2WHJA

Understanding how diverse mannanases recognise heterogeneous substrates
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
308
structure length
308
Chain Sequence
b'AGFYVDGNTLYDANGQPFVMRGINHGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKMVAVVEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIINIANEWYGSWDGSAWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSIHDYGQDVFNADPLKNTMFSIHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEETGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKPSTVFTDDNGGHPEPPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MANNANASE
publication title Understanding How Diverse -Mannanases Recognise Heterogeneous Substrates.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 125
structure length 308
sequence length 308
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2whjA00
3WH7A 4HZ6A 1QI4A 1HX0A 3DYPA 1HF6A 5JIPA 4V27A 1PAMA 4D6GA 2AOSA 4H2CA 5I2UA 2E0PA 1UWQA 3VTRA 3WIJA 4DM2A 3GYCA 1OIFA 2W62A 5D9OA 3KEHA 3VU2A 4MAZA 3UCQA 5BWFA 1CGWA 3BMWA 2PI6A 2A3EA 4OOZA 1E4LA 1RP9A 2ZUNA 1JDDA 3BSGA 1M04A 1G5AA 3ALGA 4UFHA 2XG9A 1BPLB 1GJWA 1AMYA 2VRQA 4U2ZA 3GZAA 2J7GA 3RM8A 1K9EA 3GM8A 5BXSA 5HBFA 2VI0A 2OYLA 3ARVA 3W38A 3EYPA 4J27A 3WUFA 1DTUA 4GZJA 1J0HA 4PCTA 3K8LA 1ZU8A 5IDIA 2Y2WA 2YDQA 4AEFA 4AW7A 4AD5A 2YDRA 4TVDA 5A6AA 1EOMA 2YBTA 5AY7A 3SCWA 2UY4A 4WIWA 5KEZA 1LWJA 3WD2A 1AQ0A 4E2OA 3MUY1 2CHNA 5A94A 2Y5EA 4HMEA 5FD0A 1JZ8A 2WCSA 3AMCA 3RM4A 4LGXA 3CZJA 2ZUUA 4AXNA 1XD0A 4E8CA 5GNZA 1W3LA 4KMQA 2Y24A 3CMJA 3RCNA 4UOZA 2ZUWA 1UYQA 1KBKA 1LG2A 1GQJA 2CYGA 1GPFA 1CLXA 2VCBA 7CGTA 3DYMA 1M03A 2YL5A 2VL4A 4W86A 4YHGA 3W29A 1BVZA 2BVTA 4GPNA 2PWHA 1GOIA 2OWCA 1OCQA 3T08A 1CXIA 3OG2A 2BHZA 3VUPA 4D1JA 4ACZA 2VRKA 1CXEA 1NOFA 1QVBA 3D3AA 3QGVA 1V6UA 2WSKA 1MW0A 1PPIA 3BXWA 1H5VA 2VX5A 3CZKA 1SFSA 4M56A 2J78A 5D9PA 4E8DA 1X6NA 4PMRA 3VDHA 4Z2IA 3WDRA 1HJXA 3MO4A 4B3KA 2WLZA 5E09A 1V03A 2ZXAA 1N82A 3TTOA 1CGXA 1HP4A 3SCVA 2GJPA 4UQCA 4GQRA 2G41A 5LYRA 5I6SA 3WF0A 1PBGA 2BV9A 2VR5A 4M82A 1UWUA 4YN5A 1GOQA 3KZSA 2J62A 1JAKA 3WMBA 1QPKA 5A69A 2QF8A 4UFMA 2GSJA 3AXIA 1V02E 4J3XA 8A3HA 3AHZA 1J0IA 2CBIA 2W66A 4A3HA 3EDJA 3WQWA 2XM1A 3ZT7A 1H0IA 2VTFA 4PMNA 1QHPA 1TZ7A 4ATDA 2XFFA 3LMYA 3WQ5A 5A3HA 3M6DA 4FLSA 3K1DA 2X0YA 1JDAA 5C71A 2WMIA 3NSMA 4JHOA 5M03A 2XVGA 5CQ1A 1J0ZA 1V02A 3N12A 1XD1A 3SUVA 3L4ZA 2OSYA 2IUZA 4UQEA 2D0HA 1AQHA 4AISA 2WW5A 1CGUA 1M7XA 4AMCA 2XYLA 3CH9A 3ZR5A 5CSUA 4J3SA 5DO8A 1BGGA 1S46A 1HNYA 3WEZA 4UCFA 1WDPA 2O9TA 4CU7A 4MNKA 4AZGA 1B3XA 5DT7A 1EA9C 1BFNA 1JD7A 3RIKA 3N04A 3GNRA 1XH0A 1GQIA 3CZ8A 2F8QA 1BTCA 3WENA 4BCEA 1UR1A 2WHKA 4J3WA 5DMYA 4M8UA 1J01A 1IZKA 4H04A 4X9YA 1B3VA 1Q6DA 2ZX5A 3FY1A 2VX6A 4JFWA 2W61A 2W5FA 1BGAA 3AICA 5D9NA 1Q4NX 4PRWA 4Z2JA 3AIVA 3VMOA 1HKJA 1QW8A 3ZM8A 4CD6A 3AYRA 1DWGM 1UKOA 2PB1A 3WH5A 3OLGA 2J74A 1QI3A 1DEDA 4TVUA 3W37A 3RILA 3WELA 1V0NA 3I3BA 4TXEA 4M80A 4KWUA 4M1RA 2ESCA 3PZMA 4DWSB 3ARRA 4MJ2A 5FKYA 3WH8A 3W26A 2GK1A 2WMGA 2ZXDA 3ZJ7A 4DUWA 3EMZA 2B31A 3WQ6A 2VNCA 4JAWA 4YPJA 2OSWA 5FCZA 2JIWA 3CUIA 4NRRA 3OLEA 3BAJA 4J28A 1PX8A 1W2PA 1W91A 2J79A 3A4XA 1BVNP 3CMGA 1EGZA 1B30A 1U33A 2DDXA 1HJQA 4PMDA 4AIOA 4CCDA 4CVWA 3ZJ8A 3WMCA 1TCMA 3W25A 3VIHA 4JKLA 3VINA 2UY3A 4AZ6A 2ZUVA 4HA4A 1XH2A 1JFXA 3QOKA 2ZWZA 3RM9A 2ZE0A 2J7FA 2RGMA 2WZIA 4U33A 2F61A 4PMQA 1OIMA 5A8MA 4M24A 1W3KA 1UR2A 1LQ0A 2WNWA 1HJVA 2VMFA 5HNNA 3EDFA 3B9DA 5A8PA 4A3YA 1R7OA 4F8XA 1VJZA 3CZEA 1WO2A 2CESA 2WHMA 3AIEA 4D71A 3AISA 3K4DA 3II1A 2D3LA 4W89A 3VIIA 5A6KA 1ZS2A 1BYCA 1E6RA 2CKRA 1UWTA 3PZ9A 2YL8A 4JZ5A 3F5LA 1MFUA 1Q6CA 2E3ZA 5D8WA 5I5RA 3MUIA 5A2AA 5A6JA 2JF6A 1E15A 1CENA 2XFRA 1PIGA 2XUCA 3BAYA 4UFLA 1B3YA 1TR1A 4HZ7A 4KGLA 3ARWA 5A2BA 3AMDA 3MV11 1MXGA 2WSPA 3U7VA 2EPOA 4UNIA 2Y4SA 5E70A 4H7VA 1WZMA 1FHDA 1NWUA 2BNJA 3VIMA 4JFTA 2JF7A 2CEQA 3WH9A 1E4NA 3NDZA 4P7QA 2TAAA 3VGHA 1MQQA 2EXOA 1E5JA 2BVYA 1JI1A 1VEPA 1JFHA 3UR8A 1KXHA 1XSIA 2PWEA 3CHEA 1ECEA 2ZX6A 4H8HA 1JZ4A 1TA3A 2CETA 2XVNA 3GXFA 1QNRA 3CIVA 4XZWA 1UWRA 4QP0A 1E4IA 4U5KA 2WKGA 1HIZA 1UZ4A 3B8SA 3VNZA 5EBAA 2YL6A 1W32A 4PMXA 3T09A 2EEXA 1OB0A 4W7WA 5JBDA 2AMGA 2VOTA 4CGTA 3PZVA 3WBEA 5D9MA 5I23A 5ABFB 5DEZA 5BRQA 2BXZA 4GINA 3OGSA 3OGVA 4QCFA 4QCEA 2BY2A 4B9ZA 3RJYA 1E6PA 2VC9A 4UR9A 1Y7VA 4CUCA 4AWEA 3GBEA 4PMOA 2OWWA 2WBGA 1WKYA 1JNEA 4UTFA 4PMVA 1GVIA 4PMZA 4MB4A 4OJYA 4D6HA 3FHAA 4RE3A 4ACZB 2XJ7A 1US2A 2VQTA 2X05A 3PZUA 3VD3A 1OWQA 1JZ7A 1H49A 4DWSC 4AD3A 4BQ3A 1E6ZA 1H3GA 2XFYA 3TTSA 1JDCA 1BHGA 2WXDM 1NQ6A 1WB0A 3VIPA 3G6LA 2WVTA 1OT1A 4HA3A 1NP2A 1XC6A 2YLLA 4BF7A 1ITCA 2VJXA 4V28A 1GORA 5LA1A 4JFSA 1VEOA 4MJ4A 3CZGA 1KGXA 1V0LA 2X0HA 2VVNA 3ARYA 3VD5A 1ZJAA 4ZFMA 2Z1SA 3VDBA 4J3TA 3A6OA 1W9DM 1OGGA 4HOZA 2EPKX 2W92A 5EFDA 2WVSA 3RPMA 4D1IA 1F4AA 2MANA 2BY1A 2Y8KA 4LYPA 5A6MA 2UY5A 1A47A 1MYRA 1V6VA 1U2YA 5F7UA 4UQDA 4IISA 1GVYA 1V3HA 2V5DA 3CO4A 5A6BD 4JFVA 2AAAA 3ARSA 4P7OA 4FLOA 1GUVA 1W1TA 1V6XA 4WK9A 2XSBA 2C7FA 1B2YA 5TD4A 2D20A 3IJ8A 2VURA 2FHCA 2J7EA 2WMIB 1OD0A 1J0KA 3B9EA 3GNPA 1RPKA 3VD7A 4WLCA 