2WHJA

Understanding how diverse mannanases recognise heterogeneous substrates
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
308
structure length
308
Chain Sequence
AGFYVDGNTLYDANGQPFVMRGINHGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKMVAVVEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIINIANEWYGSWDGSAWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSIHDYGQDVFNADPLKNTMFSIHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEETGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKPSTVFTDDNGGHPEPPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MANNANASE
publication title Understanding How Diverse -Mannanases Recognise Heterogeneous Substrates.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 125
structure length 308
sequence length 308
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2whjA00
5FL0A 5IHRA 4HZ6A 4C7FA 2A3BA 3CZKA 3W24A 4EANA 1ISWA 2A3EA 2WHJA 1CTNA 4L4OA 1CXHA 3THCA 4CD7A 2WSPA 1ZBCA 1CGXA 4CD4A 3GYCA 1V6XA 4AY1A 3ARRA 2WC4A 1EQCA 2VOTA 2VR4A 3OGVA 5CLTA 5AYIA 3IJ8A 1W91A 2ESCA 3SCSA 5LA1A 2PBGA 1E4MM 1MXGA 4TX8A 4Q22A 1V03A 3OLEA 3DHPA 4QLKA 2AAAA 5I3DA 2JALA 2WM0A 2G8ZA 4PMZA 2ZICA 3VGHA 1JF5A 1RP9A 2X8RA 4ZEPA 3L2MA 3NYDA 3VU2A 2DSZA 1E71M 2ZUWA 5HPCA 1GQKA 3K8KA 1JD9A 3HN3A 2X2YA 1O6IA 1WCGA 4J3XA 1QW9A 3WIJA 1ZBWA 4HA3A 5GQBA 1B3WA 4CD8A 1LL6A 4NI3A 1NWTA 1M03A 2J4GA 2ZXBA 1ZBVA 5DF0A 4ZXLA 4C7GA 4ML4A 3WMBA 3HU7A 4IUGA 4HA1A 5JIPA 4JFTA 1PIFA 3F5LA 2DPEA 2J79A 4GXPA 1PX8A 4UOJA 1A3HA 4WF7A 1UR1A 2ZXDA 2D0GA 4HMEA 2E9MA 3ZT7A 5M5DA 4W5UA 4MDOA 4LGXA 3MMDA 1KCKA 4WKHA 3DYPA 4J3SA 2V5CA 4JIEA 5CPSA 1QW8A 4JFVA 3WD3A 5AC4A 1MFVA 1WNOA 2Y5EA 3MS8A 5EMYA 3WUFA 3AHTA 3QGVA 4FLOA 1XCXA 3EMQA 3FNDA 1MW1A 1LL7A 1UH4A 4W88A 3TTSA 2BS9A 4UZSA 3M07A 4M80A 5C71A 2WYSA 1PJ9A 2DGAA 2OWCA 3T2OA 1C8QA 2WHKA 5C70A 2DEPA 2EEXA 1IT0A 1MXDA 3VIOA 4YHGA 3APGA 2GJRA 2Z1KA 3OGSA 1Q6GA 1JZ7A 3L4UA 4AZ6A 2XHYA 2VVNA 3CZLA 2QHAA 2DT2A 3DYOA 5CSYA 1E4IA 5D9NA 2DH2A 3N12A 4AW7A 5D8ZA 4ZFMA 1WAWA 4XV0A 1JZ3A 2JFEX 4Z2IA 5DMYA 1XSJA 3WEOA 3B9DA 1CGYA 2YDRA 1HF6A 3IJ7A 1V0KA 3QR3A 1TFVA 3RILA 2VO5A 3ARVA 3WNMA 2X1IA 4QFUA 4PMQA 1UKSA 2VI0A 1JXKA 4OUEA 1W1VA 5JUVA 3EBVA 3WKZA 3WNOA 1U2YA 1M01A 1J10A 4ZE4A 4JHZA 3WDJA 1XYFA 1DHKA 3VPLA 5CG0A 3U7BA 4UQAA 1W9DM 4CU7A 2G3IA 4CCCA 1ZJAA 4AZGA 4Z2LA 4AMCA 4JKMA 4KRTA 2J25A 1BYCA 3IANA 1OD8A 2W61A 1HN1A 4BQ5A 2WMKA 3UEQA 4ZXOA 3RM4A 1QNOA 4PMDA 3RO8A 1K9EA 3WH7A 1H11A 3KWXA 1EDQA 1QI5A 4PTWA 3AHVA 1OWQA 4U31A 1CGWA 2IXVA 4PCSA 1WZKA 3FY1A 1JF6A 3WQ6A 2DIJA 2XSBA 2WWCA 3N15A 1J11A 1PZ3A 4S3JA 5D8WA 2RGMA 2WPGA 1BQCA 4C7DA 1LLOA 4GI6A 2UWFA 1I1XA 3BSHA 1OINA 1R8LA 2W67A 1H0GA 4P7QA 2G41A 4B9YA 4BA0A 5BXRA 1XD0A 3BAKA 1I75A 4W93A 5IFPA 2VRKA 2VNCA 3WUGA 1V3JA 1WDQA 2XIIA 2ZUNA 1DWFM 4AZCA 1UZ4A 2WMHA 4AC1X 3M7SA 2EPLX 1PAMA 3BMVA 2QPSA 4W7UA 1CIUA 1TMQA 3ZJ8A 3WSUA 2PB1A 3AXXA 2FHCA 3FXYA 2NW0A 1CWYA 2O9OA 1NOFA 1BYAA 1QBAA 3ARPA 2J75A 4TOQA 3WD4A 1FH9A 3AZRA 3AIBA 1JDAA 5DO8A 5HXMA 1KR1A 1TR1A 3IAQA 4UQDA 1Q4NX 1VAHA 2E8YA 5CJ5A 4J27A 3VDHA 3W6LA 2YL6A 3T08A 1GOOA 1VEOA 2WBGA 1JAKA 1E6XM 1B1YA 5ABGA 3WELA 4MPKA 3N11A 3I3BA 3RJYA 2JE8A 5FD0A 1UD4A 1NP2A 1AMYA 1H1NA 3WFLA 1SMAA 2XVGA 2D0HA 2J7CA 4HOXA 3GXDA 1ZB5A 3SUTA 2V3FA 1GOIA 1CENA 4GZEA 1HVQA 2CETA 4M82A 4MJ4A 4UOQA 1QI2A 2FHBA 3NUKA 4MNJA 2G3MA 3AMGA 3MUY1 4Y7EA 4MADA 1G5AA 4H7VA 1J0ZA 1UWQA 2FHFA 1CZ1A 2OYLA 1KWKA 3T0AA 1GJUA 3MU7A 3A4WA 4DWSD 2D2OA 3LPPA 4URIA 3WUBA 1C3FA 2WVSA 2XIBA 3AI0A 4JAWA 1BG9A 2XVPA 5I6SA 5D9OA 3WNPA 3CMJA 1N82A 3WENA 3N18A 1UUQA 3K4DA 1UD6A 3VO0A 2CKSA 4MJ2A 2WSKA 4AWEA 2PWGA 4EKJA 4CVUA 1JNEA 3MUIA 1GOMA 1E5NA 4PMNA 1QI0A 4AIOA 2DQXA 3GXIA 1J0IA 3BAIA 5BXTA 1F4HA 1UH3A 3W25A 4PRWA 1W3JA 2EPKX 2GK1B 2D1ZA 1AQHA 2CNCA 2J7EA 3MO4A 5A6SA 2UY5A 4FLQA 3TONA 4AXNA 3ZQ9A 3EDEA 3WH5A 2XJ7A 4HU8A 2QPUA 1Z32X 1HJVA 1H2JA 4UFJA 5M3WA 2CIPA 3WH6A 3GNOA 3AIQA 2EPNA 2CESA 1OT1A 3WQWA 3U57A 3U5UA 3WUEA 1PBGA 1R86A 1UD8A 1BPLB 2YL5A 3F4VA 2CBIA 1OD0A 5BXPA 2J7DA 3PZMA 1CNVA 2ZXQA 2VCAA 1J18A 4FF5A 1ITXA 2XSAA 2V38A 2XUCA 3J7HA 1JGIA 1W9UA 2J62A 1HKMA 2ZUTA 4F66A 1W1TA 2WZIA 1CECA 1OBAA 3WH9A 3FHQA 4UTFA 3CUGA 4PMVA 5BROA 1MWOA 1R85A 2YDQA 4H8HA 2ZIDA 2WMJA 2CITA 5D9PA 3M6DA 1H49A 2VT0A 2V3GA 4DUVA 1S46A 1L0PA 4UQCA 3VM7A 1DWAM 1OB0A 1HJXA 2UY4A 2GDVA 2WKLA 3AS3A 3OZOA 3ARWA 3CIVA 4J3UA 1CDGA 1E6ZA 4AZ7A 3D3AA 4P8UA 3DC0A 2VX7A 2XFYA 1DTUA 5CPTA 3AQUA 3WMSA 1O7AA 3VD9A 3RM9A 2WMGA 5A8OA 2J8FA 1LL4A 1HX0A 2MANA 4MNLA 1SMDA 3PBGA 3VMPA 5ECUA 3VGFA 4PTXA 3CLWA 4D6JA 3VNZA 4QAWA 4KWUA 4HOZA 5E0FA 3WNLA 4WJXA 3GDBA 1QNSA 4LQ1A 1TE1A 1VFUA 2UY2A 3RMEA 3SUSA 3GH5A 4PUDA 5EFDA 1ZU8A 3W82A 1WE5A 4RL3A 2X0YA 5LA2A 2QLYA 1EDTA 1E1EA 4W87A 5GNZA 1V6VA 1M53A 3ZR6A 3WDQA 1PX4A 4HZ8A 2J78A 2OYMA 2Y2WA 4W89A 1C7SA 3SUUA 4UFIA 3THDA 3OLGA 3BC9A 1UZ1A 1XHGA 2W63A 1PZ2A 2ZUUA 4U3AA 2A3AA 2UY3A 4JFSA 4P7LA 2CPUA 5DT5A 1KWGA 1E43A 2XM1A 2ZX7A 1M7XA 5CXPA 4CN4A 5BRPA 1J01A 4U2YA 2XTKA 5A69A 4K68A 3CHDA 2D20A 5HDRA 1R7AA 4CN1A 4GZJA 3B8SA 5CQ1A 5IXEA 