2YCLB

Complete structure of the corrinoid,iron-sulfur protein including the n-terminal domain with a 4fe-4s cluster
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
309
structure length
309
Chain Sequence
AVEVLKEKWNSKVVEVTLGTGDKTVTLGGDSTLPFLTFEGEMPNPPRFALEVFDTPPTDWPDILVEPFKDVINDPVAWAKKCVEYGADIVALRLVSAHPDGQNRSGAELAEVCKAVADAIDVPLMIIGCGVEEKDAEIFPVIGEALSGRNCLLSSATKDNYKPIVATCMVHGHSVVASAPLDINLSKQLNIMIMEMNLAPNRIIMDPLIGALGYGIEYSYSIIERMRLGALTGDKILAMPVVCFIGQEAWKAKEAKDPEVAEWGDYALRAIHWETVTTVALIQAGGHLFVMRHPKSLAEVKEHLKRILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CARBON MONOXIDE DEHYDROGENASE CORRINOID/IRON-SULFUR PROTEIN,
publication title Structural Basis for Electron and Methyl-Group Transfer in a Methyltransferase System Operating in the Reductive Acetyl-Coa Pathway
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
total genus 101
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03599 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 2yclB01
2E7FA 2YCJA 2DZAA 4MWAD 2VEFA 1Q85A 4C1NB 3TYUA 1TWWA 4O1EA 3H2AA 4S38A 3BOLA 3MCOA 3H26A 4D8AA 3H23A 4G9PA 3H21A 4DJDD 4DJFD 3H2CA 4S3FA 3NOYA 2DQWA 4NL1A 1EYEA 1Q7QA 3TZFA 2YCKX 4S3CA 2YCIX 4MWAE 1TX2A 3MCMA 1TX0A 4DAIA 2OGYA 4DJED 1AJ2A 1Q8JA 3V5OA 3H2FA 4S3DA 4NHVA 3H2NA 5JQ9A 3H22A 1F6YA 3H2EA 4S3BA 3BOFA 3TYZA 4DB7A 1AJ0A 2BMBA 3TYEA 4DAFA 2Y5JA 3H24A 4S3EA 4MWAA 1Q7MA 4HB7A 1AD1A 4CCZA 4NILA 4MWAC 3K13A 3H2OA 3TYAA 4S23A 1Q8AA 4D9PA 3MCNA 2YCLA 2DZBA 1AJZA 2VP8A 4S39A 4NIRA 1TWSA 3TYCA 4DJDA 4DJFA 4O0QA 2H9AA 2Y5SA 4DJDC 4DJFC 3TYDA 1TWZA 4PZVA 3TYBA 4O1FA 2YCLB 4S3AA 3TR9A 2VEGA 4C1NA 1AD4A 4DJEA 2Y0FA 2H9AB 4D8ZA 1Q7ZA 4DJEC 3TZNA 4MWAB 3H2MA
chains in the Genus database with same CATH superfamily
2GJXB 4XD5A 4C1NB 3WQEA 3MC5A 2PD9A 5FF0A 3APTA 1C3FA 1SZGA 3TA6A 3CQIA 3QGVA 3AS3A 3UPWA 3R4IA 2NSXA 3PULA 3SURA 1JDCA 1DQWA 2PPGA 3IVUA 3FJ4A 2UBPC 4E5TA 2F2KA 1KFEA 4ZE5A 1TG7A 2VX5A 4C90A 4KFPA 1AH0A 3DAQA 4RDZA 1VB9A 3OYZA 3MHFA 2GQ9A 1B3XA 4B4HA 3SAZA 8XIMA 1V3LA 1UQZA 2TPSA 4AVOA 4K1WA 1W3HA 4AG0A 4NVTA 4DB7A 1L2QA 1WDRA 4WKAA 4GLEA 5M3WA 2BY2A 3UWYA 2PWUA 1QO5A 4IIGA 3QW3A 1XSIA 2WVTA 4JTCA 5EL1A 3WELA 2IKIA 1GYNA 2QMKA 4DO6A 5EBUA 1XIIA 1F3EA 2FZ9A 3SDOA 3WLOA 4JXCA 4FNUA 4PFMA 2J8GA 3MP3A 3BLOA 2ZUTA 1VJIA 3L23A 1TQJA 3L7RA 3UWVA 2C0AA 2YL9A 3LM7A 4O13A 1FUYA 3VDGA 4BQ3A 2O0TA 1GOQA 3H12A 2BB0A 5ABEA 2BHZA 3LQGA 3MI2A 3WUBA 5FAGA 1QCWA 2DUAA 4LS2A 1QNQA 3UA4A 2EG6A 2FVKA 1KB3A 1TMHA 3QZAA 5EMYA 1XYFA 3KWXA 3BG9A 1EIBA 3OG2A 2AMGA 3CLMA 3EX3A 1VAHA 5F2LA 4NZ5A 5AYZA 4M80A 5HNUA 5CLTA 4GX8A 3O2LA 4MYAA 2WZHA 3M0HA 3W26A 4E2BA 3RLVA 3PZVA 1VPQA 4HVXA 2CHNA 1F6YA 4GO9A 3VILA 1PIFA 4LH8A 1F8MA 3LSBA 4OECA 1T8QA 4AMCA 3L5AA 1XIJA 3MHGA 4QJ5B 3L21A 4ML9A 4O28A 3W7GA 2VCCA 3B3DA 3QQWA 2PD5A 4GO8A 4JFVA 2ZDSA 6ENLA 1OX4B 3EX2A 1DXEA 4OUEA 4YYCA 1EZ2A 3P84A 3W07A 3GKFA 2R82A 4DBSA 5FKYA 4C7FA 2QJMA 3R1ZA 2Y8UA 4JNMA 5E70A 3P5ZA 1A3XA 2GDVA 2PDPA 3EKZA 4GY1A 4PA8A 2A1YA 4K39A 1LTDA 2X1UA 1AVAA 5ABHA 2CHRA 1OGBA 1XLDA 2I5GA 4PL1A 2WSYA 4HHLA 3GTIA 1B9ZA 3R79A 3QMRA 3ZLHA 3SCVA 3ALGA 3CYJA 4HSNA 5BU6A 1TTQA 4XZ9A 1TX2A 1UP2A 3PM6A 1F2JA 1C91A 3MI3A 3GHUA 3R43A 4H01A 2HNHA 2RAGA 1PJ9A 1XV8A 2EQDA 3HPXA 5JQ9A 2WC7A 2W91A 1BG4A 1JZ2A 3GBDA 2BWGA 2P8CA 1OYCA 2ZRWA 2NV2A 1OHLA 2PGRA 4L1GA 3HF3A 3AUOA 3AJ7A 3S2CA 4J35A 2FVMA 5K3VA 4JHMA 5G4HC 2PLCA 2QCNA 4CQ9A 5C2GA 3WQFA 1EX5A 3U7VA 4IPIA 3R8RA 1XG3A 2C3ZA 2BXZA 3C3NA 3NL5A 3P0XA 4MF4A 2WCAA 3NSXA 3UU0A 1H62A 4ZO8A 4V33A 4HK7A 2ZCGA 1KFWA 4GHRA 3TE9A 1NARA 4AIEA 3WH6A 3RCYA 3CJPA 2R94A 1XYAA 3QV8A 2Y4SA 1SQ7A 1C7SA 3UP8A 4L5ZA 1R3WA 5I3GA 1A5LC 1A5MC 4M6QA 1PZ1A 3VOGA 2V2CA 1SMDA 4UNKA 4PMNA 4JFWA 4DXKA 3N12A 2HPMA 5AYBA 3W86A 1KFJA 4LVDA 5A6SA 1TVNA 5I79A 3GDTA 1KRMA 4ONVA 5K4XA 3S4TA 1GUVA 5BXPA 1E40A 2VENA 3S2MA 3MO4A 4LBUA 1A5BA 3ITYA 4DWDA 3P0WA 3H4XA 1Z42A 3ITVA 1BWVA 3S1GA 1QK0A 4O16A 3DFOA 2AGKA 3EKGA 3Q37A 3PJTA 1V5XA 1RVGA 3H8AA 2GPTA 3G1FA 5DX7A 4GQRA 2D2JA 4RDVA 3U4AA 3NVTA 3VVGA 4GI4A 1BQCA 4RPQA 4XZMX 4GBDA 4E4FA 3PUDA 3TYCA 2VWSA 1AQHA 4WD0A 4X61A 3QXBA 4W8AA 6CGTA 3MUAA 3LV5A 1GONA 5A8MA 3WLTA 2FIQA 2WMKA 3SY5A 3FX4A 1QW8A 3OZMA 4U3CA 1W5QA 3GO2A 3N29A 4GJ1A 1KKOA 4UQDA 3TONA 1C9DA 2FB2A 3F4VA 3FGCA 1EJUC 4XBSA 3QTGA 1W9PA 3U2ZA 1DKWA 4PUWA 4UQEA 3SGGA 3RM4A 1VQTA 3WH7A 3DHUA 3UR2A 5CG0A 1JD9A 4GKLA 4DUXA 5I7GA 5L9FA 1R3TA 3ERPA 3K4AA 2Q09A 2OQLA 2Y5EA 3FA5A 3ZMRA 1U1HA 5FAJA 4C6PA 1HKVA 1US3A 3MCOA 1YHTA 5IBXC 3CWHA 1V3MA 1H7NA 3MWCA 3M6DA 3SUWA 4RNIA 1HF6A 1QW7A 2PWGA 1P0NA 4QJ4B 1A50A 4HN8A 3N15A 2QCLA 3A47A 5LKYA 3NXFA 2BX7A 4QDPA 2HISA 4DAIA 1WDQA 4UTIA 1EP1A 3WBYA 3U8GA 4DRSA 3VKAA 1K9FA 2W27A 5AC8A 3IK2A 3OHMB 3FIGA 4FA3A 3HU7A 3TUUA 3RCMA 4R3UA 4M3PA 1KCXA 5JH1A 3SN4A 5A69A 1FCUA 1QNPA 3OGSA 4UTUA 1DQXA 2Z1XA 4ILSA 2C1HA 3WL0A 3N4AA 2VD9A 3CZJA 1JNDA 4AZ7A 1AH3A 4UQ9A 1UWAA 3SUSA 3W1MA 4Z42C 3T0DA 3DDMA 2PGEA 1QI2A 2XGIA 2CLIA 4KWVA 3KOWA 4JTLA 4K8EA 5BWFA 2VEKA 1UPPA 4A8IA 3W1AA 3S5SA 4A3UA 5LGXA 4Z2GA 3TKFA 1A5OC 2BVTA 1S1PA 2PDLA 1M5WA 2Y8VA 2PTXA 3TH6A 