2YCLB

Complete structure of the corrinoid,iron-sulfur protein including the n-terminal domain with a 4fe-4s cluster
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
309
structure length
309
Chain Sequence
AVEVLKEKWNSKVVEVTLGTGDKTVTLGGDSTLPFLTFEGEMPNPPRFALEVFDTPPTDWPDILVEPFKDVINDPVAWAKKCVEYGADIVALRLVSAHPDGQNRSGAELAEVCKAVADAIDVPLMIIGCGVEEKDAEIFPVIGEALSGRNCLLSSATKDNYKPIVATCMVHGHSVVASAPLDINLSKQLNIMIMEMNLAPNRIIMDPLIGALGYGIEYSYSIIERMRLGALTGDKILAMPVVCFIGQEAWKAKEAKDPEVAEWGDYALRAIHWETVTTVALIQAGGHLFVMRHPKSLAEVKEHLKRILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Electron and Methyl-Group Transfer in a Methyltransferase System Operating in the Reductive Acetyl-Coa Pathway
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Transferase
molecule keywords CARBON MONOXIDE DEHYDROGENASE CORRINOID/IRON-SULFUR PROTEIN,
total genus 101
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03599 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 2yclB01
1Q7MA 4NHVA 2E7FA 2YCLA 4MWAA 4MWAC 4O1EA 2H9AA 3H22A 3H2OA 4D9PA 4C1NB 4CCZA 1Q85A 4S3CA 4HB7A 4NILA 4DJFC 2DZBA 4DJFA 3TYUA 1TWWA 2VEFA 4D8ZA 4DJEA 4DJDC 4MWAD 4S3BA 4S3EA 3MCNA 3H2EA 3H24A 3TYZA 3TZNA 2VP8A 1AJ0A 4DAFA 4DJDA 1Q8JA 3TYDA 4S38A 3H2FA 3MCMA 3H2AA 3TYCA 3H2CA 2DZAA 2DQWA 3H21A 2OGYA 1AJZA 3H23A 1Q7QA 1EYEA 3NOYA 4NL1A 4S3AA 3H2NA 4C1NA 1Q7ZA 3TYBA 4PZVA 4DJEC 1AD1A 2Y5SA 3K13A 3TYEA 2YCLB 4DJED 3TYAA 1TX0A 4S23A 1AD4A 4DB7A 3TZFA 4D8AA 4DAIA 3V5OA 2VEGA 4MWAE 2H9AB 1Q8AA 2YCJA 3H26A 4MWAB 5JQ9A 1F6YA 4S3DA 2YCIX 4O0QA 3BOFA 1AJ2A 2Y5JA 3H2MA 4O1FA 2BMBA 1TX2A 4G9PA 4S3FA 1TWZA 2YCKX 4DJDD 4NIRA 2Y0FA 3MCOA 1TWSA 3BOLA 4S39A 4DJFD 3TR9A
chains in the Genus database with same CATH superfamily
1ICSA 2VRKA 3KHDA 3R58A 4HD5A 3ZOAA 3BLEA 1J6OA 1FTXA 4PMUA 3OEXA 3S2JA 3AAMA 3VKAA 4XAZA 2ZZ7A 3S42A 2J6XA 4LB4A 1Q2RA 3UJEA 4AEOA 1US2A 3QV6A 1FCQA 5HUOA 4H9TA 4YYCA 3E9AA 1ZUAX 3BW4A 1VEOA 3DZ1A 1EZWA 1QATA 2JIEA 1YDYA 2G3MA 4P7NA 3GDMA 2DVXA 3GKAA 3C2VA 3RF9A 3SSZA 1O7AA 4B5WA 1CI1A 1P1MA 2CWNA 3EA2A 4JIEA 2PLKA 1EPXA 4J35A 2BDQA 1YPXA 5CPSA 2QEZA 3OG3A 4HJWA 4B16A 2J27A 3QMRA 3M9YA 5C2GA 6ENLA 4JTTA 5T9BG 1EWDA 1JPMA 4N9EA 3H4XA 5REQB 1XBVA 1CBGA 1EP3A 5C5YA 3UJFA 1PCKA 1KV8A 1TWZA 1HUVA 4E8CA 1OFDA 4GABA 2ZA3A 2UBPC 2VNCA 3N2CA 1WDWA 3BOLA 4UUIA 1LL7A 2TRSA 1R8LA 4OOUA 4Y9PA 4UTTA 3C0JA 2PBOA 3W00A 3QTPA 3GZ3A 5DEZA 1EJWC 1QMLA 2DZBA 3P0XA 1UWIA 3RAOA 1NELA 4XZHA 2RAGA 1DWGM 1OGGA 1ITXA 1PKYA 4QS6A 3UWWA 2GPTA 2OU4A 2GQAA 1YTKA 3MBFA 3T6CA 1VPYA 1EO7A 4C5YA 1POJA 3H24A 3GRIA 1XYBA 1PX8A 3IAPA 1X7FA 3PB2A 1W2PA 4Z2JA 3T8LA 2IXVA 3RILA 3WFAA 4J2PA 1AJZA 5DMMA 4M7TA 4GH1A 3M0ZA 4JTFA 4QSFA 4HK7A 2V6AA 4F0RA 3E6EA 3Q45A 2VEKA 2ISDA 4PMJA 3BARA 1HKMA 3EWUA 1PVNA 3N6HA 2FB2A 2XG9A 4ACZA 4QJ1A 3IIZA 3BLFA 5D32A 3ITTA 1BWLA 3GSMA 4OU1A 4ERAA 1RJRA 3GS6A 2XUCA 2X0YA 3L2MA 3E5PA 2BOGX 1R6WA 4UQDA 4WJXA 3EB2A 1XIIA 4GQQA 1OZMA 4TO8A 4L9XA 4LX4A 2XIOA 3K4AA 1W5PA 2FVMA 2PBGA 3N2OA 3NAVA 6PTDA 2I57A 2Z1XA 2OELA 4RUBA 5BZAA 1BWKA 1QASA 3MC5A 2PD9A 1TRDA 1UG6A 3QOKA 1H63A 3DI1A 1GVYA 3RYSA 2IUZA 3EKLA 4XZMX 1DJGA 3MZ2A 2J75A 3VD7A 2A7NA 4O53A 1JGIA 3MCNA 4IMAA 1C7SA 3EOOA 3HJZA 4D6JA 2ALDA 2ZDSA 2QCLA 1R3SA 2ZBTA 2Q09A 4MM1A 3TKFA 2VM8A 4I6KA 5DN1A 4M82A 4MPQA 2C18A 3SCSA 4QLJA 1UD6A 4RV3A 1I2QA 1LWIA 2DW7A 3TYEA 2Q01A 2UY3A 1PWMA 2CBUA 3LMZA 3CH0A 3OLIA 5LNWA 2C79A 1PSCA 1CLVA 4Z2KA 3AWNA 3LDVA 3WNNA 2NSXA 5I3GA 1O5XA 3AUOA 2Z28A 3RFAA 5AECA 3MKCA 2E1WA 5CAKA 4W8LA 5AHNA 2I1OA 4XBJA 1XYMA 4RV8A 1DXIA 3EKGA 2VR4A 5LIKX 2Z1WA 3IGHX 2FVLA 1MZRA 3AIVA 4WJEA 5AN7A 5C0QA 2NQLA 1DHPA 3TIMA 1K1DA 4HU4A 1XXXA 3M0JA 4LY4A 3NPXA 3WLSA 2Z29A 3W7QA 4XV0A 4ZOEA 4G7FA 1A4MA 3BZGA 1M7OA 3GVGA 7A3HA 2V5BA 1IT7A 4L7ZA 2C6QA 3G5EA 2ALRA 4U3AA 4EIVA 3CHCA 5ABTA 1XRFA 2DIEA 2OJPA 3QC3A 3WLOA 5A69A 2Y24A 1XLFA 3VDGA 3BJTA 3QHOA 1PO9A 1S46A 4D2JA 3UG4A 3FAXA 1GKQA 2Z0IA 3QF0A 2O7QA 4JEQA 2RGMA 2PU1A 1T8XA 2VL4A 3CUGA 1S5TA 1GOXA 3PJTA 2OKOA 3K8LA 4AYGA 1KA9F 2VGGA 1N7KA 1SZEA 2YA1A 1LBFA 4LFYA 1X98A 3GXNA 4XZBA 1E9IA 3B03A 3P5ZA 2ATMA 4G9PA 2DSWA 1XH0A 8XIAA 3RMJA 2I5IA 1SFJA 5HNNA 5DCEA 1MO0A 3CLWA 4JAWA 5LHEA 1I1XA 4AXKA 2VI0A 4F0MA 4WGHA 2H9AA 1TVLA 5D30A 1OQFA 4MZYA 1L6YA 1BXCA 4UQBA 3GXMA 1IR2A 2NLYA 2I9UA 2ZX7A 1XI3A 1QPOA 3AROA 1CXFA 4UQ9A 2DZPA 1G0CA 3CTTA 3I65A 1Q6LA 4ROPA 1I0DA 4S38A 3VNKA 3I3BA 1KXTA 3ABZA 3BLIA 1B3ZA 3H12A 2ZVIA 4DWDA 3DGBA 3H23A 1ZS2A 2W66A 2AMGA 2XIQA 1QPRA 1FHDA 2GL5A 1H09A 2CLKA 4MJ4A 3N04A 2PRLA 1XIDA 5JVLA 4Q8OA 3NQCA 1B9BA 1IIGA 3TVAA 2VGFA 5GJPA 1SMDA 1H7WA 5C2XA 1JPIA 1O66A 1WDRA 1PKMA 1XIFA 2VVNA 4E8DA 2D2OA 2ZZ1A 2V2HA 1V7YA 5HANA 2ZRUA 1WOAA 2HXTA 4MWAE 7REQA 3L23A 1K02A 3RDKA 1R2TA 4K36A 2VRJA 4FNPA 1EKOA 4DX3A 4M6VA 2X16A 3UCCA 5GNZA 2Y62A 2GVJA 3S6TA 4J3VA 3CPUA 4AZIA 4H8VA 5HJYA 4H41A 2PC4A 4PMXA 3ARZA 1QBAA 4HSHA 3MTWA 4EE9A 3NXLA 1VHCA 3GG1A 5EFDA 3V18A 1ONEA 3MYOA 3E0IA 1HTIA 3GIPA 1KXVA 3AJ7A 3MHGA 3PVFA 1X1NA 4MHBA 3H22A 4B3ZA 2X0HA 1GT8A 2YBVA 4CCDA 3THDA 1UHVA 4DJFC 3H4GA 2ACUA 1H7NA 5AHIA 2W4XA 1UP2A 1VBHA 1BAGA 