z1WA 5EIIG 3VU1A 2CXGA 1WCBB 1SXCA 2FEEL 3AYRA 3GXFA 5K1VA 1CIDA 4YE4H 3FB5A 5ITFA 1R3YA 4DZBB 3CMOH 4B5XA 2UWEE 2PS2A 2X5PA 2VEGA 3SCMD 3ABMB 4AIZA 3CUFA 4MKTA 1ENUA 4PV1C 3ZM8A 5CEYB 2PDMA 3LM7A 4A2RA 3EBAA 3EADA 3RM4A 1HINH 5CBBA 4P8QA 1CGXA 4IJ3B 2P7TA 1RFDH 4FF5A 1UJ3A 2VR5A 4YL9A 3RVWC 3QYMA 2AL2B 2WZ0A 5I3KA 4XOBA 3ATAA 5J5DA 2NXGA 3PQYB 1WUNT 2A1WL 4N0CC 3GR7A 3TBWA 5L8LB 1N8ZA 2Z2BA 3TTSA 2G2RB 5D9SB 1UPMB 3G6LA 1S7XB 2NZIA 2EPNA 4Z3TA 4JO8A 1H3UA 4KK5C 3MNDA 2G75A 5L9DL 4Q9BA 4EF8A 1FDYA 2NXZD 1IFGA 4MCYA 4J5VA 4LHQB 5T91A 2DQDH 4IF2A 1RR2A 4N2MA 1NGWB 4OAWA 1UA6H 1WA1X 1YHTA 2B59A 1LLWA 1ADQL 3B1UA 2IS7A 1CENA 2PGRA 1QBLL 1R3JA 4QR6A 4UQDA 3S3BB 3N3EA 2GJ6B 1H0GA 1PZ0A 1PS3A 2EIDA 3CWNA 1GHFL 4HIHB 3V4BA 3BD4A 3VXUB 3BAEH 1KGXA 2ERJB 3ECQA 4N3UA 4L5ZA 1ZXKA 4EZMA 4UMSA 3BKCH 2WTRA 4R84A 4HHAB 1ZHLA 1BQHA 1LO4L 1YO4A 5B3SB 2ZVRA 4WRLA 3MRNA 5SWSE 5E51A 5XIAA 2VDLB 2JXMA 3QORD 2FWOB 3N42F 4XMPL 4YDZA 7A3HA 4XN8A 4ZSTA 3R94A 1FV1B 5KVGH 3IWPA 3H70A 1GSKA 2VWSA 5F1IA 4KV5E 3CDZA 5C0FB 3EH2A 4KKZA 4GIRA 4U1HB 4WHTB 2A3CA 1DQML 5CKGA 2CZVA 3GB7A 3NRFA 1W5MA 5A16A 1EHAA 3HG0A 2I9TA 3APDA 3WNIA 5K39B 1FYHB 4P5KB 2Y2TA 3GWJA 3C56A 4XO5A 4NCDA 3CFJA 3IKKA 5IWLC 3M0VA 1NC2B 3UJ2A 2OTPA 1MUWA 4KX9A 5AC5A 5AZUA 2GHWB 4OQVA 3L0NA 1AO7E 2CHDA 4Z7UF 1UM5L 4FZEH 2PP8A 1CGSH 1Q7MA 1S7SB 3OB0K 2QQNL 2HK1A 3X3GH 1JGMA 4UT9L 1JERA 4GGHA 1JAEA 2RJGA 1P5UA 3DWTA 4QLJA 5GRJH 2UXFA 4X6BA 5GGSY 1GZQB 1D5IH 3CHCA 2Z92A 1ICQA 2X70B 4DJMA 3WH7A 4L8BA 4QTIL 5FJPA 4XPTH 2Z27A 1BQSA 1T80A 4H8VA 2VRJA 3KLKA 3RY6A 2EKJA 4NO3A 2VDPH 3LH9A 5I07A 3H9HB 1IGJA 1PFOA 4R9HA 2X1IA 2ITCA 1P4IH 2RJMA 1IKFL 2LE9A 1JEZA 4LASH 3LLFA 4V28A 3DJRA 2CJ3A 2X41A 3VFUA 5G1YA 1US3A 4YDLC 4MTVA 4WZHA 1F76A 5KZMA 1KBWA 1SBSH 1YBQB 3SCRA 4QRPB 1LLAA 3RE0A 2JB5H 3IWVA 4KUCD 4ZS7L 5JVLA 5F9DC 3B2XA 1QBML 1ZXQA 3TQVA 2B4CC 3UGUA 5IVZB 4LNYA 3ARFB 2C7UB 1XWYA 3F84A 3CUXA 1P7QD 1Q1PA 5DK0B 5IV2B 2IKGA 4RMWA 1TTUA 9PCYA 5D96C 2X4RA 1KM1A 1E4XH 1B6UA 4YHOL 1OQOA 2BCMA 1NMAH 2YD8A 5E2VH 4RWHA 4Y19E 4APXA 5GGUA 3BDKA 1INQA 4NNYA 4D9RE 4DNLA 2FIKA 3EEZA 1O1ZA 3TC9A 2Y1ZA 5IESH 5I74B 5JU6A 2WLKA 4PTTA 2YKKA 3KDMB 1JCTA 3CUPB 3KE0A 4JQVC 2BWGA 4LLAA 5A6JA 4G43B 4P2RD 1ONXA 4MCMA 1QWKA 4OJCA 2XBTA 1KM0A 2AANA 3B05A 4E8CA 4YHNA 1EFQA 2J88H 2IG2H 1YZZA 2BP5M 4QFUA 1JPMA 3TBTB 4Y4FB 1KJ3L 1OD7A 4N6FA 1FP8A 4WGXA 5J12B 5I3DA 3LNGA 1T5AA 