2XIIA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with an extended 9-fluorenone iminosugar inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 157
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xiiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xiiA01
4MAZA 4CU7A 3WNOA 3TOPA 4AISA 1J18A 2VZSA 1NWTA 3O6AA 3WD2A 1BSIA 3HU7A 1BAGA 4JCLA 4NZCA 4WJXA 3SURA 1JZ5A 1NM9A 1PEZA 4JKLA 5A2CA 1B3ZA 1UKTA 3BVXA 4PTWA 2DT0A 1C93A 4CD4A 3A47A 1U30A 5D8ZA 4D6CA 2ZUSA 2YA2A 2G4FA 1FA2A 1NP2A 1NOWA 1VBUA 3CMGA 2O9RA 4F9DA 4ACZA 1KXVA 2WVUA 4E8DA 2WYSA 4X0VA 5CSUA 4J3VA 3AMGA 1TQVA 1B3VA 2EABA 2XFFA 1KTCA 1H4PA 3I3BA 4UZUA 4HMEA 2ZX6A 5D8WA 3WQ4A 2PWHA 3MV11 3PZNA 4LYQA 2GJXB 4P8WA 4Z2KA 4P7OA 1K9TA 1WE5A 3UCQA 3VIPA 4L4PA 4LPCA 3EJRA 2VQUA 1V6XA 3OLGA 4ZENA 1MW3A 3KLKA 2GSJA 3WD3A 3VMNA 1CXFA 2XVLA 1K9EA 1MQQA 3UEQA 3OLEA 1EQCA 2J47A 2GJXA 1JXKA 2J74A 1OT2A 4AZCA 1QNOA 3N13A 3BAXA 1CPUA 3RCNA 3BUIA 4Z2GA 5HBFA 4D6HA 1D7FA 3T0AA 3WQ6A 2VRQA 4P7LA 2E3ZA 1BYDA 1ODUA 2D0GA 3VX0A 1IT0A 4AMCA 4LGXA 1XHGA 4LQ1A 3BVUA 3F4VA 3OGSA 1UQZA 3B8SA 3KWXA 3BSGA 3WQ5A 1H11A 4U2YA 3PN8A 5E09A 1XYZA 3T2OA 2WMIA 2Q8XA 2D3NA 1CTNA 5LA1A 2W62A 3U5YA 2EADA 2QMKA 2XVGA 5GNZA 3VNZA 3M46A 1VF8A 2GFTA 4A3YA 1QBBA 4RE3A 4HTYA 3ZSSA 1V6YA 2OW6A 1QNRA 3AISA 4DM1A 3W82A 2WPGA 2E9LA 3RO8A 4F9JA 1PIFA 5A6SA 2G3MA 3A4AA 3UG4A 2GJPA 3LRKA 2EAEA 3II1A 3LXBA 3K4DA 1Q6EA 2ZX7A 3L2MA 4U33A 3RILA 1PS3A 1JFXA 4UQBA 3MU7A 1QVBA 2W91A 1J9YA 1KR1A 1WZKA 2ZWZA 4Z2HA 3VIJA 2A3EA 1NOFA 3A24A 3IJ7A 2J7HA 3VDBA 4AIOA 2E8YA 4AXNA 2VCCA 5E6YA 4CD8A 5BCAA 3L4TA 2Z1KA 1ISYA 4BCEA 2WZEA 4AC1X 5HPCA 2V5CA 2J7CA 3VD5A 4OGZA 6CGTA 4KRUA 1TG7A 2V3GA 2EEXA 4UFMA 4EKJA 1DHKA 2V3DA 3AFBA 4WIWA 3UR8A 2PWDA 2GUYA 1V3LA 1ZJBA 5A6AA 3AMDA 4AZHA 1CENA 1V3JA 2JF6A 5IXEA 4FNRA 3AHZA 3BVTA 3HN3A 2QPUA 1TA3B 5A3HA 1OGGA 3THCA 1GQJA 1J0JA 3ZQ9A 2VOTA 4P7NA 2VZTA 2BHYA 1JIBA 2X05A 3VTRA 3BMVA 2AMGA 3PHAA 4WKAA 1HTYA 3WSUA 5A1AA 3FAXA 2EPKX 4J3SA 2EO7A 3J7HA 2WB5A 3O9NA 3U5UA 5BRPA 1AQHA 1E72M 1AVAA 3AI0A 1LJYA 3DX2A 4CD6A 3L4WA 3S5YA 2JE8A 2QF8A 3WUEA 1XCXA 2WVVA 4YN5A 4AZ5A 4UR9A 3MMWA 2VTFA 3CPUA 1R8LA 1OSEA 5FL0A 1XD0A 2OYKA 4M8UA 1E71M 3QOKA 5DFAA 4GZIA 1ITXA 1EDGA 1NWRA 2WC4A 3D4YA 3NSNA 1KBKA 2XTKA 2WKLA 2XVPA 1D2KA 1HKMA 3BAKA 2CKSA 4M1RA 2JEPA 1OB0A 1ISZA 2XYLA 4PSPA 3WIJA 1G01A 1JZ2A 1F4HA 3CMJA 2X0HA 2ZE0A 4UQEA 2CHOA 3ALFA 4UNIA 3KLLA 3EMZA 1YQ2A 3KZSA 1HF6A 3WD0A 2O92A 3CZGA 2WC3A 3EBVA 3HG2A 4GO9A 4UQCA 3GH4A 4H2CA 1B3YA 1W2PA 3AYSA 2OLHA 2GK1A 1JZ8A 1SR0A 1KB3A 3FY1A 3F5KA 1NWUA 1DWFM 3D4ZA 4FK9A 4J3WA 3G6LA 1SMDA 1LG2A 4IM4A 1ISXA 1FP8A 1W3KA 5IHSA 2XWDA 1GOWA 3WY1A 4BF7A 5C71A 4D6EA 4DM2A 3OGRA 1V3KA 1E9LA 4IUGA 3DX3A 1TQTA 2BY3A 2RGLA 1SMAA 3DYOA 1ZJAA 4CKQA 4HZ7A 2O9TA 1TVNA 2CKRA 5BXPA 3AIWA 1FP9A 3AXIA 2A3BA 1VRXA 3WMCA 1WZLA 1VJZA 3VDCA 3AS3A 5A8NA 1UWUA 1HP4A 4GI9A 5CSYA 3WEZA 1UR1A 3WFZA 1ITCA 1RD6A 1HP5A 4UFIA 2GK1B 3QHMA 2J78A 3BSHA 1US3A 1XD1A 1QOXA 2XGBA 2PWEA 1KFWA 2DSVA 3K46A 4KGJA 3PTKA 3WD1A 3CUFA 3WEMA 3L4UA 4QP0A 4EE9A 3K1DA 5IHRA 1W3LA 1E6RA 4ACZB 1G0CA 4GXPA 2V3EA 2YL5A 4X0NA 4QLKA 4MAVA 2XSAA 4RE2A 2WMJA 2C8NA 4TVUA 1E6NA 1V0NA 3W6LA 4AD4A 1ZBCA 1Q4NX 1QI4A 4UCFA 2CYGA 2E4TA 4ACYA 1KGUA 1E6QM 1C3FA 2DT2A 4HOXA 1WPCA 4B16A 3PZTA 1NH6A 4LYPA 1JXJA 2VVSA 4JCMA 3ZJKA 4EANA 1MFUA 4FNPA 1MW2A 4NZJA 1HKKA 2D24A 3OZOA 5I23A 2HISA 4JKMA 1B90A 5D9OA 3VD7A 1GOQA 2WWCA 5TD4A 4MDPA 1CIUA 1G5AA 3L2LA 1GOIA 1XYFA 4PMVA 4MJ4A 1O6IA 4OUEA 1EQPA 3VIKA 1B3WA 5ABGA 5ABFB 1J01A 4QCFA 1ZL1A 4D1JA 1OWQA 3CZ8A 3B9EA 5I0DA 2J8GA 1WKYA 1TFVA 2WAGA 1W9XA 3ARYA 4CCDA 4CUCA 2JF7A 1HJSA 1A3HA 4Q22A 3W28A 3EJSA 2XPKA 4F79A 3UG3A 1KWGA 2DH3A 2ZX8A 1HXJA 3ARUA 2QHAA 4ML4A 1M04A 3FNDA 1KCLA 2YDSA 5A6BA 1N82A 4C7DA 1R47A 2EBNA 1GHSA 2J79A 1GOMA 3SCNA 5F7UA 2D20A 3AIRA 3SIMA 5E0CA 4YHEA 1J0HA 1V3HA 3GH7A 3VU2A 3OG2A 1EHAA 3WQVA 1NQ6A 2AOSA 3WNNA 2WK2A 4P8VA 2CBJA 2GDVA 1OM0A 1R87A 5EB8A 5LYRA 1HX0A 5JBDA 3BUDA 1JG9A 2CHNA 1W9PA 1VFMA 3BCDA 3BUBA 4DUWA 4AD1A 3AS1A 4KWUA 5A6MA 4TX8A 2VRKA 2VURA 4N0RA 2XFYA 1JZ3A 2BNJA 1GNXA 3SCQA 1LG1A 3A4WA 3GXIA 2DEPA 5AY7A 1LLOA 3HZ3A 1BQCA 1OIFA 3U7VA 3IGUA 1JYXA 1EOMA 1Y7VA 3ZMRA 3CLWA 3EDEA 3ZJ6A 2YL9A 3GXDA 1GONA 4DWSB 1GCYA 1JD7A 1FH9A 3GTNA 3DC0A 2XHYA 4J27A 1DWGM 3LXCA 2WHLA 3VVGA 2DSZA 2OWCA 2WWDA 1UD8A 3LXAA 3WD4A 1UZ4A 4PUEA 3LPOA 5FOOA 4FLRA 2MANA 4AEFA 3MUZ1 1ISVA 3L4YA 3GBEA 4W86A 1TE1A 2W5FA 3ZT7A 1OGBA 2F1AA 5KEZA 2X09A 1NARA 4CCCA 3QGVA 1LF1A 5CLWA 3PZVA 5I3DA 2YDQA 2OW7A 2CNCA 3OA5A 5D9PA 3ZM8A 4M82A 4AD5A 1B3XA 2DSWA 3VDAA 4AZ6A 3AIEA 2FE0A 2BY0A 4FNQA 3AXHA 3CZLA 5A6BD 4BQ3A 2VUYA 1GPFA 1JGIA 3UG5A 2Z1SA 1P6WA 1QW8A 1KR0A 4HA1A 2JIEA 4WKFA 4NI3A 1GVYA 3QR3A 2JFEX 1B1YA 3T2PA 1Q6GA 3AQUA 3WN6A 5A94A 1QX1A 1JF5A 3ZT5A 4JFSA 1E1FA 4J28A 3T0BA 2BVTA 3T09A 3TTSA 4PUDA 4JL1A 2D2OA 1CGTA 3K8KA 1PAMA 4LYRA 3VIHA 1K6AA 3VSVA 3WDJA 3AIUA 3UR7A 4W89A 2OSWA 1TA3A 2WCSA 4D6FA 3GXTA 3W53A 3ECQA 2YLLA 3WUGA 4CVUA 6A3HA 