4IMGA

Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-glycolylneuraminic acid
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
293
structure length
293
Chain Sequence
MKNLKGIFSALLVSFNADGSINEKGLRQIVRYNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDEIALIAQVGSVNLQEAIELGKYATELGYDSLSAVTPFYYKFSFPEIKHYYDSIIEATGNYMIVYSIPFLTGVNIGVEQFGELYKNPKVLGVAFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTQAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLDGVEAGYCREPMTKELSSEKVAFAKELKAKYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N-acetylneuraminate lyase
publication title Structural Basis for Substrate Specificity and Mechanism of N-Acetyl-d-neuraminic Acid Lyase from Pasteurella multocida.
pubmed doi rcsb
source organism Pasteurella multocida subsp. gallicida
total genus 123
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2013-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4imgA00
1S5WA 2C0AA 2HSAA 5D37A 3KVKA 3TFXA 2P10A 2Z1BA 1TYGA 2OT0A 1VHNA 3VE9A 4MY8A 3W84A 1FWRA 2ABBA 1YPIA 4M19A 3NOEA 4IXXA 1H63A 3W7RA 1O95A 3HIJA 3TXZA 4L4LA 4WXZA 3ZFHA 1V5XA 3GKAA 4UTTC 2V82A 1OFOA 4O15A 2GJNA 3W1RA 4XWUA 1DHPA 5FF2A 2V0TA 4M7SA 3LERA 3L66A 1CI1A 1YDVA 4LC8A 3OVPA 3NDOA 2FQIA 1OYBA 3C61A 1GQNA 4DO5A 2ATSA 2B7OA 1FQ0A 4AEOA 4PC8A 1CW2A 2QCCA 1G4TA 4UFJA 3NA8A 5CSRA 3MP5A 1SPQA 4MY9A 4JGDA 3DKLA 1K3UA 1TPFA 1R30A 3T40A 4EF9A 4JX5A 3N9RA 1W3NA 3TW7A 4JEQA 5AB3A 3Q37A 1OFDA 3PB2A 3C2FA 3LDVA 5BRBA 1LOSA 2VFDA 4Q32A 3WJWA 3LLDA 4LU0A 4AWTA 1VC4A 2QCMA 1DORA 1K8YA 3C56A 2J9XA 3FS2A 1K02A 5BW6A 4CQAA 4AWSA 3OIXA 2QCNA 4RZ6A 2X30A 1TCDA 4HSNA 1IIGA 3A23A 4UXDA 1J5TA 4GUHA 1G6CA 2WSQA 4FX6M 5HR6A 4JY8A 2BLEA 4MZYA 4OV4A 5K7JA 4NJHA 5KZMA 4PL2A 2Y6ZA 4P61A 3GDKA 5HMSA 1XUUA 1TTJA 5IM51 2P0OA 2DZPA 3THAA 3FJLA 3MHFA 3GDRA 1ONRA 5D2WA 5LNSA 1VS1A 3S42A 4MLJA 2CLLA 1EA0A 4IX2A 4ZQPA 4FNPA 3W7EA 1VLIA 4O13A 1OX4A 1Z48A 3FFSA 3D0CA 3R89A 2ZA2A 1OABA 3LM7A 3F1QA 3HQ1A 5U7SA 4IPIA 4GUIA 3HMJG 3L21A 5MHBA 1I2OA 3NQGA 3GK0A 3O05A 5G5IA 3FA5A 3W6YA 1M6JA 1AL7A 1W5OA 5ABTA 3U8GA 4Y6GA 4IMDA 2D73A 3H54A 1PCKA 5EMUA 2E09A 3LGEA 1SW3A 3L0NA 4IMCA 4R33A 4DF2A 4QM1A 3W85A 4DBDA 1GVRA 1S3HA 3NEVA 5HWNA 1QR7A 3P8JA 4MIMA 1LORA 4BWLC 3IV3A 3L0KA 2NXHA 4ZMGA 4CNPA 1R2SA 3KHJA 3PVFA 1BKSA 2WJZA 3MBDA 2AGKA 4DF1A 3W7NA 3TQVA 1P1XA 3NQVA 4YL2A 3W70A 1XDMA 3NG3A 3RU6A 3NO5A 3TQKA 1F05A 4M6QA 3C8FA 4UTUA 3BO9A 3P80A 1K7EA 3A21A 3W7CA 3WK2A 2Y89A 4IMEA 2F84A 4FIRA 5K4XA 4NJJA 4UTLA 3F03K 2FPYA 3NQDA 3TKFA 2Y62A 5D09A 4ICNA 3TA6A 4NZJA 2X16A 1AK5A 2ZZ5A 3EXSA 3EX3A 3UPBA 1TPB1 3O07A 2NX3A 2P1FA 5FEWA 4BI6A 5E93A 2YFNA 4HNVA 4NXSA 1QAPA 1WXJA 1TB3A 2QUTA 1J2WA 4M5PA 1ICSA 2GQAA 4Z1BA 3FIGA 3I7SA 3DFNA 3PBYA 3NPUA 4JYEA 1FX6A 3P84A 1DBTA 4PTNA 1OG0A 3G8RA 1GEQA 2AAMA 3NQCA 5CKSA 2VFEA 3TSBA 4GBUA 4N9EA 1H5YA 2WSYA 1JUEA 5LSMA 4XBKA 1I2NA 1IXNA 1GVQA 3BPWA 1ICQA 1FCBA 3AJXA 4LS1A 1VPXA 3VKJA 4AAJA 5I3FA 2TYSA 4Z0JA 3W9ZA 2X1RA 3WK1A 3LCHA 2YPIA 3GXPA 5LNWA 1S5VA 4ADUA 2B7QA 3MW7A 3W7KA 4ML9A 5IBXA 3G1VA 4N4QA 4JTTA 1P0KA 3SECA 5D2VA 4AHPA 2ZRUA 3UY8A 1A5BA 5I3JA 3C2EA 1KM2A 5G2WA 2R94A 4N4PA 4R53A 1KA9F 3FEMA 4I7UA 3GXTA 2Z0IA 3GX9A 6TIMA 4ZL1A 3CEUA 2NV1A 4CQ8A 4Z1DA 2VFIA 5K9XA 2ZZ3A 1XUZA 1TPWA 4TMBA 1F5ZA 3PF3A 4AMAA 1OX6A 3G0SA 2ZCGA 4HNTA 2WNNA 2YW4A 1JCJA 4DXVA 1Z42A 1TPUA 3BG3A 3KVLA 1B57A 4AHOA 3W7LA 4JIPA 1TJRA 2G97A 1LOLA 4YCOA 5A8GA 3W1AA 4TMCA 3GDLA 4O8RA 3HBLA 1NF7A 3NQMA 1LOQA 2GOUA 3GAYA 1Q3NA 3O63A 4MYXA 1SQ7A 2Y63A 4LC6A 1KFCA 1QWGA 3W7JA 1C29A 4QISA 2ISVA 4E38A 4WQ6A 1OVDA 1TSIA 3QM3A 5TBOA 1PCWA 5D33A 3NAVA 1TPH1 2J88A 4N6FA 1E51A 3MI6A 1L6YA 1RQHA 2ZTKA 4ONVA 4H6KA 3BG5A 2QJIA 3WJSA 2WO5A 1W31A 3DBPA 1ZAHA 1F6KA 1EB3A 2FPVA 3W88A 3VFLA 3S1XA 3QMRA 3BV4A 1R2TA 4QQ3A 2EHHA 5LHEA 1TPDA 4NNAA 3MYPA 3GIYA 3HF3A 1I2PA 2W79A 4HPXA 3JS3A 1VYPX 5CZSA 1ZHAA 2VENA 1ZCOA 2ZFAA 2G96A 4X3ZA 2CLIA 1SR9A 1DJNA 1N55A 2UV8G 2NUYA 4IXHA 2C18A 4QSHA 4GXMA 2PURA 2DJLA 3ZWSA 2WNQA 2Y7GA 3NYZA 2NWRA 7TIMA 4MY1A 4JN6A 3EX1A 2A5HA 2HMCA 1LBFA 4DF0A 1HFBA 2RHGA 4GUFA 1XBZA 2ZZ4A 4N2YA 1QFEA 3IIOA 1O60A 1PE1A 4FX7A 1KFJA 2ZZ1A 1GJPA 1AW2A 4QIUA 5F4XA 3LRLA 3MI2A 4UMCA 5TIMA 4PA8A 5AHMA 2C3ZA 1SO3A 3LCIA 3GVGA 4JTSA 3TX9A 5G2HA 1ZAIA 3TK7A 3SR7A 2V5BA 1OFRA 1A5AA 3IRDA 1GPWA 1H50A 4O0ZA 3FLUA 3TJLA 2JBMA 4IMGA 1T99A 3I7QA 1RQBA 4NJGA 3KOFA 1YXCA 5LKYA 2QR6A 3LTPA 2FLIA 3EX6A 1W5MA 1VYRA 2FDSA 1W5PA 3KX6A 3O06A 3G1YA 4U28A 3T78A 3FKKA 3BGGA 4NU7A 3C0JA 2FIQA 4LY8A 3W1QA 3W7GA 4JD4A 1MSSA 5LNRA 3E12A 3IGSA 3CT7A 3L9CA 4JTKA 4TX9A 4BK9A 2EPHA 1PL9A 3N2XA 1G69A 3ABOA 2Z2UA 3P67A 3W2MA 1JJKA 4JYFA 3P5ZA 4K7YA 4HKPA 3S0CA 4MJZA 1PHQA 4JNMA 5H91A 1F76A 3M7WA 1ALDA 1H61A 4I7WA 4AWUA 2A0NA 1GTEA 3RFAA 1FCUA 5DCEA 4YCPA 1R2RA 3C2RA 1X8FA 2GVGA 4XKYA 4EVZA 3A5FA 4PH6A 4S2CA 2OCZA 4FIQA 3UXAA 3DFSA 1RR2A 1VZWA 1I2QA 1XXXA 3KRUA 5AHEA 1BWLA 5AFDA 1LRQA 4JY9A 3AO0A 5AYXA 3S1WA 2ZRVA 3ATZA 2GJLA 1R46A 2DZXA 4YWIA 1B9BA 3EWZA 1VJIA 4ADTA 1VCVA 3W1XA 3A9IA 1KBJA 4UFMA 1QO2A 3HG4A 1TTIA 3N14A 4JTFA 2ZQ0A 4KFNA 1W37A 