5TD4A

Starch binding sites on the human pancreatic alpha amylase d300n variant complexed with an octaose substrate.
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHNNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Evaluation of the Significance of Starch Surface Binding Sites on Human Pancreatic alpha-Amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2016-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5td4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5td4A01
3CZGA 1V6WA 2X0YA 3WH7A 1J01A 4CD8A 1QW8A 3AISA 2WANA 3GBDA 2FHFA 1QHZA 2GJXB 3KE0A 3OIHA 3WY1A 3ZO9A 4PMOA 5JUVA 3WEOA 3FHQA 1CENA 1OT2A 1V3MA 1TQSA 3GBEA 4WSKA 2IXVA 3ALGA 4LYRA 1BAGA 3BVXA 1GJUA 1T0OA 1VBRA 1E6XM 1V3LA 1L0PA 4PMQA 3SCNA 2QHAA 2YL6A 1UKSA 2EPMX 1HKMA 3WNLA 1VFFA 1J0JA 2NT0A 3AIQA 3AIWA 2QMKA 3NSNA 5LA1A 1PZ2A 2VCBA 1KWKA 4J3VA 1VIWA 2BNJA 3TONA 2V3DA 3EDKA 1LG1A 3WD2A 4P7QA 2EQDA 1JFXA 3WF1A 1ZL1A 2X2YA 4QLJA 1M03A 4C7DA 2EPNA 1LQ0A 1CDGA 1KTCA 3EJPA 3AZTA 3WH8A 1D3CA 2IGTA 1X1NA 5GNZA 1XH1A 1V6YA 3SCQA 1JXJA 5DT5A 3RO8A 3MO4A 1GQIA 4BCEA 1G9HA 3VDBA 4CN4A 1ISXA 4TVUA 3BC9A 1EO7A 3RIKA 4AMCA 3RMEA 2WWCA 1SMDA 4Z2IA 1XSIA 5A8NA 1BLIA 2C0HA 2V5CA 1JZ7A 2GUYA 3VDHA 3GDBA 2GVYA 1JAKA 3VSUA 3VIPA 4AZHA 4PMVA 1DWFM 1LWJA 3AS2A 1C7TA 2CBIA 2VC9A 2D22A 2BFGA 1UZ1A 3W28A 4EANA 3PZOA 5D9NA 4AEEA 1BPLB 4D6DA 1R7AA 1EQCA 3I3EA 4JL2A 1JD7A 3RJYA 1E6ZA 3K46A 1H4PA 1GOWA 2VZTA 4TX6A 3NDZA 3VGDA 2D1ZA 3ZM8A 5JBFA 1Y7VA 2WMHA 4BQ2A 3WQ6A 4CU6A 5I3DA 1HWWA 2J7HA 4EK7A 1BSIA 4JL1A 1F4AA 4QDMA 3A3HA 1V6VA 4HZ8A 5C70A 3A24A 1UG6A 3OBAA 1K9FA 4MTVA 1KXHA 2F1BA 2YOCA 2BVDA 1GOIA 2QPSA 1NWTA 3GTNA 3WBAA 2X2HA 6CGTA 2F7RA 7A3HA 2Y4SA 2PWHA 4OIFA 4KRUA 3CUIA 1E4MM 2W91A 2X0HA 3ALFA 1JZ3A 2PF0A 2YDSA 2VZUA 4UFHA 4V27A 3WDPP 2Y8KA 4AIOA 3CUHA 4IPLA 1B3XA 3OLDA 1TVNA 3W27A 3ZSSA 1JNEA 3J7HA 