4A3YA

Crystal structure of raucaffricine glucosidase from ajmaline biosynthesis pathway
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
501
structure length
469
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAUCAFFRICINE-O-BETA-D-GLUCOSIDASE
publication title Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 177
structure length 469
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4a3yA00
2OYKA 1QHPA 1TVNA 1CXEA 1CPUA 3RJXA 3GYCA 4V2XA 1UQZA 1V3JA 3N13A 4E8CA 5AC5A 4UZSA 1Q6CA 4OJYA 5I79A 2WVVB 2ZXAA 2NSXA 1BYCA 4H41A 3AMCA 3CZLA 2DSKA 2VRJA 5KZ6A 1W1PA 4HPHA 2BY0A 2WMHA 4YHGA 3RM8A 1X1NA 1OT1A 4LXFA 2BY1A 2BY3A 2CHNA 2E4TA 3A47A 2OYMA 5IFTA 2WANA 4P7NA 4UFKA 4AMCA 3IJ9A 4WK9A 4EANA 1B9ZA 4XZWA 1NP0A 2Y8KA 3WNPA 1GQLA 2ZX7A 5A94A 3AYSA 4CVUA 2E9LA 1TE1A 2OLHA 4GZEA 3L4UA 5DEZA 3TTQA 3SCPA 3WBEA 3CLWA 3BLKA 1EIBA 3S6TA 1BG4A 4YPJA 3HU7A 1XD0A 3VDHA 4W86A 1V3LA 1CIUA 2A3BA 3VGHA 2O9PA 3AS3A 1E72M 2DSVA 4BCEA 2WB5A 2WWCA 1KBKA 3ZT6A 3CZKA 3QR3A 4W89A 1W3HA 4WSKA 1MQQA 1QHZA 4V28A 2W4XA 1NM9A 1BFNA 3N11A 4HU0A 4W7WA 1E6RA 2CNCA 1JZ5A 2WAGA 5FL0A 1V6VA 4ACZA 2QMJA 1UH4A 2V38A 3AXIA 3EDDA 5JBFA 3NSMA 1W9XA 2WMFA 4DUXA 2DT2A 3W81A 1WZKA 3MSDA 2WLZA 3ARPA 3VIMA 1TA3A 5A6SA 4S3KA 3ECQA 4CD4A 4U2YA 2YDSA 4U2ZA 2X1IA 3DECA 1TUXA 3CHFA 4JFUA 1DWGM 3ZJ6A 4ATLA 3EMCA 4URIA 4K68A 4M56A 2UY4A 1OT2A 5CSUA 2ESCA 5FL1A 2VZOA 4J3SA 1WZAA 1FP8A 3BAWA 3OG2A 1E6SM 4EKJA 1NOFA 3VDBA 3EMZA 1KR0A 3IAPA 1CXHA 3MMDA 2J75A 3AIBA 3VDCA 5A8PA 4Z2JA 4AZCB 5M3WA 4H8HA 2CESA 4YN5A 4JL2A 3AZRA 3W24A 2O9OA 2EPNA 3DHPA 1ESWA 5A6AA 1WAWA 1W9UA 3WUFA 2RGLA 3BAJA 3K4DA 4AIUA 1SR0A 3WEOA 2WMJA 4BZYA 5EBAA 4Z2HA 5CQ1A 2XJ7A 4JCMA 2XVGA 4W5UA 1V3KA 4TTGA 1JZ8A 5LA1A 4FLRA 3B9DA 1PIFA 4PMDA 4QCEA 1OINA 1TVPA 3AMLA 3GTNA 1UWTA 3EDKA 4W8BA 5I24A 2PWEA 3AS0A 2AAAA 3CHDA 3VIHA 4D6GA 1WZMA 3E1F1 5CLWA 3T2QA 4H8UA 1E0VA 4AD2A 4BF7A 1JIBA 1Q4NX 4PMYA 2XUCA 1JZ6A 3GZAA 4UFIA 4M24A 1KGXA 4BQ3A 3QHNA 1EA9C 3PZMA 5EFDA 4BS0A 3PZVA 1JZ3A 4OOZA 5DT5A 1UR2A 5A2BA 4NZCA 1JZ2A 1B90A 3N04A 1JZ4A 5BRQA 4MADA 4PMUA 1C91A 5CLTA 1F4HA 2YL5A 2BV9A 2WXDM 1CEOA 4M1RA 2F2HA 2GUYA 4UQDA 4UTFA 2C7FA 4A3HA 1VFFA 5A6BD 1GQIA 4MB1A 3B8SA 3W29A 2J47A 1V0NA 3AHXA 2YOCA 1LL7A 2D24A 1HIZA 2C0HA 3UR8A 3AS2A 1QPKA 1QBAA 4B15A 1GPFA 1O6IA 6CGTA 3HMCA 3WH5A 3APGA 3POHA 4UQBA 2EPOA 1CLVA 1TCMA 2J7HA 3SCQA 5BROA 1V6WA 5A2AA 4W88A 1VFUA 3WD1A 3AMKA 3VD4A 1OIMA 3PZTA 1LWJA 2XG9A 1UQYA 2BHUA 2VT0A 4H04A 4EE9A 4ZENA 5HOSA 5FD0A 2G3NA 1BF2A 3GBDA 3VKKA 4AZ5A 4KMQA 4D1IA 4IPLA 3NUKA 2QV4A 3VM7A 1C92A 5HPCA 1LF1A 1OGSA 2W61A 2VX6A 3VIPA 4HZ7A 3IAQA 2DSZA 1UKSA 4U5IA 2DEPA 2D23A 3T09A 2DSWA 2VI0A 1QI3A 1CDGA 3MUY1 1UA7A 4ZE4A 4LYQA 3SIMA 4AW7A 3AHTA 3VMNA 1WNOA 1DWAM 4BA0A 2X09A 2WBGA 5A2CA 4JKMA 3OGSA 1EDGA 4JHOA 2E0PA 1DTUA 3SCOA 4PMNA 4U33A 2WCAA 3OLEA 5HXMA 3N12A 3O9NA 4FLQA 2W62A 1HJXA 2EXOA 5ABFA 1KCLA 1B0IA 3GBEA 3UESA 3TA9A 4H8VA 4MJ2A 1NWUA 1YQ2A 3RO8A 3VU2A 1CECA 1E6ZA 1GVIA 3BGAA 4AZIA 3ZJKA 1H49A 1XSIA 3MUIA 1OD0A 2WHMA 3VGBA 4AY1A 4DUVA 1R8LA 1Y7VA 4CN4A 1E3XA 1JL8A 1L8NA 3VX0A 4E4PA 2X0YA 1UKPA 3M07A 4D71A 1UD3A 1GZJA 1L0PA 1XD1A 2VJXA 1B1YA 3WNOA 4J27A 4P8XA 4D6CA 3AICA 3DYOA 3VD5A 3N9KA 1D7FA 4DWSB 4HMDA 2QHAA 2BY2A 3ZOAA 3VM5A 3AMGA 1IT0A 1BVZA 1FHDA 1V02A 1OM0A 1ITXA 2J7GA 1DWJM 5ABEA 3UETA 3PTMA 4MB3A 2FDMA 1MFVA 2E8YA 1KBBA 3SUVA 3WMSA 4JFWA 1E73M 1JD7A 4ATDA 5AYIA 1JDAA 3AFBA 4AWEA 2CBUA 1K6AA 1XYZA 3WF1A 2WNWA 1GOWA 1HJUA 3M6DA 5HPOA 3WH8A 5CGTA 4RE4A 3NDYA 4W87A 2W63A 1QI2A 1R7AA 1KFWA 3SUTA 3OA5A 1FOBA 2WVVA 4JKLA 3GH7A 5C71A 1G0CA 2DPEA 2J62A 2ZOXA 4C7GA 1W2VA 1FFQA 3WMBA 5BXRA 3A4WA 3PZUA 1RH9A 5D9PA 3W82A 4MNJA 1I1WA 2VL4A 2AMGA 2QMKA 1QNRA 1EO5A 4MB4A 4TVDA 3BAYA 1E6NA 1V0MA 3GNOA 4GI8A 3GNRA 3K8LA 1Z32X 3L4XA 3VGDA 2FHCA 1D3CA 2E9MA 4XZBA 1DEDA 3UCQA 1K9DA 1XH0A 4W7UA 3ARTA 2VMFA 4MNMA 1VBRA 1WCGA 2VRQA 1MXGA 1W1VA 2PI6A 3RM4A 4MDOA 1W32A 1FA2A 5A6KA 5A69A 3AQUA 3AROA 3CZGA 3ARYA 2GVYA 3T0AA 3GM8A 3EDEA 4GI9A 4JZ5A 4PRWA 5ABFB 1C8XA 3WDJA 4CGTA 4MJ4A 3OIHA 3ZSSA 4A3YA 3VIJA 3MV11 1VFMA 4HOWA 3RJYA 2ZICA 4TVUA 4HA4A 2CPUA 2FGLA 1QOXA 3DYMA 4MNLA 4HMCA 1HKMA 2GSJA 3RM9A 4AZ6A 3WQ8A 1H2JA 1EGZA 2YL9A 4MB5A 2FGZA 3IJ8A 3IK2A 3ZMRA 2UY5A 1C8YA 4R5EA 3PZ9A 2GDUA 4Z2KA 1H3GA 1NOUA 5HBFA 2GJRA 2XVPA 3T2PA 3K1DA 1QI4A 3MV01 4WKAA 2YLAA 5LA2A 4ZE5A 1KXHA 1XH2A 1VB9A 1DHKA 3WNMA 4PYSA 4S3JA 4C7DA 2BS9A 1MQRA 2GK1B 3AHVA 2G4FA 1MW0A 2XM2A 4L4PA 4D6JA 1UKTA 4F9DA 4AZCA 3WELA 2XGIA 3NCOA 1UKQA 1B2YA 4NSBA 2WC4A 3SCSA 1J18A 2X8RA 2XFFA 5A6MA 2XVLA 4X0NA 3GH5A 3UR7A 4PCSA 4Y7EA 2VX4A 4D6FA 1ISXA 1UOKA 2JF7A 3RPMA 1V03A 3KEHA 2DQXA 4UQ9A 1KXQA 4HOZA 1QI5A 1ZBWA 5BXTA 4UOZA 4LYRA 1JNDA 4CU6A 4CD8A 4JKKA 2W5FA 3HN3A 5E09A 5C8BB 4UCFA 2B31A 1E70M 3W53A 4B3KA 4LX4A 5JUVA 1CGXA 5BYWA 1IZJA 3A6OA 3MMUA 2BHZA 4J3VA 7A3HA 3FXYA 1V02E 1V6YA 2PF0A 4AD1A 1PPIA 5E6ZA 3IJ7A 1CXLA 1BSIA 1D2KA 1WB0A 2FHBA 1CGUA 2XVNA 4MTVA 1I75A 4M80A 1KB3A 4PUDA 3KL5A 2EBNA 1CWYA 3TP4A 4Q22A 4BQ2A 