1UA3A

Crystal structure of the pig pancreatic a-amylase complexed with malto-oligosaccharides
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Pig Pancreatic alpha-Amylase Complexed with Malto-Oligosaccharides
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ua3A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ua3A01
2XIIA 2VX4A 2BV9A 4ZE5A 2DIEA 2BVTA 2ZIDA 3VIKA 4FNTA 1PX3A 3WBAA 2J74A 3IJ9A 4PCTA 1QX1A 5HPCA 4OZOA 5A8PA 5C70A 4URIA 3AS1A 1ZU8A 6TAAA 3THCA 1Z32X 3ALFA 1H41A 4S3KA 1UQYA 2VZUA 1ISYA 4D6EA 3EJPA 2WVUA 4UCFA 5AC5A 5IHSA 3RM9A 1NARA 4QLKA 2CETA 4EE9A 9CGTA 4HTYA 1EOMA 1LLOA 2PBGA 5A6KA 1GVIA 2WVVA 1LG1A 2W67A 5GPRA 1UKTA 2WHKA 2WK2A 2WSPA 4PMYA 1NWTA 5FKYA 3SIMA 3WUBA 1JAKA 1BPLB 1DWJM 4W5ZA 4DWSD 5GNYA 3SCPA 3ZSTA 1QNRA 5CZKA 3NJ3A 2F2HA 1JI2A 1PPIA 1AMYA 3W25A 1UWTA 3ARUA 4E8DA 3BMWA 2DT1A 3K8LA 3THDA 4JKLA 5LYRA 1E3XA 2BNJA 2X09A 2VJXA 5ABHA 2Y4SA 2MANA 4M80A 1C8QA 1KTCA 3RJYA 2HVMA 4ZFMA 4DUVA 4GQRA 3LXAA 1JZ2A 2GDVA 5A6MA 4A4AA 2J7CA 3VDBA 3AIBA 4AZ5A 1JYWA 2WNWA 1TZ7A 1E73M 1UA3A 4HZ6A 2YL9A 3JUGA 1VF8A 2EAEA 1V6XA 2YA1A 3DC0A 1WDRA 2F1BA 3A47A 4GKLA 1J18A 2ZXBA 5ABGA 3GBDA 2CHOA 1OGSA 3L4XA 4HA3A 3U57A 4GIAA 1GCYA 1OT1A 2YIHA 3G6LA 3VDAA 4AEEA 1GQJA 5I23A 3RILA 4MB5A 4QCFA 1VJZA 2XGIA 4RL3A 1UKSA 3WUFA 5AC4A 1NWSA 2VO5A 5CLTA 1GONA 1JF5A 2WHMA 2WLYA 1OSEA 2XSBA 1QHZA 2GFTA 3CGTA 4PMVA 3L4UA 3B9AA 2C7FA 3NUKA 1CGXA 3OZPA 2GDUA 1UKPA 4HA4A 3F5LA 1E0VA 3D51A 2F61A 1ISZA 2VCAA 4UFJA 2WHLA 2D24A 3CV5A 1H09A 1E15A 2OLHA 2IUZA 3WY4A 4LX4A 2ZXQA 4ATWA 1QNPA 1EDQA 4MDOA 4EKJA 3FHAA 3SUWA 4FLRA 2EPLX 4UQEA 3MV01 5LA0A 3S5YA 1G01A 2WCAA 5JBFA 3ARPA 1H3GA 4M24A 1HKMA 4Z2LA 1DHKA 4NRRA 3T0AA 3N04A 1CDGA 4DUXA 1G9HA 2VVNA 1W9BM 1HKIA 2PI6A 1K9EA 2X2IA 2VCBA 4TOQA 5DF0A 3A23A 2ZUVA 3OA5A 4BQ2A 3QR3A 4CUCA 4J27A 1EIBA 1LF1A 2EACA 2Y5EA 3BAXA 1KCKA 3HJEA 4UTFA 2EJ1A 4LYRA 3L4ZA 1HL9A 3OLDA 1HXJA 4MADA 2ZICA 1W9XA 1W9VA 3WFLA 1E1EA 3BAYA 2YL8A 2YDSA 3VD5A 1KBKA 3WNMA 2OWWA 4P7LA 4B16A 2GJRA 1AQ0A 1R34A 5D9MA 2IXUA 5EBAA 3LPOA 3RM8A 3KEHA 1ZBVA 1KTBA 2YJQA 3EJTA 1MYRA 1JZ3A 4TVDA 2ALWA 4PSRA 4MNMA 3MS8A 2WKLA 1VENA 1J11A 4LPCA 3ARXA 5JBDA 3BVUA 3POHA 4EANA 2FYVA 3CUGA 3DECA 3D3AA 3F5KA 3WH7A 3VSUA 1R87A 2WMJA 4MPKA 3ZJ7A 3SCOA 1E70M 4XB3A 4N0RA 3DYPA 2X0YA 5EFFA 2NSXA 4TVUA 4M8UA 2WMIA 3ARQA 1SMAA 1C92A 4CGTA 3HN3A 2AMGA 3APGA 4V27A 1MW2A 3AMDA 3ARTA 4CD8A 5ABFB 3BLKA 1HIZA 1BYAA 1D7FA 4AZBA 4ZE4A 1CXLA 3L4YA 4Q7NA 3BVVA 1B3VA 2A3EA 1V02E 1H0IA 1J9YA 5CPQA 4GINA 3PZGA 5C8BB 2XFRA 3F4VA 1FHDA 3EDEA 1B1YA 2QV4A 3SCWA 3S2CA 3AIEA 2OW7A 3POCA 3HG2A 4PMDA 1GJUA 2E9BA 1NM9A 4U2ZA 3KL5A 2J78A 1E0XA 4NXSA 2OSWA 4JIEA 1K9TA 3HG3A 1RD6A 5A2BA 1V02A 1EHAA 1R85A 2DSUA 2V38A 3AHZA 2J7BA 4P7OA 2EADA 3RDKA 4PMOA 1CXIA 3K8MA 4UFKA 3A6OA 3MUIA 4D71A 2YKKA 4MB1A 4RE4A 2CCRA 3OGRA 1KGXA 1W2PA 2QPSA 3I3DA 1E43A 1VJSA 4WSKA 4D1JA 1GQIA 3L4TA 3AXXA 2BXZA 2DQXA 3VDCA 4KMQA 4M56A 3WBEA 1VBRA 3ZMRA 2UY4A 1R33A 5LA2A 3WQVA 2J8GA 1OCQA 3LMYA 2O92A 1WE5A 4PEEA 3SEPA 3CZEA 3WF4A 3KWXA 1FOBA 5CSUA 4FK9A 3K46A 4FLSA 2W5FA 1CXKA 4D6GA 4DO6A 3OB8A 1JDDA 2EQDA 3CLWA 3WH8A 3B9EA 2V3EA 4JHZA 5JIPA 4ATLA 2DIJA 4PYSA 3CC1A 3NDZA 5IFTA 4AIOA 3GXNA 1DWFM 1TQTA 4AD0A 3UR8A 1V6WA 3QOMA 5CSYA 4AXNA 3RIKA 5GNXA 3VGEA 3U7VA 3WD0A 1OIFA 1PS3A 5CGMA 3AIRA 1C7SA 2PWDA 3UR7A 1IZJA 1KGUA 3CZLA 3VDHA 1OWQA 3OIHA 1CBGA 1Q6EA 4NF7A 2VR4A 4AC1X 3MUAA 4F8XA 1WNOA 2E0PA 1I1XA 4GQQA 4P8VA 2UY2A 2VQUA 3SUTA 1WDPA 1HNYA 1QNQA 1R75A 4W89A 3W6MA 1E6QM 2GVYA 1L8NA 2G4FA 3QHNA 3IAPA 5I5RA 1HT6A 5HDRA 1WCGA 1HKKA 5A6SA 3WEMA 3BVWA 5M3WA 4MNJA 1O7DC 2VR5A 3WH6A 2YA0A 3SCRA 2WWCA 8CGTA 3TTSA 4E2OA 4YHGA 3VGGA 1JDAA 2WXDM 1UR4A 3VGBA 3LRLA 3WQWA 5BCAA 3CZKA 4X9YA 7A3HA 3FXYA 4JZ5A 4HZ7A 4CD5A 2A3HA 4LYPA 1BAGA 1W2VA 2EXOA 5HBFA 1E0WA 4CD7A 4AZ7A 4D6IA 3H54A 3SCQA 1HJSA 2VT0A 4GPNA 4D6DA 5BWFA 1M04A 5DO8A 1UWUA 4ACZA 4AEFA 4F79A 1ZJAA 3O9NA 3MMWA 4P7RA 1HVXA 2XVPA 1XV8A 2WCGA 2ZE0A 1VFOA 1MQQA 1OD8A 2AAAA 3ZR6A 4J3SA 1ITXA 3GNOA 3AXIA 3NCOA 1R46A 2C0HA 1RPKA 2BHYA 5CGTA 3WL0A 4Z2HA 2ZXAA 1WPCA 1AVAA 2ZX8A 1TQVA 3CHFA 3S6TA 2D23A 4AZ6A 4W93A 1PZ3A 1XH1A 2ZWZA 2YLAA 1BGAA 3ZR5A 3AROA 2G3NA 4JL2A 1MVYA 2D22A 1GQLA 2WSKA 3OGSA 2V5CA 4DUWA 2X2HA 4JFSA 5A2CA 1SZNA 3BLPX 2BVYA 3CH9A 1JNDA 4PBGA 1UD6A 3ZJKA 3BC9A 4LGXA 3VSTA 4FF5A 4WIWA 2BFGA 5IFPA 3A21A 4UNIA 1E4NA 5HPOA 3WF3A 1UA7A 5E1QA 3MMUA 3HG5A 1W3JA 2W91A 2VUYA 4AW7A 1W3KA 4HU8A 1UD8A 4GZIA 2YL6A 2VMFA 3OLGA 2J4GA 3WNLA 1E56A 3W81A 3EBVA 1G94A 4M81A 2A3AA 1BGGA 1HJQA 3WY3A 5FCZA 5EMYA 2OWCA 1K9DA 2FE0A 1K6AA 3MSDA 2W66A 3WF2A 3D50A 3WDRA 4ATDA 1ZL1A 2E9LA 3WD2A 3WQ4A 3ZOAA 3UERA 4BQ5A 1HKJA 3GH5A 1VRXA 3WY1A 1EHNA 4QCEA 8A3HA 4V28A 3UG5A 2X0HA 4LXFA 2IGTA 1X6NA 1SYTA 3ZJ6A 2YFNA 3FAWA 3WL1A 2J79A 2J7GA 2J62A 4D1IA 1GOWA 4J3XA 4CCEA 1JNEA 2CITA 3NIYA 4J3TA 3NSXA 4U3CA 1FH7A 4TX6A 3K4AA 2D0FA 3GXDA 1EO5A 4IUGA 3EMZA 1RH9A 3VD4A 1UH4A 3CTTA 2ZUMA 4W88A 1KCLA 3W38A 4W7VA 3AQUA 4W8LA 2CNCA 3D4YA 3T0BA 5M03A 3CPUA 