2YCLB

Complete structure of the corrinoid,iron-sulfur protein including the n-terminal domain with a 4fe-4s cluster
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
309
structure length
309
Chain Sequence
b'AVEVLKEKWNSKVVEVTLGTGDKTVTLGGDSTLPFLTFEGEMPNPPRFALEVFDTPPTDWPDILVEPFKDVINDPVAWAKKCVEYGADIVALRLVSAHPDGQNRSGAELAEVCKAVADAIDVPLMIIGCGVEEKDAEIFPVIGEALSGRNCLLSSATKDNYKPIVATCMVHGHSVVASAPLDINLSKQLNIMIMEMNLAPNRIIMDPLIGALGYGIEYSYSIIERMRLGALTGDKILAMPVVCFIGQEAWKAKEAKDPEVAEWGDYALRAIHWETVTTVALIQAGGHLFVMRHPKSLAEVKEHLKRILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBON MONOXIDE DEHYDROGENASE CORRINOID/IRON-SULFUR PROTEIN,
publication title Structural Basis for Electron and Methyl-Group Transfer in a Methyltransferase System Operating in the Reductive Acetyl-Coa Pathway
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Transferase
total genus 101
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03599 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 2yclB01
4S39A 4MWAE 1TWZA 1AD4A 3TYZA 4NILA 2DZBA 4S3FA 4HB7A 3V5OA 3H21A 4C1NA 3TYCA 3BOLA 1Q7ZA 1Q85A 2VEGA 4O0QA 2YCIX 4S23A 4DJFC 2DZAA 4S3AA 3TZFA 4PZVA 1F6YA 3TYDA 4MWAD 4CCZA 2H9AA 3H24A 3MCNA 2YCJA 4S38A 1TX2A 3H2OA 3MCOA 4DJEC 3TYUA 4MWAA 3NOYA 4DJDD 3BOFA 2Y5SA 3H2CA 3H2AA 3TYAA 4O1EA 3H2EA 3H2MA 2YCKX 3TYEA 4DJDA 4O1FA 4S3BA 2E7FA 4D8ZA 2YCLA 2VEFA 4S3DA 4S3EA 3H26A 4C1NB 4D8AA 4DJED 2VP8A 2Y0FA 1Q8JA 3H2NA 4D9PA 1EYEA 4MWAC 4DJFD 4DAIA 1TX0A 4DJEA 3TZNA 3MCMA 4DB7A 1AJZA 4DJFA 4DJDC 3TYBA 4MWAB 3K13A 2BMBA 4G9PA 2DQWA 3TR9A 4NHVA 1AD1A 1Q7MA 2OGYA 4S3CA 3H2FA 2Y5JA 4NL1A 1Q8AA 3H22A 5JQ9A 1AJ0A 3H23A 1AJ2A 1TWWA 2H9AB 4DAFA 1Q7QA 2YCLB 4NIRA 1TWSA
chains in the Genus database with same CATH superfamily
4JD4A 5DFAA 4O11A 2NVDA 3U48A 2C18A 1KC7A 3QR1A 5AC5A 2YXOA 4UFHA 3ABSA 3T07A 4AEOA 4IGNA 2CZVA 5E0FA 1XRSA 2DW6A 3I7QA 4JY9A 4ORMA 4A8IA 2H9AA 3NL5A 2XM2A 1V6YA 5HMFA 1XR2A 1PAMA 1SR0A 4RZ5A 1KM6A 2YBVA 1PCWA 3EWCA 3TN6A 3A4JA 2WMHA 3KBSA 1W9UA 4GUFA 2A4AA 4RE0A 4TTUA 1BVZA 3RAOA 1RCXB 2P0OA 1JPKA 4ZQOA 3C52A 4NZCA 1IYXA 4MY9A 4LV9A 1TRIA 4IXHA 2WNWA 1J6PA 1W8SA 3B8IA 3GD6A 3LCFA 2VGIA 3ZSSA 3VOIA 2XZ9A 1ZU8A 3CUZA 1QVBA 1H5VA 1BYCA 1XC4A 3O6DA 3UZYA 1MI3A 1TTIA 3FS2A 4JPGA 3TR2A 3W1LA 1ZJBA 1XG4A 3RX3A 4FNUA 1Z69A 3VKCA 3WYZA 1YMYA 1TV7A 1S3TC 3EDKA 2JIEA 1XLKA 4U2ZA 1B3OA 4JTHA 3A3WA 1RCQA 5GVJA 2OYKA 1NEYA 2PDNA 5AYIA 1FCBA 4KRTA 5KZEA 1Q7ZA 4FOJA 4BEUA 3DHFA 1N55A 4GQ0A 1E43A 1TTJA 4EXBA 1BXCA 4GUIA 3TW6A 1THFD 1S2UA 1KTCA 4D6FA 4IX0A 1BF2A 3CPGA 1F07A 3N73A 3GU2A 2QCFA 2J74A 3CMFA 1ICQA 1G4SA 3TJLA 4MNLA 4JIIX 1J79A 4LYRA 4O8RA 3PZIA 2R91A 2C79A 3QXBA 1Y0EA 3GFXA 3CZGA 3P6LA 1GPWA 3F4NA 1P5BA 3GW3A 2X1RA 4W9TA 1O68A 7REQA 3UA4A 2Q02A 3QV6A 4PEEA 1QOQA 1UKTA 2RGMA 4LS1A 3M43A 4B5WA 3OBKA 4IMGA 3BAWA 3FVMA 4EE9A 3L4XA 4CQ8A 3GVWA 3GHSA 1EHAA 1E55A 4XKYA 2QUVA 1B3WA 5D05A 3FOKA 5E1QA 4JR5A 1MZHA 2CLPA 1P0NA 1MXGA 4L65A 3R6IA 2D1ZA 4N9DA 1DIOA 3NQAA 1KO0A 2FVMA 2QJNA 2R1MA 2QPXA 4L4PA 4KIEA 3FJNA 3R5EA 2C1GA 3FY1A 2B31A 2NSXA 3W70A 1QAPA 3H2CA 1XRTA 3S3GA 2WAGA 4IH3A 3ZFHA 1TJ1A 2NT0A 4H9XA 1CGYA 4H8VA 4AW7A 4JZ5A 1XIBA 4IIGA 1OJXA 3SCVA 4TIMA 3VCCA 5CC5A 3EKGA 1ZGDA 3NYZA 1MEWA 4J5NA 2CBJA 3GR8A 2PDXA 4KEVA 3C2VA 3PSVA 4AWEA 5G1MA 3W7JA 2VFDA 3C56A 5I3DA 1TX0A 3G1RA 1J0IA 4UFKA 2QZRA 3B0XA 3NPXA 1J96A 3QLLA 5I78A 1PUDA 4G5DA 3EPOA 2Q71A 4KWUA 3GG8A 1YBQB 3KDOA 3PHAA 1PXGA 5FEZA 1HIZA 3PUEA 3IACA 3Q45A 1SJAA 2C14A 5D2VA 1EJSC 4QJ4B 2GGIA 3HN3A 1XM3A 2ISFA 3DKJA 4WEVX 4AY7A 5JMUA 1W1IE 1YNPA 3S42A 4LBSA 4BQ5A 1UWAA 2X1IA 3UY8A 1EQCA 3M0JA 3E0IA 2PDYA 5HJYA 2W62A 4A6GA 4OFCA 3BICA 1J0YA 1L0PA 1TMHA 2E4TA 3TOYA 4I6VA 1K9TA 3SRFA 3W7OA 1VFTA 5HULA 3CT2A 4L4MA 2PAJA 2WM1A 3G2GA 1XBYA 4B92A 1JI1A 3UU0A 2J47A 2QPSA 4IFKA 4H7VA 3FW6A 3H2EA 3CV2A 1RY0A 2GQAA 2HCVA 4QIUA 3HG5A 2YZ5A 1CWYA 3FX4A 1UH3A 2J88A 4BF5A 3R43A 4OZOA 4P2VA 1G69A 2EJAA 1F05A 5C70A 1SU5A 1DWHM 4UTHA 1ONRA 3L4VA 1M7JA 4J28A 3WLTA 3ALGA 4GISA 4WD0A 3ITYA 3W07A 4AZBA 4O1BA 3TR9A 3WJSA 1F4AA 1E4IA 3ZO9A 4WJXA 4E38A 4JFVA 1TVLA 2YL5A 4NAEA 2QGHA 4XBSA 1D7KA 1QW9A 2RJGA 3LTSA 1UD3A 4WOQA 2QJIA 2FJKA 3ZVHB 4BQ3A 5FD0A 4FMVA 1EIBA 3TAOA 5FJOA 2HBVA 4BZYA 4ECLA 4MOZA 1K4HA 4RPQA 3W7NA 4B15A 3AMCA 3CEPA 4DPPA 1S2VA 3OLGA 5AYYA 1VR6A 4DUOA 1MXDA 1EA0A 1QW7A 3Q2DA 1XICA 4LUIA 4J3WA 3TOPA 4Y9AA 1NDYA 4CQDA 3N18A 1BXNA 2EGZA 2V5CA 2VGBA 3POHA 2J7EA 4HSNA 5HJLA 5BWFA 3UW6A 1W5QA 3ARXA 2VEFA 3PJTA 3SW6A 3U2EA 5I02A 1PSCA 3LXCA 2Z4GA 3STGA 3M6DA 3W7DA 3W6MA 1G01A 4O10A 5C9WA 1AMKA 3W2NA 3QZ6A 3SGZA 5K9CA 4R7JA 1P4CA 3QEZA 3QC0A 3PTDA 1OM0A 1KCZA 3QQWA 4TVUA 2W6RA 4MHBA 1GQNA 1VFOA 3NQ8A 1FHUA 2R8WA 4JHOA 3GC2A 1VIZA 1B3XA 1BF6A 8RUCA 1MWOA 5FF7A 2WVTA 3DFPA 3RR4A 3AS1A 1FFQA 4UTWC 3L5AA 2Y70A 3N2TA 2VOMA 2Y6ZA 2PD5A 5AC8A 3FYPA 1F6YA 3M0VA 2AGTA 1R5YA 4AD4A 3O1NA 4A3YA 2VR2A 3A5VA 2PWGA 3WQFA 3TYUA 3NOYA 3EGJA 2VGGA 3I3BA 3W7KA 3WNPA 4YIWA 3ABRA 2F6XA 1E15A 1EDQA 3DBPA 4X0NA 2WWDA 4GFIA 2G3IA 1JRCA 3MDWA 3GBEA 4GH1A 5U4NA 1NFGA 4W85A 3WFLA 4ZQCA 1T41A 3UT0A 2Y8KA 5J5RA 