1CGYA 2GUUA 4NJGA 3RX4A 1XW8A 3GR4A 4QS5A 3VU2A 4L6DA 3FAWA 3VZYA 1R9YA 2BV9A 3S46A 4ZVJA 4OE7A 2INZA 4XZNX 2OXNA 3G2GA 1KW1A 3LBCA 1SR9A 1M3UA 1NP2A 3KTCA 4HGXA 3T40A 3M64A 3OHIA 2J4GA 4EF8A 1F2JA 1LORA 2J7FA 4JN8A 1E6NA 4IFOA 4KPLA 2CLOA 1BYBA 1GUVA 3PHAA 4RZ5A 3EWCA 3GG7A 3LCLA 4KFPA 5KINA 3NVDA 3ZVIA 2VZUA 2HISA 2PDBA 1DIKA 1G6CA 3CB8A 3UY8A 4HVXA 1TMLA 3CAKA 2O9OA 3G1AA 3W1XA 1KO0A 1ME9A 4O1FA 3FDKA 2GWGA 5F1UA 2FZ8A 1FH9A 1G1YA 4U31A 5FF0A 2NVAA 3YPIA 4GUHA 1SJAA 2QAPA 2E9LA 3ZLHA 4V2XA 3O05A 4IH3A 4E2VA 4FLSA 1WP6A 3BG9A 4HN8A 1QVBA 3CT7A 3PUEA 4JFSA 4C7DA 3DYOA 3DKJA 1TWWA 2PB1A 2PAJA 1C93A 4ORIA 5D4YA 4MAVA 1VFOA 3IJ7A 3CYVA 5K4ZA 4H2HA 4XKYA 1L6WA 1OF8A 1HW6A 2BBFA 4QE5A 3W81A 3D3FA 1QAPA 3G0SA 1YADA 1TV3A 1E3XA 1VZWA 3C4UA 3PZ9A 4JHOA 3VD9A 4L9YA 3GDBA 1EQCA 3O3RA 2PEVA 4GA8A 1S3HA 3QC0A 4XIAA 2B31A 1SQ7A 1OYCA 2PDUA 3RN6A 2ACQA 3W83A 3BICA 1TZZA 1RK6A 1UIPA 3WQPA 3O1NA 5DMNA 3TONA 1E6RA 5F4XA 5D33A 4IQLA 2A79A 4WSKA 4KIRA 3NO5A 2VFFA 4IX0A 2ZRXA 1VFFA 3ES8A 4S3DA 2YCIX 4WK9A 3TTSA 3M0XA 3DFOA 1NWSA 3B3DA 3OP2A 4OHQA 1EQPA 1RCOB 2DSVA 3L4VA 4RCXA 3DHDA 3QSRA 4M3PA 4KEUA 3D47A 3W1AA 3LTYA 3EGJA 4QQ3A 3VIMA 2DSKA 2P50A 2F6KA 3H2OA 1WDSA 5HQLA 1YLVA 2OX4A 1PBGA 4JZ5A 3O8AA 4DM2A 1O12A 4W9TA 3TSDA 5A6SA 1XC6A 2KZHA 4MDOA 3DUGA 5E1QA 1W0MA 4ML4A 4HYRA 4PSRA 2R24A 3GUGA 1E51A 3DC8A 4Q3MA 2RDXA 3S4TA 4WRHA 1IWBA 4RZ6A 1BQGA 4Q6JA 1EYEA 3PZUA 4ZGYA 3DGRA 3BGJA 3GAKA 3HQNA 3TXVA 2QF8A 2AQWA 4LB3A 4LYRA 3HPFA 3CQ0A 4X2RA 4TX9A 3FV9A 3STPA 4AIBA 4D6FA 3ZWTA 3CV2A 1UOZA 4Q32A 5FL1A 3SJNA 4XAFA 5DELA 1S2CA 1UZDA 4M19A 2B0MA 4P8UA 3VZXA 2OEJA 3LBMA 3WNMA 4Q8UA 3V5CA 1IR1A 2WMJA 4GMEA 2XVPA 4PRTA 4IG2A 1D9EA 3KUMA 4J3SA 2PF0A 1DVJA 2BVWA 4OOZA 3BLLA 4IGSA 3N6JA 5I00A 2Y2WA 4LSBA 4FHAA 2V3FA 3N18A 1WAUA 2CLIA 2Z6JA 2R14A 4L4PA 1D3GA 3BLOA 4CD8A 4AWUA 5BRPA 3QM3A 2YR1A 3WDRA 4L4MA 4ZCWA 2A3HA 5EA9A 1VFLA 5JIPA 4K1WA 4BQ5A 3WDJA 1MMFA 2MANA 3MCMA 1KB3A 2J13A 3IVUA 3BLKA 3DU0A 4FIRA 1XX1A 1OEPA 2PPGA 2IPJA 2WSYA 2AL1A 4NNAA 1ONWA 2ACSA 1A49A 2XH2A 3NL5A 3M5YA 3P0WA 3DFNA 1VB9A 1SZNA 2E3ZA 4I9JA 1PV8A 4C1LA 4JXCA 2EKCA 3EXRA 2ZX5A 4EXQA 2Y61A 1FH7A 4AHQA 2X05A 3KL5A 2GUBA 3VNLA 1V6UA 3ZLFA 3SJ3A 3FJLA 1EJXC 3UETA 3ITVA 8A3HA 2HS8A 1CX9A 4FMVA 1IZJA 3TLLA 3EX4A 1VF8A 2DY3A 3W25A 1KCLA 5HJLA 3P81A 5KZEA 2NQZA 3AXXA 3SCVA 4GE8A 4DWSB 3QY6A 4UC5A 4LVFA 1GNXA 3QTGA 2YX0A 3AYVA 1PKLA 1WX0A 3EEZA 3UEQA 4UTWA 1RVKA 4MYAA 3SRHA 1ENUA 1AK5A 2OLAA 1W6TA 3T0BA 3PBGA 1H2JA 4CNPA 3CUHA 3S5NA 4L5ZA 3HV9A 2VD8A 9RUBA 2QNEA 1LOQA 2QJMA 5G4EA 3ABSA 4MSSA 5LA0A 8RUCA 3ARVA 3D3AA 1EDGA 2DT2A 5AHMA 3NJ3A 3QGAC 1RY8A 5J5RA 1CGVA 3ZXWA 1DJWA 1ZB5A 2O92A 4J27A 1FWIC 2EPKX 3MMTA 1YXYA 2FJUB 3QMSA 2KX9A 4LUIA 1SO5A 5M2FX 3GM8A 1LJYA 3PBYA 3STCA 4HSNA 1T5AA 2PGFA 5M17A 1FHUA 3VK5A 1U1HA 4P7RA 2BMBA 4D72A 4XX6A 2FFIA 4N42A 4GO9A 2QCFA 3CUXA 1E9LA 3MUCA 1FCVA 3GFXA 1UWRA 3V16A 4MLRA 4IPIA 2X30A 3GXTA 3W86A 3M47A 3N4AA 3WBXA 1TMQA 2O7SA 5XIMA 3CEPA 3W7DA 1MDLA 5IM51 1CWYA 1QNRA 2WZTA 3C8FA 4XBSA 1KXHA 3VYLA 4H6KA 2H3BA 3W27A 2CYGA 3QZ6A 4LBRA 2D0HA 1Q3NA 1JIBA 3ECQA 3B8TA 3VC5A 1YNQA 3K2GA 4N7QA 4B90A 5LXEA 4XISA 1YXCA 1V6TA 3V7PA 4ZTXA 4PBGA 4Q8VA 1XDLA 2R1MA 1ELSA 3SCUA 3L0GA 2C3ZA 4DLMA 3MBDA 3WX7A 5E9AA 1SU5A 3Q65A 4HPHA 1A5OC 3N2BA 2IS7A 1JCNA 4KCUA 1F73A 2BHUA 3BAJA 4JL2A 3SRDA 3ZJKA 1IGWA 3I10A 1WE5A 4GO8A 1V0KA 5H2ZA 1TREA 4DB7A 2WSKA 3WF2A 2HPIA 2AMXA 4LRTA 4CCCA 1FRBA 1MEHA 4AZ6A 5DY2A 3WLIA 4RPPA 3JRKA 1KFWA 1H7RA 3BOFA 4ZB2A 1X38A 1OG6A 1VCGA 1W1PA 2V5KA 1DEDA 4F66A 4KRUA 4GJJA 4KFNA 2WCGA 1FXQA 4QIUA 4I5RA 4DJFD 2VQUA 3C61A 1U22A 1Z42A 4H6RA 3UW6A 1VFTA 3GWQA 2W92A 1FVPA 4J1OA 4F2UA 1X7IA 2HTMA 3SGZA 2GOKA 1JYWA 2OWXA 3BGAA 3V1PA 4B15A 2BOFX 3LHWA 4AC1X 3PZGA 3WF3A 2EPMX 1UZHA 4DAFA 2WVVB 2BGQA 1XICA 3RX2A 3CWOX 2OX1A 4U3CA 4IQDA 1NEYA 4U2ZA 2BWGA 1GG1A 2Q8LA 4WVXA 4HK5A 1HGWA 1H1YA 5A6JA 3L5LA 1SZRA 1OINA 1I60A 5AHFA 4JTSA 3AQUA 1SVDA 3K46A 3QBUA 3MHUA 3MY9A 5BWAA 3ITOA 5FJRA 4E6MA 2FZDA 2E68A 2W3ZA 5AC5A 3U0HA 3JVAA 4E4FA 5I77A 1SFSA 1P0EA 3TMQA 2FDSA 3PBUA 3U7BA 4HA1A 3WQWA 2BVYA 2Z2AA 3KRZA 1YE6A 2WHJA 4GINA 3W82A 1BEUA 1BRLB 1AVAA 3VOJA 1NARA 3MCOA 3DFTA 1WB0A 3W7PA 3EB3A 2OSWA 4I9TA 1E6SM 4ZFCA 1D3CA 1PWLA 1FCBA 3IIXA 5CC7A 3BK0A 4ATLA 3PSVA 4YLWA 3LM7A 2C1GA 5E0KA 2VQTA 2J7BA 1YHTA 3MJMA 1HF6A 2XIBA 2R1KA 3EBVA 1JPDX 4IIFA 5TBOA 3TROA 1HJUA 3ANVA 2VFIA 1J4EA 5D38A 1TPDA 3KOYA 4IXHA 2XGIA 1S38A 2G3FA 2P88A 1BD0A 4WSJA 4IZGA 3ZJ8A 1Q6DA 2WHKA 3QQWA 3W1QA 3IWPA 2ZX9A 2DZAA 2C13A 3B9AA 2CESA 1VLWA 4PCTA 4AD5A 2R1LA 4GVGA 3AXHA 1T40A 3GW0A 1ZGDA 2D0FA 3G22A 4JIIX 1POKA 4XTIA 5TQLA 1Q6GA 4ENLA 3G1DA 4US5A 1MXDA 2ZKMX 5E6ZA 3DENA 2OPJA 3W7NA 4BY3A 3H7VA 1XFBA 2WC3A 4O15A 2CLLA 1NF0A 2VFHA 3PANA 3CO8A 3RO6A 4JTRA 3I7QA 1BXNA 5G4HC 2PDYA 3WLJA 1GHRA 4PTXA 1A5SA 3DDMA 3O16A 2QJHA 3CQJA 3PZQA 3H2MA 1REQA 2YDSA 2RHGA 4N6EA 4JPGA 4B5TA 1Q6FA 3WIJA 1LQ0A 1QNPA 5F2GA 1I2RA 3GXPA 2CFFA 3GHSA 4JTKA 4HZMA 4NAEB 1UMLA 3GXIA 1R2RA 1TPC1 3LLXA 3EOSA 4MWAA 2WNQA 2Z7GA 2GWNA 4RNHA 3M7SA 3AI0A 3UVIA 1O1HA 4UTHA 4KMQA 3B8WA 