3L67A 3E9AA 2FB2A 3W2NA 1M7OA 5H2ZA 2ZRXA 3P8IA 4NVTA 2A7RA 2I14A 4UTWC 3LHZA 4O14A 4XUGA 5I3IA 4UNKA 4DO6A 1VYSX 4FNTA 4JS3A 4DO4A 1K8XA 3KXQA 3QFEA 4NNCA 1TMHA 1OFEA 3ATYA 4UTJA 1W5NA 3NPXA 2B7PA 1XKYA 3SZ8A 3M0ZA 1JUBA 1G4PA 3STCA 1XM3A 1G4SA 1XBYA 4OU1A 3TFCA 4DPPA 1GWJA 3DU0A 3WFAA 1P5BA 4PEKA 3IIVA 3HGRA 5FEPA 3JR2A 1RZMA 2VFFA 3EWBX 4P2VA 1LLZA 4RKAA 2OJPA 5GVJA 4PL1A 3CPRA 3SGZA 4A2RA 2ISSA 1T0OA 3S5NA 4LUJA 3CU2A 1TQXA 3NPVA 3EXRA 1GOXA 4X9SA 4LTSA 1TO3A 2FTPA 3IIXA 3P74A 4O57A 3W2LA 3SJ3A 2JK2A 2OT1A 5CG7A 2YSWA 2TRSA 4MPQA 4IJBA 4AF0B 1YYAA 2GQ9A 1KV8A 3PUEA 3W7DA 1O5XA 4N6EA 3W1TA 3TDFA 1GYLA 4L4MA 2F7FA 1KM0A 1HO4A 3LLFA 3SI9A 3W7MA 4MYAA 3F4NA 2W6RA 3BLIA 4O1AA 3GR7A 3QW4B 2CW6A 5CGQA 1IXPA 3CQ0A 2H8ZA 3LCFA 4CNNA 1EWDA 3L0GA 3S1VA 1TTPA 3NL2A 3W2KA 5DCBA 3CWNA 4CCDA 2E1DA 3BW2A 5D2YA 1FUYA 1I2RA 1JVNA 2AQWA 1M7PA 2E77A 2PRHA 5CPLA 1SW0A 1LBMA 4CLMA 4S1FA 4DBEA 3LCGA 2Q8LA 2Y61A 1SO5A 5DELA 3W7PA 2J6XA 6ALDA 2X1UA 5CPMA 4CNOA 5KMYA 5C2XA 3P61A 5EBUA 1GG1A 3QQ0A 1D3GA 2A85A 4OGZA 1WYIA 2E6DA 2DORA 4JX6A 2YR1A 4UTTA 1EP2A 2ISWA 2GQ8A 3E49A 1ZALA 3GLCA 3I68A 4UFLA 1TTQA 1KM6A 4IWWA 4WD0A 2FJKA 3BVJA 1NEYA 1Z41A 3LXCA 1QOQA 4NQ1A 4QJ1A 3NQEA 5AHFA 5AN7A 2J9YA 3L68A 2H3BA 2VEPA 1OK6A 1F7BA 4YMZA 3WK3A 4UTMA 2ABAA 4WZHA 2Y7DA 3W7IA 3R13A 1G67A 4MLRA 5F2MA 1H7OA 3QZEA 3GNDA 5DY2A 1WBJA 2XN1A 1OFAA 3M41A 5J5DA 4Z08A 2YFOA 1W54A 2NLIA 1G7VA 3LBCA 4BF9A 1IGSA 4MZ1A 3G0UA 4OT7A 4C1LA 4D2JA 2PC4A 4K36A 3NZ1A 1ZAJA 2VELA 4LVGA 3IIPA 3GXNA 1YTDA 2JKPA 3NVTA 2EF9A 5E1QA 4QNEA 3SIZA 4ZQOA 3W1LA 5FF4A 3PUOA 4C1KA 4CQ9A 4JDBA 2V2CA 2GVLA 1FDZA 4UR8A 3MJYA 4JTHA 2CLMA 1F73A 2OMAA 3V75A 3TMQA 4EOUA 3LOTA 1J4EA 5D05A 5CSSA 1LM1A 2E5DA 2E6FA 3TC7A 1VCFA 3DFOA 2R14A 2C19A 4KWVA 3B0VC 1CX9A 1EWEA 1DV7A 1A50A 2RDTA 3O8AA 1UBSA 2PRMA 4GFSA 1KFLA 2WKJA 2CZ5A 1DJQA 3QW3A 1NFBA 4LNYA 3G3DA 3M5XA 4BI7A 3NQFA 1IF2A 2C14A 2VOMA 3C52A 1WOBA 2QCEA 3PSWA 1Z44A 3MYOA 2ZBTA 5G1TA 5HINA 4HSOA 2CZFA 1BEUA 4KKXA 5CZ0A 3P82A 2QEZA 2QCLA 4POCA 2PE4A 2XN2A 4OHQA 1S5TA 3B0UX 3Q58A 3B8DA 3W83A 3VE7A 3TV8A 4E0CA 1OX5A 1FWNA 4RR4A 4UC5A 3MHUA 3DZ1A 1VH7A 5SWUA 4R34A 4BWLA 3QEZA 3TSMA 3B05A 2DZUA 3TJXA 1AL8A 1FWSA 4QITA 1EIXA 4IX0A 1JQVA 2I1OA 4O17A 3W74A 4Z1CA 3QMTA 5L9FA 2OX1A 4EIVA 1C9DA 2QCHA 5AHIA 2PCQA 3TSDA 1FXPA 5AHLA 1WBHA 3R2GA 4AXKA 3UWYA 5I3GA 1QO5A 5KZEA 3NL6A 3LV5A 5KTLA 3PAJA 1LRNA 4NJKA 3TC6A 4K8EA 4O52A 5HJLA 4I7VA 3DAQA 4Y96A 1H1ZA 2V9DA 1M5WA 3IVUA 4NX0A 3UY7A 3MUXA 3GZ3A 2DJXA 3G18A 4FF7A 1OF8A 3B06A 4X22A 2Z6JA 5CZJA 2YDAA 1H7NA 4PCFA 3TW6A 1WDWA 3LXBA 4BR1A 4O54A 4NXKA 2BWGA 5FEZA 3PG9A 3M5YA 3G8EA 2YZRA 3OVQA 1VRDA 5E0KA 3T7VA 1JQXA 2VKZG 1GZGA 1X6UA 2PRLA 1O94A 1UCWA 4FNRA 3FYPA 3WK0A 3C2OA 1ZENA 4EWND 1U5JA 1W3IA 3EWWA 3IGXA 3NXFA 4MOZA 1F2JA 3MI3A 1L9WA 4MFDA 1DQWA 3HPZA 5K3VA 2W0UA 1D3HA 4FXSA 3NQ8A 4JR5A 4K7VA 1ZFJA 4LS0A 5TQLA 1TV7A 3EB2A 3TE9A 3N2MA 2YW3A 4FNUA 4CCEA 5EKYA 3NQ7A 2R8WA 3W22A 1TIMA 3GAKA 2CLKA 5K9CA 5CZTA 3LCLA 1K03A 3N34A 4WY0B 1H7RA 4XTDA 1I45A 1W1ZA 4K37A 5DBUA 3F4WA 4TIMA 4N9DA 1WX0A 3L65A 4AH7A 2NUXA 3RNDA 3G1FA 3UWZA 2Y7FA 1DL3A 2WV8A 2YYTA 3M16A 1TRDA 3NR0A 1IXQA 3MP4A 5DY3A 2A21A 3HGOA 1YLVA 1LTDA 4B5NA 3IVTA 3C6CA 1FDJA 2R91A 4EF8A 3FJ6A 3DI0A 2YCEA 3N9SA 2QCDB 3I6RA 4GC4A 3QF0A 4W9TA 2VEKA 1OYAA 1YTEA 3QQ1A 3PWAA 3HG5A 5KITA 1WAUA 1YADA 2ZZ2A 3THQA 2TSYA 2KZHA 1KBIA 2VEMA 1AMKA 2ZA1A 2BXVA 2FFCA 3NM1A 5FEXA 4GWEA 1N8FA 4JYDA 3HOJA 5D02A 3W3OA 4O53A 1QDSA 4NNBA 3LBMA 3NQAA 5DXXA 1NVMA 2WNZA 1XC4A 5HUPA 1Y0EA 5C55A 3W76A 3YPIA 3W7QA 4A29A 4A21A 3STEA 2J27A 4RX0A 1OFBA 3G24A 3M5VA 4LVDA 1A5CA 1A53A 3S5YA 3IEBA 3NM3A 4UTKA 4O1BA 3W87A 2CLOA 3S9YA 1LROA 1XDLA 4LRTA 4H3DA 2EKCA 4ZQMA 3STGA 1VR6A 5BOOA 1THFD 2FB3A 3GR8A 3HB9A 1TQJA 5AHNA 3PSVA 3EEGA 4QAIA 2G95A 4RZ5A 4UTIA 2QAFA 2JKAA 3LHWA 3QYQA 3EX2A 4LVBA 4O50A 3CHVA 1KTNA 3WJYA 1RPXA 2WOQA 3T55A 5AC7A 1OJXA 5AYZA 4JTJA 5DLCA 1GG0A 4N9CA 2ZZ6A 1TREA 3DI1A 3GDMA 3PY2A 4O11A 4O1CA 3OG3A 4ZVJA 1R47A 3QRHA 4O0KA 3L5LA 2B7NA 1X1OA 2BSLA 4S2BA 3HG2A 3ZS4A 3O15A 5G2IA 3UNDA 3KRZA 3TUUA 1ME8A 4RV8A 1NSJA 3RK8A 1OF6A 2VFHA 3TH6A 4OBTA 2J24A 1TJPA 1HO1A 4E2BA 4JICA 3W1NA 3CIXA 3S5ZA 2E6AA 3ABQA 3QPZA 3W73A 5HWMA 1LBLA 4FO4A 5F2GA 4LVFA 4MJMA 3E0IA 3INPA 1FBAA 4OE7A 2E6YA 4K8HA 4OV9A 4Z1AA 3DKJA 5U4NA 3TMLA 3T44A 4UCGA 1LYXA 2QCFA 4JTUA 5DCDA 5KINA 2CLEA 5C54A 5D2XA 4E2DA 3SSJA 1OYCA 2O7QA 3GNNA 4O10A 1BTMA 4G1KA 5G4EA 4FXRA 1W3TA 1SFJA 2Y7EA 3DENA 3W7OA 1JR1A 1I4NA 5C6MA 3LI0A 4XQ6A 4ORMA 3UQNA 3MHGA 3W71A 5K2ZA 1ML1A 3O6CA 3DHDA 2ATMA 1KTCA 2VC6A 4WJEA 3P81A 3PB0A 3G0XA 4LW7A 1OHLA 1SZNA 1G7UA 2B0MA 2Y70A 4O19A 4FB7A 2WSRA 3LHUA 3HG3A 4UR7A 3UXDA 5DBTA 3E96A 3ABRA 1KLZA 3LHTA 4YLWA 5EYWA 3BW4A 2X1SA 3RLUA 3CIWA 3W1UA 1W56A 1OX4B 1ME7A 3LTYA 3QSRA 1F6PA 2RKXA 1KM1A 4IUOA 1W5QA 3NPWA 2X2GA 3QC3A 1A5SA 3KRSA 2RFGA 1VCGA 3UWUA 5CPOA 4LT9A 4XBSA 5AC6A 4KWWA 4AVFA 3E02A 1QPRA 2V81A 2BZNA 1XL9A 3N3MA 1KFBA 5FI8A 1KW1A 2VFGA 1KM4A 4HNUA 3EWUA 1X7FA 4K38A 3UPWA 5F1VA 4O4WA 3SY5A 5KZDA 3VI2A 4YXGA 3VCRA 3UZ5A 5DXYA 4RCXA 