4IMGA

Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-glycolylneuraminic acid
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
293
structure length
293
Chain Sequence
b'MKNLKGIFSALLVSFNADGSINEKGLRQIVRYNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDEIALIAQVGSVNLQEAIELGKYATELGYDSLSAVTPFYYKFSFPEIKHYYDSIIEATGNYMIVYSIPFLTGVNIGVEQFGELYKNPKVLGVAFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTQAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLDGVEAGYCREPMTKELSSEKVAFAKELKAKYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylneuraminate lyase
publication title Structural Basis for Substrate Specificity and Mechanism of N-Acetyl-d-neuraminic Acid Lyase from Pasteurella multocida.
pubmed doi rcsb
source organism Pasteurella multocida subsp. gallicida
molecule tags Lyase
total genus 123
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2013-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4imgA00
5HR7A 4R34A 4HT3A 3BW4A 4UFHA 1K8YA 1RV8A 3TAKA 5FF2A 2W0UA 3W71A 1F7BA 2ZZ2A 4K7VA 2B0MA 1YPFA 3S1XA 1ZAJA 3HG5A 1JCYA 5E0KA 1G69A 1QOQA 4RKAA 3O05A 3G1VA 4JY8A 1R47A 3S6DA 4UR8A 5D09A 3W72A 3B06A 4FXSA 2H6RA 1WX0A 4TIMA 5DLCA 1GG1A 3W7GA 4JS3A 3KVKA 2VFDA 1E51A 3PBUA 1A5AA 2XN1A 2OT1A 3LX9A 3L0KA 2J88A 4LNYA 3S1WA 2C18A 1QWGA 2QCGA 1TQXA 3SJ3A 1NEYA 4JGDA 4Z1DA 5HULA 3W87A 4XTIA 4JTHA 3SZ8A 1JR1A 1TJPA 3BLFA 2DZUA 3M43A 4MPQA 5FESA 2A7RA 2GPTA 2B7QA 3M0ZA 3MI3A 3P7YA 1GJPA 2E6YA 1KTBA 1UJPA 1ZNNA 4OBTA 2DU2A 1S3HA 2CLFA 3CWOX 4H4IA 4NNBA 3W23A 5KINA 3G1DA 5LNUA 1LROA 3G1HA 3O6DA 1XUUA 2WQPA 3FA5A 5BW6A 3WJYA 3C61A 2PRHA 3QPYA 3BVJA 1B3OA 4K39A 3MI2A 3I68A 1LORA 3T55A 4UFLA 4K37A 3KVMA 2Y7DA 1WOAA 3G22A 1FCVA 2EKCA 3IIXA 1H61A 2WV8A 1GPWA 2QCMA 2FQIA 1AMKA 3M7WA 2Z1BA 4LVBA 3TX9A 4UTTA 2CLOA 3HPSA 1OK6A 1LTDA 2XN2A 1C29A 4TX9A 4TR9A 2NLIA 2J24A 2WKJA 1GWJA 3R5EA 4RXFA 4FXRA 4EIVA 3N3MA 4IOTA 5AHIA 5D33A 1XUZA 2YFNA 3LB0A 2CZDA 4XKYA 1AG1O 2DJXA 2Q3RA 4K6AA 1VRDA 2NX3A 1S5VA 2X1SA 1V7YA 1UUMA 3NA8A 1MEHA 4DQWA 3B03A 1VCVA 3DENA 1OYBA 4LRSA 1Y0EA 4O1BA 4AAJA 4MZ8A 3KRUA 2F7FA 5DBUA 4TO8A 2A6LA 3BGGA 1IIGA 5DY3A 3UZ5A 4YCPA 1B9BA 2C6QA 2GVGA 1O5XA 2HMCA 2ZZ1A 1OABA 4ZQOA 4B5NA 2E5DA 4WZHA 1KFKA 4PTNA 4EOUA 4LT9A 1GVSA 1K8XA 3G24A 4N4QA 4NJJA 3GKAA 1K03A 2FTPA 4N9EA 4UFKA 1XL9A 3QC3A 3BPWA 3GXTA 1U83A 3IIVA 1WBHA 2QCFA 3B0PA 3ZFHA 4LWWA 4O4VA 3VFLA 3FEMA 5C6MA 4HNVA 3NZ1A 5FI8A 1W5NA 3TJLA 4ML9A 4IX0A 3GR7A 2YPIA 1VHCA 4E2BA 1OVDA 3LRMA 3PC0A 5D38A 1PHQA 1KFEA 3W1QA 3WJWA 1VS1A 4CQ9A 1P1XA 3FYOA 1TPVA 4TMBA 1QMLA 2NV1A 1ME9A 2BZNA 2TYSA 5CKSA 2X1TA 3G3DA 4O17A 4ZMGA 4HSOA 3TW7A 4IWWA 1PIIA 5KTLA 4NZFA 2ZRXA 3L66A 1EUAA 3N2XA 3LDVA 2ZA1A 2BTMA 1WBJA 3NYZA 5A5WA 5FEXA 4DEFA 2Z6IA 1KLZA 7TIMA 1LRNA 4DELA 4FNUA 2BXVA 3RFAA 3GK0A 1FUYA 1RPXA 3OG3A 3WK0A 3IEBA 2YYUA 3W2KA 2QKFA 3NPWA 1GEQA 3HPXA 1KM0A 3ATYA 2H8XA 3HG3A 3N73A 1H1ZA 3MBFA 3IRDA 3KRZA 3CTLA 4GWEA 1DJQA 2YX0A 3B4UA 5I3IA 1EIXA 3C2FA 1CW2A 1EP3A 1H7WA 4K8HA 4EWND 4O0KA 1LBMA 4E0CA 1XI3A 3MYOA 1XXXA 5T26A 2O7SA 3WJXA 2QR6A 5AYYA 4S1FA 3W1AA 1OFEA 3CLMA 1HG3A 2ISWA 2CLIA 1W3IA 2VFIA 3E12A 4FEZA 1PE1A 1LZOA 5AHEA 4GFSA 1TPFA 1LLWA 3L5LA 1SW3A 3C8FA 5G2WA 3S5OA 4QQ3A 1TRDA 5D2WA 2OCZA 1G4EA 5K9XA 1TIMA 2PRLA 3A5FA 4QNEA 3S1UA 3Q58A 2RHGA 2W79A 2BWGA 3NAVA 2I14A 3HJZA 1FWSA 4N02A 4WJEA 1LBLA 3HQ1A 3R89A 1GVOA 3LTYA 3GX9A 4M5PA 3STGA 1WQ5A 4O1AA 3PY2A 4MJMA 1G4TA 2W6RA 1Q6QA 4NXSA 1BWLA 5CPOA 3HPZA 1ADOA 1AW5A 1GQNA 3PSWA 4O57A 3VE9A 1S5TA 1L6SA 4YWIA 3C6CA 3BK0A 1TPWA 2A2IA 1YDVA 3EWYA 2NV2A 1TSIA 2E1DA 3KOFA 1PS9A 2E68A 4FX6M 4JTJA 1VYSX 5G5IA 1BEUA 4NNCA 1W1ZA 3QW4B 3SGZA 3P5YA 2EAWA 2YR1A 3PULA 1Q6OA 3LXCA 4LRTA 1Q45A 3EXRA 1HO4A 2FJKA 1VHNA 1SZGA 2E77A 3EWWA 3B04A 1BTMA 4NNAA 2WJZA 2VEKA 3GVGA 3S5NA 3TXZA 3LV5A 4YMZA 3L67A 5L9FA 5L6UA 3HO8A 4FO4A 4JTFA 4FF7A 3NZRA 2V2DA 3FJ6A 3HOJA 1H7XA 3T40A 3IIPA 4JEQA 4AHOA 4IMEA 5DBTA 4CNOA 4WOQA 1SQ7A 3UNDA 4QISA 1TV7A 2TPSA 4Y96A 3BARA 2OT0A 4G1KA 5F2GA 4AWUA 3W7NA 1OFQA 4DO6A 2B7NA 2OZ0A 3W2NA 1EB3A 1QPQA 1FXQA 3NQ6A 4PL1A 5LKYA 3W2MA 3BG3A 4AF0B 2R94A 4RR4A 3EEGA 5AOUA 2GOUA 1F76A 4X9SA 4UTWC 2H8ZA 3DBPA 5D2XA 1FWNA 2CW6A 3BO9A 4YXGA 4LVAA 2Y85A 1QDSA 3V1PA 2GVLA 3WJSA 5G4EA 1SO4A 3UPWA 2V5BA 4PH6A 1OF6A 4DO5A 2G97A 3QRHA 5CSRA 3GDKA 4XQ6A 3R12A 5D2VA 5G4WA 1PHWA 2QJHA 3NQCA 4X3ZA 1P0NA 5LZLA 5HUOA 1T96A 3RLVA 1OX4B 3EXSA 3IV3A 3TQKA 1M7OA 1EP2A 3UZJA 2ALDA 3NPVA 2CLEA 2QCDB 4HHPA 1H60A 5LNSA 4O1CA 2X1RA 3SI9A 4I7UA 3UPBA 2ZA2A 3QH2A 2R91A 3EX4A 2YDAA 4WXZA 2QCHA 5AB3A 5C2XA 2CFFA 4O12A 2I1OA 4M7SA 3SSJA 4N6EA 5LNRA 1YDNA 2X16A 2DZWA 3WJZA 1AL8A 1K3UA 1SO6A 4XUGA 4ICNA 4BK9A 3NR0A 3PBVA 2QCEA 1F05A 4UMBA 3TMLA 5EA9A 4AEOA 4CQAA 1ICPA 3L5MA 4GC4A 1XM3A 4QIUA 5GVJA 5EMUA 3R13A 1VZWA 3USBA 4XWUA 5TIMA 1YXDA 1XKYA 2J9YA 2NX9A 2ZCGA 1T0OA 2JKAA 4ZQRA 3UXDA 4RXGA 1KFJA 5CZ0A 3C3NA 4UTMA 3EX1A 3TR2A 2C0AA 4AB4A 1DJNA 4WQ6A 1A5CA 2GQ8A 4HNNA 4LS0A 4UFJA 5LGXA 4MY8A 2HTMA 4ORMA 3UY7A 4KWWA 2VC6A 4A2RA 3TROA 4MYXA 5K4ZA 5KZMA 3JRKA 2TRSA 1IIHA 3M16A 3BG5A 2YXGA 1P4CA 