5TD4A

Starch binding sites on the human pancreatic alpha amylase d300n variant complexed with an octaose substrate.
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHNNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evaluation of the Significance of Starch Surface Binding Sites on Human Pancreatic alpha-Amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2016-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5td4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5td4A01
2D0GA 1OGBA 1TE1A 3THDA 1JNDA 3WDQA 1JAKA 4GZIA 4CN1A 3DYMA 2JF6A 4GXPA 2ZXDA 1E56A 3QHMA 4JIEA 2HVMA 3WDRA 3AFBA 1UWIA 3VSTA 5CXPA 1E73M 2VZTA 1PAMA 1B0IA 4NXSA 4OGZA 1BQCA 1V3HA 5C8BB 3A47A 4NI3A 5D8ZA 3WD1A 5GNXA 2W4XA 2OYLA 3MMUA 4JCMA 3N17A 3ZJKA 3NUKA 3WEZA 3SUTA 3QGVA 2ZUMA 1JF5A 4AZCA 4GPNA 3QHNA 1SMAA 2G4FA 3PBGA 4CD8A 1BPLB 3N9KA 1ESWA 2BV9A 3EDDA 2VJXA 1ISZA 3VTRA 7A3HA 3DECA 2XHYA 1EQCA 1C90A 1M04A 3NDZA 3BCFA 3ARUA 1QWNA 3CTTA 3TV8A 4BZYA 1QOXA 3UCQA 4EANA 5HPOA 1XSIA 3HMCA 5EB8A 4TVCA 1EO5A 1R8LA 1FA2A 1TVPA 1W9PA 3AJ7A 3LRLA 2C8NA 2UY4A 5M17A 1PX4A 2FH6A 2BXYA 2DSUA 3AQUA 3F5LA 1A47A 3GBEA 4UOJA 4OBSA 2RGMA 2NW0A 3W25A 4JHOA 2XVLA 3ZT7A 3BUPA 3GXDA 3AZRA 4OOUA 4PCSA 3UG4A 4X0VA 1M7XA 2G3MA 1KBKA 4M81A 1J0KA 4R27A 4MB5A 3CUJA 4FNPA 1CTNA 4RE4A 5ABEA 1BGGA 1KTBA 4FLSA 1VF8A 4PBGA 4A3HA 4C7DA 3VX1A 4D6CA 1E3XA 3HG2A 4D72A 5LA1A 1JYVA 2CETA 2EPOA 4PN2A 4BQ4A 5CQ1A 4H7VA 1MWOA 4HOZA 4LYPA 4MNMA 1BF2A 4AZIA 3VNZA 3IAQA 4CD5A 4WK9A 5BROA 3ZJ8A 4GQQA 1EOMA 1I75A 2J7HA 1UKPA 3GH5A 3H54A 1TQVA 1K9EA 2XFYA 4YPJA 1QVBA 4GINA 4GO8A 2D23A 4LYRA 3UR8A 1XHGA 3BSHA 4DWSB 3KL5A 2ZXQA 1UKSA 2WNWA 4PCTA 3O9NA 2ZUNA 3IK2A 3WNKA 1KTCA 1E0VA 1L0PA 1BGAA 1UD3A 3TONA 4J7RA 1UD8A 3KLLA 3QHOA 1KGUA 4GO9A 4MPKA 1QI5A 2DH3A 4B15A 1KB3A 3VD7A 5LYRA 3BC9A 2DDXA 1UR4A 1JFHA 3LRKA 3W81A 7TAAA 5EMYA 3OLGA 3OLDA 1V02E 4LX4A 1CWYA 3WD4A 3NIYA 5I78A 3A21A 2Y24A 3JUGA 1VRXA 4CN6A 5LA0A 2NSXA 1G01A 1NWTA 3THCA 1UHVA 4DWSA 4EK7A 3WH9A 2OYKA 4CU7A 1TA3A 1ZS2A 1BYDA 2EQDA 4QFUA 1PX3A 3FN9A 4PTXA 4PUEA 3MANA 1UH4A 1GZJA 2DQXA 1V0KA 1H3GA 2J62A 4MB1A 1J0YA 3W27A 1O7AA 1XV8A 3DHPA 4E8DA 5A6MA 3AMCA 1H1NA 1EA9C 2CPUA 2G8ZA 3A24A 2O9PA 2WCGA 3AICA 1BYCA 4TTGA 3T0BA 2YA2A 5E9AA 1D7FA 1WDPA 6A3HA 3S5ZA 1H09A 2WMIB 3BSGA 1R46A 3HG5A 3ZJ6A 1IZJA 1LLOA 2YL5A 3WH5A 3ZJ7A 4F66A 3U5UA 1KBBA 3TP4A 3BH4A 3EDFA 1AQ0A 4D6IA 1GQIA 1FOBA 2EPMX 1EXPA 2W92A 1HWWA 4UTFA 2OWCA 3CZNA 1OGSA 5DF0A 1C8QA 4M8UA 4M1RA 1JD7A 2WW5A 2WYSA 4LXFA 1V0LA 1DWJM 1ISVA 1LJYA 1GORA 3TTYA 3GTNA 2VVNA 3U7VA 2CXGA 2WKGA 1HP5A 3GXFA 2WC4A 4JKMA 1MQQA 1GOWA 3AS1A 1HL9A 4U33A 1G94A 4NX0A 3HG3A 2YDRA 2B31A 4UFHA 3SEPA 3CO4A 1E71M 2V3FA 3D4ZA 4P7RA 3L4WA 3ARWA 4PTVA 3POCA 1B3YA 3W6MA 1WZKA 5ECUA 3BUQA 2XPKA 1BYAA 3AS2A 1KR0A 1V03A 1X6NA 4BF7A 1VFMA 2VQUA 4HA3A 2ZUSA 2QLYA 4AD4A 3CZJA 2C7FA 3GDBA 1XH0A 3OIHA 2XVGA 3CPUA 5CGMA 2J78A 4X0NA 4MADA 1E43A 4H2CA 2VZOA 1F4HA 4AWEA 2GDVA 1QI0A 1VEPA 1FHLA 2D20A 1PJ9A 1I1WA 3BXWA 1W9VA 2EPNA 5CGTA 4WLCA 1IV8A 1CEOA 1UQZA 5DT5A 1C91A 2YFNA 1LQ0A 2VCAA 1U2YA 2V3DA 3VU2A 1CLVA 2JF7A 3SUWA 3WD2A 2X1IA 4QP0A 4BQ3A 3S5YA 5FL1A 3A23A 4U3CA 3BAYA 4AZCB 4D1JA 3DX0A 5M03A 2WMJA 4PYSA 4WJXA 3GH7A 3KE0A 3VD5A 3VX0A 3CIVA 1DWFM 2FE0A 3W6LA 5JUVA 2YOCA 4W8BA 3CV5A 1OM0A 4D6DA 4MJ4A 5I5RA 2JIEA 1UKOA 4S3JA 3N04A 5CLTA 1B3ZA 1JNEA 2WVUA 1KFWA 3N13A 1B31A 3WFZA 1K9FA 3FHQA 2UWFA 4J27A 2XN0A 1GCYA 1B1YA 3CUIA 3VM5A 1HJUA 2E4TA 1EH9A 1UR8A 4TTUA 2JFEX 2OLHA 3VNYA 1E70M 4J3UA 2WZHA 2D73A 5EFDA 2WLYA 1FP9A 2EO7A 3VIGA 4PMVA 3WD3A 5AY7A 2EADA 3PTMA 3AS3A 3D3AA 3CUGA 2PWHA 5EFFA 4NRRA 1QNPA 1ZJBA 1J10A 3FNDA 1UZ1A 4UQEA 5A6BA 2CKSA 3WIJA 1KR1A 3ZIZA 4GI6A 3W0KA 1HKMA 5CPQA 1UKQA 1C8YA 4AZ6A 1V6WA 2X05A 3QOKA 3FHAA 3ALFA 1V3LA 2V3EA 4P7LA 2VT0A 1XH2A 2BY1A 4AZBA 3WUBA 4PSRA 5I24A 4B3LA 3W29A 4TX8A 1B3XA 3OA5A 3OLIA 3RM8A 2EJ1A 4AEFA 4ZEPA 1W3JA 2ZXAA 3EMCA 3ZSSA 2W62A 3FAWA 1JG9A 3NYDA 4PMDA 3AS0A 5A1AA 4PMYA 4F9DA 2AMGA 1E1EA 1UR9A 3PZNA 3DHUA 5I0DA 3VIIA 1YQ2A 1CGTA 3BVUA 2ZX5A 2RGLA 1HJXA 3EJQA 2YL9A 4MNLA 1QW9A 5E6YA 1FH8A 3WQ8A 1L8NA 2XM2A 2YA1A 5D9NA 1KXVA 3SCUA 5CPTA 3PZ9A 4AD1A 3M7SA 3D50A 3MUZ1 2ZXBA 3TTQA 2AOSA 1HJSA 5FKYA 4PMRA 1HL8A 3F5KA 4IPNB 4WSKA 5JBDA 1I1XA 4R5EA 2VZUA 1JYXA 3CLWA 4ZENA 1CXHA 5HNNA 3OZOA 4AC1X 3IJ9A 3LPOA 4D6FA 3AIRA 3OBAA 2FHFA 1XD1A 3K8MA 2GUYA 1TZ7A 2G3IA 1SYTA 3QOMA 5IFTA 1J12A 1CGUA 1EDQA 3K8LA 3NSMA 3U5YA 2CBJA 4U2YA 2J7GA 3AI0A 3N12A 2CEQA 1OIFA 2WHMA 3VVGA 2GK1B 2VX7A 4CCCA 1W32A 2X2YA 3WN6A 2ZX6A 3NDYA 2ESCA 1Q6FA 4H8VA 4CD6A 2W63A 2YA0A 5E1QA 1EO7A 3AXXA 2WHLA 4MJ2A 2BVTA 1EOKA 1KQYA 4AW7A 3B9EA 4JHZA 3L4XA 2VX4A 3MS8A 3EJUA 1W3LA 2J4GA 5I77A 3VKKA 4AXNA 1OCQA 2WVTA 2YJQA 4QLLA 3ZT5A 2DEPA 4MDPA 2BY0A 2X2HA 3PZOA 3PZMA 2MANA 1OSEA 3EYPA 3OZPA 1LL6A 4AZHA 4B16A 2WM0A 1W9DM 1J18A 1V3MA 2W67A 3VD9A 1GJUA 2JEQA 1XH1A 5BXPA 2GJPA 1XSJA 3ALGA 2F7RA 3BGAA 4XZBA 5A3HA 4DM1A 1WB0A 2G3NA 2GK1A 4JFSA 1GHRA 2YBUA 5D9OA 3CC1A 1CGVA 2EXOA 4PMZA 1HJVA 2CKRA 1D3CA 2D3LA 2W66A 