4A3YA

Crystal structure of raucaffricine glucosidase from ajmaline biosynthesis pathway
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
501
structure length
469
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
molecule keywords RAUCAFFRICINE-O-BETA-D-GLUCOSIDASE
total genus 177
structure length 469
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4a3yA00
4RE2A 3AMDA 1Q6DA 4AD0A 2G3IA 1G9HA 1V0KA 5IFPA 1MW1A 4F79A 3RJXA 4NI3A 4AEFA 1C8XA 2ZX5A 3VDAA 1NWTA 4HA4A 4HPHA 2XWEA 2WVUA 3IAQA 2XJ7A 2QPSA 4H8VA 1QI5A 5EB8A 3WMSA 3TTSA 4AD4A 3W26A 1W1VA 1UR9A 3CUHA 4CCCA 2C7FA 2DT3A 3L4TA 4B3KA 1ISXA 1HJWA 3AZSA 5JBEA 1WZAA 2WVVA 5HBFA 5D4YA 4BA0A 1W1TA 3ZT6A 2Y5EA 1UD8A 1UD3A 2CIPA 3GNOA 5A8OA 1F4HA 3LPGA 3OZPA 3SCSA 5A6SA 1QVBA 4DUWA 5A6BA 3WNNA 4YPJA 1CPUA 2F2HA 3SCTA 1WZMA 2WHLA 1W9DM 3CH9A 3U7BA 5D9OA 4JAWA 1WNOA 3L2MA 1XYFA 5CJ5A 3MS8A 5E6YA 3GNRA 4HTYA 1TE1A 2BHUA 3MUZ1 4V27A 4HOZA 1H2JA 1NWRA 4CKQA 5A6BD 1V3IA 2D22A 4UFJA 1ZBVA 4TVCA 5CGMA 1JDDA 4UFHA 1NARA 4PCTA 3WD1A 4K68A 3CIVA 2VX5A 3CHCA 1DWJM 2O92A 3W27A 1A47A 3EBVA 2W62A 3OG2A 3N18A 4Z2HA 2Y24A 1UWRA 3PTQA 3W38A 1PBGA 2VX6A 3JUGA 4AIOA 3A4WA 1OGBA 2D0HA 4HA3A 2BY3A 2CCRA 5FIPA 1JF6A 1H0GA 2OSYA 3B9DA 3ARVA 3MUIA 1PX3A 4JFWA 1KWGA 5BXRA 2HVMA 1VJZA 3DYOA 4AIEA 3VIIA 2UWFA 2E3ZA 1G0CA 2VO5A 1E6PA 2DPEA 1E4NA 1V3MA 1W3LA 4YN5A 2WMGA 1QOXA 4UCFA 2XVKA 2WMFA 3SURA 1XD0A 3M7SA 1NWUA 2CHNA 4PMRA 3FNDA 4AISA 2ZUUA 2E9BA 1UKPA 1WDRA 3NIYA 5ABHA 3APGA 1EO7A 1PZ2A 4M29A 4UR9A 2D3LA 4J3WA 2Z1KA 3SUWA 1DP0A 1XRVA 3F5JA 2J7DA 5I6SA 1H41A 2WMHA 4MADA 4S3JA 1J18A 2OWWA 3QOKA 2YL6A 3ZO9A 1QHZA 2ZUTA 1ISYA 2YDSA 2W91A 4ZXLA 2DQXA 1EDQA 1E5NA 1FFRA 3SCWA 1MFVA 3SCVA 3UG4A 4D6CA 4EE9A 2WC7A 3AI0A 3THDA 4MNMA 3GBEA 4GQQA 1BGGA 5CXPA 3DC0A 3N11A 5EBAA 3WH9A 2RGLA 3CBWA 4CN4A 1CGYA 3CUGA 2D20A 2NT0A 3VNYA 3L4ZA 2XUCA 3ALGA 4QDMA 1GZJA 3WQ6A 2J25A 4OJYA 1UD4A 2JIWA 1E0VA 4JCLA 4Z2JA 5I2UA 1OGGA 3WMCA 3K4DA 1V6VA 3ZR6A 4XZWA 3AMCA 1BSIA 5HDRA 4X9YA 5A8PA 3CGTA 1LWJA 3AXXA 1X6LA 4WIWA 1PX8A 2BY2A 1E40A 3VMNA 4KRUA 3M6DA 2DSWA 2WB5A 3SUTA 1OD0A 1E55A 1GQLA 1DHKA 1CNVA 4ATLA 2J79A 1EXPA 3AYRA 5EFFA 4CCDA 5BYWA 5HPOA 2MANA 3GXDA 1GPFA 5LYRA 3IJ7A 3POHA 3SUUA 4MNKA 5A6AA 2VZOA 4WLCA 2VUYA 3N04A 1JNDA 4AD2A 1TR1A 2V5CA 2XPKA 2W5FA 5A6JA 1CXIA 1UG6A 2YLLA 3KE0A 1OB0A 2VMFA 2PB1A 1VRXA 2WWDA 3F5KA 3LMYA 2CERA 4WSKA 5A95A 1KCKA 2FGZA 2XYLA 5LA1A 1XC6A 3RPMA 2YIHA 2C8NA 1E73M 4AZCA 4GIAA 1QNOA 2NT1A 3RO8A 1J11A 4AZ5A 1AQHA 4TTUA 4HZ7A 3RIKA 2YKKA 4BQ3A 3VGDA 4C7FA 2WCGA 1MQQA 2CKRA 5CPTA 4D72A 1Q6GA 2YBTA 1E0XA 3AJ7A 2ZXQA 4MNLA 1W9XA 1EOKA 3WEZA 2QHAA 3AZRA 3BC9A 1W3HA 2JF7A 3OB8A 2DIJA 2CKSA 4W84A 1BQCA 3L4VA 4ACZB 8CGTA 1B31A 1XSKA 3AQUA 3B8SA 1HN1A 4D6DA 2X0HA 4HZ6A 1FA2A 2PC8A 3ARSA 1UH4A 1C3FA 3CUIA 4ZENA 3CHDA 4UQDA 1MQRA 1VJSA 2VZSA 3DYPA 3AHTA 1R87A 1JAEA 1MW0A 4W86A 1UWIA 3OLEA 4ACYA 1BTCA 3NCOA 4X0VA 1UD5A 1G5AA 1OCQA 1CXLA 3O6AA 1GUVA 2ZXDA 3ARYA 4AXNA 1UD6A 3OGRA 3UCQA 4M81A 2VZTA 3SIMA 4CVUA 1X1NA 1HJSA 4AC1X 3WQ8A 3II1A 1GCYA 4LX4A 2Y8VA 1J9YA 1LL7A 5HPCA 3RM4A 4EK7A 1WDPA 3WMBA 2A3EA 4UZSA 2VX7A 1WDQA 4AD5A 2CPUA 3E1F1 3GDBA 1JYWA 4CN1A 4U5IA 4J3SA 3U5UA 3W53A 4H7VA 5GNZA 3WDJA 3ARTA 1J0KA 1UKOA 1UH3A 2NW0A 3AIWA 1VEMA 3FHQA 5M3WA 3N13A 1H1NA 1GQJA 1HJXA 1HNYA 2GK1B 2XHYA 1UR2A 3BMWA 4AZCB 4DWSA 3RCNA 1UOKA 3RM8A 1K9EA 3T0BA 1HKIA 2QLYA 3UR7A 1QNQA 5JUVA 2J8GA 1GOOA 4HA1A 1GQKA 3I3EA 1PEZA 2RGMA 5ABFA 3TOPA 3CZKA 2WANA 2DGAA 1HJQA 3WL0A 2BY1A 3G6MA 2CYGA 1C8YA 1RH9A 1GONA 5GPRA 3VUPA 3SCOA 1MXDA 4QFUA 2CNCA 1NP0A 3F4VA 2Y8KA 1E5JA 1UHVA 1EQCA 4MPKA 3A47A 1JDCA 1V02E 2VX4A 5AC5A 2DH2A 3AHZA 3W0KA 1ISZA 2A3HA 4UFIA 1JIBA 1U2YA 4A3HA 2IUZA 5JBDA 3WDIA 4CU7A 6A3HA 3G6LA 1UA3A 1QHOA 3ZJKA 1EOMA 3PBGA 4JL1A 1HJUA 1J0ZA 1R86A 2ZWZA 3GNPA 3WUFA 4AZBA 4Q22A 1CEOA 3ZM8A 1H5VA 1D7FA 4PRWA 1LL4A 1UR0A 4MDOA 4W93A 4JZ5A 2BV9A 2QPUA 2W92A 1UQYA 1LF1A 3M46A 1XCXA 4IUGA 1FH9A 2VCBA 3VIPA 5A8MA 4JFTA 4PMDA 1GHSA 1GW1A 5DF0A 1XYZA 2CBVA 4OOUA 1E6RA 3AMKA 1XCWA 1MFUA 2XM2A 3D5HA 4KGJA 2UY3A 2J78A 4AIUA 4R27A 1WKYA 3BAIA 5E6ZA 3VM7A 1FFQA 3A6OA 2E8ZA 3GYCA 2B31A 3BMVA 3PZGA 3HMCA 3ARZA 2ZX6A 3QOMA 1VIWA 2V3GA 4JKKA 1ZBKA 4KMQA 3NSNA 1V0NA 1E0WA 3AIBA 1E15A 2GUYA 3GH4A 4P7RA 5IFTA 2VI0A 1XH2A 3QGVA 1ZJAA 4GO8A 2X2YA 1J10A 1E56A 1FH8A 5A8NA 4J27A 4AEEA 3WSUA 5DFAA 4M56A 1LJYA 3WDPP 2ZOXA 4F9JA 1BG9A 3AIRA 1X6NA 1C91A 4CD8A 2V3FA 1UWQA 4WKFA 4J7RA 2PWDA 1NM9A 4QP0A 3S2CA 4TX8A 2XFFA 2DIEA 1HIZA 3O2LA 1SYTA 4N0RA 5LA0A 2YL9A 2A3AA 3TONA 2XM1A 1BYCA 4H04A 2J7CA 2X1IA 2OWCA 2G8ZA 1QHPA 3WD4A 3K46A 2JEPA 4UQBA 3VMOA 1E1EA 3FAXA 2WHJA 4JCMA 3BAJA 2G3MA 1E6XM 2JFEX 3QHNA 1DWIM 4MB1A 3CMGA 4NZCA 4CD4A 4D6FA 5KZ6A 3BSHA 1VBUA 2C0HA 3AIUA 5JBFA 5D8ZA 5C8BB 4UFKA 4CU8A 3AIVA 3PZUA 5EFDA 1NQ6A 2Z1SA 2J62A 1BF2A 2ZUMA 3UETA 3UG5A 2FDMA 1E6SM 1JAKA 1UR4A 2EPLX 2WZIA 5ABGA 1I75A 1S46A 4DWSC 1EHNA 4JFSA 4F66A 4Z2IA 3GZAA 3KEHA 4FLOA 4FLRA 5LA2A 2G3JA 2WZHA 1TVNA 2J47A 3EYPA 2UY4A 6TAAA 4TX6A 