5TD4A

Starch binding sites on the human pancreatic alpha amylase d300n variant complexed with an octaose substrate.
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHNNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evaluation of the Significance of Starch Surface Binding Sites on Human Pancreatic alpha-Amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2016-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5td4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5td4A01
3O2LA 3WBEA 1WE5A 1KQYA 2CKSA 3LPOA 1QNOA 4EANA 2W5FA 3W38A 4QP0A 3N9KA 3A47A 1I75A 5BXPA 1MFUA 1JFXA 5A6BD 1TMQA 1GQKA 1CWYA 2RGLA 2Y8KA 4U5IA 3D4ZA 3RMEA 3L4UA 3RJYA 4HU8A 3ZSTA 3BLPX 1G9HA 2O9RA 5AY7A 4B15A 7A3HA 4NI3A 2BVYA 2J4GA 3W81A 1HVQA 2YL5A 4JL2A 5FD0A 1BYDA 4OIFA 2YL9A 3MI6A 4N42A 4BQ4A 2ZICA 1QBAA 5D8WA 2J7CA 1QW9A 5DT5A 3BLKA 2YDQA 3SCPA 1QBBA 1U30A 1E4NA 3GH4A 3BVTA 8CGTA 3N11A 5CSYA 1UUQA 4QDMA 1V3HA 1WCGA 3WEZA 1ODZA 2XG9A 1NWSA 5A94A 3UEQA 3WNMA 2D22A 2VQUA 2WHMA 2ZUTA 2DSWA 3ZO9A 4M82A 4HU0A 2ZUWA 5HXMA 1TE1A 1CGYA 1EDGA 2F1BA 6A3HA 1JZ8A 1HIZA 1GJUA 3CZEA 1L0PA 3PZ9A 4EE9A 5A1AA 3VIFA 1JF5A 1OSEA 3D5HA 1NOUA 1OIFA 3VILA 2VT0A 1UWTA 4CCCA 1HKJA 4E4PA 2FH8A 3G6MA 1QWUA 3QHOA 1BYCA 4JFTA 1LQ0A 3RO8A 4KWUA 1W9UA 2V5CA 1PX8A 2ZXDA 4OZOA 1R34A 2EABA 3A6OA 2WHKA 3PZNA 4DWSC 3DX3A 4BQ5A 2V3GA 4L4OA 3LPPA 1E6PA 4LQ1A 2XWEA 3GDBA 3KL5A 3AYRA 3GBEA 1WZKA 1JIBA 4H8UA 4E2OA 1M03A 3VGEA 5C71A 4CD6A 2BV9A 3ZR5A 3L4TA 1UA7A 4AD3A 4D72A 4J3WA 5IXEA 4AZHA 2EACA 3BCFA 1C8QA 4WSJA 1E40A 2G3IA 5D4YA 2WMKA 3N12A 3I3DA 3WD2A 1OT1A 4AMWA 2GJPA 3VIKA 3WNKA 2DPEA 3CHEA 1HKMA 4J3XA 1UZ4A 4PYSA 1BSIA 3L4VA 1J18A 2YBUA 3BAYA 3K8KA 2BHZA 1NWTA 5CPTA 4AISA 3BVUA 4QAWA 1BGGA 4H41A 4JKKA 2W61A 3MV01 4ATLA 1US2A 1UKSA 1C7SA 3GXMA 3VGDA 1JNEA 5A6AA 1HP4A 1H4PA 4MDPA 4LX4A 4B9YA 5FL0A 2BHYA 3OGVA 4AZGA 1KTBA 4KH2A 5D8ZA 5A8PA 5FOOA 6CGTA 1GONA 1AQ0A 3K8MA 1KXVA 3VDBA 1B3XA 4B3KA 2EEXA 1R75A 1TQSA 3BAIA 2GJRA 1OT2A 3RIKA 1V0MA 3K4AA 1DHKA 1UKPA 1XSJA 1HKIA 3WBAA 1B90A 2ZUSA 1JZ7A 3SCTA 2ZXBA 3MMWA 3UR7A 5EBAA 1E6ZA 5E9AA 3CTTA 3WQWA 2CYGA 1SYTA 4U2ZA 5CZKA 2WWDA 1EGZA 2VNCA 4QCEA 1MQPA 3ZJ7A 3GXPA 1JZ4A 1FH9A 4R27A 4GZIA 4UQEA 1HNYA 2XVGA 3HZ3A 1JG9A 2A3CA 2VI0A 1W2VA 3KL3A 1GOKA 2EJ1A 3APGA 6TAAA 4MADA 5I2UA 1ZJBA 3II1A 1EO7A 1UQZA 3GXIA 3AZTA 2Y4SA 2EPNA 2WSPA 2O92A 1CGUA 3CO4A 2V3FA 1QI2A 4HOXA 1TVPA 1UD6A 1CECA 1M53A 3NJ3A 4CKQA 1HL9A 3WEOA 1V6YA 1V08A 2D20A 4JHOA 1C8YA 3FHQA 1FFQA 4BS0A 1CLXA 4URIA 2NT1A 3SCNA 3ARTA 4JCMA 1TA3B 1WPCA 4CD5A 2BVTA 2VRJA 1QI4A 2DSKA 3SIMA 1JDCA 1VENA 1JDAA 3A4XA 1NWUA 2IXVA 5M03A 4XV0A 3OA5A 2ZUNA 2BY3A 2YKKA 3G6LA 4UFIA 1C91A 4GQRA 3W82A 1XV8A 4LYRA 2CITA 1OINA 1SMDA 3ZSSA 1HWWA 1VAHA 1B1YA 4P8WA 4PMYA 4D1JA 5DT7A 1EXPA 1CXKA 1UOKA 4NZFA 4M24A 1Q6GA 2O9OA 2JEQA 1XD0A 2VRKA 1FHDA 1E71M 1KTCA 3EBVA 1GOQA 3VDHA 3IAQA 7TAAA 2CESA 1ISZA 1EA9C 1M04A 2IUZA 3EDDA 4PCTA 3PTMA 4W87A 2WVTA 3RM9A 2WVVB 3W0KA 1EOKA 3AIVA 2ZUMA 5D9MA 1EHNA 3WH6A 3CGTA 2YL6A 5IFTA 4JKLA 3W25A 1Q6DA 4DO4A 4GZJA 3SUVA 2IXUA 3WF3A 2GFTA 3CBWA 4HMCA 4WJXA 3B8SA 4MDOA 2WZIA 1WZAA 1HJVA 4FNTA 1XD1A 4HZ6A 5A8QA 4OBRA 4FLQA 4MNMA 4D6DA 1E4MM 2CKRA 1LF1A 3BUIA 1IV8A 1CGWA 3J7HA 2CBVA 3GZAA 1CEOA 1CYGA 1W9VA 2E40A 1E0WA 2EPMX 3VIHA 4HA3A 3MO4A 1PIGA 5JBEA 3BSGA 4RL3A 3GTNA 2IGTA 3T0DA 2Q8XA 3NDZA 4PMXA 3VM5A 4WKFA 2WCSA 4PEEA 4MPKA 3DX4A 4H04A 1SFSA 2UWFA 3MV11 4NXKA 5LA0A 2WB5A 2J7GA 4N0RA 1TQUA 2OSXA 5CSUA 3D4YA 3SCUA 3ZJ6A 4PTWA 3LX9A 3ARQA 3VX1A 4P7OA 1H49A 4JFVA 1BHGA 3T09A 4TX8A 1H41A 1QX1A 3W4RA 1PS3A 4J3SA 2CBIA 1HX0A 2PI6A 3N15A 1K9DA 1KGWA 3A21A 2JF7A 4DM2A 4BF7A 4CN4A 3MSDA 3NSXA 2BXZA 5BYWA 5BWFA 3U5YA 2QMKA 1A3HA 5JBFA 3WH7A 1C3FA 2D3NA 3U7VA 3NSMA 4ML4A 2UY3A 3T2PA 4NZJA 1VF8A 2WMFA 5A95A 4Z2LA 2VO5A 3SUWA 1UWRA 2J47A 3CC1A 4Z2IA 1TUXA 4MB4A 1X1NA 2F1AA 4C7FA 2VVSA 1BYAA 2CNCA 3SUTA 3DX2A 1B3VA 3LRMA 2VL4A 3POCA 1OGSA 1KBBA 4U31A 4RE3A 2EPKX 3AOFA 5LA2A 4ZXLA 3ZT7A 4YN5A 5C8BB 3RM4A 3W26A 4M8UA 1IT0A 5A6MA 3VU2A 2EBNA 2EO7A 1JF6A 1B30A 3LXBA 1A47A 4PTVA 3CUIA 2DQXA 4P7QA 2BY0A 3ALFA 1EO5A 3PZGA 1SR0A 3D50A 2NSXA 3FNDA 4AYGA 1GOOA 4PMUA 3SCSA 2W67A 5FL1A 4TVCA 2ZWZA 3BSHA 4HA1A 5M5DA 4WKAA 4U33A 1GVYA 2EADA 1EOMA 1EHAA 1E56A 3MKKA 3ARYA 2ZX8A 1H5VA 1O6IA 4X9YA 4D6IA 1AQMA 3AS0A 4CU6A 4GI9A 3AIQA 4D6CA 1GPFA 1CENA 3AIWA 4J27A 1Z32X 3BAKA 1V02A 2OWCA 1W9XA 2VZVA 3M7SA 3BVVA 1XSKA 2WHLA 4GO8A 5DMYA 1E1FA 4AZCB 1VFUA 4UNIA 2GJXB 1GHSA 1B3WA 1KR0A 5CLWA 1VEPA 4MTVA 5D9PA 3W6MA 4CN6A 3SCOA 4XX6A 2J7FA 1QNQA 4QLLA 4MB1A 2WPGA 1P6WA 3EDEA 3GM8A 4DUVA 1WDQA 2D0HA 3BGAA 3WFZA 2D24A 4JFSA 3WNPA 3W6LA 1HT6A 2VZSA 2BVDA 1E5NA 3WNOA 2WK2A 3BVWA 1PX4A 1WZLA 3HJEA 1CXLA 4OOZA 2UY4A 1VBRA 5CQ1A 2PBGA 3BMVA 1W2PA 2ALWA 3AISA 3AMKA 1OD8A 2YJQA 3WUGA 1LLOA 5JUVA 1V6VA 5GNZA 3KL0A 1VB9A 4B16A 4ZENA 3IK2A 1RP9A 4Z2KA 3WD3A 1JZ5A 1UR4A 3GXDA 2V38A 4GZEA 4XZBA 3VNZA 1CXEA 3PZQA 5JIPA 1ITXA 3VIGA 1GZJA 5A3HA 1D3CA 1AVAA 2A3AA 2D2OA 1CBGA 4UFMA 1W3KA 3CPUA 2X2JA 4NZCA 1QOXA 1W3JA 