4AYGA 2YR1A 2X41A 1ZNNA 2I5QA 2GUUA 3MQTA 3O8AA 5E0KA 1UMYA 2W92A 5GNZA 4HNCA 5LHEA 4NXSA 3V4BA 1Z3NA 2D0GA 4XUYA 4Q8PA 3SJNA 1XF0A 1QO2A 1VJZA 4Q8NA 4UWMA 3WBAA 4AAJA 3KAOA 1DBTA 4LALA 2GGEA 4H9ZA 2WJEA 4E2DA 1RBOB 1UKTA 1CXFA 3QLLA 3UGRA 2XVNA 3N6QA 4P7OA 1SFSA 3A64A 2E1DA 1ZBVA 3GVGA 2RDUA 4UTJA 4AXKA 3VNDA 1D3CA 1F3WA 4IQJA 5G5IA 2BMBA 3AXMA 4DYKA 4BHYA 1AA1B 1W1PA 2WV8A 4AQLA 1TPEA 4D8LA 4CD6A 2QJNA 3OZYA 1SFTA 3NSNA 4XQ6A 1I0DA 1O95A 3PNUA 4E2OA 5HOSA 1CGWA 1A0DA 3ZYZA 4MIMA 3EPOA 5AOUA 1P5BA 1UA7A 4GI9A 2V63A 1TPFA 4ORIA 1E55A 3CV6A 4I7VA 1EF3A 1ZJBA 1LWIA 3BLEA 5CSRA 2P76A 1O1ZA 1QRQA 3LLXA 1NWUA 2EG7A 2PC4A 4TV6A 3HV9A 2QCMA 1UWSA 4H2CA 1TPDA 3FGCB 1M03A 1LLWA 4LUJA 1A5KC 4KFNA 7TAAA 2YL8A 3W7JA 2EPHA 2F61A 1FXPA 3H21A 2HNEA 1GVQA 4B5XA 4H8VA 3AMLA 1W31A 4Z17A 2EAWA 1FWRA 1XIGA 1UZ1A 1TIMA 4JOMA 5G4EA 2ZX5A 2PS2A 3ZZ1A 1YNPA 1F73A 1ZCOA 2DU2A 1W17A 2A3BA 4LOCA 3WYZA 3IJ9A 1KXQA 4X0VA 4BS0A 4OOZA 3MKCA 3WLPA 2JIEA 4MFEA 3HFYA 3H2EA 2QCHA 1P0DA 3DEQA 1RAKA 4BF7A 2R1PA 1X97A 3PC0A 4ZQCA 5M5DA 1ZJHA 3JZUA 4IJRA 4O18A 4WX2A 3WD3A 1TZZA 1TR9A 3CT7A 3TJXA 5AY7A 4V1XA 4HNTA 4F66A 3P8IA 2WKJA 2IMRA 3M07A 2PU1A 1ENUA 3V75A 3GUGA 4JTRA 3ES7A 1UD4A 4PZVA 4M6PA 1CLKA 4AW7A 3WNLA 3BK0A 1ELSA 4PRRA 3W7MA 2HRWA 4BI7A 5T8GA 4M8UA 5EMUA 2GQAA 1FWNA 2ZA2A 5MHBA 1Q85A 3R7MA 3W76A 5HPCA 1TE6A 4JQ3A 1EA9C 4WUIA 2PDCA 2C71A 2F7FA 3W28A 2V0TA 3DYPA 1I45A 3APGA 1RJRA 4B15A 4F0HA 3VA8A 4GJJA 3GXIA 1H63A 4QCFA 3WLQA 1JI2A 4M29A 5A2CA 1F8IA 2E28A 4H8UA 3GVVA 1GTEA 4OIFA 2G0WA 1EXBA 2ZWZA 4LAUA 4TUFA 4JKLA 3LU2A 2OOGA 4LYRA 1IZCA 2BVWA 5CSYA 2E6YA 2VGGA 4EPDC 3WLMA 4D1IA 3RX4A 2NWRA 3S6TA 1R3VA 1CENA 1S39A 5KMYA 2V3DA 1QPRA 1GZJA 5J5RA 4JIHA 3AIEA 3K1DA 3GFXA 1ISYA 2FMNA 2W9MA 1LG2A 3M46A 1H3GA 5BWAA 4J28A 3QV6A 2UY3A 3F5LA 3EEGA 4GIRA 4JFUA 2X05A 3SRKA 3WD0A 1UZ4A 5D38A 4GVHA 2OEMA 5IHRA 4B5NA 2Y0FA 2QUNA 3QR0A 3T0BA 4HK6A 4DLFA 1KM2A 4RXFA 4IL0A 1W9BM 4NF7A 8RUCA 3TZNA 1IWAA 3CXOA 5DT5A 4HMDA 3VIPA 4H9TA 3CL8A 1W54A 1X6UA 4DO7A 1RD5A 3TYUA 1NJJA 1TO3A 3AXIA 5U4NA 4ZBCA 4MNJA 3TC3A 3WEOA 1R30A 2QIIA 1YTKA 3CUFA 1QPQA 3R6IA 3VI2A 1UR0A 1L8PA 2JBMA 5DY2A 3CO4A 4K6AA 2QDGA 2IPFA 1PSCA 3N73A 4UQCA 4XAGA 4Q4PA 2PCQA 2Q3RA 3NZRA 1Q8JA 2G3FA 2HPIA 5E5CA 3WNMA 1FWHC 3GE7A 4MHBA 4QNWA 4QEHA 2VC9A 1UZHA 3YPIA 2J88A 4WGXA 3HA1A 1QBBA 3FYPA 3K30A 5HWJA 4IUGA 4F0KA 2XVLA 3PP7A 4UTLA 1CZ1A 3BGAA 4AUBA 1S2VA 3L5MA 1CYGA 1K4HA 2PLKA 2PLJA 1OEPA 2HVOA 2J9XA 3E1F1 4ZQNA 3GH5A 3WUGA 2XGBA 2AOSA 3CUJA 2AQOA 2VEMA 4RV3A 4BWLA 1ZENA 2ZUUA 4PMXA 3MZ2A 2C18A 3BOLA 2IXUA 5KZEA 3LG3A 3M5ZA 1W2VA 3EDDA 1T41A 3GW0A 3TAOA 4GFIA 3SIMA 3WKZA 2BXYA 3GLCA 3B9DA 5FJJA 1GOIA 2P1FA 5KINA 1GW1A 3UT0A 3DFPA 3DCPA 1HL2A 1F05A 2GOKA 2O4MA 4US5A 3BH4A 5HAOA 2Z6JA 5DMYA 2E0PA 3VNJA 4ACZA 3ID7A 1TIWA 3F4CA 4YCOA 1MXGA 4CGTA 5F4SA 1O5XA 3SFWA 2GSJA 1MEWA 1U83A 4B5WA 4GYPA 1CGTA 4JKMA 4KIEA 2C6QA 3TC7A 4L4OA 2OXNA 3NSMA 3AC0A 4S3EA 1QW9A 4HB7A 4F48A 2XZ9A 4JAWA 1NFBA 4U3AA 1H7XA 1IZKA 2TMDA 2D23A 5A95A 1DWAM 4WDWA 2AKMA 2ZXQA 3L0NA 4QX4A 5IM51 5IRPA 3FW6A 1VHNA 3KVLA 1QASA 1CTNA 4J3WA 1Q6LA 3BMXA 2EBNA 1ISWA 4DBWA 3IEBA 2WZEA 2O9OA 2CLKA 3TYDA 2XIIA 1XC4A 4LY8A 3L65A 2C7FA 3GU1A 1T0OA 2WWDA 1S2UA 3M6YA 1KCLA 3NO1A 2PURA 4MKSA 1Z8AA 1QHZA 2Y8KA 1M53A 3T40A 1HNYA 3UNTA 3SRFA 3W7OA 3BOXA 3EX1A 4LUIA 3UCCA 4JL1A 2DVTA 3VOCA 2XISA 2XH2A 3IIPA 3P2VA 3W24A 2PF8A 3GZAA 2ZRYA 2VZOA 3C56A 1POJA 1BYAA 3TCEA 3SGUA 1A5CA 2Q8LA 3TP4A 3I7RA 1HP4A 3E5BA 3NAVA 1TRDA 3G1XA 2QPUA 3KBSA 1H5YA 1OFQA 2QUMA 3RHGA 4DJED 4K8GA 1QT1A 3GHSA 2OLSA 3U48A 3OLIA 1XLFA 2BGQA 2QHAA 2VFEA 4B90A 4PRTA 5D03A 4JYEA 1DORA 3UF9A 4FF7A 4UQAA 3SUVA 3GC5A 3T8LA 4G1KA 3LBCA 3U2OA 5HDRA 1E1EA 2Y89A 2VWTA 4X9YA 4WHBA 2XUCA 2WZTA 4HOZA 1GVYA 2IQTA 4KCVA 1LOQA 3CZ8A 4S39A 2ZRZA 3QMTA 3BPWA 4UFLA 3D47A 2GGHA 2BVYA 4G7FA 1MZRA 3KCJA 1CXKA 3VMNA 1VCGA 2Z24A 4EVZA 3G0SA 4PH6A 3SSJA 5JBFA 1AW2A 4KIRA 1MW0A 1QBAA 4K7YA 4H7CA 4Y90A 3KDNA 4AHPA 4IX2A 3VNZA 5AHEA 3UWQA 2EPLX 1A0EA 4QCEA 3HM7A 5I77A 3SM0A 1WZMA 1S2TA 2OLHA 1I1XA 4MG4A 2NQ5A 4ERIA 4N6EA 3OPSA 3M4HA 3AOFA 5CZSA 3OQ8A 4JHOA 4DJFD 3OTRA 2OTDA 3QV9A 1H0IA 4KPLA 4MB5A 1F3XA 2Y2WA 2FTWA 4WSKA 3PJWA 4NI8A 3C2FA 2I14A 4QIUA 3ZJ7A 8CGTA 3TC6A 4DQWA 4DWSC 2QW5A 4AD3A 2WBGA 1XCWA 4ACZB 3W1LA 3M0IA 3PBWA 4CN1A 3THUA 1NSJA 1O5QA 4FR1A 3G0UA 2HZGA 4DUVA 1O12A 3VGDA 3FOKA 2ATSA 3O07A 4G5DA 5CJMA 1EA0A 2BGNE 4DZ5A 4GUFA 4Y9AA 5AECA 4GYJA 1JXJA 2PMQA 4MZ1A 4US6A 5G1TA 3UJ2A 2Z1SA 3WQOA 4M19A 4TMBA 4IMEA 1QOQA 3THQA 2E8YA 1Q6CA 4B91A 1JRCA 1AZ2A 4HQVA 3U7BA 4AX7A 2XIBA 1DVJA 3TFXA 3HURA 2BDQA 1GPFA 2DZXA 4AIUA 4BK9A 3BAXA 7TIMA 3EOSA 4D6FA 1L6YA 3TTEA 5LNUA 4POCA 4JEQA 3UYCA 4Y7EA 1MXDA 5TD4A 3WCZA 3CWNA 3GIYA 3PN8A 4OT7A 3WLLA 4H04A 1R3YA 4IP4A 2R6OA 1V3IA 3BCJA 1GKQA 1JZ7A 2OGYA 5F2IA 1XIMA 2V81A 3CZGA 1W5OA 1OX5A 5C9UA 4NSBA 1XSKA 2EPKX 3FJNA 3F2DA 5LIUX 4XB3A 1TV5A 3MV11 3ARYA 4C6MA 1HL8A 1IIGA 3MSYA 4JS3A 1KBLA 3KTCA 4ZOEA 4AMAA 3WIJA 4KQNA 3UW6A 3B8IA 2YXGA 4KESA 4HYVA 2GJPA 2ZX7A 4Z2LA 2QCDB 4N9EA 3U4FA 1V6VA 4UTTA 4FLRA 4JQ2A 4RZ6A 5BOFA 4J9JA 