2G3NA 2AOSA 2W4XA 3AHYA 5CLTA 1SMDA 2YA2A 4LPCA 4CD6A 1J0IA 1QI4A 1KB3A 3CZGA 8A3HA 1PIFA 4DWSB 5D9MA 1UUQA 3MSGA 3VDCA 1B2YA 1XGZA 1WPCA 5E70A 4GI8A 2GDUA 1BLIA 2J7GA 2XVLA 1V3LA 3KL5A 4J3UA 4ATDA 3BLKA 1BYBA 1H0IA 4CU6A 2ZUNA 1HVXA 1W3KA 3IAPA 5CG0A 4AZIA 1VFUA 1JDAA 4A3YA 1UA7A 2A3BA 3MUY1 4ATWA 2O9PA 3POCA 4PTVA 3KL3A 3SCRA 1EO5A 4H8HA 1FH7A 1WCGA 3SEPA 2CEQA 1J01A 3VKKA 1KXQA 3WH6A 1W32A 1V3JA 3WNOA 1XSIA 1GNXA 1VFMA 3OA5A 3CZLA 5IDIA 4UTFA 1WZLA 5DT5A 4H8UA 3IK2A 3VMPA 4MJ2A 1N82A 2EEXA 3AROA 3ZSSA 2ZWYA 2WNWA 2WSPA 1HP5A 4RL3A 1OSEA 2E0PA 2VCCA 4PMUA 3CMJA 4Q7NA 4MB5A 5F7UA 4HMEA 1UWSA 4WKAA 2CBJA 1CDGA 4JHZA 1BPLB 4CN6A 4WK9A 3FN9A 1KGUA 5AC4A 1TA3A 3VIKA 1R8LA 2YL5A 1JYVA 3EDDA 2BS9A 1JXJA 1LLOA 2WMIB 1PAMA 5FL1A 3OLGA 1E3ZA 4OUEA 4IPNB 1WDSA 3VGBA 1BVZA 4Z2KA 2VL4A 5I77A 3PZ9A 2VT0A 5KEZA 1EIBA 2WC3A 3CHFA 3VX0A 3W25A 3PHAA 3LPOA 3VGFA 2ZX8A 5BCAA 3MMUA 4CVWA 2DH3A 2WKGA 4MDPA 2WYSA 1E4IA 5A6MA 4CD5A 3BGAA 1ECEA 3RM9A 4URIA 2D3NA 3DYMA 5M17A 1H49A 1PZ3A 1KBKA 3IJ9A 2J4GA 3RJYA 1ITXA 1CECA 1QI2A 3VVGA 3VPLA 2EXOA 2WZEA 2GJXA 4GINA 2WKLA 2CBUA 2V5DA 1GOIA 1TZ7A 3TA9A 1B30A 3VGHA 1WB0A 3GXMA 3ZQ9A 5FL0A 2JEQA 5JIPA 5I0DA 1ZJBA 3AZTA 1VEPA 1FP9A 2D0FA 3K1DA 1FP8A 1CGWA 3CZEA 3IJ8A 2D23A 2V3DA 3L2LA 1CLVA 1IT0A 3WQWA 4NRRA 5CSUA 4AWEA 3EMZA 5DEZA 2DT0A 3WD2A 4TUFA 5GNXA 5A6KA 4AZHA 1CGVA 2ZUSA 3NSMA 1B3ZA 1JXKA 3AS3A 2ZIDA 1C7SA 3SCNA 3MV01 1OIMA 2E4TA 1UKQA 4TTGA 4P7NA 1J0YA 5FCZA 3OBAA 2YA0A 3VIOA 1L0PA 3WNLA 2EPNA 1PX4A 3T09A 4RE4A 7TAAA 1E6NA 1UKSA 3HU7A 1GOQA 4GPNA 4PBGA 4TVDA 4PTWA 4E8CA 1TCMA 3WF3A 2JALA 3LPFA 2WPGA 1Y7VA 3PTKA 3ZOAA 1GOMA 3VX1A 3WH7A 3T2OA 4M24A 3UEQA 1K6AA 5HNNA 2OSXA 1IZJA 3WDHA 2WK2A 1WE5A 1O6IA 1E4LA 1RP9A 2WAGA 1MQPA 3BH4A 2ZXBA 1TA3B 1V6XA 3A4XA 1ISWA 2WSKA 1WO2A 3BAYA 3GH5A 3O9NA 3MKKA 2YA1A 3SUVA 3WBAA 3BCDA 1JL8A 2E40A 1JZ4A 2QV4A 2UY5A 4DM2A 4E2OA 2ZUVA 3WFLA 4AZ6A 2F61A 5AY7A 1JZ5A 3VIJA 3WENA 1JFXA 4GQRA 2XWDA 2AAAA 4AZGA 3SCQA 4HOXA 2JE8A 2EPKX 4MAVA 1KXHA 2E8YA 1HVQA 3SCUA 1YHTA 4GKLA 2VTFA 2VVNA 1WAWA 2WLZA 3EDJA 4W8BA 3VIFA 3ZT7A 1E72M 3W81A 4AD3A 3PZQA 4MNJA 1QNRA 3THCA 3AMLA 3WH5A 4V2XA 3CHEA 4A4AA 2VNCA 4OOZA 1HKJA 5CPQA 3K8LA 2DSUA 2ZXAA 2XIBA 1R7OA 2QF8A 4P8UA 7CGTA 2J7EA 1B3YA 2XVNA 4W7UA 1ISVA 1BGAA 2YDRA 3VD4A 3KWXA 4U5KA 3WUEA 4ZXOA 1I1WA 2W66A 1VFOA 1P6WA 1UZ1A 1JYXA 2D24A 1E6ZA 1V6WA 4PMVA 2OYLA 4H41A 2VRKA 1JI1A 1BVNP 3KZSA 4ACZA 1E1FA 4J3XA 3ARUA 2PWGA 1UWTA 3CUJA 1W3JA 4C7GA 1ODZA 1CBGA 2VJXA 1W2PA 1UWUA 4H2CA 1ZBWA 1BG4A 1J0JA 3AS0A 2JF6A 1JFHA 2Y4SA 4JL2A 4M1RA 1SMAA 3DHUA 4L4PA 1CZ1A 1DWHM 1W91A 2VRJA 4KWUA 1OIFA 4S3KA 2IXVA 4PTMA 1K9FA 1XD1A 3MMWA 3WUBA 5I78A 1Z32X 4PUDA 2CBIA 4AW7A 4R5EA 2PBGA 2BNJA 3DHPA 1UYQA 2DT1A 4HPGA 1M53A 1QBAA 3WNMA 3VIHA 1GVIA 3FAWA 1J0HA 3WDQA 3NSXA 1CXHA 3A4AA 5A6LA 1JZ7A 3NDZA 3GXIA 2GDVA 1VF8A 3WD3A 2EQDA 5M5DA 4ZE5A 3CPUA 1ZU8A 4D1IA 4OZOA 3L4XA 1HL8A 3UR8A 1M01A 9CGTA 3CUFA 3L4WA 3WL1A 4X0NA 3TTOA 5CZKA 3N12A 4PMNA 1BYDA 5BRQA 2A3CA 4OKDA 3WN6A 3ZJ6A 3RDKA 1Q6CA 1WZKA 4PEEA 4Z2LA 3AFBA 2WBKA 3GBDA 3ALFA 2J7BA 2PWFA 3OLIA 3UESA 2WC4A 1M04A 5EMYA 4W85A 1EA9C 2GVYA 1NWSA 2PI6A 1OT2A 5A2AA 1XH0A 1EDGA 3W24A 4JIEA 5I3DA 2YBUA 3VIGA 3VD7A 1W9UA 2W63A 2Q8XA 3GM8A 1E4MM 3WF0A 2XVPA 4FLSA 4KRTA 3N17A 1W2VA 3WEOA 4EANA 3MUAA 1BHGA 4XUYA 1UD2A 1C92A 1OD8A 2VCAA 3CO4A 4F9DA 2O9RA 3FW6A 3CZJA 1NP2A 3GXFA 5DT7A 1OGSA 1G94A 3OGSA 2DSVA 3VGGA 4IISA 4DWSD 2EO7A 2BXYA 3ZJ8A 2VOTA 2OWXA 1KWKA 1V03A 1NOFA 4PTXA 1OINA 1EH9A 4HMDA 4C7DA 2GJPA 1US3A 1TVPA 3VTRA 3K8MA 3PZTA 4JKMA 1KXVA 4AZ7A 4PMQA 3PZNA 1HX0A 3ZMRA 3DECA 1TUXA 5BXPA 2G41A 3B9AA 1OWQA 1H09A 4DM1A 5CQ1A 2GJRA 1HXJA 1Q6FA 4ML4A 2X09A 3PTMA 2W61A 3RMEA 5FD0A 1OM0A 1V3HA 4BS0A 4W8LA 2J7HA 4OBRA 2XIIA 3UERA 1PPIA 3W6LA 4AYSA 1QPKA 3MANA 2CXGA 2UY2A 5E9AA 4PMXA 2VRQA 3ARXA 4LYPA 3GH7A 1Q6EA 4GZIA 4YHGA 1Q4NX 3U7VA 1VAHA 4F8XA 3BAXA 1GVYA 4GO9A 2BHYA 1GORA 1XV8A 3TTQA 2WVTA 5D9NA 5HOSA 3K8KA 1MWOA 3WNKA 5CSYA 4MJ4A 1NOUA 3B9EA 2YLAA 1C8QA 2OLHA 5HXMA 4LYRA 4KH2A 1CWYA 3F5LA 2F8QA 4UQEA 1A3HA 3HJEA 4HU8A 1JG9A 1K9TA 1CGXA 1E43A 1V6UA 4UQAA 1KXTA 3VGEA 3IANA 3BLPX 5BXTA 1CGTA 5BXSA 3N15A 2XSBA 3T2QA 2BFGA 5TD4A 3ZIZA 3WIJA 4W5ZA 4GI9A 1KR1A 4QCEA 3VD9A 2V3EA 2J75A 3AXHA 1UR8A 1H4PA 1LQ0A 1L8NA 3WKZA 4M82A 1EHAA 1HJVA 1GJUA 4P8WA 1I1XA 5C71A 1KBBA 2WVVB 2PWHA 4XV0A 3T0DA 1MYRA 3AHVA 1V02A 2YDQA 4P8VA 3K4AA 1KQZA 1QNPA 3AOFA 5BWFA 1HKMA 1QW9A 2YOCA 3VOCA 3CZ8A 1GQIA 4TOQA 2ZE0A 1MVYA 4B16A 1U33A 2YJQA 2XG9A 4LQ1A 1VFFA 1DTUA 3VDHA 4UOZA 1B3XA 5IHSA 3SUSA 3W4RA 4Y7EA 4J28A 1M03A 5GQBA 1V3KA 4QLKA 3TTYA 4D6HA 1SFSA 4HZ8A 4CCEA 1KFWA 1RPKA 1QI0A 3WQ5A 5IHRA 3T0AA 1E70M 4TXEA 3RILA 1WP6A 1U30A 3VD5A 1AMYA 1C93A 4ZFMA 5DO8A 4U2YA 2CETA 3GTNA 2VURA 4HOWA 2FHBA 1NH6A 3WF4A 3VNZA 1HL9A 2WHKA 1EDTA 3S6TA 1JZ3A 5BROA 5DMYA 5IXEA 2XGIA 4IPLA 4U3CA 2BY0A 1K9DA 4ZE4A 4OIFA 4WSJA 1NOWA 4YHEA 1AVAA 1FHDA 2X05A 2WVSA 4FK9A 3LPPA 5CGTA 3VDBA 1R85A 5BRPA 3HN3A 2FGLA 1FOBA 1M7XA 4NF7A 1VB9A 2J77A 