4A3YA

Crystal structure of raucaffricine glucosidase from ajmaline biosynthesis pathway
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
501
structure length
469
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAUCAFFRICINE-O-BETA-D-GLUCOSIDASE
publication title Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 177
structure length 469
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4a3yA00
1W3HA 1XHGA 4D6CA 4XB3A 4XX6A 3WD1A 3ZR6A 5A6BD 3CZJA 2EPOA 3AIQA 3IJ9A 1E43A 3GBDA 4EK7A 1E4MM 3L4YA 3EDFA 1HN1A 5FCZA 5LA2A 1UD3A 2XYLA 3K4AA 4CU8A 1UA7A 3WFZA 4AWEA 2XG9A 3SUSA 3VIHA 2DT2A 4LGXA 3PTMA 4QLKA 1PX4A 3ZJ7A 4D6FA 1V6UA 5GNXA 3BAWA 4UR9A 3VD7A 4Z2HA 4D6GA 3CMJA 1W1PA 3T2PA 1J0KA 3AYRA 3ZJKA 1CXFA 2G3JA 3WQWA 4IM4A 1V08A 4PBGA 1EOMA 4HOZA 2VURA 3MUIA 5EBAA 1L8NA 2V3GA 4PN2A 9CGTA 3L4TA 2WSKA 4PTMA 3K8KA 2EO7A 2FHCA 1GCYA 3WDPP 3DC0A 3SCNA 3GDBA 3WUFA 3UG4A 1AVAA 3JUGA 1UD2A 1CNVA 2OYMA 2BVYA 2UY4A 4W84A 1WZMA 5C71A 4BQ5A 3NYDA 1CWYA 2PC8A 1O7AA 3AROA 4YPJA 1EDGA 3N9KA 4MNKA 2PWDA 4CU6A 1QW8A 1RD6A 1JNEA 2YL9A 2BXYA 4LX4A 4WF7A 1E56A 2J7EA 3GH5A 3WL1A 2CXGA 2JIEA 2PI6A 4H8HA 2CKRA 2J8FA 1XYFA 1W32A 4MJ4A 1E3XA 2OYKA 3TTYA 3WDJA 1UQYA 5DO8A 4TUFA 4D71A 3CZ8A 2J77A 2J7CA 1AQ0A 4M8UA 1VFUA 1FOBA 2PWHA 2ZUWA 2JF7A 5D4YA 5F7UA 3AXIA 1BLIA 2Z1KA 1JFHA 3BAIA 4QCEA 5I6SA 1B3ZA 5E6ZA 4TOQA 2GJPA 4W93A 4UZSA 1DWJM 3IAPA 1CEOA 2A3EA 2WMFA 5BYWA 3EYPA 1MW0A 1EDTA 3L4ZA 4DWSD 4XV0A 1OGBA 3M07A 4ZE4A 1W9DM 2DEPA 2G3MA 3SCSA 2VI0A 1OCQA 4JFSA 1ISXA 4M29A 3N13A 2ZXQA 2ZUMA 3AS1A 1X6NA 4LYPA 1ZU8A 2W92A 4UQDA 1V3LA 2CPUA 3MV11 1ZBCA 1LL6A 3L4WA 3VIJA 4WKAA 1E6NA 4HZ6A 4PMNA 4E4PA 4TX8A 1V3IA 1E55A 4KMQA 4PMYA 3M6DA 3KL0A 2DH2A 4D6DA 1FH9A 5A95A 1W3KA 3KE0A 2J62A 3SUTA 4X0VA 5DFAA 2VC9A 3LMYA 5DEZA 3WD4A 3L4XA 5IDIA 1ECEA 4DWSA 3BC9A 2JEPA 3EBVA 5M17A 4E2OA 4F66A 3WMCA 4CU7A 4JL1A 1TR1A 2BHYA 3CUJA 4NF7A 3MMWA 1DWFM 7A3HA 4FMVA 3T2QA 2YBUA 1EGZA 3FXYA 5A8OA 3DYMA 2NSXA 3F5LA 1CDGA 4CCDA 4UOQA 5A8NA 3GXIA 1B90A 1D7FA 1MW2A 3AFBA 3HN3A 5FKYA 4UQAA 1QHPA 4W7WA 2UWFA 5BXPA 4RE4A 3O6AA 2NT0A 3WH9A 2VX4A 2YL6A 1DEDA 1XSKA 2UY5A 2Y2WA 3PZOA 4HA3A 3BCDA 4XZWA 1E15A 4B16A 5CJ5A 4JKMA 4WKFA 3UESA 4UFJA 4ZXLA 2DQXA 1SFSA 2WPGA 2VX7A 4B9YA 1BVNP 1TE1A 4GZIA 4IPNB 1DWIM 4W86A 3QHOA 1N82A 3TOPA 1G5AA 2EBNA 1NM9A 4JHZA 1IZKA 1MQQA 1QBBA 1VAHA 6CGTA 1LWHA 4ACYA 4MNMA 2V38A 2ZUTA 3KWXA 1WZKA 4UFKA 3WFLA 1XSIA 4LYQA 2X05A 1VENA 4CVUA 4UFMA 3VDBA 2VZTA 1J01A 1XH2A 1ITCA 1GQKA 3N18A 3GYCA 3J7HA 4OOZA 1K9EA 1PBGA 2VL4A 3AHTA 2YA2A 4MNLA 2YLLA 3CHFA 3VGGA 2X0HA 4E8DA 1E4LA 2XVPA 4HA4A 1W9XA 5TD4A 5A94A 3WDQA 3VOCA 2E8YA 4PMRA 3U5UA 1GPFA 5I23A 1WCGA 7TAAA 5AC4A 2YDSA 5EMYA 1B30A 1JYVA 1V02A 4CN1A 3PZ9A 3MMDA 3VIPA 2VMFA 2BV9A 1BG4A 2GUYA 2O92A 4KRUA 2DIJA 1TVNA 4UTFA 4YN5A 1IT0A 4AEEA 4Q22A 3A4WA 4W89A 1ESWA 2V5DA 6TAAA 1JYXA 1LL7A 1DTUA 1D2KA 4P8WA 5A6JA 3NSNA 4TVCA 2ZUNA 3WNMA 4P8VA 3N1AA 2EXOA 1OGGA 1CENA 1VJZA 2GJXB 3RM8A 2GK1B 4F8XA 3BGAA 1E0VA 1VIWA 3DYPA 1PAMA 1EO5A 1C93A 3FY1A 1CGYA 3OZPA 4M82A 4UFLA 5CSYA 1C3FA 3WNKA 3TP4A 5I3DA 5M03A 1MVYA 1GHRA 1MYRA 2YDRA 1FA2A 2BXZA 1H4PA 3AZTA 1R86A 3W6MA 4N42A 2VRKA 2E9BA 5I78A 1E5NA 3WNLA 1GHSA 1J0IA 4LXFA 4B3KA 2XWDA 3AXHA 3VTRA 1BYBA 3VDCA 2QHAA 3N15A 1QNQA 2VR5A 4JIEA 5HPOA 5E9AA 1GONA 1NP2A 3ZJ6A 1V6VA 2J47A 3N11A 2CEQA 3AMGA 1R8LA 2HVMA 2O9PA 1BFNA 1WAWA 2W5FA 1BYCA 1WO2A 3LPGA 2XFFA 4UOZA 3A4AA 4TXEA 1UR4A 1HKJA 1Q6DA 4S3JA 1C8XA 1XH1A 3HU7A 1Z32X 4CN6A 1XYZA 3AQUA 3RJYA 1JNDA 3DYOA 3AHXA 1W1YA 1IZJA 1NOUA 4FLRA 3AMDA 1XCWA 1JZ7A 4U33A 3HMCA 4AMCA 3WUGA 3T08A 2VOTA 1QI2A 3RO8A 2W4XA 3QOKA 3EMZA 5HNNA 2YJQA 3MO4A 1UD6A 3AICA 4WLCA 4WKHA 5M5DA 1GOIA 1KBKA 4GZEA 2E3ZA 3AIEA 2EPKX 3ARTA 4AW7A 1DHKA 3VD5A 1ZJAA 2VZVA 4OUEA 1JAKA 1M53A 3WF1A 1B3VA 3SIMA 4CD7A 3GH4A 1M7XA 2XIBA 2B31A 3HJEA 1PX8A 5I79A 3BLKA 5EFFA 1OD0A 1J10A 3UETA 4TVUA 1C7TA 3WUBA 1BTCA 1QI5A 1KCLA 4AY1A 3B9AA 2JALA 1YQ2A 2VNCA 1QI4A 4BS0A 1TZ7A 1OBAA 2VVNA 1ZS2A 2FGZA 1TFVA 2RGLA 1OGSA 3WH6A 3RDKA 4GINA 5BWFA 1W2VA 4W5UA 4B15A 4JAWA 1XSJA 3OLDA 3RM9A 1C92A 3AIVA 3ALGA 1O6IA 2J7BA 1B9ZA 4H8VA 1GOMA 3VMNA 3BAYA 1HXJA 1NWUA 5M3WA 1OIFA 1WDSA 2DGAA 2WMGA 1WZAA 1B3YA 1FHLA 2WVTA 5A6KA 4V2XA 3MS8A 5BROA 4CN4A 3N17A 3WQ8A 4PMDA 3E1F1 1V3JA 1I1XA 5AY7A 4PSPA 5A6AA 5IFTA 1NWRA 5C8BB 1VF8A 1CGVA 1EHAA 1WNOA 2WHJA 3WNOA 3ZOAA 4F9JA 1TG7A 3ALFA 1GORA 3WD3A 4PMZA 3OBAA 1HJWA 4AYSA 1MQRA 3VX1A 5A2AA 2NW0A 1RP9A 4QLJA 1DWAM 3ZQ9A 3WN6A 4CCEA 3PZGA 2YDQA 1JXKA 4MDPA 4PTVA 1C8QA 5HPCA 2WM0A 2WMHA 2BVTA 4LYRA 4EE9A 2VQTA 4P8XA 4PMQA 3GNOA 1CXEA 4W7UA 4OZOA 2EPNA 4MPKA 1HT6A 3QOMA 3GZAA 4DM1A 3M7SA 2D23A 3T0AA 2A3CA 4PSRA 1UKTA 4RE3A 4AZIA 3BMWA 1FP8A 4AD3A 3SUWA 5A6BA 4JFTA 1KBBA 3OLGA 1NWTA 4GXPA 3EMQA 2PBGA 4S3KA 4M56A 1MXGA 1TUXA 1AMYA 5BCAA 4D6IA 4X0NA 2VRQA 2GJXA 1M04A 4B9ZA 3WELA 2GK1A 7CGTA 5CLTA 1KXHA 3AHZA 3CUHA 2VCBA 3PZQA 1M01A 1V0MA 2D24A 4HOXA 2CHOA 4U2YA 3T2OA 2BY1A 3FHQA 2G3NA 2XVKA 5EB8A 2GVYA 3FNDA 3W0KA 1G9HA 4PTXA 