1TREA

The structure of triosephosphate isomerase from escherichia coli determined at 2.6 angstrom resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
255
Chain Sequence
b'MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVNLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Structure of triosephosphate isomerase from Escherichia coli determined at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Intramolecular oxidoreductase
total genus 87
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1992-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1treA00
3CWOX 2A85A 1VHCA 2NZLA 2ATMA 3P84A 3NYZA 2VELA 5AYYA 3W1UA 1W8SA 5EKYA 1O4UA 1YDOA 1K7EA 1B9BA 5I3KA 2J9XA 2DZWA 5I3JA 3C0JA 2BSLA 1M6JA 1ADOA 4A3UA 3O6YX 1IXOA 1PL9A 3SZ8A 2FPYA 4AHPA 3PBWA 2YW4A 2VFHA 1OFOA 3P5YA 4GE8A 4OQVA 1XBXA 3W7JA 3STGA 3TSDA 1P4CA 4EIVA 3LGEA 3N14A 3P5ZA 1FBAA 2JGQA 5MHBA 2ZZ2A 4MYAA 2X16A 2RHGA 3MYPA 1UBSA 3INPA 5E1QA 3HQ1A 1OK6A 3UWUA 3EWYA 3IEBA 3DFNA 3W7LA 4JX4A 3VCRA 2PRHA 4JTGA 2WSRA 4ADTA 3I7SA 3LHUA 1SO5A 1OFAA 4UFJA 2I14A 3DFOA 5HWNA 4UFMA 3CHVA 1MO0A 1QO5A 3W1RA 4A29A 5AHMA 4AWUA 3QJAA 2C16A 5C54A 1B4EA 2NUWA 3B0VC 1PVNA 3NGJA 2JBMA 5K4XA 1VRDA 4O4WA 1FUYA 1QDSA 5LKYA 4LY8A 3LI0A 3M5XA 4HT3A 4BWLC 4JTEA 2Y88A 2GJNA 4FX7A 1Z44A 2ZZ1A 3L21A 4PC8A 3P81A 1U83A 3RU6A 3MI3A 2WO5A 4IOTA 3NL3A 1DORA 2VFEA 1DVJA 1BEUA 4QJ1A 4GUFA 3CTLA 2DZXA 3NQCA 2ZZ3A 2VEPA 3G1HA 3VKJA 3S1VA 3TQKA 4UTMA 3Q94A 2Y62A 3N3MA 2V8ZA 5DBTA 4AWSA 3P67A 2OT1A 3QYQA 1TPVA 1OFPA 3ZWSA 2E6FA 3GKFA 1YDNA 1I4NA 5BW6A 3CIXA 3DGRA 1CI1A 4OT7A 1YADA 4JTTA 1KW1A 2YYUA 2E77A 4IMDA 4JIPA 1GVQA 3C61A 4I7VA 2A2IA 3CEPA 4OV9A 4AEOA 3NAVA 2V30A 1PCKA 3S5NA 3BW2A 1TPWA 4QQ3A 3CLMA 2VEMA 1EB3A 1NVMA 4NJIA 4XBKA 1WOAA 4JD4A 4MLRA 1KM2A 3LERA 3GNNA 3B05A 3PF3A 4B5NA 2ZRWA 3M44A 1AW1A 3EWXA 1GYNA 4JX5A 3M0ZA 3W71A 3C4UA 3OVQA 5G4WA 4FX6M 3OHIA 3PAJA 4GBUA 3FJ6A 4MUZA 4AVFA 3KXQA 1UUOA 3WK2A 3VE7A 3IV3A 3CPRA 3HGOA 2C1HA 3E9AA 2FJKA 4RXGA 3GAYA 4S2BA 4O1BA 3ABQA 5FF2A 5HJLA 2NWRA 3VNDA 2QJHA 4IMEA 3UYCA 2BLEA 1P0KA 1OX4B 5KINA 3W7GA 4O15A 2OMAA 3SIZA 1SO6A 2J88A 1QOQA 3LV5A 3GZ3A 3TNOA 1QO2A 2TSYA 2ZDRA 1HG3A 4NJGA 4PTNA 4WOQA 1O5XA 3G8EA 4OGZA 1VYRA 2VEIA 1YXCA 2HSAA 2H8ZA 4OBTA 3B0UX 1TPC1 5AYZA 2XN1A 3GXTA 1TTQA 1Z42A 3NM1A 2RDTA 4K8HA 4ZQCA 3KRUA 3LRKA 4M7TA 2BXVA 3IGSA 3RNDA 5DCBA 4UUIA 5FEZA 3W7IA 5HR6A 5AC7A 1FXQA 3HGRA 3LHTA 3GR7A 3UZJA 4BI6A 4OWGA 3N2MA 1LP6A 1J2WA 3LHZA 4POCA 3G0UA 1P5BA 3TXZA 1AW5A 1IIGA 3SI9A 5EMUA 3LXCA 1PCWA 2ALDA 2A7NA 3C56A 3P60A 3BO9A 4WY0B 3UXAA 3DHFA 1VJIA 3O63A 5CZSA 3TR2A 1KM5A 3JR2A 1UJPA 2D73A 3IIOA 4JEQA 3SECA 1YXDA 4XKYA 1FQ0A 4MY8A 2FB3A 4LC6A 1ICPA 4ADSA 1T0OA 3G1VA 4BFAA 1R2TA 2B7NA 5D32A 3LXBA 5KSWA 3NEVA 1KM3A 3O16A 3W1NA 4KFOA 2EHHA 1SSDA 2CWNA 2A1YA 4IXXA 5HQEA 3UZ5A 3O6DA 1AL8A 4LUJA 3G1SA 3A24A 3G18A 1W0MA 1WAUA 1K8ZA 4QNWA 1TPEA 4JXCA 1SZEA 1TB3A 4CNOA 1G69A 5CZTA 3C2VA 4M5PA 5D2TA 1TMHA 1NF0A 1W1ZA 5FEXA 1XDLA 3EX2A 3P61A 1R30A 3W1QA 4PODA 1T8XA 3U8GA 1GG1A 3W2NA 4IMFA 1IXPA 1EPXA 3QF0A 3S1XA 1ICQA 1A5AA 3ELFA 4IPIA 5CPLA 4HN4A 1O95A 3PUDA 5LGXA 1PHWA 3EKZA 3W7NA 4RZ6A 1QPRA 2HTMA 3ANYA 4YMZA 1SZGA 1G7UA 4K38A 3RLUA 4O11A 3C2EA 3LHYA 3M9YA 5C6MA 4UTLA 1ALDA 1WBJA 2VFFA 3W7QA 1LCOA 3A22A 1LYXA 4UTKA 2NUYA 3PB0A 2NX9A 2JKAA 3DENA 5FF0A 1XCFA 4PA8A 4UTWC 4KKXA 4FX8A 3S42A 4PFMA 2CLMA 4HNVA 1GVOA 1A50A 1OF8A 1W5QA 1GT8A 5K9CA 2HMCA 5DY2A 1I45A 3P82A 3ATYA 2G5WA 5DCDA 4O10A 1TTIA 5FF7A 4WD0A 1IGSA 3KAOA 3H55A 3LTSA 2Y63A 4JYFA 4NJJA 3DFTA 3W85A 3TMLA 1EP2A 1GVRA 2ZTJA 3L2IA 2WSYA 1Q45A 2VFDA 3PBUA 2Y7FA 3FJLA 1ZALA 1FCUA 5HINA 1QPNA 4RJEA 3TK7A 4L4LA 1IIHA 3EEGA 5U4NA 2PRLA 3UPWA 4OU1A 4RXFA 5AC6A 2YX0A 4AHQA 4TMBA 3IIVA 4RX0A 2RFGA 1KFEA 3M5ZA 4N9DA 4A21A 3UQNA 1ICSA 5HULA 4M6QA 3ATZA 3W1XA 3V1PA 3L5AA 3PUOA 3TX9A 4X22A 1SO3A 2NX3A 1VCVA 1OFDA 2FPVA 4IMCA 4BI5A 3WFAA 5AOUA 3W2MA 1WBHA 2Z1BA 2A6NA 4N9CA 2FQIA 2DP3A 2CLOA 1SR9A 5D2WA 1OG0A 1SZNA 4HNNA 2WKJA 1L2UA 4UR7A 2FPTA 2Y6ZA 3O1NA 1OK4A 4I7WA 1GVFA 3H54A 2ISSA 4WY0A 3Q58A 3TKFA 1QR7A 1DBTA 4HKPA 2DJXA 3BG3A 1RPXA 1GEQA 2ISVA 5F2LA 4JYEA 1OFEA 2ZCGA 4N4QA 3W83A 1M7PA 2OZ0A 1G4SA 2C15A 4DPQA 5HWMA 3PVFA 2WV8A 2F84A 4M6PA 1OF6A 2QCDA 3B4UA 2ZA1A 1T99A 3CEUA 4MOZA 3SFKA 2GQ8A 4GFSA 1I2NA 2A4AA 3W1PA 2JGYA 1IXQA 2DU2A 4WXYA 1NF7A 3MW7A 5D02A 3QFEA 2W0UA 2FB2A 2ZQ0A 1VS1A 4MZYA 4JTIA 1VH7A 4KFPA 2E6AA 1LRNA 5AHNA 1I2RA 3W7EA 4UFKA 3PM6A 4WY0F 2ISWA 4IX2A 4UMBA 4I9AA 1H50A 5AHIA 2CLKA 3EB2A 2QEZA 4NX5A 3QPZA 4RV8A 3Q2DA 4UNKA 2V2HA 2QUUA 1LM1A 3GDRA 1K8YA 3PWAA 3T4CA 4DELA 4NJKA 2Y7GA 5H2ZA 2B0MA 4Q32A 5G1TA 2OJPA 4BWLA 2VENA 1H7XA 5CSRA 4ALDA 1JCYA 2TYSA 3F4NA 3BK0A 4R7JA 4IGHA 2V2DA 3P62A 4NNAA 1YPIA 3IIXA 1KTBA 1EEPA 4O13A 2WPBA 4G1KA 4BI7A 3M47A 1VLIA 2QCGA 1S5WA 3HPSA 4RR4A 3LBCA 4FXRA 1DKWA 1P1XA 4ZZ9A 1K8XA 4LV4A 1J4EA 1A5CA 1V5XA 3C3NA 3BPWA 2BTMA 1RZMA 3LCFA 5BOOA 1XM3A 3I68A 1TV5A 1OJXA 2TPSA 2QUTA 2JKPA 1SW3A 3V75A 3RFAA 3S1UA 5L9FA 4PL1A 2W79A 4HSOA 1ZY9A 5BMXA 1RV8A 4DF1A 