1SFJA 1XRFA 4KGJA 3FAWA 3S6OA 2F7FA 3K8LA 5LNSA 4L56A 1EP2A 2VFGA 3BAIA 3HZ3A 3FA5A 2YW4A 3NPWA 4YVPA 3LPGA 1W1B1 1FHLA 3FLUA 5D2WA 4JICA 1OK4A 5AHIA 4KH2A 3CASA 4YXGA 2DQWA 4UIOA 1OCQA 1VB9A 4GE8A 1YQ2A 2CWNA 5L9FA 2CLEA 2O56A 4FIRA 1OZMA 1XI3A 1RK5A 1ZJIA 3CTLA 2DZPA 1TMLA 4W8AA 5I07A 5A8NA 4AEEA 4ZQRA 1M9HA 2YL6A 3LMZA 3IAPA 5CLTA 1W37A 3GLCA 1DQUA 3N6QA 1Q5MA 2YJQA 3KBJA 2W0UA 3BPWA 3BMXA 5HWJA 1DJHA 1UJPA 4NXSA 4B5SA 3GS6A 3DCPA 3QFEA 1UPPA 3LS9A 1BFNA 4YWSA 1U83A 5H1WA 3RPDA 3P60A 3PC0A 5EMUA 4W8BA 4MWAA 3ZLFA 2FDSA 5HDRA 3W0KA 3LMYA 4S2CA 4UBPC 3UZWA 3D0CA 3CHFA 2HMCA 1FH7A 4NNAA 5KTLA 2RDXA 2QGYA 3OG3A 1KFCA 1K9FA 2VCBA 3POCA 1G4TA 2I5GA 3QJAA 3AMDA 3P5YA 3B03A 4C1NB 3O0KA 3G1VA 2GVEA 2XIOA 1K4GA 3ARUA 2Y0FA 2ZRZA 4LEQA 4RKAA 1PZ2A 3ARWA 3T44A 5CZTA 4Q6JA 3HPFA 5HMEA 1QXLA 3L4UA 3CV1A 3THDA 5D9PA 3ZOAA 3UXDA 1W9XA 1VLIA 3OYZA 3C6CA 3IARA 1O5KA 4PUDA 4ZO7A 5LNRA 3ITOA 2WPGA 5TF0A 2WBGA 3RU8X 4GY7A 3DECA 4IOTA 2A3CA 2QV4A 4E8CA 3IGUA 3LRMA 4X0VA 3CMJA 2DSWA 3WX7A 2WWCA 4H9YA 1ZSXA 4MB1A 1REQA 1KRMA 2XYLA 1TQXA 4IF2A 1DJZA 3LV6A 4MSSA 1VEOA 4IQJA 4BHYA 3QBUA 1G67A 3TIMA 2FGLA 4CLMA 1WOAA 5C2XA 3OIXA 3E2SA 3MZNA 4LCQA 5BRBA 1H50A 1LM1A 5KZMA 4NYYA 2QW5A 4IUOA 2OSXA 3PULA 5B7YA 4ZSUA 1GUVA 1J11A 3GTNA 1HL9A 4N0RA 1J5SA 3P61A 4AEFA 4XD5A 4GYPA 3CEUA 1VRXA 3VNJA 4RK8A 4KRZA 3OHIA 1KKOA 1WZLA 3F5KA 1WP6A 3OGSA 1VQTA 1CGXA 2VKZG 3KRZA 5K9DA 3LEPA 4AIOA 3B9DA 1XKYA 4C6EA 5K4ZA 1B1YA 1R9YA 3MB9A 3S6TA 1F6PA 8CGTA 1B5TA 4C5ZA 1I2NA 3IGXA 1IIHA 2UY3A 3GFYA 3VOJA 1TWSA 1IWAA 1O7AA 4LRSA 2XM1A 2XJ7A 1HZYA 3BLIA 1WO2A 1H51A 4BF9A 2PTZA 4DBUA 3NVTA 1QW8A 4G2DA 3MU7A 4AWUA 1MFUA 1IXNA 2VGFA 1EB3A 1UUQA 2W5FA 1CXEA 2FTYA 1SO3A 5HJXA 1JGIA 2TSYA 3WDQA 2AKZA 4HYRA 3W1QA 4HNCA 3V5FA 4O1EA 1BQCA 3YPIA 1GVFA 4A2RA 2PRLA 1H49A 4HOXA 4AQLA 3DG6A 4A21A 3AZSA 4NXKA 1EDTA 4UTJA 4JQAA 5DRIA 4DI9A 3W1XA 4RZ4A 1IWPA 3WLSA 2HXUA 3PTMA 4H9TA 3TK7A 4IXXA 4QM1A 2D3LA 2Y89A 4O0ZA 1G6CA 1XDMA 4C6CA 5AHMA 4IG2B 4X61A 4QHRA 3Q58A 2ZX8A 5ABFB 5DMYA 2WSQA 1U2YA 4G9PA 1XYBA 3HGSA 2DVXA 3GRIA 3N15A 1S5VA 2V5JA 4LVBA 1FXPA 3UESA 2PDFA 5JH1A 4QCEA 5FKYA 4FNQA 3I4KA 2VJXA 3UBPC 4AZIA 4ZB5A 1F7BA 3M47A 2OU4A 1MW2A 2DZBA 1ADOA 1QR7A 1HXJA 3DIPA 3HV8A 4K7VA 4OUIA 3E2RA 3RR1A 3W7GA 1OZQA 1O5RA 4QBXA 3N13A 4O0QA 1JD9A 3PANA 4YJ5A 2DVUA 2ZZ2A 5DT7A 1VFMA 1ZCCA 3SDOA 1E1EA 5ECUA 2HTMA 3EEGA 1HKIA 5JU6A 5EPDA 3GFZA 3L7RA 1DJYA 4KIRA 3WFAA 2WM0A 3KCLA 4RLIA 3WK0A 3VDAA 5BXPA 3URBA 3CQJA 2XVKA 4IL2A 4XD3A 2BOGX 1W1TA 4DIAA 1SSDA 2VZSA 3E5PA 5AHNA 2EPOA 4I9AA 1NSJA 5B7ZA 3NQBA 5CAHA 1SZFA 3CV6A 3ZZ1A 4IQLA 2ISVA 2X0SA 3NQGA 2ZFAA 3B8UA 2Z1VA 1V93A 2POTA 2DSUA 2YCEA 4GIEA 2G4JA 3GYCA 3IV8A 5KITA 1KWGA 3VE9A 1DJIA 2HK0A 2HRWA 1RQHA 3GNPA 3PBMA 4AVFA 2NT1A 3M64A 4REQA 1I2OA 2VDHA 3KRSA 5G1YA 1KRCC 4Q6XA 3VZZA 3WEMA 1CCWB 1J0JA 1VGAA 1CGVA 4NKCA 1LZOA 5D33A 2ATMA 4L4OA 4HIBA 3P74A 1V6VA 2BY1A 1XC6A 2VEIA 1F6KA 3ARPA 5IXEA 2WMGA 2AGKA 3VI2A 4O12A 3S47A 1LLOA 2ABAA 1PIGA 1GT8A 2FH8A 3OGRA 4N7QA 3PJXA 4UTTA 1YE6A 4H6QA 1W17A 3VNLA 1DOSA 3WQ4A 1AFSA 1KFBA 1BAGA 1ZALA 2Y5SA 2D2OA 3W7CA 1EWEA 3WMLA 3BK0A 2FLIA 3NSNA 4JIRA 4MJ4A 3R8RA 1XLCA 1P48A 4E0CA 5JH2A 1EGVA 1KFJA 1UWRA 4FNPA 3E2VA 1FWNA 5M2FX 1FHVA 3APYA 1HN1A 4JN7A 1VJSA 3RLGA 5AKQA 1RV8A 3AXHA 3LPPA 4A3RA 1Z9AA 4FR6A 2YDQA 4XZHA 1LTDA 4QSHA 2WZMA 3PZQA 3KXQA 2QULA 2UY2A 1JYNA 4E3VA 4NI3A 4QISA 1VFLA 3ONBA 2XHYA 2E3ZA 4FX7A 5CKSA 1O1HA 3JU2A 4J27A 4KCVA 4DLFA 1EXPA 1NTHA 1DXIA 1UWIA 2DUAA 4LVGA 4BFAA 1V7YA 2DIKA 4ZL1A 2OWXA 5IDZA 4Q7NA 1X8CA 5BOEA 1E5JA 2FZ8A 1I1XA 3QKZA 2C1HA 2ICSA 3BGJA 3EB4A 4PMRA 3UQNA 1D8WA 4PUMA 4CGTA 1E0WA 1GVEA 4Q22A 2O4MA 3BWWA 4K2SA 3KM8A 4QE5A 4MLJA 3KOFA 4CNOA 1SO6A 2E68A 1I60A 2X0HA 3RNDA 3AJXA 3PFMA 4MG4A 4IGSA 5JBDA 3ONCA 2VD9A 3AXMA 4H2CA 3WEZA 2ODOA 3A12A 1NF0A 2Z2AA 3VK5A 5AVNA 4NX0A 2HNHA 3G18A 4RR4A 1TE1A 1L2QA 3TYEA 5DRCA 1DQXA 3W26A 3WH8A 2Q8LA 1J0KA 1I4NA 3PG8A 4UUIA 1OABA 4WDXA 1VS1A 4XISA 3CHVA 5EU9A 2FGZA 1WKYA 3GDTA 3WG6A 1B54A 3PAOA 2PCQA 4B5TA 1MZRA 2DZTA 2FZ9A 1XCWA 4DBWA 1TJRA 1YRRA 2A1YA 4TUFA 3W71A 4L1XA 3QGVA 4C1KA 1HL8A 1HX0A 2DZWA 1LBMA 2IQDA 1H11A 4PMVA 2JEPA 3VTRA 1AD1A 3N12A 4ZMGA 2QCGA 4IG2A 3D46A 1OC7A 1WYIA 3WH5A 2XGBA 1QI4A 1BXBA 1OX4A 2QUTA 3O16A 1BSLA 4LV4A 1QWKA 4MB4A 3UWZA 5FEXA 3APGA 3CXOA 3HQNA 2YXGA 2J78A 3LM7A 3EX6A 1CGUA 3TQVA 3GTIA 1XYAA 2ALRA 3DHDA 4DEFA 1KM1A 1Q4NX 4M6UA 6PTDA 2FMNA 4FF7A 4W84A 2PZNA 1S5TA 4QDMA 2TMDA 2Y7GA 3LZ3A 3C2FA 2GLKA 1E56A 1MFVA 1BVWA 1UA7A 4EXAA 2DPEA 2KAUC 3T40A 1MEHA 1QNRA 4LXFA 4LYPA 2A3LA 6TIMA 1G7VA 4TX9A 5D32A 1XIHA 4EANA 4S3JA 5K7JA 3VGDA 5CPMA 2INZA 2ZRYA 2OFJA 3TU9A 1B30A 4JCLA 5C54A 5K2ZA 5CPOA 4CU8A 2ACRA 4EWJA 2MANA 5E93A 5DF0A 3VKKA 3NZQA 1GPFA 2WJEA 3W3OA 1WAWA 2JALA 4JIEA 2AOSA 4F2BA 1JEZA 1SYTA 2FPTA 2HE8A 1V02A 1J12A 4HNNA 3C8NA 3PN8A 1JPDX 3C5QA 1VBUA 4O54A 2I9UA 3QPZA 3I65A 3LSBA 3PPCA 3GIPA 3IJLA 2ZE3A 2XWDA 3NZPA 4MVAA 3E96A 1NWRA 1FP9A 4L9YA 2CXEA 4WGXA 4PN2A 4R9OA 1LWIA 3VNDA 4GC3A 1TIWA 1S3HA 1DTUA 1F3EA 3DOPA 3S2NA 3S4TA 2FDMA 3S1VA 1KBIA 1DWFM 2G95A 5LIWX 4L64A 