4A3YA

Crystal structure of raucaffricine glucosidase from ajmaline biosynthesis pathway
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
501
structure length
469
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RAUCAFFRICINE-O-BETA-D-GLUCOSIDASE
publication title Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
total genus 177
structure length 469
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4a3yA00
3SCSA 1WKYA 1KXHA 3T2OA 1NARA 4TVDA 2ZUVA 4B3LA 1WNOA 1H41A 2PWGA 3IAPA 2J7HA 3SUTA 1J10A 2D22A 3UESA 2YA0A 5CLTA 3W26A 1E4MM 2J25A 1GHSA 3CHDA 2W67A 4UFIA 5A6BA 1DP0A 3BAIA 5CXPA 1DWJM 4UR9A 1F4AA 3FNDA 2DQXA 4C7FA 4JFSA 1E6PA 2FGZA 4HZ6A 3AHXA 3ZQ9A 2J77A 3TTQA 3VMPA 1BPLB 1VEPA 4TTGA 1V6YA 4M82A 1UD6A 1W9BM 1XYFA 4GQQA 1E72M 3WMBA 1RPKA 4CVUA 4MNMA 2WMJA 1KXVA 3EYPA 2ZUNA 2W62A 3RILA 5E0FA 1KGXA 1O6IA 1SFSA 1KFWA 3WIJA 4AZIA 1V3KA 3TONA 5BYWA 5CLWA 2WPGA 5I2UA 3S2CA 4P7QA 2O9OA 1ECEA 4E8DA 1CBGA 4P8XA 5JBEA 1UD8A 4UQCA 2EPLX 3DHPA 3ZMRA 2UY5A 2PF0A 3MMDA 3OGVA 2VZVA 2PB1A 1HL8A 4MB5A 1CLXA 1FH9A 1ZJBA 3A4XA 3DYPA 2UWFA 1JZ3A 2EXOA 1XSJA 5DT5A 2CETA 5ABEA 3PZMA 2WMGA 2HVMA 3ALGA 3HMCA 1HF6A 1VENA 1CXKA 1QI0A 2RGLA 5DT7A 4D6HA 1BG4A 1UR4A 3N15A 1C3FA 4GO8A 1J11A 1WCGA 3U7BA 3VIPA 2YDSA 3L4VA 3AXXA 3PZNA 1GQLA 1UD2A 1EGZA 1VAHA 1CZ1A 3I3BA 3AXHA 5I79A 3VGEA 3WF3A 2OLHA 4UCFA 1OM0A 3WQWA 4FLSA 3WUFA 2YL6A 1PJ9A 3DC0A 3MSDA 3D5HA 4OBRA 5AC4A 4PRWA 5GNZA 2XIIA 5CPQA 4PMDA 3VDAA 4JHOA 4KRTA 3GTNA 1NWUA 4DWSC 2BY2A 1V0LA 4JKLA 2ZXDA 3VGHA 2G3NA 3KL3A 4W89A 4AD1A 4K68A 4UOJA 3RCNA 1YHTA 4HP5A 4XX6A 1CXIA 1KWKA 3I3DA 4QDMA 1H09A 1WZLA 3W53A 1JDDA 3WH6A 2FH6A 2GDVA 4WF7A 3GXDA 4BF7A 3LMYA 1WP6A 3WQ6A 1AMYA 3F4VA 5HPOA 4W8AA 3L2MA 3II1A 2XFFA 2F61A 3FAWA 1E5NA 1GZJA 4Q7NA 1HJXA 1J0HA 4N0RA 2VCAA 1PBGA 1GCYA 1KCKA 5FOOA 1KQZA 5E0CA 5A8MA 4AD0A 1X6NA 1MW2A 1PAMA 2JE8A 2WSPA 1EQCA 3SCTA 1W9DM 4KRUA 2XGIA 3MUY1 4ZXOA 4KH2A 2ZIDA 3GH7A 2YA1A 1R8LA 2PBGA 1OB0A 3AS3A 1UWTA 5CSYA 3VDBA 4JZ5A 3K1DA 5E6ZA 3SIMA 1BLIA 2CBJA 4F66A 3WUBA 1E70M 2CBVA 1JI1A 1I1XA 1IZJA 5BXPA 4YN5A 2Q8XA 2YLLA 2EPKX 2OYLA 1MXDA 1K9TA 2BHYA 2XFYA 2QMKA 4TVCA 5LA2A 2Y4SA 4ZENA 5FCZA 1E9LA 2GJRA 1ZBKA 4H04A 4URIA 4P7OA 1O7AA 1YQ2A 5DEZA 2WNWA 3CTTA 2ZICA 1EHNA 1IV8A 4MAZA 3ARWA 4P7RA 1N82A 3N13A 3WKZA 3BCFA 5A95A 4M56A 1JG9A 3UERA 3ZR5A 4CU8A 2CHNA 4DM2A 4E8CA 3PTKA 3CH9A 2W63A 1EDTA 4PMQA 4ZXLA 3BC9A 4KGLA 1BVZA 4TOQA 2CNCA 1BF2A 1P6WA 3O6AA 4TVUA 2J4GA 3ARXA 1TA3B 3G6MA 5ECUA 3AIQA 4PMXA 3CHEA 2WVUA 4JKMA 1UH4A 5FIPA 1M01A 2X0YA 3AHVA 2Z1SA 4CKQA 1FA2A 5A6KA 3ZSTA 5A6BD 1UWQA 3AZRA 4PEEA 2E40A 2VZSA 3NUKA 3EMCA 5LYRA 2DH3A 4PUEA 4HZ8A 3CHFA 3TTYA 2VX6A 3WBEA 3WDHA 5F7UA 5FL1A 1TCMA 3F5LA 1ZJAA 1BVNP 4V28A 3WELA 5I3DA 1GOQA 4CU6A 2E0PA 4OKDA 5JIWA 1ODUA 1LWJA 3CLWA 1V03A 4D6EA 5GNXA 1E4LA 2C7FA 1UYQA 1VB9A 5A8QA 1UKSA 3K46A 2TAAA 2Z1KA 2ZXAA 1JAEA 3GH4A 2EEXA 3POHA 4CD4A 4R27A 1X6LA 1TE1A 3VU2A 4MB3A 3WY1A 3VIFA 3AHYA 1E0XA 1DWIM 2V5CA 4AEFA 1FP9A 5FD0A 1XCWA 5DF0A 2J7FA 3EDDA 1BHGA 5D9MA 4IM4A 2JF7A 1MFVA 4GXPA 2D24A 3VNZA 3WH8A 2WHJA 4PCTA 3OLEA 4LYPA 3S6TA 5BXRA 3ZJ7A 4H8VA 2YKKA 1TR1A 4TTUA 3WD1A 3VD9A 1EH9A 4BZYA 3UCQA 2WZEA 1OT2A 3GXMA 1EO5A 1CLVA 2ZUSA 1GQKA 1HP5A 3OGRA 4IPLA 5IFTA 2DSWA 1WDQA 3UEQA 1I1WA 5C70A 4Z2GA 4IISA 5I0DA 5AY7A 2VQTA 1KBKA 2EJ1A 4HMDA 1HT6A 5EBAA 3M46A 1GVYA 3APGA 1XCXA 3UG3A 4V2XA 3IANA 4FMVA 3VGBA 1CGTA 1XRVA 3MMUA 3MMWA 3WBAA 5E09A 4AWEA 3PTMA 3CHCA 3ZT7A 3VKKA 4FK9A 1UWSA 3SCOA 2G3JA 2BXYA 3N18A 3OA5A 1J0KA 3W24A 3TP4A 3NYDA 2OYKA 4GQRA 3FY1A 1G94A 1V6WA 4UQDA 3T2QA 3UG5A 1OWQA 4PUDA 1NOFA 2CBUA 2WB5A 4MNJA 3VM5A 1BG9A 1MQRA 3AZSA 1R7AA 3RM4A 3VX0A 2ZUWA 3ZJ6A 3CUIA 3WF0A 5CJ5A 1QBBA 1AVAA 3GNPA 4DUWA 2CITA 4JKKA 3O2LA 3BGAA 3UETA 4LYRA 3MU7A 5C8BB 3L4UA 3NDYA 1W1VA 3F5KA 1E1EA 7A3HA 2DIEA 2WLZA 1V0MA 1HN1A 1BYAA 2WW5A 5LA1A 2CCRA 3CUJA 3GXFA 3WL0A 3SUVA 3ZJ8A 4ATLA 4P8VA 2W92A 1PX3A 3UG4A 3ZM8A 2DT1A 3FW6A 5CGMA 2WWCA 5JBDA 5HDRA 3PZ9A 2NSXA 3CGTA 1JYXA 3T0AA 4JIEA 3WDQA 1VFMA 1Q6EA 4DUXA 3N12A 3VDHA 4H2CA 4QLKA 3WNNA 3AYRA 2X2YA 1LLOA 3WNMA 1M03A 2WMIA 3SEPA 4CD8A 1VIWA 1NWSA 2XWDA 2JIEA 1X1NA 1PZ3A 3TTOA 2BNJA 5I78A 5I6SA 1BGGA 3BMWA 1ZBWA 1OINA 2XM2A 4WLCA 2EPNA 1WZKA 4ZEPA 5HPCA 1M7XA 4B3KA 5IHRA 5EFDA 4U3CA 3IJ9A 4CCCA 3K8LA 5TD4A 4DUVA 1KXTA 3AQUA 1IZKA 1UH3A 1WO2A 2O92A 1XC6A 3HU7A 1PEZA 3AMKA 4P8WA 2WMHA 4HZ7A 3RIKA 2J47A 1IT0A 3GBDA 1SYTA 1B3ZA 3SCPA 3AI0A 1UWIA 1JNDA 3ARQA 4AW7A 3PBGA 5IDIA 3VILA 3KZSA 4PMRA 2J7CA 4AC1X 2NW0A 1DWGM 1KR1A 4EAMA 2PWDA 5D4YA 1J0YA 4UFJA 2JALA 1KGWA 1FHDA 2RGMA 1W1YA 2DT0A 1J0JA 1HJQA 4XZWA 3K4AA 1C91A 2VX5A 1B1YA 4ACYA 2VUYA 2FHFA 2V3EA 2D23A 3BSHA 1UHVA 1UKTA 5CPSA 3OLDA 3VMOA 5HBFA 3VGFA 1FP8A 1U30A 2DSVA 1FOBA 3MUAA 2ZX6A 1ISVA 1CNVA 4W7UA 3M6DA 4UTFA 2Y24A 4U3AA 1OD8A 2WWDA 3WH9A 5M5DA 3EMQA 1J0ZA 1GHRA 1V02E 1E0VA 3FN9A 3PN8A 1C90A 1V0KA 1LG1A 1B9ZA 3ARTA 1V08A 2XIBA 2VRJA 3F5JA 2DIJA 3CMGA 2OSYA 4HOZA 1QI2A 1DWFM 1W9UA 2O9RA 3ECQA 4HMCA 4W93A 5AYIA 1QHZA 