2XIIA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with an extended 9-fluorenone iminosugar inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 157
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xiiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xiiA01
3UETA 2JIWA 3GYCA 1TVNA 1G5AA 1UASA 1OB0A 3UG3A 2ZX8A 4AMXA 1SMAA 4IUGA 4L4OA 3U5YA 2ZUSA 2XPKA 4QLLA 3EYPA 1TQSA 3NUKA 4FLQA 2BVDA 1R34A 5GNZA 3WDPP 3K4AA 1C3FA 4M1RA 1EXPA 4D71A 1PX3A 1W9PA 4GZIA 1CNVA 4J3XA 4FK9A 2Q8XA 3I3BA 1C8YA 3ZQ9A 1J0YA 2W66A 4UQBA 1SMDA 4PSRA 4C7FA 4AZIA 2FGLA 7CGTA 3OLGA 2TAAA 3A5VA 3NSMA 3LRMA 2JFEX 3E1F1 4AD1A 1HP4A 1BQCA 4AZBA 3CBWA 5JBFA 2DQXA 1KWGA 3MO4A 3ZT7A 5A1AA 1Q4NX 1JIBA 1ESWA 3WY4A 2PC8A 1J0KA 1V6WA 3OB8A 2BVTA 1ODZA 4HPHA 3ALFA 1QPKA 1BGGA 4CD5A 5ABFB 1UKTA 3GXNA 4TVDA 1UR0A 4H8UA 2WHMA 3EDKA 1QHPA 3WBAA 1SZNA 4Z2HA 1NH6A 3VIGA 5BXSA 3UESA 4EAMA 1JYNA 1I1WA 1H2JA 3DX2A 2VZOA 4Y7EA 5A8NA 4U33A 1EO5A 5DO8A 1PPIA 5LA2A 3CUIA 3CZJA 3EMZA 2XTKA 2VX4A 2QMKA 1HL9A 2XGIA 3W82A 1NWUA 1HXKA 2WLYA 1HVQA 4B15A 3AICA 1IZKA 1ZBCA 5M03A 2ALWA 3SUVA 1ZJBA 4E8DA 1E0VA 1PX4A 1UWTA 1GVIA 5BRQA 2EACA 1GONA 3BCDA 3ARRA 1HX0A 2WKLA 1V0NA 4PMZA 1J12A 1UYQA 4AZHA 1FOBA 2A3HA 4CD8A 3GBDA 3CTTA 1OM0A 3EJQA 3SCPA 1UWSA 1WZAA 1RP8A 3RM9A 4YPJA 4J3WA 4CN1A 3NYDA 2X2JA 4Z2GA 1CTNA 3A4AA 3HMCA 3HG3A 1C7TA 3W4RA 3CUJA 1V6YA 2EJ1A 4FNQA 2BXYA 4FLSA 2FGZA 1BF2A 4UQ9A 1E4MM 3CZ8A 2CKRA 2ZUTA 4W89A 4WSJA 5ABEA 4Z2KA 4YHGA 5FL1A 4V28A 4LYPA 3K1DA 2OSWA 3RIKA 2W4XA 1WZMA 5BXPA 3VIIA 3NCOA 3LPGA 2WSKA 1A3HA 1PIGA 3EBVA 2QF8A 5FD0A 2OLHA 5E1QA 3HG2A 4GZJA 3CZNA 3H55A 1V02E 1JAEA 3CIVA 4PUDA 5JBEA 1E6QM 1CLVA 1E55A 2G3IA 3MUZ1 4K68A 5CQ1A 3U7VA 2WHKA 3NJ3A 3VX0A 5KZ6A 3ARQA 3VSTA 1O6IA 1CLXA 4QLJA 2IXVA 2OWCA 3J7HA 3L4UA 3L4VA 1OINA 2VI0A 4ATLA 4NRSA 3EDJA 3GBEA 1DEDA 4E4PA 2EEXA 2DIEA 1WDRA 1MQPA 1W1TA 4Q22A 5AYBA 2E40A 3K46A 2FYVA 3EJTA 2BVYA 4MB5A 1LL4A 2VZTA 3CH9A 4AIUA 5JIWA 1ZJAA 2EPMX 5GQBA 1DWFM 1BVZA 3SIMA 2VL4A 1J10A 1VEMA 3KL5A 1HKIA 1E6XM 3G6MA 3ARVA 4GI8A 2YLAA 4GKLA 1Q6EA 1K9TA 3WMBA 1QHOA 2D22A 2XUCA 1R33A 2WWCA 4CN4A 3DYPA 4UTFA 1FH9A 4AIEA 4MB3A 2BHYA 5I79A 3WDRA 3VDBA 1KCLA 3D51A 3S5YA 4W86A 1XCWA 2NT0A 2XVPA 2O9RA 1CZ1A 3ZSSA 1JDCA 2VRJA 4J3TA 1N82A 3TTQA 4P7OA 3D4YA 3WNNA 3N12A 1BYBA 3AFBA 3N9KA 4ACZA 4RE2A 4GQRA 2XVNA 3EMCA 2PWGA 1CXIA 2F7PA 3G6LA 3GH5A 2HVMA 4TX6A 3WQWA 4W8BA 2XSAA 3FAXA 8CGTA 5DT7A 1QNPA 5ABHA 4AW7A 1X6NA 1TMQA 1JFHA 3A21A 1V6VA 2E9LA 3IK2A 1QI0A 3VU2A 1RPKA 3WF4A 4PEEA 2HISA 3EMQA 5ECUA 5EMYA 4PUEA 1LL6A 4H41A 3WD0A 1JXKA 2XN2A 5I24A 4EANA 1UWQA 3ARTA 2V3DA 3WH9A 5DEZA 1JL8A 1XHGA 1WNOA 3WH7A 4MB1A 4MJ2A 2XG9A 4XX6A 1H09A 3THDA 4LQ1A 5A8QA 5CSYA 3GXMA 1FHLA 1H41A 5E09A 1TCMA 2OSYA 1TR1A 1UR9A 4W8LA 2PB1A 2VR4A 3CZEA 1GPFA 4WLCA 1WDQA 3MI6A 2WZHA 3N17A 4WIWA 4CD4A 2VX7A 2ZUNA 3TA9A 5IXEA 3CLWA 3LRKA 2VCBA 3K4DA 1W32A 5AC5A 1BGAA 1W91A 3WEOA 1ZB5A 2J75A 2QMJA 3ARWA 5GPRA 2WMGA 1UKOA 4UQDA 3WQVA 3VGFA 2WB5A 2VZVA 1KR0A 3ARXA 5AY7A 3FY1A 3BAXA 1K9FA 3UR7A 3OZOA 3SCOA 3POCA 4OGZA 3VOCA 2X0YA 2XM1A 5E6ZA 2WMHA 1XGZA 1CXKA 1S46A 1KQZA 3VIMA 1NWSA 2ZUMA 3WNLA 5LYRA 1J18A 2DT2A 3WNKA 4CCCA 3RDKA 3SUUA 5HDRA 4IISA 5A6SA 4TTGA 4OIFA 5HOSA 1KCKA 3KLKA 1UR4A 2PI6A 5M17A 3WD1A 2V3EA 4HP5A 1JD7A 3RJXA 3A6OA 2E3ZA 4DUXA 2FHFA 4KMQA 2D0GA 5EB8A 3WUGA 5HPCA 3WQ8A 2ZICA 1J0IA 4N42A 1BLIA 4HOZA 3WF3A 3N04A 1J01A 3RPMA 3WFLA 1E43A 3W29A 5HNNA 4CU6A 5M3WA 3W6LA 2W62A 3S6TA 5A2CA 8A3HA 1LQ0A 2WWDA 2JE8A 3VM5A 3OIHA 1XC6A 2XGBA 1UZ4A 4D1IA 2YA2A 1QOXA 3GH4A 1QNSA 4QP0A 1HXJA 2IGTA 3EJUA 3I3EA 4PMDA 4V27A 2G3MA 4BQ2A 2GFTA 1UKPA 1XRVA 2EO7A 1GNXA 2ZWYA 1XH2A 1UA3A 1R87A 4CUCA 2ESCA 1CWYA 3DX0A 3VGGA 2XYLA 4EKJA 3GDBA 1BVNP 2J78A 1UD8A 3VUPA 4FNSA 3QR3A 1R7AA 4M56A 4PCSA 2J7GA 3DECA 2CBJA 1U33A 5BRPA 5EFFA 1CXHA 2ZUVA 4PCTA 4UFLA 1C8XA 1C93A 3CZSA 3O9NA 1WO2A 1E0WA 4A4AA 2G8ZA 2XFRA 3ZT6A 4AEEA 1MQRA 5FIPA 3W53A 1B1YA 3SCNA 3AHXA 1JI1A 4DO5A 2DGAA 2D73A 6TAAA 3PBGA 1KXVA 2E0PA 3PN8A 2WC7A 4PMUA 4GZEA 3II1A 3U5UA 4D6CA 4CVUA 1V3JA 1OCQA 3VTRA 1KGUA 3WDHA 2DIJA 3B9EA 3VD9A 3QHNA 4QAWA 1LG2A 5LA0A 3BVTA 3GXFA 1Q6DA 1U2YA 2WMJA 3VM7A 4ZFMA 4NF7A 4F8XA 1HJWA 4CN6A 1Y7VA 1HJQA 4GO9A 1KFWA 1GHRA 3WMSA 3CHCA 4UQAA 1B3ZA 2XIIA 2W67A 4D6HA 3WIJA 3TTOA 4ZE5A 4CKQA 4Z2JA 3W27A 1ZBWA 3THCA 2OYMA 1UR1A 2DEPA 5CPTA 4UQCA 2WC3A 3BVUA 3F4VA 1ZU8A 2GUYA 4XZWA 2VRKA 1FFRA 1HKJA 1JI2A 3CC1A 3HG5A 4M24A 4J3SA 1TQVA 3BUIA 2V5CA 3PZTA 4MADA 1HWWA 2BV9A 1FP8A 3BAKA 1BSIA 1BYAA 1OIMA 3OLIA 3WL1A 1U30A 1E72M 2ZUWA 1F4HA 4OZOA 1W9XA 2GSJA 5CGMA 2X1IA 2O9TA 1EIBA 2QPUA 1DWAM 2BHZA 2EPOA 3POHA 4A3YA 2UY2A 1HJSA 2YL8A 3AS3A 3T2PA 1T0OA 1CGWA 4NI3A 1UUQA 2CEQA 1RP9A 4GO8A 1LF1A 4CCEA 4ZXLA 1QNQA 4AZCA 3HG4A 1MVYA 2O92A 3ZMRA 4D6GA 4UZSA 3WENA 1DHKA 2UY4A 1TFVA 4UNIA 2YA0A 1JGIA 3WQ5A 4OUEA 4TTUA 1XH0A 1EA9C 1KBKA 4CGTA 3VGHA 2Z1SA 1KB3A 4HMDA 3WF2A 3DC0A 3K8KA 3AXIA 1SFSA 4LYRA 2WZEA 4MPKA 2VX6A 5TD4A 3CMGA 1GQLA 5CLTA 2Y24A 1ISXA 2VUYA 