4A3YA

Crystal structure of raucaffricine glucosidase from ajmaline biosynthesis pathway
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
501
structure length
469
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
molecule keywords RAUCAFFRICINE-O-BETA-D-GLUCOSIDASE
total genus 177
structure length 469
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4a3yA00
3VGDA 4PMDA 1LLOA 7A3HA 3WQ8A 2XWEA 3TTSA 1H0GA 3SCOA 1CENA 1VRXA 5DMYA 2CEQA 3WENA 1B3VA 4QCEA 3RIKA 1JDDA 3BC9A 5E0FA 3T2QA 5IFTA 3T08A 2JIWA 2ZXBA 3QGVA 3VIPA 2FDMA 3A47A 1R86A 3N1AA 2FHBA 1HKKA 1DWIM 1I75A 4CVWA 1W3KA 2V3GA 2YIHA 2QMKA 3ARQA 2EJ1A 1XCXA 3W37A 2W91A 3N13A 2ZXDA 1OWQA 1CYGA 4U33A 3VM5A 1H3GA 4PMOA 3W24A 2ZUVA 3LMYA 1H4PA 4W8AA 2WKLA 4PTWA 2Y5EA 3EMQA 4QAWA 1WDSA 1CPUA 4HMDA 3VKKA 2XVKA 1GORA 4NI3A 1E70M 2WZIA 3WMSA 4Z2KA 1C8XA 1D3CA 1TA3A 1TUXA 4V27A 2XGBA 1BYCA 2JF7A 1UKTA 2CBUA 3ZM8A 4HZ6A 4EE9A 1HJWA 5A6KA 3VGBA 4GI6A 4PUEA 5M03A 2BFGA 1I1XA 2XPKA 4MB5A 2J7GA 2ZUNA 4PMVA 5JBEA 1K9EA 1TE1A 2HVMA 3AIVA 3CHDA 1BQCA 2WHLA 4D6DA 2OSYA 1JD9A 4HA3A 1CGXA 4YHEA 5CZKA 5A8PA 4LPCA 5A2AA 2E9MA 3EMZA 4L4OA 2AOSA 2IXUA 3WQWA 2FGZA 1R7AA 4FMVA 4U5KA 5I23A 1M53A 2WMIB 3F5LA 1V3IA 5BRPA 1PIFA 1W1VA 1G5AA 2FH6A 2X0HA 2YDQA 3SUTA 1KQZA 1VEMA 3UCQA 2J77A 3ARSA 3AS1A 4KWUA 5AYBA 5C8BB 3EBVA 4R27A 2DGAA 3AYSA 3RM8A 1YHTA 2VURA 3OBAA 1E5NA 5BWFA 3HU7A 2J47A 1HP5A 2G8ZA 3OLEA 1UHVA 3MV01 3W29A 4P8XA 3KL5A 4MDPA 4JKLA 2J7HA 3MO4A 1UR0A 5HNNA 3ZR5A 4W5UA 2CKRA 4S3KA 1E6RA 3CMJA 3OGRA 4CU7A 4AW7A 3WIJA 1MYRA 4WSKA 4D6HA 1V6XA 2EQDA 4CD6A 2DSVA 2D0FA 1TVNA 4CN1A 1UR8A 3VINA 3ZT5A 1KB3A 2G4FA 1CXKA 1ZJAA 1E4LA 4WKFA 4MTVA 5IFPA 2WBKA 1JF6A 2BVYA 5DF0A 2ZX6A 2A3HA 3BH4A 4OIFA 1JFHA 2D20A 1QNRA 3DHPA 3SEPA 1X1NA 4A4AA 3AMKA 5LA1A 3AHVA 4UR9A 4QDMA 5CSUA 2WMGA 1TR1A 4UQ9A 1UG6A 1JDCA 3PZIA 1B90A 4XB3A 1P6WA 3AQUA 2VCCA 3L4TA 2F2HA 2VQTA 3VIKA 2W62A 3WDQA 2C8NA 1CBGA 3A4AA 1MVYA 4TX8A 1EHAA 2VC9A 3VPLA 4PEEA 2VQUA 5CQ1A 3GNRA 1WZMA 3GH7A 4M8UA 3SUSA 1NQ6A 3AHTA 4W7VA 3MSDA 1MQRA 1OGGA 2GK1A 1B3YA 3HN3A 3TONA 4CVUA 1C90A 2CETA 3RO8A 3WMCA 1ZBVA 1ISXA 1EIBA 2EPMX 1OIFA 1XD1A 3WD0A 1E3XA 2W4XA 1GNXA 3HJEA 3WNOA 4AD1A 5I77A 2AAAA 3M07A 1PX3A 1CDGA 4NZCA 2ZUWA 1D2KA 2V3DA 1WPCA 1UD5A 4UOQA 4TXEA 5E70A 4W84A 2BXZA 1B31A 1KR0A 4FK9A 1JAEA 4MNKA 1UA7A 3WNPA 1PZ2A 1HN1A 2WAGA 5GQBA 5A6SA 5AY7A 4OJYA 1QI2A 2WKGA 3TP4A 1CGTA 1HL8A 1OD0A 2NT1A 2FHCA 2F61A 1QHPA 3AFBA 2ZWYA 2BY1A 4FF5A 1E1EA 2EPOA 2WVSA 3AHZA 3FAXA 5A8QA 1DWFM 1JIBA 1KGXA 2Z1KA 4E8CA 2IUZA 1BPLB 4WK9A 2FHFA 1JXJA 3ZJ8A 1E6PA 2ZX7A 3SCNA 1CXFA 4FLSA 4HOZA 4GZIA 2D22A 3ZO9A 3MUIA 3PZMA 3EYPA 1RH9A 1KWGA 4AEEA 3W53A 2XIIA 3AMGA 3CUFA 3WELA 3WSUA 5A6LA 1JZ4A 3ARRA 1ZBKA 5KEZA 4S3JA 4M29A 3CUJA 2WNWA 3VIMA 1R8LA 2WANA 1QHOA 2PBGA 1A3HA 2A3CA 1NOFA 1G0CA 1GOWA 4B3KA 1RD6A 2VZSA 2J8GA 4N0RA 1V0LA 1C93A 3PTKA 4HU8A 4GQQA 1TVPA 1XYZA 1BF2A 4QLJA 3N18A 3W28A 1V6WA 3SUVA 3GXMA 1NP0A 4AD2A 2E9BA 4JHZA 3HMCA 2YL5A 3WH8A 1B9ZA 2B31A 3L4VA 5ABEA 1LWHA 4LYPA 1VB9A 4QP0A 2QLYA 1GVYA 1WZKA 2WCSA 1BSIA 2WM0A 1FFQA 1XC6A 1HF6A 4HU0A 1Q6GA 4U31A 1VFUA 1JG9A 4J28A 2DEPA 4TVUA 2WMFA 3PBGA 3K8MA 3VDHA 1EH9A 9CGTA 4JFWA 5FOOA 3UEQA 5DFAA 3BLKA 2E4TA 1LF1A 1VIWA 2V38A 2O9PA 1AVAA 1M7XA 3WEZA 1LQ0A 1HJUA 1FP9A 1EXPA 4U2YA 5I0DA 3K4AA 1HJXA 3UR7A 4JKMA 3WL1A 3BLPX 5JBDA 1E56A 4QLKA 2DIEA 1EGZA 3L4UA 4H2CA 4GKLA 3AMLA 3AIUA 1M01A 3SURA 5AC4A 1C8QA 1QVBA 2YL6A 2RGMA 3S6TA 2XJ7A 4EAMA 3VDAA 1WE5A 2ZX9A 1GQLA 3WF0A 4WKHA 1OM0A 4U2ZA 4AD5A 2YDSA 3MUY1 4W7UA 4N42A 4CD5A 4HTYA 1JFXA 4AD0A 1JAKA 2J7EA 3CMGA 1UKQA 4DUWA 3N12A 4J3SA 4AIUA 2WHMA 1J0IA 3OLDA 5C70A 1H1NA 1C91A 2VCAA 3WH9A 3U5UA 3RCNA 4MJ2A 2G3IA 1B0IA 2W67A 2CHOA 2VX7A 1NH6A 4PMRA 3T2OA 2WCGA 3U5YA 1E40A 2OSXA 4W8LA 3EDEA 3SCQA 4TVDA 1V6VA 2VZUA 4RE4A 4BZYA 1JF5A 3BAWA 3AROA 4JFSA 1UD4A 1SYTA 4J3UA 3I3BA 3SUWA 1J0YA 4GZJA 2Z1SA 1NP2A 2BY3A 5I79A 3CZJA 2EPNA 1W91A 4U3CA 3KL3A 1DEDA 4YPJA 4P7LA 3BAIA 4ACYA 4PMNA 3AIRA 3U57A 4GIAA 4PUDA 1OBAA 4CD8A 5M5DA 1UD8A 3IAPA 3A4XA 3POCA 4PYSA 2TAAA 1ZS2A 1W9XA 3LPOA 1XH0A 4UTFA 1UWTA 4PTXA 4GI8A 2J25A 3KEHA 3UG4A 1TA3B 2XSBA 4OUEA 1JZ2A 2WZEA 3VUPA 3VIOA 4H04A 2ZUUA 4PMYA 1QI3A 2OYMA 1UR2A 2J75A 4E8DA 3TTQA 3G6LA 2GJXB 2DH2A 2J7BA 2OWWA 3ZSTA 1VBRA 1EOKA 1OT2A 1V02A 1C3FA 5KZ6A 3WN6A 5D4YA 1B30A 3GYCA 3OA5A 1VFFA 3WBEA 2DDXA 3AMCA 4EKJA 1B2YA 3BXWA 2UY2A 4PN2A 3WQVA 3CZLA 1KQYA 2G3JA 1DWJM 3ZT6A 1HT6A 4LYQA 4ML4A 1GW1A 1PX8A 3W38A 1ISZA 3POHA 1NOWA 4LQ1A 5A8OA 1BTCA 3GNOA 3UESA 1HJVA 2JEPA 4KRTA 2JALA 4ACZB 1M04A 5GPRA 4URIA 4MJ4A 5GNZA 4F66A 4AIEA 1V0MA 3K8LA 1HX0A 5A6JA 2XG9A 3WH6A 2BY2A 5BXPA 4C7FA 4MB4A 1FH9A 2VX5A 3WEOA 2QPSA 3VOCA 1UYQA 1HKIA 2XUCA 2DT3A 2OYKA 2FGLA 5BRQA 1US2A 4D72A 2EPKX 4CU8A 3ARWA 4M56A 3UERA 1IV8A 1JZ7A 2DPEA 3GM8A 5BYWA 5M3WA 4OZOA 3CUHA 2WWDA 3KE0A 1L8NA 1KCKA 3DHUA 3RJYA 5JIWA 4NRSA 4PMUA 1OD8A 3SCWA 5CGTA 2VI0A 2BVDA 2Y24A 2AMGA 2X0YA 4H8UA 2WSPA 1JDAA 1BFNA 3ARYA 5LYRA 4UNIA 3VX1A 1QI0A 1W3HA 4UFLA 