4IMGA

Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-glycolylneuraminic acid
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
293
structure length
293
Chain Sequence
MKNLKGIFSALLVSFNADGSINEKGLRQIVRYNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDEIALIAQVGSVNLQEAIELGKYATELGYDSLSAVTPFYYKFSFPEIKHYYDSIIEATGNYMIVYSIPFLTGVNIGVEQFGELYKNPKVLGVAFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTQAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLDGVEAGYCREPMTKELSSEKVAFAKELKAKYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylneuraminate lyase
publication title Structural Basis for Substrate Specificity and Mechanism of N-Acetyl-d-neuraminic Acid Lyase from Pasteurella multocida.
pubmed doi rcsb
source organism Pasteurella multocida subsp. gallicida
molecule tags Lyase
total genus 123
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2013-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4imgA00
2BSLA 4N9CA 4GWEA 2FFCA 3DI1A 2Y63A 1LBLA 5KZEA 3IGUA 2NZLA 3LTPA 4LC6A 4OGZA 2AQWA 1LBFA 4EVZA 1QO2A 1AMKA 4ZQCA 3B8DA 4O16A 3NGJA 4ZQNA 3C2RA 1JUKA 1U5JA 3IRDA 5A5WA 1TJRA 4UTTC 4BI5A 3TDFA 3GNNA 3W7HA 1PIIA 2BZNA 1HO1A 3BK0A 3H53A 1SZNA 2WSQA 1TRDA 1PV8A 1YPIA 2QR6A 3O07A 2X1TA 3WJWA 3PB2A 3TIMA 4MZYA 3TR2A 2OT1A 1W5MA 1LBMA 4AXKA 4O54A 4BI6A 2OT0A 3R5EA 3F4WA 5EPDA 1FY6A 1XI3A 3G24A 3M5ZA 4FB7A 1L6YA 5D2WA 1YYAA 4UXDA 1UJPA 3L5MA 1KFJA 1TPUA 1H62A 4JY9A 4UTMA 4TIMA 4UTHA 1SFJA 1YXCA 3WFAA 3S5ZA 3A5VA 3TAOA 1Q3NA 2J9ZA 3TMQA 3M47A 4JX6A 1VCVA 3G0SA 2Q3OA 5D02A 2HMCA 3DH7A 5HR7A 3G1VA 4ADUA 3WK3A 2BX7A 4M7SA 1GTHA 3N9SA 1I2RA 5CSSA 1TTQA 1P5BA 4RLIA 3QQ1A 1JCMP 5C55A 2YYTA 5F4SA 3FYOA 3TX9A 4PTNA 5CZTA 3V75A 4MYAA 3TFXA 4KKXA 3GDRA 3NOEA 3A5FA 3ZWTA 1BEUA 1G69A 3HG4A 4NNAA 1OK4A 3HG3A 3B0PA 2VFDA 3GIYA 1AW5A 1OF8A 1H7RA 1HFBA 5HWNA 1YTEA 3R12A 1ZAJA 4WD0A 4PA8A 1YDNA 2CLEA 3LV5A 1OVDA 3FEMA 1GPWA 2VENA 3PULA 3S9YA 2W79A 1OABA 1TV7A 3M44A 4OT7A 3FS2A 2QKFA 1QPRA 3FKKA 4CQAA 3G1AA 3FYPA 2J27A 4IPJA 2Y61A 3LLFA 4P61A 1NEYA 2DZTA 3GX9A 4NJJA 3A21A 3OIXA 1A5BA 5G4EA 4N4PA 1LROA 4BR1A 2QUTA 3PC0A 5DCEA 2A1YA 1TPH1 4JEQA 4BK9A 2Y7DA 4KFPA 1Q6LA 3ZWSA 2DORA 4NT0A 1L6WA 2QDGA 2VELA 4JR5A 1SU5A 2NV1A 1KFLA 3CEPA 2DJXA 3ZS4A 1C9DA 1DQWA 2BWGA 5D32A 4JIQA 1F73A 3L65A 3B06A 1KM6A 2HTMA 1X1ZA 2FJKA 2XN2A 4Q33A 3IIVA 1PHQA 3CT7A 2FB2A 1G4SA 2YDAA 1XL9A 1OYAA 3TROA 4AF0B 2YPIA 3KXQA 3THQA 3LI1A 3MO7A 4M7TA 3PBWA 3QW4B 3M7WA 2GJNA 2DZVA 3C2OA 3NO5A 4WQ6A 2YXGA 5BRBA 1SSGA 2GUUA 3HPZA 4OV4A 3EX3A 4AWSA 3E96A 3BLFA 4E38A 3U2OA 3A22A 1FCBA 2Y70A 1QO5A 3L0GA 3GDLA 2E6AA 1XCFA 3G1SA 2QCHA 4RZ6A 1QNVA 3L21A 4A2SA 2F84A 4AWTA 4UFKA 5LNUA 3L66A 4RXFA 4Z1AA 2X2GA 3L5LA 2LLEA 1W8SA 4S2CA 4WY0B 1TSIA 2NV2A 5K4ZA 3TA6A 2E77A 2QCDB 4H3DA 5DLCA 3W84A 2H6RA 1YXYA 2E6FA 3FJ6A 3W87A 5D30A 1M5WA 4MIMA 1CW2A 3OHIA 3M9YA 1EP3A 2ZTJA 5BMXA 3MHFA 1EEPA 4S1FA 3PVFA 3W1AA 3M5VA 5I3KA 4K6AA 4XBSA 1RD5A 1WBJA 3NYZA 3GXPA 4CQ9A 4C1LA 4LV4A 4GBUA 2R8WA 1G4PA 4TMBA 3A9IA 3MYPA 1FCQA 1YDVA 4XKYB 2Z2UA 1EX5A 1V7YA 2QF7A 1SW3A 1K8YA 1L6SA 1OJXA 5BW6A 1OFPA 4DXVA 4TO8A 2E09A 3I7RA 4IMFA 3LXCA 4IX2A 4NX5A 5D33A 1SSDA 2P0OA 3NPWA 3GKAA 3M6YA 3GK0A 4CCEA 1F6PA 4JDYA 4HN4A 3A23A 1XUUA 4CNNA 1QFEA 3W72A 4IX0A 1QCWA 1SO5A 1DVJA 3NAVA 1NF7A 3GDKA 3NQ2A 3UZJA 3MJYA 4O19A 2A5HA 1BTMA 5G5IA 4CNPA 2FB3A 4FNSA 2DU2A 1GQNA 4NNBA 3TMLA 5HWJA 4OE7A 5GVJA 5C54A 4MKNA 2CU0A 3M5XA 1IXPA 1IF2A 2ZZ2A 3UYCA 1BKSA 4NQ1A 4O11A 4WJEA 4A22A 1ZY9A 4IMEA 2QEZA 4Z1BA 1VHNA 3AJXA 1H7NA 5FF7A 4JXCA 3UY7A 1P4CA 3S6DA 4O15A 4O50A 3EXRA 5LNSA 4HPXA 1W5NA 4N4QA 3EWUA 1VYPX 3G0UA 1HG3A 3W3OA 3MI3A 5FF0A 3UD6A 2CFFA 3CIWA 4WY0A 3DZ1A 3NPXA 4LT9A 3RFAA 2ISSA 2QCGA 3PY2A 2QCDA 4LOCA 3W1QA 1JULA 1R2TA 1JCJA 1W31A 3VCRA 3I7SA 3NQ8A 4R53A 3W2MA 4DBEA 4X9SA 1PS9A 5G2WA 1D9EA 2YR1A 3IVUA 4LNYA 5DXYA 1S5WA 5DCDA 1MEIA 4PODA 3P8JA 2GQ9A 2ATSA 1GVRA 2QCNA 4AAJA 1FWWA 4JTGA 3ATYA 3HF3A 1GVSA 4XKYA 1DBTA 2CWNA 4KFNA 4RXGA 1Z44A 4AVFA 2QUUA 3LCIA 4QISA 4PEKA 3O6DA 5G2IA 2HS8A 4LWWA 2A6NA 3QSRA 4Y8FA 2ZA2A 3C6CA 3QMTA 3EWZA 3NQVA 4QIUA 3P82A 2E6YA 3AO0A 3BARA 3PS7A 3W71A 3QRHA 1LOLA 4N2YA 2CLFA 4EWND 3WJXA 2B4GA 2YZRA 3NEVA 2CLHA 2Z6JA 4WUIA 3MW7A 3GNDA 4JN6A 4WX2A 3KRSA 4JTFA 2GVGA 4TU1A 1R2RA 3W07A 4DELA 5H2ZA 1OX4B 2X1RA 2ZRYA 3NM3A 3Q2DA 4E0CA 4DPPA 3ZR4A 5LKYA 2V5LA 2TMDA 3G8EA 3UWYA 1FCUA 1GVFA 2ZBTA 2YFNA 4EIVA 1ONRA 1Q45A 1TV5A 3HPSA 1XM3A 2Y7FA 4O1DA 5TQLA 8TIMA 5LGXA 3TNOA 1TQXA 5G2HA 1L9WA 1XBZA 4AHPA 4OWGA 1ME8A 3LRKA 4N6EA 4WOQA 3O06A 1K3UA 2A4AA 2V82A 4RX0A 5KITA 4CCDA 2V2CA 5FI8A 2A85A 2C19A 4FX6M 1KTCA 4Z0SA 1VHCA 4LUJA 4ZQPA 5AYZA 5T26A 2Q3RA 2ISVA 4DF0A 3TFCA 3ABRA 1HL2A 4YXGA 4LY8A 3S1XA 3IIZA 2ZDRA 3UWWA 4YCPA 1GG0A 4OHQA 1WV2A 2P10A 3W2UA 4MFEA 4QM1A 4UIOA 3L0KA 4NUWA 3IV3A 2Z6IA 3EXTA 3NL2A 5K4XA 2CW6A 1JCXA 4PC8A 1MO0A 3W7QA 1P0NA 3NL6A 1F76A 1VLWA 5HQEA 2VC6A 3W2KA 1UASA 1W5OA 2G97A 3NQDA 2H8ZA 3TQKA 2CLLA 1WOBA 2ZFAA 3KHJA 4LV9A 4UFIA 3DFOA 3EXSA 3MBDA 1Q6OA 4Y6GA 1XC4A 5D03A 3TK7A 4O18A 3C52A 1C8VA 2DP3A 4GUGA 1H51A 1ZJIA 