3PTKA 1QNOA 2A3EA 3M6DA 1V0NA 1AQHA 5DFAA 1GOMA 1KXTA 2WSKA 2BS9A 3GNOA 7CGTA 4ACZB 5A8OA 1PZ2A 1Q6EA 4MDOA 4BQ5A 8A3HA 4OIFA 5A2AA 1FHDA 1V3KA 2BHYA 1C3FA 4JL1A 1JZ8A 3WD0A 3LPGA 2VRKA 4GZEA 2EBNA 3BVTA 4CGTA 3ZMRA 5ABHA 1ZB5A 4JFVA 4FNQA 4J3SA 1QHOA 4CCEA 1R86A 2GSJA 1WE5A 4HMCA 2E9MA 3CUHA 1XSKA 2YBTA 4JAWA 1W1VA 2VQTA 1E55A 1JZ2A 1XYZA 1N82A 1KWKA 2UY2A 1XCWA 2VC9A 3WUEA 4W87A 4HA4A 3MUIA 2O9RA 1KWGA 1E6PA 5AC5A 1BTCA 1QW8A 3A6OA 1MYRA 3W28A 4Z2HA 2VURA 4FF5A 2J79A 1NH6A 3WF4A 3MV11 4FLQA 3VGBA 1RPKA 3QR3A 3WDIA 1SMDA 2CITA 4V27A 3VD4A 2VL4A 4AMXA 5BXRA 2CBIA 2D1ZA 3NSNA 2F2HA 3LMYA 4DWSD 3WY1A 1PZ3A 4AD3A 3ECQA 3RMEA 3PZUA 1BLIA 3M46A 5HPCA 1MQRA 6TAAA 3A3HA 1DEDA 3WEMA 3S6TA 4E2OA 1GW1A 5I79A 2JE8A 1E4NA 1GOIA 4OKDA 1KXQA 3IAPA 1OT2A 1ZJAA 4UFIA 5C70A 3OGSA 3HU7A 1MFVA 4M29A 3ARPA 1HTYA 1IZKA 1FFQA 3GXNA 3RPMA 5JIWA 5BYWA 4UR9A 1HKIA 2W91A 3NCOA 3WH7A 1E6RA 3SUSA 3O6AA 3WFLA 3WKZA 2BHUA 1HKKA 1JZ4A 4OBRA 3WDJA 2BVYA 5TD4A 1UQYA 3WBAA 2VR5A 1PBGA 3WQ5A 1QX1A 4LQ1A 3T2QA 1G5AA 5D9MA 3ZOAA 1QHZA 2GJRA 4AIEA 1TA3B 1E4IA 5BCAA 3UG3A 4HOWA 3NSXA 3BLBA 3WH6A 1DTUA 4L4PA 3SCRA 4FNUA 2J7CA 5FCZA 1W2VA 5IFPA 4J3XA 1WKYA 1HT6A 3L2LA 3A4WA 5BWFA 5I6SA 1QHPA 1UR2A 1BG4A 4ACYA 2VUYA 2X0HA 2DSWA 2X8RA 1G0CA 1H5VA 4W88A 1NQ6A 2WAGA 4Z2KA 3GXTA 1DHKA 3SCOA 5AC4A 3DX4A 1OIMA 3CBWA 4QDMA 2WWDA 1HXJA 3OLEA 1H2JA 2WMIA 1QNSA 3N11A 1KCKA 2Y2WA 3BLKA 2WWCA 1HN1A 1LL7A 1TQWA 3LXAA 2WSPA 3AZSA 5IDIA 2A3CA 4HPGA 5E6ZA 3ARXA 3FAXA 1VAHA 2VZSA 1US3A 4B9YA 3T2PA 2VCBA 4OJYA 2OSWA 2IXUA 4YHGA 1B90A 1J0ZA 4J3WA 1XCXA 2WZEA 3GNPA 2J7EA 3CH9A 4AD5A 1LG2A 4MNKA 1UH3A 2WXDM 3T2OA 1NOFA 5JIPA 3RJXA 4H8UA 4PTWA 2WKLA 4Y7EA 5E70A 5BRPA 4A3YA 2J7DA 2GVYA 2WCAA 4CUCA 4AMWA 3AROA 1GONA 4UFJA 1EIBA 4F8XA 3VIPA 1CGWA 2WCSA 3BAIA 2D0FA 4K68A 2FGLA 2D22A 3EMQA 2ZUWA 3K46A 5D9PA 1WP6A 1BHGA 3FW6A 3S2CA 4J28A 3AIUA 1BAGA 2CESA 2J74A 4FLOA 2OWXA 2QMJA 1OWQA 3BAJA 4KRTA 2E0PA 3J7HA 3CZGA 1SFSA 2FHCA 1Q6DA 1VEMA 1SZNA 1R85A 4Q22A 1FH7A 2WANA 3VDBA 1ZBCA 1V6YA 2UY3A 2A3HA 1GUVA 3VGHA 1K9DA 2XN2A 2WVSA 4NZJA 4XUYA 1C7TA 4WKAA 3AMLA 4P7QA 2Q8XA 3VIHA 3DX1A 1CXIA 1ITCA 3A5VA 1OINA 1DWIM 1OBAA 3AHZA 2CHOA 4BCEA 3K8KA 1V6XA 1VBRA 3MSGA 5BXSA 2D0HA 1E1FA 1W9XA 5M3WA 3BUBA 2ZWYA 1R7OA 3VMPA 3MV01 2PF0A 2WC3A 2J8FA 3WH8A 2YL6A 4AZ5A 1JYNA 2Y4SA 3AMGA 2CBVA 2X2JA 2XG9A 2BFGA 4D1IA 3GM8A 3DDFA 2BY3A 1EQPA 3UR7A 1UA3A 1JL8A 3VGEA 3WMCA 2VMFA 2F7OA 2O9OA 1UWRA 1JAEA 1HX0A 2ZX8A 2PI6A 4M24A 4JCLA 1KGXA 1JI2A 2W5FA 3OGRA 2YFOA 3WDPP 1V3IA 4DUWA 3GYCA 1B30A 2XM1A 1V08A 5A6BD 1NP0A 4P8XA 3K4AA 2CNCA 1V6VA 3RM4A 8CGTA 1U33A 2WBGA 4W7UA 4P7OA 1MW1A 4MAVA 2JIWA 3U57A 2ZUVA 1SR0A 3UEQA 2ZOXA 4W86A 3ZSTA 2BHZA 3IJ7A 1H41A 3B9DA 1OD8A 3TTSA 1WZAA 3EDEA 1E3ZA 1ITXA 2OWWA 3VGGA 2WMKA 3K4DA 2ALWA 1LF1A 2VR4A 3SCPA 4KWUA 3EJRA 4E8CA 2YKKA 3T09A 1W2PA 3VM7A 4DWSC 3K1DA 1TVNA 2J47A 2VOTA 2E8YA 2OYMA 4FK9A 1ECEA 1C7SA 1G9HA 3VDHA 3VIMA 3VSUA 3VIFA 4NSBA 4BS0A 1VBUA 3BAXA 2E9LA 4MTVA 1EHAA 2ZIDA 2FH8A 1CYGA 2FGZA 3N15A 4CVUA 4AIUA 1JDCA 1GVYA 1ISXA 5DEZA 2OSXA 1QNQA 2EAEA 1F4AA 3W37A 1UWSA 4KGJA 4TVUA 4PRWA 1US2A 2FHBA 1BFNA 4PMXA 4PUDA 4B3KA 3HJEA 4WIWA 2DSZA 4UQDA 4ZE4A 4EKJA 2PBGA 5A8MA 3PZQA 2E9BA 3WUFA 3UERA 2GJXA 3UETA 2WMFA 2XFFA 1H49A 3ARSA 3W82A 1HXKA 1MVYA 1NARA 3AOFA 1TCMA 3OB8A 4AZ7A 2XVNA 2YLLA 4JFTA 5A6JA 3MMDA 1TQUA 6CGTA 4UQ9A 1UR0A 3E1F1 1QPKA 1S46A 1HVQA 4PMQA 3ARVA 2IXVA 5HOSA 1Q6GA 2DSKA 3IJ8A 1NOWA 5I3DA 1WNOA 3T08A 2JALA 4PSPA 2PBOA 3CMJA 1WDQA 3AHXA 3WF3A 2WZIA 2YDSA 4HTYA 1FFRA 1GPFA 4TUFA 1J9YA 4XB3A 4ZE5A 4NZFA 1BVZA 1JFXA 5AYBA 2TAAA 3BAWA 2XVKA 2J25A 3F4VA 1JIBA 3WQWA 2DT1A 3BVVA 1M01A 4NXKA 1UYQA 3VGFA 4F9JA 4DO4A 1GJWA 3T0AA 2OW6A 5A8PA 3PN8A 4D71A 4W7VA 3KLKA 3ARRA 2GDUA 3GXPA 2WB5A 4WKFA 5CJ5A 3LPFA 1V02A 3CGTA 5CG0A 3VUPA 5E0FA 2JEPA 1JD9A 4F79A 4UZSA 1HNYA 3APGA 1R7AA 1UD6A 4RL3A 1CPUA 1WCGA 3II1A 1PS3A 4J3VA 1QI3A 1V6UA 2PWDA 4BA0A 1E6ZA 1JZ6A 3LRMA 3AXIA 1P6WA 3WNPA 3WQVA 2XUCA 2EABA 4HZ7A 3WY3A 3VINA 1A3HA 1C8XA 3IGUA 1VIWA 3SCQA 5BXTA 2VX6A 1UD2A 3WSUA 1TG7A 3SURA 1TFVA 3KEHA 1W9BM 4URIA 1YHTA 3G6MA 2Y8VA 3AISA 3CZLA 5C71A 4LYQA 4C7FA 4DUVA 3PZTA 1DWGM 1RP8A 1J01A 2XIBA 3GXIA 4WSJA 3LX9A 2BXZA 4CU6A 4E4PA 3VPLA 5DO8A 1TQSA 1CGYA 3F5JA 4JFUA 4IUGA 2ZUUA 3BLPX 2DT0A 1KCLA 3WDHA 3AIQA 3T0DA 1ISYA 2E40A 4UOQA 2EPKX 1IT0A 1QBBA 2GFTA 3SCVA 2F7QA 1H11A 1WZMA 3KL0A 1CXEA 3LXCA 2WK2A 4UFMA 4N0RA 2C0HA 3IANA 4M82A 4U31A 5CPSA 3D5HA 3DX2A 1AMYA 3L4UA 3M07A 2PWEA 3VDCA 3BMVA 4DO6A 2ZWZA 2IUZA 4CN4A 4RE3A 3SCTA 3RDKA 2DT2A 4HMEA 5IHRA 3A4XA 3WL1A 4N42A 4D6GA 3PHAA 4UOZA 1E72M 1ZBWA 3GH4A 1ODZA 1DP0A 1E4MM 1KQZA 2X2IA 1VENA 1VFFA 4PMNA 5KZ6A 3MSDA 3MUY1 2DT3A 3L4VA 2PWFA 2WBKA 3DDGA 3KZSA 3POHA 1LG1A 3WNLA 3AIVA 2BNJA 4PTMA 3EMZA 4CD4A 3RIKA 3A22A 3WELA 5ABGA 2VNCA 1ISWA 5I2UA 2XWDA 1ZL1A 1M03A 1JZ7A 1Q6CA 3KWXA 4U5IA 2FYVA 5HXMA 2A3BA 1E6NA 2V3GA 1ODUA 1MW0A 1X6LA 1JDAA 3WNOA 4W8LA 3H55A 1HP4A 1AVAA 1O7DC 3H53A 2ZICA 2XSBA 4W84A 5GNZA 3DYOA 2OSYA 5FOOA 4QCFA 1MFUA 3W26A 