5IHSA 4D6IA 2BNJA 3EDFA 3T0BA 1UH2A 2VZOA 5DT7A 4GO9A 1DWAM 4EK7A 3PN8A 2XFYA 2VVNA 7CGTA 4HPGA 1H49A 1K6AA 4ZE5A 3PZTA 1KXTA 3AISA 1E72M 1WAWA 2E8ZA 2OSWA 1UZ4A 2BHYA 2WVTA 4B15A 2OWCA 1VJSA 4BF7A 4UOJA 1DWHM 1WZLA 5A6MA 4W5ZA 4H8HA 1V3HA 2YDRA 5CJ5A 4WKAA 1HL9A 2G41A 4ZE4A 5A8NA 3VGFA 3BAJA 1DTUA 1U33A 1R85A 5E0CA 3VD9A 1FH8A 1NWUA 2WCAA 4AD3A 1EA9C 4PMQA 5GNYA 3GH4A 1TMQA 1JZ3A 2D2OA 3PZOA 4Y7EA 3W27A 1V02E 2BS9A 1FP8A 3THCA 5A3HA 1OSEA 3E1F1 1PIGA 1JYWA 4CKQA 1BVZA 2D3NA 5CG0A 1UR1A 3TA9A 1FOBA 2J7DA 2FH8A 1W2VA 2DT0A 4KGJA 2XVNA 1I1WA 4IUGA 1F4AA 2G3NA 4AZIA 4AEFA 1JI1A 3VNYA 1MWOA 4X0VA 4XUYA 3CUGA 1Q6FA 1UH3A 1YQ2A 3KZSA 1H41A 3SCRA 5BCAA 3PTQA 1EDTA 5A6BD 2XVGA 1MQQA 1V0KA 2O9RA 5AC5A 3CBWA 2CESA 2BV9A 1MW0A 1X6LA 2JEQA 1NWTA 1NOUA 2CERA 3QOMA 1TZ7A 3BCDA 1WDQA 4A3HA 2V5CA 4U5IA 1VFOA 4AC1X 1US3A 1B3ZA 1WDPA 4FLQA 2XM2A 5EFDA 4ACZA 2ZOXA 5E6ZA 2EO7A 5A6AA 1CXEA 3ZR6A 5I2UA 1NARA 1UOKA 2JE8A 4JFVA 2NT0A 2CXGA 3DYPA 4YN5A 1QNSA 1E15A 3B9DA 4PCTA 3QHNA 1DP0A 2XIBA 5BROA 4H41A 1CNVA 3L4WA 3VGGA 3AIEA 1E6SM 3WBAA 4IM4A 1W9DM 1NWSA 1W9UA 3ZJ7A 1CLXA 4UQDA 5D8WA 3ARUA 3GDBA 3OB8A 4WSJA 4PMZA 5A69A 4UOZA 4P8VA 1E43A 1W9PA 4WJXA 4P8WA 3AS3A 1W1YA 3W0KA 4QCFA 3WFZA 4HMCA 7TAAA 3IANA 3UG5A 2X05A 1QBAA 3K4DA 3SCSA 5D9NA 3MKKA 2PWDA 3RPMA 1JD7A 3FHAA 4MAVA 3WNNA 3TOPA 1LL6A 3TTYA 1XGZA 5FKYA 3AJ7A 3K8KA 4JCLA 2NW0A 2YLAA 3DYOA 5HPOA 2WSKA 1MW1A 1ZU8A 2Y8VA 2UY4A 1UWSA 3QHOA 2ZX5A 2G3MA 3U7VA 2PWEA 4UFIA 3GXDA 6A3HA 1KWKA 3ZOAA 1H5VA 3MUAA 5DT5A 1TG7A 4J7RA 3PHAA 3ZJ6A 4B9ZA 4FLRA 1J10A 3ZIZA 3N11A 4FLOA 1E6XM 3IK2A 4X0NA 3CPUA 2PF0A 3AS0A 4OOUA 1HP4A 5I6SA 4D6EA 3MANA 4V28A 4MADA 2GUYA 5BXTA 4AY1A 2WMHA 1ISVA 3MUZ1 4MNMA 3WFLA 3O2LA 2WWCA 1U30A 3VIGA 2EPLX 2JF6A 3OIHA 3IAQA 2Y4SA 3OGSA 3SCPA 4M80A 4W88A 1WO2A 4M82A 4W8BA 4C7GA 1V3LA 3UG3A 2UWFA 4MNLA 4B3LA 1QBBA 2D0HA 4JL2A 1E3ZA 1JNEA 4CCDA 2WB5A 4W89A 3TTOA 1PJ9A 4TOQA 3I3DA 4R5EA 3AIBA 4P7OA 1UWRA 5A2CA 1E4IA 1UQZA 1CECA 5BXRA 4BQ5A 4HMEA 1NWRA 2F8QA 3U7BA 2ZUTA 2E8YA 1C8YA 5CLWA 2WMJA 3NSXA 5CSYA 3WH5A 4DUVA 1KXQA 2BHUA 1BGGA 3T2PA 3PZNA 3ARTA 3GZAA 2ZUMA 3KL0A 1DWGM 3PZVA 2CPUA 1Z32X 4L4PA 1KR1A 4D6JA 2J7CA 1VEOA 5ABHA 3D3AA 1WKYA 4BQ2A 4A3YA 4JCMA 3OG2A 3DC0A 3II1A 1SMAA 2A3BA 2VMFA 5A8MA 4E2OA 5TD4A 4C7DA 3APGA 3L4ZA 2YL8A 3AHYA 6TAAA 5HBFA 1KXVA 3L4YA 1UWIA 3PZQA 1E71M 1FFRA 2VCBA 3NDYA 2XGIA 3K46A 2VZVA 1ISYA 1UWQA 1BHGA 3OZOA 1GCYA 3RM4A 1HKMA 5JBFA 4UCFA 2YBTA 3OLGA 1XH1A 1XHGA 4W93A 3VM7A 2W92A 1CLVA 2O9OA 3ZSSA 4J3XA 3PZUA 5D9PA 3FHQA 3VTRA 1E4MM 4UQAA 1RP9A 4WIWA 1KGWA 4TTUA 3WD4A 1ITCA 3AIQA 4P8UA 4AMCA 1IT0A 3VU2A 4YHGA 1UQYA 1J11A 2C7FA 3AI0A 3ARVA 3WQ4A 1C7SA 4LXFA 3BAXA 3W82A 4B16A 2WYSA 3GXIA 3RJXA 2XFRA 1W2PA 1V6YA 2WLYA 1JYNA 5I24A 3I3EA 2BXYA 1ZL1A 3OZPA 5E6YA 4UQBA 5CGMA 1AMYA 4P7QA 1VBUA 2X1IA 4HZ7A 3O6AA 5E09A 2PWGA 3BSHA 2VT0A 4LX4A 3VX0A 1JYVA 1BLIA 4NSBA 4PSRA 1NM9A 1SFSA 2QPUA 4MB3A 3AZRA 1UUQA 4J3VA 1ITXA 3NYDA 4XZBA 3LPGA 1UD6A 1QNOA 2Y2WA 3WNKA 5JIPA 1GPFA 2VJXA 5GNXA 1XD0A 1KBKA 1Q6CA 3SUUA 1G01A 1H11A 2OWXA 4ATLA 4PSPA 1W1TA 3WF1A 1X6NA 3NDZA 3LPFA 3VVGA 3ALFA 1UD2A 1HIZA 3ARZA 5LA2A 1E9LA 3CZKA 2W66A 3L2MA 2VRQA 2WHKA 3VIJA 2VRJA 3ARPA 4BA0A 2WC3A 4UFMA 4CD7A 2YBUA 4DWSA 3THDA 1XCWA 1K9FA 2O92A 3W6MA 4BQ4A 4Z2IA 2WVVB 1E1FA 1B1YA 3W26A 1VENA 1GOOA 2C0HA 1GQJA 2GFTA 1OINA 1E0WA 1OT1A 3VIFA 3QOKA 2WVUA 1IZJA 3RDKA 2PC8A 4AZHA 4AISA 4GINA 2WLZA 5EBAA 3MMUA 3VGEA 3WDIA 4AZ6A 3VMPA 3CIVA 3EDDA 4X9YA 3VIIA 1GQIA 2D0GA 1FHLA 4DWSD 3QHMA 1JXKA 2VOTA 4Q22A 2DT1A 4JL1A 5D9MA 4W85A 2PWFA 2J7FA 2GSJA 1G94A 1JL8A 4OBSA 3A4WA 4M24A 3GTNA 1JZ6A 5D9OA 1KXHA 1V3MA 2BY0A 4Z2LA 3AOFA 4W86A 4UQEA 4JKKA 1E0XA 4OOZA 4DWSB 3QR3A 4JAWA 3CZEA 1UR4A 2GJXA 4AYSA 3ZQ9A 1VF8A 1K9DA 4CU6A 1GHRA 1WP6A 3VD7A 2VNCA 2E3ZA 5DO8A 1GHSA 1GJWA 3J7HA 3FW6A 1CIUA 2EBNA 2EEXA 1RP8A 3CO4A 1MQPA 1UD3A 1MFVA 2RGLA 5EB8A 4ATWA 5CXPA 2WC4A 5A2BA 4PMXA 4WLCA 3N04A 3SCUA 2WMIA 2YA0A 1CWYA 3DECA 1MXGA 1Q4NX 3F4VA 2E0PA 2UY5A 2W5FA 3WF3A 2VVSA 3B9EA 2QHAA 3RILA 2DSWA 2W61A 1ISWA 2XM1A 3CHEA 3WD3A 1VFMA 4UZSA 4HPHA 2ZE0A 2XWDA 1FH7A 2CNCA 4JHOA 3FNDA 3NJ3A 2J74A 1OCQA 1PZ3A 1V6UA 4HP5A 3B8SA 1V08A 1XRVA 2DSUA 1AQHA 4HA1A 3WL0A 1CGWA 1E6ZA 4UFJA 3VD3A 1C92A 1C7TA 5CPSA 4GI9A 2D23A 1ECEA 1XSIA 4AZBA 2PBOA 1W1PA 1EQPA 1WB0A 1BG4A 3CGTA 1XYFA 3IJ7A 1QNPA 1Y7VA 8A3HA 2VR4A 4Z2HA 3BAKA 4QFUA 1J9YA 4UFHA 1HVQA 1E4NA 2ESCA 1VEPA 2DQXA 3WEMA 1UKSA 3NIYA 1AQ0A 3SCVA 3WY1A 2E9LA 1TCMA 2ZXQA 1Q6DA 4DM1A 4LYRA 3AIWA 2CCRA 1CGYA 5IXEA 1JNDA 5HPCA 4AZGA 4AZCA 3WUFA 1MXDA 4PRWA 4CD4A 5CPQA 4XV0A 1HXJA 2VTFA 3VMOA 3CZGA 4UFKA 2WPGA 2Q8XA 2VL4A 1MFUA 2WZHA 4ZEPA 1ZBCA 1JYXA 5A94A 1XSJA 3VDCA 3WQ5A 1IZKA 1GOQA 2X8RA 1SR0A 4LGXA 4PTMA 4ZXOA 1HKJA 3F5KA 4EANA 3WDRA 4IISA 1E5JA 1W3JA 1EO5A 1E6NA 4D6GA 3EDKA 4AD4A 2DIJA 4KGLA 2J8FA 1CXHA 1E73M 3WDPP 1UZ1A 2O9TA 3JUGA 1EO7A 3LPPA 1GONA 3SCTA 2GDUA 4CN4A 1RPKA 4OBRA 1J18A 3BAYA 1U2YA 1AQMA 1GZJA 1R7OA 3VDBA 2ZIDA 4ZFMA 4AWEA 8CGTA 4F79A 3ZJKA 2PWHA 