4IMGA

Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-glycolylneuraminic acid
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
293
structure length
293
Chain Sequence
MKNLKGIFSALLVSFNADGSINEKGLRQIVRYNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDEIALIAQVGSVNLQEAIELGKYATELGYDSLSAVTPFYYKFSFPEIKHYYDSIIEATGNYMIVYSIPFLTGVNIGVEQFGELYKNPKVLGVAFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTQAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLDGVEAGYCREPMTKELSSEKVAFAKELKAKYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylneuraminate lyase
publication title Structural Basis for Substrate Specificity and Mechanism of N-Acetyl-d-neuraminic Acid Lyase from Pasteurella multocida.
pubmed doi rcsb
source organism Pasteurella multocida subsp. gallicida
molecule tags Lyase
total genus 123
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2013-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4imgA00
3LTYA 3H55A 3LLFA 4GUFA 2X16A 3RF9A 2B0MA 4M5PA 3GX9A 3W7QA 4A29A 1LRNA 5AHEA 4MYXA 3W7MA 2A2IA 3CIWA 5MHBA 3SZ8A 3L66A 1R47A 3O16A 3L65A 1RZMA 1RV8A 3MI2A 1TIMA 1LTDA 4ZQMA 3IGUA 4AHPA 4LVAA 4ZQOA 4Z1DA 1YXDA 1M5WA 1Z44A 3USBA 3VE9A 4K6AA 3V75A 4JX6A 3MWAA 2XN1A 2BTMA 5BMXA 4WOZA 4AHOA 4JYEA 2Z6JA 4MZYA 4AAJA 1PCKA 5EL1A 5KMYA 2J9YA 3NPVA 4JDBA 3EWUA 3W1RA 4ZMGA 2R91A 1OYCA 4BI7A 2A85A 3INPA 1L2UA 1D3GA 5DBUA 2YXGA 3EWXA 3HIJA 1EX5A 1KTBA 4JGDA 3EXRA 2W6RA 5HUOA 4XKYB 5I3KA 1BWLA 7TIMA 2Y7FA 3BG5A 5AYZA 3GR8A 4ZZ9A 3SI9A 1PE1A 3B0VC 3LTSA 1AL8A 3L0GA 4YCOA 1DBTA 5AB3A 3PR2A 5HWNA 3DHFA 3OG3A 4JYFA 1HO4A 1K02A 4O16A 3WJWA 2V5LA 2FPVA 4OU1A 3SIZA 3PUDA 3A22A 3G22A 3M7WA 4IX2A 1MEHA 2A4AA 4QNWA 1WOBA 3W84A 1PHQA 1GZGA 2DJLA 4U4MA 2GJLA 4D2JA 3W7CA 1Y0EA 4O10A 1X8FA 3W1AA 1UCWA 4IUOA 3RMJA 1B57A 2F7FA 3YPIA 1ME9A 1I2QA 1TJPA 1Q3NA 4RXGA 4JTSA 1KFEA 2ZRXA 4YL2A 4JR5A 5BOOA 5DCDA 1LRTA 2ZRWA 2QAPA 3P8JA 4L4LA 4NJGA 3KAOA 3ABSA 1P1XA 5AHIA 1SZEA 2RFGA 3UWVA 2V2CA 3QW4B 4P61A 4X3ZA 1NEYA 3M6YA 5D2XA 3DFQA 3GIYA 4MY9A 3VE7A 1CI1A 4LS0A 1FCBA 3TK7A 1KM5A 4PC8A 1M7PA 1W37A 4O12A 3EX6A 1XUZA 3TFXA 3QPZA 1O95A 3W7RA 2E09A 1I2NA 5FF0A 3UYCA 3RLVA 1O4UA 1YXCA 1KM3A 2TMDA 3L5AA 3BGGA 2ABBA 1T0OA 4UMCA 1TYGA 2WNQA 2H3BA 3C2FA 3CHVA 1JCYA 1CW2A 3EWZA 2E68A 3TJLA 3KX6A 1IGSA 3FS2A 4LV4A 2EGZA 3C4UA 3GVGA 4KWWA 5DCEA 3FJ6A 2NV2A 4FHAA 1RD5A 3MBFA 5CPLA 3F4WA 3NOEA 1QOPA 2HTMA 4MLRA 4UTKA 4CLMA 3GZ3A 2NV1A 4A3UA 1KV5A 2YZRA 1F6PA 3DI0A 2B7NA 4WUIA 3A9IA 5AYYA 3PSVA 3BPWA 3N14A 4PA8A 1GEQA 3LCXA 3STCA 4WD0A 4I7WA 3A24A 4O1AA 3GNDA 3IV3A 3PG9A 4FB7A 3BG3A 1GG1A 2BX7A 2JGQA 5AFDA 4QITA 2B4GA 5D2WA 5DXXA 2J9XA 1K03A 3TC7A 4A21A 3THQA 1AG1O 3KXQA 2RH9A 1X7FA 4BI6A 5KZEA 1KBIA 1EUNA 2DZPA 3NGJA 1FWTA 4RR4A 3RFAA 4DF0A 1TPB1 1VYPX 4NT0A 4YWIA 4MUZA 3NQDA 3N9RA 1F73A 4GUHA 3W86A 3P7YA 1JULA 3I7SA 1ZAIA 3QH2A 1R46A 4JDYA 3SFKA 3MP4A 5G4WA 3HPSA 2FFCA 1I2PA 3STFA 1DORA 4JTEA 4S1FA 2I1OA 3NQ8A 5E0KA 5C6MA 4AEOA 3MI3A 1H7WA 2B7QA 3NQEA 3ABOA 2QCDB 1ZHAA 3JRKA 3PB2A 4KFPA 3NQ7A 4QNEA 3HPZA 1OFQA 1B3OA 1ICPA 1G7VA 1HL2A 1HFBA 1IIGA 1Q6LA 5BRBA 1KFKA 3LRMA 1DJQA 3R2GA 4RKAA 2HSAA 3LGEA 1FUYA 1EUAA 3DXIA 2X1RA 4CQ9A 4O50A 4OE7A 4W9TA 1VPXA 3FKKA 3VKJA 1NFBA 4HHPA 3UWYA 2OZ0A 4HPXA 3W7DA 3TW6A 3W1NA 2OCZA 2DORA 3TC6A 1XXXA 5DY2A 1XC4A 5A5WA 4HIBA 3DH7A 1P5BA 4FNPA 1H5YA 3FIGA 4IMGA 5F4WA 3N2MA 1JQVA 1GPWA 4EF9A 3TJXA 4O54A 1UBSA 2ATMA 1H61A 1K7XA 1YADA 5CZSA 4UNLA 1TPDA 2CWNA 3TFCA 1N8FA 3Q58A 4XUGA 1RR2A 4A22A 1E51A 2QCMA 3M5VA 4DQWA 3NQ2A 1VH7A 1A5CA 1QMLA 1VS1A 2C0AA 3I6RA 5LNRA 3LHZA 1GJPA 3HGOA 1EWEA 2BZNA 5FI8A 3PUEA 4X22A 3WJZA 4NQ1A 4OQVA 1T8XA 5C55A 3TROA 1TTJA 2GQ8A 5BW6A 1MSSA 4EVZA 3HOJA 3GDMA 5CPMA 1TO3A 5LGXA 3FJLA 3OVQA 1SO6A 2WQPA 4N9DA 2WSQA 4AWTA 3W6YA 2A7RA 1Z48A 3DFSA 4HNTA 1EP2A 3F03K 2QAFA 1H50A 3WJSA 5K9XA 3P74A 1KFLA 3E9AA 3B06A 2OJPA 3C56A 1N7KA 4POCA 3N19B 1QAPA 4HNVA 2ZYFA 1IXOA 3MYOA 5H2ZA 2QUTA 1JCLA 5A8GA 3S1UA 3SY5A 3TSMA 4RJEA 3HF3A 3PAJA 1ZCOA 1L9WA 5D33A 3U6WA 1YDOA 4JTGA 4E2BA 1GTEA 1I45A 3TR2A 2QCCA 2NUYA 3DFOA 2CU0A 2YYUA 3G8EA 1QNVA 4JD4A 3KVLA 3B8DA 1XDLA 3TAOA 1UASA 3G1SA 3TMLA 3TIMA 3CWOX 3LOTA 2VFDA 2W79A 2DJXA 1A5AA 4RLIA 1JCXA 2JGYA 2B7OA 1W54A 3L2IA 1AL7A 3G0XA 5HWMA 1BWKA 3T4CA 1H1YA 3EXSA 5D38A 1ZALA 3TNOA 1D3HA 3STGA 1LOSA 1KLYA 3B4UA 4NXSA 3W75A 2RHGA 1TPWA 1K8ZA 3TAKA 3VI2A 1TRDA 1H7NA 1H7OA 3O6YX 3VNDA 4MZ8A 2PRHA 3QEZA 3P80A 2WNZA 4GXMA 5CZ0A 1FWSA 1QOQA 5LNWA 1OFOA 1FDZA 2CZDA 3S8HA 2FPTA 5FF4A 1M7OA 1XBYA 2X30A 4PODA 3NEVA 3WJYA 1YTDA 3GNNA 4UFIA 4B5NA 5LHFA 4C1LA 1N55A 1H60A 1PS9A 3W1XA 1XI3A 4JY9A 3W87A 2GUUA 2I9EA 2F84A 3S5NA 3RNDA 3NVTA 3M41A 2BLEA 3BW2A 3P62A 5I3HA 1TQJA 4N9CA 3OEXA 1OFBA 2QCFA 3SGZA 1TQXA 4CNOA 1ME8A 2QKFA 3W2NA 2BSLA 3TX9A 1V7YA 3IIVA 3LB0A 5D02A 2VEPA 1C9DA 2DZSA 2E5DA 3EWWA 1WQ5A 4IMDA 2WNNA 4O4WA 1RPXA 3GKFA 3H53A 2VEIA 2H8XA 5FEWA 1W31A 4LVDA 4Z08A 2GVLA 1ICSA 3LHTA 3BW4A 3CEPA 4NU7A 5ABTA 5KITA 3KHJA 4NNAA 4JTUA 3DBPA 1H7RA 4RXFA 4CCCA 3WFAA 1VGAA 1JUKA 1W5QA 3ABRA 3LLDA 5AC8A 2KZHA 1GQNA 1X1OA 3ZWSA 4HSNA 