2XIIA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with an extended 9-fluorenone iminosugar inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 157
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xiiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xiiA01
1CPUA 2PWHA 1WZAA 1KXHA 5I24A 4RL3A 3B9EA 3MV01 1W9XA 3VTRA 4KGLA 1VEPA 1FA2A 3BLPX 3WD4A 3DYMA 2WCAA 2V5CA 1QNSA 3WFLA 1MWOA 2VI0A 2ZX5A 1E1FA 4D72A 3RM4A 4PMRA 2BVYA 3DX0A 1EA9C 2PBGA 4F79A 4CN4A 5A1AA 3H53A 2NT1A 1EGZA 5DO8A 4CKQA 1VFFA 4MB3A 1UZ1A 2VJXA 2ZXDA 2CERA 2EJ1A 5DEZA 2ESCA 1W1PA 4UQDA 1XCXA 2X09A 3TTQA 4AD5A 2PWDA 3WIJA 2GJXA 4Z2LA 2JALA 2E9LA 4D6CA 2WHKA 1R7AA 4QLKA 1CYGA 2XSBA 6CGTA 3WBAA 4AZ6A 3VD4A 2Z1KA 1P6WA 1JAEA 1OM0A 1VBRA 1BPLB 4P7RA 3N15A 1TQUA 3MUZ1 1DTUA 2WMIA 1W9PA 1IZJA 1UD6A 1W9BM 1CEOA 2GK1A 4QCEA 3HU7A 4FLOA 2XGIA 3POCA 2WKLA 1C8QA 6A3HA 3FAWA 1DWGM 1WCGA 3EMZA 4AXNA 1FH7A 4EKJA 2XPKA 3T0DA 3O6AA 1E6PA 1G0CA 1ISXA 3WNPA 3H55A 3GXIA 1HP4A 3AIQA 2VUYA 4P8UA 1KB3A 1HKKA 1QX1A 4EK7A 3M6DA 3D52A 1E1EA 1CWYA 1NP2A 1JDDA 4MDPA 4EANA 2XHYA 3WMSA 5CSYA 3GXNA 2DH2A 1BF2A 5JIWA 4B9ZA 1JXJA 2DIEA 4UR9A 1DWHM 3MMDA 3AIRA 1J01A 2QF8A 4UFMA 5BROA 2DT3A 3BSHA 4R5EA 2FE0A 3D4ZA 1ZL1A 3WUFA 4FMVA 2F7QA 1V0KA 3S6TA 3THCA 1JZ2A 1GOIA 2ZX7A 1J0IA 3CC1A 1LWJA 4BF7A 2D73A 4AZGA 4CCCA 1JYVA 1U33A 4E8CA 1R86A 4PCSA 1NH6A 3D3AA 3TA9A 2J7CA 2F8QA 3T0AA 3MKKA 5FL1A 2DQXA 1ITXA 2VRQA 1GNXA 3VM5A 3KE0A 1FHDA 3SCQA 3KZSA 2Y8VA 1D3CA 1XH1A 2EPMX 2HISA 5FOOA 3AQUA 1T0OA 4LX4A 4TX8A 5E6ZA 2YDQA 3HG3A 3VMOA 2OLHA 3CMGA 4ZXLA 3AYSA 1TVPA 5HPCA 1UASA 2VZUA 1H3GA 3AXIA 2BNJA 5E0CA 3NDZA 1MXDA 1C90A 3MI6A 2AMGA 3FW6A 3W27A 2YFOA 4UFJA 3WN6A 3OIHA 5ABHA 5A8PA 1MQPA 2XYLA 4H41A 1XSIA 2PWFA 4AEFA 3A47A 2BHZA 3MSDA 4KRUA 1FH9A 3WY3A 3ZR5A 2F7RA 1VRXA 1PS3A 4J7RA 2D20A 2FHCA 1JXKA 4PSPA 3VIOA 2F7OA 3FHAA 1E6QM 1RD6A 3PBGA 5A3HA 1JDCA 4QAWA 1BTCA 3LPFA 2J79A 3VIPA 3LRMA 3U5YA 2WKGA 4LQ1A 4Z2IA 2WCGA 3EJPA 1HXJA 4AYGA 3VO0A 3IJ9A 1E0VA 1WB0A 3APGA 4GZEA 2XM2A 4E8DA 3VILA 3N1AA 2VR4A 4D71A 1W91A 1CGTA 3L4XA 3SCNA 1ZB5A 3SURA 1LG2A 3AMCA 2XG9A 4OOZA 1LQ0A 1GQIA 1OGSA 5I0DA 4CD6A 3RM9A 4U2YA 2XIIA 4AZBA 1ODZA 2EAEA 4OGZA 5D8WA 4L4OA 3UR8A 1HTYA 1JI1A 3WD0A 1C8XA 1E6NA 2JF7A 2J8GA 2E9MA 1JFXA 3WQ6A 3F5JA 2FDMA 2ZUUA 2VRJA 5A2BA 1Q6DA 3EDKA 1V02E 1HP5A 3OLGA 2DT2A 1QVBA 2XVGA 5GNYA 2J47A 4UFKA 5ECUA 3ZO9A 3T2QA 5M3WA 3VUPA 3BVUA 3CUJA 1ISWA 1FP8A 3IAQA 3OLEA 5CJ5A 4HMCA 2AOSA 3W37A 1JF5A 5A8NA 1C7SA 5E70A 4HZ7A 3SCVA 2WM0A 1PAMA 3B8SA 2PBOA 1OD0A 4FNPA 1LJYA 4MADA 5FKYA 2JE8A 2QPSA 1XRVA 1XH0A 5AY7A 1B3XA 3T2OA 4PMXA 2WBKA 5CPQA 4C7DA 5A6AA 4H8UA 4M24A 3ARZA 5EBAA 1R34A 3W4RA 2WANA 1UH4A 1LG1A 2UY5A 1H09A 1KTBA 1X6NA 5D9OA 3AMLA 1O7DC 3WY4A 5CXPA 4ATWA 1UWTA 1JZ5A 4AIOA 2X0YA 3NSXA 3BMWA 1WAWA 1US2A 1RPKA 4J3UA 1M7XA 4JFUA 1QW8A 3CHCA 1VFOA 2ZWZA 1GQKA 1Q4NX 1NP0A 4UOJA 1QHPA 1C93A 2GJPA 1UD3A 3AI0A 3BCDA 3CHFA 4M80A 1VJSA 2GJRA 4AMCA 5A2CA 2WVVB 2ZE0A 2XTKA 3UERA 2BV9A 2PI6A 4D6GA 4BCEA 3S5YA 2XVKA 4A4AA 2EEXA 3BC9A 2YIHA 2ZUNA 1B9ZA 4AZ5A 2WMGA 5AC5A 3WENA 1JD9A 2WWDA 4OUEA 1L0PA 4MNJA 3WBEA 3W81A 1NOWA 5E6YA 3AXXA 4TTUA 4UFLA 2CHNA 5JBEA 2WVSA 4L4PA 4HZ6A 2YOCA 1BG9A 3NDYA 4MPKA 3WDQA 3D4YA 3BVWA 1GONA 1CNVA 3AMKA 5DFAA 5BXPA 1V6VA 3ALFA 4DWSD 4ZFMA 1A3HA 3DX2A 2F2HA 4GI8A 3A23A 4W89A 3VDCA 2VMFA 4ACZB 4DWSB 3NCOA 2V3DA 2HVMA 3QR3A 1VEMA 4WK9A 4HPHA 1DP0A 4J27A 2XIBA 2CXGA 2Z1SA 3IANA 1ITCA 4NRRA 2B31A 1JZ6A 2WZHA 3DC0A 3WQWA 5GNXA 5BXRA 3S5ZA 3HG5A 3SUSA 4ZE4A 3WEMA 2ZWYA 1H5VA 5IFTA 1ISZA 1E6SM 3F4VA 4HOXA 3AHYA 4DM2A 1OGGA 3ALGA 5AYIA 4CN6A 1E6RA 3G6LA 1KQYA 2G3IA 1X6LA 3AZTA 3VD5A 3VKKA 2ZXQA 3WDHA 4FNTA 5CG0A 4H2CA 3W24A 4ATLA 1V3KA 1UHVA 5D9MA 2WHJA 1UWQA 1I75A 3NSNA 2VOTA 1XD0A 1NWUA 2DDXA 3BAXA 2ZUWA 1FFQA 1KCLA 1UG6A 4DO6A 4PMVA 4JCMA 4Z2GA 1E0WA 4FNRA 5C70A 4HTYA 1ISYA 4TVCA 2A3HA 3WY1A 5CLWA 3SCTA 1UR8A 2XN1A 5BCAA 2J75A 2PF0A 1TG7A 2FH6A 4J3VA 4HP5A 1OWQA 3NSMA 4W85A 3A6OA 4PMUA 2CBVA 3FHQA 1CXLA 1UQZA 1KWKA 3DX1A 4BS0A 2WCSA 3AXHA 4LXFA 3ZJKA 3A21A 4MJ4A 3UESA 5AYBA 3WL0A 3VIFA 1LL4A 2ALWA 4WSKA 4JCLA 3JUGA 3U5UA 2J7FA 3FXYA 4N42A 3VNYA 2J7HA 1CECA 3CH9A 1BVZA 4D6FA 3GYCA 2J8FA 2DT1A 1UKTA 2CBJA 4YPJA 4GI6A 2C0HA 2CHOA 1LWHA 3WF1A 3FN9A 3S2CA 2OSWA 4MNMA 1Z32X 1SFSA 5IXEA 4GINA 3K1DA 1CLXA 1FHLA 1AQ0A 1B1YA 2G4FA 1WKYA 4GQQA 1JD7A 4H7VA 2WHMA 2VZOA 3QHNA 2WYSA 1TR1A 2J25A 1UD8A 3KWXA 1BYBA 4AY1A 1W3KA 4W86A 4MB4A 3ARWA 3MUY1 5A8OA 4MAVA 3BAWA 3TV8A 1EHNA 3GXTA 1V08A 1V6UA 4JZ5A 1H2JA 4BQ2A 2EBNA 1EDQA 4FK9A 4XV0A 3AFBA 1OGBA 1JG9A 1WP6A 4WJXA 1GJWA 1PJ9A 2WLYA 1QWUA 3EYPA 3MANA 4U3AA 3PZ9A 2J74A 1CXKA 3AS3A 3F5LA 1R33A 2YL5A 2BHUA 3WY2A 1W1YA 3AIEA 3KL0A 5C8BB 1RH9A 1WZMA 4U3CA 2WVVA 4H8VA 3AROA 1TQVA 1BGAA 4PTXA 2CIPA 4A3YA 1GZJA 3UCQA 1OBAA 5AC4A 1XD1A 4V2XA 2D2OA 2F61A 5CSUA 1QOXA 4E4PA 2RGMA 4LYRA 3PZNA 2YA0A 4W8AA 5CQ1A 1NWRA 1H0IA 1VFMA 3NIYA 1PX3A 1EOKA 4GKLA 4P8XA 4NXSA 4NSBA 1H41A 2YBUA 1TVNA 4H04A 1VENA 3QHOA 1JZ3A 