1XGZA 1QHPA 2E9LA 3ARTA 1AQMA 3RIKA 1KBBA 2J74A 3VMOA 4DWSC 1BHGA 1CBGA 2YDSA 3SIMA 3SCUA 3WY1A 1UHVA 1LF1A 4W86A 4NF7A 4M81A 3B9EA 1GUVA 1V0MA 1JD7A 1GOQA 2VX4A 2W62A 1K9DA 1JL8A 1UKPA 4PN2A 4ATLA 3EDJA 1JZ8A 3GNRA 4GKLA 4PTMA 1VBUA 5HBFA 3VIPA 3SCNA 3VVGA 4B9ZA 4XZBA 2VZVA 1KGXA 4TUFA 3ZT6A 3GM8A 2VURA 2PWDA 3PHAA 3ZM8A 3AIUA 3VINA 3AXHA 2Y8VA 4U5KA 2PWFA 3N9KA 1Q6EA 3AISA 4JL1A 1WPCA 1HP5A 3CGTA 1NH6A 3MKKA 2CCRA 3D5HA 2J77A 4J28A 2BFGA 1U30A 1EXPA 2VCCA 4E8CA 1WZAA 3CPUA 3HMCA 3T2PA 1GVYA 1CXEA 2XVNA 2BHYA 1JNDA 3KL5A 3A6OA 2OSWA 1CLXA 1VRXA 4AISA 3N1AA 1HNYA 5AY7A 5BRQA 1E5JA 3ZJKA 4NRSA 1VJSA 2Y4SA 4BQ4A 4V27A 1NM9A 2DDXA 2WCAA 4MDPA 1US3A 1WO2A 2XM2A 3VTRA 3W81A 4E4PA 3VDBA 3IJ9A 1UA7A 4P8VA 4D6EA 3VIIA 3AIEA 3PZQA 1EOKA 1AVAA 2BHZA 5CZKA 2GUYA 3WDIA 2O9RA 4OBRA 2GK1A 3W6MA 4JCLA 2F2HA 3WH8A 2YBTA 3G6LA 2WMFA 5E6YA 3KZSA 4MAZA 5I79A 5JIWA 2XFRA 3ZJ7A 4PSRA 2ZUMA 2XWEA 4A3HA 3QOKA 1CLVA 3GBDA 2VRJA 2VZSA 3BLPX 4QLJA 2W4XA 1QNQA 1UKOA 2CBUA 3GXFA 1VBRA 2VQUA 1ESWA 5A2CA 3W0KA 1E55A 2YA0A 1JYXA 3K8MA 4FLSA 5GNXA 4AEFA 3FAWA 5A8PA 1MQQA 3UG5A 4N42A 5A95A 2J47A 3BCFA 3MV01 3MUAA 1ODZA 3UCQA 3WD2A 1GJWA 1KGUA 1UD5A 1TG7A 2TAAA 7A3HA 3MMUA 1EHAA 1KXQA 3AMKA 2WANA 2BXYA 4D6IA 3BAXA 5BWFA 1QI3A 2CEQA 4W7VA 1RPKA 1KR0A 4OZOA 3WF2A 2BY1A 3WF1A 5DEZA 2GDUA 2VRQA 1XH0A 1V6YA 3WF4A 4Z2HA 2WMIB 5D4YA 6A3HA 1NQ6A 1QPKA 3K1DA 5ABHA 3NDYA 5A3HA 2PF0A 2YKKA 3W28A 1HXJA 5A2BA 1CXIA 1ECEA 3W26A 4D1JA 5EFFA 4ATDA 4J3WA 3CUJA 1JFHA 4XZWA 1UWSA 3ZMRA 3ARXA 1BSIA 1I1WA 1BVNP 3PTKA 4QCEA 2D0FA 3VUPA 2BVYA 3VD5A 2WHMA 1EHNA 3MUZ1 2BNJA 5AYBA 1CGVA 2EXOA 3OIHA 3BSGA 1LG2A 4DWSB 1J0KA 5IFTA 1C91A 2E0PA 3AHZA 1E9LA 4HMCA 1DWJM 2J7BA 3OA5A 4AIEA 3PZVA 5I2UA 1EQPA 4AZHA 3ARZA 3PZOA 2E9BA 2BVDA 4UQEA 1E0WA 1ZJBA 3RPMA 4LYQA 3WQ8A 4GIAA 1W9VA 5JBFA 1UWUA 3NCOA 1CPUA 1VFFA 3PTMA 2XGIA 1BG4A 5A6AA 2WAGA 1GNXA 1XYZA 1VF8A 4TVCA 2HISA 3BH4A 1BYDA 3VKKA 1ISYA 4UR9A 4J3TA 5BYWA 4HPHA 3UG3A 3TP4A 1HP4A 4TTGA 5EBAA 1E6QM 1V6WA 2GJPA 2GVYA 2VQTA 3OLDA 3AHXA 3GZAA 3PZNA 5A94A 5A8QA 2X05A 1LWJA 1PX3A 3UERA 1TZ7A 1WDSA 5FCZA 3KEHA 5JBEA 4U5IA 4BF7A 7CGTA 2OLHA 1DWGM 1H3GA 1UWIA 1BGAA 1V3MA 1OGBA 4L4PA 4YN5A 4M24A 5I23A 4WIWA 1KXHA 1B3XA 3E1F1 1JZ4A 4HMDA 4PMRA 3TA9A 3UR8A 2X0HA 4W7WA 5CGTA 3NDZA 4PSPA 5CPQA 3SUWA 4AZBA 1H41A 2OYKA 3VDCA 4EAMA 1E6RA 1X1NA 1E3XA 2VJXA 4CU6A 2EO7A 3BAWA 1JI1A 1WZMA 3POCA 4F79A 4IPLA 2VTFA 5BCAA 1MQRA 4BZYA 3POHA 1C90A 3BGAA 3ARQA 3PTQA 2D23A 1GQIA 2WVVB 1F4AA 3UR7A 4X9YA 1GPFA 3L4VA 4WK9A 2BY2A 4H8VA 6TAAA 4TXEA 4DUXA 4MAVA 1UR9A 1TCMA 4ZENA 2RGLA 4OJYA 3RM8A 1OIMA 3ZOAA 4WSJA 4DUWA 1YHTA 1OIFA 3LPFA 3F5JA 2D3NA 1B9ZA 4UQ9A 3VM5A 3GH4A 2CYGA 3SURA 3ARUA 1HJSA 1JYVA 1NOWA 1M04A 1MW2A 2A3HA 3AJ7A 4P8XA 4TVDA 4MB5A 1E15A 1UR0A 2DSWA 1HIZA 4JKKA 3VIFA 1ZS2A 1GOKA 3TTYA 4TTUA 4GI8A 1TVNA 1GVIA 2DIEA 1NOUA 3AMDA 4PBGA 1NP0A 2WCSA 3VGDA 2YA1A 1D3CA 1UR2A 1H5VA 1B3ZA 1H4PA 3IK2A 3WDPP 5KZ6A 2VZOA 4ACYA 4MB3A 2NT0A 2AMGA 2OWXA 2JEQA 1V3LA 1LG1A 1LWHA 2VVSA 3WFZA 5HNNA 2VX6A 3MANA 2PBOA 4PCTA 4AYSA 3GTNA 1E6NA 2QV4A 4PTVA 3KE0A 4W8AA 3SUVA 3T09A 1KGWA 1V02A 1TUXA 3WQ5A 1GZJA 5JBDA 5A6BD 1VENA 3DYMA 3T0DA 1CXFA 3ARYA 5AC5A 1W3HA 4KRUA 1VFOA 2J7GA 5M17A 4MNMA 1W1YA 2GJXB 3NSMA 3OGRA 1TA3B 2YOCA 2ZWZA 3OG2A 1QBBA 3W38A 3AS2A 1J0HA 1C8YA 2ZE0A 4PYSA 1IZJA 1X6NA 4AD3A 1MQPA 4BS0A 4PUEA 1EGZA 1AQ0A 4UFKA 2W91A 4JKLA 2J7HA 1E4NA 4LYPA 4M8UA 2E4TA 4TVUA 1V3HA 4DM2A 3NSXA 3PZUA 1RH9A 5IDIA 3VGGA 1U33A 1B31A 4LXFA 3KL0A 3FN9A 2WMIA 2XGBA 1JZ2A 2FH6A 2YLAA 3G6MA 4KGJA 4XUYA 4KMQA 4UFLA 1C93A 3OBAA 1WDPA 1BTCA 4QDMA 1UWRA 5E9AA 4QLLA 1Q6DA 3CUHA 1LJYA 3LPOA 2F8QA 1K9TA 1NWSA 2JEPA 4RE4A 1GORA 3DHUA 1FFRA 1W3KA 3AFBA 1E6SM 3VD3A 5D9MA 1ISZA 1UWTA 2A3CA 4E8DA 1YQ2A 2JIWA 1Q6CA 1XH1A 3T2QA 1PIGA 1QHZA 3I3DA 1SFSA 2OSXA 4DWSA 4S3KA 1H0IA 3CHFA 4B15A 2XFFA 3PZTA 4A3YA 1W9PA 3L4ZA 4OOUA 1JYWA 3M46A 3QOMA 1OSEA 1BFNA 3L4XA 1KBKA 1BLIA 4AD0A 1MW3A 4W85A 4HTYA 4BCEA 2DSKA 3RDKA 4W8BA 1NWRA 3L4WA 1EH9A 3AMLA 5I24A 3A47A 1V6UA 5LA0A 1JYNA 1B90A 2YL8A 3VIHA 1HJQA 4MB1A 1L8NA 1HL8A 1V02E 1JXJA 2W5FA 4P7OA 1X6LA 2YL9A 2NT1A 4BQ2A 1XD1A 5DT7A 1V08A 3U5YA 3FW6A 4P8WA 2XVLA 4D6CA 5A8NA 1JIBA 1ZBKA 4JCMA 3T0BA 2CBVA 1B3VA 1D7FA 4QP0A 2W92A 3K46A 3RJXA 3NIYA 4CD5A 2XG9A 4RE3A 1BGGA 3VNYA 1MFUA 5A6BA 1G1YA 3WF3A 2O9PA 4IPNB 4HPGA 3OZPA 4DM1A 3BCDA 4H8UA 4P7RA 2WHLA 1E3ZA 3ZR5A 3UESA 4UCFA 1HKJA 2PI6A 1EDGA 5I77A 4UOZA 3ZT5A 1XSKA 3FAXA 4J7RA 3MV11 3GBEA 3K8LA 3WBAA 3WL0A 3CZGA 4UFHA 3CZJA 3QHMA 7TAAA 3VIKA 2O92A 2D24A 4YPJA 2C8NA 3AIVA 1E0XA 2DT1A 5A6KA 3VGEA 4H2CA 4PMUA 4J3VA 2WVVA 1FH8A 3CZ8A 2ZUSA 1ODUA 1FHDA 1WB0A 2E3ZA 3MSGA 2GFTA 4AEEA 2WWDA 2DT0A 3GNPA 3W29A 5F7UA 1HJUA 5I78A 5GNYA 1GW1A 2DSVA 3AHYA 2VZUA 1VFMA 2J8GA 2YA2A 1W2VA 5CLWA 3BXWA 1QHOA 4R27A 5I0DA 3CMGA 4EK7A 5ABFB 4FMVA 2JF7A 1QVBA 1V3IA 5FIPA 1FA2A 3SCQA 4LX4A 5A6MA 4AZIA 4F9JA 3VD4A 1KQYA 5FKYA 4ACZB 2WC3A 3S2CA 3BMWA 1JZ5A 4H04A 1XSIA 1HT6A 3AIRA 3WEZA 4W84A 1J0JA 4E2OA 1DEDA 1UG6A 1C8XA 4B16A 1VIWA 2ZX9A 4Z2JA 1GCYA 3NJ3A 1XV8A 2CERA 4W8LA 3CHCA 