5TD4A

Starch binding sites on the human pancreatic alpha amylase d300n variant complexed with an octaose substrate.
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHNNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Evaluation of the Significance of Starch Surface Binding Sites on Human Pancreatic alpha-Amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2016-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5td4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5td4A01
2QMJA 3BUQA 3I3DA 1VENA 5AYBA 3WH9A 1KXVA 3BAYA 3HG3A 2WZEA 3SCRA 2ESCA 3FY1A 2OWWA 1CDGA 1CGVA 1U30A 1UKPA 5EB8A 3AHXA 2WKLA 3WNMA 1ZBWA 4UFHA 2CEQA 1W1YA 2W5FA 4S3KA 1NOUA 2CCRA 3VNZA 4H04A 3WD4A 3FHAA 3L2MA 5CSUA 1NH6A 3WQ5A 1CXKA 3VM7A 1RP8A 2XFRA 1BF2A 2DIEA 1E6SM 2QHAA 3VDBA 1KFWA 3VDCA 1E73M 1UD5A 1JIBA 7TAAA 1V03A 1FOBA 4WK9A 3AIBA 1PZ2A 2VRKA 1B30A 3OZPA 2JEPA 2F18A 1V3IA 1B2YA 5A2AA 1E55A 3THDA 2XVLA 2A3HA 4E2OA 2DGAA 4UOJA 3AI0A 1HXJA 1MQRA 1VBRA 4JKLA 4CGTA 3BAWA 3EJPA 4GKLA 3AIQA 3CGTA 3JUGA 1BFNA 3WN6A 3ZT5A 2EPOA 3HG4A 5ECUA 2BNJA 3N11A 3FAXA 2JIEA 3GXPA 5ABEA 4JAWA 2BHUA 4D6FA 4F66A 5A2BA 1WPCA 2G41A 3MSGA 2FHBA 5FD0A 2YKKA 2XSAA 4QLKA 3GH4A 4JZ5A 3U7VA 2WHLA 3WEMA 1XSJA 4A3HA 4FLOA 1X6LA 4JKKA 1E5JA 2CBIA 1OINA 4TOQA 5A69A 1TUXA 3NDYA 4W89A 4FNQA 2AOSA 2CKSA 1O7AA 5A1AA 2G3MA 1PX4A 2OYMA 3WL0A 1PS3A 2YL8A 2ZUNA 3AFBA 1HJVA 1W3LA 3DYMA 4GI6A 1VBUA 1E4MM 1M53A 1XD1A 2CIPA 4AD4A 2X1IA 4ZEPA 2ZOXA 5JBFA 3QHNA 3EYPA 3DX2A 1JI1A 3IJ8A 3UERA 1JNDA 4XZWA 2VC9A 1W1PA 1H09A 3AROA 3ARVA 3DDFA 4Z2JA 1XCWA 3ARRA 4AZIA 5GNZA 1J0HA 3VGBA 2UY3A 5I79A 1C8XA 4M1RA 4LQ1A 4PMXA 4CU8A 5FCZA 5LA0A 1US2A 1WCGA 2Z1SA 1HTYA 2F7OA 4FNUA 4D6HA 1JD9A 3OLDA 2FHFA 1OSEA 1P6WA 1SYTA 3PZNA 1OCQA 1XYFA 1E0VA 2ZUSA 4X9YA 3CLWA 3T2OA 4AIOA 2WBKA 3WF3A 1UWTA 5E6YA 3TV8A 3UCQA 2A3CA 3K46A 1E6XM 4OZOA 3W0KA 1ZJBA 3MU7A 3L4TA 1UA3A 2WC7A 4JFTA 4W7WA 3AZTA 3CTTA 4A4AA 3MUZ1 4YHEA 5CJ5A 4PTVA 3WKZA 1GONA 4CVUA 2ZICA 4LYPA 1JGIA 3SCVA 2XVPA 3CUGA 3QGVA 3BSGA 4FNTA 2Z1KA 1VAHA 4UZSA 1V02E 1AVAA 1RPKA 2BVDA 4DWSC 1VIWA 1GHSA 3CH9A 3LPOA 1ISXA 1TQTA 3VIFA 3K8MA 2VX5A 4GZJA 3WDIA 3VIIA 1V6XA 3N15A 1NQ6A 2VURA 2WMHA 2J7FA 1EQCA 5BRPA 1DTUA 3ARSA 2PWDA 1OGSA 5E70A 1V3LA 2D3NA 1AQMA 1ODUA 3BMWA 5A8NA 3AMGA 5D4YA 2O9OA 5IFTA 3N18A 3IAQA 1N82A 2J62A 1KTCA 4MJ2A 1QI2A 2O9TA 2D0GA 2G8ZA 4P7QA 1UASA 4CD8A 3DHPA 2QF8A 1HP5A 5CGTA 3FXYA 4IUGA 5AC5A 4P8UA 3LMYA 5CSYA 3NSNA 2C7FA 3IANA 4C7GA 4AMCA 1FH7A 3GXMA 1TE1A 3K4DA 5E6ZA 5I77A 2XWEA 3AMKA 4Z2KA 3BVVA 1UR1A 4FF5A 1W91A 1QVBA 5JBEA 1G1YA 3GBDA 3UG5A 4QAWA 3WDQA 4LYQA 4ACZA 4FLRA 2OSYA 3HMCA 1QW9A 2C0HA 2GK1B 3VMPA 1GJUA 1UZ4A 1XYZA 3AYRA 4HU0A 1PZ3A 3CMGA 4BQ5A 1UHVA 5M17A 1KCLA 3MO4A 5BXRA 5M5DA 4FLQA 1E71M 1E56A 4AZ6A 3AOFA 4AZ5A 2FE0A 1E5NA 2YA2A 3IJ7A 3WSUA 1AQ0A 2WMJA 1E0WA 4HU8A 2BVTA 2CETA 2Y5EA 1D2KA 2WCGA 3ARZA 4RE3A 1UYQA 4P7OA 4PRWA 3EMZA 3IK2A 2A3EA 5A8PA 3CZ8A 1B3YA 2DPEA 1HJQA 2WHKA 3VD5A 1TFVA 1WDRA 4D6EA 2ZX8A 3VMOA 4UOQA 1XH2A 3RPMA 2DSUA 1JZ8A 3WY3A 1JDAA 3EJUA 4NRSA 1D3CA 1H49A 1ZL1A 2PI6A 4GZEA 3WH5A 1OGGA 4IPLA 1WZMA 3ZMRA 1ESWA 4OKDA 1NP2A 1UR8A 1KQZA 2F7RA 3A47A 4PMRA 2XM2A 9CGTA 3W81A 5FL1A 2EPMX 4ZE5A 4DO4A 3EMQA 3L4YA 4B9ZA 1E6NA 1KGUA 4XB3A 5E1QA 3VD3A 4WIWA 2WMIB 1BVZA 4IM4A 3GZAA 1R85A 2EEXA 1HJWA 4D1JA 4F9DA 2J7DA 5C71A 2PWEA 2F7PA 1KR0A 1I75A 2FDMA 3AS3A 3MKKA 1UD6A 4CU7A 4JIEA 1W9XA 1K9DA 1V3KA 2PBOA 1UD2A 2J47A 1LJYA 4UQCA 1B31A 1C7TA 5A8OA 4J3VA 3A4XA 3U5UA 4P7LA 4E4PA 1VF8A 1CXEA 3S5ZA 3ALGA 3WQVA 3CUHA 1VB9A 3ZT7A 3WY2A 5D9NA 1ZBKA 4NZFA 3ARPA 2YFOA 2QLYA 1FH9A 1MXGA 1EHAA 1OT2A 4MDOA 3RM9A 3IAPA 7A3HA 2YA1A 2DEPA 2CBVA 4ML4A 2QPSA 4XX6A 2JEQA 4CN4A 4AMWA 1OIMA 1WDSA 3WUBA 2O9RA 3KE0A 3OGVA 1EHNA 4JFUA 1DHKA 4R5EA 3VVGA 5FIPA 2VVNA 2VQUA 4UFKA 2YIHA 2X2IA 2BHYA 3SUVA 4CN1A 4AXNA 2W4XA 3AIRA 3VIPA 1ISYA 1H2JA 4L4PA 4GIAA 1HP4A 2JE8A 1X1NA 3U5YA 3CUIA 5E9AA 4PMZA 2UY5A 3GXNA 3PZQA 2B31A 3BUIA 4WKFA 1QI4A 1PPIA 1E3ZA 1CLVA 1R7AA 3MMDA 3II1A 4HTYA 3ZO9A 1JDDA 3PHAA 1IV8A 1BGAA 1EQPA 3VSUA 1PAMA 3AMDA 4WLCA 1FP8A 1BPLB 2D22A 1T0OA 1HKMA 3MS8A 1UWIA 3VIKA 2ZX9A 3WDRA 2D1ZA 1GOIA 4EE9A 5I78A 1QHPA 3SCSA 4NSBA 4PTXA 1Q6GA 2F8QA 3EBVA 5EMYA 3T2QA 4W85A 2NT1A 4UQBA 1KXHA 2XFFA 4DWSB 4UOZA 1V0LA 3GNRA 5D9MA 4U3CA 2Y8KA 5I24A 4HZ7A 3T0DA 4HZ6A 5E09A 1PIGA 4XUYA 2ZXBA 3L4ZA 1DP0A 4YPJA 2X0HA 3HG2A 1QBAA 4DUVA 4WKAA 1UD8A 2GUYA 2F7QA 2VZTA 4HMEA 2F1BA 1B3VA 1TR1A 1BG9A 2WB5A 3OBAA 2UY2A 2XG9A 1UG6A 4HMCA 3BAKA 1V3HA 2A3AA 3QOKA 1JAKA 2OW7A 1OT1A 1R86A 1GOWA 6TAAA 1EO5A 3AIVA 3CZLA 3ARWA 1HJUA 3CZSA 1MW0A 3G6MA 2CPUA 1K6AA 4PCTA 4MPKA 1W2PA 5DT7A 3G6LA 1UR2A 1WDQA 3BH4A 1WKYA 2VOTA 3CHDA 2TAAA 3WD1A 1R7OA 1BLIA 3PZGA 2IGTA 4PMUA 4UR9A 3B9AA 3WDJA 3B9EA 3SUTA 2NW0A 2HISA 1QOXA 1HIZA 1EOMA 3A21A 1H4PA 2D24A 1UWQA 3D50A 2OSWA 4U33A 8CGTA 3N9KA 4WF7A 4UTFA 5A6SA 1J10A 2EXOA 3CUJA 1HL9A 1DWJM 2EADA 1DEDA 1G5AA 3VOCA 1W9UA 1OD0A 3WELA 1HJXA 5D9OA 2D0FA 2BV9A 4J28A 2PWHA 5A6JA 2Y4SA 4FNRA 2HVMA 3ZM8A 3WD2A 1KGXA 3LPFA 