2WC4A 3M46A 2YOCA 1JXJA 5FIPA 2DEPA 1G01A 1T0OA 1E6XM 1H11A 4WSKA 2HISA 4MJ4A 3OLGA 3ARZA 2E3ZA 1UD3A 1J9YA 1QHOA 2XIIA 1HXJA 3POHA 1MWOA 3BUDA 1G0CA 1L8NA 1NWRA 1PZ2A 1KGXA 2WMJA 4AZ6A 3WF1A 3ARSA 2J8GA 3M07A 3RM8A 2OYKA 4HA4A 3CUGA 3LMYA 3K1DA 5EB8A 1FHLA 3BUPA 3T08A 3VD3A 2Z1KA 4DO6A 1V03A 5F7UA 3GXNA 2V3EA 2DH2A 2CPUA 3EDJA 3ZR6A 1V3IA 1JAEA 2DIJA 2VJXA 2PWEA 4X0NA 2XWDA 2AOSA 4AZ5A 3W27A 3WQ6A 4MB5A 2E0PA 1M7XA 5C70A 4D6JA 4P7RA 3I3BA 1KWGA 4ZE5A 3W53A 1LL4A 2WBGA 1JFHA 3PZTA 1J01A 3SCQA 4UOQA 1FH7A 3AYSA 4Y7EA 4Z2JA 4W8AA 1JAKA 2UY5A 2XHYA 4BQ2A 3RILA 2GDVA 3CZ8A 4DM1A 2J25A 3GBDA 1H09A 4AD0A 5ECUA 4DWSA 1MW3A 1CGTA 2XN1A 2GUYA 3IJ8A 5IDIA 4F9JA 4ZEPA 1X6NA 3CMJA 2YA1A 3NYDA 5A8OA 2XJ7A 2G4FA 4UFJA 4AZCA 4D6GA 4TOQA 3UG3A 4AD5A 3SUSA 3WQ4A 5E1QA 3CZNA 5CXPA 1J0ZA 3VDCA 3WL0A 5IFPA 5JBDA 4Z2GA 1UH2A 2X2IA 3VD4A 4U3CA 3LXAA 2J8FA 1VFMA 4NRSA 1KCLA 1E6NA 1UA3A 3CHFA 1UHVA 4GPNA 5LA1A 1OM0A 4FK9A 4DWSD 2D73A 1S46A 3MUY1 4ATWA 4F9DA 1W32A 1WP6A 4MAZA 1MVYA 5TD4A 2FH6A 1KWKA 2XUCA 3UETA 4D1IA 1TVNA 3IJ9A 4J3UA 1JNDA 5E09A 1E9LA 1QNSA 1ZBCA 2EPOA 4HOZA 2WZEA 1N82A 1QWNA 4JHZA 3H55A 2OYLA 3AIUA 3WH5A 4AD4A 3HN3A 4PSPA 4MNLA 1PX3A 4AY1A 2W4XA 4YHEA 3VIOA 1JDDA 2O9TA 2VCAA 2E8ZA 2PWHA 4M29A 1LWHA 4B3LA 5GNXA 3HMCA 1K9EA 3VGGA 4PSRA 4PUDA 4YPJA 2WVVA 2DSVA 4R5EA 5HPCA 3VPLA 5A6BA 4AZIA 1HL8A 8A3HA 3WKZA 3CZJA 5CLTA 1UWIA 3KE0A 2F18A 2XVPA 1W3LA 3VSUA 1BAGA 4UZSA 1WZMA 3WQVA 4JAWA 1AQHA 2OYMA 2YFOA 1CXHA 1FA2A 2WVUA 1BTCA 2Y8VA 1BFNA 1J0HA 1WDPA 1ISXA 3ZOAA 4DWSB 2DT1A 3MS8A 3VINA 1V02E 1C90A 3D51A 1B0IA 3LXCA 1JD9A 1MQQA 2OWWA 2PWFA 1UD8A 1W1TA 4PMVA 2VQTA 1W9PA 3EDFA 1SZNA 1RPKA 1C7TA 1RD6A 1VFOA 4C7GA 2O9PA 4K68A 5EFDA 1FOBA 2J75A 2JF6A 1MW2A 2FGZA 1HF6A 1FP9A 2V5DA 1BQCA 4UTFA 4BQ3A 1CGVA 3CZGA 3ARWA 2QLYA 1B3YA 1ZBKA 2WLZA 5ABFB 1GOIA 3H54A 5JIWA 2ZWYA 4UFKA 5M17A 2YBTA 2WMGA 2F7QA 4P8VA 2AMGA 1GJWA 2XVKA 1BPLB 2FHCA 2D1ZA 2BXYA 3MANA 4CD8A 2XN0A 2XSBA 2W92A 1ITCA 1GHRA 1HKKA 1WO2A 2PC8A 4M81A 4W8BA 2AAAA 4P7LA 3BXWA 4IPLA 2WXDM 3ARVA 1CPUA 5A6LA 1ODUA 4CCDA 1V6XA 2JIWA 2ZX9A 2BHUA 1CXFA 4CUCA 1EDQA 3VSTA 1US3A 4D6EA 1XCXA 2YDSA 2WC3A 5CG0A 3W29A 2XM1A 2XGBA 1CIUA 3GXTA 4RE2A 4HZ7A 3IANA 2CXGA 1V0KA 2YFNA 2WANA 3KZSA 1LG1A 3WDQA 3NDYA 1M01A 4UQBA 5I77A 3WQ5A 3CZLA 1UWQA 1DWAM 4HPHA 1XH2A 5D9OA 2FHFA 2EAEA 1E55A 1WKYA 3F5KA 4MNJA 4E8DA 5A8MA 4MAVA 2FGLA 2JEPA 5I6SA 1BLIA 5D9NA 1MXGA 1KB3A 1V6WA 2GK1A 2WMIB 2BY1A 3KEHA 1UD2A 2WWCA 5KZ6A 1R46A 9CGTA 3GNOA 3WY3A 3NSNA 1HJUA 4D6HA 2EXOA 2WZHA 5LYRA 1EQPA 4UQDA 3VVGA 1Q6FA 1KFWA 2D3LA 1XGZA 4JL1A 1E6SM 3GH5A 1QI5A 3EJPA 4TXEA 4WK9A 4AW7A 2ESCA 2EPLX 2DSZA 2BY2A 4FLSA 2ZXQA 4UQAA 4AMCA 3RJXA 3UESA 3VGBA 3WSUA 3BAXA 4CGTA 2FE0A 1TCMA 2VURA 4YHGA 4P7NA 4MNKA 1DWGM 5AYIA 3AQUA 3UR8A 3BVXA 3BMWA 3UG5A 4TTGA 3L4ZA 4H2CA 2RGMA 2C0HA 2OSYA 5CPQA 3AHTA 1G5AA 3CZSA 5BXTA 2GSJA 3A4WA 4FNUA 3WF2A 3DX1A 3T2QA 4A3YA 3OIHA 2JFEX 1CNVA 5A8NA 4AIOA 1H2JA 1JYNA 2Z1SA 3S2CA 3WY1A 1E43A 2JALA 1RH9A 2D23A 2F7OA 2FDMA 2F7RA 2QPUA 2XFRA 3ZT5A 3EJRA 1V0LA 1EIBA 3PZOA 1XHGA 1V3KA 2ZX5A 4KRUA 2V3DA 3EMZA 1MW1A 2F2HA 2WVSA 5I5RA 3AJ7A 5I0DA 3QHNA 4PCSA 3WNLA 3SUUA 1R87A 3EDKA 4OBSA 3VDAA 2E8YA 1J11A 3TTQA 4QLJA 4AWEA 3W28A 2UY2A 1QHZA 4GIAA 4UOJA 1JYXA 1E3XA 3TA9A 2E9MA 4W88A 4PTXA 2FHBA 3TONA 2W63A 3RCNA 5I24A 4GXPA 2ZX7A 1UZ1A 3AIEA 4KMQA 3CHDA 1BYBA 1W3HA 2C7FA 1CLVA 4OOUA 2GJXA 2E4TA 3VMNA 1GQLA 5I23A 2OWXA 5HPOA 4KGJA 3CZKA 2Y5EA 3FAWA 2DDXA 5ABHA 5IHRA 4KRTA 2D0GA 3BUQA 4H8VA 1J0YA 2PF0A 3HG5A 1NARA 3AZSA 4NRRA 3WDHA 2X2HA 4UZUA 1WDRA 4TVDA 1D7FA 4AIEA 4NXSA 3QOMA 1VEOA 5A6KA 1CZ1A 3VIMA 4A4AA 1HN1A 2E9BA 4U5KA 3AZRA 3OG2A 3WD1A 3UG4A 1PBGA 1JGIA 1GW1A 2DH3A 1V6UA 3T0BA 1TQVA 1NOWA 4F8XA 1WNOA 1YQ2A 4JIEA 2VX6A 4E8CA 1UYQA 1IZKA 1TG7A 2TAAA 5ABGA 4ATDA 1JZ3A 1VEMA 2PWGA 3CUJA 2NT0A 3AMGA 3CIVA 3VKKA 2J78A 5GNYA 4QCFA 4ZE4A 1KXHA 1JI2A 1NH6A 2VRQA 3GH7A 1DEDA 3HG4A 1WDSA 3AIRA 2DGAA 3MUIA 2PB1A 5KEZA 2WCAA 3A24A 3EMQA 1EQCA 4ACZB 3BC9A 1E72M 3WUBA 2WSKA 4OGZA 1WAWA 4W7UA 1H0GA 3IAPA 2Y24A 1V3JA 1OGGA 4TX6A 4KGLA 1GOMA 5BRQA 4D71A 1AMYA 7CGTA 3DHPA 4CVUA 3VO0A 3N1AA 4OUEA 1CTNA 2VX7A 3BUBA 4TTUA 5HNNA 2CHNA 3OLDA 1TR1A 1QI0A 4LPCA 1KXTA 1UKQA 4AMXA 1FP8A 1OD0A 1E6RA 1NQ6A 1U33A 2VR5A 1JL8A 1QNPA 1H0IA 3CLWA 1KQZA 3AHXA 5M3WA 3HG3A 1UR1A 2JIEA 2J7BA 3DX0A 1U2YA 2XSAA 4AD1A 3TOPA 4J7RA 3OB8A 3SCRA 3CHCA 4UFLA 1V3LA 4AXNA 2PWDA 3MUAA 1BGAA 1NOFA 3VMOA 3A5VA 1DWIM 1XYFA 3BH4A 3AROA 1JZ2A 1TQTA 3IJ7A 3L4WA 1KCKA 4HP5A 3UERA 4M80A 4AYSA 1JYWA 3ZJ8A 3FN9A 2QPSA 2ZIDA 5ABEA 4TVUA 4X0VA 5GPRA 4RE4A 4EKJA 5A2BA 2WM0A 1JXKA 1UD5A 2F7PA 1R8LA 1BVZA 3WH8A 4MJ2A 2J77A 3QR3A 1ZU8A 1UH4A 2VCBA 1DP0A 4QLKA 1GORA 4LYQA 4ZFMA 1ZBWA 5GQBA 3W37A 2A3HA 2Y2WA 3ZIZA 3WL1A 1W9BM 4U3AA 3DYOA 3HG2A 1UR9A 3WMSA 4IPNB 1V3MA 3SURA 4V28A 4D6FA 4FNRA 4QFUA 5DFAA 3GYCA 1R7AA 2X0HA 2X09A 3K8LA 3TP4A 1W1YA 4CU7A 2A3BA 2XM2A 4FLRA 4GI8A 2WAGA 5CJ5A 2YL8A 1Y7VA 1XYZA 2OSWA 3CUHA 4LGXA 3S5YA 2X0YA 3W24A 3WMBA 3WF0A 1UKTA 2E9LA 1UASA 3D52A 