1KCKA 4WKAA 4K68A 4F79A 1E70M 3KWXA 1I1XA 1K6AA 3AS3A 1E55A 4HMCA 1JF6A 1GHRA 2VZSA 3A47A 4AIEA 4NI3A 3I3EA 1CPUA 1JYWA 1KXTA 1FH9A 1ODZA 2VR4A 1OINA 2FDMA 4BZYA 5A8QA 3F5KA 3WF4A 4UQ9A 4JKKA 1AQMA 2DSUA 3BSHA 5HOSA 1NP0A 3G6MA 4MAVA 4U2YA 3WD0A 3CHCA 2YA0A 5CLTA 2EBNA 5DF0A 3T2OA 3VX0A 1JYXA 2OLHA 1E3ZA 3GDBA 1LJYA 1GONA 4TUFA 2OYMA 3W6MA 2DSKA 3PTMA 2YL9A 4J3VA 1W9VA 3SCTA 3UG5A 2WANA 2CIPA 1FP9A 6CGTA 4NSBA 1W9UA 1DHKA 2WK2A 1JGIA 4M29A 3CGTA 3DHUA 5JBFA 2CPUA 1B90A 4WJXA 4AZBA 1M01A 3UERA 1RD6A 1WDSA 3N18A 3POHA 1ODUA 2BVDA 2G3MA 2VX7A 2FHFA 2YJQA 3MMWA 4RL3A 3F5JA 4R5EA 1CZ1A 1WCGA 4JKMA 3U57A 4QFUA 2CKSA 2XIBA 1CTNA 1B3WA 2GK1B 3WNOA 3SUSA 5BXRA 3QOMA 4B3LA 2DPEA 4BQ5A 3DC0A 3SCNA 1CXKA 5A2CA 3WDHA 1FP8A 3PZTA 1FA2A 1KCLA 4HU0A 3J7HA 4OBSA 4W8LA 1OGBA 5FL0A 2Y8VA 4UOJA 4OIFA 5GPRA 3AMGA 2NSXA 2DIJA 1YHTA 3WNLA 1E40A 4QLJA 2G4FA 1J0JA 3ZJ6A 3CPUA 1EDTA 2E9BA 3HMCA 4CVUA 4MNJA 2VCAA 1IV8A 3AS1A 2FGZA 2DH2A 5IHRA 4LQ1A 4W88A 1MWOA 1NWSA 1HJUA 1Q6GA 1FHLA 2WWDA 1GOWA 2G3NA 4C7DA 3AI0A 2XM2A 2NW0A 1XGZA 1MW3A 4HOWA 3CHFA 1J10A 5A6BA 1JZ3A 3WBAA 1QHZA 5E6YA 1ZL1A 1BG9A 3AZRA 4WKHA 4R27A 2WAGA 1UKSA 1R86A 3ARPA 3PBGA 4P8XA 1BQCA 1UOKA 1UKTA 4GZEA 1LG1A 4PSRA 4URIA 3VIKA 1C8YA 2FGLA 3FHQA 4XZBA 3M7SA 2WYSA 1CWYA 3AQUA 1VEMA 2PWFA 1ISZA 3KL3A 2OSXA 2PBOA 3UEQA 4UFKA 4NRSA 4C7FA 3NDYA 1C90A 1UR8A 1TG7A 4JIEA 4AZCA 1QHOA 2CBUA 3VX1A 3OGRA 1BAGA 3KL0A 4TVCA 3K4AA 2QPUA 3EBVA 4HMDA 2XIIA 4ZXOA 3F4VA 1LL6A 1US3A 3AHXA 2WB5A 4P8UA 2VQUA 4AC1X 3PZOA 1E6XM 4EK7A 2QHAA 3GBDA 5KZ6A 3PZGA 4GI6A 5A8NA 2DEPA 4PTMA 3AMKA 1Z32X 4D6JA 1O6IA 4QLLA 3WNNA 1TA3B 4OZOA 2XGIA 5AYIA 3TA9A 3ZR6A 3BCDA 1LL7A 2GFTA 4L4OA 4OUEA 3PHAA 2O92A 1UUQA 5CZKA 5CSYA 4P8VA 2ZWYA 2J77A 1H2JA 1E4MM 1ZBCA 4HA1A 1WZLA 3UETA 3AROA 3RJXA 1JNDA 1E43A 4JCLA 1KQZA 2BY0A 3WMSA 1H41A 4F66A 4X0VA 1E0WA 2BFGA 1H0GA 1QNSA 1V6YA 1ZBVA 3BLPX 2O9OA 2A3HA 1QNQA 3GH5A 2CCRA 3VGFA 5I79A 3WNKA 1ISVA 2EQDA 1FFQA 3VGGA 3CZLA 1JYNA 3NUKA 2GDVA 2IXVA 1JG9A 1UR0A 1E6QM 2V3DA 4NZCA 1NOWA 5HPCA 5JBEA 2YLAA 3CHDA 1UWSA 1QI5A 4W93A 3WFLA 2DT2A 4OOUA 4X0NA 1UKQA 3TTYA 4QDMA 1JXKA 1PX4A 4W5UA 4CD7A 2GVYA 3K8KA 3SCRA 1CLVA 4HU8A 1PJ9A 1GOKA 4MNLA 4W85A 1UD5A 3UG3A 1W1VA 1CNVA 4H41A 1GQLA 2ZX7A 3OZOA 2G3IA 3VDAA 2V3FA 3T0BA 3ARZA 1CGVA 3PTKA 3WKZA 5LA2A 4U3CA 1KGWA 3AMLA 1QNOA 2VUYA 1U30A 4AD4A 4XX6A 2Q8XA 1EIBA 3IAQA 2UY2A 1DWIM 4DM1A 1TVPA 4D6IA 1RP8A 1FH8A 2JALA 4JHZA 1KFWA 5BRPA 1WZAA 2WM0A 4ATWA 2ZOXA 3LPPA 1TFVA 3D5HA 2J25A 4RE2A 3HU7A 3BMVA 3U7BA 3BAIA 2E40A 3VNYA 4MB3A 4Z2KA 1D2KA 1KR0A 3ZQ9A 1J18A 1IZJA 3W53A 3O2LA 2XVKA 3BCFA 4GQQA 1SMDA 2VX4A 3ZJKA 4UZUA 2XWDA 1IT0A 1KB3A 1CXHA 3THDA 1ESWA 2EPNA 1FH7A 1R8LA 2GUYA 4XV0A 2E8YA 2NT0A 3PZNA 1V08A 3ALFA 3S6TA 3ARUA 1E56A 4D6FA 3WUGA 1E72M 3WEOA 1E6NA 1WE5A 1UD4A 1LL4A 4Y7EA 2GDUA 2BS9A 3MKKA 1JZ5A 5E6ZA 3W27A 1W9XA 2W91A 1E71M 1K9FA 1J0YA 2ZUTA 1TUXA 4ML4A 5A8OA 1OM0A 1SYTA 3VGDA 2JIEA 4P7RA 5CGTA 2JFEX 3VVGA 2VVSA 2YDSA 3ZSTA 1ZBKA 3T0AA 4J7RA 4AIUA 4QLKA 1VFFA 3SCPA 3W81A 1JZ6A 1DWFM 1UD6A 1VFOA 3W28A 1MXDA 4F9DA 4EE9A 1MW2A 3MMDA 1ITXA 1JAEA 4PMYA 4GO8A 4UQAA 1VFUA 3ZOAA 4NF7A 1WDRA 2BY3A 3ECQA 3VMNA 5E9AA 4EANA 5ABGA 4XUYA 3FAWA 4MADA 4B15A 5C8BB 2XWEA 4BS0A 1L8NA 1EO5A 2WMHA 3GTNA 3K8MA 3WUBA 1PEZA 4GKLA 3WD3A 1V3IA 3BC9A 4FK9A 1HL9A 4LXFA 3EDDA 3OIHA 3L4VA 5CG0A 2F2HA 4AZ5A 4PCSA 1MQRA 1V6WA 1J12A 4UOQA 4CD5A 4TX6A 3ARTA 3SCOA 3VM5A 1NH6A 2RGLA 3O6AA 3TOPA 4WSKA 3L4YA 5I77A 1B3ZA 1C92A 1VB9A 2DH3A 4HP5A 1F4HA 4AYSA 2PBGA 4GXPA 4W8AA 3SUTA 3WDQA 1KGUA 2A3CA 3SEPA 4A4AA 1E1EA 3MUAA 3AIBA 4MB5A 5BYWA 3MANA 3VGBA 3FN9A 1X1NA 1VIWA 4P7LA 2V3EA 3MSGA 4LYQA 3W24A 1VFMA 2QMJA 3MU7A 2ZUMA 3VIJA 1BYAA 3RO8A 1TE1A 1XSJA 2XGBA 4TTUA 4JL2A 3WN6A 1NOUA 3UESA 3SIMA 1C7TA 2BHYA 3N15A 4Z2GA 3U5YA 3OLIA 1E5NA 1QOXA 1R87A 3T2PA 2DT0A 1CXFA 2QLYA 4GI9A 1UA7A 4IPNB 3PZIA 2DSZA 1JL8A 3IANA 4ZE4A 4AZCB 4ZEPA 2PWGA 1HVXA 3BAXA 5CGMA 5I3DA 1UD2A 1VBRA 2ZIDA 4PEEA 4TOQA 4MB1A 1K9TA 1K9DA 1JIBA 2FH8A 1VBUA 3WL1A 5HXMA 3HN3A 4CKQA 1ZJBA 1UD3A 1WZKA 2E9MA 5E0FA 3VIGA 4LPCA 2WCGA 4PUEA 4ZENA 5JUVA 4CU8A 1OSEA 3KE0A 4U31A 4CD8A 1KWGA 1W9BM 2WCAA 3THCA 1KXVA 5FL1A 3U5UA 2UWFA 3VO0A 5BXPA 1I75A 3QHMA 3B9AA 3SCSA 4D6CA 2WVVA 1UH3A 5CXPA 3MMUA 2DSVA 2WVUA 1QW9A 1E6SM 1D7FA 1EDQA 1UQYA 4YHEA 4S3KA 2ZXQA 5ABEA 2W4XA 1UR4A 4AD1A 1NM9A 3SCQA 3AZTA 1DWJM 4AY1A 4W5ZA 4DUVA 3CUGA 5CPTA 1BLIA 1W2VA 4CCCA 1GW1A 2A3AA 1WP6A 1XYZA 3AIQA 3QHNA 2YIHA 2JEQA 4MDOA 4PSPA 1C3FA 2VCCA 3WQVA 2D22A 5M5DA 3TONA 2G8ZA 2J7HA 5BROA 1DWAM 3SUUA 3GH7A 2VZVA 3DYOA 4H8VA 2WKLA 4B16A 1JYVA 4KH2A 2J7DA 1KR1A 4KRTA 5CLWA 3L4XA 2C0HA 3A4AA 3NIYA 3WL0A 4C7GA 4CN4A 5IXEA 3VIOA 1UKPA 3AHYA 3T2QA 1SMAA 1OGSA 1HVQA 7A3HA 4CD4A 1QBBA 1R7AA 1V0MA 2DIEA 4N0RA 5BXTA 2VO5A 4IPLA 3AIRA 3CUJA 2VT0A 4PN2A 5AC4A 1BG4A 1VRXA 3UR7A 2VRJA 1E9LA 1UD8A 4MTVA 4Q22A 2W67A 4S3JA 1V0KA 1DWHM 2ZX9A 4OBRA 5AYBA 4KGJA 4M81A 3OA5A 5CPQA 4Q7NA 1UZ1A 2BXYA 4N42A 3SURA 5ABFA 1WNOA 5IFPA 1CDGA 5A95A 1XRVA 1W3HA 2WHLA 2Z1KA 4FF5A 2G3JA 4PUDA 3GXIA 5AC5A 5EFFA 2C8NA 4HTYA 