4ADTA 3GXTA 2NXIA 1H7XA 3STFA 2RFGA 1TB3A 3MHGA 4LRSA 3O6YX 3WJZA 1DJNA 1KM5A 4PCFA 1BWLA 3C2FA 2QJGA 3DFQA 2QJIA 3W85A 1XXXA 2VFGA 1S5TA 4FX7A 3PSWA 4IXHA 2JKEA 5K9XA 4A21A 1T8XA 2GVLA 4EF8A 4U4MA 3EX2A 4AB4A 1OYCA 4JTHA 3ANYA 4LS1A 5D2TA 3NQ7A 3P84A 4IXXA 1W56A 1OX4A 1FDYA 2YGYA 2ZRZA 4LVDA 3S1UA 4ZMGA 4BF9A 5U7SA 1WA3A 3P7YA 3W1TA 2Y6ZA 3TW6A 5AOUA 2JBMA 1SR9A 1VS1A 2NWRA 1TPDA 3OA3A 3YPIA 3C8FA 4XBKA 4AHOA 4GE8A 1QPNA 4B5NA 3ABQA 2NWSA 3W75A 3S1WA 1K7FA 3Q94A 1XDMA 1M6JA 3V1PA 3PB0A 3NNTA 3STEA 3IVTA 4NU7A 3PUDA 1JRBA 1KLYA 3DI0A 2B7NA 1R30A 3C61A 1IXOA 1N8FA 4FIQA 3A24A 2E5CA 3EB2A 2H3DA 1OK6A 3LCWA 1Q6QA 1K8ZA 4JDBA 3G1YA 1RV8A 4UTIA 3C56A 5J5DA 4JIPA 4LVBA 3L0NA 4X3ZA 1A50A 3IEBA 4EF9A 3E9AA 3F03K 3PG9A 5TBOA 1OFRA 1GVOA 5G1TA 1FXPA 3CLMA 5DBUA 4L4MA 5CZ0A 4NJIA 2H3BA 2Y62A 4NVTA 3M43A 1KV8A 4MUZA 1I45A 5CPMA 1I2PA 3I6RA 3BG9A 4JTIA 1W3NA 2HS6A 1VR6A 3LV6A 3TCEA 2IQTA 4LVAA 3NQGA 5KZDA 5I3JA 3P5ZA 2W0UA 5KMYA 1LRNA 1VGAA 1FUYA 3S0CA 3T40A 2PRLA 3OVPA 4UR8A 4WXZA 5CZJA 5HNRA 3B05A 4GXMA 1UUOA 3LLDA 3DKJA 5HUPA 3O6CA 3UWUA 3B03A 3LCGA 3CWOX 3GB6A 4LS0A 3P80A 4CCCA 5EL1A 4WOZA 1LLWA 3HG2A 4LC8A 4RZ5A 1OFEA 5LZLA 3LGEA 2ZZ7A 4GUJA 4I7WA 2O7SA 5AHNA 2X1UA 4PL1A 3VKJA 3W2JA 4Y9AA 3LXBA 1KM4A 4Y96A 4JTLA 4YL2A 3T44A 4IQLA 3KVKA 5D2YA 2J88A 2QCLA 3HGRA 3SI9A 2NUWA 3FKRA 3RMJA 1SZFA 5LGZA 3EX4A 3U8GA 3BG3A 3QF0A 2GQAA 1WOAA 4A2RA 3TSMA 3B4UA 1VRDA 4H6KA 3D0CA 1QPQA 3W7JA 4O28A 3C0JA 1WBHA 3KFTA 1FWNA 1FWRA 4RR4A 2R14A 3CIXA 3TC7A 1V5XA 3L68A 4PH6A 4HKPA 4UFMA 4FX8A 5AHEA 2KZHA 3PSVA 2JGYA 4ZQRA 3HO8A 1LORA 2YYUA 1ICSA 2TRSA 2VOMA 5DY2A 2FQIA 3HMJG 3W1LA 3TXVA 3TC6A 1QDSA 4KWWA 1Q6RA 3QMRA 1ICQA 4UMBA 2EKCA 1O94A 2E5DA 1XBYA 4M6VA 3W73A 3WK1A 2ABBA 2A7PA 1VH7A 3LHTA 4O52A 1M7PA 3F4NA 3DENA 3LCHA 3S8HA 1F05A 1FDJA 1TPFA 5G4WA 4UTKA 3DBPA 1DORA 3VI2A 5CSRA 5AHIA 3ABSA 4BI7A 1KW1A 3SGUA 2V81A 3TKFA 3EX1A 3O16A 4FXRA 3LTSA 1XKYA 4OBTA 1DQXA 5IBXA 1X8FA 1YPFA 2E5BA 1H60A 1WX0A 1LRTA 5CKSA 5HWMA 3DHDA 3G0XA 1JCLA 3R2GA 2Z1BA 1D3HA 3SZ8A 4H4IA 3KX6A 2QUVA 1Z48A 4JX4A 5BMWA 2ABAA 3M16A 3USBA 3N14A 3G22A 4JY8A 1W3IA 1JQVA 1SZEA 2ZZ5A 3LHYA 1YTDA 4U28A 3HIJA 3G18A 1B4KA 4FIRA 2YW4A 4QJ1A 3W74A 3W83A 3NM1A 2G5WA 3NL5A 4RKAA 2ZA3A 1OFAA 3KVJA 5D04C 1W54A 4ZL1A 2QCEA 2OCZA 4I9AA 3UXAA 3LHWA 4R7JA 5G1YA 2EPHA 4GJ1A 2WQPA 1VQTA 1N7KA 3S5OA 1OX5A 1GJPA 1K7XA 5J5RA 1CX9A 4XTDA 3G1HA 4LTSA 1HO4A 1OG0A 1QR7A 1NFBA 1SW7A 4ZZ9A 3DXIA 3HJZA 1XBXA 1K7EA 1R46A 3B0VC 2Q8ZA 4MY1A 1RQHA 1N55A 4X2RA 2A6LA 3WJYA 5K9DA 3S5NA 4LVFA 5HINA 1OX6A 2Q8LA 3TV8A 2FLIA 4LU0A 3LI0A 2FPVA 4DF2A 4E2BA 3SSJA 3P74A 3DFPA 1MSSA 1D3GA 3EWWA 4JTSA 4MYXA 3LRMA 2AAMA 3O05A 2JK2A 1UBSA 3LHZA 4ALDA 2WNQA 5I3HA 5FF3A 4AF0A 1I2OA 4DPQA 1DKWA 1O60A 4O53A 5DELA 3SJ3A 5K2ZA 1KFBA 1EPXA 1EP1A 1UB3A 5FF2A 1H1YA 2WPBA 1VYRA 2ZCGA 5F1VA 2NXHA 2WOQA 3STGA 4O4VA 3NQEA 2C0AA 3FA5A 3ATZA 4YMZA 3BVJA 3CU2A 1EP2A 2AGKA 3INPA 3L5AA 3W7LA 5AC7A 4UR7A 1UCWA 4AHQA 1UUMA 3E02A 3MP4A 3GAKA 5AHFA 3GAYA 3WJSA 5H91A 1IXNA 3HPXA 5AC6A 2WSRA 1NF0A 1LTDA 1P1XA 3NQCA 3H54A 3QFEA 4BFAA 4JYDA 5BOOA 3P62A 1T96A 3QEZA 3BW3A 3F1QA 1G7VA 3NXFA 5AHLA 3ELFA 1RQEA 2E68A 3MWAA 4IOTA 1A5AA 3NQ6A 1QAPA 4O10A 1RVGA 1WQ5A 4HNUA 2D73A 2YSWA 1G7UA 4NJHA 4C1KA 1K03A 3GR7A 2GOUA 2ATMA 3UWVA 1G67A 4MLJA 1SW0A 1WAUA 2OMAA 2VFFA 4KWVA 3W7EA 5BNKA 1GWJA 1XBVA 2DZPA 2QCMA 1JJKA 4XZ9A 1TTJA 1W3TA 3HOJA 3CTLA 1W0MA 3S42A 1ALDA 3DFNA 3LERA 4O1AA 1FWTA 3IIPA 1F2JA 5DXXA 3IIXA 5CZSA 1H7OA 3W22A 3W7PA 2PRMA 4HHPA 4QAIA 3SR7A 4HNTA 3DHFA 3PBUA 1EWDA 1KBIA 5AB3A 4IMGA 2PRHA 4TX9A 1I2NA 4FNPA 2JKPA 5LNRA 1B3OA 2B7QA 1TJPA 1EA0A 5CPNA 1U83A 2NX1A 3PR2A 1LCOA 3MP3A 2O7QA 3QH2A 4A29A 2J6XA 3C4UA 4Z1DA 3DFTA 4MFDA 3NPVA 1W5QA 3HBLA 1AW1A 2JKAA 3BV4A 4HSOA 2VEIA 2WKJA 3P60A 2VEPA 3W86A 4QNEA 1LM1A 4K38A 3U6WA 3LCXA 4UTJA 4K8EA 2CLIA 3HG5A 4O13A 5EY5A 4GUFA 5EBUA 3W7DA 3SY5A 1KM3A 3EKZA 3G3MA 1FBAA 2R91A 1BWKA 4NXKA 3NG3A 1PCWA 5TIMA 3W7KA 3W7NA 2NUYA 3BO9A 2E6DA 3W2NA 1KM2A 2PE4A 3MI6A 1OF6A 1SO4A 3I7QA 1YXDA 1KV5A 1Z42A 4DBDA 5D05A 2ZRVA 3UWQA 5ABTA 1ICPA 2V2HA 4YCOA 2I9EA 1KFCA 1H63A 5I3IA 2XN0A 1KTBA 2C16A 4BWLA 5K7JA 2EGZA 3L9CA 5LHFA 3PF3A 3CPRA 2J24A 3GR8A 1FWSA 1H50A 4UTUA 4NXSA 1I8JA 3TQ0A 3S1VA 3TU9A 5CGQA 2QCCA 5F2LA 4AEOA 1PVNA 1NSJA 1S5VA 2DZXA 4RCXA 3RK8A 5IBXC 4IGHA 2V8ZA 4Q32A 1SO6A 3NQMA 4JYEA 2FTPA 1K8XA 4Z0JA 4QNWA 1FX6A 3G1FA 3MI2A 5LSMA 5AHMA 1H5YA 3QM3A 3N9RA 4IMCA 3EKLA 1ME7A 2ZZ1A 1LDCA 3EWXA 2H90A 4JS3A 3W70A 3P81A 4S2BA 3ZFHA 3RLVA 4ORMA 1KTNA 3W7MA 1EUAA 1RR2A 2EAWA 5FEPA 4OQVA 1AG1O 1A5CA 1AL7A 4M6PA 2B0MA 2C15A 5D37A 1GYLA 1F7BA 3EWYA 3B04A 4EOUA 1VCFA 1OHLA 2QCFA 1KM1A 2C18A 1B57A 3W1MA 1Y0EA 4WY0F 1MXSA 1R47A 3VE7A 3GXNA 2RHGA 1LOSA 3KRZA 4JTJA 1MEHA 2WV8A 3NQAA 3QSTA 4R34A 3NZ1A 2A7RA 1ME9A 2PC4A 1SUXA 1LZOA 3LB0A 2VFEA 3WK0A 2QDHA 4JGDA 4ONVA 1YDOA 3PWAA 2ALDA 5D09A 1QOPA 4JX5A 3DFSA 4QITA 3ABOA 1EUNA 3S5YA 2RDWA 3JS3A 3QMSA 5I3GA 2Y7EA 4O4WA 4POCA 3C3NA 5MHBA 4MJMA 2CZDA 1SZGA 1ZNNA 2W6RA 2V2DA 4E2DA 4FNRA 4NX0A 4JYFA 1H7PA 2Y85A 3B0UX 1ZCOA 3MYOA 2J9YA 3HGOA 