1TREA

The structure of triosephosphate isomerase from escherichia coli determined at 2.6 angstrom resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
255
Chain Sequence
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVNLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Intramolecular oxidoreductase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Structure of triosephosphate isomerase from Escherichia coli determined at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 87
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1992-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1treA00
4K6AA 1VZWA 2YPIA 3SZ8A 1D3HA 1H50A 3Q2DA 2RDUA 2OT0A 2PCQA 3PBUA 2BXVA 4O1DA 1JCXA 5LGZA 4MFDA 3G1VA 3MUXA 2ABAA 2Z1BA 3CT7A 4MJMA 4FNSA 4DF1A 1W5PA 1GTEA 4R34A 3UY8A 5LNRA 5LGXA 3W84A 3KVLA 4GJ1A 3PY2A 1SZGA 3DBPA 3W7CA 3W75A 3ATZA 2QF7A 4O18A 5KSWA 1Z41A 2C6QA 2GQ8A 3W2NA 1UUMA 2C16A 3WJZA 5LNUA 3N73A 1UBSA 4S1FA 3CU2A 1H7NA 3JR2A 4LV4A 1SPQA 3I65A 2YZRA 3P60A 4O14A 3STGA 1LRTA 1V5XA 4RJEA 3T7VA 3B04A 5FEWA 4LUJA 3KVJA 4R53A 3W1PA 3WJYA 4TO8A 1GTHA 5D32A 4IUOA 5KZEA 2O7QA 4K8EA 2A1YA 4WXYA 2ZBTA 1B4KA 4YL2A 3TR2A 2JGYA 1MEHA 5C6MA 4ZQMA 2RDTA 1LCOA 3L2IA 2P10A 1PVNA 4FX8A 3UY7A 2ZA1A 1OK4A 5TIMA 1H7OA 3VE9A 3LX9A 5J5DA 1YXYA 3EX3A 2ZA3A 4JY9A 2FJKA 3S1VA 5F1UA 4NJJA 4Z1AA 2H8ZA 4I9AA 4FNTA 3O1NA 5D2VA 1X6UA 5AHMA 1NFBA 3V1PA 2JKPA 4UTUA 4JICA 1EUNA 3P84A 5FEZA 3F4NA 2HTMA 3SJ3A 2QCCA 3PBYA 1JRCA 3NPUA 3KRUA 5CSRA 1IIHA 3W88A 4A29A 1GT8A 5EYWA 1H62A 4NVTA 5D09A 4RCXA 1QPNA 3C2RA 3GDKA 4MVAA 3N9SA 4JIQA 3B0PA 4QSHA 3EX4A 3K30A 4JY8A 1F2JA 3MO7A 3TIMA 4EF8A 1YDVA 5K2ZA 1XKYA 4JEQA 4O15A 1S3HA 1JULA 1PL9A 1B57A 3HPXA 5HWNA 3VFLA 5A8GA 3HPSA 4RZ6A 2A0NA 1OHLA 3S1UA 2WSQA 4HN4A 2ZDRA 3N2MA 3A5FA 3W2MA 1QWGA 2V8ZA 5H2ZA 3C6CA 4O4VA 1G6CA 1BEUA 1WOAA 3QZEA 2TMDA 2H3DA 7TIMA 3TC7A 4J9JA 1TPB1 1X1OA 3UWQA 3BG3A 4RKAA 3AO0A 4AF0B 2ZTKA 3P5ZA 4NT0A 3O06A 4R7JA 4N4QA 1J5TA 4N9DA 4AWTA 1R2RA 3QSRA 4DBEA 1O4UA 1XCFA 2XN0A 4YCOA 3NVTA 2ZFAA 4UUIA 3P74A 3G8RA 3B03A 3A21A 3P82A 1WBHA 3GXNA 3LLDA 4NJGA 3ABSA 5E93A 2FLIA 3DAQA 4LS1A 3Q94A 3TQVA 5EA9A 1AW2A 3HJZA 1SFJA 1TTIA 5FF3A 1O5XA 1TCDA 2H8XA 1T99A 3BVJA 3VI2A 1QOQA 1NAL1 3BW2A 4G1KA 1C8VA 4FEZA 5T26A 2CLOA 4UTMA 1SZEA 3W7PA 3LHYA 1N55A 3TW6A 1EPXA 2A7RA 3UXAA 2V2DA 4PH6A 1THFD 5D2WA 3W1AA 1ALDA 3LCHA 2Y89A 5D2XA 3GVGA 3ABQA 4I7UA 2GQ9A 4ALDA 3DFQA 1FCVA 2EAWA 1OABA 4ADSA 3HG4A 1O60A 3G1YA 4Y96A 4RK8A 4K37A 1YPIA 4NXKA 3WFAA 1ME8A 2E1DA 3DFPA 1EP2A 3ZWTA 1EEPA 4YLWA 4E2BA 5ABTA 5K4ZA 1FWNA 3YPIA 1X8FA 4GUFA 1BKSA 3QQ1A 4FXSA 5F4WA 4CCCA 1HUVA 4Q32A 3DFTA 4K39A 4BR1A 4O13A 1SO4A 1MO0A 3HMJG 4UFKA 4RZ4A 1XFBA 4DO6A 4XTIA 1KFJA 1YXDA 4ORMA 4M6VA 2C0AA 4RX0A 3EWYA 2B7PA 2OX1A 1H1YA 4MFEA 3MHFA 3A24A 1VYSX 3G1AA 3SR7A 1H7XA 2C14A 4TU1A 3P81A 3S42A 1TPFA 4KWWA 5IM51 1CI1A 3B8DA 5K3VA 5LNVA 5FF7A 2J88A 5F4XA 3EWBX 1AL7A 3QSTA 3QMTA 4LRTA 4JNMA 3L65A 4XBSA 4EVZA 2YDAA 2YFNA 2KZHA 4BI6A 3KXQA 4LRSA 3VE7A 1VCGA 4OU1A 1EWEA 2CLEA 4O17A 3QF0A 5LHEA 1LDCA 1FXQA 3EX6A 4PC8A 4Z1BA 3NM3A 4JIPA 2HS6A 1L9WA 2Q8LA 3W7JA 1TSIA 3NYZA 4L4LA 3USBA 3PF3A 2YGYA 3NQ6A 2WNNA 3TJXA 4B5NA 5EPDA 2BZNA 1KLZA 4LNYA 2CU0A 3IVUA 2WPBA 3W1RA 2YFOA 3NOEA 3GDLA 5HUOA 3DXIA 3NQDA 3RK8A 4MJZA 3LHWA 3CTLA 4S2CA 1EIXA 3SSJA 1W5OA 5IBXA 2WNQA 3QC3A 3QW4B 3N2XA 4MPQA 5C2XA 4N9EA 2X2GA 3PBVA 5BMXA 1KM2A 4AHPA 1QNVA 4HKPA 3RNDA 4NJIA 3S1WA 3G18A 1QO2A 3NDOA 1DJNA 4MY1A 3W87A 2A4AA 3PUOA 3LHTA 1WAUA 1LRQA 2HMCA 1GEQA 1VHNA 2DZSA 2VXNA 1SW7A 2W79A 2X1SA 2ZRWA 4NX0A 5KITA 4Z0JA 3MP4A 1VR6A 4R33A 4XKYB 4DPPA 2V82A 5FI8A 2Q3OA 1D9EA 2GQAA 3W23A 1W5NA 1JRBA 5BNKA 1Q6LA 2YSWA 5DBUA 3U6WA 5LHFA 3NR0A 1BTMA 1IGSA 2ZYFA 4NXSA 3W3OA 1JUKA 1N8FA 3IGUA 4O1BA 3TV8A 5EKYA 3PSVA 3T78A 3PG9A 2AAMA 5F2LA 4UTTA 3NL5A 2Y70A 4DF0A 1JCMP 3TSDA 5BOOA 3OA3A 2ZRZA 3M41A 1A5SA 2J6XA 5DCDA 2DU2A 4UTJA 5D02A 1YDNA 1TJPA 4O10A 3DENA 5FF0A 4N6EA 2QCDA 5DLCA 3P61A 3G0XA 4BF9A 3KHJA 1MXSA 3BO9A 1XL9A 2JKAA 5AC8A 3DU0A 1W54A 3QRHA 2O7SA 4IX2A 2QCFA 2QUTA 2ZRVA 1VLWA 3L0NA 3BG5A 1X1ZA 3TNOA 3NQCA 3EWXA 4GWEA 3TMQA 1JQXA 4AF0A 1SO3A 4JTUA 2G5WA 3LDVA 3STFA 3W74A 3JRKA 2VFEA 3C52A 1F6KA 3BLIA 3KVMA 3MYPA 4JTJA 4DXVA 1RVGA 4O8RA 5K9CA 2Y88A 1EWDA 3E02A 2OZ0A 4JD4A 1H63A 3QJAA 3PAJA 5D2TA 3SGZA 2G97A 2QCLA 1OFAA 4Z1CA 2FQIA 4IWWA 4KKXA 1VYPX 3M5XA 3W2JA 1XBZA 5DBTA 4M7TA 1TV5A 5AYZA 1KBJA 3NQFA 2OCZA 5U7SA 3TFXA 4H6KA 3MJYA 3DH7A 3NO5A 3W7GA 4O52A 1J4EA 5HNRA 1UCWA 1ZENA 2DZVA 3IIZA 4DO5A 4CCDA 2WQPA 3QEZA 3LI0A 2DP3A 1W5QA 4OE7A 1OX5A 4XTDA 1DQXA 4QJ1A 1KV5A 1JJKA 3DI0A 3M9YA 3E49A 3TK7A 3GYEA 4M19A 4LVFA 1Q6RA 1TTQA 3GZ3A 1OFDA 3R5EA 1QCWA 3D0CA 3TCEA 4WOZA 2XFWA 4QAIA 2CLMA 4YWIA 2GJLA 4P2VA 1Q3NA 3G22A 1RZMA 2WOQA 1DKWA 5HJLA 4WY0F 3NQVA 5AYXA 3M5VA 5LSMA 4FO4A 1B4EA 4H4IA 4I7VA 2NX9A 3I7RA 3NPVA 3NXFA 1O94A 2HS8A 3P67A 1TPDA 3M5ZA 3W1QA 5G4WA 1OFRA 2V2CA 3OEXA 1KM3A 3CC1A 2XN2A 4ZQPA 3QFEA 1LOSA 4M7SA 1WYIA 1IXNA 1J2WA 4UFHA 4EIVA 4X9SA 3LHZA 5D30A 3LERA 1SSGA 4GRSA 4EF9A 