3ZO9A 3WY2A 5F7UA 3BUIA 3ZR5A 5E09A 5JBEA 3VMNA 5I23A 4ACZA 4HMDA 1CXLA 3O2LA 3EDKA 1MXGA 4P8UA 1TMQA 2EEXA 3WNMA 2Z1SA 3VO0A 1T0OA 2FDMA 2W61A 2WMHA 4ZXLA 4MNJA 3BVWA 1U30A 1W9UA 4W89A 5HBFA 5A94A 3W24A 3LXBA 5HDRA 2XGBA 1D2KA 3WENA 1XD0A 1K9TA 2F1BA 4QLKA 2DH2A 1W91A 3PZIA 1MXDA 4UCFA 3HG4A 4UQBA 4ZXOA 1JXKA 4W93A 4HZ6A 4GQRA 2VRQA 1CBGA 1OD0A 2XJ7A 4YN5A 1UASA 1O6IA 4MB3A 2CCRA 2WPGA 2O9TA 1J0HA 1K6AA 4U5KA 4CKQA 3VILA 4CD7A 1WDSA 1JXJA 2E8ZA 1BVNP 4GZJA 4HU0A 3TOPA 2QV4A 1OGGA 3VSVA 1WDRA 3RM9A 3CHCA 2PC8A 3SUVA 4FNSA 1BYBA 4JKLA 4XZWA 2WVVB 3N18A 5A69A 3EJTA 4CU8A 1E40A 1HJQA 3AIBA 5A6LA 1XC6A 4Q7NA 4ZFMA 3DX3A 1ZBVA 2V5CA 2YDQA 1NWRA 1UUQA 4L4OA 3AMDA 4NRSA 1W1TA 4M80A 2YLAA 3GNRA 4WKHA 4FNTA 2D24A 3D4YA 4AZGA 2X09A 3WF2A 4W7WA 3RILA 1CGXA 1E15A 1MW2A 1X1NA 4UQCA 1TR1A 3U7BA 3WMBA 1CENA 3I3EA 1JDDA 1W3HA 3MI6A 2IGTA 4IISA 4EE9A 3BCDA 3MUAA 1UA7A 2NT0A 4V28A 2Y8KA 5A95A 1RD6A 1NP2A 1V0MA 1UR1A 1NM9A 1LWHA 3ZT6A 1OB0A 2F7PA 3HN3A 4M56A 1W1YA 1UZ4A 5EBAA 4KMQA 1QBAA 3VDAA 3BAKA 1H0GA 1C93A 1CIUA 3SUUA 4H41A 2J77A 1R87A 3VOCA 1E9LA 3SIMA 2WC7A 2HISA 5A8QA 1H4PA 4EAMA 2VO5A 4ML4A 2VTFA 3A4AA 3HZ3A 1R47A 1E5NA 1CECA 2CHNA 3WF0A 1XYFA 3TA9A 3SCWA 2QPSA 1GOQA 2A3AA 3UG5A 2V5DA 2XFRA 3WNNA 1VFUA 3L4YA 2V38A 4W5UA 4H8HA 4P8VA 1XRVA 1B2YA 3AHVA 2UY5A 2CYGA 3CZKA 3L4TA 1GQKA 4AD2A 1C92A 3AHTA 3VGDA 1J11A 3CHEA 2XIIA 1MQPA 1JF6A 5DT7A 5FD0A 3MKKA 1E0WA 3W38A 4HP5A 3CZSA 3BMWA 2J7FA 1UH2A 1G1YA 1AQMA 2CIPA 1KXHA 4CVWA 1EDGA 2XYLA 5LA2A 1EHNA 2J7BA 1HVXA 4OUEA 4TVDA 3SCSA 4PMUA 2D2OA 5CSUA 4DUXA 1VEOA 5GNYA 3FXYA 2D3NA 4UNIA 3ZR6A 3WL0A 5IXEA 3EJPA 4AMCA 1JZ5A 3NJ3A 1VJSA 3PZGA 1FP8A 1ZU8A 4JKKA 1EGZA 3WMSA 3SCNA 2OW7A 1UWUA 4AYSA 4H04A 1NWUA 4UFLA 1KGWA 1UG6A 4TX6A 2BY2A 4GIAA 5A2BA 4NF7A 3VD3A 2X0YA 3G6LA 5KEZA 5E0CA 1E4LA 4QAWA 4XX6A 1UKTA 3L2MA 4IPLA 2NT1A 1VB9A 3AYRA 5BRQA 1CZ1A 3WQ6A 2DGAA 5A6SA 1UOKA 4QCEA 1UD4A 2AAAA 2CERA 5CLWA 1PPIA 1PEZA 2XSAA 4HOXA 3WQ4A 2J75A 4KRUA 4HPHA 4JL2A 1DWAM 4BQ2A 2BVDA 3WUGA 4C7GA 4NZCA 4ATWA 4AY1A 4LGXA 2XWEA 3D51A 4PMOA 3FY1A 2VRJA 1CDGA 2QF8A 1E5JA 1JYWA 2G3JA 3MO4A 4KH2A 4GI8A 2QHAA 1GQLA 4AEEA 3ARZA 1E0XA 1OT1A 4YHEA 4UQAA 3TTOA 3ARQA 1NOUA 1Q4NX 2XVPA 5ABFB 3WEOA 2E3ZA 5DMYA 1Z32X 3LPPA 3KL3A 1JI1A 1WAWA 2VZVA 3EBVA 3ZQ9A 4WF7A 4MB4A 3WF1A 1GOKA 2Z1KA 3I3DA 3AHYA 1CXFA 1FH9A 4LPCA 3CMGA 4HU8A 4Z2LA 2VX5A 5IHSA 1HF6A 1GVIA 5CZKA 3VIKA 1E6XM 1VJZA 3CZ8A 1QNRA 3N1AA 3DC0A 3BVXA 3ZM8A 5CSYA 1WO2A 1W3KA 1HIZA 2WHKA 5AYIA 1ZBKA 2J8GA 2VI0A 4XV0A 2PWGA 4A4AA 4GKLA 4Z2JA 1H0IA 4P8WA 1BSIA 1CXKA 4JZ5A 2EACA 3GXMA 1VFOA 1PIGA 2DIEA 3B9AA 3AZTA 4D6EA 2XN1A 1HKJA 3RJYA 5A6KA 5D8WA 4FNRA 2PB1A 2YL8A 1GNXA 3DYPA 4FLRA 4MAZA 5A8NA 1UD5A 3MU7A 3ARTA 4J3TA 1XGZA 5ABFA 1RH9A 2DSVA 3ARYA 1J0JA 3GBDA 4FMVA 9CGTA 1MW3A 1GQJA 3AIWA 4V2XA 1QI4A 2VVSA 3AMKA 3CHFA 4IM4A 4CCDA 2VCCA 1R33A 2ZX7A 4KGLA 1JZ3A 5A2CA 3CZEA 1WPCA 3VMOA 2CBUA 4UZUA 4DO5A 4Z2IA 4HA1A 2G41A 4B9ZA 4U3AA 1TUXA 3GZAA 3I3BA 2XGIA 3AXHA 3VIJA 4TOQA 4X9YA 5A6AA 3D52A 1HJWA 4S3KA 5GQBA 4AD0A 5GPRA 4GI9A 4PEEA 4UFKA 3WY4A 1B3WA 3RO8A 1W1PA 3UESA 2F8QA 2XTKA 5M5DA 4AISA 1R75A 3EJSA 2DPEA 4TXEA 4Z2GA 2DIJA 3OGVA 3W4RA 1UWTA 1M53A 1E6QM 1UWQA 2WMGA 5JBFA 4RE2A 3OG2A 5D4YA 3BUDA 4D6JA 2O92A 3PTQA 1PX8A 4D6HA 1LWJA 2YIHA 1V3JA 1B3VA 2GJXB 4AIOA 1QI2A 4P7NA 4W85A 4AYGA 1TQTA 1CNVA 1GHSA 4HZ8A 3MMWA 3RCNA 2WLZA 2ZX9A 3AIEA 4W5ZA 2ZUTA 2EPLX 1BG9A 1WZLA 4DM2A 1RP9A 1QWUA 4OZOA 4JFWA 3CHDA 4QLJA 1PIFA 3WBEA 1R34A 1JGIA 3L4ZA 1EDTA 1DWHM 2F61A 2WHJA 5FL0A 3AYSA 3W53A 2WVVA 2QPUA 2Y5EA 3EDJA 1NWSA 2ZE0A 1B9ZA 4ATDA 1GOOA 3CUFA 1E6SM 4U2ZA 2QMKA 3B8SA 3VIOA 5FIPA 4ATLA 1LL4A 2F1AA 3PZVA 1CLXA 1J0IA 4OOZA 2F18A 4W8AA 1Y7VA
chains in the Genus database with same CATH superfamily
5I5IA 2DMBA 1BQHA 1CR9H 2F15A 4TOYL 1TE1A 1P1VA 3THDA 3WDQA 4LOUC 1K72A 3Q5TA 1IAIH 4P59L 2Z7WA 1IAOA 4I0PC 2ZONA 1VZIA 2ZXDA 2C91A 3H23A 1E56A 2MOQA 3QHMA 1NICA 1BAWA 3PUEA 4FFVC 4FHBD 4Y90A 3HQPA 3NK3A 3CU1A 3MLSH 4JY4A 4NXSA 3WAKA 1BQCA 5D2VA 5C8BB 3A47A 4NI3A 1WBYB 4OVVA 1X5AA 3L3HB 4PB0H 1KBPA 1XR8B 5D1QA 5GNXA 3HB3C 2IPTH 1IXQA 1YMMD 3REVA 3HNVH 3V7AE 3MMUA 2X4QB 3HFML 4RRPG 2IKGA 1J9RA 5ANMB 1ZLWK 4AY7A 1JWUA 2CM5A 5CSZA 5C09D 1RA5A 1D5MA 1SEBA 5LUMA 3BQUC 1ID5I 3SE9L 3A3WA 3LKRA 3FFCD 5IOPB 2EC9U 2G4FA 3IBEA 4ELDA 1TPWA 4JTAA 3ZE2B 2XYBA 3D18A 1VPYA 4JQIA 2PD9A 3O4OB 4WI9A 3SDAB 4X4YB 3EDDA 4M7KL 3LV6A 4LDEB 5HDBE 3WFBH 3E96A 5SWSA 2NR6D 5CZVL 3SN1A 1VH7A 3ARUA 1QWNA 3IU4H 3GIPA 3CTTA 3BFWA 1TWSA 5DC4B 4IG2A 4ADTA 5T3XD 4BZYA 1QOXA 2ZUYA 4JTCA 1H50A 1XSIA 3E3QC 1CT5A 4ODHH 5BOOA 4K15A 1CB7B 3OPSA 3Q9PA 5KVDH 2WBJD 1OCNA 1W9PA 3TROA 1FG2B 5A16A 5ECUA 1Q72L 2WW8A 2Z91B 5M17A 4M6VA 2ESVB 1VZWA 2FD6L 5ABAA 2VW6A 1DQJA 4G9DB 3VWJD 3F5LA 1XF5A 1A47A 1K4DA 2F54A 1GZQB 3GBEA 4L1LA 4LNVA 5L9DL 1X6UA 5FJOA 3EADA 3TMQA 4A6YB 3W86A 3KX6A 2RGMA 4E3TA 1KEGH 2ABBA 1NGZB 1Z9LA 4N2FA 5BPPA 3KP1A 4W9DC 4PRRA 7FABL 3WHE0 1F4XL 5DVOA 4W70A 2FMOA 2NX3A 2ONEA 1YC8A 4JPSA 2AXGA 3SDXE 2HLAB 4LAKA 4HLZH 4KY1H 