2TMDA 1WV2A 4UTWA 3W75A 3NL5A 2VEIA 1TPC1 4RXGA 2CLHA 3RMJA 2YXGA 4BI5A 3R8RA 3TAKA 2OZ0A 2A7NA 2EGZA 4MVAA 3DFPA 1RD5A 1H1YA 5D30A 3MWAA 2NX9A 3O16A 2RDUA 1MEWA 1I8JA 5AOUA 1RQEA 1XFBA 3M6YA 2QJHA 1GYNA 3CEPA 3EWXA 2H90A 2QKFA 2ZDRA 4GUGA 3KAOA 5CPNA 1K7FA 3U2OA 1RVGA 3L2IA 3PULA 3STFA 3BLFA 4JTIA 3PS7A 4JTGA 3WJXA 1UASA 1DKWA 2H8XA 4O1DA 3TAOA 4DEFA 1QPOA 3W1PA 3TQ0A 1SU5A 3G3MA 1HG3A 2GVJA 4J9JA 1SZGA 5KSWA 3VNDA 3SGUA 4LUIA 2YYUA 1VGAA 4MUZA 1ZY9A 2Q3RA 1Q45A 3NNTA 3TU9A 1KFEA 1BWKA 3CLMA 4GNJA 4XTIA 4ZQNA 1UUMA 4QNWA 4MZ8A 1RV8A 3LI1A 2HS6A 3DH7A 3FOKA 3CB8A 1B4EA 1QPQA 3UZJA 3PR2A 3TCEA 3PM6A 4WUIA 4R7JA 2IQTA 3OVRA 2QAPA 5FF7A 1NF0A 3OEXA 3CTLA 5FF3A 1PV8A 2CWNA 3M44A 5HNRA 1KTBA 4N02A 1FCVA 3BARA 1QPNA 3LCWA 2E68A 2XN0A 3LB0A 3IGUA 1GVOA 1H7WA 4TU1A 3W2UA 5EPDA 3G1SA 4AF0A 1KLYA 1K7XA 1ME9A 1HL2A 4IQLA 3O1NA 4U4MA 5AYYA 1SZEA 4UNLA 3W07A 1LZOA 3LHYA 5G1YA 2ZA3A 4HHPA 4M6VA 4KFOA 1VHCA 2NV2A 2VXNA 1LRTA 1WOAA 2V5LA 1SFLA 1Q6LA 3BLEA 3DFQA 1V7YA 1MEIA 3P60A 3UWVA 3EKZA 1NAL1 5I3KA 4RLIA 1D9EA 2ZRWA 3TXVA 3C4UA 3P5YA 4UTHA 5IBXC 3TROA 1U83A 2QCGA 1JULA 5F2LA 3W1MA 4IMFA 4O16A 4NZFA 3CM4A 3M1ZA 5D38A 4Y8FA 3Q2DA 1EUNA 2H3DA 1GTHA 3ELFA 3G1AA 1W8SA 3PBWA 3QJAA 1W0MA 1H60A 4Y90A 3N19B 1XI3A 3M9YA 4GJ1A 1JRBA 3USBA 1B3OA 2CU0A 4LV9A 4Q4KA 3A24A 3LRKA 4ZZ9A 4DELA 1GT8A 2DZVA 4RXFA 5LNVA 1PS9A 1KV5A 3LX9A 4FX8A 5BMWA 1LCOA 5AC8A 1C8VA 1LDCA 1EX5A 2G5WA 2Y88A 2H6RA 4FHAA 3NZRA 2A6NA 1PHWA 5DN1A 3UWQA 3BG9A 3WJZA 5HULA 5LGXA 5J5RA 1VQTA 2I9EA 4FEZA 3U6WA 3EKLA 3C2VA 3S1UA 3ABSA 4ALDA 3KVJA 1OFPA 4DQWA 3H55A 1N7KA 3A5VA 4M7TA 3PUDA 4MFEA 1YPFA 5HR7A 1ZNNA 1OFQA 2BTMA 3B4UA 4UMAA 2A1YA 2WPBA 1AG1O 2LLEA 4FNQA 5A5WA 2V2DA 3W86A 1QOPA 2NZLA 5FF0A 2QDHA 4JTEA 4M6PA 3UWWA 4RK8A 2CLFA 2DP3A 1EPXA 1X1ZA 1SO4A 1VLWA 3LRMA 2HTMA 1H7XA 3Q94A 3V1PA 3CC1A 3M43A 5D32A 1P4CA 2QF7A 5BNKA 3LXAA 3IIZA 3S5OA 3SFKA 1IIHA 3NL3A 3W23A 1UUOA 1KFKA 3G22A 4JTLA 3EXTA 2J9ZA 1O4UA 4X2RA 1WQ5A 8TIMA 4IOTA 4NT0A 1DQXA 1JCXA 4AB4A 2QUVA 1H7PA 1AW1A 1FDYA 3O6DA 4A22A 3BW3A 1T96A 3HPSA 4OQVA 1JUKA 3MP3A 4ZQRA 4UFKA 1YDNA 3OBKA 4PFMA 4LRSA 4Y9AA 4UUIA 3A22A 4UMBA 4GE8A 3FYOA 4Z0SA 4HPJA 1JCYA 5HQEA 3HO8A 3PBVA 5T26A 1LLWA 2EAWA 4I9AA 1MO0A 4O4VA 4WX2A 5LHFA 4TR9A 4NUWA 1TPEA 4TO8A 2CFFA 3P62A 2ALDA 2XFWA 3BGJA 1L6WA 2GPTA 2ZRZA 3GKFA 3TR2A 5F4SA 1TPVA 3TNOA 3JRKA 1XCFA 1FY6A 2ZTJA 3NQ2A 2ZYFA 5F1UA 1ICPA 3QSTA 3DHFA 4XKYB 4CCCA 5LZLA 1TRIA 3M47A 1Q6OA 1TV8A 3HJZA 4IGHA 4HN4A 1SUXA 5LGZA 1LP6A 3P7YA 3ANYA 5HWJA 2V2HA 2X1TA 3SW6A 4WXYA 5L6UA 1SO6A 4O18A 1P0NA 1MXSA 3L5MA 5LNUA 2C13A 2NUWA 4JDYA 5D03A 2RH9A 1K8ZA 3B04A 2C1HA 1O5KA 1KM5A 2TPSA 3G1HA 3UD6A 4JX4A 1FCQA 5EY5A 3GDTA 1SSDA 3OHIA 3DGRA 4K6AA 3OA3A 2DZSA 1EP3A 2ZZ7A 3EWYA 5HUOA 2V30A 3PC0A 3L5AA 3LCXA 2O7SA 1HTIA 1OK4A 4A3UA 2JGQA 1WA3A 1HUVA 1XBVA 1Q6RA 1SSGA 3LTSA 1JCMP 1QCWA 3MMTA 5I3HA 3W7HA 4JXCA 2FPTA 5G4WA 2C6QA 3BK0A 1ADOA 3R12A 4UFHA 3G1XA 3M5ZA 5EA9A 1FXQA 3LV6A 4LOCA 2NX1A 1JRCA 3PG8A 4WY0F 3LHVA 3R5EA 4HT3A 2YX0A 4MKNA 1H51A 1FWTA 1YXDA 2A2IA 3HGJA 3MO7A 1F74A 5K9DA 2V8ZA 2CZDA 4WOQA 2A7PA 4A2SA 4WY0A 4UIOA 2CZEA 2E5BA 1SW7A 2JGYA 1MZHA 4HNNA 4Q33A 4OWGA 3T4CA 1H62A 4ZQCA 2QDGA 1FWWA 1G4EA 1L2UA 2E5CA 3QH2A 1XBXA 2HS8A 1MEHA 1PIIA 3O6YX 5K4ZA 2QJGA 2YGYA 3W72A 1GVFA 4AHQA 5D04C 3G1DA 2BX7A 2QUUA 3DFTA 3B0PA 3PBUA 1DOSA 5F4WA 4LWWA 4FNSA 1IXOA 2QCDA 1TV5A 1PVNA 3H53A 4O12A 1B4KA 5D2TA 3QMSA 2GUUA 4XZ9A 3ZR4A 2ZRYA 3KFTA 3UYCA 1SZFA 1UB3A 4WOZA 3RF9A 2A4AA 4ORIA 5FESA 5F2IA 3NGJA 1GVSA 1QNVA 2A6LA 4IPJA 3GYEA 2C15A 1EEPA 2NXGA 5C5YA 3C3NA 3RLVA 4GUJA 4GRSA 1UJPA 2DU2A 2Z6IA 3ZWTA 3CWOX 4KFPA 4PODA 3TIMA 1YTKA 3S8HA 1EUAA 3DXIA 4ADSA 1EP1A 4N9BA 4RZ4A 2JKEA 2B4GA 4LVAA 4DPQA 4LV4A 1T8XA 4LS2A 3HPXA 3K30A 1DVJA 1JCLA 1KM3A 3NQ6A 1ZJIA 3N73A 4UFIA 3FKRA 2Y85A 3QPYA 2Q3OA 3I7RA 3I65A 3HGSA 4HIBA 5BMXA 2Q8ZA 4K39A 2C16A 1AW5A 3GB6A 1L6SA 3KVMA 5EL1A 1YXYA 4BFAA 2RDWA 4JIQA 2NXIA 4NJIA 3W2JA 2DZTA 3MBFA 1JCNA 2WQPA 3IVSA 4NX5A 2NWSA 4H4IA 4O28A 3EX4A 3S6DA 1QMLA 1Q6QA 2DZWA 3B03A 4RJEA 1YDOA
chains in the Genus database with same CATH superfamily
1HN1A 1VB9A 4QG8A 2HSAA 3TFXA 3ZLGA 2OT0A 1JEZA 3O6AA 3GUGA 5LXXA 2EQDA 4NIRA 4M19A 4GYFA 4JTAA 3TXZA 1V5XA 2BVWA 2V82A 1OFOA 2YOCA 4XWUA 1AD1A 3S47A 1CI1A 4IQEA 2FQIA 1GQNA 4PC8A 1L2QA 2XVKA 3LNMA 3NA8A 5CSRA 2R1NA 5IFPA 3VAVA 2PDPA 3T40A 1J11A 2VI0A 3P2VA 4JX5A 2V6AA 3WDIA 1UD2A 3DX5A 4H9XA 4GVGA 1GJUA 3ARTA 2Y8UA 4LU0A 3CGTA 3WF4A 1HJXA 2J9XA 3G77A 1SFTA 3SCQA 2X30A 4C6OA 4AG0A 3CASA 3EEZA 1G6CA 3EYPA 4OV4A 5H8UA 5KZMA 4JTCA 3GDKA 3M0MA 2ZUTA 3N12A 1CXEA 2FDMA 1ONRA 4HZ7A 3S42A 1LUCB 1EA0A 4IX2A 2WZIA 4IGMA 2IW0A 3K5XA 4E3TA 1RCXB 2Y1HA 5M1TA 1K9DA 3R89A 2ZA2A 4JN8A 4GK8A 4DUOA 4DM1A 3L21A 1E6RA 2IPFA 4JNZA 2J13A 4QRNA 1I2OA 3NQGA 3GK0A 5G5IA 1DJXA 4LY4A 1TA3B 1JAEA 3SAZA 1XIGA 4IGNA 4REQA 1ZBKA 3BCFA 4D6GA 1SW3A 3L0NA 4R33A 4DF2A 5DRIA 1MVYA 4PTXA 1QR7A 4HK6A 5HAOA 5HWNA 4MIMA 3L0KA 3WUGA 4CNPA 5LA1A 4PUUA 1W9UA 3W7NA 1P1XA 3GC5A 3NQVA 3W70A 3NG3A 3EA2A 4DZHA 1PEZA 3R8HA 3ME3A 3G2GA 4YHGA 1E0WA 1MDLA 