4N2FA 2QSVA 1DVFC 4GAYA 2YRBA 4BFIB 4K9EC 3ARXA 3PFUA 3BUYA 3WD0A 3GDRA 4OFPA 3OB8A 1QSFE 1ZANH 4TVSa 5JLZB 2HEJA 2E40A 5KN5A 1IAIM 2WWCA 3KRBA 4W89A 1SJVA 2DL2A 3HGSA 2H6OA 4GAGL 4I7ZC 3UPCA 3SQBB 3TN0B 5DQ9B 4XQ6A 4M6AA 1H3TA 2O6CA 5C3TA 3FCTB 1D6EA 1RZIA 2ZZ2A 2QVFB 2K4AA 1NCIA 2WXOA 1CFTB 1H51A 4G9FB 2A85A 3WQWA 1TQTA 4H9UA 4ENZA 3A13A 2XJKA 4W70A 4GS7B 3ZT6A 3S37L 4LL9A 4CNSA 2FO8A 3QWOB 4PHZA 5C6TH 2O26U 3L4CA 4A67A 1XIIA 3SDAA 4FAMA 4IKKA 5D9MA 4UB0L 4N85A 3GS7A 1RURL 2BZCA 1EPVA 1JTTA 5IMKB 3CFBB 1I1WA 3OKMA 2Q02A 1TITA 5I6PA 4I48A 4PIBA 3OGOE 1D5MA 5GVJA 2QPUA 3UAJD 4DBDA 2D0FA 4JZOB 1S9VB 3PBVA 2RAGA 4MRCA 3BOFA 5E5MB 3WNKA 2WJEA 3DBNA 4Z2JA 5AYXA 1TV3A 2YCEA 2DIEA 1KBJA 5L2JB 1IFRA 2WOQA 5SWSD 5DQJA 1OQXA 1V08A 3FULA 5J9PB 4K23H 2GI0A 2OU4A 3G3DA 4OJFH 1HDMB 2YPVH 3GX9A 2HMIC 4DM1A 4MBOA 3VFGH 4LHUB 3C2RA 1GTEA 3QNXA 5KJRL 5FUZH 4B41A 5DR5H 1BZEA 3FO0H 1IEVA 4NJ9H 5DA0B 4S1RL 5ACZA 2JKSA 4OVVA 5GGRB 3SDDB 2GUOA 3RIFF 3CK5A 3BFWA 3QQ3A 1WUZA 4QRFA 4N87A 4DGIH 5C0BE 3TO4C 2QDWA 3STFA 3TSMA 3ZFHA 4Q8BA 1RIVH 5DRCA 4KKCC 4JKLA 4KK8C 4PRAA 1ZHBB 2Y88A 5DBUA 4P23A 2Z6FA 3F5LA 1R9FA 2R29A 2WSDA 1RALA 1AO7D 3COOA 1TX0A 3W01A 3VFMA 2C4XA 1ZSXA 1SOQA 3GNDA 1N0LB 3IDMB 1L3NA 3ZO9A 5D7LA 2CITA 2YBVA 3EJZD 3WJLA 5JXEA 3QG7H 1KV3A 3C75A 2GKIA 2R1LA 5LGJA 5A3IC 2QCCA 3APCA 1TOXA 5LG6A 5G2NA 4M81A 2HT4D 3G6AA 5FL0A 6PTDA 3LXCA 5FWQA 1FNAA 2OSXA 4FI8A 3W7EA 1VCVA 4PMNA 2YRZA 3FB7A 1RHHA 4HT1L 3OVRA 1MW3A 4E8GA 7REQB 1BAFH 2J6EA 3AXHA 4JL1A 5DMGC 3BWAB 1LUCA 2MHAB 5I6MA 4XBJA 3RF9A 4DP5X 4EVZA 2D3JA 4WY7L 1XVSA 1EMTH 4PV8A 2J9XA 4JBSA 3GS4A 5JNYA 3I7SA 4P2OD 3K4DA 4LVBA 2XXGA 5GZNA 2ZTJA 4F2TA 4JKPL 3RKPA 3Q0HA 1IGCL 2V17H 3LU2A 2WW8A 4L4VA 2XDFA 1EGJA 2GJZA 3FT1A 3D0AA 3ME3A 4ZUVB 4G42A 4JDYA 2LHAA 3GHPA 3P81A 1VGKB 5DJ6A 2QADB 1X9QA 1EWHA 4MPKA 2E9LA 5GGVY 4HKPA 3WKML 3WQ8A 3M1OA 1KNWA 4TUKH 3IDNA 4J1UB 1NARA 4G7SB 2HWGA 4N9GA 3U4KA 1F45A 5ESVA 4D9RD 3WUBA 3U7VA 4HK0B 1HL8A 3V4VL 2Y85A 5H35A 1JNHB 3MLUH 2ZSVB 4LQFH 3B8DA 2R4RH 1IFHL 2WQSA 2HLEB 1S2CA 2VJXA 1OO2A 1G4MA 1MREL 2DQFB 4NQSA 4XN9A 1L3WA 2FH6A 2VM3A 3P77A 1OBAA 3UJRA 2CO7A 1D9EA 4PJ5B 4XWOC 2H8PA 3U0TA 1BVKB 4H25A 2RB8A 1I8KB 4GAJH 1GOGA 3MU7A 2WNXA 3DIPA 2H47C 1QSFD 1V0LA 4RIRB 1FCCA 2GT9A 2VP8A 1MNNA 5U7SA 1RK7A 3P54A 2HPTA 2BINA 4GUFA 2VHLA 3R0NA 3WN5B 3LLDA 2EXWD 2Z25A 2MNJB 2A3TA 2IDFA 1A6UH 1K3IA 4ZB2A 5E6IB 