2XIIA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with an extended 9-fluorenone iminosugar inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 157
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xiiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xiiA01
1H0GA 4NZJA 2DQXA 4QP0A 3H55A 2W61A 7TAAA 1VFOA 3ZSSA 1W9PA 3EMQA 5D8ZA 3OZPA 2WKGA 3E1F1 2J7FA 5E0CA 1QHPA 3L2MA 2VZUA 1R47A 4IM4A 4J28A 5A6MA 1Q6FA 4TX8A 5CGMA 3DX2A 1TG7A 1KTBA 1EGZA 4D1JA 5JBFA 2YDRA 3SCRA 1UR0A 1JIBA 3FN9A 1BQCA 3ARPA 3LRMA 3VPLA 3WN6A 5JIPA 1IZKA 1V6UA 4CVWA 1CGUA 4FNPA 2WZHA 1TR1A 3AHTA 3MUAA 5A8PA 3EJSA 4AMCA 1XH0A 3ZO9A 3BH4A 3MUIA 2XHYA 1HP4A 2Y4SA 4PTVA 4UQEA 3GZAA 2QLYA 3AHYA 4ACZA 1ISXA 1OD0A 3APGA 3WNPA 3BSHA 4MNLA 1CNVA 3PZQA 3CO4A 4DO6A 1EDGA 3SCPA 3U7VA 3SUUA 3ZJKA 4A4AA 1H09A 4P7OA 3DX1A 3LXCA 3CZNA 2ZOXA 1HJVA 4J3UA 1JXKA 3A3HA 1V6VA 3FNDA 2QPUA 3TONA 1J0IA 3VOCA 2NSXA 2F7QA 2V38A 1MWOA 3DDGA 5LA2A 1ZBCA 4OZOA 5BCAA 1W2VA 3OLEA 1ZBKA 1KR0A 3VIIA 1BGAA 1JZ3A 2CKRA 1HXKA 1KBBA 1BFNA 1ZJBA 1GOQA 5E70A 5JBEA 2X2HA 5CZKA 2ZUUA 2J7BA 5CPSA 3SCNA 3T0AA 2WVUA 3CTTA 2XN1A 1JYVA 3BAIA 3CHFA 3WQ8A 4KRUA 5BXTA 4AZ6A 3T08A 3VMPA 1OIMA 3U5UA 3W4RA 3BUIA 2WKLA 3CZKA 1R8LA 3WQ4A 5A6SA 2BFGA 2OW6A 5GQBA 5CSYA 4WF7A 2VZSA 1TQVA 1VFUA 1GQIA 2O92A 5EMYA 3WELA 3TV8A 1EDTA 4AXNA 1XCWA 4IPNB 2WCAA 2YIHA 1QBAA 4UFLA 1CGXA 1FH8A 1CGTA 2BXYA 5I77A 2GJXB 2J7GA 4HZ7A 1E55A 4FLSA 1E6QM 2ZUMA 3AIBA 5DT7A 1ODUA 3UG3A 3WDJA 4Z2KA 2UY2A 3GNRA 4YHGA 3L4YA 1E3ZA 4J3WA 5FCZA 3A24A 1E73M 4HOWA 1US3A 3S5ZA 1QNSA 2VX6A 3BLPX 3QOKA 4JFSA 3VD7A 2GUYA 3EJQA 2C8NA 3GXNA 2WMIA 4AZCA 3PTKA 4F9DA 4QLJA 2Y24A 1QI0A 3M6DA 4ACZB 4QCEA 3VIJA 2J75A 3DYPA 1TZ7A 1VF8A 2UWFA 1JFHA 1B2YA 3WUEA 4FNTA 2ZX7A 4JIEA 4H2CA 4AD0A 4D1IA 4ZFMA 3BUDA 1TQWA 1PEZA 4IUGA 1CXEA 3GXMA 1C7TA 6A3HA 2WLZA 1ZS2A 4PMVA 2QMKA 2OLHA 4M80A 3CZEA 3KE0A 4W93A 1OB0A 3AIWA 3AQUA 1V6YA 3IAPA 2ZUTA 2OSXA 1R7AA 3LPGA 5A6JA 3EJRA 2OWWA 4W89A 4E8DA 3WH6A 3WEMA 5A3HA 3K8LA 1FA2A 1E0XA 3T2PA 4AZ7A 4PMUA 4UZUA 3G6MA 2C0HA 1JI2A 2QMJA 2HISA 3GXIA 5ABGA 3N18A 3KLKA 4XV0A 4W84A 5ABFB 2X0YA 3VGFA 1E15A 1GHSA 4D6EA 4L4PA 4PRWA 4JZ5A 3SCVA 3CUJA 1JNEA 2EBNA 4FF5A 1TQUA 3ZT5A 2UY3A 2CPUA 1J0JA 1A47A 5A8OA 3S2CA 1FH9A 5D9PA 3QR3A 1HXJA 4UZSA 1CIUA 1CXHA 2YA1A 3F5JA 4PMOA 4D6CA 2W5FA 4CKQA 4GI6A 1HJUA 2VZOA 4BF7A 4RE3A 1C90A 3AHXA 3HJEA 2CXGA 1BG4A 5I3DA 2J25A 5E1QA 4AW7A 3M7SA 4JCLA 4UFKA 4JKLA 4J7RA 3KWXA 1EO7A 3BVTA 4UFIA 4BCEA 3PZUA 2XYLA 2BS9A 3L2LA 4W5UA 1GJUA 3MS8A 1MQQA 1T0OA 1TVPA 1FHDA 2WWDA 3WSUA 1B90A 3F5LA 3PTQA 2Y8KA 1QI5A 3A22A 1K9FA 2IXVA 2OWXA 2WXDM 2B31A 4QCFA 1E6NA 4L4OA 4MJ2A 4R27A 3A6OA 2WPGA 4HPGA 1EA9C 5EFFA 4HMCA 1JZ4A 4GO8A 1QWNA 1CLVA 1GOIA 2NT0A 1KXHA 3AHZA 5IHRA 1TMQA 4MTVA 2ZUSA 4BZYA 1WDPA 3K4DA 2CCRA 1SMDA 2ZICA 4PN2A 3BXWA 3QHNA 1J0ZA 4MB1A 1W9UA 1TUXA 4Z2LA 4AYSA 1LJYA 1CXKA 3MSDA 1CECA 1V6WA 2CKSA 2BHUA 3AS2A 2O9RA 4S3JA 4D6IA 2VRQA 2G8ZA 2WMIB 4AZCB 1V3HA 3BVWA 1B3YA 3WQVA 1WKYA 3CUFA 1E6XM 3ALFA 4DM1A 4TTGA 3CZGA 1W9XA 3HG2A 1VFFA 1ZBWA 3HG5A 2JE8A 2VZTA 1HVQA 1EO5A 1E6RA 4HZ6A 5BRQA 5C8BB 5M3WA 4PSRA 1BLIA 3BGAA 3AIQA 2XFYA 3BUQA 3VDBA 2WC7A 3AZRA 3CUIA 5ECUA 4YHEA 4AZIA 3DX4A 5EB8A 3D3AA 2WMJA 3TTQA 2C7FA 1QNRA 3KZSA 3AHVA 3VMOA 1FHLA 2BHYA 1UR2A 2A3HA 1XGZA 1LWJA 2ZIDA 4TUFA 3ZT7A 3SCOA 1UWUA 3GM8A 2GDVA 3WD1A 4AMXA 4W7WA 5AC4A 5LA1A 5A94A 3PN8A 5D9OA 4JHZA 3RDKA 2CEQA 4PYSA 3VSTA 8A3HA 3W53A 2PI6A 2VNCA 2OYLA 1UD8A 1OGGA 4NRRA 2JIWA 1E6ZA 2WHJA 3AXHA 4KRTA 3H54A 1M04A 3L4VA 4UQAA 1VENA 4W88A 1RP9A 3A21A 2XVPA 3EDKA 2EPNA 3B8SA 3GNOA 2X05A 2VX4A 5A1AA 1WCGA 4ZE5A 3OLIA 5CXPA 2VURA 3MMWA 1VIWA 2VX5A 3LXAA 1TQSA 4M56A 4AEFA 4NF7A 4YPJA 3PZIA 2XIIA 3EDJA 2G41A 4HU8A 1UKPA 3BLBA 3WY2A 2WK2A 3ZJ6A 4TXEA 4OKDA 1LL7A 2E9LA 1QHZA 3T0BA 4KWUA 4W86A 4D6DA 3WF4A 3D52A 1XSIA 3UETA 1QNQA 1GORA 3EDFA 4PMDA 2BVYA 1P6WA 1GONA 1KQZA 3VSVA 4V28A 1BYDA 3WDQA 1H1NA 2J77A 1V3MA 2ZWYA 3ARXA 4N0RA 4P8UA 3MANA 3SCUA 2XVGA 1CDGA 4BQ4A 4AD4A 3GXFA 1LL4A 5CQ1A 5BYWA 3WDHA 1LLOA 3MUZ1 1BSIA 1XD0A 2VUYA 4D6FA 1WDSA 2WC3A 3D50A 2JIEA 4DUXA 1W32A 3EDDA 3JUGA 1B3XA 5E6ZA 3AS0A 1R7OA 3WBEA 1AQMA 1HTYA 2ZXQA 2CHOA 1JF6A 3FAWA 4OIFA 4PTXA 3MMUA 3CHCA 3WENA 4EAMA 1L8NA 1JZ7A 3DDFA 2WBGA 2YFNA 5AYIA 1PIGA 3CUGA 4D6JA 1W9DM 2F7OA 2WSKA 1VBUA 3AYSA 2A3BA 4TX6A 4B15A 4EE9A 2GVYA 3VX1A 4C7FA 2EO7A 4LQ1A 4CU6A 3AMGA 1DWHM 2GJPA 3ZT6A 3WKZA 2WYSA 4EKJA 1NWUA 1HWWA 3AIVA 3WUFA 3RMEA 4B3KA 1CTNA 1UD2A 3VMNA 1W3KA 3N15A 4QAWA 3VD3A 1E3XA 3EDEA 2VZVA 1BYCA 5E9AA 3IJ9A 1VJSA 2G4FA 4LYPA 2XSBA 1FFQA 3W25A 1E6PA 1VB9A 5FL1A 1PX8A 1ITCA 2A3CA 1RD6A 1US2A 3W6LA 2E3ZA 3AYRA 1KTCA 1PJ9A 4U2ZA 1W3JA 3POHA 3WH5A 2D20A 4AEEA 3POCA 2VR4A 2ZUNA 3D5HA 4WKAA 5JBDA 4LGXA 2WVSA 2EPKX 4AZBA 5AC5A 1W9BM 4IPLA 2Q8XA 1PZ3A 4FNUA 4E2OA 4CD7A 4GQQA 2J4GA 2ZUVA 4CU8A 4NXKA 4AD2A 1PX4A 3VIMA 2F7RA 3CC1A 2XVKA 4GZEA 1K6AA 2O9PA 4KMQA 2X8RA 4U5IA 2YDSA 2DSVA 4W5ZA 4J3TA 1W91A 2J8GA 1H41A 2NW0A 3BSGA 4PSPA 2XFRA 5BXRA 