1GQIA 1I75A 1E3ZA 2WSKA 4OOUA 4X9YA 5FL0A 3VD7A 1W9VA 2UY2A 1CXFA 4LPCA 5A6SA 4J3SA 3SCVA 1LL7A 3VIMA 2V3FA 4OIFA 1QI5A 4OJYA 1QBAA 4BQ3A 5A6LA 5I5RA 4XUYA 2OWWA 2PWFA 5GQBA 1CIUA 3L4XA 1K6AA 1DWAM 2QV4A 1QPKA 5KZ6A 2WMIB 2JF6A 1B90A 4LXFA 5HXMA 5A8OA 2G4FA 1UQZA 5D9NA 2YJQA 2Y5EA 3M7SA 2GFTA 1PPIA 1CEOA 5HOSA 2XTKA 1UKQA 3ZJKA 1XD1A 5A6AA 4IPNB 3MSGA 3L4TA 1RD6A 2C0HA 3AS1A 1GORA 4MAVA 2QF8A 1PIGA 4PMVA 1ZBCA 2FDMA 5I23A 2D2OA 3WNPA 4M8UA 3U5UA 3K4DA 4LGXA 3VIKA 4W7VA 2WVVA 1BYCA 5D9PA 1J9YA 5EB8A 1KGUA 2WBKA 1AQHA 2VRKA 1GONA 4ACZA 2WC3A 1LG2A 1ODZA 2D3LA 1E4IA 1Y7VA 2WZIA 3AIBA 1FFRA 4N42A 3WD2A 3U5YA 5A6JA 3AMGA 3AMCA 4GINA 4F8XA 2GUYA 4WJXA 5CGTA 1VRXA 4CVWA 1DHKA 4PN2A 2BVTA 3EMZA 3EDEA 1KCLA 3N17A 2IXVA 1F4HA 2VVNA 4W87A 4GI8A 1GQJA 3W29A 4D6JA 1MQQA 4CU7A 4ML4A 3OLIA 4DWSA 4MJ2A 1TZ7A 1JZ7A 4CN4A 1VFUA 1W3KA 3W37A 2XVLA 1CPUA 1V3MA 1KB3A 1QNRA 4S3JA 2WBGA 4KMQA 3VD4A 4MNKA 1HKMA 3AS0A 4AZ6A 4GKLA 3CZKA 2ZX5A 3UR7A 1WB0A 2XPKA 4L4PA 3VIHA 2PWHA 1JXKA 3WQ5A 2UY3A 4D1IA 3N11A 2WAGA 1OGBA 1E1FA 2A3AA 2YIHA 2VR4A 2ZXBA 1U33A 1V6XA 1GOWA 4TXEA 2YA2A 3QR3A 1EDGA 4BCEA 3L4WA 1QW9A 4C7GA 4NRRA 4W5ZA 5GNYA 3E1F1 1ITCA 3AMDA 1CXEA 3OB8A 4MADA 2VQUA 4IUGA 1UZ4A 1PX8A 2DSUA 2G8ZA 5I77A 4OBSA 1ZU8A 2PWEA 3ARVA 2BY1A 2J62A 3M07A 1BFNA 3N9KA 4UQEA 1J01A 3SCRA 4QCFA 2DT3A 5ABGA 3WDPP 1H49A 3A4AA 3VIJA 3VMNA 3U57A 3VIOA 1CGYA 3W81A 1C7TA 2XM1A 1UD4A 4AZ7A 2WVTA 3BLKA 4U5IA 2VL4A 3WEMA 4BQ5A 4ZE5A 4QP0A 3CZGA 3PZOA 3NIYA 3CZJA 2A3CA 1E5JA 2VC9A 2BV9A 2DEPA 4QLLA 5IFPA 2J74A 3TTSA 4J3VA 1VEOA 5LA0A 1B31A 2Y8VA 1JZ4A 2ZUTA 1XSKA 3BAKA 1SR0A 3WDRA 4CCEA 1UQYA 3ZT6A 4PMOA 4CCDA 3MKKA 3CPUA 4ATDA 1JNEA 2WCGA 2BVDA 2WMFA 2XVGA 3CZ8A 3VM7A 2WC7A 4XB3A 3RM8A 3AFBA 1CGXA 3MV01 5A2AA 3EDJA 1CGVA 1MQPA 5AC5A 1KR0A 2XG9A 1JDCA 1WDRA 7TAAA 4X0VA 1BTCA 1JFXA 1JXJA 1VFFA 2AOSA 1OD0A 1R86A 1GOKA 3AJ7A 3OGSA 4AYSA 1W2VA 4CD6A 1H11A 4AZGA 1ISWA 2W5FA 4F9JA 1UG6A 2F2HA 4F79A 4S3KA 3GH5A 3A4WA 3ARRA 1WAWA 5E9AA 3AIUA 1CDGA 1TVPA 2JEPA 2VURA 3BXWA 1V6UA 4Z2LA 4BA0A 3AHTA 1JAKA 4BQ4A 2XGBA 2VZTA 2BVYA 1B3XA 1B0IA 3DYMA 4M80A 2D0FA 3W0KA 2J7EA 4AD3A 1UOKA 2J75A 2VZOA 1TMQA 4OOZA 4W7WA 1GJUA 1NWTA 3W27A 4CD5A 4D71A 3PZIA 1OGGA 4WKFA 1LF1A 2WMKA 5C71A 1PZ2A 1S46A 1BYDA 1V3JA 3ARSA 1V0NA 2DSZA 1FH8A 1W32A 2XYLA 3GXIA 4U33A 2CPUA 1EDQA 1FHLA 2ZXQA 4MPKA 3LPOA 3B9AA 2UY4A 1XYZA 2E9BA 2WM0A 4UOQA 3OZPA 2ZUUA 4WIWA 1RH9A 4J28A 1HKJA 4UFMA 1WE5A 5M17A 3TA9A 4KWUA 4A3YA 5JUVA 4PMUA 1E40A 2WCAA 1XSIA 3ZSSA 3ALFA 1TVNA 1LL6A 1UD3A 2E9MA 3AS2A 1E56A 3VINA 2ZX7A 2Y2WA 2F8QA 3FXYA 4J27A 2AAAA 2VX7A 3FHQA 1R87A 3B9EA 2QPSA 3WN6A 3QOKA 1W3JA 4AZCA 1DTUA 5I24A 3PHAA 4AY1A 5D8ZA 5ABFA 3OLGA 3NSMA 1LL4A 2CIPA 3D3AA 1CENA 1CTNA 4GO9A 1U2YA 2CEQA 1CYGA 2E8YA 1G1YA 4GIAA 1E73M 3WF1A 1JZ8A 1FH7A 1ISZA 1EOKA 1EQPA 1Q6GA 3AIVA 2MANA 4GI6A 1JGIA 4HPHA 1JZ5A 5BXTA 3EBVA 1GOMA 4HMEA 4HA3A 4R5EA 5A94A 2QHAA 3QOMA 3GBEA 2GDUA 4AZHA 2WKGA 3VIIA 3DYOA 3ZO9A 1W9XA 4WKAA 3NDZA 1H2JA 2FHBA 2DGAA 3MUZ1 2D20A 3VIGA 1HJSA 4Z2JA 4PMZA 2CERA 2G41A 4QCEA 4UZSA 5BCAA 5EMYA 2XJ7A 2D0HA 4B16A 1MW1A 1GUVA 2CBIA 3BAWA 3T09A 1HNYA 3ARYA 1WDPA 3MUIA 1UWRA 4J3TA 2BHUA 1NQ6A 3IJ8A 1J12A 2DDXA 2VCBA 3WD0A 3WDJA 4DWSD 1EHAA 3U7VA 4D1JA 1UUQA 1NH6A 2YDQA 2PC8A 1GPFA 1WPCA 2X1IA 4HOXA 4MB4A 1B3VA 3AIEA 2XSBA 5A8PA 4F9DA 2OSXA 1G0CA 3PZVA 1HKKA 3WUEA 1JF5A 3THDA 1W1TA 4RE3A 2ZUMA 3BH4A 2D0GA 2CXGA 4PYSA 1OGSA 1UWUA 2YL8A 2JFEX 2VNCA 3KE0A 3W4RA 4BS0A 3B8SA 2WCSA 3QHMA 1XH2A 1XHGA 1VBRA 1H0GA 3AXIA 1E4NA 1JF6A 3VD3A 1TUXA 1C92A 2WKLA 4Q22A 2OWXA 3CUHA 2B31A 1NOUA 2QMJA 4TX8A 1RP9A 1J18A 1EOMA 4UFLA 2FH8A 2W61A 1ZB5A 9CGTA 5JIPA 5D9OA 1E71M 4MDPA 1QHPA 1CWYA 4AZCB 4W5UA 2BY0A 5ABFB 3WFLA 4B15A 3PTQA 1ZS2A 6CGTA 1HJUA 1OT1A 3WD3A 4UQBA 2YL9A 1C93A 1GVIA 1K9FA 5BXSA 3T2PA 3AYSA 3W25A 2WANA 3B9DA 3AICA 1HJWA 1ISYA 2O9TA 3EDFA 3GNRA 1G01A 2J79A 1ITXA 1OCQA 4FF5A 1QNPA 1HXJA 2YL5A 3QHOA 2EQDA 4CN6A 5M3WA 4M81A 2VI0A 1BGAA 1E43A 3NSXA 3WQVA 4JFTA 1SMAA 3QHNA 3OG2A 1TFVA 4U5KA 4JHZA 3RDKA 1OBAA 4P7NA 1G9HA 3I3EA 1KQYA 1NP2A 4H8HA 1WZAA 4OUEA 3FAXA 2J7BA 4MTVA 1R85A 1HP4A 3GM8A 4UNIA 1AQ0A 3HJEA 1E6ZA 4GPNA 3RMEA 4AIUA 2XUCA 1OIMA 4EKJA 5CQ1A 1XH1A 1UH2A 3WH5A 5A2BA 3AIRA 3VGGA 2EPOA 2V38A 1JD7A 1UA3A 4AD5A 3WNOA 4HOWA 1QI3A 1QW8A 1PX4A 2XFRA 3GYCA 3VNYA 1JFHA 3ARPA 3W82A 2FGLA 3MV11 3CO4A 1MFUA 1US3A 4UOZA 3PZTA 3MS8A 2XVNA 4PTWA 3CBWA 8CGTA 3VO0A 4D6CA 1EO7A 4MJ4A 1UR9A 3ZIZA 2VCCA 1H4PA 3DECA 3CUGA 2A3BA 4AMCA 1H3GA 1QNSA 4Z2HA 2J78A 4UQAA 3SURA 2NT0A 2GSJA 3IK2A 4CN1A 4B9ZA 3VTRA 5CSUA 3CZLA 3SUSA 1UKPA 4QAWA 3CMJA 2YLAA 4HA1A 3W38A 4P7LA 4BQ2A 1VBUA 4E4PA 1LQ0A 3THCA 1GW1A 4XZBA 2WHKA 3RJXA 3AIWA 4V27A 1R7OA 3CIVA 2J7DA 1JDAA 2C8NA 4HU8A 3QGVA 3VX1A 1CGUA 3G6LA 1HX0A 1SMDA 2WC4A 1W2PA 3IAQA 4PMNA 4ZE4A 4PSPA 4QLJA 2O9PA 4LQ1A 3BAXA 4HPGA 1XV8A 5JBFA 2QPUA 3SCQA 2EPMX 3W28A 4YPJA 1EXPA 3GNOA 5GPRA 3NJ3A 4D6GA 2PBOA 1OIFA 1GOIA 1ESWA 1TA3A 1WZMA 1CXHA 2Y8KA 1H1NA 4M24A 1BSIA 5EFFA 1UR2A 3W6LA 4CUCA 5BRPA 