3FUFA 3BUPA 3GXDA 1SZGA 4Z7WB 3AZRA 1QACA 3ASWA 1RJPA 1G1OA 3T3PE 1KB9K 1U3HB 4FJZA 3GSOA 2VXTL 4RDQF 1A25A 4R3SA 4M81A 3LQLA 4EPDC 1XWYA 1KRAC 4MFEA 1ZA6A 5CBAA 4R27A 4IBTA 4I5XA 3RLUA 1DL7H 4XWOC 4IGMA 5KYXB 4LUSA 4NYLB 4ZXBC 1TQCB 4Y1AB 4YDIH 1FSKC 1NCGA 4IRJC 3WFCH 4HSOA 4PW9A 4G1NA 1KTBA 4FLSA 1VF8A 5CGBA 4KFMA 3GLDA 4HIXH 1MSPA 4ZFGH 2MUCA 3BZJA 4C7DA 1C1EL 4D6CA 1RY8A 2VC2H 4JQVC 4ODTH 3TYGH 4FG4A 4DWHA 4IMLB 1QD0A 1AMXA 4UTAH 2E77A 1DBBL 4YWSA 5D1ZI 4UV7L 3TBCA 3ZL2A 1GT8A 2EPOA 3PNZA 1MHCA 2R7EB 1DORA 2PDJA 3QXBA 2NNFA 2A83B 4I18C 3CD4A 4QUOA 3BI9X 3VXUA 1MWOA 5J4MA 1IEHA 1RSFA 3CK0H 1Z9SB 3UZYA 4AZIA 3Q2LA 5FCUL 3O9WA 3ZVHA 2AJSH 2DQTH 3D3VE 4WK9A 1U8IA 3ZJ8A 4GW5B 3S0PA 5HYJE 3A12A 1HL2A 3BO9A 1I75A 3C2VA 1M05B 4ZMGA 4N0CC 5HK4A 4ODVL 2VITA 4TLKA 3RRQA 3AWOA 3LLXA 3H54A 5B4MD 1K9EA 2V2CA 2ICCA 1JN6B 3DXAE 4HG4K 3VD2A 1SBSL 3VWKB 4GINA 2QUUA 2FYYB 2A1WL 3PG9A 4M1GL 5D6DA 3I4KA 1FN4B 4CNSA 3BKML 3UR8A 4UMCA 3KTSA 2XZQL 5HHOD 3FYIB 1ICQA 2R69A 3HN8A 4DQOH 5A3IC 1BLNB 2YO3A 1P0DA 3KL5A 3VA8A 1F41A 3U9UA 3JZ7A 4JO3L 5J06A 2TRYA 1UKSA 2YK1H 2WNWA 4NNXA 4MA3B 3QEQD 1F8MA 5I3FA 3WJMB 1FY6A 1OVDA 2OTPA 3BWUF 3HFFA 3MACL 3VFMB 3WNKA 1RJQA 2XXMB 4LLWA 3GW0A 1K6QH 3UPRB 3H2MA 3CFEA 3WJLA 2P10A 3F4NA 2R2EA 1RLCL 3MA9H 1ZP3A 3LCXA 4DBDA 5F7FA 1BX2A 5IM7B 4UIOA 1KGUA 3EGXA 1EP2A 3FA3A 1W31A 3TT3H 1JK8A 1FV1B 1IEWA 4M7ZC 1NDWA 1I1YB 2P46B 2DL9A 2UBPC 3INOA 5KSAD 1I60A 1XIDA 5E1HB 4HYRA 4LVHB 2VFHA 2XQYK 1SXSA 2R39A 3N40F 1JFHA 3DUUB 1TZZA 2DLTA 2K0RA 3N9GL 4O57A 2BNRE 1U91A 3NIFF 5GISL 5C55A 1QFHA 3F7YB 3O4LE 3M0MA 4ZFFB 1LT7A 4PU2A 3UBPC 4NYUA 1TMCB 4GIOA 4KKNA 7TAAA 5JNYA 1I6NA 3LGEA 3T0EC 3TN6A 1DO5A 1CWYA 4ZFCA 4ZSOB 3PULA 2EXYD 5BVJB 1MPAH 4XD3A 5H8UA 4ANKA 1R3YA 1SY6L 2YPLB 3D06A 3Q37A 4PJHE 4JGUA 1S7SB 4TOYH 1KV3A 2VKXA 2VN4A 4JPWH 4X5QA 1VKXB 2QL1A 3WLWD 4BQ6A 4JY8A 5E95B 4MSSA 4U1LA 3LQZA 1UHVA 1T99A 1S8DB 4ALAH 3V0JA 3JWDH 3WH9A 5CEXA 4X9SA 1S3KL 3N55A 4QYOB 1AQFA 3T55A 1BTMA 2OLSA 4CU7A 1P7QD 4R7DA 2HPTA 1TKWA 4UMAA 3K3QA 3MLSL 3BLOA 4PUEA 5E1GA 2R2BA 4FQ1L 3L5LA 3B3IA 4XP5L 4C65A 3VKAA 1AAJA 2YSSB 4UDTA 1Z9OA 2PDLA 3MANA 3QPQD 2VLJB 4AKQA 2FKPA 3E2HB 3PHSA 2ZADA 5ALBH 2J62A 1UC6A 3E80A 4MB1A 5MKGA 5I66B 3LEPA 3GSQA 2XN9D 2WXKA 5B22A 3SGGA 5MEPA 2LU4A 3PBMA 4X61A 4ZW5A 4US5A 4I7VA 4HALA 2ILLA 5DUPH 2HTLC 4C1NB 1F3XA 5KITA 4GP8B 3QYSA 1FGVH 1M7PA 1EGMA 2ADGB 2EO1A 4PJCB 3W6YA 4JG9A 3PBWA 2HX8A 3OVGA 3LS5H 1KLGB 5F3BB 43CAB 1XG3A 5A6MA 3SJNA 5C8JA 3IS4A 3SBQA 4CNIA 3CASA 1L2UA 4DKTA 1CD9B 2WJDA 5XIMA 1IBYA 4IMKA 4AZ8B 3KNBB 2O9PA 1DUZA 2PYFA 3K72B 4RWYH 5F7LB 4TTGA 1BYCA 3AICA 2ZZ5A 2O61A 3T0BA 1D9KA 2EG6A 3B9KC 2FLRT 1D7FA 4QKXB 4JNZA 3V5DB 1A6VH 2CDEB 3EBAA 3BKJL 3S5ZA 3VFOA 3V7AG 1NGPL 2ZRZA 5E8PB 3UZ5A 3ZJ6A 4GSXA 2O4EA 1ZQ5A 3NSJA 3PJSB 5D2LB 5E8DH 4APXA 3M44A 1GKQA 1KBBA 2PRMA 1WTGT 3CPLA 3ETSA 3ILDA 4G7YH 1ZJIA 5IGXL 5TE7H 3NZHL 3BH4A 3KWVA 3V2AR 2F53B 4GXFA 5CEXB 3S5NA 4UQIM 4N2AA 2EDOA 4U3SB 5B1JA 3GB6A 2J9YA 1I82A 2NXGA 5HVHC 2I9LA 2EPMX 1WAAE 1OTSC 1HWWA 32C2A 4YTSA 5EIIA 4KHXL 3WX7A 2Q8LA 5JXAH 1T7XA 4XC1H 2G97A 1C8QA 4XMKL 3LKSA 5EO9A 5C07A 4RISH 1V0LA 3KH3A 5F9DC 1JGVH 1DWJM 3ONCA 4CC1A 1P1ZB 5LQBL 5JMRA 1DPMA 1LJYA 1GORA 1X38A 3QY8A 2F8IA 1OTUD 4R96B 2YKLL 5EBLB 5KBDA 1UXMA 2VDRL 4A7UA 1B57A 3D2UA 2AK4E 3H2QA 3U83A 3GTNA 4PWFA 1U21A 2NY0D 5FXCH 3KS0H 1UUMA 1KKOA 5C97A 1LT8A 5TGBA 4GH7B 4AMKL 2CO2A 3FJ4A 4I3SH 5BS0B 1GOWA 4PH8A 3DKLA 5FEZA 1E50A 1FZMA 3AS1A 3I10A 4RGND 4YHKL 2GABA 1OGAA 1INQA 3G5VB 1DL7L 5CGYD 1E28A 3UTPD 3KNBA 3P3UA 4MD4A 3HJZA 4K38A 3IMRA 4UTUA 3QW9A 2P76A 4NRXA 1KIQB 3HURA 5L9FA 3PIQB 2EDTA 3OXRB 4OW6A 3X3FL 4HMNA 5ENWA 2XC8A 2HT4C 1E71M 1GW9A 1G9MC 1GTHA 5I3GA 3D4ZA 5GS1B 4P7RA 3HNVL 3L4WA 2VP8A 3TOYA 2M26A 3DPBA 4ZMLA 4PTVA 4Z1YA 3FT0A 3POCA 1BZDA 2BWGA 4AM0Q 8PAZA 1B3YA 2WO5A 1NWPA 4WI5A 3CL7A 5EMKA 5D8JH 5CSUA 4A2MA 3V4PB 3MRNB 1ZLSH 3TURA 2AP2A 2ISDA 5E4AA 1JNNH 2PTVA 4XTDA 3CHXA 4AQAA 2CHZA 1N4XH 4GXVL 1TEGA 4JRFA 4XC3H 2OOGA 2PSNA 1VFMA 3U0TB 2W9MA 4XCFH 2VQUA 3V6FB 2W0PA 1YYLH 4KK9D 4W1TA 4NNBA 3ZVVA 2C7FA 5I8OH 2HVKB 2JCCF 1O6VA 1LXMA 4ZQKB 1VR6A 2QGBA 3IIZA 3CT7A 1A4AA 3BUYB 5AB2A 1DR9A 4D0CB 4PV9A 3AYVA 4WKZA 1QABA 2B14A 3Q2CA 4X0NA 4MADA 3D69A 2GVLA 4JEQA 2VZOA 1MHEB 2C9QA 1Y1UA 2F5AL 1FHLA 3VYLA 4JQIL 1J96A 2H3DA 5EPDA 5GJNA 4DOHE 4F0LA 4WLCA 3NG3A 4M4PA 3L3GA 4MMYA 1XIWB 3PJUA 2QT3A 4ZB5A 4DJDD 1BYNA 4XVUD 1Y6NR 4FGMA 4P3CL 4F24A 2XI9A 1XRFA 4NAFA 3OAUH 2HFFB 3FTGA 2GYSA 4JHUA 1XLAA 4FFWD 1JVLA 1CLVA 4HN4A 2VL5B 2WINA 2Y07L 4QHNB 3S36L 4QROA 3VKJA 3L5AA 2IQDA 2FZ3A 2QKSA 2UZIL 1SJDA 2Z92A 1T7YA 2BVPA 3MZNA 5LLIC 4FAAB 3BWZA 4QP0A 4XVSH 5F9JA 2P3ZA 1GKPA 3UADA 3O2WL 3V79C 2GK2A 1ZHBB 3BAYA 3QGAC 4AZCB 3MA7A 4KRPB 1EK3A 1NDZA 4D1JA 8RUCA 3BANA 5LAXB 4HAGA 4JG0L 5LIKX 4I9TA 5M03A 4JQ3A 1A7RL 3QIBA 1BAFH 2EIDA 4FP1A 2CJ3A 4FI4A 5DJCA 3RYSA 3MRNA 3PFUA 4K9EL 3NH7H 3U48A 1A5KC 2GOKA 2RGSA 3VX0A 3BSZA 3NP4A 2VDPB 1Z9NA 3O1NA 4DPAX 4G1MB 3NJHA 5E6IC 5GGRY 1XAKA 1H3VA 1HJBC 1PIIA 3ARFC 