2WHJA

Understanding how diverse mannanases recognise heterogeneous substrates
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
308
structure length
308
Chain Sequence
AGFYVDGNTLYDANGQPFVMRGINHGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKMVAVVEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIINIANEWYGSWDGSAWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSIHDYGQDVFNADPLKNTMFSIHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEETGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKPSTVFTDDNGGHPEPPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-MANNANASE
publication title Understanding How Diverse -Mannanases Recognise Heterogeneous Substrates.
pubmed doi rcsb
source organism Bacillus agaradhaerens
total genus 125
structure length 308
sequence length 308
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2whjA00
2VX4A 1GZJA 2VO5A 2WKGA 1GQJA 2IXUA 4WSJA 1IV8A 2PB1A 2WANA 3PBGA 4GIAA 1HT6A 1TFVA 2JEPA 2DH2A 2Y2WA 5DO8A 1PX8A 1QVBA 1V6YA 2DIEA 1UWRA 2EXOA 3GBDA 1BYCA 3TA9A 4DM1A 1A47A 4PUEA 3U57A 1AQHA 2FHFA 1EQPA 2WVVB 1W3JA 2D23A 3EMCA 1OWQA 2UY2A 4Z2HA 6A3HA 5CGTA 4MAZA 5KEZA 4BZYA 4UOZA 1NWTA 5DT7A 2VOTA 1QNQA 2VMFA 3WH6A 1DEDA 4TTGA 2ZUVA 3WDJA 3AHVA 2VRQA 4CN4A 1US2A 4CN6A 3WIJA 1LG1A 3JUGA 4JIEA 3ZSSA 2YDRA 2CNCA 2E0PA 1C92A 2VCBA 3L2LA 3W37A 4D1IA 3CZKA 3AYSA 1OT2A 3VDCA 3KEHA 1OGSA 2PI6A 1G1YA 3HU7A 4JAWA 2YL9A 4DWSB 3EMQA 4Z2KA 3CUHA 3BLPX 3NJ3A 3THCA 1KGUA 2XFRA 3ZR5A 1JYWA 1HP4A 2PWEA 2G3IA 1R87A 3ZT6A 1GQIA 1DWIM 1QBBA 3TTSA 1TCMA 2J7BA 5A95A 4DWSD 3F5KA 2VRKA 3A6OA 1GVYA 3MV11 4H41A 6TAAA 2W67A 5ABHA 1UH4A 3KE0A 3MMWA 1BGAA 1ITCA 1W32A 3QHMA 2E9BA 1OD0A 4NI3A 1OT1A 2O9RA 4EKJA 1E6QM 1W9PA 2O9OA 3M46A 3AHXA 4QDMA 2X8RA 4X0NA 3W53A 3T0AA 2WNWA 3EDFA 3ZJKA 2XTKA 3VM7A 2DSUA 1ZBKA 2ZX9A 3N12A 2VQTA 1B3ZA 4C7FA 1KQZA 1W3KA 1W9DM 5GPRA 5FD0A 4W8BA 1W1TA 1E6PA 5DT5A 5BROA 2AMGA 2ZE0A 3BCDA 3F4VA 1CLXA 3MO4A 1X6NA 2BY2A 2GDVA 4CN1A 1KB3A 2WB5A 3ZSTA 2Z1SA 3BCFA 1V3HA 2DPEA 1CXLA 4PN2A 1VBRA 2BHUA 1QNSA 1MW2A 3VTRA 5D8WA 1XV8A 3TTQA 3AMGA 1V02E 1R8LA 3BMWA 3DC0A 3NSMA 1JXKA 2VR4A 5CLTA 1FA2A 5CSUA 1R7AA 4PMYA 3CPUA 1V3LA 2OYMA 3LPOA 1NOWA 2CBJA 4OOZA 3SCRA 2YL6A 3VIPA 3AI0A 1DHKA 1UG6A 4LX4A 2J8GA 3ZT5A 1LL4A 2G8ZA 4UQBA 3VIGA 1BYBA 2VX7A 1B1YA 1V0LA 1W3LA 3FAXA 4GZEA 4J3VA 2W63A 4NSBA 2GVYA 3ARPA 1B3WA 4UQEA 2D1ZA 1WO2A 3WFLA 2ZUMA 4CCEA 3ZOAA 1OGBA 2V3DA 3U7VA 1CIUA 2WHLA 2WVUA 3SUVA 1EHAA 4DWSC 3CHDA 3EDKA 3NIYA 1L8NA 2QMJA 4UNIA 1FHDA 3BAKA 1CXKA 3ARTA 1UKPA 1UWQA 5JIPA 3WMBA 3BSGA 5A6BD 1SYTA 4AD5A 2F8QA 3SCSA 3VGDA 3N04A 1J0KA 5EFFA 3W38A 3IAQA 4MPKA 4CVUA 2Y5EA 4BF7A 3LPPA 1ECEA 1NP2A 1UZ1A 5D9PA 1W2VA 3T09A 3IJ9A 3PZQA 4HU0A 1MQPA 4BQ3A 1UH2A 4YHEA 2ZUWA 1XGZA 4W84A 4UFJA 4J28A 3GDBA 5CSYA 1LL7A 5BWFA 4YN5A 1PPIA 2YJQA 5E70A 3A47A 3QHOA 4MNMA 1V03A 4ZE4A 4HZ6A 4UOQA 2D2OA 3W27A 1SFSA 4W87A 1C91A 2WMGA 4QFUA 4W8LA 4P7OA 4J3TA 5E9AA 1SR0A 1UWUA 1E43A 4HPHA 3ARZA 5D9MA 2OSWA 3RM4A 4PMXA 4J3UA 5DEZA 1R7OA 4W7UA 1H41A 5HXMA 2XJ7A 1HKKA 4AIEA 3G6LA 2VZOA 3WEOA 4NZCA 4U5IA 4MNKA 1JZ4A 2QF8A 1CXEA 1UHVA 3GYCA 3W6MA 2XGIA 2DDXA 3FAWA 5JIWA 1E40A 3PTKA 4MB5A 1YHTA 1UD4A 2X09A 2WLYA 3OGVA 1GPFA 2W92A 3BLKA 1BG4A 3MV01 3VOCA 3NCOA 1BSIA 2V38A 1ZBVA 2E40A 2CIPA 2ZUNA 3PZNA 2WPGA 3L4WA 5CPQA 3WN6A 2JF7A 5CLWA 1F4HA 3MMUA 4CGTA 4DUXA 1GOKA 3WF4A 3L4VA 2J25A 3GNRA 3WQWA 4X9YA 3VD7A 5IHSA 2ZUTA 1FP8A 5GNZA 5C8BB 1ODZA 3PTQA 1VBUA 2WHMA 4EAMA 5AC5A 2BFGA 3VDAA 4UQ9A 2CBIA 3WDRA 1S46A 4S3KA 3DHUA 2DSVA 2Y4SA 2EPLX 3POHA 2BHYA 1JF5A 1QHZA 1EOMA 1F4AA 4V27A 2ZXBA 1TA3A 1KBBA 1V3IA 3PZOA 4JKMA 3WL1A 3SUTA 1BF2A 4MAVA 1VRXA 3BH4A 3VIHA 2J75A 4AYSA 2WVTA 3I3EA 4KH2A 2XIBA 5E6ZA 5BXRA 2J78A 1DWHM 1OGGA 3AIEA 1GVIA 3APGA 5BYWA 1NOUA 6CGTA 1KWKA 1CZ1A 5GQBA 5FOOA 5CQ1A 3AFBA 1WZLA 1B3VA 1TE1A 1H1NA 1HNYA 1E4NA 1FHLA 4X0VA 4PCSA 2GDUA 4UR9A 4NRSA 3UERA 3AROA 2PF0A 1UR9A 5FIPA 1FH8A 3L4XA 2CHNA 3T2OA 1ZB5A 2IUZA 4ATLA 5A1AA 1CXFA 2EPKX 4M81A 4D6IA 3ZJ7A 2W61A 1EQCA 4XB3A 1O7AA 1UYQA 4NRRA 1UD2A 4TVDA 1UR1A 1G94A 4P8VA 3AMLA 2RGLA 3U5YA 3WKZA 4F9DA 5BXSA 4M56A 4QCFA 1O6IA 4PSPA 2E8YA 1U33A 1US3A 3PZTA 1PIFA 3CMGA 4PMVA 5I5RA 1V6XA 1W9VA 2UY5A 3BMVA 3OLGA 1WDRA 4AY1A 2QPSA 2BXYA 2A3AA 2X0HA 4KGLA 5CPTA 2PBGA 3VDBA 3L4TA 4QLLA 4BQ4A 3CZJA 1JL8A 3AIRA 4HA4A 1VFOA 1RD6A 5DF0A 5CG0A 1MYRA 4AD1A 1VF8A 1UKOA 1W91A 4B3KA 1V0NA 5LYRA 1E9LA 3WSUA 1XYFA 3K1DA 1BAGA 3N9KA 2DH3A 1E71M 2CBVA 2FH8A 3EDJA 1TG7A 1B9ZA 3WBEA 1JDCA 1HJUA 2D3NA 3VINA 4FF5A 2V5DA 3ARXA 5CZKA 4W5UA 1IZJA 3PZUA 2CETA 4H8HA 1J0YA 4S3JA 3W0KA 2VTFA 5M3WA 1B3YA 4JL1A 1V02A 4TX8A 1E5NA 2CKRA 1DWGM 2FH6A 5I2UA 3B9DA 4P7LA 2JFEX 2J7FA 3K4DA 1EHNA 1H5VA 1QNOA 4OUEA 5A2CA 3CZ8A 4H04A 3VIIA 5DMYA 3D5HA 1LL6A 1UD3A 2XVNA 1JDAA 3UETA 3BC9A 2QMKA 1G9HA 3KL5A 1CTNA 2BNJA 3CUFA 4N0RA 4AWEA 1QW9A 3SUSA 1AQ0A 1B31A 1GHRA 3AS1A 3WMCA 1B2YA 1W1PA 3VX1A 3CZEA 1E6RA 2A3CA 5LA2A 2OYKA 4JKKA 4HTYA 2BHZA 2VR5A 4BCEA 3AJ7A 1V6VA 3SCQA 5HPOA 2HVMA 4P7NA 2ZX5A 3WNMA 4MJ2A 3BGAA 4BS0A 1NH6A 4PBGA 4GI8A 4OZOA 3GZAA 