2A3EA 2D1ZA 4FLQA 2BS9A 4PSRA 2CHOA 5D8WA 4RE4A 2DT2A 3EDKA 1JD9A 3T0DA 4AZ5A 2ZWZA 1CXLA 1L8NA 1HJVA 4PTMA 1US2A 2OYMA 3WF2A 4NI3A 2XWEA 1WDSA 3SUWA 1UZ1A 2VZUA 5E6YA 2GK1A 1LJYA 1W3LA 1H0IA 4W86A 3VDCA 3VPLA 1HKIA 3AISA 4W88A 1E6RA 3CUFA 2GVYA 2VRQA 4C7DA 1LWHA 1C7SA 2E3ZA 2VOTA 2DH2A 3UR8A 3KWXA 4CGTA 5M03A 3AZTA 2OSWA 1A3HA 4A4AA 3L4YA 3K8MA 1HVXA 1MW0A 4PTXA 1V3IA 4Y7EA 5A8NA 4B9YA 4AZBA 1HVQA 2ESCA 4X0NA 1MYRA 4JFUA 3ZOAA 4J3WA 5IHSA 5CPTA 2IXUA 4DM1A 1JZ6A 4PMYA 4J3UA 4NZCA 3WEZA 1MW3A 1Q6FA 2X05A 1E6SM 4WSJA 1B3YA 2V5DA 3OBAA 3BMVA 3LPGA 2IUZA 4EANA 1Z32X 3WNLA 1MVYA 2VTFA 3A3HA 5KEZA 3AHZA 4JL1A 2E8ZA 4AD2A 1BYBA 2WVVB 4YHEA 3WDIA 3JUGA 4NRSA 4PCSA 4D6FA 1PIFA 1JYNA 4JCLA 2J8FA 4ACZB 2CKSA 5BWFA 3O9NA 2FHCA 5DMYA 4UZUA 3RJYA 1BAGA 2VMFA 4H8UA 4UQ9A 6TAAA 1D7FA 3SUUA 2G3MA 1C8YA 3AMLA 3PZQA 1XD0A 4W85A 3AROA 3AOFA 1RP8A 3L2LA 8A3HA 3RPMA 1Q6DA 3N04A 4GZIA 4Z2IA 1AQMA 4JFWA 3J7HA 1CGWA 2OWCA 3ARUA 1E15A 3GDBA 5FKYA 2CYGA 4RE2A 1JI2A 4NF7A 4U2YA 1NWRA 1V6VA 1QHOA 4EE9A 5AYBA 4D6DA 4DWSB 2EO7A 2WYSA 1V3HA 3BLPX 4XV0A 1B2YA 3OZOA 4HTYA 4U31A 1Q4NX 3POCA 4L4OA 3L4ZA 1VJSA 2CKRA 4WKHA 1NM9A 1QOXA 4AD4A 3WEOA 3BSGA 4TUFA 1QNQA 2J8GA 5A3HA 2VO5A 2WHLA 3SCWA 1K9EA 3FHAA 3WFZA 2GK1B 5A1AA 4LX4A 1VEMA 2DPEA 1OSEA 4MDOA 2XVKA 1A47A 3CZEA 4GI9A 2XHYA 1M53A 4AIOA 3T0BA 4MNLA 3WD4A 3IJ7A 6A3HA 4UFKA 7CGTA 1W3HA 1GOOA 5CG0A 1E3XA 5BRQA 1HL9A 4JAWA 1E6QM 1MXGA 1W9PA 2WZHA 1NOWA 1M04A 2W91A 3OIHA 1C8XA 2W66A 3WH7A 3PZUA 3RO8A 4P8UA 1QVBA 5A69A 1V3LA 2ZE0A 5HNNA 2E9LA 2W4XA 1VJZA 1W91A 2V3DA 4TX6A 1CECA 2J7GA 4QFUA 3LPFA 5CZKA 2GJXA 1QI4A 2ZX9A 5IXEA 1JIBA 1VF8A 4E2OA 3WSUA 2WK2A 1JZ2A 1VFOA 4AXNA 2YOCA 3NCOA 4J7RA 4UFHA 1C8QA 1UR8A 4OZOA 2E4TA 2CESA 3K8KA 1UD5A 3RM9A 2BY3A 1E55A 3N1AA 1ISXA 1UR1A 4H7VA 1EA9C 4D72A 1FFQA 2X8RA 2BHZA 4KGJA 2YBTA 2PI6A 2BXZA 2X09A 2WLYA 1E0WA 2HISA 3MANA 5E70A 1UKOA 3SCUA 1ZBVA 1QNOA 1GJWA 3LPPA 4PTVA 4LYQA 4ZFMA 3ZT5A 2VT0A 4W84A 2YBUA 1JYVA 4CD7A 3ZR6A 1GNXA 2VJXA 3T08A 4HA4A 1G5AA 4W8LA 5ABHA 3WQ8A 2ZX8A 1DWHM 3KEHA 4HU0A 2XSAA 3TOPA 4A3HA 4J3XA 1J0IA 4GZJA 1UR0A 4M1RA 3KL5A 4EK7A 4AISA 1B3WA 2WVSA 4PBGA 2VX4A 1XGZA 3VGDA 3WQ4A 1E6XM 3PZGA 1JYWA 4WK9A 1D2KA 4AEEA 1DEDA 3W6MA 1L0PA 2VVSA 3WUGA 2WHMA 5BROA 3A6OA 1HIZA 2D3NA 1D3CA 1JL8A 4W8BA 2AMGA 2X0HA 3WL1A 2G3IA 3ARZA 1KWGA 1MWOA 1KXQA 2BFGA 2V3GA 3VUPA 4GZEA 3GZAA 1Q6CA 3WF4A 1BQCA 3HN3A 4JFVA 2JEQA 1XH0A 3BAYA 3MO4A 3DHUA 4M29A 4NSBA 3WMSA 3A47A 5DO8A 1NP0A 5DFAA 4WSKA 1E6NA 3BAJA 1H5VA 2EBNA 4RL3A 1TG7A 4Z2KA 3KL0A 2VR5A 3WNKA 5A6MA 2ZOXA 2QLYA 1ZL1A 4FLRA 4D6IA 2DSKA 2XVPA 4FLOA 4MB1A 3WENA 2ZWYA 2JIWA 4JCMA 1V02A 1KBBA 2YDRA 4AIEA 2GJXB 4U2ZA 4YHGA 3WMCA 3VVGA 1K9DA 1UA7A 3NSNA 3SCNA 2NT1A 3BCDA 4ATWA 1EIBA 5A2CA 2A3HA 2WXDM 1B30A 3VD5A 2GJPA 4H41A 4JL2A 1W1PA 3VOCA
chains in the Genus database with same CATH superfamily
3B0UX 3EGJA 2C79A 4GWEA 4CNOA 3EB4A 3F4DA 3KOWA 3NL2A 2CLPA 2PWGA 3SGGA 3IAPA 1J10A 3UPWA 3CHDA 5A6BA 1DP0A 2FZBA 6REQA 4UR9A 2CFFA 1E6PA 4JFSA 2R1LA 4HZ6A 3AHXA 2J77A 2HQAA 3TTQA 3VMPA 3NZGA 3S83A 3E38A 3BJSA 3KUMA 1W9BM 1XYFA 4IGMA 3FKKA 1JJKA 4MNMA 1TZ9A 3EWCA 5E0FA 2PDPA 1O6IA 3N14A 4LUTA 4NJKA 4HPJA 2V5KA 1V3KA 3UT0A 4BKNA 2WPGA 5I2UA 4ZB0A 2QV5A 3GVGA 5A5WA 4DJFD 1ECEA 4E8DA 5JBEA 4O16A 2GWGA 4RW5A 2EPLX 2PAJA 3W1LA 1TJ0A 3NZ1A 3OGVA 4C6NA 3VUSA 1CLXA 3B8TA 1ZJBA 2UWFA 1JZ3A 2EXOA 2GWNA 2GJLA 5DT5A 2CETA 2WMGA 3S1VA 4Q4QA 3ALGA 4Y9AA 1HF6A 2PCQA 4JYFA 2Q71A 1CXKA 1LM1A 1YEYA 2V82A 3S2NA 3LDVA 9RUBA 2NQZA 1E9ZB 2TODA 2FVLA 3WZ0E 1ZJHA 4MY1A 3NR0A 2Z2BA 4GOAA 3NQ6A 3PZNA 3Q37A 1VAHA 4YS1A 5SWUA 4LW7A 5I79A 5I3KA 2X0SA 1V77A 3B40A 3GZ3A 6XIAA 2CU0A 3WQWA 4PMJA 4WCJA 1DE6A 4F0KA 1TX0A 4DUOA 3FYYA 3DC0A 1SJDA 3MSDA 5DLCA 2YR1A 3TJLA 2XIIA 4O50A 3MBFA 4PMDA 4RJEA 3VDAA 2PGEA 4JHOA 3GTNA 2J9XA 2UZ9A 5D09A 1NWUA 3ZVHB 4GA8A 1JULA 1IXOA 3VGHA 4JNYA 2Z4GA 3O8AA 3RITA 3QPEA 1LQAA 1KNWA 2A2IA 4NQ1A 4XZHA 4K3ZA 4J40A 1IEVA 4XX6A 4DO6A 3E2RA 1CXIA 4QDMA 1H09A 1F61A 2ZZ7A 3GXDA 2G3FA 4NJIA 1IXNA 1WP6A 4H9ZA 4IIHA 4ZL1A 2O55A 4PL2A 1OF6A 3L2MA 1FKWA 2A7PA 4Q7NA 3H70A 3M4HA 4CCZA 4POCA 2VCAA 3GYEA 1PBGA 3FJ4A 1KCKA 1RZMA 1VS1A 4LAZA 5A8MA 1EQCA 3SCTA 2C71A 4Q8NA 4MWAE 2XGIA 4ZQNA 3PS7A 2ZQ0A 3LRMA 1ZNNA 3RU8X 3SADA 3KBJA 1U5VA 4P2VA 4V1YA 3BOFA 4B2DD 2PBGA 4KFNA 3AS3A 1L6WA 4GISA 4ZQCA 5CSYA 2PDCA 4UNKA 3NGFA 4DI9A 3SIMA 1TKKA 4UBPC 1EPXA 1E70M 2CBVA 4YLWA 1IZJA 3R1ZA 3S1GA 3UNDA 3LXCA 4B5VA 2EPKX 1MXDA 1K9TA 2BHYA 3UPBA 2Y4SA 2YB4A 1GWJA 4P7OA 2Y61A 2V8ZA 1EJWC 4GRSA 3UZ5A 2ATSA 4PUKA 3W7EA 4MUPA 2CWXA 4MAZA 5XINA 1P0DA 2X40A 1JG9A 1NEYA 4Q4OA 4L6DA 4N9CA 3T44A 1S2CA 4XIMA 1FBAA 3C3UA 4PMQA 2A0NA 1QATA 3WBXA 3QQ0A 4TOQA 3VE7A 1WKEA 1LOSA 4L6HA 3ARXA 3G6MA 2PF8A 5ECUA 3HPFA 3SN0A 1PDYA 3WLLA 3CHEA 2X1SA 2E7FA 2ZC1A 1M01A 4GBUA 4LAMA 3UJRA 1KTNA 3H2CA 1KBJA 3BWWA 4KIEA 1F6YA 1SSGA 4PEEA 3P5ZA 3TXVA 4AHPA 4PUEA 1EA0A 2VX6A 4V1XA 5F7UA 2PE4A 1YX1A 1ZJAA 2H8XA 1BVNP 4V28A 4O1AA 5I3DA 4WY0A 2O4QA 4YL2A 1ZJIA 2J6XA 1F6KA 4MFDA 4FOKA 