2XIIA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with an extended 9-fluorenone iminosugar inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 157
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xiiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xiiA01
3CZKA 1ZS2A 2BHZA 4OJYA 3DYMA 2F8QA 3ZQ9A 4H8UA 4OUEA 3PZMA 1HXKA 3WIJA 2PWHA 1V0LA 4F8XA 2WBKA 5E6ZA 1W3LA 3WUGA 1LWJA 3S2CA 1NWUA 5AYIA 3S6TA 3WDJA 3VD3A 1JNEA 3WFLA 3EJQA 1H3GA 3M6DA 1ITCA 1KGXA 5A94A 1T0OA 3ARTA 3W53A 1H49A 4CD5A 3WQ8A 1OGBA 2XVPA 1K6AA 4HZ8A 1CZ1A 3ARQA 1A47A 1G94A 1EXPA 2QPSA 4B9YA 4KH2A 3D51A 1V08A 2J77A 3K8MA 1V3LA 2WZIA 3ZOAA 4B3KA 4OOZA 1TCMA 2ZWZA 4OKDA 1TUXA 3K8LA 1AVAA 1JFHA 4P7NA 2JF6A 3BCFA 3PZVA 1E56A 3VPLA 1AMYA 1GPFA 4PTMA 2VZVA 4J3SA 5JIWA 4TX8A 1JXKA 1KB3A 1HWWA 4HOZA 1Y7VA 4M56A 3VDAA 4MDOA 5IXEA 2DDXA 5BXPA 2XGIA 1AQ0A 3K8KA 2C8NA 3VSTA 1ZBKA 4U3AA 5A8OA 4EAMA 1B0IA 1UH4A 1LJYA 4AZCA 1L0PA 3VGBA 3K1DA 3EJTA 1TVNA 4D6CA 1EH9A 5A8NA 1UWQA 1Q6DA 4LGXA 1RPKA 4HMDA 3LX9A 1QNRA 4OGZA 5A6BD 1OGGA 4FNTA 5A6MA 4ZE5A 3WMBA 1B90A 3AS3A 1CXEA 2WKGA 1UQZA 2DT1A 3AIWA 3WEZA 2EAEA 4A3YA 4GO9A 3PZNA 5A3HA 1UWTA 4S3KA 2WK2A 5EFDA 3VDBA 5I3DA 3CZGA 2E8ZA 1KWKA 1WDSA 3SURA 3CC1A 1B9ZA 3VIMA 3WD3A 3K4AA 1HTYA 3NSXA 1CGYA 3FAWA 3AIQA 2ALWA 5IHRA 1KBKA 3M07A 5CQ1A 2VZUA 2GJPA 1QWUA 3CUFA 2X2IA 3OB8A 2QF8A 3U7BA 1J0IA 3TTSA 4P7OA 1OINA 4DO6A 2QLYA 3KL0A 3SUTA 3WH5A 2YFOA 4J3UA 4UOJA 1AQHA 4OBSA 1MQRA 5A6BA 1WNOA 1B3XA 1W1YA 1F4AA 5CLWA 4MB5A 3N12A 2EABA 3DYOA 3DECA 1HL9A 2EEXA 3SCNA 4HOWA 2J7CA 5D9OA 1CIUA 1MWOA 2WZEA 4PTXA 1A3HA 1WKYA 3POHA 3PZOA 3WD1A 3D52A 1VFUA 1VEMA 1JGIA 3WEMA 5BXTA 3ARSA 1JDAA 3BC9A 2OW6A 4NF7A 3ZMRA 3WY2A 3SCRA 4GIAA 5I5RA 1ISVA 2DSKA 3A4WA 2VUYA 2EQDA 2IXUA 2MANA 3WFZA 2F61A 3HG4A 1JL8A 4URIA 1GQLA 1QNSA 1GONA 2G41A 4CU8A 1ZJBA 2NSXA 2VQUA 3VGGA 4H41A 3NSNA 1V03A 2EADA 2J7HA 3GH7A 1R8LA 1UR1A 1BQCA 4MB1A 4DO5A 3F5JA 4QFUA 3A23A 4GZIA 1E71M 3HN3A 3SEPA 1MXGA 2OYKA 4PN2A 2V5CA 1XRVA 3DYPA 3MUAA 5D9NA 2B31A 4QP0A 2VVNA 2J74A 3RILA 5JIPA 2AOSA 3B9EA 4PMXA 3EJSA 1DHKA 1EO5A 2YA2A 1E6SM 2QPUA 4IM4A 2OYLA 1JZ3A 3T0DA 5A6AA 2VTFA 3RCNA 4HA3A 2F18A 2XWDA 1WPCA 1JXJA 3J7HA 1VBUA 2AAAA 2XVNA 3AFBA 2WANA 1ODUA 3AHZA 1J0KA 3VIHA 5EMYA 1KTCA 4JL2A 2WSPA 3KL3A 3LRLA 3NDYA 3RDKA 3WNLA 1DEDA 1CEOA 2VJXA 2J8GA 1J9YA 2WMKA 1UA7A 4ZXOA 1G5AA 1H09A 1Q6FA 1BYCA 2W92A 3CV5A 4WK9A 5I79A 5JBDA 1TR1A 5CPTA 2YLAA 2WKLA 2W4XA 1TQVA 3DHUA 5FIPA 5I24A 1CBGA 3BUPA 2XVKA 3BUQA 3SUVA 3UEQA 1H2JA 3PN8A 1ZBVA 1JF5A 3FAXA 1JD7A 1EIBA 2XGBA 3NDZA 1HJQA 1XHGA 2X1IA 1UKTA 4FLRA 4L4OA 5DMYA 1QNQA 5FL0A 3BMVA 3LPPA 4MAZA 2DPEA 1QWNA 1W9PA 4JZ5A 4AISA 4GPNA 4PSPA 2V3FA 2XM1A 2ZUWA 3WNKA 1PPIA 4OIFA 2FGZA 4AEFA 2OWCA 3N9KA 5FKYA 5AC4A 2OYMA 2J7GA 4D1IA 1W3HA 4X0NA 4MDPA 1RD6A 1UH2A 1I75A 4UFHA 4DM1A 4J3XA 4CD8A 2CITA 3RIKA 2PWFA 3EMZA 3GZAA 1E3ZA 3A47A 2BXYA 1UR2A 2FDMA 1U30A 1V6YA 2XTKA 2EO7A 2D1ZA 1CXFA 4Q7NA 3VX0A 3MKKA 3LPGA 4JIEA 4ZXLA 4QLLA 4L4PA 3L4ZA 3A6OA 5CSUA 1XSJA 4HPHA 3D50A 2YDSA 1FHDA 1DWAM 2JALA 3THCA 5DF0A 2ZUMA 3EMCA 2Y4SA 3OGVA 3WNMA 3N15A 1JZ2A 1TQUA 3MUY1 3WF2A 4MADA 1V0KA 3AICA 2XHYA 5BYWA 1ZB5A 1VENA 3TONA 1HX0A 1WCGA 3WH9A 2TAAA 1IZKA 1CXIA 4U5KA 3MUZ1 1OD0A 1HJXA 1OD8A 4UFIA 1C8YA 2GVYA 3KWXA 4B3LA 3WY1A 1DWIM 3WH8A 4CUCA 5CLTA 2WYSA 2EPOA 4H8HA 1R85A 1UG6A 1KBBA 4AW7A 5HNNA 3WEOA 1PZ3A 3WF1A 5HOSA 3WBEA 1QBAA 3RM4A 1TFVA 2V3EA 4DO4A 4PUEA 4LYRA 5ABGA 4JFVA 2CNCA 3VVGA 3I3DA 4U31A 2DIEA 1UKPA 3MU7A 2F1AA 1R87A 4PCSA 2J75A 1JAEA 4JCLA 4BQ4A 1OB0A 4GZEA 3VMOA 4W7UA 1OIMA 1US2A 4GO8A 4W93A 3ZT7A 2IGTA 1HP5A 4YN5A 1JNDA 2VNCA 1MW2A 1HKIA 6CGTA 4Z2KA 1XCXA 3KL5A 1M53A 3BMWA 3ECQA 1GOQA 2WCAA 1MQQA 3OLDA 3FNDA 3AXIA 3AQUA 3RJYA 2BHYA 1GQJA 4MAVA 1BF2A 5E0FA 3VO0A 1O6IA 2DT2A 2QV4A 1LWHA 1XCWA 1RP8A 3VD7A 2ZUVA 3ZJKA 1B30A 4AZ6A 2YOCA 1DWFM 1E9LA 2W5FA 3GBDA 2DH2A 9CGTA 1M03A 1JDDA 4FNQA 3VSUA 1UWSA 5C71A 3W24A 4DM2A 5A8MA 3THDA 1E6NA 1UKOA 2VZTA 4U3CA 4IUGA 2VRQA 4HOXA 1JYNA 1EO7A 3BAYA 1XSKA 2BVYA 4UQCA 1AQMA 3VGEA 1E6QM 2O9RA 5HPOA 4M82A 3NCOA 1CECA 1TA3B 3W0KA 3TTYA 1UHVA 3BVTA 1WDPA 2W63A 1D2KA 1PX8A 3HZ3A 3AIRA 4ATDA 1QI0A 3AMKA 3IJ7A 4LYQA 1UZ4A 3MUIA 2E9BA 4NZCA 1JYVA 3WY3A 1WP6A 4KGJA 1UASA 4PCTA 3FW6A 4GQQA 5D8WA 2D2OA 4KMQA 3BLBA 3L4XA 2YL5A 4MB3A 3SUSA 4CVUA 1H0IA 2D22A 3CHCA 4J3VA 4IISA 1GOMA 2VCBA 3F5KA 3ZSSA 4J3WA 1J11A 1E5JA 2FE0A 1TE1A 2YKKA 3WNPA 2DSWA 4HMEA 3KE0A 1G01A 3LXCA 4KRUA 1JF6A 3AZSA 1XH1A 3BXWA 2DT3A 1VF8A 1CXHA 4HA1A 1W91A 3GTNA 1V3KA 4ATLA 1PAMA 4XX6A 3GM8A 3W26A 1F4HA 4NI3A 4RE4A 4JL1A 4H2CA 4OBRA 4BQ2A 2BNJA 3I3EA 3CZSA 3BVVA 5DT7A 1J0ZA 5BWFA 4U33A 3TTOA 4AWEA 2CKSA 3WUFA 4XZWA 1JZ4A 3EDKA 3AXHA 4DUWA 3AISA 4FNPA 5LA2A 1U33A 1J0HA 1NOWA 3T09A 3VTRA 3L4WA 3W27A 3GH5A 1W3JA 2DSVA 2D3NA 2XIIA 4J27A 4GINA 3DX1A 1Q6GA 4FMVA 3W6MA 4NZFA 1PX3A 2EACA 1LLOA 1TG7A 2GDVA 3AIBA 1V6XA 1XC6A 5GPRA 1MW0A 2F7OA 5ECUA 1ZU8A 4RE2A 2CCRA 3B8SA 3UG3A 1M04A 1R86A 1NWRA 1BGAA 3CH9A 1CXKA 4KWUA 