1VAHA 1OD8A 3NDZA 2VCAA 2WCGA 2J79A 3OG2A 1EXPA 3WD4A 5EFDA 2DT2A 1XD0A 2DGAA 3TONA 2J74A 4LYQA 3A3HA 3O2LA 1RP8A 4GZJA 2X05A 3T2QA 2Y24A 5D8ZA 3WQ8A 3ARVA 2JIEA 2VVSA 3AS0A 3GBEA 4AZGA 4HA1A 3ALFA 3WEMA 4WLCA 2WBKA 3HMCA 1XYZA 2BVYA 1D7FA 2AAAA 4MB4A 1GJWA 3QOKA 4CD8A 1B0IA 4LQ1A 1JG9A 3WNPA 3BAXA 3M07A 1CLVA 3WNOA 2GSJA 1B30A 4D6DA 2WC3A 3PZVA 3W24A 1ESWA 3EYPA 3FHAA 2ZXAA 2PC8A 3GH7A 1V3MA 3O6AA 4Y7EA 1Q6EA 3NUKA 2NW0A 3L4ZA 2J7CA 4ZENA 5HBFA 2BY0A 1JI1A 3AIVA 1HN1A 5A2BA 4H8VA 4PMQA 2CITA 2WKLA 1NP0A 2CCRA 2GUYA 4CU7A 1UQYA 1LWHA 3D3AA 3ARYA 4KGJA 4RL3A 1JAEA 3QHNA 3SCNA 1E1EA 3CMJA 3F5LA 3WNKA 1PZ2A 3CUGA 3VIMA 1J18A 3MU7A 2PWDA 3E1F1 2UWFA 4PCTA 4PMOA 3PZGA 3VNYA 1LLOA 1CWYA 2JALA 1LF1A 1QW8A 2VZTA 1ZJBA 1ZBWA 2WMFA 4LPCA 1K9DA 2PWFA 2F2HA 1ZJAA 2EJ1A 3IAPA 1OCQA 3AZSA 4RE3A 4UZUA 4PTVA 3OLIA 2XM2A 4HA3A 2WHJA 3SCOA 4CD7A 3CBWA 3W28A 4CKQA 1CGWA 5CXPA 1TZ7A 1FP9A 1OIFA 1FH9A 1UD6A 1QI2A 4J3WA 5E09A 1Y7VA 1HL8A 3SCTA 4UFMA 4MJ4A 1E5JA 4B3LA 3W82A 3AHZA 3MUAA 4LGXA 4MB1A 2HISA 2YKKA 3AYRA 2W66A 2X0YA 1BYAA 3BAWA 3WDPP 1JNDA 5A3HA 3VIFA 4D72A 2XFYA 1DP0A 4KWUA 3AIBA 1OBAA 3POCA 3WFZA 2VRJA 3WD0A 3DYOA 3VUPA 5AYIA 3WQ5A 1V0KA 5BRPA 4NF7A 1J0HA 4OKDA 3IANA 4MB3A 4UQCA 4AC1X 1K9TA 4AIOA 2J47A 2ZUUA 1E15A 1E6XM 4GI6A 3VD5A 4PYSA 3WF0A 4TVCA 2OWCA 5A6SA 2D0GA 4M29A 3TTOA 2PWHA 3WY1A 4JZ5A 5FL0A 1UZ4A 4GPNA 3EMZA 2XM1A 4A4AA 2FHCA 3IK2A 7A3HA 3GXDA 1BG9A 2XPKA 4JFSA 4P8WA 1XH1A 3UEQA 4D6GA 5M03A 1KR1A 1NOFA 4V28A 2VVNA 3VD4A 1H0IA 3WL0A 4Z2LA 2W62A 1UWTA 1E73M 3QR3A 1JIBA 8A3HA 4JFTA 4UFLA 2JEQA 4OBSA 2UY4A 1TA3B 3KWXA 1E0VA 1JGIA 3ZJ8A 3EDDA 3AQUA 3DHPA 1W3HA 4M82A 4CD6A 5A8PA 1JYVA 5E0CA 1E0XA 2V3FA 3FW6A 4KRUA 5BRQA 1E4MM 1DTUA 4J7RA 2WSKA 4MNJA 5E0FA 3UR8A 2EBNA 4AZIA 4D6CA 2OSYA 3BAJA 3WUBA 3CUJA 4QCEA 2BY1A 1UQZA 2WC7A 2VI0A 5A8OA 1KCLA 3SUUA 4W8AA 3WD3A 4U33A 4CU8A 1VEPA 4D6HA 3W26A 3UR7A 3HN3A 4ML4A 3LMYA 4AZ6A 3VILA 4W85A 3RDKA 5FKYA 3WH7A 1J0ZA 2XSAA 4FLQA 1LWJA 1HJWA 4MNLA 2YLLA 1JZ6A 1QHPA 2PWGA 5BXTA 1GORA 4AMCA 1HKJA 2XIIA 1GQKA 1E1FA 2BY3A 2EEXA 3WBAA 4TX6A 2W5FA 2E4TA 4KMQA 2J7EA 4HPGA 3IJ7A 4GQQA 3AIWA 3UG5A 5JBEA 4CD4A 3W81A 4DUVA 3W4RA 2GJPA 1JNEA 4CUCA 1W9XA 1QNPA 4U31A 3CHFA 1WDSA 3SCVA 2YOCA 3KZSA 4HP5A 3GXIA 4WSKA 1EDGA 3VGGA 7TAAA 4F9JA 4WJXA 2WHKA 2WWCA 3CH9A 3FXYA 1PX3A 3AXHA 4V2XA 3B9AA 5A69A 5DFAA 1V0MA 1XH2A 1HKIA 2YL8A 4M24A 3WUFA 2XFFA 1CGXA 4HMCA 3MMDA 5ECUA 3VIKA 1ZBCA 3THDA 1OINA 1QBAA 2VT0A 3S6TA 2ZXQA 4UFKA 3AOFA 1BQCA 1ISXA 3VMNA 3PHAA 4HOXA 1CNVA 2ZX6A 3T2PA 5CJ5A 1KBKA 1GUVA 5FCZA 1GJUA 2J7DA 4UFIA 4TOQA 4CCCA 3BXWA 2E8ZA 3WQVA 2VZUA 4AEEA 3OBAA 5ABFA 3IJ8A 1C8XA 1H49A 4ZEPA 2D0FA 1K9FA 1EH9A 3CHCA 4CD5A 1V6WA 2G4FA 3ARSA 1WZMA 3F5JA 3WF3A 1WAWA 1VFUA 2W4XA 3QGVA 3ZO9A 3AMKA 1DWAM 1BVZA 3UG4A 4PMRA 4HZ8A 1R86A 3BSHA 1LG2A 1W1YA 3VDHA 2XYLA 3G6MA 3VMPA 2CESA 2QHAA 2ZXDA 1KXVA 2GJXA 1WZAA 4KRTA 2FGZA 3NDYA 2ZWYA 4J3SA 3RMEA 1X1NA 5A6KA 5I6SA 1J11A 1E72M 3A4AA 4AD2A 1BHGA 2WW5A 3MSDA 3B8SA 3SCPA 2FGLA 4GKLA 3W6LA 3VD9A 2YDSA 4AD4A 3VKKA 2C7FA 2WCAA 1CDGA 5BXPA 3ZQ9A 2WMKA 1HXJA 3K8KA 1DWJM 1JYXA 5M5DA 4ZXLA 1VENA 3OZPA 1HJXA 1H11A 1VIWA 1H3GA 4ATDA 4W88A 4CU6A 1JF6A 2VJXA 1V3KA 3WMSA 1N82A 3WH5A 4D71A 2YLAA 5I3DA 1UOKA 3PZ9A 4ZFMA 1VJSA 4D1JA 3PZIA 3VX0A 1U30A 3MANA 1VEOA 1CGTA 4RE4A 1OSEA 2VNCA 4AISA 2XHYA 2XSBA 1JZ8A 3DECA 4LXFA 4PMUA 1PX4A 2YBUA 3CGTA 4WKFA 3OLDA 4M1RA 3RM8A 2VZVA 4U3CA 1OM0A 5A6MA 3CZGA 4JHOA 4Z2IA 1I75A 1J9YA 1UKQA 4HOWA 4U5KA 4ACZA 2EQDA 3WD1A 3WD2A 2G41A 1E0WA 4AXNA 3LPGA 1GOIA 1Z32X 4PMDA 5CGMA 1XH0A 1WB0A 1VFFA 3ZR6A 1MQQA 2BXZA 1E70M 1WZKA 2W91A 4GZIA 3WELA 3OGRA 4JCLA 4AW7A 5CPSA 3MUZ1 3VIJA 5I78A 2NT0A 5D9NA 4YPJA 3WEZA 1GONA 3FY1A 3QOMA 1PEZA 2WMIA 3SUWA 1V3JA 3WDHA 2X1IA 4D6EA 3KL3A 1HIZA 2XGBA 3N15A 2QV4A 2ZOXA 5FL1A 1M53A 2DSZA 3GNPA 2XVKA 4AZ5A 3HJEA 1JFHA 4JFWA 2XG9A 1VB9A 1J0JA 2XVPA 4ZXOA 3CTTA 2EPNA 5LA0A 4UOJA 1MVYA 2VURA 2V3EA 3CZLA 4AEFA 4UFHA 5JUVA 4E8DA 5EB8A 1KR0A 2GK1A 3OIHA 1C7TA 1V08A 3WNNA 3AIQA 3ARRA 8CGTA 2E9LA 2QLYA 1XSIA 1CPUA 2YA1A 3T0DA 2EPOA 3MKKA 3A4XA 3N17A 4ZE5A 4AZ7A 3K4AA 1JZ2A 5A8QA 4JKLA 1Q4NX 3II1A 4L4OA 1VFMA 1WE5A 1TVNA 1ISZA 2CPUA 1D2KA 5TD4A 2J4GA 4H7VA 3FHQA 3EDEA 3VGBA 1CBGA 2CBUA 3AISA 2BVTA 5HDRA 4PMZA 3PN8A 3AHYA 3FN9A 3CO4A 1D3CA 3ZJ6A 1GOMA 1J10A 1TMQA 2YA2A 1XSKA 4AZCA 3VO0A 1UWSA 1J0IA 3AMCA 2ESCA 2WC4A 3LPFA 2VCCA 4GO8A 1NWSA 1YQ2A 4H2CA 1G5AA 2J7HA 2NT1A 2O9TA 1BFNA 1MFUA 2YL5A 1PZ3A 5I23A 1AVAA 1HJQA 1Q6GA 2G3JA 1B3XA 4DUWA 3AIUA 1MW1A 2V3GA 4HZ7A 4A3HA 4WKHA 1UWIA 1CEOA 3OZOA 3N1AA 1W9UA 3EBVA 3UCQA 2A3BA 4P8UA 4OBRA 1J01A 4PMNA 3K8MA 3GTNA 2EO7A 1WDQA 4BQ5A 4GQRA 3TTYA 3KL0A 3AXXA 1DWFM 2CKSA 4UZSA 1NWUA 5GNXA 1MWOA 4U2ZA 4JHZA 4F66A 1QOXA 3CHEA 3DYPA 1SMDA 1CXIA 2WK2A 1IT0A 4IM4A 3WH8A 1CYGA 3WDIA 5A8MA 1EDQA 3MS8A 1I1XA 2XUCA 5ABGA 7CGTA 4JFUA 3CLWA 4W5ZA 5F7UA 1UR2A 1KXQA 1EIBA 3VIOA 4UCFA 1QI4A 2JF6A 3WQ4A 4FLSA 2WMJA 3ZIZA 5KZ6A 3OA5A 1MXDA 4B16A 1CENA 2WVVA 2PBOA 1E6ZA 2DSKA 3I3DA 5I77A 2F61A 1XSJA 5D9OA 4B9ZA 4PRWA 3OLEA 5AY7A 3BAIA 2QPUA 3OGSA 4FK9A 