2WHJA

Understanding how diverse mannanases recognise heterogeneous substrates
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
308
structure length
308
Chain Sequence
AGFYVDGNTLYDANGQPFVMRGINHGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKMVAVVEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIINIANEWYGSWDGSAWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSIHDYGQDVFNADPLKNTMFSIHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEETGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKPSTVFTDDNGGHPEPPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MANNANASE
publication title Understanding How Diverse -Mannanases Recognise Heterogeneous Substrates.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 125
structure length 308
sequence length 308
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2whjA00
4MDPA 4V28A 3RDKA 1L8NA 1KGUA 4FK9A 3K8KA 1BLIA 3IANA 2E3ZA 2Q8XA 4AY1A 1RP8A 2DGAA 1E73M 4EANA 3BAWA 4PYSA 2DT1A 3F5JA 4CVWA 3OGVA 4EE9A 3RCNA 1J0HA 4UOQA 4JKMA 3CPUA 1KQZA 3MUY1 4BA0A 3GH4A 1CXKA 2OSYA 4OIFA 1O7AA 3W0KA 4PMZA 2HISA 4ACZB 4XUYA 1JGIA 4AXNA 3KE0A 3GTNA 2WHLA 5DMYA 3LPFA 2VRQA 5I2UA 3CMJA 3ZSTA 2GDUA 3AMGA 1W3KA 2J75A 1UKQA 3ZJ8A 4B9ZA 1D2KA 3FHQA 4ZE5A 5I0DA 4JCMA 5KEZA 2VT0A 5C70A 4P7RA 2EJ1A 3VD3A 2J78A 3O9NA 3SCVA 5ABEA 3NDYA 4UFMA 3EYPA 2OLHA 2CBUA 1W2PA 1ZBWA 5I3DA 5A95A 4LYQA 1PX8A 1KBBA 3ALGA 3CZKA 1DTUA 3CIVA 3WH9A 4ACYA 2AMGA 2XWDA 1HP5A 5A94A 3WH8A 5JIPA 4RL3A 1EDTA 2G3NA 4F66A 1HKKA 1AQHA 1UWUA 3L4YA 1JZ4A 3U7BA 5A8QA 1C8YA 1MXGA 1CXEA 1K9DA 4U31A 4DWSA 3FNDA 3L4WA 3VGDA 3GBEA 2EXOA 4JCLA 1A3HA 1SYTA 2WC7A 3W4RA 3TTSA 1OWQA 4U5IA 1HXJA 4U2YA 1LF1A 4OBSA 3UG3A 1KXTA 1J0YA 3MSGA 4NSBA 3VDAA 1SMDA 4JKLA 2JF6A 1EA9C 1EH9A 3WQ8A 4UFHA 2QMKA 4TTUA 4CD6A 1MW0A 1D3CA 1E0VA 2V5DA 3WQWA 4KH2A 1KQYA 1SFSA 1N82A 5D9NA 1JAEA 4UFJA 4FLQA 3RM4A 1E6RA 1PJ9A 2VVSA 4A4AA 2XTKA 3WF2A 1UH4A 4LQ1A 3WDIA 2CBVA 3LPOA 1V3JA 1W2VA 1AQ0A 1JZ5A 3ZJ6A 4KGJA 4P8UA 3NIYA 5D8WA 4IISA 1W9BM 1HJVA 4PBGA 1K6AA 2CIPA 1VFUA 1GJWA 3I3EA 2J74A 1V3KA 3VIPA 1ZU8A 1XYFA 1XC6A 2WLYA 1BQCA 2YA1A 1CECA 1VBRA 5DEZA 1M03A 3W24A 1UOKA 4YHGA 1QHZA 1QNSA 1W1VA 5DO8A 5E0FA 1H2JA 2JIEA 5DF0A 3ARTA 2GVYA 3GH5A 3ZR5A 2QLYA 1OD8A 3K4AA 4JIEA 5CLWA 4NF7A 3GNPA 4W7VA 5A3HA 4MB1A 1XH2A 2CESA 2E0PA 1FH8A 3W28A 1BYDA 3CZGA 2BVYA 4M29A 1UR9A 2A3AA 3N1AA 5D9OA 5BWFA 2OYLA 5EMYA 2DEPA 3EDFA 4W7UA 1C8QA 4KGLA 3ZT5A 5M03A 2XUCA 2V3FA 4PSRA 5A2AA 1HJUA 4S3JA 2Y8VA 1CGTA 2CITA 1JYNA 1CDGA 1XYZA 3VIGA 3I3DA 1V08A 4HPHA 1KBKA 3AFBA 2XSAA 3VIMA 5AC4A 5I24A 2CKRA 2X1IA 2WZIA 1OGSA 1WPCA 1Q6CA 3NDZA 1J11A 3EMQA 4AIOA 4CD7A 3UCQA 2VL4A 3WD2A 3U7VA 2J7GA 4ATLA 1WDSA 2X05A 5LA0A 2UY4A 5HPCA 1L0PA 1QBBA 5JBEA 1G1YA 1VFOA 5A6MA 1MW1A 4U2ZA 5D9MA 1DHKA 1TVPA 3NCOA 3L2LA 4XZWA 2BS9A 4ZEPA 2ZUUA 4P8XA 1RH9A 4MAVA 2WWDA 4JKKA 3CHDA 4AZ6A 4UTFA 3VD5A 3SUTA 5CG0A 1UH2A 3UETA 3N18A 4JZ5A 1M53A 3T08A 5A6AA 3FXYA 4GXPA 2C0HA 3ARQA 4Y7EA 1GQIA 3OLGA 1E71M 2J7FA 1KR0A 4GKLA 4TVUA 3ECQA 1UD4A 3THDA 3WF4A 3FW6A 4AZGA 4LGXA 1W3JA 1MQPA 4CN6A 2X0HA 5CSYA 2WZEA 2O9RA 1UR2A 1UKSA 1WB0A 5A1AA 3CLWA 2FHFA 1KCKA 1E3ZA 4JFUA 3VIJA 3CGTA 4CD8A 2ZX5A 2E8ZA 2D3NA 4HZ6A 1V02A 3KL3A 3BLKA 3SCNA 3WUFA 1UQYA 1B3WA 1OB0A 5A69A 3WSUA 1KXHA 2CBIA 4AZ7A 3T09A 2MANA 2W91A 4AMCA 1DEDA 1H41A 1XV8A 3MANA 3MMDA 1AQMA 2PBOA 2VCAA 1JZ7A 1IT0A 2VVNA 1ODUA 1BYCA 1HKIA 3OZOA 5EFDA 1B3XA 2ZX8A 4KRUA 4J3TA 3AIRA 2VUYA 4DWSC 3AIVA 3W29A 2WMFA 2V3EA 3NYDA 3SCUA 1HL8A 4PMRA 3GNRA 5AYBA 1B2YA 3BH4A 2XJ7A 4LXFA 3FN9A 3WF0A 4KRTA 1S46A 3AMKA 2OYKA 1HX0A 3BMWA 2O92A 4XB3A 3WDRA 1PAMA 2WB5A 4D6FA 9CGTA 3AXXA 2DSWA 5M3WA 4UFIA 1CENA 1GOKA 4WSKA 1R85A 3WH6A 4DM2A 5A2BA 2CXGA 4CGTA 3WNNA 3ZSSA 4L4PA 4CUCA 2WCAA 2YBTA 5CPQA 2BFGA 4HA3A 3LPPA 3KZSA 2WMIA 2CHOA 4UR9A 2J47A 4E4PA 2F8QA 1LWHA 1UA3A 2J25A 5JUVA 2YDQA 4Z2IA 3II1A 3CZLA 3UR8A 3W6MA 4GQQA 5AYIA 2DT3A 1QNPA 4OJYA 2BHYA 3WMSA 1KWGA 1W1TA 4UFKA 1LLOA 4HZ7A 4E8DA 3ZT7A 3ARRA 1CGUA 1GHRA 2BHUA 1YQ2A 2WYSA 1GOMA 1JYXA 3POHA 2WMKA 1E6QM 1BPLB 2CCRA 1BGAA 2AOSA 1GQKA 2OWWA 3SCOA 5CGMA 1JZ3A 2XM1A 3UG5A 3F5LA 2ZWZA 1I75A 4WF7A 1U2YA 5BXSA 2WMGA 3HN3A 1E55A 4GO8A 2YIHA 3PTKA 2G41A 1Q6GA 2J62A 4P7OA 3A6OA 4AEFA 1FP8A 1UR0A 4BQ3A 2ZOXA 3HMCA 1F4HA 3U57A 1J0KA 3GNOA 2XFFA 4D72A 2BVTA 1V0MA 3PHAA 2OYMA 5ABFA 3PZOA 1EO5A 2WHKA 4W89A 1NP2A 3WFZA 4B9YA 2B31A 1W9PA 4OKDA 3AIBA 2PBGA 2PWDA 2JIWA 3BCFA 1J0JA 2DQXA 2YL6A 1R7OA 5BXPA 5D9PA 3QOMA 2GFTA 2UY5A 3T0DA 3AOFA 3WNLA 3UERA 2EBNA 4EAMA 1JDDA 3G6LA 4AZBA 3WEOA 2Y5EA 3AMDA 1GQJA 2W63A 3VINA 1H1NA 5CZKA 4UZSA 2EPMX 2GUYA 2O9TA 4UQAA 4MDOA 1OBAA 2WVTA 4WK9A 3CBWA 4M56A 3AS0A 3OGSA 2FGLA 4PCTA 4F9JA 3CUIA 2YOCA 3SCSA 1JAKA 4WKHA 5E6YA 2WBKA 1V3HA 1CYGA 1EDGA 1B30A 2QV4A 4DM1A 4QCFA 3RJYA 4BQ5A 1E56A 5A8PA 2GJXA 1B9ZA 4W5UA 4GI9A 1UYQA 4R5EA 3HU7A 7A3HA 4FMVA 3VU2A 1CLXA 2ESCA 2OSXA 3K4DA 4UNIA 5HDRA 5HOSA 2V38A 3AS3A 4UQDA 3IAQA 2CNCA 3K46A 3WDHA 3KEHA 4D6CA 2QMJA 4YPJA 5A6BA 1VFMA 4M8UA 1W3LA 2GK1B 2IXUA 3RO8A 1K9FA 2ZXDA 2W4XA 3W6LA 4OBRA 2G4FA 