2F18A 3BAJA 3WDRA 3HG4A 4QFUA 1G9HA 4MJ2A 1E70M 5IHSA 1R8LA 3DECA 2VCCA 3GM8A 1TMQA 1L8NA 4PSRA 2WK2A 4JHOA 1V0MA 1TA3B 5JBFA 1MFUA 1CBGA 1E3ZA 5A6MA 3W6MA 4WKHA 3G6MA 2D0FA 3AIWA 3AIBA 1E4MM 3CZJA 5HBFA 3BUIA 5DF0A 5KZ6A 4PRWA 5E09A 3WDIA 2CETA 3ECQA 2W62A 4UOZA 3CUGA 2RGLA 1V3JA 3GH5A 3EDDA 2FHFA 2AAAA 3W6LA 5IFPA 1EO5A 3CZSA 1KWGA 3N9KA 4CGTA 2YL9A 3EJSA 4M29A 2C8NA 2DEPA 3CZKA 4FLQA 2WMFA 4GO8A 5CZKA 3NJ3A 4LYQA 4UTFA 4F9DA 1WNOA 4IPNB 4TVUA 2O92A 4RE2A 1XYZA 1MXGA 1CXEA 1WDSA 1GOWA 1E3XA 1V3LA 1B90A 3AIVA 1E72M 3MV11 1HF6A 3WUEA 4URIA 1UZ4A 2YFNA 4FLRA 5I5RA 4P7QA 1UR2A 1MVYA 3A4XA 1UOKA 4MB5A 4RE4A 5I79A 4CD5A 2JEQA 3GH4A 4AD0A 3L2LA 1E15A 4B16A 4JL1A 3AICA 2BHYA 4U31A 3ZT7A 3N04A 3VINA 3WQ4A 1MQQA 1EO7A 4PCTA 2VCBA 3U7VA 2J62A 1EIBA 1OSEA 2YLAA 2QV4A 4PYSA 4AISA 4U5IA 1TE1A 4HA1A 1JFHA 1B2YA 1XV8A 2EPKX 3O2LA 1U30A 3A4AA 4P7OA 3ARUA 2E40A 1GQJA 3BUBA 1CIUA 2WMKA 1ESWA 4RE3A 1J0ZA 4JFWA 7A3HA 2A3BA 1G94A 1YQ2A 1GW1A 1BYDA 4TUFA 4CVUA 4UQBA 3TTYA 3UETA 1E9LA 2JIWA 5A6KA 1JGIA 1AVAA 3LRLA 4NZJA 3HMCA 3NYDA 2XJ7A 3J7HA 4W88A 4GZJA 2W92A 2DSWA 1W2PA 2BFGA 3ZR6A 5A6JA 3GTNA 3KLKA 2WWCA 3AMDA 4P8WA 3QOKA 1VFUA 1B0IA 1R85A 1W32A 4HA3A 1PZ3A 1HVQA 2QMJA 1I1WA 3IJ7A 1E5NA 2CCRA 4UNIA 5BYWA 1QNRA 3BUPA 1IT0A 2FH8A 3WNOA 4BQ3A 3SCUA 3UG5A 4QP0A 1N82A 2XVPA 4GI9A 2YDSA 5EFFA 2E8YA 1E5JA 1OCQA 4J3WA 2DSZA 3WF2A 3CZEA 3CZ8A 4B3KA 1DEDA 4ZEPA 3NUKA 2Y24A 1GOOA 1CGWA 3THDA 1QI2A 1D7FA 2DSUA 4W8LA 3CIVA 1SMAA 3BH4A 3BSGA 1CTNA 3SUUA 5A6SA 3SEPA 3CZLA 3HN3A 4TX6A 3RJYA 2CPUA 3QOMA 2FYVA 2J78A 1BVNP 2EACA 1RP9A 2Y5EA 3K8MA 4DWSC 3BUQA 1WE5A 2EPNA 3M46A 1KGXA 1W1VA 1J0YA 3AIUA 4PUDA 3AJ7A 3VMPA 5BRQA 3LPPA 3IGUA 4UOQA 4J3TA 5FD0A 1LLOA 3DDFA 5HNNA 5I6SA 1Q6FA 2CITA 2CESA 5GNZA 3M7SA 4CD8A 4WF7A 4WLCA 1GHRA 2YLLA 4UCFA 4DUXA 1UD4A 3VIIA 1PPIA 3AS0A 3VX1A 4M81A 1B3VA 2YA1A 1IZKA 2J4GA 3GNOA 3B9DA 3EJQA 1W9DM 3LXBA 3GBEA 4Z2KA 4JKMA 1J11A 4HU8A 2WC7A 3WEZA 1HJXA 1LL7A 1J0HA 3KL5A 1B3ZA 1ZU8A 3VGDA 2DIJA 2WVUA 4J3XA 3TTOA 1PEZA 1E4NA 4S3KA 4DM1A 1W1TA 4PUEA 3WH5A 1WZKA 3HJEA 2OW7A 4AZIA 1M01A 3K4DA 4QLJA 4WKAA 1EQCA 3SUVA 1QHOA 5BRPA 4X0NA 2UY4A 1NOUA 3WNKA 2VVSA 4ZXOA 8A3HA 4NZCA 1VBUA 1UD5A 1K9FA 2CKRA 1XGZA 2FGZA 3I3EA 4XB3A 3N17A 3RMEA 1UYQA 4M82A 4UFHA 2E8ZA 1GOKA 3KLLA 3VPLA 1JZ4A 3CV5A 1HJVA 3RJXA 3PZGA 5D8ZA 3VGBA 3BVTA 2PB1A 1C7TA 3BVXA 3VDHA 4NZFA 4JKKA 3VDAA 4C7FA 1HX0A 4NI3A 2J7GA 1J12A 2FHBA 3RO8A 2XWEA 1Y7VA 3UEQA 1WZLA 5JIPA 3WH8A 4J3SA 2XGBA 4NF7A 2V3GA 3GDBA 3ZT5A 3VDBA 4DWSA 2OSXA 1GPFA 4HU0A 5GQBA 5BWFA 3A5VA 3WH9A 2J7BA 5I2UA 2D0GA 2VX6A 3AOFA 3MO4A 2VC9A 1AQMA 1ODUA 3WELA 1US3A 2J7EA 2D22A 4PMNA 2E3ZA 1PZ2A 1UH2A 5HXMA 1JI2A 4OBRA 2DPEA 1TQTA 4LPCA 1E40A 2D1ZA 3ZSTA 1C92A 4CD4A 4TXEA 1QW9A 1SYTA 2WMHA 1IV8A 3ZM8A 4X0VA 1CGXA 5BXSA 4GO9A 2X8RA 4TTGA 3EDEA 2EPLX 5CPSA 1W3JA 2BY1A 3L4WA 3MS8A 3ZIZA 5GPRA 3WH6A 3RDKA 3BVVA 2X1IA 1H11A 1FP9A 2PWEA 3FY1A 4JFVA 2ZX6A 1UR4A 4UQ9A 1RP8A 3POHA 2WLZA 4QCFA 3MUAA 4AMXA 3E1F1 4A3HA 1BG4A 1U2YA 4KMQA 2Y4SA 2IXUA 3EMQA 2XN2A 4OBSA 4WSJA 3A3HA 2XM1A 3GXDA 1MW0A 3VMNA 4F8XA 1WDQA 3TTSA 1OT1A 2YKKA 4H8HA 3I3BA 5D9PA 3L4UA 1KXQA 1CGUA 3FAXA 2VX7A 4AC1X 3WF3A 1E0XA 3EJTA 1UWIA 4XZWA 2VQUA 3VGGA 4HPGA 1S46A 3H54A 1V6XA 1QWNA 1V02A 4OKDA 2J77A 2WC4A 2VURA 3D50A 3AHVA 4UZSA 2XFYA 1OINA 3W29A 1QNQA 3HG2A 4Y7EA 2ZUMA 3EBVA 2X05A 2DH3A 3OG2A 3DDGA 3ARTA 4KRTA 3PTKA 4IISA 1F4HA 4TVDA 1R46A 4LYPA 4M8UA 2QPUA 4GXPA 2VZSA 1M53A 3VIMA 1BHGA 3QGVA 3VIHA 5EMYA 4D6IA 1LL6A 3GXPA 4PBGA 3VD7A 5ABGA 2NT0A 2BXZA 1R75A 2WVTA 2VZTA 3WEOA 4YHGA 3CBWA 1QI5A 1ZBCA 4WIWA 3VOCA 1A47A 4BQ4A 2V3EA 4W8BA 5DT7A 2EPOA 2O9OA 3AYRA 3TP4A 9CGTA 2NW0A 3CO4A 3WD1A 1KBKA 4CN1A 1UR9A 1OD8A 2BVTA 3AISA 5M03A 1Q6GA 4W5UA 3W53A 3BGAA 1KQZA 2VCAA 4W7WA 4Q7NA 1QBBA 2TAAA 2WMJA 3ARVA 4P7NA 3CGTA 3DX3A 4U5KA 5A2AA 2W91A 1DHKA 1SZNA 3EJUA 3ARPA 2G3JA 1B3WA 1UA3A 3OB8A 1ZBKA 4K68A 3OLIA 1WDPA 3WNNA 2JFEX 5IHRA 1TQWA 1JZ7A 3WNLA 2WBGA 2X2YA 2YBTA 2VVNA 1GJUA 1R47A 3DHPA 5IDIA 4UQEA 2ZUTA 4JFSA 3ZJ7A 3VSUA 1CLVA 3GBDA 3GZAA 4Q22A 1NM9A 1E71M 3PZUA 2ZIDA 1O6IA 1UKPA 3BUDA 3VGHA 3AHTA 4FF5A 1B3YA 4MDOA 3T0BA 4PN2A 2ZXAA 2D3LA 1QNOA 3WMCA 1KXVA 2EO7A 3WKZA 3LPOA 2W63A 4CU8A 1J0JA 4XZBA 1G1YA 4XUYA 3TOPA 3FNDA 4PMZA 1GCYA 4OJYA 1FOBA 3WQVA 2CBIA 3WSUA 2UWFA 1HJUA 3OBAA 3K4AA 1HKIA 1KFWA 1MW2A 3SCOA 4CVWA 4PTVA 3U7BA 3VD3A 4AMWA 4CU7A 2VZVA 2F1AA 2CKSA 3RILA 1CXIA 1E43A 1KGWA 3ZQ9A 1JIBA 3PTQA 3L4VA 2J7DA 4MB1A 2C7FA 5I23A 2YDRA 4AZCB 3WD3A 4BQ5A 2OSYA 3AHXA 4HZ8A 5A6BD 1PX4A 1H0GA 1B31A 4NXKA 1QHZA 3PZOA 1TCMA 5I3DA 2UY2A 5D9NA 3PHAA 3OZOA 3CZNA 3VGEA 1ZJBA 1R87A 3EDFA 1CENA 1JZ8A 1YHTA 1GORA 1UWUA 1QNPA 5FIPA 4UFIA 1K9EA 1EDGA 3BAKA 4AD1A 1C3FA 4OIFA 4AIEA 2ZOXA 1CZ1A 1XYFA 3VGFA 4S3JA 4JL2A 1CGYA 3T08A 1HT6A 4M1RA 5F7UA 4UQAA 1BAGA 4PEEA 2XSAA 2GSJA 4PMQA 1BFNA 5DMYA 2F7PA 2WSKA 2VR5A 1V0LA 4PTWA 3SIMA 2WXDM 1J9YA 1PBGA 2D24A 4GIAA 1EOMA 2A3CA 4PMYA 4EE9A 1ISVA 2D3NA 4OZOA 4AIUA 4P7LA 4MNKA 3VNZA 3SCPA 1UQYA 