1XBYA 4FX7A 1GYLA 1SZNA 3ELFA 5HINA 4RJEA 4XBSA 3NQMA 1KTCA 4JYFA 1OYCA 5AC6A 3F4NA 4JYEA 3B05A 1FXPA 4M6VA 1R2TA 1HO1A 3OA3A 1WDWA 4PCFA 3NL3A 4PL2A 3W7QA 1DVJA 1TTQA 5CPMA 2V0TA 4OWGA 2PE4A 4UCGA 2HS6A 1AW2A 2GUUA 4JICA 1W37A 1Q6RA 1FWWA 2HS8A 3U6WA 1SU5A 2ZRVA 2C3ZA 4AHPA 4RZ4A 2CLHA 3W7CA 1JULA 5G1TA 3A21A 4JYDA 5AC7A 4FB7A 5I3GA 4QM1A 3P62A 1M7PA 3MI6A 3A23A 5AHMA 3MO7A 3CEPA 3NGJA 3C52A 3O6YX 3MHFA 1OYAA 4LY8A 5AYZA 3W83A 4O0ZA 5AHFA 4OV9A 2NWRA 3QEZA 3DFPA 3C56A 3S0CA 3NQ8A 2Y7GA 1FX6A 3HGJA 1XBXA 3RF9A 4E38A 2NXHA 1TTJA 2H3DA 3QSTA 1TV5A 2XN0A 3DHFA 3SIZA 1I2OA 4M7TA 1SZEA 2E6DA 3W7LA 1GYNA 1JUKA 4HSNA 3Q2DA 5F1VA 4UTLA 3DKLA 2P1FA 1GVRA 1ZAIA 3LRLA 4JTLA 3G3MA 1EWEA 2YFOA 3G0UA 4BF9A 3GNDA 4N9CA 3FOKA 1DOSA 3KRSA 4HNUA 4IMDA 4UTWA 2EGZA 1VGAA 3TC6A 1I2NA 3L0GA 8TIMA 1UUOA 1J5TA 5FF4A 3FKKA 3MUXA 1I4NA 4GUIA 1G4PA 3CB8A 2ZTJA 3M6YA 1THFD 3W7KA 1Z41A 4Y90A 3V75A 1WA3A 4JNMA 1K7FA 5G2IA 3P74A 4IQLA 4OT7A 3FS2A 3T78A 1ZAHA 4BI7A 1BWKA 1FBAA 3GKFA 1TTPA 3O16A 4RX0A 1F6KA 3M44A 5HJLA 3BGJA 3DGRA 1R2RA 1SW7A 5D04C 3QPZA 4DPPA 3LBMA 3N9SA 4MZ1A 3DFSA 1XCFA 3EX3A 4O28A 3M5VA 2V81A 3ZS4A 5DCBA 4AH7A 1GG0A 4BI6A 3GAKA 1KBJA 1H51A 1JUBA 2QEZA 3QQ0A 1VQTA 4AWSA 4MFDA 2CLKA 1C8VA 3G1AA 1RQHA 3CT7A 1LOSA 1XBVA 1I2RA 1DQWA 1TPDA 3LHWA 5EKYA 3MMTA 4CNNA 1ZHAA 2JKEA 2G96A 3W1UA 3DXIA 3KXQA 1UB3A 3LHTA 2ABAA 3W1LA 2Z0IA 5D03A 4FNRA 4FNQA 1QR7A 4WOZA 4AWTA 5U7SA 4O50A 5HUPA 4UNLA 3MHUA 2V5LA 2ZA3A 2A1YA 2ZQ0A 4LV4A 4N4PA 4IX2A 4Z0JA 1N55A 3QZEA 5I3JA 3L65A 1GTEA 2ISVA 3WK2A 5F4SA 3M1ZA 1TTIA 4NXKA 4N6FA 4ZQNA 3NPXA 5DXXA 2EF9A 1H62A 3F03K 1ONRA 5AYXA 1YTDA 1QFEA 3RK8A 4R7JA 1GTHA 1FWTA 3OIXA 4HPXA 1W56A 4O54A 3CC1A 3W85A 1K7XA 3TXVA 2ABBA 3MHGA 1XFBA 2NUXA 3L0NA 1W5OA 3N2MA 1LDCA 4NT0A 3W73A 4DXVA 2VXNA 4MIMA 3FLUA 5AHNA 3ABRA 3DH7A 4Q33A 2V9DA 1F74A 1RZMA 1DHPA 1SSGA 1X7FA 3BG9A 3RLUA 3G0XA 1RR2A 2VELA 1YXCA 5J5DA 3NL2A 1AL7A 3EX6A 4KKXA 5H91A 2QF7A 3CIWA 3IIZA 2A5HA 3M47A 3D0CA 3UWYA 1QO5A 3W6YA 2YGYA 4NVTA 1VR6A 3SR7A 4HIBA 3QJAA 3M9YA 4DBDA 2A7NA 5LSMA 4KWVA 3W7EA 3LHZA 1LRQA 3HMJG 1EPXA 3RMJA 1I45A 4N2YA 2KZHA 1D9EA 2QUVA 3GAYA 4ALDA 1JQVA 4CNPA 3PWAA 1Z48A 1G67A 1FQ0A 3BW2A 3CIXA 1VYPX 3OHIA 4MOZA 3B0UX 2VEIA 4MY1A 3RNDA 1VJIA 3O06A 3THQA 1TYGA 3NG3A 2VKZG 4NUWA 3NPUA 1TCDA 4Y6GA 2G95A 3P8JA 1IXOA 5J5RA 3N34A 1NF0A 5IM51 5FF0A 4C1LA 2IQTA 2FIQA 5BMWA 4NU7A 1B4EA 5EYWA 2Y89A 3ZWTA 4LC8A 2Y7EA 1J4EA 4OE7A 1ZALA 3QF0A 1LM1A 5I3KA 3WFAA 1FDJA 3T7VA 2ZBTA 1PV8A 2NWSA 4BR1A 3QMSA 2V30A 2EPHA 5A8GA 4ZQPA 3PS7A 2GQAA 1YPIA 1P5BA 2QDHA 1OFBA 4FX8A 4MY9A 1VPXA 3O8AA 1VLIA 3NQ7A 2ZZ3A 3KVLA 1XBZA 4S2CA 5IBXA 4QAIA 3FFSA 1DKWA 2VEMA 4UMAA 2DZXA 1O4UA 1VCFA 3QQ1A 5MHBA 4HKPA 2A21A 2CLLA 3HGOA 1X8FA 1H7RA 3LCGA 4A22A 1OX4A 4U28A 2Y7FA 1QOPA 3W7OA 3PG8A 3KAOA 1H7PA 2VENA 2Y63A 1WAUA 4EF9A 3W2UA 2C13A 1EP1A 5DXYA 4JX4A 2QCDA 2RDTA 4LW7A 1O60A 4UFIA 4NJHA 3G1FA 1S5WA 4DF0A 2R8WA 1SFJA 4FIQA 3P61A 3W7DA 1WV2A 3PUDA 1SZFA 2B7PA 3W76A 3GIYA 2ZDRA 3IVTA 5CG7A 2NXIA 4OU1A 1F5ZA 1IXPA 4JDYA 3W7PA 5CZSA 4PODA 1I8JA 3W1PA 3P84A 1M6JA 2GVJA 4UTHA 4O15A 3NM3A 1HFBA 1YYAA 3O07A 4JTSA 4NX5A 1W8SA 4FNTA 4CQ8A 3G1SA 1CX9A 4L4MA 1G4SA 2X30A 3O15A 3LRKA 5EPDA 4WXYA 3KX6A 2ZZ5A 5D32A 4PA8A 4GE8A 4JIQA 4JTGA 1OX6A 4QJ1A 5D05A 3WK1A 4O14A 4KFNA 3ABQA 3NM1A 4K36A 2E6FA 3ABSA 4O10A 1TJRA 3MP4A 2QCCA 3PM6A 2Y88A 1FCBA 1F73A 1W3TA 3CWNA 3EWXA 4HPJA 3STCA 2CZ5A 4JTKA 1SSDA 3P8IA 3TW6A 4O8RA 2GJLA 1LYXA 5KITA 3W88A 1XC4A 4N9DA 1JUEA 3MW7A 3W1MA 2AQWA 3SW6A 3HIJA 3UWVA 1KFBA 3W1XA 1EUNA 4YLWA 3LOTA 1VYRA 1WOBA 2CLMA 4X2RA 3EXTA 5KMYA 3HB9A 1NAL1 3DAQA 4BWLA 3G1XA 1JQXA 2WNNA 4IJBA 2CZFA 2YW3A 3L2IA 4O4WA 5K7JA 1OFAA 1LBFA 4JTEA 3TMQA 2GJNA 4K8EA 4R53A 3NNTA 5DCDA 3LCXA 2V2CA 3L9CA 4FHAA 5EBUA 1PCWA 3EX2A 1V5XA 3FYPA 3UWUA 2R14A 3AO0A 4UIOA 1VH7A 3DHDA 4DF2A 3IVUA 3S1VA 3VNDA 3O63A 5BNKA 1KM6A 4QSHA 1YDOA 1X1OA 3W3OA 2BX7A 3MP3A 1GZGA 2PC4A 5K4XA 1MEIA 4ZL1A 1YADA 3OBKA 1SPQA 2J9XA 4Y8FA 3OVRA 3NEVA 2Q8LA 5AHLA 3DFTA 4IMCA 4A3UA 4MJZA 4GUGA 3S5YA 4S2BA 4IPJA 4OHQA 1ZCOA 4MLJA 5BOOA 2ATSA 4LV9A 1L6WA 2ZZ7A 5HNRA 3SECA 4ADTA 3S5ZA 3EWBX 3OEXA 4J9JA 4LU0A 4UTIA 4RZ5A 4AMAA 1OFPA 3UWQA 2C19A 1L6YA 3TNOA 5K2ZA 3LTSA 1UBSA 5TQLA 3SGUA 2F84A 3A22A 3W70A 3U8GA 3I6RA 2FPVA 5K3VA 3CPRA 3BLEA 3CQ0A 1NVMA 1OFOA 3S8HA 4A29A 3GDTA 3OVQA 4EVZA 3TC7A 1PVNA 3TA6A 3TFXA 2JGQA 1SR9A 4HNTA 1TPUA 2QUTA 1WXJA 5E93A 2C14A 1H7NA 1EA0A 2VFFA 4Z0SA 4UMCA 3TV8A 1XDLA 1H7OA 3TH6A 1RQEA 1MEWA 4IMGA 1EWDA 1I2PA 3E49A 3N9RA 3GDRA 3UD6A 3A5VA 3KVJA 2CZEA 2QAFA 3THAA 3LCHA 1XDMA 3R2GA 3L21A 1ALDA 3NQAA 5HWJA 1WYIA 4U4MA 4CLMA 1F6PA 4WUIA 2J27A 3HBLA 5AFDA 1ZJIA 1SFLA 4JR5A 4XBKA 4UTUA 2DZVA 4JXCA 2ZTKA 2WSRA 3UY8A 4CCCA 3QM3A 1HL2A 1O5KA 4OQVA 4UXDA 3DKJA 1JCLA 2JGYA 2Q8ZA 1OFDA 5ABTA 3PF3A 2OMAA 4RCXA 3M5ZA 3PBYA 3LLFA 3W1TA 4JY9A 2J9ZA 4WY0B 3TDFA 3MJYA 1H1YA 1NF7A 1AK5A 5CZJA 3DI1A 4ADSA 3W22A 2D73A 3P81A 3W7MA 3QFEA 3KFTA 4KFPA 4Q32A 1FDZA 4PC8A 4RLIA 1N7KA 5E1QA 1G7VA 1ME7A 6TIMA 1TREA 4GJ1A 1LRTA 3L68A 1TO3A 3PB2A 3O6CA 1T99A 3P82A 2RH9A 3TSMA 3O1NA 