2XIIA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with an extended 9-fluorenone iminosugar inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 157
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xiiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xiiA01
2EPNA 4C7FA 1CLVA 3BLPX 3CHCA 1KQZA 3CZNA 1V0MA 1CWYA 3WQ5A 1HJUA 5FKYA 4D6FA 3S5YA 2FE0A 1JD7A 1MWOA 2VRQA 4NXSA 3W38A 1C8XA 1FOBA 1E73M 3BSGA 1FH7A 2XGIA 1GQKA 3BUIA 4PMVA 1EHAA 1HJVA 1E3ZA 3GZAA 1KTBA 5CPSA 3ARWA 3VM5A 1QI3A 3CHDA 3W24A 2A3CA 4AZCB 2J78A 2NT0A 1PPIA 3WDJA 2W4XA 1W32A 1E5JA 4N0RA 1UWTA 2WZEA 1ZJAA 1TE1A 3IAPA 5CSYA 3KL0A 1ZBWA 1FP8A 3BMWA 4CU6A 1M53A 5EB8A 1GCYA 1RP9A 3W28A 4OJYA 3WF2A 1BG9A 3IJ7A 2QLYA 5A69A 3HU7A 2VX7A 4TVUA 3BAKA 4B15A 1FH9A 4JFVA 3GDBA 3DHUA 5CPTA 1UZ1A 4PMOA 3BLKA 2WKLA 3VIMA 3OLEA 4CD6A 3QOMA 4ATWA 4J3XA 2BVTA 4CD5A 4UFLA 4AD4A 4JKKA 3PZQA 1XCWA 5I24A 3T2QA 3N1AA 1WCGA 3CUGA 4YN5A 3VSVA 2UY5A 3M6DA 1GQLA 1D7FA 1UQYA 2O9OA 2ZUSA 3N18A 1XRVA 3SUWA 1BYBA 3S2CA 5HDRA 5A8NA 3WFZA 3GM8A 3BAIA 2YA0A 1TVPA 5CLTA 3VD5A 1JNDA 5D9PA 2MANA 5JIPA 4KGLA 2GUYA 3OLGA 3NJ3A 4NI3A 4DM2A 2EACA 3NDYA 3UG4A 1YQ2A 2V3FA 3WY3A 3T0BA 3SCPA 2BXZA 3O6AA 4PMXA 5LA2A 1HKIA 2FHCA 1W3LA 3PZIA 4HA3A 1GOIA 2DT1A 1J0JA 2CNCA 1HF6A 2BNJA 3L2MA 4NRRA 3WUGA 3VD3A 2FH6A 1HVQA 2WVTA 3AHTA 4NZFA 2F1BA 2IGTA 4HTYA 2XJ7A 4YPJA 1DP0A 2F7PA 1WE5A 1XV8A 3GNRA 4MAVA 4AZ6A 4W86A 3WUFA 4A3HA 3LPGA 4JFTA 1K9DA 4HU0A 3IAQA 5JBDA 2OYLA 2BY1A 1QHPA 5HNNA 2EABA 5A2AA 3FY1A 1JNEA 3GXFA 2W91A 2AOSA 1JAKA 1H0GA 1RD6A 3N17A 3WD4A 1XSIA 2ZUWA 1CXEA 4J3TA 3II1A 1PEZA 3CPUA 1J0HA 2BHZA 3BUBA 1BF2A 1UKQA 3CV5A 1V6YA 5LYRA 4D6HA 1QX1A 4PBGA 2PC8A 3HMCA 1QPKA 3BVTA 1EIBA 3HN3A 2W66A 1KXTA 3VGGA 4CCCA 1UKOA 5DT7A 1J0KA 1NOWA 1AMYA 1IZJA 3LRMA 2E3ZA 4B9ZA 1J10A 3F4VA 3F5JA 1CYGA 3VD4A 2ZWYA 5FCZA 1GONA 3N04A 5IHSA 1EOMA 2VQTA 2BHUA 3AYRA 1KTCA 3NIYA 2ZX9A 3VIKA 2WHMA 3W81A 1K6AA 1V08A 5HXMA 3HG3A 3CO4A 1C7TA 1J11A 2XFFA 1E72M 1OT2A 2FH8A 2OYKA 3SCQA 1JFXA 1XHGA 2W62A 5CG0A 4P8UA 4JCLA 4J27A 2J8FA 2EPMX 4L4OA 3SCRA 1P6WA 2ZXAA 2BS9A 1W3HA 8CGTA 1KBKA 3WKZA 4P7LA 1KR0A 2OWXA 1XH1A 3HG2A 4BCEA 4H8UA 4PEEA 4MADA 4MTVA 3F5KA 4CD7A 1VIWA 4DWSB 3KEHA 1TFVA 3BGAA 4PMUA 4E2OA 3ARVA 1Q6EA 4IM4A 3VGHA 1HT6A 3OZPA 4WKHA 4TVDA 4PMZA 2ZUTA 2WCGA 1V6WA 3SCWA 3NDZA 3A23A 5CJ5A 4FLRA 2OLHA 3BC9A 2XM2A 3D5HA 5AY7A 3EDJA 4V2XA 3BVVA 4CVWA 4PRWA 3UG3A 5BXPA 1GOKA 3DX4A 5A6BA 1UKPA 4MDOA 4QLJA 1QNSA 3UR7A 1R86A 3E1F1 3WMBA 1DWFM 4UFIA 2J7HA 2F7QA 2OWWA 1TQTA 2D73A 4JKLA 3EJUA 2VZVA 1WDQA 1WNOA 4DWSD 3CC1A 3CZGA 1V0KA 4XZBA 4UFMA 3WQWA 2ZUMA 4R5EA 2IXVA 1TA3B 3K8MA 3N13A 3EJSA 1NARA 5A3HA 4M8UA 1ITCA 3VDAA 1CGWA 1EDQA 2GK1B 4NSBA 4YHGA 4JCMA 2TAAA 2YL5A 2XFRA 5A6AA 3ZJ7A 3RM9A 1UH4A 5BWFA 1OIMA 2JIEA 4JKMA 3A21A 5GNZA 3AS2A 2F8QA 4UOJA 2ZICA 2PF0A 3O9NA 4CD8A 2NSXA 2FGZA 1B3YA 5CXPA 4M81A 4DUVA 1HL9A 3CZ8A 1MW2A 1W1TA 3EJQA 4PMYA 1VFMA 1AQ0A 4DO5A 3GXNA 4C7GA 3CIVA 3A47A 3GTNA 1WDPA 4FNSA 4MDPA 1QNQA 1W9BM 1V3LA 1LL4A 1XYFA 3EMQA 3N11A 3WNPA 1UZ4A 1OWQA 1NP2A 1OINA 3VSUA 3OZOA 4D6DA 4JFSA 3L4TA 1QI5A 2NT1A 5A6BD 2YBTA 1NM9A 2DT3A 4V27A 5FOOA 1DHKA 1GVYA 2VVNA 1UD5A 2OSWA 4PUDA 1Q6GA 1JL8A 3WQ6A 2WMKA 1CZ1A 3A3HA 3SUVA 3LPPA 1E4LA 4UFKA 2VZTA 1MQQA 4KWUA 5DMYA 2G4FA 1GJUA 3L4ZA 5A8QA 1E9LA 1TR1A 1H2JA 1V02A 3WIJA 3QGVA 1MW3A 5E0CA 2DPEA 3TONA 4R27A 4FLSA 1GW1A 2EBNA 3AFBA 3POCA 5C70A 1JYNA 3DYOA 1SR0A 2GDUA 3AHVA 4DM1A 5E70A 2X0YA 1UHVA 3GH5A 2G3MA 2F18A 5I77A 4F8XA 2JE8A 4B9YA 2PWGA 1LQ0A 3PZMA 4UQ9A 2WXDM 2XHYA 4P8XA 1E6NA 3UETA 4ATDA 1QNRA 1UOKA 1XH0A 3SCOA 2W92A 1I75A 2VRKA 3HG4A 2WCSA 1ISWA 4RE2A 2CITA 4D6EA 5BXTA 2QHAA 3D50A 1JF6A 4UZUA 5A8PA 5I23A 1H0IA 1GZJA 1E3XA 4GQQA 5CGMA 2XN1A 3BVWA 2CERA 1PS3A 3WNNA 4Z2LA 1WP6A 3LXAA 2VT0A 5A6MA 4ACYA 1JAEA 3NYDA 2EQDA 4WJXA 1VJZA 1AQHA 1C90A 3CH9A 2DGAA 1G9HA 3PTQA 1B3XA 4JFUA 3JUGA 2VCBA 1XC6A 4HOWA 3W82A 3WF3A 1HNYA 5A2CA 1V3JA 1MQPA 3ZR6A 2AMGA 4OGZA 1E4NA 3VGDA 3N9KA 1VFUA 4W93A 1FA2A 3BCDA 3SURA 4BA0A 4WF7A 3WD0A 4Z2JA 1E4IA 3OA5A 2XGBA 5EFFA 4E8CA 5AC5A 1ZU8A 3WY4A 1QBBA 3CUFA 1XYZA 2GFTA 3BUQA 1R8LA 2YFNA 2ZOXA 3LPFA 5A8MA 1E6XM 4A4AA 3ALFA 4X0VA 1SMAA 3ZT7A 4Y7EA 3DX3A 4QLLA 4FNRA 2YL9A 2X09A 5JBFA 5AYIA 3ALGA 1CGYA 4U2YA 1JZ8A 4AIOA 4OOZA 4UQAA 3QHOA 1R7OA 3D4YA 4H41A 3ZMRA 3L4YA 3PZVA 2F2HA 5CLWA 4GQRA 3GBEA 3AMLA 4LPCA 4ZXOA 1V3KA 3AZRA 1V03A 4J3VA 1UR0A 2WMIA 1OD0A 3GYCA 4PTWA 1OM0A 4W89A 5CSUA 1JI2A 4XB3A 1QOXA 3CZEA 1PX4A 4TTGA 3WSUA 5DT5A 2ZXQA 3FHQA 1J0YA 3TTQA 3T0DA 3VNZA 5M3WA 1W9UA 1KWGA 4DUWA 1TMQA 1BFNA 2RGMA 2CBIA 4EKJA 5D9NA 2V5DA 2EO7A 4AZGA 2QMKA 3M7SA 4X0NA 3WUEA 1RH9A 5DEZA 4TTUA 5E9AA 2PBOA 1FHDA 3G6MA 4ZE4A 4L4PA 1IV8A 2A3BA 2XVPA 3CZJA 4DWSC 4OBRA 1DEDA 3K4DA 3WENA 1VFOA 2Z1KA 1XSJA 3VKKA 4PTMA 1LL6A 5GQBA 3WDIA 2GJRA 1LG1A 4AW7A 1UR2A 2D20A 2BY2A 1NP0A 4UOQA 3DDFA 5BRQA 4JHOA 3VDCA 1UD8A 2VL4A 4JFWA 2WWCA 1OGSA 5A6LA 3TTOA 2IUZA 3N15A 2OSYA 1TQWA 3BH4A 2VC9A 4Q7NA 4NX0A 4CN6A 3RJXA 4HA4A 