4UNIA 1UA3A 4OBSA 1UR4A 4B3LA 1B30A 2JF6A 3VX1A 1B2YA 6CGTA 3BAJA 1QOXA 4P7NA 4W5ZA 2FGZA 4AD4A 2O9TA 3F5KA 1EA9C 2VCBA 2EPOA 2CXGA 2FDMA 4KGLA 4MNKA 2BHUA 2PWHA 1W9BM 2VL4A 1PEZA 4ATWA 2VUYA 3WF0A 4AZ5A 1R7OA 9CGTA 2GJXA 3PZGA 1HKKA 1TA3A 1Y7VA 3SCVA 2HVMA 3N17A 1CEOA 3W27A 2IUZA 1TVPA 2WNWA 1JZ6A 5GPRA 3WDRA 3OLIA 1JAEA 1FOBA 3FHAA 1OCQA 3KL3A 2ZXAA 2EPMX 2YBUA 5CGMA 4FLRA 4CKQA 4NSBA 5A6JA 1SYTA 3CTTA 1CYGA 2YJQA 1E1FA 4XB3A 3W53A 1XC6A 2EJ1A 5KEZA 2VMFA 1E6PA 1BAGA 1JG9A 1OT2A 3CH9A 1FH7A 4WSKA 4RE2A 2WZEA 1A47A 3JUGA 2PWEA 2Y24A 4GI9A 5E70A 2VZTA 5FL1A 5HOSA 4UQBA 4D6GA 4CCDA 1RP8A 2C7FA 3VIMA 2Y8KA 1HVXA 1KFWA 5E0CA 3AYSA 4IM4A 2J7FA 4GPNA 4OOZA 3TTQA 4AD1A 2ZX8A 2PC8A 3BLKA 1JDDA 4F8XA 3O2LA 2E8ZA 3EDKA 4NZCA 5HPOA 2XPKA 4WKAA 4H41A 3BAYA 1W9XA 1UKQA 4GZIA 2ZWYA 2WXDM 1W1PA 3VX0A 2C0HA 1P6WA 3VILA 1UH2A 3VMNA 1EO7A 1UR8A 3AZTA 2QF8A 3I3EA 3VDAA 5BXSA 1ZL1A 4BQ3A 1HL9A 1PPIA 2GSJA 3AOFA 1Q6FA 2YIHA 1US2A 1XCWA 1GONA 5ABEA 5A8MA 4CCEA 1OGSA 3WNKA 1V0NA 4XX6A 3UG4A 3ZJ6A 1E70M 4JFWA 1MW0A 1LQ0A 5C8BB 1JFXA 3ALFA 4LYRA 1OM0A 3AS1A 4OIFA 2XYLA 2WVTA 2DSUA 3SCPA 1FP8A 3O9NA 1RD6A 4CU8A 1QI4A 1EIBA 2AOSA 1W3LA 4U33A 4PMXA 1V0LA 3A4AA 2W66A 3LMYA 2BVTA 2F61A 3SCTA 2WW5A 1E0VA 3A4XA 2WK2A 1K6AA 4Q7NA 4B3KA 3IAPA 4A4AA 8A3HA 3PZIA 2VC9A 3L4YA 4D71A 3QHNA 2WB5A 1WKYA 3WBEA 4GQQA 3VOCA 1E40A 1NWUA 1R87A 4Z2KA 2IXUA 2WZHA 1WDRA 1V3KA 4X0NA 2ZOXA 1H09A 1HKIA 4X0VA 1WZLA 4N0RA 2EQDA 3O6AA 4AIUA 3AXIA 4EE9A 1G9HA 4MTVA 1DWIM 1W2PA 5A2AA 5CSUA 1KB3A 3LPGA 3ARSA 4D72A 2WC7A 3PN8A 4YHEA 4HU0A 1CXLA 1ISXA 3K4AA 4UFMA 3GH7A 1UKTA 4U3CA 1NARA 3N13A 3TOPA 2WKGA 1JDCA 3UETA 3S6TA 5ABFA 3AROA 3CO4A 3PZ9A 2QMJA 1UQYA 3DECA 4QCFA 4CGTA 4CVWA 3L2LA 4ACZA 4AD5A 1C92A 2V5DA 3WMCA 1XH2A 3EMCA 4GO8A 1KXVA 1MVYA 5A6LA 3SCRA 1UYQA 1G94A 4NRRA 1J9YA 2ZX5A 1EOMA 3AZSA 2CHNA 3WN6A 5E6ZA 2CBJA 1UQZA 2X09A 5M03A 4JHOA 1WP6A 4JL2A 4D1IA 2V3EA 1CGTA 4AD2A 3EMZA 1IZKA 3VGBA 3A3HA 1BVZA 3ZIZA 5FOOA 2BXZA 4KH2A 3GXMA 4F9DA 2FH8A 4U2ZA 4HOWA 1FHLA 1B0IA 4WLCA 1E72M 3AYRA 2B31A 2YLLA 4JFUA 1GQLA 3B9AA 3SCOA 1GQJA 5I5RA 1UD2A 2V3DA 8CGTA 2BY0A 4D6FA 1J12A 1OGGA 5TD4A 3CUFA 3OB8A 4JZ5A 3ALGA 4OKDA 3VIJA 2Q8XA 3ECQA 1DWHM 3ZSSA 4CD6A 4IISA 1VB9A 1QNPA 4TX6A 3WQ4A 3N04A 4HZ7A 5LYRA 4V2XA 2WLZA 3W4RA 1SR0A 3SEPA 3WQVA 1KCLA 1E73M 2FGLA 4FK9A 1VEMA 1CXKA 3WEMA 3CBWA 1FFQA 1GOWA 2ZX6A 3CUIA 2E40A 4MB4A 3VD7A 1EO5A 3CZEA 3W37A 3AICA 5IHSA 2BY3A 3HJEA 3CHEA 3VIGA 1XRVA 1VEPA 2OWWA 3TTOA 3AS0A 3MSDA 3AMCA 3U7VA 4LPCA 1CGUA 1KQZA 1ITCA 1D2KA 2VR5A 4PMYA 4CN6A 4GO9A 4HA4A 1G01A 3EDFA 2D22A 3WNNA 1FP9A 4V28A 3ZO9A 4PMOA 1W32A 4CUCA 1E56A 3II1A 4R5EA 2CHOA 3SCWA 4PEEA 1KXTA 2CKRA 2JIEA 4M1RA 5E09A 4WKFA 2WCGA 2G3JA 3NSNA 2WLYA 3WD0A 1UOKA 2G4FA 3L4TA 1QNRA 3AIWA 2G3NA 4ZE5A 4UZUA 1BF2A 3EDDA 2VX5A 2ZUVA 5DFAA 1K9FA 1G0CA 4GQRA 3ZSTA 1B3YA 1J0YA 2BV9A 1HJWA 1JI2A 2OSYA 4HP5A 2XWDA 3WD1A 3EYPA 3WL1A 4D6DA 1GHRA 2EBNA 1ISVA 1C7TA 1GHSA 1DP0A 3QHOA 3WDHA 1E4LA 4M56A 2D3LA 1BYBA 4M29A 3RCNA 2WVUA 4Z2GA 2WBKA 3MMWA 5EB8A 2DT3A 1IV8A 1VJZA 4GINA 1MYRA 1UD3A 2DH3A 2QMKA 2XVKA 2NSXA 4D6HA 4AZCB 2Z1SA 5A1AA
chains in the Genus database with same CATH superfamily
3APYA 5IHRA 4C7FA 3W24A 4EANA 1ISWA 3TJLA 2A3EA 4L4OA 1SSGA 4CD7A 2WSPA 2YW4A 1CGXA 4CD4A 3O3RA 1NDZA 1RSCA 4IFKB 3S2JA 3GYCA 3OYZA 3ARRA 2PRHA 3TYZA 2VOTA 3ABZA 4PL2A 3OGVA 5D30A 5B80A 5CLTA 1BRLA 3TYEA 5AYIA 4HNOA 3BW4A 1W91A 2FQIA 4K6AA 3IJLA 3G18A 1BXBA 2YCKX 4ZCWA 4NVTA 7PTDA 3H2MA 5I3DA 4O1FA 2G8ZA 2ZRUA 3QC0A 2BWGA 3E0IA 3NO3A 4B5SA 3VU2A 2ZUWA 3K8KA 4HK5A 1O6IA 5CC6A 2AQWA 3SQLA 1ZBWA 1PIIA 4XBSA 4NI3A 5DF0A 4ZXLA 3HU7A 3M0MA 5H8MA 1MO0A 1PIFA 3F5LA 2X41A 1T7LA 3B0YA 5G4EA 4UOJA 3C2VA 4MWAD 2ACRA 4RZBA 4F0RA 4WF7A 1UR1A 3HV9A 3W7JA 1EJTC 1JCJA 2FZ9A 1HO1A 4ZSTA 4IPIA 1FDJA 1C29A 2QIWA 3ERPA 4JTQA 4J3SA 3NO1A 1SW7A 4JIEA 1KTNA 4NKCA 4JX4A 3QKZA 1JUEA 3JR2A 2ZA3A 3OG3A 3H4GA 1U5HA 2Z27A 4IZGA 3PPGA 3WUFA 3FYPA 1UH4A 4ML9A 4W88A 2OX1A 4UZSA 3M07A 3EXSA 5C71A 3S9ZA 1F8IA 3T2OA 1C8QA 1HL2A 4FI4A 2GQAA 1SO3A 1JEZA 1GYMA 2Z1KA 1TPWA 5EMMA 4KIEA 3L4UA 3GHTA 4AZ6A 1S3TC 2OVLA 2QHAA 2DT2A 3DYOA 2C16A 5CSYA 1E4IA 3SW6A 5D33A 4EACA 3DHDA 5CPMA 5D8ZA 3D6NA 4NXSA 3WX7A 1JZ3A 4FX7A 3CV7A 3B8UA 4R9OA 5DCDA 4Z2IA 5DMYA 3BJSA 1HF6A 4HPNA 1V0KA 4TV6A 3W7DA 5HQLA 4LSBA 3RILA 3ARVA 1BKHA 4PEKA 2E6AA 1W5PA 3UJEA 5H8PA 4IPJA 1TJRA 3EWZA 5I02A 1BQGA 3M5XA 4Z08A 1VFTA 1FDYA 2PDUA 1EJWC 3CQHA 1DHKA 5I03A 3VPLA 5CG0A 2HZGA 3CU2A 2ACQA 2CZDA 4AZGA 3ES8A 1T99A 2FZNA 3VNJA 3W7EA 2XISA 4DO4A 4EPEC 3TYBA 1OD8A 3R5EA 3TAOA 1MNZA 1GVSA 2YFNA 1A0CA 4ZXOA 2XH4A 3RO8A 2VC6A 1K9EA 4LUIA 2ZA1A 4JPGA 4UC5A 1QI5A 2XIMA 2GSHA 2VGFA 3PTDA 1CGWA 2IXVA 1I4NA 1WZKA 3TQVA 4DEFA 2DIJA 1GVOA 4QJ1A 2XSBA 2R1KA 3K30A 3B06A 2JK2A 1TTPA 2WPGA 4MJZA 1LWIA 4C7DA 4DBSA 3GR4A 2UWFA 3BSHA 1S5VA 4LCRA 4O0QA 1YPFA 3MC5A 2Q3OA 4HCLA 2PGEA 1DQWA 1H0GA 5JH2A 4P7QA 1ZUAX 2D2HA 1AW5A 2G41A 4BA0A 1DPMA 1UZHA 2WV8A 1BSLA 4QNWA 3TSMA 5CPOA 2QCMA 4HCDA 2VNCA 1CLKA 1WDQA 2XIIA 2VWTA 4L9ZA 2WMHA 3IGXA 3M7SA 3SM0A 2QPSA 1EF2A 3QLDA 