4XB3A 3KZSA 3JUGA 4M8UA 3VGFA 1GCYA 5BXPA 1WZLA 1BGAA 1XYFA 1PBGA 4HOXA 1H5VA 2FH8A 1VBUA 1EH9A 3GXMA 1J0KA 1CXIA 4JFVA 3PZGA 5CXPA 1RPKA 3CUJA 5I3DA 3SUSA 3G6LA 2AOSA 3ALFA 5LA0A 3F5KA 2V3DA 3BSGA 3OGVA 2J7FA 4MAZA 3BLPX 4QCFA 3WDHA 3NIYA 5JBDA 2CERA 2QLYA 1MWOA 3PZIA 2JFEX 5I5RA 5FCZA 2O92A 5KEZA 1BGGA 4OIFA 1J10A 2Z1KA 1VJZA 2XPKA 4F9JA 2VX7A 1E4IA 1BQCA 1WE5A 1ZS2A 1ZBVA 2ZE0A 1R86A 1M53A 1OGGA 4GQQA 2VNCA 3VX1A 1X6NA 1W91A 2V3EA 2E9BA 3TTSA 4AZGA 3NYDA 1CGWA 4TX8A 5D9NA 3OLDA 1KQZA 2VCCA 4D6EA 2XHYA 2ZXBA 1US3A 1UWQA 3VIFA 2ZUNA 1PZ2A 4OOUA 2VZSA 3WDPP 1FP9A 3WL0A 5A95A 3QHOA 1HT6A 3VGEA 2WSKA 5E0CA 2EPLX 1J0JA 3VNYA 3OB8A 4IM4A 5DF0A 3U7BA 4PBGA 4Q7NA 2CBVA 4MAVA 4CUCA 2GJXB 1LG1A 1W9VA 3ZO9A 1LJYA 1ZBCA 3WUGA 3SCNA 3VPLA 2ZWZA 1CXKA 5D9OA 5I23A 1W3LA 4B3LA 2W91A 5I77A 4HA3A 3CUGA 3EDFA 4WKHA 2BVYA 3MS8A 3WNNA 3AZSA 2JIWA 3VGGA 4J3XA 1LQ0A 2O9TA 1B31A 4PMXA 1W9BM 1AVAA 1PAMA 1GVYA 1HKKA 2WVTA 2DSUA 1EOKA 1OCQA 3AISA 4FLSA 2CKRA 1XSJA 1OWQA 1AMYA 1UD4A 1MFUA 3CZ8A 5HNNA 3SCWA 3WEZA 1UR0A 4D6DA 3UG4A 3MMWA 4AIEA 3A3HA 3T08A 2WMIB 1QW9A 3O2LA 3CBWA 2WHLA 3FHAA 2ZX9A 1M03A 3VUPA 3BH4A 2PWHA 4JFSA 1A47A 3WD0A 4JIEA 1XRVA 1W1YA 1IZKA 2WVUA 4TXEA 3THCA 1JYVA 4HTYA 2XGBA 3ZJ8A 3U7VA 1KGWA 4J3TA 4DWSA 1LL6A 1E43A 4RL3A 2DH3A 1JDDA 4KH2A 3ZT5A 1HX0A 1PZ3A 3WIJA 1TZ7A 4UFMA 4UFLA 2VR5A 5ABHA 2PWGA 3SCVA 1H0IA 4RE2A 4MNKA 3SURA 1HJQA 3ZQ9A 3EBVA 2NW0A 1BHGA 1PX4A 2WSPA 4P7QA 4B9YA 3QOKA 4M82A 2UY3A 1ZBKA 2X0HA 3AZTA 3NSXA 4M29A 4QLLA 1B3XA 1B3YA 3EDJA 1S46A 1UR8A 2J4GA 1JAEA 1ECEA 2CKSA 4CU8A 1GJWA 1AQHA 5IHSA 3L4VA 1G5AA 1ZB5A 1E4NA 4KRTA 4WJXA 1UD8A 2YKKA 1UD6A 3F4VA 2D2OA 1B30A 4B9ZA 3WH6A 3PHAA 2XWEA 2Y5EA 1TG7A 1GQKA 1WKYA 1A3HA 1JYNA 1YHTA 1DP0A 1XGZA 4GO9A 5A8QA 2OWXA 2JIEA 1BVNP 4QP0A 3BMVA 1SYTA 1N82A 2WHKA 4HZ6A 1E15A 4ZXLA 4H7VA 4UFJA 4E8DA 1UD2A 2YA0A 3GH4A 2V5DA 3CPUA 1J0ZA 2X2YA 4W85A 4TVCA 4UQAA 3MU7A 3VIIA 4EK7A 1QI0A 1V3IA 1E0WA 3PBGA 1HKIA 3RDKA 2G3IA 4OBSA 2VOTA 1KXVA 1G9HA 4PCTA 2UY2A 2YDQA 3L2LA 2BVDA 2D0FA 2OWCA 3WF3A 2ZUVA 4KGLA 4M81A 1GOIA 3ALGA 2D20A 3ARUA 2J7CA 3WF0A 3K8MA 3L4ZA 4GINA 3ARQA 3VMOA 1Q6GA 1JD9A 1HL8A 2G3JA 5ABGA 3SEPA 2BXZA 1BYBA 2RGMA 1GJUA 1W3JA 1NQ6A 2WMKA 4ZFMA 2ZUWA 1WDQA 5JIPA 3EMQA 4WF7A 2EQDA 4CD7A 4OBRA 1C7SA 3DC0A 3VILA 5IXEA 5FOOA 2Y8VA 5AYBA 4U3AA 2PB1A 1BLIA 2VC9A 3IANA 3TOPA 3CUFA 3LPFA 1I1XA 3W6LA 3DYPA 4XX6A 2D22A 1NWSA 2J25A 1VEOA 3VINA 2D1ZA 1QBBA 1V0LA 1XC6A 2CYGA 1IV8A 3U5YA 3WQ4A 1MW1A 2GK1A 5EMYA 4DM2A 3RCNA 3RIKA 3ZIZA 4N0RA 2WLYA 4U3CA 8CGTA 5CSYA 3UERA 1CXFA 1WDRA 3SCRA 3SCTA 1J12A 2QPUA 3GNPA 1FH7A 2BXYA 4W84A 1HL9A 2WC7A 2Y24A 1XHGA 4C7FA 1UWSA 1G01A 1GORA 2TAAA 1WO2A 1X6LA 1LWHA 4PN2A 2W67A 4V27A 4NRRA 4PTWA 5AY7A 1ODZA 3GDBA 1QNPA 4Z2IA 1CYGA 4W8AA 3GXDA 1QW8A 2WZEA 4UFHA 4Z2GA 2WWDA 1ISVA 1UZ4A 2G41A 3AYRA 2EEXA 2A3EA 5CPQA 1NH6A 3VMPA 1EOMA 3QOMA 1ZL1A 1E6PA 2QF8A 5A8MA 2ZX8A 2JE8A 2VVNA 2DT3A 1OB0A 3L4YA 4GI6A 1C3FA 2FH6A 1VEMA 2YL6A 4F66A 1PX8A 3RILA 2WPGA 2XFYA 2Z1SA 2C8NA 2YJQA 1KWGA 3CTTA 3L4WA 4QLKA 1ZU8A 2D0HA 1XCXA 1FHLA 2VCBA 4GZJA 3QHMA 1EQCA 4JCLA 3WQ6A 3I3DA 3F5JA 2V5CA 2GJPA 1JFHA 1CLXA 3WBAA 1ODUA 3VIGA 1Q6DA 5A6BA 2YL8A 1DWHM 5ECUA 2CEQA 3T0DA 3WEMA 5JIWA 4TUFA 3K46A 1HP4A 3WDQA 3CZEA 1UWIA 5GQBA 4CN1A 1P6WA 1PIGA 1PJ9A 5E6YA 5GNXA 3N15A 1CTNA 2J7DA 1V3HA 6A3HA 1E4MM 1H0GA 1F4AA 1XSKA 1K9EA 1WPCA 4NRSA 3WQVA 3TTYA 1KQYA 2Y4SA 3BCFA 1W9PA 3SUUA 1UR1A 3BAIA 3CUHA 2ZUSA 1W3KA 3FW6A 3AHZA 2VZTA 1Q6EA 2J77A 4GO8A 4AD0A 1VIWA 1RD6A 4L4OA 3WQ5A 1ZJAA 1UWUA 2WCSA 1E71M 4J3UA 1W9DM 3U5UA 1CENA 2WYSA 5LYRA 4FMVA 3BCDA 4TOQA 2E3ZA 1HVXA 1UYQA 3F5LA 3PZNA 3CO4A 1J0IA 2VCAA 3WENA 3A4XA 3LMYA 2X05A 3VD9A 1H09A 3ARWA 2WCGA 4CD6A 5M03A 3GXFA 5A8OA 4PMVA 2YA2A 4AC1X 1VRXA 2J74A 2IXUA 2GJXA 4PTMA 5CPTA 4J3WA 3OZPA 3KL0A 1J11A 2XSAA 2OYLA 2YBUA 1HF6A 1NP2A 3WF2A 2ZX6A 1QHOA 1NOWA 5A6LA 4OZOA 2PBOA 4GKLA 3AXHA 1WP6A 3B9EA 5D8WA 1JAKA 4W5ZA 5A8NA 1KXTA 4PTXA 1K9FA 1OIFA 1FH8A 2FHFA 2DGAA 4U5KA 3N17A 4KRUA 2XIIA 3POCA 2NT0A 5I78A 2JEPA 1CNVA 3FY1A 1V6XA 3MANA 5I6SA 2BHYA 3SCUA 3WFLA 4LPCA 1KR1A 2PBGA 2ZIDA 1JXKA 5GNZA 1C93A 3WSUA 2DT1A 2WKLA 4WLCA 2PWFA 4IISA 2D3NA 4NI3A 3ZSTA 2CIPA 2YLLA 2VR4A 2UWFA 5I2UA 4RE3A 1B3VA 2WMIA 1SMAA 2IXVA 1V3MA 4D6HA 3WF4A 4AIOA 5IDIA 1QNOA 4CCDA 1JNEA 4A4AA 3CMJA 1VENA 1MW2A 3KL3A 4N42A 2DDXA 2DT0A 4UNIA 3G6MA 5FKYA 1H11A 1HJWA 5CG0A 1E40A 4P8WA 1UD5A 3W38A 3ARZA 4JHZA 1U30A 4FLOA 3AIUA 3WH9A 2Q8XA 3BAXA 3I3EA 1PEZA 4JFTA 1GOOA 5I0DA 1ITCA 3OBAA 1LG2A 5CGMA 1VAHA 1RP9A 1EXPA 2WW5A 4QLJA 1XCWA 1EHAA 4AD3A 2OSXA 4AEEA 4WSJA 1E0XA 1ISYA 2W92A 1K9TA 4J7RA 4HMEA 1BYAA 4J28A 2F61A 3K8KA 1E6QM 2DIJA 9CGTA 3PTQA 4ZEPA 5TD4A 2YDRA 1KCKA 4F79A 4YHEA 4ZXOA 3M46A 3OGRA 4QFUA 2VRKA 4AZ7A 4Z2LA 4PUEA 2ZXQA 2CITA 3NSNA 4F8XA 1B3WA 2D3LA 8A3HA 3NDZA 1E5NA 4LGXA 4TX6A 3ZR6A 1CGTA 3WH7A 2JALA 5E0FA 1HJVA 1ISWA 4KGJA 4PMOA 1DWFM 4PSPA 3ARVA 3MKKA 1C90A 2XTKA 3CGTA 1VEPA 3I3BA 1HVQA 4HZ8A 3W27A 1GNXA 4HPGA 2V3FA 3GXIA 2CETA 3CHEA 2YIHA 4QDMA 