2J7GA 3WEMA 1UG6A 1CEOA 2Y8KA 2V3DA 3ZJKA 3RCNA 4OUEA 1ISYA 1H49A 1HKJA 4QCFA 2FYVA 2X0HA 1J12A 1JZ2A 3OLIA 2UY4A 4HMEA 3BAJA 2GJXA 1E6PA 1NWRA 3MV11 5BYWA 3CMJA 1HJXA 3RO8A 1GUVA 4U2ZA 3AIWA 4PMRA 1B2YA 1BHGA 1E71M 4PN2A 4AWEA 1B3WA 5BROA 4P7RA 1E6ZA 3GXMA 3FXYA 2YDSA 1BQCA 4W7UA 2WVVA 3ARQA 2X8RA 3AMGA 3IJ9A 3AIRA 3WH6A 3BUDA 2YFOA 1CBGA 1HXKA 5HOSA 1CXFA 4WSJA 4TOQA 1J0ZA 3VIPA 2F1AA 5JUVA 4EANA 5ECUA 1DWHM 1JI1A 3FAXA 3RM8A 5E09A 1GOOA 1PIFA 5HPOA 3GXDA 1WDRA 3WL0A 2Y4SA 4MB3A 1HKMA 3GXTA 1J0IA 3OB8A 1QNPA 3AS3A 3VDBA 5GNXA 2VCAA 1D2KA 1JDAA 4PSRA 3RM4A 4TX6A 3VMPA 4P7QA 4P7NA 2WAGA 1US2A 1NWUA 3FN9A 4MNLA 3NSNA 2QMJA 3CHFA 1JYWA 2YLAA 2WVSA 4GO8A 3AIQA 3WH9A 2G3IA 4FF5A 3UESA 4D1JA 5IXEA 1WPCA 1BLIA 5C8BB 3LRKA 1E43A 4J3SA 4EE9A 5HBFA 2V3EA 2DSUA 2OW6A 4CGTA 2B31A 2PB1A 3AMDA 5A6KA 4AIEA 2VZOA 1JZ6A 7A3HA 1R46A 4IUGA 2WZHA 3WNOA 4U3AA 1C8YA 4NF7A 4LYRA 1VBRA 3LXBA 1JDDA 1VB9A 1UR8A 4B16A 1Y7VA 5A2BA 2Q8XA 3MV01 4NZJA 1CGVA 4AD3A 1JYXA 3OLDA 1Q6FA 1ZJBA 2J25A 4DO4A 2XIBA 1XD0A 2XSBA 2Z1SA 3MANA 1RP8A 3WQ4A 1GOMA 3AZTA 3U57A 3WH5A 5DF0A 1KXVA 1MFVA 3LRLA 1OT1A 2WLYA 2V38A 1GVIA 2D2OA 1BYDA 2VZSA 3MUY1 4MB4A 1B3VA 1W2VA 4FLQA 3DECA 1GHSA 1NOUA 1UH3A 3WH7A 3ZJ6A 2C7FA 1HTYA 3FAWA 4CKQA 1ZBKA 1G5AA 4ML4A 2W5FA 4GIAA 1UYQA 1VFFA 3WMSA 1MVYA 5I2UA 1R85A 4HOZA 3TTSA 4W7WA 2YDRA 3MUIA 1M01A 4AC1X 3FHAA 2E4TA 3AHXA 4PTXA 1CPUA 1KCLA 3CUHA 1ISXA 2GSJA 2VVSA 3PHAA 3AIBA 3I3DA 1UKTA 1CDGA 3RIKA 4MJ2A 1V02E 4D6JA 1H1NA 3ZT6A 2FDMA 2WSPA 4UQDA 3W29A 4UOZA 1UQZA 3NSXA 5ABFA 2WMHA 4CU8A 1C93A 3DYPA 2CEQA 1EDGA 2V3GA 3N12A 3I3BA 3VDHA 1F4AA 5IDIA 1CENA 3DX2A 5I78A 3PZOA 3ECQA 1BGAA 3PN8A 1OD8A 4FNQA 2Y2WA 2GDVA 1VBUA 4W8LA 1O7DC 4J3WA 2CYGA 2YKKA 3ARUA 3PZNA 5IFTA 4LX4A 1AQMA 4PUEA 4CN4A 1QHOA 2PWEA 3SCTA 2XUCA 3M46A 2X2YA 1KGWA 3EJTA 3A4WA 3SUUA 3DDGA 3CZLA 1LWJA 2VR4A 3HG5A 1UWUA 3VVGA 1W3KA 3SCUA 1TVNA 3MMWA 2WMJA 4BF7A 1CXHA 4AMWA 3KWXA 1HJSA 4BZYA 4GZJA 2J8GA 1E1FA 1W2PA 4HZ6A 2X2HA 3K1DA 3MI6A 5TD4A 4QAWA 5FD0A 4HZ7A 4FNTA 1C8QA 5I3DA 1EQPA 4TXEA 2GJPA 1HJQA 1I1XA 5LA0A 2ZX6A 4F9DA 1W91A 2J7DA 2XTKA 3D51A 4FLOA 5BRPA 4N42A 1GJWA 3WUBA 1W9VA 2Y5EA 4UQEA 1PBGA 3ZQ9A 4DWSA 2BFGA 1EQCA 4ACZB 2WVVB 5ABHA 2O9PA 1TCMA 5EBAA 3W4RA 1K9EA 3MS8A 2CKRA 1BGGA 4F9JA 5E6ZA 5D9MA 2WW5A 1HVXA 1U33A 1E0VA 5HPCA 3WDRA 5E6YA 4D71A 4DO6A 2WC3A 4W88A 1LL7A 4M1RA 1TZ7A 1DWGM 4P8VA 2CETA 2DSWA 1SFSA 1UD3A 1BG4A 2X1IA 1VEMA 4E4PA 1HWWA 4GINA 1US3A 3MMUA 1VEPA 3ZJ8A 2BHYA 3BXWA 1JZ3A 3VGBA 1BPLB 1UR4A 2JF7A 3B9EA 2GVYA 4MNJA 4ZFMA 3B9DA 3LXCA 1QI4A 3CGTA 4HPHA 3KLKA 3J7HA 3WF0A 2XIIA 1QVBA 1WKYA 1E4MM 1G0CA 3UEQA 1TG7A 4KRUA 1WAWA 5CZKA 1ZBVA 4MNMA 3L4VA 3EMCA 1PX3A 1ZBCA 3PTKA 1UUQA 4IPLA 2X05A 3WF4A 3GBDA 3CUIA 4XUYA 4XZWA 3DX0A 1FHLA 4GXPA 3ZT5A 2O92A 1IT0A 1OCQA 6TAAA 5I79A 1RPKA 3VIFA 4AD0A 1UWQA 3CMGA 4B3LA 2VOTA 4UFHA 3U5UA 2DSKA 1ZB5A 3ZIZA 2FGLA 3AXHA 2WBGA 2WM0A 3WEOA 3VX1A 4LYQA 3SUTA 3BVUA 3T08A 4OOUA 4CVUA 1QW9A 4AD5A 4DUXA 3QOKA 3H54A 2EEXA 2W61A 4AY1A 2DH3A 2ZUVA 1E0WA 4JHZA 4CU7A 3APGA 1WB0A 4M82A 2VO5A 1TQSA 1V0LA 4TX8A 1BSIA 2ZIDA 1CNVA 1W9XA 1R47A 1PZ2A 3AICA 3W27A 1UA7A 3KZSA 4OBSA 6CGTA 1LF1A 4FNUA 3GNOA 3PTMA 3WY1A 2PI6A 1JZ5A 4GI6A 1V0NA 3PZTA 4BQ3A 2CBJA 3BLBA 3WBAA 2WHLA 4LYPA 3OBAA 1E6QM 4W87A 1V3HA 1W1YA 4CUCA 1OSEA 1ODUA 4MAZA 1CECA 2G8ZA 3CZSA 2JIWA 1J9YA 1NQ6A 1XD1A 4IPNB 2J4GA 2DIEA 4URIA 1U2YA 3AZSA 4PTVA 2YL6A 3GXIA 7CGTA 4U31A 3K46A 4YHEA 1HXJA 2W67A 2C8NA 2VI0A 1HIZA 4JL2A 4BS0A 3U5YA 3T2PA 4GZIA 1QI0A 4H2CA 2CIPA 4CN1A 5I6SA 2WCAA 2WHKA 1W1VA 3BSHA 4J28A 3TP4A 3DX1A 2ZXBA 1KCKA 3ZM8A 3RDKA 2CBVA 2VX4A 2XM1A 3VIGA 2VJXA 1JXKA 5D8WA 4FNPA 3NUKA 4M80A 4OIFA 2WLZA 1CGTA 3VUPA 1EDTA 1QI2A 5ABGA 4F79A 2YA1A 3PZGA 3VO0A 1UKSA 3ZR5A 1E70M 2Y8VA 1GPFA 1ISZA 1H09A 2YDQA 1MW1A 2JALA 3VIHA 1E40A 1SYTA 2VR5A 5M17A 5EFDA 2WBKA 5M5DA 1FFRA 3T09A 1W3JA 1X1NA 3ARXA 1QW8A 4D6GA 3KL3A 1V3IA 1U30A 4RL3A 4AMCA 2ZXDA 1L8NA 1V3MA 1DWIM 5A6JA 4UNIA 1GORA 3VTRA 4QP0A 1I1WA 3BAWA 1Q4NX 1UH2A 3AJ7A 1SZNA 1C92A 1ESWA 4KMQA 1PIGA 4OZOA 1E1EA 3WQ8A 3HZ3A 4BQ4A 4ACZA 5KZ6A 4HPGA 2NW0A 1LWHA 1W9DM 1R7AA 5BXRA 5D9OA 2D1ZA 1TA3A 4D1IA 3AROA 4ZE5A 3RPMA 3WDQA 3IGUA 3ARTA 1DWAM 2AAAA 3WD1A 3OGSA 3VGEA 2FHFA 4XX6A 1F4HA 2BVDA 1G94A 3D3AA 2BY3A 1ISVA 2Y24A 1KR1A 3MO4A 1VRXA 4EK7A 2YBUA 2WB5A 3ARZA 4WLCA 5DFAA 2F7OA 4W5ZA 1JZ7A 2XWDA 1KFWA 4PMDA 5BXSA 3O2LA 1B30A 1FFQA 4HMDA 1CLXA 4GO9A 2YOCA 3AQUA 3EJRA 2HVMA 4M29A 2G41A 4Z2KA 3GNPA 3AIVA 1OGGA 2QPUA 2DIJA 4AZCA 3OGRA 3L4XA 3VSTA 3SEPA 1DTUA 3AHZA 2OSXA 1CGXA 4JIEA 3WDHA 1E15A 4ZENA 4W85A 3VIOA 4LXFA 4GPNA 1BVNP 1B9ZA 3LPOA 1EOKA 1WO2A 2XYLA 3WN6A 2D0GA 3VIJA 2XN2A 3WNKA 1EA9C 3SUSA 1XCXA 5EMYA 1EO7A 2X2JA 1MFUA 1C91A 4AEFA 2DT0A 2ZX7A 5GPRA 2UWFA 3W25A 1CXKA 4J7RA 3WNLA 3A4AA 1WZMA 3MUAA 2EXOA 1ITXA 3GH7A 5E0FA 2BXYA 5FIPA 1KGUA 1GOQA 4RE4A 1BVZA 4WSKA 5FL1A 2JEPA 4WKAA 4S3JA 1DWJM 1BAGA 4W8BA 1MXGA 1UR9A 2VX6A 3UG5A 1BYAA 4AXNA 1XSKA 4H8HA 3DC0A 2C0HA 1BTCA 2D22A 3EDKA 1R75A 