1WOBA 4DY1A 4GI9A 5H8PA 4XVDA 4AWSA 3O7UA 3HBLA 4AQLA 1F6PA 1V0LA 1F8MA 5HDRA 1MI3A 1MW3A 3W2MA 1UBSA 4ONVA 3GD6A 4KH2A 3THCA 1MYRA 1GOWA 3P2VA 3BSHA 2V3DA 1I75A 2W5FA 1LRNA 5U7SA 1UPMB 1JZ3A 1OK4A 3SO7A 3FJ6A 4Y2WA 3PWGA 1KM5A 1XLHA 1UROA 3LPFA 3LUTA 3OLDA 1MXSA 1RXOB 3T07A 3RHGA 1BXBA 1EH9A 1F07A 1W1IE 2V82A 3CXOA 2VVSA 4LOCA 3VKKA 3HQOA 4IPPA 3GR8A 4JTGA 1JGMA 3RR1A 3TZFA 2XVNA 3BUVA 1JFHA 3EOLA 1BVZA 2F84A 5I78A 3AMLA 4MG4A 3DFPA 4Q4QA 2GOUA 3LQLA 3IGSA 4IL0A 2OG9A 1GVFA 3SFKA 4CN1A 4ZQOA 1QBBA 3RUBL 1PDZA 1GYLA 1MNZA 4DNHA 1E1CA 3PAJA 2JALA 3K8KA 2AQOA 2QW5A 2WQDA 3FA3A 1K9EA 4U4MA 1XYCA 3PTDA 2AKZA 3TQVA 5AYXA 4FXFA 3L4XA 4A3RA 2NQHA 4I5XA 2P3ZA 1K03A 2AGKA 1OFEA 1QI0A 2ZRYA 5GJMA 1DE6A 2AGTA 1XM3A 2HE8A 2VWTA 2A4AA 1IF2A 4OUEA 3USZA 3R13A 4O8AA 1XQKA 3REQA 4C6MA 1XIEA 3L67A 3R4IA 5E93A 1F3WA 4IIEA 3LRMA 3E2SA 5D2WA 3P8IA 5A95A 4PMQA 1ZBCA 4J40A 1KGUA 4FI4A 4HYWA 1DWHM 3W1LA 1X6UA 4M1RA 4DUVA 4DZ5A 3KOZA 3N9SA 4R9OA 1R7AA 1YE4A 2OZ3A 1S5NA 3IAQA 2YB4A 1B3XA 2FB3A 2BGSA 1SMAA 3V35A 3C0QA 3CGTA 4RXGA 2J62A 2A3BA 3APGA 3KAOA 3TA6A 4A6GA 4K39A 2QQ6A 4ZSTA 1O94A 3IUHA 2GJRA 4BF5A 1TYGA 1FKWA 1OFBA 1E0TA 4ZOCA 2Y5JA 3UA4A 2FH6A 1Q2SA 4ZO7A 1QCWA 3TCSA 2ZTJA 3APTA 4L4LA 4AVNA 5IBXA 3RO8A 4O28A 1XYLA 3ZMRA 1NU5A 4A8LA 3NVTA 1L8NA 4JTEA 2CLMA 4E4PA 2ZFAA 3S1UA 4BK9A 3M16A 2FPVA 4KWVA 4GYPC 5GJNA 1X8FA 1S2UA 4NZ5A 4JTCA 4H6EA 3WH7A 3RG6A 3VCRA 2WLZA 3WMBA 5JMUA 2HRWA 3GVWA 3OBAA 4I7VA 1UMYA 1CLKA 1JZ4A 1YRRA 2BTMA 1JZ5A 3N17A 4HPJA 1JCTA 1SR0A 4B2DA 4KGJA 2QUUA 4WHBA 3T0CA 2E0PA 2OCZA 4FX6M 3H2AA 1MEIA 2PDFA 4DM1A 2OLHA 1KFCA 4GNKB 2EEXA 4KFOA 4C1NA 2NX9A 4AZGA 1ZRQA 2CXGA 3UPWA 3VNDA 4S3KA 3I6RA 3G0XA 5DMLA 4X2PA 1DWAM 3SECA 4WR3A 4OKDA 4GZJA 2Q02A 5KEZA 4GNJA 1A5UA 1HVQA 3KE0A 4EANA 1X6LA 2GYIA 2YCJA 4F8XA 2R82A 2B4GA 1HFBA 2EGZA 5JQ9A 4Q8TA 1PYMA 3CQIA 2I14A 5CH9A 3SCRA 3TQKA 3FW6A 1LLOA 3GX9A 1JF5A 1JNEA 2ZTKA 4ERGA 3T44A 4HCDA 5DANA 3TNBA 3SB0A 3VILA 4KCVA 4MKVA 3W87A 1CNVA 4M0XA 4DI9A 1NFBA 5IOBA 2WWDA 2JBMA 1HJWA 4O1EA 4RDVA 1EXBA 1XRTA 4MNLA 4Q4SA 1W3TA 1H62A 3JW7A 1XBYA 1PZ0A 5G2HA 2E4TA 3VDCA 3EOEA 3BLPX 3JS3A 3AIUA 2YB1A 3RJYA 3CB3A 2O55A 3WFZA 4L61A 4NJJA 4LJ3A 1UWAA 3QY8A 1N8FA 1FWDC 1CTNA 4NAFA 3GAYA 3M6DA 2PRMA 4PUUA 4FALA 1KFEA 4YXGA 5FF2A 2PD5A 2WB5A 4OVXA 5HMEA 4QAWA 1HX0A 4K7YA 4EOUA 2CBJA 4B91A 4PBFA 3NOYA 1DIDA 3K5XA 4GX9A 2X1UA 2GJNA 1FDZA 4GUIA 1G4SA 1DJQA 3B40A 4AUBA 1ODZA 3WLRA 1GZGA 2HK1A 3PUGA 1ML1A 1QJWA 4Q8NA 2QKFA 4R9XA 1SO6A 2XPKA 4JYFA 3S5ZA 3AXKA 3Q4DA 4YHEA 1O5KA 3QYQA 1E4MM 4YTSA 4HCLA 3B8VA 1WZKA 3II1A 2FMOA 1CDGA 4PEKA 3WLMA 4MUZA 2QLYA 3CZ8A 2CLHA 5ECVA 1OFQA 2PLJA 3W7EA 3CHFA 1W3IA 3NYZA 1BPLB 1LYXA 1Z89A 1MW2A 5DBTA 1BYDA 1PJ9A 2E8ZA 3R2GA 1O95A 4WF7A 3MSYA 3N25A 4YNGA 3G3DA 4B5SA 3PY2A 1O5RA 4ZA0A 3KWSA 4INFA 2XGBA 3TTQA 4C90A 2ZXDA 4Z1BA 1JDDA 3WQ8A 3MB9A 1HJQA 3D46A 4O50A 5D8ZA 3CTLA 4NXSA 3GDTA 3OA3A 5D2TA 1H7PA 3ID7A 4Z2IA 1VBRA 2WV8A 4XZWA 2AL2B 2JKPA 1QOPA 2DFAA 3UCDA 3F4DA 1BQCA 4FPSA 2QHAA 3IRDA 1ZP3A 3R0UA 1TJ1A 2FTWA 3O15A 1AL7A 4WD0A 3UXDA 2HXUA 4LAUA 4AIEA 1PEZA 2XH4A 3OB8A 1K9TA 5REQA 3O6DA 6REQB 4O0QA 3ATZA 1PX3A 3A21A 5IXEA 3N15A 1KTNA 2Y85A 2VZTA 1RJPA 4FNTA 4QDWA 4KIEA 4F0HA 3S2NA 4BI7A 3VIIA 4MFEA 1V7AA 2FZMA 2V3EA 2XHYA 5BXSA 2QPSA 1KBBA 1NP0A 3S1WA 4YIWA 1V6XA 3RLGA 1AUSL 3N4EA 2VEMA 3M0IA 4UQAA 3QHMA 1B4KA 5CPLA 5AFDA 2OTDA 4W5UA 4LUSA 4KT2A 2XYLA 4Z1CA 4Y8EA 3KP0A 1UCWA 1SYTA 3NPUA 3UZWA 3OGVA 4JCLA 2BNJA 1RBLA 1QW7A 3AHYA 5DQPA 1XD0A 4P5UA 3O2LA 1EF3A 1FCUA 1DV7A 4S3GA 2QJNA 3CWNA 4OGZA 1BTCA 1RPKA 1NQKA 2J25A 3F5KA 4NZFA 1OADA 1VJZA 4DBEA 4LANA 4RR4A 4GFIA 4HMEA 4DPPA 4H8HA 3LTPA 2VTFA 3CAQA 3LS9A 5XINA 2ZZ2A 5HULA 3PNZA 3EDDA 1K6WA 4Y7EA 4EXAA 1F8IA 2PI6A 4IPLA 3NFUA 5E5CA 2O4MA 3W7LA 4JFVA 3QR3A 1CW2A 4GXWA 3U7VA 2YSWA 2C8NA 4LF1A 1F7BA 3ZT6A 4D1JA 1TX2A 4WY0B 4P8WA 3DEQA 2NUWA 1W1B1 1ADDA 4L1XA 3VABA 2DJXA 3E96A 4IJRA 5CC6A 4FF5A 5U4NA 1PAMA 3UZ5A 3O0KA 4H9XA 1KR1A 2VGIA 2C1HA 2EG8A 3URNA 4EACA 2BZNA 2SFPA 1VR6A 4X3ZA 2GJXA 1FWGC 4MZ1A 1PTGA 4A2RA 2VGBA 3LENA 4XD6A 2ANUA 4AZCA 4R53A 4GIEA 1GHSA 3LY0A 5XIAA 3AUJA 1AJ0A 1VCVA 3HV8A 3W2JA 3CQHA 2PDIA 4Q8PA 3W24A 4HZ8A 5I6SA 5C9WA 5FACA 4LYPA 4BF9A 1XDMA 4GHRA 4ZB5A 4IQEA 4NQ1A 3PZOA 2EG7A 2IQDA 1DE5A 3OIHA 4H4IA 4M6UA 3GE7A 3G1HA 5D9NA 1UR8A 3LHUA 1K8YA 4PFHA 4RW5A 3VXGA 4QCEA 2Y1HA 1DKWA 2X7VA 4GQBA 3E5BA 4TUFA 4PUEA 1GTHA 2TMDA 3SY1A 2OZ0A 2CLEA 2Y6ZA 1P6CA 4X0VA 2O4QA 5D2XA 2CITA 1FHVA 3T4WA 2XSAA 1EHNA 3U2OA 3PS7A 4RJEA 2HROA 4ES4A 2XZ9A 3R10A 4PMVA 1ALDA 3W7HA 3DFSA 3G24A 3TU9A 2B7OA 4KEVA 5A8GA 1W9PA 3LHYA 3W2NA 1IV8A 4DPQA 2X2YA 1W5NA 3L21A 3VA8A 3TJ4A 3S6OA 3O0FA 3PUOA 3BOXA 1W5QA 1E5JA 2TODA 3THUA 1LG2A 4L9ZA 4JKKA 5HAOA 5DO8A 1OCBA 3RPTA 4D8LA 5FSEC 3LCWA 4PB3A 3QV7A 2FKPA 2Z2UA 4I9AA 1NWRA 3EX1A 5JBDA 1O68A 1WO2A 3ABXA 2VEIA 4JN7A 2PDNA 2XWEA 1YTDA 3IIOA 4IFKB 4UR8A 1Q6EA 3VFLA 3IV3A 3L65A 1CGXA 2C15A 1TWIA 4NNBA 3HQPA 1A47A 3ZVHB 5IFPA 1KM3A 1P0BA 5DLCA 1J11A 1RA5A 1QWKA 3OYZA 2YIHA 3BZJA 3NZGA 1EJSC 5B7ZA 4R7OA 4F0LA 2NVCA 1KV5A 1V3IA 5A8MA 4CD4A 2NSOA 4IPJA 