4ACZA 1UD2A 1UA7A 3LRKA 3DYOA 4AZ7A 1E4IA 3N11A 1W3HA 1FFRA 1PIFA 4D1JA 2WMIB 5C71A 3DX4A 4M56A 5ABFB 3PZMA 1C8YA 1K6AA 3ZJ8A 4FNSA 1HKMA 3AS1A 1CXHA 3OGVA 3AS2A 2EABA 4XX6A 2YL6A 4AEEA 3IAPA 1XC6A 3WUGA 3ARXA 1E6XM 3ARRA 2BXYA 4U2ZA 1WO2A 4LGXA 2XWDA 4V27A 3W82A 2GJXB 4F66A 5DT5A 1FH8A 2XVLA 3M07A 1J0KA 5E1QA 2GDUA 2WZEA 2VX4A 1W2VA 1BGGA 3VVGA 1DWAM 1HJSA 4CD7A 2VTFA 4AZHA 1HNYA 2BS9A 1EDTA 3U57A 2O9PA 3WQ5A 4Z2HA 4JFTA 3N13A 2A3EA 1O7AA 2VRKA 3WDJA 5CPTA 5CLTA 3BLBA 3DYPA 3VD9A 2G41A 2WB5A 3CUHA 1VEOA 4AZCA 2VL4A 4FLSA 5A8QA 2DSVA 3K46A 4ML4A 3QHMA 1GHSA 4HA4A 1KTCA 1D2KA 3KEHA 3BMVA 4E2OA 3ZJ6A 1KR0A 1XH2A 4MNLA 4ZE5A 6TAAA 3BAYA 3VSVA 2W67A 3OLDA 5A95A 3ARQA 2IUZA 1EHAA 1CDGA 3MMWA 3ZSSA 4BA0A 1UWSA 1UUQA 5ABFA 4B15A 3UR7A 1V6WA 1ZBVA 1QI3A 1OIMA 2ZICA 3WH7A 5BXTA 1V6YA 3SUTA 1BLIA 3IK2A 3GNPA 4JIEA 3W26A 4FNQA 3OZPA 4PTMA 4N0RA 2BVDA 1KR1A 1VAHA 2Y8KA 2CBUA 2GK1B 1BSIA 2E0PA 1ZBWA 3BXWA 4YHEA 2X2JA 2ZX8A 3N18A 2WSPA 1XSJA 5HDRA 3RCNA 3EJRA 3GXMA 1TUXA 1NARA 2BY2A 4PMOA 2W4XA 4EAMA 3LX9A 3GNRA 1Q6EA 3LXAA 1M03A 4IUGA 3ARSA 4FNUA 3MU7A 1TFVA 1AQHA 2QHAA 2DGAA 1V3IA 2CYGA 2PC8A 3PZQA 3PN8A 1BYAA 8CGTA 1HL9A 5TD4A 4YN5A 5HPOA 2OYLA 2OW6A 2E4TA 3VSTA 2WNWA 3SUWA 2YA2A 1HJWA 4JHZA 4GQRA 2V5DA 4AD2A 4D6EA 3GXFA 1QI0A 1OIFA 3MSGA 4J28A 2G3MA 1J18A 1JNEA 3BCFA 3A22A 2WZIA 2V3FA 1W9UA 3CUIA 5I77A 2IXVA 1NWTA 2W5FA 1V0NA 1XCWA 1HVXA 1XSKA 4KH2A 4AYSA 2D0HA 3K8LA 2JF6A 2NSXA 4CU6A 1HIZA 3DHUA 2D23A 4W87A 3WUBA 1GOMA 1UKSA 5EFDA 3CHDA 1SMDA 1UH3A 3K8KA 4W84A 3VU2A 3WFZA 1KGUA 7TAAA 4R27A 1TZ7A 4DO4A 3IJ8A 3LMYA 4IM4A 2UY3A 5HOSA 2OWXA 3LPGA 2XVNA 4MAZA 2DSKA 2XFRA 4GPNA 3UG3A 4B3LA 4KGJA 3HZ3A 4WKFA 1E56A 1MFVA 3F5KA 4D1IA 1C91A 3W25A 5I78A 3ZMRA 5LA2A 5M5DA 4CCEA 4HMEA 3OA5A 2O9TA 2YL8A 5EB8A 2ZUSA 2MANA 3A4WA 3VIKA 3W0KA 1H1NA 3WDPP 3RPMA 5D4YA 1HJQA 4TOQA 1H49A 5A69A 3CUFA 4Z2JA 3VM7A 4ACYA 3W28A 2EADA 2XFFA 3WMBA 1NQ6A 1VIWA 2XUCA 3SCSA 1GQLA 4B9YA 4P8VA 1M04A 4AW7A 1JYWA 1ZS2A 3WF0A 2E9BA 4ATDA 4GZIA 4PMDA 1OT2A 5A94A 2G3NA 2Y2WA 1XHGA 2WHLA 5LA1A 2A3AA 2ZX9A 1JAKA 2FGLA 2Q8XA 1J10A 2W66A 3ARYA 1AMYA 2OWWA 1OB0A 3D51A 1ECEA 3AMGA 2WC3A 1UKQA 1QPKA 1UR1A 3CPUA 4MTVA 3T09A 5CGMA 3D5HA 1CXFA 2QLYA 3OGRA 1HXKA 3L4ZA 1SR0A 5A6LA 2JEPA 1JF6A 2QMKA 4BZYA 4UZUA 3AZRA 2IGTA 3WD2A 3KL3A 5E0FA 3CLWA 2W61A 3EDJA 1DWFM 2X0HA 1EH9A 1WPCA 3CZGA 4UQCA 5E9AA 3GH7A 3L4YA 3BLKA 1I1XA 1V03A 2GDVA 2GFTA 4V28A 4D6HA 1V3HA 3B9AA 3WF4A 2V38A 2WAGA 1JDAA 2WW5A 3PZIA 1JYNA 3CHEA 1Q6CA 3W38A 3PZVA 4JAWA 5CGTA 5LYRA 1MQRA 2BY3A 1E73M 3WL1A 1W3LA 3WQ8A 3LXCA 3SCWA 1DWJM 3TONA 4AD3A 3OGSA 2PWGA 1NWSA 4W5ZA 5A6BA 2XN0A 1CGVA 2GVYA 4HMDA 1TQSA 4DO5A 5KEZA 4QDMA 1KXTA 3ZOAA 1HWWA 2ZUVA 7CGTA 3PZTA 3RM8A 1ZJAA 2OYMA 4JKLA 1MW3A 2OYKA 1HKJA 1VB9A 2EQDA 3EMCA 3L2MA 1H4PA 5JBDA 3AHZA 1QBAA 2G8ZA 4W7VA 3PTMA 2OWCA 5FCZA 1EQPA 1MYRA 1VF8A 1R7OA 2ZXBA 4AD4A 2BY0A 1QI4A 3VIGA 1HL8A 4QLLA 5LA0A 2VX5A 4D6JA 2VT0A 2DT0A 4F9JA 2JIEA 3O9NA 1KCKA 3VIJA 1JNDA 4AWEA 1JL8A 2X2HA 4X9YA 5ABEA 1GOQA 3CTTA 4C7GA 4KWUA 5FL0A 1GVYA 2CEQA 2VQTA 1V3MA 1NOFA 4CUCA 3N12A 3II1A 1F4AA 1WDRA 3AZSA 4NX0A 3ZT6A 4ZENA 3L4TA 3CMJA 1VJZA 3T2PA 3RIKA 4DUWA 2F1BA 1E4LA 4HOZA 3MUIA 1E55A 1K9DA 4HOWA 2VNCA 4DUVA 1LF1A 1JYXA 3VX0A 1G5AA 1G01A 3SCRA 1PX8A 1BYCA 3BAIA 1EXPA 3A24A 2YJQA 4NRSA 1GVIA 3I3DA 1UR0A 2EXOA 1UKOA 1BQCA 2WPGA 1UWRA 1HN1A 2VO5A 1KBBA 4OOUA 1TA3A 1DWIM 1X1NA 5JUVA 1GUVA 1W9VA 4U33A 1PIGA 1B30A 2CNCA 4IPLA 4CCDA 3UG4A 1K9TA 2O9RA 3WNMA 5M17A 4W93A 5A8MA 1MW1A 4D6DA 3MMUA 2X2IA 4W7UA 2GUYA 1E6ZA
chains in the Genus database with same CATH superfamily
1KLYA 3DJ9A 2E7CA 4XC1H 4FQ2L 4K73A 1P1MA 3HFTA 4RL3A 2DWTA 2QJDA 4N1CA 3MV01 4KKPA 1CF1A 2ISWA 2QULA 4P2AA 4B5XA 3ZKQD 3GX9A 3K0WA 4G70B 1N8FA 2B59B 3BZFA 3BLPX 5DEGB 4AWSA 1QDSA 3Q8CA 4PV8B 1Q65A 3MRNA 3T0XA 5DZVA 3U6XS 1EWEA 4ZS7L 4LASL 3WLPA 3VFMA 5IHBA 1QLFB 2V5CA 4MG4A 3WFLA 4ABVA 4WU7B 2NUWA 3K5RA 1Q3NA 4BY3A 3RM4A 3UA4A 3VXQB 4PMRA 3F1QA 1E51A 4AZUA 3TAOA 1INEH 3P77B 1E28A 1N0LA 1K8ZA 5I07A 2EIZA 5FGCE 1YJDL 3J07A 1UT9A 1XCTA 1I7RB 4NRYA 4RIRA 4RMVA 5GGUA 2PBGA 5DVOA 3VE7A 3ARDB 1A9EA 5A1AA 5FECA 2VELA 5C7XH 1NDTA 2MWCA 1AXTH 4JDTL 3NQVA 2CJSA 1IQWL 4BIKA 1XLCA 3W2MA 1MQKH 4PGDB 4M5YH 5EUOB 5AD0B 1V6TA 2G5UA 3GMPA 5IQ9B 5SWUA 1EGZA 5DO8A 4CKQA 5JH1A 1VFFA 4FOUA 1H3VA 4JQVC 4P07A 2IANE 5GSVB 4DP7X 2QUNA 4N7QA 1W6LA 2ZXDA 3JXAA 3UAJC 1CO1A 3O11A 5AOJA 1XGPA 4N86A 4LEQA 3ALPA 3WIHH 4LRTA 1GR7A 3V4PA 3CHPA 4FEMA 1A9EB 5FECB 2CWRA 3PR2A 3W7IA 3FB8A 3BP5A 1UXMA 2C16A 1YNPA 1TFPA 5G2WA 4AD5A 3WIJA 2QCNA 4XO3A 4LMQI 2EDJA 1H9VA 1M05A 3VFOB 1LLZA 5H35B 4OFIA 2A99A 3NT0A 1P4CA 3Q5YA 2E25A 4D6CA 4V33A 5D1XE 2O26U 3WFDL 3W02A 3AAZB 3ZTNL 2FDSA 3IVKB 2HE8A 1R7AA 4LSDA 2XSBA 1XLBA 3QJAA 3WBAA 4G56A 4MSWA 1E4KC 5DI8B 2AJ3A 1ECQA 5FAGA 5DSCB 2J8UB 1QFOA 3QUZB 2BOEX 2PDPA 2BSSA 1JUBA 4JTDA 3NJLA 3RPIB 3FSUA 2A5UA 4H2AA 3QXDB 3VWKB 4BE5A 2DMGA 1OWRM 2QF7A 3LCWA 5D71L 3N15A 1TQUA 4BKNA 1O9ZA 3RWJA 3MUZ1 1YDYA 1YMYA 