1UA3A

Crystal structure of the pig pancreatic a-amylase complexed with malto-oligosaccharides
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Pig Pancreatic alpha-Amylase Complexed with Malto-Oligosaccharides
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ua3A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ua3A01
3OG2A 5LA2A 4KGLA 3NSMA 1HJQA 1OT1A 2DH3A 1GQJA 4N42A 3U7VA 2NT1A 1FFQA 4P8XA 3VD7A 2CKSA 1UD5A 1ISWA 3DC0A 1E56A 1ZS2A 5A2CA 2NT0A 2JIEA 5I3DA 3T2QA 4ZE4A 1BSIA 1M53A 4DWSD 2O9OA 3D3AA 3UCQA 2J7EA 4KGJA 1R46A 4GO9A 4W5ZA 2WVUA 4TX6A 1VFOA 1DHKA 3PTMA 5FOOA 3CHEA 3HG4A 4AMXA 4W88A 3L4TA 3AXHA 5HPCA 1OGGA 2WZIA 3D5HA 3PZIA 9CGTA 4Z2KA 3WH5A 1QNSA 1MW0A 4XZBA 5D4YA 1U33A 1BTCA 4J3SA 2WC7A 4D6DA 4M56A 5CPTA 3WDIA 2ZUUA 4TUFA 5A8PA 1MW1A 2GFTA 4MNLA 2E4TA 2YFOA 3ZMRA 1KWGA 2PF0A 1BYAA 3BLKA 3VD4A 1Q6FA 1C90A 1ZJAA 1HKMA 2ZUMA 4UNIA 1JZ4A 1CXFA 2B31A 3L4UA 2J77A 5LA0A 1LLOA 2YLAA 3CUFA 5M17A 3WD3A 3DX1A 2X0HA 2WC3A 1CXHA 1VFUA 1ISZA 4E8DA 2F7QA 3B9EA 2WVTA 1TCMA 5E9AA 1V03A 4OOZA 1EOKA 1UR2A 1GNXA 1XH1A 4AXNA 1XCWA 4Z2GA 5JBFA 1WDQA 3A3HA 5A8OA 1JFHA 2WM0A 3D52A 2DEPA 2E9BA 2XVLA 3CZKA 3GDBA 4UR9A 3OGRA 1NOUA 2JEQA 2OLHA 5FIPA 1B3WA 2G41A 4W86A 3O6AA 1FH8A 5GQBA 5E70A 3FAWA 3EJPA 1NOWA 3CIVA 3BLBA 4EE9A 1B3YA 1GOIA 3ARZA 1H11A 4CD7A 3SCPA 4C7FA 3VUPA 1MW2A 2V5DA 1HP4A 5DF0A 4UQBA 5EMYA 4V27A 2GJXB 2XPKA 1CIUA 3VGEA 1J18A 3A5VA 3BUBA 1W1PA 1XRVA 3HG3A 1JZ5A 2DT3A 3EJSA 4UQEA 3BXWA 2ZE0A 3AZRA 4CD5A 4AZIA 3CMJA 3WFLA 2YOCA 2PWDA 1GORA 2WHJA 1HXJA 3BVWA 1V6WA 3EMQA 3DDGA 3NSNA 3LMYA 1BGAA 3ALFA 2E8ZA 1W91A 2YFNA 1HKIA 2OSXA 3AIRA 1X1NA 1OIFA 1G94A 3AXXA 4F8XA 3MSDA 1V0NA 3RM8A 1GUVA 2QMJA 3AYRA 3BVTA 3DYPA 3OZPA 1OD0A 2D20A 4V2XA 3VGDA 1QNRA 1V6UA 4DWSA 1CXIA 1OB0A 4JL1A 2GK1B 3AIWA 4PUEA 3H54A 2YBUA 3WD2A 4H41A 4UFJA 4MB3A 2WXDM 1WDPA 2DIJA 1ODZA 2PC8A 4RE3A 3SCTA 3SCVA 2EPNA 1HIZA 1DWFM 3HN3A 5HOSA 2OYLA 1CGVA 3WNKA 4J27A 3PZUA 1V3HA 3EYPA 4NF7A 1E70M 4EKJA 1E4MM 1WNOA 4Z2IA 1U30A 3K46A 2FGLA 1OBAA 1JDAA 3LRLA 3F5JA 3ARUA 1XD1A 5FCZA 4UFIA 5EBAA 1JNEA 3AISA 2VX7A 4PSRA 4K68A 2Y8VA 2QPUA 1AVAA 3N9KA 1D7FA 3UERA 2F7RA 3ZT6A 3NCOA 3RDKA 3ZJKA 1FFRA 2QMKA 2ZWZA 2RGLA 5D8WA 5BXTA 2JALA 2XTKA 2XSBA 2XN2A 5IHRA 3AS1A 3CUIA 1ZBCA 1ISXA 4J3TA 2WMGA 4AZCA 3WBAA 2WMKA 4HA3A 1Z32X 1QWNA 4W84A 1VJZA 4JIEA 3A6OA 4JKLA 1A3HA 1J0YA 3SCQA 1H49A 1E0VA 3ARXA 1XSJA 4HU8A 1CECA 3E1F1 2C7FA 3VNZA 2FHFA 5E1QA 2A3EA 5CPSA 2Z1SA 3WD0A 1BF2A 1WAWA 5E6ZA 4E4PA 4PMYA 2VTFA 4E2OA 1V0KA 3BCFA 2J7FA 1ZBVA 4BA0A 3FY1A 3OGSA 3WUBA 3WH6A 4B16A 3F4VA 3MV11 2Z1KA 2WSPA 3MUY1 1HVQA 2X2YA 3AI0A 3VM5A 4CU7A 3IJ7A 1LWHA 1JFXA 5CGTA 1XSKA 5I78A 3T0AA 4CVWA 3WH9A 3BUDA 4UFMA 3F5KA 4WK9A 2JIWA 3QOKA 5HBFA 1V08A 3TP4A 4HOXA 1JDDA 2WPGA 5A6BD 3DYOA 2OYKA 1UKSA 5I6SA 4NZFA 3VILA 4JCMA 4GI8A 2XFYA 3BUPA 2YDSA 1E5JA 1OM0A 1HP5A 2D0FA 3MV01 1UKPA 5TD4A 1S46A 3THCA 1M7XA 2FYVA 3BSHA 1UR4A 1WZKA 3CZNA 4PN2A 5DT5A 4B9YA 4QCEA 2IXVA 4GZJA 3DECA 3GXIA 1W9XA 2X2JA 1W2PA 4ATLA 1LL6A 1NP2A 1KQYA 1V6YA 3VDCA 1R33A 3FHQA 3VX1A 3VMPA 1JL8A 3BH4A 2VX6A 3SURA 4S3KA 2FH6A 5GPRA 3RPMA 4DO4A 2PB1A 2XSAA 3W6MA 3TA9A 5CPQA 3T2OA 4CVUA 1VJSA 4OJYA 3GXMA 5E0FA 1UR9A 3GTNA 2WLYA 1JXKA 1HKKA 3TTQA 3VD9A 1W1VA 2XIIA 5LYRA 4AW7A 1TQUA 3SUTA 4H7VA 5DT7A 5CXPA 4TVCA 2BVYA 3TV8A 1UD6A 2F7PA 2XWEA 1WZMA 3CGTA 4TVUA 1UD3A 1J11A 4QLKA 2YJQA 4FNPA 1UKQA 1TVNA 1H1NA 3NDZA 5BWFA 2EJ1A 1MXDA 5KEZA 2CETA 1RH9A 3TOPA 2VRJA 1VIWA 4QAWA 2J8FA 1UD8A 3VTRA 2W91A 4ZE5A 2PBOA 3BUQA 1C7TA 3WEMA 3WH8A 3CZGA 1W1TA 2PWFA 3N13A 3W82A 4LYPA 4FNUA 5DO8A 2A3BA 5IFTA 4AY1A 1XSIA 5AYBA 3NUKA 3ZJ6A 4NX0A 3ZQ9A 4ATWA 3F5LA 4CU6A 3OLDA 3ZR6A 1OD8A 2OYMA 3VM7A 3TONA 3S5ZA 1WB0A 1E6SM 1E73M 3AIEA 5A95A 3ARYA 3T2PA 3L4VA 2J78A 3H55A 3WQ4A 4WKAA 1RP9A 5D9OA 2WNWA 1X6NA 1G01A 2E9MA 4J3XA 4P8VA 4M8UA 1E6RA 1EQCA 2O9TA 2WMIA 1NH6A 3EJTA 1EHAA 4U2YA 1MQRA 2NSXA 3OGVA 1NWRA 1LG1A 3VO0A 2Y2WA 3SCNA 3M46A 3FAXA 1JZ8A 4PYSA 1TQWA 1CLXA 5JBDA 5A8MA 1W9UA 5FL1A 4XZWA 3N17A 2EACA 3GXDA 3EDEA 1QI0A 1MYRA 3CO4A 4P7LA 2VZVA 1WCGA 4AYGA 1VBRA 1TVPA 3WEOA 4HPHA 4AD2A 4AC1X 3ZSSA 1PZ2A 1PPIA 3VIOA 2ZICA 3T09A 1O6IA 1MW3A 3CPUA 1LG2A 1TFVA 1VFFA 3SUWA 3CZLA 2CESA 1JNDA 4W89A 4LXFA 4U31A 4JHZA 1PJ9A 4GINA 1JI2A 3RMEA 2DSKA 3AIVA 3WUEA 4NZCA 4X0NA 1Y7VA 3L4YA 2D22A 4YHEA 4JZ5A 1OINA 3AMKA 3RM9A 4PMZA 1UH2A 3FXYA 4DUVA 2W92A 3EDFA 3VPLA 4CD4A 5C8BB 1K9TA 2CNCA 2EPLX 1E6QM 2BVDA 2AOSA 2EPOA 4GI6A 1D2KA 3VIMA 2BFGA 1JZ7A 3WF4A 4D6CA 2ZUVA 3W25A 3A4WA 1B0IA 1UYQA 1U2YA 4FLRA 2VT0A 1E6NA 3CBWA 1FP9A 3L4ZA 1JAKA 1LQ0A 1R7AA 1US3A 4CU8A 1LWJA 2YL6A 1OSEA 4D6GA 3DX4A 1C8YA 3QHNA 4J7RA 2DGAA 2WC4A 4L4PA 1BHGA 3ARWA 1HJXA 2JF7A 1EIBA 3CHCA 1CDGA 1PBGA 1GVIA 2E9LA 4KRTA 1GOMA 1ZJBA 3VMNA 1HWWA 2FHBA 1EDGA 3CMGA 3VOCA 4BCEA 5CJ5A 5BXPA 1UG6A 4D6JA 1X6LA 4D1JA 3ARQA 4HTYA 4U3AA 3VIJA 3DHUA 3VVGA 4UCFA 4AYSA 2VX5A 5D9MA 5ECUA 1SMAA 1E3ZA 3SCRA 1QPKA 2C8NA 1GPFA 4U5KA 2FE0A 1DWHM 4JL2A 2DSVA 4WLCA 3WBEA 3MSGA 1KR1A 1V3JA 1TA3A 