3VIIA 3D52A 4WK9A 5D8ZA 2W63A 2E40A 3FW6A 2WPGA 2VUYA 4FK9A 3SCSA 2YJQA 4UCFA 3VOCA 4XV0A 4AZ5A 2WC4A 3ZOAA 2PWFA 2DH2A 4CCEA 3ARPA 1KBBA 2WKGA 2WNWA 2XVNA 3BUPA 3WF1A 1R34A 3A5VA 1LJYA 5JBEA 3OGVA 3S6TA 2OW7A 3CBWA 1MXDA 1VF8A 3WQVA 1V6VA 1XGZA 2VURA 2PWHA 3WDPP 4HA1A 1O7AA 4JZ5A 4F66A 3M07A 3KL5A 2CPUA 2WSKA 2F7RA 2WMIB 1UWIA 2E0PA 4X9YA 4MB5A 2A3HA 4H8VA 3AXXA 3ARSA 3GXPA 3VD9A 2J79A 2PWDA 3EDEA 1ODZA 1M04A 1Q6CA 1E56A 3B9AA 4HOXA 5BCAA 3MUZ1 3DYMA 1B31A 2O9RA 2WMFA 4MJ4A 2OWCA 4WKFA 1AVAA 4CCDA 1TQUA 3W53A 3K8LA 3IK2A 1OIFA 4PYSA 1GHRA 1J01A 3OIHA 3F5LA 4PCTA 3MSDA 2EJ1A 2O9TA 1WZLA 2D0HA 3B8SA 3BMVA 1PJ9A 2VMFA 2YL8A 2ZX5A 1UR1A 4TUFA 1X6LA 5M03A 1G01A 3WNMA 2J7BA 1NWTA 1WDSA 5IFPA 1OBAA 3DHPA 1QHZA 2E9LA 4HU8A 2OYMA 5IHRA 2RGLA 5AYBA 2ZE0A 2JFEX 1OGBA 7TAAA 5CQ1A 5D4YA 4UFJA 3TA9A 2WZIA 3AXIA 4EAMA 1YHTA 4MB1A 4WIWA 1B3ZA 5AC4A 3CTTA 2XN0A 3WELA 2DSZA 4PSPA 4M24A 4A3YA 2VX5A 4HZ8A 3AS1A 4GKLA 1WZKA 4AISA 3AHYA 4AZBA 1O6IA 2DDXA 4H7VA 1UWSA 2JF6A 3CZKA 3OG2A 5CPQA 2VTFA 3AI0A 1JIBA 4GI8A 2VCCA 3AIUA 2ESCA 1SMDA 4QFUA 2WWDA 4KRTA 3PBGA 2QF8A 2J75A 1PX8A 3A6OA 1B1YA 2CESA 2D3NA 2CCRA 2A3AA 4PMNA 2QV4A 1EXPA 4HMCA 3MMDA 1JG9A 2HISA 2G3NA 2UY2A 1KGXA 4HP5A 1ECEA 8A3HA 3ARRA 1PAMA 2VQUA 2GK1A 2EPLX 2XPKA 3LMYA 3THDA 5CGTA 3IJ8A 1XH2A 4UTFA 1HN1A 4PCSA 3PZUA 3VILA 3SCVA 5LA1A 1UD4A 3L4UA 1VENA 2YA2A 3AISA 4AEEA 3VMOA 1N82A 2BV9A 4TVCA 1D3CA 3BVXA 2D23A 2QPSA 2GJXB 2XVKA 2BY0A 3EYPA 1A3HA 2XG9A 3U7VA 1MYRA 3D4ZA 2CHNA 1MW0A 2EPOA 5I5RA 2YIHA 3ZSTA 4ZXLA 1E0XA 1R33A 3K4AA 4AIUA 3HJEA 4AYGA 1KQYA 2EADA 5C71A 4Z2GA 3ZO9A 4RE3A 5A95A 4D6IA 4CD4A 1IZKA 2PBGA 5FL0A 1EO5A 3LX9A 1C3FA 4S3KA 1UASA 1JYVA 5F7UA 1EGZA 1KB3A 2DSVA 1C7SA 1JDCA 1KXQA 4W8AA 3AMKA 2CBUA 4B3KA 2IXUA 4ZEPA 4D72A 3PZ9A 2G3JA 4W5UA 3WEZA 1CXIA 1OB0A 1JXJA 4AMXA 1GQIA 1JF5A 3QHMA 4AD1A 2WC7A 1HL8A 1V6XA 1UD2A 3KLLA 1CGUA 1V6UA 1Q6DA 1H3GA 3AOFA 4M56A 4PMQA 1UA3A 3WBEA 4H04A 4U5KA 3CHEA 3EBVA 3T0AA 5A8OA 1FH8A 2XFYA 3UERA 3BCFA 2E9MA 3KE0A 3G6LA 4NZCA 1M03A 2E9BA 1QBAA 2J47A 2JEQA 2BVYA 4UQCA 4AYSA 1PZ3A 1QNOA 3H53A 3VPLA 3QR3A 2XWEA 1ZS2A 2ZWZA 3TOPA 5A94A 3WY2A 4JAWA 3MSGA 2ZUNA 3AIEA 1QWNA 4LQ1A 5KEZA 4MPKA 3VGFA 4GZEA 2D3LA 4KGJA 3ZSSA 1HX0A 3SCNA 1EH9A 3NSMA 3WL1A 2EAEA 3UR8A 3EDFA 3RMEA 4D6CA 4U5IA 3VINA 3GH4A 3RJYA 2FHBA 4UZSA 1TQVA 4Z2HA 3QHNA 2XVLA 2VNCA 4UQBA 1K9TA 1W9PA 2J77A 2E8ZA 1VJSA 1HP5A 1H5VA 3I3EA 2VZUA 1NOFA 5ABFB 4K68A 4QDMA 3W26A 1Z32X 4V28A 3WFLA 2J7EA 2J74A 3WD2A 3VM7A 2YLLA 1WZAA 5E1QA 4ATLA 1NWSA 1NH6A 5A1AA 5A6SA 1GQJA 1LLOA 1JFHA 1KWKA 1H11A 4U33A 6A3HA 1FP9A 3WMCA 3NCOA 3VNYA 3W6LA 1A47A 4U3CA 4W84A 1EHNA 2DEPA 3U7BA 2ZUUA 1CXLA 3FNDA 3THCA 1CTNA 3AYSA 2J7CA 4AD2A 3L4WA 1HP4A 1H41A 1QWUA 1M7XA 2ZX8A 4P8WA 4FMVA 1KXHA 2XSAA 3VMNA 5ABEA 1VEOA 3BAXA 4J3UA 2WMGA 3H55A 1VAHA 1R87A 4MNKA 4AZHA 1JZ4A 5JIWA 4Q22A 4QLKA 3VD7A 3EMZA 4LGXA 1GNXA 3A4XA 3IANA 1UD6A 1HJWA 3TTYA 2V5CA 2J62A 1MQRA 1B90A 3RILA 2XVGA 1T0OA 4AZIA 5DO8A 2UY3A 1H4PA 3CLWA 3VU2A 4C7DA 2CHOA 3EDDA 2WANA 4NXKA 4QCEA 1G1YA 3W37A 4BQ5A 2X2IA 3BAYA 2WVUA 4AZ7A 3UCQA 3EJPA 2CKSA 3MKKA 5GNYA 3T2OA 3AMCA 3POHA 1TUXA 3W6MA 1W1PA 4Z2IA 3S5ZA 4BQ2A 3A24A 2WK2A 4E8DA 2F61A 1E5NA 1K9FA 2CXGA 1CIUA 4OKDA 4IISA 3ARYA 1ZL1A 3WH8A 2D24A 4UR9A 1LG2A 2ALWA 1J18A 4JL1A 3VX0A 2WYSA 3A22A 2A3EA 3WD3A 3CUJA 1UWRA 3MU7A 1E55A 1E6RA 3K8KA 4P7OA 3L2LA 3W0KA 2VRJA 1JD9A 2DQXA 1BYCA 2J7FA 1HKKA 2EPKX 4NRSA 1S46A 3SIMA 1L0PA 9CGTA 4W7VA 4GI9A 2WHJA 1X6NA 3AS0A 2E8YA 1E6SM 4KH2A 3TV8A 1JGIA 5I0DA 2D0FA 1GOWA 1B0IA 2DT2A
chains in the Genus database with same CATH superfamily
2PYEE 3O11A 1A5UA 3O81A 3FT3A 4PJ7A 2NMSA 3QW9A 4JY5L 4HKJA 3NZHL 1BKSA 1V0MA 3OG6B 5B4MC 1R6VA 1P7KA 4O2CB 1ACXA 2N56A 4A7GF 1CWYA 3V4VL 4AXWA 1HJUA 2J24A 5D04C 5I1DB 3WQ5A 4QOKA 3ZZLA 5IJKC 2QCDB 1GZ1A 4OLZL 5L9DL 4DHLA 3AXLB 3M0JA 3QS2A 5HVHB 3UO1H 1FOBA 1JQVA 1RKRA 1S7RB 2FECI 2V82A 3EWXA 4K2SA 3RG1C 1XW8A 4Z42C 4LCUB 4CMMB 3O4LB 1S5VA 2XGIA 1UB5B 4BXSV 1RJPA 4PMVA 3GSXA 1IBZA 4Z3IA 1BMWA 3DURB 2BOBA 5CSZA 1XBDA 1EHAA 4I3SL 2B1OA 3V0IA 3WIIL 2HFGL 3L3KB 3RU6A 2ACRA 4A8RA 1E4KC 3IK4A 2VC6A 1ONRA 1E3ZA 1KLZA 1FXPA 3JV4B 1KTBA 4PJDB 4JFOA 2HROA 2A2QT 3QT2A 4KKAD 4OE7A 1PVNA 1QI3A 4NBXB 5ACZB 1A3WA 3CHDA 1MFCL 3H42L 3WV0A 5HNTA 1P7TB 1AR1C 2NT0A 1TJRA 3WDJA 2APTA 1BF8A 3QJHB 1L6WA 4IG2B 4N2BA 2ZCLH 3VA2C 5C6PB 3TA3D 1N59A 3N2JA 1S8DA 4I18A 4NQXB 3CL6A 4L6HA 1WIPA 1MRCL 4JPSA 2Y0SA 1N12A 3OM3B 4S39A 1FFTB 5I0XA 4O54A 1QNZH 4P3WA 2DLGA 5T1DH 5TDPA 3UJTH 2Z4QA 4NC1C 4KKRA 2MFNA 4PJCA 1IKNA 5H2BA 5DY3A 5D2NB 5FO2A 1JZEA 3DFOA 1MCOH 3N9GL 4Y2LA 1BG9A 2R4SH 2VDKB 2L4OA 3FJNA 2LLNA 3PWPD 4AJ0A 1BD2B 2AXFA 2GPZA 4IRSB 3ERXA 5F9WB 3S3BB 4JO4H 2F6XA 2G0WA 3TYDA 4PY8J 1CG9B 1Q72L 1YEEL 3SYQA 5BZXA 1EAJA 1MCPH 2GJZB 5D5MA 1ETJA 2XETA 3NDZE 2OK0L 1P2CA 1MN4A 4N4PA 3D2UD 3DHUA 4PTTA 3KPOA 2CNYA 3VIMA 3OLEA 4XMTA 2QCMA 3BYTA 4Q4KA 4CD6A 2WINA 2NTSP 1JRBA 32C2A 1GZQA 4G8EA 3D06A 4J3XA 2ZKWA 4ATWA 2NXYD 3AWNA 4IRZL 4NX5A 