1KXHA 1E6RA 5A6BA 1B2YA 3KWXA 4CD7A 2OYKA 3VSUA 3EDDA 1WZLA 4P7NA 5HBFA 1BYDA 3FAWA 1ISYA 3WDIA 3VD5A 1OGBA 3SCSA 1UKSA 4TVCA 4W88A 3BCFA 3TV8A 2YL5A 4EE9A 4URIA 2WVUA 1JNEA 1PZ3A 3GNRA 3VD3A 3AQUA 4TOQA 1EOKA 1MW0A 4MNMA 4U3AA 3BVWA 1DWJM 2Y2WA 1R46A 1F4AA 5A6JA 2XSBA 4J7RA 2GJRA 5IHRA 1LWJA 2ZXDA 2WCAA 3ARSA 1TUXA 2FHCA 4MAVA 5DFAA 1R7OA 2ZOXA 3GM8A 4KGJA 4BQ5A 2VMFA 3RCNA 3NIYA 1MW3A 3L4WA 4W5UA 3T2OA 1JD9A 4FNRA 3SUSA 3WUFA 3WY1A 1HJUA 3QGVA 3ARYA 5A6MA 2WMFA 2BY0A 1V0MA 2VTFA 3B9AA 1UA7A 9CGTA 1UH3A 1TZ7A 1NARA 5GNXA 4LYQA 1V0KA 2GK1A 2RGLA 1H0IA 4HMCA 2GDUA 3QHOA 3ZT5A 2V38A 4LXFA 3GTNA 1TE1A 2Y4SA 1AMYA 1B90A 3AZRA 3MSDA 3A3HA 4ZXOA 3ECQA 4AD3A 2A3AA 1UD2A 3ZJ7A 3LPPA 4F66A 5CPQA 1VEPA 1AVAA 3A22A 1OWQA 4HA4A 1C7SA 4UFHA 1B3WA 4WJXA 2IUZA 2CKSA 4BS0A 4L4PA 4M81A 4B16A 1OBAA 4FLRA 4PMRA 4KRUA 3DX1A 2VZSA 5A6BD 1E71M 1W1YA 4HZ8A 4NRRA 3N13A 3AHVA 3WH6A 5IHSA 5I77A 2D3NA 4UFMA 1W1PA 3EDEA 1FH8A 3RM4A 2AOSA 2JALA 3VDAA 5BWFA 3TONA 2DH2A 2YL6A 5FCZA 1ZL1A 4GIAA 1JZ6A 4D1JA 2X2YA 1MWOA 1ECEA 1E1FA 5CXPA 2XWDA 4NZFA 2BFGA 4AXNA 2QHAA 2YBUA 1CGUA 2J74A 4P8WA 1WP6A 4PTMA 5D9PA 4YHEA 1HNYA 3AZSA 2D23A 3PZIA 3AHTA 1GORA 4MNKA 4PMOA 3BMWA 2B31A 1WAWA 1J11A 2MANA 2VO5A 3CO4A 2VURA 4JHZA 4J3UA 4MTVA 4Z2LA 3GXDA 3KE0A 3FHQA 2OWWA 4BA0A 4PN2A 1KXTA 2G3NA 1UWUA 3WL0A 1XD0A 2OSXA 2BY1A 2DT0A 3W37A 1TG7A 1E9LA 2VVNA 1ZS2A 3APGA 3O2LA 2CNCA 2VQUA 1NQ6A 1H0GA 3EJRA 2D0FA 4AY1A 1EH9A 2J7HA 3SCTA 1XD1A 1ISZA 1UHVA 4WKFA 1R85A 5D8WA 1W1VA 3PHAA 3TTSA 4AZ7A 2G4FA 3AS1A 2WMKA 2CERA 3SUWA 3M46A 1H3GA 3AMKA 3BUPA 2F8QA 4Z2IA 1CXLA 2WCSA 3OGVA 3B9DA 4NZJA 1TQUA 2EQDA 3VILA 4KWUA 4BCEA 2E8YA 3VSVA 3IJ8A 1UD5A 3D3AA 3ZR6A 1TA3A 3GXPA 1H1NA 1DP0A 2F7OA 4JFWA 1J0JA 4J27A 3AMDA 2YFNA 3AMCA 1G0CA 1ITXA 3KLLA 3W25A 2EXOA 3AROA 4FNPA 2PBOA 3T09A 1QI2A 3CMJA 4AC1X 1L0PA 2WKGA 1AQMA 4M8UA 3NDZA 3WKZA 5A6LA 4U2YA 2J79A 3ZR5A 3AS2A 3BLPX 2DT3A 1V0LA 2CHNA 5C8BB 1KTBA 3CUGA 2V5DA 1FP9A 1MQQA 4PMNA 3GNPA 4U3CA 3WH5A 1PBGA 1C91A 4FNTA 4PRWA 1M04A 2BS9A 1PEZA 2YKKA 1B3XA 2D20A 5AC4A 5EFDA 3MS8A 4XUYA 1EQCA 1VAHA 3ZJKA 1B3VA 2PBGA 2J7DA 5CZKA 1TVPA 2GJXA 2ZX7A 3QHMA 4PYSA 3QOMA 1QWNA 3CUFA 3T08A 1G01A 2ZXBA 3AIRA 4JAWA 5C70A 4CU7A 2X09A 2O9PA 2UWFA 4M29A 1V3IA 4JZ5A 2CBVA 3N11A 3W26A 2WMIA 3WUEA 5A8OA 4D6FA 2PF0A 1WB0A 2Y8VA 1W9VA 3FN9A 2BHUA 1VJZA 4UCFA 1D2KA 2WXDM 5LA1A 4C7GA 1GOKA 3VIOA 1UD4A 2WM0A 2W91A 2DSWA 1E5JA 1OIFA 3CGTA 3GXTA 4V2XA 1VBRA 3VNYA 4CVWA 4YN5A 4TVUA 1JG9A 1VEOA 3ALGA 1QI3A 2OYLA 1XH1A 2ZX5A 3BAYA 1W2VA 3WDQA 1H5VA 3W0KA 3W38A 2FDMA 1VJSA 2WCGA 4XV0A 1XYZA 4TX8A 1CBGA 3MUY1 2ZX9A 3AMLA 3GH7A 4DWSA 1DWGM 4H8VA 1V6UA 3WNPA 1HN1A 1VENA 3HN3A 1JZ2A 3A47A 1E1EA 1E4IA 2YOCA 1QX1A 1UOKA 3NDYA 3MMUA 2CCRA 4HA3A 3RO8A 5DT5A 4UFKA 3AHYA 3L4TA 4ACZB 1MYRA 4OJYA 3D4ZA 2AAAA 3BVVA 1J0HA 4M82A 1G94A 3RMEA 2J8GA 2V3FA 3OLEA 4AZ5A 4BZYA 3SCQA 1MXDA 3CPUA 1MXGA 1E70M 1DWIM 2WVVA 2D3LA 4PTWA 1PJ9A 1QW8A 2J7EA 3AIBA 3NSNA 1CECA 1LJYA 2E9MA 3EJPA 2VC9A 3OBAA 5CJ5A 5I5RA 3VPLA 3WD4A 1NOFA 1D3CA 4RE3A 4WKHA 2ZWZA 3JUGA 1DTUA 2VR5A 2CITA 1E4NA 4W84A 4M80A 4MB4A 1MW2A 1YQ2A 2WZIA 1J9YA 1R47A 3MSGA 4OOUA 1HP5A 3VGDA 3AOFA 1GCYA 2FH6A 3AXHA 3AIQA 5JBDA 2DSZA 4UQEA 2F18A 2PWEA 5CGTA 4CCDA 3S2CA 1HKMA 3OA5A 1C8QA 2PWDA 4H2CA 1KWKA 4QFUA 3AISA 3IAPA 4BQ4A 1ZBVA 4DM2A 2XFFA 6CGTA 1VBUA 3W81A 1JFXA 4ATWA 2WVSA 1US2A 1JF6A 2F7RA 1EQPA 5CPSA 2XM2A 4W5ZA 4CU8A 4DWSD 3AIEA 1KR1A 2XVGA 4MNJA 3IGUA 1UD6A 3WNMA 1FA2A 4D6DA 4NXSA 2A3CA 2WHJA 2VT0A 1JNDA 1EDTA 1W9UA 2DSUA 4JCMA 1CGTA 4GPNA 1JYXA 4JL2A 3WNOA 7A3HA 2XHYA 1KBBA 3BSHA 3TOPA 5ABFA 2DPEA 3U57A 1CDGA 4X9YA 3VNZA 1GHSA 1B31A 2DT1A 3LXAA 4B3LA 4AWEA 4OOZA 2XVKA 1RD6A 2WAGA 5DF0A 4E8CA 5CLWA 1IV8A 1E5NA 4UZUA 4GXPA 1UKQA 1K9DA 4JKKA 3VD4A 3WFZA 3AIUA 1AQHA 2ZE0A 3WN6A 1GJWA 3H54A 3BAIA 1GJUA 3SCVA 5JUVA 4UFJA 3WH8A 3PZGA 3D5HA 3BMVA 3DDFA 1R75A 1ZBKA 3SCRA 1NOWA 4H8HA 5BXTA 2VOTA 4R5EA 5BROA 2VCAA 4R27A 1QNOA 2J62A 1VIWA 1K6AA 3EDFA 3MV01 3BC9A 3AIWA 1SR0A 4AD5A 5E9AA 4D6EA 4ZE4A 1OD0A 2WYSA 3GXIA 4AYGA 1W9DM 1WDPA 3IANA 3IJ9A 2CESA 1BPLB 4AD4A 4UOQA 2UY3A 1W9BM 3PZ9A 1C90A 3M6DA 3ZOAA 4U31A 2GJPA 2JEQA 5BYWA 2VJXA 1UG6A 4AMCA 4AD2A 4PMXA 3DHPA 1EO7A 3PTKA 1I75A 3UEQA 1E6PA 4ZENA 2NSXA 4WF7A 5A3HA 4XZBA 1E3ZA 2CBUA 5I0DA 3PZNA 3WSUA 1UR8A 3VMOA 3W24A 4TUFA 4DUWA 2C8NA 1V3KA 3RJYA 2ZIDA 4W7WA 1E73M 2G41A 1JXJA 2ZXAA 3LXCA 5D9NA 2YLLA 5E6YA 1FHDA 1NP2A 3MMDA 2X2IA 3AZTA 4F9DA 2WK2A 3MUIA 1LWHA 3T0AA 1UD3A 3L2MA 3QOKA 2XN1A 3FW6A 4UFIA 2YDRA 3EJSA 1E56A 4E2OA 3LPOA 3VIHA 3UCQA 2F2HA 1HVXA 1OT1A 1KGXA 4S3JA 4AZGA 1JZ5A 4IM4A 5HPOA 3AMGA 4QCEA 3WUBA 2X2HA 3SURA 3T0BA 2WPGA 4DM1A 2RGMA 1QBBA 1XCXA 1EOMA 1W3KA 4PMVA 1QNRA 4KRTA 2GVYA 1V08A 1QBAA 4OBRA 1V03A 3BAJA 3M7SA 1B0IA 1MW1A 2F7QA 4ML4A 1NP0A 3VKKA 2DSKA 2WW5A 3RILA 4CD6A 3K8MA 1AQ0A 3GNOA 4BQ3A 1CEOA 2EABA 6A3HA 5A6KA 4GINA 1UR2A 3ZM8A 3A4WA 4X0VA 1FFQA 4HZ6A 4S3KA 1ODUA 4AMWA 4WKAA 4B9YA 5DMYA 4U5IA 2EBNA 2JF6A 1QVBA 1Q6GA 1CGVA 1JYVA 5KEZA 