2XIIA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with an extended 9-fluorenone iminosugar inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 157
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xiiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xiiA01
1E6SM 1H11A 3VTRA 3DX0A 3WD0A 3DECA 4ACZB 1EOKA 4IM4A 1G01A 2WZEA 1GOOA 1VJSA 1D7FA 4NXSA 3NDYA 2PC8A 2XSBA 3PZIA 3KZSA 1U30A 3K4DA 2F7OA 2BS9A 1JNDA 1DWAM 1TZ7A 1XYZA 2XVGA 5CLTA 2BHZA 4AD1A 2XFYA 1LWJA 1UH4A 2X8RA 3W24A 3OA5A 2UY5A 3VGEA 1FHDA 2ZICA 3N9KA 3MUZ1 4W85A 1D3CA 2X1IA 4H04A 1KR0A 2JEPA 4A3YA 4Y7EA 3EJSA 3T2PA 1R47A 3WEOA 2OW6A 1OD8A 3BVTA 2VTFA 4DUXA 1AQ0A 1V3HA 3ARQA 4U2YA 3WDQA 1HL9A 4D6IA 4KMQA 3T0AA 2ZIDA 4MADA 1E73M 5ABFB 4UOQA 3WQ4A 1JF5A 5EBAA 2WMIB 4P8XA 1JXKA 3AXHA 4V2XA 2J7EA 4C7FA 1G94A 2X2JA 1Q6FA 2J8FA 3VUPA 4JCLA 2X0YA 3VIKA 2WKLA 4CCEA 1VBUA 4GO8A 3GDBA 2EEXA 1O6IA 1CBGA 1E4MM 1W1TA 3T09A 2GVYA 1JFXA 5CLWA 1H2JA 3OGRA 3GXPA 4KWUA 3A23A 3BAJA 3VMPA 1E3XA 3VO0A 1H0IA 3VDCA 3CZEA 1B30A 3PZNA 2WC7A 2VX5A 1DEDA 1M01A 1UWQA 2D0GA 1JL8A 3SIMA 1E9LA 2QHAA 1V02E 1V6WA 2NW0A 4E2OA 5LA0A 3ARTA 3SCPA 2WWDA 1JZ8A 2A3BA 3KWXA 1K9FA 2PWFA 5CSUA 4UZUA 2W63A 3AJ7A 1ZS2A 1HX0A 3SCTA 1K9TA 1JZ6A 5A3HA 1UH2A 1BYCA 3L2MA 6TAAA 5A69A 1V3MA 1UH3A 4U2ZA 3WFLA 3VNYA 1EGZA 3DYOA 3NUKA 3VD3A 1BAGA 4PMOA 4Q7NA 4HPGA 3II1A 2YDSA 2QPSA 1CPUA 1VRXA 1KTBA 4ZE5A 4YPJA 5CJ5A 1CIUA 1YHTA 4H8UA 2CESA 2VZUA 3W6LA 3VX1A 3GNOA 4AEEA 2G3MA 3ARRA 3HU7A 4QAWA 2WHKA 4JFUA 4XUYA 4NZFA 5I0DA 1QNRA 2YL5A 4L4PA 1E0XA 3WH5A 3FAXA 4CGTA 2BVDA 1SYTA 4BQ3A 1H3GA 4U3AA 3RM9A 4GZEA 1CWYA 4D6CA 4AZ5A 1JI2A 1LJYA 5A6BD 4F66A 2J47A 2W5FA 3W26A 2BY1A 5LA1A 3WNNA 3HN3A 3VGHA 1UKSA 3K8MA 3SCRA 2G3NA 1FFRA 3MUIA 4CVWA 4AZCA 3AIVA 4CCDA 5I79A 1W3KA 4F79A 2VR4A 1BYDA 3AHZA 3AMLA 2F7RA 1E6QM 1ZBKA 3WD2A 1JDAA 1FH9A 2OLHA 4P7RA 3AISA 1GQJA 3CUFA 3GXDA 1ISWA 5A8QA 3WDHA 4B15A 2DGAA 2ZUSA 4OBRA 3BCDA 3AIBA 1VFFA 2FGZA 1UQZA 2DSZA 1OSEA 2Y5EA 3UEQA 2D20A 4OZOA 2V3DA 3WUEA 2WVSA 1QVBA 1FOBA 2UY4A 3LPFA 2WW5A 3MO4A 3EDDA 2DT1A 1BG4A 2BY3A 3SCOA 3N1AA 5CPTA 3MSGA 3WELA 3WF4A 3ZJKA 3DHUA 1HJSA 4EANA 1JNEA 5CZKA 1CXKA 2V3FA 4B3LA 1FP9A 2WKGA 1R7OA 2XN2A 1JYXA 3LRKA 2JF7A 5A95A 3KL5A 3DC0A 3EJTA 1CXHA 3FN9A 5IHSA 5FL0A 2JE8A 5GNYA 4PYSA 2D2OA 1W91A 4HOZA 3BAIA 4JFVA 1UQYA 2HISA 3CUIA 1NM9A 4QDMA 3POHA 1ZJBA 3CPUA 3OLEA 2CNCA 4AWEA 2ZXDA 1UZ4A 4DWSB 4HZ7A 1NP2A 2VURA 4DM1A 5M3WA 4J3TA 4MNJA 1R87A 3WD3A 2G41A 2GJXB 1QI4A 3AMGA 3DDGA 1TA3A 1QBBA 3AS2A 1QPKA 3BLBA 1VF8A 2GUYA 1E6ZA 1ZJAA 1GPFA 2YL8A 1I1WA 3WENA 2J7GA 1K6AA 3FXYA 4DUWA 2ZX5A 3WF3A 4DWSD 5M03A 4WSJA 1UOKA 3CZKA 3RIKA 2X2YA 1BGAA 2D24A 2VVNA 3VD5A 4AIUA 2CBJA 4TTGA 2ESCA 1LL7A 1M53A 2YJQA 1ESWA 1V0MA 1DTUA 1W3LA 1W1YA 2PBGA 2PWDA 1JF6A 2J4GA 4JKLA 5D8WA 2PWEA 4AZGA 3W82A 3WNLA 2G8ZA 5I2UA 2YL9A 3N13A 1OWQA 3CGTA 3MUY1 2EAEA 5IFPA 2VO5A 4GIAA 3RPMA 4AD3A 2JEQA 1X1NA 3S5YA 1LG1A 4CN1A 2QMKA 3VDAA 2CETA 2ZUUA 4JKKA 5FKYA 3VIHA 2WMHA 1LL4A 3KLKA 1LL6A 1VFMA 5ABEA 4QLLA 4AZ6A 2J78A 2DIJA 1HKIA 4QCEA 4EAMA 3GZAA 4FNUA 3THDA 3TTOA 3A22A 4W8LA 3J7HA 3D5HA 1BG9A 1V6XA 1VIWA 1GQIA 1R8LA 2VX4A 4W7VA 3DX1A 1UWIA 3WN6A 5FD0A 3VDBA 5DF0A 2XJ7A 4PMXA 3VGBA 3F4VA 3GYCA 4AYGA 4S3KA 4IPNB 4BQ4A 1EDQA 3IK2A 1MXGA 4XZBA 4KGLA 1L0PA 2WVUA 1XCXA 1XD1A 1V3JA 1B3XA 1HJXA 6CGTA 2VOTA 1JXJA 2J62A 3BVWA 1CGVA 1BFNA 4UQ9A 4JHOA 3WUBA 2DH2A 1WZAA 1E4NA 1OT1A 1OGBA 2OSWA 3TV8A 2EPKX 3IAQA 2VZSA 4AZBA 1ISZA 3EMCA 3VILA 3ZJ8A 1EHAA 3AMCA 1NOUA 3GNRA 3WQVA 3D50A 2BVYA 4KGJA 5JBDA 2BHYA 1HKMA 5I6SA 2YL6A 1F4HA 3N17A 4CKQA 1R85A 3ARXA 2F2HA 4J3UA 3S5ZA 3L4VA 3MMWA 4P7OA 2CIPA 1GZJA 1KFWA 4PRWA 3N04A 1J11A 3LPOA 3HG4A 1E3ZA 1GW1A 5C70A 1BVNP 1TQUA 3RO8A 4HTYA 4F9JA 5D8ZA 2G3IA 3AS1A 4ACZA 3L4YA 2WPGA 1CGWA 1VBRA 2EQDA 4QP0A 3ARPA 4ML4A 3A4AA 5HPOA 4CN6A 3VSTA 4JIEA 1W9DM 1VEPA 2VI0A 4EK7A 2XPKA 5FL1A 4HA3A 4C7GA 5A2BA 4LQ1A 2EABA 4ZE4A 3L4TA 3AHVA 1JIBA 2YDQA 1HIZA 1E6XM 2ZX7A 1M7XA 1OIMA 1HJVA 3A6OA 2EPNA 5BROA 2WWCA 1HWWA 3AIWA 4HA1A 3MMUA 4UQCA 4F9DA 1B1YA 4OJYA 1OD0A 3ARZA 1NWUA 3PZGA 5I78A 2FGLA 2E0PA 1Q6GA 2VZOA 1WB0A 1J10A 5ABFA 4WKFA 3G6LA 3LX9A 2YIHA 2W62A 1OBAA 4TTUA 2WMIA 3BLPX 5D9NA 1U2YA 1W3HA 3KL3A 1CXFA 3AHYA 2J74A 3VSVA 3ARSA 3ECQA 4W88A 3CHEA 1EDTA 1GQKA 1YQ2A 1GJUA 2D1ZA 4FNQA 1AQHA 3BVVA 3QHNA 5GNXA 1SFSA 4BQ5A 3EJRA 2VX6A 4PTXA 3W0KA 2WYSA 3A4WA 2V3GA 1EH9A 2GJPA 2EO7A 3TOPA 3W38A 1GCYA 3A24A 2IGTA 4UFJA 1MW2A 2DDXA 1M03A 1OB0A 3TTSA 4UR9A 3CV5A 4D1IA 2FE0A 1CEOA 4B16A 4CD4A 2Z1SA 2J75A 4Z2JA 1Q6DA 5BWFA 2EJ1A 2RGLA 2VCCA 3NCOA 2VX7A 1KXTA 2A3HA 4H2CA 1W3JA 4ZXLA 3AMDA 3I3DA 1M04A 5M5DA 3W25A 3WF0A 2XGBA 4IUGA 3L4UA 5GQBA 3D3AA 4W7WA 1KXQA 1DWIM 1EOMA 1MQQA 2ZXAA 3BC9A 3FY1A 4AC1X 5CGTA 3VU2A 4KRUA 3ARVA 4J7RA 1H0GA 1QWUA 1ITXA 4D6EA 3OIHA 4D71A 3EBVA 2XHYA 1EO7A 5CPSA 2ZXBA 2X09A 1E4LA 3DYPA 4E8CA 4F8XA 3WMSA 3ARUA 4R5EA 4AZHA 1VB9A 3DHPA 2J8GA 1AVAA 4J3SA 2PBOA 3VDHA 3LPPA 4AIEA 4UFIA 1HJWA 1H1NA 3M46A 4GZJA 1W9VA 3K4AA 