5AYBA 3BH4A 3PTKA 4AD0A 2ZX8A 4JCLA 4WSJA 2VX6A 1MQPA 4HU0A 2ZX6A 1R87A 1BQCA 2CHNA 3VINA 2GDVA 2IUZA 3WEMA 1E70M 1KQYA 4Q7NA 4A3YA 2XVLA 2JIWA 3FHAA 3CUGA 1W3LA 1MW1A 2QV4A 5D9PA 1CGXA 1PIGA 1VEOA 2OWXA 3ARPA 4PRWA 4FLSA 1CGUA 1TMQA 1JZ6A 3VO0A 2V3EA 5JBEA 1UD5A 2D3LA 2W91A 5AC5A 1CECA 3RPMA 1BSIA 1VFFA 1NOFA 1QBAA 1UWTA 3PHAA 4GZJA 1PZ2A 1W9UA 1V6XA 2G8ZA 3CZGA 4KWUA 4J3UA 2XFYA 3ARZA 2Y4SA 1HKMA 4JKKA 4DUWA 4GI9A 3W53A 1AQMA 2J4GA 4QAWA 4U3CA 1WPCA 4OIFA 1V0LA 3AHYA 1KFWA 2YA1A 1V02E 3T09A 4UQ9A 3ZIZA 2A3BA 2WVVB 5I24A 5HOSA 2XJ7A 3O2LA 1XRVA 3CUFA 2D22A 4OKDA 1KQZA 2FHBA 3U5YA 5IXEA 1DWHM 2W63A 1E6PA 2O9RA 1GJWA 2CNCA 4J27A 1H0GA 4GI8A 1E3ZA 1PPIA 1HL9A 2ZWYA 1E6SM 3DECA 3NCOA 2XUCA 2WLZA 3RILA 3OLEA 3TTOA 3EDKA 1WDQA 3WEOA 2WWCA 1NQ6A 3F5KA 1ISYA 5CPSA 3L2LA 4MB5A 5JIWA 5KZ6A 5DT7A 4MADA 1OT1A 2WMIB 1I1WA 1HJXA 2E9MA 1UHVA 2BHUA 1HP5A 2WZEA 2FH8A 3W38A 5BXSA 4YHEA 1BPLB 1J0HA 3QHNA 1MXDA 2WW5A 1LL4A 2XVNA 2XPKA 2VCCA 4LPCA 2J7FA 4DUVA 4PUDA 4Z2LA 2IXVA 2WBGA 4WIWA 1K9TA 3SCRA 3GTNA 4UNIA 1UR9A 1EO7A 3MUZ1 2V3DA 1V3HA 2Z1SA 4HPGA 1HVQA 1CPUA 4HMEA 4NI3A 3U7VA 3KL5A 1CXHA 4GKLA 4AC1X 1V6YA 4J7RA 1JG9A 3MV01 3SCPA 1JYNA 4PMXA 1BGGA 1KXTA 1SMAA 4MB1A 4W7VA 2PB1A 1CLVA 5IFPA 4FF5A 4GQQA 2VRJA 1A3HA 2WNWA 5BXRA 2WMKA 2X8RA 2XWEA 3AMKA 3DHUA 2QF8A 4D6EA 1ODUA 1VEMA 2WHKA 1B3XA 4M24A 1J0ZA 8CGTA 1EOKA 1LQ0A 1E1EA 3OG2A 3CGTA 1RPKA 3F4VA 5IHRA 1SMDA 1HX0A 1VFMA 1OINA 1G1YA 4UZUA 2J78A 2OLHA 2XM2A 3WH8A 1HP4A 4D6HA 1W91A 2E0PA 1KWGA 3BLPX 4EANA 3VX0A 4AD2A 3RMEA 4J28A 3ARUA 1JF5A 1K9DA 3WF2A 2EPMX 3OB8A 3ZM8A 3UR7A 3L4VA 1XH0A 3BAXA 1U2YA 4ZXOA 4DM2A 4AZ6A 3UEQA 1E0WA 3VDHA 3UCQA 1W9PA 2YLAA 3CTTA 2VZSA 4F9DA 3W26A 1Q6CA 2E9LA 3BXWA 1VEPA 2DH3A 2AAAA 3MSGA 2DSWA 4L4OA 2XIIA 1Y7VA 1HIZA 3CMGA 4JFWA 1J18A 1PZ3A 5A69A 3SCTA 3W29A 1BYAA 3VGBA 2D20A 3K1DA 3GNRA 1RP8A 2BVDA 3LPPA 4MNJA 2J7HA 2X0YA 1UZ1A 3G6LA 4ML4A 2FHFA 4TTUA 2XGIA 1PJ9A 3THCA 4HMDA 2PWGA 4KGLA 2ESCA 4AD4A 4J3SA 5I2UA 3EDEA 4AXNA 4RE2A 3CZLA 4BF7A 3MUAA 3WDIA 3NSMA 3D3AA 3NJ3A 4OBSA 2EQDA 3QR3A 2W67A 1YHTA 3VPLA 4EAMA 1MFUA 2VQUA 4NSBA 4PCSA 3WQ5A 1W9BM 3POCA 3SEPA 1E40A 1DWGM 3WDHA 4GO8A 4HZ8A 5FL0A 4B3LA 2GJRA 2J74A 2YBTA 3F5JA 2C7FA 3AS0A 4U3AA 1QI0A 1ISWA 3WD0A 1US2A 5A2CA 1JAEA 4RL3A 1ZBWA 1GJUA 2QLYA 2OWCA 5JBFA 1CXIA 1Q4NX 4P7RA 3CZEA 4D72A 3VM5A 1Q6EA 2VVSA 1E6RA 5CPTA 2WVVA 2XSAA 3CHEA 2O9TA 1UKOA 3ARXA 3WNNA 4PMUA 2OSWA 3B9EA 2VO5A 1ZBKA 3WSUA 3BSGA 3AJ7A 3DHPA 4OOUA 1QOXA 4MJ2A 5ABHA 1JZ3A 1EH9A 4FK9A 1J12A 4U31A 4PTWA 2OYLA 1CYGA 3AHVA 5CPQA 2O9OA 1B31A 1HKIA 4ATDA 1GVIA 1UOKA 2E8ZA 4EKJA 4JZ5A 4W87A 1V0NA 3IAQA 3B8SA 2PF0A 5GNYA 1JD7A 3WMSA 1KWKA 2Y24A 2WMIA 3WNPA 3RCNA 1KGWA 4A4AA 2XGBA 4BQ2A 4WK9A 4U5IA 3GH7A 3VIMA 3W25A 5JUVA 1UWIA 1FFQA 1MW3A 1B1YA 1E72M 2A3HA 1CGWA 2F8QA 1NH6A 1UUQA 4TVDA 2Y8VA 1TA3B 3VD3A 1CIUA 1VBRA 4HTYA 1V3MA 1JGIA 1UG6A 3WH5A 4GPNA 3I3DA 4MTVA 5E09A 3L4UA 2CBVA 2XM1A 4OBRA 5FIPA 4JFUA 3WKZA 4BQ3A 4MAVA 1JZ8A 2E40A 2WK2A 2CETA 4QP0A 4UCFA 2GSJA 5DF0A 1ISZA 1L0PA 4CCCA 3CZKA 3SCVA 1J11A 1E73M 3VM7A 1WP6A 1J0YA 5FD0A 5A6LA 4W85A 1JI1A 3IK2A 3VVGA 1KXQA 2WCAA 1E5JA 2ZX5A 4LQ1A 1HJSA 2D2OA 3IJ8A 3K8MA 3AIUA 6A3HA 5CZKA 3NIYA 2FGLA 1RH9A 1K9FA 3WBAA 2IXUA 1PX3A 3TTQA 2UY3A 2YL8A 2CBUA 2W61A 2J8GA 2ZICA 2BHZA 4JKLA 4ZENA 5CGTA 1HNYA 5GQBA 2XSBA 1CZ1A 1OD8A 4MDOA 1H1NA 3OIHA 4C7FA 4J3TA 1JFXA 5A6SA 3EDDA 1H0IA 2FDMA 2RGMA 2WLYA 4CGTA 3AXXA 4P7NA 3T0BA 4D1IA 3CUIA 1R85A 2WXDM 5E6YA 2CERA 1CGTA 3VU2A 4UQBA 4TX6A 3UG5A 3ZO9A 1D3CA 1GOOA 4Z2GA 1CTNA 3IJ7A 1EQCA 4IISA 2OWWA 4KRTA 2WHMA 4H41A 2WMJA 1C90A 3I3BA 3MANA 2VT0A 3WQVA 4PUEA 2VZUA 2WVSA 3MUY1 1UZ4A 4P7QA 1EDQA 1UQZA 4WJXA 5A1AA 5ABGA 2DPEA 3APGA 1PEZA 3VIGA 1JDDA 3VILA 4X9YA 1GZJA 1H5VA 3AZRA 5A3HA 4HOWA 2G3IA 3TONA 2CCRA 2V3FA 2WC7A 2WAGA 3OGRA 3TTSA 2HISA 1UR0A 3B9DA 1HKKA 5HBFA 1MFVA 3D5HA 1QNPA 1MWOA 5BRQA 4AZCB 4PCTA 1V0KA 5CLWA 1S46A 1BHGA 1UWRA 1GQIA 1E9LA 3EDJA 1JYWA 2VJXA 1QI3A 4URIA 4A3HA 1G94A 1OT2A 3T0DA 1JD9A 3LPFA 1LJYA 2DSVA 3GXMA 4IPLA 5FOOA 2WYSA 3OLIA 3VDAA 4FLOA 2CYGA 4W8AA 4ZE5A 3A4XA 3RJXA 1R7OA 1OSEA 1UWSA 1X1NA 1UYQA 4AD5A 1JZ2A 4KGJA 3WMBA 5BXTA 1KGXA 5A2BA 1FH7A 3PBGA 1NWSA 4QDMA 4MB4A 1E1FA 2WSPA 3THDA 2EJ1A 2ZWZA 1J0JA 1QW9A 3S2CA 3N12A 3ARSA 3W81A 1H3GA 3VNYA 1KXVA 1FP9A 3AMCA 3MMUA 3ECQA 1EHNA 3VUPA 4PMVA 3CO4A 5DMYA 2NT1A 2DT0A 1LG1A 5FL1A 2YIHA 2CBIA 3BAJA 1LLOA 1QPKA 2ZXDA 2E4TA 3FN9A 2ZX7A 1UKSA 4ZFMA 5D9OA 1GVYA 2WB5A 3SCOA 2BY0A 3WH7A 4OJYA 2YOCA 2GDUA 2DT3A 5D9NA 2XHYA 2G4FA 2WZHA 1BGAA 3FAXA 2A3AA 2WCSA 2CKSA 4PYSA 1LF1A 8A3HA 1KCKA 4KH2A 1VJSA 1CXKA 4TTGA 3NUKA 5A8QA 1CBGA 5ABFB 4U5KA 1FH8A 2QPSA 2ZX9A 3VMPA 4UQCA 3AIBA 5CQ1A 1M03A 2ZUVA 1UKQA 4F79A 1C7SA 3CHCA 2JF6A 5HDRA 5LA1A 1WKYA 3W37A 3ARYA 1OM0A 2W62A 2PWEA 2AOSA 4AD1A 5A6MA 1BAGA 1UD8A 1CXLA 1TA3A 4H04A 1XCXA 3ZMRA 3PZIA 5DT5A 4DUXA 1DP0A 2YL5A 1SR0A 3WQ4A 4L4PA 4CD8A 3MKKA 3ARVA 4BA0A 1JZ4A 1IV8A 3CH9A 2W66A 2QPUA 5HXMA 4NRRA 2VX5A 3OA5A 4C7GA 5LA0A 1VFOA 4UOJA 4AIEA 2WHLA 