3CTTA 2FHCA 3CLWA 2NSXA 1JYNA 3ECQA 2XTKA 3EMCA 3WELA 1W9BM 1RP8A 1MW3A 4U3AA 4EAMA 4LXFA 1LG2A 1B3WA 1KGXA 4W8AA 2EPMX 1H3GA 3VILA 4P7LA 2J7FA 5I79A 4B9ZA 2VR5A 1XHGA 2CITA 3ARQA 4HU0A 1CXEA 5A2BA 2WXDM 1W1YA 1RD6A 1OBAA 1DWAM 2BHZA 4M8UA 1W9PA 5A69A 2WWCA 3NDYA 3UG3A 2TAAA 3W6MA 2WBGA 2Y2WA 1UKTA 3U5YA 3WEMA 3NUKA 1US2A 6CGTA 1HP4A 1JD9A 3ARPA 2DSZA 4UFMA 3AHXA 3FXYA 5ECUA 4PMZA 3BAKA 3PN8A 1FHLA 1UQZA 5ABFB 4GZEA 4EKJA 3AS2A 1GOKA 3WF2A 5A1AA 1DWFM 4U2ZA 1CIUA 4GZJA 2VVSA 5M03A 2J74A 5AYIA 2XFRA 4FF5A 2WMKA 4JKLA 5I24A 4FLQA 3WH8A 4PYSA 1G01A 4WKHA 3W28A 1AQMA 2EPOA 4XX6A 3MSDA 4PUEA 4UNIA 4GI6A 4MAZA 1CGUA 3ZJ7A 4BQ4A 3WFZA 1JF5A 4PCSA 2WMIA 3WD0A 4AY1A 3L4UA 1VENA 3I3BA 4P8XA 5A8QA 1LG1A 5D8WA 2DT2A 5E09A 1JD7A 2VZUA 3ZT5A 5I5RA 2PF0A 3T08A 3VU2A 4E4PA 2X0YA 4RE3A 1TFVA 3PZVA 2GSJA 3MV11 4QAWA 4Z2GA 2V38A 1LWHA 1UH2A 4JFUA 5C70A 4B15A 1UR1A 4PMOA 1HKKA 3OIHA 2WLYA 2ZX9A 3WQVA 2ZX7A 3ARWA 3PZMA 2EJ1A 2D1ZA 1QNSA 2HISA 5A94A 4MB4A 2IXUA 4HMCA 2E9LA 4D6JA 5D9PA 4D71A 1JI2A 2D0GA 3FHAA 4BF7A 3QHMA 4P7QA 2FH8A 4V28A 3BAWA 1HT6A 2OYMA 1PIGA 1BFNA 4J3VA 1E3XA 1CXFA 3NYDA 5FOOA 4FMVA 4UQ9A 1E9LA 1W9VA 1VBRA 2BVDA 3VM5A 4OBSA 4D1JA 1B3VA 2WM0A 1R7AA 4J3TA 4XZBA 3EDKA 2EBNA 1EGZA 3TP4A 3ZR5A 1C90A 1HF6A 2O9OA 5E0CA 2XGBA 4AMCA 1C7TA 2XVGA 4UQCA 1D2KA 1SR0A 3A3HA 1JZ6A 4U33A 4LYQA 1BAGA 4B3LA 4PN2A 1DWGM 3KL0A 4XB3A 4W87A 1UZ4A 1AQ0A 4DUXA 4BQ5A 2DEPA 4UZUA 1G1YA 4E8DA 3WBEA 2WCAA 2VQTA 3NJ3A 4W89A 2GJXB 4BCEA 1KQYA 1ZS2A 5A3HA 3FY1A 5GNYA 2X8RA 3WUGA 3AMGA 1QW8A 1V0MA 4D6IA 2OSWA 3AISA 4QLJA 4WF7A 2XSAA 2DSKA 4WJXA 1MXGA 4PMYA 1IZKA 5CLWA 4NRSA 1CYGA 2QMKA 4BQ2A 1JZ8A 4JFVA 4UOJA 3W29A 3W37A 2J8FA 1D3CA 3BXWA 2FHFA 4UOQA 1GJWA 2ESCA 2ZUWA 5E0FA 3PZOA 2O9TA 2WW5A 1B0IA 5JIWA 4W7VA 1ESWA 5CPSA 1BYAA 3D3AA 3AS1A 4TVUA 1F4AA 1J12A 3OGVA 3MU7A 1QBBA 3AIEA 3N9KA 1V0LA 4IM4A 1JGIA 2JIEA 3EDFA 5AYBA 2VQUA 1VEOA 2ZICA 5ABEA 1B1YA 7A3HA 4QLLA 4CD7A 2PBOA 1PJ9A 2GK1A 3J7HA 1KR0A 4AD1A 1B90A 2BVYA 3VINA 3WQ4A 4LGXA 3AYSA 1ZBCA 1E71M 3EDEA 3WDRA 3M07A 1CXKA 2WCSA 4DUVA 3L4YA 1H11A 1CTNA 4U31A 4P7OA 3AICA 4BZYA 2AMGA 1EQPA 3VD3A 2E9MA 3SCPA 4UFLA 4MTVA 1TMQA 1ZB5A 3WNPA 4QCFA 4D6EA 1XH1A 2FH6A 3ARRA 3QHOA 2CESA 4M80A 3VO0A 4GXPA 1OT1A 2YL8A 1JZ2A 3OZOA 1B9ZA 1MW2A 3T2PA 4ZEPA 4NSBA 1LL6A 4CUCA 5I23A 4L4OA 1CENA 2VC9A 2QMJA 4N42A 3OLDA 4PSRA 2BVTA 2DDXA 3AXIA 4CGTA 2VZVA 2D2OA 2G4FA 3U57A 1GHRA 4KGLA 1IV8A 1ODUA 1E6QM 1GOWA 2WMJA 3EMQA 2W67A 4PSPA 3WF1A 2CHOA 3PZIA 1KCLA 4JHOA 4MB3A 3W82A 4W7WA 2PWEA 3QR3A 1XSJA 2BXZA 1ITCA 2VR4A 1W1PA 3ZSTA 2OYKA 2XFYA 1JNEA 3I3DA 3N1AA 1QI3A 4D6GA 5A2CA 1ZL1A 2WHMA 4W88A 1YQ2A 3MO4A 3WY1A 4W5UA 1DEDA 3VIMA 4B9YA 3BSGA 1V08A 2GFTA 3BCFA 1O7AA 4HP5A 1KGWA 5FKYA 3AIQA 1TG7A 3MMDA 1V6YA 1CLXA
chains in the Genus database with same CATH superfamily
3ITXA 3BLEA 3C3NA 3O8AA 1VLWA 1AD1A 4AD0A 1G9HA 3N4EA 3IEBA 2QCHA 3VDAA 3LLFA 3QGKC 1TWSA 4HPHA 1P7TA 3KBNA 2YX0A 2WVUA 3IAQA 2QDDA 2QPSA 4H8VA 2J6VA 5CC7A 1NDVA 4PA8A 3H21A 3ITYA 3WLSA 1IEWA 3CUHA 3TEVA 2GQ8A 1W5QA 3TMLA 3SQMA 3B0UX 2C7FA 1OX5A 3L4TA 3NQDA 1Y65A 2SFPA 1WZAA 1PWLA 1W1TA 4PTNA 4MJZA 1OX6A 2OZ0A 4CNNA 2CIPA 5A8OA 5DLCA 1VRDA 3PB2A 4H01A 4DUWA 2ACSA 4YPJA 1EJUC 2OU4A 1CPUA 2F2HA 3VNLA 5EL1A 3BV4A 3B4YA 2J9XA 2QDHA 1WNOA 1XYFA 5CJ5A 3GNRA 2BHUA 4HOZA 1WUFA 4Q8UA 2BVWA 4FP1A 5A6BD 3V4BA 3R5EA 2VEMA 1ZBVA 1JDDA 2FZDA 3UWYA 4FX6M 4PE8A 4K68A 3NVDA 3S2LA 2VX5A 3CHCA 3W27A 4E4FA 3EBVA 2W62A 1DE5A 2VGFA 4LJ3A 4Z2HA 1IT8A 3HPXA 4DQWA 5D09A 3EEGA 1YDVA 5K9XA 4H9XA 1OK6A 2Q8ZA 3QKEA 4HA3A 1U1UA 2BY3A 3OYXA 1X8FA 1H0GA 4FXFA 3KRBA 3UCDA 1I45A 4ZOCA 2GUUA 3APTA 4M1BA 1PX3A 4JFWA 3PSWA 2HVMA 1XQKA 1VJZA 3DYOA 1IEXA 2Q09A 1QRQA 1XKJA 3NPXA 1SFJA 1W3LA 3KP1A 1YPIA 1IR1A 2YW3A 4UCFA 3ISIX 1XD0A 3M7SA 3DG3A 1NWUA 3C6CA 2CWNA 2VP8A 3FNDA 2E9BA 1UKPA 1WDRA 3NIYA 2IW0A 3N73A 4M29A 4J3WA 4C6JA 3G1SA 1XRVA 3W7MA 5CZ0A 3F5JA 2HPMA 2ZZ3A 2DY3A 2AL1A 2BLEA 3MDWA 2Z26A 2Y7GA 4S3JA 4JTAA 2X0SA 2FFIA 2YL6A 2PAJA 2Z4GA 1HGYA 1ISYA 1IGSA 7XIMA 5C2CA 3CASA 1E5NA 4O15A 3M0ZA 2XZ7A 2FIQA 4F0LA 3APYA 3E5BA 4EE9A 5DMNA 1X6UA 1KLZA 3NO5A 3EWDA 4FOUA 3B8WA 3UD6A 2Q6ZA 3QZAA 2P5NA 2QF7A 1YYAA 1J5SA 5HR6A 5L9FA 2FPYA 3KW3A 3N11A 2HE5A 3W86A 3KTCA 1BF6A 4XQ6A 4CN4A 3EWXA 4QDMA 3LK6A 4OJYA 1E0VA 2PDCA 4DPQA 3UR2A 1X7FA 3EOLA 1DL3A 3ZR6A 1FKXA 1M65A 4XZWA 3AMCA 4GUJA 1EFZA 3N2MA 3ANUA 1M9HA 2QXWA 3EX6A 1LWJA 3WQCA 1S1PA 2E6AA 2OZ8A 4WIWA 2A6NA 4MZ8A 4O0ZA 1GW9A 3VMNA 3GWQA 4KRUA 2BXVA 2V68A 2PMQA 1G67A 5FJIA 3SUTA 1OD0A 1GQLA 1XDLA 4OV9A 1R46A 4ATLA 2J79A 4DWDA 1K8ZA 1I2OA 2MANA 4JIQA 4FA3A 3NQ2A 4MYXA 3SUUA 4MNKA 3M0HA 5A6AA 4IZGA 4TV6A 4WLCA 3N04A 4QQ3A 4AD2A 3QKZA 2CC0A 1KBJA 2YLLA 1JQVA 4FIQA 1A5NC 4EF9A 1AW5A 4A22A 3OBKA 3RMJA 4R88A 4QG9A 4RNHA 2VEGA 1GVOA 5D2VA 4A3QA 4M0XA 3RN6A 1FDJA 2YIHA 2Z2BA 5FESA 1TJ1A 2NT1A 3S1WA 3ZYZA 4E2VA 3Q58A 4AZ5A 1AQHA 3QSRA 4LUTA 4TTUA 4PL1A 3RIKA 4LB4A 3VGDA 4C7FA 2WCGA 1R2RA 1UMYA 4S3DA 1NJJA 4D72A 1Q6GA 3M5ZA 2YBTA 3E2QA 3AJ7A 2HMCA 1EOKA 