3AJ7A 2XIBA 3F5JA 5FOOA 2VNCA 3WY2A 1MYRA 1XD0A 1GUVA 2CKRA 3LXCA 1R85A 2JEQA 4NX0A 2YFOA 1W3JA 4CVWA 4WK9A 1NP2A 1CPUA 2E0PA 4R5EA 2GJRA 4FF5A 1B3WA 3WNOA 2D0GA 3GNRA 4HP5A 1WZKA 2X8RA 1XD1A 1UKOA 4HMDA 4PMUA 4S3JA 3G6MA 3LPFA 4MNJA 4P7LA 3IK2A 5BRPA 3VSVA 2DH2A 4XB3A 5I77A 2NW0A 2XFYA 3GXMA 2J7FA 1RP9A 1FFQA 3FY1A 1BVNP 3ARWA 4ACZA 1VEOA 4OBRA 3IANA 3WMSA 4RL3A 2MANA 3KEHA 3LXBA 3DHUA 2XWEA 1J12A 4CN1A 4BQ3A 1UH4A 1V0KA 1UUQA 3I3DA 1H5VA 5CPSA 3TTSA 4P7OA 3EJUA 5BXSA 3G6LA 1ZBVA 4W87A 3AXXA 5HPOA 3VM5A 4IUGA 1UA3A 2EO7A 3WEMA 3D4YA 3BMWA 4HPHA 2DSKA 2ZUUA 4UQEA 4UR9A 1ODUA 4E8CA 4FNUA 2XIIA 3PTKA 1GHSA 1VEMA 1UHVA 2WVVB 1DWAM 2ZUNA 2YIHA 4BS0A 2Y8VA 1H0IA 1AQ0A 2YA2A 1B30A 3WL0A 3VUPA 2B31A 1OBAA 4NF7A 1QX1A 2WHMA 3WDJA 1MQQA 3BUPA 1W91A 3BLKA 2ALWA 4AZCB 2FYVA 1JF6A 2IXUA 1I1XA 2WYSA 1BGGA 4HOWA 2NT1A 1V02A 2ZXBA 4YHEA 5EBAA 1EA9C 3POCA 1OGBA 5JIWA 4Z2JA 4W7VA 1NWSA 1KQZA 3ZMRA 3BAWA 3VGHA 1H2JA 1MQRA 5I2UA 5CPTA 2Y2WA 1CXLA 3H54A 2XTKA 3VD4A 2D0FA 1P6WA 2GSJA 3RPMA 4U31A 1GNXA 4U2ZA 5M03A 1HJSA 4WJXA 1JI1A 4D6FA 5FD0A 4OZOA 3RDKA 2X05A 4OKDA 4LX4A 2EACA 2Y24A 3AYSA 1UKTA 5EMYA 4AISA 3SUTA 3WY3A 5I0DA 3W6MA 1WE5A 3ZQ9A 2V3GA 4UFKA 1H3GA 1HVXA 2CCRA 4AD4A 1OSEA 1UKPA 2W62A 2EBNA 2JALA 2OWXA 3GM8A 3AMDA 5I78A 3K8MA 1FA2A 4UQBA 2WWDA 1DEDA 3CLWA 3W6LA 1C92A 4ACYA 1E0VA 3CC1A 4RE4A 3U5UA 4LQ1A 3AICA 3BAJA 3BXWA 1EQPA 2TAAA 3VX0A 4W86A 1WZLA 4GINA 3WL1A 2VVNA 3ARQA 3QOMA 5HPCA 2CPUA 4M1RA 2XJ7A 3SCOA 4W84A 5A69A 4Q22A 2XVKA 1TUXA 1AQMA 1KQYA 2YL5A 2YJQA 5IHSA 2VRQA 4NZJA 2E4TA 2CITA 1G5AA 3EJRA 1CGVA 5LA0A 1JZ8A 2ZXAA 2X2JA 1PBGA 5F7UA 1ODZA 2A3AA 3HG3A 1E43A 2VX7A 3BCDA 2YDQA 1H49A 5BCAA 4DWSD 4ZFMA 2XVPA 3BLPX 3POHA 3BVVA 1X6NA 1UD8A 1E0XA 3ARTA 1EH9A 1J10A 3PN8A 1OIFA 2WHKA 2WBGA 4V28A 2XGBA 3UCQA 4WLCA 3MUAA 2BXYA 5D8WA 4CKQA 1HKIA 4FLSA 2FHBA 2WC4A 3NSXA 3NUKA 3A4XA 