5FI8A 4O0KA 1HO1A 4JDYA 2YSWA 4MYXA 3TAKA 3KRSA 5LNRA 3S9YA 4NVTA 1C29A 4O57A 4RCXA 5D09A 4DXVA 3MP4A 3W87A 4N6EA 4Z0JA 4O1DA 3WJZA 2ZRUA 4U28A 5CGQA 1LRTA 4W9TA 1OHLA 2B4GA 1KTNA 4O19A 4GUIA 5G1YA 5TIMA 5F4SA 4FIRA 2P10A 3DXIA 5KZEA 3UWWA 2UV8G 2OT0A 4UIOA 3U6WA 1KM4A 2ZBTA 2F7FA 1H63A 4MFDA 3N2XA 1TV7A 5AFDA 2CZFA 4GUHA 4QITA 4JDBA 5G4EA 2Z2UA 3TW6A 1OFBA 3QQ1A 1GOXA 1UCWA 5F4WA 4JICA 3TE9A 3THAA 3W23A 4GUJA 3MP3A 1JUKA 3BW4A 3A9IA 5FEPA 1KFJA 1ZNNA 1FY6A 2CW6A 3EWUA 2WOQA 3BGGA 2B7PA 2ZZ5A 4UTTC 1GQNA 3PBVA 3VFLA 1D3HA 5K2ZA 1AW2A 1TSIA 1W54A 1IXNA 2C18A 1X1OA 2DORA 3AJXA 3DAQA 3G1DA 2O7SA 4Y90A 1VYPX 4FB7A 2Y70A 4YLWA 4TX9A 2Z6IA 4XWUA 4O53A 4E38A 2CZ5A 4LNYA 4LT9A 4LUIA 1FWNA 4JS3A 3FLUA 1WOBA 6TIMA 1DL3A 1DQWA 3NR0A 1LTDA 3TMQA 3WK0A 1PV8A 1GWJA 4ZQRA 4LC8A 4M7SA 1UB3A 4K39A 1B3OA 3CWNA 5IM51 3JS3A 4UTJA 1Z48A 3WK1A 2PE4A 3SW6A 3O8AA 1OX6A 1WQ5A 3E12A 1DV7A 3W7PA 3TCEA 4O8RA 3ABSA 3C2OA 4DO6A 1HO4A 3GVGA 2QCHA 3NQMA 4K8EA 1L6SA 1R47A 2B7OA 2W6RA 5L6UA 1KFKA 4QISA 4QNEA 2NX1A 3F1QA 2ZYFA 4OHQA 1F2JA 4DO5A 1H61A 1YXYA 5E0KA 3TU9A 2J9ZA 1F73A 2GVJA 4Y6GA 4PCFA 2FIQA 4TO8A 1VCGA 3S8HA 1J5TA 2XN2A 3ZR4A 3QW3A 3LCXA 2AGKA 5DCEA 2NXHA 4MY9A 4ZQOA 4JY8A 1G6CA 1TJPA 4O4VA 5AB3A 1RVGA 5EYWA 4XBSA 2NLIA 1EWDA 1TTJA 1VR6A 4ZQMA 1MEWA 1VZWA 1FDYA 1KV5A 2A5HA 3L5MA 1F5ZA 3KOFA 2OCZA 1A5BA 3G3DA 4DEFA 1QWGA 2CZEA 1EA0A 1Z41A 3LCHA 5DY3A 1HUVA 3LTYA 1DOSA 3L66A 3M5YA 3MHUA 3DFQA 4IUOA 1TRDA 4LS2A 3TFCA 2YR1A 4MFEA 1LLWA 2B7QA 4UTWA 1Q6LA 1I2PA 3BV4A 3MBFA 8TIMA 4XUGA 3NZ1A 4ZQNA 1SPQA 1P0NA 1DJQA 1SUXA 4WJEA 3EX3A 2C3ZA 1VCFA 3NL6A 3UNDA 2VFGA 5BMWA 3GX9A 3M16A 2A7PA 1JULA 2DZUA 4MVAA 4AF0B 1DJNA 1SQ7A 3HGJA 1TRIA 1KM0A 4CLMA 3S5YA 3IVSA 3CIWA 1SSGA 2YW3A 4Q4KA 4LRTA 4YXGA 2FTPA 4U4MA 3G22A 1ME9A 5SWUA 5AHLA 3WJWA 1FCQA 1F74A 1R2SA 5LNUA 3D0CA 3BG5A 4GRSA 2V5LA 3P80A 2ZZ6A 1ME7A 5KZDA 3CU2A 5D2XA 1W31A 1K02A 3A5VA 2RDWA 5CKSA 3F4WA 3C6CA 2KZHA 5FF3A 4Y96A 5CPMA 3E49A 4NX0A 4EOUA 1TYGA 3B04A 1YDVA 1H1YA 3LV6A 4ZMGA 3NO5A 4WXZA 3P7YA 3W7MA 1F6KA 3QRHA 1JQXA 2Y89A 5D2YA 2EF9A 2AAMA 3N73A 3MI6A 4NZFA 1H7NA 2QUVA 1NEYA 1LROA 2PURA 1TQJA 4ICNA 4RK8A 1S3HA 3I7RA 3W3OA 3KFTA 4KFNA 1G4TA 4HPXA 4K36A 3MUXA 4MIMA 4JGDA 5DN1A 2EKCA 5AYXA 1TPH1 4YCPA 3N9SA 4UTIA 4ZQPA 4HIBA 2P0OA 4FNUA 3TJLA 5FF4A 3LDVA 3UY7A 4UFLA 1YTKA 3HMJG 3NQ2A 3QZEA 4GC4A 1I2QA 4E2BA 1LLZA 1GPWA 2J24A 3LRLA 2X1SA 1H5YA 2X1RA 4FEZA 3W22A 1XBZA 4FNQA 4NNBA 1F7BA 2XN0A 3GDKA 3HOJA 4MY1A 4RZ4A 3MJYA 3QC3A 4R33A 5LHFA 4IX0A 1VPXA 1WYIA 3IVUA 1M7OA 3NQAA 4LTSA 3CC1A 2WJZA 1R46A 3A21A 1YTEA 1ZFJA 1W5NA 3G1XA 3OG3A 2G95A 4O28A 3DZ1A 1MSSA 2RDUA 4NU7A 3TSBA 5C2XA 3W2KA 4AWTA 3U2OA 4MZ8A 3TDFA 3KX6A 3E02A 5AN7A 2HS6A 3M1ZA 1RR2A 4HSNA 3NPWA 3K30A 4N4PA 4AB4A 2CLHA 2E6YA 3E0IA 1F6PA 1OX4A 3NQDA 2Y7DA 5FESA 3NQ7A 3DI0A 1WX0A 3TC7A 3W1TA 4P61A 5F2GA 2JK2A 4O0ZA 4O50A 4N9BA 5A5WA 3FKRA 2H90A 3B06A 2Z6JA 3GDMA 1GZGA 3SGUA 4HNTA 3LBMA 3NQFA 1B57A 1EIXA 1JJKA 1TJRA 1ZCOA 5LSMA 4UR8A 3BLFA 1TCDA 4LOCA 5KMYA 2ZTKA 3KVKA 1VQTA 4O1CA 3NNTA 4XQ6A 1OFQA 4EF8A 1XBVA 2QAPA 3FIGA 1NFBA 3OVPA 1VC4A 5A8GA 3L0NA 5CZ0A 3KRZA 1T96A 4NQ1A 3N9RA 4ORMA 1TREA 4QM1A 5F4XA 4GJ1A 5LZLA 4Q33A 5DXXA 2RKXA 4UC5A 3DH7A 1QAPA 3BVJA 4JN6A 2AQWA 4PEKA 4KWVA 2J9YA 4CQ9A 1ZENA 1G7VA 4K37A 1FXPA 3MWAA 4JYDA 4DF2A 3M41A 1QOPA 3PULA 1C9DA 3MMTA 1FWTA 1I8JA 2G96A 4IWWA 3W7DA 4XZ9A 3NL5A 2BWGA 4HHPA 1KM1A 3IIPA 3C52A 3R13A 1GJPA 3G1YA 1D3GA 3IRDA 2E5BA 3B0PA 5HWJA 3R89A 1OVDA 1RQBA 5FEWA 4JTLA 3NQEA 2FLIA 3O15A 2C13A 1JCLA 4IXHA 2VXNA 4X3ZA 3DI1A 4L4MA 2VKZG 1SFJA 3ZWTA 3OA3A 1LOQA 3YPIA 3NXFA 3PB2A 1EX5A 3FFSA 2Q3OA 3W75A 1XI3A 1ZHAA 3BARA 5D37A 1CX9A 3G3MA 3O6CA 4GUGA 3R8RA 1FWWA 1M5WA 2A21A 1X8FA 4AHOA 5KITA 4A22A 1VHNA 4UTTA 2CLFA 2TMDA 3JRKA 4JNMA 4C1KA 3CB8A 3MHGA 1CW2A 1F05A 2BX7A 3NOEA 2V9DA 1XUUA 3FYOA 2DJLA 3TH6A 2WNQA 4EWND 4ML9A 5BNKA 3FA5A 3O07A 5DLCA 3L68A 4H3DA 3TSMA 4XTIA 3W1LA 3RF9A 4QSHA 2GUUA 3L5LA 4OE7A 2YZRA 4RZ5A 3SGZA 1YTDA 3MBDA 2J6XA 3PBYA 4KWWA 2XFWA 4YCOA 1Q3NA 2YGYA 3MI2A 2H8XA 3W07A 1FCVA 1DQXA 4J9JA 1C8VA 3PSWA 3W2JA 2NXIA 2E68A 1PE1A 3KHJA 4LWWA 3HG4A 1K7FA 4S2CA 1PIIA 4GNJA 1WA3A 5D38A 5HUOA 3G8RA 3B8DA 4LU0A 1ZAIA 3LCWA 3NVTA 1TPB1 4IQLA 4UMAA 4QAIA 4MLJA 1JVNA 3EXRA 1H7WA 4DO4A 4UTHA 1ZJIA 2GPTA 3BG9A 3EWZA 6ALDA 5I3GA 3L0GA 4DPPA 1A5SA 2CFFA 3PSVA 1KV8A 1XBYA 1XKYA 3DFSA 2GVGA 3QMSA 3NQVA 5K9DA 4ZVJA 2G97A 2I1OA 4MJMA 5EPDA 3G1AA 3GYEA 2NV1A 4DBDA 5DBUA 4DF0A 3OIXA 3ABRA 4E2DA 4JTHA 3HG3A 4O16A 3EWWA 1AMKA 3PG9A 2RH9A 3THQA 2ZRZA 2VFIA 1XDMA 3W88A 4CQ8A 1H7PA 4AH7A 1QPQA 1GTEA 4H4IA 1E51A 3R12A 7TIMA 1O5KA 2QJGA 5D05A 1SZFA 3QSRA 3R2GA 2EGZA 1WDWA 3EXTA 3GIYA 1H62A 1JCNA 2H3BA 3QH2A 3SJ3A 1XC4A 2H3DA 4NXKA 3WK3A 1SO4A 4ZL1A 2YFOA 5TQLA 3PY2A 1KTCA 3KVLA 2O7QA 4HPJA 4QIUA 3IGUA 2PRMA 3TFXA 1UASA 3W76A 2VC6A 5HMSA 5CPOA 1UUMA 4GWEA 1TV8A 2R91A 2WNNA 1TQXA 1HTIA 1FCBA 1OX5A 3L9CA 1QFEA 3FEMA 4M6VA 1MEIA 4XKYB 5DELA 4LRSA 3LHVA 3MO7A 4Y8FA 5H91A 1LBFA 2ZRVA 3QPYA 4FNSA 2Q3RA 2VEKA 2A7RA 2X2GA 3GXPA 2TRSA 