1PZ2A 1HJWA 2HISA 5M17A 3N11A 2WMJA 1FOBA 1UA3A 1CEOA 3VDCA 2X09A 3MS8A 3L4UA 3FXYA 5FIPA 1HL8A 3PZQA 3CUFA 1OBAA 5FOOA 3BLKA 1EQCA 5IFTA 3AOFA 4D6EA 1EHNA 2J8FA 2ZICA 3N13A 1MFVA 4PTVA 1R85A 3AZSA 4GIAA 1W1YA 1HKIA 4CCEA 2X2YA 1QI2A 3W6LA 2EPMX 1CXLA 3ARQA 1G01A 2OYKA 1E73M 4JFUA 3VILA 3BGAA 1H11A 1W9PA 5A6LA 3CLWA 2CITA 4H8UA 3GXMA 2GJXA 3WEMA 3GH4A 1WAWA 3PN8A 1E0XA 1ZB5A 2V38A 4QAWA 4MDPA 3WQ4A 5JIWA 5CPSA 1AVAA 4ZE5A 3S2CA 1EHAA 2CBVA 4AZIA 3NCOA 1XSKA 3MSDA 1JF5A 5BCAA 3NYDA 3RDKA 2D1ZA 3AS2A 9CGTA 5GQBA 1UWIA 1W1PA 1ISWA 3FAXA 1B31A 2J7CA 4HOXA 2BHUA 3VGEA 3RMEA 1EXPA 1ZBWA 3TTQA 3W0KA 3T0DA 3HJEA 2NT1A 2VZOA 2E8ZA 1JD9A 1NARA 1CYGA 1XHGA 2D23A 2XTKA 4PTXA 2PWDA 4PBGA 2V5CA 2YOCA 4U5IA 1KBBA 4WSJA 4LX4A 1QNPA 1OT2A 1P6WA 2HVMA 1B9ZA 3WF1A 3LPFA 4PMUA 3WF3A 1GHSA 2CERA 3DECA 2WMKA 1B1YA 3LPGA 1ISXA 1GOMA 2CXGA 1BYDA 5ECUA 1GCYA 3AYSA 3IJ7A 4E4PA 1ISYA 4AZHA 2O9PA 4CN1A 4ZXLA 1HJSA 2J4GA 4JCMA 3CUHA 3MUZ1 1O7AA 2ZXBA 2EJ1A 3AXHA 1CGTA 4HPGA 1X6LA 4MNMA 3M46A 1WDQA 2ZX8A 3ZIZA 3O9NA 1JXJA 3EDEA 1VJSA 3JUGA 2CHOA 2CBJA 3WDJA 3WUEA 4GO9A 3VPLA 3VMPA 4EAMA 5I24A 1C91A 1W3JA 2O9RA 1KWKA 1V3MA 2J47A 5D8ZA 3ZT5A 4AD0A 3WY1A 3ZO9A 1CGYA 6TAAA 2WC4A 2WHJA 2XPKA 1VENA 3N9KA 3BH4A 2XHYA 6A3HA 2DQXA 4IUGA 1TMQA 4D72A 3VD9A 3VIFA 1UH2A 3GNOA 2CNCA 2WLYA 3N1AA 5ABHA 5HDRA 3M07A 3OBAA 1LF1A 3ZT6A 3IAPA 3E1F1 2DT1A 3WDPP 1CIUA 4GI8A 1HT6A 4DWSD 2WWCA 1JI2A 3CTTA 1QBAA 1BF2A 1G94A 2A3BA 1MW1A 5DT5A 4AD2A 3TP4A 2FHBA 3BAKA 2D3NA 2XVLA 2D24A 1C8QA 1TVNA 2EO7A 1MQPA 1B0IA 3L4TA 3AIUA 4ACYA 2EPLX 3OZPA 1QI0A 1EO7A 1YQ2A 3WH6A 1G1YA 2WPGA 1MVYA 1VF8A 1KQYA 3KL5A 1G0CA 3WDIA 1PZ3A 3VM7A 1I1WA 5I78A 4WKFA 3W82A 4UZSA 2PF0A 5I0DA 3MV01 4Z2HA 3I3DA 4LYRA 4HZ8A 3W4RA 3SCUA 5IHSA 1EOKA 1GJUA 2FH6A 3QHOA 1H1NA 1HKKA 2J7BA 5CJ5A 3EDKA 3IK2A 3PTQA 5DFAA 2X8RA 4WF7A 2WVVB 5EMYA 3AS0A 3WSUA 3AIWA 2JE8A 2QMKA 3SUWA 4Z2LA 4L4PA 4CU6A 3OLDA 3CBWA 4J3UA 5E0CA 3WD4A 1NWTA 3L4WA 2QPSA 3L2MA 1D3CA 4ATLA 4OKDA 2XVPA 2WMFA 1RH9A 2DGAA 2YA2A 3UG4A 3AXXA 1NWRA 4GZIA 5A6SA 1GZJA 4W87A 3WFZA 1LLOA 1HXJA 1V3LA 2VZUA 3QR3A 4RE4A 4V2XA 4UQBA 2XSAA 1UH4A 3OB8A 1L0PA 4CN6A 4F9JA 1H09A 1EDGA 1J9YA 7TAAA 2E9LA 3WD1A 1UR9A 5M3WA 4P7NA 1PIFA 2IXUA 2W63A 4W7VA 2JEPA 1GNXA 2J75A 4DUXA 4PTWA 3A3HA 3NJ3A 3VOCA 4W7UA 1UQZA 2DSWA 5HPOA 4XB3A 3ZSSA 3LPOA 3NSXA 3AFBA 1A3HA 4JL1A 1C93A 5D4YA 2J8GA 2WC3A 2WZEA 2WC7A 1HKMA 3L2LA 2D0GA 1KXQA 1Q6EA 4UFJA 4W8BA 3FNDA 4FMVA 2OWXA 3FW6A 3ARXA 3POCA 1XCXA 4BA0A 3ZMRA 4DWSA 3BAWA 8CGTA 1GOOA 4BQ2A 3WNPA 5GNYA 1PX3A 4FLRA 1XYFA 1CECA 1XCWA 1BSIA 4FLQA 2WZHA 3VD4A 1UHVA 1V3KA 1E3XA 5A1AA 5EB8A 3WF2A 4W84A 3AHTA 4KRUA 4UFIA 1C8XA 3K46A 1XV8A 2DT3A 1BYBA 1FFRA 1E0VA 1M53A 4P8WA 1EH9A 2E4TA 1J11A 3IJ9A 2QV4A 3A4WA 3VKKA 1UG6A 1E1FA 3EMCA 1XH1A 1HN1A 2ZUSA 1V3JA 1WPCA 5LA0A 4AEEA 1Q6FA 1EQPA 4PYSA 2GJXB 4MPKA 2PC8A 4D6DA 4AZ7A 4EKJA 2YBUA 4IM4A 1C7SA 1OD8A 3AHVA 1LWHA 3GXDA 2D0FA 1H4PA 2YA1A 4TX8A 2X1IA 1VAHA 1CBGA 4HPHA 3AJ7A 3N17A 5GNXA 3WQ8A 2WBKA 4TTGA 3EMQA 5C70A 2V3GA 3APGA 1JZ2A 2D2OA 3WNMA 2YKKA 1SR0A 1GQKA 2GJRA 1G9HA 4B9YA 4U3AA 4BQ4A 2VZTA 3NSNA 1DP0A 1HP5A 3DHPA
chains in the Genus database with same CATH superfamily
4J4KA 1SPQA 3WH7A 4GGHA 1GOXA 1HX0A 2EHHA 3LLFA 2RDXA 1TWDA 1UWQA 4HJFA 2FZNA 1TUFA 2HXUA 5D9OA 3ZFHA 4MAZA 3UCQA 4LVFA 1CGWA 3E96A 2A3EA 4OOZA 3VE9A 1RP9A 1XIEA 3ZVHB 1DVJA 4AB4A 1EC7A 1SJCA 3ALGA 4UFHA 2XG9A 5BZAA 4U2ZA 3RM8A 4US5D 5E1QA 1FCBA 3N2OA 4PA8A 5BXSA 1RBAA 4ALDA 4WEVX 3NO5A 3DFQA 5HANA 3U48A 4GZJA 3M43A 3K8LA 4BI7A 2OX1A 2QUVA 4W4QA 2YDQA 4AEFA 3MUCA 4L7ZA 4TVDA 5A6AA 2YBTA 5AY7A 4J3ZA 3TW9A 1VHNA 2UY4A 5LNVA 3EWXA 4XBSA 1SFTA 1S2WA 4FIQA 2WCSA 4LGXA 1R9XA 3CL8A 2ZUUA 3LB0A 1Q2SA 5AC7A 1NEYA 2ZKMX 2Z29A 4Z42C 4R7OA 1F73A 1TB3A 3FYYA 4I5XA 1ITUA 1EJUC 3TC7A 4Q3MA 3NQBA 3TJIA 1CLXA 2DVXA 3WBYA 1US0A 1YIXA 3LX9A 4GUHA 5FEZA 3QFWA 5K7JA 2PWHA 3OG2A 4V1YA 3QGVA 1L8PA 3UXKA 1V6UA 2X1RA 1PPIA 3CQ0A 3QEZA 2V2HA 3CZKA 3B0VC 1SUXA 3GLCA 3WJSA 3VDHA 3MO4A 3B3DA 2WLZA 2OEKA 1W1IE 1V03A 1GG1A 1N82A 1KA9F 2YYUA 5TF0A 1OK4A 3O63A 1HP4A 1IXQA 3M5ZA 2GJPA 1ZNNA 4LEQA 3WF0A 5CPNA 1XBXA 2PWUA 2VC6A 4HT3A 3KZSA 1JAKA 3P62A 4UFMA 3T44A 3AXIA 4J3XA 4Q8PA 8A3HA 3AHZA 4BF5A 2W66A 4XISA 5F2LA 3GG1A 3A5FA 3FA4A 4ZOCA 4DJEC 4DPPA 4JTUA 4HSHA 3M6DA 2OLAA 1Z48A 3MDUA 4IP7A 4UTLA 1RCQA 3LXBA 3VFLA 3W7QA 1N2VA 2FZ8A 2HCVA 1Q7QA 4NAFA 1HTIA 1V02A 3N12A 1DJQA 2V6AA 3RLHA 1AQHA 3CAKA 4LV9A 1M6JA 5EYWA 4F2TA 1CGUA 4GUGA 3B06A 4D8LA 3UPBA 3B4YA 3T0TA 5DO8A 1BGGA 3NEVA 3QV7A 3W7GA 4Q6JA 3WEZA 2O9TA 2RH9A 5DBUA 1TV3A 8XIMA 4HQVA 1BFNA 4ZO7A 2V30A 3RIKA 4O10A 5L9FA 1ME7A 4CQDA 1TPB1 6ENLA 4H04A 3RPTA 2Z2AA 4UTMA 2BSLA 2VX6A 5G2WA 2XIQA 4I8DA 4PRWA 1VH7A 3VMOA 4NJGA 1QW8A 3ZM8A 1DWGM 5H91A 4GFSA 3CB8A 2GYIA 3WH5A 4HPXA 2IPJA 3OG3A 1QI3A 1QRQA 3W37A 4M80A 3SGZA 1YBQB 3KRUA 3QKEA 3PZMA 3AYTA 3F4WA 5FKYA 2F84A 3PWAA 2GK1A 2WMGA 2OGYA 4DUWA 3EMZA 4JTDA 4DAFA 1JUEA 4JAWA 2FJKA 3QPZA 2OSWA 5FCZA 3TDFA 4BR1A 1W2PA 4ZODA 2QCDA 1U33A 2DDXA 1K77A 3N4FA 3VZXA 3C2FA 3TJXA 4XKYA 4AIOA 3NQDA 3CAWA 3ZJ8A 