2EXOA 2F7PA 1BVZA 3CH9A 1V0NA 1OCQA 1UZ1A 2V5DA 4AMCA 3ZT7A 3HG2A 4FLOA 4HPHA 2G3JA 1K9EA 2DQXA 2W67A 2WSKA 3OLDA 1E5JA 3GTNA 1JI1A 1JZ5A 4MNLA 3QOMA 3AHTA 2A3EA 2FHFA 3BAXA 2A3AA 1NWSA 4WF7A 1JAKA 4MAVA 2YFOA 4X0VA 3EYPA 3UCQA 9CGTA 3H53A 3LRLA 3MUAA 1TQSA 2OW7A 3VM7A 2IUZA 2V38A 2VL4A 3HG5A 1CTNA 1MW0A 3CZLA 3TA9A 3LXCA 3KL0A 1WE5A 2XFRA 2XVKA 4NRSA 2VC9A 4PMQA 4JL2A 1Q6CA 4W84A 3E1F1 1X6LA 4U5IA 2JIWA 4ZXOA 2OWWA 4AZIA 1XCWA 4C7DA 2ZE0A 3BSGA 3PZMA 3WDJA 2WBKA 4X0NA 5JIWA 1QHPA 1K9DA 1NH6A 2UY3A 3M6DA 1V6YA 5EFFA 2VVSA 3K46A 3NYDA 3U5YA 2E8YA 3SURA 4D6FA 1W9PA 3F5LA 4ZFMA 1FH8A 3OG2A 3RJYA 3NIYA 4IPLA 4J27A 1JDCA 4ATWA 1OINA 1HTYA 2WSPA 1G5AA 4MNKA 4QCFA 1V3LA 3CC1A 3SEPA 4GZIA 4PMDA 2Y8KA 2GJXA 2VQTA 3FAWA 3GXTA 1J18A 3CZGA 3OZPA 4ATDA 3QHMA 2O9RA 8A3HA 1C92A 5BXTA 1LF1A 3VMOA 5I3DA 1BGGA 1EHNA 1ISXA 3ZT6A 1JYVA 3N11A 2E9LA 1E0VA 5A2CA 5JIPA 2AOSA 4BA0A 1IT0A 1E6RA 1ZBVA 2GDUA 4D6HA 1WZKA 2QMJA 3K1DA 5AYBA 3CZJA 3SCWA 1QOXA 2J7BA 1I75A 1WPCA 3FNDA 1QNSA 4OUEA 2WCSA 5CSYA 3T2QA 5EFDA 3NDZA 3AS3A 1HF6A 5C8BB 3WNPA 1E1FA 1JAEA 1V02A 1XRVA 4YN5A 3LRMA 1XV8A 1G0CA 2XVPA 5C71A 1H4PA 3HG3A 3ZIZA 1XSIA 2VMFA 3VGGA 3AROA 2XN1A 3T2OA 4CN4A 1E6PA 4MJ4A 1BTCA 4Z2LA 2FH6A 4W7UA 1FA2A 4HU8A 7CGTA 3PTMA 1WO2A 1OT2A 3RCNA 3W28A 1Y7VA 4FMVA 5DFAA 1QW9A 3GH7A 2V3EA 1VFUA 1TG7A 3CMJA 3NSNA 3WQ6A 3M7SA 4UOJA 3SUVA 3D51A 2XUCA 3WH6A 1DWJM 1DWHM 5EB8A 4GI8A 1E70M 2CBUA 4PMVA 1N82A 2XN0A 4DM2A 2O92A 3WQWA 4AMWA 1ODUA 3WDPP 3O2LA 3VIJA 2XSAA 3T0DA 1JDDA 2CCRA 4RE3A 5BCAA 1KGUA 3PBGA 1US3A 3O6AA 3RM8A 4LYRA 3VM5A 2QPUA 4HA4A 5FCZA 1PEZA 1HJUA 3AICA 1E72M 6A3HA 3ZJ7A 1OGGA 2DSUA 2DIEA 4CD8A 1JZ2A 5EMYA 4PTMA 2DEPA 1BSIA 4UQBA 4AY1A 3WY1A 3SCNA 5E70A 1UWRA 1CNVA 1HP4A 1MW1A 3F5KA 1BYAA 2JIEA 1ISVA 2XM1A 1UD6A 1UR9A 4HZ6A 2AAAA 4V27A 1V3KA 2XTKA 1PIGA 2X05A 1GOKA 3WL1A 3L2LA 2CITA 5DO8A 1ODZA 5BXSA 2ZXQA 1HVXA 1HN1A 3VD9A 4W87A 4GXPA 1SZNA 2DSWA 2D23A 2WLYA 2ALWA 2ZOXA 3WH9A 3BAWA 1TQTA 2W92A 3BH4A 2ZWYA 4DUVA 3VNZA 3BVXA 1CENA 2WCAA 3KEHA 2J7DA 3AOFA 3VGFA 3BCFA 3NSXA 2YLAA 5I23A 4P8WA 1UWTA 2D22A 1R7AA 1MFUA 3VOCA 1XSKA 2XFFA 5ECUA 2GDVA 1KCKA 4WJXA 1FP8A 1BYBA 1T0OA 2GK1B 5CXPA 4WSKA 2VZVA 4P7QA 2BNJA 1SMDA 3WY4A 4M8UA 5A6JA 4UNIA 2CYGA 3B9AA 1GNXA 3WNMA 4TVUA 5A8MA 2XVNA 4MDPA 4UCFA 3WEZA 1GONA 1MFVA 2VZTA 4FNSA 1VEOA 1S46A 4W8BA 1KGXA 1ISYA 1KBBA 1ZL1A 5IXEA 1EIBA 1HKJA 5GNZA 4E8DA 1JYNA 3UG5A 5GPRA 2QV4A 5AC4A 5E0FA 4B3KA 4PMRA 4Z2HA 3AFBA 2F18A 2J7HA 2YOCA 2F7QA 3EDEA 3MS8A 3S2CA 4HZ8A 2CBVA 1J9YA 2XYLA 1GVIA 1KCLA 1D2KA 4Z2GA 4K68A 1V03A 1OGSA 1US2A 4P8UA 1E1EA 2QLYA 1PZ3A 3WUFA 1GOIA 5KEZA 4D6JA 2OYKA 3AIRA 1E40A 5AYIA 2D0FA 3AZSA 1RP8A 3K8LA 1A47A 4XB3A 3EMZA 4Q22A 1O7AA 3AIUA 1KBKA 4RE2A 3W53A 4UTFA 1DP0A 1JFHA 5LA2A 3CHDA 2X2IA 1UR2A 4FNTA 2E4TA 3PZQA 1R46A 1FH7A 3GH5A 4V28A 5E6ZA 3ZMRA 2Z1KA 2QF8A 1MQRA 1QHOA 1CGUA 3WNKA 1VJZA 4M82A 3A21A 2A3CA 2YBUA 1GJWA 2WMKA 2WAGA 3GNPA 3CTTA 3GH4A 5FIPA 3U7BA 4D1JA 4UQDA 2Y24A 4PBGA 4AIOA 1ZBWA 2C0HA 1TR1A 1I1XA 4PN2A 1H09A 4WKAA 1BF2A 1W9XA 3TTQA 1WNOA 2VCBA 4HMCA 1GORA 3WL0A 3POCA 1KQYA 4H8HA 2CHNA 4MNMA 1E6NA 4MPKA 1PAMA 3SUTA 4UQEA 1UR0A 3MI6A 4NZJA 4PCTA 3AYRA 1W9UA 1QI3A 2NT0A 1J0JA 2XWEA 1UR1A 1J0KA 4MB5A 1WKYA 3T0BA 1V0LA 4JHZA 2YDRA 3CBWA 4WLCA 4B9YA 1UD8A 2OYMA 1L8NA 5I24A 2XIBA 3GXMA 3SCSA 3BAKA 5CQ1A 4QLKA 3IJ8A 1SR0A 1MVYA 5HDRA 5A8PA 2GJRA 3EJUA 3ZR5A 2XIIA 3IJ7A 1UWSA 3VD7A 4BCEA 5KZ6A 4OIFA 2OSXA 2CERA 5ABHA 3A3HA 3GBDA 1B3ZA 1KXVA 2E3ZA 2DT0A 2WXDM 3CUHA 4A3HA 4MB3A 5I77A 4J3WA 3IJ9A 2CHOA 3RJXA 4ATLA 1EO5A 4OGZA 2CKRA 2WVVB 3AZTA 4XZWA 1R86A 4HU0A 1OM0A 3SUWA 4LX4A 1JZ4A 2WNWA 1B0IA 4FLRA 7TAAA 3H54A 1PIFA 3WMCA 3OB8A 5BRPA 4PSRA 1UA3A 3BMVA 3HZ3A 3LXBA 4J3XA 1HJQA 2O9OA 5DT5A 2F61A 2YA0A 2PB1A 3OGSA 4JL1A 3VMNA 2XG9A 4UFLA 1KR1A 1HKKA 4TUFA 5A6SA 3BVUA 1XH1A 4AD2A 2EACA 3VGDA 4FK9A 4WK9A 5D9PA 3PN8A 1H41A 3ALFA 2WMGA 3QOKA 1HT6A 1J0ZA 1VEMA 5IDIA 4FLSA 2VRKA 1CXLA 2XM2A 5M17A 1KQZA 1R34A 2ZX6A 1TE1A 3PZUA 1B3YA 2O9PA 1C7SA 3D4YA 1PJ9A 2ZUTA 1XSJA 3D52A 4MAZA 3AXIA 4OOUA 3PZVA 2OWXA 2DSKA 4IISA 1WZLA 2WC3A 5A8NA 1PZ2A 1C7TA 3DYMA 1WDQA 3M07A 1XHGA 5A6AA 3MMDA 3KE0A 2BY0A 3MSDA 3I3BA 4MB1A 5A6BA 1F4AA 3A47A 4NRRA 1QI2A 3O9NA 4JFWA 2FYVA 2E8ZA 4LYPA 2V5CA 1JZ7A 4FNPA 1XYFA 2BFGA 4EKJA 1MXDA 4W86A 3SCQA 4NX0A 4YHEA 3CLWA 1KXHA 3UR7A 5IHRA 4Z2IA 1TVNA 1C8QA 4AXNA 1C93A 4NF7A 3BUBA 3U57A 4LXFA 2XWDA 1IZJA 2X2HA 1W2PA 5E6YA 4XX6A 3VKKA 3AXXA 3OZOA 1KWKA 3WMBA 4CU8A 4NSBA 3CO4A 2EPLX 3MV11 5D9MA 1GQLA 2MANA 2D73A 3FHAA 1E0WA 1UHVA 1R75A 2AMGA 1V6UA 1B90A 1VAHA 1NQ6A 1AMYA 4PMNA 3W81A 3WBEA 3UR8A 4BS0A 4GINA 3VSUA 4CD7A 3DDFA 3CMGA 3GXNA 4PMZA 1TVPA 2CEQA 2BXYA 3AIEA 3AHXA 2WLZA 2BXZA 1X6NA 2WVTA 4DO5A 2XVLA 3WH8A 1UKOA 3F5JA 2FDMA 2YLLA 2J25A 2JFEX 4U3CA 1UKPA 4W8AA 1J0HA 3AZRA 1TCMA 4ZENA 2W66A 1WDRA 1UKTA 2DT3A 2YFNA 5JBEA 5HNNA 4W5ZA 3OLGA 2E40A 2IXVA 4FLQA 1FFQA 3WDRA 4P8VA 5E9AA 1QWNA 4GQQA 5E1QA 3ARWA 1CGTA 2Y8VA 4JKMA 3APGA 4W89A 4M29A 1C3FA 1KWGA 