2DI8A 1E67A 3W70A 3BWUC 2WKOA 3N0AA 4KUZH 1U8KB 2EVIA 4CQ9A 2DRUA 4IIQC 4EPBC 2G2NA 2OLAA 2R2BA 4L4TE 5D2VA 2OP4H 4QTIH 1W9BM 4PUKA 5E0KA 4XSMA 5G55A 2VH5L 4M51A 3UTSD 1R17A 2P45B 5FJJA 3UBFA 2FQGA 3KW7A 3D25A 6A3HA 3FAWA 1WCGA 4OCRH 5EMUA 1G87A 1E9IA 5FEBA 5K9OA 2HJKB 1ZGLM 2Q09A 3PC0A 4MWFB 1JZJA 3U36B 4CNIA 1J6OA 4K7FB 2WXGA 1WDDA 4DN1A 3O6AA 2I27N 3GSVB 1D7DA 4AL8C 4KPLA 2NZ1A 4R9OA 4NEHB 5BW7C 3P0YL 5IRPA 2ZOOA 5F6HI 5I8KL 1U6AL 3ROOA 4BQCA 5B38G 4GUJA 3QUXA 4WY0F 1S5VA 4AVIA 2NUPB 3Q2CA 3QFGA 2W0UA 1CURA 1Z89A 2HRHA 3DX8B 2VUYA 3TYBA 1KB3A 3EO1B 2PPEA 5CP3H 2O5YH 3M6DA 2AJSL 3D52A 4LRIC 2XXMB 4CRPA 1E1EA 3W22A 2YD8A 4RFEB 2NZ9D 1GKEA 3WFEL 5L0QB 4LCYB 1ZSDB 5IEKA 1UROA 3D3FA 3FDGA 4J4KA 4HPYL 4RWYH 4BWTA 5ETUB 4M7JH 3IIZA 2XHYA 2NUTB 4EANA 4JTEA 4GSXA 1SOSA 2C1GA 1BF2A 2XKSA 5LXVA 2C9AA 2P26A 1OFAA 3LUTA 4RK8A 2PKDA 3N2BA 3R8GA 1U8QA 4ZNCD 3EBIA 1CI1A 1GPOL 2ICCA 5BV7H 1YMMB 2OFQA 1HG3A 4R4BA 1RZKH 4D0DB 4RCXA 3PFUA 4TO8A 3QYQA 3TNOA 5B7EA 5BROA 2NQ5A 2VM4A 4JNZA 1XR8A 1YJDC 1PZ1A 4WRHA 1HHKB 3G0XA 3VUSA 5JOEA 2MQGA 4G1MA 2DV0A 1QXLA 5SX4I 3KD4A 1H1ZA 1MHHB 1TRIA 4TOYL 2C5DC 3G5VB 4IICA 4GJ1A 2JV6A 3MUCA 4R88A 5TQ2H 4AVOA 3JW7A 1YNLL 3KGTA 3PUEA 3VFRA 3QH3B 1FVPA 1J0IA 4O4YL 1U8LB 3HE6C 1LWJA 5FGCB 3X1BA 3B8VA 1P5VA 4BF7A 1HQTA 3ARED 3RB5A 3SDXE 3QIUC 3NPZB 1EHXA 1P0BA 3PAVA 3RWDB 2XFWA 1IL1B 5FXCH 4C6QA 4F5CE 1NH6A 2A77H 3D3AA 3ZGIA 1QPOA 2J7CA 3RHGA 2F8QA 2FZBA 4DKDC 2WLMA 3UADA 1MNNA 3WD5L 2BP0B 5TPWH 4K7PY 3QDAA 1E27A 4C4KO 5JOPE 4HSCX 4Z7OF 3BPOC 3FSZA 2PYED 4LVOB 3U6RB 2DQXA 1ITXA 3E6HA 1RJLB 4OT1H 2NQDA 4TIMA 3KE0A 2BXVA 2E09A 4F8TA 2HLFD 3SCQA 2JSFA 3KZSA 3UH8A 2Y8VA 1XH1A 3IFNL 4M62L 2HISA 2YCIX 4FI6A 3LBMA 3O07A 5F2MA 1DBJL 1ILSA 4Z7OB 3LM7A 4FR1A 1BM3H 3HG3A 4JM4H 3UZVA 3VWJC 1DKWA 1SO5A 2IF7A 1F45A 3BDBA 4HA0A 1E90A 1UXSB 5GRJH 2IKJA 2V7NA 1TVPA 3VE0B 3V52H 3GG1A 5HPCA 3SJVB 4TQPA 5HGDA 2VLKA 2G37A 1SJBA 1H3GA 3AXIA 5EF1A 1X38A 1IEXA 5CMAB 2BNJA 2O30A 3N3EA 4FS0A 3FRPA 4XNQA 2DZAA 3TJIA 5CIPB 1ED3A 2EXTA 2I17A 3IK4A 3BW9B 3LKSB 1WDWA 4CMMB 1CT8A 3AQZA 4N3UA 5H94B 1GVSA 1SM3L 3PV7A 3UBXB 5JW5B 2C3XA 4OJFL 3CV7A 4UFJA 3WN6A 3W7QA 1GYWA 5HYSG 5ABHA 4EXPX 5A8PA 4BH7B 4GP4B 4PTUB 2XIMA 1PG7X 5KSUB 4LUSB 4K2UH 4J2XA 3H4GA 1XB3A 2DQHL 5CEZH 4KRUA 3QWOB 2IFFL 1YA5A 3I9PA 1U95B 1MNZA 2ZTJA 1PZAA 2F7RA 2J8UA 3QUZA 1D2PA 4WWKC 3BJ91 3HFFA 1A53A 4Q6JA 1WSST 2YEZA 3MKVA 1OALA 3RZCD 2PXYD 3BVNA 4K3DH 5HHMD 2G0WA 1N64L 4MMWA 4Q4KA 4ZFGL 2ZZ1A 3L7FA 4N6RB 2ZRVA 3N2MA 2NSMA 3V0UA 4FERA 3GSUB 3DFNA 1FL3A 3UAJD 1Z9LA 5DFTA 1XQKA 4QNPE 1JWSB 1AXSA 1J8SA 1SJVA 3HKFA 3T0ED 1JDCA 1KC5H 1L0XA 3ECWA 4A7GF 4HH9B 3GZOA 4ELMA 4DJFA 4X7FC 2J79A 3MLXH 1WOBA 1XIHA 3KCOA 1TSIA 3VIPA 5FHAH 1KRCC 1XDTT 2WKGA 4IGHA 1OCRB 3TLRA 3B2PA 3FB7B 4JKPH 4LQ1A 1UEYA 1W3TA 1O6VA 5DUBB 4MY9A 2WCGA 4A68A 1BQRA 4EI0A 2E46A 1HXJA 4ONVA 3NEOA 1E0VA 5EOCL 3T8LA 1S9XB 4ERGA 3APGA 4LEEA 1XFBA 3WLKX 3BKMH 4OZ4A 4LSPL 2BSEA 4MD5A 4UT9H 3UPBA 4BK5C 5DCCA 2GJ6A 2PDFA 3VILA 3GC2A 3OEXA 2ZWNA 2VR4A 2VMJA 4DP9X 4HKZB 5HI3C 2YBRB 2AFNA 5CJNA 1KO0A 1SN0A 4JJOA 4X9HA 2UZXB 5E2VL 2POZA 3L4XA 1UT2A 3IMTA 3DHFA 4ILDA 4WKZB 1MI5D 4DAIA 3GNDA 4LV4A 2A6IA 3SBFA 1TKKA 3SURA 4M5YL 3UZXA 4PJAE 2XG9A 4JAMA 1H6UA 2YXFA 1E5AA 1CE1H 1QFUH 3HI1B 4BK8A 1LQ0A 4C6CA 3WE6B 1O5DT 4CD6A 2B0SH 2DDQH 3NJMA 2YMTA 5EBWA 5K9JL 2IKHA 3GM0A 3N3TA 4J5NA 2L8AA 4U2YA 4WI2A 1Z7JA 2NUTA 1SJDA 2J43A 4GT7A 4QRTA 4D0DA 1J1PL 4QXWA 2VLJD 4ZOEA 3TN0A 3GFXA 2IPTH 2JKWA 3JWNH 1H8SA 3LHVA 1ZSDA 1PBYA 1HTYA 1PHWA 4L4OA 2Y7GA 3UR8A 2AKMA 2YQ3A 3GI8H 1ZGLP 4WDUA 3WD0A 1WISA 1Z5HA 3ULUH 1C8XA 2Z2BA 1HO4A 1NLBL 1GYMA 4PJ7E 3P11L 5DQ9A 5D2NC 1XB8A 3F5JA 3W3OA 3IDMA 3WX7A 4OGYH 2HT4C 5A2BA 2QCLA 3COTA 2WQAA 5DLMH 1A2YA 4IRJA 4HIBA 2J6EH 1YEHH 1HP5A 3GZQA 1X97A 2DT2A 1QVBA 2OM5A 1OTUC 4IIZA 1NY1A 2J5LB 5JR1L 8FABB 5GNYA 3BFQG 3QDGA 2YPIA 3W75A 3MROB 5BJTB 1QFEA 3BQVA 1ZVYA 2WXLA 4JREC 4GH3A 3QORD 3B7RL 8TIMA 3ZO9A 4M1BA 4U6XB 4R7LA 3U1SH 3BVUA 3APYA 3NZ1A 3P4MB 4A8IA 2IALB 3L81A 4B3ZA 4OZFH 5D7IF 5GZNA 5GGQL 3JTSB 3PF2A 1L9MA 5CFHA 4OV9A 1YUKB 3D3VD 1B9BA 1BXCA 4UB0L 5A8NA 4NZUL 2GSHA 3DBNA 3CH0A 5CWSA 2PNDA 2WXNA 3U2SA 4MJ5B 2ZNXA 1BZ9B 1QLEB 4EQ2A 5E1AA 3QWQB 2EZ0C 3ULUC 2PBOA 2RH9A 4LCQA 1UQSB 5HINA 1FX6A 1YXCA 3NO5A 4IGNA 4PG9B 3SN6N 1WT5A 2UZIL 1MI5E 2JE8A 3PQYB 5IFHH 3EYUL 3I50H 2Y7DA 3FFDA 1D8WA 5I2IA 2HKFH 1AIZA 1B3XA 1QPXA 1S7TB 4NSKA 3FGCB 1US0A 4LANA 2DWSA 3IU4H 2B7PA 1AH0A 5A6AA 4JO1L 4S3EA 2ENPA 5EV7A 4BZ1H 1S9WA 1R34A 3L6FB 4XBPA 4KCUA 4JTJA 2Y88A 4LY4A 1NCHA 2QSQA 2A4EA 1CDCA 3G3MA 5KG9B 2QVNA 1LEIA 1KCSH 2FT6A 1KTBA 1X6NA 5C07B 3I7RA 5D9OA 2YKLH 3HS9A 4G72B 3R89A 5TDNA 3JZUA 4NQDB 2AMUA 1O7DC 2IH3A 1BAFL 2FSEB 5DRXB 4Z1PA 5E93A 1PDZA 3TOYA 4PJ7A 2XU2A 1SHMA 5CXPA 4ZK8A 2OB3A 1QO5A 1OCWH 4AIOA 2LW3A 1UWGH 5FYJL 2VDQL 4JAMB 4QXUH 2OMYB 3BMWA 1PTGA 2O4EA 4U3SA 5AEAA 3LZ5A 4LPTA 4L6DA 4EK7A 5E9XA 4MWAB 1M7XA 1GT8A 4X6EA 5D7KD 4JFUA 4AF0B 3UD6A 1QW8A 4JZJA 1FWXA 3KPOA 2EXSA 