4ZEPA 1G0CA 3W6LA 2WANA 2BY2A 2OSXA 1H2JA 1B2YA 4P7LA 1KB3A 4GO9A 2F61A 5E0CA 5C70A 3AZSA 4AZHA 1KGUA 3OGSA 4MB3A 3WBEA 4GI6A 4P7OA 4UFHA 2JEQA 2Y5EA 2TAAA 4W88A 4AZBA 3KL3A 1E0XA 1WDPA 1OB0A 3KZSA 3A47A 2VR4A 3VD9A 4CUCA 3AS2A 1FFRA 4HP5A 1UH3A 2ZUUA 1UR8A 3SUVA 4Y7EA 4ACZB 4Z2JA 2WBKA 3W24A 2EEXA 3PZMA 2VUYA 5I5RA 3II1A 2J7DA 2OSYA 3M46A 3VIIA 2V5CA 2WWDA 3BAKA 4DWSC 1R7AA 3LPOA 2XFRA 3ZT7A 3WEZA 3PZVA 1HL8A 3GXDA 1W9VA 3IANA 3UG3A 4PEEA 5JIPA 4D1JA 4CD5A 4V28A 2X2YA 3VNZA 1ODZA 4JCMA 1W1VA 1SYTA 1UR1A 2VTFA 1GQJA 2J75A 1H49A 3SCQA 1NP0A 1WDRA 1VB9A 3CIVA 2CITA 1C91A 4P8UA 3VKKA 4IUGA 1CLXA 1WE5A 2Q8XA 3ZT5A 4FLQA 3A3HA 1BVZA 4NRSA 5D9MA 5IHSA 1J9YA 3VIKA 4Z2KA 4M1RA 1E4IA 2JFEX 3U57A 3SUUA 3OGVA 2PBOA 3VIFA 3A6OA 3AS3A 2VZOA 2DIEA 4JHOA 5E70A 1GNXA 2Y8KA 2WC4A 2YA0A 2J25A 4AZCA 3L2MA 3CHDA 2QMKA 4MAZA 4CD6A 4HU8A 4NZCA 2BNJA 2WCGA 1OWQA 3AMLA 4HPHA 3PZTA 4J3VA 1JDAA 1Q6FA 2FH6A 4AZ5A 3TA9A 2J79A 2CESA 2GFTA 3FAWA 3BSHA 4H2CA 4AZ7A 5A8PA 2DT1A 1TCMA 3GXFA 4CD4A 1EA9C 3W82A 1QHOA 3ARRA 1W3JA 2CIPA 1V03A 2VCAA 4Z2IA 4CVWA 3WENA 3RM4A 1PIFA 2G41A 3SCUA 1TVPA 3NDYA 1ITXA 3WIJA 5ABEA 2BS9A 1GOWA 2ZXBA 3CPUA 3O9NA 4C7DA 1H41A 4YHGA 2WC3A 3ARWA 3PTQA 4R27A 1W1TA 3U7BA 1XD1A 1VBUA 5I77A 2ZOXA 3MSDA 4BZYA 4AZGA 5KEZA 1VRXA 4E8CA 2AMGA 1KR1A 1NOWA 5GPRA 4H7VA 1US3A 1XGZA 4WSKA 2C8NA 4AEFA 1ZBVA 5GNZA 3ZSTA 5CGMA 3VIOA 1AQHA 3WF4A 1GOKA 1NARA 1ZB5A 5JBDA 5ABFA 1LG2A 1C8YA 5D8WA 1Q6GA 2XVGA 3UERA 2WVUA 3W27A 1ZJBA 2JE8A 3WL0A 4QFUA 1XD0A 2F2HA 4CKQA 3K46A 4AIUA 3KEHA 1QHZA 1FHDA 1K6AA 3MU7A 4HMCA 3WY1A 3ZR5A 3ARQA 4BQ4A 3VD4A 1WB0A 1GQLA 2DSKA 3AISA 1HJQA 5CXPA 5LYRA 2ZUSA 4JL2A 2D1ZA 3AOFA 1JZ5A 3SURA 1P6WA 3GNPA 1EXPA 4J3WA 1ISVA 3I3EA 1E6QM 1UKPA 1HVXA 3W28A 2D0FA 3G6MA 1JXJA 4U2ZA 3VGDA 5AYIA 1BF2A 1B3WA 5A8MA 2ZIDA 1XV8A 4JFVA 1JDCA 4XUYA 3WUEA 3POHA 1HJUA 5CSUA 1GOQA 3QHMA 1H11A 5E0FA 3FW6A 1EQPA 1E4NA 1GUVA 3AIRA 2EPLX 2XTKA 1BYDA 3GM8A 2PWFA 4HZ7A 1HJVA 4HA1A 1JL8A 2CBJA 1UWQA 3CBWA 4BCEA 2X1IA 3AIWA 4UQEA 1U33A 3ZJ8A 3AI0A 3K8LA 3PZUA 4ACZA 5ECUA 2WZIA 3VGEA 3ZT6A 4V27A 1UH2A 4UFIA 4GQRA 1X6LA 1UH4A 4AIOA 4ATWA 2DSZA 1A47A 1E6ZA 2DDXA 4H8UA 2D0HA 3PZNA 1JIBA 3AYSA 1WZLA 2YKKA 1UA3A 2QMJA 3BCFA 1UWUA 1QNOA 1XC6A 3ZSSA 1I75A 5EFDA 4K68A 3S6TA 4R5EA 4QLLA 3NSXA 4XZBA 3EMCA 2BY3A 3CLWA 1G01A 4QCFA 1EIBA 3OZOA 5D8ZA 5CG0A 3BMVA 4W8BA 3WQ6A 3RIKA 3WF0A 1ZL1A 2WKGA 4W5ZA 2J7GA 5BRPA 1LWJA 4DWSB 4ATLA 4J3XA 1W2PA 3K4DA 3VGFA 4N0RA 1KR0A 4GIAA 1UR2A 2WKLA 1E6XM 1F4AA 2UY2A 3UR8A 3WF3A 3PN8A 1OIMA 3WD2A 3WDRA 3N04A 1B0IA 1V6WA 2ZXAA 4D6JA 1E71M 1GW1A 1JI2A 2D3NA 4M80A 1H09A 1QNRA 1U30A 1F4HA 2D0GA 3QGVA 4PMOA 3VMOA 2BFGA 3W4RA 1V3KA 2ZE0A 4AISA 1BG9A 1QVBA 5I0DA 4W8LA 1UD4A 2C0HA 1QNSA 4M81A 3NDZA 3GBEA 2DSUA 3VGHA 2MANA 3SCWA 1JF6A 2X09A 1HF6A
chains in the Genus database with same CATH superfamily
4RV3A 3V7PA 3SBFA 5A6BD 2GVJA 2EPOA 4U10A 3S5NA 3NQGA 3I6EA 3L4YA 3EWWA 4IG2A 2VENA 3BW2A 1HN1A 3W73A 4EXAA 1QFEA 2TMDA 4PMJA 3CL8A 3LM7A 4AWEA 4C1LA 4LGXA 1PX4A 3ZJ7A 4D6FA 1ME9A 3GW3A 4O1CA 2PTWA 2HCVA 1UZHA 4DAIA 1OFRA 1IF2A 4UR9A 1UMYA 1UJQA 1DJHA 2E77A 3T2PA 3AYRA 3ABZA 3D46A 3WQWA 2G3JA 4QTGA 1F3XA 4IIHA 5H6HA 1EOMA 3CTLA 4DJDC 4K8HA 2V3GA 4YTRA 2OPJA 4JHMA 4B5SA 3L4TA 2DVTA 2EO7A 1R3QA 2L5HA 4WJ8A 1UB3A 2ATSA 1MXSA 1ZRQA 1VLIA 4R9XA 3GDBA 2WSQA 3W84A 1UD2A 1CNVA 2OYMA 1TJ0A 5C9WA 4DO5A 1WZMA 4BQ5A 3M0YA 3TIMA 1KW1A 2CZFA 4FPSA 3AROA 4YPJA 4XVEA 2PWDA 1H7PA 5K4XA 3WCZA 2BXYA 2GL5A 1RVKA 3GH5A 4BY3A 1UIPA 4NIRA 3GHSA 3EKZA 2CXGA 1SO4A 2PI6A 3T07A 1XYFA 4MJ4A 1E3XA 5XIMA 3ZVHA 4I9JA 1J96A 4TUFA 4D71A 2WQDA 5L9FA 5DQPA 3P5YA 3ES8A 3S46A 3U2OA 3VYLA 4US5D 3LRLA 5F7UA 4I6VA 2GQ9A 4EWND 5I6SA 5E6ZA 2GJPA 3H7RA 4W93A 3IAPA 2ZFAA 3M44A 2A3EA 3S3GA 1FWIC 3UY8A 3T8QA 5K7JA 1NDZA 3L4ZA 3UP8A 1RA5A 1QDSA 3TMLA 4ZE4A 3M0LA 2Z2AA 3W83A 1UCWA 4JDBA 4M29A 3N2XA 2ZXQA 2ZA3A 3AS1A 4DBSA 2DZAA 2OODA 2IKHA 3MV11 4LANA 4HZ6A 3BANA 4E4PA 1V3IA 3QGKC 1E55A 5H2ZA 2KX9A 3QV7A 2XN2A 4FXSA 1A4LA 3FGCB 3P60A 2Z1BA 1QASA 2GZXA 3M5ZA 3VK5A 3KE0A 2J62A 1HFBA 2X7WA 3OHIA 1W5OA 1GT8A 2NQ5A 1OFOA 3LS9A 3APYA 4L4LA 1GVEA 2JEPA 3SI9A 4PUMA 3T8LA 3MMWA 1DWFM 2Y89A 4QITA 4E3TA 1V79A 4XVDA 4FMVA 1Z69A 2YBUA 5GJNA 1D8WA 1AODA 1QU4A 4NKCA 3F5LA 3KRBA 3CNYA 4F4RA 5A6TC 1EP3A 4Q7IA 4WXZA 2XINA 3RF9A 1EF2A 2J9ZA 5FKYA 4UQAA 1OYBA 2Q8ZA 5BXPA 4XBJA 3O6AA 1UOZA 1DEDA 3BURA 3PZOA 4ZB2A 1POKA 2P8CA 5CJ5A 2E5DA 4Q6XA 3OBEA 4JKMA 4WKFA 3UESA 3HMJG 4UFJA 2DQXA 1OC7A 3WQGA 1BWVA 3EEZA 3NL2A 4DX3A 2VX7A 4B9YA 1XF0A 4DRSA 1TE1A 1DWIM 1K7XA 3BLDA 3EB2A 4WDXA 4Q8MA 1IZKA 1MQQA 4XTIA 4ACYA 3IUIA 2Z6JA 3FJNA 1PDYA 4UFKA 3WFLA 1VJIA 1Z89A 2VZTA 4QHRA 1XH2A 2J6VA 3J7HA 2CWNA 3TQKA 3U4FA 1PBGA 2VL4A 3QTPA 2YA2A 2BGQA 3ZLFA 4MNLA 3VGGA 2X0HA 1H7NA 3CL6A 2DZXA 2XVPA 4KWVA 4HA4A 4N2YA 1EXBA 5A94A 2TRSA 1QOPA 3BG5A 1SZGA 2VEFA 3WDQA 3VOCA 4G7EA 3GFZA 4RV8A 2E8YA 3WBXA 3W7MA 1TJ1A 4NU7A 1EC7A 5AC4A 2QIWA 3U3HA 1TPDA 2YDSA 5EMYA 4IQLA 3P84A 1JYVA 1AH3A 3W7OA 3TEVA 4KCVA 2VMFA 4JY8A 