1S5VA 4C1KA 3W1LA 3TJLA 4CLMA 5D38A 1NF7A 2H3BA 4QNWA 1TV7A 1ICSA 4Z0SA 1Z48A 3W1TA 4AAJA 3UZ5A 4KFNA 5SWUA 3P8JA 1FBAA 2CFFA 4O1AA 1SU5A 3LRKA 5AHFA 2E5BA 5I3GA 1OX4A 1VRDA 2VFIA 1ZCOA 3SFKA 1KM0A 4N4PA 5AFDA 1PCWA 3E0IA 1DQWA 2X1RA 4IXHA 1GVSA 1OVDA 2V9DA 2A21A 3LCLA 3M0ZA 5F2GA 3IIVA 4IMDA 1LLWA 3LM7A 2NXGA 4E2DA 1C9DA 4N9CA 3PULA 2PRMA 2QCGA 4GBUA 4A2SA 4A21A 4CQ9A 2Y85A 4FNRA 1C29A 1WV2A 2E6FA 2EF9A 1JCJA 3C2FA 3MI2A 3OIXA 2YCEA 4IGHA 3W7QA 3C8FA 4FNQA 1IF2A 4UIOA 1AW5A 5HWJA 1DOSA 2NWRA 4FNUA 3TSMA 1HO4A 3A23A 4LS0A 4TIMA 3W1UA 3PWAA 4HSOA 1YDOA 2OJPA 3PVFA 3S8HA 4GE8A 4FB7A 1OJXA 1B9BA 5KMYA 2NUWA 2ZZ5A 1W3TA 3TDFA 1TMHA 4Y6GA 1VCVA 3CB8A 4UFJA 3FKRA 1DV7A 1H7RA 4UTWC 2PRHA 5DY3A 2JBMA 3I68A 4K7VA 3KRSA 2CW6A 3MP5A 3RMJA 3LTPA 4ZQCA 2E5CA 3B06A 2QUUA 1VYRA 1PIIA 1HL2A 4IPJA 5LNWA 1IXQA 4EOUA 3R13A 3M7WA 2B7OA 6ALDA 5K9DA 3TA6A 2Y62A 1GVRA 1QPOA 4JYEA 1NEYA 3SY5A 4UR8A 4NJKA 1QOPA 3INPA 2EKCA 2B0MA 1K7XA 1WQ5A 1SUXA 1QO5A 4UTHA 2JK2A 1M7PA 1TREA 4XKYA 3PB0A 1WBJA 1LM1A 4DF2A 4MYXA 3W7KA 2CZ5A 3PC0A 2TRSA 2ISWA 3BGGA 3KX6A 3GAKA 1KTBA 4XZ9A 4JTKA 3C2EA 5CGQA 3ZS4A 5D2YA 5K7JA 4FXRA 3EX1A 3OVPA 4E38A 5C5YA 5IBXC 5G1TA 3EKLA 1H61A 2Q3RA 3GB6A 3V75A 1R2SA 2DZXA 3PG8A 4UR7A 2TYSA 3CEUA 2BX7A 4M6PA 1FX6A 4N2YA 1TQXA 2Y7EA 2QCDB 2V5BA 3TROA 2J24A 1I2OA 4NZFA 3F4WA 3BG9A 5HWMA 4AEOA 4LV9A 1L2UA 3MW7A 4OQVA 3GK0A 1QFEA 3L5AA 1W0MA 3CLMA 2QCMA 2E68A 4PL1A 3QMRA 4ZMGA 3VNDA 3B05A 1P4CA 5D33A 2I1OA 3TUUA 1Y0EA 3IEBA 1HO1A 2RH9A 5D04C 1G4SA 3VCRA 3TH6A 4TMCA 1XC4A 1LOLA 4O0KA 5CZ0A 1H7WA 5C54A 3T55A 4HNTA 1W56A 3W83A 2ZCGA 4X3ZA 4LU0A 5F2IA 4E0CA 4UFIA 1OYCA 3M47A 4UTTC 3STCA 4DEFA 1R2TA 4RZ5A 3G1FA 1F7BA 2Y7FA 4GUIA 4IPIA 3R2GA 1FWWA 3FYOA 4RV8A 2PE4A 3PSWA 2NV1A 1SW0A 4MKNA 1ML1A 4WZHA 3ANYA 3U8GA 1TV8A 4O1CA 1WOBA 3F1QA 3SI9A 3WJSA 4ORIA 2W6RA 3GR8A 2VC6A 1P1XA 1KBIA 2PURA 3G24A 2VKZG 3O05A 4OWGA 2NZLA 4UFLA 1TO3A 5MHBA 2F7FA 4WJEA 1PE1A 1W5MA 4ZQRA 4QM1A 5G2HA 4C1LA 3O6CA 1GVOA 1TPUA 4DBDA 3L5LA 1F6PA 3W2KA 3ABOA 3HOJA 3DI1A 3LLFA 3MBDA 1OFPA 4IOTA 3UPWA 1AL8A 2GUUA 1VC4A 1A50A 4GFSA 1KFKA 4AH7A 3SW6A 3CIXA 4NUWA 2PRLA 3NEVA 3ZFHA 1XDLA 4O19A 1W3IA 1KV8A 1KLYA 4XUGA 1VQTA 4NU7A 2V2HA 3NQAA 4JX6A 3EXRA 4HSNA 4OV4A 1W37A 3JS3A 3N14A 4AWSA 3W07A 4O28A 3L66A 2VOMA 3W7IA 3MP3A 3M5YA 1OX4B 1FY6A 3GXPA 3PB2A 5EMUA 2TSYA 2QCNA 5G1YA 4PFMA 3BPWA 3RF9A 3CQ0A 3GNDA 2UV8G 4WX2A 2DZPA 4UTWA 4IXXA 1TTJA 1LORA 1NF0A 2BWGA 3R8RA 4LY8A 1W31A 1TPEA 1GG1A 1TQJA 2I9EA 4FX7A 4JX5A 3SGUA 4JN6A 2C3ZA 2JKEA 3FIGA 1PHWA 1ZAIA 3EKZA 3LCWA 3T4CA 2CZEA 4O54A 3FS2A 3HGJA 3BW3A 1H60A 4JGDA 3HGSA 3TU9A 2ZZ2A 1ADOA 1XXXA 5D37A 4PCFA 3FEMA 2QR6A 4FIRA 3N9RA 3W7LA 1W3NA 4DO4A 2WO5A 3TC6A 3W9ZA 2Z2UA 4ZZ9A 4NNCA 1FDYA 2J9YA 2YYUA 2VFDA 2QAPA 3HQ1A 1IXPA 3GLCA 3IIPA 2RDWA 1VJIA 3CPRA 1XUUA 2B7QA 3GAYA 3WK0A 1TPH1 3TXZA 4FF7A 5DCBA 5LZLA 3LI1A 3LBMA 1I8JA 3IGXA 3TX9A 2GPTA 3NZ1A 2QAFA 3NQ2A 5G2IA 1G4PA 4W9TA 3TW7A 3NA8A 1YTKA 4JYFA 3LXBA 5G4EA 4MZ1A 1L6YA 6TIMA 4LVAA 3ATYA 1VCFA 3WK2A 3GDRA 3I7QA 5AOUA 1HTIA 2NLIA 1OYAA 1RQHA 1XI3A 5AHEA 3LRMA 4JTLA 2J9XA 2VEPA 1JVNA 2Z0IA 4Z08A 1KA9F 4OT7A 4UNKA 3B0UX 4N6FA 1TIMA 4MOZA 5L9FA 1XDMA 1TPWA 5CPNA 1RV8A 3QPZA 2WNZA 1OF6A 1TTPA 3S5NA 3LHVA 5CPMA 3QPYA 1Z44A 3W2UA 2CWNA 2GOUA 1D3GA 2YW3A 4GUGA 1GYLA 4M6QA 2ISSA 3FJLA 4JTSA 2OMAA 4JTTA 2H6RA 3ZWSA 3O6YX 3NL6A 3TXVA 1S5WA 5AC6A 1SZFA 3QH2A 2C1HA 1MEIA 3VKJA 3UQNA 2WSYA 4U28A 3OVRA 3BLFA 2GVGA 3BARA 1OG0A 2CLLA 4UC5A 1QPQA 2YR1A 3MMTA 1GVFA 1G69A 1T0OA 3NQ8A 5U4NA 4ADTA 3S1XA 5LKYA 3HB9A 3W6YA 1WX0A 1PV8A 3W22A 4EWND 4MLRA 3C0JA 2QCHA 5TQLA 1GOXA 5D03A 3CWNA 1ZY9A 1G7VA 2A5HA 3EXSA 5AN7A 3LHUA 5L6UA 3W7OA 1KM5A 4CQAA 5FF4A 3SECA 2F84A 4PA8A 2FFCA 4PTNA 3C2VA 3UD6A 4IX0A 4OV9A 2YYTA 3GR7A 2E6YA 1DJQA 2NXHA 3EWUA 4LC6A 4LT9A 4WY0A 2Y7DA 3PM6A 4RXGA 4NZJA 1IIGA 4FHAA 4NNBA 4Y8FA 3DFNA 1FQ0A 4U4MA 3EWZA 1XBVA 3OVQA 4AHQA 4KWVA 5F1VA 1B3OA 2NXIA 4PODA 2CLHA 3TSBA 3KAOA 5HR7A 5F4SA 3HGOA 2GVJA 4K7YA 3BV4A 2B7NA 3A22A 3NL3A 1JUEA 4D2JA 1VH7A 4WQ6A 1LTDA 3GDMA 3NQGA 2QJHA 2P1FA 2YXGA 5HR6A 1LRNA 5I3KA 3IRDA 1F73A 4PL2A 3W1MA 4AVFA 1UJPA 1QPRA 1PHQA 1XM3A 2EHHA 3P62A 1EUAA 2V5LA 3A5VA 1P0KA 1R30A 3WK3A 5J5RA 3MI6A 2WV8A 4AWUA 1XBYA 1AG1O 4QNEA 3R89A 1LOQA 1OYBA 1FWSA 2R8WA 3TAOA 3W1NA 3S0CA 4BWLA 4HNVA 3AJXA 3PBWA 4HPJA 3ABRA 5CG7A 5CZTA 2XN1A 4OHQA 3ZR4A 2QEZA 4YMZA 3THAA 2GJNA 3W7DA 4RR4A 3W7HA 4Q4KA 2R94A 4K36A 3C4UA 4WUIA 4RLIA 3IV3A 1HFBA 3W7EA 4ZQNA 3EWWA 3L67A 2A7PA 3QYQA 3UWVA 4JXCA 4O11A 1ICPA 1JQVA 1OFBA 3OG3A 1E51A 1TYGA 2C13A 3W71A 1BWKA 4FX6M 4L4MA 3O16A 4DELA 3Q58A 3ELFA 4LVBA 2AGKA 1SFLA 2A2IA 2NV2A 3NAVA 3W7MA 3LCGA 2VFGA 1XBXA 2R91A 1F74A 1UUOA 3HG2A 4CNPA 1CW2A 5EBUA 4X2RA 4XQ6A 1OFOA 2ALDA 3E9AA 4IMCA 2E09A 5HULA 3LBCA 2NUYA 1SZNA 1H1ZA 1QR7A 3KFTA 4FIQA 1LBFA 1K02A 3DFSA 3T44A 2IQTA 2X1UA 4TX9A 3G1HA 2Z6JA 4ADUA 1LBMA 1FCQA 1A5CA 4JYDA 1YPFA 2X16A 2B4GA 3HO8A 3L5MA 4O53A 2QDGA 3NQ7A 5TBOA 3RLVA 3HG3A 1DBTA 4IMFA 3I6RA 4JX4A 5DXXA 5KTLA 3LTYA 5CPOA 4WD0A 3QW3A 1I2RA 1WA3A 