2QEZA 2CLMA 1T99A 5EMUA 2QDGA 4Z1CA 3CPRA 5G2WA 4GWEA 4AXKA 1BKSA 1VCGA 1XBVA 1G6CA 3IEBA 2ZRZA 4Y6GA 5DN1A 1L6WA 1XBXA 2NZLA 3DFNA 1YDNA 2CFFA 3NPXA 2DZXA 3DHDA 2ZZ6A 2QJHA 4JY8A 4YXGA 3BLFA 1SW3A 3SW6A 4Q33A 1B4KA 4IOTA 4M6PA 4MYAA 1TCDA 3PBVA 3ZR4A 2VFFA 3NG3A 3LHUA 4WZHA 3TU9A 1D9EA 2AGKA 2NX3A 2P1FA 2ZDRA 5HUPA 4O0ZA 4OBTA 2Y85A 3DU0A 1F6KA 4S2BA 2ZTJA 4UR7A 3W7NA 1HUVA 3P61A 4AH7A 1PCWA 2GQAA 3UWWA 2CZ5A 1OK6A 3TSBA 5HMSA 2ZQ0A 4PL1A 4UFMA 3LHVA 1PVNA 1ZY9A 2WKJA 5FEXA 4LRTA 1TTIA 4NJKA 1TREA 1TRIA 3WK0A 1MO0A 4MFEA 3T40A 3CB8A 3EB2A 1OABA 5C2XA 3AJXA 1SO5A 1LCOA 3LTPA 4AMAA 3FEMA 2CLOA 5CGQA 3S5OA 4N4PA 4UMAA 3B05A 4NVTA 4O28A 3M5YA 2Z6IA 3IVTA 1K3UA 3OIXA 4O18A 3ELFA 1JR1A 3C8FA 2DZWA 3G1FA 4KKXA 5D32A 1OX6A 3DAQA 3OVRA 3QC3A 3L0KA 5BNKA 4LW7A 3SR7A 1A5SA 1A50A 4FIQA 3N73A 1QFEA 1OX4A 3ZS4A 4JIPA 2FJKA 1KLZA 4OGZA 1XM3A 3NPUA 2VEMA 4NX0A 2A6NA 2NXHA 1OJXA 5TIMA 4FEZA 3BV4A 5EBUA 1UB3A 4FNSA 1U83A 2YFNA 1LOQA 3EX2A 2FIQA 4IJBA 4K36A 3R13A 4K39A 1TV7A 2TYSA 2WPBA 3KRSA 2LLEA 3IIPA 3W76A 3HBLA 3P67A 3W71A 5K4ZA 3C6CA 1FXPA 3T7VA 3MHUA 3B04A 3UWQA 2ZCGA 4K7YA 3LCIA 5F1VA 3M5XA 2NX1A 2Y7GA 4HN4A 1LP6A 3FYOA 3O8AA 2DZVA 3SJ3A 1YPFA 4YMZA 4H3DA 3KVMA 4IQLA 4A2RA 3C61A 2FB3A 3HMJG 2ZRVA 2HS8A 3W1PA 5FF3A 3S5YA 3FOKA 1ONRA 1QPRA 2RDUA 1WAUA 3NO5A 4WQ6A 1NF7A 2XN2A 3KVKA 2AQWA 3ANYA 1Z42A 2VXNA 5DBTA 2O7QA 4DF1A 4YLWA 2EF9A 1HTIA 4XBKA 1VRDA 1UUMA 5AC6A 1TTQA 4AVFA 4OHQA 3NQAA 3TA6A 2RDTA 4NJIA 3W74A 4PCFA 3C2RA 3G0SA 1FBAA 4Z0SA 2JBMA 3QYQA 3QFEA 4CCEA 2C14A 4K8HA 2UV8G 3LI0A 4NUWA 1JQXA 1TMHA 4IMFA 3QMTA 4Y9AA 3DGRA 1G4TA 1C8VA 3W1MA 1TTPA 3I68A 1CX9A 5FF2A 3ZWTA 1F5ZA 2VFIA 3V1PA 2A21A 4L4MA 3EX1A 4GNJA 1BTMA 4NJHA 4N9EA 3S42A 3TW7A 1LBMA 2WSYA 5LNUA 3F4NA 2CLKA 2E1DA 4WY0A 2AAMA 2G96A 2XFWA 4NJJA 1WOAA 3GAYA 3P8IA 2V9DA 4M6QA 3C2EA 3W83A 3W1UA 3GDLA 1W8SA 3W2JA 3A23A 4GUIA 2Z2UA 4LVBA 1R2TA 3PBUA 4TO8A 1U5JA 1WDWA 3BW3A 3GK0A 4IGHA 3EKLA 3OHIA 4HSOA 3L9CA 3TXZA 1LLWA 3UWUA 4R33A 4LUIA 1WBHA 5EPDA 3G1DA 1Q6RA 5CPNA 3I7RA 5DELA 1OX4B 4JX5A 2OX1A 4JTJA 8TIMA 1S3HA 4FNRA 2YYTA 3L5LA 4RCXA 4JNMA 1PHWA 4CCDA 4CNNA 3Q37A 4MJZA 1SPQA 4Y8FA 2ZA3A 4IMCA 1I2RA 3GXPA 1JVNA 1OFEA 5HQEA 3N2XA 3GKAA 1VYSX 1YDVA 5EKYA 2Y61A 4E38A 3NDOA 1DVJA 2X1UA 4LVFA 1YTKA 5CSRA 3GXNA 3B03A 3S1VA 5J5RA 5F2IA 2O7SA 3DI1A 4IXHA 3LCLA 3SSJA 2QCNA 2R8WA 3T78A 3DKLA 2CLFA 5AHLA 2ZZ2A 5F2MA 5KZMA 5G4EA 2BXVA 1LBFA 1F05A 2PC4A 2V5BA 2QCHA 4IMEA 3W1LA 3DFPA 4FNUA 4UXDA 4ZQCA 2FTPA 1XKYA 4LUJA 2H8ZA 1ZAHA 4O14A 2OT1A 5D09A 1LRQA 1QR7A 5AN7A 3OVPA 3CT7A 2V8ZA 2VFHA 3IIOA 6ALDA 1DV7A 1B9BA 1NAL1 4UMBA 5D2TA 4N6FA 3IVUA 3M16A 3IIXA 3W2LA 4PH6A 3CC1A 3LBCA 5G2IA 2ZZ3A 4JX4A 3TXVA 3HG4A 4BR1A 1SO3A 3NL2A 3PC0A 4UR8A 3G0UA 1O5KA 4XWUA 1W5OA 4PTNA 1TPH1 3W7OA 4UNKA 2TRSA 3WK3A 4FNQA 1W3IA 4EF8A 1VR6A 4JS3A 3PUOA 3W7IA 5K9DA 2YPIA 1W56A 5CSSA 1JUEA 2ALDA 2V2DA 1SZGA 1QPQA 3BG9A 3O6CA 3NPWA 2V81A 4JEQA 5LNVA 2R14A 2J88A 1L6SA 4WOQA 2PCQA 4N9BA 2Q3OA 1KTNA 1Z41A 2JK2A 3NQGA 1ZAJA 2PURA 5LHEA 1GWJA 4GUGA 3KRZA 5I3GA 1NSJA 4NNBA 3Q94A 1TV5A 4WY0B 3O63A 1QPNA 5LZLA 4M6VA 2Q8LA 4XTDA 3FFSA 4FX8A 3W2UA 4DPPA 4WJEA 4DO4A 1SSGA 1WBJA 3O07A 3R5EA 3PG8A 4UUIA 3KOFA 3GB6A 4FXRA 2XN0A 5DLCA 4AHQA 4LV9A 4J9JA 4JTFA 3B0UX 4YCPA 2G97A 2Y63A 5U4NA 3MYPA 2OMAA 1OFPA 1F2JA 3SECA 2E5CA 2NUXA 3BO9A 3UZJA 1J2WA 2P10A 3NAVA 4MJMA 2ZZ4A 1SW7A 4O4VA 4MVAA 4N6EA 3M1ZA 1FX6A 3F1QA 4O8RA 3UWZA 1H51A 4MKNA 4G1KA 2JKEA 5AHMA 3PVFA 5F2GA 4LWWA 4ADSA 4R7JA 2V30A 1ALDA 4E0CA 3HB9A 3TQ0A 4P2VA 4O19A 2G95A 4UTUA 3E96A 3W1QA 4DXVA 4MOZA 3NZ1A 2C6QA 1DHPA 3W72A 1ZFJA 1TV8A 1DQWA 5D05A 3G1HA 2C13A 1TPC1 5HWJA 2WOQA 3ABQA 3UXAA 2EPHA 1Q6QA 2CZEA 3HJZA 4UFKA 2C1HA 4ADTA 3EWYA 3TMQA 1YTEA 5EA9A 4UTMA 3I7QA 4HPJA 5K2ZA 3E12A 1LM1A 2TPSA 1EA0A 1W0MA 3GXTA 1VYRA 4UTIA 1TPFA 3KVJA 3HPXA 3OA3A 1JCNA 1UJPA 1GVFA 3MW7A 1KV8A 2E77A 1THFD 4FO4A 3C52A 1KBJA 1AW2A 2Y7EA 4OWGA 1VLWA 3W23A 3RLUA 2A1YA 4O15A 1GG0A 2Z0IA 2VEKA 5TBOA 2QJIA 1LDCA 1W1ZA 3RU6A 2FB2A 2J24A 4MY8A 3A21A 4I7VA 1S5TA 4O1DA 4RZ4A 1YXYA 2FPYA 3UD6A 4GBUA 2P0OA 4GRSA 4UTTC 5H91A 1LZOA 1O60A 1VLIA 1OK4A 3BGJA 4NZFA 3K30A 3MP5A 5E1QA 2A5HA 4LTSA 4K7VA 4DBEA 4OV9A 1EPXA 4GC4A 3UPBA 1KFJA 2C16A 4I9AA 3W22A 2NWSA 2QR6A 1AW5A 3W2MA 1GVOA 4LNYA 2RDWA 3GDTA 4FX6M 1DL3A 3DFTA 4JYDA 3NNTA 1WX0A 1F74A 4MZ1A 2WJZA 3O15A 4CQAA 3UY7A 2ATSA 4PFMA 4IWWA 4WY0F 2GPTA 2QCEA 4JTLA 4RX0A 1H7PA 1R2RA 4AF0A 4BFAA 4OT7A 4U28A 3S5ZA 3PM6A 2HS6A 2C3ZA 3O1NA 3LM7A 1TPUA 2A6LA 4R53A 2JKPA 4UCGA 1OFRA 1P4CA 1EEPA 5KSWA 3HGSA 4QJ1A 1GVQA 3W2KA 2NX9A 4KFOA 5K4XA 2DU2A 2NXGA 4Z0JA 1T96A 1VQTA 5KZDA 4TU1A 1JUBA 3GLCA 2Y70A 3QMRA 1XDMA 3FLUA 1JRCA 2YR1A 1GTHA 1M6JA 5FEPA 1X1ZA 2VELA 1OYAA 3N3MA 4O17A 4I7UA 1K7FA 4QQ3A 4UTWC 2QCLA 3C3NA 3LXAA 1WV2A 4ZQNA 3W7JA 2EKCA 4FX7A 1YPIA 1UUOA 1G69A 3G3MA 1EWDA 1KFCA 5EYWA 2VC6A 3A5FA 4WX2A 4KWVA 5FEZA 4A2SA 1KW1A 1SO4A 3TE9A 4HNNA 1KA9F 2TSYA 3HG3A 2ABAA 4E2DA 4M7TA 4LC6A 4H6KA 2D73A 5LNSA 4UTTA 1DKWA 4S2CA 5I3JA 3L21A 3O06A 4HNUA 3L5MA 5D04C 1OF6A 1ADOA 3LV6A 1G67A 3GDKA 2WSRA 3EKZA 4HKPA 2HMCA 