1GVSA 3TJXA 1LZOA 3TROA 2X1TA 3LCLA 1ZAJA 2C19A 3W86A 1ZAHA 5EBUA 3NZRA 3NPVA 3STEA 4Z1AA 3W2LA 4FIQA 1OYCA 1U5JA 2R8WA 4A2SA 3EXSA 5D30A 5IBXC 5I3HA 2QR6A 1Y0EA 2EPHA 3SSJA 1YLVA 1XUZA 4ORIA 3QQ0A 2ZZ4A 3T55A 3C2FA 2QJIA 4RKAA 3UPBA 3W84A 3HJZA 5ABTA 3S5OA 1LBLA 4CCEA 1AG1O 5F1VA 4GXMA 3HG2A 5F1UA 4LV9A 2WNZA 2GVLA 3DHDA 3P8JA 3OVRA 3WJYA 5CSSA 3LOTA 1G4EA 1OYAA 5F2IA 3BW3A 3NDOA 1SW7A 4AMAA 4JIQA 1KM6A 3LCGA 5TBOA 4K6AA 3TQVA 4O18A 3LB0A 1R2RA 3O06A 2NV2A 1EUAA 2QDGA 4UCGA 1KFBA 4X9SA 3DU0A 5D2VA 3T44A 4YL2A 4CNNA 3NQ8A 4MKNA 3W7CA 1TPDA 4UTUA 2DZTA 3RLVA 1VGAA 4Z08A 1W3IA 3R5EA 3M5VA 4LVGA 1SU5A 2QKFA 2QCNA 5HNRA 3PUEA 1VYSX 3GKAA 3FOKA 3KVJA 3TC6A 1S5VA 4FNTA 1WV2A 1AK5A 1YPFA 4AAJA 1BWLA 3DFPA 3QW4B 5D04C 2GOUA 1JRBA 4UMCA 5J5RA 1MXSA 2X30A 2A6LA 1H7RA 3L65A 3PG8A 1ONRA 3T40A 4YWIA 3M43A 1W5PA 1X7FA 2Y7EA 2YCEA 5U7SA 3NM3A 3UWQA 3HG5A 4D2JA 4PH6A 4O52A 3LI1A 3W74A 4FXSA 3G0SA 3LCIA 2QCFA 2V0TA 1L9WA 4OV4A 4HNUA 3QMTA 2E5DA 4LS1A 3LRMA 3HPXA 4WUIA 2X1UA 1B4KA 3GR8A 1RQHA 2Y61A 5G5IA 3W6YA 3AO0A 5LNSA 3KVMA 1EP3A 5K9XA 1NAL1 5F2MA 4FNPA 2ATSA 3OBKA 4K7VA 2CLEA 2GJLA 3DKLA 4NZJA 1ML1A 2WSQA 3W1AA 4IPJA 1W5OA 2QCEA 1TPFA 3MHFA 5AHEA 1EUNA 3GNDA 3TA6A 4O12A 3EKLA 1G67A 3GB6A 3P8IA 1FDJA 3LM7A 2YDAA 4FF7A 4CNPA 2NWSA 3LXAA 3PS7A 3HPZA 3NG3A 1H1ZA 3ZS4A 1I2OA 1GG0A 3I65A 1K03A 4NXSA 3CT7A 1S5TA 3N34A 1JUEA 2QAFA 3PR2A 3G24A 1WXJA 3WJXA 4A2RA 4MPQA 4FHAA 1D9EA 2QCDB 3W2UA 1LBMA 4FNRA 3C8FA 4EF9A 3HIJA 5LGZA 2ZRXA 4Z1BA 1G4PA 4XTDA 3W73A 2ZA3A 3UXDA 3TQ0A 3LHWA 2ZZ7A 4TR9A 4NT0A 2ZRYA 1N7KA 4UNLA 3LTPA 3ABOA 3UY8A 5KTLA 3HBLA 3LLFA 2QCCA 1PS9A 3A5FA 1OFRA 5CG7A 4O17A 3TIMA 4R53A 3TUUA 3VI2A 5LHEA 1DHPA 3H53A 2BZNA 5D03A 3DBPA 4H6KA 4NUWA 3QMRA 3G1FA 4O1AA 5GVJA 1HFBA 2Z0IA 1Q6RA 1TIMA 5AC8A 1EP1A 3M7WA 3T7VA 5D33A 2E5CA 4BR1A 1H60A 3S0CA 2ZA2A 1JCXA 2HS8A 2V82A 3HF3A 3HO8A 2PC4A 2Y85A 4I7UA 2V5BA 2PCQA 3O05A 3STFA 5J5DA 3HB9A 4CCCA 4O14A 1MZHA 4WZHA 3UD6A 3G0XA 1SFLA 3SR7A 5K7JA 4AXKA 3NQ6A 1EWEA 4UFIA 1KA9F 1KBIA 4LVFA 3TW7A 3EX1A 2YXGA 1X1ZA 1OABA 3W7KA 4Y9AA 3EWBX 4NNCA 2P1FA 2FDSA 2V81A 4JTJA 2CZDA 4IMGA 3BLEA 4E0CA 1Q6OA 4LVAA 2YYTA 4WQ6A 2EAWA 5I3FA 1LORA 3W7HA 5LNVA 2CLIA 3BGJA 3BLIA 1RQEA 3MP5A 4N9EA 3W7RA 2Q8ZA 5HUPA 2CU0A 3OEXA 2CLLA 3TAOA 1K3UA 5KZMA 5C5YA 2QCMA 1V7YA 3CQ0A 3IGXA 2YFNA 4ADUA 5DXYA 5AHFA 2R94A 3F03K 4BK9A 3TXVA 4FO4A 2ABAA 1LRQA 1PHQA 3NPUA 1K7XA 3I7QA 2GQAA 3L67A 2NXGA 4TMCA 1XL9A 3GDTA 4WX2A 4JY9A 5T26A 1KFLA 1JCJA 4ONVA 5G2WA 5I3IA 1ME8A 3NPXA 3T78A 3PC0A 4UFHA 4AF0A 3WJSA 5G2IA 5EA9A 5G2HA 1QPOA 3ZFHA 3B03A 5K4ZA 3E96A 4IJBA 3NL2A 3GLCA 3W7OA 3LX9A 4R34A 3DKJA 1O60A 1IF2A 5CPNA 1FWSA 3P74A 3QEZA 2YPIA 5CZJA 1LOLA 2A0NA 4Z1CA 3S6DA 3RK8A 3FS2A 3C2RA 1JR1A 2Q8LA 5EL1A 3I6RA 1TO3A 1BKSA 4RLIA 1VLWA 3GXNA 3L0KA 1AL7A 1W37A 3N19B 3FYPA 3GK0A 5BRBA 2V2CA 1JQVA 1GYLA 1QNVA 4PL2A 4LVDA 1KBJA 1H51A 4JTSA 1F76A 1W5MA 3CM4A 4NJHA 2OX1A 4MJZA 1FWRA 1TTPA 3S5ZA 2C14A 5HR7A 4TIMA 2FFCA 4LVBA 1XXXA 3STCA 4CCDA 3FKKA 3LLDA 4JTFA 1BWKA 2E09A 2H6RA 4DBEA 3EX6A 4DQWA 3VE9A 4C1LA 3W1MA 1L6YA 3TV8A 3GDLA 3NQGA 1L6WA 1BTMA 5EY5A 4EVZA 2NUXA 4S1FA 2VOMA 3S1WA 4JTUA 2DZPA 4N6FA 2J27A 1KLYA 3RMJA 1JRCA 2IQTA 2E6DA 4JTKA 1N8FA 1H7OA 1JUBA 1TPUA 1Q6QA 3IVTA 3UWYA 1KFCA 2I9EA 1N55A 2E1DA 1LDCA 1YYAA 4Z0SA 2LLEA 3A23A 4X2RA 3W9ZA 3USBA 3MYOA 4P2VA 4Z1DA 2C6QA 3W70A 3IIZA 1W3TA 2C0AA 2DZVA 4M19A 1NSJA 3QSTA 1W56A 1A53A 2R14A 1OYBA 1FX6A 2QF7A 2JKEA 4O54A 4LS0A 1FDZA 2GQ9A 1RD5A 1LOSA 3UWZA 1GTHA 3W72A 5IBXA 1KLZA 3QM3A 4LW7A 2ZFAA 4CQAA 1HL2A 3Q37A 2DZSA 3UWVA 1XFBA 2QDHA 2QCLA 4N2YA 1THFD 4WOZA 4BF9A 1SW0A 2ABBA 3M6YA 4K7YA 4TU1A 4JR5A 1QMLA 5LNWA 3HGSA 1X6UA 4JX6A 3GAKA 2WQPA 4MZ1A 5K3VA 1MEHA 1JCMP 1W3NA 3EX4A 4N02A 4UXDA 5E93A 1O94A 1QCWA 5C55A 3NA8A 3SY5A
chains in the Genus database with same CATH superfamily
3CWOX 2NZLA 4ZSTA 2VELA 5AYYA 3AYRA 1C8QA 1W8SA 4LBUA 2Y5EA 1B9BA 5TD4A 1Q6DA 2DZWA 3CIVA 2E9BA 3C0JA 5I3JA 2BSLA 1ADOA 3OQEA 1JYWA 3GC4A 1QNOA 2AMXA 1GPFA 5DFAA 4AHPA 3PBWA 3EDFA 2OSXA 1HP4A 4N42A 2W27A 3NXLA 3P5YA 4OQVA 3P2VA 4FOUA 3WDJA 1E3ZA 3STGA 4PCNA 1SMAA 3H4XA 3OBEA 3SRHA 3QY7A 4Z1YA 1R7OA 2I7GA 3PZ9A 2RHGA 1W32A 3GIQA 2Z26A 3HQ1A 4EKJA 1OK6A 3WBEA 2CETA 4JTGA 2G50A 2PTXA 3DFOA 3CHVA 1MO0A 4OIFA 1QO5A 1TR1A 1XCWA 1W1VA 2C91A 4YVVA 4AWUA 3V3WA 5C54A 5EB8A 2XGZA 3B0VC 1UH2A 4PUUA 3FW6A 2X1IA 1PVNA 1ZBVA 4YTSA 1QDSA 3FJ4A 1JNEA 3VILA 4C6KA 3FK4A 3M5XA 4JTDA 2XFFA 3JZUA 4ZA0A 3U5UA 4EAMA 3RU6A 1ELSA 2WO5A 4H6RA 2QPUA 4QJ1A 1BEUA 3W25A 5M03A 4GC3A 4GUFA 3MSGA 2FH6A 3CTLA 1F4HA 2ZZ3A 4WJ8A 4H41A 4PMOA 2PDGA 2GSEA 1M41A 3GG7A 5BXPA 1EJWC 4AW7A 3S9IA 2GK1B 3ITOA 3DGRA 4J3ZA 1H3GA 4OT7A 3VDAA 1KW1A 3A4XA 4HU4A 3NAVA 4AFYA 2VZSA 3BW2A 3VD9A 3S83A 1BXNA 4NJIA 3LUTA 1DE5A 4XBKA 4M1BA 3KBMA 1DWJM 4MLRA 4KIRA 4PCPA 2PODA 3EWXA 1GYNA 2QJNA 3W4RA 3SQMA 4GBUA 4V1XA 2PDQA 5I6SA 1UUOA 2FTWA 3WUGA 1J79A 3CPRA 2FJKA 4H19A 4RXGA 5DQPA 3R58A 4PCSA 1QOXA 3IANA 4LGXA 3MT1A 5HJLA 4I3GA 3VNDA 2BLEA 3TLLA 1P0KA 2AKMA 2DZBA 3IJIA 3EWDA 5ABFB 