2B4GA 5FEPA 2A0NA 2QCNA 1MXSA 5D37A 5DCEA 3PUOA 3TSBA 1U5JA 2C1HA 5K9CA 1D3GA 1QCWA 3M41A 1I2QA 4GXMA 4IMFA 5D30A 2E5BA 4POCA 5I3HA 1LLZA 5KSWA 3W75A 4ORIA 4O11A 5CPLA 4JTUA 5EY5A 3PG9A 1FDYA 4DF1A 1C9DA 1IGSA 3DZ1A 1HTIA 3U2OA 2X2GA 2RDWA 4O19A 2VEPA 2JBMA 3GZ3A 1TQJA 3PVFA 4O53A 4C1KA 5IBXC 1QO2A 1QPRA 3PB0A 1QPNA 1KBIA 1RQBA 3INPA 2QJIA 5HQEA 4DO4A 4W9TA 3NQEA 2V2HA 3C0JA 1W31A 3T44A 2FDSA 4P2VA 1A50A 1K02A 3HGSA 5CPNA 1OHLA 1B57A 3IIOA 3EB2A 4GUJA 1B4KA 4NQ1A 3TAOA 2NZLA 1QNVA 4JX5A 4JIPA 5K9DA 3TQ0A 2NUWA 4LC6A 3TUUA 1KW1A 1GOXA 3E0IA 1TPC1 4L4LA 3STFA 2WO5A 4JN6A 2P10A 1KA9F 1DV7A 4QITA 1K8ZA 4IXHA 1FCQA 1IXQA 4RK8A 1TMHA 2Z6JA 4MKNA 3E02A 3M5XA 3SFKA 1TRIA 3A9IA 4IUOA 3W9ZA 4NJIA 2C15A 4WX2A 3S9YA 2UV8G 1LOLA 1L9WA 1A53A 1FWRA 2FB2A 3H53A 4LOCA 4M6QA 2X1UA 3TIMA 3C2OA 2BLEA 5CSSA 1VCGA 4NZJA 5HWMA 3TU9A 3NQGA 4A21A 4BFAA 4EF8A 4FNSA 4H6KA 2ZZ4A 4Y9AA 5FEZA 3P67A 1W3NA 2Z2UA 3AJXA 2HSAA 2ZRUA 2Q3OA 2P0OA 2WNQA 3TJXA 1X1ZA 3DFQA 1Z42A 3A24A 2DZTA 1TPH1 2A4AA 5I3FA 6ALDA 5G1YA 4O18A 3UWWA 4PEKA 4IGHA 4BWLC 3C2EA 1GVQA 3NDOA 5D2TA 4O1DA 3ZWSA 3HG2A 3M5YA 2ZFAA 1JVNA 3TCEA 2ZYFA 4TU1A 2JK2A 1JRCA 3NL6A 3E9AA 4R33A 5SWUA 4I9AA 1ML1A 3LHUA 1EEPA 2G5WA 1KM1A 4GUHA 4IXXA 2YZRA 5LNWA 1OG0A 3G18A 2WPBA 1O94A 1QAPA 4I7WA 4MVAA 5AC8A 2DZSA 2ZZ6A 5DY2A 5FF7A 2ATMA 3VCRA 5BRBA 4UC5A 3NQFA 2I9EA 4KFOA 3UWZA 3ABOA 1KLYA 4MFEA 5DELA 4JTTA 1R46A 1RVGA 1EX5A 1QPOA 1ZY9A 5F4WA 4OGZA 3VI2A 2FB3A 3FKRA 3LCFA 1BKSA 3TK7A 1GVFA 1W54A 3IGUA 2DZPA 5D02A 1TB3A 2PRMA 1KFLA 3NQ2A 2DORA 4OV4A 3C2VA 2Y61A 4MYAA 4LS2A 1J2WA 3JS3A 3HG4A 3QYQA 3PR2A 3PUEA 2AGKA 5LGZA 4LVFA 3W1NA 3W1RA 2QAPA 3P60A 5U4NA 5F2IA 4ZQCA 5KZEA 1FCUA 1W0MA 1JCMP 3GB6A 2OX1A 4AF0A 4M19A 4BI5A 4JD4A 4XKYB 5C55A 1ME8A 3VE7A 3W84A 1G7UA 3F1QA 2GQ9A 3PSVA 5F4XA 1IXNA 1LCOA 3HF3A 2A6NA 3NQDA 3IGXA 5HR6A 3IGSA 1OK4A 4MLRA 3VKJA 3TE9A 3H54A 4ZVJA 1HUVA 5KZDA 3LGEA 3RU6A 3Q37A 1A5SA 1TV8A 3F4WA 2E5CA 3GLCA 1KFCA 4NJGA 5LHEA 3GXPA 3S42A 3QMRA 1O95A 1F2JA 2H90A 3KHJA 5D2YA 2Y70A 1KM4A 3W74A 5LNVA 1YLVA 4O52A 1DORA 4JTIA 3LBCA 4LUIA 1MZHA 2RDUA 1M5WA 1W5PA 3W86A 4LVDA 2ZRYA 2AAMA 4UR7A 3MYPA 1RD5A 3I7RA 3W2JA 3MWAA 2YW4A 3I7QA 1TPB1 2VFEA 2FFCA 5G2HA 3DFOA 2FPTA 2WSQA 2VFGA 3TKFA 1VC4A 5FEWA 1W5QA 2Y6ZA 5H2ZA 1AW1A 1YTEA 4LS1A 3CM4A 4O13A 3WK3A 3GDMA 2QJGA 1N8FA 3LI1A 1Q3NA 1W5MA 3GR8A 1OJXA 3MBDA 4M6PA 5FF3A 1DBTA 4WY0F 2PURA 3G8EA 4H3DA 2QUUA 3G8RA 3OVPA 4N9BA 3ZR4A 2CWNA 2LLEA 4X22A 4AVFA 4NX0A 3I65A 3W07A 3YPIA 3LXAA 3I7SA 3E96A 3W7HA 5HWNA 3CEUA 1ZENA 4CCDA 1A5BA 4IPIA 5CGQA 3B0VC 2FLIA 4QNWA 3NO5A 1YXYA 4DBEA 1MO0A 1YTKA 3BV4A 4I7VA 3CHVA 4A2SA 1Q6LA 4JDBA 1OFRA 4ONVA 3QSRA 2WNZA 5C5YA 1R30A 1UCWA 3W2LA 3TFCA 3ATZA 4AXKA 2TSYA 4UFMA 2YCEA 2EHHA 2NXGA 2VFHA 3UYCA 3DI0A 4FNPA 1D3HA 1GT8A 3GXNA 1NFBA 2FPYA 2CU0A 3QMTA 3LLDA 4O16A 3TQVA 4ZZ9A 3BLIA 2Y62A 3LERA 4MUZA 3GDLA 3EWZA 4DPQA 1H5YA 1T8XA 1OX5A 4LVGA 4Z1BA 3QW3A 4XZ9A 2XFWA 4ZQMA 5F2LA 1LP6A 3G0SA 3FJLA 4Z08A 4FIRA 5F1UA 1TPEA 5TBOA 3LV6A 2WSYA 4RV8A 4TMCA 2V82A 1JJKA 3C2RA 4HN4A 1KM3A 1CI1A 5F2MA 1PCKA 1G6CA 3LHVA 3B8DA 1IF2A 3FIGA 2H3BA 1SUXA 3P5ZA 3STEA 2E09A 5LHFA 4WY0A 1ICQA 1JRBA 2YYTA 3Q94A 2TMDA 3PAJA 1H50A 4UTTC 3N14A 1JCXA 3ANYA 3SY5A 1KV5A 3LTPA 3C4UA 2B7OA 1PL9A 2JKPA 3EWUA 3W7IA 4K38A 4JX6A 1R2SA 3DFNA 4D2JA 3PBWA 2RFGA 3LCIA 3EKZA 3BW3A 4GUFA 3HGRA 3H55A 4UTJA 4ADUA 2YSWA 3LXBA 2ZRZA 4GRSA 3CU2A 2C16A 3LHYA 3LCWA 4PFMA 3TSDA 2O7QA 5AN7A 1K7EA 2OJPA 2J6XA 2A85A 4Z1AA 2ISSA 3NL5A 5BMXA 5CZTA 2ZRWA 1MSSA 4GNJA 1SO3A 2DP3A 4RZ6A 4WD0A 4YL2A 1JCNA 1OF8A 4P61A 3T4CA 3N19B 2BSLA 2QCLA 3L5AA 1KM5A 1SW0A 2RKXA 1H63A 1LOQA 1X6UA 4YCOA 1Z44A 1FY6A 3IVSA 4LUJA 5C54A 2NUYA 3GNNA 3W7JA 3EKLA 4E2DA 3R8RA 1KTNA 2E6AA 2V8ZA 1DQXA 3LI0A 1P0KA 4GBUA 4Z1CA 3MP5A 4LTSA 4XTDA 3NXFA 5EL1A 3NVTA 3G1YA 1ICSA 1UASA 1DL3A 1NSJA 1L2UA 1SO5A 4UTKA 5HMSA 2QDGA 4CCEA 2NX1A 3NQVA 2PCQA 3LM7A 3LCLA 4UNKA 1KM2A 3K30A 2A7PA 2WOQA 1VLWA 3UXAA 4K7YA 3P80A 1ZFJA 3GYEA 3UQNA 3DU0A 2VOMA 4UUIA 3W7RA 1KV8A 4Q4KA 1JCJA 4NJKA 2DJLA 5DN1A 3NOEA 3JR2A 4AHQA 4MZYA
chains in the Genus database with same CATH superfamily
4PB3A 4HT3A 4UFHA 4WJXA 4ZBCA 3S83A 2Z1KA 3W71A 2OR2A 4DRSA 2BDQA 4YN5A 1XLKA 2JALA 3UR2A 1ZAJA 5E0KA 1CBGA 3U5UA 3O05A 1UHVA 5GJMA 1PX4A 2FZ9A 3EDEA 1XKJA 1FHLA 4W93A 1T7LA 3WCZA 1E9YB 3W72A 1KR0A 4FXSA 5C9UA 3MPGA 4G8TA 3M07A 3VNJA 2BXYA 2OT1A 3L0KA 3EDDA 2C18A 4CNSA 1OCBA 3H4XA 3UP8A 2J66A 3SJ3A 4ZTXA 2HQAA 4JGDA 4OOUA 3PPCA 4JTHA 3SZ8A 2XU2A 2A7RA 5A8MA 2B7QA 1GJPA 1UD6A 1X6NA 2GSEA 3CWOX 2DT2A 4KCUA 4FLSA 5DMYA 3HTWA 2AAAA 5CBJA 1XUUA 1HJQA 1VFMA 3VX0A 3T2OA 1Q66A 3QPYA 1B3OA 3MI2A 5A8NA 2AKMA 4UFLA 3RAOA 4K37A 3KVMA 4QCEA 1EF3A 1JZ7A 3U2CA 3PN8A 4AD0A 1UP2A 3QKZA 1H61A 1GOIA 3MMDA 2WV8A 2FQIA 3AHXA 3LSCA 1P48A 2IKJA 4IPPA 3TX9A 1FFRA 3FSUA 2XH4A 3HPSA 4XIMA 4ZOBA 4UBPC 2XN2A 4UQ9A 3VK5A 4XIAA 4HU3A 4Q8TA 3VDGA 4H19A 5IRPA 1UC5A 3R5EA 3RM8A 4QCFA 3VGFA 1JYNA 4FXRA 4EIVA 1E6PA 5BOEA 1RSCA 3RX2A 2E7FA 2R82A 4R5EA 4K6AA 1TWDA 3ARUA 1Y7VA 1RY8A 1V7YA 1UUMA 4DQWA 4AAJA 4O1BA 3VVGA 2F7FA 2OEJA 3CMFA 