4JTGA 1ZTVA 4ZB0A 4IG2A 1GEHA 2CZVA 1Y5XA 5GJMA 1KA9F 1JFHA 2OZ8A 3DHPA 1H1YA 3AXKA 3B9OA 3HGSA 2ONEA 3KBVA 5JMUA 4DF2A 3W82A 3I7QA 3C0SA 3K5XA 4JX5A 3G8EA 3WQVA 3WD1A 2ZUNA 3N11A 4E4UA 3M0KA 1TPH1 3MS8A 1Y8BA 2ZXDA 4R27A 2X09A 3W37A 3T1GA 4LPCA 1RK5A 4GA8A 1TWIA 4JIQA 3SCNA 1E73M 4HK5A 2F84A 1VFHA 1FA2A 4X0NA 3NCOA 3QHMA 2BVDA 4YN5A 3TNOA 3MSGA 3H2FA 4ZL1A 5I3FA 2BBFA 2EGZA 1E0TA 4L6HA 3VOHA 3H4WA 1S2CA 2XVKA 3UQNA 3WLJA 5F2GA 4QP0A 1V79A 3AYSA 3A4AA 5DRIA 3S5NA 1WDPA 5AB3A 4N42A 1ZJAA 2VFHA 2BHYA 1OX6A 4MAZA 2OYMA 1JEZA 3NZGA 1E43A 4H83A 3L2MA 2E9LA 2C91A 2F6UA 3VOJA 3QTPA 2OQYA 2D20A 3VX0A 4ORMA 2JQXA 5A3HA 3P3BA 1TVPA 2WB5A 5I3HA 2ZRXA 4HTBA 5TF0A 3LCIA 2PRLA 2QIWA 3OG3A 4AY8A 2ZC1A 5KZMA 2C14A 5CPLA 4D6GA 4QITA 3W7HA 1EGMA 1HJXA 3M0XA 4PMUA 1FVPA 4GPNA 1WXZA 3WNKA 5I02A 3MVTA 1H50A 3GHTA 4W5ZA 5I3KA 3IJQA 3GC4A 1FHVA 3BAYA 2PBOA 4MJ4A 2P5NA 4MKNA 4GGBA 3L67A 3CZLA 4EK7A 2GYIA 4UFHA 1NF0A 2C13A 1DJZA 3SADA 3MV01 4LEFA 2ATMA 4PTVA 2VX4A 1BAGA 3MSDA 1LQAA 3HO8A 2DSVA 2FZ8A 1UKSA 4UZUA 1GNXA 1ZPTA 4RLIA 4UTHA 5H2ZA 1H41A 4QROA 3RMEA 4TVUA 3M41A 3WEMA 3WMLA 5LIYX 3MI6A 2QEZA 3A3WA 3PZMA 4S3BA 5DQPA 3LRMA 5A8QA 4LVBA 1UKPA 3UZWA 3P62A 3N2XA 1ODUA 1W8SA 4CD5A 3S2LA 1BD0A 2WHMA 4GE8A 4X22A 2WNWA 5C7HA 3QGAC 1NWRA 3WQ6A 2E25A 2MANA 1PDZA 3K13A 2CBJA 4NT0A 1V77A 3A4JA 3RM8A 2H6RA 5EA9A 1WP6A 1JULA 4FLOA 3LTSA 4TU1A 1BF2A 4YTQA 1J6OA 1ICSA 3GNDA 1V8EA 1JZ3A 2YW3A 4AZ5A 1BSIA 3VMOA 3M0VA 3KTSA 4CKQA 2F38A 1SZRA 3LM3A 3NXLA 4IJCA 1QTWA 1CCWB 4ECLA 2INZA 5LZLA 4TTGA 3U9IA 1TTIA 3AZSA 2Y88A 1ISXA 3W38A 1FCBA 4C6LA 3TW6A 4GYKA 1JPMA 4O15A 3QHOA 2WOQA 3WDPP 1U5JA 2DSUA 4PSPA 4IG2B 5CPQA 1PUDA 2YBTA 4J3SA 4M56A 4PMDA 4O1DA 4LVAA 4D6IA 2EXOA 1KLYA 1JUEA 2DORA 3AMKA 1BWLA 3J7HA 3A24A 1G9HA 1B3YA 4AWUA 1UBSA 2XN1A 3GC2A 1BKSA 2C15A 4BKNA 3B0UX 4V2XA 3V35A 2CCRA 1WKDA 3Q2DA 3S5YA 1DIDA 1UMLA 4K38A 1KXHA 5HQEA 1ZFJA 1W3TA 3EWUA 4HMEA 4NILA 3NQ6A 3V0TA 1Z9AA 3S2JA 1PE1A 4BQ4A 1OJXA 3FA4A 4DIAA 1H2JA 4JHZA 3TN4A 3O6YX 4Q8VA 1SSGA 3M1ZA 1QNRA 3VKBA 4DF1A 4R5EA 3GYCA 4EIVA 5I06A 4GG9A 4PFHA 1B3VA 2F8QA 3QV7A 1B0IA 4XBKA 2BOFX 5HULA 4HCDA 4Z0SA 1RJQA 3CBWA 1IT7A 3G3MA 3PUEA 1XRSA 3RRXA 2WANA 5HQLA 3NL6A 1EJTC 3RLHA 2CBVA 5A6BD 1JZ5A 3LCHA 4YCPA 4UOQA 3N19B 3NO5A 1RBAA 1Z41A 2NX1A 4Q8OA 2WHKA 2YL5A 3AJXA 2ZE3A 4L4PA 2O7SA 3B0VC 1W9UA 1IQ8A 1X39A 3BG3A 5G2WA 8A3HA 4YVPA 2QV4A 5LA0A 4O17A 3A22A 3NQ2A 1WZKA 3BCFA 3QPZA 5FCZA 2YA0A 2PDKA 2RJGA 4UMBA 2X1RA 1XYMA 1CPUA 4J3UA 1HIZA 4AD0A 3AFBA 4XKYB 3VDAA 5FSDC 1MW2A 1K1DA 1XD0A 3TROA 5JUVA 1G7VA 3NURA 1R2TA 3OVGA 3WDHA 3W22A 4HSOA 3UD6A 4DPQA 1F7BA 2OSXA 1FWAC 2WBKA 3M0JA 3ME3A 5BXSA 2YB1A 4PTDA 4Q32A 2QDHA 3VKCA 3DOPA 2VKZG 4JYFA 1KKRA 4Y9MA 1V7YA 4L80A 1P0BA 4IUOA 1KGUA 5KETA 3CZKA 4A21A 4O52A 3AAMA 5TBOA 1OF6A 2QAPA 3WMCA 3G1DA 4LCSA 4QBXA 1WBHA 2WQPA 3VABA 4JTTA 2PGFA 3T81A 3KOXA 2J7BA 2XFWA 1K7FA 4UFJA 3C2RA 1EQPA 3RU8X 2Y63A 3E0FA 4ICCX 4M24A 4GI8A 1OCBA 4CQAA 5I03A 1HZYA 4FALA 5EMLA 3IUHA 4H6QA 3W85A 1WKEA 2J7HA 3UVIA 1J0KA 4C6OA 3THAA 3WJYA 1CECA 1QK2A 4IGNA 1XR2A 2ZX8A 4YYFA 3IK4A 4FPSA 5CGQA 1V6XA 1LJYA 6XIMA 4X9SA 4D8AA 4Y9PA 3I10A 3S9YA 3KOZA 3DFYA 3EPNA 1KQYA 4I9AA 1FQ0A 2VL4A 3ARTA 1YPXA 5F1UA 2I17A 3ES8A 1ECQA 1AJ2A 4BF9A 5BMWA 1OG0A 3MBFA 5J04A 1G4PA 2DIEA 3GXMA 3VU2A 4EWND 3U3HA 4LV9A 2QQ6A 3GNNA 1I2QA 3TYEA 1QUMA 3OGRA 3ZXWA 2CU0A 3KVJA 4MYXA 4RNHA 1J93A 1EL3A 1MWOA 3MT1A 2OVLA 3RUBL 3VZZA 1ZAHA 4UNIA 1D7KA 3LGEA 1PZ0A 4JGDA 5K9DA 2CLLA 1FWBC 3VIJA 1S5MA 2OX1A 2YBUA 1K8XA 1PS9A 4IFKA 4MZYA 2OWWA 4J3TA 1C90A 4YLWA 4IZGA 3IANA 5AYYA 1EJXC 3AHXA 2NQLA 3E3HA 2Q3OA 1FKWA 1SZNA 4ZQMA 3KRZA 5IFTA 1M9HA 3OYXA 3GK0A 4A3QA 5AKQA 1JYNA 3PZIA 1CXEA 3GH4A 4XD6A 4L7ZA 2YDAA 1NAL1 1VF8A 3W7LA 2IQDA 3I4KA 4LEQA 3KFTA 2OB3A 5A2BA 3S1WA 1C7TA 1AMKA 4FNSA 4UFIA 3MSRA 1NDVA 1S3TC 1E1FA 5J8LA 1E6SM 3CHEA 1YX1A 1BVNP 1HXJA 4IQDA 3USBA 3GTXA 2PDMA 3KLLA 4ZSUA 3UR7A 4AEEA 5CZKA 3N4EA 1HTIA 1LWJA 2EEXA 3N34A 4ALDA 2YDQA 4UFMA 4HOXA 4RE4A 4A4AA 1MQRA 1H11A 1PX3A 1F74A 4AIOA 4MM1A 1WKYA 3VD3A 3NQBA 1S2WA 3BSGA 3CC1A 1XFCA 2ZADA 5MF5A 1B5TA 3G1HA 1ZS2A 2CESA 4S23A 2DUZA 5A8GA 4UR7A 3UPBA 5D02A 1KBJA 2XU2A 4I5UA 3N9RA 3SY1A 1XG4A 2BS9A 1PIGA 3PBGA 4Z0JA 4GRSA 1KR1A 4O8AA 1TUXA 3EGJA 2B7OA 1XDMA 1KXVA 4A8NA 3UEQA 4MNMA 5ABTA 2D2GA 4OU1A 1FWFC 4QTGA 1RLCL 4ZFCA 2OO0A 4BQ2A 4LUSA 4U2ZA 1ZUAX 4WEVX 2ZUMA 3NWRA 3RXZA 2CEQA 2ZBTA 2OZ3A 3IVTA 4JTEA 4PN2A 2DW7A 4S38A 3VD5A 4P61A 3WJXA 5E6YA 4RNJA 5DMLA 7CGTA 2G3NA 5C9RA 2ZICA 4H3DA 1WAUA 4PTNA 2FYMA 5D4YA 4L65A 3D0CA 1BXNA 1GVIA 2POTA 3R12A 2PDQA 1LQ2A 1BLIA 3WQCA 3LI0A 4MNKA 2V3FA 2O55A 3L2LA 4NJJA 3L68A 4HBKA 3S6OA 1XP3A 4W4QA 2J78A 1TV4A 4P7QA 3UY8A 4NI3A 1X1ZA 3W7KA 3VDHA 4C6EA 1G94A 4IP7A 3A3XA 2XYLA 1FBAA 4NJHA 1F6KA 1CLXA 4S2CA 1VEPA 4LYQA 1C8YA 4GCAA 1L0PA 3LBMA 2GDQA 5DCBA 3P7YA 4RPPA 2DZBA 4R85A 1XGZA 2IKHA 4F2UA 4ZMGA 5D2VA 5E9XA 1HQTA 2V82A 2XINA 1FP9A 1C92A 3PTQA 1LT7A 3GXNA 5REQA 1UIPA 4IFKB 3POHA 3STEA 3ISIX 5HBFA 2GGGA 4EWJA 3PZTA 2ACSA 3G1VA 2I7GA 2C0HA 4E38A 1TWWA 2CBUA 2PWDA 5E09A 2QJJA 3OVPA 5CXPA 2B4GA 3UCDA 1WZLA 