3VVGA 1UYQA 4AZ7A 1KTCA 3CUJA 5JBFA 1VENA 4S3JA 5I5RA 4LPCA 1DWFM 3EDFA 1UG6A 2WB5A 5A8OA 4HOWA 4DO6A 3LPGA 5CPQA 3RM4A 2YA2A 1ZU8A 1WZMA 1J0YA 5D9OA 4DWSA 3PZTA 1C8YA 3ZQ9A 2OSYA 2BV9A 3A5VA 2EBNA 2OYLA 2OWCA 3VIPA 5E09A 1E56A 3VINA 4D6DA 1TQVA 2VQUA 3QGVA 1QI5A 1GOQA 3CHFA 4MDOA 4OOZA 3WD1A 3TONA 4W93A 1JD9A 1RH9A 3VIOA 3EJQA 4WKHA 4X9YA 3AQUA 2EADA 4UFKA 1PPIA 1TQWA 2VR5A 3BUPA 3GXIA 3WY2A 5HPCA 2X0HA 4LGXA 1H49A 2YBTA 4N42A 4CVUA 3VIIA 4ACYA 3N15A 3TTYA 4PTWA 3WIJA 1MYRA 1CDGA 4U33A 3TP4A 3WUGA 1WP6A 3QHOA 3NSMA 3VIGA 4W5UA 5FOOA 4CCCA 1CZ1A 4TOQA 1E71M 2RGMA 2GK1A 4E4PA 3L4ZA 2C8NA 4UFHA 2PWGA 3OBAA 2ZUNA 3IAPA 1LWHA 4FF5A 2WM0A 4AISA 2D0HA 3MV01 4GKLA 3ZSTA 4EE9A 1O7DC 4U31A 1R33A 4WIWA 2Y2WA 1ITCA 1WDPA 3N12A 4QLJA 1E5NA 2F1BA 1NARA 1LLOA 1J12A 1U33A 4N0RA 2E9MA 4RL3A 4XV0A 3PHAA 3CZNA 3WSUA 3HMCA 3SUSA 1ZBCA 3EMQA 3BLKA 1JYWA 5HXMA 2VNCA 5CGMA 1CYGA 3UETA 4CUCA 4PUEA 1Q6EA 1TMQA 1PX3A 1MW3A 4M80A 3SCVA 1HP5A 4U5KA 3PZ9A 3A4XA 3BXWA 3RILA 1NWTA 2ZX9A 3CHCA 1J0IA 1A3HA 2CKSA 4JFSA 1IV8A 4CD6A 4FNRA 4L4OA 3CZ8A 3OLIA 4NZCA 3THCA 2J7CA 1UR8A 5BRQA 4JCMA 4B9ZA 7A3HA 5A1AA 4BQ2A 1V6VA 2WMJA 3EDKA 5IFTA 3L4WA 4D72A 2ZUWA 1NOWA 1UD3A 4M81A 2FHCA 3ZM8A 3WDIA 1W1VA 2WCGA 2WZIA 3BUQA 2XGIA 2J79A 3MANA 1KB3A 1RPKA 2TAAA 1J01A 1HXJA 1QHZA 2VCAA 4URIA 2HVMA 2WZHA 1QNOA 3AS0A 5HOSA 3CZSA 3DX4A 1MWOA 4CU7A 4MJ2A 2C7FA 5ABGA 3U7VA 5DMYA 4PEEA 4JAWA 3LMYA 1E15A 2W4XA 2WHMA 1KGWA 3AI0A 4AW7A 2PF0A 3K8KA 3UG3A 1EQCA 1W2VA 2UWFA 2DH3A 3FHQA 3ZO9A 1SMAA 2DSVA 3WH7A 5HBFA 3WKZA 4M24A 4OBSA 2PWHA 4AZCB 3WQ8A 4PCSA 3D4ZA 3WY3A 2WMFA 3ARYA 1H5VA 2WBGA 1E4IA 4AD4A 1PX4A 1NWRA 2FHBA 4J28A 3VD4A 1PX8A 3VIMA 1BQCA 5A6KA 4GI9A 3OGVA 4TVDA 3RMEA 2W91A 3WBAA 4UQAA 3SUUA 5DT7A 3ALGA 4CD5A 4PTVA 4A4AA 4TX8A 2BY2A 1QNQA 3ZR6A 1WCGA 1W1PA 3MKKA 1BPLB 1XH2A 1BLIA 4HOXA 3W37A 2EPMX 3CUGA 4AD0A 2WVVA 2ZX8A 4P7NA 3PTKA 3GM8A 3BUIA 4H8VA 1EA9C 2DPEA 4GQRA 1LG2A 2PI6A 2WHLA 4J3VA 3W6MA 1VFOA 1UASA 2F8QA 4P7LA 1ZB5A 3ZSSA 1B31A 1UUQA 5CG0A 3MU7A 4BZYA 1XD0A 4MTVA 3BGAA 1XGZA 1HVQA 4NXKA 3WF2A 1XH0A 2D3LA 1WAWA 1QBAA 5BXRA 4HP5A 4BF7A 2BHUA 2UY2A 1V08A 4R27A 1NOFA 4KH2A 3EJPA 3HJEA 1GVYA 1HL8A 3DX3A 3PZOA 1Z32X 1JG9A 3FW6A 4HMDA 3VX0A 3S6TA 4AYSA 4AD5A 3AMKA 5AY7A 5A6MA 1C91A 1TA3B 1CGXA 1CLVA 2B31A 3BMWA 3VIFA 1MQPA 1ECEA 2CBIA 4PUDA 2CXGA 2GFTA 1B2YA 1AQMA 2O9TA 2Q8XA 3BUDA 2YA1A 3DX2A 3GXFA 3I3EA 4TX6A 1V3IA 1GOMA 2ZUVA 1EQPA 1RP9A 2J77A 3H55A 1CLXA 3IANA 4LYQA 2WANA 5BYWA 2YKKA 4UOZA 4AMXA 4GPNA 2VUYA 3SCUA 1B3VA 1CXIA 1PBGA 3UG4A 1UR4A 4JZ5A 3UERA 3AIQA 8CGTA 3B8SA 4M1RA 4H41A 1UA7A 1EDGA 3N18A 1GHRA 1UWUA 2W61A 1JD7A 3B9EA 2J7FA 1UD2A 1CGYA 4UZSA 4CU6A 1QX1A 1FHLA 5JUVA 4PMUA 1G9HA 1TUXA 1V0KA 3EDJA 3L4XA 2GSJA 3UESA 1B9ZA 3NJ3A 2NT1A 3U5UA 1EXPA 1C90A 4QFUA 4KRTA 2WK2A 4AEFA 1HNYA 2BVTA 3ZJ6A 2VJXA 3VPLA 5A2AA 3ZT5A 1CXEA 2FH8A 1G1YA 5DEZA 1QNPA 1NP0A 1WDSA 4YHGA 4Z2KA 2WHJA 4H7VA 1UKQA 3QR3A 4TVCA 3WNOA 3RDKA 1IZKA 1LQ0A 4PMYA 1HXKA 1DWGM 1E55A 3G6MA 2VRJA 4RE4A 1XC6A 1PS3A 4DWSC 2G4FA 1BHGA 4UFMA 1E43A 2NSXA 1QW8A 4M56A 5TD4A 2JF6A 3BSHA 2DT2A 4D6GA 1W9BM 5A94A 1W32A 1QI0A 3IGUA 2D3NA 3KLLA 5E0CA 2ZWZA 1OIFA 4DO4A 3W4RA 2IXUA 3JUGA 4NI3A 4MB4A 2E9BA 4ZEPA 1CECA 3PTQA 3ZOAA 4GO9A 3WFZA 1GHSA 1JGIA 3WD4A 1GOWA 5BXPA 5A6LA 2F1AA 2EPOA 1DHKA 2CPUA 2Y4SA 4PSPA 3WEMA 1UD4A 3B9DA 3W27A 2WC4A 2ZUMA 4TXEA 1JZ3A 3W29A 2VRQA 2VT0A 4OKDA 3CIVA 2JALA 1Q4NX 3LXAA 1UD5A 5AC5A 1RD6A 1C8XA 4GI6A 5D4YA 4JFTA 3WQ5A 3T08A 5F7UA 3BAYA 3AYSA 5LYRA 1B3WA 1TFVA 1P6WA 1GUVA 3GBEA 3WF1A 4HMEA
chains in the Genus database with same CATH superfamily
1E6SM 4YU1A 3LN5A 4Y9CA 3E3QE 5EZJB 2PMQA 3CLFL 3RB7A 1MI5E 1N5AA 3DURB 5I1KH 1A6UH 5IHUH 2EDNA 1C29A 5I75B 1IGWA 3EWCA 3QF0A 3AM8A 3BHBB 1FHDA 3N3TA 1NUNB 4LEBA 1FWIC 3IGXA 2ERJC 3F03K 1JPEA 3CX5J 5D7JA 1A1NA 4NO5B 1V3HA 2FD6L 2CLRA 3DSNA 1GAFL 2AL2A 4RA3A 4U3HA 1T2QH 4Y4FC 2XZQL 4BV1A 3B8VA 5L2KA 1XJBA 4YDKH 1IVTA 1L9WA 1S7VA 1KULA 5C3LD 3P77B 1EEPA 1AIZA 1JGUL 4AL8H 4H00A 3VDCA 3PZNA 1JNHA 2DQDL 3CXHK 5IK3A 1EBGA 1DEDA 2IQAA 2P24A 2KZHA 2DP3A 1QBMH 3MRFA 4H20H 4DB7A 2QHAA 4TS6A 1RZKH 4E2OA 5HD8C 3ZIMA 4EUPH 1R9YA 4GKZA 3W07A 5C0FB 3BWSA 3O6YX 2VEGA 5I3FA 3EB2A 1IM3D 1UH3A 3PWPE 4OZHF 2CNZA 4J4KA 3WFLA 2HH0L 1R5WA 2B77A 4F2FA 3O9WD 4WWID 2P88A 1NMBL 1JV5B 2ACUA 2YDSA 3GS7A 2W60A 3JWNC 1NCIA 1EFQA 1I9IL 4ZZ9A 1LO2L 5ABAA 3MRLB 4AEEA 4IZGA 4POZD 3HU7A 4U6YA 1CICC 2YL5A 1QVOB 3HUJE 3KPSE 1K5NA 3S6DA 4CGTA 1NCJA 1T2XA 2WLIB 1PIIA 3FSZA 3RM9A 3V0TA 4JFED 1CWYA 1JI2A 5D2LE 1LO0L 3VWJD 3G6JF 2YSWA 4GXMA 1UUSA 2FD6H 2QBWA 3WX7A 3TVMD 3ZKSD 4NN6B 1GAFH 2VR4A 1BYDA 5JIKA 5BRZE 2F7RA 3C8FA 2NXYB 1R3JA 4ZRGA 4P2QE 3GXDA 5EBUA 3BCDA 2Z93B 2XZQH 4UMSA 1LVEA 1TV2A 3JWNG 1XCQB 1FOBA 1GKOA 2E7CA 2W65A 4ZFQA 1J2BA 3M1ZA 1JGUH 3IDJB 2DQDH 2P5WB 4GT7A 4LBAA 2JKJA 3WELA 5EU3A 1JNEA 1UPPA 1FP9A 4F8LA 2AERT 2JF7A 4MAUL 3SYOA 4CBPA 3QJUB 1JGLL 3JWNE 4TQEL 1KT2A 2XPYA 4G9DA 3P69A 1MI5D 4UTLA 3MO1A 2XDHA 4NPYA 4IWWA 5I0VA 1KKOA 