5AY7A 5KINA 3W7GA 1S2TA 3BLOA 4O15A 4IP7A 3SIZA 2ADAA 1QOQA 3RAOA 5CAHA 1QO2A 4L7ZA 2UY3A 4NJGA 3WQCA 3SUTA 5D9PA 4Z2GA 1EC9A 3E1F1 2HSAA 2GJPA 5IDZA 5JIPA 4ERAA 1DWFM 2XN1A 4G7EB 2VD9A 3SCUA 4MNMA 2VP8A 3RCMA 4ZQCA 3RPMA 3IGSA 5DCBA 2VYOA 3SCTA 3LHTA 2HXTA 3GR7A 2RJHA 4BI6A 2Z2AA 1LP6A 1JYNA 5E6YA 3DGBA 1LQ2A 4R9OA 2DT2A 1B30A 3TXZA 1RLCL 1IIGA 1B3VA 2VUNA 4XZHA 3S2LA 1DIEA 3LXCA 3OODA 2A7NA 1NM9A 1GEHA 1E1EA 4WY0B 3ITXA 2J8TA 5CZSA 3AYSA 3TR2A 4LAKA 3VGFA 1UJPA 1V3KA 4W7WA 5BRPA 4XKYA 4XVEA 3WQDA 2DUAA 4MY8A 4F0KA 2QUNA 2FGLA 1R2TA 5D32A 1XLJA 4L61A 5KSWA 3N6HA 3IUDA 4HYVA 1WZLA 3EWCA 1W0MA 1K8ZA 2VQUA 4JXCA 3B9AA 4CNOA 1G69A 5CZTA 3C2VA 1UD2A 2YKKA 1Z8AA 4E2OA 3TWAA 2BS9A 1OADA 1XIFA 4REQA 5I5RA 1GG1A 4J3SA 1EPXA 2EPNA 3BXWA 3WF3A 3GNRA 5CPLA 4ZOAA 3TYDA 1O95A 3EKZA 2YB1A 3A64A 4BKNA 4YMZA 1SFTA 1DEDA 1QW7A 5FKYA 4CD8A 5C6MA 3AZRA 1WKYA 4Y8EA 3DENA 2D1ZA 3QVQA 3S42A 2PWVA 1W5QA 2YBUA 3GG0A 2HMCA 5DY2A 3P82A 4O10A 1OY0A 2R1NA 2WCGA 3VAVA 1HL8A 5FF7A 4EXAA 3OGVA 1YE6A 3H55A 3H12A 3PPHA 4DN1A 5ABFA 3BUVA 2ACQA 5CEWA 4JZ5A 3QYSA 4S3JA 2ZUMA 2I56A 2Y7FA 4GI9A 3FJLA 1ZALA 3N2TA 4RJEA 3ARPA 3TK7A 1IIHA 5U4NA 4HBKA 3NDYA 1E9IA 4A35A 1LWJA 2YX0A 4AHQA 4TMBA 1SGJA 3SY8A 4M8UA 2YXOA 3U0HA 2CZVA 4N9DA 4A21A 2C8NA 2HQAA 5HULA 4DJED 2C7FA 3V1PA 2D24A 1HL9A 3VOFA 1U33A 4QRNA 3SFWA 2NX3A 1OFDA 3MDWA 5AOUA 3W2MA 1AJ2A 1WBHA 1EPVA 2CEQA 2A6NA 2PDUA 2FQIA 2DP3A 4JQ4A 3S2NA 3FSTA 4AZHA 1XV8A 2AKZA 1XLLA 2Z29A 4WY0A 3Q58A 4XSMA 3BG3A 1RPXA 1CDGA 5F2LA 1W3HA 3VOIA 3W83A 3M64A 3I3EA 2EO7A 2C15A 5HWMA 3PVFA 1S3TC 2XH2A 3H70A 1OF6A 1PTDA 2JGYA 4QE5A 3W01A 5JBFA 1TZ7A 1NF7A 3MW7A 3IUHA 3RLHA 2YLAA 4L1XA 3PPGA 1OT2A 2FB2A 4C5ZA 3WMSA 4EPEC 5AHNA 2CHNA 2VWTA 3CQJA 3WQ4A 1TWDA 4MMWA 5FJJA 2ISWA 1Q66A 2PWFA 2WWCA 4NX5A 4H6EA 3MMDA 3QPZA 1JPKA 3MCNA 4D1IA 3GDRA 3T4CA 2Y0FA 1QHZA 5H2ZA 2B0MA 3CJPA 4J3XA 4Q32A 2ZICA 3B0XA 3LSCA 2VENA 1WAWA 3BAKA 3F4NA 4R7JA 1F3EA 1BF2A 1CXFA 4GCXA 4G1KA 4KMQA 4IQJA 4CNUA 1S5WA 4HPHA 2WZIA 4M81A 1BKHA 1GGOA 1TVLA 1DKWA 1P1XA 5C70A 3RX3A 4KWSA 4LV4A 2BGSA 5JBEA 1J4EA 1VEOA 2QGYA 1XH0A 4CD7A 1V5XA 1RZMA 1HIZA 4DJFA 3CUHA 2XH0A 4WSKA 5BOOA 1B3WA 4JQ2A 5T8GA 2TPSA 1SW3A 1X7IA 3SUWA 1AD1A 4HSOA 1FWBC 4DF1A 2HEJA 3GVVA 4WF7A 4KEUA 4MYXA 1OQFA 1RP9A 3L2LA 1TMLA 2UY2A 4LF2A 1VF8A 3IJQA 3LSBA 4IFKB 4L4OA 3MVIA 2CKSA 4Z0JA 1R87A 1LRTA 2GGGA 1OHLA 4TV5A 1ZRQA 5F4SA 1EHNA 1NH6A 1V6UA 5JMUA 2UV8G 4UIOA 3U6WA 1KM4A 3R25A 4DJEC 4U2YA 3KCJA 5XINA 4JDBA 2R1KA 3QQ1A 5J8LA 3CMFA 3EEZA 4QEHA 2OOGA 3MP3A 3A9IA 5FEPA 3POHA 1ZNNA 2DVXA 1GQKA 3EWUA 3AMDA 3BGGA 3ZT5A 4UTTC 2XIJA 3IWPA 1TSIA 2WNWA 4Z42C 2C18A 4XX6A 2GSHA 4FB7A 2W3ZA 3RM9A 4OUEA 4TX9A 5LYRA 4LXFA 3CZEA 1J96A 3EOOA 3AMGA 1WOBA 3F7JA 3NR0A 4UOJA 3AMKA 1GWJA 4ZQRA 2VC5A 2OEJA 4E3TA 1UB3A 3CWNA 1Z48A 3TZNA 2Q71A 3WK1A 3WEOA 4NI3A 1B2YA 3SW6A 3II1A 3E12A 1DV7A 4YN5A 3TCEA 4P7QA 2F6KA 2G4JA 3T8QA 3QTGA 1R47A 1KFKA 2RGMA 3W82A 1P7TB 4QNEA 2NX1A 4AVOA 4OHQA 4PULA 2QF8A 3K4WA 4DO5A 4LBSA 1IWBA 2X41A 2XG9A 4B16A 4U31A 1LL6A 1A5UA 1EJVC 3UEQA 2CC0A 3MWCA 4PCFA 4TO8A 1VPYA 6ENLA 3HMCA 1X97A 2XN2A 1A5LC 4ZE4A 3QTPA 1KCKA 2Z7GA 3QW3A 3GXMA 2OQYA 3TYZA 4MY9A 3WLPA 1G6CA 4O4VA 3GY1A 1UZ1A 3ZYZA 2VC7A 3E0WA 2WXDM 1VZWA 4LB3A 3HQOA 2RDXA 2OCZA 4AZ7A 1IR1A 2C0HA 3OLGA 1XLCA 2NQZA 1RA0A 1D3CA 3L66A 3U48A 3MHUA 3KEHA 4WDTA 2BOEX 3TFCA 2YR1A 2D20A 4GKLA 2FTYA 4KCUA 4GH1A 1ISXA 1EXPA 4UTWA 3KWXA 4H83A 4B9ZA 3PZIA 1O1ZA 3MBFA 1PKMA 3LNPA 3EX3A 3TP4A 2C3ZA 1VCFA 3GDBA 4NI8A 1KXHA 1LT7A 1YNQA 1FWFC 3VNJA 1DJNA 4CLMA 3IVSA 2EXOA 1BPLB 4YXGA 1ME9A 1A80A 1KRMA 5SWUA 4LCQA 3WJWA 5LNUA 2GUYA 3P80A 2VDGA 4MWAA 1VBHA 3A5VA 2RDWA 1RA5A 3F4WA 3C6CA 5FF3A 3QZ6A 4NX0A 4NG3A 3DX5A 3UJ2A 1VKFA 1TYGA 5IDIA 2VDHA 1RD6A 3W7MA 2ONEA 2OVLA 4IGNA 2TAAA 4HA4A 4WR3A 4JEJA 5CAKA 5D2YA 2EF9A 2GSJA 2OWWA 5ENLA 2AAMA 1L0PA 2QUVA 3SCRA 1NEYA 4F2UA 1LROA 4ICNA 1FHDA 3I7RA 1JDAA 3GBDA 3KFTA 4M1RA 3BSMA 1B9ZA 1ZU8A 2W91A 1WB0A 1TPH1 1TMQA 1JFHA 3S2JA 4HIBA 2P0OA 1UKSA 2ZWYA 4GQQA 3HMJG 1V3HA 3NQ2A 3QZEA 1QNQA 3HFTA 1WZKA 2P76A 2J24A 4DWSA 3BTNA 2J7GA 1VJZA 4MSSA 4K1WA 3C8NA 2NVAA 3HFYA 1PKNA 1VPQA 1F7BA 1YDYA 1XIMA 5FCZA 3HOJA 2AAAA 2PWEA 3O0FA 3QC3A 4FI4A 3Q67A 4IX0A 1WYIA 2XFYA 4HMNA 5DRCA 3NQAA 4LTSA 2XSBA 3TNBA 4BF7A 1FWHC 4Q4OA 4PFHA 1JGMA 2XVLA 3OG3A 2G95A 4Y9PA 4NU7A 1CZ1A 5C2XA 1ZS2A 4GZ7A 1BHGA 2I57A 3TDFA 3KX6A 3E02A 5AN7A 4A3RA 1RR2A 1DXIA 5FAJA 4HSNA 4YTQA 3NPWA 4N4PA 5HAOA 3BCFA 3IJ9A 3GIPA 1PZ2A 3WNLA 3NQDA 1VBUA 1Z6KA 5E0CA 1WX0A 4CVWA 3W1TA 4Q8WA 2GGJA 2G4FA 3KP1A 2H90A 3B06A 4W89A 1XGEA 2Z6JA 3GDMA 4RUBA 5A1AA 3CV1A 1IEVA 4MUPA 1OC6A 4HU3A 3ITTA 3NQFA 1JJKA 1TJRA 4XIAA 4Q8MA 1SJBA 3BLPX 1JPMA 1ZP3A 2GJXB 3RITA 1TCDA 5KMYA 4JFUA 4NYUA 3RU8X 1XG3A 1VQTA 3U2ZA 6XIAA 4EF8A 1CECA 1V6XA 4DXKA 1AZ2A 2O4QA 2RAGA 1QUMA 3UG4A 3KDNA 3TA9A 4ACZB 5F4XA 5LZLA 2CCRA 2VVSA 1TV3A 1HKKA 4UC5A 1EJSC 3U5YA 2VHLA 4JN6A 1FFRA 3B0YA 2GWNA 3MWAA 2PLJA 4DF2A 1DJXA 3M41A 3PULA 1FWTA 4PGLA 3W7DA 2DY3A 3MKVA 5DT7A 2BOGX 2RGLA 2XH4A 4LFYA 4V15A 5HWJA 