1AW1A 1W3HA 1Z42A 4PFMA 2XH0A 2CKSA 2HBXA 2F2KA 1XSKA 2OXNA 2CLKA 2PU0A 1HN1A 4QIUA 4OFCA 1C3FA 4ZQPA 3LX9A 3EWZA 1MQRA 3MHFA 3P3BA 4GYJA 3DYPA 3B8DA 3E2SA 5LXXA 4JTCA 3MCNA 3M1ZA 1XGEA 1JAEA 2XZ9A 4DBUA 1SJCA 3U6WA 3STGA 4X0VA 1FUYA 1TWDA 3B8TA 5CC6A 3UCQA 4M81A 4DJFC 4P2VA 4N9BA 3II1A 5G1YA 1YKWA 2A2IA 2Y8VA 3GC5A 3TAKA 3F2DA 1P4CA 1Q6OA 4EK7A 1WDPA 7REQB 3FVDA 1T40A 4H4IA 3STCA 4ES4A 4U4MA 1PIIA 4HT3A 1DHPA 4RZ4A 5GNZA 3GTXA 5T8GA 3ARTA 1Z3NA 2NW0A 1SZFA 4IIHA 4AWUA 1S2VA 3DXIA 2PA6A 2OX1A 1JVNA 5M3WA 3G1XA 3N13A 4YYCA 1GQJA 2V81A 1O4UA 4ZOEA 2GK1B 2XHYA 3ATYA 1UR2A 4FNQA 1XLKA 3BGJA 1AH3A 3PPGA 5DY3A 5T9CE 1DJYA 2VM8A 1OY0A 2VFFA 2AL2B 3THQA 4L6DA 4PUWA 2J8GA 4L5ZA 4OTKA 3I3EA 3V18A 3M64A 3TOPA 5J5RA 4X63A 1PKLA 3WL0A 1P43A 1C8YA 4IP4A 4Y6GA 3G3DA 3G18A 3LGGA 5K7JA 3TCEA 3VC6A 1KRMA 4QFUA 4XD5A 3GR4A 2Y8KA 1E5JA 1UHVA 1KO0A 4I6VA 5B7ZA 1N55A 1V02E 3BJSA 3AHZA 4Y96A 3GG7A 1PUDA 3VOJA 1JIBA 5LNUA 4PH6A 2IPJA 4CU7A 2BDQA 3G6LA 2V2DA 4JL1A 5CZSA 1HJUA 3NQMA 4B92A 3UYIA 3GXTA 2RKXA 1D7FA 4RZBA 4DO4A 4JDYA 2QVNA 1O60A 1FH9A 5C0QA 2HRWA 2BBFA 1O12A 5FF4A 5A8MA 4JFTA 5DF0A 1XP3A 4HA0A 2CBVA 1S5WA 1XC4A 3D5HA 4KGJA 2P88A 2UY3A 3WLIA 5F1VA 4AIUA 4R27A 4ZVJA 1WKYA 3BAIA 4LRTA 5E6ZA 3C2EA 4DBWA 4EXQA 1FWTA 2J9ZA 3KOYA 4NZ4A 1QOPA 3HMCA 4UTHA 4V1YA 3NDOA 1MEHA 1S2TA 4JKKA 4YCOA 4KMQA 3WQPA 1T8QA 3LDVA 4OT7A 3L66A 3ZVIA 1LOQA 4UTKA 4ONVA 3I4EA 1E56A 3CWOX 3VCRA 3H2MA 3O63A 3LHYA 1XRFA 4QE4A 1PKYA 4M56A 4U28A 3WLMA 4HD5A 2DUXA 4CD8A 1KCZA 3C0QA 2V3FA 3CV6A 4HHLA 4G56A 4HQVA 3L21A 4TV5A 4QP0A 1NM9A 5IBXA 4TX8A 1RQBA 3PB0A 4N0RA 2W79A 1ONEA 1XICA 4PCPA 3HPAA 2G8ZA 2Q8LA 1E9ZB 2REQA 1BRLA 4F3HA 4L9ZA 1YXDA 4EACA 2JFEX 4MB1A 1UWAA 1ADSA 1XLBA 5HMDA 3OYZA 4ECLA 3PUDA 2XU2A 4BK9A 3SO7A 2C0HA 3AIUA 1EWEA 3V0UA 1O68A 1QPNA 2Y6ZA 1FXPA 4PL2A 4IP7A 4GE8A 5CZJA 5EFDA 4IFKB 2Z1SA 3WG6A 1BF2A 4ZQCA 3UETA 3L0GA 3UG5A 2FDMA 2VYOA 1E6SM 4HNUA 1UR4A 1K03A 3VZZA 3H7VA 1S46A 4Z1DA 4F66A 3P5ZA 3GZAA 3KEHA 4LW7A 4FLOA 4FLRA 1TVNA 2J47A 4QDWA 1B5TA 4NY2A 2AOSA 1TTQA 1W8SA 1AL7A 3WBWA 4CD6A 5XIAA 3CZGA 8A3HA 1PIFA 5D9MA 3A3XA 1XGZA 2O4MA 2GDUA 3KCLA 1NDYA 1CB2A 5G4WA 2XVLA 3MYPA 4JPGA 5DCDA 3BZJA 5HINA 4FXSA 4J3UA 1E0TA 2ZZ6A 4ATDA 5HATA 4BY3A 1W3KA 4NAFB 2YSWA 4HJFA 4ATWA 2QZRA 3POCA 4O1BA 2JKAA 4FNUA 3NGJA 3KL3A 3SCRA 3KWSA 4J9JA 3G0SA 3C0JA 1VCGA 3EX3A 1KXQA 1W32A 2EJAA 1YBQA 1XSIA 2PCQA 1GNXA 2VEIA 1IWAA 3GDLA 4UTFA 5DT5A 4H8UA 2Q71A 3IARA 3IJDA 1UC4A 1N82A 1ME8A 1PKMA 3SW6A 2ZWYA 2F6KA 3NZ1A 4A21A 3UW6A 4JQ2A 3G2GA 1ZTVA 4WHBA 4ICMA 1HP5A 1HG3A 3TFXA 2E0PA 3SQLA 1EYEA 1FHVA 4MB5A 4A8LA 2J6XA 3OHIA 4WKAA 2H3DA 2CBJA 1CDGA 2YXGA 4GBUA 5CSRA 4F0HA 4DNHA 1KGUA 3VIKA 3W7HA 4Q8NA 4GY0A 2HCVA 4OWGA 1JXJA 3QLDA 1EX1A 2WMIB 4KEZA 4L9YA 2I7GA 1E3ZA 4WDUA 3EWWA 3GXPA 3MSYA 1TV4A 3OVRA 2OQHA 1BVZA 3GTHA 4Q8QA 5I77A 3LI1A 5KEZA 3CHFA 1I2PA 2NV9A 3VX0A 3SFKA 2BZNA 1IWBA 3VGFA 1TV3A 4CLMA 1I8JA 2WKGA 4XZMX 3B0YA 5A6MA 2BX7A 1ECEA 3ABOA 4URIA 2GVJA 4NNAA 4S39A 4C60A 2HWGA 1PZ3A 4A35A 2J4GA 2XH2A 5IOBA 3RJYA 1ITXA 1DJNA 1CECA 5AHFA 4IXHA 1MUCA 3O07A 3VPLA 2GJXA 2QCCA 4AH7A 3GQYA 1WXJA 2PRHA 4LS1A 3VGHA 2ACQA 3H12A 1VBGA 1J93A 2EGZA 2JEQA 3U2CA 1GG1A 1ZJBA 1VEPA 1FP9A 4IL2A 3S1UA 4GD0A 3K1DA 3CZEA 3IJ8A 1CLVA 4Q8MA 1KM3A 5I07A 4NRRA 5CSUA 4AWEA 5DEZA 4H9ZA 4XVDA 2DT0A 3M0LA 3WD2A 5GNXA 4FOJA 1CGVA 1JUBA 1QXLA 1XLIA 1A0CA 1JXKA 4S1FA 3MV01 4TTGA 3LCHA 2YA0A 3WNLA 3U0HA 2V6AA 2WNZA 1UKSA 2OO0A 1GOQA 4GPNA 4PBGA 4E8CA 1EPVA 3HPZA 2OGYA 1KV8A 2FDSA 3S9IA 3WH7A 4Q4MA 1P6BA 1OCNA 1K6AA 5HNNA 1IZJA 3WDHA 2WK2A 4IQDA 4LAKA 4H7CA 3N4AA 3BH4A 4GQ0A 2FB3A 1JPKA 3IV3A 1WO2A 1WDWA 3H2EA 4Y9PA 2QJJA 3GH5A 3M43A 3MKKA 4IX2A 5HK4A 2E40A 2WSRA 2VEPA 1ADDA 1IEVA 3W71A 4DM2A 4E2OA 2ZRWA 4AZ6A 4XKYB 4BI7A 4GQRA 2DZXA 4OVXA 3EA1A 4GX8A 1UP3A 4Q3MA 1SZNA 4GKLA 4HNLA 2OR2A 2VTFA 1ZY9A 5HNUA 3EDJA 1FWNA 1HL2A 3F4CA 4W8BA 3VIFA 3O7UA 3ZT7A 2QAPA 2ZBTA 5MKGA 3DU0A 2IPFA 2IS7A 4MHBA 1GKQA 5C54A 4MNJA 1QNRA 3LHUA 4V2XA 3CHEA 4OOZA 1VP5A 5HWNA 3NGFA 4EP8C 3K8LA 1MRQA 2DSUA 4MKNA 1R7OA 2A7PA 2PDIA 2QF8A 2DUZA 4Y9MA 3AWOA 2ALRA 3CH0A 3H24A 4Z08A 1FWJC 2H6RA 3VKDA 2PP1A 1REQB 1G69A 2YDRA 1SSDA 3VD4A 5DMMA 4PCFA 4U5KA 3WUEA 1I2RA 4ZXOA 1ZAHA 4XZLX 1VFOA 3NM1A 1E6ZA 1V6WA 3PBVA 4H41A 3KZSA 4YTRA 5I09A 4PCNA 1UWTA 5SWUA 4JICA 3TMQA 2QCDB 2ISDA 2VJXA 2CZFA 1W2PA 2AL2A 4ZR8A 1ZGDA 1H7NA 2EG8A 3CC1A 2ZTKA 1A5CA 1EC7A 5CSSA 1JFHA 4DO6A 1A5UA 5EKYA 3TROA 1CZ1A 3CWNA 1W91A 4XBKA 2VRJA 2XIMA 4KWUA 3R79A 4F40A 3BGGA 3MMWA 3W7NA 3WUBA 1Z32X 4AMAA 2FYMA 4AW7A 2IKJA 3DHPA 2DT1A 2VR2A 1M53A 5D30A 3GRIA 3WNMA 5HAOA 2C91A 4QJ3B 5DN1A 3MI2A 4Q8WA 3R94A 3SJNA 4M6PA 3IJIA 3RHGA 3GXIA 2FVMA 3CPUA 3F2BA 1G4TA 4YWSA 4L1GA 1UZDA 3RR4A 3FX4A 3LTPA 4JBRA 1W1ZA 1TPC1 3B9OA 1M01A 4AQLA 1NIUA 3L4WA 4X0NA 5CZKA 4ILSA 3N12A 1F2JA 1V51A 2VOMA 3WN6A 1CW2A 1Q6CA 3AFBA 1R0MA 3W7PA 2TMDA 1K8YA 3ALFA 3IUDA 1AZ2A 3S2NA 3UESA 3E0VA 3WQOA 4DAIA 2PI6A 2QV5A 2QJIA 1EDGA 1MXSA 2YBUA 4RDYA 3GM8A 2XVPA 3N17A 3NEVA 3LLDA 1SQ7A 