4GYPA 4HCHA 5J04A 2HMCA 3U2ZA 2BVWA 4B5NA 3AZSA 3TN6A 2PZNA 1VAHA 3Q67A 4LT9A 3WDHA 1K8XA 3B9EA 2PDCA 2WMKA 1K03A 4H8NA 2WM0A 4Q4OA 3RG6A 3BPWA 3GXTA 1JGIA 1WBHA 4RDVA 2ZX5A 4LWWA 4O4VA 5AC5A 2X09A 3CBWA 1F61A 3TJLA 1YKWA 2HE8A 4F66A 2YPIA 1WKEA 1VHCA 4G7FA 2BNJA 1PHQA 3WJWA 3VGDA 1R8LA 1P1XA 2IKGA 2NV1A 4FMVA 2IS7A 1O7AA 2YA0A 5JH1A 4O17A 3L4WA 2A3HA 4H8UA 5LXXA 4C6MA 1EUAA 3N2XA 3NYZA 3AYRA 2PGRA 1NY1A 5A5WA 1KLZA 3F7JA 1LQ2A 1EJSC 3RFAA 3AYVA 1V6UA 3WK0A 1WZAA 3NPWA 1GEQA 5CBBA 1WZMA 3SCRA 2IKIA 4FLOA 1HVQA 2H8XA 3AROA 4XZLX 1H1ZA 4F8XA 3WD4A 3WY1A 4Z2GA 5I3IA 4PUKA 1H7WA 4EWND 1ZP4A 5T26A 4AD5A 3GW0A 1E0TA 3LY0A 2QR6A 5AYYA 3M6DA 3CHFA 1OFEA 3CLMA 4Q7BA 3C0QA 1HG3A 3WNLA 2ISWA 2NVCA 3DBNA 3BCJA 4DWDA 2D2JA 1KXHA 2BFGA 2PDXA 2GVEA 4FEZA 3GY1A 1PE1A 3EYPA 1Y5XA 3AIWA 1TPFA 1QW8A 3S5OA 1TRDA 3S46A 5AECA 2XJ7A 5D2WA 5BCAA 2OCZA 4CN1A 1TIMA 3R58A 4QNEA 1ZB5A 4E8CA 1EYWA 3GYCA 2D0GA 3VKAA 4B5TA 5ABGA 3HJZA 3QTPA 2DSZA 3R89A 1GVOA 3B8WA 4M5PA 3PZVA 3N2BA 1WQ5A 4KWUA 1G4TA 1QXLA 3VUPA 1BWLA 4REQB 1E56A 1JL8A 3HPZA 1ADOA 1AW5A 4DM2A 1B30A 1GQNA 2OB3A 3PSWA 1S5TA 1L6SA 3RUBL 1JXJA 2FMOA 1J0IA 1VKFA 3EWYA 2NV2A 1TSIA 2VCAA 3WKZA 1PS9A 3G5EA 3U48A 1GHRA 4UOQA 4JTJA 2BS9A 4N42A 4NNCA 3SGZA 2ASHA 5FSDC 2J7BA 4J35A 3PULA 4ILSA 1HO4A 2FJKA 2QDDA 2E77A 1W8GA 2RJHA 3B04A 3EWWA 1K6WA 2WJZA 1WNOA 3S5NA 3LV5A 4YMZA 5L9FA 1HJUA 5ECVA 1OGGA 4FF7A 1KO0A 1OWQA 1VJZA 2J78A 1B3YA 3MA8A 1Z8AA 4AHOA 2DIJA 4LEQA 3GS6A 4YU1A 2EG8A 3F2BA 3V16A 1QW9A 5DQPA 4AWUA 4CEUC 4W89A 3ZIZA 3AMKA 2AMXA 1KGWA 1OADA 1E40A 5CPSA 3N9KA 3WYZA 2OZ0A 1EB3A 1NOFA 1QPQA 4PL1A 3HMCA 3PZNA 3LMYA 2J47A 4I3GA 1NP0A 1W1PA 2GOUA 4IH3A 3IJDA 3WX7A 4QDMA 5I3DA 3VFCA 5D2XA 4LVAA 5JMUA 3LA4A 2PP1A 3WJSA 5G4EA 1SO4A 3R4IA 2V5BA 4PH6A 4AZCB 1EEXA 4V33A 3GDKA 2BMBA 4HA4A 1UIOA 1MW1A 3LUTA 3VPLA 2YCLB 5C0QA 2OEKA 3S5SA 5LZLA 1L8NA 5HUOA 1LLOA 3EXSA 4DHGA 4C1NB 5CC3A 1QHPA 4E8GA 1EP2A 3RX3A 4YVPA 2JEPA 2Y5SA 2QCDB 2P8BA 3LSBA 1W3JA 3APGA 3UPBA 1TA3B 2O0TA 3OJGA 2ONEA 3EOLA 2O9OA 2CFFA 3TZFA 4N6EA 5CBIA 1SO6A 3P3BA 4UMBA 1UR4A 4KGLA 4CQAA 3L5MA 1Q5MA 2WPGA 4CD6A 3ZXWA 1VZWA 4LB4A 4RV3A 3WFLA 1XKYA 5FIPA 1M68A 4S3EA 1KFJA 3I3EA 4W8LA 4ZB2A 2YL9A 1O5RA 4X60A 2C0AA 4AB4A 1A5CA 4DNHA 3CUJA 2Y1HA 4LS0A 4UFJA 4IFOA 2VC6A 4ZTYA 1V77A 3FDGA 4JCLA 5I03A 5K4ZA 1PPIA 3H2EA 4I8YA 3VMOA 2H9AB 1XBYA 3ELFA 2DQWA 2F9RA 3NQMA 1LUCA 2CZVA 2VP8A 2DSVA 5JXQA 1R5YA 4JYEA 3B05A 1IEXA 2Z28A 1FXPA 2J7GA 1Q6DA 2D23A 1WDWA 3MKVA 3VOJA 2BY0A 2XPKA 1P0EA 2NT1A 2VM8A 3GG8A 1IWPA 4JFWA 3UA4A 3W27A 4UCGA 4IGSA 3BLKA 3UVAA 1W1YA 4NZ3A 1Z32X 1OQFA 1W37A 1FWWA 2HS8A 1SU5A 2ZRVA 2CLHA 1DXIA 1DP0A 3D3AA 1MRAA 5G1TA 4C90A 3UZWA 3MUAA 5I3GA 4HSHA 3PK7A 1M7PA 1AJZA 1V3HA 2YDSA 3NGJA 3C52A 3O6YX 1I75A 4AG0A 4XBJA 2JIWA 3GBEA 4O0ZA 1ZBKA 3QEZA 4ERIA 3S0CA 3NQ8A 2Y7GA 1FX6A 2GWNA 1XBXA 3SUSA 3RF9A 1SMDA 4E38A 4L7ZA 4XD6A 3UZYA 1TV5A 4LCQA 1KFWA 1XYCA 2VHLA 5C7VA 1I2OA 2AMGA 4J28A 2E9MA 4Q8QA 2Z00A 2I16A 3Q4DA 4M82A 3GTHA 3IUIA 3B9DA 1ZAIA 4E2VA 3G3MA 1EWEA 4QXIA 1JXKA 1DOSA 3KRSA 2X05A 3ARSA 4UTWA 2UY2A 1VGAA 2HCVA 2EPMX 1B0IA 4N0RA 2WVTA 3GR4A 3E0WA 1F9CA 2ZTJA 2CKSA 2PWUA 4UNIA 3DG7A 1YE4A 3THCA 3W7KA 1Z41A 3DC8A 2QMJA 1WUEA 3V75A 1K7FA 3P74A 4IQLA 4JL2A 3FS2A 1HKVA 3T78A 1ZAHA 3WMCA 1BWKA 1FBAA 3O16A 2WVVB 1C7SA 1GOMA 2AGTA 3DGRA 3URBA 4Q6XA 1E5JA 1XIDA 1S38A 3FN9A 1WPCA 3A12A 3DFSA 1H0IA 3W0KA 2POTA 3M5VA 1NWSA 1FRBA 3QXBA 4DI8A 1KBJA 4Z2IA 1DWFM 4AWSA 2XTKA 2CLKA 3VD5A 3N2CA 4J40A 1TPDA 1J01A 2X0SA 2BP1A 3MMTA 3BJTA 4FSAA 1ZHAA 2G96A 2FTWA 1SFSA 3DXIA 1X7IA 1E73M 2ABAA 2VEFA 3GFXA 2KX9A 2Z0IA 4L64A 2HZGA 4IGNA 3LM3A 4O50A 5HUPA 5I07A 2ZA3A 2ZQ0A 4LV4A 4ZEPA 1R3TA 4ZFCA 3WK2A 1MMFA 1TTIA 1W9VA 3F5KA 1RLDA 5DXXA 5I77A 3I3BA 1YTDA 4LB3A 3PPFA 1E1CB 3FSTA 3OIXA 4REQA 3CC1A 4PUEA 1S39A 1PZ3A 1T6MA 2XISA 3AALA 4Q33A 1SSGA 3MTWA 3OLIA 1BKHA 2QF7A 1NQ6A 3IIZA 2A5HA 3VABA 3WEZA 3W6YA 1V0MA 2YGYA 1W2VA 3SR7A 1YEYA 4DBDA 4QROA 1W3LA 2A7NA 5D9MA 4R85A 2P8CA 4IPLA 2I17A 3LHZA 2E0PA 1EYEA 2QUVA 4ALDA 2J7FA 2EPLX 1QOXA 1Z48A 4JTRA 1G67A 1FQ0A 4JFVA 1BVNP 1P7TA 3B3DA 2WMJA 1AH4A 4MOZA 1RUSA 1G01A 3B0UX 3H7VA 5IXEA 1GOOA 4S3JA 3ZJ7A 4F0MA 1PKYA 1K6AA 3E6EA 5CC7A 2E28A 1NIUA 5J5RA 1EC8A 4C1LA 1B4EA 5EYWA 3ZWTA 4QDWA 4LC8A 2Y7EA 4OE7A 1AH3A 3QF0A 4C5ZA 3WFAA 1FDJA 1WDDA 5EFDA 1IEVA 5LA1A 4ZQPA 3H24A 4AZCA 2PDNA 5EMKA 1VPXA 1GOWA 1VLIA 3NQ7A 2ZZ3A 1CENA 3QBUA 3FFSA 4GI4A 2ZIDA 2HNEA 1LQ0A 1HXJA 1XLBA 1VCFA 4EXQA 2HRWA 4PB4A 4ZGYA 3LCGA 1E6ZA 4A22A 2X0YA 4GX8A 3HQNA 1QOPA 5HANA 4C1NA 4GY0A 1A5OC 1I1XA 3W2UA 2C13A 2QCDA 2VO5A 3EPNA 4LW7A 4UFIA 1UA3A 4NJHA 1AD4A 4IG2A 1VEPA 5LIKX 1SZFA 2B7PA 3W76A 3AIEA 3LGGA 5CG7A 3GHTA 1F5ZA 1LT8A 5REQB 5CZSA 4PODA 4BHYA 3MV11 3M0LA 3W1PA 1S2WA 1M6JA 1RK6A 1YYAA 1E0VA 3IS4A 5AVHA 4JTSA 1P0BA 2W4XA 3G1SA 4Y2WA 4UCFA 3CPGA 2C8NA 4WXYA 4PA8A 4A3HA 4JTGA 4QJ1A 3WK1A 3SM0A 3TVAA 4JQAA 1PX3A 4DXKA 1A47A 4G1NA 1QBBA 1ZJAA 4K2SA 4WCJA 3ABSA 5XIMA 1NP2A 1ZQ5A 1FCBA 1F73A 4QS6A 4EPBC 1SSDA 3N1AA 3TW6A 2A3BA 4IQJA 2DVUA 2EG7A 1XC4A 1JUEA 3SW6A 4GIEA 1ITCA 2WCSA 2QLYA 