1G01A 3AHYA 5GPRA 3PZMA 1WCGA 3PTMA 3WD4A 2WHLA 4MB3A 2JEPA 2DPEA 4JCLA 1Q6CA 2WCGA 2YLAA 1KBBA 4BA0A 3WKZA 3WSUA 4MNLA 4CCDA 4OBSA 4KGJA 4U5IA 3CHDA 3LPOA 4BF7A 1MW2A 1BTCA 4PTXA 3LPPA 5E1QA 3TTYA 1GONA 4FNRA 5LYRA 3FHAA 1VB9A 2DSVA 1UA7A 2WLZA 4WKAA 3SUWA 1HVQA 2YA1A 2W66A 1GCYA 4WF7A 1V6XA 1B2YA 1HJQA 5M3WA 1ITCA 4QFUA 1CBGA 2UY4A 1KWGA 3SEPA 5D8ZA 3VIHA 2CHNA 1VFMA 3U5YA 1HXJA 1JF5A 3NJ3A 5DMYA 4HMCA 3N15A 5A6BA 4W8LA 4ML4A 2F2HA 1OB0A 1ZU8A 3ZOAA 4IPNB 4AD3A 4CVUA 5A6MA 2WCSA 1E6NA 2J7GA 3ZSTA 3FNDA 5BWFA 1QHOA 3BAYA 3GXIA 2EXOA 3L4ZA 1MW1A 1W9VA 2YA0A 3BSHA 4FNSA 5D9MA 2ZX9A 2O9TA 3CZ8A 2VTFA 3W26A 4D6EA 2IUZA 1QOXA 1O7DC 1LF1A 2WVTA 1FHLA 3CHCA 3SCWA 3AMGA 1PX8A 4A3HA 1Q6DA 1BQCA 3AIEA 2BV9A 2WLYA 4GZEA 3OGSA 2DT3A 2YKKA 2OYMA 2D3LA 4RE2A 3NYDA 3NCOA 1PIGA 4NXKA 2OWCA 2ZWYA 1CGXA 4MJ4A 4DM2A 5IHRA 1FHDA 4H7VA 5CGTA 4AEFA 2PWDA 2WMFA 5FKYA 1WO2A 3WD3A 1KXVA 3A6OA 3VX1A 5A8PA 4FLQA 4D6HA 2D0HA 1R75A 1C91A 3WH9A 2E9LA 2XVNA 3WF0A 1H1NA 5CLTA 1NWRA 2G8ZA 3AZRA 4UQDA 3UR8A 3M6DA 4AY1A 4J3SA 5DO8A 2J79A 1QNOA 3RILA 4X0NA 3WUFA 5BRQA 2EPKX 3CUGA 3MUY1 2ZIDA 2PBOA 4Z2KA 2VZSA 1UQZA 1DTUA 3VIIA 4QLLA 2UWFA 2A3BA 2A3EA 2A3CA 2O92A 1CTNA 4K68A 1WDRA 5A8QA 1HJVA 1QWNA 3BAXA 3IAPA 1ZBKA 1M53A 1JGIA 1HKKA 3F4VA 2WMIA 4JCMA 1V02E 3RJXA 4D6GA 1GQJA 2GDVA 3VIOA 4EE9A 3WMBA 4GQQA 5E6ZA 1TR1A 2F1AA 4D6JA 4F9DA 1C8QA 1HJUA 1V3KA 3QGVA 1E9LA 1SMAA 4JIEA 3IJ7A 3M07A 5LA2A 1OWQA 2DIEA 2GFTA 1CWYA 4D6CA 4HA1A 2J62A 1KCKA 5BXTA 1FP8A 2PWFA 3T08A 1LLOA 2O9PA 4DWSC 3AIRA 5CGMA 1R33A 3ZJKA 1C93A 4F8XA 3TV8A 1WDPA 1TMQA 2W63A 3VO0A 5FL0A 1TFVA 3M46A 4ATDA 3HZ3A 3WQ4A 1EDTA 1C7SA 5ABFA 2AOSA 2VL4A 4PMZA 2VURA 3KL3A 4HA3A 4BQ4A 4HOXA 3UG3A 1DWJM 2WC7A 2CIPA 4GPNA 4URIA 5E0FA 1CXKA 1ZJAA 2BXZA 1O7AA 1GORA 2WSPA 2DSZA 4U5KA 3D3AA 5CPQA 1NOWA 4BQ5A 6TAAA 3CZKA 2ZICA 4AMWA 2YL8A 1H11A 3OG2A 