2XVKA 2XIBA 4P7QA 1XCWA 2VCBA 3VKKA 3DYPA 2E4TA 3E1F1 3ARPA 4ML4A 4CKQA 1HN1A 2XVGA 3FY1A 4C7DA 3ZQ9A 2YBUA 2PWHA 1FP9A 4CU6A 2UY2A 3RMEA 1B31A 1FFQA 3VNZA 1E1EA 1VFFA 3EDEA 4MJ4A 4Z2KA 2QPSA 3BAYA 3ZJ7A 3TP4A 1UZ1A 3B9DA 2GDVA 3PTMA 1KGWA 3WNPA 2VZUA 5I78A 3VD4A 4MB3A 2FGZA 1E72M 2XVPA 3BCDA 3CUHA 2VQUA 2W62A 1E3XA 2E40A 3KL5A 7CGTA 1NWTA 1B3YA 1C90A 2FH8A 3VMPA 2J4GA 1HJWA 3SCWA 3O6AA 2WPGA 3WNMA 1ESWA 1KWKA 3AICA 1CIUA 4PMUA 1V6WA 2A3BA 3HJEA 1JDCA 3WDQA 4ATDA 2NW0A 1DWFM 1BAGA 3T2PA 4JFVA 4UQEA 2D2OA 3B9AA 2WM0A 1ECEA 3WMBA 2WVVA 3AQUA 2VOTA 3NJ3A 3IK2A 1BFNA 4AW7A 4WLCA 2X8RA 2J7EA 1JFXA 1W9VA 1WZAA 1VBUA 1OCQA 1VEOA 1I1XA 3AXIA 1Q6DA 3SIMA 4JAWA 1VRXA 2DT2A 1GZJA 2DPEA 3L4ZA 5A8MA 4GZIA 2XIIA 2D22A 2VRKA 1VB9A 4MPKA 3L4VA 5CJ5A 1U33A 3S6TA 1QOXA 3VDBA 3SEPA 4H8HA 5CLTA 3CHFA 2VJXA 3SUVA 4BF7A 1FHDA 2AAAA 3W25A 3N17A 2ZUWA 2E9LA 5FKYA 3UEQA 2EPKX 1NQ6A 4ACZA 1E0WA 5M5DA 5LA1A 1Q6EA 2VURA 1PBGA 1IZKA 1NOUA 1TCMA 2A3HA 3CMGA 4WKAA 4QP0A 4W8LA 4PTVA 3EDJA 4WSJA 3ALFA 1EDQA 3W37A 4X9YA 4Q7NA 3OGRA 1BVNP 4D6EA 4TXEA 3AYRA 3BAXA 3T2OA 3AZTA 4FLOA 1JF6A 3ARSA 4NZCA 1V6VA 1E6SM 4MTVA 3WD3A 4B15A 2D0FA 3BGAA 4GO9A 4HU8A 4MNKA 4F8XA 3T0BA 6TAAA 1TA3B 1OT1A 3UG4A 1B3ZA 1E6PA 3B8SA 5FL0A 3OBAA 3PZ9A 5IDIA 5D4YA 3POCA 4HOWA 3SCRA 5I77A 1ISVA 2WCSA 3QHNA 4PMOA 3IJ8A 1GOWA 1ZBCA 1ZB5A 2CEQA 4UOZA 3I3BA 4QCEA 1C8XA 2DSKA 5C71A 4S3KA 5EBAA 3FHAA 1WZLA 1VJSA 1E0XA 3GXFA 2VQTA 2J7HA 1OD0A 2DSZA 2E9MA 3ARZA 3WD4A 3B9EA 3TA9A 4PMNA 2YL5A 4N42A 4PUDA 4QFUA 2JALA 2NT0A 3WUGA 1C7TA 2CERA 3S2CA 1BG9A 4OZOA 2WLZA 3RM8A 4IPLA 2ZX7A 3VMNA 3VDCA 2WSPA 4MNJA 4BZYA 1CGYA 1V3MA 1E4NA 2VZVA 1ODZA 4AZCB 4W85A 4C7FA 2BHZA 2XG9A 1IV8A 3WQ5A 2VNCA 2XWEA 3CO4A 2DDXA 4B3LA 4FLSA 2PWFA 3GXIA 5A6SA 1XSIA 4IM4A 4H41A 1CXLA 3GXDA 4PSPA 3SUWA 3M7SA 3VO0A 3WD0A 1CTNA 4MNLA 1HF6A 2WW5A 4L4OA 1CXHA 1OGBA 2FDMA 2Y2WA 2OWCA 1UD8A 2J79A 2DIJA 1HVXA 1QVBA 2CPUA 5IHSA 2XGIA 3AHTA 1Z32X 3G6MA 1ISWA 4W88A 4PEEA 1FOBA 2ZXAA 3CUJA 1R8LA 3AROA 3WBEA 3WBAA 4OOUA 4ATWA 3IAPA 1V0LA 1V03A 4J28A 4J3SA 1W1YA 2Y24A 1Y7VA 1QHOA 1JF5A 4JL2A 3VX0A 5TD4A 1O6IA 1G9HA 4W84A 1G0CA 3VILA 1WAWA 1WNOA 4QDMA 1EO7A 1EXPA 2A3CA 3AS2A 2XSBA 3CZ8A 3VOCA 2E9BA 1BTCA 1PPIA 1CGVA 2ZUVA 3NUKA 5A2CA 4UQBA 5IFTA 1U30A 3PZMA 3MMUA 1UUQA 3WH5A 2PC8A 2WANA 4J3VA 5EB8A 1W9DM 1PX4A 3MUAA 4UFLA 3ARYA 2HVMA 4XX6A 1OT2A 4MAZA 4AYSA 1MQRA 1R86A 4JFWA 1UHVA 1PIFA 1JNEA 1BSIA 3VGBA 1GONA 2DSVA 3ZR6A 1QI4A 1TMQA 1MQQA 2J77A 1RD6A 3QR3A 2C8NA 4JHOA 3MSDA 2CETA 1ZJBA 5BXTA 1UKTA 1BYAA 3WNKA 4HOXA 1E15A 5CPTA 3ZIZA 4TVCA 1LG2A 2WXDM 4P7LA 5HPOA 1WZKA 3W81A 1CPUA 1XH0A 2DH3A 2XYLA 4H8VA 3VGHA 5ECUA 4CD5A 3VGEA 8A3HA 3WKZA 1FA2A 2YJQA 5I5RA 3AIQA 1B1YA 1QI5A 1GW1A 5HNNA 4H7VA 6CGTA 1J0ZA 4H04A 1WCGA 4W93A 2FH6A 2GJRA 5JIWA 5I6SA 1LWJA 4GZEA 4GIAA 4U3CA 3FAWA 2UWFA 3ZOAA 5CGTA 1CGXA 1OSEA 1W9XA 4JFSA 1X6LA 4QAWA 2XVNA 1BG4A 1M01A 3GM8A 3VD7A 1KCLA 4Z2GA 1CXIA 3GH7A 1TE1A 3AYSA 1ZBKA 2QHAA 3WQVA 4TX8A 1TZ7A 1GORA 3NSMA 5FD0A 1PZ2A 1UD6A 4UZUA 3L2MA 1VENA 1BYBA 2XHYA 1C92A 3OA5A 1XD0A 2BVDA 1W3HA 4AC1X 3AI0A 1R7AA 2F61A 2VX7A 4J3WA 3VM5A 5IFPA 2VR5A 3WIJA 3SUUA 1CZ1A 1H0IA 4D6HA 1SR0A 1US3A 2G8ZA 3MV01 4MB4A 2Y4SA 4W87A 2DH2A 1RPKA 1G01A 1CWYA 3MMWA 1E9LA 5A8OA 1MYRA 1KB3A 1J0IA 5A8NA 3KWXA 3JUGA 4KMQA 1FFRA 5BROA 5C8BB 1E6NA 1E1FA 4URIA 1NWRA 3WUEA 1UQZA 1WDPA 4Z2JA 4AZ5A 5LYRA 1LQ0A 2J7BA 2WVSA 1DWHM 3DYMA 1XHGA 5KZ6A 3CZJA 3ZM8A 3THCA 2XFRA 3QHOA 3BAKA 3ARVA 1CEOA 2IUZA 3SCPA 4CU7A 1HT6A 4M81A 3VNYA 1V6XA 5I23A 1JG9A 4DUVA 4B3KA 4CD4A 1GOIA 2E8YA 2ZE0A 1W32A 1X1NA 1DWGM 5FL1A 1QHPA 3AIWA 3DYOA 1GHSA 4W7WA 1XD1A 2ZXQA 4M1RA 3F5KA 4ZFMA 2O9OA 4LYRA 3WMCA 4AIUA 2WSKA 4CCDA 1TFVA 4FF5A 5HBFA 4ZXOA 5DT7A 3IJ9A 2WVUA 1ZJAA 4ZENA 2YLLA 2V5CA 5FIPA 4HOZA 3BLPX 4J27A 1VEMA 1VIWA 5CQ1A 1UKPA 5DT5A 2GSJA 2WC4A 2ZIDA 3CUFA 1GVYA 5LA2A 2X2YA 3A4AA 3D3AA 3OLDA 2ZUSA 1QPKA 1JI2A 2WAGA 4J3UA 5E70A 4HTYA 3VIHA 4HZ8A 1JZ8A 2ZUTA 1MFVA 3AMLA 5GNYA 1QI2A 3KL0A 3PZUA 1Q6FA 1X6NA 1OIFA 2ZX9A 3CTTA 1UWSA 4D6JA 4M24A 4PTMA 4E8CA 5ABHA 1P6WA 2BNJA 3WELA 2VZTA 1G94A 2VCCA 2XVLA 3IJ7A 1JD7A 4DWSB 5GNXA 4XZBA 3MKKA 1H49A 3U5UA 2Z1SA 5BYWA 4DUXA 3W27A 2D20A 2CKSA 1XH1A 1WP6A 1JIBA 1VEPA 3N13A 3PN8A 1V6UA 3TONA 3CUGA 1UA7A 1LG1A 1MFUA 2WK2A 4W8BA 3ZMRA 1HJQA 3WDPP 4GZJA 4JHZA 2BY3A 3W26A 4GINA 2VX5A 4PMYA 4PCSA 4DWSD 3SCTA 1WDQA 1XGZA 3AXHA 3F4VA 4NI3A 1TUXA 8CGTA 1NOFA 5BXRA 1BVZA 1R87A 3AIEA 2WMJA 3BXWA 5JBDA 3OZPA 1J01A 3MV11 3WH7A 1J9YA 2WZHA 4D1IA 1C91A 3VTRA 2WBGA 2RGMA 2J7CA 3A3HA 2A3EA 4MB5A 1NWUA 1CNVA 1WE5A 3AISA 1D7FA 4W5ZA 1H0GA 4D6GA 7TAAA 4IUGA 3UR7A 1BF2A 3L4UA 4W86A 3EDKA 4LX4A 3OIHA 1GOOA 3N9KA 3GZAA 4TVDA 3WENA 1QBAA 2V3GA 1ZS2A 3EDDA 3K1DA 2VX6A 1C7SA 3CZEA 1JI1A 1HJSA 3WQ6A 1FH7A 3OG2A 3MS8A 2D0GA 4V27A 1UWRA 1ZBVA 2WWCA 1J18A 2GK1A 4Q22A 1ISZA 2VX4A 2FHBA 2WNWA 3WL0A 3BSHA 4RE2A 3VDHA 2EPOA 2JE8A 2J7DA 2W5FA 2VZSA 3MU7A 4CVUA 1E4IA 1E6ZA 1UD3A 4KWUA 1TG7A 4AD5A 1UWIA 1VF8A 4ZE4A 1DP0A 2Z1KA 3CHCA 5E09A 2X0YA 2J8FA 1GNXA 2G3MA 3M07A 2NSXA 3BAIA 2VRJA 1KXQA 3NSNA 1MW3A 4EKJA 