5HPOA 1E72M 4PTMA 3RO8A 3T0AA 1ZB5A 1H1NA 1LF1A 4KGJA 3M6DA 4OBSA 5CG0A 1AQHA 2X09A 3VDHA 3AJ7A 5CXPA 4M8UA 4B16A 3HJEA 2VL4A 3LRKA 4M24A 4EANA 5C8BB 3EDFA 4PN2A 5KZ6A 5BRQA 5IHSA 2MANA 3GXDA 2VTFA 3VSVA 5TD4A 3OGRA 1MW3A 4C7DA 1E6PA 1V6YA 3W29A 5JIWA 3BUPA 2XHYA 4ACYA 2XJ7A 2YBTA 1TQVA 4DWSD 5EFFA 3AMCA 3AQUA 2VCCA 4D6GA 4HPHA 1V3MA 3W37A 1C8QA 3LPPA 4E8CA 3HN3A 1HWWA 1CPUA 4U3AA 5CLTA 4AZ7A 1GQKA 3L4UA 3ZQ9A 2XGBA 4V27A 2Q8XA 2GJPA 3MUIA 4ZE4A 2J78A 1M01A 3OZOA 1QHOA 3VM5A 3VUPA 5BXTA 2D0HA 2YJQA 4E8DA 5LA1A 3KEHA 1J0KA 3WNOA 4OOZA 1I1WA 3LXAA 3VMNA 3HU7A 4J3WA 2GSJA 2E9LA 3VX1A 1EDQA 1XSKA 2EO7A 4TX6A 3CO4A 5I6SA 3GDBA 3AS2A 1TCMA 3SUSA 1FA2A 3WF1A 6A3HA 2PBGA 2XM1A 2PWFA 2CYGA 1E40A 5M3WA 2ZXAA 3BSHA 4NF7A 3EDKA 3PZVA 4OJYA 1UWSA 3MSDA 3RCNA 1GQIA 2V38A 2GK1A 2WANA 1MVYA 2VO5A 5I3DA 2J7BA 3OG2A 3K1DA 1BYDA 1OIFA 1B90A 3BMVA 2WWDA 2QPUA 3F5JA 1CTNA 2XSBA 5BWFA 2YOCA 1UR0A 3A4AA 1LLOA 4FK9A 3LRLA 2G4FA 4P8VA 2E8ZA 4CCCA 4AIEA 1J11A 1JD7A 4WJXA 3SCQA 1SFSA 1QHZA 4R27A 2EQDA 1UR4A 5LA2A 2ZUVA 3EDEA 1G0CA 4JFWA 1JFXA 4D72A 1Q4NX 1PJ9A 4AEEA 5I2UA 3CZNA 3OA5A 3SCOA 4AD0A 1D7FA 1GHRA 4GI9A 5ABGA 1JG9A 2IUZA 2IXVA 4D6JA 1OGBA 2V3GA 1TQSA 1G9HA 2XUCA 3I3BA 3VGDA 4ZFMA 3UR7A 3OIHA 1RP9A 4PYSA 1XGZA 7CGTA 3PZTA 1UKOA 2VVSA 1UR9A 3AXHA 2JFEX 1L0PA 3A4WA 2E4TA 3DX3A 1NOWA 1BHGA 1R33A 3RJXA 3CHEA 1KR1A 3I3EA 4V2XA 3WMSA 3PN8A 4H8HA 2DT1A 3VINA 2G3NA 1LL7A 4AYGA 3PZUA 2WVVB 4A3YA 2WK2A 4JL2A 1CEOA 2WMIA 2ZWZA 3DX0A 1J12A 2WLYA 1WAWA 2BY3A 2VRJA 2WXDM 1CWYA 4NRRA 2VZSA 2CKRA 4H7VA 2XN2A 1R46A 2XGIA 3WQ4A 1MFVA 5BXPA 4AEFA 1JL8A 3LXBA 4PUEA 1VEOA 1WE5A 4MNJA 2QV4A 3WY1A 1HJSA 4CVWA 2WKGA 2W91A 2G3IA 3WD3A 4WKHA 2EPLX 4GQQA 1JZ3A 2J77A 3QHOA 4C7FA 2BY1A 1IZKA 3SCWA 5EBAA 1LL6A 1V6WA 1CXFA 1K9FA 5C70A 2DH2A 2CBJA 3DX4A 3PTQA 2ZX7A 1FHLA 5CZKA 2WWCA 2AAAA 1UH2A 4YHGA 1E6RA 4W8BA 2E9MA 2WZHA 3CZGA 3AIEA 2J75A 1CXHA 1B1YA 1UH3A 1VFFA 2BY0A 3WENA 4BZYA 4P8XA 3W82A 5HBFA 4CD6A 1QI0A 6CGTA 3QR3A 4FMVA 5BROA 3NDZA 3DX1A 2WBGA 4AIUA 1A3HA 1V0NA 4P7NA 3UESA 5A2CA 1OD8A 4CN6A 5ABFB 1J0IA 2VZVA 2X2HA 3VIJA 4PMYA 3FAWA 1UKQA 2V3EA 4CKQA 4Q7NA 3HG5A 1HT6A 2YDSA 1UWUA 4RE4A 4AZHA 3PTMA 5A6AA 1TVNA 1EA9C 2VRQA 4GZIA 4M80A 1VEMA 2YDRA 2ZUWA 1M04A 3T09A 1BVNP 4PMNA 2VCAA 1AMYA 1SZNA 4J3SA 4CU6A 3WQ8A 1CZ1A 5EFDA 3WNKA 1UA7A 1CXIA 3WDHA 4J3XA 1XSIA 3SUUA 3U7BA 1DWFM 5A8QA 3AZRA 4U5KA 1E9LA 1B0IA 4OIFA 1C93A 2ZX5A 1CIUA 5KEZA 4ZXOA 4DWSA 1NOFA 1IT0A 3WEOA 3OLEA 4AMXA 1NWTA 5GNYA 4MB4A 1LL4A 3T08A 1HVXA 2ZUMA 3D4ZA 3WF0A 1TA3B 1Q6DA 3GXIA 2WM0A 2X8RA 1MYRA 2YL9A 1H11A 3NUKA 2ZX6A 3RM4A 4ZENA 4UZUA 3CZKA 2WVUA 5A8MA 4TVUA 1QI5A 4MDPA 2WCSA 1JZ4A 1E43A 3SURA 1YQ2A 5HOSA 4CD7A 4WSKA 2GJXB 2W62A 2VQTA 4URIA 1Q6FA 4AD5A 1B9ZA 4NZCA 1B3ZA 3A23A 1GQLA 3AISA 4AD3A 3S5YA 3BLKA 4AW7A 1QNPA 4RE2A 1EH9A 3TTSA 2YLLA 3OLGA 2XIIA 2YBUA 3WIJA 1HXKA 1U2YA 2VX7A 3SCPA 1JF5A 3AS0A 4H8VA 2O92A 4W87A 1Q6CA 2J7CA 5JIPA 1UQYA 3E1F1 1F4AA 4JHOA 1Q6EA 2ZE0A 3TA9A 1V0MA 3A24A 4GPNA 4TXEA 4MADA 3K4AA 4DM1A 1HKKA 2F1AA 1KCKA 3T2PA 4JHZA 1QNOA 4LYRA 1BG4A 1E0XA 1KBKA 1B3XA 1WDPA 1MWOA 5HXMA 1C90A 2V5CA 3PZMA 3AHVA 3ZOAA 2DH3A 3CC1A 4UFJA 2PB1A 1GUVA 4QCEA 1EOKA 2D20A 1W3KA 1ZJAA 2GDUA 1OBAA 2EPKX 1H5VA 4BS0A 3N04A 3UR8A 2XN0A 3D52A 2CBUA 3M46A 4L4OA 3SCTA 4V28A 3WUGA 4UQAA 4LXFA 1E6ZA 2VR4A 2WLZA 1CGUA 4ZXLA 1TQWA 4HA4A 3WQ6A 4AWEA 2DIJA 4W8LA 3SUWA 1WNOA 4AYSA 2EPNA 3BUBA 1BYBA 1CGTA 3BVTA 1ODZA 2RGLA 4UFLA 2OWXA 3VIGA 1RH9A 2F2HA 1FHDA 4YN5A 1SMDA 1JF6A 2DT0A 4DO6A 3CIVA 4GO8A 2ZXDA 4PMVA 1JZ6A 1GNXA 5DMYA 1E1EA 1GCYA 3MUY1 1NM9A 1R8LA 3M7SA 1JZ2A 3WQWA 4U31A 3CBWA 1XC6A 3BC9A 1X6NA 1KWKA 3N17A 1W9DM 2VCBA 1JXKA 3VSTA 3WFZA 4J3UA 1GOKA 2XVNA 3BCFA 4IISA 2FH6A 3WUEA 1ECEA 2EACA 3KL0A 4PEEA 3S6TA 3N13A 3KZSA 3VKKA 3AIUA 3DECA 2WAGA 3B9DA 5LYRA 4CUCA 2FYVA 4GXPA 2FH8A 3EJRA 3BVUA 1H41A 3L4VA 2OYKA 3WNPA 2FGLA 2X0YA 4MB3A 1V02A 2WC3A 1WP6A 3B8SA 1V6UA 4W84A 1EIBA 3W24A 2V3FA 3ZJ8A 4NX0A 2VT0A 4JFSA 2VX4A 5FL0A 4CCDA 3AHYA 2WHMA 1SR0A 1QNQA 1O7DC 2VNCA 3EMCA 1BGGA 4ATWA 4PBGA 1I1XA 3MMWA 4F79A 1DWIM 3VGFA 2CHOA 3NYDA 4PUDA 2XWDA 3KL3A 4IPNB 5AYIA 3VIMA 1E4IA 2C8NA 3THCA 4HPGA 1KB3A 5A6BD 1QWNA 2X2JA 1Z32X 4N42A 2FGZA 1UD4A 1J0YA 2W61A 3MV01 4DUXA 2WPGA 2ZXQA 1J9YA 1K9EA 2WYSA 1NARA 3GNOA 3J7HA 4JCMA 3W6MA 1KBBA 1W9BM 1S46A 1VEPA 2J79A 3AYSA 4M82A 4EKJA 3RM8A 2XPKA 2JF7A 3U57A 3W28A 2VZUA 3WF2A 3CZJA 4K68A 3GXTA 3APGA 1GORA 4Z2HA 2BVYA 2DDXA 1C91A 2WW5A 1DWHM 2O9PA 3O6AA 3ZSTA 2W66A 2WZIA 3PTKA 2D3LA 4KRUA 1CGXA 1H0IA 1JYNA 3F5KA 1US3A 1ISVA 2WVVA 3VPLA 1VJSA 1UOKA 4KGLA 1M7XA 1EXPA 4PMQA 4CD5A 5IDIA 1R75A 4H41A 1QWUA 4HMDA 1V6VA 3N12A 4NXKA 2IXUA 1C92A 1E3XA 1TMQA 3KL5A 3A6OA 2WC4A 4CCEA 4PSRA 3ARYA 5I23A 3PZ9A 3ZR6A 3F4VA 3NCOA 4NXSA 3A3HA 4HA3A 2EJ1A 3TTYA 3WDPP 2VMFA 1HL8A 4Q22A 2J8FA 2YFNA 4MAVA 2WCAA 1V08A 2CERA 2EAEA 2WSKA 1MQQA 5IHRA 1WZAA 2J7EA 3O2LA 3ZIZA 4KRTA 3AXXA 4AY1A 1HX0A 3IGUA 4TUFA 2XFYA 2D23A 3PZIA 2OLHA 1MW1A 1QX1A 4B3KA 4M29A 1O6IA 3UEQA 4LPCA 1ISZA 3W4RA 3RILA 2DSKA 