1DVTA 3KPQB 2DL9A 1HI6A 4AEHH 1GG0A 3RMJA 4XMVA 1HKVA 4CD5A 1JNJA 4PB3A 1S2TA 4AD4A 1SYVB 3BPWA 2FZ3B 1VACA 2H6UA 2YD2A 3FX4A 5HUOA 3T2QA 1TNMA 4QHKJ 3UZVA 3N1AA 3CUGA 4QE5A 1WLHA 2DQWA 2H6PA 4FEIA 4L3ED 3UZQA 1JUBA 5FHAH 2E9WA 4G1EB 4BH7B 4LDEB 2UY5A 3V5HA 2N01B 1GQLA 1D7FA 1RVGA 3W5MA 4E38A 2QNEA 3CWOX 4MOZA 1U8KB 4JG0H 1OAQL 4U1LA 2CJUL 1EC7A 1FFOA 2ZUSA 3CU1A 1Q65A 4HEME 4UYPA 5MHSE 4XR8C 2QKFA 3LNEA 1J5OL 1I8KB 1M7IB 2DLHA 3VE9A 1EF2A 5T3ZH 2Z26A 2MPAH 3VI3A 5D05A 2NVCA 2GL5A 1AKPA 5IVZB 1QFUL 1S3KH 2PW1A 4G42A 3MCLL 5SX4I 1RVKA 4PZVA 3FTYA 2P80D 3PREA 5DD3H 4FQ2L 1ZENA 2IDFA 5CLTA 2OLDA 3MHUA 3LHZA 3S9IA 4LV4A 4K7PX 1NCCH 3ZTJH 2OO6A 1XXFC 4ZVJA 4KUCD 1RZ7H 4LVGA 2VN3A 1YQ2A 4OCSH 1A5AA 2Y23A 4Z0JA 1CBJA 3WY3A 2ERJB 3B0PA 5F4SA 4HS8H 1BIIA 5D1XB 4LVBA 1L4IA 4P8WA 2X7LA 2BXZA 5LGHH 2ZC1A 1JWMB 4RWYH 3BCJA 3LH8A 2RUSA 4RDVA 4MD5B 4IZGA 3OVPA 3BDYL 2P4AB 4I9TA 4U4MA 5AAMC 1T22A 2IDTA 2Y9RT 3KHOA 3A4JA 3G5VB 3C60C 2WMPB 3BKJL 4DESA 2KDYA 1W3LA 2V2CA 4IQEA 3C60A 3QUKA 3W7LA 2N1KA 3B2UD 1MWAL 2EEFA 2FWLB 5FO7A 1GOIA 4K2UH 2DT1A 2XG4A 1A3RH 1KYFA 2CNCA 1XZ0B 3EX6A 1X7SA 5IBXA 1S9YB 3AREB 1MDTA 1XIDA 4N3TA 3SDDC 2ZXGA 1E2VA 3OKEB 4NRRA 3SRHA 3ILPB 3MLTA 1BXBA 1QOKA 1ETB1 4GG8B 5JIDA 2Z7GA 2DAVA 4PC8A 4YPJA 1KBGH 4HTYA 3TSBA 4BWLA 3L3OA 4Z77B 3M0KA 4CL7A 4Y4KB 5DD5L 4MZRA 5K1NA 3V0FA 1H1YA 4YU1A 1XGRA 3B0UX 2VGIA 2CLVB 3BQUA 2F38A 3UWUA 2X4QA 1UXMA 3OC5A 1ED3A 3KCLA 3KAOA 2ZNWA 4BR1A 3LPGA 1FV1A 2X44D 3ARBD 1K9DA 2C9UA 2H0EA 3MA7A 3UROR 4F7MB 4NO3A 1KOAA 2YSSA 3TL5A 2OYLA 3ZKXB 5AENA 2A1YA 5HGAB 5JBDA 3FKRA 3BLDA 2BY1A 4GE8A 3MJ6A 3LS9A 1DSFH 1R3KA 4EO5A 1A4JA 4LV9A 5E93A 2UUDH 2QCCA 5I1CH 5AC8A 2ZZ1A 2GPTA 2G30A 1UJPA 1MCWM 1UJ3A 1W16A 3CH8A 2NY4B 5CGYC 43C9B 4AAJA 2W91A 1JGLH 1E90A 1Z9SB 2Y06L 3D5OF 4DJFC 1RZJL 4GQPH 2A74C 4AQEA 3N17A 1J93A 4KFPA 1S7WB 3BH9A 3E2HC 3QQDB 5KVGE 1DQJA 3KR3L 3IRPX 2Z7YA 5C0FA 1PEZA 3CPUA 4WJEA 1D3GA 4HIHA 3U0PB 1BF2A 1UKQA 3H3BC 5LYRA 2HRPL 2O5YH 2Y2TA 5E4IA 4LDCA 5J1AA 4FQCH 3HMWH 5AOMA 4FQ1L 5C3TA 5IP4A 2NY2D 5DR5H 3FVMA 1OWWA 4F58L 4UMCA 4P9HH 3W7OA 1FAIH 1N5AB 1OAZH 3CLEL 1FYHB 2PC8A 4PVNA 4PMJA 3HN3A 4JAMA 2W66A 2YZ5A 4Q6KA 1J5SA 5I1HL 1K1DA 1UOLA 2ATMA 1I7UB 4P3CH 3K2UL 4HWZA 3S7GA 7TIMA 3CDGB 5EUOB 5KUMA 5JPNA 2YR3A 3H2CA 1MOEA 3BT2H 4FIRA 4Q6JA 5G5DB 2CLMA 1IZJA 1LP9A 4P2QA 2QS8A 3LCWA 3P8JA 1CGSL 2EIZA 3W76A 1C5BH 2PDXA 4PTUA 3E1ZA 4GAAA 3EBHA 4B9ZA 3Q01A 5IG7A 1U1HA 4TR9A 1PG7W 2OMAA 3EKCA 3VCRA 5BO1L 3IMSA 4JDVB 4G6AC 3QVAA 4WY7L 3W57A 3VD4A 2D2CC 1SY6A 3DOHA 2IDCA 4NWUH 5JXEA 2FQGA 5IHSA 2WQUA 4AX3A 3CHQA 3FS9A 4PLKD 5CJ8A 1EOMA 1BPVA 2HFEA 2PO6A 4EF3A 4ODTH 4W6XB 3OSKA 5JHDD 4F20A 3MV8A 1TJHL 5JUEL 3GTTA 3C6LD 3KLSA 1T21A 2CALA 2WHMA 3VIKA 3VOJA 1UQSB 2ATAA 3T8LA 2V9RA 3VXSB 4DNLA 1LE9A 4WNJA 5CEZH 2WXRA 1EYEA 3C09C 3T3PB 2NXGA 2VDQL 3GK8H 1E2ZA 1RZPA 5LSMA 1C7TA 4A6YL 2A9ML 2GTQA 3STZB 1J8KA 5D02A 3MREA 4L9LC 5IBLD 1OT2A 2OYKA 3G6AB 3VRLF 5IJCC 3WQPA 3WX7A 3SPVA 2C7UB 4X9GA 1JFXA 1XHGA 5T8GA 3W1RA 2JQXA 3SKMA 2IADB 4JCLA 4J27A 2IPKA 1ZLUK 3RPDA 2N7AA 1EGVA 3QDMB 3I75B 4OD3H 5C07A 1TJIH 3P2TA 3U30C 1LO2L 2EPMX 1HH9B 1A0DA 2BS9A 3NR0A 4KK5D 2EIEA 4CDHA 1W17A 1O6VA 3WEXB 3OAUH 2UX6A 1EPVA 1YYLL 5DGRA 5FS5A 1GGBH 1NJ9B 1QNIA 4P7LA 2UZXA 1SVDA 3Q13A 4GCAA 1OAYL 3I85A 1ME9A 4MCYA 1ZVNA 1H8LA 2R1XA 3INOA 4I48B 4YHIA 5XIMA 3F2DA 1UMLA 4H8UA 3HEIB 2R1YB 4NKOA 3TC3A 3GMNA 4ZG1A 1BWKA 3F5KA 2CM6A 5DK2A 1T2QL 2ESVB 4I85A 4PMUA 4NYYA 3LHPL 4MMZA 1BM7A 1FBIH 1TCRA 1XO8A 4ICWA 4WWKC 2YW3A 4ABUA 1QFHA 5D1QE 5HR6A 1Q9KB 1YE6A 1P9MA 1KXVC 4JTRA 4F8LA 2ZD0A 3H9HB 3P3SA 1KBIA 4MJMA 2R29L 2ZUTA 2ZCHH 4KDTC 5HVHC 1V6WA 1BOYA 1MLCA 3QRBA 1O66A 4WCJA 3ARDC 1ZRQA 4L3EE 3D12B 3DWTA 4X4MA 3V95A 2EVJA 3EGSA 1EMTH 2ID5A 2UYLB 3BC9A 1W3TA 2A9NH 2XM2A 5AY7A 5EDXA 2G75B 3EDJA 1GOKA 4DBEA 4QCIA 2OXGB 4F7TA 1GC1C 1QVOB 4I18B 3QPQD 3TV3H 2YB4A 1PZDA 4IHOB 3RPBA 2B59B 2CMRL 1TPH1 2Z35A 1S7QA 1GVRA 5BQ7B 5KVFL 2V8ZA 1IKNC 2YXMA 3EA1A 5BJTA 3E1F1 1WA1X 1VYRA 3S9ZA 1DWFM 2A9NL 5FAAA 5K9OB 3GFXA 3S96A 4EZMA 3WFEL 4WAFA 5D96B 5CZXD 4JFEB 1YXYA 4YAQA 1TLMA 5B8CB 1TQTA 4DH2A 2JI3A 3RCYA 2QZQA 1XRFA 1KENH 3O3EB 1CG9A 4G8IA 2EO1A 3B3IB 2ROYA 5FHBH 3RHWK 4I1PA 1YHPA 1WDQA 4KTEL 3DOSA 1ZHBA 4JFFD 3ZN6A 4WO4C 1N2RA 3H2PA 2X4OA 1EWHA 5EZIH 1V0KA 1WNOA 4XZBA 3QG7L 3ZTJG 3DCPA 4DVOA 1VGEL 3QP3A 2W94A 2FT6A 4LASH 4K3DH 1M6OA 4ZO8A 4UFMA 4R5EA 4GAYB 1KGIA 2XWTB 4JTKA 3LLDA 3K8MA 4IBYA 1YRKA 3N13A 1E3FA 1IXNA 3TW9A 4Q9RH 1FH2A 2HN7B 3A0OA 2R1PA 3WMLA 2HJFA 3DGRA 3GTVA 5I06A 4RE0A 1TZIB 1CGWA 3VDAA 3KBSA 2GK1B 2JI2A 3VFNA 3W6YA 4WI4A 7PTDA 1JPDX 1V10A 4X8JB 1A5NC 1ZJHA 4JTTA 2EIJB 1FNSH 3NCXA 2TAAA 4K7PH 1IUZA 4X6DF 5I1KH 1UH4A 4FOUA 5BWFA 3FOLA 5EOQL 5CR8A 2E77A 1AGDB 2ZXEB 4JKMA 5D4YA 3A21A 1AG6A 1J88A 1WGVA 4FZ8L 1G7IB 5D1QD 5BPPA 3T6VA 3BZEA 5E9DE 5B8CC 2UWEA 3VXMB 1PG7L 4KI5F 2Q2EB 2C16A 3ISIX 1PD1A 4PD4K 5AAWA 1CDJA 4G7VH 2IQTA 4Y2DD 2ALDA 3M47A 4CD8A 1T5XA 3TN0D 2AF2A 2Z9TA 4YWIA 2FGZA 5IQNA 1DJSA 