2BV9A 3GC2A 2PDCA 4J5NA 4KRUA 1ZTVA 4UTFA 4YN5A 4AU0A 3W7KA 1H60A 2Y61A 1LL7A 3A4JA 1D2KA 2QJHA 1NU5A 1B9BA 4Q8WA 3NR0A 1ZAJA 3RFAA 2I5IA 1OGGA 1CENA 2PDIA 5LGZA 3BGAA 3N34A 1E0VA 3HBLA 4K1WA 4ORIA 4GX8A 1AD1A 3GY1A 1EO5A 3UGRA 1C93A 3FY1A 1OFPA 3QFEA 3WLNA 2I57A 3R79A 1W8GA 1Q6LA 3RGTA 2XGZA 2YDRA 1H4PA 3AZTA 3W6MA 1QR7A 3B0XA 3WNLA 3LLFA 4KETA 1Q8JA 1D7KA 3YPIA 1A5SA 2IPGA 3VTRA 1BYBA 1GG1A 4JIEA 4QDWA 5E9AA 1BRLA 1FVPA 3ZJ6A 4HPNA 3N11A 4RNIA 3BARA 1PE1A 1TJ2A 1ZCOA 4GBDA 1TELA 1S2CA 2ISFA 3QBUA 4TXEA 1HG3A 2OKOA 4S3JA 1C8XA 4S39A 1PO9A 1Z32X 3P0XA 4PR4A 1KM6A 1NOUA 1XCWA 2YB4A 3LTPA 3MSRA 2EHHA 3WUGA 3MY9A 3S5ZA 2ANUA 4LT9A 1T6MA 1JPDX 3N3MA 2YJQA 4HKPA 2PFHA 3AICA 2W6RA 4WLCA 4C1NB 4NZ5A 1VPXA 3W22A 4GZEA 4F0LA 1EF3A 1FWAC 1ZHAA 1IEWA 4A35A 3AIEA 4AW7A 3VD5A 3GC5A 5AVNA 1UBSA 1ZJAA 3S6OA 1M53A 1O5KA 3GH4A 3RRAA 5E93A 3EB4A 1PKMA 3OODA 1J10A 3TSMA 5HA7A 5JU6A 1C7TA 3BJFA 5JMUA 3GTIA 5KSWA 4DI9A 2JALA 1R2SA 1QI4A 4BF9A 4QAIA 5C9UA 1MEHA 1ZS2A 4MY9A 1AUSL 3ZFHA 3VXGA 3WH6A 1TPUA 4E2VA 3WZ0E 4MWAA 4Q32A 3MJMA 2V5LA 3SGUA 2W79A 3NQDA 5F4XA 3OLDA 2GVLA 3HIJA 3RM9A 4TO8A 3DG7A 4H8VA 3USZA 4DJDD 1GOMA 1WKEA 2NXGA 3VMNA 3NQBA 1WZAA 1MUCA 3UA3A 4LF2A 3N17A 3E1F1 1XLKA 2XZ9A 2QCDB 2C16A 1Q2SA 4DNMA 3L5LA 2ZA1A 1S5TA 1WNOA 4AWTA 4JQ2A 4TMBA 3R7MA 3V1PA 5D02A 3MTWA 1M3UA 3BQ5A 3EAUA 3L5AA 1AD4A 2PDGA 2GPTA 1DWAM 3QRHA 3ZQ9A 4PTVA 2IPWA 1C8QA 3GFYA 5HPCA 2WM0A 2WMHA 3UJEA 3RYSA 3W1TA 3FOKA 3I10A 5HQLA 4QISA 1CXEA 3W7RA 1PVNA 1O1HA 1MSSA 1HT6A 2X41A 3GZAA 4DM1A 4BF5A 2V81A 3KBVA 1KFKA 1V77A 3BMWA 5FACA 3SUWA 3IRDA 5H91A 2OELA 4JFTA 3OLGA 3R8HA 2P5NA 3EMQA 1A0DA 1MXGA 3VA8A 4QEEA 4E2BA 3M1ZA 2GK1A 1LM1A 5CPLA 1FKWA 2FZNA 4TMCA 4J1OA 2CHOA 2FPTA 3V5CA 3T2OA 3H7UA 4QE5A 2BY1A 5AN7A 5HANA 2XVKA 1DJYA 4H9TA 4BI6A 4AD0A 3TYDA 4IQJA 1O5XA 2DQWA 4JCLA 1X1OA 3OBKA 1BQCA 4M51A 1S38A 1L6WA 2B7QA 1YDNA 4HU4A 4A3YA 2VFHA 1I2RA 4JQAA 3QH2A 1H50A 5D9PA 1PIGA 2OWXA 1TMQA 2X1SA 1JZ6A 1THFD 2V3EA 5T26A 2P3ZA 4XZLX 1PSCA 5AC5A 4FX8A 3HG4A 3H4XA 4LJ3A 1NOFA 1B5TA 1BD0A 2JBMA 4B4FA 1W9UA 3KRSA 1HO4A 2QVHA 2ZA2A 3CZGA 4KWUA 1L2UA 4QR6A 3GKFA 3EA3A 1F05A 4M6VA 4LUTA 5ECVA 4U3CA 1EP1A 5LIXX 1V0LA 1XISA 4Z0SA 3OZYA 3AHYA 4KT2A 1KRAC 2GGEA 4UQ9A 2JKAA 2XJ7A 3LDVA 4H00A 5AHFA 1XRVA 4V33A 1RAKA 3PR2A 2X40A 3I7SA 3KDOA 1WXZA 3SECA 1E6PA 1GJWA 1XIJA 2PTXA 4GI8A 1E3ZA 1A5BA 3DI1A 4O1DA 1HL9A 2ZWYA 2XUCA 1FHUA 3H2EA 1V8EA 3CEUA 4MF4A 1WDQA 3WEOA 1XIHA 1ISYA 5CPSA 1VGAA 5LGXA 3ZS4A 3U2CA 3V0UA 2ICSA 1G6CA 2E9MA 1LROA 4JICA 2VFGA 4JTRA 2FH8A 1KA9F 3W38A 1VFLA 5BXSA 2DORA 3TC6A 1J0HA 3QHNA 2XVNA 1ADSA 3OQEA 8RUCA 3NPXA 2WBGA 4A3RA 3SCRA 3V75A 1UR9A 5BNKA 4YYFA 3CV1A 4HPGA 2ZZ1A 3AO0A 4WDTA 1HVQA 1H7XA 1CPUA 2IW0A 2E67A 3BUVA 3MUXA 3QVQA 4GKLA 4DYEA 1ZJHA 4H2HA 1DIDA 3HG5A 3HPAA 3KXQA 2PTZA 3MV01 3SCPA 4H9XA 4PMXA 1BGGA 2PB1A 4NZFA 2VRJA 1H7OA 4KFNA 1IEXA 3QZEA 4Q4RA 3TOYA 4UTWA 1L6FA 3ITCA 3A24A 4YYCA 4Y2WA 2E1WA 1RHCA 4D6EA 1T0OA 1FWCC 1VEMA 3VCNA 2PGEA 5KZEA 8CGTA 1EOKA 3CHVA 1VHNA 1E1EA 2JGQA 5G4WA 1HX0A 2V5KA 3KCLA 5HMDA 5K9XA 2OLHA 3CIWA 2E0PA 3GTXA 2IPFA 4EANA 1AW2A 4PB4A 3RMEA 1GWJA 2QUMA 1JF5A 3WF2A 2EPMX 4KCTA 3OB8A 3W76A 1CT5A 3KVJA 1U2YA 4IUOA 4RE0A 3N3TA 4JTLA 3UCQA 1U5HA 3VKBA 2YLAA 2VZSA 4E4UA 1Q6CA 3EOUA 3RK8A 2YZ5A 3GWQA 1SO6A 2WNZA 2HZGA 3CMGA 4JFWA 1OABA 5A69A 1TR9A 1BYAA 3VGBA 4C91A 3SN1A 5F4WA 1EGVA 3GIYA 1RP8A 2BVDA 3T7VA 5AB3A 2J7HA 1LBFA 2X0YA 1UZ1A 3STFA 3T9PA 3LCIA 4O53A 4ZOCA 2H8ZA 3G6LA 4NNAA 4ML4A 3S5YA 1YDOA 5HWMA 4M6UA 2PWGA 1XIDA 4KGLA 2OX4A 3EDEA 4BF7A 4IIDA 3GUGA 3D3AA 4OBSA 2W67A 4UTJA 3PWIA 2VQUA 1S1PA 4PCSA 1LT8A 2GQ8A 4IHCA 1W9BM 3EX4A 3POCA 3UG8A 5C2XA 1DWGM 4INFA 3WDHA 3EXRA 2DZPA 2HVNA 4HZ8A 2GJRA 1JPIA 4U3AA 4GXMA 3WD0A 2GQ3A 1JCXA 2QLYA 2OWCA 2O4QA 1CXIA 3H7VA 4D72A 3VM5A 3BOLA 5LNUA 3APTA 4EPBC 2BLEA 2VVSA 1E6RA 4UB9A 3ARXA 3TJ4A 1HUVA 4GUIA 2QUTA 3RAOA 1EZWA 3WSUA 2WZTA 5G1YA 3BSGA 4YWSA 3OEXA 4U31A 1KBJA 5CPQA 4XO7A 1LOSA 2O9OA 2XIQA 3S4TA 1UOKA 2Z2BA 4JZ5A 1ELSA 3VKDA 1SQ7A 2PF0A 1JD7A 1IXNA 2HE8A 4GXWA 4TIMA 3S9YA 2G0WA 3RCNA 1MRQA 4BQ2A 4WK9A 1XIEA 6XIAA 1RBAA 3THUA 3W25A 4C6MA 5G4EA 3D0CA 2A3HA 1CGWA 2BG5A 1NH6A 1UUQA 2CZ5A 4TVDA 2X16A 1UC4A 1JUBA 3IIPA 1VBRA 4KEZA 1O1ZA 1YXDA 4Q3MA 4HTYA 2PP3A 3W7QA 2VGBA 3WH5A 4GPNA 1OG0A 2P8BA 2OOGA 5E09A 4E5TA 2FVMA 2XM1A 1TTJA 4X2RA 4EPKA 4MAVA 2E40A 4JIQA 1WKFA 3NZRA 5EGRA 3B4YA 2IMRA 1ISZA 1YPXA 1D9EA 4ZMGA 2NVAA 3CZKA 3VM7A 1E73M 1WP6A 2VWTA 3HFYA 1VYPX 3B8IA 2NLIA 2Y7DA 1SSDA 3W86A 1JI1A 2YR1A 3IK2A 1KXQA 2WCAA 1E5JA 2NX9A 3HQOA 2RH9A 3IJ8A 2YCLA 5HJYA 3R13A 3GAKA 1ZPTA 4JN8A 4YJ5A 1VFHA 4BWLA 3IEBA 3DOPA 1PX3A 2YL8A 2CBUA 4YCPA 2W61A 1PTDA 2PDJA 3RITA 4ZENA 1HNYA 2XSBA 3CYJA 4MDOA 2V9DA 1FCUA 3DI0A 3OIHA 2ABBA 2O0TA 3NGFA 4H7CA 4P7NA 3QV6A 3WG6A 4J2MA 1LORA 4Q8PA 3CUIA 5E6YA 2CERA 1CGTA 4TX6A 3ZO9A 1GOOA 1R47A 3KOFA 4M19A 4WSHA 2OWWA 1ZUAX 2WMJA 5M1TA 3CQ0A 2G3FA 3WQVA 4WCJA 1VLWA 3M0ZA 1GVOA 4IMAA 4WJXA 2R82A 3CPGA 3RCMA 3KVLA 4MY8A 1PEZA 4G8TA 2QXWA 1JCYA 1JDDA 