4XQ6A 4O14A 3N34A 4GRSA 3W1PA 4O0KA 2ZZ4A 4N02A 5F4XA 5C2XA 3IGSA 1PL9A 4AMAA 3M41A 2H8XA 4RK8A 5K9CA 1F5ZA 1WYIA 2RKXA 1C29A 1GYNA 1H7WA 1NVMA 2I14A 4ORIA 4FNQA 4CQ8A 5AFDA 3W6YA 3T7VA 4HSNA 2OJPA 3T4CA 3UPBA 1LRQA 3RNDA 1XFBA 3H55A 2X1SA 3UY8A 4A3UA 1LP6A 3UQNA 4K7VA 4O0ZA 1TMHA 3M5YA 5D2XA 1X7FA 4AWUA 4L4LA 3W1RA 1XDLA 2RDUA 2NX3A 1OFOA 4HIBA 4JTEA 5K3VA 2X16A 1DL3A 1F74A 4NZFA 1ZAIA 3W7GA 2ZRXA 3GVGA 5D2VA 3W9ZA 5C5YA 4GUIA 3GYEA 1GVQA 4ML9A 4NNCA 3STCA 3W76A 2B7PA 4DO5A 2GJLA 2P1FA 1AL8A 3PUOA 3CWNA 1TTPA 3TSBA 3W7OA 3CEUA 4M5PA 1JR1A 1O5KA 3SW6A 5HJLA 3LTYA 1WDWA 6ALDA 5I3FA 2ZRUA 4JTKA 4RJEA 2VFIA 5KZMA 1VPXA 3PAJA 2E1DA 4MY8A 3P8IA 3E12A 1K02A 5E0KA 1JCNA 3W7CA 3P67A 4NJGA 4P2VA 1J4EA 2VXNA 4R33A 3N73A 4XTIA 4TMCA 4ICNA 2ZTKA 1GTEA 5L6UA 1B4EA 4FEZA 4N9EA 3QW3A 3TH6A 3LX9A 2WNZA 3SGZA 2A2IA 1L2UA 2YFOA 4GFSA 1MEWA 2V5BA 1S3HA 3TJXA 2QJHA 3OEXA 2RDTA 1THFD 3O8AA 3SIZA 4D2JA 4N9DA 3JRKA 4O12A 1RQBA 1FCVA 2YCEA 5F2IA 1JUBA 1F6KA 3QC3A 2FPYA 1EWEA 2V0TA 2QAPA 3R8RA 2I1OA 2TYSA 1X6UA 3DAQA 4UFJA 4I7UA 3G3DA 4ADSA 4DO4A 2G95A 3I68A 4PL2A 3LOTA 2ZYFA 1O95A 2WO5A 2A7NA 1OFQA 5F1UA 2A21A 4OV9A 3TUUA 1PCKA 2WNNA 1W1ZA 1VJIA 1MZHA 3TW7A 4LRTA 5D38A 1TREA 4UTWA 4MJZA 2NUXA 1JRCA 1J2WA 1TPWA 2TSYA 1P0KA 4GC4A 1IXQA 1PE1A 1X1OA 3BLIA 2PCQA 3HGSA 2VEMA 3O63A 2NX9A 4YLWA 3PM6A 3FIGA 2VFHA 1DOSA 3VE9A 2FIQA 4JTTA 3BLEA 2Y88A 4M19A 4HPJA 2R94A 3G8RA 3E49A 1WXJA 3UZ5A 3SECA 3KVMA 4G1KA 3FLUA 4N6FA 1QPOA 4BWLC 3L2IA 4MPQA 4CLMA 3HB9A 4Y90A 1YTKA 1FXQA 3K30A 3P61A 2Y7GA 3MUXA 4K39A 3LDVA 4WZHA 4TR9A 4FXSA 4Z08A 3BGJA 2FDSA 4DO6A 5SWUA 5HUOA 3JR2A 1EB3A 3P5YA 2RH9A 1YADA 3O15A 1ZAHA 3THAA 1FQ0A 2G96A 1H61A 4UTTA 3G1DA 2VEKA 2C14A 3LCFA 3W1XA 1GZGA 2FPTA 4K8HA 2NLIA 4LW7A 3TXZA 1OFDA 3NR0A 5HMSA 2C1HA 3GKFA 4DF1A 2WSYA 4IPIA 3IGXA 5FEXA 1JUEA 5KINA 1RPXA 3HQ1A 1GEQA 3NL3A 3QQ0A 1KM0A 1HUVA 4UFLA 1LLZA 5E1QA 4XUGA 4JNMA 5C6MA 1OFBA 4UFHA 3Q37A 3VFLA 3Q58A 1SQ7A 1A5SA 2YX0A 1ZFJA 3TJLA 4K37A 4MZ1A 2EHHA 2OZ0A 1YLVA 3CB8A 3W7RA 4IUOA 1TPVA 2OX1A 3NPUA 1LYXA 1VLIA 1GOXA 2PURA 2YW3A 1GT8A 4LS2A 1IGSA 4GUHA 3UXDA 1KFEA 4ZQMA 5CPOA 4O1CA 5U4NA 1RZMA 3OBKA 1VZWA 3LM7A 3W23A 2F7FA 2JGQA 5HR6A 4DEFA 2Y89A 5EA9A 3BW2A 1VCGA 1LOQA 4PFMA 1Z41A 3GZ3A 4N9BA 3MHUA 2B7OA 1TV8A 5FF4A 4ZVJA 2DZUA 2ZQ0A 3NQFA 4JD4A 4RZ4A 1SPQA 4WXYA 3OG3A 3SFKA 2V9DA 2A0NA 1JCYA 4W9TA 5HULA 3PBYA 1AW2A 3UNDA 2BLEA 1TPB1 1W5PA 2WJZA 3LXAA 2C3ZA 1SFLA 4LUIA 3N3MA 3R13A 2ZZ3A 4ZQOA 5KSWA 3MMTA 5AC8A 3C2VA 1E51A 3R89A 3W88A 4NZJA 4MY9A 3IIOA 5L9FA 1I2QA 3KRUA 5LNWA 4MLRA 3RF9A 4M6QA 3KVLA 4FO4A 1DHPA 2CZFA 3VNDA 5DY3A 3CQ0A 1QOQA 4GNJA 3QYQA 5LHEA 1EIXA 3BG5A 3MBFA 4JICA 1O5XA 1TRIA 3TE9A 1DV7A 3QZEA 4FNUA 3W1UA 1ZHAA 3E0IA 1H1ZA 1TYGA 5FESA 3NVTA 4RV8A 3T55A 2V30A 5AYXA 1G4TA 3CM4A 3RU6A 3GDMA 4MVAA 1G6CA 1KBJA 4HT3A 3FFSA 2TPSA 2ZRWA 3DU0A 4I7VA 5FEWA 3LBMA 1TTIA 2Z0IA 3TSDA 3NZRA 1QWGA 1A53A 5KTLA 6TIMA 2CLKA 5AN7A 3O1NA 1ADOA 3L67A 2UV8G 4DQWA 4HNVA 2XFWA 3TAKA 1T99A 1VYSX 3W2LA 1GG1A 2ZA1A 5CPLA 1AK5A 2C6QA 3BPWA 5F2GA 5EKYA 4FHAA 4CNOA 4UMCA 1R2SA 1KLZA 1TO3A 1ZENA 2EF9A 3PG8A 3IVSA 2BTMA 3T78A 1O4UA 3C2EA 1J5TA 5DCBA 3LHVA 4K7YA 4K36A 4OU1A 2X30A 3HGJA 2DZWA 1JQXA 4IJBA 1NAL1 1W37A 2GQ8A 4UMAA 5E93A 2DJLA 1DJQA 3NA8A 4UNKA 2DZSA 3CC1A 3LHUA 4J9JA 4O57A 3M1ZA 3LBCA 1ML1A 4NJKA 1IIHA 3BW4A 3QPYA 1TCDA 1M7OA 4X22A 3FJLA 3DGRA 1XUZA 2CZEA 3EX6A 1CI1A 2CZ5A 5A8GA 4UC5A 1IIGA 3BGGA 2C13A 4FNTA 4XWUA 1VC4A 3MP5A 3DKLA 4IWWA 3PBVA 4UCGA 3GLCA 3UWZA 1QMLA 3NDOA 1KFKA 3OVQA 3PUEA 3N2MA 2BXVA 3I65A 2ISWA 4MZ8A 2VKZG 3G1XA 2GPTA 2HSAA 3OVRA 5EYWA 2CLMA 5FEZA 2GVJA 3EEGA 3LRLA 5EMUA 2XN1A 4Q4KA 1G4EA 1TQJA 5AYYA 1PHWA 4UNLA 1JVNA 4KFOA 1TPC1 1T0OA 4JTUA 1SO3A 4HNNA 4UTWC 2ZZ6A 3CHVA 4Z1CA 1B9BA 4YWIA 5DN1A 4UUIA 3M0ZA 3WK2A 4IMDA 5F2MA 4UTLA 1KA9F 4FF7A 3KAOA 4O8RA 3TQVA 1ZALA 4QSHA 2NXGA 4O1BA 4O17A 3FOKA 3N2XA 3EWBX 4LVGA 5DBTA 5IM51 4AH7A 1TPEA 3LCLA 2J9XA 3N19B 2QAFA 2CLOA 3KOFA 1OYBA 1HTIA 5F4WA 1I4NA 3QPZA 4QQ3A 4MOZA 3W7IA 7TIMA 1TIMA 3RLUA 3W1NA 5CG7A 3QJAA 3GDTA 5LNVA 3UPWA 1FDZA
chains in the Genus database with same CATH superfamily
4N9CA 4DI9A 4DZHA 2VC9A 4OGZA 2AQWA 3MZNA 4I9TA 1AMKA 3PZMA 2AKZA 1GOKA 2WVSA 2GJXA 5A5WA 4MAZA 2DSUA 4BI5A 3TDFA 1PIIA 3B0YA 3S2NA 1HKMA 3CLWA 9XIMA 3OO2A 2GVYA 3RRXA 2D2GA 4GNKB 3SURA 1K9DA 3VPLA 4UQAA 3TIMA 2BFGA 1GHRA 3E74A 3CUIA 3T2OA 1DYSA 3I3EA 2G3FA 3LU2A 4TTUA 2D69A 3CO4A 5D2WA 1YYAA 1KFJA 1TPUA 4PRWA 4CN1A 4UTHA 1H2JA 4L65A 5KETA 4XB3A 1E5JA 3S5ZA 4M6UA 3TAOA 1Q3NA 3E0VA 4JX6A 5D02A 3REQA 3ZVHA 3G1VA 3JZEA 3WK3A 3HV8A 2WKGA 1GTHA 4LYPA 1J5SA 1I2RA 1KC7A 1TTQA 3QQ1A 2YLAA 3LSCA 5KEZA 4KKXA 3MTWA 3RO6A 3GDRA 4FF5A 1JF6A 3VGBA 1LQ0A 4I3GA 3WNNA 3HG3A 3B0PA 2VFDA 2ZICA 1C93A 1AW5A 3GIYA 1OF8A 4J40A 1HFBA 2Z2BA 2E8YA 1ZAJA 1YDNA 2WANA 1OVDA 3IUIA 2VENA 4MB1A 3TCSA 3WNKA 3S9YA 4UQBA 1OABA 4FXFA 4OT7A 2QKFA 3FKKA 3G1AA 1FWDC 3E2RA 4IPJA 2Y61A 4BF7A 3L7RA 4D6DA 5IFPA 3OIXA 1A5BA 1W3JA 2QUTA 2A1YA 2BODX 1ISYA 2WMIB 4JEQA 4BK9A 3VA8A 4JFUA 1Q6LA 4KFPA 4JR5A 3TTYA 4MTVA 2YA0A 4JIQA 1XPGA 3L65A 5XIMA 