4D1IA 1GOIA 1BG9A 3IJ8A 2ZX8A 1QI4A 4MAZA 4K68A 2A3AA 3WDHA 2XYLA 2YJQA 2E40A 2QF8A 1V03A 2MANA 5A1AA 4AXNA 4D6CA 4KH2A 1WNOA 4RE2A 2OLHA 4CCCA 3CH9A 3UR8A 2A3EA 4CCEA 3N15A 2XVPA 4IPLA 2VR5A 2ZXAA 3MV11 3RM9A 1H09A 4JIEA 4AZCB 1HNYA 1GJUA 1WDRA 1V3KA 3AMDA 2WW5A 1HJQA 3CLWA 4JZ5A 1K9TA 1PPIA 3WUBA 1B3WA 3T0DA 3ECQA 1XH2A 4P7RA 3WUGA 2CBJA 1GVIA 4CGTA 1SMDA 4AZ7A 2DSKA 2GJRA 3WNLA 4D6FA 5C71A 4AZ5A 2BHZA 4TVCA 1S46A 1BGAA 1JI2A 1CXLA 2V5DA 4MB1A 2CITA 2PB1A 1BYBA 3B9AA 3MS8A 2GJPA 3PZGA 3VILA 4TX6A 1BYDA 1QOXA 3L2LA 4RE3A 4PBGA 1VAHA 4DWSC 3ZMRA 1UH4A 3F5JA 5ABFA 3AZTA 2D1ZA 4WF7A 1CEOA 5EMYA 1MW3A 3VMNA 1D7FA 1Q6EA 3A3HA 3CZ8A 4PTVA 2YOCA 2WBGA 1L0PA 3BMWA 3T0AA 4CUCA 2YA2A 1EOMA 3DYMA 5IDIA 4Z2JA 1R87A 3PTMA 3BGAA 3CHCA 3NCOA 1XV8A 1LJYA 2OYLA 4IPNB 5FL0A 2UY3A 5HDRA 1CGUA 4BCEA 4QLLA 5CLTA 1F4HA 1H2JA 1H0IA 2ZWZA 3W81A 5JUVA 4NF7A 1ZBWA 4UZUA 1OGBA 2GK1B 4BQ3A 1DHKA 4GZEA 3EDJA 3GXFA 5HXMA 3M46A 5FIPA 2WC7A 3ARXA 3CHFA 1WZAA 1G9HA 2JFEX 4HZ8A 2WVVA 6CGTA 1CZ1A 3CUIA 3EMCA 1PX4A 1J0ZA 1LG2A 3VIHA 4J3TA 4OKDA 2XHYA 3FAWA 2CHNA 5I5RA 3WF2A 4H8VA 1V3JA 1BAGA 3MMDA 4M1RA 2YA1A 3AXXA 3KWXA 4NRRA 2CYGA 4GQRA 5HOSA 1QW9A 4MNJA 2WK2A 3T09A 3GBDA 4PCSA 3RMEA 4GO8A 3AHXA 4HA4A 3UETA 3VD4A 2D3LA 3W25A 4B9YA 2NSXA 1O6IA 1E0VA 1QNQA 5AYIA 2PI6A 3K1DA 4J27A 2ZICA 3G6MA 3AICA 4J3WA 2YL9A 2DT2A 2XFFA 1PAMA 3AYRA 2VX6A 2J62A 1ODZA 4W7WA 1QPKA 1O7AA 1XSKA 2XSAA 2JIEA 4BS0A 3N17A 1JZ8A 5ABGA 1OIMA 3NUKA 4Q7NA 1CGVA 3FY1A 4P7NA 1E55A 1GQKA 3W4RA 1LG1A 5FD0A 5BXSA 1BVNP 5DEZA 3GNPA 4MPKA 3N9KA 3VGHA 2V3FA 3NSMA 1EHNA 4XZWA 2W63A 2VO5A 3VD5A 1W9BM 4GPNA 4D1JA 4ZENA 1B3XA 4F9DA 1GUVA 1ZB5A 4HOWA 1HVXA 2DH3A 3GH5A 1G1YA 3BCFA 1W3LA 2X2YA 1J01A 4CN6A 1KCLA 4JFTA 1V0NA 1BYAA 3SIMA 4DUXA 4Z2GA 2QV4A 3WDJA 2BVTA 5F7UA 2J4GA 1OGSA 2EXOA 2YKKA 5CPTA 1OB0A 2V3EA 3OGVA 3CTTA 4TUFA 4D71A 4M81A 5E9AA 2J78A 3AS2A 4UQCA 5IHRA 5FCZA 3VO0A 3WQ6A 2HISA 2CBVA 1J0HA 4KMQA 2D24A 4AIOA 2VZTA 3MSGA 5EFFA 3MMWA 2CBIA 4KRUA 1UR9A 1GOMA 2WHJA 5FL1A 1W32A 1VJZA 3AZSA 1CXIA 1PEZA 3FXYA 1FA2A 3WF4A 4H7VA 2WXDM 4JFUA 1JZ5A 3M6DA 2Y8KA 1UA3A 3WD2A 2X09A 1M03A 3WD1A 1QHZA 1J0JA 3FN9A 3BMVA 4ATDA 3D5HA 3M7SA 2XTKA 2J79A 3S2CA 1KGUA 1LWJA 1GOKA 1EQCA 3OLIA 4E4PA 3L4XA 1N82A 1W9VA 1UKOA 3ALGA 3O9NA 3PZ9A 2YLLA 4V2XA 5ABFB 3WKZA 4RL3A 1HJSA 1TFVA 3WNMA 3W6LA 2GVYA 1EDGA 2VX4A 5I3DA 1MW2A 4MDOA 5ECUA 1FHDA 5A6BA 5I78A 3VNZA 1J0KA 1ODUA 1WCGA 1ZJBA 4DM2A 1PBGA 2CIPA 2VRKA 3IJ9A 1QI5A 3GBEA 4GXPA 2GDVA 4ZXLA 5M17A 1UWUA 4F8XA 3AXIA 1KFWA 2VUYA 2XVLA 3BSGA 1LL7A 3WMBA 1UKPA 1JGIA 2IXVA 3NSNA 4W87A 4U3AA 4F9JA 3MU7A 3ZT7A 4HOXA 1A47A 1EDQA 2ZUSA 5LA0A 1KBBA 2QMJA 1E6QM 2DSZA 1J12A 1LL4A 4TTGA 5D8ZA 1CTNA 1QW8A 2CKSA 3A6OA 3AXHA 1ESWA 2WMKA 3WUEA 5A95A 4XX6A 3WH7A
chains in the Genus database with same CATH superfamily
3CU2A 1F6YA 2YSWA 1VHNA 2XWEA 2ZZ3A 1CENA 4W4QA 5DMYA 2DUXA 3APTA 3WENA 3EB4A 3LENA 3RIKA 2ZTJA 6ENLA 2V2HA 3NEHA 5IFTA 3QY6A 3AUOA 1FUYA 5HMFA 3TTEA 2R9RA 3A47A 1HKWA 5HQEA 4YCOA 3NO3A 3KZPA 1W3KA 1XP3A 2V3GA 3QC3A 2QMKA 2EJ1A 3W2JA 1W5NA 4JQ1A 2W91A 3KDOA 3WFAA 2PRLA 1TPC1 2ZXDA 3E2VA 4U33A 4L65A 1PYMA 1H4PA 2ZRUA 2PDWA 2INEA 3HFTA 2XVKA 5F4XA 2FJKA 1C8XA 3SZ8A 4NASA 4H6KA 3SN4A 3G3MA 3M5ZA 2XGBA 1FWFC 4X22A 1GJPA 4I7WA 4PRRA 1UKTA 4FX7A 1YDNA 4S3CA 2PGFA 3EA3A 1JVNA 3GR8A 4MKSA 5AFDA 2OZTA 3W7QA 1ZPTA 5M03A 2BFGA 1VBGA 4IQEA 2ZUNA 5JBEA 1XYMA 1POKA 5C9UA 2HVMA 3QR1A 3GU9A 2OCZA 4C6BA 1FWDC 2BOFX 1JD9A 2DQWA 3QMTA 5G1MA 2E9MA 2PTWA 2IXUA 3GR7A 4N2YA 2DVUA 4LTSA 4FMVA 2GZXA 3ID7A 1M53A 2H3DA 1OZMA 3VAVA 1PIFA 2IMRA 2WQDA 2X0HA 1H50A 3UCQA 2QUMA 4IHCA 2J77A 4DJED 3AS1A 4KWUA 5C8BB 1JRBA 1CX9A 1YHTA 2VURA 4MWAE 1S3HA 3P81A 1VD6A 5BWFA 4K1WA 2IPWA 2Y85A 3WQEA 2J47A 2G8ZA 1SFLA 3KL5A 4Q7IA 4MDPA 1UBSA 3ZR5A 4FA3A 4R53A 1KC7A 4W5UA 5DBUA 1DXEA 1YKWA 4AW7A 1MYRA 4DJFD 3VNKA 3XISA 1TMLA 2HMCA 4DHGA 3OG3A 1OQFA 4DJEA 4GJ1A 2D0FA 1TVNA 3PUDA 1UR8A 4L1XA 4CQ9A 3TWAA 1KB3A 1L6GA 1CXKA 3CAKA 1IE7C 4WKFA 4DB7A 3IGXA 4IJBA 2WBKA 1JF6A 4X2RA 4E5TA 5DF0A 3EA2A 1MDRA 1JFHA 2R82A 3DHPA 3SEPA 4KETA 1X1NA 5LA1A 3AHVA 2PS2A 4IG2B 4UR9A 3IS4A 4DNHA 3MDWA 1XLKA 1RR2A 1LT8A 3CYVA 2QAPA 2CLLA 3PZIA 3R0UA 2A21A 1P6WA 2VCCA 3BLFA 1QJWA 3VIKA 2W62A 3ELFA 3WDQA 2E6DA 2Z24A 5KZEA 1EHAA 5LNWA 2C16A 2YB4A 3LDVA 4M8UA 3SUSA 2A3LA 2GGJA 1TWIA 1DOSA 4O14A 3S3GA 1OGGA 3RMJA 1B3YA 3IACA 2CETA 4Q4SA 1ZBVA 4KIRA 1LROA 1OIFA 2EPMX 5I77A 5KITA 1QDSA 1YE4A 2OZ0A 5HJXA 1QO2A 1RD5A 3S42A 5BMXA 1D2KA 2V3DA 5JU6A 5E70A 1T40A 3E2RA 4NZ4A 4MNKA 2PDHA 3EAUA 1HN1A 2WAGA 5A6SA 1FQ0A 2YX0A 1XPGA 4CCZA 3EX2A 2B7PA 3WK2A 3TP4A 3LCLA 3NQEA 4ZTXA 3CIWA 1Q7QA 4KERA 4DYEA 1QUMA 1QHPA 3PM6A 5LNVA 1VLWA 4YNGA 5HMSA 2FZ8A 3CS2A 1MEWA 5FJPA 2WVSA 5AHIA 3AHZA 1TZ9A 3VKDA 4B5WA 1KGXA 1IT8A 2DZAA 2HCVA 4UTHA 1JXJA 3ZJ8A 1O68A 4FLSA 3SBFA 1X96A 4PB5A 2E6AA 3ZO9A 1AJZA 3WCZA 2G3FA 2Q01A 4LC6A 3AMGA 1A49A 3WELA 4MG4A 3ARRA 3NPVA 3C56A 4K2SA 2R1LA 4S3JA 4M29A 3RXZA 2WNWA 5JXQA 1R8LA 2IS7A 3BUVA 4X61A 2WANA 1NOFA 1G0CA 