3N2BA 3VILA 2GLKA 2OU4A 3O63A 2V3FA 4ICCX 3EXSA 1VBJA 5HBFA 4YVXA 1K4GA 2DJXA 4AZCB 1MWOA 5KZMA 3ONCA 4XTDA 4ADTA 1E9LA 4ZSUA 2XFWA 1JYWA 4LRSA 2RUSA 1OT2A 3LCLA 2Y63A 1HTIA 2DSVA 3GXMA 2ON3A 2YGYA 1Q5MA 3OLIA 1KLYA 3QW3A 2VFDA 3VDAA 3TCSA 4ZE5A 1KFLA 1RJPA 1UASA 4QJ4B 1DXIA 3WMBA 3TLQA 5BZAA 1SPQA 5IDZA 1SO5A 3PBGA 1NWSA 4PEKA 3KOZA 2QW5A 2EJ1A 3S2CA 2FZMA 3URBA 1YLVA 1KXVA 1UZDA 3MMUA 4JGDA 1Z9AA 1MO0A 3ECQA 4PMVA 2Y6ZA 5LNVA 3LCFA 4LBRA 1Q4WA 1J5TA 1OX6A 1RBLA 3WLTA 3BZJA 4ZFMA 1DYSA 5D9OA 1GTHA 1AW1A 3SCOA 1OG6A 1ZJIA 2YOCA 1PTAA 4L80A 3RLHA 3NZQA 4YTTA 1DJWA 1Q8AA 2XHYA 2G4FA 3KBWA 4KH2A 1VJSA 4AIBA 1QRQA 4LY4A 1CBGA 2WJEA 1WDWA 3AIBA 4EP8C 3S6DA 1LQAA 4ZSTA 3CHCA 3KVMA 3A22A 5LA1A 1WKYA 2PAJA 5D38A 1CXLA 4FNQA 3RU6A 4AF0B 5DT5A 4U4MA 2ISDA 4DUXA 4PFMA 5LXXA 3WQ4A 3ARVA 4BA0A 3B8DA 4E6MA 5HXMA 4C6FA 3F03K 4NRRA 2FZBA 3TZNA 1ICSA 3OA5A 2HS6A 3REQB 1RXOB 4S1FA 3CUZA 1OFDA 3W6LA 3Q4DA 1H2JA 4IICA 1OZQA 1PKYA 1B2YA 4GO9A 4IJRA 2F61A 2NX3A 4JIRA 2J8TA 1EKOA 3OGSA 4ZZ9A 3IJQA 4GI6A 4P7OA 2JEQA 4KIEA 2BVWA 4QJ5B 1OB0A 2P88A 4NUWA 1DQUA 1BKSA 2VR4A 1FFRA 4HP5A 4I7VA 4B5WA 4G7FA 3SUVA 3QJAA 3H54A 4HCLA 2P10A 3DBNA 4LAUA 4ALDA 4S3AA 3PZMA 3E49A 3UXDA 1T5AA 2PDXA 3E2SA 5M2FX 4LC8A 3M46A 4DWSC 2AQVA 2XFRA 1AJ0A 4Z0JA 3PZVA 1HL8A 4LCRA 3GXDA 1W9VA 3A5VA 3IANA 2QS8A 3MJYA 5JIPA 3SDOA 3W7IA 2X2YA 4JCMA 3R8GA 2HXTA 4JTUA 1NP0A 1SW7A 2CITA 1C91A 3TWBA 4FLQA 1P48A 4JOMA 4NRSA 1FWHC 3U8GA 3GG7A 2PC4A 2A79A 3PB2A 1KBIA 4Z2KA 4M1RA 1J93A 1AJ2A 1O95A 1NVMA 3IWPA 1XLGA 1G69A 4KS0A 2VZOA 2V6AA 3SJ3A 4IL0A 2J25A 2HK1A 3L2MA 1Z42A 4HU8A 1M7OA 4NZCA 3LCWA 2WCGA 4UTWC 5EU9A 3VNKA 1UWAA 4ENLA 3L0NA 1A0EA 4WZHA 4HPHA 4UTTA 2O56A 3QQWA 1JDAA 4N9BA 3M7WA 3M0JA 2FH6A 3TA9A 1XFCA 2E68A 4DF1A 3A5FA 4H3DA 2PTYA 1TV4A 2A7NA 1TCMA 2DT1A 3TNBA 4DXVA 5I3HA 2GDQA 2FFCA 4PCNA 1S5MA 3ARRA 5LHFA 4YTUA 4CLMA 3KW3A 2I5GA 4GK8A 4H6KA 4AYGA 3RM4A 1PIFA 2G41A 3GR8A 2SFPA 4QM1A 2A0NA 3NDYA 4KWSA 3ZWSA 1P7TB 1GOWA 2ZXBA 4GFIA 3W7LA 3T78A 4IFKB 3GUWA 2YXXA 4GABA 3DIPA 3TLLA 1XD1A 1LQ2A 1KRMA 1Z44A 4DEFA 1VBUA 2ZOXA 3MSDA 4BZYA 2C71A 5B7ZA 1NOWA 2PRMA 4IMCA 3SZ8A 2VEIA 1XGZA 3GG0A 3A9BA 5CGMA 2G97A 4IIFA 2TYSA 3EKLA 5CEWA 4DHGA 1D3GA 1JPHA 2J24A 2DVXA 1W37A 1LG2A 2XVGA 2W27A 3FVDA 4GNVA 4IMEA 3K46A 4AIUA 1QHZA 1B57A 1A49A 5LNSA 1XWYA 1T96A 3V5OA 1HQTA 1GQLA 4ZOEA 4UBPC 5CXPA 4EIVA 1SZFA 3HPSA 1RJRA 5LYRA 2ZRYA 4JL2A 3AOFA 3AC0A 4J3WA 5HUOA 2VC5A 1E6QM 5CC3A 2PS2A 3VGDA 1BF2A 3ICJA 4LUIA 2HMCA 2ZIDA 4JFVA 2VEKA 1EJSC 2AAMA 1ZQ5A 3QHMA 5E0FA 1EQPA 3EEGA 3GM8A 1WUEA 4X22A 2UBPC 1KFCA 3EB3A 3KOWA 1UWQA 4IXXA 2XN0A 3CBWA 3GRIA 4F0SA 4N9DA 5BWAA 3F7JA 3OYZA 1F07A 4LEFA 2VR2A 3VGEA 3I4EA 4LUYA 4GQRA 4LVDA 1X6LA 1UH4A 1Q45A 3CL7A 1Y5WA 3V36A 4ATWA 1A47A 1R30A 4YLWA 1JIBA 3AYSA 5EBUA 5I09A 1XLJA 4JTSA 4QS5A 3BCFA 1LRTA 3S9IA 4K68A 3L2IA 4ZBCA 5HK4A 1X6UA 4C65A 4I5XA 5CG0A 1HO1A 1YIXA 1X8CA 4W8BA 3FJ6A 3VDGA 3WF0A 1ZL1A 5BRPA 4DWSB 4ATLA 4JTFA 1W2PA 4AQLA 4N0RA 1KR0A 1UR2A 1E6XM 3UR8A 4B2DA 1OIMA 2VDGA 3C2RA 4HTBA 5EL1A 1E71M 3M0MA 3DC8A 3WLIA 1FDJA 5AHNA 4EACA 2D3NA 1QNRA 1TWIA 1S39A 2QF7A 1EX1A 5I0DA 4W8LA 1UD4A 1QNSA 4F2UA 4BWLC 2PURA 3NDZA 1L6YA 3SCWA 1JF6A 1HF6A 4F3HA 3CB8A 4XX6A 3WD1A 3TVAA 3CZJA 1M1BA 4QG9A 2WPBA 2BSLA 3IJ9A 3GBDA 3SFKA 4JR5A 3PM6A 4FX6M 2FZ8A 2PWUA 5XIAA 4HYRA 2J9YA 4E38A 3MQTA 3TR9A 4CU8A 1UA7A 3WFZA 1TIMA 2XG9A 3SUSA 3VIHA 2DT2A 3PTMA 3AU6A 3LERA 1XQLA 3GHRA 4O17A 1V6UA 2HBXA 4DUOA 3FEQA 2DZWA 1X1ZA 3VD7A 2WJZA 3W71A 5AC6A 4G9PA 3RLVA 4IM4A 4HOZA 1PWLA 1LLWA 2PA6A 3GG1A 4N02A 3LI1A 1Q7ZA 5CPOA 3MDUA 1EJ7L 9CGTA 2WSKA 3PUEA 2FHCA 4BI7A 1GCYA 2QJMA 3W1MA 3PUGA 1XKYA 2B81A 2DVUA 1XLBA 3PK7A 4IWWA 3S1GA 3IJIA 3WUFA 3JUGA 3A3XA 3IGSA 2BVYA 4W84A 5EA9A 5C71A 1CWYA 4C6LA 4OQVA 1FXPA 2UZ9A 5ABTA 1EDGA 1D3HA 4GA8A 1RD6A 4REQA 5LXEA 2PLKA 4WQ6A 3Q45A 5J5RA 4H01A 2CKRA 5BRBA 3GTFA 2QKFA 3GB6A 4WXYA 2F84A 4XISA 2Q09A 3R10A 4GACA 1FOBA 1AH0A 1PHQA 2DUZA 2ZUWA 4FNRA 4RNHA 3GC4A 3W7NA 2Z1KA 4G1NA 4ERAA 1O4UA 3SIZA 1DXEA 4UZSA 1DWJM 5AHMA 1L9WA 1I2PA 2GQAA 3GU2A 1MW0A 4UWMA 1ZSXA 1EDTA 1G4PA 4HPXA 4DWSD 1OGBA 2Z28A 4R7JA 3LZ5A 2INEA 3F2CA 1OCQA 5EMJA 2I17A 3WLQA 3ZLHA 1LRNA 1EUNA 2W92A 1ZBCA 4UIOA 1LL6A 1W3IA 1W1IE 3GO2A 2YYUA 4PMNA 1RVGA 4IJBA 5BOOA 3BMXA 3URAA 2Z0IA 4Y96A 4PMYA 4O54A 5T91A 3ME3A 3BOXA 3KL0A 3TN6A 4US5A 3CMFA 4D6DA 4M7SA 4S3CA 3RG6A 2OZ0A 1W3KA 4WEVX 1S5NA 3SUTA 4DAFA 4IX2A 4XIAA 2VC9A 1QWGA 5DEZA 1US0A 5IDIA 3DAQA 3H26A 3PS7A 2ZTJA 3OJGA 4HJWA 5BOFA 5JXQA 1OHLA 4E2OA 2PDHA 4I9AA 4WY0F 4NF7A 1ZALA 3RR4A 3UWZA 2PWVA 1RA0A 3UBPC 2YSWA 4Q8TA 5C9XA 5K2ZA 1IWPA 3ITTA 1KM1A 2IQ0A 4MHBA 3QEZA 4DWDA 3LNMA 5A8NA 3EX3A 3CT7A 2FLIA 1MW2A 3HN3A 4Z17A 4ZL1A 3WH9A 3NXFA 1CB7B 2YL6A 3TXVA 3TC7A 1XSKA 3VNJA 5TF0A 1XJBA 3C61A 5FF4A 4XZWA 2YPIA 2EAWA 4GISA 3M64A 4ML9A 1SFSA 2WPGA 3K30A 3AYTA 2OZ3A 4LY8A 1BVNP 3LLDA 4GZIA 1E9IA 2XZ7A 1UR3M 3QHOA 4XQ6A 2NQ9A 1NM9A 3MP4A 5AOUA 1W5NA 2CZVA 5C54A 4Q8UA 3VNIA 2XDFA 3FS2A 3B97A 3UFYA 4GZ7A 2ZUTA 3P82A 4MGGA 5EMLA 