3RJXA 1YQ2A 2HBXA 3E0FA 2PZNA 4TTUA 3HN3A 2MUCA 5IDIA 4DWSD 1ADSA 1HJSA 3NQAA 2WHLA 3AS3A 4PUNA 1AW1A 5CG0A 3IJLA 2DPEA 3TV8A 4US5D 4KWSA 4GC4A 3IACA 1UASA 3QZAA 4HHLA 2HK0A 5HMFA 4AY8A 1W5OA 2D20A 4DJEA 4Q4OA 4GI8A 3WJXA 4YPJA 2JIWA 4QEHA 3Q2DA 4WKAA 3R43A 5ABFB 1RK5A 3H2EA 2BGNE 1Q65A 1VEMA 3BAYA 3IARA 1A5CA 3R8GA 4DF1A 3WBAA 3HOJA 2WJDA 3LXBA 3O06A 1EF2A 3FJNA 4PYSA 4RK8A 3W76A 3MT1A 4ZXOA 1TA3B 3DG6A 4IP5A 3NO1A 1OGSA 4WDTA 2UV8G 1J0ZA 2PODA 4L4OA 1UP3A 4ICCX 1QNVA 3HA1A 3TE9A 3W73A 3WD4A 2V5DA 4JIHA 4IL2A 3UR5A 1R3WA 1T7LA 1XIHA 1TZ9A 2DW6A 4A8RA 4HT3A 3RMEA 3HPXA 4PL1A 2QIIA 4A3QA 1SUXA 2A6LA 1EDQA 2GJLA 4UXDA 4H9YA 1E55A 1VH7A 2O9RA 2WCSA 4LNYA 3OPSA 2Y8UA 3LQGA 1DXEA 4LAKA 3T2OA 2NX1A 3KZSA 4M6PA 4K6AA 3MI6A 1Q7MA 2OKTA 1GQJA 4D6CA 1U33A 2WANA 3SN0A 1KWKA 2J7CA 4HB7A 3GVRA 3A24A 3L7RA 2EG6A 5CGMA 3SUUA 1TJPA 1WPCA 1UJQA 4W4QA 3VOIA 4TMCA 2XDFA 4DO6A 2QV5A 3ARRA 1QNSA 4QE1A 3S1VA 4JIRA 3RK8A 2PWUA 1YNPA 2C91A 4OZOA 3EAUA 5AOUA 4DYEA 1DJIA 3QGVA 4NUWA 1DWJM 2G3IA 4IM4A 2E28A 5D9OA 4REQA 5A94A 4PMRA 1IGSA 4K1GA 4QX4A 2W67A 5FJOA 4MNJA 2QJJA 3NQVA 4QAIA 1TR9A 4ORMA 2ZRZA 4YTQA 4O1CA 5G1MA 5GNYA 1KKRA 1RLCL 3VPLA 3BC9A 4N02A 3N2TA 1TPB1 1EWEA 1I45A 2CEQA 4QP0A 4IT1A 4QG8A 1FP8A 3N11A 1F4AA 2DORA 1V3LA 1NFPA 4HYVA 2X1TA 3EPOA 3WF0A 4CU7A 1AQMA 2WVUA 4GVFA 2Y7EA 2Y89A 3RCYA 1I2OA 3PPFA 1XP3A 2IKJA 4XTDA 4JDBA 3LM3A 4OIFA 1OFRA 2VEPA 2QYGA 3W26A 3SCTA 1B3YA 1M1BA 3M0KA 1HP5A 3DHPA 3R0DA 4AY1A 4BHYA 5I09A 1TQJA 4DRSA 2PTDA 3VD3A 4JYDA 3TR9A 3CYJA 3AZSA 2ZZ5A 1QW8A 4D6IA 2DUAA 2Y7GA 4UTMA 4CVUA 4NILA 4AWEA 2QGHA 1U5JA 1S5MA 1LBMA 1G7UA 5G1YA 3MP3A 4UMAA 2VWSA 3UG5A 4KRZA 1MQPA 4W87A 3RCNA 5B80A 3UQNA 1X6NA 5GNXA 5HQMA 4GKLA 4R7JA 3A4JA 3BMXA 3GYEA 1EP1A 2BXZA 3VKDA 3GQYA 1K4GA 2BX7A 2ZXAA 1E4IA 3OZPA 3RM4A 4FA3A 3Q37A 1CGUA 3HIJA 1GJWA 3BDKA 1YW1A 3QQ1A 2CZ5A 4JTLA 4GD0A 2OGYA 1C92A 7TAAA 3LMYA 1O6IA 2VKZG 2OYKA 3MV11 1YDOA 5JH1A 3PFRA 4NYYA 1ZAHA 2Y7DA 4H8NA 3K1DA 5CBJA 4I7WA 1A53A 1XS2A 1UZ4A 4UFLA 1H51A 3PBMA 3NDYA 3SN1A 1ZFJA 5BW6A 4Z0JA 2FH8A 1CZ1A 3N3TA 3SN4A 1U83A 3UWZA 1WBJA 3MO4A 2HEJA 3NM3A 3PAOA 4AC7C 4LUTA 3VD5A 1PL9A 3F4VA 4MPKA 1M5WA 2OSYA 3QFWA 1KBLA 5I3HA 3UGRA 1VPXA 1NY1A 3RCMA 5AC8A 1PE1A 3OODA 2X1IA 6TIMA 1R3RA 4EP8C 4IICA 3MSDA 1D7KA 1E1FA 3WL0A 5LIXX 1NH6A 2X40A 3FVDA 4LCSA 4Q8QA 3VOFA 2A85A 4ZE4A 4HA3A 1UR1A 1KCKA 4BF7A 3FIGA 2Q3OA 3W7JA 1GWJA 3GG8A 3T0DA 4NZ3A 4B9YA 5KETA 1B90A 1B54A 4L56A 3M0YA 3LV6A 4ZOAA 2W91A 1GGOA 4QR6A 4AD4A 3WZ0E 2G4JA 3EKZA 3CU2A 3T78A 4DF2A 5L9FA 1W1ZA 1GVSA 1JEZA 2G8ZA 3NTYA 2F2HA 4AF0B 4PUKA 1JYNA 2VELA 4U33A 2TYSA 3WLHA 6CGTA 3CJPA 1O4UA 3CAWA 1ISVA 3PFMA 1TPWA 2WMIA 2I9EA 3F4CA 2EPOA 4ZR8A 3JR2A 4V33A 3SCPA 3WLLA 3ME3A 1XBXA 4AD0A 1G4EA 4UBPC 2NQJA 2V9DA 4UTUA 2OOGA 3W01A 4F40A 3T08A 3WUEA 5A6TC 4AEEA 3HFTA 1SJBA 2E09A 2GZXA 2YL8A 3T09A 5CG7A 7XIMA 2G37A 1Q6OA 3ANUA 2CZEA 5C2CA 2XH7A 3FYYA 3LBOA 4I6VA 4I8YA 5HXMA 1JG9A 3CH9A 2OFJA 3COTA 1DORA 2E7FA 4EKJA 3EYPA 1R46A 2R91A 5I3DA 1AW2A 1DYSA 1RAKA 1S5VA 5CPTA 4V28A 5D2YA 4WJ8A 3CV7A 4PTVA 4GISA 1VFMA 3TN4A 2CBVA 3HM7A 1W9DM 1W1TA 3TN5A 3WDQA 1GQLA 3QR0A 1P43A 4DI8A 3HZ3A 1KFKA 5CPMA 3OU8A 3TYZA 3FS2A 4IMEA 4FP1A 4V1YA 2VUYA 1QT1A 5EU9A 1I2NA 3LCHA 2QR6A 2RDWA 2OVLA 2B7QA 3KBMA 3HB9A 1LM1A 4WOZA 3W6MA 3AIWA 3LCGA 4OV4A 2J77A 3WK2A 2YA2A 4YCPA 1JF6A 4NYUA 1US3A 1UPPA 1WDQA 2PS2A 4Z08A 4QJ4B 1K3UA 3NQEA 4WGXA 2WMFA 5CLTA 3GH5A 1WKYA 3P60A 2GVGA 4KWOA 2QUTA 1JI1A 2YBUA 4GZIA 2R94A 3LK6A 1E9YB 4WY0A 1TV8A 2QV4A 5JH2A 4X0NA 4XKMA 3WYZA 4P8XA 4A3YA 3PJUA 3WQ5A 2F9RA 1E9ZB 1G67A 3WMSA 1Y5VA 3FKKA 2JEQA 1G69A 3E3HA 1A0CA 4BCEA 2FIQA 3UWYA 3LNPA 4IF2A 3MMWA 2J47A 4OUIA 3SW6A 1OWQA 1J01A 1EC8A 3BANA 1B3VA 4GC3A 5FF3A 3M41A 4LUYA 1VCFA 2VFDA 3KOFA 4S3CA 1M01A 5G5IA 1GW9A 2H3DA 3NG3A 3CV1A 5FF7A 3PWIA 4R7WA 1K70A 1RALA 4LBUA 2H8ZA 5BNKA 2NXIA 3KCJA 4UFIA 3NQFA 2DIJA 3UT0A 2POZA 3LNMA 3BW3A 2EHHA 5C6MA 3R79A 4LUSB 1LF1A 3L0KA 3NQ7A 3GC5A 3NL2A 5JBEA 2J24A 3WL1A 4FNSA 2VENA 4XQ6A 1C90A 3EWYA 3RU6A 3GH7A 3ATYA 2PWEA 4QDMA 2P5NA 1UH3A 3PPGA 2OGJA 1TPVA 3MP4A 4UFKA 5FJIA 1NDVA 3L4WA 4OFCA 3EWZA 3C2EA 4H1ZA 5BCAA 4ZO9A 4QTGA 2NT0A 5MKGA 3WD3A 4AB4A 2QCDA 1XSKA 4CD5A 5DFAA 3B0PA 4IG2B 3LI0A 1B1YA 2V67A 3WLQA 2VCCA 9XIAA 3LPPA 2YCKX 3SR7A 3URAA 3ARPA 3L2LA 1K7FA 2FHFA 3WH9A 2WM0A 4BZYA 3M43A 3KBVA 3GLCA 5D2VA 4GOAA 1EJRC 1E4NA 2XH0A 2PFHA 1OY0A 4Q33A 3FHAA 3ERPA 4J3UA 3UR7A 3WD2A 4DJFA 1E15A 1GPFA 4H9MA 3UWQA 2FYMA 1HKVA 4GGHA 3TC6A 5CLWA 2X1SA 1ECEA 3IIVA 4NU7A 3VM7A 4XD4A 4I90A 1EJ7L 3QFEA 3W53A 5FEPA 4HSOA 5DT7A 4I7UA 2FHBA 2DZWA 3HFYA 2OO6A 1SFLA 1ISXA 3QEZA 5AY7A 4QJ5B 1E4LA 2RFGA 3GDRA 1JAEA 1GG0A 1Z3NA 1A4LA 2Y4SA 1FWAC 4JBRA 4HU3A 3W29A 3P82A 9CGTA 1J5TA 2BHYA 4AVFA 2FPYA 2D22A 4ZZ9A 3GU9A 3NGJA 3FGCB 1VKFA 3IGUA 3LPGA 4L6HA 4MTVA 4B5VA 3A9IA 4MWAB 1E40A 3LLDA 1IWPA 3KL3A 4W89A 2F7FA 5ECUA 1IZCA 2JKAA 2QPXA 1ZJBA 1K9FA 2YZ5A 1AFSA 4TVDA 1U1JA 5CZSA 2AOSA 1QXLA 4DBSA 3CO4A 4PTDA 5HUPA 3KVLA 2RJHA 3RIKA 1V8EA 1R85A 1C29A 2XZ7A 4ZQMA 2YKKA 2WCAA 3WQDA 4XO6A 3IUDA 4GK8A 1IEQA 3W1MA 2WLYA 1V02A 4WEVX 