3GXIA 1J10A 2OSYA 3GNRA 4M82A 2F8QA 2ESCA 4KGJA 3WELA 3ARSA 4E4PA 1TA3B 2XVGA 4ACYA 4GI8A 1JFXA 3WQ8A 3HU7A 3WD3A 1JYVA 4H41A 1FH8A 3T2PA 4UFMA 3W6LA 1US2A 4UQBA 2DT3A 4AD4A 2FHCA 3LXCA 5A6AA 3WF0A 3U5UA 2D3NA 5E9AA 3DDFA 1E40A 3AHXA 4AD5A 2O9TA 5D9PA 1UQZA 1TQUA 2X2YA 4PTXA 3BCDA 4Z2IA 2V3FA 1GOIA 1HJVA 1PIFA 4XX6A 1UUQA 1WZAA 4CU8A 1LWJA 1CTNA 2X05A 2F7RA 4DO4A 4TX8A 2WM0A 1OB0A 3WF1A 4FNQA 1G0CA 3RMEA 4DWSB 3M6DA 3WDHA 1QI3A 3CZSA 4PMNA 1QW9A 3IJ7A 1CWYA 1KFWA 5EFDA 4CKQA 1NWRA 3KZSA 1BTCA 3GTNA 4CU6A 4KRUA 1WB0A 2Z1SA 1JD7A 1WO2A 5BXPA 3VIIA 3FAXA 3WQ6A 5A6JA 4H2CA 5AYIA 3SUUA 5E0CA 1B0IA 1YQ2A 3VMOA 1JG9A 2J8FA 1KGWA 3KL3A 3AZRA 1Y7VA 1O6IA 1DP0A 3VMPA 1V3LA 2V3DA 1V6UA 5JUVA 2XVKA 3KLLA 2FGLA 3DDGA 1J0ZA 4W8AA 3LPFA 1JI1A 2CXGA 4JCLA 3ARRA 2EO7A 2VOTA 1GJWA 2JE8A 4AMCA 5HNNA 3SCTA 1NP2A 3AXHA 2F1AA 3TTYA 4UQ9A 3CZNA 1CGTA 3DX2A 4AWEA 1KXTA 1B9ZA 4P8XA 3RPMA 2VRJA 2D20A 1ZBKA 3GH4A 2NW0A 4FMVA 2BVDA 4ZEPA 3A4AA 3AJ7A 1KWKA 1EGZA 3D52A 3VIHA 3RCNA 2DT2A 3EDDA 2DEPA 2EPOA 5D9OA 1V0MA 2DPEA 3L4VA 3UETA 1VEMA 4PTMA 1KQYA 5A8NA 1R86A 3AIQA 3DHPA 3LX9A 5CLWA 1GOOA 4AISA 4AYSA 2CHNA 4W84A 2Z1KA 3VIPA 1CGYA 5IHRA 7TAAA 1B31A 3PN8A 3WNPA 1V0NA 2ZUTA 2WPGA 5FD0A 4BCEA 1BYBA 1CYGA 2VZTA 1JGIA 4UQDA 2VVSA 3BVXA 1JZ7A 1E9LA 1CGWA 4H8VA 4CN6A 1LQ0A 1J0YA 3VSVA 3EDJA 3EJUA 2OYMA 3VUPA 3VD9A 4HU0A 2ZX7A 1OINA 4AZCB 5M5DA 1VB9A 1V03A 2GJXB 3W82A 2VRQA 2XGBA 3PZOA 3W29A 3DYMA 2RGLA 4ZXOA 1E6ZA 1QWNA 1TE1A 1NQ6A 2G3JA 2D0GA 2EABA 2XFFA 3PBGA 1NP0A 5E70A 4FLOA 2QLYA 1DWHM 5FL1A 1TG7A 3CUJA 4WKAA 4V2XA 2O9RA 3RJXA 1QPKA 2A3CA 2G3MA 2WANA 3U5YA 3BMVA 1C91A 5AY7A 1J12A 1CGUA 1XH0A 3GXFA 2VZVA 4P8UA 2XVLA 1MQPA 2E8ZA 3N18A 1DWAM 1E4LA 2PF0A 4F9JA 5A69A 2G41A 4HZ8A 2ZX5A 1UR0A 4X0VA 1PZ2A 1OBAA 3TOPA 1KXQA 4NZJA 4DWSA 3WQ5A 3GNPA 1B3YA 4BQ3A 4AMXA 1MXDA 1VEOA 4IM4A 2GJXA 3WMBA 1LL6A 4CVUA 1C90A 4UQCA 3PTQA 3ARWA 2Y8VA 1W1TA 4HOZA 3I3BA 4JFWA 4YHEA 2BY0A 5D8ZA 3W26A 4JKKA 1TVPA 3CMJA 5CJ5A 3PZTA 4OOUA 4UZUA 1TQSA 1TQWA 3OGVA 1X1NA 2CIPA 1XCWA 3UEQA 3A24A 3W53A 1E55A 2WMGA 1V6VA 2CYGA 4AY1A 2TAAA 1TUXA 3AISA 3TA9A 2YDQA 4OIFA 5FIPA 1JIBA 1BVZA 4AD2A 2F7OA 4GXPA 3CZJA 1GQKA 1QHPA 4IPLA 4PMQA 3QGVA 5JBEA 2WMHA 4ACZB 4PMXA 1HJWA 3MU7A 2FHFA 1QNSA 3WUEA 1XHGA 3UG4A 4PTVA 4AD3A 2EEXA 3ZJ8A 1TVNA 4YN5A 4W85A 3VIGA 5A95A 4W7WA 3BAIA 1ODUA 5A1AA 3GXTA 4GZEA 1UD3A 1W1YA 1LG2A 1MW3A 1CNVA 5E6ZA 5I24A 3AHYA 3WD1A 2XM2A 2JALA 2BY2A 4JCMA 2VL4A 1QI5A 2XN1A 4PUEA 4W87A 1FP8A 2UY3A 2XSAA 3VIJA 1D3CA 2XFYA 3A3HA 5I2UA 1QWUA 2AOSA 1CXHA 4BZYA 3H55A 2GK1B 2G8ZA 1BG9A 5I78A 1J01A 2XHYA 2W92A 1E4IA 2IXVA 1HXKA 1MWOA 1UG6A 3CBWA 3PZVA 1SFSA 4NRSA 2WBKA 4B9YA 1QVBA 2W61A 2OYKA 1YHTA 3AZTA 2XIBA 1GHRA 2ZX6A 1XD1A 3L2MA 2PWEA 3AIVA 2JEQA 1E6PA 3I3EA 2DSVA 3ZT6A 3ZIZA 2E9MA 1UH3A 4H04A 3T09A 3VGDA 5IXEA 2J7DA 4AZIA 1KB3A 3IAQA 2YFOA 5A8OA 2WWDA 2GJPA 3VGFA 2YLLA 4J3WA 4IISA 6A3HA 4AZGA 1B3WA 4PRWA 3VD7A 3NSMA 1Q4NX 5I77A 4A3HA 2WCSA 3TONA 3SUVA 1JYXA 4AMWA 1R7AA 2W4XA 3FW6A 2J25A 3BUBA 1JFHA 1ESWA 4OGZA 5DEZA 5JIWA 2CEQA 2XYLA 1I1WA 1DEDA 3N1AA 5BROA 2EBNA 2DSKA 4QLLA 4EAMA 1FFQA 1OGGA 1OD0A 4F66A 3FN9A 3WKZA 2ZUWA 1UKOA 3WH5A 4CN4A 4JHOA 3WSUA 3LRKA 1W1PA 3OBAA 1Q6GA 1C3FA 2WVSA 3GM8A 1UOKA 1A3HA 1W1VA 1BQCA 2VNCA 2FDMA 4BF7A 1QOXA 3O2LA 4WJXA 1NH6A 4C7FA 2VX6A 4JFUA 1E6RA 1ECEA 4BQ4A 3AMGA 3MANA 2WZEA 1UYQA 4C7GA 1KXHA 3UCQA 3L4WA 4PMRA 1ZB5A 3PZQA 2V5DA 2C8NA 3WEZA 1UD4A 3DX4A 2UWFA 3AMKA 5AYBA 1ZJBA 2WMIB 1T0OA 1QNOA 3T2OA 1JZ4A 3BGAA 4UFIA 4TUFA 1BLIA 4PUDA 1F4HA 1EDTA 2DDXA 3ARYA 1GORA 1VFFA 3DX3A 1N82A 1UZ1A 1TFVA 2VTFA 1NOFA 3M46A 2D3LA 1MW1A 3VOCA 1B3ZA 1G5AA 3DX0A 4D6FA 5KEZA 2VURA 1MW0A 1OIMA 1WDQA 4J7RA 2D73A 1XD0A 1P6WA 3BH4A 3MO4A 1GUVA 2QMJA 4J28A 1ISVA 4DM2A 2VZOA 4Q22A 1JDCA 1PX8A 4BA0A 3OG2A 1CPUA 1NOUA 1UD5A 4U33A 1CXFA 4AZCA 1UKQA 3WN6A 4NSBA 2NT1A 3N15A 4P8WA 4M29A 4QAWA 1GHSA 2D1ZA 3TTQA 3M07A 1VEPA 2ZUUA 1W3LA 4B3KA 2FGZA 2J77A 1LWHA 4GZJA 1US3A 1AQMA 1B2YA 5I79A 2E8YA 1C8YA 3BSHA 1V3MA 4UOZA 2ZOXA 3BSGA 1PIGA 1CENA 3BAJA 5I0DA 4GO8A 4XUYA 1CXEA 1Q6DA 1JXJA 1HVQA 3VVGA 2XJ7A 1IZKA 4AIEA 1KR0A 4U5IA 3A4WA 3S5ZA 5BRPA 3RO8A 1M7XA 3WEOA 2ZX9A 1NWUA 2HISA 2FH6A 1W32A 3WH9A 5D4YA 3A4XA 4RE3A 4KGLA 4W7UA 1QHOA 3BXWA 1ZBCA 1WZLA 4XV0A 3BUPA 1JZ5A 3VTRA 3WY2A 3DYOA 3CZ8A 3HMCA 3BVTA 4D72A 4PCSA 4AYGA 3EMQA 1BYCA 2F7QA 3MI6A 3SCSA 1GOMA 4HPGA 3T2QA 3VGHA 1Q6FA 1B90A 3PTKA 1HP5A 1WZMA 2WVTA 1UWIA 3SCVA 4MJ4A 1UWQA 3NDYA 3WIJA 4W5UA 1R7OA 1I75A 3CHEA 4YPJA 3CMGA 1LL4A 2CPUA 5A6LA 3VNZA 1J0IA 2BY1A 1J0HA 1VIWA 2QHAA 2X2JA 4MB3A 3EDFA 2YBTA 2E3ZA 3EJSA 3MUY1 1UWRA 3AHTA 3AS2A 2YA2A 1H0GA 1XRVA 2JEPA 3PZ9A 4CD6A 5ABFA 2WC7A 1EDGA 4P7QA 4UQAA 4OKDA 5TD4A 2PC8A 4IPNB 3D5HA 1EO7A 3OLIA 3GZAA 4B15A 2DT0A 4PTWA 4U3AA 4HOWA 1ZS2A 3GBEA 1V0KA 4J3UA 3GYCA 3PHAA 3HZ3A 1DWGM 4Y7EA 2YDRA 4FLQA 1H5VA 4HMDA 1GOQA 1QW8A 2XPKA 1S46A 3ECQA 1BFNA 1R47A 2XVNA 3CZGA 1MXGA 3AI0A 3QHOA 2DGAA 2CBIA 2BHZA 3ZM8A 4HMCA 1W91A 1CEOA 1HX0A 4TXEA 3AICA 3AOFA 3WDJA 3AS3A 4MNLA 