2FHCA 4KCVA 2PWVA 1KC7A 2QCHA 2ON3A 3ARPA 3B03A 1R3SA 4GK8A 1NDVA 4KETA 5HXMA 2PUZA 4UQDA 5CJ5A 2E8YA 4EF8A 2NUWA 4JTTA 1OEPA 3A13A 4GYJA 4NP7A 2VC5A 4YTUA 1ZCCA 2WBGA 4NJGA 2XN1A 5ABGA 4OGZA 4G9PA 1BD0A 1UD4A 4BF9A 1NP2A 4XUGA 5DANA 5LNSA 3LCFA 1SMAA 2D0HA 4ZB5A 4HOXA 2HBXA 5EY5A 4F0MA 2R14A 1CENA 1YDYA 4GZEA 3T1GA 4LH8A 4MJ4A 1QI2A 4A8IA 2G3MA 3VNMA 5CJNA 4DJED 1G5AA 2C14A 2OZ8A 2YXXA 1GJUA 4DWSD 5FF3A 2QEZA 4XO7A 3WUBA 4ADUA 2XIBA 2WNQA 3W72A 1YTDA 1IQ8A 3I6TA 1S2AA 1D8CA 1UD6A 4AFYA 2I57A 2DU2A 3A64A 4MJ2A 2DZAA 2DVTA 4QDWA 4AWEA 1WUFA 9RUBA 2PLMA 1JULA 5I3JA 4NQ1A 2PWGA 1FCVA 3MUIA 5F4XA 4ENLA 4LUYA 4ERGA 3QY6A 3NPXA 3BAIA 4O18A 1UH3A 2OEJA 3W25A 5GJMA 2D1ZA 3U4AA 2CNCA 1OX4B 2H9AB 4WCJA 4FLQA 5D37A 1F3XA 4S2BA 4IIGA 4AXNA 4GRSA 5CC7A 1Z32X 1L6YA 3WBYA 3WQFA 5B7YA 4QG8A 3AIQA 2NV2A 1OT1A 4O4VA 1IXOA 3WQWA 2ZZ6A 4PA8A 5DRIA 3U57A 2UZ9A 4C6JA 1NFBA 1R86A 2OFJA 3UWYA 2P50A 3F4VA 4IGMA 2CBIA 4ALDA 2VENA 2QAFA 2VCAA 4M6PA 2OU4A 1ITXA 3BW2A 3N4EA 3M47A 2XSAA 1V79A 1JGIA 4O19A 3EX3A 1OBAA 2OOFA 4NX5A 3CUGA 2VR2A 5BROA 2AMXA 4EOUA 2ZIDA 4X61A 3DC8A 2WJZA 5LGXA 5D9PA 1X1ZA 1ADDA 1EBGA 1QO2A 2R1NA 2C79A 1L0PA 4ZQMA 3BQ5A 3VM7A 2UY4A 4Y90A 1XFCA 1BKSA 5J04A 3CIVA 4J3UA 3AUJA 3FKRA 1XF0A 1OFPA 4HNLA 3D3AA 2PP3A 1EF3A 4GH3A 3VDGA 3WMSA 3RM9A 4KS0A 4AY8A 3EWWA 2J8FA 4V1YA 1HX0A 5AHFA 4UTTC 2GDQA 5ECUA 3VGFA 1MEHA 3CLWA 5C2XA 1Q63A 3EKGA 1IT7A 5HMFA 4QAWA 2X42A 5DBUA 4OV9A 2EKGA 3GVRA 4F48A 3WNLA 4DQWA 1FWHC 4M1BA 3SUSA 2P8CA 3SN1A 5EFDA 1LBMA 4IL2A 4PUDA 4ZOBA 3H12A 2HRWA 4IJCA 4GUIA 3CQKA 5LA2A 2QLYA 4DWDA 5CGQA 5DMLA 5D05A 5HUPA 7ENLA 4OECA 4HZ8A 3OLGA 2YZ5A 2BOGX 2W63A 3EZ4A 2V2CA 3GR7A 5DQPA 1XWYA 1GQNA 2DP3A 3P82A 2CPUA 3GG7A 1KWGA 2ZX7A 4DI8A 5HMEA 3PJXA 1POJA 3EKLA 2OQLA 4U2YA 5HWMA 2XTKA 4NX0A 3P7YA 2GYIA 3DFYA 3CHDA 2D20A 1R7AA 4GZJA 2VEFA 3NQFA 4Q6XA 3PPCA 2E9LA 1KBBA 3VMOA 4XZNX 2XIQA 4LBSA 2A2IA 2PDXA 3RMJA 4B2DD 3GAYA 3SIMA 1QPNA 3TNOA 4C5YA 1J93A 4M81A 1GUVA 1AH0A 4HTBA 5TF0A 2Z6JA 2W62A 4PTDA 3MY9A 1FKWA 3LRLA 3W76A 4PN2A 4ATLA 1A5AA 1JZ8A 3GNRA 3S8HA 3MYOA 3VIPA 4D9PA 1QXLA 3Q65A 3I4KA 2VFGA 3H23A 1HZYA 4UBPC 2C1HA 4S39A 3VINA 3KLLA 5I3KA 1OYCA 2A5HA 4IMFA 3CYJA 2VDGA 1U1HA 1F7BA 1WPCA 1HP5A 3EOUA 3MKKA 1FWTA 5CSRA 2J77A 2X40A 4D8LA 1U30A 1Q5MA 2OXNA 1FWCC 4DO5A 4A8LA 4G1KA 2VEIA 1WZAA 1R3YA 3HMCA 3T2PA 3DFSA 1GVYA 1CXEA 2RDTA 2XVNA 4N9BA 4I5XA 1JNDA 3KL5A 3A6OA 1VRXA 1E5JA 2VEKA 2AKMA 5LNVA 4FEZA 1NQKA 1RVKA 5AYYA 1AD4A 1VP5A 4Q4SA 1WO2A 1GT8A 1YEYA 2REQA 4E4PA 2PD5A 3VDBA 1WKEA 4P8VA 3VIIA 4DBDA 2BHZA 2GUYA 2PDBA 3UR5A 4OBRA 3RHGA 4JCLA 2X16A 2Q01A 4NZFA 1PTDA 4LAUA 2VWSA 3TNBA 4NZ4A 1IYXA 3G6LA 2WMFA 1Q6QA 3UWZA 2ZUMA 4MZ1A 3QOKA 3U3HA 1UP3A 3BLPX 4JTGA 1QNQA 2CBUA 2NVAA 4M0XA 3SSJA 4A3RA 3C3UA 4N02A 1ESWA 4FXJA 5A2CA 3W0KA 1X97A 1IGWA 2Q6ZA 3FSTA 3URQA 5K9CA 4H8NA 1AZ1A 4FLSA 3PC0A 4MGGA 4C91A 3XISA 1SR9A 2C1GA 4N42A 5MKGA 1R9XA 2IPJA 1S1RA 1ODZA 3UCQA 3WD2A 4A05A 3S46A 1GJWA 2NV9A 4Q8PA 4I9JA 3H7RA 3BAXA 4MYAA 1KR0A 2J6VA 4DXKA 3TWAA 2VRQA 3BARA 3F2BA 3DFHA 3WK2A 2BSLA 3N6JA 3WF4A 4Z2HA 2WMIB 1RHCA 4NZ1A 1KM5A 5D4YA 6A3HA 1NQ6A 1JCLA 1QPKA 1LROA 1QT1A 1HXJA 3S2NA 1ECEA 4BEUA 4RLIA 1XIJA 3ICJA 3NZRA 3CUJA 1UBSA 4O14A 1UWSA 3ZMRA 4IP4A 4OVXA 4XIMA 1LOLA 4QCEA 2YYTA 1VS1A 4XAFA 3QY8A 3BJFA 2BNJA 5LIUX 3R6IA 3OIHA 4WX2A 1FX6A 1IWPA 3QV8A 1E0UA 4HMCA 1DWJM 2J7BA 3OA5A 4AZHA 2GVJA 3EWXA 3NOYA 2E9BA 4UQEA 1ZJBA 3RPMA 4LYQA 3ITOA 4GIAA 1FWJC 1UWUA 3PF3A 3C5QA 2ZVRA 3W02A 3UCCA 3PTMA 4C6MA 1TV5A 2BGNE 4TVCA 3WQEA 3VKKA 4XVEA 4UR9A 3FJNA 4GLEA 4J3TA 5BYWA 3OVGA 2JBMA 2VQTA 3TC7A 4GVGA 4KWSA 3SY1A 3VI2A 4JN7A 4NASA 2NXGA 2X05A 3HZ3A 3KTXA 1WDSA 3MI3A 1KW1A 3KEHA 4DAIA 4BF7A 3FJ6A 1H3GA 4L7ZA 3T4WA 4N9EA 4N4QA 4YN5A 1AJ2A 1E1CA 4WIWA 4DBEA 1R6WA 3I7RA 3GE7A 1UIOA 1YNQA 5C55A 4PMRA 3G24A 4MUPA 3N2XA 1E9ZB 5CGTA 3OP2A 4IMAA 5D2TA 2OYKA 4EAMA 1E6RA 3BURA 1X1NA 2VJXA 1W3IA 4CU6A 2EO7A 4F79A 3CV6A 2B7PA 2PLCA 1MQRA 3B05A 4ICMA 1WUEA 2G50A 1VYSX 1WA3A 4RXGA 2D23A 5K9XA 3THQA 4AX6A 2G96A 4X9YA 2BY2A 1TTQA 2OQHA 3W74A 4F4RA 4XK2A 4WGHA 3LY0A 3KWSA 1ZQ5A 1OIMA 3ZOAA 4WSJA 4DUWA 3MCOA 4ZQRA 3LPFA 3WK3A 4E0CA 4IP5A 4DJFA 5KSWA 1M04A 1H7PA 3UXLA 2A3HA 3AJ7A 3RCMA 1UR0A 2WM1A 3RAOA 3URBA 1ZS2A 3AYVA 4FOUA 1GOKA 5D04C 3G0UA 1TVNA 3F4DA 2WKJA 5BOEA 1NOUA 3AMDA 3V4BA 3ABOA 4IXXA 2WCSA 1B3ZA 1H4PA 3FOKA 3R0DA 5KZ6A 2DY3A 4JX6A 1OC7A 3KDOA 1DIDA 3UY7A 4KFPA 1DJZA 1DQXA 4PCTA 4AYSA 1UP0A 4HSHA 8XIMA 3TR2A 3SUVA 5D09A 5CC3A 1GGOA 4NT0A 3W1LA 3T0DA 1TV4A 1R5YA 3KTCA 1VYPX 5AC5A 1W3HA 3TLQA 4AG0A 3N4AA 1R9YA 5F2MA 3PG9A 1QPOA 5HWJA 1VFOA 1GOXA 2XH0A 4MNMA 2GJXB 1FRBA 3BG3A 3NL6A 3Q67A 3W38A 1J0HA 1C8YA 2ZE0A 4PYSA 4AD3A 2R1MA 3UWQA 4IH3A 2ZZ2A 1E4NA 4LYPA 3KOWA 4M8UA 1NF7A 4DM2A 3NSXA 5IDIA 3JS3A 1KLZA 4LXFA 1R30A 2HS8A 4RV3A 2YLAA 1RXOB 2Z7KA 4C1LA 1EJ7L 4IMGA 1Q85A 1MDLA 4LWWA 3LHTA 3VABA 2DVUA 1Q6DA 1LJYA 1K9TA 1NWSA 2BASA 2JEPA 3CT2A 3IVUA 3HBLA 3DHUA 4V33A 1UWTA 3W2UA 1O94A 1YQ2A 1JCTA 2G5WA 3T2QA 2ISSA 4NJKA 2Q8ZA 1LRNA 3F2CA 2O55A 3TVAA 1KBJA 3GIYA 3BGGA 3GO2A 3FIGA 4B15A 3H4WA 