5D03A 2QPUA 4BFAA 4AZ7A 2Z00A 2BG5A 2F38A 5I07A 1ZCOA 4REQB 3WDHA 3WEMA 3B9DA 4ATDA 4EK7A 1H50A 1UYQA 3T42A 2VUNA 4N4PA 4QDPA 3MP5A 1AMKA 3W1NA 4UZUA 4IIHA 5C71A 5H91A 3TTEA 3GNXA 1OD8A 4PH6A 1VFHA 4EF9A 2XN0A 3U4FA 1KCZA 1G94A 4M81A 1NFGA 3TQ0A 3KDNA 2CC0A 3BGGA 3DG7A 1FWTA 4LUJA 3WLTA 3A23A 2J9YA 5A6LA 1UUQA 4WSHA 5G4WA 3BVJA 5T91A 1G9HA 3W88A 1EZ2A 3ARQA 3QH2A 1YDNA 3MI3A 3TAKA 3ZM8A 2BFGA 1JYXA 1HO4A 1L2UA 4UCGA 3UBPC 3C2RA 3VDBA 4IJBA 1HKJA 4MDPA 4E38A 4XG1A 1TTQA 4KKXA 3CUIA 1NWTA 1V08A 1Z6KA 1F9CA 1JZ2A 3WJZA 2YJQA 2XIJA 4M5PA 3LHTA 3ES7A 1XYFA 5A8PA 3TOPA 1BKSA 1AZ2A 3QW3A 1SFTA 1TA3A 2OLSA 4YMZA 3FXYA 1EXPA 4HOZA 1BTMA 3ZLGA 1X39A 3AIQA 4JY8A 2YDRA 2YXGA 4WZHA 5G2IA 4E5TA 1M04A 3AMKA 3TFXA 2QJIA 4AIOA 4BWLA 5ABFA 1TPFA 4RE0A 4IQJA 3R1ZA 3TYCA 4CCEA 4PODA 3SRFA 1S1RA 1YNYA 2VFGA 3FDGA 4O1DA 3GHRA 4GX8A 1PZ3A 3TJXA 4TQTA 4Q4PA 1C9DA 1DWFM 2DU2A 2XVGA 3VE9A 2BODX 3W9ZA 5ABGA 3TYAA 3FLUA 1PHWA 4YL2A 5T26A 4K7VA 1B3WA 2ODOA 4M24A 4ICNA 3KWXA 4PRWA 4Z17A 1VP5A 2OB3A 2YXXA 1AQ0A 2EO7A 2VCBA 1F6YA 2XJ7A 2Q3RA 3ZIZA 5A1AA 2CCRA 2CZFA 1SSGA 4UFJA 4L1WA 2F6XA 2NXGA 3VUSA 4EPBC 2R1NA 4RE4A 3AU2A 5LXXA 1R9ZA 2IKGA 2OWCA 4YN5A 3W22A 3UXLA 1KNWA 4LGXA 4IMGA 4LVAA 1P6WA 2VR2A 4JR5A 1F5ZA 4LQ1A 1BKHA 2V38A 5CPQA 4HQVA 1KRCC 4HNOA 4HMCA 1TUXA 3OVRA 4IFKA 5EMUA 2WMKA 2WM1A 3LRLA 1RZMA 2FFCA 3WMLA 4F2TA 1ZY9A 3MDUA 3PTMA 1CYGA 3TFCA 3CT2A 1KLYA 5CC5A 3NDZA 2J9XA 4HK6A 3BE7A 4QM1A 3PNUA 4UTIA 4LAOA 4W5ZA 2XVLA 1Q8JA 4J7RA 4C60A 2ABBA 5D02A 1XLKA 5DBUA 2O0TA 1LCOA 3WBYA 3A9BA 3UR2A 3MUZ1 5EGRA 1R5YA 1SW7A 1ZENA 3QQ0A 4MGGA 1P1XA 4JQ3A 2C0HA 2ICSA 5IFTA 1MW0A 3TN6A 4YU1A 1GZ1A 3PB0A 4Q7NA 2VC9A 3KL0A 3NQGA 4JHZA 4Q22A 3RLVA 3WD1A 5J5DA 4QBXA 1NOWA 2H9AB 3KW3A 1M7JA 2PCQA 3LCFA 4OBTA 1FY6A 2HVMA 2PTYA 4WCJA 1UD3A 5CSSA 1JDAA 2JQXA 2HSAA 1R0MA 5EMYA 1V6VA 4O1AA 3H7UA 1UR0A 1BFNA 3GTFA 1SW0A 1VJSA 3DESA 3OA5A 3N2XA 1EA9C 1W1YA 1OC7A 4OBRA 1LROA 3F2DA 1R47A 3KTXA 3NURA 3UXAA 4ADUA 3S1GA 3NYDA 1WCGA 4JKMA 2ACRA 3GVQA 1DJHA 1LOLA 3A4XA 3NXFA 4AEFA 3ITCA 5DY3A 5CGTA 1CENA 2DH3A 1LG1A 1K4HA 2VDIA 8TIMA 1W9VA 2GQ9A 3V4BA 4GCAA 4GRSA 4YWIA 3BQ6A 4DUWA 4NSBA 3PZTA 2QDHA 5F2LA 5C7HA 1QI2A 1VYSX 4B92A 3A3HA 1XJBA 1OK6A 1SJDA 1T96A 4LS2A 2HMCA 2UZ9A 5JXQA 3WF1A 4O13A 1Q7ZA 4GCXA 3GC2A 3ABRA 4HCHA 1X1OA 1W56A 4U2YA 1W31A 5T9CE 1EX5A 4DELA 1D8WA 4CLMA 3MSGA 1I8JA 4QJ3B 3SAZA 3ZQ9A 1AD4A 1QU4A 2WYSA 3W74A 1A3HA 4HZ7A 4J4KA 3ZO9A 8XIMA 4CQCA 4DZIA 5CZKA 2J6VA 2Y8VA 4YWSA 3DBNA 3T0TA 3GIYA 5HWJA 3CZGA 4IISA 4F9JA 5FI8A 3TQPA 3NM1A 5AHEA 1PZ2A 5BROA 3HTWA 3C2YA 1OX4B 2C0AA 3BV7A 2CLPA 5K3VA 4FX7A 1GZJA 3IJ9A 2YW3A 4CN6A 1M41A 1RD5A 3PK7A 1NDYA 1FHLA 1HZYA 2VO5A 2D69A 4MWAC 1C3FA 4Z1AA 4L65A 1WXYA 4JTJA 4ZE5A 3HG5A 2QJGA 3R0KA 3MQTA 3QLDA 4PBEA 2JF7A 3KDOA 1J96A 1EHAA 2XINA 3L5AA 1JUKA 1L6SA 3IK2A 3TJIA 2CNCA 1X1ZA 4LF2A 4MUPA 1T0OA 3KLKA 2VDGA 4LCQA 2D24A 3S2LA 3KBNA 3Q67A 3C86A 3LHZA 4MLJA 5BU9A 3F7JA 1IEWA 1PPIA 3PBWA 3M5VA 2YL6A 3IVTA 2DQWA 1AZ1A 1KRAC 3G18A 4MADA 3TNOA 4Z42C 4DBDA 4B3LA 1PB0A 1UIOA 5KZ6A 3SDOA 1C91A 1IEIA 4NZCA 3K4DA 4EAYA 1EEXA 3OIXA 5K9XA 2WAGA 3HU7A 1TIMA 1ITQA 2HJPA 2DZTA 4DO5A 1EPVA 1P0NA 3JUGA 4KEZA 3GO2A 2E6AA 1FWRA 6REQA 3WQVA 3P3BA 2YGYA 2YW4A 1V03A 1LL6A 1PZ1A 2XN1A 4H9UA 1GVIA 1KRMA 3S47A 4GY1A 4BEUA 1LT7A 4AZBA 1DJYA 2CKRA 4BR1A 1H49A 1OYAA 3HJEA 4NNCA 1LWJA 3UF9A 3CPGA 1ZAJA 3MVTA 2NX3A 4AD3A 4GI6A 3IJQA 1EIXA 4OV9A 5C9RA 4LH8A 1SO3A 3T4CA 2A3LA 5FF4A 2P76A 3M0MA 1D3HA 2C14A 3EWWA 3S5SA 2C7FA 4MZ8A 1GQNA 1IXQA 3PG9A 1XPGA 2CXEA 2D73A 5BXTA 3P8JA 4HJFA 3R5EA 4S3AA 1Q13A 1HKKA 9XIMA 2E5BA 3TWAA 3UZZA 1UWUA 3AZTA 4HTYA 4O54A 5BU6A 2OQLA 4A22A 4ZQRA 3BMVA 2NZLA 5BMWA 3IK4A 1QPQA 3NO3A 2YA0A 3VGFA 3R8HA 4WIWA 2PTXA 1ZJHA 3T55A 1H7XA 4DAIA 1R38A 1KFJA 2VMFA 2A21A 1M7XA 3HURA 3NSNA 1EC7A 1XCFA 4OQVA 4LTSA 5LIWX 1LOSA 3ENLA 3NL3A 3W28A 3WNLA 5FEWA 1J9YA 1WKDA 2ZUVA 1A5NC 3F1QA 3VIPA 4ZEPA 3B0UX 4MY1A 3GNRA 3M5ZA 1GVQA 1UR4A 2WOQA 2ZYFA 4FEZA 1E0XA 4ZB0A 4Q8WA 3Q58A 4PMZA 3OGRA 2YCLA 4FAMA 3SUTA 1XDJA 1TV4A 4ATWA 5MHBA 3FY1A 4V27A 1JULA 4H00A 4CGTA 3U3HA 4D8ZA 3MJYA 4O0ZA 1MUCA 4MWAD 4GLEA 4CNNA 3E0LA 2WZHA 4NAFB 3BSMA 3LCIA 1ZLPA 4X60A 5AZ0A 3A5VA 3DECA 4A29A 3HG4A 4CNOA 3I7SA 2D23A 2QUVA 4W8BA 3UESA 5AYZA 1TSIA 1DJXA 1RR2A 4EWND 5BYWA 4IMDA 1NOFA 3QW4B 3K13A 4NI3A 5CBBA 3LXCA 4G7EB 3BMWA 4IPNB 2PLCA 4Y6GA 4RNFA 4W84A 1H0GA 3CLMA 5D37A 2HWGA 1VQTA 3KVKA 3L0NA 2PGWA 2FVKA 2XTKA 3PBVA 3WFLA 3DYMA 1G4TA 1HGYA 4ML9A 2PMQA 4O1BA 4JD4A 2WZMA 5EBAA 1RCXB 4RNJA 1F3TA 1UP0A 4B9ZA 4F2BA 2CIPA 3XINA 5ENLA 5AC4A 4UNKA 4ZSUA 3VKBA 2AAAA 3PZIA 1W91A 3G1SA 1QI4A 4WKFA 3FA4A 1W9XA 3KVMA 5EMJA 3I6EA 3FFSA 2IQ0A 3EWXA 3H8AA 1E70M 3WQ4A 1BG4A 4JTUA 4UMCA 3B0XA 3MA8A 4J5NA 4C1NB 3PC0A 1X8CA 2OT0A 2PWHA 4KETA 4FZIA 2VX5A 4W88A 4UNIA 5HMSA 4CQBA 1KBJA 4HA0A 1VBUA 4F79A 5HWNA 3KRUA 1ZNNA 3BAXA 3WO8A 1W1VA 5I03A 1V3JA 4UTJA 4OJYA 5AVNA 1P7TB 2HZGA 2VP8A 1Z9AA 1N8IA 1R3QA 4MNKA 4GY7A 3KVJA 4KCTA 3MDWA 3VX1A 4ZO6A 1RLDA 5AVHA 1MEWA 2Z2BA 4JIQA 2TSYA 3AWOA 2XIIA 4WXYA 3RLUA 3HF3A 1RVGA 2O56A 4PZVA 2HCVA 3NQDA 3W38A 