4AKPA 3V6OA 1PSKH 2PDMA 4M81A 4ZW3A 2Z31D 2ZSVA 4L23A 3S36H 2AEWA 5SWZD 4XSMA 1AQ0A 4N6FA 5AZEH 2J8TA 3UZEC 3X1GA 4XN9A 4C7GA 5B1KA 2ZSWB 3DUUA 4QJ3B 1NMCB 4G42B 1PB0A 1SJAA 3GTNA 4HHAB 1AP2B 4WTZA 3FFCB 1ZQ5A 1WCBA 3O06A 1NKRA 3H7BB 2B77A 5IMKA 1LL4A 4IPIA 2EYRA 3Q2VA 3DJTA 4YTSA 3I6TA 2QDGA 5E9XA 5C0EB 2YD3A 4DP7X 3QHFL 1OINA 1W54A 3QXUA 2R4RL 3OAZK 1I8MB 3M0LA 3QI9B 3OVRA 4D6DA 3OKNB 4X80L 3DIFB 4Z7VB 5C9XA 2YPLB 1QI5A 4GO6B 4XO5A 1EIXA 1OX4A 1ZANL 3P0VH 1CGSH 1QSZA 4OM1H 1PY0A 3NYZA 3T0TA 2KLRA 5FXCH 1Q9LA 1U8HB 5A16B 3VE7A 2ZTKA 1MJ7H 3B9KD 4P57B 2VFHA 5IF0A 5TF1H 1HSAA 4NPYB 5JHDE 3TO4B 2CO2A 4HSHA 5E2TH 3RITA 5FOOA 3Q48A 1GVYA 5JPMB 4WNQA 2VERN 1YEJL 2ZYHA 2Y3AA 3GHBH 5GRXG 5I6NA 1JL8A 4X9FA 3WQ6A 3WK3A 1AH3A 4DHGA 1P4CA 4KNSA 3SBWC 4UT9A 3UPCA 3LPPA 1E4LA 2ZKHL 4RGNB 3MOAL 5DA4A 1MQQA 3BW2A 4FYTA 2QAPA 3LKQA 3GSNL 1CW2A 2PKDA 4N0UA 1YN6B 2W0UA 3TFXA 4LCRA 2P5EA 1LYXA 3ILEA 1GJUA 2D31A 2IANE 3V6BR 3P30L 3PGDB 5EB9A 1H2JA 3LN4A 3WIJA 2FVLA 1MW3A 3UAJA 3LA4A 2DPEA 1M7JA 1O5PA 2H3BA 3V1HA 4M5TA 1AQKH 4JFHD 4AYBA 4EIGB 1LO4L 4AV0A 5AG9A 3C0LA 4UTAH 4KRPD 2OXHA 3WLWC 4NO3B 8XIMA 3HPAA 1CL7I 1QFWL 2EJAA 3VRIB 6XIAA 3MJ9L 3AITA 4UIKL 4DGUA 3AHVA 1DSFL 5E70A 1XTLA 4YUEL 1Q4WA 5JOPD 5DELA 1M42A 3GH5A 2F18A 2WBJB 3H9SE 1CLCA 1NCIA 3FRPA 3QR0A 3V0WH 1HW6A 3KYKL 4YWSA 4F8XA 2A9CA 3KBPA 1T5WA 2PWGA 4OQ1A 5GS0H 4GD0A 4UQ9A 4ODHH 2MKLC 5DC0A 1VFHA 1S7WA 1D9KB 3A6CL 4KK5C 3T6XA 3UETA 3ZKSD 1J87A 4NZUL 3QJSB 4ATDA 2A9BA 3QNYB 3TU6A 3NM1A 3O3AB 3K6NA 1VFTA 1OSYA 2WQXA 4KEUA 1OEZW 4IOFC 1R3IH 2VDLH 2L8AA 4AGPA 2VLKE 3HG4A 3ULUC 2AQVA 3QY7A 5IT2L 1Q9WA 3CL8A 2R83A 4HSNA 4RE2A 1GOHA 3O63A 4XZUA 1UZ8B 2VUOA 4N9DA 4RZ4A 3TZNA 1U9KA 3D50A 4KVCH 3C6SB 4HZMA 4UZUA 1BLNB 1FVEB 3GF8A 2ADIB 5I16A 4Z08A 1OY0A 3T4AB 3A3WA 2VDPH 3MJWA 2XN1A 1PS3A 3WNNA 3QWOA 3TA4D 4O00A 5LQBH 5CEYB 1F8IA 3HNSH 3ORJA 4PJGA 1YVLA 1OK0A 1O5QA 1TZOA 3G5EA 4K9JA 4MD4B 3GDTA 4JFDE 4OF8A 5LKNA 3G5WA 4PJDE 1JVOA 2G2NA 1P4BL 5HWNA 1NJJA 2O1AA 3GMRA 3EJZC 3NAAL 1FVDB 2B1AL 3KBHE 3OKMB 5LGHL 3P82A 4J6IA 4WI9A 2EECA 3HIZA 2DGAA 2HSIA 3ZFHA 1G9HA 2GUOB 2EDWA 4NNYA 1SN2A 2C9PA 3L9YA 2DICA 4KIEA 2NNAB 4NN5C 3MTXA 3SKJL 3WLOA 2KLTA 2FTWA 4GIEA 5BZAA 3VG9C 2NUTA 4HOWA 3W82A 1HNYA 4N5EC 5G5IA 2HZHA 3V75A 3ZR6A 2AMGA 3L1GA 2JKNA 2CIIB 1JR1A 4XP6L 1LP9E 4P2QE 1FA2A 8FABA 4BA0A 3DHFA 3IJQA 2AJUH 2G37A 1TJ0A 5JQHC 4NUGL 3OA5A 2XGBA 5EFFA 3UJ2A 4Z78B 5FYJH 1E4XL 1THAA 1J5OH 1N0LA 4XP6H 5AC5A 4LLMA 1DCLA 5CM1A 4AMAA 2BNQE 3TNNB 1YNTF 2GC4C 3L3GA 4QS6A 1O0VA 1QBBA 4MMYB 5EU6D 1KELH 1TZGH 4J3ZA 3BUQA 3IN2A 2YFNA 3LPFA 4JMXA 2NNFA 2XQBH 4N2DA 1OZTG 4BFJA 3VWKB 2P3YA 5D6CB 3MNZA 1T6WA 5DK3A 4OFPA 2DQ6A 4JFZL 2WJZA 4EX4A 3ALFA 4XK2A 3LYEA 5CLXA 4G80A 4Y19D 4Y4HD 3ZT7A 3MBFA 3LNDA 4DP5X 3T3PF 3WFHB 4KX8A 4TNFA 1DKWA 1EJUC 2H26B 2DWEA 4KKLC 4QLLA 1KB5B 4NQSB 4QYAA 1A4KB 3WUWG 3DX6A 5C6TL 3ULVL 1YTKA 3X1NA 4L6OA 1JK8A 1PCKA 2ZZ3A 4XD6A 5JBFA 3KRBA 3E6EA 5CZVL 3UAFA 5EN2A 4Z7AA 1L3NA 4OU1A 2NSOA 3HPLB 4C5ZA 1EJOL 4WTQA 3OP2A 3DMMD 3NTYA 2R23A 4YDLB 1A4LA 3MY9A 3KHQA 4XVDA 3A3YB 2A21A 1BDYA 4A6YA 1VGAA 3P62A 4Z7QF 1OP5H 1MFAL 2XKUA 3MBEB 1GS8A 1VERA 4M5YH 3ZMRA 4MMZB 4H41A 4M7TA 1X4YA 4ZMZA 5CLWA 1U92A 3WIFB 4ZI8A 3FQYA 4ZTOL 4LVOC 4XTIA 2FVKA 1QOQA 3ISWA 3AMLA 4PV8A 4N02A 1NDZA 5EZPA 3IWVA 3SDOA 1JTTA 3W07A 5IMOA 6ALDA 4NC0B 4S1SH 4BZ1A 3L0KA 4S0SD 1IT9H 4J8RB 4QHLB 1MLCB 3S5NA 4D0BB 3T1WA 2WMIA 1OD0A 2B08A 2C9XA 1DQDL 1U3HB 4HV8B 1JI2A 1X7TA 4X42A 3RI5K 5GRYA 2NQZA 1IBFA 4NM4H 2ZA2A 1IU1A 5CJNA 3Q44A 1PX4A 4HUUB 5I0ZA 4A7UA 4XPTH 1K8XA 4GRLD 2DQFA 1PEWA 1EX1A 5C9RA 1P0SE 2VAAA 4N2GA 3QEHA 2X4SB 1KJ3L 5J57B 4IX2A 4NT0A 5DT5A 4EPKA 5CBEA 4X63A 4GQZA 2Y22A 4D9LH 1SEQH 2E27L 1LTDA 4PWJA 4HKZA 3SPGA 3U25A 5GZNC 4A8NA 4UTAL 1KN2H 1CT5A 3HI6L 3LS4H 2YQBA 5F0LB 1QCWA 4MIMA 1THCA 2WLMA 1II4E 2V2TA 4JY6A 1RURL 3O0KA 5HATA 4A29A 1G1CA 4R7WA 3QEGH 3O3EA 1LT8A 4LRSA 3JXAA 3CFEA 1ZSXA 4AUYA 1WS7A 3KYMA 3M7SA 1OP3K 4S1QH 4X0NA 1EXUA 1YPZB 2UX7A 5EIIB 2P49B 2CWXA 2KZ1B 2F8IA 1ONQB 3ARGD 3MOAH 4LHUA 3RWFA 3CTLA 2PBOA 4TTUA 1RH8A 2R9HC 4JQXA 4RRPA 1KTDA 4X99B 1A6TB 3CQFA 4ADGA 3G6MA 4AB4A 2FX7L 3STEA 3QHTC 2EDOA 2I85A 2ICEC 4LU5L 4G7EA 5JW4R 2EDQA 2EIKB 3BSMA 2GI0A 1I9IH 4HS6A 4P2VA 5D2VA 5TF1L 2VFEA 1F8MA 3CZJA 4X8JA 3D39D 4BIKA 3JYBA 1FXQA 4ZZ9A 1XCFA 2RIKA 2WLLB 4TTDD 2PDLA 2QT3A 3JQOB 2OAAA 3PANA 1JK9B 3NZHH 3RWIB 2PCXA 3IE9A 2X9WA 1Q6OA 3MKGA 3CDZB 3LRSA 4F5CE 2Z1KA 1C5CL 3PUDA 3EOBB 1XF2A 3LBMA 3QZEA 1XSJA 2DQIL 4GRMB 1ZOXA 4M1DH 1BFTA 3N1MC 4XN5A 1ALDA 1J8RA 3QIUB 4GLRH 1K4CA 4TQTA 1UWXH 3QULB 4HIQA 2GVLA 3M5VA 3BPLB 5HDQL 5F6HJ 3OGCA 2IH3A 2DM3A 5F7MC 1UD8A 4LHQB 1IBYA 2QW5A 5A6LA 5IWLC 3T0CA 2OSYA 1UA6H 3STGA 3ONCA 5DXWA 1TQWA 4PI2A 1E9OA 3SCMD 2AGKA 1XLFA 4I2XA 1NF0A 2BERA 1XDTT 2ZG1A 3FQ4A 3QFJD 3GBNH 5ICYA 3MDUA 4NO2A 4HA4A 2EDLA 2CO7B 1WCBB 4TL4A 4ZJ9A 4N0CC 3ITOA 5IFHL 4HIEB 5HYFA 4AYDC 1TTCA 2J2ZA 4FF7A 1OTTC 2I5YL 3QEQB 1UG6A 5A95A 4KCTA 4P9MH 4U3XA 3L1EA 2E9IA 1A6UH 