1F05A 1NOWA 1S38A 3V35A 4IMEA 4AWEA 1XKJA 3NSNA 3CK5A 1EXPA 3TYEA 3CHCA 1UG6A 4NZJA 3B9EA 1UWTA 5JBDA 3I6TA 2BFGA 5I23A 3A3XA 1PIFA 4WCJA 3EX3A 1J79A 1TPB1 3UPBA 3O07A 3BSMA 4H9ZA 3EMZA 1VEOA 1UD6A 3PWGA 2QUNA 4Z1BA 3I7SA 2EPLX 5FJTA 3NPUA 1S5NA 1FX6A 3CXOA 2PWHA 1OG0A 5CKSA 2AAMA 4GBUA 4W8AA 4BQ5A 4IG2B 1JUEA 1VBUA 4DM2A 4PMNA 4FLQA 2X40A 1I2NA 1IXNA 2CWXA 3PUGA 3AXHA 1E15A 1FCBA 3AJXA 2BODX 1BQCA 1VPXA 4CQCA 3GU1A 3BLLA 2CBJA 2WHLA 1HP4A 2X1RA 3KCOA 4HJWA 3KEHA 3LCHA 1S5VA 3C2YA 4RZBA 2B7QA 1ZLPA 3W7KA 2ACSA 3G1VA 1E3ZA 4N4QA 3UU0A 3MQTA 4B2DD 2WHKA 4GXWA 3UY8A 2D0FA 3ITGA 2WXDM 2UBPC 4TOQA 4N4PA 1EC8A 2I5GA 2PDMA 3XIMA 3GX9A 3KWSA 4ZL1A 3IJQA 2I17A 2HWGA 1XUZA 3QGAC 4I90A 4RE2A 4XAYA 2GJRA 4HNTA 2J74A 4HMCA 1JCJA 1Z42A 2HEJA 3W7LA 3M0IA 4L4PA 1FFRA 1E71M 2O0TA 4YCOA 1GJWA 5A8GA 3AHYA 1XLHA 2H9AB 4DI8A 5B80A 3JVAA 3GDLA 1LOQA 3VM5A 4E8CA 1NOFA 4M1RA 4MAVA 2Y63A 1KFCA 1VBRA 1YEYA 2DZAA 1C29A 1HGWA 3T0CA 1GGOA 4WQ6A 1TSIA 4PRTA 4CKQA 4C91A 5D33A 4B5TA 3W82A 4N6FA 2BY3A 4F4RA 3QXBA 2VDHA 4GIRA 4ONVA 4PTDA 4QCFA 2QV5A 3VVGA 2WMKA 3WJSA 2G37A 3ID7A 3BC9A 1CXHA 3UW6A 3UF9A 3S1XA 3QMRA 2YL5A 3MUZ1 4QQ3A 1UMLA 2F9RA 1UKTA 5LHEA 2J7CA 4ATDA 3VGFA 1M9HA 4V1YA 4I5RA 5CZSA 2VENA 3W01A 2ZUUA 3RGTA 4X3ZA 4AZGA 2CLIA 1SR9A 3CTTA 2VDIA 2C18A 1NQKA 4GXMA 1E6ZA 2DZBA 3WQWA 3ZWSA 2WNQA 1Q6DA 1H3GA 1BXBA 1LBFA 1KWGA 1IT0A 3VDCA 1QFEA 2EG6A 4FX7A 4J3WA 3U48A 1GJPA 3UG8A 5F4XA 3OIHA 3LRLA 3AICA 3MI2A 5DO8A 4EE9A 4ZSUA 3BSHA 3GVGA 3ZVIA 3SFWA 4JTSA 3TX9A 4TVUA 3SR7A 3VO0A 5CJ5A 1QI2A 1OFRA 1A5AA 4PUKA 4HN8A 3FK4A 3AIRA 3VKCA 1BFNA 1NP2A 1UWUA 3P0WA 2DT0A 4JEJA 2CC0A 4ERIA 4PTVA 4GYJA 4TUFA 4JN7A 2PU0A 4HCDA 5LKYA 1A4MA 4QJ5B 3WLHA 3O06A 3PZNA 4JHZA 3BGGA 2GGEA 1K6WA 4PCNA 1O7AA 2FMOA 2VHLA 3VNJA 5FOOA 1MSSA 5LNRA 3E12A 4KIEA 3LM3A 3DHUA 3T0TA 4JTKA 2W67A 3FJNA 4TX9A 4BK9A 1PL9A 3RO6A 2ACRA 2QV4A 2Z2UA 3P67A 1VIZA 1BVWA 3TLQA 4K7YA 4BHYA 4JNMA 1F76A 4ERAA 1ALDA 3K2GA 4I7WA 4AWUA 1FCUA 3BICA 2D2JA 1N2VA 4PB4A 2X05A 1R2RA 1UHVA 4DJDD 3A5FA 2OCZA 7ODCA 1R3SA 3DFSA 3T42A 4QQUA 1SVDA 4S3FA 3PHAA 1I2QA 1XXXA 3S2NA 3PPHA 2JF7A 4KPLA 5AYXA 3AIQA 4ZGYA 3ITTA 3ATZA 1QATA 2GJLA 2CBIA 1DYSA 1S1RA 4GYPA 3W1XA 3A9IA 1KBJA 1QO2A 1TTIA 4KFNA 3E9AA 1PIGA 1X97A 1M7OA 2WMIA 5H2ZA 1CGWA 3P8IA 2AL1A 2EPNA 4WKAA 3L2LA 4PN2A 4DO6A 2BOGX 4BQ3A 3ARYA 4NNCA 3WDJA 3KL5A 4GIYA 3STCA 3H4XA 1XBYA 5CGMA 3TFCA 2FFIA 4LBUA 3DU0A 3HGRA 3JR2A 3EWBX 1GQLA 3UBPC 2XU2A 4P2VA 1LLZA 3T2OA 2P5NA 1BTCA 1T0OA 1YDYA 1YNPA 3CU2A 1IR1A 4GNKB 3LG3A 4GLEA 2NQ5A 3VIOA 2YDSA 4X9SA 2C0HA 1TO3A 1OC7A 4W89A 3WBXA 3RLHA 3ZJKA 3HQPA 1OGSA 1W1B1 1IHIA 3POHA 2GQ9A 2J66A 4AZBA 1UH3A 1HKIA 1GYLA 1VAHA 3V16A 2VWTA 4GCXA 1ZP3A 3F4NA 2ZUMA 4O1AA 4M1BA 5XIAA 1IXPA 1QHPA 4E8DA 3VPLA 4B5UA 2H8ZA 3WD1A 4CNNA 1ZBWA 3GXMA 3K46A 3CJPA 1VPYA 2J79A 3PZOA 5E09A 2PRHA 4BS0A 2Y24A 1V3MA 1SW0A 1YBQB 4W85A 1JZ6A 4S1FA 4DX3A 3I4KA 1ZZMA 3VNMA 3KLKA 3WNMA 3SO7A 2UZ9A 4OBSA 5C2XA 3P61A 9XIAA 5A6JA 2YCJA 3AYSA 1D3GA 2GQ3A 1Q13A 2E6DA 1T6MA 5LIYX 1J8VA 3M0KA 4UTTA 3VUPA 5CC7A 2XUCA 2RAGA 3FAWA 4IWWA 2OELA 3AOFA 4G5DA 1OC5A 3VABA 2OB3A 2OR2A 5AHFA 5AN7A 1CT5A 4DIAA 1FWEC 1F7BA 3WK3A 4WZHA 5MKGB 3R13A 4LCRA 1W2VA 1WBJA 1M3UA 5J5DA 4GNVA 3VKKA 4A3RA 8A3HA 4D9PA 2Z7KA 4NI8A 4PEEA 1B1YA 5BWAA 2AKMA 3CUZA 4BF9A 4MZ1A 1OQFA 1OEPA 1J12A 5EGRA 3G0UA 2A3CA 4C1LA 1EZ2A 4H01A 4K36A 3E0WA 3WYZA 4L7ZA 3RM9A 3M0YA 3TJIA 3NZ1A 1ZAJA 4HHHA 4LVGA 3IIPA 3ITYA 3GXNA 2C91A 4HB7A 1UOKA 5IHSA 2JKPA 4QNEA 3OLDA 5JIPA 1GQKA 2PCEA 5FF4A 2J8GA 4HSHA 4JDBA 4IIDA 1FDZA 4UR8A 1DWJM 1EEXA 1V08A 4LUTB 3LOTA 1UP3A 1J4EA 3S2JA 2FTWA 4LYRA 3T2PA 2E6FA 3TC7A 2R14A 2PU1A 4P8WA 4KWVA 4HP5A 1DV7A 2OSYA 3WUBA 4CVUA 4KRUA 1KFLA 3QHMA 3G3DA 1KCXA 3CQHA 3GC2A 4BI7A 1H0IA 1XICA 3VILA 2ZBTA 2PDXA 4MWAE 3PPGA 5CZ0A 3B8IA 4POCA 4HNOA 4OHQA 3B0UX 2YA1A 3PJUA 4A3QA 3W83A 1XIDA 1IEVA 4E0CA 4RR4A 2Z7GA 3QGKC 3MHUA 3KZPA 5A69A 4GINA 3DZ1A 1VH7A 2WSKA 4R34A 1SZRA 3QEZA 4K3ZA 1O1HA 1Q8JA 1FWSA 3EMCA 5TNVA 2GSHA 1EIXA 4KGJA 3GH7A 1LL7A 5L9FA 2OX1A 2QCHA 5IFTA 3VD5A 5ECVA 1KXTA 1WBHA 1GEHA 3SDOA 1GOQA 4HOZA 1CLXA 4RPPA 1H1ZA 1EBGA 3ZLFA 3G18A 4IF2A 1ISVA 4PCFA 3LXBA 4BR1A 5FEZA 1Z7AA 3TJ4A 2YZRA 1VRDA 1TFVA 1MWOA 3P14A 1JQXA 4D6IA 1GZGA 2BS9A 3DFHA 1O94A 1C8QA 3CV2A 3LK6A 1UKQA 4FNRA 4YVXA 1G01A 4YJ5A 2B31A 2GK1B 3A12A 3EWWA 3IGXA 3FCPA 5ABFB 1MUWA 4MFDA 4F2UA 2W0UA 4FXSA 2XVLA 1JD7A 4P7RA 1A0CA 4S38A 3GU2A 3MKCA 4J35A 2BP1A 4CCEA 2R8WA 3UG3A 4HNCA 1TIMA 2CLKA 4R7OA 4H9TA 5K9CA 1VFOA 2OQYA 1XIFA 2JEPA 1HF6A 3OVGA 3CPGA 5BXPA 4XTDA 1DEDA 3KL0A 2VZVA 4HU3A 1EQPA 4N9DA 3UETA 1JYNA 3RNDA 3G1FA 5GJPA 1TRDA 3MP4A 4GJJA 3NURA 4DUXA 3AIVA 4PSRA 3SEPA 3MB9A 2XHYA 3H21A 2PP3A 3QF0A 3TZFA 3FA4A 4KCUA 3ARSA 5KITA 1A5KC 1YADA 2ZZ2A 1VFUA 2BXVA 5M5DA 2FFCA 3NM1A 3NFUA 4J3XA 1N8FA 5FCZA 3HOJA 2VP8A 4FPSA 1XC4A 5HUPA 3WDQA 2HPMA 1R9ZA 2VDGA 2AL2B 1BG4A 2VZSA 2J27A 4FLRA 1OFBA 3G24A 4LVDA 4AUBA 3VKDA 4UTKA 1EKOA 2E7FA 3S9YA 3CQJA 3A13A 1Q85A 4BQ4A 1V7AA 4JCMA 2J7EA 4ZQMA 1VR6A 1THFD 4WF7A 1WP6A 4B9YA 2V38A 2R1MA 3AQUA 1EJRC 2G95A 2Z4GA 4UTIA 2WPGA 