3KBNA 4A2SA 2GQ3A 3N3MA 4IT1A 3PVFA 1O5KA 4AD0A 4HTYA 1A0EA 2DSKA 3WLIA 2QNEA 1J6PA 3RDKA 3W7MA 1A5CA 2HXUA 3A47A 2FIQA 1TKKA 3KLKA 5TBOA 3DFPA 2Y5SA 3O05A 1WX0A 2BGSA 1SO4A 4IQEA 4DZHA 5C9ZA 1FWIC 4FS9A 2NT1A 1TPFA 1TQXA 4PZVA 3FFSA 2G97A 3M0ZA 4FR1A 4J35A 3U5YA 3B0UX 2I9UA 5A8NA 1S5TA 3T0BA 1GZ1A 3S6OA 3W7LA 2FTPA 1B3VA 1Y5WA 3LBOA 4XISA 3VE7A 3K46A 4CD5A 3VNYA 1G1YA 2O9PA 4IPNB 4H8UA 4DXVA 1XLBA 4S3AA 4NNCA 6REQB 4GYFA 1VC4A 3EX2A 3KAOA 3ZR5A 3LQGA 3UESA 2PI6A 3S47A 2UBPC 1EDGA 1PTAA 4UOZA 1X7FA 3D47A 1V7YA 4GH1A 5U7SA 1FWAC 2GGHA 3WL0A 3DEQA 7TAAA 5AOUA 1EGVA 2O92A 1XDLA 1IWBA 3QV9A 3VYLA 3AWNA 3AIVA 3PUGA 2DT1A 1P0NA 4FR6A 4Q4QA 2Q8LA 4FB7A 4UTWA 4BF5A 4JTJA 1Y5VA 2ZBTA 1WB0A 5CZJA 3A9BA 2GFTA 1IXNA 5J8LA 1OHLA 1O1HA 4DO7A 2QKFA 4GHRA 3DAQA 1GWJA 1TB3A 3HTWA 1XYBA 5CZ0A 2VZUA 3KTSA 2J8GA 4KPLA 4XG1A 1TV3A 1W2VA 1ZLPA 4E2DA 4R27A 3FJ4A 4EK7A 4FMVA 2JF7A 1TJ2A 3H2FA 3W2MA 1TWDA 3SAZA 5A6MA 3P0WA 4F9JA 1KQYA 4ACZB 3Q45A 1QPQA 3N25A 4H04A 3S5NA 2DZUA 3WEZA 1J0JA 3SO7A 2D2JA 2W79A 3K4WA 2OO6A 4MYXA 3JRKA 4UNIA 1I8JA 1UA3A 2PTZA 5I7GA 3V5FA 1UR4A 1XGEA 1A5SA 3LGGA 3WLOA 4XZHA 1Q45A 2AL2A 3VX1A 2XIJA 1YADA 1LDCA 4E8GA 5BZAA 1GVQA 5EMUA 4KGLA 2FDMA 2XSXA 2FPTA 3DN5A 1PEZA 4QE1A 2VUYA 3W6YA 1KM6A 1MUMA 4L56A 1HKKA 1TA3A 2HVMA 3MUXA 1T40A 3H6OA 4IF2A 1GZGA 4DUOA 7XIMA 2NQHA 4PUNA 3KL3A 1LQ2A 2EPMX 2YBUA 4DLFA 4NSBA 5A6JA 2HK1A 2QPXA 3MZ2A 4UTKA 2ZCGA 1AMKA 5TAOA 4CEXC 1EZWA 4L1WA 2OGYA 3F03K 3NOEA 4PH6A 1JG9A 3CH9A 1J8VA 4AU0A 3H2OA 3PWIA 4C6PA 2F7FA 2VZTA 1WOBA 5AVNA 3KOYA 1XM3A 2GL5A 5FL1A 3QTGA 1TE6A 4QE4A 1WQ5A 4UQBA 5H6HA 1XYMA 1ZP3A 4CCDA 3VIMA 1HVXA 4RUBA 4KCTA 4L1XA 1XQLA 3BLKA 4O1EA 2ASHA 2HVOA 2VGGA 3NO5A 3EDKA 4WOQA 4JQ1A 4A8RA 4O0KA 3UU0A 2VFDA 3P5YA 3LCGA 1W9XA 3C0SA 5PTDA 4GZIA 2OODA 4GI4A 1XLIA 3OODA 4HN8A 1DQUA 5TQLA 4GA8A 1P6WA 3VMNA 3U0HA 1EO7A 4G5DA 1ZL1A 4O8RA 2GSJA 2QDEA 1Q6FA 4BR1A 2YIHA 2BG5A 3VNDA 2QIIA 4Q7BA 2D69A 5BWAA 4DYJA 4L1GA 1XIFA 1OFBA 1R9ZA 2EKCA 3C56A 3BZGA 3IVSA 4BI5A 4LYRA 2WVTA 3SCPA 2NQ9A 1BRLB 3F1QA 4CU8A 1QI4A 1EIBA 4C6QA 3A4AA 3B8TA 2W66A 1XPYA 3LMYA 1L2QA 4K7YA 3SCTA 5U4NA 3LHVA 2ZRYA 4MWAC 4B3KA 1DHPA 1KM1A 4DAFA 1U1JA 2XN0A 3RF9A 5GJPA 1NWUA 1R87A 2WSRA 2WZHA 3TH6A 1DIOA 2UV8G 3W7QA 2J9ZA 4N9CA 4X0NA 1V4YA 1ZAIA 5SWUA 4X0VA 3TXZA 1KV5A 3COTA 4R53A 1EP3A 3EPOA 1WZLA 3GYEA 4DLMA 1PYFA 1S2WA 5D38A 3BG9A 4I9AA 1DWIM 5E5CA 5CSUA 3ELFA 1EWDA 1RV8A 1OK6A 1YIXA 3TW9A 4GY0A 1CXLA 1ISXA 1FWRA 1H7OA 1JQVA 4NJHA 3V5CA 4C1NA 4PUJA 3QZ6A 2WKGA 4JIPA 5CCZA 2Z6IA 3AROA 5MF5A 2YB4A 4TX9A 2DFAA 4JYEA 1FHUA 4I90A 1M3UA 3SSZA 4E2BA 2WZMA 6XIMA 3AZSA 2P0IA 4YCOA 1I2PA 2DV0A 1UQZA 4P61A 4R85A 5M03A 3DENA 1CGTA 3WJSA 4AX7A 3WLPA 3VKCA 2X1RA 3QC3A 3M43A 2BXZA 4KH2A 2NUXA 3KBWA 3FX4A 3W7RA 2BX7A 3JZEA 1HKWA 3QXBA 3ANUA 3E3HA 4L6DA 4MOZA 3FDGA 2E5CA 1E72M 2B31A 3GC5A 3R8RA 3TMQA 2CWXA 4MY8A 3SCOA 1UD2A 2V3DA 3FXGA 4D6FA 1J12A 1OGGA 5FF7A 4H9VA 4OKDA 3N6QA 4JZ5A 3ALGA 5G2HA 3R94A 3TSBA 3ZSSA 1H7XA 4IISA 1QNPA 2GGJA 3TQ0A 4QJ5B 1R46A 4HZ7A 4GFSA 4DI9A 2KAUC 3SEPA 1KCLA 2FGLA 1YXYA 3R10A 1CXKA 3B0VC 2PU0A 3CB3A 5EYWA 5FSDC 1WKFA 3MJYA 1OZMA 1EO5A 3CZEA 5E9XA 3AICA 1EXBA 5IHSA 2BY3A 3AS0A 3S1UA 3MSDA 3MQTA 1KQZA 3IIZA 4KRZA 1ITCA 4JXCA 3T78A 1JCYA 4XD3A 1G01A 1TMLA 2DZTA 4QS5A 3EEZA 3GTHA 4HK6A 4A3UA 3INPA 3ZO9A 1W32A 1RBOB 3QZAA 3SCWA 3WLHA 1LRTA 2SFPA 3O0FA 3EWCA 3IV8A 4UNKA 1YE4A 2JIEA 2FFIA 4M1RA 4WKFA 3PUEA 3TA6A 2WLYA 1XISA 3ID7A 4PB4A 3USBA 1IEVA 2FB2A 1QU4A 4ZE5A 3HPFA 1TQJA 1J6OA 1XIBA 3ZSTA 1CW2A 1J0YA 7TIMA 2PF8A 3ZVHA 4H3DA 4GVIA 4D6DA 3L12A 1ML1A 4M56A 1KBIA 5LHEA 3M5VA 1JRCA 1VJZA 4LS2A 6ALDA 1MYRA 3G1AA 3UW6A 2PTXA 5G5IA 4H00A 2XVKA 1TPUA 2NSXA 2B81A 5KETA 5A1AA 5FL0A 1KM0A 4HZ6A 2H3DA 3QBUA 3CZKA 3VKBA 5HWNA 3EAUA 3TU9A 3MDWA 3THCA 1V6XA 4L9YA 1EQCA 3AALA 1A5NC 3NEVA 4LFYA 4S3BA 3GZ3A 3SCSA 2HV5A 2PBGA 2FJKA 3P81A 4TX8A 2YYUA 1PE1A 3OLEA 3G2GA 3DHPA 5FEZA 1SUXA 4QLKA 2JALA 3OHIA 3M64A 4PMZA 3C0JA 2QF7A 2ZICA 4XZLX 4RNFA 4FHAA 1JF5A 3QR0A 4I5UA 1GG1A 1OX6A 4ZEPA 3L2MA 4J2PA 2DSZA 4NZ3A 3KS6A 5HPCA 5ECVA 1JD9A 2NWSA 5HNUA 4YWSA 2RDWA 2Y7DA 1B3WA 1LL6A 1N7KA 3QFWA 2A6NA 4DJDA 1WXYA 3L65A 4HGXA 4RKAA 3SRHA 4DELA 4AB4A 1NFGA 3DKJA 1IF2A 3STGA 3SY8A 2DPEA 2J79A 4JTEA 2VD8A 3TQKA 3BOLA 3MSRA 3TYDA 3KCJA 4PE8A 1O5XA 5M5DA 1CB7B 4ZO9A 3MMDA 3NTYA 3DYPA 2RH9A 3RLGA 4WXZA 4JFVA 3SBFA 3WD3A 2BTMA 2E67A 2Y5EA 4MFEA 1FDZA 3AHTA 3E2QA 4LJ3A 3QGVA 3FNDA 4UXDA 2X30A 1MW1A 2CU0A 3JVAA 4CNOA 2BS9A 3V0SA 4JBRA 2WYSA 1PJ9A 3SR7A 4Q7IA 3FLUA 5C70A 2DEPA 2EEXA 4AC7C 1IT0A 3VIOA 2GJRA 1OG0A 4ZO7A 4ADTA 2XHYA 2PDNA 2DJLA 3CZLA 2PLKA 4TMCA 3CQ0A 4DPPA 5D9NA 4XO6A 2CWNA 1AG1O 3MJMA 3WEOA 1H63A 4M6VA 3UFYA 3IJ7A 3S5SA 1TFVA 3PY2A 5J5DA 2VO5A 4BEQA 3ITVA 2Y89A 3F4CA 3XIMA 4CNUA 4HJFA 1W1VA 4J40A 2PA6A 2BODX 4ZE4A 4MUZA 1TPDA 1XYFA 1XIHA 4F3HA 1XICA 3B4UA 2VM8A 5A5WA 3LD5A 1W9DM 3TN3A 3OEXA 4Z2LA 3SZ8A 3C0QA 3N6HA 2J25A 3LSCA 2FMNA 2X1TA 1AH4A 1P0EA 2QZRA 1U5VA 4IQDA 3W86A 3ENLA 1QNOA 3WH7A 3WG6A 3DHFA 3W1QA 3CH0A 1EDQA 4PTWA 1FWEC 3AHVA 1OWQA 1D3HA 2Z1XA 3FY1A 1RA5A 3WQ6A 