1V02E 1X1ZA 1GOMA 5B80A 2VGFA 1ZUAX 2HV5A 1D7FA 3IIVA 1W3KA 2ACRA 3A4AA 4HYWA 3UA3A 1B31A 1OYAA 3TROA 3UESA 4JFWA 1P0DA 8XIAA 1WXYA 3JW7A 1CXFA 3GW3A 2PDQA 4O1FA 5D9MA 2DSKA 1F3TA 3HPZA 4OV4A 3EX3A 4AWSA 2ZOXA 3V5CA 4E38A 2OODA 2Y70A 3GDLA 3D3FA 2E6AA 1XCFA 3G1SA 2QCHA 2A3HA 4RZ6A 4EXQA 3L5LA 5C2GA 6TAAA 2NV2A 2NT0A 2HISA 3GNRA 2G0WA 4H3DA 1MMFA 2WYSA 3WBEA 4H41A 5D30A 1M5WA 3S2CA 4JFSA 3SBFA 4K8GA 3M9YA 1EP3A 3HN3A 4HP5A 3WQWA 4ZFMA 1XCXA 4K6AA 5B7YA 3GE7A 3EDJA 4LV4A 4GBUA 2R8WA 1G4PA 4TMBA 3WSUA 1FCQA 1YDVA 4XKYB 3H70A 4PTMA 1EX5A 1GVIA 2QF7A 1K8YA 4MSSA 5BW6A 3TVAA 3KBNA 4Q8NA 6PTDA 3PZGA 4NG3A 4IX2A 2REQB 2I5GA 2QPSA 2P0OA 1E55A 3GKAA 4AVNA 4HQVA 4LH8A 4INFA 3UXIA 4WSJA 4QR6A 1NTHA 3A23A 3WEZA 1RPKA 3U2CA 1KGUA 1VFFA 4C5YA 3UZJA 4O19A 2A5HA 4I6VA 4XO6A 4CNPA 1TWSA 2INEA 1JEZA 1SGJA 5HWJA 5FJJA 3WLQA 5GVJA 3TWAA 3CASA 5C54A 1XGZA 2G37A 1ZY9A 4Z2JA 3IK4A 1H7NA 1WCGA 2VC5A 4JXCA 4MPKA 2NQHA 1GOWA 5A3HA 4O50A 4MB3A 3HURA 4MG4A 1MUMA 1FHLA 3ZSTA 2JEQA 3PBGA 1A5UA 1ECQA 4F48A 2J7HA 1T6MA 1X7IA 4NKCA 1A4MA 4HNLA 4R27A 2NLYA 3VNLA 3CIWA 4WY0A 3NPXA 3GU2A 4LT9A 3RFAA 1TZ7A 2QCGA 4LAOA 2QW5A 2PAJA 3W1QA 4HK6A 2V3GA 1R2TA 1S39A 3I7SA 3NQ8A 4R53A 5HMFA 1PS9A 3B8TA 5LIYX 1D9EA 5DXYA 3WDHA 1JPIA 3MT1A 3OVGA 7REQA 1XF0A 3EDDA 4U5KA 3CV7A 4Y9MA 3E1F1 1DEDA 4LFYA 1BXCA 3BAYA 4GO9A 4WCJA 2GQ9A 1FWWA 1GVSA 9CGTA 1XRFA 4Q8PA 1BYDA 4PBEA 5CSYA 4RXGA 1KBBA 1Z44A 2YKKA 3CGTA 3IJ6A 5JMUA 1S2VA 4ZR8A 3LCIA 3IK2A 4P8XA 1W91A 3B3DA 2HS8A 4Y8FA 1FTXA 3EWZA 4QIUA 3BMVA 3RXZA 1IZJA 2PU1A 2Z00A 1LOLA 3P2VA 3BV7A 3PANA 3GNOA 4ZB5A 1ITUA 3H4GA 1X6LA 3GNDA 4JTFA 1RJRA 2GVGA 4TU1A 1R2RA 4DELA 1UYQA 1I1WA 2V68A 4AFYA 3VK5A 4ZBCA 5LKYA 3ZR4A 2F61A 4JFTA 2DPEA 4JL1A 5GNYA 1GVFA 3K13A 3E0LA 1ONXA 3PJTA 4PN2A 1Z89A 8TIMA 5G2HA 4M82A 3LZ5A 2HDJA 1V3JA 4G9PA 1ME8A 3BLLA 4C1NB 1IGWA 2ZWZA 3EKGA 3LD5A 2A85A 1DHKA 2C19A 1UZ4A 3LS9A 3PWIA 3QZ6A 1HJSA 4AX6A 4DF0A 4YXGA 4LY8A 2Q02A 1REQA 3S1XA 4PFHA 2DEPA 4FA3A 1TE6A 1B0IA 1WV2A 4MFEA 3GH4A 4QM1A 4UIOA 3W4RA 1XLIA 3NL2A 5K4XA 2CW6A 4R3UA 1MO0A 3NL6A 1VLWA 4RNFA 5HQEA 5A8PA 3MSRA 5DT7A 4OBSA 3SUVA 2H8ZA 1JDDA 4J28A 4LV9A 3UZWA 3C52A 2EKGA 3GXTA 4REQA 2QPUA 3GH7A 2RFGA 1TB3A 3CZJA 4LCQA 3OZOA 4B5VA 3WJZA 1KM5A 1VFSA 4D6CA 4DBSA 1XXXA 2VFGA 1M3UA 4FX7A 4RZBA 1F8IA 5K9XA 4A21A 2FJUB 2GVLA 4U4MA 1XS2A 3EX2A 1DJXA 4JTHA 4AEEA 2OZ8A 3WNPA 3ARYA 1DIEA 5D2TA 5M2FX 3P84A 1FKWA 2VGBA 3GXMA 1JXJA 2YGYA 2ZRZA 3DERA 3N12A 4IL0A 4RW5A 4ZMGA 2UWFA 4HHLA 4QSFA 2CBIA 3TW6A 4Q7BA 3OA3A 1CGUA 4AHOA 3ABQA 3QPEA 3S1WA 1K6AA 3WBAA 1XDMA 1HGWA 1R0MA 3CWHA 1O68A 2WCSA 2DT1A 1TMQA 1KLYA 2WLZA 2B7NA 1IXOA 1E0WA 4NZCA 3A24A 1EJVC 4DM1A 1ZBVA 3AMKA 4IIEA 4RPPA 4UTIA 3C56A 1YMYA 3L0NA 5DT5A 5HMDA 1XC6A 3MU7A 3WQEA 3CQHA 1GVOA 1HJQA 5G1TA 2DVTA 4PUEA 3G2GA 1FXPA 5DBUA 4L4MA 3WLJA 3AMGA 4EAYA 2PDLA 3BG9A 3GG0A 1A5LC 3A13A 2Y8UA 3LV6A 3VM5A 5A8NA 4ZB2A 4KETA 3P5ZA 2W0UA 3O2LA 2YL5A 4GPNA 3U57A 4C7DA 1OCNA 4GXMA 1LQAA 5HUPA 3O6CA 1X98A 3CWOX 1OZMA 3GB6A 1PX4A 4CCCA 3HG2A 1DXFA 5FJUA 1A5KC 3VC5A 2GYIA 2X1UA 4LUSA 1GEHA 3IV8A 1E0UA 1RA5A 2WMHA 3WELA 2QCLA 4DJEC 1SZFA 3EX4A 3U8GA 5EGRA 4D6FA 2QUMA 1WZKA 1FWCC 4DIAA 2J7CA 3UXLA 4B9ZA 1IHIA 2I9UA 1QPQA 3W7JA 4EE9A 3KP0A 1WBHA 5DMYA 1EOKA 1UKPA 2FZMA 1JL8A 2R14A 3GHRA 3L68A 4HKPA 4FX8A 5AHEA 1RXOB 2XSAA 1LORA 3CQJA 2VOMA 2Y5JA 3EB3A 2CC0A 3PZIA 1QDSA 5XINA 1XLDA 2VO5A 1Q6RA 1LUCB 1BG9A 1XBYA 1R7OA 4M6VA 3WK1A 1E9LA 5TNVA 3LHTA 3LQLA 2OO6A 4EK7A 4WGHA 3ECQA 3DENA 5M03A 1F05A 4HHHA 3ITYA 1J0HA 3SGUA 1W9BM 1EBHA 3H21A 1KKRA 3O16A 2OO0A 1OCBA 2R1LA 2V67A 4H04A 2FTWA 2E5BA 2IKHA 2CZVA 5HWMA 5A6LA 2UY2A 4PSPA 1CWYA 3QXBA 1J9YA 5A1AA 3S4TA 4H4IA 1Y5XA 3NJ3A 1Z48A 3TLLA 2ABAA 4IIFA 3OQEA 2D0HA 1OSEA 1O1ZA 1JQVA 1SZEA 4PUKA 4F0LA 2ZZ5A 4JIHA 1BVZA 1YTDA 3FXYA 1B4KA 3H2NA 1FWGC 1JNEA 5T9CE 4W85A 2G5WA 1YE6A 1S1RA 3QOKA 1OBAA 4ZL1A 3QGVA 2XG9A 3LHWA 4R7JA 2OQLA 1AUSL 4GJ1A 3H12A 1N2VA 4DWSB 2WQPA 1VQTA 4LXFA 1N82A 1VF8A 4NRSA 3S5OA 7ENLA 1GJPA 3GNPA 1F3XA 1E43A 4XTDA 3BXWA 1IZCA 1HO4A 2G4FA 1QR7A 1SW7A 4UCFA 1PEZA 4ZZ9A 4ZO6A 1DJHA 1XBXA 1K7EA 2ZUUA 4ICMA 2Q8ZA 4MY1A 3VKCA 4YVPA 3E38A 4GXWA 3U7VA 2I5IA 2J74A 1ZJAA 2Q8LA 1P1MA 5D9PA 4DAIA 2FPVA 1IQ8A 3RCYA 3ZJKA 1XIIA 3P74A 1MSSA 4XBJA 1TJ1A 3MVIA 2AAMA 3O05A 3OHMB 2ZX6A 4XV0A 3E0WA 3DC8A 4ALDA 4DRSA 1B90A 4O53A 5K2ZA 1KRAC 1EP1A 5FF2A 3BOFA 1AH3A 3WH5A 2QLYA 3JZUA 8XIMA 1C8QA 5A8QA 4KWUA 1B54A 1SJCA 2J75A 4XSMA 4LX4A 3SRHA 4GKTA 4UR7A 3PTQA 3UF9A 4Q4SA 1UUMA 4W8LA 3WJSA 5H91A 3CHEA 5AC6A 1JPDX 1FH9A 1LTDA 2DIJA 4TOQA 1EGMA 3QEZA 3BW3A 3F1QA 1JDEA 5DMNA 5MF5A 5AHLA 2OKOA 1V3LA 1MQPA 2E68A 4EANA 1UH3A 4HA3A 4O10A 4HNUA 2FVMA 4XZBA 2Z26A 2D73A 1BSIA 2BVDA 3KLKA 5ABFA 7XIMA 3LMZA 2VZVA 1MI3A 2C0HA 3QR1A 1J0ZA 1R3YA 1H0IA 3AISA 4Z1YA 5A2AA 3H7VA 2PWUA 4LEQA 4HYVA 5A95A 4P7QA 5HBFA 3N1AA 3AHVA 4AMCA 1JZ3A 3HOJA 4DJDA 1R9XA 4LNCA 4J27A 3ERPA 3IIPA 1CXEA 3FYYA 5CZSA 3WF2A 4QAIA 4N42A 1E72M 1PAMA 4HNTA 3PBUA 4W5UA 3TEVA 4GQGA 5CAKA 4IIHA 4RE0A 1TELA 2PRHA 1JZ8A 4TX9A 4LF2A 2JKPA 2FHCA 1TJPA 3ZT5A 1M1BA 1TR1A 1O12A 3PR2A 4YN5A 