1BQCA 3K8LA 1XCXA 4LYQA 4MTVA 1KWKA 3BLPX 2WMHA 1DWIM 5JBEA 1YQ2A 4M81A 6CGTA 3BMVA 1Q6GA 4PMXA 3WD4A 4ACYA 1HL9A 3PTQA 1D3CA 4NXSA 1WO2A 4DWSC 4MDPA 1DWJM 4H8VA 1KXHA 1R86A 1PEZA 4UQDA 2XM1A 3UR8A 1J0ZA 4AZHA 3VIGA 3QOMA 1W3LA 1JF5A 3N1AA 1QNPA 3DX2A 1GQKA 5A3HA 5IXEA 1CGUA 3S6TA 4PCTA 1HJSA 3SCWA 3CHDA 4ACZA 1E1FA 1NWUA 2J79A 3AS0A 3AMGA 3W24A 2X0YA 1UKTA 2J74A 1WPCA 2VZUA 3VSVA 2CHNA 2GSJA 1B9ZA 4M29A 2XHYA 1KB3A 3SCSA 3VDBA 2JE8A 1OIMA 1JXJA 4NRSA 1GOQA 3MU7A 4UTFA 4QLLA 3M7SA 2E8YA 4XV0A 4AMWA 3KEHA 5CZKA 5JIPA 1W3KA 1BLIA 4U3CA 3WDRA 1BAGA 1E72M 4MB5A 1G9HA 5M03A 3TTOA 1G5AA 1JZ3A 2J4GA 3SUVA 3OA5A 4W87A 3THDA 4ZEPA 2J47A 2WKLA 4W93A 1PAMA 1NM9A 1EA9C 4W5UA 5IFPA 1B3ZA 5AY7A 3CTTA 2F18A 1HJVA 2ZX7A 1FP8A 3OBAA 1GHSA 2BXZA 4GQRA 4D1IA 3A4AA 2CITA 2EPMX 4AZ6A 3WY4A 4HMEA 3N18A 2XIBA 1NP0A 3VGBA 2BY3A 4DO5A 3MMDA 5A6AA 4KMQA 4TTGA 4PTWA 2BV9A 2WWCA 1IZJA 1QI4A 4CGTA 5KZ6A 2XN0A 3OLGA 4IM4A 1EXPA 1VEOA 2EBNA 1KTBA 1GJUA 3AROA 1RPKA 3W6LA 3VD5A 2G8ZA 3CHFA 1SYTA 5I5RA 3PZTA 3AMDA 3CZEA 2J7CA 5I2UA 3BAIA 3T0BA 5A69A 2GDVA 2O9PA 3KZSA 3MO4A 1EO5A 1UASA 5HPOA 2W66A 2D1ZA 1TQVA 2ZUNA 4P8WA 1VB9A 2G3IA 4XB3A 3PZGA 3SEPA 1I1XA 2BNJA 4GPNA 1ZU8A 3WF1A 1OWQA 3WH7A 1QW9A 4YN5A 3POHA 2V3GA 1JIBA 2VURA 1JD9A 1QI5A 4ZENA 3WD1A 3K1DA 2G3MA 3AS2A 1PX3A 3I3DA 2WBGA 2E0PA 1KGWA 3EMZA 5FL0A 1B2YA 2BHYA 3A24A 1E0WA 1QBBA 1TZ7A 2XGIA 4PRWA 4OZOA 1UZ1A 3OIHA 5A8NA 3IAPA 1V3MA 2WCSA 1MVYA 5CQ1A 2ZWYA 2EO7A 3GBEA 4W7WA 3RCNA 1VAHA 5JUVA 4YPJA 1QOXA 3NYDA 3WF0A 5HXMA 1CBGA 4CD6A 2WHKA 2VCBA 1E55A 2D2OA 5BRQA 4AWEA 3AOFA 4MPKA 5EB8A 2Q8XA 4J3WA 1KCLA 1TA3B 3MKKA 1GCYA 2YA0A 3WFZA 2GK1A 1XHGA 2DT1A 3II1A 1GOWA 3WDHA 3VGGA 4UZSA 1QI3A 1WKYA 1A47A 1GZJA 4DWSB 1UH3A 4GKLA 3WMCA 2Y4SA 3WNOA 1K9FA 1CXLA 2IUZA 3BVVA 4AZGA 3CLWA 1BYDA 1KXQA 4PUDA 1I1WA 4MDOA 1GJWA 2A3AA 1TQTA 2YA1A 1ODUA 1E4IA 5BXSA 5IDIA 1AMYA 1TUXA 1R47A 1B1YA 4XUYA 3MUIA 1XH2A 4JAWA 5D8ZA 4PMUA 1UWRA 3ALGA 1CGWA 1BGGA 1HJUA 2VJXA 5BYWA 3RJYA 1CGYA 4BF7A 3AIUA 4CKQA 1E1EA 4HZ6A 3WY2A 3M07A 4BQ4A 5C70A 3LRMA 4ML4A 4AD1A 1VEMA 2QV4A 1Q6EA 3UESA 4F9DA 3HG5A 2XYLA 3MUZ1 1E4LA 3AHYA 1E3XA 2WANA 2WMFA 1UA7A 3ZR5A 3VSUA 1H4PA 1BYCA 1UR0A 4V28A 1W9PA 2XVKA 4X9YA 4JFSA 2YIHA 1B90A 3AHXA 1B3XA 1US2A 1H0IA 2NW0A 1QNOA 4B3LA 1EHNA 4PCSA 2BY2A 1QHPA 4M1RA 2YLLA 4UQCA 4HMCA 2VO5A 3HJEA 1V6VA 2UY2A 1OGBA 2YBTA 1UWSA 1RD6A 4AZCB 3LPFA 2GJPA 4AZ5A 1E6PA 7TAAA 5M5DA 1KGXA 4GZIA 2VCCA 4PMDA 1VEPA 1HF6A 1XYFA 1KGUA 4QDMA 4TX8A 3B9AA 2WW5A 3WENA 3PZ9A 3WF2A 4F9JA 2V5CA 1UUQA 5BCAA 1CWYA 5A6BA 4P7OA 4U5IA 1W9DM 3VIIA 1UOKA 3BAWA 1H41A 3A4XA 4PBGA 2ZX6A 1XV8A 3ZT7A 3IANA 2XGBA 4HA1A 1K9DA 5DFAA 3KWXA 1P6WA 3W28A 2HVMA 1XH0A 1UR8A 3PZOA 4W8LA 2EEXA 4KRUA 3W27A 3LXCA 1H3GA 4QCFA 4CCCA 8A3HA 3AMCA 2G3JA 4AIUA 4D6FA 1BYBA 4QP0A 4B9ZA 3B9DA 3G6LA 2BS9A 4D72A 2WHMA 2J7DA 1UWUA 3AIQA 3L2LA 5GNYA 5A1AA 4PMOA 3W38A 3SIMA 3A22A 1BVZA 1I75A 1KCKA 2J7GA 3DX3A 4PTMA 2WK2A 2O9RA 2WVVB 5M3WA 5A8QA 3APGA 3VU2A 3AQUA 3QHOA 3BAXA 3CC1A 3KLLA 4C7GA 1E6ZA 3W4RA 1W3HA 2D0GA 2D73A 3LRKA 3GZAA 3ZSTA 4MNJA 4D6EA 4PSPA 4EAMA 1HT6A 5F7UA 5D9PA 2ALWA 1MQPA 4MNKA 3HU7A 3D50A 3CH9A 2WYSA 3WNLA 3ARVA 4D6IA 3GXNA 1NOFA 2D23A 1HTYA 1JZ2A 2X09A 4URIA 1B31A 2A3HA 4FF5A 1O7DC 1VFMA 3BCDA 4J3UA 6TAAA 3PTKA 3WN6A 3MUAA 5CSUA 3N15A 3UG3A 4RE2A 5ABHA 3BC9A 5I0DA 3EDDA 3D4YA 3EJQA 4PMVA 4H8HA 3N04A 3CUJA 4MNMA 3VIPA 1FHLA 1WP6A 3WY1A 4IPNB 4JFUA 3VDHA 3WMBA 3WY3A 4JCLA 2DT0A 1UHVA 1E4NA 3LPGA 4HOWA 1EGZA 1TE1A 1WE5A 1C91A 4RE4A 5BROA 4HZ7A 2OWXA 4L4OA 5AYIA 2FGZA 3WNMA 4ZFMA 2WZEA 3L2MA 4M80A 3N12A 2J7HA 2PI6A 2GJRA 1UR1A 1UA3A 3SCOA 2VVNA 2VZTA 3UEQA 1EQPA 2ZX5A 4N0RA 5CSYA 1J0HA 4JKMA 4D6HA 2ZUWA 1VENA 4U33A 2YKKA 1QHZA 1V3KA 1UZ4A 1MQQA 3ECQA 2QPSA 3PBGA 4FK9A 3FNDA 3RO8A 5AC4A 4RL3A 1FHDA 3B8SA 4W7VA 2X2IA 3CUHA 4FNSA 1H2JA 3MI6A 4AD4A 2WCGA 1KQZA 3POCA 2VVSA 4OIFA 4M82A 4CN1A 2ZUSA 2ZXDA 5ABFB 2J62A 2V3FA 3EMCA 2GUYA 1MFVA 4J28A 5I23A 1K6AA 2WMJA 4LYRA 1W2VA 3A47A 2VQTA 4IUGA 2XFRA 2DSUA 2VZSA 2J75A 1R75A 4PMQA 1TR1A 2J8GA 1KBKA 1E0XA 1MXGA 1C92A 2DIEA 1UD2A 3I3EA 1ISVA 1SFSA 1OGSA 2JFEX 1KXVA 3CZ8A 1HXKA 3QR3A 2WVVA 1GONA 3WQVA 3VX0A 4P7RA 1UQZA 2JEPA 2G4FA 4NRRA 4YHGA 1XD0A 4UFHA 4Z2JA 3W37A 3D4ZA 3RIKA 4WIWA 1O7AA 4P7NA 2VR5A 1Q4NX 3KE0A 2PWEA 4OKDA 3FW6A 3AICA 3LPPA 5A6MA 4OGZA 1EDTA 1SZNA 2QF8A 1UH4A 2WCAA 4JFWA 3NJ3A 2EPKX 5CLTA 3MMUA 4GZEA 3NSXA 1QNQA 3K8MA 2WSKA 3WEZA 1CPUA 2OWWA 2VUYA 2DH2A 1ZL1A 2CEQA 2F7OA 1EDQA 1OT2A 2CPUA 4AD5A 5EFDA 2V38A 2FH8A 4AEEA 4TTUA 1EO7A 1CTNA 5HDRA 3AIBA 4NI3A 3H53A 3GYCA 1JI1A 4IPLA 1J9YA 3VDAA 1V0LA 5LA1A 3L4WA 3WDPP 3WUGA 1UWQA 4XX6A 5C71A 1JAEA 8CGTA 2D3NA 1TMQA 4UQ9A 2DSWA 4MB1A 4A3HA 3WUFA 1KXTA 3GXTA 4LX4A 4AZBA 5ABEA 1BVNP 2ZIDA 2W5FA 3MANA 2CCRA 3GXFA 3ZJ7A 1ZBWA 2DQXA 3K8KA 3W29A 1UKOA 5DEZA 1M03A 4HMDA 3RM4A 4A4AA 4AMCA 2BY0A 2DPEA 4GXPA 1ITXA 3UETA 3WF3A 1AQMA 3FN9A 1E15A 5CLWA 4FNRA 1UQYA 1CGXA 3EJUA 1HN1A 2CBVA 4GI9A 1IZKA 2YA2A 4UFLA 1E43A 3WQ5A 5E6YA 4E8CA 2Y5EA 3GH5A 3ZO9A 