1Z48A 1SN5A 4PS8A 5AZ2L 3ZFHA 3QORA 4AQZA 5IMLA 3K80A 4JN2B 4JY4B 3RWGA 1UZ8B 3UR5A 1QHPA 1F42A 1TTAA 2GBVA 4NO5B 3IMUA 4O02A 1YNTF 3AI0A 1QBMH 2JI2A 4M80A 1IU1A 2J4WH 4IQDA 4N22A 1VJSA 2GJRA 4K3ZA 5I1IL 5A2CA 3L8QA 5DRCA 3NJFA 5D9SB 5LG6A 2Y1VA 2Y7QA 3HLAB 3MBWA 2XTKA 1SGKA 4EP8C 3WHE1 2R0LL 3LRSA 4C56A 3ZZ1A 4MAYB 4B95C 5HNTA 2PI6A 2ED9A 1I7RA 5GGUB 3PG2A 5D5MF 4HSNA 1U8OA 1FLRH 3CHQA 1GGTA 3LZ3A 4HPNA 3F7VB 3PABB 3PNWA 3V5DA 1A14L 5KSBB 2ZJSL 5CN1A 5BMXA 2YIHA 3EOTH 3LDBB 2OMBA 5I5IA 1B9ZA 5IW1B 2WMGA 5C0BB 4MAUH 4A2MA 3O8XC 4QRUB 1F6AB 2B2XL 3FT0A 4X5QA 5KVEE 4GBUA 1W0WB 2XPYA 2XWBB 4WWNA 1HOEA 4MNJA 4FX5A 1N18A 5C9XA 3TJEL 3QY7A 4WUUE 3ULSB 4P46C 1AA1B 2H6PA 2CO7A 1A4JB 2QPDB 1L5GA 2GSMB 3BPCB 4K71C 3VI4E 4YHYB 5HYSB 1F4WH 5FYLL 1OM3H 4FXJA 5EU9A 2DFAA 3T2LA 2VR6A 5JBEA 3ZE0B 1EA0A 2WVSA 1XIWC 2QDWA 4FQLH 4OB5H 3LHWA 1BG9A 2NY2C 3BH8A 4ZNEA 1GONA 3P9MA 2ANUA 1KYDA 5KYYA 1NCBL 5DA4A 1MCRA 4OZIB 1V6VA 3DMMB 2ZZ4A 3EJYC 2K3TA 1RZ7L 3AT0A 4LZKA 1THCA 4XNMA 1A3HA 2PDYA 3NQ7A 1RIVH 4Z9KB 4ZFMA 2C1OA 2HVBA 4NKIL 3GSXA 4RW3A 3N2OA 2I7GA 4GBXA 4Y2WA 3BH9A 4UTBL 4Z0XB 1DQLL 1OEZW 2DKMA 2F54B 3E8VA 4ACZB 2APWA 1XWVA 3N9GH 3RWFB 1YNTB 3DI0A 3FT4A 4FXRA 4U28A 2CQVA 2R91A 4Z95H 4DEFA 3WQEA 4QTIL 5DHDA 4JZJC 5KOMC 2HXUA 1HIML 2QELA 1VEMA 3SGDH 1MCQA 2BNRD 5C8JB 3GLDA 3P81A 4RISL 2NYKA 3AREC 3FN3A 4JPQA 3TLLA 5T1MA 4Z7IA 2B31A 1K2DB 4PRPB 1C9DA 4N1HB 3TF7C 5GNXA 4FYRA 2OFJA 3GMRB 1ZGLA 3SUSA 3WEMA 3U83A 1UA6H 1H5VA 2O6PA 5DRWB 3MJ7A 3ZE1F 4HOXA 1X7TA 3QEQA 4TVSa 4MZRA 5CAYB 4OE7A 5SWQB 3H9YA 3LN3A 4PE8A 1OGGA 3PAJA 1FA4A 1QSEE 3WJMB 3I6LE 5MI0C 4QD2E 5BOOA 3FT1A 1KQYA 2G3IA 2ZKMX 1TREA 1X6LA 1H5BB 4FFYA 1M7UA 3VD5A 4JJHA 3RWIB 3O0RL 4LL4A 3WDHA 1O60A 3D46A 4ANKA 4H2CA 5TE6H 3W24A 4ATLA 1V3KA 2FO8A 3FZUD 4F8PA 4ICNA 2EG6A 2ARJA 2ZYHA 2ZRZA 3UPMA 3KDNA 4JRLA 1J8KA 4XG1A 5BV7C 4HS6B 5G4WA 3BAXA 1HKLH 3DARA 3TE9A 1X1ZA 5E6IC 1E6JH 2EIJB 2JJSA 4XGZA 5I6LA 1UG6A 3SDXA 4DO6A 4PMVA 3ECBA 4F0RA 4JD4A 3EOAB 3E2RA 5C70A 2OI9C 3H9HB 4TVCA 4KTDH 2ORBL 1KEGL 2DLTA 4MXQD 1KYAA 2VO8A 4M6NH 1EO8H 1HYSD 2VMCA 4BZ2A 4ELKA 5I8OH 4C1NA 4RJEA 2J75A 3SJVE 2PF0A 3TCEA 2FH6A 3V0VB 4NUPA 3GHBL 4AYDC 4UTTC 4P05A 4CCDA 2UYLA 4HMNA 3G18A 1F6YA 3GIVB 4IMLB 4V1DA 3IU3A 3EFOA 3DKHA 1WK0A 4X7DC 3INPA 3EGXB 4BF9A 2B39A 2P1YA 2OJEB 3VXPB 1KWKA 4OQTL 1QFUL 1HC1A 2IMNA 4YNYA 2WCSA 3TW6A 3G0SA 2CR3A 3BWZA 5DUML 2NNAA 2PPFA 2VABA 3RZCA 3AXHA 4LXFA 1Z41A 4I3SH 3A21A 4MJ4A 1FZKA 1AY1H 1MWAL 3EZ8A 3M7FB 4NO2A 3MP5A 2APSA 3NNTA 4RSVA 3L12A 3VIFA 1YPZA 5G4HC 1ZLSH 2YEQA 4JFPB 4WKXA 5GZND 3A3XA 3C09B 3JWNE 4H4NA 4WK4B 4WSKA 3F65A 3QDHA 3ZVVA 2IBBA 3TN0C 1XGEA 4QLWA 2JKJA 1TZIA 5FUZL 1BXXA 4DOHE 2GQ3A 3JUGA 4TR9A 2J7FA 3O4LE 3UFYA 4XBJA 2MCPH 5D8JH 3QUMH 2ITCB 1KM3A 2B4CC 1F4XH 4R7DA 4RUBA 3FOMA 5K9OB 4Z1AA 3JV5A 4Z8FH 2KZKA 3QZNA 3GYCA 2J8FA 1JOIA 4PJBE 2AHIA 2CDEB 5HMSA 2XPGA 4A35A 4PHZA 3P9LA 4DY1A 1MFAL 4GI6A 4G7VL 3TFKD 5GGRY 1LWHA 4HGWA 4KRPB 1PZDA 4AUYA 2YQGA 2HDJA 2OLSA 2IPKB 4QUOA 3ZDWA 2Q0ZX 2YWZA 3CMFA 1YYML 4MNMA 1Z32X 2IQ9L 4ZSOE 4O1FA 4GINA 3W85A 1CLXA 4EXAA 3MV7E 2ICWJ 2NXYC 1OP4A 2G4FA 1RY8A 3HI6L 2WZ0A 5GS0D 1R3HB 4GQQA 3TNBA 2X4QA 2CR6A 4AIZA 4MAYC 1MUMA 2E7HA 4FF7A 3L3KB 5JLZB 3L9YA 5B1JC 5FFLA 3BP6A 5JXEA 2BMBA 1XPYA 4GRWH 2WYSA 3RA7H 3TEUA 2CO6A 1UXSA 1I3VA 2AJ3B 3BZ5A 1W3KA 4F7PB 3AY4C 3CHOA 4MDJB 1EZSA 3C5QA 3GGWA 2V69A 3CDCA 4J6IA 2Y06H 1EHNA 1OANA 3GXTA 5J6GB 2FO1A 2C3HA 4QY8B 5TF0A 3OMNB 1G7LB 43C9B 3PY2A 4EF8A 2FUQA 4POZC 1S39A 2F58L 3BGMB 4UINH 1HI6B 3AU2A 1O4UA 4C91A 1JG9A 4FL4B 4AC7C 5MHSD 4HNCA 1GJWA 2WLYA 4ZFGH 1KCRL 3P8JA 1NSJA 4KF1A 3ARFA 5BZXA 2MNWA 5IESL 3PZ9A 5EC2A 4JRYD 4U3AA 2A7NA 4I5XA 1OP5K 1UP2A 3KBJA 4Q14A 3BGJA 3EWYA 4IOTA 3O6FA 3QWRA 3DN5A 1W1YA 1CD0A 4WWKA 3WUEA 4ONHB 3GSQA 2B20A 3GTIA 4M7ZC 4PREB 4JG0H 1TQVA 3DX5A 5FHAL 3PWPD 4QITA 3VH8G 6TIMA 1F11B 1A6ZA 2D69A 3BRGC 5BRZB 4K15A 4ZAKD 4MJHA 1OFBA 3DBPA 4X22A 3A6BH 1AOZA 1GZJA 1XMEB 1OBAA 3SKNA 4GMEA 2JELH 3KDMB 1IGTB 4XPGH 5F97E 1VC4A 4V2XA 4YMZA 2D2OA 5JW4N 3MRKB 4YDLC 3T1FA 4LSSL 3QFDA 2XYBA 3R2GA 5B39G 3U9UA 3NK3A 4JDEB 3NXFA 1MCFA 3T65A 4IBTA 3LRHA 3WIFA 4LF3A 5INDB 4KFOA 4LYRA 1P6FA 2E7LC 1TETL 2DWDA 4GSUA 3PJWA 2QZ5A 4Y88A 5IJVB 1BBDH 1NCCH 4LOFA 1VFMA 2HJPA 2P8PA 4LAOA 1EXUB 1QRNB 4G6KH 4DZIA 4ESKA 4ZTEA 4HOMA 1PLGH 1AQKL 4PG2A 4TNWF 4FC3E 2V5TA 4N2KA 1ROWA 4PV8A 4P8XA 5LIKX 2Y2YA 2VEIA 2R4SL 5KS9F 1GKOA 1AJ2A 5ISZB 2IMRA 3CXHK 3HCVB 3GBMH 4KY1L 3QJSB 3Q43A 3O15A 1WJ3A 4LNRB 1MCWW 2G60H 4WDWA 3QHOA 4PRNA 5EF3A 3HO8A 4Q8TA 4KRZA 4X5WB 1YNLH 1UWXH 3BAJA 4NOBA 1E30A 4EDWL 2G5BB 1F76A 3CTLA 3UQNA 1O68A 4C8XA 4S11A 1J8HE 3IRPX 1LRNA 3M0IA 3QQ4B 1AUSL 1R8LA 3B9KB 3S3BB 4D2NA 5FO8A 1VDGA 4PJEE 4PSRA 4TRPH 2FWSA 1FKWA 1U8PA 2XXGA 3TYFA 3TYGH 3PUDA 3W2NA 1V0MA 3EPNA 2V9RA 5D5MB 1U5HA 1NFIB 3CFQA 5FFOA 3UC2A 5K59E 4F33A 3U36A 3WZ0E 2QADC 1HINH 3UYPB 3VXUB 1CBGA 1U42A 4F15C 3X1GA 3E96A 4IQEA 4XXCA 4O15A 5L9FA 1GIGL 4HPOL 4KZEL 3D25B 3SB0A 2EC9U 1C5CH 2BVPA 