3MP3A 2O7QA 3QH2A 2JE8A 4A29A 3R6IA 1XSKA 2GJRA 3AOFA 1ZJBA 2WW5A 1S5NA 2DVXA 4MFDA 1W5QA 3IUHA 1W1A1 1AW1A 1R3QA 3HBLA 3F2BA 4HSOA 2ADAA 3GXIA 2VEIA 1W8GA 3ZZ1A 4C60A 2C91A 2PDPA 1PXGA 4K38A 3VINA 4C6OA 1XIMA 5CXPA 3THDA 3WMBA 3CB3A 3LCXA 4LAZA 4UTJA 3BLKA 5AKQA 4P8VA 3I3BA 3B8VA 4K8EA 1IR1A 3BAWA 4I5XA 2CKSA 3GC2A 1EDTA 1G94A 4PMZA 3SY5A 1Q4WA 3R1ZA 2PA6A 1FBAA 1XGEA 1BWKA 3PWGA 4DYKA 4UBPC 3W7KA 1GKQA 4ZENA 4I9JA 3W2NA 2GJXB 3WDJA 1GQKA 4KEVA 1Z42A 2A3CA 2PB1A 2PS2A 1QNRA 2ZRVA 2J47A 6REQB 3FHQA 1H63A 5I3IA 1P7TB 5DANA 3FJ4A 1V3IA 3APGA 2EGZA 3PF3A 3CPRA 4HMCA 3GR8A 1H50A 2ESCA 3SB0A 3I6EA 4I90A 2YZ5A 1KD0A 4UTUA 5F2LA 1S5VA 3U2EA 1DWFM 2XISA 4IGHA 2V8ZA 2Q09A 3EEZA 4WSKA 3NQMA 2FTPA 1K8XA 1YNQA 2QNEA 2GL5A 1CXHA 1VIWA 2W4XA 4KIRA 2XGBA 5AHMA 3RRAA 4HZ8A 1LDCA 2P8BA 1FHUA 1JPMA 3LK6A 5ENLA 3ABXA 4GACA 8RUCA 4RE2A 4S2BA 3OLIA 4HYRA 5T9BG 1DXEA 1PDZA 3L4XA 1D2KA 3BQ5A 1A5CA 4M6PA 1JAKA 4NYUA 2C15A 1S2TA 4GISA 4QEEA 5D37A 4C7GA 5A2CA 3VMNA 2VJXA 1B9ZA 3EWYA 3B04A 4EOUA 1VCFA 1BWVA 1KM1A 4GIYA 4KMQA 1OM0A 1R47A 4IL2A 3KRZA 3LENA 4NRRA 3NZ1A 1UZDA 2GGJA 2A7RA 4X9YA 2ZE0A 4DY1A 3I10A 2VFEA 4YTTA 2WJFA 2P3EA 2PPGA 1BD0A 3ZQ9A 5D09A 4BEUA 4HJWA 3WKZA 3LGGA 5A6KA 2Y7EA 4O4WA 3VNKA 1NDZA 3C3NA 2HQAA 4FNRA 3FK4A 2W91A 3TNBA 1CLKA 4IGSA 2GUYA 4L1XA 2Z1XA 4GRSA 3W1PA 4XO7A 5HJYA 1HP5A 4O0KA 2NT1A 3GU9A 3UCDA 2ZZ4A 4N02A 4M29A 5C2XA 3H7UA 3IGSA 2RJHA 1FP9A 3AYSA 1QI3A 4RK8A 5E5CA 4HCLA 3NQBA 1H7WA 4GYJA 3USZA 4CQ8A 2PDCA 1H0GA 2E7FA 4W7VA 3T7VA 5CBIA 4U31A 2QUNA 4LCSA 4B5TA 1VAHA 3UQNA 4K7VA 2NVAA 3M5YA 4CVWA 5D2XA 4Z2HA 4JKMA 3CUZA 2NX3A 3KOWA 2J79A 5K3VA 4JHZA 1IV8A 4NZFA 4Y2WA 4JTQA 2IMRA 2VVSA 3U0HA 2ZRXA 3GVGA 5D2VA 2GFTA 3QLLA 4GZ7A 4CU8A 1MW0A 2WHJA 1MNSA 5D4YA 4MWAD 2B7PA 4GI9A 3URNA 1ISVA 3PUOA 3ITOA 4DWSC 5FOOA 3B9AA 3TSBA 1QRQA 3W7OA 4M5PA 2BBFA 3H23A 1CXKA 3RCNA 6ALDA 1UKTA 2F2HA 2VUYA 4JHMA 2VFIA 3CT2A 2X0SA 4NIRA 4KESA 3IPWA 3PAJA 4WDWA 2YBTA 3IS4A 2GSHA 3D47A 1ZBCA 1HT6A 2Y24A 4WRHA 1XRTA 3OODA 1GTEA 1VB9A 3QW3A 4U3AA 1XIDA 4MNKA 2F2KA 2A2IA 3WMLA 3N6HA 2RDTA 2BOFX 3RG6A 3JRKA 4AUBA 4DJFA 1FCVA 3LM3A 4H8HA 5I6SA 1V8EA 1XYMA 3RM4A 2TYSA 1EC7A 4CEUC 4ADSA 2O4MA 2G95A 2WO5A 1UH4A 1XIHA 3L4TA 3N2OA 2OELA 2UY3A 1KCKA 3BAKA 3TUUA 5I3DA 4S3CA 1VJIA 4G7EB 4HOWA 3KM8A 4LRTA 5D38A 4A3HA 4ATLA 3AZSA 5AY7A 4XIMA 4M80A 3GG7A 3HGSA 1RHCA 2VEMA 4YLWA 3PM6A 1QOXA 4MNMA 1DOSA 1XLFA 4HPJA 4HOXA 2ZIDA 1UWRA 2WZEA 4D6EA 3E49A 2CLPA 1MRAA 2I17A 4MWAE 1WDQA 3KVMA 1QPOA 4PMJA 4BWLC 4DB7A 2YL9A 1Q66A 1RJQA 2FFIA 3KTXA 1FXQA 4ZXOA 3POCA 1XG3A 1XSJA 5D9OA 3LDVA 4YNGA 1J8VA 1QI5A 2FDSA 5SWUA 4ZA0A 5HUOA 1EB3A 1DTUA 2RH9A 2X7WA 1ZAHA 3THAA 3UT0A 2G96A 1TR9A 1D3CA 1R6WA 3W1XA 1E9ZB 4U33A 1C3FA 1SM9A 3UZXA 1GYMA 2PSNA 5CGTA 1MWOA 3GQYA 3P0XA 3NR0A 1WAWA 3VXGA 3N15A 3VUPA 2EG7A 3L4WA 4C6MA 2C1HA 1MUWA 1W2PA 4R88A 3VZYA 4UFLA 2AKMA 4XUGA 1OFBA 4UFHA 3Q37A 3MY9A 3VNZA 1A5SA 3HA1A 2D24A 1QK0A 5IDZA 5GPRA 1GVEA 3E2SA 2BY1A 2VC7A 1YLVA 3LNMA 1OEPA 3VCNA 3KZSA 2BY3A 4C6PA 2OX1A 3QKZA 1VLIA 1XYAA 2PURA 3BCJA 2A3BA 3VILA 3AWNA 3W0KA 1U22A 4YHGA 2P0IA 5EA9A 3ZIZA 4PFMA 1OT1A 1Z41A 3GZ3A 3Q65A 3MHUA 2VZTA 2B7OA 4F0RA 3W37A 3SFKA 2V9DA 2A0NA 4PMQA 4PRRA 2E3ZA 3LXAA 2ON3A 4UZUA 4ZQOA 3SUUA 3SCQA 2DV0A 3NZGA 1YKWA 1V6UA 1V3MA 5LNWA 1K8CA 2ZUWA 4LYKA 2CZFA 4RNHA 3VNDA 5DY3A 1PTGA 2VEGA 4GNJA 3QYQA 5LHEA 1NJJA 1O5XA 2XM2A 1ZHAA 4MDPA 5FESA 1VJSA 2WPGA 4IZGA 3WQOA 3GD6A 3T55A 1G4TA 3O0FA 3GDMA 5BOEA 5DMLA 1VBJA 1UC4A 4AY1A 4PUMA 5DQPA 1QWGA 1A53A 2CESA 3ITCA 1J18A 3CH0A 2UV8G 4DQWA 3NURA 2CETA 3ZT7A 3TAKA 5J04A 1VYSX 2ZA1A 4JKLA 5CPLA 3F5JA 1AK5A 2C6QA 3OLGA 5EKYA 3A47A 4FHAA 3N4FA 2GQ3A 1R2SA 4S3FA 1TO3A 3PG8A 4ZGYA 4ZSUA 3WUEA 3T78A 4EXAA 5DCBA 2INZA 3VUSA 2YDSA 2X30A 3ICJA 3QV9A 3D46A 3PNZA 4P7RA 5E93A 1VFMA 2C71A 1DJQA 3H2EA 3CC1A 2JIWA 1RBOB 3GRIA 3T09A 3LBCA 1KBKA 1IIHA 1M7OA 4X22A 4IHCA 4I8DA 4FOKA 4LAMA 1CI1A 1CZ1A 1Q7MA 3BANA 2BVYA 3FN9A 2IQDA 1IIGA 4MJ2A 2QGHA 2Q71A 4B5WA 6XIMA 4QG9A 3EDFA 3S2JA 4QE4A 3OGVA 3WH8A 1OT2A 3N2MA 2ISWA 4MZ8A 3RUBL 2OYMA 3JVAA 3G1XA 1QNPA 4CU6A 3VNIA 3SY1A 2Z25A 1GZ1A 4US5D 4EPBC 3LRLA 1GK8A 3PZQA 1X8CA 1PIFA 1PHWA 2BNJA 1ISWA 4KFOA 1T0OA 1SO3A 1O7AA 5DN1A 1PTDA 2OXNA 4UUIA 1KRBC 1O66A 1M01A 4UQDA 3CTTA 2FGZA 4QSHA 4O17A 3S83A 3FOKA 3FGCA 4Z42C 3EWBX 4HPHA 1E3XA 2TODA 3SM0A 3P6LA 3NUKA 1TPEA 3CMGA 3BLDA 3LCLA 3VMPA 3AZRA 2Y4SA 1TV3A 2I5QA 2CLOA 1HTIA 3VDGA 4G2DA 5F4WA 1I4NA 3M46A 2DUZA 4H2HA 2OSXA 3W1NA 4AZ7A 3QJAA 4LB4A 1WZMA 2ZVIA 3UPWA 3SRKA 2PFHA 2Z1SA 5DFAA 3VDHA 2FFCA 2Y63A 3AIUA 1WUEA 4IISA 3IGUA 3TJIA 2NZLA 3KRBA 3B4YA 3B8DA 4J5NA 4O16A 4R85A 3NGJA 4KIEA 2PDGA 5B7ZA 1AQ0A 1U5JA 3QGAC 5CBBA 2WMGA 2V63A 4LGXA 4NZ1A 3BK0A 4DXKA 1MDLA 3WD2A 3V5FA 2HCVA 1JZ4A 1TRDA 4LUYA 1YPIA 4K1WA 1W9XA 3WJWA 4W8AA 3PB2A 4ICCX 2A3AA 1W5MA 4AXKA 4O54A 2FGLA 5H8MA 1KRMA 2BGNE 1FY6A 3SN1A 2PCEA 1BKHA 5C71A 1XI3A 3M5ZA 1XYFA 1V7AA 3L5MA 2J6VA 3K2GA 1XLHA 4MAVA 4JY9A 4UTMA 3KCLA 1SFJA 4ACYA 3ID7A 3UJRA 2R82A 5MKGA 4KEUA 1ENUA 1EXBA 1VEOA 3W38A 2J78A 3BSGA 5BU9A 4GI6A 4ADUA 2YA1A 1TVNA 4M7SA 