3GKFA 4UMBA 5DCEA 2A85A 1ICQA 2GVLA 2E5DA 1TJRA 1LYXA 4OGZA 1ZHAA 4BI5A 1UASA 3O6DA 1RQBA 1A5BA 1YTEA 3LCIA 3U2OA 3HF3A 2J27A 1ZJIA 2NX3A 1HG3A 4RXFA 3HGRA 1N7KA 2ZRXA 4NQ1A 1LROA 1I45A 2NUXA 4IQLA 1K8YA 1EB3A 2G95A 4AHOA 2QUVA 1RQEA 4ZL1A 2LLEA 2BSLA 4A22A 4LW7A 2VFHA 1FCBA 1GVQA 4Y90A 3NM1A 1K8XA 3G1SA 3FKKA 3P80A 1Q45A 4MLJA 5HQEA 1FWTA 3EB2A 1O95A 3FA5A 1EP3A 3TMLA 4HPXA 4LC8A 2CLKA 4LOCA 2VFFA 4HIBA 1K3UA 2DORA 1DORA 2VEMA 1K03A 2CZFA 4XWUA 3LV6A 2ZRUA 2ISVA 5FESA 3DGRA 1U5JA 1G7UA 1G4EA 1SQ7A 4CNOA 3FOKA 1H5YA 1FDZA 3QQ0A 2Y63A 2ATMA 4JTGA 3IVSA 2DJLA 3NG3A 1I2PA 2Z6IA 5DN1A 1OFEA 3C56A 2C18A 3G0UA 3N34A 3L0GA 3EEGA 1EX5A 2EPHA 1DHPA 4GUJA 4HNNA 3A9IA 4WY0B 3TFCA 4IMGA 4K38A 1FUYA 4O57A 2HSAA 1FWRA 3TAKA 3W70A 2ZZ6A 2I14A 1PCKA 1KTNA 3GKAA 1TB3A 3HPZA 2DJXA 1VS1A 1XUZA 1YLVA 2WJZA 1LLZA 1SSDA 1RPXA 4LVDA 3FFSA 4KFOA 2YX0A 3P7YA 3WJXA 1W8SA 4O0ZA 2CLFA 3N19B 3RLUA 3E12A 2PC4A 3LV5A 3EXTA 2X30A 1U83A 1W1ZA 3TE9A 2YW4A 2Y7GA 4M5PA 5EY5A 3KVKA 1AK5A 3WJWA 3HG5A 2P0OA 3KRZA 8TIMA 2DZUA 1L6SA 2W0UA 3IGSA 1KW1A 3TQKA 4JTEA 3LGEA 1LP6A 1H7PA 3UZJA 4QISA 4Q33A 1O5KA 1ZALA 2VEIA 4O12A 4MYAA 1K7EA 1I2QA 1A53A 1T96A 3LXAA 3W7NA 3O63A 2E6AA 1AMKA 3C61A 3MBFA 4DPQA 1NVMA 3L21A 4FNPA 2D73A 2FB2A 3DKLA 5CSSA 3MHUA 1YTDA 3M6YA 2FPYA 1VHCA 3H55A 3HIJA 3W85A 3PS7A 3CWOX 1AW1A 4GC4A 3IVTA 3NQMA 5KINA 3DZ1A 3CIWA 1K7FA 1F76A 3L68A 4IMEA 3NQEA 2E77A 4ML9A 1H51A 1ME9A 3B4UA 4A2RA 1RR2A 5CKSA 4N9BA 1M6JA 3O8AA 3S9YA 1TRIA 5CZJA 1KM4A 1DVJA 3FYPA 4JDYA 3W73A 1X7FA 1R47A 1ZNNA 4LWWA 3P5YA 3TQ0A 2QJGA 3OBKA 4QQ3A 4UTIA 1JCNA 3DHFA 3LCXA 4PEKA 1OK6A 2FDSA 4OBTA 3Q37A 4ZQOA 4K8HA 4AB4A 5I3JA 5KZMA 1UB3A 3STEA 3O07A 4CCEA 3FLUA 2RFGA 5EL1A 1R46A 3W76A 4JDBA 2RHGA 3NPWA 5DELA 5FEPA 4CNNA 3NNTA 3SIZA 3RU6A 4ZVJA 2Q8ZA 3CM4A 3B0VC 3E96A 2DZTA 5AC7A 3CHVA 1OF8A 3BGJA 4BWLC 1JR1A 4O16A 3EX2A 2ZZ3A 2V30A 1LZOA 3FJ6A 3BLEA 1WDWA 3CEPA 3GXTA 4WOQA 2Y61A 3UNDA 4IJBA 5K9XA 4S2BA 1T8XA 2NWSA 4AMAA 5LNSA 2A6LA 3MI3A 1G4TA 4UMCA 2FB3A 3UWYA 5FF2A 4GXMA 5G2WA 4A3UA 1GPWA 4I7WA 1M5WA 4LUIA 1V7YA 1EA0A 1LBLA 1KM1A 2QKFA 1CX9A 1KFBA 2CLIA 1I2NA 2VEKA 3UPBA 1NSJA 1Q6OA 3UWZA 5BW6A 3H53A 4LS2A 4P61A 3LTSA 2AQWA 4JTIA 1I4NA 4NJHA 3MWAA 4MUZA 4MY9A 3PUEA 5F2MA 2ZZ1A 1FCUA 3TKFA 5HUPA 3L9CA 4H3DA 3G8EA 5CPLA 4TMBA 5K4XA 1TRDA 3IIOA 3M16A 2FPVA 2WKJA 3GDTA 3UYCA 4UMAA 4NX5A 4HT3A 5H91A 5BMWA 3S5ZA 2R14A 3H54A 1MEWA 2H90A 5AHLA 4LVGA 1SO6A 3L0KA 5KZDA 4ONVA 1FDJA 2QJIA 2ZRYA 4JTFA 4UNLA 1GZGA 1QDSA 5A5WA 1L6WA 4JR5A 1ZAJA 3G3MA 3NPXA 2ATSA 4Y9AA 3LXCA 1QAPA 4UTKA 3UWUA 3W86A 3NGJA 2A6NA 4JS3A 4N02A 1JCYA 3QMSA 1KTCA 4BFAA 4DQWA 3G1DA 1K8ZA 3OHIA 3O15A 3UXDA 5I3IA 2VELA 4UCGA 1ZFJA 4O50A 2BTMA 2E6DA 4LTSA 1VPXA 3N3MA 1EP1A 2C19A 3UWWA 3DKJA 1TPVA 4AXKA 5AB3A 3GX9A 2J9ZA 4O4WA 3G1XA 2C15A 3QM3A 4NNAA 4UFMA 1F05A 1OFQA 3S5YA 3WK1A 3HBLA 3C3NA 1GWJA 1BWLA 3PUDA 1ONRA 2G96A 3RFAA 5D05A 3GIYA 5C55A 1KFLA 1JUBA 1VGAA 5FEXA 2OT1A 1GJPA 2WSRA 4MIMA 3MHGA 3PR2A 1A5AA 3NL2A 5CZSA 3C2OA 4HNUA 4CQ8A 1FXPA 1KM6A 2BLEA 3M43A 4GUHA 4Z1DA 4YCPA 3W2LA 1G67A 1GQNA 4WXZA 2ZA2A 2ZZ7A 5E0KA 3MYOA 1KFEA 1KFCA 4BI7A 1JCLA 2FPTA 5G5IA 3W7RA 3W72A 2DZWA 3W1XA 1P0NA 4UTLA 3LCFA 1P5BA 4HHPA 3G0SA 1PS9A 5DXYA 1GG0A 2FTPA 1ZAHA 2EGZA 2TPSA 5AHNA 1OX6A 3P8IA 3LB0A 1YXCA 4QITA 2ZQ0A 3M1ZA 1F5ZA 1DL3A 3G3DA 3M44A 4BK9A 1TPC1 5BRBA 5AYYA 4TR9A 1S5TA 2Y6ZA 4GNJA 4MZ8A 5I3HA 5E1QA 4XBKA 5GVJA 3DHDA 2RKXA 2FIQA 2QDHA 3F03K 2JGQA 3R12A 4MZYA 4MY8A 4ICNA 2NX1A 3GNNA 3S6DA 3LRLA 4X22A 1SW3A 4QIUA 5I3FA 3NZRA 2ABBA 1WXJA 1YADA 3S5OA 2X1TA 2V0TA 4UXDA 2QCEA 3THQA 1YYAA 1MSSA 2ZTJA 1IXOA 1SO5A 3BW4A 1Q6QA 1QMLA 1Z42A 4JTHA 4YXGA 5AHIA 1M7OA 1MZHA 2A7NA 1SR9A 3LOTA 1GYNA 1ME7A 4POCA 5HMSA 5DY2A 3BK0A 4KFPA 1VLIA 3KOFA 2V81A 2ZZ4A 2VENA 3IIXA 5HINA 3DFOA 3T40A 1RD5A 3I7SA 2CZDA
chains in the Genus database with same CATH superfamily
1VZWA 4LAOA 2YPIA 1D3HA 1VFTA 3VCNA 3WQ5A 2VGIA 1PZ0A 2RDUA 3CO4A 2PCQA 5JUVA 1M04A 5LGZA 1IZKA 1J0HA 4MFDA 1J6OA 3AMLA 2Z1BA 3CT7A 1E6NA 2DIEA 4DF1A 2PA6A 1ZJHA 5EMJA 5LNRA 3PWGA 3D46A 1EKOA 1W9BM 3DGBA 4W88A 3MKVA 1V6VA 4O18A 2VEFA 1Z41A 3EWCA 2C6QA 2FZDA 2ADAA 2GQ8A 2C16A 4Z2LA 4QR6A 1QNQA 3WJZA 4QE4A 1UBSA 4S1FA 1H7NA 3ARWA 3JR2A 3NOYA 4IFRA 1LQ0A 4O14A 4EXAA 1LRTA 3KVJA 3W1PA 4H7ZA 2O7QA 1XGEA 1B4KA 1UC4A 3TR2A 4G56A 1MWOA 2DV0A 4ZQMA 2I5IA 1LCOA 4OBSA 3S3GA 4XVDA 3MUY1 3C86A 2P10A 3CV1A 3UY7A 4ZB2A 4AZIA 4KERA 3EX3A 2C1IA 3N17A 4LAKA 2E0PA 3GW3A 3S1VA 4NJJA 4Z1AA 3O1NA 5D2VA 4MAZA 4BEQA 4FR1A 4Q7IA 4KRZA 5ABGA 3OHMB 2FH8A 2QCCA 3UR2A 1I1XA 3WBEA 1HJXA 4W7WA 2OGJA 1LUCB 1H62A 1OIMA 3QGAC 4RCXA 5CSYA 2XH2A 4B2DA 2J7GA 3ARPA 3GDKA 4MVAA 3FXYA 4JIQA 1ZPTA 3EX4A 4QSHA 3MO7A 1TZ7A 3TZFA 3TYCA 1DYSA 4Z2GA 4O15A 4DM2A 1CT5A 1JULA 2WZEA 1VBGA 1KCKA 1KWGA 3VFLA 3VUSA 2A0NA 2PTXA 3IACA 4INFA 3S1UA 1V6WA 1NWRA 2I16A 4PBEA 2V8ZA 3AICA 1IWBA 1E9IA 4JCLA 1BEUA 1WOAA 3QZEA 1M03A 4EE9A 2FZ8A 1OADA 4J9JA 1TPB1 2WPGA 3O0FA 4GBDA 4WJ8A 4NT0A 4AWTA 4YCOA 1E3ZA 2O56A 4TTGA 3P74A 3B03A 3BJFA 1XGZA 2FLIA 1NJJA 1OIFA 