2PP3A 5GNXA 2C7FA 3KCOA 3VNIA 4E3VA 1HKVA 1VB9A 4JIHA 4OBTA 2XIJA 1G4PA 2HK0A 3GRIA 4S38A 3KBWA 3GH4A 3NVTA 3ICJA 4R27A 1K3UA 4TIMA 1XP3A 2FTWA 1X6LA 4IH3A 3SO7A 3BV4A 3APTA 2YCKX 2ZE3A 4MB3A 4F2UA 2YXOA 3RR1A 3RHGA 4LVDA 1E0XA 1DWIM 3LA4A 3UWEA 3IRSA 1XCWA 5DF0A 3UXAA 3U6WA 3EDDA 2EG6A 1KRMA 5HQLA 2X42A 4LYPA 1R2TA 3S6TA 4H8VA 2YKKA 5CJNA 3CC1A 4BZYA 3GXMA 2ZUSA 2VGFA 2B7PA 4DVOA 3ABRA 1I1WA 2Z0IA 1AUSL 1TUFA 4IISA 1E9IA 3RUBL 1HT6A 3BLDA 2PMQA 3W73A 3FJ6A 1UR3M 4A8NA 2Q09A 1BEUA 1TV5A 5E09A 4A05A 2OB3A 3NQ2A 3O05A 2WQPA 3W76A 3L68A 5U4NA 4XBJA 4FK9A 2WSYA 1TJ1A 3OJGA 1XC4A 3N18A 3OA5A 3S6DA 3NYDA 2OYKA 1FWIC 1KW1A 4NNBA 3HM7A 1V6WA 1VBHA 2OKTA 3VC5A 4DBUA 4PRTA 2WB5A 4B90A 3AALA 3AZSA 4GYJA 1QBBA 1JDEA 3QGKC 2YBVA 3HA1A 1EJXC 4UMAA 3N2BA 2VFFA 2NXIA 4XTDA 2WLZA 5LSMA 4LBRA 1BYAA 1RLDA 2X7VA 3A9IA 1OYCA 1PCKA 3W7DA 4D2JA 2CWNA 3BCJA 4HNUA 3W74A 2NX1A 4J5NA 1D3GA 2W92A 3M0JA 2QYGA 2DT1A 5CGMA 3BQ6A 3UNTA 5HDRA 3WLIA 1IXPA 3F2CA 1W3IA 4LVAA 3W7QA 4JIEA 3WDQA 3EWXA 4I90A 4RNIA 3WNNA 1SO4A 4LV9A 3NFUA 3NM1A 3M64A 3PJWA 4DJED 2QVNA 2V68A 4EVZA 1JCJA 1KFKA 1X1NA 3TTOA 4LC6A 5I78A 1IT8A 4XZ9A 2QR6A 1OINA 4B3KA 3IWPA 5IHRA 5EFDA 4FB7A 3K13A 4U3CA 3IJ9A 3K8LA 3LSBA 4EX4A 2QCMA 1KXTA 1OCNA 3AQUA 1XLBA 4GIRA 1WO2A 2O92A 1XC6A 4OV9A 1YTEA 1DXFA 4HZ7A 3RIKA 2J47A 4L1XA 1FDJA 3CT7A 2QQ6A 2IKGA 3AI0A 3GNXA 3IV8A 3UA3A 1JNDA 4AW7A 4AC1X 3R8RA 1KR1A 2CLLA 4KCUA 5D4YA 3WK3A 3VFLA 1A4LA 3OVQA 3M6YA 3N2XA 1FHDA 3MZ2A 1W1YA 1VKFA 1XIBA 1J0JA 1F74A 3GC2A 4LAOA 3K4AA 1C91A 6ALDA 1B1YA 1A49A 2VDIA 2W9MA 4GC3A 2V3EA 4J35A 4YYFA 2D23A 5HQMA 1UKTA 1QXLA 5HBFA 3UFYA 1QK2A 4RPQA 3VGFA 3COTA 1FOBA 4Q8OA 4UTFA 4U3AA 1HKWA 4TV6A 1GHRA 3FN9A 2RAGA 5GVJA 1O60A 5H8UA 5D37A 3F5JA 2BSLA 3S4TA 5AYXA 2OSYA 4HOZA 1L6GA 1QI2A 1LBFA 3T0CA 4HMCA 5D05A 4JTUA 1JUEA 1OC5A 2IS7A 1GQIA 4WDWA 4OOUA 1W9VA 1GEHA 2UY2A 4LPCA 5F1VA 3SCVA 1LL7A 2RDTA 4U10A 4OIFA 1QI5A 1SQ7A 2QEZA 3VNKA 2AGKA 4OJYA 3UQNA 5I5RA 4XUYA 2PWFA 3MKCA 4EPEC 3L4XA 4C91A 7XIMA 2JF6A 1B90A 5B80A 5K9CA 5HXMA 4JQ3A 2ISSA 3NO3A 1PPIA 1FWWA 4JQAA 4IPNB 4XD5A 3MWAA 2XZ9A 2GGJA 1ZBCA 3WNPA 1JUBA 3VIKA 2OLSA 1J9YA 5FSDC 3REQB 1TB3A 3ITOA 4YJ5A 3WCZA 2I5IA 4ACZA 5D2YA 4ASTA 2WC3A 3U48A 2YFOA 3K5XA 3KAOA 2CLEA 1G7VA 3NAVA 4ECLA 3EA3A 3AMGA 3TR2A 4RDVA 1ZRQA 2TYSA 4GINA 2GUYA 4GQGA 4CVWA 1ZFJA 3O7UA 3QMRA 3FGCB 3QMSA 1PWLA 2IXVA 3GKAA 1XM3A 1GQJA 3W29A 1EFZA 6ENLA 4ENLA 1MQQA 2GUBA 3CTLA 3P61A 4HNLA 3WFAA 4MJ2A 1TZ7A 3W37A 3SB0A 4L9YA 1CPUA 3ITXA 1QNRA 1B5TA 2OEMA 4MNKA 2RDWA 3W87A 4FR6A 4GKLA 4I9MA 2ZX5A 2ZZ3A 1FQ0A 4IX2A 1KM2A 4QE1A 4D1IA 2AQWA 2YIHA 3N4EA 2VR4A 2ZXBA 1U33A 5CPOA 1V6XA 4TXEA 1N8FA 2V2CA 1JCTA 1RJQA 3LRKA 3T7VA 2GPTA 3VC6A 1UCWA 3OB8A 1CXEA 1NQKA 4MADA 3HOJA 3R0KA 5C55A 2RJHA 1NJJA 1P6CA 3SN4A 2WZTA 2ZRXA 2IPJA 4H19A 1KFEA 2G8ZA 4ZQRA 1WBHA 3M41A 4A2SA 3MC5A 5B7YA 1ZU8A 3WJWA 1S2WA 1SZGA 4ILSA 1XPGA 5J5DA 2J62A 3M07A 3SRFA 1WKFA 3N9KA 3KRSA 1OHLA 1J01A 4QCFA 2PDNA 5AVNA 2EG7A 3A4AA 3VMNA 2VDGA 2XM1A 1OFRA 1UD4A 3FKRA 3BZGA 3BLKA 4FOJA 3WEMA 4ZE5A 4XZIA 5DELA 3A13A 5TBOA 2BV9A 2Q3RA 4QLLA 4O4WA 5HJYA 3TTSA 2DU2A 4Z1DA 5LA0A 3ITVA 3W2KA 3G1YA 1DJXA 2ZUTA 2YXGA 3G1SA 2QF7A 4CCEA 1TRIA 1O1HA 2V69A 3MPGA 4NYUA 3ZT6A 4CCDA 3MKKA 4IMDA 4RXGA 2PURA 1JNEA 2BVDA 2WMFA 4M6PA 4BF5A 3RM8A 1EUAA 1S2AA 1OZQA 2OT0A 3MV01 5A2AA 1MQPA 3I7RA 5BU9A 3ANVA 1KR0A 1JDCA 7TAAA 3HQ1A 1UP2A 5DCBA 4QJ4B 1BTCA 4L7ZA 4FSAA 3SY8A 1JXJA 2ZZ2A 4RR4A 2ANUA 3AJ7A 3OGSA 1W2VA 3VDGA 4K37A 4C5ZA 1ISWA 4I5UA 1Q6QA 2W5FA 4C6PA 3NA8A 3ZYZA 5E9AA 1GJPA 3AIUA 1LLWA 1R5YA 3NPUA 4BA0A 4UTWC 4IOTA 2VOMA 4LU0A 4Q4MA 2QCNA 2XGBA 1B3XA 4M80A 4A3RA 2E6YA 3B04A 1Z89A 2D0FA 3VOIA 3W0KA 4BHYA 4AD3A 5GJNA 5CSSA 1I60A 4OOZA 4W7WA 1GJUA 9XIAA 5FJOA 1XLJA 2P53A 4WKFA 5C71A 2WNZA 4U4MA 1BYDA 3ARSA 3GDTA 1FH8A 2XYLA 3KBMA 3B05A 3TFCA 5FJUA 1FHLA 4B5WA 5JVLA 4INFA 4FX8A 1XYZA 4HMNA 4A6GA 4JX6A 2CLOA 2CLMA 2Q01A 3TN5A 2ZTJA 2JK2A 2YXXA 1F05A 4I9AA 4XZLX 3GIYA 4JIIX 4NU7A 3JS3A 5I09A 4K38A 1XG4A 2FIQA 2WCAA 1XSIA 1LOLA 4IQLA 1E56A 3JRKA 3VINA 4FXJA 2F8QA 4DLFA 2AAAA 2GUUA 2V9DA 6XIMA 2PRMA 1XLIA 3UZXA 1Q66A 1TWIA 2QPSA 4FNRA 1DTUA 3P84A 4AY1A 2BLEA 3OLGA 4GHRA 1LZOA 3N2OA 2CIPA 3D3AA 4GO9A 4JN7A 1G1YA 3H7UA 4C6OA 5HNTA 4BF9A 3SAZA 5EYWA 1FH7A 1ISZA 4B5UA 3TZNA 1MRQA 3H6OA 5D38A 1JGIA 1J6OA 1QPNA 1JZ5A 3UZWA 4XAFA 5A6TC 1GOMA 4HA3A 4PTNA 4R5EA 1IXQA 4GVFA 1BQGA 4AX7A 3DYOA 3K30A 5D2WA 4OWGA 5D2TA 2FHBA 4PB3A 1DPMA 1M68A 2CERA 2G41A 4OTKA 2VUNA 3L65A 2QCFA 4JN6A 4PCFA 4UZSA 2XJ7A 4MVAA 5FJTA 1MW1A 1GUVA 3CO8A 2CBIA 1M41A 6PTDA 5JMUA 1UWRA 4Q32A 3PJUA 1NQ6A 3IJ8A 3WD0A 2GQ8A 1S39A 3U7VA 3SW6A 2VEFA 2YDQA 3M0VA 1GPFA 1WPCA 3W7JA 4HOXA 3C0QA 4B2DA 1A5UA 1B3VA 3AXKA 3AIEA 2XSBA 5CPMA 2PTYA 2QDHA 3WLOA 1YTKA 3MYOA 3MDWA 4BI7A 5AHEA 2PZNA 1HKKA 1X1ZA 3V35A 1OF8A 3THDA 1W1TA 4RE3A 5BOFA 4PFMA 4DZAA 4YVPA 3FJNA 4BS0A 1YKWA 3LENA 4AF0A 2P88A 1EJVC 3LM3A 3VD3A 4GUHA 3RN6A 1VFLA 1C92A 2WKLA 3ZZ1A 4ZOBA 1UJPA 2C13A 2P0OA 1RP9A 1PKLA 2V2DA 5JQ9A 2HNEA 4XISA 