4MB4A 4H2CA 3W53A 3VD3A 3L4XA 3RJXA 3EDKA 3QGVA 2CYGA 4H04A 3ZOAA 2E3ZA 3WIJA 4HZ8A 2GVYA 1HVXA 2W62A 2V3DA 1PIGA 1QX1A 1WZLA 4FLOA 2ZXBA 4WSJA 1R87A 2XVPA 3WQ8A 1FH7A 3HG2A 2YDRA 1QWUA 2D0HA 3A23A 4HA4A 4WSKA 3UR7A 4WKHA 3GNOA 1V3IA 4HOZA 2JF6A 3IK2A 3NIYA 2BHZA 7CGTA 2IGTA 2YL9A 2X05A 2F1AA 3RILA 1XYZA 1NWTA 3AMLA 3VGFA 1G1YA 1CGTA 3BSGA 3SUSA 3WDQA 3T08A 3WSUA 1C93A 3BAJA 3W26A 1GOKA 4Y7EA 4P7QA 2VRQA 3PZVA 4AZ7A 1H5VA 1V6XA 4GQQA 2Y8KA 1E5NA 4AISA 3IJ8A 1CNVA 2WMIB 2X8RA 3U5UA 2GJXA 3GNPA 1ESWA 3G6MA 2VOTA 2J25A 7A3HA 2FDMA 1W1YA 3VNYA 2E40A 1R85A 2ZXQA 3IAQA 1GQIA 2CKRA 4Z2HA 4UOQA 1G0CA 3PZMA 1WZAA 1OCQA 2XG9A 4KWUA 3J7HA 3VIKA 4H8UA 2CIPA 5ABFA 3U7BA 3TTYA 2GDUA 1ECEA 3OLEA 2BHUA 4NSBA 4ZXLA 5D9NA 1Q6CA 3ZT5A 2EABA 2QHAA 4BQ5A 2XJ7A 3UG5A 2J7BA 2W63A 1H0GA 4JHOA 3LXBA 1QVBA 5HNNA 3VKKA 3AJ7A 2F61A 2DDXA 2CHOA 4U2ZA 2WBKA 2ZOXA 2VC9A 3IGUA 2G3NA 1JYNA 3JUGA 4QFUA 1FOBA 4TVDA 3WL1A 4CUCA 2D24A 1J10A 3AHZA 1Q6DA 3ARPA 2EQDA 4OBSA 3LPOA 2HISA 4OUEA 4IISA 4ACZB 3DX0A 1PX4A 3WQ6A 5I79A 1V0MA 4LPCA 2W67A 2BXYA 3BAYA 4LQ1A 4UOJA 4EK7A 2UY5A 1B30A 2CERA 2O92A 4DM1A 4CN6A 4W7UA 2CXGA 4JFVA 3U57A 1C7SA 4WF7A 2XWDA 4FNTA 1SR0A 3BAKA 4NXKA 1W32A 1C3FA 3GH4A 5AC5A 2OSWA 3VSTA 3CV5A 4AEFA 1NQ6A 2OWCA 4MAZA 1GOOA 2UWFA 3BVXA 4B15A 3WDJA 2VI0A 2F1BA 1E71M 4AD3A 1LF1A 2X1IA 2WVSA 4WJXA 2Y24A 1JYWA 1CYGA 3K4DA 1ZBKA 1GHRA 1QI2A 3T0DA 1FA2A 3WKZA 1EOMA 1V02A 1GQLA 2A3CA 1IT0A 3VIFA 3BMWA 2DT2A 1T0OA 1B3VA 3DDFA 1BFNA 5E09A 1JF6A 3O2LA 4Q22A 1CEOA 4FLSA 4BQ3A 1J0KA 1RP8A 1AQ0A 3W81A 3LXAA 4HP5A 3EDJA 1WDSA 4B3KA 6A3HA 1TQSA 4GO8A 2PWGA 3VMOA 2VZOA 5EFFA 1EH9A 1JYXA 4UQAA 1ISYA 1E6XM 4MJ2A 3SUUA 4BS0A 3ZJ8A 1KTCA 1J12A 3IJ9A 2CBJA 2YDQA 4GIAA 1VRXA 3SCUA 1V3LA 2CBUA 2YL5A 2ZXAA 3GXPA 4OBRA 4ZXOA 4R5EA 1E9LA 3FHAA 4WKFA 4FLQA 1LL7A 2WWDA 2F2HA 1E40A 3WNPA 5I77A 4HPGA 4NZJA 1JYVA 5ABGA 1M04A 1YHTA 1PZ3A 3KL5A 3D51A 4X0VA 1DTUA 3KL0A 1SMDA 5BXRA 4CCDA 3AZSA 2VNCA 3PZQA 4AD0A 4W8BA 3AYSA 1H09A 2AAAA 2WKGA 5DMYA 3DYMA 5BRPA 1KFWA 5CGMA 2XVNA 1HL8A 3ZM8A 3UG4A 2C0HA 5FD0A 1CLVA 3GNRA 4UFKA 1F4AA 2WB5A 1PIFA 1ITCA 4P8UA 2QLYA 3AHVA 1BG4A 1R34A 1K9EA 1C8XA 4FMVA 3WQWA 3AZTA 3TTSA 3OB8A 3KLKA 2XVGA 4A3YA 3CZJA 4KH2A 4F79A 3VGHA 4QLJA 3WL0A 4EANA 1JGIA 4PTXA 4PTVA 2CBIA 2VR4A 1HKJA 1UD4A 2W4XA 1CXEA 4UOZA 3N11A 4UZUA 2WHLA 1R7OA 1L0PA 1N82A 4CN4A 1QW8A 1J0IA 5I24A 3AS3A 1MWOA 2D3LA 1DWAM 3AFBA 4D71A 3OLIA 1DEDA 3PN8A 1L8NA 1JD7A 3AXIA 4PMRA 2XUCA 1KBBA 4DM2A 3GBDA 1QHOA 3DHPA 2UY4A 1M01A 1F4HA 1ZB5A 2VCAA 1KR0A 2VQUA 4CD8A 1DP0A 3CUGA 2WLZA 2OW6A 2OW7A 2EADA 3ZIZA 2VL4A 1W9VA 2WZHA 2VRKA 4AIOA 3WNNA 2ZX9A 5A94A 3EJRA 4BZYA 4W8AA 1QBAA 4JFTA 3VIHA 4S3JA 2X2HA 4C7DA 2F8QA 3GH7A 3PHAA 2DSZA 1C8QA 1XGZA 5GNZA 2ZX8A 1WDRA 4MJ4A 4OOUA 2ESCA 4LGXA 1XC6A 5A2AA 4FNQA 4MAVA 5A6SA 1MFUA 2OSYA 1FH9A 2TAAA 4PMNA 3AHTA 3EBVA 1BPLB 1CZ1A 5A2BA 3A21A 1DWGM 1VF8A 4HU0A 4DUXA 2RGMA 3BGAA 1CENA 1J01A 1LL4A 2FHCA 3VINA 2XM2A 1PX8A 3S5YA 1IV8A 1JDCA 4CCEA 1HJWA 4ATDA 1W9BM 3ARRA 4R27A 3W0KA 2BVTA 5A6JA 3WELA 1W3JA 4J3VA 3O9NA 3PZNA 3ARTA 2PWHA 4JKKA 4MADA 1V02E 3M6DA 1JG9A 1NWSA 3ARSA 1NARA 3I3BA 1VBUA 1PS3A 2YL8A 3MMWA 4DO6A 5A6KA 2AMGA 1AQHA 4Q7NA 5GNXA 3HMCA 1HX0A 2XFFA 2BY1A 3HZ3A 4AIEA 2EXOA 5FKYA 2UY3A 1UWIA 4DUWA 5JIWA 1GVYA 5E0CA 1R8LA 1CXKA 2EAEA 1HNYA 1TG7A 3CZSA 3MS8A 4Z2LA 3S2CA 1BG9A 2ZUTA 3KL3A 3BUIA 3U5YA 1JZ6A 1UWTA 1GW1A 2PBGA 1LJYA 4TOQA 3LX9A 1J0JA 2XN1A 5IHSA 3WMSA 4F66A 3QHMA 3BVUA 5CG0A 4BQ2A 3K4AA 2VX4A 4W85A 3GM8A 2VMFA 5A6LA 2V3EA 2IXUA 3OZOA 2MANA 4M24A 3NDYA 2WAGA 4TXEA 4PEEA 2W61A
chains in the Genus database with same CATH superfamily
1A6ZB 1I3RA 3BKCH 4LFYA 4GEIA 2J44A 1DBJH 3S34L 4HV8A 1SXCA 1WLHA 4FYSA 4XUGA 1IC7H 4N42A 3W02A 4KJWC 2EDMA 2FJSA 2VFDA 3VD7A 4FAMA 1UM6H 3UPMA 4P4KB 5DURB 3QV7A 3DC0A 4R0LA 5LO7A 1Q6LA 1ZS2A 4P5UA 1QBML 2NLJA 1SQ7A 1GTEA 3T2QA 4H8PA 4NJKA 3FTVA 1TVBB 2HRWA 4ZB0A 2AKRB 1UVQA 4XMPH 1M53A 1RUKL 3QG7L 4LAQL 4X8JB 1IC5L 5B7YA 4DHGA 4J23A 2NW2A 2O9OA 4FXGA 4MCNA 2ZZ7A 3UCQA 2CHRA 1SGJA 1ZEAL 2TMDA 3QUMA 4KGJA 1AI1H 5EU5B 5B1JA 3TC3A 4ZQMA 2IXQB 4ES9A 5I0XA 4GG8A 4PGDA 1FDLL 4AJ0A 1DQML 2YUXA 1YE4A 3HG4A 3CHEA 2NY0C 1E9PB 4AMXA 4QSHA 5FOOA 4LVHB 3BE1L 4X6DA 2HJLB 2Y7NA 3NCXA 4G7YL 3PBVA 4PJ8D 3MJGX 5HPCA 3JYBA 5CBAA 1OGGA 3UBXI 3VUSA 1YQVH 1QLFB 1QWHA 3APNA 4FKKA 3V6FA 3ES8A 2R56L 3O06A 9CGTA 5LKNA 2ZKWA 3V6ZA 1PLAA 1K3UA 1QNSA 4Z2KA 4HMNA 3T3MB 5D4YA 5E00A 1MCKA 1EUAA 1WBZB 1YECL 2FATL 2BCMA 2ON3A 1H8OA 4PHZA 2WC7A 3D69A 3DX8A 1VSCA 4DO7A 3ETTA 4U1LA 4D6DA 3OKDB 5CPTA 1EJRC 1N8WA 1WEJH 2PXYC 3MHZA 3V0WL 4TUFA 4ZFCA 3IDMA 5AWNL 3VRJA 4BI7A 5HBBA 2ZNXA 3RWEB 2VM9A 1XIIA 3CK0H 1F4WL 4D2NA 1AJZA 4R9OA 4IOFC 2J6XA 3S47A 2QCMA 5SX4I 1G9EA 4QHPA 4JIPA 5FM8A 1U8LA 1AZNA 4O2FA 1A9BB 1HHHB 2F58H 4PJDA 4Z0XB 5TGBA 3WUZA 1JZ4A 1A0DA 1HKMA 2CJSA 2CO7B 1MJ8L 1Q6FA 1SJVA 3SPVA 1T7YA 1LLOA 2YLAA 4KK9C 3CUFA 3WIHL 4UANA 5HQEA 4X7TA 4NO0D 5DC9B 1BBJB 4OCXL 3L9YA 3PWLA 4IIGA 1KIUB 3MRJA 1DUZA 2F7QA 3CUXA 1F7BA 5MHBA 1SXZA 