4LGXA 1QI5A 5HXMA 1HKKA 1K9EA 4UOZA 1UH2A 3DHUA 3WQ6A 2J7BA 4DWSC 3A24A 1E0XA 4WSKA 2JEPA 5FOOA 1DWHM 3TTYA 4XB3A 2WBGA 4IPNB 4QDMA 4AD0A 5D9MA 5IFTA 1B3YA 2J7FA 3MUAA 4AZCB 3MKKA 3LPFA 3AIVA 3ZO9A 3F5KA 3A23A 3T0DA 2Z1KA 1EGZA 3SCWA 3ZJ8A 2J77A 1LLOA 4AZ6A 4UOJA 3WBEA 3M07A 4JHOA 1C92A 2WNWA 4DUVA 3CZLA 5AYIA 2DSVA 2BY2A 1JF5A 4JKMA 3VVGA 2FH8A 1PX8A 1VF8A 1V6XA 3DYOA 1TQWA 3K8LA 4JKLA 1E6NA 7TAAA 4DO4A 1HL8A 4AEFA 2OW7A 3UERA 3N15A 5D8ZA 3FXYA 4ACYA 4ATDA 4BF7A 4F9JA 5A6AA 3L2LA 2W61A 3MMWA 3BGAA 1US3A 1BHGA 4EK7A 2JIEA 2FHBA 4W87A 3BUBA 1QHZA 2UY5A 3TP4A 2D0HA 1L8NA 3O6AA 2PWFA 2XVLA 1ITCA 3ZJ6A 1GOIA 4JFUA 3AS0A 2VRQA 3FHAA 1H4PA 1YHTA 4W7UA 2CXGA 4MJ4A 2QPSA 2XFYA 1EHNA 1B9ZA 2G3JA 2DDXA 4P8XA 4OKDA 5E0CA 3LMYA 3PZQA 4P8VA 4KGLA 2CPUA 2YJQA 2EPLX 3DX3A 4HTYA 2NT1A 4B3KA 2X8RA 2NW0A 4AIOA 1OGSA 1BFNA 3WF0A 1GVYA 3VDHA 2O9OA 4U5KA 2D1ZA 3F5LA 1CGYA 3PTMA 4QCFA 1OSEA 5D9OA 2C0HA 5A94A 1WDSA 4HU0A 4X0NA 1O7DC 4P8UA 1WE5A 5IDIA 5CSUA 2GK1B 3ZIZA 1E6ZA 4OBSA 3DX4A 2ZX6A 3CZGA 1E4LA 2J4GA 5D4YA 3B8SA 3BSGA 1XSIA 1W3LA 1GOQA 1WCGA 2J25A 3F5JA 3BUQA 1Q6FA 3U7BA 2WSPA 3MANA 4MDOA 1NWRA 3KEHA 5M5DA 5C71A 3VD7A 1H49A 5I2UA 2JF7A 3W6MA 4MDPA 4FNUA 2FE0A 3WEZA 1E40A 2E4TA 4P7QA 1ISVA 3PTQA 3MU7A 1M7XA 5FL0A 4LPCA 3SCUA 2J47A 4PTXA 2PWHA 4FLOA 2X05A 1QWUA 2C7FA 1VFFA 3IAQA 5I3DA 1MFVA 5A95A 2W92A 1NM9A 2F1AA 4H7VA 2EADA 3ARPA 2GDVA 3AYRA 4J3VA 3VO0A 1WKYA 1XV8A 1HJVA 2CETA 5ABGA 5F7UA 3LX9A 3CV5A 1TQTA 4GQQA 4W7VA 2XIBA 3VMNA 4JFSA 4MAZA 2VVSA 4D72A 1E3XA 4QLKA 3KL0A 3BVXA 1XSKA 3BLBA 5I6SA 2BXZA 4D6JA 3AJ7A 1Z32X 3L4ZA 4KH2A 1XSJA 3HU7A 4U2ZA 1UZ1A 4JL1A 2CBIA 3OZPA 3ZSTA 1KTCA 3CUHA 4JIEA 4B9ZA 3L4XA 1JZ4A 5A2BA 3OLDA 2D2OA 5EBAA 5I23A 4RE4A 3VIPA 4P7RA 3UG5A 1UWRA 4J28A 1JAKA 4PTVA 1X1NA 3CHFA 4W8AA 3UR8A 1NWTA 4DO6A 2QLYA 3HZ3A 5A8MA 1H11A 1BG4A 3WDJA 1PZ2A 3AI0A 1KQYA 1NOUA 3VIFA 2WBKA 2YIHA 5A69A 4HOWA 5E0FA 3ARZA 4NXKA 1I1XA 1CENA 1VFUA 1GQIA 1VB9A 1E6SM 4IPLA 3D50A 4HA1A 5A2AA 3HJEA 5A8PA 3OGRA 1EDGA 1HIZA 1JDDA 3BUDA 4PMQA 3WY3A 2XJ7A 3WF1A 2XN0A 4H04A 3GZAA 1ISWA 1TA3B 3PZUA 3VDCA 2WVTA 2A3EA 1OGGA 1KXQA 4PMYA 3RM8A 3H53A 5BCAA 2YL9A 3N18A 2E9BA 3IJ7A 1V02A 5GNYA 4UR9A 3OGSA 1CXFA 2A3BA 2EPNA 4LX4A 1W3JA 3NSXA 1A47A 3VGBA 1X6LA 2WC4A 1HF6A 3I3DA 2X0HA 1GZJA 3DYMA 1RH9A 1OT2A 3AXXA 3KL3A 1V3MA 2ZXQA 4P7LA 3KZSA 4HU8A 2YDQA 1GQJA 1W3HA 3LXBA 3VX1A 4NX0A 1R86A 3CHDA 3FNDA 1MFUA 2BNJA 4JFTA 4D6IA 4FF5A 3VINA 4HZ7A 2ZUUA 1G1YA 1IZJA 1J0ZA 4Q7NA 1HTYA 1LG1A 1M01A 5CG0A 5JIPA 4NZCA 3SUTA 2WHLA 3UG4A 4HMEA 3D52A 2WLZA 3WMCA 1CGXA 3MV11 3L4YA 3WELA 2IXUA 4F79A 2GJXB 2DH3A 1UQYA 3BLKA 3VIKA 2F1BA 3WD2A 1KGWA 4JFVA 3N1AA 5E70A 1Q6CA 3CZKA 1W2PA 2YA1A 1GQKA 1QI4A 4W85A 1GOWA 1EHAA 1M03A 3VIJA 2J8FA 1M53A 2YFOA 3PZOA 4GI9A 2AMGA 2F61A 3BH4A 3WY2A 2EPKX 4PSPA 4NSBA 3A4XA 4HPGA 4HOXA 2WMIB 2Y5EA 3ARUA 1BTCA 1O7AA 3PZVA 1GOMA 2D24A 1JZ7A 1CXEA 5BXRA 1CPUA 1JYWA 1HJXA 3BAWA 2J7CA 3VMPA 2V3GA 2VX5A 2WANA 1OD8A 3WD3A 2CHOA 4AYSA 2EAEA 4PBGA 1BAGA 1B30A 1UH4A 3LRLA 1WPCA 1G9HA 1GOOA 2BY3A 4JCLA 1GW1A 1IT0A 1FH7A 2YBTA 1HT6A 1P6WA 2Y8KA 3SEPA 4C7DA 2W5FA 1GUVA 2CIPA 4MNLA 1BG9A 4WK9A 3T2QA 1R8LA 5FKYA 2QV4A 2VCCA 1EDQA 4TXEA 4DWSB 1V3LA 4RL3A 1D7FA 1QW9A 1JDAA 1CYGA 1VFMA 3WQ4A 2XWEA 4AISA 3AHZA 3PZMA 1PIFA 1JZ3A 4A3HA 3DDGA 4N0RA 1V3HA 2VZUA 4GI6A 3BXWA 3W28A 2E8ZA 2OW6A 1XYFA 1PAMA 1CIUA 5IFPA 1LL7A 3OG2A 1E15A 1VFOA 1UWIA 4FMVA 1SYTA 2YDSA 2OWXA 2VQTA 1JZ8A 3AYSA 3S5ZA 1BYCA 2WVVB 2CYGA 1PS3A 1UQZA 1VRXA 4ZEPA 2W63A 3CHEA 1WZKA 3VGEA 2VNCA 5I78A 4W93A 3WEMA
chains in the Genus database with same CATH superfamily
3KHDA 4F80A 4QO1B 2RQ8A 3CYVA 4K3ZA 3PTDA 4NASA 1GPOL 1XIEA 4N2LA 3FSVA 4NT6B 1GPOH 2L7EA 1UZDA 2Y7DA 1PX3A 5DFVC 2VDLL 2QHRL 2LV4A 3FYPA 3U7WL 5IOKA 3PHOA 4WFFD 2TAAA 2VDPB 2VDLH 2QHRH 1HP4A 1W3TA 4XXCA 1FWEC 1BWLA 3U7WH 5JZ7C 2PC8A 3AXKA 1U93A 4ZSOA 2BIPA 2BVTA 3SPIA 1ODZA 1A9VA 5DYFA 4YC2B 2Y6SC 4HNLA 4NIRA 4L4TA 2IPWA 1O9VA 1S7VA 1QHPA 2XFGB 3ONBA 2IS7A 2R27A 4Y7EA 4YOKA 1EO5A 3T0EB 2OEKA 3NEEA 3EYQC 3GHTA 3SY0A 4WI4A 2VX4A 4G8GE 3KM8A 3DRQB 1NL0L 4M93C 1FPTL 4G7FA 1YLBB 1CDHA 5KZEA 5JXEC 4X5XB 1U83A 3NCFB 1NL0H 5ELIA 1FPTH 3GMRA 4LB4A 3TNBA 2AJYL 4IQJA 3QORC 1RZGB 2VMDA 5KYXB 3QCUL 4QHLB 3GVRA 3MLZL 3W4RA 2EJ1A 2AJYH 2QADB 1FBIL 3TC3A 3QCUH 1A9BA 4RMTA 4WSJA 2QGDA 3MLZH 4O17A 2AW2A 5I5MA 1FBIH 5A2LH 3LY0A 4Y4KB 5JTWA 2OTDA 3O4LB 4KK5D 4XO7A 1IXOA 1INDL 2WLIB 3WL9A 3EBVA 1I7TB 3VFNA 4DESA 3LGGA 3UT0A 2DWTA 5IVXA 1T7LA 1V02E 1INDH 2BVEA 3RGVC 1UB6B 1I82A 1T0MB 3VX0A 3UTSD 1NC2A 4WNQB 3L3OA 1OINA 3L3KA 3B6SA 3JS3A 5E6IC 4AIUA 1ZJAA 3GHUA 2VLJB 3KPMB 4G9DB 1EZVY 2WN3A 5TGBA 5FJUA 5ENLA 3KLAB 3E9UA 1CBJA 3EOBA 3BN9D 3GTIA 4ZMNA 4NQCB 1KCLA 1ID5I 1UGKA 1WX0A 4DP0X 5BZWB 3UFYA 1E28B 1OP3K 1NWPA 2EYSB 1BMZA 5HYJB 4K7YA 1AH0A 4LPYA 3RKPA 3KCWA 1M6JA 5H8MA 3K2GA 4RIRB 3V0IA 3HMJG 2OKOA 1NF7A 3EMQA 2NX3A 1MRDL 3PWIA 2Q86B 2EE3A 5DEZA 4ZCWA 4D0CA 2PZNA 3GLEA 3CK5A 3M0ZA 3GG8A 1MRDH 1I8LA 1A5NC 3UPMA 1TCMA 1GYMA 