1TREA

The structure of triosephosphate isomerase from escherichia coli determined at 2.6 angstrom resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
255
Chain Sequence
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVNLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Structure of triosephosphate isomerase from Escherichia coli determined at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Intramolecular oxidoreductase
total genus 87
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1992-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1treA00
1KV5A 5G5IA 4DPQA 3S1WA 4MZ1A 4MLRA 3IGUA 3NL2A 2FQIA 2DZWA 4RZ6A 3I7RA 3FLUA 1DQWA 4XKYB 3W86A 3IV3A 3O6YX 3KOFA 1M6JA 4K7VA 5K9CA 3UWQA 1GVRA 1FUYA 3O8AA 3QPYA 1TYGA 3GIYA 3DAQA 3W7KA 2V5LA 3WK3A 2P1FA 4IGHA 3EX4A 4QJ1A 4M6VA 5CZJA 4H6KA 2BLEA 3UYCA 2TPSA 5HUOA 3TXZA 3PM6A 4Z0JA 2CLFA 4LVBA 3W7IA 1YTDA 2I1OA 3W1AA 4JTSA 1OJXA 2QF7A 1KA9F 1Q45A 1QNVA 5L9FA 3W7JA 5A8GA 4IOTA 3V75A 1H62A 3C56A 4HN4A 4KWVA 2Q3OA 4AF0A 4UFHA 3QW4B 1VLIA 5LKYA 2Z0IA 3CHVA 1KM6A 3TK7A 4ADUA 4PH6A 4O1BA 3OIXA 3KRSA 3KHJA 3W7CA 2E77A 2QJGA 4FX8A 3BPWA 3LBCA 4X2RA 1XC4A 2ZRWA 1GQNA 5C55A 2RDTA 3L2IA 4ZQRA 4ALDA 3U6WA 4FNUA 5HMSA 2YXGA 3A5FA 2ZZ2A 4IMDA 1M7PA 3N14A 4KFNA 4NZFA 3L0NA 2GVGA 1L2UA 4O14A 3RU6A 1U83A 2ATMA 3BG9A 1HO4A 3G1YA 4GUIA 3PUOA 1DL3A 1TJRA 3NM1A 5FEWA 2ZZ7A 1T96A 3ABRA 3GX9A 3LI0A 5D33A 1W5OA 2CLIA 1GVQA 2VEMA 2A0NA 3STGA 2Q8ZA 3DGRA 2ISWA 4HIBA 1V7YA 5HWMA 1KFLA 4NJGA 2CZFA 3FKRA 5J5RA 2CLMA 4POCA 1OX4B 2ZBTA 1JRCA 3LHZA 3N3MA 4RCXA 4MJZA 1TPDA 3CC1A 3LRLA 4NX5A 2WO5A 1TV8A 3CB8A 4UTWC 1FWWA 1TTIA 2J9ZA 2NX1A 1XXXA 2ABAA 4FNTA 5EPDA 1FY6A 3GLCA 3NQFA 2X1SA 1I2NA 2GQ9A 3A21A 3USBA 3EWXA 5EA9A 2WOQA 3GKAA 3PBUA 3TQVA 4Z1CA 1YXYA 1DBTA 4JICA 5FEZA 4WQ6A 1SSDA 3ZFHA 5LZLA 3MUXA 3G22A 1IXQA 3DHFA 3M43A 1D3GA 1ZHAA 3E02A 4FEZA 3FIGA 3TSBA 4O15A 3UXDA 4D2JA 1K03A 4LW7A 2C3ZA 3S1VA 4JDYA 4YXGA 1EX5A 5LSMA 3M5XA 3PBWA 3S0CA 1KM1A 3DI0A 3W1UA 3E12A 1VZWA 2QDGA 1TO3A 3B04A 1K8YA 2NZLA 1W54A 2GQ8A 1OF8A 4RJEA 3GKFA 2A6NA 3HMJG 5HR7A 1T0OA 4ICNA 4ZL1A 3RK8A 4N9EA 3UY8A 2HSAA 3TSMA 1H1ZA 5AC8A 3FKKA 2TSYA 2VEPA 3TW7A 1B57A 4AH7A 1EA0A 5HR6A 3HPZA 3STFA 3S5ZA 4HHPA 3PSWA 3Q94A 4XKYA 5D30A 2UV8G 4RX0A 2OMAA 1GTEA 3TE9A 1JCNA 3YPIA 5AHFA 3TMQA 2Y70A 2VOMA 4BWLC 1YTKA 2WKJA 4QNEA 3DI1A 3GNNA 5DXYA 3TSDA 5LNWA 4Z0SA 3NG3A 1VRDA 3L5LA 4FHAA 2VEKA 2VFGA 5DXXA 1OK6A 4O0KA 2QUTA 1YTEA 3N2MA 4CCDA 6ALDA 1ZALA 1GYNA 1TIMA 4TMCA 5U4NA 2TRSA 3HG5A 5D2TA 3ANYA 4PFMA 3DENA 1YDOA 5D38A 4MKNA 5FF0A 1KM4A 4U4MA 4LRSA 4O53A 2X1RA 3PC0A 1HTIA 1MXSA 1OFOA 3S5YA 3AJXA 5BMWA 2NLIA 5DBUA 5AB3A 1OFAA 3TJXA 4U28A 2OX1A 2ZA3A 2R8WA 3O07A 1H1YA 2QCCA 3PAJA 4KWWA 3TCEA 4K8EA 3HGRA 3JS3A 2YYUA 3NYZA 2Y7DA 3W2NA 2R91A 4KFOA 4YL2A 3NL6A 5K9DA 3ABOA 1W0MA 2QAPA 3KFTA 3S6DA 5BW6A 3HB9A 1VYPX 1F05A 4N6FA 4HKPA 1KLZA 1LOQA 1WQ5A 1B4KA 3TW6A 5HINA 4NJKA 2Y63A 3ZWSA 3C2OA 3CIWA 1EPXA 3SGUA 2E09A 2B7NA 5G1YA 1T8XA 5EYWA 2GJNA 4JY9A 1F2JA 1OX4A 2Q3RA 4OU1A 2QCNA 4UR7A 3IIPA 3P62A 3DFSA 2VENA 3DBPA 1GG1A 3LXBA 1K3UA 1UCWA 4FIRA 2JKAA 3UNDA 1EIXA 2JKPA 3I6RA 1KFKA 1MSSA 2EKCA 1SPQA 2E68A 3PUEA 3MP5A 4AXKA 1W56A 1LLZA 1R47A 3QZEA 4R7JA 4RZ4A 2HS8A 1LCOA 3TDFA 3TKFA 3TQ0A 3C0JA 3O15A 4O1AA 1R2SA 5BNKA 2ISSA 3WJWA 2YSWA 3W1TA 4A2SA 1F6PA 3FYPA 3WFAA 1THFD 4A21A 3MI6A 3FFSA 1ZCOA 4DBDA 2ZYFA 3NQ8A 1S3HA 3E9AA 2FIQA 2NX9A 1IIHA 1ADOA 3BG3A 3NPVA 3EXTA 2C16A 3TAKA 3VI2A 4Y8FA 1VCVA 4M19A 4MUZA 3LTSA 1WAUA 4FF7A 1FXPA 2WSYA 2C13A 1VH7A 5G1TA 1QOPA 3JRKA 4NVTA 2B7PA 4MJMA 4WX2A 4KFPA 2Y7FA 3IVUA 2DZXA 2YZRA 4OT7A 3W71A 2WSRA 3LHYA 4ONVA 1O5XA 1DQXA 4UFMA 4A29A 2B7OA 3CEPA 3LHTA 3PG9A 2QDHA 1QWGA 3EKLA 2OZ0A 4OE7A 4AVFA 4MPQA 3EWWA 5ABTA 1WV2A 2VFFA 4UTWA 2I14A 1FX6A 1SFLA 4TU1A 4O0ZA 2Z2UA 3VCRA 1ZENA 3W22A 4DXVA 1WOAA 1W3IA 2DZSA 4XTDA 4A2RA 3QSRA 1GVSA 3R2GA 3O05A 4UUIA 4GC4A 4WXZA 4M7TA 4XBSA 1FCUA 2F84A 3IRDA 4Y9AA 2QUUA 3NQEA 2CZ5A 1H7XA 5HNRA 3LV5A 2ABBA 3LI1A 2NX3A 2GQAA 3G0UA 1YADA 3NM3A 1F6KA 3TR2A 4JTTA 3LCLA 3CPRA 4I7VA 3TROA 4JY8A 5AYZA 1RQEA 4EF9A 2Z1BA 3W2JA 4WOZA 1F73A 1P4CA 4KKXA 3IIOA 3MJYA 3E96A 1XBVA 1XUZA 1TRIA 2A4AA 3H54A 3QMTA 3FYOA 5K2ZA 1VYRA 5KSWA 1AL8A 4ZQCA 5C54A 1SZGA 5I3HA 5FF7A 5C6MA 4MIMA 3I7QA 1FXQA 1OABA 1Z41A 3B0UX 1FCVA 3T40A 4WXYA 1IXOA 3WJZA 4CLMA 3L9CA 1OFQA 4PA8A 4BWLA 3TC7A 3UWUA 1G67A 1LDCA 2GPTA 3WJSA 4XQ6A 3MBDA 1KTNA 5G2WA 1ZNNA 1LM1A 4O16A 3G1SA 1TTPA 1UBSA 1RV8A 3G1VA 3Q37A 4ORMA 4FX7A 4LS1A 4QM1A 3O6DA 3NZRA 1EP3A 2NUYA 3KVJA 3GDKA 3EX2A 1W8SA 1W1ZA 4CNOA 3BO9A 1H63A 4LVFA 1AW1A 1Z48A 1IXNA 2A1YA 2O7QA 2WSQA 4GUHA 3QM3A 4NZJA 3PBVA 5E1QA 2GVLA 2J27A 4IMFA 2DZUA 1SQ7A 1BKSA 1YLVA 1L9WA 3QW3A 5CG7A 4H3DA 1B9BA 3LHUA 1X6UA 4PL1A 3NPUA 1VQTA 1PHQA 1WBJA 1OVDA 4LRTA 2PC4A 2BZNA 3AO0A 3B8DA 4JDBA 3W2UA 4UFKA 1N55A 2Y85A 3NQ6A 1G69A 2QCHA 1H7PA 3L68A 2JBMA 4N9BA 3L5AA 3M44A 3LCHA 5AC7A 1IF2A 3BVJA 5DN1A 5CPOA 2W6RA 2RHGA 3D0CA 5CPMA 4TR9A 2E5DA 3W7QA 5BRBA 2YFNA 3TC6A 5KINA 1QPOA 4OWGA 3R5EA 1EWDA 