4Q6XA 3Q65A 1E6NA 3Q94A 2F9RA 4O12A 4DBEA 2BSLA 4U28A 3AHYA 1RHCA 1XDJA 1EGVA 1GOWA 3C52A 4O0ZA 3OHIA 3BARA 1NFPA 2ZC8A 3NZ1A 1CIUA 1W1VA 1J0HA 2JEQA 1K02A 4KT2A 2I5IA 2WM1A 2QCEA 4ZENA 2AL2A 3FJLA 4CD4A 2D0HA 4MTVA 3SQLA 4WY0F 3VD9A 3GU2A 3CHFA 5HR6A 1TSIA 4J4KA 4WOQA 1NDWA 4BQ5A 4PB5A 3WFAA 3U6WA 5JIWA 3OA3A 3KZSA 2CZ5A 4C1LA 3MCNA 4R88A 3EMZA 1X6NA 3C86A 4GNJA 1GG0A 4NIRA 2UY4A 4ES4A 4KEUA 2G8ZA 4O11A 1L6FA 1C93A 1QI4A 1UD5A 2R1LA 2WSKA 4YJ5A 1L9WA 1OD8A 3SCPA 2ZWYA 2HE5A 3H4GA 3FK4A 4IMDA 4CVWA 4O14A 2XZ7A 3FDGA 1IR2A 1EC8A 1BKHA 4U2YA 4EOUA 4KF1A 4G8TA 4DUOA 4HIBA 1W91A 2QT3A 4K1GA 4LUSB 4LANA 2D22A 3OJGA 4FI4A 3G2GA 4CNUA 3MO7A 1POKA 3VZYA 1BGGA 1H61A 3KBJA 3LPFA 4AD1A 2ODOA 1DE5A 3PSWA 4GKTA 4Z08A 2DDXA 2IQ0A 1BTMA 3LMZA 5T91A 2OZTA 1EWDA 2OO6A 4NHVA 1UP0A 3T2OA 4C6BA 2ABAA 3BO9A 1NM9A 4PUNA 1WOBA 3M5VA 5L6UA 3LGGA 3R0KA 5A94A 3LHUA 3QHNA 2FKPA 3UG3A 5K4ZA 5CPOA 1SMAA 2FTPA 1J12A 4LY4A 3H55A 1LF1A 4D9PA 1W32A 1M6JA 1EQCA 2NLIA 4Q6JA 1JAEA 3POCA 4EXQA 5XIMA 2HV5A 3TTQA 3CUZA 3H7RA 4DXXA 1HP5A 2HBVA 4GUGA 5FIPA 4XIAA 4BFAA 1PCKA 3EOLA 4DJEA 3TMLA 1PZ3A 3W2JA 1VBRA 3RAOA 4FIQA 1MMFA 4S3GA 1UKQA 2G4FA 1EFZA 4AIBA 2ZXAA 4FF5A 3BSMA 1XI3A 5HJXA 1DYSA 5REQB 1UWUA 2XH7A 4WK9A 4B5SA 3B97A 2WNZA 1TB3A 4K7VA 2JKAA 3GY1A 3LPPA 1BYCA 4WF7A 1UD2A 1Q6DA 2Z2UA 3FKKA 4J2PA 2D24A 1SYTA 1R87A 1XWYA 2CHOA 4XVEA 3EPMA 2V67A 3QYQA 4C6QA 2D69A 1FWSA 1ME7A 1FHUA 1PDYA 2YPIA 3TXVA 4YNGA 1FWIC 2IKJA 5KTLA 2YZ5A 4GX9A 5D9MA 3OA5A 3OIXA 4W7UA 2AL2B 2CNCA 4A22A 4UOJA 4I7UA 3T4CA 2P8BA 2ZVRA 2OJPA 3V3WA 4HMCA 7ENLA 3CUHA 3CIWA 1HKJA 1A5SA 4DJFA 1TKKA 1GPWA 3LXAA 2CZFA 2NQZA 1VP5A 1CXIA 2CBIA 3MUY1 1E6ZA 3USZA 4L9ZA 4BI6A 5KSWA 3AWOA 4DXVA 3W2LA 1I4NA 2JIWA 4MWAB 1I2PA 4MOZA 1XLLA 4Q8WA 3MYPA 2PFHA 3RMJA 3VC6A 3ABSA 1XIEA 1E9IA 2VMFA 1UH2A 4O57A 3MKKA 1OFPA 5C8BB 1OK4A 3GTFA 2HK1A 4C5YA 1P6CA 4X2RA 3RNDA 2PP0A 3NGJA 4DJDD 1BRLA 2D2OA 3IJ8A 1QPOA 1B2YA 4KERA 3E0WA 2YCIX 1KD0A 1ZAJA 4H8HA 4F3HA 4JZ5A 2WMIA 3CHDA 3IAPA 1HJVA 1DXIA 1R47A 4YWSA 1HGYA 2CLMA 2GLKA 5I6SA 1K6AA 2HDJA 2R14A 1HX0A 5LNRA 2ADAA 1IWBA 3LI1A 1VIZA 2TAAA 3BTNA 2VR5A 1CLVA 6REQA 1DWFM 4XK2A 5DN1A 3ENLA 4YHGA 1PAMA 3TTOA 2VELA 4ROPA 4ZO7A 1G5AA 3KTXA 2G5WA 1OFOA 5D30A 2Z7KA 3SY8A 1TPB1 4D6JA 3O05A 4FX6M 3LXCA 2D3NA 1O5RA 3L4VA 3VDBA 2RFGA 3ARZA 1B57A 1REQA 3CWOX 4HCLA 3W7PA 4KETA 1TPWA 5SWUA 3ATYA 1O7AA 4Y6GA 4IOTA 4XSLA 4GZIA 3LHYA 3NZQA 3AICA 2FHCA 3BWWA 2QCGA 4NYUA 4K2SA 1Q6RA 1U22A 2VQTA 4CQDA 5A5WA 4Y8FA 3CS2A 1WDSA 3EA3A 3IACA 3FYOA 4WZHA 1JZ4A 1KWGA 1Q6EA 3DI0A 4IHCA 4UC5A 5EPDA 1XW8A 1UR8A 2VZTA 4GUJA 4TX8A 3BAKA 1XLGA 4LUTA 1EOKA 2R1MA 5XINA 3SUTA 4WXYA 1W3JA 1W1B1 4D2JA 4PMOA 3UGVA 2GFTA 1YNQA 1D3GA 3AALA 1J01A 1YNYA 4GVFA 3L66A 3VGBA 4D6DA 1P1MA 1A47A 2FZDA 3NR0A 1E51A 4IIBA 3LBOA 2Y62A 1S5NA 8TIMA 7A3HA 2DGAA 1F6PA 1YW1A 4RNFA 2VZUA 3ALFA 1VEOA 2NV1A 4U5IA 1VYPX 3TOPA 1R7OA 5FESA 1EJWC 2GWGA 2WO5A 3AS0A 5MKGA 4OOUA 4HZMA 3T42A 3URNA 3ZT6A 2CETA 4Z2IA 4NJGA 3FVDA 1V3HA 1JRBA 1X1NA 1K4GA 3L9CA 2E7FA 2ANUA 1AUSL 7XIMA 3P61A 4BEQA 2GVGA 1G4SA 4O1EA 3JR2A 4JTFA 1UOZA 4RW3A 3MMWA 3WBEA 4BWLC 1S5TA 3BLLA 3RR4A 1RCQA 3URBA 4B5VA 1LUCA 1U30A 5EMMA 4GH3A 4NNCA 3M0ZA 1K70A 1P0EA 4FXSA 4LX4A 2HXUA 2XJ7A 2QF7A 2B0MA 3TJ4A 3PS7A 1CGXA 5BRQA 4QNEA 2W79A 3AIVA 1P0KA 4EPKA 2OZ0A 3QR1A 1TV2A 2WXDM 3GU9A 1BRLB 1A3HA 3R0UA 4KW2A 2E3ZA 4KGLA 1E9LA 4Q22A 3NQEA 4KKXA 2VR4A 1QNOA 4HZ6A 4IGHA 5E9AA 1V0LA 4W8BA 4J27A 2PF0A 1MNZA 4XD4A 3WL1A 1XPYA 4LBRA 3W73A 2WMIB 4GYPC 3NM1A 3GVQA 3OVRA 3L2IA 4WJ8A 1ME8A 4FIRA 3HJZA 4MB1A 3NTYA 3AYRA 1ZP3A 4MLJA 2C19A 2ZXBA 1CXHA 1EUAA 3VUSA 1W5MA 3N04A 4M7SA 4NZJA 5G2IA 1E0XA 1G1YA 3MBDA 1DXFA 1D2KA 2VDHA 3EDJA 4A3YA 3UZ5A 6REQB 4QS6A 5DFAA 3UJFA 1N8WA 4ADUA 3RLUA 1AD4A 4HPXA 5C6MA 3FN9A 5DMNA 4D8ZA 2XVGA 2HJPA 3TIMA 2CC0A 1CX9A 1QXLA 3NNTA 3CK5A 1ZB5A 2YCJA 1KBKA 1HO1A 1VRXA 4I9MA 4KCUA 1FHDA 4AFYA 3W1NA 3CAKA 4LS1A 3I6EA 1TVLA 2G50A 1HJUA 5D2YA 2BLEA 1Q4NX 1REQB 4B2DD 3GKAA 1ONEA 2Z1VA 4WOZA 2QJHA 5IFPA 1VRDA 3TFCA 4CQ8A 4NX5A 3WO8A 2DZSA 4PULA 3HQ1A 4DEFA 1LLOA 3NL2A 1DL3A 3QPEA 3ZM8A 1LZOA 1X6LA 3AHZA 4ATLA 3M43A 5EFDA 1RUSA 1V6TA 1V08A 1C8QA 4IQLA 4DVOA 1ADDA 1HN1A 3QC0A 1UC5A 5GVJA 2VFIA 3FDKA 5HA7A 3SCOA 2P50A 3RX3A 4LUTB 2CLEA 2X1IA 1OGSA 2E6AA 3IGSA 5FJOA 6ALDA 5CAHA 1DOSA 2GSEA 1EPXA 5C0QA 3AWNA 3XIMA 2CLHA 1K9TA 3UJSA 1XCFA 3B8SA 3MUZ1 1R5YA 3WK3A 3GHRA 1KC7A 2OG9A 3TAKA 4CCCA 4LT9A 3GG7A 1OYAA 4PRWA 4AWTA 3ABRA 1LROA 1PVNA 1CDGA 5CEWA 3NO3A 1FWCC 2CWNA 3TWAA 1KGXA 3VNLA 1ZALA 4PBGA 1O5KA 4C65A 3BQ5A 1ISZA 4HPJA 3VGGA 3PJXA 3IV8A 1KFKA 5MKGB 5AHNA 1E9ZB 4H8NA 4TR9A 4BCEA 2XDFA 1VENA 1QHPA 2WK2A 2VTFA 3W1QA 1NOUA 4QG6A 3UG4A 1Q6OA 3NPXA 3QM3A 6PTDA 3SSZA 3VIKA 3W1PA 1BF6A 1B3OA 2FZNA 3DERA 4D6CA 3MVIA 3UFYA 2O56A 2E09A 4FSAA 3GDBA 1LUCB 3R10A 4F79A 3VD7A 3BXWA 2YB4A 1M7JA 3ARSA 4R34A 4AZBA 1GWJA 3BC9A 4GZEA 3HJEA 3NEVA 3TTYA 4W86A 2XGZA 2GJNA 4NASA 5A6BA 3W9ZA 2CERA 5BOEA 1Q13A 4JR5A 3SB0A 2BOGX 4XKMA 2XN0A 2A21A 3UPMA 3VC5A 1BVZA 2FJUB 5C9XA 4C91A 3LHTA 1HG3A 2BP1A 1UWTA 2BG5A 4A3RA 3AQUA 3IRDA 2W67A 1UR4A 