2WMHA 3M4HA 1QPNA 4XIMA 3SADA 1ZCCA 2NUYA 4G1KA 5HNTA 3OQEA 4DJED 1IZKA 4M6QA 5F2IA 2I5GA 4QNWA 3GU1A 4M29A 3OZOA 2VJXA 5CC3A 3B97A 1GONA 2R9RA 3BAIA 5A6BD 4B2DD 1V79A 1C7TA 4J3WA 3ELFA 2E5DA 1OABA 2W63A 4G6CA 4RE3A 1K8XA 2ZA2A 1E6ZA 2XSXA 3BSGA 2RDUA 2XFRA 1FWHC 5LNSA 3M0VA 2Z25A 1A0EA 3STGA 1RSCA 1XIBA 2Y0FA 1XGDA 3B9OA 4GI4A 4HKPA 2X8RA 5FEZA 7TIMA 3FN9A 1A3WA 4H19A 2OR2A 5TF0A 1L2QA 1IXPA 1Q63A 3VI2A 5BXRA 5H1WA 2PP0A 1U1UA 1GYNA 1ZU8A 4DYKA 1UA3A 2EBNA 3B8DA 4GACA 4A3HA 1E43A 4XD3A 3W1UA 4A35A 4GY0A 4J9JA 2CWXA 1J18A 1ZHAA 2E5CA 2VXNA 5HMDA 3C52A 1HXJA 2P53A 4DJDA 3N2MA 3NUKA 5FJTA 3F5JA 2GK1B 3MWAA 1EJVC 2EPLX 1TTPA 2B7NA 3NA8A 4JTQA 1R3YA 1UD5A 4NL1A 2OZ8A 4KGLA 1XGEA 3WUFA 5M03A 4Y9OA 2VURA 4RXFA 5DXXA 2HBVA 2WKLA 3QKZA 3AIRA 3CZEA 4Q7BA 1JXKA 3VINA 1E1CB 3G6MA 1DTUA 3MWCA 3JZEA 1A5LC 2Z26A 4FXRA 3SM0A 4FK9A 3N12A 4UTWC 5LYRA 3LEPA 2QCEA 3V0SA 1WUFA 1J0KA 4P7OA 3HPZA 2TAAA 4B4FA 1VIZA 1XLJA 3PZVA 2UY2A 5EMMA 1ZSXA 1UB3A 3V36A 3MUY1 3MI2A 1W3JA 2PWFA 3AXMA 1F61A 1YKWA 5HR7A 4U5KA 3WDPP 3J7HA 1WZMA 2X2GA 3SQMA 5D05A 4S1FA 4GYJA 1OCQA 2WJFA 4S3JA 1FWJC 5FOOA 1L6GA 4FLRA 4M8UA 1XV8A 2MNRA 2REQA 4NJKA 3BJSA 1JL8A 1NSJA 3WENA 3NQ8A 1KRBC 3NEHA 3CMFA 2OYLA 4QG6A 3OG2A 1M68A 3IRSA 5FEXA 1KR0A 4HPGA 3HGJA 3NQ6A 3NZPA 4PMYA 2E77A 1XH2A 4GVIA 4ASTA 1B9ZA 2VDHA 4PSPA 1L8PA 4I8DA 4LAZA 1AW5A 3SURA 3G0UA 4P8VA 2F61A 4L64A 4KRTA 4X61A 4F0KA 4NKCA 3H26A 1QO2A 2TPSA 4MJZA 2PTZA 3OZYA 1SSDA 4H01A 3GHUA 2QF7A 1M65A 2RKXA 1M53A 4LPCA 5A2AA 5LIYX 2ZCGA 4HPNA 1DIOA 3QSTA 3CNYA 4DNMA 2WBGA 1T8QA 3U4AA 1U5VA 3MKVA 1FWBC 1MSSA 1N2VA 2D0GA 3AHZA 4CQAA 1W32A 3ZJ6A 5J04A 1J93A 4GXPA 4IWWA 4IP7A 4MY9A 1OT1A 1IXOA 3PP7A 3W0KA 4IGHA 2GDVA 2PGRA 4TV6A 3E2VA 4PUWA 4IX2A 1EEPA 3HPAA 3AZRA 4M56A 3GTHA 2VX6A 3LGGA 4ZENA 5MF5A 4G7EA 3EDFA 1DJZA 4W8AA 3SZ8A 3S2MA 4IP4A 2QCCA 1SZGA 2A3EA 1J0HA 3TH6A 4O52A 3ZFHA 3W1PA 3A13A 4MVAA 3FOKA 2PDHA 1XG3A 3AMDA 5I7GA 4C6QA 2ZC8A 3PR2A 3QXBA 3MU7A 3BQ5A 3C6CA 3VOCA 3EWBX 2DVUA 4W7UA 1YXDA 1K6AA 3CV6A 3I3EA 3HGSA 1QW9A 1CECA 1DHKA 1IEVA 3LXAA 3V1HA 1EB3A 1GJPA 1W8SA 1JNDA 2WSQA 4QCFA 3SUWA 1GYMA 1G5AA 3P67A 1E0UA 3FYOA 4KW2A 1XLMA 5RUBA 3M7WA 1OCJA 4H7CA 4HA4A 1SGJA 5FIPA 4KWUA 3S0CA 1S2VA 2ON3A 1FQ0A 3RRXA 3SRKA 1UKPA 1LBLA 3GYCA 4NF7A 1Q6RA 3BV4A 5CZTA 4H8UA 3IJIA 4KCWA 4DJDD 3A5FA 1QHZA 1R30A 1SM9A 1CXLA 1I6NA 1DP0A 1JCJA 1I0BA 1XL9A 1GK8A 1M9HA 4HNVA 4DBUA 3C56A 2ISWA 2WPGA 5GQBA 2WQPA 1HP4A 3VOGA 3GUWA 2YBTA 1VC4A 3RXZA 1XG4A 4XAPA 4P7LA 4O12A 3ITGA 4B5XA 3B4UA 1CGTA 1GQKA 1R2SA 2I5QA 3B0YA 1MUWA 3GNNA 4J3TA 2P0OA 2CHNA 2WXDM 3POHA 3OVPA 1ZPTA 3URQA 1Q4WA 4XAGA 2QVHA 3CZKA 2CHRA 4QHRA 5ABHA 1A0DA 1PKNA 3ZWSA 2NV2A 3NCOA 3QMTA 4EAMA 4XVEA 4C7FA 4C6PA 3TC7A 3NZRA 4L80A 3VCNA 2QDEA 5CGQA 1JFXA 2V5LA 3UZXA 3VGGA 1W37A 1FX6A 4DVOA 1R86A 3PTKA 4BWLC 2E6DA 4M80A 3UU0A 3B8UA 3QHNA 1XLBA 3BG3A 3K1GA 3TN3A 1OVDA 1XLGA 1FH8A 1RHCA 4ADSA 4URIA 2ZUUA 1Z48A 3ZYZA 3L66A 4X9SA 1V93A 3TSBA 5IRPA 3DOPA 3L2IA 3WJWA 4UR7A 5D09A 5FESA 1IIHA 2PDLA 1ZZMA 4XUYA 4G1NA 1H0IA 2G95A 1V0NA 2FDMA 3BCDA 3WBEA 2GQ3A 2P8BA 2ZUNA 2DZSA 2VOMA 3S9IA 3AC0A 3W1TA 4BQ4A 4F3HA 1HJVA 4JFUA 4WXZA 5KTLA 2WVSA 1HO1A 3UNTA 5IHRA 4JNYA 3VIGA 3EXTA 4FXSA 2ZICA 3WCZA 1EO5A 1V5XA 3CAVA 1GJUA 4EVZA 2HPMA 1R9XA 3AU6A 4LRSA 1JDCA 2YYUA 4JQAA 2BY0A 4HP5A 3EDKA 2QAFA 3W70A 2ZZ3A 5I3KA 4JHMA 3TEVA 4W7WA 1BG9A 2Z1BA 3WNPA 3CHEA 3E12A 3S5OA 1GOIA 2HVOA 1HVXA 1G4PA 2WSPA 1XYAA 3M44A 2DT3A 1JUBA 3O6YX 2IMRA 3IJ8A 3DI0A 4LV9A 2D2HA 1KCXA 3LGEA 1J2BA 3F5LA 1XSJA 5KZDA 1FWNA 4OTKA 4Z1YA 3P7YA 3ALGA 1XIGA 3G1VA 3VVGA 1QNQA 1UD4A 3SBFA 4MAZA 4DIAA 2OEKA 2JKEA 2VX4A 1S2AA 2X7WA 3TC3A 2DIKA 3DAQA 3KRSA 3UR8A 5LGZA 1E6XM 2IKHA 3EPNA 3VMNA 3GTNA 4UQCA 4HPXA 3I4EA 2V68A 3UJSA 1HL8A 1V3HA 3KRBA 1FBAA 4AAJA 4S3BA 5A8NA 4QEEA 3MVIA 4CD6A 3JZUA 1QK0A 1XH1A 2PDXA 3ICJA 3LZ3A 1ECQA 1TE1A 4LWWA 4AH7A 1PDYA 3GDKA 4JTIA 3RR4A 2WWCA 2FZ9A 3MO7A 2P8CA 2E9MA 3T9PA 7ODCA 3BXWA 2J7GA 3ORWA 4PL2A 2D2GA 2XWDA 3TYBA 1VD6A 1VFSA 2WPBA 4FR1A 3UD6A 4E8GA 4WDXA 4DO7A 3M46A 4US6A 4PCFA 4QXIA 2PP3A 3VO0A 2VC7A 1CB2A 4AHOA 1KGXA 3C8NA 3UXKA 1ESWA 4GZ7A 1L6FA 1K7XA 3SIMA 6A3HA 3HGRA 3PSWA 2ZUMA 1XCXA 3N1AA 5HQEA 4B5NA 2BY3A 1GW1A 2EPHA 2WJEA 2E67A 4HNUA 1KC7A 4IUGA 4RZBA 3CL8A 4LS1A 3RM9A 3VZZA 1E6PA 4UMBA 1NOUA 4LW7A 3TW9A 5I3JA 3DH7A 2DZVA 3NEVA 3EX3A 2W62A 1BLIA 1UC5A 4TOQA 2G50A 1EC9A 3A12A 1YDVA 1W3LA 2E8YA 5F4SA 3BPWA 4O8RA 1M7PA 4P7QA 1TCDA 1QPKA 3SGGA 2YL9A 1VPQA 3D6NA 1KM4A 2PP1A 1WXZA 5CSUA 1PIIA 4GVHA 4XUGA 3NDOA 2GVEA 4AF0A 4RE2A 4HBKA 4L1GA 2PDGA 3Q94A 2I17A 2XSBA 4FSAA 2PDCA 4WLCA 1RV8A 4QNEA 1TO3A 3VX0A 2YCLB 1GVRA 1XYZA 2FLIA 3VIJA 1U2YA 3L4TA 4GWEA 3RGTA 4GGBA 4S23A 4ACYA 1J10A 1K7EA 4X9YA 2BVTA 3U48A 2VZOA 4LS0A 4EX4A 1UZ1A 1XLLA 3ZT7A 3R11A 4O14A 3RPDA 3SI9A 2QULA 3RLHA 5LA2A 2ISSA 8CGTA 2G0WA 4I9MA 3UPBA 2J7EA 2WJZA 4PTWA 2DV0A 1DTNA 1GOKA 4W86A 1FXPA 4ACZB 2IXUA 5HJXA 5CPNA 3T2QA 3UNDA 2YL5A 2DP3A 3QVQA 4LUTB 3T81A 3T05A 2VD9A 1VBJA 3V0TA 4NZJA 2ZUSA 3K30A 3USBA 1TIWA 1H41A 5HNUA 4BA0A 2F8QA 5DXYA 4E2OA 1J0JA 1Z44A 1H60A 3N14A 3VKJA 5KMYA 