1QPNA 2YYTA 1W31A 4IMEA 1ME8A 1TPVA 3QPZA 3MO7A 1TQXA 4AMAA 5U7SA 4MY9A 3T78A 5LNSA 3W1PA 3GNDA 3MMTA 2ZFAA 4E2BA 4O50A 3M9YA 4O54A 3LERA 5G2HA 1ZFJA 3UD6A 4K8HA 3F03K 3HJZA 3LB0A 2FB3A 1PS9A 3B4UA 2X1UA 1LORA 4BR1A 3EXRA 1K7FA 2WPBA 3ZR4A 1ZY9A 3W1RA 4JTHA 2DZVA 4OHQA 5HWNA 3JR2A 3W7PA 5LGXA 3MWAA 4R34A 1DJNA 3U2OA 2YPIA 8TIMA 2QEZA 1MEHA 4MFEA 1GWJA 2YW3A 6TIMA 4IWWA 4RZ5A 2A5HA 2GOUA 3TQKA 4HNVA 1LOSA 1YDVA 1XDMA 2HS6A 1TTJA 1TCDA 2PRLA 2A7NA 5CZSA 3W70A 1JCYA 4HPJA 4CNPA 3W6YA 5BMXA 3A24A 4FNQA 1K8ZA 2C0AA 1I4NA 5SWUA 3G24A 1O4UA 1NEYA 1JCXA 3M5ZA 4BFAA 3EB2A 3GYEA 1NF0A 3O16A 3KX6A 3F1QA 3PG8A 2OT0A 3C4UA 3CWOX 3HGSA 2QCGA 4X22A 1MO0A 1A5AA 5FF2A 3S1UA 2V8ZA 1ONRA 3EX1A 5DELA 3GVGA 1GG0A 3FS2A 2Y62A 1YYAA 3G18A 2DP3A 1SSGA 2PE4A 5KMYA 1VR6A 2VFEA 3F4NA 4GJ1A 5FF3A 1TJPA 3HPSA 3A9IA 4DBEA 3S8HA 4WD0A 4CQ9A 3KAOA 1EP1A 3QRHA 5CSSA 4MFDA 1TREA 3W7RA 3T55A 4AEOA 2E6DA 4JX5A 3C2FA 5LHFA 4GBUA 4MLJA 3NOEA 3MYOA 3DU0A 1YPIA 2H8XA 1HL2A 2ZTKA 1GVFA 3CIXA 3HIJA 3M16A 2PURA 1FWTA 4XZ9A 3SECA 4AHPA 3NPXA 4NJJA 1FCQA 1VGAA 2AQWA 4L4LA 2EGZA 4FXRA 2WQPA 4NQ1A 1TTQA 2XN2A 4UMBA 4GUGA 4WOQA 4DO4A 2C19A 5I3FA 1AG1O 3G1AA 3DFTA 2C18A 2G96A 1NSJA 2FTPA 3G8RA 3RMJA 1YDNA 2VELA 1XBYA 1Q6OA 4UFLA 3W75A 3W74A 3LM7A 3F4WA 3DZ1A 4S2BA 1JCLA 4IXHA 5LGZA 2G5WA 1LRQA 5DLCA 4O1DA 1Q6RA 3ELFA 4W9TA 4UXDA 3DH7A 3DKLA 1FCBA 2X30A 4ZQNA 3VKJA 2E1DA 1W3TA 3O6CA 1TPH1 3L0GA 4YCPA 2ZDRA 2QCDB 3B06A 4IXXA 3W3OA 4NUWA 1RD5A 1KW1A 3TX9A 2EHHA 2V82A 1Z44A 3QYQA 5GVJA 2C15A 4NNCA 5D2VA 4LOCA 1G4TA 3FJ6A 5F2LA 4IPIA 3CQ0A 2C14A 1H60A 3G8EA 4PEKA 2LLEA 4YWIA 1Z42A 3NNTA 2QCMA 4OV9A 2VFHA 5H2ZA 1K7XA 4GUJA 5IM51 4LS0A 1RQBA 4Z1DA 2CZEA 2P0OA 1FWRA 4AB4A 1H61A 3O1NA 4Y96A 5AC6A 1K7EA 1F7BA 2JGYA 5AN7A 3C2EA 1G4SA 4YMZA 4UTMA 2NV1A 3G0XA 5AHMA 1K8XA 1S5VA 4BI5A 3TUUA 2Y89A 1H51A 1WYIA 3GDLA 3TFXA 5D37A 2NUWA 2DZTA 3ATYA 3TJLA 4Y90A 4GNJA 1Y0EA 2QCEA 1R30A 5DCBA 5KZDA 3HGJA 3TV8A 2Y88A 4GE8A 1W5MA 3G1XA 4O57A 4S2CA 3C52A 4E38A 3EEGA 1TPUA 4LVGA 1SZFA 4UR8A 1EUAA 1KM3A 5TQLA 2H3BA 4Q33A 4XBKA 3W72A 1UASA 4N4PA 1DJQA 4JNMA 1TPB1 3S5NA 4K37A 5EMUA 4AWUA 1UJPA 2DZPA 3OA3A 4BK9A 4UMCA 4EWND 1SZNA 3LRKA 4MYXA 1RVGA 4NX0A 4C1LA 4I9AA 5K7JA 2BX7A 5KITA 3N19B 1TMHA 3GXTA 1NVMA 1P0NA 4NT0A 5CZ0A 5E0KA 2ZZ6A 4O18A 1N8FA 3CEUA 4JTFA 2NWRA 3EX3A 4HSOA 4QSHA 1M5WA 5FF4A 3IVSA 4H4IA 2AGKA 3M1ZA 1CX9A 1D3HA 1NF7A 1A50A 3PULA 3GAYA 3KRUA 3GDMA 1X7FA 4UNLA 3HPXA 3P60A 2CW6A 3SY5A 2F7FA 3SZ8A 3IIXA 3G0SA 4DF1A 1UUMA 3PY2A 4BI6A 2QKFA 5D2YA 1GEQA 1H50A 1JVNA 3TU9A 1QPQA 3DFOA 4LVDA 3RLVA 1EB3A 4UMAA 1QCWA 1X8FA 4K36A 1MEWA 1XI3A 3L21A 3L66A 3ZWTA 2E6AA 3G1HA 2ZTJA 2YCEA 3MP3A 1EEPA 4ADSA 3P82A 2BTMA 5HULA 4ZQOA 3LTYA 1N7KA 3CWNA 5D05A 3TFCA 2DU2A 2ZA2A 1X1ZA 5F4XA 3W9ZA 3LCIA 4M5PA 3HBLA 3P67A 3PB2A 4NJIA 4OBTA 4DQWA 5F4WA 4JX6A 1L6SA 4A22A 2QAFA 2ZRUA 1EWEA 4AAJA 3LCWA 1NAL1 1OFRA 4QQ3A 3GAKA 3NL3A 3SSJA 3ABSA 2TMDA 2JK2A 3N9SA 2QCDA 5LNVA 5CSRA 3R12A 4FO4A 3NEVA 4L4MA 1PV8A 3BV4A 3O63A 4RK8A 3FJLA 2V9DA 3P7YA 2ZZ3A 4O28A 4PTNA 3B0VC 1TB3A 1ZAIA 3HOJA 5H91A 3UPBA 1GPWA 4ORIA 1LLWA 2J6XA 1HG3A 4M7SA 4UC5A 1KTBA 4R33A 2FJKA 3RF9A 4ADTA 3B05A 2Z6IA 5G4EA 5G2IA 1F5ZA 2Y6ZA 1Q6LA 3CT7A 2JKEA 3EXSA 3LV6A 4LWWA 4HPXA 1FDZA 1QDSA 1FWNA 5AYYA 2QR6A 4JTJA 3G3DA 2W0UA 3DFPA 3W76A 3GZ3A 3NDOA 3UWYA 4UNKA 3UZJA 4R53A 4JTUA 1OX6A 1OG0A 4AWSA 1OFDA 3W84A 3U8GA 1KFBA 3RLUA 3WK0A 1AK5A 4LY8A 2V2CA 4GRSA 4DEFA 2R14A 3GB6A 4O13A 3LTPA 4TX9A 2FFCA 4DPPA 3OVRA 4UTHA 5AFDA 3UWZA 4PCFA 2ZZ5A 2GVJA 3UY7A 1AW5A 3SW6A 2ISVA 1LRNA 4G1KA 1TPWA 3MW7A 4QIUA 3LLFA 3PSVA 2FDSA 2IQTA 1GVOA 2RKXA 2RDWA 3LHWA 3ZS4A 4YCOA 3W88A 3I68A 3HG2A 4N9DA 1OX5A 3RNDA 2CZDA 1BEUA 4LVAA 5G4WA 4DO6A 4X3ZA 5I3GA 3V1PA 1PCWA 3PUDA 4N2YA 4I7WA 3WK2A 4QITA 3HG3A 4C1KA 2QCFA 2OJPA 4LNYA 1ZJIA 2E6FA 2RDUA 3DKJA 3GDTA 3W7LA 2VKZG 1PVNA 4JR5A 5I3IA 3W7EA 3B03A 4GWEA 5K4ZA 5BOOA 3EX6A 1O5KA 5A5WA 3Q2DA 4CCCA 2DJLA 2A6LA 3IIVA 1W3NA 3N9RA 2Y61A 1FQ0A 5J5DA 1ALDA 2V2DA 2V2HA 2W79A 4PC8A 2AAMA 2ZCGA 3LLDA 4FNRA 3VE7A 1G4EA 1JCJA 2DJXA 1KFJA 5AHNA 2NXIA 2FPTA 4UCGA 1A5SA 4RLIA 4IUOA 3DXIA 1TRDA 1J4EA 4LU0A 3GR8A 4IQLA 4GUFA 2BXVA 3QMSA 3MP4A 3NQDA 2I9EA 1R2RA 4BI7A 1RQHA 1JUKA 4NU7A 4LT9A 2H90A 1GJPA 2NWSA 3A23A 1YXDA 3W7HA 1DKWA 2ZZ4A 3BW4A 4YLWA 1CI1A 3BLFA 1TQJA 3RFAA 3H55A 3W85A 3SJ3A 4LUIA 3M6YA 3NXFA 3W7GA 3N2XA 1W5QA 3C2RA 5HUPA 1O94A 1G6CA 2CLHA 3QMRA 3W1NA 4JTLA 1JULA 5LHEA 1WX0A 2NXHA 3BGJA 1BWLA 5C5YA 3L65A 3K30A 1JR1A 1A5CA 1V5XA 5I3KA 3BK0A 4DF2A 3LGEA 1YXCA 3UXAA 1IXPA 3DFQA 1PHWA 3FEMA 2Y7EA 4JEQA 3TA6A 3NO5A 1AW2A 1H7NA 4XWUA 1OFPA 1JQVA 3DFNA 4O8RA 1PE1A 4HNUA 1I8JA 4J9JA 3PVFA 3GR7A 1S5WA 1GTHA 1AMKA 2ZA1A 4P2VA 4XUGA 2VXNA 3ATZA 4O17A 3VNDA 4LC6A 1HUVA 1KFEA 4NXKA 2CLLA 3SFKA 3TXVA 3NQAA 4GXMA 4WZHA 1OF6A 4MYAA 1LBFA 4WUIA 3HG4A 3ABQA 3C8FA 1AL7A 4OV4A 5CPLA 1VHNA 4DO5A 3QSTA 1DV7A 7TIMA 4O4WA 4UTTC 3TH6A 3CTLA 3PR2A 1QMLA 3S42A 4MOZA 3FA5A 4EOUA 1TPEA 2E5BA 1SUXA 1D9EA 1BWKA 1QPRA 4RR4A 1SW7A 5F1VA 3SIZA 3QH2A 3QQ0A 3DHDA 4EIVA 