4TTUA 4A3YA 5HOSA 4IPNB 4UTFA 3J7HA 4TXEA 3ZT7A 1X6LA 3GH5A 2BS9A 4N42A 3WH9A 1M01A 4FLRA 1KGWA 4XX6A 1MXGA 4E8CA 2CYGA 4GO9A 3TOPA 1C90A 4TUFA 3VPLA 1WPCA 4PSRA 5AC4A 2J77A 2B31A 4Z2JA 2WLZA 2D24A 5A6JA 3CIVA 1M04A 4MDOA 1A3HA 4HMEA 1RH9A 2DEPA 3SURA 4LYRA 3GXMA 4JCMA 4BA0A 1QI5A 4DWSA 5IFPA 4M8UA 1JDDA 3OB8A 4W7VA 3WNLA 1C8QA 1ZU8A 2WZIA 4XUYA 4B9YA 4AZBA 1H09A 1WDPA 2XVLA 1JZ7A 1XHGA 4MDPA 4CVWA 1BLIA 3L4YA 1QHOA 2DT1A 2VX6A 2TAAA 1XC6A 3NSXA 1W1VA 3N18A 9CGTA 2A3HA 1UH3A 1CECA 1NM9A 4R5EA 1HJSA 2ZUSA 1HF6A 1JFXA 5M17A 3T08A 4EANA 1C93A 3VD3A 3MSGA 4WKAA 4PTWA 2WAGA 1UR8A 1XRVA 2MANA 3TP4A 1GCYA 2WM0A 1EO5A 1HP5A 3WUEA 1UD8A 2YA0A 1PIGA 2DSWA 2Y8VA 1J12A 4OOUA 1GQLA 3W29A 1JYNA 3DYMA 1BYDA 2WYSA 1UR0A 2J62A 4Z2GA 4IISA 1GOOA 4K68A 3WF1A 2OWXA 1EO7A 1UKTA 1ISWA 2WZHA 3VM5A 3ARQA 2WSPA 2AOSA 3NSNA 1JD9A 3CUIA 2GFTA 3ZMRA 4J3XA 4C7GA 2CEQA 1L0PA 3RO8A 4AD0A 1QPKA 2OLHA 1V6UA 2CERA 1MFVA 1BGGA 1I1WA 3PZMA 2YBTA 5ABFB 1JXJA 4GINA 5BCAA 2J7GA 1QI3A 4OIFA 3WUGA 1ZS2A 5JBDA 1E3ZA 2UY3A 5IHRA 5JBFA 1UUQA 2VL4A 3N11A 1TVPA 5EMYA 4RE2A 1HVQA 2E9MA 1KWGA 3K8LA 2GJXB 2JE8A 2G3NA 5A6BA 3AMDA 4WK9A 1CXHA 1E4LA 1WP6A 2ZIDA 2VZSA 1GNXA 2Q8XA 5IFTA 1KFWA 2O92A 5E6YA 2BV9A 1SMAA 5LA1A 2E3ZA 4M80A 2RGMA 4FMVA 2C0HA 3RM9A 4QP0A 1E6NA 3T0BA 3SEPA 4AD3A 1NQ6A 1P6WA 1NARA 3ZM8A 1UD5A 3WF2A 2ZWZA 5C70A 3BAYA 1XCXA 3WQ6A 1ISYA 5A6AA 5EBAA 2G3MA 2WVSA 1PAMA 3WENA 4F79A 3SCWA 4U2YA 4W7WA 1E6SM 4MTVA 3L2MA 4P7RA 1JAKA 3L4UA 2OWWA 1FFRA 1CGYA 1FH7A 1G0CA 4AIUA 2DQXA 1QI0A 3ECQA 5HNNA 2VQUA 4OJYA 2EPMX 3AZRA 1ITXA 1UA7A 3U5UA 4JFVA 3RCNA 1TR1A 2WCSA 4AZHA 1RP9A 1EOKA 1GW1A 4E2OA 1KXTA 3UG3A 5ABEA 1Q6DA 1W2PA 3SIMA 3RILA 2C8NA 4E4PA 3GNOA 3AXIA 1E4IA 1WNOA 1Q6FA 3VVGA 1XD1A 4PTMA 3ARWA 2Y8KA 3VMOA 2CXGA 1G01A 2OSXA 1HVXA 1UKSA 4EE9A 3VNZA 1EGZA 2J8FA 1M03A 1UR4A 2BVDA 5A6LA 1WCGA 4MADA 3GXFA 2O9PA 1K9EA 4UQDA 1PJ9A 2ZX7A 4IUGA 1KQYA 4U3AA 4ACZB 4D6JA 5IDIA 1QNRA 1RPKA 4PTXA 1EA9C 4TVUA 4UQAA 1ISVA 1H4PA 1R85A 3RJXA 3AICA 4ACYA 5IXEA 2V5CA 1GOQA 3GH4A 2Z1KA 3NYDA 1OB0A 3A4WA 4QLJA 3VU2A 2JIWA 3ALGA 1HJVA 1FOBA 5I0DA 3RIKA 2WMIB 1VJZA 2WWDA 1C3FA 2DIJA 3ARUA 3M6DA 4W86A 5I79A 4WF7A 5AYBA 2D20A 3N13A 4XZBA 3VGEA 3RJYA 3W25A 2D3LA 1MQRA 1W9BM 2YIHA 1BTCA 3WDQA 3SCUA 2A3EA 4GXPA 1JD7A 4Q7NA 1HX0A 3I3BA 4H8UA 1GHSA 4PEEA 2GK1B 1Q6CA 2FHBA 4B15A 1H0GA 4P8XA 4PUDA 4URIA 2YDQA 4FLOA 1FFQA 1KGXA 2ZX8A 4HOZA 5I24A 3AS2A 5D4YA 4R27A 1K6AA 1OIMA 4DM2A 5C71A 1JZ5A 4W89A 2OYLA 2XWDA 1ZL1A 2WZEA 1TUXA 2D22A 3M7SA 4C7DA 4WIWA 2D0HA 2XWEA 3AZTA 4CCDA 3MUY1 1HL9A 4P7QA 4W93A 1BPLB 4BQ2A 4Q22A 1KCKA 4HU8A 1HKMA 1MW0A 4GI9A 2VUYA 3U7BA 4J27A 4QAWA 1C8YA 1CGUA 5A8NA 1ODUA 2CHOA 4LYPA 1BVNP 2DT0A 5GNYA 3B9EA 4ATWA 1AQMA 2VX5A 1B90A 1UA3A 4JL2A 4AZCB 3AS3A 1WKYA 2DT3A 3VGHA 4XV0A 2XVGA 2X2YA 4QLKA 1JI2A 2ZICA 4D6FA 3RPMA 1IZKA 2WMHA 2NSXA 1AMYA 1VEMA 2GJRA 3K46A 4L4PA 1KXHA 3VGFA 2WBGA 3S2CA 4EK7A 1MW3A 1H2JA 2FDMA 1E3XA 2IXVA 5HPCA 1E56A 2VC9A 1E55A 1EDTA 3GM8A 3AHTA 3PTMA 1M7XA 1C7SA 5A2AA 1XCWA 4YHGA 5A94A 1LJYA 3UESA 4XZWA 1JZ3A 4IPLA 4F8XA 1LQ0A 2WXDM 3FNDA 3O9NA 1U2YA 1CGVA 3MUIA 1NWRA 1PBGA 4HMDA 1GOWA
chains in the Genus database with same CATH superfamily
2VX4A 1GZJA 1LT7A 1YTDA 4WSJA 3P67A 3SRDA 1IV8A 3C8NA 5LNUA 2PB1A 3ZWTA 1PCWA 4MUPA 2DH2A 1OX4B 1PX8A 1V6YA 1QFEA 2EXOA 3GBDA 4DM1A 3PJWA 2PDLA 4ICMA 1BXCA 4MWAA 4US6A 1TKKA 4Z2HA 4HK5A 1XP3A 4MAZA 5C9WA 1NWTA 2PFHA 3WH6A 4L4LA 4CN6A 3WIJA 1S2CA 1LBFA 3CLMA 2PF8A 2CNCA 2VCBA 3L2LA 3W37A 2BMBA 3AYSA 2JKAA 1OT2A 1GEHA 3FEQA 4GVHA 2ADAA 2PI6A 4IMCA 4JAWA 2YL9A 4YMZA 3EMQA 4Z2KA 3CUHA 1R38A 3V7PA 4DYJA 1SR9A 4IG2A 2A0NA 1U1HA 4M6PA 2YCLA 4KQNA 5HATA 4KCVA 2OB3A 4DZAA 3KRSA 2G3IA 1WUFA 3ZT6A 3JS3A 1XIMA 4DLMA 4LCRA 2XIMA 4JOMA 3BLOA 3BK0A 4O0KA 1P1MA 4BF9A 3MV11 2W67A 4M5PA 4DF2A 1TR9A 1S2UA 4NI3A 2W79A 2YSWA 3WLPA 3M46A 3T0AA 2WNWA 3EDFA 5A6TC 1KFKA 2GSHA 1W3KA 1I4NA 2XN1A 3LBMA 2QYGA 4W8BA 1W1TA 2X16A 5XIMA 5BROA 3BCDA 2CLIA 2XN2A 5MKGB 2BY2A 2GDVA 4YTRA 4JY8A 3QY7A 1V3HA 2R6OA 4J3ZA 3URBA 4DPQA 3N4EA 4LEFA 1FWJC 1QNSA 3ZLGA 1XV8A 3TN5A 4GG9A 3TC6A 4A6GA 1ADSA 1R7AA 1ZY9A 4O0QA 3JW7A 5AKQA 1OQFA 1UJQA 4OOZA 2YL6A 3VIPA 4UTUA 2NV2A 4ZOAA 2FZDA 3ZT5A 3WX7A 2G8ZA 1UIOA 4ORMA 2VX7A 3CUXA 4J3VA 4NJJA 2W63A 1O1ZA 2GVYA 2V0TA 3ARPA 1GVSA 1R9XA 1WO2A 4CCEA 4RV3A 1EHAA 3CHDA 3EDKA 2OT1A 1RHCA 3MUXA 4JN7A 2QMJA 1FHDA 2WSRA 4MFDA 1VRDA 4ZQCA 3V0TA 1P0NA 3FGCB 1SYTA 3K5XA 1X8CA 2HPMA 3MI6A 3SCSA 3VGDA 3N04A 3GWQA 2RDTA 3IAQA 4CVUA 3H26A 1W2VA 3T09A 3PZQA 4DJFC 2G4JA 1XBXA 4YHEA 3NO3A 4S39A 1V7YA 1A5SA 5FACA 4J28A 3EEZA 4LU0A 2YJQA 2CWNA 5E70A 3QHOA 3DFQA 1V03A 4ZE4A 4QX4A 4UOQA 3LI1A 4PH6A 4A21A 4ZQPA 1SFSA 5BU9A 4QFUA 4P7OA 3DX5A 4J3TA 1FKWA 3KRUA 3PM6A 1DYSA 5E9AA 1SR0A 3IGUA 4HPJA 4HYRA 2OSWA 1YBQB 1ICPA 3ERPA 2BXVA 2B7PA 1I8JA 3TYCA 4AIEA 5REQA 1TPEA 4WD0A 5I03A 3TYZA 2QF8A 1DJZA 4MJZA 2ZZ4A 1CXEA 1XBYA 2DIKA 1P6CA 2OZ3A 2XGIA 3FAWA 5CBIA 1E40A 3PTKA 1UD4A 3NPXA 3BLKA 3O0FA 3MV01 4HHMA 3ANYA 1ZBVA 4X63A 2ZUNA 3PZNA 4ZO9A 4K2SA 5CPQA 5CLWA 3VNLA 3WQWA 1EZWA 4X9YA 1Z8AA 