1CLVA 4NXSA 3SCRA 3S5ZA 1C91A 3HMCA 1BF2A 3ARPA 1HVQA 1GVIA 3NSMA 4FNUA 1W1YA 1GUVA 1TVPA 2J8FA 3GNOA 1HWWA 1CGXA 2VR4A 1W9UA 1DWAM 4BQ4A 1B0IA 1EGZA 3WH7A 3MS8A 4V28A 1FHLA 1RP9A 4OIFA 2DGAA 5HNNA 3CIVA 3HG3A 2E0PA 3U7BA 1BGAA 5JIWA 4MB5A 3VSUA 4HU0A 5A8QA 1XH1A 3CUGA 5CQ1A 2YFNA 4D71A 5DMYA 1MQRA 2J77A 4JFVA 2FHCA 1E4LA 2CERA 4HMDA 2UY4A 1FHDA 2EPMX 1GOOA 2BVDA 1I75A 5I77A 3ZIZA 4B3LA 1W2VA 4ZXLA 1FFQA 3WF1A 3LRLA 2WSKA 1JI1A 4DWSC 5A2BA 3CUJA 2X8RA 3I3EA 4AD0A 3AZSA 2VX6A 3CC1A 3VSTA 2X2JA 4HPGA 1DEDA 4KRTA 1E0XA 3WMSA 2VCAA 1V02A 3ARWA 1M7XA 3GYCA 1UR8A 4JHOA 4OOUA 4D6GA 1PX4A 1J0IA 9CGTA 3WMBA 5AC5A 2D22A 2EQDA 1HJWA 2DIEA 4UOJA 1ZS2A 3SCSA 4AYSA 4A3HA 1XV8A 3CH9A 3LX9A 1MFVA 2VZUA 4PTMA 3SEPA 1DWJM 1SZNA 2JEQA 3VGFA 2XG9A 3A6OA 3ZJ8A 1M01A 1JDCA 3CGTA 3BLPX 5FCZA 1EXPA 3L4XA 4WK9A 3WF4A 2VO5A 1C8YA 4V27A 4GI6A 1D3CA 1WDPA 5BYWA 5A95A 1FOBA 4J7RA 5CJ5A 3ARSA 3PZ9A 3IJ8A 4JFWA 3ZOAA 2YDRA 3PZIA 4JKKA 2CESA 4MB3A 1ZBWA 2PF0A 3FHAA 3SCPA 1J10A 1UH4A 1WZMA 1W3HA 1JL8A 1J0YA 2DT3A 4J3TA 1QHZA 2YL8A 3CZSA 4ZXOA 4CD7A 3VGGA 2XGIA 4Z2LA 3DECA 3KL0A 1R85A 3MMDA 1QNQA 3OZPA 3QOMA 1M53A 4ATDA 3GXFA 1ISWA 4V2XA 1QI3A 1VFFA 3G6MA 1OIMA 4S3KA 3VO0A 5JBFA 3EMQA 2D0FA 5IFTA 1V0MA 3VIOA 2F2HA 1I1WA 4NRSA 2D23A 3CUHA 2TAAA 2X2HA 2F7RA 3NSXA 4TX6A 1R7AA 3TTOA 4PMOA 2XN1A 3WF3A 1W9VA 3AHVA 3EDKA 4QDMA 1ZU8A 1E4IA 1CZ1A 1CEOA 3K8MA 3D51A 3WL0A 1ZBVA 3RMEA 2F61A 4QLJA 4AD2A 1E0VA 4H04A 3VGHA 3ARZA 2XWEA 3MSGA 2XM2A 3W24A 3GM8A 2NT1A 1ZB5A 1GJUA 4TXEA 3AROA 1AQMA 3T08A 1R33A 3LRMA 4MNLA 2E8ZA 4HMCA 4F66A 1GOKA 1PBGA 4JFTA 4ATWA 1GW1A 1UR4A 5M5DA 1HJQA 1R86A 2RGMA 5A6JA 3WUBA 5GPRA 1TCMA 1U2YA 1Q6CA 4AZGA 1V0LA 2CBUA 3ZJ7A 3VPLA 1MXDA 1BVZA 5ECUA 2ZOXA 2F1BA 1OT1A 3LPFA 3NJ3A 1L0PA 1E1EA 2J7EA 1DP0A 1I1XA 1JDDA 1K9DA 4YHGA 1BYCA 3OB8A 1Q6DA 3ZO9A 3EMCA 1JZ7A 3RJXA 4P8UA 2EXOA 1TUXA 2XSBA 1QI2A 3T2QA 2OSXA 1JAEA 3GXPA 1CXEA 1JYNA 1GORA 3W29A 3N12A 4TVDA 1W9BM 3AJ7A 5BROA 3VMPA 3N9KA 1PX3A 5E1QA 3VD9A 1H0IA 3OLIA 1E4NA 2W61A 2Y4SA 4K68A 4CD5A 2XUCA 4MNKA 3TV8A 2G3NA 1JNEA 3RIKA 2J7DA 3WY2A 3WDRA 4UOZA 2WMIB 1UG6A 5M03A 2V5DA 4PSRA 1W3JA 4W5ZA 1VENA 5JBEA 3W0KA 5I6SA 1TR1A 2NT0A 3K4AA 3S2CA 4R27A 1TQUA 1E5NA 3VMOA 3BVVA 4DUXA 3NIYA 1UYQA 4AZIA 3SUTA 1EH9A 1CLXA 3SUVA 3RM4A 1CBGA 2VC9A 2ZUMA 2J62A 4H7VA 2IXVA 1JDAA 1MW1A 1B30A 7TAAA 4EAMA 3CZKA 3WY4A 3FN9A 1LL6A 4W85A 1IZJA 1A47A 3WBAA 2C0HA 1E6ZA 2IXUA 3VNYA 4QFUA 1V3MA 4W8AA 2B31A 5AYIA 2C7FA 4AEEA 3WY3A 1C8QA 4OJYA 3D5HA 3BAIA 5BXRA 3UESA 4FLSA 1UD3A 3W37A 1K9FA 1E40A 1HJXA 5E9AA 4XZWA 3WDIA 4UFKA 4PYSA 1KTBA 3PZQA 5M3WA 1KXHA 3SUUA 3K8LA 3A4XA 3EYPA 2CXGA 4HPHA 4CCEA 2ZUTA 3KEHA 1E56A 5FL1A 3WNMA 1CGWA 1KGXA 4R5EA 2YOCA 2BY1A 1H1NA 2VX7A 2BXZA 1ECEA 2CETA 3WNKA 4FF5A 2VMFA 4HOZA 2X2YA 1HJUA 3DX4A 1E70M 3VDHA 6TAAA 1X1NA 5LA2A 2BS9A 4JHZA 1TQWA 2BHUA 1CDGA 1CXKA 3MO4A 1H5VA 3MUAA 1IV8A 4MNJA 3W38A 3WH5A 1R75A 3PBGA 1ODZA 1LQ0A 2ZX9A 3M6DA 4U31A 4E2OA 3VOCA 3ARVA 1QHPA 1JAKA 2NSXA 4HA4A 3WQWA 2YBTA 4AMXA 3LMYA 3ARTA 3N15A 1WDQA 2VR5A 3AZRA 3A21A 2W67A 2DSKA 1RP8A 5A69A 3AHXA 2EPOA 1VAHA 2X0YA 3VIGA 1UOKA 3N04A 1T0OA 3WH6A 3KL5A 3VUPA 3RDKA 3NYDA 4GIAA 2YFOA 1OD8A 3QHNA 2FHFA 4B9ZA 4GZJA 3KE0A 2VX4A 5DEZA 4F8XA 4NSBA 1DWHM 1X6NA 4OKDA 1VEOA 1NP0A 1OBAA 4GPNA 1VJSA 5HPOA 2WZHA 2PB1A 1UH3A 2V38A 3CUIA 3ZT6A 3WNLA 1JF6A 3M7SA 1C7SA 1XCWA 2WHJA 3CHFA 3ALGA 3GBDA 1B31A 4M56A 4CGTA 4MTVA 3WKZA 1XSJA 5CGMA 4ZE4A 1HL9A 4ZFMA 3VD4A 3N18A 2UWFA 3WF0A 3NUKA 4MPKA 2ZXQA 4WLCA 1E5JA 3CHDA 1CECA 2Y5EA 4IISA 1HIZA 3EJPA 3L4ZA 1OD0A 4QAWA 1LWJA 4TTUA 3H53A 1NWSA 3BMWA 4AW7A 2WLZA 4RL3A 3AZTA 4NF7A 2J25A 5A2AA 4CN6A 2OYLA 3GXNA 1BYBA 1KXQA 2ZUWA 1QI5A 3EJTA 1V6VA 3PZOA 1FH8A 2O9OA 1X6LA 4UFLA 3BLKA 4W5UA 4PCSA 2XN0A 3EDDA 1UR2A 1V08A 4PMNA 5E6ZA 3BXWA 3RM9A 1PZ3A 3BLBA 2FGZA 5AYBA 4QLLA 3WH8A 2WMHA 3W26A 2YLAA 4W7WA 4XUYA 4MB4A 1O7AA 3DYMA 3PZMA 1UASA 2WCGA 3BVWA 1G9HA 4AY1A 4M81A 2D0HA 2J75A 4UOQA 3MUIA 1ZBKA 3SCWA 1BG9A 4JL2A 2BV9A 5AC4A 4BZYA 4CVWA 1CNVA 2ALWA 1V6UA 2AAAA 1M03A 2DH2A 2VT0A 1EO7A 3B9DA 4GZEA 1JZ4A 1UA3A 3AOFA 3OGVA 1ESWA 3A22A 3ARQA 4PMUA 2OWWA 5I2UA 4GO8A 2EPLX 4UFJA 2QV4A 3QHOA 4HZ8A 1V03A 1W91A 3HG4A 2BHZA 5FIPA 1KCKA 5CLTA 3CZNA 1J12A 4GQQA 2WVVB 1UKQA 2G8ZA 2W63A 4PTVA 3W4RA 5A8MA 3UETA 4KGLA 3EDFA 1R7OA 4P7RA 1Q6FA 3VIMA 3U57A 2GDUA 1UD2A 5EFDA 4W7VA 3A5VA 3BUPA 3AIVA 1HN1A 2VCBA 1KQYA 4BS0A 3OLDA 5HOSA 4EK7A 2QLYA 1W32A 3OIHA 7CGTA 1G1YA 2UY3A 2ZXAA 1AQ0A 5A8PA 1H2JA 4TOQA 3NDYA 2BVYA 4PCTA 1UWQA 2BXYA 3IAPA 4LX4A 4QCEA 1Z32X 1UKOA 3D3AA 1H41A 4M80A 1GZJA 1HKIA 5DT7A 3TP4A 5LA0A 1W1TA 3VIIA 2YIHA 3BAJA 1E73M 3CHCA 1BTCA 1FFRA 4DO6A 1CWYA 5DO8A 3POCA 4JIEA 4HA3A 1MWOA 4NX0A 1E0WA 1BYAA 1JFHA 2J7BA 4UQAA 1WO2A 3LPPA 1O7DC 4IPNB 3PTMA 1W1VA 5JUVA 4HU8A 1WNOA 1XH0A 4E4PA 4B15A 2VZOA 2DT1A 2FHBA 2ESCA 1CGVA 1TQSA 4CU6A 2W4XA 3ZSTA 1EA9C 2IUZA 4W93A 1UZ1A 2NW0A 4DO5A 1E6XM 2ZIDA 4PMQA 4ZEPA 4MB1A 1XC6A 5CPQA 3AMKA 2J4GA 4TUFA 5GNXA 3RPMA 2QMJA 3DX0A 4U3CA 3AMCA 