2UXFA 3AG4B 1ZV5A 1WBHA 1I8MA 2Y6ZA 5CBAA 5EOQH 3PAUA 1JFQL 1H6UA 1AO7E 5J0BA 1TPB1 3OKLB 3ELFA 4OJAA 4K7VA 5AB3A 2DQIH 4FCHA 5ABAA 1I4FB 2CRYA 2X0HA 1CF8L 4GIRA 5FV1L 4UWQB 1RQEA 2ARJQ 3R8BB 1FWRA 3W7CA 3M0HA 1CE6B 5KSBF 1SM3H 3TYBA 2QCGA 5BRZD 2EKJA 4EIUA 3I84A 4XO9A 4N2OA 4WU7B 5LNRA 1KXQE 5MEOA 4U2ZA 2R24A 1CR9L 3FT4A 3GW3A 4ES9A 2AGJH 2Y7QA 1CCWB 3UNDA 3B0VC 3SFKA 2BIQA 1HG3A 4N0UB 1BHGA 4HH9A 3S3PA 3O3BB 5I8CB 1E71M 1QRQA 4GAJL 5EZOL 1IQWH 1B3WA 1KENL 4XAWH 5FHBL 1E6ZA 4PJEB 3FXYA 2YDSA 1I4NA 4KWVA 3FEQA 5I1AB 2VH5L 4NCDA 3N1QC 5DMNA 5AB1A 3PWJB 4AH2A 2O6FA 3L5WB 4FG6D 1TTUA 2SFPA 3B9NA 2HVOA 2X8RA 1PUDA 2HNHA 3AMGA 3BL3A 3IPFA 3V0TA 1AS6A 4X6CB 1WF5A 3G5YA 5BS0E 4MWAC 2D7TL 1PU0A 2REQB 1ZNNA 5D1ZC 3IJ9A 1ECYA 1ECQA 3AIRA 1FAKT 1T1ZA 3FCSB 3RBGA 3E8UL 4M1CC 1ONEA 4WEBL 3QBUA 4QLWA 1CXFA 2OQYA 5DHYA 4HDIA 2QGDA 4Y2DB 2GGJA 3AUOA 2HJPA 2WXOA 5C09B 4GNKB 3T3MF 1A21A 3TFKD 3VIPA 2HTKD 4KDTA 2JH2A 3QDHA 2DW7A 5FA3A 1A0QH 4AMKL 3FFSA 1BJ1J 2QTVA 4DGYL 3O6LH 4M7SA 3MWCA 4WHBA 1MNUH 1ROWA 4E9XA 5E09A 4NFBA 2HMIC 2YD7A 1GOOA 4S1SL 1WC7A 3MI3A 2YQ3A 4RPPA 4JRXA 1AQFA 1DN0B 4IBQA 1L6SA 1TRIA 4P06A 5IJVA 3GXTA 2IMRA 4DTGL 1J0IA 3OB8A 4K3GA 5KTEL 1JS4A 4EXQA 4AY0A 5GNXA 1P5BA 2PGFA 1TVDA 1MKFA 5FJRA 3FCTA 2YXGA 5I6PA 4PB4A 3QUXD 2GITA 4NZDA 5EFIA 3F4WA 3PAJA 5KSAB 2BNRB 3CL7A 3UBPC 4E41D 5T33L 3AYTA 4JFYB 4N0FA 3V5FA 2OXNA 2P5NA 1NWUA 2AJSH 4L9LB 3F05A 2QMJA 1SHXA 4H0HB 2VIRB 1TJIL 3AY4C 3QZPA 4OD3L 4HHLA 4BKLA 2YLAA 4NNYB 4LCVA 1NEZG 4QRPB 1IEIA 4QYOB 3NIGB 1SJEA 2W07B 1PWMA 2WVSA 2BSTB 3PHOA 1C16A 4GO8A 5EU6E 2B14A 3U0TA 2P8PA 4NNPH 3AIQA 3KNBA 5FCZA 1KBPA 2L7EA 4MQ7A 1WPCA 3KPPA 4PRPD 5I6LA 3OF6A 3M1OA 5FUZL 4KBXA 2Q87A 4RSYA 5HYIA 3S3DB 1TZHB 3HI1A 1VHCA 2YOAA 3INUH 1ZGLB 3LKOA 3CUZA 2PTVA 4Q2ZB 3DTXA 2OW6A 3G3LA 4L48A 4EDXB 4Q4IA 4CGTA 1LUCB 2I7SA 4RJEA 2PCPB 3GNMH 3WN5B 4UCGA 2EDTA 5A6KA 3ZL4L 2ZPKH 2VZOA 1JZ6A 2JTDA 4IUGA 4XCCH 2BASA 1NOAA 3RNKA 4Z7NF 2GGGA 2BRQA 5EA9A 5EA0H 5DEFB 5J12C 4K8RD 4MVBC 2V5LA 5D6CA 4WCYL 5KAQG 1BZ7B 1MVFA 4L18A 3IVUA 3BXNA 3CE1A 3QG6A 2WNZA 3M43A 4LP5A 4YXKL 4B16A 1Y7VA 3UIYA 3FB5A 4B0MM 3UPMA 5E6ID 1NANH 2L7UA 5D2LB 1X8CA 5DJ6B 3UWYA 5DZOA 4E2VA 2P43B 3MLYH 2E47A 3L65A 4H7CA 1PF3A 1DJIA 2L04A 1NMBL 2B1AH 3BT2L 1Q6FA 3SGZA 3USZA 3GS4A 3DEQA 3ARGB 3OAYH 2JCWA 4HB7A 2GCYA 3MCMA 1ZXQA 4P3CL 2DQJL 2BINA 2Y0FA 3K7UA 4KVNL 3PGFH 4JTEA 2H7WA 5GJNA 3QO0B 1LD9A 4Y5YB 5B7MA 5J13C 3VNMA 3MBEA 1NANI 4JRYD 3WZ0E 4A04A 4BF9A 4F58H 1IARB 1MFVA 4R7DA 1ZEAH 5T3XH 1GTHA 3TC7A 1KRCC 4GOSA 4TUKH 3IU4L 4O28A 4BI6A 4NZ1A 4ODXA 2YAPA 4RW5A 2HLFD 1GC1L 2VZSA 3QGKC 3FTWA 2APVA 4NO0B 5D7HA 4JY4B 1UH3A 2WZMA 3TLQA 1NA8A 4R4FH 4OF0A 1ZBKA 3VZXA 1UC4A 4S1RH 5B7YA 2CXKA 3TN3A 1JJUA 1XJBA 4IJCA 5C3IA 3MRDA 5F72S 1UYWH 1UYQA 4GH1A 4HWBH 5IQMA 3K71B 5EF1A 1R2RA 1U3HD 3QIWB 4RCAA 1FLRL 4LCWB 4E5XG 4HJEA 5D70H 4Q4MA 2WZ0A 3PBYA 3GSRA 4GUPB 2PP0A 1F4WL 1SVZA 4UM8A 1N64H 5AOKA 1FP5A 2YPVH 3W1ZA 2YDRA 4H9TA 2XZCH 3FHAA 1NINA 2GGHA 4KRUA 3LERA 3V0VA 1X5ZA 1ZWIB 5GGVY 3CUHA 4L56A 3QXDB 2FR4A 3PHAA 5FF0A 1ZV9A 3AIBA 4LSTH 4C6MA 3N42F 1RUAL 2WWMC 2DI8A 2CR0A 4HS3A 3GU2A 3WLRA 5TDNA 4KUCF 4EI5C 1HXYA 3GC3A 1R4XA 4JGJA 1V02E 2OT1A 2DIKA 4D6JA 3G6JA 3TEXA 4WWPA 3EFDH 4B91A 5IZ7A 1OGPA 4OIBA 2FDMA 4UOZA 3TEYA 1UQZA 4XPBH 1ZT4B 2NUWA 5IROA 3WK0A 2ZOUA 4DBWA 1D7KA 5JHLH 2VDKL 3I6LE 3W0WA 4WGWB 2UZPA 2D69A 4Q8TA 4KKBC 1NCWH 1KULA 1CD9B 3TLRA 3SYOA 1F4AA 4B96A 1XHHA 4X4YA 2VXTH 2EVGA 1KKOA 2P8CA 4OW6A 1BVNT 3KGTA 4L8SB 5AALA 5IQ7H 1FQ9C 4ANWA 1J1OL 3SN1A 2FBRA 3N85L 1PO9A 1Y0LB 5FFLA 4LUSB 1TQBC 2EDHA 1XIGA 5CBJA 4P49A 4UC5A 4B9IA 2QIWA 4X80H 3QIUA 1B0WA 3WO8A 5IOBA 2N7SA 1L9QA 2NY4D 4AX6A 1O7DC 3PP4H 4J3WA 4Y16A 5FYJE 4EQ3A 1AW2A 1ZGLP 3FSZA 1MJ8H 1RZ8A 3ASNB 3CFUA 3IMTA 4FQXA 3S34L 2W9DH 3ZGIA 2TRYA 1YUKB 2BIPA 1RZFL 3NJVA 3PWUA 4IK7A 5FLVA 3MCLH 4BSVB 1T99A 3MLXL 3QISA 3WUWA 1QRKA 3SCTA 4QRUA 3DI3B 3UOAB 2R2CA 1BSLA 4Q4SA 1HEHC 3U2ZA 1GW9A 2X2YA 5CZ0A 4ODWB 1KGWA 1SFTA 2PDFA 4QRBA 1M9WA 3EJTA 4MDRA 3SUUA 4NGHL 4M7KH 1S78D 3SE3A 4PLNC 3SY5A 1LWJA 2VR4A 4GKSA 5FA4B 3DENA 1QQDB 3MPGA 5FJIA 5KMYA 4Q8PA 5G4WA 3S36L 1H51A 5KJRH 1TVNA 4B2DD 5F3FA 2OMUA 5D7EA 2YUVA 3Q5OA 5HI4D 1Q6RA 4J5VA 4JY9A 1HJSA 4BZYA 3R79A 3UWWA 3W02A 1M2VB 4GZJA 3T1FA 5TQ2L 4DW2H 4CEXC 4OZHA 3X1FA 4Q7DA 3MGTB 4RDQF 4UTJA 4AHOA 4NL1A 1DBBL 4ELME 2OGJA 3DZ1A 1KW1A 5TD4A 4K23H 2XYCA 3MRMB 1Q6QA 2X4UB 2BP8A 3RGBA 4L61A 5D6DA 3S4SA 4O0KA 4PWHA 1HE7A 3NJIA 4FNTA 3FJLA 1JWSB 5BVJA 3IS4A 2X1PA 1EQPA 4Y5VA 3U83A 5HYJA 5DHVH 2WXGA 3FQUB 3PFUA 4G3YH 5AYTA 1T7LA 2W9MA 3NZQA 3VQLA 1OM3L 4J9JA 4AH7A 1KCRL 1RR2A 3ARDB 3M64A 5G2WA 4LLWA 4Q8VA 3VDHA 3FU8A 3PGCB 5D1XD 2NPLX 5DHDA 3TVMB 2NY6D 1P0BA 4F40A 3B2XA 4KRNA 3FT2B 4NP9A 2ADJA 2MJWA 4YDIL 2L7QA 4M62H 2YGPA 3GBLA 4G11A 1YEEH 4X9HA 3RPIB 2WBJD 1M7DA 1F3WA 4L8BB 1H7PA 3MMEA 4NQDE 1WFUA 4Z7WB 3EX3A 3ZQ9A 4S2SB 4DWSA 2WLIB 4GNVA 4ACZB 3PWJA 2NW2B 2VERA 1TV2A 1CD1A 3BI9X 3DRTB 2I9TA 1W1B1 1B4JL 2A6JA 1COBA 2F0CA 4KRPB 