2I7GA 3VD7A 1H1YA 3S1VA 3GVRA 2A85A 4GA8A 4UMBA 1QJWA 4ZO8A 2UBPC 3UQNA 4BI6A 4EAMA 1L6WA 2BFGA 3RCYA 5BMXA 4ZBCA 1W37A 3E38A 3GR8A 4JTEA 5HJYA 3QRHA 4IX0A 3B8TA 5GVJA 1QHZA 2NV9A 1EOMA 4DQWA 4BI7A 3MDWA 4V27A 1A4MA 1TA3A 4JKMA 4ZL1A 2NXIA 3TYDA 3VFLA 1VHNA 3EKLA 4QJ4B 3PB0A 4D8ZA 3VIHA 1RA5A 3G1SA 1JR1A 3LV6A 4KH2A 3RR4A 3BO9A 5RUBA 1DWHM 1OGGA 3AIEA 5H1WA 3U2OA 3STGA 3NQMA 2ACRA 1NOUA 3IGXA 2Q3RA 1JUKA 4XIMA 1CZ1A 5GQBA 2CLEA 1NDZA 1QPOA 3B9NA 3OP2A 3OA3A 2EG6A 1V8EA 4PCSA 4NXSA 4UR9A 5F2GA 4NRSA 3ITLA 3UERA 1FWNA 4LALA 3RNDA 2GZXA 3L4XA 2AL1A 2E1WA 3EWYA 1GW9A 1L2QA 1TO3A 2IUZA 3GUGA 4ATLA 4L6HA 1I6NA 5A1AA 1CXFA 1CCWB 1EQCA 5D2WA 4XB3A 1O7AA 1UYQA 4NRRA 1DJQA 1G4EA 2BOGX 4P8VA 4C5YA 1XW8A 4EAYA 3FKRA 4IP5A 4WZHA 4HNVA 4GIRA 2IKGA 1US3A 3NL6A 4GX9A 4WDUA 1W9VA 2ANUA 1AUSL 3SN0A 2A3AA 4KGLA 1D9EA 2PBGA 4Q8PA 3TCEA 2X40A 2ZZ7A 2IKHA 3AIRA 4HA4A 1RD6A 5CG0A 4R7JA 1MYRA 1P0KA 1ZCOA 1UKOA 1W91A 4NY2A 3B8DA 3DI1A 5EBUA 2HS8A 2INEA 4ZQMA 3W7QA 2FH8A 9XIAA 2QCEA 2WNZA 1B9ZA 1XISA 2V5KA 2Y6ZA 2OLSA 1JDCA 1HJUA 2R8WA 4IT1A 3W7NA 4FF5A 2IKIA 4MWAB 3DERA 3PC0A 1SSGA 3P74A 1XR2A 4I9JA 3PZUA 2CETA 3W0KA 2GVLA 4M6UA 2NQLA 3RR1A 2VTFA 1PKMA 5M3WA 1B3YA 1MDRA 3PWIA 1ZP3A 2GUBA 4OV9A 3B9DA 1SFLA 1UCWA 6ALDA 3GKAA 1F73A 1EHNA 1JDFA 2EHHA 5A2CA 4HBKA 4C6CA 4K1GA 2DJLA 1DIOA 5EY5A 1UD3A 4IGNA 3UETA 3IARA 3NZQA 5JH2A 2E5CA 2C16A 1E51A 1CTNA 1PO9A 1KW1A 1R3TA 4HN8A 4IG2B 4XZNX 1GHRA 2OELA 4BWLA 1GGOA 1W8SA 2YCLB 1E6RA 3A9BA 5BMWA 4JKKA 3DG7A 2PU0A 2AQWA 3BV7A 1RQHA 2R9RA 3SCQA 3ISIX 3KM8A 4IIHA 2CZ5A 1T0OA 4MJ2A 3BGAA 2FKPA 4BHYA 1J6OA 4JEJA 3NXLA 3CM4A 3R5EA 4NX0A 1F74A 2ZRYA 4XAYA 3WLIA 3B03A 4L65A 5AYYA 3LB0A 3OG2A 2FJUB 4HTBA 3WQGA 1XD0A 2DGAA 2OX1A 1EGMA 2CLHA 3S83A 3A3HA 3GDMA 4NZFA 3MCNA 4GZJA 3W02A 3MZNA 3T2QA 5AC6A 3E5PA 3WQ8A 5JU6A 2PD9A 2JIEA 3GBEA 4HSNA 5F1UA 2F7FA 3GDLA 2Z25A 2I5IA 2BVYA 1D7FA 3TC3A 4LQ1A 1VCGA 3WNPA 4E38A 5FA5A 1CLVA 3R8GA 3FHAA 2ZXAA 2CZVA 1MDLA 3GH7A 5CEWA 4FXRA 1R3RA 4Y7EA 4BI5A 4OHQA 3QW3A 3NUKA 3L4ZA 3M47A 1S38A 3RCMA 4MY9A 5A2BA 4L4MA 1C9WA 1XDJA 2WKLA 3F1QA 2CCRA 2GUYA 4CU7A 1UQYA 4JIRA 3GNDA 4O1BA 4B5XA 3ARYA 3OW1A 3RRAA 1JAEA 4RXFA 3DKLA 5FEWA 3FLUA 2YCEA 3VIMA 1J18A 4HSHA 4PMOA 1AODA 2EKGA 1KM1A 2JALA 4XWUA 1ZBWA 3OG3A 5HQEA 2QPXA 4CEXC 4XVEA 1HZYA 3IAPA 5H8UA 1OCQA 3RF9A 4UZUA 3N4FA 1KBIA 2WHJA 5F4WA 5D2TA 1K3UA 4J35A 1PHWA 2FIQA 1DJIA 3IJDA 4O28A 3R94A 1OIFA 4U4MA 4J3WA 1HL8A 1RK6A 3UU0A 3S42A 1DORA 3ABQA 4A35A 3MCMA 4B3LA 4FA3A 1BYAA 1GK8A 1DTNA 1NU5A 3WDPP 1JNDA 1IXOA 1GKPA 4BF5A 1GVRA 1FWAC 3R8RA 3IS4A 4KWUA 1EP2A 4XKMA 3HTWA 2E25A 3H4WA 5REQB 4HCLA 1X7IA 4HHPA 1GYMA 1F3TA 3VUPA 1TRIA 1KM0A 4GY0A 5BRPA 2R24A 4NF7A 4OKDA 3GVGA 3M5ZA 3GO2A 4MB3A 1UIPA 1JUEA 4ZQRA 2P88A 2Z6IA 4PA8A 3GU2A 2ZUUA 4PYSA 2V5BA 1GQNA 1EJXC 2OWCA 5A6SA 3SI9A 4M29A 3TTOA 2PWHA 4O0ZA 4GPNA 3O07A 2RHGA 2XM1A 4LAKA 1TV3A 4GH3A 1OFRA 2XPKA 1BEUA 3F2DA 4Y9OA 4JTAA 3P61A 1OX5A 4R7WA 5K4ZA 1U22A 1KR1A 1NOFA 3PAJA 4MMWA 3LCFA 3WL0A 5C2XA 3PBMA 5FAJA 1JIBA 1PYFA 1TA3B 3I6RA 5AECA 1AA1B 4C1NA 4M82A 3CB8A 4CD6A 3KHDA 2V8ZA 3GG7A 2QNEA 2VDHA 3FW6A 5FESA 4RW3A 1E4MM 3CV2A 2OX4A 4J7RA 4TU1A 4LWWA 4MNJA 3TCSA 4D6CA 2DY3A 3CUJA 3DC8A 2BVWA 2WC7A 2VI0A 4IFKA 4W8AA 4KCUA 1DQUA 4IICA 1OFBA 1MMFA 2YXGA 3UWYA 3VILA 4W85A 1XS2A 1J0ZA 3O15A 4GUGA 1HJWA 4IMDA 3NGJA 3EWBX 3MJMA 2VDGA 1FWTA 1QHPA 3KVLA 2NQ5A 2PGRA 4AMCA 3NXFA 5EU9A 2NQJA 4TX6A 1BWLA 4E2VA 4KMQA 5IBXC 4HPGA 4DUOA 4GQQA 3AIWA 4LUIA 1FY6A 3W4RA 1JNEA 2J8TA 2A3LA 4YNGA 3CYVA 3W23A 4E2DA 4CQ8A 1W9XA 4LVFA 3IIOA 5KMYA 3E02A 5EYWA 5GJNA 2WZMA 2ZC1A 3GXIA 4O17A 3VGGA 3R4IA 1F5ZA 3VI2A 3QEZA 4V2XA 5DFAA 5AYXA 2XFFA 1CGXA 1NIUA 3G1AA 4TV6A 1TQJA 2PCQA 1BRLA 1Q66A 1OINA 3NYZA 2VT0A 3P6LA 4XTDA 1CW2A 3H2CA 4QNWA 4DBUA 2ZA2A 3WQOA 5FSEC 2ZX6A 3T2PA 3UWQA 3INPA 3SQMA 1RJQA 4IZGA 3KBSA 1GUVA 3TQPA 1Q2RA 4CCCA 3BXWA 2BODX 4AEEA 3OBAA 1C8XA 3LDVA 4ZEPA 1X38A 3CAWA 4GUHA 1OX6A 3G1HA 4J9JA 5CBBA 2PDXA 1VFUA 2D2HA 2W4XA 3DKJA 4C90A 4C1KA 5CSRA 5EMMA 3UNTA 4PBFA 3LHYA 3KP0A 3NA8A 2XYLA 3G6MA 2CESA 2QHAA 1UC5A 1KXVA 3TYEA 2PGEA 3DHDA 2GJXA 1WZAA 4KRTA 3KDOA 1MZRA 4UTLA 1HFBA 1VPXA 4Q8VA 3NDYA 1BKSA 3MP5A 4J3SA 3UJSA 4H9MA 2ZZ2A 1X1NA 3SB0A 3A4AA 2J9ZA 2IPFA 1S2VA 1XGEA 2QDDA 1HKWA 3ZQ9A 3GQYA 2WMKA 3K8KA 3TJ4A 1M7JA 4QDWA 2OQLA 1JYXA 3FJ6A 4GVGA 1VENA 1H3GA 2V67A 1W17A 3U0HA 5DCDA 1HG3A 2G95A 3K1GA 3NM1A 3PZ9A 4RZBA 2XIQA 2V69A 3LV5A 1CGTA 1H7RA 4JTGA 4FNQA 5TBOA 4AISA 1RXOB 3A21A 4LS2A 1BWKA 3M0YA 3TK7A 3CGTA 2QCFA 4JQ2A 1VKFA 2GGIA 1YDOA 3BV4A 3CZGA 3I4KA 4Z2IA 2AMXA 3VUSA 2ABBA 4XSMA 3VKJA 2ZADA 4U5KA 1TPUA 4H01A 3PR2A 4ACZA 2JGQA 1TIWA 3WD1A 3M5YA 5DLCA 5GJPA 3PJUA 4MWAD 1E0WA 4AXNA 4U28A 3LPGA 3LHWA 1XIDA 3IUIA 3ZR6A 2BXZA 1E70M 1J93A 3WELA 4JCLA 1GTHA 1TPH1 3UA4A 4F0RA 3VIJA 1OG0A 4E4FA 3E2VA 2NT0A 4JDYA 2QAPA 3MY9A 4YPJA 3E96A 3T1GA 3LHZA 1V3JA 2X1IA 5AHNA 3FDKA 4IL2A 5DANA 3BL3A 2B4GA 3GNPA 3HJEA 2VGIA 2XG9A 3TW7A 1OG6A 3CEPA 3TN6A 1Z69A 3BG5A 1VB9A 3S4TA 1MSSA 1Z41A 4OT7A 1EX1A 2IPJA 4JNMA 2EPNA 4UOJA 4DJDC 1MVYA 2VURA 2JK2A 3LSCA 3E2RA 5EB8A 