3P5ZA 2X1TA 3QF0A 4PODA 2X2GA 3WJXA 3NZ1A 1RZMA 3M47A 1WBHA 3T44A 2H3DA 2H8ZA 3NQGA 5CGQA 1XFBA 2A7PA 2P10A 4TIMA 4O11A 4WJEA 4PL2A 3VE9A 1KBIA 3OVPA 4UFJA 3HF3A 1ML1A 1C9DA 1LROA 1VYSX 5E93A 1XBXA 3UWWA 2CLKA 1KM2A 1H7WA 1ICQA 5D2XA 4AHQA 4RV8A 1A5BA 1DORA 3KXQA 3W1MA 3GXPA 3BGGA 3TIMA 1I2QA 3THAA 3QFEA 2WJZA 4TMBA 3W07A 1DVJA 1JQXA 3S5OA 3UPWA 4BF9A 2A7RA 5KZEA 1LYXA 2YW4A 5C2XA 1OHLA 2QUVA 3MI3A 4LS2A 1HO1A 3B0PA 3LDVA 3NA8A 2NV2A 1VJIA 3GK0A 2ALDA 2NXGA 4UTIA 3W7DA 3UQNA 2QJHA 5HWJA 1CW2A 4IJBA 3LCFA 3OG3A 5I3JA 5IBXC 1WXJA 2YFOA 3VFLA 3W7NA 1JUEA 2WNQA 1ME9A 3PF3A 1H5YA 4QAIA 4JYEA 1G4PA 4MZ8A 3EWBX 1JRBA 3M5VA 3HGOA 4JIQA 2NUXA 4UIOA 5CPNA 3TAOA 2VEIA 3NQMA 3M0ZA 1SO3A 2FLIA 3EKZA 3EWYA 2OT1A 1LRTA 1LBLA 1KM5A 1KTCA 3LHVA 1A53A 1I2PA 1OYBA 3MI2A 1J5TA 1XL9A 1JJKA 2WV8A 1LZOA 1ZAHA 1O60A 1TV5A 4JYFA 4O1CA 5EBUA 1XUUA 3KRZA 3MHGA 3A22A 3QC3A 1VHCA 3LCGA 5HJLA 1MEIA 3BW3A 1W37A 3SR7A 3MHFA 1TPFA 3M7WA 1VCGA 3M5YA 1H7OA 4JD4A 2JGQA 3LBMA 1WA3A 1BTMA 1XCFA 5KZMA 5D03A 4ZVJA 1Q3NA 1QFEA 3NQVA 4K39A 1P1XA 5LNUA 4FIQA 2V5BA 4NXSA 3C2VA 5CZTA 1C8VA 4FNSA 4MY1A 5D02A 4CQAA 4A3UA 1G7UA 2ZRVA 1S5TA 2CLOA 3W7MA 1XBZA 4N4QA 1TPC1 1GOXA 3QJAA 2J9YA 3LXAA 4AWTA 3L5MA 3N34A 1OYCA 2A2IA 3W2LA 4HSNA 3P5YA 4QISA 4JXCA 3C6CA 3OVQA 1SU5A 3CLMA 1QOQA 3E0IA 2XFWA 2C6QA 3MYPA 3IGXA 1G7VA 5DCDA 1WOBA 4NNAA 3WK1A 3H53A 5D2WA 2PRHA 4Q32A 4TO8A 3W7OA 2G97A 2XN1A 2A21A 1SW3A 4OQVA 1U5JA 2X16A 4N6EA 1SFJA 4JTGA 5K3VA 3NAVA 5DY2A 3NQCA 4Y6GA 4HT3A 1FDJA 4JTKA 3LRMA 4CCEA 3BLIA 4IMGA 4RXFA 3N73A 3UZ5A 2OCZA 1W5PA 2ZZ1A 2DORA 3M41A 3PWAA 5K9XA 1LOLA 5T26A 3LOTA 3LXCA 4JX4A 4EVZA 4JTIA 3CU2A 4K7YA 5F2IA 1KV8A 1OFBA 4X9SA 4JN6A 4WY0F 1GT8A 1J2WA 3P8JA 2VFIA 4UTUA 4Z1AA 1EP2A 2A85A 3O06A 3T4CA 1LTDA 1F74A 1UB3A 5KTLA 1XDLA 1R46A 2QCLA 2E6YA 5AHIA 5TIMA 1MZHA 3P61A 2YDAA 4E0CA 5AYXA 2EAWA 1K02A 4Z08A 3NGJA 1B3OA 2R94A 1WDWA 2O7SA 3C61A 3P74A 4GFSA 4WY0B 1SO6A 1VCFA 1SZEA 1IGSA 4N02A 1GYLA 3P8IA 1JCMP 1I45A 2B4GA 4M6PA 3W1LA 4S1FA 2V30A 4UTTA 2VFDA 5DBTA 3PS7A 1H7RA 3I65A 1VLWA 2C1HA 3LX9A 3IEBA 2VC6A 3W1XA 2YGYA 1T99A 4K6AA 5AOUA 5EKYA 1PIIA 4ML9A 3P84A 4O19A 1IIGA 4CQ8A 2BWGA 3S1XA 1OYAA 3PB0A 4JTEA 3BARA 1I2OA 3KVKA 5HQEA 1HFBA 3CM4A 1SO5A 3OEXA 1KM0A 3W73A 1KLYA 3LCXA 3HQ1A 2EPHA 2Y7GA 2V81A 3W2KA 2D73A 5K4XA 3PBYA 1ME7A 1VS1A 4JS3A 1VC4A 3G1FA 1M7OA 1DHPA 3I7SA 1L6WA 1KBJA 3NQ2A 2WNNA 5FI8A 3BW2A 4AHOA 2CWNA 1LBMA 1R2TA 4MZYA 1SR9A 5F1UA 2GJLA 4LUJA 5EY5A 4LC8A 4RXGA 1FDYA 5CKSA 4JGDA 4UFIA 1EUNA 3WJYA 3STCA 2G95A 3SGZA 1SW0A 3G1DA 3Q58A 4O12A 5D04C 4B5NA 4LTSA 1RR2A 1I2RA 4IPJA 2ATSA 4LV9A 4IX0A 1TSIA 3NR0A 3BG5A 4XTIA 1KFCA 4FXSA 4M6QA 4AF0B 2XN0A 4ZQMA 1P5BA 2ZQ0A 3BLEA 5IBXA 1XKYA 1E51A 3STEA 2CU0A 3NQ7A 3GDRA 4DF0A 4UTLA 1F76A 3INPA 4O4VA 1FBAA 4UTJA 2Z6JA 3NPWA 4CNNA 4ZZ9A 3TNOA 3MBFA 2ZRZA 2QJIA 5FEPA 1L6YA 3NL5A 1ICSA 1TV7A 5DY3A 3IGSA 1PL9A 1QO5A 2J88A 3L0KA 5FESA 2FPYA 4FB7A 1FWSA 3EWZA 4QNWA 3R8RA 1QO2A 4P61A 4HNTA 2WNZA 2YR1A 3OBKA 3IVTA 1RPXA 1B4EA 2FPVA 3HO8A 4IX2A 3GXNA 3KVLA 2GUUA 4DELA 4K38A 4Q4KA 5AHLA 3P81A 1QR7A 4LV4A 4RKAA 4UTKA 2BSLA 2RFGA 3QQ1A 4FNPA 1XM3A 3W87A 3IIZA 2EF9A 1ICPA 1W5NA 3W83A 1P0KA 3S9YA 4NJHA 4O10A 2CLEA 4JIPA 4I7UA 4MY8A 3W23A 2YX0A 3A5VA 1C29A 3E49A 3EWUA 1NFBA 2PRMA 1SO4A 4HNNA 3L67A 5FEXA 4NNBA 4ZMGA 1DOSA 1VPXA 3FOKA 5F2GA 3SI9A 1O95A 5AHEA 4N9CA 4IMCA 5F4SA 1X1OA 3NVTA 3UWVA 1UUOA 3R89A 1PCKA 4WY0A 1LP6A 2J24A 3OHIA 2TYSA 3QEZA 5MHBA 2PCQA 5D32A 3R13A 2HTMA 1Q6QA 2Q8LA 2ZRXA 3MHUA 2FB2A 2KZHA 2ZRYA 1YPFA 3P80A 1QAPA 5EL1A 4O52A 4JYDA 2B0MA 2RH9A 3THQA 4MVAA 4OGZA 3W1QA 5TBOA 1JUBA 5F2MA 5LNRA 1ZAJA 4FX6M 2V0TA 2B7QA 3T7VA 3W2MA 3KVMA 1OFEA 4ZQPA 1GZGA 4E2DA 2H6RA 1OK4A 3G3MA 2CFFA 5DCEA 3C3NA 4Z1BA 5L6UA 2HMCA 5D09A 3TMLA 2J9XA 4EF8A 2E5CA
chains in the Genus database with same CATH superfamily
1BHGA 3VM5A 4GQRA 3PFRA 4ZCWA 2DZWA 4XKYB 3O6YX 3HFTA 1M6JA 4HJFA 5BROA 3P0XA 4R27A 3GIYA 1C7TA 4BA0A 5ABGA 1KNWA 1T40A 3KOZA 3EX4A 1W3KA 4QJ1A 4M6VA 5I24A 2BLEA 3SQMA 2TPSA 1E4MM 1TR9A 3PM6A 1A5MC 2CLFA 4LVBA 1AA1B 1YTDA 3W7IA 3BMXA 4JTSA 1OJXA 3BAXA 1KA9F 4JTAA 5JH1A 3WIJA 4HN4A 3C56A 1PDZA 1JI2A 4W7UA 1KM6A 3L4TA 1R3SA 3OIXA 3KHJA 4FR6A 5AY7A 1YW1A 5GNYA 1CWYA 3PAOA 5D9OA 2XVKA 3WNLA 1GQNA 5C55A 3A4WA 5XIMA 5HMSA 3MJMA 3EA2A 4IMDA 3V16A 4LXFA 1G01A 3MKVA 4KFNA 2I17A 3WBXA 2VX6A 1FWAC 3EMQA 2GVGA 3U4FA 1U83A 1H1NA 3SY8A 4PSPA 3P93A 5REQB 2P0IA 3PUOA 1TVLA 1TJRA 4KIRA 1GOIA 2DIEA 2ZZ7A 4C60A 3CUGA 1W5OA 2PCEA 2CLIA 2VEMA 3AJ7A 4NYUA 3STGA 1NDVA 3RIKA 1XQLA 2Q8ZA 4LBSA 2ISWA 3EYPA 2HROA 5HWMA 1V79A 4IMAA 5J5RA 1JRCA 1V3KA 2VP8A 3G1RA 4MJZA 1NWTA 1TPDA 1DWJM 2ZICA 1L8PA 4FNTA 5EPDA 3NSXA 1T41A 1ZSXA 3A21A 3FXGA 3EWXA 5EA9A 1K9DA 2DW6A 3DYPA 3VMNA 3PBUA 4AEEA 2IKGA 5FEZA 3VCCA 3ZT5A 3OQ8A 3M43A 1D3GA 3DYOA 4FEZA 2X05A 3S1VA 1EX5A 1W17A 3M5XA 5HA7A 4BCEA 1KM1A 1YNYA 3FHAA 3W1UA 4XSMA 4RNJA 1J0KA 3E12A 4FLQA 5CBBA 4J3ZA 4GMEA 2B81A 5HR7A 1T0OA 5DEZA 2BVDA 4N9EA 4S3EA 2GJPA 2HSAA 3TSMA 4RNHA 2XPKA 4AH7A 3HPZA 2V3DA 3STFA 3S5ZA 