1UR1A 2BY1A 2EQDA 1EIBA 1MVYA 3MUIA 6A3HA 1WZMA 2ZXBA 2ZUMA 1XCXA 1MWOA 2WMHA 1LL4A 4WJXA 1BHGA 1UG6A 3WD1A 3DHPA 2F2HA 1F4AA 1DWJM 3PZVA 1ITXA 3VIIA 2ZX6A 4AD3A 1JL8A 4CCCA 1V3LA 1XSJA 4AISA 4U33A 3ZO9A 2CHNA 1HNYA 1Q4NX 4V2XA 1BGGA 3N12A 3O2LA 2JEPA 2PF0A 3VD9A 2D23A 4PMVA 4PMXA 1NOWA 2DT0A 1ZL1A 5BCAA 1V02E 1H09A 1E5NA 3BMVA 4NRRA 4AZHA 4WIWA 3A47A 4UOJA 5I79A 2BXZA 4UQCA 1H5VA 2D24A 1GVIA 1XSKA 4GQRA 2EO7A 3W82A 2WKLA 2WHJA 1PX3A 4GI8A 4AD0A 4HA1A 3PZGA 4M82A 1J12A 4EK7A 3OLIA 4MJ2A 4QLKA 4TX6A 2JEQA 4C7GA 4CN1A 3WDJA 4CU8A 1PEZA 4U5KA 4LYPA 1GUVA 4PMQA 4BS0A 3SUSA 1GCYA 2YKKA 3VIFA 3WF3A 1E4MM 4W8AA 2GJPA 5IXEA 4UQ9A 4DUWA 2ZWYA 2ZICA 1CBGA 3MUZ1 1MW2A 2CYGA 1DWAM 4PTXA 4F79A 1JFHA 2RGLA 1PZ3A 4WKFA 4H2CA 1MXDA 4X0NA 3W53A 4Z2LA 4FLRA 3ARUA 2XM2A 2WHMA 3EBVA 1OIMA 3QOKA 4HU0A 3OB8A 1GQLA 1GJUA 1HVQA 1V0KA 2D0HA 2XGBA 1AVAA 1I1WA 1QI0A 4YN5A 5A6JA 3TOPA 2OWXA 4AD4A 1UWQA 4HMCA 3K8LA 4P7NA 3W38A 4A3HA 2YDRA 2EPNA 5E9AA 4D6IA 1EHNA 1QNOA 1LL7A 3FAXA 1EQPA 4HP5A 3WN6A 4D6DA 2D1ZA 1TA3A 1ISXA 1XRVA 5EFFA 3WUBA 4LPCA 1G5AA 1UH3A 3K8MA 2O9PA 3TTQA 1E5JA 4M80A 1HKJA 3VX1A 3L4XA 5CSUA 3QHMA 1EOKA 4D1JA 3LMYA 4AD1A 1UD2A 2VI0A 4UCFA 3RJXA 1FHLA 1JYWA 3BAJA 3T0AA 3WY1A 2WMIB 3EMCA 1M7XA 2XFYA 3VMOA 4E2OA 4D71A 2J8GA 4R27A 4RE3A 2PWGA 4TOQA 4HMEA 1J10A 1JXJA 2DSUA 3M6DA 4BCEA 2WCGA 3J7HA 3M46A 1K9TA 4JFTA 1CXFA 3ARXA 1LL6A 2G3JA 5ABGA 1LJYA 5D8ZA 1HP4A 2YLAA 1HL9A 4J7RA 2ZUNA 3PZNA 5CPSA 4JL1A 4AZCA 1B0IA 1W1PA 2PI6A 1KGXA 3BSGA 4HMDA 1W9UA 5A6LA 3WFLA 4CCEA 1JYVA 2YDSA 2FHCA 2UY3A 2VC9A 3VGGA 4OOZA 2W92A 3N15A 2BY0A 3U5YA 1OINA 2VZOA 3LPGA 1UR8A 4P8VA 1EOMA 3TTYA 3AS1A 4Z2HA 4X0VA 3CHEA 5A6KA 2G3IA 3VIOA 4OUEA 2TAAA 5HXMA 1B90A 3GXMA 3PBGA 4PMDA 5ABFB 4AD2A 2IXVA 3AIUA 3BC9A 1YHTA 4YHEA 4PRWA 3AHXA 1JZ6A 3WL1A 2WKGA 2JF7A 1US2A 1NWSA 1RP9A 5IHRA 2PWEA 4AWEA 3T2QA 5JBFA 4HPGA 3N04A 4AZIA 2VR4A 1AMYA 1TR1A 2EPLX 3A4WA 2YA2A 3UESA 3RILA 3N11A 4NRSA 5FOOA 3VVGA 1CGWA 1FH9A 1WDRA 1ISYA 2JFEX 1E40A 3DHUA 2BV9A 1QNQA 4J3XA 5BRPA 5GQBA 1QNRA 1TVNA 3CH9A 4PN2A 1VAHA 1V0NA 4AEEA 1E4LA 4A3YA 4ZXLA 1QW8A 5CXPA 5M17A 4N0RA 3D5HA 3TTOA 2WC3A 1EQCA 1HJXA 2W66A 2GJXB 1WKYA 2YL9A 3WQ4A 1EGZA 5GPRA 2YA0A 4H8UA 1SMAA 3A4XA 1V6YA 5GNZA 1H4PA 4MADA 3AZSA 4IPNB 4K68A 1K9EA 2EEXA 1NH6A 1NARA 4GI6A 4BQ2A 1JD9A 3VUPA 1UKOA 3APGA 3DECA 1UZ4A 3AZRA 3WEZA 1JDAA 1JZ2A 1NM9A 1HIZA 3AHVA 3EMZA 3AHZA 1B3VA 1IZJA 1KR1A 2OSWA 1A47A 4QLJA 1NP0A 3RIKA 2PB1A 4PUEA 3ZJKA 1E6XM 2YL8A 2Y8KA 2X09A 1E70M 1C93A 4HA4A 3PZQA 4U3AA 1M04A 4GPNA 3AMCA 1CLVA 3ZT6A 1JXKA 2C7FA 2VMFA 3RM9A 5DFAA 3RPMA 4TUFA 4QLLA 1UWTA 1UD5A 1QW9A 5A6BD 1KFWA 5FCZA 4RE4A 4XV0A 3VIKA 1EHAA 2DIEA 3PZTA 1OGGA 1WO2A 3WF1A 2XPKA 3GYCA 3SURA 1H11A 5AY7A 3WEMA 5E0CA 3QGVA 1GPFA 5AC5A 1W91A 3VM7A 3ARWA 4TTGA 4B16A 2VO5A 2V3DA 3VGFA 1C3FA 3MO4A 3PZIA 4MNMA 2QF8A 3PTQA 1ITCA 5F7UA 1DWIM 2VTFA 1QI3A 4F9DA 3WNOA 1H3GA 4P8WA 3DC0A 2BY2A 1PIGA 2BXYA 2W61A 4BQ4A 5BRQA 3NSXA 1HKMA 2W67A 1E43A 3VPLA 4CN4A 2WVVB 1V3IA 1KXVA 3GDBA 2CBJA 2QPUA 3OLEA 3SCQA 3GBDA 4AIEA 1UR4A 4PTWA 1OM0A 1VJZA 3AJ7A 5E6ZA 1GOQA 2D3LA 2NT1A 1JNDA 3L4TA 3AHYA
chains in the Genus database with same CATH superfamily
4UBPC 3OOQA 2VD8A 4MDPA 1Q6OA 1OYBA 4FR1A 3E0IA 1J2WA 3LCFA 1R2RA 3S1VA 3OVRA 3SDOA 1YXYA 4LC6A 1XYAA 1TZ9A 1QOQA 3PWIA 3CAVA 4YL2A 1QFEA 2NQHA 4HB7A 2DT1A 3F5JA 2Z2BA 3LHYA 1J0HA 3NWRA 4UOQA 1FWTA 3GH4A 1O7AA 4DBUA 4KQNA 4G8TA 4Q33A 4ACZB 4V33A 1FTXA 4AXNA 7TIMA 4NZ4A 4DELA 2WHLA 4KCVA 4EIVA 2L5HA 3BW2A 4Q4RA 2IQ0A 2QT3A 4I9TA 5I0DA 5KEZA 2I56A 3QC3A 2AQWA 3VD3A 1HKWA 1I0BA 3O9NA 3SCVA 4LBSA 2GUUA 5LNUA 3NNTA 2Z00A 1FHVA 1FWCC 3WBWA 1PX8A 1U22A 3TN5A 5DXXA 3CIVA 4ACYA 2BZNA 1SO3A 2ZTJA 2XWDA 4RV3A 3MCMA 3CYVA 3WH8A 1ONEA 2HK0A 3RLVA 4NAFA 1AQHA 1UWUA 2VDHA 3L4YA 1C8YA 3RX3A 3UXDA 3TQKA 1K9DA 1KFKA 4DWSA 4XZIA 3M5YA 3FNDA 5HR7A 4DXKA 2EXOA 3H2CA 4NJHA 4ZTXA 4ICNA 3N6HA 1WKEA 1SYTA 3ELFA 3UJFA 4U2YA 4FOKA 1KXTA 3L0KA 4RKAA 1AD1A 1EH9A 4CD6A 1D3CA 1A4LA 2UV8G 2V5DA 3NEVA 5KZMA 3HG3A 3N9SA 4UFJA 4LEFA 3TMLA 3RM4A 2YZ5A 3TROA 1J5SA 3TLQA 3WCZA 2XTKA 5AHMA 3M5VA 1AQ0A 1JZ5A 1OX4A 4P8UA 1TPDA 2YB1A 1W9BM 1HJVA 4UTMA 3M7WA 1LTDA 3A3WA 4PBGA 3E0WA 4JTUA 1VFUA 3NTYA 3NQMA 1V3KA 2PWUA 3URAA 3WLRA 1BQCA 2YA1A 1VBRA 5DEZA 3W24A 3E96A 4DO4A 1W1VA 5D38A 2OO6A 2JIEA 4C6FA 1F05A 3ARTA 2GVYA 3LXBA 1TPC1 1TO3A 4XIMA 2V8ZA 4Q8VA 5CLWA 1TUFA 4MB1A 1XH2A 1WOBA 3IGHX 3W28A 4MYAA 3VKDA 2BVYA 4WRHA 1UR9A 2GL5A 5D9OA 3PNZA 4Y6GA 5HMFA 5EMYA 3EDFA 2OB3A 1C8QA 3WLOA 3ZT5A 2V3FA 2BSLA 5A2AA 4S3JA 4E4FA 1UOZA 2GGJA 1JYNA 1CDGA 1KKOA 4NXKA 1LT8A 3DFPA 3GU2A 3VIGA 3C6CA 2XSAA 5CJNA 5AKQA 2CKRA 3O1NA 3WJYA 4F0MA 2BLEA 3P7YA 5T9BG 1EP1A 3EOSA 4C6PA 4AIOA 3UA3A 4HCLA 3PY2A 4QE5A 2VL4A 3SN0A 3WD2A 1LOLA 4A3RA 2J7GA 3MI6A 4MZ8A 4ATLA 1WDSA 1XQLA 3U6WA 2UY4A 3QSRA 5HPCA 1XCFA 4XKYA 1G6CA 1G1YA 3C56A 1VFOA 3NCOA 2BWGA 1NFPA 4XZWA 1MUMA 2FYMA 1PB0A 1RH9A 4MAVA 3VD5A 1F8IA 3WLPA 3PFRA 4X61A 2A21A 4ICCX 4CEXC 3T08A 5MHBA 3OIXA 3N3MA 4GXPA 4IF2A 2HSAA 3S9IA 1GQIA 1X8CA 2J7FA 3GS6A 1XGEA 4TVUA 3ECQA 3JR2A 3WF4A 