4RE2A 1R87A 4DO4A 1OWQA 3WF1A 4PMRA 5HPCA 4DWSD 3WUGA 3ARYA 4D6GA 1W3HA 2CHNA 1BTCA 2WMFA 4UFHA 2E0PA 2X1IA 1NARA 1QNOA 3UG4A 2V3DA 1UWSA 1UHVA 3WD0A 5GNYA 1KQYA 1GVIA 4PEEA 3ARTA 3OB8A 5EBAA 4U31A 3WY1A 4CD8A 3K1DA 1NOWA 1J0KA 2D0HA 1DWGM 2TAAA 3EMZA 1E40A 1HKMA 1X6NA 3WBAA 2XN0A 2CESA 1WDRA 4P7LA 4FMVA 3GH5A 1CXFA 4CUCA 1E43A 2VC9A 2PWEA 2JEPA 4E4PA 5DF0A 5HNNA 1E70M 1E0VA 3LPFA 5ABFA 1H11A 1KXVA 2DH2A 1R75A 2G3NA 4H8VA 2QV4A 3L4UA 3ALGA 1GOOA 1GOKA 1B1YA 2EPLX 3VX0A 2FDMA 3DHPA 3MO4A 4MNMA 1NH6A 3HMCA 2WMKA 4P7RA 3SCSA 4AIOA 3UR8A 4ATDA 4P8WA 1BF2A 1GW1A 1QW9A 3AXIA 3GDBA 1UR8A 3G6LA 3WEOA 1EOMA 3AIRA 5FOOA 4W85A 2WANA 3KEHA 3L4TA 4CVUA 1RPKA 1CXLA 1GOMA 3OGRA 3GH7A 4H8HA 3U5YA 1UA7A 1FP9A 2CBUA 2FGLA 2W67A 2OYMA 1MFUA 1PAMA 1V0LA 3QHMA 1EQPA 3SCWA 2JF6A 4ZXLA 2ZX5A 2J7HA 2NT1A 3M46A 2WVVA 1CENA 4XZBA 3SCTA 3SUVA 3GXPA 1XD1A 3CMJA 3BMVA 2WMGA 5JIWA 3WD3A 4X0NA 3RM9A 9CGTA 5A8QA 3AMLA 2JF7A 1BGGA 2DT3A 1QI3A 3CLWA 1GQLA 2XJ7A 3EYPA 4W7UA 3BAXA 3WH9A 1FH7A 2J74A 1BVZA 1KB3A 4ATLA 5BRPA 1BHGA 4HA3A 3ARZA 3UR7A 2DT0A 5A69A 2W91A 3W82A 4J3VA 3A5VA 2FH8A 3W38A 1V0NA 2XWEA 3VDCA 2YA2A 2WNWA 5A2BA 2GJRA 5TD4A 2MANA 3AXXA 4AD1A 5IFTA 5CG0A 3MV11 3ZMRA 3BAJA 1CZ1A 3CZLA 1CBGA 1WZKA 2BHZA 3N11A 1QNPA 2V5CA 3GBEA 3MV01 1EOKA 2F2HA 1BYAA 1VJZA 1V02A 4NI3A 4A3YA 1MQPA 3ECQA 2YL6A 1PPIA 4HOXA 2VVNA 2XUCA 3BLKA 4TVCA 4GKLA 5AY7A 1JNDA 3F4VA 3VTRA 1UUQA 3AJ7A 3A4AA 3UERA 5CSUA 4NXSA 1V3IA 4M82A 2WCGA 4M24A 3A4XA 1QVBA 1H0IA 4PCTA 3WEZA 1KCKA 1S46A 1OGSA 1BG9A 3OA5A 3RIKA 2DSUA 1L0PA 4RL3A 1HL8A 1UH2A 1HF6A 1HJXA 1LG1A 2VJXA 3AIUA 3CBWA 1UD4A 8CGTA 3UCQA 4ATWA 3EMCA 5A6BA 3CHDA 1TFVA 2PF0A 1H5VA 1J9YA 1CGWA 4JL2A 4W8BA 1MW2A 1M7XA 1E5NA 1CGYA 2EJ1A 3IGUA 1OT2A 1KCLA 2DIJA 1UWTA 1XH2A 3RO8A 1G1YA 7CGTA 1D7FA 3CZ8A 1C93A 3WQ5A 2PB1A 2XVLA 5GNXA 1KGWA 3BAYA 4MAVA 3BC9A 5A8NA 1JZ6A 3OLDA 1GQKA 2BY3A 2JEQA 4Z2IA 5A6LA 1JAEA 2OSYA 3DECA 4S3KA 4GI9A 4HMEA 4B9ZA 4UQDA 2WVVB 1JAKA 3NJ3A 3N04A 2W62A 3VO0A 1V08A 2E4TA 3LRLA 1CLXA 4AY1A 1F4AA 3RJYA 2ZX9A 1C7SA 1OIFA 3WUBA 2CITA 4PUEA 1RH9A 1G0CA 4UTFA 2VR5A 1CWYA 4FNQA 2XPKA 3DYOA 1UKSA 5A95A 2ESCA 1R46A 3ARVA 1C3FA 4EANA 4PMXA 3L4ZA 1JDDA 3ARWA 4PBGA 2WHKA 1MW1A 5A6AA 3NDYA 3WIJA 4D71A 2GFTA 2E8YA 2F7PA 4WK9A 3AZTA 1WZAA 1EIBA 4LPCA 1KWKA 2WHLA 2V3FA 4WKHA 5DO8A 3NSNA 3N12A 2W63A 3CPUA 4B16A 1JI1A 2GK1A 2YLLA 1JGIA 4C7GA 2ZUWA 1JZ2A 3WDRA 3VIFA 1HKIA 1NOUA 1G94A 6CGTA 1YHTA 2E40A 3ARUA 4PUDA 4HA4A 4CD4A 4LXFA 3NSMA 3WF2A 1E6SM 5C71A 3NDZA 1V3LA 1X6LA 2RGMA 3CMGA 3WQ6A 3CZSA 1HT6A 3AZSA 1HJQA 3WNKA 1H2JA 3PTMA 2PWHA 4KH2A 3W6MA 1HVXA 3ZM8A 1CXIA 1UKTA 4PMQA 1NP0A 3WD4A 2OWCA 1NWTA 4BQ2A 1WDQA 4DO5A 1BVNP 1XCXA 5I5RA 4N42A 3ZOAA 4D72A 4NSBA 3BVUA 3RM8A 3UESA 2G3MA 2CYGA 1ISWA 2YLAA 5IDIA 5AYBA 3AMKA 4ML4A 3W27A 2PWGA 4GZJA 4Q7NA 1B31A 3VUPA 1HN1A 4W8LA 3WMSA 2ZXDA 2YDQA 3WDPP 1UWIA 2J7DA 3FW6A 1J18A 2XN2A 2EXOA 5HOSA 5FD0A 3TOPA 1XC6A 2VL4A 1G5AA 2VRJA 4M29A 3NUKA 3AFBA 3BUPA 1V3JA 3THDA 2VTFA 4AD3A 1M01A 3FY1A 2WAGA 1UQZA 2VVSA 4GQRA 2Y2WA 2X2IA 4H8UA 2F61A 2EADA 5I0DA 3ZQ9A 5C70A 4LYQA 1JFXA 1E1FA 4U3AA 3FAXA 3VIPA 3GXTA 3OZOA 1WO2A 4UCFA 4FK9A 1U2YA 1QI2A 1CEOA 2IGTA 2YBTA 2WZEA 1NQ6A 2AAAA 3K4AA 4HPHA 3ZR6A 1E4LA 3W24A 4JAWA 2G3IA 3WNNA 3VGHA 1GVYA 5I2UA 3U57A 1E4IA 1ODZA 1JD9A 2ZXAA 5ABEA 3OGVA 2EABA 4TOQA 1E72M 2OYKA 2BV9A 1AQHA 3N1AA 2X2YA 3DYMA 3T2OA 1DTUA 5I23A 1IT0A 1B3VA 4ZENA 3AIEA 4MDOA 1Q4NX 3ZJ8A 3WF0A 1GHRA 4W7VA 5LYRA 3PBGA 2DH3A 3PZNA 4M81A 2ZE0A 2E8ZA 2CBJA 2GK1B 1MW3A 1WNOA 3EJUA 3VSUA 3NIYA 3O9NA 3L4XA 3IAQA 1OT1A 1UH4A 1E71M 3KL0A 4FNRA 4X9YA 3CH9A 3RJXA 4HZ8A 1E5JA 2V3GA 1J01A 1QPKA 4GI8A 4FNSA 5JUVA 2FE0A 4Y7EA 4HMDA 3VDAA 1MXDA 1MQRA 5FKYA 1V0KA 4W87A 1O7DC 3RM4A 1JXJA 4PMZA 2YKKA 2VQTA 3LPOA 1HJWA 2A3EA 1XH1A 3BVVA 1VEPA 4AIEA 4QLKA 3WNLA 1DP0A 4IISA 4AYGA 4MB3A 3S6TA 1UR1A 3SUSA 5D8WA 3O6AA 1VEOA 1XSKA 1G9HA 1KBKA 3WNOA 3DHUA 3IK2A 1K9DA 3N9KA 4W8AA 2J7CA 3BVXA 1GNXA 4E8CA 1JDCA 3VNYA 3CGTA 5BROA 3IANA 1SYTA 3NCOA 3BAWA 2W92A 3NYDA 2F1AA 2D2OA 1R33A 3WY3A 3WNMA 3D4ZA 4MDPA 2D0FA 3W26A 5D9MA 3D4YA 1IZJA 4P8XA 5KZ6A 3CHEA 1V03A 1OGBA 4OBSA 1TA3A 4NZFA 3WFLA 4U33A 1GPFA 4UFMA 1LL6A 4FLRA 3ARSA 3SEPA 2BY0A 1ISVA 1ISZA 2PWDA 1FP8A 1C92A 1JYXA 3AICA 3UEQA 3VINA 2X2JA 4FLOA 1R86A 4GINA 3VGEA 3VIKA 1JZ5A 1XYFA 3ZR5A 1FOBA 1NP2A 2WC4A 2PBOA 3WF3A 5CPTA 2OW7A 3A23A 3OBAA 4JFUA 2AOSA 3AS1A 4XB3A 1KGXA 2D24A 1I75A 5M17A 4ACYA 4AWEA 1EXPA 2CBVA 3LXBA 4GO9A 4CN1A 1K9EA 1E4NA 2CIPA 4MB5A 1HIZA 2YL5A 4M8UA 5A2CA 4TVUA 3BCFA 5A6BD 2PC8A 4C7DA 2Z1SA 1G01A 1JYNA 3VKKA 4K68A 3MI6A 1LG2A 4ZEPA 4P8VA 1J11A 3PZMA 2WVTA 1EHNA 4M1RA 1JL8A 3MMDA 1Q6DA 1GQJA 3LX9A 1UYQA 2XFFA 4UFJA 4HU0A 1DWAM 2XM1A 1H49A 4JFVA 3EJPA 5IXEA 2XG9A 2PBGA 3J7HA 7A3HA 1ZU8A 4NZCA 1PIFA 1UR9A 1HP5A 5E6YA 1H4PA 3ARRA 1NWSA 1UWRA 4OUEA 2EACA 1SFSA 2J62A 4DM2A 4NX0A 1I1XA 1OSEA 4PTMA 2W66A 5HDRA 3KLLA 2D23A 1D3CA 1E0WA 4GXPA 1M53A 3KL3A 1DWFM 4KGLA 3VVGA 4BQ3A 1JDAA 1E4MM 2XIBA 2PWFA 4XZWA 2A3AA 