5GPRA 2PU0A 1MNSA 1RA0A 3LLFA 2YZRA 1XISA 4O4VA 3FVMA 4JOMA 3BWWA 4H7ZA 3WN6A 3OVGA 1XGZA 5HATA 1V77A 1DL3A 3MMDA 1P4CA 5H8MA 2JEPA 2PA6A 1FDYA 4JIPA 3CWHA 1FWEC 3ARSA 3L12A 3GU2A 5IHSA 1ZBKA 1Y5WA 4LV4A 1GQIA 4S2BA 3L4UA 7ENLA 1TX0A 5F2MA 1N8WA 3I7RA 4HHHA 4MJ2A 3T7VA 5DRIA 1E1EA 3U5YA 3WH5A 1E73M 4Q8MA 3FX4A 4DZAA 2G5WA 2QUNA 2H90A 2R1PA 2PGEA 2VZSA 3C2FA 1ICQA 3C2OA 5D8WA 2G97A 4YYFA 1VBGA 3E2QA 3G3MA 5ABEA 3UP8A 5FCZA 4GIAA 3AHTA 1JCYA 3KM8A 4XZIA 5FL0A 4AZ5A 2DZUA 3MZNA 1TCMA 1XLEA 3JU2A 4W85A 5HA7A 4F48A 2EPNA 3CHDA 1GOMA 4FNUA 4QSHA 3T2PA 1J79A 2BXVA 3ZR4A 2WMGA 1BYCA 3KX6A 2GJPA 2GUYA 3WJYA 2V5JA 3OOQA 4B5UA 3B04A 3EX2A 2A3AA 4G5DA 1JRBA 1NJJA 2A1YA 3MHFA 2YXOA 3B06A 3W7RA 5FSDC 3KOWA 4FX8A 3GTIA 2OQHA 4AX6A 2PDWA 4CU8A 4LVGA 3CK5A 4XKYB 1OM0A 3SY8A 2VOTA 1W9BM 1GVEA 5H8UA 2NT1A 3WSUA 1RD6A 3BJFA 3UZJA 3K8MA 4H7VA 3GW3A 1QR7A 1V3MA 1NDWA 3FXGA 4DJEC 5C9ZA 4D1IA 2I16A 3OGSA 4AW7A 1LLWA 3IJ6A 3DKLA 5BMXA 1H3GA 2XM1A 3LSCA 4G56A 5JU6A 3U2EA 2ZA1A 1B4EA 1OX4A 3VMOA 1KGWA 5JIWA 3KLLA 4KS0A 3THAA 4RLIA 1J6PA 4LXFA 5JUVA 2ZVRA 4Y96A 2H6RA 5CSYA 4MY8A 1HL9A 3L4ZA 3BAKA 2P10A 2ZRVA 2J66A 1DWIM 4K8EA 1PTAA 2G3JA 3NQBA 2Q8XA 2QXWA 1TVPA 3C5QA 3MYPA 5G2WA 5CEWA 2JGQA 4PRRA 3W7GA 1MXGA 1LQAA 3PUDA 2YDQA 1UR9A 1THFD 5LA1A 3VCCA 1FUYA 6ALDA 1J2WA 4QRNA 4JNZA 2DSZA 3KFTA 3OJGA 4LC6A 1OZQA 4AIUA 3GR7A 2IW0A 2NLIA 1XRSA 4JKLA 2E40A 3VDAA 4RKAA 2VHLA 3QPYA 1OG0A 2GSHA 4Z1DA 3W7KA 4JFWA 3O6AA 1EGZA 3GY1A 1TG7A 5AB3A 5EY5A 1TE6A 2GVLA 3WNOA 2REQB 3QPZA 4LEQA 3GK0A 5IBXC 3G1XA 3QN3A 4UOZA 4R27A 1XUZA 2ZOXA 2PRHA 3KHJA 2DSUA 4BQ2A 4NRSA 4NJIA 4XAYA 3EB4A 4NXKA 4AMCA 4Z2GA 3EWDA 3EX6A 3KP1A 1FWWA 5I0DA 3R94A 3SQLA 2Y5EA 4J3XA 3HMCA 4XSLA 2B7PA 3SQSA 4FF7A 3QV8A 3VMPA 3HPSA 1KKOA 4S2CA 4F4RA 4ZODA 3LYEA 4GUJA 1DBTA 5TIMA 1MUMA 1TV5A 2VR5A 5K9DA 5LNUA 2V81A 4I3GA 3ZSSA 4D6DA 4L6OA 2YFNA 5LKYA 3P93A 7REQB 4YS1A 1MWOA 4PUMA 1KQZA 3GG0A 3LX9A 1TWSA 3OW1A 4I5UA 3STFA 4FNRA 3VUPA 5CBIA 5MKGB 4ZMGA 1V4YA 5TD4A 4HTBA 1YPIA 4IUOA 2VZVA 3DHUA 5AZ1A 1Q85A 2CU0A 3WDIA 4E0CA 4E2BA 1MFUA 3RNDA 5I2UA 1ME7A 2PC8A 2J8TA 1XWYA 4JICA 4K3ZA 4NX5A 3H2FA 3QZEA 1ADOA 1V3KA 4Y9MA 1NVMA 3UERA 1K77A 1YIXA 4ADTA 1DQXA 4HNNA 3OO2A 1XHGA 1BF2A 3EMCA 2C16A 3WQGA 4XK2A 1CXIA 1D8CA 5E0CA 1LQ2A 2HVNA 2FGBA 4N9CA 1W1A1 1H7OA 4JX4A 1H1NA 1JVNA 3HMJG 4AZHA 1T41A 4GXMA 1MRAA 2FJKA 2ZUTA 2ZE3A 1ZJAA 1UR2A 2ISFA 4BI6A 3VNJA 3W37A 5C55A 3MV01 1K9DA 1IT0A 1QHPA 2ZWYA 1LP6A 1LTDA 4Y90A 3GBEA 1Q4NX 2CW6A 2W79A 3E02A 3NQMA 3S9YA 4RL3A 1WKEA 2PDQA 2JE8A 5FKYA 3AS2A 4RDYA 1EIBA 1OX5A 4HNCA 2VEFA 3K4WA 2OMAA 4DJDC 4UNLA 1YEYA 1WXJA 4D6GA 4RDWA 1EX1A 2QZRA 3GDLA 3VGHA 5G1TA 4JTHA 1GEHA 5DCDA 2NQ9A 3ONBA 3NL6A 4CQ8A 1JQXA 2RH9A 4ECLA 2BXYA 2J7DA 3G1RA 4F9DA 1Q66A 4N4QA 1KFLA 2JFEX 3DYPA 1FOBA 4GZEA 3KCLA 4TX8A 4G8TA 4WKHA 4LY8A 4EXBA 4ZL1A 1TKKA 1LT8A 3O07A 1KM0A 2XVKA 4KESA 3CHVA 3AJXA 2D2JA 3FEQA 3S5YA 4TVUA 2DQXA 3H70A 1XCWA 2IPWA 2Z1SA 1TUFA 4YJ5A 1A5KC 3WMCA 5K4XA 1OX6A 1U30A 2Q71A 2QT3A 1E0VA 4K68A 2OOFA 1NAL1 1YBQA 2VX7A 5F7UA 2FTYA 4AWTA 3G8RA 3W7CA 3ITLA 1WBHA 4E4UA 1DQWA 2V30A 1IQ8A 3H6OA 4M1BA 2ZX6A 3S3GA 3WF4A 1EOMA 3BO9A 2UWFA 4JX5A 2BB0A 3B4YA 2HE5A 1F3XA 1UKSA 4H3DA 1MFVA 2BS9A 1VGAA 1DXFA 2FGZA 1TMHA 3CPRA 4CQ9A 1HJXA 1V6WA 3MUXA 3LI1A 2BHZA 3W7IA 2WMIB 1F74A 3P62A 1CEOA 2A3CA 1B30A 2RDTA 3EDEA 2ZRWA 4HMDA 4JY9A 3TYDA 2V69A 6XIAA 4TU1A 4PCNA 5AYIA 4LC8A 3H2CA 3ABOA 3A47A 1LUCB 5T8GA 4AU0A 1PHQA 1XF0A 2OO0A 4RNIA 1W2VA 5CZJA 3WD0A 3MS8A 1OF6A 1S2WA 4PULA 3KTSA 3CUJA 3VD4A 3P61A 1XR2A 5I3IA 1U5HA 2W27A 3VNYA 5E9XA 3B05A 3P6LA 4IJCA 3VFCA 3ZR6A 5E70A 3EXSA 2WNNA 5LHFA 3F2BA 1W17A 3PWAA 1UKQA 4O18A 2WNZA 4O57A 3DFHA 2A7PA 4O16A 2FZBA 3QOMA 3FGCA 4DUOA 1IXNA 2OYMA 1HNYA 4MF4A 4E3TA 3B0VC 4TTGA 4O0KA 3M0LA 4UOQA 4QLLA 2Q8ZA 1QI3A 3ZR5A 3WLNA 2YLLA 3FYPA 1E6QM 5A6BA 3NPWA 1RPXA 3TW7A 4FIQA 3O63A 5A3HA 5C9XA 3KBWA 3OBKA 3PTQA 3D5HA 2VYOA 2BVDA 4TXEA 4Z2LA 3FJ4A 3U2CA 1WUEA 2QCNA 3QJAA 1F6KA 1SJCA 3P84A 2VT0A 2BP1A 4HMNA 4D6EA 4LALA 4C5ZA 4DXVA 1J5SA 4TIMA 1MRQA 3WUBA 4FOKA 5F1VA 2HDJA 3T1GA 2XU2A 2UY5A 3QY7A 4DUXA 3ARUA 2VC5A 4PMNA 3VIOA 3ARWA 1H5YA 1ZBVA 1VS1A 1J0YA 2C1IA 4AY7A 4D8AA 3IUIA 5FD0A 4DEFA 1ICPA 4EPDC 2OZTA 4C7GA 2J88A 2RJGA 1ZJIA 1OIFA 5I24A 3GXDA 3NSMA 4UFMA 1GCYA 2WHMA 2QCDB 4IGNA 3CL6A 1WYIA 4A05A 1VIWA 2Y70A 3E1F1 3TSMA 1GOQA 1VYRA 4E2DA 2PDKA 3RM8A 2WZEA 4NIRA 4CN4A 2EXOA 5FAJA 5HNRA 4IIDA 2V2DA 3SUVA 3GXFA 4M51A 1JCLA 2O9TA 3P74A 5K7JA 1XQLA 4QG9A 3UCQA 3TX9A 3V75A 4GNVA 3BCFA 4N0RA 2DT1A 1YYAA 3DFQA 4HN4A 3TYUA 1I9CB 3AOFA 3FNDA 1BWVA 4KEMA 2A2IA 3G1YA 3TP4A 1JZ7A 2OODA 1OT2A 2Z6IA 3WK0A 3D0CA 2H8XA 4XZLX 3KEHA 3VM5A 4NI8A 3BTNA 2OWWA 2VC6A 1WKFA 2XN2A 2ABAA 2CLFA 3G8EA 1C8VA 2PWVA 4TR9A 2ATSA 2D3LA 4PE8A 1E5NA 1UQZA 3H4WA 2P0IA 5A6KA 2NWSA 1DQUA 4FLOA 1VRXA 3VKCA 1R87A 1CB7B 4R5EA 2E9BA 4Z2HA 5I02A 1NF7A 1V51A 3AYRA 5A2BA 3W7OA 3QYSA 1L0PA 3INPA 4AD1A 3CASA 4KBXA 4IMCA 3TWBA 1A5AA 4P2VA 1Q8AA 4DHGA 3KOXA 2LLEA 1I1WA 4QISA 1IE7C 5BRQA 1EP2A 4R3UA 1IWAA 2V2CA 2V8ZA 3XISA 2E1DA 1ITCA 2X0SA 1GVOA 2C19A 1SO4A 4JGDA 1QO5A 