3W1QA 2YW4A 2GK1A 3OIHA 2PAJA 2GDQA 3STFA 2OEKA 3NNTA 4JIHA 3SRFA 4HNCA 2QLYA 3IEBA 3T0DA 1XF0A 1A0DA 2PE4A 1B4KA 2DZSA 3H7RA 5A8QA 1Z9AA 5HUPA 1TVNA 3P84A 3PBVA 1RZMA 1D8WA 4NZ4A 1Q7QA 1ISZA 8XIMA 3QW4B 3VFCA 4ZB0A 1X1OA 3FHQA 3QY6A 3CK5A 2IPGA 4ZOBA 2W6RA 4Z1CA 1GOMA 3W7LA 5E0KA 3U4FA 3LEPA 3LA4A 1ZJIA 2HMCA 1TMQA 3H4XA 2OZ8A 3H70A 2QKFA 4O19A 3QBUA 3AMCA 2DUZA 5BNKA 4FNUA 3ORWA 1JRBA 4H2CA 4PFHA 3UZJA 4JTCA 3UZZA 3N2TA 2NT1A 1BFNA 1SJBA 4RK8A 3SRHA 1F2JA 3AIUA 1DXFA 1RR2A 4YYFA 1UWIA 2GL5A 5HWJA 4HK7A 4IQDA 2YCIX 1J01A 1EFZA 3GTNA 3O6YX 2CLPA 2EO7A 5ECVA 3KL0A 3CAQA 4JNYA 5TQLA 5K7JA 4NJHA 1W56A 4F2BA 2Z2AA 1MRQA 1TWDA 3FVDA 3ZXWA 1NY1A 3DYPA 1OK4A 1YTEA 1CXIA 3H2FA 2WK2A 3ITTA 2A7NA 3WH8A 1WA3A 3VAVA 3ZLFA 1IT8A 1EDQA 3MS8A 4HK6A 4DAFA 2PDKA 7CGTA 4GD0A 3CLWA 3OO2A 4W5ZA 3TZNA 1KXQA 3N34A 4Q4PA 3V16A 4UTKA 3LD5A 4FLSA 3Q58A 4Z42C 1MXDA 1E6ZA 4UC5A 3V4BA 3TU9A 2PTDA 3RN6A 1ADDA 5M1TA 4H3DA 3ZT7A 4C1NB 1X6LA 2PPGA 3XINA 3PP7A 2RUSA 4N42A 1M01A 4F40A 4LRSA 5TF0A 3MSYA 1KGWA 3W7JA 3TOPA 3DGBA 4X61A 4GZ7A 2D24A 1M04A 3RX4A 2AQOA 3QLDA 1IXNA 5BWAA 4UTHA 4IFKB 3P8JA 3GXMA 4DWSA 4C6KA 1DJXA 4FHAA 3S6OA 5FI8A 2VEGA 2QCLA 5AHIA 3OHMB 3OIXA 1IWAA 4AZBA 1H09A 1WDPA 1TV4A 2V5LA 4CVWA 1Y5XA 4GYPA 3L4YA 1GYNA 4XUGA 1W1VA 1YXCA 5FJJA 9CGTA 1CECA 1NM9A 1JFXA 4EANA 2YB4A 1GVQA 3P62A 4WKAA 4PTWA 5KSWA 3NZ1A 2Y7GA 2MANA 3NR0A 1GCYA 1TJ0A 4AY8A 1EO5A 3S9IA 1HP5A 1UD8A 4RDVA 1S5MA 1IF2A 4IPPA 3W29A 1UBSA 1P1XA 1XIJA 2OGJA 1UR0A 1BRLB 4X2PA 4Z2GA 4HNLA 4K68A 2OWXA 3RX2A 1IEQA 3CJPA 3FX4A 3D0CA 3G0UA 3MHFA 2AOSA 4O1AA 3ZMRA 4C7GA 2CEQA 3E0VA 4BR1A 3RO8A 4AD0A 5LKYA 1QPKA 1QPQA 2J66A 2CERA 1MFVA 2WZTA 2BGNE 1A3XA 4KEVA 5BCAA 4Z1BA 4YTQA 3N73A 3LTPA 3RU8X 2QJGA 3KOXA 1QASA 4GC3A 1GKRA 5JBFA 5F1VA 3GXTA 3VZZA 3N11A 1TVPA 3TKFA 1HVQA 3VYLA 4OUIA 2VFEA 3MDUA 3K8LA 1NF7A 2GJXB 1QNVA 3AMDA 3KP1A 1CXHA 1E4LA 2ATSA 3PBYA 3W2NA 2Q8XA 5IFTA 1KFWA 5D04C 2O92A 2P3EA 4M80A 4NP7A 1WKDA 2FB2A 3P82A 1UPMB 1QOPA 5EMLA 4ZCWA 3L65A 3LXCA 1NQ6A 3ZM8A 4FR6A 2XFWA 1XM3A 1Y5VA 5L9FA 4MYXA 2HVNA 4GY1A 1IGSA 3EXTA 3FIGA 1ISYA 3BOFA 3GHUA 4F79A 3SCWA 4U2YA 4W7WA 3L2MA 3L4UA 4LAMA 1H7XA 1FFRA 1VBHA 3IJLA 1G0CA 4RCXA 4NZ5A 1ZGDA 4Q8MA 1W3TA 2DQXA 5CZ0A 3OBEA 1XI3A 1BD0A 1JRCA 2CC0A 4OJYA 2EPMX 3AZRA 3U5UA 4C6DA 3DFPA 4RUBA 5I3IA 2Z7GA 1TR1A 4AZHA 1RP9A 4XO7A 4AX6A 3LBCA 4KBXA 3KHJA 3RILA 4X3ZA 4KIRA 4L6DA 3C4UA 1RPXA 1YMYA 1M3UA 1OADA 4QBXA 1G01A 1P5BA 3ZVHA 5LSMA 3TQVA 2R94A 4GIYA 3VCRA 5MHBA 5A6LA 1WCGA 2FZ9A 5AZ1A 3BLEA 5EKYA 4C6BA 1PJ9A 1ITUA 4LUSA 1LWIA 2H6RA 4GNKB 2EG8A 3FYOA 2MUCA 3WQCA 4ACZB 1XRFA 5IDIA 3LHUA 4PEKA 2FVKA 3G1RA 3TQKA 1KO0A 2Y5JA 4H9YA 2Z00A 3TZFA 2GGGA 4L9XA 5IXEA 2QUNA 1L2UA 3EEGA 4KEUA 3NYDA 3SSZA 1WXYA 2ODOA 2BX7A 3E0FA 2J27A 3SQLA 3U4AA 1KC7A 5CPMA 2WWDA 3DFTA 1A49A 4UTTC 5AYBA 2RAGA 5AHEA 2XGZA 1TYGA 2PGWA 1GVEA 1HTIA 1A4LA 2D73A 3CAKA 1D7KA 3H2MA 2HK0A 5AN7A 1KCZA 5CJMA 2FTWA 2A3EA 2NSOA 1GHSA 3A12A 2GK1B 2QCNA 2NVDA 3WQFA 1NFPA 4DO4A 4URIA 4PUDA 2YDQA 3BVJA 4HOZA 5I24A 2OR2A 4R27A 4L6OA 4C6OA 3EX1A 1TWIA 9XIMA 2OYLA 3MCOA 3M7SA 2D0HA 3E5BA 1A50A 3HB9A 1W5QA 5AHMA 1VYRA 1SZEA 3GAKA 1TPFA 1F3WA 1HL9A 1FCUA 4Q22A 4HZMA 1KCKA 4AWTA 2IKJA 3HPZA 2E6FA 4GI9A 4XG1A 4ZVJA 1KCXA 4J27A 2PDWA 1C8YA 4Q6XA 5A8NA 3TSMA 2J88A 2V2CA 1WKEA 4Z1AA 2DT0A 5GNYA 1V51A 4AAJA 2VX5A 1KRBC 1Q6OA 1UA3A 4JL2A 4LT9A 1WKYA 1EJUC 2POZA 1O4UA 4GCAA 2R14A 4D6FA 4ZTXA 3GX9A 3UCCA 1AMYA 1VEMA 4L4PA 1KXHA 2WBGA 4M1BA 2VC7A 1H2JA 3VZYA 3GD6A 3I7SA 1UBPC 1SZRA 4A8NA 1E56A 4GIEA 1ICQA 3WLRA 1E55A 1EDTA 2E28A 3GM8A 3PTMA 4YTTA 1XYCA 4EPKA 4AQLA 3NZRA 3PUEA 1DV7A 3G3MA 1LQ0A 2WXDM 1I0DA 1R0MA 1MUWA 3WCZA 3CT7A 1BSLA 3LZ3A 1J96A 4PFMA 3UWEA 4HMDA 2ALRA 1S2TA 1WDWA 2VO5A 3ME3A 4LBSA 2WKGA 2IXUA 1Z3NA 3RLUA 1F6PA 6ENLA 2WANA 4N4PA 4YIWA 2Y2WA 4QG9A 5DO8A 2NUXA 2PURA 3PWGA 3U57A 4PUEA 5LXXA 2FHFA 3GW0A 5C2CA 2FVLA 4O4WA 4V1XA 1W3JA 1OWQA 1XDLA 1QT1A 6A3HA 5CGTA 2PP1A 1P0DA 2FFIA 4BZYA 2CXEA 3T44A 2ISVA 4TTGA 3RXZA 3AHVA 4CN4A 1US2A 5XIAA 1EBGA 3OODA 3JUGA 5CPLA 4JIEA 3VNKA 2QUUA 2DZAA 3IVUA 3GVVA 2VD8A 1DOSA 4CQBA 2F38A 3R6IA 3TYUA 4D1IA 3CZKA 4KWWA 3VDCA 2X42A 1N8WA 3QLLA 4AEOA 3QYSA 4Q8TA 1TREA 1ELSA 4IX2A 1G4PA 1F6KA 4O54A 2YXXA 4DWSB 2FYMA 3BLPX 1SZFA 2DZPA 1RVGA 1D3GA 3EWDA 4K8HA 3THAA 3NJ3A 3THCA 2XFRA 4WY0F 1OFQA 4N6EA 1TE6A 4MZ1A 2GQ3A 2PP3A 1DWIM 3C2FA 3USZA 2J7BA 3F5KA 2V82A 3MI2A 4NL1A 1V5XA 3UZ5A 4POCA 1UZHA 2VWSA 4PC8A 3B8VA 1UH4A 3KE0A 1OC6A 1BGAA 1W32A 2E9BA 3W7IA 3NQFA 2O9RA 1W9PA 3SY1A 3QC3A 4GACA 4X0NA 1LROA 1V77A 3ZJKA 1EJWC 3TH6A 4O53A 3TFXA 1B3ZA 1Q6LA 1W9DM 3BW2A 1SZGA 1YW1A 1RVKA 4HVXA 4MKNA 4DJFD 1E6PA 5DT5A 3UPWA 2AMGA 1K7XA 3VOFA 4XZMX 3GIPA 4OU1A 3W72A 1J2WA 4ZOCA 1X6NA 2RDWA 4QM1A 1VCFA 2WB5A 1KFJA 5JMUA 3BCFA 3H24A 2DPEA 3FYPA 4FXSA 1K8XA 4PN2A 4TQTA 3QR1A 2VOMA 3W01A 5D8WA 2BG5A 1NDVA 3KVMA 4JIIX 1H7OA 1V02E 4Q4KA 1R8LA 3BMWA 4LW7A 1XIFA 2VR4A 1FA2A 4PMYA 4O50A 3CPUA 4HQVA 5SWUA 1M6JA 1MUMA 1TJPA 5KZMA 2Q71A 1KFCA 1BXBA 1THFD 1LL4A 2JGYA 4B2DA 3CL7A 3BG9A 1V0LA 2A2IA 4GZEA 1VZWA 2CU0A 4UQEA 2PD5A 