1GQJA 3LPPA 1EHNA 1NARA 3PZOA 3SUWA 3WUEA 3WNLA 4PEEA 4D6IA 2BFGA 3WD3A 5AC4A 1O7AA 2A3CA 3WDRA 3ARSA 1JI1A 2F8QA 1M7XA 1BTCA 4UR9A 2OSWA 4AD4A 4E2OA 3ARXA 1FFRA 3FN9A 3WQWA 7CGTA 3TTOA 4CD5A 1UWRA 2WHJA 1HKJA 2ZWYA 3ZJ7A 5BWFA 1J0HA 2WZHA 2ZX5A 4GIAA 1MVYA 1CZ1A 1PX3A 2XYLA 2PWDA 3BAKA 3II1A 1H4PA 1UA3A 2J7BA 3VDAA 4WIWA 5A1AA 1E9LA 3CIVA 1J0YA 3MUZ1 2CBJA 4PTVA 3W4RA 2VQUA 1JI2A 2ZUTA 2G8ZA 4NF7A 5D8ZA 4B16A 1UR4A 4X9YA 4ACZB 5GPRA 3NJ3A 4UQEA 3VD3A 2DIEA 3UG5A 3VD7A 3B9AA 1CGVA 4D1JA 1LLOA 1UUQA 1J01A 2IUZA 1E1EA 1V08A 2CXGA 2J8GA 2V3GA 1BAGA 3VNZA 1TA3B 1M04A 1GHRA 1GUVA 4CN6A 2WM0A 5EFFA 3CUIA 5CJ5A 3ZM8A 3OZOA 2J7EA 2WVSA 4JAWA 3VO0A 1JF5A 3U57A 1NWRA 6TAAA 3WD4A 1M01A 2MANA 3AIEA 3AOFA 1AQ0A 4D72A 1U2YA 4OKDA 4FF5A 2O9RA 3N1AA 4W93A 4TTUA 1GHSA 2GDVA 3O6AA 2A3HA 4W8LA 1OSEA 1WDSA 3WDIA 3VIKA 3D5HA 3CHCA 4QAWA 3W37A 4AZBA 4HU8A 3WUBA 4DM1A 1H1NA 1JYWA 1JFXA 3OLGA 4LQ1A 3BMWA 4JL1A 4CU7A 3THDA 3OLIA 1JGIA 3T0BA 5BRPA 1HXJA 1JDCA 1UZ1A 2CHOA 5E9AA 2J78A 1G1YA 2EPMX 2XIBA 3T2OA 1HP5A 1C7TA 1TMQA 3BXWA 5E70A 3KWXA 3WNKA 3AI0A 3AIWA 2JEQA 5GNYA 1UR9A 1VF8A 2DH2A 3WFZA 2VO5A 1B3ZA 2JF6A 4P8UA 3MSGA 4DWSC 5HDRA 1ZJBA 5DFAA 2VZVA 5D4YA 5DMYA 5CPSA 4AEFA 2XFRA 1JYXA 4AD5A 2NT1A 5A6JA 4DUWA 1GW1A 1UG6A 1RP8A 2WMGA 4UQCA 4GXPA 4CKQA 3VIOA 4AISA 1EDQA 4AYSA 1TFVA 1HJSA 1MXDA 2GFTA 1MQPA 4AZHA 1H41A 3TONA 1E5JA 2Y2WA 5BCAA 4EAMA 1QNSA 1JXJA 1UH3A 4LYPA 5IHRA 2QPSA 2VURA 2EO7A 1E56A 4UOQA 2XM1A 3PN8A 4UZUA 5DO8A 2VTFA 2BNJA 1FH9A 1G94A 1SFSA 2WZIA 2J8FA 2VQTA 1MYRA 3ARRA 4BQ5A 1C8QA 1VFOA 2VUYA 2J79A 3PTKA 1KWKA 3A4AA 3AMDA 4CVWA 3L2MA 4P7OA 1HNYA 1E4LA 3FAXA 1WDPA 3MUAA 3WN6A 3FNDA 2CBIA 1V0KA 1E6XM 2WBKA 2XVKA 2WKGA 3N18A 1U33A 1Q6FA 3W6MA 1E3ZA 4ACYA 2ZXDA 2G3MA 1VJSA 3J7HA 2WC3A 2XWDA 2HVMA 4ML4A 1NWTA 4MPKA 2ZUMA 1TR1A 3UG3A 3BSHA 3UEQA 5C70A 1OD8A 1MW3A 3RMEA 1XV8A 1ISZA 1OGBA 5M5DA 3CMGA 3WD2A 4HA1A 4PMRA 3KE0A 3VVGA 2ZUUA 4CCEA 3D3AA 4FK9A 3AIQA 4U31A 1R85A 2XSBA 4PSRA 4H2CA 3AIVA 3L4TA 1V6UA 1BG9A 3W28A 4XV0A 3M7SA 2D0GA 3AJ7A 3BC9A 2OWWA 4XUYA 1W2PA 2A3AA 1GOMA 4AXNA 4PMZA 4CCCA 1QNQA 3LPGA 4BQ4A 4IPNB 1GOKA 5IFPA 1LL4A 2BVTA 4P7RA 3AIRA 3W0KA 1EDTA 2PC8A 1QVBA 3WL1A 5BXSA 1W1TA 1AQMA 2EPKX 5M17A 1BPLB 3DHUA 4MDPA 2HISA 3CH9A 1SMDA 4WKFA 3WY1A 2E8ZA 1US2A 3MO4A 5JBEA 5FIPA 5D9MA 1GONA 1OBAA 1JZ7A 1CGYA 1R7OA 1E55A 3AHYA 3K4AA 4UOJA 4IUGA 4P8VA 4PMQA 3ZT7A 3HJEA 4KWUA 7TAAA 3LPOA 3VTRA 1JG9A 1R87A 4ATWA 3PZQA 3WKZA 4GQRA 1EQPA 2W66A 1XH1A 1J9YA 5CZKA 2VZUA 2VVSA 2WK2A 5A3HA 3FAWA 3VOCA 5DT7A 4HP5A 1KGUA 3WMCA 3W26A 2YBTA 3AS1A 1UH2A 1EO7A 2VX5A 4GPNA 2CCRA 4GZIA 1UKOA 1CBGA 2OSYA 4OUEA 5EB8A 4R27A 1HN1A 1JF6A 1GOQA 3QGVA 4DWSD 3EYPA 4P7LA 1DWIM 4X0VA 3W25A 2YA1A 3FHQA 1BYDA 3S2CA 3ZR5A 5F7UA 1UHVA 4W7VA 1E1FA 2EJ1A 3AXXA 2E40A 3CZJA
chains in the Genus database with same CATH superfamily
4WY0B 5KITA 1CXEA 1TWSA 4O4WA 1OY0A 3AXKA 4O1FA 4MZ8A 1DE6A 1MDLA 4OJYA 3VDGA 4H41A 1SJDA 3TEVA 3AMCA 1GKRA 3FVDA 3LX9A 1R2RA 4RZ6A 1OX4A 4B5UA 4HPHA 3V0UA 5HQEA 1X1NA 4LXFA 2BY3A 3LBMA 4S23A 3TDFA 4HNOA 2WANA 4UFKA 2DFAA 3IJ9A 5LNSA 3WNPA 3UP8A 5FJTA 1TE1A 1UCWA 3IUDA 4GGHA 3TTQA 2X1UA 1G4SA 3L4UA 4LYKA 2INFA 4KEMA 2Y5SA 1FRBA 1BG4A 3DENA 4LT9A 4YPJA 2QJGA 4IZGA 4KFNA 3P82A 5DX7A 2WB5A 4MKSA 2WWCA 4ORIA 1KBKA 2GUBA 4WSKA 1MNSA 5D09A 4KCWA 3CV1A 1TPDA 1BFNA 4IFKB 1F9CA 4FSAA 1JZ5A 4PUKA 5FL0A 3E0LA 3UZXA 4XKMA 1UP0A 5JBFA 4DUXA 4JIRA 3W7LA 3P5ZA 1XKYA 4JNMA 3MSDA 4L7ZA 4DNMA 1V51A 2POTA 4ES4A 2WLZA 3VIMA 3ABZA 1Y5XA 5EYWA 5A6SA 4YYFA 4AEOA 4J35A 1TCDA 2FJKA 3O1NA 4DB7A 3ZJ6A 3EMCA 4ZB5A 4E2VA 4A8LA 4I8YA 1JCNA 2UY4A 2V81A 4MF4A 4RKAA 5FL1A 1UB3A 2JK2A 2QAFA 3S46A 2PDNA 1BTMA 1KR0A 1Q7ZA 4S3GA 3MYPA 4NZ5A 4XBKA 1VYRA 2J75A 2V2HA 4RNFA 3PJTA 4Z2JA 4H8HA 4QAIA 3OBKA 4LV4A 3FDKA 4O18A 2CESA 4YN5A 5LIUX 3W24A 2O9OA 2PWVA 3DHPA 3R8GA 1WAWA 3D46A 1WA3A 3THQA 3GR7A 4N6EA 3C5QA 4A22A 4HD5A 5I09A 4BZYA 2PF8A 2OQLA 4NIRA 4C6NA 2P1FA 4FLRA 1CX9A 3GDMA 3G1XA 3GTNA 3RHGA 3TXZA 2ALRA 3VOIA 3ZLHA 3ATYA 2AKZA 4XAPA 1ZJHA 2G0WA 3WLLA 1XCFA 2BGNE 1FDZA 3GAYA 4PMYA 4UFIA 1SZNA 3AUJA 3G5EA 2QIWA 1JZ3A 1EWEA 3WJWA 5DT5A 3QTPA 1N2VA 4RZ5A 1TX2A 4ZL1A 4MLRA 3P81A 1JZ2A 2NX1A 1C91A 1EZWA 1F4HA 3DFYA 2WXDM 3CH0A 2GUYA 4UQDA 4R85A 4MB1A 4XK2A 2HPIA 2CLFA 3BCJA 3MT1A 3OZMA 4LBUA 1LL7A 4IUOA 3H2MA 2DV0A 4IOTA 4XD3A 5KZEA 1C29A 3UR8A 1R46A 3AS2A 2YR1A 3E0IA 5KMYA 4B15A 4PMJA 3BSMA 1O6IA 3HMCA 2QDDA 5BMXA 4UQBA 4L1GA 2R1PA 1H7NA 2R9RA 1V6WA 3SRKA 1VFUA 4NG3A 4ZFCA 2KAUC 3LU2A 2DZPA 2J66A 1UQYA 4H04A 4H9TA 5FEZA 4LF1A 4EE9A 5FD0A 1XS2A 4IPLA 4AG0A 3LTSA 5I02A 2DJLA 2BSLA 4BEUA 3UJEA 2QCDA 3VIPA 2WM1A 1HO1A 4QE5A 3DU0A 2DEPA 3T09A 1LROA 2PDKA 1UA7A 4ZE4A 1FWBC 1YE4A 3MCNA 1DWAM 4BA0A 5A2CA 4JHOA 4NYUA 4LANA 4PMNA 5HXMA 4D8LA 3N12A 4O52A 5G1YA 3HQPA 1HJXA 3GBEA 1VYPX 1US0A 3QYQA 2AL2A 1NWUA 1XLMA 1YQ2A 3BJFA 5HJLA 2YCLB 2G95A 1GVIA 1T7LA 1XRSA 3BGAA 1S5VA 3MUIA 5G2WA 1NJJA 2VEIA 4Q4KA 4AY1A 4DUVA 2PE4A 1JL8A 3VX0A 2IKGA 5AZ0A 3CASA 1GZJA 1KA9F 1UIOA 4AF0A 