3VD7A 1JYWA 4PTWA 3VIHA 3O9NA 1ITXA 1XRVA 3VGGA 2PF0A 2CHNA 1JXJA 4KMQA 3AZSA 2OW6A 3CMJA 4QP0A 4AC1X 3RMEA 3AIWA 1CGWA 1OB0A 2JALA 3H53A 1JI2A 4GINA 3S2CA 2YDQA 3WFLA 1KTBA 3WH7A 3H55A 1U33A 1GZJA 2WVSA 1E6QM 5ABFA 4P7RA 1VFMA 2OWCA 5GQBA 4MNMA 1LG2A 1EDTA 1W3HA 5D8WA 1CECA 3NIYA 5I5RA 3CPUA 5JUVA 1HKIA 2Y24A 4AZCB 2YA0A 4W93A 3BAIA 1JYXA 4AD1A 1MFUA 2AMGA 4B15A 3RJYA 2VUYA 2VR5A 3L4WA 3SEPA 4EAMA 3ZSSA 2VX6A 4UQDA 3BLPX 2XYLA 3BLBA 3SIMA 2BS9A 1MQPA 3WY4A 1C7SA 2DSVA 2E8YA 2XVGA 1UKSA 1KXQA 3AHZA 1R47A 5A6KA 2FHCA 5DFAA 2X05A 4M81A 2XN1A 4BQ4A 5DF0A 4J27A 3WD0A 3ZT6A 3MV11 3CHCA 1XHGA 5CPTA 1WO2A 3VIOA 1DWGM 3ARTA 4QCFA 3UETA 3EJQA 3VD4A 4GI8A 1GPFA 1LWJA 3A22A 1GW1A 1JAEA 1TA3A 2BXZA 2DSZA 1JDCA 1ZBCA 3OLIA 3D5HA 1ZBVA 1ZU8A 3AMLA 2BFGA 3BAXA 4BF7A 2YL5A 4X0VA 4BQ2A 4TVCA 1E15A 1V0KA 4MB5A 3VGEA 3CV5A 1C8YA 3LXCA 2VZOA 1ITCA 4TX8A 3PBGA 2BY2A 2EBNA 1IZJA 4PMOA 3N1AA 4RL3A 3AHTA 4NI3A 2GJXA 4U5IA 5BYWA 1DWAM 1JNEA 1HNYA 1WB0A 5D9PA 3MMUA 3CHFA 1TQUA 1GJWA 5I0DA 4LGXA 3VNYA 4UFMA 3WEZA 3AXIA 4D6CA 4U2ZA 3D4YA 1PEZA 1QBBA 5E0CA 1LWHA 3UG3A 4GQRA 4B3LA 4MTVA 4W88A 1E1FA 1FFRA 2G3JA 2ZWYA 1FH8A 2J4GA 4UNIA 1H0GA 3BCDA 1CLXA 3OGSA 4PMDA 3WNNA 4F8XA 1R87A 1QNSA 2Y2WA 1NWRA 2XIBA 5IXEA 4UFIA 3ARXA 1GOMA 1OM0A 3TTQA 2GVYA 1WZLA 5BCAA 1BYCA 4DM2A 3WMCA 1W9VA 4HZ8A 8A3HA 2VI0A 5CPQA 1MXDA 3WF4A 1GOOA 1QW8A 3D51A 1UH4A 3LRMA 3EDDA 2ZUTA 4J3TA 3W27A 1G94A 5A6BA 3K8KA 1JZ5A 2WSPA 4AD2A 5A95A 2GDVA 5DO8A 4H2CA 3D3AA 2CITA 3FNDA 1NWSA 4W5ZA 1UQZA 3WNLA 2A3BA 2F61A 1C3FA 1KWGA 3LX9A 3SCNA 1HVQA 3QHMA 1VJZA 1W2VA 1EO7A 5DT5A 1NWUA 5AC4A 2WNWA 3WBEA 2NT0A 2Y8VA 2BXYA 2W92A 4W5UA 2QMKA 4HA1A 2V5DA 2PC8A 1YHTA 4JFVA 1HKJA 2E40A 3GNPA 3L4XA 1J0ZA 3WUFA 5M03A 3DHUA 4FLSA 5A6MA 1J01A 3PZOA 1JFHA 4XZBA 5CQ1A 1K9TA 4M56A 3MANA 3ZJ7A 3LPGA 2DQXA 5HNNA 3FHQA 4MJ4A 3VX0A 5AY7A 2WMKA 5FKYA 3VU2A 4H8UA 4D6IA 4UQ9A 1KXTA 3TTOA 3L2LA 5FOOA 3CUFA 1ZS2A 3ARQA 4JKMA 3UG4A 2GJRA 4TTGA 4BCEA 1V3JA 4P8WA 3EJSA 4DUWA 4J7RA 3M07A 3BUDA 4W86A 3DYOA 5D8ZA 2E9BA 1PBGA 1KQYA 1TZ7A 2VJXA 3KWXA 1SMAA 4OBRA 4U2YA 3AS1A 1VRXA 4MAZA 2J7GA 4W7VA 2UWFA 3W53A 1H3GA 1QNRA 3BXWA 4QFUA 4D6DA 3DC0A 1CGYA 4LX4A 3SCUA 2J7HA 3GM8A 2X2YA 2ALWA 4Z2IA 4XV0A 2WVTA 1GVYA 4AZGA 4W7UA 4PCSA 3WBAA 3NSXA 3MI6A 4MB1A 1QI3A 2DSWA 3GYCA 3VILA 2GFTA 2PWGA 2WMFA 1CENA 3IJ9A 1UWRA 4UQEA 5HPCA 3BAJA 2JIWA 1BSIA 3EDJA 3FW6A 4F9JA 4WSJA 3FN9A 1EGZA 2DT2A 2BHZA 4EK7A 1LG1A 4JL1A 3W26A 2W63A 4BQ3A 2YL6A 1QPKA 1UUQA 3TP4A 3A5VA 5CLWA 4Y7EA 2W67A 4AISA 4ATLA 5CPSA 2ZIDA 1VFUA 3DDGA 3VO0A 1CNVA 5E0FA 3POCA 3QOMA 1B3WA 2WHJA 1W32A 4S3JA 2UY4A 1PX8A 1KGWA 1JZ7A 3VTRA 3ALFA 1HF6A 3ZR5A 5GPRA 1W3JA 1F4HA 3ARUA 4QDMA 4Z2GA 2J25A 4JCLA 1W1TA 3RDKA 5IFPA 4BA0A 3AICA 4TVDA 1XCXA 1W9PA 1R34A 3WH6A 1BQCA 4PSPA 1UD3A 2J8GA 4HOWA 3NSMA 1PX3A 4MNKA 4OGZA 4UCFA 3F5LA 4FNSA 3VGHA 4ACZB 4HOZA 1W1VA 1CBGA 2E3ZA 2V3DA 3HZ3A 1OWQA 2ZUUA 4DO5A 3GTNA 1LQ0A 2XVKA 1FFQA 1CYGA 2CESA 4NZJA 3W25A 1TVPA 1M03A 1GVIA 4KH2A 3VDAA 3VD9A 4MNLA 4D1IA 5DEZA 4FNPA 1A47A 4QLJA 2OSXA 3TONA 4X0NA 3NJ3A 3EJTA 3POHA 5A6LA 2J74A 3KLLA 4OUEA 5GNXA 1E70M 1E4LA 1ISWA 1XD0A 5F7UA 3GH5A 1XV8A 1TG7A 3GH7A 2XTKA 1J0JA 1HN1A 3WL1A 2DT3A 1UZ1A 2OYLA 1PIFA 1JYVA 3DYPA 1BTCA 4AZCA 4KWUA 4CD4A 1XH1A 3GBEA 5HDRA 1G01A 3WH8A 3OB8A 4N0RA 4AZBA 4Z2LA 1RD6A 4GO9A 2E0PA 1XH0A 2D2OA 4D71A 3T0BA 3GXFA 4OOUA 3TOPA 1Y7VA 3W38A 4QLLA 2RGMA 5JBDA 1L8NA 2YLAA 1MW2A 3RIKA 2NSXA 5ABHA 5A3HA 3WMBA 1EDGA 3MUAA 3K8LA 1FP9A 3BVXA 3ZJKA 1WZKA 4HP5A 1GQJA 2JF6A 4TTUA 2CNCA 2WMGA 3KLKA 3ECQA 2EABA 2CXGA 1UKTA 1BAGA 3BVWA 1GOQA 4HOXA 3BGAA 5BXSA 4W8AA 2D73A 4B9YA 1J18A 1E4NA 1BYAA 1VFOA 3ZJ6A 1NP0A 1CXLA 3CZEA 3H54A 5CGMA 5A94A 3W6LA 4ATDA
chains in the Genus database with same CATH superfamily
5IG7A 1CTOA 2WAQA 2P5EB 1LDPH 1G1OA 3ID7A 3ECUA 4LAOA 5H91A 4TQPA 3U7AA 1FYHB 2E47A 1S3RA 3HB3D 3GBNH 2PNDA 3O2VL 5ITFA 3WQ5A 1KM2A 1U5HA 2L4OA 3RGHA 3ANYA 2O4QA 1FL3B 1H0DA 1KM3A 4JYEA 3N3TA 3U7WH 5D6CB 1M3IA 4WK9A 3AIBA 3QPQC 1UXMA 3ZKMD 5EYWA 4JTGA 1IBHA 2CKNA 4OKVA 4JK0D 5D2WA 1TWIA 3QDMB 3MVTA 1QFWI 3BIKB 1KZQA 4PM1A 4X4ME 4F8QA 5CEZE 4Q6IC 3OWEA 1EJSC 5ECUA 2YBRB 3DZ1A 3GXPA 2DW7A 4D6FA 1HGWA 1UP0A 4CVXB 2B59B 1H3WM 3CIXA 1W54A 5EO9A 4WW2A 4PJFA 1ROCA 2AK4E 1KBPA 2KZ1B 2VABB 3G5WA 1TPWA 5CEZH 1HHJB 5F21B 2AXWA 4FNQA 2AOSA 3CXOA 2E4FA 1A3XA 3OXSA 1YBQA 1G4EA 3QJUB 4XOAA 1F45A 3Q6FA 1U8MA 2Z25A 4S2SB 1A8ZA 1H3PL 1UACL 3UERA 1TVLA 1C5DB 2Z31D 1KFGA 4DLFA 1HNGA 1CFQB 5DZPA 3CLFL 3TVMA 4DXXA 2DIBA 2VFDA 4PY8J 4NIRA 2DQGH 1TPEA 5KYXA 5FCZA 3B2MA 4GD0A 1P6WA 5FLVA 3O3DA 1XYFA 2OKTA 3CLWA 4HH8A 5KAQG 4X6CF 2VOMA 1PYMA 3IJHB 3UCQA 1HWHB 1ZENA 1OQXA 4V1YA 3E2HC 1F7BA 1UA3A 1N4XL 4LHUA 1NGZA 5HPMB 5D72L 4XNXL 4YHZL 2B39A 3CBKB 1HI6A 4Y2DB 2C1HA 3O6DA 2TRSA 2IF7A 2P44B 2WXPA 2NPLX 4JN2A 2NUWA 4ANWA 3GSXB 2A79A 1CGSH 2NY1B 1VERA 2VX5A 1IGIL 1TYEB 3ZN6A 4PRDB 3F00A 2VURA 2EKSA 5DK2B 4XVOA 4L4TE 1WFMA 4HFWA 5E70A 2PDFA 2L0DA 3HTWA 3LD5A 3SYCA 2DM3A 5JOPE 1N18A 3NIDF 1SDYA 4MJ2A 2O9TA 2PLTA 4YHPB 4PJ9A 