1RD6A 1W8SA 4JOMA 2J8GA 4N0RA 1C93A 1TPFA 3PTKA 1GEQA 2AL1A 1KA9F 4HTBA 4X3ZA 2QCLA 4UTMA 2GJNA 4XZHA 4A05A 1KFCA 3GXMA 2J27A 4JHZA 2O7QA 3WH8A 4UTUA 3L4VA 5H8MA 4LYPA 1VB9A 4YVXA 4HNNA 3DFOA 1GVYA 1WZKA 3GQYA 4N4QA 3IRSA 3PG8A 4CNSA 3L65A 1QFEA 4U31A 1Z9AA 3DDMA 2DEPA 4TVUA 3RO6A 4KESA 3VDHA 3WLJA 1EH9A 3SFKA 9CGTA 5FOOA 4OTKA 2BGQA 1VIZA 3NL3A 2O9PA 3EXSA 1HJUA 1FP9A 3W70A 4U2YA 4EPEC 3TC7A 3BLPX 3QBUA 2FVKA 4Y9OA 5CC5A 4GKLA 3MWCA 3AMLA 3TMLA 1EBGA 1M01A 3SURA 2Z6JA 2H8ZA 2NLIA 2XJ7A 4MKVA 3VDAA 1EKOA 1UC5A 1GQLA 4DRSA 4WKHA 4U2ZA 4EXQA 4FNSA 5AYYA 2GGIA 4AD5A 2NUWA 4AD0A 1R3VA 2YGYA 5AOUA 2HS8A 1XICA 5H6HA 3N12A 3O6CA 3W00A 4AIUA 5BW6A 2WHMA 3VOHA 2PGEA 5C70A 3NQFA 3RR1A 1C91A 2PWUA 3T81A 5CJMA 3WH9A 2I56A 3U5UA 1FWGC 3RCNA 4NZ5A 4D2JA 3V35A 1W5PA 3OU8A 3T2OA 5L9FA 4FI4A 4W8LA 3W1TA 3UA3A 4LRSA 5DBTA 1PDYA 3AROA 3KCJA 4JFSA 4J3UA 2DP3A 5DLCA 1J0YA 3HGSA 3LSCA 3CV1A 4GXMA 1NP2A 6PTDA 3T0CA 1D3HA 3GNDA 1W91A 4XZ9A 1S2VA 2VD8A 3D46A 5C7HA 1YDVA 1OBAA 1TPVA 4XZNX 5BU9A 5M5DA 1RCQA 2PDPA 3A4XA 3MKCA 3HV9A 3LPOA 4UTFA 3BQ5A 4IPPA 3KEHA 4PRTA 1HGWA 2XSBA 2EGZA 2WZEA 5K2ZA 3DFPA 5LSMA 4GUJA 1RY8A 2FIQA 4XQ6A 1WYIA 1UR2A 4Y2WA 4KW2A 4ZQOA 4E8DA 3CLMA 1YRRA 3G18A 4O13A 4L6OA 5ENLA 3IJQA 1TO3A 4GIYA 4NZFA 5LIYX 1TYGA 3STFA 3BPWA 3WN6A 1B30A 3GAYA 1VFFA 2CLPA 1A0EA 2ISDA 2DDXA 3AMCA 1A0CA 3BOXA 1I2OA 4PN2A 1K7EA 2YW4A 4C6CA 3W87A 4AMAA 4LYQA 4ML4A 4LT9A 3P84A 1ISZA 3PJWA 1BTCA 4LUSB 4JQAA 2C91A 3VABA 1X7IA 3A5VA 3SY8A 3NOEA 4MJ4A 2BG5A 4AIEA 1V0MA 3K8LA 1HX0A 2XG9A 4L9ZA 4C7FA 1FH9A 3A64A 2QPSA 1P7TB 2F9RA 5BRQA 1LBFA 2EPKX 4FSAA 3MC5A 4OV4A 1XIGA 1B4KA 1SZGA 4R7JA 4OZOA 1W54A 4MHBA 1KCKA 5BRBA 3TW7A 4LUJA 3DHUA 4ZOEA 4JTUA 4NAEA 1Q6OA 2FB3A 5FSEC 4FS9A 3CIXA 4QJ4B 4A22A 1IEIA 4UTWC 1AL8A 2XIMA 3D3FA 2GSHA 3WG6A 3R1ZA 1QO5A 3P0XA 1HL2A 2PE4A 1QI0A 4UFLA 5IHSA 3N3TA 4E3TA 3EDFA 4CQCA 3BGJA 3AYTA 2D73A 1BWKA 2XFYA 3C0JA 3CXOA 1KXTA 4GK8A 3V0UA 4D8ZA 2E8ZA 3DHDA 1UZ4A 4A2RA 4EWND 2NVAA 4BF7A 1XJBA 4FALA 1V3HA 3TSBA 4WKAA 2G41A 2ACRA 4CQAA 3BAJA 1WXZA 4HHHA 3ITXA 3BURA 5E0CA 3TCSA 1FH8A 1ZFJA 5F2MA 3GH4A 1EPXA 1JZ3A 2D2OA 4JTLA 1KLZA 2PWVA 3PZOA 3S1XA 3W27A 2BS9A 2FGBA 3THCA 1Y0EA 2X1RA 4CKQA 1K03A 1IXPA 1VLIA 3W7GA 5SWUA 1V7YA 2FH8A 1IEVA 4DPPA 2XVNA 2GJLA 1I1WA 3USBA 3FJLA 2ZZ2A 2XFWA 3VNDA 3VOJA 4IUGA 3RCMA 3DFHA 3MTWA 1MWOA 3ANVA 1UH3A 3W75A 1YQ2A 3KZSA 3SCRA 1EDTA 2XVGA 4GUGA 1EJUC 2O9RA 3CBWA 1MW0A 1S5MA 3M0MA 1TZ7A 1U5JA 2NSOA 4A3HA 3RGTA 3TN4A 1US3A 1B3ZA 2E5CA 3LM3A 1YEYA 4WD0A 2V69A 1WDPA 4FLQA 4H83A 1VS1A 5EFDA 1XG4A 3LHYA 1M41A 3ABZA 1R38A 3UZZA 5T91A 2ZKMX 4Y8EA 4OQVA 4JFVA 2NT0A 1XBYA 4YN5A 3QHNA 4PCTA 1O5KA 1DP0A 2XIBA 4H41A 1CNVA 1SJAA 3SSZA 3TV8A 1XL9A 1YW1A 3AIEA 1E6SM 4K36A 1W9UA 3CK5A 1U1UA 3CWNA 3A22A 1SZNA 3PBMA 3C3UA 4JNMA 5A69A 1YYAA 4N6EA 4MUPA 1W9PA 4WJXA 4P8WA 1W1YA 5E5CA 3KOZA 4YWIA 2F2KA 3GFZA 1W56A 2UBPC 3EXRA 3N25A 1DE5A 4ICMA 3JZUA 4PMJA 3PB2A 3URQA 2Q6ZA 3CEUA 3OO2A 4HPXA 4NZJA 1GZGA 3S5YA 2PWDA 3RPMA 1UBPC 1M7PA 4FX6M 1XGZA 2I9UA 5FKYA 3AJ7A 1L6SA 2QVHA 3OYXA 3DYOA 2WSKA 3RRAA 3S9IA 3OW1A 3PR2A 1S2AA 3QHOA 2G3MA 3JRKA 1W1B1 4HNCA 3CO8A 3CTLA 3QV9A 1H5VA 1EC7A 4NAFA 2PU1A 4AC7C 3ZJ6A 5I00A 2HS6A 3CT7A 3ZIZA 5G4HC 2Z29A 3IK2A 4JTSA 5BOFA 3HGJA 2VDHA 4F2UA 2QV5A 4DF2A 4NY2A 2WO5A 2DIKA 4GD0A 1Y65A 5BXTA 5AB3A 3PPHA 5CKSA 4RCXA 4LF2A 1WX0A 3VIGA 2JF6A 2G95A 1POJA 5DXYA 5CC7A 3IAQA 3OGSA 4QS5A 3Q4DA 4HCDA 4M82A 1OABA 3S6OA 1PIIA 2C6QA 5HJYA 4I5RA 4B3LA 1VQTA 1KBIA 4JL2A 1B5TA 3KCLA 2WB5A 4QGCA 2A7RA 1FX6A 3LHTA 1PJ9A 3RCYA 4PEKA 4R5EA 3SRFA 5KSWA 4WY0F 4PTDA 3VI2A 3IGHX 1PHQA 4Y8FA 1NWRA 3U7BA 3UPMA 2KAUC 4S2CA 3I4KA 2ZUTA 2E8YA 2FJUB 3G1YA 3QYSA 1GG1A 1UASA 3PZNA 3BOFA 1EEXA 1F5ZA 3GZAA 2QCFA 3KL0A 3QLLA 4PUNA 3KFTA 5FSDC 5LZLA 1KR1A 2FVLA 1F9CA 2J7CA 1VEOA 2DVTA 3IIZA 2OQYA 3BVJA 2J6XA 4BQ2A 3OG2A 5C54A 2OQHA 3GS6A 4Q8QA 3II1A 3QQ0A 3N3MA 4E2OA 4J9JA 4C7DA 1S2CA 2BWGA 2HBXA 3AHYA 2Q3OA 3T8QA 3LHUA 1WKDA 4YLWA 4O11A 3PZQA 3UWYA 2X1TA 2WZTA 5CBJA 3A3WA 4JHMA 1X8CA 1H7PA 3IEBA 2VZVA 1W5OA 3GX9A 4A3QA 1TPH1 3RM4A 3F7JA 2XH7A 1FCUA 1K8ZA 3VYLA 5JBFA 4C90A 1PWMA 5ABTA 2DZWA 3BWWA 1K1DA 4PL2A 1R3RA 3O3RA 3ZSSA 4C6OA 4J3XA 3B0YA 3VTRA 3UWZA 3E2SA 1UP2A 3W85A 4WIWA 5XIMA 2YCEA 4NIRA 3JU2A 1ITCA 2VEGA 4P8UA 1W1IE 2NZLA 2A6LA 1UQYA 3TZNA 1LTDA 3O16A 2YPIA 1DJGA 4NL1A 1O95A 4KPLA 2WYSA 3GXIA 3T8LA 2EHHA 4Q8OA 1W2PA 3K5XA 1V6YA 3CUXA 3E02A 4ERIA 2QCCA 2I16A 3STCA 1ZL1A 2ZVIA 4UQBA 2DW6A 2G37A 5CGMA 2ZA1A 4KEUA 4P7QA 3QTGA 4YYCA 1KM0A 2FTPA 4C6MA 5K9XA 4TMCA 4IL2A 1JYVA 1VBJA 4NSBA 4PSRA 6XIAA 4MB3A 3AZRA 4BY3A 2OTDA 4HT3A 3G1AA 4J3VA 3G24A 1M9HA 2OQLA 3LPGA 3A9BA 5EL1A 1UD6A 5LNUA 3M0LA 1V8EA 4CNNA 3R8RA 1XDMA 1G4PA 1SW7A 1GPFA 2PTXA 3GSMA 1G01A 2OWXA 3VVGA 1UD2A 3ARZA 2NQLA 5C2XA 3B06A 2NX1A 2W66A 1DJQA 3SQMA 1TRIA 2VRQA 4JYDA 1E9IA 2Y62A 3VIJA 2VRJA 3M5VA 3P14A 3DG7A 1VR6A 7XIMA 4UFMA 4EXBA 1XCWA 4NNCA 3NO5A 4GCAA 9XIMA 1P48A 1VENA 1OINA 2ZDSA 1U22A 5EMKA 4ROQA 3IV3A 1OT1A 3VIFA 3SDOA 1IZJA 1NU5A 