3VFCA 4RR4A 2X05A 1P0EA 4GIRA 4CVUA 4FF7A 1NTHA 3GYCA 4OOZA 4KCUA 3OP2A 4DZHA 1XFBA 4J2PA 3SY8A 4E8DA 4OBTA 3FYOA 3KVKA 5BMWA 3WJSA 2ZCGA 2XIOA 2X30A 4PMRA 3HG2A 5I23A 2QYGA 1FY6A 4Q6JA 2V2CA 1KD0A 4F0KA 1B30A 4UTTC 1V02A 3JVAA 2EKCA 5FA5A 3MMDA 4UTKA 3OTRA 1R3SA 4MYAA 3LSBA 2JGYA 2H3BA 3G1AA 3TA6A 4QBXA 3F4WA 3R0UA 1ZNNA 1VRDA 1VFTA 3OIXA 3T44A 3A4WA 4LFYA 3L9CA 1Y5XA 3GXTA 2A2IA 1IWAA 3W70A 2ZUNA 4GUFA 3VFLA 2E6DA 2GGHA 4P8VA 3N1AA 4LALA 4K36A 2GJXB 4GNJA 3P67A 4F8XA 1ADOA 1VIWA 1IIHA 4CQ9A 3DYPA 4S38A 3H4GA 1PAMA 2R1NA 4FHAA 2DFAA 4K38A 3PJWA 3RN6A 5CSYA 4UFLA 5G2WA 1AJZA 3WNKA 4GCAA 3W01A 1F8MA 5I3DA 3LMZA 2DW6A 1MVYA 1S2WA 1WXJA 3ORWA 5CBBA 1SZNA 4MLRA 3UYCA 7PTDA 3L23A 4N42A 2VRKA 2E9BA 3BLIA 1YMYA 3R1ZA 1ECQA 3N29A 3K1GA 4LXFA 4N7QA 1XICA 2XWDA 3AXHA 3E9AA 3F4DA 1YBQB 1QNQA 3K2GA 5HPOA 1ZENA 4I7UA 3VKAA 1F8IA 3RO6A 2I1OA 3TCEA 1NP2A 1V6VA 4GC3A 5F2LA 2BX7A 3AMGA 3N4EA 2W5FA 3MB9A 4NAEB 3ATYA 4KEVA 3A4AA 1HKJA 5LKYA 4L56A 3FGCA 1ONEA 1EEXA 1XH1A 1LDCA 2DW7A 1XYZA 4NJIA 4JN7A 3RJYA 3DYOA 3AHXA 4L9YA 1IZJA 1JZ7A 4U33A 3E5PA 3IJLA 4AMCA 4KERA 4OV4A 3RO8A 1I6NA 5EYWA 3SRDA 3OVPA 3CK5A 3T05A 1J6PA 4NVTA 5LIUX 3TNOA 1KBKA 2ZZ7A 3EX6A 4KFOA 3H6OA 5BOEA 2E3ZA 3MI6A 1PUDA 3GDMA 2Q3OA 1DHKA 2ZRZA 3P2VA 2VZVA 4AVFA 3TU9A 4UTIA 5DMNA 1R9ZA 4NX5A 1PX8A 2DY3A 5EFFA 1OD0A 3O06A 3UETA 4HIBA 3UW6A 4TVUA 1AMKA 2ZDSA 4LTSA 3SW6A 1EJWC 3WUBA 1BTCA 1QI5A 1KCLA 3NQ2A 3B9AA 3LQLA 2PLCA 6REQB 2VNCA 4BS0A 3GK0A 1OBAA 2FGZA 1OX5A 1QXLA 3VOHA 3M41A 2RGLA 3MA8A 1OGSA 1R38A 3BWWA 3NL6A 2CLKA 3P74A 4DJEC 1A5AA 4FZIA 5BWFA 2DU2A 3K13A 4GINA 5K9CA 4US6A 1KKRA 3O0KA 4XO6A 2YXOA 2PODA 1C92A 2QDDA 4NZ1A 2WKJA 3AIVA 4OVXA 1O6IA 1B9ZA 1FUYA 1XRTA 5M3WA 4YU1A 3L65A 5BROA 1U1JA 2YYTA 3WQ8A 4NYYA 4GUGA 3NM1A 1V3JA 4PSPA 5IFTA 4UXDA 2R24A 5C8BB 4EF8A 1WOAA 4IZGA 2ZZ5A 1RLCL 1JULA 2BDQA 3VNLA 4F9JA 1XCFA 3QSRA 4PBEA 1KRBC 4PMZA 5IM51 1AG1O 1CB2A 2AL2B 4AYSA 5GJMA 3LBCA 3N14A 2NW0A 2E6AA 5F4SA 5EMKA 3WN6A 4CCEA 2YDQA 1S2UA 1ITUA 4A3UA 4S2BA 4A6GA 3L0KA 3IACA 1MRAA 3O16A 2BVTA 3ZXWA 4P8XA 1HL2A 3GNOA 1J2WA 2OVLA 3NZPA 3RNDA 1E1CB 4MPKA 2VUNA 3QOMA 1SZEA 2D23A 2A3CA 5RUBA 1QK0A 4CNSA 1WX0A 4AD3A 2QPXA 1VR6A 5DBUA 4Z1YA 3N9SA 3FK4A 1NWTA 1KC7A 5BCAA 3KCJA 2VRQA 2UV8G 4NJKA 5CLTA 5C9RA 2YCJA 1M01A 1HKVA 4N6FA 5CC7A 4UC5A 4BR1A 2NV9A 2OT0A 4GGBA 2OJPA 2P3EA 4PTXA 1OF8A 3H2OA 2ZX8A 4DLFA 4CEXC 4O4VA 2VX6A 2XISA 5LIKX 4HU0A 2ZX6A 2CHNA 3L7RA 2CLPA 2AKMA 3TR2A 2PGWA 1E70M 1KQYA 4Q7NA 4XD6A 3GDRA 1EB3A 4MKNA 1XM3A 5CCZA 2ATMA 1VEOA 3NQ8A 3PUDA 3LYEA 2DZUA 2WQPA 4XWUA 2G95A 1IXQA 4GE8A 3QLDA 2PMQA 3GVVA 3RPMA 1VFFA 1QBAA 3PHAA 3MCNA 1PZ2A 2Y7GA 2PDUA 2XFYA 3ARZA 2CC0A 2PPGA 2Y4SA 1TQJA 1HKMA 1NDWA 3H22A 1P6CA 1R2TA 4QAWA 5FEWA 3PPFA 1Z48A 2P50A 4JIHA 2VWSA 4HHMA 4JBRA 4C1NA 1KFWA 2YA1A 1V02E 4Y9NA 3ZIZA 5FAJA 3U9IA 3ZLGA 2A3BA 5I24A 5HOSA 3LXBA 4IP4A 3LNPA 5I00A 4HQVA 4LV9A 5HR6A 1LRQA 4MY1A 1DWHM 5IXEA 2W63A 3QGAC 4DO4A 4DBDA 3LB0A 1E6SM 3PWAA 4JTTA 3TTOA 1JUEA 3NVTA 3T0CA 4AHQA 2EG7A 5KZ6A 3BOFA 3GHUA 1OT1A 2CWXA 1IWBA 3UWVA 4QG8A 4O14A 1HJXA 3IIOA 5REQB 1TKKA 3DKJA 5DN1A 4FXJA 2WZEA 3CAVA 4N9EA 1FWDC 4YHEA 3KUMA 1ZP4A 2WW5A 3CT2A 4HHPA 1F6PA 4EF9A 1RQBA 4DZ5A 1F9CA 3LV5A 5CAHA 2FIQA 2YB1A 3GTNA 2BGNE 3N9RA 4UNIA 3C2VA 4L64A 3VABA 1DE6A 1SJBA 4HMEA 2F7FA 1EJUC 2ZDRA 4V15A 2HQAA 4AC1X 2QCDA 4HNLA 4X2PA 4J7RA 5I3FA 3HO8A 4B92A 4CNTA 1JYNA 1KXTA 3R89A 3M0IA 4W7VA 3AALA 1A3HA 1AFSA 5BXRA 3N2CA 3PAOA 4ONVA 4RUBA 1TJRA 3CQIA 1BEUA 3I68A 2XWEA 3CV7A 4FOUA 3MP3A 1X98A 1ODUA 1FWJC 3QF0A 1B3XA 3PWGA 4L9ZA 3NA8A 4M24A 1TWWA 2DZBA 3LK6A 3QQ0A 3RX4A 4A2RA 1EWDA 3PTDA 3DFQA 3EX2A 3F4VA 1X96A 2DZVA 3EXTA 1B4KA 4KKXA 4QRNA 4IIGA 4S3EA 4D6HA 1W91A 1KWGA 3BLPX 3S83A 3BK0A 3VX0A 3CH0A 3W74A 3BVJA 4LCQA 2IKIA 4NY2A 1RK5A 1M7JA 1OCNA 4LS0A 1XH0A 3BAXA 4DM2A 4AZ6A 3UEQA 1E0WA 2V5BA 4OU1A 3GX9A 3LCHA 1W9PA 2F38A 2NQHA 2X1RA 3SSJA 3MCMA 2WO5A 5GJPA 4O11A 2GVGA 3N19B 4YS1A 5E5CA 1VEPA 3MSGA 4L4OA 3PFMA 1J18A 4MOZA 3UA4A 3NPVA 4MNJA 5HNUA 5BW6A 2ZVRA 5TQLA 4C6KA 4I8YA 4TTUA 3IVSA 1PJ9A 3THCA 4HMDA 4Y9PA 5C55A 4M0XA 2Z1VA 3HGSA 2ESCA 2QQ6A 4J3SA 3DGBA 1VBGA 2D69A 3CZLA 3MI3A 2QGHA 2Y0FA 2ADAA 3LI0A 2HPIA 2OT1A 1YHTA 3UZWA 2Q02A 3VPLA 1MFUA 1TSIA 2PDMA 4GUHA 3G1RA 2QULA 3LXAA 2VXNA 1F76A 2NLYA 1U5JA 2RFGA 1PL9A 2C7FA 1ISWA 1US2A 1QPNA 1JAEA 3EOSA 1W8SA 1ZBWA 1GJUA 2G5WA 4P7RA 3M5VA 3CZEA 4ZCWA 2YFNA 4AB4A 4OUIA 3IGUA 4C6DA 2XSAA 1YXCA 3PBMA 5DCEA 4PMUA 2OSWA 3C8FA 1XDJA 2VO5A 2VC7A 4ZO7A 5HWNA 3BG9A 3WK1A 5SWUA 4OGZA 1QOXA 4WX2A 2HDJA 4MJ2A 2PCEA 5ABHA 1JZ3A 1EH9A 4FK9A 4PE8A 2HXUA 2I56A 1SJDA 2QCMA 4PTWA 2OYLA 4DJED 3ID7A 1EC9A 4XZMX 3H53A 5MF5A 5EMUA 4GMEA 3QZAA 3KLLA 3MVIA 3B04A 1SGJA 2C1GA 1KWKA 1RQHA 4NASA 2PU0A 4RZ4A 1E9YB 3TQ0A 4U5IA 5FAGA 3UVIA 5JUVA 1LYXA 4H9UA 4IMFA 1FFQA 3E38A 1XYLA 1MW3A 1E72M 3COTA 3LGDA 3LOTA 2R1LA 2AL1A 1S3TC 2Y8VA 2GUUA 3BO9A 1TA3B 3BCJA 3VD3A 4ERGA 3KP1A 2ONEA 3U48A 1XLCA 1JJKA 3MCOA 3WJWA 1UG6A 3PSVA 2VELA 5C5YA 4B2DD 3MI2A 3L4UA 5FIPA 4JFUA 3WKZA 