1E9IA 4PJ7E 1DBTA 3HC3L 4YVXA 3O6FA 3RVUC 1OK6A 4D9QE 3D9AL 1PPIA 1IGIL 4H7ZA 2QF8A 4H6EA 2EQDA 3FH7A 1UPPA 5C0JA 1NOUA 5JH1A 4W9LC 1OVDA 1EEUA 4MY9A 3G5ZA 3VD5A 1DVTA 4XO3A 4EAYA 4J3OH 3DO4A 4CQDA 2ZWLT 1BYCA 1G9MH 4XCCH 5EBWB 1B3XA 1S8DB 3V36A 1EWDA 4AJ0A 1KKRA 4UTLA 3BAIA 3AMGA 4XK2A 2CBUA 1Y5VA 2P3ZA 5HYSG 3BH8A 3IIXA 5D5MB 3EXJA 3IPEA 4I1RA 1BREA 4UOZA 4MQXD 3GK0A 1MRDH 1JF1B 1REQA 3DX0A 3ZRSA 3FONA 5IHSA 2IVFC 4HGXA 2R0LL 4RA3A 2ASHA 2Q7AA 4UBDD 4Z0XA 3NCFB 5IQNA 4J8RB 4BBWA 2JKXA 5AVWB 5E9XA 1OCRB 2V3FA 1FL3B 3PL6D 4C54A 4EOWL 4L9ZA 2WZPA 4YFLF 1UP3A 1PBYA 1TR1A 1JZ5A 4RZCA 5IHRA 1HJQA 5BNXD 5AAWC 1F3TA 5D1XE 1XGPA 2PCFA 4BGDA 2XBDA 2XPGA 1EX1A 1X6LA 1U93B 3EO9L 5HVWA 3GIQA 4AZUA 3T2PA 3N04A 2DIBA 3S83A 1BD2B 5HAOA 4I3RH 4N24A 3IGKA 1J1XL 4POZC 2JCCF 1XR9A 1E0XA 4P8VA 4C6KA 1JWSA 5C0BD 1BGAA 2X16A 4LGRB 2CM5A 4CSTA 2WBJA 3RVXC 4A2SA 4LCCC 3QR3A 4PMYA 1V54B 5DJZB 3G9VA 2Q87A 4MHHG 1WFJA 3B8VA 5HHVH 1T0OA 4BD4A 2L7JA 4IZGA 4GOAA 3VG0H 1M53A 3O81A 2QJJA 4IIEA 4E9QA 2ZKYA 4NX0A 1J8RA 3UJFA 3LNDA 2EXTA 4FQXC 4NRRA 4NJHA 1DHKA 3NJGA 3HMXL 4KTYA 1EJOL 4GVFA 1TIMA 4W87A 4RNJA 1VGAA 1E1CB 2Y2YA 5DRXB 1QAWA 2CJTA 1G6CA 3N2JA 3QEQA 1IT8A 2VYOA 1ESWA 3ATDA 4WFHE 1TCDA 3HO8A 2QAFA 3NWRA 3BJFA 4FLRA 1YDNA 3AIUA 3X1NA 1R24A 4A7GA 3GMQB 2IQAA 3F04A 1ZMYA 1NEZA 5GJSH 3WTXA 1QNZL 1RUQL 4G1KA 3F7PC 5J0BA 5LGKA 4FX5A 4D6FA 2FJGA 1R34A 3FUDA 4KQ4H 5D2WA 1FJ1B 5LIUX 3IGUA 3WK1A 4Z3HA 3PDGA 3LPOA 3WQPA 3L17A 1O6SA 2ZWZA 3WH5A 4C7DA 4JM4L 2DWXA 2DVXA 1I9EA 5EU5B 1EXPA 3GC4A 1B0RB 3QJFA 4OD2A 3KOWA 2CKBL 2I57A 1P5BA 4DW2L 1R0MA 1E3XA 2QKFA 5MI0C 5BW7A 1TV4A 1WIUA 3H26A 4F9PC 4DH2A 4E4FA 4PBXA 3G08B 3PPGA 4UMCA 5AHMA 2ZG2A 2V7NB 5JHBA 4G5ZH 5EO9B 1C9WA 3LSBA 2GTZB 2OMXB 1DIKA 1H8NA 3CB3A 2NZLA 4HJSA 4E8DA 4TSCH 2HFGH 2BH0A 1GYVA 2EDJA 3VX1A 5HWJA 1J11A 1NGPH 3RDTC 4DCQB 4M19A 2G0WA 2FYVA 2XKNA 2WLZA 5F71A 1G6VK 2PKDA 3N9KA 1PTZA 1PS9A 1YEDA 3BUIA 3MNWB 3PHSA 1SMAA 2DGAA 2PUZA 3NABH 1DVYA 1J5DA 4MLIA 1OFOA 4JTLA 2OT0A 4AM0A 4EN2A 3EYVB 5E8DL 3BVUA 3RJXA 3QXAA 1SHXA 3MP5A 3IFPA 4GY7A 3LBCA 4QY8B 4U1KB 1XKYA 4GKOA 4P5TC 3BQ6A 3NSXA 1EUUA 3PP3K 2X40A 2XWEA 3VB9A 2FQDA 3L1GA 4D9QD 3GRWA 1DWAM 1OF2B 4RGNE 1BG1A 1W2PA 4LAQL 4X9SA 5D96B 2YMTA 3MCMA 3HG4A 4HG4K 4XN5A 2JBMA 3FOMB 4NZTL 3TL5A 5E9AA 1W1IE 2C19A 2DDQL 4LS1A 3E6FA 3U1QA 1CCWB 4JHOA 3IXAB 3B0PA 3JS3A 3RK8A 3U6WA 2YLLA 2VN3A 2G4EA 3TKFA 