3EEZA 2WCSA 2YPIA 5I23A 1QASA 3TA9A 3LSCA 3PPFA 4PL1A 1JCLA 4K1WA 3FYOA 3FKRA 3HPSA 2ZUNA 1V3HA 1E4MM 4LF2A 3I10A 1EL3A 2RKXA 5BOFA 3QPYA 5GQBA 1UR3M 2Z1BA 4S1FA 4K38A 1TMQA 1QU4A 1UROA 5CZSA 2C13A 3IIPA 3GKAA 3LOTA 3T2PA 4XTIA 3NTYA 4OU1A 4BKNA 3CTTA 2O92A 1YIXA 2PBOA 4PH6A 3UG5A 1F8MA 1Z7AA 1K6WA 4J40A 3L4TA 1W91A 2IPJA 3K13A 3BAKA 1ICPA 3EA3A 2ZDRA 3B0UX 2B81A 4C6NA 1LRTA 2EG6A 5A6MA 3W85A 2OPJA 1TV5A 2G37A 1POJA 2Z7GA 2VRQA 2PEVA 1LQ2A 3HPXA 3NJ3A 1R3TA 2EXOA 3MDUA 2A3AA 4K6AA 2DJXA 3EOOA 4NQ1A 5BW6A 2WVVB 2Q3RA 2J7DA 2XIJA 3V75A 2J7BA 3V18A 1M53A 4PODA 4JTEA 1L2UA 2HBXA 3VD5A 4WXYA 1HO4A 1ADDA 4PUJA 3T81A 1TVNA 1DJWA 3GM8A 4LBUA 3MCNA 5AOUA 3HMJG 4XV0A 2WMFA 4V27A 2J27A 3UZXA 4EPBC 5JIPA 1UG6A 4WRHA 3WQCA 3B40A 5MF5A 5EMKA 3H12A 1UIOA 2ZUTA 5EMYA 2I1OA 3B06A 4NP7A 3HG2A 2C8NA 5DN1A 1EZWA 4H7ZA 1GG0A 2V2DA 4C6LA 3U4AA 3OYXA 4UOJA 1VPQA 4IZGA 3NQFA 5A5WA 4M3PA 3P81A 1OCNA 4C7GA 1CLXA 4LB4A 3MCMA 3PZUA 4PMUA 4M7SA 4JTFA 3SSZA 3CC1A 1U30A 3FJ4A 4LC8A 4O1CA 3K4DA 2B7OA 1V79A 1GOXA 2INEA 3AHZA 4MB3A 4MIMA 2F61A 5JXQA 4LT9A 5HANA 4HVXA 3EOLA 3BCJA 5J8LA 3VIIA 1LORA 1FDYA 1JZ2A 5LIYX 3G6MA 5LXEA 1DORA 3VIHA 2SFPA 3QY8A 4ZO9A 3UWEA 4AD5A 1WAUA 3TH6A 4MZ1A 1E51A 1KQYA 3GVQA 1EBGA 3SJNA 4H9UA 4DLMA 1HP5A 1IZCA 1EJWC 4GFSA 1ECEA 1U1JA 5D38A 2E6YA 3SCPA 3AIVA 2XPKA 1IIGA 1T8XA 4OBSA 4DWSB 4N02A 4HNVA 1ZTVA 4LALA 1KV5A 1D7FA 4K7YA 2XIMA 5HUPA 3WL1A 3BQ6A 3L2LA 4GA8A 5CGQA 2WO5A 4NI8A 4HMNA 5AN7A 5HWNA 3W1UA 1DYSA 3EWUA 3ABOA 2ZVIA 3ZJ7A 1ONXA 2XGZA 3KX6A 3SY1A 4W86A 1B0IA 4U2YA 4KEMA 2E77A 5G5IA 4JTKA 4XZMX 1CECA 5GJMA 4HQVA 4QS5A 4X9YA 5DQPA 4MB5A 2DFAA 4M6PA 3AHTA 4JTAA 1H1NA 3NO1A 1XGDA 2ZUVA 3QR3A 2RJHA 3CO8A 4LTSA 1QWGA 2O9TA 1V6XA 4ZB0A 4FO4A 4EAYA 4IP4A 2X30A 2BOFX 4J35A 4CUCA 2GGJA 1DIDA 3W6LA 3QOKA 5EB8A 1OX6A 1A5MC 2IMRA 3N4AA 2EAWA 3M1ZA 1EA9C 7A3HA 3DH7A 3QSTA 1A0DA 4P8XA 1XFCA 5EYWA 1PV8A 2ZUMA 4AY1A 2V3DA 1TELA 1EC8A 3AU2A 1L8PA 5HNRA 5CBJA 3GUGA 1KV8A 3RM4A 1P1MA 2DZXA 2PC4A 2DT0A 3RLVA 2OVLA 4DWSC 4HCLA 1H60A 3APTA 1US0A 2ZRXA 3H24A 3OODA 1CXHA 1YXDA 4OVXA 1ITCA 1SPQA 5ABEA 2DW7A 3M0LA 1F8IA 5D8ZA 4LAKA 3N1AA 1LF1A 2DH3A 1W9BM 1CX9A 2YDSA 1KLZA 3AUJA 3M46A 4MNJA 1NIUA 3ID7A 3DI1A 3CAVA 2W27A 3MANA 4PGLA 4W5ZA 3BG3A 4HA3A 1ZENA 3BG9A 2ZZ3A 1QCWA 2PTXA 1W31A 2AAAA 3SM0A 1JPHA 4CD5A 2G4FA 2E9LA 3LX9A 1FA2A 1W56A 3PZVA 3DFSA 4L1GA 4KETA 4Y7EA 3FGCB 4OTKA 4LUYA 2GSHA 3BVJA 4ONVA 3SGGA 4KWOA 2PA6A 4M82A 3VGBA 2NWRA 5AYBA 5C9RA 3AISA 4OKDA 3N3TA 1YEYA 4DWDA 2YSWA 1HVQA 1JRBA 1J01A 1KXVA 5TAOA 2YDRA 4YTQA 3A4XA 1QBBA 3HIJA 1X38A 3ES8A 3P67A 4IP7A 3OZMA 4JAWA 3L0NA 4B3KA 2VI0A 2C7FA 2G3FA 4RNFA 1VBJA 4PL2A 4O53A 4L9XA 3B9AA 2CETA 3WLKX 5CSRA 1QI0A 1XD0A 2WVVA 3AALA 4XIMA 1J4EA 3HGRA 7ENLA 5DY2A 1U22A 1WZAA 2VX4A 3PJWA 1NDVA 3LHYA 2OEJA 1R86A 4IJBA 1BRLB 3GH5A 4H2HA 1T40A 5HWMA 3O9NA 1J10A 1R3VA 2I14A 2VWTA 1T7LA 4RDVA 5EKYA 1TPC1 2VFEA 1DPMA 2EEXA 3OOQA 4E4FA 4WIWA 1A49A 4R34A 3SGUA 2QT3A 3VIKA 3A22A 4LCSA 4WLCA 3RIKA 1IEXA 7XIMA 3KL0A 2OJPA 1KGXA 1QHOA 1ONEA 4UR9A 4YTRA 1BWKA 3V7PA 4FLRA 4D8LA 1K7XA 2J6VA 3KZPA 3MJMA 2ZXAA 4TVCA 5CAKA 2YB4A 1EJ7L 3E02A 3IVTA 4GOAA 4PB4A 1JUBA 3W83A 4CD8A 1PTAA 5EBUA 1QRQA 5CZ0A 1V3JA 3EX2A 3AIRA 3M0KA 3COTA 1GCYA 2HE5A 2ZZ6A 4HU4A 4JGDA 1FCVA 3TWBA 1VFHA 1RK6A 2PZ0A 1YXYA 1RD6A 3PPGA 3H54A 3THAA 3RCMA 3TQ0A 3W7LA 5F7UA 1S2AA 2H8ZA 3K2GA 4NUWA 1SZRA 1DHPA 1QI2A 3D5HA 3VINA 1CI1A 3KUMA 3BOFA 1E0UA 1IR2A 2QDHA 4HU0A 2DH2A 2DV0A 5DELA 3MVIA 1LWHA 1YADA 3GQYA 4ZFCA 2NSOA 4IISA 4Y8EA 3SRHA 2NQLA 1TR1A 4L80A 4S3BA 4O0KA 4XAYA 3T08A 2A3HA 3E3HA 2C1IA 1LUCB 5IDIA 4FNRA 3STCA 4OE7A 3BE7A 2PLKA 1WQ5A 1FWCC 3EYPA 3E38A 1DL3A 2ZICA 3W22A 4K37A 3WDHA 1QHPA 3L68A 4UZUA 1S5NA 1C9DA 3B3DA 2WC3A 3N9SA 1E4NA 2Y8VA 4UFIA 1E40A 1NP2A 4K68A 4CN6A 1F74A 2IXVA 3ALFA 1OFPA 1PKYA 2C71A 4S3CA 1YE4A 2RH9A 4G8TA 3CUJA 2GWNA 4GXMA 1V77A 2WMKA 3S1WA 2ZWYA 1OF8A 3HB9A 3G24A 4A2SA 1CXKA 3TN5A 2V6AA 4EAMA 2P8CA 4ZQMA 1OFOA 1D3HA 1S2TA 4JTQA 1T99A 4DF2A 4XZIA 3WUFA 3SUVA 4UFJA 1UR9A 3ANYA 2Z29A 1GHSA 4OBRA 5I3IA 3NFUA 1SJBA 4IFRA 1PTGA 3VABA 1UD8A 4JOMA 4DO4A 3MCOA 3A4WA 1X1OA 4XD6A 1H4PA 4C6FA 3WQWA 5A6LA 3IJQA 1JYXA 3PBUA 3BO9A 5LA1A 3GG7A 3CWOX 1Q6CA 1RP8A 4WJEA 4GCXA 4MZYA 5FA5A 1K70A 2Q8ZA 4BJHA 3C8FA 1Q6OA 1UWUA 2VELA 2XU2A 3SCRA 3IUIA 2XVGA 4ACZA 4NAFB 3HG3A 3R58A 1OBAA 2BVWA 3MI2A 5RUBA 1Q66A 1W9DM 4ATDA 4FNSA 3QGAC 2WW5A 4W89A 1K1DA 2OXNA 4DZAA 4I9JA 3DN5A 3TC7A 2CWXA 3CL7A 5DT5A 1VH7A 3OPSA 1OFDA 4PCFA 2AAMA 1V3IA 2WHKA 3MHUA 2EQDA 4W7UA 3H22A 4RUBA 5AB3A 2D2HA 1Y7VA 4TOQA 1I6NA 1JCXA 2RDTA 3FGCA 2G3NA 3PB0A 3H70A 1AD4A 2CNCA 5I77A 1GOIA 3SUTA 3LK6A 4DZ5A 3O06A 2BGQA 3E2QA 3N14A 3WQ8A 1TWDA 2H6RA 4UWMA 1ZUAX 3BC9A 4A8RA 2CHRA 1GVOA 3OTRA 1JL8A 2HVOA 4YMZA 4TMBA 4PMXA 1TJPA 3AWNA 4EX4A 3SB0A 1E6RA 1UKOA 5A6TC 5T9BG 3VCRA 1V03A 1UZHA 1I0DA 4ERAA 4IWWA 1A53A 3LM3A 2ZX5A 1Z8AA 1CGWA 1KXTA 2V8ZA 1S1RA 2V5LA 4ICCX 2VRJA 4M8UA 1E6SM 2XVPA 1JQVA 2CZFA 1KR1A 1UR1A 3HFYA 4EF8A 4CN4A 1BTCA 3LCXA 4JTLA 4ICNA 3UEQA 4NJKA 2I16A 5H8MA 3D3FA 1R8LA 3EWYA 4PRTA 5AC6A 3ZWSA 1B57A 2QHAA 3GHTA 