2OEMA 1I2NA 1SQ7A 3W25A 3VIHA 4AZ6A 3VUSA 4HNVA 2ZWZA 2ZE0A 2J7FA 2RGMA 1W3IA 1GVRA 2CZFA 4M24A 2O7SA 1QK0A 4B2DA 3NQAA 4I5UA 2CLIA 2CZDA 3FKKA 5F1UA 3WBWA 1SZNA 2PD5A 4R88A 5HNNA 3LCFA 4JD4A 1R7OA 3M0IA 1VJZA 3SW6A 1K4GA 3KTXA 3II1A 3VIIA 1W0MA 1N7KA 4O14A 1UWTA 4XAZA 4Z0SA 4E5TA 2YL8A 4JZ5A 5AHLA 1SZRA 1EPVA 4A05A 4US6A 5D8WA 5I5RA 2CLKA 5A6JA 2JF6A 4G7FA 1E15A 2Y62A 3DGBA 2XFRA 1JQXA 1Z7AA 1LBMA 3BAYA 1TR1A 3NG3A 4HZ7A 2B4GA 3BV4A 1MXGA 5DBTA 3U7VA 2EPOA 2Y4SA 2E28A 5E70A 2C15A 2I17A 2PTDA 4H7VA 1WZMA 3LZ3A 5GJNA 3KBMA 1RAKA 3UZXA 3RN6A 3VIMA 4JFTA 2JF7A 3G1DA 2CEQA 3WH9A 1P6BA 4N9CA 5KSWA 2V8ZA 3UW6A 2H6RA 2DJLA 2GVGA 4OVXA 5JVLA 1ZENA 1JI1A 1VEPA 4Y9NA 5D03A 1A80A 3C52A 2CZ5A 4HNTA 2ZDRA 1BRLA 3GXFA 3CIVA 1E0UA 3QBUA 4S38A 2WKGA 1CX9A 1HIZA 1UZ4A 5T9BG 3MI3A 3TC3A 4PMXA 4B5VA 5FF4A 1OX4B 5I02A 4JDYA 3VC5A 2QDDA 3TTEA 2AMGA 4IOTA 3GQYA 5ABFB 5DEZA 3ABZA 3H2NA 3FJLA 4QCFA 4NJKA 3EEZA 5JXQA 5FF2A 1AG1O 3QPEA 1E6PA 4HU3A 2PRLA 4CUCA 3F2BA 1ZCCA 1EZWA 1TELA 4PMOA 2WBGA 1WKYA 1ONWA 1W17A 3WLLA 2QQ6A 4OJYA 1W54A 2OKTA 5HQMA 4UTTC 4WHBA 2XJ7A 3MW7A 2NUWA 2J9XA 1NJJA 1H3GA 3IGHX 1NQ6A 3PUDA 1WB0A 3G6LA 2WVTA 2YLLA 4ZVJA 4BF7A 1Q8AA 1DTNA 2H8ZA 4GBUA 1ITCA 4P2VA 4XZMX 1E1CB 1ZJAA 3GVWA 4ZFMA 2CLMA 3TLLA 2VGBA 4GY7A 1KFKA 4HOZA 2EPKX 2Z1BA 3KM8A 3UA3A 2NQLA 3RPMA 3NM1A 1TTIA 2NQ9A 4CEUC 3TC6A 4DB7A 1X6UA 2GPTA 3V0SA 3ITYA 3WJXA 1T40A 4IISA 1UOZA 4JQ2A 1VBJA 3CO4A 4HYRA 2ZRZA 4LFYA 5A6BD 2AL2B 4KIRA 2OT1A 3ARSA 3LV5A 4FLOA 4C1KA 4WD0A 2KZHA 3IJ8A 4C1NA 2OQHA 4H9MA 1DBTA 2WMIB 2G97A 3D46A 1U5JA 4ADTA 4WKAA 4K68A 3S5SA 4NAEA 3KWXA 1A5LC 4IJCA 3USBA 2Q01A 1I1XA 1ZPTA 4FOUA 1E55A 4HMCA 4MJMA 1GHRA 1ALDA 1QFEA 1EWDA 4NI3A 3T55A 1X8FA 1D3GA 1XG4A 4WJEA 1CPUA 1Z8AA 4E8GA 3V16A 1VPXA 3GR8A 1H1ZA 2CLOA 1XL9A 4JS3A 2G95A 1YTEA 4RXFA 2C79A 3F5KA 2AKMA 3BSMA 4LWWA 1AQMA 3W02A 1EUNA 2PDLA 1AD1A 4MWAD 3R2GA 2QCLA 4U2YA 3CHCA 1JYXA 4ZMGA 3GDBA 1LJYA 4TUFA 3W6MA 2E09A 4XD3A 1W9VA 5E9XA 3FDKA 3R43A 2Z7GA 3IUIA 3QXBA 5D2YA 2WK2A 1JGIA 3S2NA 4QDWA 4RZ5A 4GIEA 1T7LA 2INFA 4AZBA 4K1GA 1M01A 4F0MA 1RUSA 2YCLA 1LLWA 3NOEA 2G3MA 2VX7A 2NSOA 3KW3A 4R5EA 4WZHA 3RX3A 3PSVA 3PF3A 1JEZA 3LHUA 1EB3A 3WNOA 3SUSA 3QOMA 2HWGA 1CXKA 3QC0A 4OBSA 3SADA 4W8LA 2OOGA 5AN7A 5FL0A 3P6LA 1WXJA 1ZHAA 1MSSA 2HBVA 3P80A 3CWNA 4B91A 1MEHA 5I3FA 3PNUA 2FMOA 3B0YA 1JPKA 3LRLA 4V15A 2QJGA 1M41A 1DXEA 1IWAA 4CVUA 4GJIA 1IV8A 4TMBA 5IHRA 2DJXA 4LQ1A 4W88A 2HK0A 3M5XA 1NWSA 1HJUA 1Q6GA 1XRTA 1GOWA 5C6MA 3VC6A 4C7DA 5FJJA 1IT7A 1FCUA 1KCXA 1E9YB 2CWXA 1PIIA 3TMQA 1J10A 2FGBA 2E5DA 2QGYA 3GTXA 5E6YA 1ZL1A 4DZIA 3R0UA 1TVLA 2PDWA 3BGJA 2WAGA 2Y5SA 3PBGA 3HGJA 4BJHA 3NPWA 1UOKA 4PSRA 4URIA 1PWMA 2BGQA 2ISWA 3FHQA 4MWAE 4XZBA 3EKZA 2ONEA 1CWYA 1VEMA 1QWKA 1ISZA 3KL3A 3IIPA 3LBOA 3GDLA 2PBOA 4O1CA 2NWRA 5C9WA 4G2DA 1JPIA 1C90A 4ZA0A 5HA7A 2GWGA 1BAGA 4LYKA 4PCNA 4O19A 3GG7A 4C5ZA 2R82A 4H6QA 4CEXC 5FA5A 2VKZG 3F4VA 1MUCA 2WB5A 2XN0A 3P3BA 4IIDA 3ZLHA 2DUXA 1PCKA 3PZGA 1V79A 3H24A 3RITA 3W1PA 1WA3A 3SN4A 1Z32X 3LYEA 2QS8A 1O6IA 3IACA 2QAFA 3VAVA 3MP3A 1LUCA 1XS2A 2XGIA 3G1FA 3VNJA 4TV6A 3N2XA 4OUEA 5CZKA 1FWDC 3JS3A 2J77A 1RY8A 1H2JA 2PS2A 1KQZA 1RJQA 2FQIA 1H41A 3IGXA 3ZS4A 2UV8G 3UA4A 4X0VA 2OOFA 4ROQA 1H0GA 1V6YA 4ADSA 3BLPX 1FWTA 1WKEA 1LOLA 5GVJA 1IHIA 1YDYA 3KVLA 1FFQA 2IXVA 3LA4A 1E6QM 3PSWA 4QROA 1BXNA 5JBEA 4C6BA 4CQBA 3CHDA 1GW9A 3W2KA 3H55A 4DY1A 1A0DA 2ZFAA 3FXGA 1XJBA 5LSMA 1XLDA 3KRZA 3SCRA 4XO6A 4W85A 2YPIA 3NFUA 4NZ5A 3H4GA 3UG3A 1H51A 1CNVA 4H41A 2OTDA 1OYCA 5FJTA 1QU4A 3UXAA 3MT1A 1XBZA 1PL9A 4F0SA 4O54A 2G96A 4PGLA 2RJHA 1YPXA 4IQDA 1QJWA 3GVVA 4QG9A 3ITCA 2Y7EA 3DFNA 1U30A 1XKJA 4PUUA 4KW2A 1SW3A 1T96A 4ERIA 2UY2A 1TVPA 1AMKA 3LBCA 4LW7A 1KFWA 2V9DA 4IFOA 1O95A 2FZBA 3E9AA 2Y8UA 3W1TA 5U7SA 2PURA 4MB3A 2J13A 1D2KA 3ZQ9A 1J18A 4GRSA 4TV5A 1DHPA 4DJFD 2XVKA 4AWUA 4AC7C 3LHTA 4GHRA 4OUIA 2XWDA 2R94A 1W8SA 4LCRA 2WNNA 2VP8A 4REQB 2HBXA 5TIMA 1ESWA 3ABOA 3EPMA 2E8YA 2PDNA 5HMFA 1DL3A 1TKKA 3NTYA 4JN7A 3C0SA 1UD4A 1FCVA 4FOJA 4FHAA 2E25A 2G50A 3WZ0E 3MKKA 4IXHA 5E6ZA 3S4TA 3W27A 3GS6A 1E71M 1J0YA 2PLMA 1TUXA 4ML4A 1OM0A 3CIXA 4P7RA 3EOSA 5FF3A 3EWZA 3TYCA 2GWNA 3CL7A 5IBXC 3VVGA 5SWUA 1JDFA 2I7GA 1L2QA 1XLFA 1ZBKA 5J04A 2WJFA 2PLCA 3B0UX 4LAKA 1UIOA 2PD9A 4NU7A 4ZOEA 4ZTXA 3DGRA 1KM2A 1MXDA 3QF0A 5LKYA 2WZTA 1MW2A 1PO9A 1ITXA 2HNHA 5FJPA 1T6MA 3JZUA 3MB9A 5MKGB 4FR6A 1OFPA 2VDIA 1QMLA 5HWNA 4C90A 3ECQA 5E9AA 1ADSA 1XFCA 1HW6A 4EANA 2XWEA 4BS0A 1EO5A 2WPBA 4JY9A 1I2QA 3TR9A 4FXSA 3HFTA 1HL9A 3OIHA 5HMDA 4O1EA 5CG0A 4PCSA 1V6WA 4E2DA 3SCOA 1NH6A 4IG2B 3TOPA 5CEWA 2I5IA 2TPSA 2E7FA 5I77A 1ZALA 3NVTA 1C92A 3QR0A 1DE6A 5E0KA 4LSBA 4A4AA 5BMWA 3LD5A 4PL2A 5BYWA 4LV4A 4IHCA 3MCOA 5CAHA 3VGBA 3FN9A 1YNQA 1FX6A 4P7LA 1Y5WA 3EXSA 3UXLA 4N9DA 2QMJA 3MU7A 2ZUMA 1F8MA 3QYSA 1BYAA 4AX7A 1U1JA 1XSJA 4GUFA 3WN6A 4MM1A 2B0MA 5C54A 2ZTKA 3SIMA 1C7TA 2BHYA 4Z2GA 3OZMA 5G1TA 3OLIA 1E5NA 1SVDA 3TCSA 3N2CA 1CXFA 2QLYA 3IEBA 3UJEA 2OKOA 3PZIA 3ZR4A 1PDYA 3QTPA 5CSSA 1VBGA 3U9IA 2VD9A 4RJEA 4Q4OA 2ABBA 1DKWA 3H2OA 5I3DA 4PEEA 4CNOA 3SI9A 1WZKA 