3OLEA 3FU3A 2JSFA 4L0YA 2HH0H 3WCYA 4L8SB 2G41A 1NMBH 3ESPA 3SDAB 4N28A 5MERB 3LEYH 4ZUVA 1FL3B 1ZJAA 5B4MC 1OGTA 4MLRA 1LO2H 1Q94B 2V2HA 4FO4A 3KPOA 2DU2A 3R19A 3OAYK 1K6AA 1VCAA 5D1QC 4DWSD 2C13A 1SN5A 4WSJA 5J89A 1ZVYA 4JAMB 3V4UL 1AH1A 2ARJQ 1VBHA 4GFSA 1Q8MA 2HBXA 4GAYB 2WMPB 1LO0H 1QMLA 2NY3D 5D7KE 2SFPA 4K7PY 1MEXL 3MUY1 3EYVA 4D8PA 1VGKB 4Q56A 2A6IB 1G1CA 4YIWA 5HI4D 4U1JA 4W8LA 1GGIL 2HX9A 5DJYB 2XN9D 2GUBA 1H50A 3B7RL 3RX9A 4GAFB 3PWPD 4S3KA 5DMMA 2WVUA 2HN7A 1YECL 3MU3A 3U2SB 1E2VA 3FC8A 3BVWA 1I7TA 43C9B 1V27A 1OFAA 4W9HC 4LOVA 5LGXA 5KANI 5ID1B 4TQEH 2INFA 3TL5A 5FR3A 3EMCA 5JLZB 3PWVB 1K3ZA 1QBLL 3HV8A 3Q01A 4JFPB 4LT9A 4XN2A 5D1QE 2Y7DA 3KPSD 4DOHE 3ARXA 1CZ8L 1EEXA 3PG2A 4PJDF 5DJ2B 5L6UA 4Y4FD 4L8DA 4PCPA 4C47A 3OHXB 4JPVL 3OKKB 1VBRA 2WTPA 3A4AA 4ZQNA 1JOIA 3O0KA 3EHBB 5CAHA 4PRIB 5BRZD 4FMKA 4C7GA 3HRZB 3V4UH 3V35A 2XTJB 4LQ1A 4P2QD 2PABA 5FV1L 4FG4A 1KC7A 3PWLA 1I85C 1JPDX 5HD8D 1JRHL 3MV8E 1HWWA 1BXNA 1VR6A 2OX1A 5DGQA 4RXGA 5DFVC 1MEXH 5G5IA 3QH2A 2K45A 3SPVB 4HW6A 2JFCA 2IV9A 2NDGA 3CDYA 1U2YA 4GBXC 3MI3A 2QDGA 1GGIH 2BZDA 3PAZA 3BO9A 4YMPA 4B5VA 4NQTA 5LG6A 4FXGC 2FJSA 4M8VA 2A6KA 1M05A 2BSCA 1ZIAA 4QHRA 4QDWA 4ZB2A 1YECH 3WIHL 4R97B 1F7BA 3OF6A 2HTKC 3WLSA 4QLRA 5HK4A 3E12A 2EJ1A 2NSMA 3Q2CA 2N3JA 3FUKA 3FFDB 2VX7A 1KXTA 5DU7A 3B6SB 1QBLH 2H8XA 4ZXLA 3K74B 3N9GL 3RX8A 1M04A 4APXA 4S0SD 3OVPA 2EE0A 1WICA 2YZ5A 2QQQA 5D6DA 2XTSA 4DP0X 3SFKA 5CSRA 5D7KD 2H1PL 2QJNA 5EU7E 2XHYA 4JPVH 1OTUC 1YPZA 2BWQA 4UCGA 2Z31B 1V8EA 4RMBA 4U6VL 3H8AA 4OUUB 1UWYA 5GHWL 1RHHB 4IOIB 4E41A 3M46A 1JWUB 3WHE1 3C6EA 2OGYA 3TYDA 3NG3A 2DM7A 3P0YH 1JRHH 2CBTA 1OCQA 4ABUA 2A9AA 4MQ7B 1I8KB 4YFLF 5A7EA 5EIIG 5EO9A 1TEYA 4A38A 1MRDL 2B0SH 4PUJA 3Q37A 4MAVA 1QAWA 1TDQA 2IJ0C 5EORL 5B4MD 4WGVB 2BIOA 4CDHA 4YC2B 5JW4N 5DEJA 5AOJA 4OGXL 4LH8A 3UAJA 4MWFA 4ERAA 5D1QD 1CTNA 1G4SA 4LCVA 2COQA 3LXCA 4HNNA 1H6TA 5D6CA 2H4EA 1N8WA 3WIHH 2DMBA 5CF3A 1EP3A 5T3ZD 5CCJA 3TA3A 1MCIA 2YBVA 3ZDYB 2ZRVA 1WG3A 3H9SA 4X0NA 1TZZA 2QCNA 3FFOA 4XI5D 2EDXA 2BVQB 3ZU8A 4QXIA 3GSNB 2ITDA 5IHZA 5CHNA 4ZFMA 2BO0A 4L61A 1U93A 4MAYA 3P4NA 4YHLL 2YBRB 3UAEA 3S88L 5SV3A 3P2BA 3O6DA 3IBOA 3MV8D 2H1PH 5TGBB 3C0QA 4E2DA 5HPMB 8A3HA 4LLDB 3OVRA 5I3DA 1FCBA 1CLCA 3QS3A 5JIPA 1CFSB 4QHPA 2IEPA 2QJJA 5GHWH 5DEGA 5DZLA 1XF0A 3SCWA 3Q2LA 1P6CA 3FNDA 5C0DB 5HYQB 1XGRB 2FECL 3K1GA 1E1FA 3JT0A 4YN5A 1ZWIB 4O1EA 3IKCA 3Q45A 2FJKA 5L8JB 3EGSB 1U8OA 1FG2B 4P9MH 3CUPB 4C6EA 1MRDH 1FVDA 1T22B 2CHRA 1T1XA 4GX9A 2B1HL 3LBMA 2YXFA 4FIRA 1RZ7H 3LDBB 2VLJE 1DSWA 2BNUA 3JVAA 5EORH 1IQWL 4OGXH 2UXGA 4PTTA 3RZCB 4L4VB 5I71C 1UACL 3KDMA 3HMXA 5F7KC 3GQYA 2X4SA 1JDDA 2XU9A 1F76A 1V79A 3N6YA 4POUB 1TQBC 4LSTL 3DIFA 4AY1A 2PCFA 5F7MC 2D2CC 1P5UA 1UJPA 2QFRA 1N64L 1UR9A 2H9AB 2ADIA 1YEDB 1UYWH 5KS9E 4YHLH 4GBXD 5BXSA 4CDGC 1YMHB 4NX5A 4ZNCD 3SHSA 5E6IC 3NZPA 1CENA 3GKZA 3D46A 5D7LA 3NCEB 1D5MA 1RERA 1BKHA 5GGUB 2MNRA 2GK1B 3TYAA 5JQHC 1AODA 2CYGA 4WCJA 1LUCA 4A7GA 3LCHA 3P5YA 1TX0A 1JQXA 2F7QA 1URZA 3K72B 4F7KA 5C54A 1TCRB 4S0TD 3ULSA 2AJZB 4HWZB 3S3BB 2GVEA 4J39A 1OTUD 2Y85A 3AIRA 1L3WA 5DURB 2C1GA 4NGHL 1UACH 4Q22A 2WAQA 2X0UA 7ODCA 1UT1A 2CIIA 5LBSL 3ZRCC 4B53A 3B83A 5T1LB 3PZQA 1R46A 2OX5B 3LQAL 4M0XA 4AE1A 4WU7B 2IOIA 3ESMA 5DJ0A 4OGQC 4P0DA 4FFVC 3TCLB 1CGUA 4NHUA 5T1KA 1Q2RA 2FFIA 3GH4A 4AWUA 2Y24A 2BCKB 5AW8B 1N64H 2VCBA 3RVUC 2G30A 3R43A 2C9RA 1KW1A 3RWHB 3CEUA 4WGHA 1J0KA 1PQZA 2VEKA 4FZEL 3UZJA 4PJXE 1O9ZA 3IV3A 3FU5A 4MWAB 2GDQA 5MI0B 3IJ8A 4XPAL 4HKXA 5HDRA 5BOFA 2VLJD 4WEEA 5SWZA 2NQJA 2C4XA 3ZR5A 2POTA 2K3TA 3FQ1A 1KXVA 5T26A 4BHUI 2HNHA 4XNYL 1OM0A 1TSRA 1GVQA 2D31A 1KIUA 3QULA 1M56B 3UJTL 2FJGA 4B96A 2XG4A 4JMXA 1KIRA 4N86A 3QYNA 3VMNA 2AXHA 4RFEA 3MBEB 4AD2A 4WHYG 1AH4A 4C1NB 4QHKJ 2OXGA 4NGHH 3NA9L 4PS3A 4R6UA 4ESKA 3HTWA 5LBSH 2XCMC 4KOCA 1TE1A 3LQAH 3P0VL 3F3HA 3K6SA 2FJHA 3D4YA 3W7HA 1CX9A 2XPZA 5U4NA 2XXGA 4KY2A 4X6DF 1BYOA 3F4NA 3UBHA 1XSJA 1LM1A 1CN4A 3E6HA 4Y9MA 4FQHA 5KZMA 1FZMB 2X1PA 1WDQA 4C6OA 5F9DC 3M0HA 1T7VA 5XIMA 1SMOA 3V16A 4GQGA 2V2CA 1KXHA 4NQXB 4FZEH 3CYVA 2K9FB 4DO7A 4WI3A 1GVEA 2X2HA 3KM8A 3WMBA 3AXXA 1D5IL 2WINA 3MV11 4XPAH 5IV2B 2ODIA 4KVNL 1A5BA 1G6CA 2HVKA 1P48A 3EH3B 3INUL 1QD0A 3VA2C 1YX1A 4NO0A 3UJTH 4HPOH 2V33A 4KO6A 1XF3B 3TN6A 2JFEX 3FN0H 5HNNA 1H6FA 5HJ3A 1FFQA 1MWAL 1FC2D 3NA9H 5I1DA 2ED7A 4L5FE 4NJGA 5I5RA 1DQDL 3KLDA 5FF3A 3INPA 4HAGA 1EEZB 3FT3B 2NY1B 3P0VH 4DO6A 1IJNA 5KBMA 3GJFB 5KW9L 3NEEA 3FU8A 2Y1AA 3NPZB 2BV9A 1G0DA 4OKVA 1KY6A 3MV7E 1CT8A 1QI5A 2BC4A 1F3JA 3RDTB 3EJQA 4AB4A 4APQA 3E5PA 2C9AA 1XQKA 4NQDD 2YYUA 4WEBL 3VH8G 5JMUA 3P54A 1CDGA 1KB5L 2TRYA 2Y23A 3E8UL 4PQXA 2ZRZA 1A7QL 4O2EB 4W5UA 1D5IH 5FOOA 2B1OA 1I9RH 3M0ZA 4HG4J 3MDJA 4QTFA 4KVNH 1I9CB 2VXUL 2KHAA 4AISA 4DZHA 4M4PA 5GZOA 1NSNL 3GLEA 1OF2B 4LLQA 4N8PA 4L8BB 3INUH 3QCVL 4TLSA 3WSUA 3GJEB 32C2A 2BOCA 3WFEL 4OI7A 3OWRA 4O57A 5HMFA 4DH2A 3MLVL 3GAKA 5CGMA 1J86A 4L9LB 2PDKA 1PLAA 2UY6B 3Q8CA 1DFBL 2DVTA 1M6JA 1MWAH 4Z7IA 3MJMA 4ANWA 1TJIL 