4DWSD 3BJTA 3AMLA 2BODX 5BNKA 4Q8NA 4IQEA 5FJJA 1UZ4A 2VEMA 4QQUA 2BNJA 1MW3A 1KTBA 4H4IA 3WZ0E 1XH0A 3HOJA 1VCVA 3W1MA 3TDFA 2REQA 3MSYA 4ES4A 1RA0A 2G3MA 4UMCA 3W75A 1FDJA 1PWMA 4K3ZA 3GNXA 2WSPA 5XIMA 1RBOB 4TU1A 1OWQA 1QT1A 3T7VA 3MS8A 1SFLA 3WFZA 5KEZA 1S5MA 5FSDC 1LT7A 3H4XA 2OT0A 3A24A 3TC3A 5IM51 3C0SA 2WNQA 4XUGA 4D6JA 2OCZA 1ZBKA 4DF0A 1EJVC 5F1UA 3E12A 3TYAA 4A35A 4IUGA 2J9XA 1EUNA 2BHZA 3W53A 2ZQ0A 4LUJA 4CEUC 3WIJA 1RUSA 3KCJA 4UMBA 3FV9A 1YPXA 2KZHA 3QM3A 3ICJA 3E5BA 3PWAA 3LQLA 2J7GA 3UWUA 4DXXA 1VRDA 3M07A 3P82A 3MHGA 2HPMA 6ALDA 3M16A 1XRVA 1X98A 1RH9A 3UGVA 2VUNA 3N9RA 1W32A 4AG0A 2VCAA 1I1WA 2WLYA 1YXCA 5A6JA 3UXIA 4H7CA 1PL9A 4HPNA 1E0TA 4Y90A 3TNBA 5GNXA 5T9CE 3UYIA 4I5UA 3DERA 3IGSA 4JHMA 3DG7A 4F3HA 3W7EA 2GYIA 4LF1A 5HBFA 3B8DA 3AOFA 3RITA 4GNJA 2OODA 4OJYA 4DO5A 5D2YA 2HXTA 3NL2A 3ARTA 3W84A 3I7SA 2HJPA 2GSEA 1OIFA 1XIIA 2A3BA 5M5DA 5CC7A 3HMCA 5A3HA 3UCQA 5D9MA 4IIEA 2PDBA 1CLKA 4JX5A 2OYLA 4C6IA 3CHCA 1IGSA 4LBRA 4DJEC 4QLLA 3VE7A 2UBPC 4HNOA 5A6BA 4YN5A 3UG8A 3W4RA 1UD4A 4L6HA 3DFNA 2JGYA 1FFRA 3ITLA 2RDWA 5I3KA 3TUUA 5C8BB 1VEPA 1R9ZA 2QF7A 4UQCA 1DP0A 3MTWA 3NOEA 4Y9PA 4C6DA 2PP0A 2PURA 1KFWA 2C15A 3DHUA 4YCPA 1C8XA 3IUDA 4TTGA 1V6WA 1PYFA 3VMPA 2VD8A 4HSOA 1FDZA 1UR0A 4AC7C 1XGZA 2FZNA 3CPRA 1E6PA 2CKSA 1YKWA 3OG2A 2R1PA 1DE5A 4AZCA 4DJFA 4MTVA 3MPGA 4BS0A 3VIFA 4IT1A 2GJXB 3G1XA 2OEKA 3S2LA 3QSRA 3TV8A 3MV01 2E5CA 3STFA 1XISA 1OC6A 4HSHA 4L5ZA 1XLMA 1U5JA 2E8YA 4H9VA 1RSCA 2HQAA 4G7EB 3N17A 4QDWA 2QCNA 1UQZA 4M56A 1JDCA 4YHEA 5HA7A 1UKSA 4UTIA 1Q85A 3USZA 4MZ8A 1QO2A 4GKTA 4PZVA 1ZB5A 4J3UA 3AYSA 2BY2A 5CQ1A 3EMCA 2PRMA 4DY1A 1A5SA 4MNKA 5DEZA 3CNYA 3VOHA 1A4MA 4HMEA 1KFKA 2XFRA 1LLWA 3RJYA 1EH9A 1E3XA 1KRAC 3CK5A 2GJRA 3IIZA 4V33A 2C0HA 5LZLA 4QQ3A 4RDYA 3F1QA 4UC5A 3T0CA 3RM9A 1JPIA 2YXXA 3HQ1A 4IPPA 2YX0A 1GJWA 3CWNA 5HXMA 1LDCA 2VX6A 3WJYA 2PCEA 3HPZA 1OCJA 2WLZA 4ZOAA 4EVZA 4WSJA 1JFXA 2OQLA 1A5CA 3M5YA 3GXNA 3MMUA 1J2WA 3GBDA 2X2GA 3W2LA 2ASHA 4ASTA 3LZ5A 4JNMA 4M51A 1UOZA 2CHOA 4XQ6A 3BUVA 4XZWA 3UGRA 1EO5A 1VBHA 1RCOB 1V51A 3BW4A 4M1BA 5D09A 3LHZA 4NT0A 4H41A 1AH4A 2EHHA 2Y1HA 4BQ2A 2QQ6A 4C1LA 1EO7A 3P8JA 2Y5JA 3QHOA 3SUWA 2P88A 3OZOA 3CV7A 3VXGA 1UR2A 6ENLA 1HKKA 4W93A 3VGGA 1RJRA 1EX1A 3V5OA 3QQ1A 1JDFA 4HPHA 5G2HA 4Q8WA 1UWTA 1CEOA 1H1ZA 2VQTA 3CAQA 3UG4A 3EKZA 3NG3A 3L0GA 1K8ZA 3QOMA 1SZEA 1PDZA 3USBA 2GUBA 3KBMA 4AWTA 1YTEA 1XP3A 1L6YA 3A3HA 4YWIA 1WDRA 5DLCA 3V1HA 2PMQA 4J2PA 1DWIM 3F5JA 4KEUA 3SR7A 2DIJA 4JTDA 2YFNA 1YPFA 3TTSA 4JTGA 2ON3A 1FWWA 1LWJA 2I7GA 3G5EA 5HQEA 1EGZA 2RAGA 2BHYA 3G0UA 3UFYA 3BZJA 1V8EA 5BXTA 1XBXA 3TN3A 3CQKA 3HFTA 1RPXA 2AMXA 1AMYA 3W25A 1RD5A 1W1ZA 3PBGA 1H0GA 1QUMA 4F79A 3DESA 7CGTA 1KXQA 4DJEA 3ZR6A 4I9TA 1W3NA 1XYLA 3WD1A 1FTXA 2VQUA 3UJFA 3V4BA 3WEOA 2HSAA 3WD0A 1G7UA 2R1KA 4UZSA 5IHSA 2VC9A 4NHVA 1JZ3A 4R5EA 2O7SA 1M04A 3F7JA 1I0BA 4ZVJA 4PE8A 1XD1A 2E28A 3LGEA 4QSFA 3WLLA 5CGTA 4URIA 3RU6A 1W1A1 3EX3A 3ZT7A 3JR2A 3PNZA 2GJLA 2OG9A 4I6KA 2AMGA 2Z28A 3GU9A 3QYQA 4KF1A 1FWAC 3B97A 3PUOA 4OHQA 5FOOA 2AKMA 3WNLA 7REQB 3IVSA 1O5QA 2BVTA 3NAVA 4QNEA 1JUKA 2CZ5A 2J13A 2YCJA 1PHQA 3H2OA 3DU0A 4ZE4A 2F6UA 2GOKA 3TFXA 3RMEA 2PWUA 3NQ2A 3U2ZA 2G96A 4TR9A 2R1LA 3WH9A 1MRQA 3AZRA 2BX7A 1ZAJA 4OWGA 4PUKA 4DJDA 4XKYB 2PDIA 4Q4RA 4HZ6A 4XX6A 3R13A 2WYSA 2YKKA 4KWVA 1XJBA 1OGBA 9XIAA 1LRNA 5C2CA 1RJPA 3S8HA 1XLAA 3VKBA 2O4QA 4UQBA 3WQ6A 2FZMA 1JR1A 2VZVA 4YVVA 2YBUA 1JXJA 2IKGA 4ATWA 3QZAA 4LANA 3KVJA 2WNZA 2EPKX 2PFHA 4GCAA 5I5RA 5BU6A 3ZT5A 3L21A 3IRSA 4WVXA 4B4HA 2XIQA 1K03A 2J66A 4NX5A 4AXKA 1YDYA 1ME8A 1PDYA 3RF9A 1PWLA 2QF8A 5DCEA 1CPUA 3ATZA 3NWRA 2E8ZA 2FTWA 4X3ZA 2A79A 2AL1A 3ZJ6A 3U7BA 4GLEA 1XLHA 3HJZA 3CMGA 3VDBA 3MYOA 3NZGA 3SN4A 4UQEA 1KBJA 1QPRA 3G0SA 3U8GA 3V3WA 1B9ZA 3W27A 4O1DA 1U1HA 5ABTA 3W37A 5EA9A 4HZ8A 4GVIA 3AIUA 5HR7A 1V0KA 1GNXA 3UJSA 5FJTA 4F0LA 3FHAA 3GC5A 2GSJA 6TAAA 4AF0A 3ARSA 4IP5A 1A3XA 4B90A 2ZZ7A 3BG5A 4Z1AA 1GOQA 3AQUA 1J0ZA 2WKJA 4D8ZA 4UFLA 4JX6A 3AXKA 5FEWA 2FHCA 3HGJA 5FL1A 1A5OC 2VX7A 2OZTA 2RDUA 1M7PA 3F5LA 2NV9A 4MUZA 4Q4PA 1J18A 4XKMA 1SFSA 5JVLA 2FTPA 2D3NA 2PF8A 3MUAA 3W76A 4GYJA 1HJQA 1UPMB 1H7PA 4GNVA 5M1TA 1FWRA 4PTNA 3K8KA 1Q6DA 1F2JA 1ZLPA 3WN6A 2O0TA 5CZKA 4J4KA 4IFKB 4UXDA 4JIQA 1E9LA 5DX7A 1JI2A 3BXWA 4P7QA 1DBTA 4NZFA 3U6WA 1OFAA 1E1FA 4C65A 2EPMX 4KWWA 4JL2A 4B2DD 1TZ9A 3WF2A 4A3HA 4ZSTA 4WSHA 2DQXA 4Z0SA 3QMSA 5AHFA 4E4PA 1H41A 3K1GA 1U5VA 3SQLA 4BK9A 4R85A 4NJHA 1JXKA 4JTSA 1JUEA 3PFRA 3LI1A 1JNDA 3DYOA 2BLEA 1W5NA 2J8GA 2Y61A 2I5QA 1MQRA 1XGEA 2X7VA 2Z1XA 3RGTA 3W7QA 4LVFA 3WMCA 2A7NA 3R89A 2PU0A 1LCOA 1C29A 3THUA 4PMNA 4E3TA 4FSAA 4NAEB 3TW7A 3EX4A 5FAJA 4O13A 2GK1A 3LU2A 4C7FA 4JYDA 4AY8A 1UUMA 3ITVA 2AQWA 4DO7A 2NQ5A 4B4FA 4NSBA 5DCBA 2CLFA 3CM4A 5DMNA 2P5NA 1LQAA 5D04C 1D3GA 1UD5A 4M80A 4PTXA 4GI8A 3KRBA 4HK7A 4JEJA 1Q13A 2WCAA 2E0PA 1TA3A 2JF6A 1WXYA 5FEPA 1S5WA 4B5VA 4DI8A 3NVDA 3ZSTA 3GYEA 3VDGA 5CBIA 5CCZA 1AJ0A 3NQ6A 3C61A 2ACSA 3UXLA 5LNVA 4XB3A 3WLPA 2PDKA 1XLFA 3EZ4A 5GJNA 4Z2IA 1RLCL 4LW7A 1LOSA 3WUEA 3WLIA 4QJ3B 3DHPA 4C7DA 2XH2A 3F4VA 4XAFA 1M5WA 4Z2KA 