5CPOA 2YSWA 3S1WA 3G1YA 3M9YA 3S9YA 3PWAA 3P81A 3LDVA 3ATZA 3E49A 3LXCA 2ZA1A 2A0NA 2YCEA 3BARA 3EX3A 3PF3A 5L9FA 2E6AA 1XUUA 1KM2A 3IGSA 5HJLA 1XCFA 3Q2DA 4UFHA 4BF9A 2ZZ5A 2J6XA 4QSHA 1KFBA 3I65A 3M43A 3TSDA 2JKAA 3STEA 1S5WA 2C19A 3QSTA 4NXKA 3BK0A 4ZQRA 3L67A 1GOXA 3VFLA 1GYNA 2ZZ7A 1FY6A 5K9CA 3QQ0A 3TDFA 3FYPA 1FDYA 1TPVA 1P0KA 3A5VA 1ML1A 3MO7A 4QAIA 1FCVA 4JTTA 3NYZA 4LT9A 4MIMA 3LV5A 4UFLA 2QCDA 4AWUA 2ZRUA 1NVMA 3FKRA 5IBXC 2E6YA 4NX5A 2Y89A 2DZTA 5EY5A 3QJAA 4DELA 5HULA 2QUVA 1RVGA 1FWRA 2YX0A 4JN6A 1RQBA 2WV8A 3TH6A 5DXYA 3HG5A 1TPEA 2RKXA 1I2OA 3EEGA 4LS1A 1VCFA 4Y90A 1J4EA 4UTWA 1R2SA 3NQ6A 3T55A 4ORIA 3LCWA 4DO5A 4N2YA 1S5VA 1VHCA 1K8YA 3W7GA 5DCBA 2Z1BA 3QM3A 3GDRA 3KFTA 3C2OA 5CKSA 5HR7A 5D37A 4AF0B 1W3TA 4CQ8A 1KM6A 4CNPA 1WXJA 1QO2A 3WJXA 3IRDA 1JRBA 3W85A 1RQEA 2E6DA 4UC5A 4LU0A 4O1CA 2FQIA 1EIXA 6TIMA 5D30A 1SFJA 3P82A 1LBLA 4K8EA 3MUXA 4HT3A 3O05A 1NF0A 5D2VA 4O0KA 3G1XA 2VENA 4MFDA 4PEKA 3TQKA 3R12A 1TJRA 4Z1BA 1LYXA 1XBZA 2ISSA 2VFGA 3ATYA 3HO8A 3P84A 1VHNA 3MJYA 1FCUA 1W3NA 1F7BA 1SR9A 1QWGA 1WA3A 3HGRA 4DEFA 3UPWA 1QPOA 4PL2A 1YYAA 5IBXA 1IXPA 3LXBA 4LRSA 1A53A 3NQVA 5C54A 3HGJA 3DKJA 4MLJA 3S6DA 1W5PA 2OT0A 3C2VA 1PV8A 3G24A 3OBKA 3DZ1A 3M47A 3NR0A 4FIRA 4Y96A 1IXQA 3H54A 3MMTA 3CQ0A 2NXIA 4JTHA 4EIVA 5LSMA 4DBDA 1MEWA 1Q45A 2C18A 3W7KA 3U2OA 3S1XA 5IM51 3T44A 3PBYA 1FWWA 5FESA 4UIOA 2H3DA 2Y88A 3D0CA 1SU5A 1R30A 4AWSA 4BI5A 3R89A 2E5BA 4GE8A 5F2LA 4O57A 3NXFA 2X2GA 1ME7A 3IGXA 2ZRYA 2EHHA 2VOMA 3IIZA 4ADUA 1MZHA 2X1SA 3L0NA 3CU2A 3LRLA 4ALDA 2G5WA 1ZNNA 3S0CA 4RK8A 4BWLC 3CLMA 4UFJA 5G2HA 1B4EA 3PULA 5G1YA 2ZFAA 4BK9A 5D2YA 4LVGA 5J5DA 4IPJA 1EP1A 3NM3A 5F4SA 1QO5A 1MEIA 1OFAA 3M44A 5GVJA 3PBWA 5L6UA 1SFLA 3BVJA 4QISA 4WXYA 3MI6A 5CZTA 2ISWA 3NA8A 3W88A 3R8RA 4ICNA 5HR6A 3MHGA 3QW3A 3DENA 1BEUA 4DF2A 3JR2A 2DP3A 1IF2A 1LORA 3E02A 5K7JA 3P5YA 1SQ7A 1I4NA 1RQHA 3UQNA 2CLHA 4JTKA 1KM4A 1L6YA 3PSWA 2VKZG 4NZJA 1OVDA 5TQLA 5KTLA 2E6FA 4O11A 3HQ1A 1QDSA 4XTIA 3GAKA 2NLIA 1YLVA 3G3DA 3ZFHA 1FDJA 4GFSA 1KM1A 4NNCA 3M5ZA 1AW1A 1VZWA 5C5YA 1AK5A 3PS7A 5LGZA 2ZZ1A 2C15A 1H62A 2GQ9A 1ZENA 2V2HA 4RZ6A 2W0UA 2FDSA 3QRHA 1G4SA 3GR7A 4Z1AA 4X2RA 3G18A 2CZFA 2IQTA 2QF7A 1H1ZA 2FLIA 3W73A 1FQ0A 5CG7A 2WO5A 1H63A 2GJNA 3G1AA 4UTJA 3W7HA 3RK8A 1X6UA 1P0NA 3TQVA 4RZ5A 3CM4A 3U8GA 4R34A 3W7EA 3EX4A 3BLIA 1O94A 5I3IA 4FF7A 4IX0A 1KM0A 4RV8A 1JCJA 1VJIA 4TMCA 2GVGA 2CLLA 3TUUA 5K3VA 4BWLA 4ORMA 3L68A 4GJ1A 3N34A 2Y62A 4XZ9A 3MBDA 2V82A 3UXDA 5G5IA 2NWRA 4XQ6A 1GVRA 2ZA2A 1JCMP 1OHLA 3NL6A 3G1VA 4KFNA 1EB3A 4N4QA 3QZEA 1JJKA 4LC8A 3LERA 5AC7A 3GYEA 5LKYA 4Q32A 4M7SA 4DO6A 3G8RA 3O6DA 4OV4A 1HO1A 4Q4KA 3QF0A 1J5TA 1LOLA 2QDHA 4TR9A 3QPYA 4ZVJA 4MY1A 5DY3A 1TB3A 5I3FA 5HINA 2J27A 2YW4A 2ZBTA 1MXSA 4O1BA 2PE4A 1FWNA 4O53A 3FA5A 2PRMA 3P5ZA 4TIMA 2V0TA 5AHNA 3LRKA 3CIXA 1G4EA 5AYXA 1AMKA 3MP3A 2YGYA 4UTHA 3C0JA 4JXCA 4QIUA 3PB0A 2Q8ZA 4EOUA 3PY2A 3CWNA 3W70A 1G7UA 4X9SA 2CLEA 3LBMA 1HG3A 1SSDA 5T26A 1EP3A 3JS3A 4LS2A 4DPQA 1OYBA 2A7NA 3TCEA 1C29A 1IXNA 1K7EA 4O13A 3W07A 4M19A 1GVSA 3MHFA 4JTIA 3NZRA 1I8JA 4ONVA 1WYIA 4AB4A 4ZQPA 1ICQA 2QCGA 3CTLA 2H6RA 3WK1A 3THAA 2Y6ZA 1OX5A 1LLZA 4C1KA 4K37A 3P60A 1A5BA 3W1TA 2QJGA 3TKFA 4K38A 2GVJA 4XKYA 3B0PA 3EWBX 3LHYA 1LROA 2VFEA 3W7PA 4JIQA 3EXTA 5FF7A 1SZNA 5AOUA 1DQXA 5F1UA 2YDAA 4UTLA 3E0IA 1Q6OA 3QQ1A 1OF8A 3UZ5A 3WK2A 1OG0A 4FNTA 2J9ZA 1F76A 2YFOA 1SUXA 2BWGA 3SGUA 3N9SA 3W9ZA 1VC4A 3LHWA 5CZJA 1SW0A 5BMWA 4EWND 4N02A 2CW6A 3KRUA 2CLIA 3LCGA 1PIIA 1KTCA 3AO0A 3UY8A 3NQCA 2YW3A 3NM1A 4TMBA 1IIHA 3NL3A 5U7SA 3NQFA 1G4PA 1H7XA 1ZJIA 4O52A 2PRLA 1SZFA 2GOUA 1OFDA 4GUJA 5HNRA 2NUWA 1GYLA 2H90A 1FCQA 1DOSA 1XL9A 2ZTKA 4JICA 1TSIA 2ISVA 5KINA 5F4XA 2Y7DA 3NL5A 2A7PA 1V5XA 1PL9A 1W5NA 5G1TA 4ZL1A 3M0ZA 1W5MA 1FXQA 4H4IA 1DJNA 2DZUA 2Q3RA 1GT8A 4QM1A 4FXSA 3UNDA 1QCWA 2B7PA 4XBSA 4ML9A 4WXZA 1VCVA 4IPIA 5SWUA 3QSRA 5AHFA 4MPQA 3QMSA 3LI1A 3CEUA 2EAWA 3LX9A 2R94A 2QUUA 3LCFA 1O5XA 4IXXA 4LY8A 3W3OA 3W7LA 3HG2A 1K8XA 1XFBA 2I14A 4LOCA 5E93A 3BLEA 3LCHA 5D03A 3NQMA 3IVSA 2X1TA 4TX9A 3VCRA 3TV8A
chains in the Genus database with same CATH superfamily
4B5WA 3H55A 2X16A 1R7AA 4ZE4A 3GX9A 4NRSA 5AHEA 1HVQA 3N3TA 4GIYA 5MHBA 3SZ8A 1TIMA 3B0XA 6A3HA 4D6DA 1E3ZA 5E9XA 4LUSA 4LVAA 5HMFA 2VTFA 1EEXA 4WRHA 3AXIA 1YXDA 4O0QA 1V0NA 1M5WA 3VE9A 1HP4A 4JX6A 1OIMA 2XN1A 5BMXA 2QDEA 1B30A 2Z6JA 4MZYA 1PCKA 1XLCA 4DY1A 3W1RA 4QSFA 4NKCA 1WZAA 3UXKA 2PGWA 3PZVA 2XJ7A 3AC0A 3QLLA 1D3GA 1KXTA 1EX5A 1A4MA 3WQVA 1S39A 1XJBA 5HUOA 4UQ9A 5I3KA 1DEDA 2FKPA 3AROA 2Y7FA 1WE5A 3PPFA 4ZZ9A 3SI9A 3S47A 2PDLA 4YCOA 1XP3A 5HWNA 1WKDA 1HO4A 3WJWA 3K1GA 2V5LA 1EC8A 3UBPC 3A22A 3IUHA 1V4YA 3DN5A 3CMJA 2WMJA 1WOBA 2HVOA 3W84A 4D2JA 3W7CA 1X8FA 3PFMA 1WDPA 3RMJA 1B57A 1XYLA 4MPKA 1I2QA 4FLSA 3WDQA 2ZRXA 4QQUA 4JR5A 2CITA 3B8SA 2ZRWA 4E8DA 2QAPA 4D6IA 3KAOA 3ABSA 5M17A 1O66A 4X3ZA 4J3SA 9XIMA 3KL3A 2I9UA 4P7QA 4Z17A 3VE7A 3BUVA 1E4LA 3V0TA 1R3WA 3I3EA 5CPSA 4YNGA 4MWAB 3VIOA 4AXNA 1QI4A 3R0KA 5FSEC 2JFEX 3UYCA 1KM3A 4GYKA 2WNQA 2H3BA 4BA0A 2O55A 3UJRA 1XSIA 3C4UA 3TTQA 4Z2GA 3TYAA 