1N6UA 2DZWA 3CV5A 3FB7B 1BJ1H 1T3FA 3MRHA 1DZ0A 1EFQA 4K7FA 4MJ4A 2E28A 2PTWA 1ZHLA 1OF8A 3UPWA 2PW2B 5I2IB 2H26B 3PS7A 5G4HC 1JNEA 5CJ8A 1W3NA 1OTTC 2FEJA 3AU1A 3B9OA 2OXGA 1QKZH 1BQKA 1IBFA 2EDRA 4NM4L 4MKMA 4UANA 5B38G 4G56A 1TCDA 2ALDA 1QUNB 1YAIA 5AVSB 5T9CE 4P59H 3TAKA 2P8MB 1BGXH 5I5JA 1IEIA 3KBJA 2XWJA 2ED7A 4J27A 3K1KC 3ULUH 5CHNB 3P2VA 1G0DA 3QYQA 5LG6A 1GCYA 1R1CA 3C87A 4U0QB 4X6CB 4P5MA 3V9EA 3WFEH 1CX9A 3QQ1A 1T2QL 3VM5A 4Z0BH 1HJUA 4UTTC 2B59B 4D9RD 3C3NA 1R3JA 3W53A 4M1DL 3BV4A 3PRZA 1UR8A 4TTUA 1PFCA 3ABZA 4WI6A 2JKEA 1D6EA 1VACB 5JHBA 3IJHA 1YLVA 4QRPD 3R5EA 4Q4RA 2V67A 1T6WA 4MVBC 2PD5A 3T2NH 4DGIH 4UTMA 5I3JA 1V8EA 4HAFA 3ZLHA 4J3UA 1QWKA 2ALRA 2D73A 4NZRH 1SXZA 3SOTA 4DKEH 5JHDB 1SZFA 2A4EA 2WLYA 2I57A 5I0XA 4MQXC 5TE4H 3TIEB 4JB9H 4PMVA 3WD3A 5AY7A 2O5ZL 5C54A 2R0KL 3D3AA 1TVBA 3CUGA 4OLWL 2PWHA 3ZJAA 2DW6A 1MEIA 3NOIA 3CYVA 5AC8A 2V5KA 3RNQA 4A6YH 4IGHA 4NRRA 1WV7T 4US5D 4POUB 1UZ1A 3RR4A 1WIPA 2DLHA 3C60B 3GQFA 4NQDA 4NKDB 4P9HH 4P9HC 4D0DB 1I9CB 5A6BA 4D3CL 3GIZL 2X7LA 1JCNA 3UBXG 1FZOA 5BV7H 1BF8A 2REQB 3PWPA 3SFKA 3G2GA 4I2XE 4GI6A 4MQ7B 1WG3A 1J9QA 4MY8A 5I9QC 4RFEB 3W0KA 3W83A 4PB3A 4Y9MA 1UEYA 3C5JA 1MNZA 1C8YA 2W79A 4AZ6A 3UYCA 1XLKA 3N6JA 4N2KA 4C6KA 1YNLL 2A74A 4G7YL 1V4YA 4JOMA 4K71C 4PJ8A 4YSUA 2FIRT 4NFBA 2X89D 3CN1A 1ORQB 2V3EA 1CL7H 3O15A 1R3WA 4L1WA 2J57A 2PKDA 4Y4FA 1XH2A 1FAKT 3T0EE 3M16A 1W8NA 2BJML 2BY1A 2X89A 1UUSA 3MCNA 1AG0A 1RJYB 4U4MA 2EDFA 4UQ2A 4DP2X 2WUCL 5TE6L 3R2GA 3OYXA 2H4EA 1EJOL 1ZSXA 2EJ1A 4AEFA 3IIPA 3Q6FB 3OSVA 1Q9OB 4NT0A 1M7IB 1WAAA 2X4PB 3BW9A 1TTUA 5CEZH 4KBXA 3XINA 3QCTL 2Z4QB 2Z64C 2DVUA 4QAMB 5BZXA 3UAJC 4NAEB 4PMDA 4YEEA 3OAZK 5D1XD 3W5NA 1U8CB 4GFSA 3QNXB 2ORBH 4FNLL 1D9EA 4KJWD 3QA3A 5A1AA 1GTEA 3MFFA 3BP7A 5DT1H 2XXCB 3QIUD 4R4BB 4DERA 4P57A 3QC0A 5TAOA 2JGYA 1D5IH 5E5MB 1QEWB 1I2PA 3TA3C 1C08B 1YW1A 2RQ8A 1CLCA 4AQ1C 3GFYA 3MSPA 3TQPA 2K8QA 1I8JA 3RUGF 4QE5A 4L9LA 3CHVA 1IC1A 4LHUB 5BXFA 3EJQA 5ES4B 2ON3A 4MNLA 4YBHA 3FCUB 4NQDB 5EZJA 3VW3H 3BGGA 1HHGB 1SN0A 1V5JA 1QW9A 1U3JA 1JMXA 4JIIX 1MFCH 4Q6IC 2YA1A 4BFIB 5D9NA 3FB8B 2NCEA 3LMJH 4DP0X 3CJPA 2WUBH 3GR7A 5L88H 2A73A 1CCWB 2PTTB 3GK8H 3G0XA 1SM3L 4ZW3A 4O58H 5LQBH 1ASQA 3PNWA 4WK2B 2AOSA 2P8PA 1ORQA 4GRLB 3FOLB 5FCUH 4E41E 3A5FA 1Z5LB 3IJLA 3TW9A 1HHHB 3I85A 1HL8A 5BZDA 3RX3A 3NCWA 4YSPA 3UACA 3ZL1A 5HGHB 1I1XA 4R5EA 4WDXA 5TQLA 1OSPH 4KK8D 4UQ2B 3VRJB 2VZUA 5AW0B 4FPSA 3SE8L 5KJRH 4EPBC 4CDHA 2NVAA 1A21A 1KXVC 3ECUA 1IQWL 2AANA 4K8EA 3WN5C 1CZ8H 2G75A 1MQKH 2X70A 3E0GA 3KDMB 4WXZA 1JGLL 4NLHA 4Q8BA 3AY2A 2G3XA 3FZUC 3L6FB 3S3GA 5LXXA 4AC1X 3IJ9A 5LN8A 1ED3B 3KPQA 4LQFL 5M95B 4HFUL 2OMUA 4ETQB 1Q2SA 3UZQA 1IIIA 3K8MA 5KSAB 4A2SA 3LNDA 1GAFH 3S35H 3BLEA 3VI2A 2GUYA 2OJ1A 4ETYA 4P2RB 4MNGB 3KTCA 4CEXC 4DLMA 1WK0A 5BRZE 1FZKB 1CFSB 3RAJH 5IFTA 1J12A 1X9LA 5HHME 2YPVH 3IUIA 3KPNA 3JZYA 1PE1A 1HOCB 3CFEB 2R2EB 4PLOB 1TTIA 2HX7A 3D30A 1W3TA 1XF0A 2KYIA 4U2YA 1TZHB 2HVOA 3TYFB 3N12A 3VFLA 1HQ4A 1ROWA 3T0TA 1IT7A 5EDXA 1RPUA 5B4MC 4I9WD 1X98A 3W57A 4LDCA 1SJCA 1YEKH 3R7RA 4ZQOA 2HSIA 2YKLH 1F90H 4LIQH 2C4FT 2G3ZA 2ICWI 1XXFC 3BH9B 3CH8A 2V30A 1VGEL 4AKPA 1A7PH 1AH1A 3EH5B 1IQDA 2FGWL 2BSSB 4GRMB 5B38B 2BS71 4WEBL 1LL1A 4KESA 3HVDA 3RB7A 4H8VA 3KYAA 4K3DL 5E9DA 3W0WE 2WLKA 2W63A 1S9YA 4NBYB 1R5IB 1WOBA 2A21A 3HHRB 4BQCA 1RSYA 4Y5VC 3AXXA 4JPGA 2DZEA 4G3YL 4PJGA 1EOKA 4Z7QF 4EXAA 1GVFA 3LI0A 4LCQA 1O4UA 4XMVA 2GIYA 4JHZA 1ZVSB 3L4XA 2VX4A 4DYJA 3IPEA 4WI3A 1ZAHA 2PURA 3VC6A 3FYOA 3VFCA 3VKKA 2NTFA 2VM3A 4NNPL 4MMZB 3QJZA 4GB9A 3ZKXC 4DW2L 3L3DA 4XOEA 3RVVC 3MO1A 2DEPA 5FYKL 3US1A 2XPZA 3KDOA 3IXAB 3QZPA 4D0BB 3WLMA 1KYAA 2ZSVB 5FJPA 2MANA 1OSEA 1X5LA 5HYIA 4L3ED 4ZZ9A 4TUJA 4FQXD 4MRBA 5D1XB 1Q85A 4C6EA 4AZHA 3AQZA 3MV8A 2HWZH 3WLRA 1PFOA 4JG1H 1HCYA 4JY5L 4MDJA 5F1SA 3F7QA 3IJYA 1NCBL 4JR9H 3KZ8A 1YNPA 5G4WA 1V3MA 2W67A 1U8LB 1MVUA 1GHFL 2A0LC 1GJUA 3KGRA 4M48H 1H62A 3KS6A 4H7ZA 6PTDA 2JEQA 4ELME 4JUSA 1ZMYA 3HZKB 1IQ8A 5BMWA 3OGOE 3TQVA 4YX2L 3JQOB 2TSBA 1XSJA 1U4FA 2J8UA 3BGAA 4GMSH 5HJGA 4EZJA 4DJED 5C0EA 3N06B 2WNGA 4RMTA 4Y4KA 3L9RB 1QK0A 3UD6A 2H8PA 3RX8A 2AQOA 4BRVA 1LOQA 3QFGA 2GK1A 3F85A 2YBUA 3ID7A 3O3RA 2R56L 4MD0B 4ES4A 3VGAB 3CC1A 1R2RA 5FO9A 4B4HA 3KFTA 3PTKA 3MJ9L 2PUQT 2Y06L 3M6DA 5JHAA 4LANA 3ZE0B 1AQHA 3GU2A 4HUCA 3AC0A 4V2BA 1KXTA 1VFTA 4QDWA 2BS9A 1H9VA 2DWTA 3CIXA 1FNHA 4UT6H 5DUBB 1IAMA 7CGTA 5IMOB 3DMMD 1LO2H 1L0XA 4A35A 2UY7B 2JELH 5I9QB 2O93L 3M4HA 4LB3A 2WYZA 4BQ5A 5F9OL 1V3KA 4M1CD 5CMAA 4BSJA 5MEOB 4NZ3A 2WKJA 1E67A 3FYPA 2R1YB 4JL1A 1JZ8A 3WD0A 3LPGA 4X6BB 2WSRA 1SRDA 1XF4B 2VRKA 4YZWA 5TH2A 1J8SA 2VE6B 4PHXA 1QFPA 1GIGH 4K07A 3BVTA 4KNUA 5IMKA 3ZMRA 4OCXL 1M1SA 4Z7OE 2RJMA 3VNJA 1D2OA 1VPXA 5ABHA 4CCEA 2XZ7A 3OZKA 2GSJA 2BFVH 1BQLL 5HD8C 3DI1A 1WE5A 2NOYA 4UTWC 2J2ZB 3FT2B 5T5FH 2E9MA 1DQLH 1RK1A 3EF7A 4FADA 1RUQL 4S0SD 3VE7A 4HSNA 4DGUA 1XSKA 1HILB 3S35X 1FWEC 5DJ0A 1K03A 3LAFA 3RR1A 3W71A 4R3SB 2FMNA 3ANVA 2YXWA 4Z7UE 2Z91A 3M0LA 4XAKD 5CLYA 2D2HA 3M5VA 1ECYA 4PS4H 1SOXA 1VBJA 