1G5AA 2D20A 3DAQA 1OEPA 4LYPA 2PPGA 4N7QA 2WCGA 3TQVA 4XSMA 1LJYA 3BOFA 4GG9A 1TTIA 4MF4A 5GJNA 1T99A 1BQGA 3MJMA 2WC3A 3VI2A 3BAJA 3RHGA 1XIHA 4G1KA 1M3UA 1C8VA 4I9JA 5T26A 3OYXA 5IRPA 3LHYA 1N55A 4HPHA 5FACA 3TW6A 1SGJA 2RGMA 2A7RA 3BL3A 4U31A 2V2DA 3ZIZA 5D2WA 1ALDA 3LCHA 4CEXC 4DZHA 2P3ZA 4KWSA 5BWAA 2BXZA 4I7UA 2EO7A 3DFQA 2XINA 2FGLA 4F0RA 1FCVA 2EAWA 1PKLA 2QV5A 3G1YA 1R6WA 4RK8A 1AQHA 2EXOA 1ME8A 4HA3A 4PB4A 2Y8VA 3ZWTA 2RJGA 2W63A 4F2UA 5K4ZA 2HPMA 1RUSA 1FWNA 3DIPA 3KHDA 4GUFA 3QQ1A 1TX2A 4FXSA 4CCCA 1HUVA 3DFTA 1CB7B 4B4FA 1RA5A 2WSPA 4LJ3A 1XFBA 3DYMA 4ORMA 1MZRA 4M6VA 3D6NA 4E4PA 2C0AA 3ZYZA 3EWYA 5GNZA 3OQ8A 4JL1A 3AYSA 4P8WA 4M1BA 4RW5A 4OUEA 1H7XA 2C14A 1XWYA 1DJZA 3P81A 3UGRA 4KWWA 5IM51 4FK9A 1QU4A 3B8SA 2PP3A 1XSIA 3CV6A 3EWBX 4GZJA 4OFCA 3QSTA 4ZR8A 4XVEA 4H6EA 1FHVA 1BAGA 4DUXA 2YFNA 4ATWA 1XSJA 1N8IA 4BI6A 4LRSA 4OU1A 1A5MC 4O17A 4Q22A 3QZAA 1Z8AA 4ZB0A 2PTWA 4PC8A 3ERPA 2PWGA 4FP1A 1L9WA 1TSIA 3USBA 3AYVA 2WNNA 4IG2A 3PPHA 3KDOA 1WXZA 2FDMA 3APGA 4I6VA 2BVTA 3H22A 1TFVA 2VC9A 2W91A 3NQDA 1J8VA 1GGOA 3SSJA 3UVIA 5IBXA 3QW4B 3N2XA 4MPQA 2VQTA 3URAA 4N9EA 1K6WA 3OTRA 5BMXA 1RY8A 2OOGA 1D3CA 4IGNA 4HKPA 1K9TA 3G18A 3RR1A 1DWIM 2A4AA 3PUOA 3VMNA 3G77A 4GA8A 5AY7A 3QHMA 2ZRWA 3BICA 5KITA 4Z0JA 1VR6A 4R33A 4XKYB 3NZQA 4S3DA 2FYMA 3G2GA 5DBUA 2X05A 3U6WA 5LHFA 3NR0A 1V02E 1IGSA 2ZYFA 4NXSA 1W3KA 4HZMA 1ELSA 3TYAA 1XRTA 4PRWA 1GKPA 3EEZA 4IHCA 4LYKA 3PG9A 4O1EA 4UTTA 5FJPA 3RIKA 2ANUA 3GIQA 3NL5A 2Y70A 3KCOA 3CO8A 4DF0A 3PBMA 4E5TA 2J6XA 1K4GA 1WAWA 1UR8A 1QTWA 2R1LA 4H8HA 5A95A 4O10A 1DJYA 4YIWA 4QDMA 2PDQA 2QCDA 3P61A 4C5YA 4HK7A 4KH2A 3KHJA 1XL9A 5AC8A 1MI3A 1W54A 4H19A 2PTZA 2QUTA 2ZRVA 2ZVRA 3VFCA 3BG5A 1X1ZA 3TNOA 4HU0A 3NQCA 4GWEA 5IFTA 4JHOA 2YL6A 5M2FX 1KR0A 4JTUA 3N11A 1FRBA 3LDVA 2D0GA 1TMLA 3JRKA 3C52A 3BLIA 1QHPA 2BY2A 4W89A 4HPGA 3FK4A 1UD3A 3M07A 3N29A 4GIAA 2G97A 3F4DA 1OFAA 5DRIA 1VYPX 4U5KA 1ZTVA 1GUVA 2V3GA 4C6LA 1ZRQA 4UQCA 3NO5A 3HQNA 2J8TA 3H24A 4M56A 1ZENA 1B3VA 3IIZA 2VVSA 4LEQA 4J28A 3WUEA 1REQB 3CZGA 4QJ1A 5AVNA 1KV5A 1JJKA 3GYEA 3UR8A 4LVFA 1TTQA 3GZ3A 2VRJA 1X8CA 1MNZA 2QJMA 4DM1A 3GNXA 3PZQA 3D0CA 4CVWA 1B54A 3RR4A 3WKZA 4AY7A 1D8CA 2J8GA 3UZYA 4QAIA 2CLMA 5AZ1A 2PDYA 2HPIA 3N2BA 1RZMA 2WOQA 2YBVA 5AYXA 1VFUA 1JD9A 5LSMA 4LY4A 3WNMA 4D8AA 5G4WA 1OFRA 1X6NA 4M24A 1XYFA 2XN2A 2Z27A 3R0DA 1E55A 1WYIA 3PPCA 3Q67A 1H5VA 1TE1A 3W1LA 1NF7A 4ZE5A 4QXIA 4RNIA 3W1TA 3UZ5A 1V02A 2CFFA 3R0KA 3TEVA 2EEXA 3BV7A 1PCWA 2CHNA 4HHHA 1GVSA 1EHNA 3WSUA 4HMNA 1T8QA 3LCLA 2NXGA 1EJUC 4JIRA 1S38A 1SJBA 3PULA 2PRMA 3GE7A 4A2SA 3BSMA 4HBKA 2F61A 1JNDA 2E6FA 3ZJ6A 4NYUA 2ZIDA 2YCEA 4IGHA 3C8FA 1IF2A 1AW5A 4H1ZA 1HO4A 3W1UA 4TIMA 4HYRA 2UY2A 3T2OA 4HSOA 4GE8A 4QFUA 5KMYA 2NUWA 1FFQA 1AJ2A 1TMHA 4PMZA 1JI1A 4US6A 1E0XA 2Z00A 4UFJA 3FKRA 5BCAA 3AXHA 2NQLA 4DWSA 2QHAA 3TN5A 5DY3A 2JBMA 3I68A 1Q8AA 4HZ8A 2WVSA 3KRSA 1WPCA 1EQPA 1XCXA 3E74A 2QUUA 2YXXA 1HL2A 4PULA 2GOKA 3DUGA 2VVNA 3L23A 2P53A 5D9NA 5BXRA 3PTMA 4JTRA 1KXQA 3AIUA 3SY5A 4NJKA 1P1MA 2DVUA 3CUXA 2B0MA 3HPAA 1WQ5A 1SUXA 1QO5A 4S3FA 4UTHA 1M7PA 4XKYA 1WBJA 3VXGA 4XSLA 1A5LC 4DLMA 2QLYA 2CZ5A 3GAKA 4TXEA 1JL8A 4LCSA 1IEWA 1WXYA 3CWHA 4GQGA 4GJJA 1JDFA 3EX1A 3OVPA 1G0CA 3LNMA 4R5EA 2DZXA 2TYSA 4EKJA 3ITLA 1TQXA 4GNKB 4BKNA 1GOKA 4EXQA 4LPCA 3U5YA 1WNOA 2QUMA 3GG1A 3CLMA 4KCTA 2UY5A 3VNDA 3IJQA 2G3NA 3BSHA 3TCSA 2RAGA 4QJ3B 1MFVA 4YVVA 4TMCA 1XC4A 4HNOA 4QG8A 2VO5A 4IFOA 1H7WA 2HE8A 2Z1XA 4H6RA 3WF2A 4R27A 3W83A 5F2IA 4HYWA 3NZPA 2XFYA 1MUWA 1R2TA 5CEWA 3R2GA 1VPQA 3FYOA 4RV8A 3U8GA 1TV8A 1WOBA 3SI9A 1IEIA 1FWJC 2XISA 1P1XA 1KBIA 3SCTA 4OWGA 4X2PA 5MHBA 4LALA 4GKTA 4WJEA 4ZQRA 3S2MA 3GTIA 4C1LA 2Z25A 4UB9A 4UWMA 4Z2JA 5CQ1A 1F3WA 5D8ZA 3VPLA 3L5LA 1F6PA 4GO8A 3WG6A 2Q6ZA 1HNYA 5I77A 5CPSA 1PX4A 3LLFA 3EA3A 4GY7A 4IOTA 4CNTA 4XK2A 2IUZA 3CIXA 1QNOA 4P8VA 1QI5A 3DERA 3RXZA 2INEA 2PRLA 4ZXLA 4HA4A 4P7NA 1XDLA 5FL0A 3M0XA 3ITOA 1HP5A 4Q8MA 2VT0A 5ENLA 3PJWA 5FL1A 2C8NA 3NQAA 4JX6A 2PU1A 4OV4A 4QG6A 3DG7A 3BAXA 4O28A 4Q8QA 2VOMA 4XZLX 1UKTA 1C8XA 3MP3A 2YCIX 1OX4B 4AVNA 4G9PA 1O1HA 1FTXA 4U10A 1F9CA 5G1YA 1Q6EA 4R88A 3WDRA 2DZPA 1LORA 1DE6A 3QV6A 1NF0A 4LY8A 1TQJA 4FOJA 4MAVA 1EJRC 1PHWA 3EKZA 3LCWA 4O54A 1CNVA 2OFJA 2PAJA 3TTEA 3AIVA 3HGJA 3M46A 3THDA 4PCFA 3FEMA 2QR6A 4FIRA 3W7LA 2J75A 3BGAA 7REQB 1FWDC 4IPLA 1DTUA 2QUNA 1J5SA 1JDEA 3HQ1A 3KLLA 1IXPA 5AYIA 4UZSA 2RDWA 3LD5A 3CPRA 1FA2A 2OYMA 1XUUA 5H8UA 2FTWA 4LCRA 3LPPA 1JYXA 4QS6A 1S3TC 2FTYA 4H83A 3EDJA 5I23A 2BVWA 5KETA 3I3DA 3TX9A 2Z1VA 3OZOA 3NZ1A 5G2IA 3L4TA 3NA8A 3AS2A 3UCQA 5G4EA 3CPGA 1L6YA 2XH7A 3WLQA 3BH4A 3ATYA 4LVAA 1FH9A 2IQ0A 2Y24A 3WEMA 1VCFA 3I7QA 3B8UA 3H23A 1NP2A 4A8NA 4FOUA 2D2OA 5AHEA 4H9UA 3WQ8A 3LRMA 2VEPA 1FHDA 3SDOA 1IEXA 4AZGA 2ALRA 3DFYA 1LLOA 1NIUA 3B0UX 4WSKA 2J47A 5A6KA 1E1CA 1YBQB 1EPVA 3QPYA 2CWNA 3UA4A 8CGTA 1GYLA 4M6QA 2ISSA 4Q8OA 4JTSA 4S3EA 4JTTA 3NL6A 2WYSA 1JYWA 5AC6A 2HDJA 3CMJA 1UWUA 3GFZA 2GWNA 4W87A 2JIWA 3OVRA 1EC9A 1OG0A 4ZTXA 1QPQA 2WK2A 2YCJA 4C7FA 1ZLPA 2VGFA 1C90A 3N1AA 