4D9RD 5T1DL 3I9IA 5AW2B 1IO4C 5HHME 5I1DA 1TWZA 1F13A 3KDOA 3M8OL 1A7OH 3IWUA 1D5ZB 3MRJB 1WUFA 2H1LM 5IGXH 1QUMA 3OB0K 2NYKA 1S7RA 4PD4J 1BGGA 2QSTA 3HPJA 4HUXA 4IIHA 1OT4A 2CG9X 3GIYA 4Y5XB 1UB5A 1F3RB 3ETSA 2G9KA 3MRFB 3Q2LA 3VC6A 1AS7A 4UTLA 5KW9L 4Y9OA 2BOBB 5CSZB 3SKUD 3CMFA 3LBCA 1P4IL 4MJIB 5E6YA 4GFTB 3ZIMA 4C5YA 2DZUA 1ZT7B 4JQ2A 2F54D 4JO3L 4LUJA 3S48A 4CNSA 1FKXA 4JRFA 1J9CT 4JDZA 1EMTL 5EOTA 5JORB 3OU8A 4UMSA 3IE4A 2GSEA 5BMFH 5CEXB 1HCYA 1HHJB 1A5OC 3GU9A 3T77B 4REQB 1GGCH 1UD3A 3H3PH 4KVPA 5F0PB 4BZ1H 2AJVL 4GRWF 4CAGA 4QMEA 2ZZ4A 1O7VA 5GZOA 3SKNB 4HU4A 3PWLB 4O14A 2DQUL 5JW3H 3VFSB 3GTXA 3V0EA 4O2FB 3WLKX 3MMUA 1LT7A 4O10A 2G9HB 4Y19E 3DX9A 4E9WA 4FXGB 2Z1VA 1G7JA 3F2CA 3D2UB 4QTHB 4ZPVB 2ISWA 2E7BA 4JYEA 2GFBB 3LQAC 4FQPA 4XCYB 5JW5B 3S8FB 3X3FL 5IFJA 1EP1A 5E5MA 3FSUA 3LQLA 2X0VA 3ML8A 5ENWB 5H2BB 1ZCRA 3VGBA 1VFSA 4QWWD 1NUGA 2FUTA 1U3NA 1BPLB 3DKHA 3SRDA 3QO1B 3W84A 1OLZA 5K4XA 4MA7H 4YQXL 3B9EA 3WSQL 5B38B 4FDWA 2DD8L 1GXEA 1OJXA 1YEDA 3BT0A 2B0MA 5AYIA 1S2CA 2O4QA 5HK4A 2YARA 3LXCA 2DJLA 1QI4A 3CGTA 4HHHA 4C56D 3KLKA 3WFCL 1H5BB 4QDPA 2XIIA 2Z31B 2G97A 4CNNA 5FYLE 2ZRZA 5INCA 3BZ4A 2GUBA 3Q65A 4GA8A 4G72B 4I4WA 3I02A 1E4MM 1S5WA 1G0CA 1TG7A 2PCQA 4U1MA 3EO9L 1EVTC 2NYYD 2VELA 2EINB 1PIIA 4GS7B 1CO1A 5J12B 3V4BA 4GS7C 3G6DL 3CJPA 3L4VA 3EMCA 1YYMH 2ENJA 4OT1H 3EWDA 2WW8A 4U6XB 1HI6B 3JWDH 1FBAA 2WGNB 1I7RA 1V7ML 1GSKA 2AP2A 2W95A 4H6EA 5HWMA 1QSFB 2R39A 4IPLA 4WDTA 3PDDA 3IPWA 3QMRA 5DVNA 5DEFA 1GKPA 1NFAA 2O6CA 3E80A 3MTRA 1MI5E 4EAYA 3NJMA 3A64A 3DX0A 3KW8A 1FL6A 2A74B 3T6ZA 2DRUA 1JWUA 3ZT5A 2LT9A 1KCUL 1IFGA 4EN3D 2WXQA 2O92A 1D5XA 1OCQA 2PRLA 3HQNA 3NEHA 3WJLA 1KCWA 2F8OA 2J1KA 4HAKA 4UOW0 4LIQH 5I79A 4IDLA 2C1OB 3BURA 3UPRA 1SDDA 3TYEA 4MS8C 2OX4A 1A25A 1X8FA 4JM2A 1C5BL 3LTVA 3NEXA 3OZ9H 2DW5A 1UWQA 3QLDA 3U5UA 1I1CA 5EC1B 2NX3A 4QE1A 3AXHA 3ZIZA 3BSZL 2Y1ZA 3F7YB 2V2WA 4K8EA 3UX9B 3NFNB 3VX1A 3PL6D 4JN1L 4ICCX 2IALB 3BVUA 1LO5A 1H3TA 4PJ5B 5HJDA 3T08A 4CVUA 5HHQB 4OOUA 1Q3NA 5KSAC 2DW6A 1QPPA 1E6JH 1U8PB 4O57A 1JPFA 4AD5A 5EUKB 1QABA 3H54A 1S2UA 4RAVA 2VITB 4NRXA 3THMH 2DH3A 2ZUVA 4QRAA 3N2BA 3GG0A 3GG1A 4WWKA 4AVNA 1F45A 4F57L 3SGGA 5JW4Q 1HC1A 3HGJA 1SPQA 5AVRB 1OCRB 1KM2A 4AM0Q 4JY4A 2Z2BA 1WB0A 1EFXD 1V0LA 1OD9A 1NFDE 5G2NA 1CNVA 2I60H 3RVXC 5JQ6H 2FYMA 1SHMA 3KW7A 3MRDB 3BISA 1I8IA 3L48A 1K03A 1HS6A 3C2AL 2H8ZA 3CN4A 2YKLL 3DK2A 5ADOH 1UA7A 2AI0L 2BP0B 2WZPD 4GUPA 3T04D 4WZHA 4JZOB 1R1CA 2F53E 2DTSA 3PWNA 2XLLA 4RESB 4F48A 3AREA 3B7YA 1P0DA 2Z93B 4DPAX 4Y1AE 2MUCA 3PZTA 4O16A 1KY7A 1E28B 4ERSH 1HCVA 1IBHA 3BLBA 4Z95H 5DQJA 1GZGA 3WBAA 1QTPA 2KZWA 5DJAB 4QHMA 4JDTH 4MASA 2OMVA 1BFOA 5D2LF 1BQLL 4X8GA 4L9XA 1IGMH 3VUSA 1JPTL 3C6LC 1ODUA 1ZAJA 5TDNB 4OCYH 2D2HA 1IQDB 4XWOC 1CECA 3BFOA 5KOMC 5F7BA 4E9SA 4NN7C 4IIFA 1GZHA 2DQCL 5T9CE 1PLCA 3SBFA 1J9YA 3L3OC 1D9KC 3X2QB 1XD1A 4X8CA 4IPNB 2J4GA 2DIEA 2PZNA 3RUBL 1J6PA 4PTVA 3V0JA 3TJ4A 4UTWA 3T8XB 3U2JA 3BOFA 2QGCA 3S34H 4NN6B 5IVXF 3QW4B 7CGTA 1T7VA 4L29B 3BZJA 1HXJA 3TIEB 2FEDD 2C8NA 1BW8A 1XYAA 3SO3B 3NL6A 4YDKH 3FK4A 2OMNA 4LKCA 2AEPH 4XMLL 3PDOA 4NQED 3QXAA 1CVRA 3IJYA 3T2PA 1OC6A 2INFA 3ARFC 2C19A 4NRZB 4H2CA 5E4EB 2O5XL 2CIPA 4JTFA 1Y0LA 5I6SA 3MRCA 1DBJL 1YNLH 4NAFA 3ZLHA 5FB8A 2FT8A 3O9WD 4L4JA 2O5XH 4TNGA 1SGKA 3U0PA 3BSHA 1M3UA 1MCHA 3C6LB 1F4YL 1MRQA 2AXJA 1YEHH 3DX1A 3LENA 2OSLB 2ZXBA 3EYFA 1UZGA 2X28A 1KCKA 2W9LA 4XAKE 1RZ7L 5CINH 1N18A 3VXRB 2C71A 4M6UA 3HS0B 1AH0A 2FZ8A 3Q9PA 3FO9A 1DL3A 4LFHG 4WR3A 2OJZH 5FCUL 5LDUA 4DI8A 2HXTA 2VM4A 5BS0D 4OUUA 4WUUD 5DD3L 2VN6A 4NKDB 1AMXA 2WLZA 5DLML 2Q6WA 1CGTA 2R1LA 3LUTA 1QI2A 3LYRA 1UCWA 1HIMH 3FU5A 2YA1A 1J9RA 3GIZL 2CLRB 3OD3A 1QQDA 5AEAA 5KYWB 3O6YX 4HHWA 4QEEA 1SW7A 1GRWA 2J66A 3TCEA 3TT1H 2FATH 4QO1B 4BFFA 1ISZA 3DFHA 1H09A 2YDQA 3GSUA 1OAQH 3LXUX 4PTUB 3UQNA 4Z3HA 2NWSA 1Y8BA 3CXFA 5IG7B 1N64L 4O1DA 3S47A 5EFDA 5M5DA 4QOKB 1W5QA 2RCSH 5LBGA 2QCDA 3T09A 4JPGA 3V7PA 4WI0A 3HUJF 4OLUH 5FO8A 1QW8A 1FLRH 1KGCE 3KL3A 4D6GA 2PDYA 3QZWG 3PJUA 3VFPA 3DV6B 4JFPB 2WSRA 4JTAA 4ZO6A 5FV2A 5GS3A 4WUIA 3S46A 3WGVB 3CB3A 1EJ8A 2MCG1 4E9QA 2QDHA 2W27A 4XOCA 1VHPA 2X4RB 3ECWA 2YKLH 3DV4A 1CDUA 4UDUB 1T40A 1Z41A 2R1WA 4K6AA 1V3MA 4R8WH 1Z5LB 3NCWA 1HL5A 1EZUA 2OMWB 4X5PA 5D7KD 3HAEA 2A3LA 4CQ8A 5LIYX 3TS8A 4YHPB 2WP3T 2H9AB 1S7TA 3B5GA 1QPOA 5G4EA 2F68X 4UNIA 5J11B 1GORA 3LH9A 3P0WA 4L1WA 2FDBP 4WGKA 4XPFL 4Q33A 4KO5A 4R0LC 4HK7A 2ADJB 3NGFA 4DPQA 1Q4NX 3WFDH 4B3ZA 2VYRE 3AJ7A 2X4PA 1E9QA 3SKMB 2ICEB 3MLWL 5ETUB 3QY6A 3UCCA 2V5RA 1X9LA 3PWPE 4PRHB 3RFZA 4MJ5A 1QOPA 3LCXA 5GSRB 4J40A 3HZ3A 2TYSA 2F6UA 3GMOA 4ACZA 1TPDA 2FZDA 1TITA 5AFAA 3L54A 5DMLA 3AM8A 2VR2A 4MWFB 4RZCB 4W9LC 4HA0A 5CHNB 3ARBB 4LDOB 1MLBB 3FTZA 2GB2A 2X53A 1NCDH 4A7TA 2ISSA 3MNVA 1NDWA 3HO8A 5JXQA 5EZLB 3OZ9L 3EH3B 3HPJB 4FXSA 3X11B 2Y36H 3FQNA 1QNZL 3L2NA 4P48A 3RPMA 4GYBA 4YXKH 2AXFB 4ZOAA 1DWAM 3U2CA 1SGJA 3S5LB 4N28A 4DPPA 1WDWA 1NCDL 2CKBL 2GGIA 4CQ9A 4B50A 2EE0A 1Z7JA 2FHFA 2Z91A 2MNRA 4XX6A 1J1PL 