3NJNA 3T6WA 1T0MA 2HMCA 4GQ9H 5HJBA 3MHGA 4V2CB 3EOBB 2EICA 2Y5SA 4WKHA 3G6MA 4KROB 2VLMD 2KZ1B 3AIWA 3QQWA 2AP2A 2H1PH 1T04A 1QBLL 2N1TE 2VLJE 5C2BL 3S35L 2WMPB 2EDOA 4C58B 2PA6A 4F3FA 1G6RL 3ANUA 3W7PA 1M2VA 3MODL 4XMKL 2OJPA 3ECQA 5ANME 3HI5H 5FOBB 1EYWA 1MZHA 2X70A 2XFXA 3QXDA 3T6VA 5HAOA 2D3VA 4GT0A 5DD6A 5DTFA 4LVAA 2XRAH 4J23A 3I50L 1A4BA 3UFIA 2AEPH 2QDVA 3CUGA 2X88A 2C15A 4Q9QL 1EFXB 1V3JA 4U1MA 2YO3A 1LOSA 2KPWA 4I90A 3TZVA 2WYTA 2C9XA 3G6JE 1QFWH 2DZWA 2MOQA 3C8FA 5LVEA 2AK4D 3N9RA 2AAAA 4DKFH 3RU6A 4C6FA 2MTPA 2YN3A 3MCKA 4Z3TA 4GUQA 4PCKA 5C09A 3CZSA 4QNPF 1QYGH 3IPEA 4CGTA 1AS6A 3EJSA 1DANT 4JDYA 2DEPA 2DWDB 4JZNB 3EH1A 3ZXAC 4LEBA 2Y63A 4JQVA 4QHRA 1U8JA 4NVTA 2FGWH 1P9MC 1QP1A 1G0XA 1GGBL 2B4CH 2WXOA 1IEWA 2IAMC 5FYKU 4K8RL 1T0PB 3TESA 4LGSB 2EVHA 4M61A 2TODA 4FQIH 2WMFA 5E9DA 3NJ3A 1AYRA 1WBZA 5L4MA 2EJAA 4LLWB 5CUSH 1YCSA 5HI4C 3SYAA 3HB9A 1TJXA 4RE2A 2OZTA 1FGNH 3LTVA 2QAFA 2AMXA 1IIGA 2ED6A 3D85A 4P5KB 3A67L 3AIVA 1FHVA 4JEGB 3Q2DA 3MBXL 1T2JA 5AW2B 1CX9A 5DZAA 5DYFA 5AB0A 2Q10A 3HMWH 1BWMA 1UZ4A 3N91A 3VYNA 4EZLA 1F56A 3HQNA 2HJLA 4XHJC 3V0IA 3P61A 3TTEA 2C3WA 3ZDZB 4ZQRA 5TGBA 1FG2B 3TBWB 1V77A 4O53A 5LIXX 3BOLA 3CO8A 4EACA 4J3BA 4YHML 3A4XA 4K39A 1IRAY 5MEOB 4GYFA 3AG1B 1JUEA 4JTHA 3BKJH 4XP1L 2JEQA 3WFAA 3ZLHA 1E4KA 1XXXA 4PFHA 1WKFA 3SDAC 3L2LA 4GKSA 3X3GL 2VLRA 3SAZA 4LPWA 1E15A 2VDPH 5DT1H 1H51A 3DAQA 2AJSH 3SN1A 1TWIA 1UB5B 3AICA 2MFNA 2ARJQ 2YB1A 1S7QA 2ZC8A 2IJ0C 3TM6A 4JN6A 3VINA 3RIAF 3RDJA 2PRLA 1IM3A 3ARDC 3DX7A 5EORL 4D0BB 2ZADA 4JRFA 2VCBA 5E2VH 3VH8B 2J62A 1EIBA 4M03A 4CC4A 1OSEA 2AQSA 3KCWA 2EVFA 2YLHA 4WDIB 5D7KE 5JHDE 5FESA 4M7LH 3WKMH 3F6IA 4FQHA 2X30A 2IQTA 4LB3A 4GKZA 1AG0A 5I1KH 2QTVA 3T9WA 2CG9X 1JSYA 2DQDH 3FYOA 3ZDZF 1RULL 3O2VH 3H2FA 3O2LA 2L4OA 4OZGE 3V5HB 1FVCA 1GKRA 3A4AA 3QNYB 3ARUA 4KKBD 5LNUA 4X4YA 5CIPA 2PZ0A 1M2OA 3U0HA 1A6AB 1LP6A 1F2XK 4FG6C 3X3FL 1R3RA 3W56A 1ESWA 5KYUB 5CSRA 3M17B 1KGCE 4Z7AA 4ZSOA 3OYZA 3P11H 3NTCL 2FPVA 3CSGA 3W57A 2FMOA 5I8CA 4ZQKA 1GW1A 3C8NA 3W1QA 4FMKA 3KPSD 4R96B 2BK8A 4UQBA 3TTYA 5HP5A 2LTQC 1MVUA 3UZEC 5IQMA 3BLIA 1IILE 2X89D 1RIHL 1LLAA 3UETA 1Z66A 4GABA 4HXBL 2HROA 4HN4A 3LRLA 1JERA 4KNSA 3L5MA 5G4MA 4UILL 4FGMA 5J12B 3IDNB 1R6WA 3ATAA 8FABA 5DQDH 3AQXA 5SWSE 5AOZA 2Z1WA 4GXWA 3J7HA 3S96B 5CC3A 3CXFA 2XINA 2Y23A 4DK3A 4YLBA 3FDKA 4XD3A 2C9SA 1NBVH 2O5NA 3MV9A 2G3FA 4X6DB 1T0NA 4A7TA 3CWOX 3RFZC 1JZHA 3FU8A 4NQCE 4TL5A 1W32A 1R5VB 1XLHA 1UUNA 1KM5A 5T91A 3BO8B 2PMZA 3EBGA 3HHSB 3HRPA 1GWJA 2WUBL 2J6WA 3T5WA 5IUSA 1FCQA 3FH5A 3OKYA 1E5NA 2B4CL 1MMFA 3KR3L 4IZGA 4R0LC 2CCRA 3PXHA 4KAQL 4UNIA 1J93A 2G96A 3T7VA 1KCRH 1JVLA 1NBYA 2Y3NA 3MLUH 3WBYA 3BUPA 3TQVA 2BC4B 4Z5RB 4PJDB 4NN5B 4BQ3A 2CAKA 5D6CB 5GRJL 4J6RL 5TDOA 3RVUD 1FYTA 3BUTA 2WQDA 1FWWA 4QP0A 5BOZG 1Q63A 3S2NA 1UENA 1N82A 4DBDA 1ASPA 4X5LA 5IF0A 3HMWL 1SJMA 3MXVH 1PCKA 2OX5A 2XZ7A 3GLEA 2Z7YA 3CT7A 4RRPM 1CICA 5JW3H 3N2CA 3BPLC 1F3JA 3KPRD 1DANU 5IIEB 2QDDA 3STGA 3MJYA 1DEDA 4ZPTB 3JVFC 4N0UE 4NC1E 4WR3A 3WIAA 1WHPA 1ZVSB 1HUVA 3ULUE 4YHLL 2DTML 1UUMA 1CS6A 3WIIH 1ETZB 4OVXA 3R25A 3STLA 3RO6A 4P3CL 4EN2A 2V68A 1SMAA 3BH4A 3O2DA 4BV1A 3BSGA 4O4VA 3H2QA 4KVNL 1G7IB 3NR0A 3SEPA 4ORZC 1TV2A 2YZ8A 1UJQA 2XT1B 4A37A 1Y18A 3PL6B 1DVFA 2CPUA 3HOGA 5AZ2H 4CMHB 2J78A 2A9NH 2EACA 1IIIA 1RP9A 5AW0B 5B3SB 3U6WA 1XYCA 3FQ4A 3DBSA 4LLVB 1OKEA 4Y16D 1MCHA 5KZCB 2Z1XA 4DWSC 4XPFH 3M46A 4GAJH 2BVQA 1J1XH 4H8QA 1QBML 4AYFB 1NMCB 2YAMA 3HBPA 3MZGB 5HATA 2CIKB 1VGAA 3W7GA 3IJLA 4DNMA 3VMPA 4UTUA 1S7XA 3ZKXC 3L3IB 4Y9OA 4BF5A 4FMFA 3LPPA 5F7YC 1GA2A 3IGUA 3NZ8B 5FK9B 5DMGC 4K8EA 1KIUA 4B0MM 1ZPUA 4DVRH 2YCEA 4J3TA 5IOBA 3R4IA 2V6HA 3P6LA 4S0SD 3S0PA 4R5TA 5DJZA 5FD0A 2FJSA 4H44C 1PDKB 1BGXH 4YDIL 1CQYA 5DU7A 1NGYB 1K4CB 1GGYA 3NTCH 3U0TB 5HNNA 1PVHA 1ODAA 2WV3A 2O61B 2PDIA 4EPEC 2A2IA 4GSDL 1IEIA 2BDNL 3JTTB 4UR7A 2IKGA 2B81A 4JM2A 3VFNB 1QLEH 3O3DA 4Z0JA 2V7HB 4XVJH 3BP7A 4ZX5A 3BW9A 5ACZB 4MQSB 1FC1A 4P5MB 1F1DA 3VXUD 1GHRA 2IAAC 3GMNA 3QAZC 3LHZA 1UD4A 1MUWA 2QUVA 3D39E 3ZDXF 4N2NA 2YA1A 4G6FB 2QHRL 3OG4B 4WFFD 3ZMEA 4MJJA 3QNXA 1RJZA 1NJJA 1UP0A 2ACSA 1T6VN 2OQYA 4RNIA 2F7FA 1YEJH 5BQ7A 1OP9A 2DLHA 2D7TH 2GFBA 3FQTA 3LJ3A 4JKMA 5AG8A 1M7OA 1FWBC 5I75C 1PKMA 3W7MA 1G9NC 3ZRCC 4YTUA 4F0KA 3C6EA 5BS0B 1RIVL 3VGAC 1LL7A 4YBQC 4YAQA 4HNTA 3DSFH 5ID1A 1NFPA 1TVBA 3GTVA 1F3RB 1MCJA 1INDL 2AXWA 2ZRXA 3TTOA 1JRHH 2F08A 4BGLA 2DZXA 3GS6A 3AWOA 2Q6WA 1W1TA 4M6OL 1W56A 4HNVA 2DZTA 4D6EA 2JKRM 4MHHG 1SOXA 1WZKA 1F9CA 2EUVA 4UT6A 5I66A 2F9RA 1VGEH 3HRZB 4QI3A 4XN7A 1GVOA 4IMLA 4V1DB 1LORA 3K4DA 2WBJC 5H8MA 4OF7A 1XBDA 1A5LC 3G5ZA 1XO8A 1EQCA 2E77A 1TVHA 4OAWB 3R8RA 2XXFA 3Q37A 4X0NA 3SUVA 2NY5L 2VFIA 2UY4A 3UBXI 3APFA 4NO5A 3P3YA 4X6BA 1T6BX 4ZAKB 2VVSA 3MRFA 3HNVL 4NKQB 1MRFL 2NY0C 4NZCA 5DWUH 1VBUA 4TQHA 5D7SL 1K9FA 1X96A 4RDQF 4QM1A 3CG8A 3VNJA 1ZHKB 1NEYA 1ZA3A 2DB8A 3O2WL 4QAMB 1FVDA 3C9NA 4P3CH 3AYVA 4Q4SA 3VXGA 2CCWA 4WSHA 4XB3A 3N17A 4AYID 1R3SA 3MAWA 1TPH1 1KJVB 2AGJL 1O6SA 4FXFA 