3HB9A 1Q63A 3PZQA 3WO8A 1BPLB 2VX4A 1JQXA 3G1XA 2NVDA 3WQVA 4PMNA 4IJBA 2CZFA 1EQPA 5M3WA 4AC1X 1CDGA 1LBFA 4LF1A 1XSIA 3LCXA 2V2CA 5DX7A 4UIOA 1VH7A 4H2HA 2XGZA 4GFIA 1EH9A 1Z69A 3VNDA 4JKKA 1KM6A 1RCXB 4QSHA 4LUYA 1EDTA 3W3OA 1GZGA 3CQKA 4YS1A 3RPMA 1HP4A 3OBKA 1UUQA 5I00A 4Y8FA 1HKKA 1DJWA 4AXNA 4S2BA 4FZIA 1ZCOA 4YPJA 2ATSA 1B9ZA 4WEVX 5HNRA 4QSFA 3AS1A 4A4AA 4HMNA 4O1EA 1ECQA 4H7VA 4LU0A 3IV8A 5ABFB 1POJA 2GGIA 2C19A 1L6YA 1VEOA 5T9CE 2D3NA 4MM1A 2B81A 3BLPX 4ICCX 4E3TA 1BYAA 3NIYA 5TQLA 3SGUA 1HN1A 3B40A 3N3TA 4J3WA 4O1FA 4WIWA 1NVMA 2XG9A 2O92A 4B90A 3UNTA 5FL1A 4Z2HA 4EVZA 4OBRA 1PVNA 3TA6A 1MQPA 2JGQA 1Q6FA 2QUTA 4CQCA 4ROQA 1NU5A 1B31A 4UMCA 3TTSA 1MEWA 4MAZA 4IMGA 1I2PA 4ZSTA 4DJFA 4F2TA 4HHLA 2REQB 3CZLA 3KVJA 3LYEA 2CZEA 3WH7A 1S2UA 3E74A 2WVVA 3SY1A 3VIOA 2PBOA 5HWJA 1WYIA 4U4MA 3PUGA 3IJ6A 2INEA 1SFLA 4UTUA 1W9BM 4JXCA 3QM3A 1E3ZA 1O5KA 1R9XA 3DKJA 2Q8ZA 4IUGA 3SCPA 4LPCA 4RCXA 2OSYA 2CXGA 3W1TA 4JY9A 3PP7A 4WY0B 3TDFA 1JAKA 2C79A 1S5NA 1F07A 4DI9A 3ARRA 5JU6A 2D73A 3S1GA 1VFFA 1DWIM 1NDYA 3QFEA 4KFPA 4PC8A 1IT0A 4BQ3A 4WDXA 2R9RA 1MRQA 5E70A 3PB2A 4P8XA 1JFXA 1T99A 3HZ3A 3CS2A 4ZFMA 2BBFA 3DDMA 4HZMA 3TSMA 3O1NA 2XSBA 2ZXDA 5HJYA 3PUOA 3TSBA 2VX5A 4QRNA 1D3GA 2V3DA 4QBXA 1QCWA 4B3LA 3O0FA 4GXMA 2ON3A 3PAOA 4POCA 5KSWA 1W9PA 3KTXA 4O11A 3KRBA 4JTUA 4DF1A 1A5NC 1E1CA 2Z24A 2CBVA 2XVPA 4XZBA 2X2GA 2RDWA 4IQDA 1ISXA 4UQAA 1A4LA 3BSMA 2WC3A 4JQ3A 3AXMA 3II1A 1QPRA 1US0A 3PB0A 2O9PA 1QPNA 1KBIA 2QJIA 4DO4A 3TW9A 3VIFA 2V2HA 1W31A 4MB5A 4H9XA 1A50A 1FFQA 1OHLA 2F6UA 3IIOA 4CUCA 4FS9A 4CN6A 1P6CA 3TAOA 4JX5A 4JIPA 2NUWA 3TUUA 1EPVA 4L4LA 1XJBA 3DIPA 2VTFA 2IXVA 1FCQA 2QUMA 3OLGA 4A3QA 1V6WA 5PTDA 4FOJA 1TMHA 3O3RA 4MKNA 4GNKB 4H1ZA 3E02A 3SFKA 4KS0A 3ONBA 3U4FA 3WBAA 2XFYA 2FZNA 5AVNA 3W9ZA 4NJIA 2DT3A 4H7ZA 3BAIA 4U2YA 1Q7ZA 3S9YA 4IFRA 3ME3A 4PR4A 1PYMA 3ZQ9A 3H21A 1FWRA 3H53A 3UXLA 4M6QA 2BLEA 5CSSA 4IJRA 5HWMA 1VIZA 3V0TA 3KOWA 3QV9A 1V6XA 1Y5WA 2R1NA 3FK4A 5FEZA 1DJZA 2QZRA 3QOMA 3RM4A 4QE5A 3ITOA 1MQRA 1X1ZA 2QUNA 4HNLA 3BMXA 1CCWB 1F3EA 1TPH1 3KZPA 2QJJA 1POKA 1OSEA 3RILA 3C2EA 3S2JA 3S9IA 3M5YA 1XSKA 4HA3A 1M1BA 4ZB0A 4Q3MA 3TCEA 5BRPA 3E9AA 4IISA 5SWUA 4I9AA 4ATLA 1FP8A 2G5WA 1KM1A 3F5LA 3H2NA 2V68A 2WPBA 1VB9A 4BQ4A 1QAPA 3IAQA 4I7WA 4DY1A 1KWGA 3I4KA 1BRLA 5FF7A 5BRBA 1E4MM 5CGTA 4HK7A 1F8MA 2Y8UA 1JI1A 4MKSA 1I6NA 4NZCA 3F2DA 2G37A 3FKRA 5A2AA 4Q8UA 4U3AA 1JDDA 3RR1A 1W54A 2VRQA 3A64A 3IJIA 4HPGA 5DRCA 2PRMA 1TX0A 4MYAA 3ES8A 3UPMA 1X6LA 3PTKA 4F2BA 2A3LA 3AMCA 2A3EA 3QYQA 3PUEA 2OYMA 2AGKA 4U10A 3IRSA 2J25A 1M65A 5U4NA 4ZQCA 4AW7A 1EZWA 5KZEA 1JCMP 3V0SA 4AF0A 4M19A 3M0HA 2AQOA 4FI4A 4Q4MA 4BI5A 3K1DA 4WR3A 4NY2A 4JD4A 1CECA 4I8DA 3W84A 3IJ9A 1BGGA 1MXGA 5ENLA 4JEJA 4XX6A 3TE9A 3H54A 4ZVJA 3LGEA 3Q37A 3A13A 4J7RA 2IXUA 4XKMA 3S42A 1D8WA 1LG2A 1V3JA 4MUPA 3QMRA 1ISZA 2NVAA 2VZTA 3GTXA 2WNWA 4FXJA 1K4GA 4XB3A 3N18A 3TYBA 3I6EA 4CNTA 1GQJA 4LUIA 1M5WA 2GUYA 4LVDA 2ZRYA 1WKDA 2R6OA 4UR7A 1OEPA 4GVFA 3I7RA 2YW4A 5DRIA 2D0HA 4QG8A 5G2HA 3DFOA 1MNZA 2VFGA 1CNVA 2NT0A 1V7AA 4IFKA 1VC4A 2BASA 3MB9A 1V0NA 3VGGA 1JZ3A 3EDJA 3L4YA 3LI1A 1OT2A 1XLAA 1BF2A 2ADAA 2HE5A 4LCRA 1HIZA 2PURA 4JTQA 4U2ZA 4DN1A 3G8RA 3OVPA 1EDQA 3DFYA 2HROA 2V69A 2XIBA 4X22A 4K68A 4NX0A 4EWJA 2FYMA 3LXAA 5HWNA 1UWIA 2FLIA 4JQ1A 3U5YA 4QNWA 1YXYA 4DBEA 1YTKA 1YNYA 1Q6LA 5HNNA 4MKVA 4ONVA 3QSRA 1UCWA 2Z7KA 3R25A 3ATZA 4AXKA 4UFMA 2YCEA 2EHHA 4Q7NA 4R7WA 3CZKA 4MJ4A 1NFBA 1H09A 3QMTA 3TQVA 3RPDA 4ZOEA 3TWBA 2Y62A 3H23A 2REQA 2I56A 4N7QA 3LN3A 1TELA 3LD5A 1H5YA 3PZGA 1OM0A 4Z1BA 2JE8A 4XAZA 5I06A 5F2LA 1LP6A 1JPIA 4GYJA 3OODA 2V5JA 3NFUA 5F1UA 4AYGA 2WSYA 1J93A 4J4KA 3C2RA 1U1HA 3C3UA 3UR7A 1PCKA 3NURA 1WP6A 3ALGA 2BGSA 4OKDA 3R11A 1ZUAX 3P5ZA 1UG6A 4WY0A 1JRBA 2TMDA 2VC7A 3T6CA 3HN3A 1H50A 1E4IA 3OA5A 3EDFA 3CV6A 3ISIX 3ARXA 3ANYA 1PSCA 2FGZA 5C70A 4GG9A 1PL9A 2JKPA 3W7IA 4F0SA 4B9ZA 2QULA 1UWQA 3HGRA 4UTJA 4ADUA 4OBSA 1GOQA 3LXBA 4QJ5B 4OECA 4GRSA 2PDMA 2VX7A 2O7QA 4LF2A 2OJPA 2A85A 1EJTC 5G4HC 3EMQA 3V35A 2DP3A 4WD0A 1JCNA 3RO6A 3GQYA 4P61A 3T4CA 5CGMA 3WH8A 3L5AA 4AMCA 6TAAA 3WDRA 2NQ9A 3W28A 4YCOA 4EP8C 3RLHA 1Q4NX 3VNIA 3KDNA 4LUJA 1XYAA 4U5KA 2PDYA 1TFVA 1VF8A 2YOCA 1CGVA 3N29A 3EKLA 4E3VA 1DQXA 3LI0A 5D4YA 3EBVA 4FR6A 3KCLA 4QTGA 1UKTA 4YYFA 3C2YA 2QVHA 3NXFA 2YKKA 1H11A 1UASA 2V6AA 1DL3A 1NSJA 1SO5A 2FZ8A 3M7SA 5HMSA 4CCEA 3VYLA 3NQVA 2PCQA 2E9LA 2OQHA 1WDPA 1XH1A 2VT0A 3MO4A 1YE6A 1IV8A 3TLQA 2X41A 3KWSA 1ZFJA 3P80A 3UQNA 4L56A 3H2CA 3GU2A 4M1RA 2D69A 4IP7A 2Q8XA 2AL1A 3W7RA 3WZ0E 2W67A 1ISVA 5LXEA 4Z2KA 3UCCA 4NJKA 4JN8A 3JR2A 4AHQA 4WRHA 3ABZA 3BL3A 6PTDA 5A8PA 4GQRA 2GK1B 2HBXA 4KCWA 2X7VA 1RV8A 2DUAA 1GZ1A 4B5WA 1F7BA 3G6MA 2A3CA 2OSXA 3T0AA 2JFEX 2XYLA 3S1XA 3FAWA 1G69A 1QOQA 3GVVA 1R47A 3S6DA 3KP1A 5C71A 2WCGA 1GG1A 3W7GA 1ZTVA 2VDGA 4PCPA 5HAOA 3WQ6A 3PBUA 1B54A 4LNYA 1QWGA 4YTQA 4HN8A 3TYZA 1RBOB 2IQ0A 4Z1DA 2EBNA 4GZ7A 4XTIA 1KRAC 4MDPA 4W5UA 1XD0A 3M43A 4MPQA 4XZMX 3M0ZA 1VFUA 1ZNNA 3CO8A 4OBTA 2O4MA 2GJRA 3AAMA 1S3HA 3AXXA 3KBWA 4H9TA 4WSHA 5GQBA 1RD6A 4HOWA 3O6DA 4JTCA 1DTNA 