2J4GA 3DX2A 3T0BA 3AOFA 5BXRA 4GI8A 3F4VA 2G3IA 4CN4A 2A3AA 1LL6A 4AEEA 3SUWA 5EFFA 3T2QA 3ZO9A 2HVMA 4M80A 2D0FA 3CHDA 1SYTA 3OLIA 2E40A 5TD4A 3WELA 2FHBA 1UA3A 1ZBWA 1B3ZA 4MNJA 4P7QA 1KXTA 3VD5A 4Y7EA 3N13A 4H7VA 1BHGA 1J0JA 4P8WA 2GDUA 2W62A 2GJXA 1B3YA 1QHOA 2D23A 4UFLA 3OG2A 5A2CA 4YHGA 2CPUA 2DSUA 1BG9A 4QCEA 4AZBA 2CEQA 4F9JA 1E15A 1I1WA 1V02A 4TVDA 1QNPA 2BY2A 1VEOA 7CGTA 2CESA 3CUJA 1BFNA 1HIZA 4J28A 5M17A 3DC0A 1B31A 1BYDA 4J7RA 3ZT5A 1XSIA 2NW0A 2QMJA 4W87A 4W5UA 1OM0A 4P7LA 4AD4A 3WSUA 4KGLA 5IFTA 3VIGA 1O7DC 4LXFA 1VFFA 4NXKA 4TOQA 3OA5A 1QPKA 3D4ZA 1JFXA 4AZCB 3VNYA 3LMYA 1BGGA 4GKLA 1WZLA 1UYQA 3VIOA 1CGXA 4W88A 2ZUTA 1G0CA 3H53A 3A22A 4D6DA 4UOZA 1UR4A 2J7DA 4PEEA 2YDQA 5F7UA 2FHCA 1CYGA 2VOTA 3N17A 1C8XA 5EBAA 1FHLA 5ABEA 3WL0A 4E8DA 4W8LA 3N1AA 4WSJA 2BXZA 2WB5A 4ZFMA 1E0WA 3TTQA 4WJXA 5AY7A 4NRSA 1WZKA 1GW1A 3UCQA 4WSKA 1GOIA 3AMDA 4WKHA 3VM5A 1GCYA 1E72M 4LQ1A 2XFRA 3RM9A 1UR8A 1E1EA 1HKJA 4UFJA 3S5ZA 2E4TA 4BS0A 3PZUA 3CZNA 3BVWA 2D24A 2G8ZA 2VVSA 2X2HA 3GXNA 3AI0A 1PX4A 2DSZA 3H55A 1W32A 4Q22A 4FNSA 4JFWA 1V3MA 2EPKX 1E0XA 1CTNA 5BROA 2WW5A 5A6LA 3W81A 2V38A 1R33A 1E4MM 2E8YA 1VJSA 2ZX6A 1H0GA 3SCWA 5JBEA 5KZ6A 1KXVA 1UKSA 3SIMA 2XN1A 2A3CA 3G6MA 2VRKA 5CGMA 3W29A 2XUCA 4UQBA 3MSGA 4MNMA 3AMLA 4LPCA 5DFAA 3LRMA 3OZOA 4WKAA 5C8BB 1R7AA 1QHPA 4MB4A 4NRRA 3MSDA 2OW7A 2J79A 1UR9A 4YHEA 4HPGA 3MMUA 1W3KA 1WO2A 2GUYA 1B3WA 3U7VA 3BAWA 3WDQA 4MNLA 4GZJA 2E0PA 1QI5A 4CCEA 3CMGA 2V3GA 3JUGA 1C7TA 2BVTA 3QHOA 1V0MA 3N18A 2VMFA 3N11A 4D6IA 1EQCA 3BSHA 4BQ3A 2VX6A 3EDFA 5E09A 3VIIA 2BVDA 3AZTA 3ZJ7A 4X0VA 2ZUUA 1UH3A 1Z32X 1ZJAA 2Q8XA 3IJ9A 2Y8KA 4R5EA 1E0VA 4J3TA 1KQYA 4CU6A 1HKKA 1GQKA 4NZJA 4AD3A 3ZR6A 1HNYA 4V28A 3OLEA 3CGTA 1US3A 1OIFA 4RL3A 3SCTA 2VX7A 4FLOA 3GXIA 1C91A 3PZGA 7TAAA 2C0HA 1C3FA 3PBGA 5CPSA 4XUYA 3UR7A 1J12A 3D3AA 1XV8A 3TP4A 3A3HA 1H4PA 2FGLA 1BG4A 1NOUA 4P8XA 2J25A 3BSGA 5DT5A 3ARWA 2CBJA 1PBGA 2XSAA 1UD4A 2ZICA 1MYRA 4GI9A 2GFTA 2DIJA 3BVXA 3M46A 1JD9A 1CPUA 4TUFA 3SCOA 2F7QA 5IDIA 3CMJA 1E4IA 2RGMA 3EDDA 3CBWA 1X6NA 3WD0A 4UQ9A 3WD4A 2ZXBA 1JZ6A 1JZ7A 2G3JA 4AIOA 2PBOA 2WVUA 4AMXA 2WHLA 2VCAA 2G4FA 2WPGA 4MJ2A 3WQ6A 3W6LA 1UD5A 1UD2A 4AZ5A 1B1YA 1LQ0A 1N82A 4AY1A 3OBAA 5I78A 2WM0A 4AD0A 2A3HA 1NOFA 3ARZA 2PB1A 1JI2A 3PTQA 1L8NA 3W28A 2ZE0A 5GNZA 3POCA 3L2LA 2CYGA 3DX4A 3OIHA 1CGTA 1ZBCA 2J7EA 1MFUA 1FH7A 4AD5A 5E70A 2EPMX 2PWDA 4FK9A 3VNZA 1DWHM 4OOUA 3RPMA 2XVGA 3VDCA 3W4RA 3B9DA 4WKFA 4AZ7A 1ISWA 3SCSA 1FOBA 1PS3A 2YL6A 3AXXA 4UZSA 4QCFA 4UQAA 3I3BA 2VQTA 1QNOA 1OSEA 5IHSA 4UQEA 1DP0A 4GI6A 4UQDA 1P6WA 1R7OA 5ABHA 3BH4A 1BTCA 4PMZA 2CKRA 2ZUSA 4BCEA 3WF0A 5FD0A 4ZENA 2E3ZA 1VAHA 4XV0A 3MI6A 1VFOA 4B9ZA 3L4TA 1V0NA 4AMWA 4UZUA 4FF5A 2E9LA 1FFRA 3ARRA 5E9AA 4ACYA 1XH2A 3U5YA 3W25A 3N04A 1HJVA 1K9EA 3CIVA 4TTGA 1LF1A 3WDPP 3WQ5A 3CHEA 1E70M 1M7XA 2J7FA 4DWSD 1D7FA 1JYWA 4W7WA 1UZ1A 2ZX9A 4AXNA 4U2YA 1GOKA 2BY0A 4JKLA 4AZIA 1QI2A 1VFMA 4EE9A 1WZAA 1K9FA 2ZUNA 2EPNA 4JKMA 3LRKA 1SMDA 3EJRA 3BAIA 3AHXA 3TOPA 2WHMA 2UY5A 1NH6A 3NYDA 3W82A 3MS8A 1JAKA 4PSRA 3WF4A 2X2JA 4TXEA 3BUIA 8CGTA 3RJXA 4ZE4A 2V3DA 4UOQA 3RO8A 2WVTA 3WY4A 3IANA 3CPUA 5A95A 5CPQA 4V2XA 4QAWA 5E1QA 3VILA 1HN1A 5D9PA 3U57A 1XYZA 4BZYA 1JDCA 3CHFA 1PEZA 1UD6A 3BUBA 3G6LA 5M5DA 2CERA 3AIEA 3EJPA 4AZHA 2XFFA 3BAXA 4IPLA 3WMSA 1J10A 5A2BA 3LPFA 5ABFB 3GBEA 1UD8A 2WAGA 1KXHA 2FH8A 4MNKA 2YJQA 3PHAA 1ZL1A 4WF7A 4D6EA 1GQIA 5E0CA 3SUUA 5LA1A 3GXDA 2DGAA 3CZJA 2VT0A 5JBFA 2YA1A 3KZSA 2X0YA 3PZTA 4BQ5A 4CD7A 3A5VA 3WQ4A 4AD1A 3T2PA 1UWIA 1K9TA 2VI0A 4FNUA 3PTMA 4PMVA 3CZLA 4Z2HA 4B16A 1HVXA 4HZ6A 4CCDA 4CU7A 1ISYA 3GXPA 2RGLA 3O6AA 2VX5A 4FLSA 2XFYA 3GH4A 3T08A 5C70A 2EJ1A 4MPKA 5BRPA 3AMGA 2YFNA 5D4YA 3WH7A 2WXDM 1WB0A 4W8BA 3KLKA 1FP8A 4PMRA 2ZOXA 1YQ2A 2BV9A 2JEPA 5JUVA 3A24A 1C90A 1MXDA 4JFUA 2CIPA 1M01A 4TVCA 1EOKA 1EOMA 1HKMA 5HPCA 2YDRA 1IV8A 4D6JA 1MFVA 2XPKA 5DEZA 3QHNA 1J0YA 3VUPA 2YIHA 4E2OA 2WSKA 1TMQA 1KR0A 3VX1A 3BGAA 3EJUA 4KRTA 2A3EA 4PRWA 3QOMA 3VIKA 3GXFA 3O2LA 3WDHA 1ESWA 5BRQA 1R46A 3BCDA 4F9DA 1GUVA 3K4DA 1FP9A 6TAAA 3OGRA 3SCVA 4LX4A 2WLZA 5LA0A 2BFGA 1IT0A 4TVUA 3UG5A 4AD2A 2D20A 3WKZA 3A4XA 3AYSA 5CG0A 5I2UA 2IUZA 3E1F1 3WD2A 1EDGA 1CGWA 2A3BA 1G1YA 1GJUA 1TA3A 4DUXA 3S5YA 1E6XM 1RP9A 3WNNA 1MW1A 1BYBA 4UR9A 2XSBA 4DWSA 4CD6A 3D5HA 1EHNA 4PUDA 1WDQA 1NP2A 1WZMA 4B15A 1B2YA 1V02E 5FOOA 2YA0A 2W67A 2J8FA 3VU2A 1GZJA 2XN2A 2CXGA 1GNXA 4W7VA 3RM8A 5AYBA 3F5LA 5HXMA 3U5UA 4NX0A 1WDRA 1E6RA 3NJ3A 2HISA 2PBGA 5CSYA 1C92A 2X0HA 2JF7A 4HA4A 3WDRA 4P7RA 1TQWA 3L4UA 5CXPA 3FN9A 2ESCA 1TZ7A 3VGDA 5A8QA 5A69A 3GNOA 2G3NA 4D6FA 4DWSC 4W5ZA 3QHMA 1GOWA 2JEQA 2F7RA 2PC8A 3OZPA 3ARUA 2GK1A 2YBTA 2VR5A 3WENA 3KLLA 3B9AA 1B3VA 1JI1A 3CUIA 3T0AA 1V6VA 3WH6A 2YL9A 4JFSA 4ML4A 2JE8A 3TV8A 4N0RA 1SFSA 4CN6A 5I23A 1UQYA 4D1JA 4AIEA 1CGUA 2BS9A 2J47A 1Q6EA 2V5DA 1X1NA 6A3HA 1VBRA 1MW3A 2XVLA 3FY1A 3EMQA 1H11A 2UWFA 1UKQA 1VRXA 1O7AA 5A6SA 3VM7A 3AIVA 4FNRA 3VINA 3VIPA 2ZX5A 2XN0A 1J18A 3ALGA 2D0GA 4H8VA 