3AQZA 3SYCA 5M95B 3DTXB 4M7LL 3V0GA 2ATPA 5FKPB 3M86A 1LEIB 2X4UA 3G04A 4Z3TA 4U49A 5KW9H 5IM7A 4KO9A 1WFMA 4KNSA 4X9HA 1HXJA 2NWSA 1M6OB 3D9AL 5H8PA 4MLIA 4ZBJA 5FGCE 1NC2D 1QSEB 2JV6A 4AEOA 1XCTB 5GIRB 5SWSB 3LQLA 2PF0A 3IDIA 2AVFA 4Z17A 3KD4A 1ICQA 3ALPA 4TF4A 4WEBH 4XXCC 1JUEA 3ABKB 5EPDA 1KB5H 2WBGA 3E8UH 3GRIA 1RBOB 1A7QH 3DA0A 3VIMA 3TN0A 4Z7AA 5EY5A 2NLYA 4X7TB 3GTXA 2VXUH 3P2VA 3SUUA 3QQ3A 4I1NB 2C4FT 1UATA 2BY2A 3KBVA 5JIDA 3KPQB 3L9BA 2OZ4L 3S1XA 3W76A 3QCVH 5J9PA 1YXDA 2P8LA 2PO6A 1BZ8A 2F8QA 1BWWA 3WFEH 3V9CA 3LA4A 3UJFA 1YQVL 5CEXA 2FATL 4BZYA 4PJ7B 1AACA 1DFBH 1QBAA 2FLMA 1TJIH 2ZC8A 1KA9F 1QRNB 3N43F 2FNWA 3VE0B 2GJLA 4RAHA 4M7LH 4ML9A 5C0AB 3HPAA 1UENA 3DOSA 1Y0LB 1ZE3H 1CLVA 2NUPA 1AOZA 5DJAA 2GFTA 3MRRB 2VDPL 4NN6C 4ANKA 1I3RA 2BSRA 1VACB 3RX7A 5I0XA 3RURA 2HRGA 1FNEB 4PREA 1DBKL 3FPXA 2V0TA 1GPOL 4IXHA 4W6YB 1PDKA 1I0BA 2AW2A 4Z18A 2XWTB 2V68A 2EG7A 5JUVA 1BZQK 1TQCC 4GUFA 1OW0A 1QAPA 5GVJA 3UESA 3NJ3A 4YHOL 4OLUL 2X4QB 1QATA 4YXLL 5J11B 4O8RA 2WHJA 5T1MA 4NZDA 3LOWA 5IEKB 4HJUA 4I90A 1H8LA 1IIHA 2O56A 1LQ0A 1R6VA 4R4BB 1XC6A 2OZ4H 5FOBA 4HKBB 1QW8A 5AYTA 1LOQA 1S5VA 1EVTC 2ZWZA 4DO4A 1ONXA 4FA6A 1QEWB 2FATH 4OM1L 4MS8C 4N2NA 1FWGC 4PCYA 1R9XA 3T7VA 4CQBA 1J5TA 4F7CA 2ZUMA 2JALA 3GVQA 4PGZA 4NT6B 5ECVA 3C5SA 3DKJA 3ITOA 4MY9A 1P6WA 2HXAA 1HAUA 1BVLA 2H2PD 4WWKB 3RPBA 1XAUA 4XCYB 4JFYA 3MDWA 2NW3A 1GOOA 1ZT1B 4FJYA 1YE4A 4OZ4B 3KYNB 1EZVX 2BHZA 2P5WE 5FW7A 3MJYA 5IMMA 3NQIA 3II3A 3HQ1A 4WNQB 1DBKH 4UTUA 2V6AA 1GPOH 4HYRA 4LKXA 3R0MA 1RK1A 3EZJB 5HAOA 3QXUA 5TPWL 2VB5A 1AQ0A 2VEPA 1TJHL 4UNVA 5J5RA 3CH1B 2WAHA 4BUHA 4MDJA 3AXHA 1LE9B 1TOXA 4YHOH 4PV8A 1WITA 3NZGA 4OLUH 4JM4L 2BP8A 2J8FA 4YXLH 3X1EA 1GW0A 4CCEA 1UGNA 2EXSA 1A5UA 4AM0A 2OU4A 3OGRA 2JJVA 5DHVA 2WBJB 3BAJA 2V0AA 3ERXA 3KGTA 4J4PA 2EECA 2WC7A 4PW9A 4KH9A 1B5TA 4ZUUA 1D9EA 4G8EB 5K69A 3DUSB 3FQXB 4MHHG 1KM5A 5IOBA 1R2TA 2H9GA 3OHXC 5HY9B 4JO2L 2YCLB 3G5ZA 2I85A 4OM1H 3EWYA 3SB0A 1TITA 2PWFA 3ZE2F 5INCB 2B2XH 4UZUA 4QNPF 3M45A 3HRZC 2XTJC 2YZ1A 1BPVA 2CBOA 4FFYL 1V7YA 3RWCB 3LNDA 1RUAL 2V5JA 1CFTA 3I9PA 3LRSA 3W7OA 1HEHC 1U8IA 5EPMB 2VDLB 4YPJA 4ILSA 4AU0A 1CQYA 1VADA 1BXAA 3T07A 4YO0B 4X8CA 2N0KA 4D9RE 2JIXD 3RWDA 3B7TA 1OX6A 2CKNA 3L81A 4L4PA 3AU1A 4BFIB 1N6UA 1H3GA 1M7IA 4D6CA 3TAKA 2VLRB 4M1CC 2MUCA 5TPWH 3OJMB 2BNQB 3D18A 1TJHH 1AGFA 2XETA 1RQEA 4TNVK 1AY1L 4F79A 4R97C 5F1KC 1FH9A 3QVQA 4JM4H 3UO1L 4E38A 4H9MA 2AK4D 3BEVA 2IPUK 3IU3B 4JN7A 3GXUB 1R5IA 4RMUA 2VXTL 5FJRA 4PRIE 5H94B 2NXYD 2XTJE 2GK0A 2NZ1A 5E4EB 5CEZE 1AGCA 1P9MC 3FUMA 4JO2H 1P0NA 3BPWA 2GBTA 1Z44A 3P80A 2Z31C 3QC5X 2GBUA 3BAIA 2P5WD 3TXAA 1NM9A 4KUZH 3K1KC 3V79C 4PRAB 1S8DA 4HUMB 1YYAA 1KN4L 3OB0K 2VURA 1RUAH 5D04C 3ARBA 4P3DA 3L9YA 2A79A 1IM9B 4B6ZA 3GVVA 4NQVA 1DUZA 1BAFL 3HPJA 4F5CA 5ID0B 4HT1L 5M03A 2PTTA 4RK8A 5ESVB 3KH3A 1J6PA 1XWYA 3THUA 1F4XL 3T77B 3GFUA 2TPSA 2CLOA 3VI4F 3W56A 4Q6YA 1UIOA 4FR6A 4MS8D 2OAAA 2XY2A 4AVHA 4X9GA 1EHKB 4BGLA 1AY1H 2G4GA 1XO8A 4Q6IA 5F1IA 2RDUA 1LT7A 1LL4A 4P9HL 5EUKB 3UO1H 3TTOA 5IRPA 2VABA 2XWBA 4NCDA 4L1GA 3RGVB 1AH0A 2VXTH 5LNUA 3K2KA 4EVNB 2GUOA 3BISA 1CK0L 1B3XA 3MBXL 4GMEA 4K37A 5PAZA 5FWQA 4F1ZA 5FOJA 1HCVA 5BZDB 1LK3L 4DJEA 4XBJA 3T1FB 2DQJL 4D9RD 5ABZA 3SJVB 3O6FA 2IOOA 4XC1L 4XPGL 1R85A 3G1DA 4J3UA 1KN4H 1T8QA 4GRLB 4G2DA 1DORA 2ZONA 5EBGA 1NAMA 3N04A 4GSUA 3W3OA 4WW2C 4BJLA 4M1DL 3ZRFC 1XIHA 2BW4A 3C09B 4NVTA 3CCHA 4W9GC 4JTAA 4Y5YA 1WKFA 3SE8L 3O0RL 4HT1H 1ICPA 3PHOA 2BIMA 4B5ZA 5AW6B 1GTFA 1F4XH 3B7UX 2E68A 4OCXL 3ZDYE 2XPGA 2CDEA 5C7XL 4B90A 2WB7A 5IB1B 5ALBL 4QKTA 5HDWA 2VR9A 5E94B 3QQ4A 2EIJB 2AJUL 1PDYA 4X7EC 5T3XE 4NSKA 1CLZL 2VUNA 3NMEA 2XTJD 5C07B 3EZ4A 3G6LA 5CEZD 1ADQL 4P9HH 5D9NA 4L3AA 3ARDB 3HI1B 4ODXA 4ZTXA 1NEZA 2JJUA 2OZ3A 3QHNA 4KZ0A 3VXPB 3OKEA 5TIMA 2O5NA 4PTXA 2PGWA 4BK9A 1GG0A 3NQ6A 4AQAA 1OXYA 1YA5A 3JV6B 1JGVL 2FE0A 3NPSC 4L0PB 3GMRB 5D9SB 4F9PC 2PU1A 4Z1YA 1LK3H 2ZZ2A 3EKGA 4Q9QL 2DQJH 3AMDA 2PDQA 4XC1H 3KXFB 4KC3B 4ODWB 4XPGH 5DQ9B 1VRDA 3L4UA 2JKLA 4W7WA 3N4FA 1OFDA 1RJLB 4FG2A 3PBUA 4M1DH 1P53A 2AEWA 5LAXA 5CZVL 5D05A 4QE5A 3ME0B 4L4VE 3O0RH 2PR9A 5EBMB 2DMKA 1BMZA 5J6HB 1SLVA 1DYSA 5HQLA 3CHVA 4QRQB 4OCXH 5C7XH 4IP4A 3W2DL 5CC3A 5ALBH 4Q4RA 2Z31D 5BOJA 4NJHA 2DQXA 5LB1A 3OLDA 1TRIA 1CLZH 3GTNA 7XIMA 4Y9AA 1X5JA 5EMLA 3E2VA 3IS0X 3LCLA 1ADQH 3N9SA 3NN8A 3ILEA 4G7FA 2FWUA 1XR9A 4DK6A 3LRLA 3IDNA 4XCEA 1RQBA 5KAQF 3CS2A 3TA9A 1P84K 1NGXB 2XFRA 4X6BB 1JGVH 3HKZA 1POKA 4KJWC 5JXED 1X6LA 1RALA 4U5IA 4ZXOA 4HUVA 3LSBA 5C3TA 3MV9A 8FABB 4JB9L 2VIRB 5GGRA 9RUBA 4Q9QH 1R3QA 4FQLL 1WYIA 5MI0C 3APCA 4TQHA 2IH1B 3HS0C 1E4HA 4ZOCA 4AJ0A 1KACB 5C0BA 1INQB 4V1DA 1RZIA 5CZVH 3UO8B 4Z1CA 3DIVA 4LCUA 3ZN6A 1C5DA 1FKWA 5T3XD 2VDNB 4JNZA 3MMEB 1YAIA 4YBLC 3DO3A 3U0PB 3WTUA 3DJTA 1FNHA 5AAPA 1WPCA 1ILUA 3KPNB 4IIEA 3W2DH 1JAEA 4FQ2L 2IAMB 3TTEA 1AUSL 4PC8A 5C71A 3N41F 3HG3A 4MKMA 1SFDA 3Q9QA 3ZW3A 3W9EB 3QXAA 5KBDA 5DK3A 1O68A 1LDSA 1IWAA 2V2DA 4AYFA 3GH7A 1OL0A 3HG1B 4HZLA 3W22A 3GZPA 3SUVA 