1DQWA 2YR1A 3USZA 3ONBA 3B0VC 4QM1A 5HMSA 3JU2A 3BPWA 3NWRA 1KM4A 2ZA3A 7ODCA 3CO4A 2CLEA 2GL5A 2FTWA 4UIOA 2YW4A 2O9RA 1XYAA 3FW6A 3CZJA 5CPMA 3IWPA 2BXYA 4RLIA 4F0MA 3IK4A 4JIPA 1SW7A 1V03A 2Z6IA 4J4KA 3IJLA 1R38A 1EBGA 1R3QA 1TVPA 3VTRA 4JKMA 1RK5A 1HX0A 3DECA 4LYKA 2PGRA 1OWQA 5FF0A 5CQ1A 2X1UA 3VNMA 1B54A 2F84A 4E8GA 1HFBA 4ML4A 3BW4A 4INFA 1A3WA 3GD6A 4W8LA 1GK8A 4OBRA 3UERA 3IJQA 4AYSA 3FA3A 5I3FA 3V36A 4PMXA 4C6QA 2VRQA 3ARXA 2Z1BA 4LYPA 4GZIA 4YHGA 1OYBA 3PBUA 3HF3A 3CIWA 2PDXA 2BP1A 2P8BA 4NL1A 3BAXA 2FZMA 1ZUAX 5G2IA 4S3EA 1HKVA 1S2AA 3QVQA 4MMWA 2P3ZA 4R7JA 3SY5A 3ZVHB 5CSYA 3B9EA 5EYWA 2OLHA 4F0RA 4KH2A 4QG6A 5DX7A 2F8QA 3CMFA 3FEQA 1A3HA 1G4EA 4GH3A 5FI8A 1K9TA 1CGXA 1E43A 2XSXA 2Y89A 2VDHA 3VGEA 3WLLA 3Q67A 5BXSA 4JR5A 2D2JA 4GKTA 4W5ZA 1Q6QA 4B3ZA 2Z2AA 1TO3A 1ZP3A 5I3GA 3A5VA 3HQPA 2ALDA 3C2FA 3QW4B 3ZXWA 1I1XA 3GUWA 1MYRA 3AHVA 3B8VA 1KQZA 1QNPA 3AOFA 1QMLA 1HKMA 1QW9A 1LROA 2FZBA 4PEKA 2YYTA 3CZ8A 1GQIA 1XWYA 3GC4A 1XIFA 3IUHA 4Z1BA 4B16A 5AYYA 1OG6A 1UB3A 1DTUA 3VOHA 1B3XA 4UTJA 5IHSA 1HKWA 3SUSA 4QROA 2V30A 2WSYA 1S2WA 3VNKA 3MKCA 3PPFA 4JTJA 1SFSA 4JY8A 1QI0A 4QJ5B 3T0AA 1E70M 4I5RA 1YTDA 4ZFMA 2YZ5A 4I8DA 4Y9OA 1TX0A 2CETA 2VURA 1ZP4A 1NH6A 3WF4A 2ZDRA 5LNRA 4UB9A 1EDTA 5BROA 3NZQA 3W2KA 2NQ5A 3H70A 1FWSA 3N19B 1R3RA 2YCEA 2WVSA 3FGCB 4FK9A 3IVTA 1RV8A 1FWBC 3NQAA 5CGTA 3VDBA 2QCMA 2YFOA 3BOLA 2QCGA 3FGCA 2EAWA 2Y88A 2FHCA 1MEIA 2NSXA 1LRNA 2HBVA 1W9BM 1MW3A 4IQJA 1K8XA 4LXFA 1LG2A 1B3WA 3QQ1A 3VILA 2J7FA 1NU5A 4LAOA 1W1YA 2BHZA 2RH9A 4JGDA 5A69A 3ELFA 3EA2A 3GNXA 1M1BA 3NDYA 4NVTA 3K13A 2WBGA 4Z0SA 1UKTA 1PV8A 3S5OA 2J88A 4HCHA 4WY0A 1US2A 3TTEA 6CGTA 1HP4A 1Q4WA 3ARPA 4DZIA 3AHXA 3EKZA 4JTRA 3BAKA 3DERA 4NX5A 2RFGA 4GJIA 1BKHA 4ERAA 1XDJA 1PHQA 3QZEA 5M03A 4LUJA 2YXOA 5AYIA 4JKLA 5I24A 4FLQA 3WH8A 3SIZA 4PYSA 3QH2A 5I3KA 1AQMA 3UBPC 1MUWA 2EPOA 3PP7A 4UNIA 5K9DA 3UGVA 3QSTA 1GVRA 3GAYA 3ZJ7A 2VFHA 4R53A 4EIVA 4AVNA 1O94A 4PCSA 3BQ5A 3WLHA 5TNVA 2J8TA 4H83A 3L4UA 2P0IA 3QM3A 1VENA 4P8XA 4QG8A 3WLTA 1KKRA 2Z27A 5JVLA 5D8WA 2DT2A 1JD7A 2FVKA 3H23A 3R58A 2VFGA 3W02A 4O10A 2CZ5A 1QK0A 3H6OA 3HQNA 3PFRA 4HPNA 2QCFA 3GDKA 3T1GA 3MVIA 2DJLA 4RDZA 5C70A 3YPIA 4UTWA 1UR1A 1W8GA 5HMFA 2NXIA 1HKKA 1IHIA 1RLCL 3WQVA 3HGOA 2ZX7A 3ARWA 2FFCA 3V75A 2D1ZA 1QNSA 4RCXA 5JMUA 4D2JA 2E9LA 1D7KA 3KBSA 4D6JA 3TFCA 2OODA 2D0GA 2A85A 4F0SA 3HBLA 1GYLA 1PIGA 4L1WA 1XINA 4J3VA 1E3XA 1GG0A 2GGHA 4FMVA 4UQ9A 4OBSA 4D1JA 2ZDSA 1B3VA 4J3TA 3EDKA 4BKNA 1Z48A 3FLUA 3ZR5A 8XIMA 4ORIA 1DIOA 5G2WA 3UWWA 1C7TA 2XVGA 1D2KA 1SR0A 3D3FA 5FJJA 3MKVA 2QVHA 4LY8A 4GUHA 1BAGA 4B3LA 2C15A 1DWGM 1WV2A 5FJRA 4I9AA 3ZVHA 4ZMGA 2A5HA 4BQ5A 1WA3A 4DF0A 3IGUA 3QC3A 1XS2A 4E8DA 3PG9A 3LLXA 2IKIA 3UNDA 2GJXB 2X7VA 4UMAA 1BWLA 3WUGA 3AMGA 4D6IA 3MI3A 3NOYA 4J1OA 3UJRA 1LBMA 3KDOA 4O0QA 1VGAA 3UZWA 1H51A 3W29A 1CCWB 3VNIA 1D3CA 3ANVA 3H54A 5FACA 2ESCA 3EPOA 5JIWA 5LZLA 1V7YA 4JNYA 4W7VA 1ESWA 3M0VA 3OGVA 3OVGA 2B0MA 4RZ5A 4IM4A 1V0LA 2PDUA 3NQGA 4N4QA 3FJ6A 3S2JA 1ECQA 2GK1A 3J7HA 4TO8A 3OP2A 1JGMA 1R3WA 2POZA 4PTDA 1B90A 2PU1A 3VINA 3WQ4A 3RG6A 2REQB 2OGJA 3IIPA 3LERA 4LGXA 1XGDA 1XDMA 1OYCA 5DRIA 3M07A 1CXKA 4GVIA 2OKOA 4U31A 4XD3A 4BZYA 1KFJA 3OO2A 3VD3A 4AVOA 1TWZA 4MTVA 2C1GA 1ZB5A 3GX9A 3WNPA 1ONXA 3PR2A 3KS6A 3QHOA 3C2YA 2CESA 2YL8A 1B9ZA 4F2BA 4JYEA 4GYPC 3OG3A 4N42A 1J5TA 3MT1A 4CNPA 3SFWA 1YTEA 2VZVA 4GRSA 2G4FA 2P10A 2YDAA 3Q94A 4KGLA 1ODUA 1A53A 3G1YA 3PFMA 5JH2A 1LBFA 5G2HA 2OQLA 3W82A 3PZIA 1P1XA 4WEVX 4WD0A 3QR3A 2ACUA 4A6GA 3M0MA 3ZSTA 2XFYA 2DZTA 1S38A 2C16A 4KF1A 1QI3A 3FXGA 5A2CA 1YQ2A 3MO4A 1VBJA 4W5UA 4HCLA 3QJAA 5I3IA 2FZNA 1PZ0A 2YCKX 3BSGA 2GFTA 4U10A 3W07A 1TSIA 4LTSA 2OTDA 4GNVA 2PTYA 4OUIA 3AIQA 4EPBC 1V6YA 2IQDA 1FHDA 2HTMA 1Q6DA 3CQJA 1V0KA 4F79A 3LBOA 1YPFA 1H7RA 1KRBC 4K7VA 2AMXA 3DBPA 4XKYA 4BF5A 5K9CA 2XWEA 2I9EA 4CNUA 3EA3A 2XJ7A 5EB8A 4XAGA 3TTSA 4AD4A 3B40A 4N9EA 4CCCA 1IIGA 2QAFA 3GFYA 3W7RA 1SZGA 3DKLA 1X96A 3ZT6A 4MWAB 3SDOA 4MLRA 2DFAA 3TQKA 3CJPA 3VOGA 1F3EA 3LPGA 3WQFA 5A6BA 4YMZA 3VA8A 3WNNA 4PUKA 1QJWA 5D38A 1W9DM 4BHYA 3CH9A 3U7BA 5D9OA 4UR8A 4EX4A 3QY7A 4K2SA 2YCIX 4HTYA 4KCTA 1TE1A 4GUIA 1W3IA 3L23A 2NWRA 2C19A 4Y90A 1HTIA 4TVCA 1XIGA 5CGMA 1NARA 2ZZ2A 4PCTA 2NQHA 3WD1A 3KXQA 3HO8A 2B7OA 1DWJM 2O92A 6XIAA 2AQWA 3AUOA 3BLOA 4QS6A 3EOEA 3N6QA 2Y24A 3W38A 4GC3A 3S1XA 4B2DA 2VX6A 3H22A 3JUGA 3E0LA 2QS8A 3KAOA 2R1KA 2R1MA 2P50A 1Q7MA 3WBXA 2OSYA 3QQ0A 5I3HA 9XIAA 3TYUA 4XD4A 1KWGA 4O13A 3OA3A 4AIEA 1K1DA 3RX4A 4UBPC 4X60A 1RR2A 2E3ZA 1Q7QA 1G0CA 1V3MA 1XKYA 4M7TA 1QOXA 4UXDA 1RA5A 2WMFA 4FF7A 3B04A 2Y7DA 2CHNA 4PMRA 3EEZA 2INFA 2GGGA 2PTDA 1NFGA 4WY0B 1LCOA 1ALDA 2J13A 3DUGA 4AHQA 3LU2A 4XZ9A 3TNOA 4S23A 5D04C 5HJXA 2GQAA 2J7DA 4JEQA 1H41A 1YNYA 2WMHA 3LV6A 1J18A 3N2BA 2OWWA 3QOKA 2AKZA 2W91A 3FSUA 2DQXA 1EDQA 3GVVA 9RUBA 3A23A 1P48A 2WC7A 3S8HA 3GBEA 2A1YA 1GVSA 4DF1A 4ROQA 1EGMA 3T4CA 1BGGA 2ZZ1A 5CXPA 3RPDA 5H8UA 4V1XA 3WH9A 3COTA 3IGHX 3T0TA 4JTUA 2RGLA 4V33A 3CBWA 1T96A 3CUGA 2G37A 3VNYA 