1PPIA 3WQVA 2OSWA 3DX0A 2ZX5A 3D52A 1WZAA 3MSGA 1MVYA 3SCVA 1VFOA 4Z2HA 3HG2A 3CZEA 2GDUA 4S3KA 3KLLA 1WDSA 1PS3A 1XYFA 5CZKA 2WAGA 3GXFA 3N1AA 4P8WA 2BY2A 4W8AA 4QCFA 4M80A 4Q7NA 2XWDA 5JBDA 1JG9A 4W89A 2J77A 1XC6A 3ARZA 2WMJA 3SCRA 3OLEA 4NSBA 4AD1A 4H8UA 3ECQA 3CBWA 3GNPA 4MAZA 4GQRA 5CG0A 4OJYA 1N82A 1BFNA 4B9YA 1ISZA 5ECUA 1C3FA 4AZ5A 5I5RA 4JFTA 1W1VA 1DWGM 2J7CA 1MQPA 2VZVA 5DEZA 1JZ2A 1MFUA 3N17A 4EAMA 4TOQA 2WKGA 3AOFA 4JHOA 3AMCA 5CSUA 1U2YA 4PBGA 5GQBA 1UYQA 5I79A 3OGVA 4GI9A 3T2PA 3W25A 2G4FA 2ZX6A 3FXYA 3B9AA 1F4HA 1KTBA 3BUIA 1UQYA 4J3UA 4HMEA 4D1IA 3MANA 2Q8XA 4DO5A 3SUVA 1QNSA 1UD4A 1JI2A 1V3JA 1ECEA 3QHMA 1RP8A 4W85A 3EJTA 4NZFA 2AAAA 1QI4A 4M56A 3A47A 2XFRA 3HMCA 4X0VA 4AD2A 2J7BA 5E70A 1HJWA 2E40A 3WD1A 4NZCA 3ZT6A 3VIJA 4B3LA 2FDMA 1TG7A 4UOJA 2GK1A 1LL6A 5DFAA 1CXEA 3WEZA 4J3TA 3VMOA 1QNQA 4KMQA 1GQKA 1BYBA 4JKLA 1CIUA 1W9XA 4W7UA 3K4AA 1UD6A 5BXRA 1UD5A 1VFUA 5A6AA 3W37A 1EIBA 4D72A 2W61A 5A8OA 1UR2A 5EFDA 4DUWA 3VGBA 1HXKA 3A4WA 4Z2LA 1ESWA 2E3ZA 2OSYA 1I1WA 4CCEA 1KR1A 1NOUA 4KH2A 1Q6FA 4TVDA 1VRXA 1HP4A 3KZSA 2VRKA 4JFUA 3WUGA 2VRJA 1HTYA 2CBUA 2XYLA 3AIUA 4GXPA 3PZQA 3DX4A 1XHGA 3TP4A 1K6AA 3VU2A 1LJYA 3N18A 4HZ6A 4WSJA 3W38A 5M5DA 2E8YA 1SYTA 2V3FA 3LRMA 2BY0A 3VMNA 1HKJA 3APGA 5FL1A 4PTVA 2D2OA 1LG2A 4AYSA 1O6IA 1E3ZA 2JE8A 3GH4A 3L4UA 1GZJA 4H8VA 2ZWZA 2G3NA 1WAWA 4PN2A 5TD4A 1CGWA 3CTTA 3EDFA 4J27A 1SR0A 1KXQA 3WDIA 4DM1A 5I24A 3MUZ1 2FGZA 4CU8A 1J0ZA 4J3WA 4JHZA 4OUEA 3ZT7A 4YPJA 4GIAA 4HU8A 5A6LA 1KCLA 4P8XA 3AS3A 3THDA 1E5NA 1R46A 4HU0A 4NRSA 1JIBA 1JYWA 1J18A 2F7PA 1E5JA 3PZTA 4TVCA 2OYKA 2D3NA 5HNNA 4GI8A 5E9AA 4QP0A 1CZ1A 4AMXA 1C8XA 4NRRA 1QNRA 3KL0A 2VQTA 4ATWA 3TOPA 1UH3A 2VX6A 3CZLA 3LPGA 3AXHA 2CHOA 2WM0A 3GNOA 3WNKA 2VUYA 2G41A 2OWWA 4MAVA 2ZX7A 1B0IA 5HBFA 3CV5A 2BS9A 2X09A 3HU7A 4XV0A 1W2VA 1E56A 2WKLA 4M29A 1HN1A 1EDGA 