3B0PA 2VOTA 4LANA 3NQEA 4C1NA 4X3ZA 4L4MA 2VKZG 3VIJA 2A79A 3ZWTA 1QI4A 3ECQA 3IJDA 1RJRA 1LOQA 3PB2A 1EX5A 1XICA 3SSZA 1PDYA 2Q3OA 1E0UA 3GQYA 4M56A 4W5UA 5BYWA 1ZHAA 3BARA 1M3UA 1M5WA 2A21A 4B15A 4A22A 4ZB0A 1VHNA 1EJRC 1PXGA 1ZQ5A 1W2PA 3FSUA 4CEUC 2VZVA 4C1KA 3CB8A 3K5XA 1UD6A 4JCLA 1JD9A 3WF1A 1RK5A 3FXGA 5A6TC 3FYOA 2QXWA 3OW1A 2VX5A 2ZC1A 3W1LA 3RF9A 2GUUA 3MSDA 4OE7A 1EZ2A 4S3BA 3QY6A 3MBDA 1NDWA 1LUCB 1D2KA 1VAHA 2X8RA 2WZTA 1Q3NA 2QYGA 3VD3A 1Q7ZA 5E09A 1V3JA 2XTKA 1K70A 3R79A 3HG4A 4UWMA 1XRTA 5HUOA 3GU2A 5A6LA 3DEQA 5JXQA 4LU0A 3NVTA 1TPB1 5C9RA 1XYBA 2NW0A 2PZNA 3EXRA 2JE8A 1PJ9A 3TYAA 4UTHA 2QPXA 2OX4A 1V0MA 4C90A 4AG0A 2GFTA 4V1YA 1KV8A 2GVGA 3N18A 2G97A 4LAZA 3CMJA 4XBJA 4HNOA 5EPDA 3OYXA 4J2PA 4DBDA 4DF0A 4E2DA 1WKFA 3HG3A 2GJXA 3EWWA 2W61A 1PYMA 2GGEA 2RH9A 3THQA 4OBRA 1NOUA 3HURA 4XZMX 3LG3A 4AH7A 4IIFA 1QPQA 1L6FA 1E51A 1GKRA 1AH3A 3AHZA 4LCSA 3PZVA 3UJSA 3QSRA 2BVDA 3GIYA 1E4NA 2XHYA 3EMQA 4CGTA 4QTGA 2YFOA 3PY2A 2XIMA 4FOKA 2VL4A 3TONA 2PRMA 1UASA 2VC6A 2YCLA 2WNNA 1HTIA 3L9CA 2VJXA 1KFWA 2P3ZA 3H2MA 3VGBA 2DVUA 1IGWA 3PZGA 5H91A 3QPYA 3Q45A 4CQDA 1CB2A 5JQ9A 1QT1A 3CH9A 1TUFA 3LCLA 3M7SA 1AJ0A 4W7UA 2BBFA 2J78A 1W1B1 4DRSA 2VDIA 3W2LA 4FIQA 1OYCA 2O56A 2R8WA 3EXSA 1HX0A 5I3HA 4Q6JA 2WHKA 1Y0EA 5G4HC 1ZGDA 4FS9A 2NSXA 3QQ0A 3T55A 2JALA 1E56A 3RILA 3W84A 4H7CA 3CL7A 4IGMA 1LBLA 1U5VA 4AISA 1XCXA 1H2JA 4GXMA 4F3HA 2VZOA 3BCDA 3GVRA 1ZPTA 2PC8A 1JXJA 1UWTA 4XSLA 1BXBA 3PWIA 2YZ5A 1W9PA 4AMAA 4DZ5A 3GU1A 3TQVA 1YHTA 2CHOA 4IISA 1L6GA 1I60A 2QDGA 4UCGA 2BY2A 5DMLA 4X9SA 2REQA 4MB4A 4CNNA 1N82A 4MKNA 1FVPA 2PGWA 3CHFA 4UTUA 1ISVA 1BF6A 5BOFA 4Z08A 4CUCA 3CH0A 3AIUA 4Y7EA 3PUEA 3KVJA 4AX6A 4G6CA 5CQ1A 4AZGA 3R6IA 4IPNB 1AK5A 1YPFA 2XVPA 3GHRA 3N17A 1TWWA 3QW4B 1MYRA 1DHKA 1JRBA 5J5RA 1MXSA 3M0HA 4YWIA 5I07A 1W5PA 1XLAA 3QOMA 4D2JA 4PH6A 1S2AA 4O52A 1S2CA 1HZYA 5GNXA 3ZLGA 1H09A 3T4WA 2QCFA 1BYCA 3TQPA 2E5DA 3W6LA 3HPXA 3TN3A 2X1UA 1CCWB 1RQHA 2Y61A 3W6YA 3FXYA 4I8DA 3TYBA 1O66A 1RCOB 4CQCA 5F2MA 4C7GA 3O2LA 3HPAA 3NZPA 3ITGA 1Z3NA 4RV3A 4K7VA 2CLEA 2GJLA 4NZJA 4HTYA 3TWBA 1IWPA 3W1AA 2QT3A 1TKKA 4O12A 2GUBA 3EKLA 1G67A 4GO8A 5EFDA 2BHUA 3RGTA 4FF7A 3WQGA 5JBDA 3AXXA 3NG3A 4U5KA 4E8GA 3M0XA 3MQTA 1H1ZA 4G9PA 3Q65A 4Q4PA 1HKIA 2FZMA 1CLXA 4PMRA 3TR9A 1J12A 1UC4A 3U4AA 3PZQA 4MPQA 1D9EA 2JEPA 2QCDB 3W2UA 1LBMA 3GH5A 3C8FA 5ECUA 4XTDA 3OZPA 1BVWA 3FN9A 4ATWA 3LHWA 3U2CA 3OIHA 3VGGA 1E40A 1N7KA 5DF0A 1UH4A 5KTLA 3QY8A 3JVAA 2WJFA 3A5FA 3EA1A 4O17A 3WFZA 3MZ2A 3TUUA 3OP2A 1QW8A 1NQKA 3DBPA 2ZX5A 4H6KA 4JQ1A 1BSLA 3VINA 3QMRA 1XSIA 3G1FA 1ZBWA 4P8UA 1TIMA 1EP1A 2EPKX 1H60A 4JTQA 3HO8A 2Y85A 2V5BA 3AWNA 3O05A 2XVNA 3HB9A 2BVTA 2IQ0A 3CL8A 2PBGA 1VP5A 2VI0A 5CG0A 1SFLA 4AXKA 1KQYA 4DAIA 1ZJBA 1EWEA 4TQTA 4LB4A 3D3FA 5I79A 1U22A 1KBIA 1E6XM 3WH5A 1KQZA 4J3VA 4HCDA 1X1ZA 5FJUA 1MRAA 3EWBX 1GOIA 3RJYA 4IMGA 1Q6OA 4LVAA 3W24A 3WLJA 4F4RA 2EAWA 1V3MA 5CBBA 1LORA 2CLIA 3JU2A 1M7XA 1VIWA 5KEZA 2Q8ZA 5HUPA 1VJSA 2NLYA 5C5YA 2BMBA 5AYBA 1K9TA 3C0QA 4JAWA 2GYIA 2YJQA 1Q5MA 1R0MA 4JQ3A 4IIBA 3WNKA 4XD6A 5AHFA 5JVLA 3BC9A 4FLSA 1A3HA 1CXEA 3F03K 4S3FA 5D4YA 3EDKA 1DJIA 4V27A 3VMOA 3ZVHA 5CJMA 4W85A 3NPUA 3I7QA 4AC1X 1XSJA 2GQAA 5HMEA 2PGFA 1KXTA 4JY9A 4FLRA 4L9XA 5G2WA 2BB0A 4UFHA 4KEVA 1J0IA 2OLAA 4H6QA 3WJSA 2ASHA 3WNOA 3ZFHA 1KO0A 4EXBA 1GYMA 3AWOA 3E96A 4JKKA 1FKWA 2E28A 1IF2A 3D46A 1EQCA 2OWCA 1LJYA 1LOLA 2IXVA 4UQAA 4C6QA 3FS2A 3C2RA 3WBWA 4PMQA 1XS2A 1BKSA 1VLWA 4BCEA 3OVGA 1W37A 3N19B 3GK0A 2WVVB 1WUEA 1JQVA 2PP1A 1QNVA 3GUGA 4WIWA 5GPRA 2J7HA 3UGVA 4DB7A 4HHMA 4NJHA 1OD0A 2IPFA 1TTPA 3S5ZA 2FGBA 3K46A 4JFTA 5HR7A 4JBRA 4GINA 6REQA 5BXSA 1KC7A 3WMCA 3FKKA 3GO2A 3LLDA 3U7VA 2E09A 2H6RA 5MKGA 2DSWA 2ZIDA 3EX6A 2ISDA 2X2YA 3WBAA 1L6YA 3ORWA 1L6WA 4EVZA 3UCDA 2NUXA 2AL2B 2UY5A 1W9VA 3H2EA 4N6FA 1D8WA 3R0DA 4IG2A 2P5NA 1UKTA 3TYUA 3VIFA 4DJFD 3B8SA 2Q09A 1N55A 5HATA 1LDCA 2LLEA 1TA3A 3WLKX 3USBA 3MYOA 4ENLA 3CZKA 2D23A 1IEIA 3R0UA 1QWKA 4Z1DA 2C6QA 3W70A 3IIZA 3DOPA 1M7JA 3B8WA 1OGBA 1A53A 4UQBA 1OYBA 2GQ9A 2HVNA 3ITVA 1LOSA 3UWZA 4K68A 5I78A 3EMZA 3WLMA 1JZ6A 1RBAA 1T41A 3Q37A 4XK2A 1ODUA 3WX7A 1XFBA 2QDHA 2QCLA 2XIQA 1TZZA 4W4QA 3U3HA 4TU1A 5LNWA 4DYEA 2ZX6A 2WQPA 4MZ1A 3VTRA 1JCMP 3ZT7A 4UXDA 1QCWA 3H23A 3NA8A 4ZGYA 4LCRA 2A85A 2ATMA 3P84A 3SN4A 4DO7A 2ODOA 3F5KA 4JIEA 2R9RA 3W1UA 2GZXA 2WPGA 1O4UA 4TXEA 2XIBA 1K7EA 3UERA 4I9JA 4KT2A 4MJ2A 3M6DA 3BV7A 3WEZA 3O6YX 3LK6A 3WENA 1EKOA 5FACA 4PUNA 4W88A 4GNVA 1V02E 5A6SA 4B5VA 2YW4A 1PIFA 4PMZA 4H01A 3SQLA 1JAEA 3W7JA 2E9MA 3TSDA 1P4CA 2ZXBA 3WF0A 3P5ZA 2ZZ2A 1NOWA 4D71A 2X16A 1G9HA 1K6WA 2ZWZA 3LPGA 1AH0A 4EK7A 4ZR8A 3IV8A 3UWUA 3EWYA 2V6AA 3DFNA 1PBGA 3AIVA 2F2KA 3W7LA 3I7SA 3LHUA 2HE8A 1KR1A 3CAKA 2OQHA 1K9FA 1BVZA 1OFAA 1WZMA 1UMLA 4J35A 7A3HA 1S1RA 5H6HA 4GXPA 4F0SA 2NUWA 4B5XA 2JBMA 3ITCA 4RPPA 2D0FA 5LKYA 3LI0A 5D9OA 1XYFA 3ERPA 1P6BA 2OFJA 1Z44A 1FHLA 2ZZ1A 4PC8A 2BHYA 3P81A 3SUUA 3PZMA 1RJQA 3ANUA 3OU8A 1OIMA 4ZO8A 2DZXA 3NQCA 2VEPA 3GW3A 4IIDA 3BMWA 3S1VA 4UTMA 2J8GA 4URIA 3BWWA 