1R34A 5KEZA 1W9VA 3ZSTA 3AI0A 1AMYA 1CYGA 4R5EA 3WL1A 3PHAA 2DEPA 1B0IA 2O9TA 1N82A 2D3LA 1RP8A 2FHFA 4CN4A 5I24A 2V5DA 1ZB5A 4J3XA 1QHOA 3WFZA 4B9YA 3WMBA 4JFWA 5BXPA 4BS0A 1UD6A 1J0YA 2F8QA 4MNJA 2VX7A 1XSJA 2RGLA 4DUWA 1PS3A 4CCCA 3LPPA 4XX6A 1QOXA 3RILA 4JL1A 1W1TA 1TA3B 4WJXA 2FH6A 2XSAA 2Z1KA 2BY2A 3TTYA 4F8XA 1SR0A 2Y8VA 1KWGA 3N17A 2D73A 2DDXA 3AROA 2YL8A 1Z32X 4V27A 1W1VA 3CUHA 1GOWA 3OGSA 3B9DA 4UQBA 2WLYA 4TTUA 1BYBA 1LQ0A 4OJYA 5F7UA 1PZ2A 1DHKA 2FYVA 4GIAA 1TQTA 1UQYA 1UH3A 2F1BA 1KXTA 4RE4A 2JALA 4F79A 3LRKA 3W81A 5A8MA 1UG6A 1B3WA 2J78A 3MKKA 2DSKA 4P7NA 4TVDA 4HP5A 4PMYA 4PMNA 3GNPA 1UWQA 1OM0A 3BCDA 3FHAA 5I78A 5CJ5A 1JYWA 3II1A 4QLLA 3B9EA 1W1YA 3CV5A 1ITXA 2AMGA 3F5KA 2DPEA 2YBUA 1ZBVA 3M07A 3T2QA 2XTKA 1K9TA 3GTNA 3TTOA 1BPLB 4JHOA 3W37A 2D22A 3VIGA 4AIUA 1CGVA 1W3LA 5DMYA 1V0MA 1HX0A 4QFUA 1I1WA 1LF1A 3VGDA 1J10A 1HKJA 1UKOA 1UZ1A 3L4WA 1B30A 1ZL1A 2XM2A 5BXSA 2WCSA 4MB4A 3H53A 1J12A 1NWRA 5A6KA 3FXYA 4DWSA 5A2AA 1B9ZA 3T0DA 4J27A 1C8QA 3WY4A 5CLWA 3TP4A 1E56A 1QWUA 4U5KA 1QW8A 3A47A 4GZIA 3GYCA 1PX3A 3RPMA 3T09A 3D51A 4HOZA 1CPUA 2O9OA 1UASA 4H7VA 2ZX8A 2BVDA 1LWHA 4H41A 2CNCA 2EAEA 3EJTA 3QGVA 4URIA 1IV8A 2QHAA 4CD6A 3TTSA 3PZOA 2QF8A 1WB0A 3GH4A 5D9NA 2DSWA 3VIOA 1GCYA 1DWIM 1FFRA 4QDMA 3AS3A 5M03A 3O2LA 3RCNA 3B9AA 4UNIA 2WMHA 3VM7A 2BVTA 1HL9A 1KFWA 4CGTA 4YN5A 2XWDA 4V2XA 2CERA 1JG9A 4WLCA 4AZHA 6TAAA 1PBGA 4WIWA 5E09A 1E9LA 2VMFA 1V6XA 1XYZA 3GBDA 3AISA 3OIHA 4WSKA 1Q6CA 3OG2A 3W0KA 2VCCA 2WBKA 5DT5A 5EFDA 2D3NA 2VOTA 2W4XA 3ARQA 4UOZA 2DSZA 2UY4A 4ZXOA 1EDQA 4OGZA 4LX4A 4OOZA 3WH7A 4PCSA 2F18A 2GDUA 1UR4A 1XHGA 4FLQA 4AC1X 2GSJA 4F9JA 2FHBA 5FL0A 4LYRA 1GZJA 1O6IA 2ZX6A 1WZMA 3N13A 2XVNA 3TA9A 1C8XA 4WSJA 1UOKA 3WH8A 5E0FA 4DUVA 2YA0A 3AMDA 3QOMA 1W1PA 3VGGA 5M5DA 4HTYA 2DT1A 1BAGA 4KGJA 1SMAA 2IXUA 2ZXBA 3MUY1 1JD7A 5IHSA 4UQCA 3K8MA 3MU7A 3VGBA 2ALWA 1JZ8A 4OBRA 1VAHA 4CN6A 1V02E 2VCBA 2J8FA 1OCQA 2WHMA 2QPSA 4XUYA 1F4HA 3WDIA 1WZLA 3CZJA 4A3HA 1DEDA 1ISYA 4DWSC 1VBRA 1OINA 2DT2A 4AMWA 4AD5A 3SUTA 2BY1A 1X1NA 1KXQA 2D1ZA 2UY5A 3VD9A 1JF5A 2CETA 2J47A 3SCQA 1D2KA 1VRXA 3K46A 3LMYA 2E9MA 4BQ5A 3I3BA 4AISA 2BNJA 1GJWA 1QBBA 1KGUA 2WM0A 1HJSA 2VI0A 2EEXA 1EHAA 1NM9A 4DWSB 3ZJ7A 1U33A 4B3LA 3BUBA 1U30A 1UD5A 3CIVA 4JKMA 4JKKA 3HN3A 3HG3A 3VM5A 1TVNA 1Q6EA 2WW5A 1WPCA 1E1EA 4J3SA 3SIMA 3VDHA 2EQDA 4CCDA 2WZIA 1GUVA 1HKKA 3MSGA 3AOFA 4JCMA 1M03A 3QHOA 1MFVA 2E9BA 5CPQA 2YOCA 4MNKA 1AVAA 3HZ3A 5I6SA 3S5YA 3THCA 2VQUA 3HG4A 3WQWA 2EPOA 5BWFA 1UZ4A 3BMWA 3VD4A 3VU2A 2DGAA 4ZE4A 5I79A 2WWCA 3NSXA 3SUWA 3OLGA 4UR9A 2Y5EA 3VNZA 3DC0A 5HXMA 4Q22A 1Y7VA 2VO5A 4CCEA 1DWJM 1ESWA 1MYRA 5HPOA 1UD3A 2J79A 2IUZA 1W2PA 1ECEA 4X0VA 3W29A 1V3KA 2VT0A 1Q6GA 3IJ7A 4U2YA 1TE1A 2X09A 3EBVA 4UOJA 3VD5A 3DX3A 1WAWA 1C8YA 3U7BA 2X0HA 4UOQA 3AMCA 1MVYA 3PZTA 1OD8A 1QI4A 2CBIA 2HVMA 1QX1A 4AZ5A 2FGZA 2YL9A 4F66A 4GPNA 1WP6A 4UQ9A 1VFMA 3PZGA 1XV8A 3BAKA 3HU7A 3VILA 2XGIA 3GXDA 3PZVA 5GNZA 2G3JA 2DIEA 4MPKA 4NRSA 1UKQA 4OOUA 2VCAA 1ZJAA 2EPMX 1NOFA 4EK7A 2V3EA 1J0HA 5CGTA 5D4YA 2JFEX 4U3CA 3K8KA 4HA1A 4WKFA 3FHQA 4AZGA 3PZ9A 1OBAA 1TCMA 5IFPA 4CD5A 4Z2HA 2ZWZA 1SZNA 4MJ4A 4MADA 4BA0A 2XGBA 5GPRA 3I3DA 3WD2A 2WB5A 4Z2GA 2BXZA 1C91A 3WMCA 2YFOA 5ABHA 5HBFA 1WE5A 4PTWA 3W28A 1UA3A 3I3EA 5LA0A 1EQCA 4MAZA 1R85A 1H3GA 1EH9A 5CLTA 1KR1A 1MW0A 3IJ8A 3KL5A 2YJQA 1O7AA 5DEZA 3ZIZA 2D0GA 3A4WA 1B3ZA 2J7EA 3SURA 1XRVA 4CU7A 2WSPA 3WL0A 1AQ0A 2VRKA 4D6HA 4Z2JA 1A3HA 3VIHA 1MXGA 5FIPA 2OSWA 3UG5A 4P7QA 2FHCA 1YQ2A 4JFTA 1VEMA 5DFAA 4H04A 1HNYA 3DX0A 2GJXA
chains in the Genus database with same CATH superfamily
2F9BT 3BPOB 4J35A 2IALA 5HNTA 5KYNA 1SLVA 2ZAIA 1XUZA 1KC5H 4GAYA 5JW5B 3OZPA 4PJ9B 5DJ2B 5JHAA 2CSPA 4O0KA 4TX8A 2FRGP 2GWNA 4HX1B 4LP4A 1JIBA 2W0FB 4IMKC 4U6TA 5JIPA 1P5UC 2FLIA 2WGNB 1CGUA 3PP3H 3PNUA 4YDKH 3LEPA 4P23D 4XCYB 2HRHA 2PZ0A 1Y0LA 1PVNA 5F7AA 4MG4A 2QLYA 4ACZA 1OAYL 2J6EA 5LJYH 3L4CA 5EEYA 5IJDC 1IC5H 1HIMH 1DLHB 1H09A 2GIYA 1D5BA 5E8DH 5BZDA 1R3RA 4B2DD 5DQDL 3B4YA 3QUHA 3BFQG 4CJ0A 1WICA 1LLWA 3GKWH 5ADPL 1HXKA 4YO0B 2H6PA 1AIFA 2HJLB 2Z26A 2ZUUA 3CXDL 1RAMA 1B0WA 4DGYH 4X4ZA 2ZVIA 1LCOA 2H9GA 3F7JA 2GVJA 1MXSA 4LWWA 3WHE1 1U8MB 5D1XD 1E28A 2E27H 3U0HA 2LU5A 4BWWA 1D5RA 3EF4A 3IF1A 2WCAA 3BP4B 4QXIA 1CGXA 3TN0B 3D0VA 1OAKL 4GX9A 3BKCH 2JJTC 1XCFA 3D2TA 5AL0A 3P77B 1THAA 4OU1A 1OPGH 3DC8A 3P2BA 3IJHB 4LF2A 5DT7A 2K6YA 3BDBA 4I0PC 2UY2A 3LD5A 4MYAA 2J1KA 2JKIS 3HBQA 1Z6JT 4CVXB 2PDWA 5ID1B 3UZQB 5EDSA 4KFNA 3DV4B 4YWGL 1CLCA 5D7IA 4RZ4A 1IT7A 3GBMH 4IPPA 5FA4B 3AXLB 1QI0A 4QXWA 1SYVA 3N06B 2AXFA 5JOFB 1TQBC 1E7UA 1QRNE 5E8NB 5TE4L 1UWEH 3E6EA 2J8UE 5EO1A 2XLLA 3GAYA 3W11C 3FVDA 3BQ5A 2PRHA 1T0NA 4OQTL 3D85A 1XLBA 1A3WA 3VGFA 4Y9OA 2OJEA 4Z3FA 2CGYA 4QRUA 2CRYA 4JDTH 4HALA 3B4UA 3PFQA 4CW1B 4AQ1B 3U46B 2I5QA 4PMOA 4XPTL 2J43A 5F7LB 4PB3A 1U6AH 1IBYA 2CH8A 4NDMB 2YRZA 1OARH 1BG4A 2AAVA 3IE9A 2AQNA 2Z4GA 5EO9B 1UMLA 5MEPB 5E1HB 2JNZA 2RDXA 5GGQH 1G1CA 3H7LA 1CF8H 5T3ZD 1MCOH 5F96H 4Q8WA 4QRAA 