2J75A 4TVCA 1WAWA 4CN1A 1E6NA 4W8BA 4N42A 5DMYA 4JFTA 5D9NA 1MFUA 1XGZA 4DM1A 1U2YA 3LPPA 2VZSA 2ZUSA 2J7EA 3PZMA 3CO4A 3VINA 3HG4A 1UHVA 1JL8A 2VI0A 3BUQA 1JAEA 3U7BA 4MTVA 4PN2A 3O6AA 3VU2A 3OZOA 1H2JA 1M01A 1H1NA 5BRQA 3CHDA 2JF7A 1UZ4A 2VX7A 3WDPP 2XM1A 3TTOA 2CERA 5CQ1A 2WC4A 1IT0A 1QI4A 1C8XA 4R27A 4ZXLA 1JD9A 1WKYA 3SURA 2QF8A 1HN1A 3J7HA 5E6YA 3WNNA 3AFBA 3W28A 2WMKA 1BVNP 3IK2A 3CUHA 2F18A 1W3HA 1CGVA 1HWWA 3DHUA 4CD4A 3VIMA 1BSIA 3WMCA 2DH3A 2PWHA 5CXPA 2EPNA 3AIUA 3AMCA 1PEZA 2OSXA 3WNKA 1BHGA 2XN2A 4GI6A 1V08A 1SR0A 1VBUA 1QBAA 3PZNA 4KRTA 4AD1A 4MNKA 3VX0A 5A2AA 5A6BA 3VPLA 1HL8A 2PB1A 4LYQA 2CKRA 3N12A 1CECA 4LQ1A 1C93A 1JXKA 4BS0A 3SCNA 3OLEA 1KR1A 1XSKA 2YOCA 4EK7A 1E6SM 1L0PA 1QI2A 1D2KA 3DX1A 1TMQA 1U33A 2DH2A 5DT5A 3ZT5A 3VX1A 1GPFA 3UESA 4UOQA 1WDSA 4NXKA 5HOSA 5F7UA 1HP4A 1KBBA 3WFZA 1TR1A 1WP6A 1LJYA 1PBGA 4MAZA 5I3DA 1ISWA 2OW6A 3WMSA 3M7SA 3VNYA 4L4PA 2VCCA 1XSJA 4NZFA 4GI9A 1UR8A 3BCFA 4UR9A 4HPHA 5A94A 1XC6A 3A22A 4UFHA 1MFVA 3SCUA 2XTKA 5I6SA 2GK1A 5BYWA 5GNZA 3VIOA 2WBGA 2FH8A 1GZJA 4J3VA 3II1A 3W4RA 4OOZA 4NZCA 3GXPA 1EA9C 1B30A 4CU7A 4DWSC 3BAKA 5BXRA 2D0HA 1DWIM 1QI0A 1UH2A 3W24A 3ZT7A 3TV8A 1W9UA 5DFAA 1U30A 3T0DA 1HTYA 3QHMA 2DSWA 3WDQA 3FHQA 3NYDA 1E1FA 3FY1A 4JL1A 3VM5A 3PTMA 4H8HA 7CGTA 3LXBA 4DO5A 2WZHA 1J0JA 1RP8A 3GH7A 3G6MA 1M53A 1KWGA 4ML4A 2GSJA 2FHBA 3AIWA 1TA3A 5EB8A 3N13A 1R8LA 1PX4A 1E5NA 5CPTA 1F4AA 2J7FA 3K4DA 1FHLA 4B3LA 3GXMA 3WUGA 3WENA 2W62A 3B8SA 4QLJA 2O9PA 1XH2A 2WAGA 2JFEX 3VM7A 1EXPA 3FNDA 2Y8KA 4U31A 2WC3A 4D6HA 5BXSA 1E72M 1JZ8A 2BY3A 4H8UA 4UZSA 3CHCA 2YBUA 2YL5A 2O9OA 1H49A 4R5EA 2B31A 3W37A 4OUEA 5A3HA 4KH2A 3K1DA 1H11A 1UD2A 1QBBA 1ZBWA 3SUSA 2OWXA 1DTUA 3NSNA 3H53A 1HF6A 4X0NA 1W9DM 3RM4A 4AIUA 5CPSA 3WD4A 2UY5A 4HA1A 4HP5A 5HXMA 3ALGA 5D8WA 1J0KA 2E40A 4TTUA 2GUYA 3BUDA 2WZIA 2CESA 1O7AA 3VMNA 2QMKA 3MV11 3VKKA 3AHVA 1FH9A 1G1YA 2EPMX 2CBJA 2WHJA 1XSIA 2PWFA 3AYSA 1W9PA 4AZHA 1OT2A 2X8RA 2WB5A 1MQRA 4M1RA 1GNXA 3B9DA 4CVWA 1RP9A 2RGMA 1FFRA 3EJRA 4PMZA 3TP4A 5E0FA 1KXVA 3CUFA 4MAVA 4JFVA 2J47A 1JF6A 3VIFA 1JZ6A 1KQZA 4WKHA 6CGTA 2V3GA 3LPGA 2ZXDA 3LRMA 2CKSA 2CBVA 4HMEA 3ARVA 1GW1A 2F7PA 3AS0A 1UR1A 2J7HA 4KWUA 2WMFA 4MB4A 1BG4A 3ZO9A 1NOWA 4P7NA 1GOKA 5E09A 1V3JA 3QOKA 4WLCA 1EQPA 4FNRA 1OM0A 2WW5A 5ABEA 4CCCA 4PMUA 2XG9A 2CBUA 4RE2A 3N9KA 4OBSA 2X1IA 5CG0A 4U5KA 4ZENA 5M17A 2OYLA 1E71M 1JYNA 2Q8XA 4U2YA 4XZWA 3E1F1 1C7TA 4MJ2A 4JAWA 3AMLA 2WVVB 3BAWA 1CZ1A 3MMDA 4QP0A 1E4MM 3KLKA 1BYDA 1FP9A 4HOXA 2ZUNA 1PJ9A 2BS9A 1TCMA 4H7VA 3MUZ1 2WKGA 4MDPA 5DT7A 4Z2JA 4A3YA 3EJQA 5GQBA 4PSPA 3W27A 2PWGA 5LA1A 4FNUA 4D6CA 3KL0A 5ECUA 3AZSA 4Z2GA 2BXYA 4UFLA 2JIEA 2D2OA 5A8QA 3EMCA 3UG3A 3VILA 1H4PA 3GDBA 1A47A 3N11A 5A6BD 4L4OA 1UR9A 1CLVA 1Q6CA 2VC9A 5FOOA 2QPUA 3ZQ9A 4FNSA 3BUIA 1ISXA 1VFMA 2G3IA 1V3HA 1UR2A 3EYPA 4K68A 1VAHA 3PZUA 2Y2WA 3T08A 2VQTA 3CIVA 2BHUA 4W86A 3A5VA 1V3IA 4WKFA 1HJXA 1ODZA 1UASA 1BF2A 4QFUA 3PZIA 1V0LA 1E3ZA 1UWSA 2WLZA 3MKKA 1WZKA 2VX5A 3N17A 5A8MA 5IDIA 2VRKA 1FA2A 4C7DA 3IGUA 4WK9A 3KE0A 2WYSA 1IV8A 1EQCA 1CLXA 1SMDA 4E8CA 5KZ6A 1LL7A 4TTGA 1B3XA 1E6XM 2ZWYA 1HJUA 1ITCA 1V6YA 2EPKX 1OGBA 2PBOA 1X6LA 1M03A 2Y24A 4F9DA 3ZSSA 2XUCA 3IANA 2XN0A 2DSZA 4B9ZA 3EDKA 1VFUA 3WNOA 3WDIA 3K8KA 4D6JA 5FL0A 3L2LA 4OBRA 3VO0A 3AYRA 4CCDA 4JKMA 2JF6A 1K9FA 5BXTA 4FNPA 1CIUA 4OJYA 2JIWA 2XWEA 1XYFA 1V3KA 4NX0A 3W0KA 4QDMA 4Z2KA 4XZBA 1XYZA 3D4ZA 2NT0A 3BLBA 3IJ8A 1XCXA 1GVYA 2W63A 3CUIA 1EH9A 1EOKA 3VD3A 4WSJA 1E5JA 2XWDA 3MSGA 1PAMA 2A3BA 3ARZA 4WF7A 5C71A 4NI3A 2E4TA 4S3JA 3F5JA 1AQHA 4UOJA 4GO9A
chains in the Genus database with same CATH superfamily
2RD0A 5B8CC 2DZTA 4KRLB 4ZE5A 2BVTA 4XBJA 4N90E 1CZ8H 2XQBL 5KVDE 4XK2A 5MI0C 3VIKA 4JTLA 1XBZA 2V2CA 1MCPH 3QWOA 2J8UA 4P2VA 1A8JH 1SW0A 4F5CA 2X4NB 1LJMA 4KK8C 5D7LB 3MKVA 1LBFA 2J74A 4RCXA 5LNUA 5DSCA 1EVTC 3PG9A 4I3SL 3N4EA 1IWPA 5HPCA 5C70A 2UWEE 5GJPA 1WWCA 1OCJA 1V7AA 1E9ZB 1GGBL 3AS1A 1FAIH 3MA8A 1ZU8A 1MELA 4M7LL 4Q8QA 3REQA 2UXGA 1CGSH 1XAUA 2PCPB 2VZUA 3ZL4L 2BJMH 2ZZUT 5C0BD 2D7TH 4XZ4A 5GGRA 2AAMA 3UZWA 4D6EA 4HLZG 1K85A 3CFCL 2M1KA 4L56A 4MFEA 3FCUB 2YQBA 2IKJA 4K8HA 3T6CA 1Y65A 4CNPA 2Q8BH 3OF6D 2EXYD 3BZEA 3TFKC 4PJ9C 1FWWA 1NARA 4ZFOB 3PP3H 1WISA 2PR9A 2Y6SD 3IT8D 3VUAA 4UT7L 1U91A 4FTVE 1CLYL 2EE0A 2CMRH 5TQ2L 4JBSA 3SQRA 1FWEC 1XLEA 3JZ7A 3S46A 4WW1B 4EE9A 4HTYA 3TIEA 4ZW6A 1QW7A 3EYUH 3PNWB 3CVIL 2BWDA 4LKXA 1NLBL 2EO9A 1XUUA 3TYEA 1GKOA 5GPRA 1EP2A 1IRAY 1JWMA 2PCPA 4GYKA 4U28A 4JQ2A 5F7LB 4HZLA 1VYSX 4YYFA 4TSBL 1ROWA 2RCSH 1U58A 2VQ1A 1U93B 2YPLE 4PAZA 3SIMA 2A73B 2BNUB 2HRLA 3PPFA 2VXNA 3WUBA 3QR1A 2QFRA 1W1A1 4C56B 1JAKA 5CBBA 2NUTA 1MJ8L 1W54A 1EFXB 2N3JA 1MH5A 4KCVA 4W5ZA 5ALBH 3UNTA 2FJHA 4KQ3H 3H2MA 2HVJB 5I82A 1GYWA 5GNYA 2H6OA 3DURB 5D71L 1TZHA 1DBML 4DP4X 5F3BA 4PJ7A 1GK8A 1QNRA 4TLKA 3RRQA 3TUUA 4L9DA 3NJ3A 2F2HA 1E6JL 5ICYA 5CJBA 3RL1A 3M41A 1TREA 3EB3A 4ATTA 3U2IA 2BSRB 3BMWA 4WFGE 3DGGA 4WI8A 4X7DC 5IFHH 1EJUC 1A3LL 2AJUH 2PMZA 5D8JL 1OOAA 1KFBA 4JKLA 1M9SA 3G5ZA 