2WCGA 3LHVA 4PUEA 4LS1A 4CU8A 1D8WA 1OSEA 2VUNA 3KE0A 4U31A 5IOBA 1W9BM 2DZXA 4M0XA 4OV9A 3VO0A 2PGEA 4HCDA 2BDQA 5BXPA 1GWJA 3SCSA 4JDBA 4XD4A 1TQJA 3MMUA 2WVUA 2WM1A 2H9AB 3C56A 3LENA 1E6SM 4DBUA 3EKGA 3UJRA 4AD1A 3B8DA 6TIMA 4W5ZA 5CG7A 4CCCA 4NX5A 2YIHA 3UCDA 1RR2A 3GRIA 3TONA 4LUIA 3GH7A 1TREA 2WKLA 4B16A 2ASHA 2ZADA 4KRTA 2C0HA 3A4AA 4UTWC 3NIYA 1ZCOA 3SFKA 5IXEA 3HB9A 4O18A 3T2QA 7A3HA 2BLEA 1VCFA 4J9JA 4N0RA 3W85A 4NI8A 2VO5A 4IPLA 2VT0A 2FPTA 4O13A 1LQ2A 1E9LA 1Y5XA 4Q22A 3OA3A 3IIXA 4DF1A 4M81A 2YBVA 4Q7NA 1UZ1A 4N42A 3QYQA 4S1FA 3QFEA 3TNBA 2WHLA 3EZ4A 3LV6A 3O16A 2OPJA 4YCOA 1BWLA 1LRQA 2RFGA 4PUDA 5T8GA 3G2GA 1WX0A 5EFFA 2C8NA 5F2MA 3ONCA 3MYOA 1HJWA 5M17A 2Q8LA 3ANVA 4K37A 2ZRYA 3MS8A 2BWGA 2W3ZA 3CUFA 2AKZA 1OBAA 5FOOA 3BLKA 2QULA 5IFTA 2YW3A 3L12A 1L6FA 2ZICA 1MFVA 4ADUA 4M7TA 1R3QA 3AZSA 4GFIA 3NM3A 4GH3A 2O55A 3G0XA 2DUAA 3A4JA 3GC4A 2X2YA 1L6WA 1XGEA 2EPMX 4O16A 4H01A 4GY1A 4Q32A 1U1HA 4C6OA 3PN8A 2V38A 4QAWA 3WQ4A 3T6CA 2A2IA 2V82A 1LLZA 1R2SA 1XDMA 1EHAA 4FEZA 3VOHA 2CBVA 4AZIA 9XIAA 3NCOA 3H2FA 2ZA1A 3V4BA 5BCAA 4UIOA 1ZJIA 3M7WA 3AS2A 2QCFA 3PUOA 9CGTA 1UWIA 3EB4A 1FUYA 1ISWA 3FAXA 2P8CA 3NQ2A 1B31A 3JZEA 1ZBWA 4E3VA 1G67A 3W0KA 4Y6GA 3APTA 2NT1A 4K7YA 4FS9A 7REQB 2YR1A 4CNTA 1XHGA 2INZA 2YOCA 4U5IA 5DY3A 3A12A 3MSRA 3SQMA 4WSJA 4AG0A 1QNPA 1OT2A 3JW7A 4LBRA 2PDUA 3M9YA 1FHUA 5G1MA 3DECA 4EAYA 2WNQA 3NPUA 4LY8A 2YXOA 1EC8A 5ECUA 5HR7A 3AYSA 4H9XA 4GXWA 3SJNA 4GYKA 1RY0A 3ZWTA 3IWPA 2GOKA 3CK5A 1RALA 2ZQ0A 3CH0A 3TJLA 1UJPA 2ZZ2A 3AXHA 4EXBA 4MNMA 3M46A 1WDQA 3A9IA 1F6YA 5EPDA 1JXJA 2NX9A 3W87A 1XLIA 2ZC1A 4QJ3B 3VPLA 5I24A 3UVIA 5D8ZA 4FPSA 4AD0A 4HN4A 3ZO9A 4AU0A 3W7IA 2XPKA 4YLWA 6A3HA 4LNYA 3OQEA 3Q2DA 2E5BA 1XWYA 3KBVA 2A1YA 4UXDA 1QTWA 3M07A 5HDRA 3TN6A 3E1F1 3P8IA 3O06A 1CIUA 4GI8A 8TIMA 1HT6A 1KD0A 1UIPA 3S2JA 3RUBL 3FEQA 4JICA 5KTLA 4AYGA 2WWCA 1JI2A 3CTTA 1QBAA 4JTKA 4TO8A 4HHLA 2XVLA 1H63A 4DBWA 2FFCA 5H8MA 3P0WA 2G0WA 1QO2A 1JRCA 4YVXA 2ACQA 3AIUA 4R3UA 4ACYA 2EPLX 5I06A 1QI0A 2WJZA 1YDVA 3CNYA 4L64A 4S3BA 3MP5A 3WH6A 2BZNA 1LOSA 2WPGA 3WDIA 1UPMB 4OHQA 1I1WA 4I90A 2LLEA 3W82A 3WFAA 3BW2A 4UZSA 3DENA 2WO5A 5FEXA 3W1MA 4Q4QA 5I0DA 3OQ8A 3I3DA 4RNIA 1R3VA 3SCUA 3LXCA 3FOKA 4GNVA 1TCDA 2NVDA 1GJUA 1GZGA 1XLEA 1HKKA 3OYXA 5CJ5A 5HJXA 3TVAA 2QXWA 2X8RA 2V5LA 5D2XA 3AS0A 3IARA 4J3UA 4LU0A 4N4QA 2WQDA 1TRDA 3L2MA 1KM3A 4KEMA 1TV5A 3STEA 1AJ0A 1XLJA 1F7BA 3DFHA 1R38A 3LNPA 3BOFA 2YA2A 4XD5A 4DN1A 3NYZA 3RPDA 5A6SA 3JU2A 4KBXA 4R9OA 1AK5A 4V2XA 1WDWA 3EWBX 1UH4A 3OB8A 3S9IA 3NGFA 4JTFA 4DXKA 3A5VA 1EDGA 4KPLA 1K1DA 4K3ZA 7TAAA 4JBRA 1CCWB 2CXEA 2E5CA 2E9LA 2Y70A 5M3WA 1POJA 1JCJA 2IXUA 1GT8A 1GNXA 4ORMA 2JEPA 1VFHA 1T0OA 2DSWA 3L5MA 3Q37A 2ACUA 4H1ZA 3ZSSA 3SBFA 4TQTA 5D4YA 1PS9A 2WZEA 3GHUA 4LBSA 5C2GA 3L2LA 1KXQA 1Q6EA 1H7RA 3FW6A 2F9RA 4CNUA 5F4WA 3ZMRA 3W84A 4PB3A 4IGMA 3T40A 1GOOA 1D9EA 3GYEA 3O1NA 1SZFA 5IDZA 4FLQA 4ZGYA 3VOGA 4Y8FA 3KHDA 5EB8A 3WF2A 5LIYX 4GGBA 1S5VA 3W7OA 4KRUA 5A6TC 1XIJA 3UZWA 1G7UA 3NXFA 3S2MA 1KM0A 1E0VA 4LVAA 3VA8A 1XC4A 1NIUA 3PAOA 4FF7A 1J11A 3B05A 1CW2A 3VKKA 3NL2A 3C2OA 3EMCA 1TRIA 3KCJA 2ZUSA 1YE4A 5LA0A 1Q6FA 4HPNA 1TPVA 4H9ZA 3S6OA 3S1XA 3GXTA 4LUTA 4A3UA 1LWHA 1FWFC 1MI3A 2PDHA 3MBDA 2XH2A 1VAHA 1E9ZB 4HPHA 3P93A 3AJ7A 5GNXA 2WBKA 3G8RA 4AUBA 3EMQA 3APGA 1JZ2A 1RCXB 2D2OA 2YKKA 3ERPA 2GJRA 1G9HA 5G4WA 1O1HA 2YX0A 2VI0A 3PB0A 4L4MA 5JIPA 4RNJA 1PAMA 4JX6A 2E0PA 5T9CE 5K9XA 2W62A 3LSBA 3KEHA 3VU2A 3NDOA 1TYGA 2PI6A 4OV4A 2ZUNA 3F2DA 2XZ9A 4JTHA 4RZ6A 1AMYA 3EEGA 3FEMA 3BJSA 5HBFA 4J27A 1D7KA 4PCTA 1VLWA 1ZU8A 3AU6A 2GVEA 4XTDA 3SN0A 2ACRA 1N8WA 4AW7A 4AD5A 3GE7A 4GYPC 2B7PA 1DIEA 3BL3A 3SSJA 1S2VA 3MI2A 1V7YA 2PDBA 3SCWA 1ELSA 1TJRA 2XFWA 5KEZA 4E2OA 2CHNA 3W1QA 4HMEA 3F4DA 2JBMA 1JZ8A 3AMCA 3RM4A 1DIOA 3CZJA 2YB4A 4OGZA 1Q5MA 4GY0A 3QMSA 4YU1A 5GNZA 3MY9A 5KZEA 3CMJA 2C1GA 2ZUWA 3GTFA 3M0LA 1LG2A 4DJDA 2VCBA 3DYMA 3QW4B 3STCA 2YL5A 1RCOB 3P60A 4W86A 4WGHA 4XSMA 2ZE3A 5ABTA 5EL1A 1VFSA 3UWQA 4GPNA 1GOIA 4CNSA 3T08A 3NOYA 3GO2A 3MHUA 1CXIA 2BHZA 3CYVA 4ACZA 2NUYA 1CXEA 1NOFA 1QVBA 6PTDA 1R2RA 2CFFA 2ISDA 3OZYA 1L2UA 1TJ2A 4IQEA 4KWVA 3TV8A 7XIMA 4M56A 2J78A 1KKOA 1X6NA 3IJIA 5AHMA 4O1DA 3ONBA 3BG5A 1CGXA 3NVDA 3ORWA 3SCVA 5CJNA 1CB7B 9RUBA 2PFHA 5I6SA 1P6CA 1LP6A 5MF5A 2XIMA 3BVJA 4LAZA 1PBGA 2BV9A 1F8IA 4RZBA 1RLCL 1ONEA 4M82A 4EXAA 4K6AA 1UWUA 3LTPA 2J62A 3WMBA 5F2IA 1V02E 4B2DD 3H2EA 1YTKA 1UZDA 1GKPA 1H0IA 4PMNA 4ATDA 2GVLA 5C9RA 1T5AA 1AH3A 3LMYA 2OO0A 5A3HA 4QISA 3UWUA 3GY1A 3K1DA 2X0YA 3CV2A 4PR4A 3T8QA 3TKFA 3BGGA 4HNOA 4QM1A 1GGOA 3LHWA 2G37A 1XD1A 4HZMA 2IUZA 3W2NA 1ZAHA 1OY0A 4IIBA 2WW5A 1QPQA 1M7XA 2XYLA 5CSUA 4J3SA 5H2ZA 5FI8A 4BWLA 1W37A 5EBUA 4CU7A 4ZQPA 4AZGA 5I3JA 1JD7A 6REQB 4A3QA 1XH0A 1PDZA 2F8QA 3WENA 3KRSA 4LH8A 4PTDA 4G7EA 3CXOA 2WHKA 2GGGA 3OVGA 1IEIA 1B3VA 4X9YA 1Q6DA 2ZX5A 3FY1A 2OG9A 2HTMA 2VWSA 1DJGA 2REQA 4JN8A 1BGAA 3EWCA 1FWGC 4PCFA 3ANYA 3AYRA 1WBJA 3PVFA 1DQXA 3NQCA 1EIXA 2EKCA 1TPFA 1DEDA 4GNJA 1EEPA 2HRWA 1L6SA 4J5NA 3I3BA 4WY0A 4M1RA 3NAVA 4DWSB 3ARRA 4BFAA 1PE1A 4Q8WA 