4Y4KB 3U6RB 2R94A 4DP5X 3DGRA 2DWDA 4TV6A 1A4LA 3LOWA 2YD8A 3SGJA 1N12A 4GOSA 4CADB 2AKRB 3AG2B 3STZB 5I76B 4N7QA 2PC4A 1M56B 3N50A 4JFHD 4W87A 5I73C 5G1MA 1JZGA 1N3NB 1Q0XH 2C71A 2YZ5A 1FFPB 3B0UX 4RAUA 4I7ZC 3P0YH 5HNRA 4JRWA 2CO6A 4JPVH 3ULSB 1BTCA 1KRMA 3LHTA 5DMNA 3A6OA 1MYRA 5T91A 5T33L 1EZLA 1NCDH 3KYKH 3W9EB 3AALA 2VR8A 1Q7MA 5I30H 4HX1A 4XRCA 3IFOB 4JAMB 1NH6A 4MMXA 1OFOA 4PJDF 1R3IH 3S5LG 3UZVA 1P4UA 2E68A 4J2MA 4ZMPA 4F40A 5FEWA 3R7MA 1PZ5A 3UYIA 1TQBC 3RUBL 1SMDA 3MREB 5LIXX 3QVAA 1VHCA 4LF2A 1Q0EA 3QXVA 3C8HA 3H7BA 2QDHA 2OMZA 5D7LD 5KN5A 1XIWD 3GBLA 4MJHA 2CBIA 2NY4C 2P42B 4AQAB 5REQA 3K74B 4MDIA 2F2HA 2CK0L 4NX5A 2FO1A 2YPKB 2ZQKA 1QBLL 1ITUA 1JCJA 4OGYH 2ZP8A 2E56A 1HCVA 5ABZA 4WWOA 1W8EA 4P9HL 5I6KA 3LH9A 1R9YA 4JDTL 3ECQA 4M4RA 5DEGA 3UZEC 3PZUA 4LWWA 1ICPA 1BLIA 4QITA 4KPHH 1TITA 3HIZA 3WEMA 4ORGA 2EG8A 1QOPA 4XAWL 3ULUF 3L4CA 2VN6A 4KERA 1QVOA 2J1ZA 2CXEA 5I79A 1HOEA 4KC3B 3G6JB 1FDJA 2JI2A 1E4NA 1D5XA 1MY5A 2V7NA 4YVNA 1FORL 1JGUL 4OKDA 3U6RA 3VOJA 1FI8C 2WXOA 3V0TA 2DI9A 2HZHA 3MSRA 3KYOB 1ZJAA 1XLBA 4MHHG 4BZ1L 2ICES 3QNYA 2FRGP 4MCYA 4PUKA 1IBDA 4OGQC 1JVOA 3B8TA 1YRKA 1DZBA 4P2QD 3ARPA 4HCLA 9XIMA 3C6CA 1MCOH 1NBZB 3O11A 4EWJA 1CURA 4PJIF 3VFNB 4PN6A 4AGLA 1ET5A 5HJBA 2IAMC 3RPMA 3A13A 5JIWA 4XMPL 3N9RA 2Z1WA 5BYWA 2V5TA 2J71A 5FYJD 3EBIA 3W7GA 2W91A 3LV3A 1HKIA 4FQHA 2Z1XA 2I5GA 2V5YA 3WH7A 2UZXA 4OB5L 2PPAA 4UM9D 4F7KA 1E6RA 4WWKA 4XCNB 1IIHA 4O0ZA 3BSMA 3WFLA 2BHUA 4BGDA 1HKKA 3QIBB 1JZ4A 4UTBH 5AKQA 1U8JA 3PWNB 4OBRA 1BIIB 1EIXA 3MKCA 4PTDA 1ZWIB 1K7EA 3OO2A 5DCEA 1K5NB 2GFBB 4J4PC 3AUVA 1HFBA 5LAPA 4M6AA 1AD1A 2UYLB 3KHDA 5TD4A 5C2XA 1PBGA 4IBQA 2P5WA 4D71A 3C5ZB 2Y1HA 5EN3A 3IFPA 4PV1C 1PL3A 3D2TA 3TBYB 5BNXD 5I6OA 4C6QA 1Y5XA 1TRIA 3DGDA 4KZ0A 1X5YA 4GS7B 3WU1A 2XETA 1L6SA 2QKIB 3MXVL 3QJVB 3TA3A 3D85A 5G5IA 3F7YA 3UTTE 3W00A 3SQOH 1DQML 3SCRA 2YHGA 4FI7A 1C9DA 2E5BA 4YLCA 3FK3A 2J7CA 3ZKND 4F8LA 4EACA 5IFPA 1F5ZA 2YPLA 2BBFA 5JPMB 2QW5A 3E49A 1I7UB 3D12B 4P49A 1IO4C 3EB3A 5ADOH 1HT6A 3IDMB 1UCWA 1TEYA 3TT1H 3A4WA 5BWFA 1QHPA 1HI6B 3B0VC 1QSZA 4YMPA 2I5QA 5HHQA 1UVQA 3NIGF 4JN6A 2VUYA 5I8CB 4YSTA 3MJ8B 2Z29A 4M6NL 5LHFA 2L7UA 2DSWA 2X8RA 4Y5XC 4JY9A 1NUFA 2W80C 5LGHH 4AJWA 1ZVYA 4W88A 2KX9A 2KKQA 2WAGA 3FUHA 1EV2E 3S97C 2PCEA 3GC2A 3LHZA 5GGRA 4B60A 4H9TA 2R4RL 3H12A 3SW6A 3SCOA 2QSTA 4HJ0C 5HHPB 5AC4A 1N26A 5B8CB 4S3AA 2XINA 4QNEA 5DHVB 5DJ6A 1C5BH 4B2DD 1J8RA 3OLEA 3GQYA 2WZ5A 1AFSA 3N6HA 4RWHA 4LLYB 1T0MB 3HI5H 1IGML 1KJ2H 1MJ7L 2JSFA 4CQ9A 2A4AA 3TJEH 1HN1A 4E9XA 3AZUA 3X3GH 5A2JH 4DRSA 4PRID 3AU6A 1M3IA 3M45A 3NM3A 2WSPA 2A3CA 1HDMB 4F9PC 1KM0A 1F1DA 2XTJD 4H8PA 1ZHKB 3C08H 2WP3O 4JFYB 4RFEA 1TPDA 2VZSA 1DDHB 3IACA 1US3A 3UF9A 1WHPA 1KEGL 32C2B 4ENZA 2VCBA 1WIOA 1G4RA 2D7PA 2HN7A 2OSWA 2QT6A 1JNJA 4ICMA 2IXUA 1HGYA 4HYTB 4IGBD 5AW1B 2WZEA 1XCXA 3GNPA 2J7EA 5AZUA 1LG2A 1OT4A 2J20A 2VR6A 4WFGE 1P1ZA 2WXDM 2W9EL 2RCSH 2L7EA 5JIPA 4KEMA 5C2GA 5E5LA 3SQBA 1XF3A 2VERN 4FA7B 3GSMA 2QDGA 1PKMA 2JJSC 4XBPB 1HS6A 1T5KA 2ALAA 4ODSH 3UJTL 4ML9A 2WCAA 4XQ6A 2WMPB 4OZHE 1MCWW 4AMWA 3NQKA 2BOGX 1Y8BA 5DFWH 3HPXA 4F8XA 4FCHA 3VIPA 1FWBC 4FQ2L 3MV9E 1E28B 1QSFD 4U3SA 3BAIA 3U4KA 4PW4A 4K68A 4NY2A 5D55A 4HIIA 4XNMA 5C7VA 5FGBA 4UAOC 1AGBA 2D22A 2ZZUT 3DOIA 2UZ9A 3IRZA 4NKOA 4A29A 1Q9LA 4D9PA 4BEIA 1UA6L 4L4VE 4PJFF 1AIZA 4IU2A 3MYJA 3THUA 1YN6B 1YVLA 4LLYA 5D9PA 3FW6A 4PRAA 2FD6H 1OP4A 4HGKC 1E2VA 4LHUA 4A2HA 1N2VA 3O0FA 1BAGA 3LIZA 7XIMA 4MXWL 3L3OC 3ZBMA 4J4KA 2OMTB 2VDKB 4MAYD 4CJ0A 4F48A 3B97A 2DQGL 3Q3GB 3BAJA 3ZMEA 1OWQA 4JTRA 4KRTA 1SM3H 3BXNB 1SFSA 3MCMA 4QRTA 1VEMA 1D8CA 1SU5A 2GGHA 1INQB 4TQHA 5AZ1A 1TQBB 2ATKA 3SY0A 3UTSB 2NY1C 2VR7A 1FH7A 4YFDB 4GUPB 5FA3B 1DCLA 3QFJA 4M7KH 4R90H 4E42A 3S37L 4HDIA 1GUVA 4Y7MA 2UY3A 3EKLA 2IQAA 3VGHA 5F7NC 1QOKA 2VDNB 4MCZA 5D96B 3P67A 4M80A 1S7QB 2XN2A 4NZJA 4HIJB 3SDAC 4LPVA 2MMXA 2CNYA 4JM4L 1L3NA 4QY8A 1PLBA 4AQ8C 4JX5A 4TYUA 2PYEB 3DJRA 3FH8A 2LLEA 3PF3A 1UXWA 4EXQA 2JK2A 4P2QE 2BNQE 4BUGA 3MUXA 1ITCA 1ONQA 4IRJA 1ECZA 2FO4A 4F92B 5IEKA 3L6FA 1XX1A 4K1WA 1JNLH 1LO2L 1F97A 4LSVL 2I60L 4PJGE 1WGOA 5F1OB 3SKOA 4F3FA 4PY7A 1OINA 1E30A 4DKAA 3CNYA 2OJPA 4FEIA 1OQFA 3S5OA 1XR8A 5D1QB 5D4QA 5BOJA 2E6FA 2ZYSA 2CDFA 5LXEA 4XP1H 4LKCA 3O2DL 2Q3RA 4C6JA 1JEZA 2UXGA 4S1DD 4WXYA 3BUBA 1XB8A 3DTXB 3QZ6A 4F2BA 4A7SA 1AP2B 3MBWA 3CFCL 3DMMA 3URQA 1EHKB 4LL1A 4JIQA 2J8FA 5DZLA 2YL6A 3IVTA 3OB0H 4C57C 1JYNA 1X5JA 3H2FA 3K4ZA 4E9RA 2GT9A 1ZKAA 3MGAA 2YC1A 4YDZA 1A8JH 4Y9GA 3CU2A 3M7OA 4KT2A 3T8LA 4DPQA 2V5RA 1ZANH 2B20A 5D4IA 3E6EA 2DJMA 3ALPA 1MO0A 2H32A 2PP9A 4JDTH 3CFDA 2HFGL 2RMNA 4QJ4B 4RCAA 1FNLA 3ZZLA 1DHPA 4XMWA 1EGVA 5F2MA 4EVNB 3UR7A 1HHIA 5BU6A 1JPTH 5J9PA 3M17B 1UA3A 4HLZG 3DEQA 1NGQH 4BKTC 4K3DH 5HVFB 1U8MA 4MZYA 4K9EC 3MOBH 1DFBL 4QQ3A 3VGEA 2NQJA 25C8L 3NVQA 4IDJL 2VMFA 1HJCA 2VXNA 5DQJB 3P93A 5TE7L 4YEFA 2DYPA 2O9OA 5IHUH 5IW1A 4MCZB 4M00A 3DV6A 1NQBA 1DOSA 2PI6A 3AUJA 1A6TA 4RGNE 4BHUI 4F2UA 5IROC 4JQXA 4HIXL 4JCLA 5FK9B 1KGXA 4N5EC 5C0CB 3OGRA 4QNWA 5FDWB 1W56A 