3AYRA 2XFRA 2O9PA 2ZICA 2CIPA 4AZCB 4CN1A 4JFUA 5CZKA 3ZR6A 2JIWA 3UERA 3JUGA 1TZ7A 4FLQA 4AYGA 1R34A 2EPNA 5C8BB 4H8UA 1UH2A 4H8VA 1OCQA 4U5IA 3DDGA 5E70A 3AHYA 5JIPA 8A3HA 3AMLA 3AIBA 3BAWA 4M24A 3BC9A 1RH9A 1EOKA 3WL1A 2G41A 1WDSA 3T0DA 2Y2WA 3PTQA 2WHMA 1PJ9A 3FXYA 2PI6A 3B9AA 1QNSA 4B9YA 1DWIM 1QW9A 1HL8A 2VZVA 4PMRA 3BUQA 2J7FA 2WBGA 3F5JA 4AZ7A 1BFNA 2XIBA 5IFPA 4UFHA 3WELA 4FLOA 3VM7A 2ZXDA 4GINA 1QHOA 1VFUA 2XIIA 2Y8KA 2WC7A 1FH7A 2OSYA 1HNYA 2GJRA 5I5RA 3APGA 2EJ1A 2YBUA 4W8LA 2EACA 3WUFA 4Y7EA 1UHVA 1V3IA 2W66A 3L4VA 2VL4A 1U33A 1WB0A 1QPKA 4D6IA 3VGDA 1XSIA 2XJ7A 5FKYA 1EO5A 2WHKA 4AMWA 1MQPA 4PBGA 1UD4A 1C7TA 3AICA 2VRJA 2GVYA 3E1F1 1C8XA 4UQDA 1B9ZA 3CO4A 1H09A 1W9DM 3SUWA 3PZUA 4OZOA 3TTQA 3VINA 2Y24A 3VIFA 2WVSA 1XSKA 3AS0A 4M29A 1XGZA 4D1IA 1BPLB 2F7QA 4URIA 2JALA 2YA0A 2E40A 5IDIA 1MYRA 3CZEA 2CITA 2YA1A 1VFOA 3NDZA 4CU8A 1E15A 1V02E 5I24A 3O2LA 1J11A 4DUVA 2WMKA 3IANA 1TMQA 1BGGA 1PZ2A 4KH2A 5KZ6A 4OBRA 4YPJA 4UTFA 1JNDA 2OWXA 1CYGA 3AHTA 3N17A 3POHA 1C92A 2F8QA 3RJYA 3VGEA 1E3ZA 3ARRA 1AMYA 1KXTA 1PIGA 1JD9A 2PWFA 3DDFA 1BLIA 3WDPP 4FMVA 4TTGA 1KQZA 2CCRA 3SCVA 2XVKA 1UWSA 3H54A 3SCOA 2WNWA 1CGYA 1GQLA 2VVNA 4AIEA 1VEPA 4MADA 3CZJA 2XVNA 2FGLA 3GDBA 1RPKA 3D52A 1V0KA 3GNPA 4P8XA 3AIQA 1R46A 4BQ2A 3M07A 5A8OA 4PRWA 4LXFA 5I79A 3H55A 3W81A 3I3DA 1OGSA 1HJVA 5CPSA 4AZBA 2UY2A 1QWNA 4RE4A 1G94A 1VIWA 3KL3A 3TA9A 3MI6A 2ZUNA 1QWUA 4AWEA 1C90A 3TONA 3WNPA 1GHRA 3WFLA 3VGBA 1CXLA 4MDOA 1LL7A 1EHNA 1UR9A 2FYVA 1E4MM 3ZR5A 4L4OA 3A3HA 2DSUA 1L8NA 4OOZA 4Z2JA 5A6KA 3FW6A 1EDTA 4ZE5A 3EDJA 1V6WA 1OINA 3MUY1 3W6MA 2XN2A 2ZX5A 3MKKA 3SCTA 1XH2A 3GZAA 5I78A 4AIUA 2G3JA 2ZUVA 2A3CA 1S46A 1E6SM 1VBRA 4H8HA 2VQTA 2E9BA 3EJQA 2DDXA 3EJUA 4E8CA 3WH9A 2OYMA 1E3XA 3CBWA 5ABHA 2IGTA 5EFFA 4D6JA 2E9MA 3F5LA 3BGAA 2DPEA 4U3AA 2BFGA 3W27A 2G3IA 2VX5A 3PZGA 4GI8A 4P7QA 3WDHA 2WMGA 5ABEA 1UWRA 5A6LA 2HVMA 3OBAA 4ATLA 3VKKA 4B3KA 2XM1A 1UR0A 4U2ZA 3BAYA 3IK2A 4W8BA 2PBGA 3CV5A 4CN4A 5BXSA 2Y8VA 3SUSA 1UUQA 1H0GA 2QPSA 2A3HA 3HJEA 1UD6A 1UWIA 1JYWA 4BQ5A 1LL4A 3BH4A 4W87A 1E6PA 4J3UA 2WW5A 1BHGA 2F7PA 5D4YA 1B2YA 1MXGA 3HG5A 3CHEA 1EDQA 3VM5A 4C7FA 4PMXA 4FNTA 2VNCA 1NOUA 4NZFA 2CPUA 4U5KA 2FDMA 3WENA 3VX1A 1UKPA 5BWFA 4NXKA 3MMUA 2FH8A 3RM8A 3W25A 1WP6A 5EBAA 2A3AA 3N1AA 2DIJA 1KWKA 1QI0A 3DYPA 2VI0A 1PPIA 4Q7NA 2YKKA 1HVXA 4DWSD 4C7GA 3N11A 3CTTA 3MV01 5BRQA 4NRRA 4XB3A 1WDRA 4H41A 3THDA 4PMDA 2F7OA 1YHTA 4GQRA 2D1ZA 3AXXA 3MANA 4XV0A 2CBIA 2PWGA 1EIBA 2FH6A 1GQIA 1XRVA 1UA7A 1JYVA 4XZBA 4UQ9A 1H3GA 2WCAA 1CXIA 1KGWA 1QBAA 4PEEA 2YL6A 3S6TA 4W7UA 3IJ9A 4XX6A 4FNSA 3NCOA 3VD3A 3DX1A 2VJXA 2F18A 1UWTA 1CXHA 2WKGA 1US2A 1WZAA 4KMQA 1VEMA 1E43A 2DQXA 5DT5A 4BA0A 4GKLA 2WLYA 3WDQA 3GXMA 3IAQA 1IZKA 3LPGA 3D50A 3WQ8A 4DWSA 2WVTA 5BXTA 3MSDA 1CGUA 1GJWA 3WF2A 2WZIA 1VB9A 3SCUA 2V3FA 5CGTA 5EMYA 3TTYA 7A3HA 5HDRA 2WBKA 4X9YA 5GNYA 1MW0A 5M17A 5ABFA 4Z2IA 3GNRA 3DHPA 4W88A 4WKHA 5C70A 2X2IA 5CPTA 5D9NA 1LWHA 2ZUUA 1UD5A 2BY2A 3WEOA 5CXPA 1WAWA 4WSJA 1MVYA 1UKSA 2WANA 1HT6A 4DO4A 2ZWYA 2PBOA 3FAWA 1SFSA 4AD3A 1E55A 1SYTA 2W92A 1DTUA 3A23A 1QNPA 1UQYA 4MNMA 2D73A 4PTXA 4D72A 4MJ2A 4PMYA 4IPLA 2WSPA 2CBVA 1GQKA 4TVCA 3BCFA 1J0ZA 4W84A 3ARXA 5E0FA 3AS2A 3GH5A 4PN2A 1WCGA 2WMFA 2WXDM 5CG0A 2YJQA 1HXKA 5FD0A 1JZ6A 2J7GA 4HZ6A 4OBSA 4JAWA 1KBBA 4A4AA 4HOWA 4N42A 5GQBA 4UZSA 2CEQA 2X1IA 4HP5A 4S3JA 8CGTA 2WM0A 4JZ5A 1PX8A 1W1PA 1J0KA 4D6DA 1HKJA 1BVNP 2ZXBA 1BG4A 2UY5A 2PC8A 5DF0A 4PMZA 4WF7A 4WSKA 1JI2A 1H49A 3VILA 5HXMA 4J3XA 3WBEA 5D9MA 1F4AA 2D3LA 3FHQA 3DHUA
chains in the Genus database with same CATH superfamily
3BO9A 3DI1A 4K73A 5FA5A 1XGRB 4EWJA 3JW7A 4JFOB 4K8RL 3TOPA 4BHUA 1RZJH 3JT0A 2HZHA 1FORH 1KLGA 5LLIC 2XN9B 2CNYA 3WV0A 3ILPB 5FGBC 5HGDA 5E5MB 1T2QL 2BWIA 4O0QA 4S3GA 3F6LA 3E2SA 3WBWA 1KIPB 4LNRB 1OE2A 8XIAA 1BVLA 3ORWA 3H12A 4FQHA 3SURA 5ES4B 5I5IA 5K39A 2I57A 2I9TB 4Y5XA 3OAZK 3HB3D 5L6UA 4XBSA 3PGDB 3U4EB 3MJ9A 1IZCA 1SW0A 4JE4B 4NO0B 3U4BL 1TENA 3O81A 4J4PD 1NM9A 1TPUA 4G6AD 1RIVL 3NM1A 1A1MA 1NGQL 3PWNB 4NBZB 4ZRGA 1R0MA 1WUEA 4EZLA 3HAEG 2FD6H 1UKTA 3SY0B 3DJSA 1A1OB 5JYMA 1C93A 1ROWA 2RQEA 3A47A 3CDZB 1LBLA 4NP4H 5DMJB 4GNJA 4OUIA 4D6CA 1CO1A 2ZUSA 2L5HA 2EE2A 4UMSA 5I1LB 5DJDB 3QCUL 2NYKA 1MRFL 2XA8H 3QFJE 4ZI8A 1NFDE 4V1YA 3H2WA 5FJIA 3T44A 3VWKD 3KM1A 1FA2A 2PCEA 2VC5A 1PS9A 1NOWA 2BP0A 2EUXA 3U9IA 5DMNA 4F91B 2H26A 3G0UA 5T1KB 1Q9LA 3EF4A 1TE1A 2O9RA 5D1ZA 4F9DA 1KTDB 1XL6A 4NN7C 3VW3L 5DK0A 3O6KH 4DN3H 3W00A 1K85A 4S38A 3HI1B 1I7RA 5I82A 1ASPA 3QFEA 2DWYA 2P8LA 2F19H 4RDZA 1YEFL 3RMJA 4NVTA 4DKEL 5LGYA 2E5BA 1N8ZA 4E8DA 3V6ZA 2R0KL 1XIFA 1MCKA 1RVFL 4PPTA 3HRZB 1TO3A 4IXHA 5EB9A 2J1KA 3BT2H 1NCJA 4RX4A 2JCCB 4FTVA 1MFAL 1TQVA 4EOWH 1QSFA 2YK1H 4ZX6A 4OV5B 5AKRA 1UIPA 2ACRA 3O2WH 2NPLX 1N0LB 3I3BA 4Z7UE 2Y69B 3QQDA 3KGTA 1XF3A 4HMEA 5HYIA 5C2XA 3B1UA 3MV11 4DEPB 3IJHA 3OKLA 2QVFB 1HWGB 3RY6C 5JQ6L 5J57B 1IBDA 4I3SL 4DKDC 5FB8B 1F1GA 4P7OA 5L4JA 3IXAA 2APBA 3NFSH 5D33A 4ICWA 2VDPH 5FHAH 1JCJA 