5DBTA 3QV6A 4AWSA 4DJFC 1VFUA 1DIKA 3QYQA 1J18A 1TPVA 4CN6A 2OZ3A 2VR5A 3XINA 5BW6A 2QIIA 3UNTA 2OZ8A 2PUZA 4Q7NA 3NZQA 4IMDA 4JIPA 1GVQA 3C61A 4FXFA 4OV9A 3EPMA 1PX4A 4XVDA 4HQVA 5REQB 4QQ3A 4XD5A 2WM1A 1Q4WA 3LERA 1I9CB 3PF3A 3B05A 1CLVA 2HVMA 3DECA 3TYCA 3VGEA 1WDRA 3GNXA 4GCAA 4JX5A 3W71A 5HNNA 1Q13A 3OHIA 3MV11 1OCNA 1GONA 3VIKA 3H24A 3WK2A 2PP0A 3ZO9A 3AFBA 2C1HA 4G8TA 1W6TA 3VKKA 1JL8A 1XSKA 3B8UA 4QAWA 3ABQA 1MZRA 4F79A 3BAJA 3RX2A 3DHPA 1OX4B 3UCQA 5BWFA 1JYVA 2PGRA 1K8CA 4MWAD 1UKPA 2TSYA 3FVMA 1UR9A 2ZDRA 3PZOA 1O5XA 3EA3A 3L4WA 1SVDA 4BJHA 1VYRA 4JCMA 5LIYX 1YXCA 1V4YA 3VYLA 4IJRA 3B0UX 4XO7A 1TPC1 5AYZA 2BXYA 2PTDA 1CIUA 4K8HA 1NQ6A 3BDKA 3VD4A 2W9MA 3KRUA 4M7TA 2BXVA 1IWAA 4UUIA 3QQWA 5AC7A 3CK5A 4Q22A 3HGRA 1Y8BA 1HGWA 3N2MA 5A6AA 1HJXA 4GPNA 3B3DA 4P7OA 3C56A 1Y5VA 3P60A 3BO9A 3EGJA 3VKAA 2YIHA 3DHFA 3LM3A 4WK9A 4AIEA 3GG1A 1W1A1 4JEQA 2HDJA 1P48A 1FQ0A 2FB3A 4DWSD 4LEQA 1ICPA 1T0OA 1QNPA 4BFAA 5E9XA 2CBUA 1OWQA 3NEVA 4KFOA 2EHHA 4L65A 2FZ9A 5HQEA 2PDPA 3O6DA 2BOFX 3UJRA 4LAUA 3TZFA 4LUJA 3G1SA 3A24A 3OYZA 3H2OA 1TPEA 4PMNA 1TB3A 4XD3A 4H8VA 4M5PA 3Q4DA 5FEXA 4GYPA 3P61A 4LY4A 4PODA 1NWRA 3U8GA 3OB8A 3LGDA 4IMFA 2PDLA 3WQVA 3QF0A 1ICQA 1A5AA 3ELFA 4IPIA 1A4MA 5I02A 4CCZA 1QASA 2HK0A 2J79A 1PHWA 2IPWA 1O68A 3HV8A 1A49A 1SZGA 4UTFA 4K38A 3C2EA 4J4KA 3LHYA 3QHNA 5REQA 2FVLA 3AS3A 4UTLA 1M65A 2PWGA 1TJ1A 1WBJA 3BLKA 3W7QA 3GRIA 3WY1A 5I3DA 3DIPA 4UTKA 4NILA 2NUYA 3N9KA 1Q6EA 1KWKA 4PA8A 4UTWC 4P7NA 5FJOA 3AJ7A 3NVDA 4QCEA 4HNVA 4FZIA 1H5VA 1OF8A 3DUGA 2V3FA 1I45A 3CAWA 3ATYA 3GZAA 2G5WA 5DCDA 4C6NA 1TTIA 2IXUA 1GW1A 1TJ2A 4B5UA 3LTSA 2Y63A 2XH7A 3DFTA 1U30A 1EP2A 1JDDA 3RR4A 4HPGA 1XP3A 3VIIA 5PTDA 2OLSA 2HBVA 4GIYA 3T2OA 3PBUA 3RDKA 2DSKA 2VGGA 4MWAC 5HINA 3VA8A 1QPNA 3EEGA 1BD0A 3JZEA 1A3XA 3SADA 4OVXA 2VC9A 4D6HA 4C6FA 3IIVA 3MV01 3T42A 3VX0A 1Q8AA 1KFEA 3M5ZA 4I5XA 1ICSA 4DYJA 4M6QA 1Y7VA 3L5AA 4FLQA 1SYTA 3TX9A 4IMCA 2Z1BA 1DWHM 3GXFA 1MQPA 1IZCA 2ZC8A 1A0EA 1SR9A 1B5TA 3N11A 3WLRA 5CCZA 2WHJA 1P43A 1OK4A 2JQXA 1GVFA 2PF0A 2ISSA 3H54A 1ITXA 1QR7A 2WMHA 4FMVA 2I9UA 1DBTA 4C5YA 1GEQA 2BFGA 3AIQA 3AIBA 2PMQA 1XLMA 2OZ0A 3WD3A 1G4SA 4DPQA 3G6LA 1FHUA 2QIWA 4M6PA 4Q6XA 2ZA1A 3OZOA 1Q65A 1RPKA 1U1UA 4MOZA 4DWSC 1MUMA 2GQ8A 1I2NA 2A4AA 3W1PA 5D9MA 5A94A 2Y4SA 5AVNA 2VRKA 1IHIA 3WMBA 2QVNA 1BGAA 1JG9A 1DQUA 2ZE0A 3EPNA 4MZYA 5CSUA 3WF2A 3FJNA 4PN2A 1LRNA 2FHFA 5JH1A 4B90A 2PP3A 3W7EA 4I5RA 4UFKA 3R10A 2OKOA 3BJSA 2NQJA 4I9AA 3FA3A 3EB2A 2WANA 1NWTA 3RYSA 3Q2DA 3WSUA 2QUUA 1GCYA 1LM1A 3PWAA 1K8YA 4WSHA 4W8BA 3JW7A 1FH8A 4BWLA 5CSRA 1JCYA 1QJWA 3UW6A 3O6AA 3NQBA 5FJRA 1EDQA 1NY1A 1YPIA 3IIXA 5CSYA 4O13A 2WPBA 1EYEA 4RR4A 2CITA 5FJPA 4FXRA 1F3TA 4ZZ9A 1BRLB 1K8XA 3GNOA 4M0XA 3V7PA 4WLCA 4HYRA 3EBVA 3PBGA 2WVUA 3BPWA 3S47A 4D72A 4QG6A 3LCFA 2PU1A 3I68A 1FWAC 2QUTA 2JKPA 3RFAA 4JFWA 4H9XA 1ZY9A 1RV8A 2J8FA 4XISA 1HO1A 4GHRA 5GNZA 4MB5A 3CO4A 1CGWA 4I9MA 3KRSA 5I00A 7REQB 4I90A 4O57A 4UQ9A 4RCXA 1CNVA 2E0PA 3RUBL 4DXVA 3IACA 2W66A 3MP4A 4WGXA 3ZSSA 4O1DA 3WJZA 1WKDA 3F2BA 1L8NA 4PBGA 4O19A 4GUIA 5G1YA 4FIRA 2P10A 3DXIA 2FVMA 4ZXLA 2Y24A 1E4LA 4C65A 2G41A 5EMYA 1OGSA 2OT0A 1H63A 4MFDA 1TV7A 4GUHA 1FP8A 4QITA 4OOZA 2Z2UA 1V0NA 1FWGC 1GOXA 1UCWA 4JICA 3TE9A 1X1NA 1CENA 3W23A 3CPGA 4S3AA 3HQNA 3BW4A 2BHZA 2WOQA 3TLQA 2B7PA 2ZZ5A 1GQNA 1D3HA 3KLKA 1W54A 4DUXA 1X1OA 2DORA 3AJXA 4BS0A 3AXHA 4YHGA 3G1DA 1NWSA 5C7HA 4IIEA 1VYPX 1DP0A 3A12A 2Y70A 1JNDA 4LAMA 3WQOA 2Z6IA 3KTXA 4XZBA 5A6MA 2IMRA 3BE7A 4LUIA 5XIMA 1FWNA 1UPMB 6TIMA 1DL3A 3TMQA 4L9ZA 2E25A 1YQ2A 2FDMA 4PYSA 4S39A 4J3UA 2WVTA 4UTJA 2PE4A 3B8VA 1WQ5A 3L4ZA 4O8RA 3ABSA 4DO6A 1YW1A 1S39A 4MWAE 5CC7A 1L6SA 2B7OA 4J7RA 4S3EA 3JUGA 3URBA 3VKCA 5AVHA 3F1QA 2V5DA 1W9XA 2QJMA 1F2JA 1VIZA 2YL6A 3TU9A 2HBXA 2GVJA 4JFVA 5DO8A 1EA9C 1VCGA 3MMUA 2O55A 4H00A 3ZR4A 3VM7A 1PB0A 1RH9A 5DCEA 2NXHA 3L12A 5DT5A 1OD8A 1ZSXA 3WUFA 4I8YA 3URQA 4C7DA 4L5ZA 2OEKA 1VFFA 3KM8A 3N6QA 1FDYA 4OECA 2A5HA 4H7VA 1F5ZA 2WWDA 3KOFA 3GS6A 1YX1A 5IRPA 3LCHA 4XAYA 3LTYA 2WMIB 5GJPA 3S5SA 1GQJA 1TRDA 4XZNX 3GG8A 4MFEA 3TCSA 3WDQA 1MI3A 4X60A 2ZUTA 2PSNA 1QHOA 4HJFA 1Q6GA 8TIMA 4XUGA 3NZ1A 4MPKA 1NARA 1BLIA 4ZQNA 3T8LA 2Z27A 4GX8A 1XYLA 4WJEA 3FCPA 3UNDA 2D2OA 1JF6A 2VFGA 3U57A 1X8CA 3REQA 2DIKA 2DZUA 2F6XA 1H4PA 1MW1A 2WHMA 1KM0A 2YW3A 1XYZA 2L5HA 4LYQA 4G56A 2D0HA 4U3AA 3WNPA 4JIIX 1F74A 4QG9A 4G2DA 2A3CA 2VO5A 2HXUA 2V5LA 2EKGA 2W5FA 2D2GA 4KS0A 1XQKA 3PJUA 4PBFA 1TZ9A 4XB3A 2NQLA 4A3QA 4HTBA 2ZX9A 3VDCA 2WB5A 4Y96A 1NJJA 1YE4A 3EOUA 1EGMA 1H1YA 3LV6A 1UYQA 5F7UA 3BLDA 2MUCA 4AEEA 1F6KA 2G3FA 3GW0A 1AVAA 1JQXA 1A5OC 3MKKA 3N73A 2NVDA 1PZ3A 1YEYA 2PURA 1IEXA 1S3HA 2CERA 3L4TA 5EMLA 2PDJA 4KFNA 3WDRA 4HPXA 3N29A 1FWCC 4R88A 1RCQA 1TELA 1VFMA 2ZUNA 8A3HA 1ZCCA 3LDVA 3UY7A 1YTKA 1ZLPA 3GHUA 1US2A 2C71A 1DWIM 1J0HA 5H1WA 1IT7A 3K8MA 4E2BA 1LLZA 1GPWA 1WKEA 3W0KA 1FRBA 3BL3A 2X1SA 3EZ4A 4HN8A 3AROA 1H5YA 4F40A 3GD6A 2X1RA 1XBZA 4G5DA 3WQWA 2WC7A 2XN0A 2G3NA 4MY1A 4RZ4A 4PB5A 3DN5A 3KOZA 4Y9NA 4R33A 5LHFA 4KF1A 1VPXA 