3SCMC 1TCMA 2PRMA 3U0WH 4FEZA 1X8FA 2W9MA 1V03A 4JO3H 3T04D 1EOKA 1MFDL 2VELA 1OAXH 1GNXA 1GYWA 3NO5A 4AXNA 1XCWA 5EWIH 4WHTB 1I7UB 3A3HA 2EYRA 3NMEA 4K94L 4R4NC 1NGWA 3EOAB 3UTTE 4GQGA 1JFHA 3FFDB 2YZ1A 3WLRA 2WM0A 2D7OA 1T0MA 3D52A 4KUCD 4ASTA 1RBOB 4E0RB 5FO8A 4NUGH 3GK0A 3H2OA 3QC3A 4AVJA 3EWWA 1TFHA 4PJBF 5CINH 3FIGA 4EO5A 2CRYA 3HB3C 5CZXD 3L7EA 3KWWB 2EVHA 1NOUA 1IGIH 1PGRB 1JHKH 4K5PA 1VGEH 3MUGB 4O2EA 3OA3A 1H63A 1SBSH 3O6LH 5IMMA 4LNRA 4TOYL 4L0ZA 1FH8A 3O6AA 4LHUB 1XUUA 1NOWA 3GSXA 2YK1L 4NJ9H 4JKNA 1MCRA 1UWFA 4OTKA 4GPVA 2ICEA 4HUVB 4NUJA 1U8PA 4OV6F 3ZKNC 2BW5A 1P7QD 5GSRA 4PJFB 1IWAA 1O5QA 3M17A 4L29B 2YGYA 3MSYA 3SCPA 5IT2L 5G5IA 1BM3L 4XO7A 2XTJC 4EN3C 1ND0B 3OKEB 3GI9H 2UWEF 4ZMLA 1AW1A 1HP4A 4I9WD 4MDIB 4F9LA 5AAPA 2Z7KA 1DVYA 3CO8A 2LR4A 3OSVA 4KUZL 4LCIH 3STZB 4GRLA 2ED6A 3V7AG 4BFJA 5I1GL 5EUOF 3PFQA 3KTXA 3APDA 1BYOA 2X1PA 3GJEB 1JGMA 4LALA 4RXGA 3BUBA 3RGVB 2H6PA 4UM9B 1RZFL 5JHLA 3QXUA 2DI8A 1YPZE 3WFHA 4U1HB 1C8PA 4AYID 1XIMA 4UQEA 4HJTA 4GUHA 3OQEA 3C6EA 4BZ1H 1X7QB 5DDHB 5LCVL 5J7CC 1RBAA 3GDRA 3HUJA 1KB5H 2PTYA 3UBFA 4Q89A 1MCWM 4B9KC 2OMUA 2RDTA 4HD5A 2XIQA 5D7JA 2NY6C 3H9SA 2PWDA 4HS8H 1S2AA 1UGKA 4LSQH 3ZLHA 4A3RA 1Y5WA 3JWNH 1QEWB 4HHGA 4ZS7L 3VNIA 4A1RA 4XVSH 2Q10A 3P62A 4RNFA 4DBUA 3BVWA 3TJHC 5K9KA 1OEPA 3I50H 3BZDA 3NSNA 4Y2DC 3LMYA 4YMPA 5I1CL 5DVOA 3G6JE 3HHRB 1MN4A 4FZ8H 2FTWA 1R30A 2L7EA 1TOXA 4YR6A 5DRNA 4LVOB 1GZQA 3CN1A 4IOIB 1OK4A 1MZZA 3MRFB 4MA7H 1HKIA 2DQ6A 1BVOA 3ITXA 2AABH 1KC5L 2HX7A 1UG9A 1S9VA 1SOKA 3LKOA 3A5FA 4G7FA 2XG5B 1B0GB 1T4KA 2CO6A 1MRQA 1TV7A 2QMJA 3CH1B 3X3GL 3RM8A 4GP5B 4PJ8B 5ENLA 4PCPA 3WIFB 3QN3A 2WWKT 5BPPA 3DYPA 4LK4A 1B0GA 1GAFH 1KG0A 3SBWA 3DUSA 1T5KA 25C8L 2OCJA 5CD3B 3MRNA 1MMFA 3TVMC 2D03L 2D20A 1BM7A 2K8QA 2YD8A 3MZNA 2N56A 4BV1A 4U6XA 4Y5VB 4X98A 1A3LL 5ID0B 1V6UA 4FO4A 5D6CB 4JL1A 1J6OA 3PFUA 3IGSA 5IHZA 3AIWA 3IETB 5CIPB 1JPST 2C3WA 4P2QE 3H54A 1S7TB 1KM1A 2BGQA 2D9QB 1OCRB 2BIPA 4ICWA 2X4NB 3NQ2A 2NXZB 1N8IA 2J6EH 3I85A 2AJZA 2OMXB 5T5FH 3P0XA 1FN4B 1MSPA 3GI8H 4DQOH 2PWUA 3BLLA 1KCRH 4L1GA 3R89A 2VC7A 2X42A 1P7TA 4JFHE 2I9UA 4XZ4A 1WH0A 1ODZA 2PDMA 2PC8A 1SSGA 1A3WA 1K3IA 2JJUA 2DWTA 4OLXL 2UVEA 5CEYB 3HRZC 2O5YH 4TPRH 4N0UB 2FZDA 4ONFL 4NN6C 5I74C 3CHOA 3L3OB 1LP9E 1DWFM 4MZYA 1MCIA 1S7UB 5DYOB 3NIDB 1CGVA 5KJ7E 4HUKB 4J27A 3RWEA 1NOAA 4QRRD 2XV0A 4PEEA 3V6BR 3ZHNA 4D9QD 1HFBA 1SJBA 1V3HA 1YPIA 3MRHB 4NF7A 4H1LG 2PLTA 3M16A 1NCBH 2YUZA 3P69A 1W0VB 2EKSB 2ESVB 3EHBB 3ZLQC 2FGLA 1OBAA 3LKNA 4PMEA 2DYRB 1M41A 3LRLA 3NL5A 4K2UH 3MFFA 5EDSA 1NGQL 2DOCA 4X8CA 1W5MA 3IIOA 1FE8L 1PO9A 4YN3A 4MWAC 1JNEA 5EBAA 4PSRA 1JVNA 4L5FH 5DWUH 2VDHA 2FD6H 2Y8VA 2QPUA 3DH7A 4NQCE 2J8HA 5AKTA 1NKGA 3EFFA 1P7HL 3L3OC 2Q1EA 4H0HB 4R0LB 2NY2C 3BN3B 4Y19D 5AOIA 2LHAA 4JN6A 4HQQL 3MYZA 5IFAH 4BGDA 3AWGA 3W7KA 2WBJA 2IGFH 1PG7H 3ZJKA 1FFRA 3K2GA 3QA3A 4WKZB 1W6LA 4QOKB 2XIOA 1UOVA 1ZLUH 2ZWZA 3IMUA 4RZCA 1O94A 2RGLA 3H4WA 1G84A 4E0RA 4TQIA 5BU9A 3USBA 3U0WL 4XCCH 2REQA 5IHRA 3E0FA 3V9EA 3QFDA 3BWAA 1KKOA 4LCWD 5HJ3A 1IM3A 4NAEA 3MRIA 1J79A 1YC8A 2Z4QA 4LC8A 3CX5K 4LE8A 4OTXL 2WLJA 2DQDH 2JKXA 4DFHA 4HJEA 4LY8A 4R7VA 2B4GA 3WBAA 1YY8B 2WMKA 1KYAA 4IUOA 1S9YA 4PP1D 5HGBB 3AABA 3Q6GL 3KS5A 1HHJB 4HA3A 3QIBB 4Q8BA 4HNOA 3TLQA 3IDUA 4AQLA 4QRQB 4YTSA 2XU9A 2YDAA 2P7TB 1FG2A 3FQYA 2ZZ2A 3QJHB 3RGTA 3VQLA 4JKLA 5KVDH 2DI9A 4HFUL 1A3HA 4PUNA 1TV4A 3VXQB 3SCQA 4HIHB 4FX8A 1U91A 3P9LA 4P5TC 2CRIA 1EZ2A 2OR7A 5C0GA 5EUOB 3P4LA 3STBA 2BGNE 3R8BB 3NJKA 2OZ8A 3NQEA 4Q3MA 4CC4C 4PJCB 3NOIA 3VRJB 2C7FA 3IFPA 2QJMA 4E9VA 5IT2H 4DAGH 2A3EA 5IMKB 4A35A 5SWSA 3MCLH 1WAWA 3QZBA 2L4OA 4PJHE 5E6ZA 5JUEH 1I31A 2K9FB 3CUPA 1XL4A 3CC5A 2EUXA 3U2JA 4PJDE 3S2AA 3APYA 2AQ3A 5KN5A 5L88H 3IRDA 2HSAA 5A16A 3QDGA 4O16A 1P48A 2VO8A 3L3IB 4KDTA 3ZE2E 5FYLE 3RLSA 1A6UH 4US5D 3SIZA 2CA4A 1WKFA 2VDLB 4JTAA 1W2KT 4OJFH 1IKFL 1QG3A 5IB2A 1EEZB 3UTZA 5JXEC 2WSPA 2X2YA 4F57H 3OZYA 3SE8H 3IFOB 4FKEA 3VM5A 4C56A 1I2PA 5KYUB 1JPKA 1TPB1 4S2SB 4G8IB 1KB9J 1AZZC 1U41A 3ATBA 4LLDA 4MA1C 5K59E 2OEMA 1L6ZA 1GOHA 3U9UA 3NURA 4S10A 5F88B 4IIZA 3QJAA 1BX2A 4HBCL 3IJLA 1K5NA 4BGLA 4JO4H 4EDXA 5BW7C 4LSQL 1EVUA 1S38A 2MCG1 4C1KA 1UM4H 3LZ3A 4CVWA 3BUDA 4IM8A 3ROOA 3X11B 4WK9A 3LKQB 5E5MB 1DQDL 2JIXD 2JIWA 3QOKA 5LNDA 5IFJB 2DWSA 3HI5H 4FS0A 1JDDA 3LQMA 4PYGA 4A6YL 4Y2WA 3ABZA 3S9IA 2OYKA 3HM7A 1R3LB 4FQCH 4JB9H 2WLIB 3DETD 5I6SA 1YEIH 1WBJA 3CH1A 2CKBB 4RMWA 3TMLA 4DN3H 3VILA 2OA9A 1EUUA 3BCJA 2NY0B 1W0MA 2PRHA 4PWGA 2EDHA 3BUPA 2YDSA 4FRWA 1WZ1L 4LCQA 1Y5XA 4E9TA 3B9KA 4QRTB 1H7PA 5TD4A 3DFHA 4GA8A 4ZMQA 2H8XA 5KW9L 4I18A 4CLMA 3PNZA 1I7RA 3WJMB 3CZNA 1UR4A 4YLWA 3BW3A 4E3TA 2K7QA 3V0VA 3HFML 5ID1B 1OCWH 2V9TA 5HDWA 1JCMP 5B39B 1KIRA 3SE4A 2IXVA 4PGZA 5T5FA 1NCWL 3S3CB 3SB3A 4JNYA 5LWYH 2R1YA 4GBXC 3GXIA 3ZZQA 4JM0A 2HZHA 4BXVA 5IR1B 1DQXA 1A0QH 1W2PA 5E51A 1CFTA 5DRWB 4PRAB 3IVKA 3FHQA 2WN2A 1NMAH 3VX1A 1PKYA 1JL8A 2GABA 3OYXA 4FG4A 3W07A 1TRIA 1NIUA 1HAWA 5GPRA 3GWJA 3IEAA 5LB1A 4B3EA 1HKVA 2XZAL 2DW6A 5JOFA 