4ZZ9A 2DY3A 3AXKA 3MUZ1 1HL2A 4GUJA 5TQ2L 3WFHB 3KTXA 3QPEA 4B0MB 4LSPL 5E2WH 3V4VB 1FP5A 1CTMA 3K5XA 1LWRA 1WAWA 3KZSA 4UQEA 1SMDA 2BNQA 2J79A 1JS4A 1I7RB 4KMTL 4EXKA 3OWEA 3CM4A 4PBVC 3B5TA 2FRGP 1Y5XA 1CGYA 3WIAA 4JFVA 1KB5H 5B39A 4R90L 1UP0A 2VT0A 3UY7A 3LRSB 2EEXA 4JNYA 3Q2VA 2MRYA 3QWQB 2CSPA 4BYHA 3GMRB 5JQHC 3PAVA 1GORA 1PE1A 3N40F 3FN3A 5KZDA 3ZDZF 3TURA 1WWBX 1UZDA 1HZHL 1TMCB 1K4CB 1DQUA 2MOQA 2OZ4L 3TROA 4U49A 3RLHA 1XFBA 4CEXC 1MH5A 4EOUA 5D1XD 2HJLA 5I1DA 5L4FA 1ZBWA 4ATTA 2YGPA 3B5GA 5H8MA 1HS6A 3DXIA 4PMOA 3BLPX 4ILDA 2EDKA 1SJCA 5FO9A 1RLBA 3RI5F 1ZRUA 1KTDB 4XP4H 3PJXA 3ZL1A 1CXHA 1ZRQA 5EV7A 4S3FA 3MOBL 5CR8A 4JE0A 1XSIA 4PRPA 3PWVB 4AUUA 3NPSC 3LKPB 4KZEL 2CLVB 2JKLA 4ISVA 2Z8WC 1CE1L 1OXYA 1DZBA 2DF3A 1LP9F 2E75C 3F62A 2ADYA 4ZNEA 2DUAA 4LSVL 3ID7A 2J55A 3G7TA 1FBIL 3MV11 1QFUH 3PJSA 3TAKA 3TPKA 5DHMC 1NCTA 1FXQA 3TNNA 1YPZA 3PK7A 4PD4K 2Z1KA 4U6XB 4Y4HC 1RPKA 3GJEA 4KJYA 4HJ1A 1N5YL 2X1QA 5AQ0A 1G7PA 3VTAA 4JTIA 3KYNA 2WXLA 4LP5A 3KPMA 2ZKHL 2DQHH 5HVFB 1U91B 4MZRA 3TUUA 3ZO0A 2Z00A 4S1QH 1TVHA 1TLMA 3CN2A 4O13A 3W2NA 1A0QH 4PJFB 4FCAA 3LEYL 4Y5VB 3HBZA 3CT7A 4Q4MA 5I0YA 4OH2A 3OKDA 4O54A 5I09A 4OV6F 5TPWH 1OCJA 3QZ6A 3MVIA 1N70A 3UTPE 1CYWA 1M7PA 1YYML 3P4NB 2BIOA 4LSQH 1OTTD 4KAQH 2REQA 4JRXE 2WXMA 3P61A 3TVAA 4HJWA 1YADA 3P0XA 1R3IL 5IR1B 5B1JC 5F7UA 2QDDA 4GSUA 5TK4A 1QD0A 2XWRA 3TEXA 3S9DB 3HV9A 3MGAA 4PTXA 2QKIC 3MJMA 3DPBA 3RB7A 1HFBA 3RWHA 4NQUA 3NVDA 4F0LA 5MENB 4G6AD 3C6LC 3G1YA 3PZTA 2B5IC 4MDJA 1C16A 3CQFA 5IW1A 2P47B 4G1EA 4Z7QE 2YXGA 5KINA 1CLOH 2YA2A 3ILEA 3HI5L 5BZWA 2OKTA 4P46A 1HNFA 4DQWA 3E2RA 1DQJB 3GUFA 1T04B 4LBRA 2W1NA 4UT7H 4N3TA 3VE9A 3S8FB 5DWUH 3LZFL 3TJXA 5BXPA 3NVTA 3AG4B 4V2CB 3BO8A 2D7QA 4WO4A 4C56A 4B9GA 2V7HA 1J9TA 3G8EA 3NGFA 1RUML 4J3OG 4DJFA 1HKMA 3AMLA 3T2LA 1JGEA 1OJXA 3W6YA 3I6GB 4LPTA 4TQPA 3RUGE 4WGVB 4P06A 4NM8H 3BZDA 3CPGA 5KBPA 2LT9A 5AW2B 2RD0A 1TPEA 4YUEH 3US1A 4PJXB 5E6UB 2DJ4A 1DIEA 5REQA 4IQJA 4UM9B 2WM0A 3TW9A 4RZKA 4OZHB 5LIWX 3CQIA 4NQEB 4OLYH 2V33A 4A3UA 3L0GA 1F73A 1TZGL 1F3RB 4JY6A 4N2BA 2AXFA 2DIAA 4BQ6A 1TT6A 3L3GB 4S11A 5K4XA 1ISZA 2NQ3A 1I9JH 4BFAA 4ML4A 4RAVB 2IWEA 1RJRA 3E1ZA 4ZSOA 3SE4C 2P3EA 1N2RA 4XPAH 1OP3H 4RGND 1I1RA 3QFDA 1JAKA 2FDSA 3RGTA 1JNEA 2ADIB 4ZQNA 3VKDA 3VFWB 1CF8H 5F1UA 5KYWB 5LSMA 1IGTA 4XO6A 2ZXCA 1URIA 2YZ1A 2XU2A 2JQAA 1DQXA 4P3DB 4PJ9D 2BNJA 5G5IA 4ERAA 4JB9L 3DVGB 3MKGA 