4UNVA 4QCIB 4AV0A 3UL4A 1GGUA 4ROPA 3B7TA 2B5IC 5JQ6H 1QPOA 4GXWA 3WTSA 3UOAB 3DBPA 3QIBB 3KYKL 5GIRB 1RPUA 4CMMB 2QJNA 4PB4A 5KN5B 3JUYA 3MLRL 3AYRA 4CADB 4IMLA 5L0QC 4ALAH 3X2QB 4US6A 3MRPB 4IS6B 4IBVA 4YJ5A 3W11C 1E5NA 2GK2A 1A5MC 4H2AA 4HU8A 1BIIA 5A3ID 3W7PA 3STLA 3NJKA 3EMZA 3QNZA 1WA0X 1KPRB 4RMVA 2YSTA 3WLNA 1XH2A 1N5YL 1O7DE 4HWZA 1DN0B 1ZL1A 3TIDA 4EF9A 1ICSA 4LC8A 1J9SA 3K6IA 4MHBA 2ICEB 2COVD 4JBSA 4R8WL 1ELSA 3ATAA 4MNGA 4XAGA 1V7NH 3EUDA 4GUHA 4UNLA 3VE0B 4D1JA 3GRWA 3EWCA 3QO0B 3OBEA 4MMXB 3ILQC 4IT1A 2GJ6B 4C4BA 3ZIMA 1IM3D 5FESA 4E4PA 5EOQH 1WDAA 5C9ZA 2YD8A 3WFDH 4IOTA 2YPKB 4BHUA 3ZZ1A 4LAJH 4F0SA 1CFMA 1GKRA 5I1DB 2XN9E 1V7AA 3ZUCA 3ZDYB 2BOCB 5ESAA 5FECA 1I7ZA 4Z76A 1EC8A 1SQMA 2BHYA 3SUVA 1E3FA 1H2JA 4L4PA 4GIAA 3BWAA 2CBPA 4G8AC 4EDXA 2PE4A 4PJ7B 1QKZL 2X6BA 5JIDA 3C87A 3EWBX 5DJCB 1LD9A 4MS8C 1BBDH 4DAGL 5EFIA 5HD8C 2JXMA 2H45A 1G87A 4IU2B 1GWJA 5LHFA 4EE9A 2P24B 4ADSA 1TJIL 1T1ZA 3EBVA 2HTLD 4IYKA 2X4PB 2QT3A 4UOZA 2FZMA 3CC5B 3N2TA 3MRHB 3MRJA 2X0HA 3VFTA 2C1PA 1T0NB 2V2XB 5KYYB 2FT8A 1H3UA 3KCPB 1ADQL 1OGTB 3OQEA 3IRDA 4XWGH 3AW5A 5L7XL 3WTUA 1TTIA 2CNYA 1PTZA 5EULV 2OW7A 4R3SB 1EUAA 1ZIAA 4G8EB 5IHWA 1RZJH 1UR2A 3B8TA 1I3UA 3QZWB 1HKFA 4U1MA 4PRRA 3CCHB 5C0FA 1IGCH 3TBTB 3FRPA 3D50A 3QB7C 3CWNA 3GMNA 1D5RA 4AWJC 5F7AA 1MQKH 1G6VK 3WD2A 3LPFA 3HBLA 2VN7A 4MA3B 5HI3C 2AJZA 4YHLH 2KLSA 5E0KA 4L1BA 1AXSA 4FOJA 4DP9X 3PNWB 5FUZL 3NO1A 3EDFA 2YXGA 2VTFA 4B92A 3T4CA 5I71C 1XICA 4XNAA 4I9WD 4U7KA 4MZ8A 5KVMC 3VNKA 1YYAA 2OFQA 3LN5B 3TBCA 5IW6B 1QWHA 4DAFA 2BERA 3ZQ9A 2OPJA 1RUKL 4AIXA 3R0NA 4M03A 4ZNCD 2J1WA 1T2QH 5BXTA 1PKQB 3SYQA 1Q2SA 1DVFC 4Z7WA 3D1MC 1YUHA 1AK5A 3QZPA 1KY7A 4QHRA 3NYKA 1K8DB 4GKSB 3C75A 3ZIYA 2PD9A 5HDBB 4DP6X 3R12A 3EYSL 2C1PB 2ICSA 1KTKE 1BD2E 3HMJG 2XQYK 4MF4A 3U46A 1EF3A 3KBJA 3W1QA 4UF7C 2Y5TA 2A2IA 4AF0A 1NUDA 4QHMB 1JD7A 1F4WL 3NZ8B 1YC7A 2EIZB 4V1DB 2RALA 4BQBA 5I6NA 3NJNA 3GAKA 4JFED 4AEEA 3ZKQD 1XCFA 3MBFA 1AIFA 3TLRA 1DKWA 2XUCA 3RO6A 3WFCH 2HYMA 2P7TB 4ZMZA 2MOVA 4QNEA 3WE6B 2EYSB 2QCDB 4H4NA 5HI5D 2X44D 3OPZH 1UZ6F 1E8XA 3I6RA 4H9TA 2WXDM 5B38G 1I8KB 4O19A 3AYVA 4AEFA 3CK0H 4I5RA 2F5BL 2KDGA 3QEQA 2W9DH 4WUKH 5JLZB 2PTYA 2BWGA 3QHOA 4JO1H 4C7FA 3SRHA 1KC5L 1K9FA 4IG2A 4M1BA 4FB7A 4LKCA 3DX4A 2CBJA 1RLWA 43C9A 4QLRA 1V27A 4N90D 3HUJA 3B6SA 3DMMB 5EC2B 3WENA 1A6AB 2IWKA 2IPUK 4GX9A 4GNVA 5DC4B 2NUTB 2FO4B 1PG7H 3IN2A 1J0IA 3DETC 5A16A 2X2HA 3VIJA 5I17A 3W75A 1W80A 1UKQA 1CLKA 4ZT1A 3C5ZC 2J21A 4ACTA 4BKLA 1J8HB 1W5MA 1R5WA 2P8PB 2YDSA 5A6AA 4AZ8B 1TVNA 4AF0B 4AY7A 4MIMA 4K5NA 2HFGL 4U7SA 1MFEL 1NPUA 1XSIA 1RVKA 1PQZB 3SUUA 5A8QA 3APDA 4F91B 2C1GA 3RHGA 1VGEL 1OCBA 1BQKA 4HWUA 3GXIA 1H9DA 5C0AE 3PXHA 1MLCA 3NURA 3TWYA 2Y7FA 3ITXA 1U6AL 5A8MA 4XBMA 4P3DB 4MDPA 5FEWA 4DN1A 2A5HA 3VTTA 4URIA 4AD5A 1U92B 2QVIA 1R3LB 2C3ZA 2XVBA 1FKXA 1UXWA 5EF1A 3N14A 2GGEA 1ZRUA 2G3FA 2IDQA 1JF1B 1T6WA 3NEVA 4RDQF 3MB9A 2HE8A 1HXKA 1U2YA 4MMZC 3COTA 3SDDA 3FT3B 2VEGA 1CX9A 2NY5H 4D2JA 1UQYA 4XX1G 4DJEA 4U1KA 4A8IA 2HKHL 3ZRCC 2OXGA 5LHDA 1NC2B 4MZYA 4A37A 5FYKU 1TJ2A 2HEJA 2DH3A 3CC1A 3MV7A 1S5VA 3NFSL 4YWGH 4TIMA 1EOKA 2EILB 2P5WD 2HKFL 4BS0A 4I9TA 1X9UA 3MROA 5IGXL 4PHXA 2UY7B 2J6EH 3GPSA 3VDGA 2DIJA 3LHPL 4GUIA 4TMPA 3SO3B 1K8IB 3T8QA 2D03H 1FNGA 4U49A 1OWWA 3OQRA 3ZLFA 4ALAC 1G7LB 4FXGA 4M4PA 3KYNB 4AW4A 4DO6A 5F7DA 5AYTA 1YEJH 2GY5A 3JWNE 1B2WL 3EYFB 3W1XA 2R29A 4D94A 4R4BA 3ZYIA 5HJBA 2X70B 1KWKA 3N17A 3T3PE 2XJLA 1LRTA 3BCFA 4IISA 4JX6A 1QJWA 4NZ8A 1OPGH 2BSED 1CVRA 2ZUYA 3QCUH 4NSKB 2NXZD 4K23H 2QV5A 3CFQA 4Q74A 5EGRA 3S98A 2GGHA 4JFHD 5I6PA 4CUCA 3U2OA 4GXPA 3HE6B 1RALA 2GITA 4UCGA 4G5AA 1M7IA 2ZAIA 5FL0A 4FMFA 2GCYA 4JTKA 3QQDB 1O7DC 4KW2A 3GLAA 3R8HA 4P05A 2Q5BA 5C3IA 3B9KB 3FB7B 4AEHH 4LF2A 3ZTDC 5FO9B 3HZMB 1KB3A 4JDVA 3FN3A 4C6NA 3M6YA 4NKIL 4JUSA 1Z32X 1UD4A 4IW4C 2WYSA 2DQTH 4JCMA 1PDYA 1W9BM 3QYCA 1OSYA 3MU3A 2W0KA 1ZTXL 3APGA 4PH8A 1V79A 3N25A 1H0IA 3F5KA 3FTSA 2X16A 1RLCL 2DQCL 1R75A 3P0VL 5IMMA 4G80A 4N9CA 3EOAA 1UB6B 4NZ4A 4PB5A 4HW6A 2WC4A 5KMYA 1DQQA 2WWNA 4QMEA 5E03A 4GG6B 3OGOE 3QJAA 1N0XL 3O3UN 5JXEC 6ALDA 3OHXB 2CRYA 3MYJA 4AY1A 5IJVA 2D23A 1QX1A 2X87A 5F7DB 1O6IA 4P5TB 2IXQB 5DMMA 1AQKH 2GI0A 2BP0B 1SO5A 3ZL4H 2ZUQC 4HSCX 2Y63A 2VENA 2BVQB 4KMQA 3N42F 3DXAB 4FFYA 4AJWA 3W01A 3Q58A 3WH7A 4J3ZA 3L54A 3MFGB 2EGZA 3FCSB 1VFMA 4GA8A 3GFUA 1JWMB 4MZ1A 4YE4H 3FO1B 3MBXH 1GAFH 1PBYA 1FCVA 3EX4A 4EUPH 2FSEB 2AZUA 5DK3A 2OX4A 1RZJC 3I6KA 4GKTA 2DJSA 3HQNA 3WD0A 4JG5A 2R15A 3MLXL 1I9JL 5BQ7A 2D2HA 4QCFA 5TDNB 5IMKB 3ABZA 3W1TA 3F7KA 2XUWA 1JCTA 2D7NA 2R0LL 4ZOEA 1CT8B 4J8RA 3BARA 4X0VA 5CCKL 2AL2A 5HNTA 4XP1H 3KCOA 1IZJA 5EPDA 3N1AA 3BP5B 5I0DA 2QKIA 1TO4A 1X4YA 3D4YA 1KC7A 2NVDA 4X9SA 3OG4B 4R7DA 3NH7L 1VFBA 1E1FA 2J4GA 4UNIA 3K4ZA 3BCDA 3FNKA 2XGZA 4PMDA 4ZD3L 4H20L 3REQB 2ZG2A 5CIPB 1DQIA 3OJDA 5F7BA 5I2IA 2PTWA 1A4AA 4E9LA 3QZ6A 3EDDA 4L29B 1GS8A 3KBNA 3K8KA 3D85D 3M4HA 4ZTYA 1UVQB 2DLIA 1WOAA 4K4KA 1D2OA 4OBTA 4FR6A 1XF4B 2X40A 5BS0D 3TCLA 2AERT 3TS8A 2QDWA 5GS3A 4X50A 5I15L 