3T7VA 4AZGA 1MQPA 1A5CA 1JPMA 3LENA 5CSYA 3PBYA 4ALDA 2DZUA 2QDGA 3PJXA 1EC8A 3OZMA 3H2MA 3CLWA 1RALA 2JQXA 1KCKA 5T26A 1RSCA 1YNPA 3S5SA 4UB9A 2QIIA 4DJFA 2PDBA 2ZX5A 4HK5A 1OY0A 4LRTA 1QXLA 3W72A 3UCDA 4EPKA 3K5XA 4QE4A 1WUEA 1ZCCA 1HO1A 1TWWA 1RAKA 4KWOA 3WSUA 1M68A 4NNBA 4GJ1A 2WJZA 3KCJA 2JKAA 4FSAA 1H41A 3MANA 1FDJA 1ZQ5A 1PVNA 2VVNA 1ODUA 5I3HA 2ZVRA 4C6BA 2OX1A 2E1DA 1ONWA 4M6UA 3AIRA 4IXXA 3AIVA 4O12A 3NYDA 1R3WA 4QSFA 2I57A 1I45A 3NPUA 4JQ2A 2GDQA 4WHBA 4L6DA 5AYBA 4HD5A 2XJ7A 5H1WA 5G4WA 3W7NA 1S5NA 3I4KA 3ITLA 3KHJA 3AMKA 1EJRC 2PMQA 3W7RA 1E0TA 3H70A 1W31A 4XB3A 3TW6A 3W70A 3WDRA 4ZQNA 3AXXA 3AU6A 1T8XA 3C2YA 4UFIA 1CENA 5AZ1A 3QQ0A 4P5UA 9XIMA 1DBTA 4WSKA 1VFSA 1V7AA 3MQTA 1E9ZB 3FYOA 4MM1A 2YBTA 4OTKA 5CPQA 1MEWA 1XI3A 1XIHA 4LUJA 3BK0A 2VC6A 4UXDA 3LPPA 1A5NC 2CHOA 2J25A 3OQ8A 3GNXA 2YXXA 1KWGA 3OHIA 1SW3A 1N8FA 6XIAA 3I7QA 4E8DA 1GVSA 3SFKA 2QCLA 2PDGA 3V18A 4LYKA 3IIOA 1KFLA 2WYSA 1GOMA 3LLFA 1KC7A 2WMKA 1BPLB 1BGAA 1ZTVA 1TKKA 2XM1A 1AJZA 2I5GA 1I75A 4XBJA 3PUOA 1W5QA 1E55A 3PTKA 3D0CA 2E25A 4NZ5A 1YMYA 1ZAIA 1UUMA 1TQJA 1TPFA 1F76A 5HAOA 5LZLA 4TX9A 1F4HA 2QJGA 3U57A 2GQ8A 4ZOCA 3PHAA 1EO5A 4A8NA 4IMDA 3GR8A 1W9PA 4OKDA 3RPTA 2PWDA 4R7WA 3CC1A 1YADA 3HG4A 2NV9A 2UY5A 3ZXWA 3C3UA 4R3UA 2I1OA 3EWWA 3OVPA 2DZWA 5D04C 3AMDA 1H1NA 1H7OA 5ECVA 2NV1A 4MDOA 3HURA 4QG8A 3XINA 3T44A 4WK9A 4HNTA 1SU5A 2CHRA 3AS0A 2P5NA 4F9JA 5L9FA 3CUIA 3SO7A 1Y0EA 4O50A 4US5D 1KRMA 3SCSA 3W74A 4FXRA 4DAIA 4XBSA 1JAKA 4WKHA 4YVPA 1P48A 1V3HA 1EDGA 1S5MA 4QCFA 4BQ5A 1E56A 4X3ZA 3E3HA 3NYZA 2GJXA 4B4HA 1B9ZA 1JPIA 1EJSC 1IXNA 1K8XA 2JKPA 2VFHA 1SSGA 1UPPA 3K4DA 1VYSX 3TW9A 4Y90A 3SZ8A 2CNCA 3GHUA 3KEHA 4D6CA 4F2UA 1SJCA 3IUIA 3E2RA 4M8UA 1W3LA 4RJEA 3RCMA 3RO8A 3T1GA 3V3WA 1WXZA 2NQZA 3EX2A 2G4FA 3CWOX 4P7QA 1WDWA 4S3AA 3ABXA 1XCWA 4GKTA 1CLKA 5HNRA 3UVIA 1HN1A 2XVGA 4C7DA 3INPA 3ERPA 3S42A 2ACQA 2PWHA 2NVDA 2OOGA 5E0KA 3B04A 3VNZA 2QPSA 3BAYA 5H8MA 1FDZA 3OO2A 3EPOA 1T96A 1NFBA 1YXDA 4Q8TA 1GZGA 4I9JA 3D6NA 3VD4A 2E6DA 5XIAA 2GJLA 3DN5A 3VZZA 2INEA 2W62A 1E3XA 3KL5A 7CGTA 4IXHA 2CLEA 1W5MA 4BF9A 2P0IA 5I06A 2FH8A 3VMPA 3S8HA 2BOGX 1HJWA 4FF7A 5KZEA 3O6AA 4KCTA 1KWKA 3FJNA 4GBDA 3WK3A 4OVXA 1V6WA 4NUWA 2FMOA 3HJEA 6ALDA 2NW0A 1J4EA 3P67A 4QX4A 3GDMA 1AJ0A 4L4LA 3GX9A 3S47A 2WM0A 2WVVA 1PKYA 3M0KA 1OZQA 3ONCA 3LS9A 1AJ2A 1VIZA 1JFXA 2OODA 1DL3A 3TYDA 1J79A 1PXGA 2DQWA 3RX4A 2VGGA 2YGYA 2DT2A 1GZJA 3V35A 3UZZA 2CZFA 2VRKA 5F4SA 4G1KA 5BOOA 4MPKA 4E4UA 3S6TA 2CLFA 4UR8A 3O3RA 2JGQA 3SEPA 3B0UX 3LTSA 4WDTA 2AAAA 3AALA 3W25A 3TX9A 4Y8FA 2PSNA 2EPKX 4ACZA 1E0WA 2DW6A 2PCEA 2VURA 1ZSXA 1WUFA 2WJEA 3L5MA 3CMGA 4W8LA 3EDJA 2ACRA 4G1NA 4CNSA 1BVNP 3JRKA 2Q71A 4FLOA 4L64A 5FF4A 1HKVA 1TREA 4RDWA 4GIRA 4MTVA 3E6EA 3PAOA 5K9DA 3THUA 4EAYA 4M0XA 1B3ZA 4YS1A 1E6PA 3B8SA 5FL0A 2MNRA 4HOWA 5I77A 4YTTA 3GDTA 3SR7A 1ISVA 2WCSA 3QHNA 1GOWA 3FEQA 4NZ3A 4H6QA 1DJGA 1C8XA 2BGSA 4HT3A 3G77A 1MI3A 3IIVA 4KFNA 3GXFA 1KTCA 2X7VA 1Z48A 6XIMA 4IGNA 2DSZA 2CZVA 3ITTA 1S5TA 4PMNA 3TA9A 2YXGA 2YL5A 4N42A 4ERAA 1QK0A 2XH7A 3R10A 4B92A 4MKNA 4IPLA 2UBPC 4AHOA 5D09A 3VDCA 1J93A 8XIMA 1TV4A 4MNJA 1CGYA 4JTRA 1A50A 1YKWA 2QQ6A 1E51A 4AZCB 3BQ6A 4C7FA 1PL9A 1OJXA 5TIMA 1NJJA 2POZA 2GZXA 4X9SA 2J66A 5A6SA 4N9EA 3SBFA 2A7NA 4H41A 4RXGA 4PSPA 3MA8A 3R4IA 4BWLC 1CTNA 4WZHA 1HF6A 4L4OA 3EGJA 2Y2WA 4HHPA 2OWCA 1Q3NA 2DIJA 1PHQA 2CPUA 1NDVA 1ZCOA 4CNTA 1F3TA 4DI9A 3G6MA 5TBOA 3CUJA 4LOCA 1IYXA 2PD9A 4OOUA 1V0LA 1V03A 4J3SA 2DUXA 1ME8A 4FNPA 1AW2A 1JF5A 3KDOA 4WX2A 4JL2A 3VX0A 1MUCA 1O6IA 5EY5A 1NF0A 1G9HA 4W84A 4K1WA 4LTSA 4FXFA 1AH0A 5LNRA 4WJ8A 2A3CA 3MJMA 2GQAA 3QPEA 3MT1A 2E9BA 2ZUVA 5IFTA 1TELA 4UQBA 1TSIA 3UY7A 1UUQA 3T81A 1S2WA 4M1BA 2BDQA 1DIDA 3IJLA 1VR6A 4XWUA 5I3GA 3MUAA 5LNSA 3EX1A 1I4NA 4MAZA 1MQRA 1R86A 4I8YA 1GONA 1A5BA 2C1HA 4C6KA 2I5IA 1RD6A 3QR3A 2C8NA 4FHAA 4JHOA 3MSDA 5LNVA 3MW7A 2CETA 2IPWA 1BYAA 2W3ZA 1E15A 4PC8A 1LG2A 2Z1VA 1L6SA 5G1MA 1WZKA 4OV4A 3W81A 1CPUA 2HS8A 4DF1A 3B8DA 3SRHA 4B3ZA 4CD5A 3QR1A 1FKWA 4X2RA 1H1ZA 4IHCA 4YVXA 3ZYZA 3P81A 4O1CA 5I5RA 3AIQA 1W17A 5A6TC 3P80A 2R24A 3OW1A 3C0SA 4XUGA 4NILA 1ME9A 4NP7A 3MC5A 3UWWA 4GH3A 3C0LA 1EKOA 3Q58A 4GZEA 3GSMA 1QMLA 2WNZA 4POCA 2UWFA 3E5PA 2GVLA 1OSEA 2PTZA 4UTJA 4JFSA 3JS3A 4QAWA 1BWVA 3W7JA 2HWGA 3P62A 3GM8A 3ABZA 1U5HA 2YX0A 2FGBA 1FWDC 1DVJA 2YCLB 1W8SA 3R94A 3GH7A 2FZ9A 1ZBKA 4Y9PA 3WQVA 1E9IA 4KEZA 3KTSA 5TAOA 3CT7A 1TB3A 2XHYA 3NFUA 1XD0A 1W3HA 1EBGA 4J3WA 5AYYA 5IFPA 1XGDA 4R7OA 3E38A 1H0IA 3VABA 1RCQA 4D6HA 2ISDA 2Y4SA 2C6QA 2DH2A 4RV8A 1G01A 1KKRA 1XLIA 4Q8OA 5A8OA 5A8NA 3E2QA 2XDFA 1DIEA 1FFRA 4BHYA 4B5SA 2Z7KA 1NWRA 5H2ZA 4XZ9A 4AZ5A 2WVSA 4PUNA 3DYMA 1EJVC 1GTHA 3O07A 3ZM8A 1XBYA 1CEOA 2P3EA 4YTRA 3RU6A 4GFSA 1KBJA 3SCPA 1XRTA 1O12A 3LZ3A 1KA9F 3VNYA 4WY0B 1JG9A 1GGOA 1H7XA 4DN1A 2ABBA 5M1TA 2E28A 1X1NA 1GVQA 5FL1A 1QHPA 1GYLA 3MYOA 4NASA 2PF8A 4RNFA 4KIRA 3F5KA 2OXNA 3QJAA 4EPBC 5HQMA 3CQIA 1ZJAA 4I5RA 4Y96A 3VXGA 4QDPA 4HOZA 3BLPX 3QLLA 3WLIA 3WBXA 5B80A 3RITA 3D3AA 4DAFA 3ZWTA 1OFQA 3C2VA 1JZ8A 4GYFA 1MFVA 3EOLA 1QI2A 3LA4A 