3YPIA 4MA1C 2BRRH 2C1IA 1K9FA 4AH2A 5KN5A 2XKNB 5K2ZA 3VKDA 2LTQB 4JHVA 4Y16D 1GOIA 1GGIH 1NDVA 2ENJA 4E9LA 1U93B 1WDPA 2YBGA 1I0DA 3CBKB 4U3SA 1CLZH 4P3WA 1W9UA 3TCEA 2EICA 2XQYG 1ACYH 2O9RA 1EPFA 4YR6A 2EG7A 1V3HA 3SKJL 2L3BA 2YWZA 3HG0A 4ZMOA 3V5KB 4QG9A 1JCXA 5BRQA 4HFUH 2TSYA 2ZAHA 4WV1C 3AGVA 5EB8A 1W0VB 5HGHB 5B1JC 4B9GA 2NY2C 4XZMX 1UB3A 2PDHA 2JJUA 2EZ0C 1UWGH 5C0DB 4AQ8A 4ODWB 2BP5M 2NZ9C 5I3JA 3GX9A 4JHZA 1UCBL 1JGLH 3UC0H 5GSVA 3PSVA 2YMXL 3D48R 4JN1H 4KRTA 3SDCD 4MZ1A 1RP9A 2XVPA 2BTMA 2BS8A 4DTGH 1YIXA 4E68A 5LNSA 1YEHL 3E49A 3LXAA 5BNXD 2G41A 5KSBB 5JORA 1FLRL 2NYYC 1N0LA 2ZCHH 2D7TH 3SFWA 3T8XA 2NY5C 5BOOA 5AB2A 4UTAL 3EZJB 1KBJA 3CLMA 2BVYA 4NNYA 3L7RA 3U2OA 4CNUA 3JT2A 4XMTA 3GSOA 1AJ7H 3GVRA 5FA3A 4WI2A 4OZIF 3SCUA 3MA9L 4Z1CA 1VZGA 2BP1A 3WDHA 1LLOA 1FBIH 2DWEA 3QQ4A 4OVXA 1KELH 3WJSA 5ECGA 3FOMB 1BSIA 1J5OL 3M0JA 3LA4A 3JW7A 3N34A 5E6ZA 3ABSA 5IJVA 4XC1L 3X1FA 1VA9A 4OZHB 2YD8A 4P5MA 3BJSA 4Q8BA 1SDDA 3MMUA 3T8QA 4PJGE 4PH8A 2C3GA 3RNQA 1RSFA 3UZ5A 2Z2BA 2E6YA 4EE9A 1D7BA 5KVGL 3T05A 1MN4A 2AL2A 1DBKH 2OKMA 1HKLL 1CTNA 3EOTH 4WVRA 3ETTA 5IOPB 1EZ2A 3MSYA 3WIHA 1VB9A 3FUJA 1KIQA 2F19L 4QKXB 5FL1A 4JTIA 4YNYB 2A3CA 3D0LB 1US2A 4FULA 3KWUA 4WKAA 4N8VB 5E8EB 4E5TA 1TZ8A 2YBRA 5M94B 1ZANH 3VFUB 5IR1A 3B8WA 3RZCD 1HCVA 4RUBA 4GXWA 3TL5A 4Y0GA 3N0AA 2F7RA 4DK6A 3MV7B 4F33B 3FO9B 2Y2YA 1MUCA 1EBAA 1JNHA 4FP8L 4YSTA 3KS0J 5LN4A 1BVNT 2NXYD 1NEPA 4LEQA 2CHNA 5AW2B 1JRHH 4RMTA 4DZ5A 5DBUA 5LXVA 4U31A 3D9AL 1NOWA 3PGCA 2EJAA 3NACH 4FMVA 2FQFA 1S78C 5SWZA 4MD0A 2QCHA 2WWMC 4IPJA 1YMMB 3GRWL 1T0PB 4R7XA 2XICA 4DOHE 1F58H 5I09A 1QYGH 1IAIM 3BICA 1A4JB 4OF3A 4JTRA 5IG7B 1BF2A 1Q65A 1UZ8A 3E6HA 1CTMA 5I1KL 2H3NB 3IWUA 4OUIA 4A7QA 9XIAA 4Y9AA 5F2MA 1WZ1H 4HUUB 3SDAD 4R33A 3R10A 3S3JA 3U5YA 1P4IH 1NUDA 1ADWA 1VGKB 1V0LA 1EQPA 2IQTA 1YEWA 1BFOB 3ZHFA 4EOUA 4A35A 4F2FA 3GXPA 2A74A 2KQMA 1JZJA 3BMVA 2CKBA 4IOIA 3OKNB 3D3VD 1SUXA 3QXWA 2O26U 1R3TA 1GGTA 3RWIA 2NVCA 2VLJB 1OB1A 3OKEA 3WIIL 3LSOA 2NY7H 2B0SL 2DZVA 2XFXA 3FUHA 2ZD0A 2UV3A 4QTHA 2QPDB 1TUFA 4W9EC 4U1SA 2JIXA 3A67H 4BK9A 3AG3B 1FNHA 4L3CA 1SJMA 4MSWA 5AOIA 4F93B 2O5XH 1CBGA 2BHZA 4G8AC 1TPFA 3O11A 4YHYB 1ORQB 1UQSB 1T22B 4Z7UF 3FJNA 3TX9A 1MFNA 3UERA 1LQSR 3W0WD 2QADD 4FPSA 1T2QL 4J1OA 5C2BH 1QVBA 1KCKA 2PDMA 2QVKA 1IVLA 1H3PL 3IRSA 3EO1B 3IFPA 3TT3L 1J9YA 1JF1B 3AB0C 2OFJA 4ZGYA 2EJ1A 4G42B 3C6EA 5EMJA 5C0BD 4JO3H 3L0KA 4QRPA 1E7VA 3VXOA 4RDQF 4A7GF 4ZJ9A 1V08A 4AY1A 2R2EB 2C1PB 1J88A 3QUXB 3LI1A 2VR5A 1I3GH 3Q2WA 2FGBA 1WUZA 3BG9A 2NSQA 3VYNA 2WTRB 3NCEB 4KX7A 3X11A 2OCJA 2YPLA 1KJVA 1KGYE 4C7GA 2VDQH 4OGYL 1YHTA 5JQHC 4CD4A 3L9BA 3WF2A 4X6CE 2C9VA 2CGRH 4LCYA 4MGGA 1BQGA 4XT1C 3GS6A 2VSDA 3EO9H 4GFIA 4N2NA 1G7JB 2G5RA 3QPQC 3BZFB 3O2DL 4MM1A 1DVYA 4AT6A 5HY9A 3DMMD 1H7XA 4FX7A 3QWOA 4MY9A 3GMOA 1OVDA 2PW2A 1UEYA 4LUIA 3R8GA 1G5AA 2BZNA 1JERA 3V0WL 4IKIA 1RIUH 4KZDL 1K8CA 1TJHH 3IWPA 2DQWA 5FO7B 4F27A 5AWNH 4H8WL 1FV1A 6TIMA 5AHNA 4BSVA 4PLOB 2NZLA 2DBLH 2A1WL 1U5JA 1LEKB 1E1FA 3KLHC 4JPSA 5J8OA 1KCSL 4HNVA 3MP5A 3GEWB 1CEOA 1OG0A 2IGTA 43C9A 3SQRA 3MTRA 3GKAA 3MOQA 1VRDA 4HPJA 1JD9A 2YKLH 3B9VA 4TOQA 5J1AB 5TF1L 5HJBA 3QQDB 1QSEE 5CBAA 4YBQC 3WK3A 3DJRA 5LVEA 4HEMA 2W9LA 4MAYB 3QEQD 4N6FA 4W7VA 2D7OA 3MYJB 5E9DE 5CD3A 4OGXL 4P4KD 1MCNA 4OZIA 2QVIA 3UJSA 5BOJA 4LEEA 5T5FH 3MLRH 2G9KA 1E71M 4HZMA 4J2QA 3G9VA 2O5ZL 4IKKA 2WXGA 2HJFA 4FI6A 5JUVA 4NFDA 5DRXB 5KTLA 2C91A 1ADQL 4L4TA 3UJTL 4H20L 4LGRB 1Z9NA 4DKFL 4IICA 1QPRA 3WV0A 2WQVA 4QLKA 1E4KC 3HI6L 5C0GB 4Z1BA 1HH6A 1Q9WA 2I27N 4IISA 1W0WA 2CLOA 1U8NB 1FNFA 3W7EA 1KBKA 4NQEB 3UJJH 4S1RH 5HJ3B 3K6NA 2B0MA 5D02A 1F97A 1MCQA 3OW1A 5CEZD 3WLKX 3FBQA 4TRPH 3SE8L 5KZ6A 2AJ3B 4GSQA 4OW6A 2PF6A 2X0SA 4KKAD 4DPCX 4GUQA 1HNFA 1ISVA 1IM3B 3M64A 1K8IB 1ISZA 1VLXA 1JYXA 2R9HD 5FUOH 4ZMNA 3U4BH 3LM7A 4JM2B 1MHPL 5L4MA 3A23A 4EUPB 2FYYB 1EC7A 4ZYKB 4CJ1A 4JO5A 4OLZL 3UAEA 2VB5A 4R4BB 5FFGA 5FUZL 2NW2A 4JFXB 3BCFA 4I5BA 3N1QC 3M0XA 1SJEB 2NY4C 1YTKA 1Q1JH 2R27A 1GQJA 1PYWB 2Y06H 5KAQF 1MO0A 4NO0D 2JF1A 3EJPA 2CJUL 5IXEA 1PE1A 1S5TA 4B0MM 2XX0A 2YSSA 4NJJA 4PQXA 1DSFL 1DYSA 4G7VL 2UZIL 2MCMA 1I1XA 3MBED 2EILB 2RDWA 4RGOL 4KGLA 5A2LH 2I14A 4D9RE 1R34A 1JRHI 5LZLA 4KY1H 2FHFA 2NQJA 5I28A 2VC2B 2RTTA 4JFWA 1UD6A 1J0YA 5AB1A 4ZMPA 3PWLA 5CCKL 3L81A 3LPPA 1S9YB 3CMOH 1NEZA 3MRHA 4PJXE 5BXFA 2HTKD 4A37A 3QFJD 2D9QB 4QXGH 3WTXA 5DU7A 2R6OA 1HEHC 1G4TA 4E0CA 3QHTC 3QIWA 5HNRA 1KXTA 1NBVH 3MKKA 4G6AC 4K71B 3BO8A 3LKNA 3FONA 3MUXA 2G2NA 5CJ5A 4ZUSB 3TBCA 1T6MA 2WSDA 1W1YA 1KEML 4DIXA 1YEEH 1K9TA 4WCYH 4MMXA 3STFA 4C56A 4OTKA 1RZ8A 1FWBC 3CB3A 4MCYB 1FHVA 2OZ4H 3G3LA 1X38A 3QO0B 3VI4B 4Z7UA 1JUBA 5A2AA 3K4WA 2HT2C 2H6PB 1PX3A 3QFDB 3PJXA 2NY6C 4YLQT 4FFYH 3G04A 4HVXA 4OF8A 4URIA 1W37A 5IF0B 2OZTA 2OMTA 2VDRL 2GSIA 4NNCA 5KSBF 2XN9D 4QG6A 15C8H 1QNZL 2BOCB 2WLMA 4XODA 4ZG1A 3RCYA 4HHHA 1F4YH 1DJGA 3JVGC 1OFRA 5L2JA 2CERA 1W72L 4YSAA 4NZ8A 5ID0A 1Q6CA 2A9ML 4HIIB 4NUJA 1FA4A 35C8L 3FT9A 2DSZA 3MLWH 1D5MA 3WXVL 