1DWJM 2QPXA 2VISB 4OW6A 3MFGB 3RK8A 4AHOA 2PXYA 3CPRA 1Q7QA 5I73B 3WDPP 4MWAE 4F1SA 1XMWA 4XAWL 2B39A 1D6EB 4XAPA 4HYTB 2E25A 3GMLA 5EOCJ 2LGNA 4BCXA 3T9PA 1CFQA 4FZIA 5HGHB 4LYRA 4DFHA 3HN5A 3H4XA 4JB9H 2QUVA 3RZCD 4L4VD 3ZE0B 2DEPA 1BSIA 2ZWLT 1CNVA 4FQLH 3CHRA 2PCQA 1ISVA 3D0CA 3G5XA 1T89C 2CHWA 4JUTA 1SGKA 3GIZL 2VGLM 1HN1A 5H1WA 4S3CA 1FO0B 3A64A 1FCGA 2DSWA 2DQUL 1RPXA 2WLYA 2X5PA 4PU2A 4BH7A 4RPQA 5AWNL 2ZWYA 1NMAL 3EPNA 3LAFA 2Y6ZA 3IRSA 2X1TA 3C5XA 2FYYB 4H0LC 1KYUA 3RWJA 4E5TA 2Z28A 2ZOTA 1N2RB 3QIBB 4MDPA 4YNYA 4FQ2H 2WO3B 1EX1A 1CO1A 1VA9A 3O9WC 1ZL1A 1HKJA 5GNZA 2C34A 3VFUB 1CJYA 4M6OH 5E0FA 3VAEA 1UB6A 3QDMA 4HNCA 1FZKB 4XNUL 1D2KA 2QV5A 5E2TL 4NUQA 4MXWL 3F12A 4P8UA 1BAWA 2DFAA 2R39A 2P10A 3ZTCC 3CHSA 2KT6A 2P8MA 5EOTB 3GC2A 1XKJA 2CWNA 3RDTC 5LAPA 4UTFA 1DP0A 5TH2B 3VWJC 4WDIB 2X2IA 3ABQA 2E4TA 4IQLA 2ICWJ 2WJFA 1BQHG 1BD2B 1MQRA 5DURD 4IXXA 1VJZA 1BEYL 1GJWA 1UOWA 1EXUB 5AVYB 4UQDA 3AY4C 1E5UI 3RU8L 4LCYA 4GUQA 1TR1A 4WKAA 5T1LD 5EZOL 3R8QA 1UZHA 4P99A 1FWXA 2NYZA 1GYWA 3H0TA 1W9UA 1A6UL 2JKWA 2XWEA 2DQUH 1PKLA 2CQVA 5AWNH 4OB5L 4IGBB 3CBWA 1OG6A 4M1GL 2YR1A 1TPH1 3REVA 1DVFB 3VFVB 3TWYA 5FM4A 1C08B 3FTYA 2AGKA 5CP3H 1RUKL 2A6JB 4KJWD 3U0HA 4L9LC 3LTSA 4YNGA 2NLIA 4I3GA 5ABHA 2CHXA 1YN6B 4MYAA 3UGUA 2GQHA 2WYIA 4U1GC 3W1TA 3RVTC 4XNUH 3CD4A 5DQPA 2PB1A 3DHMA 5E2TH 5IG7B 3B43A 4MXWH 3QFJB 4KI5F 4YHYB 5L9FA 4QJ4B 1IM3A 3UTQA 4FL4C 5J1AA 1RZKL 3TXVA 4XZ9A 4BI7A 2K70A 3VD2A 4Z7OB 4FZ8L 1USZA 3SAZA 1BEYH 4XB7A 3G3LA 3PNZA 1TQXA 1HXYB 5K9DA 3RU8H 4Y6GA 4WXYA 1UZ8B 5EZOH 4F37K 4XZNX 3WAKA 4JFEA 3MMDA 3SIZA 4H40A 3OXSA 4IPIA 4JZOB 2XV2A 1TTJA 4ICCX 5C2GA 4LYPA 1XGUA 3TVMA 4ODTL 1JCLA 3RKPA 3CC5A 4HN4A 3JSSA 3UJRA 5H37H 5AHNA 4Z2IA 1BJ8A 3LS9A 4OB5H 5LHFA 4ODUA 2C7UA 4M1GH 1NKOA 3FKUS 2IWEA 3F7VB 3PGCB 1FP5A 1RUKH 1ZOXA 3HMWH 5E4AA 1AS7A 3RFZB 2MANA 3LZRA 1R75A 3DVNB 5F7FA 4FXFA 1OV8A 4CNPA 2P43B 4PMZA 4N2OA 1QSEE 4M8RA 1E28A 2G97A 2AXFA 5DDHB 5SWSE 1MI5A 1UKTA 4HIBA 5IW6A 2WY3B 3NP4A 2I9TA 5AAMA 1ZNNA 3OKLB 1ZS8B 5C2BL 1LQ2A 1AHKA 1G6VK 4HSQA 4TQIA 1NIAA 5FDWA 2F8OA 2H3NA 4O19A 5K9XA 3TV3L 3N44B 1UG6A 2NV9A 1A53A 1JEZA 5A2IH 3TSBA 4FZ8H 4MGXA 4DWSA 4NP7A 5FYJL 2ZYFA 2ENJA 2Q3OA 2LTQC 3FMGL 3A5VA 2EBNA 5E6RB 5I06A 2W88A 3LEYL 5EN2A 4J3ZA 5D32A 4J9JA 4EBQL 1NBQA 2OLAA 3IJEA 3MFFB 1F8TL 3HURA 4P05A 4PJ7E 2VR5A 4XHQA 1G6RB 2OQYA 2X0HA 2EKGA 4ODTH 5ICXA 4F0RA 3TCSA 2DW7A 1LNUB 4DJDD 1QRNE 3C5QA 3H6JA 3RDTD 2KLTA 3IJSB 4YWGH 2RAGA 3TYFB 3QA3A 5C0AE 4CCCA 2X4OA 3L4ZA 5GS2H 2C8NA 2XN9A 2PWGA 3HE6B 1G43A 3W1ZA 1F3EA 1NKRA 2ASHA 4RNRA 5JHLL 4U31A 4WIWA 3CU7A 3AXLB 4C6KA 2B16A 1NARA 1XZ0A 5IB3A 4HU2A 3LD5A 1OF0A 2VZ3A 4U4BA 4OFIA 4DGYL 5I0WA 1CFMA 3TQ0A 1THCA 1LRNA 3CPLA 3T0TA 4GOSA 1AGDB 1Q6EA 5C2BH 3K5XA 3T6CA 1M9SA 3HUJA 5E6SB 1HP5A 1JPTL 1NWTA 5I1AB 4PGDA 3K2GA 3IDXL 3MJ8A 4CW1B 5MEQA 4F7TA 3GO1L 3IXAB 5I09A 5D2LA 3CZ8A 3UY7A 4Y4FA 1DQVA 4LVDA 2V9RA 3TV3H 4BSVB 3ZVHB 3MZTA 3DHFA 3GT6A 4AIZA 3PHQA 5FYJH 5I3HA 1GA2A 5FEPA 3E9AA 3FMGH 2AJSL 1CS6A 1B4KA 3B4YA 2IDSA 4EBQH 3RVTD 2YW4A 1F8TH 3ARGB 2OKMA 4YHKL 1OHLA 1G87A 1SMAA 1ZLUH 3EYQC 4OLXH 2WBJC 2C5DC 3QWQB 5DR5L 1SF3A 3QZNA 1I7ZB 1QSED 3BJLA 3BN3B 5IQ9A 3BWAB 5SWSD 4NUWA 1IBFA 4XI5C 2Y22A 3RMEA 2O6PA 2EC9T 2DMCA 4AGPA 3IWPA 1XFPA 1T0MA 2P48B 1M42A 4X8JB 4P5KB 5CLYA 4E0RB 5JHLH 5BO1L 1CICA 4OLWL 1J8VA 3LV6A 1NCWL 3CFKB 3FOMA 3C2SA 1RY8A 1ZPUA 2HPTA 4DGYH 2MRYA 1ITBB 2ICEB 1E90A 5C55A 4JANB 1KENH 4J1OA 1R3LA 3WF2A 1WAWA 2ENSA 4BF7A 2H0PA 1JPTH 4XP5L 2FGBA 1UWEL 3IDXH 5E8EA 2AZAA 3KYOA 1HJBC 3CBRA 3V10A 3GO1H 3FW6A 4BH8B 1AMKA 1RVGA 2ACQA 2Z4QA 3U9UB 3AWGA 1AQMA 4KWWA 1F5WA 3GHEL 2YD2A 1QRND 3UGVA 3DAQA 4JRYB 2AJSH 3P8IA 2A83A 2Y5QA 5C0AD 5C6WH 3H21A 1UA7A 3H8NA 3VC5A 2D9CA 3B9KB 4YHKH 2G4EA 4M5ZH 3MRHB 2DYPB 3LXUX 3OPZL 3QPKA 1V0KA 1ECZA 3UU0A 2DQCL 5DR5H 1ROWA 4G8IA 4Z3GA 1KC5L 4X6EB 3T78A 3RX2A 2NT1A 3P0YL 4R7XA 5EU7C 4WV1B 1GOXA 3B1UA 1NBYA 1UJTA 3BESR 1CXEA 5L4FA 5L2JB 5D1QA 2B0SL 1EEQA 2W81C 5E9DE 5BO1H 4OLWH 3SJNA 3G6MA 3CLEL 5I5MA 2NSXA 1NCWH 5TD4A 5B1AB 4XZUB 3BSHA 3BP4B 1W32A 3HPLB 3W4RA 3JUGA 4ZMGA 25C8L 4MB4A 1LD9B 3GLZA 1CG9A 4S2BA 4PJGF 5M7QA 1BZ7B 2BNQE 3WD4A 4JO8A 2Y4SA 1UD4A 4XP5H 5KYYB 2X41A 1UWEH 1ML0A 1M41A 1AQFA 3L17A 1FF5A 1ED3B 4X6FA 1T5XA 3V7PA 3DCPA 3DVIA 4LEFA 3DX0A 2PPDA 3GHEH 2Y7OA 2ZC1A 5BUPA 2X44D 1XYZA 4UIMA 1HHKA 2B4CH 1G7LB 2V67A 4WWKD 4MD0B 3MUZ1 3LHYA 4WFEE 3RGVC 3RITA 4KOBA 4MJMA 3ATFA 4DGUA 3AWOA 3ASNB 2E46A 4URTB 4LDLB 3OPZH 1TNMA 3BJTA 2DQCH 5ABFB 3N1FC 1KC5H 4OCNC 5LNGA 1JJKA 3P9WB 1TRDA 3NPWA 3QJAA 3QJHB 2P1FA 2IG2L 1R24A 4NNXB 1P4LA 4P9ML 5C9JB 1W1TA 4PCNA 1P1ZA 5CLWA 3NGJA 3BO8A 3GXPA 3RY4A 4LB3A 3A23A 4O17A 1RZ7L 3CLEH 1UM6L 4FNLL 4O54A 1I85A 4DP5X 1JL8A 5EZLB 25C8H 2FO4A 2XQYK 3N2BA 3C09C 1V6WA 2ACSA 1FUNA 5CJBA 3EYQD 5B3JE 3KWXA 2WBJD 3ES6B 3BE1L 1W1IE 3D0VA 2ED8A 3HAEH 1UH2A 4GBXA 1ZVSB 3WQPA 4U2ZA 5LDUA 3FQRB 4J12A 1T3FA 5DX7A 2YGYA 3KPLB 4XZLX 5H35A 4FXGA 1TO3A 1UYWL 2ATKA 3GNOA 1EGVA 3DI3B 3IVSA 3GMOB 