3PZUA 3CTTA 3EX6A 4K7YA 3M9YA 3ATZA 3L2IA 2BNJA 1O4UA 3WELA 2VZTA 2CLIA 4JX4A 5GNXA 4TO8A 1H49A 3EWUA 1JJKA 3TC7A 4JN7A 4DX3A 5BYWA 4DUXA 1M1BA 3W27A 4EWJA 2D20A 1FWEC 4REQB 1HW6A 4QDWA 3SGUA 2I14A 1VEPA 3N13A 3PN8A 2QEZA 4US5A 1S2AA 4C65A 1UA7A 4C6IA 5C6MA 4NJIA 4R34A 1MFUA 3P5YA 4M3PA 1XIGA 3FJ4A 4W8BA 4JIQA 3DOPA 4LBRA 3PC0A 4GZJA 3LM7A 1VPQA 3S0CA 1XGZA 2YFOA 4WVXA 3QPZA 2BB0A 4LBUA 1R2TA 3AIEA 2WMJA 4W9TA 4ZFCA 3U2OA 3CM4A 3B0XA 1P4CA 3LY0A 2OGJA 1EB3A 1J01A 4HJFA 4Z0SA 3XIMA 3CAQA 5GJPA 1X96A 4ZODA 2ISVA 2Y89A 2YDAA 2VDIA 3CU2A 3C61A 5DMMA 4DZAA 1YX1A 3ZWSA 4Q7IA 3CV7A 2EG6A 1H0GA 1GZ1A 4D6GA 4IP7A 2Z6IA 3E0VA 1XR2A 3L4UA 1TWDA 3EDKA 4GCAA 3OIHA 2HBVA 5CC3A 3N9KA 3NQEA 4TVDA 4DVOA 1QBAA 3K1DA 1ZS2A 1C7SA 1JI1A 4WD0A 5K9XA 2D0GA 3LNPA 3GDLA 2DJXA 3E0FA 4Q32A 1ZBVA 2WWCA 3CH0A 3APYA 3GFYA 4Q22A 1ISZA 2FHBA 2Q8ZA 4LUTB 3BSHA 4UWMA 1I6NA 3WQPA 5M2FX 1F8MA 3NM1A 3NO3A 3HPXA 3CHCA 5E09A 3AYVA 2A79A 1H61A 2HDJA 4DBEA 3KTXA 2VRJA 2ZZ1A 1XYMA 4EKJA 1UR1A 4D9PA 1EIBA 6A3HA 1DJWA 1KM5A 5FI8A 3ITXA 4QNEA 3LU2A 1J6PA 4L7ZA 1GT8A 2ISWA 1J96A 3M0XA 3PZVA 5D32A 4LAKA 2H8ZA 1XSJA 4FOUA 1RY8A 4AISA 4Z42C 1V77A 3ZO9A 1OF6A 1Q4NX 3GFXA 2NVCA 1BGGA 2JEPA 4LY4A 4Q8WA 3U8GA 4PMVA 4QQ3A 5BCAA 3MVTA 3H4WA 3P14A 2FIQA 2E7FA 4MVAA 3DBNA 3BMVA 3CV1A 3ITYA 4NRRA 4A3QA 4KEVA 3GU9A 3PR2A 2YYUA 4CQDA 1H5VA 2D24A 4GQRA 2C18A 4AHPA 3GRIA 1FCUA 1PX3A 3SQSA 4UTLA 4M82A 1J12A 4EK7A 4QLKA 4CN1A 3WDJA 4CU8A 1PEZA 3NZPA 4U5KA 1GUVA 1I2OA 2X1UA 4PMQA 2FFCA 3VIFA 4W8AA 4UQ9A 4DUWA 1OX6A 4IFOA 2ZWYA 1CBGA 2CYGA 4A8RA 1JRBA 1XLHA 3MO7A 3B8UA 3N2TA 5A8GA 3W53A 2Y85A 3ARUA 1OIMA 3QGAC 4I6KA 1SZFA 4Q4OA 4QG9A 1AVAA 1I1WA 1QI0A 4YN5A 2P88A 3BL3A 2OWXA 4AD4A 2PP1A 3W38A 3H12A 4MIMA 1EHNA 1QNOA 5CZTA 3TYUA 4I7WA 4HP5A 3URNA 3WN6A 4D6DA 2D1ZA 2G97A 3M0IA 4J9JA 4LPCA 3SRFA 3PF3A 1G5AA 1TWIA 2KX9A 2O9PA 3TTQA 3HG5A 3BDKA 1ZY9A 3VK5A 4M80A 3PBMA 1HKJA 1EL3A 1A49A 2YR1A 4D1JA 4L5ZA 3ZLHA 4NJGA 3NXLA 1UD2A 2AKZA 1I2NA 4JTGA 4V1XA 1JPDX 3RJXA 4GA8A 4O8RA 2WMIB 3TV8A 3TJ4A 1K77A 2ZZ7A 2V9DA 4D71A 4KERA 4R27A 3SQMA 3WJZA 1J10A 1OG6A 4L9XA 4C6CA 4OHQA 1XS2A 1Z44A 5G4HC 1K9TA 4NU7A 2OU4A 4LH8A 1LL6A 2PGRA 5D8ZA 3R12A 5HATA 2ZUNA 3PZNA 1XIJA 4AZCA 3BARA 1W1PA 3OG3A 1KFCA 1K03A 5G4EA 4B5NA 4HMDA 1VYRA 3BUVA 4M7SA 4L56A 1W9UA 5HULA 5EU9A 2YDSA 4OOZA 2W92A 1B57A 5FESA 1EOMA 4GQGA 3N2XA 1EFZA 4Z2HA 4E0CA 5A6KA 2JKEA 2YSWA 1T5AA 5HXMA 3SSJA 2PDMA 3PBGA 4AD2A 4LUSB 5HJYA 2IXVA 3QYQA 1YHTA 3UG8A 3ZVHA 4QXIA 2WKGA 1AK5A 1DQUA 2TSYA 2JF7A 3MP4A 4QS5A 3L65A 1RP9A 1T6MA 4HPXA 4YXGA 3T2QA 3ZS4A 5JBFA 3NZRA 3G0SA 3DIPA 5C7HA 3FS2A 1E9YB 3AXKA 4FAMA 3N11A 1ISYA 2JFEX 1MXSA 4B5VA 4H00A 3DHUA 4AB4A 3SFWA 3W6YA 1A0DA 1QNQA 3BW3A 5BRPA 5K7JA 3CH9A 3GO2A 1NIUA 4MSSA 1G4PA 3TVAA 5D2WA 4NHVA 3NQDA 2FTPA 4N0RA 3UPWA 2FZDA 1F6YA 1DPMA 2WC3A 3S5ZA 4AIBA 4Q4KA 1RA5A 3V36A 3IIXA 2X30A 4L80A 4QJ5B 2YA0A 1B3OA 1VYPX 4H8UA 3AZSA 4Q7BA 5AZ0A 1QU4A 2EEXA 3N29A 4IMGA 3KHDA 1AH3A 1EJXC 1NM9A 3AHZA 1YDNA 1KR1A 5FJTA 1US0A 3OU8A 2UZ9A 3LCIA 2RDUA 4QLJA 3U9IA 1TJ2A 4NJJA 2PUZA 3ZJKA 1E6XM 2YL8A 4INFA 5GJNA 3GDRA 4H9YA 2O7SA 1QCWA 3ABSA 2GOKA 2INZA 4OV9A 5H6HA 2PODA 1EA0A 2NX1A 4NYYA 3RM9A 1L6GA 2H3DA 3TJIA 3I7SA 1IIHA 1MSSA 3N4AA 1YDYA 1KFWA 3UZJA 4RE4A 2YCLA 3VIKA 5HWMA 5JXQA 1WO2A 4RNIA 3TFCA 1D9EA 5AY7A 1XLFA 3WEMA 1GPFA 1K02A 5AC5A 1I2QA 1F5ZA 3VM7A 3IUHA 4TTGA 3CNYA 1YE4A 4GX9A 4JDYA 3DFYA 4GACA 4KFOA 2QF8A 5CAKA 1QI3A 3PWAA 2NLYA 3W2NA 4ZR8A 3DC0A 2OZ3A 2W67A 4OECA 3OVGA 4Q4QA 3OLEA 4AIEA 1UR4A 4L65A 3M64A 3TQPA 1W5NA 1M7OA 1KGUA 2TYSA 3MUCA 1F61A 3V0UA 1FUYA 3NQ2A 1QT1A 2Z1XA 1DE5A 2D73A 3FX4A 1P6CA 3TYZA 3WFAA 2DGAA 4RXFA 3OJGA 1NVMA 1TPVA 2HS6A 1S2VA 4EANA 4WY0A 1SPQA 4DPPA 3OGVA 1B54A 3MJYA 3MUY1 4LB3A 4BA0A 3W0KA 2CWNA 4FXSA 2HISA 1Q2SA 4XUYA 2VEMA 2EKCA 5C2XA 1SZEA 2JK2A 2VRQA 2VEGA 5C9ZA 3M4HA 4ZE5A 4JCMA 3PPGA 3HJZA 3FDKA 5TF0A 2FQIA 4P7RA 2EJ1A 3QR0A 5ABEA 4GWEA 3KRBA 4UFMA 1H7NA 2OLHA 1W2PA 3UQNA 3O8AA 3C2OA 3M0HA 4LYQA 3KVMA 3ALGA 3CZKA 3WH9A 4GFIA 1BWLA 1QTWA 4FIRA 2ACSA 3RN6A 3TYCA 2FMNA 3UXKA 1HKKA 4GXMA 4ZO8A 2QCNA 1MXGA 1F3XA 4U31A 1LROA 4TQTA 2OZ8A 2RDXA 1TIMA 3VGDA 1A5AA 5AC8A 4OBTA 1N7KA 2CLHA 1A3HA 2VD9A 2WC7A 4REQA 3W4RA 3B0VC 3LXCA 1WYIA 4OBSA 4TIMA 3CS2A 1SMDA 4JKLA 2JF6A 4UFHA 2QMKA 1MW0A 3V4BA 3F4NA 4BK9A 2DZXA 1XDMA 3LXAA 1Q2RA 1JAEA 4IIHA 2Y0FA 4FLQA 4NQ1A 5H8PA 3S9ZA 2Y70A 4A4AA 2FPTA 4GUGA 3WF2A 4LQ1A 3WDIA 3LPOA 5CC7A 1W2VA 2JBMA 4XVEA 3UJ2A 3B0YA 5D8WA 2PP0A 3TSDA 3FVMA 4B5XA 3SN1A 3EAUA 1GJWA 1DJNA 1NFGA 2J74A 1F7BA 2FZBA 3I3EA 2GOUA 1ZU8A 3TAOA 2PDFA 1YBQB 2WLYA 1TJRA 3MYPA 1KFBA 1UOKA 4P2VA 1PUDA 1QHZA 3KRUA 2J13A 3IVTA 2TMDA 3QKEA 2XH4A 3UNTA 4H9XA 3BZGA 5C7VA 4NF7A 3GNPA 2NQJA 3FGCB 2CESA 3LCGA 2ANUA 3STEA 1FH8A 1BYDA 1QO5A 4M29A 2QUNA 1SVDA 5FEZA 4O0QA 4GABA 2V68A 3I65A 3LEPA 3PTDA 4KGLA 4IQDA 1H50A 2Y8VA 4Q3MA 2CITA 3VOGA 2OO0A 1LLWA 1PZ1A 5FJJA 4HPHA 4LUTA 1HO4A 1KBKA 3AFBA 5AC4A 4YYCA 5I24A 3FSTA 5C2CA 5D2TA 2WZIA 3OA3A 1OGSA 5KETA 2ISFA 4CNPA 3NOEA 1U5VA 3BSMA 4LY8A 1UC5A 3T4WA 3UCQA 3V5FA 1MRQA 3L7RA 4C60A 4PULA 