1VBJA 3U7YL 5I71B 1P2CB 2COQA 4JPQA 1A5LC 2Q3XA 3I6LD 1EBHA 2Y24A 3MO4A 2O93L 1VFBA 2VLJB 4WO4B 5CEXA 2BOCA 1UTDA 3SM0A 4H0IA 2ZP8A 5DUBA 4RIRB 1EJSC 4H20L 1AAJA 5BUGA 3GSNA 4QXIA 5AC6A 2UYLA 5IR1B 4PGBB 4L4TB 1YYML 4TV6A 3PL6C 3QUYB 3PWLA 4PMDA 4XPFH 3VI4E 3WIIH 4AIBA 2WQPA 2W0FB 3P69A 4QCIB 4F7TB 4MJZA 1VADA 3ME3A 4R4NC 3P1VA 4FAAB 4HUCA 4N9BA 4GO9A 1DVQA 5H6HA 1HH6A 3CFKA 3EJRA 3V7AE 4F93B 5BQ7A 2HVMA 1BQHB 1CLOH 5E5MB 1NGPH 3L7FA 3UYRH 4Z2KA 3FH8A 3GNPA 4IRJB 3MJ8A 4U1NB 2DIJA 4AZCA 2YC1A 3L4XA 5CCJA 3U8GA 5D2WA 4BFKA 5ITFB 2Z4GA 3B9KC 2Q2LA 1B88A 4XE0A 1J7VR 3WDHA 4K37A 4KRLB 3DOSB 1AD1A 1SHSA 4RFEB 2X4OB 2IV9A 3DMMA 4GPNA 4F7EA 4PCNA 4NHCL 1F9CA 3LPOA 2MOQA 5DWUH 1S4IA 3RJQB 4O53A 4AEOA 3SJVA 5C7ZA 1WO2A 4ZTXA 4DETA 2NY3B 4K5LA 2XWTA 5IVZA 4M00A 2XN2A 3AREC 4KKPA 3WNKA 1US0A 3SUSA 1DE4A 5JDSA 3MJMA 4S3CA 1A3XA 2QUVA 4I1RA 3GIZH 3TH3T 1BF5A 2IPFA 3GUFA 4HJSA 2X2JA 1NLDH 3RTLA 1MG3C 1R5IB 3FB6B 3VFNB 5DFVD 2ZX7A 3RCMA 4DGWC 2IMNA 1I7RB 5AZ0A 4O02H 1GGCL 3QRLA 3RAOA 4LL1A 4FULA 4R84A 2XPZA 1WZMA 5GIRA 1PHQA 4XT1C 4YEFA 3GSVB 5I17A 3UTZA 5CINL 3F4CA 4HBKA 3QPXH 1S7VB 4KNQA 2OKOA 1G7IA 1KGUA 2H32A 3T7VA 3GC5A 1GOQA 2BVQA 4RE4A 3MV9D 1FWFC 2RDWA 5H8MA 1A6ZB 2JEPA 4HPYL 1EUNA 3HKZA 2IH1B 4EIVA 1EWDA 1YC7A 3W2DH 4IBUA 1XUZA 3CSTA 2H9GA 2GFTA 3OKEA 5I6OA 2HT2C 1UR9A 1QPRA 4H4IA 4WOZA 2PYFB 4YDKL 1E5AA 1XSKA 1LO5B 5DANA 4F2BA 4JFXB 3WHE1 3EDKA 3L3HA 1R75A 4H2HA 1IQWL 3GAYA 5B21A 1CDYA 1F42A 2V4LA 3D52A 3O6KH 4R7XA 5CS7A 3UTTA 2WO2B 5D4JA 5IHZA 2CLVA 3BQUB 5IMKB 3PS7A 3LLFA 2FWSA 4LAKA 4XHJD 2E40A 2V17L 3DHMA 2P0OA 1XEUA 2R9RA 2WJ7A 3D85D 4JG9A 1SR9A 3SCSA 4W9KC 4M62L 3SPIA 3UXKA 3IXAB 4IMLB 4ELKB 5E7BA 3ZQWA 3JTBA 1NQBA 4K55A 4XV0A 3WIHH 4EF8A 4GBUA 2UZ9A 5C0JA 2NUYA 2QKIA 3CIWA 2X70B 1A4JB 1CURA 2GY5A 3SDAB 4IIQC 5KBKA 1U8IA 3N91A 1NOLA 3U4KA 2PWFA 4XC1L 3PV6A 1GCFA 4EI5D 1SJBA 1KBBA 4C59B 1NCUA 3RIAF 1MZYA 2XWBA 3HNTH 5BVPL 4YFLI 3NIFF 5JPMA 1YEFL 2B39A 3ZE0B 3BUPA 2PWUA 1R34A 4LVHC 4MRCA 3SQOH 2UWEF 4PW9A 3MCG1 2J1YA 5A6IA 4NENB 5GZOC 1JCMP 5EU3A 3WE6A 2OW7A 3PHQA 4Q58C 2FBOJ 2UY6B 4FKEA 3BRGC 4JHAL 3TVMD 2POZA 3CBWA 5CIPB 1VF8A 3XINA 4OFYA 2EXYD 1L6XA 4HLZH 1YJDH 4PJFF 5DURD 2EXSA 1V6VA 2Y1HA 4JTDA 1KLGB 4WUUA 1W8EA 3G1XA 1WFNA 2R6OA 2JJSC 4N8CH 1VCVA 4JTJA 4PL1A 2K8QA 1PKOA 1OCWL 3MUHL 1JMZA 4G9DB 5G4NA 3T4YB 2NVDA 2CLZA 4HA1A 1O7AA 1EZLA 4JZ5A 4F66A 3QZOA 2VDML 4KK8D 2CPUA 4AQ8C 2HK1A 1Q1JL 3VH8G 5DVPA 2E6AA 2ZUQC 1OE3A 2ZONA 3Q7JA 4PW3A 3I10A 3IJLA 1OCBA 1GMIA 3W11D 2PR4H 3KPRE 3R0DA 4PL2A 1KC5H 1X5MA 3RL1B 3GXPA 2YPIA 1RK5A 3WTUA 1G7HA 4JN1H 3GNNA 4KY2A 2YAQA 4RMTA 5I1EH 2RD0A 3BSZH 5DGQA 3GBML 5DC9B 1ODZA 2XX0A 4WDIB 4PR4A 1XISA 1IAIH 1XT5A 2Y89A 4C56A 2EH8H 4APXA 1KM1A 2PDQA 3UPBA 4EKXA 3DYMA 3HS9A 1W1IE 4QXGL 3LDBB 3OBKA 4MJ4A 1H3VA 3FN3A 3VXTA 3PRZA 4WKFA 3OC8A 1TE6A 4CCDA 3W53A 1A49A 3VKBA 3RZCB 4Y8DC 3IK2A 2AV7B 1I3VA 1OIFA 1WA3A 3EFFB 1GHRA 4LU5H 3OIHA 4XZUB 1YUHA 4HIIA 4AL8L 1W0WB 3MSDA 2FAUA 5E2JA 5DD0H 3PC0A 3E6FA 4H88L 3SDAD 4NCC2 5K1VA 2VDGA 4FG0A 1T96A 2OZ4H 3GMQA 4M6MH 2J5LB 3N3EA 5ICUA 2HG5A 1B4LA 2Q9OA 1GW6A 2G50A 2BC4A 1UR1A 3KM8A 3MODH 5J3HD 5D7LB 1G01A 4JIHA 5T1KD 3WNMA 1ZE3H 3QDMA 1HCZA 3EO9H 1NWTA 4AWJC 4TPRL 3M41A 3Q43A 4NYLA 5K33A 1OBAA 2ZA1A 5IFPA 3GMRB 5EMJA 4ZUWB 2X6VA 3BDKA 4NY2A 4PGEB 4AFYA 5TE6H 5IHRA 2J12B 5I3GA 1KN2L 2CKBB 3SCMA 1ZGDA 4PCKA 3KBWA 4H1LB 1XI3A 3JWNG 1OK6A 1OGBA 2GEEA 5GGUA 3SY6A 2CJSA 4Z7UB 3TIDA 1UM6L 3U2SA 1SW0A 2CFFA 2WZIA 4NI8A 3FPYA 2YPVL 2XA8H 4G6AD 2NUTB 3SZ6A 3NRPA 1OW0C 2ATKA 4TNWF 2GBAA 4U1IB 3DV6A 4JFPA 4ONHB 4XPTL 4Q89A 3UYCA 3PWPA 4D6HA 4KDWA 4DXXA 2ESVA 1BA9A 1E0TA 1C5DA 3T4AC 2V6AA 1GY2A 4P23C 4WI7A 1DJGA 3RL2B 5IFAH 4S0TD 4V1DD 1PKQB 4Z5RA 3PABA 4NQCB 3RA7H 3VI3E 4DEPB 4ZFOB 3MMTA 4IXHA 3NDOA 4KESA 5GGSA 5AC4A 2XN0A 4WI3A 1N9PA 3BO8B 1OIOA 1DYZA 1F41A 4J2PA 4POUB 5JW3L 1YDPB 3ARGC 4N2CA 3EOLA 1ADWA 3AS1A 4DEUA 1WZKA 3N41B 3BLFA 3A6BL 4XMPH 2VZ1A 2QCHA 4MKNA 1MFAH 1MHEA 3UWVA 3H6AA 5AHLA 4GYPA 3LZNA 4B5TA 2DDXA 4H7VA 3HFMH 2JF6A 5K9KB 3GMOB 5E2VL 3HKFA 3LG3A 5KETA 4LSPL 1TIWA 1UJ3C 4LPXA 5D7IF 2ATPA 3R18A 1KM0A 2XZAL 3FPXA 3LS5H 4PJFA 1T83A 4AVFA 2OP4H 3ES6A 2EDXA 4GRLA 1NCJA 2E6JA 2VTFA 1MCLA 5C08D 1HDMB 1S6NA 4GI8A 2CBMA 5E8EB 3C2FA 4NNBA 1I2PA 1S2VA 2X3BA 3GDLA 1KDJA 1SDAB 3MSYA 5D4HA 1QLRA 4KFZC 4HPOL 2V5JA 3TVAA 1L6ZA 1PX8A 4JK0D 4CQBA 2FJGB 4FQHA 4PU2A 5KSBA 5RUBA 3S8HA 4M7ZC 1G1OA 1H0DB 3UAEA 4C6BA 2QR0B 4FJYA 4K5MA 3WMQA 2Z91B 3HMJG 1L6FA 4BQCA 4AVOA 4DQAA 2WXHA 3HN5A 1SXZA 5E9DD 3IWPA 2APFA 2XWJA 5D5ME 4P2RE 3GUWA 4HMCA 4WCYH 1LP9F 3T0EE 3E0WA 5C7XL 5F7DA 3H2OA 5C0CD 1JV2A 3ZRSA 1EPFA 1HUVA 3IFOB 1JG9A 4P46C 3P61A 1E4XH 1IC4H 4B9FA 1XLLA 4F8QA 4N85A 4JTGA 4BI7A 1OADA 2GK1A 3ARDD 3LGGA 4PGBA 2HEJA 5EKYA 1TTGA 3LZFL 1XBRA 3GSQB 3U9UB 4CBPA 1NSJA 1WIOA 2W0FA 4KY1L 5AUMA 5CJXA 4UBDD 2BBFA 2RAGA 2XPKA 3E2VA 3THDA 1WK0A 2BVOB 2PXYB 4NWTL 4YDLC 3AUWB 1C29A 2PTZA 4L8DB 4E9RA 4W4QA 4LLVA 5HHPA 4KKCD 1BQHA 1XH2A 4JZJB 1LO0H 3K91A