3UWQA 1F3EA 3DYOA 3N9KA 2QJHA 2B7PA 3ZOAA 3KW3A 3VM5A 1L8PA 3AMGA 3RUBL 2I7GA 1IT0A 4NUWA 1BVZA 1V02A 4BI7A 1OM0A 3SN4A 1DWJM 3CTLA 1R47A 4MB3A 2FDMA 3T9PA 3E6EA 2YDAA 4LVFA 1I60A 4G5DA 2G37A 1JDAA 1F2JA 3QY6A 2WNWA 1PKMA 1O5KA 4Y8FA 4JX5A 3F7JA 4WY0A 1UMYA 3WQFA 3XINA 5HPOA 1OFEA 1XR2A 4IMAA 2ZZ4A 1KRCC 5ECVA 1KTCA 3NO1A 1S2AA 4GVFA 3EPMA 2DPEA 3UWUA 3TYAA 1Q2SA 4XAZA 4V33A 1RH9A 1I1WA 2E09A 1LP6A 7TIMA 3I6TA 5AC8A 2QMKA 4MB4A 2RDTA 1T8QA 1V0MA 3UXIA 4ZO8A 3BLIA 3LXBA 4RXGA 3M6YA 2QGHA 1XDJA 3IUIA 1N8WA 4ZO7A 3VGDA 1D3CA 4H6QA 4JX4A 4MKVA 4XZBA 1SM9A 4UTTC 3UCQA 3E9AA 1B4EA 1K9DA 1Z7AA 3WG6A 1WCGA 4ERAA 1MXGA 2PGWA 1W32A 3AROA 3ARYA 4UTLA 3KDNA 5ABFB 1LLZA 4FI4A 1C8XA 4LRTA 4O14A 2DUZA 2V69A 3OIHA 4JEQA 1IGSA 4A8IA 5M2FX 4IFKA 4GYPA 4HSOA 5IDZA 1DJYA 3UJFA 2W0UA 2PS2A 1UC5A 2ZICA 1EP2A 1FWFC 1OZMA 1TPWA 3DYMA 2RUSA 3IIZA 5I3JA 1IEWA 2QF7A 3RM9A 3NURA 3WQ8A 1Q5MA 2NZLA 2Z7KA 2YL9A 2C15A 2PDGA 3AYVA 3EGJA 3U2OA 4UMAA 2CLHA 4PODA 2GDUA 4K38A 1TQJA 1RAKA 3TV8A 3VZXA 2P8CA 1QI4A 4WKAA 2YLAA 5EGRA 1XH2A 3O15A 1NQKA 1JJKA 2H8XA 3GVWA 2G97A 4NVTA 2X2GA 3W7KA 1EUNA 4XZLX 3O63A 2XM2A 2PRHA 3FSUA 4IMCA 3SQSA 1M68A 1GVQA 4D6JA 1Z44A 3U6WA 4EF8A 3GVQA 2XGIA 3NCOA 3TC3A 4GFIA 5A6MA 2WSRA 1A49A 4X0NA 1V8EA 1KV8A 1W31A 4CLMA 3AAMA 1V77A 3A13A 5FAJA 1UOKA 3Q37A 4XIMA 2JF7A 3M4HA 3RPMA 2XH0A 3GWQA 5CZSA 1ZBWA 1XYCA 5BXTA 1OQFA 4TX9A 1XLDA 3LV6A 2OT1A 1MMFA 4AH7A 5JVLA 5E09A 1E70M 3W53A 5JUVA 5AB3A 5HNTA 1POKA 4B4HA 5B7YA 2BG5A 7A3HA 2A6NA 2FDSA 4QTGA 1V02E 4NJHA 2PF0A 3EX1A 4JHMA 2MUCA 5E6ZA 3HTWA 1D2KA 1KO0A 3VOHA 3QW3A 2KZHA 3INPA 4BQ2A 3GHTA 1W3NA 4M8UA 3QZEA 1GCYA 1WZLA 3P5YA 4UXDA 5CC6A 1QW7A 4JTEA 1PBGA 1VBUA 3LRMA 4R9OA 1AK5A 3W7MA 3PZGA 3NOYA 5CXPA 1TIWA 4FX6M 4N4QA 3G6LA 2GZXA 3M5XA 4QX4A 4FOJA 3TTEA 2OKOA 3L0NA 4NAFB 3WDHA 4MAZA 1IWBA 2DVTA 4PZVA 3ELFA 2CERA 2QLYA 2JFEX 1VJIA 3QF0A 4QNWA 5LHFA 1XBZA 1OC5A 1BGGA 1EJSC 1PUDA 3VUSA 1DJQA 2XPKA 3KVLA 1ZS2A 1ZBVA 3B8WA 5CG7A 3QQWA 3VE9A 1KC7A 1FCQA 3VX1A 2CLLA 3B04A 4AZGA 1K7XA 4YJ5A 3HQOA 2HPMA 5I00A 5D9NA 3RN6A 4KCVA 1Q3NA 1US3A 1FVPA 4EF9A 3ATZA 2ZUNA 3BGJA 4OOUA 4HK7A 3WL0A 5A95A 2W3ZA 3VGEA 2D2JA 5E0CA 3RITA 2EPLX 2H90A 2GGIA 4PBGA 4PH6A 4EP8C 1KBLA 6ENLA 1W8GA 3WK0A 3W1NA 4CUCA 3VNDA 1TPVA 3QKZA 2C71A 3APTA 1PZ0A 3L7RA 1LG1A 3ZO9A 4K8GA 1SQ7A 1ZBCA 1W56A 4FA3A 3LI1A 8XIAA 4DJEA 2E1DA 3GTIA 3NL6A 1TV5A 4MOZA 4GVIA 1WXJA 3VKCA 5I23A 3BG9A 3V18A 3CUGA 2RDWA 5K7JA 1OCJA 3OODA 5CSSA 3VGGA 1W1A1 5HMSA 4YXGA 3W88A 3FYPA 4PMXA 1GVYA 5I3HA 2D73A 4YTUA 3AISA 4AVOA 1KV5A 4NP7A 4JNZA 3TC6A 3URNA 4D6DA 4C6LA 3UG4A 3MMWA 3A3HA 1QW9A 4GBDA 4DELA 2WHLA 2VFGA 3FHAA 2ZX9A 1JEZA 1XIMA 3KRSA 3E0FA 1VLIA 2Z1XA 3KP1A 4JFSA 3MJMA 3MVTA 3W23A 4DXKA 3WD0A 4LAZA 2W6RA 4MIMA 3R10A 1HKVA 3C0SA 4HA0A 3VKDA 4NX5A 4ZO9A 2QAPA 4RL3A 2GWNA 2DH3A 2PC4A 4UWMA 4UTIA 5DCDA 1TJRA 3ZT5A 4XAYA 3G8RA 1TZ7A 2VR5A 5ABHA 5C54A 1F3TA 3R0KA 1H0IA 4DBEA 3LHUA 5LHEA 2QCMA 3HG5A 2A3LA 3EBVA 3HMJG 1BHGA 1TREA 1RCXB 1S1PA 3QOKA 1T6MA 4M82A 4PC8A 2X0HA 2IW0A 3EDJA 4AVNA 1S46A 2J4GA 1JAEA 2CKSA 4GIEA 2SFPA 1AQHA 2A6LA 5IHSA 1DQXA 3L4VA 3IV3A 3E96A 1VBHA 4F2UA 3DFPA 2YCJA 2D2OA 3VNKA 1P4CA 1GQKA 4E2BA 1WKYA 4AXKA 1L9WA 5HATA 1GYLA 4ALDA 3TC7A 5DRCA 3S6OA 4EPDC 2OWXA 2PLKA 4AFYA 2DZTA 1BVNP 1YTDA 4Q7BA 4QP0A 1L2QA 4H7VA 4L9XA 3MYOA 2WQDA 1Q4WA 4E8DA 2QUMA 3G22A 1G6CA 4XO6A 3CPUA 1GJPA 1ICSA 4TVCA 4L6OA 3SY8A 2Y7GA 4DZHA 1LBLA 2DZBA 3FLUA 4N6FA 4QITA 1R3SA 3AWOA 3RDKA 2G3IA 4JDBA 1G9HA 2A2IA 3WF3A 1FCVA 2RDXA 2J7CA 3K8MA 1O1ZA 3MHGA 1EP3A 4WVXA 4WJ8A 3SEPA 2D2HA 1RPXA 5C9ZA 3G3MA 1C7SA 2ACUA 5FOOA 3BLFA 2OO6A 5AYBA 1R3WA 4WDTA 5K9XA 4IFRA 1BXCA 4LS2A 1O1HA 4LB3A 3LPFA 1I1XA 1SO4A 1KFKA 2AAMA 3DYPA 3QLDA 2J25A 3TSDA 5AVHA 1DJIA 5G1TA 3IIPA 5DBUA 4NYYA 4QIUA 4YVXA 1IIGA 2ZRUA 4GQBA 3UF9A 3CMFA 4DM2A 1DORA 3RIKA 1WDRA 3QEZA 3W2KA 2QUVA 1J12A 3GNPA 2PTYA 3EB4A 1HL9A 2B7QA 5EMLA 4RUBA 3GVRA 2Y24A 4C7FA 5LSMA 5AHEA 2FZBA 4QISA 3O6YX 1G01A 3D3FA 2TAAA 3WJYA 3S83A 4PN2A 4O1DA 2WSYA 4V27A 4NRRA 2DZVA 3STPA 1DTNA 4B5TA 3BICA 3QFWA 3B97A 3GHRA 1BKHA 1KW1A 2WZEA 4Z2GA 3UPMA 3G0SA 1UZ4A 2EEXA 1EF2A 3L2IA 1F7BA 3N6HA 3WBWA 3PJWA 4JTSA 4FXSA 1E51A 4Q4RA 4LVDA 2R14A 3ZR4A 4Z0SA 4XKYB 3W9ZA 1IXQA 4LUSA 3RILA 4DI8A 4Q4MA 2WPGA 1HW6A 3OO2A 3W7QA 1Z8AA 4K2SA 3HPAA 2XH7A 3CQIA 3CTTA 3UVAA 3S1VA 4QLKA 1GTEA 4RZBA 1Q6LA 3OA3A 2PP3A 3A5VA 1QATA 2P5NA 5KZMA 2GGEA 3R8HA 3WQ6A 1JVNA 2V5CA 1ITQA 4KF1A 1JFHA 4DO7A 3WBAA 3GB6A 2YL8A 1XIIA 1M7JA 3EWZA 4XAGA 1QT1A 3HFYA 1M65A 1PHWA 1TMLA 5GQBA 1PIGA 2FQIA 1A5UA 5GNXA 3N15A 3CL7A 4EPBC 4XBSA 3ZS4A 4NAFA 3CWHA 2R82A 4NRSA 3T40A 1PTDA 2Y4SA 4MMWA 3SUUA 2Z0IA 3CUHA 1GVOA 3WQEA 1XUZA 2ZRZA 5LNUA 3GIPA 3L9CA 1FXQA 3C3UA 2NWRA 3QVQA 1VIWA 3OG3A 3M64A 1T40A 1QU4A 1PZ1A 4O53A 2PAJA 3TSMA 4H01A 1XLFA 1CENA 3KRZA 3S3GA 3SQMA 2E3ZA 4QROA 3PZNA 1J0IA 1GOXA 1NEYA 2R1MA 3A4XA 2VFHA 2X05A 3VD9A 4FOUA 3ARWA 3PPHA 3GXFA 5A8OA 1TPB1 3QC0A 3K1GA 2VEKA 3WLSA 4PTMA 2GOUA 4J3WA 4RLIA 1ZAIA 3KL0A 4AX6A 2YBUA 1HF6A 4R34A 1Q13A 