2ZBTA 1RVGA 5H2ZA 1ZQ5A 3VX0A 1KM3A 2VFFA 1A3WA 3WMBA 4YTSA 3UZ5A 2A7RA 5CJNA 5A8MA 3FVDA 1EGMA 4F4RA 4LS2A 1KM4A 4X60A 1IR1A 2VX5A 4GMEA 4LY8A 4Y96A 5SWUA 5AYZA 5D2TA 1AQMA 2X40A 3EA2A 4WY0F 4LJ3A 1IXQA 1O4UA 2ABBA 3B05A 3NQEA 4KT2A 3IRDA 3QFWA 2VRKA 2BXZA 4M29A 1XH1A 1AL7A 4ML4A 4JXCA 1AQHA 1P43A 3KVKA 4HGXA 5LIKX 5C55A 1XYCA 5TNVA 2EO7A 3DC0A 2QS8A 1FVPA 4UB9A 3I6RA 3RO6A 3QHMA 1W0MA 4DM1A 1VC4A 4U10A 3OLEA 1W5OA 1CTNA 3M5XA 2P3ZA 1YW1A 5E0CA 1NWUA 4J1OA 4CNPA 5KZ6A 2ACQA 3EPMA 1TRDA 5FJPA 4N42A 1W2VA 4MMWA 1IT0A 5ENLA 3T8LA 3KLKA 4AZHA 4LEFA 3AC0A 4PTWA 4Q4OA 4WXZA 2OLAA 4GK8A 3WSUA 2J8FA 5AZ0A 3FAXA 3GC4A 1P6WA 4BQ4A 3KTXA 2AL2A 5AC7A 5C5YA 4O1AA 4AD0A 5IRPA 3Q94A 1KB3A 3MC5A 3W88A 3L4YA 3BLFA 3N19B 4HJWA 3R0DA 4QITA 3GVGA 5BZAA 2ZZ4A 4XO7A 4I9MA 2WOQA 3VILA 4WX2A 3GK0A 1SMAA 3P7YA 2Z1SA 1RQBA 3HU7A 3KVMA 3T0DA 1P0BA 4LNYA 3DI0A 4LH8A 2QAFA 3NQ7A 4PB5A 1VBGA 3W28A 1XG3A 4E2BA 1KFLA 3LQGA 5BROA 5C71A 1Q3NA 1WDPA 3I3EA 1LQ0A 3GAYA 3PNUA 3RRAA 1V0NA 4FI4A 4O28A 3GDLA 2YZRA 4IMAA 4DVOA 5I7GA 5I09A 3VIOA 3VNZA 3TYBA 3GVVA 4MWAB 4LRTA 3QV8A 4JX4A 3IPWA 2GUYA 5M3WA 3L67A 3QN3A 3TSBA 4Z1YA 2V81A 3CIWA 1SM9A 1X1NA 3HA1A 3KFTA 1UYQA 1Z44A 3WBAA 5F2LA 1WDDA 5A94A 1A5AA 3UR5A 5HMSA 1Q6FA 1GONA 2YDAA 3WDIA 2EKGA 3TZFA 3E1F1 3CWHA 3B0YA 1V0LA 3AWOA 3OA3A 5BMWA 4Z2LA 3AHXA 2CCRA 4ZTXA 1TPWA 1EDGA 4CNTA 3M0IA 3S9ZA 2WNNA 1C90A 3BLOA 3G1HA 2CITA 3N2CA 2EJ1A 1ZAIA 3LYEA 3WD2A 2ISSA 3CO4A 4HN4A 1R7OA 3QF0A 1TPFA 4V1YA 2F9RA 1QHZA 1W3JA 2JEQA 3BSGA 4D6CA 2W79A 1O66A 1TSIA 4Q7BA 5FIPA 1XLEA 3MO7A 1REQB 2DZUA 2PDLA 4MWAC 2C16A 2QDDA 4QLKA 2WJFA 3E0WA 2NUYA 2VZUA 3AYRA 4F9JA 4GUHA 5HNTA 3BANA 1VLWA 4Q4MA 3W02A 3CL6A 1BYBA 3U2CA 3TTYA 1ZCOA 5G2WA 3A9IA 4QS6A 3T05A 1CB7B 1JZ8A 1B90A 3P8IA 3U5UA 3BOLA 3RCNA 5XINA 5BRPA 1ISXA 1LYXA 1PTDA 2CBVA 4WDTA 1SJCA 2I17A 4JQ3A 4BEQA 1ML1A 2XIBA 3RYSA 2GGHA 4K8GA 4ZOEA 4JEQA 4K39A 1VP5A 2C6QA 1IEIA 5CJ5A 4LSBA 1L6GA 4EPEC 3V16A 4YCOA 2QCHA 3KEHA 5CXPA 4ZODA 1QK2A 5A8GA 3SN0A 2GGEA 4P61A 2PLCA 4DZHA 2PWVA 4WR3A 3W1PA 3QVQA 5ABHA 1VHCA 2OELA 4F0MA 3N4FA 2DORA 1R3QA 1I8JA 3PS7A 2VP8A 1OG6A 2EG7A 3NQDA 3OVQA 2WZHA 4KMQA 2IKIA 3T78A 3MKVA 3NCOA 4RNHA 3MKKA 4V2XA 3NDOA 3DUGA 4PMJA 2OOFA 3R94A 5BMXA 3UF9A 1RZMA 4Q8PA 1AUSL 3M41A 4R7WA 1BTMA 1LBFA 1XX1A 5DCDA 3CYVA 4GHRA 4W7WA 3LBCA 3MBDA 3OGVA 4OV4A 1C8YA 4XBJA 5H6HA 2GJPA 5I03A 4NL1A 4FF5A 3TTEA 3B9OA 2E1WA 4GUJA 4GYPC 1X39A 3FN9A 1SW3A 4J3ZA 4S39A 1UH4A 4MYAA 3PZMA 3GDBA 1WKFA 1H63A 3HM7A 3RN6A 3NA8A 1GHRA 4CVWA 4H1ZA 3ZVIA 3KOWA 4WOZA 1W5PA 2PDJA 3A6OA 4DYEA 3P0WA 5M03A 4JKKA 4S3AA 4UTFA 4D6HA 2Z1KA 1XCXA 1RP9A 2VO5A 1WV2A 4HZ7A 5K9XA 1PZ0A 4XSLA 4A29A 2EPLX 2WV8A 1RLDA 1ONWA 2NV2A 2QNEA 2CKRA 3MA8A 3MKCA 4GY1A 3W2UA 1R7AA 2GDQA 3THQA 3PZ9A 3MI3A 3JZEA 4PC8A 1XPGA 3W9ZA 1TG7A 2Z6IA 1FH8A 5F4WA 3S46A 1ITUA 3S6DA 3VKAA 1BSIA 1WNOA 2BTMA 3I7RA 2XG9A 3F4DA 3CZJA 3NEVA 3G0XA 4CCEA 1W3HA 3GHUA 2WKGA 1JNEA 3UD6A 2X05A 5HINA 9RUBA 3EDFA 4S2BA 5ABGA 1HKVA 4AX6A 2XWEA 5TIMA 2YB1A 1FWSA 1DHKA 4KESA 2QV5A 2C0AA 3AROA 1TPUA 2R9RA 3FHQA 4YNGA 2DZSA 2PWHA 3ENLA 1XIEA 1F3TA 4QEEA 3ELFA 4BI6A 5TBOA 3M0MA 4JS3A 3GR4A 2QDEA 3NXLA 4RJEA 3O3RA 5DMMA 1FKWA 1WE5A 2WSRA 3THCA 1HNYA 4CD7A 1AL8A 2XIIA 3TYCA 3GY1A 4PTMA 1DKWA 4E6MA 1R0MA 5IFPA 1GVYA 2DJLA 3UXKA 3MUXA 4HT3A 4WSKA 2ZADA 2W4XA 3LBMA 1E6XM 2Z7KA 1EEPA 2QKFA 4WY0A 7TAAA 5BCAA 1XDLA 3W7HA 4J7RA 3HGOA 3K46A 1ISWA 4REQB 2IPFA 3VM7A 1GYMA 5FF2A 1XINA 1EWDA 1WKEA 3JRKA 4IMEA 5A2CA 4MPKA 3S5YA 1HJVA 2ZUUA 1XL9A 5LIXX 1HO1A 5I79A 4JDBA 2PWFA 1G4EA 3NO3A 1M3UA 2XSXA 2WZEA 1JDAA 5CSUA 3W00A 5KETA 1UZ1A 3KE0A 3LNPA 1Y8BA 4RL3A 2OOGA 3DG3A 4DRSA 2P76A 4K1GA 2NVCA 4XVDA 4IMFA 4PBFA 4Q4QA 1ODZA 1OYBA 2PLJA 4EK7A 3VGEA 3T0TA 3RG6A 3DEQA 1S2CA 1CXFA 4LPCA 2PDQA 3TCSA 5EGRA 1AW2A 3WQEA 2QCCA 3G1AA 2J7HA 4QG8A 5E5CA 4KFOA 2DZAA 4FHAA 2VC5A 1I75A 4ML9A 5D02A 5LGXA 4U4MA 4XG1A 1SW7A 1M65A 4C60A 3UJ2A 3VPLA 4C91A 2J8TA 3T8QA 4N9EA 3SFKA 1IF2A 1NJJA 3DAQA 2E6DA 3WF4A 1LT8A 4JIHA 4CNNA 3UVAA 1OINA 1XYFA 4QCFA 2Y62A 3EDDA 4O50A 3CUHA 3S5NA 4H00A 2E67A 4W4QA 4Y6GA 5I0DA 4MGGA 4UTTC 4LVAA 3W81A 3W2KA 3WBWA 3W01A 2OZ3A 4MM1A 3EBVA 5AVHA 3NO5A 1XIJA 4AMAA 2ATSA 5AZ1A 3U3HA 2D20A 4F2TA 2PLMA 3RPMA 2G41A 3N2XA 4IIBA 1H7NA 4PA8A 3TSDA 4FK9A 3BAJA 2Z1WA 4EXQA 2ONEA 1K8XA 1OFEA 2VMFA 2Q6ZA 4RX0A 5A6AA 2ZOXA 1OF6A 4PMYA 4I7WA 4ZB2A 4H8UA 4UOQA 3NURA 3PP7A 4O4WA 4ZE5A 5GNZA 4A8LA 2J24A 3NM3A 1OGSA 2VOTA 3SEPA 5F1VA 3R8HA 1LROA 4LX4A 2TRSA 3NGFA 1MNSA 1OHLA 1PO9A 3MUCA 3DX5A 3H7VA 4TXEA 4IGMA 4FZIA 2RGLA 1BGGA 4MWAD 7TIMA 1T0OA 5C7VA 2MUCA 5CPQA 4XZNX 1MUCA 4DZIA 2O9RA 4PFMA 3LLXA 2OSWA 2BDQA 2H90A 2JIWA 2VC7A 3AS0A 1B3ZA 2DT2A 4ZR8A 4M7TA 3GX9A 4ERIA 3WLHA 3RX4A 1OX4B 4PCTA 2IKJA 5BYWA 1F61A 3BZGA 3WY1A 3C2OA 1TQJA 1KNWA 2JQXA 4YLWA 2FYMA 2OZ0A 2WKLA 4ZOBA 3WK3A 2Q01A 2W61A 3VUPA 2NXIA 3P3BA 4TX8A 3ERPA 3AFBA 4MNMA 2BGNE 3IAQA 2V5DA 1QO5A 2VEPA 1JDDA 1YLVA 1TWIA 1XIDA 3BL3A 3LXAA 1TUXA 2PGRA 2YA2A 3SIMA 4AD1A 3T6CA 5LA0A 3T0AA 1TPH1 1VFSA 1JAEA 3UR8A 2WJDA 2G8ZA 4R7OA 2BS9A 4QG9A 5A2AA 4IHCA 3UP8A 3L66A 2ZX9A 4ZQNA 