4XVDA 4HWNA 3A64A 1EJTC 3D12B 4GXUN 2P1FA 4L29A 2FBJL 4MUZA 4Q7DA 2GJXB 3VDBA 4FZ8L 1TJHL 3EB4A 3HIZA 3BLEA 1ME7A 5GJNA 1XFCA 1RY7B 1H5BC 1RAMA 3U6XA 1BOYA 3PV7A 3IDGB 3BVDB 3QUHA 4LSRH 3QZWG 4RX4D 4IJCA 5HUPA 2QCMA 1KBVA 1EJRC 3ARFC 5DFTA 1XF5A 1K02A 3P9MB 6PAZA 1U2YA 1G9NC 2HYMA 1X7IA 2V2CA 5HI5D 3DI3B 2JKRM 3L3OA 5C08A 3VCCA 2VX6A 3IV3A 3P4MB 1VFBA 1VPOH 1U3YA 1PDKB 3ANUA 1OP5K 3WKZA 4N4QA 5INDA 4ODSH 4NZ8A 4M6UA 5I74C 3RWDB 1UCWA 3MMEA 3AYVA 1FWDC 2VLRD 2PMZA 2VCOA 3OG4B 4JHUA 5E1GA 3FQ4A 3NNTA 1FHLA 5DUMH 3VB8A 4HS8H 1OWQA 3DLQR 4K94C 3PVFA 5F21B 3CFNA 5JO5B 3MRPA 3HRZC 2HAZA 1V77A 4IG2B 4ZUTA 4Y4FC 2PDUA 3GKZA 1QI3A 5CSGA 1HX0A 3KCPA 4FG6D 4XN1A 3VO0A 5J12C 4OGAC 1GOXA 3WTSA 1PZ1A 3UO8B 3HFML 5DUPH 1WD8A 2WLIA 1GC1C 5CEXB 5HNNA 3SDYH 2Z35B 1S2TA 4F9LC 3JWDL 5CMAA 3PZIA 2PTWA 4NLHA 4HUUB 3TN0C 4LLVA 4PRRA 4ZTEA 1YUHB 1ITXA 4C90A 1R7OA 1H8LA 3BVVA 2ZX6A 3LN5A 3SADA 3UTPD 3VGEA 1H0IA 5DQDL 2Z4TA 3ENLA 4JRXD 1FQ0A 3G3LA 1ZIBA 4GS7C 2JCWA 4C1NA 1LNUB 1CLXA 3DX4A 1Z9OA 4FTVD 5DHVH 2R1PA 2VEKA 2Q6WB 2OJEA 3RCYA 2Y8VA 3MV7B 4H20L 4WU7B 1U33A 3VFSA 4JY9A 4NYLB 3AHVA 4LCCB 2K6YA 4OGYL 3BEVA 2CA4A 1J8SA 1NJJA 4KXZI 3FXYA 3TYFA 1XWVA 5K9XA 1DJZA 3T2NH 4BWLC 4G7YL 3HURA 3FSUA 2XX0A 4FQXB 4AQEA 5IEKB 4HYVA 1MIEH 3FHAA 4JN2B 2P5EB 4WF7A 3NCJL 2GSHA 1J05B 4PVMA 3Q6GL 2HS6A 2EKCA 3DGCR 3QXDA 4C83B 5K9QG 4BHUA 2G4FA 4H7VA 4Z76B 3GRIA 1LBFA 3M1BB 1ZB5A 3IJ7A 4JTHA 5KUMA 1KTBA 4UTKA 3SCTA 4GUPB 4OJAA 2KC0A 2ALRA 3RVTC 1U0QA 3FL7A 1PG7L 3BZFB 3H42H 2VOMA 3SBFA 5FJJA 1J48A 4QRSA 3HNVL 4O1EA 3T0CA 4ZFOL 5FJRA 2NV1A 1QI2A 4PGLA 1I1YB 3F7VB 1C3FA 3WMLA 3K5RA 1E9LA 2OL3H 3PZ9A 3QW4B 1MDTA 3BUQA 4BIKA 2NDGA 1U3HA 5IB2A 2W63A 3ANVA 3KYOA 3AG2B 4JTSA 3M0JA 2BFVL 4BSVA 1UB6A 3GNMH 4JO5A 4LIQE 3QJUB 4OLVH 2VELA 3VNIA 1OP4A 4EIZC 5MI0B 4C5YA 2OQHA 3HN5A 3DJTA 1VCFA 1OTUC 3RNDA 2YZ8A 1XLGA 4XO4A 4JJHA 4QYAA 4Y1TA 1PVHA 5T1KB 4YSQA 2X7WA 4O57A 2WP3T 3FFCA 3BZ5A 4WW2C 1ZPTA 3ROOA 3HI6L 1S5MA 2R1XB 1HXKA 1ZD6A 1XTLA 1RSYA 2PYEE 2V5BA 3WJWA 5E1AB 3CUZA 2G96A 4HSAC 2J43A 4LARL 3OLDA 2GITB 1FH2A 5DLMH 1CICD 3EMQA 4AM0Q 3JRKA 2DSVA 1A1MA 1M42A 5DS8A 4E9SA 3PWPA 1OAYL 2DQEH 4F57H 3FQRB 3PGDA 4AZ6A 4JQ4A 1EUTA 4QTGA 2WO2B 3P6LA 2CUIA 3BSZA 4M3PA 3P9LA 1LO2L 4KPHL 1SYTA 1T6VN 3EYUH 4JPWL 4OCMC 1G9NL 5LLIC 1YNPA 3MJ9A 2APTA 3W11C 4U3SA 4UDTA 2UZYB 2Q8AL 1U8HA 3TA3C 2XZQH 1F6KA 2IALB 3EO1A 2VMCA 1XI3A 2J7BA 