4NWUH 5DHYA 1F6LL 1AYRA 1KN2H 3S98A 2CR3A 3CHOA 3NIFE 3QG7L 3QO1A 2VQUA 4GMSH 3PWUA 2X4OA 4GW4A 5FO9A 1UYWL 3OLGA 3G04B 1EJTC 1W1IE 1A1NA 3L2IA 1Q72H 4JTEA 4JQIH 1I60A 4I7VA 1MW3A 1W0YT 3FO1B 3S5SA 2XH7A 1NDVA 3EBGA 1SUJA 2F84A 4P8QA 5F1IA 3I4KA 3QUML 3N1QC 2CLEA 3EUDA 1KKOA 1DL7L 1RLDA 3RU8X 5K9DA 1MCBA 1TQBC 3KS0H 2G4JA 1EQCA 2KX9A 2Z6JA 4KEVA 5AFDA 5I03A 2APSA 2GJXA 2CKBH 2ADJB 3SO3B 4LASL 1OT2A 1TJGL 2CNZA 1JERA 2DYSB 4R4BB 3DO4A 3MRPA 3CHPA 4Q6KA 2EYRB 4U1IA 2A6DB 3PWPD 2Z8SA 1IC7H 4U6HA 3QZ6A 5E9DB 3S42A 3BUIA 1S5IL 3UXFA 1XLBA 1HZKA 5KVEH 2JLLA 4XVJL 3QG7H 4GMSL 2F58H 1BKHA 4X3ZA 1D7FA 1D7DA 1P4LB 2GI7A 2VRQA 3KPQA 1BYDA 5E1AA 3VI4B 3KOYA 3LERA 1Z5HA 2DM4A 4G5AA 4PP2A 3NOIA 1R0AH 4O1FA 4TRPH 5ACZB 3VX0A 4AMCA 1J5IA 1W0WB 2GBUA 5DEGA 4DN4H 1KM1A 3F4VA 5LO7A 5RUBA 1VCGA 4M6AA 3V4PL 4J6RH 3PG8A 3E2RA 1FVEA 1GZHC 1NKOA 3HE6A 5D2LA 1QG3A 2EXSA 3GKWH 3VXRD 1NSJA 3XISA 2HKHL 3C5ZC 3WTTA 3Q94A 1XLEA 4Q32A 4IKIA 3HQOA 2F5AL 2NWSA 3T2OA 2RD0A 1S3TC 1J1PH 1CTNA 2NUWA 4F0RA 5LA1A 1Q8JA 3D2TA 2W62A 5I0XA 2L7QA 3QYSA 1KCVL 2XVGA 4B9IA 1ZXKA 1RVFH 4F1ZA 1FZMB 4X9HA 4AC4A 1U92B 8TIMA 2GJNA 5AYUH 4GPVA 1VPOH 2GG1A 2EC9T 1N5AA 1T3FB 2HFTA 4JVWA 4A3YA 3GFUA 1P7TB 2A9AA 3HURA 4JQIA 1CTMA 1MWAL 4FFYL 2JKXA 4HBQA 4GMTH 2QQNL 4B6ZA 3TEUA 3GMQA 4F9LA 2FJGB 2OW6A 4E3TA 3MJ7A 1AGDA 1M05B 3TCXA 4YLCA 4Z7WB 5B21A 2DV0A 1OP9A 3TK7A 5FYLH 2WPGA 1MCLA 5K1JA 1DQDH 1ED3A 3RUGB 1AG1O 1XT5A 3E6FB 4J3OC 1B2WL 5EBGA 1SFTA 2BNUA 4KS0A 3UGXA 1X7FA 4CSZA 4JTKA 1TIUA 2GJPA 3LRKA 4CDGC 2GKIA 3II1A 4KRZA 4LVAA 2R82A 4JFFA 4H8NA 5EIIG 3QPXH 4NC2B 3FK3A 4ES4A 1JGLL 1G4MA 4LT7A 4UQBA 3FJ4A 1H15A 1QVBA 1J9YA 1NPJA 5E8OA 3OAYK 4Z2HA 2F54A 4HCRA 1M5WA 5IY5B 1YNLH 5HGHA 5DSCB 1NOFA 5LAXA 3VKDA 1F8MA 3VDBA 4PMFA 4AIOA 2DQTL 3B37A 2DN7A 3BFQG 4QHNA 2A9MH 5C07D 1QNVA 4CD8A 4IOFC 2E6FA 2YZ1A 1L9RA 4BK5C 5BRZB 3ZVIA 4BCEA 2WZEA 1QVOB 2YPLA 2EAWA 4QGCA 3HKZA 5ESAA 4QE4A 4NZUH 2JIXA 3BZ4A 1ORQB 4GIEA 4QM1A 4YLBA 1RZJL 4HKXB 4OGZA 5KSBE 1DVFA 1OGAA 1TG7A 1AW5A 1D9KC 1QR4A 2FDBP 3U0WH 1JXFA 3MRCB 4FQLH 4EKJA 1DHKA 6XIAA 1N5AB 1T3FA 2IDTA 3ITVA 2AXFB 3OR6A 5TK2A 1XEDA 4R8WH 3UZXA 2GUYA 2LTQC 3R58A 2DQIH 3CQ0A 4Z7VB 4NNAA 3W2LA 2HT3D 5CJBA 1KBGH 2CA4A 2OQHA 4AVIA 4LAJH 4RUBA 4HGMA 3AZUA 4ODSH 5HGBB 1MRQA 1PKYA 1RIUH 1V3JA 4WSGA 3P0VH 4C58B 1OF8A 1XX1A 5IXEA 4K15A 3MUCA 3FFOA 3FTUA 4LHQB 2V6AA 3NCCB 3OSKA 1BDYA 3BVTA 3HN3A 3K6FA 5MEPB 1F4WL 1DJSA 3ZTNL 4P3DA 5AKTA 2BM3A 4TQEH 1VPYA 4H9UA 2ARJB 2CLRA 4H2HA 1QAWA 1W0WA 4XCNA 3ZQ9A 4GIYA 4MCNA 3MR9B 2WXPA 2H4EA 2AZUA 2IDFA 5L9DH 5D5MA 1QTPA 3WLJA 1P4UA 3S97C 5F6IB 1EP3A 2BHYA 1GR7A 2C9RA 5I1CL 2WINB 5LDUA 1H3VA 2FBOJ 4F8TA 1UPPA 4B5WA 2QIWA 2J88A 5IBUG 4KDTC 2AMGA 1Y5WA 5LUMA 4OTXL 2VLJE 2VDQL 2W6RA 1MJ8L 1KV5A 3J7HA 4KCVA 2YXXA 5KTEH 3C2AH 3L4CA 1MEXL 4Y2NA 3RHWK 2OCZA 4MAYC 3QJFA 1E72M 1YO4A 4FI4A 2HRPH 3MV9E 3W7JA 5D1XA 1T8QA 2R2BA 3TC7A 3ES6A 1BBDH 3DX2A 3VUAA 4NZDA 1FBAA 4YH6A 2BOEX 2Z27A 3RM8A 3TC6A 4ECLA 4ZSTA 4Q7IA 3T0ED 2JE8A 3WUEA 2GBTA 4E9LA 3I75A 2SODB 1DR9A 2WWKO 1INEL 1FZOB 4L6OA 1YEIL 4DZAA 4UT6A 1ANUA 4NM4H 3PHSA 5LHDA 1K8DB 3NIDB 3S9DB 4RV3A 3TN6A 1JV5A 1K4DA 1ACZA 1XD0A 3ZTCC 1ADQH 2HFFB 5EEVA 4Q8TA 5DVNA 3DWTA 3K5RA 3Q2NA 3RDTB 1A6TA 4W9IC 4ZO6A 4DGYL 1QR1B 1DHPA 3NL3A 3UT0A 5JQ9A 5FHBH 1MRCH 2JGQA 1NQKA 4OIIL 4UM9A 1PWMA 1F13A 5FB8A 4C4UA 4WHTA 4HIJA 1AJ2A 4EXPX 1ITXA 1EDGA 4YDJA 5C09A 1WBXB 4QG8A 3VFVB 3N2CA 2OX1A 1FWWA 1E9PB 2E4FA 3SGUA 2XVPA 1XO8A 3BAKA 1IIKA 2CKSA 5J6GB 1NVMA 3NIFB 2DZXA 2JEPA 1HI6B 4PQXA 1HZYA 2Y5JA 2I7GA 1ISZA 2XYLA 4PSPA 3F2CA 4L8CA 3WIJA 1G01A 1H7WA 5F7EL 3DXAD 4WIQA 4DFIA 2WZMA 4XN1A 2XG5A 1RMFL 3FT9A 3V6ZB 4PS4L 4AYFB 3US0A 2H0PA 1UQSA 2EH8L 4JLRB 2X0HA 4NHCL 5ADPH 3CT7A 3QDGB 2DQ6A 1J5DA 4X83A 4JPWL 2BX7A 4I48A 3L0NA 1JTTA 1RY7B 3KLLA 1YQ2A 4OGAD 4FJYA 5AB9A 3TBWB 3KZSA 4CW1A 4LLYB 4NWTL 3VYPA 3OKKB 3IVTA 2O92A 3ARGD 3CZGA 5CLXA 4HIXH 3HG2A 1Q13A 1KV3A 2L3BA 4YFDB 4GO9A 4L8BB 1EYEA 3T6VA 1W2PA 2P5NA 2QPFA 4FFZA 5DD3H 4AHPA 4XZIA 4ZXBA 4AQ1C 5IBTL 3Q58A 2C5DC 3C9NB 2R0WH 1SMOA 5EUOF 3OKEB 2APFA 3JV0A 3OMIB 1VIZA 2Z4GA 4B5VA 4JG1H 3WUZA 1AHWC 5GRVK 4N2BA 5DFVD 3CFNA 1PZ1A 3FY1A 3LIZL 5FJPA 5AL8A 1PYMA 3D4ZA 1TRIA 4HXBL 3NA9H 1XPGA 2BP8B 1ZCRA 2R2HB 3HV8A 2YEVB 3VXUD 1N9PA 3G6LA 1SMDA 1LG2A 2AXGB 4BIKA 1ID2A 1FP8A 1LUCA 3RPTA 1KC5L 2GQ8A 2FO4B 3QV9A 4KTEH 3WY1A 4PJCB 2IV9A 2H41A 4PD4K 4O53A 2NUTB 3OGRA 4YGVB 1FN4A 2ARJQ 4YHZL 3DX3A 3O2DA 3N6JA 2X3BA 1MHPL 1TQTA 2BY3A 1RXLA 2Q9OA 4NYLA 1SMAA 5FIEA 4W70A 1EPVA 2X3AA 3LKPA 4CKQA 4ZW6A 2YS4A 2LLEA 1BFOB 2ZUXA 4CQAA 1NFPA 4JNYA 3EKCA 5C7ZA 5L88H 1J05A 1X7QA 4MSWB 4L5FL 3UYPA 1HGYA 1A4JA 2OMXA 3NRFA 5C0CB 5HYFA 2WJ5A 3T6XA 2EEAA 3VXQB 2XKSA 1MNUH 1J5OH 3PSVA 4Z3JA 3OHXB 3WFAA 1HP4A 4QRTA 4NX5A 3NZUA 1AXTL 3LEPA 4DBSA 1AH3A 1I2QA 4RGND 2VENA 3LRSA 3WFZA 3P8JA 1DOSA 4Q9BA 1ZZMA 4J3OD 4MNHA 3WLIA 4ZGYA 3QHMA 3GLDA 4DPBX 4QTGA 3FSVA 2J78A 1US3A 1B4JH 4HKJB 1HESA 3KW3A 1F3RB 4KUCF 4XHJD 3M5ZA 2NY1D 4NNXB 1RVGA 1R3RA 