4LAOA 1W8GA 3TYEA 2Z29A 4ROQA 3WMLA 4AZIA 3DG7A 2HTMA 4KS0A 2WANA 1IE7C 2EQDA 3F2CA 5JVLA 3NWRA 4Z2IA 1KV5A 2YZRA 3A13A 2DT2A 3PSVA 3N14A 1GEQA 4XZLX 4GJJA 3GHUA 2GUYA 4I7WA 4D6CA 4I9JA 3PG9A 5FJUA 3S2JA 3SRKA 1HNYA 1MDLA 3WL0A 3OBEA 5AFDA 2BX7A 2JGQA 4QITA 2WVSA 2EPNA 4QE5A 4A21A 1V6VA 3KXQA 2RH9A 2XIMA 4BI6A 4H2HA 3RU8X 3OZYA 4L6DA 4RR4A 2EO7A 4DF0A 1VYPX 4YWIA 4MUZA 1JD7A 3VA8A 4F9JA 2BVYA 1XDJA 2X1IA 1M7JA 4IIHA 1ITQA 3L4UA 3I7SA 4DBWA 3EOOA 1FP9A 1US0A 3KLLA 1EGVA 5LYRA 1M3UA 3STFA 2P8BA 2VEFA 1DORA 2PTWA 1BPLB 5PTDA 3KWSA 1TJ1A 3NQ8A 5I77A 1EKOA 4JTQA 1WO2A 3ITVA 2WCAA 3WNMA 4MKSA 4G9PA 1B3YA 1OFQA 1MXDA 2V3GA 4GC3A 3OODA 1HL2A 4MB3A 1SJDA 1Y8BA 2XVGA 1YDYA 2HSAA 1M04A 3LGEA 3DXIA 4CQ9A 4W9TA 4RDWA 3DBNA 3VKJA 3E0VA 1VFOA 3NEHA 6TAAA 2OZ0A 3EWDA 1JFHA 3OU8A 3W7DA 3URQA 3PAOA 1XIIA 4M80A 2OCZA 2QUNA 1UD6A 2J74A 3TYZA 5IDIA 1FKXA 3H2FA 4XAGA 4IP5A 1JQVA 4WF7A 4E8CA 2ZE0A 2HCVA 3MUZ1 1XLHA 4FXFA 1V6TA 2D69A 3IPWA 3TJXA 1K4HA 4JHOA 1UBSA 2RJHA 3Q58A 1RR2A 1OGBA 1ITUA 3M5VA 4DQWA 3B8TA 1VH7A 1OCQA 1E6NA 1EWEA 4W5UA 5ECUA 4D6EA 4NILA 1Q4WA 1T8XA 1EH9A 2GQ8A 1DE5A 3ONBA 1MW0A 1UH2A 3OVQA 4D6HA 4OFCA 2AAAA 4AUBA 2VZOA 4ZTYA 5DMYA 1H50A 5K9XA 1XICA 3BZJA 1KFLA 4ILSA 1US2A 1YX1A 1J5SA 5EMJA 3SRDA 4POCA 2OLHA 3B8IA 1DTUA 4HNVA 4FLOA 4L1XA 3FVMA 2BVWA 3URAA 1IXOA 3TN6A 2Q01A 5GPRA 3TSMA 4RJEA 1ZCOA 1TIWA 1JG9A 3MUAA 3U6WA 4GMEA 2NUYA 3ZJ6A 2CU0A 1QNVA 2ACRA 1CXIA 4JIRA 3VGDA 3UR5A 2PWGA 4GVGA 3NO1A 4AEFA 3B8DA 1IWBA 3CWOX 2VFDA 1M68A 1UMLA 4E3VA 4WKAA 3TA9A 2B7OA 4JQ4A 3T4CA 3G5EA 4MDOA 3F4VA 4HYVA 1XQKA 1E4NA 2C0HA 2VX4A 4AC1X 3CLWA 1V0KA 2XZ9A 1H2JA 1KLYA 1G94A 3W75A 2ZADA 2QQ6A 2RHGA 1TPWA 3GRIA 2BXYA 4H8NA 1PZ2A 1JPDX 1H7NA 1GKRA 3L4VA 2YLAA 4PODA 4JTCA 2VL4A 2CBVA 3S3GA 4B5NA 9XIAA 1PS9A 3W1XA 2CHOA 4HYRA 4B5UA 3UP8A 2I9EA 3VD4A 3E2QA 2FVKA 3TCSA 3NVTA 1UH3A 4LANA 1EJUC 2CEQA 2UY2A 3VCNA 1TV2A 1PPIA 3DG3A 4S3GA 1OFBA 4D6JA 3GC4A 1IT7A 3VM7A 1RPKA 4Q4MA 4LX4A 3CV7A 3C2YA 3EWWA 5CAKA 3VVGA 2WNNA 2VEIA 2H8XA 1W31A 4LVDA 1ICSA 1I6NA 5ABTA 1E0TA 3WSUA 2GSEA 4CCCA 3LLDA 1KRCC 2KZHA 1X1OA 5H8MA 2QEZA 1GVYA 2DUAA 4KGLA 1U5VA 2B81A 4B4HA 1BKSA 3EMZA 4Y6GA 2NZLA 4IFKB 1YDNA 1TMQA 3LN3A 1UOKA 5A8NA 2VCAA 4GABA 1TCDA 4XAPA 3ZR4A 3NG3A 5CG0A 4L9XA 3ARZA 2YBVA 3RDKA 2P1FA 5HUPA 4O0ZA 4R7WA 1T40A 1EYEA 4RE4A 4S2BA 3VNKA 2XPKA 3UWWA 2R1KA 2YZ5A 3AALA 1K77A 3LHVA 4XAZA 5HJYA 3H24A 4LRTA 1TTIA 1J0JA 4NJKA 3T05A 3WK0A 4UZSA 4IL2A 4NL1A 2Z27A 3CB8A 2RAGA 3EB2A 6CGTA 3LBOA 2ZUWA 3CV2A 3USZA 1SO5A 4AMAA 1GHSA 3FEMA 2CLOA 5JH2A 4N4PA 1F9CA 1K3UA 4HTBA 4HA0A 3ELFA 3AMKA 4RPPA 3CYVA 4KKXA 1OX6A 4QG6A 2WBGA 5BNKA 3W53A 1OX4A 4J3UA 3BV7A 1V3KA 2FJKA 1POKA 3R7MA 4WGXA 3HPAA 4IISA 3B0YA 1B3WA 2A6NA 4ECLA 2NXHA 1OJXA 1Q7QA 3WH7A 5JIWA 3TVAA 4FNSA 5BYWA 2OOGA 3AICA 4A4AA 3EX2A 2FIQA 2CBUA 2E0PA 3BH4A 5J04A 1AZ1A 1TV7A 2HPMA 2QMKA 3HBLA 3W71A 2FJUB 5K4ZA 3C6CA 4GNVA 4J3XA 3LCIA 5F1VA 3M5XA 1L6GA 1V03A 1LP6A 3O8AA 2DZVA 2PDCA 4H3DA 4A2RA 3AIVA 1CECA 3FGCA 2G41A 3OJGA 3RUBL 2PGFA 3GVVA 3W1PA 3QV7A 1Q4NX 4IP7A 1QPRA 4LAMA 4WQ6A 1BWVA 1NF7A 4HOZA 4XSMA 2AQWA 3ANYA 3ENLA 2EF9A 3M0VA 1JZ6A 3NQBA 4QDPA 4AVFA 3OQ8A 1F6YA 3TA6A 4JQ2A 3IUIA 3C2RA 2C14A 5C2CA 4K8HA 1FVPA 2UV8G 3LI0A 2VMFA 2WCGA 4IMFA 4L5ZA 3CHDA 2A3EA 3CB3A 4HCHA 2QZRA 2GK1B 4C6BA 2ZICA 3W1MA 1TTPA 3I68A 1CX9A 3U4FA 1D7FA 2OSYA 4B90A 3O0FA 4U10A 3TP4A 3ABZA 2WZEA 1ISXA 3WQGA 2HQAA 3AS2A 2VFIA 3V1PA 1MYRA 2DUXA 2ZDSA 4N9EA 1A5UA 3S42A 3F4NA 1RBAA 1TJ0A 4BEQA 1WOAA 4DJFA 3DGBA 1M1BA 3C2EA 3W83A 4HK7A 4Y2WA 3THDA 4CVUA 2QIIA 2E7FA 2IPJA 2NVAA 1V93A 4GUIA 4LVBA 4PTXA 3W25A 4CEXC 4DJED 3GK0A 2G8ZA 2OPJA 4GI6A 2IMRA 3AIUA 3WQWA 3EMQA 1QPKA 3UWUA 2V63A 4LUIA 2Y2WA 5EPDA 2F6XA 2JEQA 3G1DA 3K13A 5CPNA 1H41A 3UJEA 4GA8A 5DELA 4BF7A 1TWZA 2QMJA 3C0SA 1N2VA 3NFUA 3UG8A 2EG6A 1Q66A 2C7FA 3IJ7A 3N13A 4CNNA 4MJZA 3WN6A 1FHVA 1C91A 4QEHA 2F9RA 4ACZA 4IMCA 3AYRA 2QV4A 1JDAA 1JVNA 3GKAA 3L4ZA 1W1TA 1QASA 5XIMA 1R9ZA 4E38A 3NZQA 2VZTA 2X1UA 5HNTA 3TEVA 3H4XA 1HX0A 3DI1A 3ES7A 3PPGA 3LCLA 1IR1A 5H8UA 2R8WA 3RM4A 4RNFA 1CWYA 5F2MA 1VFSA 2BXVA 2V5BA 1F05A 3QPEA 2QCHA 4IMEA 3W1LA 4FNUA 4UXDA 4M8UA 1XKYA 7ENLA 1E0XA 2BHZA 1XLBA 2EEXA 3GS6A 1DE6A 5AYIA 4GHRA 5C9RA 1LRQA 1OG6A 4IG2A 5A6AA 3OVPA 3CT7A 1U1HA 2REQA 4LUTA 2VFHA 3IIOA 4GQ0A 2HRWA 3OP2A 1NAL1 3N04A 3M16A 3IIXA 3W2LA 5G2IA 4DI9A 1PWMA 4PUUA 4UR8A 3HV8A 7TAAA 1W5OA 4MMWA 3QHOA 4UNKA 1AH0A 3UYIA 4EF8A 1IEXA 1VR6A 1PDZA 4F0HA 1W56A 1OCJA 5CSSA 3HM7A 3BG9A 3NPWA 4JEQA 2R14A 2J88A 4Q8PA 4JOMA 4WOQA 1HT6A 1RBLA 3R8GA 2PCQA 3KBSA 1SMAA 5HNUA 1JYVA 2Q3OA 1KTNA 1Z41A 3C5QA 3EDEA 1LT8A 4GUGA 1LL7A 1ENUA 2BP1A 3WH6A 5I3GA 1P6BA 3WUFA 2WSPA 4GI9A 3CMGA 3WEZA 1NELA 5E6YA 1Z3NA 4IIDA 2HXUA 3II1A 5LZLA 1E6PA 3VDBA 2Z1WA 4PMVA 4K1WA 1SSGA 1YPXA 4JIIX 3O07A 4FXRA 1W1IE 4AHQA 5T9BG 3AYVA 1XLEA 3W6MA 2VZVA 4C6LA 2CWXA 4JEJA 3GVRA 1UUQA 3WUEA 2PDNA 2QGYA 1XYCA 4AZ5A 3W26A 2OLSA 3SECA 2E5CA 2NUXA 3CJPA 2XH2A 1Q7MA 4MVAA 5ENLA 3M1ZA 4XZHA 4O8RA 3GNPA 4PBEA 1OINA 4G1KA 3PVFA 5F2GA 4LWWA 1KRBC 4R7JA 2PWVA 4QGCA 3LA4A 4I9TA 2WXDM 3W1QA 4HOWA 