1JCNA 2VELA 4QIUA 1L9WA 1Y65A 1S2CA 5BRBA 4GCXA 3EPNA 4C6MA 2B31A 1YXYA 3H7RA 2VNCA 2G3FA 1U1UA 4YPJA 3WO8A 2JIWA 5C9XA 3BAJA 1IYXA 1PX8A 2B81A 3TA6A 2VC7A 4A22A 1HJQA 3FJNA 1MO0A 3W1XA 1DJHA 5HULA 1QPNA 1EGMA 3FCPA 3IUHA 4S23A 2UY3A 3S3GA 2ZCGA 4XWUA 2WZIA 1QT1A 4AHPA 5CC3A 4XKMA 4MOZA 2C91A 2F61A 2SFPA 3F4CA 2YDAA 1W3KA 1XBVA 1TIWA 1UR2A 1VS1A 3TX9A 3B9DA 5A8PA 4F8XA 3CZEA 1EJWC 2PU0A 2CESA 2WHMA 3AIEA 4D71A 3AISA 3QSTA 4W89A 5A6KA 1H50A 2YCJA 4L6DA 4RX0A 3LS9A 3AC0A 3CEPA 3F5LA 3NA8A 1XYLA 1MFUA 4X61A 3QH2A 5A2AA 3T8LA 3LTSA 1PYMA 2XSXA 1UC5A 2FPVA 3F1QA 3T9PA 2XUCA 4UFLA 3UU0A 5BU6A 1B3YA 1FWJC 1E51A 1XIGA 5A2BA 3MV11 4IX0A 5FJUA 4HK7A 1KV8A 1A5KC 3GZ3A 5U4NA 4N4PA 3W7MA 4UNLA 5D05A 2DZTA 1BVWA 1AD4A 2Y89A 1SO3A 2E6AA 3PPHA 3LG3A 4H8NA 4ZZ9A 1RK6A 3BOXA 4P7QA 3VGHA 1MQQA 1O12A 1KM6A 2EXOA 3ZLGA 3MKVA 2IPGA 1E5JA 5BU9A 3R8RA 4Z08A 3CAVA 1PSCA 3AWOA 1XSIA 3CHEA 1ECEA 2ZX6A 4H8HA 1TA3A 2QNEA 3EKLA 2DZBA 2ZZ7A 1QNRA 1UWRA 4DNMA 1WBHA 4CCZA 2YL6A 3CS2A 1SO5A 5CH9A 2E77A 3EWUA 4PUJA 5AHNA 3T09A 4NQ1A 1O5XA 2FVLA 4DYJA 4CGTA 3PZVA 1UMYA 5BRQA 2BXZA 3OGSA 3B40A 3CYJA 3OGVA 5DXXA 3RR4A 1O60A 3I68A 4UR9A 1Y7VA 4AF0A 2I14A 4AWEA 3L0GA 3GBEA 1QAPA 4H9VA 4PMVA 4PMZA 2L5HA 2GL5A 3FHAA 1LBFA 3EOUA 1OYAA 5CC5A 3PZUA 2R1KA 4FNPA 1OC6A 3O8AA 4A29A 1H49A 4DWSC 4AD3A 1E6ZA 4DUOA 2WXDM 1SSDA 2GGJA 5I3KA 3VIPA 3H8AA 3IGUA 4HA3A 1NP2A 1XC6A 4ZQMA 4IFKA 3W7EA 1R5YA 4LCSA 3W72A 2VJXA 1K8ZA 3IIZA 4JFSA 4MJ4A 1A0EA 3CZGA 3T4WA 1A5UA 4DLFA 2PLJA 1S5TA 2VVNA 3ARYA 3VD5A 4HGXA 3HA1A 2Z1SA 3PUEA 1O5RA 2HJPA 3O0KA 4YIWA 3A6OA 5A8GA 3KOYA 1W9DM 5KMYA 2RJGA 2Y6ZA 3W2UA 5AZ0A 3MBFA 2BY1A 4IGSA 2AL1A 2Y8KA 4I6VA 5A6MA 2UY5A 1EJRC 1I2RA 4AH7A 4Q8OA 1MYRA 1V6VA 2Q8ZA 4LNCA 1V3HA 3M0KA 4JFVA 2AAAA 3FGCA 1GUVA 4RW5A 3GK0A 1IIHA 4N7QA 1DXFA 3KBWA 2WSQA 2D20A 2VURA 1H61A 4GI4A 4Y96A 3V36A 4AY8A 1J0KA 2MUCA 3B9EA 4QBXA 1RPKA 2Z6JA 1KCKA 1W6TA 2NXGA 5DLCA 5HNUA 1K6AA 5G4EA 3AS3A 1JF6A 2QDGA 3N2BA 4AIEA 4LANA 1ZFJA 3W9ZA 4B5WA 3GU2A 4RW3A 3WJZA 1FH9A 1ODZA 1VR6A 2FDMA 3HTWA 4OU1A 2I9UA 2BGSA 3TAKA 5LIXX 3WF4A 4JKKA 1SM9A 2DSUA 3R0KA 1W31A 4KCTA 3ABXA 3BSHA 2PLKA 4MAVA 3R13A 2GVJA 1DJYA 2YA0A 5CLTA 3COTA 5K4ZA 4PODA 2V5KA 2OLHA 1O5QA 2OYMA 5I03A 2DSKA 2PODA 2YL9A 2WANA 1EPXA 1J8VA 3M0MA 4ZO8A 2XH4A 3VNKA 2HDJA 3LGGA 4M29A 3W7CA 5HATA 3CGTA 5JBFA 2CPUA 3K30A 1B90A 3HM7A 3K2GA 4WJXA 3OU8A 4HYVA 1RD6A 4W9TA 3N18A 4QS6A 2BVDA 3CASA 1FY6A 4WOQA 1NU5A 3QVQA 2FHFA 2HS6A 3U57A 1VIZA 1AZ1A 2OJPA 2CKSA 1SGJA 2QF7A 3L66A 3HF3A 1EJTC 2DPEA 3SCNA 3THAA 5A2CA 4WX2A 4C6DA 1FP8A 2Y1HA 1UW9A 3BOLA 4RNFA 1KCLA 1EJ7L 1LORA 4HU0A 3W75A 1F9CA 3VKAA 3EX1A 3RLUA 4K8HA 3MPGA 5CBIA 2NSXA 1XF0A 1YHTA 3CL6A 2NQJA 4QLJA 2QCHA 3VFCA 1XR2A 4DLMA 3ZJ6A 3RX4A 2VGIA 3TXZA 3AS1A 3GHSA 3SQSA 1ZJHA 1EXBA 1RVGA 2HSAA 2WWDA 2G3NA 1A50A 2XM2A 1XGZA 3N73A 1MW3A 3VXGA 4X22A 5EU9A 1PKYA 4GQBA 3WBAA 1GYLA 1QHZA 2IPWA 3EX2A 4Q7IA 4WKHA 5B7ZA 1PZ0A 2QZRA 3ARPA 3LLDA 1KRBC 3DFOA 1LG1A 4QSHA 3T4CA 2FGLA 2VFEA 4LVBA 3AQUA 3S5OA 3ELFA 1SU5A 4NVTA 4UFKA 4NRSA 2QJMA 2Q09A 1YKWA 1OFDA 4C7FA 8XIAA 4S2CA 3ANUA 4JIEA 3XISA 3UQNA 2QCNA 1M9HA 3LN3A 4LC6A 1SSGA 4TVCA 3A22A 1SO6A 3K4AA 3SIZA 4PB5A 2QPUA 4HA0A 3EBVA 3DDMA 3D6NA 3AWNA 1US3A 1U22A 4TR9A 3FVDA 3W6YA 1MNZA 2ZZ3A 3OVRA 2VEGA 3FK4A 3OBEA 5KZ6A 3KLLA 2BXVA 2NV9A 1K7XA 4IP4A 5F2GA 4PTMA 4E4FA 4QLLA 4OZOA 3TW6A 4L4OA 3N34A 1H5YA 1RSCA 2O92A 1EJXC 3TFCA 2V5BA 4QJ4B 5CSYA 4MF4A 3HQNA 3GR4A 3SQLA 1E43A 3H4XA 3WMSA 1I0BA 4M5PA 5BOEA 4G5DA 5HR6A 3CQIA 5G2IA 1QNSA 1XLKA 2O9OA 4GK8A 3GH5A 4Q8TA 4R7JA 2ZVIA 3AYVA 2EQDA 3EB3A 2ISSA 3VGGA 3WMLA 4ECLA 4QQ3A 3L0NA 3W7NA 4MPQA 3LCXA 4OT7A 2XH0A 2YSWA 1NOWA 1DQWA 2YLAA 4AX6A 1VYRA 4X0NA 1UKQA 3TTYA 4QTGA 4CD7A 3PBUA 1M68A 1PJ9A 2J6XA 3JVAA 4EP8C 3RRXA 4IUOA 4Y9MA 1BTMA 1W1VA 2Z1XA 1R6WA 4DQWA 3B9NA 5GJPA 1GQLA 3M16A 4O53A 4HNNA 5LGZA 3AU2A 4NYUA 4HK5A 1VD6A 3ARZA 3CV1A 4NZ1A 1CGVA 3MVTA 4KWOA 4U3CA 4LOCA 1KGWA 3PAJA 5BW6A 2HPMA 2VUYA 3AO0A 1LTDA 1OCJA 4F0KA 4N9BA 4AD4A 4XX6A 1GYMA 3BLEA 3GC5A 1J5TA 4Y9OA 3I10A 4U28A 1DWIM 2Y61A 2Z4GA 3MTWA 4GJ1A 2CW6A 1TFVA 2OFJA 4GXMA 3EAUA 3BMVA 4EPKA 3U7BA 4JTEA 3V1HA 3NQFA 1GVSA 4H2HA 3W53A 3FX4A 3P5ZA 2E1WA 4KKXA 3WLKX 2P0IA 2VX4A 3R4IA 3ZJKA 1IT0A 5LGXA 1CXHA 3N4EA 4M6VA 2EPNA 2EKGA 2J9YA 3H6OA 4GYJA 4QHRA 3W2MA 1T8XA 4Q4RA 2BASA 3PZNA 4MYXA 1V08A 4UMAA 3ZZ1A 3PJWA 4X9SA 1TTJA 3W7JA 4R53A 4D6FA 5CSRA 1ZP4A 3ID7A 1LL4A 3DI1A 2GDUA 2BS9A 3KCLA 5XIAA 3VCRA 4KWSA 4DXXA 3GR7A 1K9FA 4Y9AA 4S3EA 4HTBA 1SYTA 1YPIA 2JIEA 3QLLA 4JTTA 1O94A 3DOPA 2VVSA 3WQDA 2HVNA 1OZMA 4J7RA 3MZNA 3UWEA 1S3HA 4O0QA 4WOZA 1DWFM 5D37A 5CBBA 3CV6A 3BG3A 4N6EA 5DN1A 4XZ9A 1XBYA 3MMDA 2VDGA 4PMYA 4GO8A 2NUXA 1ZGDA 4UQAA 3OVQA 1VFUA 2IKJA 4NF7A 4WGXA 3VMNA 5EMLA 4WCJA 2I5GA 4XUYA 4R9XA 3NZ1A 3BJTA 4ERGA 1L8NA 3GTNA 3K8MA 3GIPA 1GYNA 3WUBA 1PEZA 1S3TC 4L1GA 2YXGA 4FK9A 1J79A 3EDDA 4LXFA 4CNNA 3ME3A 3HO8A 1H60A 4PBEA 1F5ZA 4UOQA 4CD5A 3GHRA 3XINA 2CU0A 3VM5A 5IM51 1A4MA 3L4YA 1VB9A 3UYIA 2ATSA 2DH3A 1F4HA 2CLLA 4GXPA 3HFYA 5C5YA 2DFAA 4KESA 5T26A 3SEPA 2Z25A 3QZAA 1E1EA 