3GK0A 1XGDA 3U7VA 3BZGA 1CIUA 2WHLA 3SUVA 2OJPA 3MVIA 4N7QA 3CQHA 3L2IA 4LVBA 3KCJA 4AC7C 1V7AA 4AX7A 1XLLA 1CXKA 2XU2A 4OQVA 4HGXA 3WMBA 4UNLA 3BSGA 4K3ZA 1EPVA 3W38A 1J0KA 5CJNA 4MPKA 2OOGA 3A9IA 4FI4A 4HU0A 5ABTA 2PZNA 4MM1A 1T41A 3A64A 3QF0A 3LX9A 5CSYA 3GIQA 5BWFA 1RBOB 3HGJA 4ASTA 3P5ZA 2E6AA 2WMGA 6TIMA 1KLYA 3VA8A 1PHQA 4KT2A 3ZVHB 4LUSB 2ZVRA 1FWSA 3EXRA 3FK4A 2DORA 3QKEA 1H41A 2C15A 3WYZA 2G5WA 2VZOA 4MKVA 3NPVA 3V36A 3VKAA 2VXNA 1JZ4A 2VYOA 3VKDA 2NX9A 2WNNA 2DDXA 3NQCA 1WXZA 4H6EA 1HQTA 3HF3A 2X09A 2WLYA 3M0XA 2W92A 1EC9A 5HR7A 5DY2A 3VOCA 5G1MA 3L0GA 5AZ0A 3M4HA 4K39A 1JJKA 1RALA 2WPGA 1JPHA 1QK0A 2QVNA 3WN6A 1F4HA 3ZZ1A 2NLYA 1XLFA 5CC3A 4MSSA 2P76A 5IHSA 4LSBA 2ZUTA 5DN1A 1FP8A 3LI0A 4M6VA 4KCWA 1A5BA 1RQEA 1L8PA 5C8BB 3PTQA 2NX1A 1VBUA 2WHMA 1PYMA 2HK1A 3UVAA 1WUEA 4DO6A 3OEXA 2CBIA 1C9DA 1K7FA 3D6NA 4LB4A 4C65A 1KTCA 3DHUA 3TJIA 2Y4SA 4WRHA 2BHYA 1J5TA 1JF5A 3T9PA 4FOKA 4UTIA 2CLKA 1AW1A 4Y90A 3F7JA 4I5UA 5FF3A 1VBGA 3HQ1A 3PZOA 1V3IA 3WL1A 4CNTA 2H3DA 3HGOA 4F2TA 3RAOA 2GGEA 4MAVA 3RMJA 4GBDA 4ZZ9A 4AYSA 1F6YA 1MO0A 3LSBA 5HANA 4LANA 1NF0A 5FJPA 2C6QA 1HGYA 4JIPA 2Z26A 3GFYA 4HT3A 3HQNA 4HD5A 1RJPA 4DPPA 4C5ZA 1WZLA 1B3VA 2DZBA 1H1NA 1DJWA 3L7RA 3T81A 2ZDRA 3MT1A 3B04A 3O05A 1A53A 1UR9A 2PF0A 5FIPA 1FH8A 2CHNA 4RPPA 3ABOA 4ILSA 3UZYA 2VWTA 3I6TA 4UTTA 2ABAA 4J1OA 4F0KA 3T07A 3ZJ7A 4YCOA 3IGHX 3B0XA 4ROPA 3UGRA 4TVDA 3WKZA 5BXSA 4F9DA 4B5VA 3ENLA 4PSPA 2E8YA 3PZTA 1PIFA 4PMVA 4Y8FA 1V6XA 2I5GA 3F4CA 2UY5A 7REQA 3OLGA 4AY1A 4YWSA 2X0HA 4N6FA 5CPTA 3VDBA 4QLLA 4O11A 1F76A 1RY8A 4H19A 3KCLA 3S2JA 4IF2A 1JL8A 1FWWA 5A8GA 1TMLA 1VFOA 3S3GA 5DF0A 4IIFA 4UMCA 4Y9AA 4AD1A 1VF8A 3NQGA 3QN3A 2CLFA 4B3KA 4GUIA 4AVFA 1V0NA 2D2JA 1G7VA 1P0EA 2DH3A 4EXAA 4LEQA 3I4EA 5DBUA 1VR6A 1VFHA 1TELA 4F0MA 3FKKA 3OTRA 1Z6KA 3WBEA 4L7ZA 1LP6A 2D3NA 4NJKA 4L1WA 2OOFA 2I17A 4ZR8A 3ARXA 2QCMA 5CZKA 4W5UA 1IZJA 3L9CA 1NTHA 3KDNA 2HS6A 3R0KA 2UV8G 5CC6A 1JULA 4P7LA 3BOXA 4LJ3A 2JFEX 2J7FA 4IIBA 1IR1A 5DRIA 2PDNA 4LY8A 1H5VA 1ZCCA 4OUEA 3CZ8A 1SJDA 5DMYA 3KOZA 2YYUA 1LL6A 4H9XA 5FEXA 1VFTA 3BC9A 3V75A 5CAHA 1SM9A 2BNJA 4N0RA 4AWEA 2ASHA 3LNMA 3SUSA 1TWZA 2FLIA 2DP3A 3IIXA 3AS1A 4GVFA 1NELA 3VX1A 3GC5A 2P0OA 3VE9A 2DZVA 3F03K 2A21A 2YYTA 3VDGA 3FJNA 5H91A 3QV6A 1XRSA 3AYTA 4I5XA 2ZBTA 3AJ7A 1V6VA 1XIIA 3KLLA 2GSEA 3DDMA 3W1PA 4KWSA 1Q7ZA 1ZJHA 3C0LA 3GC4A 4QEHA 4I9TA 2ZX5A 1GG1A 4R3UA 3WNMA 3BQ6A 4S3CA 2F6XA 3EA1A 3BGJA 2XZ7A 3GZAA 4JEQA 4MF4A 4PULA 2Y1HA 2WCGA 4RNJA 3GHTA 2DT2A 4G7FA 3TONA 3VKBA 3MJYA 4LYQA 4N4QA 2Q3OA 3I7QA 2PDGA 3NVDA 1K4GA 3ARVA 1KTBA 4QS6A 3AS0A 3RRXA 1LUCA 4AZGA 1R3VA 1RQBA 2WBKA 2JQXA 4IQJA 3AJXA 2CLLA 1X7FA 3W1LA 5BW6A 2CZFA 2QUVA 3M07A 1M41A 4D6DA 1RCOB 2WC3A 3PZVA 3KFTA 2GJLA 1ESWA 3EYPA 1ONEA 2PC8A 5HINA 3TVAA 1V3MA 3O6AA 1Q6EA 1HGWA 2NW0A 1A5NC 4Q32A 2XN0A 4W9TA 2ALDA 1REQA 2BY0A 1JI1A 3AIVA 1HN1A 4H8VA 1LLZA 3FA4A 1XQLA 3SO7A 2MNRA 2PUZA 3KVJA 1JPIA 1FWDC 2Z0IA 4N9CA 2TSYA 5XINA 3W22A 3DIPA 1XIHA 5EMJA 4AWSA 1PTGA 5AYZA 3QHNA 1E1EA 3M6YA 1PZ2A 3TXVA 1TX2A 3F2CA 4B5NA 1L9WA 1VIZA 4YS1A 2PWDA 4PCTA 4N02A 1FCVA 1LQ2A 6XIAA 2OEJA 4WEVX 1CWYA 4ZA0A 1J5SA 1NAL1 3UG8A 3O6DA 2WMFA 4LUJA 4LPCA 1ZJAA 1ZPTA 3LCIA 3GU9A 2XM2A 5HK4A 5C55A 3SCOA 4AFYA 2NQHA 3H22A 2GGHA 4MJMA 4LS0A 3LTYA 2OKOA 4RDYA 1LRQA 5I02A 1Y7VA 3SFKA 2SFPA 2IMRA 3SCTA 1V79A 4UNKA 1E5JA 4MKSA 3AYRA 5CBJA 4DJEA 3BAWA 2GVGA 1DP0A 4Q6JA 1U5HA 3AIBA 1K6WA 1PVNA 3POCA 3P0XA 2HROA 3M0HA 2C79A 5AYIA 3WQ5A 2P8CA 3TAKA 3KBMA 4RZ6A 3FOKA 4UQCA 4J5NA 4GOAA 3DAQA 3K13A 4AIOA 3VD5A 1OFOA 1E15A 3M44A 3T6CA 2A6LA 4TVCA 3QTGA 1EYWA 3S1GA 4KFNA 4JZ5A 2Y63A 2I16A 5LXEA 1F8IA 3NOEA 2O4QA 1UZ4A 3T0CA 3PPCA 3B4YA 3IK2A 3R7MA 4GK8A 1XX1A 3B8IA 4P8WA 1QO2A 1XH1A 3HPXA 2FMNA 3UEQA 4D6GA 2OMAA 4UCGA 4V28A 1I45A 2Y70A 4HU4A 3VD4A 2BZNA 1H0IA 4Z2LA 2W62A 3PG9A 1UWTA 2CZEA 4F0LA 3QV9A 1W1A1 3QR3A 4Y9MA 1Y5WA 2JEQA 1XG4A 5DXXA 3W7CA 1E0VA 1JGIA 2AGKA 3ZJ8A 5LNVA 3EDDA 2WSQA 3N3MA 1TSIA 5A8PA 3LCWA 4KRUA 3O16A 4NI8A 1YX1A 4DI9A 3TUUA 2OSYA 3BAJA 4FNSA 4QCEA 1UQZA 2ZDSA 4L5ZA 5A8OA 3S46A 3GR4A 3SUUA 2QDHA 1F7BA 5M2FX 3ITGA 4CU8A 1W5PA 2OU4A 4D6HA 3TEVA 2GPTA 3LM7A 5FKYA 2XSAA 2OPJA 4EPEC 4DWDA 2PWGA 4R34A 1XBZA 4LH8A 1GQKA 1UR3M 1QPNA 2TYSA 1T6MA 3MBFA 2E4TA 4RX0A 1M5WA 4R53A 3U9IA 4DUVA 4LUTA 2GJPA 5G2IA 4GI4A 1Y0EA 4E5TA 4GMEA 1QPRA 4B91A 3Q2DA 7TAAA 2WWCA 3CH9A 3FXYA 1VFSA 7REQB 3AXHA 4ERGA 2VEIA 1BTMA 3CTLA 4HMCA 3MMDA 5ECUA 1JCYA 3LMZA 1IEVA 1ZBCA 3HQPA 1QBAA 5C54A 1R3SA 3T8LA 4UFKA 3AOFA 1BQCA 2IQ0A 1ISXA 5A5WA 3VMNA 3BSMA 1VPQA 4C6QA 2HSAA 1GJPA 4UFIA 4D8AA 4TOQA 3CWNA 4OVXA 3V18A 4ADTA 4YCPA 3WQVA 5ABFA 3EX4A 3ARSA 5KZDA 3WF3A 3ZO9A 1T96A 2FDSA 1DVJA 1H1ZA 3THQA 1DWAM 1HO4A 4PMRA 3P3BA 4HZ8A 1R86A 1SGJA 3ANVA 2ZXDA 4JD4A 1VJIA 2PTYA 3OYXA 4YXGA 3L0KA 1POKA 3T05A 3RMEA 3URAA 2NX3A 1UMLA 4D8LA 1E72M 1LZOA 2HRWA 4XZHA 3EOEA 3SCPA 4GKLA 3R8HA 2YDSA 3VKKA 2XIOA 2WCAA 1CDGA 1HXJA 5CKSA 1DWJM 2ZTKA 3B97A 2NLIA 1H11A 3LCHA 4RPQA 1V3KA 4DJDD 3WH5A 4QSHA 3GHRA 1VD6A 4NT0A 3AUOA 1UOKA 2I57A 1VJSA 4FPSA 2Z1WA 2VFHA 1HL2A 1CI1A 3E74A 