3W3OA 1JJKA 4NNBA 3WZ0E 1FVPA 1YXCA 4RZ5A 5DQPA 3VNIA 3VGEA 3WDIA 3F1QA 3VIIA 4XIAA 4YTSA 1FHLA 3LN3A 1S2WA 3O15A 5D9MA 4W85A 2J7FA 1YNQA 1JCNA 5MF5A 5D9OA 3B4UA 2BY0A 3EOOA 4GGHA 4JY9A 1BTMA 2PTZA 4RKAA 4AYSA 5I7GA 4NP7A 1GVEA 3HG4A 2IW0A 4W9TA 3WBWA 1GHRA 1WP6A 3NQ2A 3LCWA 2Y7EA 3RHGA 4LS1A 1XWYA 1JPHA 2JK2A 3OP2A 1EF2A 3F4WA 4DXKA 4ATWA 4IMCA 5CXPA 2ZC1A 4GMEA 3CV2A 3QTPA 3FK4A 5G2HA 2P53A 3MZNA 2YA0A 5FF2A 3GFXA 1PUDA 2IQTA 3F4VA 2E0PA 2VVSA 3CAQA 2GOUA 3BMXA 1I2PA 4G1KA 4O1CA 2WNNA 4GY7A 1FH7A 4JX6A 1W0MA 4I8YA 5CZ0A 2EF9A 2ASHA 4HP5A 1W3IA 4NZ3A 1XRVA 1YXDA 2QCMA 3WL0A 4UIOA 1C92A 1C7TA 5CPSA 3UNDA 5HWNA 2B7QA 3PUGA 3W1QA 1WB0A 1OFOA 3CGTA 4J40A 3IJ7A 3WLKX 1PCKA 5DCEA 8A3HA 3MDUA 3DC8A 4QFUA 2OR2A 1HVQA 2ESCA 1VEPA 1VPYA 1EJWC 3HA1A 2E9LA 5EMUA 2VGBA 3UPBA 2CCRA 3V36A 3KBJA 4AZCA 4CD4A 1F3TA 4XV0A 1OF8A 4GQGA 2VTFA 1O5XA 3GTHA 4UFKA 4BF9A 2WPGA 1E1CA 3OPSA 1X97A 2WZHA 5A94A 2PP1A 1IZKA 1SR0A 3O63A 1TJPA 3ZLHA 3HBLA 3JVAA 1XFCA 4EX4A 4XUGA 4EANA 2PU0A 3L0GA 1SZRA 1XR2A 1EO5A 1E6NA 2C79A 4CNUA 4D6GA 3EDKA 1XQLA 1N8WA 5C9ZA 4G1NA 4AD4A 3WDPP 3QSTA 3G1DA 2O9TA 2XH0A 3BLDA 3BLOA 4MLRA 1TSIA 3UXLA 3QKEA 1GONA 4PB3A 2C71A 7ODCA 4O10A 4AF0B 1J18A 4JXCA 2PODA 1AQMA 3LCHA 1AA1B 1F76A 3CM4A 4QE4A 4ZFMA 1VFTA 1RBLA 4Q4OA 3EWYA 1ZCOA 3BLEA 1WXYA 4IP5A 1QW7A 3KBVA 2Q71A 3IJ8A 3NQGA 1UUOA 3SM0A 4MAZA 1KV5A 1NQKA 2PDJA 3WDHA 2WJFA 3CPRA 4A3UA 4G9PA 3T55A 4LJ3A 3UVIA 5A1AA 4UMAA 1BKHA 3G5EA 4D6CA 1WNOA 1OCJA 2OLHA 2A3EA 4CCEA 3STPA 1NF7A 2XVPA 5LHFA 3MV11 4HPJA 4NUWA 3W1PA 1VCGA 1HNYA 1TJ0A 1SFTA 1REQB 3NA8A 1M1BA 5B7ZA 3WUBA 3ECQA 1XH2A 3KRBA 3WUGA 2VGGA 1GVIA 4OHQA 4FB7A 4CGTA 1T96A 4AZ7A 1A3WA 3KVMA 2VOMA 5DN1A 2R8WA 3LXCA 4XAZA 4E4FA 3H6OA 2QDEA 4GBUA 1EP2A 2HSAA 2NWRA 3V0TA 2Y1HA 3ZMRA 5ABFA 3P60A 3BLIA 1M68A 3AZTA 2PC4A 1CEOA 5EMYA 1MW3A 3A3HA 3TR9A 2BGSA 3W7CA 4GJIA 3IUDA 1GVQA 4LBSA 2YA2A 3MJYA 1J6OA 1BKSA 1LJYA 3TN5A 5FL0A 2HDJA 3KP1A 1Q2RA 5CLTA 4F0RA 3I7QA 1H0IA 1R6WA 2AAMA 3THAA 1DHKA 4GZEA 3AWNA 4RNHA 5HXMA 1BQGA 2XIQA 1OG0A 4F0MA 3HB9A 3CHFA 4TQTA 1G9HA 3GDMA 4LY8A 3REQA 4DZIA 3TLLA 3CUIA 4C91A 1PX4A 4IPJA 1AW2A 1LG2A 4HGXA 4J3TA 4I9JA 5I03A 1MXSA 4O28A 4OKDA 2XHYA 5FI8A 9RUBA 1T8XA 2A1YA 2REQA 3G1SA 3MMDA 3AXXA 3KWXA 2I57A 4NRRA 3MSYA 2CYGA 2R91A 2FFIA 3RRXA 1QW9A 4IFKA 4PCSA 1ICQA 3VD4A 3W25A 4AX6A 1QU4A 5I3FA 2NSXA 4N9BA 1QNQA 4WGHA 1GYNA 2Y61A 4RW3A 4LUTA 4Y9NA 2YL9A 2XFFA 3AYRA 4NJJA 2VX6A 4ZQCA 5AHFA 4PR4A 1JZ8A 5ABGA 1OIMA 2HROA 3TROA 3JS3A 3N2MA 1QWKA 3LGGA 5G5IA 2CZVA 3UXKA 1EA0A 1VCFA 1OVDA 5CJNA 1BXBA 1SU5A 2Z1VA 1TV5A 1FCVA 4XZWA 3N14A 3VD5A 4GPNA 5EU9A 3T42A 1B3XA 1ZB5A 3STEA 4HOWA 2OZ3A 1W3LA 4XD4A 1RK6A 4KRZA 1VKFA 1KCLA 4JFTA 1BYAA 1XRTA 2O0TA 5G2WA 3S1WA 4YTUA 2YKKA 1OGSA 3N6QA 1Q6LA 3LS9A 3NZRA 3GVGA 3W2LA 2V3EA 1WV2A 3OGVA 3SSJA 3GNNA 3BGGA 5FCZA 1SUXA 4EPBC 2VZTA 4G7FA 4EF8A 4UXDA 4ZB0A 3WLPA 4B4FA 5K3VA 1ITQA 1QMLA 2WHJA 4LV9A 1EBHA 3TVAA 1VJZA 3AZSA 3LTSA 3DERA 3WF4A 1VC4A 4C6LA 2Z7GA 2Z1XA 3LOTA 3M6DA 2IQ0A 2QEZA 3JW7A 3S1GA 3WD1A 2A79A 1QPRA 4IJRA 1W8GA 3IIOA 1LWJA 1GOKA 1EQCA 4E4PA 3ALGA 3TC3A 4AWSA 5ABFB 4RL3A 3WNMA 1TFVA 5FEXA 2TYSA 1TV2A 5I78A 1XXXA 1ODUA 1VGAA 4TO8A 1B57A 4WDTA 1YPFA 3BDKA 1XIIA 5DCDA 3RFAA 3IJ9A 4E8GA 1QI5A 2GDVA 3EWCA 3KOFA 2GUUA 3DFSA 4F8XA 1KFWA 3AC0A 2KX9A 1XLFA 4MUZA 4UUIA 3WMBA 1UKPA 2J13A 5G1TA 2PDQA 4F9JA 1ME7A 5HUPA 1XKJA 2VEPA 1J12A 3BV7A 2OG9A 3W6YA 2Y8UA 3R10A 1QW8A 1J5TA 1N2VA 3A5FA 4XZIA 1H5YA 1ONXA 1TJ2A 3AXHA 3WUEA 1TPUA 4GY0A 5AN7A 2CLKA 4K38A 3TTSA 4O1BA 4DJDD 2ISFA 1EPVA 2ACQA 2E1DA 1S38A 5DMNA 4B2DD 1O1ZA 2ZYFA 3TAOA 2E67A 4LEFA 5E93A 1FHVA 2P10A 3IIVA 3GKAA 1MZRA 2FDMA 1QNVA 4AWUA 2FHBA 4QG6A 1TPDA 4DJDC 2E68A 4XD3A 3FFSA 4AHQA 2CC0A 4CVWA 2OLAA 1KFEA 3ARQA 2Q8LA 1DJHA 3N13A 2DY3A 1OCNA 1X1ZA 1K8YA 3DHFA 1ZAIA 3VM5A 3O6YX 2QCHA 4PMOA 3W24A 3BICA 2ZUVA 4NAFB 2WKLA 1OYBA 2Y5EA 5I07A 1WDSA 4PUJA 4HMDA 1A5SA 2P3ZA 2WZIA 2DU2A 4Z2KA 3WMSA 3OVGA 5EMJA 4QDPA 3WK1A 4V27A 3UZXA 1AD1A 1BYCA 4NX0A 3QM3A 4HZ6A 4EE9A 1S39A 1HJWA 1A0DA 3CAVA 4FXFA 1FWSA 4LWWA 2PDBA 4IGSA 4GI6A 5T9BG 1DQWA 4O0ZA 1I1XA 3GWQA 4MB5A 5C9XA 3QSRA 2AQVA 3CYJA 4O1FA 4S3AA 4Q6XA 2GQ9A 1DPMA 5AC6A 3FLUA 4XD5A 4AXKA 1DIDA 5A8PA 3PF3A 1HO1A 4K8GA 2VKZG 1R7AA 2RHGA 5I23A 4U5KA 4IZGA 3C86A 4JX5A 2WMIB 1AK5A 1V3IA 3UNTA 1W1VA 2YDQA 5FESA 2FH6A 4INFA 1KQZA 1XLMA 3B03A 4AY8A 1X8FA 3W83A 3EBVA 2A7PA 3KCOA 3RM8A 2HTMA 3OBAA 3OLEA 1UHVA 5I02A 1O1HA 3EKZA 3YPIA 2J7HA 3MO4A 2DZUA 1UR0A 1KBLA 3NQ6A 4HN8A 2PDKA 2XH4A 3I6RA 2EQDA 2DSVA 1TX0A 1TJ1A 4NJIA 4CN1A 2CWNA 3VINA 5HANA 1E4LA 2G0WA 4LUTB 4MTVA 5BOOA 1EWEA 1KM1A 2VGIA 4XZMX 4JTFA 4GYJA 3HPZA 2AGTA 5DMMA 4UC5A 5HQLA 3GVVA 2FZBA 2ACSA 3P5ZA 4QDMA 4CLMA 4BK9A 5T26A 1DIOA 4GE8A 2V81A 1PVNA 3E49A 3QZEA 4JQ3A 1B90A 4YTTA 3T4WA 2V5LA 3L4TA 2F2HA 3K13A 2VQTA 1KLYA 3MBDA 4S3GA 3MWAA 3OZMA 1MZHA 2C8NA 1UR3M 1CBGA 2C3ZA 3A4AA 3TWBA 1MVYA 4TX8A 3S47A 2ZZ1A 3MI2A 4PEEA 1M5WA 4ZO9A 4HBKA 1AJ0A 4HHMA 4Y9PA 2WM1A 1WZMA 4NJKA 5EY5A 1IIGA 3AHTA 3LRKA 