2PB1A 3O0FA 3T8XB 2XTLA 1SMOA 2JF1A 1VJSA 1QU4A 3GXMA 1UR9A 4NYLA 2IANA 4BZ2L 2WJ7A 2Q3OA 3GTNA 3QDHA 4PI0A 2R4RL 1JXKA 2YHGA 3HPJB 4M0XA 1V51A 2Z91A 1F61A 4OI9A 5B7EA 5IWLC 2GQ8A 4XPHH 4GAYA 3TTQA 4B4FA 3PDOA 3IM1A 2XIIA 1SHWA 2IANB 2PP0A 1YN7B 2XA8H 4R9HA 4RK8A 3MV9A 4ZUSA 3SUTA 2WNNA 1LO3H 3TL5A 1N70A 1T0PB 2HT4C 1D5BA 1RJZB 1D5XB 9PCYA 1XBVA 5KBLA 1KTJA 1AJ0A 4IICA 5H2ZA 1Z9SA 3V4PA 5T1DL 5EPDA 1ESOA 2BVYA 2V30A 3HQOA 1ADWA 3EOTH 1SJHB 3IUDA 1LQSR 3BOVA 2XWEA 5F1NA 3VI3E 5CO1A 3HV8A 4QLKA 2YJQA 1U1JA 1UJTA 2MNRA 2ZADA 4FQLH 1HJBC 1NUGA 4M48H 5DXWA 1PZSA 2GGEA 2J5LC 2BOBA 3MRDB 1QYGH 4H20H 3MRCB 4Y1SA 5EORH 2AQOA 3RWHB 4ABWA 4ODWA 1QATA 4G7EB 5DHMC 2FK9A 1FO0H 7FABH 4C6NA 3BUQA 3N1QC 1S3KL 3QLLA 3VE9A 4FA7B 3FH7A 4WO4A 1W1TA 3TPUA 4NQEE 3N13A 1JK8A 3UP1A 3FUIA 1L7IH 4YPGA 4UNUA 1PLGL 1NBYB 2Z64C 5I17B 3HZYB 4FNUA 3C0JA 1VADB 2XX1A 4YIQB 5CBEB 1A7RH 3BGFC 2F1EA 4GRLD 1XI3A 1BBJA 4JFED 4CVXB 3D08A 1DSFL 3QQNA 1EMTH 4FQQB 4MD4A 1W5OA 3B97A 3VNJA 3HZYA 2I56A 3QRHA 3O3UN 1QPQA 2Z3FA 3WMLA 4DPPA 4HHWA 3ZR6A 5FB8A 1M05B 4KIEA 5I71B 1YEGH 4UTIA 3VM7A 3TONA 5AVRB 1WB0A 5D30A 2FAUA 3N43F 1TVHA 3HRZA 2BC4A 3MV8D 1E73M 3GMPB 1UM5H 3FEMA 1T5XA 3OAUL 2P4AB 1RIHH 2Q7AA 5ENWB 4D8LA 3H55A 3T4AB 1R3QA 1JHLL 1NBQA 4IMKC 4XD3A 1MQKL 4G9FE 4HHHA 3SDAD 3U9PH 4UV7H 4QRUA 2AJXL 5D9OA 1NGPL 4EAYA 1AKJD 1DJIA 3TNNA 1RZ7L 2WNWA 4POYA 4AQ8C 1G01A 3ABOA 4HJ1A 4G1MA 4W4OC 4I0PC 3E9TA 4TULH 1WBZA 1EQCA 3RU8H 2ACSA 2PLJA 4N9GB 4BWWA 2WMIA 3N3EA 1RJLB 1AFSA 3WQDA 4PEKA 2I9TB 2PTZA 4HUWB 4Z7NF 1CU4H 1NCIA 3N55A 1JQVA 3OGVA 2ICWI 3O9WA 1INEL 3P9MB 3BZ4B 5FI8A 5L88L 5MF5A 1LG1A 3VO0A 4YYCA 5FYKU 2Y2WA 1NCTA 3M46A 3UAJC 1JZ8A 4XODA 1JUEA 2HCVA 1XICA 5G2IA 1UQSA 2EE3A 4XSLA 1RUSA 4DAIA 3IDGA 5D1XE 5DUJA 5C08A 2NW3A 1NAMH 2VLJE 1GW6A 4G8GD 1IAIM 4NO3A 4OGAC 5CWSA 3HUJF 1UENA 4DW2L 3ONBA 4K9EC 5HHNB 3RLHA 5CJMA 5KBMA 3HEIB 3IIVA 4NO0A 1YXDA 5KBPA 4RAUB 2IDTA 3DMMC 5HPMA 5EIIB 5FL1A 5HYSB 1MWAL 2Z4GA 3LZNA 3HURA 3TZNA 3ASOB 1I8MB 1UM4L 2ZWLT 2UUDH 4U6HA 4MMZA 5GRVK 3NQAA 1VFBB 1XR9A 3ZO0A 5KYXB 1BDYA 3HVNA 1CICB 3Q06A 2OGYA 2Y89A 3BUYB 4XBJA 1AFVL 3M0KA 1DBJL 5JW5B 2G60L 4HH9B 2VZVA 3K71B 3WEXA 1F3DH 3ABMB 4KHXL 1TVPA 4AYEC 3HS9A 4YS4A 3C60B 3H3PH 3U36B 2W65A 4JEJA 1A5BA 3QJRB 4AMKH 1I3VA 1PZ2A 4F7MB 3RWFB 4J3OC 1XLLA 4Q8NA 1RVKA 4WY7L 4GKSB 4M6NH 3VIOA 1K5WA 3NGBB 3X13B 1Q1PA 1BLNA 3IGFA 1PFOA 3FQRA 3QEGH 3T09A 3UO1L 4XCNB 3PWLB 2H0EA 2I24N 2XWZA 4EJ1C 5JMUA 2KKQA 3SUWA 3FL7A 3PGDB 4PH8A 4MXQC 3AAMA 2CESA 4NZ8A 5BZDA 1CE6B 2Q6WA 1Y18B 5CJQH 4ZRGA 5JO5A 4A29A 3K6FA 4MNGE 4DPAX 2PPFA 4LMQI 5IMLA 5IQ9A 4EDWH 1I9JH 2CKNA 3C8KB 3LIZA 3UPCA 3WYZA 4Z7UB 4NZCA 3GU9A 2R2BB 4L2YA 3L8QA 4P9HL 4Y9NA 1Y7VA 4XPBH 3L4YA 4GBXA 3ILDA 2BVPB 3QM3A 1YQVL 4HKBA 4FXGC 4X7EC 3TBSA 3HIJA 4GIEA 4HK7A 4Y4KC 4YHEA 2CWXA 4S0HA 4P3CL 3RL2A 5MP6H 5E2VL 4IRZA 1F4YH 1S7XA 1UH2A 1NC2B 1N6VA 4C56E 1QRQA 3FXYA 4JRXA 4PMYA 4LDOB 3OM3B 4Z7UF 1KENH 3TO2A 1XW8A 2K3HA 4YNGA 3I9GH 2HFTA 3X17A 4DXXA 2Y7EA 5C8BB 1K5NB 2EE6A 4PY7A 4UQ3B 1O7SA 1K9TA 5FM5O 4U10A 4AQEB 5I9QC 4M4RB 4WUUE 4GI6A 4JGMA 4F7CA 2AOSA 3DIFA 4Y19B 4YH6A 5AFDA 1YG9A 1IBGH 2WLKA 3DNKA 1JNNH 5D55A 1FFPA 4QT5B 1IGSA 1H9VA 5AW8B 5FYLH 3QUYD 2CA3A 4F7KA 4L37B 4KWVA 4BK5C 5G1MA 4WEEA 1FCQA 2FBRA 1U8KB 1NEYA 2ZXGA 4O4VA 3QAZB 1TKKA 1S2VA 3L4ZA 1EGMA 4JQIL 2Z7UA 3JWOC 2YL6A 4NAFB 2C3ZA 1NWOA 1NFDE 1I2RA 1R6WA 5AQ0A 4BF5A 2WC4A 2NX5E 3NIDF 1KLGA 5D2LE 1J9SA 1NBVL 3FQWB 4HKXB 3M86A 1OVZA 4L1TA 4MQ7B 4P3DB 3LRSB 4FQLL 4ZTPL 5TH2A 5AOZA 2NDGA 4JO1L 1JCNA 2WUCL 4PJFF 4KVPA 4Y5YC 2EKSA 2YAQA 3DHJA 4IGBC 5D1ZA 1CDGA 1AKPA 1LT8A 5DSCB 2Q2LA 1RUAH 5LJYH 3BZFB 4N2HA 2GITA 3FULA 4WFED 4ENED 3TF4A 2J21A 4JPWH 4QHUB 1U93B 1ZJBA 3VXSD 1TZZA 4MJIA 3VMNA 3IN0A 1FVPA 4U7SA 1G0DA 2GSHA 4F2MA 4KV5F 3MVIA 4B5TA 3A12A 2NXZD 1P53A 4I5RA 2XZZA 2Z1BA 1AGEB 4O57A 4BCEA 3EFOA 3U6XA 4A8IA 1ZHNB 1QSFA 4RDYA 5BXPA 3F00A 1YMHA 3T1FA 3TFKC 1UG6A 1QBLH 4MD0B 4LU0A 2JCWA 1IGIL 1EZVY 1F6FB 2X6MA 1TZ9A 3HC0B 3GSWB 4R96A 4D1JA 3PWGA 4E5XG 3QE5A 2AK1H 4QWWD 1NPUA 4AGNA 4OD3L 4UCFA 2H32A 3AG2B 1F6KA 1XDMA 1NDGB 5EZOL 1KRAC 1CF8H 3OJVC 3GKZA 3UR2A 2GQAA 1Y1DA 3W5NA 1KM0A 1UYWL 2X4NA 2A9ML 4LMQE 4ZFFB 2EXYC 1A4KB 1QPKA 2PKDA 3C09C 2C8NA 1RSFA 4J1UB 4LNRB 4XP6L 5HYJB 5HMSA 2IPWA 5FX3A 2PDUA 3DI1A 4JL2A 4DN1A 4JIIX 5D33A 1UA6L 2P9RA 4F7PA 3WBEA 1KR1A 1V3JA 1TA3A 5BOOA 4FQ1L 4K94H 5H8MA 2E25A 3P14A 5E6RB 5IJDC 4MXWL 3NFSL 3QJXA 1S3TC 3K8LA 1M57B 3F85A 3UBXA 4HWEH 1B0RA 2EIEA 4S0SD 5EU4B 3AY4C 1XAUA 3BLPX 4NSKA 1CB2A 2XBDA 1TJPA 1T83A 4XXCC 2BH0A 1DXFA 1KLZA 2XIDA 1P1VA 1N0XH 3EF7A 4Y4HC 4J5NA 4QKXB 1GG0A 2BIHA 5C0BB 1VGEL 3GJFB 3ATYA 3EWUA 4M81A 4DEFA 4LDEB 2HA1A 2JJVA 1I2NA 4MJHA 3MV8E 4PMXA 5XIMA 4O9HH 4UT6A 3JWDH 5EU6D 5T33H 1HU8A 3KWUA 4JM2C 1MRFH 1WO2A 4DWSC 4MDPA 3S1WA 4JDVB 1J5SA 1EAOA 2H6UA 2AC0A 6PCYA 4JAMA 1OTTC 4QI3A 4UQDA 4XZUA 4MQSB 1KPUA 1PV8A 2MMXA 4P3DA 1BM3H 5D1XC 5EU3A 3ULUF 2Y70A 4OLUL 4PUWA 1J0ZA 2EUWA 2D2JA 3HZKB 3NDOA 3OPSA 4PLNC 1G6RL 1XBDA 