3ISIX 2XXCB 5BOEA 1ZT7B 2XNAA 1L7IL 3S34H 2V2TA 2VLKD 3HMXA 2PDBA 5AAMA 2EC9U 1EKOA 3O8XB 4G2DA 2YMTA 4RAUB 1AH3A 3C2AH 4GP8B 3HI6L 1NC4A 3S4SA 2DQXA 4MGXA 5AYUL 3EEGA 2OMZB 1KXTA 4F7PA 3ERXA 1IXOA 2M26A 4LRNH 4JKMA 4LLWB 4WJG3 4I0PB 4TTGA 1H8OA 3UXKA 1MI5B 2Y6SC 1KJ3L 4J7RA 4JQXA 3AAZA 3QF0A 4YAQB 2JKIS 4OBRA 2KBGA 4NJHA 2EDOA 1J5OH 4IPPA 2MOQA 5D9SB 4ZTOL 3KPOA 3BN9D 2F58H 4JFYA 4WU7B 4WHBA 1VGKA 4GUQA 2ADIB 1PVHA 3IMWA 4H7ZA 3J07A 1ZLPA 1QSFA 3OSVA 5IQMA 4HHAA 1A5OC 3RLUA 3FGCB 2EECA 4EK7A 3SDAD 2OX1A 1QYGL 4H6QA 1DJGA 3TP4A 3RUGF 3QQ4B 2ZKXA 4ATLA 2LABA 4UBPC 3HCVA 4PS8A 4PV8B 2UY4A 1M9HA 2HK0A 5D1XB 4HSOA 4TSBH 1F6AA 1MCHA 2H8ZA 5IR1A 3HC3L 4ONFL 4YHOH 1R34A 3MGTA 1RI8A 4L1SA 2VISA 3HAEH 2OEMA 4D8OA 3E12A 2IWFA 5FPIA 4GS7B 3E9UA 2GJNA 1KLGA 5MHSE 5L6UA 4XBPB 1NY1A 1MY5A 1LDCA 5KVDE 2DLFH 2PDXA 1QSZA 4PJIB 2ZZ1A 1UA6L 1OW0C 2XZCL 5J7CC 2OSXA 4X0NA 1RZ8B 3VB9A 1I8UA 2J72A 32C2B 2NZ9D 1ISWA 5KVDH 5F7UA 4NCC2 1V5JA 3DPDA 4YK4B 3S1WA 3INOA 3L95A 4Y5VB 2E6QA 3D3VD 1NM4A 3XIMA 4JVWA 3LN4A 2WNZA 1HTIA 1O94A 5E2UL 5ABHA 4MUPA 2OMNA 3DTXA 3LNIA 2P8CA 3GRWL 1JPSH 3M1BA 4HGXA 3A67H 3A13A 5FYLL 2D73A 4B9YA 3R1GL 5CR1A 1FNHA 3K30A 1XF5B 4K9EH 4Y16C 4NUWA 4MNQA 5AHNA 3I3DA 1AJ0A 3VYLA 4G6KH 5AYBA 1VKXA 3N06B 4I18B 1MREH 2CIKB 3AB0C 2NY5C 4KIEA 2GDQA 4A35A 5JHDE 4FP8L 1W8NA 4DYEA 5K7JA 4G9FB 3QI9D 3LCHA 1JHTB 1K4HA 2YEZB 3P5ZA 4LRIC 7ODCA 3W7KA 4F58H 1INEL 4OCNC 5JHAA 2AGJH 4M3PA 2WQ8A 1NCDL 3ES6A 3PPEA 1TPB1 4RNJA 4LLYA 1RZ7H 2XVLA 3QQ1A 4UT9L 2YRBA 2VH5H 2QCMA 4U1LA 3WLLA 4LPXA 5T1LD 3AIQA 3JUGA 3HN8A 4XBGA 5HHXL 5L2KA 3P3TA 1UGKA 2RFGA 2WHLA 4A3HA 1D3GA 1G7UA 4JKKA 1FIEA 3HGOA 4EQ3A 3C6SA 1O5DT 3JWNC 1U58B 2R9RA 4A6YB 3GKZA 3EO9H 5J1TC 2VR6A 5I8CB 1QU4A 2JKXA 5F8QC 1II4E 5C09D 4OCWH 2VGLM 3CDGA 1QSEB 3CBRA 3PWUA 1PYWB 3H7UA 4DGYH 1VKFA 3QDGD 1H09A 2FWOA 1RMFL 5AHLA 3UTTD 4Q4KA 1F4YL 3RDTD 4U1JA 5DQ9A 3GNDA 1XIEA 1N6QL 3CUXA 5C92A 4DF2A 3OLDA 3QEHA 5LDSA 5KYWA 2ZUSA 4NQSA 1VPYA 4EN3D 3VG0L 2GGIA 3H21A 4P46C 1OGAD 4ZK8A 4XVJL 3ZZQA 5IJKA 1CQKA 3VXMB 2IAND 4M5YH 1A0CA 1XRTA 3S42A 1R5VA 3QCTL 5E6IC 4W7WA 3BPLB 2Q6ZA 5JUEH 3G5VA 1E0OB 3U9IA 3BESR 2EUVA 4HIXH 5H2BA 5SX4H 5K9JL 3LPOA 3SKUD 4RPQA 3EA1A 3OVRA 4M51A 1KA9F 1BXVA 3MODH 4FF7A 1KCRL 3L3IB 2EF9A 5DANA 3VXSD 3MO7A 3BLEA 3RK8A 3L4CA 2XZQL 1HQTA 1K1DA 3ORJA 2QHRH 4G59C 5DMJB 2NWSA 1XCQA 5E56A 4P5KA 3C8NA 2YW4A 4HCHA 3FB6B 1N8WA 4PHZA 1UP2A 5I1JH 3IANA 3JV6A 5G2WA 4DBSA 3BPOB 4OT1H 4Z1BA 1OARH 5LN4A 2V4LA 3IACA 3MNMA 4U6HB 1K3UA 1BBJB 1QW9A 1FZOA 1YEDA 1QWKA 2PURA 3JR2A 4WK2B 3JWDC 4Z8FH 5I0ZA 4KKQA 2WZ0A 1KCLA 3MO4A 1AS6A 1S7WA 2ZSVA 2R9HD 2UYLB 4UM9A 4PBXA 2DQUL 2AQRA 1WFNA 3NK3A 5AC7A 3AQXA 4HWEH 3TQVA 1Z9NA 3UWZA 4XK2A 1U91A 1KCWA 1MOEA 3WY3A 4AH2A 4K3DH 2IG2L 4K7FA 3HPJA 3L9YA 4UTKA 3MSPA 1QRND 4AENB 4NRZA 2GVGA 4N2AA 1DO5A 3MRNA 5FL1A 5G4EA 5DN1A 2F54B 5C0DA 3T7VA 5DVOA 2W9EH 4WU5A 1KULA 3VD3A 2Q09A 4I90A 3F3HA 4JFOA 2GUOA 1HCYA 5I19L 1ES0B 1SZRA 4FI7A 1T1XB 3QJTB 1BF8A 3GZQA 5ANMA 5FB8B 2ZZ7A 5JHLA 4DBDA 3GGWA 2W1NA 5GJPA 2ZZ3A 2X4SB 2JEQA 4CN4A 3A6BH 4NN5C 1PZ5B 3GI9L 1TZIB 2O9RA 1EHNA 4JFUA 4UTAL 4R5EA 3H9SD 5A8GA 4DZ8A 2VQUA 1QATA 4XVTH 4H1LB 1P6AB 2WLHA 3NZ1A 4P9HL 1PG7W 3RFRA 3HR6A 4EF8A 5J12C 4X0KB 1HP4A 1TQCC 5D1ZI 5TE4H 1MO0A 2B9BA 4QKTA 1CLVA 2RCSH 2IGFH 1BEXA 4IBQA 1PTDA 1ADDA 4QYAA 4JZJC 2LVCA 4I48A 3ES7A 3CSYA 4JX0A 5I78A 2ZCGA 5F2LA 1ZT4B 4OQTL 3X3FH 5L9FA 3IDUA 3NPWA 3T2QA 4PRPD 4C6MA 3M43A 1NBZB 5C0CA 3V4BA 3H4XA 3FA4A 1V0LA 1OJXA 3QULA 1ILSA 4M6UA 4HZ6A 3ZTNL 1PIGA 4KK5C 3HG2A 4WKAA 1K8ZA 2P88A 5CZVH 2ITCB 3TT1H 2X1PA 1G7JB 4PRIE 3NQDA 1AO7E 3B7UX 1A14L 4ANKA 4G8GB 3SDXE 1SPDA 2CPUA 3IPWA 3QUYB 1R0AL 3HPXA 2EIBA 1WDQA 3IS1X 3CHDA 1M4KA 1BLIA 3VWJD 5DQPA 2IGTA 4IBZA 3P3UA 4FHJA 1NFAA 2CLRB 4Q4MA 4HUVA 1L9PA 4LCYA 2BTMA 4ZMXA 2BJML 2CLKA 3ECWA 2RA1A 4KKLC 1BWLA 3IIZA 1HJXA 4XBSA 5D9OA 2Y4SA 3A4FA 4X9HA 1CFNB 2H0FA 1CD0A 3PDOB 1S6NA 1JCXA 5AC6A 4LHJB 1G1CA 3QIWD 1I3VA 4LB4A 2X09A 1FBAA 3VDHA 4EOWL 3AJ7A 1LEKA 3LRKA 1Q1JL 3M7WA 1NIAA 4XISA 2FTYA 3FONA 1DE6A 2R69H 3KYMB 4JFPA 4LMQE 4LVBA 1YNKL 4FG6C 3AMCA 3IIPA 1UBSA 1O66A 2EDWA 3VXUE 1ZLSL 4GRLD 5HWNA 4ORGA 5E2JA 3NK4A 4XC3H 2PDQA 1FP5A 4K3EH 4CNIB 5I3HA 2BO0A 3HU7A 4J3WA 3UIZA 3L3GB 1D5BB 1XLEA 4DBEA 2DTML 4YMPA 1R30A 5AB1A 1IIGA 1TO5A 2MSPA 1SY6A 5A2LH 4RIRB 3MW7A 4U0RC 3W7RA 5C07E 5HHME 2YSSA 1OCOB 1LP9F 1XBRA 4WR3A 3QISA 4A3QA 2GBUA 4OM1H 3I50L 2LV4A 5D7IF 1RFDH 5GZOA 3MJYA 1D5XA 1UR4A 4HHHA 3VFGH 1NEZA 4K9EC 1U3ZA 3VFWA 3VFUA 4QRRA 1YMHA 1XGZA 4WI3A 3F4NA 2MQ0A 5GGTL 1BHGA 2DYPD 3FTGB 1AJ7H 3H0TB 5K9KA 4HX1A 3T77A 5K39A 3PZUA 4NNPH 2CM6A 1U8LA 3DX0A 2K78A 2G30A 1U3HA 3OVGA 4Z0BL 2Z1BA 5FM5M 5MEOB 2CJUH 1NL0L 2E86A 4PUEA 3U7YH 5HHPB 4CVWA 1JGDA 4XD4A 2RGSA 4WUUD 1U93B 2WGNB 4PTNA 2IQAB 3TZVD 2IPGA 3SY6A 4RMRA 2X9XA 3OF6D 4AYFB 3UBXB 4TV6A 4QXTA 3DTUB 4AQLA 4GUFA 2WBGA 4EEEA 4ZX3A 4AIUA 5DS2A 1R3TA 5ABFB 1Q9WA 1YVLA 3HC0A 4JM2B 1EO8L 4FS9A 5T1JA 3RL2B 1HSBA 3AUVA 5D2LA 1JGEB 3OKYA 1BVNP 4BDVB 4HIJB 1N10A 4F57H 