2E28A 2WWCA 1PZ3A 3PPFA 1ALDA 5D8WA 3EOEA 2RGMA 1X1OA 4X22A 4C6IA 3VA8A 3VUSA 1I1XA 1L8PA 3QQ1A 1IE7C 4WQ6A 4F0LA 3H7VA 4I8DA 4FAMA 3UNDA 2EAWA 3HURA 4WSHA 7REQA 5BXRA 4RDYA 4S3DA 4DO6A 3BAKA 1KTBA 3WUGA 1LP6A 3KUMA 3CJPA 5C54A 1ZY9A 4AZCA 1C9DA 4AC1X 1SM9A 3RLUA 2EPLX 3ATYA 3WSUA 4JIHA 2WJFA 4I5RA 3LM3A 3UGRA 3FXYA 4RW5A 4YS1A 2P10A 2O9OA 1QBAA 3CTLA 4TOQA 2YXGA 1XLGA 4GUHA 1JDAA 1RA0A 3LQLA 5DO8A 2I7GA 4OV4A 3OQEA 1RAKA 3IAQA 3B9OA 1VAHA 1C9WA 2IQ0A 3TOYA 3W6LA 1XRFA 1RCQA 2YL6A 3T08A 1PL9A 1P5BA 1VEOA 1JAKA 4MPKA 3S83A 3N11A 3I3BA 1IXPA 3FS2A 3NQ8A 2JE8A 5FJJA 4K39A 4K2SA 1H1NA 3L9CA 3WFLA 4JTHA 1LOSA 8TIMA 3OO2A 3CIXA 3GXDA 1F3WA 3A9IA 3SQSA 3SUTA 3RN6A 2ZZ3A 5DMNA 1HVQA 5BOOA 4UOQA 3BANA 4MNJA 1OABA 1XBVA 3AMGA 4TQTA 2ZKMX 2QUNA 2RDXA 1CZ1A 3KRZA 2OYLA 4J9JA 3T0AA 1RK5A 4QSHA 2D2OA 3LPPA 4URIA 1X7IA 1VRDA 1MEIA 3KBSA 3LV6A 3RPTA 3VCNA 4B3ZA 5I6SA 4MZ8A 3TW6A 3WENA 4K1GA 3T07A 3N18A 3WLLA 3E2RA 4UTJA 3OOQA 4OBTA 4GQ0A 4IMCA 2WSKA 3KOXA 3G1RA 4LV4A 2E6FA 1HW6A 2REQB 4R7JA 1QI0A 4AIOA 5BXTA 1F4HA 3QMTA 3H53A 1MDRA 4PRWA 3R79A 3LNPA 3MO4A 5A6SA 2UY5A 1EYEA 3KVKA 1NAL1 3WJWA 3VCRA 3EDEA 2CXEA 2XJ7A 3TFCA 1HJVA 1H2JA 2QR6A 3LU2A 5M3WA 1S2UA 2EPNA 1WBJA 1YXCA 2KZHA 4BWLA 5HNTA 3HG5A 2ATMA 2P88A 3U5UA 1BPLB 4AF0A 4JY8A 4FNQA 4NYYA 1FXPA 4DJFC 2VEMA 4IG2A 3L21A 4KERA 1C8VA 2J7DA 3PZMA 4L61A 2ZXQA 4HSOA 3VKDA 3R25A 5H91A 5MKGB 3J7HA 3VOFA 2J62A 4ZQPA 4F66A 4RE0A 2JQXA 2XDFA 1ITQA 4CCZA 4ASTA 3NR0A 1MWOA 5HR7A 2OKOA 4LUTA 1R85A 2FB3A 2WMJA 3P67A 1T8XA 1AQFA 3QMSA 3SGGA 1RLCL 1H49A 1ONRA 1KFLA 2V3GA 5AN7A 3UVIA 4UQCA 3EWYA 3LHUA 5FSEC 3W7GA 3CC1A 2GDVA 3LRMA 4Z1CA 3LM7A 3AS3A 3N2OA 1XLHA 3F2DA 3M5ZA 1NJJA 4P8UA 2XH7A 3KBVA 5CPTA 1EP2A 3AQUA 5C7HA 4MLRA 1EFZA 4L4MA 1KKOA 2QCEA 2MANA 1KRMA 1SMDA 3GFZA 2NVCA 3IEBA 2NXIA 1LT8A 4MKSA 1XUZA 2VDIA 3TJXA 1SZEA 4HOZA 2R1PA 4YYCA 1TE1A 2UY2A 1XR2A 3NEHA 3RMEA 3GH5A 1W1IE 4PUWA 4S3CA 3W82A 4LVDA 5C2GA 1VCVA 3LNMA 5I00A 4AAJA 1LQAA 2GGIA 1V6VA 3ZR6A 1W3NA 2J78A 3GXNA 1C7SA 1ZGDA 2QGHA 3SUUA 4UFIA 2NVDA 3GDTA 1PZ2A 4ZSUA 2G3FA 2A3AA 4JIIX 1P0BA 2UY3A 4FPSA 2PWUA 5FF0A 5DT5A 3W83A 3BQ6A 1E43A 1K03A 3D0CA 5CXPA 4CN4A 1J01A 2V5KA 3SRKA 2C19A 1HQTA 5A69A 2OOGA 4K68A 1Q6LA 1J5TA 3WFAA 1TWZA 4D8ZA 3KW3A 5HMSA 5CQ1A 4LB4A 2IS7A 5IXEA 1J96A 5C7VA 1XGZA 2VELA 4LF2A 1F61A 2DUZA 3Q58A 1BHGA 2YDSA 2QAPA 3SCUA 2ZA2A 1E1CB 1UHVA 4NF7A 3B9EA 3GC4A 3REQA 5LIWX 3DERA 1JL8A 1UKPA 1L6FA 3EDJA 1NVMA 4GKLA 1K4HA 1VBUA 4QG9A 4WDTA 4ZQNA 4B9ZA 4XZBA 5IRPA 2VZVA 4TUFA 3ZT6A 3GM8A 2VURA 4AY7A 5MHBA 2IW0A 1KRCC 3BO9A 1O60A 2CLOA 1GKQA 3ZS4A 4U5KA 4QISA 3BLLA 3N9KA 2V5LA 3L23A 4JL1A 2CCRA 3MP4A 3D5HA 3M0YA 2VCCA 1JUKA 1GG0A 4GCAA 1PTGA 1XLLA 3LBMA 1N8IA 3N1AA 1HNYA 5AY7A 1A49A 3PBMA 2V9DA 3T42A 4NRSA 1BXNA 1OCBA 3RO6A 1K8YA 1NM9A 2B7OA 3MVIA 4ZGYA 2XM2A 3VTRA 1XIMA 4KIRA 1UA7A 3AIEA 3WDIA 1I0BA 4QR6A 3W6MA 3FA5A 2F2HA 2YBTA 3HFTA 3RLVA 3ITGA 1I2OA 4UTWC 3DFQA 4MAZA 2EPHA 2KX9A 2VRJA 4QLJA 4A29A 3ITLA 1FXQA 1SO5A 4AYGA 3CL8A 1VBRA 3WZ0E 2CFFA 1E55A 5HNRA 4A21A 2GVLA 5EKYA 3FAWA 1UZDA 1YDOA 4HNUA 5A95A 2R8WA 1W3TA 3BCFA 3MV01 3MUAA 4F0HA 4ZTXA 3KX6A 1F73A 1KGUA 1UD5A 1TG7A 2TAAA 3S5ZA 1XL9A 5BRBA 2BXYA 5IBXA 4L80A 4GNJA 4N6EA 4X63A 4FIRA 3THUA 1ICSA 1QI3A 1KLYA 4PBEA 3WF2A 3IJQA 2E1DA 3LA4A 4L64A 2HEJA 1XH0A 1XRTA 3PJWA 1DJIA 4AUBA 1JCXA 4C6BA 3HMJG 3BOFA 3G1DA 4PL1A 3VKJA 1EPXA 5FEPA 4IX2A 3LLXA 3F7JA 4O52A 2YKKA 3GHSA 4F2BA 5A2BA 2E09A 3NA8A 3CNYA 3PAJA 4ZBCA 3UBPC 3W26A 1XI3A 4C1KA 4Z1DA 4J3WA 1TREA 4RZ5A 4IGSA 1SVDA 3A3XA 2J9XA 1R38A 3VD5A 2WHMA 3GIPA 1EHNA 4QE5A 4Q8MA 2EXOA 1LG2A 2X7VA 3GG1A 4ONVA 1EC8A 4AIEA 3N3TA 3MUCA 3ARZA 4PCFA 1TX2A 2BVDA 4GISA 2JGQA 5FF4A 2V2HA 1W9VA 3V1HA 1TO3A 1CPUA 1VFFA 2OZ3A 2XGIA 1BG4A 3TCEA 4TU1A 3ITYA 2ZRWA 2R24A 3E96A 2HK0A 1DJYA 2HISA 3NVDA 4FOKA 1LRQA 3GTXA 4EXBA 2ALRA 2GJPA 3GX9A 3B4YA 3OLDA 1SO6A 3GZAA 1NIUA 1TZ7A 2CLEA 4NNBA 3RRXA 4NL1A 3W7CA 5FCZA 5JBEA 4U5IA 7CGTA 1IZCA 4POCA 5LSMA 4L4PA 2OZ0A 4P5UA 3IIVA 3H2NA 3LCXA 3A5FA 3KOZA 3UCDA 1A50A 1O1ZA 4MFDA 1JZ4A 2IQDA 4PMJA 4S1FA 4W7WA 4UB9A 1JPDX 3B3DA 5CPQA 1H41A 3MSYA 4GNKB 2Z1VA 1E3XA 3T7VA 2VFFA 1WZMA 2QUVA 3TZFA 5CPLA 3B0XA 1DORA 3LGDA 5BCAA 3PTQA 3UR7A 3IIPA 2BZNA 4L4LA 4DUXA 4MAVA 1UR9A 1G7VA 1D9EA 2GQ9A 2GJNA 3W1NA 2JGYA 1TCMA 3G8RA 3KRBA 1FTXA 3APTA 2RGLA 1PWLA 4HB7A 3F5JA 2XZ9A 2NQLA 3VC6A 3VM5A 2RJHA 3ARUA 1HJSA 1JYVA 3RFAA 3AAMA 1P1MA 1MW2A 3NZPA 4TVDA 1E15A 1YW1A 4YVPA 1VPQA 4TTUA 4GI8A 2YBVA 4IMEA 1B9BA 2ISFA 2XGZA 3QZEA 1VPXA 4MWAE 2YA1A 4EP8C 2E6DA 1UR2A 1H5VA 3WDPP 3R8GA 4MB3A 1PB0A 3DG6A 4Y9PA 1MEWA 9XIMA 2JEQA 3HM7A 5BU6A 1HFBA 1VR6A 1R2TA 2I56A 3GTNA 1E6NA 2QV4A 4JYDA 3WLNA 2V82A 5K4ZA 2AL2B 1TUXA 3WQ5A 1KBLA 1GZJA 5A6BD 3B8DA 4LUSA 4C65A 1VENA 2PSNA 3TJ4A 3U2EA 4LRTA 1F9CA 3SJNA 1CXFA 4FP1A 4WEVX 1BXCA 3GY1A 3N9SA 2P8BA 2WQDA 1QK2A 2I1OA 1OADA 3WQPA 3ZFHA 1W1YA 1NELA 2XN2A 3NSMA 1TA3B 4KF1A 2YOCA 2ZWZA 1OCNA 3OG2A 4K1WA 2A21A 3HQ1A 3AS2A 3KZPA 3P62A 3DKLA 1X6NA 4JTIA 4PUEA 4UFKA 2W91A 4CQCA 2BXVA 4JKLA 2J7HA 1TWIA 1RQHA 3SQMA 2E4TA 4TVUA 1Z41A 3PZUA 