3SGGA 4PMRA 4EWND 3NXLA 3C0JA 5TQLA 2J7FA 4ZGYA 3LY0A 1UPMB 3LHUA 4GZIA 4PA8A 3OB8A 3SN4A 3SJNA 1RCOB 4OV9A 4DN1A 2E6YA 3SY8A 4WY0A 4RXGA 4NZJA 2J13A 1XD0A 5HNNA 1FQ0A 3CHFA 5F1VA 1L8NA 3NYDA 2CLHA 4GI8A 1MW2A 1LL6A 3JW7A 3VIGA 1AJ0A 4RPQA 2BMBA 3A22A 4B4HA 1JUEA 1UWQA 1YNYA 3T8LA 4Y7EA 1JYNA 4JKLA 2XFRA 1LTDA 3GYCA 5HR6A 3V18A 2VR5A 2WBKA 1F73A 4AVFA 1RK6A 1TWWA 4HNLA 3P62A 3S2JA 1DTNA 1XGDA 4K8GA 4GABA 2V5LA 1P0KA 1FH7A 1W1YA 1GQIA 3WK3A 3ECQA 3GIPA 3D3FA 3MI6A 4C1NA 4YJ5A 3T08A 4QE5A 1LOQA 3IV8A 1R0MA 1FWSA 3BMVA 5CBIA 5EMYA 4BS0A 2VUNA 3AJXA 3PBWA 2Z1WA 1HXJA 1KXVA 3VTRA 3C5QA 1GQJA 2V6AA 3GBEA 2XN1A 4C90A 1H49A 4D9PA 3ZR4A 1EIBA 3H6OA 1W6TA 4K36A 4QRNA 3C4UA 4MWAB 3W7EA 1TX0A 3OG2A 3CXOA 4ZCWA 4QJ4B 2OR2A 3ENLA 1Q6DA 2IMRA 4HOWA 1T7LA 4AIEA 3RLGA 3GXDA 3Q58A 3WFZA 3ITVA 2A2IA 2I5GA 3QKZA 3W7MA 3EWDA 3ZOAA 2R91A 3HG2A 4QQUA 5EBUA 2E09A 5A6MA 4PTMA 4QG9A 3SN0A 3WBXA 5G4HC 3S2NA 3K13A 3H4XA 4W5UA 4CD8A 1GW9A 3FNDA 5I79A 1EGMA 1XFCA 3O9NA 4YHGA 1KFWA 2XM1A 3VIMA 3EB3A 3ONBA 3OGRA 2QXWA 1LBMA 1FCQA 1A5CA 3MMDA 2X16A 4O53A 3WQ4A 2VWSA 2AQVA 2SFPA 5DXXA 5E6YA 4JTAA 5B7ZA 1WA3A 3GKFA 3OGVA 2GVLA 2HISA 1TJRA 4OECA 1GONA 1HJUA 4OGZA 1ONEA 4AWEA 4PB5A 4DJED 5JVLA 3O6DA 1GQLA 1VPYA 1UPPA 1GQKA 3HF3A 2J27A 3N12A 2WMHA 3L4WA 1HG3A 4RXFA 3UJEA 4IICA 2PDCA 3QR0A 3C3UA 1O6IA 1DE5A 4CN4A 4AHOA 1S2WA 1EJSC 1EXPA 1NQ6A 4NL1A 2LLEA 3KCJA 4W7UA 4Y90A 2WWDA 3FKKA 1BD0A 4E3TA 1MMFA 3TMLA 3AXMA 1XIJA 2EJAA 1MFUA 3E0FA 3SAZA 2DORA 2VEMA 3KP0A 3LV6A 2AAAA 3KBJA 4H7CA 4OJYA 2XIJA 2ISVA 4M6UA 3WY1A 1G7UA 1DXEA 4M82A 3AXXA 4HYVA 4W8LA 1ONXA 2Y63A 2ATMA 1XIFA 1E70M 4JTGA 3NG3A 1I2PA 1ECEA 3E0LA 1OFEA 2P88A 2NV9A 4LF1A 4FPSA 4GPNA 2PLMA 3APYA 3N34A 1WKDA 3L0GA 3M64A 1M1BA 3T2QA 5KZ6A 4GUJA 1R38A 4HTYA 2P8CA 4BQ3A 2A3LA 3A9IA 1S46A 2F2KA 4ATDA 4IMGA 1AQFA 1HP4A 2F8QA 5A6SA 1E6RA 4O57A 4G5DA 2XIQA 1Z7AA 2OQLA 3DYPA 1PCKA 4O1FA 4H04A 3WF0A 1OT1A 2X41A 1XUZA 4ICMA 3SCVA 4GYFA 1ISZA 1C7TA 2PDLA 4ZE4A 1NWTA 2CLFA 2YKKA 3N4FA 3E12A 3ITTA 2IKHA 1S1RA 3EXTA 1PIGA 1KWKA 3TE9A 4M5PA 1PSCA 1E0UA 8TIMA 2GWGA 3QHNA 4MKSA 3VKAA 3IGSA 4IIGA 1EDGA 1LP6A 2XSBA 3UZJA 5ABFB 2D2JA 1O5KA 2VEIA 4PCNA 1ADDA 1K7EA 4MB4A 3GH4A 4H8NA 2ACSA 1I0DA 1DIKA 3IJ9A 3QBUA 5FJJA 4HHLA 1FWBC 3R1ZA 2D73A 5BU9A 1DXIA 5CSSA 3EAUA 4PGLA 4LYRA 2YL5A 3FA3A 1SMDA 2ZUWA 1VHCA 4NRRA 2VEGA 3AU2A 3CWOX 3IVTA 5AKQA 1IYXA 4LEFA 3JVAA 1K7FA 1F76A 1B3XA 4U2YA 1DWJM 3QV9A 1HT6A 3KOYA 4FLQA 2E8YA 2O55A 5CKSA 5JIWA 3ZT6A 2VCBA 1WE5A 1KM4A 3D5HA 4YTUA 3ALGA 2B31A 3URNA 3W73A 1ZNNA 4LWWA 3WLTA 2QJGA 2VM8A 1HQTA 4PEKA 1E71M 1KKOA 4OBTA 4ZQOA 4K8HA 1ZU8A 2BGNE 2RHGA 1PTAA 5DELA 4CNNA 3SIZA 3RU6A 2ZX7A 3NEHA 3E96A 4JL2A 3TTSA 3G1RA 3VIOA 2XSAA 2PDIA 1TUXA 4OOZA 3EX2A 4EP8C 3PTKA 2V30A 1LZOA 6CGTA 3CEPA 1AZ2A 2R1KA 3CH9A 4W8AA 4DZIA 3TLQA 3FHAA 2W67A 2FB3A 5FF2A 4GXMA 3IUHA 3ITXA 4IP5A 1XS2A 4I7WA 2QPUA 2PP1A 2Y5SA 2Y8KA 1KFBA 2A3HA 4GVHA 1I2NA 3LPGA 3UPBA 1UJQA 1QVBA 3RAOA 2D0HA 3OPSA 4P61A 3LTSA 9RUBA 3LA4A 2FZ9A 3PUEA 1JZ5A 4B90A 2ZZ1A 5HJYA 4JTQA 3KZPA 1NDZA 3L9CA 3M7SA 1UKOA 4OVXA 4D1IA 5K4XA 3N2CA 4X9YA 2WKJA 3UYCA 3E38A 4PN2A 1L2QA 3KM8A 1PYMA 2UY3A 2H90A 2I9UA 2R82A 5KZDA 3AZRA 4UNLA 2FZBA 1QDSA 4W86A 4NSBA 1C7SA 1I75A 4X0VA 5FA5A 1ZAJA 3AMGA 3NPXA 5GJMA 2WMFA 1PB0A 3LXCA 1J0YA 3WX7A 4JBRA 3UWUA 2Z1KA 5DMMA 3QY7A 2A6NA 2NT0A 4N02A 3BJTA 1JCYA 3QMSA 5TD4A 1KTCA 3VDGA 2ZC1A 3OHIA 4ERAA 4GX8A 5I3IA 2VELA 1VP5A 1W3JA 1P6CA 1VPXA 2J4GA 4JFUA 3N3MA 1CGWA 3CS2A 3I10A 1GVIA 1B3YA 1F8MA 3QM3A 4O4WA 4CN6A 4E8DA 1F05A 3VNZA 3FN9A 3ES8A 3S5YA 1UWSA 1W1A1 3RFAA 2OLAA 4ERGA 3GIYA 3AHZA 1JUBA 1X98A 1GJPA 2OT1A 1KB3A 1XYLA 1WZLA 1QASA 4PTVA 4E4UA 3BZGA 3MVIA 3NL2A 4AQLA 3BOLA 5CZSA 1O68A 3C2OA 1KGWA 4GUHA 2WLZA 4YCPA 1G67A 1ZSXA 4DWDA 5FAJA 3TR9A 4GJIA 3LS9A 5E0KA 2PODA 3SURA 3PZTA 4CU6A 2NQ9A 3POCA 3LCFA 4RPPA 1UIPA 4KGLA 4M0XA 1OCQA 3T0AA 2D3NA 5D4YA 1GG0A 3GXMA 1RH9A 1F07A 1XYMA 1JGIA 2EGZA 1BGGA 3MV11 5AHNA 1NELA 4QITA 2PWUA 2ZQ0A 1UA7A 1F5ZA 3G3DA 1E4LA 1TPC1 2Y6ZA 4GNJA 5I3HA 2WM1A 5E1QA 4XBKA 3QY6A 3PZVA 2GVYA 1XR2A 1P0BA 3F4VA 4MZYA 2IKJA 4IT1A 3GNNA 3QY8A 6TAAA 1SW3A 2XTKA 5I3FA 3NZRA 1WXJA 2VC5A 1YADA 4UXDA 1LWJA 2ZTJA 1T41A 3HQPA 3BW4A 1Z42A 4J40A 2RGLA 1MZHA 4JPGA 3VIIA 1IT7A 1ME7A 3WLJA 1HL8A 3TYZA 1VLIA 1X96A 3KOFA 3MUAA 1BQCA 4OTKA 3CZ8A 3T40A 3HV8A 3U2ZA 2XH4A 3B9NA 2WB5A 4EAMA 2BXVA 4Q6JA 3G1VA 1RSCA 2OB3A 4L4PA 1LQ2A 2EPNA 4FNSA 1TWDA 2RDXA 4JHZA 1W5PA 1GOWA 1OGGA 3UY8A 1P43A 3W84A 3CAKA 3KVLA 2J78A 1SZGA 3W7CA 4IL0A 3ATZA 2AL2B 2O4QA 1E9LA 5LNUA 4H41A 2BVDA 2WXDM 4AW7A 3TOPA 4CD6A 3BAYA 2QIWA 3MCNA 3T7VA 4LUJA 3TWAA 1Z89A 1MQPA 1OGBA 3WJYA 1ZZMA 3LEPA 3NTYA 3AXIA 1XYBA 1BG9A 1ITQA 4YL2A 2QYGA 4TUFA 4WKAA 3CUZA 5C2GA 2RDTA 3MUZ1 3V0SA 2VOTA 3STPA 3W26A 2ZA1A 2QW5A 5J5DA 3R6IA 1CB2A 4OKDA 4DYJA 2FJKA 4U2ZA 4KEVA 4XZMX 2OWWA 5AHMA 4Q4MA 3R8HA 1NFBA 3V1PA 4NKCA 4JICA 1IQ8A 3AQUA 3F4NA 3POHA 3SJ3A 1SM9A 1FWHC 3KRUA 3GHTA 3WD1A 1IIHA 3W88A 2WC7A 3VD5A 5FCZA 5IFPA 4NVTA 5EBAA 1UIOA 1RJRA 3VUPA 3K4AA 3GRIA 2CBJA 3N9SA 