1KN4H 3L66A 3GD1C 3WEMA 4B27A 4FERA 4FYQA 1IAKB 4QS5A 3QXUA 3H23A 4UXDA 1G1OA 3HNSL 4AVJA 3K1DA 4BBWA 5LKYA 1JF1B 1W3LA 4O54A 1TIMA 1R24A 1S9WA 2G5BB 4HQQH 5C7HA 3LN3A 3AT0A 4TNWF 5IB1B 1BQSA 4EI5D 1POKA 4KKAD 4UT6H 2V3EA 4B9PA 4C56B 1E51A 3VXGA 2OI9B 4GRWE 1UADC 5KVFE 3ZBMA 4MAVA 5ESQA 2ZJSH 2ICCA 2VM3A 5L6YL 2B4CL 1AZ2A 2C8NA 3JTBA 2WMJA 1E6NA 1PKQA 3VZXA 3PBVA 4Y19D 4Z95H 3V0EA 3LZLA 4M4RA 1I0DA 3K6DA 2WXNA 4XAKE 3UC0H 2DW7A 4N0FB 3GGWB 1QI4A 3NSCA 1PDKB 4QTHB 1AO7E 3WTSA 4P2OB 2NVAA 1DVZA 1BXBA 1YBQB 1Q94B 1VZGA 1R5IA 2EDFA 2E4TA 5DMIH 1KGUA 1OAUL 2BW5A 4N2LA 4BK8A 3EGSB 2LVEA 1FH5L 1E7UA 5MKGB 4FL4C 1WPCA 5IVXB 1WD9A 4G9DA 4PRHA 5MEOA 3PZTA 4P23B 3NH7H 4I90A 4LYPA 1FVDB 5DRNB 4UYPA 3SQRA 4FX7A 2KPWA 1IAMA 3GDTA 3P9LA 4YAQB 3DOIA 1TITA 1NC4A 1PHWA 4YE0A 4JCMA 1QSEE 2OMYA 1ZGDA 1T1YA 5D6CB 3BIAX 1FSKC 4BINA 1RCYA 5SX5K 3ROOA 2VDIA 3ANVA 3CXDL 4M1GH 3H2NA 2HG0A 1AGBA 4F2TA 5K2ZA 2Q0ZX 4ADGA 1TJHH 2WQUA 4P5RA 2QV2A 2J6WA 2VDPB 4FNPA 3WS3A 3RRXA 3LQAL 2GB2A 3NJIA 5HVGB 5GS3A 3TBSA 5I23A 2EZ0C 2AKRA 1LO0H 2Y1ZA 3FUJA 2HISA 3FCGA 4X6DA 3T4YA 1CLYH 3UDWA 3ZHLA 5EEYA 3EWWA 1E5UI 4JX0A 1RZGA 2CQVA 3EUUA 5TD4A 4AJ0A 1IGCL 4NERA 1GOQA 1KCZA 3QV8A 2H1XA 4MNGA 4MDPA 3E38A 1X5FA 2G5BA 3LS5H 5ICXA 3RWFB 4G2AA 2I24N 3PAVA 3TYGH 3MXWH 4GIPD 4MDRA 4P57B 4Z78A 1VZHA 4HJGA 3BG3A 3IFPA 1J01A 4PMNA 4GY0A 3WMBA 4QCFA 4XP9L 4D1JA 2KDGA 1X39A 4G42B 3CZ8A 3DX8B 4NO5A 5AAWA 2HFEB 5CNHA 5I0DA 3OL2A 1WKYA 3TUUA 2C9SA 1GS7A 1TFVA 1LXMA 2V7NB 1NSNL 5G4WA 1N70A 1MKFA 4TO8A 4D0BB 1SXNA 3W7NA 2V9RA 2E27L 3N2BA 4JO1L 3V5DB 1FCUA 5K7JA 3VWKC 1HJSA 4GSQA 4JRXD 4ALAH 1A3HA 5F4SA 3EGXA 1ZAIA 2LGNA 5E6IC 5E6UB 1TU2B 3NACH 2LLGA 3MMEB 1I7ZB 4EI0A 3TYGL 4OLUL 2JKRM 4XZUB 3WSQH 4OQ1A 3K2UL 3G1AA 2XPKA 3V9EA 3IETA 4WI4A 2IBZX 4WFGE 3UG3A 1U6AL 1KWGA 5E4AA 2J9YA 1A0EA 4NQDE 2DH3A 3ARUA 2XRAH 1BV8A 1IGFL 2C3XA 3P4NA 5F1OB 4H7CA 1MRDL 4AV5A 4PS8A 1KCLA 4HW6A 1VD6A 4PJ8D 2P76A 2Y2TA 2DW6A 3VD1A 2YDSA 5A6BA 4Z2JA 2X6AA 4HUWA 2EBNA 1ZHLA 2Y7MA 3QFJA 4UTCA 3SCNA 2D20A 3AIRA 2DEYX 2BNRA 2AZAA 3SIMA 1PG7W 2PCFB 1F1DA 4OZIA 4YHEA 3PBWA 2EDOA 3CHRA 5HAOA 3VU2A 5AUMB 1AQ8A 2E7LC 1MCDA 3CLEL 5C0GA 1KTNA 4RRPA 3CC5B 1W17A 3XINA 5B1JA 2IANE 3ETBF 4F58H 5TQ2H 4E5TA 4K71B 4O5LL 1NQ6A 1ML0A 1FGVH 2QGDA 2AOSA 3WNNA 5TE4H 3E5PA 5C9ZA 2APVA 4D7PA 3FULA 2QSCH 4IMLA 4OCRL 4BFIA 1TTPA 1ZGLB 4OZIB 3WLHA 2APWA 4P3CL 3UACA 2R24A 4ZO9A 3QV6A 2VE6B 5EB8A 4KQ3H 2J6EH 4F8OA 4IBLT 4C91A 4B96A 1XC4A 4PGEB 1NL0H 1UP0A 5JBDA 1D9KB 2CHNA 1WWBX 3B2UC 1KB5L 3BUBA 3FTZA 2BP5M 2X70B 2QCFA 3GHRA 3HLAA 1FFNA 4KWUA 5A6MA 4LCIH 4TX8A 2EDDA 4E36A 4UWMA 4F8PA 4N0RA 2EDKA 3O2VH 2XFYA 1JZ3A 1L9OA 2BC4B 3HPLA 4UTHA 3SCQA 1CF1A 3EYFA 2AEIT 4J23A 2WYTA 2XNAB 3OXRA 1JGEA 1DBJL 2MCG1 4QNEA 5LXVA 3H2CA 3B5TA 2IPFA 4HJ0D 4D8PA 1IFHH 3IDYC 2DEPA 4DBUA 1WUZA 1KM3A 3QI9D 4PJ7F 2ZQ0A 2VABA 3GMOA 4WXYA 2PCYA 1A2YA 3HZ3A 1QD0A 2ZYSA 4L8CB 3U6RA 3CEPA 2JTYA 5HP5A 2QJNA 1CICD 1JPIA 2X89D 3UAJA 2Z0IA 4ZZFA 1Y7VA 5AZ2L 4C8XA 4DNLA 4F7EB 5IUCA 2XH2A 4JXCA 2KC0A 4XN5A 5HDBE 4EE2A 3QZWG 4DWSB 3NQEA 3GB7A 3MV8B 3NESA 1FH9A 3GTNA 3G0XA 1FPTH 1HHJA 1EXHA 4Y8EA 3LXCA 3RCMA 1QQDA 3BO8B 4KUZH 3VOGA 4L3AA 2DSZA 1HSBA 1NELA 2XACC 2Q8LA 1ADDA 2WWDA 2WQ8A 3RDTA 2X89A 4U1NB 1SUHA 5CGQA 3AMGA 1UD8A 3TIEA 3I9AA 1EJOL 3H56A 5LNGA 1PKNA 3L9BA 2VOMA 4EXBA 3LPOA 5FEPA 5EO0B 1WFJA 4XBEH 5D7IF 3NZGA 4K8EA 3ULUF 3MUZ1 3QI9A 1LK2A 3Q7JA 1HILA 3TH4T 1T03H 4IPJA 4PJEE 4TNVK 3ZT7A 2X1TA 2GJ6E 3K80A 4B53A 4WD0A 2NY2B 4ZTOL 3ROOB 1ITUA 1WUNT 1YTKA 3QGVA 4Q33A 4DELA 3RX5A 4JFZH 2O0TA 2WO4A 1HYSC 1NFIA 4YJ5A 1TQCC 2F8OA 2NR6C 4XAWL 3VCNA 5I3IA 2MJWA 2HV5A 2P43B 1YNKL 3HA1A 4Q3MA 4BH8B 4OGYH 2DY3A 1EXBA 1BZDA 1XHHA 2EIBA 3RX9A 2VYOA 3I68A 4PLJD 2XQYA 3HZYA 1X1OA 2FE0A 1WBYA 3LIZH 4FNQA 5D1XD 2WWCA 3AXHA 3HFTA 2P4AB 4OZHE 3ZIYA 1FZKB 2Y3NA 4B3KA 2AJSL 3GGWA 4G7QB 4ETQB 2ALDA 3BZFA 3UG5A 1QLRA 1AODA 1L6ZA 1PKQB 2ICEB 3PNRB 4XCYA 4ESKA 5I74B 4LVOC 3SKNB 4ZFOL 1GVYA 4WKFA 2JFEX 4K71C 1AO7B 2I26N 4A6GA 2Q86A 5JQIB 1RHHA 1MZHA 4O13A 1ZFJA 1TJIL 3WN6A 1S8DB 4O52A 1N0LA 4LAQH 1JF5A 5I1KH 3HCVB 4JFSA 4YR6B 5C0AA 1E1FA 1FRBA 3NPUA 2GTWB 1CYWA 1KCRH 3PPEA 4LCCA 4ZBJA 5HHXL 3TTSA 4WI8A 3WS6A 4JL1A 4O2CB 3VQ1C 3GK0A 2FSEB 1PAMA 2WQVA 4H19A 1XR9A 4DJFD 1U8IB 4QRBA 5L0QB 4HFUH 4K3JL 3AIUA 5I66B 4KWSA 1LP9B 4Y2OB 3L7FA 1Z9MA 3NG5A 4XWUA 4ONGL 2WCSA 1JNNH 1WT5C 3O3BA 4NRYA 3PG9A 3WUGA 3NIDE 4KERA 3W3OA 4M93B 4Y1AD 3LHVA 4AUBA 1PZDA 3HE7B 3S5ZA 3LYEA 3R2GA 2J73A 5DYOB 4ADSA 2O26U 1HVQA 3GMNB 1BEXA 1AE6L 3HF3A 1W8EA 2A99A 3NCYP 4RMQA 3A3WA 4FNUA 4WO0A 4G1EB 5DJ8A 3WG6A 4LANA 4YYCA 3OHXA 1QK0A 4Y2DA 1TQBB 4LSPL 5IWLA 4PTUB 4QAIA 1A4JB 3JTTB 2EC9U 4NG3A 2VZ3A 6ALDA 1CGXA 1FBIH 1FNAA 2LAGB 3Q1SH 2IBGA 3F05A 3PYCA 4WJ8A 2N7AA 4U3SB 3FSTA 4HCRH 2NX3A 5TE7H 4O0KA 3RA7L 2JI3A 2NOYA 3MS8A 2APXA 1Q0EA 3V0DA 1IBHA 1H19A 5I1JL 2VM8A 3CFCH 4N1EA 3RE0A 2K6WA 1TLMA 3ETSA 4HS8L 4Y5XB 5HVWA 4YXKL 3BO8A 1AJ7H 3NJXA 4F33B 4X6CF 4TVPH 1CCWB 25C8L 1E2ZA 4IJTA 2W07A 