1GOOA 3GYCA 2VCCA 3VIFA 4U2ZA 2WWCA 2CETA 2Z1SA 4ACZB 3AJ7A 2YLLA 4UFKA 4DWSB 1CDGA 1UOKA 2W61A 3IK2A 2X09A 3BAKA 3AS2A 3IAQA 3MV11 2XIBA 2WHJA 4M8UA 2E9MA 5KEZA 3MV01 3BAJA 1W1PA 3AHTA 1OT1A 3ZT6A 1FH9A 7A3HA 1R47A 4QDMA 3WL1A 3FHAA 3MO4A 1CXLA 1W2VA 2PWEA 1E73M 3FHQA 2O9TA 1QW9A 3APGA 3WDIA 2F1BA 1XGZA 1HJUA 1CNVA 5I77A 1LL4A 5CZKA 4PBGA 1EHAA 4PMYA 3ARVA 4RE3A 2VL4A 4Z2JA 3LXBA 1DTUA 1VB9A 1QVBA 4UNIA 2GK1B 1E6ZA 1E6PA 2NT1A 3IJ8A 1VJZA 4F66A 4W89A 3UESA 1FA2A 4AYGA 1HJWA 2NT0A 1QHZA 2QMKA 3GXTA 3QGVA 1BVNP 3LPOA 1D3CA 4XZBA 2EPLX 1H41A 1KFWA 2WC4A 4PMUA 3HG3A 1XYFA 2D0HA 1OBAA 2ZWYA 2BY1A 2DH3A 1TQSA 1EQPA 3AYRA 4OZOA 4TX6A 1GVIA 1KWGA 4C7DA 1GHRA 1JIBA 2WC3A 1KTBA 2X2YA 4GXPA 2DEPA 1CWYA 3GNPA 3O9NA 3BLKA 2VURA 3UERA 4YPJA 4P8UA 1UUQA 1HJSA 1HVQA 2Y24A 4QLJA 4CGTA 1V6UA 3CO4A 2F7PA 1W2PA 4HTYA 1VEPA 4W86A 1BSIA 1C8QA 2CBVA 3EDEA 2FH6A 1LG2A 1KCKA 4CCCA 4S3JA 1OCQA 4M24A 2PWGA 3ARXA 1EDQA 4P8VA 2OWWA 1CLXA 5A8PA 4HP5A 1W9UA 1UWUA 3DDFA 1V6WA 2VRJA 4HU0A 4C7FA 2WC7A 4D72A 4LYPA 1I1XA 4DUVA 2IXVA 1V3JA 1R34A 2OWXA 3BVUA 1KCLA 3A21A 3II1A 3TA9A 5E6YA 1HP4A 4AYSA 2WVVA 4PMNA 1S46A 3ARYA 2WCGA 3CZEA 3NUKA 5A6JA 1BLIA 4EK7A 2CHNA 4V27A 2J7BA 3SCQA 3IGUA 3L4VA 2AMGA 1R75A 4MTVA 4AIUA 4N42A 3EYPA 5HBFA 3VGHA 2EBNA 2WMIB 3PTKA 5FL1A 3L4YA 1UR0A 2WCSA 3SCPA 4GQRA 1K9DA 5CJ5A 4HZ7A 2FYVA 1HF6A 5GQBA 3UR8A 2O9PA 5M03A 2JIEA 1J01A 2WLYA 3VMPA 3AIUA 3A4AA 1NQ6A 1QI3A 1W1TA 2WMGA 4JAWA 5D9MA 1E1FA 2GJXB 5ABFA 2WZHA 1NWTA 1UD3A 3ZR5A 2JFEX 1EGZA 4XB3A 1WAWA 4E8CA 1WE5A 1NWSA 1CGVA 1TVPA 2Y8VA 5A2AA 3SCUA 1MQPA 2ZIDA 2WMJA 3DHPA 1H5VA 3NSMA 1YHTA 3HU7A 2VR4A 3GXMA 1LL7A 3BLPX 4D6GA 4IPNB 1FH8A 2ZX7A 3H54A 4JFTA 5EB8A 2W91A 4A3HA 3CUHA 4PTWA 1BPLB 2BY3A 4PMQA 1E43A 3WUBA 4ACZA 4FLQA 4R27A 3VGFA 4Z2GA 1HXJA 2VC9A 1GVYA 5M3WA 3MANA 2JIWA 2ZXAA 3WF3A 5D8ZA 4BA0A 3AS0A 4M1RA 1GJWA 1QOXA 2WBGA 1V3HA 1E55A 5A1AA 3EBVA 1LG1A 3AZRA 3VIJA 3EDJA 4NXSA 4D71A 1BVZA 4JKKA 1Q4NX 4UFMA 1SMAA 4TTUA 1CLVA 4JCMA 1E4NA 1PIFA 1HL8A 1BYAA 3GNRA 4PMDA 1KXQA 2VZOA 5DO8A 1SZNA 4Z2IA 1NP0A 2QHAA 1W9BM 3HG5A 5I0DA 8A3HA 1H1NA 1NM9A 3UETA 3ZJ6A 3CZ8A 3CUGA 1ITXA 3ZSTA 4CVWA 2VX4A 4CKQA 3WQWA 1W9DM 2VZSA 4BF7A 4PTVA 4ATWA 2DQXA 2BHUA 3L2MA 2OSXA 3WNOA 4K68A 2WVVB 3IAPA 5FCZA 5A6KA 1ECEA 1UWRA 3BUDA 3HJEA 3ZJ8A 2Z1KA 1TQTA 1W9VA 4ZEPA 4EANA 2WVSA 4WLCA 1RH9A 1GORA 3VOCA 4PYSA 4HMCA 3OGSA 2WMFA 3DX3A 1X6LA 1DWGM 2DT0A 4H04A 2ZXDA 1NARA 2WMHA 3AHVA 3FXYA 1JZ5A 3W38A 3M7SA 1BAGA 1VIWA 2UY3A 2XJ7A 2WNWA 3QOKA 4EKJA 1E4LA 4U5IA 2VO5A 4QLKA 3CLWA 2PI6A 4F79A 1ISXA 1U2YA 2FHFA 3DX0A 3AHYA 1E5NA 2O9OA 1G9HA 4X9YA 3PZQA 3VDHA 1EA9C 2YL8A 2D3LA 1OT2A 2ZXQA 4HU8A 3GDBA 3T2OA 2WMIA 2Y5EA 3PZ9A 1QW8A 3D4YA 1C7SA 2PF0A 1JG9A 2O92A 1KR1A 1XD1A 1XD0A 1QX1A 5I6SA 3UG4A 3DDGA 3HMCA 3WBAA 4M81A 3VKKA 3NIYA 5LYRA 2F2HA 1E3XA 2G3MA 3VSVA 2J78A 2EXOA 5GNYA 1ISZA 4AMCA 3VMNA 2W66A 3ALFA 3ARPA 1PJ9A 3MMWA 3VD4A 3ZM8A 2C7FA 1IZJA 2XG9A 1FFQA 4M29A 1SR0A 1V3IA 1E40A 2WWDA 4Z2LA 4MJ4A 5BCAA 1OGSA 1OWQA 4W85A 4CN1A 2CBIA 4E4PA 4AZGA 3W37A 5AC5A 3AS1A 1JZ8A 2Y2WA 1PIGA 1QI4A 4WIWA 1KQZA 1KGWA 2ZX8A 2CBUA 4D6HA 1JYXA 1W1VA 2XM2A 4JHOA 4JHZA 3MMDA 1Q6CA 2XYLA 3AROA 2X8RA 5IFPA 4NSBA 2OLHA 3VD9A 1DWJM 4A4AA 2OSWA 4PMOA 2XWEA 2UY4A 3AMCA 3QR3A 3LXAA 4W8AA 4CD4A 1C93A 4W84A 3WMCA 3WUEA 1GHSA 3RMEA 5BXSA 2YBUA 2UY2A 1PZ2A 2GSJA 1QBBA 1EDTA 4UCFA 2J62A 2X05A 3KEHA 4AC1X 3CTTA 2D73A 1XH0A 2CHOA 5CGTA 1ODZA 2GJRA 1HT6A 2OSYA 5GNXA 4C7GA 1W9XA 3WN6A 3WQVA 4UTFA 3HG2A 1KGUA 3OLGA 1CENA 3PZIA 3K46A 3ZIZA 1MVYA 5HDRA 2WHKA
chains in the Genus database with same CATH superfamily
1WRFA 2FIQA 1Z3GL 4EBQH 3QIBA 3DYMA 4QT5B 2F8QA 5JIDA 4M62H 1D9KA 1MHEB 1P1MA 4OUEA 4YJ5A 1KLUA 3LEVH 2HEJA 3V7MA 1XYAA 5MEND 1WD9A 3LZ3A 1CE1H 4NENA 2APWA 4P04A 4P2RB 4A6YA 5BOPA 2PWHA 1K4DA 2QKSA 5FYJH 1EEPA 2J6VA 4F8XA 1G7UA 4FEIA 2ZYRA 2IBZY 1PNCA 2AEQL 2B3IA 5E6ZA 5SX4H 3BHBB 1W3LA 3DXAD 3IJEA 2FPTA 3RLHA 3VYOA 4M6PA 3P4MB 1C08B 1OOAA 4GWEA 5EYWA 3WDJA 3S6TA 5K3VA 3VD3A 1JNEA 5ILTH 4B97A 1Q9OB 3EJQA 3OJVC 1H3GA 4MNHA 1ITCA 3D39E 1FIGH 2PW1B 3PAZA 1TZIB 3D3VB 4NEHB 2DZBA 2GOUA 4JTCA 1AD1A 3F6LA 3QIWD 1UM6H 4CD5A 3TOYA 1YMMD 4JO5A 2IKJA 3FCPA 3EWZA 1LYQA 1IXOA 4ZB0A 1WISA 4PJHE 3VWJB 3MQTA 2XVPA 3M0HA 4ICNA 2WD0A 1RZIB 4IJTA 3U6RA 1SQ7A 1RVFH 2AQWA 4Q52A 4PJCF 4F2EA 3HBPA 1RHFA 2OX5A 3SM0A 1U8KA 3T77A 5IHWA 1A47A 1G94A 2J57A 2CDGA 1SRDA 2FECL 2L0DA 1A6VL 2ZWKA 3QZWG 3DZ1A 4NUWA 3B2DC 4JREC 3LTVA 1Z3GH 3S3GA 1L3NA 4MAYC 5BS0B 1NMBL 4OFVA 3SKOB 1JCNA 2VDOH 3AUVA 1LL1A 5KYXA 4GY4A 2J77A 2WTRB 1X7QB 2P3YA 3KPNB 4OZHF 3RL2A 1XL4A 1P9MC 4P9HC 3VFOA 1YAIA 3D25B 3U2EA 2ZVIA 1LD9A 2QS8A 2VN4A 3KWVA 2DVXA 2UVEA 4B96A 2IPFA 2E5BA 4K5MA 5CC7A 1A8ZA 1AVAA 5I1CH 5EULV 1QR7A 5T91A 2VSKB 1XB6A 5EF1A 3RNDA 2EDRA 4PP1D 1A3XA 3P80A 3C3NA 3RB5A 3GU9A 3CQFA 3NABL 4KFZC 4P46D 4XH2A 5AVSB 1S9KC 2PMZA 1DL3A 2HK0A 4LUIA 5JIWA 1JXKA 5IUSA 1HWWA 5HGHB 4TNWK 4P46C 5IQ7L 1CS6A 3S2NA 3R43A 2MQ0A 3AQZA 4JRXA 4URTB 5JNYA 4Y9PA 3OR7B 