4PL2A 3PPCA 5HQMA 2JGQA 4FLQA 4R9XA 3KDOA 3PWIA 2ISFA 3LD5A 4FNPA 1YKWA 4HA1A 5CKSA 4CNOA 2YXOA 4ADSA 3BJFA 1XYZA 2B81A 4JX4A 4YTRA 3IJ6A 1E6QM 4BA0A 2IPWA 3VM7A 3H2MA 1KM0A 3LCWA 1YMYA 2V5DA 1LOSA 3LPGA 5LIXX 4WIWA 3WJZA 3MP4A 3CM4A 1IEIA 4JTDA 5IOBA 2WC4A 1TTPA 1I0BA 3N3MA 1G7UA 2GDUA 4GI6A 2YLAA 4LYPA 4IT1A 2PBGA 2OEJA 4INFA 4JIEA 3KOFA 1EYEA 4B4FA 4QG9A 2YCKX 2H3DA 1KV5A 1WKFA 2J77A 3W27A 3RU6A 1T5AA 3PZQA 1TJ1A 3KZPA 4O4VA 2ZA3A 1B1YA 2IUZA 2Y7GA 3IARA 3TMQA 3RX2A 2WSQA 3ZVIA 3KL0A 3TYZA 3M5YA 5CGTA 3O6AA 3AI0A 1U33A 2H8XA 1JUBA 2PTZA 3PZNA 4XZLX 3LA4A 4H19A 4ZCWA 1HJWA 2WLYA 5I24A 3PJUA 3TQPA 4XBJA 1DJWA 4N4PA 2VCAA 1UPMB 5T9CE 2VR2A 2NWSA 3RGTA 2F6XA 3GDLA 1R9YA 3IRSA 3E74A 2NUWA 4H6KA 4OBTA 1TWZA 3C8FA 3ABXA 3ZO9A 1ZBKA 3C2YA 1FRBA 4FZIA 1B9BA 5FOOA 1A4MA 1TMQA 3GG1A 2GGIA 1QATA 4RV8A 2NSOA 1W5NA 3FSTA 4DYEA 2QKFA 2X2GA 3MYOA 3ITOA 1R9XA 3OBKA 3PZGA 3FHQA 5AZ0A 2VRKA 1L6GA 3O3RA 3K46A 4JY9A 3V16A 3R8GA 2C16A 3STGA 4JTQA 4XAPA 5CC6A 1V0MA 4A8RA 2P0OA 1TCDA 1LL6A 4ZQRA 2ZX9A 1NDYA 1W1A1 1E70M 3CL6A 5EGRA 1KNWA 1Q66A 3OVQA 3ZR5A 1LDCA 4OZOA 1GORA 3KL5A 4B92A 2EJ1A 3SBFA 2R9RA 2OKOA 3CV1A 5HMFA 1Y65A 2UZ9A 3QZ6A 3KEHA 4IGMA 1R85A 1W3LA 3TYAA 3N25A 3MU7A 3AMGA 5LSMA 4M1RA 4CNTA 5FJUA 1SUXA 1KFBA 4H9VA 3JVAA 1JPHA 1GYMA 3WH5A 2XSAA 4QR6A 1VC4A 1JCLA 3VNMA 5LGZA 3CNYA 1YYAA 3UNDA 2BY0A 4HHMA 3UXLA 1JDAA 3M0YA 3N13A 4TOQA 2GK1A 3QF0A 5CJ5A 3EX6A 4ROQA 3VGHA 4N9DA 2Z2BA 1IGSA 1IEQA 2VEFA 1IT8A 2PGWA 1FDYA 3BAIA 1AQMA 3PBYA 1UZDA 1N2VA 4XAYA 1J4EA 3GXPA 4OV4A 4GVIA 1QR7A 4UXDA 1EKOA 2HMCA 4NNAA 1W1YA 3M64A 3JUGA 1EHNA 3TCSA 3G6LA 5I09A 3UETA 1TFVA 2G41A 4MDOA 1EPVA 1XRTA 4J3XA 1H51A 2HTMA 3OGVA 1OC7A 3DGBA 3GDMA 2PP3A 2BXVA 1F61A 1M04A 3S1UA 4ZOAA 3P67A 3AIBA 3NJ3A 1NWTA 4AC1X 3EXRA 1FWGC 3R94A 1W6TA 4CLMA 4WR3A 4ZE4A 3GBEA 2FJKA 1C8XA 2VX7A 4A3HA 4YU1A 3ANUA 4DBUA 4EE9A 2PP1A 4GXMA 3DG6A 2NVAA 4JQAA 1A3WA 3UYIA 2X7VA 4IMFA 2DVXA 5K2ZA 1EC9A 2H9AA 3QJAA 1WUEA 1BGAA 4LQ1A 4PYSA 3OZPA 3VGFA 1LRTA 2P88A 5T26A 3MMUA 2ALRA 3GXTA 3LHZA 3GXDA 5H1WA 2OSYA 1B4KA 3H6OA 4OJYA 3TU9A 1YPFA 3W1RA 1YDVA 4GK8A 4HT3A 3TOYA 3BV4A 4LS0A 4KBXA 3IV3A 2H3BA 3ONCA 4EXBA 3EZ4A 4XAZA 3IPWA 2J25A 1OABA 1ZQ5A 2VOTA 2OMAA 2VHLA 4H4IA 4MDPA 4RUBA 1PYMA 4LFYA 3ZT5A 4AD4A 5JH2A 1SZFA 4DN1A 3GNRA 1W0MA 4PUDA 3CEPA 3EA2A 5AHIA 4M82A 2ISSA 1EJ7L 1GEQA 2YZRA 1GVSA 1UUQA 4E8CA 5CZ0A 5GJNA 1CGUA 3E2SA 1JPKA 4HD5A 2O9TA 3Q67A 1UD8A 3MWAA 3WBXA 1S2AA 3B9NA 4N6FA 3GG8A 4HSHA 4QG8A 1M1BA 3O6DA 2JF6A 1NH6A 2W3ZA 5AC4A 5D9OA 1HVQA 2QVHA 4IX0A 2A7RA 4JDYA 4KRTA 3A5VA 1US2A 3OLGA 1B30A 1GVRA 1EC7A 1RLDA 3STCA 3QKEA 4R33A 3GR7A 3LTPA 1TREA 2WMFA 3L4YA 1V7AA 2AAAA 4CNSA 3TA9A 1RA5A 4LGXA 3OLDA 2G3IA 4MUPA 2GK1B 3Q4DA 1QOPA 3BAJA 4YTSA 5D8WA 1E72M 2HSAA 1F4HA 3BZGA 5CGMA 1NY1A 4WRHA 4IF2A 3W7EA 1EBHA 1AODA 3QQ1A 5I78A 4GIYA 1RPKA 2UY2A 1NVMA 1WNOA 1W3IA 1CGYA 3B8VA 3MZNA 3W29A 3VDCA 4G1NA 5IXEA 2E5DA 4F8XA 1UD3A 4PCTA 1J0YA 4UCFA 2QGYA 2CFFA 3WLKX 2AQVA 3LHWA 4ERAA 1E3XA 4M51A 4JTSA 3LHVA 1EHAA 4HHHA 4MY9A 3N9SA 2DT1A 1UR2A 5C71A 2DZPA 4KWOA 4UTMA 2POZA 4RZBA 3WH9A 3EWYA 3VGEA 1FWJC 3TLLA 5AYXA 3DFTA 2Y61A 5GNYA 3DN5A 3ABQA 4DPPA 4R53A 3WY1A 3Q58A 4AVNA 2A3HA 1EB3A 1EDTA 1OM0A 3TLQA 4S3JA 3GQYA 3VINA 4OVXA 3DU0A 3EWWA 2H9AB 4WKFA 1G6CA 1L6SA 3PB0A 2QZRA 3I65A 1OFRA 2VNCA 3GB6A 3VIHA 1DV7A 1G4TA 3LZ5A 1HT6A 1P6BA 3ITLA 5HK4A 2UWFA 4LCQA 4R7JA 2VO5A 2BFGA 4NAFA 1CWYA 5I5RA 2A6LA 3E6EA 3QFWA 4KMQA 2C1GA 1QNSA 2YX0A 4AX6A 2ZZ2A 4NQ1A 3W7CA 5LNWA 3LNPA 2HVMA 3R11A 1XQLA 4FS9A 4YTTA 4DUWA 3EEZA 3HGRA 3TJLA 2VDGA 4WXZA 3WLNA 2DZVA 2AQWA 1M7OA 3CQ0A 4KRZA 1ONWA 2QDDA 1HW6A 1PWMA 2GZXA 4B16A 1TR1A 2PDWA 3UXIA 1Q7MA 4Q4KA 3ZT7A 2PCEA 1XQKA 1CB7B 1D7FA 3A4XA 4PCPA 1SPQA 2NXHA 3U2EA 2EPNA 3MMTA 4AD5A 2EG8A 2J7CA 2REQA 2XM1A 3W00A 1FDZA 5BZAA 1G0CA 2J75A 4LW7A 3G1SA 4R7OA 2VD8A 1UJPA 4Q4QA 3BURA 4PUEA 1R0MA 1EBGA 3SFKA 4J7RA 3LEPA 2GGJA 5HWMA 5CSUA 1FKXA 4LSBA 4FHAA 1QI5A 3EOUA 4O4WA 2VUYA 2X8RA 2YYTA 2C8NA 4C6NA 1IE7C 1E9YB 4DI9A 4QM1A 4I8DA 4ADTA 1UWQA 4A35A 5ECVA 2WHJA 1LBLA 1VEMA 3HG4A 4IMGA 1JQVA 3I6RA 2XN2A 4MY1A 3UXAA 2YSWA 1MEIA 4QLKA 3EXTA 1PPIA 1XLJA 3KCOA 4QQUA 1RCXB 8XIAA 3RK8A 4YVXA 1YIXA 1QOXA 3OIHA 5IHSA 1IXOA 1EWEA 3ZFHA 1JDFA 4TQTA 5EKYA 1XIDA 1TV8A 4FOUA 2Z28A 4PMRA 1Z44A 1C29A 3JW7A 4XTDA 5BNKA 4Q33A 2XH0A 1AD1A 5EMJA 1WV2A 3K2GA 2WPGA 1Q63A 4U10A 2O4QA 1N8FA 3K8KA 1KFLA 2HVNA 1UWRA 1V51A 2XFFA 2OOFA 1I8JA 4DJDA 2BZNA 1O66A 2ZZ5A 3ZSTA 4NP7A 3B0XA 5KZDA 2RHGA 4HZ8A 5FEZA 4DWSB 3QY8A 2OU4A 1V93A 4EPBC 1F9CA 4PMYA 3LZ3A 5FJRA 4V1YA 4IPNB 2IPGA 3N14A 4H00A 2Y24A 1E0VA 4EAYA 3ITXA 1UC4A 1V3JA 4JDBA 4UR9A 5DCDA 3E0LA 1JVNA 4L56A 4LB3A 3PANA 1B90A 1HKIA 3RPTA 4GCXA 4JKKA 3WMSA 3VZXA 3W83A 3LMYA 1EOMA 1WE5A 5AHLA 4LAKA 1SZEA 1FTXA 1H5VA 2VC6A 1QHOA 1FWWA 4GY0A 3IAQA 4NAFB 5E0CA 5DCEA 3E02A 5M17A 1XLIA 4URIA 4KCTA 3MCMA 1NDZA 1J10A 2ICSA 1OYBA 1ITQA 1SGJA 1BYBA 2PDBA 4XZIA 5T9BG 3WZ0E 3LERA 3MP5A 4EPEC 3V5OA 3AYVA 2D0FA 2DQXA 1M7XA 2G97A 5JXQA 4DHGA 5H8MA 4ZOCA 4WSHA 2GOUA 4GZ7A 3T2QA 3CT2A 3MTWA 3F1QA 3RJXA 3L4TA 2PDUA 3CTLA 4S3KA 