4HHPA 1FHDA 1I1WA 4QRNA 4MWAC 3HTWA 4Q7IA 3LZ5A 2UV8G 1TG7A 4ZOBA 3GDBA 1PWLA 3TE9A 1JCNA 4OJYA 3DHPA 4BWLC 3GNNA 3TWAA 2YA0A 4BZYA 4YTUA 2WWCA 2YLLA 3L5LA 3GW3A 1NP2A 1R86A 1ISXA 1VIWA 2OWWA 1UKQA 2QUTA 5D4YA 4F8XA 2FH8A 4CCDA 6ALDA 1TIMA 5U4NA 4HNOA 3HG5A 2OZTA 1KR0A 3OG2A 3SAZA 4O53A 2X1RA 4DNMA 4DJEA 5I3DA 1C8YA 3WQFA 2ZA3A 3QKZA 1UR2A 3EEZA 1EKOA 1CPUA 3JS3A 1Q6DA 3NYZA 1D8CA 4Q4OA 2Y7DA 1FH7A 2R91A 3UJEA 3MZ2A 2UWFA 3ABOA 1W0MA 3TLLA 2QAPA 2PBGA 4UQAA 3GIPA 4YTSA 4I5UA 3HB9A 1VYPX 1F05A 4JTDA 1J18A 1EPXA 2E09A 4Q8PA 1Q7QA 4RUBA 3U0HA 1T8XA 2GJNA 4CEUC 1OX4A 3TEVA 4P7NA 3DFSA 5I03A 2XZ9A 2EG6A 3AHVA 1GG1A 2QXWA 3LXBA 1K3UA 4G1NA 4HU0A 4L6DA 1Z69A 1EIXA 3I6RA 4ZBCA 1OC7A 8A3HA 1P48A 1EJ7L 4AZHA 5JXQA 3MP5A 2OR2A 1W56A 1LLZA 4MNMA 3V5FA 2WLZA 1R2SA 1CGTA 5BNKA 1J0ZA 3AROA 4JFVA 4QDMA 3FYPA 1XG3A 2J7CA 3MI6A 4DBDA 1S3HA 1DJIA 2NX9A 1ADOA 1GJUA 2IKIA 2OELA 1G5AA 2C16A 2WCAA 5EFDA 1F8IA 3TAKA 3PZUA 3VI2A 2EO7A 5LXEA 3VYLA 4AVNA 4M19A 4MUZA 3LNPA 1WAUA 1K9EA 3CNYA 2C13A 3S5SA 3OHMB 4MG4A 4WX2A 3BLKA 2Y7FA 3B9EA 4UQBA 3GG7A 1UH4A 4IPLA 1BSIA 2OLHA 4ZB2A 1WZLA 4U33A 4UFMA 1TKKA 2V3EA 3CHCA 2Z1XA 2PWHA 2Y4SA 4BHYA 1XIBA 4AIOA 4OE7A 4MPQA 5ABTA 3RM4A 1E43A 1QNOA 1SFLA 4TU1A 3LS9A 2J77A 4TUFA 1WOAA 5KEZA 2YBVA 4UB9A 4A2RA 3EA1A 3FHQA 3AICA 1OC6A 3ISIX 3AMKA 4ZE4A 1X6NA 4P5UA 3F2DA 4XBSA 2F84A 3IRDA 2BVTA 3CAVA 3IJ9A 5HNRA 1KKRA 3LMZA 3URBA 3LV5A 5E0CA 1JFHA 1YADA 3NM3A 5A2CA 3IJ7A 1EL3A 1R9XA 2OO6A 2ZVRA 1KQYA 4LH8A 1RQEA 2Z1BA 3W2JA 4WOZA 3VIMA 2GDQA 1E6XM 4KKXA 1WNOA 1ADSA 1XBVA 1VYRA 5KSWA 1UR9A 1Y8BA 1SZGA 4H6QA 3WEMA 2YLAA 3WDJA 2E1WA 4MIMA 1AMYA 3B0UX 3AS3A 3CYVA 3T40A 4MWAA 3PBMA 1MW2A 4Q4RA 4ERGA 1E55A 3WJZA 4CLMA 3DEQA 3M0MA 3S2CA 4PA8A 3S46A 4BWLA 2O9TA 3HV8A 4XQ6A 1K4HA 4H9UA 5AZ1A 4C6FA 2WXDM 1R3TA 2D0GA 2OYKA 1TTPA 4F0HA 5M5DA 3Q37A 4EPDC 4LS1A 1YBQB 4V27A 5HJYA 3AMDA 2QPXA 1BXNA 3EX2A 1OD0A 1RLCL 1W1ZA 2CNCA 1EO5A 3KTXA 3QPEA 4GUHA 5BRQA 1JPHA 1FFRA 5E1QA 3UR5A 2HCVA 5IFPA 5M03A 3GTHA 4JHOA 3H22A 1UQZA 4H3DA 3LHUA 4D8LA 1Q2RA 3NPUA 1VQTA 1PHQA 4Q7BA 3WQOA 1KXHA 4Y9NA 2BZNA 1ZP4A 3B8DA 3W2UA 1ITCA 4UFKA 2Y85A 1ZU8A 1CGYA 2GDVA 3RDKA 2JBMA 1S46A 4D6FA 5AC7A 2QJJA 4GO8A 5DN1A 2W6RA 4NAEB 3ZXWA 4QR6A 3COTA 4W7VA 3W7QA 1GZJA 2F38A 1RSCA 2VR2A 1YDYA 3C86A 3UG5A 1W31A 1ME8A 3QR1A 1MUCA 3QPZA 3MO7A 1TQXA 3L4XA 2BODX 4MY9A 3T78A 1B2YA 1VRXA 8CGTA 2QW5A 2GSEA 4M24A 4RE0A 3MMTA 2GFTA 4HD5A 4NYYA 1CXFA 3RPTA 1EJSC 3CUHA 3AHZA 3M0JA 4O50A 3A12A 3M9YA 4O54A 3SJNA 3O7UA 4HU3A 2E9LA 3HJZA 3LB0A 2FB3A 3MWCA 3B4UA 4ML4A 1OB0A 2JF7A 3W1RA 2DZVA 4Q4SA 3JR2A 3W7PA 2WVTA 3EBVA 2O9RA 1BF2A 5HQMA 3TW9A 4PGLA 1DJNA 4RE2A 8TIMA 3PZ9A 1DJWA 2CERA 1UKTA 4IWWA 5FJOA 2GOUA 4I8YA 3TQKA 5H8MA 4CCZA 1YDVA 2FGZA 3RGTA 1U1JA 5LIWX 3N18A 1C9WA 3W6YA 3A24A 3H21A 1K8ZA 2C0AA 1I4NA 3W6MA 2E9MA 4QCFA 3M5ZA 4BFAA 3GYEA 4B5WA 1NF0A 1E1EA 2GOKA 1JF5A 4FOJA 2TAAA 1XW8A 3UG8A 2QV4A 2X0YA 4EAYA 1RCQA 4GYPC 4FOUA 4Q8MA 5DELA 3SUTA 4D6HA 2F2HA 2QNEA 3LD5A 4XD4A 2WM1A 1BVWA 3CYJA 1SSGA 1XX1A 5KMYA 1VR6A 4GJ1A 3T6CA 1WZKA 2VCBA 4DBEA 2ZADA 1TREA 1XGDA 4QCEA 1JAKA 3T55A 1E0WA 1XIIA 3UA4A 2E6DA 3WLIA 3AUOA 1OGBA 3NO1A 4NY2A 3APYA 3M16A 2PURA 4QLLA 1BXBA 4G8TA 4AHPA 4NJJA 2FZ9A 4NQ1A 1Z6KA 3N17A 3VDCA 4XZIA 4IIBA 1CENA 2XVPA 5EMJA 5AKQA 1U2YA 1FTXA 4WOQA 3L7RA 5H8UA 5I3FA 4GGHA 2PI6A 3G1AA 4GHRA 1EDGA 1BQCA 2C18A 1ZGDA 1OCJA 3W74A 3LM7A 3N11A 3PP7A 2AMXA 4HZ8A 3SN0A 1PZ3A 4F0KA 1O1ZA 1F3WA 3DKLA 4AZCB 3BL3A 3VKJA 4KMQA 3NTYA 2QCDB 4C5YA 3B06A 3CL6A 3WFZA 4MHBA 1RD5A 1AD1A 1Z44A 5D2VA 4LOCA 4AWEA 3FJ6A 3R0KA 2ZUTA 4XV0A 2C14A 1H60A 1MFVA 1A47A 3T2OA 1K7XA 4PRWA 2XH2A 1US2A 2CZEA 2P0OA 5DANA 1PZ0A 1X98A 1F7BA 2WZTA 5AN7A 1VPQA 1G4SA 4W8AA 1QASA 3G0XA 3ZZ1A 1K8XA 3T2QA 3TUUA 2Y89A 1NM9A 3TFXA 5D37A 3ATYA 1XIGA 1DIOA 2OQYA 1QK2A 1QHPA 1XISA 2QCEA 1R30A 4GH3A 5KZDA 4HMDA 1HKWA 5I79A 3G1XA 2Z27A 3EEGA 1SZFA 4UR8A 4XVEA 2H3BA 4S3DA 4Q8UA 1EOMA 4XAPA 3S5NA 3UBPC 1JYVA 4S3BA 2HK0A 3VNYA 4NF7A 1A49A 3WO8A 3LRKA 3VD5A 2D2GA 3PJWA 4NX0A 3CGTA 3OBEA 1IT0A 2GDUA 2FDMA 4LF1A 2XH7A 1OGGA 1TMHA 3RCMA 3CQKA 4QLJA 5E0KA 2NV9A 2IPJA 1HKIA 4UZSA 1MQQA 2VD9A 3EX3A 1N2VA 4C91A 3SB0A 3CPGA 4D6IA 1SGJA 4GXWA 4QSHA 1M5WA 2RUSA 5FF4A 2VZVA 3MS8A 2AGKA 3XIMA 3JU2A 1XPYA 4Q8WA 2PU1A 1ZS2A 4J2PA 4JTQA 2FFIA 4GY7A 3LPOA 4C6NA 4PBGA 1IZKA 1ESWA 3KRUA 4ACYA 1GOMA 2J78A 1KRBC 1CB7B 1TZ7A 3G0SA 4DF1A 3PY2A 4US5D 4EX4A 3TOPA 5IOBA 5D2YA 1H50A 3A64A 1JVNA 3VGGA 2Y0FA 3EDFA 3G2GA 4FOKA 1X8FA 4K36A 1D3CA 4GY0A 3L21A 1Y7VA 3ZWTA 2ACRA 2E6AA 3LPFA 3WQ6A 2ZTJA 1GNXA 1YE6A 1EEPA 4ADSA 2BTMA 2QIIA 5HULA 2MUCA 4H01A 3TFCA 3FA3A 2DU2A 1X1ZA 1AJ0A 4GYPA 3LCIA 1S39A 3HBLA 3CV2A 3P67A 2CZVA 8RUCA 5F4WA 3SUWA 3AMCA 2BY2A 4J7RA 4A22A 4HOWA 5A3HA 1EQPA 3I3EA 4Q6JA 3LCWA 4AAJA 1NAL1 1OFRA 3GAKA 2CHOA 3SSJA 4Z42C 1A5OC 2D2OA 3N9SA 2JK2A 4L9XA 2BP1A 3NEVA 4L4MA 3BV4A 3CTTA 4RK8A 2EPLX 3B0YA 2JIEA 2YL6A 3I4EA 1UR0A 1G1YA 4PTNA 3M0IA 3EPOA 4FP1A 1JYNA 1ZAIA 2GK1B 3UPBA 4E4PA 1GEHA 4G7EB 3RO6A 3CLWA 1GPWA 4W5UA 1UMLA 2J6XA 3VVGA 