1DLHA 2A7BA 2WIIA 4JN1H 2FO4A 5FWQA 3RU8L 3QUYD 5IR1A 1JUKA 1NM4A 4XISA 3RMEA 1SOKA 5EYWA 5EMJA 3BEVB 1DCLA 4UFHA 4K1GA 1W72B 3KVPA 4IMKC 2ZBTA 1JZ4A 2P8LA 3VPLA 1G9NL 2XTLA 5I71C 1H7XA 3AXMA 1R5WB 3L65A 2LR4A 2ABAA 4L3AA 2J1ZA 4XTDA 4WFHD 1A5MC 2IDUA 3L9BA 5B1AB 1XGQA 1OX6A 4Z1BA 1ADDA 1E5ZA 1KXTB 4DETA 5JH2A 5REQA 1C16A 5FF2A 4NQDE 4KDWA 4MMXA 7TIMA 1HX0A 5KBMA 5LLIC 4NI3A 2J7GA 1UM5L 4A2SA 3CT2A 2XDFA 1HKVA 1TEFA 5ESQB 4UNLA 4A2GA 4KZ0A 4DRSA 3PDOB 4AK2A 3BSMA 5ELIA 3JBG7 1IKFH 1WA0X 5GGVY 1IAMA 1AGDA 1I1FA 2N0MA 3BFWA 4N0YL 5JIPA 2GVGA 4GFSA 4O0KA 4ZR8A 4GBXD 2H8PA 2X1OA 3GDBA 2QDEA 2PS2A 2X89A 3ZT5A 5E5RB 3FH7A 3GW3A 2RCSH 4CAGA 3U2SB 2VISB 4DWSA 5KSWA 2VFHA 3W7RA 4FYQA 4R96A 4KK5C 2ZWKA 1EHLL 2AV1B 2GBTA 1VCFA 2VDGA 3CIWA 4QJ1A 3WH9A 5FEWA 3BD5A 5T1KD 5F2IA 2VX6A 5K39A 3AOFA 2Y85A 3WKQA 3ANYA 3NCEB 1YNTA 4L3EA 4A7QA 1DJSA 4PJBF 5ID0A 3NQGA 5KVFE 3EBAA 3MBEB 4YLCA 3WTXA 2J7EA 3SN0A 3FJ6A 3TA3C 4TSAL 2R2HB 3GWQA 3G6DH 2UWEB 5AW6B 1E9PA 1AD0A 2CD0A 2UZYA 2E3ZA 3M45A 1FVEA 5IFAL 5IBUG 5HXMA 4QISA 3MJ8B 3BPNC 2DPEA 4Z78A 1P1ZA 5J5DA 2QCGA 3N6QA 5JOPD 2D1ZA 4X2RA 3V55A 4A2EA 5JXQA 3FHEA 3GMQA 2FBRA 3QPXL 1Q2SA 2VXNA 2VYOA 2P7TB 4N85A 2ZOKA 3B34A 3JUZA 4KX7A 4DP5X 1NCWL 4M7KL 3JT0A 1A64A 3ZM8A 1AGFA 3MRDB 4E38A 3MP3A 4GFTB 4HUUB 4N87A 4GAAA 4ODSL 5H37H 5AZEH 3ULSA 4O00A 4FJZA 3VXTA 1F3TA 2YPVL 3WK1A 5GJMA 3Q2VA 5HQLA 4LC6A 3GTTA 3NQKA 4NG3A 1XGYL 3EO0B 3BZEB 4ZB5A 4ZQCA 3G5WA 2BY1A 3MS8A 6ENLA 4MKTA 5C09D 4TUJA 3UTOA 3DG3A 1BMGA 4GP8B 1AW1A 2FO4B 5EO9B 3L3JA 4GKOA 1HL4A 2X1IA 1MELA 3TBYA 4QSHA 1H11A 1IQWH 3S5LG 3C2YA 4BE6A 4DGIL 1JCTA 1VR6A 1N55A 2YSTA 3N4EA 4PR4A 2P8LB 4ANVA 1U58A 2NY1C 1NCUA 1F4YH 2CMRL 3IEAA 4JFVA 2ZX6A 4UQIM 4YDZA 2CRZA 2EDXA 5E2TH 1MSSA 5F3BB 2FZ8A 1CG9B 5DWUL 4F15B 4YQXL 4DJEC 3LEVL 3EGDB 2GAZA 2MOVA 4P49A 1JGLH 2QJIA 4QCFA 5MHSE 4IG2A 5JHDB 4NQSA 3HE7C 1RH8A 3MJ9L 3RL1B 5AC8A 4JRYE 2YK1H 2Z93A 1U2YA 1ZANH 3MRCB 3MQIA 4P5TD 3GJFA 3KS0H 1SLXA 4U1LA 4E5XA 1IC5L 1HO1A 2XN2A 1FRGL 4ETQB 3GVWA 2ZOWA 1WVZA 3I7SA 3OKMB 3SCMA 2XM1A 3GXDA 1OAUH 3DIVA 3AUVA 5EU3B 3AU0A 3HPLA 3I3BA 4H8HA 4XOEA 1E7VA 3FKKA 1A7OH 3HUJE 3L4UA 1NDMB 4IBSA 4IK6A 4NO3B 3PB2A 4C1KA 3L7EB 4FA6A 5JW3L 4ODXB 5F93C 2OXNA 5KITA 3VDGA 1U58B 4HJ0C 3MOAH 4ZI8A 4BZ2L 4I9MA 4NJJA 2P80A 2R69H 3L67A 3O3RA 4IMAA 1DQKA 3VXRB 3NZHH 1ZHLA 3FYIB 1E9QA 5F9JA 4U6VL 3TT3L 1S46A 4TMBA 1MCSA 3H54A 3TU9A 1LQBC 4WI4A 1QWNA 4OKDA 5KJ4A 4C6LA 4OKVA 3FQNB 2YWYA 3C5ZB 4L8SC 4PJXF 4D8ZA 4OLZH 4MMZC 4LLMB 3TBVA 5DEGA 2EDFA 4TSBL 1S2WA 2IC2A 4W9CC 1DL7L 3LKRB 2LTQB 3MHZA 5EO1B 3ABXA 2FFIA 2IO5A 4BELD 4WW1B 3UGUA 3HG2A 4Y7EA 2CA4A 1OLZA 3O0RH 3RTQD 5B3JE 5L2JB 5EORH 4RAUB 5DJDA 1XR9A 3BUYB 4QTGA 4N2YA 2YMXL 2ED7A 4QG9A 3ME0A 3ARTA 3CWNA 4JYFA 3CB8A 1X8CA 2N4IA 2Z34A 3D4CA 3UBXA 1FDZA 2AQOA 3KM8A 3V5KA 4PUJA 3GB7A 4FABH 2QCEA 4F48A 2Y5TA 4RDZA 3FO2A 4P5TC 4IW4C 7FABH 5CFAA 2VN7A 1AZBA 4WUKL 1R46A 1Z69A 4US5D 1G7MB 1KGYE 1L3WA 2QPUA 4HVBA 4GXPA 4JTCA 1A5FH 4L9YA 3H9SB 1T5XA 3UZQB 4LCWB 5EL1A 1T4KA 3QVQA 3VIMA 3QGVA 5CU9A 5D1ZA 5HYFA 3O45A 4UUJA 3TNMA 4Y9GA 3RVXC 1B88A 1HQRB 1SF3A 2PABA 3L68A 2RTTA 3PHOA 2O5YL 5ICXA 2ERJC 5C0GA 4PBGA 1HHIA 2HG5A 2Z64C 1NCWH 2VQ4A 4OLYH 2CLRB 1NBCA 4IRSC 2BXZA 4LIQH 1W8OA 5ANMB 2WVTA 4Z08A 3ERPA 1V7NH 2OEKA 2Z29A 4YU1A 3L3OA 1EVUA 3R19A 4OV5A 4M1DL 4IHOB 3DFSA 1OHZA 4UTAA 5A16A 4XZ9A 5E7BA 3QFWA 1A4KA 2J4WL 2F7IA 1J5OH 2VM3A 3VOCA 2KLSA 3KVJA 1XT5A 2V3EA 5DT7A 2ESVD 3EHBB 4E9WA 3P30H 5DQDL 1ZAIA 1L0QA 1W72L 2EPOA 2INEA 4GZ7A 4MVAA 3AYRA 3VWKC 5J12C 2Z91A 1CFVH 1RZIB 1K7FA 1VYRA 1SY6A 5CBIA 4HK0A 4G83A 4G3YH 3WD1A 1KBKA 4O51B 5GRZA 4BCXA 1BM7A 3QNZA 2Q7AA 5AW5B 4DERA 4AMAA 2WB1A 1R38A 3W53A 3QJXA 3BGAA 4Z7NB 3CAQA 3K6NA 5I1EL 1CZ8L 3PP4L 3D3VE 3FJ4A 2VCAA 1G6RH 2V2WA 1MCOL 2WMJA 2PRHA 1S5TA 3SDXB 4DNHA 3HG0A 5LXEA 3K6FA 4YXKL 1OAUL 5F7KC 4WO0A 4OZGA 4O9HH 4WU5B 2P48B 3DX3A 1I8IA 2VQ1A 5C08B 1IGFL 3SBWA 4BQ9A 3M0XA 3KPMA 4U5KA 2X7LB 4X6FA 3W1ZA 4DTGH 2A77L 2W91A 3V0WH 1DHKA 3DDMA 3TO2A 4JKWA 1LK2A 1NANH 3ARPA 5JOFB 4IFKB 3MI3A 3QNZB 4L56A 3WD5H 2X38A 3K71A 2AEQL 3T4WA 3GD1C 3VA8A 3G1HA 3OTRA 3OB8A 3FEQA 4K68A 4C6OA 3IIPA 2WUCL 3BYTA 3WNNA 3QZAA 4LVBA 3TW7A 1SOQA 2QVMA 1FHUA 1WUEA 1OP3K 4RMQA 1S7UB 1OZQA 1Q6LA 4XX1E 3MHFA 3P4OB 4EKXA 4QDGA 5DMIL 3RYMA 4YL4A 2MNRA 3HN5A 3ZDYE 4Z7WA 1JZ7A 1VFTA 1OFOA 1UXLA 3QEQB 4MGGA 2WBGA 4V15A 2ZG2A 4IWWA 1JCJA 1AD1A 2R0WL 4K5LA 4YZFF 1AE6L 1O75A 4HH9A 1C5BL 3Q06A 3WHE0 1WXJA 2GTWB 2OL3H 2LLNA 2YQ2A 4X4ZA 3L13A 4HNUA 5KVEL 3CNKA 2AJVH 4LEFA 1F6PA 4DZ8B 5IOKA 3GZAA 1HQRA 5IUCA 2WZMA 4XMTA 4Q22A 5D6DA 1NM9A 3SDDB 1E71M 4ZQKB 2OI9B 1S78C 2ZIDA 3BIKB 3N14A 1WQ5A 3M17A 4PTTB 4AQ1A 2B8OT 1URZA 2WZ5A 4ZXBC 1LZOA 5MEQB 3CFJA 3WMCA 4Y2LA 5E5MB 1KG0B 1HYRC 1FI8C 2X2GA 3W2DH 3NQDA 3LS9A 2Z7GA 3IDJA 2LOEA 1BGXL 3LPOA 4PIBA 5JW5A 5GS1B 4HGWB 1XSOA 2AL2B 4PMZA 4Q4QA 4Q8WA 4OJYA 1HXYA 3IDGB 3ARBB 4PJGE 4RGNB 3DGBA 4KJPD 5CZJA 3WSUA 3UCDA 1NUGA 3CFDB 1CFSB 1OW0A 3F7LA 1LEGB 3PQYD 3PRZA 5LN4A 