4UINL 4FQXC 5B1KA 1E3XA 4N1HB 4IBUA 3WJJC 3MY9A 4JB9L 5EBLA 4ZMQA 5K5YA 5U7SA 1JOIA 2J21A 2VJXA 1BA9A 5ABHA 4Y2OA 1F0LA 3NJMA 2Y4SA 4X9BA 3BH9B 4H9ZA 4XVSL 4OAWB 4A1RA 1EYWA 2B7QA 5AL8A 1R0MA 4JFZL 1EVUA 2OJPA 1C8QA 4GXVH 4J3OG 3TX4A 3RJYA 4BZ1H 4EI5A 1X1ZA 4DFHA 4Q33A 4LOUC 5GVJA 4M93C 3RXZA 4FR1A 4E38A 5IEKB 3ZVVA 1QKZH 1V5JA 2V5JA 1AQFA 3PUGA 4JO5A 3GSWB 1LLWA 1IKOP 3RX4A 1WFUA 5AYXA 2GDVA 4AQOA 4WI3A 1NICA 1CFTA 1XGPB 1FH2A 2AQVA 3HBZA 4O2CA 2J7CA 3AIBA 3GHUA 2NUWA 3BOXA 1TZ7A 1E73M 4K38A 1UA3A 2Z0UA 3D8MA 3GO1L 3VFNB 1N6QH 5K93A 3NVDA 4UUIA 2YL9A 4N9OB 1PZ5B 4PJBA 5AYQA 1VF8A 3H2FA 1DIKA 3ZYOA 2G2RB 4IS6A 2EAEA 5DVPA 3LYRA 5JLZA 1Q7ZA 3JSSA 1V6XA 2HQAA 4M6QA 3NGBC 1JDEA 1I9RL 4GKLA 4TQIA 3VXUA 4PTTB 3ZDYE 4F0RA 5CSBA 4CC1A 5HNTA 2QVKA 1AE6H 1YEHL 2CHOA 1OGSA 3T6ZA 1IFHH 2JVUA 2V4LA 1GCYA 4R90H 5HI4D 3P1VA 5FAGA 4QHMA 2K7PA 3VDAA 1KN4L 2B20A 4N22A 1GQJA 3H9HA 1K8ZA 4JG0H 3SRKA 2TRYA 1BFOA 3K72B 2QUMA 2XGIA 3D07A 5AHIA 5H94A 1TV2A 3QHZH 3TPUB 2GPTA 3DFTA 4MJMA 5IBXA 3SQOL 3AC0A 3II2A 1OIOA 3MGOB 3FKUS 1Z5YD 3E3QE 4WO4C 3SGEI 2Z7UA 3E0FA 2E3VA 1H15A 2WLYA 1R3SA 1EJTC 1Z41A 2YCJA 1SFHA 1T3FA 3KNBA 4GUOA 2ZA3A 2GFTA 3MDWA 3LIZL 5IVXF 1XB6A 4S0SD 3RNQB 5C07B 3QJFB 2C7FA 4GIOA 4K94H 2CBPA 5DJZA 4FX6M 4IKJA 1K70A 1RZMA 4FALA 1KJ2L 3O6LL 2ZYIA 3EJZD 4K3DH 1QLEL 4WW2B 1QEXA 2NQCA 5CD3A 3QQDA 1TR9A 1E0VA 3PNZA 2OZNA 4NN5C 1K7FA 1B3JA 1S9WA 2H47C 3AABA 3D51A 4DJFD 4FTDA 1NDVA 5AAPA 4KEVA 4QGCA 4UFJA 3ENEA 1FSKC 2WKOF 1QLRB 1WFTA 3QEQE 3QUZA 4ZTPH 1MNUL 1E15A 2D24A 2NUYA 4J3ZA 4WI0B 3VFTA 2X1QA 3B6SA 4FP8H 2P44B 1QNPA 1NBYA 4PJ8B 4YLQT 4K07A 2O1AA 5KBNC 3AVEA 4EKJA 2PODA 2LFGA 5CWSB 3S98A 4GFSA 4GQBA 1GHFL 4ZA0A 1ZDSA 2WLLB 3TBTB 4IIDA 4MYAA 1EP3A 5JBFA 1MI5D 2EH7H 4HCLA 1XLFA 4Z2LA 2DKMA 2HFGH 2J55A 4JTAA 1D7CA 4XMLH 5DHVA 1UIOA 4A7GF 2OO6A 1KG0B 3N04A 5F9OL 1CDGA 3MRCA 4QS6A 5CPLA 2Z91A 1W9BM 4MQXD 4FXKC 3EO9H 4Z7VF 1S7UA 1GW1A 2WZ6A 3ESUF 3IJYB 2VN5A 1KJ3L 3GSQB 4AQ1B 2ZWKA 4PGDA 1JNHB 2QPDB 2X2IA 1K9EA 1OCCB 3DSFH 3ZZLA 1TPB1 3PUUA 2IWEA 3T3MF 3ISRA 3RDTC 4BQ2A 2DQEH 1F4WL 1Q7MA 2DQHL 3EZJB 3RX9A 5HYFA 4G70B 1AW1A 2DY3A 4Y5XC 4I4WA 5AUMB 5T3ZE 1EIBA 4AM0Q 1LF1A 4XTIA 5C1MB 3ULUE 4P06A 4BFIA 2HXUA 3HJEA 4CCZA 3O1NA 4BFEA 3L4ZA 4MCZB 4LB8A 3FQTB 2UZXB 2ZICA 3DTDA 3QZNA 4HXAL 4WWID 2C7UB 3L7EB 3U46A 4BQ9A 3IJQA 4WD0A 4QXUH 1NBQA 3WJXA 2JJTA 3QNFA 1OM3L 4OVUA 4MMXB 3BURA 3ALWA 4WDTA 3ARDB 3QPKA 5JXEC 2BOBB 3BAYA 3OHXB 1F9CA 2YL8A 5XINA 5HYJA 1KBKA 2WKOA 1L6GA 1PCSA 4JM4L 4P7LA 1YTDA 1R34A 2V5YA 1J1PH 4KEZA 4JRLA 4P4RA 3U0TA 5EBAA 4JUSA 2PTTA 2BVQB 1CK0H 1HZHL 3ASNB 3QRGL 3EJTA 4R8WL 5EC2A 1MYRA 4MQTB 3T78A 2UZIL 4MJIB 4LYKA 4JFFB 3NCJH 4IRSB 4PSRA 4MNMA 1VENA 1JXGA 5KSAD 3P4NA 4AQEA 1MWAB 2CBQA 5JBDA 2MHAA 3BVUA 4PS4L 3POHA 4N5UA 4QOKD 2WNZA 1P7QB 3MCMA 1F97A 1JF1B 1TIUA 1XHHA 1PLBA 1ZANH 3SGEH 2B1HH 1YN6A 2X9ZA 1AH3A 4E8GA 3RA7L 5D09A 3QT2A 1S2UA 3L1OH 2WMJA 1YY9C 2PP8A 1EC7A 4K7YA 2E86A 1G1KA 2QDHA 1PZCA 4PRDA 5HQEA 3WO4B 2IGFH 1DFXA 1CFQA 2FECL 2E1DA 3DCPA 4N9GA 3CFDA 4HJJL 3MP3A 5HHXH 1KJMB 4OCYH 1Z9LA 1TJHH 1FHNA 2IAND 1J8HA 3CUPB 1DUYA 2YR3A 2IPTH 4L4VB 2NSXA 5K59E 3U48A 3KM2A 3P8IA 2IBZY 2WMPB 1GZHA 4NUGL 2X10A 5FDYA 1C92A 5TBOA 1W0WA 3UTOA 1P4LA 2ITDA 1YEGL 1YEWA 3ENLA 1JWSA 5I76B 4MKMA 4MNQD 1AI1H 3UAAA 4G80B 3KOWA 4PBFA 4NZUH 5BJTB 1HIZA 2C18A 4PV8B 1BYAA 1OFQA 5DXYA 2ICEB 4HJIA 4WW1A 4RISL 3W7QA 2ZSWB 3TU9A 3GZOA 4ODHH 3L4YA 3EOBA 2R4RH 1PTZA 1THAA 5IJBC 5FACA 4KJPC 3SGJA 2C14A 4Q7NA 2Z31B 5IIEA 3CU7A 4WAFA 2P50A 5GGTL 3CBJB 5C09B 1WA2X 5DVMA 2PDCA 1TQBC 3PL6D 5E08H 1GZQB 1H0IA 2ZZ5A 4AHPA 5SV3A 4ZFFA 1G9ML 1DO5A 2FB4H 1MI5E 1CDJA 3SD2A 4LEFA 4LBSA 3ETSA 4G9FE 4AM0B 1S2AA 1KT2A 3PV6A 2L4OA 4WHBA 4N85A 4X61A 3TZNA 2RFGA 1FBAA 4XZNX 1QNZL 1SDYA 1XEDA 1FHDA 1JPKA 1NFPA 1B1YA 2IXQB 5I7GA 1U8CA 2FBRA 2OW7A 3P73B 5D7IA 2GEQA 1X4XA 3POCA 4PMDA 4Q8UA 2K78A 3CZFB 43C9A 3U9WA 5FLVA 3K1GA 1ZTXL 1JNLH 3QJSB 2GOUA 4W9FC 1I1AC 4MWAA 4JIEA 3QBTB 3QAZB 2AFNA 2C3WA 2QQKL 1ZSDB 3MRFA 3N1GC 3LN4B 2RCSL 3P69A 2DWEB 4Z8FH 2IPJA 2AJZB 1D5ZA 4QHPA 2C13A 4HYVA 3O6ML 3RZCB 4YK4B 3V0DA 3P02A 1AP2A 4UMGA 3JRKA 3LCHA 3PVFA 2ALAA 4JY8A 4S3CA 3L12A 3UZQB 3JTTB 4RE4A 2DMKA 3NA8A 3PAOA 2H45A 4X5LA 3ATZA 4PRHB 3DN5A 1TPDA 4UYPA 4XX1E 1KGXA 1W2PA 1UM6L 2QCDA 4YO0B 1B4EA 3QGKC 3VFMB 1A5LC 1NGWA 3J27A 5G2NA 4N7QA 3L4TA 3R7QA 2BXZA 1IVLA 2HBXA 2DQXA 3B5TA 1RQHA 4UT6A 4KMQA 4M56A 2A6KA 2X41A 5C2BL 3WBEA 1VBRA 3EIFA 3G6AA 2PLMA 2FWOA 3FOLA 3FO9B 3Q01A 2AJZA 4KZDH 2D31B 1AKJD 4JFZH 4N1CA 2KX9A 5I2IB 4OKVB 4M5ZH 3LMYA 1OQXA 1E30A 3KDMA 2O92A 3BDYH 1JGLL 3UZQA 3CQQA 3LHAA 2FDBP 3W11D 4AQ8C 2QCNA 2FYYA 2X0SA 3FIGA 3ZK0A 3LHTA 3VXRA 3CSTA 3K80A 1BVLA 4LBUA 3WF4A 1KM0A 1AQKH 3IUDA 2WP3T 4G8EB 1Z3GL 5D1ZB 3SKJH 1U2CA 3VJ6B 4LSSL 4ZVJA 5CSUA 2DWEA 1E6OL 2DD8H 4L0YA 2TRSA 3TJXA 4ODXB 1CXKA 3ELQA 2RDUA 4D6GA 1TUPA 4TQ8A 4Z3FA 5D1QE 4XODA 1JDDA 1X9UA 1QQDA 4AYEC 5L9DL 4S1DC 3VXME 3IGSA 1I9EA 3BGMB 3QDGA 2PGWA 2Y88A 3QA3A 5AHLA 5M2FX 3WJLA 3EYUL 2LU3A 3B9EA 