4M7SA 3ZVHA 1I6NA 4KEUA 1B3VA 1KTBA 2WVVB 3HM7A 3B05A 5G4EA 5G2IA 3DUGA 1E6ZA 2Y6ZA 3E0WA 4QAWA 4CQCA 5EFFA 1XH1A 3WUGA 1UR8A 3CT7A 3RRXA 2JKEA 2ASHA 1QDSA 1KCLA 3PJUA 2W0UA 3URAA 3GZ3A 3NDOA 4NG3A 1DHKA 4UNKA 2J7HA 4CKQA 3BH4A 4AWSA 1EXBA 1S38A 4KIEA 5I77A 3W84A 1FHUA 1KFBA 5CAKA 3RLUA 3GTFA 4IGMA 3TTEA 3F4CA 2XVGA 1YKWA 4GRSA 2R14A 3GB6A 1Q6CA 4LANA 3CBWA 3W38A 4ZOAA 4UTHA 1AW5A 1LRNA 4K2SA 3VABA 2X7VA 1XG4A 4PBEA 3PSVA 1AH0A 2IQTA 1F3EA 1E9YB 4EACA 4JKLA 2GJXB 2XGZA 3WQGA 3RPMA 3I68A 3RNDA 2CZDA 2IPGA 4S3AA 4GINA 1BEUA 2INEA 2NSXA 5I3GA 3WH9A 4S3FA 4P8VA 3V1PA 3WK2A 5GNZA 4C1KA 4HYWA 2OJPA 3K4AA 1ZJIA 2VD8A 1PTDA 2RDUA 5C70A 3GDTA 3H2OA 4JR5A 3ONCA 4WEVX 2ZC8A 4DBSA 2DVUA 1WDQA 3B03A 5K4ZA 4PZVA 3MSGA 4XISA 3EX6A 2OEMA 3UESA 5J04A 3Q2DA 2VQUA 1NFPA 4CCCA 1J96A 3PJXA 4DRSA 4K3ZA 4LX4A 3AZTA 1ISVA 1KBKA 3NGFA 1CIUA 3VE7A 4QBXA 1G4EA 3NVDA 3OJGA 5H6HA 2WMKA 4Q8QA 2DJXA 4M6UA 2QUMA 3UNTA 4UCGA 3MCMA 1A5SA 5FCZA 4EE9A 1W9DM 4H1ZA 1E3XA 3GR8A 4IQLA 1J0IA 4GUFA 1ECQA 2AMGA 2PDPA 1HKKA 3QMSA 1QNQA 3NQDA 2I9EA 2YOCA 4BI7A 2J6VA 3VNKA 4PCNA 5FSDC 1GJPA 4A8NA 1YXDA 2NQZA 1DKWA 2ZZ4A 4YLWA 3URQA 1CI1A 2FMNA 3W85A 2ZXAA 3SJ3A 1BQGA 2CHNA 1G6CA 4JTLA 3OIHA 1V0KA 4IISA 1JULA 3BQ5A 4QP0A 3H6OA 1WX0A 1R7AA 1FP9A 1BWLA 2IPFA 5A2AA 3B8UA 5A69A 3L65A 3S3GA 1EJUC 3QLLA 3ZQ9A 2WVUA 4BJHA 1PTAA 3EA3A 3MUIA 5I3KA 1P0DA 2NVAA 4DF2A 3H12A 3E74A 3BLPX 3DFQA 3FEMA 4JEQA 4X0NA 1HKMA 3TA6A 2XINA 1UH2A 4XWUA 2HK1A 3M6DA 3CUXA 4HNUA 1I8JA 1S5WA 3ATZA 3VNDA 5E5CA 1JG9A 2XU2A 3O0FA 2CXEA 4MYAA 1LBFA 4WUIA 1KQZA 3SURA 2BHUA 1UQYA 3KDNA 2WC3A 5MKGA 3VX1A 3T4WA 1HJQA 3QSTA 5AECA 4O4WA 3TH6A 4IP7A 3FA5A 4EOUA 1D2KA 2E5BA 4F2BA 1C91A 3T2PA 1D9EA 1L0PA 2GUBA 3B8WA 4OUIA 3MUAA 5F1VA 3FSTA 1P6WA 4AD5A 2X1TA 3QF0A 3WJXA 4CD5A 1XS2A 1RZMA 3SCTA 1PX8A 3T44A 2H8ZA 1XF0A 4PE8A 5E6YA 1XFBA 4B3KA 2P10A 5H8PA 4WJEA 3VE9A 1KBIA 6XIMA 4KEZA 1ML1A 3CPUA 3CZGA 1VYSX 4JCLA 4MTVA 5E93A 2CETA 1Q6FA 5D2XA 1V3IA 2ZVIA 1E5JA 1XC6A 1M04A 1LJYA 4DN1A 1WDDA 3THAA 4UOJA 1XH0A 1HVQA 1JQXA 3S5OA 3UPWA 2YW4A 4LS2A 1HO1A 2JEQA 1KRAC 2VRQA 3LYEA 3SCNA 3OOQA 2W5FA 2CHRA 2VX4A 5HWJA 3LCFA 1C93A 1UP2A 2PP1A 3AYSA 2FHFA 1OZQA 1DIDA 4D6GA 4H00A 4Y7EA 2WNQA 4LYPA 1JFXA 4QAIA 4GVHA 1G4PA 2INZA 2NUXA 3UT0A 3TAOA 1QOXA 3UFYA 1XP3A 3MANA 3M0ZA 3EWYA 2VWTA 2QULA 3M0KA 1LRTA 1KM5A 3LHVA 3GHRA 1OYBA 4FLRA 1E3ZA 2DQWA 4J35A 1LZOA 3KCOA 2Z28A 1SFSA 1TV5A 2BXZA 4JYFA 5EBUA 3UZYA 3KRZA 1XCXA 3LCGA 2L5HA 4Q6XA 4IFKB 1HJXA 1MEIA 5DMNA 2JGQA 4QDPA 2XGBA 4M1BA 2PDGA 3UR8A 5D03A 3SCRA 3NQVA 2P8CA 2FVKA 1P1XA 4LAMA 4FIQA 4YHGA 1BG9A 4NXSA 2J8TA 4IHCA 3GIQA 4G9PA 5CZTA 4MY1A 2Z26A 3VA8A 4CQAA 1JZ7A 3W7MA 1XBZA 4JFSA 4N4QA 3REQA 3IUHA 3D5HA 3ARXA 2YCIX 3QHOA 2HBXA 4AWTA 3N34A 4JXCA 3E0FA 4O1FA 2W62A 3AIBA 3CLMA 3E0IA 5I2UA 2C6QA 4XUYA 1LUCB 3IGXA 1CLXA 2HEJA 5DCDA 3WK1A 3AYTA 4GI6A 3GTIA 4Y8EA 2PRHA 4Q32A 5M17A 3R25A 2XN1A 2A21A 1SW3A 5BXSA 3R0DA 4FI4A 1CT5A 9XIAA 4GKLA 2PLKA 3UJSA 2DT2A 4PYSA 5DY2A 2ONEA 4CEXC 1M1BA 4YTRA 3TN4A 2EQDA 1IE7C 1FDJA 3I10A 1A0CA 2CESA 3BLIA 1JPIA 4R9OA 1XLAA 3N73A 3UZ5A 4CU8A 2PLMA 2ZZ1A 4EXQA 2EG7A 3PWAA 5FAGA 1LOLA 2Z2BA 3PUGA 2ANUA 1KV8A 1P7TA 2BY0A 4X2PA 3BAKA 2DPEA 1QTWA 1XR2A 3UEQA 4FMVA 1R3RA 1X6LA 1EP2A 2VDHA 3S47A 3T4CA 1MW3A 2CKRA 1LTDA 4URIA 1UB3A 5KTLA 1R46A 1K8CA 3D47A 1B3WA 2YDAA 2BMBA 2O4QA 3BGAA 5E09A 1L8NA 3M4HA 4Z08A 4GFSA 1BRLA 3KTSA 1XLKA 3GW0A 1JNDA 3IJ6A 4M6PA 4KQNA 4QHRA 3W1LA 4DAFA 2V30A 3M0LA 5I02A 1J93A 5DBTA 3I65A 2C1HA 3LX9A 3T08A 1QUMA 1SMDA 4LUTA 1UUQA 4ILSA 5FA5A 3NURA 4H41A 1H2JA 3PZGA 1IIGA 4CQ8A 2IKHA 3T07A 3S1XA 1IR1A 3T0DA 3KVKA 1GHRA 3LN3A 3CM4A 1SO5A 1KM0A 3LCXA 2EPHA 4B5VA 3IJIA 1ECEA 1F8MA 2V81A 1G9HA 2D73A 1H09A 1HL9A 1RPKA 5RUBA 1ME7A 1VS1A 3S9ZA 4JS3A 2W27A 1KCKA 2DDXA 1XRTA 4B5XA 1L6WA 3NQ2A 2WNNA 5FI8A 4TX8A 4AHOA 2C79A 1LBMA 2CWNA 4LUJA 4JGDA 2GZXA 9CGTA 3E0VA 3APTA 1SW0A 4GZJA 1MNSA 6REQA 2YIHA 5D04C 4B5NA 4LTSA 4IPJA 3ECQA 4LV9A 4PTWA 1ZBWA 3GUWA 1DJYA 1EPVA 4M6QA 4AF0B 2XN0A 4ZQMA 4WSKA 1E1CB 2XIQA 3KOYA 3T1GA 1E5NA 1I1XA 1GJWA 3MUCA 4DF0A 4IGSA 4ZXOA 4O4VA 3ANUA 5DMLA 4YN5A 3V1HA 3U9IA 5LXXA 4EAMA 1SZRA 1PPIA 1CXLA 3N2TA 4PUDA 1L6GA 3TNOA 2QJIA 4OOZA 2QPSA 2XH4A 1TV7A 2X40A 4ZODA 2PDUA 4H9MA 5DY3A 4QQUA 1QO5A 2J88A 3L0KA 4FB7A 4QDWA 1XRFA 4C1NB 3EWZA 4HNTA 3OBKA 3M7SA 2PP0A 1RPXA 3IVTA 3HO8A 3WL0A 1JZ3A 4KWSA 4Q4KA 5AHLA 1XLFA 1EHNA 3UG4A 4UTKA 2DW7A 4ERAA 2PUZA 4PTXA 3QQ1A 4C7DA 3W87A 3PTDA 3GXDA 3IIZA 4H8HA 1F9CA 1W5NA 4GFIA 2RAGA 1DP0A 3R7MA 2P3ZA 3WNNA 3KWXA 1YPXA 5HNTA 4ZSTA 2XTKA 3UGVA 3WBYA 2J79A 3MKKA 4HK5A 3WDHA 2PF8A 2J7FA 3E49A 1NFBA 3GG8A 3SUVA 4CD4A 3SI9A 7PTDA 4C90A 4N9CA 1B30A 4L6HA 3EKGA 1UUOA 3R89A 1ODZA 3SN4A 1LP6A 2J24A 3AWNA 3ES8A 2BS9A 2PCQA 3R13A 1Q6QA 3AXXA 4KS0A 4O1EA 4D6JA 1W3JA 3WNPA 1FWFC 3CHFA 4DJFC 3W1QA 1ZAJA 2B7QA 3VNJA 3KVMA 1GOQA 3MB9A 4AD4A 1N8WA 4Z1BA 2HMCA 5ECUA 2XFFA 4EF8A 2E5CA 1KV5A 2PP3A 4LY4A 2J25A 3S1WA 4HPGA 4L5ZA 4RZ6A 3WMBA 2O56A 3KLKA 3W86A 3CO4A 3UWQA 4MGGA 1FUYA 3O8AA 1TYGA 3DAQA 2BY1A 3WK3A 1QK0A 