1JDCA 2QAFA 1PX8A 1MMFA 1EOMA 2YA2A 3EX2A 4LVBA 4O50A 3CHVA 4OZOA 4Z2JA 2NQ9A 1RY8A 3DIPA 1ODUA 3WJYA 4ZTXA 3KW3A 5AC7A 4R85A 4JTJA 1GG0A 1BWVA 1Y65A 4N9CA 1D2KA 4J3ZA 4FAMA 2VUNA 5F7UA 4O11A 2FH6A 2IPWA 4O1CA 3E2SA 1E4IA 4ZVJA 1R47A 1ONWA 1G5AA 4O0KA 3L5LA 1H49A 2BSLA 2NLYA 4S2BA 4IP5A 1OIFA 3HG2A 2AQVA 4RV8A 1Z3NA 1OF6A 8XIMA 4WJ8A 4OBTA 2J24A 1TJPA 1GVEA 4E2BA 3GFYA 1MYRA 3GHTA 1CENA 1EDQA 4FO4A 5F2GA 4LSBA 3THDA 3INPA 4KMQA 3VKAA 4OE7A 4K8HA 3W6MA 4F48A 3T44A 4J4KA 1XRFA 2QCFA 1QI0A 5DCDA 3OYZA 5D2XA 1WDRA 3W25A 5G4EA 1GHSA 2DUXA 1JR1A 4EXQA 4PRRA 3UQNA 5AVHA 3MHGA 3KS5A 3O6CA 2XFRA 3AMGA 2ATMA 1G1YA 4GZIA 1AH3A 2YBVA 3P81A 3C8NA 4GQBA 4DZIA 2F8QA 2Q6ZA 3LHUA 3UXDA 3E2RA 3DECA 1KLZA 3GM8A 2P0IA 2W9MA 4US6A 3GWQA 4ZXOA 1DJGA 3CIWA 5FSDC 3WQ6A 2RKXA 2VQUA 2X2GA 5G4HC 2RFGA 4HZMA 1W1YA 2E9BA 2G4FA 5CPOA 1Z8AA 4AVFA 4KEUA 4LYPA 4REQB 1WE5A 1KW1A 2DQWA 4K38A 1XYBA 4X61A 3UPWA 4DNHA 1PYMA 3WELA 1GK8A 3O3RA 5DXYA 2VEIA 4NASA 2OZ0A 4QLLA 1PO9A 2EGZA 4MVAA 5D9OA 3GG1A 1H1YA 4IJCA 3O16A 2RDUA 4AY8A 5JIWA 1P43A 1XFBA 3M6YA 1XRSA 3GTFA 1P0EA 3F2BA 4JL2A 4NY2A 4TTGA 3KAOA 5DMNA 1R8LA 3C0QA 3UR5A 3BLFA 1R3RA 1UWRA 3WJXA 1XFCA 1U5VA 1OGBA 5IRPA 5JXQA 1AQMA 2WKLA 4DEFA 4DLFA 4UQCA 2GVJA 3VX1A 3VNDA 2MUCA 4NAEA 1VGAA 1ADDA 2D1ZA 1VFLA 4GD0A 4DJFA 4UQDA 2I56A 4XTIA 2PTZA 3FHQA 3WQCA 3B8TA 4QNWA 4MZ8A 3WL1A 5A8MA 3QY8A 3M7SA 1PZ0A 1B4EA 1QPQA 3TCEA 4WUIA 3STPA 2IQTA 1KBBA 5AYIA 3CTLA 5FF3A 4C7GA 3LMYA 2CWNA 3M44A 3SUWA 3QR1A 4IH3A 1C93A 1KTBA 1PXGA 2I16A 3GU9A 1E5NA 9CGTA 3BV7A 1UR8A 1EGVA 1XC6A 5A6LA 3AJ7A 3O7UA 4IGSA 4UNIA 3S9IA 4PMOA 3KOWA 2D24A 2QW5A 1KLYA 3R79A 1HW6A 1K7XA 4IQLA 4F0MA 4FR1A 1SZEA 3W07A 3EGJA 4AD1A 1OGGA 3VOIA 2WBGA 2JALA 3N15A 2ZVRA 1NDVA 4NG3A 2WWDA 3BLPX 3DFQA 2POTA 1NAL1 1ZTVA 2ZWZA 1RBOB 4AISA 3R7MA 1U83A 3ALFA 4DYKA 5F2LA 3VIKA 4MADA 3ONBA 3RRXA 4ZO9A 2PC8A 2OYLA 4P7NA 4IMFA 4O16A 1EC9A 3M1ZA 5D38A 3Q2DA 1EUNA 2H3DA 1UR0A 3G1AA 3PBWA 3N2TA 3I3BA 2FGLA 3AYTA 1JRBA 1B3OA 5HPCA 3B8WA 2VTFA 3N4AA 2GDQA 5TAOA 1PS9A 1CXFA 2QJNA 4FX8A 5AC8A 4KBXA 5A8QA 1LDCA 1EX5A 1SMDA 2BVTA 1YNQA 2G3MA 1JD9A 1CNVA 1PHWA 5DN1A 3NEHA 2QVHA 5HULA 4B16A 4PMUA 5J5RA 1VQTA 4M3PA 1R5YA 2I9EA 4FEZA 1ZSXA 3U6WA 4CQBA 3ABSA 1GVYA 4AX6A 3F5JA 2YA0A 3H55A 4XO7A 4ICMA 3GBDA 2D2HA 2DVXA 4M6UA 4EXBA 1XLDA 4MFEA 1XDJA 3NIYA 3ZT6A 4HMDA 3U7VA 2CERA 5A5WA 3W86A 1RP9A 4BF5A 1EIBA 4L6HA 4IPNB 1EJWC 3S1GA 2NZLA 3DFYA 3JU2A 1ONXA 4X0NA 3UWWA 3PJWA 3N2CA 2DP3A 1MW1A 1I1XA 1VLWA 3LRMA 4XISA 2HTMA 3VIMA 3VIGA 7ENLA 1J0HA 2QF7A 1JPDX 3VOFA 4EAYA 2J77A 2D3NA 4MWAB 3SFKA 5D9MA 4IFRA 5EMJA 1O5RA 4IUGA 3V1HA 3T08A 5AC4A 5BYWA 1QI5A 3H4GA 2HK0A 2J9ZA 3R11A 2QDEA 1TUFA 1JCXA 6REQA 2DY3A 4V15A 4ZA0A 4XAFA 1H7PA 2PDJA 1E6PA 4L1XA 4A22A 4GG9A 4ZQRA 4UFKA 5A8NA 1YDNA 4LRSA 4Z0SA 1JCYA 5MF5A 1TE1A 1DJZA 3HO8A 4E4FA 1WUEA 2X42A 4O4VA 4WX2A 1KC7A 1Y5WA 4NUWA 4ZFCA 2XIIA 4PTMA 3ITCA 4XO6A 2G50A 3TR2A 2I7GA 3R4IA 4B92A 4P7LA 1GPFA 1QVBA 3LEPA 2ZYFA 3IUHA 5DMYA 3PFRA 4EXAA 2PLMA 2NQZA 3TWBA 2I57A 1TRIA 3K4WA 1Q6OA 1TV8A 5HMDA 2NQJA 1CGTA 3FAXA 3GVRA 4A3YA 4JQAA 1PKLA 3TZNA 1LP6A 3QR0A 3ANYA 1D7KA 2VGIA 5L6UA 2Z26A 4L9XA 4C6PA 3L5MA 2C13A 2NUWA 1A5OC 3IAPA 2QHAA 5I09A 4QSFA 4RDWA 3ZO9A 4NF7A 2J7BA 3MC5A 1OB0A 2YCKX 1FCQA 2WMIB 5EFDA 3GDTA 1V3KA 3BMVA 4BY3A 3OA3A 2QJMA 2DZSA 1EP3A 1OD8A 4JQ1A 1YNYA 3VOJA 3VDHA 2V30A 4RW5A 5LA2A 2HK1A 2FHCA 4ZE5A 4JQ4A 1U1UA 1XSKA 3ARVA 3DYMA 1QCWA 3MMTA 1KGXA 4GYPC 4V27A 2EO7A 5CXPA 5G4WA 3BK0A 1ADOA 3R12A 4GMEA 3G1XA 1TVNA 1FXQA 5EA9A 4WY0F 1X96A 3R5EA 1H51A 1FWTA 4K1WA 2A2IA 3HGJA 3BLOA 1F74A 5K9DA 1O1ZA 2CZDA 3OZYA 3A4XA 4WOQA 4A2SA 4WY0A 4UIOA 5CJMA 4HVXA 1SW7A 4Q6JA 4OWGA 3ICJA 2WANA 1QUMA 1S46A 1G4EA 2E5CA 3M07A 2FZBA 3QH2A 2JF6A 1MEHA 4I9TA 3N3TA 4C7FA 3NGFA 4GBDA 1QK2A 3W72A 4AHQA 2XTKA 3EAUA 2BX7A 3B0PA 1KB3A 3PBUA 5C9UA 2ZUVA 4LWWA 4WVXA 1TV5A 3WFZA 5E9AA 2PAJA 3H53A 1B4KA 2INFA 2OSXA 1RBAA 2Q8XA 2GUUA 4A8IA 5IOBA 2ZRYA 4Z17A 1MZRA 1XYLA 3KFTA 3TVAA 1BYCA 3CL7A 2BBFA 3RF9A 5F2IA 1AJ0A 3GXIA 4OBRA 3KCLA 1UWQA 1QNVA 3GYEA 1LQ2A 3W26A 4UWMA 1ISYA 3CH0A 2Z6IA 3RN6A 1WUFA 5DANA 1ZJBA 4LS2A 3EZ4A 1DVJA 3THCA 3FSUA 3N73A 1VJSA 4XB3A 2Y85A 1OT2A 2Q3OA 2CPUA 3H2NA 1WPCA 4W5ZA 1J6OA 1V3IA 2MANA 1WZMA 4BFAA 2RDWA 1EO7A 2Z25A 4NJIA 1ZUAX 2DZTA 1JCNA 2WQPA 1XSIA 1XSJA 5JU6A 1JCTA 2KAUC 2FZ9A 3GG8A 1QMLA 4W7WA 1J9YA 2DZWA 2Z2AA 3Q67A 4RJEA 5HBFA 2CHNA 1L8NA 1TYGA 4O1FA 3WIJA 3BTNA 1LJYA 1GQIA 3LSCA 3VE9A 1TWSA 2NV9A 3FHAA 3LZ3A 2ABBA 5CBBA 3GFXA 2CEQA 4WEVX 3GKAA 4UTTC 4M80A 6TAAA 3UJ2A 3SUUA 1DHPA 1V6YA 2V0TA 2YZ5A 5CC5A 1W9DM 4E6MA 4DJEA 1MFVA 2PZNA 3O0KA 2B7OA 4AEOA 2GL5A 3ARUA 1XQKA 2QCCA 5HK4A 2WVSA 5KETA 4MY9A 4BF7A 3LMZA 1TPFA 3SURA 1TR9A 4EF9A 1K70A 1W3NA 3TW7A 3W37A 4MTVA 3WLIA 1UIPA 5AB3A 4GKLA 5XINA 3VGDA 1OFDA 3UWEA 2BHZA 3C2FA 1LOSA 3CAKA 3WJWA 3GSMA 3LLDA 5TF0A 2PF0A 2WB5A 1D8WA 1VC4A 3V0TA 1FP8A 2PD5A 3FS2A 4CQAA 3NTYA 1B3VA 3OIXA 1TCDA 2J25A 4UXDA 4NZ3A 3AC0A 2PZ0A 4GUHA 4FX6M 2ZC8A 4PULA 3KLLA 4JY8A 1DE6A 5K7JA 1SR0A 4PL2A 1Z69A 1WB0A 1XUUA 2DZPA 5I78A 1ZGDA 3RCMA 2VYOA 3MHFA 