3RR4A 1ZV9A 3G04B 1CWVA 3DVNA 4GVFA 3DG7A 4KK6C 1E2WA 2P5WA 4QRTA 4Y19B 3IE4A 4ATLA 1UUNA 2X1SA 4AJYV 1AO7A 1Y5VA 4XVTH 2YEZA 3W71A 3ARFA 4AIOA 3ALXA 5CEXB 1EJVC 2XC8A 1PTDA 3UR8A 2CCWA 4KUCF 5EZJB 3NVTA 4NAEB 4PUWA 3DESA 1M56B 2QCLA 3WD0A 4PWIA 1NSJA 1KT2B 3PV6B 1Q0EA 3UAEA 1OIFA 1PS3A 1BWKA 2CO6A 3NIGF 3R1ZA 1UWAA 1XR8A 1C7SA 2LU5A 5I73C 5LB1A 3BK0A 1IZJA 3CZLA 5HJ3A 1M57B 4WI5A 1UACL 3UAFA 1UZGA 3AY4A 3FUNA 3OIHA 32C2A 1NCWH 4MCYA 1CBGA 4N8VA 3K6NA 5HGDB 3W2DL 3ZJAA 4E0CA 5DC2A 1KLUA 4HUXB 1J4EA 3C5ZD 5HGGS 3MUAA 3B1TA 2JB6A 1OFAA 3OX8A 1IM3B 4OZ4A 1I1XA 1KEMH 2CXKA 2VABB 2DUAA 5E2JA 4G83A 2UY2A 1MQKH 5DUBA 1SQ2N 5FGCB 4YHLL 4S2CA 1LHZA 2NXYD 1BCIA 3CV7A 1HNYA 2CH8A 1KY7A 3ESNA 4OCSL 2CLZA 4RZ6A 3W2UA 2XACC 5F0LB 5CBIA 2D4FA 3NH7H 2GVYA 4TUJB 3EFOB 3IXAA 1EEXA 3QHNA 3IAPA 1N70A 5TDNA 1KJMA 2R8SL 3OBKA 4ICMA 3U2OA 1HT6A 4PUBL 5DHYA 2JIXB 3V4UH 5ECVA 4DEPB 3ULVL 1CF1A 5CJOH 3KCPB 3FO1B 3GIZL 4CNIB 4P3CH 3WEMA 3BVWA 1MRFH 4K7PL 2XH4A 2DI9A 4G7YL 4A6YB 3DOSA 4YSSA 2PWUA 1KIUB 1QQDB 4MD5A 5HJGA 3WQFA 4FZEL 2P52A 3MV8A 4JO3L 4ZOAA 3SCRA 4YHGA 5C0DB 1JDAA 4L8BA 2BHFA 5DVLA 2WXDM 1JZEA 3ZE0E 1UR4A 5EEXA 3DUGA 5H35A 3MI3A 3N1MC 1CT8A 4NO0B 3LEYH 5GZNC 3WQWA 1N67A 1W0YT 2GAZB 3BEWB 1FZOB 3FMGL 4EN3D 3CZKA 1TIWA 4U7KA 3B9KB 3I75B 4YC2B 3UZ5A 4LLMA 2G96A 3BPCB 4RFNC 4MBOA 1P0EA 3FXYA 3RWCA 4QHKJ 4KAQL 1G7PB 4MWFA 4QXGH 2YCIX 1MCFA 2YUZA 4LYPA 5FEWA 4WTZG 4R9OA 1H63A 4A8NA 2EC8A 4YXGA 6PCYA 3RPIB 5E8NA 3UWEA 3RWGA 3H3BC 5HBFA 3HNSH 4WGWB 2J2ZA 3WZ0E 4PD4J 5HYIA 3DOHA 3DRQA 4FZIA 4PJCF 2GQAA 4HWZA 3IFOA 1IEVA 1XJBA 4N2HA 4O52A 3CEPA 5FECB 3L9RA 4YTQA 1QSED 4ZCWA 2VT0A 1V7NL 3WXWL 1U5VA 2WN2A 2J8UF 3FA4A 1DQJA 5DO8A 4GPNA 3W72A 1KTLA 2GJZA 1U8OB 5DHVH 2OPJA 3HZYA 4OCRL 1QABA 2GWNA 3UZZA 3MLTA 3CFJA 3F3HA 3PULA 1JQVA 2HG5A 1TPFA 3QORA 1HH9B 1EPVA 2UX6A 2WCGA 2ZE0A 4JRWA 4JX5A 1HQ4B 1TJXA 4Q4PA 2D3VA 2HXAA 4FMKA 1MQQA 2AJ3A 1H0DA 2AAAA 4IFKB 1BWLA 4PJFF 1RVFL 1OWWA 1NKRA 2VDRB 1KFJA 1ITXA 4Y2WA 4ANWA 2WJZA 4HLEA 3V0WL 5JU6A 4MA7L 3ZKQD 4NSKB 1N8WA 5CGTA 1HHKA 1C9SA 3QHFH 1ZSDA 1WPCA 4XVUD 5IESH 1UR3M 1GYUA 1BZ7A 4ES9A 1RLDA 5JR1L 3S6TA 1NAMH 3LMJH 3GK8L 3LN3A 2WQ8A 2DQJH 1PZ3A 2ZWZA 1I3UA 1EZSA 4AV4A 4IPIA 4J3OH 4L1GA 4Z42C 4L8SB 2WXIA 3HBPA 3IGAA 4NM4H 1GC1L 1TZIB 1TMCB 3QUHA 4JL2A 3WL9A 3N73A 3SQSA 2A83A 4AB4A 1X9QA 3PXLA 4DUWA 2V5CA 1AD1A 2CZ5A 3NABH 1SZNA 4Y5YC 4DK6A 1PZUB 1L9WA 3CK0L 3BLPX 3PHSA 2BVYA 5M3WA 3WJMB 1OG6A 3KPRB 3CBRA 3I85A 2EZ0C 1CTMA 1XL9A 3L3KA 4LGXA 4KPHL 1WS8A 4IX2A 3NIFF 3CU2A 3A67H 2ZOWA 4NO0D 3VSTA 2FLIA 3KHDA 4HLZH 4BUGA 1N0XH 5JO5A 1E4NA 3WS3B 4YVXA 4PJ8C 2GT9B 3V5DA 1VBGA 4H9TA 4X60A 4W70A 3TV3L 3MJ8B 1ZALA 2VUYA 4AW7A 4DKFH 4HU8A 3KZ8A 1I9CB 1UD8A 1U8IA 2YN5A 1JV5B 4GZIA 2YL6A 4HJFA 4YHPB 4KKCC 4HWZB 1K4DB 2EXWC 1WYJA 2V7NB 2R24A 3WLKX 3NIDE 4Z7NB 2YR1A 3G6DL 2WXMA 1A9VA 2VC2H 1DJXA 1UURA 3S9DB 1G94A 4AQAB 2X1OA 4M81A 1GJIA 4Z95L 3SJVB 1B0GB 4PJGB 1OE2A 1TPWA 4CNNA 4UBDC 4FXKB 1RZFL 3ZDXE 2VR7A 1ETZA 3QUKA 2ATMA 3HRZA 2BSEA 3I75A 3WDRA 3AADB 4BF5A 1FZOA 1ZL1A 4KDVA 5FESA 5CP3H 2X4RB 2OULB 4UV7L 3QFJA 1CCWB 3HB3D 4DGYL 3MDUA 3WQ4A 1DVFC 2A4ZA 4JFEE 3P82A 4N02A 1K8IB 3LY6A 3TLRA 1KO0A 4CVZA 3QGAC 3QQNA 4DP6X 2F74A 3T8MA 3HVNA 4N9EA 4BQ5A 3GYEA 4AF0A 3EA3A 3F05A 5JOEA 3GH5A 4JS3A 3MQIA 4N2KA 3UL4A 2P5EA 1YAZA 3KPLB 4JG9A 3G5ZB 3NQKA 4LVOB 3TCLA 3U2ZA 4Q6YA 3LJ3A 2IGTA 4KUZH 4KEMA 3ZN6A 1I7RA 3ARDC 4BUHA 2YFNA 1MCDA 4ADGA 2QUTA 4JFFA 1K8XA 5BZWA 3R06B 3MSYA 4QEHA 3M8OH 1AO7D 4D1IA 3DFHA 4Z0XB 2J6EL 4JYDA 1RK5A 2J88L 4QMEA 1MUCA 4HVXA 2CITA 1G87A 1RU9H 1I1RA 4XBSA 3O11A 1SFJA 2NR6A 4R7XA 5D4JA 4CC4C 5IM7A 1F6AA 3F6JA 1FH7A 5CNHA 5EUKA 2ZRVA 1A5AA 4LVHB 4DO7A 4IL0A 4B2DA 4IUGA 2C7UA 3L7EA 2R1NA 1A4KA 4EI0A 1FWRA 4DZHA 2LTQB 1TYGA 4XN4A 4OUIA 1HHJA 1AL7A 2R4RL 3ZTNL 5CSZB 4MCYB 3R25A 3AY2A 1KCLA 3QUMA 2IPKB 4NRXB 4V1DA 4DGIH 4PRIE 2WQWA 2FMOA 1HOCA 5JHDE 5BNXD 3D47A 3PANA 3FJNA 3RIFF 4JPKL 1TWZA 3BP7A 2QQLH 3D4YA 1A5CA 1RCYA 3T0BA 3AYVA 3PBVA 5M03A 2A3TA 4WDIB 2HJLA 3OGOE 1ITQA 1OGAE 2X2GA 2Z24A 2OK0L 1TA3B 1LE9B 4G6AD 3UTTE 4NS0A 2VWSA 1J8KA 4JE0A 3PIQB 4RFEA 1P7TA 4KWOA 3IRCA 1PJWA 3T1WA 1R3IL 4FEMA 3CC5A 5EB9A 1BM3H 3BESR 5KYUB 5I3JA 4HWEL 1Z69A 4GABA 4HH8A 4AH2A 1ADDA 3BQUC 4MXWH 5E6IC 1ZT1B 3GJFK 4G6ML 2XVGA 4DJDC 4QTIL 1F8MA 2B39A 2VQ1B 4GSDH 4JAMB 1EP1A 1ZT4B 2OT1A 3IS4A 2XBTA 3TS8A 1IU1A 2Q6WA 3MREB 3WQ8A 4JKPH 1TT6A 4E0RA 1W5MA 3VXTB 1KRCC 3LSBA 4XVTL 4ZO6A 4NI8A 3U1SL 1G7LA 1HH6B 1JK8A 3HO8A 4UQBA 3T42A 5EOTB 4H1LB 3AT8A 3CQJA 2VDKL 4ZOCA 1OP5H 4MZRA 3TA4D 2Y61A 3LXCA 3LUTA 3TW9A 4FA8A 3HI5H 3NZRA 3AU2A 3IRZA 5EOQL 2C1IA 2Y7MA 1E40A 5TH2B 2G95A 2E9WA 1XH3B 3RE0A 1QO5A 1HHJB 1L0QA 4YDVB 1ZLWH 1ILUA 2JNZA 1TQUA 5T33H 1A9BA 3BCDA 3RY5A 2C3ZA 5FGCE 1GKQA 2REQA 3AWFA 3TIMA 3P2TA 2VDGA 5FCSH 3N41F 4DJDA 5AB2A 4CA4A 3ARGA 1GOIA 3BSZH 4WDXA 1PIFA 4UMCA 2NY3D 3DSNA 3VXRE 1UUQA 1WZAA 4CU8A 2G2PA 4NASA 2VM8A 1Z6JT 1I1AB 1IBDA 2Z4QA 3HFMH 1Q94B 2F7RA 2J1XA 4I3SH 4DO4A 1DQWA 5G1MA 3WFBL 2V5BA 5HR7A 