4O02H 2W94A 4P59L 5D7LD 3U1QA 3L5WA 4M5TA 3MNVA 3K8KA 4K7PH 4CJ0A 1IC0A 2APFA 4QXUH 4WU7B 3M7WA 4U3AA 4HSOA 1P4BH 4GRWH 4PJCE 5AVYB 1FWNA 3HS9A 1FDZA 1LJYA 2R8SL 3DSNA 3R79A 2LLEA 1TVNA 1IC5L 2VFGA 4D6CA 1JSYA 4ISVA 2Q7YB 1SSGA 3DKJA 4LGXA 3WLWC 4HMDA 1TTRA 3QRBA 4GUPB 4RAUB 5TDOB 1G4TA 2YSWA 3BKMH 1RZ7H 3PWNA 4Y5YB 3B9KA 3IIOA 4ODBD 1A3LL 1AE6H 3TNNB 1XLGA 3QAZB 2D7QA 3TQVA 3CLFL 1UXLA 5FB8A 4FOJA 3SKJL 1B90A 3AS3A 2DT1A 3QZBA 2DY2A 4OZHB 4LDOB 2PDCA 2G2PA 3IJSB 5AAMA 3QHZH 4H9YA 1I8UA 2QJDA 5F1OB 5E24E 1UWTA 1J1PL 1WQ5A 4W7UA 2LFGA 3BZEA 4JPSA 5JPMB 1NY1A 1T2QH 5C7HA 7PTDA 1GZ1A 2MQGA 3T3PF 3U0TB 3MX0B 3KOZA 5CPNA 5EFDA 3S6OA 4F2FA 1X6UA 3MLUH 2E8ZA 1DQTA 3UJTL 3BGMA 1HHGA 1Z48A 4AY7A 4AT6B 3SURA 1MSPA 3CC1A 4Y4HA 3CMFA 4BWTA 3K4AA 4KTYA 5C9WA 3LDBB 2NYYD 3ARGA 1SJAA 2FBJL 3E3QC 5CIPB 1KB9K 3FAWA 4ZT1A 2J8UF 4AQZA 4EBQL 5C9JB 3CWOX 3ZHLA 1AHKA 1KBKA 4PWEA 4U4BA 1KCXA 1MY7A 3M07A 4N2AA 1K70A 3KW3A 3LLDA 1PCWA 2QULA 4LYKA 2VZUA 6TIMA 2BCKB 3TNNA 2BZ7A 3SE8H 4JFFD 2F9RA 4WY0F 5EU6D 3U7BA 2QLVB 4RFOL 1P2CA 5ERWA 3UZVB 3TTSA 1XF5B 3WFHB 5IY5B 1LUCB 4LOEA 1ONRA 2D03L 2AKZA 1FVCB 3CFBB 3KL0A 3SUTA 3HUJE 3ZY7A 4HKPA 3QY8A 2R8WA 2Z29A 2A5UA 4AUYA 1K1DA 3BL3A 5DXWA 4OQVA 2DLTA 2E27L 2POZA 4KI5D 3FO0H 3LZFH 3U2OA 3B9KD 1FSKC 2NXYD 4Z78A 1ONQA 3GBMH 2DI7A 2FO1A 3RTQB 4K7FA 5IQMA 1B3XA 4FTVA 5B3JF 3NJHA 3G3LA 4JREB 2VE6B 3MDJA 1IGFL 4MZ2A 1PQZA 3BIKB 4P4KA 2YPLD 5GGQH 1UWEH 5ADPH 3VA8A 3N12A 2DW7A 4DAIA 4HJTA 3H42H 1P1ZB 2NZ1A 3DECA 5DRZA 1VYRA 3IEAA 4TVSa 5IVXF 3A3YB 1AC6A 3FK3A 5CLXA 3VRIB 5IJCC 3VI2A 4EE9A 1SF3A 3RU8H 1NFPA 2YKLL 1CLKA 4DQWA 5I5MA 3LQGA 1BJ1J 1NAL1 4O58L 4W9CC 1MWOA 2RA1A 4DN3H 2BOGX 2GT9A 4HHHA 1BVKA 3TBCA 3BXNA 4HD5A 2V30A 1PDYA 2WIMA 1ZLDA 2CK0L 4YDNA 4WFFD 3RRXA 2J8UB 1MUJA 2NQCA 1VFUA 1V7NL 2RACA 4LCIL 4LHJB 3IRSA 3O8XA 1I8LA 4ETYA 3EZ8A 5BXTA 4J8RA 4WDXA 1TZGL 2XKNB 1Z0MA 2R51A 2HN7A 1JDAA 2OW6A 4A55A 5EDXA 5TE7H 3OODA 4X6CB 3WGVB 3HV9A 4HNLA 4NYLA 1FLTX 3ZMRA 3WY2A 2ZYSA 2XU9A 1OB1A 3LD8C 2GKIA 1ZLEA 2CKBL 1FP5A 4Z3IA 1HKVA 3SCRA 2CUHA 3NEHA 1DBML 4N2EA 4Q6JA 1ZALA 3EBIA 3HG1B 3NPSC 1T1YA 4WHCA 4XMXA 2DSKA 3G5EA 2VUYA 2EQDA 4KJQD 2IXUA 2MOVA 3CVBA 4M61A 2MANA 3IDGA 4MG4A 4RNRA 3F01A 1GONA 1Z69A 4ODHL 3A4JA 4UM9B 3LQLA 1ZJBA 4L8BB 4EN3D 2NSXA 3OX8A 4PJGE 3VGGA 4JICA 4KROD 2UUDH 1PYWA 4QRTB 4F7TA 4PRNA 2EADA 4F0KA 2XWBB 4XZUA 3V4PA 4H0HB 4YSPA 5C2UB 2ZRYA 1KPRB 2NNCA 3OHXA 5CCJA 5DRIA 2V2WB 3UYPB 3KS5A 3UG8A 3WJWA 4MZRA 2LU5A 1N8ZA 3HN3A 2NXZB 5DK0A 1MXGA 3K5XA 4CADA 3U48A 1CDJA 2XTJC 5ERWB 4ZQKB 3ZDZF 4HGWA 4KKLC 5FA3A 2ON3A 2FT6A 3D85A 1IXPA 1ZHLA 2BFVH 2J74A 3T6CA 4PJGB 3VACA 3B3BA 4OM0H 4O10A 2WYTA 3B9EA 4TOYH 4PMXA 5HAOA 4N26A 1ZE3H 3U36A 3V4LA 2C6QA 2WWOA 5DZ9A 5FKAA 2J9ZA 3VB9A 1XBRA 1UP0A 4MY1A 4DJMA 4L61A 4MZYA 1FBIH 4RMUA 5EH1A 2VXUH 3LBCA 2ABAA 2EDFA 3GC4A 1EQWA 1LLZA 3IXTB 3GBLA 2MCAA 1TTGA 1KBIA 2BBFA 2RGSA 5EU4B 4Q4MA 4W9KC 4ATTA 1WPCA 2DQFA 3OMIB 4PWFA 3J7HA 4GIYA 4X6CE 2HS8A 1R3LB 4ODVL 2XVNA 3V1HA 2BO0A 5GRJH 5IIEA 2YBRB 3OHXC 4Q9CA 3V4UL 3AHZA 3AU2A 3RU8X 4P06A 3H6OA 2H47C 1ETJA 1R3KB 5EMYA 4KPLA 4HWBA 2RAMA 1LK3H 4XRCA 4HK3N 3LCYA 3NDYA 3IM1A 4RMTA 1UM6L 3B2PA 4QE1A 1OAYH 1TQJA 3W00A 3RTQC 1J9YA 1OY0A 2WMKA 4YBQD 3OMNB 1EJVC 1F58H 1QRNA 4HJGB 1D5ZB 2F6UA 2TRYA 1EUAA 1MUJB 3BLIA 3TYFA 3PV6A 5JW4Q 4FJYA 4PZVA 2BOFX 2DJMA 2ESVD 3L95A 3X11B 4WIQA 2HT3D 4MD5B 1UJQA 3COTA 5K5YA 1E6OL 2QSQA 3FYIB 3DPBB 3ZUNC 3W5MA 4HQVA 5LNUA 4WWPA 2BHFA 5JOFA 1OAYL 2J6WA 3O4OC 4RX0A 3GSRB 1IM3D 3DHUA 5J0BA 1NCTA 2XFXA 4GUQA 2YPVH 3DTUB 3D0VA 2ZADA 3IXAB 3B8YA 1M56B 3X3GL 1WT5C 4NERA 4DHLA 5GJNA 2BWDA 1XCQB 2XVKA 4XKMA 3MRPB 5LNVA 3L0NA 1JF5A 4AF0B 4EF3A 1EIBA 2UZPA 1I4FA 3UDWC 4JM2B 3CAWA 1HJQA 2AITA 3NDZA 2A9DA 2PTDA 5AD0B 4S2BA 1TZ8A 5F0JB 2OCCB 4B90A 1VGAA 4LSQL 5I6OA 2V5SA 2BS8A 1HWHB 2ZCHL 5DMYA 4X8JB 1QNQA 2R94A 1CFBA 3KDOA 1PDKB 4REQB 2PFHA 3AW5A 3BMVA 1T20B 3LPPA 4LVNC 5DD3L 3QHFL 4YXLH 3C12A 1QWNA 1VFHA 3TYBA 5AOMA 4AISA 4GPNA 2FEDD 4C8XA 4Q6IC 4XXCC 4B9KC 4Q8MA 4WUIA 3OZYA 1IAMA 3MSRA 3UGXA 2RJHA 2V5BA 4DYKA 2X4UA 3NPSB 2FGZA 1HEZB 5E2TH 2FZDA 4WNQA 3ZTCC 2VGFA 3CE1A 1UOLA 4GKSB 1HCFX 3N9KA 1LJMA 4M5PA 2AS5M 4WCJA 4Y8FA 5FKYA 4BV1A 4J5VA 2F0CA 4H5SB 3S97C 4NN7C 3W2MA 3AB0B 3KPQA 3BYTA 3HI6L 1MFAL 4OIAA 5F1SA 4YXLL 3G1DA 4D1IA 1OQFA 4ZTPL 2QCCA 1E9ZB 1DQJA 2AJXH 3ILQD 2VLJB 1FORL 4LRIA 3QQ4A 2IW0A 4LF1A 2N7SA 5IEHB 1NVMA 2A83A 2DJXA 3IBOA 5F3BA 1UUMA 2PWFA 3EMZA 3GZAA 2AAVA 3U4AA 1E3ZA 4TSAL 3CDFA 4G1MB 3WKYA 2I9TB 2HJKA 2V2XA 3M45A 1OEZW 4KZ0A 4OGYH 2ILLA 4Q9QH 4HK3J 1MDRA 4WFFE 1UR2A 4LF2A 1F74A 1V6YA 1RZKH 2WZ6A 2G0WA 4ICCX 1XLBA 3KPSE 3VE0B 1G4MA 3PJSB 3CSYB 4FQQB 2CU0A 4GX8A 4Q7NA 3DUUA 4EI5A 3Q2VA 3LMZA 1WFOA 3LPGA 4JIEA 2BH0A 5HDLA 1B3IA 4ZXLA 4QLLA 2VB5A 3X1BA 4IMGA 4ONFL 1QSEB 5CINH 5CSUA 1WHOA 4GAFB 5JR1H 2VERA 6ALDA 5HWNA 3NQ7A 1PSKL 4FQLL 5D93C 3ZDXB 4JQXC 2GVEA 5GISL 1DWAM 1I9EA 3L3KB 3U3HA 3BANA 1QD0A 3G04A 4Z7AA 1VC4A 1T1XB 3R2GA 3HMXA 5CSZB 2DJLA 2ZUMA 3S1VA 