3RN6A 3VKCA 3W6LA 4WKAA 3GFYA 3BVJA 3C5QA 5MKGB 1V3KA 3I68A 1LORA 3UYIA 3OIHA 2Y7DA 1WOAA 3G22A 1RALA 4EE9A 6XIAA 3IIXA 2X40A 1GPWA 4B16A 1KNWA 4GIYA 1UPPA 4LVBA 1RP8A 4KCTA 1JDCA 4QFUA 1C29A 3LNPA 1E5NA 4XD5A 1S5MA 3OGVA 4US5D 2WKJA 4ZXOA 7A3HA 4QE1A 4H9ZA 3S2LA 4ZOCA 4IOTA 5CLTA 3QZAA 5A2BA 1VRDA 1HW6A 2XWEA 4I6KA 1S5VA 5M1TA 1E6SM 3FNDA 1IGWA 1ZBCA 3CO4A 4XVEA 1OYBA 1JAEA 2VR4A 3OP2A 4LRSA 1KKOA 2OQLA 3BGGA 4HK6A 1IIGA 1VBRA 3UZ5A 3UGRA 3IK4A 4YCPA 1B9BA 3GH5A 2ZZ1A 2E5DA 2F6XA 2X8RA 1KFKA 4JPGA 4PTNA 5DT7A 3FXGA 4PMQA 4EOUA 1AQMA 4JCMA 4N4QA 2ZKMX 3MCOA 3QHMA 1TG7A 4N9EA 4MNLA 4PTDA 1YDYA 2PP3A 5IHRA 5I23A 3V5CA 2G50A 2YXXA 4DJEA 3IIVA 3B0PA 4UWMA 1XIBA 3ZFHA 2PSNA 5BU6A 1I0BA 3BAWA 5C6MA 4HNVA 1G94A 3NZ1A 3PNZA 4P7LA 1W5NA 1VFTA 1FTXA 3BQ6A 4KWSA 4CQ9A 3JW7A 3T8LA 3FYOA 5BXTA 3SQMA 1DIKA 1ME9A 4B92A 1E72M 2BZNA 3OBAA 2V3FA 5FD0A 2CBUA 2TYSA 4L65A 4FLRA 4HSOA 3QFWA 4K1GA 4DWSA 2CNCA 3S4TA 4IWWA 3BJFA 3AU2A 3AIUA 3L12A 1WBJA 4CKQA 3BMWA 1R9YA 3ITXA 2I9UA 1CZ1A 2DUXA 3KE0A 3GK0A 3IEBA 2YYUA 2ZX8A 3HPXA 1EC7A 3ATYA 3BXWA 3N73A 2EJ1A 3K8MA 2J13A 5EGRA 4TTUA 5H6HA 1XFCA 4K8GA 1EIXA 1CW2A 4LYPA 4E0CA 1DE5A 1KWKA 2O7SA 3MDWA 1ZJBA 3FA4A 3GG7A 4KERA 2W3ZA 3W1AA 4KEVA 3WQ4A 3WH6A 7REQA 1S1PA 2VZSA 3VDAA 2VFIA 1GK8A 1QI4A 1EC9A 2VD9A 5AHEA 4GFSA 1SW3A 3OGRA 3MUIA 5CLWA 2PRLA 3A5FA 2BWGA 4TXEA 3OB8A 3LPPA 4WJEA 3AICA 1NELA 1Z6KA 3NSXA 4EXBA 2YDRA 1U30A 1XWYA 1Q8JA 1GQIA 4O1AA 2PZ0A 4Y9PA 1XG3A 3RRXA 1C7TA 2E9BA 1Q6QA 3VCCA 2WVUA 4NXSA 4WK9A 3VA8A 5AYIA 1J0YA 4RDYA 4YWIA 4IQEA 1V93A 1JGMA 2E68A 2Y5EA 1VYSX 4G2DA 1US3A 3QW4B 4GPNA 1VFHA 1OBAA 4WGHA 2OYLA 1HX0A 5KZ6A 1Q45A 1K9TA 1V4YA 1VHNA 2O55A 4NNAA 5GNZA 2VEKA 3HA1A 3I4EA 4FO4A 4NIRA 4L9ZA 3TWAA 1PO9A 1D3CA 4DJDD 4H6EA 4JEQA 3CGTA 3FVDA 3W6MA 4CN4A 4P7RA 1SQ7A 4QISA 1TV7A 2TPSA 4Y96A 3BARA 3AU6A 3CTTA 4G1KA 3W7NA 3IAPA 1OFQA 1XLIA 1S2TA 5B7YA 2R94A 4RR4A 4GY1A 2YL8A 4GLEA 1IT7A 1F76A 4X9SA 2I57A 2IPFA 4KEUA 4H04A 1GORA 3ZO9A 3NDZA 1JZ2A 2VGIA 2CW6A 2OG9A 4J5NA 3BO9A 2ACQA 4UQEA 8CGTA 1QDSA 5BZAA 4UQCA 2GVLA 4GVHA 1LL4A 3UPWA 5A6BA 4KETA 1OCNA 4DO5A 2YLLA 2G97A 3NSNA 1AQFA 4PCNA 4AZIA 4AX6A 3N6HA 1E15A 4XQ6A 3R12A 3NSMA 5G4WA 1I1WA 3SCSA 1P0NA 1M03A 1OX4B 4AY1A 3IV3A 3TQKA 4PN2A 4G6CA 3WLRA 3NPVA 2CLEA 4PB5A 4J27A 5B80A 3W26A 2X1RA 2ZA2A 4ZODA 4OVXA 3TZNA 5C9RA 2YDAA 2QCHA 3E0FA 4M6UA 4O12A 4F3HA 3SSJA 1FWJC 1YDNA 3K13A 2DZWA 4CU7A 5HPOA 3WJZA 3B8UA 1AL8A 3RM9A 1W17A 3NR0A 3PBVA 2OZTA 3QGAC 3KBSA 1OT1A 2FZBA 4CNUA 4GH3A 4LQ1A 4JHMA 1KCLA 3T9PA 1ICPA 4GC4A 1W2PA 5GVJA 3R13A 3JVAA 1ZJHA 1RH9A 4XWUA 3RJXA 3QR3A 2NX9A 5HATA 2ZCGA 2ZE0A 4ZQRA 2X1IA 3UXDA 4DJEC 2DZBA 1SR0A 4PTVA 2WWCA 4HB7A 3N12A 3IPWA 4AD2A 3E3HA 3LLXA 4WQ6A 2PC8A 3PBMA 4HNNA 4IICA 4MY8A 4W87A 4ORMA 3V36A 3UY7A 3CMGA 4A2RA 1D2KA 3CPUA 4MYXA 2CXEA 1J0KA 3VNLA 3VIIA 1GYLA 4H9UA 1R7OA 1H4PA 3CYVA 1E1FA 2Q71A 3QHNA 1GCYA 4DWSC 4LXFA 3ZT5A 1OYCA 1GYMA 1OCQA 3OQEA 2OKOA 3SUVA 3OA3A 1UR1A 4PCFA 1YX1A 2EQDA 4J2PA 3WBYA 4AZ6A 3W7QA 2J7EA 1TTQA 4RL3A 2V0TA 4OWGA 3T2QA 1AW2A 1XX1A 1ZP3A 4JICA 1Q8AA 2I7GA 3VNMA 3O0KA 3LPGA 5JVLA 2O9RA 1O1HA 2C3ZA 3NUKA 3TA9A 1NWTA 3BOLA 6REQA 3A21A 3L4XA 4JYDA 2DV0A 3UFYA 1CWYA 4QM1A 1UD2A 3P62A 1AFSA 3B9NA 4O8AA 3BSHA 4GBDA 2Z27A 4LY8A 2GVYA 3T4WA 5E6YA 1GKPA 4OV9A 4CU8A 5CG0A 3C56A 1CEOA 2H3DA 2W9MA 3DHFA 1O12A 1MXDA 3W7LA 3GXIA 3CQHA 1CXLA 4HSNA 1HL8A 1PJ9A 4GXWA 3DKLA 3C86A 3GG0A 2WHJA 4JTLA 1PZ0A 4YJ5A 3WDPP 3TN4A 3GNDA 1HJVA 3VKDA 3HQOA 1QTWA 5JUVA 2JF6A 3TC6A 3L0GA 5EBAA 3VM7A 1J5TA 3DX5A 1M9HA 2GSHA 1G4PA 3CB8A 2XVLA 3M6YA 1KR1A 4Y90A 3VOGA 1WA3A 4JNMA 3OTRA 3CV1A 2PWEA 2VGGA 4RX0A 5DANA 1R6WA 2IW0A 4JNYA 5HJLA 5T9BG 1SJBA 1SW7A 5D04C 5H1WA 1PWMA 4Q8OA 4MZ1A 3CHDA 2I5QA 1EXPA 4B4FA 4O0QA 2SFPA 5DCBA 1E6RA 1MDRA 2PDPA 3U4AA 1QK2A 1VQTA 1C8VA 1E1EA 2ACUA 4Y9MA 4DZAA 5A2CA 4IM4A 2VZUA 3ZYZA 4CNNA 1EGZA 2ZOXA 1YRRA 4GKLA 3W1UA 1UB3A 3GUGA 1WO2A 3FXYA 5XIAA 4FNRA 4PCTA 4FNQA 1QR7A 3CXOA 4AWTA 5U7SA 3JZUA 3WQ5A 3SCOA 4UNLA 5JQ9A 3GVQA 2A1YA 2PGFA 4W7VA 2TAAA 3T09A 5HMEA 1N55A 5I3JA 1GTEA 4I5RA 5F4SA 3M1ZA 1LG1A 1BAGA 1BYDA 4N6FA 4LCSA 4D1JA 4ZQNA 1ZLPA 3NPXA 2EF9A 3H6OA 2DSKA 1ONRA 3G2GA 1QFEA 4R7JA 5B7ZA 2FGLA 1FWTA 4HPXA 1M7JA 3NQBA 3TXVA 3UR5A 4W88A 2NUXA 1FH9A 2FH8A 1V8EA 3N2MA 2F8QA 4YVXA 4TQTA 4JZ5A 5AHNA 4AIUA 4B3ZA 3NYDA 1F74A 1RZMA 3WUEA 5GJNA 2VELA 1E6NA 3MMUA 5ABHA 5J5DA 3NL2A 1BG4A 5H8UA 1CPUA 4KKXA 2CCRA 5H91A 2IQDA 2Q6ZA 1QK0A 4ICMA 3WD1A 3UWYA 2PWGA 4NVTA 4LAUA 4A6GA 2W5FA 2WAGA 2QT3A 3WDJA 2DQXA 5AC4A 1EPXA 4GX9A 1X1NA 2V38A 3MSDA 4URIA 4HQVA 3TYDA 2PDLA 3FAXA 1UBPC 3SRKA 1VYPX 3OHIA 2HVOA 3NGFA 2VEIA 1Z89A 3OZOA 3GC2A 2Y8VA 2P3EA 3THQA 3NG3A 4DBWA 1JEZA 3NPUA 1UR2A 4Y6GA 3TLLA 2G95A 1JCTA 2ZXAA 1E4NA 1R0MA 2IQTA 2FIQA 2POZA 4JL1A 2CIPA 1TZ9A 3TOPA 3UXIA 5I6SA 5AZ0A 1ZALA 1J79A 3TNBA 2DEPA 5I3KA 5HMDA 2XIOA 3LQLA 1H49A 5HK4A 1PV8A 4BR1A 1VBGA 1EXBA 4HOZA 3O8AA 4DZIA 3L4ZA 2VEMA 4H00A 1GKQA 1O4UA 2VOTA 1QHOA 1ZBWA 2A21A 2XFRA 4HK5A 3CUGA 2O4QA 5T8GA 1H7RA 1NM9A 3R0KA 1OX4A 4U28A 3W7OA 3VOFA 2VDHA 1EP1A 4HPNA 4JX4A 2RDTA 2VVNA 1J8VA 