3CIVA 3RAOA 4ZSUA 2E0PA 4GAGH 1S9VB 2YUXA 4C57C 4ZMLA 2VR3A 3C5ZD 3S35L 2I5IA 3VSUA 4F7EA 4OTXH 3CUGA 2DQCH 7PCYA 2NY2D 2ZAGA 1J93A 4NGHL 3RURA 2NY7L 4MD0B 5I15H 1JXGA 3DFTA 5DDHB 4QOKE 3L3DB 4CBZA 3U6RB 1E7VA 3KYOB 5DJXA 3WJJA 2J77A 4JFVA 4Q4RA 5L9DL 1OP3H 2FHCA 3GIQA 4A2GA 4I5XA 2IWKA 3SAZA 1BIIA 1Z0NA 2G60L 4IBQA 4JX4A 1GZQB 2LOEA 4BCZA 2O1AA 3MOAH 4MXQC 1B5TA 2B15A 3FB7B 1M65A 3UWYA 2NR6A 4GEJA 1PYWA 3DSNA 5C6TL 3TZFA 2OT1A 4XE0A 5MEQA 3MOBH 4Q4EA 2Z8VC 5CCKL 2X4SB 3ZMNA 3CUXA 5IMOB 2WSKA 1XGQB 4DWSC 1URIA 2UZXA 4KVCL 2ZBTA 1JN6A 1PBYA 1NCNA 3KPSE 3QDGA 5E1HB 5A2BA 3I3EA 1JVLA 3TURA 3KAOA 3NPSB 1YNTB 4ZDHA 1BXXA 4JM0A 2VX6A 2WJFA 3VSTA 2EE3A 3KYNA 2W9EL 1HKWA 5CBEA 5DXXA 4ONGH 5E1AB 3U2SA 1DEDA 3QQ4A 4M7ZC 4EI5A 3HOJA 4DAIA 1OD9A 3WMSA 3SYQA 3WOVA 3ARWA 3ZGIA 2A6KB 3OJDA 4JHOA 3P81A 1SW7A 5TDPB 4OOUA 2HLEB 1J0IA 2C9QA 2NW3A 3UPRA 4NZUL 1QK2A 1HIMH 4D3CL 3OXSB 2EQDA 3VRJA 2BODX 4YCPA 5FDWB 4JFHD 4LP8A 1DLFH 2E7MA 3QUYB 3QWRA 4XNZC 1OANA 4Z77B 5D72H 3D46A 1ZS2A 4H40A 1NDWA 3WX7A 3VFOA 4AYSA 2EUVA 4CNSA 3CH9A 3A0OA 2V9QA 2VC2B 3LX9A 4FXGB 4N90D 1XMEB 3RI5K 3WE1A 4Q8PA 1Y6NR 1ZLEA 2CWNA 3GJEA 4F27A 3KYOA 2MOGA 3A6OA 1UXMA 1BXAA 3CVHA 3QNXB 4NT6B 4S0SD 4YXHL 4GNVA 5CP3H 4NQXA 5AOUA 4AIXA 3WHXB 1M01A 1R3LA 4A05A 4BR1A 3QSTA 3BLPX 2ED8A 3WIFB 2NUPA 3L4XA 4YPGB 3OA3A 1C8YA 2GEEA 4MA8H 3NZ8B 1JPST 2R69A 4GI6A 3DK0A 4OGYL 4A7UA 1IXOA 3GLZA 1WDPA 1JCTA 4J35A 3BARA 3GC2A 1QBMH 5IQ9A 4OZIF 5J6HA 2B81A 5A95A 1W37A 4G8IA 2J55A 3OKNB 3CTLA 4HJSA 4ODHH 1CZ8H 4AYMC 2CBOA 2XTJC 4HPNA 3P2TA 4F0MA 1LYQA 5KG9A 4QITA 5DFWH 1ZHBB 2OMUB 1ZBWA 3UTPE 2J71A 1FDLH 1KUMA 1J10A 4G42A 1HKLL 3W1AA 1UIOA 4H20H 1KRBC 5SWZE 3QDMD 2E68A 1U3HD 3CWNA 5B7YA 2KS0A 4YFLI 3IMSA 1QHZA 4ZXOA 3ATFA 3ZTJH 3R5EA 3FBQA 2UY6B 3O11B 4WAFA 1M7UA 5ICXB 3VGGA 4Y2DB 5I1DA 1EZWA 2XGIA 4F0HA 2WXLA 3LV6A 4S2SA 1IEBA 1KTDA 4IKKA 4XCFL 4DGVH 4Z5RA 5BNKA 1YVLA 3FB8B 5FUZH 1EP2A 1A6ZA 3EO1A 4OD2B 2ZFAA 3QOMA 4HG4J 1R3TA 4G56A 2MRYA 3FO0L 3OVPA 3PFMA 4ATDA 5EWIL 4GJJA 3HE7A 1NFAA 2Q3XA 3MLVL 5IIEB 1B9BA 3T6CA 1PSCA 1ZK5A 2ZA1A 3QWQB 3MBXL 2ID5A 1UXWA 2XKNA 3IMUA 5J8OA 4WTWA 4S3KA 4IMDA 5FCUH 3VO0A 2G2RA 4TLKA 2D0FA 1SXSA 4TRPL 4R85A 1I1WA 1XR8B 2PW2A 3MKGA 4G6JH 2NQCA 5E0KA 4Q2ZB 2MPAH 3B8UA 2W81C 4TX6A 1EJXC 4LH8A 1KLUA 1R7AA 3FUNA 2WUBH 5F7MC 3SBWA 5C0BA 3AACA 4KDVA 3WF3A 2DQMA 4C1LA 1L6WA 2PYFB 2XXMB 4FKHA 4YSPA 4AM0Q 4HPJA 5L9FA 2RFXA 4AENB 4QDMA 3SJ3A 4RQQB 5DSCA 5HGHB 1E4IA 2CZFA 3HTLX 4L4TE 4ZW7A 3MNWB 3C52A 2C9VA 1CZ1A 3MUXA 3M88A 1H15B 3KZ8A 1CEOA 3K8MA 3WL0A 3LQLA 4PWHA 2F61A 2CW6A 2JV6A 3FC8A 4FZEL 5LCVA 3PS7A 3UA3A 2BB0A 1EJ6A 5FECA 3GSMA 4L29A 4NKQB 4ODUB 2XM2A 3MWAA 3SYOA 2X0WA 4YJZL 3WU1A 1FGVL 4APQC 1XICA 4QTIL 3S3CB 2IQ0A 2R1NA 2HRHA 1DE4A 4TXEA 4U10A 5I3JA 2NY6C 4HX1A 5E9NA 1SXZA 3BH9B 5CINH 5AW9B 1Q5MA 1IGML 3NTYA 3W23A 5DCDA 4WOZA 4YWSA 1D6EA 3LRMA 2E8ZA 4GX8A 3LH2L 1P1ZB 1E6OH 1UR4A 4P2OD 2RFGA 2D31A 1KT2A 4XC3H 4G8FB 4AL8H 3O3EB 1U2YA 3UYIA 3X12A 3B0YA 4OCSL 1Q6CA 2RA1A 4M43L 2K3TA 1NDMA 5CR8A 3MLUH 2EDNA 4UDTA 1M7PA 3ZKXB 4TNGA 5C8JA 2GSHA 4Q8QA 3G6DL 3N06B 3PIQA 1MXDA 3FFCE 1T1XA 4R7XA 1BVZA 1SLWA 3ECVA 4DKEH 4DGUA 5KSBB 2Z2AA 4G7VL 5DK2A 1WQ5A 3NXFA 4XO8A 2F1BA 4OTKA 4PYGA 1DVXA 5DHVA 3MQTA 1IT8A 4NOBA 4LEXL 5AZEL 2J7EA 2AGTA 4C6KA 2YD4A 1DP0A 1BZ9A 2XUWA 2Y06L 1ZLWK 1FVEB 3SKJH 2K6ZA 4X4KA 3CMOL 2WLHA 3F00A 4Z7VE 1Q6DA 2PGRA 1N6VA 4QHRA 3ZE2F 5C1MB 2AAVA 3IJDA 5FYKD 2EUZA 2EXOA 1TUXA 1JAEA 3R18A 3F2LA 3MREA 1GORA 3W29A 4TVDA 4K55A 3PJSB 1WZ1H 3C60B 2CDGB 4JDVA 4L4TA 4RDYA 4AVOA 4KCTA 3N9KA 3IIPA 5E1QA 1KMGA 5FF3A 2QQ6A 1E4NA 1A9BB 4P46B 5AALA 3U4BH 4P5MA 4LEOA 5B4MC 1LEKA 5BNXD 2PGWA 1SBSH 5KETA 2YSSB 1KFAH 2QVIA 3JWNC 4GRLC 2H32H 4PP1D 5KS9F 1SSDA 2ATMA 4Q8WA 1LO0L 3CFJA 4H8PA 5F1IB 4LEFA 1JNEA 4P5TC 3RIKA 3VFSA 4YSQA 2Z2BA 2FFCA 4BWLA 1D5IL 3AG1B 2F6UA 1IM3B 4MNGE 4OGXH 1JUEA 2WMIB 4CEXC 3SGDI 2V5DA 3L1FA 2AV7B 2X4OB 5GRUL 4AC2A 1VENA 3FCUB 1ZGLA 4NAFB 5HDBB 2NV9A 2XG4A 5B3JE 4ADIA 1HQTA 3FGCB 3K7UA 3T77A 3S5LG 4R27A 1CL7L 1GRWA 1TQUA 3KXFA 4LDEB 1E5NA 3BVVA 2YZ5A 3CVCA 1W72L 2NY3D 4XNQB 1UYQA 5LNWA 3SUTA 3UFYA 3KXFD 1RZKL 2Z92B 1CBGA 5DJXB 2UY4A 2ZUMA 1ET7A 4H7VA 2BOBA 1GT8A 4JICA 1T0PB 3HC0B 5ANMA 4X9IA 5TQ0H 1MW1A 2OZ8A 4HVXA 2ZCKH 4X9SA 4MJ5B 7TAAA 4WWNA 3CZKA 1NAMB 3WY4A 3GSNB 4JY4B 5CJQH 2XIDA 1EK3A 4KXDA 4FA8A 1Q85A 2XZ9A 4IK7A 4NI8A 3HPFA 2GQHA 3D18B 5BVJA 1KJ3H 3PF2A 4LAUA 1E6ZA 2HDJA 5AYIA 4L9ZA 2VLKD 4R7OA 2B31A 3RX7A 1KM4A 4DY1A 2DLFL 2IO5A 4FQXB 4OJYA 3D5HA 5CZSA 3UESA 4JG9A 1UD3A 1DVUA 1I1AA 4PJ7B 4PLKC 4XZWA 4UFKA 4CSTA 4XH2B 1FWRA 2PDIA 3UBXG 4XNDA 1D5XA 2Z3FA 3AU1B 5F7KC 3Q2WA 1K03A 1VFAA 1WZ1L 3HNSH 4H0HB 5GZOD 1S7RB 3G1SA 3G77A 3SUUA 3T4CA 5M3WA 3QXVA 4HC1L 2HFGH 1KXQE 3VGAC 4AUYA 2X4PB 4PWJA 5G5DB 3A4XA 1F00I 2ED7A 3SKMB 4CEUC 1JHLH 1YN7B 4HIEB 5D1XB 2ZUTA 4G8GB 5CAYB 1LBMA 2VDLH 4J3ZA 5INCA 3KEHA 1J5TA 2GK2A 5TPWL 3EGJA 1DE5A 2ALRA 1PZCA 5IB4A 1NGPL 4AF0B 3EOLA 2VIRB 1E28A 5BO1L 5DC0A 3LNPA 4Z7IA 1SZFA 2AXHA 