3M0ZA 3VX0A 1U30A 5HQMA 1TX0A 4HCDA 3CIWA 3LY0A 1OSEA 4V1YA 4XD5A 4EPDC 4QJ5B 1HKVA 4PMUA 1O66A 3OLDA 1FWHC 3N14A 3V3WA 4FNTA 3C2RA 4H9TA 4U3CA 2GQ8A 3BANA 2D2GA 5BRBA 2ACQA 3K4WA 4IGMA 1GG0A 3QYQA 3UP8A 4YTSA 1LUCB 4ES4A 1ZQ5A 3H55A 1S3HA 3AXKA 2G41A 4IFRA 4IJCA 3UPBA 1Z32X 4LVGA 4PMDA 5CGMA 1XH0A 3GTIA 3RPTA 4QJ3B 1MNSA 3W3OA 4GZIA 4OECA 5DRCA 3OGRA 4IIDA 4DYEA 4AW7A 2QJIA 3NL2A 5CPSA 3MUZ1 1CB2A 3QOMA 1UC4A 2WMIA 3SUWA 3HOJA 4DF1A 4L61A 5HWNA 1UMYA 3KL3A 2TODA 3SGZA 3MQTA 5FL1A 1M53A 2DSZA 1REQB 2DFAA 3E49A 3NG3A 1UJPA 1J0JA 2YCJA 5LA0A 4FOJA 5K9CA 3BJTA 3WK3A 3CZLA 3TE9A 4WSHA 4UFHA 3SAZA 1US0A 3C5QA 5LZLA 1V08A 3WNNA 3ARRA 5KTLA 1K77A 4FX6M 2BSLA 2E9LA 1XSIA 2QF7A 2F2KA 2YA1A 2PLMA 3LZ5A 2VGGA 2AL2A 4NUWA 3F4WA 4IPJA 4KRZA 4WX2A 3A3XA 4ZE5A 1DXEA 1JZ2A 3W2MA 3NVTA 2WOQA 1QTWA 4L4OA 5E5CA 4OTKA 1OJXA 2PLCA 4FOUA 4QXIA 1TV7A 2BP1A 3N9RA 5I07A 4XTIA 4H7VA 3VGBA 4ZOEA 4FEZA 2X1UA 1CBGA 3RX3A 2AGTA 2BVTA 1S5NA 3EA3A 1D3CA 1TVLA 3EB3A 3TSBA 4AB4A 1WBJA 2FMOA 2YA2A 4AZCA 3EX3A 2YZRA 2ESCA 3L68A 4DRSA 3LPFA 2VCCA 4GO8A 2I14A 4JX5A 1YQ2A 1LOSA 4IGHA 2QJHA 1G5AA 3RYSA 5C5YA 1LYXA 1Q6GA 3SBFA 1B3XA 1JQXA 1MW1A 2V3GA 3PBWA 1A5OC 4HZ7A 1M1BA 2Z7KA 3M0LA 3OVQA 4OBRA 3K8MA 4B2DD 4TX9A 3I68A 3WK0A 1R2RA 3QTPA 3QMTA 2C18A 1Q5MA 1WOAA 2QQ6A 2CKSA 3EWXA 1PXGA 4U2ZA 4C6IA 2R1LA 3CHEA 1SMDA 1IT0A 4IM4A 3MPGA 3WDIA 4IXHA 1OYBA 3SSJA 3DEQA 3BDKA 2JKPA 4QS5A 1QI4A 2VEKA 3WMLA 1XLCA 5FF7A 1AL7A 2H90A 2WVVA 5FJIA 3IUDA 2A4AA 4FX8A 2HE5A 1TPWA 4RZ4A 4UTJA 1H62A 5D9OA 2FB3A 3OLEA 1XFCA 4TTUA 4A3YA 4ERIA 5HOSA 3CUZA 4UTFA 3PFMA 4PBEA 3BWWA 3EOOA 4TXEA 3G77A 4FAMA 4WVXA 3PSVA 4FLRA 5T9BG 4XX6A 3OVPA 5FF0A 1C90A 1Q3NA 3VPLA 1WPCA 4QG8A 3LNPA 4X9SA 2B31A 3WLNA 3S2LA 2WLZA 1YLVA 2XH4A 1IXQA 4PUWA 3AUJA 3G1VA 1MUCA 5HAOA 3SURA 4LS1A 3VZXA 4BA0A 1QI5A 4H00A 3SIZA 4M8UA 3CQ0A 3KRZA 3OB8A 3EXSA 8XIAA 3WNLA 1C8QA 4NXKA 1H60A 1KM6A 2XVLA 1XHGA 4OE7A 4MDPA 4JPGA 1OHLA 2BB0A 1QHOA 2VX6A 1H63A 1XC6A 3N18A 3TMLA 3KVKA 2KX9A 1UH3A 4LUTB 2ZUSA 1OFDA 5M17A 3T08A 1M7PA 1C93A 3Q67A 1PCKA 1PWMA 4GNVA 1DPMA 4DXVA 4JTJA 4IHCA 1MEWA 2TRSA 2NVAA 2DSWA 2Y8VA 1J12A 1RLCL 4MFEA 4PUUA 5KINA 1JYNA 3FV9A 3W86A 2OLAA 1SVDA 3HG3A 4Y6GA 2WYSA 4IJBA 2J62A 2PWUA 3WF1A 1EO7A 3P93A 1ISWA 2Y62A 3VM5A 3U48A 1A5MC 3ARQA 1K02A 2WSPA 2E1DA 3IV3A 1JD9A 3CUIA 3LGDA 2ZE3A 1L0PA 4XAFA 3GXPA 2Z29A 1BGGA 1I1WA 3PZMA 4WR3A 4EWJA 5ABFB 2V2DA 3K30A 1QI3A 4MGGA 4HHLA 1ZS2A 4Q8WA 5JBDA 1XINA 2GOKA 3WLQA 1E3ZA 2UY3A 3OBKA 5IHRA 4C91A 3NM3A 4LAUA 3G22A 3KS6A 5G4EA 2PDFA 1W31A 4RZ5A 5EMYA 1TCDA 2DVXA 1KWGA 3S5ZA 4N9EA 3T4CA 2JE8A 3LHTA 2PDYA 3QKZA 3W1TA 4N9BA 3GB6A 2QXWA 2QW5A 5E6YA 4K8EA 5TIMA 4RDWA 2RGMA 4FMVA 3RM9A 2P1FA 4D9PA 1TV2A 3CQIA 5I00A 1P6WA 4DYKA 3T4WA 3BOLA 1UD5A 2PEVA 3IIPA 1YPXA 1OYCA 5EBAA 4Q33A 2VEPA 4B5SA 4S2CA 4WQ6A 3R89A 2HEJA 4MTVA 1JAKA 3TWAA 4CNUA 1KRAC 4JTDA 3EOUA 3GS6A 1EC7A 4XIAA 5JVLA 1VBJA 1R3QA 4Q7BA 2VQUA 1LORA 1JVNA 3K2GA 2A1YA 4JFVA 3RCNA 2WCSA 3S0CA 1GW1A 3DCPA 5ABEA 1W2PA 3M9YA 3SIMA 4NASA 2C8NA 3DI0A 4V33A 3GNOA 3WLMA 2QUTA 3VVGA 1XD1A 3ARWA 3H7UA 2OSXA 3R0DA 3H2EA 1UKSA 2DZXA 4EE9A 4IQEA 1EGZA 1UR4A 4K8GA 1B3OA 4MADA 3JR2A 3CO8A 3CQJA 3VNIA 3W75A 4J2MA 4XAPA 2Q6ZA 4KF1A 4M51A 4KFPA 3QGKC 1Q65A 1QNRA 2OODA 3Q94A 1EA9C 4DX3A 4UQAA 2XISA 1ISVA 1H4PA 1R85A 4JTKA 3IUHA 3ITVA 4LVDA 1XYLA 3GH4A 2YB1A 3TTEA 1HO1A 4DEFA 2G97A 4NAFA 1KV8A 1WXJA 3M0KA 2YFOA 4C6NA 2WMIB 4KW2A 4IH3A 4JN6A 2QS8A 1DJYA 2VKZG 4BK9A 3ARUA 3STCA 5I79A 3ES8A 4KFOA 1I2PA 4Z1DA 3LOTA 3IJQA 3M41A 1KNWA 3W25A 2D3LA 3HPFA 3O6CA 1W9BM 2YIHA 2Z1XA 1BTCA 3SCUA 4Q7NA 1HX0A 1ZAIA 3Q45A 3I3BA 3IWPA 4JYDA 4PEEA 1Q6CA 3TROA 2FHBA 1JDEA 1H0GA 1AL8A 1T99A 4FS9A 2ZX8A 1J2BA 2AL2B 2B81A 1K6AA 1Z48A 1T8QA 5E9XA 2XH2A 2XWEA 1EJRC 3PF3A 2G96A 4ZSTA 3ID7A 1DL3A 3KZPA 5HR6A 4CCDA 3W7HA 4W93A 4BQ2A 3HBLA 2EF9A 1HKMA 3IV8A 1MW0A 3JVAA 2WV8A 1UUMA 2VUYA 4GJIA 3U7BA 1T7LA 4H6RA 1KTNA 3TMQA 4LYPA 1BVNP 4JTRA 3H6OA 2O0TA 3R0UA 2CWXA 1B90A 4AZCB 1XWYA 3KAOA 1VFLA 2RKXA 3Q37A 1AJ0A 2XVGA 3KBJA 1JI2A 3CV7A 1IGWA 3RITA 4ZODA 2GJRA 2GVJA 2L5HA 3VGFA 1MW3A 2YXOA 3V5CA 1QK2A 5G4HC 2IXVA 5HPCA 2O7QA 3KWSA 2ZZ3A 3W1RA 2VC9A 3QM3A 2V5JA 3ES7A 2UZ9A 4NNBA 3UESA 4F2UA 4IPLA 4JTIA 3FNDA 4AU0A 3GKFA 1U2YA 3NQDA 3VKCA 4LF2A 2HQAA 1PBGA 2B7OA 4XD6A 4LV4A 2X2GA 2HCVA 4NVTA 4J40A 5G2HA 1AH4A 1XBVA 5EGRA 1GQJA 1YPFA 2PLKA 3PAOA 4QE1A 1RSCA 5AC8A 2YPIA 2DIEA 1BYCA 1KRCC 3TA9A 1U5VA 1A47A 1AQHA 4E2BA 2XSXA 2WVVB 5CH9A 3AC0A 3TLLA 3G0XA 3EB2A 3QC0A 1T8XA 2Y7EA 5CSSA 2NVCA 1QNQA 2ZUVA 2VRQA 3UVIA 4DIAA 4E4UA 2G3FA 1LG1A 4GFIA 4MYAA 3TN3A 1A5KC 4XD3A 3GG1A 2E0PA 1C92A 4R88A 3BLIA 4EP8C 4JQ4A 4FIRA 3KEHA 4PCNA 1OGSA 2BDQA 4QISA 1G1YA 4BY3A 4HCHA 1R47A 4LC8A 3S9YA 4DJED 4UUIA 2QGYA 4DB7A 4LB3A 3UR2A 3ZR5A 3VNMA 4JTFA 4XKYA 2Y8UA 3D3FA 3KTXA 1GQIA 1QBBA 3R11A 4JTLA 5D05A 4R7OA 5F2MA 2E09A 3NO5A 3A6OA 6TAAA 4K6AA 3SADA 2ISFA 3EPOA 3MMWA 4JYEA 2BOFX 3QR0A 1ITCA 3QHMA 3DBNA 3SW6A 1OT1A 4EKJA 2Y88A 3GSMA 2Z2BA 3FCPA 4QDMA 2X8RA 3W53A 4A3QA 2QAFA 3VM7A 2DSUA 3GE7A 2ICSA 3WJZA 2HZGA 1ZBKA 2ZX9A 3D47A 3N12A 