1I0BA 1PX4A 4MLJA 1MRAA 3H2AA 2VGBA 3PZ9A 5JQ9A 4XSMA 4FNPA 3W7EA 1VLIA 2WNWA 2FVMA 1OY0A 4O13A 5BXSA 4DBUA 1Z48A 5T9CE 2OSWA 1OABA 3LM7A 1AZ2A 5U7SA 4GUIA 3HMJG 5FL1A 3MPGA 1TJ0A 4Q7NA 5MHBA 1K6AA 1BF6A 2POZA 4Y9MA 2I5IA 1AL7A 5ABTA 3E3HA 4E2VA 4IMDA 1ZU8A 5LYRA 3TYZA 3GO2A 1PCKA 3H54A 4D8AA 3DERA 4QM1A 1UWAA 3FN9A 1V4YA 4DBDA 3NEVA 5EMMA 1LORA 4H2CA 4JAWA 2NXHA 3RX2A 2WJZA 2AGKA 4R9OA 1V02A 3NVDA 3MMWA 3RU6A 1CTNA 1UA7A 2GWNA 4GY0A 1JZ8A 1CXLA 2X0SA 3C8FA 4UTUA 5E0CA 4MNKA 1MRQA 3BO9A 5BROA 2CESA 3CQIA 2W61A 4UTLA 2VUYA 3F03K 3NQDA 2OWXA 3ZLHA 2PDYA 1SMAA 1PZ1A 4LJ3A 1T41A 1NOUA 1AK5A 2QVNA 4G7EA 4ZO8A 1TCMA 4J2MA 1XLKA 2X0YA 5FEWA 4MKSA 3PJXA 4BI6A 3WENA 4HNVA 2YFNA 3WMLA 4PB3A 2D2OA 1VP5A 3MDWA 1QAPA 4IIHA 1WXJA 3IANA 3V4BA 2QUTA 3WX7A 2FVLA 2GQAA 2CBVA 4CGTA 3HZ3A 1QNOA 1DBTA 4PTNA 3G8RA 3BMXA 1W9PA 4IICA 3L4ZA 1UQYA 3AZRA 2WSYA 2YL6A 3ZM8A 4XAGA 3BAWA 1GVQA 2P3ZA 3BPWA 4Q4OA 4LS1A 2DUAA 4AAJA 5I3FA 1E1FA 1Q7MA 3FVDA 3W6LA 3FVMA 4G8TA 2ZE0A 2YPIA 3K8MA 2PWGA 5LNWA 2G3FA 1K9EA 3R0KA 3DYPA 2ZRUA 4OUIA 1QJWA 3ARQA 5I3JA 5I77A 3GD6A 3BOLA 3VZYA 2GVYA 4R53A 3VXGA 3FEMA 3MUY1 4ZB2A 4H8VA 3CEUA 3WSUA 5K9XA 2XH0A 1C9WA 1TPWA 3NCOA 2VR2A 1NQ6A 3PF3A 3FA3A 1OX6A 2ZCGA 2WNNA 3U2ZA 4DXVA 3KVLA 4JIPA 1TJRA 4UQBA 3WQOA 5H1WA 3HBLA 1NF7A 1E0VA 3NQMA 3GAYA 1K4HA 4QAWA 4WDXA 2XJ7A 1J10A 2E1WA 3AWOA 3W7JA 2ISVA 4DWSD 5J8LA 3QM3A 3NAVA 1TPH1 1E51A 3GTXA 3MI6A 3RU8X 1E56A 1UR2A 1HL8A 3AMLA 4H6KA 1S2CA 3WEOA 3NZGA 3MT1A 2WHJA 2V3GA 3OA5A 2ON3A 4YNGA 1F6KA 1U30A 3UFYA 4HGXA 3BV4A 2BASA 2P50A 1TPDA 4NNAA 4ICCX 4OUEA 4IQDA 1I2PA 4TXEA 2W79A 4HPXA 1VYPX 1CGVA 1EQCA 2CKSA 3CUHA 5I03A 2UV8G 2NUYA 4QSHA 4DYEA 3B0XA 4KCVA 4WSKA 1B2YA 1PWMA 3NYZA 4CD4A 1A3XA 1F6YA 3R8GA 4KWUA 2A5HA 2HMCA 4LUSA 3PPCA 1M53A 1MI3A 2YB1A 2ZZ4A 3PZMA 2HXTA 4TQTA 1KFJA 4B4FA 2ZZ1A 4XZWA 1AW2A 1JDEA 3IGHX 1ECQA 3ZR5A 5I24A 5A8OA 1ZAIA 3WQVA 4EPKA 3WFLA 3IRDA 4KH2A 1W9VA 4KEMA 3QOKA 2JBMA 1T99A 3JZEA 2QLYA 3MZ2A 3CV1A 3IJ8A 3MO4A 1O66A 2R9RA 5DMLA 1VYRA 3KX6A 1V3JA 3V5OA 3G1YA 3T78A 3FKKA 2BG5A 1WDSA 2V67A 1TWWA 2MNRA 2IKGA 4AX7A 4JD4A 3F7JA 4QR6A 1LLOA 2GGIA 2W4XA 1YPXA 3CT7A 3L9CA 1RCOB 5I00A 2QNEA 1Y5VA 1G69A 3ABOA 4FS9A 5B7ZA 3CUJA 3W2MA 1P7TA 3L2MA 4FP1A 4HKPA 1WKYA 1B3YA 3VUSA 5H91A 2Y8VA 1FOBA 1H61A 1GOWA 1X98A 3KZSA 4NRRA 4YCPA 5IDIA 1X8FA 4XKYA 2WJDA 4S2CA 4FIQA 2BMBA 3OZMA 3ZQ9A 4GISA 4GVIA 2PPGA 1BWLA 5AFDA 1HP5A 1LRQA 1VFSA 1XLJA 4JFTA 1S3TC 4JY9A 1XPYA 3S1WA 3A3WA 2ZRVA 3L4TA 1SM9A 3S5SA 1R0MA 1R46A 1VCVA 4UFMA 3VGGA 3HG4A 5BOEA 1TWDA 2REQA 4LCSA 4KIRA 4PZVA 1BKHA 2FB2A 1RALA 1UZ1A 2ZRXA 1V02E 3RX4A 2A7RA 5FJUA 2I14A 3VDGA 2NT1A 3EA1A 1US3A 3R43A 4UNKA 1VYSX 1K8XA 2FHFA 2PDQA 3ATYA 1TZ9A 3NPXA 3KHDA 1B3ZA 2B7PA 2OO0A 4I8DA 1XM3A 1G4SA 4PMVA 4OU1A 2PF8A 1J0JA 3VD9A 1NWUA 3OQ8A 3WFAA 1WDPA 3IIVA 5FEPA 1MXGA 1FWIC 3U57A 5AECA 1Q2RA 4RKAA 2PP0A 4PL1A 1K77A 2ISSA 4LUJA 4S3CA 4CD6A 1TQXA 2IQDA 3DYOA 3EXRA 4WK9A 4LTSA 1NDWA 4DJFC 4L4OA 3PTKA 3IIXA 3P74A 1NFGA 4MKVA 3UESA 3AIBA 5CG7A 4MPQA 4BKNA 3W7DA 3TDFA 2F7FA 3FDGA 1IQ8A 2PA6A 2VURA 1A3WA 1WDQA 1X6LA 3A64A 1U2YA 5I02A 3QW4B 1UMYA 4GI8A 1VPQA 2CW6A 3I6EA 3FV9A 3BAXA 2IPJA 3CAVA 1Q4NX 2OX4A 1EWDA 4CVWA 3SN0A 3RR1A 4CCDA 3WF3A 2E1DA 1IEXA 3QHNA 1GONA 1JVNA 2AQWA 4Z42C 2XSBA 1EJSC 5CPLA 1UPMB 2W63A 4S39A 1LBMA 4CLMA 3TYBA 5CPSA 5BZAA 4DBEA 3VC6A 2EG7A 3AUJA 3LPFA 2YL9A 3WLKX 2Y61A 1KCZA 4QP0A 3ITVA 4BEQA 2IPGA 1XHGA 5EBUA 1GG1A 3QQ0A 2A3EA 1D3CA 2A85A 3GS6A 2J78A 3H7UA 2BB0A 1WZKA 3VNYA 4TVCA 1XH2A 3E49A 1ZALA 1HJVA 3LPOA 4UFLA 1KM6A 3BSGA 1E5JA 3LXCA 3NQEA 1B0IA 5AZ0A 3TWAA 2J9YA 3L68A 4WJXA 3L12A 2VZUA 4YMZA 2Y7DA 3MVIA 4HPHA 1G67A 4BCEA 1H7OA 1OCJA 5I5RA 2DVTA 3QZEA 3GNDA 5DY2A 2VX7A 4Z08A 2YFOA 1OADA 3ZYZA 3HPAA 3LBCA 1EJXC 2X0HA 1XH1A 5A8PA 4M81A 4U31A 3HQOA 4IT1A 1CB2A 3SIZA 3W1LA 3PUOA 2WAGA 2G41A 1PUDA 2V2CA 2DIKA 3V5CA 1V0KA 3MJYA 4JTHA 4Z2GA 2OMAA 4IFKA 5D05A 4P8VA 5BWFA 3L4VA 3N2BA 2HNHA 4PMXA 3XISA 5EB8A 3Q65A 1CX9A 1EWEA 4W88A 2PWFA 4LF1A 1DIOA 1WKFA 1UBSA 3O8AA 2PRMA 2WKJA 6REQB 2CZ5A 1DJQA 2PS2A 5JH2A 3QW3A 2DDXA 1IF2A 3PSWA 1FKWA 1HKJA 4JOMA 3CQKA 2DW7A 5A6AA 4HSOA 1K9TA 4KKXA 2WMFA 3AXXA 2QCLA 2PE4A 3BZGA 1MXDA 3Q58A 3QBUA 4OFCA 3TV8A 3VE7A 1FWNA 1T8QA 2C1GA 4XD3A 4BWLA 3TSMA 1RAKA 3TJXA 1AL8A 4QITA 3ZT5A 4GY7A 1JQVA 1NWRA 2I1OA 3COTA 3QMTA 4EIVA 1C9DA 5AHIA 2PCQA 3TSDA 3KE0A 1FXPA 5AHLA 1W9BM 2VC5A 3LV5A 3W38A 5KTLA 3RX3A 3LZ5A 2VGGA 1S2UA 1LRNA 4NJKA 3TC6A 4K8EA 3GHUA 1JYXA 4Y96A 1M5WA 4NX0A 4FF5A 3G6MA 3VC5A 2DJXA 4QCEA 3WLNA 1IEQA 1MW2A 1OF8A 3MY9A 5CZJA 2FMNA 2YDAA 4US5A 4QEHA 3PG9A 4C90A 3OVQA 4AVOA 4TVDA 3T7VA 2BHYA 1ZRQA 1V6TA 2VKZG 1UCWA 4Q22A 1HL9A 4N0RA 3L4YA 4GA8A 2Q02A 1R9YA 2DH3A 1W3IA 3OLEA 3RAOA 3MI3A 4LF2A 1V6WA 2FZMA 3HPZA 3CL8A 1D3HA 4JR5A 4LALA 2B81A 1VBHA 2YW3A 3NQ7A 1Y8BA 3QKEA 2YDQA 3QC0A 2ZUSA 4WY0B 1I45A 3T0DA 4K37A 5DBUA 3PNZA 1N8IA 1BRLA 3F4WA 1UW9A 3KBJA 3L23A 4AZIA 4DNMA 1WX0A 1UKPA 2NUXA 1HVXA 1XISA 3T6CA 1FWGC 1J0YA 3BJFA 3NR0A 5DY3A 2A21A 1EX1A 1LTDA 4B5NA 4KERA 3VKBA 2O55A 2R91A 4K68A 4EF8A 4Q7BA 1UP2A 4GC4A 2PB1A 1OYAA 