3CDCA 4IHOB 3WBXA 4ALDA 3O6FA 3UJFA 4WNJA 1UJ3B 3I4KA 5AC7A 4JO8A 3A67H 4KTEH 3TM6A 2Y4SA 4FEZA 4JM0A 3OGVA 1ZSHA 3WNMA 2AJXL 4ENED 2PUQT 5F3BB 1JZ2A 1A9VA 1TQUA 2QAPA 3NRPA 2D7PA 1OAKL 2VLKD 3CFDB 3K2MC 4NSKB 1QOQA 4ZDHB 2HK1A 3RLVA 4XCYB 2ZNWA 2XPYA 2Y1YA 1KT2B 4ODWA 3MP3A 1IFRA 4KXCA 1KSRA 4LMQI 4C57C 4U49A 5SX4I 4IKIA 4S1SL 1VENA 1A5CA 2D31B 3B56A 4YZFF 3TONA 2P8PA 1JDEA 3WH9A 1TEYA 2PZ0A 2F7IA 2ALDA 4L37B 1OD0A 1O5QA 3PJLA 1OD8A 3NSYA 4UFIA 3KWXA 1KDJA 4R6UA 1K6WA 2NQHA 4B3LA 2WBJB 1MCJA 4YE4L 5F88A 1XW8A 4BHUA 5CLTA 4IXHA 3AT0A 3BDBA 3V5DA 2APVA 2LV4A 4H8HA 3QRFM 4ZOBA 4AW7A 4MSSA 2HJFA 4TLKA 4WWID 3RQ3A 4C4KT 1NIAA 2XX1A 4ENZA 1IQDB 2QVTA 3WF1A 4BFNA 4F15B 5FF2A 5CPMA 3LKQA 4Y0GA 4Y8AA 4YYCA 4L4VD 1UROA 1MHPH 4PUBL 4DF1A 1TV2A 1QBAA 1FO0L 3LB6D 1HL5A 2FYYA 3QVQA 5T3ZH 4MY8A 1FFPA 1BOYA 4XAZA 5DQPA 1P7BA 1M1SA 3O4OB 5K1VA 2V3EA 1A5FL 4F2MB 1ZAJA 3HE7D 5F1NB 2QGDA 4PB3A 4BKLA 2JXMA 2ZSVA 3HC2A 1B4JH 3E0WA 5ISZB 1I3RA 3VC6A 1CIDA 2ATKB 4TVPD 2ZPKH 3SDXF 2OMUA 4FMFA 3EWCA 1WWAX 4Q2ZB 4JY6A 3SE9L 4AVOA 2VHLA 3OHIA 2DIEA 3O3BB 1I53A 5HVHB 1XIWC 3G1HA 1JK8A 1I7ZB 4JM4L 7REQB 2SEBA 4LZKA 4XD6A 1SJMA 2P10A 2RDUA 3S36L 3IUIA 3HI1A 4JCLA 1DQXA 3HMWL 4A8LA 3VFWA 3M0MA 4P8QA 4K15A 3PV6B 5I82A 4HLJA 4RW5A 5LZLA 4LSRL 1Z41A 2NW3A 4UQ2B 3ZU8A 4DJEC 4LLWA 3MHZA 4UU9B 1PLGL 1OF0A 1OIMA 2HYMA 5JHLH 3ZT7A 5DK2A 4H8QA 4BIKA 1HGYA 3CV1A 3O0LA 4NKQB 3OKOB 2ACRA 4RDYA 2BP1A 3GBML 4Y7MA 6CGTA 2W9EL 1XCXA 5I28A 3J8F7 4JANB 2XYCA 1S2CA 4ORIA 4NASA 4DW2H 3R10A 1FWHC 3CLEH 3GI8H 4UDUA 3AREB 3PGFL 3AQUA 3RJYA 1AFVL 1YYMH 4H8NA 3GJFK 2VDPL 1Q0EA 1MDAA 4HDIA 4HPYL 4N2GA 4ZYKB 1NGZB 4ZFGH 43C9A 1KCBA 1OGAE 2IDSA 3S88L 7REQA 3GIPA 4ZMGA 2DT2A 3GZKA 2QV4A 4RNIA 5BU6A 2DIAA 4TOYL 1VCGA 4NQDD 5JDSB 1N8FA 3MUAA 2FPYA 3TYAA 5D1ZI 4L3CA 5KSAD 4K5OA 1B30A 1FWEC 4AZ6A 3GSUA 3ZRCC 3NABH 1E9LA 4R97B 5C0FB 4WGKA 1S3HA 2FZMA 1UXSA 1AH0A 2DH2A 1EXBA 3H2FA 4FO4A 1FORH 1P69B 4W81A 4MJIE 1M7IB 2KS0A 3VSUA 3WMLA 3X12A 5C71A 1QPXA 1ZA6B 3MRBB 1UKOA 3FOMA 2WXPA 4U3CA 2Y1HA 3GAKA 1OVDA 3QPXH 1BFTA 1JZHA 5HGGS 1F4WH 3RF9A 4O16A 4DESA 2BNQD 3PNWB 1N8ZB 3VJ6A 3S9YA 3C0JA 3UY7A 3ZLHA 3V0TA 4MVBD 4IPJA 3RX4A 1YC8A 2WXHA 4NX5A 5G5DA 2GLKA 4HNOA 4A68A 3I7RA 3WLTA 3JTTB 1R3HA 1E4XL 4FXKC 1U5VA 2B4CC 1BF5A 1TA3B 5DVPA 2V8ZA 5GGUB 4HUNB 3FTXA 4ILSA 3IPEA 4OWGA 4G1EB 2GJJA 4ZFGL 2OX1A 4JR9L 1UHVA 2QKFA 1KFAH 4HAGA 4F0MA 2ICWA 4G9FE 4WTWA 1K3IA 1VERA 4L1SA 1FHVA 4PJEB 5IW1B 3RDTA 3HZ3A 4Z0BL 5LAXB 4X6CA 3SW6A 3VNIA 1EAPB 3CFJB 4LRNL 3VWKB 3HFTA 4Q0XL 1K5NB 3GRWA 4U7MA 1H8LA 3RX2A 3F7YB 3AU0A 1NGPL 4PJ7B 2HB0A 1MELA 3L17A 2W60B 4KKCD 5LQBL 1A0EA 5HHNB 3LRHA 5C0BB 1UZ4A 1J8HA 2QV2A 2E9BA 3P0VL 4OAWB 1XR9B 4KGJA 2Y2YA 4PJFE 3WY3A 1IAOB 4PJDA 1FH5L 1UASA 4YS4A 5ADOH 2AC0A 2PGRA 1QWKA 1AJ0A 1KRAC 1NLDL 3FW6A 2XKNA 4X80L 3T4AB 1EUTA 1NWOA 2D2OA 4KMQA 4Z7VA 5IFJA 1MEXH 3KGRA 5AAPA 1ZPLA 1AYOA 2FX9H 4FQIL 3MGAA 4G82A 2BJML 3NTCH 3MV9E 2H3XC 3U7AA 2LAAA 1J11A 2IBBA 3ZSSA 3D1MC 4AQ1A 4J23A 4YDIH 3QIUC 3RA7L 4AYFB 1XUUA 4NHCH 3VAVA 5BV7C 1TE1A 2YKKA 3KJ4C 4X8GA 5DLLA 1RZJH 1G7LB 2FO8A 2YUXA 3H4FA 3KE0A 5GISH 4BHUI 4S3EA 2OCFD 2CJUL 4KRUA 4NJJA 4OM1H 4Q8NA 5HA7A 1MLCA 1XH1A 1KIRB 2PXYA 3S5LB 3BXWA 4OM0L 2L7EA 1U91A 2DT3A 1W3IA 3DIPA 4JHVA 3B1UA 3UWVA 4OCXL 2XC8A 3KCJA 1GS7A 3QW4B 1OGPA 1QFEA 5FYKL 1LGVA 3PXJA 5CGBA 2D7TH 2ZDSA 4QQ3A 4MWFB 3W9DA 1DQDH 3L7FB 3AGVA 4HGWB 4OD3H 2B0SH 5DT1H 4XX6A 3STPA 1OHQA 1KGJA 4UT7L 1XF5A 4ZUUA 3IDMA 2PCPB 2WJ7A 5MI0B 1P5VA 1GPOL 1B0GB 1SN5A 4NLAA 1GA2A 4POUB 4H2CA 2BCKA 5CZVH 3WKQA 4MRCA 3KR3H 2HVJA 2ZPKL 2BNJA 3H4WA 1OP5H 3BVVA 5E2JA 3SGEI 3L9YA 3S2JA 4Z7WF 1UIPA 4XZUB 1OWRM 4ZFFB 1CG9A 5KITA 4RGNB 2ANUA 4HMNA 4KXZI 5C9RA 3FYYA 3VABA 4OBTA 2R91A 1JZ4A 2EVGA 5D6CB 2GJ6E 2G5RA 3SDAA 5AYYA 2G0KA 3QJTB 2HT4C 5JDSA 2Y25A 1EIXA 4R5TA 4RPPA 4JOMA 1OVZA 4MKMA 3KW8A 1U33A 2NY3C 1GGUA 3IU4H 1NOWA 3M7FB 1LMIA 5J6HB 5DI8B 2RQEA 3KFTA 1TYJA 3L4WA 5ID1B 4HA0A 1XCTB 4BQ8A 3W7HA 1W3JA 2DEWX 4FS9A 2XIIA 4GUJA 3QXBA 1HO4A 2C7UA 4V11A 4QG6A 3TBYA 2INFA 3QHFH 4WUKL 5E56A 3COOA 1JV2B 3FUKA 4JY8A 1CFQB 3W6MA 5JW5A 1FCGA 5KANI 5H2BA 2WJDA 5AZEH 4NZFA 4F0SA 1YPFA 3TFKD 1OZUA 3B8DA 5JMUA 3UJSA 4P99A 4DQOL 3O0FA 4XO6A 4BWLA 3TYGL 4PREA 3WIAA 3TK7A 3BPNB 4CMMA 1RY0A 4F57L 1LMKA 3WZ0E 2Q6ZA 3AIBA 3P3BA 4DXXA 2H1LM 1V6XA 3MRIA 3MRNA 4LLWB 4UU9A 1WVZA 3O8XB 4MCMA 5HHNA 1UGKA 1MCNA 4RDZA 2F7OA 4OCMC 1RH8A 5FW8A 3N55A 5DMIH 4P49A 4IOIB 3B8SA 5I9QB 3UG3A 3KVJA 3ZUCA 3TCEA 2VZ3A 4AGOA 4H88L 4DP0X 4FTVE 1JGLL 4ZQNA 1BGAA 4JRYA 4KOCA 2Q8BH 1CXKA 1J5SA 7PAZA 3T3MF 1T6VN 3R0NA 3QY6A 1ACYH 2J4GA 3CDGB 4LUJA 5G2HA 2DJ4A 1P0BA 3GVWA 3W7EA 3DX2A 3L3GB 3WE6A 1C29A 5CCGE 1K4CA 3UZQB 4XH2B 1DOSA 2W9MA 2G3IA 3AOFA 3F4VA 3C5JA 3F83A 4CN4A 4X2PA 2OZ4H 5ALCH 4AEEA 5BMFH 1VH7A 3HV8A 4JO4H 4KPHL 4JFOA 5AB1A 1W72L 2JWYA 5F7NC 1MFAH 1TQCC 1M68A 3CHDA 4M80A 1Z9NA 2RCSH 4QRSA 2HKHL 3D34A 5C7XH 1BVWA 3MUXA 1GYAA 4FG6D 3OLIA 1OP5K 2DVUA 2E40A 2ZSWA 4R0LB 3F5WA 1XGQB 3ZKSD 2RFXB 2GSHA 