4PUWA 1M7OA 2V38A 1OB0A 2C79A 4WKFA 3CC1A 3SRKA 2WJZA 1R46A 1WUFA 5I2UA 4YJ5A 1Y65A 3B9EA 4EXQA 2OSWA 1E55A 1R3YA 2X42A 3DZ1A 1MSSA 5C7VA 3IJ8A 1R9XA 3L4XA 3ARUA 4AWTA 3U2OA 3UBPC 3VNZA 3H2AA 5CXPA 2IQDA 3GNPA 1Q63A 3AXKA 1XYAA 2CLHA 1IR2A 3E0IA 1F6PA 4RNHA 1RALA 1W8GA 3NQ7A 1W9UA 4V2XA 1R8LA 2JK2A 2Y8UA 4W8AA 4Y9OA 1UD4A 4O50A 4N9BA 1XLKA 2OYLA 2WMIA 2PTWA 1ONWA 3SGUA 4HNTA 3OLDA 3UZZA 3LBMA 1B57A 1EIXA 4PRWA 2BASA 3N2OA 4GZEA 2AQOA 2NSOA 3USZA 3BLFA 2J7BA 4LOCA 3D6NA 1P6WA 4O1CA 3SURA 1OFQA 4FALA 1EZWA 4DLFA 3UESA 1VC4A 5A8GA 4GFIA 3N9RA 4NQ1A 2HCVA 2IPJA 4Z2LA 4HPNA 2PAJA 4Q33A 4YU1A 5DXXA 2RKXA 3UG3A 3EDEA 2VQTA 1UBPC 1C92A 2OB3A 4KWVA 9RUBA 4CQ9A 1FXPA 4QLLA 1C9DA 3MMTA 3QV8A 2GOKA 4GJJA 4IWWA 3OLIA 3NL5A 2DT3A 4WJXA 1E71M 1XINA 4MGGA 3C52A 1GJPA 2Q6ZA 2E5BA 3CZJA 3R89A 1RQBA 5FEWA 3CZ8A 3UF9A 1REQA 3UT0A 3I6TA 2C13A 3BAIA 3F4CA 1JCLA 4GBDA 2VXNA 5E9AA 5H8UA 3H2CA 1KD0A 1E9ZB 2XINA 3ES7A 1FP9A 3FFSA 3ARVA 1EXBA 1XI3A 5D37A 3O6CA 3BOFA 2W63A 3A4WA 4KERA 1VEPA 3UYIA 2CLFA 4R85A 1HNYA 4WSJA 2TMDA 3JRKA 3IUIA 3ITYA 4QX4A 1W17A 1CW2A 4LEFA 4BY3A 1CYGA 3U4FA 3NOEA 1XUUA 2DJLA 3TH6A 2WNQA 4EWND 2Z1WA 3M0MA 4ML9A 3R0KA 3UJEA 5AC4A 3FA5A 1QBAA 4S3GA 3AXMA 5DLCA 3RXZA 1E0WA 2PZ0A 3KCOA 4QSHA 4RZ5A 3R1ZA 3SGZA 3QV9A 1YTDA 1FA2A 2J75A 2GL5A 4XAZA 4Z2IA 4LAOA 3MI2A 2O9OA 4PZVA 1DQXA 1C8VA 2GWGA 3PSWA 2E68A 3IK4A 4LWWA 2R24A 1RBLA 4C6OA 6CGTA 5D38A 4W5ZA 1UIPA 1ZAIA 4UMAA 1JVNA 1G1YA 4DO4A 1NDZA 2GPTA 1ENUA 3BG9A 4IZGA 2OR2A 1JD7A 2OEMA 2A3BA 3BSGA 1A5SA 4TTGA 1XKYA 3NQVA 5K9DA 1XR2A 2I1OA 5KETA 1R3SA 1GOQA 4C6DA 4KRUA 5DBUA 2E3ZA 3ZLFA 3WL0A 1RVKA 1UD8A 1W3KA 3L7RA 4H1ZA 3KDOA 3EOEA 1PUDA 2XSAA 2ZUWA 2VFIA 5C2GA 2P50A 1XDMA 4GG9A 1H7PA 3LLXA 4JOMA 4M29A 4H4IA 7TIMA 4S3CA 3N2BA 3AUOA 4D8ZA 3UZXA 4RDYA 1QPKA 4Q7BA 3QKZA 3M0JA 1DJYA 1HJSA 3R2GA 3ONBA 3MMWA 1JCNA 4ROPA 4S23A 3VXGA 2H3DA 1EX1A 1UP0A 1DIDA 3UA3A 3ALGA 3NTYA 1A4LA 1SO4A 4ZL1A 2DV0A 5TQLA 2VD8A 5LIXX 3PTKA 4QIUA 3ES8A 4GOAA 3W76A 5CPOA 1UUMA 3A9BA 3MANA 3MKCA 3VGDA 4GMEA 1TQXA 1FCBA 1OX5A 3K4DA 1QFEA 4M6VA 4XKYB 1SM9A 4LRSA 3T08A 4NZ3A 1KXVA 3GXDA 3GXPA 1GVSA 3TJXA 1CTNA 3TROA 1ZAJA 3RCNA 3ZIZA 3W86A 4ZODA 1TV2A 1CXHA 1NFPA 5HXMA 1H0IA 4V28A 4Z1AA 2PDWA 4TOQA 1MFUA 2I5GA 2QR6A 4GVHA 3S4TA 3SJNA 3KTCA 5FL0A 4MDOA 3SSJA 1RJPA 1EF2A 1YLVA 3WNMA 4J3TA 4KWUA 4ORIA 3C2FA 4REQB 1NIUA 1UZ4A 3FAXA 1XIDA 3H22A 1O1HA 4DJDA 5C9UA 3P8JA 3OVRA 3WJYA 5CSSA 1V02A 1OYAA 3KBSA 4K6AA 3PJXA 1O7AA 1KBBA 4HZ7A 2BY0A 2QQ6A 1KFBA 4YL2A 2CNCA 3L4VA 4ZOEA 2XDFA 3NEHA 3WLTA 1W3IA 3FYYA 1BTCA 3R5EA 3M5VA 3RJXA 2QCNA 1VFHA 1HF6A 5A6KA 1S5VA 1ONXA 4FNTA 4DBSA 3KW3A 1TWZA 1R3QA 1UKQA 3TOPA 3HA1A 2A6LA 5EMKA 4DM2A 3M43A 2HZGA 2Y8VA 4LX4A 1X7FA 1MDRA 2YCEA 3NM3A 1NP2A 3N13A 2HNHA 4RZBA 5HPOA 3LI1A 3POCA 3G0SA 3KP0A 3LCIA 3AHYA 1KXQA 3DCPA 3QMTA 1K4GA 4WUIA 3CUGA 1B4KA 1ITCA 7PTDA 3AO0A 4PMXA 2CYGA 1PAMA 2ZADA 3HU7A 3ZM8A 1GHSA 1H1NA 5HMDA 2DQWA 4HZMA 5DEZA 1EUNA 4M82A 3R4IA 1V0LA 3GB6A 3P8IA 4IUGA 1B31A 3C2YA 1PZ0A 4WKAA 3BSHA 3I65A 4Q7IA 4XO6A 1K03A 4NXSA 5CH9A 3CT7A 5M1TA 3VFCA 2QAFA 4G7FA 3K13A 3M4HA 3WJXA 1ISZA 4A2RA 3AS2A 3AIEA 3WZ0E 5IFTA 4R5EA 4LBRA 3S3GA 3PNUA 4FNRA 4EF9A 3HIJA 5LGZA 4HA1A 4LYPA 1F8IA 3LGGA 3O0KA 3UXDA 3DC0A 1GOMA 3TQ0A 1Q8JA 3GH7A 3UP8A 3CUXA 5MF5A 4XZWA 3DFHA 3SIMA 4PE8A 4AU0A 4TR9A 5GNYA 2ZRYA 4H8HA 4DWDA 3LTPA 2QGHA 3R8HA 3LU2A 1GK8A 5C9ZA 2QCCA 1OFRA 1R6WA 3TIMA 5LHEA 4TX8A 2BZNA 5I24A 3U9IA 4NUWA 1QBBA 2BDQA 1XLHA 3NIYA 3I4EA 4O1AA 5C2CA 1EGVA 1HFBA 5BXTA 2E5CA 4BR1A 1BFNA 1RSCA 2ZA2A 2BVWA 1P0DA 1HKVA 3C86A 2PCQA 3U2EA 1F61A 4MTVA 1JFXA 5K7JA 3NQ6A 2QVHA 2J7CA 4GLEA 1KA9F 1K9DA 3CHEA 1CGYA 4LVFA 3TW7A 3EX1A 2YXGA 5FOOA 4BHYA 1ECQA 2V3EA 2CZDA 1UKOA 1DPMA 3PWGA 4S38A 4QP0A 3LZ3A 1VENA 3W7HA 5LNVA 4BZYA 3QXBA 3BGJA 4AD2A 2NQ9A 3MCOA 3BLIA 4N9EA 1DWAM 5I23A 3W7RA 3H7VA 4C6JA 2CU0A 3OEXA 2CLLA 5KZMA 1HGYA 1V6YA 1PTGA 3OLEA 3WQFA 1V7YA 4EE9A 2WC4A 2XZ7A 3TJ4A 3GYCA 1LRQA 5I09A 3L67A 2NXGA 1XL9A 4KEZA 4WX2A 3VIHA 5T26A 1B90A 3FAWA 4ONVA 5I3IA 3DC8A 2PFHA 4BQ4A 1LLOA 4AF0A 4LALA 2B81A 4KWOA 4YYFA 1GHRA 3W7OA 1RK6A 4R34A 2P53A 3DKJA 1O60A 4JTAA 1FWSA 1PYFA 3T0DA 1UD3A 2VTFA 2Q8LA 1WCGA 1BYDA 3GUWA 2ZVIA 2WMKA 3R94A 4EX4A 1KBKA 2V2CA 2QNEA 3W26A 4GYPC 4GABA 3W53A 1QHPA 1R9ZA 4LVDA 1EJ7L 2IUZA 4QR6A 4PTXA 5HMFA 5CBJA 4RE0A 3BQ5A 4FK9A 1GJWA 1UP2A 3XIMA 5CC6A 4CCDA 4QLKA 3QR1A 2DUXA 1POKA 4JTFA 3WNNA 2ANUA 1XIEA 3E6EA 3K1GA 1Y5XA 3ZJ7A 3VE9A 3W1MA 3CQHA 1XKJA 1BTMA 3K1DA 3T2QA 5LA0A 4WDWA 3WLNA 1PWMA 3GC5A 3KE0A 4JTUA 2DZPA 1C90A 3N4FA 2EBNA 4QDPA 3RMJA 3LMZA 2E6DA 1N8FA 4I9TA 1H7OA 1TPUA 2DEPA 3NCOA 2I9EA 2X05A 4H8NA 1YYAA 1D7FA 2YXXA 2HWGA 4C91A 4LJ3A 1GW9A 3L4YA 3PNZA 3M07A 4B4HA 1NSJA 3LN3A 1ESWA 3T9PA 3ARRA 4F0LA 4YIWA 4F8XA 4WRHA 2QF7A 4O54A 2JKEA 1HJWA 1JDCA 3HTWA 1XQLA 4UZUA 1J10A 2BVYA 4LS0A 2EG7A 5A8MA 3VMPA 1BYAA 4BQ2A 1OGGA 2JF6A 4W7VA 5IBXA 1KRBC 1KLZA 1T7LA 2R1PA 4JTRA 4IICA 1A5NC 3CL6A 4N2YA 1THFD 4WOZA 4BF9A 2ABBA 3M6YA 1E1CB 1FH9A 5H8MA 3VDGA 3NDZA 3EX4A 3RLGA 7TAAA 1O94A 4E8CA 