1HTIA 1PU0A 3NIGB 3V6OA 5L2JA 3QJHA 2DM3A 1U3HB 5EO1B 3K30A 1H1NA 3BPLC 4H3DA 4S3BA 5JW4M 3FLUA 1ECEA 2CETA 3KX6A 5KVFH 1RZGB 3UMTA 3T8MA 3ZY7A 2OELA 3P9MB 2HXAA 4FQJH 1T21A 2QKSA 1R1CA 1SQ2N 3PFUA 4PJAF 5J6SA 3RDTD 4HOZA 2AKRB 1BM3H 3DX4A 1YAZA 2Y0SA 4W6XB 5INDB 4PJFE 4IIZA 1NDGB 3UXIA 1Z9LA 1P0NA 5FKPB 4ELME 3BXNA 1MQKL 2YAQA 3RU8H 5HGDB 1AGBB 2ZOUA 4JMXA 4YBHA 1MHPH 4GIOA 3RITA 5IOPB 2J57A 2F5BL 3E7JA 4K5MA 3CXHK 3SGDH 5E2VL 1IEIA 3UAJD 1S7UB 4KIEA 5D2YA 2BOLA 5DRNA 1SJHA 5C08E 5T1LB 4AQOA 4IL0A 2E6JA 4AIZB 1F56A 1PEWA 2IV8A 1HNGA 3MLZL 4PUBL 3GAKA 3IMTA 3QIBA 3T4AA 3IJLA 4MNJA 4XZNX 3TJIA 2YKLL 3PBGA 2AXFA 3OR6B 1LQ0A 3QUMB 1GW0A 1J8HE 4WHBA 4G8TA 3KBPA 1ZLDA 3M6DA 4FZEH 4QBXA 3R0KA 2YARA 3QUYD 4XOBA 1YMYA 3BZGA 3FBKA 4Q52A 1FV1B 2NSXA 4RZ6A 2IQ9H 4FDWA 3WQWA 4WDUA 5DANA 4B4HA 5C07B 3LMYA 2BCMA 4UT9A 1KLYA 4PIRF 3U7VA 2VR5A 1XLIA 3A21A 4MFEA 3QXDB 3VXSB 2EDTA 4KRLB 1A0DA 5FO7B 1A4MA 4GJIA 1Z5LA 5I6NA 2DSKA 5IESL 4DYEA 1NFIB 4R3UA 2MQ3A 1UBSA 3R8QA 3ZN6A 3GDCA 5REQA 3CH8A 4PUMA 2J12B 1OQOA 4PWEA 3SFKA 3OZLA 4P05A 5EZJA 1TR7A 4FTVD 1VAHA 3KYAA 5AKSA 5E2WL 3U0PB 1UOKA 2L04A 2NY0C 2YSWA 4ODTL 4X6EA 5DMLA 3ONCA 2D7TL 4GUPA 4CSSA 3W22A 3TNNB 3QC0A 1D9KD 4GIAA 4M3KB 2CO3A 3AALA 4N1CA 4K7PH 3SYCA 1V7AA 3H7LA 3SZ6A 5EIIA 1GSMA 1OPGL 2I60H 5FYLD 4GZJA 1H7RA 4YBQD 2QUUA 2CM6A 5DEZA 2R9RA 3B56A 4L3ED 4NZ8A 1R5VA 1CYXA 4EVNA 3M0IA 5BV7L 2IF7A 2EC8A 3HBLA 1X6NA 4FTVE 5GIRA 4N0UB 4OKDA 5DUJA 4DT2A 1MEHA 3B05A 1YKWA 4UNKA 2FVLA 3CBKB 1DQLH 1VJSA 2Q8BL 5ALCL 1GS8A 1KPUA 4QHMA 3QO0B 5EOTB 4S0HA 2D2GA 2PB1A 1KSRA 1J88A 4L8SB 5CHNA 1VZWA 3TKFA 4A3QA 4EWND 5T9BG 5D96C 1GZPA 2V7HB 1CR9L 1CD9B 1C7SA 1XCWA 2WHJA 3W2JA 4Z1AA 1E5CA 5DY2A 4AITA 2X4NA 2ILLA 5KOMC 1UB5B 5BZZA 4CGTA 4N9GA 3X1EA 4AK2A 1ZY9A 2IH1A 5JHBA 1YEIH 3UWEA 2N7SA 4OF7A 3VVVA 1QOPA 2G95A 1HU8A 1TXKA 1BQRA 2BVQB 3SOBH 3N18A 3HI6L 3V1HA 1PFCA 4KKLD 2Y36H 4TS6A 1OLLA 1YPZF 4LNYA 3NUKA 3S0PA 1TJ0A 5T1LD 4C6FA 3JZEA 1ZUAX 4P2AA 1QBML 2CLVB 1PVHA 1N55A 2YXVA 1YAIA 5JIHA 1UJ3B 1CECA 1LNUB 1YE6A 5C7XL 5E2UH 4FG6D 3KCPB 1X5AA 3EJPA 5I9QC 4FXSA 1MCFA 3VI4A 1XLKA 4FQQB 3QQ3A 2EKSB 2DZWA 3WFHA 1NGWA 2ATKA 2PPEA 1IBGH 5SWSD 3IVUA 3IRCA 1OD0A 3LKSA 4PJGF 3DFOA 3E0VA 2I85A 5F2GA 4F9PC 1B54A 1ZT4A 2VAJA 4QAWA 3ZTNH 1NFBA 2VQ1B 1C08B 1KEGH 3JR2A 4PGJA 3H53A 5C0FB 1A7PL 4Z0BL 4NQTA 1Y5XA 1NEZA 5BUPA 4Y4FD 1AQDA 3UW6A 3WJLC 4XVUD 2VXVH 5JOPD 2J25A 5SWSE 1JCKA 3CD4A 3PP4H 3QZNA 3FS9A 3PJXA 5JHLL 2OYLA 5TQ0L 2BCKB 2FVNA 3WLRA 1SFJA 4NQ1A 1BYBA 2KMWA 2MTAA 1OC6A 3DKHA 1ZHLB 3T3MF 4IFKB 4RNJA 3KPMB 4ZFZA 2XIOA 1Z48A 2FFIA 3W1PA 1X6LA 2Z0BA 4UFLA 1EX0A 2BSEA 4J4PA 1J8RA 1PYFA 4N9GB 3ILDA 4L61A 4NO2B 3MRQA 1ZVHA 2CCVA 4IG2A 5DHEA 3RPKA 5DCEA 3QWNA 2OMTB 3HJZA 1H7OA 2DI7A 1A14L 3FUDA 1NGXA 4HGWA 4JQXC 5GRUH 5JQHC 4ZUVB 1TJ1A 3FUKA 3EGXB 4P4KB 3BYYA 4MA3A 1PLAA 4A7SA 3TVAA 3WH8A 4PJCF 5FUOL 2YLAA 4XUYA 3QTPA 3BKCL 1AIFB 3V8CA 5L2KA 5CM1A 1E4XH 1KCBA 1X7IA 3IACA 4JGNA 3WLNA 1KFAL 1P7QB 1XGPB 2WCGA 3PUUA 5EV7A 4C6JA 4E9QA 1XLFA 3BVWA 4QEEA 2DZVA 5HWNA 2H6UA 1ZT1B 3RK8A 2EH7H 3PANA 1B4KA 3ZUCA 2PF8A 5K33A 4HPXA 2JK5B 1ZBKA 2BDQA 4TULH 3KBVA 4JL2A 4U4BA 3QPXL 4XZLX 3EJYC 4PLOB 3SCWA 1Z66A 5I19H 1RVKA 1AAJA 3UNDA 3W7IA 3ISYA 4ASTA 2DM2A 5HR6A 2C9UA 3QXTA 4LSDA 4U1LB 1MHHA 1RLBA 1AQDB 3PWLA 4M9OA 4UZGA 2BP0B 4JRLA 4U6XA 3ATBA 2VT0A 3L3JA 5FYLE 2P50A 3HB9A 1F2QA 3B9DA 3SGJC 3ZZSA 5L4FA 3X14A 3W1LA 4MDIA 1T7XA 3CMOH 3DESA 3GRWA 1JZ4A 3NCFB 3KLAB 1UA3A 3MACH 3QDAA 5T1JA 1QUMA 3M17A 5F88A 4LEXH 5AZEH 2DMKA 5SWSA 4B7LA 2BTMA 4Z7OF 5C0EB 5KSAB 2QL1A 2DQGL 1KGIA 4U0RB 4H8QA 4TVSa 3M64A 4LVEA 4UFJA 4BRVA 2QV4A 3TBVA 2DUZA 4ELMB 1MNSA 4JTHA 4AU0A 3REWA 3MBWA 4WK2B 4FFYA 3V0VA 1CUOA 3MV8D 3HG4A 5HY9A 3WTYA 2OSLB 5FF2A 2A5UA 4E41E 5H2ZA 2CO7A 3BPNC 3ZQXA 4HQVA 1SNRA 3G6JE 1A4KB 4YXLH 2WOBA 4FQHB 4GQQA 4IKJA 4QRUA 4F4RA 2DQJH 4JPIB 1X3DA 3SBWC 1C5BH 1R5IB 3OBEA 2EO1A 3ETTA 4IGMA 1QASA 3UETA 4M5ZL 2IANA 2RDXA 5T8GA 4J6RL 3VWKB 5FYKL 1V7NH 3EDFA 4LB4A 4P7RA 1IGMH 4PJDE 3NWRA 4O11A 4MSSA 4OI8A 4RNHA 1OT4A 2IKHA 4UV7L 3VIMA 4LPTA 4YVNA 1TTBA 3U57A 2GDUA 3TPUB 4UM8A 3U6XS 1I0BA 2FZMA 2BRQA 2EDHA 1UJ3C 2ADFL 3IE4A 3LD8C 4QWWC 2J7LA 4LZKA 4XMVA 1KDIA 1UOZA 4FI6A 2O5YL 4PGCB 4XVJH 3HGOA 3P14A 4S3CA 3VFWA 1KGCD 3DUGA 3TAKA 5HHXH 1DO6A 5AOZA 1IC7L 4Y9PA 3VXTA 3VXUB 1FKWA 1HN1A 1Q38A 3TSBA 2DQUH 1KM2A 4NQSA 4BS0A 3BESR 1UT1A 2CKBL 5BW6A 4KJQC 4EK7A 3VI3B 1VACB 4OWGA 4Z1YA 1EJVC 1EAQA 2CM5A 4JE0A 1ZAHA 3O6FC 3E0LA 5I18H 1TNNA 2HRLA 5KSAC 1TTJA 2BVYA 5BUAA 4QRRE 3DARA 3GSWB 5DXYA 3HPAA 4LX4A 1Z32X 3QH3A 3D3AA 1CD8A 2O5YH 3GSQA 3RL1A 3NDOA 4G6JL 4LCUB 1W1TA 4NWUL 3VIIA 4WHYH 4QRTB 3TBYA 2YIHA 2B1AL 3CHCA 4K7FA 2EVJA 4R5VA 1FZJA 1RK1B 4UUJB 3PL6D 2PXYD 4MCMA 2IGFL 2X4QB 1ZLWH 4MZ2A 4NX0A 5IBLC 1CB7B 1R5WB 1A7NH 3LPPA 3BP6B 1FV1A 3MRLA 4N8UA 3T8VA 3PTMA 5TK4A 3FYOA 5D71H 4E4PA 1VR6A 5FUZL 4ELDA 5AZUA 3IAGC 4RZKA 2WXFA 1MJJB 3BT2L 1EC8A 1P5VA 2DT1A 3LHAA 4WTZG 2JB6B 2ESCA 5DLCA 2FIRT 3PNUA 1CGVA 2I9LA 3BOLA 