1KGUA 3AMKA 2J8GA 3L4YA 3VIFA 1FFRA 1UZ4A 3LRLA 4HTYA 1KR0A 1WZMA 3QOKA 2JF7A 1OGGA 4FMVA 3DX2A 1QBBA 3BH4A 3AIVA 2E8ZA 1DP0A 4GZIA 3FW6A 1VAHA 3UG4A 1BYAA 3ARSA 3IJ9A 2DSUA 3VPLA 3DDGA 1WB0A 3DECA 5JBEA 1KFWA 1LL4A 1PIFA 5D9OA 1Z32X 3WDQA 3CMGA 3ZR5A 1JFHA 4QLKA 1UWRA 1JD9A 1B90A 4LYQA 3PZGA 1FP9A 3BVUA 1R47A 1KXTA 3VMPA 1KBKA 2J25A 1DWHM 3MV01 3WUBA 4AZ7A 3HG5A 2VCCA 2ZXQA 4ATLA 1JAEA 5IFTA 4MDPA 2F8QA 2JIEA 4L4PA 3GXDA 1JXKA 2VR4A 1PJ9A 4PCSA 3L4XA 4XZBA 5E09A 3T2OA 4W5UA 4PMDA 1C8YA 3WBEA 3D50A 1GQLA 2WZHA 1D7FA 1OT1A 3MU7A 4DWSA 1HX0A 5C71A 4J3XA 1E73M 5HDRA 1KGXA 3ARXA 2ESCA 4W93A 4D1JA 1W1TA 2VR5A 2CESA 5A6KA 1NP0A 1U33A 1J0KA 4AIEA 1CLXA 3VIKA 3KWXA 3DYPA 1E72M 2XN2A 5A8MA 4OOZA 1W1PA 1UR4A 2ZE0A 3KL5A 4P7NA 3EBVA 3EJSA 2WMGA 3CIVA 1BG9A 3FAXA 3ZJ7A 2QV4A 3S5ZA 3SIMA 2XN0A 2WK2A 3VDAA 4TXEA 3T09A 3VD5A 5A6BD 4UQAA 4C7FA 1QPKA 3VGGA 1JDCA 1B3ZA 1ZBCA 2XSAA 2NSXA 4OGZA 1XRVA 4WIWA 3TA9A 2J74A 1K9DA 2WW5A 3O6AA 1DWIM 1RPKA 3VVGA 2WSKA 4E8DA 3B9EA 3B8SA 3A22A 2PI6A 1XSKA 2WPGA 2W4XA 2OSXA 2CYGA 3VSTA 4PEEA 3WUEA 1UWTA 4GO8A 1RD6A 2VZOA 1UR1A 2CKSA 3W81A 1JZ4A 3OB8A 3VNYA 1LWHA 2GJPA 4JZ5A 1W32A 2ZUMA 2WCAA 3AI0A 3UETA 1WPCA 1ZJBA 1B3VA 4JFWA 3VNZA 3WFZA 2VT0A 1JYVA 4UZUA 4B3KA 1ZBWA 2ZUSA 2WMIB 3W4RA 1TQWA 4B9ZA 2X1IA 4HA4A 4PSPA 1W3HA 4R27A 2QF8A 4PYSA 4X9YA 1JZ5A 5A6JA 3B9DA 3WIJA 3CUFA 5JIPA 1W2PA 2XSBA 1J0HA 4AZBA 3T0BA 3MMUA 4UOZA 2RGLA 1E6SM 3OGRA 1GOOA 4U2YA 3A4AA 4J7RA 3LX9A 3AHVA 5A94A 3ZIZA 4N42A 3THCA 1US2A 3MS8A 4ZXLA 2HISA 3AQUA 3PTQA 4AXNA 4MB5A 8CGTA 3WENA 5ABFB 2D73A 1EO5A 3D51A 3W82A 1ISWA 1JDAA 1H0GA 2A3HA 4AZGA 2CERA 3GZAA 1PAMA 1GVYA 4D71A 2EAEA 2VOTA 1TE1A 4CUCA 1ZS2A 4PMNA 3K8LA 2Y5EA 1YHTA 3CHFA 1W3LA 4U3AA 4ZEPA 5A6SA 4DUXA 4W7WA 3EDJA 1NM9A 1PX3A 1W3KA 4F9JA 1B31A 1V03A 1G0CA 2EPLX 1FOBA 4LGXA 1QHPA 2CNCA 5HOSA 2PBGA 3SCSA 2WMKA 3BUBA 4H2CA 