4X63A 3A22A 1L0PA 4ASTA 1QBBA 2DVTA 5LHFA 3FVDA 1A0EA 4U2ZA 1I9CB 3ZLGA 2BS9A 2QCMA 4P8XA 2ZUUA 3CXOA 2KZHA 3TXZA 4XD6A 2WWDA 3ZR4A 3CHDA 3GW0A 4PB4A 5I03A 4PCNA 4ZQRA 5CG0A 4QROA 1Y65A 2AGTA 2VM8A 4L9YA 4JXCA 5A6AA 3ORWA 3W2JA 3ARQA 4Y7EA 3OP2A 3UR5A 3OLGA 1KR0A 4KT2A 4CQCA 3MP5A 1C29A 1VCVA 4CN6A 5DELA 4KWVA 1RJQA 1WB0A 2PZNA 3R8RA 3NL3A 2FHFA 1E3ZA 4JFUA 3GC5A 3CGTA 3BOXA 3GG7A 3BPWA 1EC7A 2OKTA 3KRZA 2WQDA 3HGOA 5D37A 1V4YA 2P53A 3LHUA 3I68A 3KL3A 4RZ5A 1BVWA 3W9ZA 1SGJA 3WUFA 3TYBA 1VQTA 1B3WA 2VENA 4AZ7A 4XQ6A 2HXTA 4AMCA 4S2BA 3MI3A 3ZZ1A 1XV8A 3MMDA 1KRBC 4JDBA 2PBOA 1JZ7A 1IT0A 3L68A 1R9YA 5JMUA 4LV9A 3W71A 3FV9A 2IKIA 4QTGA 5AVHA 1HKIA 1KM6A 3OZOA 4L9ZA 6REQB 1REQB 2ZX8A 4KRUA 3THQA 3IGXA 3S83A 2VDGA 1Q85A 2WSQA 3W1AA 3SCUA 5C0QA 4PMRA 2DZPA 5DQPA 3S1XA 1BRLB 2PDJA 3UWVA 4IOTA 2OYKA 3V75A 1HX0A 3BMWA 5HNTA 1XIEA 1VHCA 3RUBL 9CGTA 2DSWA 3FXGA 5M3WA 4PZVA 2HCVA 3LBMA 1RLDA 3EWYA 3PSVA 3WH6A 4Z1YA 2BG5A 3WNNA 3ZSSA 4L4PA 4CUCA 2BFGA 1DXEA 3E2SA 1MEHA 1VCGA 2WMIA 1H7WA 3EX3A 1TJ1A 5JUVA 4Z2IA 1KRAC 3CZLA 2QW5A 5AYIA 1TTQA 4HZ7A 1IIGA 3R0KA 1CGUA 3HGRA 2REQB 2BHUA 4DIAA 4IMAA 1T0OA 3FKKA 1JYXA 1LUCB 1E6QM 2CCRA 1Q6RA 4DLFA 2AOSA 5C55A 1GQKA 5XINA 1TMLA 2OWWA 3G1XA 3UG5A 5HUPA 4FALA 3ABOA 1VH7A 2YBVA 4RUBA 2ASHA 4GYPC 4AQLA 3LD5A 2ISSA 2WMGA 2BASA 3GUGA 1R38A 3LGEA 1F07A 5IDZA 1P6BA 3DH7A 1JCLA 3EA2A 3MDWA 4P7OA 4AWTA 1FP8A 1UR0A 4BQ3A 2ZOXA 3I6TA 5EL1A 2ZZ2A 4GNKB 4YVVA 2F9RA 3NZ1A 2ICSA 2OYMA 4LUSA 1NP2A 3AIBA 4O53A 1F73A 2JIWA 3QLDA 3N6JA 1X38A 2YL6A 1R7OA 5DBTA 2GFTA 1ZPTA 1ZJHA 3T0DA 3AOFA 3YPIA 3A5VA 3BJTA 4EAMA 3FEMA 3E2VA 4AZBA 4ADSA 3CMFA 3LLXA 1MNZA 3VINA 4M19A 2GUYA 4UQAA 4O13A 1OBAA 4DZHA 2WVTA 4XD3A 5ENLA 3OGSA 2FGLA 1EBHA 2O56A 2R6OA 5E6YA 4UMBA 2QV4A 5F2MA 4RR4A 4O17A 1FHUA 1O5XA 1THFD 3EWXA 4JTSA 5A8PA 4GOAA 1AQFA 3KCOA 4R5EA 3HU7A 4FMVA 3PBUA 2G3FA 3VU2A 2BOFX 2ESCA 5HOSA 2V38A 4FNSA 3GD6A 3IAQA 3ID7A 3WDHA 2BVWA 4ES4A 4NX0A 3REQB 4YPJA 3RG6A 5I7GA 2IXUA 1FWAC 1K9FA 2ZXDA 2W4XA 1VLWA 4BWLA 3RRAA 4YJ5A 5D02A 4HNVA 3KBJA 4AVOA 3DYPA 3E1F1 3ARPA 2A6LA 2ZFAA 2PE4A 4S3DA 3Q45A 2YBUA 1A5MC 4FB7A 3DG3A 3R11A 4MJ4A 3G1RA 3M41A 1UZ1A 1SFJA 1P1XA 3H2NA 2VZUA 2Z2AA 3TC3A 1RY0A 2XVPA 3LERA 4CQ8A 3BCDA 3CUHA 3ZVIA 2VQUA 1Q7QA 4NZJA 4YLWA 3PJWA 1NWTA 5AHIA 4M6QA 1QATA 1T99A 3TQ0A 2J4GA 1PTGA 2Q09A 2WPGA 1ESWA 3AICA 1JCYA 4FOJA 4PMUA 3H2OA 1OQFA 4JOMA 1JDCA 1MNSA 2G0WA 4N6FA 3WDQA 4GVHA 1EF2A 2D2OA 3WMBA 1H63A 3IK2A 4AW7A 5CGQA 1CCWB 3TC6A 2WSYA 1VBUA 5BU9A 2Y63A 3TJXA 2ALDA 4DXXA 1OCQA 3SW6A 2C3ZA 1I1XA 1Q6DA 2OPJA 3SIMA 1AFSA 1VRXA 4TMBA 3EKGA 2BX7A 2DPEA 1JGMA 1VPYA 1VB9A 4XSLA 4EX4A 5DY3A 2NLIA 1OYCA 1U33A 3SY1A 1HFBA 1O5QA 3NO5A 4JNYA 5CLTA 3TW7A 5G2IA 3U2EA 5FKYA 3UU0A 1NQ6A 4N4QA 5M5DA 1Q6EA 1XBZA 1AG1O 1IEWA 1TCMA 4WKAA 5D2XA 4QP0A 4GJIA 1EDQA 4WXYA 2VFIA 3B3DA 3EWCA 3OGRA 4KESA 3GVWA 4TXEA 2Z25A 3AYRA 1FWRA 3T2OA 1JF6A 1AL7A 3LUTA 3UZYA 3OBEA 4OE7A 1V6VA 1WQ5A 1E6SM 4LWWA 3WD3A 1RUSA 3BGAA 4HU8A 4MNKA 4F8XA 3BICA 4GGHA 3UG4A 3OBAA 3MPGA 5D4YA 5DRCA 3UA4A 1N8IA 3HF3A 1DJZA 2DJLA 1UB3A 4JTLA 5I3KA 4ILSA 1UASA 1ZBCA 4HNNA 2WZTA 2CEQA 3BG5A 4F40A 2A5HA 3MDUA 3EEGA 4S1FA 1HG3A 4AX6A 4GLEA 3O7UA 4S3KA 2XN1A 2VQTA 3IJIA 4WGHA 1AD4A 4MWAE 2OX4A 1PWLA 2E9MA 3WD4A 4QJ1A 4GRSA 3W1MA 4LVGA 4N4PA 4Z1CA 3LOTA 3L12A 1C7TA 4J40A 2OEMA 4BEUA 4BF5A 5GJMA 4OZOA 2Z1WA 3IV8A 3V0SA 4MY9A 4KFPA 1XLMA 3TYAA 3W7CA 4LS1A 7ENLA 1E4NA 1I2PA 2VZVA 4MZ1A 2IPFA 4R53A 1NAL1 1M7JA 1K6WA 3CAKA 4JQ4A 1EF3A 4HTBA 1SZGA 3T9PA 3T55A 3F2DA 1YXCA 1BD0A 1NDYA 2NSOA 4BFAA 2DDXA 3COTA 4FLSA 3LBOA 1XSIA 3L0GA 3AWOA 1L6WA 3GXDA 1YBQA 4Q8PA 1VFHA 3M7SA 3B8WA 5I09A 1AW5A 3UFYA 3B4YA 5JH2A 1CXHA 2FDMA 2J88A 4PRRA 1EX5A 2J79A 3NPXA 4XTDA 2J9XA 3VFLA 2A3LA 1EZWA 2V69A 5IHSA 2FTYA 1YTKA 3HQOA 3FGCA 4W88A 4PEEA 1FOBA 4JQ1A 2NZLA 3E5BA 3WJXA 3KAOA 2PZ0A 3WBEA 3OVQA 1KV5A 3IIPA 4GC3A 1GG0A 3VZYA 1QHOA 4GUFA 4FNUA 4YWIA 1TJ0A 1DIOA 1XLJA 1XISA 1UPMB 2P50A 4XIAA 2ZADA 2XSBA 4HGXA 1GQNA 3CZ8A 4GH1A 5A2CA 3C2RA 1U30A 2X40A 2AQOA 2PC8A 4IFKB 4J3VA 3Q67A 7PTDA 3UWYA 1GKQA 1PX4A 2B7QA 4G9PA 2B7PA 2HVMA 1S39A 4LAOA 3H23A 4AYSA 2OG9A 3MUXA 3TMQA 2DSVA 3SJNA 5GVJA 4R7JA 1UW9A 3D3FA 2Y7EA 3TNOA 3UJSA 2E6FA 2ALRA 5JQ9A 5BXTA 3IPWA 1R2SA 3WNKA 3RYSA 5TQLA 4HOXA 2Q3RA 5CPTA 4PB3A 2WXDM 4WXZA 4P7LA 3VGHA 2CLMA 2FDSA 2PTYA 2HE5A 3USZA 5AVNA 1JEZA 1B1YA 2H6RA 1GW1A 3KBWA 4X2PA 5HNNA 4B90A 4FR6A 4E38A 2DZTA 4R33A 2R82A 4A8IA 1RK6A 3NL2A 4W93A 5LNWA 3O16A 4DYKA 3N4EA 2GJRA 5CG7A 3R0UA 2XN0A 3FAWA 1H62A 1S3HA 3RMJA 1O95A 2ADAA 5A5WA 3W7QA 2WJDA 5K4XA 3EXTA 1D3GA 2Z28A 4O0KA 3W07A 2PLCA 1M01A 4O10A 1OZMA 1KCLA 3GXPA 2J9YA 3N19B 1TE1A 2WQPA 1TZ7A 1GORA 4ZO6A 2GGEA 3NSMA 1VENA 2EG8A 1BYBA 1OFBA 3TQVA 2ZZ3A 3S2LA 4XSMA 3DI0A 3AI0A 4AWUA 5E93A 2VX7A 3VM5A 2VR5A 1TWSA 2FPVA 4H8NA 4I9MA 3SUUA 1JQXA 4HHHA 1SR0A 4NY2A 2G8ZA 1PTAA 3MV01 4JTKA 4MB4A 3C2EA 4Q8QA 1S38A 3T42A 3MMWA 4LS2A 1MYRA 1J0IA 3KWXA 3CAWA 3KFTA 3OHMB 6REQA 1REQA 2ZDSA 4IIBA 4Z2JA 5LYRA 2J7BA 4F3HA 1DWHM 2AAMA 1XYLA 1XHGA 1QPQA 2R1KA 3N2MA 3CZJA 4Z1BA 1QPRA 1XQKA 