1AR2A 4A7GA 4RISH 1YXCA 4NN6C 3D05A 2ICEC 1MQKH 2VKZG 4GW4B 4BR1A 4GXFA 3EGJA 3TF4A 1WZMA 1MNUL 4KRPC 3US1A 4EIUA 1S9VA 1CDUA 1HHHB 5FECB 3TYEA 1Y8BA 2E7LC 3NQGA 4ODSL 2OEJA 2YN3A 2MPAH 3RTQB 3TEVA 1ZDQA 2AXFB 4UAOB 1JMZA 1DQWA 1BD2E 4AD5A 4TSAH 4ZFOA 2ZC1A 4LT9A 2W1NA 1GW0A 4RZCB 4BJLA 2RDUA 3VD9A 1JF5A 1X5KA 1TDQA 4EN3C 4E0RA 1QBBA 1ZEAL 4F3FA 3GK8H 2A6DA 4E9WA 1IFHL 1L6ZA 4B7IA 5E51A 4JTDA 2JTYA 3SY5A 3LS4H 1H9DA 4LCIH 5D93C 4DX3A 4W70A 2WW5A 4YL4A 4MJIE 4EI5D 4D2JA 5BNKA 4J3SA 2BGNE 4Q4MA 3S97C 4WNQB 1BVWA 4NUWA 5D96B 2FWSA 3HF3A 3BSZL 5T8GA 5JW5A 4PJ9A 4Y9EA 1YW1A 5BWFA 1WEJH 1A50A 1UB6A 4TXVB 4MLSA 3VNZA 5HXMA 2W0FA 5BZZA 1RZFL 5KANI 1U1HA 2YYUA 1UWXK 4PGCB 3Q5OA 4XCYA 3DX3A 3CAQA 4HIJB 1C8YA 4AH2B 3U7BA 4OD3H 5E6IC 5KN5B 4XNQB 4Z3IA 1QAPA 2V69A 2CBIA 4BKSC 4G9DB 3QKEA 4LKCA 4G8GE 3ULUH 1UT1A 3DVNB 5D2NB 1W80A 1DLHA 4I0KA 2D7MA 4MY8A 1W8SA 3QV7A 3KW8A 1BXAA 4IGNA 4QO1B 2FIQA 2GIMA 5C9JB 2XUWA 4YO0A 4M4RB 3L3KB 1SZNA 2HJLA 5JPNB 1LWIA 1LOQA 4BA0A 4B5WA 1QFWL 3R8HA 3TC6A 2YRPA 4N3UA 2AV7A 1REQB 3JWDL 1JE6A 2PRMA 1UA3A 1VPOH 1U8MA 3WMQA 1EQCA 3GLZA 1QDSA 3GTIA 4HJGB 3WFEH 4EUPH 3BP4A 1A3HA 1SO5A 1K7EA 4N3TA 2W9EL 3EXJA 4M1CC 1A4AA 3TN0A 5E8PB 4LLAA 3HHSB 4MHBA 1OANA 1FWHC 2HKHL 3P77A 2BC4B 2Y6TE 1ONQA 3DX2A 1P1MA 1I1CA 2D3JA 3A6BL 4CVXA 5ID1A 1XG3A 3DX9B 3UZQA 1S7SA 3DV4A 4W9LC 1BXCA 2FEDD 3RHWF 1IC7L 4NP4H 5FA4A 2O72A 3AXLA 4NNYB 3WK0A 3GSOB 5JOFA 1F3EA 3P9WB 3ZJKA 7XIMA 5FA3B 5E8NA 4P7OA 3JZEA 1HYSD 5HWNA 4FQ1L 3UBFA 4X61A 5ACMA 5ISZD 2DWEB 5AVWB 3OKDB 1D9EA 4E2DA 1BCIA 3MR9B 2SEBB 4JLRA 4ZTPL 1W2VA 3DURA 2DIKA 5CUSL 1JZ3A 4LASL 1A5KC 2J4WL 1SDDB 4GUFA 4PW3A 1V05A 3SCNA 5L9FA 3EWUA 1PZSA 3CTTA 3II2A 1A49A 4FOKA 1UUSA 5KBKA 3W4RA 1R8LA 4CW1A 2BFGA 4AQ1A 1UWXH 3U46A 4O02B 4BFIA 1X5AA 2X3CA 4NP9A 2RCSL 1VFUA 5EMYA 3OXSB 3PHSA 2J6XA 4RRPA 1E9IA 32C2B 5EO9A 4GAGL 5MEPA 3DJSA 1WX0A 2BXYA 3TROA 2VLMD 2PWUA 4ASTA 2J6EH 3RDTC 3PF3A 4ZB2A 2J7GA 4G82A 4PJEE 3B6SB 2I1OA 1OF6A 4HEPA 2XKNA 4FLSA 3AIBA 2YUVA 4KKNA 1U93A 5C07D 3N25A 4PRHB 3KXQA 3VYLA 2IWEA 1TVLA 2ALAA 3B56A 1EWEA 1I4NA 3SYOA 1QD0A 1U8OB 2Y24A 4B9JA 4LQFL 3VIJA 4JIPA 3MBXL 3WUEA 3V5KA 4JIEA 3ARDD 1TV2A 1IGJB 1GTEA 1JMXA 4K7YA 4HZ1A 2YQBA 5HQEA 3VG9C 1W0VA 3C5ZA 3QIBC 2ZUTA 5HGHA 2OSXA 4X60A 4P5KB 2WYHA 1NCWH 2C9UA 1BFVL 5T3ZL 3GHTA 2HBXA 4XNAA 1XIWC 3GFYA 5ABGA 5J57B 4XV0A 5HDBB 4ODWA 4L4PA 4PRWA 5IMKB 4IM8A 3ZE0E 5B80A 2AQ1A 5K39A 3W7LA 1Z3RA 1E9ZB 3SFKA 4BUQA 5BZWB 5KSBA 3BVTA 3B37A 3DO7A 2J5LC 5LCVA 1TVPA 4PYGA 5ABAA 3KCPB 3HPZA 5G55A 3FL7A 1E6NA 4IOIB 3TJIA 5IHRA 3U36B 1RD5A 5DRIA 4BZYA 1FZKB 1GGBL 5EIIG 1CECA 4UXDA 1THFD 3FOMA 1OFQA 2WXHA 3D4GA 3CNYA 1OEZW 3ATZA 3BGJA 3WLPA 5HHQB 3E2VA 2VSCA 3O6KL 2HNEA 4YSOA 4M6OH 1A4BA 3TEYA 2VZTA 2Y69B 4RWYL 2YLKA 1G7LB 2VFDA 3F2CA 5CEXB 1OTUD 3GHUA 2R0ZL 3SCMC 1ZSDB 1KTDB 4F7TB 1UYWL 4Z8FH 1T4WA 1HDMB 3ZK0A 1RLCL 5IOPA 4AZUA 4OIBA 4X99B 1T5KA 2WIMA 3IFPB 4YNYA 3B1TA 3D0LA 2AFNA 1NFIB 2WHJA 3QC3A 3VE7A 4NQCD 1PSKL 4CKVX 4N8VA 5E8EA 2RGSA 5C2GA 1K1DA 3VFUA 1UEMA 1AK5A 1GCFA 4NF7A 4JM2F 3ZO0A 1T80A 3WQOA 2EDRA 1LL7A 1FL3B 3MV7A 2CIKA 3QWRA 4KKPA 4W86A 4F33A 3FO9A 3JYCA 4QHLB 1U8JB 4AYDC 4PFHA 3UETA 1K6QH 3U8GA 3ZTJG 1GORA 1R2RA 2OVLA 4X4KA 3J8F7 2VDNH 5DHYB 3WDQA 4GAJL 4KRLB 5AOUA 4Z1PA 4BQ4A 4AD4A 4Q0XL 1T41A 5C0CD 3B03A 2CAKA 3GUFA 2AEWA 1PQZA 2Q3XA 1OHQA 4JBRA 3TSBA 3PABB 1W32A 3NSFA 3NTCL 5LGZA 1ZHAA 1R7OA 1GYMA 3SJNA 3L65A 4JZJC 3FB5B 1WRFA 2OR2A 2PGEA 3P5ZA 5AYIA 1YMMA 4PRPB 2XTJE 3KDMB 3LDBB 1LTXA 4K6AA 5I7GA 5G4NA 3STZB 2ENSA 4GJTB 5BO1H 4FQXB 1A4JA 2CNYA 3S34H 5IG7A 2JJSC 5HGBB 2X4RB 4BQ6A 1U5VA 4HUUA 4AT6B 1XLLA 5E9AA 3JV0A 4F24A 1VGKA 4HHMA 3L1EA 5T3XE 4UMCA 3M0IA 1BFOA 1T2JA 2WSQA 3W6LA 3AYRA 3GU1A 4IG2B 3POCA 3OKNA 3QQXA 3NGBB 5I8OH 4GVFA 5E03A 3O0FA 1P48A 1M1XA 2VLJA 3T0ED 4NUGL 3GC5A 2E9IA 2HWZL 3R0NA 2MEJB 4DP7X 4I5UA 4GKOA 4JHUA 5KBLA 5DRCA 1EX1A 2PO6D 2X8RA 3JYBA 2Z8RA 1L7IL 4W5ZA 4HW6A 4NN5B 2HFGH 5FYKD 1N8ZB 3NPUA 3UD6A 2ICWI 2V7HB 1OXYA 3PXLA 1XJBA 4HK3N 3TLRA 4WEEA 4PEEA 1UQSA 1T22A 3JTTB 4JDBA 3EBHA 2AABH 3VI4F 1DWGM 3WIHH 3REWB 1HKMA 3IJEB 3GYEA 3B7YA 4CUCA 1E43A 1HI6B 2E9GA 3TQ0A 3UYRH 2G3NA 4MKSA 2P80D 1NQKA 3FUEA 1GOKA 4DI8A 4CRPA 4G9FE 4PAZA 1IKFH 1NGZB 3GB7A 5CJNA 4Z95H 5HDQL 2BZ7A 1JF1A 4L4TB 1WG3A 2EEBA 4KUCD 4G42A 4C90A 1QR4A 1N19A 3MXWL 4IMFA 4HULB 4JTJA 2FT8A 3NVDA 3K5XA 5D70H 3SCWA 4QI3A 4YGVA 4XCNB 5I1HH 4XZBA 4DF0A 2R2EA 4QM1A 5JIWA 2C1PA 2Q3AA 9CGTA 1T83A 3OHXB 3QUXA 2XWRA 3WLWC 4JFED 5FJJA 5KVDL 1NIEA 2EKJA 4E9RA 5AHEA 3BWUC 2WTRA 3EW3B 1MWAL 3H22A 3ANYA 4IT1A 3VTTA 5DFTA 3G18A 4J3BA 3C6LA 5DLML 2XWEA 3GO2A 2GSGB 3CAVA 1M7IA 4P57B 1WIOA 5TH2B 1QRKA 4M7JL 3HURA 2NR6D 4PWKA 4ZO6A 4WEBL 4Y9FA 3I6LE 1QPQA 4PGZA 2CQVA 1G7JA 4I5BB 1B57A 1S9KC 3BZFA 2EEAA 1XL9A 3M5YA 1DO6A 2ACSA 5CFHA 5E2WL 5MHSE 5H8MA 4NJAH 3PG8A 3OMIB 3TFKC 2CKBH 3TVMB 2AQVA 3UTPE 5E24E 5EOCJ 2OLSA 5FF6B 3OR6A 2YX0A 3KHOA 5GRYA 5CSRA 3V75A 2ESVD 1GVOA 2OGYA 3H6JA 3WQ5A 2ZTKA 2BODX 2OLAA 5GNXA 4LSVH 