2DSWA 3PZNA 3GH5A 3WF4A 3PHAA 3SUSA 1J0YA 1HNYA 1PZ3A 1LL7A 4AYGA 4PCTA 9CGTA 3PZUA 4MNKA 3VILA 2V3EA 1YQ2A 3UR7A 2FHCA 2OW7A 4M24A 2CBJA 1K9TA 3ZR6A 2CETA 4DO4A 4M82A 4PMRA 3DHPA 5KZ6A 2CXGA 1K9EA 3DDFA 1GJWA 2DEPA 4L4OA 4HZ7A 1Q6EA 3VKKA 3CO4A 1E1EA 1UR0A 3CZJA 4AZ6A 4CD5A 3BMVA 4W8BA 2DGAA 3S6TA 3H55A 2CBVA 2YDRA 4ZE5A 4GKLA 1PX4A 3WDRA 3BVWA 3TTOA 3QHOA 5CXPA 3LXAA 3EMZA 5AYIA 4KRTA 5KEZA 1E6QM 4CD6A 3VIMA 1E15A 3VOCA 4UFJA 2WNWA 5IXEA 1GVIA 3AHXA 4UFIA 1W9PA 2J7DA 1GOMA 1CNVA 2EEXA 1UWUA 2VI0A 2UY2A 1H41A 2PWGA 1WNOA 1R34A 1TA3A 4IM4A 3MKKA 3O9NA 1VJSA 3BLBA 3K1DA 1L8NA 1CGTA 5CSYA 3L4TA 1R86A 3RCNA 3VD7A 4CU7A 2GJXA 2ZUTA 4FLOA 1CXHA 4JKMA 3WH5A 4XX6A 3T0DA 4QAWA 1CECA 1UR8A 4PTWA 3CPUA 3W24A 1BVZA 2VCAA 2XM2A 1BYDA 3JUGA 4N0RA 1E4LA 2GK1B 5I23A 3D5HA 3N13A 3T2QA 4KGLA 3ZJ6A 4TTGA 1MW0A 1NH6A 4AWEA 3OLIA 3N11A 2G3MA 2VVSA 3CMJA 5IDIA 4F79A 3EMCA 3WY4A 1WDQA 1IZKA 3F5LA 4AD0A 1SZNA 4WKHA 3SCTA 5AC5A 1VJZA 4J28A 3VGFA 1R8LA 2FGLA 4AIUA 5AYBA 2OYLA 4CD4A 1RH9A 4U3CA 4AZIA 6A3HA 4PMXA 4F66A 4ACZB 2O9OA 4UQ9A 4P8VA 1XH0A 4MPKA 5A2AA 2OLHA 4UNIA 3PZVA 3VD3A 3M7SA 5I6SA 3WNPA 5D4YA 1QI0A 4IISA 1MXDA 2PWEA 4TTUA 1QVBA 1GW1A 3HN3A 4MDOA 3BAIA 2ZXDA 4NI3A 1V08A 4H41A 2JFEX 1SFSA 4CGTA 1Q4NX 1UH2A 3RM4A 3WQ8A 3L2MA 1E40A 2EABA 4W88A 2YBUA 4UFLA 4UFMA 3K8KA 2WC3A 1D2KA 3WH6A 3PZIA 1FH8A 3ZT5A 1CGUA 1J9YA 2BVTA 4E2OA 2PB1A 2BHZA 2OW6A 3FN9A 3EJQA 4QCEA 1B1YA 4KWUA 4TX8A 2F18A 5HXMA 1ISVA 3BCFA 3DYOA 3GXTA 3SCUA 2G3JA 1UR9A 4NXSA 3SUUA 3WF3A 2G3IA 3BSGA 2F61A 1NWUA 1WP6A 1JYXA 1PEZA 1XCWA 4EKJA 1B3YA 3L4VA 1ISYA 4MB4A 2CEQA 2J8FA 4MB1A 1E4NA 3CUJA 1UWSA 4UZSA 2V38A 1VEPA 1CXFA 1S46A 3VM7A 3AXIA 4UOQA 3D4ZA 1IV8A 1QBAA 1ZB5A 2YBTA 5FIPA 1J11A 2E9MA 1HJXA 3PBGA 5DF0A 5BROA 3WNNA 1NOFA 4U33A 3A23A 1E0WA 1WKYA 2J47A 2V5DA 3CZSA 3FAWA 3VDCA 5CQ1A 3LMYA 1XYZA 1EXPA 1KGWA 4ZENA 