2E28A 3C6CA 3R2GA 1M6JA 4J35A 3ZVHB 3TONA 1C90A 1VRDA 3I65A 3RUBL 3UA4A 1ISXA 1EIBA 1XD1A 4FXRA 3KOXA 2QUNA 4XBKA 1PX3A 1PKLA 4GH1A 1XRFA 3W1RA 2ZUWA 1ZY9A 4JX4A 1UD5A 2OEKA 4TXEA 4ZOAA 3CL8A 2V2DA 1Z89A 1FKXA 2CLMA 3H2OA 4W84A 1O4UA 2BXZA 4FOUA 4WJ8A 4F0LA 5KTLA 1IZCA 1KR0A 3GFYA 2O56A 3PWIA 2XDFA 1JAEA 3M0HA 1UA7A 4I5UA 1PZ2A 4HNUA 3S46A 4M6QA 1RVGA 4TX9A 5AY7A 4LV4A 3O7UA 1Z6KA 3TKFA 1MUMA 3K2GA 3IRDA 1CGTA 4QS6A 1OD0A 2NT1A 4RE0A 2MUCA 2F61A 3VFCA 1VZWA 1EC8A 3UFYA 4N9EA 3AFBA 3NWRA 5HULA 2BY1A 8XIAA 3KHDA 4RDYA 2AQOA 4JEQA 2GGEA 1DWFM 2J9ZA 1YTKA 2V9DA 4YCPA 2FHFA 2ZX7A 4MZYA 3DKLA 4HOZA 4GZIA 4L1GA 4H9MA 3EYPA 1UOZA 1RH9A 3UXIA 1KWGA 4LCRA 3MKVA 5CPLA 3S5SA 1O12A 3GIPA 5KEZA 3KX6A 1RBOB 1LT7A 1R9YA 3VIMA 4C1KA 4H6EA 1QHOA 2A4AA 4WHBA 5CPNA 1A3HA 3W7HA 1NDZA 2A3CA 2VZSA 1G67A 1V0LA 4HU8A 3PNZA 3KW3A 4KFNA 1QRQA 3MMTA 3W28A 3TK7A 1NP0A 3VKAA 4G56A 6REQB 2I9EA 4AX7A 1BWLA 2BSLA 1B9ZA 2B31A 1D8CA 2QLYA 1BSIA 2E5DA 2BOGX 4I9TA 4GYKA 3WLRA 3KBMA 4AF0A 3LLFA 3RG6A 4OBTA 3SY1A 4LVAA 2XZ7A 3W1XA 3PBGA 3W73A 3K8MA 4RW5A 1FHUA 4XBJA 3GK0A 3HPAA 4JFWA 3UEQA 2E4TA 1LF1A 5F1VA 4MIMA 5DXXA 3M7WA 1YLVA 4LBUA 1ZRQA 1EXPA 3K4AA 4LCSA 4DJEC 3EA1A 5F1UA 5JBDA 4QLKA 2VFHA 3GR4A 4M6VA 2OU4A 1E1CB 4H2CA 3AXMA 1Z48A 3AIUA 3ATZA 3BW2A 4RR4A 2NV1A 3S6TA 3UR5A 2CU0A 1X98A 2ZX9A 3PPFA 4NU7A 1EYWA 4EP8C 4N42A 3F2BA 1HZYA 1PDZA 1JAKA 2OJPA 3NPWA 2PD5A 4DUWA 4I6VA 4UWMA 4PCPA 3H7UA 3ERPA 1QATA 3TN3A 1XYBA 4BI7A 4HYWA 1EJXC 4GJJA 1GVSA 4GQ0A 3R11A 1NH6A 3LB0A 4PMRA 2WCGA 1XIEA 3WQDA 2ZZ5A 2YFNA 3BAWA 4ZMGA 4Q4PA 3W7OA 3MYPA 1UD4A 3SUWA 4GISA 2HXTA 4IOTA 4H9VA 1H60A 3T0TA 4U3CA 5HJLA 4GYPA 4YPJA 1QTWA 3PJUA 4GIAA 2QCEA 3BOLA 2J9XA 4CD8A 3IWPA 3XINA 1CLKA 1ZS2A 2DJLA 3O07A 4QAIA 1UWTA 3VC6A 2C18A 4DI9A 4NZ1A 1TA3B 4O4WA 4OUEA 3TYAA 1JZ2A 3LHZA 1R2TA 3VIOA 2ZUUA 2OFJA 4KFOA 3TYZA 1WDDA 1PSCA 3K4WA 2E09A 3FKRA 1LQ2A 3TTQA 2EG6A 3G6LA 2UZ9A 3TYUA 4J2PA 2OWWA 2AKZA 4Q4QA 1EOKA 5XINA 3G8EA 1V02A 4ZBCA 4NYUA 2OELA 3TNOA 4I6KA 1DV7A 5MHBA 3NPUA 3BXWA 4KEVA 2PP0A 1XBZA 3CZLA 3WQVA 4CEXC 4H01A 3O0FA 3ZT6A 1HT6A 3QR0A 1PX8A 3W38A 4M3PA 3O6DA 3GNOA 4WEVX 5D30A 2JEPA 4KRTA 2JALA 4ACZB 2ABBA 3LI1A 1M04A 4PA8A 5JQ9A 4URIA 5GNZA 2E5BA 3KDNA 3IGUA 2PEVA 3GY1A 3VOCA 2DT3A 2OYKA 1F05A 1H7WA 1V51A 1FWJC 3HG3A 4CU8A 3SRHA 4ZGYA 1IV8A 3GM8A 1UMYA 2QZRA 1RZMA 1C9DA 4GUIA 4PUKA 3KE0A 3PULA 5CPMA 3AJXA 4NRSA 3LLDA 4PMUA 3WBXA 3T4CA 3R13A 5CGTA 2VI0A 4GUFA 2I17A 4Z1CA 2AMGA 4L1WA 2X0YA 1KM4A 4H8UA 5BZAA 3VNLA 5LYRA 4UNIA 3VXGA 3OHMB 4PC8A 1Q4WA 1SPQA 3I6EA 4D6IA 4O17A 1AW1A 3T0BA 2PDGA 5DT7A 2D2JA 4IL0A 2OKOA 3PN8A 4REQB 4EK7A 2VVNA 4HPGA 1H49A 5REQB 4ZE5A 1YMYA 2HNEA 4BHYA 2GGGA 5REQA 1E72M 4JS3A 2OSWA 2HJPA 2BHYA 4L64A 1P4CA 4B15A 2OWCA 1A4LA 2PCQA 1WZLA 5A6MA 1ZAJA 1EX5A 1XW8A 2YDRA 4X60A 4F0HA 4LEQA 1B3OA 1GYLA 1DJZA 3D47A 2ZRZA 3HQOA 3KXQA 5A8NA 4NVTA 3IUHA 3N2TA 4O1EA 3B8VA 4H4IA 1U33A 3W22A 4O4VA 2WKJA 4AD3A 4MGGA 3ITLA 2Q3RA 3T1GA 1MMFA 4LAKA 3UVAA 1Z7AA 3MT1A 1YADA 4Y7EA 2GQ3A 4PBFA 3TW9A 1S1PA 5A3HA 1JYWA 1EF3A 1FCBA 1BVZA 2D3NA 2JGYA 4E2BA 2VXNA 1TPWA 5K7JA 2QT3A 1TELA 3TXZA 2JQXA 3E6EA 5BMWA 4KWVA 1US0A 3VNYA 4A2SA 5CSRA 3BG9A 4XUYA 3EKGA 3PPGA 4WCJA 4QQUA 1H41A 3NGFA 5A6BD 1DJYA 1T6MA 1V0KA 3HTWA 1FXPA 1TV4A 4P5UA 2CESA 3Q45A 4AAJA 1ENUA 2NQZA 1X6LA 1NWTA 1NOUA 2X40A 1R3WA 3BCDA 4AG0A 1WDQA 4AC1X 4QISA 2RDTA 1W5QA 4XKMA 2JKPA 5HA7A 1H61A 5E6ZA 2PDIA 3OVQA 4XD6A 7REQB 5I2UA 1UOKA 1M65A 2JE8A 3ZR4A 2CXGA 3DYPA 4RK8A 2OKTA 1E15A 2J9YA 3PVFA 2GVJA 1NWSA 3ZJ7A 4UQDA 3BO9A 3ARUA 3GDBA 4PMZA 3QLDA 1FWCC 4Q33A 4MWAB 3L21A 3LCXA 2OGJA 1KCXA 2GYIA 1OFAA 3R6IA 2X05A 1TZZA 5BU6A 2EKGA 3NVDA 2Z2BA 3MB9A 1JD7A 3TOYA 4IQDA 3WNNA 1LL6A 3UG8A 3P82A 1TQXA 2CW6A 1P6CA 4IIBA 4DQWA 4GUHA 1MW1A 3H8AA 1ZU8A 4EF9A 2NQJA 2UY4A 1UWSA 3HMJG 3Q65A 2PWEA 4BJHA 4Z1AA 3GXDA 4Z1YA 1KWKA 2XZ9A 2QCNA 4ZOCA 3MUAA 1TG7A 1XRSA 4Q8UA 3PHAA 1V6TA 2HZGA 3TYDA 2RFGA 4X0NA 4OOUA 1SZFA 1J4EA 1O5RA 4QE1A 1Q2SA 1AG1O 2FZ9A 2W27A 2GUYA 4MADA 1NFPA 2Q8ZA 1W3TA 1PHWA 2ZRWA 3MUZ1 3WFLA 3O2LA 2WWCA 4QEEA 3LMZA 1QOQA 1F3EA 1TX2A 2Y4SA 3NDOA 3SCPA 3C0SA 3CPGA 1WO2A 4GC4A 3AWOA 4QXIA 5AYZA 1ML1A 2UWFA 1TVLA 1X6UA 4E38A 4XAFA 1JNEA 4IP7A 4W89A 4GVIA 1WOAA 3TTOA 1P43A 3I3DA 2V5JA 3AIBA 1EP1A 4IP4A 3FS2A 2WV8A 1E4IA 1IXQA 2FDSA 5BXRA 2QDDA 3SGGA 4PE8A 4PCNA 3P61A 2CLHA 6REQA 1C8YA 2ZRYA 1OC6A 2CZ5A 3W7KA 3FVMA 1M7JA 1KXQA 2BHUA 4CQDA 4YMZA 5T8GA 3BW3A 3PZVA 4L4PA 3I6TA 4S23A 2YCLB 1WKYA 4A3YA 3DC0A 1OFQA 1SMAA 3Q2DA 4WR3A 1BRLB 3N73A 5A8MA 5HNUA 5TD4A 3HG2A 3VDGA 3M47A 6ALDA 5HBFA 4MYAA 1UWIA 2QCDB 2VCBA 2XGIA 4ZZ9A 3MVIA 4F2TA 3K46A 1UWQA 1GCYA 4AHOA 3OOQA 2XIOA 3ONCA 5U4NA 2QIWA 3O8AA 2SFPA 2BOEX 4UCFA 4A8IA 3OLGA 4XSLA 1JULA 2P50A 1DORA 3L0NA 5F4SA 2RUSA 2ZCGA 1ZJIA 2O9OA 2G5WA 3PZUA 3FHQA 4JTKA 1B4EA 2Z1WA 4L6HA 4L61A 4TTUA 3C5QA 4H9ZA 1WXJA 3BQ6A 3AIQA 3DXIA 1J11A 3AI0A 3MP3A 3BAXA 2X41A 1FWHC 3E0VA 3TYEA 1EIXA 4X9SA 3WYZA 1JYNA 5I24A 1H1YA 3S9YA 2OLSA 1RJRA 2CLEA 3OTRA 4JIIX 2ONEA 1AMYA 1VBUA 