4QE4A 5G4WA 2PTDA 4GJJA 4QFUA 3TNOA 4HU3A 1F9CA 4PBEA 3BAYA 4Q8UA 3W7MA 4ZA0A 3HQPA 4TV5A 1ZHAA 4HB7A 4XTDA 5JUVA 1XUZA 3GXTA 3GKFA 1Y5VA 2PGFA 2BVDA 4O17A 1GKPA 1LBLA 1EJUC 3H4WA 1IHIA 4L4LA 2QCMA 3O15A 3WQOA 3NQVA 3BLEA 1VJIA 5F4SA 3L2IA 5LKYA 4DF1A 3A23A 3KOXA 1RBAA 4LY4A 5MKGB 4I8DA 4RPPA 1ECQA 3PTKA 3LV5A 4LVDA 5EBAA 1NFBA 1D8CA 2X16A 3BURA 4WHBA 2YR1A 1NFPA 2YYUA 3ZWTA 1QK0A 1AA1B 3BLPX 3WQ5A 1N8WA 3U5YA 2OWWA 3PG9A 1Q8JA 4DELA 5FCZA 3TLQA 3C3UA 3BOXA 1A5BA 3WMSA 4L6DA 3QYSA 4GQGA 3VUSA 1TJ0A 1FWGC 8A3HA 3CUXA 1HJXA 1QATA 2PODA 3CQ0A 2WVSA 3QZEA 1QI3A 2IQ0A 2V63A 1XIMA 4DUWA 3C2YA 4JQ1A 1CXIA 2OX4A 4GZJA 4RW3A 4PUUA 3E74A 4IIFA 4I7UA 1JCNA 4XZBA 1UMYA 4EKJA 2IKHA 4DPQA 2A6NA 1KWKA 4KEZA 3D47A 5FAGA 4P8UA 2PF0A 1CB2A 3BLLA 5HPCA 4ADTA 3VKJA 2VVSA 2YLLA 3GUWA 1XHGA 2PPGA 4KS0A 4GD0A 3OO2A 5DANA 3CB3A 2V82A 1LL4A 3KW3A 4CCDA 1P0EA 4JKMA 1UC4A 1LG1A 3LERA 3MMTA 3AO0A 2OSYA 5KZDA 4C6OA 4MFEA 4TX6A 1K7FA 4FOKA 1KGWA 2OX1A 4P8WA 2Z0IA 4WJ8A 2VFHA 4AXNA 3N6JA 2BP1A 3OQ8A 4PSRA 2YCLA 2OKOA 4B3LA 4LU0A 3H26A 4J2MA 3AIEA 3O7UA 3PVFA 3CU2A 3HG4A 1FP8A 3CQHA 3O6AA 1EOMA 3WJWA 1HP4A 2F84A 4D6DA 2KX9A 2QJJA 1TV2A 2EBNA 1TCDA 2DT1A 3H7UA 4LC6A 4FALA 4Z2GA 3P62A 2NX1A 3GNRA 3IK4A 1JULA 4NZ1A 4R9XA 4ROPA 3R7MA 3VMOA 3SECA 5A8QA 2YA0A 2CLLA 2E6AA 1RHCA 3KTSA 3H23A 3GVRA 3EDJA 4CQ9A 2POZA 5G4EA 3QLDA 2BFGA 2JKEA 3AI0A 3R0UA 2FFCA 3V1PA 3QHNA 2P0IA 5L6UA 3H7RA 3RO8A 2VR5A 1PKNA 3BH4A 5F4XA 4U28A 1TX2A 4E2VA 1UUOA 4XAPA 3EWDA 2H8XA 1QDSA 3BMVA 2DT3A 3FSTA 3NZ1A 3VZYA 5DBUA 1KA9F 1L9WA 2V69A 4AISA 1B9BA 4Q4KA 2FFIA 1JGMA 1FWDC 3KP0A 1OG0A 5AFDA 4GI4A 1Q45A 1A0EA 3W2MA 5LXXA 1R6WA 1KKRA 4HN8A 5BU9A 5CPTA 3UZJA 3B4YA 3OHMB 1DV7A 1YNYA 3W38A 4HA4A 3WDPP 2B7NA 3QY7A 2FHFA 4JTTA 1L6SA 3A47A 1KBLA 1J0HA 4KRUA 4MAVA 3WDRA 4OV9A 4A05A 4A3QA 3VKDA 1V3LA 2VUYA 3C0LA 3KBVA 1POKA 1IT7A 1D2KA 3VAVA 1EZ2A 3VD7A 3CB8A 2QVHA 1JCJA 1ZL1A 3LGDA 1J8VA 3GW0A 1MQQA 3BSHA 4N9CA 3GXMA 1I2RA 4TQTA 4XSMA 2FZBA 3SO7A 4ZCWA 1MSSA 1IEWA 1FWEC 2H3DA 3CGTA 1JFHA 3J7HA 4AHQA 2OMAA 4YTUA 3UA3A 5A2BA 5JBFA 2YYTA 3Q65A 1W54A 4MLRA 1XIFA 3ZT6A 4XZ9A 3T09A 3GH4A 4GINA 2CLKA 3VGFA 4CCZA 4CN1A 3ZR5A 5CC3A 3ATYA 1MQPA 3II1A 2D73A 2QJMA 3SURA 3R4IA 4IJCA 4XAGA 3TJ4A 1XKJA 1FCUA 3UETA 4AZ5A 3S83A 1RBLA 3FKKA 3L5MA 3IJ8A 3ITTA 1XWYA 5DXYA 3ARVA 4HCHA 3BJFA 5T8GA 2DUZA 2ALDA 4Z1DA 2D0GA 4CQAA 3DZ1A 3STEA 5HAOA 1R2SA 2UY5A 3REQA 3MUY1 4UNKA 2R82A 1NU5A 3CS2A 5I3JA 4U3CA 2W91A 1BWVA 1AQ0A 1E9ZB 4FNTA 3UNTA 4KKXA 3NM1A 1T96A 1NP0A 1LP6A 3PUDA 5MKGA 3GHRA 3IIVA 1YDNA 2XVNA 3KOYA 3W7PA 3TZNA 3PWIA 3WLMA 4FLSA 1JF5A 4LOCA 1JD7A 1HW6A 1K9EA 1Q2SA 2MNRA 4UTUA 1OX5A 4MJMA 3LHUA 3TLLA 3H2FA 3PF3A 4NZ3A 2Z24A 2QMKA 1Z89A 3TN4A 3DENA 3G1YA 3V0SA 3WD3A 3WF0A 3R1ZA 3DDMA 2CIPA 3DC8A 4O8AA 2Z6JA 3AXIA 3HTWA 4JYEA 1BKSA 4RZBA 1NDZA 1YPIA 4RXGA 1W3IA 2YL9A 1E6ZA 1XF0A 1JZ6A 1WUFA 3S1GA 3O6YX 1W6TA 2QXWA 3LY0A 4YYFA 1BYAA 1JG9A 1H5YA 2R14A 3FA4A 3CIXA 4N4QA 4MKSA 4DX3A 4EOUA 2R6OA 5CPNA 4H83A 3MMWA 1JCMP 3SSJA 4HNUA 3ITGA 1FWBC 1SO4A 3OVPA 4RV8A 3EPNA 2BY3A 3KHDA 3SIZA 3TSMA 3PUGA 3KVLA 3CQIA 1BYDA 3URAA 3S9YA 1GW1A 3VX1A 4A22A 4PMOA 3MP4A 4W8LA 4Y9MA 3IANA 4QGCA 1T5AA 3LBOA 1M7XA 3G1SA 3A21A 3TX9A 1ISZA 2NLYA 2XH7A 4FLQA 2VDIA 2XN0A 1Q6GA 4TV6A 3MVTA 2CEQA 2VC6A 4DUVA 4PYSA 4DXVA 1GQLA 2XINA 2ZZ5A 1EPXA 1H61A 2WSYA 4JDYA 4B5XA 3WBYA 3BW2A 1JZ5A 3GSMA 4QXIA 3R8GA 3FIGA 1GGOA 2CFFA 1CENA 2EF9A 3U4FA 3I4EA 3CL8A 3TCEA 1ZBCA 2FMOA 3GZ3A 2Z25A 1GW9A 2WHMA 3VD3A 3PJUA 3GE7A 3EKLA 1XXXA 4BF7A 3KL3A 3D3AA 2QIWA 3GG0A 4US5A 4S3GA 3W82A 4Z1BA 3BJSA 4IPJA 2VXNA 2WBKA 1L6FA 2NUXA 4EIVA 4WKHA 1A5LC 1BD0A 3NQMA 4IFOA 1DJXA 1WPCA 4XVEA 3TWAA 2GVLA 1ZNNA 3TC6A 4ZO6A 4ORIA 4IGHA 5F2IA 4POCA 5FESA 2XDFA 1DIKA 2E6FA 3MUZ1 3FDGA 4D9PA 4Y8FA 2XH4A 1TREA 4ILSA 3W1RA 4HTYA 3WUBA 3LTYA 1P6CA 2IUZA 3SRDA 3UJEA 3UXAA 2DDXA 2WC4A 4AIBA 1C93A 2YA1A 3W23A 3PB2A 1IT8A 1F3WA 3VIPA 3B8VA 1Q7MA 3W7RA 4GIRA 3FK4A 5JQ9A 1IXOA 1W3TA 3B8TA 4Q33A 5D4YA 4FB7A 2QCLA 1SVDA 4L7ZA 3T1GA 4JFUA 5C7HA 3LHWA 3OLIA 3OP2A 4NG3A 3N34A 3IJ9A 1R30A 4S23A 2HDJA 2E5DA 4NZ5A 4L61A 4DHGA 4IJRA 3UNDA 1BEUA 1B4KA 2TYSA 1M6JA 1LL6A 4AYGA 1FWJC 3N11A 1BLIA 2HVMA 4PFHA 1EJRC 4PTDA 1GOWA 3H2AA 4GRSA 3ZJKA 1PX8A 2GZXA 2GJNA 2PSNA 5LIUX 1MUWA 3NEHA 2ZUWA 4AFYA 4JBRA 1JZ7A 2CZEA 2E7FA 3M0XA 4IMCA 2GDUA 2O7QA 4NASA 4H6KA 1WB0A 3AYVA 1DJNA 4NJIA 1GYNA 4RW5A 3TTOA 4ZEPA 4HMDA 2XFYA 5HK4A 2XUCA 2V2HA 4N6EA 4LS0A 1R9XA 1N2VA 3CUGA 3WLQA 1AJZA 5BRQA 5XIAA 4M0XA 1QI5A 4A3UA 2E25A 3PAJA 5AECA 1G0CA 4B16A 4DBEA 3KHJA 1S2WA 1MEIA 2V3GA 2A3EA 1P0DA 1I45A 4AIEA 1X7FA 4GVGA 3PBYA 4GGBA 3K30A 5FF3A 2GQ9A 3N9KA 4FOUA 4ACZB 1VPXA 1V08A 1ZJHA 3EOUA 5T26A 3GU1A 2HV5A 3M4HA 4PBGA 1GORA 4D2JA 2OZ8A 2ZYFA 2ZWZA 1TR9A 4W5UA 3RMJA 1QNVA 1S39A 2OTDA 3KRUA 1YDVA 4N6FA 4HZMA 4GUGA 3FYYA 4LNCA 1NWTA 1YBQA 2CLIA 3ZMRA 5I3FA 4FX6M 4JTCA 3KBWA 1UD6A 2X1UA 4UCGA 3OW1A 1RXOB 3SCUA 4US5D 5FI8A 5GNYA 1G4PA 3T4CA 4OBTA 3AHVA 2DUXA 2CYGA 4CU7A 1KGUA 3UY7A 4B5UA 4PUEA 3VFCA 1W5MA 2ZRUA 1E5NA 3FA3A 3QV7A 1HTIA 4AC1X 2A21A 4BR1A 4FP1A 2WPBA 2PD9A 4I5XA 1AH0A 