3MUAA 4IMDA 3CEUA 3BARA 3MANA 3BLOA 4H4IA 4RR4A 3PJTA 1X1NA 1VIWA 1Y0EA 1REQA 1JQVA 3O6CA 3GXNA 4UUIA 4X63A 4FX6M 4X3ZA 3RO8A 3TW7A 3VKDA 2XGBA 4TTUA 4JL2A 3UESA 3DU0A 3SSZA 3TUUA 4JPGA 4CQCA 3N15A 3CHVA 4UTKA 3SGUA 1V93A 1R87A 4DVOA 1OG6A 4GI9A 1UA7A 3M0ZA 2DSZA 1PKLA 1JL8A 4C6EA 2XDFA 4H19A 3IANA 4AZCB 1SZEA 1YLVA 1Z42A 3PPGA 4M51A 2Q3OA 1K9DA 1S1RA 2GUBA 3REQB 4CKQA 3VIGA 4MWAB 4LPCA 2A6NA 1IWBA 5J5DA 3PP7A 1EWEA 4DO6A 1AODA 1VJIA 3EA1A 1TJ0A 3JRKA 2GJNA 4HK6A 4L9XA 1I75A 3QHMA 4D6CA 2WVVA 1PCWA 3LQLA 3A9BA 2DSVA 2PDGA 1TZ9A 4N02A 1UQYA 1W5QA 3P2VA 4S3KA 3IGSA 3UZJA 2W4XA 1QO5A 4EXQA 4UMBA 3GG0A 1WP6A 3SDOA 3AIQA 3QHNA 2JEQA 4PSPA 1C3FA 2QCGA 3WQVA 4K7VA 2J7HA 1DWAM 4H8VA 2WQPA 2QCEA 3N6JA 4KH2A 2J7DA 1DV7A 1WDDA 4DRSA 3LU2A 3L4XA 2DP3A 3WL0A 3RCMA 1J6OA 1B4EA 3VIOA 2DV0A 3AHYA 1YADA 3WK1A 1OGSA 1R7AA 1PKMA 1W1A1 4S3CA 5BXTA 3OJGA 3CUJA 1VRXA 2VRJA 4KCWA 1UD8A 4GVHA 4O1BA 2H90A 3FKRA 1V0KA 4YVVA 2QYGA 4C6FA 4X2RA 1TSIA 2ZX9A 3N6QA 4AWSA 2YFOA 3OA5A 5CPQA 1R3SA 5IFPA 4PBFA 1AZ2A 2XH7A 2HZGA 2X2GA 1UP0A 1SR9A 3NZQA 3GXIA 3UZYA 2R24A 5AC5A 1PZ2A 3FV9A 3GTIA 1Q63A 1RK5A 5FJIA 3FS2A 5C0QA 2X09A 3SRFA 3L4UA 4KCVA 4IMGA 2ICSA 3S5NA 3AOFA 3VDGA 4J35A 2J8FA 5DCBA 1AL8A 5LZLA 3IJDA 1YNYA 3KTCA 3OHIA 1W1YA 2BG5A 1HKIA 1OX5A 4J40A 1Q3NA 4ZSTA 3PFMA 4PFHA 3GG8A 1G01A 2Q3RA 4GKTA 1E73M 4JFUA 3BGAA 4EVZA 1H11A 2OLSA 2R1LA 4CQAA 4MVAA 4O57A 3QY8A 4H8UA 3GXMA 3UF9A 2GJXA 3GH4A 1WAWA 2OODA 3NL5A 5JIWA 5CPSA 4KWWA 1MDRA 4F40A 3S2CA 3LCWA 3E02A 4DJEA 2HNEA 3KLKA 3NYDA 2Z0IA 1FXPA 1AFSA 3P5YA 2Y7GA 3DBPA 2BHUA 3VGEA 3NQEA 1OEPA 4H6KA 3URQA 3TTQA 4MWAC 4KS0A 4TMCA 3T0DA 2O7QA 2YCIX 4QSFA 4MJZA 3P81A 1UROA 3C61A 2PGWA 1RA5A 5CPOA 4PTXA 4PUWA 1KFJA 1WKFA 2ZRXA 3TAOA 1DXIA 1KBBA 4LX4A 3MMTA 1R3YA 3D0CA 3ZVHA 2I16A 1OFQA 4KEZA 1GHSA 3M0VA 4B90A 3GFYA 2WMKA 1ISXA 1GOMA 2CXGA 3LOTA 3I4KA 1XW8A 4JN6A 5F4SA 3DERA 2CC0A 3IJ7A 4E4PA 1ISYA 2YXXA 5G4HC 3KS5A 4IZGA 3W88A 3SGGA 4CN1A 2NXHA 4ZXLA 1HJSA 1P48A 3U4AA 3NPVA 1O7AA 4F48A 1CGTA 4DYEA 2E6FA 4HPGA 1X6LA 1IR2A 1EBHA 3QKZA 2WJEA 2F7FA 1K03A 4ROPA 3O9NA 3S2LA 4FB7A 3EDEA 3OODA 3BE7A 2CBJA 4RDYA 3CMFA 1TV8A 3WUEA 4PCPA 4GO9A 2PZNA 4EAMA 3QV6A 1W3JA 2JKAA 4O1AA 2J47A 4DXVA 4XIMA 3PJUA 3ZT5A 3WY1A 2R1PA 2WHJA 2R6OA 4GIYA 4H9TA 3RR1A 1NDYA 3GW3A 4IUGA 1TMQA 4D72A 3VIFA 2CNCA 4WR3A 3EX4A 3OBAA 2ZBTA 1LF1A 1W5OA 2PRHA 3IAPA 3N4AA 2J88A 3UPWA 4A21A 1K3UA 4O50A 5TQLA 2GQ9A 1S2UA 2GGIA 2YCEA 2I57A 4HSNA 4O11A 2A3BA 1MW1A 1BKSA 2QAPA 2X30A 5DT5A 3TZFA 4AD2A 3PG9A 4M3PA 3BAKA 2RKXA 4DI9A 3E6EA 4ENLA 1XLCA 4IWWA 1TVNA 2EO7A 5D04C 2ADAA 3PY2A 4XAPA 4QDPA 2HEJA 1EO7A 2Q02A 3HG4A 2VYOA 1YQ2A 3EGJA 1G1YA 4RCXA 3IV8A 1KFEA 3TWAA 3KL5A 2X7WA 1PZ1A 1PZ3A 4RNHA 4DO4A 3VM7A 5I78A 3G1XA 1VYSX 2C71A 2PF0A 1FDJA 3MV01 5G1YA 3CQKA 4HZ8A 4C6NA 1M7OA 3W7DA 1OC5A 3BWWA 5AKQA 3DXIA 3TLQA 2FH6A 3QHOA 2F6KA 3NZRA 1FWBC 5CGQA 2JE8A 2QMKA 4HNUA 5D2TA 3W1LA 3GSMA 3OLDA 5E0CA 5HUOA 3L4WA 2W6RA 4GMEA 2QPSA 1XINA 3APYA 5C55A 1NDZA 2XVPA 4NZ3A 3PBWA 4LF2A 6XIAA 2DGAA 2GSHA 3GVGA 2UZ9A 3KP1A 1W3TA 3WFZA 2AGKA 4DBEA 1HXJA 1LDCA 1V3LA 3O15A 4AY7A 4UQBA 2XSAA 2NQHA 3GHTA 4BK9A 4DO5A 1L0PA 1P7TB 4PTNA 1XM3A 4XO7A 3WLJA 1VC4A 1F3EA 4ASTA 1UR9A 2R91A 3C8NA 2W63A 4W7VA 4FXRA 4RPPA 4DUXA 4PTWA 1F76A 2ZVRA 1X39A 4W7UA 1UQZA 4CQ8A 5DY2A 3NSXA 1KNWA 3AFBA 1C93A 2WC7A 4WSHA 3LCGA 1X97A 2E6YA 1EUAA 5K4XA 3FDGA 4UTTA 4W8BA 4JNMA 2ON3A 2DZSA 1YMYA 1EJSC 3H22A 1YBQA 2PF8A 2TRSA 2WSYA 4GISA 1GVQA 4QG8A 5GNYA 1PX3A 4FLRA 1VP5A 1XYFA 3DI0A 6ALDA 2WZHA 3CO8A 4DJDD 1UHVA 1V3KA 1J4EA 3VD4A 3GU9A 3BICA 1KO0A 4O52A 4QX4A 1QDSA 3SY8A 4NKCA 1XLHA 1FWEC 3K46A 3URNA 1XV8A 4L1XA 4ZQRA 2A85A 1P0EA 1EH9A 2E4TA 2XGZA 3IJ9A 2QV4A 1E1FA 4PC8A 1UP3A 2ZYFA 4XBJA 2PGFA 4DX3A 1EQPA 4MPKA 1K02A 1A5NC 2XINA 2YBUA 3E0WA 4IM4A 4QS5A 1C7SA 3ZVIA 3AHVA 1R9ZA 4YS1A 4DJFC 2PDIA 3IK4A 2D0FA 1H4PA 2YA1A 4ZSUA 1A5MC 2X1IA 2JGYA 2X16A 3KUMA 5AHFA 3GWQA 3GXPA 2Z00A 4E2BA 3STPA 3WQ8A 4YYFA 1Z6KA 3WNMA 2PE4A 3R89A 1GQKA 4MSSA 4G1KA 1KRAC 3EX6A 2VZTA 4ZOAA 4O28A 3NSNA 4Q4MA 2WV8A 1DP0A 4FR1A 4I9JA 4IT1A 1QI4A 2FKPA 1HF6A 4V27A 4D6GA 2C18A 3SY1A 1FBAA 4H2CA 4YTRA 4NT0A 2UBPC 5I3GA 3VTRA 5E5CA 3WIJA 4ZQOA 4UTJA 1OIFA 3RU6A 4EPBC 3BMWA 3P61A 2PDYA 1A5OC 1M04A 1THFD 1BPLB 1IZCA 1YYAA 1GJWA 3QC3A 4G9PA 3L65A 1HO1A 2YZRA 3GZAA 2J7GA 1PTAA 1OFEA 1RXOB 1X1ZA 2OEJA 1K9EA 5LIUX 2OYLA 3ARVA 1MRQA 3EYPA 1E9IA 3WUFA 1DTUA 4GE8A 4DZAA 3T0CA 3UGVA 4POCA 1NFPA 1TE6A 1F2JA 1EOMA 3UZ5A 1FWRA 3DFYA 1MZRA 1TPC1 3HQPA 3V18A 2CLPA 3MUY1 2Y5EA 2OXNA 5DMMA 4FNUA 4WUIA 4AXNA 1OX4A 3NQMA 4FA3A 2B7QA 1XD0A 4E8CA 3V0TA 4DZ5A 1UZHA 2Y24A 3RCNA 5D2WA 2BVWA 3LXAA 4UOZA 2FZDA 5LXEA 2X42A 3TQKA 2HE8A 1LROA 2PTXA 1M03A 5CBJA 1Q45A 1OHLA 4YHGA 3PANA 5I3IA 2QEZA 1EFZA 1TV7A 4RDZA 4NX0A 2WOQA 5I00A 3TYBA 2QPXA 3GDRA 3N29A 3NWRA 3D3AA 3WBXA 2WSKA 1MW0A 1OQFA 1H5VA 1W5PA 5M2FX 1S1PA 3L67A 4AMAA 4E8DA 2RDWA 1A49A 5LHEA 3BMXA 4Z2IA 1Y8BA 3WDRA 1AJ2A 1HJXA 4B3KA 5K2ZA 1G4SA 2ZXAA 3EOEA 3TTOA 4HU4A 2DW7A 3I4EA 1SJBA 4GQRA 2G41A 4HIBA 3O05A 3TYEA 3UCCA 3CC1A 4IPJA 4Y2WA 1GOQA 