3ATYA 2KZHA 3RYSA 3FJ4A 2X1IA 4JEJA 4LAOA 5FACA 3GHTA 1XBXA 2NQ9A 3H2NA 3P0WA 3LBCA 1K7XA 4PTNA 2IKHA 5D37A 1JUBA 1BLIA 1OFPA 2V63A 2QPUA 3H21A 4N9CA 1ITXA 2E77A 4MMWA 1XLIA 2DUAA 4PUUA 3BZJA 4IX2A 1A4MA 3NEVA 4C65A 3WNKA 4MVAA 2VJXA 4FNTA 1XYCA 4F4RA 5GNXA 1XD0A 1KBKA 1UWAA 3ALFA 4EWJA 4KCWA 3MUXA 3QC0A 3OYZA 2WHKA 4A3RA 3FJNA 4WXYA 4E4UA 2Y63A 4MOZA 1EUNA 3ARPA 1EYEA 2WC3A 5AVHA 1J2BA 3BW4A 4DWSA 1K9FA 1Z8AA 2O92A 4BQ4A 3F2CA 4Z2IA 3AALA 3OODA 3Q94A 1OK4A 5I06A 5PTDA 4EOUA 4K8EA 2C0HA 2GFTA 1E0WA 1GYMA 1CI1A 4OU1A 4O1DA 4UTTA 5AZ0A 4H9UA 3GXPA 4OVXA 1TV7A 2VFFA 2OT1A 3IVTA 3NGJA 3NQMA 1XYLA 4NKCA 4R7OA 4DWSD 2G50A 5KMYA 2YCJA 2IPJA 4H8NA 4JL1A 3C2EA 4IMDA 1K7FA 2PWFA 3URBA 1MEHA 4OBSA 1D8WA 4R88A 4C1LA 1H62A 3GTNA 3S83A 4O54A 3QXBA 2OZ8A 3AOFA 4W86A 3EWDA 5FAGA 3CZEA 3ZQ9A 4BWLA 2E3ZA 4Y6GA 1GJWA 1LORA 3J7HA 2PDFA 3EXTA 4L6DA 3FCPA 3W76A 4AQLA 4C5ZA 3CO4A 1MQPA 1ALDA 1MFVA 2RGLA 5EB8A 3ZYZA 5CZJA 4IG2A 2BBFA 4RV3A 4NXSA 5EYWA 3SCUA 5G4EA 1L2QA 2WSYA 2AKMA 5D09A 2I1OA 2WMIA 3FX4A 1CWYA 4I7UA 1MNZA 1Q4NX 4HNLA 4QQ3A 1QXLA 1UP3A 2HK0A 3B9EA 4B91A 4HJWA 1RCOB 2W61A 3ITTA 4GBDA 4I8DA 3AO0A 3CHEA 3L66A 1VHCA 4HPHA 2CNCA 3NJ3A 1OCQA 4DYJA 4TMBA 4JQ2A 4JTCA 3LSBA 1XI3A 1PO9A 4FNUA 1TWZA 3TJXA 2R14A 1XKYA 2HVNA 1B9BA 3RU6A 3M44A 4AZBA 2PLKA 3LI0A 1Y7VA 2VR4A 1K4GA 1P0KA 2UV8G 4UFHA 3URNA 2C15A 5EMMA 4H9TA 1UKSA 1ICPA 4QDWA 2WJEA 1ZJHA 2OT0A 2ZXQA 1JCLA 1Q6DA 1CGYA 2FMOA 4U28A 3SN0A 1DXFA 4NQ1A 4AZGA 1MXDA 2A6NA 3MY9A 1LRQA 3VMOA 3CZGA 4ZQPA 3BG3A 3R43A 4MZ1A 3MHGA 2P8BA 4ZEPA 1JYXA 1PWLA 1XSJA 4YS1A 3ES7A 2EG7A 2VC5A 4ZXOA 3SRKA 1GKQA 4WVXA 1BVWA 3HPFA 3P3BA 1H51A 2XN0A 4JDBA 2WJDA 2J8FA 4LF1A 4LS2A 3TU9A 3EWBX 1ONRA 3ABQA 3SCTA 2GDUA 3EX6A 3LU2A 7ENLA 1H7RA 3BAYA 3C2FA 4RV8A 3P8JA 2ZRXA 3VDBA 2ZIDA 1W5MA 2OVLA 3I4EA 5CH9A 2YYUA 2PWHA 1A53A 1T41A 1GOIA 2ZZ7A 3H4XA 1QI4A 4JQ4A 4K68A 1A5UA 2OOFA 3VCNA 3CWHA 1EGVA 1EZ2A 3V5OA 5MKGA 2G96A 1S2UA 2QF8A 1V03A 4Y9MA 4PULA 3B40A 3F4NA 3PFMA 1V79A 4TIMA 3U9IA 3UGVA 1VFHA 3UR8A 1TV3A 3WLLA 3CL6A 4EVZA 2PURA 3RITA 2DZVA 1WUEA 1A5MC 3IIXA 1H09A 1FDYA 5AHEA 4JIEA 4AZCB 1GJUA 4LNYA 3UP8A 1V3KA 3AMDA 1HJQA 3CLWA 4H6RA 4L5ZA 2JGQA 3T0DA 1FWIC 1UJPA 4DZ5A 1LCOA 3M9YA 1OYCA 3EPOA 1GWJA 1EC9A 2GJRA 3WNLA 4D6FA 1LUCA 3U8GA 1DL3A 2INZA 5AKQA 4UBPC 4OUIA 4AZ5A 5TBOA 2BHZA 6TIMA 3DEQA 1BGAA 3KVLA 1JI2A 4RZ4A 4DY1A 4HIBA 3Q67A 3QGKC 3SJ3A 1XIJA 4TX6A 1KRMA 1I2QA 3DN5A 2ZFAA 3L2LA 4RE3A 1P6BA 1UH4A 3F5JA 4WF7A 4QM1A 2O4QA 5H2ZA 1R9XA 4PTVA 2YOCA 1ZENA 4CUCA 1RV8A 3DYMA 5IDIA 4I5XA 3B8TA 4IICA 2HEJA 3BJTA 3DG3A 3NCOA 2BVWA 4GABA 3UPWA 4IPNB 4MZ8A 5HDRA 1P0DA 1VBHA 1RLDA 4BCEA 3NURA 3P62A 3HM7A 1F4HA 3K1GA 1I9CB 1NAL1 2ZWZA 4IIFA 3TIMA 1OGBA 2GK1B 4BQ3A 1WAUA 1OFEA 3GXFA 4ADTA 3WX7A 2WC7A 3ARXA 1WZAA 2JFEX 2R1PA 3M5XA 6CGTA 3NFUA 3OHIA 1J0ZA 3NZPA 1BF6A 3LUTA 1EJ7L 2CHNA 5I5RA 1V3JA 2BLEA 1IYXA 1NSJA 4C6EA 3QMRA 3MSRA 3LTPA 2HWGA 3P2VA 4HN4A 4IFKB 4GQRA 3KBSA 4MNJA 1SR9A 3P67A 3BZGA 2NVCA 3PTDA 3KTXA 3SY5A 3T09A 3GBDA 3RMEA 1OHLA 3AHXA 3GUGA 4HHPA 3UETA 1HW6A 1UCWA 4KWSA 1O6IA 1E0VA 1I4NA 5AYIA 4K8HA 4QJ1A 2PI6A 1YX1A 2ZE3A 4ADUA 4ZO7A 2ZICA 4CEUC 2DT2A 3ABXA 3NXFA 2J62A 3H53A 4W7WA 3AU2A 4JN8A 3WLNA 3KAOA 3GZ3A 3RLGA 3OZYA 2QULA 4BS0A 3N17A 1SM9A 3NUKA 3W1MA 3FY1A 4IGMA 3R0KA 3LCFA 3QMSA 1GQKA 3W4RA 4KEMA 4C1NA 4N7QA 3L5MA 2TPSA 4RPQA 4OV9A 4MPKA 4PZVA 1XINA 3H54A 5HUOA 3H12A 2DZPA 1U1JA 2W63A 2VO5A 5D2VA 1D3GA 4D1JA 1GUVA 3KBNA 4FEZA 3PY2A 4XG1A 1G1YA 3B8IA 4DIAA 2X2YA 3NL6A 4H7ZA 3E74A 5FJJA 3GNXA 1VJIA 4DUXA 3CL7A 2QV4A 1JCYA 4ORIA 3WDJA 4G5DA 2YYTA 3HGRA 4ZO6A 4QJ5B 4XO6A 2EXOA 2B7NA 3GG8A 3LX9A 4MYXA 4TUFA 1F73A 1U83A 3T40A 3C52A 3SAZA 1AW5A 2HISA 4IXHA 4QROA 2C1HA 3CV7A 5EFFA 4KRUA 1VFSA 3WJZA 1Q8JA 4GX9A 1ZHAA 1TJRA 3W72A 1FA2A 5C2GA 5C9RA 4GKTA 4H7VA 3KS6A 4R9XA 4KCUA 2A7NA 1UA3A 3WD2A 4HSOA 2X09A 4QIUA 4UTTC 1XLGA 1QHZA 1RVKA 1J0JA 3FN9A 3MBFA 3BMVA 4K39A 4GYFA 1P5BA 3V16A 3M7SA 4BR1A 2J79A 4DX3A 3S2CA 1KGUA 4R3UA 3DENA 2Q02A 1N82A 2Z25A 3PNUA 3QFEA 3PG9A 2QKFA 1HJSA 4QR6A 4C6QA 5I3DA 1MW2A 5K9DA 3QZ6A 1FHDA 5FJUA 4DUOA 1H63A 3VNZA 4Z17A 1J0KA 2NXIA 2VHLA 1TB3A 1WCGA 3UXDA 4DM2A 1QK0A 1S5WA 1XIDA 1EEPA 1THFD 2R6OA 4BF5A 4Z1DA 3W7EA 3GHSA 2VRKA 3GBEA 4GXPA 1GVFA 3LA4A 3AXIA 1XC4A 2XVLA 1WKFA 4GFIA 4W87A 3MU7A 4HOXA 4NNAA 1A47A 1EDQA 2W3ZA 2ZUSA 1KBBA 2YFOA 1CTNA 1I45A 3QPYA 2C1GA 4F40A 2R24A 4H9YA 4DBSA 1ESWA 4NJHA 4XX6A 2AGKA 1XG3A 2IPFA 1XIFA 5AC7A 1UMLA 1AD4A 3L67A 1H0GA 1AMKA 1VRXA 3SCOA 2FFCA 2CEQA 5AHMA 3V75A 4QCEA 3I68A 3FEMA 1JDDA 3BC9A 1V77A 3HPSA 2OX1A 5EKYA 2ZXBA 3GO2A 3QGVA 4O19A 1AQFA 2PLMA 3L5AA 3N1AA 1HKKA 2XN2A 4M1BA 1I75A 2BZNA 3OQ8A 1LOSA 3B05A 2YIHA 4LSBA 4ZA0A 8TIMA 3VE7A 2V67A 3UU0A 1OWQA 3EKLA 3W7JA 2QCGA 1P0EA 4FIQA 1PXGA 3LMYA 5LIXX 4W8AA 3KRZA 3EMQA 5DANA 1CPUA 5C6MA 4NI3A 3BE7A 4GZ7A 1D3CA 4RJEA 3W7DA 1TA3A 2F84A 3IJIA 3DU0A 1VYRA 2JF7A 2CBUA 3QW4B 3DFYA 1Z44A 1I8JA 2Y70A 1O60A 4G7EB 3VGBA 5FF7A 3H2FA 2J7GA 4PMVA 3AIVA 3CHDA 1LRTA 3UY8A 1NDWA 4D6DA 4HA3A 