3PWLB 5T3XL 3N6HA 1AHWC 3WF1A 2H3NB 5M95B 3AB0C 3C5JA 4AHOA 3IJDA 4LAQL 2G5BB 1DBAL 3RWEA 3T6VA 2P46B 2KZWA 4KY2A 1HCVA 5LIUX 4IHOA 3I2CL 3GNML 4XHQA 4KK9D 2GBUA 4JFYA 4I0PC 4XKYB 5F1UA 1QI3A 3TEXA 3VFMA 1KCUH 4JO2L 4KXBA 1XCTB 2MCG1 5EOQH 4DXVA 4JFPA 4I18A 4WFHE 1EJOH 1IBFA 1SEQL 2V5MA 5L2KB 1F3XA 4GSUA 3H0TA 1WA0X 3NCFB 1Z3GH 2ZJSH 5TK4A 2J8FA 4FOMA 4PUBH 3NPVA 1KJVA 4KT2A 4LSVL 3BTNA 2OKMA 1QFHA 1H61A 3NJFA 5BMXA 1CX9A 1NWRA 5CC7A 3EB4A 2BC4A 3C8KA 1BTCA 4PTTA 3QZWG 1RZ8A 4GRMB 2Z1SA 5CU9A 3ARBA 4DF2A 4OD3H 5E9DE 2ZCZA 1EC8A 3THML 2NZ9C 2R2BA 1RY0A 3VIIA 1CB7B 3CVIH 3JWOH 3VRJA 4H2CA 3DO3A 5GS3A 5FOBA 5A6JA 3EJCA 1RCXB 3TC6A 1RUKL 5E0CA 3APMA 1HHIA 1YQ2A 2QQQA 3PQYB 3F5WA 3WSQL 3ASWA 4ZB2A 4B4HA 4J1UA 5MHSE 1DP0A 5EN3A 1JGVL 4AD2A 1FXPA 5KSAA 1VA9A 5JUVA 1KYOJ 4F7PB 3GWQA 1OX6A 3KLLA 5DRNA 3IDMB 1IGIH 2EIZA 4UQ2B 2XN9D 2BP3A 4G6FB 4UTCA 3TL5A 2J12B 5E4AA 4APQD 5IOPA 4DT2A 4GUGA 4PQXA 3IYLW 4W8AA 4TUJA 2MNRA 2CZNA 4KTEH 1JI1A 1FNEA 2CXGA 1XQLA 2ATPB 2BVOB 5B21A 3T65A 1O4UA 1Q9WB 1FL5B 5TPWH 2YPLB 2Q76A 4O58H 1SJEB 3KDPB 4H5SA 3WXWH 4YSQA 1HJCA 3PB0A 4H0IA 3UCCA 1KKOA 1EXUA 7FABL 1VLXA 2YD3A 1DE4A 1FC2D 5F96L 4P4KA 3WMQA 4ZNEE 2F1AA 2Y62A 3LDVA 4FXJA 1ND0A 4HIHB 3UGRA 4MTMA 4JD4A 4UQ9A 3KBFA 3L3OB 3QWQB 2W07B 4L8SA 5HGDA 4XAZA 6XIMA 1FDZA 3TE9A 3HNTH 4K3JH 5AW2B 3QDGE 2I5GA 2AXFA 2OTUB 2UUDK 1LEKA 4F8TA 2EUVA 2F6UA 5FJOA 3TAOA 4TQHA 3VSQA 5I1IL 1DKWA 3PF3A 3KJ6L 3KVMA 4LV4A 4BM7A 2ITDB 1P4LB 2UY6B 4QHKI 2G4GA 4DOHB 4IJRA 4JZOA 4G2AA 2CLKA 4HEMA 2AP2A 1EUNA 4ZEPA 1RY7B 3ZE2F 3A4AA 3WNJA 1U8JB 5EU6E 4LL4A 3VIHA 4QS5A 1A3RH 1HIMH 2NRDA 2NX5B 2WNKA 1SHXA 3NJJA 3N50A 3OR7B 3LNEA 4N9GB 3TBVA 2DEPA 3MJ9L 3KBMA 1ZA3A 4BFAA 4Z3GA 1Q65A 3O9WA 4K3EL 2EPOA 2X4TA 4O1CA 1MRFL 1U8MB 1VGEL 3L4VA 1V0MA 2DPEA 2ZCKL 4RPPA 3UETA 1Q72L 1VEMA 4X4XB 3RAJH 4YH6A 3RY4A 4RZBA 1RJLA 3ZYJA 5IFJA 5A8NA 5AWNH 2ADYA 1A5NC 1RUMH 1XF2B 4GLRI 4N3UA 1MWAA 1NUNB 3DHPA 5E0QA 3EFFB 3LX9A 5CLWA 1A53A 2O7QA 1IEAB 5E7FA 2R29L 4AYSA 2Z2UA 2CHNA 2Z1KA 4IBYA 5IROC 1F2QA 5GS2H 2FIQA 5PCYA 1P0SE 1F8TH 4L4TE 3HM7A 7TAAA 5FUCE 2APFA 3UCRA 1K02A 4LLQA 4OUUA 3LZ5A 3WNPA 1BAWA 2HTKC 1ZV2A 2ANUA 4HJ1A 5EUOE 5DN1A 3CDZA 3CU1A 4LB4A 1EX5A 3HNSL 4QHNB 5K9JL 1LUCB 3OW1A 1IBYA 3WFHA 3D5OF 2VZTA 3MNVB 1DLHA 1UZ6F 1E9OB 1QA9A 1UT9A 2A6JA 2VN3A 3KHQA 3IXTB 4JW3A 5C6WH 3F1QA 3DX7B 2MOVA 4FHBD 4K8RH 3UJJH 3TR9A 2Q86B 4ELMB 2PDPA 4JHBA 1HCFX 4EIZC 4QRUB 5H8PA 4AK1A 4AH7A 1FLRL 1MFBH 5DLCA 4NU7A 1SN0A 3VSVA 1RPXA 1NUFA 4KQNA 3MLPA 3B04A 1PVNA 1TEYA 3RPTA 4E68A 4UXDA 3EJUA 2OYMA 3GI8H 3Q5TA 3VD9A 4MY9A 3WLTA 5BOEA 1UXLA 3B9KC 1J9SA 2ITCB 1NCAL 2NY1D 5FOJA 1OINA 3IJYA 3HB9A 4AZCB 4KKAC 3BUYB 1ZGLB 1GTNA 5M5DA 2OXHB 2XWRA 7PAZA 4XO7A 2W9MA 3W82A 2VRQA 3AAZB 4IYKA 2XGBA 3DFPA 3E0VA 3VCRA 4BSWB 3D30A 4F2BA 3EH3B 4JUTA 2ZP9A 3QH3A 3PZOA 5C0EB 3DYMA 2DM3A 3SKOA 3UBXG 2CZFA 3EPNA 3IFPA 3MCKA 1BTMA 1E6ZA 1QWNA 4IBZA 2KLSA 3BPNB 4HUKB 1U8QA 5E2UL 1NQ6A 2EABA 1TE1A 2XFFA 4EI6B 1Q90A 4L9XA 1JHKL 3B2VL 1EEPA 2GHWB 4NKIL 3RMJA 5KS9F 3TQVA 4YTSA 3TO4B 2NR6C 4CC4A 1TG7A 3CUJA 1KCSL 1KJ2B 2O9RA 5FF6B 1SFTA 4EIGB 2QPFA 4UNUA 4AQAA 1QPKA 4NNPH 3OJMB 5IK3B 3SBQA 3ZY7A 1L9NA 2X3AA 5JQ6L 1Y6NR 1K1DA 1NJJA 4OE7A 4HF5L 4WXYA 2OCFD 1SYVB 4AEHL 3MP5A 4DQWA 1B6DA 3P54A 4S3DA 3BMVA 3EAUA 3K2UL 3HS0B 5B7MA 4DF0A 5MKGA 1EFQA 2DQGH 1J12A 5DQ9B 5DS8B 1A5UA 2HVNA 2MQCA 3LKQB 2CRYA 2OKTA 2OQHA 2J73A 3VC5A 1YC8A 2DW5A 1P0NA 2LVEA 5CN2A 5D72H 4YN3A 2B7NA 3AG2B 4C1NA 1OPOA 3MACH 2PP9A 4YHOH 5K9QI 2XSKA 4P8UA 3M1ZA 1NGQH 2XVLA 1ID5I 4H1LG 4PD4K 2MQGA 1XIIA 3SPHA 5JW4Q 2E8ZA 1CFVL 5G5DA 1M3JA 3KBEA 3S35L 3BANA 1E4LA 4PVMA 1XIDA 1EZVY 5TF1L 4F57H 4I90A 2PNDA 2WINA 4NKIH 2FWUA 5A69A 4JVWA 3NL6A 4JANB 1IL1A 3FTGA 4FHKA 1A6TB 3BHBA 1M7PA 3E5PA 2GC7C 4P3DA 3DFQA 4HU4A 1EZWA 1XEUA 3QHTC 5HDWA 3T3PF 4HS6B 4YBQC 4ZMXA 4WJEA 2FZ8A 4DWSA 1U8QB 3LV3A 4X2PA 3MR9A 4Z7AA 1PLAA 5I30H 4JTRA 1ZHLB 1FVCA 3SIZA 2FJSA 1VEOA 3GYRA 2IV9A 1LL6A 3TR2A 1SHSA 3P4MA 2Z7YA 2BCMA 3RKDC 4D9LL 2R27A 3NJHA 4PRDB 5TQ2H 1C90A 3MCKB 3UTQB 4LS1A 2XFXA 3ARWA 5AOJA 3SN6N 1M65A 5F7BA 5I16B 4EIUA 2FZ9A 3VYOA 2PCFA 4HOZA 1EHLL 3AAZA 5TF1H 4PG9B 4YDJB 3KDOA 2NYZA 4L0PB 1Z0MA 4AVHA 3FRPG 4F92B 2KI6A 2BY0A 3UFIA 4PR4A 3A12A 3U6XA 3MA9L 3KXFE 5K2ZA 1QMUA 3W26A 1KOAA 4LASH 4EOWH 3SPJA 3O4OB 3MV8D 2V8MA 3PZTA 4OOUA 3FU0A 4UZUA 2D3JA 3H24A 3EYOB 3PAJA 1TQWA 1OAZH 3HKZA 3G6JB 5EU6D 4IQHA 1TU2B 2YXXA 3OGVA 1BECA 1XCWA 2R82A 3TXVA 3O6FC 2Q7NA 2WMGA 2Z6FA 3V1PA 1WFJA 4AY1A 3MI2A 3FFOA 4UMSA 4B7LA 1TUXA 3FQWA 3HOJA 3QM3A 4DUOA 4RZ5A 4XAYA 1QSVA 1CYWA 3DXAB 4KROB 4R4ND 5KVEE 1OFPA 4PWFA 2CAKA 5HMEA 3K91A 4TVPD 1NAMB 4RGND 4R2GD 4APXB 2I9EA 3HA1A 2Y3NA 4ZSOA 3DI1A 1H6TA 2F7OA 2P80D 3BEWA 3CZJA 3QZEA 4GUHA 3E2SA 2B5IC 5DHMC 1N55A 1QHPA 4LSVH 3LQLA 3G8EA 4Q4EA 1SBSH 1SSDA 3R12A 4D8OA 1TQCB 3MNWB 4N26A 3B0VC 2NXIA 2EUZA 2EDHA 3KTCA 3WJJA 2F9RA 2AEPL 4HIXL 4X6CA 4YNYB 1QNSA 4ZB0A 3WUEA 3VFRB 3VI3F 4MZIA 4A3RA 3HE7C 1O94A 1EAQA 1JNLL 1NSNL 2HUHA 4BZ2A 2BX7A 2X9WA 5L4FA 