4PUKA 1BRLA 5HQLA 1ZAHA 3BAKA 3O0KA 2XU2A 4L6OA 1HT6A 3QFEA 2QUUA 2I9UA 4DUVA 1GOIA 4V15A 2ZE0A 1DWGM 1KTBA 3VFCA 3QEZA 4LAMA 1GHSA 4W7WA 1PSCA 4RPPA 4XZHA 2YYTA 4LVDA 2O9OA 4LYRA 3NA8A 1YLVA 1TFVA 4FF5A 4C6MA 1MDRA 4ZXOA 3IJ9A 2ATSA 5K2ZA 2YLLA 3HFYA 5FIPA 2OT1A 4LUYA 1DJIA 2A1YA 5CQ1A 4E5TA 1UKPA 5DT5A 1DV7A 2WC4A 2REQA 5E5CA 3A5FA 2AL2B 3W1UA 1LUCA 2ZUSA 1U5JA 2WAGA 2CZEA 4J3UA 3DG7A 4HZ8A 1YDVA 4C1NB 1OIFA 4J1OA 4D6JA 4XTIA 5AHLA 2QUVA 5ABHA 3BV7A 3IJQA 5MF5A 2A0NA 2VCCA 3PWGA 1R9XA 3MKKA 3P84A 3BLDA 1FXQA 1U83A 4DJDD 3U5UA 2P0OA 3KOWA 4WEVX 1OC5A 3DX5A 3I7RA 1XH1A 1WP6A 4MKSA 2DZVA 2YW3A 2Z4GA 5IRPA 4RZBA 3WQFA 2E6AA 3CUGA 3EOEA 5CCZA 1WXJA 4S3EA 4I7VA 3ZMRA 1GEHA 2Q01A 5FEXA 4PUUA 3WDPP 3S2JA 1KM2A 4MWAC 4HIBA 1WDQA 4NI3A 1TUXA 3ISIX 4GVGA 4RPQA 8CGTA 1RQEA 1XDLA 1R87A 3QZ6A 5AYXA 3WK1A 2QNEA 5JBDA 4PB5A 4O15A 3EWBX 1TCDA 2A7RA 2WZHA 5AFDA 4NZFA 4D1IA 2WBGA 2GQ9A 5CPNA 1EGMA 1W1IE 1WE5A 2AL1A 4UTHA 1DKWA 4OWGA 1D7FA 5I3FA 4DBSA 7TAAA 3EB3A 1TTJA 4H1ZA 1R6WA 5C9UA 2ZVIA 4XBKA 1LZOA 4MYXA 3CZEA 1HJSA 2RDTA 1FH7A 3REQA 4V27A 1IXQA 3SM0A 3DHDA 5FA5A 1ZUAX 1J18A 4ZL1A 4H19A 2Y7DA 2WNWA 3VKAA 3QYSA 4ONVA 5DCEA 4O1BA 4FNRA 4C6OA 1UWIA 2WZMA 5B7YA 3TUUA 2Z1KA 3GIPA 5FF3A 4UNKA 3WLHA 3LNMA 4G2DA 3BAIA 1GVFA 1KXQA 1MW3A 1XYBA 4GJJA 2EQDA 1MVYA 1WZMA 2Z6JA 4LNCA 4HCDA 2PDKA 4E3VA 4ECLA 3GC2A 2WMHA 1BHGA 1UG6A 3WD1A 2F2HA 3U48A 3CQHA 2J6XA 3GTHA 5FJOA 3VIIA 3DKJA 4JNMA 1F3EA 1IR1A 4LUIA 1V3LA 1P43A 3O2LA 2PF0A 4S3BA 3GYEA 4NAEB 4O57A 1VJIA 3R13A 4PMXA 1L9WA 3R89A 1YIXA 4MUPA 2G96A 5BMXA 5HJLA 3G0XA 1WBJA 4AZHA 4UQCA 2ZA3A 3H55A 2O55A 2H8XA 2EKGA 3FIGA 4G7FA 2A2IA 3PM6A 1XSKA 3N14A 3AAMA 1X1ZA 5F1UA 2WHJA 3ITGA 5DXYA 1ZALA 4AD0A 1IXPA 3BV4A 4MJ2A 2JEQA 3QV9A 1S1RA 2H3BA 1ICSA 4BS0A 3G1FA 3FSUA 4WCJA 2X1RA 3SUSA 1TVLA 3LTPA 3IACA 1IR2A 4NX5A 3WF3A 4QHRA 2Y1HA 3UGVA 5LXXA 4AWSA 4JICA 1M5WA 1ONXA 2ZICA 3MUZ1 3GTFA 1MEIA 2D2GA 1SW0A 3OTRA 2RGLA 3GKFA 4WKFA 3RXZA 4ZQMA 1MXDA 4FLRA 3QOKA 2WHMA 1A5OC 1V0KA 1XIFA 1EZ2A 3GQYA 3TOPA 4P7NA 3K8LA 3TOYA 3CV2A 2YDRA 4KKXA 4DO5A 4NVTA 5E9AA 3A13A 1OFPA 3G18A 4IT1A 4D6IA 5FJUA 2YZRA 3FAXA 3GFZA 4DI8A 1H5YA 1XRVA 3EKZA 3IARA 3BQ5A 2FVLA 1O60A 3C0QA 3S46A 1GK8A 3K8MA 4RK8A 4C6NA 1E5JA 2NUXA 3MVIA 3TN4A 3VX1A 3CT2A 4CNNA 3R1ZA 3F1QA 1NU5A 4O0ZA 3CL7A 3G2GA 3LMYA 4AD1A 5EYWA 2VI0A 3GTXA 3OYZA 3PSWA 4UCFA 2Z1BA 2HNEA 1FHLA 3T0AA 2RDWA 1PWMA 3LI1A 1M7XA 4JTEA 1RD5A 4PUWA 2J8GA 4HMEA 1B5TA 1P5BA 4RX0A 4KCWA 1CX9A 2FKPA 4BCEA 1VBJA 3E9AA 1W3NA 1GPWA 2OVLA 4N9BA 1CXFA 3CTLA 1X7IA 1QR7A 1RBOB 3PULA 2QIWA 3OQEA 5EGRA 5I00A 1B0IA 3GHSA 3W7KA 4JN8A 5CPLA 1NDWA 2DP3A 4RE0A 3W01A 4GQ0A 3HG2A 2PDWA 4YNGA 5A6LA 3MTWA 1JVNA 2FHCA 1WKFA 2VC9A 1OINA 4EOUA 4P8VA 2V63A 1B9BA 5IBXC 4X0VA 3R7MA 3UWUA 5F1VA 3GXMA 5ABFB 1UR3M 1PKNA 4ORMA 3BC9A 1NQKA 4CCZA 4MY8A 3AHXA 3ENLA 4ZB2A 3UZXA 1H7PA 5BZAA 1NWSA 3AWNA 1FWGC 4AWEA 3MHUA 4LEQA 4K6AA 2WNQA 5EBUA 4HPGA 3N04A 3WMLA 3F2CA 3LV5A 5EMLA 3RPDA 4KBXA 3WQGA 4NI8A 3M0YA 4NRSA 3NQ7A 3H7RA 1OF8A 3VVGA 3VCNA 5K9CA 3KTCA 1RBAA 3CIWA 3DGRA 4J3XA 3G0UA 3DZ1A 2R94A 4IFKA 3UWZA 3GW3A 2QCEA 1VAHA 2HEJA 1V0NA 2V5KA 4LVBA 4GUIA 4Y8EA 2OGYA 3TCEA 3WQCA 1QW8A 4B5UA 3ES7A 4LRSA 3PJTA 1CT5A 3D5HA 3G1VA 4AMAA 3TTOA 1IEXA 1EQCA 3TEVA 4H2HA 1WDDA 3PS7A 3N73A 2W66A 2E1WA 3N4FA 3EEZA 2PU1A 3WQ4A 1OYAA 4M7TA 3A4XA 3Q37A 4MADA 4WOQA 4HPNA 3QV8A 4Y9NA 4IP5A 2DVXA 3HA1A 5HMDA 4PFHA 1JD9A 1UKOA 4FA3A 2C14A 4Q4SA 3W1PA 5DX7A 3LHWA 3P74A 3PPFA 1S5VA 1NP0A 2ZRWA 5G1TA 1K8CA 1C93A 4HA4A 2G95A 3EB4A 1CLVA 3FA3A 3DKLA 4O8AA 1LP6A 3RPMA 1BKSA 4TUFA 4QLLA 1AZ2A 1UWTA 4D2JA 2P8CA 1IHIA 3IVSA 3VC5A 3W1QA 2IQDA 4HU3A 3LQGA 3IVUA 3IRSA 3WF1A 2XPKA 3GYCA 4WR3A 3S2MA 3VI2A 3SURA 4EVZA 1PIIA 4XISA 4ZGYA 1W91A 4F0RA 1P0BA 3TWAA 3MO4A 1AUSL 1NY1A 3A23A 1ITCA 3UY8A 1DWIM 2VTFA 4F9DA 5C9XA 3WNOA 1XFCA 4ADUA 2BY2A 4BQ4A 5JU6A 3BG3A 4CQ9A 4ZVJA 4BI6A 2FPYA 5HQEA 1E43A 4CN4A 1KXVA 2CBJA 4C91A 2RUSA 4PTWA 3AJ7A 5E6ZA 5HR6A 1EUNA 4Z1DA 3KW3A 1Q13A 2ZA1A 3MBFA 1L8NA 4FK9A 3QN3A 3K8KA 4JY8A 3SADA 1BLIA 1SUXA 1LT7A 2Q8XA 4AY1A 1RP8A 1CB2A 3KUMA 3VDGA 3FA5A 5FJPA 3QY6A 4PYSA 4XD4A 1R9ZA 4CVWA 4EE9A 1WOAA 3RCNA 4IL2A 4JKMA 3CPUA 1KQZA 1CXKA 2OSYA 4QS6A 2BOEX 1QO2A 5CBIA 1W0MA 4O19A 3ITCA 1DHPA 5K4ZA 2BGQA 1R5YA 5I2UA 3UZ5A 1AL8A 3CMJA 3T07A 4GYJA 3C8NA 2J75A 1UKQA 5H91A 3ZJ8A 4B9ZA 2Y5JA 1VHNA 2CW6A 2VT0A 3F7JA 3KM8A 1XP3A 4RNJA 4H9VA 1AH4A 3NDYA 4I7UA 4R9OA 4DJDA 4OQVA 2AL2A 3NL5A 1P0NA 5AHNA 1RCOB 1YW1A 1I8JA 3B97A 3M0LA 3QMRA 5I3DA 1KBBA 1Q45A 2AMGA 4C1NA 2C15A 1NDZA 1HP5A 4JX5A 5EPDA 3W73A 5A94A 2VWTA 4BKNA 4FI4A 4RL3A 2G3NA 1O5KA 4F66A 1XUZA 6PTDA 1JZ4A 3PBVA 4JYFA 1CXEA 2Z0IA 2Z7GA 4PL1A 2Z26A 4JYEA 3L4WA 3HPSA 3GBEA 4GQBA 4IPJA 1VD6A 3TTSA 1OWQA 1LF1A 3MSGA 3PPHA 4NSBA 9XIAA 1R30A 4TTUA 2PDIA 2PRHA 3QW3A 4KH2A 2ZZ5A 5D9NA 1A5SA 4IIEA 2DZBA 3VA8A 1FWIC 4H6KA 1OVDA 4GUHA 2VVSA 1UH4A 1V3JA 4KGJA 3NIYA 2OTDA 2QDDA 3LMZA 2QS8A 4JTAA 5D05A 3VIPA 5EMUA 1XYFA 1CECA 1N8WA 1M03A 1ENUA 1XIDA 3H4GA 4G56A 5DO8A 2CZDA 3FFSA 1XM3A 1H2JA 3XISA 3GH5A 3BLFA 3ZR5A 1FWSA 2QLYA 3FYPA 1OD8A 