2PTTA 3MI2A 1X5IA 1J8KA 3HQ1A 3LRGA 1KXTA 4PS4L 2W0UA 2R0ZL 3NQVA 3N13A 1YJDL 2G5UA 2JKWA 5TK2A 3QYMA 1DHPA 3W1UA 4A04A 4BSWA 1V27A 3RZCB 4HAKA 4N0YL 1BHGA 3W5NA 1J0JA 2DKSA 2VEPA 1YAZA 1W72H 2FUQA 4P8WA 5AC8A 3HJ0A 4ORMA 2BWGA 2EPHA 2GJXA 1QHOA 3EBGA 5GRWA 5JXEA 1G6RA 5DBUA 1R5IB 2OKOA 3OXRB 3OG2A 3QDGB 4R7VA 5GRVL 2NWRA 3NK3A 4GSUA 4UUJA 1XS2A 3TCLB 4PUKA 2X4NA 4F9JA 1E15A 3P69A 3LB0A 4KX8A 1V02A 1G1KA 3N3TA 4GYJA 4TVDA 1TPFA 3VQMA 4Y6GA 3O6LL 3VH8B 2BVPB 3G1XA 4MYWB 4NKOB 1BFNA 1UATA 4F8OA 1HIZA 4L6OA 4QEEA 4IQJA 4ZNEE 5M17A 3KPMB 2F53E 1ND0B 4EOWH 3BVNA 3P3YA 5B1KA 2OK0H 4OLWL 1A4KB 1TSIA 1SM3H 4WI5A 3B43A 5GGRB 3WJYA 1FWGC 5E1AB 3ATAA 3TURA 3X3FH 3MNWB 4ZEPA 3QUKB 4HCRA 2YZRA 5KTLA 3LDBC 4J7RA 4DF2A 4ZQMA 5ALBL 3ZT5A 4LLQA 4POCA 1G0YR 2NW0A 2DJUA 5FWQA 2QMJA 3SR7A 2ZOWA 4CSZA 1HW6A 3L3KA 2ITDA 4ZFFA 4UTAL 2WBJD 3O2WL 2H9GA 4UILL 2CJSA 5DJYB 3WLNA 1F45A 3RX8A 5ACMA 4YVNA 5IOPB 1KTKE 1P6FA 1QPKA 4P4KC 5TDOA 1M9WA 1JFXA 1EWEA 5HNUA 4OQTL 1OHZA 3SQOL 4O02B 4ZTXA 4Z7WE 4A6YB 2AL2A 3VFWB 2IBZX 2R2EB 1CE6A 1U3HB 3UZZA 3CU7A 1MHEA 4FTDA 2OJPA 4J4PA 3VXQB 3WN5B 3LGGA 2E9GA 3QUXB 4ODVH 5DZJA 5F0LB 1PFOA 4IBQA 2QVHA 4LSDA 3OVUB 5F89A 4MDIA 3H7BA 3SYPA 5IWLC 1KJ2L 1I7RA 1G0CA 3H53A 4R4BA 1PYMA 4EVZA 3MNVB 5FF3A 3GK8L 4PRBA 4J1UA 5FUOH 3EHBC 4UOZA 3CK0H 4TMBA 4PRPA 4UT9A 4UAOB 4H83A 2EYSB 5IMLB 3NIGE 3C5ZC 4I0KA 4BHYA 1DJWA 3FFCE 3NCEB 5C2CA 3N17A 2QDGA 4MXQC 4IOIA 4NO3A 4FKEA 3KWWB 3VXUA 4PRPE 5L0QB 4JN8A 2A74C 2NY7L 3KP1A 1SDYA 5ABEA 2J1XA 2WWKT 5F9JA 2XG5A 1HQ4B 4WFEE 4G80A 1L6PA 1WBXB 5L8JB 4S1DC 2VW4A 3N1AA 1OK0A 1SDDA 4OZIE 3P4LA 2XWXA 4WSGA 3VWKC 3GU2A 3ZS4A 2VITA 3V0AC 3WTVA 4HAFA 3FB6A 5DJZA 3D30A 4XBPA 2VR2A 4UTKA 1KZQA 4P2OB 4WJXA 3UZYA 3FU7A 2OMYB 3WK2A 5MKGA 3SKOA 4IU2B 2HNEA 3B0UX 4MVBC 1AO7B 1QZ1A 4D0DB 1JHLH 3NFPA 5AVUB 2DYPD 1Z9MA 4K9EH 1WZKA 4N20A 2AEIT 4Z3JA 4DVRL 4LF3B 3V5HA 5J56B 3R06B 2FB4L 1KTRL 1S3TC 2DTMH 4M5ZL 3VM5A 5I0XA 3ZMNA 4PRHB 2GSGB 4ZPTB 3FA5A 3GLCA 3R1GH 5C2BL 3TW9A 1QNIA 4YSQA 4KRLB 1GPWA 4YUEL 3UOAB 5JOPD 4Y4KA 2ZA3A 4NJHA 4YHNA 3PTDA 4ZMYA 4YIWA 3NQEA 3ZE1E 3EHBD 3Q6GH 1M9HA 2PRLA 3Q8BA 3OC5A 4NKDB 3DPBA 3CZNA 4NZ3A 4JS3A 2BNRE 4JQIH 5BPPA 2EZ0D 3ABLB 1W80A 2MCPL 5C0RL 3MYZA 4IRSA 3R58A 4NENB 3S7GA 2EH8H 2WOQA 2YLHA 1ZVSA 3ZE1B 1X7FA 4RXGA 2NVDA 1W32A 4PTTB 5L9DH 1H62A 2UV8G 1OAUH 3ATDA 3ISRA 1HE7A 3M17A 5CBAA 2EPKX 4H9XA 1EP2A 2WY3B 5DR5H 2Q1EA 2J2ZB 1RFDL 1P1XA 2BSLA 2EIZA 5CZXC 4QS5A 3EOUA 3AWGA 1S9YA 2V38A 4RZ6A 5CZTA 4GFIA 3HLAA 1R33A 3DGCR 2CGRH 2X2UA 2YBRA 3DIFB 3QJSB 2OM5A 3T2NL 1E4MM 1ZGLB 1H0GA 5JBEA 1M05B 1N6VA 3D18A 3UIYA 2XN1A 4EOWL 1YBQA 2AQQA 4NKIH 3ARGC 5D2LE 1PKLA 4POYA 1OCNA 2A3CA 3EPOA 2OCJA 4LC6A 5EU4A 5CGMA 4JB9H 4WO4C 1GW9A 1HFBA 3P1VA 2UWEB 4YL4A 3P3UA 5KVFE 3NM3A 4XBKA 4KHTH 5CEZD 2XUCA 2OJ1A 5FLVA 2EKJA 1NC4B 4FL4B 5JDJA 4AIXA 4XN2A 2ADAA 3UPAA 4PGBB 5SWZE 3GWJA 4Z3EA 3DFYA 2V9DA 2HX9A 2VWEC 4UTIA 2JKAA 1A6PA 3AMLA 4BRJA 3JR2A 2ZZ6A 1YPZE 2IQ0A 5B1BB 3ASWA 1CVRA 3APNA 2ZXWB 4TVPL 3PB2A 1R7AA 4R0LC 1QHPA 3QR2A 4GNKB 4OCSL 4WWKA 3HF3A 1V55B 2C1OB 4JB9L 4IOSA 3D87B 4L4TB 4MD0B 4BH7B 2HVNA 2J79A 2VWSA 3F7JA 3LHUA 5JHLA 1RCQA 3I9GH 5EZLA 1W3KA 1ZIAA 3MYJB 3GR7A 3HE7C 3MODL 4WW2F 4N6EA 4YGAB 1P6BA 2PO6B 2WN3A 2IWKA 2OXGA 5JIMA 3WDQA 1TJGL 2NSQA 1ZHBB 5LXGH 2AXGB 3I02A 5IBXC 1AGDA 4MHHG 1L9QA 1MF2L 1QKZH 2VLKA 4NRYB 1T7WA 3ECUA 3VUAA 1JWUB 1YLBB 5IVZA 4PJEA 3HN5A 6REQB 1PJWA 5HVHC 3XISA 4NZ8A 5CEYB 4I77H 1P4IH 5IB1A 3OPZH 1XM3A 4ML9A 1AUSL 2H0EA 5AYXA 1YCSA 1A7BA 3H26A 4PRHA 4ZPTA 4XX1G 1T2QL 4TNVK 2V2DA 3M4HA 3PWGA 3FRUA 2BVDA 3AZTA 1GWJA 2F6KA 2PP1A 2EC9U 2HPIA 2X1SA 4XCNB 4X0VA 3KPTA 5C0JA 1W15A 4X4XB 2PCFA 4N2NA 1I8KB 4OF0A 2Q8XA 1MRQA 4XBSA 4LFHG 5EBMA 2VRAA 1EX1A 1GQNA 2PO6A 3INOA 2WYHA 3L08A 3L9CA 1Q2SA 1OAZL 1IYXA 1ICPA 1KQYA 5E5LA 3O15A 3O3AB 4QJ3B 4FSAA 3NP3A 3SO3C 3DFPA 4CU6A 3GDTA 4MKTA 4AD3A 1TWSA 1V10A 3ZR6A 2BOBB 4PE8A 2VQ1B 4G6JH 5T1KA 2K3HA 1AZ2A 1JGMA 1NPUA 5FESA 2IPUK 4PB9L 3LOWA 4IT1A 3TXVA 4G5ZH 2OQHA 1YEKL 4UILH 3QXAA 1F05A 3JWDL 4KEMA 1AIZA 4Q4EA 2DQCL 4QRUB 3AUJA 3CLFH 1A80A 1C91A 1ME7A 1R3LA 2Y5SA 1PKQE 3NCMA 3PZGA 4BCZA 1QCWA 5DHMC 1J48A 4D7PA 1VZWA 1DR9A 3O3EA 3UR7A 3GJFB 3NESA 4LCWA 5K1JA 5I1IL 5I1KH 1XV8A 2VXQH 4H7ZA 3ABXA 4L9DA 1EX5A 3PK7A 4OVXA 5EB9A 5T5NG 3RX5A 4Z7OE 4ZB5A 1IGFH 4NQCD 4B3EA 1H4PA 5DJXB 1NOUA 3UTSA 5MEOA 4LPVA 5TDNA 1B4EA 1CD8A 1UCBH 4MSWB 3BSGA 2X4OB 3Q2NA 3ARWA 4RGMB 1AXSA 2A6DA 3CXHK 3F4WA 1G4PA 5BJTB 2ZUYA 2VR8A 3BKCL 4UQ3B 3WKPA 3DG3A 2UWEE 1JZDC 3BVXA 1TZOA 3MLSL 2H3KA 3FTUA 3V9CA 5K9OA 1GVEA 5FOJA 2Z2BA 3RZWA 2F7QA 2J6EH 5IDIA 2VC2L 1WWWX 1E4IA 3KPRD 1UFGA 1INDH 1YPXA 4RZBA 3QC5X 3EDDA 4ODSH 4OR1A 1IIHA 4G6CA 5C0CB 3VQ1C 4UQ9A 1A4KA 2H0FA 2L8AA 2SEBB 2C3GA 4ADTA 1JZ6A 2R59A 3CDZA 3FO9B 4XK2A 4LPWA 12E8L 5KVEH 2PBOA 5F2MA 2EEFA 3LS4H 1IKNA 1XF3B 3OGCB 5ECGA 4HQQH 2VXTL 2AXHA 7FABL 5F2IA 2GG1A 2C91A 4ZO8A 2VKXA 3GYRA 4OSUL 4MJ2A 4PJ9A 4AG4H 4HHLA 4WOQA 4OUUB 4P05A 1YECH 3CN1A 3TCLA 1FZOA 3EX3A 4JTRA 