3BMXA 4HIEA 3Q8AA 4YSUA 4MDIB 4E38A 5D02A 4F7MA 4ZXOA 4NAFB 4D8PB 1IT8A 2G2RA 5XIAA 3HHMA 4IGBB 4QRSB 4MWAE 1J9RA 2PRLA 1ZSHA 3R58A 4RX0A 1H11A 3P4NB 4Z7NB 1RJPA 5MKGA 1NCCL 1T21A 3FPYA 3SE8H 2CLFA 5AWNH 2QEZA 1USZA 4K2UH 3FUMA 2YGQA 1B0GA 3TL5A 1AXTL 1Q6FA 3N40P 3R43A 3S5YA 2MNJB 1EMTL 4S3GA 2A9NH 4LLQB 3AU0A 4GI4A 5EMJA 1YLBB 1OAUH 1CU4H 4X8CA 5E99H 3MKGA 3WIJA 3M88A 5C08E 3N9RA 1AD0B 3QNFA 3BQUD 4AFYA 5E7FA 1HDMA 5ENWB 3LLFA 4W87A 1P4LA 5GHWL 2VDNH 1F4AA 1JPDX 2ZE0A 2Q7YA 4GPNA 1IKNA 2PMQA 4MADA 3F12A 2M83A 3KMDA 2J66A 3TPKA 1HKLH 1V93A 2GBTA 3V5HB 4Q8QA 3U48A 2XWZA 4PJHA 3GF8A 4QY8B 4BZ1A 2PYFA 1FFOB 2ATPA 1QZNA 1HHKB 3MTXA 2XG5A 2EZ0C 1OY0A 2AXGA 3STFA 3BT2H 4X5QA 3QFJE 4P2CG 4L4OA 3VOHA 4LXFA 2GK0B 1W8GA 1WNOA 3LM7A 2A0NA 3V0WH 4JG1H 4W9CC 5HVWA 4GAFB 1IQ8A 5HYJD 4H01A 2WQDA 2AJYL 1JZ2A 1XC6A 2WZ5A 1CFBA 4G1EA 5D7LB 1BFVH 2YPLE 2JB6A 5MP6H 4N0UE 1HAUA 5IMLB 3US9A 1TMHA 5DO2D 2AXFA 3KCJA 4DP1X 4Y2LA 2FH8A 3BE7A 1EUNA 1IQWH 1ZAIA 4L1TA 1YEYA 1V02A 4OIAA 3EO1B 2CO6A 2VT0A 1NFDF 2VX4A 3F7YB 3LEXB 3ELQA 3VXNB 3DI2B 2FAUA 3OKOA 1ME7A 3FFSA 4C6EA 1F13A 1KRAC 4PUDA 4HJSA 4FAMA 1KN2L 5DJ2A 1R5IA 2WY3B 3AXKA 5A6BD 5EU3B 1JCYA 2FGZA 4NKMB 2ZXQA 2QZQA 1RUQH 4M82A 5FYJD 2JI2A 5F0LB 3NCBB 4WDWA 4HCLA 1UATA 3R6IA 1D3HA 3BCJA 4LSVL 5D7JD 3WS6A 5JDSA 4ZQKA 4QGYA 5D1ZA 3BP6A 2WVVA 3FMGH 1QWUA 3JU2A 5DMNA 4HMDA 3U2JA 1YECH 4I3SH 1W72A 2ERJC 1KPUB 5KZCD 3ATEA 3T1WA 5FUCE 3IDYB 3UZQA 2ZADA 4ZTXA 4G3YH 1UTDA 1OG0A 3QLDA 3U30B 4HA3A 1T03H 1D9KC 1E2ZA 2H1LM 4JM4H 1ZLEA 3RIFF 1TZHA 3KM1A 2F38A 4BWUA 1SUHA 1A4JA 1S7RB 4EMZA 3EYOB 4F2FA 4B3KA 1A80A 4LPWA 2DF3A 5C0BE 5C6WH 4KVCL 3RRXA 3PP4L 1HCFX 5ILTL 1ZHKA 3MA7B 2BINA 2JB6B 2BNQB 4ERAA 3MNZB 4P7RA 4A6YL 1BYPA 4D9PA 2A1WH 2J8UA 5KANG 2D69A 4K5OA 3H4GA 2Y5QA 5I5RA 3CPUA 1HKIA 3WL9A 4P4RA 1TV4A 2VX6A 3WFAA 1Y07A 2WNGA 2XWJA 4MSWA 2OTUA 1C7SA 5EMMA 4ABQA 4NT0A 2X05A 3ETBJ 4YXKL 4J27A 3ZDWA 3WLKX 2EIKB 4HT1L 1Q9KA 3CX5K 3TYZA 2AS5M 3TO4D 4A7GA 5DRWA 2A77L 1VACA 1CLCA 5IG7B 1H1ZA 4ZUVA 3DO7A 2MOGA 4PJCA 2GOKA 4BF7A 3TIEA 3U4BH 1C8YA 2LE9A 4GJJA 2NNAA 1I7RA 5ITFB 2POTA 5BYWA 3UYCA 1WB0A 1WKDA 2P0OA 4OGYH 7FABL 1H0DB 5AEAA 4J5VA 4X4ZA 4WJ5A 2CNZA 1KEMH 3TBVA 2ZWYA 1KY6A 4P3CL 4OKVB 1KN4H 1XYCA 4JTIA 1QNSA 4PYHA 2GVYA 1WZLA 4U4MA 1FPTL 2EXYD 4G8IA 2DWXA 4EAYA 1EJUC 4M6MH 4J3TA 1A7RL 4Z7QB 2WNQA 1H5BC 5EO9B 4WW2B 4PJFB 2Z0BA 4TVPD 1INQA 4M9PA 2MTPA 3DJ9A 5C7VA 2F61A 2VO8A 4RNFA 4HUWA 1DDTA 4BSJA 3OXSB 5L9DH 3TJ4A 1OM3L 3SAZA 1NWUA 1E6OH 1YBQB 2V69A 1RXLA 3EZ8A 5SWZE 2WLLA 5M95B 3Q6FB 2OULB 1XIWD 4G7VH 1U8MB 4KQ0A 1ZK9A 4LEFA 2J55A 4YBQC 4HJTA 3VZXA 3VOJA 4U10A 3ZHFA 1QTYT 5IVXE 1GGIH 5M03A 5A6MA 4XVDA 2ICWI 4L5FE 2BX5A 3T6ZA 3TVMB 5LGJA 1MNSA 2LLEA 3ZJ7A 5BVPL 4O0QA 5KYXB 4WEEA 4GYKA 3PSVA 4FEZA 1OIOA 4HJFA 4ZSUA 3O3DB 4XO6A 3LENA 3VCNA 5DLMH 2HKAA 4KTYA 4BCEA 2WBJC 1O12A 3AQZA 1PBGA 5E95B 5EUOA 1A3RL 2E1WA 1I7RB 1VRXA 4LHUB 1NGZB 2R4SL 2ZJSL 3QR0A 2NWRA 1RIVL 3ZWTA 4R9OA 4PBFA 1A9VA 4ZS7L 1HI6B 3AM8C 2F53E 1QBMH 4E9VA 1K5NA 2X4TA 3WBAA 3NSXA 4JN2B 2DDQH 4MB1A 2ABBA 3FSVA 3VILA 1F86A 3RVUC 3NA9L 2WN2A 1KCUL 3TF4A 3HRPA 4DF9A 3UPMA 2C26A 3OIXA 4GVGA 2EKSB 4ODWA 2IPKA 3B0UX 3L3OC 4IKKA 1UUQA 2BBFA 3SY1A 4HFWB 3UZEC 1FWFC 5CPSA 1ZE3H 2CHXA 5E9DE 3HS0C 2OM5A 3EKZA 4O1BA 4PJ9B 4I5XA 1UUOA 4QDMA 4OFYA 3L66A 4G72B 3Q37A 1GGCH 5JW3H 5HI4D 3H7RA 1GR7A 4L61A 3GG8A 2J88A 2EDTA 5CJXA 1B88A 3O0KA 5CP7A 3EHBB 4QSFA 2Z4QA 1BV8A 1XXDC 1A7QL 3TBYA 1M03A 3QUXD 4FEIA 1MQ8A 5GISL 4IMLB 3ZKND 4DPAX 5F6IB 5SV3A 5D55A 1IGWA 4OUEA 1OAKH 4NENA 3WUWA 1BIIB 3STLB 1JNJA 1RY0A 3SOBH 3QNZB 5AFDA 3TN0C 2JKPA 3W5MA 4GYFA 1F8TL 4AZCA 1EGVA 4HWZB 2HE5A 3TIDB 1TU2A 1L8NA 3SSZA 4Q9RH 4MWAC 4MNGB 5M7QA 4JREB 3QJFA 4XPHH 2JF6A 1AGCA 2CNCA 2VMCA 3KLKA 1CK0L 5AW2B 5I1KH 1TNMA 3R8RA 1NJ9A 3ARDC 5T33H 1DYSA 3LEPA 1CE1L 5GSVA 1KXVA 4P2RE 1V7MH 3DK0A 3C60C 1ZBWA 5E5CA 1W1YA 3FA3A 3Q06A 4HQQH 4HUUA 2CO1A 3P0XA 5T91A 3VM7A 4QXGH 5MENA 1RP8A 1J5DA 4BSVA 2EIJB 2ZQKA 4HWBH 1F2QA 4CNTA 2I14A 4XR8C 3CWOX 3L0NA 2PP3A 1M2VA 2OX5A 3P2BA 4LS0A 5ESAB 5FECB 4MJMA 1J1OH 1I7ZB 4Z76B 1PZ2A 2HPOA 2VW4A 3LQLA 5AKRA 2I07A 4WWKA 1T66C 4E5XA 2C1OA 4UOJA 5ESQA 3QNYA 3BWAB 4EDXB 4O10A 3SCMA 5AHFA 1LD9B 2QGHA 5EFIB 2JXMB 2QJJA 4ETQA 3B2UC 5IVZA 1DDHA 3MBDA 2XSAA 3QXDA 1T1ZB 2R4RL 3G0UA 3CQPA 1PFOA 5FF6A 1XSJA 1ZLUH 1WWAX 1E5JA 2UZIL 4OR1A 4IX0A 3NIGE 3QUZA 3MRJB 1PX4A 1AZVA 3CV2A 5DEFA 3VFTB 1W3LA 3RDJA 1E4MM 5EA0H 4ADIA 3PWIA 2BOLA 4KC3B 4BRVA 2ITDA 1QPRA 3VFNA 2IJ0C 5F1KC 4WFHE 4GO6B 1TVHA 1WCBA 2QUVA 4FNUA 4U1MB 4Y1AA 1TJMA 1CFSA 5C0FB 4GNKB 3PZNA 2ZCKL 3N73A 4O00A 3FRPB 1WQVT 5J9PA 3ZU8A 3GMNB 2WIIA 1LBMA 3QV8A 4PV1C 4RLDA 2ACQA 3MU7A 2P10A 3SKJL 2ZYSA 3CTTA 4Z7VE 3HE7A 2EH7L 2AJZB 4IEFA 4IRSC 1IFGA 3S5LA 3ANVA 3IGLA 4B9GA 1KZYA 4CVUA 3I84A 1AXSB 4E6MA 3BSGA 1Y1UA 3PP7A 3VNDA 4DWSC 5TF0A 5I1HL 5D4HA 2XYBA 5F9WC 2D7TL 3K8MA 3QIUC 2W0UA 4QQ3A 2D4FA 3N44F 1ZHLA 1HU8A 2WMHA 4KBXA 5FUCC 1NDGA 1V3LA 8XIAA 1SN2A 4A8LA 2I5GA 1DBAL 5EN3A 2O9OA 4W9JC 1N82A 2NY4C 3PHQA 4NI6A 4Z7WB 