1V7AA 1W3TA 1NP2A 1NOWA 2PBOA 3AXHA 1WP6A 4W5ZA 1KXTA 1OIFA 3N17A 4IQDA 4LRSA 2INZA 2NT0A 5H2ZA 1VPYA 5FJUA 1NTHA 3S5YA 3EOLA 1IQ8A 1P0NA 3DZ1A 3LOTA 1FCBA 3VC5A 1DIDA 3GFYA 3WSUA 4NI3A 2VR4A 4ORMA 4RE3A 3AALA 5DY2A 1QK0A 3IJDA 1A5SA 3C2OA 4QBXA 4L1WA 3IRDA 5IDIA 3MBFA 4IMFA 4A4AA 3CMJA 3VKJA 1VENA 1BXBA 3I68A 2QKFA 3KL3A 4EPKA 3KTXA 3SDOA 5HUPA 4UNIA 4F0RA 5FKYA 3THAA 1DJHA 1RQHA 4GY1A 4K3ZA 4Z0JA 1UD5A 4C90A 3HV8A 3ARZA 4JHZA 1HQTA 1U30A 3DGRA 1VD6A 4FLOA 3AIUA 1T96A 3LZ3A 5ABTA 3OBAA 3NNTA 4IF2A 4Q4QA 4ERIA 5CGMA 4Q32A 3TE9A 1RP9A 5REQB 4QLJA 4L4MA 1EHAA 2OSXA 4JDYA 1YDYA 1UUMA 3CPRA 1BYAA 3NZGA 4J28A 4WOQA 3UXLA 3MB9A 4DF0A 3CIXA 1VKFA 1XI3A 5TD4A 2INEA 5AKQA 1S3HA 3CXOA 5CPLA 4F79A 4YHEA 3QYSA 4AHPA 1QFEA 3M16A 3OGRA 4X22A 3CWOX 3N3MA 2VRKA 4AZ7A 1PKYA 4CCZA 2CITA 1B3WA 2D3LA 8A3HA 2H8ZA 1FHVA 4TX6A 2JALA 5E0FA 5CBIA 4UC5A 3RXZA 3ARVA 2P88A 3MKKA 4EXQA 3A22A 1GKPA 2QR6A 1HVQA 1K6WA 1PKNA 2PMQA 2V3FA 2CETA 3U9IA 3AU2A 3OVGA 2HE5A 4QDMA 3FEQA 5GJMA 3WUEA 3WNLA 4ADTA 2BFGA 4D6IA 3SGZA 5EY5A 5D33A 2GGJA 4QRNA 2XISA 2F8QA 4AC7C 1QXLA 1GZ1A 2ISDA 4AD4A 2YPIA 4E2OA 2QUTA 2JGQA 1ZY9A 3PULA 3FN9A 4B3ZA 7CGTA 3TTOA 4CD5A 4G8TA 2EKGA 2A21A 4ZOCA 1MVYA 3TWBA 1PX3A 2XYLA 3W7PA 3W7RA 5FEWA 3BAKA 2CWNA 1H4PA 1K8YA 1H50A 3IGXA 3V75A 2O4MA 4WIWA 3CIVA 4Y90A 2CBJA 3MCOA 3S9YA 4PTVA 2QCEA 2ZUTA 3RPDA 4NF7A 3PBMA 3RMJA 1I6NA 1F6YA 2ZKMX 6PTDA 3WLKX 3UG5A 2E28A 2VWSA 2IUZA 1LCOA 4E0CA 1WKEA 2J8GA 4KRZA 4IMGA 4FR6A 1M04A 2ISWA 5EFFA 1R3YA 2C16A 5CJ5A 1X8CA 1HG3A 5CPNA 3OZOA 2J7EA 4PUWA 2NQJA 3VO0A 1JF5A 3DI1A 3IIXA 1DXFA 4HSHA 5T26A 3AOFA 1AQ0A 1R3QA 3O05A 5SWUA 4W93A 2VR2A 3G1SA 1GHSA 3O6AA 2A3HA 3T8LA 1G7VA 3Q58A 5AYZA 4TMCA 3E2QA 1ADDA 4P2VA 2WO5A 4US5D 1MRQA 4PFMA 4XQ6A 3LCHA 3GNDA 1H5YA 3AO0A 4XKYA 5TIMA 4S2BA 4DM1A 3LERA 1R3VA 3HG3A 2ISFA 3BMWA 3PR2A 4JTKA 4DLMA 3OLIA 3G0XA 2Y61A 5C9UA 4AWTA 2J78A 5CBJA 1T99A 4IX0A 4AYGA 3LNPA 2ISSA 1XJBA 1HP5A 1C7TA 1IR2A 5BU6A 3HPFA 1SU5A 3AIWA 1MDRA 1RV8A 3SBFA 3SRFA 2DH2A 1SSGA 2VO5A 2JF6A 4POCA 4DWSC 1ZJBA 3G18A 3C2YA 2POZA 5DRIA 3EX3A 3VC6A 5CC5A 4UQCA 4CKQA 1HKWA 4AISA 4AYSA 2ZC8A 3XISA 2HV5A 1B4KA 4KBXA 4C5YA 2XN1A 2C1IA 4KIEA 1UH3A 4LYPA 1E56A 1C9DA 4NQ1A 2XM1A 3PN8A 5B7ZA 2OEJA 1KLYA 3SADA 4O15A 4KESA 3DN5A 3W75A 5IOBA 3GR4A 4OWGA 5D04C 3VNLA 2VUYA 2J79A 4HQVA 3UPBA 1YDOA 3L2MA 2Q3OA 1HNYA 3S0CA 1E4LA 4GVHA 3MUAA 4IICA 2XVKA 4GY7A 2WKGA 3N18A 1U33A 3W6MA 2G3MA 2WPBA 4LV9A 4MPKA 4S3EA 1RY8A 2ZA3A 3GR8A 3UG3A 1Z6KA 1I2PA 3LS9A 4GYKA 1ZUAX 1WUFA 3HBLA 2YW3A 1VP5A 2PFHA 3WBYA 3KE0A 4H00A 3D3AA 4FK9A 4S3DA 4HYWA 4ZOEA 2EGZA 3DUGA 3SJ3A 3L4TA 1BG9A 4CNSA 2CZ5A 4QJ3B 3GC4A 5LIXX 3R2GA 4AIBA 4XUYA 3ID7A 3LPGA 4IPNB 1GOKA 2OZTA 3S1UA 2VGFA 4RPPA 2EPKX 3DHUA 1ZAJA 4FNSA 2HISA 1SMDA 4A21A 2JQXA 4NL1A 5FIPA 5D9MA 3LENA 1CGYA 5G5IA 1P1XA 1UROA 3AHYA 2QDHA 3K4AA 5DLCA 4PMQA 4H9UA 3MC5A 3K4WA 3B0XA 1JG9A 3IGSA 1R87A 1IEXA 4ATWA 3M0KA 4X61A 3A3XA 1TTPA 2P50A 1J9YA 5CZKA 3T0CA 4HT3A 3IVTA 2VVSA 4ROQA 1EJTC 2Z6IA 4HP5A 4XZIA 3W26A 2FMOA 5DCEA 3LLFA 4GPNA 4L5ZA 3ZVIA 1K77A 4GUHA 1L6YA 1NY1A 1DWIM 4X0VA 3K30A 4WY0F 4H7ZA 3FHQA 1RD5A 1BYDA 2FZ8A 1TE6A 2J9YA 3LN3A 1V5XA 3UVIA 2GUUA 4PCFA 1QHPA 3UFYA 4U28A 2WOQA 2VENA 3VKBA 1A3XA 3VFLA 3E5PA 4LVBA 1R9ZA 3QW4B 4MZ1A 3QPYA 1LOSA 3B3DA 2DIKA 3N13A 4UZSA 4F0LA 1M41A 5I79A 4E38A 3UBPC 1DXIA 1EWDA 4R7JA 1Z42A 4L9YA 4ZO6A 1LZOA 2X16A 1OK6A 4GG9A 4MFEA 2E4TA 2QNEA 4LAUA 1BRLB 3LCFA 4XZWA 3LUTA 1TPEA 3HF3A 4DJFD 5A94A 4CVUA 4GZEA 1AH3A 3DFHA 1MUCA 3KCLA 4D8AA 3CWNA 3S6TA 3GIQA 4MWAE 3VK5A 3VDHA 1CIUA 4HYRA 3TN3A 2O9PA 2YXOA 4LAKA 1NVMA 3ZT6A 3QR3A 1W3HA 1ZRQA 1AZ1A 3DHFA 4BEQA 1NM9A 4O54A 3R13A 4W7WA 2CNCA 3K13A 2EG6A 1MXSA 3S1GA 1V6VA 3NVDA 2QMJA 1UH4A 4OT7A 2V38A 4QSFA 1WXZA 3TNBA 1YE6A 2DT2A 3W81A 3Q65A 1OX6A 5F1UA 1WZKA 4GYFA 3ARPA 1JDEA 3CHVA 4CD4A 4MHBA 1O68A 3WZ0E 2X1IA 1TWDA 4JFUA 4UTMA 1DWGM 4O16A 3BTNA 3GW3A 1Y65A 3DFTA 5AYYA 3WLQA 2ESCA 2VZOA 3PPCA 3FYOA 1I8JA 3BAWA 4DX3A 1E6SM 2DZAA 2E25A 4EKJA 5AFDA 3VDBA 5T8GA 4J40A 1TSIA 2HS6A 4UR7A 3UR5A 3AIBA 4A6GA 3G1AA 4JL2A 1FBAA 1ESWA 2QYGA 1W9UA 1E9IA 3NXFA 4GCXA 3BAJA 2G3FA 3QXBA 4UIOA 4AIUA 1SR0A 3LZ5A 1QCWA 3TAOA 2VYOA 2WMJA 1QJWA 2XJ7A 2XVGA 4W5UA 1QK2A 3UYCA 4TTGA 1NF7A 3PBYA 1JZ8A 5LA1A 4KW2A 2ZADA 3UWZA 5AZ1A 1PIFA 1EJWC 3UYIA 3SQLA 1OINA 4GNKB 1TVPA 4NX0A 4W8BA 1XF0A 2PWEA 3L5MA 1PTAA 3R7MA 4L65A 3E1F1 5CLWA 3GW0A 1JCJA 3T2QA 4H8UA 4BF7A 3W07A 4JTGA 1LLWA 3ME3A 2XUCA 4M24A 4YTQA 1EC9A 3M5VA 4XBJA 4BQ3A 3PM6A 3PZMA 1J6PA 3THUA 1BD0A 1FDJA 4OGZA 3G24A 3LEPA 4REQB 1UJPA 3BQ6A 5A2BA 5J04A 1B90A 4G1KA 1CEOA 3E12A 1UJQA 2OQHA 2EKCA 1OFOA 3W1QA 4Q4SA 1VFFA 4Q8PA 3B8SA 3UY7A 2BWGA 2BODX 1V0NA 3N4EA 2YOCA 3UD6A 1HIZA 2C0HA 1QPKA 2C0AA 1XYAA 2ZFAA 6CGTA 5G2IA 1CLVA 4XSLA 1TCMA 5CAHA 2J7HA 2R1KA 4B90A 4E4FA 3EWXA 3RFAA 1UOZA 4O1CA 4UMCA 3AMKA 3CT7A 2Y6ZA 4A35A 1PDYA 5HQMA 1I0BA 1FWRA 3TN5A 2BHUA 2VT0A 2F84A 3DKLA 2ADAA 2F9RA 1EGVA 4ZENA 4NJIA 5HOSA 1BF2A 4AZ5A 5C2CA 3GO2A 1SZRA 4D1IA 3U48A 3URBA 5DMMA 3RR1A 