3W88A 1QK2A 2HPOA 4G7FA 4R7JA 1N82A 3CJJA 5MKGB 2ZG3A 1R5IA 1F11B 3B8TA 1EX0A 4L1DA 5AVQB 1RFDH 4WO4A 5IM7A 2A3HA 3ARZA 4PV1C 4QR6A 1IBBA 1JI2A 4LP4A 5CUSH 3W28A 1T5XA 2ZE0A 2V5KA 3L2LA 4X5XA 1ACYL 5SWSA 2XKSA 5K59E 1CGTA 3G1SA 3WHE1 3CNYA 1HEZA 3T0TA 2RBLA 3D47A 2JKJA 1TXKA 1IWPA 4UR8A 5E4EB 2AVFA 4MA8H 4QRRD 3V9FA 4JQAA 5AHLA 2C3XA 4GG6B 2P80D 1OT4A 3GUFA 3EA2A 3VNZA 4G6AC 4QRSB 3T7VA 5HY9A 4UT6A 2JB6A 3QG6A 1HHIA 1JV5A 1KB5A 2XVGA 1J8RA 4WK0B 3NO1A 3Q5OA 4WI7A 3W4RA 3HR5B 1SQMA 3MRGB 1ISWA 3OBKA 4NJAL 4KI5F 4PJFF 3AXXA 3H12A 3C5JB 1SFHA 4AMKL 5KZCB 4V1YA 1E4KC 4CDGC 4UQAA 5C0EA 3DIDA 4Z0BH 2VQTA 3DARA 4JM2A 4Y1AE 4UTAA 4F24A 3JVGA 4EDWH 4JZNA 3GHRA 3P2BA 4Z7UE 5EO0B 4OZIB 3DAQA 3ORWA 4LLUB 4GRMA 2A2QT 3N40P 5B8CC 3CH0A 4GI6A 2J88A 3TBBA 5INDB 3VFSA 5KYUB 1DBJL 3GSRA 1R1CA 3MRGA 4EUPG 4GKZB 3QUYA 4BCEA 3MGOA 5E9DD 1LP9F 3BD5A 3Q01A 1Q7ZA 2PR4L 5HY9B 4QXTA 1ADSA 3GFZA 4OV9A 1DQQB 5K2ZA 2HJLB 4ZENA 3ZE0F 2I60L 3H3PH 4ABQA 9PCYA 1FVCA 1VAHA 3CFBA 4HIXH 4IBWA 4YNGA 2NX5A 1PKQA 3VA6A 5AG9A 1AZNA 2PO6C 3BOXA 1ZK5A 3B9VA 2AJVL 4MMZA 1GGIH 1GSKA 3VXMB 2ADYA 3W23A 1E9QB 3KPNA 4N0UE 4NC1E 1K85A 4LDEB 3RYSA 1T0NB 4FF5A 1YEEH 3ARRA 4L1BA 5E9AA 3BLOA 1U1HA 4P3WA 2XQBH 1XH2A 3KHJA 3SB3A 3KBMA 1I1YB 2EE2A 1HJVA 1K9EA 1UPMB 3U5YA 3MU3A 2A0LD 1LF1A 4QHLB 3D0CA 4GRWE 3QC6X 3WBDA 5HI5C 3CHEA 4NUQA 5HYJB 1E70M 4S10A 4UT6L 2J7FA 1D7FA 4ADGA 1KOAA 4KKLD 1O75A 2ZX9A 2NY6B 5DMIL 4AXNA 5FHBL 1AD0B 1NCWL 2Z7WA 4R90H 4FLHA 4XOEA 5KSBB 4RLDA 1GOKA 1IT8A 1OYCA 3I68A 2ROYA 1NBVH 4JM2D 1QI2A 4YCPA 1VFMA 1A4AA 4RGND 3HFFA 3DBPA 3FPYA 5EWIL 3STLA 4K9EC 1WZAA 1J7VR 1XLAA 3NL3A 4BH8B 1W6WA 3NQ2A 5FI8A 4OV5B 3S0CA 3MRQB 4B91A 4YXKL 1EVUA 2PUZA 1KIQB 1U4FA 3EOTH 3GM0A 5T3ZE 1FVPA 3BAEH 4UOW0 1JE6A 1TIWA 4LEOB 3VUSA 1MAMH 2ZAHA 5AW4B 1SMDA 4IQDA 2K1MA 3DFSA 3EJYD 1G4RA 2UZXB 2Y6TE 4Q74A 1C5BL 1JOIA 4B5WA 4Z1CA 3QBTB 4QS6A 3D06A 4JG5A 1S2EA 3BAIA 5KVFH 4FXSA 3G5YB 4CNUA 2FLRT 1XDJA 1FFNB 3CQIA 1FL5B 3VQ2C 1BF6A 1W6TA 2BB0A 4NQ1A 4EI6B 3ESNA 4JFHD 4I3GA 1RBAA 3VOHA 5I6XB 1IKOP 1NDGB 3WE6B 4X9IA 2E6QA 4OHQA 2RQ8A 4ZO7A 8XIMA 3OJ2C 2ZWNA 4DZBA 4L4MA 4UOQA 2QF7A 2B7DT 2WVTA 2WQPA 1H5BA 1YEHL 3CPUA 3O45B 4AF0A 5BOEA 4NO2A 4H6KA 3OKDA 3K4ZA 3LKOB 3N44F 5KSUB 3VILA 2PR9A 5FM4A 2NQ9A 1IEAB 3G18A 1VIZA 3HPLA 3F1QA 2PABA 1A2YA 4BZYA 1BSLA 4U1HA 3DG7A 1DE6A 2A1WH 3LKNB 1PEZA 1O9VA 3UWWA 2CBQA 1TZHB 4L2LA 1RIHL 5DRXB 3U46B 3EJPA 3T4AA 5ABTA 4Y1SA 2XFFA 2BPBA 1U8HA 2H6OA 3FU9A 4J12A 1IAOA 2P5EA 4PJDB 3UJIH 4EXKA 4Y2DA 4Y19A 5IQ9B 4G5DA 5L88L 3QXVA 4IKJA 3T78A 3C0QA 2OODA 4PIBA 4BY3A 4QJ4B 1PBYA 5EU3B 2IH1B 5JH1A 3ERPA 2CE6A 1UD8A 4B5ZA 2QGHA 3PJUA 4MMYB 4UT9L 5L7XL 1KFLA 4MNKA 4G70B 3PHAA 3ZVHB 2E7CA 2ZTJA 4Q14A 3SGDI 1TZHA 35C8L 3HR6A 3SQBA 3CL7A 3CWHA 4U6VL 2EDYA 4LV4A 1NEUA 4K8EA 1LE5A 4KI5C 5AW0B 1A2YB 1JV2A 1MNZA 1XG4A 3BQ6A 4FP1A 5JH2A 4MCZA 1PHQA 4KO9A 3BPOC 4K8RH 3UTZA 5I15L 5LG6A 1XICA 3KZSA 5KN5B 4Z8FL 3PZTA 3OVPA 1YX1A 1JHTA 4FQIH 3JTTA 4O4YH 1JGEB 3DXAA 4NZTL 5ABZA 3WUWG 3M41A 1KC5H 4GYPA 2V9TA 3T2PA 1D6VL 2BSBA 1FFOA 2JK5A 2VE6A 5I1EL 1K9TA 4UAOC 2HQAA 3WBYA 4N2IA 5IVXB 5AG8A 3WQFA 1SXBA 4H4NA 5DUPH 1ZRUA 3PTMA 1CG9B 2YCEA 1H7OA 3CEPA 1TMLA 3HW7A 1E4WH 3OHMB 3KS6A 3NIDE 5AWNH 3QFDA 1SFDA 2K7QA 4UB0H 1JTTA 5I0WA 1MWAH 2PXYD 2OZ0A 3UP8A 3WLQA 3MRBA 1B0GA 1IRAY 2PCEA 4WJEA 2FJKA 3QYQA 4Q8TA 3EO0B 4S1FA 4FABL 3MMTA 1ISYA 4B5UA 3GXPA 3UTPD 4FLSA 3GZOA 2IVFC 1G7HB 2DF3A 4Z6AT 3G6DL 4FKHA 1UW9A 2XFYA 3GH4A 2C9RA 2PKDA 3T08A 1H6EA 4YFLF 1UA6H 2I16A 5TQLA 3AZUA 3HUJF 5EEYA 3TCXA 4E9RA 3WH7A 1AGBA 1MHCA 3EYFB 3FQNB 1WB0A 2XWRA 4LBEB 3HPSA 1RU9L 2IQ9H 1AOHA 1XYMA 4LUSB 3TW6A 2Y5TA 5K9DA 5IVXA 4N2MA 1U93B 1DVFA 1DQVA 1P9MA 2X38A 1IE7C 2J6XA 2IFFL 3Q8AA 1Q4WA 1XF1A 4LARH 4GRWF 5MERB 3SGKA 4M61B 1G67A 5KOVC 2VENA 3A24A 4GW5B 1C90A 4NZTH 5DS8A 1O4UA 1TWIA 3BG9A 5LDSA 2K70A 3Q43A 4JFUA 2CM6A 2E56A 1BPVA 2CIPA 2ZRZA 3BWZA 1G6CA 4GMTL 3DMMA 1WUFA 4WO0A 1IM9B 1KENH 3PGCB 2WLLA 2CDEA 2DLGA 2CG9X 4ICXA 1S9YB 4Y2OB 5EZJB 1YEIL 1XAKA 1IL1A 1OAQH 2BNUB 3VVWA 4DH2A 4D6JA 1HTIA 4ZSOA 2IPTL 2VMEA 2B7NA 4LLAA 4HKXB 2YIHA 4E2OA 1TMQA 2NUXA 1TTFA 4GAAA 4KJPC 4ZW6A 3VX1A 1VFTA 3MJGX 5H1WA 2ENJA 2VUOA 1GKOA 2A3EA 4LT9A 5XIAA 5IFJB 3GXFA 1NMBH 3O8XD 3O2LA 3WDHA 1BECA 2VERN 4GUPA 2VR6A 3NQBA 1LLWA 4UM9D 3WLPA 3ABQA 2GI7A 2VXVL 1WG3A 1NQBA 1ME9A 4KK8C 2ZKHL 1O68A 3FUEA 1E42A 3O4LA 4OZGA 1D5MA 3PWUB 1A7QH 1HIMH 3CSPA 4F3HA 1Q94A 1X3DA 3IDXL 6TAAA 4PP1C 3SBQA 5IDZA 2WLZA 1RVGA 5C07D 3U82B 3EYSL 1PF3A 3UO8B 2IAMD 2PDMA 3UG5A 5FGSA 4IOFD 3W75A 2NUTA 1GOXA 3B4YA 4ZFZA 3OJMB 1YUKB 3BRFA 1MIML 3LPWA 3RDTB 2FWSA 3AYSA 4NNBA 4IGSA 2IUZA 2VDQH 3E1F1 4Q2ZA 3MBFA 5E6IA 1AIFA 2H3NA 4FXRA 4Y8EA 3BEVA 1JGLH 5K1NA 3UADA 3HPAA 2G60H 4JNYA 1TA3A 3VXUD 3MO1A 4L1HA 2Y7OA 2NY0D 3BWAA 3FT3A 1VZIA 4POZD 3ROOB 5EIVA 3WO4B 1WUNT 3TVMA 2ICWI 2VABA 3S88H 4LWWA 2HUEA 3DTXB 1YNKH 4PJ7E 3O8AA 2FYYB 1XTLA 3IFLL 2G5WA 3CSTA 1DE5A 2YMTA 2XSBA 1YDNA 5HHPA 4XAPA 1PO9A 5JLZB 3D5HA 4BQ6A 1EHNA 1Q7QA 