5ABEA 5E0CA 2FE0A 2BY1A 3H53A 3HG4A 2VX4A 4HPGA 4Y7EA 1JNDA 1EOMA 3CZNA 2W67A 1TCMA 2C8NA 3MI6A 2EPOA 2Z1SA 1UD2A 3WMCA 3NIYA 4GI6A 2XUCA 1JZ6A 1OINA 4GO9A 4TUFA 1V0MA 3BAKA 1M04A 5E6YA 2ZUVA 3AFBA 4M81A 2W5FA 3EDEA 1U30A 1AQHA 1US3A 1EGZA 3F5KA 3ARVA 1DHKA 5AC4A 3ARUA 1UWQA 2XVGA 2WZEA 3CHEA 3DYMA 3N12A 3WQWA 1XSJA 3N04A 4W5ZA 3RM8A 5FCZA 2DT1A 4CCCA 5A2BA 4LYPA 4UCFA 5M17A 3MMWA 4MNMA 4LPCA 2ZUWA 3A21A 4FNQA 3QR3A 1X6LA 3KLKA 1C90A 1FH7A 4A3YA 1BYCA 2F7QA 3MSDA 1QI3A 1CXIA 2AMGA 2DIJA 3UERA 3I3BA 1W9DM 3GYCA 1JL8A 2W92A 1V0NA 3EMQA 4UTFA 1JYNA 3W29A 2VJXA 2O9RA 2Z1KA 4M8UA 1Q6GA 1W1YA 2ZOXA 1CYGA 3L2LA 3ZJ8A 3DX3A 4JAWA 2FH8A 1QI2A 4UQCA 1XGZA 2C7FA 1IZJA 2BY3A 3PZ9A 1BGAA 3GXNA 3LRKA 3UESA 1E6PA 1HP5A 3BGAA 1XV8A 4DWSB 1V3HA 3L4WA 4CD7A 5D9PA 3DX1A 2J78A 1CEOA 1TQUA 3AZSA 2WZIA 4H8HA 3EYPA 4FNPA 1TVPA 1HT6A 2BHYA 5CJ5A 2J4GA 5C8BB 2X2IA 1EHAA 1H09A 4MADA 1UASA 2WVVA 2QPUA 2VQUA 1M01A 2XVLA 3T0AA 3HJEA 8A3HA 4AC1X 4PRWA 3GH7A 2XM1A 4JKKA 2BHUA 3II1A 1NARA 2WVSA 4WKFA 1EOKA 5ABGA 3VIGA 3OZOA 2DT0A 4AZCA 1AMYA 4XUYA 4ZXOA 5DT7A 1GHRA 3WF2A 4LXFA 1ITXA 1NQ6A 2WHJA 3BUQA 3IAQA 4BZYA 1V6UA 5BYWA 3VD9A 5GNYA 3K4DA 3AMLA 1OM0A 2PC8A 2DQXA 4HOZA 4MJ2A 1M7XA 3BUDA 4CN6A 5AY7A 2WB5A 1HIZA 3WQ5A 4DO6A 3RM9A 3IJ8A 3ARYA 1A3HA 1CLVA 1R7OA 1VBUA 4PUDA 1UD3A 4V2XA 2J7EA 1E55A 3AS1A 4XZWA 5EFFA 3MUIA 1KB3A 1EDQA 2FH6A 3BVTA 1QNPA 3GXPA 1GOQA 4AD5A 3CH9A 4H04A 2YFNA 1VENA 4PTMA 4OOUA 4B15A 5ABHA 1QW9A 2RGMA 3U57A 3WN6A 2J75A 2DH3A 4FNTA 2QLYA 2BVYA 1HF6A 1MW3A 1HL9A 4FK9A 3CGTA 4JFSA 2YL9A 2DDXA 4YN5A 3VINA 3AYRA 1V0LA 3U7BA 2UY3A 2XHYA 1MWOA 1B9ZA 1TQTA 3SURA 4Z2GA 2XFFA 2WXDM 1TQVA 3OZPA 1I75A 2D23A 3W53A 2E9BA 2XN1A 4E4PA 1TZ7A 3OLGA 1XH2A 1UOKA 2JF6A 1OIMA 5CLWA 7CGTA 1OD0A 4P7RA 3WNMA 5A1AA 1VF8A 4B16A 5EB8A 3UG5A 4PSRA 3UEQA 1OD8A 3DC0A 4AW7A 2VMFA 1BF2A 3S2CA 1UKQA 1R87A 2WVUA 