5CC5A 2WK2A 3ITGA 2CETA 1UIOA 3EWCA 4KWWA 3IV3A 5DF0A 3GVWA 4CCCA 4ZB0A 3SCVA 3A64A 5FD0A 4W85A 3C2OA 4KIRA 1X38A 4D8AA 1HJSA 5DMMA 2Z6IA 2P76A 6A3HA 1J2BA 2BMBA 1RH9A 3RRXA 3MZ2A 1N2VA 3GFXA 4DPPA 4V1YA 4DELA 4GCXA 5F2MA 1N8FA 2HNEA 2J8GA 3FKKA 3CASA 3LTSA 3HQNA 2B0MA 2ZKMX 5H1WA 4GQBA 2Z27A 4C7FA 2P0IA 3EDDA 3E0IA 4KPLA 2WLYA 1H7WA 4QNEA 2REQB 4A29A 2WXDM 4JX4A 2G96A 1D3CA 2NWSA 1VPYA 4BK9A 1EQCA 2J13A 2WHMA 3BG3A 4PUWA 3LGGA 2VT0A 2QAPA 4PB5A 3CQJA 3MUY1 3B8WA 2ZE3A 2JKEA 4GUJA 2FTYA 3HGRA 1EDQA 1UQZA 2D2JA 4MSSA 4F0MA 3TW6A 2H9AB 1GZJA 1H5VA 3AU2A 5A3HA 1OYAA 1WDDA 2G3IA 4JNMA 3FX4A 5LHEA 2WC7A 3CU2A 2WAGA 4RPPA 4ECLA 5HMSA 2HISA 2WNQA 1NDYA 1MFVA 6ALDA 3W85A 1Q65A 5CLWA 3UR5A 2FTPA 3ANYA 1BHGA 2NXHA 3L0GA 1P0DA 3P81A 2QCLA 3EDJA 2VJXA 2G50A 3EPOA 1G94A 1F2JA 1JD9A 1TUFA 4XAGA 1EJXC 4IPLA 5FOOA 3DG3A 3W75A 3O05A 2R91A 2VOMA 1MUMA 4O1BA 4W8AA 4LVBA 3WLKX 1FWGC 4RW3A 4AD5A 1JZ2A 2R8WA 4JTQA 1JQXA 5BXTA 3UGVA 1FH7A 3G1DA 4DIAA 4F40A 2IKGA 1KFEA 4QDMA 3LHTA 3GVRA 4LAMA 1SSGA 3THDA 1QW9A 3N12A 3P6LA 3VNYA 1EIXA 3VKJA 1IEQA 1FP9A 3DESA 1NF7A 1UPPA 3AMCA 3VUPA 4AVNA 4LOCA 1F73A 2NT1A 2DT0A 1GKRA 5FL1A 5IOBA 2YIHA 3KOYA 2O4MA 1LLOA 1FBAA 1N8IA 2NV1A 2ZX7A 4CQCA 1FHVA 1GVYA 1C29A 1I60A 1TIWA 2WB5A 3M5XA 4OJYA 3QYSA 4R88A 1A5MC 1SUXA 2GDUA 4RDYA 3LRKA 4JIIX 1XG3A 2A3AA 3RCYA 1KCKA 4RW5A 1LCOA 1CXKA 3DFPA 1KTCA 3U0HA 5A8QA 3UCCA 3LM3A 5DX7A 1AK5A 4R33A 3TV8A 4UQCA 3CQKA 5AVHA 5CQ1A 5FF7A 7ENLA 3DUGA 5FSEC 4F79A 2JF6A 3TDFA 1XIBA 1XW8A 4RJEA 3W7GA 2W62A 4FP1A 4BI5A 3IUHA 1K8YA 2AOSA 4AD1A 1BAGA 2OXNA 5FSDC 1Q66A 1XCXA 3B06A 4LBUA 4NXKA 3A9IA 1AL8A 2DZSA 2FPYA 5D2TA 3MKKA 3DFNA 3F2BA 3PULA 3AUJA 3CH9A 4AG0A 1EBHA 3C86A 3BE7A 3F1QA 1KV8A 2XH2A 3W2JA 4C7GA 1O12A 1VFOA 2RDXA 3DX5A 4B5NA 2PEVA 3NZGA 4S3FA 5I03A 4ROPA 4H83A 9XIMA 5E0CA 5C70A 3LBMA 3B0UX 4AZHA 2BWGA 4KCWA 4MB3A 3WBEA 3NPUA 6XIMA 4LF1A 1R3TA 1WDPA 3S47A 4CUCA 3EPMA 1UH3A 3O6DA 4E4FA 1UR8A 3WBWA 2P1FA 4LEQA 4Y7EA 1YNPA 4IGHA 1QPQA 4ACZB 1EA0A 1ZAIA 2VUYA 5DY2A 5I5RA 3II1A 4GQGA 3WK3A 2J7DA 3NQ6A 2Y62A 3GTHA 2ZVIA 2V5CA 3E2VA 4KRZA 2WWDA 3W7PA 4JTDA 5HQEA 1XLFA 1Q13A 4CD5A 2O7SA 3O6CA 1ODZA 3VNZA 4UTUA 1SYTA 1UR1A 2E28A 1FWFC 4XZ9A 3U2ZA 4NL1A 1AW5A 2J75A 1A4MA 3SCQA 2NUYA 1EGMA 3VKKA 4E3VA 2AGKA 1W1A1 1A3XA 3RPDA 4IUGA 1IT8A 4AXKA 2Q8XA 3EKGA 3FJLA 1BVZA 4EXQA 4UTHA 4QS6A 3G1YA 1R46A 1PIIA 4A2SA 3AXMA 1W5MA 4AZCA 3CJPA 2QMKA 3V0TA 3NM3A 2BNJA 3BV4A 3EOLA 1OWQA 2NVCA 3PZTA 3TSBA 3C2EA 5TNVA 1QWKA 3P3BA 4P61A 2GFTA 5FJTA 4UMBA 4X60A 3L66A 1EUAA 4IQEA 5HQMA 5A8PA 3GXFA 4K7VA 1EA9C 1PXGA 4I7WA 4JY9A 3W82A 4NAFB 1Y0EA 4MJMA 1ZGDA 1V03A 2VCAA 4Z2IA 3QMSA 2KZHA 1Y5VA 1I2NA 3SCUA 1VBHA 3UWYA 1TVPA 3MUCA 4A8NA 4MIMA 5ABEA 2ZZ6A 1NELA 3WFAA 4O4WA 1A80A 1RY8A 4N4QA 4FR1A 3QYQA 4YHGA 3TMQA 3E12A 3ARWA 3I6RA 1W1TA 2OFJA 3U7BA 1OADA 4XKYB 1H63A 1GKQA 3KS5A 5I77A 4AZGA 2G4JA 3KDNA 2AMGA 1KR1A 2A6NA 3DH7A 5DLCA 3UZYA 3C0JA 5GPRA 2J66A 3CLMA 2EG6A 2RAGA 4WSKA 1ZBVA 3ZSTA 3WF4A 3EZ4A 1U1HA 1GOKA 1MNZA 1NARA 1K03A 1K7EA 4GY1A 4HSNA 1ZFJA 1H7RA 1C8YA 2Z1XA 5D8WA 1M41A 2Q01A 5FEZA 3EA2A 3KRUA 3T40A 3UERA 4A3QA 1JQVA 2BXVA 2GWNA 3WJXA 1R3YA 1UP2A 3MU7A 5K4ZA 3JR2A 3O15A 3WY1A 4BQ4A 3P0WA 1WB0A 4AF0A 2QDEA 4Z42C 1HJQA 1N55A 1Q7QA 1FWBC 2D1ZA 3KOXA 5HMFA 3RLGA 1JUKA 2BOEX 1ISVA 1HVXA 2YDAA 5A8MA 1IGSA 3REQA 3NG3A 2YCEA 3LD5A 1IEVA 4ZVJA 1XLMA 3ITVA 3FW6A 1E4NA 4E0CA 2XTKA 2C91A 1D8CA 3NQMA 2Q8LA 1UW9A 3D47A 3TH6A 2CBJA 3G0SA 3SSZA 3DDMA 2C6QA 1ITQA 2X1IA 1WYIA 1EJVC 2FYMA 3O07A 3JRKA 3PZUA 4WGXA 5AHEA 1TV3A 3OA3A 1W17A 5DBTA 4C5ZA 3R6IA 1RSCA 3SY5A 1UROA 2DSZA 3STGA 3LA4A 4WDUA 2D0HA 3G1SA 2NQZA 4NYUA 2YKKA 3PANA 1UWUA 1XC6A 1I75A 5LNWA 4O16A 1G01A 3AWOA 3NQCA 5G2HA 3BMVA 2ODOA 2VEGA 3GW0A 4B5UA 3UU0A 2WKGA 4FNSA 4W5ZA 4F0HA 1LWJA 3TKFA 4J3XA 1XRFA 2WKLA 3V35A 2UY2A 1TREA 3PN8A 4FNUA 3G18A 3UXIA 1V6WA 4HNVA 4ERIA 4TR9A 4H6EA 4QGCA 1JI2A 4WUIA 2OEKA 4MVAA 4Q8OA 1U30A 3NL3A 3U4AA 1I0BA 4FAMA 3BTNA 4AISA 1QVBA 4GKTA 2C0HA 5LIWX 4IXHA 3B4UA 2VEPA 4M81A 3N4AA 1TV8A 3VGHA 2MANA 2X09A 4Z1BA 4K2SA 1XHGA 2BTMA 4D6CA 4XB3A 3ZR6A 3N2TA 3AIQA 1VCGA 3RUBL 5HAOA 3QPEA 5LA2A 1P1MA 3MBDA 2XYLA 3GNXA 4QXIA 3K4AA 1P7TA 3QR0A 1SW3A 1XX1A 4JYDA 4IFKA 4QLKA 2QUUA 1QPOA 5GNXA 4IMGA 1KTNA 1RK6A 3BAWA 1OFBA 3BQ6A 4D6GA 1W1PA 1W5QA 1J0KA 1X39A 3P8IA 3ZJKA 1CXFA 4GGHA 3S0CA 1V08A 4PBGA 2WV8A 2VURA 3V16A 3W7CA 5EBAA 1L8NA 5C6MA 1NIUA 4PN2A 3IPWA 2E25A 5DRIA 4PTMA 3D3FA 3FYPA 3K8KA 1FCQA 2R1MA 3WDPP 1R3RA 3DC0A 3R4IA 1QO2A 5CJMA 2ALDA 2HS8A 3G1VA 2UY4A 3DN5A 4D8ZA 1BXCA 3NYDA 4C1KA 2PC8A 1O7AA 3QM3A 1YX1A 3N9KA 4CU6A 1JNEA 3R25A 5H8UA 4A8IA 3LHUA 2PGFA 4WF7A 2RDUA 3GR7A 2J7EA 4DPQA 3KBNA 1DJNA 2J8FA 4LVGA 4MUZA 4LUJA 2OYKA 3C0QA 1OX4B 1DXFA 3WDJA 1UQYA 1YRRA 3M0XA 1Q6OA 1O5QA 5IBXA 4K37A 3CZ8A 4ZQPA 1M6JA 3W7JA 3SRKA 1AQ0A 3SRHA 3THAA 3W7EA 1M68A 4GVHA 2JF7A 1BLIA 1P0NA 1KRCC 1REQB 1JFHA 3BAIA 4QCEA 1B3ZA 2ALRA 4TOQA 4GNKB 5BYWA 1TO3A 3FA4A 3M07A 1MZRA 1W9DM 3BZGA 1E51A 3H12A 1YTKA 1ISXA 4JEJA 1X6NA 4JTCA 4UQDA 