4MM1A 3B0PA 1RD6A 3T42A 5DT5A 4B5VA 1YDVA 2DVXA 1S3HA 2WHLA 1PL9A 1B57A 1VEPA 4ACZA 1EGVA 3TOYA 1XH1A 3SCOA 3HPSA 4RZ6A 1OHLA 3N2MA 1QWGA 3B9DA 5A2AA 2UBPC 4NZ5A 2TMDA 5CZKA 2WKLA 3TC7A 3CHDA 1K1DA 3UWQA 1XV8A 3LSCA 4PRTA 4AF0B 2ZTKA 4N9DA 1J5TA 1P7TA 3NVDA 2ZVIA 2HXUA 2DSUA 1O4UA 3FCPA 3G8RA 3GXNA 2UWFA 3LLDA 5E93A 2PBGA 1P6WA 4LS1A 3TC3A 4DZ5A 1NOWA 1AW2A 1TV4A 3GTNA 5FF3A 1E56A 5H1WA 1TCDA 1ITUA 2H8XA 2FMNA 4XIAA 4H00A 1XLKA 3T81A 3BVJA 2VCAA 4F0MA 2CC0A 5DRCA 3WH7A 4FEZA 3KUMA 5BXTA 1F3EA 3C0SA 2YZ5A 1B9ZA 1E72M 4D71A 1MW1A 4J3WA 2GQ9A 3V0TA 3I4KA 3ID7A 6XIAA 1I0BA 4D6HA 3EDEA 1EJVC 1O60A 4QROA 3ZO9A 5IOBA 4K37A 2YL9A 1WDDA 1YPIA 1ZB5A 5FAGA 3RILA 3WFAA 3WH8A 1WKYA 2ACUA 1EP2A 5FOOA 1XLBA 2INZA 4E2BA 1HGYA 3VGGA 5ABTA 2V3DA 1BKSA 2Q01A 1FWCC 4PUDA 4S3GA 5I5RA 4BR1A 4P5UA 4MJ4A 4Z42C 1EJWC 2V3FA 1XPYA 5GNYA 1J0ZA 5RUBA 4XTIA 1FKWA 1WUEA 2OSXA 4H9TA 2BY1A 4AZBA 2HV5A 2P76A 4GVGA 1K9FA 2PD5A 1ONWA 1VYSX 1ZP3A 3G1AA 3WIJA 4NAFB 1E4IA 2WMIA 2GGHA 2CXEA 3RLHA 3W38A 4M51A 2J88A 3WF4A 1D2KA 3L65A 2EKGA 4QTGA 3BDKA 1HKKA 4EVZA 1RJPA 2KZHA 3USZA 2AL1A 1VCGA 3RO8A 1QT1A 2CLEA 1A0CA 4MDPA 3QF0A 5LHEA 7ODCA 4Q8TA 1GOMA 2X0HA 4U5IA 4HA1A 1EOMA 4NY2A 5M17A 4HMCA 4NI3A 3W02A 3CH0A 2YGYA 1Y5WA 4G8TA 1JPMA 4B5NA 1KBBA 1V4YA 1HJWA 2CU0A 3IVUA 3W1RA 3GDLA 3F2CA 3DXIA 3LHWA 3CTLA 2WWCA 3AMDA 1EIXA 5GQBA 5DQPA 3HURA 4HVXA 2WNQA 3M0HA 4AX6A 1MQRA 3I3EA 2EPMX 4GQQA 1QO2A 2D2HA 1GVYA 3W87A 2XGBA 1FWIC 2OEKA 1V6YA 2BHUA 2HMCA 1GEQA 2VD8A 4HQVA 2E4TA 4NZ1A 1SW7A 2W79A 2FHBA 3SB0A 4LBSA 1LQAA 2VUYA 1D9EA 1K77A 3WL0A 4ZXOA 1JRBA 4GLEA 2YCKX 2YDSA 1Q6LA 1UR1A 1ZBVA 4LUTB 5M1TA 1VBUA 3W3OA 3WUBA 5REQA 1JUKA 4O1BA 1NU5A 1JF5A 5ECVA 4CEUC 3PSVA 3WF1A 4V28A 2NQHA 5F2LA 4ZFMA 4MUPA 3WNLA 2QPXA 1JCMP 1Q6FA 1LWHA 3PBGA 4WLCA 1A4MA 2ZRZA 4AYSA 1A5SA 1ZBWA 5XINA 3EDDA 4UTJA 1YDNA 3ZM8A 1JD7A 3DENA 4TV5A 1UBPC 4N6EA 4J3XA 4BA0A 5AYBA 4L61A 3QRHA 4AZ6A 2QCFA 2Y8UA 4AZHA 1IEVA 1VLWA 1TV2A 4IF2A 1DWHM 1AH4A 3TMQA 1POJA 1E73M 4AF0A 2E67A 2VQUA 2IPGA 2G5WA 3STFA 4IIEA 3W74A 2VFEA 3AJ7A 2ISDA 1AQ0A 4DXVA 1RVGA 3V5FA 1XLJA 1UD2A 5K9CA 1EL3A 4OBRA 3VIPA 1MRAA 5I24A 2Y88A 1EWDA 2ZC8A 3E02A 1H63A 3PAJA 3VVGA 1OGSA 2XHYA 1JEZA 1CTNA 4Z1CA 3GG7A 2PCEA 1CGTA 3M5XA 4GVIA 3AHXA 3AIQA 2E9LA 1BGAA 1U22A 1AA1B 3K8KA 5DMLA 4KCWA 1H0IA 3QEZA 2DP3A 1W5QA 1OX5A 4M19A 1Q6RA 4E2OA 2PWEA 2VRQA 3LZ3A 3R5EA 1EO5A 3RCYA 1Y7VA 4HK6A 2VZTA 1BSLA 4YWIA 2GJLA 3SUTA 3NQVA 4FO4A 4H4IA 3I7RA 3NPVA 3NXFA 3M5ZA 3GY1A 1IZCA 1Z69A 3APTA 1BVNP 3UWEA 1NY1A 3I6EA 1LOSA 4M7SA 1IXNA 5CC7A 1BG4A 1J2WA 4UFHA 4EIVA 3BAIA 3LHZA 4X9SA 3GHSA 5DANA 3WLHA 1SSGA 3K4DA 4GRSA 3QTGA 2XDFA 5D38A 1XQKA 1TV7A 4O8AA 1Z48A 5SWUA 3JUGA 4O1AA 3AAMA 3LRKA 5AHFA 1VRDA 2VFIA 2WVVA 5JU6A 5I3DA 9XIAA 4MADA 2DQWA 4N4PA 4HU4A 6REQA 1DQWA 2X1RA 4IXHA 1KRBC 1OVDA 3ISIX 3E5PA 4M81A 3IIVA 4IMDA 3LM7A 1C9DA 4N9CA 2QCGA 4GBUA 4BHYA 2Y85A 4FNRA 1WV2A 3CUFA 5ECUA 1J0KA 2EF9A 1CECA 3MI2A 3MB9A 1DWFM 3OIXA 1EX1A 5HWJA 4FNUA 3TSMA 4LS0A 3S8HA 6PTDA 4FB7A 1XIGA 1B9BA 4MGGA 4R7WA 2I17A 1PUDA 4AZCB 2ZZ5A 1W3TA 3TDFA 4Y6GA 2VX7A 3TTOA 3LBOA 2AKZA 1VCVA 3REQA 1E6PA 5LIWX 4NZ3A 1DV7A 1CGXA 3GTHA 3MP5A 2A3AA 4LAMA 1VIZA 2E5CA 3B06A 3ZMRA 1OY0A 1PKMA 1VYRA 3V7PA 1PAMA 5LNWA 1IXQA 3QVQA 4EOUA 3R13A 3M7WA 2B7OA 6ALDA 4WSHA 5K9DA 3IK2A 1QPOA 1LL4A 4TV6A 3INPA 2NVDA 2F6XA 3H4WA 1XD1A 2JK2A 3PZNA 3PB0A 2J25A 1LM1A 3IGHX 1IT8A 2PMQA 1V77A 3W7KA 3G6LA 3VAVA 3PC0A 3KX6A 4B5TA 4RDWA 4HTBA 4XZ9A 1HL9A 2J6VA 2PLJA 5K7JA 4FXRA 4E38A 4DJEA 5C5YA 4KWUA 4HD5A 1H61A 2Q3RA 2X8RA 3PG8A 3QYSA 1BVWA 1CXHA 1FX6A 4YYFA 4N2YA 1HIZA 2V3EA 3AWNA 3OODA 3TROA 2W92A 2ZOXA 4F3HA 3BG9A 4JFSA 4LV9A 4P8XA 5IHSA 2ZDSA 3MW7A 4UOJA 1SYTA 1QFEA 3V36A 1SJAA 4GCXA 2QCMA 2E68A 4PL1A 4U3AA 1JXJA 2PD9A 4B15A 3B05A 1P4CA 3NCOA 5D33A 2I1OA 3IEBA 2VURA 1HO1A 1G4SA 3VCRA 2P8BA 5AZ0A 1QW9A 4O0KA 4HNTA 1WO2A 2BG5A 3C8NA 3R7MA 1OYCA 2GDUA 1PZ2A 3STCA 3AZSA 3T0CA 3ONCA 3QKEA 5E0CA 1SW0A 4MKNA 4KRTA 2OLHA 1CBGA 3F1QA 4ORIA 1QBBA 2VC6A 2DFAA 2VKZG 3O05A 2PDMA 5HANA 4ZEPA 1TO3A 1Z32X 1UMLA 2FJUB 3AISA 1W5MA 4XAGA 1W1TA 3CQIA 4LB3A 4QM1A 2J62A 4HB7A 3OQEA 1GVOA 4DBDA 3IJ8A 3ABOA 1A3WA 3HOJA 3LZ5A 2PDJA 3IS4A 4DLFA 3MBDA 4QLLA 4C6QA 3KCLA 4C65A 1VC4A 1A50A 3VGEA 1KFKA 4AH7A 1E4MM 2WHKA 1HKWA 3RUBL 3B9AA 3ARSA 1Y5XA 4XUGA 1VQTA 2V2HA 3DHUA 3EXRA 4HSNA 4MHBA 4ZOAA 3GO2A 1W37A 3PPGA 3W7IA 4M29A 2V5JA 5CC5A 1NARA 2REQA 1DXFA 1FY6A 3GXPA 5HQMA 3NFUA 1JZ6A 3I3BA 4QHRA 2ZX6A 3ZSSA 2QCNA 3BPWA 3CQ0A 4UTWA 1S2CA 4DJFD 1TG7A 2IPFA 4DNMA 3R8RA 3VZYA 4JX5A 1EYWA 4JN6A 1WDSA 1ZAIA 2CPUA 3MDUA 1QNSA 1H4PA 3WDQA 1JNEA 3QZ6A 1QHOA 1XXXA 4DI9A 3GZAA 3N9RA 5B80A 3MMWA 4DO4A 3W9ZA 4J3UA 2ZUTA 4H9VA 3WMLA 2F2HA 3UT0A 1YHTA 2WSKA 3HV9A 3TYEA 3WLKX 4GQBA 4Q4RA 3WN6A 4S23A 4IIDA 2E9MA 1VJIA 3GAYA 4KQNA 4WR3A 3O2LA 1TV3A 1KQZA 3TXZA 4L1WA 4O0QA 4FF7A 5DCBA 1C93A 1I8JA 4H7VA 2IPJA 3NQBA 2GJXB 1XYCA 1M7XA 1JFXA 2GPTA 1ZS2A 3VZXA 4LUSA 4GINA 1G4PA 3TW7A 1H3GA 1OB0A 3OP2A 3OLDA 3WQGA 3WK2A 3GDRA 5AOUA 1HTIA 2NLIA 1RQHA 4X61A 3SADA 2J9XA 