1IF2A 3OBAA 3RLVA 4DAFA 4Y4KA 5G5IA 1WAEA 3SDDA 1KFWA 4W9HC 1K6QH 3MFGB 1MW2A 1X8FA 3NZ8A 4HC1L 4O5LL 3SCOA 2DUZA 4CVWA 2QBWA 1SSDA 3NM3A 1W72H 3U7BA 4Z3HA 4AMWA 4YSRA 4YSPA 5AVSB 1GS6X 1BQUA 1TJHH 3VI2A 1M05B 2DQ6A 4K3GA 1TOXA 2F1AA 3I9GL 3H0TB 4G80A 3RILA 1CFNA 3TN5A 3U3HA 4G71B 5D1ZC 2VRAA 4LLYA 2RMNA 1G9EA 4AXKA 3XINA 2H45A 2ED8A 3L4VA 3WEXB 4CVXA 1EV2E 1G1KA 2EDTA 2C91A 1VPOL 3NCJL 2ACQA 2OXHB 4Z7QF 2EVJA 2W5PA 3AU6A 2NY4D 1YNQA 2DU2A 1ZXKA 1YAIA 4DN4H 3A6CL 3O6FC 4HUWB 2R69A 4DPQA 3H3PL 3WS6C 1T3FB 4PJAF 5DFWH 3HS0A 1OCNA 4XVTL 1HFUA 4I77L 3BGFC 1SXAA 5HHVL 3X14B 2RDWA 1PX4A 1N4XL 1S2EA 4HUXB 8PAZA 3ARFC 5GJNA 2DM2A 4E5XB 3VC6A 5MERA 1B31A 4NXKA 5AVUB 5TGBB 1QHZA 2G0KA 4LP8A 3T2NH 3QRHA 4XVDA 1E5UI 1NCDL 3K71B 2ICWA 3PHQA 2VEFA 4ZPTA 5I3FA 3GZKA 4JHUA 4ZMYA 1EVTC 2D4DA 1O12A 3UTZA 3VFGH 4MYAA 3WSQL 5KJRH 3MVTA 3HG1B 4P2OA 1OD9A 1JZ8A 1EYEA 3QZLA 2XA3A 4NQVA 5KVFL 3OJGA 1FL6B 2I85A 4Q2ZA 3TBTA 1J9RA 1BQLL 1T3FA 3FQUA 5EUOE 4NP7A 1HWHB 3MUHL 5TIMA 3WLLA 3DVGB 2QQNH 4G1MB 5BU9A 2OXHA 3BAKA 4FL4C 5T5NG 2H0EA 2NLYA 3IJSB 4AD1A 2X1PA 4ES4A 3FYYA 1A0QL 4MA7H 4HIEA 3H56A 5AFAA 1XAKA 3VGFA 1VZIA 5K9QG 1LEKA 3M0ZA 4S3JA 1JPTH 3GU2A 1CGYA 5CJOL 3ANVA 2MSPA 4AYEC 3LA4A 3DENA 3CBRA 2ZAGA 1QOKA 1JWUA 3CVIH 3SBRA 4JRXE 2X4OA 1AW2A 1V0LA 3LGEA 4S3AA 1QFWL 4AEHH 1U93B 2KLRA 2NW2A 4FI7A 4LCWE 4IJRA 3KS0J 4JIIX 4LVEA 1KY6A 4GIAA 2A3CA 2FNWA 5FO9A 1TIUA 1LYXA 4X50A 5FO7B 4M43L 2KPNA 3KLAB 4FQCL 4DAGL 4ECLA 2H1LM 5LBGA 1D7KA 2DJ4A 1LGVA 3FUDA 5DJ6A 5I1DB 1KULA 2UVEA 4DP8X 4U4MA 5F7DA 3KS6A 4U1HB 3M8OL 3QEHA 3DXAE 4N0YH 4AZ7A 1QUMA 2YR3A 1E4IA 2X4RB 5EIIB 4XPTL 5I8CB 1Q9OB 5T5FL 1PIFA 3RZCC 4K9EH 2BVPB 3DX4A 3L3GA 3C2VA 5HYQA 2BSTA 1XKYA 2P76A 1Z7AA 4Q8UA 4O58H 3CSTA 3QC6X 3ATFA 4LLUB 3U7YH 1K6AA 2X1TA 2A1WL 4LDCA 3EX2A 2OGJA 4QS6A 4WVXA 4X3ZA 3RR4A 2B7NA 1OAYH 1ZEAL 3OGVA 1MREL 2KL6A 2VKXA 1UJ3C 4M48H 3LH8A 5EO0A 5LUMA 4X5PA 2NWRA 1AAJA 5HSFA 4XX6A 2SEBB 4YO0A 3ZJ8A 4OM0L 4A38A 3TJXA 2YEVB 1B4TA 3WUGA 2CBTA 1XF5B 3TVMB 5I1LB 1SVCP 4PJIB 1P7QB 1E6XM 3QLLA 2BXYA 1DUYA 3N1PC 3N43F 2VDLB 3LCHA 3EW3B 1EAOA 2YDAA 5I73C 1IUZA 2EECA 3BT2L 3E0FA 1F3WA 4LGXA 3TZFA 4G5ZL 1E4JA 3V6FA 3W82A 1WAUA 1NL0L 2GJXB 3CK5A 3W2KA 4QRTB 5AVYB 1J0KA 5I82A 3H4FA 1ZIBA 3LIZL 5LQBL 3U2ZA 2W65A 4K4KA 3HAEH 1QMLA 3BW2A 2V2XB 1NCOA 5BZZA 4JRXD 1W2VA 1XGTB 2HJFB 4NQEE 4WUUD 2ALRA 3MPGA 2DAVA 2N3JA 1SJEB 1WV2A 4CD7A 3L48A 3UIZA 3IJYB 5JHBA 4JANA 3C9NB 4MCZA 3TYAA 4P4KC 4AZHA 3D8MA 2AGTA 2BS9A 3EGSB 4GSQA 4X6FB 2DQDL 3FSWA 4Z2HA 2YBRA 1N7MH 4ZGYA 3FTSA 5TQ0L 2Z4QA 3O2DL 1T8QA 3CXDL 4KRPC 5MKGB 1A0DA 3HBQA 3TFBA 5KYXA 4U1KA 2JNZA 3ISYA 4XBEH 1XFCA 4KEMA 4KVPA 1KIPA 4TQEL 3D85B 4P5KA 4CNUA 2PYEB 3W5MA 1TRDA 3BJFA 3EXJA 1KV8A 3REWA 1FLRL 4GUPA 3VD9A 1OEPA 3FY1A 1XF2A 1PD1A 1CQKA 3DJSA 4N8VA 1FBIH 2G41A 1DXIA 1F00I 4W9DC 1DJNA 5T3XL 3BLOA 1XGRB 3I74A 4Z76B 3CBKB 5DJ2A 5K1NA 2IV9A 4U05A 3FFSA 1U6AH 1MCPH 3R0NA 4NERA 2DSVA 4Y5XA 4QRRE 1YQVH 1EC8A 2PDBA 1PG7H 4HA4A 4B97A 4LC8A 1U1JA 3ARBD 1KTCA 5I66B 1SJEA 3UJFA 3OPZH 4AX7A 3DNKA 4K8RD 1G0DA 3H0TA 1IVLA 4HAGA 4MXQC 3SY0B 5DRNA 4RWHA 4E2OA 1J5HA 4Q9QH 1AZ2A 1KR0A 2JKAA 3FH8A 2XI9A 3DG7A 1EUTA 4MNLA 2XQBH 1FL3B 2A9ML 4ZE5A 6TAAA 5FYLE 2VDRH 35C8L 5D2LA 1WD8A 3RAOA 2Y7MA 3JWNG 5GJTL 3WMPA 3SE4C 1CC3A 4OU1A 3RLGA 4PJFF 5IV2B 3OLDA 2W67A 3OC8A 3SQBB 4BYHA 5A95A 2Q76B 3ARQA 3VXME 2QCMA 3GVRA 1FGVL 1EHAA 5D05A 1TQBC 1QEWA 3MMWA 4MKVA 1K8IB 3V75A 3HR5B 2UUDK 2J1YA 3RI5K 1KJMB 3F7PC 3TPKA 4J4PA 2W0PA 4ZFOB 3E6EA 4NHUB 3IFNH 3ZY7A 4DYJA 4Q6IC 3TA3D 2CZNA 2GOUA 4P46A 3CL8A 2DQGL 1OIMA 3PJSB 3MJ8A 2IPKA 2O6CA 2YGOA 1IFHH 2ZICA 3O0LA 4W6XB 4ZYKA 1TX0A 1RK0B 4KI1A 3W7NA 1BLIA 1HXYB 1KLFB 4O1AA 4FXKB 1XDMA 4JLRA 1B9KA 1IAIH 1QSFD 3EEGA 2ZYRA 3MYZA 5HMDA 1Z3NA 3NYKA 4OLVH 1ZHNB 4L4VB 2ATPB 4FNQA 4HWUA 3JYBA 4BQBA 1SLVA 1PV8A 2A0NA 5C3TA 4N0RA 3GAKA 4JICA 1HZLA 1KOAA 2PCFB 4N8PA 5DVPA 1IBDA 1ZLPA 4EI5A 5EG6C 1S2CA 1KJMA 4AWJC 2I5GA 4J2QA 3BXWA 3X12A 2HVJA 4JO8A 4YHEA 4ZTYA 5J13B 2E6QA 3GS4A 4RMUA 3I6KA 2ZF9A 3DGGB 2X6AA 3CC5B 3B05A 5CD5D 2NX9A 5I15H 1HU8A 1I85A 3GXMA 5FO7A 2WP3T 3ALWA 5I5JA 2GQ8A 2NXIA 4NY2A 5AAMC 3A6BL 1EJOL 2A85A 1UVQB 5I5MA 1REIA 2VDNB 2J57A 3CPLA 4EAMA 1TG8A 3B7UX 1DVFB 4DBEA 2PWVA 3BWWA 4JFYB 1BG4A 1LTXA 3MBXH 3NCMA 4TTDC 3LXAA 1T1ZB 4I9AA 3W7HA 4LVNB 4K7PH 1RU9H 1DV7A 3L5IA 3UC0H 1A3LL 2X10A 3R12A 4A3UA 1HEZB 1RXLA 1MFBL 4JKNA 2XQYG 1IL1A 4Z1DA 4AZ8A 5I18H 2A9AA 2F6XA 3VOHA 1ID2A 1UT1A 3OKDA 4JDZA 2DGAA 3RXZA 2I9TA 4JR5A 1N7ML 3PZQA 3NEEA 1EGJL 3QG7H 2F6AA 3NSYA 3NGFA 4R33A 3L0NA 1FH5H 5TD4A 2OQJB 1NCIA 5HPOA 1O7SA 4KK9C 5AN7A 2W95A 2NCMA 2IW0A 3MRCA 2CGRL 4FFYL 3WLNA 2WNWA 2DZPA 4KH9A 3EZ4A 3LBOA 3SUWA 3EOUA 3KFTA 5IF0B 2YA2A 3ISIX 1ACXA 1FVDB 4WI7A 3T65B 1RJYA 2I9UA 2F5BH 3T6QC 2V5DA 3JRKA 4D2JA 3OKKB 3HNSH 3WOVA 1H62A 1CICB 2IQDA 3PP7A 4YVXA 5DD3H 3PGDB 3KYNA 4NP4L 5CJMA 1OAQH 1NTHA 3LLXA 3WLIA 4UTKA 1RUKH 4RFOL 3A22A 2FCBA 1T7VA 2ZCKL 3A4EA 2AJUL 4A2LA 3BWAA 4PRDB 5JIDA 2C7UB 4HVXA 5I77A