3ARTA 3NZ1A 2C6QA 5BWFA 4JFUA 2VDGA 3SCTA 3G2GA 2C13A 3ZR5A 1DXFA 3M7SA 1N8WA 3ABQA 1MVYA 2EPHA 2AGTA 2ZOXA 4IHCA 3EWYA 4I9MA 5GQBA 2Z28A 2J47A 4PUWA 3TJ4A 5K2ZA 3QY8A 4MDPA 1LM1A 2G37A 1EA0A 1VPYA 1W0MA 2JF7A 1HJVA 3HPXA 1JAEA 3NUKA 1KBJA 3POCA 4XVEA 4KIEA 3QR3A 3GBDA 3UJFA 2A1YA 4O15A 2J7CA 4XZNX 3IAPA 1KBBA 1EX1A 3UXIA 1MI3A 1LDCA 2J24A 1Z8AA 1MMFA 1TWSA 3ITGA 4R27A 3IS4A 3VKBA 1I75A 4JFSA 1VIZA 2BMBA 1E71M 4GXPA 2A5HA 4LTSA 5DT7A 4ZA0A 1KKRA 1TA3B 2C16A 4I9AA 2NWSA 2QR6A 1AW5A 3V0SA 1JNDA 4FX6M 1AD4A 1DL3A 3CQKA 3MV01 5A1AA 1F74A 4IL0A 1UR8A 2ZWZA 1S2AA 4PFMA 1W1PA 2QCEA 4JTLA 4RX0A 4PTMA 4AF0A 1WDRA 3WBAA 1J01A 4U28A 4DO7A 2C3ZA 2YJQA 4JN7A 3DIPA 1A49A 1DHKA 4X9YA 1OFRA 1RSCA 5KSWA 4QJ1A 4ZFMA 3RXZA 3LPGA 3TLLA 2CC0A 4Z0JA 5KZDA 3LNPA 4Q4OA 1VENA 3IK2A 1H09A 1O68A 3FLUA 1V6UA 3VIJA 5FEPA 9RUBA 3GUWA 2QNEA 2VELA 1PKYA 2WSKA 4XSLA 1EHAA 4QQ3A 3R0DA 6REQB 3V35A 1WV2A 1QI2A 2OU4A 4IM4A 3WEOA 1YPIA 2WM1A 1G69A 2ZC8A 1EJWC 3A5FA 1FHDA 1R38A 4N0RA 3RO8A 5I6SA 4A2SA 3RN6A 2PC8A 2X40A 1SO4A 3VD7A 4R5EA 1KA9F 2BOGX 2P3EA 2ACQA 4E2DA 1PJ9A 4F66A 3T2OA 2D73A 5LNSA 1YEYA 4S2CA 3SUWA 3O06A 4NI8A 4Q3MA 4HNUA 4IMAA 3RG6A 4PRRA 1EDGA 3GDKA 1GPFA 2DT3A 1DJZA 3EKZA 2X7WA 4HKPA 2HMCA 5CPOA 2YSWA 2E67A 3SB0A 1AH4A 2BB0A 3LDVA 2ZA1A 3PZQA 3PF3A 3WH9A 1X1NA 1XUUA 3Q2DA 3STPA 1KFBA 3TSDA 1S5WA 1EIBA 3QSTA 4NXKA 3HURA 1KFWA 1Q6GA 2ZZ7A 1FY6A 1ECEA 1MW3A 5I00A 1A5KC 2GJPA 3ZMRA 4V28A 4BQ5A 5TAOA 1DP0A 2D0HA 1CGWA 1NDWA 1ML1A 3MO7A 1ZRQA 3LV5A 2OKTA 3FKRA 1HP5A 2Y89A 5EY5A 2P76A 3G77A 2UWFA 3LYEA 2PLMA 1AZ2A 3DYMA 1FWRA 1QNSA 5BOEA 3TZNA 4QJ3B 1QJWA 3HG5A 5DMNA 3WLHA 5D9MA 4UOJA 3T55A 4JFWA 2Y8VA 2ONEA 4FF5A 4JL1A 4ORIA 3RCYA 3UXLA 2W9MA 2VC7A 1NP0A 2ZX8A 3MCOA 4H9VA 5JIPA 4GIEA 3C2OA 5CKSA 5REQA 1IWPA 2DQXA 1KM6A 1O5RA 1DQUA 3KM8A 1WZMA 1JRBA 4YTUA 2IKJA 2VWSA 4LCRA 4UC5A 2DSUA 2DIKA 3CT2A 4LU0A 4O1CA 5J8LA 2FQIA 5C2GA 4M24A 3JZEA 1JF6A 6TIMA 4AD2A 4MWAE 3ZLHA 3B8VA 4DAIA 1C92A 1NF0A 1XLDA 3PK7A 4AD1A 1UD4A 1TV3A 2NT1A 2G3NA 4LCQA 4Z2LA 2Y24A 4ZOEA 3HO8A 3P84A 1VHNA 2PSNA 1OT1A 3WLTA 4DJEC 1GJWA 2D2JA 1E1CA 3C0LA 4TVCA 1SR9A 3A3WA 4GFIA 1A4LA 1NJJA 4J5NA 4B2DD 1XC6A 3KP1A 4BQ2A 5IBXA 1BG9A 1XLJA 4LRSA 3VIIA 4CCZA 1W5PA 3BGAA 2ACSA 1TUXA 3DZ1A 3VKCA 3N2TA 4EIVA 5LSMA 2C18A 3PZGA 2KAUC 4WCJA 3AMLA 1FWJC 4DUOA 2Y88A 1SU5A 2F61A 1PX4A 4BI5A 2E5BA 3A9BA 2OYLA 3CGTA 4XV0A 4XAFA 4TVDA 4PMZA 3LZ3A 4H9MA 3CU2A 3LRLA 3R11A 4ALDA 4RK8A 4NG3A 3CLMA 3GUGA 1TE6A 4PTDA 2ZFAA 1UKQA 5G1YA 2PF8A 4NHVA 3QHNA 2OLAA 4ZR8A 3VM5A 1GW9A 1TFVA 1UYQA 3UT0A 1QO5A 2WVVA 1OB0A 1G0CA 3M44A 5GVJA 4WSKA 3PBWA 3BCJA 5L6UA 1LWHA 3BVJA 4QISA 3NA8A 3FGCB 1AMYA 1BEUA 2VC5A 3E02A 1SQ7A 2AOSA 3MQTA 1RQHA 3FJ4A 2CLHA 3MSYA 3VZXA 3RJXA 1KM4A 1XD1A 4NZJA 2ZUVA 4U3CA 3VNLA 5TQLA 4P5UA 1WXYA 4OKDA 3HQ1A 4XTIA 3GAKA 3JVAA 4Z1YA 2NLIA 2D20A 1G5AA 3VC6A 1YLVA 5CJ5A 4NNCA 1XRSA 3SN4A 1AW1A 2VRJA 1SZRA 1VZWA 3PS7A 3VDAA 2C15A 1H62A 1ZENA 5EMKA 3UZYA 1K9EA 2CESA 4Z1AA 1UMYA 3CTTA 3GBEA 4A8IA 5CG7A 1E6RA 2D3NA 3SCRA 2GJNA 1T6MA 3TQVA 3O6AA 2NV9A 5KEZA 1E43A 3CM4A 1V0LA 1GNXA 3WQOA 2PP0A 1W32A 2PAJA 4IX0A 4RV8A 3EZ4A 4RE0A 2GVGA 3BSGA 3MTWA 2X09A 1RALA 4LEFA 2Y62A 2OVLA 3MBDA 3L2LA 4GVHA 3L2MA 4XD5A 4L65A 2OQLA 5DRIA 3OOQA 1VF8A 4FOKA 4GG9A 3G1VA 1HVXA 1TG7A 3QZEA 3CUHA 4W8AA 5AC7A 3WDJA 5BXTA 3BJSA 4M7SA 4OV4A 4Q4KA 4QR6A 1JNEA 3QF0A 1UQZA 3QPYA 3VNJA 3DDMA 4TX6A 3WENA 2YXXA 4A3YA 5I3FA 1MXSA 1KBLA 3SEPA 1T41A 2PZ0A 3M0YA 3LRKA 4E5TA 1SVDA 4WVXA 3QKEA 1AMKA 4QJ5B 4IIFA 4UTHA 3C0JA 1GOWA 2PPGA 4JXCA 1UD3A 3KBVA 4EOUA 3PY2A 3CWNA 5TD4A 1UKOA 1S3TC 3GXDA 2CLEA 3LMZA 4PGLA 3O2LA 4ZENA 3JS3A 3ZVHB 2V5KA 2A7NA 1K7EA 3D3FA 1GVSA 2O0TA 3F5JA 4XD6A 3W82A 4PTWA 5GJPA 1E0VA 2VRQA 3DOPA 3M0IA 1A5BA 3W1TA 1OWQA 3H2AA 1E9LA 2VDIA 2GVJA 3CZKA 4LUTB 4A8LA 4B4FA 2NQHA 1F4HA 1OBAA 1UWRA 3T4WA 3W7PA 4ICMA 1K6WA 3U57A 5FF7A 4G7FA 1DQXA 5F1UA 1PZ0A 4YTSA 4DZAA 4QEEA 4L6HA 3UZ5A 1OG0A 2YFOA 1AH3A 1SUXA 5FJIA 2ZXQA 5E09A 3W9ZA 1CZ1A 4B9YA 5CPTA 4EWND 3LD5A 1W1VA 1FH9A 3TWBA 3AU2A 3F4DA 1PIIA 1KTCA 3KOXA 3UY8A 4IH3A 4UQEA 4TMBA 2WLZA 5U7SA 4E8GA 3NQFA 1G4PA 1PX8A 1H7XA 1AUSL 1KNWA 1BQGA 5LIUX 4QS5A 2H90A 1XL9A 4JICA 2ISVA 1PIFA 2PBGA 2Y7DA 1GKQA 1WDQA 1B54A 2A7PA 5TF0A 1PL9A 3AHVA 3ARWA 4PMOA 3M0ZA 2IQDA 1W5MA 5AYBA 1FXQA 2PI6A 4H4IA 4ZFCA 2BBFA 1DJNA 2DZUA 2OB3A 1RXOB 3QOMA 1JZ8A 5SWUA 2GJRA 4IIBA 5AHFA 3QMSA 1ISVA 3CEUA 2EAWA 3LX9A 2QUUA 4AWEA 1O5XA 1DTNA 4LY8A 3OZOA 3CO4A 3P14A 3BAIA 5D03A 4DXXA 3VCRA 4DZIA 3LTYA 3LLFA 1BXBA 3RCNA 4GUFA 2B0MA 4MYXA 3W7MA 3AYTA 3OYZA 4AC7C 2PTYA 2GSJA 3SCQA 1P0BA 3L66A 3WLRA 3O16A 1RZMA 1Y7VA 1RV8A 3MI2A 5M2FX 4DYEA 4ENLA 4M6UA 4ZQMA 5LIXX 3IGUA 1RJQA 3GVQA 4ZQOA 5I03A 5HNNA 1XIBA 3V7PA 3USBA 3T0AA 3V75A 1BRLA 2OZTA 4W4QA 4HCDA 4A6GA 5BXSA 3M0MA 5FSDC 4WOZA 3KZSA 1BVWA 1W91A 3WY1A 3VZZA 1EO7A 5EL1A 2DVUA 3NPVA 4XIAA 4ZMGA 1FFRA 1OYCA 2A85A 3W00A 3INPA 3VAVA 3VTRA 1MWOA 1L2UA 5DBUA 2YXGA 3EWXA 5A6MA 3WLLA 2W6RA 1NY1A 4XKYB 4LY4A 1BWLA 7TIMA 1EFZA 4ERAA 1PE1A 3WNLA 3LTSA 5C9UA 5AB3A 2A3BA 3GU2A 1EJSC 3PUDA 3GXFA 2BY3A 4C1NA 4QNWA 