5M17A 2A7PA 3QMTA 3C0QA 3HPAA 2BV9A 2GGGA 1US2A 2WCGA 3I68A 4MFDA 3BARA 3WQVA 2A85A 1G1YA 4XZLX 2NQJA 3EB3A 1UW9A 2OGJA 1LOQA 1B4EA 3PZGA 3STPA 3OEXA 2V30A 4F8XA 3E49A 3WNNA 1LRQA 5H8PA 2A0NA 2UV8G 1UBPC 4ZBCA 1LG2A 2QUUA 3F4WA 4Z2HA 1UH2A 4OOZA 1JYWA 1UB3A 6REQB 3TJXA 4GBUA 2QJGA 4R33A 4CNSA 3H55A 2NV1A 1PZ3A 3ARRA 3K5XA 4PMDA 2ZX7A 3H4GA 1YYAA 2XTKA 4KCUA 4WZHA 1EQPA 2I9EA 3OLDA 2NZLA 1XLGA 1KXHA 4UTKA 2REQB 3H2MA 3IK2A 4O1FA 3IGHX 1H0IA 2VR4A 4GX9A 1XH2A 2CU0A 1FWFC 1F5ZA 4ADSA 4FAMA 3EDEA 1M41A 3ZVHA 2IW0A 1E3ZA 5TQLA 2BG5A 1SW0A 4G56A 1BG9A 3WKZA 4HNTA 4U31A 1R3RA 3WLOA 3ABXA 3RUBL 5EFDA 4A8NA 4X63A 5E9AA 5GJPA 2R24A 4UTWA 3LPFA 3LCIA 3JW7A 3C4UA 4IICA 1JF6A 2AQVA 4V28A 2PRHA 4PUWA 4WKFA 3WBXA 2VT0A 1OGGA 1PIFA 4GQRA 1DTNA 1MRAA 2UWFA 1RQEA 1RY8A 4P8VA 3FNDA 4L6OA 1PEZA 4GBDA 1UMLA 4S3FA 3IUHA 4O19A 2X09A 2BZNA 4AD2A 3ZLGA 5BXRA 3WBEA 1Q65A 3O8AA 2PTYA 1UD2A 2Y5EA 4BY3A 4HK6A 3S0CA 1VAHA 1Q63A 1RJQA 4PR4A 4LYKA 3PZOA 4MKVA 1ITXA 2Z2BA 1DWGM 1V6TA 6A3HA 3W87A 1QOPA 1HVXA 4HNLA 2JK2A 8XIMA 4H9ZA 4PCSA 1FQ0A 1NH6A 1OYCA 2Y8UA 3FSUA 3OZYA 1TPEA 3EWWA 2P3EA 3EWBX 4ZXLA 2Y7FA 1MXSA 2OKTA 1C7SA 2IS7A 1FWHC 3SUUA 1UWSA 1DXEA 3MMDA 3NIYA 3XIMA 3RHGA 2Z2UA 1JVNA 2BWGA 3C0JA 3R12A 2PI6A 4US6A 2CBUA 1Q4WA 1ESWA 4QNWA 5D9NA 3K8MA 1JJKA 2I5IA 4Z17A 1I9CB 1UP3A 4D6EA 3N4EA 4D1JA 3QQ0A 6XIMA 3R11A 7ODCA 2ZDSA 2XFFA 2IXUA 1XIGA 3A64A 4ALDA 3AHYA 1CW2A 3H21A 3P84A 4D6IA 1G5AA 1RVKA 1W3LA 3SAZA 1DJGA 3JS3A 3UYCA 1JDEA 2GWGA 5HOSA 3G1FA 3TYDA 2QEZA 3QW4B 2XFWA 4BI5A 4AZCB 3UPMA 4H8HA 1V5XA 2G0WA 2ZX6A 2CHNA 2NQ9A 4RV3A 4J9JA 4RE4A 3NL3A 5G2IA 3S9IA 3A13A 4M24A 4CD4A 1EF2A 1KW1A 1PJ9A 1X7IA 3XINA 1N7KA 3SCTA 3TE9A 2HWGA 3GG1A 3GNNA 4P5UA 3GWQA 1IZKA 1GEHA 1PBGA 1YHTA 2VENA 1GVQA 1QTWA 5FF4A 3S1UA 3UR7A 3V0TA 4ZQPA 2EPNA 3N04A 1TTPA 5D03A 4TVDA 1VYSX 3AYTA 1ELSA 2W9MA 1PIIA 3VU2A 3NPUA 1AODA 1E6QM 4DXKA 3GXDA 2YIHA 3RJXA 3NDZA 2WQPA 2HISA 4V1XA 1ZRQA 2OR2A 3MZ2A 2E09A 3T0BA 4ADUA 1PE1A 4KFNA 3W1NA 3GTHA 3QY6A 1F76A 5LNWA 1K8CA 1VD6A 5A6SA 1MMFA 4Q8TA 4HKPA 5LGZA 4NU7A 3V36A 2P10A 1NOUA 4C1NA 1CYGA 9XIMA 3L9CA 4QRNA 4GJIA 4KPLA 2QCDB 4Q8VA 4DJFC 3FJ6A 2G5WA 1UCWA 4FPSA 1A5KC 1KM5A 2Z26A 4YL2A 1UQYA 4GYKA 3A4AA 3BTNA 3VDHA 3QH2A 2PC8A 4CKQA 3P80A 1K6AA 4P7RA 4JHZA 3FXGA 3TONA 5DXXA 4YTTA 2VM8A 3LRLA 4QJ1A 6REQA 4GO9A 1BVNP 1OCBA 5CG7A 3SI9A 1R3YA 1WDQA 3UWWA 1I2PA 3NSXA 3UZZA 4D72A 4JQ4A 4QR6A 3PSWA 3ZLHA 4D1IA 5EMLA 1D3CA 3F03K 3HV9A 3MP5A 1C7TA 5DBTA 3R2GA 1GZGA 5MHBA 2A5HA 2VL4A 3ABZA 4DAIA 2HNEA 1ZS2A 3T9PA 3M0ZA 3QMRA 3W86A 3EWZA 3WUGA 3NR0A 3RLHA 4B5NA 2BXYA 4JFSA 1UR4A 2G50A 4HA1A 3MO4A 4QJ5B 4JTRA 3MQTA 1FCQA 2GVGA 5H8UA 3C3NA 3SZ8A 1WUEA 2UZ9A 4WDWA 4ERGA 4MUPA 3ZM8A 1UP0A 3W1TA 1XLIA 2NW0A 2YLAA 4H01A 1NOWA 4NIRA 3GXPA 3KZSA 5A1AA 4R27A 4DBDA 1KFEA 2V2CA 3QTGA 1TPVA 3RDKA 3TQPA 1GVIA 2OEMA 1GJPA 1W9PA 4YVXA 3IJ7A 3UPBA 3TEVA 2XN2A 5LYRA 4YHGA 1ICSA 1MDLA 1MNZA 1XQLA 4HPJA 4N9BA 1J6OA 3CHDA 4FX8A 2F38A 2PDGA 2OLSA 1KM0A 3U57A 5LHEA 1V3MA 1EEXA 4L9ZA 2ZKMX 4LYQA 3GTFA 2OLHA 4DNMA 4BI7A 1MDRA 3EWXA 4UTMA 1CGTA 4LUSB 4AVNA 3G77A 2QR6A 4PRRA 1PX4A 1WDSA 2VYOA 1HL2A 4O14A 3OU8A 4ZOCA 3RM8A 3WF3A 5FJIA 3K4WA 3VDCA 4QEHA 2Y2WA 1HGWA 1UR8A 4GI6A 2VWSA 1N82A 1XFBA 1MYRA 1ZAHA 1TVPA 3VNKA 2DSKA 3M0YA 3BLDA 4G7FA 1VCFA 4HA0A 2ISDA 3OJGA 4MF4A 1GTHA 1OD8A 2PBGA 4JCMA 1GQIA 3LN3A 4WDUA 3VIJA 1NQKA 3ITCA 4NVTA 5I3HA 5B80A 1GOKA 4PMZA 4QE1A 5BWAA 1UOKA 1XBVA 1R47A 3R25A 4YU1A 4QLJA 3P0XA 4ZZ9A 3FCPA 3ITXA 4FEZA 3SQMA 1AZ1A 1Z6KA 4E2OA 1IXPA 2YCIX 3U7VA 5E09A 3E0LA 1OFQA 2Y7DA 3ZS4A 3DFYA 5FL0A 4DO6A 5BOOA 5KSWA 1GVRA 1A50A 1KBBA 4KFPA 2CESA 3BMWA 1XDJA 1VYRA 2QMJA 3SRKA 3MV11 1GZ1A 4LAUA 5E70A 5ABFA 2Y24A 3GXFA 4MADA 3U2OA 1MW0A 5LA2A 2QUNA 3S5ZA 3ZXWA 1PVNA 1XLDA 3WJXA 4I5RA 1ISYA 1EKOA 3SY8A 5AHLA 4W87A 2G3JA 4GNKB 3VC5A 4F2UA 4DN1A 2FH6A 4AZGA 3W72A 3CZ8A 4FS9A 1LJYA 4MJ2A 4F48A 3ARYA 2ZA2A 3DYMA 3MYPA 1VJZA 2ZUSA 1KCKA 1WBHA 1IGWA 2PTWA 3CAWA 2J4GA 2ZCGA 5LNUA 5CG0A 2QIIA 3RLUA 1KD0A 4DB7A 1BQGA 4MY8A 3TXZA 1JYVA 3UWYA 4DJDC 1JCTA 2PDHA 5D37A 4AF0B 4K8HA 1CIUA 4Q7IA 1WDWA 4HOZA 2WMIB 1X6NA 3M9YA 4K8EA 3CYJA 1AJ2A 2CXGA 5IFTA 4GI9A 4DAFA 4JTIA 3ZIZA 3EXSA 4LCRA 4HTBA 2J9YA 1Z42A 2B4GA 3TYZA 4AB4A 1UZDA 1EOKA 2TPSA 2C91A 3VMNA 4IQDA 4Z1CA 1E70M 1MO0A 2INFA 3DYPA 4ZFMA 1HJUA 1ZP3A 5K4XA 5ECVA 2F2KA 3IIOA 1QMLA 4C6BA 1OIMA 5A8OA 2V38A 1OVDA 2DP3A 2Y63A 3OB8A 4NZ4A 2ZRWA 3EX1A 3SQSA 1EBHA 2QCDA 2Q8XA 2ZC8A 1O5XA 2GQ8A 1DEDA 4H6RA 2HS6A 3SCSA 3TROA 4PCNA 5E0KA 2H3BA 1PZ1A 3GZAA 2RUSA 5AYXA 4NNBA 4HHPA 8XIAA 4HOWA 3MWAA 3B9EA 1GTEA 1EYEA 2WXDM 3KLLA 4GG9A 3ISIX 3NYDA 3U0HA 3B0VC 4GIYA 2DU2A 3B04A 4P7LA 3W7IA 3MHFA 2QPUA 4GACA 3UJRA 5IOBA 2ACUA 3QGKC 3TJIA 1LL7A 3ZJ8A 2JGQA 5CLWA 1RA5A 4LB3A 1O1ZA 2O9OA 2GPTA 4O15A 2GK1B 7PTDA 3LRKA 1UKPA 3PR2A 3Q4DA 4MWAE 1TWZA 4GO8A 3WQPA 4NILA 3DGBA 3ECQA 3SJ3A 2BVYA 2ZC1A 3WH6A 1OY0A 3MT1A 3RX2A 3CZKA 4K36A 1G94A 3ANVA 2W63A 2O9PA 4CEXC 1WZKA 4Q4SA 3BDKA 1LLZA 2GVJA 5A6BD 3FEQA 3D6NA 1UC5A 1TA3B 1SO5A 4HYVA 1HKJA 1CT5A 3P14A 4NYUA 4B9YA 1J9YA 2ESCA 3KP1A 1PYMA 3PBVA 5CJMA 3ARZA 