1R86A 1ONEA 4RLIA 1JCMP 1J0IA 1TWDA 1XQKA 4TVUA 3WQFA 3A5FA 1BEUA 1J10A 3HG4A 4XG1A 1HKWA 2XFRA 1M53A 3KWXA 5HWNA 2BG5A 2GK1A 1YTEA 3CO8A 2CLEA 3LV5A 2XIOA 3FEMA 1E6PA 1DIDA 4UQCA 1PX3A 2G3NA 3ARSA 2ZWYA 4PMXA 4WJXA 1QNOA 2J27A 3EB4A 3LLFA 4FI4A 4J4KA 1NEYA 4KCTA 2L5HA 3L4YA 4NJJA 5E6YA 3A21A 4N4PA 1LROA 5DCEA 1TVLA 1XHGA 3H8AA 3UR8A 2I16A 3ZWSA 2VELA 1YNPA 3CEPA 1XLAA 2DJXA 3ZS4A 1C9DA 3C0LA 4C6EA 3VIOA 3E2VA 4JPGA 1ZRQA 2WM0A 4H1ZA 4YU1A 1KCLA 1X1NA 4ATDA 1XX1A 2PDFA 1Y5VA 4OFCA 2HNEA 1ODUA 4IFKB 4MDOA 4AG0A 4AZHA 4CVUA 2XN2A 1JD9A 4YTSA 2FB2A 2ZVRA 1J0YA 1BVWA 2YDAA 1XL9A 1VFLA 4J1OA 2EBNA 3KXQA 3THQA 1HGYA 4DWDA 2V5JA 2OQYA 3MO7A 3PBWA 4IIBA 3QW4B 4PUWA 1ZQ5A 3C2OA 3NO5A 1UC5A 4A35A 4IICA 1CDGA 3IJDA 1SFTA 3NO3A 5E9AA 1QO5A 4QAWA 1MW1A 5CZKA 1OQFA 4B3LA 2DH2A 4DUWA 1EO7A 4RXFA 2OOFA 2LLEA 4ZOCA 1TSIA 1RH9A 3TA6A 1WKYA 4CN6A 2E4TA 3H4WA 1YXYA 2E6FA 3W87A 2HBVA 2DIKA 1Q63A 1K9TA 3ANUA 3GY1A 3ITGA 1POJA 2PMQA 1DWJM 1WBJA 4D1IA 5J8LA 4Q7NA 5PTDA 1OB0A 4GQRA 1SW3A 1OIMA 2E09A 3I7RA 2WMIA 3EPMA 3MJMA 5D33A 2XH0A 1SSDA 3NPWA 3NYDA 1EJXC 3FDKA 2OWCA 1XUUA 1TV2A 7CGTA 2Z4GA 4CNNA 1W1VA 3VOCA 1QCWA 3ITVA 3GS6A 4PBGA 3NQ2A 5G5IA 4FNSA 4NNBA 3DG7A 3AHXA 3VFCA 1W32A 1V0KA 3NZPA 2IS7A 3ZMRA 5LIXX 4OE7A 1Q85A 3A3HA 5I79A 4MNJA 2CU0A 4IPNB 1BKSA 2Y5SA 4JQ2A 4O11A 4WJEA 4A22A 4IMEA 5FF7A 1GW1A 4O15A 3AFBA 4HPXA 1W5NA 3MQTA 4NHVA 3GG8A 1HG3A 3VO0A 3DHPA 5FF0A 4S3EA 1EDQA 2QJJA 1W3LA 3KL0A 2MANA 3VD5A 3GW0A 4DJEA 2VZUA 3VKDA 3WX7A 4DBEA 1JF5A 3IVUA 1AFSA 4LNYA 3RDKA 1MEIA 1A5NC 2ZXQA 4QG6A 4W4QA 1UKSA 4AZGA 2VWSA 2ATSA 3ZLHA 3VIHA 3ATYA 4XKYA 3C8NA 1AZ2A 4S23A 1BYAA 2XIMA 4KFNA 5HJXA 2YOCA 4H6RA 3RPTA 3T8LA 4Y9NA 1FWBC 4FLRA 4DX3A 3O6DA 4JTAA 4Q3MA 1PIGA 1XLKA 3QMTA 3ARXA 2PGWA 2E6YA 2WZTA 3BARA 1UR4A 1HX0A 3ARVA 4N2YA 3WJXA 3MCOA 1E6XM 3R43A 2CLHA 3IARA 2Z6JA 4WUIA 1NOWA 4WX2A 3KRSA 3UR2A 3W07A 1HKIA 4L9XA 3ARRA 3NM3A 3T0DA 2V5LA 3UWYA 1AD4A 2ZBTA 2YFNA 3WBXA 4QDWA 5A6AA 1FWEC 4O1DA 3LA4A 1W9PA 3WLLA 4OWGA 3LRKA 4N6EA 3O06A 1K3UA 3VOGA 1VFHA 2FZDA 3ONBA 4RX0A 4CCDA 5KITA 5FI8A 4YTUA 2CNCA 1KTCA 1DWGM 4LUJA 4ZQPA 5AYZA 2W92A 3WIJA 2ISVA 3ABRA 3RR1A 1XH1A 2EJAA 3UWWA 1M03A 2DZAA 1GG0A 1CYGA 4OHQA 1XIBA 3L0KA 2Z6IA 5IDIA 4WJ8A 4PC8A 3W7QA 4FLQA 4X61A 1C90A 1JZ6A 3EMCA 4Q4QA 4BKNA 4XVEA 3P93A 3UJ2A 4UFIA 3PN8A 5BOFA 3AXKA 3B8SA 3N25A 4Y6GA 3TK7A 3NOYA 1H51A 1ZJIA 3QV7A 2NXIA 4OJYA 1EX1A 3W53A 4GH3A 2X0YA 3O6YX 4KH2A 1J11A 4PCFA 5H8UA 2XSXA 3WY1A 4G1NA 3C2FA 3QY8A 2QJGA 4RV3A 3W85A 5FAGA 1K1DA 3MKVA 1RP8A 4E2OA 2JKEA 4CCZA 4AB4A 4W93A 3W81A 1XYBA 1QUMA 3ANYA 4DYEA 3UETA 3H26A 1E15A 4HZ7A 1JAEA 3NQ7A 1HNYA 4IXXA 4X60A 4LVDA 1LLOA 4D6JA 4B2DA 3AIWA 5U7SA 1D8WA 3RYSA 1UIPA 2JBMA 2WC4A 1TPDA 3YPIA 3C8FA 4Q22A 2WM1A 5C2CA 2NWSA 4XD3A 4AD5A 1QNSA 1K7FA 3WDRA 2WSPA 4HN8A 2P88A 3NNTA 3STEA 3IVTA 4C1NA 1RD6A 4F9DA 1R30A 2ZKMX 4GNVA 3OBAA 4WDXA 3QGKC 1OK6A 5FD0A 4JNZA 3RILA 3G1YA 5J5DA 3EPNA 1D8CA 3VD3A 3DDMA 4HCDA 4EPDC 5CAHA 1OFRA 1H4PA 4JCLA 4NJIA 2Y62A 2F6KA 3L23A 4MUZA 3GG1A 4E2VA 2Z1KA 3DCPA 1EO5A 3I6RA 3F5KA 3WLHA 4H83A 1UIOA 3K5XA 1U5HA 2HS6A 1VR6A 5KZDA 2FVLA 3WQPA 2XGIA 3S0CA 3OVPA 1ZP4A 5HNRA 5CZJA 4LJ3A 3B05A 1S3TC 3L2LA 4LYRA 2X41A 2RAGA 2QVNA 1EFZA 4DBWA 1SFSA 3P80A 1EIBA 5EL1A 1XLJA 3AROA 4YS1A 1OC6A 4LC8A 4AIUA 3LGEA 1A3XA 2ZZ7A 1KR1A 1YPXA 1KM4A 4Y96A 4JTLA 4YL2A 5LYRA 2J88A 4M0XA 2CXEA 2NV9A 4IGNA 1WOAA 4A2RA 3TSMA 1B3ZA 4GVGA 2ZX8A 1XISA 1W9UA 4H6KA 4J3WA 1E6QM 4IG2B 3OLEA 4IQDA 4GY0A 1FWRA 4RR4A 5HNUA 3N2CA 3DIPA 3LPPA 3WQDA 1AZ1A 4PMVA 3PSVA 5LIUX 4ZQRA 3GBDA 1ICSA 2TRSA 3P3BA 1V0NA 3WNLA 5DY2A 3HMJG 1H09A 3TC6A 4FP1A 4DNHA 3AYTA 1AMYA 3AS1A 4KWWA 3CQKA 2PDMA 2E5DA 2WNWA 3SUTA 2OLAA 3W73A 2A7PA 3S3GA 1VH7A 1Z3NA 4O52A 3DG6A 5AECA 1QI4A 4H9VA 3DBPA 1DORA 2PC8A 5CSRA 4BI7A 2VP8A 1KW1A 1EXPA 2V81A 4WIWA 4FXRA 3AXMA 1FWHC 1DQXA 5CBJA 1X8FA 4ZCWA 2YJQA 3AMCA 5A69A 4H9MA 3TTSA 3DHDA 4J2MA 3W28A 2QDDA 2DSVA 1D3HA 3TP4A 1XYLA 3SZ8A 1GW9A 5BMWA 1M04A 2R1KA 3M16A 4KCVA 1JGIA 4MF4A 3V18A 1BAGA 5A94A 1DJGA 1KXHA 3PJXA 2XIIA 4U28A 1BXNA 4PSRA 3ZM8A 1WKEA 3WBWA 3N4EA 1M41A 4KRZA 3WF0A 4XK2A 2QCEA 5HNNA 3PK7A 5I7GA 3WMSA 4UR9A 2A3LA 3CL8A 2CBVA 2PDKA 1OG0A 2P8CA 4A05A 5CC6A 1OD0A 2I57A 3RX3A 1RQHA 2XINA 1N55A 3WJYA 1DE5A 4H6QA 3S5NA 1TJ0A 1NFGA 2DIEA 4B3KA 3LI0A 4MKSA 1LUCA 3BL3A 4PCNA 1ZB5A 1D3GA 4JTSA 4MYXA 1UBSA 2R24A 2WNQA 3CPGA 4ZTYA 4AF0A 2X42A 1I2OA 4DPQA 1DKWA 1MW3A 3HFTA 5DELA 3SJ3A 2CHOA 1KFBA 5G4HC 1UB3A 4AY7A 3OW1A 2WPBA 1E4LA 4M81A 5F1VA 1S2AA 2NXHA 3HFYA 2WOQA 2Y2WA 2EPOA 1SVDA 3A3XA 2C0AA 2AAAA 3ATZA 2HK0A 4RE4A 2XPKA 4Z17A 4AD0A 3CU2A 3INPA 3L5AA 3V3WA 3W7LA 1BGGA 5AC7A 1UD2A 3WQCA 3E02A 1ZBKA 1HP4A 3GAKA 1TX2A 2WSRA 3QV8A 1P1XA 3NQCA 4JNYA 4QE5A 5BOOA 1UR3M 2V38A 3UJFA 1G7VA 2VT0A 1H41A 1HZYA 1RQEA 3M64A 5REQB 1M65A 3UG5A 5BZAA 1K6WA 2QVHA 1A5AA 4G6CA 1WQ5A 4HPGA 2YSWA 1G7UA 1AA1B 1K03A 2GOUA 2VGGA 1I6NA 4DWSA 1KWKA 2PWEA 3SQLA 1QJWA 2BY2A 1G67A 3H2MA 4MGGA 3VNJA 3EMQA 5H1WA 4KWVA 5BNKA 2CWXA 3U9IA 1KR0A 1JJKA 4BQ2A 2XVNA 3WLRA 4OUEA 3CTLA 2XUCA 3MKCA 1CGXA 1ALDA 4LQ1A 3LERA 4O1AA 