1ESOA 3ZJ8A 3MLUH 3REVA 4YN5A 1F18A 2QQNL 4XXWA 2YXVA 1AHMA 2Z1VA 2X28A 4EQ2A 4B5UA 3BAIA 3KPQA 5GS0L 3D69A 1F3JA 1OZUA 5A1AA 1X5YA 3PNUA 1AGBB 4UV4L 2ALRA 4DVRH 3LDBC 1B0RB 1QEWB 3INOA 5DHVB 1VC4A 1G43A 5T1KD 3NL3A 2WYTA 1VPXA 2GVJA 1P7TB 2Q6ZA 3HPSA 4MHBA 4JN1L 3NCMA 1QR1B 4I6KA 5B38A 4W4OA 4QRRD 2KZKA 3HR6A 2XM2A 3LAFA 4IK7A 4US6A 5EU9A 2LT9A 4W9HC 1EJXC 5C0NC 1LQAA 2ZRZA 2ZKXA 3MUJA 4W9KC 2YCKX 3LHPL 4WSHA 2XYBA 4AKPA 2VLKE 3IUIA 1IBZA 2GIXA 3B5HA 2XSAA 4OZGA 1H5BB 2NNAA 4PRAA 5SX4H 1F76A 1YEIH 2OZ4L 1AC6A 4HPNA 1MFDH 1QWUA 2CNYA 2WCPA 4PRIB 3B3IA 1ULVA 5DHDA 4C6BA 4NRXA 3QAQA 4V1DB 9XIMA 3E02A 2WLNA 4W9DC 3MLUL 5LUMA 2EVIA 3V52L 3K2KA 3RLVA 5DTFA 5B8CB 1RULH 1ONQB 1C16B 3IN0A 1E4IA 1FWNA 5AC6A 4FFVC 4PJAA 2WWKT 3FUIA 4PMFA 3WKQA 1J5OL 1QFEA 4HSAC 5H4ZA 2R1XB 1MPAH 3QJOA 4A6YH 3PZVA 1I6NA 1SFSA 4RNFA 3KPOA 3PWGA 2OR7A 1S8DA 3GVQA 1TPH1 4NRSA 4WOQA 1BD2D 2VCOA 4FQIL 3UIYA 1SYSB 1AO7B 4HTBA 3STPA 3SY1A 3U2CA 5CMAA 4ECLA 1KMGA 1Y07A 1NGPH 4G5ZH 3DKHA 3AZTA 4AVOA 2AEQL 5D9SB 3W11C 4AQEB 4Y7MA 5DD6B 4AEHH 4XNZC 1JZHA 1X7QA 3X13A 2DIKA 3BD5A 3GT6A 2G60L 3Q8BA 3F4WA 1UWGL 1CDHA 5IFHL 1E6PA 4RPQA 2ATPA 3V4PL 3JTSB 3HJ0A 4IEFB 3ZT6A 5FO7A 2FFCA 3CZUB 5MF5A 4X5WB 2E9MA 4DLMA 3IIOA 1FNLA 3GHRA 3CFKB 3UTZA 4AYID 2BW5A 1U1HA 2ZONA 2O5YL 4IOFC 4AX7A 4I18B 2BOBA 3OHXA 2H41A 4NGHH 5CIPH 5HHNB 3N41B 1YLVA 1NBVL 3BYYA 2DQCH 2J7DA 1P9MA 4W6XB 2YYUA 4GBXD 3IM1A 5CP3A 5FFGA 4F57L 1L5GA 2YLLA 4U1MB 1GYAA 4JHAH 4ONHB 1DQMH 5J89A 4HNCA 2Q87A 1ACCA 2IAMA 3S34L 5F9OH 4IISA 1KGYE 5BWFA 1IE5A 3R0NA 4TPRL 4JNZA 3N19B 1M2OA 1Q4NX 1PZAA 4FS9A 4WY0F 3BPOC 1BDYA 1YE4A 3TYBA 2J43A 3TONA 3GR8A 4L3FA 3EKCA 1SRDA 4PHZA 2W4XA 1F4WH 1MNZA 3ROLB 1ONWA 4WEMB 1B4JH 4JFHD 3CFKA 1BZOA 4QIRA 3QE5A 3C8FA 2B3RA 5HBBA 2QJDA 1BOGA 3W2DH 4C47A 1WWBX 4OGZA 5L2KE 4N9CA 4QE1A 1XCTA 2FD6L 4M6PA 1IAKB 4FFZL 5C0CB 5EMUA 1H7XA 1KEML 2CKNA 4JG5A 1I1WA 1DEDA 3ABRA 3N1AA 4PRIA 2DLHA 4MRCA 4KJPD 4JX0A 3RWJA 2EBNA 4XO8A 1BXUA 3P30H 4OZHA 3T77B 4B96A 5HYSG 2AQWA 3FCSB 2GI0A 2DSKA 2NSOA 3HUJE 4EAMA 2Y1ZA 5DHXB 5J1AA 1OGGA 5I15H 2VLRE 3H6OA 1A02N 2J5LC 4JJHA 3O6KL 3WQCA 1LRTA 3N0AA 3MZGB 4IGBB 2DQTH 1IF2A 1MCRA 4NQEA 1OVDA 1BD2E 1K4CB 2XWJB 5DZPA 3CNYA 2PPFA 1L7IL 3VG9B 2ZUWA 2NUTB 5FJTA 1E0TA 2NY5L 2XZAL 4WU7A 4CN4A 1DLFH 2ZRYA 3S47A 3ESPA 5FA4A 1E1CA 2WVSA 3LBCA 3NO5A 4FIQA 4Q2ZA 4C6PA 2NTSP 4Q4IA 1QFUL 5K1VA 3FT4B 2R51A 5HYQB 4O02B 1IGTA 3QI9A 4OQTL 1EMTH 4Z7VE 3KCJA 3OO2A 2WOBA 2DQFB 1G7QA 4NHUA 4XRCA 4YSCA 1RFDL 4Z08A 3P11L 2C9VA 5FFLA 4C7FA 5EFIB 1FHGA 3S2MA 2VX6A 3M1OA 4ERGA 3VXSA 1Z9AA 3VXUD 2ZZ4A 3QMRA 1HL5A 4X50A 2XIDA 1T89C 2C16A 4R7DB 4PGLA 3HE7B 4B9FA 4OZIF 3AMGA 4L6OA 1UYQA 3MBXL 3MSPA 1ZT4A 1D5MB 1N8ZB 1XG4A 3N14A 4S1FA 5DJ6B 1C08B 3BSZL 3EGXB 2ADGB 1ZB5A 4Q6XA 5FF2A 4B90A 1NINA 2QKIA 1YDVA 2VXQA 3F58L 5IVNA 2V5DA 4MS8D 1ZPUA 5D5MA 3XINA 2BNQB 5T9CE 1U3ZA 2VD9A 2CDGB 3B8YA 1SQ7A 1WK0A 2HSIA 3NAAH 4K7FB 1NCCH 1KNOB 5T3XH 3TN0C 2UWFA 3RG6A 2NCEA 3F00A 1MHCB 1FLRH 1MFBL 2JI2A 2WMPA 1T0OA 2PYFA 3RWIB 3T2OA 1FHUA 3MT1A 4ES4A 3AHXA 5JW3H 2FPYA 1ORSB 1EGMA 4JJ5B 3WN5A 3GI8L 5E8PB 5F2IA 2VLJA 3SB3A 5IBTH 1FF5A 1UZ1A 5A2LH 4P46C 4RDQG 3C52A 1U1JA 3NQ2A 5CBJA 4MNGB 1IEQA 1UYWH 1QSFA 3RDTA 4QXVA 1MW1A 2COQA 1ME8A 3IGHX 5HDBF 1GYLA 1Q9LB 3F7YB 1OIMA 1A3LH 3W6YA 1INEL 2EDJA 3IEAA 5IVZB 5FJIA 5C0QA 1RZJH 4WW2C 5BMFH 1RZGA 4G8GA 3ARBC 1L0YA 3TYGH 1XD0A 3AO0A 1P6WA 3BH4A 3DMMA 4FFTA 3MO4A 4ZS6C 4H9UA 3VH8B 1ZRQA 2QJMA 1EAOA 1XX9C 2L8AA 2WO3B 3OPZL 4HFWA 4FA7B 1ISVA 4JZNB 4ZD3L 1R3HB 1O9VA 1OHQA 2YD1A 5I1CL 3VQ1C 1GPOL 3C6SA 2X6CA 1GVQA 4C6QA 1YBQB 1O6SB 1UD5A 2HX7A 3QFJB 3KMDA 1UKQA 1MWAL 8PAZA 1JULA 2E5DA 4NSBA 2NT1A 3T40A 4AZCA 1FGVL 3AM8C 4NKQB 2LW3A 4MZ8A 3MRIA 3E9UA 5CZJA 4HS6A 3SDOA 4UAHA 2VDKB 4UILH 5F6HJ 2J9YA 3TTQA 3ESVF 3VA6A 1PE1A 3R0KA 4ODSL 1L9SA 2E6PA 3QXTA 4Q58C 3EX6A 2FGZA 1QVOB 2X4UB 3C8HA 4XZLX 3VFUB 4BRJA 2VYRE 4JNYA 1HO4A 1CT5A 4GZJA 3UZXA 1AQMA 2IJ0C 1B2YA 3DGCR 4BSJA 2BXVA 4M62H 4XAKE 5FJJA 3EGJA 2E8YA 1Z3RA 2CUIA 5JMRA 3TSBA 2NQ3A 1BQ5A 4Y5VB 2DVXA 3RY6C 1IEWA 3MMEB 2B77A 2BVWA 3LZPA 3TO4C 4XAKD 3BWZA 2EDXA 2PPCA 1CENA 4NQDD 5A3IC 2CLRA 3UXDA 3AM8A 2OMXB 3EH4B 4P2OB 1LQSR 4U3SA 4DN4H 5C0BA 1FWBC 4NKDB 1S9YA 4JHWL 1TB3A 3BSZA 3DV4A 1RPUA 3DZ1A 4IMAA 3B2UD 4XUYA 5GGQL 3QEUA 1CLOL 2FPTA 4OB5L 1JXJA 4XX1G 1HVQA 2OMWA 1YEEL 3O8XC 1ID2A 2IALA 5E6UB 2Q8ZA 2XJ7A 2W0FA 3OF6A 1T2QL 1MREH 2OR8A 3KAOA 2MTPA 5BRPA 4HFUH 1S9XA 3RO8A 3H2PA 3Q58A 4EXQA 3MRNB 3IVSA 4D8LA 4E9SA 2BCKB 2ZX9A 3VXOA 1NWUA 2HLAA 5L2JA 1W32A 1QO3B 3NAVA 5D4YA 1ICQA 2EP6A 3NK4A 2BMKA 3QV7A 4Y9FA 1GH7A 4BK5A 2DEWX 4KGLA 2AABH 1ONXA 3S5SA 1NMBL 4WW2F 4X7TA 2R23A 1QHOA 1YCSA 4CVXA 4R33A 3IETA 3CFJB 4P5RA 4QXWA 2N7BA 2FD6H 4LHUG 3C0LA 1YEIL 1KRAC 1CICD 4GXVL 4ORGA 3G1RA 15C8H 3T0XA 3EKZA 2DM7A 1LDPL 1F3EA 3HMCA 3BVTA 3RBGA 4D72A 3BQ6A 5JZ7D 1NMAH 1F58H 3EMQA 3NMEA 2FPVA 4JDZA 3SY6A 3H1ZA 3MI6A 1YEKH 2P43B 2ZKYA 5KZCB 5U4NA 1GOMA 4WEBH 1NDWA 2CWNA 1RK7A 3T2QA 3PP7A 4UUJB 3ELAT 2IH3A 3VGHA 3GG7A 