5FO7A 4L5FE 4WTQA 4OM0H 2HPMA 4NZUL 3QORC 2AL1A 4R3SB 1B3JA 1DDTA 4U6XB 5KUMA 1LEKA 2V0AA 3VO0A 1CLXA 3S1XA 3TYBA 5BO0D 4H9UA 3O6LL 5J1AA 3QQDA 2B7OA 2GPZA 4WK9A 1SW7A 4RGND 1Q63A 4MAYA 3QIWB 3ITLA 4ML9A 4PJHF 1KXTB 1HZHL 5FI8A 2QIWA 3BN3B 1EUTA 1RZJH 3LKNB 4Y90A 3FONB 4IGBC 3Q05A 4JRFA 3OBEA 4PUWA 1X6LA 2L8AA 4HYRA 4ZRGA 2G37A 5DRXA 3E02A 3FT1A 3ULSB 4RSYA 4BSJA 1EFXB 1SBSL 4C56B 3LD8C 3CNKA 1BVNP 5C0GA 4AMAA 4N9CA 3FU8A 2JFCA 5J13B 2AJYL 3LH2L 4Z7UB 1PWMA 1U8NA 1R3IH 3FCTB 2XZQH 2Y25A 5D1ZB 2VKWA 5HJ3A 3FW6A 3WGVB 4G1NA 5H2ZA 5AVSB 3PM6A 2PTXA 3TBWB 1L9MA 5EL1A 4PI0A 3OKKB 1J2WA 3UAJC 5HD8D 3GS4A 2YDAA 4N25A 5LHDA 5FYKU 4KVPA 1IM3A 1K8IA 3ZQ9A 1MCEA 3E9AA 5IGXH 1LO5B 1MG3C 3ZR4A 4JM2A 1ZPTA 4XPGH 4IX0A 4MZRA 4OCLC 5HUPA 3GS7A 2FYYA 4R90H 1JPSH 5ADOH 4ZYKA 4X80H 1CD1B 1UBSA 1GKPA 3B9KD 4R4BA 4XH2B 1OE3A 4K3ZA 4LVGA 5DK2B 1ZAJA 4JFXA 1SJEA 4JNZA 1MW3A 4GX8A 3ZQXA 3WLJA 1PYWA 3CHXA 3OPSA 2OR9H 4QNWA 4QE4A 3ZL4H 2PP9A 4AJ0A 1FKXA 1VP5A 4K8RH 1Z3GH 5CEZL 1NCJA 4Z17A 5CJXC 1V0KA 4NT0A 3D5OF 3QC6X 1HJWA 3N2OA 1CZ8L 1DP0A 5JO5B 4AC4A 1T3FA 1G9HA 1EC8A 2Y89A 5L0QC 1XTLA 1UT2A 2I17A 4UUIA 3BVXA 2C9SA 5JYMA 4YAQB 3SDDC 4N2OA 1BECA 4R7NA 2Z6JA 5DRZB 3WFLA 1G6RB 4KNUA 1GPFA 5KS9F 1GYVA 2C7UB 5TIMA 3QFEA 5FM5O 4N0UE 1AL8A 2XH4A 5AC7A 2DUXA 5JHDE 1IFGA 1J8HD 1UB6B 3VINA 3CEUA 4FLOA 4DPPA 5H37A 3AG4B 3ZR5A 4MJZA 1IR1A 3OBAA 3ZL1A 4DYEA 1I75A 2KMWA 5C5YA 1TO5A 4ZUSA 4IQJA 5CU9A 3QISA 1O5QA 5BW7C 4LKCB 1VGAA 5A2CA 4XGZB 2VDLH 3VE0B 1LBFA 4O2CA 1EHNA 2BJML 1NCTA 4MCYA 1P1ZB 3MACH 5HDBF 1DIKA 2XFFA 1I7UB 1WGVA 3SE6A 3QO0A 3VI4A 5TQ0H 3IEBA 3B97A 5D72L 3QFDA 2YD0A 4JX4A 5CSGA 5GRJH 1AOZA 2O93L 4QF1A 5IF0A 2AV7B 2PD5A 5BOPA 3EJJX 3KL3A 2BOCA 3V4LA 3IJYB 3FSUA 3GLDA 4BFAA 4RNJA 3Q4DA 3DIVA 2QUTA 2OPJA 3WQEA 3VCLB 2HWGA 3KVQA 2Y7FA 4ZT1A 3BKYH 1W54A 2YK1H 1MREL 4HIIA 3V0GA 1K4GA 1QOXA 4IH3A 1LO0L 2AXJA 1YE6A 2ISDA 2Y8VA 3P0YH 5AZEH 4GW4A 1XIMA 1ONQB 3S1WA 4OJYA 4WDTA 1EKOA 2DKSA 2W95A 3MRKB 4Q97A 3L67A 2G4EA 1FX6A 1HHHA 1UJ3B 5FECA 1PMYA 1S7SB 5E95B 1E90A 1JYWA 4K7PY 4XMPL 2Q3OA 1RIVL 2LE9A 3RTQA 1WFTA 2A4EA 1P7QB 1MAMH 1CYWA 4XCEB 4LK4A 1O75A 3W37A 1G9MH 4RZCA 3D39D 3QW9A 1HX0A 1NJJA 2XETA 1L3WA 1KO0A 3VGDA 4PN6A 2IBGA 1MUWA 4FNLL 3V9CA 4JLRB 1YEJL 3DURB 3FCUB 1QLEH 4G6JL 2ZUYA 3WY4A 1E56A 1Q2SA 4G1KA 4U5KA 4K4KA 3BEWB 4HOZA 3L6FB 5EUKB 5F1SA 5HK4A 5EMLA 2GQAA 1OWRM 1M05B 4PUNA 1W5OA 4HUNB 4WNQA 4NQDD 4HJTA 1OSPH 4QDMA 3JWNE 4Y19D 2O4MA 4BFIB 3M0KA 5B38G 2EH7H 3EOOA 3OPZH 2OULB 4UNLA 3FMGL 4YHML 3OZMA 3VC6A 4WLCA 4WIWA 4JRXE 4EBQH 3LCHA 3OG2A 3SR7A 3MLPA 2D3NA 4AU0A 2N4IA 3QCVH 3AADB 3GPEA 1A7PL 4PGCA 1IZCA 4EP8C 3P2DA 4Y9MA 4E3VA 2J88H 2UZXB 3MRNB 4HIJA 2GBUA 3JWDC 1H5BC 4XNQA 5GXBB 4NAEB 4G9DA 2ISVA 3N13A 3QDJB 3LVEA 2IFFL 2XA8L 3DVNA 3S2JA 5D2NA 3HHRB 3SB0A 4BUGA 3PHOB 1OEPA 3IU3B 5IP4A 3CAFA 4ANVA 2B1HL 1J96A 3LLFA 3X3FL 2PYEE 3L3DB 4JHMA 4AGLA 1Q13A 3H9SD 4LHQB 4NRYB 1JZ8A 4GFTB 4CN6A 4AUYA 5B1CA 4QO1A 5C9JA 4XUYA 4JPVH 4M4RA 4PJHA 4A3HA 3L3KA 5JPNA 1OINA 1XI3A 1U3NA 1XGEA 5TNVA 2HYMA 1BMGA 3DBSA 4M5ZH 1REQA 3UYIA 3K46A 3KPRD 3GG8A 1CL7H 1UACL 2VI0A 3C5ZB 2P9RA 3BJFA 1H51A 4HJGA 4YL9A 4QE1A 3CZFA 1TZOA 3W56A 3E8UH 3RK8A 3P74A 1DSYA 4TN9A 1RAKA 1AUSL 1BGXL 2AK1L 3INOA 1IEVA 5E8PA 3NCCB 3FB6B 3HHSA 4LU5H 2FFIA 1HFBA 3CL8A 1F07A 1A7OL 1AHWC 2BC4A 4H9YA 4AV0A 3B0UX 5K39B 1TTJA 3R5EA 4GS7B 1FZJB 2FX9H 3DO7B 3IPEA 1WK0A 4IJTA 1OHLA 3DX9A 3GC2A 2Z31D 3OJMB 1OD8A 2GDQA 2ERJB 4XNYL 2IGLA 1C12B 3I7QA 3DOPA 2Z25A 2DW6A 2I5IA 5FYLE 3U0WL 1QU4A 5LGKA 1MHCB 4PREB 3KR3L 2G2PA 4O58H 2VLRE 3OKDA 5E0KA 2V3EA 2GK0B 3MR9A 3RLHA 2SEBA 1H1YA 4AZGA 4Q7BA 3CUXA 3PZ9A 1AL7A 5DO2C 4KVCL 1JFQH 3NIGE 2VM4A 3H2FA 4LF1A 2XPGB 1YXYA 2YFOA 4XAPA 2BNQA 4UT6A 2HN7B 1R85A 5FGSA 4O02A 3MTXA 3BN9C 1K3ZA 3LCIA 4P0DA 1WAPA 3OXSA 3V7PA 4V15A 4ELMB 2H9AB 32C2A 1FWAC 3GINA 1EJ8A 1TEYA 4MMYB 4AE1A 2YPVL 5CPSA 2HSAA 5GS0D 2VXSL 2J5WA 3B6SA 3CHSA 1E5ZA 3V0AC 5T1LD 3WUWG 1W9PA 4MJJA 4NZRH 2NV9A 1NA8A 2BVQB 3I7SA 2PXYB 2R0WL 4PRHA 4UTTC 4I7ZC 3I6EA 1KZYA 2GGEA 1OQFA 2Y5TB 5F88B 5KS9A 6FABL 3OMZA 4JN7A 2CIKB 4EZJA 3VXMD 2ANUA 2X9ZA 3BH4A 4L56A 2Y4SA 4FD0A 1U8OA 5DWPA 4JY6B 1UP2A 2C9RA 1CNVA 4HCRL 3I9PA 1T6BX 3ECWA 5AYUH 3NWRA 4HK7A 1IGJA 2VWEE 4WGHA 1FWGC 2Q09A 2NNAA 1PQZB 2VXQL 4FTVB 3O6ML 4P5KA 1KR0A 5E70A 2X2HA 3BURA 3TTEA 5GGVY 1VZIA 3TQKA 3EO0B 4P2OD 1XIEA 4QRRE 1T03H 3EOYG 2XN1A 3JR2A 1V7NL 1W5QA 4KRUA 5IMKA 4M5YH 1LOLA 2BVUA 1TWWA 1W56A 2OZ3A 3V7MA 3WFDL 5BZWA 3MV9D 2MCPH 1FH8A 3JU2A 5I77A 4WTZG 2CDFB 3BIBX 2VN3A 2CZ5A 1ECZA 3KCPA 2AV1A 1Z89A 1VFTA 5G4MA 2XZ9A 1M7DB 3U36A 4YZFF 3OAUH 1ODUA 1M1XB 1FZKA 4QHUB 4HJEA 2E7MA 4KZ0A 4P2RB 3L4YA 1Q45A 1LRTA 3S5ZA 3K2MC 4JRYE 2HE5A 2B39A 5CN3A 5GZOD 1L9OA 4JG5A 3PTKA 1D9KB 4MHHG 3WMPA 1GPOL 4Y5YC 5TK2A 5HHQA 2J75A 3T71A 3I50H 4NM8H 1AC0A 4QBXA 3B0VC 2ZX7A 4P3CL 4ZFMA 5AKRA 1G7LA 4FQQB 5CEXA 3L3OB 4TTDD 3U2JA 1H7NA 1EXBA 3FJLA 2WSRA 1ZSDA 3RDJA 4XI5D 1R7AA 1KTDA 4F7TA 2OWWA 4DN4H 3WH6A 3HE7D 4AZ7A 1HDMA 1QWGA 1R3YA 