1E6QM 3DYPA 3MU7A 3K4DA 3WUEA 2YIHA 1XC6A 1TQWA 2D0FA 2G3JA 3OGRA 3WUFA 1B31A 1GCYA 1EDTA 2VC9A 3WQ8A 2PBOA 4W7VA 1E15A 5HBFA 5AC4A 1JI1A 4IUGA 3AS3A 1G1YA 2WW5A 4UR9A 5FCZA 1GOWA 3AHYA 5EMYA 1E0XA 2G3MA 3FAXA 3WFLA 4PMRA 5BCAA 2XTKA 4PN2A 2GK1B 2J74A 1QHPA 2QF8A 2WLYA 3FHAA 3T2OA 4LXFA 1NM9A 3E1F1 1MYRA 3B9AA 1GQIA 4U2YA 4CVWA 3F4VA 4XB3A 3BLBA 3MMUA 5FKYA 3U7BA 1LL6A 1ZJAA 4PTMA 1H1NA 1Q6EA 1C92A 5DF0A 1HVXA 3QHMA 4V27A 1ISWA 3ZQ9A 1C93A 4AEFA 1J10A 5A2CA 5CGMA 5IHSA 3VNYA 2G41A 1O7DC 1UWSA 4AZ7A 1H3GA 3LPFA 3AI0A 3H53A 3WY4A 1O7AA 1UR8A 2J7EA 1XCWA 4W93A 3DYMA 3VUPA 1PEZA 3EJQA 2YA2A 1J0KA 1E70M 3N13A 1BG9A 4F79A 4GINA 3AICA 3S5ZA 1QNRA 2VOTA 3BCDA 3BAWA 4AD2A 2WKLA 3DHUA 5DEZA 4NSBA 1MFVA 3KWXA 3PZMA 4C7DA 3WEMA 1CDGA 3VOCA 4J3TA 4Q7NA 5I79A 3PTKA 1DWHM 4FF5A 3PZVA 4NF7A 4LYPA 2MANA 1GNXA 3N04A 3SEPA 3TTYA 3FW6A 4EK7A 3AMCA 3A23A 1LL7A 4HZ8A 1B9ZA 3OZPA 4BZYA 1ISVA 3KLLA 2XFYA 3OLEA 4V2XA 5AYBA 1XSIA 1VJSA 1OBAA 3VSVA 4WIWA 3WN6A 5A6JA 4FNPA 1OB0A 5HDRA 2VZOA 1FH8A 1W1VA 4W84A 1KR1A 1SMAA 1ZB5A 4AIUA 3EJSA 2J62A 3GXFA 1LWJA 1UR0A 2F8QA 4JZ5A 4UFHA 3TTSA 1W91A 1UQYA 5E6YA 3RDKA 3AS1A 3AXIA 4PBGA 3WELA 1KXQA 3O6AA 2CHOA 2G8ZA 3ECQA 3ALGA 2W66A 3ZMRA 5HOSA 1ISYA 4PUEA 4JCLA 3S6TA 2CEQA 3WD4A 3PZIA 4CCEA 2ZE0A 3KLKA 2GVYA 2CIPA 1OWQA 1MXDA 3FY1A 1F4HA 3VTRA 1B2YA 3L4YA 1DWJM 4PMNA 3ARUA 4UQCA 4ZXOA 1Q6CA 3VD9A 2QV4A 3B9DA 3ZJKA 1HTYA 1OGBA 2EQDA 3PN8A 2OLHA 2WNWA 4PMDA 3EJTA 2VCCA 1I1XA 4AZBA 2CERA 4WKHA 4FNQA 3LRLA 3UCQA 1PIFA 3GNPA 4HPGA 1GQJA 2VX5A 2VUYA 4CD7A 4WLCA 3LPGA 1QW8A 2WYSA 1ZL1A 2HVMA 1E5JA 3PBGA 2X1IA 4HOWA 4GQQA 4FMVA 2OW6A 2WMIA 3MUZ1 5I78A 1EH9A 3WMCA 4UCFA 3SCVA 5EFFA 3VIIA 3AHZA 2QMJA 1LJYA 2VX4A 2DIEA 4MB3A 1UKOA 2CCRA 5E70A 3OBAA 2WMHA 4M56A 4AEEA 3PHAA 3EYPA 1GUVA 2B31A 4GKLA 1E1EA 1V0NA 2ZOXA 1RP8A 2W62A 4OKDA 5ABFA 2WCGA 5A69A 1ESWA 4JFUA 1G94A 1D2KA 1DWFM 3DDGA 2A3EA 3L4XA 1WB0A 3VGHA 3AS2A 3D3AA 1UWUA 2CBJA 1VIWA 4W5ZA 3NIYA 4OJYA 4W8LA 1BF2A 3RPMA 3OGSA 2BNJA 3WDIA 1XRVA 1HJQA 1PZ3A 3NCOA 1E4LA 2DT2A 3MMDA 3EJUA 3TV8A 5E6ZA 3F5JA 4W7WA 1ECEA 4AC1X 1X6LA 3DECA 1J12A 4DUXA 2XN2A 3AMLA 4W85A 5BROA 3N18A 3L2LA 3A3HA 3O9NA 1PJ9A 2ZX6A 2WKGA 3AIBA 1R7OA 1YHTA 5CGTA 1UG6A 2YDRA 2VR4A 2YA0A 2XGIA 4PRWA 1UR2A 1R47A 2WBKA 4Z2HA 1J0JA 1W9DM 1JZ6A 1W1PA 2X05A 3U57A 1MW0A 2J7HA 2VZTA 2W91A 3PTQA 2YLAA 3NUKA 1HP5A 2XYLA 1C8XA 3PZUA 3OLIA 4JKMA 3CUFA 2BFGA 3U5UA 3WF4A 5DO8A 2VTFA 2GDUA 3OZOA 4IISA 4P8UA 1KGUA 1VRXA 4DUWA 1XH1A 4CD4A 1E4IA 1BG4A 4S3JA 3ZM8A 3AXXA 3T0AA 3B9EA 2J79A 1GVIA 1HXKA 2CBUA 1TFVA 3VD7A 1E0VA 3DDFA 1OIMA 2ZUUA 1KBKA 2J7DA 2BS9A 5E0CA 1UD4A 4JFWA 2XFFA 1LG2A 3ARPA 1BVNP 1QVBA 1FFRA 4P8XA 4FLOA 5BXSA 2WHJA 1QPKA 3CV5A 3A4AA 2JE8A 4ACZA 4B9ZA 3IGUA 4XZWA 4J3VA 4EAMA 3LRKA 4HMDA 4F66A 5BXRA 2DT3A 1Q4NX 4PMOA 3M6DA 2CETA 1DTUA 1VJZA 1PPIA 3VIJA 4GO9A 3WH9A 1NP0A 2XPKA 3VMPA 1NP2A 2C8NA 4A3HA 2VVNA 3CMGA 1TZ7A 2XVNA 1XH0A 1K6AA 1HJSA 3THDA 4UQ9A 1K9FA 4BA0A 1HJWA 1I1WA 4PMZA 4FNSA 3MSGA 3WD0A 4W86A 2OW7A 2X2YA 2VMFA 4BCEA 3THCA 4UOZA 1K9TA 3VX0A 1JYVA 4PMQA 4XUYA 5AC5A 3WDRA 3WDPP 1TA3A 4J28A 4S3KA 2DSUA 3SCWA 2QHAA 1OCQA 3WIJA 4WF7A 3F5LA 3QOKA 1IZJA 5I3DA 4M1RA 2YLLA 3WY2A 3ARXA 2F61A 4CN1A 5E0FA 1F4AA 3L2MA 3VGFA 1PAMA 1HJXA 4HTYA 3GNRA 2G3NA 2WC7A 3WDJA 3K46A 2X8RA 1ZBVA 3I3EA 4GI6A 3AMDA 2ZUVA 2ZXAA 5BRPA 3QGVA 2NW0A 3ARRA 2DT0A 3DC0A 3FXYA 4IM4A 3AHVA 5A6SA 1ZS2A 4Q22A 4NX0A 3EMCA 1JD7A 3AXHA 3VIPA 5A2AA 3VD5A 3BAJA 2FYVA 4CU8A 3ZT6A 4H7VA 1CXIA 3AFBA 3VM7A 1E73M 2XVLA 3A22A 4DO5A 2VZUA 1VFFA 2XIBA 3CH9A 4ACYA 1VBUA 1R33A 3TTOA 4W5UA 4HMEA 5CPSA 1J0IA 3WENA 1E3ZA 1CGXA 1B3ZA 4W89A 1MQRA 3HU7A 3N17A 3JUGA 4L4PA 1R85A 1UH3A 1QI3A 3WNNA 1R86A 4H8HA 4TUFA
chains in the Genus database with same CATH superfamily
3BT2H 5CMAB 2EE9A 1DQVA 3WBEA 4XAFA 4P9ML 2Z4QA 4HX1A 1FGNH 3NJKA 5EBGA 3LPOA 4Y1AA 1OP5K 1U8LA 4FXKA 5I5IA 4KC3B 2ZWKA 2NY5C 2WY3B 4QHKI 5HGBB 5KSBB 2W5FA 3LIZL 3MLPA 5ICYB 1E5AA 2GQHA 3LY6A 4YN3A 3A47A 3MJ9L 1ZS8B 1REQA 1JFXA 5A6BD 1LP9A 4X6EA 1EJ6A 1SM3L 2ADIA 4AKOA 2NY7L 3WEXB 3E3QE 4BK9A 1F3RB 2OKTA 4ZMYA 3BYYA 5CHNA 4U6YB 1BFVH 2E46A 3N06B 3HHSB 1SPQA 3I68A 4O19A 3DOSA 5MEPA 1J2BA 3D4ZA 3HS0C 1LNUB 4HU8A 2F8IA 3ZRSA 3FFCB 3DARA 3UBXB 1G9HA 1A6TB 1JERA 1VF5C 2DQFA 5AY7A 1CLCA 1CB2A 4NI3A 3W81A 5H2BA 3KYAA 3W85A 3RAJL 2YL5A 4UV7L 3MO7A 1VZHA 4KROC 2YQBA 4E9LA 3P30L 4HKXA 3IFPB 5BZWA 4BSWB 1KDJA 5J11C 4L8CA 2NVCA 1E4XH 3S5NA 4ENZA 4O13A 2WHMA 3CFJA 3T4WA 2BIMA 4JKPH 4N42A 3SBQA 1OQXA 4S1FA 1I1RA 1QFUH 3PHSA 5EWIH 5D8WA 5T8GA 4H9VA 5DT5A 3ME0A 3BJTA 1LQAA 2JCCB 1QBBA 1U30A 3GMNB 3V5HA 5IB5A 4NILA 3SQOL 1RPXA 2C0AA 2VFIA 1E4NA 3WTVA 3QUKB 8CGTA 1XLHA 3N11A 3WK2A 5C9ZA 3FKRA 4QDMA 5D1ZD 3CHXA 5KJ4A 4U6XB 4ZW7A 3W1NA 4PJCB 4RFOH 1AS7A 4X6BB 4GRMB 5DC0A 4ACTA 4DAGL 1K8XA 5A94A 2DSWA 1QPPA 4WQ6A 4LY4A 4HU0A 2ZUWA 3N2TA 3GHBH 4NM8L 3IPEA 4OAWA 3VA8A 4TUOA 3DIFB 2JXMA 1VA9A 4YFDB 1JZ8A 4AGOA 1ZSDA 1BZEA 3CZEA 3FBQA 1L0PA 2EKGA 2FBOJ 4LSSL 3GSUA 1JF5A 3KPSE 5AYQA 1OSEA 4EI5A 4PRIB 3D5HA 4G1KA 1M1SA 