2GOKA 3OYXA 3VM7A 2HNEA 1EJVC 5CEWA 1ADOA 1QTWA 4BR1A 5HPCA 3CPGA 5A6TC 3UY8A 1OGSA 2VX6A 3LSBA 4GIYA 2DSZA 3ERPA 4HCLA 1Q45A 1EC7A 3OPSA 2WNQA 3KTCA 4Q8QA 2ZRWA 2DSWA 3LYEA 3QM3A 3MW7A 4O50A 4AWSA 1ZPTA 5D2VA 3SIMA 4AW7A 1LOLA 3AHTA 1WNOA 1EDGA 1JUBA 3FJNA 4MY8A 3H2AA 4U33A 2PDPA 3OLEA 1LORA 2IQDA 2QJIA 2W62A 2IS7A 1B0IA 4G6CA 2HJPA 4MJ2A 3XIMA 2X7WA 3AYTA 5H8PA 3RO8A 3VU2A 3W7HA 1CECA 4AZIA 5JU6A 2WJEA 3ZJKA 3LBCA 1OD0A 3VGBA 3H12A 2F7FA 2TSYA 3GNXA 1R8LA 4WXZA 1WOBA 1JPIA 1I2OA 3RLUA 5K9DA 1UD3A 1EKOA 2JKPA 2ON3A 3LHTA 2VFDA 2YSWA 4XSMA 1B1YA 1AG1O 3AJXA 1Z3NA 3C8NA 3AICA 4IFOA 4OHQA 2QHAA 3LV5A 1JUEA 4I90A 3Q4DA 1PV8A 1FWNA 1TJPA 5DY3A 3W3OA 4NILA 1FX6A 1ITXA 2J7GA 4RX0A 3UETA 4YWSA 1LT7A 5CPMA 4AHQA 4IG2B 4JR5A 1WAUA 1KBBA 4JFWA 5HJXA 1YBQB 3SO7A 2R6OA 5AYIA 5I3FA 3KCJA 4DBUA 4YMZA 3NQAA 1HJUA 2PCQA 5BNKA 2VFEA 4KWOA 5DCBA 3UJRA 1ZP3A 3NDYA 4ZZ9A 2HBVA 3GH7A 5CBBA 3FJ6A 1A0CA 2NV9A 1O5XA 2J62A 3C2VA 6ALDA 1W2VA 1RVKA 1NF0A 3WMBA 5BXRA 3AU6A 2QJJA 4MNJA 3FIGA 4GACA 2AMGA 2OPJA 1TTQA 5XIMA 3BAYA 3GNOA 2ZDSA 1BRLA 3GNRA 1Z32X 5HWJA 2E9MA 3UZ5A 5J5RA 1S38A 5H6HA 1DEDA 1XH0A 4W7UA 4MNMA 1VBRA 5H1WA 3O6CA 1W1VA 5A6KA 5A69A 3F4DA 1I0DA 3CZGA 3T0AA 3GM8A 1I2QA 3EDEA 2A79A 4GI9A 1XIEA 4JN8A 4DBWA 1ZSXA 4CEXC 2Q3RA 5AHNA 2QCFA 4CGTA 3ZSSA 3VIJA 3QLLA 1XLKA 4PFHA 1JUKA 1XIDA 2W79A 3RJYA 3MJYA 4TVUA 2Q6ZA 2CPUA 1QOXA 3EOEA 1KRAC 3S42A 4HMCA 2GSJA 4QE4A 1H2JA 1EGZA 4IPPA 2O0TA 3PB2A 3IK2A 3WLOA 3ZMRA 2UY5A 4R5EA 4C6BA 1W54A 2TPSA 1W3IA 4JYDA 3NQDA 4Z2KA 4H6EA 1YXYA 2QEZA 3T2PA 3MV01 5LA2A 1KXHA 2DQWA 4L80A 1R6WA 2XU2A 2NXGA 1EPXA 1POJA 2PDYA 2YZ5A 3WNMA 4S3JA 5HANA 5CCZA 4US5A 4CQBA 1IXPA 1W5NA 5LKYA 2BS9A 3PG8A 3RU6A 1MQRA 1MW0A 3E5BA 1IE7C 3OJGA 2VM8A 3CEPA 4L4PA 4IQJA 3CQJA 3NL3A 3A5FA 3FJ4A 4M0XA 2IPFA 4ADSA 3UZWA 2C6QA 4C5ZA 3WELA 1IEQA 1E9ZB 4GVGA 3SI9A 1X98A 1UC4A 4A3UA 1KM6A 5FESA 3PFRA 3R79A 4C1NB 3FCPA 5JMUA 1ISXA 5GJPA 5IBXA 1F6PA 5T9CE 3KUMA 3DEQA 3URQA 4UB9A 4KWWA 2NSOA 1KBJA 1UIPA 2W5FA 3W00A 4LX4A 2V6AA 2Y89A 1C9WA 3JVAA 4RXFA 2YCIX 1IZJA 3PVFA 2BHZA 4F48A 3FXYA 5H8UA 1PPIA 2GVLA 3BWWA 3HPSA 1CXLA 1A5KC 3LRLA 4K8EA 5HNUA 2XVNA 4MTVA 4M80A 1V4YA 2VEMA 1W5MA 2P0IA 4M6QA 4H6KA 2DUXA 4LAOA 4OVXA 1BEUA 2OOFA 2HMCA 3JUGA 4KWVA 1TV7A 1BGAA 3Q2DA 1QPRA 3RX2A 1DPMA 2ZA1A 4REQA 1Q8JA 3OP2A 4JFVA 4Y8EA 4YU1A 1ZALA 2PD5A 4I5XA 3U2ZA 3SUSA 1FWGC 3G1FA 3QV8A 3ZWSA 1U1JA 5F4WA 3H53A 1HO4A 1YXDA 3L65A 3OGVA 4QNEA 4H9ZA 3BLPX 3UZYA 1WUEA 1DXEA 5JBDA 1XPGA 5CGQA 4JN7A 3M5ZA 4ZSUA 2O92A 4OIFA 3GFZA 3A23A 3E49A 2Z1KA 3TKFA 4PCNA 4F9JA 1E4IA 1WE5A 3O07A 1LT8A 1NDYA 1R86A 1M53A 1SJAA 1OGGA 4GQQA 1QUMA 5TAOA 1VHCA 3TTSA 4HCDA 4C6QA 4F0SA 3NYDA 4TX8A 3HGRA 2VCCA 2XHYA 2ZXBA 2J8TA 4KETA 3QHOA 5D2YA 2WSKA 3VNYA 3GVVA 4Q7NA 2CBVA 1TRIA 4YCOA 2GJXB 1LJYA 1XP3A 2FZNA 1G4EA 4QR6A 1NFGA 4LNCA 4DYJA 2HVNA 1DV7A 3DHDA 1CB7B 1E1CB 1A5OC 1W3LA 3L5AA 3M41A 1K8CA 2WJZA 3GYEA 2BX7A 4WKHA 3MS8A 3G1DA 3WNNA 2JIWA 4Q6XA 5FAGA 1LQ2A 1OADA 1W9BM 1ICQA 1HKKA 2DSUA 1OCQA 4FLSA 1XSJA 4R9XA 5LXXA 1UD4A 3VXGA 4HCHA 4ECLA 4U4MA 5HNNA 2Q01A 1BWKA 1G4PA 2Y0FA 3SRDA 4A3QA 4AIEA 3HV9A 3QY8A 3T08A 2WMIB 1UPPA 3PNZA 4NASA 1BWLA 3H2FA 1UPMB 2IPGA 3KOZA 3BH4A 1W1IE 4JTJA 3W7EA 4XZMX 4MY1A 3EWCA 2O7SA 2OO0A 5E5CA 3S2LA 2E68A 4MJZA 1IZCA 3EB2A 4TXEA 3THCA 4I7VA 3ZJ8A 3D47A 8TIMA 1EF3A 1QWKA 4J3TA 1LL6A 2OT0A 3NPXA 2E77A 4NI8A 4O28A 1JDDA 4HZMA 2ACSA 4HJWA 3WIJA 3SIZA 4UNKA 3NEVA 2A7NA 4FX8A 2G4JA 4E4UA 4HHMA 3SCVA 4IG2A 4MNKA 1HJQA 1P48A 3B9NA 3ZQ9A 3BG5A 4Y2WA 2NW0A 2ABAA 1TPH1 1EB3A 4B9YA 5D38A 4DIAA 1ZBKA 4M29A 1FUYA 3SJNA 4ZB0A 3ABQA 2YYUA 3BVJA 2HNHA 1X97A 3T42A 1ONRA 4EVZA 1ZB5A 1E4NA 1UD8A 1RZMA 1UD6A 3TJIA 2RDUA 3DCPA 3WH6A 4PTNA 2XWEA 4DJFA 3M7WA 2OZ3A 4UNLA 1DP0A 3BQ5A 1XISA 2JIEA 3PUEA 2VP8A 5LNWA 2WHKA 4O8RA 1DHPA 3CL8A 3KBNA 3GDRA 4ZVJA 1F8IA 4UFJA 2YA0A 1XIJA 3UWWA 1W37A 2C1GA 4UQAA 3T78A 2I5QA 4O19A 2ZRXA 3P6LA 1V3IA 2J9ZA 3LSCA 3PBGA 1HKIA 2HXUA 2VOTA 1KXVA 3W2UA 4PCTA 2UY2A 4NNBA 3L2LA 3PAOA 4L64A 1P0EA 4M81A 1GOIA 1SR9A 3N73A 2QW5A 3TMQA 3GZ3A 3N3TA 2KX9A 1F8MA 3SW6A 1TTIA 1AH0A 4H3DA 5J5DA 3ANUA 3VMOA 3FA5A 4RNJA 5ABGA 2BXZA 1BYBA 1VCVA 1GJUA 1U5VA 1W3JA 3TOYA 3H23A 3M0MA 5JIPA 1XIGA 2A0NA 2VGGA 4WF7A 3ITXA 4OBRA 3DC0A 3EEZA 4U3AA 5FEPA 4AB4A 2PB1A 4HNVA 2NVDA 2ODOA 4HK6A 3TOPA 4XX6A 2CZVA 1NIUA 4JTRA 1VEOA 3GQYA 2B0MA 3U4FA 2G50A 3RG6A 1QBBA 1V0LA 1J2BA 3S9IA 3WLJA 3U5YA 1X6UA 4QJ1A 3DG3A 4ZTXA 2YXGA 1MI3A 1YPIA 2WLYA 2QIIA 5CC7A 8CGTA 3W73A 3SCRA 3B0YA 3SCTA 2P10A 1MNZA 4W84A 2Y88A 1NDVA 2DVXA 1I4NA 4FXRA 4MG4A 1GORA 1WO2A 4RK8A 4QG6A 4C6OA 3A9IA 1LWHA 4C1NA 4YTSA 3GDBA 3P61A 3KVJA 4XG1A 4Z2IA 1CYGA 1QW8A 5HNRA 4HGXA 1EOMA 4B2DD 1PHQA 1E0UA 3HGOA 4DYKA 3LCLA 2JE8A 2VVNA 3WCZA 4JQ2A 4GI6A 3R94A 1VEMA 1S5NA 2Y8UA 5G4HC 1G69A 5BWAA 2XFYA 4OV4A 3L5LA 4QXIA 2YJQA 1J93A 3L4WA 4F2BA 1ZZMA 3LXCA 2D0HA 1FHLA 1K4HA 4GZJA 3QHMA 5G4WA 2PDIA 3U2CA 3ENLA 3LHYA 3I3DA 2GJPA 1MEWA 2J6VA 1CLXA 1ODUA 1Q6DA 4NKCA 1TVLA 4O0QA 5JIWA 4TUFA 1NSJA 4DF2A 5FF4A 3MI2A 