2FKPA 3HC2A 4JIIX 5AUMA 3BW4A 4X99A 5EU6B 1EJ7L 2RDTA 4QWWD 2GVEA 3CV7A 1Y1DA 2JK5B 5A8OA 3BZ5A 3GB7B 1NFIA 3QR3A 2HP4A 2JGQA 4DEWA 2NNRA 3DTXB 3MOBH 1C90A 1SQ2N 3AABA 3ZGIA 4F0SA 1B88A 3M7SA 4Y1TA 3NQBA 5DZOA 2IH1B 2ZOOA 1S7RB 3EKZA 4YGVB 4BKLB 1FL3A 2A85A 2Q3ZA 4QHLA 1U8JA 1NAMB 1Q90A 3CXFA 4MJ2A 3A6OA 1MI5D 4RXGA 4DFHA 4RFEB 5DHYA 1XBVA 4PMEA 4YX2L 1UFUA 1AFVH 3NQIA 1DBAL 1AZBA 1VYSX 2CKSA 5KVEL 2HFEB 2BHUA 3OG4B 3C6LB 2WMIB 3PABA 3N85H 2H26B 5L6YL 4GWEA 4ZW5A 2E9JA 3FB5A 5E5CA 5DZAA 5BW6A 2BXVA 1M7IB 1ZBWA 1FSKC 4A7SA 5I30L 1D8CA 1CBVL 4YWSA 5M3WA 5C09B 4PRPA 3B40A 1TFHA 3KDMA 3NSYA 1O5XA 3CUIA 3STZA 4FQXA 2ITCB 1E5UI 5HGBA 2X4RA 5LCVH 3EX4A 2NQZA 3H70A 2NX5D 2D4DA 3U2CA 5DUPL 1YECH 5AC4A 1EJSC 3MXVL 2OYLA 1Y18B 3OR6B 1E6ZA 3AXHA 2VUKA 4IG2A 3FEQA 3PRZA 2OMBA 1FI8C 4QXUH 5C0RL 3TAOA 2EDNA 3TZVD 4Q32A 2CO2A 2OL3B 3SDAC 1IM9D 4MZIA 2EDYA 2WQ8A 2CHWA 2B1AL 3F1QA 4JFHD 1LYXA 5BV7C 5CJMA 4OKDA 5KYXB 1RVGA 3BFOA 2B2XH 3L2NA 4O0ZA 3HKZA 4KQ4L 4HHAA 3STEA 1P0DA 1XEDA 1N8ZA 2XIOA 2V7HA 4AMKH 4PJ7E 2JJVA 4P8UA 3T2LA 5D7LA 4C6DA 1KNOB 1LL4A 1S5MA 1TTGA 1XINA 4LVAA 3JTTA 1SM3H 2V8LA 3CFCH 4JG0L 4ZFGH 3WYRA 3REWA 5IW1B 4B5ZA 3RHWK 3IJEA 2ADAA 3HG1E 3SE3C 4O51B 4KK6D 1HI6A 1RZ7H 2X1PA 5JMUA 4KEMA 2X0VA 3Q8AA 1W6TA 5LIKX 1IQ8A 1NGZA 3JBG7 3HLAB 3QZLA 4K8GA 5EZPA 4QOKD 3EXRA 5J3HD 1KT2B 1BYCA 4IIQC 3KM2A 5D04C 3E96A 3BPLB 4H01A 5GISH 5L7XH 2QGDA 4KT2A 5FYKL 4I89A 4XCNA 4XWOD 4ZQNA 1EP1A 5C08B 9PCYA 1UXSB 2MJWA 1PLGH 1BRLB 5K59E 3OHXA 2DTML 1GHFH 2A38A 1PD6A 1G7VA 1ZSHA 3VFRB 3VNLA 3I2CL 2B15A 3C5SB 3KTSA 3QI9D 1UROA 4Z5RB 5KYWB 1WKFA 4YXLL 4CQ9A 1NC4B 1GOGA 4WFGE 1SLXA 2IAAC 1YYML 1E42A 1D2PA 3PPSA 3QQWA 2GSGA 4IJRA 2YO3A 3WF1A 4P57A 1NCBL 1X6UA 2XWCA 5TH2A 3IU4H 4KJPD 1BTCA 4BWUA 2HXAA 3NT0A 4PJ8D 1QZ1A 1UHVA 3WD0A 1J2BA 4G72B 5HHOE 2KUTA 5ESAB 4ODHL 3AWNA 4IBZA 1MCFA 4ZTOL 5EHFA 2R1PA 4F91B 4D8LA 2OMZB 4FR6A 1UWFA 3D46A 1OZQA 2DL9A 4HXAL 4QAMB 3ZKND 1B1YA 4RZBA 4K7VA 3ATEA 3TVMA 2YEVB 3MO4A 4BWLC 1ANUA 2ODIA 5FF6A 4H40A 2K9FB 3AIRA 1N6VA 3LV6A 2MSPA 4ZMWA 1Q94B 5K9QG 2D03H 5E5LA 1RPKA 3OGRA 2YW4A 1JZEA 3DMMC 2NZ1A 1A7QL 2GWGA 2CBUA 4GSRA 4YDIH 4RZ5A 1T3FB 2F5AL 1FAIH 4R3SA 5BS0E 4U6XA 3ARED 4WUKH 2FBOJ 4JM0A 4Q6KA 2UXVA 4R4NC 4DF1A 2APBA 2XJ7A 1XMEB 4I1NB 4TQEL 4R7NB 1BVZA 1A4CA 4ATLA 4XB7A 1XLJA 1Q8JA 2ZE3A 1PFCA 2GJ6B 4H0IA 2PCQA 5ELIA 5FEBA 3O2VL 5DTFB 4XRCB 1KPUA 4QYAA 2J71A 3QPXH 3TWYA 1A65A 1G0XA 1RJPA 3F4CA 1T66D 3ZLGA 3HC4H 3MNMA 1XWYA 2J88A 3ULSA 1O1HA 4P4KC 4DETA 1EFXA 5C0NC 3DUHA 4O2CB 4S11A 1UM5L 4CC4C 1PZ0A 3RITA 3E0FA 5AECA 2KLRA 1LG1A 9RUBA 1UD4A 5CN1A 3FCTA 2F5BH 3OKLB 5A6BA 5D1ZA 4MUPA 3W1RA 2GGJA 1F1GA 2DIJA 1FWDC 4QF1B 2RH9A 2QUVA 3TBWA 7CGTA 3V0VB 2X6VA 3OKKA 4XMZA 1KGWA 3BAYA 4MAVA 1M42A 3OLDA 3HR5B 5F0MB 2OSYA 4OJFH 3CV1A 1Z3NA 3KBNA 3KWVA 2XJKA 1LO5A 3KLQA 3AYTA 5EN2B 3WJJC 4IJBA 1ZV9A 1I1AC 5F9OH 5DZ9A 3UR2A 4DAGH 3QS2A 4GKNB 1C3FA 3S0CA 1CD1A 2RD0A 4KKAC 5BQ7B 2ZOKB 3UZEC 4LAMA 1KRMA 3R1GH 1QSFE 3MQIA 4XH2A 1KCRH 3ULVC 4EOWH 5REQA 1XX1A 5DK2A 3H2NA 2HSIA 4K5NA 3N9GL 3QWNA 3UGEA 1HCFX 3WGUB 4HWBL 4GH7B 2HH0H 4NNBA 3PQYE 4WY7L 3B3IB 4JIRA 3WQCA 4RW5A 5CHNA 1JDEA 3IXAB 2PWHA 1N12A 3GSWB 2HUEA 4PMQA 3Q2DA 5DHDA 2GIXA 3GLEA 4BQ2A 2X0WA 4ELMF 4BH8B 4W68A 3KXFB 4AXWB 5LXEA 1JPHA 4GO6B 4O28A 1FP5A 3VOJA 5JO5A 1RZQA 3CVIH 1G0YR 5SV3A 3T8LA 2IPUK 3EHBB 4YAQA 3IFNL 1GAFH 4LHUD 4BQCA 3T3PE 5HWJA 1NBCA 2V68A 3ZDZB 2EXYD 2RJMA 1PZDA 1LP9E 1ACZA 1FAKT 5DRZA 1G6RA 3HA0A 4Z7WE 4U7KA 3U2IA 2VVSA 1GZQB 4CMMB 3CLEL 4BF9A 2C7UA 5JQ9A 2F61A 4J2XA 1K2DA 3OZOA 2FJSA 4UCFA 4LRIC 3ELAT 3CAWA 2YBTA 4RJEA 1OADA 3O4LB 4S1SL 3QH3B 2HTKC 1E4IA 1PG7L 5FACA 1N5AB 1T1XB 4XOBA 3NEVA 3F85A 3G22A 3L1FA 2H0PA 2O7QA 3M41A 1TSIA 4XGZA 3NYZA 1GHRA 4JTEA 3VE0A 1OTSD 2R4RL 2FT6A 5MI0B 1P1ZA 1I7UA 1NLDL 4QEEA 1JCMP 2QFPA 3TWCH 2V3GA 1F6FB 4PJHB 4LVHC 4F9PC 2HXUA 5CZ0A 4RDWA 1S3HA 4HMDA 1MXDA 4FXFA 5ABDE 1O7DC 1ET7A 4O52A 2PLCA 3MRLB 4HK0B 3MCKB 2J1YA 1XGYL 3IJYA 1WT5A 4LEBA 2Y1ZA 4UOW0 3M1ZA 1MDRA 3WNOA 1MCDA 1EBHA 3IK2A 3CZFB 5AVXB 1GJIA 1YPIA 1RUPH 3VCLA 1JDCA 4WOZA 2DUAA 4JAMB 3V5CA 1KLYA 4TUJA 4X7SL 3VG0H 1OGBA 4U33A 5EORL 5GHWL 2PUQT 1MEXH 3NP3A 2BY0A 2JQZA 5BUGA 4GLEA 4KBPA 4KJQD 3TXAA 1AD0B 3MRKA 3N40P 2A3LA 2WXRA 1P0BA 4HCFA 1UJ3A 2DV0A 1U8HB 4JFUA 4DP2X 2GC4C 2AOSA 4PTTB 3SKNB 4RLDA 2UBPC 4ACYA 4AWEA 2XPYA 5BU9A 2R1WB 5FC9A 5I1EL 4JS7A 3PULA 1P7QA 1XLEA 4Y4FC 3XISA 4C7DA 3EYUL 4XCEA 1ZP3A 3IKKA 2WVTA 3X13B 4GJIA 4XC3H 4XNUH 4IP5A 2CXEA 1H49A 2PBGA 4E4FA 2BVEA 2ISFA 2VC2H 3N42B 4Y1AD 1R38A 4NLHA 3BEWA 5IROD 3L6FA 1NWSA 2UZPA 1AE6L 5EUKA 1RBLA 1M05A 1T8QA 2BNQB 3VVGA 1E0WA 2VOMA 4BEUA 5BRZB 1R5YA 3CN0A 3B43A 3EPNA 5EC2B 5H37H 4DVRH 4MD4B 5C9KA 4U3XA 2D3LA 2FIRT 2ADFL 3FKRA 4FKHA 5E8OA 3O9WD 2O7SA 4HS6B 1XSJA 3RL2B 5I1CL 2XYBA 3QRBA 1TA3B 2FH6A 2HT3C 2UZXA 3MRNA 1F61A 4DKAA 2FJFB 4HYWA 2G0LA 3APDA 4NAEA 5ERWB 2J27A 3B2DC 3QDJA 1UUOA 2Y23A 1BOYA 2F15A 5AW5B 4PM1A 3NTYA 3ZHNA 3PHOA 3IU3A 1GVSA 5KS9B 1IB5A 3L3DA 1BM3L 