3QFJD 2V5YA 4QT5A 2VAJA 3P11H 4P5TB 4MNQE 5IBTH 3G0UA 1NKRA 1LL7A 3OKLB 5KZCB 3V0TA 4HFWB 4I85A 5F1SA 2EH7H 2NY2D 3G5YB 4YHYC 1KXTA 3L5IA 5IF0B 3FQUA 1IQWL 2K0RA 3SN1A 1FAKT 3KM2A 1JR1A 2DZWA 5LAXA 3D85A 4AJWA 4EDXB 2ZJSH 3WF4A 2VXSH 3IDIA 4YHLL 4ZYKB 5EBMA 3U2EA 1TFPA 4IPJA 1BQRA 5E9DB 4Z42C 4XP6L 1MI5A 3UP1A 4FLHA 4Y9PA 2XH7A 3K3QA 1GZHC 3L2IA 1BQLL 4N9DA 1AP2A 1FWBC 4OSUL 3UACA 1GC1L 1O94A 1SQ7A 3F58L 3KWWB 4H4IA 3B43A 4XN2A 2WAQA 4FNPA 3WDJA 4UT6L 1LORA 1PCSA 3GKAA 2VC9A 3FDKA 1S5HB 2GK2A 2WZHA 3IBOA 1MZHA 4AF0B 1G4SA 4NY2A 3RU6A 2FQIA 1E40A 4HP5A 3SJVE 2RDWA 2HKHH 1HXMA 3ULVF 5DEGB 3CVBA 4HJJH 4JTJA 3WN5C 3JZUA 2C4FU 4ZUSB 2Y7NA 5D9NA 1OQFA 2KT6A 5L4MA 4LH8A 4UWMA 1MO0A 2OCJA 4A7GF 4BV1A 3BARA 1TJ2A 1DXFA 4K3JL 4Y2WA 4HKZA 2PB1A 3QV7A 3SY0B 4NILA 2DT1A 2WTPA 1KXHA 2FYMA 1BM3L 4F2MB 3BGFC 2ZOTA 5I15L 3W56A 4A63A 1NCDH 1CDCA 2OMVA 3E6HB 4GMEA 4U6VH 4IUGA 2J8FA 8PAZA 4K15A 4IKIA 1Q8AA 1C92A 1KENL 4JXCA 3KHDA 4LLDB 3LKOA 1JGIA 4MHHI 1R4XA 1Z7JA 3G1HA 4XAGA 3E9TA 4P04A 5ETUA 3FTGB 3NPSB 3H8NA 4PGEB 1SO5A 4ABQA 4GYPA 2ZCZA 1MVYA 3ARGD 3RL1B 4MA3A 3H7LA 3B7TA 1RHCA 1E4XI 1ZLUH 4D1IA 1M6OB 4IGNA 4ONHB 1HYSC 2HVKA 2ZX7A 2H2PD 4PGDB 4DGVL 2RCSL 3ZTJH 1N68A 4Y4HB 3ITTA 1RJYB 1XIJA 2TPSA 3PV6B 4JANB 1QSEA 1DO6A 2F7OA 2XTJD 2EUXA 2DQUH 2ATKA 3CHFA 4FQQA 1V5XA 2GEQA 2BVQB 3LMYA 2PCYA 3A0OA 3OTTA 4HFUL 5F6HJ 2EP6A 1M56B 4ACTA 4JDTL 3DGBA 1P2CA 4TUJB 2BASA 1ED3A 3DBXA 5DD3L 2V2WB 4BFGA 5CP7B 4L5FE 1TVBA 4RJEA 2VDQL 2VXTH 1UMLA 4DJDD 4GW5A 5JDSB 1AH1A 4RBPK 4OI9A 5AAMA 1WFMA 3BSHA 3WHE0 3T6WA 4UTMA 3C2SA 4D2JA 5HHME 2QKIB 1IEXA 1LCOA 1YEIL 3R11A 4PUEA 3G3MA 4WK9A 2CH8A 3UERA 3C52A 4H19A 1VADB 3ABZA 1MFEH 1M71B 3QDGA 4AVOA 1JD7A 5SWQA 3NZ1A 2PR4H 4BFOA 2VKXA 3C6LB 1BQUA 1ZHKB 3LDBC 1XUZA 2B5IB 4A6YA 4D9LH 3MGOB 4OV4A 4I77L 5G4OA 4TSBH 3MPGA 2PXYC 3W7NA 2VZTA 4P9ML 5JHLA 3QZEA 4DHLA 5K4ZA 4RRPA 2H1XA 3T0WA 4JZ5A 2W92A 5ADOH 3V55A 3KL5A 1YJDL 3IETB 1FZOA 2EDQA 3GBML 4Y16D 3BKYL 1KCVL 2F7IA 4K3DH 1F2JA 3AUJA 3CVDA 2EXSA 2PYED 3P93A 1ACYH 1ZGDA 1E4WH 4H6KA 4QXGH 5F9OH 3K6OA 3IFLL 4PW9A 3LB6D 3NURA 3BOLA 1BFOB 1IEBA 1FZMA 3SO7A 2QZ5A 3DU0A 5C0AA 3LKRB 3DSNA 3CVIH 4IIGA 3CXOA 7TAAA 3BT2L 2V6AA 2EG8A 3DVNA 4LKXA 2VERA 5ALBH 1O6VA 4UTWC 5FA3A 3G5WA 3FSVA 3IJLA 4Z7OB 2A83B 1XH0A 1VFTA 3N1PC 2XSAA 1PYWB 3IMBA 3ARDA 2OX5A 5G1MA 2EACA 4MNQD 5ISZE 4ZFOB 3V0UA 4RK8A 3B4YA 4G70B 4YR6B 2CO6A 2PURA 2FLBT 