1YBQB 3LV5A 1JPKA 1WA3A 3RX3A 3OVQA 1UA7A 1V02E 4AMAA 1EA0A 4UTFA 1VFUA 1PS9A 4AG0A 1JPHA 1QI5A 3RITA 4ILSA 3NGFA 1PIGA 3TUUA 3TMLA 1Z69A 3DIPA 3KS5A 2E6FA 3LRKA 4GG9A 1O5QA 2GDQA 3TW6A 3FSUA 1JJKA 3WELA 1KXQA 3A3WA 4LEFA 2BSLA 4MYXA 1XSIA 1OCNA 1MVYA 3TZNA 1JCXA 3WG6A 3OYXA 1PTDA 1Q6QA 4PC8A 3L4YA 1T99A 5D04C 3SEPA 1Y65A 1XIMA 4CQDA 1Q7QA 1ITUA 3BL3A 3LB0A 3EA1A 3T8QA 1P0KA 1GORA 2DT0A 3ISIX 4DXKA 4C6FA 4RX0A 3R89A 1B31A 2PDPA 2DVTA 3C3NA 4W7VA 1OJXA 2GGGA 4A4AA 3QRHA 4C6EA 4MKNA 1Z32X 4IHCA 1XUUA 2IKIA 1HKIA 2YFOA 3W23A 5I06A 3AFBA 2Z27A 1XIJA 3MMUA 1KM1A 2INEA 1Y8BA 3ZSTA 2JF6A 3N13A 3SCOA 4FB7A 4S3FA 3M1ZA 4NX0A 3UG3A 1D7FA 1EGVA 4HOWA 4GIYA 1ONRA 3VE7A 4WDUA 1EBGA 2ZDRA 5LZLA 4E3VA 3S6DA 4J2MA 1G7VA 4HOXA 4UFHA 5AC7A 2Z1KA 2JK2A 5E09A 1PXGA 2GLKA 4NG3A 2QS8A 2GGEA 3ZVHA 3QKEA 5LNRA 3W75A 5M1TA 3SCNA 1AG1O 1NQ6A 4JQ1A 1TZ7A 2W0UA 4WQ6A 2X1RA 3V5FA 4JS3A 3UWVA 4UOJA 1Y7VA 3U6WA 2A0NA 4MB5A 1W3NA 3MANA 1VLIA 2E25A 4YTUA 3UJRA 1CXEA 2GGHA 4WDWA 2NXHA 3KBJA 4PR4A 3M07A 2FHCA 3UG8A 3A22A 1AH4A 1KBKA 3TCEA 3VIFA 2AAMA 2CZDA 2IPFA 4UZSA 3UFYA 1E3ZA 1KTBA 3LA4A 1FWCC 3LERA 3GNDA 4K38A 3V5OA 2NQ5A 1HT6A 3E49A 3LZ5A 1TWDA 4MJMA 2X42A 1YMYA 2CKSA 1OFOA 2D3NA 3CQKA 1CPUA 3N9RA 4A8NA 3VTRA 4OWGA 2ZC1A 2INFA 3UGVA 3N6QA 1TELA 1E71M 1TB3A 3LSBA 3S2CA 4UB9A 5CCZA 5AC6A 4Y8FA 4ZBCA 4GPNA 3L68A 3ARYA 4C6LA 1EJTC 1LWHA 4C6OA 1EBHA 4DYJA 1MW1A 3A4AA 1W9UA 2NW0A 2Y8KA 1QRQA 2GQ8A 5DX7A 3WH6A 3E0VA 1R3TA 3AHVA 3LOTA 4MB3A 4RDZA 1ISWA 3W85A 4X63A 1I4NA 1CXHA 1TPH1 1Q45A 4NP7A 1RUSA 1XLDA 2Z7KA 3VNMA 2CERA 4Q6XA 2WK2A 5KSWA 5CKSA 4WY0F 3IVSA 4Q7IA 4HIBA 2AKMA 2WKJA 2QMJA 1YPFA 2GVYA 2QCGA 1XC4A 5JBFA 1TFVA 1TV7A 3OLEA 5HWMA 2GSJA 4TMBA 4W93A 4AISA 3N73A 3PJXA 2CHOA 2GJXB 5HOSA 3M6YA 5TAOA 5CJMA 2P3EA 3VGDA 3UJ2A 3WJSA 4GQRA 3WH8A 4C6DA 1UKOA 1WDPA 1Q6CA 1AJ2A 4CEUC 1OIMA 4RPQA 1WQ5A 4UIOA 3SY5A 3STEA 4UQEA 2HS6A 3ALFA 3CZJA 2UY4A 4HNTA 1JCMP 3TAOA 4K8GA 4AFYA 2EJAA 1KLZA 3AIEA 2Z1VA 2XGZA 5EPDA 2XFWA 4NHVA 1HL2A 1NTHA 2BY1A 4JQ4A 4N9BA 2VFEA 4BEQA 1H4PA 3WQFA 4KWWA 2PDJA 1CGWA 2P1FA 2C71A 1US0A 1QHOA 2ISVA 1O60A 3VC6A 2HNEA 1N55A 4A2SA 1P48A 5A8OA 4H2CA 1AA1B 1EJUC 5HK4A 4CNSA 3AS0A 1QOXA 4MB1A 4B4HA 3GB6A 1H1ZA 1EL3A 5A6AA 5LNVA 3H21A 2PUZA 1MDRA 3KS6A 4XB3A 4FO4A 4JEJA 1OD0A 1YX1A 4LVDA 3A6OA 3HO8A 4GIRA 5LSMA 4R34A 3THQA 1I2PA 1HN1A 1GKPA 3PN8A 1TQXA 3EMQA 2Q6ZA 4CNTA 4HHPA 2X09A 2GFTA 1BF6A 2FPTA 4PTNA 1C8QA 4FNQA 2QGYA 3NNTA 4JN6A 3WK3A 1H11A 5IDZA 3PPHA 3ITXA 2DUXA 2PSNA 2A7RA 4QLKA 3NSXA 1ZAIA 1J8VA 3A3XA 3QLLA 1BRLA 3BLDA 4CEXC 3HG2A 4AD2A 1M03A 1XRVA 5KZMA 3EOUA 1XBZA 5EMLA 4ZO8A 1W5MA 1DIEA 1A3XA 1GEQA 2PZ0A 1FFQA 4MMWA 4IOTA 3E0WA 5EKYA 4QGCA 4FOUA 4D9PA 5CQ1A 2DDXA 4M7SA 3QR1A 1S3TC 4YHGA 3UY7A 3OTRA 1ISYA 1PCWA 1P5BA 3G6LA 1SPQA 3LCXA 1B3OA 4QROA 3ARTA 1JRCA 1WZAA 4DBWA 3RRAA 4LYKA 1WV2A 1CCWB 3B8SA 1X96A 1GKRA 4B3KA 3ZZ1A 2B81A 4PTMA 2ZXQA 1S5WA 2YYTA 3F03K 1CXKA 4TX6A 3VDHA 1ZTVA 3WK1A 2WVVA 4BI5A 4FS9A 3TR2A 5B7YA 3RU8X 2O9PA 4ZXLA 4H9VA 3PJWA 1AD1A 4DLFA 2BASA 2F2KA 1UC4A 1P0DA 3L9CA 4C6IA 3S8HA 4GFSA 3FA5A 4QITA 3R25A 4ZQCA 5HPCA 2Z4GA 5K9CA 3GNOA 4U28A 5A2CA 4WOQA 1K8ZA 4K2SA 3I4KA 4C6BA 1XPYA 2XFYA 4EPEC 3PG8A 2RUSA 2PWGA 4ICMA 2HV5A 4NRRA 4GYPA 1GPWA 3NIYA 1ME8A 2QIWA 4ZFMA 4DWSC 1HQTA 1BVWA 3GH4A 5PTDA 3TK7A 1PUDA 4PUDA 1IYXA 2W9MA 2ZQ0A 5E6YA 3FK4A 4NZ4A 2HNHA 3R7MA 3NWRA 2WO5A 3LHVA 3LU2A 1JI2A 4TV5A 2BY2A 3BURA 1SZFA 4MFDA 1W54A 1ISZA 1EDTA 3R8RA 3W4RA 2ZIDA 5EBUA 3SGUA 3AXIA 3BH4A 1NDZA 3PPCA 2JGYA 2J79A 5EFFA 3C3UA 1HIZA 1ZALA 2QDDA 3ANYA 5A6MA 3QPEA 3ABQA 2ZZ6A 5BOEA 1A5MC 1MQRA 1OFPA 1FP9A 4IXXA 3IPWA 4LNCA 3L5MA 3MSRA 4Q4RA 3OBEA 3W7MA 5C9UA 4XZ9A 3T0AA 5E0FA 7CGTA 4PUJA 1QWGA 1EUAA 3WLPA 1KBIA 1ZQ5A 4PGLA 3UZYA 1XINA 3B8IA 1PX4A 2PF8A 3U8GA 7PTDA 4ZOBA 1XLCA 4C65A 1AH0A 3H55A 4LCRA 3NZ1A 3POCA 1AH3A 4ALDA 3U57A 4UR9A 4GYFA 2ONEA 3EPMA 2WBKA 3W2UA 4XWUA 5HBFA 4FOJA 2G41A 3GNPA 1EFZA 1BGAA 3IJDA 4R33A 3W02A 2Y88A 1Z7AA 3A4WA 4PA8A 2WZIA 3DC0A 3NZQA 3F2CA 1LL4A 1MZHA 1XD1A 4BKNA 1WNOA 2NUXA 4JX6A 3HQ1A 1ONXA 3W71A 5DF0A 4C6KA 4EPKA 1OC6A 1IEXA 2YPIA 4O11A 3SFWA 4A8IA 3NPVA 1BYAA 3N9KA 4AX7A 1QNOA 5DMYA 4U5IA 1JD7A 2DGAA 1TRIA 5FAGA 5J8LA 1EGMA 4DZHA 4AZCB 5I5RA 4OT7A 4UTKA 2GSEA 1JUEA 3DXIA 4Z0SA 1R7OA 4F0SA 2WSRA 1A5BA 3EA3A 2XM2A 3CS2A 3M5XA 3FSTA 1V0MA 1RBAA 3M0HA 3DHFA 5CXPA 3GIQA 1W3KA 1OYBA 3DCPA 4FXJA 4ZQNA 3LPOA 3W6YA 4J28A 4C6JA 1IHIA 3PF3A 1VENA 1A50A 3WUGA 1L9WA 1RQBA 1UUOA 3KXQA 4O4WA 4DWSA 1F76A 3CUZA 1B0IA 4YVVA 1ZP4A 5EL1A 3WEOA 4XD5A 5A5WA 3GKFA 3ITYA 2R6OA 3CBWA 4O10A 1PIFA 5L6UA 4S39A 2WC7A 4IFRA 5AYYA 1NWUA 5AHLA 5M3WA 3AMGA 4GQGA 2V63A 2NVDA 5D9PA 2FZNA 2WVTA 3AYTA 4UWMA 3AISA 2VRQA 4CUCA 1VEPA 2QCHA 2F6UA 3XIMA 1FWSA 2XIMA 3UWEA 3CMGA 1A80A 3OLGA 2ZXBA 4DF0A 1BVNP 5HR6A 4P61A 1YTEA 3QGKC 2R8WA 3VNIA 2J9ZA 4C1KA 3H7RA 3CM4A 3I3DA 4PMOA 1XLAA 1QTWA 4QE4A 3DBPA 4PEEA 3WBWA 4LBSA 2DH2A 1TJ2A 1TTIA 3ARXA 4UTTC 1KD0A 3GZAA 2Y7FA 2WKGA 3HGOA 3H2NA 2G96A 3VGBA 3REQB 1ZBWA 4GJIA 1LLZA 2OEMA 3EEGA 5M5DA 1RQEA 1UWTA 1FFRA 1UKTA 4JDYA 3EMZA 2ADAA 4HU8A 3AHXA 3O6CA