2P8BA 4GZIA 4NI8A 4DZ5A 3WH6A 3KL5A 4R5EA 1OG6A 1CBGA 2I57A 1AJZA 2WYSA 4HZMA 4Z0JA 3R79A 4BQ2A 3EWDA 5L9FA 5A8GA 3GVQA 1H62A 1P1MA 1UPMB 4D8ZA 2Z0IA 4ADUA 4PH6A 7TAAA 1RK6A 5DO8A 4GVIA 4FX8A 3LBCA 2OKTA 1TJ0A 1PWMA 3FX4A 3PPGA 3KW3A 3IJ8A 4E4UA 3U5UA 4ALDA 3U6WA 3H8AA 1HF6A 4FNUA 1VPYA 4S3CA 1A0EA 5FSEC 2PD5A 4O14A 3RU6A 2ACQA 4WF7A 1DL3A 3NIYA 3LI0A 4N42A 1X7IA 2DEPA 2WBGA 3KDOA 2A0NA 1UKPA 2VZOA 4HIBA 1V7YA 4NJGA 3F2CA 2CZFA 3FKRA 2CLMA 4POCA 1EGVA 3CAQA 4RCXA 2EG8A 1K6AA 2WMHA 3ITVA 3LRLA 1TV8A 3CB8A 2NX1A 3VNIA 1XXXA 1FHLA 1IEQA 2WZHA 1EC8A 4PUWA 2X1SA 1I2NA 3S9IA 1L6FA 2HBVA 4QJ5B 1UA3A 4F0MA 3GKAA 3WD0A 4LAZA 1DBTA 1SSDA 1VFTA 1DXFA 4BKNA 3NFUA 2OG9A 3AI0A 3ES7A 5KZ6A 3BUVA 3QGKC 7REQA 5LA0A 1ISWA 3RUBL 3TSBA 1J2BA 4LAUA 3SRFA 1K03A 4LW7A 1LG2A 4YXGA 5LSMA 3ZT6A 4ENLA 4AUBA 3DI0A 3GQYA 2PGRA 3DG6A 2QDGA 1TO3A 4HHLA 5T8GA 1SR0A 5CJMA 2AKMA 2B31A 2GQ8A 2Z7KA 1DPMA 2A6NA 2HE5A 3HMJG 4MWAE 4IGNA 1Q8AA 1WKEA 3RK8A 1RA5A 4E6MA 1H1ZA 3FKKA 3TW7A 2VEPA 1B57A 1EA0A 2OYLA 4J3UA 2WJEA 1JXJA 2A79A 4LUSB 4XKYA 5D30A 2PODA 1BKHA 1JZ4A 4OTKA 2OMAA 1S5MA 4JKKA 4X63A 1QWKA 4GZ7A 3QTPA 2GGGA 2VOMA 5JMUA 1YTKA 2WKJA 3DI1A 1JZ2A 3GO2A 2AOSA 2O9OA 1VRDA 4FHAA 4DYJA 2VFGA 3OQEA 3OU8A 4DO7A 2IKJA 1YTEA 3N2MA 4LJ3A 1GYNA 2TRSA 3ANYA 1UBPC 1YDOA 3QTGA 4M82A 4BQ3A 4DWSD 4V15A 4DJFA 4LRSA 4CQDA 4MNKA 4JTCA 1GKQA 3AJXA 5BMWA 4GY1A 4NSBA 5G1MA 3V18A 3GFYA 3W24A 2R8WA 1QRQA 1H1YA 2QCCA 3O07A 3PAJA 3HGRA 2YYUA 3PHAA 1GGOA 2WMJA 3KZPA 1W9PA 3AYVA 4YL2A 3NL6A 3VIIA 4GYJA 1ENUA 5REQA 1UWQA 1PIFA 5LA1A 3IJQA 3TW6A 2Y63A 2IXVA 3VGDA 3DG3A 3CB3A 3G6MA 1MQRA 2Q3RA 3LG3A 3IIPA 3P62A 5E9XA 4L6OA 3K2GA 5CPQA 1EC9A 4WCJA 1UCWA 4IFOA 1TCMA 3T9PA 2EKCA 2E68A 1VJZA 1R47A 2HS8A 3HA1A 4JTRA 2WBKA 3F7JA 4JAWA 4P7LA 3O15A 1H0GA 5CPSA 1BG4A 1UIPA 2ISSA 3WJWA 3W6LA 3W1TA 1F6PA 4A21A 1N82A 3FFSA 1ZCOA 3E9AA 3AZSA 2FIQA 1IIHA 5GJMA 3GBEA 2WZMA 2QMKA 4E8CA 1VCVA 3H24A 4LCRA 1UD4A 4NI3A 3LTSA 4FF7A 3BQ6A 4QX4A 2WSYA 4D72A 1VH7A 5G1TA 1B3ZA 3DIPA 4DIAA 4KFPA 1Q63A 1J6PA 2YZRA 3V0SA 4LFYA 2PDYA 3W71A 3LHYA 1DQXA 5D9NA 3G77A 3U2CA 4B4HA 3CEPA 1EHAA 3B8IA 4AVFA 2J13A 3EDKA 4HGXA 2Z29A 3EOLA 3ERPA 4LEFA 1XLDA 3VCRA 4HQVA 1W3IA 1JZ6A 1KGWA 1V02A 4XTDA 3L2MA 1OY0A 4PBFA 1Q8JA 3VZXA 3R58A 3GRIA 1UC4A 3R2GA 2VC9A 4JQ3A 4MNJA 2WSKA 4W93A 1FWGC 4GC4A 2GYIA 2GVYA 5A6TC 4M7TA 4M0XA 2XSXA 5BYWA 1NP0A 2R82A 4NZ1A 3NQEA 2CZ5A 1DWGM 5A8NA 1E72M 3SCVA 4TOQA 4HCDA 2O0TA 3RRAA 2GQAA 4MDOA 1TUFA 3RO8A 3B97A 3CPRA 3AUJA 5E6ZA 3TROA 1VIZA 2ISDA 5AYZA 1FA2A 1F73A 5CLTA 1J9YA 4DYEA 3PK7A 3MJYA 2A4AA 3VGFA 2BHYA 5C54A 1AUSL 5I3HA 3BOFA 2DH3A 5C6MA 1HZYA 3SN1A 4Z2GA 4M29A 2BDQA 4C7FA 3CASA 4A3RA 3FW6A 2VYOA 1RXOB 4WXYA 1UWRA 1QI2A 2IW0A 2HE8A 2V69A 1UZDA 4ZXLA 1UD5A 3UWUA 1LDCA 1EJWC 4QJ4B 1Q7ZA 1AODA 1ZNNA 3BSHA 3G1SA 2PDJA 2OSWA 1O5QA 1UBSA 1OZMA 2EJAA 4I9JA 4ROPA 4FX7A 5AZ0A 6XIAA 1EP3A 3E6EA 3DFYA 3OB8A 2HDJA 2GJRA 1W8SA 3WLJA 2VOTA 3BO9A 1NTHA 1AW1A 2A1YA 2WSQA 5CH9A 6TAAA 1J6OA 3H23A 2DZUA 1SQ7A 1UIOA 1BKSA 1QVBA 3QW3A 1ZCCA 1B9BA 4NIRA 1X6UA 4ERIA 4ICCX 1OVDA 5ENLA 4LRTA 1IWPA 2WPGA 1W1YA 1RVKA 1BLIA 3GXIA 1S2AA 3L68A 4N9BA 2CITA 2RDXA 2PDHA 3OZMA 3BVJA 3CUZA 3CV7A 1IWBA 3WNOA 2E5DA 4LF2A 1IT7A 3NXLA 5BRBA 3U2ZA 3LA4A 1PYMA 1QPOA 3LU2A 1Y5WA 3HPAA 5ABFB 4MKSA 3QGAC 3GC2A 4QEEA 4P7QA 2PWUA 3IK2A 5BZAA 1UOZA 2E8YA 5LNSA 4MPKA 3W1PA 7CGTA 1VKFA 1Y65A 3C0SA 4DJED 3LERA 7ENLA 4PB5A 3UCQA 3F03K 3MZNA 3MTWA 1YHTA 3O0KA 2X1UA 3V4BA 4JTHA 4OHQA 5C7HA 3CUJA 3MWAA 4GYKA 5JIWA 2YPIA 3GUGA 1EZ2A 2F6KA 1W2VA 4YVVA 1EBGA 1LOSA 1TV3A 2CCRA 4J3TA 1XDMA 1GKPA 2A7NA 2VC5A 3DDMA 3WLRA 3RM9A 4REQA 2WZEA 3RXZA 2NT0A 2XDFA 2QLYA 3G24A 1O4UA 1S5NA 4C7GA 1CXIA 3PPHA 2YCLB 3N9KA 2VM8A 3KX6A 4P7OA 4X22A 3UA3A 1ONRA 1GG0A 1OQFA 5IRPA 3FN9A 3G18A 2VFEA 2PWFA 3F4NA 4S3GA 5FF3A 3A9IA 1HIZA 3CHDA 3KAOA 3QRHA 1BVNP 4C6JA 3AC0A 3WCZA 3W7RA 3GVWA 4AEOA 3F5JA 1S3TC 9XIMA 3NOEA 4XD6A 1UZ1A 1YBQA 1HL2A 2ZTKA 1WB0A 1FWTA 3K8MA 3LMYA 1Q5MA 2XISA 3O6AA 4OIFA 1VGAA 3VCNA 2EGZA 3WNKA 2WB5A 2WQPA 1TTQA 2XN2A 4XO7A 3U2EA 4UMBA 1B9ZA 4K1WA 4HA4A 3EMZA 4XAZA 1RCOB 2X0SA 3KRBA 3UXLA 4EPEC 3GYCA 1EO7A 1EXPA 3DFTA 4P8WA 3KP0A 2VELA 5CEWA 1XBYA 1Q6OA 3VDGA 3F4WA 2GSHA 3DZ1A 5C9XA 4MB5A 4C5ZA 6ENLA 1XYFA 5DLCA 4O1DA 1Q6RA 3CZKA 1OT2A 4NAEA 2X30A 4CVUA 2YDQA 3TLQA 1HL8A 3SCSA 4AFYA 2RGMA 1TPH1 3L0GA 3AS0A 1VEMA 1JL8A 1VF8A 3LLXA 4FS9A 5TF0A 1OIMA 2EHHA 2V82A 3QYQA 6CGTA 3CQ0A 3G8EA 4ZB5A 1Z42A 4EP8C 1OT1A 4N0RA 4OKDA 1LF1A 4IQJA 5H2ZA 3GTXA 4Q4PA 3IAPA 1FWRA 4AB4A 1H61A 4Y96A 5AC6A 1M65A 3OPSA 2X8RA 2YA1A 1S5VA 4BI5A 1H51A 1WYIA 1SJDA 2UY4A 4MWAD 2TODA 5BWAA 2F61A 2W61A 3TV8A 1XYAA 1W5MA 4O57A 4KW2A 3C52A 4S2CA 2QF8A 1EUAA 2WMIB 4JIEA 3QQWA 4R3UA 3VU2A 2ZUWA 1X97A 2GGHA 4K37A 1VBGA 4AWUA 4J2MA 2DZPA 3OA3A 4XO6A 1SZNA 5CC5A 4MYXA 4C1LA 4GQQA 2BX7A 3N19B 3M0VA 3SM0A 3UG3A 3GXTA 1NVMA 4JHZA 3O3RA 2QUNA 1QW9A 2WCSA 2NWRA 3UXKA 4HSOA 1JI1A 5FACA 1GPFA 1PBGA 1GZ1A 2ZE0A 1R3VA 3IVSA 4H4IA 4WDUA 1EOKA 3N2BA 3Q4DA 4HB7A 2OSXA 3PWGA 3ZR6A 1XIJA 5A8MA 2OPJA 