2FH8A 3W02A 3I6TA 1AH0A 1OX4A 3GG0A 4WEVX 3CQJA 4AZCB 1RR2A 5ABFB 4B15A 3E5BA 3EPNA 1ZS2A 3WD3A 5BXSA 3AYSA 4YXGA 4H83A 3B9DA 1ISYA 3F2BA 2O9TA 3LHTA 2DZAA 3GNRA 4PULA 3CYVA 3MB9A 1G01A 2J79A 1O5QA 2ZDSA 3QHOA 2QCLA 4YYCA 3EX3A 3WJSA 2ZBTA 1BGAA 2R1KA 4FP1A 2QCDA 5D32A 2PP0A 4AVFA 1W54A 4OUEA 3O15A 3N19B 1O1ZA 1HP4A 4UNIA 1KCXA 4GPNA 3RMEA 1THFD 1TPUA 4EKJA 5CQ1A 2YB1A 3EEGA 1P0BA 1AL7A 4MZ1A 1P48A 3VGGA 2V38A 1JD7A 1YPIA 3AUOA 4HYRA 1QI3A 1WDWA 1XUZA 1R9YA 3VNYA 3W7IA 3MV11 3QMTA 3ZLGA 1MFUA 2F2KA 4M5PA 2QCCA 3MS8A 4PTWA 3O16A 2VWSA 3ABSA 4WY0F 5I3JA 5TNVA 3VFCA 4CEXC 4M7SA 4N9EA 2GSJA 3JZUA 1Z6KA 3CZLA 3SUSA 3W70A 3ZVIA 2PDKA 4LUIA 2YLAA 4L56A 2QPXA 5K4XA 3G3MA 3W38A 3PJXA 5KITA 3A3WA 3T1GA 4HN4A 3KS6A 1VBUA 1LOQA 1GW1A 3RJXA 3AIWA 1YPXA 3S5NA 4PB4A 3MVTA 1YNPA 1JDAA 1ZCCA 3SGZA 5BU6A 4MWAA 4EPBC 2Z28A 5HWJA 3BW4A 4WJ8A 5K7JA 5FF3A 2WC4A 1W2PA 4K36A 2C0AA 3IAQA 4PMNA 4M7TA 4I8YA 4IMGA 2KAUC 1UB3A 1UASA 4KS0A 2OOGA 3M0IA 3W28A 4W9TA 3ONCA 3V7PA 4Y8FA 2PBOA 4JPGA 3VOHA 3HMJG 4W4QA 1TA3A 4GJ1A 1K4HA 2D2JA 2Y8KA 4M24A 4FX6M 4PUWA 4NAEA 1W5PA 1REQB 1BSIA 3QV8A 2A3EA 4KCVA 2D1ZA 1XIGA 1G6CA 5LGXA 2I56A 2QUMA 1JD9A 1V7YA 3OODA 2ZWZA 1CXLA 3UZZA 3T4CA 2AKMA 3PTDA 1HJVA 4S3EA 1US2A 4JNMA 5G2WA 1UZ1A 4Q8TA 4R9XA 1Z41A 3TXZA 1HKIA 4H00A 4W88A 1Q6OA 1P4CA 1XBXA 4C7DA 1UP0A 1WXZA 1C7SA 2VOTA 2DH2A 4GNKB 4NXSA 5C2CA 2PP1A 1SUXA 1YDYA 4CGTA 2QXWA 1E1CB 3B8WA 3LV5A 4LS1A 3DG6A 3LHYA 1TV8A 4KETA 5HR7A 3RK8A 4Q8PA 4A4AA 5LIYX 1S3HA 3CXOA 3A5FA 5C54A 4YCPA 1CW2A 4AZBA 1HVQA 2ESCA 4G1NA 4QDPA 4YTUA 4LT9A 3ZOAA 5AC6A 2IXUA 4JS3A 2VC5A 3BOLA 3CLMA 1MW3A 3QZAA 4C6EA 1DYSA 1ICSA 1E6SM 4XKMA 4WSJA 1B3YA 4JTLA 2ABBA 3OBAA 3L5MA 4LRTA 1KKRA 1Y0EA 3LPGA 4EANA 1Z32X 4ROPA 2P0IA 3WNLA 5IOBA 4QR6A 1LORA 1PXGA 1LBLA 2WVVB 3QJAA 2OR2A 4QG8A 4JCLA 2V6AA 4J2PA 1KA9F 1KC7A 5DMYA 3LGGA 1AJ0A 3Q2DA 4UQ9A 1QFEA 3SUUA 2G3MA 3MCMA 1XI3A 3PZQA 5G1TA 3RPMA 4C6KA 3W72A 1DXEA 1H60A 1AQMA 1CGWA 1TJ2A 3QW4B 2OO0A 1E15A 4XBSA 4ZOAA 4ORMA 4U2YA 4Z1CA 2RUSA 5AYBA 2EO7A 2R82A 1F3XA 2XU2A 4M6VA 1M5WA 1F3WA 3UR2A 1NTHA 5DX7A 1T0OA 3IGHX 3TW9A 2ZADA 1W5MA 1KM1A 4I3GA 4B5XA 1Z3NA 4AWTA 2AMXA 1VHCA 1NY1A 4MDOA 1IWPA 3TNBA 3T0BA 3WQOA 1J93A 1JQVA 4WSHA 2H8ZA 3WD4A 3W7RA 3H54A 3W1TA 1A5AA 4Z0JA 1GOOA 4IHCA 1PTAA 1Q5MA 1HL9A 1UIPA 4EWJA 2WZHA 3UJ2A 1NOWA 1DTNA 2PDQA 5FF2A 1C8XA 2W66A 4O0KA 4P8UA 3TFXA 4JTAA 5A69A 3PB0A 2V67A 1Q8AA 2ZE0A 5HNNA 3GD6A 3E12A 1ICQA 1QT1A 1LDCA 2E9LA 4NL1A 2W4XA 3BGGA 2H9AA 3UPMA 1CECA 3RFAA 2J7GA 2Y1HA 1AJ2A 2GJXA 1QI4A 3CIWA 2PUZA 5IXEA 1JIBA 3RX2A 3WSUA 4G7EB 1JZ2A 3U9IA 4M3PA 3VZXA 4UTKA 1F2JA 3N34A 1WBJA 1C8QA 1UR8A 5FJIA 2OEKA 3RRAA 4AVNA 4GYFA 2BBFA 1UD5A 1X8CA 1EA9C 4D72A 2FMOA 1ITUA 4MY9A 3DFYA 2BHZA 3KOZA 5LIKX 2PI6A 2X09A 2DZVA 4S3FA 2DZBA 3R6IA 1QNOA 1KKOA 3QN3A 5CAKA 4ZFMA 4NX5A 2NV2A 4FHAA 3MCOA 2YBUA 1JYVA 3ZR6A 1VP5A 1G5AA 1FCQA 4HJFA 2Y85A 5ABHA 1DWHM 3G77A 3KEHA 4HU0A 4IP7A 3TK7A 5LIWX 4A3HA 4JX5A 2A21A 3QC0A 2HWGA 2PFHA 1ADSA 4H7CA 1AZ1A 1A5SA 2FPYA 1E6XM 4ADUA 1JYWA 4WK9A 5HNRA 4C60A 3O6DA 1GGOA 5LNUA 1UPPA 3CQHA 2WJFA 4AEOA 1KBIA 3A6OA 3QYSA 4PCPA 3LI0A 5GJPA 4R88A 1JL8A 1FXQA 4W8BA 3TTEA 2KX9A 3I6RA 3SR7A 4K6AA 3GZAA 3I10A 3M0HA 3BAYA 3DCPA 1EGVA 3EX2A 3WMSA 1R9ZA 5DFAA 4WSKA 2V5BA 1NFGA 1TJRA 3IJLA 2EBNA 5HA7A 2Z7KA 4IL2A 3LGEA 2ZOXA 1ENUA 1GPWA 4QNEA 2VFEA 2G5WA 3C0SA 4GACA 1H1ZA 1EEXA 2PDFA 2PU0A 1EIXA 4CEUC 2DZWA 3FDGA 3H2MA 5CSRA 3OG3A 3ANYA 2OLAA 2CW6A 4G9PA 2ZCGA 3T8LA 5DY2A 2P50A 3GVQA 2A3LA 4O8RA 1Q13A 2CLKA 4ATWA 5F2MA 2CZDA 4JTJA 2WXDM 4YWSA 1B30A 4H41A 1L8PA 1W1PA 3SCSA 2G37A 1D8WA 4AX6A 4MPQA 4DHGA 3EPOA 3KZPA 1G7UA 2DORA 1WNOA 4ZOCA 5AKQA 3SUTA 1P7TB 4C1LA 2W67A 3DG3A 2FB2A 4C6CA 3G1XA 3W6YA 3SBFA 1DWJM 3FNDA 2DQXA 3LNMA 4C7FA 3UP8A 1XKYA 5FAGA 4M82A 1UD6A 1EEPA 4GQQA 3WQDA 3TQKA 3EA1A 1O68A 2FTPA 3IGXA 4LB3A 4CVUA 4ZR8A 2WMJA 1KXVA 3OP2A 1VRDA 2ZUNA 2W62A 5M2FX 4UTLA 3ZS4A 1RXOB 4QG6A 1SFSA 4NZJA 4DPQA 3Q4DA 4AZIA 2B7QA 3PY2A 4O0ZA 4P7QA 3LOTA 3E2QA 2F9RA 3DHPA 2UY5A 4MGGA 3MMDA 3TJ4A 2PDLA 3U4AA 2PB1A 1HL8A 4MB5A 3W3OA 3A4XA 3DYPA 1QWKA 2OZTA 1XSJA 4C1KA 4XVDA 4XG1A 2XIQA 3TOYA 3PZMA 3KFTA 3CB8A 3STGA 1Q7MA 1SZFA 2RGLA 3EWZA 4D6HA 4AUBA 1BG4A 3W22A 3PPGA 4WR3A 2BDQA 4GCXA 4E4FA 1J11A 4FNSA 1YDVA 3AXXA 3TE9A 1GQLA 1XLFA 3B9OA 1NVMA 3I3BA 1H50A 1GG1A 1ZP3A 3THUA 4QS6A 3LHVA 2DP3A 2YSWA 3V36A 2QAFA 3R89A 4QS5A 4OBRA 2XZ7A 5AHMA 4LTSA 3G1HA 3FYOA 3NO5A 2VEMA 2HVNA 4FXFA 1LRNA 4KERA 1V0LA 4XIAA 3RLGA 5C0QA 3R12A 4AD1A 2VR2A 3BZJA 4Q6XA 3R94A 5D02A 2PLCA 1DJWA 3IIPA 1Z7AA 2FH6A 4BF7A 3LMYA 2OZ3A 3WQ6A 2O4MA 3FXGA 5EMJA 1YIXA 3P8JA 1PSCA 2F61A 3TH6A 2JKPA 1GZJA 4AIBA 4HKPA 4N0RA 4MZ8A 5FOOA 5E0CA 2TMDA 1MW2A 2JE8A 5EMMA 1EP3A 3XINA 3HQNA 3N4AA 3M0YA 3ZR4A 1VFSA 3WJZA 2HBXA 3L5AA 2O7QA 2ADAA 3DENA 4LAKA 4H2HA 3TEVA 1R8LA 4C5YA 2SFPA 1I0BA 3K1DA 1SO6A 1BLIA 1Q85A 4KFPA 2GQ3A 5BXPA 3LQLA 2YLLA 2OYLA 2XFYA 1JR1A 3ES8A 1OADA 5LA2A 3LHWA 3TNOA 5DEZA 2VGGA 2C16A 1UC5A 2INFA 1EHNA 3IIOA 1IV8A 2XH4A 4P7RA 3N13A 3BCFA 