1K8CA 3ZDZB 3NXLA 1GSKA 2KLTA 3ASWA 1F74A 2KZWA 4C7GA 4UINH 1YUHB 2C5DC 3C61A 5KSAD 4R83A 5CHNA 1NDTA 5JW4M 1TKWA 3AMKA 2G5WA 3OMZA 1KM0A 5HJYA 1U8JA 4PL2A 4ACZA 4FLRA 3M47A 1WX0A 3TWCH 4Y19D 4GLEA 3U46B 1Q90A 5H37A 4LU5H 4N2DA 2HRGA 2ZCLL 5T5NF 1MCWM 4K15A 1RIUH 2YAOA 1Z69A 2Y5TB 6XIAA 3TMLA 3SD2A 2WQAA 2YPVH 4ODBD 2FE0A 5GGRY 5BZDA 4XVEA 5EEXA 3EX2A 1A7PL 4ZUTA 3GYRA 1UYQA 4PRWA 1AIFB 1BEYH 1MCPH 5BMFL 1OP5K 1CLYH 1ZEAL 2YSWA 4M8RA 1NP2A 1SUJA 3DG6A 4JFZL 3E80A 1UMLA 4XP4H 4UWQB 1R4XA 2BS8A 1FZMA 2PZ0A 5AZEL 2ZXGA 4JGNA 2F1EA 1R19A 4CKVX 3AS3A 1QTSA 5CD3A 4JIEA 1K9DA 3U6XS 4PQXA 2B7OA 3QEQB 1FE8L 1WYJA 5DURD 1U41A 5LNDA 4FHAA 2XWRA 4JAMA 5B1CA 1AFVL 4IG2B 2C3HA 1S7VA 3L5WA 1MXGA 4LKCB 3LI0A 1D6VL 43C9B 1ZLDA 2DS4A 3HUJB 3B6SB 4XX6A 1VHCA 1OIMA 4PRHE 1G6RH 2XPYA 3HOGA 3GKWH 5FIPA 4A2FA 2L5HA 2L8AA 4PR5A 3AIRA 3G1HA 5A16B 5I17B 2UY5A 5CBJA 1IXQA 3JV4A 4GABA 4BKLB 1R5WB 2GQ9A 1JDDA 4M6NL 3TC9A 5EPMA 2LAAA 2H3BA 4LCWE 1FP8A 3GSRA 5I9QB 1RJLA 4GRWB 1QHPA 3BP7A 4BELD 2PAJA 1OZUA 5C6TH 2E25A 1A6PA 4MG4A 1A8JH 3RB5A 2PRMA 1IE5A 4NM8H 1WZ1L 1IBFA 4XSLA 5D9MA 4I77L 1SBBA 4CC4C 4KNUA 1THFD 4KRNA 3DPBA 3PC0A 2VZTA 1MLCB 5T1KA 3JWNH 4G83A 1XHHA 2YYTA 4PG9A 5FCUL 2UZPA 1DUZA 3AIVA 5FSEC 1S5IL 4QRUA 4ZFOA 3G6MA 3ZJAA 1TCRA 2F7FA 3Q1SL 1U95A 2VJ8A 3O6FD 4OCLC 2C9QA 3WMQA 5CD3B 5CZXD 3KS6A 2EG6A 1UXWB 3B06A 5I75B 2Z8VC 5C86A 1OYAA 3QBUA 1HL9A 1DWJM 3SDDB 2WJZA 4CJ0A 2PYEE 3MO1A 2DQDH 4CEXC 5EZIL 3E1ZA 1AC0A 1IKFL 1DLHA 1ZE3C 2OR9L 2R2BA 1JWSA 2YRPA 2QDGA 3IPEA 3QHFH 4U1KB 4DTGH 2Y7DA 2OXGB 5FW6A 4M8UA 2CGRL 5EEUA 4RE0A 1JNNH 3T0CA 4LASH 3MV7B 5TD4A 3O6LH 1ZXQA 4B4FA 3ULUD 5BO0D 3MHFA 5T5FH 3T3PF 3PAUA 3KW8A 3Q9PA 4NBXB 2QYGA 5C0RL 3MROB 3AQUA 4D6GA 4F0LA 1LHZA 1YEHL 4NBZB 4XCYA 4XTRC 1OYCA 5CLTA 1WOBA 1S3KH 3DGDA 1RH8A 4JRXD 1FNGB 3NM1A 3L1OH 1NU5A 4FXGB 4HEPG 3KAAA 4B3EA 5CFHA 2W6RA 1ZCCA 1TZGL 2FZDA 5CEYA 3KRUA 4R4BB 2X6VA 2FO1A 2BP5M 3GW0A 3LEYH 3DFQA 3WF1A 1DJYA 3KDNA 1UWSA 2EDJA 5EOCJ 3MSDA 3KPSD 2ISWA 2V7NA 5IJBC 5E1HB 2VO5A 1VLWA 1CS6A 1DBKH 3QQ9C 2GITB 2XSBA 5ABTA 3HMWH 1JDEA 1M7IB 4CCCA 3JWDH 4JHVA 4LGPB 4X6DE 3ZW3A 2GCYB 4E41A 1LE5A 1G84A 4RISL 5CGYC 4O11A 1BVWA 2WQSA 4AD0A 4LOUD 1I6NA 3KPLA 4GI9A 5ABGA 2IUZA 4JDVB 4B27A 4Z7UA 2NXYC 2OVLA 3DFSA 1AZ1A 4PI2A 4L1LA 4RNRA 2NQJA 2O72A 3PZTA 1Z6JT 4P5MA 2PDUA 3DX3A 4HYVA 2Q3AA 4I1RA 1F11A 4PJDF 3ELFA 2HS8A 1OOWA 1DQLH 4AWTA 3DI0A 4JL2A 5JW4Q 2ZWZA 4M7TA 5IMMB 3GHEL 2VRJA 4G80B 4QTGA 4Q4EA 1DIOA 1HYRC 2QEJA 4X8JA 3RX4A 3EOAB 1AZZC 2NQHA 4MJIA 3W56A 2C9SA 2MCPL 4WY0A 1EVUA 3LD8C 1FWJC 2E5BA 4PBDA 1IYXA 1THCA 3GO1L 1KEGH 1DQQB 2EPLX 3G9VA 3KBSA 1KYDA 1MCQA 1CXFA 4JE4B 4D0BA 2J5LB 3MYJB 1DEEA 2FJSA 5IJVB 3ZVIA 3ISWA 3AIEA 4KU1A 1AI1H 1NLBH 4U1GC 1N6UA 3MV8D 2A38A 5IP4A 2CK0L 3KRZA 3JW7A 5DHVH 3NAAH 4IJBA 3V0SA 5JZ7D 4X9GA 2Y1AA 2OBGA 1ED3A 2FJGA 4NQVA 5DSCA 1H5YA 4CN6A 4MXWL 4QM1A 1B57A 4OGQC 4XMWA 3CFCH 3MLUL 1HNFA 1FGNL 1KCVL 3KBFA 4PS4L 4L3EE 3HG5A 2V9UA 4M80A 4F37F 2FJKA 1SZNA 3QUKA 3I6KB 2O6PA 1WV2A 1MAJA 1NOFA 1IT0A 4IOSA 5BQ7B 2OO0A 5DK0A 3R0UA 4YGAB 4WK0B 2APFA 4X42A 4J4PD 4S0SD 4GJIA 4FTVD 5GS2D 1TE6A 3FFCD 4GXVL 4J8RB 1MCDA 1YPXA 3VXRE 2BLFA 4LSPL 2AL2B 4PJ5E 2HTMA 4DP7X 3R7RA 1VZWA 3PWPD 3RFZA 1SLXA 5DWPA 2QKIB 1OTUD 2H2SC 4YBLC 1DTNA 3P4OA 1A5AA 3VAVA 2YUZA 4R7DB 2HMIC 3WQOA 1VFBB 4NRYA 4F0MA 4K5MA 1WXZA 4JQVA 3M5XA 4G7RB 1OO2A 1MCEA 9XIMA 3AS0A 4WCYL 5H6HA 5JIPA 1IT7A 1XPYA 2RJHA 4JHOA 3B5HA 2GQHA 4A63A 3OJDB 3A24A 1F3EA 3VRLF 4Z1AA 1RJQA 5I2IB 3K4AA 1JUBA 4APQA 4TUKL 2JV6A 2BVOA 4PJBE 1ADSA 3D0AA 1UM6L 1Z0NA 4JDTH 1XLGA 1BJ8A 4UFJA 4KPHH 3D30A 5FA4A 2YCEA 4UT6A 2XN0A 3V0EA 3TCLB 4TMCA 1MVUA 5I6LA 3D2UA 4KZ0A 3WQ6A 2XNAB 2BWQA 2V2TB 1OVDA 4BQ6A 1OX4A 1F5WA 3VOFA 1KB5H 4GO8A 4PMVA 2V0AA 2HH0L 2CXKA 4IBWA 1NCUA 4HJJL 3GG7A 3O6YX 1XTLA 1NC4B 1HILA 3S4SB 1RZFL 4ODSL 1HZYA 1KXTB 3DO4A 4F7PB 4PAZA 3O0RH 4TNGA 3WGUB 3WLWD 1S5TA 3AAZB 1EIBA 1ZLWH 1HZHL 3HVDA 3D39D 3OKKA 3QEGL 3KPOB 3U4KA 4JFYB 4NLAA 1VGKB 3MT1A 3IFLL 3UAJA 5E8DL 5IBLC 5AUMA 4U7MA 1QSFB 5SWSE 1XVSA 1BW8A 4O16A 4HHAB 3T2NL 3NL2A 5LAXA 4FS0A 1CUOA 4YUEH 2NXGA 4Z2HA 1HFUA 2DOCA 4BKNA 5C2GA 3RU8H 4DVRL 3HB9A 3C2VA 5DT1H 3QORD 1C9DA 1NANH 5BUGA 2D8KA 3HCVB 4NN6B 1UOKA 2FQFA 5ICUA 5LBVA 1F6AB 1MFDL 3E2SA 5IR1B 1XWVA 3A6OA 1GMIA 3ESVF 3HZKA 2A6KA 3MGTB 3W2DL 2BGQA 2VISB 3PWJA 2FB4H 5KITA 4LQFH 5ADOH 1SJBA 2CA3A 2SFPA 2JMRA 2J20A 1KLGB 2VDQB 2HVKA 3ZIZA 5T3ZL 5FHAH 1HX0A 5E2TL 4FQ2L 1BYNA 5IOBA 1WD9A 4HF5L 2P5EE 4ONGL 1PE1A 1EX0A 3FF8A 1N3NA 4OF8A 4PTWA 5J13C 3VIHA 5CC7A 1AS7A 3VGGA 4QP0A 4JQAA 1FN4A 4IHOA 1GPWA 4YDJA 4CQ8A 1D8CA 4C54A 3WFBL 4ZXBA 4LL1A 2WWKT 4MNMA 2WO2B 3UH8A 1I9RL 4BFIA 3L95B 1NUFA 2VM4A 1IGJA 3M7FB 3SQMA 4AD1A 3UPWA 4EKXA 3SEPA 4RFEA 3U83A 3PWVA 3LN4B 4RNIA 2XV6B 2LHAA 2ONEA 3WY4A 3EB2A 4D8LA 2E8YA 4UT7H 3DTXB 3SB3A 5ECJE 3M1BB 3KWUA 5DBUA 4I3GA 2XN1A 4MY1A 3NFPA 4BQ4A 1PZ1A 1PL9A 4UXDA 3BD5A 4K8RH 4HPOH 3JUZA 1WO2A 3CLEH 2BDQA 3ARTA 3EJQA 1AR1C 4LIQL 2DQIL 5K3VA 2CR0A 5DR5H 4MNQB 15C8L 4RCXA 4ZUSA 2BRQA 2ZAGA 