3CZEA 3MUXA 3T05A 1UWIA 3BOFA 1SZGA 4CN1A 2ZTJA 1OFQA 3GRIA 2J7DA 6A3HA 1E4MM 3KBMA 1H0GA 1DJXA 1XSKA 4M7SA 1WPCA 2Z6JA 3WQVA 3TTYA 1QO5A 4E3VA 3BAIA 1U5HA 4RR4A 2ZUSA 4BKNA 1W3KA 3TAKA 2OXNA 3FW6A 1VCGA 2J77A 3GVGA 3DFNA 1RD6A 4PB4A 4R7WA 3W1TA 3NQFA 1ZJAA 1UWUA 4R53A 2OGYA 3W87A 5LYRA 1JRBA 1UYQA 3TN6A 4B5XA 2XIQA 2VCAA 2AL1A 5D02A 1QOPA 2AQVA 3LMYA 5AN7A 5MKGB 2WCGA 3TQVA 2YA2A 4AC1X 2J74A 3KOXA 2IXUA 2GJXA 5CPTA 6TIMA 3NAVA 2UV8G 2C14A 1J11A 2FVMA 4QDPA 1AW5A 1QPQA 2ZX6A 5AVNA 5C9XA 3BJTA 5A6LA 3B9EA 3B0VC 3B0UX 1E1CA 4LVAA 3ZXWA 3V5FA 2OEKA 1FH8A 4U5KA 4KRUA 2JEPA 1CNVA 4XUGA 1WDWA 3FY1A 4PUNA 5I6SA 2AQWA 3BK0A 3STEA 3SCUA 3WFLA 1KR1A 2PBGA 4M1BA 3STFA 3NPUA 4XAFA 1JXKA 1GVSA 3T4CA 3NQGA 3OVPA 4NZ1A 3W1XA 1P6BA 3D6NA 5TBOA 5MF5A 1B3VA 2WMIA 3ZVHB 3WLTA 3IJIA 3WF4A 1QNOA 4QM1A 2QJMA 3LHWA 1FY6A 1FWIC 3WLIA 2HROA 1VCFA 4E8GA 3M44A 1MW2A 4QDWA 4N42A 3TW6A 2DDXA 2CHRA 3G6MA 3TROA 4UTUA 2PDLA 3W38A 3DESA 3WH9A 3I3EA 4QHRA 3MZ2A 4JFTA 2J9XA 1GOOA 5I0DA 1ITCA 1LG2A 2V2CA 4KCUA 1ZP4A 2I16A 1VAHA 3W83A 3N29A 1UP2A 2WW5A 1M3UA 2YXXA 3KDOA 3DFOA 3BGGA 1XCWA 2UBPC 3QPZA 1VYSX 4AD3A 3GDTA 4IL2A 4AEEA 4WSJA 2NUXA 1DJGA 2GVGA 2C18A 1SO3A 9CGTA 4ZQMA 3PTQA 1OC6A 1PE1A 1PL9A 4BI6A 1KCKA 2HEJA 4ZXOA 3APYA 3TW9A 2HTMA 4QFUA 5C9RA 4JTQA 4E3TA 3BO9A 2PGFA 1OFRA 2OMAA 2GLKA 4Y96A 5T9BG 1AD1A 1CGTA 4H83A 3WH7A 1KRMA 2DORA 3LG3A 1HJVA 4Y9OA 4LNYA 4FAMA 4PMOA 2PDQA 1VEPA 4HZ8A 4HYVA 4ZGYA 4Q8WA 1A5CA 5CSRA 2ZVRA 2YIHA 1GQJA 3W71A 3SUWA 2ZZ7A 2V5BA 1RR2A 2A3CA 2Z1VA 4HPNA 3ARSA 1O94A 4LWWA 4UR9A 3R0DA 2ZRVA 4L56A 4JN6A 3ARXA 1FFRA 4J2PA 3L0KA 3WQWA 2WHJA 1HKJA 2ZWYA 1J0HA 2WZHA 1REQB 3MMTA 2NQLA 2PWDA 4GJ1A 3DI0A 1MSSA 1UA3A 1A5LC 1J5SA 1Q2RA 1H7RA 3MUZ1 4KEVA 4MSSA 4DJDD 4HHLA 3W22A 2VQUA 1JI2A 1K8ZA 3I7RA 2GQ9A 3MVIA 4ACZB 1O12A 1AW2A 3VD7A 1CGVA 3MKVA 4D1JA 4QJ5B 4OUIA 3LGGA 2V3GA 1BAGA 1FWAC 2IPWA 1TA3B 1KFCA 2ZZ5A 1GHRA 4C6IA 1EYEA 5DXXA 3BANA 4IH3A 2PRMA 5EMMA 3R12A 1XL9A 4F0KA 7PTDA 4WUIA 1H62A 2VDGA 4DJEC 2Z2UA 2VGBA 5DANA 4D72A 1B54A 4FF5A 3NQ8A 1IR1A 1Y8BA 1LUCB 4NJGA 4W8LA 2NQHA 1IYXA 4NHVA 3BLLA 3S4TA 4WHBA 4OQVA 3CHCA 1RA0A 3SFWA 4QAWA 3W37A 4AZBA 2XFWA 3LY0A 4GMEA 1JYWA 2PDXA 3OLGA 1ME8A 4LQ1A 4NAEB 5D32A 1R9XA 4ZODA 4JL1A 3Q94A 1SFLA 3KBVA 3QPEA 3T0BA 1P6CA 4TV6A 1UZ1A 4GIRA 2FMNA 5FACA 2EPMX 4GUJA 3LGEA 2WZMA 4KS0A 3H7UA 2I1OA 1TMQA 3WNKA 4C65A 4E2DA 2JEQA 1TV4A 3WFZA 2OTDA 1B3ZA 2XIMA 4PTDA 4ENLA 3MSGA 1E9YB 5DFAA 2VZVA 5DMYA 1N55A 2XFRA 1JYXA 5A6JA 4DUWA 2ACRA 3P14A 2WKJA 3BLOA 1RJRA 1IHIA 3L12A 1GEHA 2XIJA 1TFVA 1MXDA 5LIKX 1Z9AA 1MQPA 1A0DA 4WSHA 1N8IA 1YX1A 3TONA 1XQKA 3IWPA 3LQGA 5BCAA 5D05A 5IHRA 2EO7A 2D2GA 3VNMA 4UOQA 2PWUA 2QVHA 1BQGA 2FFIA 5DO8A 2VTFA 2V30A 1FH9A 4OFCA 1G94A 1P1MA 2DZXA 2B7OA 2FB3A 1TZZA 2R1NA 4L61A 4CQAA 3I7QA 3PTKA 1H7PA 1OCBA 1X1OA 4DVOA 3OHIA 4WDWA 3WN6A 2WQPA 4H8NA 5MKGA 2CBIA 1V0KA 2WBKA 3T81A 3TNOA 4EWJA 1CW2A 1D8WA 2WC3A 4ML4A 3W86A 2YZRA 1NWTA 3WQGA 4DEFA 2ZUMA 4LW7A 4DBDA 5F2MA 5CZ0A 1MW3A 2NV2A 3RMEA 2QQ6A 4B5WA 5M5DA 3EEGA 2XDFA 4LEFA 3AC0A 3MI6A 3V1HA 4LH8A 1H60A 2ZUUA 3C4UA 4GLEA 2ZYFA 3AIQA 3DH7A 4U31A 1R85A 3EPNA 3ABSA 3PBWA 2J24A 1V6UA 1XLLA 1W0MA 1JGMA 3AJ7A 1U1UA 3NGJA 1IWAA 4K36A 4AXNA 3H21A 1WOAA 2OU4A 1MZHA 3ZVHA 1JQVA 4PA8A 4S2CA 2PC8A 3WL1A 4GOAA 2F2KA 4PB3A 1W1TA 1AQMA 1BPLB 4P5UA 4L9ZA 1LRQA 1QAPA 1US2A 3B8VA 3MO4A 5JBEA 1A4MA 1XWYA 5C0QA 1OBAA 1JZ7A 3SY5A 5PTDA 1K8XA 4J3ZA 4PUJA 3TH6A 4LU0A 4MVAA 1M7OA 1PVNA 3NTYA 3M1ZA 7TAAA 4PEKA 3VTRA 3LMZA 3B40A 1Z69A 3LRKA 3PZQA 4R88A 2PLJA 3EPOA 3B8TA 4RV3A 5FSDC 4MYXA 4YS1A 1KGUA 3LTPA 3WMCA 3HPXA 1SFJA 4WD0A 1UH2A 3PWAA 2A85A 1EO7A 2J27A 2OSYA 4R27A 2O55A 1GOQA 3QGVA 1VFLA 3EYPA 3W25A 1XRFA 3B9OA 1WBHA 3ZR5A 1RBAA 2ZQ0A 1LOQA 3N14A 4BWLA 8XIMA 4IJRA 2O4QA 3B8DA 2EJ1A 1K03A 3S9ZA 3V7PA 2QDEA 5D2WA 4GY0A 1XRTA 3MZNA 1TVNA 5E0KA 3F4NA 5FF2A 3LCXA 3GYCA 3VABA 5C2GA 1UQZA 1V3JA 4FO4A 4E8CA 5AC5A 1Q6CA 3KM8A 4FIRA 2WVVB 4IGHA 2ZXAA 4WRHA 1BYCA 2GJLA 2GDQA 4H9XA 3G1VA 3H55A 4WGHA 2VRJA 5KZ6A 1W1PA 2BY0A 3W2LA 2WMHA 4JIPA 1YW1A 4QQUA 4C6MA 3UQNA 1OT1A 3H4XA 2BY1A 2CHNA 2VXNA 5T91A 4N7QA 4P7NA 4GHRA 2PZ0A 1B9ZA 4AUBA 1NP0A 1GQLA 2ZX7A 5DEZA 1LRTA 1YNYA 3SCPA 1KM4A 3WBEA 3CLWA 2ZTKA 4GZ7A 3BLKA 1O4UA 3V16A 2BVWA 3UZJA 1XD0A 1KM5A 3P8JA 4W86A 1V3LA 1REQA 1P5BA 4BCEA 2V8ZA 5I3IA 3CZKA 2AMXA 1JCYA 1MQQA 4V28A 1ZTVA 2W4XA 3N11A 4HU0A 1M7PA 4HN8A 2H9AB 1E6RA 4Y9PA 1M1BA 1W5OA 2WAGA 4ACZA 5D2XA 3EDDA 1S2UA 1RLCL 2ZDRA 3RR4A 1TA3A 3C61A 3KAOA 4FS9A 3ECQA 3EWYA 4LJ3A 1OYCA 3BV4A 1KLZA 1PWMA 4IIBA 3DFQA 4U2ZA 1DBTA 3N4AA 4KIRA 3HB9A 1TR9A 3CAQA 3CHFA 2VEPA 5EA9A 3O0FA 4XD4A 4K68A 5FSEC 4M56A 4MKNA 4QS6A 3M5YA 1OT2A 3PF3A 3UG8A 5CSUA 5FEXA 3NXLA 4ASTA 4XTDA 4B2DA 2PD9A 1ZJIA 1NOFA 3H22A 3IVUA 3V0TA 1LUCA 3O06A 1UBSA 3IAPA 3MMDA 2A4AA 3ITVA 3ONCA 3M0HA 5A8PA 2HWGA 4AZCB 3M0YA 4P61A 4L6HA 2OFJA 2FVLA 3EX2A 3P2VA 1A53A 3AZRA 2P8BA 1AJ2A 5A6AA 6XIAA 1EL3A 2PDUA 3MY9A 4MWAD 4NAEA 1P43A 1F73A 3CEUA 4FR1A 3IACA 3WEOA 4NJKA 4FPSA 1WKDA 3GHSA 4A05A 