2XUCA 1Q2RA 1LUCB 2J25A 4DBDA 2VWSA 1OGGA 1G4SA 4BI5A 2V5BA 2C0AA 5HDRA 4AFYA 1FVPA 3ZLHA 4TMBA 1X6LA 1S39A 1PX8A 3GW0A 4J5NA 2ICSA 1O1ZA 3DG7A 2ZYFA 3M6DA 3THAA 4UMBA 1ZALA 3W76A 1CNVA 3NG3A 3SRDA 3AYRA 1EXPA 1SZEA 4CCDA 3KBVA 1CX9A 5BYWA 3M41A 3GXDA 3S9ZA 1GPFA 3IJ7A 1S5TA 3POHA 5BMXA 1JRBA 1EP3A 4YTSA 1JNDA 1TR1A 1SO6A 2W5FA 3CAQA 1UG6A 4LF2A 3HQ1A 3KE0A 3R0UA 2NVCA 1PYMA 2VMFA 3N14A 5I7GA 5D05A 2G0WA 4NP7A 1XUUA 4IJBA 4JTIA 4QR6A 2B7QA 3C2VA 4N7QA 4HYWA 4XIMA 1PO9A 3F1QA 5LA1A 1KCXA 3CAVA 1QPOA 3UVAA 4AZCA 2NV2A 1Z7AA 4IMCA 1J11A 4HSHA 3UJ2A 3T40A 3DGBA 1TZ9A 1BXNA 1IWPA 4R9XA 4W4QA 2PWVA 3ORWA 1K70A 3NFUA 5FEXA 4HBKA 3WEZA 4XWUA 3TIMA 1PKNA 1SFLA 3JRKA 1B31A 1B4KA 4D6DA 2X0HA 4HZ6A 4HIBA 3ARSA 4RW5A 1UH4A 1EZWA 3VE9A 5H2ZA 3N2CA 1R87A 3RXZA 4H9TA 4KWSA 4PB4A 4E0CA 4W86A 1I2NA 1UWIA 3OLEA 1YXCA 2PLKA 3NCOA 1UD5A 1KRCC 1CXLA 1GUVA 3ARYA 4N2YA 4AXNA 1OX4B 2PTXA 4LSBA 3N6JA 1ICSA 1GPWA 4HYRA 3LCFA 1FTXA 2BMBA 2H8XA 3TQPA 3SIMA 4ZTYA 4C5YA 3BV7A 4AC1X 3WQ8A 1EJVC 4LX4A 3I6RA 2PF8A 4DYEA 2OKTA 3UY7A 5HPCA 4JY9A 3RM4A 4GQGA 1NDZA 4Y9NA 5CAKA 2A3EA 4WJ8A 3N29A 1WDQA 2W27A 2CWXA 3E1F1 2XH7A 3E38A 3GDBA 1JYWA 4RDWA 4J3SA 2RJHA 4H7VA 4O57A 1J0KA 3AIWA 3FA5A 1Q5MA 3Q45A 3GUGA 4ZO6A 2ZRYA 3GTFA 3KS5A 1H1NA 5L6UA 3UJFA 1AJ2A 1HJXA 4C1KA 1HNYA 4ENLA 3HFTA 2PZNA 3CQ0A 1X38A 1QDSA 3GVGA 4AZCB 1HKIA 1A5AA 1RQEA 3UR7A 5JUVA 3BW2A 1U83A 1GOOA 3E2RA 3BLIA 4HA1A 1GQKA 1PEZA 5ABFA 4C6IA 2ISFA 1H7WA 4BF9A 4C1NA 2CYGA 4EPDC 5AFDA 3CEPA 2HNHA 1AL8A 2CXEA 3C5QA 3WFAA 3VUPA 4CNOA 3W7IA 1MXDA 1GYNA 4IMGA 1EQCA 1K7FA 3ME3A 4IFRA 5AC5A 1VYPX 3F7JA 3W0KA 3BL3A 2A3HA 1GVFA 1VPXA 1YE4A 1FBAA 2BGQA 4MY9A 3WDIA 2VDGA 1RY0A 1XLJA 6ALDA 1R86A 2ZWZA 3IVSA 3WUFA 3KZPA 3CEUA 2PDPA 1H5VA 4ZCWA 4GIEA 5F1UA 1UR0A 5BRBA 4MDOA 4W93A 4HU3A 2BV9A 3K1GA 4LAUA 1KM0A 1OFAA 1OJXA 2QPUA 2W92A 2Y7FA 4GNJA 3W7DA 4IUGA 4H9YA 5CBIA 3VIPA 2ZRZA 1GHSA 1K4GA 1GW1A 1BTMA 1A5OC 3O05A 4PUMA 4UTLA 3MMTA 1E6RA 3AMKA 3AXKA 3AUJA 2GVLA 2FKPA 5CJMA 1FWWA 7REQA 1P0BA 2NX1A 3VM7A 3GYCA 4HNCA 3BMVA 1Z8AA 2FQIA 4LH8A 4OECA 4O8AA 2V3GA 4LNYA 3URAA 4C65A 3TYDA 1WX0A 3LI0A 3P6LA 4JX6A 3XISA 3B4UA 3QGVA 3LBCA 1W5OA 1LLWA 1R5YA 4AVFA 4J27A 3L5LA 1IR2A 2WQPA 1OFEA 4RNJA 5DFAA 1LJYA 3LGDA 4WCJA 5AHMA 2ZOXA 1JUEA 2XIJA 1VIZA 3TR9A 4H9MA 1C91A 4NNCA 4UTTA 4R3UA 2WV8A 2BASA 2A3LA 4EAYA 4S3AA 4FI4A 1E51A 1M3UA 3O2LA 2NUXA 3R25A 2YL9A 2A3AA 2XM1A 4IHCA 1PTGA 2OWCA 3BUVA 3WD4A 2J24A 3K46A 3ITLA 1VS1A 2VGBA 3FAXA 2WHJA 1Q66A 3SGZA 1TMHA 3U4AA 2XN1A 1DWIM 3UXDA 3MTWA 3BSHA 5HMEA 1VBUA 2G3FA 2JK2A 3B8UA 4UFKA 4C6CA 2H9AA 3PZUA 1LORA 3WJZA 2J62A 2ZUMA 4ZQRA 1XLCA 2H9AB 4NG3A 5IRPA 2NUYA 1JAKA 3LCXA 3NZGA 2EPLX 3KTSA 4RPPA 2WZIA 4O11A 3FJ4A 5ABGA 3R89A 2QQ6A 4Z2IA 1DBTA 2E7FA 2XIOA 2Y5JA 1RZMA 4Q4QA 3EYPA 2UY4A 2TPSA 4GWEA 4K38A 4QITA 4TX6A 2G3NA 1SMDA 4LPCA 1J0IA 3H7RA 4DWSB 1UUQA 1B2YA 3UVIA 1WPCA 1BLIA 2J7GA 1V3LA 3KL5A 1T99A 3B03A 2B4GA 1W3TA 3TW6A 4CU6A 5FSEC 4WDXA 3DFQA 3IAPA 5CG0A 3MJYA 2E68A 1HZYA 1SJAA 4A3YA 1SJDA 2VD9A 2A3BA 3WK3A 3MUY1 4A8NA 2O9PA 2OELA 3A9BA 4MVAA 4DY1A 3TJXA 4ZGYA 3BLLA 3CB8A 1YNQA 3GR7A 5MKGB 1TELA 2CEQA 5JXQA 1J01A 1A0EA 3ITTA 3VKKA 3WH6A 3N3TA 3WNOA 3OA5A 1UBPC 2J9YA 4RNIA 5TAOA 3IK2A 3VMPA 4MJ2A 4NNBA 1QO2A 2EKCA 4AUBA 1PYFA 2WSPA 4ZODA 2RDWA 4RL3A 2YCLB 4PMUA 4Q7NA 5F7UA 3W88A 3CPGA 3GVWA 1ZCOA 3A9IA 3UWZA 4XZIA 4JHZA 3CXOA 4J35A 1OFOA 3L5AA 1YPXA 1R8LA 2YL5A 1JYVA 3ZLGA 2XFWA 2V63A 3HV9A 4IPNB 3VGBA 1Z9AA 2VL4A 2WJDA 2VT0A 3T44A 1TREA 3AXMA 2PTZA 3JW7A 1RCOB 1NY1A 3MMUA 4FAMA 1UROA 1KBIA 1W1B1 4CD5A 3BGAA 4F2UA 1TPWA 1L8PA 4RR4A 3RM9A 1V93A 4KCWA 5T91A 4KEVA 3HA1A 2D3NA 1CLKA 4DI9A 2BTMA 2HPIA 5M17A 4XAFA 3FV9A 1SW0A 2QCEA 1KBKA 3K30A 3MA8A 3VVGA 4O16A 2V5DA 3W73A 4GI4A 5LGXA 3PBWA 3TA9A 2HNEA 1DKWA 3ZQ9A 5FL0A 2B7NA 1Q45A 5I0DA 4DJDC 3LENA 2D0FA 6TIMA 2D23A 3L2LA 3OVQA 4YU1A 3TU9A 1JDFA 3HGSA 2C18A 1ZLPA 3TLQA 2Z6JA 4TUFA 5A6KA 4AZHA 3NSMA 5AZ0A 1B3ZA 3AS3A 2ZIDA 1C7SA 3RUBL 1T6MA 4JTQA 1SO5A 1WOAA 3BDKA 1P6CA 1RY8A 2EPNA 1PX4A 3T09A 4RE4A 5C9WA 1E9YB 7TAAA 1E6NA 1K6WA 1XBXA 3N25A 2Y1HA 4KIEA 6ENLA 3I6EA 3W00A 4WGHA 1TCMA 3LPFA 1AODA 2Z7GA 1C29A 2O4QA 3PTKA 3VX1A 3UEQA 1MDLA 4LVDA 2V5LA 1AZ1A 3TVAA 4L6HA 2C6QA 4LVBA 2WAGA 2ZXBA 2E77A 1V6XA 5CZTA 3O9NA 4JYFA 3WBAA 1TRIA 3BCDA 3W7JA 4FB7A 1QWGA 3LCWA 3R2GA 5BOFA 4IJCA 5EMJA 3ZR4A 3WFLA 2HXTA 2OCZA 1UIPA 2F61A 3WENA 4RKAA 1JFXA 2EG7A 3CK5A 2KAUC 1KBLA 2DV0A 4AF0B 1MNSA 2JE8A 2E8YA 4WJEA 1YHTA 1EWDA 3CS2A 1NSJA 3SQSA 2WLZA 2F7FA 3ICJA 1XFBA 4K7YA 5D02A 3KRSA 2WJZA 1DIEA 2POTA 3CUXA 2P1FA 2OEJA 3O06A 2HQAA 4NJHA 3S42A 3SN4A 4BWLA 4AD3A 4QTGA 3THCA 4GFSA 4N9CA 3WH5A 2C13A 4A4AA 2VNCA 5LSMA 3P93A 4JIHA 1LRTA 5FF3A 1XW8A 7CGTA 1PE1A 5H1WA 1VR6A 1ML1A 2GGJA 3OU8A 4FXJA 3A22A 4NT0A 1P6WA 1SZRA 1UZ1A 1JYXA 1A5BA 1JI1A 1E1FA 4YL2A 2Z1WA 4J3XA 1DXFA 3MHGA 3SZ8A 4C7GA 2GGEA 5FF2A 1FWFC 3IUIA 1CBGA 5C6MA 1UWUA 4GFIA 4ZB2A 2JF6A 2QW5A 2Y4SA 4WOZA 1E1CA 4LT9A 4PUJA 1XG4A 2VC5A 2OO6A 4S3KA 1XD1A 3H2NA 3WLNA 4PUDA 4C5ZA 