1X4YA 3UCCA 4WUIA 4AZHA 5AC6A 3V75A 3OAWA 4U4BA 4N0CC 3IXTB 4Q8PA 2ZTKA 1IGCL 1JF5A 1HXMA 4JO2H 3GW0A 1DIDA 2W60B 2H3NA 4XO5A 3QI9C 2DQIH 3G3LA 2N3JA 3CAWA 3KOFA 3OOQA 2D69A 3LHPL 5A3HA 1URIA 3FO0L 4AXWB 2HPIA 4MZ3A 5EMKA 2ESVE 1UWEL 1HJSA 4OAWB 3EH2A 4Z0JA 5C2GA 3CHDA 3SE4C 2PZ0A 3O9WD 4HK3N 1NWUA 4BFOA 3RX9A 3ZVHB 4U6TA 4K9EH 4ZTEA 3QEZA 4PB0H 4H0LC 5HD8C 3FRUB 2R2HB 4IJBA 1PY0A 3GJFH 4WI9A 1WPCA 1Y18A 1G0YR 5EH1A 5JO5B 3RG1C 1EDYA 2Y06H 5ESVB 4PTTA 3VSVA 3EX6A 3LEXB 5IDZA 3PP4L 1XR8A 1OX5A 1QDSA 1X5ZA 4Q33A 2XHYA 1KB3A 3GFUA 3WUWA 2DQWA 5E8DH 1AE6L 2CO2A 2FBOJ 1NC2A 4F58H 3QQDB 3RPIB 2VAAB 3GUTA 4L9LB 4AYFA 3FQTA 1GOQA 2N1TE 3ESOA 3MR9B 5FM5M 4BSWA 4QLLA 3QXAB 1LTDA 1Q8AA 4UTFA 2IPFA 3O2VL 2QZ5A 4L4VE 4IK7A 5IW3A 3TC9A 4Z1YA 4WI0A 1H50A 5C7XH 4IRJB 3HB3B 4JO5A 4TPRL 1P5BA 1UC5A 4IG2A 4WEVX 3KEHA 2WJZA 4XV0A 1NGZA 4PB5A 2AITA 3K0WA 5D96C 1TFPA 4KKQA 5MP6L 2YPKB 4PS8A 1AGBA 1VFSA 3JT0A 4JFEA 2OEKA 4AQ1B 3HG1B 5J89A 5LNVA 3QPZA 4AC2A 4NRXB 2IADA 3EJYD 4NKOA 4BK4A 4ZMAT 5CLYA 3GC4A 3MRRA 1IFHH 4IS6A 1ZSDA 1G5AA 2VGBA 3PM6A 3SUVA 2QELA 2YLHA 1JBJA 3SJVE 4LBUA 4G8EB 5MEND 3RYSA 3SKOA 2DL9A 2FUTA 4PV9B 5T3ZL 4KFPA 3VE0A 3DFOA 4X99B 4NN7B 4WO4D 1FDZA 3BPWA 4MJZA 4W5UA 4Z1AA 5HYFA 2A2QT 1K3ZA 4ABQA 4JVWA 5BRZB 3FUMA 4AQAB 4PVMA 5E4AA 2JQXA 5IJBC 1VACA 2F18A 5C97A 1BIIA 3OKKA 5JBFA 1DLHA 3U6RA 1X4XA 2ZAGA 4GYJA 3OBAA 4A6GA 5INDB 4PW3A 4JQVC 3A4AA 3Q6FA 2VLRB 4D9LL 5LGHL 6TIMA 4AZ6A 3VKBA 2OTWB 2Y62A 4HMEA 4JW3A 1AOZA 1JPDX 5D7LB 3N18A 4LAZA 2XIBA 2NR6C 1NP0A 4GIOA 4I8DA 5LUMA 4DKFL 3V2AR 1N5AA 2P47B 1TPDA 3EGDB 3VGBA 2BVEA 1QPNA 4G9PA 4MYAA 3SCMD 2VLJD 2VN7A 1TZHA 1K1DA 4KHTH 1SJEA 2AW2A 4XBMA 4DZBB 2IFGA 3GRWH 5JA9A 4HCDA 1TSHA 5D2LB 4PS4L 3ZY7A 4FXGB 1KV7A 4MAYA 3DMMB 5ADPH 3LZOA 4AJWA 4PRDB 3KBNA 4IGNA 4MY8A 1JPMA 5EF2A 3LEVH 4LSUH 5AKVA 2Y7DA 4O1CA 5AKQA 1BJ1J 1KTBA 2M2DA 5DRCA 4NZRL 4EZKA 1I8KB 1N55A 4MF4A 1RPKA 3KOWA 3PPCA 3LHAA 4F93B 1G6VK 1M9HA 1MO0A 2F5AH 3M9YA 4XC1L 3QW3A 1UOZA 4A38A 3BFOA 4BKLA 3CZEA 4WI0B 1XLAA 2RFXA 2J7CA 4IG2B 2I5GA 5I2UA 2B39A 3KBVA 2A9MH 5IV2A 1PWMA 2GAZA 2VH5H 3OAYK 1YHPA 3OPZH 5E0QA 5GS1A 2R29L 4YPGB 3WFCL 2CNZA 4JY5H 1WFJA 5LG1A 2A6IB 2GDVA 3KZSA 3UC0L 3HE7B 3CJJA 2BDQA 3ZFHA 5HPOA 2Y23A 2W66A 2D1ZA 2PDKA 3EYUH 3I7RA 3N2BA 3G5ZA 5F72S 1GGIL 2A74B 5HHVH 1P7KB 3E38A 4CVXA 2ZUNA 1ECQA 1CDJA 2B7NA 1GGCH 3WTUA 1IAIH 4UV4L 5D2NB 5E9DD 1VB9A 3FFCA 5CPOA 3T55A 2UUDK 1AZBA 2BVQB 3LHWA 1NDMA 1RUPL 1M1BA 2J56A 3WHE1 1CICD 1MUMA 4Q6KA 3SEPA 3BYYA 4F57L 3D3VB 2ZZ5A 3SE8L 3S88L 4DGUA 4O10A 3S1GA 1LEKA 5DZNA 3BYTA 3C6SA 3B3IB 1KZQA 1FKWA 2HFEA 4DT2A 5C3LD 1F3JA 1F2JA 5IVNA 3BO8B 4AG4L 5D96B 2GJZA 5DMKB 3R43A 4M1DL 1LCOA 5MEQA 2WQAA 2E6FA 4JTQA 3Q8FA 1CFQA 3GSUA 3QPXH 4N2GA 4NKDB 5I0VA 2NY6D 2X4SA 5CZRA 2B0SL 4YFLF 4S38A 3QIWC 1GGUA 4ZENA 3KHQA 3V0HA 3MCLL 1PX3A 3VH8A 2OZ0A 3I3DA 3KBJA 1QSFB 5HUOA 2WSQA 4DX3A 1PU0A 5L7XH 3N41F 3AAZA 2BFVH 2R0LL 1EJVC 5BZZA 2D7TL 1B2YA 2FO4B 5DVMA 1UACL 3KDPB 3KHOA 1RJZA 5D7KE 1WX0A 2ZZ3A 3IIXA 1TZ7A 4EZJA 1T80A 5HULA 5DT1H 4OZOA 4AT6B 2A0LD 3LHUA 1KTLB 5H8UA 5H4ZA 1AG1O 3MV9D 3CLEH 5C08B 3ZKMD 3LS4H 3U4EB 1TQBC 3E49A 3ZS4A 4P2RE 3FYIB 1FL3B 2X9ZA 1YY9D 2WCSA 2SODB 3NPZB 4OT7A 5E6ID 2ZWYA 3GBEA 4NS0A 4XISA 5CCZA 4YPJA 5CCKL 1D8CA 1F3DJ 3FB7A 5JIHA 3F58H 3P4MB 4NKIH 2E9IA 2OT1A 3QRGL 1OXYA 3MLZL 3TJPA 4FC3E 5MHSE 4FTDA 5EO9A 3S1VA 4XP1H 1OX4B 1LRTA 3DFSA 1I7RB 1QSVA 2CH8A 3WJMA 4J3WA 1RZKC 1TIMA 2Q8XA 5GSRB 5H8DA 3OL2A 3ULVF 3L3JA 4ZQCA 3MKKA 4Q4OA 4KH9A 4EOWH 3G77A 2VDQH 1Q2SA 1UT9A 4HZMA 1AE6H 2GK1A 1CYXA 1IBBA 3OQRA 1OANA 1U42A 1KCWA 2WXRA 1XHGA 1XZWA 2Z0IA 1LO2L 3II1A 4FFYA 1XCFA 3M0YA 5EMMA 1J7VR 3VVVA 2HWGA 4FOJA 4WVXA 1ACXA 3GMNA 4PI2A 5E5RB 4I9WE 4KI1A 3WDHA 4ANKA 2WCPA 3E2HB 4UZSA 5ESAA 4KK6C 4K39A 1WKYA 3G8EA 3TCTA 1BMWA 3VW3H 4AVNA 1WAAF 1GZJA 4DWSB 1KFLA 1K9FA 4ZFQA 2IUZA 5KITA 5C0AB 5GGUB 4TSAH 3CLWA 1IGML 3Q48A 1KXQA 4YCOA 1UXWA 3NZSA 4GAGL 3C6LA 4PUDA 2PR4L 4ONGL 1VDGA 2R29A 3VYNA 1SYVA 1I1WA 5AAMC 4A7TA 3QW4B 2A3AA 1J9CT 4PFMA 4IEFB 1OSPH 1F2XK 5DQ9A 1AC0A 3MLSH 3VRLE 1QR1B 3NO3A 1V7NL 1GS7A 1NL0H 4PJEB 1B1YA 2GVLA 3KAAA 4R5XA 4JAWA 4XP9H 3UJSA 2DQGH 4XBSA 4J1OA 1D5ZB 2JKLA 2VKWA 2VJXA 2BERA 4Y16A 2NMSA 1TDQA 5GGVY 4YHYC 1CGYA 2WBJD 4ADGA 3QJQB 4CJ0A 2WN3A 3K6IA 4LOFA 1DVFC 4HZ6A 2J1ZA 1ZTVA 1R5IB 5LXXA 5AZUA 1P4IL 1IXQA 5C70A 4DZ5A 3LRMA 4I5BA 4I85A 3ARFA 4H88H 4CSSA 1JXDA 1R3WA 1X98A 2OB3A 1VEMA 5DS8A 3W71A 2RAMA 3TA6A 4S2BA 3E12A 2A6LA 2HE8A 3LD8B 3CHSA 3FDGA 5ISZD 2I17A 1ES0A 3HKZA 3VXUB 2G5RA 3OKDA 1I8KA 4Q52A 1KBWA 3MUZ1 1FL5A 1Q65A 4QTHA 3AHYA 2FVLA 3L9CA 4U1NA 3K2MC 4I0CC 1YXYA 1N2RA 5DJ0A 3ZR5A 4YDLB 4LLWA 4M8QA 2CK0H 1MUJA 3NCCB 1H4PA 2PW2A 1ILSA 4Q6IA 3VXMD 1BEYL 5SWSD 3RR1A 4AF0B 1JZEA 1NGXA 4X9YA 1UWGH 4RNHA 4QYOA 2NY1B 3W2MA 4MJ5B 1VBGA 1X5IA 1QYGL 1JPFB 4IIQC 1RIUL 4AQ1C 1HEJC 1DQVA 1CI3M 1A22B 1T1YA 3JTSB 1RERA 1B3XA 4NDMA 3NSDA 2GFBB 2V5SA 1S3KH 3MUUA 4XWGH 3ZE1F 4B5ZA 4PJXA 3T0EE 1QNOA 2WP3T 4YS1A 5K39B 1VHNA 2BY2A 1QHPA 5FEZA 2AEIT 