5CQ1A 4UTJA 4QG8A 1V3KA 3SFKA 3GG7A 1B9BA 1J6OA 3S2NA 4PMDA 4QCEA 4HKPA 1N7KA 2PDBA 3AMLA 4V1XA 4PULA 1H1ZA 1BF6A 1UWTA 3EDKA 3KVMA 5I24A 2AAAA 3CHDA 4D6GA 3U0HA 1WZMA 4MJMA 3C2FA 3RF9A 1SW3A 4M6UA 1ZGDA 5HINA 3P0WA 1JIBA 3ICJA 1Q4NX 4J2MA 2V5LA 3N19B 3RLHA 3HGSA 3LI0A 3GZAA 4DAFA 1HGWA 1BVWA 4HHPA 2YCLA 2R8WA 3GG8A 4LY4A 5EFDA 4BS0A 3PZVA 3RLVA 3TJLA 9XIAA 1UR2A 2NLIA 2GSHA 4H9VA 1ZAHA 3NQEA 4NZCA 4UR8A 5CLTA 4D8ZA 3PS7A 4JY9A 2F2HA 4GWEA 3JZUA 2C7FA 4DO4A 3U2EA 1X38A 1AL8A 3W29A 3N6QA 2R94A 3KLKA 2D24A 4B92A 1A3WA 1FKWA 4JNYA 1QBAA 3APGA 3G1HA 4CQ9A 1RXOB 4XISA 2V2DA 3SCQA 5A2AA 4W88A 5EPDA 4DUOA 2PUZA 3MQTA 4KFOA 4RV8A 3A4JA 2OLAA 1F05A 3PZTA 1LWJA 2XG9A 2GWGA 4M19A 3O8AA 2G3NA 1SJBA 2OELA 4WX2A 3VKKA 4KMQA 4FHAA 3Q67A 3WQDA 2HE8A 4QSHA 3C8FA 2PTZA 1LF1A 5I3GA 3HZ3A 2X0SA 2W61A 4HZ7A 4ZOBA 3IAQA 1I9CB 1E0TA 1EBGA 1UKSA 5F2IA 4U5IA 1RK6A 1RA5A 3BLEA 2D23A 4UTWC 1J8VA 1G4TA 2VI0A 1CDGA 4IPIA 3KS5A 1T0OA 2O56A 3VMNA 1O95A 1A4LA 4JTDA 2Y5JA 4JTAA 1UZDA 4FB7A 3WBXA 2E0PA 1DTUA 3PK7A 1W8SA 2WCAA 4IIGA 3NEHA 1Q85A 4JTHA 4GUFA 5GJNA 3W7OA 5CZJA 2EXOA 5ABFA 3S5OA 3UESA 3KHJA 4IXHA 3CQHA 3NQCA 4H8VA 5BOEA 3GKAA 4Q3MA 1H49A 1XSIA 1TQXA 2WHMA 2PCEA 4CN4A 1E3XA 2VC5A 4E4PA 3G0UA 3W2MA 4AX7A 4D71A 1L0PA 3KOYA 1D3GA 4H2HA 4I9JA 5I06A 2VOMA 3NPVA 3GTFA 4D6CA 4JICA 3VD5A 1X7FA 1EJRC 1OG6A 1H7OA 3DBNA 5C6MA 4IJCA 1H1YA 4DZAA 4PB5A 1FHDA 3PAJA 4DBSA 5ABEA 4GH1A 2PDWA 4ZOAA 5L6UA 1OC7A 2E8YA 3N2OA 2ONEA 1J4EA 3TLQA 1OJXA 5EMUA 3AFBA 4AWEA 1B5TA 2CBUA 1K6AA 3UZZA 1XYZA 2CZEA 3DC8A 4C6CA 1XBXA 3LDVA 3HJZA 3M6DA 3MDUA 2FZDA 3HFTA 5CGTA 1GG1A 4RE4A 1YIXA 4W87A 1EX1A 1R7AA 3OA5A 4L6DA 2WVVA 3AXMA 1G0CA 4KCTA 5FI8A 1FFQA 3A4WA 3H6OA 5AYXA 1GVRA 3B06A 2VL4A 2YBVA 4PL1A 3PC0A 1EO5A 3L67A 1SFTA 1E6NA 3EA3A 3CNYA 4GI8A 1X96A 1K7EA 3K8LA 3L4XA 2FHCA 1UW9A 4JTCA 2P3EA 3ARTA 2VMFA 3IS4A 1F61A 2WNZA 3TK7A 3RM4A 4MDOA 1FA2A 3V1PA 1EJ7L 1Z89A 4IHCA 4PBFA 3AQUA 4DJDA 2GVYA 4LCSA 4JZ5A 4I5RA 2Z27A 4IIHA 3T4WA 3WDJA 1KM2A 2GQ3A 3FK4A 4FF7A 3UCCA 4MJ4A 4O57A 3WJZA 1Q63A 2TRSA 4IIDA 2H9AA 4A3YA 3MV11 1L6GA 1VFMA 3TYUA 2OR2A 1I45A 2QCCA 4I3GA 1KTBA 4HOWA 3KS6A 1X1ZA 3GAKA 4GFSA 4ICCX 4HA4A 2FGLA 4JTUA 5JH2A 4MNLA 3VCNA 3QBUA 3P84A 1HKMA 3ZZ1A 3IGHX 2WJDA 4H1ZA 2FGZA 2JKAA 4G56A 1XC4A 2VFFA 2RHGA 3PZ9A 3E02A 5AECA 4TMBA 1RALA 2ZVIA 1H3GA 1X7IA 2X42A 1ICPA 2GQAA 5K9CA 2CXEA 4HB7A 3N6JA 1OYAA 4HJFA 5KTLA 3NL5A 4PYSA 4C7DA 2PDFA 2Y1HA 2XIOA 1R3TA 3AHVA 1TPFA 4XZHA 2VEGA 4WR3A 3DBPA 4IJBA 1PS9A 1TZ9A 4K8HA 4MWAB 1LTDA 1UKTA 3LCIA 4NNAA 4AZCA 4N4PA 2WC4A 3M0IA 1YLVA 2XVLA 1HL2A 3GH5A 3QN3A 3UR7A 4PCSA 1CB2A 2CZFA 1JCMP 2VX4A 4D6FA 3M47A 4Y9MA 5HWMA 1V03A 3KEHA 2DQXA 3PFMA 4NZFA 4UQ9A 1KXQA 4WEVX 4UOZA 4LYRA 4DZ5A 1JNDA 4CU6A 4CD8A 2RJGA 4UCFA 2B31A 4B3KA 1YXCA 3MDWA 4RNHA 1QPNA 2QPXA 1V6YA 4MLJA 4AD1A 1YPFA 5I3KA 3MCMA 1BSIA 3QMRA 2ASHA 1I75A 1KB3A 4PUDA 2P3ZA 5EMJA 4Q22A 2R1LA 4MZYA 3KZSA 4DHGA 3VGFA 3EKZA 1XYFA 2OOGA 4HOXA 1H5VA 2FH8A 1EH9A 3GXMA 1YEYA 3ABRA 1CXIA 1U5JA 1ENUA 3ALFA 4I9TA 3G8EA 2V3DA 2FZMA 3BSGA 2DZUA 2J7FA 4QCFA 4CEUC 3LNMA 1S2WA 3GIYA 5F4XA 3NIYA 5G1MA 1P0KA 1MWOA 5FJJA 4DI9A 1MEIA 3FSTA 5KEZA 1P0BA 1J10A 5L9FA 1AZ2A 1NFPA 1VJZA 3IK4A 2VX7A 4K7YA 4IX2A 3UPWA 2AGTA 2ZE0A 3EWWA 2OODA 4ADUA 4GRSA 1VGAA 4INFA 2I57A 3CB3A 2QT3A 3SAZA 3IJ6A 4QE1A 1CGWA 1GT8A 3OLDA 1QRQA 4D6EA 3P80A 1UWQA 3VIFA 5XINA 1PZ2A 1RY0A 3WDPP 1NDWA 3GUWA 1HT6A 2W9MA 1J0JA 1SGJA 4IM4A 5DF0A 4MAVA 3I6EA 2DZSA 2REQB 4F40A 2D69A 5XIAA 1RJQA 2PDCA 1W9VA 3VAVA 2IPJA 4A8NA 4FOKA 1NFBA 3SCNA 2Z25A 3VPLA 3SRHA 3M0XA 5DXYA 2ZWZA 3CM4A 1CXKA 3BOLA 5D9OA 2ACQA 3S5ZA 3EXRA 5I77A 5HMFA 5CJNA 2BASA 2GYIA 3N2XA 1OFPA 4CNUA 2Z2AA 1LQ0A 4J3XA 1XX1A 1B31A 4AWUA 1EJXC 1PAMA 3I6RA 3CQ0A 3PJXA 1EOKA 3LLXA 2QUUA 2IKHA 3S47A 1MFUA 1F6KA 3O0KA 1HGYA 3SCWA 3WEZA 1FWEC 3M0JA 4D2JA 2X41A 1KCXA 3PJUA 2A7RA 2BOFX 2Q71A 4J4KA 3O2LA 3CBWA 4RNIA 4C60A 1BWVA 3UNDA 3VUPA 2PU0A 1XBYA 3TX9A 2PWHA 1XW8A 3KRUA 4GA8A 2PTXA 1A5AA 4PRRA 1A47A 4JIEA 1XRVA 4YL2A 1IZKA 4KERA 4D9PA 4HTYA 2JGYA 2FVKA 1UR3M 1XGDA 1U83A 4PL2A 4IGMA 5I7GA 3PNUA 1HX0A 1PZ3A 4GNVA 3A21A 4UFMA 4UFLA 4DPQA 1YDNA 1EBHA 5TQLA 4NJJA 2PWGA 4XVDA 4RE2A 1ZHAA 3SURA 1RQEA 3QQ0A 1UMLA 4LUJA 4Q4OA 2BDQA 4P7QA 3LD5A 5I03A 3QV6A 2VC7A 2UY3A 3E38A 3LQLA 3QY7A 1B3XA 4NZ4A 1B3YA 4DZIA 1XFBA 2XSXA 1UR8A 4ZSTA 3JZEA 4CU8A 4PGLA 5CPOA 3F2DA 1GJWA 2OB3A 3CC1A 4JS3A 4HU4A 5C2XA 1JULA 1MUWA 3PHAA 3UCDA 4HMNA 1TG7A 4LB4A 4XZNX 2NUWA 5CKSA 1EGMA 2LLEA 2PGEA 3EA1A 5F2GA 4GO9A 1UWAA 3FXGA 3BMVA 1N82A 4ZXLA 4IP5A 2BXVA 1VRDA 1GYNA 2Z28A 3R43A 4CQCA 1T8XA 3GH4A 4K1GA 1HFBA 2W27A 3MP3A 2X2YA 4W85A 3CJPA 3QTGA 3MU7A 1EC8A 3VIIA 4RPQA 2Q8LA 3GC5A 3GXNA 5AHFA 4NZ3A 1QI0A 1SW7A 4QEHA 4OBSA 3F4CA 2G5WA 2YDQA 4FEZA 2D0FA 2OWCA 1K4GA 1EXBA 3W6YA 3VZYA 4GINA 3CLMA 4PUUA 4PRTA 1PXGA 1Q6GA 3FVMA 2G3JA 4MFDA 3VA8A 1NQ6A 2WMKA 4ZFMA 1WDQA 3EMQA 2EQDA 4CD7A 1S5WA 2B4GA 3U3HA 3VILA 3LTYA 3IV8A 1M5WA 5C7VA 3IANA 5HA7A 2C13A 4ZBCA 1XLEA 3CUFA 3MTWA 4O17A 3W6LA 2D22A 1VBJA 1K0