2PB1A 4NOFA 2XX1A 3S2AA 1U4FA 3UGXA 1WDQA 1S38A 1INEH 3IJYA 4E3TA 3LRKA 3N19B 3SRKA 1K8DA 3N50A 3W02A 3U1PA 1H5BA 4BSWB 2NQDA 2EZ0D 1V79A 2J66A 5C9KA 1KYFA 4MQ7B 2N1TE 3TTEA 5IMOB 3RJOA 4HDIA 2ZUMA 5FC9A 2VIRA 5MERB 2ESVE 4MCYA 1WF5A 4I8YA 3B2MA 3PV6A 3M8OL 3P3YA 3H0TA 3WMPA 1JV5A 4CSTA 4ELMB 3WQ8A 1XINA 1BLIA 3M8OH 4PJXA 4ETQA 3I9PA 3P73B 4E3VA 4FXTA 3MLPA 3QIWB 3H7BA 3PL6C 3RWCA 2I5YL 3IMBA 2OU4A 2ENPA 4LCCB 1XC6A 3TW6A 5GSRA 3S35X 1JVOA 2I5YH 4IRJB 5L4JA 4WI2A 2NUTB 4JPVL 1JEZA 5A5WA 5A6IA 4RR4A 3QJFB 3GU2A 1CWVA 1TTUA 3VWJA 4NJJA 2HLFC 4JPVH 2DIBA 3QNYB 3TAOA 4RGNC 5IQOA 4I0PC 1HILB 5FLVA 1BA9A 1TO4A 1WFTA 2FYYB 4DIAA 2E6JA 1U33A 1FO0H 1QMLA 5D96C 3WFBL 4F8TA 2CQVA 1BZ9B 4DVOA 3NM3A 5HI4C 1WO2A 5AOMA 3VOHA 1KZYA 1NAMA 3WFBH 1RSCA 2V5SA 1YPZE 5JQIB 1UJ3B 4DY1A 5AZ2L 5K7JA 4ETYA 2D7QA 5G2IA 4FG6C 4UIMB 1IQDB 4N87A 2P24B 4Q6YA 5AZ2H 3II1A 2K7QA 1KGUA 3VD9A 3MRIA 3ANUA 1OCJA 1FZJA 5HDOA 4DIXA 3Q8FA 1AIZA 1Y1UA 2CLPA 2Y69B 4YHYC 1KIPB 1F1AA 3WIJA 5AZUA 2HNEA 3V5KA 5HPMA 3P77B 1CICB 1TZHA 3T0VA 3TWBA 4L8SB 2J5LC 1AODA 4Y16D 1BSIA 1U30A 1E72M 2ZUWA 3T0TA 5FWQA 2XN9D 2JLPA 1IZCA 2IWEA 1DDHA 5EZJA 3WS6C 5EEYA 1G7PA 1HJSA 2KUTA 3GSNB 2YL8A 3K72A 2JB6B 1UUQA 4LVFA 3FUNA 3B34A 1H7RA 4ZXLA 4NPJA 1TZ8A 3DX7B 4C57C 1EF2A 3SYOA 2QQ6A 1D6EB 4WOQA 1MJJB 4BSVA 4KUCD 3FUHA 1TFVA 4J3OG 1DQTA 3OBEA 4KO9A 1TR7A 5DK0B 3O11B 4A8RA 5I73C 2FMOA 5E0KA 4H1LA 2OGJA 5FUZL 4OT1L 1K85A 3F4NA 1BYDA 4XZNX 1TYRA 5FUZH 5K1VA 4OT1H 3R5EA 3DX5A 3IF1A 5IIEA 2NQLA 4EE9A 1NBZB 3B2PA 1UP0A 4ZVJA 1KACB 4MQSB 1R46A 4YDJB 5A6JA 1OX5A 2WCAA 1TUXA 4QXTA 6PCYA 4PWIA 3BXNA 3V7MA 1ZGLP 3CAWA 4IMDA 2GSHA 3TBVA 3GSXB 1OHLA 2XG5A 1EXUA 2UWEA 3JZ7A 4NWTL 4WGXA 2VTFA 1VZWA 1RVFH 1UM5L 2H8PA 4NWTH 2CRZA 3UJFA 2QQNL 2EE6A 1YO4A 2WBJD 5BV7C 1P5UB 3EKLA 1UM5H 3F6IA 2WJDA 4AV0A 3W9ZA 3PWLB 2Y4SA 3HGRA 2QQNH 5CP7B 3TR9A 3ECQA 1HKLL 2BC4B 4A7TA 1LQAA 1NEYA 4Y9BA 1HKLH 3HPZA 4IKKA 3QFJE 4PW9A 3DX1A 3GLCA 3NEXA 3KLSA 4PRDB 4C59B 4XUGA 3RM4A 1V10A 3D85B 4GW1B 4P5TD 2O4EA 3S3JA 3LCXA 1TENA 4NZFA 1AXSB 2NYYC 5L9FA 2AEOA 4A8IA 1OZUA 2R23B 4ZPTB 1J11A 2JJSA 2IH3A 4JHZA 3P4NB 4JY4B 2OBGA 3FHQA 5MP6L 2OSXA 2BY1A 3GDCA 1PKYA 2Z6IA 3O2LA 2XHNA 3BZ4B 5MP6H 3F5WB 2F5BL 4ZUTA 4L9LC 4E41B 4QXIA 4ZO8A 5IFAL 7PAZA 3MRFB 4J8RB 1RLCL 2F5BH 3APTA 3DI3B 1JCXA 5IFAH 4X99B 4L4VD 3C5JB 1N7KA 4PGZA 2AXJA 4Y5YB 4BCEA 2E8YA 3BK0A 1KG0A 4LPTA 4AE1A 4XSLA 4N2IA 4PRPD 2R91A 4Z1BA 3K6SA 4L56A 4JBRA 1XX1A 2Z24A 4GIRA 3FF8A 4AMKL 2DJMA 2EXOA 4PLKC 2GZXA 4MD4A 4YUEL 4G6JL 4LUSB 4U3XA 4Z7QE 4AMKH 4QPEA 3OP2A 2VXUL 4A8LA 4YUEH 4G6JH 4P46A 2VC6A 1FWXA 2VXUH 4N26A 6PAZA 5DMKB 3IV3A 3EJZC 1E1CA 1DQXA 4C6NA 3WTYA 4FYQA 1ONQB 2PYEE 3BURA 1B0WA 4K7PX 1G9EA 2DM2A 3PJUA 5A6TC 1ZSDB 4U1MB 1KOAA 2X09A 5CJOL 3V6ZB 2WXIA 2UWFA 9RUBA 1KNOB 2QCCA 4JZ5A 1Q72L 3OMIB 5CJOH 4WW1B 3HTLX 1FVDB 4J2QA 4KKAC 1Q72H 3ECUA 3LDBC 4AQ1C 4A37A 3N55A 2Q3OA 3ULUD 3WLBA 2WY3B 1JG9A 3E80A 3VI3F 1X3DA 3F7PC 3W0KA 4CVZA 1F5ZA 4XMKL 2TMDA 3W7DA 4PRBA 3MUY1 3SDXF 4XMKH 3QJQB 4OLWL 3NRPA 1NFGA 4GYFA 3NT0A 4RMVA 4OLWH 5HVHB 1T96A 4KTEL 2Z31D 4GUHA 4JG9A 4ZBJA 3BVVA 3CIQA 3WU1A 4KTEH 1CI3M 5FK9B 3SKNA 3FU7A 3E2HC 4AJVA 3ZTJG 4WO4D 2PR4L 2R4RL 1TVHB 2BP5M 1ITQA 3NJVA 3WEXB 3S6DA 2R4RH 2VDOL 2XQYK 1MCHA 3QNZB 3RKDD 4W84A 4UWQB 3W86A 2VDOH 2FH6A 4OIAA 4FKKA 2VKWA 4H9YA 2PWEA 4PJCE 1L9PA 3UZZA 3ZE1E 1ZBVA 4ATWA 3KVJA 5AB2A 2VW4A 4DWSD 3AREB 3WNMA 3N29A 5JQ6L 2ZKHL 1YEEL 5CZXD 1R24A 3T6ZA 1K70A 1MDLA 4GPNA 3TEZA 4HJGB 1D5XB 3WNOA 1OGAE 5JQ6H 2ZKHH 1YEEH 1ZHKA 2C9SA 2PF8A 1XT5A 4G9PA 2HTLC 4OJDH 4PJ9B 4Y8EA 5I17A 4LIQE 4B9KC 5D1QC 4ZFGL 3AIUA 2GC4C 3MGOA 1ONWA 2IBZY 5EC1B 2EXWC 2ZE0A 4JG1L 3PF3A 5JHDD 2ODOA 3IFPB 1R75A 2YBRB 4ZFGH 3SCRA 4JG1H 1YLVA 1P7TB 3PBMA 3US0A 4JJ5B 4ONHB 4JPIB 5BROA 2VCAA 4J4PD 2PF6A 3H4FA 3TC6A 1AW5A 3U36B 4XVTL 4POZC 3AIWA 2ZXWB 2PP7A 4NN7B 1WHPA 4XVTH 4NY2A 1BXVA 1QFOA 3LH8A 5GJPA 3OVUB 4S1QL 5C0GB 3NO1A 2JEQA 3ULVE 1K5NA 3SGKA 5K9QG 4PMXA 3PTKA 1TPEA 3BG9A 1KT2B 4QUOA 3MBEB 4IGBC 4S1QH 1JQVA 3VMOA 4G1EB 2CFFA 4Y7OC 3STCA 1HCYA 4HIHB 4LIQL 5T9BG 4F27A 3TNMA 1KGCD 5D33A 2XN1A 5E5LA 5EA9A 4O0ZA 4LIQH 2AAMA 3U48A 3UCQA 1V7YA 3SSJA 4PC8A 2RDUA 3PAUA 4FQQB 2VWEC 1TRDA 4O50A 4DHGA 4LC8A 1HG3A 3NIGE 2DQIL 4LB8A 1IT8A 4UANA 2DWEA 3M7WA 3FIGA 1MW1A 3ARBC 1SJDA 2F7QA 4MVBD 2DQIH 4LESA 3ULVL 1UPMB 4DZHA 3LQLA 4JICA 1KIQA 4WHYG 3NZUA 1KPRA 1I1RA 3ULVH 5KWYC 2EBNA 2IW0A 5IROA 2ZXGA 1J1PL 5IEKB 3PBWA 4XPFL 5EEZA 1NGZA 3NQ7A 2OMAA 1J1PH 1VYPX 4DJDC 4XPFH 1KCVL 1YNTB 3TIEA 1YTEA 1KEML 4DBDA 4OM1L 4F58L 1HYRC 3BW2A 1KCVH 4ECNA 1IEAA 1OAUL 3EG9B 5I71C 4AZ6A 3QBUA 1KEMH 2ZTJA 3L3JB 4F58H 1ONEA 1BM7A 4NPYB 1OAUH 1E6NA 2LU3A 4MDIA 1UT1A 2GJNA 3DIVA 3UERA 3N15A 4ACYA 4ZX5A 1BYOA 2DUZA 5HQMA 1YDPA 1BHGA 3UTZB 3AUWB 4DWHA 2BP8A 4LCYB 5DUBA 4RZ4A 1LO3L 1B9ZA 4DKTA 2EIBA 2LQRA 1L2UA 2P28B 1XBYA 4FAAB 2AP2A 1BFNA 1LO3H 1RQHA 1B3IA 3FQNB 4IDJL 3QPKA 1U8NB 3QYSA 3AT8A 4IDJH 1WDSA 5KSAB 3I84A 2EDWA 4XO4A 1QLRA 1ZT4B 2WD0A 1IKNC 4PRIE 