5A69A 1V7AA 2QF8A 3AAMA 1MRAA 2GSJA 3Q58A 2X0SA 7ENLA 4L9YA 2AL2A 2D2GA 3A24A 1J0IA 2CBIA 2QT3A 4A3HA 2QV5A 3W2LA 1TIMA 3WQWA 3ZT7A 2VTFA 1TZ7A 3V75A 4R7WA 3GD6A 3HV9A 1EP1A 3WQ5A 3LK6A 4FLSA 3DX5A 4LUJA 5XINA 1JDAA 3DESA 5C71A 2WMIA 3AXMA 3WK3A 1XISA 2YZ5A 3UFYA 9XIMA 3VNIA 5CQ1A 2ODOA 3E5PA 3L4ZA 2OSYA 3G1AA 4UQEA 1S5MA 3UZZA 3H26A 5HWJA 4AISA 4AMCA 1HQTA 4HMNA 1I4NA 1S46A 4NHVA 4JX4A 1WDPA 4DO7A 5D33A 3W2JA 3HMJG 1B3XA 4NP7A 5DT7A 1SFLA 4GOAA 1EA9C 1KKRA 1C8VA 1SW7A 3BLFA 1ITQA 1TPEA 3N04A 3MCNA 1R30A 4OECA 5EGRA 3W86A 3CB3A 4ONVA 4BI6A 1POKA 4J3WA 4M8UA 5CC7A 2AGTA 1IZKA 4ZCWA 1EBGA 4JFWA 4XAFA 2BX7A 3AICA 3W00A 3QMRA 4Z2JA 3AIVA 1KRCC 3CQHA 2DORA 4Z1AA 3TXVA 1QK2A 4DYKA 5C7VA 3WELA 1V0NA 3ICJA 4TXEA 8RUCA 4KWUA 1LT7A 2PDMA 3E0IA 3IIOA 2PDXA 4FSAA 4MJ2A 4IH3A 1NF7A 4XQ6A 3WH8A 1TR9A 3W26A 3C8FA 2ZXDA 3MQTA 1W5NA 1G7VA 1KCZA 2ZDSA 4KETA 3SECA 2IPFA 3WQ6A 1NDWA 3H7VA 3OLEA 4J28A 4NRRA 3W7LA 4NJHA 2INEA 1F3WA 3RX2A 3A4XA 1BVNP 2VEKA 1B30A 2F2KA 1MXSA 4PMDA 1P1MA 1TCMA 4YXGA 1D3HA 3AJXA 1WXZA 3P67A 2ZUVA 1XH2A 2VFIA 3QOKA 3RM9A 2AAMA 3PWGA 3BV7A 4U33A 2BTMA 1TX0A 5A8MA 4NASA 4AWTA 2BBFA 3MKCA 4V33A 3H21A 4B92A 1LQ0A 4MGGA 1TJPA 1HJVA 1W5MA 3LLXA 3EDFA 1EX1A 1WO2A 1XCFA 3G1YA 4AAJA 1E6RA 3L9CA 3PZ9A 4K1WA 4YWIA 3LBMA 1V8EA 1Q6CA 2E3ZA 2ZZ1A 1CENA 3S9YA 1XUZA 1BWKA 4JTCA 1YX1A 3QQWA 4KGLA 3ARWA 1TMLA 4XAGA 3Q67A 2IKIA 1AQFA 3GVQA 1FHDA 4JNYA 1NWUA 2BNJA 1XQKA 1ME9A 3O0FA 2VFGA 2O4MA 2Y7DA 3CV7A 3C86A 3L5AA 5IBXA 3CWOX 3I7SA 5C2CA 1IQ8A 2V5JA 1VFTA 4GVIA 1JFHA 3I7QA 4XZIA 4L65A 2PDCA 2XVNA 2XN1A 1JRBA 4XZWA 4XTIA 1E4IA 3LGDA 2IMRA 5EBAA 3V1PA 3VNZA 3NEHA 4H83A 5AB3A 4CLMA 1OB0A 3CUZA 3LEPA 2A7RA 5JBDA 1JVNA 2VOTA 1UBPC 5D9MA 5I23A 3NL3A 4GINA 3R10A 1YW1A 2FVMA 3G0UA 2BY2A 3DHFA 3CT2A 1MDLA 3C5QA 3RJYA 3SRHA 2VC9A 3TMLA 3RLGA 1F6KA 3HV8A 4D6HA 4YTUA 2W9MA 4RE3A 2P53A 2VQTA 2X05A 2PWVA 4JXCA 3WYZA 4IIEA 4AIBA 1JZ7A 4MLRA 3WK0A 2FLIA 3TTSA 1JDCA 1FTXA 3E0LA 4S3FA 2C14A 2P5NA 2DU2A 2VOMA 3WQFA 3ES7A 4WXYA 3DN5A 3HPFA 1ZQ5A 1GORA 3R7MA 3WK2A 1LBLA 2NX3A 1GVFA 1HL2A 3DH7A 4XD6A 4PMJA 1YDOA 4AQLA 2MNRA 4J3TA 1OGGA 3PPCA 3W83A 3C6CA 5EFDA 2WVSA 1ZZMA 4D1IA 1F4AA 3TZNA 4LYPA 4IMEA 2BODX 5KZMA 1A47A 1TPH1 5F7UA 4UQDA 2P8BA 2V5DA 3N2MA 1BD0A 3W71A 4ICNA 4C6QA 5DQPA 3OPSA 4ZO6A 1JDEA 5DCDA 4Q7BA 4YCPA 3VZZA 2VD8A 4A8RA 2FHCA 3DEQA 3LHZA 3DC8A 3A13A 1OD0A 1GKRA 4Y90A 3I7RA 3VD7A 3VKJA 1E70M 3I6EA 3QMTA 4NAFB 5HQLA 2GQ3A 3E12A 1KLYA 4REQA 1QOPA 3G8EA 4IGHA 5LNRA 5ENLA 1DYSA 4EF8A 3RMJA 1JYWA 1KXTA 3XIMA 1H7PA 5EMUA 1FRBA 4BZYA 1P43A 4GQ0A 5A8QA 1XGDA 2QIWA 3SFWA 5D32A 1BEUA 3R1ZA 3B0PA 1KW1A 3LMZA 1NP0A 3G6MA 3WD0A 3S1GA 2PDKA 3V35A 3HQOA 3P74A 3N6HA 3VX0A 4Q4KA 1E3ZA 4J3VA 3UG5A 2DVUA 1DOSA 5FF7A 2CIPA 3VOIA 3EX3A 1Z3NA 6CGTA 4NSBA 1W9UA 1DHKA 4UTWA 4XUGA 3DHUA 2HS8A 3QGKC 4FNTA 2OT0A 3UERA 1K4HA 3UT0A 1TV2A 3RRAA 4Q8MA 1AW2A 3UG8A 3G0SA 1VCGA 4RL3A 1AJZA 3MMWA 1WCGA 2H3DA 1V77A 5HNTA 3DHDA 4JKMA 4TU1A 4QFUA 2Y88A 2DZUA 2XIBA 5MKGA 1B3WA 2GK1B 4B3LA 3T81A 1PB0A 5FEPA 4QEEA 5DMNA 3LDVA 3EXRA 1PV8A 4GWEA 3IRDA 3PNZA 4KEVA 4UOJA 4OIFA 2QCDB 2Z7KA 3PJXA 3AMGA 1IF2A 2DIJA 3WNLA 3KOXA 1IIGA 4YNGA 1J0JA 4K8EA 4XKYB 3CPUA 4F4RA 2E9BA 3HMCA 1JUKA 2VCAA 4MNJA 2VM8A 4F2UA 2C6QA 2DH2A 5D09A 1XYBA 4IG2A 2PMQA 1FHLA 2FFIA 2GOUA 3AI0A 3OO2A 2NW0A 1RQHA 1L6GA 2A21A 4HOWA 1JCMP 4E6MA 4RZ4A 4JR5A 3OEXA 1BG9A 2OMAA 2G5WA 1KC7A 4R27A 5D30A 1UKSA 1R86A 4S39A 2CWNA 4P8XA 3VNDA 1BQCA 4GZEA 1UKTA 3VIKA 2QR6A 1RQBA 2V81A 1KM5A 4QXIA 3M7SA 4I5RA 4KEUA 5FESA 1Z69A 1NSJA 2OSXA 2VFHA 4H7ZA 1MMFA 4QEHA 1RJPA 4FXJA 4AEOA 3S8HA 3NDYA 3HURA 1UR8A 3SO7A 1RVKA 3VX1A 3OGRA 3L2IA 3AALA 3KL0A 1O4UA 4I7UA 3GTHA 4IJRA 1Q7MA 4KFOA 1LRNA 2XIIA 3W1AA 3IVSA 4NUWA 1G6CA 3OBKA 2OGJA 3PZOA 3TQVA 3OW1A 2QHAA 3GBDA 4ZB2A 3E2QA 2ZZ6A 4LC8A 3VE7A 4GI6A 5A8NA 3IJ6A 2DEPA 2FVKA 5LIWX 4MHBA 5DCEA 3L0KA 4Q8QA 2H9AA 4EACA 1BRLB 1T41A 3TA9A 1CB2A 3ZR6A 3BCDA 1LL7A 2GFTA 4QR6A 4MFEA 1Q85A 1WUEA 3LSCA 2QKFA 1DJIA 4P8VA 3W7PA 1E4MM 1ZBCA 3D3FA 4HA1A 1WZLA 4IPIA 3RJXA 4MMWA 1AL7A 3R8GA 2NV2A 3ITTA 4AFYA 1LWIA 4LAOA 1E0WA 1FKWA 3BANA 1ZBVA 3LERA 3UJ2A 4CNPA 3LRMA 3KAOA 2CCRA 3HIJA 1JPHA 3ABSA 3H2CA 3WNKA 1P0DA 3VKCA 1ISVA 2Q6ZA 4Z0JA 3S42A 3CZLA 4GZ7A 3LTYA 4C1LA 3NQ7A 3W73A 4A3RA 3NUKA 1JG9A 3E2SA 3S47A 4NZCA 2VWTA 2IKGA 4HYWA 1UWSA 1QI5A 3ISIX 2JK2A 4OOUA 4QDMA 4GCAA 2J24A 4OBTA 4FX8A 1CLVA 4HU8A 4MNLA 2QCMA 3GIQA 5C9ZA 1QASA 1UD5A 4DIAA 2J9ZA 1BF6A 2ZX7A 3L21A 3MWAA 3OZOA 4GLEA 1MEIA 3OP2A 3VDAA 2XIOA 1FWCC 3TU9A 1IGSA 3L23A 1XYCA 3PTKA 3GW0A 1F74A 3BZGA 3CTLA 3A23A 4XAYA 2O56A 3SAZA 2Q8XA 3R94A 1EKOA 4DM1A 4J2PA 1RP8A 1FH8A 4QJ1A 4JHZA 4C91A 1IEQA 4L4LA 3MI6A 2WM0A 1ML1A 2ZOXA 3D5HA 4FZIA 4PB4A 4C1NB 1WAUA 3UNTA 4Z2KA 1KR0A 4LEFA 2QVHA 2DZAA 4GQQA 3C2VA 4LS2A 4EPEC 4NAEB 7TIMA 2WJDA 2KX9A 4LVGA 1XI3A 2Z28A 3GX9A 2P88A 1V51A 1XPYA 5DANA 1DJZA 4XV0A 3R79A 3FIGA 2PDQA 3ALFA 3S6TA 3ARUA 1YXDA 1H1YA 3KOZA 3NQGA 3WUGA 3WEOA 1E6NA 4UWMA 4Y7EA 3ITLA 5A5WA 4AXKA 2J66A 3UWZA 1W9XA 2W91A 2XU2A 3RU8X 4H00A 2OX4A 2ZUTA 2ZZ4A 4Y8EA 3UPMA 1IEXA 2BMBA 2P