4BFIA 1XL9A 3ZDYE 1UWTA 1OAXH 2POTA 4HJJL 3G6MA 4HJFA 4LNRA 1O7SA 1QWUA 4BFAA 1DQQB 3KWWB 3P2DA 5AAMA 3PDGA 1BYCA 1W8NA 3LDBC 4B50A 1L6GA 4ZCWA 1VYRA 3SSZA 4MA1B 1EJUC 1NUDA 1E4JA 3WTSA 5PTDA 3PPFA 1WGVA 4GLRH 3QQ3B 3P5YA 4E5XA 2DQIL 3N2BA 1YRRA 2FBJH 4PJ5B 4DRSA 4DFIA 4YS4A 4YCOA 4XPHL 5LCVL 3R1GH 3MJ9A 4NNPH 4E9RA 2Q8AH 4LPVA 3IJSB 4WHYH 3S46A 3I7SA 3FQWB 5I26A 4KFPA 5D1QD 3FDWA 1JK9B 4LQ1A 4ZPVA 4HLEA 4WU5A 2Y1HA 3V3WA 3KL5A 1DVXA 5ISZE 5H91A 5LHDA 4B9GA 4LCCA 2WOYA 4YHLL 4H8UA 1KFGA 1UACL 4CGUB 2DDQL 2H47C 2NQLA 4CD6A 2BV9A 3QFJA 1PCXA 4KEMA 4UBDD 2VB5A 5DXXA 2HX8A 1EUNA 4AY8A 3IAGC 2JQZA 4PJIB 4RISL 5GGRB 4OLZL 3EYOA 1IKNC 4AZHA 1AE6L 2EACA 4Q14A 1C8QA 3SGJA 3B0YA 2IC2A 4RZ4A 5D5MB 5FCUL 3N6HA 4UTKA 3LKQA 3FFDA 5FIEA 4IIBA 3EPMA 2X4UB 4BUHA 3N12A 3I3DA 2VFEA 1JQVA 1S7QA 4G8IA 3CIQA 3GSQA 3SKJL 4OI7A 4IIQB 1KCXA 3PAJA 5T1LA 4FA3A 1B4LA 2QR6A 4PAZA 1CLYL 5K9JL 2L8AA 1PNDA 3ALWA 3WNKA 2DPEA 4PJCE 1BVLA 1EEYB 1G7LB 4Y2OB 1O75A 4FABL 1HKMA 3MVTA 4J3XA 1O68A 1UZ4A 3QSRA 4PYSA 3N6YA 3V5KB 5DEGB 4DBDA 3MV9A 4QRSA 2PGEA 1T7VA 4X9IA 1TMLA 1JMZA 4S1QL 4OLZH 1PU0A 2DQHH 2VH5L 3P11H 2IADA 4Y0GA 1CX9A 1UXWB 4PV8A 4N90D 2PU0A 3M0ZA 5CPTA 1D9KA 3CBJB 1JWSA 1DOSA 3BVUA 4QAWA 4C54A 1BGGA 2RCSL 3RRXA 2NVDA 4UT7H 1T0PB 3CV1A 2DPKA 3EZ4A 5LIKX 4KK5C 5D2LE 1TKWB 3GRBA 5IEKB 1US2A 4LVNB 3MVIA 3N6JA 1EZLA 4Q4QA 3NESA 5I3HA 3RX2A 5I0YA 3WXVH 2Y88A 3DHJA 3G5VA 3JVGA 1MJUH 4L4VE 3ULSB 2CRIA 1UBPC 4R4NC 5HHOA 1OSYA 1E4KA 4MDPA 4B9YA 3H9SA 1S2WA 2BHYA 4M93C 4RNJA 3HMXA 1QQDA 3JV4B 3MJ7A 4IW4C 4KH2A 5IEHB 4XCYB 4HK6A 4C6NA 3UPAA 2QPXA 3RZCB 4PYGA 1QOQA 1TPXB 2G60L 3C8KB 2X3AA 3MNWA 1GONA 2OVLA 4JDYA 1QP1A 4HWBH 4WGKA 4PRRA 1AQ0A 5J89A 3K5XA 1HL5A 3MBEC 3KGSA 1CN4A 4MWFB 3EKGA 3UFIA 3OQEA 4B3KA 3KVJA 4XIAA 1I1FA 4HWZA 2N0KA 4DGIH 1IR1A 4ERGA 1X39A 4J3OC 1BD2A 2L3BA 1H0DB 3BAIA 3W9ZA 1VHCA 1XBZA 3GUTA 3LN4A 4IRSC 2V9UA 1OCBA 3H3PH 1V0MA 4KHXH 4H13C 1EEZB 5HINA 4F8QA 2OX4A 4ZMOA 3W1XA 1DHKA 2XCMC 5E23A 3UROR 3WBAA 3BPWA 1FIGL 2GAZB 43C9A 2ZUSA 1YPIA 1KLFB 2ZXBA 2X4OA 4GUPA 2Y7QB 4ODVH 2XOTA 3IN0A 2Y1ZA 4HHAA 4HKZB 3S6DA 3G0XA 1E6ZA 5AYXA 1SBSH 4X98B 4E4UA 1QSEE 5CZVH 4FOJA 5GS0H 2Q76B 2YN5A 3N3TA 2XKNB 1UWFA 3NH7L 5EZJA 2WWDA 3EBGA 2P8MA 1BA9A 3MI3A 4YNYA 1MCCA 5IB3A 1LGVA 1JN6B 2VNCA 5INCA 4AL8C 3HE6A 3TIEA 4YHOH 3CU7A 3ZJ7A 4GWEA 3V10A 3ZE2E 2V5YA 1KTLA 2NYZA 2P42B 4LPUA 1FZOB 1XF4A 3ZHKA 1B0GB 4GZIA 1U83A 2V2XB 1DJQA 4MWAE 3I75B 4DTGH 5BS0E 1J9TA 1VFAB 3VG0H 2A3CA 3SY1A 3OEXA 4JTEA 4QBXA 2PGFA 1GOKA 6TAAA 4G1MB 3UC0L 1KIUA 5JZ7D 1DVQA 1CVRA 1ZJBA 3II1A 3EJZD 3ZDYF 5CCKH 1H7WA 1P0EA 4IRZA 3DLQR 1S2VA 1UQZA 4JY6A 4GQGA 3AZTA 2W0FB 3IPFA 1NBZB 2EPNA 2OMZB 4J39A 2WQRA 3O0RH 1O4UA 2GTQA 2WSPA 5DZPA 4D0CA 3HV9A 4LF2A 3RLVA 5F7EL 1QD0A 3BIKA 2I9LB 1BZDA 3MYJB 3ANVA 1CGUA 1C08B 1CBVL 1I8UA 3CO4A 2F5BL 5DX7A 2ICWI 3OM3B 2D9CA 2R2HA 4JRYE 2CDEB 4JG5A 4LMQE 3SJVB 5D93B 3UTTB 2GHWB 3QXAB 4CAGA 4KHXL 3B2VL 4OJDH 1TJRA 1XYCA 3ENLA 1JUBA 1V10A 4LALA 3EGXB 3OJGA 1MHEB 1AGCB 5DY2A 1RQEA 2PTXA 3IDUA 4TOYL 1DLHA 1FO0L 4CKQA 1HL9A 1U8KA 5DS8A 4OUOA 2D20A 4JHOA 5ID1A 4RDYA 3FHQA 4BS0A 1CLXA 3E80A 3RWIA 1AYRA 3W73A 2QAFA 3IRDA 1WPCA 3OPZL 3BH9A 3M1OA 5KBMA 2BHFA 2DSKA 1R3TA 4UAHA 5DJZA 4K3ZA 3AQYA 4JX0A 5M03A 2JJWA 4FI6A 1NMCB 1PZAA 3DVGA 4HIXL 3OA5A 4PGDB 2ZUNA 4IIQA 1V4YA 4YXHL 5IV2B 3SDAC 4EAYA 5T1LD 3KYOB 4LYRA 3PHOA 2CITA 4FAMA 2F19L 4FLHA 3L7EB 5KVGH 4GYPC 2OMVA 1VAHA 1F3DH 4A21A 2NTSP 3OMIB 2QT3A 1SXBA 4P8WA 3BLOA 1IC1A 2YAFA 4OLXH 4M8QB 2QVNA 4LLVA 3O4LE 1KFKA 1FN4B 1ZE3H 4R88A 5D96C 4F58L 1Y1DA 1CXKA 2ICEC 3KW7A 4JFOB 1UOKA 2F19H 4NZFA 5LGHH 4F15B 5KZCD 2ADYA 4JIHA 4N9EA 4DXKA 4YDJA 4TLSA 3FF7A 1AD0B 1FHDA 3WMLA 1YQVL 3ULVF 3RWDA 1X9LA 4P5KA 3FUMA 4ZQKA 3PWPD 1DE4A 1KTCA 3Q7JA 2DVTA 5B38B 2DZXA 2DBLL 5HPMB 3QIBB 3Q44A 3HVDA 3GR7A 1EA9C 1I1YB 2DTSA 4KKPA 5CPLA 4UF7C 1BYPA 3DVNA 3EDDA 5D71L 1MFEH 1GJPA 4E38A 4I90A 4F2TA 1EUTA 1ZGLM 1FLRL 1NC4B 4IRSA 3ASOB 4KDWA 4DP8X 4HEMA 2EINB 2A6DB 2WVTA 3T3PF 4NQXB 4KETA 4LVBA 2PTVA 4JN2A 3AIVA 3RM9A 3ICJA 1LE5A 3FO1B 4LVNC 1I2RA 3WH6A 1T1XB 3ZQXA 4TSBH 4KQ3H 3U7WL 3UXDA 5AKVA 5J5EA 2YL6A 4PWKA 2OLAA 2TRSA 4MNGE 5HGDA 1BD2E 4RGNC 4GJJA 3MRKB 4V1DB 2XPYA 2Y85A 3ARDB 1ZIAA 5EA0L 4A1RA 3LERA 3U79A 3UTZA 2D7NA 3GQYA 4HYWA 1GYWA 4UIKL 4FJ6A 4HNOA 1A5OC 2WBJB 3NRFA 4GP8B 2O6EA 3NDZE 3ABMB 3AXLA 2E28A 3WF3A 2A0LC 2ESVD 3WBYA 3STLB 2X9WA 2CM5A 3VC5A 3WZ0E 4EUPH 2A38A 4PW4A 2Q76A 3VH8G 2C91A 1AG6A 4FLQA 4LP8A 5TBOA 4XVTL 1CURA 1CD1B 1E4MM 4XP9H 2XVBA 3TIDA 1S5MA 5AHMA 4UR7A 2P5WA 3BUIA 1RCXB 3KVPA 1CGWA 4I0PA 3J7HA 4NS0A 3NCJL 4KRMB 3RO6A 4Q9QL 5J11B 4DLFA 2WZ5A 3GZAA 3UZWA 3AFLA 1W9VA 5IB3B 4F7EB 3FZUD 4DYEA 4LPWA 1E0WA 3BV4A 3MUCA 2EPMX 1D6VH 1N5YH 4L64A 3VIHA 1P1ZA 3EYVA 5GGSA 5L8KB 3MYOA 4X60A 5I3KA 5I1AA 5L6UA 4X98A 4ALDA 5JBEA 4QJ4B 3BP6B 3B56A 1D8WA 1IQDB 3BSGA 4RL3A 7ODCA 1T99A 3PXHA 2AC0A 4MKMA 5AZUA 4HIPA 3DIFA 1MREH 3VI4A 1FPTH 3T0DA 1F6KA 1A4KB 2FPYA 2Q8XA 5AW7B 2QQKH 1FNHA 3CSYA 2J56A 5IKCB 4BQCA 1XZWA 1LQBC 2WCSA 2OMZA 4FRWA 