4H6EA 1F5ZA 3M47A 3A13A 3VKJA 3HQPA 2WCGA 1GW9A 3P81A 4RL3A 2Y70A 1ZAIA 4I5RA 4RR4A 4QFUA 2QS8A 1XBYA 2Y7DA 4MJMA 1ZBCA 1LLZA 3WK0A 1H1ZA 3K1GA 4UR8A 4ZO9A 1I75A 2REQB 3M44A 3PZUA 5HWNA 5A2AA 1CB2A 3E49A 1I60A 2VVSA 2E1WA 3U5YA 3PG9A 1W5PA 4WDTA 4QE5A 3FAXA 3S83A 1NP0A 2ZTKA 1FCVA 1NWSA 3IJDA 4MWAD 2XVPA 3ELFA 2OQHA 1FH8A 3NQAA 2QULA 2X0YA 4QAIA 3LX9A 1E56A 3GW3A 2XTKA 1PX8A 2FDSA 3VMPA 1FWEC 2CXEA 1R86A 4M81A 1N82A 3W72A 2CKRA 5JIPA 4E0CA 3L4WA 1QPNA 1OFBA 4RKAA 3F5KA 4UMCA 2ZTJA 5LXEA 3ABZA 3E2VA 2PRHA 1KR0A 3IJLA 3C6CA 2PDYA 1R6WA 3BV7A 3SCSA 2ZOXA 1JJKA 3DECA 1DJNA 4HU8A 3WQPA 3EAUA 2PDGA 1Q6GA 2Z26A 1EDGA 2VURA 1QAPA 3N2OA 4JEJA 4IISA 3LY0A 3E2RA 4O1AA 3B8TA 4B3LA 3OZOA 4F2BA 4P8XA 3WQ4A 4FNQA 3WQ5A 4J40A 2XSBA 4XO7A 4E4PA 2GSHA 4H7ZA 2A7NA 4EACA 2PC8A 5I3DA 3JS3A 1BHGA 1RY8A 1HL9A 2HEJA 2AGTA 1SFJA 2OT1A 3NL3A 2JKPA 4PB4A 3BJSA 4D1JA 5FF3A 3GNPA 2CXGA 1JIBA 2X7WA 1OCQA 1FHLA 1MQPA 3O06A 4V15A 1OCJA 4GFSA 1H7OA 4Q7NA 3IVSA 3AMCA 2GVLA 3RYSA 1VLIA 5CPMA 1V0NA 4LU0A 3SRHA 2HQAA 3FV9A 3K8MA 3W02A 3C0JA 3TR2A 2WJDA 4Z1YA 3CMFA 3EB2A 2NQJA 2J47A 4WJEA 1YXDA 2J8FA 2RJHA 4GQBA 4NAEB 2YKKA 2QLYA 4Z2KA 5DXYA 1HJQA 4ATDA 3ZVHA 4E2VA 4HN4A 4Q8UA 2QCDA 3ANVA 1ZY9A 3PY2A 5EMKA 4RJEA 3DBNA 3W71A 2XIOA 4KEVA 4KCWA 3L4UA 5HMDA 4ZO6A 1YADA 1S38A 4AY1A 3B9EA 1K7XA 3UZYA 3CMGA 3WFZA 1OY0A 4Q4MA 2VEIA 1VBGA 2ON3A 3D3AA 3CAWA 1R7AA 4B2DA 3D3FA 4P8VA 2J7DA 3DXIA 4ZA0A 1UYQA 3Q45A 3S0CA 4LVFA 1GQNA 3P93A 3NQCA 3WFLA 2DH2A 2DW6A 3DFSA 3ZIZA 3PAOA 1ITUA 4PE8A 2RH9A 1A53A 3G0XA 4DJEC 2KAUC 4U5KA 2GQ3A 4P7RA 2PDFA 4L64A 4E3TA 3P5YA 1XC6A 1X8FA 4JFTA 5CC3A 4CU8A 4KRUA 1G69A 3EYPA 3QLDA 2X42A 1TZ7A 1OFAA 4NZFA 4CCEA 2PAJA 3N17A 3F03K 2DJXA 3MDWA 3MW7A 2CW6A 1O68A 1EO5A 5C55A 4RDYA 4TTUA 1UH4A 3DYMA 3MUCA 5HPOA 4C6CA 1E6RA 4ZFMA 2BTMA 2VRJA 1SSDA 4N9CA 3DHDA 3MY9A 5CAKA 1SJCA 1ADSA 3LCXA 3OQEA 3MJYA 1JCMP 4QISA 3WUFA 1AJZA 4DO5A 3NYDA 5D32A 3T09A 2WQDA 3R5EA 4N2YA 4Y8EA 4DJFC 2W66A 4IPJA 1BFNA 2WSPA 1JCXA 4BI5A 2MUCA 1KCZA 1AFSA 3EX4A 3FHAA 1MUCA 2A79A 1UUMA 2B7NA 3CHCA 3M7SA 1J0ZA 2ZRUA 5A6LA 1DJIA 3QBUA 1E4MM 1ECEA 1OWQA 2BOEX 4KGJA 4NJIA 3MUXA 3H7UA 3I7SA 1Q4WA 3KHJA 1MUMA 1RV8A 3V5FA 2I56A 4GISA 2WJFA 4QDWA 1TMLA 1I9CB 3COTA 4IXHA 1EH9A 3CQHA 3HBLA 5A6TC 1E6XM 1K03A 4UQBA 1SW0A 3TN3A 2NXGA 1KM4A 1F4AA 1IEXA 3C5QA 5HUPA 2W6RA 1TELA 4Y2WA 1V02E 2G4JA 5I07A 3A6OA 2QGHA 2CZDA 5AC5A 1OC5A 3BANA 3ZVHB 1OD0A 3HPZA 3IJIA 3M16A 3U2CA 3ZR4A 1ZJIA 4IFRA 4N0RA 1OT1A 2NVDA 3JRKA 5CPTA 1UR1A 3S5OA 3VXGA 1TV3A 3PVFA 1XKYA 3CAQA 1TV7A 3WK1A 3FA3A 3UZZA 1VFMA 1NQKA 3NM3A 4V27A 1JF5A 4JY8A 3O16A 3AIUA 3ZS4A 1F3TA 4GVGA 3O6CA 5F4WA 2VM8A 2O7QA 1DIEA 1X7IA 4W85A 2PTDA 3NQVA 4HPNA 1P6WA 1NOWA 3AXHA 2DZAA 1LRNA 3EDEA 2D3LA 4W7WA 2NT0A 2Y1HA 1CT5A 3S8HA 2DSZA 2QAFA 5FF4A 1QI0A 4RXGA 4G9PA 4OBSA 3RPMA 4AHOA 2FHFA 1P43A 2PUZA 4MB3A 2GUYA 2A4AA 5D2WA 2JGYA 4GD0A 4LNYA 4MVAA 2PODA 1RP9A 2ESCA 3WQWA 2R8WA 5DXXA 3A3HA 1WO2A 2WVVA 1TRIA 4JCLA 4ICNA 3W70A 1WXYA 4GQ0A 1BXBA 3AS1A 2VFGA 2X1SA 3JU2A 4YS1A 1XRFA 1FFQA 1LP6A 4U33A 5HJYA 1XBXA 1VFOA 4TXEA 3SRDA 3NDOA 3NEHA 1XSJA 1XX1A 5FF7A 2PZNA 4PUJA 4NY2A 2X2YA 3APYA 2CLFA 3AYTA 3WDJA 3KWSA 2QUUA 5FSEC 4AH7A 3BGGA 1NELA 3AHVA 1XLMA 1O94A 3W6MA 1DWHM 3RO6A 1M01A 3BJTA 2IPJA 3OW1A 5BOOA 1VS1A 3FAWA 1B3ZA 4XKYA 1LL7A 3TQVA 2P53A 3FXGA 3G1AA 1S5WA 3B04A 3KRBA 2Q6ZA 4JQ1A 2JE8A 2RGMA 1SM9A 3P80A 1S1RA 4HHPA 2QCCA 1DPMA 3GG0A 3LDVA 1WAWA 3B05A 5AYIA 1X98A 2P3EA 4XV0A 1XLEA 3VPLA 3QOKA 1ZSXA 4RDWA 1J79A 4H9UA 4G7EA 2E5CA 4IJBA 5IDIA 5AHFA 3UVAA 3WEZA 3WK2A 3AIQA 4AY7A 1VIWA 2YW4A 1XLBA 1K9EA 2QPSA 2Z2AA 1KW1A 1DTNA 3WF2A 4GNVA 1I1WA 1JXKA 1VFSA 2Z7GA 1KRAC 1FY6A 1K3UA 3R25A 4NRRA 4O0KA 1DJXA 2YLLA 4S3DA 4NZ3A 4X63A 3LS9A 4FNTA 2HS6A 1VBJA 3G18A 5FEXA 2VDIA 4F0SA 2DIKA 2X16A 4GUHA 4KFOA 1VD6A 4GACA 4ZB2A 4OQVA 5I3IA 3SUUA 3KLKA 1VKFA 1PEZA 2VVNA 2QCFA 1H0GA 2CPUA 4K68A 4FXRA 4LYKA 1V02A 3FXYA 1R9ZA 4UTWA 4CN6A 3H7VA 1DHPA 4F2TA 4HNVA 2EJAA 1V0KA 4IM4A 2FZMA 5G4WA 4RE0A 3NOEA 1MFUA 2ZX6A 1NP2A 3GZ3A 1UIOA 4DYJA 3I3BA 3KM8A 4HCHA 1R46A 3KP0A 3EMCA 4AZGA 2ZZ6A 1KWKA 3NQ7A 2J24A 4G6CA 3U57A 1IYXA 1YXYA 3HGJA 1PO9A 3TW9A 5EU9A 1OF8A 2JEPA 1F07A 2Z4GA 4JL2A 3KVMA 3BL3A 4XZNX 3UWEA 3PPHA 4ENLA 1H7WA 2YBVA 4I3GA 3N2CA 5DBUA 1SFLA 2Q8ZA 4Z1CA 1V4YA 3C3UA 4I9JA 1JAKA 3B0YA 4REQA 5C70A 4A2RA 2XFRA 1MYRA 1PHQA 4WJXA 2INFA 3SIZA 3EBVA 3S1VA 4C1KA 4I9TA 3UJEA 1W2PA 3WG6A 4E8GA 3UESA 3WN6A 4BJHA 1OVDA 3RO8A 2WVVB 4FO4A 4XAFA 2PWFA 1BWKA 2GJRA 2X30A 1B3WA 3G24A 5CCZA 3G8RA 1OT2A 2YL6A 4IP5A 5EB8A 5CPSA 4PCNA 2OFJA 1ICQA 1KTNA 4O1CA 1OINA 1UB3A 4B3KA 2FGBA 3LGDA 1NOFA 1OBAA 1Z32X 5AFDA 3ZJ6A 3SCRA 5H8PA 4IPPA 3KX6A 4ZOBA 1MQQA 2FDMA 1OZMA 4C5ZA 3RPDA 3VX1A 1DWGM 1ESWA 4M6VA 3LK6A 3P74A 3FFSA 3KL3A 3I3DA 3WLHA 3NA8A 3V18A 2QMJA 2QDEA 1JCYA 1M7PA 3D6NA 3D46A 1IEWA 1D8WA 1RK6A 4QJ1A 1J5TA 3HPFA 4LRSA 3V5CA 1RPXA 1AW1A 5JVLA 1XBZA 4UMAA 4HTYA 1JQXA 1A5AA 3TQ0A 4PR4A 5EBAA 1SO4A 5FL0A 3NOYA 1T7LA 1JCTA 1CW2A 5DO8A 1RXOB 1NU5A 2CYGA 4GXWA 4HMNA 4P2VA 3DH7A 4G7EB 4KS0A 3QN3A 2BNJA 1VFLA 4RW5A 5HINA 3TN5A 4RE2A 4H1ZA 