2WM0A 1MUWA 3KWXA 4PCSA 1PHQA 1GZGA 4MNJA 3B9DA 4DRSA 4KETA 4O10A 3GHRA 3T8LA 1UCWA 4IUOA 2UZ9A 5CBJA 5F7UA 3OLDA 4DUVA 1TJPA 4HYWA 4RXGA 1PZ1A 4JTSA 8XIAA 2GGHA 3K8KA 4U5KA 5BOOA 2BY1A 5AHIA 1SZEA 3UWVA 1IZCA 2V2CA 3QW4B 1TVPA 2XDFA 4YU1A 4P61A 3BOLA 1P7TA 3GIYA 3HFYA 3XINA 3ARQA 4EK7A 3FSUA 1CI1A 3VINA 5BU9A 1KM5A 4C6FA 4O12A 3R1ZA 1AVAA 1XUZA 5TNVA 4HSHA 2BHUA 3V5CA 3QPZA 4MB4A 2I16A 4S39A 3RLVA 1O4UA 2TMDA 3L5AA 4LUYA 4RDYA 1T0OA 4UMCA 1TJ2A 3BCFA 4J3WA 1PEZA 1L8NA 5MKGB 2E68A 3TJLA 1TX2A 1F07A 1WXZA 4WHBA 3GVGA 4YJ5A 2FHFA 1VBJA 2NV2A 3UU0A 1KCXA 2XM2A 4R9OA 3NOEA 1CEOA 2ICSA 4HZ7A 4H8HA 4IGNA 1Y5VA 2XM1A 3LCXA 4B92A 3CYJA 4O1AA 3IV3A 2GGGA 1J11A 2B4GA 3T9PA 1AG1O 1KBIA 2DZPA 1FWTA 4NYUA 4WDXA 4IGSA 4NT0A 2QJJA 1OC7A 1LWJA 1LL6A 3P7YA 2I5QA 1JULA 3EGJA 3K1DA 4F0RA 4MJ4A 1E73M 4FR1A 5DMLA 3HPSA 4W88A 2BV9A 4GYJA 4Y9NA 4B5SA 1CB2A 1GUVA 1UKTA 5E0KA 2VQTA 2XGZA 1GYMA 3LU2A 1ZHAA 3JRKA 4M51A 4QNEA 1TV4A 1B3OA 1ICPA 1G7VA 1IWAA 3PTMA 1RJPA 4XKMA 1IIGA 5BRBA 3N4AA 3ZM8A 3MO4A 1DJQA 3R2GA 4IZGA 3URBA 2ESCA 4ZSUA 1EUAA 4QROA 2X1RA 1XYBA 4B91A 4O50A 4DB7A 3V0UA 1VPXA 3VOJA 3UWYA 2H9AB 3VMPA 3FDGA 4PYSA 2PTXA 1K6AA 2PWUA 1JGMA 2HWGA 1XXXA 4QHRA 1A3HA 2OELA 1V0MA 2WAGA 1XC4A 1RJRA 3W38A 5A5WA 2WJEA 3EOUA 3VX0A 3DH7A 1GONA 4EF9A 1B3VA 1XPYA 4O54A 3ZJKA 1H61A 1K7XA 1FHUA 2W27A 1ZP4A 2AQVA 4XUGA 1E51A 2QCMA 2PUZA 3M6DA 3OYXA 1KCZA 5IDZA 3WLSA 1A5CA 1QMLA 1VS1A 3LHZA 2BZNA 5FI8A 3PUEA 3WJZA 4NQ1A 5HOSA 2WJDA 3QC0A 5IFPA 1YE6A 1QBBA 2WHLA 4HHLA 3SCSA 1RK5A 5D8ZA 4EVZA 2XGIA 1D8CA 3XISA 4KCWA 4GCAA 4C6KA 2WQPA 3MA8A 3UR2A 3SUVA 1HQTA 3ZXWA 4AEEA 3BICA 2BNJA 3M0KA 4HNTA 3CZJA 4OZOA 3F03K 3SQMA 3WJSA 5DMMA 4W5ZA 3P74A 1UC4A 2OZ3A 1IEVA 3C56A 3GW0A 3S1UA 3SY5A 1AJZA 3PAJA 3WMBA 3CUZA 4ATWA 1YDOA 2V5JA 1GTEA 2Z2BA 4AU0A 3GG0A 4Q8TA 4IFRA 5HXMA 5CXPA 4JD4A 2X0HA 1XDLA 3TAOA 5I3DA 3W28A 4LF1A 3TMLA 3TIMA 4H6RA 3KBMA 2DJXA 2VWTA 3H2EA 3GDBA 1JCXA 1OCBA 3UZZA 1W54A 2J66A 2C91A 3WQ5A 2HEJA 2IPGA 1BWKA 1H1YA 3S4TA 1W3HA 1ZALA 2IQ0A 3B8WA 4OBRA 2X2YA 3B4UA 5DFAA 4F8XA 3I6EA 3TTOA 4D6FA 1EDQA 2XH0A 3TAKA 1YNQA 3VNDA 4MZ8A 3GO2A 3CZEA 2PRHA 3QEZA 4MWAD 3P80A 5CZ0A 2FPTA 2VUYA 1M7OA 2PS2A 3PTDA 3IV8A 1PO9A 1SMDA 4A8RA 1XCXA 2XUCA 1NOFA 1YTDA 3AXXA 3GNNA 3AIWA 4DVOA 3WF3A 1X98A 2XU2A 3WF1A 2WMIA 2QVNA 6XIAA 2WHKA 3APGA 4REQA 2G0WA 1S5MA 3M41A 5ABFB 1H3GA 3NSMA 1TQJA 3ICJA 4P7OA 1M9HA 2QCFA 4CNOA 1ME8A 2QKFA 1JIBA 4RNJA 1XIMA 4HNOA 3W2NA 2BSLA 3ARYA 4P8XA 3TX9A 5A95A 2GOKA 1J18A 5DEZA 5GNXA 3PWIA 3UFYA 3EDFA 1C9DA 1QI5A 5A2BA 4E4FA 1KWGA 4O4WA 3GKFA 3ZLGA 3WDHA 3U2EA 3CEPA 4NU7A 2OSWA 3M0JA 3KHJA 3VUPA 4NNAA 4JTUA 4U5IA 3WFAA 4GO8A 1JUKA 4JIHA 3ABRA 3ITTA 4CKQA 5AC8A 3QY7A 3ITLA 4M1RA 2UY5A 1RCOB 2QDGA 1HZYA 4Z1CA 4G1NA 3PHAA 3C8NA 3EB3A 1XBVA 3IEBA 5DN1A 1HN1A 3QV9A 3DFNA 1UZHA 2DZXA 1LUCA 3Q65A 4AY7A 1UWUA 1NDYA 1SW3A 4Q33A 1B4KA 4IOTA 3UVAA 2WQDA 3BSMA 1UIPA 4MYAA 4I5XA 1ZP3A 3GHSA 3PNZA 2VFFA 3VOHA 3LHUA 3GWQA 4DM1A 2ZDRA 3PZUA 3DU0A 1F6KA 5ECVA 3C86A 3PUGA 2D1ZA 3NGFA 4AH7A 1PCWA 1UR0A 5D8WA 1OK6A 6ENLA 3E74A 3QKZA 1I0DA 4UFMA 1KXVA 1PVNA 4CN1A 5FEXA 1DWGM 1I0BA 1EJ7L 8CGTA 2VC9A 2PU1A 4RPQA 3AJXA 4NI3A 1FTXA 3OW1A 3GFZA 2DT0A 4QLKA 5CGQA 1JL8A 3W24A 3S5OA 3B9AA 1HJQA 3P93A 4Y9PA 3LPFA 4NVTA 4YHGA 1E15A 1WUFA 1ZS2A 4WDWA 4DAFA 3GG1A 4Z2JA 3DAQA 3OVRA 3QC3A 3VU2A 1VB9A 4FIQA 3N73A 2ZE3A 1QFEA 1KGWA 3NYDA 1P6CA 1QW8A 1CDGA 4FLRA 3FV9A 2W3ZA 3WH8A 3NCOA 5LA1A 1KLZA 1XSJA 4OGZA 3NPUA 2VEMA 4NX0A 4D8ZA 4AZ7A 1XKJA 3CL8A 3AWOA 4FEZA 1GZ1A 3UCQA 4JKKA 4FMVA 3CQIA 2R1LA 4GJIA 4K36A 3FN9A 4K39A 3KRSA 3MKKA 3P67A 3WNOA 4PB3A 3T7VA 3BMXA 2PP3A 3UWQA 4NYYA 4K7YA 2Y7GA 3AHYA 3VXGA 4HN4A 3RJYA 4O8AA 3SJ3A 1YPFA 3VIMA 4YMZA 1VFUA 3KVMA 4LQ1A 5I5RA 3C61A 1BYAA 4F40A 3HMJG 3N25A 2ZRVA 4O1EA 2HS8A 4C5ZA 2PLJA 2X41A 1ONRA 2RDUA 3UR8A 3NO5A 1ITXA 1D2KA 2XN2A 3I10A 4C7FA 3TYBA 5DBTA 2O7QA 1UZ4A 1HTIA 4XBKA 1GOMA 3AIRA 5CBBA 1TTQA 4OHQA 2JE8A 3NSXA 3NQAA 3WD3A 4PCFA 4OUIA 5I06A 2O9TA 2D0GA 3WF2A 3QFEA 2W62A 3Q67A 4RNIA 2GGJA 1B2YA 3GC2A 3BSHA 4NUWA 1TMHA 1RA5A 3QMTA 3UWEA 4Y9AA 1G4TA 3HZ3A 3DHUA 3IRSA 4ZXOA 3B9EA 4I5UA 5FF2A 3VKKA 4JQAA 3ZWTA 3RLGA 4ROPA 2FGLA 2A21A 4H9ZA 4L4MA 4LAUA 4NJHA 1XSKA 3B97A 4GYPC 3KS5A 2AAMA 3QFWA 5DF0A 4NJJA 3T42A 3GAYA 4ZO9A 1BRLB 2BHYA 5FJTA 3MANA 4MNLA 2BS9A 1TUFA 3FX4A 3REQA 3W2JA 4TO8A 3PBUA 1M7XA 3WUGA 2O9OA 4YVVA 3OHIA 4HSOA 2XVNA 5AZ0A 3AQUA 4K3ZA 5BCAA 3E5BA 4R33A 1HIZA 1FWGC 1Q6RA 3VNIA 1ZZMA 3I7RA 5DX7A 3CV1A 5A6BD 2YYTA 1MQPA 4RCXA 3BLPX 2YDSA 1PHWA 1TR1A 1HGWA 4GQRA 4PSRA 3MDUA 3JZUA 1WCGA 2DZAA 4Y8FA 2ZA3A 1OFEA 1AQ0A 2Y61A 5B7YA 3NDOA 3UESA 1YTKA 3OPSA 3V1HA 1XLKA 3GXNA 3B03A 1WZKA 3S1VA 5J5RA 4BQ3A 5F2IA 2O7SA 4PN2A 3VCCA 4H7ZA 1ZBKA 1Z9AA 2RUSA 5KZMA 5G4EA 1P7TB 4FP1A 2QXWA 4LUJA 3I4EA 1AODA 3UF9A 1I1XA 1V6YA 4ZE5A 2V8ZA 4UB9A 4GZIA 5E9AA 5CAHA 4PB4A 3NXLA 4PH6A 4HPHA 2ZZ3A 1XV8A 2A3AA 3HG4A 4IPPA 1EXPA 4BR1A 4ZB0A 3PC0A 3G0UA 1O5KA 3WF0A 4XWUA 3LSBA 4PTNA 2TRSA 3WK3A 3GTIA 4A3HA 3SSZA 1DIKA 3CZ8A 3D3AA 4GGBA 3PUOA 3M07A 2YPIA 1HKKA 3H2OA 1CLKA 2ALDA 4G6CA 5JXQA 4M1BA 4TTGA 