2NDGA 3WFDH 3K71B 1I3RB 1R5WA 4KFZC 4NQDB 3WTUA 2GT9A 1UCWA 2BGSA 4YU1A 2OLSA 3JV0A 3R13A 3HLKA 1OTTD 3V4BA 4H04A 3SSGA 1EDYA 4OSUL 2OCFD 2X6VA 2NY6B 1QRQA 3LHPL 1N0LA 3K2MC 1RAMA 1AY1H 3EO0B 1VCFA 3ARBA 1IGJB 2B20A 4NM8H 1GY2A 1QMUA 2X1PA 1QPOA 2OSXA 2XTLA 2E7MA 4MZ8A 5HBFA 3OKEA 1A3LL 4FQ1H 5HDBB 2VSKB 4FTVA 2NY5L 2ZNXA 3UT0A 4GMEA 1TIMA 2IALB 3FCTA 3DETC 3LUTA 4PJGA 1E28A 3VX1A 2C3GA 4Z3FA 4ZVJA 2J2ZB 4P7OA 2Y0SA 1IWAA 5AYZA 3CUPB 1BHGA 5A40E 2DT1A 3QIWB 2FEJA 4WWOA 3T09A 1EEXA 3UBXI 1XLJA 3K3QA 2GZXA 2QQ6A 4TX8A 3URNA 3W4RA 2CBIA 1HX0A 4ZPTB 2H8ZA 3LZOA 2VGIA 4MNQA 1CIDA 3N15A 3MZGB 1X5FA 3N4EA 1BM3L 4X80H 4KBPA 3FU5A 1JHLL 3UBXA 4MMYA 1G9MC 1QA9A 3TT1H 3S83A 3NRPA 4YDVA 4PLNC 3OZKA 4ECNA 3LEVL 3APTA 4HD5A 4B9KC 3WLNA 1C3FA 1PYWA 2D3NA 3TBBA 1XDLA 2A9MH 4NN6B 4LU0A 2HX9A 1DCEA 1AUSL 2Y06L 1G7HB 3CFJB 5EF0A 5EBWA 1U8QB 5DT1H 3D0VA 4NJGA 3G5EA 3MGTA 1KEGH 3GK8L 4J1OA 4MIMA 3U8GA 4PIRF 3DERA 3ZHLA 2OSLA 1D7KA 1RA0A 4S2SA 4IPPA 5GRUL 1N6QL 1P4BL 3RY6C 4XCEB 5KG9B 3UPRA 4Z2LA 2B59A 2VXVL 2YW4A 4FX5A 5AZ2H 1X1NA 3VXQB 3ULUD 2CNZA 4HH9A 4DP7X 2GIMA 2Z8SA 4ZZFA 4C7FA 1QNIA 4B5EA 1RUKH 3QEGH 3UGUA 4DYKA 1A5UA 2O4QA 3CN3A 5IMKB 3QQ4B 3MJ9H 1R5YA 3LS9A 3LRMA 3M43A 5KTEH 8FABB 4HNNA 3QYSA 5DN1A 3F5WB 2HK1A 4CEUC 2OM5A 4AT6A 2QQNH 4LRIC 2LFEA 2HG5B 3H2WA 2DEXX 5DDHA 4EF3A 5D7LA 4NO5A 2H32A 2J6XA 2NY2B 1BVLB 1EEYA 1F90H 2EPKX 3R06A 3SDCC 3LKNB 2JQAA 5SX5K 4ELKB 1H1ZA 4DQAA 3HZMB 3JTSA 4ONVA 1T89A 3USBA 3IF1B 4HWNA 1Q7ZA 3ZT7A 2DP3A 4LYKA 5C8BB 3RM4A 3W26A 3S6OA 4PB5A 5HUOA 2PF6A 4BWTA 5A6MA 1SOSA 3QFGA 4YHYC 4BH8A 1ASOA 2EBNA 4G9PA 2EO7A 1JF6A 4ZPVB 5F1NA 5D2NB 4NAEB 3B6SB 1PD0A 2K8MA 4PTVA 4BFJA 1RZJH 1OF8A 4Q9RL 1B4JH 3VSQA 4KNTA 4MA7H 4U10A 4P61A 2OMTB 3DAQA 3KX6A 3QR3A 1NJ9A 4XCYA 1KG0B 1J6OA 1F5WA 2CM6A 2HPIA 3D3VE 5HBBA 3LTVA 1EK3A 5E4EC 1F6FB 3BFWA 5EC1B 2WO2B 5KOVC 4PZVA 3HNTL 1EO8H 5EFIB 5JORB 3TW6A 5D9SA 3GZ3A 1EFZA 4TMBA 1UCBH 1V8HA 4U33A 4UV4H 4WWNA 4OQTH 1GVYA 2BSTA 5DI8B 5JIDA 1TU2B 4JFYB 4U1MA 3N19B 3HCVB 2VLJE 4AX7A 1MY5A 1EOMA 3QZWG 1M2VB 1Y5WA 2C1HA 5CN3A 2FLIA 2Y2TA 3N43F 5JOFA 4MGGA 3LV3A 2AGJH 3O16A 5JU6A 3DX7A 5D7IB 4CSTA 4D6IA 1AQMA 2Z93A 2WQXA 3AS0A 4I7WA 4CU6A 4DP9X 4GI9A 3AIQA 4IGNA 4HZLB 4LSSH 2F6AA 2R1YA 1P4CA 1I3RA 4J27A 4NQDA 4LAZA 3BAKA 4LMQI 3V5KA 3MSYA 5I09A 1MJ7H 5GRJH 1OF6A 1G7IA 4A6YH 2DKUA 1OFRA 1W9XA 4Y9GA 1D8CA 3BVVA 1XSKA 2R39A 2WHLA 1Y1UA 3N1FC 5HI5D 4ZTYA 4R96B 3QDGA 4XNXH 1VFUA 5EU6E 3WFEH 3B2PA 1DLFL 2GJXB 4QEHA 1GHSA 4J3OD 2ZOTA 5H2ZA 1QG3A 1ZNNA 3SFWA 1CFQA 4YVNA 3D07A 1P69B 3TPUA 3MFGB 4Z0BH 5GIRB 2CFFA 2ZYSA 3C60A 3CHRA 1I2OA 4JN8A 5D9PA 3W6MA 5CZXD 2J7FA 4IL2A 1QNQA 2BX5A 5I9QB 3RHWK 4GAGH 2TPSA 2WBJC 4MB1A 1U8CB 4HIEA 4S0TD 1ZALA 5FGCB 2WPGA 1BVNT 2ISDA 2WZPA 3RB7A 1P6WA 3EDEA 3L67A 4DUVA 4HCHA 2FYYB 4BSJA 2WYTA 3BGAA 4KAQL 3PGFH 3WFZA 1HHJB 4JFSA 4XAKD 4B7LA 3AHZA 4MD4A 5GGTH 3ULUH 1SY6H 2Y7SA 3W7KA 4U0RC 2BVDA 4GISA 3QUMH 1XIWB 4BUGA 1L3NA 4YHYB 1ZS8A 1REQB 1OSPL 1WZLA 2FZ3B 2MH4A 3W87A 1E9IA 1FFTB 1AHWB 3LYEA 2DZPA 5HGGS 2YEZA 2G3ZA 3KPNB 4C56E 1Q9LA 3LQAL 5KTEL 4BEQA 2OZNA 1QVOA 3NIDB 1RCYA 4PJ5D 3BMVA 1W2PA 1WVZA 3NJXA 3DOHA 3GB7A 3MYZA 4DP2X 1ACZA 4GQ0A 4HCRL 4AXKA 5C2GA 2ZXGA 2YJQA 3WUGA 4Q6IC 1PTAA 4R7NB 5IM51 2ILLA 1FZMB 3BZFB 4MWAB 4NKDA 1QYGH 5F6IB 2GJ6A 4HUXA 1C16A 1KFEA 1KM1A 2XH0A 3W7EA 2N7SA 2WWOA 5IW1B 4DKFH 5FKPA 2YWYA 1T7ZA 3BX7C 3NFNA 4QNPE 1VB9A 2O0TA 1T80A 2AI0H 5IJVA 5LBGA 3DSNA 2COQA 1M6JA 4JRXD 4NKOA 1S9XA 3NCWA 4IOIB 4UTWC 3FU0A 4F8OA 1DBJL 2X4SA 1MDTA 1JZ5A 4QHMB 5D2LA 4WU7A 3B37A 5KW9L 1ETJA 1Q0YL 4A8IA 4LLMA 4LOVA 2C4FU 3BT2L 5AHEA 3OG4B 3OMNB 4FFYA 4GBXD 3L5HA 5DJ2B 4ANKA 3TJLA 1A14H 3EYUL 3GU9A 5KVFE 2DWDA 2YSTA 3OR6B 4QITA 3HIZA 4N2GA 4O17A 2GSMB 5GJMA 2D2OA 2AABH 1EAOA 4WSHA 4Z7WE 5FF6B 5DFVC 1SDAB 1WX0A 1FQ9C 2BP8B 3V5DB 1WA0X 2WC4A 1FDJA 1HXMB 4IGSA 4LHUG 1HS6A 4OJEH 4Q7BA 4UTBH 4QXTB 2HH0L 3UD6A 2YLHA 1FWXA 3B3IB 1I9IH 2C5DC 1WH0A 2J2ZA 1NF0A 4YWGL 1I1YA 4W4NA 4MJ4A 1CDJA 3B9KB 5GSRA 3FTUA 3U7YL 2WLLA 4FQIH 4A7VA 5GS0L 2E3ZA 2WJ5A 1DVUA 5I1CH 5B38A 3POHA 5EMUA 2A6IA 1RHCA 5BOOA 3BUDA 1OALA 2X87A 1NWRA 1G6RH 1PV8A 3U3HA 1KGXA 4YSPA 5IJBC 5I76B 1DJNA 1MHEA 1W5PA 3WF1A 1BJ1H 2MTAA 1KIRA 1M6OB 3V0EA 2J8GA 4ISVB 4GX8A 3RM8A 3L08A 1YDPA 2Z8VC 2R2HB 2HRHA 4KK6D 3UTTA 1UCTA 3UTZB 2XISA 2JTYA 4PJBE 5DJZB 4FIRA 5EB8A 1ULVA 1OXYA 4X6CB 2PURA 3FS9A 2J44A 4WR3A 4FS9A 3HHRB 3RBSA 1TJHH 3MRKA 3P73B 4YVUA 1IGFL 1GKPA 1BBDL 3L17A 4A66A 3KVLA 4F0HA 3RCMA 4CMMA 5EO0A 3R18A 3FT4B 4DO6A 4FULA 4A2GA 35C8H 4C56D 5IV2A 1SLWA 3PQYA 5I1GH 3BEVA 3GXNA 2V3EA 4H1ZA 3ZVHB 2H1PH 1Z42A 2CPUA 4AIZA 3P77B 3S48A 4WFED 1QR1A 2ZD0A 5ADOH 1DN2A 1CLOL 4WWKD 4WJEA 1QNVA 3VA2C 4X0NA 4LVAA 3CH1A 1UB5A 3R0DA 1KB9K 2YD5A 2XV2A 4AF0A 4NC0B 4Y89A 1JEZA 2E0PA 2Y1YA 3KPSD 3TIDB 8FABA 1E8ZA 1BEYH 4D6JA 4GG6B 1RLDA 5CU5A 4HV8A 3GM0A 4DKEH 1TTBA 2RMNA 2H2PC 4X7FC 3MR9A 4YHZH 4POYA 2WYHA 3WUWB 1ILSA 2LT9A 3CNKA 2XXCB 3QPXL 3CU1A 4GRLC 3VG9B 1M3UA 3W84A 3BN9C 3CLEL 5ESVA 2YXFA 4Z7UA 5D6CA 3BVDB 1ZUAX 