4ECLA 3KTSA 1JVNA 2VR4A 2WMKA 2Z0IA 4Z08A 4WKFA 2J7EA 3SRFA 1TIMA 1EJXC 1TPWA 4RZBA 5CPNA 3QPZA 1TA3B 2Y2WA 3S5NA 2BHZA 3BXWA 3LHVA 4ZOCA 1Z44A 4Z2IA 2GOUA 1O5RA 4GUGA 2W27A 3UESA 3FJLA 5C9WA 2OMAA 3RCNA 5A8PA 2XGIA 4C6IA 2H6RA 3O6YX 4AIOA 3OGSA 1H11A 1XICA 1CLKA 1S5WA 1SZFA 3QH2A 1MEIA 3VKJA 1QRQA 3K2GA 1K70A 1CLVA 2WKGA 1GVFA 1EBGA 4ADTA 3A4XA 4IP4A 3H2NA 5CGMA 3UNTA 1B31A 2QZRA 1GOXA 3BC9A 5D03A 5L6UA 1C91A 5T8GA 3SECA 4I9TA 2VZUA 3KEHA 4PTNA 3C2VA 3PZMA 3W25A 1E43A 5LXXA 1VFSA 2YYTA 3CIVA 4A3QA 3GR7A 1VENA 1DJQA 2NXHA 4LT9A 4GI6A 3R43A 1OC5A 2GGJA 3DFNA 4RE4A 3OVQA 4MNMA 2D24A 3SM0A 2OOFA 4AHQA 4KF1A 4KWVA 5E70A 1B3OA 2VGBA 4PODA 3GW0A 3TSBA 3KAOA 2HVMA 5HR7A 3GVQA 3HGOA 3UERA 5A6TC 1R9ZA 4K7YA 3UFYA 2MUCA 4JCMA 4KETA 1XIMA 3WFLA 4MTVA 3UETA 4FOKA 3NL3A 2VZOA 1CZ1A 1VH7A 5I2UA 3NQGA 2D69A 2CYGA 4B5WA 1YW1A 5DT7A 5I3KA 1LG1A 4PL2A 1UJPA 2EHHA 2FH6A 2XIIA 3A5VA 2PGWA 4FLRA 3QV7A 5BOEA 4AIUA 3LK6A 4Q8UA 2PWFA 4AWUA 1XBYA 3VX0A 2QVNA 3ZVHB 1AG1O 5BZAA 1W9XA 4QNEA 3LGGA 4W8BA 1NFGA 2R8WA 3S0CA 4GD0A 1R8LA 4IISA 1HVQA 1NP0A 1Q7MA 4HPJA 3VIFA 3ABRA 2Y0FA 4IGSA 1RXOB 5CZTA 2GDQA 2XVKA 2XG9A 1BYAA 2QEZA 3CHEA 2P50A 2GJNA 5XIAA 4RR4A 3W7HA 3RRAA 3DX5A 2WJFA 2R94A 4RLIA 3IV3A 2O4MA 2VMFA 3EWWA 1XLIA 4DX3A 4JXCA 1UQYA 1WKFA 1J93A 4L65A 3PZOA 1E51A 3W71A 1BWKA 1PDYA 5A3HA 4DJDD 4XKMA 4DELA 2PWVA 3ELFA 2YDRA 4L1GA 1SFLA 1BYDA 3NAVA 4I5XA 1XBXA 1F74A 1UUOA 1XX1A 2PWDA 4CNPA 3IK4A 5ABHA 1CW2A 4P7OA 1OFOA 2H9AB 1XLAA 4IMCA 5H8MA 5CGTA 4AC1X 1SZNA 1X1NA 1H1ZA 3BMWA 4UCFA 4JQ4A 3CZLA 3VNMA 1W3LA 4GH1A 3DFSA 1QI2A 4R3UA 2IQTA 1N8WA 4DAFA 2Z6JA 6ENLA 5A8NA 3U9IA 3NIYA 3HO8A 3RLVA 5TBOA 3NQ7A 3HG3A 1Q4NX 1DBTA 1VFLA 4IMFA 3VA8A 3IPWA 1UKQA 5CPOA 3AI0A 4WD0A 2WJEA 4PBGA 3DC8A 4NAEA 4JTCA 4MWAC 1I2RA 4UMBA 5DCEA 1ICQA 4B3LA 5MKGB 2VZVA 4JFTA 5LXEA 3ANVA 4NZ4A 1BRLA 1ZHAA 4BI5A 3PZ9A 3U2OA 2NX3A 4NQ1A 1I60A 1I45A 3EKGA 1XLCA 4IQLA 1UR0A 3W0KA 2G95A 4B9ZA 4ZENA 3WLOA 1RQEA 4PE8A 2VFHA 3FXGA 3NM1A 1K8XA 4R85A 5FJUA 4MLJA 1GKRA 1FWTA 1EP3A 3DN5A 4IMAA 3E0WA 3ITYA 2QMKA 4LCQA 2WMGA 2NSXA 1K3UA 1XG3A 1DORA 3CTTA 2OKOA 3GVWA 4REQB 2ZRUA 1YNPA 5F7UA 1F3XA 2GL5A 1SQ7A 4OOUA 4CNOA 4BY3A 3OZPA 4U33A 4MNJA 2VR2A 3IVSA 2VP8A 2Z6IA 1TIWA 2NLYA 5DN1A 2O9PA 5JBDA 1FWGC 1PKNA 4PTXA 2EPHA 2BODX 2O92A 4MB3A 1RLCL 3E2RA 4HNNA 4X0NA 2GK1A 4JNYA 1FUYA 3FGCA 2C91A 2PGEA 4HJFA 3TN6A 3GKAA 4XZIA 1TB3A 3WF3A 2WJZA 3MY9A 1SMAA 2DZBA 3ZSTA 3GNPA 3UG4A 1W8SA 1QI4A 3BMXA 3U3HA 4KT2A 1NFPA 1OD8A 5JH1A 4KMQA 4Y9NA 2YA2A 1W1ZA 2Y7GA 1S1PA 5EY5A 3KVKA 1AK5A 3CLWA 3KE0A 1U1JA 4I8DA 3WJWA 2AOSA 3QN3A 1UA3A 1J0IA 1R7OA 3BQ6A 4HCHA 4AIBA 3GXIA 3MZNA 3VKDA 4JTEA 1X6LA 1NWSA 1QI0A 3VNKA 1ZALA 1TWSA 4O12A 1A53A 2E6AA 3NGFA 1GPFA 3C61A 2FZNA 5J04A 4CD7A 1R9XA 2CXGA 5PTDA 4WHBA 3DKLA 3KL5A 3U2CA 1YTDA 4ZODA 3E2SA 3O0KA 2A3CA 2AGTA 4W4QA 2ACQA 3HIJA 4H2CA 3W85A 3AIRA 5E9XA 3PS7A 1AW1A 4MWAD 2OSWA 3NQMA 3V4BA 3K1GA 3PNZA 4PUUA 3L68A 1W1IE 3EMCA 3NQEA 3N13A 1OC6A 2PDFA 1ME9A 1RR2A 1VBRA 3TW9A 4V2XA 1DWGM 2XPKA 4JIEA 3CUGA 3OJGA 4S39A 3P5YA 3OBKA 4UTIA 4RNFA 2VDIA 4PMJA 4XAPA 4HSHA 1VKFA 3O07A 4CCEA 2RFGA 4JDBA 5CXPA 3LPOA 3W28A 3WZ0E 3GHUA 4GYJA 4E2VA 2Q8ZA 2PDWA 4YTTA 3GHRA 2FFIA 1BLIA 2CKRA 5CJNA 1B90A 3CBWA 4O16A 4MDOA 2ZZ3A 3GUGA 5H6HA 5CAKA 4ERIA 3MSGA 3BLEA 2IXVA 2DIJA 3VDHA 3CQKA 1T8XA 5LNSA 4U3CA 2CWXA 3FDKA 3MI3A 4UMCA 2VX6A 4A3HA 5G2WA 4S38A 4A3UA 3TYBA 2PDHA 4LUIA 3W37A 1V7YA 4G7EB 4FA3A 1IZJA 1EA0A 3XIMA 4HJWA 1CX9A 2VEKA 5CC3A 1DIOA 3I4EA 3RJXA 1NSJA 3MTWA 3EGJA 4CUCA 4AD4A 4XBJA 2FGZA 2BOFX 1VFOA 1RY0A 3PJXA 4MY9A 5F2MA 1W2PA 3TKFA 1E5NA 4XD4A 1Q2SA 1E40A 4WIWA 3G8EA 4TMBA 1TRDA 3T2PA 3QR1A 1TCMA 3S6OA 4UMAA 4NX5A 5H91A 1J11A 3N2TA 3S5ZA 3H54A 4JFVA 5AHLA 4LVGA 1SO6A 3L0KA 3H70A 2GUYA 4PYSA 1FDJA 3SO7A 2ZRYA 4JTFA 1GZGA 2NT1A 5A5WA 1PO9A 2DH2A 1XYAA 1XLDA 3WNKA 1RCXB 3MC5A 1LUCA 3RDKA 4BFAA 4DQWA 4PUJA 1NM9A 3W29A 2WMJA 3H2CA 1A3HA 4S3BA 4UCGA 1C3FA 1DJHA 2E28A 4REQA 2DDXA 3UWWA 3DKJA 4WJXA 2PI6A 3WQVA 4LAUA 2C15A 4PZVA 4GY0A 1C9WA 3F7JA 3SCRA 1UG6A 3HBLA 3C3NA 1LG2A 4KRUA 5D05A 1J2BA 4CKQA 1E6SM 1VGAA 4GMEA 3MHGA 3PR2A 3WBYA 5BU6A 1FXPA 1KM6A 3M43A 3RCMA 2BV9A 4Z1DA 4WXZA 3V5CA 5C7VA 2EG6A 1W1VA 3VDBA 3MYOA 4NASA 1KFEA 3WLIA 1KFCA 2ODOA 5G5IA 3T8QA 3W7RA 3UJSA 3W72A 2JQXA 5M5DA 4PUNA 1P5BA 3TYUA 3NUKA 4HHPA 3UPMA 5DXYA 1UYQA 4LGXA 4QLJA 2X0SA 3UU0A 3LB0A 1P6BA 4GZEA 1DL3A 4G6CA 5LIUX 4BK9A 3VINA 3RO6A 2C71A 4TR9A 3UBPC 1DWAM 1RLDA 1VJSA 3GG0A 2FIQA 3VOJA 4DUWA 2QDHA 4E3VA 4YNGA 3DFHA 3F03K 2YDQA 1ZUAX 2HRWA 3EYPA 3SIMA 1VIWA 1ZJBA 2PUZA 4BJHA 1R7AA 3AS3A 4QIUA 3SUSA 3S5OA 2X1TA 5FSDC 5A6JA 2VCCA 1RALA 2QCEA 1YYAA 1CLXA 3T05A 1IXOA 3QC0A 1Q6QA 3QGKC 1GZ1A 3UVAA 5CJ5A 3M0YA 4LYQA 4PSRA 5AHIA 1IEQA 1BTCA 3LOTA 1CGVA 1V6TA 5HMSA 3H2FA 2Y4SA 3L4YA 3OA5A 2YIHA 4ROPA 1YKWA 3BK0A 1UWRA 1IR2A 2V81A 4UOZA 2ZZ4A 3FEQA 3I7SA 7TAAA 1W9UA 2ONEA 3SZ8A 4HZ7A 2OT0A 1CCWB 4Q7NA 2CITA 1K4HA 1G9HA 2ABAA 4MJMA 2IKGA 1GTEA 4Q3MA 4R34A 1DQUA 8RUCA 5LGXA 2XIMA 1V08A 3N15A 3PY2A 4EPKA 3GTXA 1WKEA 1IR1A 2QF7A 