1O60A 1K9EA 3SRHA 3G1FA 4AEFA 3P61A 5CAKA 2ZDRA 2NXIA 5CXPA 2YBTA 3W7PA 3W02A 4O15A 3NM3A 4NI8A 1R3SA 1F6YA 4NX5A 1QHZA 3NOYA 4UOZA 4L6OA 3B8VA 2BVDA 1CX9A 4L4MA 3O15A 5EPDA 1UR0A 5DMMA 5D32A 4RNIA 1SJCA 2CBJA 3M4HA 1ADSA 5BRQA 3ITGA 4GE8A 1C91A 3UG8A 3UJRA 5D05A 1D7KA 5BXPA 4O14A 4LYRA 2A79A 3CWHA 1E55A 1TJRA 2PUZA 2HBVA 4GI8A 2PDHA 3PM6A 1W3TA 4JFSA 3STCA 2CZ5A 1X96A 2PTWA 3P8IA 1QNPA 3BZGA 4O8RA 2ZXBA 3TQPA 2XSXA 4NILA 3VKKA 3W88A 4ZO7A 4TVUA 2WSPA 1FHDA 3AIVA 3LOTA 3QVQA 1WOBA 4EANA 2WLYA 5A6KA 4NAEA 3P0XA 5EMLA 3L2IA 1VBHA 5K7JA 3UETA 4AZ5A 3JU2A 5HJXA 1MUMA 4R53A 3NNTA 5DCDA 4A8RA 4FHAA 5EBUA 1PCWA 1V5XA 4D8AA 4QHRA 3AO0A 1FH7A 1C8YA 1UZ4A 3FHQA 3THDA 3AS0A 4JIEA 4DF2A 4L9XA 3AXKA 3GTIA 3WG6A 2WC4A 3O63A 4DB7A 4C60A 4Q4RA 1YBQB 4J3SA 4RE3A 1MEIA 4ZL1A 1YADA 4KH2A 2J9XA 1TV3A 3BAYA 3NEVA 4X63A 4C7DA 4TV5A 5FOOA 4MLJA 5BOOA 1GGOA 2ZZ7A 4PMJA 2WKGA 4M80A 4ATWA 3SECA 4ADTA 3QLLA 1WDSA 4DXXA 4FALA 4TVDA 2D3LA 5LA2A 3EWBX 3IJ7A 2X42A 2QGHA 1MFVA 3VCNA 4AMAA 4CQDA 1ZL1A 1UZ1A 1OFPA 3N11A 4QX4A 1ZPTA 3UU0A 1A5KC 3GXMA 2WJFA 3LTSA 2F84A 3NVDA 3A22A 2FPVA 5HA7A 3PJUA 3GWQA 3CPRA 3BLEA 3U3HA 2G4FA 3WQGA 4HP5A 1OFOA 3S8HA 4J2MA 4DBSA 4K3ZA 2QMKA 3OVQA 4HYVA 1TX2A 2Z4GA 3FHAA 1PEZA 5GJPA 5EMMA 3TCSA 1XYBA 3U2EA 3WD3A 2WW5A 1WXJA 1TKKA 2C14A 4XSMA 2J7DA 5CJ5A 4D6DA 3TH6A 1ISWA 3CZJA 2FHCA 1JYVA 1EWDA 4QQUA 3BANA 3GDRA 3A5VA 3VMNA 1W91A 1GJUA 3AZTA 3OZYA 5DMLA 2OLAA 1EQCA 1MUWA 4UR9A 2PF0A 1KBLA 1TCMA 3RPTA 3DYOA 4WUIA 5AFDA 4JR5A 3H2AA 4XBKA 3UY8A 4TX6A 1TR1A 3JZEA 3UF9A 2QW5A 4OQVA 4GHRA 1JCLA 4H01A 3PF3A 3E38A 4UQDA 4JTDA 4GA8A 3FDKA 3MJYA 1SZRA 1IWBA 5CZJA 2WWDA 1XGEA 3DI1A 4B5VA 1JPHA 2WZEA 3KFTA 4Q32A 1V0KA 4RLIA 1NTHA 4MB1A 2D2GA 3EPMA 2YLAA 1PUDA 2P50A 4PYSA 5E1QA 1G7VA 2WLZA 3UJEA 3OOQA 3QR0A 4QG9A 4GJ1A 3O6CA 1PB0A 1FKXA 3P82A 3EGJA 4OTKA 2UWFA 2ZVIA 5FEPA 5GNXA 3PNUA 5D37A 1KXTA 9RUBA 2JF7A 5FJIA 1CLKA 3ORWA 3UWEA 2OWWA 5D30A 1AUSL 4HNCA 5I3HA 3W75A 3BAXA 1CGXA 2A3AA 1PDZA 5CPLA 1FDYA 3KUMA 4L4OA 2YBVA 2Q01A 4O19A 4KGJA 1BQGA 1DEDA 2XVNA 2PMQA 3VOHA 4RW5A 5I0DA 1DTUA 3BQ5A 1QO2A 4D6EA 2E67A 3INPA 2NW0A 4Z2JA 4W9TA 1BVZA 2YZ5A 2XM2A 3NQEA 3C0JA 4PUJA 3T44A 2FDSA 2XVGA 2ZDSA 1KRCC 1B4KA 3WLIA 4KEZA 4NZ4A 2WKLA 3TQ0A 4LC6A 1SM9A 1W9DM 1KW1A 2DVTA 1TPC1 1QATA 3BH4A 1WDRA 2PD9A 3STFA 1DYSA 2WO5A 4AFYA 4JN6A 2P10A 1DV7A 1H41A 4QITA 3VILA 3NEHA 2Z6JA 1R3QA 2XIIA 1MI3A 3GZAA 3WLSA 2PWVA 3KW3A 3U7VA 1TRIA 2Z7GA 3PFMA 4GNVA 2C15A 4WX2A 3GHUA 4S3KA 2GDQA 1L9WA 1LUCB 1A53A 4ROPA 1UROA 3RIKA 3TIMA 3WQ8A 4R88A 4AIEA 3TU9A 4A21A 4NHVA 4EF8A 2GGEA 1UD3A 2ZZ4A 4Y9AA 2UY4A 3P67A 3PBGA 2DW7A 3RITA 4LY4A 1EFZA 1KD0A 2HSAA 3VC6A 2IPWA 2WNQA 2EXOA 5AZ1A 1Z42A 2DZTA 1KQYA 2G4JA 3LS9A 4HMDA 3ARZA 4F48A 5I3FA 5G1YA 4EAMA 3UWWA 4IGHA 2J4GA 1GVQA 3NDOA 3FY1A 4O1DA 3H8AA 1JVNA 3W25A 3ARQA 4TU1A 2JK2A 1JRCA 1WZLA 3NL6A 5ECUA 2VD8A 5A6TC 1ML1A 1LWJA 1RP9A 4Y7EA 2YZRA 5LNWA 1O94A 3K46A 3CAQA 5AC8A 3IUHA 4KPLA 2DZSA 2ATMA 3BURA 3AYTA 1UD4A 2ALRA 3PZ9A 4UC5A 3NQFA 2I9EA 3DN5A 4MFEA 5DELA 4JTTA 1R46A 1EX5A 1QPOA 4LAKA 5F4WA 3VI2A 5FAJA 1BKSA 4HCDA 3PWIA 2QVNA 2DZPA 2ZX9A 4U31A 2OZ3A 3EEZA 4A05A 3C2VA 2FGBA 2HVMA 1KXVA 3WLNA 1LJYA 4LS2A 3EB4A 5DFAA 3B0YA 1RBAA 3W1NA 1RCOB 1W1VA 2OTDA 1T41A 5F2IA 3VZZA 1S46A 2BODX 3CV7A 3WL0A 4HMEA 1CXEA 2NV9A 3WDQA 5C55A 2DFAA 4PMRA 3WQWA 1LCOA 2A6NA 4HJWA 1OK4A 4M0XA 5FKYA 5E5CA 1XR2A 1TVPA 2E5CA 3GLCA 3VIJA 1KFCA 5LHEA 4KEMA 3AHTA 4DAIA 4RDZA 5DMNA 2GYIA 1T5AA 4HU8A 3PTMA 5D2YA 4BF5A 2Y70A 1KM4A 3AHYA 3EMCA 3WUFA 2OPJA 2QJNA 5LNVA 1YLVA 1DORA 1J12A 3S47A 3LBCA 3B9OA 4H6RA 2AAMA 2XGBA 1YBQA 3UXKA 3WUGA 3GBDA 1ELSA 3MYPA 3QYSA 1XRVA 4JQ2A 3W2JA 3SB0A 3ZT7A 1TPB1 3MQTA 2FFCA 3D47A 1VJSA 1P6WA 2FVLA 5FEWA 3PZIA 1W5QA 3ERPA 5H2ZA 1YTEA 1WKYA 4LS1A 3CM4A 1Q7MA 1XSJA 4O13A 1ZBVA 1UWRA 4XAPA 2QNEA 1WDQA 1W5MA 3ZMRA 3GR8A 1HJWA 1RVKA 4M6PA 4BA0A 2C71A 4C7GA 4KIEA 4DUVA 4N9BA 3UJSA 4ZCWA 2CWNA 1AZ2A 3MCNA 4MWAB 4LH8A 3EWDA 5HQMA 3OYXA 2PD5A 1RA0A 3WQPA 4GVIA 3CEUA 3WEMA 3MJMA 2BB0A 2WZMA 1LL6A 3WEOA 3QOKA 2HEJA 1XRFA 1XIFA 1MO0A 3SRFA 4MNKA 3T07A 4A2SA 1RXOB 3KS6A 2WNZA 2HPMA 3QC0A 3TFCA 2PWFA 2TSYA 3SFWA 2VFHA 3UYCA 3DI0A 2PDWA 3SBFA 3GXNA 4EXAA 5A1AA 3GNPA 2CU0A 2DW6A 2OVLA 4O16A 2W63A 3GH7A 1MVYA 4RE0A 3GU1A 1XPYA 1MW2A 2WANA 1OX5A 1NOWA 1P7TB 2MUCA 4FIRA 2D1ZA 1TPEA 4RV8A 4TMCA 3I6TA 1PZ2A 3B8DA 2OO6A 1IF2A 4GACA 3STEA 3HV9A 3M0YA 4GY7A 2YL6A 3BMVA 4RNFA 3SN0A 4HU4A 1ITUA 3T08A 2J74A 4MWAE 2Y0FA 4XO7A 1KV5A 3LTPA 1RJRA 4OOZA 1XIHA 3C4UA 2B7OA 4AUBA 1J18A 3CQIA 4JX6A 2CBIA 3PBWA 3LCIA 1Q2RA 4DM1A 2WJDA 3CJPA 2R1LA 3AXIA 3BUVA 4DIAA 4GOAA 2HISA 2ZRZA 2D0FA 3CU2A 3KS5A 1OIFA 4PFMA 4ZB5A 4E8DA 5AN7A 1K7EA 1A0CA 6CGTA 4H9YA 4IG2B 4P8WA 4Z1AA 3KLLA 2ISSA 1KBBA 1NDVA 2WZTA 2FFIA 1IT8A 2OLHA 1MSSA 5A94A 5C8BB 1FWDC 4I5UA 4GYPC 1VPQA 1TWWA 4WSKA 2BSLA 3GIQA 1FA2A 8XIMA 1KM5A 1EDGA 1Z44A 4L6HA 1NARA 2CLPA 2CHNA 1VFSA 1W1IE 4Y9NA 5BOFA 3CZGA 3OU8A 3MP5A 4AY7A 4GABA 1JI2A 3N15A 1NWRA 4UQBA 3DUGA 1ICSA 2AL2B 2VYOA 4PUDA 4ASTA 3C0SA 2QDGA 2NX1A 3MANA 4J3TA 1J96A 1KM2A 3W38A 3M0IA 4K7YA 2CEQA 