1A3ZA 1HHJA 4Q4IA 1QR7A 1GOQA 1MRCL 2CBQA 1K7EA 2DKMA 1C5DA 5BO0D 4G7RB 5M5DA 3WBXA 3U2IA 4YR6B 1MRCH 4F37K 2GWGA 3GVVA 3W07A 4FLOA 3P82A 5EOCL 5DHVB 2W92A 4U1NA 3BWSA 3AO0A 2BODX 2QVNA 3DJ9A 4F8PA 1IFGA 3CV5A 2ENYA 5C6WH 3X11B 4WWPA 5AHNA 4FC3E 1K3ZA 1TTQA 1VESA 4RXGA 5FUCE 3KS0J 4GC3A 3DGDA 1WS7A 3FQWA 4PJ8C 1X5GA 4P2OC 3ISYA 4AZ8B 5K69A 1G43A 3NA4A 3ABXA 5DA4A 1LEGB 3NCWA 1RIHL 5AHEA 3UXKA 4W9HC 1HH9B 3U7YL 1AH4A 4KX7A 2QSTA 1A6AB 3U7YH 1VB9A 3UXAA 5KVDE 4GRLC 1NF0A 4JFXB 4JNXA 1DOSA 4Q14A 3F64A 3WF1A 4U4MA 3RGHA 3VDCA 5DO2D 1VACB 3LKSA 3CB8A 1A47A 4J3ZA 4M5YL 1V4YA 2FLIA 2R0LH 4HZ1A 3S97C 5I15L 4M5YH 1W3HA 3H2FA 1ZZMA 4OLVL 4EPBC 5I15H 4RFEA 5F7AA 4BCZA 5AW9B 4OLVH 2JCCE 4G8EA 4MSSA 1VCGA 1FWJC 4UTLA 3PM6A 1OOAA 5JH2A 3O3AA 3RVWD 3LPWA 4D0BA 3ARFA 3QJXA 3GI9L 3MJ8B 2ATPA 1AJ0A 2DW5A 1EZVX 3D4GA 3W7GA 5F44A 1KGWA 2L3BA 5E70A 1MVUB 3GI9H 1ILSA 3Q6FB 2J8FA 4E5TA 3R10A 1DR9A 1BP3B 4IP7A 4HOXA 1OE3A 4ZRGA 3TUUA 3H42L 2FJSA 3G1VA 1E30A 3OKDB 1COBA 3DESA 1VZGA 2AABL 3EXLA 3T81A 3H42H 2NX9A 5K39A 4HHLA 3PUCA 3UOAB 2Y8KA 2AABH 4QRQA 3B8TA 4KERA 1GS8A 3FRPA 5FKYA 1EDQA 3WFDL 2OKMA 3HC0A 3CSFA 4X0KB 3V8OA 2XWEA 5ICYA 2GVJA 3WFDH 2IH1A 4H01A 4DBWA 4L23A 3SHSA 3UXLA 2WWKO 3RP1A 5CKAA 4MD0B 4F9LA 1U8HB 3IACA 3TWYA 3SBPA 1M65A 1LLZA 3R43A 4E42B 5AL0A 1I8AA 1PS3A 4CEXC 1Q8MA 4N68A 1AHWB 3KYNB 3CASA 1NIFA 4MJ6A 2VR2A 4KIEA 1FCGA 3NZ8B 3BD5A 4QDWA 2BSTA 4FLQA 3QIUC 2OMVA 3WDPP 4G6KL 4S23A 1W9PA 3RWEB 1U3HB 4UV4L 4PLJC 3WBYA 4MKMA 4G6KH 4UV4H 2OR7A 1BQCA 1VZHA 5LQBL 1V6WA 3MLSL 4HQQL 4B4HA 2ZUQB 4TVPE 5LQBH 3MLSH 4HQQH 2R1NA 1FNGA 1KFKA 1UR0A 4YXKL 4LGPB 4L29A 4Y9FA 5D7KD 3UTSA 5JH1A 2VH5L 4YXKH 5D7IB 3TU6A 1XRFA 1JUFB 5L8JB 3BGFC 2IDQA 2VH5H 4BEQA 3VE7A 4PFHA 1DJXA 1NFBA 3LD8C 4RKAA 2WJZA 3B7UX 2XQYG 4Q7IA 2R2HA 1SVCP 1WFIA 3SIZA 2CIKB 4GBXC 3W1RA 2F19L 1EBHA 3A4AA 1K2DB 1V6YA 3W74A 3QLDA 3PAZA 2F19H 4AV4A 1RKRA 3QQ9D 2E9JA 4LVEA 3BVJA 3BFQG 3UYCA 5MEOA 5ICUA 1MN4A 5J6HB 4Z76B 1EEYA 2F8VA 1WC7A 4MWFB 4FHKA 3FT4B 1HYSC 4GZJA 3VWKD 1QFUL 3M44A 1E55A 2HLAB 5KZ6A 2E6PA 4QXWA 3KMDA 4ONGL 3LRSB 1QFUH 3WLQA 5JW4N 3O3BA 4YVNA 3BZGA 4WKZB 1FDJA 4ONGH 5AKVA 2A6JA 3K46A 4HHMA 4MQ7A 2XY1A 1LL4A 1T83A 3ZLFA 2ZOKB 4LDCA 4BF9A 1CDBA 4G82A 3BIBX 3PUUA 1ZT1A 3GIVB 1DVTA 2FUTA 3KL5A 5B1AB 3UCRA 3DERA 3G6MA 1Q9WA 3ARVA 5HD8D 5DRNB 3PWUA 2ACUA 4F9PC 5A2JH 3P02A 4B9IA 3VDBA 5DGRA 1ZWIB 3FEMA 1EJUC 3C12A 3EMCA 1VKXA 1E8XA 2PW1B 3M9YA 4N86A 3UWVA 2GPTA 4IICA 2B4GA 4P9HL 4XMUA 3D9AL 1S7XB 2PDMA 1X6NA 4P9HH 3A67L 4ZGYA 1UQSB 3WD0A 3D9AH 3JTSA 4CVXA 1OD7A 1D5RA 5CBEA 3IGSA 4HZLB 1E8WA 3EX3A 3A67H 2ZZ6A 1HILA 2AJ3B 5I06A 4L8DB 4IUOA 1TR1A 3BOXA 1BZ9A 3P2BA 1CCZA 1HO1A 2V5JA 4R2GB 3T65A 2F9BT 1W32A 4WXZA 3WEOA 3IFOB 2J75A 4F7MB 3MACL 4XX1G 3ARXA 2BMKA 3POCA 4GACA 3MACH 4IG2A 4GH3A 3ZDZF 2NZ9D 1CT5A 3IDXL 2W9MA 3QUZD 4KEZA 2BVWA 5DS8A 2F38A 1Z3GL 3VXPA 2IALB 1KCKA 3IDXH 2ZD0A 3WD1A 4Y5XA 2R9HC 1AIFA 1Z3GH 5CSBA 4NU7A 5EB8A 5E9NA 1KJMB 3WLPA 2HVJB 2JLLA 3PE9A 3MHGA 3TQ0A 4WUUB 1KM2A 2MNJB 4ZJ9A 2CLMA 2C3VB 2XGBA 1FLTX 2XA8L 4N90D 4XNUL 1MUJB 4PMDA 5E5MB 1LUCB 1AR2A 3D3VB 2XA8H 4HH8A 1GSKA 4XNUH 3RX7A 3WFHB 1XH2A 4CC0A 5CM1A 2AI0L 3MROB 4CUCA 2Z8SA 4Y16A 1CWYA 3ILQD 4OVVA 1PSKL 1LEIA 4N9BA 1CR9L 3FOMA 2AI0H 5LBGA 2XN9A 1PSKH 1CR9H 5REQB 2EE0A 2VXQA 4XNQB 2E7FA 1LK2A 1C8XA 4JLRB 2VUOA 3H6AA 2Z8RA 3ZT6A 3MRJA 4AEEA 1MQRA 2EDYA 1BG1A 3TZVB 4JM2B 2GJ6E 5K93A 5EU5B 4DP7X 1I9CB 5DD6A 2B08A 1BD2D 1P1ZA 1A8JH 3BVTA 1EGMA 4YSSA 4P2QD 4IIFA 3STZA 2Z7WA 4OTXL 4I85A 1XLAA 1Z9SB 4KJPC 3FU6A 2UY6B 1FP5A 4OTXH 1UWYA 1WZ1L 1CTMA 2CLZB 1RV8A 1T7YA 2VRKA 4MYAA 1WFNA 3WQDA 3W71A 4DBUA 5KUKA 1WZ1H 3MRPA 2GSJA 4I5BB 4HJ0C 4IU3A 2BHZA 2DD8L 3CD4A 2Q7AA 4OH2A 1JN6A 3K71A 3U3HA 1HE7A 4QXUL 5BJTB 2DD8H 2WBJA 3WLKX 1HHIA 4QXUH 2PCEA 3QV8A 1YY9C 1FRGL 4R5VA 2H6PB 1KB3A 2G3FA 3K8KA 4EBQL 2YPLD 2VLKD 1FRGH 1CW2A 4R7NA 1ISXA 1LTDA 4XNBA 4EBQH 4CSSA 4HD9A 4N85A 4H5SB 2CLLA 3U0PB 3NL3A 4BF5A 3HOGA 4NNBA 4DNLA 1RUAL 4KTDL 1A3LL 3VD3A 3GNRA 4P5TA 2CBTA 1XQKA 4TTDD 1RUAH 2QYGA 2C1GA 4KTDH 1A3LH 4K3GA 5F9OL 3RVXD 4FMFA 4X6FA 3D69B 1U1UA 2QXWA 5F9OH 3IJHA 4K7PY 1IMHC 3AQZA 1LMKA 3EH4B 3ARYA 1EBGA 3IYLW 3CX5K 2R2BB 1TZ7A 3AZUA 1XEUA 1MHEB 1H7NA 3CU1A 1MJ8L 3ES7A 2DRUA 4LAOA 4AEHL 2WNGA 4N9DA 4UTMA 1MJ8H 4L4VA 3EFFB 4NSKB 2CJSA 1VH7A 5DEFA 2QDDA 2IQAB 3G6JE 1EAPB 4UFHA 5EU4B 3D2UB 1T03L 2IUZA 1RQBA 4PRPA 4KRUA 1NEPA 3T1FB 1JZJA 1E4XL 4OW6A 1T03H 3O41A 3EDEA 4D7BA 1WAUA 3GYEA 1J2WA 5C08D 2HROA 5GZND 2J6EL 2VAJA 1E4XH 2AK1L 2HSIA 2HX9A 5CXPA 4EN2A 2CCWA 3MV7D 4XO3A 4AKOA 1CD0A 4X80L 4WTXA 4PJ5B 2J6EH 3RZWA 3BUTA 1YXYA 1WAWA 5D1XE 2VURA 4X80H 5H4YA 4BA0A 2I9EA 3FH8A 2IPUK 3H9SE 4LNRB 5D9SA 2XWBA 5HGBA 3W37A 1CLOL 2XKNB 3V0VB 1JGLL 2X4OB 3S0CA 4HS6A 3FS2A 5HI3C 1JGLH 3UWUA 1R5WB 3HA0A 3TJ4A 5HJDA 3FN0L 4OLYL 3UBPC 2XFXB 4WHDA 3JWNG 4EI5D 4JN1L 4YBQD 2YXVA 3TJLA 3WOVA 3FN0H 2GHZA 1AKJB 2ACSA 5DY3A 2EGZA 2XZZA 3GFXA 2NY3D 2V7HA 1G84A 4X9GA 3UO8B 2JF1A 3B8DA 1YPXA 3FL7A 3WKZA 5FK9A 