2NY2C 5HJDA 5AHNA 3GWJA 5ACMA 1EA9C 3ZSTA 5GRZA 4P2VA 2XV0A 1DN0B 2WTRA 4G9FE 4H20L 4W93A 3RWIA 1R3LB 4DJEA 4KUZL 3CVHB 2V5TA 4NT6A 1XIWD 2WXGA 3BD4A 3KPPA 3MACL 2NQHA 3W24A 3PAOA 4WKZA 3FRPG 4KFNA 4S1RH 3WMLA 1UZDA 2ZIDA 3S3BB 4ZEPA 1UOWA 3CQIA 2Y23A 4DIXA 2PD9A 3RJQB 1XC6A 5K93A 1ZLVK 2L8AA 3GBLA 4GHRA 1F8TL 4CNUA 3DGCR 3U8GA 3OR7A 3UJTH 2CLMA 1MUJB 4HA0A 4TUFA 5GNXA 3RPMA 4E2DA 1BVWA 2ABBA 1AMXA 4U3CA 1FKXA 3AWEA 2LAAA 3QUXC 4DZ8A 1PZAA 5HDLA 3ABSA 2KHAA 1AQFA 3AYRA 4HSNA 3JQOB 4OF0A 1RIVH 3V8OA 2C79A 1XGTB 4NC1C 3OAWA 4PAZA 4CVXA 4C83A 1EFXB 1F41A 1A9EA 4Z7AA 4KK6C 3EKZA 3W3BA 3L65A 1X1ZA 3O2VL 3CFQA 1OL0A 3WJXA 1UUNA 5C0AE 2PURA 3BOVA 4L65A 3KG5A 4JFEB 3QR1A 1FL3B 3TIMA 1O5RA 4IJ3C 3K6SB 2BOGX 1X9LA 3FFCA 4UQ2A 4UU9B 3NQ8A 1WA0X 4HUVA 2HPIA 1XGQA 5AVYB 1SR9A 1TEYA 4MD4B 2EPNA 2ZSVB 1HHGA 3W0WE 3QHZL 4WK4B 2A7PA 4HIJB 3BE1L 1UH2A 1OCQA 2WLNA 3BLOA 4NYUA 3DSNB 1CLKA 2IPKB 1DE6A 3DDGA 5JA9A 2YD6A 5JIPA 1MHEA 1EHXA 3C2SA 5TFSL 4EUPG 3E2VA 2X88A 1LROA 3MV9A 2OB3A 4JQ4A 3W9ZA 3GEWB 1K4DB 1TTGA 5BXFB 2JIXD 4OLVH 4H0LC 4WY7H 4YUEH 2BLFA 1HHGB 4UDTB 2WBWB 3MP5A 4GACA 3O16A 2ZCZA 5KYNA 5DD5H 3JVGC 1AHWB 2DMGA 2H3NB 3D69B 3DTDA 4HG4K 3WL1A 2G41A 5DRIA 2BBFA 5DJ2B 3PTQA 2WHMA 3FB5B 5E5UB 1W8NA 3WKQA 4YC2B 2WOQA 4OFQA 1QNSA 4ENLA 1XGTA 2Y0FA 2UYLB 4ZQNA 1QW9A 3X1NA 3FGCA 1ZLVH 4PMRA 2QT3A 4DBDA 1OAYH 2Z91A 4GOSA 4K5PA 4N2GA 4O50A 5D7IA 3U2CA 5D1ZB 3UBFA 5FECB 3S5NA 1BFTA 3VG9B 4A21A 2NY1B 1M56B 2UVEA 2QPXA 1E5ZA 3ZTEA 1ZE3C 4BZ2H 4ORZC 4KBPA 2FYYB 4MF4A 2CAKA 1MVUA 3T8XA 4NBXB 5C0JB 3VFSB 3UTTD 2ARJA 4IF2A 1DANU 4QY8A 1SYSA 2NRDA 4MX7A 5IFPA 3C5SA 2B39A 4IJRA 3FTXA 2B08A 3RVWD 3WELA 3CDZA 1E65A 3FCTB 3I6LD 4G1EA 3HI6H 3KPOA 4GINA 5DJ8B 4LHUA 1VFUA 1XIEA 5GJMA 5DURD 3P1VA 1FVPA 4IP7A 1XLDA 4XB8A 3IJSA 5CEZL 2OSYA 3MRBA 1UM6H 5C0BB 4FALA 5GISH 2QHRH 4KQ4L 1AS8A 1PNCA 4DP7X 1FWCC 1XL9A 2V2TB 2YBUA 3QDHA 3W0WA 2KZKA 4CADA 1M3IA 3LS5L 1WKDA 2XZ7A 1GIGL 3W2MA 3UBPC 4L4TD 2EE0A 1AP2B 4K4KA 1V3IA 4Y7EA 3OJ2C 4FIRA 1XEUA 3RGVB 1G7MB 2NLJA 3K3QA 4XP4H 5FC9A 1JMXA 2I07A 4IIQA 3FT1A 5JO5A 3E2QA 4TQTA 3IDXH 4C1KA 1HCYA 1EZVX 2B9AA 5EY5A 4D6IA 1TJHL 2QDGA 4LS0A 3OGCB 1VGKA 4JN8A 3HCVA 4X2RA 3S83A 3IBOA 2DTML 2UZYA 6XIMA 3ULUC 4HK3N 1YW1A 4BKSC 3GU9A 3PLYA 1N8FA 3OM3B 2XJ7A 2IJ0C 2OJEB 5FKYA 1TJ2A 5A40E 1T2XA 4AMWA 4LNVA 3FSUA 4GLRH 1KCUL 2IAMA 3JV6B 4XO4A 4GT7A 3UOAB 4N6RA 4CJ0A 1SDDB 4OM0H 3VG0L 1VRDA 4C56E 2QBWA 3PWPA 4W9HC 3SQBA 3QQWA 1EGJH 2R1YA 1Q9KB 2F15A 5DUML 1ZWIB 4RMSA 2J1YA 5C2GA 2OX5B 1R2RA 3N85L 1C8XA 4UQDA 5MENE 5K3VA 1E3FA 1CLOH 1OG6A 4HK7A 1PZSA 1N2VA 1J96A 4QLRA 2XBDA 2DKMA 1H8NA 1QBLH 4FL4B 3ETBJ 2EDLA 3OZMA 3PZUA 4HSHA 2Y24A 4LC8A 4P2RD 2Z1WA 3VIFA 4YXGA 3P2VA 2XXFA 3AAZA 3FCSB 1IQWL 4PJ9A 4QNPF 1XSKA 3RWJA 2EG7A 3AS0A 1XGZA 3QDME 4JY6A 4MYPA 3O9WC 4YBLB 5MHSE 1E8XA 1WDDA 3Q8EA 4QJ4B 2J13A 2J8TA 1SJCA 4BZ1H 3BICA 5IDIA 3UD6A 3FN0L 4RXGA 3Q44A 3D2UD 4Y4KA 3DENA 3OOQA 2ADIA 1AL8A 3NDZA 3JVGA 4JREC 4ZVJA 4CU8A 3MNWA 4WEUD 1X5YA 1GKPA 1KD0A 3K5XA 4F2ME 5AFAA 1OWRM 1KFKA 1V02E 2JK2A 1U92A 3WMQA 4PUJA 1LD9B 1JFQL 3F62A 4HU2A 5DJYB 1J11A 1U95A 2NCMA 1SN5A 4N7QA 1RXOB 3L45A 4G6ML 4MRCA 1BGGA 3C0LA 1FNGA 2VDKL 4WO4C 1J5CA 4A8RA 2J8OA 1JWMA 1G7LA 4OFKA 4HEME 3WKMH 3E5BA 2OWXA 4JTCA 3MRRB 1A6VH 4X0KA 2C14A 4Q2ZA 1IGYB 1C92A 4A2FA 3K0YA 5I8OL 4P2RA 4ISVB 3TBTB 3V18A 4YHNB 4YDIH 1Q63A 3MCLH 1AANA 1FWGC 2F8QA 1ZOXA 1E3ZA 1MLBB 4JM4L 4PRRA 4FQJL 2C16A 2NV1A 3RGTA 3QVAA 4JPVL 3RWGA 1A7RH 2OXHA 4P9ML 3ZVHA 3U2SB 1JD9A 3H4HA 5F3HB 1O5KA 1V7MH 4R4ND 2NLIA 2Q71A 3PWVA 4P5UA 3CO8A 3WJZA 1NIBA 2UUDH 1M6JA 5AZ0A 4PJFA 1VHCA 4HB7A 5KYUA 5GRJH 2JGYA 4M03A 2QKFA 4G82A 3IJYA 4GKNA 1Q7ZA 2YPVH 3SE4C 1EAOA 1KV8A 1KPRA 4FJ6A 4G6MH 1IEBB 2FPYA 3NABH 3U1SL 3EOTH 4FFZH 3GVGA 1JFQH 2IOIA 2WAHA 1FFNB 2X7LB 4X9FA 4BSVA 6ENLA 4A6YB 1VEPA 1FVCA 4G9FA 4YZFE 2Z26A 3FOLA 4P9HC 1A4BA 1F3DJ 3EWZA 4HCLA 2XVNA 3GDBA 4KMTH 4PJIE 2Z7WA 4HU3A 3PXJA 4NIRA 4X4ME 3FN0H 4YWGL 3HI5L 2VZ1A 2XETA 2EDEA 1DQKA 1ILSA 2X4TA 5K9KB 1M71B 3HV9A 4LIQE 3HMWH 3L5XH 4ZUWA 1H5BA 2P3EA 4EI5C 2BWGA 3WQOA 2Z2UA 2VD9A 2G9HA 2Y7LA 4I9AA 3IGXA 4AEOA 3S9ZA 4TUOA 4OVVA 1TMLA 1KIRB 1BQLH 4F7TA 3CC5A 4I5UA 4F0LA 2CXKA 4NJAH 1H3XA 3M9YA 3CSTA 3T0EA 5J5EA 3I6EA 3TCLA 1IC5L 4I9WD 1VIWA 1AK5A 1RLWA 2Y8UA 3JYBA 2ZUNA 4RPQA 4AWEA 5H8DA 5JDSB 4HUWB 3UP1A 3QNXA 4AXWA 4AG4L 1A3RL 1ZTXH 5ICYB 3N6YA 1CW2A 2QSCL 1HL5A 2YB1A 4JIRA 4TIMA 3VXMA 2Z6IA 3W07A 3WLQA 2C4XA 1CXLA 2AITA 3GJFK 2HLAB 2DP3A 3L7RA 1IKFH 1EHNA 5F7WC 1DFBH 3ZR5A 1HHIB 2ZOLB 4U6VL 1E4MM 1IGWA 3HPZA 4PR5A 2PLKA 1MNNA 3IETB 3N91A 1WA1X 2Y3AA 3C0SA 3ARDB 5EF3A 3Q8FA 1UOLA 3PWJA 4NFBA 5A6KA 2RHGA 1AI1H 1LP9E 1QA9A 2C4FT 3TX4A 1EDTA 2ZYFA 5EOCJ 3KGSA 1ZSDA 2DJ4A 3KH4A 2YGYA 4E5XB 4ZE5A 3VRJB 2K9UA 1NBCA 1G4SA 4LLWA 1Q9LB 4I9XA 4X5PA 2GPTA 1YPZA 3UTSD 1V54B 2JELH 1CFMA 4AIUA 3FQNB 5J5RA 3TC9A 4GUGA 2PABA 2FBJL 1MAJA 3OJGA 3B8VA 4YDLB 4O8AA 4KKAC 3WGVB 2A3CA 1OFPA 2ZA3A 1E6SM 4JFEA 1PUDA 5DCBA 1IARB 4LWWA 5B8CC 2VQTA 5AYZA