1VKXB 1KCXA 2ZG1A 2WQPA 4MB5A 1MI3A 1LILA 3RIAK 4RL3A 4RCAA 1BZQK 3KBMA 4JD4A 3UTZA 3CHFA 3NQAA 1DVXA 3BIAX 1P84K 5GRJL 2PR9A 4U2ZA 3WO4C 4JQIA 4O15A 1DXFA 3VGAC 3QHTC 3C09C 3ES6B 4TV3A 4PG2A 3CQHA 3SQSA 3WV0A 1ITQA 5TE7H 1U4EA 2G3JA 2OMXA 1TZAA 4LLYB 3O4LD 2H0PA 2Y2WA 2Y2YA 1GTNA 2W8CA 3I10A 4U1LB 1M1XA 3NCJL 3O7UA 3MV9E 4EI5A 3VYPA 2C71A 1BP3B 5D38A 4XBGB 4GQ9H 2Q1EA 3ZHDA 3QWRA 3TPUA 4NNCA 1CI5A 4X7TA 5G1YA 4NQDE 5L2KB 5I0XA 5F0PB 5A95A 5CZRA 1JCVA 3QVQA 4HS6A 3NZUA 1NWSA 3THQA 1O4UA 3C6SB 1XX1A 2NSOA 1J7VR 1EO7A 3HPLA 2NT0A 2GIXA 2H4EA 5EDSA 2V68A 2WMPA 3EZ4A 3CDGB 4G6AC 1B3OA 1YQVH 2GSHA 3PWUB 2B0SL 3KW7A 3RBSA 3L4XA 3DHUA 2FWOB 2X4RA 1XIBA 4NPJA 5IB5A 5FV1L 5JH1A 3RVTC 1GPOL 4U1JB 5DQ9B 4FQ1H 1G4SA 2XTJE 3ABRA 2WXRA 1N2RA 5T9BG 4HXAH 3EXTA 3QEHB 3E0VA 4UQ9A 5KYWB 1E8ZA 4NQSB 4H6KA 5CSRA 3UU0A 2FJHA 2VMDA 2GGJA 4Y5XC 4P8WA 4WAFA 4NPYA 4MAYA 2N4IA 3UJTL 4HC1H 4Q9QL 1JDFA 3KUMA 4U2YA 3TN3A 2B1HH 1R5VB 1KNOA 5KTEH 3BOFA 1DVYA 2Y7LA 3UTPE 1MMFA 3IU3A 3I9AA 1DBJH 3G5VB 3Q05A 4WFFD 5JMOC 4E3TA 2ZXWB 4G6ML 1IEBA 1QI3A 5H2BB 3SYPA 1MHPL 1S5MA 1WAPA 2DM4A 4LLDA 2OK0L 4M1GL 3CL8A 5BRZA 1KXQE 4J6IA 3MRLA 1WBHA 3UJJL 1BREA 4HKZA 2UWEA 3S2MA 4YVUA 3VO0A 2FB3A 2GUBA 3SPIA 3B40A 4TO8A 5ICYA 3LKNA 4YSCA 3VQ1C 4N3UA 4CLMA 1XCQB 4P5KB 2ZXEB 3PIQA 3CN2A 3CFJA 5EMLA 4WTXA 4MA1C 3JV6B 2CGYA 3AICA 2YBGA 5HP5A 3ZBMA 1S7TA 3WH6A 3S1VA 2J4WL 5AYUH 2ZBTA 3NIFE 2F7IA 4MNKA 3KJ6L 4PB0H 3B2DC 1W1VA 2HUEA 1G0DA 3MGOA 5F93C 4PJEE 1FZOB 3Q0HA 1FFQA 2C3VA 1YEDB 1CYGA 4I8DA 5GRXG 4OV6F 1TVPA 2VXTH 4OZFH 4Q3MA 2ZA2A 2R1LA 5GGQH 1WAAE 1A53A 2QSQA 1S7WB 4G43A 2ZSVB 3UYRL 2Z0UA 1PEWA 4UM9B 3GC2A 3TF7C 4DPCX 3WMPA 4C6CA 2FLBT 2N3JA 4YSRA 1U91B 4BA8A 4AH2B 2BOBA 2ZZ4A 4K7FB 3HPJB 3JSSA 4D71A 3GVVA 3W38A 3MDWA 1MHEA 2D7OA 4QLLA 4PWFA 4J2MA 4NRZB 3RIKA 1DANU 2BWIA 3TVAA 2EVHA 5KSBA 3MRNB 2VITA 3T40A 5C0DB 3PREA 2I5YL 2HG5A 3LU2A 3LS5L 4WU5B 4PP1D 4P2OA 2XH2A 4JFOB 2GUOB 4MNHA 1VFOA 5A5WA 1NP0A 3MLSL 3WJLA 1A5KC 5A94A 3IU4L 2C1IA 3V4LA 4R7JA 2ZDRA 4O1DA 2LU4A 1DE4A 3UXFA 3MMEA 4YHKH 4NQEE 5JO5A 4WI5A 5ANMB 3O05A 3T0EE 2QUNA 3RGVC 2IDUA 1ZAHA 1AH1A 2FNWA 3GGWB 1VBHA 5BW7A 1UB3A 2FDBP 3ZKXC 3DRTA 3M8OH 5CUSH 3W9EA 5INDA 2JB5H 5JOEA 1SLVA 3SW6A 1JIBA 7TAAA 4M5SA 2P48B 3SGDI 2ACUA 4DZ8B 4GBXA 4C5ZA 4HK5A 4NWTH 4GKZA 3Q8BA 3S37L 4ESKA 4IPJA 4H4IA 1JGLL 4HYTB 3WHE1 3VRJA 2PDHA 4ECNA 4IQJA 3LKRA 3O07A 1PIIA 2BNJA 3GJFH 3WNIA 1I2OA 2GYSA 3CASA 2PP9A 3B2PA 5A2BA 2R29L 1UENA 2FD6L 4I48B 3OAUH 3CSYB 2H90A 2QADB 4IGMA 1X6LA 4I3RL 3MRFA 4DGIH 2G97A 5C0CB 3VWKA 3QULB 4OD2A 4YSDA 4A38A 1IGSA 3SPVA 1A7BA 2OT0A 4I9MA 4LEEA 3QYQA 2AVGA 3NJGA 1MUMA 1UT1A 1AHKA 3U1QA 1CQYA 4K7PH 3QDHA 3KOZA 3KLAA 5EMKA 5FF0A 3CMOH 2IPWA 4K94H 4QXUL 4PFMA 4DFHA 1CURA 3W7NA 4S0HA 2BB0A 5HQLA 1JD9A 4AQ1A 2FHFA 3V6BR 4CQBA 4PW3A 4HUVB 4LCYB 4JO3H 2NR6A 1PKQE 3Q2DA 2AFNA 3TWBA 3SFKA 4YNGA 3W0KA 2NY3D 1ZJBA 4Q4PA 4GX8A 5AD0A 1LRNA 1P43A 4LP8A 2KAUC 2GTQA 4N2NA 4B95C 3D12B 1LEKB 1NIEA 1Q9OA 5FSDC 4NM4H 4RDQG 1GVFA 3BKML 3W1AA 3FONB 1MCRA 1USQA 4JFPB 3OHIA 2RUSA 3K91A 4GQPH 5CR8A 2BIMA 1ODUA 2ZAHA 3M16A 4ORGB 1JVKA 1OHLA 2D0GA 2EJAA 3EOBA 4FFYL 3FXYA 3QY7A 3QO1A 4B9KC 5JR1L 3BVVA 4YXLL 4N9DA 4LYQA 3OG3A 4YHML 2OAAA 3SYAA 3BG9A 4DY1A 2C0HA 1MNNA 4IIQC 4M9OA 5CAKA 1FDLL 3VMPA 4R5XA 1JUKA 2IBZY 3S3DB 2YSSB 3FQ4A 3CMGA 4B60A 4XVSH 1KB9J 5DVPA 3T05A 1XL9A 5C2BL 1QFUL 1DV7A 3K1KC 5E94A 1D5XB 4ZTPL 4F2BA 4YVNA 4K8RC 1LMIA 1NEZB 3C2FA 1A5FH 3NJIA 3CZ8A 2LGNA 3VFWB 3GD1C 2PKDA 5GGUA 3VFUB 3VMOA 4OQVA 4QRRB 1YMHB 1D3CA 4GZEA 2RMNA 4L23A 3UZJA 4IPLA 3PF2A 4PJXA 2RTTA 3B2VH 5F72S 4IXXA 2NQLA 3Q45A 5K9KB 5HANA 4HX1B 3T77B 5EDXA 5K39B 2V5BA 4R4FL 4FZEH 1I45A 5ICXA 3Q8FA 1U8LB 3N9GH 1VYPX 2V5LA 4IJ3B 1U3HB 2CRMA 2F7PA 3R13A 3QZEA 1FGVL 3KH3A 3ZLQC 3NQEA 4C6BA 2WN3A 4WIQA 4OLYH 1XDLA 2XJKA 2VDOB 1VF8A 1GJPA 1JGDB 3BD3A 5E51A 5C9RA 4TV5A 2YFOA 4WI7A 5AVRB 3PQYD 4YVPA 4CQDA 2CBVA 1EHXA 4ICMA 2BSRA 1OSPH 1ZKAA 3FCTA 3VG9C 1UP3A 4QXTB 4LEXH 3BGMA 3C6LC 4JFDD 2F6UA 1NMBL 3DVFA 3ULVL 4Y6GA 4CN1A 5A2JH 3UO1L 2OL3H 3H3PH 4XVUC 4OCYH 3V75A 1Q9WB 1VPQA 1BWMA 3HC0B 5AW6B 1X1NA 4NAQA 3PZQA 3DC8A 1TQXA 3BT0A 3ZE1B 1A5SA 3G5XA 3HMXL 5GXBB 4P4KD 1HSBB 4R4ND 5D2LB 3FQXA 2ZX9A 1F3RB 4KI5E 4HIEB 3PWAA 4YWSA 1IO4C 2HDJA 4FABH 3EO0A 1KGCE 4F7MB 2G2RB 1YEKL 3F2DA 1CL7I 4P2QE 1QBAA 5D2NE 4GIOA 2ZKMX 4JY4A 3ENEA 2KZKA 3JZUA 3OBAA 5MKGB 1T21B 2XTJC 4R2GD 1OP4A 2FTPA 3SJVD 4CNNA 4R97B 2NXIA 5HA7A 4DOHB 1B0GB 1S2VA 5CKSA 4BXVA 1W2PA 5EMUA 1R7OA 2GHWB 3OAYH 1MWAH 4HCRA 2CUHA 3B9EA 4YYFA 2DY2A 2FEDD 3HS8A 1UFUA 3CXFA 3QIBC 5JQ9A 1ZTVA 4OWGA 3ZVVA 1HDMB 3LVEA 3VOCA 1U3JA 1BOYA 3FU7A 3RWJA 1P4LB 4WQOA 2PU0A 3NACH 1ETJA 2AQ2A 3L5HA 2Q7YB 4FYTA 2CLZA 3F12B 4GFSA 5CZSA 2DZVA 1OX5A 1JZHA 1Y0EA 4NIYE 4PJHB 3LIZH 2ZTJA 2PYFB 4ZAKA 2ATPB 2XG5B 2AXGB 2XHYA 2XJ7A 2YBTA 1EJTC 3PCYA 5TIMA 2VDQL 4TRPH 4DCQA 3P80A 4E8CA 3V4VH 1GQKA 3V6ZA 1IE4A 4KKCD 3MUIA 4M7JH 5F9OH 3FSZA 3W5NA 4ODXA 1HYSC 2HT3C 2IFGA 4E8DA 3V6FA 5BU6A 1GGOA 3LXAA 1RULH 1SHMA 2F08A 1AODA 4PGLA 3I9GH