4ZO6A 2WZHA 5DMNA 1VHCA 3NYZA 1AA1B 3N1AA 2F8QA 5EKYA 1YDOA 2PD9A 1M53A 1J01A 3PZTA 5FJTA 5I3KA 1RP8A 3AALA 4NAEA 4ZB5A 2XVGA 3EKGA 3WKZA 1IXOA 1KGWA 1OCJA 2QJJA 1XIIA 4CN1A 3SCPA 7ENLA 2VFHA 1OFOA 4GE8A 4CNTA 1XBXA 1Y5WA 5HQMA 3WELA 5LIUX 1F8MA 2WLZA 4EIVA 3N14A 4C6EA 2EJAA 5MHBA 1RLDA 1B3YA 4UQDA 4KGLA 4MYAA 3IJLA 2DGAA 1BWVA 1XYMA 5M2FX 3B40A 1E6RA 2QUMA 2OKTA 4PSPA 3ZQ9A 2WBGA 3DERA 1XGZA 3VCRA 1PWLA 2WSRA 1UR4A 4UZSA 1S46A 1SO5A 4MWAB 1XHGA 3T0CA 1JI1A 5HWNA 1UA7A 2W62A 4JQAA 5HOSA 2XJ7A 1PSCA 1CEOA 1AQMA 4DHGA 2WBKA 4NAFB 4KBXA 3NGJA 2OYMA 3W02A 4GI8A 1VRDA 3VD5A 2Q01A 4HT3A 3TTQA 3CV6A 4BWLC 3DBNA 2R1MA 4JTEA 1NDVA 1ONEA 3GTIA 2E7FA 1GVYA 3V5FA 1R9YA 4HZ8A 5TAOA 3T0TA 4LUSA 2YBTA 3K4AA 2A3EA 3SCVA 4KQNA 1DORA 2XZ9A 3WLLA 1TUXA 4MB1A 1CWYA 4O1FA 1QI2A 3Q94A 2Y62A 3N3MA 1NFGA 4AD5A 2V8ZA 2DH3A 4DBUA 3SO7A 1JZ2A 3ZWSA 2E6FA 1YDNA 1I4NA 1Z7AA 2J7EA 1CI1A 1GUVA 2YYUA 1X6NA 2E77A 1Q6FA 1E3XA 3W28A 4I7VA 4DWSB 3CEPA 3VGHA 2J77A 4AEOA 4GYKA 3DYMA 3E2VA 3S5NA 3RO6A 2OU4A 3CLMA 2VEMA 1NVMA 4V33A 3COTA 3RR1A 1G0CA 1QNSA 2E8YA 3T05A 1CT5A 3PAJA 3FJ6A 1S2UA 3OG2A 4MUZA 4AVFA 3A6OA 1CPUA 1MXGA 1VEMA 4IGSA 4PUKA 4QFUA 4X61A 3E9AA 2OGYA 1E1CA 4S2BA 1HN1A 1LG2A 4O1BA 3MUCA 2DQXA 4JFSA 3UYCA 4RW5A 3DESA 1U1JA 1SO6A 2AMGA 3LV5A 4PUMA 1S5MA 2VEFA 3A3XA 4GZIA 1HG3A 2F2HA 4RDVA 3VK5A 1PDZA 4PTNA 3AI0A 4WOQA 4OGZA 3W6MA 5IXEA 5LIWX 3OZMA 2VEIA 2H8ZA 3KL0A 4IQEA 4AQLA 3QZAA 1TVPA 3GXTA 4RPQA 1DJHA 4FP1A 4ERIA 1Z42A 3NM1A 1WNOA 1HJUA 2ZUVA 3RNDA 3W7IA 1XH1A 2Z1VA 5BOEA 4K2SA 3A4JA 1FXQA 1MWOA 3W27A 2WW5A 4OWGA 2HISA 3QLLA 3LHZA 4POCA 2PDIA 1IYXA 3WN6A 3CLWA 1PCWA 4CVUA 3P93A 4CU7A 4IQDA 1AQHA 1JIBA 3GSMA 3UXAA 1Z89A 3O63A 5HQLA 2XIIA 4KH2A 4IIGA 2W67A 5E5CA 1FWJC 4HVXA 2WHLA 1I6NA 2FZNA 3IIOA 3SCSA 3P3BA 3CUJA 3SUVA 4AZBA 3WDHA 3E2RA 2E1WA 4NAFA 2B7NA 1C7SA 3H6OA 4C1NB 1WE5A 4RE4A 3W1NA 4C60A 3AUJA 1SSDA 2XGBA 2CWNA 2A1YA 3O9NA 3UWEA 4WHBA 3EPOA 4ILSA 1RXOB 1WXYA 1PKYA 1AL8A 1ADDA 1HT6A 1TFVA 3G18A 5LXEA 3CBWA 1SZEA 3S2MA 2FGZA 1BQCA 5D2TA 1TMHA 3CZGA 1NF0A 2PCEA 1XDLA 3EX2A 1MNZA 1T8XA 1OBAA 3W2NA 3CASA 4QSFA 1IXPA 2EJ1A 2DSUA 3S1XA 2YLLA 4IT1A 4HN4A 4QS6A 1MW2A 3PUDA 1EHAA 2YBVA 4PUDA 5LGXA 3IAQA 4D6JA 1QPRA 4Z2HA 3ANYA 4FF5A 1D7KA 1G7UA 3GTFA 3RLUA 4O11A 3SB0A 2O0TA 1ALDA 1I0BA 4D6CA 4YTRA 2Z7KA 1YBQB 1LCOA 1LYXA 4XUYA 4NP7A 1UQYA 1Z9AA 1IZJA 4HNCA 2NX9A 2O92A 4GH3A 2FZ8A 4KKXA 4FX8A 4PR4A 1C91A 3F2DA 3F2CA 1P6CA 3E0VA 4KPLA 1XRVA 2CPUA 4WD0A 1EJUC 4HCHA 4JYFA 3NFUA 3W85A 2PDYA 4F9JA 1M03A 1Q45A 3UG5A 1KGXA 2AL1A 3MA8A 1J93A 1G01A 3J7HA 1FCUA 4L4LA 1IE7C 4RXFA 3AZTA 1K9EA 1LWIA 4L56A 4J28A 3FNDA 1EF3A 3UQNA 5XIAA 3M0LA 3ATZA 1GZ1A 3HQPA 1G5AA 3PUOA 4X22A 9XIMA 1VCVA 3VUPA 2E8ZA 4BI5A 3WFAA 3ARSA 2ALRA 2CLOA 5D2WA 4B5SA 1L2UA 4H9UA 4UR7A 2D2JA 3ZJKA 2Y6ZA 3O1NA 4I7WA 2J7FA 4HB7A 2YCJA 4Y2WA 1XYCA 3TKFA 4F0RA 4EPKA 4HKPA 2ISVA 4Q4QA 2YCLB 2WCAA 1CLKA 3N04A 3CPUA 4US5D 2PD5A 5CPQA 1IEWA 2WV8A 3B4UA 1LG1A 1T99A 3CEUA 2X40A 5CJ5A 4GFSA 1ITUA 3RMEA 1IXQA 2DU2A 1V77A 4C6MA 2P0IA 4A8LA 5D02A 2W0UA 3UZWA 4HOZA 1L8PA 4JTIA 1XD0A 1LT8A 2O4MA 2VNCA 2BODX 3B9OA 5T9CE 1I2RA 4P8VA 2OYKA 4FPSA 2H9AA 4NYYA 3PM6A 8XIAA 4IX2A 1K77A 3KZPA 1H50A 5AHIA 2CLKA 2QEZA 4UNKA 4YHEA 1UWIA 3M46A 1PZ1A 4DELA 4NJKA 2PBOA 2GVEA 4A4AA 3LQLA 1EBHA 1P1MA 1FWEC 4HK5A 3P62A 2DDXA 3SQSA 1EJTC 1KTBA 2NT0A 4H2HA 4P5UA 1VLIA 1IEQA 2INZA 2QCGA 1UR0A 3HPSA 3SCQA 3LEPA 1CGXA 5T9BG 3LBCA 5CPTA 5D9NA 1YBQA 4AIOA 2REQB 1A5CA 4TUFA 4B2DA 2JIEA 1JZ7A 1W1YA 1CGVA 1TV5A 1LWHA 2X0YA 3AYVA 3ARYA 5L9FA 2W79A 3CZLA 5RUBA 2I17A 1LF1A 3AOFA 4A8NA 4HGXA 2IKJA 5FI8A 3TJIA 1GOWA 4JDYA 1FOBA 2SFPA 2YSWA 3CO8A 1CB7B 4R7OA 1DYSA 4XG1A 4QJ4B 5LNRA 3S9YA 1AJZA 1YNPA 4NVTA 4K3ZA 4EPBC 3GTHA 3W87A 4N6EA 3GWQA 4XD4A 4M24A 4PMYA 5CGQA 4KW2A 4B4FA 1FFQA 1KTNA 3TTOA 5TIMA 3OPSA 3WQ8A 1H49A 1UJQA 4J27A 3VCCA 2J7DA 4UNIA 4UBPC 2F7FA 4W8LA 4I5UA 1SJDA 3D5HA 4ZSUA 3BH4A 3TW6A 1OFBA 1XLFA 5FIPA 3THAA 4E8DA 1JUKA 3L4UA 1KFJA 2G37A 2CW6A 1POJA 4QLJA 2RJGA 1ECEA 3PBVA 4OKDA 5K2ZA 1AW2A 4H8UA 1IXNA 3PZNA 3WMLA 3HZ3A 4A8IA 2BNJA 5FSDC 2O7SA 3S1GA 4DJDD 1P0BA 6XIMA 5BU9A 2HV5A 5I0DA 4XWUA 3M0YA 4O53A 5C9WA 3WLHA 4B3ZA 4CD6A 4E38A 3W00A 2QHAA 4JS3A 3FLUA 1J11A 1XPYA 3STPA 4WVXA 3CYJA 1LTDA 3WK0A 4XAFA 4O8AA 1SJCA 4M7SA 4UCFA 4NKCA 2BY1A 4IJCA 4I6VA 1B3OA 5IM51 1YKWA 2PTYA 1CXLA 4AYSA 1GVIA 3O8AA 3E2SA 4A8RA 2A3HA 4I6KA 3WLSA 3I6EA 2CESA 2Z2BA 5ABEA 4K8EA 3VM5A 1B3ZA 3VNYA 1CXKA 2J9ZA 4Y6GA 3AS0A 2FIQA 1EEXA 1E6QM 4KCWA 1BAGA 1UR3M 1J5TA 3LCXA 1K6AA 3TN5A 4D8AA 4ZQOA 4JY8A 1TJPA 5AB3A 2DIJA 1RVGA 2OZTA 4Z17A 5EYWA 3C3UA 2NLIA 3UJFA 4ZQMA 1VR6A 1MEWA 1GOKA 1KV5A 4ZO9A 1QTWA 4Q4RA 2CXEA 1ZP4A 1QWGA 1T8QA 3SAZA 1Z41A 5DY3A 1QK0A 2YA2A 1DOSA 2V69A 3DFQA 2WJEA 4IUOA 3RPDA 4NL1A 1Q7MA 3KOYA 5IHRA 3K8KA 4MNLA 1LLWA 3ZVHB 2V63A 3UR5A 1Q6LA 1I2PA 3CNYA 1OZQA 1SPQA 3WBYA 1DJQA 1SUXA 1YMYA 1WXZA 4IL0A 3NL6A 5BMWA 1UWSA 4XAPA 4QJ5B 3GX9A 3M16A 2A7PA 1JULA 4MVAA 4DIAA 1TRIA 4G1NA 4TV6A 1SSGA 4DLMA 4Q4KA 4LRTA 4DM1A 3CAQA 4OOUA 4U4MA 3MO4A<