2W3ZA 2ZX9A 4JCMA 4GLEA 3I6EA 1VBHA 3WD2A 1REQB 3AIUA 5E9AA 3QV6A 4PFHA 4BI6A 3VMOA 4DWDA 5A8OA 4JQ4A 3RPDA 1GEQA 4XD5A 2QS8A 3TU9A 2I5IA 2OQHA 1BYDA 3RLVA 5FD0A 2W92A 4US6A 2Q71A 1MEWA 1ISYA 2X2YA 3AMGA 4KGLA 3P82A 1EF2A 1SJCA 1PXGA 4ZQOA 1N7KA 3CWNA 1RUSA 2XIJA 4B16A 2F6UA 3W9ZA 4I3GA 1DTNA 4M5PA 1IHIA 4DQWA 2PWVA 1OGSA 4AZCA 2ZRUA 1EWEA 4QQ3A 3NL3A 3ABSA 2A3HA 1WUEA 2QCDA 5CSRA 3APGA 1M03A 1PV8A 2V9DA 4MB4A 5EMLA 4XK2A 4C6LA 2D3LA 4IZGA 4JQAA 1CDGA 1RBAA 4C6KA 5DT5A 3GXMA 1HG3A 4RV3A 4GI4A 3UZXA 4F0RA 4L1GA 4IIGA 2Z6IA 2WM0A 1US3A 2BGQA 6PTDA 5A8PA 2OWCA 2WSPA 1FWNA 5AYYA 3VILA 1IEWA 2QR6A 1MI3A 4JTJA 4DM2A 3W37A 4HPNA 5A2BA 3HQOA 4JTUA 1OG0A 1OFDA 2Y5EA 3SRDA 1V3HA 3KBMA 2FMOA 1YNPA 2JALA 3GTNA 2VWSA 4PUMA 4DPPA 3CUIA 2FZDA 2ZZ5A 1RA0A 1NOUA 1IQ8A 2GVJA 3UY7A 4V28A 3A3XA 3MW7A 1Q65A 4QIUA 3ZYZA 3WG6A 2FDSA 1NDYA 2RKXA 4Y9OA 2RDWA 4PMRA 3ZS4A 5AC5A 4WGHA 1OX5A 1NWRA 4R85A 1XCWA 1OWQA 4H9TA 1EJTC 2Y8VA 3CAKA 3AZRA 4QITA 4LNYA 2JQXA 3DHUA 2E6FA 3GU1A 3DKJA 3AU6A 2BOEX 3MV01 4GWEA 5HXMA 4Z1YA 3B9AA 5BOOA 3VGEA 3SCUA 5A5WA 5FJJA 3MSRA 3QHNA 2C7FA 2Y61A 2PWEA 1W1TA 5J5DA 4PC8A 4AXNA 1Q2SA 2DT3A 5FJRA 2ZCGA 1H49A 1NOWA 4FNRA 2EKGA 1JCJA 1DQUA 2Y1HA 5FJIA 2FPTA 3IRSA 1J11A 3E5BA 4RLIA 4R9XA 2VQTA 4FPSA 2YDRA 1TRDA 3OGSA 4DX3A 3OLDA 3E2RA 3MP4A 3DOPA 4LCQA 1RQHA 3IJDA 1JUKA 2ZX8A 2H90A 3IAQA 1WXYA 2NSOA 4NAFA 3V7PA 1TE1A 2D69A 3BLFA 1KGXA 4HSHA 4JFWA 1FWDC 1XPGA 3H55A 1AD4A 3IPWA 3N2XA 3C2RA 5HUPA 1O94A 3O2LA 4PTDA 3WKZA 3QMRA 4LYQA 1C90A 4DI8A 2ZXDA 4PUUA 3ZLFA 2GK1A 4G7EA 3NO3A 2WCGA 3SQSA 3K30A 3PTKA 5A95A 1XLHA 1RHCA 3B9DA 2WVVA 1V5XA 2HVOA 2VGFA 1TX2A 1QBBA 3RJYA 1IXPA 3R11A 3VIHA 2Y7EA 1MVYA 4BF5A 1AW2A 4A3QA 1XIMA 1JQVA 3DFNA 3B8VA 4L4OA 2ZA1A 3ZJ7A 2VXNA 4O17A 1HUVA 1KFEA 4ZB0A 3R43A 4D1IA 4GXMA 4WZHA 3LSBA 1OF6A 5D8ZA 3GS6A 4IIDA 1GVIA 5CSUA 3AHXA 3G5EA 2ZXQA 4HVXA 2PBOA 3EOEA 3ABQA 2VZTA 1AL7A 3VDBA 3SCQA 2PWGA 7TIMA 3CTLA 3PR2A 1QMLA 1GQJA 4N7QA 4KCUA 2GJXA 4QXIA 2HWGA 1XIHA 4LGXA 4A8LA 3KP1A 1CGXA 5A94A 4AZ7A 1H0IA 1V0NA 2X2GA 3NZ1A 3WLOA 1IR2A 3KS6A 2P76A 1I0BA 4WSJA 4YWSA 4K1GA 1UC5A 2A7PA 2PEVA 2NVCA 3CIVA 1ZZMA 4PL2A 2WW5A 4DYKA 1F4HA 2VR4A 1GOKA 3K5XA 1ZTVA 1LROA 1WCGA 5F7UA 1XBXA 3UWWA 2CLKA 1H7WA 4RV8A 3CH9A 2XVLA 4L56A 4UWMA 4S3KA 3GXPA 4ZSUA 3BGGA 2PLJA 4FALA 1DIEA 3VOJA 3QFEA 2WJZA 1YIXA 3W07A 1XH2A 2VUYA 5CSYA 4BF9A 3CZLA 2DSUA 2A7RA 1LYXA 5C2XA 3QVQA 3MI3A 1XD1A 2PD9A 2Q09A 1HVXA 3VPLA 2XGIA 3EMCA 4IL0A 3D6NA 2NXGA 3IGHX 4UTIA 3W7DA 5LYRA 3UQNA 2QJHA 4IJBA 3OG3A 5I3JA 1WXJA 1JUEA 3QOKA 1EDQA 2V3GA 4V1XA 1ME9A 1O1HA 5HMFA 2GQ3A 2J62A 1JZ5A 4M8UA 4U10A 3M5VA 2DT0A 4LBUA 4IG2B 1SO3A 2QV5A 4ZENA 2PC8A 3IARA 1I2PA 1D7FA 3MI2A 2VRKA 1UG6A 4LYKA 2HXUA 2PTXA 4Q8NA 1ZAHA 2QGHA 3AU2A 2PDKA 3HU7A 3Q45A 4GK8A 4HPHA 4XZNX 2DVTA 3KM8A 1TPFA 3M7WA 3M5YA 4H83A 2NQ5A 1AFSA 4J3XA 1IEXA 1H7OA 4KH2A 3AXMA 1BTMA 1XCFA 4ZVJA 3UETA 2AQOA 4XVDA 3MO4A 4C65A 1C8VA 4IJCA 2ZRVA 3WY1A 3W02A 4WJ8A 3UZWA 2WHLA 1TPC1 1XRVA 3ZSTA 3LXAA 2VEFA 3ITGA 2WMGA 3V5OA 3WZ0E 1OYCA 1R3WA 3E0LA 3OVQA 5B7ZA 1ODUA 1SU5A 1WAWA 3TTOA 1G7VA 3JZUA 1M7JA 4XZHA 3R94A 4NILA 2OOFA 5CG0A 1DYSA 1GK8A 3THUA 4E3TA 4NZ3A 1B31A 4PSRA 1AH4A 3AS2A 3NCOA 3GFZA 4ROQA 1U5JA 2X16A 4N6EA 4JTGA 3NAVA 3KE0A 4DJDC 3CZ8A 3LBOA 4F4RA 1KWGA 1JDAA 4JTKA 3LRMA 4DUOA 4RXFA 5I7GA 1DE5A 3WF2A 4V1YA 1UD6A 1EJXC 2OSYA 3CQJA 1TJ1A 5EB8A 3TN5A 4JX4A 4JTIA 4X9SA 1LT8A 2G8ZA 4JN6A 3TOYA 1R7OA 1J2WA 3KBWA 3P8JA 4Z1AA 1U1UA 2A85A 3O06A 5HK4A 3WH5A 4HA1A 3OA5A 3OLGA 2QCLA 4Q8VA 2E6YA 4F3HA 1AQFA 4HCHA 1MZHA 4CVWA 3DERA 3XISA 4E0CA 5AYXA 5CPTA 2AL1A 3VKCA 5CQ1A 3IV8A 3LQGA 1NU5A 4AEFA 1LWJA 1IV8A 4TXEA 3TVAA 4N02A 4IQEA 5JH2A 3VGHA 3P8IA 1JCMP 1I45A 2B4GA 2VI0A 4HYVA 5TD4A 5D9MA 2XM2A 1W1B1 4S1FA 3VIJA 4XG1A 2V5CA 5EGRA 2YGYA 1FKWA 4K6AA 5EKYA 1PIIA 2Z1WA 1E0VA 4C6BA 3P84A 4UBPC 4B2DA 1OYAA 4AZIA 1CECA 1I2OA 3VOFA 7ODCA 1HFBA 4KERA 1KLYA 3HQ1A 4I5XA 1T8QA 4JQ2A 2HVNA 3W2KA 5K4XA 2P88A 1E6NA 5GJPA 2QHAA 1M7OA 5F1UA 1SR9A 2GJLA 4JN8A 2W91A 4IFKA 5EY5A 4RXGA 1FDYA 3VD4A 5CKSA 2GGEA 3CO8A 1M3UA 1CEOA 4UFIA 2NW0A 2I7GA 1KRCC 1BFNA 3BC9A 2PDNA 2G95A 2ZE3A 1A5NC 3SGZA 3G1DA 2KX9A 3Q58A 5A8QA 4L7ZA 4O12A 2PU0A 3PFMA 2ATSA 4AD0A 2Z24A 2W67A 3T42A 4FXSA 1NIUA 1E4LA 1DWFM 1KXVA 3STEA 2CU0A 3GDRA 4Z2JA 5FJUA 3INPA 4UTJA 3IS4A 4LBRA 4WDTA 3UJ2A 5BU9A 4CNNA 4ZZ9A 1LUCA 2C1GA 3BMVA 2ZRZA 4REQB 3NL5A 3SBFA 4LUYA 1PL9A 2J4GA 3SIMA 2D1ZA 2FPYA 2HQAA 3R8RA 4P61A 2YR1A 5I78A 4AVOA 4IX2A 3KVLA 1VFFA 1K9FA 2WJFA 4K38A 3RN6A 1K77A 3AISA 1RBLA 3GHTA 3LENA 4RKAA 1ISZA 3T8QA 4IPPA 1FRBA 5BOFA 4ECLA 3NUKA 2OEKA 4DZAA 4A4AA 2EF9A 3SFWA 3SCWA 2OLSA 4UQCA 2R1PA 3BAYA 2H9AB 1W9VA 3THCA 1R38A 3LM3A 1H5VA 3CMJA 1P0KA 4NJHA 2CLEA 4JIPA 4MY8A 3W23A 3A5VA 3PZNA 1C29A 3FYYA 4PUNA 4HNNA 4XAGA 5FEXA 1V6WA 3WQ5A 4DBWA 1VPXA 2QGYA 4HU4A 5AHEA 4UTFA 5BWFA 5F4SA 1UKOA 3NVTA 1E6SM 3OHIA 1WKDA 2GL5A 3WLPA 1XHGA 4DZHA 2WMFA 2Q8LA 3W00A 2KZHA 2ZRYA 1YPFA 5EL1A 4O52A 1KKOA 3WQ4A 3ZM8A 1SYTA 1XYCA 4PMVA 2XUCA 2XZ7A 2E9BA 1XLJA 4DJDA 4FX6M 1T6MA 