3V4VL 1Q9LB 5C09E 2BP0A 3O9WD 1I8JA 1K1DA 3D0AA 3TS8A 4X2PA 3V4VH 5DMIL 1U5HA 3D25B 3E0LA 5C0BD 4AITA 5EEXA 3CHXA 3DGCR 1S7SB 4PRHB 4G6FB 2NX5D 4LDOB 1XR9A 4GC4A 2Z31A 1SLXA 4MD5B 1DVJA 3E02A 3M64A 2Y25A 1KB5L 3CIWA 2P5WE 3VXMB 4ANKA 4WO4A 3AG4B 1KB5H 1OP5H 2MNWA 4LHUG 4DP1X 1V3IA 2FNBA 4HJEA 4UUIA 4KZCA 4JTJA 4FERA 4TM9A 4F15B 4YZFE 1FFPA 1C9WA 1TR9A 4Q9RL 1AS7A 3QULB 1W0MA 4Q8TA 5FWRA 1ESOA 4XX5A 4LH8A 3HFTA 4Q9RH 1IAII 5H8PA 1CBGA 5HTSA 4DWSA 1UBSA 1JV2A 3SZKC 3T44A 4NOBA 4X6EA 3FT2B 2GI7A 4DPPA 3QXDB 3VFOA 2Z9TA 4JFFE 1WAPA 3H8AA 4AZ5A 3SCQA 1HO4A 1DWIM 3NGBC 1H8NA 4BFAA 1JMZA 2WVVA 4PTWA 1XGTB 1CECA 5JHDA 3OBAA 3IUIA 5F3HA 5FGCE 1QYGL 4WKHA 5KSBE 3KPRB 3TQKA 4FTDA 4M80A 3STPA 4XI5D 4KVNL 4J4PA 1QYGH 4ZUSA 3AXHA 1BAFL 4DWDA 2PWDA 1N0LB 5I1CL 1CE6B 4KVNH 1H3TA 3LNFA 5D5MA 1BAFH 5GRVL 2AV7A 4PWJA 5KYYB 5I3FA 5I1CH 5CPSA 2ZNWA 2XM2A 4W5ZA 1EYWA 1P5VB 3LNGA 5B38G 1QCWA 2WNNA 1UD6A 1FA2A 1WAEA 2WXGA 1HHHB 5EPDA 5EN3A 3RN6A 4X9SA 4QSFA 2EILB 3GBML 2R51A 3UTPE 2C7UB 4G6AC 4Y88A 3GBMH 1LDCA 3UYOD 2C4XA 1RZKL 1H19A 1WDAA 3L5HA 4LV9A 4DPQA 1ZHBA 5JQHC 3HF3A 3RRAA 1GJWA 4BEIA 1DQQA 1RZKH 1BBJB 2V9RA 2BVOB 2FB4L 2YZRA 3WH8A 3ULVC 5EU6E 5SWQA 2F08A 3C0JA 4YIWA 1U36A 1NOWA 5BXTA 3CSPA 2FB4H 5CH9A 4PBFA 1A1NA 1GGOA 3DFNA 1I7RB 4AV5A 5IR1B 1OD0A 4AYGA 3MVIA 4HIEA 3VK5A 3GHPA 4BHUA 2EDNA 2B7DT 2YQGA 4ZA0A 1GW9A 3PWJB 1HKVA 1GPWA 1PDKB 1PTZA 1TWZA 3W7HA 1TOXA 4GH7B 4OF8A 4ZENA 4ZT1A 1SUJA 4MMXB 2DBJA 3V1HA 4KEVA 2OXNA 4UAOC 4X9BA 1KCRL 2YD4A 4QYOA 3WJZA 3S5OA 4NKQB 1D7BA 4GA8A 4CC4A 3IGHX 5DJDA 1KCRH 5DQ9B 3QCVL 1R9XA 3GHEL 2PCPA 1A6PA 3M45A 3T0ED 2AV1B 3QCVH 4XN1A 3T0BA 5JNYB 1QBBA 1XCXA 4PMVA 2VR7A 2H6UA 3EGXB 3SOTA 3FBKA 5IF0B 3QW3A 4JO5A 5CGYD 3CTLA 3K6DA 3M7SA 5KVEE 2DSKA 4MY9A 2EDKA 3RILA 3K6NA 2QADD 3PK7A 4GI4A 1UR2A 2XDHA 3UBXI 2LR4A 3CVCA 4HKZB 4NRZB 5JDSB 1ODUA 2A85A 1IKFL 1CGVA 2BP1A 4Y4KD 3O4LD 3CIAA 2HS8A 3UGRA 2QGHA 1IKFH 3F7RA 4J3OH 1Q6OA 5D9MA 3DXAB 5IFTA 5EIVA 4B6ZA 1Z69A 4J23A 4RMUA 1LLOA 5KYNA 4C55A 5AYIA 2IMMA 4JHMA 1JF5A 4P23C 1VF8A 1URLA 3BQVA 1ZCRA 3NL6A 4PTUA 4AEFA 4UOW0 1MOEA 3LBMA 1DVSA 1BVLA 2VLJD 5KVEL 5FGSA 3W57A 1TZ9A 1S7RA 2OR9L 3N40F 2ADIB 1KTLB 1VQTA 4JO4L 2UY5A 1L8NA 3VKDA 4U1JB 1YHTA 2OR9H 5FB8A 4JO4H 1G7JB 3ZY7A 3M7FB 2GVEA 4NQCD 4L5ZA 4B3KA 1SFDA 4IYKA 4OZHE 4WFHD 5HYJD 3FULA 1QRNB 1J8HB 2GK1B 2CM5A 2K9UA 2REQA 4K07A 1FWFC 2ZX6A 1FORL 2VN4A 1X5XA 2X9XA 4OI8A 2P8PB 5TDPA 1NLDL 1FORH 1LVEA 1AGEA 5FUCC 3DO4A 1Z5LA 4Y8FA 4LLAA 4FNUA 1NLDH 1CURA 1N55A 2N1KA 3MU7A 4Q4SA 1XYLA 4HHPA 4PP1D 4U0RC 3UCCA 5F9JB 3A9IA 4BQ6A 2P3YA 3D0CA 5JLZB 3P3RA 2NOYA 2BXVA 1YMMB 1QABA 1NBCA 3B9NA 3R1ZA 4S1RL 2QR6A 3O7UA 4D6JA 3VXTA 2ZP9A 1OZMA 4J40A 2XQBL 4OQTL 2VC2L 3FX4A 4S1RH 4ZR8A 2OXHA 3K4WA 2DL2A 4KKLD 4WY0A 1NFDE 3S34L 3PREA 2XQBH 4OQTH 2VC2H 3L4XA 4Y1SA 1ZDSA 5A2BA 1ZA3B 1XDJA 2W38A 5ADPL 5B1KA 1NWTA 4WTZA 4U1SB 1A5CA 4APQC 2RTTA 5ADPH 3IFNL 2NCMA 4EI6A 2BCKB 1J2BA 4N6EA 3A0OA 4IK7A 3ZLHA 3QIWD 3IFNH 2D3JA 3EJJX 3NCEB 3VZYA 5K1JA 1NGWB 4X0KA 1D2OA 3SDCB 1JERA 4GG8B 4JANB 1TPUA 4IRJD 5FYKU 1RVKA 3DIDA 1MCQA 1A7QL 5LCVL 3NJNA 3WLIA 3W88A 1SFJA 2Q10A 1NGYB 3LB0A 1A7QH 5LCVH 3LHTA 5L0QB 4XPBL 4FFYL 3JR2A 5LNWA 4ZD3L 4HZ7A 4XPBH 4KKCC 4FFYH 2I25N 1FG2B 5SWZB 3SI9A 2ITDB 4IRSB 3HMXL 4ZD3H 1TCRB 3GSUB 2IPJA 3BP4A 5DLCA 2IPUG 4PMJA 1YZZA 3ATFA 3BD4A 1IEXA 3HMXH 2G96A 1QLEL 5JVLA 3AYVA 3RUGA 4UQ2B 1PNDA 2IKIA 1SVBA 4F91B 1QLEH 1C5BL 3MYOA 5JO5B 1ZY9A 1C5BH 4NSBA 2BG5A 1R3HB 4QRFA 1KGJA 4HPGA 4QOKB 4XH2A 4IXHA 4AKQA 3BPCB 3G6DL 4GH1A 4XCEB 2QKIA 1FWIC 4KESA 4K3DL 1CICD 3G6DH 2VDRB 4NC0B 5KSVB 1XLHA 1IO4C 4NNCA 3HEIB 3SEPA 1AA1B 4K3DH 2QFRA 2X4TB 3SQOL 5CN1A 3MJWA 3LCYA 1VFMA 3WQ4A 3SQOH 4ADSA 2Y1HA 3V5HA 3V4LA 1EHKB 4X8GA 1EZWA 3ZTJH 3WLSA 3N14A 3VRJB 4WHTB 4Z7UE 1XYFA 3SQBB 3Q3GB 3OG2A 2CIKA 1ZXKA 2GTWA 3C6SB 4AGNA 1DJWA 2EYTB 2NW3A 5BMXA 2J1KA 3GMNB 4ZEPA 3QNXA 5FJOA 5GZOD 4WW2A 2VNCA 4A2HA 4G43A 4LVBA 1FJ1B 3NOIA 2GVGA 4OZGB 5CEYA 3MWCA 4V1YA 4GWEA 2GI0A 3MR9B 3S4SA 3NTYA 2R0WL 1SDDA 3TJXA 1XIIA 3L7FA 4JN2B 5IJVB 5MEQB 2COVD 2BVDA 2R0WH 1E9OA 1WT5A 3WLWC 1FWDC 5IRPA 1I1FA 3M17B 1W56A 2HXUA 2GITA 1ORQB 3WK2A 3C09B 3EXSA 3SE4C 1E2VA 1R2TA 4Z3TA 5TNVA 4R4BA 3OLGA 4TULL 4Z7WB 1DIEA 3QH2A 3QWOB 5A1AA 1OP3H 4TRPL 4NCC1 1M3JA 4TULH 4ONFL 3SE3C 2HZGA 4TRPH 5DRIA 2VD9A 2L04A 4ONFH 4JQVC 3W1UA 5I0XA 5KJRL 1W8SA 3VWKA 1NBYA 1X7TA 5DD0L 1OQXA 1AP2A 4EDWL 2Y7OA 1O66A 1G7LA 2JBMA 3DBNA 5KJRH 4Y2DB 5DD0H 2D31B 1OF6A 4EDWH 3GSWB 2Y6ZA 2GFBA 3IJSB 3CEPA 3NSFA 3DHFA 1M41A 3GIZL 2E7LC 1X1ZA 2WKLA 1MELA 1QSFB 4AZHA 3D85D 4IPJA 4KTGA 4KI5D 3R6IA 1XCTB 5B3JE 3GIZH 2Z2AA 3MYPA 5LHDA 3ZDXE 2NQ9A 4HXBL 3FFCE 4UU9B 2ZZ7A 3CUJA 4OI9A 3NJFA 3BZFB 4HXBH 4P9HC 1H1YA 1RHCA 1Y5WA 5HYSG 1FDYA 4X6CB 3RIKA 1WZMA 4E41D 1I7UB 5H94B 2TYSA 4PUWA 2IC2A 5IMKB 4GQGA 4Q9QL 1YYML 3ZMEA 5TF0A 3O6CA 4P4KC 4R26L 3WK0A 5LGXA 4UBPC 5LIUX 4Q9QH 3G24A 1O6IA 5D38A 1YYMH 3FUIA 1X8CA 2Z7KA 1XFBA 3D46A 4R26H 5L6YL 3KWTA 2EXYC 2ZWNA 1SZRA 1YTDA 1ZIBA 1VBGA 