4HK7A 2CPUA 3N6JA 3L4WA 3VIJA 2FB3A 1YE6A 3QV8A 4TX8A 3ONBA 3FCPA 4IH3A 5XINA 2DH2A 1OFQA 3GS6A 1FH9A 3UPBA 5A95A 4RLIA 3WLLA 4X0VA 3DENA 5DFAA 3LMYA 1UPMB 1Q85A 3L4XA 5F2GA 3MHUA 4DWSA 4J3ZA 4LAOA 1VPQA 3BC9A 2HV5A 3EBVA 4F66A 3C56A 4O10A 4TX9A 3LCXA 2BHYA 1ENUA 1EBGA 3B8TA 4LUSB 1ZZMA 7A3HA 1EGZA 1BWKA 3DYMA 2MNRA 4MYXA 3PPGA 4LU0A 4JQ3A 2PLJA 1CDGA 1FWRA 4UOQA 1ME8A 1D7FA 2DJLA 3AFBA 5U4NA 1G67A 5TIMA 2UWFA 4RE4A 1K1DA 2VX4A 4HCDA 4PC8A 2Y2WA 2QR6A 4GYPA 1QW7A 2F2KA 3S5OA 4PH6A 1JEZA 2B7OA 3L67A 3BCDA 4B16A 2I5QA 7XIMA 2R14A 2PDLA 1WAUA 5L6UA 4YMZA 3C6CA 1VS1A 2QCGA 4H9ZA 1N82A 1IGWA 1EYWA 1G5AA 3UJ2A 1OF6A 2EBNA 1TPVA 1VAHA 1QBBA 4GVFA 3OVRA 4DXKA 2QVNA 1QTWA 1XSIA 4HPJA 3HGOA 1VENA 4UFMA 2BASA 3VDBA 3PJTA 1J01A 1ITCA 3GR4A 4W9TA 1GQKA 4PA8A 2PDQA 5CPNA 3ABQA 3W6YA 5FJJA 4QDPA 1JGMA 3AHTA 5HUPA 2YLLA 4J9JA 5EY5A 3UNTA 4GVIA 4H8NA 1K8CA 3VAVA 1OYCA 3H70A 5IRPA 3CEPA 1A3WA 1OFAA 4GJJA 1MEIA 1GPFA 1NY1A 4ZR8A 3LG3A 1DV7A 2HTMA 4DJFA 2H3DA 3NVDA 3UZXA 7TAAA 1DJGA 1ONWA 2FMOA 2QJNA 4YCOA 1DTNA 2OZ8A 2F6KA 1O94A 3EWBX 4CN1A 4K8GA 3VIPA 2I9UA 4FB7A 1X97A 3LBOA 3U2EA 1BG4A 2GUYA 3BPWA 4NJJA 2O92A 1XLEA 1TVNA 2J6XA 4UUIA 3B9NA 1IT0A 2FKPA 4Q22A 1ESWA 1DTUA 4P8WA 3NSNA 4B4HA 3H23A 5F2IA 2EXOA 4M3PA 3SFWA 4K3ZA 1VJZA 3USBA 1KFJA 3RM8A 3B40A 2E6YA 4R85A 4R9OA 2VD9A 1F7BA 4ASTA 1CGYA 3QXBA 3R12A 3R43A 4JS3A 2H6RA 1F74A 1IXPA 1OCJA 1GHRA 4RK8A 3QV9A 1QNVA 5C9ZA 2BXZA 1NJJA 2B7PA 1R86A 3E0LA 3W1QA 5I78A 1E5NA 1W1B1 3STEA 4R34A 1J0IA 2ACQA 1RCXB 2HEJA 1L8PA 4YNGA 4B3KA 4ES4A 4FSAA 3LHZA 3VDCA 4QG6A 4FNPA 4HYWA 1GONA 2C19A 4NHVA 2NV2A 2V2HA 1TPB1 2O9PA 1BFNA 3UWQA 2QT3A 2C0AA 4IFOA 1UR4A 1Q6DA 3W00A 3EOOA 4CN6A 4FNTA 1TQXA 3VCCA 3AQUA 4JPGA 3FJ4A 3TYUA 1JNDA 2ZRVA 1W1YA 3ES7A 4KESA 3HMCA 3NQAA 2VGGA 3OHMB 2VOTA 2W4XA 3JW7A 5HNNA 4PRTA 3MO4A 1T40A 3BW3A 1RD5A 4WKHA 5M5DA 1VZWA 1KM2A 3ITXA 4MLJA 3ARTA 1XBYA 3IJ6A 4O18A 3QY7A 3IV8A 4OUEA 3L68A 3WF1A 1B3VA 3SIMA 4ZQRA 3E5BA 2WM1A 9RUBA 3ATZA 4I90A 3HJEA 4Z08A 5I79A 3BLKA 1GOXA 5F1VA 3GDKA 5I06A 4ADUA 4HBKA 5J04A 1IT7A 4DF0A 3C5QA 3UY7A 2V0TA 4IIBA 3NPWA 2CLMA 3ZYZA 2VGIA 1GQNA 1AQFA 1XLDA 1TZ7A 4DY1A 1O66A 4EPDC 1S2VA 5D05A 4ZA0A 1SZRA 3OPSA 4TQTA 3RDKA 4AH7A 2GSHA 2IS7A 4O1FA 4B15A 5AZ1A 2FTWA 1XSJA 3M43A 1PB0A 3BW4A 1Z3NA 3C8NA 3CV6A 1QPRA 2DV0A 1TJPA 2CXEA 2J7BA 5CKSA 2VKZG 1ICPA 3P93A 1TPC1 3EPNA 4G6CA 1NWUA 1WDSA 2DGAA 1B3YA 2WVTA 5A6KA 3F4NA 4R3UA 4V2XA 5LSMA 3KBMA 1XRSA 3NXLA 4RPQA 3KTSA 4IF2A 4Q4QA 3JZUA 1I1XA 5AY7A 4HNNA 1W31A 5A6AA 1NWRA 1OJXA 1EHAA 2WHJA 1RY0A 3WNOA 3ZOAA 1TG7A 1GORA 2PU1A 2PZ0A 2QJJA 3WD3A 1A5LC 3LV6A 1RUSA 4NZ3A 1GJPA 1RZMA 2R9RA 3VX1A 1FQ0A 5A2AA 1RP9A 3PZGA 3WLPA 3GNDA 1K8XA 4C6JA 5AHLA 2BOGX 4LYRA 4EE9A 2ZC1A 1TWSA 4PMQA 4C60A 1Y8BA 4W7UA 2YXGA 4OZOA 4HMNA 4X61A 3IK4A 3T0AA 1H1ZA 4PSRA 3OU8A 1TTPA 3G1XA 4AZIA 4JX6A 1FP8A 4NXSA 3GQYA 1FWSA 4L65A 3TE9A 5D2WA 1ALDA 3IIZA 1V6TA 4S3KA 2PBGA 4XD3A 1AMYA 4WHBA 4D6IA 4X0NA 2GJXA 1M04A 2DP3A 4WDWA 3WELA 1G7VA 3AHZA 2HK0A 3CUHA 4QX4A 1V0MA 1TWZA 3LHYA 3HF3A 5HJLA 4U2YA 1HKWA 3FHQA 3R58A 2G3NA 3R11A 1YXYA 3W0KA 1LBLA 1BTMA 4MG4A 3BDKA 1GKPA 4WY0B 4WSJA 2PDNA 1R87A 3KHJA 2ZZ2A 5CH9A 3VINA 4LAKA 2IUZA 3WEMA 3N4FA 3C0SA 1YBQA 2JIWA 4DXXA 3CUGA 1W3LA 4GYJA 1CGXA 3CPRA 3ARPA 4PRWA 4FLSA 1CGUA 4RZ6A 3G1HA 4H9YA 5JBEA 2RKXA 2D3LA 2W91A 4NAEA 4GYKA 4PZVA 1BSIA 4ICMA 4Q8QA 2HJPA 3PP7A 2G8ZA 4J3UA 3I65A 5J8LA 1HW6A 3IVUA 4JKKA 4DUWA 4GI9A 3W53A 1XP3A 3HGJA 4Y8FA 4RDWA 4U28A 2E1DA 2RHGA 4Y9MA 1TZZA 2GVEA 3Q2DA 4R7WA 2Y88A 2WVVB 2E09A 5IBXC 3BJTA 4Q4KA 3CUFA 1VHCA 4OKDA 3PPHA 1KQZA 2Z25A 2OKTA 1TYGA 2FHBA 1VH7A 2QCFA 4YIWA 2O9RA 3MWAA 2CNCA 4HU3A 2EPHA 1PPIA 1LT7A 1EP2A 3DECA 4K39A 2Z7GA 3UWUA 4GH1A 2POTA 6REQA 1Q3NA 1NQ6A 5D30A 3WLSA 1K77A 3F5KA 3NTYA 4MB5A 4C6IA 5JIWA 5DT7A 1GVFA 4MADA 5B80A 2WMIB 1I1WA 1EJRC 4EPEC 5BMXA 1XIIA 2PE4A 1UHVA 5FEXA 3PF3A 2PZNA 2BHUA 1HP5A 1TCDA 5MKGA 1A5KC 1S2TA 4L1WA 4RX0A 4FALA 2XPKA 2VCCA 4LPCA 1UBPC 3H21A 4EAYA 4DUVA 4Z2LA 3SQMA 2IXVA 1XUZA 4QQUA 4Y9OA 2QCEA 4L9XA 4POCA 4LH8A 4B91A 3MUZ1 2V3DA 3AAMA 2C3ZA 4S23A 5ENLA 3ZZ1A 4NI3A 1YADA 3W7DA 3U7VA 4DBWA 3KL5A 1CXHA 1YEYA 1WQ5A 7REQB 1JG9A 2YX0A 1SMAA 3LZ3A 2WNWA 2GGGA 2WMKA 2X8RA 2Z1WA 2VP8A 2AL2A 3DHUA 4QE4A 2FZDA 3TAKA 3PJUA 3UXKA 4H19A 2QCCA 2YCKX 3UPMA 2OZTA 3OG2A 1H51A 1RPKA 4Y90A 1SMDA 4Q33A 4D2JA 1OINA 4UZUA 2J78A 3D6NA 1L6SA 2XM2A 1E1CA 1DJZA 2ACSA 4GYPC 1W0MA 3AXKA 2HSAA 1I0DA 4CNPA 4AD2A 5CBJA 2OO0A 3GDLA 1K9DA 4XZNX 1SFTA 2MUCA 3OO2A 3STPA 2QAFA 1ZP3A 4FS9A 1J6OA 5AC8A 4GX9A 1VD6A 5H8MA 2DSWA 3S2MA 1Y7VA 3IS4A 1YYAA 4LS1A 3SCTA 3THQA 3W29A 2A7RA 2D20A 3K1DA 4GQ0A 5DMLA 2XH7A 5D2XA 3ANUA 1XI3A 1EX5A 3RMJA 1UJPA 2XGIA 1GG0A 3IGXA 5I2UA 4DJFC 3MUAA 3WDIA 3NSMA 1R9XA 3NJ3A 5FJRA 4JNYA 2QGYA 2EQDA 3QR3A 3OW1A 1GW9A 1PTGA 1TVLA 2X0SA 1IE7C 4NSBA 1TTIA 4LYKA 3WQ5A 3UVAA 4IX0A 1OQFA 1E40A 1XR2A 4G5DA 4B3LA 3ELFA 4LB3A 1SJAA 2PDFA 2YBTA 1RJQA 2ZZ4A 3DFTA 3F5JA 2WZMA 1QI0A 1A5OC 3LGEA 5A2CA 4RL3A 3PAJA 1V93A 1Q4NX 3QY8A 4LRTA 1FT