4UOQA 3MP4A 4WWKB 3CX5K 4QEEA 1RLWA 2V37A 1KM3A 3RWFA 1HCYA 2FMNA 2W80C 5EOCH 5BS0D 2VFGA 2EC9T 2A9BA 2DWXA 2F9RA 5ISZB 4I6VA 3ZDWA 1RXOB 1UWXK 3SQSA 4BH8B 4WI2A 3GI8L 3UBXG 1YEKL 5CUSH 4MAYB 1AH0A 3CZ8A 2QLVB 4NUJA 5L4MA 1HKWA 3B0XA 3FO1A 5AOUA 4DM1A 3GBDA 4G8AC 4AD0A 3HI1B 2C3XA 3CIWA 1UWYA 2VABA 3VFNA 1BZ8A 4EDXA 4JBRA 2QVMA 3FL7A 3U2EA 5EIIB 4A68A 2PSNA 3KYKH 5DZJA 3WFAA 1IEVA 4J8RB 4PJGF 3SQRA 3ZIYA 4Y9MA 1TV2A 1UC5A 4YSDA 2R51A 2GUYA 3CQJA 1IR2A 1JNJA 3NJVA 4XBGB 3PNUA 1U8IA 1AE6H 3SB0A 4IG2A 2N7AA 2VDLH 4ZEPA 3NFNB 4QX4A 1OC7A 2XNAB 4NPYA 1X6NA 1K6QL 3CXFA 3OJDB 2Y6SD 3L3GA 2PRLA 1TENA 4Y16B 3KHJA 4P99A 1FZMA 3L9CA 4MWAA 3TVMC 3L3JA 4ABUA 3O4LA 5A8OA 2IFFL 2E9JA 3ZDYB 2QGHA 2G4FA 2AF2A 1J93A 4AZCA 2EIKB 1HFBA 2CZFA 3FU7B 3QAQA 3HUJF 1H3UA 4P23D 1L6XA 3FO0H 1BEYL 4PJ8D 4CILA 3K72B 5HYQB 3LZLA 3SUSA 5E1QA 1DUZA 3VDCA 1I4NA 2CKNA 4Z2GA 1GGUA 3MUUA 4GAJL 3V8OA 3WGVB 1BFSA 3LXAA 3SFKA 2YMTA 5DHXB 5IOBA 3H2CA 4AG0A 4PJAB 5AD0B 3DX6A 1HKLH 4NM4H 5JLZA 3P61A 4NRSA 1T5XB 4P57B 3F8UB 2DJUA 5AHLA 1RZFH 3KD4A 1P43A 4HCFA 1FRGL 3B2XA 1V54B 3TBVB 5BVPL 2PDIA 4PJ9C 4DAFA 4JRYA 4XCNA 3BOFA 1XX1A 3KCOA 4ONHA 1OM0A 4WCYH 1M1BA 3SGZA 1FBIL 4EE2A 2DMBA 2YPLE 3CD4A 4JIRA 2YUZA 2ORBH 4PQXA 4UNUA 3E5BA 1IGFH 4PYHA 3TA4D 7PTDA 5LXGH 3CFBB 1WP6A 1MVYA 1S7WB 5DJYA 2X4PB 3GO1H 1INEH 1AZRA 1KPRA 5TD4A 3OC5A 4NQSA 5JO5A 5JDJA 2FH6A 3H3KA 5ADPH 4PG9A 5GS0C 1KWKA 1BWLA 3KPRA 1TVNA 4XZLX 3IJ9A 3ESUF 3NK4A 4GFTB 3CFDB 1NGPL 4ALAL 1NINA 5CILL 3NG3A 4KJYB 2F5BH 1XIHA 2P47B 5AG8A 3ATEA 5GZND 2WZEA 3JVAA 1N0XH 1KIQB 5CEZD 1GGIL 1DVJA 3CT7A 5FM4A 1REIA 1QWNA 1R3KB 3C86A 1GC1L 3O0RL 1KZYA 1TE6A 4MBOA 1IBHA 5IFHH 4NYYA 3S5OA 4YFLI 3DUGA 1ILUA 3L3DB 1T2QL 4XRCA 2IQ0A 1AZNA 1NF7A 3W7RA 3TMQA 5BV7L 1PXGA 5E2UH 3WH5A 3DIPA 1QSFE 3DK2A 3LVTA 3NVTA 2F54A 3N3EA 3VG9C 3HE7D 1VPYA 1PX3A 1ORQB 2GVLA 3RVXC 1NBVL 3QKZA 4YPGB 3UGEA 4JYFA 3UY8A 4RH4A 1T6BX 3GBNL 1N68A 2E8ZA 4Y4KA 4M29A 3N9GH 1LWHA 3D1MC 2VCAA 4TR9A 4UMAA 1OTUC 4L29B 3DFOA 1KPVB 2AJXH 3X11A 3REWB 3HMCA 4B3LA 3CE1A 4KV5F 1K9EA 1CI3M 1TJGL 4JQ1A 4HD9A 4YPJA 2WVVA 1IEWA 4IU3B 2YXWA 2A6KA 4QGYA 3JR2A 3FFDB 3QQ9D 4S3GA 4S3BA 5IFHL 4YMZA 4AVHA 1KGCE 4S1RL 1KENH 1Q9KB 5ABZA 1AZBA 3DSFH 4Q97A 1OK6A 1AJ7H 4LU5H 2Y89A 4G7RB 3LLFA 2UUDK 3LAFA 2H6PA 1L7IL 1HQRA 3CZJA 5EZPA 1GZQA 3AXMA 2NY1B 1HIML 3KE0A 1JV2A 5C0JA 2X9XA 2XVPA 1A1MA 2P52A 5GGUA 2ZZ3A 3ABQA 3JRKA 3MLRL 4BXSV 2X89A 3P9LA 2E47A 2AS5M 1YBQB 1MG2C 2ADAA 5FK9B 1MI3A 3HUJE 1WZMA 2DI9A 6PCYA 1HINL 4J1UA 4HN4A 2QELA 4RLIA 2UZIH 1KM0A 3R0KA 1YECL 1YYLH 4OKVA 4ZOAA 3TFKC 4LH8A 1YTEA 2IDSA 3LKNA 4ELKA 2R4SL 2OJ1A 3E6FA 1BFNA 3MUGA 4XOEA 1TTUA 1ISXA 3ZOAA 4DWSB 3CAQA 2XWTB 2BOGX 2Z2AA 3VINA 1J8HD 4CVXB 2ZZ4A 1W72B 4LBEA 4X3ZA 3IFLL 15C8H 4TTGA 3BO8A 3II3A 2PWFA 3OB0H 3SPGA 1ZE3C 3SY6A 1W1TA 3VFRB 4BFBD 1DYSA 4K7PX 3FFSA 3G0SA 2XY2A 4KH9A 3TJPA 1IVLA 3ANUA 3QMSA 3HKFA 4KO6A 1RPKA 1U3HA 2FSEB 1UT2A 1RIUL 5T3XH 1J5HA 2Z29A 4OTKA 5CPNA 3UWEA 1RD6A 1KEMH 3WLBB 3X1EA 4A39A 2BCMA 1ZXKA 4NHUB 1LEKB 3MRRA 5KMYA 3RWDB 3SO3C 1XT5A 4K1WA 4G59C 2J75A 3P80A 4GSQA 3HBGA 4LEXL 4UYQA 4XC3H 2K6YA 1DVFC 1ETB1 2HTKC 5DQ9A 3ABSA 1HF6A 4Z0BL 1FP9A 4Q8TA 4LB3A 2CUAA 1K70A 1BQCA 1HESA 2V5KA 1CUOA 3RURA 2ISSA 1MI5E 5LBSA 1CGVA 3UPWA 3BGMA 3N2OA 5IRPA 4G1EB 3PXJA 4KO5A 4ZAKD 5FF4A 2UX6A 1GZHC 5JHLA 4L37B 1GOIA 4D9QE 4S1DC 1G7QA 3BPOB 4IGBA 1XB8A 4P0DA 3IDJA 4X99A 2O6PA 5FHAH 3ZIMA 4G83A 2KERA 3CV7A 1MDAA 2W65A 3L3KA 4F93B 1EP2A 1VRSA 1MCEA 1GTFA 5MENE 1GVRA 2WMGA 4P8VA 3DI3B 3MBFA 2XVKA 5ERWA 3C0QA 3GMNA 4WDTA 3LZRA 2D1ZA 2QDWA 3FQUA 3ZR4A 1AQFA 3PB0A 2IPUK 4ZSOA 4HS6B 5KETA 3EA3A 1ITCA 4L8BB 1FZOA 1XF4B 4Z7AA 4FFVC 4ZZKA 1DQQA 1WO2A 3EO1B 3JZ7A 3KWWA 1JVOA 4XPTH 5BWAA 2MOQA 2QEJA 2AAAA 4P7LA 5DBTA 2OFQA 5A6LA 1ODUA 3URAA 4PRIA 2WOBA 3HNTH 4GIOA 3S37X 1V6XA 4TN9A 5DD3L 5F9OH 5C8JB 2D31B 3X14B 5SWQB 1X38A 5AVNA 3MRBA 4AZ8A 5A3IC 4Q8VA 1XCXA 5DUBA 4AUUA 3TE9A 1CWVA 1GSKA 5LVEA 2P1YA 4H44C 4WY0F 3N41F 1LTDA 3ANYA 1NCTA 3UAFA 4HZ7A 4FP1A 3FZUC 3TT3L 2I5QA 3R7RA 3G8EA 3GC3A 1MCQA 1VESA 2VE6B 4BFEA 1RZJL 5LWYL 5DMMA 5FWQA 5LIXX 3SKOA 3ZRCC 1XIWA 1C9WA 3UZJA 3GUWA 4XX5A 3NDYA 2E1DA 2BFVL 4XPTL 4UQBA 4LUTA 1C8PA 5I77A 1J8HE 1ICPA 4N8UA 2CLEA 1GA2A 3KS5A 3AY2A 3A6CH 2EF9A 1NFKA 3TQKA 3KTSA 5JR1L 1JCLA 5CINL 4DF2A 4TS6A 1WIPA 2OQYA 5D9OA 2FHFA 2EAEA 2FZ3A 4I0KA 1E55A 1WKYA 1O12A 3F5KA 4XBJA 4MNJA 3QRLA 4XP6H 1HKFA 3T4CA 1ZK9A 4WK0B 2WMIB 3W71A 4NNYA 3LBMA 4ZMPA 5IROC 1X1ZA 12E8L 1C5BH 3CDFA 1TWZA 2AQ2A 1TZAA 3RITA 2WWCA 2PF8A 4EP8C 1R46A 1ZVYA 3T42A 5ANMB 2C14A 2BSEA 3WFCH 1BEXA 3KPNA 2H2SC 2GSGB 5KANI 3F64A 3SO3B 3NSNA 7ENLA 1FYTD 3ZE0F 4ZI8A 2QVIA 1J5TA 4I77L 2FIRT 4L2YA 5I5JA 3L54A 4IFKA 4LCSA 2QADB 4S3EA 5LYRA 4PRBA 1W17A 4FXTA 3MP5A 4UQDA 3NZRA 2M8XA 3MV7D 1Q6FA 5EZIH 1XB3A 2GB2A 3MJGX 4NP9A 4PJ9A 5KSUB 1JF1B 2Y61A 4JL1A 2IADB 4NX5A 1PZ1A 1KNOA 2UZXA 1E6SM 2I16A 1FORH 4HIHA 4I9WE 4BF9A 4ZFOL 1QI5A 2DZBA 1H8OA 4J6IA 3EJPA 3MOBL 1WWBX 3I9GH 4ZAKC 1Q5MA 2WP3O 4FFWD 2R94A 1HILB 3W2MA 2EPLX 2Z92A 2Q7YB 