2FJHB 3KPQA 5HDBB 3T77A 4G1KA 3RIAF 4UQCA 3JBG7 2CCVA 2WOYA 1AZRA 1WHOA 2A9AA 3OPZL 5FYJE 3SJVA 2Q20A 3VE0B 4JVPA 5EO0B 3WHXA 4I5UA 1AD9A 3CMFA 4NENB 4X6FB 3H6AA 5GGUA 1OGBA 2UY2A 2YBTA 2CM6A 1RD6A 5JNYB 2FFIA 2NY0D 4F7TA 4XMKH 4Q4QA 2I32A 4X7DC 3H70A 3REQA 3IUHA 4X3ZA 2HVOA 5DGRA 3QQ4A 4UV4H 1E6PA 4UTKA 2OVLA 4KWSA 4TYUA 2Z26A 4NY2A 5M5DA 5ITFA 2AQ1A 4MXVE 3SKJL 4PMDA 1E6JL 4X5XB 2L0DA 3CZFA 4PJBB 1EJFA 5BXFA 3TT1L 1KGUA 5DEFB 5CNHA 3ZDXF 4NQCA 4EPKA 2ETWA 5FAAA 1GTHA 7PCYA 2OMZA 4TKWA 2RJGA 4P57A 3WTTA 2WW5A 4UTCA 2V69A 3WENA 4ICXA 4A2DA 3PZ9A 4UR7A 1CWYA 3GEFA 5D1QA 4X0KA 2AEQH 5A6BA 1XGUB 1A1MA 3SKUD 1I60A 1PKNA 3GRBA 4PBXA 1ZNNA 2WO5A 5I8KH 3HZVB 4I7VA 3MGTB 3EEZA 2DBLL 4GG6A 3IFNL 3WXVH 4YSSA 2XU2A 4YTQA 1UW9A 1OC7A 4P2AA 4S3DA 2OTPA 3BDYL 4YVUA 5LAPA 3V6OA 3QB7C 2YYUA 4ADIA 4PCKA 5DSCA 1OK8A 1INEH 5DFAA 4WCYH 4XB8A 4Z9KB 3B04A 1A50A 2HVMA 1PDKB 4XVEA 2GJLA 3PZOA 4RNJA 2PUQT 3KNBB 1BRLA 4F1SA 4GRMA 3WG7B 4U6HB 1I1FB 3QP3A 1EF2A 4K8RH 4N8VG 4TQTA 2CLRB 2EC9T 1EC9A 5B1JC 2V2TB 3DXIA 1NAML 3W27A 1B4KA 1KV8A 3RX5A 4XP5L 2G3JA 2PE4A 4MCZA 3CH8A 1L9QA 3EO0B 5C0EA 1G9MC 1BYBA 4JUTA 1NPJA 3DJSA 4XNYL 4HUCA 3H3BC 3B9DA 3DJTA 3ZLFA 1ZT4A 4D72A 3BH8A 4F8NA 2P5WA 1DIKA 3UXKA 4UMGA 3PWUA 5A1AA 5KSAB 1WKDA 4G6KL 2NUTA 4PMOA 3B8YA 5I6LA 3RZCD 2G75A 2XI9A 2OKTA 4XOCA 2WUBL 1BVZA 2DLTA 1AO7D 1FIGL 1I75A 1WS7A 3BH8B 3ZGHA 5EIVA 3W00A 1NBCA 5GS2H 3VXRD 5I0WA 4ZX5A 1PTGA 2WIIA 4PTMA 3U7WL 2O9RA 1WT5C 1K7FA 1TEGA 3UJ2A 4DJEA 4PJHA 3LHYA 2V9UA 1A80A 3APGA 2O5ZL 2M8XA 3NN8B 1TIWA 5ANME 2AKMA 3FYPA 1XX1A 4C7GA 3TZVB 3MLRL 4MHHI 2FZ3B 3ETBF 1E6ZA 1J1OH 4ZQPA 3VB9A 3NZPA 3LCXA 1ZIAA 2CSPA 3UO8B 2RA1A 5D6CA 4HNLA 1SY6L 2ZWKA 4G1EB 4MNJA 2B4CL 5DK2A 5F7UA 4AWJC 1SYVB 2DZWA 1L9PA 5F9AC 1VR6A 4QE4A 5D9PA 3BT2L 2PNDA 3J07A 3MKGA 2OMWA 3GKWL 2PLMA 3D50A 2KLRA 4AZUA 3PQYE 2F74B 1K4GA 3WNLA 4XPBL 2QL1A 5BO0D 4MNQD 3GINA 2XZ9A 3ZL4H 4Y9PA 1AUSL 3GXNA 1NOFA 2IOIA 3OKNB 2ARWA 5D9SB 3KWVA 1AQ8A 1G6CA 4PRRA 3R0KA 3UJEA 4FF5A 2A3HA 4C6CA 5LGZA 4L5FE 4NPYB 1OABA 1WQ5A 2H3KA 1O7DC 4V33A 5KSVA 4Y1TA 2WZ5A 2GY7B 4J8QA 5JIQA 1Q5MA 3PTKA 3P3YA 3D69B 1KJ2A 3STGA 3FT4A 1YUKB 1TQBB 2ESVD 4NLHA 4BEIA 3PU7A 1ME9A 1T6MA 1EGJH 4M43H 3MHGA 5GRZA 3BUYA 3S83A 4DNHA 3NZHH 5F89B 4BK5A 5DZ9A 2BWIA 3G08B 4H8HA 2VDMB 4ELMB 1ADOA 1YRRA 4AV0A 3KBSA 5FO7A 4HN8A 1LE5B 5E8NA 3TIDA 3W39B 4LEFA 4LW7A 3VIPA 4ZOAA 3G5WA 1FHLA 4WWOA 4JRYE 1BA9A 2Z8SA 2XTSA 3WY1A 3TW7A 4JFUA 4M7LT 3FXGA 3WJSA 5TQ0L 2ZCLH 2AK1L 2CCLA 1QEXA 2BWQA 2J24A 1ELSA 3MYPA 4PJGE 4I8YA 1UHVA 1TUFA 1NGYB 1RCYA 1BEYH 4WHCA 4S3BA 1WE5A 4Z8FH 3W7QA 1E0OB 1ORSB 4CW1A 1KM5A 2FL5A 3IMRA 1P0DA 4KERA 1BZ9A 2OWXA 4L4OA 5AYIA 4UOW0 2DZPA 4MPQA 4P2VA 3VZYA 2WZEA 3L2MA 1GOXA 5JH2A 4WKXA 3OR7B 4HWBA 1WIPA 2NY5H 3H56A 2AGJL 2YD6A 2PI6A 2HG0A 1MHEA 4NVTA 2GBAA 3KYMA 5AW2B 5DD3H 2BDNH 3H23A 3BKMH 3KGSA 3UEQA 1EQPA 5E8OB 2F38A 2ZX5A 4BZ2A 4N0RA 4UZGA 2JKSA 2F7IA 4X4ZA 2FX8L 2C79A 4XMPL 4IL2A 4IRZL 4D2JA 2P50A 4LL9A 2K45A 3PF3A 1IEVA 2YKKA 4C6JA 4MJ6B 3WYRA 4TL5A 1V3KA 4NQCB 4WV1B 3NL2A 1SLWA 3V5KA 4URKA 4BHUI 2AS5M 2OZTA 4B9PA 4HIHA 3U0HA 3PBGA 1QLRA 2O7SA 3RO8A 2OXHA 4MGGA 1RK6A 4JY8A 1ZHKB 3QJHA 3GO1L 4PLOB 5D2NA 4TQ8A 3UTSE 4AC4A 1AXSA 2P5WD 5DC2A 1FHDA 3O3BA 4R34A 1O75A 3M0XA 2XQ0A 4FQ1H 4W7VA 1P7KA 3PR2A 3CUHA 4W4NA 1MI5E 1B54A 2PGFA 2AK4D 4AD4A 4E2DA 2WCGA 2GSIB 3LH8A 5EUOE 4XNUH 4PRNA 2ZCGA 3T4YA 2BP1A 3DRQB 2ZXDA 1I85A 3IFNH 1PMYA 1EEXA 4UTMA 4GBUA 5ABFB 1FHGA 1RURH 1U8HB 3EMCA 1MRCH 2BIQA 1RZJH 2GUYA 3CK5A 2FECI 1CD8A 4J28A 1S5IH 4NQEA 3UBGA 3W9DA 4DOHE 5J12B 5AC7A 3EGSB 4MS8C 3DGBA 3FVDA 4YJZL 4RESB 1RK1B 2XQYA 4X9HA 3N44B 4TNEA 3FUKA 3QAQA 2BP0B 4FQXC 1E8WA 3V0WH 1DOSA 1W2VA 2GFBA 4IUGA 2DQUH 2XFRA 1JGEA 1F42A 3H9SB 4KQ4L 4LHUG 5F70A 4XPFL 2XG4A 3QO1A 4G43B 2I14A 5HGHB 1R75A 1KM3A 1ZT4B 1TR1A 1H60A 2NTFA 3OW1A 4GRWF 5F1SA 5C0DB 4HAKA 5IFHH 5ABDE 3TEXA 1RZIB 2ZCHL 1TJGL 2E77A 2E68A 4AG0A 1XLFA 3DX6A 4V1DB 4CNPA 1KCXA 3ZVVA 4UM8B 4YSCA 1HXKA 3LS5L 1SM3L 4PLJC 1F4XL 4HT3A 2MCPH 3CIAA 2VIRB 3FZUC 1DVUA 4LHUD 5IOKA 3WQVA 3GZPA 5DVPA 1W56A 4G11A 4P7RA 1JWSA 2WKJA 1LO4H 3V0UA 4ZUTB 3IIPA 4DZBA 4JFQA 4NNPH 4F8QA 4J3ZA 3W9EA 4OT1L 1KW1A 5C7XL 3QGAC 4UFHA 2ZP8A 2DICA 2C4XA 3D0VA 2VP8A 2HTMA 2XZ7A 4Z2JA 1CGSL 1QO3A 2A7PA 3PBWA 1H6TA 3RIKA 3Q1SL 1Y0EA 2P7TA 5AG8A 4P7NA 1GKOA 5I1HH 3P9MA 1PYWA 4XRCB 4OKDA 1OF8A 1KMGA 3HPLA 1A1MB 2YPKA 2VDRB 4W4QA 3RCMA 3GTIA 2NYYD 5A6MA 3R8RA 2ZRVA 3PXJA 4UT9A 2CMRH 4O1EA 3BP5A 5CAYB 2GT9B 1BQ5A 1RV6X 2ZCKH 4MDJA 4S1RH 1B6UA 2WWMD 3P4OA 2NXYB 5B38A 3MMUA 2GI0A 4S3CA 3QTPA 1XDTT 3W70A 4XNZC 3C5SB 5F44A 5IJVB 1SN0A 3ZDZF 1BXBA 3RLGA 3U2OA 3V0VB 3WBWA 1VRSA 2BS8A 4MGXA 4L80A 4LLUB 1X4ZA 4ERSH 1WA2X 2V9RA 1FNEB 2WSKA 3NFNA 3PWPD 4YFEA 5BOPA 3VFGH 4ZGYA 5D1ZD 2XH4A 3MXWL 2PFHA 4YDIH 2VUYA 3IBEA 4K5MA 2YN3A 2X4SB 1ZL1A 1UWAA 4XAYA 3L6FB 2FDSA 3N3MA 2F7OA 3CIXA 3HG1E 3GS4A 5IK3A 1NLDH 2IPUK 1U2CA 3GBNH 1OALA 1T2XA 4UU9A 5FHBL 2OK0L 3C2VA 3MA8A 4QR6A 1YECH 2FH8A 5J6GA 1WIOA 5EZJA 2B2XL 2YXFA 2PP8A 