4UZSA 4CU7A 3SRKA 3THQA 4DRSA 2TSYA 4KEVA 1XIMA 2KZHA 5C2CA 1KBIA 2VRJA 4R5EA 2PMQA 4JCLA 4A8NA 3CLWA 1ESWA 4K1GA 1DHKA 3ITLA 4Q6XA 3NQBA 1NVMA 2WNZA 2XINA 4J3TA 4PSPA 3W7QA 4A21A 3UZWA 3ES7A 1RVKA 1YE4A 3M5VA 1A5CA 3WNKA 3S5YA 4QJ3B 3NM3A 3H2CA 1BD0A 4I5XA 1IZCA 3STGA 3CZGA 1XS2A 1VFHA 1W1A1 1T7LA 1HKKA 1TQJA 3PSVA 3EEGA 1JPMA 3MUCA 1BXNA 2BHUA 3CPUA 4RZ5A 3W27A 2JKAA 1XYAA 3LHWA 3QYQA 3W81A 3S83A 2D23A 1KTNA 3F4CA 3IJ9A 2PP1A 4C6IA 2XGIA 2EG8A 3EPNA 1RPXA 2WOQA 3OJGA 2ADAA 2L5HA 3CIVA 2WCSA 4KWOA 1UOZA 3KS6A 5DLCA 5BCAA 4DUWA 1A5UA 3WO8A 1FHVA 5JVLA 1TREA 3DI1A 4NZCA 3CBWA 1KBKA 4IFOA 4GVFA 3OG3A 4ROQA 2OLAA 1IGWA 3GNOA 4DY1A 1X1OA 4KT2A 1JZ3A 4AIEA 4MMWA 1RY0A 1OG6A 1PKYA 1YX1A 2GLKA 5AY7A 3ZIZA 4C6FA 1KD0A 3AHVA 5BRQA 1QWKA 2VM8A 1GOOA 1HO1A 2YXXA 2ESCA 1KRAC 1PKMA 1NELA 4Q8QA 1PWLA 3W1NA 1E4MM 3KOZA 3QPZA 4GPNA 3W73A 1LBLA 3USZA 3NSMA 3GYCA 4LVFA 3E0IA 1B9ZA 2ZXDA 3NWRA 1GYMA 5I2UA 3LS9A 4OV9A 4FMVA 4Z1AA 1QI4A 3P0XA 3TMLA 1LYXA 2V69A 2O4MA 4QROA 5C54A 3FW6A 4FLOA 4O10A 4G1KA 3WDRA 1SFJA 2WZTA 1HJUA 1I4NA 1IE7C 4ORMA 4DJEC 4DZAA 4YIWA 1QNQA 1B3WA 2VC6A 2XPKA 4J5NA 4WJEA 3PB0A 4B3KA 3THUA 1OHLA 1G7UA 4GQ0A 1F8MA 4IIBA 4C5YA 3MZNA 1X8CA 4UR7A 1PZ2A 2YLAA 4EPBC 3EPOA 5DBTA 3ABRA 3LHTA 3CHFA 4GACA 4H9UA 3BW4A 3WUEA 3RLUA 1EPVA 3CH9A 3LTYA 3QSRA 1US0A 1R6WA 2QPSA 2PLKA 3AROA 1RH9A 4YN5A 1W5QA 3NPWA 3WEMA 5HNNA 3QC3A 1A5SA 4PMQA 1POKA 1VCGA 3UWUA 4NZ1A 1XLAA 4LT9A 4XBSA 3NXLA 2HVNA 1H1NA 1QPRA 2V81A 2BZNA 3N3MA 1HT6A 4XSLA 2V5CA 3TYCA 1WZLA 1VD6A 3H22A 1F3TA 3D6NA 2DSZA 1V3LA 1X7FA 4HOXA 3SY5A 4XZHA 4I9JA 3UZ5A 4WGXA 5DFAA 4JHOA 1GKPA 2WW5A 3W75A 4RXGA 4N42A 2V5JA 4PFHA 3AMKA 5FJOA 3R58A 2WBKA 1VRXA 2YCIX 3VIJA 1MEWA 4ENLA 2R1PA 1I8JA 5AOUA 3GH4A 4KGLA 3OGVA 2AOSA 3CEPA 4XZNX 5A6BD 3JUGA 2ZDRA 5CPNA 4QE5A 2AMGA 2FZNA 1M65A 3L2IA 3G5EA 3UCQA 4FALA 4U2ZA 1UASA 1UD4A 1V8EA 4H8NA 3SCPA 3BOXA 3M0HA 1LQAA 1QPOA 3IV8A 1SU5A 3L7RA 5KSWA 4P7QA 4E5TA 3SGUA 4LUIA 3RJYA 1XGDA 2Q3RA 1Q45A 3VTRA 3NZQA 3WH9A 3CLMA 4CD8A 3CAQA 4ZQNA 4OVXA 5KZ6A 4NZ4A 1UD8A 4DB7A 3FOKA 3WZ0E 1GW9A 3CB8A 4XVEA 3WQ4A 1GOKA 3UZJA 3GNXA 5JMUA 3PFMA 3TNBA 1F8IA 1MNSA 2HISA 3CO8A 3WLRA 4R7JA 3CMGA 3LLXA 5FF7A 1NF0A 2GJXA 4QS6A 4N02A 2TODA 1YRRA 5HPOA 1FCVA 5CGTA 3BARA 3AHXA 3LCWA 3UEQA 4JFVA 3FDKA 3C3UA 4B90A 3HFYA 4AZHA 3IGUA 3GIPA 1PZ3A 4TU1A 3A47A 5EPDA 4AF0A 1Q66A 2DT2A 4LAZA 4U4MA 4JTDA 4GVHA 1P0BA 2ISFA 5AYYA 4UNLA 3VNIA 1LZOA 3UJEA 4HHPA 1FHLA 1TMLA 3VOCA 1MDRA 4B2DA 1X39A 4KFOA 1VHCA 4Z2HA 4P8UA 1WOAA 2VCAA 2WHMA 1MEIA 4MAZA 3DG7A 3EKZA 5I3KA 4RLIA 4V28A 2J7DA 3LGGA 4UTFA 2QCGA 3KTSA 2G8ZA 3A3HA 3LU2A 1U33A 4KESA 1M01A 3H24A 4C5ZA 4Z1YA 4NZFA 5CC6A 4INFA 5C9RA 2PDGA 1GTHA 1W8SA 2ACQA 3QJAA 1W0MA 3Q4DA 4Y90A 3N19B 4AZCA 1XI3A 2V63A 2WZEA 2PUZA 2CU0A 3GVQA 4ZZ9A 4B3ZA 4DELA 1GT8A 3WH6A 2DZVA 2XFFA 1LUCA 1ITUA 1LCOA 4AMCA 2WQDA 1E1CA 2JIEA 1MQPA 1Q4WA 4FHAA 3AXKA 1LL6A 1BYAA 3UWQA 4HTBA 9RUBA 1RA0A 4HYRA 3EPMA 3EKLA 3S1UA 4ALDA 3K8KA 4DQWA 3WF1A 3H23A 2JIWA 1IT8A 4LUSB 4XKMA 4Q3MA 4LPCA 4M7TA 4L9ZA 1YPFA 1V0LA 3EA3A 5FD0A 4OOUA 2WCGA 4H9MA 1NP0A 4QLJA 4IM4A 2LLEA 1ONEA 2NSXA 3R1ZA 5FF0A 4G6CA 2YBUA 4L61A 4JTEA 3E0LA 3URQA 2DVUA 1W9XA 3E2VA 5LIKX 4D1IA 2PDWA 3TN4A 1L8PA 4UZUA 2TAAA 1P4CA 1E0TA 3RUBL 1ZL1A 3IIZA 3E74A 3NL3A 1UUOA 1L6GA 2FH8A 3RM4A 4ZOBA 3UXKA 4X2RA 3E1F1 4NT0A 3N6QA 3WLLA 4LB4A 3OU8A 3O6DA 3HPSA 2OQHA 3MP3A 3QN3A 3T9PA 3OZOA 4CEXC 4PFMA 4Y9AA 2WM1A 1PX3A 1JI2A 3MWCA 1NWSA 1BSLA 4GGHA 5D4YA 3BQ5A 4Q4SA 3QZAA 4TR9A 4HZ8A 3APTA 3P62A 1ZBVA 3NDYA 1IT7A 2E28A 1AQFA 1P7TB 3QYSA 5CH9A 3VYLA 1U22A 1TPVA 3TNOA 3UA4A 1FY6A 4HA1A 3BE7A 5F1UA 1ICPA 3QSTA 4XKYB 4AEEA 3LA4A 4AFYA 2WM0A 4M8UA 5G1MA 5LGZA 3N04A 1KNWA 3P7YA 3SCSA 3AS2A 2V2HA 2X1TA 3SW6A 3K13A 1V6XA 4DJDA 1UPPA 1KRBC 1V0MA 1H41A 1MXSA 5LNUA 1KRCC 2ZOXA 4X60A 1QNRA 2WSPA 5D03A 4Q8NA 5BU6A 2REQB 3B04A 1U1HA 3BJSA 3SQMA 1AZ1A 3QOMA 1UIOA 2W62A 4C6MA 6XIMA 2IKJA 5RUBA 5I3DA 2CKRA 3MMDA 4W87A 4H04A 3G1RA 2O7SA 4NSBA 3PWIA 1D8CA 2JGQA 1WA3A 1VKFA 1XBVA 1DJHA 2ZVIA 3DGBA 3WQGA 1Q6RA 1SSGA 1M03A 1NM9A 3W7HA 4JXCA 3RRAA 4M0XA 3LV6A 4LOCA 2XIQA 4D8ZA 3ARRA 3LHVA 4S3KA 3H7VA 3OODA 4B9ZA 2OYMA 4ECLA 4HT3A 2QULA 2YX0A 5A2AA 3M0VA 3M6DA 4D6CA 2V8ZA 3T81A 2A7PA 3MV11 2CZEA 2JGYA 4G2DA 1MZHA 3B9NA 3AUOA 3SBFA 2VEFA 3KDOA 4AW7A 2WC4A 5GPRA 2HS8A 2HQAA 2BY2A 5K4ZA 4GZEA 2QJGA 1GVFA 3C86A 1DOSA 1P1MA 4F40A 1HXJA 2QCDA 3VOHA 1PVNA 3QMSA 2HV5A 2PDCA 4XZ9A 4QXIA 3VD3A 4Q8VA 1GZ1A 1SZFA 1UB3A 4WOZA 3TYAA 4ORIA 5FESA 3WD2A 1GVSA 1TR1A 3UZZA 2DSWA 4NAFB 2NVDA 4WSJA 3VGEA 3U9IA 5DT5A 5C5YA 5ABEA 4GRSA 1UJPA 2CHOA 3HQNA 4KFPA 3TN5A 4RZ4A 2JKEA 2B4GA 4LVAA 3WNPA 4LV4A 4DPQA 3NO3A 1NY1A 2AKZA 1HKVA 5FA5A 5LIXX 1RSCA 1Q65A 2P76A 3EWCA 3DBNA 1KM3A 3NQ6A 1ZJIA 2QMKA 4UFIA 3FKRA 1XW8A 3QPYA 4Z2KA 3RO8A 3I65A 3RYSA 4ACYA 1H0GA 4UOQA 4K39A 1UC4A 2YLLA 3GB6A 2C79A 3KVMA 3LY0A 1YXYA 4JIQA 2OZ3A 4XUYA 3AU2A 2D20A 4NX5A 3IVSA 3N1AA 4UQEA 3S3GA 2VOTA 3EX4A 3WCZA 1YDOA 1S5WA 2C0AA 5EMKA 1WO2A 3N18A 1RJPA 3GR4A 3DC8A 2Z1BA 4LB3A 4J1OA 2Q01A 3CWHA 5CLTA 1P6CA 2FZDA 3RMEA 3TTSA 4MY8A 