5KSWA 4ZO6A 3N73A 2OQHA 4IFKB 5CPTA 3URBA 4LV4A 1SPQA 2I57A 2G3MA 2OO6A 2YZRA 3P60A 4FXJA 3S1GA 1ISVA 3OZYA 4RJEA 3R0UA 3U48A 3B04A 5FEWA 3M6DA 5AC4A 4G7FA 4TO8A 4LB4A 1GTHA 5KZEA 1ENUA 2A1YA 4WXYA 3HTWA 1MEHA 5C6MA 3RN6A 4FX8A 1OK4A 3W6LA 2VNCA 5TIMA 3TNBA 3VE9A 3LX9A 2ZA3A 5F1UA 5HMFA 4A4AA 4K68A 3LUTA 2XM2A 3GU2A 4XAYA 2HTMA 5CSRA 3WENA 2DUAA 3EOEA 3DCPA 4GCAA 5D09A 1H2JA 1ISWA 3C2RA 2VJXA 3K30A 4JY8A 2VHLA 4P8UA 4EF8A 5K2ZA 1XKYA 3MQTA 4QE1A 3D3AA 1NDVA 3BLLA 5HMDA 3HPXA 1XH0A 4L4OA 5HWNA 1OCJA 1UR9A 2BHYA 3SUUA 1ZCCA 3FDGA 2WSQA 2ZDRA 3I6TA 3FYYA 2HNHA 3AZTA 2DSZA 5H2ZA 3C6CA 4QGCA 4O4VA 5JQ9A 2J74A 3AXKA 1G6CA 4M80A 1KNWA 1ZBCA 3FHQA 2BXYA 1PIFA 2G41A 3WD0A 2XVNA 7TIMA 1CXFA 1XIDA 3BG3A 3P5ZA 3GG8A 3O06A 1A47A 1R2RA 4DBEA 2XN0A 2DUXA 2E3ZA 4UUIA 3LQLA 3ICJA 3A21A 3P82A 1KBLA 1WBHA 4NJGA 5XIMA 5BXSA 3ABSA 4RNJA 3BLDA 3Q94A 4QP0A 1AMYA 5DEZA 4DRSA 2NQZA 3IAQA 1JZ8A 5EA9A 2XUCA 1SFJA 1YX1A 2VTFA 4UOQA 5E09A 3V3WA 4CQCA 1O5XA 3V16A 2PWHA 4Q7BA 1TJ1A 3TJIA 3IANA 1TWZA 1TVNA 1NAL1 3BW2A 3TZNA 4J27A 2PU0A 1YRRA 3PZIA 4YVPA 3VZZA 3ZR5A 4UTMA 1SZEA 3DECA 5EU9A 1MXDA 1EPXA 3S2CA 4PH6A 1LWIA 1THFD 1XIIA 2Y89A 1XP3A 5D2XA 3V5OA 4F48A 4F9DA 3ABQA 5C70A 1OINA 4ALDA 2WNWA 3KZSA 4RV3A 1RJQA 3MT1A 2WHMA 1OABA 3XISA 3HG4A 3KS6A 4A05A 1REQA 2EQDA 4NF7A 4BQ5A 4XZWA 1U5VA 2E1DA 3OOQA 3GD6A 2XWDA 1EEPA 1VFFA 4YLWA 3VMPA 1A5KC 2XIOA 1BPLB 1X8FA 3P2VA 2NVAA 5F4WA 4K39A 4EANA 3HMJG 4QS5A 1UUQA 1HJQA 4BCEA 1QUMA 2B7PA 3V1HA 3VGDA 3MHFA 3A24A 2ZE3A 4TU1A 1TPFA 3VKBA 1CI1A 3SBFA 5CJMA 2PC8A 2PFHA 5K3VA 3KW3A 5BRQA 2GJRA 4RE0A 2PLCA 1AL7A 3ALFA 2QPSA 3QMTA 4LRTA 1X7IA 4XBSA 4D8ZA 1KR1A 1DIDA 4QCFA 2POTA 3VE7A 3OLIA 3BZJA 1J6PA 1M9HA 3RPDA 2OG9A 1Q2RA 3NM3A 4DJFA 3W7JA 5TF0A 1XLHA 3NYZA 1OD0A 4L4LA 1P48A 3NQ6A 5EMMA 1MW0A 3GH7A 3W24A 2YB4A 4NRSA 4RDYA 2WPBA 2YFOA 5HUOA 1AVAA 3RK8A 2ISFA 4GI4A 4S2CA 5A6BD 1W5OA 2Q09A 1ESWA 3IUIA 1CENA 4QJ5B 5C2XA 4NI8A 3PBVA 1R3SA 2MNRA 1QNVA 2OXNA 5DO8A 3HFTA 3RNDA 4NJIA 3S1WA 3NDOA 1DJNA 4L9YA 1WAUA 1EXBA 1Q5MA 1VHNA 2VXNA 3T0DA 2PB1A 4XV0A 3MP4A 1FP9A 1PJ9A 5FI8A 2Q3OA 3W23A 3ZJ8A 1VEOA 1OT2A 3S9IA 3CYVA 2YSWA 4QAWA 3WQFA 4AMCA 3IJ6A 3B3DA 2PSNA 3TV8A 2OSYA 1W2VA 2TODA 2EG7A 3T78A 2AAMA 3MSDA 4UQAA 1U5HA 3TSDA 4CQBA 3WCZA 1UKPA 5BOOA 2DT1A 3M41A 2DUZA 4ZSUA 1RBOB 2HBXA 2GGEA 2DU2A 5D02A 2J7DA 4C7GA 1TJPA 1QWKA 1ADSA 3L7RA 5FF0A 1Q4WA 3K8MA 2PDXA 5DLCA 1AZ1A 3G0XA 3GWQA 4BF9A 3W4RA 1MXSA 1X97A 3JU2A 2JKAA 2QQ6A 2BOGX 4EACA 4IX2A 1NWUA 3L0NA 4L9XA 1QW7A 3N25A 4WDUA 1JQXA 2YLAA 2CESA 1SO3A 3U4AA 2OLSA 4UNIA 1F6KA 3MYPA 3VIHA 5EGRA 3R94A 2XVPA 4O8RA 1JPKA 3UA3A 2PZNA 2OZ0A 4BQ4A 5C9UA 4EXBA 2CETA 4ILSA 2QULA 3C2YA 3SGZA 4DJEC 3UXKA 4CNSA 2O9RA 3GQYA 2BBFA 4L64A 4IWWA 1F61A 1PYFA 2BDQA 2DH3A 3DC0A 2G37A 1TV5A 1KBJA 1HGWA 1XRFA 2OCZA 3MJYA 1XISA 5HNRA 8A3HA 1EGZA 4CCDA 1V3IA 4GYKA 1ZBKA 3LI0A 2DSWA 5C7HA 1DQXA 1PZ1A 3ARXA 3E49A 1JZ4A 2W5FA 3N4EA 4JTDA 3A9BA 2ACRA 1OFDA 3EDKA 2DT3A 3TCEA 1FWEC 4UQBA 3OYZA 2J79A 2X09A 1MDLA 3RG6A 2XFWA 1JFHA 4ZO7A 3E3HA 4P2VA 1Q3NA 3G22A 4GK8A 1KQYA 1BWVA 1DKWA 1GOIA 3MO4A 4WY0F 4ZO8A 1RBAA 3M0VA 4I7VA 3P0XA 3OBAA 1TPDA 1WUFA 3JZEA 2JF6A 1KM3A 4ZQPA 1XJBA 4J3ZA 2AMXA 4J35A 4JN7A 3TN4A 3QQWA 1S39A 4TOQA 2NQJA 5D30A 3F5LA 4EF9A 4CLMA 1DJGA 2H3BA 1J0JA 4QNWA 4Z0SA 4AAJA 3B8IA 4KFNA 3P8JA 1FBAA 2C1GA 2E5BA 2WCSA 1OX4A 4PCTA 2V69A 1UQZA 3HMCA 3QLLA 4DXKA 1KM0A 3O7UA 6A3HA 3VOIA 5BROA 3AUJA 3EOOA 2A21A 3DEQA 1LLWA 1JF6A 4UZUA 3WQOA 4FI4A 1FHLA 4DI8A 4HGXA 3MKKA 1N82A 3AYTA 4A21A 4CQ9A 4IG2B 4UR9A 4Q8WA 1JCTA 3RM8A 3FW6A 5CCZA 3NSNA 3TQPA 4C91A 3W6MA 1UOKA 4FNQA 1VBHA 4UIOA 1DOSA 2NWRA 3NZGA 2Z28A 3A23A 4J3SA 5ABEA 3PWAA 1UD4A 1TJ2A 1YDOA 2OJPA 1OJXA 3OO2A 3H8AA 5A1AA 1CXEA 7REQA 4DJDA 2DQXA 5TNVA 2V68A 1H7RA 4C6PA 4UTWC 2WZHA 1H1NA 4K7VA 4AFYA 4HU8A 4C6FA 2FVMA 2ZUUA 3RJYA 2GZXA 3NO1A 2QIIA 3EMZA 1PX3A 2VDHA 1PIIA 4IPJA 2OYLA 2R1PA 4PMXA 1T40A 2VL4A 2VI0A 3H2AA 3TA6A 2Y62A 3UJ2A 1GVRA 5JIPA 4JYEA 4F4RA 2EKCA 4YYCA 1K7XA 3THCA 1TREA 3CGTA 1JZ2A 5C8BB 4FF5A 3FSUA 1BHGA 1XRSA 2CEQA 2TRSA 3BGGA 3SRHA 3MSYA 1KTBA 3ZLFA 5HAOA 3T6CA 3ZS4A 3T0BA 3VDAA 1YE6A 2HCVA 2VD9A 4GH3A 3XINA 4MWAE 1E9ZB 3O6AA 5G1TA 3EKLA 4YTSA 3GB6A 3V75A 1R2SA 2W61A 1GNXA 4UR7A 2ZXBA 1YBQA 2BX7A 5CAHA 1MNSA 2Y7EA 3B8VA 2QCDB 5HMEA 1X39A 2J24A 4RDZA 3E5BA 4CQDA 1IWPA 3FX4A 4OQVA 4HOXA 3GK0A 3L5AA 1W0MA 3OVGA 4HCLA 3A47A 3W27A 5M03A 1Q7QA 4ZMGA 1JDDA 2WZIA 3V0UA 2RH9A 3EB4A 5D04C 1VBJA 2PTYA 1LOLA 1NH6A 5C54A 3HJEA 1XINA 1CXIA 1RK5A 1W56A 2ZCGA 4X3ZA 2F9RA 4E0CA 2Y5EA 4GQ0A 2HVOA 3M47A 2ZICA 4J3VA 5HJXA 2Q8XA 2D23A 4C60A 2ZX9A 1JDCA 2OEMA 2Y7FA 4GUIA 4IPIA 3L2MA 3DBNA 1W3HA 1U30A 1ML1A 3ANYA 2GFTA 3WQEA 2RUSA 4I6KA 3WJSA 1DJWA 2W6RA 3GR8A 1YQ2A 2X7VA 4DHGA 2PURA 3FVMA 3G24A 4HA0A 4UFLA 4A35A 1A80A 1UZ1A 2F7FA 1V3KA 4LAZA 3N6HA 4ZOBA 5G1MA 5FJIA 1QJWA 3BWWA 3PP7A 4ZO9A 3EOSA 1P0EA 4KESA 1FWAC 1XIBA 1RBLA 3QR3A 3LENA 3DI1A 5A2BA 1IV8A 2Z2AA 1BSIA 1OFPA 2GUUA 4PUWA 1YEYA 2G8ZA 4V1XA 3NEVA 1DIEA 2HK1A 2PZ0A 1W3IA 4NU7A 4LQ1A 3SRDA 4RDVA 1B0IA 5T9B