4LOCA 1KM2A 2VQTA 1ICSA 5GPRA 5J5DA 1EJTC 2ZE0A 1NFGA 3F4VA 1CLXA 4JX4A 3MO4A 2ZA1A 4MZYA 2ZYFA 3ZSTA 2ZTJA 2B7QA 4S3AA 2Z1SA 1N8IA 2E77A 2QUMA 2PA6A 3CEUA 4S1FA 2CFFA 1VBRA 2BHUA 3C0SA 3JZEA 3ATYA 3OVGA 2FZMA 2GVEA 4OFCA 1UP2A 4PR4A 3CYJA 5FEZA 3NSMA 5CLTA 1NJJA 1ZNNA 5KITA 5CSUA 4A2SA 1V3LA 3GFZA 2OYMA 3KX6A 1GZ1A 1NOWA 2CBJA 3SCRA 3GTXA 4QHRA 4JTHA 3ONCA 4LX4A 4JTUA 2ON3A 3LYEA 3SY5A 4LFYA 4K37A 5FF4A 3MMTA 1B1YA 1S1RA 2PTWA 3FAXA 3GR7A 1UP3A 1YE6A 2PWVA 2V3DA 2QULA 3PJXA 4LC6A 2WVUA 4PRRA 4DWSC 2YDAA 3QMRA 3NIYA 2Y7DA 1PB0A 1Q2SA 2DJXA 3HA1A 4E3TA 2CHRA 4HB7A 1G67A 4IJRA 3R58A 1UKPA 1R30A 4PL1A 3WO8A 5JIPA 5A6BD 2Q02A 4GYPC 1XIBA 3W07A 2Q8ZA 2F8QA 3HV8A 2EAWA 3HV9A 1XYMA 5EFFA 4S2BA 3S1XA 1P48A 3OPSA 3UJRA 4BF7A 3IJ9A 4F0SA 4H7ZA 1MQPA 3UA3A 3BJSA 3P60A 3GW3A 1JPDX 1NFBA 4NIRA 4S23A 3DHFA 2Y5SA 3GDBA 1LL7A 3A47A 3NL5A 1B5TA 3BICA 3W27A 5G2WA 3UF9A 1C91A 4W8LA 5DELA 4GHRA 3LLDA 4HJWA 1E43A 5D2XA 4GE8A 2RJGA 3WQDA 4PMXA 3DZ1A 4W7UA 1UUOA 3ZS4A 1FXPA 5HXMA 2ZZ5A 1SZNA 2XJ7A 1HKKA 3FEMA 5J5RA 3CHVA 3WEOA 4NZCA 3SJ3A 4PGLA 1W6TA 2NUWA 3W6MA 1XCFA 2G37A 1K1DA 4MB5A 4AMAA 3OGVA 4ADSA 4NAFB 5C7HA 5I3JA 2V9DA 3E0WA 2V38A 2E40A 5D09A 1P0BA 2V68A 4GH1A 3L4WA 3V5OA 4CGTA 3MB9A 4DUXA 3UXIA 1IYXA 1GOKA 1H61A 3WF4A 1XXXA 4I8YA 4Z0SA 3IGSA 1TPC1 1ODZA 3A24A 3UXDA 5C9ZA 3VDAA 3PG8A 4UQ9A 3THUA 3WDRA 3NQBA 4E3VA 2DSVA 1VPYA 3CS2A 3POHA 4BEUA 3S1WA 1FDZA 3QQWA 3W7RA 2FTPA 2QCDA 3C2OA 2CW6A 1E0TA 4H9VA 2E6YA 1VRXA 3BH4A 5AOUA 2J75A 3LERA 2XH0A 1VQTA 2QJNA 2HTMA 2CLOA 5BXRA 5D30A 2J78A 1B9BA 6CGTA 3WJWA 1KWKA 4KWVA 1YIXA 1R9YA 4Q4QA 2PDHA 1O60A 1RAKA 1PZ1A 2WM1A 5CQ1A 3ZFHA 1TE1A 1QWGA 4LVAA 4MLRA 4S3EA 1HNYA 3W2LA 3L21A 4RLIA 1FHLA 4AUBA 2ZRXA 4I7VA 3EPNA 2GDUA 5K9XA 3ITXA 3AROA 2GGJA 4ORIA 1N2VA 2PTZA 4GFSA 3A4JA 4KIEA 3TNOA 1ZB5A 5U4NA 1JCTA 4S3DA 3JU2A 2C3ZA 4XBSA 1JCLA 4XZLX 2EPKX 2ZRUA 4D6IA 2AKMA 4AYGA 3LRKA 3R25A 5CGQA 1UD2A 1UR1A 4LNCA 3O7UA 3GLCA 4O14A 2REQA 4UMAA 4FXJA 2RGLA 4M56A 1R2TA 4QCFA 1GOXA 1O6IA 3S5SA 2HE8A 5I3KA 1U33A 3O8AA 1MEIA 2QIWA 2X1RA 5I5RA 3MSRA 4GJJA 3BMVA 3NQ2A 1WDRA 2BXYA 3RK8A 4L80A 3XISA 3W85A 3RO6A 3L4TA 4HHHA 3S1UA 4BQ4A 3CZJA 4YL2A 4PRTA 3LCLA 2VFFA 2NQ9A 3H8AA 3UZWA 3EOLA 1NEYA 2HPIA 4M19A 3SN4A 3BLFA 2ISWA 4YLWA 3URNA 2DZUA 2H8ZA 4UIOA 1I9CB 3EDJA 1WYIA 2G0WA 4I7WA 3C52A 5LGXA 1XUUA 1FKXA 2DU2A 1EYEA 1FWBC 4C6LA 4H8HA 1GZGA 3TJXA 4JL1A 4TX8A 1V02A 5DBTA 3UJFA 1E5NA 1M68A 2CKRA 3UXAA 1E9IA 2FH6A 2KZHA 1L6GA 4LNYA 4DN1A 4CNSA 3DXIA 3AXMA 1TB3A 1QNOA 1BVWA 4HNTA 4ZGYA 1NDYA 2QVHA 3RU6A 3D5HA 1RJRA 3E12A 2ZCGA 3UY8A 2XVNA 1SFJA 2HBVA 3TSDA 4FO4A 3CUFA 1OCBA 4HIBA 4JNZA 1B31A 2P10A 4PB4A 1W1PA 2PCEA 4XKYB 4ZMGA 2A3CA 4CQ9A 2LLEA 4HTYA 4JIQA 2VR5A 1LOQA 4BCEA 3CWHA 3UYIA 3LLFA 2HVMA 1GVOA 4G9PA 2NWSA 2HDJA 4UBPC 1FUYA 3KS5A 4PBGA 2YBVA 1XLGA 4OZOA 1VAHA 3N2MA 4PL2A 4GQ0A 5D2VA 1H50A 2VCAA 3SGGA 3OQEA 3P0WA 1SW3A 5FF2A 2J79A 1EXPA 2FZNA 1W5MA 5EFDA 1UP0A 4GBUA 2J74A 3S2NA 4H8NA 1XPGA 3O2LA 1RP8A 4H83A 4GXWA 2X05A 2Y24A 4U10A 3KRBA 4IQLA 2OZ0A 3I7RA 4HA1A 3WEMA 5I3HA 1WDDA 4HU3A 1YRRA 1F61A 4L1GA 3DGRA 3KW3A 3O1NA 2AAAA 2C19A 1I2NA 1B0IA 3BAXA 5C0QA 3S8HA 2GSJA 4L9ZA 4X60A 2DZWA 3GDKA 3NQ8A 3LLXA 3NZGA 1L6SA 4WXZA 4X22A 4B92A 5JXQA 4JN8A 3N3TA 1DKWA 3MHGA 5C9RA 2TMDA 2J7CA 4ZENA 4B5WA 3MUCA 2ONEA 3NO1A 2XDFA 3DFOA 2P53A 2CITA 3IIZA 4LBRA 3UJEA 2PDUA 1LWHA 1NQKA 4LCSA 4KGJA 3DG3A 3RUBL 4RL3A 1OCJA 3SCNA 2VELA 1WBHA 3CMJA 3WNKA 1W1IE 3RG6A 1ZAHA 3MU7A 3E1F1 3C2EA 3WG6A 1OFAA 3PZGA 3VNYA 2VC6A 1LLOA 1Q63A 5HNUA 1LF1A 3CAVA 3LBOA 1QW8A 2VZTA 1ZJBA 2RDXA 4Q4RA 4QR6A 2WJEA 3ABZA 1K9DA 2PWFA 3A3WA 4ZB5A 2F2HA 3GDRA 2EJ1A 3ABXA 4O16A 5F2IA 4PTVA 3OLIA 4HA3A 4CD7A 3W28A 3HG5A 1ML1A 1XLMA 4KKXA 4L9YA 2H9AA 1N7KA 5CPOA 1PIIA 4FNPA 5CXPA 1FP9A 1FH9A 5KZEA 5LIKX 3NL3A 4OWGA 2P3ZA 1OCNA 2YZ5A 4UFMA 3KOWA 1FQ0A 3W82A 3MUAA 2YKKA 1JCNA 1XICA 2VGFA 3R2GA 3VIFA 4D72A 3W1XA 2XFYA 3W7DA 2PC4A 1W3NA 1DJGA 1DE5A 4HYVA 3W7OA 3WFZA 2VRJA 3WD0A 3DYOA 5T8GA 4G1NA 3APTA 5K9DA 2VEMA 5IDZA 4AC1X 4NQ1A 1M9HA 1OYAA 5DCEA 4GI6A 4IWWA 2P50A 4A8LA 1PDYA 4N9DA 3QJAA 2D0GA 3NQ7A 2QCHA 1FVPA 3WY1A 1NDWA 3HPAA 1XLJA 1FDJA 5FL0A 3QV7A 4A4AA 4NHVA 3W6YA 5G4WA 2NUYA 7A3HA 3GXDA 4EOUA 4ENLA 1BG9A 2XINA 3BW4A 4EIVA 1P43A 4MG4A 5D02A 4F0HA 3N6JA 1D8CA 2C1IA 2VVNA 4YVPA 1Q8AA 1OF6A 8A3HA 2QCDB 4OBSA 3KWXA 4O13A 1QR7A 2OO6A 1EIXA 2OVLA 5BOEA 1W3HA 3U2EA 1JYVA 1IHIA 3ZYZA 3LGGA 2V3FA 2VC5A 3SY8A 1DTUA 3T55A 3I65A 4AHQA 3VCCA 1O68A 5E0FA 4AZIA 3GTFA 2INFA 1FWEC 3QZEA 3WUBA 4GXMA 2BY1A 4S3GA 2FPTA 3IJIA 4FSAA 4RNIA 4DAIA 3E2QA 1KCLA 2HWGA 4U33A 1DJHA 1KA9F 1VEPA 3W26A 1JEZA 4ML4A 1IZCA 2DV0A 2RJHA 4AZ6A 3RDKA 3PWAA 4FLQA 1NVMA 4FP1A 5D33A 4MNLA 2Q01A 4ZQOA 5BXTA 2Z27A 1HKJA 1E1FA 1IIHA 1PUDA 2BY3A 1KFLA 3WBAA 1O94A 3P80A 1XJBA 2J7EA 5JBEA 3W81A 1BF6A 4CUCA 4I5RA 1QNPA 1X1ZA 2REQB 4U31A 3CHFA 1WDSA 4REQA 1SSDA 2VGBA 4HP5A 1EDGA 6REQA 5C2GA 4Q8OA 1DJNA 1PX3A 4ROQA 5A69A 1HKIA 2YL8A 3WUFA 4FZIA 2HXUA 2VP8A 3S6TA 1H7PA 4H7CA 3PHAA 3ABSA 1CNVA 3FXGA 3TAOA 1P6BA 1TPDA 2RDUA 2J7DA 3CMFA 1YADA 4WDXA 1SO4A <