5L6YH 2GL5A 3DURA 1KYOJ 3EJTA 3GX9A 4WHYH 3QV7A 4WU5B 3BWZA 2ZTKA 1CYWA 4BWTA 3AALA 3UFIA 1YUKB 4PJAE 5IBTL 1P1MA 2EDDA 1J9RA 3ELFA 2D22A 5IBTH 1GW0A 1FH9A 2W65A 2ZCZA 2BHYA 2E5EA 3IGLA 4PVLA 1J93A 1S2UA 2MPAL 3MBFA 2VDNB 3DUGA 1EJTC 1U0QA 3G6AA 2CHZA 3QUZA 3PUEA 2X4NA 1HWHB 4OZIF 3I6EA 3LCLA 2MPAH 4AJYV 3GH5A 3WQWA 3QIBC 3T3MB 4NUPA 1G6RB 3DH7A 3A21A 3L3HB 5CBAB 4PJIF 2YK1L 5DJZB 4PUEA 4Q4QA 1LL6A 1A0EA 3VH8A 5DA0B 2AVFA 4Z9KB 2K7PA 4MJ2A 1PZ1A 2YK1H 5IFJA 4DBEA 4QNWA 3RVUD 3VFMB 4LKXB 3PP4L 5BXFB 1DQJB 4K9EL 4UT9L 3MO1B 1KFAL 4S39A 1EHLL 3PP4H 3ETBF 1XLBA 4K9EH 4UT9H 4FA6A 5KSBF 1KFAH 2E7DA 4H4IA 2XX0A 4WY7L 1EHLH 1S5HA 2JKRM 3N1PC 2WB1A 3APMA 1ONXA 1BZ7B 3L3GA 1EZSA 3MZGB 2FWOA 4WY7H 2X0YA 2PYFB 3QXAA 1NWSA 1O12A 1I8MA 5E94B 1OW0A 3MBDA 1GOGA 1MRFL 1A4JA 1UR4A 4LVNC 4HKPA 3RJXA 2E3ZA 4YAQB 3BJLA 1MRFH 5AYZA 1VBJA 3S3DB 1PZSA 1KV7A 3LZNA 3MOBL 4GCAA 4KNSA 1BD2A 1NJ9B 1B4EA 2OJZL 4JKNA 1VR6A 2XSXA 2BDNL 3W2UA 1DZ0A 3NPXA 3MOBH 4N6QA 4HT1L 4P2QA 1TEFA 1T5XB 2OJZH 3HI5L 1HXJA 2BDNH 5AL8A 4HT1H 3FBQA 5H8UA 3HI5H 1GNXA 5IMLB 2GOUA 1WWWX 2PR4H 4GEJA 1HIML 1Z42A 4JQ2A 3ARED 2A73A 4IF2A 3GLDA 4DP4X 3BGJA 1HIMH 2GKIA 2J7GA 3LLFA 3L5WB 3UF9A 3SB0A 4PJ9D 4BM7A 1MEXL 3ZHFA 5FIPA 3BO9A 3EF4A 2MJWA 3MFGB 1MEXH 4JGMA 3VB8A 1FL6A 2YPLA 4GZEA 4RESB 3EXTA 4WJ5A 2VLKA 3VQLA 2D69A 3LTPA 3VTRA 2J1ZA 1H5YA 4XVUC 3MRCB 5HANA 2CALA 5GJNA 1ZHLA 3CHOA 5FS5A 3MJ9L 3OMNB 1CT8A 4P49A 3L95B 2Q8LA 3MJ9H 3T3PB 2XIIA 3HLAB 1B88A 3M88A 3DIPA 4XZ4A 5CZRA 1HJBC 1BWKA 5DMGC 4XCYB 1YBQB 3MA7A 5MKGB 4JDEB 4I9MA 5F70A 1QU4A 1IEVA 3KBEA 3W5NA 4ZMYA 5FJRA 2V5CA 2ANUA 5DEGB 2I57A 3MBED 4IS6B 2NLYA 2NUYA 2WZPD 1P2CA 2W27A 1ASOA 4P5MA 4GO8A 3LI1A 3O05A 3QUMA 1GEQA 1HFBA 4F7EA 4EUPA 1IAMA 2J13A 4OGQC 4PVNA 3UP8A 4RAUB 2X4UB 2JKIS 4IOSD 3C9NB 4RNRA 1XH0A 4DVRL 4Z7AA 2I56A 2JI3A 4TUOB 3LMJL 4DVRH 2EINB 1UXSA 1G0YR 3L9RA 4NM4L 3G77A 2Q02A 3LMJH 1T0NA 2CH8A 4PHXA 5AEAA 2Y22A 4TVCA 3BCFA 5C08A 5CD5D 4NM4H 5GZNA 3TZFA 2YCKX 4MNMA 4RNIA 2AQRA 1R3VA 2Y2WA 3MV7A 4OCRL 2XSBA 4X2RA 2GJRA 4UTBA 4FIRA 1A25A 4K3HA 1P4LA 1DVYA 1KCBA 4OCRH 1WFOA 2WO5A 4QAMB 5XIMA 1MW3A 3UXFA 3PIQA 3G5ZB 4ZFZB 2B9BA 3WY1A 2C9QA 2ODHA 3VTMA 1MCWW 4DEWA 1FVEB 5GNXA 4I18B 1TF4A 4KJYB 3MV9E 1AJZA 4U6VL 1TPH1 2DQEL 1B90A 2DQJL 1UA6L 1WBZA 5GRXG 2YD2A 3PS6A 3OU8A 4EI5A 2DQEH 4TSCL 2DQJH 3FVMA 1UA6H 1C7SA 4HK5A 3DFPA 1T3FA 2CPCA 4AM0A 4TSCH 3VCRA 2O72A 1TQJA 2IGFL 1YAIA 2ILLA 1F73A 4ZZ9A 4IMKC 4I87A 2YL6A 2WQPA 2YRLA 2QCMA 2IGFH 2J8UA 4MKSA 2X2YA 3LKPA 4NFBA 3ESNA 4TV6A 3QDHA 4AXNA 2BFGA 3GLZA 1GTFA 2J74A 1KJ3L 2ONEA 3WEBA 4OM1H 1PS9A 1HNYA 3E0IA 3BQUB 3O9WA 2B31A 4LNCA 3R58A 1KJ3H 3NJKA 5C0BA 2XTJB 2G3NA 2ZPKL 5C92A 2I26N 2NX5A 2VN5A 5KSAD 5E95B 2ZPKH 2WXJA 2YSSB 4NENA 4GXUN 4WKFA 1R85A 3CG8A 5T33L 5FO7A 4Y4HB 1NMCB 3SD2A 5IB3B 5J04A 1NFPA 5T33H 2X7LB 2RALA 1YEKL 2V69A 4JN8A 2I5GA 1KPVB 4EWND 1YEKH 4XHQA 2P1YA 1OYAA 4I8DA 2N7AA 3AMCA 3Q2VA 2JIXB 1ZLEA 4JHVA 3CFQA 5DD5L 5DY2A 1S9WB 5DD5H 1DHPA 3BH8A 2ARJA 3Q9QA 4APXB 5DJ0B 1NGXA 3EPNA 2PMZA 2YEQA 4LSUL 1AD0A 4TSAL 5T3ZE 4K1WA 1TVBB 5IBLD 4LSUH 3U2SB 4TSAH 5BZAA 5EOCH 1UACL 4JY6B 1EQCA 1XLIA 1XG4A 3MUHL 2B15A 5F1IB 1IE4A 4U6YB 5LXEA 4PJEA 2GJXA 3WIHA 2X7VA 1UACH 2PURA 2G97A 1N5YL 4HUVB 1JJKA 4N2AA 1TZIA 5I18L 4YDIL 1DO6A 1N5YH 4MVAA 1SJHB 3WLOA 3CVHL 4W9FC 2PF0A 3FN9A 5I18H 4QF1B 1W9VA 4YDIH 4JAMB 1VJZA 4C7GA 1DJHA 3CVHH 4XX1E 3VSQA 1NOLA 1RIHH 2B3IA 1VBRA 1XH1A 1JQXA 3ZKND 2QVKA 3FCGA 3NPWA 3L3DB 2HVNA 4WD0A 1VJSA 3V1PA 4IRZL 5T3ZL 4H8VA 4WI5A 3WNPA 4NVTA 3VOGA 3L1FA 2R15A 1YPZF 5FDWB 1XLGA 2HFFB 2DVTA 1RZKC 3W7MA 4IRZH 4XBGB 4R97B 2P10A 5CC7A 3FU8A 1UUNA 2NYZA 1TREA 3G9VA 3AU6A 1BOYA 4EVZA 1ZK5A 5LNGA 1CYXA 5ANHA 2FL5B 1WS8A 2F8XC 4QCIB 3KM1A 1SEBA 1OXYA 3OTRA 5AW3B 3VPLA 4QO1A 1MWAB 4F1SA 1YQ2A 4OOUA 1GCYA 2V8MA 1OADA 4GRWB 2H8XA 5KVDL 1OV8A 4NT6A 1MDAA 3QC3A 2BOEX 4P3WA 5KVDH 3TH6A 1US2A 1UJTA 4AQ8A 4XAYA 5IWLC 3LI0A 4CU8A 2XVGA 3E49A 3OZMA 4MNJA 4LEXL 3H3KA 2V8LA 3ZDWA 1WLHA 2VT0A 1DL7L 1IF2A 3MBWB 2CZFA 4LEXH 3TOPA 1DL7H 5F0LB 4X9YA 3VNZA 2DT1A 3BJSA 3ESMA 2F7FA 4ODBD 5T1DL 5DF0A 2DTSA 3T0EA 1G1KA 2P8MB 2FTYA 1SJBA 2C15A 3PWAA 2N4IA 4UTAA 5T1DH 3DRQA 1GJUA 3VU1A 4AX7A 3IV8A 3PZGA 1YMHB 3ML9A 4X5XA 4R5EA 3FH5A 2Y5TB 3II2A 4J3OC 1XCQB 3EDFA 4KDWA 1O6TA 1RZGA 3RK8A 3ZYOA 1MDTA 4XPTL 5KYXA 1GG0A 4QHLA 4DZBB 3SYCA 2Q2EB 1U3HD 4Q8UA 3HZKB 2R59A 2Y1VA 4JX5A 4XPTH 1TG8A 3FTYA 5BYWA 3IMUA 2CKBL 2AEQL 4Y4KA 3O4LA 2EEDA 3L2IA 5DC4B 3RJYA 2CKBH 2WLIA 4KO7A 2AEQH 2ZXAA 1I7TA 1Z5YD 3NO3A 1WG3A 2PDPA 3P1VA 1UB6A 1A4AA 1T0MA 3KNBB 4WNQA 3FW6A 4C6OA 4M6OL 1V7NL 3HKZA 3BW4A 1KLGB 5EFIB 2KKQA 4M6OH 1V7NH 1PUDA 1QUNB 5KG9B 4K71B 3RPBA 5F2MA 3GSRB 1NCNA 2VLJA 3KPMA 4G9DA 3L9CA 2IH9A 4F3HA 4HJ1A 2BSCA 3HLKA 3KLAA 2FZ8A 2P43B 2BH0A 2L0DA 4NQCA 4EIUA 5DMYA 2ZG2A 4GXWA 4KNQA 5BZWA 3S6CA 4URTB 2OZNA 1X1OA 2JKSA 5IUSA 1E28A 4H40A 3GWQA 2EYSA 1DWHM 5HYJA 5FOOA 1M2OA 3FLUA 3CB3A 2RBLA 2KC0A 1U41A 3FFSA 2HT2D 4RIRA 4LOUD 3F5KA 4HCFA 2ZKWA 1WCBB 4Q7BA 