3L5IA 3SPJA 1AZZC 4G8EB 3RXZA 2K9UA 5IVZA 4QEGA 2FAUA 4UTBA 1X5KA 2GCYA 5BZZA 3G1VA 1XBXA 1A6AB 4M6NL 1EYEA 3M47A 3TU9A 4HNLA 2OEKA 4PS4L 4MSSA 2VN4A 3H9SB 1R17A 3WSUA 2EP6A 2FE0A 3CAWA 1V7AA 2GQAA 1TCMA 2BOLA 2VURA 1YNTA 4MZIA 4DF9A 3DRTB 5KSAD 3N4FA 2AI0L 2C3VA 4MNKA 1DWGM 1KBVA 1TKWA 4I0PD 1RSYA 3AQUA 4MHBA 3UR8A 4M7LL 3G04B 1EMTL 2WNNA 4G7VH 4QXGH 3L4ZA 2CDGB 4OH2A 1BDYA 3LV6A 3SJ3A 4LCIL 4N3UA 4NQDE 1JPFB 5I1EL 3TN0C 4K73A 1IAOA 4PJDF 3WD5H 2X6UA 1WUFA 5CPQA 3RGTA 1G5AA 5HTSA 2Z35A 4AV0A 2GSJA 2V5JA 2E74C 4HYRA 4CQBA 4FNUA 4WU5B 3RRQA 2EDTA 3IDGB 3QQDB 5TE6H 2OPCA 3T2QA 4DYJA 4A3YA 3QJOA 5D32A 3ZKQD 4P2QD 4AV4A 3BRDA 3LOWA 4LP4A 1PFOA 3W6LA 1I3GH 3MNDA 3MBED 1JYNA 2JI2A 4P46D 3X3GH 1JPDX 1U8OB 2LQRA 3MV8A 3S2CA 2Z1SA 3D46A 2K1MA 3M0XA 3OYZA 1JUFB 3SGDI 3GNMH 2RKXA 4WGXA 1RH9A 5B8CC 1ESOA 4ADSA 4M7KL 1Y0EA 2CJSA 3L3GB 3RVVD 2FDMA 4H0GA 1BXCA 3UYRH 3BXNA 4FA6A 1G87A 3VDGA 2XFRA 5JH1A 2K78A 3PVFA 3CCHA 3CHVA 3SKUD 1HZLA 4AENB 2C6QA 1FAKT 3MOQA 5E5MB 3BISA 5FACA 1N10A 2PEVA 4BKNA 2VITA 2ZX5A 4B0MM 4BH7A 4UDUA 1NLDL 1IC7H 2BVEA 4P49A 3BZEA 5FLVA 4H88L 4RPPA 4BCZA 2WTRB 4AEOA 1MW1A 2V2TA 4Y1SA 5EF2A 2Z1WA 1IAKB 4FGMA 1PQZB 3UYPA 1V79A 1ZTMA 2D3VA 4B5NA 2CGZA 5AHFA 1CR9H 3VWKC 1MLCB 5AW0B 2WVSA 2NYKA 1J9RA 4EN3A 5I5RA 1UTDA 1PCWA 2AKZA 3LRHA 1LBFA 4KFNA 4XD4A 2Y23A 4JJOA 4PCSA 5ISZA 4MCYA 3WNLA 4I2XB 1ENUA 3F7PC 4M6OL 4Z3HA 3KOZA 4OF6A 4XWUA 2W5PA 1KKRA 1SJEB 3C2YA 5H35B 2Y6TE 3VIPA 3FF8A 5FUCC 4HGWB 3TZVD 5SWQA 2E6AA 3PK7A 2HPTA 1KUMA 1X98A 4QLJA 4AWEA 5EV7A 5TQ2H 2UY2A 5I1KL 1I9CB 4KJYA 4UOJA 3T05A 4XTIA 2XU9A 5C0AB 3E1ZA 5I8CB 4UTHA 4XMTA 2E9MA 4W88A 2FHBA 3G6DH 4WUKL 4YXLH 1DORA 3CHPA 4RGNB 1K3UA 4UXDA 3ULVC 5TQLA 5AEAA 4B53A 1UC4A 3KOYA 1UCBL 3HG1B 2UY7A 3I85A 4A6YA 2Z7KA 2CWRA 2XXGA 1CR9L 1RZGA 3LI0A 1UZ1A 4KMQA 3EOBA 1BYBA 1LK3H 2P46B 1XLCA 3CVIL 5ABTA 1S9VA 4BRVA 3FTXA 2ZZ2A 3F4WA 3AAZA 5FYLL 3O4LB 1TJPA 2VABB 4EDXB 5HDOA 5ESQB 4ZX3A 2XPZA 2X6BA 3KLAB 4WI7A 2NVAA 3GG8A 3HZVA 4KGJA 2XG5B 4IGBB 3ATFA 3IRCA 2Y5EA 3FAWA 3JWDC 5JW3L 4NO0A 5KBNC 2DDXA 5ABHA 4YSOA 2HMID 4G9FD 4KRTA 3APMA 1NLBH 3O3AA 4HLZH 3M17A 4A7SA 1MI5B 1L6WA 3O1NA 1AFVL 3RUGB 3KHDA 4AK1A 1EZVX 4X2UA 5F7LB 2PF0A 3SN6N 4M3HA 4UM9D 3NXFA 4L65A 3AZSA 1H8SA 4L8DB 2MHAB 4L0ZA 4HNTA 1N2VA 2QV5A 1JF1A 1WDRA 5GGSY 3U9PH 3RIFF 4R34A 1D7FA 3DX6B 3U4BH 2XFWA 2ZYHA 4ERAA 3GIVB 1THAA 2X4UA 3QJXA 2AANA 4XXDA 3A5FA 2PR9A 4A37A 3FSOA 5DK0A 2ESVE 4C4UA 2QQLH 1EFQA 3N40P 3UJJH 4ANUA 1FFNB 4FQ2L 4CADB 1MJJB 1DIOA 4TULH 3D47A 4KQ4H 3G6AB 3OPZH 2V5LA 2VQ1A 5E2VL 5HD8D 1WEJL 2AK1L 3IGAB 3MHGA 1ACYH 2EDNA 5ENWA 3OG2A 3P4MB 5BJTB 5HYIA 4O15A 2X5PA 1FRBA 1L2QA 4LDLB 3W07A 4OWGA 1KBIA 1M7IA 3LKPA 4OFIA 2ISFA 1UXLA 2Y7FA 3MANA 5CC6A 1KLGA 2AKMA 4JQ2A 4PUJA 5GJPA 3A3YB 4JIEA 1J5IA 2AMXA 3HMXL 1IZKA 1KJ2B 1EBAA 4PH8A 2PDYA 3MI2A 1YMME 4X4ZA 3ZO0A 1EUAA 2CDFA 3MLRH 3NO1A 4ATDA 2R0WL 4XWGH 1JZ3A 4E41A 1YEWA 1PTDA 1VEMA 2CZNA 3GTXA 1OCNA 2BNRE 3UXIA 1LO3L 3QRBA 3LRSB 4PP2A 5LBVA 3L5JA 6PAZA 1DQKA 1OP3H 1HUVA 2PTTA 3AMGA 4JTSA 3W7QA 4HLZG 3UTSD 1FL5A 4CVXA 5I0VA 1MCHA 3LQGA 5GNYA 1UGNA 5JQ9A 3VFGH 1S7UB 2PDFA 4LVOB 1NH6A 1TUPA 5L6YL 2GVGA 2ATKA 2JK5B 1Q38A 2A21A 2GITA 5J5RA 4TYUA 5KTLA 3MC5A 1WDSA 2FLBT 3G6JB 5CR1A 1P1VA 2WJDA 3FJNA 5E6IB 2DGAA 4JGUA 3CZFA 1POKA 5I1GL 1JZHA 2X41A 1QEWB 1XLIA 1X6UA 2PB1A 3UR5A 4YZFF 3TSDA 2OMNA 3BC9A 1E72M 1YRKA 2CG9X 3IAPA 5AOIA 1H0GA 3L3OA 4P2QE 4N6RB 3KBSA 2CO1A 3VFCA 1IE7C 4LKXA 3ONCA 4EN3C 4G6FB 1E42A 4O53A 3KAOA 2J71A 3FQYA 1OF2B 1ZRUA 3NH7H 2V17L 3PNWA 4GY4A 5E8NB 1INQA 4ZTPH 7CGTA 3VO0A 1X3DA 3FQRB 3NCMA 4IKIA 1QRNA 4OSUH 1BXBA 4MQXD 1GWJA 3N1AA 4OUEA 1FDZA 1ZQ5A 3R94A 5E9XA 2ZWSA 4HHHA 1G6RL 4TTUA 5HNNA 3D85D 3D39E 1C12B 4FE9A 5EU4A 1PKMA 2YX0A 3W3OA 1TR1A 1T6VN 4AQLA 1QI0A 4MJ6A 3UABA 1TB3A 3TJIA 2XETA 3FU6A 4ZO8A 5LNGA 5F0PB 3FB8B 1KXTA 3ARFA 3KPTA 4Z7QF 1FP8A 1RZIB 5JIIA 2NY4B 3MRPB 1U33A 3E6FB 5EBMA 3W9EB 3WE1A 2Z7WA 3W0KA 2WV3A 1C5CL 1RIHH 4HALA 3F12A 4KK8C 5IFAL 3SRKA 4DJDD 1XGPB 2UV8G 3WIHA 1LE9A 4M6UA 4WTQA 4L4JA 4W9LC 2Y8UA 1KQZA 3AHXA 2PWVA 2DQEL 4TNEA 4TLKA 1QTSA 1OAJA 4WCYL 3AB0C 3IJYA 3BD4A 2CBQA 3LS4L 3REVA 3DX0A 2J7BA 3EGSB 4RNHA 3RPTA 1E9QA 5FOBB 2OZ4A 2XSAA 3ZWSA 1LM8V 4X8CA 4PREA 3BW3A 4G6JH 4KRPD 3FSVA 1WKEA 5L9DH 1TJ0A 2VISB 3TO4D 1XIEA 3MYPA 3SCRA 4M7ZC 4IDJL 3MRRB 1XUUA 1AS6A 3TYFA 3W70A 3DXAA 1IT7A 3GW3A 3VMOA 3S1VA 3WXVL 3DMMB 1JWUA 3REQB 1BM7A 3BH4A 3GI9L 3MODH 3MA9L 4P2RD 1BQHA 2B2XL 3S3DB 3MX0B 1KCKA 1D9KB 2I9LA 3MYJA 4HP5A 4RWYH 4XODA 5KW9H 2QPSA 1Q45A 3OVGA 1XEDA 3NP3A 4UT7L 1LJYA 4GA8A 3H85A 5JOEA 2G5BB 2DUZA 4G6AC 4L1XA 1X5ZA 3LBOA 1K8DB 1KCVL 4EKJA 4I8YA 3O2DA 3RUGA 1OE1A 5A2BA 2WNGA 2WM0A 3MXWH 4GKNA 1UD5A 1HE8A 2F7PA 3QJTB 5DLLA 5KSVA 1Q7MA 2GQ9A 2JKSA 1BVZA 3FHEA 1AOHA 5EUOF 4ATTA 1SZFA 4RNFA 3TBTB 1A6UH 3V36A 3PZMA 4MPQA 3W7GA 3VFNB 1ZU8A 1WYJA 4QG6A 1RJYA 1DP0A 3IFNH 3RPIA 1I1AD 2XZ9A 1EJSC 1GORA 4WNSA 4ZFMA 3MJ7B 5IEHA 2MIZA 4HCRH 4WFEE 5TDOA 4RFNC 4KFMA 3MRNB 4QD2E 4XXWA 3BK0A 4OFQA 4IGHA 4Z0XA 4AITA 2BMBA 3HN8A 