3IK2A 1IR2A 3MUZ1 2Z1XA 4C6FA 3GYEA 1HJSA 1WXZA 5E9AA 3DU0A 1UR8A 4UUIA 2R1KA 1H3GA 2Y2WA 4KMQA 3W01A 3R10A 1Z7AA 4G7EA 4D1IA 3AMLA 2OOFA 3SEPA 1HP5A 5FF2A 2W0UA 2XM1A 2DH2A 4XZIA 2Z26A 1X39A 3ZSSA 4ZE5A 4MDOA 1ZGDA 3H4WA 4EPDC 4RKAA 3G1VA 4JY8A 4Y9OA 4UR8A 2QJMA 4FOUA 5D09A 2H6RA 4HPHA 4TIMA 3CUHA 3M0MA 1GNXA 3KVKA 1RY0A 1K9FA 1TZZA 5MF5A 3MV01 1OY0A 3S3GA 1BTCA 2XN1A 4LGXA 3LX9A 5D9OA 3S1WA 2J88A 3B0XA 2QCGA 1TQXA 3W00A 2PTYA 2C7FA 2P88A 2QS8A 5HULA 1PXGA 1XD1A 1JR1A 4V1YA 2DZUA 2OYKA 3ECQA 3MI3A 1WUFA 1UJPA 3NTYA 5HMFA 3F5JA 7XIMA 4PE8A 3L4UA 1LROA 3G1HA 2B31A 3CNYA 3ARYA 3ZOAA 2W92A 2BG5A 2WQPA 3SUTA 3WJYA 1A5MC 3THUA 3C61A 4GK8A 4K39A 1VFLA 5I24A 2Z1SA 3ANUA 1O1ZA 2PP0A 2QCMA 1AMKA 2CYGA 2Q09A 1QT1A 4AVOA 4Q22A 2WMGA 4UTTA 3S2CA 4PBGA 4GQBA 4TX9A 2GJXB 2NLIA 4BJHA 5EMYA 3W53A 9XIMA 5D33A 1XUZA 2CZDA 1AG1O 4XAGA 1D7FA 2DJXA 1UD5A 3AMDA 5H8MA 3TTYA 1XYZA 3DFHA 2X1SA 5FJOA 3EB3A 3NA8A 2C1GA 1F4HA 3B03A 1VCVA 4G56A 3VGBA 2MANA 4F4RA 1Y0EA 4MZ8A 1CXHA 3LG3A 4QS5A 1WB0A 1Y8BA 4PEEA 5DY3A 1JPMA 2C6QA 5LIXX 2GQ3A 1O5XA 1AA1B 2JEQA 3Q65A 4AWEA 4UZSA 3WF1A 1GVSA 1I0DA 4NJJA 4Q4SA 4YHEA 3GKAA 5BXSA 4JFTA 2FTPA 4PSPA 4UFKA 1XL9A 4JOMA 2QCFA 4GI6A 1DWGM 3KCOA 4FAMA 1YMYA 5FI8A 5JIPA 1H0GA 2YB1A 4ML9A 1NWUA 8A3HA 4GIAA 4IPNB 3P93A 3PC0A 5D38A 2PDGA 1KFEA 3SDOA 2ZUTA 4TMBA 1NOUA 4BKNA 5BYWA 3BLLA 4MWAA 1JNEA 3MUY1 3G3DA 1EJRC 4ZMGA 1XISA 3RX4A 3TW7A 1RBLA 1VEMA 5EB8A 2W62A 5M03A 1PIIA 4CD7A 1V02E 1BSLA 2ZRXA 2ZA1A 2BTMA 3GNRA 3VMPA 1GZJA 3SCQA 4HJFA 3AIBA 4DEFA 5FEXA 4DELA 3E0VA 3EA2A 4WKHA 3OG3A 4J3UA 4FR1A 4ERGA 3W2KA 2QKFA 1ZSXA 3F4VA 3FA3A 5CSYA 3BLDA 3ITCA 3XINA 3HG3A 5C9XA 2BY2A 3KRZA 3MBFA 1V3IA 2YX0A 3B4UA 1JF6A 3C2FA 3LZ5A 4K8HA 1LBMA 1XI3A 3JUGA 3DG6A 3WJXA 1ZCCA 4PTMA 4S1FA 4XZWA 1CTNA 3T0TA 3A3HA 4C6IA 4XD3A 4C6JA 4B3KA 4LUSB 3SO7A 1NDZA 7TAAA 3CHEA 3KL5A 3E12A 1RJPA 3E1F1 3GXDA 1PBGA 1UPMB 2VR5A 2OXNA 2VDIA 3C8FA 4W4QA 3A4XA 3PJXA 1G4EA 5K9XA 3S1UA 2RHGA 2W79A 4JHOA 3BCFA 1DWHM 3K2GA 1LWHA 1JNDA 1LBLA 3HQ1A 1EL3A 3GX9A 2O9TA 5HPCA 1XF0A 1W9XA 3STGA 5CH9A 4PMXA 2RUSA 2W6RA 1HL9A 3R79A 1UC4A 2QV4A 1Q4WA 4O57A 5C9ZA 1WAWA 1MUCA 1BWVA 3BGAA 1YDVA 2G3NA 3BAKA 2R1MA 3RJYA 2E1DA 3GVRA 3KOFA 3NO1A 1SVDA 3ICJA 4S3AA 2YCKX 4FX6M 5G5IA 1BEUA 1BRLB 2EAWA 1N8IA 3NJ3A 1E0XA 3CL7A 4LRTA 3LXCA 1OGSA 4B5XA 2F2KA 2PTZA 3EXRA 4PUWA 2RGMA 1ESWA 1BTMA 1UJQA 3GVGA 3L67A 3HO8A 1OC6A 3N4FA 1U33A 3NZRA 3KZSA 1L6FA 2V2DA 3A3XA 1XLGA 3FJ6A 3T40A 3IIPA 2PFHA 5DBTA 5EU9A 1XDJA 1NH6A 3UNDA 2E40A 2YBUA 2J8TA 1UWSA 2AL2A 4HZ8A 4DO6A 2B7NA 1VIWA 4HZ6A 5FJPA 3W2NA 1C90A 1MYRA 3FV9A 1FXQA 3URAA 3W2MA 3BG3A 3OLDA 4W5ZA 4AF0B 5AOUA 1DJYA 1BSIA 2XGIA 4YHGA 5E6ZA 1BG9A 5AKQA 4UTWC 3DBPA 2E8ZA 4YXGA 2Y85A 1JPKA 2WC7A 4JKMA 4I6VA 4S3GA 4MSSA 1UR9A 3MY9A 1OF6A 1XS2A 3TYEA 1R3YA 1CIUA 2BY1A 3AWOA 3GUWA 5RUBA 4HTYA 4TVCA 3R43A 1JZ8A 1KCKA 1PHWA 1XLLA 2QJHA 1UP3A 3FGCA 1IR1A 3NQCA 4H7CA 4NYUA 4WVXA 3RLVA 4D6JA 1M7OA 2V63A 4IFKB 3UZJA 4HHPA 1FP9A 3UR8A 3A4AA 2D22A 3SI9A 3ALFA 2D20A 3CZ8A 4WXZA 5C2XA 4H8HA 2I1OA 4EKJA 5LNRA 2Y24A 1FWGC 4XUGA 4BK9A 4ICNA 1BYCA 1MW0A 2QCEA 1F05A 3TMLA 4HTBA 5EA9A 2QIWA 4H41A 5EMUA 4IMAA 3QY6A 1YXDA 1E43A 2J9YA 2JKAA 4RXGA 1E0UA 4M51A 1J2BA 5CZ0A 3TR2A 2XVKA 1DJNA 4ZO6A 3IARA 5LGXA 1CGYA 4JNZA 3H4GA 2V5CA 5EMJA 3B9AA 3GVWA 2J6VA 1EKOA 2OGYA 2PLCA 1TJ2A 5I09A 2VGBA 3K1GA 1IIHA 1XYFA 3K5XA 3M16A 2F6KA 1XG4A 2YXGA 4MTVA 1P4CA 4MWAC 1SZNA 2GJXA 3D6NA 5D9PA 1TE6A 4ACZB 5HINA 4F79A 1TJ1A 4PRTA 1QU4A 4ZXLA 1KTCA 4DAFA 3SCTA 3F4NA 3URQA 3KP0A 4M24A 3WLHA 1R2TA 3KL0A 4A35A 1JD7A 1UZHA 1W3HA 1JG9A 3VTRA 4F9DA 1VPYA 4Y8EA 5CZKA 4JAWA 1V02A 2HS6A 3BC9A 2DIEA 1QNQA 1BLIA 3ZJ8A 3C8NA 2XFFA 2GUUA 4B4HA 5A69A 4AHPA 1PX8A 1G9HA 4RZ4A 3W7CA 1JULA 5AC7A 1UKOA 4J3VA 3UT0A 4DZ5A 5A95A 1VENA 5T91A 1QNSA 1CB2A 2ACRA 3A23A 5AHMA 3MO7A 2VQUA 3CEPA 3MHFA 3EZ4A 1OYAA 4GKTA 5AYZA 3W83A 2WMHA 2PS2A 1QI0A 5AHFA 4CD8A 2GJPA 2NWRA 9CGTA 3DFPA 1MDLA 4G5DA 4M3PA 3HGJA 4V1XA 1JDFA 1TTJA 5CAHA 1TVNA 2QYGA 2E6DA 3R6IA 2BGNE 1SFTA 2NSOA 4M56A 1QI5A 5JBDA 4WDUA 2OELA 2VRKA 3DYPA 1M7XA 3KCJA 3LRLA 3WIJA 4BF9A 2VURA 3FOKA 4MGGA 1DIEA 2EGZA 3LZ3A 3U0HA 1I2NA 1PKMA 1UUOA 4LBSA 5FF4A 3PZMA 5H8PA 2DT1A 4KT2A 4PBFA 5G2IA 1V6TA 4BI7A 1O6IA 3GKFA 3M44A 3BGJA 4HVXA 2PCEA 4DVOA 3QPZA 3AS2A 4DPPA 3H70A 2CESA 1EBGA 1QI2A 3KEHA 3V1HA 3EX3A 4O28A 3CAVA 3ZJ6A 4MNJA 2V81A 4AH7A 2XWDA 1GG0A 3VOIA 1RK5A 2QEZA 3QQ0A 4L9YA 4MFDA 2YB4A 1RQHA 3CT7A 1XBVA 3M0VA 1I2RA 1PTAA 3LHWA 5EKYA 1DHKA 4LUSA 3TP4A 1LF1A 2WBKA 1HQTA 4RNHA 3UESA 3CASA 5DO8A 3IANA 4I9JA 3FJNA 3TOYA 4KWOA 1AZ1A 2YCJA 3OVGA 1B5TA 3STPA 4WOZA 3EMZA 2PDFA 1BYBA 1HT6A 3QZEA 3SY8A 3L65A 2ISVA 4Z2LA 3V5FA 1U5HA 1NFGA 3BE7A 3M64A 5JIWA 1PIGA 1H62A 3F03K 5AYXA 1GVYA 2OGJA 3RK8A 3F4DA 5M5DA 1W56A 2HVNA 1K7XA 1N8WA 4F9JA 3MHGA 4WJ8A 5FAGA 1W5OA 1LDCA 3W73A 4PMYA 1C93A 4MIMA 4DXVA 3FLUA 1M3UA 2P76A 4ZO8A 4DLFA 5J8LA 1X7FA 3RLUA 2GOKA 4GZJA 3A4WA 1YXCA 5HDRA 1W9UA 1PAMA 2WBGA 2G3MA 3ES7A 3M47A 3EOOA 3N6QA 3D0CA 1UR3M 3MSRA 1XYLA 1VR6A 3AS3A 4W7UA 3M9YA 5JH2A 1A5UA 4NKCA 4KWVA 4PTWA 3KL3A 1GEHA