1U33A 1PUDA 2VHLA 2ABBA 2C71A 3G6MA 1Q4WA 1R3QA 4HHLA 1Z69A 2QXWA 3M41A 3LBCA 1G7UA 1WDPA 4QDMA 1M65A 3A24A 3ZLHA 3QFEA 4WOZA 2B7QA 2TSYA 4HU4A 4KFOA 4O11A 4H7ZA 2FGBA 4O1DA 4HNNA 1AW1A 1GORA 1UJPA 3QN3A 1QOQA 4PFHA 1FFRA 1W3KA 3PNZA 3AFBA 1E6SM 3VD3A 3UD6A 2Y7FA 1ISZA 1FCUA 2A3CA 4E8DA 2JIWA 1Q6CA 3QRHA 1H62A 1XH1A 1JR1A 5AC6A 3T0CA 1PIGA 1QHZA 2R9RA 2OSXA 2PS2A 5HMDA 1H0IA 1J5SA 3CHFA 2OJPA 4XSLA 3UNTA 4JIQA 2XFFA 4E2VA 1W9PA 1HG3A 4OHQA 3L4ZA 4OOUA 3HB9A 4NY2A 3H26A 4D8AA 4W85A 3LXAA 5KITA 1F07A 1DE5A 3A3WA 2XINA 3AU6A 3W71A 3L4WA 3AU2A 4E3TA 3AMLA 1V6UA 1TZZA 1B90A 1UC5A 3VIHA 4WY0F 1HJQA 1WDWA 3OVPA 5FF2A 1KV8A 3LTYA 1N2VA 4Z1BA 4WDXA 2W5FA 5TNVA 1K7XA 1ZNNA 1V08A 3LHZA 3AXMA 3DG3A 3M44A 1TSIA 4D6CA 3QMRA 3M0KA 3U9IA 4C6FA 1LTDA 1F76A 4QP0A 3UZ5A 1SW0A 4IMDA 5T26A 3NIYA 1ZAJA 2PGFA 5A6BA 3PJUA 3WF3A 1NFPA 4ZR8A 4HPGA 4AHOA 3OZPA 3E6EA 3BCDA 4P7RA 1UB3A 3W01A 2WHLA 1E3ZA 4N4PA 1B4EA 5I77A 2C0AA 3CUZA 4JTDA 3ZT5A 3M5YA 5JXQA 1TTIA 3CHVA 3W7NA 4Q8TA 4UFHA 3CZJA 3CO8A 5AHEA 3ZXWA 4YPJA 1JQXA 2G95A 3UQNA 3PB2A 1P0KA 4J3VA 2WVVA 2Y6ZA 3C2EA 1R3VA 2ZUSA 3H4XA 1FHDA 2E3ZA 3MSGA 4QQUA 3WQGA 4A2RA 4G8TA 2HROA 1QNVA 3SN0A 1HJUA 2V6AA 5GNYA 1GW1A 1EC9A 1QO5A 3AHYA 3I68A 1QAPA 3DI0A 1VFMA 1XW8A 4FNSA 4C1NB 4HNTA 3NQVA 1QHOA 5I0DA 3QR1A 5DXYA 4NJJA 3TC6A 1QVBA 2NV1A 1QPRA 4AZIA 5LNUA 3VD4A 1NDYA 3S5YA 2WC3A 1LBLA 3P74A 3BMWA 1Q7QA 3C2YA 1XSIA 4US5A 1Z3NA 3H55A 3AIRA 4W84A 3FJLA 3OPSA 3N29A 4B16A 1VIWA 1ZFJA 4Z2JA 1NU5A 2PE4A 9XIAA 4GE8A 4GXMA 1XV8A 4DJDC 2W27A 5BNKA 1XUUA 4B3LA 1B30A 3TUUA 3EA3A 3S9IA 5I3GA 1KCZA 3E2SA 3AJXA 2FGZA 2O9TA 3F5KA 2IKIA 1A5OC 5CAHA 2VCBA 3DH7A 4F2TA 3ZLGA 4MNKA 1O5RA 2PWHA 1W9BM 3IJDA 5KINA 5KTLA 3EWUA 2HBVA 2YW3A 4LCSA 9CGTA 2J6XA 2V69A 3PBYA 1ZCOA 3N17A 1IHIA 3UZZA 2IUZA 3VZYA 3W85A 1JZ6A 4IGHA 2WPBA 1LM1A 1JRBA 5GPRA 3WDRA 3NL5A 3OLIA 3BTNA 1DV7A 1ZALA 1FOBA 4QJ3B 4PB3A 1MRQA 5T91A 4CKQA 3NQAA 4L5ZA 1SYTA 4JTUA 1PSCA 4YTQA 4G6CA 1TV8A 3E0WA 3R8HA 2C18A 1FH7A 3UZXA 3GVGA 3O6CA 1UJQA 2PWEA 4JTRA 4LVBA 3CEUA 4RK8A 4ZMGA 5HR6A 1YPXA 4S3EA 3TWBA 2C7FA 1KFWA 5E0CA 3AYSA 3LLFA 4OOZA 1OZQA 3M0LA 2ZX8A 4N2YA 2P1FA 4AWSA 4XAZA 3G22A 2PC8A 1YTEA 4QAIA 4M7SA 5H1WA 2RHGA 2Q3RA 3V75A 2GUUA 4J1OA 5HPOA 2CHRA 4WKAA 4E4FA 1K8CA 1UKQA 3G1VA 3ZVHB 1SGJA 2ZWYA 2WXDM 3NXFA 1ZZMA 4TR9A 3VILA 5AHMA 1UH2A 2QF8A 3ABSA 3I3EA 2Y62A 1UPPA 4TO8A 3EEGA 1HL9A 1XCWA 5ABEA 3ITTA 4CCEA 4KWVA 3O15A 1DJXA 4GGHA 1OGSA 1KCXA 2DVXA 1YXDA 2Z26A 3ZJ6A 1V8EA 3ZWTA 3C86A 3UJ2A 4ZZ9A 3NM3A 3OTRA 3N73A 4NZ5A 4M6QA 4UR7A 4GUGA 3UXDA 3U8GA 2H3BA 3L2IA 2J13A 2DSUA 3W1TA 1FWGC 3RNDA 3HJZA 1FP8A 2GWGA 2CZEA 5KZEA 2Z28A 4XAYA 4XTDA 5HQMA 4GX8A 5HINA 2GJLA 2O7QA 4U33A 4PMXA 1V0LA 4WZHA 2BVTA 3CV1A 4YCPA 2W3ZA 4O1CA 2HVNA 2WW5A 3H21A 1E0VA 4HCHA 4C6EA 2CLHA 2WK2A 1K6AA 4NJIA 3UY8A 3WMLA 8A3HA 2G0WA 3PZIA 2VC9A 2QS8A 1QMLA 2QDGA 3L4YA 1I2RA 3MBFA 1IGSA 1E40A 2IXUA 3QPEA 3PULA 1EJXC 3NZGA 1WDRA 3U6WA 1NY1A 4ERIA 2R94A 3V35A 4I9MA 2PAJA 2EQDA 3O6AA 3O8AA 2NSOA 3HQPA 4MTVA 1H1ZA 4CNSA 4YVXA 4HPXA 2O0TA 3RXZA 1W2PA 5A2AA 1IIGA 3M6YA 4D72A 1EWEA 2R91A 4GOAA 4YHEA 5HULA 1DL3A 1UWAA 3CWOX 1SZFA 3GH7A 1UKTA 3N13A 3E0FA 3JU2A 4IICA 3TOPA 4KCWA 1FWFC 1JDCA 2R6OA 3MWCA 3S6TA 3HIJA 4PCPA 3CO4A 3PZ9A 1UQYA 3DECA 4QCFA 3GD6A 4CGTA 3QGKC 4O1AA 1W31A 1C92A 2V5DA 1XH2A 3C2FA 2ZZ7A 1WV2A 2P0OA 1Y5XA 1MVYA 3EMCA 1UYQA 5LIXX 4ZQCA 3W75A 2ZX5A 3WN6A 2XZ7A 1Q66A 2CBJA 1QJWA 1FVPA 2A7NA 4JHOA 2DUAA 1W5NA 4D1IA 3UG8A 4AD2A 1UR3M 3W7OA 3N2TA 3VOHA 3FKKA 5FOOA 1EZ2A 4WXYA 2OR2A 3QV6A 1K1DA 4JEJA 1FHLA 4EXQA 5DCEA 3ZLFA 1GQLA 1FWNA 4UTTA 4YLWA 2BY0A 1PHWA 3R89A 4OQVA 2EG8A 3CUFA 4GG9A 4PRTA 3QY7A 2Q8XA 3MVTA 4G56A 1F74A 3WQ4A 5EMJA 3ME3A 4V2XA 4HMNA 1VEMA 2G37A 3EB2A 1Q6RA 1UMLA 2ZX6A 1TPH1 2PDMA 1E9IA 1MUCA 6TIMA 5E93A 1GEHA 3W37A 3BL3A 5F1UA 3HJEA 2IQTA 3CHEA 1TPC1 1XRVA 1O95A 4MIMA 4BWLC 1QW7A 3B8WA 1D2KA 3AYTA 4GO9A 2ZTKA 4HA4A 4P2VA 4JQ4A 3EDFA 3G1YA 3WNNA 4OWGA 5EA9A 4K37A 1E56A 2HNHA 3BE7A 2QJJA 2O56A 1Q8AA 1KXTA 4Z17A 4LCQA 2WCGA 1QATA 2VFEA 4PTNA 5D03A 3W1RA 1QNRA 3L4TA 3Q4DA 5D02A 3TN5A 3C8NA 2G3NA 4UZUA 3EDDA 4S2CA 5AFDA 2ZUVA 5DFAA 1FHVA 3O63A 1G0CA 5LXEA 1JCMP 1YLVA 1B3YA 1XS2A 3KVJA 1DTNA 3UT0A 3HG3A 1R3WA 1HJWA 4NAFA 4QEHA 4KQNA 3AC0A 3EYPA 3WL1A 4HHPA 1DXIA 1X8CA 3GR8A 2EBNA 1UW9A 3QHOA 2A85A 3WDHA 4RPQA 3HQNA 3G1SA 4B5XA 7REQB 4C90A 1KFBA 2DUXA 2WVUA 2WBKA 2YXOA 4Z2GA 2CC0A 4K38A 1TPVA 4GINA 1R47A 1UD3A 1K02A 3C8FA 1ZAHA 4AZCB 2RUSA 2A3BA 2D2GA 1GEQA 3ABRA 1F6KA 4I3GA 4Q4PA 1CTNA 2GUBA 1ZBCA 2V67A 4WJ8A 1RK6A 2RFGA 3OZYA 4AY1A 1ITUA 1GYNA 4GJJA 1LUCA 4KWWA 1KM4A 2VR4A 3BLOA 2Z2UA 1P6BA 5LA1A 4QXIA 1E4MM 3BPWA 4Q22A 4KFNA 3G3DA 3T4CA 2AAAA 3S1VA 4Z1YA 2WM0A 3H70A 2FKPA 3QW4B 1X98A 4E6MA 1RP9A 2GQ8A 3T55A 3NYDA 1RALA 1E71M 2Y70A 3I6RA 2GZXA 3HN3A 2I5GA 5AKQA 2X2YA 2RDUA 3GVVA 1YNYA 1G6CA 2PDJA 1QW9A 3KBMA 4LVFA 3WIJA 4JEQA 3CAVA 4HA3A 4CD8A 1K8XA 4A8NA 1OX5A 1WAUA 3LLDA 1NWTA 2J4GA 2ZXBA 1ZBVA 3U2ZA 4C7GA 4ML4A 2Z2BA 4IUGA 5CJMA 3GKFA 4JFTA 5CKSA 4DHGA 4GXPA 4HZMA 4GX9A 5DN1A 5AZ1A 3H24A 3WQCA 2BB0A 1G4TA 2E9MA 