1MO0A 1UJ3C 2GCYA 3DXAE 4M6NH 4GRWH 4Y8FA 1HP5A 3Q8FA 5L6UA 2HPOA 3HG1B 3ZDZE 1WZMA 5FECA 1KLYA 4OF8A 2K9FB 25C8H 4P2QA 2DMBA 3HGOA 3FSZA 2FRGP 5AYUH 1HTIA 4UR8A 5SWSB 1O7VA 4HD5A 5KVDH 4J9JA 4IRZA 1R7OA 2V2HA 4JRFA 3VDGA 1I31A 3S37H 2A7NA 2DVTA 4B5XA 1QP1A 3TQPA 1I75A 3CHEA 1CDYA 1ZIAA 5LNSA 1MFEL 4PRPB 3PXJA 4PJDB 4RGOH 4GRLD 3GIPA 3VVWA 3NTCL 1VIWA 4HSCX 3MAWA 4LT7A 4A2FA 5CKGA 1P43A 4P0DA 3EJSA 1MDAA 4FABH 4I7ZC 3G24A 3HTWA 4WY7H 4R85A 3INPA 5KZCD 1RXLA 5KJRL 1MCLA 3AS2A 2VDML 4EXPX 2LLLA 3T0ED 1E65A 4JQIA 4JRXA 4YHYB 4M3JA 3HI6H 1E9OA 3QC6X 1RBAA 2O0TA 2XA8H 2ROYA 1KXVC 5I75B 1F3WA 2DMCA 3X3FL 1XRVA 1RALA 3UJTL 5ABFA 5I0YA 5BZDA 1EDGA 4QRQB 4QHNA 4HK6A 1JPSH 2E67A 5DYFA 2B7OA 1FAIL 2NXZD 5GSRA 5D1XE 1TVDA 3FSVA 2B5IB 3SGDH 2QAFA 5SWUA 4D3CH 4KK8D 1MFAL 4MGGA 2Y5TB 1E4KC 5K39A 1ED3A 4WJ5B 2HFTA 1E9QA 2G4EA 3RP1A 3VXMA 2DT0A 2IPWA 4PB5A 5DJCA 1GIGH 4QRPA 5IBTL 2VMDA 1V0KA 3GYCA 4PV9B 1MHPL 3HEIB 2GJ6B 1MFEH 3U25A 2ABAA 4LW7A 1WT5C 3H9YA 4B9PA 4F0HA 1JE6A 1X5KA 4Z3HA 5FB8A 2R0LL 1UYWL 4YK4C 1OP3H 2R9HC 1DWGM 3TO2B 1NDYA 1Q38A 1TKWB 2DQDH 3DVGA 4BH8B 1P5UA 1H5VA 1J9TA 2WOYA 1BEUA 4W9CC 1DJQA 4H4NA 3G1AA 4J2MA 3APDA 1GOQA 2WB7A 4H0GA 4XC1H 5CR8A 3BFOA 4BHUA 4FFZH 2V2WA 1NC2D 1K6QH 5HWMA 1L4IA 3CH0A 5T1LB 1P2CB 3ECQA 2CFFA 2NX9A 3QQ9D 1KENL 4NENA 3HHMA 3LVTA 1EEYA 2P9RA 3CZGA 4JFXB 3SDXF 4MMYA 3TFKD 2PTWA 3CMOH 2XVNA 3GZ3A 3CPLA 3QHOA 5CSSA 4EACA 1PO9A 6XIAA 3PSVA 1FZJB 1QZNA 2A73A 2BNUA 4NQUA 1W91A 3UYRH 4Y1AA 4BCXA 4EKXA 1CEOA 1BFTA 4C60A 3QQ4A 3V4LA 2WO5A 4AGLA 3AUVA 1B4TA 4KVNL 3RK8A 5FYJL 1EXHA 4BF9A 3QDMD 4YHKL 3BN9D 1H5BC 1J93A 5EBUA 3QO0B 3DSFL 1JUEA 3A4DA 3B0PA 3E74A 3KCWA 1KFLA 2ZRWA 2J75A 3QJVB 4QJ1A 4JO8A 4CN1A 1E6NA 3QI9C 4HJ0D 5IWLA 3L2IA 4HT3A 3HAEB 3GKZA 4YE0A 4JFTA 1GY2A 5DMYA 2PGEA 1SHWA 4NRYA 4H6QA 4DM1A 1U2YA 4FQPA 4L5ZA 3ZO0A 3LPPA 1WX0A 5HUPA 3PZMA 3MHZA 3WE6A 3C6LD 3VINA 3DBPA 3C75A 3UTPE 1IKNA 2P3YA 2Z7GA 1H8NA 3KXFA 1DUZB 5E1AA 3HB3C 1MCWM 3RVXC 2X0VA 1LQ2A 3RPDA 3N44B 1CDBA 2GLKA 1W6LA 1IQWH 4JN7A 3FJ4A 2ZTJA 4ROPA 1IM9A 5EIVA 1Y8BA 3VU2A 2R8WA 4PW4A 2VC6A 4JICA 1K8YA 2QF7A 3Q3GA 3DG3A 4JN8A 4JRXE 3KJ4B 1HILB 4WKXA 4F7TB 1O5PA 4O4YL 4JM2C 2D31A 4AK2A 2HFFA 1Q63A 3ARDD 3IU3B 2VJ0A 4WSGA 2CSPA 4WDUA 4L8DB 4RMUA 2WC4A 3OQ3B 1UB5B 4XPGH 3SE9H 4ZDHB 5I1KL 1FFPA 4PJDF 3WEXB 1GW0A 1F4XL 1Z9SA 1KXTB 4M7LH 1C8XA 4G6CA 4J3OC 3QIUC 4IDJL 1OALA 4ELME 4ZXLA 2QCDB 4G8EA 1WKYA 4NI6A 4PB0H 4BDVB 2IQTA 2WJ7A 4XPBH 2AJYL 3C2EA 5J6HB 1UT2A 1HXYB 3TJ4A 4PU2A 3ZDZF 3AU6A 4S2SB 4OZGE 1F6AB 5M7QA 2VH5L 3C87A 4B7IA 1JUBA 3IK2A 1AP2B 2GJ6E 2CU0A 4QRRA 3QXVA 4JTSA 2Q8AL 2AGJL 4RAVA 1XF3A 2QR0A 3D0LB 1SXZA 4YDVA 2RQ8A 3LKNB 3ZKXB 1EZLA 2ZDRA 4E5TA 3NJVA 5E4EB 3OXSA 2LOEA 5J3HC 1LBLA 3MRLA 5I8KL 3OVRA 3WEXA 4AL8L 4MNQE 2MNJB 4FG0A 4G6AC 4HV8A 2EPNA 2BOLA 2X6MA 2V9DA 5CHNB 2EUXA 5ICXB 4GW1B 1V08A 5HI4C 1FAKT 1OHZA 3R43A 1G7LB 1J8HE 1GPOH 2EIJB 3NZHL 5GJTH 2BSSB 3PWPA 5T1DL 5EO9B 1R3LB 1WWAX 1HILA 2YKLL 2Z92B 2JQMA 3OC8A 3CX2A 4FKKA 4FG6D 1U6AH 4HK0A 4LCUA 5DLMH 4DGVH 5IMOB 3EOTL 3PDOB 1BKHA 2CDFB 3XIMA 3MCLL 1COBA 3BWUC 4HN8A 5A6BA 5IROA 4DZ8B 1TNMA 2F15A 3MN8A 4KX9A 5ACLA 4DF1A 4KRPB 4M1DH 1IM9D 3I68A 4FULA 2VH5H 3N12A 4MLJA 1PTAA 3R8RA 3FK3A 4CJ1A 1XH3A 2DD8L 5D7JA 4BS0A 3WFCL 5F93C 5I9QB 3WE6B 3SCNA 3ITVA 1MOEA 1XSKA 4U1SA 3SDAC 4GSRA 1HS6A 3GMRB 1OT4A 1TOXA 3ZT5A 3H2OA 1IC0A 1M05B 3KP0A 4HBKA 3OVUB 4P3DB 4B3EA 3IKCA 5IK3A 4KKZA 1HP4A 4YEEA 4ZO8A 1G9EA 4OY9A 1NCCL 1QTYT 3GPSA 1WP6A 1VADA 5A2JH 4Q6JA 3RITA 1UIPA 4MAZA 1XR9B 2A9MH 2EH7L 2EXYC 3HFYA 4EI6A 2OW6A 1ISWA 1PSKL 1Z3NA 2Y6SC 4MAYD 4S1RH 3M7SA 4QHMB 4BWUA 5JIKA 5I3GA 4CLMA 4N68A 4NZFA 4C1NB 2WZPA 3VE0B 4Z3TA 5ERWB 3BCFA 4HDIA 4JFQB 2EKCA 4XBKA 5LBSA 4MXVF 1EBHA 1I7TB 3O4LD 2O5NA 4RV8A 1XC6A 4EF9A 1NGXB 3SCMD 1LO5A 1PD6A 3RYSA 2P0OA 2JKWA 1QBLH 3DUSB 3T1FA 1A49A 5F1IB 5BYWA 3W02A 2DZSA 2CGRH 1CI3M 2X1PA 2W6RA 5GNZA 3W1UA 3F7YA 1CBVL 1NPUA 2WBGA 2FH8A 3SGKC 4F7KA 1GZJA 4E2VA 1AJZA 1T04B 3WQOA 4X4ZA 4XWGH 3AWGA 3BW4A 5GS0C 1NCOA 1JPFB 3X1EA 4NC0B 4U0QB 3W7PA 2QFPA 4XCNA 4LUIA 4B3ZA 3HV9A 2GGIA 3ZGHA 3URNA 4QXUL 4J2XA 5HQLA 3C6EA 1WUZA 2FX9L 3EH2A 2EDFA 4CNSA 4HGWA 1MEXL 4I88A 4LSRL 4UMBA 2CD0A 2JCWA 4WX2A 3URQA 4B5SA 1OPGH 1UUOA 2HS8A 4D7PA 5EZLB 3M7FB 2BNQE 3H2WA 3ZKND 2OM5A 2NQZA 4GAYA 3T05A 4EPDC 5AOIA 3SKJL 1BD2A 2CHDA 1MMFA 3FSWA 2DSWA 3ZZQA 3L3GA 3FHQA 3NYDA 1E1FA 2CZDA 3TVMD 1IC1A 2IDUA 4JL1A 2XFGB 3SO7A 3LEXB 3FSUA 3RRAA 5EIQA 3SKNA 1NTDA 3OAZK 4PS4H 3G77A 3NG3A 1MCOL 3FQTA 2PO6B 1N8IA 2VFFA 1CFVH 1EC9A 2PWVA 3QUYC 5T3ZL 3WIIH 2F8XC 2VFDA 3RGBA 1XF2A 2CM6A 4OTXH 2WP3O 3GH7A 2H4EA 2OFQA 1H3PL 1T0PB 4A29A 4R6UA 4ML4A 2F19H 5LNDA 4YIWA 4JNXA 1ACYL 2Z8SA 1MXSA 1E4XL 3MLWL 4WUUB 3HI1A 1TA3A 3AIWA 5HYJD 2BP0B 2W80C 1HUVA 3N2JA 1R8LA 3UJ2A 5GHWH 1E5NA 1TJHL 3QIWC 1NCGA 2NY6B 1G9NH 5E0KA 2OMTB 2NX5A 1F4AA 4XG1A 1FHLA 3GXMA 1ZCCA 3A6BH 1B2WL 1BYPA 4YWGH 4EQ3A 4ZQCA 3WENA 3NA4A 5IREA 3B8SA 4RMVA 4DGIL 3IK4A 4AC2A 3QFJE 3VM7A 5ID0B 1I8MB 4QO1A 4LF1A 3TNOA 1A4AA