5IBUB 4U1IB 5LGKA 4ZFZB 1QNRA 3US9A 1VSCA 5IR1A 2XISA 3ARDC 4KKLC 2ADGB 1A0CA 5AZEL 2BH0A 5BZWA 4OZIB 3SN6N 4UNLA 4GZEA 3SRDA 2GB2A 1W3NA 5E9DD 3L95B 2YAFA 3SJVE 4UT9A 1UKSA 4MA3A 3HC0A 2DI7A 4FA3A 2GTWA 1OZQA 3V6OC 3LSCA 2IG2H 2ZXEB 3TFKD 1BIHA 4X4ZA 4XN9A 1VFFA 5AB9A 1XLIA 2FGZA 2Y5EA 3FB7A 2DL9A 1NEYA 1MZZA 5HHQA 3ANUA 3W7MA 4ZX4A 3MSGA 4XIMA 1UM6H 4FNLH 1TR9A 1CI5A 3QV9A 1ZJHA 5A95A 4MXQC 3H7RA 4QDPA 5I1CL 5JPMB 3BCJA 3BE1H 3IDYC 3CUIA 5A43C 5DCEA 2YEZA 5C07E 3N1QC 2QF7A 2BWDA 3P1VA 1M71A 1TU2A 4Y9GA 1ZLVK 4WFED 1Q1PA 8XIMA 5GGRY 3AMGA 3HR6A 2WN3A 3F04A 3S3SA 2YL8A 3WENA 1BSLA 3WEAA 1F07A 3HPFA 2DKUA 4CVXB 2WYHA 3EG9A 4ZFGL 1AJZA 1JMZA 4ZUWA 3V6OE 1ESWA 1J96A 5AZEH 1IM9D 1NPUA 3EKLA 1RPUA 4HU3A 2PWEA 3MO7A 4GFTB 2VO5A 4A7TA 3KXFE 3WIFA 1N18A 3S5YA 2PMZA 2XFWA 2VDQB 5DVLA 3VCLB 4Q2ZA 5EGRA 3KLKA 3NA4A 4K1GA 2H26B 3CFDA 3MLUL 1S2WA 4L7ZA 3A22A 1XLJA 4DPPA 1QLEB 2KL6A 4X6CA 2RBLA 5KS9A 5AW3B 3VJ6B 4XNMB 3UCCA 3L3GA 1VPXA 1MCEA 2VDMB 3PG9A 3W7RA 3FF7A 3RGVD 1JPST 2V4LA 4M51A 4MHBA 5I1CH 2VZSA 1ISZA 1NDGA 4G6CA 3DX8B 3PGFL 4JS7A 2Z65C 1FWEC 1BXBA 3SY0A 3I9IA 3ZVIA 3JZYA 1Q65A 3ELFA 3DNKA 5DMIL 2V9UA 3SJVD 3AS1A 3KCOA 4JO1L 1U8CB 1G7JA 3JZEA 2JGYA 3MNZB 4ZFGH 2LLGA 4JY8A 2OJEA 1HSAB 5GS0C 3L4TA 1A5LC 2P26A 2EPHA 3E2SA 1OAQL 2CO3A 2CO7B 4G8FA 2V9DA 1LO5A 1MJ7L 5HVHB 3L21A 1OF6A 5SWQB 2HG5A 1Q6GA 2VZOA 4RESB 1NFAA 4IK6A 3PYCA 4BI6A 2Z1BA 3MLUH 3VWKB 4WEMB 5E6IA 3L6FA 4HPOL 5C07D 4DXKA 1I1RA 1Q4WA 3FN0L 2FR4A 3EOTL 4G59C 2ZUXA 3ARDD 3LUTA 2MQGA 4KKLD 1Q9OA 4GYKA 4WI4A 4X4YB 3NZ8B 1ZHBB 3HIZA 1NFPA 2VCCA 4HWBH 3KWTA 4LUYA 2VMJA 3VKDA 2Q09A 4PW3A 3RR1A 4BR1A 2ENPA 1PNDA 3DFSA 1KRAC 3PGFH 1I4FA 2NTFB 3IJDA 1FNAA 2IDFA 2QQNL 4WI7A 1MQQA 4NQDA 3HG1E 1NL0L 1QNIA 1XIMA 2X6CA 3PABA 3QJZA 5DMIH 3UJJH 2BVEA 1A4KB 3KDPB 4UTMA 3KXFD 3WNJA 2KX9A 3ITCA 4JO1H 5EC2B 4R5EA 1VB9A 1T6WA 5GGSB 3S2MA 3SGDH 5AKQA 2X3AA 3KBNA 4Z3JA 4UFIA 3KGUA 4IX2A 4MXQD 1OAQH 5B80A 4I7WA 1V0NA 1MJ7H 2YQ3A 3S8WA 3ZT7A 4OD2A 3ZE0E 2H32A 1I9RL 4WI8A 3TH4T 1K5WA 1FPTL 4NFDA 5B7FA 5CZSA 5F7DB 4O0KA 4A22A 3MX0B 3U4FA 4NQ1A 5HHOA 2ZTKA 1HU8A 2O5ZL 3NQMA 4WEVX 2B5IC 3CFEA 1VCVA 1SQMA 3D25B 3KCWA 4K94C 2IUZA 2P8PB 3JYBA 3SN4A 5EU6B 4Q4IA 1W6LA 4UF7C 3EOTH 4OTXL 4E68A 2V69A 4QS6A 2PTZA 5E8PA 1Q6CA 3CN1A 2FPYA 1YDPA 3M1BA 4OF5A 1XYMA 2EEFA 3MLYH 4LVNC 1L6XA 1DVFC 1NC2A 1SHXA 5B7YA 3N29A 4HWEL 4XBEH 2WTRA 3SURA 4R3UA 3RJYA 2E9GA 1T03H 1FHGA 5I3KA 3ZHNA 1S9YA 3NJJA 1G5AA 2QQNH 1QTWA 1IAII 3ZWSA 1ORSA 4PMDA 1NL0H 1UC4A 4H5SA 2E74C 4HS3B 4QRRB 4WD0A 3PAVA 1BGGA 1CDYA 1T7XA 4P5UA 1KLUA 3FQTA 1W0YT 2DKSA 3QFWA 3OJGA 1JCVA 1GCFA 1Q9KB 1QOXA 4N9DA 2J1ZA 1AD9B 1P7KA 1BD2E 3O3EB 3QEUA 1UCWA 4BZ2A 2OTUA 3EBAA 2H2PC 1FCQA 2FSDA 1FPTH 3T2OA 4PLOB 2G5BA 2ZYHA 4H1LB 7CGTA 3LERA 4GEJA 1JZGA 1CT5A 4IMEA 2O5ZH 1VFUA 2AXJA 3H2AA 3M7SA 5E7FA 3T6WA 2CBUA 4UMGA 5JW5B 4A2SA 4N8VG 4AMWA 4X4XB 3ILDA 5HTSA 3T8MA 1UR3M 1SW0A 2O4EA 4OTXH 3TEUA 2RIKA 5GS0D 3HG1D 2IW0A 1I31A 1MFEL 5J6GA 3UWYA 1U91A 2F8VA 2BMKB 5I75C 4MLJA 4HA4A 1HJUA 5GRYA 2F74B 1QU4A 2Q87A 4OU1A 3WK3A 4PJ5A 1M4KA 1S7XA 1T1YB 4HWEH 1QR7A 5I76A 5ICZA 4P4RB 4HV8B 1KZQA 4V27A 2H3DA 4F92B 2XTKA 2AABL 3VCCA 4IGHA 1G4EA 3WL1A 1IBZA 5C92A 2HBVA 3BP5A 3QFJE 3CDZB 4I5BA 4KKZA 2FVKA 3BH4A 5CGYC 2APSA 4HYWA 3KEHA 4F7EB 4IHOA 3V0WL 1LROA 4GXVH 3CVIL 2BNJA 4Z7OE 3UWEA 1XGDA 5CGBA 4XK2A 3CJJA 4TM9A 2N0MA 3C60B 3VFCA 4PUNA 3L5WB 2YD6A 3V0VB 1EWHA 4Z2HA 3RLUA 4X5WB 2FZNA 1AE6L 3C8DA 2Q86B 5DJ6A 4KO7A 4Z2GA 4BFRA 1DBBL 1V03A 1Z5YD 2YN5A 4B9KC 2I1OA 4GK8A 3WUFA 1ZT7B 2ABBA 2RFXB 3TJ4A 4OGYL 4HKJA 4IK7A 4TNEA 3TC9A 1HZHL 1HTIA 1O7AA 3W53A 4JHAL 4HJGA 5LA2A 3MV7D 2EIKB 1MFEH 3F5WB 2EICA 4K23H 3IF1A 3LOTA 1JJUA 4LOCA 2V7NB 2PDLA 3DOPA 4QRUA 3QORB 2Y7QB 3N14A 1ZT4B 1K3UA 2NXZB 3TTQA 5EZJA 1N3NB 4FXRA 3RI5F 1PS9A 2AABH 1KO0A 4MNMA 1BD2D 4JTUA 1UR0A 1N0LB 3OYXA 1QI3A 4TMCA 1J0JA 2NXYC 1K02A 3ILPA 2N4IA 5GSRB 1RK7A 4I9AA 1B2WL 2A3LA 1NF7A 3V0WH 5CSBA 3OQ8A 4QLKA 4WUUA 3FQNA 3VYLA 3CVIH 2OSXA 4CEUC 4MB3A 5I77A 4QJ3B 4L65A 4IGBD 5EU4B 3RJXA 1DVFD 3AUWB 43CAA 3F4WA 3AZTA 2GYSA 1JZ4A 3H54A 2ENYA 1S2TA 3HA1A 5CN2A 2BP0A 2DUXA 1AE6H 3BMVA 2BPBA 1DBBH 4XXCA 1O1ZA 5A6SA 3SW6A 4L8SC 4K5LA 2W1NA 3MP3A 5DC4B 3SDAC 5AZUA 4OGYH 2Q76B 1HZHH 4N9OB 1G4TA 1TPFA 3OKYA 4JHAH 2HRHA 5ABDE 4IBWA 5ELIA 3QFJD 2B2XL 3IMSA 4L37B 4BQ8A 1PZ1A 2JIXA 4Y7OC 1E7VA 3IE9A 3ZHFA 1V7NL 3AXIA 4QHLB 3PUOA 3EGJA 1JV5A 3UVIA 5IVZA 4TSCL 3GDKA 1ADOA 3PBYA 3A47A 3E2RA 3HZYB 4LHUB 3N42F 4DKFL 2V5CA 3EYFB 1AA1B 3URBA 1RKRA 5LGZA 1MHEA 3TJXA 3JTSA 2XGZA 2WLIA 1RUML 1BKSA 1B2WH 4AVJA 3ZHKA 4NKOA 3VKKA 1UJ3B 4GB9A 3KTXA 2AK4A 4NYYA 4PRDB 4NUGH 1GQLA 1WUEA 4WU5B 3GX9A 3BUTA 1X6UA 2AJ3A 1AMYA 3HVDA 4JDZB 5E5UB 1XF2A 3W7NA 1QEXA 2CA4A 4NENA 1TVPA 2CEQA 2B08A 4IBZA 4GUHA 35C8L 3HLKA 3C6LB 1NIDA 5I26A 2WXOA 1UM5L 2O72A 3TEVA 4LU5L 5DA4A 4KHXL 1S9WA 4DVBA 1RJZB 4FDWA 3P0WA 3IETB 4KZEH 3LKSB 4GQQA 4DZAA 5CGYD 5E7BA 4JKMA 4C6CA 5ETUB 5G2WA 4S3JA 2XWZA 1BFTA 2NZIA 3EHBC 1SFLA 5AB1A 4KUZL 