2V6AA 4W7VA 2E0PA 2QJMA 1FCVA 3CZGA 1K4HA 3GWQA 4GYPA 1L2UA 1S5WA 5LIXX 3N1AA 5BWFA 1TX2A 5EMKA 2OYLA 4EXQA 5M03A 4PSRA 2D2HA 2HPMA 3E49A 1IT7A 1CGTA 1K1DA 4O28A 4UMAA 3PJUA 3I3DA 1V08A 3WLNA 3K2GA 4GBUA 1WPCA 3GIYA 1J11A 3EMQA 4CD7A 3WBYA 1K70A 4Y2WA 2E77A 2X05A 3MKVA 5JBEA 1IWBA 1TVPA 1W1ZA 3OPSA 3E12A 1DORA 4MWAB 2ZBTA 4I6VA 4WQ6A 2FFIA 5EMMA 1BF6A 4I5XA 4JKKA 2R1NA 4UTFA 3SUTA 5C5YA 1H60A 1UH2A 4JZ5A 4I8DA 3NO1A 4AVFA 2FZMA 4A22A 2C0HA 4NAEA 1E71M 4GKLA 3VKCA 1EYEA 3THDA 1RVGA 2VC5A 4R85A 4DNMA 1PO9A 3QKZA 3FW6A 4MWAD 3ZVHB 4IMEA 1W3JA 4WOZA 2X0HA 2RHGA 1XW8A 2O9RA 2QCFA 1UR2A 1UKSA 2PPGA 3JZEA 3VNKA 3C0JA 3BGJA 3UVAA 3AYTA 2QCDB 4RLIA 3VIJA 1ZHAA 4BY3A 4CD8A 1SJAA 2DZSA 1LOQA 2E8ZA 4GIEA 2D3NA 1Q8JA 3DFQA 3NOYA 2V2DA 5LIWX 3KLKA 1VFTA 1V02A 1D3HA 4XK2A 5IM51 3W84A 2OOFA 4XAGA 4K1GA 2W0UA 1OB0A 1G7UA 5A69A 5LGXA 5FF0A 1KXHA 4QE1A 3FOKA 4C6DA 2MANA 1EIXA 1FX6A 2RH9A 2XGZA 3CQKA 1DEDA 4JYDA 4TR9A 3WK2A 2VCAA 1BYCA 3K13A 2YW4A 4LCQA 1XG4A 5EFDA 5FSDC 4J3TA 2VUYA 3W29A 2WMFA 1ZFJA 4J35A 3NVTA 1HL8A 4JTHA 3GNRA 1G4SA 1UUOA 3M43A 1B2YA 3BH4A 4PTDA 2NV2A 4KRTA 1S46A 4NYUA 3TSMA 2O92A 4S3CA 4HN8A 4LF1A 1PAMA 2WB5A 4D6FA 1YDOA 4QSHA 1DE6A 2NWSA 3MHGA 4QIUA 2QJNA 1GOKA 1R85A 1CI1A 4ZZ9A 1S2CA 3GAKA 4DM2A 1RLCL 4CGTA 1X97A 2DIKA 2WCAA 2P10A 4QRNA 1VP5A 3VOFA 1K8ZA 3KZSA 3AC0A 4O18A 4LCRA 2I9EA 1UA3A 2YDQA 3H7VA 3WK0A 3W6MA 3N2CA 4GQQA 3SJ3A 1QNPA 4OJYA 4UFKA 3KP1A 1PKLA 1XLLA 1CW2A 3I4EA 3STPA 5RUBA 5DY2A 3ZT7A 2Q6ZA 3ARRA 1JPKA 2OEJA 1YQ2A 3STCA 4GZ7A 3QC0A 3CWNA 1G4TA 1XLEA 1W6TA 4O1DA 5CGMA 3TJLA 1JZ3A 5IOBA 1ECQA 3F5LA 3G3DA 4WF7A 5HINA 3HN3A 1QWKA 1A3XA 2QF7A 1RQBA 3Q65A 1XBXA 2YIHA 3NQAA 4GO8A 4S2CA 4E8GA 4HYRA 3CB8A 1OK6A 4JIIX 2FJKA 3SGGA 4P61A 1F74A 3L9CA 5JVLA 1NTHA 3DI1A 3A6OA 1VGAA 3CWHA 2PDLA 4AEFA 2QUTA 3S6OA 3HMCA 4EF8A 3KBMA 1DYSA 4OU1A 2HK1A 1PCKA 2BVTA 1GWJA 3R43A 3PZOA 5ABFA 3BMXA 3WFZA 4B9YA 2B31A 4XAYA 5KINA 3BCFA 2QZRA 1J0JA 4HSOA 2Z24A 4QNWA 2QVHA 4GVFA 1KFJA 5AHEA 3WNLA 5D2YA 3UERA 5HJXA 4I3GA 5CJMA 2KAUC 3O6CA 1MO0A 4FX7A 1UZHA 4ZMGA 2I17A 2W63A 2X2GA 1IWAA 4N6EA 2PDCA 2WPBA 3B06A 4IUOA 2QAFA 1A53A 2OZ0A 4M56A 3B05A 3LHVA 4PRTA 2DFAA 1ITUA 5HWJA 2YOCA 2PRLA 1ML1A 3QV7A 3KZPA 3TZNA 4DEFA 2PGEA 1CYGA 2VGBA 3RJYA 3W7LA 3DFTA 1LRNA 3OYXA 1ICQA 1VBGA 4W5UA 1UYQA 4QJ4B 2XIQA 4IJCA 1CLXA 4UNIA 2OSXA 2WJFA 1S1PA 3AS3A 5F2LA 3K46A 4O4WA 1JR1A 4HYWA 1VFMA 4DZ5A 1G69A 1KV8A 3LHTA 3BTNA 3NM3A 4OBRA 4O14A 2XVKA 3TR9A 2XIBA 4TV5A 1DQXA 3BURA 4KW2A 4J2PA 2VCBA 2E4TA 2DV0A 1MZRA 5BOEA 3HBLA 4JTDA 4CKQA 3N2OA 4OFCA 1Q65A 1FFQA 1VFFA 3EDEA 4Z2KA 1OFOA 3B9DA 2GDVA 3PTMA 1KGWA 3GVRA 3EOOA 3WNPA 3TAKA 4LT9A 3TK7A 3W3OA 2QDHA 3W88A 2FGZA 1E72M 3GK0A 1R3SA 2E40A 2GPTA 1GTEA 2RKXA 1C90A 3LYEA 4AY7A 3F2BA 3MI2A 3SCWA 3WNMA 1XIIA 4U10A 1CIUA 3QW4B 5CH9A 3NQ8A 2YCIX 4GY0A 2A3BA 3USBA 1DWFM 2Q3OA 3T2PA 3HPZA 4UQEA 3CV6A 4MLJA 2J27A 5EKYA 3AQUA 2VOTA 4JGDA 4C90A 3NJ3A 2CXEA 4L1GA 4IWWA 2J7EA 3HMJG 4DO7A 3EB2A 1WZAA 4F2TA 1VEOA 3D47A 4MPQA 1QW7A 5EA9A 1OC7A 3R25A 3KOZA 3CEPA 3MCNA 3L4ZA 5A8MA 3WZ0E 4GZIA 2XIIA 2D22A 2GSHA 3CK5A 4UTTC 3L4VA 5CJ5A 5G5IA 1DXFA 3BLLA 3O6YX 1KTNA 4KCUA 1A80A 1YTDA 3UJRA 3CHFA 2VJXA 3SUVA 3B40A 4BF7A 2ZUWA 2E9LA 2PRMA 3UEQA 4IIGA 2AQVA 1V8EA 1PBGA 4FP1A 1IF2A 4IIFA 1OCBA 4JNZA 1FCBA 4WSJA 5DN1A 4RNHA 3ALFA 3W85A 4CEUC 4Y9MA 5KTLA 4Q7NA 4AG0A 4R9XA 4D6EA 3BAXA 4JX6A 3AZTA 3RO6A 1AW1A 2AGKA 3ARSA 3QTGA 1LDCA 3GE7A 3MCOA 3V7PA 2D0FA 4F0KA 1TA3B 1OT1A 4B4FA 3PZ9A 1GJPA 5IDIA 3POCA 3DEQA 3SCRA 3GU1A 1UZDA 5I07A 4EACA 2ZCGA 4PMOA 3M0JA 1R3RA 4UOZA 4LW7A 3DFSA 4S3GA 1KBLA 1R3YA 2DSKA 2FB3A 4H7CA 4IIDA 1WA3A 5EBAA 1WZLA 3WO8A 3HGSA 4NXSA 2G5WA 4DPQA 1RVKA 1OD0A 1LLZA 1RBLA 5CKSA 3WLTA 1HTIA 3W83A 2XISA 3BJSA 1EX1A 2CERA 1UIPA 3S2CA 1QUMA 1BG9A 1SFLA 1H1YA 1HUVA 3UGRA 4WY0F 4BEQA 3IV3A 5D03A 4L1XA 2HXUA 4IQLA 1QJWA 3CO8A 2WSPA 1Q4WA 3RNDA 3NQGA 3KWSA 4A21A 3CQJA 4HNOA 1IEQA 4W85A 2BHZA 2XG9A 2Y6ZA 1IV8A 3WQ5A 2OELA 1R47A 3SECA 1EC9A 4K39A 2XWEA 3VKJA 3LGDA 3PG9A 3AO0A 3LK6A 1WBHA 2FVKA 1RJPA 5BOFA 3GXIA 3K1GA 5J5RA 3UP8A 4WDXA 3VO0A 3WD0A 4G6CA 2WW5A 1QNVA 1XKJA 1OGBA 4NJKA 3B8VA 4ZA0A 4HMNA 1FWBC 5AYZA 3P5ZA 4ZB5A 2XGIA 3AHTA 2QUMA 4XZMX 1TZZA 1C9WA 2OQHA 3VE7A 3GR4A 1IXOA 4ZBCA 3N9RA 3AROA 3WBAA 4ATWA 4J28A 4A35A 1W1YA 3NVDA 1SO5A 3JZUA 5TD4A 3DESA 5T91A 4DNHA 4HJWA 4S3FA 1WAWA 4QISA 4G5DA 3T8LA 2I7GA 1EO7A 4CNUA 1LWIA 1LORA 4QBXA 1ZNNA 1WV2A 2R1LA 5CPOA 5U7SA 3NUKA 1PPIA 3CJPA 1TR9A 4JIPA 4Q8UA 3WH5A 2WANA 4GD0A 3VC6A 2V82A 2VKZG 1UMYA 2TRSA 3URQA 1W9DM 3AJXA 4UFLA 4HNLA 4XX6A 1UWAA 1O1ZA 1OT2A 2EGZA 1UHVA 1JNEA 2J6VA 1SQ7A 3LG3A 3VNIA 3A24A 3ZR6A 1W54A 1TMQA 4FS9A 3B0PA 1MQQA 1OG0A 2J77A 3HV8A 3M0MA 4JTTA 3L21A 4MWAA 1ZJBA 3HPAA 1TQXA 1UKTA 3C3NA 2ACUA 3ZIZA 4LAZA 3S2NA 4DB7A 5HPOA 4IQEA 2DH3A 2PDUA 5ECUA 3BOFA 4UTWC 1K8YA 4MGGA 3WKZA 1FA2A 2YJQA 5LIKX 3GVGA 3VKBA 4K36A 1Q63A 1J0ZA 4H04A 1DXIA 3IS4A 2FH6A 1SJDA 4YWSA 1LWJA 4GIAA 1V93A 3WJSA 5FEWA 1EWDA 1Q6LA 1CGXA 5LGZA 2PC4A 3G24A 1MDLA 4Q8MA 1TV8A 2QCDA 1BG4A 1JDEA 3W22A 4Z2GA 1CXIA 4IFRA 2OQLA 3OEXA<