2GL5A 5A95A 2PTZA 1R3WA 1KV8A 4S23A 4HT3A 5HUOA 1BXBA 4CU8A 4HD5A 4DM2A 2BOEX 4ICNA 1HG3A 3PTKA 3CH9A 1EDTA 2HXUA 4ZXLA 3BC9A 4MJMA 4P5UA 1P6BA 1BVZA 3EOOA 4JTTA 1ZQ5A 1BF2A 1P6WA 4JY8A 3O6AA 2OX4A 4TVUA 2J4GA 4PC8A 5AHFA 2YCLA 4S3DA 3AIQA 1A5NC 3TIMA 4EXAA 4Q3MA 3T78A 1MUMA 1SFTA 1UH4A 5F2LA 4LH8A 1YE4A 5FIPA 4DF2A 2Z1SA 4DJFC 5A6KA 4HK7A 5A6BD 1FWJC 3AZRA 5G1YA 2VZSA 3EMCA 2P8CA 5C9WA 2DH3A 3QPZA 4L4MA 5LGZA 2ZRWA 4NAFB 4K1GA 2ACSA 3WDHA 3PG8A 1TCMA 2OT1A 3F5LA 3G8EA 1A0EA 2MUCA 1GOQA 1E0UA 3CEUA 4HNNA 3E0IA 5DXXA 1LWJA 1QU4A 1VD6A 1H7NA 2PGWA 1E4LA 5D04C 3RG6A 4F0MA 2DUZA 1UKSA 3SSJA 3K46A 4EWND 3G0UA 2ZXAA 1U1UA 3H26A 4CD4A 1KFBA 1OVDA 3AYVA 4WX2A 1XDMA 1TE1A 3WLRA 4HPXA 3RR4A 5TQLA 3MHFA 3R0DA 1LLZA 3VIFA 3NO1A 1FVPA 2X16A 3AHYA 4LUJA 2V5LA 1DV7A 4AEFA 1FP9A 2J6VA 4IQDA 2O0TA 2J7FA 1FWHC 3LHZA 3LS9A 2GQAA 1PE1A 3TSMA 1VPQA 2V30A 4X2PA 2D24A 3VNZA 5J04A 3OO2A 4Y9NA 3ISIX 1YDOA 3OLEA 1GEQA 2Z29A 1TMHA 5BXRA 4FNUA 5E9XA 1VBGA 3BJTA 4DAIA 1AD4A 2J88A 4PR4A 5IBXC 1OT2A 3FLUA 1EP2A 2EG8A 3TC7A 1HP5A 1PCWA 3OGRA 4IPLA 1WDQA 2I7GA 5C70A 3BLLA 3RYSA 4B5TA 2Z27A 3OOQA 5I0DA 4Y2WA 3RAOA 3WK0A 1LT8A 4HMDA 5EBAA 3PFMA 3SDOA 4H6EA 4XAPA 1QTWA 1F8MA 3UG3A 3IANA 3EWYA 1VBJA 4GXMA 3MMUA 3MMWA 4AWEA 5HINA 4QQ3A 3CHCA 3W2LA 1TREA 3QXBA 3VKKA 3ZT7A 2EGZA 5HANA 1U1HA 3PBMA 1G94A 1OWQA 4PUDA 3W2MA 3RNDA 1P0KA 2CBUA 3IIXA 3VM5A 2G97A 3F4WA 2ABAA 3RM4A 1OX6A 3ZJ6A 3CUIA 3WF0A 5CJ5A 4FNQA 2CITA 7ODCA 3O2LA 1VCFA 2F84A 4LYRA 1F7BA 3MU7A 2PWVA 4H9TA 1JUKA 3DKLA 3L4UA 2YCJA 3NDYA 3F5KA 3ITLA 1E1EA 1KRBC 4AY7A 3E3HA 2DIEA 3G1VA 3W7LA 2WW5A 1KRCC 5LA1A 5LNRA 3P60A 3CUJA 3SUVA 3ZJ8A 1MNZA 1F76A 1IWBA 3ZM8A 2IW0A 4I6KA 2WWCA 4DXVA 3W2UA 1DJIA 1PTDA 3GG8A 2NSXA 1WX0A 3CGTA 2BWGA 5D33A 5E93A 4O8AA 1VFMA 1VJIA 3C2YA 2OZ0A 3W9ZA 2HV5A 1AL8A 4QLKA 3HQOA 2WZMA 3AYRA 3WNMA 1M03A 2OELA 5G5IA 5C9RA 2ZZ5A 3S5OA 1HQTA 2CLFA 1EL3A 4GUIA 3UJFA 1FY6A 2BNJA 4O13A 1BGGA 3BMWA 3Q65A 2XM2A 3KOXA 3SZ8A 3VKBA 1KLZA 4CLMA 1CB7B 5TD4A 3LV6A 5FESA 4A8LA 3MO7A 5EPDA 2Z26A 3W2NA 3CPRA 4WD0A 3PBGA 2POTA 4S2BA 3VILA 5JXQA 1RQBA 3HJZA 2NW0A 1WXJA 2P8BA 1DWGM 1DIDA 1AA1B 4PUNA 3LYEA 4DN1A 1KGWA 4O52A 3ATYA 2RGMA 5C9ZA 1OCBA 1FWAC 2ZZ4A 4DBEA 1S5NA 4ACYA 3EAUA 4JY9A 1T8QA 3HV9A 2FHFA 3RU6A 3JZEA 1BKSA 4LJ3A 4PUMA 1HZYA 5CPSA 3VMOA 1FP8A 1U30A 3KTCA 3MUAA 1K7EA 1ISVA 3FFSA 3GO2A 2Y24A 3EWWA 3DFQA 1FWSA 3H4GA 1V02E 1E0VA 1I2PA 4IXHA 2UV8G 1GG0A 1C90A 1V0KA 3USZA 1B9ZA 1V08A 2XIBA 3UW6A 2VRJA 2DIJA 1OABA 3WQPA 2OEJA 4BFAA 1FKXA 4XKYB 2YZ5A 1LBMA 1DWFM 1W9UA 2ALDA 4JTDA 4K2SA 3ERPA 1LUCA 3W7PA 1IEIA 4J3ZA 5FL0A 3WQFA 1H7RA 4GABA 3G1DA 1CXFA 2FZNA 2IQDA 4J3SA 4DLMA 4MKNA 3VIMA 3HGSA 3INPA 1QBAA 2HROA 1CIUA 5CGQA 5D30A 4Y9OA 1K6AA 3D46A 1PUDA 1QPKA 2WMIB 4ZO7A 3CHVA 1XXXA 5K2ZA 1QPQA 3M7SA 2Y5EA 2GFTA 2XTKA 3MSGA 4NT0A 3AS1A 4RCXA 3URNA 8RUCA 4PMVA 2FDMA 3S5YA 5I23A 2D2OA 1YADA 1KFCA 3K4DA 4YCOA 5D9PA 2RHGA 1IF2A 2H6RA 3TYDA 1ZPTA 3GFZA 4O57A 2VRKA 1GONA 1IEWA 1RPXA 4DB7A 3C56A 3CIXA 3GHSA 2CLHA 4QJ5B 3IARA 4QGCA 1FWDC 1Y7VA 4O1EA 1O94A 4F8XA 2DQWA 1XIMA 3H4XA 4WJXA 4PN2A 3IJIA 1KM6A 4Z42C 1IGWA 2PTWA 5HMSA 2W79A 4D6JA 1U5JA 4CU7A 3G5EA 4LVGA 3OLIA 1S2TA 4DWSA 1TR9A 4OV4A 1JZ7A 1W0MA 4S3JA 4KMQA 4JX4A 4L5ZA 1SJCA 3NQGA 3LU2A 1IR1A 2Z24A 1WB0A 3U2OA 3VIHA 3GVVA 3N2CA 2PWHA 1JXKA 3L9CA 3WQ5A 2UY3A 5CBJA 4H3DA 1E1FA 3P82A 4JTHA 4O14A 1JPDX 2YA2A 3O1NA 1QOPA 1EZWA 2PCEA 2A6NA 4I7UA 3L12A 4O10A 2WO5A 1AG1O 2PRHA 1CX9A 2REQB 1ZTVA 1F07A 5CH9A 1PX8A 2W3ZA 2DSUA 2PDWA 1SZNA 4OBSA 4GGBA 2QIIA 3ARVA 2BY1A 4QXIA 4JQ2A 3ANUA 3R8GA 2WKJA 1S5WA 1WQ5A 5FEPA 3LBCA 3W81A 3P3BA 1X38A 2HJPA 1BKHA 1EYEA 4U5IA 3QSTA 4QP0A 5EGRA 3PZOA 4N2YA 1XLGA 1E5JA 2VC9A 3BSMA 4UTJA 2OGJA 4EF8A 3E0FA 3GDKA 5IFPA 1R2RA 4J3VA 4KWWA 3NL3A 2Y8VA 1MEWA 2CZ5A 3W07A 1TTQA 4KF1A 1UQYA 4GIEA 2Q02A 3C8FA 3CPUA 1DIKA 1KM3A 1LRQA 2WC7A 3TA6A 1GYNA 1IE7C 1CGXA 1XUUA 4J4KA 3GVRA 5F4XA 2XG9A 1VFHA 4X0VA 1YRRA 3GHRA 1VLIA 1VFFA 1C29A 1R86A 4BI5A 4AYSA 4CD6A 3ZXWA 3UXKA 3EEZA 3DAQA 4F9JA 1UG6A 2F2HA 1UOZA 4S3KA 4F79A 3WK2A 3GH5A 3MSYA 1WAWA 3NTYA 4M1BA 1CDGA 1TVPA 1V6UA 3IGUA 5H91A 5AB3A 2PLMA 1JAKA 2DZUA 3NOEA 4QISA 4BQ4A 3GE7A 1B0IA 3DYMA 2J7EA 1UOKA 4IMAA 2I16A 1TMQA 3N6JA 3PZIA 4MF4A 3CAKA 4FO4A 4DXKA 5JH2A 3VNLA 1A50A 4NI8A 2D2HA 1W32A 4G2DA 4C6JA 3WX7A 4GY0A 2NUXA 2E9BA 1XICA 3GG1A 1OFAA 2ZUUA 3G8RA 4WIWA 1RH9A 4XD4A 4J28A 4C1NB 2PD9A 4UFMA 2DV0A 3VXGA 5JUVA 3P14A 4PMUA 3UR5A 1LL6A 2E9MA 1X6UA 3A12A 2ISFA 2Y2WA 2VX7A 1XDJA 1V5XA 2ACQA 5DMMA 4O1CA 3WN6A 3QOKA 3M7WA 5FEXA 2C1HA 4AZCA 1PKMA 5D8ZA 5ABFA 3NSMA 2DJXA 1CENA 1DJHA 1XKJA 2CEQA 3S2JA 2E8YA 4LF1A 3NQEA 4A8IA 5HJXA 1POKA 1EOKA 1EX1A 2QCEA 4LCSA 4GI6A 1KV5A 1XYBA 4XQ6A 5FA5A 2FZMA 3QOMA 4LUSA 3GBEA 4UB9A 3VIIA 3FEQA 5HR6A 1W9XA 4WKAA 4N6EA 5EU9A 1PZ0A 2DGAA 4LCRA 4I8DA 4RZ5A 4ICMA 4WXZA 3PNUA 3SQSA 3EZ4A 5EMYA 1Q3NA 4B16A 3V5OA 4OFCA 4LFYA 3BAWA 3T09A 3SRHA 3TYEA 2WQDA 1EHAA 1YNYA 3TYBA 5D2VA 3A5VA 5BWAA 4Q8UA 2TPSA 4RNFA 4F9DA 2C91A 2BGSA 4CQCA 3WUEA 4ZQOA 5CPLA 