5CPQA 1SOXA 2R1PA 1S9XB 3IJLA 1V7NH 5AOZA 4FADA 4K3JH 4U1KB 1JCKA 1JWSB 4WO4B 4TSCH 1FL3A 1Q94A 1RH9A 3Q1SL 1WBYB 4IIQB 4DKFH 5I8EB 3IMUA 5K3VA 4LVHB 4BK8A 3GG8A 5AL0A 2OMZA 3TTYA 2X70A 4Q8QA 4F15B 1RUMH 5FYKU 4YL9A 3QHOA 1I8JA 3B9NA 3VIGA 4RDYA 4AVNA 1E71M 2RGMA 1QQDA 4E4PA 4JRWA 4AJVA 2OEKA 3OBAA 3UZ5A 3IAPA 2D0HA 3O3AB 3BARA 2Y2WA 4JRYE 1E5NA 2BASA 4N4YB 35C8H 4MRCA 1UM5H 3KWUA 4LU5H 1GYUA 3JU2A 4KHXH 3NCBB 3H7UA 1A5SA 3C8KB 1AGEA 2V9QA 3U2SA 4AKPA 1S5WA 2JXMA 2YEVB 3MHFA 4DPQA 3CH8A 1EAPB 3O2DL 1B54A 4MJ6B 3STPA 4NZCA 5ID1A 5I3JA 5BRQA 4YHZL 1IE7C 4F27A 2WMJA 2NX9A 3LNMA 4M81A 1TVHA 1SQ2N 3MUGA 3D34A 4ZYKA 2P5EB 5DJ2A 1EF3A 3FJ4A 1JCYA 3OHXA 5DMYA 3E96A 4WTWA 3OKKA 1WA0X 2HK0A 3Q1SH 3AI0A 2VC2L 2XLLA 4NQSB 1XBDA 5C9ZA 2FQFA 3KGRA 3GMNA 4PRTA 4POCA 3HRZA 1KELL 3SDAD 3FLUA 4MXVE 4DXVA 5JXEC 1ZHNB 5DUJA 4YC2C 4PB9L 3FEMA 3ARYA 1H5VA 2C71A 3BFOA 1BQCA 1AZUA 1X9UA 2VD9A 4KEMA 1J5DA 3SPVA 3TCTA 3ULUL 1BPLB 1EB3A 1EPFA 3C5ZB 1X98A 5JYLA 4I6VA 3TBWA 4L1DA 3H2OA 2ED9A 4P7LA 1MQ8A 3GSXA 3UFIA 4O2FB 3FA5A 4C6JA 2DVUA 5FF7A 1U95A 1BX2B 2BHUA 2HT2C 4R27A 2BS71 2B20A 2C3GA 3QTPA 4N0FB 1IKFL 1E5BA 3O2DH 3LKQB 3B6SA 4YHZH 3AMKA 1C91A 4HSNA 3BMWA 1MQPA 1ECEA 3GXFA 1GOMA 1MXSA 3S6OA 4JVUA 2OA9A 4Z7WB 3NQ7A 3BPLB 1P9MA 3ROOB 1QFWM 1UWUA 3C9NA 2Z31A 3M8OL 2JQZA 2J9ZA 1UD2A 4CMMA 5L9DL 2VC2H 1UIPA 4JRYD 2XIJA 1FYHB 3LDBC 3EOYG 1KELH 4IOIA 1CDCA 2QZ5A 4PB9H 3WLMA 1M2VB 2CLMA 3B9KD 3RZCC 3V0SA 1I8KA 3EHBD 1QFEA 4A68A 4YHPB 4O02A 4PRID 3VPLA 3TIDA 2CU0A 3IGFA 4H7VA 4YDJB 4IJCA 3ULUH 4LALA 1HXKA 4JY6B 3C2EA 1BHGA 4PWIA 1AJ0A 3RQ3A 3M7WA 1JDEA 4OZIE 2VFEA 1JGIA 5FA5A 4XD6A 1DZ0A 4WFFE 2XBTA 5EF3A 2VRQA 4OKDA 1U4EA 4F0HA 4HHMA 1IKFH 5FO9A 5F7UA 2CD0A 5AHMA 2Z6IA 5JIMA 4MRBA 1TFHA 2PW1A 2V2XA 3TNMA 3BOXA 2UWEA 2FEDC 2F1EA 1F9CA 2E1WA 2XFXB 1B0WA 3G1RA 3QZBA 4HGWB 5ILTL 2F7OA 3SKOB 3TNNB 1CR9L 1HNFA 2AC0A 3OA5A 2UY5A 3ECWA 1MUJB 5DVPA 3J07A 3P9LA 3M8OH 5E03A 5L9DH 1GYVA 4C6IA 3EJSA 2E86A 4DUXA 2FZ3B 4JFFA 3MACL 1XC4A 4XB8A 2VN6A 3WQ4A 5HYQA 1MVUA 3OAYH 4P8XA 4N0CC 2G9HB 4JNMA 2QDWA 4WW2A 4N9CA 4PJCB 1ZWIA 3KUMA 1FVCA 5BVPL 4Y7MA 5EFIB 1F41A 4GG8B 1IEBA 3OO2A 1HHGB 1HIML 5A6IA 1T22A 4I5XA 1B30A 3IVKB 3O45A 2C1OB 2FZBA 2CO6B 1N19A 4LBSA 3V0UA 1QSFB 3RE0A 5J56B 1QW7A 3NG5A 1OFBA 3S8GB 3KS0H 1XP3A 1WFJA 4DF0A 1FUYA 1EQWA 5D2YA 3AJ7A 3L2MA 3MTWA 2VXQA 4HXAH 1A9EB 5MKGB 1MG3C 4MWAC 4NY2A 3ZE1B 5HVHC 2VZUA 2CESA 1M1BA 3UBFA 3PDDA 3ARRA 3EKZA 5ILTH 1KTDA 2UXVA 4JFUA 1CR9H 2ZOKA 4HJ1A 4YQXL 4F9PA 4O15A 3FT4B 2EJAA 1CIDA 1OX4B 4PM1A 3A3XA 4ZA0A 2E6YA 4AZ5A 1F13A 1AO7B 3RL2A 4J2QA 2BBFA 3IDGB 2WKOF 5LA1A 3VFGL 1DCLA 3MACH 3VGHA 2HT2D 4JGMA 4DW2L 2Q7NA 5IQNA 3MBEC 3QFDB 3S5NA 5EN3A 4WJ5A 4ZB5A 1H3WM 2JCCF 1N68A 2E9IA 2NNAB 1PW3A 3FCTB 5BVPH 4ORGA 4M6OL 3SO3B 3SGUA 5LGHL 4WFFD 1UC6A 4FFWC 3UEQA 2P44B 2V3DA 1HIMH 4MJJA 3JV5A 3VQMA 4RA0C 1FWAC 1J9CT 4RR4A 3O0LA 4XO5A 4JGNA 2J13A 3BK0A 3BT2L 5CLZA 2ISVA 4X42A 1CXHA 3FN9A 3CU1A 3MBWA 3OXRB 4XRCA 1B6DA 3HTLX 4NOBA 5JDJA 5F88A 3H9HA 2Y7NA 4QSHA 3L08A 3T6QC 3DRTB 1R87A 3AC0A 1OAZL 1ZHKB 1NOAA 3LSOA 5EU9A 3C5JA 2JJWA 2BCKA 2ZG2A 3KWWB 1RSCA 4R88A 1K8CA 3DGDA 4YOKA 3TWAA 1OQXA 1UOKA 3WUWB 5K9OB 3RIFK 4EQ3A 4GC4A 4YQXH 1V0MA 2HMCA 1W8SA 4EIVA 1AFSA 2N1TE 3DESA 1S2AA 3V5DB 2VR3A 1QT1A 2AJXL 2I57A 2DAVA 2G8ZA 4ZXBB 3F4DA 3VFGH 4V2BA 2QQ6A 4DW2H 3HS0A 4LLMA 2PTXA 5LNSA 4Y19A 3K30A 4LRTA 5D1XB 1QA9A 1ZPTA 1XTMA 3SDXA 1BFOA 2ZDRA 2FEDD 2XV3A 5FJOA 1E65A 5LGHH 1GQIA 5F7HA 3FFCB 5DSCB 1Z5LB 4PLNC 1HFBA 3MA8A 3VDBA 3CMFA 2NY1C 4ONGH 4CLMA 5LCVH 2P28B 1IGJB 4RW3A 3BT2H 4XMUA 1FKXA 4G7EB 4C1NA 2NY6B 4LK4A 4DJDC 4L29B 2PDNA 1OT1A 1FFOB 2EDBA 1P7TA 4JK0D 2DOCA 2XTLA 3SECA 4N0CD 2ZAIA 4KXDA 3S83A 4KMLB 4YVPA 2AEQL 3UMTA 1TPB1 4X99A 1OAZH 2GQAA 3VXMB 3AAZA 1MDRA 4F9JA 1U8PA 5D8ZA 2PDCA 3EWBX 2E7HA 4CSSA 1ZENA 5JOPE 2EQDA 5EU6E 2PYFA 4K4KA 5HPOA 2APTA 3EOLA 1VZIA 3QUMA 3DZ1A 3PAYA 2EDEA 2KYIA 1AC0A 5AB2A 4YGVA 1E6XM 4JHUA 1HJVA 2EPNA 3U6XA 5AVRB 2AJXH 1ASQA 2J71A 5I78A 3QG7L 3HMWL 2VLME 3US0A 5JA8B 1T89A 3T8LA 4URKA 4UDTA 1M3JA 3WHE0 4LSSL 4RZ6A 1I7RB 3FK4A 3ZLGA 1W3HA 2IGFL 3QDGB 4MWAD 1YEEL 1A4JA 2JQXA 4QRRE 3A4WA 1TVBB 3W87A 2OOFA 4IMDA 2IGTA 4UOW0 5EO1B 1BQHA 1A49A 5IVXB 4Y1SA 4H1LG 3VWKD 3QNYB 2Y70A 1OANA 5F3BA 4ZG1A 4GIOA 2EEDA 2QVFB 3URNA 3O9WA 2E5CA 5IY5B 2YYTA 2R7EB 3K6FA 3MBED 2JI3A 1W17A 3IJ6A 1A66A 4AX6A 2AEQH 4RGOL 1JGDA 3WHXB 4RMWA 4AC1X 1AJ7L 4ENED 3RPIB 4FFWD 3BKML 3F2CA 1E5AA 3RDTA 1C1EL 3S5OA 3LBCA 1O12A 3VWJA 1GGYA 4LEEA 3RUGB 3W1QA 3DHPA 4YHIB 1AVAA 1VFBA 1PU0A 4NIKB 1XUZA 4YCPA 3QJQB 4YWGL 1GTNA 3AY4A 1K9EA 2VQ1B 3QG7H 1SPDA 3QZLA 1ORQB 3T3PF 4LSSH 2HJPA 2FHFA 1BF6A 1N10A 3DEQA 4AVKA 2E3VA 4KUCD 2IGFH 4XD3A 1YEEH 1K6WA 1TZHB 3LHAA 3F64A 4RZKA 2VJ8A 3MUAA 5T1JA 3GJEA 2V38A 2VL4A 2NXZC 1RZJC 3KL0A 1M3IA 4L9LA 2UY6A 2XVKA 4FEZA 1SY6A 9XIMA 4PV9B 4ES4A 1RU9H 4D7BA 5JOPD 1NH6A 2ZCGA 5FKPA 5E5MA 1LEIA 5CKAA 3S8FB 3Q6FB 2CGRL 1FH8A 2WOQA 2PU0A 4RGOH 2Y0SA 1AJ7H 3ZYJA 1M6OA 2HRWA 4FAMA 3BKMH