3K1GA 4DIAA 4W5UA 4MDOA 2YSWA 2W9MA 4LGXA 2DZXA 3NGJA 1EEPA 1KCKA 3SI9A 3FV9A 3C6CA 2ZRVA 4XAPA 5CPSA 1M6JA 2CLKA 3I4EA 5AC4A 3S9YA 1DBTA 3WQDA 4EPDC 1KTCA 1WNOA 3GFXA 3MS8A 5EMYA 2V30A 1R2SA 3EMQA 1XCXA 4FLOA 3P2VA 1LL7A 1W54A 2JKPA 1UBPC 4IP7A 2OWCA 3PJTA 1VIZA 3B40A 3DX5A 4YHGA 3APGA 3RCYA 7ODCA 3OGSA 4ORMA 4AF0B 3S1GA 4ZQOA 4IFRA 3TLLA 1AH3A 4IG2B 4IUOA 3IV3A 5HA7A 3GNNA 1RLDA 2DH2A 3N12A 4AW7A 2PDCA 4IIDA 1O68A 2A79A 4O50A 1WAWA 1IIHA 1Z44A 1AJZA 4LVGA 2JFEX 3N4FA 2BOFX 3BDKA 2RJGA 2YDRA 2Q71A 3EOLA 3QR3A 5FJUA 4LUTB 4O57A 2X1IA 6ENLA 2CZ5A 1UKSA 4QX4A 1EYWA 1OYAA 4ZFCA 1H60A 3SFKA 3LV5A 3WNOA 3IK4A 1U2YA 4Q8UA 4JHZA 3BV4A 4UQAA 1TRIA 4CU7A 4DJFD 1V93A 3T8LA 3UJRA 3W2KA 4JHMA 2EG7A 2VEPA 4WY0A 4DBWA 2W61A 4L65A 4LB3A 2V2DA 4BQ5A 1W5QA 3UEQA 3TC3A 3RM4A 3TK7A 1KM2A 3M7WA 1H11A 3KWXA 1QK0A 1RR2A 4PCSA 3IUIA 3LERA 1JF6A 4CQAA 3IIXA 4FSAA 4S3JA 2ONEA 1BQCA 3QH2A 1LLOA 3NQDA 4GI6A 1BWLA 2FZBA 1OINA 1R8LA 4ICCX 4K8GA 3HFYA 2W67A 5G2WA 4YTTA 1P4CA 4XD4A 3S6DA 1W5MA 8XIAA 1XD0A 1D3GA 2IMRA 4W93A 5IFPA 1VHCA 3HPSA 3GHRA 1PAMA 3BMVA 3TDFA 4W7UA 1CIUA 1W37A 1TMQA 4JQ2A 3W7PA 3CXOA 3ZJ8A 1OFOA 3AXXA 3IWPA 3UWEA 1ICPA 2NW0A 1CWYA 4O12A 5DELA 5D32A 1NOFA 1BYAA 3UPMA 1ZP4A 2J75A 2VGIA 3AZRA 3NPWA 2QCDA 1XP3A 3AIBA 4I7UA 4DPQA 2Z29A 1RJRA 2A7PA 4IIBA 4BJHA 4YTRA 3QSRA 4Z42C 3VDHA 2I5IA 2WZTA 4GYPA 4Q4KA 2PFHA 3REQB 3D3FA 1B1YA 3B9NA 4OFCA 3RJYA 1ENUA 3PAOA 1AMYA 1RJPA 3TV8A 4B4FA 4QROA 4UTIA 1DXFA 4PBFA 2J7CA 3IUHA 2V3FA 3M9YA 1GOIA 1V51A 5CSSA 1YBQA 4Q4MA 3LHWA 1RD5A 4N7QA 1MUWA 2CETA 4M82A 3NUKA 2FHBA 4JDYA 3S1WA 3KRSA 3MUY1 4WVXA 2ZC8A 1J0ZA 1UWQA 2FHFA 2PCEA 2E1WA 4Q8VA 1WDDA 5E0KA 1OFEA 1KWKA 3MU7A 2ZYFA 3SN4A 4F2UA 1PDZA 3AI0A 2XVPA 2HE5A 1XBYA 4HVXA 5D9OA 4DVOA 3QTPA 1SZNA 1UUQA 3SGZA 3K4DA 5CAKA 3C0LA 3W22A 3VO0A 3NVTA 4WDUA 3W7IA 4PULA 1X6UA 4CVUA 1JNEA 3LI0A 2INZA 1E5NA 2FVKA 4HHMA 1TIMA 2DQXA 1J0IA 3PG8A 3PPHA 2DQWA 3AWOA 2EPKX 1KRAC 3W1XA 3DG7A 1UMYA 4R34A 1H61A 4YNGA 2C3ZA 3T9PA 3MHFA 4W9TA 3WH5A 4FIQA 2PPGA 2AGTA 1WOAA 3W1AA 4UFJA 3WH6A 2VFIA 4YU1A 3GNOA 3BICA 2CESA 3PBWA 5L6UA 3WUEA 1PBGA 4GXWA 5BXPA 5L9FA 4DRSA 1GVRA 1SJDA 1CNVA 1IEIA 1J18A 4FF5A 4C6KA 2PDIA 3UYIA 1S5NA 1EUNA 1T96A 4UMAA 2V38A 2XUCA 3NM1A 2ZUTA 1HKMA 3HF3A 1W1TA 3QW3A 1I45A 1CECA 3WH9A 3FHQA 3CB8A 4UTFA 1IXQA 3G8EA 5LNRA 6XIAA 4EAYA 2YDQA 4H8HA 3MHUA 3NURA 3C61A 5CZSA 3M6DA 4DUVA 3ZR4A 2C6QA 2I14A 1NDWA 4HN4A 3ZYZA 1OB0A 2ODOA 4CEUC 2WKLA 4M19A 3ITCA 3OZOA 1CX9A 1VCGA 4UTHA 5T8GA 1CDGA 4AZ7A 1GVEA 4LC6A 2FMOA 1P1XA 3DC0A 3DU0A 4RPPA 1O7AA 3VD9A 1JPHA 2GOKA 3TYAA 2WMGA 1GKRA 1IR1A 4YTSA 5A8OA 2NLIA 4MNLA 3CEPA 3PBGA 1QOPA 3VMPA 3IGUA 1UC4A 2PLJA 2ZE3A 4GJ1A 3ZWSA 1OF6A 3VFCA 1SJCA 1JUBA 5E0FA 3EX1A 4ES4A 1ZENA 3GDBA 4LQ1A 2EHHA 4Q3MA 2VP8A 3W2JA 1WE5A 4LAZA 1KRBC 1EDTA 1FWBC 2FDSA 1JDFA 4W87A 1M53A 1PX4A 3BUVA 3P93A 2Y2WA 1PCKA 4W89A 1KFJA 3THDA 3BC9A 4MKNA 1UZ1A 2ZUUA 4Y9MA 4LTSA 3UA3A 2W0UA 1XLMA 3MT1A 1F6PA 2XM1A 4QG6A 1M7XA 1XBXA 1R2RA 4GD0A 1M7JA 3LCHA 4GUFA 4KBXA 1Y0EA 4MVAA 3BG5A 1UOZA 5HDRA 4RX0A 4WGXA 3NFUA 1QASA 1QHPA 1AQMA 2E68A 2J74A 3KCLA 1GVFA 1M5WA 3WCZA 4MM1A 2QQ6A 3CK5A 3WY1A 3KS5A 1V0MA 1VFSA 1FQ0A 4E3VA 2NX9A 3JZUA 2ISVA 1XINA 4PTMA 2A3LA 3VVGA 5C9WA 5FJRA 4PRRA 4X2RA 3PHAA 3FA4A 3NQMA 4BK9A 3CV2A 3LTSA 2AQVA 2Y8VA 3W1PA 4MG4A 2PWFA 4TV5A 4N6FA 3AISA 3GAKA 1NH6A 2WQPA 1M7PA 2BFGA 3EXRA 1L6SA 2HNEA 1EXPA 2X1SA 3N34A 1ECQA 1A5KC 2Z4GA 3TMLA 2OSWA 2OT0A 5BRQA 3OW1A 3ABXA 1G4PA 4V27A 2DDXA 2WCAA 1F8MA 3W81A 1BF6A 4XKYA 1PKMA 3IJ9A 3OHMB 3PZQA 4Y96A 4IPPA 4GBUA 2GK1A 3G0XA 1TWSA 2VGBA 3WH8A 1AFSA 4RZ6A 1YE6A 2ZVIA 3DESA 3QM3A 5A6TC 3BCJA 5E6YA 3CWHA 3V0UA 4XZ9A 5I79A 2XFRA 3RR1A 4PSRA 2XWEA 3E49A 1Z6KA 1CLVA 3GBDA 5C5YA 4LUSB 2DORA 2VZSA 4UUIA 1UKOA 3HGSA 1H50A 3OVQA 4DBUA 2POTA 4H9YA 4H19A 4KESA 1W1A1 3Q37A 4MMWA 5JU6A 3O1NA 2YA0A 5GNXA 4AEFA 2C13A 3HV8A 2J47A 4KKXA 3GB6A 5K9DA 3DGRA 3PB0A 4JIRA 5F4SA 2FTWA 7A3HA 3MMUA 4XZMX 1KD0A 4B92A 4XD5A 5BWFA 4IOTA 4Y2WA 3NPVA 1N8FA 4W7VA 5EBUA 1RPKA 3RU8X 5DEZA 2GDUA 1IEWA 4RV8A 5DCBA 1V6YA 3MO7A 2GLKA 2V5JA 1CT5A 3NDYA 4JNYA 1ZRQA 2PF0A 3T0TA 3W1MA 1RCOB 1UUOA 1FWWA 4GWEA 4HBKA 4D1JA 3E74A 3P14A 2YCJA 5EFFA 3P8IA 3PFMA 1JFHA 4XZWA 1SQ7A 3T6CA 5FJIA 1RVGA 4AIBA 5HK4A 1ME9A 3R0KA 5E1QA 1I1WA 3PTKA 4KEVA 2ATSA 3VUPA 2BVYA 1K7FA 3MUZ1 2E7FA 1CGVA 2EGZA 3N2MA 2FZMA 4JS3A 4QSFA 3AHZA 3NL3A 4GQGA 1BWKA 4L9XA 3VK5A 4ZA0A 4LEQA 5I2UA 2YCIX 4Y9NA 2YGYA 1E0WA 2QDHA 4U4MA 3MKCA 4MWAA 3WQ8A 5HUOA 4FXFA 4INFA 4RJEA 5JBFA 3NCOA 1QDSA 2PGRA 2NLYA 2WAGA 1A3XA 1GNXA 1VF8A 3FGCA 2PD9A 3BH4A 1I6NA 3MCMA 1ISYA 4K8EA 4MSSA 3KOFA 4HPHA 4DF0A 3TP4A 1HP4A 3BZJA 4IGNA 1E6QM 1V6WA 3TN4A 3S4TA 1Q7MA 4QEEA 3B8IA 3FEMA 3AHXA 4C5ZA 5A8QA 2HCVA 1PX3A 4BI6A 4UIOA 1W8GA 2F38A 1GJPA 5ABTA 1GKPA 1BGAA 1A5LC 1V3MA 5GVJA 5FEWA 3RGTA 1Z9AA 3WBWA 1K8ZA 3E1F1 1OVDA 4V1XA 2MUCA 5F2IA 2P53A 2GVEA 1RQEA 3EWDA 2X0HA 4MPQA 5EL1A 2YR1A 4AZBA 3DI1A 2WNNA 1JI1A 3POCA 1OFRA 4IPLA 4I8YA 4LVAA 3POHA 4O13A 2Z0IA 2ISDA 3ARQA 1BVWA 2WVVB 1GPFA 1LORA 6TAAA 4TXEA 1UCWA 1TPEA 5KMYA 4KWOA 4ZENA<