4AU0A 2VSCA 4DEUA 3LKRB 2FLIA 5DQDH 1B30A 4A21A 1MNSA 3RNKA 4IRJB 1K3UA 1OHQA 3PAYA 3STCA 4FX8A 1AS7A 4E2VA 1YLBB 5IR1A 3HS9A 3K6DA 2WBGA 3IJQA 1RQ5A 4F15C 4PBXA 1UWYA 1QFWI 3O8XC 4ONFL 2FYMA 3B40A 4HK7A 3U57A 4GG6A 4TUJB 5D1XA 4JX4A 3ZXWA 3UEQA 3HA0A 1KTDA 2OTWA 2VM9A 2A4ZA 4NAQA 3EAUA 4ZTOH 2BHZA 3PJTA 1I85A 1H41A 2VLME 1A5LC 1OARL 4GPVA 3RZCB 1U8QB 3HC2A 2J21A 4P5TA 2OWWA 1DQWA 5E7BA 4DAGH 1O7VA 3OJDB 1JUEA 5CILH 2X3CA 1H6FA 1K5WA 4AC7C 4C83B 5FO8B 2X44D 3NEVA 2MNUA 1LF1A 3ZFHA 2FSEB 1ZA6B 4FI8A 1OG6A 4KWUA 4FERA 5D5ME 4JTHA 4ODXA 2H32B 4OF5A 5ESQB 2JB5L 1K7XA 4MXVE 3MDJA 2YKKA 4PWKA 5IG7B 1UFGA 4ZX4A 1Y07A 4U1GB 1XUUA 2V7HB 5CEYB 1H7WA 3WE1A 4B5EA 3N5AA 3EX2A 4OZIF 1EO8H 2E8YA 1Z3NA 1N19A 1NJJA 3LQMA 2W5PA 4QOKE 5GGUA 4GUOA 3TESA 1ECEA 3A6BH 4YFEA 1E9OB 1AL7A 3JRKA 3QUYB 4K5LA 3APNA 1C7SA 5L8JB 4UNLA 3VDHA 3GMMA 3VIMA 3VSUA 3O07A 1OD9A 3MLXL 3DHFA 3P80A 1NMAL 3BAXA 5GSRB 4EUPB 3ET9F 4ZZFA 2E9LA 1SN5A 2IOOA 3Q9QA 4U1HB 3DERA 3IMSA 3LZFL 2ZIDA 3DX5A 3SUUA 2VDMB 3MVIA 4X60A 4CVUA 2CIKA 5K93A 4QHRA 1XIEA 3FJTA 4LCWD 3ZGHA 2ESVD 4H0HB 5C0AE 1ISXA 1CE1H 1RZ8B 1WKEA 2UZYB 2ITCB 5CEWA 2CWRA 4X7DC 2OSXA 4U1KB 1EFXB 1XF4A 2YAEA 4ENED 5C09B 3W2NA 4DF1A 3DIFA 3O6DA 5AYQA 2GJZB 3OR7B 2V9RA 5ICXB 4P2CG 1RHCA 3Q5YA 1BFNA 3QC6X 3OJ2C 5KAQF 2JV6A 4JFDA 3RTQC 4Y2DB 4G6KH 4UU9B 4ALAC 4RPQA 3H3PH 3F7LA 1SQMA 4EKJA 4LBEB 1NFPA 2PBGA 2W9DL 4YDVB 2DQCL 2JCCE 4BFRA 4LHUD 1MCSA 4TN9A 3PZQA 4L80A 1MCQA 3UERA 2RHGA 3ITOA 4JEJA 1MCLA 5B7ZA 5CCGE 1RBAA 5DZAA 1H49A 3ARSA 1TX0A 3VYNA 3GWJA 1SUHA 1TR7A 3J27A 3B9NA 3TF4A 3TH6A 1TCMA 5IM7A 5B1JC 4AZ7A 4OLUH 1ZLVK 4WO4C 2XVNA 5DJDA 3QDJE 5E99L 4Z3HA 2ZVRA 4JTDA 3VFTB 3HCVB 4GG9A 3TV3H 3N40P 4ZX6A 2MPAH 5HP5A 5CJQH 3SGEI 2LVCA 1EBAA 2PN5A 4BQ8A 2V69A 3C52A 3CFIC 4HS3A 4QHUA 4ZMWA 3KTXA 4CAGA 1A6ZB 3BUTA 4UQ9A 5I0VA 5IOKA 3E1F1 2PCFA 4P4RB 4GY4A 1S46A 1HVQA 1UR0A 3R6IA 4K8HA 4MY9A 1B0GA 5GISH 3KH4A 2IXVA 4OCRL 3GNDA 5HUOA 2R59A 3GHRA 4WHDA 3UAFA 4KI5F 1AGDB 1L6FA 4XRCB 3DA0A 5LBSL 3LS4H 3EGSA 3VFWB 1YYMH 1Q9WA 3OBKA 4LOVA 3GMPA 3GO2A 2YRZA 4ZSOA 2OGYA 4JHWL 1ONEA 1IM9D 2JALA 3OMNB 2CZVA 2Z26A 3WMLA 4JPWL 3CDYA 3L54A 3AHXA 3MV9D 2VGGA 3WF3A 3BESR 5E0KA 4NJIA 1FFRA 4AQZA 4AV0A 3STPA 3TA6A 3K6SB 1U2CA 5L7XH 2OXHB 3ARED 1AXSB 2GTZA 1KJMB 1T5AA 1ED3A 1TJ2A 1YKWA 1UGKA 1OFDA 3P3BA 1G7MB 5J13C 1YMYA 4FKHA 4JM2B 1W37A 4HUKB 1KMGA 1GEHA 1EWDA 3V0UA 1H5BB 2IDFA 4Q52A 1IIGA 1CDUA 2TAAA 3BAWA 4HIQA 4MNGA 1ZRUA 1HHKB 5EU6E 4FX6M 5D2TA 3D0VA 2QADC 3FFOA 4QLRA 4WKXA 1FPTL 3WS3A 2CR3A 2FB3A 1JIBA 4YPGA 5I5MA 3EG9A 1Z5LA 2OZTA 2GGEA 3QJXA 1JRHL 1G9ML 3KXFB 3RL2A 4BKLA 1M01A 1X7QA 4EN2A 1A9BB 4BCZA 1G4SA 2RUSA 4YDJA 4DO4A 3UYRL 3LK6A 1NSJA 3H6JA 5A8PA 1IAOB 1L9TA 3ARFD 1XEDA 1J8HB 2CO7A 2WOYA 2AK4D 3CFJA 2HLEB 1X7SA 2VGFA 2D7OA 2YD3A 4KNTA 3BLFA 1E4WH 1L0YA 3K91A 3MLRH 2F08A 4NENA 4YH6A 5E1IA 1SM9A 2A3LA 2GWGA 4IMFA 3GXPA 4O0QA 1N6QL 2IMNA 5HPMB 4IIDA 2NNAA 1MCOL 4WKFA 3EJJX 4A7TA 5CJOL 5HVHB 2PP1A 4OJFL 2DI8A 3GDCA 3RBGA 3T6WA 3QUXB 2FB2A 3GD1C 3CGTA 1UOZA 5CG0A 4J23A 2YPVA 4DYKA 1YSOA 4QRAA 1G6RH 2OR9L 3HBQA 4TNWF 5AW9B 1CE6B 2K1MA 2NUTB 2XZAH 43CAA 3QAQA 5I6MA 4DX3A 1UXSB 2CGYA 2C3ZA 3MU3A 1P4BL 2CZFA 1HNYA 4AZ8A 1BVKB 4UTIA 4F7TA 1A6AB 1R7AA 3HAEH 1HNGA 1ZS8B 4FQ2H 5FYJE 2XPYA 1UD6A 4KXCA 1K8IA 1CPUA 5EFIA 5J1AA 2VW4A 1QO3B 4K8RH 3T6ZA 2XDHA 3MPCA 3F01A 2RD0A 3ZN6A 3QRGL 4AL8H 1UACL 1V6UA 4AEHL 4Z1CA 3EKZA 1NLDH 4P9MH 5D71H 4E5XG 3Q7JA 1E6ZA 1LCOA 1SVDA 3F4CA 4OV9A 3QXUA 3SJVE 1PHWA 1SVZA 3VQ2C 3M8OH 2MSPA 1OK0A 2QR0B 1SHWA 2ZYIA 3PPEA 1RHHB 2ROXA 5B39G 2ZA1A 3HTWA 5LIWX 2EYSA 2WQRA 2E6AA 3AXLB 4FQJL 4RMSA 4RFNB 3EX1A 4WJ5A 1OAKL 4YPGB 5T1DH 4Q32A 5C5YA 3IGUA 1PLGL 3J2PA 5GS1C 3WFDH 1NEZG 2GI0A 1KT2B 2FEDC 3CDFA 1WWBX 2CK2A 4JFQA 4R2GB 1EEZA 4HPOL 3VXQA 3C0JA 3SURA 2Z93B 4QSFA 2Y69B 5CIPH 4DKEL 4QCIA 1TFVA 3DXAA 1W9BM 1A1NA 1FNEB 4OD2A 4URIA 2NZ9C 3ME3A 1YHTA 2Q20A 3GJFK 4KHTL 5D93C 3MV7B 4OLZL 2VDOB 4G7RB 4ZYKA 2NNAB 5FW7A 2XG4B 1C16B 2WO3B 3AISA 5K3VA 2FTPA 4XBEL 3G6DL 4XB7A 2YPIA 5FC9A 5K9KB 2Q02A 1A9EB 5GZND 1RP8A 2F5AH 3L23A 1FZMB 4G7VH 4NO2B 3UVIA 4UTKA 1A6UH 3P4NB 1A0QL 3T2LA 3V0SA 4FZ8L 4NIRA 4E4PA 1S2VA 2EXYC 5DO8A 1I45A 4A68A 1BVKA 2I9LB 4JFUA 4W9ZA 5EIIG 4IUGA 1BGXL 3SDDB 1XBZA 2DT0A 4WUKH 1KCLA 3UAJD 2P47B 4YCOA 3AIQA 5CP7A 3QMSA 1GTFA 4A3QA 1GVEA 4ZFZA 3CMFA 4MNQA 4U1GC 4XP1L 5KSBB 3SCVA 1I1RA 1P0KA 2VABA 3ZTNH 2F7QA 2OELA 3SSJA 2Z6FA 1JNNL 3CAWA 5JR1L 1VHPA 1E9PB 4XPFH 3DAQA 3V4PA 3G1AA 3W1PA 5BRBA 1PNDA 5IBXC 2V6HA 3N4AA 1DYZA 4U7KA 3TEYA 4HS6B 2WK2A 5KAQG 4DFIA 2JXMA 4N0RA 2Q3OA 1IVLA 4EKXA 1EVUA 3GSNL 4ZB2A 3BW3A 1BAFL 1WS7A 2D4DA 3G8EA 5AOIA 2GCYA 1G43A 1TQXA 3KVLA 2HN7B 2HFGH 3WMQA 4HFWB 1Q3NA 1OOWA 3M07A 5EUOB 4YU1A 4GMEA 3NXFA 3MLWL 3LGDA 4O53A 2EDKA 2PXYC 2WLMA 2ZNWA 4ZMVA 2DT2A 4JIPA 3RDKA 3LTVA 3RURA 2H6PA 3FNKA 5E2UH 1R24B 5ESAB 2JB5H 4CVZB 1X7IA 3PP4L 4N42A 4UIKL 1NAML 3RGVD 2X6AA 5FJRA 5AWNH 4MHBA 4G8GE 4GW5A 3GD6A 1WGVA 4F2ME 2CUAA 1LJMA 3OAWA 4N9BA 2RH0A 4XBPA 3W2DL 2C7UB 3PYCA 5CMAB 3P82A 3EX6A 