7ENLA 1BEUA 2PBGA 3GFZA 4L4MA 4UTMA 3GIPA 1ZZMA 2QGYA 2YB4A 1QBAA 3AU2A 5DQPA 4IPPA 3WDQA 1OYAA 3RCMA 1M7JA 2GDVA 1Q7ZA 5M5DA 4IMEA 3A12A 1JCNA 4GJ1A 1A4LA 4DO5A 1KM5A 3OVPA 9CGTA 3CUFA 4NZJA 3LA4A 3WL1A 4IIEA 4PMNA 1BYDA 2DW7A 3PBYA 3I65A 4QDPA 2A3CA 1SPQA 4IGHA 3ZJ6A 1WZKA 3ES7A 4PEEA 4Z2LA 2WBKA 3GBDA 2PWFA 1M04A 4FZIA 3CQHA 2NLIA 1EA9C 5DBTA 1NWSA 4RPQA 3A21A 4DZHA 3AWNA 3W24A 3TZFA 4JIEA 3VIGA 1F73A 1AJ0A 4GGBA 2OFJA 4NXSA 1J2BA 1W2VA 3MUAA 1BHGA 5A8GA 4RV8A 1C92A 1OD8A 4WDWA 3LHTA 4ZFCA 3W1LA 1ITUA 3M0KA 5DT7A 4RW3A 3TYEA 4MWAD 3LM3A 4FEZA 1JDEA 1OFRA 2OWXA 4PTXA 4HK7A 1OINA 1H1ZA 3WO8A 1EKOA 3NPUA 2GJPA 3K8MA 1KXVA 3M9YA 4ZOBA 3PZNA 4LCQA 5BXPA 4AHOA 3W2UA 4S3BA 3DFTA 2WPBA 2R82A 3OQ8A 3C56A 1TMLA 2ZRXA 5CG7A 4GACA 3PTMA 4QNWA 3CYVA 4E6MA 1J6PA 5CPOA 4BS0A 4NJJA 2J7HA 2J66A 5CC5A 1PPIA 2D69A 2CXGA 3E96A 2UY2A 3PNUA 3GH7A 2Y61A 4K1WA 2P0OA 5F2LA 3KRZA 3U7VA 4F8XA 2E1DA 1EGVA 4GO9A 2BHYA 2AGTA 4GOAA 3P7YA 1Y5XA 3G1RA 1OABA 5D9NA 3PJXA 3HTWA 3K8KA 4I8YA 1MWOA 4LVAA 4QEHA 4CNTA 4I9TA 4AWTA 3BG5A 2PDGA 1NOUA 3OHMB 4YXGA 2X7WA 5AC6A 3TYAA 5HXMA 3I4KA 4FHAA 3LQLA 1CWYA 1C9WA 1KXTA 3H8AA 3IANA 3BLPX 5BXTA 2GQ3A 1CI1A 1CGTA 4HYVA 3VDGA 4IPJA 2VUNA 3WIJA 3CTLA 4QCEA 3FOKA 2EKGA 3HMJG 2V3EA 3FS2A 3BSMA 3BLFA 1SUXA 2J75A 3AXHA 1UR8A 1LYXA 4M82A 1EHAA 1H5YA 1KTBA 1TIWA 3TN6A 4B5VA 4HMNA 1KBBA 1X39A 3L0KA 3T0DA 2NXHA 3RLGA 3T55A 4NI8A 4P8VA 3K4AA 3EB3A 2Z0IA 5BWFA 3WK2A 4YTTA 4MJMA 4LUYA 4LQ1A 3V35A 1J79A 4UOZA 4DEFA 1PDZA 4XO7A 2PDNA 2F6XA 1LZOA 1S3TC 4NAEB 5KTLA 1V3KA 3SGUA 1QPQA 3CV2A 4QLKA 2I57A 4TR9A 3TTYA 3EPNA 5C7HA 1T41A 2HXUA 4CCEA 1KFWA 2LLEA 4TXEA 3RILA 1WP6A 1OCJA 1VFHA 3VD5A 4AYGA 3SBFA 1W6TA 4U2YA 4K8HA 3SRKA 4UUIA 1XXXA 1BWKA 2WHKA 1JZ3A 2R1NA 5IXEA 4IPLA 4GUGA 4U3CA 5HWMA 4OIFA 4WSJA 1NOWA 2RHGA 1AVAA 4JHMA 1T8XA 1W5PA 1THFD 1S2CA 2V2CA 3HN3A 2FGLA 1FOBA 1M7XA 1VB9A 2J77A 2L5HA 3TUUA 1D9EA 3CTTA 3CLWA 4A3UA 2DZAA 1JYNA 2PDJA 3NO1A 4TQTA 4MIMA 4N6EA 3TJLA 3DFNA 3E0FA 5AYZA 4EVZA 4W8AA 1IGWA 2EPMX 2NQJA 3SI9A 4BR1A 1Y8BA 1XCFA 2VR5A 4B9ZA 3ARQA 3N34A 3GU1A 4YVVA 5A2BA 1RD6A 1OBAA 1DWAM 1DXIA 3NL5A 2Z24A 1MEWA 2WWCA 2IMRA 2OMAA 4X2PA 3UG3A 2ZA1A 3ANYA 3KLKA 3BQ6A 2OB3A 2PWUA 3MCMA 3NUKA 3GR8A 3W2MA 1F8IA 4M19A 3CYJA 1RHCA 3IV8A 3FXYA 3DOPA 3WYZA 4J2MA 3RX3A 1GVQA 2I9UA 3NPWA 4LBSA 1FWRA 2GOUA 1XG3A 3GK0A 3KVLA 5A1AA 3WF2A 5EU9A 3QR0A 3ZFHA 3FVMA 1UZHA 3FYYA 2XFRA 4ICCX 4FF5A 4C90A 2WMKA 3AO0A 3DBNA 1G01A 1UW9A 1XIEA 3G1AA 4XX6A 4PUEA 3EX1A 1W1A1 1O1HA 5D32A 2VFEA 2VFDA 4S2CA 4A3RA 1J2WA 1JF5A 3KVKA 3MCOA 2NLYA 5F4WA 1FWAC 4AC7C 5A8QA 2E28A 1LG1A 5F4XA 5I5RA 2PF0A 2ZFAA 3MBFA 3EWYA 2XDFA 4LAZA 3MJMA 4UTUA 2OJPA 3VFCA 4JFUA 1LQ2A 4DNMA 4E3VA 2X1TA 1XIDA 4HPJA 1LT8A 5G4EA 1W0MA 4PMOA 2WLYA 4HVXA 4AX6A 2ZX9A 1DJHA 1B9BA 3SR7A 1F6YA 1FHUA 1L2UA 2EJ1A 2P76A 3IPWA 3OW1A 3MHUA 3FHAA 4P7QA 2FH8A 4N02A 5C9ZA 3W2LA 3BAWA 3UNTA 1BFNA 2DUAA 4Q8OA 1EP1A 3G24A 3NZPA 3FSTA 4KS0A 2AQOA 3NYDA 4CEXC 1XM3A 3EKLA 2QJHA 3PUEA 1E9LA 1W9VA 1POKA 1VBRA 3VM5A 3WLJA 1R7AA 4XZBA 1EGZA 2BSLA 4JQ1A 1C90A 5E0CA 1Q13A 2XGBA 5TBOA 2DP3A 3A3HA 1JZ6A 4L56A 4U33A 4ZOAA 4WQ6A 1R9XA 2WSQA 1SGJA 3KL0A 2Z29A 3V3WA 3EOSA 4HB7A 4UZUA 1XYMA 4RXFA 2WCAA 3NJ3A 1OCBA 2KX9A 4BCEA 2G97A 1KQYA 3RRXA 1ZS2A 3ZZ1A 5A3HA 2DZUA 1D8CA 5GNYA 4XG1A 1Q2SA 3WQGA 1QW8A 2ADAA 1HGWA 4WF7A 2XSAA 4WJXA 4HNTA 1AW2A 3W87A 4Z1AA 2PS2A 3F4NA 1CYGA 4LB3A 2OT0A 3REQA 4JFVA 1XUZA 4NAFA 3LOTA 4ML9A 4Q8VA 4MKSA 3W37A 4JTHA 1A5SA 3BXWA 4KIRA 1GJWA 3DHDA 5E0FA 3PZOA 2O9TA 1GEQA 2WW5A 2JGYA 5CPSA 3D3AA 3IGXA 1QBBA 3PVFA 4ADUA 3EB4A 1JGIA 3KOWA 5ABEA 7A3HA 3SJ3A 1PXGA 4ZO7A 2ZZ4A 3RCYA 2PDFA 4HPXA 3GG8A 2BVYA 2CZDA 5CBBA 3B0XA 1K77A 1ZBCA 1XI3A 1UJPA 2P8CA 3E49A 3L4YA 1V5XA 3DESA 5FJOA 3I10A 2AMGA 1DIKA 1EQPA 1XYCA 5E9XA 1RALA 3F4DA 2FH6A 3ARRA 3HZ3A 2IQ0A 4UC5A 5FF7A 4GXPA 5G1MA 4S2BA 3NQCA 1F3XA 3OZOA 4C91A 3HG3A 1XQLA 1MW2A 5HJLA 1KFBA 3GDTA 1XR2A 2R8WA 5GVJA 1CENA 3KFTA 2VC9A 1SR9A 3P67A 4CGTA 4FR6A 2IPWA 4XZHA 1GHRA 2C1HA 3DN5A 3UY8A 1GOWA 1S3HA 1X8CA 5CKSA 3A5FA 3T0CA 1GQNA 1XIBA 1BD0A 2R1PA 2W67A 3WF1A 3H4XA 3VCNA 2W9MA 5HUOA 3TCSA 3GG0A 1W1PA 3HPFA 2E6FA 1OADA 3URBA 2R14A 3BO9A 2WHMA 5EA9A 3WY1A 1SU5A 2AAMA 3INPA 3VIMA 2OX4A 4B9YA 2ZRVA 4YTQA 3VI2A 1V08A 4HP5A 1KTNA 4US6A 1TG7A 3MMDA 3KHJA 3U5YA 1I0DA 5HR7A 1MRAA 2OEMA 2WZTA 3L0NA 4CEUC 1S5NA 1KM2A 5IFPA 1J8VA 1MW1A 3RJXA 3VZYA 4NI3A 1C8XA 3PPHA 1TPUA 4DBEA 1OFDA 4X2RA 1W1VA 3NOEA 4KEUA 3K5XA 1P1MA 3C61A 1ISXA 2I5QA 3P8JA 1HJWA 2OPJA 1DOSA 5JBEA 2ODOA 1V6TA 5D4YA 4BA0A 1ICQA 3N6HA 2Y5EA 3STFA 1S1RA 2C3ZA 4HZMA 3OZPA 1ZHAA 1QVBA 3IJ6A 5KZEA 3V5CA 3BG9A 4ZQMA 1XLGA 5E0KA 3PBMA 3SCTA 1KV5A 2WHLA 1F7BA 3DEQA 1C8VA 2V9DA 2DIKA 2VEFA 4JAWA 3L2MA 3B05A 1R2SA 5E6YA 1OZQA 1FXQA 3MUZ1 3STEA 4QE5A 4QXIA 1X1ZA 3NAVA 1WAUA 2CZVA 2D22A 3Q65A 4UFJA 3QGAC 1FDZA 4O1FA 1D3HA 4UFHA 4XAPA 3BTNA 4IFOA 5AHIA 3W1MA 3DFOA 3CIVA 1A47A 1UMLA 3OG2A 1HW6A 4X61A 1LP6A 1DXEA 3QY8A 3LRKA 1F8MA 1PBGA 3PM6A 3UZ5A 3SSJA 4S3CA 1JCJA 1PB0A 1OGBA 2KZHA 