4G8TA 1LEKB 4K7FB 4K55A 4HPYH 2CO3A 3J8F7 5HDRA 4B9FA 5GZOD 1PHWA 3R25A 3F2DA 3BESR 3S4SB 2ARJA 3H53A 4IIQB 1GYMA 3GYCA 3VE7A 4JHAH 4WO0A 3QWRA 2MCMA 3VDAA 3X13A 1GH7A 1V0LA 2Z6JA 2EO9A 3UROR 2VDNL 1O9VA 1Q13A 1Y5VA 3WUGA 3TFKD 4IWWA 1AQKL 4XX6A 2EKGA 4WTQA 1H3XA 1KRMA 5J11C 3PJWA 5E6IC 3MXVH 2NVCA 4JJ5A 2GJ6E 1TMQA 2GQ9A 3OXSB 4JFYB 2WIMA 4AM0Q 4LLMB 5EZIH 3CU2A 3UYIA 5LN4A 3ZVHA 3CSTA 1SJCA 4LUJA 2CBPA 2R8SL 4HAFA 1QUNA 4TTDC 3GPEA 3P02A 1CS6A 4PD4J 3TA4D 1PB0A 4XPAH 1HDMA 2XFXA 5DJCB 1BVNP 1U6AH 2WKOF 3ZRCC 4FYRA 2ZP9A 1OPGH 2WWNA 3TU6A 2GHZA 2DIBA 3V4PL 4UUIA 1ZBWA 4NJIA 1W6WA 3NTCH 1F8TL 2ZRXA 5ANMB 1ROCA 3B5GA 3PL6D 1E9QA 5FUCE 4X6CB 5F7WC 5J5DA 1X97A 4M93C 2HKAA 4HMDA 3RM4A 4CQ8A 4FFWD 2Z93B 2ZZUT 4PG2C 5DURD 2R82A 1G7MB 4GXPA 4HX1B 5I1JL 1ZUAX 4GX9A 3LZ5A 4DLMA 1FVCA 1J8VA 5T8IA 1JGDA 5KSAC 1QRNE 2FTPA 2IG2H 4LZKA 3RTQD 3W2DL 4C83B 5LXVA 1TPFA 1E15A 3EH1A 3G2GA 1WXZA 4KEVA 3DPBB 1I8LC 5IHWA 4W9EC 1CGXA 2VDPH 3KR3L 4KRZA 3DVNB 2GIYA 4GI9A 4Z1BA 2Z2AA 3L5MA 1FLRH 4IYKA 1E43A 2KAUC 2VW4A 4ZMOA 2WJFA 4DLFA 4PUMA 5E5LA 3CVHL 2Y5EA 4M7ZB 4PV9A 4XH2A 3NQMA 4M3PA 4E8CA 4LSTL 3QHFH 2GK0B 2G5WA 1Y0LA 1FO0A 3VD3A 3N4EA 2RAGA 4H9ZA 4JFOA 1T5XB 3TJEL 4D7BA 4UNTA 1FORH 2OXGB 3EXSA 1QJWA 3NNTA 4H04A 5L7XL 4DZIA 2ZNWA 5AW3B 4XGZA 1V6TA 2IDSA 3BP6B 1XQ4A 3M1OA 2Q5BA 3U25A 3HMXH 3P1VA 4L0YA 2AXGB 3FBQA 2IALA 3ESPA 3UVIA 2W62A 5AVZB 1PIGA 3UWZA 1ZJHA 3LOWA 3D2UD 5FF0A 1IC4H 2ZXBA 4MWAD 5FAJA 1DHPA 3EJZD 3QUZC 4FQ2H 1R87A 3CVHA 2B14A 2UXFA 4WUUB 4Z7IA 2YDRA 2D0HA 3HE6D 5E4EC 1EK3A 2PPDA 5FHAL 2WZTA 3DFNA 4HA4A 3CN3A 1EEUA 5BMWA 1D5MA 2DQEH 4V15A 4KJPC 4LOVA 3GNOA 1V3IA 4JPIB 4BWUA 2EIDA 4HOZA 1F11A 2DD8L 2JF6A 3S6CA 2FIQA 3W88A 3X1GA 3DGGB 3DVFA 5DUMH 3T65A 3T44A 3P0YL 1R3LA 4G6FD 1BQLL 5DUPH 5KSUB 1M7JA 4QEHA 3DO3A 4HIQA 2F1AA 4PP1C 2WQWA 5EOCJ 2QS8A 3HV9A 1Q9WA 3WIIL 5LGXA 3RILA 5TAOA 3W11D 1NIBA 2L3BA 4R7DB 1MQ8A 3VGFA 4PG9A 3WQGA 1CZ8L 1SVZA 2J20A 4X6CA 2WLIA 4MZIA 3RLVA 2EE9A 2YAPA 3BSGA 1RMFH 1U2HA 3LS5H 4KMTH 4F3FA 3TESA 3WE6A 4OV9A 2AABL 2AXJA 5TPWL 3BW4A 4GE8A 1C93A 5B4MC 4L64A 2CCWA 3HZMB 1OY3B 4QE5A 5L2JB 3OWEA 4U1MA 4UDUB 3G1HA 1GOKA 1I4FB 5J11B 1Q90A 2J88L 5IWLA 2BNQE 4KKBC 2VRQA 1OWRM 4Q2ZA 4O02L 3W83A 1H5VA 4WI5A 4NZTL 5DU7A 1V6XA 4XG1A 1MWAB 1AXTH 3ECBA 3OKEA 2YOAA 3AGWA 2E5CA 3BKYL 2QKFA 4PRPD 5I1HL 3U5UA 4Q2ZB 3GNPA 2QFRA 4ZTXA 4UF7C 2GJ6B 3BJLA 3BDBA 1MIMH 2VXTH 5EN2A 3TYFA 1JUBA 1JWMA 4LO9A 4PRNB 3TNNB 2E5DA 3FUNA 3F12A 2VZ1A 3BI9X 3KPMA 2FDMA 3FQ1A 4HBKA 1MZYA 3VNYA 1K8CA 2E40A 4O11A 3C12A 2ZXQA 3EBIA 3NEHA 5GJMA 3TC6A 4U1GB 1W72B 4W9GC 2NXIA 2CKRA 1XBRA 2O55A 1A02N 3T05A 3G0XA 2QQNL 3NZ1A 2VLKA 4YHPA 5TBOA 5C9JB 3V1HA 4H8UA 4LBSA 3E3QE 5IROD 2P52A 3TTYA 4WO4C 2EINB 4WW2B 5DHVB 1NCCL 4AJVA 2HNEA 2LU5A 2RH0A 4PJGB 5GGQH 3IDIA 1OK0A 4YHNB 1OM3L 4H6KA 1U1HA 2GVGA 5D9NA 2EDDA 5FK9A 5CCGE 3QZAA 1KSRA 5EKYA 3GHSA 2PYED 4GACA 1MNSA 4XN9A 2QHAA 2X0SA 2IF7A 4OGAD 1GKQA 3EAKA 3MBXL 4GO6B 3UG5A 1BQSA 1LTXA 4ODTH 4XVTL 1H0GA 5C1MB 1QVBA 4HK0B 5D4QA 4QNWA 1RK0A 2W8CA 2CU0A 2PR4H 4M7KH 3SBRA 2UZYA 2F61A 5I16B 2DDXA 3DSFH 3NQGA 4Y1AB 4RGMC 2WBKA 3QDMB 1LO0L 2VC9A 3OVUB 4UTUA 1JYNA 3MJYA 3L23A 4PTTB 2NNFA 5DZAA 1FOBA 4QFUA 3U4AA 4Z7QF 1C29A 3W0WA 2XWCA 4C65A 2DYPA 2B1AH 4Y16C 3W2UA 2AV7A 2R0ZH 3FCGA 3P11L 4KFOA 4GYBA 3GMOB 4BFKA 3CM4A 3OG3A 2EQDA 4MG4A 4C6MA 1S8DA 2F0CA 2HISA 2Y2TA 3K5XA 4Z7QE 1GSKA 3F01A 4ACZB 3VCNA 3K72A 4AEHL 3HPLB 1BLNB 3KGRA 4RQQB 4R90L 3HI5L 1BVWA 4OSUL 4KEMA 3RWFA 1EC7A 1LYXA 1E4WH 1YTKA 4LQ1A 4XP4L 5FYJH 3KS6A 5DMIH 1IKNA 1TO5A 4QHUA 3ZTDC 1YEKH 3TIDB 2XRAL 4QXTB 4W7UA 3QUHA 5BV7B 2Z9TA 5EA0L 1AP2B 3GTVA 3MV7E 2XWDA 2Z00A 4TMBA 3WLMA 1OAUL 5DQPA 2PO6D 1SR0A 4J4KA 4BI5A 3BAKA 1QACA 3QDJA 3GH4A 2OSWA 2CK0L 3EJJX 2WLNA 5T1LB 2ANUA 2Q09A 2JELH 4F2MB 1FWFC 3L2IA 1PEWA 4A2RA 1WBYB 1UVQB 2FB4L 3FRPB 3PGCA 3PPSA 3QBUA 5HJDA 3EO9H 1MVUB 2Y7LA 3D0LA 3QJTB 4LOUC 3FT9A 3FT2A 3WDJA 6ENLA 2F1BA 4MAYC 1C5DA 4W6WB 7ENLA 3UVAA 4XWGL 1Z5YD 5EU5A 5E6SB 3TVMB 4AD3A 3WS3A 4DB7A 2P8PB 3LZFH 3RWCA 2HAZA 4L1XA 3OQ3B 3C5ZA 3PAJA 1DBML 4N9GA 4YL2A 3CVHH 3HBPA 1YNKH 5GGRA 5CEXA 1JYWA 1G9NL 3W7JA 1B3JA 4XIAA 4KDWA 1OLLA 1T1XB 3K3QA 4PGJA 3JQOB 3BMXA 3FYEB 5FF4A 5BV7H 5AVWB 1ZBKA 2DMCA 3LD8C 4HUUB 4JICA 1MJJA 2YGPA 2AXGA 3WKZA 1EOMA 2V5YA 1V02A 1KN4H 1QAWA 1MFAL 4CC1A 1FNSH 4NZ4A 4LCWE 4DEUA 3I10A 2G2RA 2C5DC 4GKZA 1BYNA 4C91A 3R0UA 5H1WA 4GY7A 2B1HL 3P40A 4PJEF 3LBCA 4FHJA 5LNWA 2CU9A 3R4RA 4M61A 1BFNA 4OUUA 4O0ZA 4AGLA 4XZ9A 2QR0B 2E7HA 3IMSA 3H21A 1S9XB 3I75A 1IC4L 3AWEA 1F2QA 4FQXA 4NIKB 4FLSA 4P5KA 1H7RA 1AS8A 1RP8A 3ATFA 4TUJB 1H15A 3UJIH 1EVTC 3D33A 1YYMH 3LXAA 3RIFK 3MMEB 4HP5A 4PJ7F 2O5XL 2F53B 3M7OA 3OODA 3O2WH 3VXUE 4P5KB 2IWGA 3SZKC 4XQ6A 1G7HA 2WY3B 4GO8A 6A3HA 3HS8A 4IKNA 1FCGA 1H6EA 2VZOA 4JM2A 4WFGE 3UZVB 5D7KD 4BQ6A 1A7OL 3GG0A 5EFFA 2JTDA 2IEPA 5HR6A 2I25N 1A0CA 6PTDA 3ISYA 3QEQE 4UQAA 3TPUB 4ERGA 2ADGB 4OLEA 1NFAA 1ISYA 4G6KH 5D93C 3TNOA 3TYUA 2ADIB 3FTGB 3HC4L 3LKPB 5H37H 4CBZA 2VDNB 4MJIB 2VR6A 4MCZB