2V0TA 3T7VA 2YXOA 1OFEA 1K9TA 4E2DA 2HXTA 2H6RA 3UW6A 3G3MA 2CFFA 3WDPP 5BU6A 5DCEA 1LWHA 4M81A 5L6UA 3TMLA 1AZ1A 2XIBA 3MMDA 4FAMA 2DSZA 5G5IA 3FV9A 2OKOA 3WD4A 1YX1A 1WXZA 4B9YA 3UERA 4CN4A 3NL2A 3E2SA 2FQIA 1DJHA 1W32A 1O5RA 3FLUA 5JIPA 1OINA 1DQWA 1VJSA 3IV3A 2ZDSA 3OZOA 3KOFA 2XSAA 4H9YA 1GVRA 2RGLA 3QPYA 3W7KA 1QATA 5LIKX 2P1FA 4IGHA 4K8GA 3ANVA 1A80A 1TA3B 2VHLA 3PTQA 3H4GA 3FNDA 3LK6A 3W1AA 1RALA 2PS2A 4PMJA 3W7JA 3V75A 4XZWA 4AD2A 1UR3M 1P0BA 2Q3OA 5IDIA 3PTMA 4AF0A 1E1CA 3QW4B 5LKYA 3CHVA 4CNUA 1VEPA 4O1BA 3M46A 2DSKA 5G4HC 1E9LA 1X1NA 2QJGA 3GU9A 1HT6A 3BPWA 4X2RA 4OOUA 1VEOA 2JFEX 3L2IA 4AZGA 4ZQRA 2DFAA 3LQLA 2VDIA 4M51A 2YXGA 1XLLA 3A5FA 3WEOA 3CAWA 1M7PA 1XJBA 4C1NA 5JQ9A 3L0NA 1NY1A 1L2UA 3NSNA 3LSCA 1JPDX 3G1YA 3XINA 1YEYA 1OC5A 4LEQA 3WD3A 3GX9A 5D33A 1GVQA 2ODOA 4FSAA 5DFAA 3RCNA 4KCTA 2ZBTA 3N3MA 5BXPA 2EPOA 3MDUA 3SRKA 2WO5A 2GGIA 4UTWC 5EMYA 3W81A 3KOXA 3H70A 1FY6A 3DECA 4JNYA 3TNBA 3GLCA 3NQFA 3Q67A 2WOQA 2QT3A 3VOGA 4Z1CA 4E2OA 1YXYA 4JICA 4QE1A 5FAJA 3ZFHA 5LZLA 4AZ6A 4E4FA 3G22A 1IXQA 2FKPA 2PAJA 5M3WA 3P2VA 4D9PA 4UOZA 3E02A 1FHVA 4PMDA 3J7HA 3FIGA 2V68A 3LGDA 4C6CA 5I6SA 3UXDA 4KEVA 3EDDA 4D2JA 2C3ZA 1KGUA 1XLBA 4JDYA 5HMDA 3SUSA 3PBWA 4PULA 2CIPA 3UJFA 1UROA 3ZOAA 3CK5A 1VZWA 1QW7A 2FZBA 2Y2WA 1K4GA 4A8RA 2A3BA 1FFQA 1K8YA 4WRHA 2NZLA 1ZBKA 3HJEA 2DH2A 3VZYA 1UKSA 4HZ7A 4GCAA 2YCJA 2D2JA 2F9RA 4RJEA 1KC7A 3GKFA 2R1LA 2VUNA 1ZLPA 3P0WA 5FL1A 4RZBA 4ICNA 3A4XA 1TVNA 3U4AA 3ZVIA 3N15A 2TSYA 5HR6A 3MVIA 3E3HA 4IFRA 4GX8A 3EWCA 3S6OA 3TMQA 4W5ZA 4QNEA 3U7BA 4G5DA 3UVIA 5DXYA 4AIUA 1X38A 5LNWA 2XFYA 1JF6A 4Z0SA 3NG3A 4FA3A 2VEKA 3W01A 2KAUC 1OK6A 3BURA 4TMCA 3AALA 5D2TA 2P50A 4AD3A 4MKNA 1KR1A 4U4MA 3KTCA 3GFXA 1PEZA 1HTIA 1MXSA 3W25A 3RM8A 2NLIA 3HQNA 2PDCA 3TYUA 3VM7A 4L64A 3AQUA 4GO9A 3TCEA 1RBOB 5IXEA 5EU9A 3WBAA 4AY8A 3UCDA 3S6TA 4AY1A 4ZEPA 3V35A 3IK4A 1S2CA 2ACSA 3S6DA 5BW6A 1W1A1 1JYWA 4LB3A 1U33A 4HKPA 1KLZA 1WQ5A 1B4KA 1Z8AA 1KD0A 2PDWA 3CHEA 5HINA 3ZWSA 1NELA 3CIWA 3SGUA 4JL2A 2B7NA 5EYWA 3WLKX 4DNHA 3ARTA 1F2JA 2QCNA 4UR7A 3LUTA 3AWOA 2VENA 2VR5A 1FH9A 4FIRA 1U30A 2JKAA 3UNDA 3EOOA 2JKPA 1KFKA 1MSSA 1SPQA 3PUEA 5IHSA 4IT1A 4AXKA 1VB9A 4RZ4A 1OBAA 1A0DA 3TDFA 3TKFA 1IWAA 3TQ0A 3C0JA 4O1AA 3QGVA 4YHEA 2YSWA 1THFD 5A6BA 2ZYFA 1ZB5A 4DUXA 3BG3A 4QG6A 1WPCA 3NPVA 4J28A 4UCFA 1WKYA 1U5HA 2HNEA 1J5SA 1FXPA 1KRMA 3VAVA 4HOXA 4GGBA 2DUAA 2F2KA 2B7PA 4MJMA 4EPKA 1DIKA 1V3MA 2YA2A 3IVUA 3HZ3A 4OT7A 3ZJ6A 1E6RA 2IPWA 2WSRA 2BOFX 4ONVA 5C9UA 4C6EA 1K1DA 4IIHA 2WKGA 2B7OA 4IJRA 3PG9A 2QDHA 4NAFB 4U5IA 1QWGA 1R8LA 3EKLA 2OZ0A 3CS2A 3EWWA 2ALRA 4CUCA 4B5TA 4UTWA 3C3UA 2DUZA 2A3EA 2FGLA 1E9IA 1U22A 3KHDA 1EBHA 4LUSA 3UP8A 4DXVA 1XRSA 4Q8OA 3VIPA 4XX6A 3AYRA 4S39A 3QSRA 2VVSA 3O05A 3BSMA 4W88A 4WXZA 4XZMX 2QUUA 1MW1A 2ACUA 5JBEA 4LYRA 3II1A 4PRTA 1H7XA 4F9DA 2ABBA 2NX3A 5BXRA 1CNVA 3TR2A 3LCLA 5JBFA 5ABEA 3MCOA 4I7VA 1OCBA 2V5DA 3IUIA 4JY8A 4EF9A 3DCPA 4DLMA 2DQXA 3E96A 1XUZA 1MMFA 3QMTA 5K2ZA 3VD7A 2PWDA 3CV6A 3ZIZA 2PLCA 4FR1A 3WF1A 2E67A 2MANA 3ICJA 2HZGA 2E4TA 1OABA 5HNUA 1Z41A 5HMEA 1PDYA 4W8LA 1FCVA 3VNZA 1OD8A 1G0CA 3R10A 2UZ9A 5I06A 1GOWA 5CBIA 3B3DA 3L9CA 3QY7A 1OFQA 4ZTYA 2Q02A 2YBUA 3VNLA 2GPTA 3WJSA 1J0HA 3MBDA 3B9OA 5G2WA 2D20A 1LM1A 4O16A 1ZP3A 1RV8A 4HTYA 4ORMA 4OBSA 3TZNA 4QM1A 5C8BB 3NZRA 1ONEA 1QW8A 3KVJA 2G3NA 4CNOA 3N25A 4LVFA 1Z48A 1GW1A 3QM3A 4GNKB 4NZJA 3PBVA 1HJWA 2GVLA 1AZ2A 1YLVA 2OB3A 1BD0A 4GI9A 1XLCA 4PL1A 4X61A 4XAYA 1XD0A 3N12A 3E2VA 4QG9A 2PC4A 4IL2A 7XIMA 3VUPA 1U5VA 1E40A 4JDBA 2Y5SA 5C0QA 3MMWA 3M44A 2PDQA 1NARA 4FF5A 1IF2A 4FXFA 2IUZA 5FKYA 5C9WA 3VD3A 3D0CA 5CPMA 1WUFA 4XAFA 3VO0A 4OFCA 3GH5A 3W82A 1DEDA 2YFNA 2IXUA 3TC6A 4DAIA 4OWGA 3L4ZA 3R5EA 1QPNA 4IMEA 1PZ1A 1YMYA 2YCKX 4AMAA 4DM1A 4DB7A 5U7SA 2WKLA 1HGYA 1G94A 3AAMA 4DJFD 3GNDA 4E2BA 1AJ2A 4XZLX 3TTQA 4MJ2A 4TV5A 1ZFJA 3UD6A 3QBUA 5T9CE 1RAKA 1JDCA 1KB3A 4GQBA 4YVPA 3AMLA 4KRZA 5XINA 4ACZA 3GY1A 1R3QA 3EXRA 3GNRA 3ZR4A 3RU8X 1NQ6A 2R1NA 5HWNA 3DYMA 4AX6A 4R34A 3T8LA 1RLDA 3TYEA 2QEZA 1MEHA 4MFEA 1CTNA 3UU0A 1A4MA 1VFLA 3QV8A 1TTJA 1TCDA 1F6YA 4YTQA 3MUY1 3BJTA 3W70A 5BRPA 1JCYA 3MMUA 4CNPA 4PR4A 2PTYA 2XG9A 4FNQA 3EZ4A 4BEQA 5SWUA 4YJ5A 5H1WA 2GWGA 1JCXA 3CT2A 2X7WA 2VX5A 4FZIA 5A6AA 3VTRA 3WUBA 3O16A 3C2YA 4HA0A 3F1QA 2OT0A 3C4UA 3CWOX 3HURA 1QHZA 3HGSA 3WQVA 3RMEA 1VFHA 1KCXA 1GCYA 4BY3A 2V8ZA 3EX1A 3GVGA 3VIFA 2CLPA 1A5KC 1XWYA 3FS2A 2W63A 2DP3A 4QS6A 1RJPA 1TMQA 3FY1A 4X0VA 3DC8A 4CQ9A 1EP1A 5AC4A 3H2NA 3CMGA 5CSSA 3ORWA 4MFDA 4E8GA 1MUWA 3ZLGA 1DXEA 4L65A 2O55A 5FOOA 4GBUA 4MLJA 3DU0A 1YPIA 4BS0A 3KL3A 4TVDA 3CIXA 1ZJBA 4MDPA 1EEXA 5TNVA 3SECA 1IZCA 3VINA 4YNGA 4HOZA 4L4LA 3UZZA 4FXRA 3A9BA 2POTA 2JE8A 4EXAA 4F2TA 3TZFA 2XIOA 4F48A 1EF3A 1W9UA 1AVAA 1AG1O 4B5UA 1NSJA 3G8RA 4H6RA 3RMJA 1YDNA 3R1ZA 4AMCA 5C7VA 1UP0A 3GG0A 2WHKA 5LGZA 1F3XA 3N29A 3TR9A 4W9TA 1GKRA 4UXDA 3BANA 3L2LA 2C0HA 4ZQNA 2VCCA 2E1DA 3WUEA 1X39A 4YCPA 1I75A 1JEZA 4IXXA 5ABFA 2IQDA 3C0LA 3QZAA 4LCSA 5GVJA 2C15A 3PZTA 4NNCA 1W1IE 4JL1A 2X09A 4PEKA 2LLEA