4IIDA 3SR7A 3UPMA 2GVEA 5BRPA 3PTDA 1EWDA 1GOIA 1K4GA 1KBIA 1WZAA 3LLXA 5A6TC 1Q13A 4J2PA 5GJNA 2VGIA 3WFLA 2J6XA 4Z1DA 2WCGA 2JKAA 2WJEA 4PCPA 4IP5A 3U6WA 1RBAA 1LT8A 4F2BA 4PTVA 1LQ2A 4Q6XA 1YNYA 3WLMA 1Y65A 2XZ7A 2OPJA 5LA0A 3AXHA 3S2LA 3A64A 2F6XA 2R91A 4NXKA 1W2VA 1PCWA 3ES8A 4GFIA 5A6JA 1XWYA 4GO8A 2YA2A 3BO9A 1XLBA 4YVXA 1BVNP 2PE4A 1OF6A 3I7QA 4KBXA 1YXDA 1KV5A 4DBDA 3UWQA 4US6A 4L1GA 2XIQA 3WD1A 3EGJA 3MO4A 1KTBA 3EOSA 4BWLA 1FFQA 3AS3A 1U33A 2J24A 3S9IA 1V6TA 1J01A 4NXSA 3S1VA 3TU9A 5CGQA 2QCCA 3PHAA 4AEOA 1PVNA 1NSJA 3WQ6A 3TYBA 5AZ0A 1F6YA 5IBXC 1BFNA 1SO6A 2CBUA 4JYEA 2PDXA 3GVVA 2F6UA 1Q65A 3G1FA 3N9RA 4IMCA 1ME7A 3EWXA 1V93A 3TTQA 3BE7A 3P81A 2AQVA 2C1IA 3ZFHA 3V0SA 3PZVA 2WCAA 4ORMA 5EMYA 1KTNA 2NSXA 2EEXA 2OVLA 1EUAA 2VTFA 1Z7AA 4OQVA 1UWAA 1U5VA 1AG1O 4TX6A 4B5UA 1GYLA 4WLCA 1UD8A 1OHLA 2C18A 1JDCA 3O6AA 5FJIA 1Y0EA 3GXNA 1MEHA 3QSTA 1B1YA 4XZWA 4XZLX 2PC4A 2QF8A 3BZJA 4JGDA 4ONVA 4PMYA 5A8OA 2G3IA 3VD7A 4QS5A 3WL1A 1PUDA 1E4NA 4JX5A 3AHYA 3UW6A 4QITA 3ABOA 3EWDA 4J3ZA 4HJFA 4GJIA 1UH2A 2VL4A 3QMSA 5LXXA 2QIWA 3H2OA 4XAFA 1EYWA 4MJMA 2CZDA 2DW6A 2VX7A 2XVPA 2W6RA 2V2DA 3BAIA 3UJEA 4E2DA 2BXZA 4NX0A 6REQA 2OOGA 4NILA 4AY8A 4AD2A 1FWAC 1T7LA 2J9YA 1P7TA 4XQ6A 4O14A 4AEFA 2VYOA 5E70A 1HL8A 3URQA 2D1ZA 3UZZA 1C7TA 3OTRA 2H8XA 4ATWA 3ZT6A 2CITA 1F5ZA 1C29A 1GYNA 4IJCA 2BB0A 1RLDA 3IJLA 2GGEA 4H8NA 4JEJA 1YRRA 3L4UA 3LPOA 3W6YA 5JUVA 4QTGA 3UPBA 2PDWA 3H55A 2X1SA 3UY8A 4ZFCA 4HU4A 2FGBA 4UOZA 4RDWA 1WNOA 4O0ZA 1TMHA 5I07A 3S9ZA 4Y9PA 4HZMA 4LF1A 3WEOA 3W1RA 2W67A 4CNTA 2OR2A 1VIZA 3ARWA 2X16A 1GPFA 3B8UA 4V2XA 1DL3A 4K1GA 4GHRA 3S6TA 3GXDA 1ZAIA 4AYGA 3BH4A 3M6DA 4I6KA 3F2CA 4MWAB 3W24A 1OWQA 4HK7A 1GVQA 4ML9A 3STCA 3WQ8A 4DO5A 2P1FA 3IAQA 5CQ1A 4AIBA 1ZSXA 3CWNA 1VEMA 5H8PA 4PMDA 2XH7A 5HJLA 3LTYA 5I3FA 3UERA 4JTKA 2OZTA 5KZMA 1VPXA 4C65A 2E1DA 2YIHA 4MY8A 3P8IA 1FWIC 4M24A 2OX4A 4OZOA 4UTFA 1JCNA 1XFCA 3W7CA 4P2VA 3KS6A 3WYZA 5BRQA 5BYWA 3G6MA 1P0BA 5L6UA 1IEXA 2DVUA 1QNQA 3LX9A 2WNZA 1TZ9A 3O7UA 4G7FA 1L2UA 1TZZA 4GFSA 2XHYA 1S3HA 3OEXA 3A9BA 4NI8A 4HNOA 1A3WA 1THFD 3KE0A 3O8AA 4D2JA 1GCYA 1UBPC 5CC5A 4F4RA 4IQJA 2OGYA 4O12A 3L4VA 2YCEA 5F2IA 4FLSA 2NQ5A 1EWEA 2QAPA 3OLDA 3AU2A 2I1OA 4XSLA 1U1JA 1X6UA 4GYPC 1I0BA 1SJDA 3DAQA 4PB3A 4IQEA 4I7UA 4JQ3A 2C8NA 3G3DA 4DO4A 3LOTA 3CQIA 1A49A 1PKYA 1S5MA 1YBQA 2NVDA 1OFQA 4QLJA 2A21A 3WQVA 2WNNA 3SCVA 3VKBA 4M8UA 1LWJA 4Q8TA 3AALA 1DP0A 1TREA 1V6XA 4O8AA 2XVLA 4WGXA 5E0FA 1G0CA 3SCOA 4XIAA 4GC4A 1PE1A 1NDVA 4DN1A 2J62A 1QWKA 1UR9A 3EOOA 4KWOA 3TA9A 1EJ7L 2FZ9A 3VE9A 2FIQA 1XLEA 3NFUA 3BLEA 2Y88A 2BMBA 2R94A 1RALA 3PZNA 3GSMA 3QTGA 4EPEC 1JPKA 1LG1A 4N6FA 3AIBA 4MPQA 1G01A 5HDRA 4Y90A 1YTKA 1DE6A 5AVHA 3TJ4A 4HA1A 3T0AA 2PGFA 4A3RA 1E1EA 4TXEA 4Z08A 2G4JA 4DO6A 4IM4A 3HMCA 4P7LA 3P5YA 2IKGA 3O15A 3OB8A 1H61A 2C14A 1ISXA 3M0VA 2FPTA 5FAJA 1V4YA 4LW7A 3TXZA 4V33A 5E6ZA 2GJPA 3HQPA 2WSYA 3QLDA 3OZPA 5JXQA 1GEQA 1KM0A 1HUVA 4E6MA 1LLZA 4KRUA 5E1QA 2PTWA 4ZE5A 4JNMA 3LZ3A 3N13A 3TW9A 1ONWA 3TJLA 1ZFJA 3CUGA 2YXXA 3RX4A 2OZ0A 1E71M 2QJMA 3GNXA 5BROA 1I75A 5JBFA 4QGCA 2ZUVA 1GOXA 2YW3A 1GT8A 4LS2A 2RGLA 3B9NA 3UXDA 1X6NA 1KFEA 4G7EA 5C7HA 3E5PA 4F2UA 5I0DA 4GA8A 3SFWA 3LM7A 3MMWA 2Y89A 2WMKA 1P6WA 2RUSA 1G9HA 4ROQA 3AS0A 2DZUA 2ZQ0A 4HA4A 1EGVA 1SPQA 3TYZA 3H22A 2BLEA 2WJZA 2PDJA 5H6HA 4D1JA 3AUOA 4LUIA 3R13A 1WDSA 5KSWA 3QQWA 3B8WA 1F3WA 1E51A 4NZJA 3IIOA 1KXQA 1FWJC 1V51A 4M6QA 1UA7A 2OYLA 3AIQA 1CBGA 3LEPA 1DWAM 3MSGA 1J12A 4W7WA 1DV7A 2ACSA 2GDQA 3E0IA 1TYGA 5IOBA 4WK9A 3MUY1 4RV8A 4B92A 4S38A 3PJUA 3VGEA 1HVXA 1EF2A 4HU8A 1KBLA 2ZRWA 4IJRA 2XVKA 4H8VA 5FJPA 3W29A 5BXPA 2D23A 3APTA 5BWFA 2QV4A 6TIMA 3MCMA 1AJ2A 3O1NA 1ADOA 3TZNA 1JFHA 1GJUA 3BOXA 4AVOA 3W2LA 5BXTA 2XDFA 5T91A 3TQPA 2PLMA 3W26A 4F79A 2PU0A 3KCOA 1PPIA 3QHOA 2PZNA 2W62A 4CNOA 1POKA 4Q4OA 1CTNA 4DBUA 3LQGA 1ZENA 2EF9A 4C6JA 3IVSA 2BTMA 3GH5A 1WKDA 2QZRA 4LB3A 2E28A 4K36A 1XDJA 3E2QA 1JYWA 3FVMA 1QASA 3BMWA 3HGJA 4BCEA 4JTDA 2DJLA 1DQUA 1Z9AA 1EGZA 1L0PA 3PZ9A 4O57A 3WQGA 2D2JA 3VZXA 1TCDA 2HXTA 1NDYA 1QATA 1DIKA 5EBAA 4HBKA 2CZ5A 3A4JA 3RO8A 3U4AA 3SRDA 4XWUA 4PUJA 3SY8A 4IWWA 4AIEA 4BQ5A 7PTDA 1KB3A 4L6HA 3VIJA 3NTYA 1QMLA 1UQZA 2PLJA 4AZIA 4JFVA 1K4HA 2IPGA 2ACUA 5FJOA 3KBVA 3T2QA 4U2ZA 3OVRA 4MJ4A 2GVJA 2YLLA 2OLHA 3EEGA 2AGTA 3LN3A 4QE1A 1G4EA 2D3LA 4HNNA 3AI0A 4UTWC 3CHVA 4YWIA 2E0PA 3EOEA 3M0ZA 3AIRA 1KA9F 4FF7A 2QQ6A 3KAOA 1KGWA 4O8RA 5I2UA 3UVIA 1OIFA 1X39A 1ZALA 3GU1A 3QYSA 3N2XA 1FP8A 4LVGA 1S2CA 3CHDA 1GORA 3KOYA 3OU8A 3ONCA 3RGTA 4E5TA 4UZSA 4MWAC 2QAFA 3EDKA 3KOFA 3QPZA 5HANA 3CHFA 4MOZA 7TIMA 1TIMA 4BQ3A 3N18A 3GDTA 5CLTA 4ACZB 3PUGA 1X38A 5KZEA 1SMAA 4YIWA 3LTPA 1LBFA 1XRVA 5GNXA 3PPHA 2VMFA 1BSLA 2O9RA 4DHGA 4UTTC 4AC7C 3GNNA 2BS9A 1E56A 1HO1A 3OZMA 3H53A 1SZNA 2OSWA 3VMOA 2WSQA 2PDBA 3LG3A 1PV8A 1H49A 4YTQA 3TYCA 2QR6A 4NYYA 3O07A 3N6QA 2C1GA 3T9PA 4H9YA 3ENLA 2OT1A 1LBMA 4ZSTA 1Q6DA 2FZNA 3IWPA 3F4WA 3G24A 4FB7A 2FDMA 2V3DA 4EWJA 3DX5A 2WLYA 1JYVA 2JF7A 2FZBA 2D2HA 4WKAA 1CB2A 1EPVA 1UWSA 4TQTA 1YXCA 1VBUA 2J9ZA 1L6GA 3TMQA 4JIEA 2Q3OA 2HMCA 