3VKDA 1OD0A 3O6CA 4X63A 3ANVA 2DW7A 4JN8A 1L6SA 1IZJA 4N9BA 3U7BA 2JK2A 1ZAJA 2PURA 2AKZA 1FWBC 3AZRA 2CXGA 3KCLA 2YLLA 3Q94A 4A8NA 1TV5A 2OODA 4WY0B 1QU4A 3VGGA 4W7WA 3RRAA 3GH4A 4PFHA 4XTDA 4FX8A 3GTHA 3W2UA 3E2VA 4C5YA 5CQ1A 3TYUA 1WBJA 4V27A 2CERA 2Z1SA 3KOFA 1NWRA 3EKGA 2ZVRA 3U7VA 5FJRA 4JTFA 3AUOA 3DYOA 3UA4A 4OVXA 4PUDA 4YCPA 3A64A 2Y63A 5U4NA 2GWGA 2OMAA 1OFPA 1JEZA 3BO9A 3PWGA 3NAVA 4AYGA 4C7DA 5AVNA 4ZO6A 2PDUA 4KH2A 1KO0A 3WQ6A 4MKNA 5A8QA 2JKEA 1B90A 3UZXA 2D3LA 2NVDA 2V30A 1TWDA 3MV11 1C93A 4P2VA 1S2UA 4O19A 4UTUA 3E96A 3M0HA 3ITXA 4MOZA 3KUMA 4DWSD 5JMUA 3G6LA 3H7RA 2FGZA 1DHPA 2J7HA 5C71A 3WNKA 4MWAC 5D05A 4OJYA 1ZU8A 2J7EA 3AIBA 4B9ZA 4DLMA 5HWJA 1POJA 3EOLA 3AXHA 4LALA 4TV6A 4HU8A 1Q6QA 4ADTA 1YTEA 2YCLA 5EA9A 1XR2A 4UTMA 3I7QA 2VX6A 4HPJA 2JIWA 3W02A 3BLKA 1RHCA 2VHLA 3GC5A 2TPSA 1QK0A 1UP3A 4W84A 5EFFA 3GXTA 3CQJA 5JBDA 4UTIA 4DJDD 1E9YB 5BRPA 5B80A 2E77A 1QI3A 1UWQA 1KCKA 3C52A 5BRQA 3R58A 3WDIA 1KB3A 2PBOA 1US3A 4S3CA 4KW2A 2Y5JA 3LENA 4J2PA 4UZUA 3GQYA 4KQNA 2QJIA 1W1ZA 1TVLA 1U1JA 1MW2A 2GDQA 2J7BA 4TVUA 4MY8A 3A21A 3DESA 4D72A 4K1GA 1MZRA 4XZMX 2FPYA 3IJIA 4GBUA 1KD0A 2P0OA 2I5IA 4HK6A 3UERA 4W87A 1DYSA 2BGQA 1PTAA 1A5NC 4H41A 4LYKA 3NTYA 2HNHA 3CMFA 2XH4A 4DBEA 1CGYA 3VYLA 3UPBA 4PMQA 1YKWA 3WX7A 4PZVA 4JBRA 4LNYA 3GDTA 3AJ7A 3DFTA 4OIFA 4C6PA 3N18A 3NNTA 3MUCA 2DH2A 2WJZA 3O15A 4CQAA 5M03A 1L2QA 5CSUA 2E25A 3PBGA 4JAWA 1ELSA 4HZMA 1E6ZA 1ZQ5A 4OT7A 4GY7A 1IZKA 3S5ZA 3HTWA 3O1NA 1VBHA 1TPUA 2A6LA 2JKPA 1E5NA 1EC7A 3DECA 2DDXA 4R9XA 2NX9A 1DJGA 2GGIA 3A47A 3QOKA 1T96A 1VQTA 2HV5A 1A0DA 5HJXA 1JUBA 4KEVA 3WFLA 3W37A 3GLCA 3LM3A 4PUEA 3PJUA 2Y70A 2XTKA 5D9PA 1XDMA 1GJUA 2YR1A 1GTHA 1M6JA 3BE7A 4HZ8A 1X8CA 2NVCA 1X1ZA 4D9PA 4HCLA 1PAMA 5D9OA 4O17A 3N2CA 4I7UA 1X96A 1EO5A 3CUJA 4JHZA 4FR6A 4UTWC 2D22A 4DIAA 1B9ZA 4MJ2A 1QHPA 2EKCA 1J0YA 3QTGA 3G3MA 1EWDA 1XWYA 4FK9A 4GCXA 4K2SA 4AX6A 3E2RA 2XGBA 4JHMA 5FEZA 4FXJA 3TE9A 1Q6FA 2TSYA 2FDMA 3H7VA 1V3JA 4UTTA 1DKWA 1V3MA 2O56A 4MUPA 1OF6A 3S1WA 3WQCA 3S9YA 4QLJA 2AQOA 1PKLA 3PWAA 4AZCB 5G1MA 2DT1A 4GQBA 2QJNA 3IGSA 3KOZA 1EGZA 1Q63A 3IK4A 5BXRA 2JKAA 4IGMA 3STEA 3BAYA 4D8AA 4Q8MA 4ZQRA 3L67A 1GYNA 4J35A 2WJFA 2CZVA 5M3WA 3TDFA 4YN5A 1VPQA 1FDYA 4U33A 3D6NA 4HTYA 4QAIA 1JZ2A 3NYZA 4MIMA 2IS7A 2RGLA 4F2BA 4IP4A 2QCDA 4DX3A 1R0MA 3GH5A 2E6YA 3V4BA 1A80A 3LQLA 1QUMA 5FJPA 1BTCA 2QUVA 1RVGA 2YL9A 3ZIZA 3PTQA 3QXBA 2G3JA 3S2MA 2EG8A 5A6TC 4G7EB 1TPEA 2RKXA 1I2OA 1NWUA 3EEGA 2PDBA 5DANA 4FZIA 1VCFA 4Y90A 1W3KA 1R6WA 3VOFA 3ITOA 4PMNA 1K8YA 5DCBA 3WLKX 2EPKX 3W6LA 3CHFA 3WLQA 2GJXA 3IJ6A 4CQ8A 1I60A 1WXJA 1TVNA 1QO2A 1VD6A 1WAWA 3IRDA 4XZBA 2E6DA 4J1OA 2FZBA 4MADA 4OOUA 2DV0A 2CIPA 5D30A 1SFJA 4K8EA 4OUEA 1W1B1 1KQZA 4QCEA 2VENA 3H23A 3PJWA 5GNYA 3IJ9A 3BAXA 1R5YA 1X38A 2J62A 3EB4A 4Q4QA 2TAAA 1CYGA 4DM2A 1F7BA 1ISWA 1HKMA 3LEPA 4PEEA 2FTWA 5IHSA 1XISA 1QRQA 2G50A 1IXPA 1A53A 1O6IA 3UETA 3DKJA 4GO9A 1PV8A 3G24A 1S2VA 1DWAM 1V02A 4V1YA 3M47A 3H54A 3WCZA 1UP0A 2XSXA 1MEWA 3W7KA 5IM51 3PBYA 1FWWA 5FESA 1VJSA 4UIOA 2H3DA 4V2XA 2ZX9A 3D0CA 2D2HA 1FP8A 1FHLA 4AWSA 3R89A 1UR3M 3MZNA 5F2LA 5GJMA 3NXFA 3NDYA 2PCEA 1AJ2A 3THUA 2E9BA 2ZRYA 2VOMA 4ADUA 1MZHA 3K5XA 3WNPA 1WKEA 1ZNNA 3S0CA 3ZO9A 4C90A 3OTRA 1R3RA 4IPJA 1P6WA 2IKGA 3NM3A 5F4SA 7A3HA 4KWOA 1FH7A 1EGMA 3AHZA 5CZTA 4PB5A 2KX9A 2OSXA 2VOTA 4UNIA 3UG3A 3QW3A 2XH7A 4Q7BA 4V15A 4FSAA 1UWIA 1E4MM 1LORA 4Q8QA 3P5YA 2E3ZA 1I4NA 4BF5A 4JTKA 3VDCA 5JU6A 1OGGA 3PSWA 1CB7B 5H1WA 4QS6A 4ZSTA 3RX2A 3WD1A 2PZNA 2HBVA 1HW6A 3GD6A 3AI0A 2WW5A 1KM1A 3DX5A 3FEQA 4MB5A 1NDZA 3D47A 3PPCA 2ZZ1A 4QAWA 2E40A 4GOAA 2V2HA 3PJXA 1J6PA 2ZXDA 1M01A 5LXXA 4GIAA 3EOSA 3QRHA 1G4SA 5I2UA 4X2RA 1UKSA 1NARA 2BVDA 2QF7A 2FLIA 1EJTC 2WO5A 1XGEA 2I17A 2OZ8A 4UTJA 3OZMA 1X6UA 4JNYA 3A4JA 2GFTA 4AY8A 6PTDA 3EMCA 3TQPA 3U8GA 3W7EA 3BLIA 2GWNA 2O9RA 2ISDA 4HK5A 3URNA 2V68A 2C1IA 3WD4A 3HQNA 3TUUA 2HDJA 4O1FA 5K3VA 4BWLA 4F79A 4ORMA 2WVUA 1PB0A 3N34A 4DXKA 1PDYA 3NSNA 5G5IA 3REQB 1KRAC 2NWRA 4C7GA 1JZ4A 3ID7A 1EB3A 3LZ5A 4DUWA 3KL0A 3GYEA 5LKYA 4Q32A 4DNMA 2DFAA 4TX8A 1J5TA 1LOLA 3F5LA 2DVXA 3EBVA 2FZ9A 4PCTA 4DWSC 4IPLA 3H7UA 4O1BA 2UY3A 1F3XA 1FWNA 3CS2A 1J0IA 2AL2B 4L9YA 4P8VA 2OR2A 4YWSA 3GTNA 1E56A 3BZGA 2J4GA 2Q8ZA 4NAFB 1RLCL 2FMNA 4HD5A 3CPUA 4X9SA 4DJDC 3LBMA 1HG3A 1SSDA 4UQAA 3W27A 1EP3A 3VGFA 1C29A 2IKHA 3W07A 1KXHA 4M19A 3MHFA 1D8WA 4AB4A 4ZQPA 2H6RA 3WK1A 4H6EA 3QVQA 1GOIA 1RY0A 3GTXA 4Z42C 4PUKA 2QJGA 3NVDA 4YIWA 7REQB 3B3DA 3AMGA 1EBGA 3EXTA 3S6TA 3VGEA 5A69A 5AOUA 3M0XA 4M56A 2YDAA 4UTLA 5IOBA 2WHJA 3E0IA 3QQ1A 2WHMA 4MGGA 4FNTA 1A5OC 2PF0A 1TMLA 3MCMA 3WBWA 3B9NA 2D0FA 3SIMA 3LHWA 5CZJA 4IJCA 5BMWA 2IPWA 3UJSA 1P48A 2CLIA 2VUNA 3LCGA 2QDDA 4L1GA 3P3BA 5FD0A 2ZUMA 1IIHA 2VZUA 2UY4A 2PRLA 1QHOA 2GOUA 3WELA 1OFDA 4GUJA 2HBXA 1CIUA 2ZTKA 2DW6A 2VGFA 2POTA 4AISA 3SRHA 1L6FA 3ZT7A 2ACUA 4RW5A 4HNLA 1UWTA 3NL5A 2YL6A 3C3UA 1W5NA 3QZAA 2J8FA 3EA2A 4QFUA 4QJ4B 3QHMA 1E4IA 3UNDA 3UEQA 1QCWA 2B7PA 3WDRA 4WXZA 4IPIA 4ZCWA 3SN1A 2YA0A 4EXAA 3SGGA 3LI1A 3H2MA 3RPDA 2R94A 3W3OA 3HG2A 2QHAA 4B3KA 3C0QA 3LCHA 