4F0HA 5HNUA 4UNIA 2CW6A 2D23A 1PHWA 2YFOA 4XBKA 3ZR4A 1UWQA 3VNYA 3T2OA 4GVHA 2V5BA 1C8QA 2WVUA 1E9IA 4X2RA 4Q3MA 3T42A 1VZWA 2BGSA 2YBTA 4DJFD 4NF7A 1XLJA 3GIYA 1PS9A 3QC3A 4E2DA 1TV4A 2BBFA 4Z08A 2NUWA 3S2CA 1S46A 3TFCA 5A95A 1WCGA 1LOLA 4LUSA 1XPYA 2WZIA 1E73M 1Z48A 1WOBA 5LSMA 1CLVA 1XYZA 3FJLA 3UR2A 2LLEA 4GJ1A 1BPLB 2I56A 2QAPA 3URQA 1TZZA 3ORWA 5C9UA 3WJZA 2FVLA 2WMJA 1XLBA 3IV3A 4F66A 1HFBA 1HT6A 3CHEA 3P2VA 3M7SA 3QTPA 1SZGA 1KLYA 1L6WA 4QAWA 2XSAA 4QG6A 1OD0A 4XO6A 3BV4A 3VVGA 1Q6LA 4ZXOA 1NELA 1Q6EA 1EX5A 4S38A 4FXSA 2OO6A 4LGXA 1EF3A 3VD4A 2PWEA 4GABA 4I7VA 4AHOA 4H19A 2NXGA 4JFTA 3QRHA 1VCGA 3QPEA 1H1YA 1V4YA 3B0PA 3DKLA 3G22A 1E71M 4U33A 3LGGA 3M6YA 3SUSA 1W1VA 1S1PA 2PU1A 3S5SA 4CNUA 3A9BA 3T55A 5HNNA 2DZVA 3NNTA 3WK2A 1A5NC 3DFHA 3B4UA 2Y4SA 4HU8A 3MWCA 1V0MA 1GKQA 5AHEA 2FJUB 4GWEA 1P0KA 2WQDA 2AL2B 4CU6A 2VZOA 4J3TA 4ATLA 3PK7A 4FIQA 4AVOA 1BWLA 2FPVA 1V6UA 3B9NA 3PZNA 1R38A 2F8QA 4QTGA 1M68A 1B31A 2XN1A 1DE6A 2R1NA 2E1DA 1NARA 5CGMA 3KWXA 4L1WA 2OWCA 4MDPA 2FKPA 3V5CA 2OGYA 1Q8AA 3WNOA 4JYFA 1A0CA 3PBWA 1FY6A 4UR7A 3WCZA 5JIWA 1Z3NA 3CAKA 1GQKA 2DGAA 3AIQA 1CXLA 4NRRA 3MY9A 3VC6A 2V67A 3R0KA 2Y7EA 5E6YA 4UOZA 1H3GA 2PP1A 4PCPA 1QPNA 2GL5A 2WMIA 2HZGA 4E8DA 4M81A 1EUAA 1C9WA 1SJDA 4UMAA 4EF9A 1QOXA 1TCMA 2VFIA 4GXWA 1AVAA 1C91A 5T91A 5FACA 3EA1A 1U5HA 3O05A 5EMJA 3GH7A 3BW3A 2J7FA 2OB3A 3TQKA 3BQ5A 1UHVA 4ROQA 4AZ6A 3MJYA 4B91A 1U33A 1XQKA 3SADA 3FEMA 3UCCA 2JF7A 3TKFA 3BCFA 1PPIA 1S38A 1QJWA 2YW3A 3W29A 4AMCA 2J7CA 3AZTA 4S3EA 3GNDA 1IEVA 3VYLA 4F0SA 4JN8A 4IX2A 2O55A 1WBJA 1US3A 4H04A 4I90A 4DJED 2C3ZA 1BG4A 2X41A 3H2NA 3CUIA 1H7XA 1JIBA 2GUUA 3C86A 1TJ2A 3WH7A 3H6OA 4KCWA 4F0KA 4PRWA 2ZE0A 3S5OA 2E40A 4DQWA 2JE8A 5CBBA 4MAZA 3M7WA 2VNCA 4AWSA 5IBXC 3G1DA 2D22A 2CZDA 1ME9A 2J25A 3BLKA 3IJ6A 2QUMA 3PPHA 4IIHA 2VCCA 4AX7A 4H8NA 2CLOA 1W1YA 3WENA 4X9SA 1FUYA 3H8AA 4RE2A 1Q7QA 3CBWA 1RR2A 5CC6A 1EIXA 1DWJM 3SFWA 3B8SA 4EWND 1YTDA 1RPKA 2WHLA 2J75A 2BOEX 3WO8A 4UTLA 4O52A 4ACYA 1EYWA 3L5LA 1YTKA 4NJGA 1OC5A 1JPMA 4U5KA 3I6EA 1K9DA 3VOGA 3N25A 1KR0A 3GDRA 2BY0A 4DJDD 4D71A 3W1AA 4WK9A 2YGYA 1E6NA 2PE4A 4DYKA 1EP3A 1JCYA 4WCJA 3AS2A 1BGAA 2VEKA 3KS6A 1EP1A 4ZENA 3EXTA 1IQ8A 1X8FA 1CNVA 1ZJAA 1XS2A 3AICA 4JIPA 3I6TA 4E4UA 3CLWA 2L5HA 4W88A 5A69A 1GEQA 1TUFA 1FWIC 1YX1A 3ZQ9A 1H7OA 4PULA 4AZ7A 1P1XA 4C5YA 4PSPA 1R87A 2XISA 1FRBA 2PDUA 2CLHA 5EMMA 4GPNA 5G1TA 4LWWA 2RFGA 5K3VA 3SCOA 4BWLC 2IPGA 2VVNA 4HK5A 4G1KA 2NX3A 3KDNA 5E6ZA 2B0MA 1OB0A 4EACA 4HHLA 5AY7A 2JKPA 4CQCA 2J77A 3N2OA 4F0RA 2EPHA 3AAMA 9CGTA 3TVAA 5REQB 3UWQA 1GJUA 3K4AA 3N2BA 1GYLA 1P6BA 1SUXA 4PEKA 1WA3A 3XISA 2PS2A 4DM2A 1H09A 5G4HC 1O94A 4RZ6A 4D6GA 1X97A 4Q32A 1U1UA 4MJZA 8TIMA 4WQ6A 4GYFA 2QLYA 2NQHA 1NOFA 3O07A 2NWSA 5F2MA 2D2JA 2VURA 2D2GA 3CZLA 4AUBA 4AD3A 3LB0A 2E9BA 3LNMA 2PDCA 4GH3A 1X6LA 3MUIA 2OT1A 1OK6A 4F40A 3TTQA 1GQJA 3V0UA 2W92A 2GOUA 3LDVA 5D30A 1VYPX 5CPSA 3W2JA 4PUNA 3W73A 5CZJA 3OZPA 5JBEA 3VOFA 4GC4A 3MP3A 1E1CB 1X6UA 2X1TA 4UQ9A 4RE3A 3WD4A 3FDKA 1H7WA 1VENA 1K8YA 4O16A 1CDGA 3U9IA 4RNIA 2ZTKA 3AIWA 3F4CA 1NVMA 4EPDC 2ZIDA 3WF1A 1UP2A 1TPDA 4JKLA 3WNKA 4I3GA 3VM5A 1N8IA 3LCWA 2XVLA 3AIBA 5I2UA 4DWSA 1C8VA 3GIQA 3IJDA 4GGHA 4E8GA 3VD9A 2RHGA 1HKMA 3VZXA 1GK8A 5EY5A 3M44A 4CD6A 2HVNA 4Y9NA 1FOBA 4IPLA 2QCEA 1ZP4A 3GAKA 2FGBA 4Q8QA 5HATA 3WELA 1WZMA 3CIVA 1M01A 1ZY9A 1E0XA 4A4AA 3B8WA 4XIAA 5IBXA 5HQMA 4J3SA 4DBSA 3KBNA 2ZTJA 4O57A 4NZJA 2DY3A 1IEQA 2XGIA 3JZUA 1KRBC 2PUZA 4M1RA 4UFMA 3RFAA 4FXFA 4HPXA 3WLNA 3QV9A 3L23A 1SGJA 3SCWA 4GXPA 4AHPA 1PCKA 4B9ZA 4FA3A 1K7EA 4UQAA 1I2QA 3H53A 4MDOA 3LCLA 5HUOA 4IL0A 4HJFA 4WUIA 4RDZA 2QVNA 4OIFA 1XW8A 5H91A 4R88A 2Z27A 4TMCA 4H6EA 4JQ2A 1YDOA 4JFWA 4GX8A 3G6LA 1YNQA 3SY5A 1QNPA 4WY0B 4QX4A 4C6PA 4LAMA 4UQDA 1TV3A 2OO0A 2D69A 3GXIA 1OYAA 3O0FA 2D24A 1B3YA 3VNMA 4PMQA 3UPWA 5I6SA 3LHTA 2ZZ1A 1TPB1 2Q09A 1IWBA 1TWWA 3C2EA 3NUKA 5F2GA 4QP0A 3RK8A 2GVYA 1Q6RA 2PGWA 2DSZA 2ADAA 3IIXA 4OGZA 1V3KA 1BKHA 3K1DA 4F9DA 4BWLA 3OBAA 4JNZA 3CPUA 3KS5A 3EAUA 4FXJA 1TO3A 2BB0A 2YOCA 3LPOA 1HGYA 1VIWA 4GQQA 2DVTA 4FXRA 1R2RA 2WJZA 3EB2A 2BSLA 2OQHA 2W3ZA 1BHGA 3G3DA 4HPGA 3NL6A 3PZTA 4XWUA 4O18A 1D9EA 4XK2A 1MUMA 1O12A 3ME3A 1W2PA 1B2YA 1VBRA 1JAKA 4MY1A 4MYXA 2FZDA 1VFUA 2Q3OA 2TODA 1IZJA 2GQ3A 4S3DA 2F2HA 1O6IA 3CH0A 5I3GA 1V02E 4D8AA 2DEPA 2D0FA 1F73A 3I3DA 1H7RA 4FLOA 2JFEX 1C3FA 3UERA 1CZ1A 5DO8A 1FWTA 3S2JA 3Q67A 2HEJA 4HBKA 4WKAA 1ZPTA 3F2BA 1HJWA 1Y65A 3L0KA 1R3SA 2BMBA 1SFTA 3AXXA 3NZRA 2ZVRA 4Y9OA 3TXVA 3QW3A 3PWGA 3M5ZA 3W6YA 1SQ7A 1W1PA 4BCEA 1NAL1 2V68A 1ITQA 2HPIA 4XAZA 1KTNA 1XSKA 1BRLA 3KCOA 3R79A 4AAJA 5CPLA 3TW9A 1B3VA 1GKRA 3MSDA 1KBKA 3FFSA 3DXIA 4C90A 3G3MA 2PDWA 4ENLA 3WQGA 4XD4A 4J3VA 3CLMA 2WANA 3DBNA 3ANUA 1RALA 1FHDA 5REQA 3RXZA 2VZTA 4AYSA 2X1SA 1J5TA 3G8EA 3VGHA 1QNOA 1E4LA 3IS4A 3R10A 4YS1A 4OECA 4JNYA 5LHFA 4NRSA 1P7TB 2NQZA 1ZBVA 2J6XA 3OA5A 1F4HA 3CZEA 4CQBA 3L12A 4X2PA 1UASA 1Y5XA 3VOCA 2F6KA 1F3XA 3UG3A 1ZZMA 1TIMA 3WDJA 5FSEC 1HJSA 4GKLA 1TE6A 1XLLA 3NXFA 1FXQA 5FJRA 3OVGA 4NJJA 4JTUA 1SMDA 2A6LA 1DJQA 4GVFA 2P53A 3IWPA 1R3WA