3B40A 4X2PA 1VRXA 2BX7A 1OC5A 5GNZA 1W6TA 3N9SA 1PWLA 4F40A 5CSSA 4D71A 5C55A 5DX7A 4PTNA 5CZTA 3V75A 4MYAA 3TFXA 3AJ7A 5DF0A 1R3SA 3NOEA 3ZWTA 1G69A 1V6YA 3IJ9A 1OK4A 2X1IA 5JH2A 1H7RA 4FSAA 4PA8A 2QXWA 3M07A 1GPWA 2Q6ZA 5C8BB 3PULA 2J7EA 2W79A 3WF4A 1IT8A 3FHAA 1TV7A 3M44A 2CEQA 3H7RA 1HJUA 3THUA 1QPRA 1KNWA 1PX8A 4CQAA 3SUWA 3GTFA 4IH3A 2ICSA 3GX9A 3FEQA 3NIYA 3B97A 3UYIA 2Z27A 1XYZA 1TPH1 2DORA 2WK2A 1L6WA 2NV1A 3UBPC 4H7VA 3CUFA 2YCIX 1F4HA 1V3HA 2YL6A 1F73A 5C70A 1V02A 2WJDA 3SO7A 3B06A 5GJPA 2IPFA 2HE5A 2FJKA 3TC3A 4P5UA 4BF5A 1PHQA 2PWHA 1G4SA 4XAYA 4E8GA 4AF0B 5AYBA 1I1XA 4O0QA 4RNJA 3LI1A 4M7TA 3SEPA 1BHGA 3A4WA 2GJNA 3ITXA 1CXIA 1Q6FA 4WQ6A 2YXGA 4ZO7A 3WZ0E 1SSGA 2GUUA 3VTRA 3QR3A 3U2OA 3L0GA 3URAA 4S3BA 1VEPA 1E6ZA 1QNVA 3L21A 4A2SA 2F84A 4AWTA 4UFKA 3T8QA 3RM9A 1W8SA 3SCPA 4S2CA 4RUBA 2ZX5A 3LUTA 4H8UA 1GQIA 5CG0A 2Y5EA 3TTEA 2QCDB 1C7SA 5A6SA 3PFRA 1K9EA 3WBYA 3QY7A 1E6RA 1CW2A 3LY0A 2RJGA 5BMXA 1EEPA 2XZ9A 3CAVA 3PTMA 2ZUNA 2VEFA 4EX4A 5ABEA 3GHSA 3NYZA 3GXPA 4C1LA 2Z28A 1QT1A 3K4WA 2VR5A 3A9IA 4UNIA 1OZQA 1A4LA 1V7YA 2Z2UA 1OJXA 3QR0A 1OFPA 2W27A 5CEWA 2IKJA 4IMFA 4PMOA 3M6YA 4GH1A 4JDYA 4HN4A 2I56A 1QBAA 1V6WA 2NVCA 3W72A 4IX0A 1DVJA 3NAVA 1NF7A 4IFKA 3MJYA 4C6CA 3MCNA 2FB3A 2DU2A 3TMLA 1JDAA 2JALA 3FW6A 1DJWA 2Z1VA 4MADA 3GUWA 1OGSA 1IF2A 2ZZ2A 3GBEA 5BCAA 4KS0A 5JIWA 2QEZA 4D8LA 1F07A 1H11A 4ZTXA 3UY7A 1P4CA 3S6DA 3EXRA 2HWGA 4FR6A 3EWUA 3LYEA 2EPKX 3W3OA 1CIUA 4WKFA 3KEHA 1DJIA 3ZO9A 4PTXA 3LBOA 3GFZA 3VNMA 3VABA 1ZBWA 3DZ1A 4FMVA 2HVNA 2CYGA 2TAAA 4UWMA 3OYXA 4LOCA 3AICA 4OIFA 1LL6A 2XIBA 3VCRA 3W2MA 3EPOA 5CGMA 1PKMA 4BZYA 5M3WA 2MNRA 4PUUA 4PODA 3WFZA 1GVRA 2QCNA 1NOFA 1WB0A 4HA0A 1CGVA 3HF3A 4JQAA 4GGBA 2VRQA 2CWNA 3VC6A 1VPQA 1Q8AA 1OC7A 1J93A 4QISA 4PEKA 4LWWA 2A6NA 3QSRA 2ZA2A 2W9MA 2ZADA 3P82A 1U2YA 3PS7A 4GCAA 3QRHA 1LL7A 1JYXA 2CLFA 4EWND 1NWSA 2PWGA 4L56A 2B4GA 1RK6A 3NEVA 4XD4A 4S3AA 2XTKA 4H00A 1BRLB 4JN6A 1XPYA 4NZ4A 5H2ZA 4LSBA 1OX4B 1TE1A 4Z2GA 1N8WA 3Q2DA 4DPPA 3G8EA 1FCUA 4W88A 4D8ZA 4NAEB 4EIVA 4LAKA 1E1CB 4JTCA 4Q8MA 3B9DA 4Q4MA 4TTGA 3HPSA 2Y7FA 3IJIA 3VIFA 5TQLA 5LGXA 1CEOA 4EP8C 4CKQA 1L9WA 2EG8A 1XBZA 4AHPA 2F38A 3DG3A 2R1NA 1QI0A 4YVVA 2PWVA 4WOQA 1AQMA 2A4AA 2J25A 3CXOA 3AMDA 3FA4A 5BU6A 2BASA 3RPDA 3VD4A 4Z0SA 1VHCA 3NZQA 5T26A 2IKIA 3BDKA 2X8RA 2PP1A 4ROPA 2PDYA 2ZDRA 1CCWB 2P10A 2OB3A 3W2UA 4NUWA 3IV3A 2FHFA 4L61A 4CUCA 1PWMA 1F76A 2ZUTA 1NARA 4ZOAA 1Q7QA 1UASA 2GGGA 3R0UA 1W5OA 3W2KA 2G97A 3UFYA 3IACA 3NQDA 4HCHA 3TQKA 1UP0A 1XJBA 5FL0A 2ZFAA 3KHJA 2VURA 1CENA 3ISIX 1VBRA 3DFOA 3MBDA 2WWDA 5D8ZA 1KXTA 2XU2A 1XC4A 4KERA 3WENA 1V0MA 2DP3A 4GUGA 4ADTA 2VNCA 1M68A 3MHGA 4LRSA 3SCNA 1CLVA 1DJNA 3WUFA 1BWLA 1MYRA 3DFQA 1S5TA 2VHLA 3UXKA 4IXHA 3WDPP 5HQLA 4EF8A 1VFOA 5C7VA 1EHNA 3RITA 2J7FA 4LS1A 1UWIA 3ARQA 4NAFB 1J79A 3EA2A 3P7YA 3W1TA 1SR9A 1C92A 1VS1A 3BICA 1EYEA 1TWWA 4GE8A 5JBDA 4Y8EA 2X0HA 1E9IA 5TF0A 1VKFA 3V1PA 3PB0A 1JRBA 3BC9A 1EQCA 1QHOA 5DRCA 1N8FA 4FR1A 3GC5A 2H3DA 1FVPA 1ESWA 4U2YA 2VOTA 1Y7VA 6ENLA 2WMJA 3LCWA 1Q6QA 3GC4A 1UMLA 1RV8A 1GZJA 3SUSA 4JIPA 3TZFA 4X3ZA 1A50A 5EU9A 4EF9A 3E9AA 3PG9A 1ITXA 4HTBA 3KZPA 2PTZA 1C8YA 3WD3A 3CLMA 4X63A 1ZGDA 4JOMA 2H3BA 4MKVA 4XUYA 1I45A 4PZVA 1I2PA 4R9OA 1V03A 2VUNA 4JTIA 6A3HA 1BYBA 2IQTA 5I3JA 1LRNA 3HZ3A 1FUYA 2PRLA 2G50A 1DXIA 3MSDA 3MUCA 4WXZA 3FSTA 4GZIA 1UUOA 4PUDA 3B03A 3LCGA 1YBQB 4LS0A 2J8FA 1W1B1 7A3HA 1LLWA 3C0QA 4PUNA 3ZR5A 4LCRA 4AXNA 2O7SA 4L4OA 5AHNA 4KW2A 4PL1A 2OSYA 3VKJA 3ARUA 4HU3A 3WD4A 4Y9AA 3LXBA 4L9YA 4YJ5A 3T44A 3KVKA 5D2YA 4GYFA 3HGRA 3CYVA 3RMJA 1ADSA 1XLCA 3BG3A 3PP7A 3BTNA 2VRJA 4MB5A 2QHAA 1UD4A 3I6TA 3HV9A 2VQTA 3NSMA 3D0CA 3TYDA 3VNYA 3KFTA 3RX2A 4C7FA 1FWNA 4L9ZA 3U5UA 3EOLA 4OOZA 1LL4A 3B0XA 3CIXA 3RPMA 1B3WA 1QW7A 1FWFC 1HIZA 2KZHA 3VIMA 3HO8A 3TN3A 1TWZA 1RCOB 2AQOA 1JXKA 3EOUA 3DUGA 1Z6KA 4UMBA 3KCJA 1O94A 1KCZA 4D8AA 2ABBA 1US2A 3KBWA 4Y7EA 4F66A 3AS2A 1FHVA 1M7PA 3F4NA 3S8HA 4TV5A 3K1GA 5FCZA 5G4WA 1R87A 3CUXA 5D8WA 4UTKA 3CZEA 5AHIA 3TKFA 3LTSA 4OBTA 5IBXA 1RVKA 1OGGA 2AL2B 1IZKA 3DN5A 4AD1A 1TA3B 3G0XA 2PI6A 1JCLA 2Z1BA 4LYQA 3MZ2A 2UZ9A 2QUVA 4GYKA 1QHPA 4JX4A 1UWUA 1UP2A 3HQNA 3PZTA 1TX0A 5HQMA 3VOHA 3N14A 2XH2A 1W3IA 1UQYA 2VZOA 2OQHA 4KGLA 2GDVA 5LXEA 1PZ2A 4JIIX 3HIJA 3G18A 5ABGA 4FIRA 4QJ1A 1XIJA 3W83A 4RKAA 3NL5A 3VGFA 2ZA3A 3SCTA 3KVJA 5D04C 4B4HA 4F0MA 5LA1A 4I9AA 3UXAA 1CB7B 1HJWA 2POZA 4J3VA 5G1YA 2EPHA 1IT7A 2WMFA 2PGRA 2YCJA 1N7KA 3OGSA 2ONEA 2H9AB 4IG2A 4F0HA 1EC9A 5EFDA 4CNSA 4W84A 3G1HA 3C2YA 4LTSA 4AWEA 1HJVA 3UU0A 1NFBA 1R5YA 3DXIA 5A8MA 1P43A 1XLGA 4S3KA 5FA5A 3MB9A 1JCTA 1ZU8A 4DJDD 2WVVB 2E9LA 3FCPA 3OA5A 5K9DA 4DUVA 4XZIA 3MUIA 3BQ6A 1D7KA 3V0UA 4DF2A 4E2BA 5BXRA 3UGVA 3DFPA 2XWEA 3I4EA 5TD4A 3R10A 3LRMA 2ODOA 3LHZA 1YIXA 5I3HA 3VIKA 2J8GA 1WPCA 2PTYA 4AISA 3KS5A 1TUFA 3ZYZA 1H1YA 3UZYA 4LBRA 1VYRA 3M0YA 2GSEA 2NQJA 2ZCGA 3RJXA 3GYCA 1R9ZA 4GI4A 4O4VA 1MZRA 3WH6A 4E4PA 4GIRA 4C6LA 1JI2A 1TCMA 5EMLA 1EP2A 2X7VA 2PBOA 1UCWA 4AHQA 3MP4A 3GAYA 1IR2A 1IXNA 1R7AA 3A3WA 1KQZA 3H54A 3J7HA 2ZUSA 1PBGA 1T96A 3KBMA 4IGMA 2QIIA