2D0HA 4MF4A 1ZQ5A 3EOOA 5FIPA 1JF6A 2P53A 3MO7A 4REQA 3ARVA 3LCLA 1L9WA 3MUIA 1FCQA 3ZWTA 3H2FA 4DJEC 1UUOA 2ABBA 2D2GA 4X22A 3DH7A 2DW6A 2VFIA 3VIIA 4MY1A 1ZJHA 2UWFA 1FX6A 6REQA 2DPEA 4YN5A 5LIXX 2OLAA 2GWGA 2G50A 3RU8X 1A80A 1FCBA 2XVKA 5C2XA 3NXFA 3UXKA 2DZWA 5K3VA 1OZMA 5ABHA 1EJWC 3TKFA 1PZ2A 4QAIA 4UR9A 1IZCA 1UASA 1DP0A 4DAFA 3BMXA 2JBMA 1VH7A 1GTEA 5I6SA 4G7EB 4OQVA 3LHWA 5AN7A 4Q6XA 3T07A 3ZO9A 1QHZA 4JS3A 4IIFA 2ZUTA 3LZ3A 4UTTC 3LCIA 3CAKA 3T9PA 3VXGA 2YDSA 4ZXLA 3VKJA 3SCWA 4GJJA 1XBYA 3MZNA 4O4VA 4D6CA 3GKAA 4JNZA 2GSEA 1EP2A 4RNFA 1P7TB 2ABAA 4C6KA 3DC0A 5EBAA 3W7EA 1L6WA 2V82A 3TK7A 3CO8A 3H2OA 4WSHA 1JEZA 4NXKA 1CGYA 2PFHA 3L4ZA 3ALGA 5DXYA 1UD4A 2HK0A 3WMCA 3DENA 3K4DA 3VK5A 1V6VA 1QW7A 4C1NB 1UIOA 1BSIA 4JTLA 4X9YA 5A8PA 4QBXA 4N4PA 3RR1A 7TIMA 5LIKX 2INEA 2Y0FA 4LS2A 2DQWA 1NFBA 1UP2A 3A4JA 1L6FA 2DSWA 2WB5A 3BW3A 1DHKA 2C1IA 3GW3A 1IXQA 4GBDA 4IJRA 4EWND 5K4ZA 3UJSA 2FGBA 3A13A 1NAL1 2GJLA 4A05A 3PG8A 5LYRA 4KFNA 1Z89A 3GYEA 4RZ6A 3TV8A 2PP3A 4TMCA 4BEUA 2VUYA 2XPKA 3QV7A 2GWNA 1OB0A 2PB1A 1WOBA 2YZRA 3RLHA 3C52A 4Q33A 2NUWA 1T0OA 3F5KA 3LMYA 3XINA 2FGZA 2PCEA 3UCCA 4O1DA 2C8NA 4O52A 1E73M 1T7LA 4GIAA 1QNOA 3RO8A 2VGIA 4K3ZA 4HZ7A 5CGQA 3VNJA 4BQ3A 3GIYA 5CPTA 1WKEA 1Z44A 2I5GA 2ZXQA 4MNLA 3WJSA 4KFPA 1RK6A 1KW1A 3DZ1A 2DIJA 3PWGA 3RGTA 4NUWA 3C8NA 1BQCA 5KETA 3H2CA 3I7SA 8CGTA 3AQUA 3B8SA 2NX3A 2UV8G 2PC8A 4R9OA 1X98A 3CUIA 5TF0A 3IIXA 4UQDA 2VZSA 4RUBA 4O8RA 2E67A 1MW0A 5LXEA 1UR3M 3TZNA 1G5AA 1OCQA 3BANA 2OQYA 1UD6A 3OGRA 2BOGX 4FSAA 4YLWA 4CVUA 3TA6A 4ORMA 4L61A 3NQVA 1GCYA 1AJZA 4H6QA 5J04A 1J9YA 1LL7A 3TH6A 3W70A 1A49A 3WMBA 1G7VA 4KKXA 4UZSA 4AIBA 3OZYA 2VX7A 2V5JA 2CPUA 4CN1A 3PJWA 1MO0A 3EX2A 4AXKA 3U5UA 3W53A 1EXBA 3W1PA 5HQEA 2A21A 1UH3A 1M41A 4I9JA 2GSHA 4ZB0A 3V16A 4JIRA 3QXBA 3WLRA 3BMWA 3M0JA 3RM8A 4Q4SA 4DWSA 1K9EA 3T0BA 3QMRA 2QLYA 3E6EA 4PRRA 3EWBX 1RJPA 4J2PA 4Y9AA 2VDIA 2X16A 3MQTA 4G7FA 3R13A 3CZKA 1XX1A 1TPH1 1XLDA 2DGAA 1KNWA 3MUXA 3M47A 3G6MA 1ICPA 1VLIA 1RH9A 2X42A 1GONA 3VOIA 5E5CA 1QUMA 2CNCA 1NP0A 2NQZA 3I7RA 1JDCA 2I17A 4G1KA 2DH2A 1SSGA 4BI6A 1Q8JA 1U2YA 4MFDA 2IUZA 3RYSA 5JBDA 1IT7A 6A3HA 1KFEA 1UA3A 4US5D 3LXBA 3PBGA 1J0ZA 3W22A 2BWGA 3UFYA 4KFOA 3UWEA 4AZBA 1KRAC 4E4UA 4PRWA 4GC4A 4R33A 3KM8A 4JZ5A 4LS0A 3TC3A 3PK7A 1UQYA 5H6HA 1LF1A 3M46A 4LWWA 4Q6JA 1TYGA 4PMDA 3LV5A 2R6OA 4GH1A 1XYZA 2A6LA 1H61A 1XCWA 2FJUB 3DI0A 4GXMA 3U3HA 3L7RA 1KM1A 1DIDA 1FFQA 5AVHA 2E8ZA 4JN6A 2IKGA 3PZGA 5FJPA 2ZX6A 1VIWA 3HFYA 1TX2A 3NSNA 5EMKA 3AIBA 2FVLA 1E15A 3KCOA 2GUYA 3S46A 1XH2A 3S5SA 1ZJAA 4XIAA 1H7OA 2HSAA 1J10A 1R47A 4A2SA 3OPSA 3WZ0E 5A8NA 4GA8A 3FDKA 3K2GA 3NPVA 4AEEA 3WSUA 1YRRA 1PVNA 3SGGA 4RV3A 4DRSA 1IIHA 3WDPP 4F9JA 3P0WA 3C86A 3HM7A 1LBLA 4GIYA 3G1VA 4LV9A 1UWQA 4WKFA 2PWDA 3S2CA 3HJZA 2DIEA 5AOUA 1US0A 1HIZA 2OEKA 3N4FA 1ONRA 1SYTA 3TONA 1VFTA 4H04A 2J7CA 3CQIA 1AD4A 1ADOA 3RFAA 3B06A 5LNWA 4UTIA 3VMOA 1P0DA 5IM51 2QDEA 5LGZA 3QMTA 4JCMA 5BMWA 3BAJA 1YXYA 1FWHC 4H6RA 4I5XA 4AB4A 1QO5A 3M0XA 3CMGA 4NZCA 4M3PA 1F74A 3VKBA 3FA4A 2HVNA 3LBMA 1LM1A 5JBFA 5C8BB 4ZZ9A 3AIVA 3W9ZA 4JIIX 5LNVA 4LC8A 1QR7A 2QT3A 4O1EA 4QS5A 5E93A 1BXBA 1GEHA 4A8IA 1I75A 1EHNA 1KKOA 1AH0A 5TIMA 3W72A 2G3JA 2WZHA 4GZ7A 1BRLB 2ZZ7A 5AYXA 3UPMA 3AHYA 4GCAA 4NAEA 5CLTA 2YA2A 1QI4A 1KB3A 1ZCCA 2I14A 4H1ZA 5E70A 4GI8A 2W3ZA 1VBHA 3NURA 4QEEA 2YCLA 3KOFA 3BLKA 1N8FA 4Q7BA 2ZUNA 1RJQA 4IMFA 1VFUA 2JGQA 1JDAA 1TUFA 3GSMA 2XGZA 3U2OA 4M6UA 3G0UA 3VUSA 3WLQA 5EY5A 6XIMA 1P0KA 4DJFA 1EO5A 1FH7A 4H8HA 4XSLA 3XIMA 2QIWA 4O1CA 2BGNE 1H50A 4S38A 1V3JA 4PC8A 2AGKA 3CZLA 5HANA 4M5PA 3NQ6A 2YCJA 3O6CA 4I9MA 3ITOA 2EEXA 2X40A 4N6FA 4K8GA 4DYJA 3ZSSA 4ZQNA 3TYCA 1OSEA 3CMJA 3V0SA 1PTAA 2VKZG 4HMEA 3GE7A 5M1TA 1TA3A 3GNDA 3S5NA 3EDDA 5GJMA 1LLOA 3PJTA 5FL1A 3OLGA 1RQHA 4OUEA 1WDSA 2HZGA 3SRHA 2WC3A 3ZS4A 4IMDA 3T6CA 4NZ1A 3LPOA 3FYOA 5BCAA 1QK2A 1EBHA 3HQOA 2HS8A 1R6WA 2ANUA 3BCJA 1E4IA 3S1VA 2P3EA 3VCCA 8RUCA 2CLIA 4YJ5A 2UZ9A 2OZTA 3DYMA 1P0NA 3E12A 3UXLA 4JX5A 1Q6LA 3P2VA 3LNPA 1GZ1A 4MUZA 3E2VA 4J3ZA 3SM0A 5D2XA 3IJ9A 4JTGA 5B7YA 1QI2A 4DZ5A 4GINA 2WKLA 2YGYA 4XBSA 1VQTA 1TZ7A 1PCKA 4Y8FA 1WB0A 3WMLA 2GDQA 3T05A 5JIPA 2QJGA 2ZC1A 2XIQA 1XPGA 3UWUA 4DVOA 2QUTA 3FCPA 1XISA 3W84A 3GFXA 4Q32A 2PDKA 2PDYA 2XN0A 3OODA 2FMNA 1IT0A 4FO4A 2DJXA 4FNSA 2CW6A 3NL3A 3NQEA 4L9XA 2HDJA 4KETA 4GYPA 4REQB 4QNEA 4Y8EA 1OFBA 1Z6KA 3VE7A 4QJ4B 2ZUSA 1F07A 1C9DA 1TKKA 2QDGA 1OIMA 1UKQA 1J0YA 5FCZA 4LF1A 1L0PA 3W2JA 4KWOA 1HO1A 1A0DA 4GY1A 1PCWA 3R43A 1GOXA 4PTWA 2VELA 4F2TA 2JALA 1QATA 1MNZA 2ISVA 2WPGA 1Y7VA 1KA9F 1T5AA 4KESA 3ZOAA 1GOMA 1AK5A 1DJZA 4M24A 3CNYA 4LEQA 2OSXA 1WE5A 1QAPA 3O16A 1RP9A 4OBTA 3VAVA 4KW2A 4DYKA 1NF7A 2PP0A 1VCFA 4GVFA 1ISWA 1MDRA 1W37A 3BAYA 1HO4A 3NZRA 4C6FA 1GJPA 3BJTA 1JPHA 2YA1A 1JL8A 3TAOA 2QV4A 4QX4A 4ADSA 2UY5A 5REQA 3R1ZA 3C2OA 2ZUVA 5CJNA 1JZ5A 3VIJA 2AAAA 2VC7A 4HOXA 2EPKX 1G6CA 1F6KA 1KXHA 1HVQA 4I6KA 1FWIC 4FPSA 3KBMA 3QEZA 1GKRA 2V69A 1TPDA 4FALA 4JTFA 3QYSA 3UZZA 3MI6A 4HHHA 4M6VA <