3IGAB 4QG9A 4Q9CA 5DZ9A 3ZE1E 5I8EB 4DSYA 1EXUB 4E5XA 4LLAA 2EUWA 3EOSA 4ZD3H 3B8WA 1KQZA 2BK8A 2PO6C 4AUUA 1JXGA 2OZ4A 2VZ3A 3UPCA 5C7XL 2CO6B 1FCBA 3KBNA 4PMNA 1IU1A 1KG0A 2K78A 4ICXA 2WXGA 4S1DC 5I03A 4HHPA 1BLNA 2WBKA 4ZO9A 3KZSA 1R3LB 2IANA 4MA7H 3KPRD 5EOTA 4QE4A 1Q9LB 1TO3A 3RWDA 4GFXA 1TFHA 3WNLA 1CCZA 2MQCA 1UOLA 4PTTA 3IRPX 3MRJA 3E6FA 4X7EC 4ERIA 1QFUL 1VGEH 3CDZA 3RIKA 3UTQA 3A22A 4CD4A 1CB4A 5I3HA 1ASOA 2IQTA 2DIBA 1DUYA 1MLCB 4M03A 4GCAA 1O66A 4AWSA 3NPWA 3WQGA 3UA4A 5J6GB 4FOJA 3TWBA 3KWXA 2DWDB 4FAMA 1KGIA 3O41A 3P11L 2OAAA 1J5CA 3W7RA 2V3GA 1ODUA 1X6LA 1FV1A 3DROA 5CILL 4G6MH 3VNIA 4FQQB 2IC2A 1FO0H 3F58L 3QO1A 4RZKA 1HP4A 1T1ZA 1AVAA 3HZYB 2VFGA 3ULSA 3IARA 2ZICA 1WLHA 5D72L 1PYFA 3DYOA 3HB9A 2OSYA 4PJ5B 1FG9C 3L3JB 3IFOA 1ND0A 4O02B 2B7DT 3GYRA 4F8QA 4TMBA 3NFNB 2XWJB 4ICNA 2QELA 3TO4C 3OQ8A 4G6JL 2WXFA 5EG6C 2L7QA 5JBEA 3BDYH 5C07D 3C56A 1QRQA 3KAOA 3MUCA 5LDUA 1H51A 3U0PA 3IEAA 1UXWB 1CXLA 3OZ9H 1PSKL 4QRPA 2V17H 3O2LA 5PAZA 1BXAA 4Y5YB 1F05A 4BCYA 4WI0A 4P8UA 3CFUA 5GGTA 4MCYB 3AO0A 1P4LB 4HBCH 4N0YH 2YGQA 5LBSA 1T0OA 2FDMA 3DUSA 1ADQA 4HK6A 3TN0C 1HESA 1LMIA 2JIXD 3BIKA 2R6OA 4HK5A 4P2OA 3NFPB 3O6KH 3BVWA 4OGAC 5DWPA 3G0SA 3B1UA 2CJSA 3RY6C 3LV3B 4Y8AA 5HBFA 4LKCB 2FIKA 2Y36H 3DO7A 2OMYA 4KCWA 4PTTB 3RX5A 1MN4A 4E68A 1KTJA 4NQVB 3ZTJG 1Y5VA 1LE9A 2P7TB 3DTXA 3FL7A 1J1OL 3FU7A 4CC4C 5C0IA 4R4NC 1TETH 3IDJB 3GEFA 4K5MA 4O9HH 3CLEH 1QVOB 35C8L 3P3YA 4NLAA 3QCTH 3PZIA 5FF0A 4UCFA 1INDH 4OWGA 4ZXOA 4KIRA 4W93A 1SLXA 4ODHL 1OAUH 4XPHL 1K4CA 2EE0A 5E94A 4Z1PA 3C6SB 1CGSH 5CO1A 5CN2A 5ADPL 2VRQA 3KYOA 1OD0A 2XJ7A 1N59A 2G9HB 1SBBA 4MB3A 3ETBJ 4DVBA 2OZNA 4JFOB 1SJMA 4IQHA 1H7PA 4Y19A 1U3YA 2ARJA 1QLEH 3UMTA 4CKQA 2QJMA 1FPTH 1ME7A 2PR4H 2VLRB 2V4LA 1TMLA 3OBEA 2RACA 1JXJA 2E7FA 1HHJB 3E5PA 4UB9A 2WLJA 4P2RD 3GBNH 3X1GA 3UXLA 4G70B 1XCTB 4HU0A 4PREA 3LD8C 2CUHA 4DGWC 2FB4L 3VSVA 1GIGL 3QKZA 3QQ4B 1CQYA 2AQWA 4FQIH 3FGCB 1U8JB 3PWNA 1BYBA 2J9ZA 3NT0A 3S83A 4XZWA 2MNJB 4OIBA 4Q6IB 3MJ7B 1NPJA 4YSAA 3VXRE 1WFTA 2ZF9A 1UPMB 3RKDC 1CF1A 1P9MC 1PJWA 5GRVK 4PGLA 2A4CA 2P5WB 1HJQA 1I2RA 2ZZ6A 1DLFL 1LHZA 4NKDA 4HULB 3CPLB 4B9JA 1F6KA 1OYBA 2R29A 1XBXA 5EO1A 2V2XB 1IFHH 1XC6A 1ZBVA 3A3XA 4HHMA 4N8UA 1N8ZA 4ZBCA 5HYSB 3L12A 4D2JA 3S9DB 3BPLC 5GZOA 4GG6B 3OF6D 1NWRA 1U8CA 4NRSA 1I8KA 1KM1A 4S2BA 2AQSA 3QNXA 5D7IF 3SGDH 2PDMA 2B1HL 4OJDH 3D85B 5D70H 2AGKA 4HNNA 5CGYC 1TPXC 5SWQA 3SN0A 2N7SA 5EOCH 3GNRA 5JW4N 4LSQL 3C2AL 3EOAB 4WKHA 4O1AA 1FNSL 4V33A 4YVPA 2OEMA 1OAQL 4OZ4B 4FABL 3ZL4L 3WF2A 4XZNX 4AZGA 4IUOA 3RILA 4RGOH 3WYRA 4LVGA 1MRDH 2C19A 1RJYA 5EBLA 1HHGA 3UL4A 3UC0H 4JFOA 3WQFA 3OKEA 3N9SA 4EF3A 1P69B 2ZRYA 3N43F 3O6MH 5AN7A 5F70A 1CENA 2VWTA 1SUXA 1MCJA 2CKBB 3H42H 4AXWA 3PVFA 4ERAA 1E4KA 1TPEA 5D30A 5LHDA 3FRPA 3ITXA 5E8EB 4EE9A 3PWLB 2HWZL 2HDJA 1S2EA 5IROD 3VQ1C 4V28A 4R6UA 3BQ5A 1RD6A 4X9FA 3I50H 1NCIA 3MOQA 1XFBA 5E1AB 4FQLH 3RWJA 1V0MA 2Q8ZA 3SECA 1UR1A 1FH5L 5EORH 1C5DA 2BVOA 3NJXA 3EGDB 1B2WL 4RXGA 1KBIA 5C2CA 1P5UC 3FX4A 6XIAA 2F7PA 1LEKA 3OKLB 1SBSH 4JZJA 2XWTB 4IKLA 4LSBA 1UZ4A 1PZAA 4KMQA 3SB3A 1TTAA 2TRSA 4GHRA 1EZWA 2BXVA 5IUSA 4MOZA 3FH7A 2ZC1A 1EGJA 2X70B 2WJ5A 3DVNA 3EOLA 3FMGL 2J77A 3GHUA 1YTDA 2W07A 4QXUL 4H41A 4IFKA 4IL2A 1YY8B 1TRDA 4JQ4A 2VDQH 1MY7A 4HT1H 4UT7H 5C09A 2ICSA 4K3JH 3V4BA 3KYNA 4IXHA 5EBWB 3BLDA 4CSPA 1Q9KA 3PWGA 4RUBA 2VO5A 4PIRF 3ITVA 4WO4A 1KJ2A 2VFFA 3BISA 2VTFA 2PTTA 3ABRA 3OKNA 3WTYA 5BJTA 15C8H 2V6AA 3W7EA 4KFPA 4YS4A 3QPYA 2G95A 1B4LA 1FZKA 3VRIB 4LASH 3D05A 1E5NA 2Q87A 4NUJA 1NCDL 3KYKL 3O9WD 4K5PA 3PAVA 4N90D 2CHNA 1YEWA 3BGFC 3SKMA 2PO6B 2I9TB 1LTDA 1XF2A 3VRJA 3RFZC 3IMUA 3ZKXB 2Q01A 1CL7I 1TZHA 1SYVB 3JR2A 4DZHA 4A6GA 2GY7B 2XBZA 2PLKA 2WJEA 3FU6A 5IBUG 2QPSA 4YWGL 1KB5A 4WUUB 2QCCA 1TJ0A 4JCWA 43C9B 1VFUA 3B34A 3LN9A 3OMZA 5J04A 5D7SH 1L6ZA 4MSWA 1SHMA 1DSWA 1ASPA 4WHYH 3VXGA 3W2MA 2HZGA 1IQDB 2O6FA 3Q5OA 3RWJB 3ZDXE 2F53D 4AG4L 3QFJB 4E42B 4HDIB 1E3FA 4EIVA 4KKQA 4W9CC 3MCLL 2Z00A 1RZQA 1WJ3A 4XE0A 3TLRA 4ZMXA 3SY8A 3CCHB 4JFDE 5DJ8A 2J6WA 2PYED 4IKKA 1R8LA 3PV7A 3AHTA 4Y4FD 1UXLA 4LO9A 1XAUA 3HE7D 4PCKA 3S6CA 3ZE2F 1A5FH 2J9XA 2V2HA 1C1EH 3CHEA 3NQVA 1KB5H 3TH3T 3MJ9H 3VH8G 2Z25A 5DJCB 5FD0A 3LIUA 2BINA 1FKWA 3FN3A 4JZOB 2CPCA 1E0WA 4HP5A 4YO0B 3D18B 3V1HA 3SODB 5DZNA 2GGJA 2RDUA 3LCGA 3FB7A 2JKWA 3MRHB 1UH2A 3QULB 1D5ZB 1R0AL 1AJ2A 4CC0A 2C79A 3M86A 3M0HA 4OCSL 3NN8B 1B5TA 1KPVB 3BIAX 3I6TA 1UURA 4XI5D 5EEYA 2EKCA 1NFAA 3S1GA 1OABA 4TQEL 2JELL 1F45A 3NYKA 1F9CA 4X0KA 2KHAA 5IBXA 5LA2A 4RFOL 1J5HA 3VRIA 1SW3A 2BSSA 5B7EA 5B38A 4CW1B 3H0TA 4OUEA 3FT9A 3UYRH 4HBKA 3SCSA 4Z1DA 1MVUB 2I9TA 1FWGC 2BDNL 4HKBB 1UZ6F 3SD2A 3QORD 3A4FA 2D3NA 2TPSA 2IDCA 3ESUF 2MQGA 5HWJA 1G7LA 1XLGA 4AMCA 3LRGA 4Z5RB 1QMUA 2RFGA 4B0MM 1DO6A 5ICUA 1VJSA 3RPIA 1ZVSA 4UWQB 3PZGA 3PPCA 4P4KB 1EGZA 3WMSA 3SCNA 3W1XA 3FJLA 1GZQA 3LVEA 3JU2A 3NK4A 2APBA 4LARH 4H04A 2P44B 3HZVA 4NCC2 4O52A 2FL5B 4WVRA 2ADFL 3MO1B 4PJEB 3HHSB 4JRXD 1IGMH 1KJ2L 1KTKE 2F7IA 4UAHA 4CSZA 3DETC 1UG6A 2BY2A 4GIAA 3L21A 1WOAA