1EZ2A 4EP8C 3NQMA 3IVSA 2X1TA 4TX9A 1BGGA 3L23A 8RUCA 3RF9A 4M5PA 3H4WA 3W7QA 1BVNP 5CSYA 4A29A 1LRNA 1QNRA 4INFA 5FA5A 3L65A 1C8XA 2Z25A 1PYMA 1E70M 4AHPA 2GDVA 4MB1A 4MNMA 4ZOCA 3UG4A 1XIEA 3PZ9A 4UWMA 2OWWA 4AMCA 1CXHA 1Z44A 3WQ8A 3CK5A 5ABHA 3RX4A 4TUFA 1PUDA 3SCPA 4QDWA 4JYEA 3N2BA 1B5TA 5BU6A 4JDBA 2PDIA 3ZR6A 1HKVA 4BI7A 4KEUA 4J27A 5A6SA 4HA3A 1R87A 3SQLA 3ALGA 5DT5A 4PUNA 2I5GA 3RITA 5AYZA 5C70A 2ZX6A 3B0VC 1AL8A 3L0GA 1DBTA 1REQB 1A0CA 3ECQA 4O16A 1VFLA 1W9XA 3E0LA 1R9XA 2W4XA 3SIZA 1GQKA 1VKFA 2IXVA 1MEHA 3T0DA 4W8BA 2A4AA 1V8EA 3BQ6A 2AKMA 4UTFA 2DJLA 4U4MA 1Y0EA 2Z00A 1EZWA 2GL5A 2F7FA 1ME9A 2GQ3A 1SYTA 1Q3NA 4DWSB 1KFEA 3VK5A 4YL2A 1LRTA 3TLQA 4NJGA 4DJFD 4R88A 2RFGA 1YRRA 3ARUA 3J7HA 1Q2SA 3WMSA 1NEYA 2AMGA 1WB0A 3DFQA 4MY9A 1FCBA 1OCNA 3OGSA 4W93A 4ZOAA 3TK7A 3IWPA 4PC8A 1M7PA 3TFXA 1ODZA 1MRQA 2CBIA 1I2NA 5FF0A 4BKNA 1YXCA 3BGGA 5HQLA 1CT5A 2OXNA 1TYGA 3VIKA 1CENA 1JCYA 2PDXA 3EWZA 1CBGA 3KX6A 3MC5A 1IGSA 3FS2A 1T8QA 3VIGA 5FAGA 4AIUA 2P50A 3MBFA 2FTYA 5CC5A 2CHRA 1QOPA 4UTKA 1J10A 1UPPA 2NV1A 3N4EA 2WZTA 3DI0A 4WUIA 3A9IA 3BPWA 4S3DA 2YB4A 3A24A 4LUSB 1FKWA 2ZKMX 4Y7EA 1DIOA 1W3LA 5D2WA 5DXXA 1N8IA 1RP8A 2XVPA 4F48A 1X7FA 3CHEA 5KZEA 1EUNA 1VBGA 3HFTA 3T09A 4HN8A 5IFTA 3NQDA 4GUHA 3W86A 3WLMA 1WKYA 4LXFA 4M81A 1ZJAA 3DC0A 1ZAIA 1R46A 1GVEA 3SFKA 1U22A 3K4WA 2E9LA 5CJMA 2PWEA 4JTEA 4CD8A 4F0KA 4LPCA 5C6MA 3TOYA 2D24A 3ABOA 2QCDB 3PB2A 3WBEA 4WSJA 5EMLA 3HPZA 2FZNA 2FYMA 1UC5A 3LRMA 4ZBCA 1RK6A 4LGXA 3FKKA 1W9DM 4HHPA 4H7VA 4HPXA 3GE7A 2PD9A 1R3YA 2PA6A 3TC6A 3H26A 1ZB5A 3TN5A 3VZYA 4HIBA 4FNPA 4IMGA 1H5YA 3FIGA 5F4WA 5E6ZA 2WBKA 1XYFA 3PZTA 1A0EA 3AISA 2QGHA 2GDUA 2R9RA 7CGTA 3ITCA 3KTXA 3DFYA 1YADA 3TFCA 1N8FA 3UVIA 3RHGA 1OZQA 3MVIA 3VO0A 3WH5A 2J75A 1Q6CA 3P0XA 1W17A 2L5HA 2C0AA 4DBUA 1GJPA 1LT7A 1XYMA 4X22A 5DQPA 3MJMA 4OQVA 2YBTA 2QPUA 3TROA 1TTJA 2GVEA 2F2KA 1GK8A 2YKKA 5IXEA 1FRBA 3GDMA 1GVIA 5CPMA 1TO3A 1X97A 4A05A 5LGXA 4FPSA 3RAOA 3MPGA 4N9DA 4DHGA 2G3IA 4AWTA 3W6YA 1Z48A 1Z89A 2V67A 4JTRA 4NF7A 4UBPC 3E9AA 4EPKA 2WC3A 4IFKA 2OJPA 4PMDA 3N19B 1QAPA 4H9XA 1UA7A 1H4PA 3MYOA 2INZA 2PDHA 4AZBA 5H2ZA 1JCLA 4HA4A 5A8GA 4PR4A 4UCFA 2YL8A 5D33A 1L9WA 4JTGA 4ATLA 4OOZA 4E2BA 1FA2A 2QCCA 3QN3A 2YYUA 3KVLA 4LBUA 5T8GA 3OGRA 4QXIA 1UASA 2PDPA 1QBAA 3LOTA 5CGMA 1UBPC 3AOFA 2W79A 3KBJA 1A5AA 4RLIA 4A35A 3SBFA 2ADAA 4RV3A 1QNOA 3N6HA 2CLPA 4CU7A 3QLDA 2X0SA 1AL7A 4E2VA 2ZXBA 3FJNA 3EXSA 1XGDA 4KGJA 5D38A 3TNOA 1DPMA 2QUMA 1W2VA 3S2NA 3SURA 3OZPA 4NXSA 4F2UA 3F5KA 2VI0A 4U3AA 3OO2A 2QYGA 3FNDA 1JYNA 1H7OA 3VD3A 3VIPA 3MB9A 2WNZA 1QOQA 1LQAA 1FDZA 3S8HA 2B31A 1R7OA 1VBUA 3TJIA 1CXEA 3WJYA 4UFIA 2CYGA 3GW3A 1E5JA 1N55A 2VR2A 3K8LA 1RY8A 1XI3A 4LF2A 4JY9A 4WKFA 3W87A 4QRNA 1XYZA 4GGHA 3ZT5A 4AD0A 1MUMA 1XIJA 3GFYA 1A3XA 3BW2A 3WLIA 3M4HA 5I3HA 4E3TA 2HJPA 4I90A 3TYDA 3GNRA 1R3TA 1V7YA 4F9DA 4UOQA 5D02A 4Q7NA 4Z2KA 2J7FA 2DZSA 2E5DA 1A5LC 1WQ5A 1EHNA 1RPXA 4TOQA 1ZPTA 4Z08A 3LHTA 4HP5A 2CCRA 4ZO7A 1UOZA 5KITA 4PMRA 1H7RA 3JUGA 3N17A 1VGAA 3FAXA 1W5QA 4CUCA 4HNCA 4JL2A 1YE4A 4HSNA 3ZWSA 2IKIA 2OWCA 2CLMA 3BCDA 4LB3A 5EMUA 1BKHA 4S3KA 2X42A 2CETA 3CPRA 1R9YA 2E9MA 5G2WA 4NZCA 1A5MC 4AXKA 3M0LA 3OG2A 4IPNB 3R0UA 3S5SA 3LS9A 5CC3A 1L6WA 1XBXA 2CFFA 3NPXA 2VR5A 2QJHA 4JY8A 4YXGA 1JI2A 2J6VA 5A8MA 4B5XA 4R85A 2ZXAA 5LXEA 3T2QA 3TU9A 2GK1A 1D9EA 1XQLA 2AGKA 2NX3A 3BJFA 1E6XM 4OBTA 2ZTJA 3EPOA 4HGXA 4RUBA 1DJYA 3P61A 2XISA 2WZIA 2QV5A 1EJRC 1HGYA 1RCXB 2ZQ0A 2Z1XA 4K8GA 2PP1A 1PWLA 4GQQA 3S2CA 1ZY9A 1XW8A 4US5A 2PB1A 2XIQA 1MXGA 3H2NA 4GBDA 4JTAA 3BQ5A 4EXBA 2FMOA 4MFEA 3T40A 1BYBA 3CO8A 3EYPA 3SRFA 4F0LA 5C2XA 2Y8KA 1LCOA 3LTPA 6XIMA 4BS0A 3FA4A 1CPUA 4JPGA 4HA1A 4UQCA 3B05A 4CD5A 1V3HA 4O28A 3KEHA 3SCWA 4CQDA 3GNOA 1W2PA 4PUMA 3WDPP 4O18A 4GLEA 2X8RA 4H9TA 3WIJA 2GUBA 3MUY1 5D32A 3TC3A 1OQFA 2PDFA 1UZ1A 3L0KA 3I6TA 4KEZA 4LW7A 3SR7A 1A50A 2ANUA 4JIPA 3KS6A 4RW3A 2XSAA 1BD0A 5EBUA 1UB3A 2VVNA 1U83A 2YFNA 3IJQA 1LOQA 4DJFC 3ES8A 4KESA 3R13A 3KBNA 1Q7ZA 2TYSA 1G01A 2Q8XA 3IIPA 5E70A 4A3QA 2QLYA 3MHUA 2X05A 1BFNA 2NX1A 2RJGA 1R8LA 3S1GA 2PLKA 1ZBCA 4GKTA 5FF3A 3S5YA 4L56A 3P2VA 1CXFA 3FOKA 3MU7A 5CEWA 4NRRA 3AIQA 3KVKA 1Z42A 4QE4A 3BWWA 2VXNA 1A47A 4YLWA 4IIEA 3VUSA 3U0HA 1Y5XA 2DSKA 1UD8A 1VRDA 4BZYA 5AC6A 2E4TA 3L4XA 4IF2A 4U2ZA 3BURA 4HMDA 1JZ3A 3G0SA 4PE8A 1FBAA 2JBMA 1R3VA 4P8UA 2VD8A 3WQEA 3LPOA 3GG7A 1NOUA 2HPIA 2PTZA 2XFYA 4HBKA 3JU2A 1S2CA 3H70A 3PFRA 3DYPA 4D71A 1NWSA 1XD0A 4L1WA 1XLLA 1F5ZA 3WLPA 1JI1A 1BTMA 1GQIA 1LBMA 2WSYA 5LNUA 2CLKA 2E1DA 3WBXA 5I09A 2OEKA 3IGHX 3DUGA 4MF4A 4L64A 1UPMB 3I4KA 2V9DA 4LJ3A 4G5DA 4LFYA 5T9CE 3A23A 4DUXA 2YA2A 1U5JA 1WDWA 1BF2A 2ALRA 3EKLA 5CLTA 1Z7AA 3GIPA 5LA2A 4AQLA 4I6KA 3BLLA 1WBHA 4QG8A 4MAVA 1OX4B 3GZAA 1H0IA 4JX5A 2Z1KA 2OX1A 4GVFA 4JTJA 8TIMA 1S3HA 4FNRA 4JNMA 5AKQA 1FWHC 4P8WA 4CCDA 3OLEA 4XK2A 1SPQA 3OA5A 2OGJA 5JUVA 4JZ5A 1I2RA 2VRKA 3DERA 3GXPA 5HQEA 3N2XA 2A3HA 3GVWA 3LGGA 1VYSX 3QZ6A 5EKYA 4DYKA 4IQDA 4WK9A 1DVJA 1JPHA 2A3CA 3GFXA 1EQPA 4LVFA 3B8UA 4X2PA 1NP2A 4C6QA 4IXHA 3SSJA 5AY7A 2QCNA 3F4CA 3TTSA 3MUIA 5C0QA 3BDKA