2ZWLT 4LCCC 5E5CA 1WZMA 1IO4C 1B2YA 3KXFA 1V02E 4QJ5B 2YA0A 4LEOA 3QISA 4UV7L 2C26A 2J8FA 3JVFC 3OJDA 1IGTA 3SYCA 4CA4A 2Q02A 4YHOL 3MRQA 1W5PA 2Q76A 3QUHA 5D7JD 1GZJA 1Y18A 3VXUB 2H32B 2UY7A 3TQKA 1NC4A 5CF3A 3CCHA 4WGVB 4RAVB 2JJTA 5ACZA 3SDYH 1EJXC 1WDRA 5GVJA 3TX9A 2QQKL 5CO1A 3O0RL 3G1RA 4CNNA 4OCRL 2FSDA 1FCCA 1RXOB 1ZVYA 2WW8A 3CC5A 3ULUH 2GW5A 2OBGA 2Y9RT 4WFHE 5LBSH 2C19A 2JCWA 2NY4D 4F48A 2IIJA 4RIRA 3TA3B 3RRQA 4AUJA 4HA4A 2QQLH 4XN1A 3F2DA 2WJ5A 1QFWH 4XBEL 4PW4A 2VC2H 4L1GA 1EXGA 5A8QA 3E0VA 1INDL 3T0EA 2XGZA 4TSBH 3GNOA 1JN6B 4OCWH 2QHRH 4DWSC 1IEWA 1OCBA 3QHMA 4BZ2A 2F7RA 1Q9OA 4ZW7A 2J55A 4BDVA 3W7MA 1UT2A 4FTVD 4U4IA 2C1IA 1T0NA 4IRZL 4ZS6C 1T41A 2E67A 3PPFA 2CZ5A 3V0WH 3V0SA 3B9AA 1H3UA 3KLLA 2JV6A 1JI1A 1YPZB 2OB3A 2CO7A 2CXEA 3WFBH 3TVMD 3C2YA 5C3TA 5AALA 5B3NA 5F8RC 1EYWA 3AVEA 3BE1L 3GHEH 1V6VA 3TT3L 1PY4A 4ALAL 4ZUWA 2YK1L 1EEXA 3PWPB 2OL3A 2D4DA 3B4UA 3A12A 2QIIA 2AKRA 4WEUD 2Q3RA 4DY1A 5DN1A 3VNJA 3QH3A 2H8ZA 1KNOB 4GT7A 4UI2A 2KLTA 4G7VH 4LSPH 5F7LB 4IMAA 4Q8QA 4KKAD 1HILB 3O0RH 4O2CA 2G9HB 3K0YA 1I3RB 3VE0A 5I8OL 3BARA 3C5QA 1Q6EA 3BZEB 1FDYA 4G7EA 3SCMA 1MFBL 2V5DA 4JRXB 1X1NA 1TETH 5EV7A 2Z26A 5H8MA 1U8OB 3EGJA 3J27A 1G0XA 2UV3A 3FTZA 3WFCL 3WK1A 2NCEA 4MFEA 3DX6B 4AQOA 3MCYA 2VDLH 3PFQA 2X4NB 1X98A 4MNQA 1H11A 1RULL 3LZLA 1XINA 4JTLA 1XMWA 4AG0A 2F58H 2G9KA 3C87A 3QG7H 1J9TA 4NZUL 4IW4C 5D96C 2O6EA 1RJQA 4U0QB 2Q8ZA 5K4ZA 4FNRA 3WLHA 3ANVA 4N24A 1J18A 3FQWB 3KS0H 2MOQA 2COQA 5D1ZA 2D0GA 5D7IA 4D8OA 4AWTA 3LHZA 2VCCA 1VF5C 3QR0A 1BZQK 4XPBL 4RGOL 2LT9A 5E51A 3GDKA 4PYHA 2PMQA 3VIFA 2WWCA 2CETA 1LNUA 4M00A 1OL0A 1CL7H 3LIZA 4ODTL 2HFFA 3AJ7A 4CVXB 1EGMA 1GHFH 1NU5A 2ICES 3I10A 1M7OA 4UFKA 3T44A 2X09A 3UH8A 5I16B 4JY5L 3BUYB 3BAKA 2AAMA 2GBTA 3H3KA 5E8EB 3MV11 4GXMA 2VJ8A 4JO3H 4M8UA 1QJWA 1OC6A 1HC1A 5E93A 1R3TA 4UF7C 3MV01 4NSKA 1IEHA 3H6JA 3BAJA 1OCWH 4PRHD 3AHTA 1OT1A 2GBUA 3ZT6A 1XI3A 1I2NA 3VWJA 2VLRD 3BQ5A 1SJDA 3FHAA 3M1BA 4PBDA 3MO4A 1JCKA 4G8TA 2PP8A 4OFQA 5DXXA 2PWEA 5F6IB 4ZDHA 1X5FA 3CDZB 5BZZA 4F7PA 5LCVH 2X1OA 3OV6A 4EZJA 4GUOA 1AGDB 3RBSA 4FIRA 1QW9A 5T1DL 3LDVA 2F1BA 4WGXA 4CMHC 4GQZA 5D1ZC 3FT1A 3F58H 4XXWA 5LO7A 1J5OL 4XP9L 2EE9A 5IHUH 2DZXA 5AECA 2E6FA 1JQVA 3D5OF 3M6YA 3UTQA 1LL4A 3IFNH 1BAWA 3HC4L 4L4LA 3EGSB 2XX0A 4PBGA 3Q0HA 4FA8A 4H0IA 3ARVA 4EI5B 43CAA 3L95B 2UZIL 4PWGA 1D5IH 2RHEA 2A0NA 4PH6A 5C08B 3LXBA 1DTUA 1JPMA 2I57A 3OA3A 4UNIA 3FO2A 2YPIA 4GA8A 1JWSA 2K4AA 1FWJC 3K72A 4ZS6D 4AEIL 4DGYL 2H2SD 2ETWA 2GK1B 4NQEA 5K9KA 3NOEA 4XBJA 3TLRA 1OX6A 4EIVA 2NT1A 3IJ8A 4RIRB 5L4FA 4Z7VE 3C8DA 4J2QA 2PRMA 4GOAA 4W89A 3UESA 1JJKA 3MREB 3MRFB 1BAFL 2QMKA 4J2PA 3QGVA 3KPMA 2VXQL 3S42A 5GGRY 1OCWL 3BEWB 1D3CA 5FC9A 4Q9RL 1KC7A 3IIZA 5IB2A 2ICEA 1DSFL 2WC4A 4PMUA 4G71B 2IQAA 5ITBL 1G7PB 2Y36L 5I73B 3QZWB 3NCCB 1QSEE 1TKKA 3QDGA 1LORA 1DDTA 1LQ2A 1EPXA 2PGEA 1BVNT 2ZWYA 3NZHH 3LZRA 5T1KB 1A7RL 1HEHC 1BFOA 1QMLA 3HNTH 5C09D 4BGDA 3GINA 2ZP9A 3H9HB 1W17A 3ID7A 5D7JC 1GIGL 3AREC 4GP8B 4NDMA 1EHKB 4L64A 4OZOA 2Q76B 3DROA 1V7ML 4LHUA 5GS1C 1BRLA 3P81A 2E47A 1GVIA 3N42B 4TOQA 4GKSA 4QOKB 3JWDC 1RZPA 1QFUL 4PJXF 1KTLB 3T07A 1JIBA 4HIIB 1UZ6E 3U7YL 2GY5A 1L3WA 4GXPA 2H26B 4IBLT 1TLKA 1HL4A 1FO0A 1TYEB 2FNBA 3JWOC 4K3DH 3V6OE 1I7TA 2YD7A 1AD4A 2VLJE 2HFEA 3BLKA 3CHPA 4K3JH 1VFAB 3H7RA 4JJ5B 4ONGL 2AV1A 4WWKD 1L6YA 4R4FH 3LMJH 3UERA 2QQ6A 4YPJA 5JIHA 4X61A 1AMXA 4P07A 4HUWB 1TETL 3L5IA 2GSGA 2VISA 3L2NA 4LB8A 4XPHH 5GS0D 2V9UA 3IAGC 2FK9A 4I18A 4H9VA 3LK6A 6REQA 3ULUD 2E6AA 3ELAT 5FJRA 1MUWA 1V6UA 3NT0A 1W2PA 2LU7A 4HTYA 2ZRXA 2OO0A 3H2MA 3BKJL 4IMKC 1BKHA 1BSIA 1GYUA 4XMZA 3U25A 3OMZA 1OB1B 4NFDA 1ROCA 1JULA 3W1AA 1D5MB 3PWUA 4TUJA 2FQGA 2YHGA 3NQFA 3NZQA 2X1QA 4G1KA 3PUUA 3LLXA 5I74B 4F5CA 2E6PA 1U41A 3MNMA 4MAYB 4XP5L 5J1AB 4E0RA 4L7ZA 4YL2A 5I9QC 3V36A 5I5JA 1RUML 3N41F 1LO0H 2IH1A 5DJAB 1B88A 2EIJB 2UX6A 4YEEA 4X7FC 1OCQA 3MRDA 4LKCA 4ZUSB 3CEUA 1SUXA 2FQEA 3QUYC 5A8PA 4XMPH 3T4WA 1SU5A 4D0BB 1UWUA 4BZ1L 1TWWA 4OT1H 2BP5M 4JEGB 4NO3B 2VGBA 3WEXB 4P4RA 2VRJA 5E2WL 1K5NA 4KO7A 4HCIA 1OIOA 1PZSA 4FFYL 3TO2B 1BZDA 1R34A 4M6MH 2ZVRA 4JR5A 3MCOA 1YYAA 5KWYC 2OZNA 4Y2NA 3FQ1A 4AVHA 1BWKA 1HP4A 4CC4C 1MHCB 4C5YA 5CBEB 1S46A 1P7HL 3VNMA 3SPJA 1A65A 1NFDF 3IJHB 3WEAA 2WCGA 3M1CA 2ZP0T 5C7VA 5JQIB 1SEQL 2W65B 3N0AA 1MG3C 1P4CA 4EI6A 1MCHA 4DK5A 2O5ZH 4F0HA 1KBJA 4EK7A 2RIKA 3L8QA 1EAQA 3M0YA 4ZR8A 5B7YA 5C0NC 1O5PA 4G7RB 3RL1B 4HB7A 1OSYA 3EYOB 3TWYA 4AIUA 3FO1B 1IJ9A 1M7IA 4MJID 1LO4L 2FNWA 1YE4A 2GIYA 2PAJA 5HMEA 4HK0B 3L9BA 4L9LA 1LWRA 4LBSA 3NVQA 1OSZB 1GKEA 1GMEA 2ASHA 1FG9C 2NSMA 4R83A 2EJAA 4P5SA 3CWNA 2RH0A 1NCCL 4GB9A 2P52A 5DHXB 2VUNA 3MLTB 2MHAB 4M1BA 3VAEA 3FO0L 5DO2D 3LS5H 4CC4A 4RRPG 5J9PB 3HS0A 4GH1A 3W2UA 5BNXD 2V67A 2GJ6B 1CFSB 5GQBA 2UZIH 5JPMA 2P50A 4ECLA 2AEOA 3IDGB 2EIMB 1BQHG 3TZVC 2NX5E 4RZCB 4G43A 5D7KE 3WE1A 3VMPA 2YMOA 4MCZB 3AM8C 1NQ6A 2AJ3B 4FHAA 1W1TA 2NV9A 4LJ3A 3OD3A 4KY1H 2WMGA 4H9UA 2E9JA 2FJGB 3D09A 4APQC 1E1FA 4LB4A 3PPCA 2W0LA 4IK7A