1NCCL 3BG5A 3HRZC 2Y2WA 3MCG1 3WL1A 3GFYA 1ED3A 3UJJL 4LSQL 1TV4A 2A0NA 3LNEA 3P4MA 3VTMA 4ETQB 4O4YL 5BJTA 4DXXA 5TE4H 2GWNA 3L5MA 4I5BA 1OARH 2XLLA 4WW2A 5FCUH 1HKVA 4HXAH 1V3MA 2VZ1A 5HVHC 2V7NA 3EWWA 2ZF8A 2EZ0C 3MO1A 4XAZA 4D6FA 1WBZB 5HWJA 4AQ1A 4QFUA 2RQEA 3B40A 3ULUL 2BSCA 2OJEB 3BHBA 4DZBB 1W5OA 1ZA6A 4M7JL 1R7AA 4H0IA 2X0HA 4IP5A 1UMYA 1XFBA 3OKMB 2RD0A 5EZOH 3TP4A 2JNZA 3V2AR 4CU7A 4FD0A 2VYOA 3FTGA 3QDGD 4HKZA 1LP9B 1CF8L 3K0YA 4X6EB 3O6KL 4YHLH 4RNRA 1U5JA 2FZDA 2OO6A 5CJ5A 2QADC 3H6JA 4NUQA 2NUTA 4X61A 2D7QA 1RUPH 1ZHAA 2RJMA 2A2IA 3B0VC 1HNGA 5ANHA 3ZRFC 3P5ZA 3IE9A 4HIXH 3W24A 4HXBH 3UAAA 15C8L 3V4VA 2ZADA 3D2TA 1E9PB 1MFBH 1T1YB 2MQCA 3MA7B 5INCB 4F92B 3PFRA 3D52A 4XD3A 4TQ8A 3ECBA 3GX9A 1YO4A 1BXXA 2BSED 4KJWC 3MU7A 5DD0H 3WUEA 4HC1A 9XIAA 4PCYA 2R4SH 4HSNA 3UBFA 4X4YB 2D0FA 1QPQA 2JQXA 3WUFA 4LLDA 2VC9A 3V0AC 2PBOA 3DRTA 1SFJA 4GVHA 3HUJA 3U4KA 4TMCA 1ETZA 1RVKA 1TV8A 3S5LA 2WHVA 3UY7A 5CC5A 1JI1A 4IUGA 1PLAA 3RTQD 2ZOKB 2VDNB 4UR9A 5H37G 5J6GA 2FLMA 1EF3A 1G7VA 3H6AA 3AHYA 4PEKA 3OWRA 5DJ6A 3G1FA 3FAXA 4IQEA 4HFWA 3WK0A 3PPSA 4PMRA 5BCAA 3BPOC 4H6EA 4E2VA 4PN2A 5E2WL 5SWSA 2H90A 1OAKL 4CMMB 2HB0A 4XPAH 5A2FA 5D7IA 4GUFA 4EPDC 1QHPA 1BX2A 2WLYA 4N2MA 4PJBB 1VYPX 1AW1A 1MI5D 3BGFB 3HPJA 2X30A 3MRGB 3T2OA 3TAOA 1YDOA 4KIRA 1AXIB 3ALPA 3BMXA 3QQDA 4PTDA 4S1RH 1F8TH 3B9AA 4EAEA 2FWLB 4YIQA 5AAWC 3R1ZA 2EDOA 2NXYB 1O1ZA 3ZTJG 2EDYA 2JIXD 4YHNA 1E9YB 4BSVA 3QVQA 6XIMA 3BLBA 1LYQA 3ATDA 4PRBB 5KITA 3ONBA 4AK2A 5FKYA 4RMQA 4XMPL 5AVSB 3HRZB 4DAGH 3VG0L 2XSXA 2IAMC 1LL6A 2NNAA 3BYTA 2W9DH 4MYXA 4G56A 4HCLA 3GBNH 1UUSA 3RU8X 4XB8A 1YEHL 3WLHA 2Q7NA 1ZJAA 3QRGL 3IPWA 4B9CA 3CSTA 4JG0H 5T33L 4GCXA 2OZ4H 2UZYA 4Z7VE 1DQWA 5DF0A 4RUBA 1S78C 3CH8A 2CA3A 4GSUA 3ESMA 5F71A 4WI6A 4G6MH 3IE4A 1G7MA 5F7DA 4D3CL 2J88A 3EPNA 5DJ0A 4AEFA 3P2TA 2EH8L 2IDFA 2X40A 3VNYA 2OEMA 3QYMA 4TNWK 5DEFA 3GKWH 2BP8A 4DF0A 5AOMA 3NURA 2Y5JA 1L5GA 4M6ML 1P0SE 4WD0A 1XGQA 3F85A 4OCLC 4RXGA 3LPFA 1AKJA 3SDYL 4HHMA 2XN9E 1LNUA 4J2XA 1LYXA 1JK9A 5TE6L 4P2OB 3R7QA 1SOQA 3H53A 3WY4A 1EWHA 3I9PA 4MDRA 3MRQB 1Q3NA 1DIKA 1NGPH 2WYIA 4IIFA 1O5QA 2ED6A 4R2GD 3VUPA 4X9BA 4X22A 2HQAA 3V6OE 3EJQA 3WSQH 1FYHB 1OCWL 1E70M 5DELA 5FEPA 4C6DA 2AZAA 1BG9A 3K74B 2I85A 1IAII 4MNGA 2OL3L 2IPWA 4BK5C 3MQTA 3W02A 3O3UN 4URTB 2HVJA 1BTMA 1ZAJA 1IAOB 3FT0A 1EXUB 1A1OB 4AD2A 2AEWA 1ZEAH 4M9OA 1AHWA 3QUXA 2O5YL 4HN8A 4LUIA 4PMEA 5LGKA 5DEZA 5I19L 1PL9A 1IEAB 1SVDA 4F9PC 5DCEA 4US6A 4X5QA 1DYZA 2KL6A 4EI6B 5LUMA 3G77A 3GMLA 3MJYA 3S2JA 3S3GA 1CD0A 2IV9A 1PKNA 1JJKA 2Y06H 2EIZA 4M6NH 3GVGA 3QZMA 4Y9EA 4RRPA 2EH7H 2PPAA 2NY4C 2QPEB 4R7NA 4QOKA 3WEMA 4EEEA 1OY3B 3AQDA 3RTQB 4LLWB 1G5GA 1XB6A 5PAZA 1EX0A 4QLWA 1Z5LB 1BEUA 1I4FB 1N6VA 2Y1AA 3QUML 3MU3A 4JREC 5F3BA 4FF5A 4MUZA 4YS1A 3Q0HA 3NTCH 3KGUA 4HUVB 2MANA 1GNXA 3HPFA 4C6PA 1XAUA 1HZYA 3T9PA 2JK2A 3ITCA 4NN7C 4PTTA 3PAUA 4M1DL 4AUBA 2NXZC 5AOZA 3P4OA 4LUSB 3B34A 4Y19E 1JZEA 2BW4A 2OSLB 3VI4F 1YNPA 5EZIL 3STGA 5FF0A 4NQQA 4V2XA 3BUYA 1XSIA 4QO1B 1JGMA 5DURD 5KVDH 1VJSA 2XZAL 3MLSL 2KQMA 1R0AH 4K2UL 1FAIH 3UJTH 1G7QB 4JQAA 4LGRB 3WN6A 3NQMA 2JJTA 4Q6KA 4FNPA 5FGCE 4RMSA 4L5ZA 3GRGA 1FH8A 1WBZA 1AW5A 2R69L 2QUMA 3IVSA 5C0GA 4I0PB 2OMBA 1ZB5A 4AIUA 2J62A 2TODA 4CW1B 2PU1A 3H56A 2KHAA 5DC2A 4B3VA 3ENEA 1MFMA 4JZ5A 4UFHA 4EIVA 3TTSA 3I7QA 3QS2A 1NTHA 1W91A 2ISWA 3MGOB 1U1JA 2QZRA 3M64A 4O8AA 3MLXH 3RDKA 3ZL1A 3AXIA 3KPOB 3ZDZB 3WQCA 4B5WA 4YGVB 4XXWC 3MV8E 1GIGL 1KXQA 2HX7A 3N91A 3WELA 2DI7A 2MKLC 3INOA 3JYCA 2K9FB 5GGRY 1OF0A 5TFSL 3VWJB 2G8ZA 2YAOA 3CWHA 4LSBA 3ZMRA 3X1FA 1G1KA 5EO9B 5GRYA 3B9KA 1WDAA 2OP4L 3OAZH 3V0FA 1UFUA 3QI9D 4JCLA 1ISYA 1W5MA 1CT8A 3F7RA 4NGHL 2AHIA 2CEQA 3WD4A 1U9KA 4RAVB 1YG9A 2W0UA 1OAQL 1MQKL 5D7IE 2H9GB 3ZGIA 5D72L 2OCJA 5C0AA 1PWMA 5A3ID 4U1KA 3SDXE 1Z9MA 2CIPA 3CJPA 4OF3A 4Q4RA 4JKWA 1OWQA 1OK0A 1HI6A 5GZOC 1MXDA 1ZWIA 1F4HA 4ZX4A 4XN9A 1DWJM 1XG3A 3E2HB 2G2RA 3FY1A 5I0XA 5FO9A 3US1A 4PMNA 1CG9B 2VLJB 3ARUA 4MQ7B 2J72A 2WGXA 3CSBA 1FH5H 2BG5A 5KYWB 3VD9A 2NY0C 3JQOB 4HCIA 5CGBA 5FDYA 3RWGB 1G4EA 2FK9A 2H8PB 4GW4A 2H4EA 1OGBA 3ME3A 3KPPA 3PN8A 2OLHA 1RK1B 5ICXB 4H1LG 1U8MB 4N2HA 3TNNA 4FF7A 2YMXH 5AOJA 3STZB 1FNGB 4N6RA 4QKTA 2R59A 4U6VL 4W68A 4AE1A 4FNQA 2WTOA 1R3LB 2E4FA 2IAMB 1MQ8A 2B77A 2SODB 4NQEA 5E8PA 5J9PB 4PV9B 3UCQA 3L65A 3ARBD 2ENPA 3GIYA 1S9XB 4APXA 2H3DA 2BP0A 4L1TA 1AH1A 4B3EA 3GSOA 1EC8A 1R5IA 1MJJA 1XTLA 4M4RB 1LLZA 2Z4QB 1GXEA 1NCWH 4PUBH 2O6DA 4KTDH 1W5QA 5H1WA 3G8RA 2AK4B 2E5EA 4PN6A 2HVMA 1VS1A 3FB5A 4CSPA 4M6OH 4QI3A 5DVPA 1UM4L 4TL4A 3MLXL 1AGBA 1KM4A 1R2SA 2X1IA 2CO3A 3HQNA 1IC0A 2ZZUT 4N0FA 3NO3A 5IB1B 5FGBA 3W2UA 3WLJA 4FXGB 1B6UA 1WHOA 2B7PA 5DHEA 5C0AD 1CK0L 2H2SD 2XUWA 5EFFA 3SCVA 5C9RA 4MJ6B 4O00A 2H2PD 1DXFA 2CE6A 1DVFD 2EEAA 2HTKD 2QMJA 4P2OC 5L7XL 2DBLH 3UPRB 1DL3A 5L2JB 2XYCA 3C2RA 2DQWA 5ICYA 1LO2L 3TYDA 3BDBA 2IGLA 2GI0A 1IEXA 2WJEA 1R3JA 3DPDA 1U8LB 4FXKB 4TNFA 4ZQTA 3TVAA 4BI5A 2NNCA 5IB4A 1TQBB 4BFNA 4UQ2A 5KVDL 4FQXA 1GUVA 1LO4H 2ZSVA 3DWTA 3BPLB 3U0WH 2VXSL 5M95B