4IP5A 4N2BA 5GVJA 1JR1A 3R11A 1DXIA 4OD2B 2BY2A 1FNLA 3S35L 2DZVA 2Q86A 4TVPL 4Z7QF 2HJFB 3IVKB 2DFAA 3R19A 4JTTA 3FUMA 3S35H 4TVPH 1HXYB 1S7UB 3EBGA 1KFGA 2VXNA 1GR7A 2OULB 4LPWA 5D2XA 1U8IB 2JIEA 5FFOA 5GS1B 1ITCA 3N41B 5C0CB 2CXGA 5FACA 1XGPB 4BSWA 4A3QA 3QDGE 1YPFA 3RCYA 4AW4A 1F6KA 1A4LA 1VDGA 2VDMB 2Z29A 5IMOA 5MERA 4ODUB 3JWNE 2ID5A 4BUHA 4Y7MA 1W72L 3IKKA 4ELMA 4NO0D 4ZQPA 3EO1B 3O2DL 1W72H 4JTFA 4LBEB 1RV6X 5I3IA 3P73A 3QIWA 5I2UA 4LUJA 5CR8A 2ZAGA 4K55A 3QAZB 1E40A 3O2DH 2N7BA 4LCCA 4HJUA 2NPLX 2Q5BA 4XAKD 1QWUA 3IAQA 3P0XA 4IRJA 2NUTA 4J3VA 4BK8A 3QJFA 4R2GD 2J88A 4NO0B 4PL1A 3QNYA 1XSKA 4IDLA 5I6SA 3WO4B 1SOQA 1KTKE 2FYYA 4GZ7A 1Z6JT 5HY9B 2OA9A 1KTCA 1R3HA 2WQXA 4KPLA 3JWNH 5D2YA 3RL2B 4OTKA 4RDYA 3CHFA 3UR8A 4QHKI 1UJ3A 5A8MA 4YSQA 3IJDA 2Q7YB 3TFXA 2H0JA 3ARZA 3A9BA 2MQGA 4UIMA 1IQDA 2P24A 4PJCF 4WUUD 4OKVB 5ICZB 1AGFB 1HFUA 1HIZA 1JDDA 3T4AC 3ZE1F 2X1OA 1IEQA 2XJ7A 5KYUB 4NO3B 4KK6C 3APCA 4E5XB 1KIPA 3CQPA 1PZUB 3L5XL 4LCIL 1OALA 3H4WA 3BLEA 3D3VD 1EDYA 3P77A 1W3JA 2AL2B 1CICA 4BK5C 4WGVB 3L5XH 3N6HA 4L8SA 4LCIH 3T6QC 4ABUA 5IUCA 4NPKA 4YXGA 5H6HA 2Q01A 4H6RA 3YPIA 3RCMA 2CLKA 5D2NB 2B0MA 2YBVA 1REIA 3GSNA 3E12A 2JB6A 3MUCA 2JGQA 3DX7A 2XIOA 1XGDA 3CUPB 2LAGB 4RW3A 2P53A 1D6EA 3TZVD 4QTFA 3FQXB 1MJJA 4JM2D 3WELA 1W5QA 3DGGB 5DD1L 2W3ZA 1UQYA 3BLKA 1E7VA 5DK0A 3O11A 3M17A 5EEUA 5FA4B 3QKZA 2PTZA 5KTEL 5DD1H 5GZOA 5GGQL 3VIJA 4IXXA 3SYQA 2VLMD 2QT6A 1H8SA 1BZ8A 5KTEH 2YCIX 5AVYB 5GGQH 4ANUA 2ZRZA 3VXUE 2ODIA 2ISDA 1CPUA 3ULVF 1J05B 1NBZA 4WCYL 2VP8A 2MPVA 4ZB5A 4AG4L 4YDJA 5CWSB 4LLVB 4WCYH 1M42A 1NZRA 2YBTA 5JMOC 4LT7A 1VLXA 2ORBL 3HUJB 4AG4H 4WK9A 3MHFA 3GSXA 1OYBA 4LYKA 2H5UA 2ORBH 2O6PA 5D6CB 3PZMA 3QE5A 1QNVA 3S9IA 2Z35B 5ISZE 1HSBB 5AN7A 3ISIX 4FG2A 1P5UA 3MRGB 2NR6C 1PAMA 3RNDA 1VFOA 3PWLA 4JFDB 5CP7A 3NIGF 4BFFA 3W0WE 2BC4A 5FKPB 3PJNA 3IVSA 1L9QA 5GS2H 1P7KB 5I78A 2DMHA 4PRDA 3BN3B 4NC2B 1A22B 1R4XA 3D85A 4GW1A 2XPKA 2ZZ1A 5KAQG 2VAAB 1AXSA 2PMQA 1R34A 3N6YA 4NZ3A 2R23A 1YDVA 4ZPTA 4UQBA 5E4EB 1N6QL 3P4NA 4JY4A 3S2LA 3FUDA 2GQ8A 4K7PL 5F8RC 3TLQA 1N6QH 3BZ4A 3F5WA 4MWAE 4E41A 4K7PH 1AD1A 3MBXL 4WDXA 4CD5A 3MRFA 1TLMA 4JFZL 4J8RA 5LXGL 2W95A 2Z0IA 3FDWA 4Z2HA 3MBXH 4F92B 1AACA 1OP9A 2YAOA 4L1BA 2G5RA 4EAMA 3EZ8A 4X99A 1H2JA 3TO2B 4JFZH 3DX2A 5LXGH 3C5JA 3VC6A 1ZLWK 4Y5YA 3UZVB 2QHLA 1NCGA 3D2UD 3LN5B 1DDTA 3DMMB 1KW1A 1PX4A 3TO4B 2IMNA 5EBUA 3VAEA 3ZMNA 1UYQA 4JNMA 1FOBA 3GFUA 2QAPA 1PCKA 1AUSL 4B92A 2A2IA 4LUSA 2XETA 1WZAA 4DEPC 2CO4A 4PJ5D 1C7TA 2JKAA 4AEHH 1G6RA 5I75B 5IVNA 4DZAA 5ABEA 2CLHA 2V2DA 3DUUB 1KYOK 3GB7B 3PWGA 4KT2A 3TQVA 5DMKA 3G0SA 4MZ1A 5IMMB 1ZDQA 3UWYA 4W6WB 1XR2A 1FAIL 1ONQA 1KXQE 3MRRB 3TJEL 4ZL1A 2Q8AL 3G2GA 1T0PB 1LO4L 2VUKA 5ID1B 3UBXB 1FAIH 3AW5A 3TJEH 1ZSDA 2AK1H 2Q8AH 4U1MA 3U7VA 3SCMC 4R84A 2J8OA 3W7NA 1FAKT 2EDEA 1CLXA 4GJIA 1LO4H 3V6ZA 3S37X 2N56A 4LCWB 4K9EC 3W2LA 1KNOA 3EDJA 1AG0A 4XXDB 5AOUA 1AKJD 2OZ0A 3P5YA 4I9AA 4K39A 3L1EA 4WW1A 1FVDA 3HA1A 1YEYA 3GDLA 3VXSB 3BZEB 4DKEL 4BKNA 1CLOH 2VZTA 5JIWA 4YIQB 2OMXB 4KRPC 2ZQKA 4RETB 1YX1A 4A35A 4DKEH 5G5DB 3L9EA 4IBYA 1GT8A 2GBAA 5AW1B 2DJ4A 4ZX4A 3WMBA 2AC0A 3SGZA 4OLYH 4JN1H 5J1AB 1T6WA 3DHJA 4NP4L 4NNPL 5D70L 1OVDA 5E5CA 3ZSSA 4PRHD 2BIQA 4LF3B 4G6FD 3N42F 4NNYB 4KDTA 3GBNL 4NP4H 3NRFA 4NNPH 3NN8B 2QZQA 3CL6A 5D70H 1L6XA 3SJVB 1VHPA 2QPEB 4HYVA 2DYPB 1CXIA 2IMRA 5F7LB 3GBNH 3DFOA 4LAZA 3VXMD 3U6XA 1TVHA 2X70B 4AW7A 4HG4J 1OAZL 1JFHA 1V6VA 3WE6B 3R8RA 5EMYA 3WEXA 3FQTB 5I24A 1OAZH 5DMIH 3HPSA 1WNOA 3QNZA 3JWDL 1AQKL 4E2DA 3P93A 2GQ9A 5IB4B 3QKEA 5I00A 5CLXA 3R0UA 2XXMB 4JKPL 3JWDH 3F2CA 1AQKH 3L5WA 5KETA 4JKPH 5DJAB 1CL7I 1EWHA 3FCUB 1BGAA 2JCCF 3MI2A 3DETC 4WK2B 4Y1AB 2HX8A 3AREA 4LRIA 5JPMC 4N24A 1NUGA 2WMHA 1XGZA 4HJGA 1D5XA 2VN7A 5F1VA 3QPYA 4PJ9A 4TTGA 1Y6MR 2BHFA 1FWWA 2PFHA 3D12B 4H1LG 4DOHB 1CFQB 3Q8AA 3L2NA 1CC3A 2HK0A 2Y23A 4I4WB 2EIKB 5HPCA 4RGMC 2ICCA 1N59B 5EC1A 3LM3A 4ZNCD 5HNNA 4WI6A 2PTYA 3IFPA 2FDBP 2YBRA 4ECLA 3DENA 4ASTA 1PJWA 8A3HA 3KPRD 2D7NA 3A5FA 1P7TA 4JJ5A 4ONHA 4JPIA 1KB9J 3NQGA 3VXQB 3OJDB 1R3KB 3U36A 3EJUA 3WUWB 3MP3A 4F37F 1OAYL 3SB3A 3K4ZA 2FRGP 3QRBA 3ABSA 2RAGA 3V4BA 3HC2A 5C0GA 3S1VA 4IHOB 1OAYH 1R19A 1A7OL 3Q5YA 1KT2A 3MBEA 1T1YB 1I8KB 1A7OH 2WZPA 2WXOA 4G1EA 4P5RA 1JZFA 2NSQA 4N0UE 3JZYA 2VFFA 4H26B 3IPEA 2YN3A 3ZKQD 4HIHA 1SGKA 2X89D 2PTUA 5EHFA 1Q8AA 4Q6XA 4PB5A 4FULA 1JI1A 4IOSA 2HJPA 5FGRA 4K5NA 1EV2E 2VM9A 3C8HA 3HRZB 5T3XE 2E0PA 4MNQB 4FQQA 4EQ3A 2CLRB 5G4HC 3P2TA 3MB9A 2YWZA 2DIJA 1Z5HA 4NF7A 1HJWA 5C97A 2VEFA 4NQUA 4RNFA 1WCQA 4E2VA 1QHQA 3LY6A 1ZJIA 2DM4A 5A2KH 2OYMA 5EO9B 4JVPA 4KJYA 3KVKA 1A8ZA 4L2YA 5AAWA 1TQVA 4MADA 4WUKL 3L5LA 2I85A 3CDZB 3GZKA 1EFZA 2YN5A 4B0MM 3DPDA 1W9XA 5IEKA 4KROC 4WUKH 2X1IA 2PLJA 2EPOA 2CR6A 1ZCOA 1SSDA 3FU0A 1E90A 3REWB 3C8KB 2DORA 1YNTA 3ZVIA 1IYXA 1OY0A 2CU0A 4GYPA 5AC6A 5T3XL 4FL4B 3EG9A 2EDHA 2X6CA 4HPNA 3TN0B 3V4UL 3L3JA 3TESA 5T3XH 4XTIA 4DK3A 4NPYA 5AKTA 3IJLA 4H0HB 4RZ5A 4Z0BL 3TPUB 3V4UH 3TEWA 4O57A 1OARL 2QGCA