4JD4A 5XIAA 5A6MA 1FCQA 2DPEA 3BOFA 1LRQA 2V8ZA 1IV8A 3W84A 3OODA 3CIVA 1OQFA 3ARVA 1EDQA 3BUVA 4P7NA 1ZHAA 2XSXA 1FP8A 1PZ2A 3INPA 1AQFA 2G3MA 4I7WA 1HKKA 4IIFA 2XWEA 3P82A 1Q2SA 4ZR8A 3LTYA 3FY1A 3SJ3A 3GDKA 4F9DA 3GAYA 4GC4A 3BCDA 1N7KA 4ZVJA 4L6OA 1UD6A 4C7GA 4C6JA 1YDNA 2WSRA 3B4YA 1SO6A 4JICA 5BYWA 3BICA 1P48A 1OZQA 2Y6ZA 4AD2A 3QRHA 3M0MA 4H2HA 3UCQA 1ZRQA 5ABGA 2PDIA 3FCPA 1XH0A 5FEPA 5CBJA 1XIBA 3AU2A 1PXGA 4L1XA 2J7FA 3LLDA 3NPWA 4S3FA 3ZOAA 2P0IA 1OIFA 4CD7A 2PTWA 2DUXA 4GYFA 4N4QA 4TV5A 2RDTA 5AN7A 1XRVA 4PMQA 4AXNA 5K9XA 4REQB 4B3ZA 4ASTA 2E40A 1DIOA 3NGFA 3ZWTA 4DNHA 4HNUA 1XXXA 3ZLGA 2JF7A 3KOYA 3V36A 9XIMA 4P8UA 3CUXA 2V3EA 1ZGDA 4XUGA 3BG5A 4DAFA 4GUIA 1JYWA 2H90A 3WF3A 1YEYA 1AK5A 2PWVA 2G3JA 3T07A 4HPGA 2OYLA 3GDRA 4XSMA 1BPLB 1Z69A 2B7QA 3QY7A 5FL1A 1PV8A 4GNKB 1C8VA 1TPC1 2YJQA 4I8YA 4MAVA 3TWBA 4DO4A 1ZBWA 1U1UA 3BSHA 1ZCCA 1E15A 1YTEA 1O1HA 1K7EA 4NYYA 3VIMA 1BXCA 4IIDA 4DM2A 1JPIA 2OCZA 4C7DA 4O10A 2J6XA 3CHVA 2VT0A 2J27A 1EP3A 4H9MA 2WM0A 2DH3A 4MFDA 4GH1A 4RZ4A 1KM3A 3LRKA 2EKGA 1EEPA 4LF1A 4FP1A 2NZLA 1YQ2A 1E4NA 2ISDA 3UG5A 2UY5A 2HXTA 1XH1A 1U1JA 1GJWA 4MWAE 3I4EA 2ISVA 1KQZA 5FACA 1TYGA 4IXXA 4O8RA 3E12A 1L6WA 3SCUA 4NXKA 5DEZA 3IGXA 2Z1WA 1Q3NA 2ABBA 5TNVA 3VK5A 2F6KA 4LTSA 1K8YA 3BMVA 1AZ1A 3RG6A 4Y9NA 2ZDRA 1PKNA 1ONXA 3QR3A 1IXQA 2D1ZA 3VFLA 2A7PA 4CCZA 5D2XA 3A23A 1Y7VA 3NZPA 2ZA1A 5B7YA 3GAKA 3ICJA 4O54A 2GVJA 1GOKA 2PDNA 2WWCA 2SFPA 2Q01A 2FB3A 2FFCA 3VIOA 4PODA 1QI3A 4NUWA 3PTDA 1R38A 2RDWA 1XYBA 1I6NA 3FEMA 3S9IA 1XHGA 1GCYA 3HG3A 1S3HA 1GKRA 2ZE0A 3REQA 4JX6A 3PBUA 3LENA 3CZEA 1XJBA 3T55A 4Y9OA 1MW1A 3G5EA 3ITGA 4GABA 1VFFA 3T8QA 3L0KA 3PWGA 3LB0A 1PIIA 3XISA 1FFRA 2ZUWA 2NQHA 1AW5A 3C8NA 4GZJA 3SCQA 1SW3A 3H22A 3GTNA 3W7NA 5C54A 3QVQA 1GQLA 4HA3A 2J4GA 2HWGA 1UOKA 3GM8A 5D05A 3R2GA 1NF7A 4L1WA 1WPCA 1UG6A 3SO7A 3TN6A 2W4XA 3WX7A 3O63A 2NW0A 1J9YA 3PPGA 3PNZA 4IPLA 3W4RA 1GVEA 3BAWA 1GHRA 3LSCA 1YE6A 3TV8A 3NQGA 2AMXA 3TSBA 1V3KA 3A12A 1BVWA 2HROA 1A80A 3BLDA 3UY7A 2J62A 5CZJA 1OADA 3UWZA 3H53A 1Z7AA 1VZWA 4XTIA 3BLIA 4QHRA 1YLVA 3GIPA 1VFUA 1XH2A 2L5HA 1CNVA 4PTMA 5I2UA 3R89A 4TX9A 2FPTA 1BQGA 1RJPA 3ITTA 2NT1A 2J7GA 1K6WA 1WUFA 5CBIA 1JGMA 2CLPA 3PFMA 1MSSA 4CQCA 1U5HA 2E9MA 1E0WA 3S6DA 4ZSTA 4MY8A 3WF4A 3KRSA 1BSLA 1HVXA 3E5PA 2GVYA 1W37A 5JBDA 2BY1A 3NUKA 4I6KA 2NQ9A 4MZ8A 4LBSA 1PX4A 1YPIA 1IEVA 3TNBA 1HKWA 1BYDA 4MWAA 5PTDA 1U2YA 1UA3A 1UROA 4TVCA 5H8UA 3MUIA 2ZYFA 2G37A 1VYRA 1XIHA 4A8LA 3AUJA 4CU7A 3WNPA 1NEYA 3CQJA 3I68A 3LCFA 3T4WA 4YWIA 1SR0A 3R0DA 3C2OA 1X38A 1VPYA 4QLLA 1GOXA 4C6FA 2VXNA 1WZAA 1RQHA 3N6JA 1DE6A 3JZEA 1JZ8A 1GK8A 1MUWA 3T44A 5K7JA 4KWWA 2E68A 3DX5A 1L2UA 4O1FA 3VIFA 1IT0A 4S3AA 3IIOA 4GC3A 4PCSA 4DWSD 4KEMA 3TK7A 4NX0A 5G1YA 4DY1A 2XG9A 4DBDA 2IXVA 1LOLA 5D9NA 3V7PA 3NVDA 4ACYA 1UP3A 2I57A 1BEUA 2QNEA 3MB9A 3QMSA 4WKHA 3CPRA 3NQ8A 1B4EA 4UTFA 1UASA 1XYCA 2PU0A 1MZHA 1Q45A 3C61A 1DJYA 4XIMA 1VFTA 1LBMA 3L4XA 4GJIA 4C6KA 3GUWA 2WVUA 3V0UA 2VX6A 3ARXA 5HMEA 2NX9A 4I90A 6XIAA 4AZHA 4JIRA 3EOOA 3VD4A 2J6VA 3CV7A 3U0HA 3REQB 3S42A 4Q8TA 1YDOA 2DEPA 4LCRA 3OOQA 3EWCA 3VOFA 5E6ZA 3E9AA 2PDJA 1K77A 1TZ9A 2FTYA 3QPYA 5GNXA 2QVNA 1PTDA 2WCSA 5U7SA 3S9ZA 1A5UA 1KV8A 3W2MA 1H09A 1T8XA 3GXFA 5JU6A 1TJRA 1EYWA 4U31A 5FJIA 3EDKA 1LORA 1Q6QA 2Y5JA 3HZ3A 6A3HA 1P4CA 3H24A 1R2RA 2OKTA 5DF0A 4JTIA 3EB4A 1AL7A 1EO7A 3O1NA 1OG6A 5JBEA 3H2OA 2G96A 4QDMA 1V03A 3V1HA 2O9RA 1HUVA 1JGIA 1IIHA 4GBUA 2XFYA 5HANA 3N9KA 3NYZA 1XFBA 1IZJA 2V6AA 2Z1KA 5ENLA 4JBRA 3ZR6A 5BU9A 3B06A 4D6HA 1XBVA 3RFAA 3HIJA 4IGSA 3VKDA 3E2QA 1XGDA 3S47A 3ANYA 2DZTA 2WVSA 2DY3A 3WMBA 4I6VA 3R58A 2DIJA 3IIVA 5FF2A 2I9UA 2PRMA 5BW6A 1HO4A 3WQGA 3CU2A 1QPKA 4J2MA 2WW5A 3NQDA 3KBMA 3N18A 3NDYA 2Q8XA 3S1XA 1PKYA 3SEPA 2W63A 4FNRA 1GKPA 3G6MA 4F4RA 3AU6A 3I3EA 3W6YA 4N9BA 1TUFA 3VM5A 3QSTA 4RX0A 3B40A 1TPVA 3K4DA 3RDKA 2D2HA 4PUKA 3BW2A 4JIIX 4CEXC 1DP0A 1W9XA 3S3GA 2XM2A 4FXFA 1AQ0A 3M9YA 3FKRA 4ZXOA 2OGJA 3AHTA 3OEXA 1ITXA 4FAMA 1KLZA 2RDXA 4V28A 3W53A 2J66A 3W2NA 2VOMA 4YL2A 1EX1A 5AHMA 5C2XA 4LC8A 4FB7A 1WQ5A 4JTAA 1J96A 3W7RA 4DX3A 4UNLA 4P7LA 4G56A 4PB3A 4PMZA 4K37A 4O1BA 2DJLA 1AMYA 3G22A 4M7TA 4AWEA 2UV8G 2OPJA 3KRUA 2VZSA 5KITA 1IWPA 4WCJA 1KCKA 4AZCA 2VEGA 1K8ZA 4W93A 5FJTA 4ZXLA 3W74A 2YCEA 4A29A 1TE1A 9CGTA 1GT8A 1JNEA 3MDUA 3CB8A 4LAZA 1KGWA 1DJGA 1O6IA 3KBNA 1DWIM 1WOAA 1EJVC 4L6DA 4UOZA 1LWHA 5H91A 2ZUVA 1TJ2A 5BCAA 1VYSX 4PCFA 4PMVA 3W87A 3DHFA 3CLWA 1QJWA 4H9XA 1KTBA 4Q3MA 3B9AA 4FMVA 1KRCC 5FJPA 1QFEA 1LM1A 1W8GA 5HNTA 1VBUA 1Q7QA 1RP8A 2B31A 5D9PA 3SW6A 1JYXA 5J5DA 1XINA 4BZYA 1X96A 1YDYA 4IMCA 3WJWA 3F2BA 1EZWA 3DC8A 1EJSC 1VR6A 2VQUA 4Q4OA 4HGXA 1RCOB 5KEZA 1JUKA 3N2TA 3EB3A 5F2MA 4XZBA 1BG9A 4NJKA 2TYSA 3AIRA 1ODZA 3VNIA 1WB0A 3BZJA 3KUMA 3FSUA 1IF2A 2ALDA 3PG8A 5EY5A 2CIPA 4JTKA 5LIWX 2ZKMX 1Y0EA 4GWEA 3FNDA 4X2PA 7ODCA 3T9PA 2CKSA 1TWSA 3S2NA 5LNVA 1GVFA 3T78A 1FH7A 1SO5A 1Z6KA 4DJDC 3EOEA 3T05A 2BGSA 1R3RA 3SI9A 5HJLA 3GNOA 4B9ZA 5DELA 4Q7BA 2PE4A 3SCTA 3ABOA 2BHUA 4CD8A 4MJ2A 3WBWA 5FEWA 2PEVA 3UR8A 1JG9A 3CAVA 3KE0A 3S46A 3E0IA 4X3ZA 5CLWA 5C2CA 