5K1NA 2DS4A 3SRFA 3EF4A 1LP9A 1VBUA 3IKCB 5DJDA 2BDNL 3NDYA 1U3JA 1WYIA 1NCOA 1NDGB 4AGLA 1WLHA 2XY1A 1OCQA 4AH2A 4GQ9H 1N8FA 2F0CA 4C4KO 4JNMA 4EZKA 4A7SA 5HYQA 1OGPA 1BG4A 5H94A 3CMJA 1OTSC 4DP2X 2A7BA 1O9ZA 3QGVA 4HPNA 2AC0A 3W5NA 4TNFA 3KLQA 1RUKL 2GHZA 3NSCA 3HE6C 5FAGA 4E42B 2BP8A 4AZCA 1TFVA 3S34L 3PJWA 2YD3A 4GBXD 1YPZF 4J4PA 1BXUA 3WNMA 2J71A 3RKDD 5FSDC 4P8XA 4G8EB 2J62A 1H5BB 5CZVL 1GVRA 4YDNA 3DBPA 1BWKA 4MA7H 3SJVD 1HVXA 4BZ2H 4QHRA 4ASTA 4KXBA 3H2PA 1AJ7L 1P7KB 1A65A 4OZGE 4MB1A 3F2CA 3HZMA 1WFUA 1FO0B 4IQLA 2F53D 1MHHA 2YLKA 1LRQA 3NPZB 4FQ2L 1KG0A 4KNUA 3E12A 2OXGA 1M03A 2DDXA 4J9JA 1BEYH 3SYQA 2YCKX 4OOZA 1KBBA 4F2FA 1PDZA 3K46A 3STGA 4Y90A 4PMDA 2YXMA 3B2VL 4DO5A 3UGEA 1IQDB 1J8HA 4ZQKA 3LH2L 1KYDA 3LZOA 4ZBJA 4UWQB 4G8IA 5IFAH 2AJ3A 1MNUH 3KS5A 4P99A 5EUOE 3OJGA 4GP5B 5CJ5A 2ABAA 1RU9H 3HRZB 3DFYA 1ZJBA 3QF0A 4ETYA 4NX5A 3MCNA 1MCCA 3V6FB 4NI3A 4JG1L 1ISYA 1A7RL 3A4DA 1JD9A 4LKCB 3F4WA 3CC5B 5BRZD 2R83A 4PV9B 5I1JL 4XV0A 4Q8UA 3LIZH 4DF0A 5HJGA 2PGWA 1UM4H 1OX4A 1Q6OA 5E6ZA 4FMVA 1GTHA 2R69A 3DTUB 3TJEL 4V1YA 1FY6A 4GJIA 3IPFA 2VMJA 1Q66A 4B5TA 2D20A 2I5IA 4MJ6B 1L0YA 1S46A 3SCPA 2VDMH 4UFMA 2XPYA 4K0OA 1IM9A 2PW2B 3PDDA 4OUEA 1LE9B 2WZEA 4IK7A 4V1DA 1KV8A 1K2DA 4N25A 2F1BA 2IH3A 4HKBB 4E5XB 3TC3A 3VD9A 3GW0A 1GZPA 3QH2A 4ZUWA 4D8AA 3QULA 5HHMD 4IS6B 5JOEA 4OCYL 4WI5A 3WQFA 4W4QA 1AHKA 1QUPA 3CBRA 4XNUL 1IC5H 3D0VB 3N2TA 3MZ2A 3NK4A 2KDGA 3LKSA 2YB4A 4GRLD 3V4PH 5LA1A 4K1GA 3BJLA 1T03L 4LVAA 3IK2A 2MOVA 3S35L 5IROC 4GGBA 5BOOA 1EZVX 3IN2A 4JYEA 2XRAH 4NWUH 5JIWA 3AISA 3KPPA 1KR1A 1DFBL 3H2WA 1E8YA 1KJVA 1TNMA 2G9HA 1BSIA 3EFOB 4M6VA 2XETA 3EDJA 4Y9EA 1PNDA 4NO5B 5TJWK 2E6DA 1MJ8H 4H1LA 5TE4L 3P82A 1BOGB 5K9OB 3LI1A 4FD0A 1GGCH 2CBTA 4IBYA 1B4RA 4O2EB 1ZDQA 5I3HA 3QYCA 2A9CA 1SVZA 1DBJH 3ISIX 4IHOA 4HKJA 3Q6FA 4Y5VC 2F74A 4XHJD 3AFBA 3RO8A 2C1HA 1G4EA 5FCZA 3WIHA 1B88A 2HVBA 4HJUA 2J47A 1EEPA 5GRVK 1P5VB 2NX9A 4ZMZA 2QVMA 3QC0A 3P0VL 2AK1H 4R0LA 4YVUA 1NFDE 1R0AH 4JD4A 4XMKL 3VXMB 3QHZH 4GFSA 3KYKH 2YK1L 6PCYA 2VDQB 3N3TA 5ISZD 3TGXA 2FT8A 4KI5C 4UFHA 3HHMA 4BQCA 4PGBB 2PLKA 3APFA 2OMUA 4UNTA 1O9WA 3WLNA 4M3KB 3IDYB 4PJ8D 5LYRA 2G60L 3DG3A 2NQZA 2XY2A 3URBA 4EO5A 2CZEA 5DD0H 5GGRY 1I60A 1Y0LB 3VM7A 1IYXA 5C09B 3CFDA 3WENA 4FK9A 4CQ8A 2TYSA 1A7NL 1ZA3B 1CD1A 5C70A 3IVKA 1J0JA 1H5YA 5CINL 4WW2B 1BFTA 1WGVA 4GQPH 2Z26A 3EXTA 1N6VA 1T89A 1ONRA 4YBQC 2DQGL 