4TMBA 2WNNA 3GC5A 2CXGA 1OGSA 2YL8A 3W4RA 2VNCA 4O1FA 1FDYA 1VPYA 1TZZA 3QPYA 2YW4A 3OTRA 5HAOA 2PLKA 1XH2A 1XHGA 3GTHA 3E6EA 1E4NA 1P43A 2IQTA 3ITYA 2GVLA 4F48A 5I03A 3MP5A 2OWXA 4TX8A 2ZA2A 3PWAA 2Y89A 3SY5A 1PKYA 4UFLA 1ZB5A 1S5TA 1W1A1 3UXIA 4IMCA 4KEVA 3TX9A 1PTGA 4W5UA 2BY0A 4L9ZA 1BWLA 3PTQA 3GAKA 2YL9A 1GVIA 4S3AA 2WANA 4X22A 1HJWA 3R2GA 1HGYA 4GE8A 2BGNE 5AFDA 4J1OA 1SFJA 3NZQA 5CAHA 1PDZA 2BODX 3NVDA 4HSNA 1RJPA 1HXJA 5KTLA 1VPXA 4C6DA 3DFPA 2EQDA 4CN6A 4M81A 1EGMA 1REQA 3NSXA 4QSHA 4JFTA 3V16A 3OG2A 1PS9A 4U5KA 4JHZA 2E5BA 3RDKA 1G9HA 2NX3A 1R2SA 3R13A 1JPMA 4MTVA 1R85A 3C2VA 4GH3A 3GM8A 1AQ0A 2P1FA 3HJEA 3SGUA 4GD0A 3WH5A 1UC4A 3G0XA 3LSCA 4HOWA 3WNOA 4QJ1A 3IACA 3SFKA 2HS6A 1H61A 2DW6A 3W82A 3ARPA 3CO4A 1US3A 2OXNA 2FYMA 3PZTA 2WNQA 2XVNA 3CBWA 4QBXA 3VO0A 3IJDA 4RZ6A 3CPGA 1TV4A 2W6RA 3LCHA 4NKCA 3EX4A 2TSYA 1MDLA 2A3BA 4D8ZA 1GW9A 1W1IE 2BTMA 3VTRA 5CSUA 3HO8A 1UKPA 1YW1A 4BJHA 4GVIA 2Z00A 3KXQA 1K8YA 4LCQA 3BLEA 1E9YB 4DWDA 4E4PA 1LQ0A 4PFHA 3PVFA 4JR5A 1PZ1A 1CB2A 2DJLA 3W7HA 4AWSA 3CIVA 4MFEA 4LVFA 4REQB 4US5A 4E3TA 5CCZA 2VFHA 4UMBA 3BJFA 4J2MA 4HU8A 3QGVA 4GYPA 3IGSA 1H7OA 1CGUA 3TW7A 3E2VA 3LGDA 3G6LA 4MUZA 3LI1A 3PP7A 1U5HA 1DVJA 4A3QA 4PSPA 3W1RA 3WBYA 1RBAA 4IPJA 2GVJA 3R0UA 4LQ1A 3BAXA 5JBFA 4GZ7A 3SCQA 2Q3OA 4YPJA 1S1RA 1EXPA 3GNOA 1OIFA 3S8HA 2OFJA 1ESWA 3I6EA 3E0LA 3W01A 3H23A 2VEPA 1UR2A 2NVAA 3KP1A 3N25A 4CUCA 1RQHA 4FLQA 3C0LA 2BS9A 4PSRA 2CHOA 1JPIA 3VE9A 1X7FA 3A21A 1VYPX 3UCCA 4RV8A 4DJDA 1L8NA 4FIRA 1MUWA 2OYMA 2XWEA 2Y7EA 3PFRA 1WDSA 3SUWA 1NIUA 5H8MA 1XWYA 1M7PA 2ZA1A 3VPLA 1E6RA 3L21A 2A85A 4XD6A 4YMZA 3B0XA 3UR8A 3UWWA 2PGRA 3LCLA 2OSWA 1FXPA 1OJXA 3B03A 1A3HA 2X41A 3BANA 4LYKA 4QITA 3L4YA 1SJBA 3LTYA 3MI6A 1MW0A 4XO7A 4RNHA 3SJ3A 1V3IA 4Y7EA 1ADOA 3FA5A 2ACUA 4EACA 5I3GA 8TIMA 2Z6JA 3EOLA 4DX3A 5A8NA 1XG3A 1O66A 4GUJA 1ML1A 3UZJA 1U1JA 4JFUA 2INEA 2G95A 3CASA 1TIMA 1JZ6A 4PMYA 4NZCA 4DZHA 5FJRA 2V5DA 4G7EA 2AAMA 4WHBA 5CBIA 4LBSA 1W5OA 3CEPA 4CNTA 1K6WA 4RK8A 2VTFA 3A3HA 4JL1A 2E8ZA 4JHMA 4AD2A 1IGSA 1BYBA 4YHEA 4HQVA 4PCSA 3BGJA 3KLKA 2J8FA 3I7QA 5FJPA 4ACZB 4GH1A 3O9NA 1M1BA 2FHCA 4UZUA 3RJYA 1OC6A 1BAGA 1MUCA 2ZA3A 2VMFA 4H8UA 5H6HA 4G8TA 4ZFCA 1GOXA 1C8YA 1EZ2A 1QUMA 4MY8A 4IGSA 4GZIA 4AAJA 4Z2IA 3J7HA 4XZMX 2ON3A 1V6VA 2G0WA 3TJIA 4EE9A 1H63A 2VC7A 3DFOA 3VI2A 5MKGA 1S3TC 3QY6A 3E2SA 2WYSA 1V3HA 3BLPX 3GY1A 2EAWA 3OZOA 1ME8A 4HTYA 3TYUA 2ISDA 1Q4NX 3POCA 1GTHA 4L4OA 1XLAA 4V33A 5F2GA 2CKRA 4WKHA 4ZTYA 1NM9A 4FI4A 3NXFA 3WEOA 4TUFA 1DBTA 1A4MA 1QNQA 2UBPC 3KLLA 2VO5A 3M0LA 1K03A 3R10A 4N7QA 2E28A 3FHAA 3WFZA 2GK1B 2DPEA 1OSEA 2JGQA 4XZNX 4Q7IA 1M53A 3D6NA 5CZTA 3DH7A 3GNDA 2AL1A 3C52A 4L1GA 6A3HA 4UFKA 3FA4A 4HVXA 2WSRA 3CUZA 3AAMA 2VKZG 1MXGA 3TZFA 3HPXA 1W9PA 2I5QA 2F38A 4D8AA 5EL1A 3WH7A 4X9SA 1SO3A 3PZUA 2XIOA 5E5CA 4K7YA 2Z2UA 3LHUA 4DAFA 4IZGA 1FHUA 4G56A 1W91A 3TAOA 5AECA 1UROA 5CZKA 1PHWA 1ME9A 2QDEA 3M16A 3O0FA 4B5SA 4E2OA 4MG4A 4S1FA 3E9AA 1TPH1 3L5LA 3NCOA 1FHVA 4UFHA 4GXWA 3URQA 3STFA 1ISXA 1FFQA 2IPGA 2QJHA 2X8RA 4WQ6A 1XRFA 3QVQA 1M3UA 1A5LC 3NQBA 2WLYA 1E0WA 2HISA 4MWAD 1UW9A 2PD5A 3LPPA 1JCMP 3GW3A 4PTVA 3EA2A 3ZT5A 4HIBA 4GX9A 5CJMA 1V7AA 3WLSA 2GSHA 1UP3A 2A4AA 3V1PA 5AOUA 3MDUA 1W37A 3IRDA 5KETA 3LCGA 1WDDA 1NDYA 3WQ8A 1AFSA 4XAYA 2QUUA 2XSAA 3H7RA 2NQLA 3TOPA 4MLRA 3ID7A 4EK7A 4AISA 4JTFA 4UXDA 3H2AA 3G24A 3TVAA 3VGDA 3PZGA 1H51A 4IF2A 1D2KA 1FTXA 2PDGA 3WUGA 2PTDA 3P8IA 4EP8C 3MHGA 2YZRA 1EKOA 5BROA 2G50A 1HIZA 3S5ZA 4RW3A 1D3CA 4BEQA 1RHCA 4Q8MA 4ZMGA 3MZNA 1VIZA 2NXHA 3OVGA 2X0HA 3WL1A 3T9PA 1IIHA 1KXQA 1MWOA 1OYAA 3UYCA 1C9WA 3HG5A 3WF4A 1Y65A 3HN3A 3GDRA 2JEQA 2QW5A 3DHUA 4NSBA 2QGHA 1E6NA 4G5DA 3BAJA 1QCWA 1TG7A 3KL0A 3LCXA 3WNKA 4O18A 5A6MA 2QJIA 4PE8A 2L5HA 5TAOA 4KPLA 4FLRA 1ZL1A 4KRZA 4IP4A 4L6OA 2PWUA 4MB1A 4IJBA 2ZWYA 1V02A 2J9YA 1EWEA 5CG7A 4AIEA 5LNSA 4JTIA 1A3WA 3GIPA 1O5KA 3KRUA 1TMLA 5IM51 4JTSA 2BX7A 3WLKX 2XDFA 3NOYA 1UA7A 3NSNA 4E6MA 1EIBA 1OCJA 1LTDA 2GJPA 4KIRA 4JL2A 3VOCA 1WKYA 5DCEA 1I6NA 3T2OA 2Y7DA 1NARA 2FB3A 1OC7A 4B3LA 4LB4A 1H41A 3LLFA 2A79A 4JIPA 2J7HA 1IT7A 1ADDA 5F4WA 3UESA 2YX0A 3BK0A 3M0KA 2YA0A 4KWOA 5CLTA 3W26A 1I2NA 2J25A 4MKVA 4AFYA 1GHSA 4UFIA 2JQXA 2ONEA 4FIQA 1XPYA 5CXPA 1Q63A 2EPHA 4GJJA 3ZQ9A 5GJMA 3NWRA 4LS2A 4E4UA 4O53A 3MVIA 3CNYA 1E72M 4QAIA 1EJSC 1RPKA 5EMKA 2Y5JA 5AYZA 4UTIA 1KGXA 2FGBA 1KFWA 2O7SA 3WIJA 3TONA 3W84A 2DUAA 3CAQA 1ICPA 4CQ8A 3S2CA 2Y8UA 3LNPA 2O9OA 1CBGA 3CV1A 1GKRA 3AXMA 3KOFA 4UQCA 3MWCA 3ZMRA 3G22A 5T9BG 2PF0A 2B0MA 4WZHA 3QEZA 4OE7A 2VZVA 3AWOA 3E5PA 1FH9A 2W0UA 1OFPA 4C6BA 2Z6IA 5C5YA 2OG9A 2P5NA 5ABEA 1MMFA 3FK4A 1TPWA 4DQWA 3D47A 2J27A 1VENA 3MY9A 1QI0A 1AK5A 4LRSA 3CU2A 3T4WA 3TW6A 3GAYA 3N15A 1DQWA 4I7WA 3AC0A 3GXTA 1VR6A 5BW6A 1JVNA 3OYXA 2V0TA 3GHUA 5HNUA 4LS0A 1Q8JA 2DY3A 1P1MA 3PUEA 1EGZA 3R11A 3SY1A 3WF3A 2CHRA 3EB2A 1OM0A 4FLSA 3VABA 4GCAA 1RK6A 4ZB2A 1S5VA 2YPIA 4L4LA 4M19A 2P10A 2HXTA 3BLOA 2FZDA 3B0YA 3P7YA 5CPQA 4E2DA 4Y6GA 2FZ9A 4KRTA 4M51A 4DWSC 1UZHA 3VKDA 4I9TA 