3L4XA 2PI6A 3UYIA 1WCGA 4ZBCA 4AY7A 3W84A 4Z2IA 3NOEA 4IXXA 1H63A 3GIQA 2BVDA 1O95A 2QQ6A 3HIJA 3IK2A 4C1NA 1UZHA 1EHAA 3OZPA 4TX8A 4QX4A 4KRTA 2PGEA 3W1RA 2XIJA 5FF2A 5FJJA 4ASTA 5DMMA 4X9YA 3L66A 4LC8A 3IJIA 3WLQA 1OYBA 4HK5A 5BOFA 4HZ6A 1E1EA 3ORWA 1G4TA 1UWSA 1W6TA 1UD5A 3MP5A 3MKVA 3W00A 4HJFA 3N9KA 4H83A 1R30A 1RCQA 4TV5A 4IFKB 2XYLA 3Q37A 4LEFA 3RXZA 5BRBA 3I3DA 2QF8A 4Q32A 5A2CA 1Y7VA 3IK4A 3WQ8A 1QI3A 4AWTA 4JQ2A 2QCMA 1DORA 1QHOA 1PSCA 1K8YA 1K02A 1FWDC 4UB9A 3TEVA 4AWSA 1VENA 4RZ6A 1IIGA 3SUVA 2I5QA 5DX7A 5CPTA 2Z27A 3UVAA 1J5TA 2WSQA 1ZQ5A 2BLEA 4MZYA 4G7FA 6CGTA 2Y6ZA 2V3FA 1XX1A 2ZIDA 1QRQA 4QE4A 5HMSA 3IARA 1KWKA 3K1DA 3THAA 3FJLA 3GDRA 5D2WA 5LNSA 1VS1A 3AFBA 5CG0A 3DCPA 4NZ5A 3L4UA 1QW9A 3P3BA 1OX4A 3D0CA 3ES8A 4HBKA 1CIUA 4KETA 2GYIA 1V77A 4AXNA 2UY2A 5HMFA 3O05A 3WF0A 3FA5A 3W6YA 1R85A 4QFUA 5CJNA 1W5OA 1NWTA 3WBEA 4J40A 2VNCA 2F2KA 4Y6GA 1KO0A 1NDZA 2E9MA 3LGEA 5CBIA 3W85A 1XG3A 1GVRA 1S3HA 3P8JA 3SCOA 3UXIA 4BWLC 4ILSA 4ZMGA 3KHJA 3DHPA 3MBDA 1JFHA 2OXNA 3IS4A 1EO5A 4ATWA 3A4JA 1XDMA 1TX2A 1FP9A 4YS1A 2AGTA 3NO5A 3TQKA 4M6QA 4MB1A 1O68A 4PYSA 5FJRA 1KGWA 2XGBA 4KCTA 1BF2A 3FY1A 3P80A 3MMUA 4GH3A 1K7EA 3A21A 3W7CA 3WK2A 3AHZA 4JPGA 2F84A 4FIRA 5K4XA 4H41A 2OPJA 3ITOA 1BVNP 1UR9A 3S4TA 3TKFA 2VX4A 4KW2A 2Y62A 1REQA 1HX0A 2ZZ5A 3EXSA 4IZGA 1FH8A 3GXDA 2X7WA 1GZJA 2NX3A 2P1FA 4DO7A 3CUXA 2PGFA 2G4JA 1J2WA 1DE5A 1ICSA 4LFYA 3DFNA 2W5FA 1AH0A 4L65A 1BRLB 3P84A 1O5QA 4ZB5A 1GEQA 3NQCA 2VFEA 1XLGA 1P6BA 3E0VA 5LSMA 3D47A 4XBKA 4DBWA 4FXJA 1C8YA 1J0ZA 3BANA 3MDUA 4Z0JA 4XV0A 3W29A 3VZZA 1E9IA 3PZIA 4PBEA 5LA0A 3BAYA 4ZCWA 5IBXA 4WIWA 1GQJA 3SECA 2J7HA 3FSTA 3PANA 1A5BA 1IZKA 3C2EA 2P88A 1KM2A 5G2WA 5GNYA 3GXTA 2Z0IA 2YCLA 6TIMA 4J2PA 3E38A 4AD0A 5GJNA 2ZZ3A 3MSYA 3BGAA 2XIMA 3AWNA 4J27A 1F5ZA 3HJEA 1DWHM 4AMAA 4EAMA 2XH7A 3NSXA 3SJNA 2O92A 1S2AA 3H8AA 1TPUA 3BG3A 4AHOA 1B57A 3EOEA 2G97A 3W1AA 3EOSA 1X38A 3U2EA 4TMCA 1W1IE 4ACZA 1BPLB 4GIEA 3PJTA 1QNSA 3GVWA 2IMRA 1WAWA 4EWJA 4B5SA 3O63A 3S6OA 3JW7A 1SQ7A 3GE7A 1QWGA 4M82A 4DXXA 4H19A 4AIOA 4E38A 1JZ7A 2XIOA 4L64A 2WJFA 2VR5A 3KP1A 5TBOA 4GQQA 2A3HA 1RQHA 3A4WA 3BG5A 1FHDA 1JPIA 3N17A 1B3XA 2WO5A 1JDAA 2Z1WA 3DBPA 1EB3A 3W88A 4NYUA 5H6HA 3VFLA 1R2TA 4W5UA 3B9AA 4LNCA 3GIYA 3HF3A 4KEZA 3CUIA 3JS3A 1ZHAA 3D5HA 2ZFAA 3NYDA 3H2EA 1N55A 4DI9A 4IXHA 3HM7A 4ES4A 2PURA 4LCQA 1TWZA 3OTRA 2DJLA 1ISWA 2Y7GA 2NWRA 7TIMA 1M68A 2WLYA 2Y5EA 4JN6A 3EX1A 1JZ2A 3ZSTA 4JKMA 1XBZA 4FI4A 4L1GA 2Y5SA 3E5BA 4H2HA 3S9ZA 3IIOA 3PBMA 1O60A 1X7IA 1PE1A 5H8MA 1A5NC 3GBEA 4IIFA 2BV9A 4AU0A 3SRFA 4UMCA 5TIMA 4PA8A 1A5MC 4BJHA 3IAQA 4MNJA 4GI6A 1SJAA 2CCRA 2V5BA 3EB4A 4UQAA 3D46A 4S23A 3BAIA 4Q4RA 1GPWA 1H50A 1EOKA 1R3QA 2HVOA 3AYRA 4O0ZA 4PCPA 3TJLA 1POJA 4IMGA 3I7QA 4LYQA 1RQBA 2FYMA 3KOFA 3AIWA 3WMSA 1YXCA 2IXVA 2GVEA 2HBXA 2BXYA 2FLIA 3UT0A 4FA3A 3AU6A 1W5PA 2Z1SA 4U28A 3KRBA 2E3ZA 1KQYA 4XD4A 4NU7A 3FEQA 1M7JA 3ZOAA 1DP0A 2FIQA 3SUTA 2XIBA 4RV3A 3W1QA 1R87A 3AS0A 2EJAA 3WMCA 2WYSA 1E6QM 1EF3A 1RJQA 1WKEA 1W2PA 3IGSA 1XCXA 2OODA 5ECUA 2XISA 5T8GA 1CBGA 3N2XA 3D3FA 3P5ZA 1F61A 1PHQA 3F2DA 3M7WA 3QR3A 2RJHA 2A0NA 1GTEA 5DCEA 4B91A 1Z89A 1VEPA 5C9WA 4EVZA 1DTNA 3IJDA 1EH9A 3QV6A 1RR2A 2ZX5A 1Q8AA 1XD1A 3VD4A 2OG9A 3WBWA 4HPNA 3CMFA 1ISXA 1GKQA 3AO0A 1F07A 1Z9AA 1CWYA 5CLWA 1EGMA 1Q5MA 1DWFM 2DZXA 2IQ0A 1B9BA 3RM8A 2VD8A 3BCDA 2UY5A 3N14A 2WC7A 1ITQA 4JTFA 2OOFA 2ZQ0A 2G3IA 3L67A 3DUGA 1B30A 1RA5A 1I9CB 1DIKA 2DT3A 4C6LA 3T0AA 4O14A 2V5DA 4XUGA 1O6IA 4FNTA 4HYWA 3WEZA 1OFEA 3KBSA 4UTJA 1F4HA 1W5NA 4YWSA 3VCCA 3RITA 1G4PA 4MNMA 1ISZA 4L80A 4QGCA 4DPPA 3MUIA 7CGTA 3VCNA 1ZS2A 1RZMA 3T8LA 3GW0A 1JNEA 1QNPA 2WK2A 3SCVA 3UJSA 2OJPA 2OQLA 3WQPA 3SGZA 2GJXB 1FHUA 2X09A 4NKCA 4F8XA 3NPVA 3B3DA 2D0GA 4GHRA 1ENUA 1GOXA 1W3JA 1EF2A 1XYZA 4O57A 3W2LA 3SSZA 2OT1A 2R82A 4AF0B 2D22A 2J7GA 1YYAA 1KV8A 2GUYA 3TQPA 1GORA 4QDPA 3W1TA 3V18A 4WDTA 4L4MA 1GNXA 1KM0A 1HO4A 1XYCA 1YIXA 2W6RA 3BLIA 3PAOA 3QV8A 1CDGA 4S3DA 1C91A 3GR7A 1EJUC 1FTXA 5CGQA 3N29A 4L5ZA 3CQ0A 4H6RA 2Z29A 4C6EA 3LCFA 4EPDC 3S1VA 1TTPA 3NL2A 5DCBA 1L0PA 4D8LA 3UCDA 1NFPA 1EYWA 3SB0A 3BW2A 4PUWA 5D2YA 3O2LA 3BMWA 3TTOA 4DUVA 1RK5A 2E77A 2FVKA 3AS1A 2A79A 3SCRA 1RLDA 2Q8LA 2BGNE 3RLGA 4AIUA 2WLZA 5DELA 3KUMA 6ALDA 1OZQA 2X1UA 4W7VA 5CPMA 1P0DA 3DEQA 5KMYA 4LH8A 1NJJA 3ARWA 4PMRA 4AZCB 3GXFA 2DORA 4MB5A 4JX6A 1XRVA 2YR1A 2GZXA 3P6LA 6A3HA 1KGUA 3ABZA 2NQLA 4WD0A 1P48A 2FJKA 4RW3A 1NEYA 1Z41A 3CB3A 4H9YA 4FOJA 1QOQA 4J28A 3HFTA 3POCA 5BRPA 3RCYA 2ZXBA 4QJ1A 2EPKX 1E1CB 1DPMA 4M29A 3ZZ1A 2J47A 3W7IA 1I1WA 1OSEA 4MLRA 3EBVA 4FOUA 2XN1A 3M41A 2NQHA 3CO4A 4JFWA 1W54A 3B8SA 1G7VA 5TD4A 1J18A 3NDZA 4CN4A 1E0UA 4OT7A 1BGAA 4V1XA 4QEEA 1TX0A 4HHLA 4IP7A 5E70A 3EOLA 2WVVA 3UZXA 2VELA 3UGVA 4U33A 3H12A 2VL4A 3N4EA 3ZMRA 2R1KA 3ARXA 4CQ9A 3GQYA 5A95A 2GVLA 2CLMA 3N11A 4WKFA 1CLKA 3K1GA 4EOUA 2I9UA 3TN6A 4LAKA 3CZ8A 2QDDA 3PNUA 4HHMA 2GGGA 1VCFA 2ANUA 3G6LA 3PZVA 1RK6A 4GFSA 3M0JA 3QHOA 3UR7A 3E2QA 1HJSA 4LNYA 3M5XA 3GG7A 3NQFA 3UGRA 3C52A 3AXIA 3MYOA 2NVCA 4HNLA 3IJ7A 5HINA 3GTNA 2CZFA 4A35A 3IJ6A 2QEZA 2PBGA