2DTMH 2INZA 3LZ3A 3VQMA 1R3KB 4MJ4A 4C60A 3GI9H 4RR4A 2FYYB 3TLLA 4B97A 3PPCA 5DMKB 2Z31D 1CZ8L 3V10A 4HCLA 1F1GA 4YWIA 1T7YA 2JSFA 5F2FA 1NCGA 3QG6A 2W80C 4IJRA 1NCAH 3KPQA 5CD3B 1NIAA 1DL3A 2DYPA 4FFYH 1AGEB 2KX9A 1ZTXL 3ZTJG 5CIPB 1P0BA 5E0KA 1EO7A 3SKNA 1OZMA 3S4SG 2HH0H 2DIKA 1GZGA 3TA3B 4PRDA 1BD0A 3NSFA 2NTFB 5BV7H 2H9GB 3KVQA 1UT2A 4LQ1A 3EOAB 4MXQC 3B9EA 1UKSA 4TQEH 3T8MA 1GW1A 4GSRA 2ZYHA 1KACB 1L5GB 4YL2A 2C9PA 3QEGH 3SE3A 3CO4A 2G5BB 4JM0A 2EINB 2ZXGA 5D2NA 4YHYB 2E9JA 3T1FA 2DJUA 5ABAA 2XFYA 3VH8A 2ESVE 1OYCA 2QXWA 3TNMA 3GNNA 2XGZA 1XCQB 4Q33A 3VJ6A 4MA1C 2MNRA 2W9EL 3D18B 9CGTA 4M6PA 2OMWA 1EDTA 5C0RL 5C0CE 5FKYA 4QR7A 1T0MB 1EX5A 3OGVA 3FCUB 4POUB 2G50A 3GXPA 5EF2A 4XVSH 4I3SH 3LS4H 2YPLD 1I85A 1QACA 3FU9A 5E6RB 1BMZA 2QIWA 1VDGA 4M6QA 3MUY1 3PSVA 4Z77A 1TE1A 1DVSA 2DWTA 5PAZA 4KRLB 1BFVL 5KZEA 2I7SA 3M17B 4QBXA 4HCGA 3ZE2F 4O19A 1ZP4A 4HDIB 3L9RB 1MJJA 4NP7A 1NSNH 2YRLA 1UXWB 3ZDXB 3T4YB 1BTCA 1JZ6A 4UNKA 2VQ1A 1JK9B 5JUEL 3CL6A 2R24A 5HI4C 4NUWA 4U1IA 3FZUC 2OKOA 1HK6A 2JIEA 1HEHC 3LCFA 3BGFB 3FTSA 4NRYA 4IMEA 3PFRA 1F4WL 1MCOL 1E5AA 4BE6A 4XI5C 2GPZA 1IAOA 1I2PA 1A8JH 1W9PA 4WI7A 1O5DT 1GOOA 3BSGA 4DGWC 4J12A 5CJMA 2UVFA 3SKUD 1XLKA 1Q85A 1O5KA 4H0GA 4AXWB 1JYNA 1X5XA 5IJDC 4RESB 4O17A 1IBFA 4W4OA 4GZ7A 4D6HA 2G41A 2DH3A 2CCWA 3GKWH 3LI0A 3GIZL 3KLHD 5D72L 3FUIA 5A2LH 2XZCH 4PB0H 4LEXL 4X6DF 2AI0L 3VQLA 4XMVA 2X05A 1ZK5A 4M1CC 2Y24A 2EBNA 4FJZA 3DUSA 5K9QI 3EFDL 3CDGB 3MLVL 3MCKB 3GHBH 4JPKL 4R8WL 4ECNA 3SQMA 3P74A 5HD8D 2FB4L 2B08A 2E74C 1P1ZA 1S9WA 1IM3A 1I8AA 4LCQA 1IVLA 3HE7D 4XODA 3QC6X 3RILA 3WIIH 3KTSA 4L65A 3O6LL 4F0RA 5DO2D 1CT5A 1LM1A 5DSCB 2RFXA 3PS7A 1NFKA 4IKJA 2DW5A 1L0QA 1DCEA 1KXQA 1VZIA 2D73A 3IGLA 2O7SA 5B3JF 2B0SH 1D8CA 1A3RH 2D2HA 4JO3L 5IQ9B 3MO4A 1XLIA 3FO2A 3AM8C 2X6CA 4OZIE 3O4OC 1K3ZA 5CGTA 3KJ6L 5J7CC 1PG7W 4DBWA 1Q90A 4HWBH 1IC7H 3LSCA 4UIKL 4PI2A 3ZRFC 4NO0D 4QOKB 3BQUB 3LDBB 4OHQA 1E6JH 3BPCA 4FS9A 1CDHA 3RZCD 4JPIA 5KSBF 3U46A 4UFIA 3NZRA 2PXYB 4J35A 1MLBA 4H44C 1MCNA 4NSKA 1A0CA 3SGGA 3H9SD 4IGBC 3DCPA 3WO3B 4YO0B 5F7EH 1RD6A 3IEAA 4IMFA 4TQTA 4WY0B 4N20A 3HFYA 1RXOB 1G0DA 4QNPE 4JGDA 4GQGA 2VXQL 3HZKB 2VXUH 3U48A 5IMOB 3GTIA 4OF3A 2YC1B 4U28A 4X9GA 3DO7A 4GFXA 4K8RD 4MZ1A 1UWGH 5A7EA 1LK2A 1MFAL 5DVMA 1BYAA 3KBMA 4U3AA 3NYZA 3WFCH 3QIBA 2ZWYA 3EYOB 2WMHA 3TLQA 2VO8A 4C4UA 1I0DA 4C6JA 4L0ZA 4I6KA 2DQCL 5CBJA 1HN1A 1DEEA 4YJZ