4B5UA 4NRYA 3HCVB 3HTLX 5I78A 3B9EA 2MWCA 2ZCZA 2F53E 1OKEA 3GR4A 4O15A 4AX3A 3KVDD 1CW2A 3NFSH 3M45A 3WLMA 4UB0L 1B4LA 4IOFC 4Z7NE 4CNIB 3W7RA 3L5MA 2XZAH 1YQVH 4M3KB 2WXNA 1L6FA 5JDSB 2NNAB 3PF2A 5I75C 4IRJC 1NWRA 1F3RB 3MJ6A 4PJ5E 4Z1YA 1KM3A 2E25A 3SW6A 5I76B 3BLDA 3FQTA 3T4WA 2O9OA 3PJNA 5JZ7D 2CCLA 3PAOA 2QHAA 3FB6A 3NEEA 1KFBA 4BCXA 4S2BA 3DIDA 4TLKA 2Q20A 2YHGA 4FIRA 3AB0B 1SN2A 3WSQL 4V2XA 3ITXA 1JG9A 4LS1A 5E09A 1FZJA 2I9UA 4CNPA 3VB9A 1GZHC 4H9XA 1AO7B 3LHVA 3IRDA 1ECYA 3O8XB 4MKNA 1HXMB 3H85A 2JI1A 2AV1B 1F2QA 5IJBC 1P1VA 2GSJA 4I8YA 1SUJA 3W7DA 2GC7C 2OK0L 1BQSA 1C12A 1O5KA 2OU4A 1MCJA 2AEIT 4RESB 5E0FA 3CUPB 3FA4A 4DBUA 3FO2B 3HNTL 5ANME 2R0KH 4MS8D 5I9QC 1MHCA 2Q7NA 4PREA 3TN6A 2ZXBA 1M3IA 4HV8A 4ECNA 4XAZA 2GK0A 1MCCA 4I9JA 4DLFA 3EKLA 4DYJA 3TJLA 2M1KA 3NEXA 3VKBA 1UPPA 3BL3A 1KM4A 4MZ8A 2CDGB 2XPGA 3QAQA 3QEGH 2X88A 2HN7A 2BNRE 4MA7L 5IKCB 5I74C 4MCNA 3ZJ7A 2BX5A 4P2QE 4Q58C 1NKGA 4ELMA 2WYZA 4GSXA 2H9AA 2E1WA 5AUMB 4P46A 4MMYA 4CCDA 3VFLA 3MSGA 4BI7A 3LQAH 4DERA 4K7PL 2I56A 3CK5A 2BFVL 1V6TA 2OQHA 3NFPB 3QXDA 2ZOUA 1BYNA 4L3ED 4B5EA 2ZYRA 3FKKA 4W6WB 4HKZB 5F3FA 2BVQA 3ATDA 2WKOF 3MSRA 3NQ8A 1T6WA 2PXYA 3V5OA 1FWIC 3AAMA 4O4WA 2A9BA 2QR0B 2IUZA 1S8DB 2Y5TA 5F88A 1TQCB 3E38A 4R53A 1Q2RA 3QRHA 2Q6WA 3FTXA 4NRXB 1MRQA 4PP2B 4JY6A 2Y0SA 4L5ZA 4R8WL 1AI1H 4WW2C 1U58B 3S2NA 2BOGX 1XV8A 1C5BL 4A29A 5LNRA 3TT1H 5GNZA 3SGKA 3R58A 3W9DA 3UO8B 1A3LH 4JGDA 4EK7A 2JFEX 5D8JL 4FTVA 4WKFA 5G2HA 4QNPF 4CD5A 2AW2A 1L6XA 1RCQA 1SDAB 5GS0L 3ARDC 3MZGB 3EO0A 3W1TA 2BXZA 2BNUB 1QWKA 5HATA 4L4VE 5D71H 4FXKC 2NWSA 5BOEA 2YXGA 5SWSE 1K85A 4FQLH 3HBLA 2J7EA 4AX6A 1AS8A 3IS4A 1XRVA 3DO3A 2DRUA 4V1DB 1MXGA 2OSWA 5E00B 3Q1SH 5D1QB 1IBDA 3VWJD 4RDVA 4KUZL 3KBFA 1HNYA 2CDFA 1P0KA 2FSDA 1A5SA 1H0GA 5MEND 3M16A 2DQXA 3SSGA 2C3VB 3BT2L 3X1BA 4FXGC 1M7DA 4Y8FA 5A6MA 2WQSA 2CA4A 2X3BA 4DK3A 4Z18A 3QNYB 4QHUA 4GUOA 2J24A 4ERGA 4P2RA 1IZKA 2XIMA 4FNPA 4CL7A 3NCMA 3DSNB 2HS6A 3LIZA 2FZ3B 4P5TD 1HP4A 4HHAB 1D9KA 4ZD3H 3GZAA 1R24B 4NBXB 4JKWA 3W1LA 4UDUB 3CSYB 4UT6H 3U7VA 4GXUN 3GNMH 3DX1A 5D7LB 4O02H 4FQQA 3KDOA 1V6VA 3L3OA 2O61B 4N85A 2EPHA 1BX2B 1XF5B 4OFCA 1HG3A 3PWJA 5AD0A 5LA2A 4N87A 4X2UA 3OLEA 3CYVA 4LIQL 2AK4D 1FCBA 2F54D 4Q52A 2HKFH 4YEFA 2TMDA 2ZOLB 2J7BA 3US0A 4E41E 5EU6A 5CLYA 3EAKA 4MFHA 1FWNA 5EA9A 2JK5A 3BJTA 4F8QA 2PAJA 3CZKA 5A6SA 1REIA 1HC1A 3DTXA 3C52A 3RJQB 4MNQB 3L5XH 2XHNA 3G1FA 1ETZB 1QO2A 4AXNA 4K15A 3CSBA 4H6RA 3U30B 2ZCLH 2IH1A 4LPVA 4C6FA 1S7RA 3GM0A 3RA7L 5MP6H 3LZ5A 1FCVA 2FD6L 2LVCA 4BKLA 4HZ7A 2Y70A 4JO2H 2ED6A 2FK9A 2D3VA 2JKJA 1NAMA 2ICWJ 4WWKC 3IMRA 4EWND 1G9NH 5GJTL 1SXSA 4N2DA 4RFEA 1YKWA 3UG3A 3NQCA 4PI2A 3PP4H 3ZY7A 5FSDC 1RHHB 2BDQA 1W6WA 1QNSA 2HFEA 1EEZB 4RMRA 4TVPD 1KBVA 2WMIA 1ASPA 3HC0B 3L66A 2H26A 1GSMA 4B60A 3AVEA 1I2QA 1QR1B 5JTWA 4BIKA 5IB3B 1E51A 3ME0A 3VRLF 2OXNA 4S1QH 4OT1L 5C09A 4LDCA 3ELFA 1TELA 5KVFL 4Y9NA 3U2ZA 4MVAA 3LGDA 1SY6L 4M80A 3IAPA 4H8WC 2ITCA 1GG0A 3US9A 4C6OA 3K8LA 1G4SA 1EAPB 1MCRA 2WJZA 1R19A 4HF5L 1SVCP 3ZDZF 4FF5A 1NFGA 1Y18A 4JPQA 4IFRA 2W60B 4WDIB 5DJXB 5C3TA 4UZSA 1DVFD 3VXSE 2YSTA 1TNMA 2OL3A 1IQWL 2PODA 1Z6KA 4LCSA 2WZMA 5I3DA 4LYKA 3TXVA 5B7FA 3VXQA 5KYXA 3WSUA 1EDHA 3TCTA 3HFMH 2DBJA 2PP7A 4N0YL 4ZXBC 2WPGA 4HPGA 5GGVL 1TMQA 4ZO9A 1YE4A 3ECBB 3T0EC 3NYKA 1JXDA 3HI5H 2YXOA 3MCOA 3BXWA 1XIDA 1KNOA 2VDOL 1B9KA 4ETQB 1EJRC 2P8MB 3QJXA 5FWQA 3LCXA 5FKAB 2W0KA 4ERIA 2EUVA 1MJ7L 1J05B 3PPEA 3VVWA 3WG6A 3T0XA 3WQVA 4W1TA 5IW1A 1KPUB 2H2PD 1VFFA 2X4NB 4QSHA 4O51A 2XYCA 2VELA 3F03K 4KJWC 1AD9A 2CG9X 2AAMA 4KWWA 3RWGB 5ECUA 3HLAA 4H83A 3HAEA 1M3JA 1KT2A 5A94A 3G9AB 2R9RA 1S2VA 4I3SL 4CADB 3S96B 1D5IL 5G4EA 3APCA 4ADSA 5C08A 4XN7A 4JO1L 1UXSA 3M1OA 3MJ9L 2EIMB 1BRLA 1RU9H 1C5CL 1MFBL 4EIGB 3STBA 1VYRA 3BLBA 3VFRA 3VI2A 3C5SA 3ZJ6A 2OTPA 2HRPL 1C1EL 1QRND 4Z5RA 5KYWA 2FT7A 5LIYX 2AXWA 1VGEH 1NC4A 1KDJA 5CJBA 2WKOA 1QNQA 5EA0L 5FHBH 3EJCA 4PMDA 3W2UA 4TUKL 5HHXH 5G5IA 1EJOL 5FHAH 2RFGA 4XNXL 2Z93B 1DBMH 3PWPB 1EJXC 3ESOA 1E6OH 1Y6MR 2F6KA 4PCPA 4AIZB 1GOXA 1ICSA 3MREB 5ESAA 5REQB 3N42F 1G5GA 3JUGA 3D69B 2XV2A 4US6A 2OMZA 4PTXA 4NWTH 2NR6C 2YFNA 3NCXA 1W9DM 5C0IA 3MLUH 4TX6A 3AFLA 5CHNB 1TJPA 2VW7A 2WXQA 2XZCL 2ZCGA 4XCCL 1KBIA 3TNBA 3QXUA 3TEWA 1Q94A 4Q8NA 3CSGA 1MNSA 4I2XE 1FFQA 5F6IC 2J6VA 4PPTA 2MOGA 4HJUA 1NAKH 1B0RB 3EJYD 2D2HA 3POHA 4FG6C 3IDYB 4PP1D 5D55A 4AQAB 3P9MB 4NHVA 1PZ3A 1ITQA 4JDEB 1OJXA 4L18A 1UFGA 3L7EB 3VIMA 4KNQA 3HPLB 1X5MA 2Y7NA 1OW0A 2X6AA 4U5IA 2GJ6A 4XN1A 2BGSA 1DQML 1K2DB 1QACA 4NPYB 5C0AB 3QDGB 1NCHA 2FZMA 3GQFA 2WOYA 5DTFA 4XRCA 5C6MA 1X7SA 2IH8A 3A9BA 3WLSA 2L7QA 4LLQB 4D7PA 3QBTB 4S0HA 4KU1A 4RGNC 4QJ1A 3WFBH 4WO4D 4L1LA 5K9KB 2J9YA 3QUZC 5GS1C 1OF0A 2A77H 1H15B 1IEXA 5F8QC 3B7SA 4FQIL 5F71A 1XPGA 3P81A 4NZDA 4BXVA 4RGMB 1PG7W 4E36A 3OKLA 1QMLA 5KYUB 3J27A 1GW1A 3AXIA 5EULV 1H7PA 5FOOA 4K9EL 2P5WE 3ABKB 2AF2A 3V0VA 4BF5A 3LMZA 3SBWC 1BWVA 5LUMA 5AEAA 3QHMA 1MFUA 3HR5A 1GGOA 4G43B 5KTEL 4ZXLA 2J7HA 5IESH 4U49A 4ONGL 3SCTA