1XS2A 1SW7A 4PEKA 2Q02A 5HNNA 1W56A 3NQFA 4EAMA 3BGJA 1A4LA 3QFEA 2DP3A 3H2CA 3ORWA 1ZZMA 1R2SA 3W1XA 1ME9A 2YA2A 1XYLA 4QQ3A 3LYEA 2YOCA 1XL9A 3PFRA 4UB9A 3UZJA 1JDEA 1IHIA 4RCXA 3DG3A 2HS8A 3A9BA 4MPQA 4W89A 4PSRA 4K8HA 3CQKA 2X0HA 1QVBA 1IR1A 1KM6A 2HBXA 2V5JA 3SECA 3II1A 3FVMA 1IGWA 1WX0A 2AAMA 4YXGA 2X40A 3LLFA 1YXCA 5ECUA 1V6YA 5FA5A 3UWWA 2YFOA 2FH6A 3VCNA 4O0QA 3QSRA 4ZGYA 4FOJA 4O50A 4YPJA 3B0PA 3QEZA 2FFIA 3W7DA 3DENA 5A8NA 1LT8A 1E6PA 2A3LA 3TR9A 5CJNA 3LV6A 1MRAA 4KWUA 1XPGA 1ITCA 1Q7ZA 2FMOA 3A5FA 4IFOA 3TSDA 1YBQA 1QU4A 2VYOA 2VFDA 3O0FA 2OEKA 4XG1A 4AZCB 4J1OA 2VGFA 2XIJA 1SJBA 5IBXA 5GPRA 1HJSA 2A85A 1J8VA 3N2MA 4MNLA 4HYWA 2FVLA 2DZUA 2PLMA 1H7PA 3HGOA 9XIAA 2OLAA 4Q7IA 1XLCA 1TX0A 5H6HA 1N8IA 2Y7EA 4K3ZA 1Q2RA 2Z27A 1THFD 3P60A 1VPXA 2XIMA 1JD7A 5LXXA 3UBPC 1OK6A 3N6HA 3BLFA 4PBFA 3P6LA 1RA0A 2FLIA 1XUUA 3EXSA 2NVCA 3STPA 4QSFA 4PUMA 4B9YA 1TPUA 1PL9A 3FS2A 2YA1A 2OWCA 4IMAA 2QJGA 4NNBA 1VBHA 4AZ6A 1HFBA 2OELA 4NRSA 4L4LA 4JQ4A 4E3VA 3T08A 1CGVA 4AU0A 4CNPA 1NFGA 3UERA 3T6CA 4RZ5A 1O60A 2E8ZA 3URAA 4S2BA 5A6AA 3CV2A 2E4TA 5EYWA 3EWDA 2QUVA 2A6NA 2Z25A 1X1OA 2J74A 1PKMA 4MLRA 4ZODA 2WZIA 5HXMA 2XPKA 3VNKA 1H7RA 1I2NA 4AEOA 2DVUA 3VO0A 3VIIA 2JFEX 3W2KA 2ZRVA 5B7ZA 3P14A 3RCNA 4XD3A 1AG1O 3T0CA 4H6RA 4K36A 2JKEA 2YFNA 2IS7A 1TJ0A 5F4XA 3O7UA 3XINA 3O0KA 3THDA 2GUBA 1XCXA 4XO6A 3T0AA 1RD6A 2NLYA 4QGCA 3BW3A 3AIWA 3ATZA 2VZVA 2VEPA 3IUIA 5BRPA 1J2BA 1V6UA 1MNSA 3IGUA 3A4WA 1XDLA 3EMQA 1AJ0A 3CO8A 3G1YA 1OCNA 3AZTA 3CIXA 5BMXA 3M0LA 3UZXA 3CGTA 1B31A 3L4ZA 2QF8A 2VFFA 1FWTA 1RR2A 3HV8A 1WDWA 1IXPA 4NZCA 1W1ZA 4MPKA 1EUNA 2FPYA 2RUSA 4IICA 4QSHA 4JN7A 1RSCA 1XUZA 2VP8A 4FR6A 2VI0A 3GVRA 3M7WA 4ERGA 4QLJA 3HG5A 2ASHA 3V0SA 2PA6A 1JCJA 3SN1A 1J0IA 4F40A 3G77A 1GQKA 2A3EA 3WDQA 5HUOA 3UXDA 1PBGA 3B4UA 3DFHA 4FK9A 4KH2A 1JL8A 1XKJA 4ZQPA 2VRQA 3B8DA 2W5FA 1RY0A 3BMWA 2DFAA 4CVUA 3HMJG 1NIUA 4N7QA 3SR7A 1ISVA 3VIGA 3H26A 2WZMA 1I2RA 1YBQB 3H23A 2W61A 1DTUA 4HPHA 1Q6FA 4P5UA 2ZZ1A 1CXLA 3VAVA 2A5HA 3KW3A 4Q4SA 5A8OA 3RLGA 4W88A 2VC7A 5AVNA 4IIHA 2WYSA 3F4DA 1VHCA 5A8PA 1O4UA 1WYIA 3DKLA 1JCNA 1Z89A 4AISA 3PHAA 3WENA 4HU0A 4IIEA 4EF9A 3CMJA 2V3GA 3NQMA 4KEZA 4CCDA 3LUTA 3KS5A 4WGHA 3VE9A 4UUIA 5M03A 1QMLA 3EKLA 4NZ4A 3W2UA 3QGKC 2YDRA 4Z1BA 2Y85A 4LF2A 4J3ZA 2WMHA 1W1TA 2PWEA 4X60A 1LQ0A 3GFZA 2C79A 1JDDA 2FHBA 1ONRA 4QE1A 3BDKA 1FOBA 4QAWA 3CPGA 2GQ8A 1GOMA 4LUYA 1EGZA 5TAOA 1SU5A 2WC3A 1X7FA 2RKXA 2R24A 2Z00A 3LPOA 4BF5A 1KBIA 1T96A 3N1AA 1FWDC 4OWGA 4DNMA 2A3AA 4JTUA 4AEFA 4B5TA 2R1NA 3UXKA 4FOKA 4CNNA 1PHWA 4PTWA 2I1OA 5D09A 2Y7FA 2TODA 3MA8A 5CH9A 3QQ0A 3O9NA 3WQDA 4UTKA 1ZL1A 1U5VA 1AL8A 1J0JA 1GTHA 4EF8A 3DI1A 4AZIA 3UA3A 4KWSA 3CH0A 4N02A 4XX6A 5DBTA 2WNQA 2HK0A 5AZ1A 3CYVA 1SO3A 3PTMA 4LAOA 1WXJA 2V5LA 4NL1A 1S46A 1W3NA 2DZWA 2E6DA 4WDXA 1VGAA 4MADA 4J3VA 4PUUA 2OSWA 3ZSSA 3AISA 2CZEA 1RH9A 3STFA 1TCMA 4HJFA 3M5XA 1XLKA 3MMDA 3F4WA 3PSVA 1GJUA 5CC7A 2DT2A 5RUBA 2V30A 4W9TA 2YIHA 3DZ1A 1Y5VA 2IKGA 4JIPA 3I6TA 1VCVA 4M5PA 1A5NC 4ICMA 1UR9A 1GJPA 1TA3A 3QW4B 4IWWA 3IJ7A 3SZ8A 1UJQA 4MGGA 4UZSA 1UUOA 2VC5A 3EWBX 1Q5MA 4UTTC 5DRCA 3SQSA 4OTKA 1HGWA 4AYSA 7REQA 3U5UA 4JPGA 3WDIA 3TJIA 4D71A 2PDXA 1ZU8A 3GR8A 1G01A 1GZ1A 3C0QA 4BR1A 3GNXA 1H60A 3N3TA 1N55A 3HG2A 3E96A 4EXAA 2XWDA 3GD6A 7PTDA 3WD4A 3NPVA 1E4LA 2HE8A 2WMGA 4FLSA 2AL1A 4C6DA 3W75A 1SVDA 3WLIA 4PEEA 1Z48A 4O53A 3H70A 4LV4A 3W88A 4JNZA 1TQXA 1CBGA 4S1FA 5D8ZA 4DZIA 3NIYA 4GMEA 3TTSA 3F7JA 4B5UA 2WKGA 3KVKA 5E1QA 1GQIA 5AC7A 1QDSA 5TIMA 3V1PA 3W01A 5BXRA 1P7TA 2B7PA 3B8WA 5M2FX 2YGYA 3W6LA 3E0VA 4L4MA 1RVKA 4CEUC 4S3CA 5E93A 4H41A 2EPMX 3TVAA 3GRIA 4UCGA 5LYRA 3HOJA 4IQEA 1A0CA 2KZHA 3IUDA 1VCFA 1WDDA 1H1NA 4WSJA 3VOIA 2DT3A 1MDLA 4M0XA 2OR2A 1E0UA 3P8JA 3PUOA 3TX9A 4CN4A 1L8NA 2NUYA 3QKZA 3UR5A 1W1IE 2YYUA 3BVJA 1FX6A 1UHVA 1AH4A 1GGOA 2R1KA 3HPSA 2A3CA 6TIMA 2ACUA 1VJSA 2VUNA 4OBRA 2LLEA 1UWIA 1SJAA 1KO0A 3QZEA 3WF0A 1ZLPA 2FGZA 2EKCA 2EHHA 4LB4A 4DZAA 1KXTA 4GINA 2JK2A 3LRLA 3QY6A 4DF0A 4TVDA 2E67A 3ARRA 3WLSA 1MDRA 1MVYA 1FDJA 2GL5A 2FH8A 4GQGA 1JPDX 1A49A 4D6EA 1UQYA 3CEUA 5I00A 3ZLFA 4DLMA 1UBPC 5B80A 2J79A 1GZGA 3ZWSA 2V69A 1J11A 2CLOA 3FEQA 2VJXA 3VUPA 2O92A 2X0SA 2VGBA 3NG3A 3GX9A 1PYFA 5I3JA 2ZZ7A 4JNYA 5KZ6A 2ZIDA 3G3DA 2E5BA 4L9XA 1UCWA 4HYRA 3BQ6A 3CASA 4JTHA 1E5JA 3BE7A 3BW4A 1PWLA 4Z2JA 4DELA 4W8LA 1XM3A 3H2NA 1V6WA 3AS2A 3T0TA 1KTCA 1R8LA 3EWXA 3NDZA 1DQUA 3RR1A 2EPOA 4FXJA 3W7QA 2QYGA 3CB3A 1UW9A 2NV9A 2IW0A 4R9OA 4F0MA 2V9DA 3W3OA 5CSSA 4J5NA 4PC8A 1I2OA 4UBPC 3RF9A 1J5SA 1PKLA 1JF6A 3AROA 1R3QA 2V38A 2YCLA 3GS6A 1TTJA 4C6IA 1TA3B 4BY3A 1QNVA 2OX4A 4Q4RA 3DBPA 2VCBA 4UTWC 2INEA 4WQ6A 1ADOA 2W62A 4AF0A 4YHEA 4Z1DA 7REQB 5GQBA 1DIKA 4PTXA 3RM9A 3SCWA 3S5ZA 1YE4A 5CZTA 2PI6A 4MB4A 4DZHA 4HOWA 4PMJA 3QOMA 1JFXA 3DKJA 4H7VA 1CI1A 5LHFA 2F2HA 3ZJKA 1EJRC 1H4PA 4LXFA 3FYYA 1KM5A 3CTTA 1RZMA 1ZP4A 3DIPA 4D72A 3OBEA 4NZ1A 3OBAA 2V5KA 3WJSA 5BRBA 4WDUA 3WQ8A 3IWPA 3R8HA 4E8DA 1XLAA 3ONBA 4M6UA 1MI3A 4NKCA 4HZ7A 1GYLA 3PPFA 4OHQA 3RJYA 2V5CA 3N4FA 4LRTA 3RILA 3CPUA 3DESA 5CG7A 3TZFA 2E9BA 1JYVA 2ZQ0A 3HQOA