1CGXA 4YHEA 3KLLA 4IUOA 5A2AA 3EMZA 1EJVC 3WQWA 4GIEA 4ALDA 3CMFA 2ZTKA 1OADA 4G8TA 1VEMA 5FEWA 3N2BA 4O12A 3QEZA 4YXGA 1QCWA 3ARSA 5AYBA 4ZODA 3WMLA 2DGAA 4MWAD 1E5NA 2QUVA 3NQ8A 2F6UA 3MV01 1OG6A 3JZEA 4JKLA 1F61A 4PL1A 2X16A 5HNNA 3VK5A 3URAA 3U3HA 2CKRA 3LRMA 3DX5A 1E6RA 4I9AA 4WSKA 4D6HA 4JYEA 1KKOA 2VUNA 3L68A 1R3YA 1RA5A 4RPPA 4ZFCA 4V15A 3SR7A 2PF8A 1ZJAA 4DBWA 1HUVA 5IFPA 2BVYA 2ZX6A 2A3HA 4H1ZA 2Z26A 3BH4A 5G2IA 3GG7A 3T07A 4DXVA 4A4AA 3H4WA 3SGZA 1HO4A 1TR1A 4DBDA 1BSLA 3CB8A 1JDCA 1SO3A 5EA9A 1TUFA 5D33A 1KM6A 3G1VA 3LXBA 4Q4RA 1KFLA 3N2OA 1XIBA 3N2CA 1GG0A 4JGDA 3PWAA 3DI1A 3MCOA 3TFCA 1R47A 3GH7A 1CT5A 1JCXA 2X0SA 3CQ0A 4X2PA 1OYAA 4RNFA 4XAPA 4XSMA 2R1KA 3MPGA 4UMBA 3U2CA 2GK1A 1VPQA 4CVUA 3WMCA 2HXUA 3T44A 1ZGDA 3ZFHA 3EPMA 3WD0A 4UMCA 2W4XA 1GNXA 2XH2A 2Y89A 4AD1A 3VOFA 4IMEA 2AAAA 3BL3A 3M07A 2P76A 4ZTYA 2YDAA 5CBIA 1KTCA 4NZCA 5KINA 4PODA 5EGRA 2R94A 5FF0A 4US5D 1W6TA 4M5PA 3O0KA 2OEJA 1B31A 3NQCA 3DFTA 1L6FA 1K8CA 1E0TA 4FK9A 4GX8A 4QNWA 3A21A 3LGEA 2ATSA 3W2MA 4ASTA 2XGZA 4OJYA 4ILSA 5GVJA 3B0XA 4US6A 1X39A 4WX2A 2FHCA 1P0NA 4I9MA 5E1QA 1ZZMA 4FF5A 5D2TA 2EPOA 5HINA 1JIBA 4WGXA 2Z1KA 2IUZA 5CEWA 3W74A 4HA0A 1BPLB 4WK9A 4XK2A 3UYIA 3SW6A 2X42A 3CQHA 1ZLPA 2C0AA 4IIEA 4MLJA 3ZLGA 3TQVA 3DGRA 2D22A 1SSGA 5J8LA 1IXNA 4IMAA 1RBAA 4BKNA 4AEEA 2NXGA 2XIIA 4KWWA 1TTIA 4ONVA 3WSUA 1JZ4A 1ZBKA 1GZ1A 3KUMA 3CUJA 3MHUA 1A5OC 1N55A 4O50A 1PKYA 1EGMA 4XO7A 3NG3A 4OECA 1ADOA 4B3KA 3M1ZA 2V68A 1UROA 1BD0A 1F6PA 2X30A 4H6QA 4IWWA 5LKYA 4GQQA 5DY3A 2HE8A 1IGSA 2CLIA 3G22A 5F2GA 3N18A 3GRIA 4XAGA 4UTIA 1V6WA 1KKRA 3SUVA 4YJ5A 2PRMA 1PZ1A 2E9BA 3WQPA 3HOJA 2GLKA 2YL5A 5ABEA 4PCFA 4QP0A 3A9IA 2WCSA 3ME3A 3FV9A 2FPTA 3PANA 4HU0A 1JG9A 5K9CA 4J28A 1XBVA 2WMFA 4QX4A 3VFLA 4E3VA 1OX5A 1R5YA 1RQEA 4QTGA 4AVFA 4PUWA 3GDLA 5DFAA 4NAEB 3LHWA 3BLKA 3MVTA 3W1LA 1RPXA 4DVOA 1VIWA 2VELA 1AVAA 1Q13A 3B0UX 3WEZA 1LQ0A 5I0DA 3R4IA 1HJXA 1SGJA 6XIMA 4JKMA 2RDWA 3VA8A 2DIEA 1EGZA 4GGBA 3GKFA 2QXWA 4IX0A 4GH3A 2HQAA 2OB3A 3D6NA 5AC4A 1C8QA 4KS0A 2YL6A 2RGMA 4EAMA 4FXSA 1WE5A 4ZQRA 4DZHA 2BXVA 3MUY1 4IT1A 4HTYA 2J7EA 5AHLA 1S5NA 4J3SA 4PFHA 4DO5A 2A0NA 3W71A 4GY1A 3OLDA 4QRNA 4FAMA 1ME8A 1RLCL 2VCAA 3CC1A 1RY0A 1FWRA 4E2DA 4U4MA 2G3IA 2W67A 1MEIA 3U5YA 1E40A 2OSXA 5LXEA 3EDEA 4JIHA 4TVDA 2VZUA 4RE4A 4BZYA 1JF5A 4GI4A 2OODA 3NL5A 4FX8A 1SYTA 3RU8X 2ZZ4A 2Y5SA 3CUZA 1EP3A 2HPMA 1DHPA 3KS5A 4ICCX 4LVFA 4FXJA 1JCMP 4IGNA 5I79A 2EPNA 4DXXA 3KL3A 1DEDA 3M0ZA 4LY4A 4P7LA 3BAIA 4PMNA 3AIRA 3U57A 4PUDA 2PDUA 1UD8A 3IAPA 3POCA 5CAHA 3ZXWA 4PYSA 3NR0A 2WJZA 2DW7A 1W9XA 1F6KA 4NYYA 1Z69A 1IR1A 4GI8A 2J25A 1NY1A 5TAOA 4XVEA 2DJXA 3BTNA 1XFBA 3OIXA 4H04A 1XLCA 4AB4A 3WLOA 1QI3A 3EWWA 3N4EA 2OYMA 1PKMA 3NM1A 5TNVA 4BWLC 1RXOB 3QPEA 3P80A 5GJNA 2H9AA 3ZSTA 1UJQA 1VBRA 1XYAA 4QG8A 3L7RA 3MCNA 3UQNA 1TV8A 1GQNA 5KZ6A 4E6MA 5D4YA 1YNYA 4EKJA 4JNZA 4LFYA 2UY2A 2GDQA 1RALA 3TYBA 4LW7A 4CNPA 3WK3A 3E0FA 2G3JA 2VD9A 1RJQA 4FO4A 1GW1A 3P7YA 1FWEC 2ICSA 3W23A 1NOWA 4LQ1A 1FWWA 3UESA 1HJVA 4KCTA 3TQ0A 4F66A 3G0SA 3AYVA 5A6JA 1UP0A 2D69A 3WH6A 4DN1A 2VX5A 3HV8A 3QV7A 3TE9A 1Q65A 2XIJA 1HKIA 2XUCA 5LIWX 2FGLA 4LAMA 4D72A 3ARWA 4M56A 3S0CA 3UERA 1HKVA 3VUSA 1JZ7A 2DPEA 4HVXA 5M3WA 4HYRA 2VYOA 4IQLA 3Q37A 3CUHA 2WWDA 4O18A 4QHRA 1S1RA 4H19A 5HK4A 4F2BA 5AZ1A 5JIWA 3NYZA 3TZFA 1OD8A 3SCWA 2BVDA 4AVNA 3VZZA 3HIJA 3W7NA 1GGOA 2J66A 3ZWTA 1JDAA 1BFNA 3ARYA 1PZ0A 2PTYA 3VX1A 1XLDA 4CQBA 3U2ZA 3O06A 1W3HA 1UH2A 2VZOA 1EB3A 4H7CA 4HMNA 4GO9A 1DWAM 1RAKA 7CGTA 1I0DA 3PBWA 5AVNA 4BEUA 3LM7A 3PZTA 4YWSA 5F2LA 5G1YA 4UR8A 3AISA 1WAWA 2ANUA 1G6CA 3F4CA 3M5YA 5JMUA 1VJSA 1T0OA 4UOJA 4X63A 1DWHM 4LALA 1XUUA 3R12A 3THUA 4W5ZA 3APYA 4H8HA 4KIEA 5CJ5A 2BGNE 4R85A 2I5IA 4ZE4A 3R0DA 2ZQ0A 2QGYA 1DTUA 4JBRA 3VD9A 3O1NA 2HK1A 3H24A 3M41A 4ZB5A 1TMQA 1F07A 4Y90A 4ECLA 2D2GA 1T99A 1V02E 2EG8A 1OSEA 1PIGA 3PS7A 3H7VA 3GC5A 5CG0A 1UR1A 3WQGA 3EB3A 3TH6A 2TSYA 2J7DA 1W2VA 4KGJA 1IEXA 1KFJA 5J5RA 4KQNA 3PBVA 2ZRVA 4BI5A 4H3DA 1F4AA 1XPYA 3VCCA 4AZIA 4AEFA 4UNLA 1P1XA 4X0VA 3CUGA 5I3IA 4O52A 3KTCA 1N7KA 3OBKA 5BCAA 1YPXA 3PTQA 3UJRA 1V93A 5AC5A 3DH7A 5A8GA 5LGXA 4MFEA 3DG6A 2QJJA 4LVBA 5TIMA 1VPXA 2CERA 3QOMA 2B4GA 3CJPA 1KO0A 2V5CA 4U5IA 2J88A 3S2JA 4V1XA 3LBOA 3U4AA 3WJWA 4DELA 1DKWA 2XM2A 4DF0A 2ZOXA 5A6AA 3SECA 1CXEA 2ON3A 4GVHA 1UW9A 3DCPA 1ZP3A 4QSFA 3GXNA 1W37A 2F7FA 1ELSA 1K02A 1QNSA 1SJCA 1GOXA 4BEQA 3QZAA 3NL2A 3L4WA 3VGGA 3A24A 4IM4A 1W9DM 2GVGA 4QG9A 2PDYA 3LERA 3M0KA 4IF2A 3OB8A 4WSJA 3EPNA 4UTJA 4E0CA 5HWMA 4YTQA 4UOZA 3BJFA 3V18A 1E43A 2H9AB 2ZC8A 3XIMA 3WFZA 3R8HA 4JYFA 7TAAA 4Y96A 3P5YA 1KTNA 3UG5A 1QBAA 5D9NA 3MI3A 1D9EA 4RUBA 5FEZA 3FHAA 4DAIA 5XIAA 4MAVA 5D04C 3TOPA 4WXZA 2HBVA 3PPCA 1JPKA 4EPDC 1GT8A 3K8KA 4JCLA 2POZA 1LDCA 2P1FA 5HPOA 3E0LA 3WLSA 1TIWA 2OEMA 1IEWA 4GVFA 3U7VA 2ZA3A 4UFIA 3ZOAA 2IKJA 1NTHA 2V30A 3SJNA 3PB0A 3NOYA 3R58A 2WNQA 4B9ZA 1NVMA 3BG5A 1E6XM 2O4MA 3CPUA 2PF0A 4AHPA 1HP4A 5I6SA 3EEZA 4RZ6A 4JIQA 3H2CA 4D6EA 3FIGA 4V28A 5C7VA 3QFWA 4AY1A <