1A53A 1IHIA 2DIKA 1R3QA 2I9EA 2QCDB 2PDUA 4K68A 4JTCA 4UOJA 1U22A 2ZYFA 4HB7A 4HP5A 4MHBA 4RV3A 1KWKA 4WUIA 3LZ5A 3W53A 1JDDA 4WF7A 2GDVA 4GBDA 4EPDC 8XIAA 1TTJA 3F4VA 1FUYA 2HDJA 5HPOA 4W8AA 2BOGX 2XFFA 3II1A 3FAWA 3HB9A 1HJXA 1DXIA 4O54A 4H9VA 3V5CA 4H6RA 1X6NA 1PAMA 2WSPA 4FS9A 1SR9A 1W9DM 3HBLA 4KH2A 1J5TA 4GFIA 1UPMB 2YA1A 1XYLA 3O0KA 1UWTA 3VDBA 1XLKA 3SRDA 5E6ZA 3GR7A 1I1XA 1QRQA 1XYCA 4HHHA 3PC0A 4HPNA 2QMKA 1JCYA 3L66A 3UF9A 3C61A 3H2NA 4H04A 3WBWA 1O7AA 1YQ2A 1GKQA 3R58A 1EJUC 2LLEA 2WNWA 2HVOA 5LHEA 3CTTA 2ZICA 4XSMA 3UU0A 2R14A 2VD9A 4NYYA 3R7MA 3WKZA 3E02A 3GUWA 1CT5A 3MP4A 4M56A 3BARA 2GOUA 3ZR5A 2XIMA 4BY3A 4QE4A 4E8CA 4TX9A 4X2RA 2W63A 3VCRA 4LOCA 2GOKA 2TRSA 2J66A 4FNPA 1LQ2A 3BQ5A 1TA3B 2Q6ZA 3P74A 3W85A 3M0ZA 3HFTA 4O17A 3W1NA 3KTXA 2WVUA 4Q8WA 3KBVA 2QDDA 1G67A 3AHVA 4IJRA 4CKQA 1FA2A 3ZSTA 3W71A 5FF7A 3DN5A 3UA4A 1SGJA 3XIMA 2QUTA 3NUKA 3ZFHA 3FIGA 1K8XA 4HZ8A 2ATMA 2ODOA 3TTYA 3MI2A 3WBEA 5FL1A 5BRBA 1SW7A 3KRBA 3GTIA 1I0DA 2PA6A 4CU6A 5JIWA 3G1RA 4E2BA 1ODUA 3NZRA 3UZYA 4UTWA 1FDZA 1V03A 4D6EA 3V0UA 3PBUA 1QOQA 1V79A 4Q8QA 4JIQA 4WXYA 1JAEA 1W3NA 3POHA 4R33A 2EJAA 5PTDA 4IIBA 3MUCA 3FA3A 1YNQA 2CC0A 3WJXA 2Y7FA 1QO2A 3DC8A 4NZ4A 1BHGA 4QQUA 3MW7A 4IM4A 4YWIA 2JF7A 4GXPA 4HK5A 1CCWB 4AC7C 3APYA 3EWUA 3WH8A 1P0NA 1Z48A 1EWDA 2WSQA 2ISVA 3SECA 3WD1A 3TJXA 1EH9A 2WZEA 3QTPA 3WLPA 1EO5A 1ME7A 2OKOA 1OEPA 2DUXA 1GQKA 3QZ6A 5IFTA 3WLJA 4WDUA 3UEQA 4X3ZA 4R7OA 4Z2GA 3W7OA 2VQTA 3P62A 4N4PA 3FOKA 5AYYA 3KS5A 3PBVA 1I2OA 1DJQA 1GVYA 1XCXA 4R53A 3VGBA 1XRVA 1IEXA 3PTMA 3TC6A 4B5NA 1XLMA 4CQ9A 3SCOA 2XH7A 1G69A 4AXKA 2BXYA 1J0KA 5LZLA 3W24A 3TP4A 4GQBA 1BD0A 4GQRA 2HRWA 1TWDA 3GXPA 4YVVA 4UQDA 4JTQA 3ABQA 1EX5A 4UTHA 4BK9A 4MNJA 1GTEA 1MQRA 1R7AA 3BO9A 3VX0A 2ZUWA 4H7ZA 4CQBA 5AVHA 1Q6LA 3GNPA 3T05A 4WRHA 3M5ZA 3W7NA 3C2FA 2XN0A 2ZZ6A 3BGAA 2BXVA 3N6HA 5D2XA 4S3GA 1EBGA 1KTBA 4XKYA 2QULA 1XIJA 2FJKA 2E09A 3OHMB 3STEA 1HN1A 1OFEA 2ZDRA 1ZAIA 2QKFA 3WL0A 4P8VA 1PX3A 4X61A 2Y70A 1EYWA 1V93A 5JBDA 3O06A 3PZ9A 1JYXA 1FWEC 3T0AA 4JEQA 4A29A 3PPHA 3STCA 1Q6EA 4DUXA 3N12A 2QT3A 4DZ5A 3SM0A 3BG3A 4H2CA 1JCNA 1XR2A 2X2YA 2DVTA 2Z1BA 3H12A 4K1WA 2NSOA 2WMIA 3SEPA 4CD8A 4UTMA 1VIWA 3K4WA 3DDMA 2C6QA 1ZY9A 2XWDA 2NZLA 2JIEA 1PZ3A 1GQNA 1B57A 1SW3A 5I6SA 2PEVA 4NILA 4O11A 3GU1A 1WZKA 4FOUA 4ZEPA 5HPCA 3UJSA 4CCCA 1VQTA 4DUVA 3OQEA 1LROA 1UH3A 4WVXA 4NNAA 1PEZA 1KBLA 3MHUA 1A5MC 4P8WA 2WMHA 3SI9A 2ZC8A 1TO3A 2BP1A 3GBDA 1SYTA 4JYDA 1UWIA 3ARQA 1B54A 4V15A 5REQB 2BOFX 1JDFA 1JGMA 2DZXA 3DEQA 4EAMA 2PWDA 4UFJA 3NM3A 1W17A 2JALA 2WV8A 5I3IA 1TWZA 1T8XA 3EKGA 2DT0A 2PC4A 4WGHA 1OFDA 3QR1A 4NZ5A 2PS2A 4CNUA 2JGYA 1TTPA 2E6DA 2QJGA 2QJJA 3U2EA 1TJPA 3B4YA 5CBBA 3DOPA 2HS8A 2NQJA 4EOUA 2BVWA 3T40A 5I06A 4IMEA 1CNVA 3AUJA 5JH1A 3QGAC 4QEHA 2VFDA 3LLDA 3RLUA 3V0SA 3WH9A 3EMQA 4Y9MA 3PN8A 4KWVA 1J6PA 1GZ1A 3QF0A 3CV6A 3A4JA 3GDLA 2VXNA 4B3ZA 1X39A 3LTSA 1TQXA 1W6TA 5DRCA 4MZYA 3L0GA 1QHZA 2REQA 1I75A 1E3ZA 1MRAA 4RZ4A 2WSKA 4F0HA 1H7PA 3VD7A 1F73A 3QQWA 1XIEA 3ES7A 5A6SA 2PLJA 2V3FA 5DY3A 2YFNA 5EY5A 5KZEA 4GYPC 2BASA 3TYCA 4BQ3A 2KZHA 1WOAA 2OWWA 2NV1A 5GQBA 2Y63A 2HZGA 3PBYA 1A0DA 3F7JA 1TV7A 1RAKA 2YJQA 5HOSA 5HWMA 3NQMA 2I17A 1XD1A 4R85A 3L4TA 1RD6A 1IQ8A 4MAVA 3TSBA 4Y96A 2QF8A 4ERIA 1I2RA 3V1HA 5HJLA 4PUUA 3U5UA 3V5FA 1X98A 3DI0A 4GY1A 4W7VA 1BYCA 3LQGA 1KGUA 2WBKA 1AQHA 2JKAA 4HN8A 3CQKA 3NQFA 2R24A 4DJDC 2D3LA 1TRDA 3EXRA 2WZIA 3AIBA 3EB3A 3QZEA 3WD2A 4N42A 3U5YA 4G6CA 4GUFA 1N55A 4JIRA 1VRXA 5I00A 1DHKA 1J79A 2AGTA 1KCLA 1TIWA 4MYAA 3N17A 3WG6A 1TE6A 1F4HA 2VVNA 3DIPA 4GI8A 4W87A 3W23A 2PRLA 1MEIA 2OGYA 4ZODA 1SJAA 3VKJA 4CN4A 3O3RA 2XVLA 5G1MA 3VD4A 4NJJA 2A6LA 3ITCA 1EF2A 5FJJA 4AZ6A 1OY0A 3W83A 2IMRA 4L4PA 5MHBA 3FSUA 2WAGA 1OGBA 1O5RA 1XQLA 1GOWA 3STPA 3UCDA 4AU0A 3L4WA 1QW9A 4NRRA 4W5ZA 2QJMA 5GNYA 3E1F1 1ITCA 3GTXA 1GVQA 1EJRC 1UZ4A 2Z7GA 3GKFA 2PDIA 3C8NA 5KZMA 3T42A 4C1NA 3TN3A 5C7VA 5LXXA 4F0SA 2PWEA 3GW0A 1XRTA 3T55A 4UQEA 1N8WA 4AHOA 3SIZA 2DT3A 3PK7A 2QCGA 3YPIA 1H49A 4RNJA 3VIOA 3TN6A 1C7TA 1W8GA 3U4FA 2WVTA 2A7NA 3T8QA 1AD1A 4BQ5A 1FCVA 1MZHA 4GLEA 3QKZA 1A5CA 1T41A 7ENLA 2R1NA 1MXSA 3TLQA 2GGIA 4DBWA 1B31A 2OVLA 1LP6A 4HCHA 4N02A 3OEXA 3BLIA 5LNWA 5LIUX 1L6FA 4PMOA 1A5OC 4O19A 8XIMA 3RX4A 4ATDA 2WCGA 2XVGA 1UWAA 2VGBA 1L2QA 3DG7A 1KM4A 1CGVA 1ZZMA 5AC5A 1TSIA 4HCLA 3CL7A 1WDRA 1XISA 2C3ZA 3BW3A 1RVGA 3IVTA 1LWIA 2AOSA 1OD0A 4GVGA 4BI6A 4KBXA 4AZGA 3GS6A 3CWNA 1L6SA 4HNCA 1AMKA 1M6JA 3A4WA 3ARRA 3W88A 1PYFA 3VYLA 1IR2A 3ABOA 3AHTA 3KDNA 3UG8A 3H4WA 4Z08A 2QGYA 3VOFA 2VZTA 2BVYA 2RDUA 3D0CA 4FXRA 3QC3A 1V4YA 2VZOA 4HU3A 1NWTA 2XINA 4CD5A 1F3EA 1LF1A 4E38A 4ROQA 1KRAC 1S46A 1N8IA 3T0TA 3GHTA 1V0NA 1NU5A 3GXIA 1UJQA 1EDQA 2BGQA 4LEQA 1HO4A 2OQHA 5IDZA 4MPKA 1NSJA 3LPOA 2GSEA 2UY4A 4LVBA 3VCNA 3B3DA 1NDZA 3CV7A 3I65A 3WQEA 3BVJA 3OZPA 4IG2A 3CWOX 4HCDA 3S5SA 1HKJA 1OFBA 4HBKA 4X63A 4XWUA 5M17A 2VM8A 2XSXA 1M7JA 4A3YA 3VK5A 5C2GA 5DXYA 1TVNA 2YW3A 1UD3A 3AS2A 3TMLA 4IFKB 4PZVA 7REQA 2ZX7A 3U3HA 2PPGA 4J27A