3ARPA 3NSMA 1QWUA 3MMDA 3E1F1 4P8UA 1BHGA 1G94A 4JFVA 1GOKA 3EDDA 3OA5A 3U7VA 2JIWA 3NDYA 2F7OA 2EJ1A 3IGUA 4RE3A 2EADA 5A2CA 2XGIA 1HL8A 2QMJA 1E71M 7TAAA 1W9UA 1J0IA 1E70M 4YHGA 3SCPA 3QHNA 4PUEA 2D24A 1FH9A 1OCQA 1E6RA 3AS0A 5A95A 4FLRA 1E3XA 3AROA 1AVAA 3VGEA 1UWIA 1BG4A 5BXPA 4PMYA 2XG9A 1QI5A 1EHNA 1A47A 3ARRA 4GZJA 4DUVA 2DT2A 2D20A 4ZE4A 1E1FA 3WD0A 3W0KA 1W9BM 1MFVA 3TTQA 3VTRA 5A3HA 1OGSA 2WBKA 2VX5A 4A4AA 3AHTA 1E4IA 2HVMA 5IFPA 4D6IA 1CGYA 1JDDA 2XPKA 1MXGA 3S5YA 3WFLA 4C7GA 1V3IA 3A5VA 1G1YA 3MV11 2UY5A 2ZX8A 1XCXA 3O2LA 3AIBA 1GPFA 1IT0A 3N9KA 3AHZA 3WELA 2VO5A 3WDHA 1TA3B 5GNXA 2YLLA
chains in the Genus database with same CATH superfamily
2CA4A 4HK6A 1JPTH 4XCCH 4KQ4L 4XNZB 3EFDL 4LMQI 4HFUL 1J93A 4XC1L 1X5ZA 5C1MB 3IMWA 1FJ1B 4L3EA 4ZDHA 3WXWL 2C3VA 5U4NA 4HUXA 3PJXA 3UJIH 4XZUB 2QMKA 1Y0LA 2VLME 1KBVA 4BSVB 2V33A 2YGPA 2LT9A 5EMUA 3NQDA 4IGBD 1LG1A 4Q9RH 3UBGA 4PREB 3ETBJ 1M03A 1H3UA 1MUWA 2W79A 2KLRA 1ADDA 3IIVA 1JXJA 4AHOA 3JTSA 1JVLA 4U1LA 4CN4A 5CWSB 2AK4E 4MXQD 1T21B 1CFNA 1YAIA 5D2LA 1NFIB 4XKMA 4RFEB 1DFBL 1RQHA 3OMAB 1YLVA 5TIMA 4U3XA 1LWJA 4Q3MA 4AJYV 1IEAA 5GJSL 4PW3A 2PDPA 3O6KH 3BLEA 4K9JA 3NPSB 2WXPA 2POTA 1H3PL 3MLSH 3T0TA 2UVFA 4WJKB 3FXIC 2I9TA 4O2FB 3ZLQC 2IS7A 2VGIA 4PBVC 4JL1A 1XYBA 2OCZA 5MEOB 3XINA 1K9FA 2CZNA 1B2WH 3LEXA 2YPKA 1YEJH 4CLMA 3QIBB 3TESA 1U21A 3FMGL 4P57A 3TLLA 3K81A 1IQ8A 3QCVH 1FAIH 2QQ6A 4HHWA 2WZTA 1OCRB 1GHFL 4MMZB 3FC8A 5HMFA 3CUHA 3KJ4C 2YMTA 3GSMA 4A2LA 3OQEA 1FQ9C 3VXGA 5ICYA 1PLAA 1WDDA 3G04A 4R5EA 4ZRGA 2D0GA 1AOZA 3TA6A 1UKOA 3MBDA 4J2MA 4L4TD 4RNIA 2P80D 5F0LB 3FYEB 4H1LA 2W0KA 4Q89A 1BMZA 2A73A 4LVNB 3OKDA 4L18A 4N9BA 2J7FA 4KZ0A 1J5IA 3QORD 3RX9A 2QCDA 2D31A 3LNIA 5DVOA 3KAOA 1YNPA 4KZDH 3C86A 4KEMA 3GC3A 3P30H 4PGCA 1XDJA 3IKCB 4IFKB 4JN2A 1UM5H 4N2HA 2P8CA 2OZ4H 2K8QA 2ZUUA 4Y2OA 1H7XA 4PLOB 1TTQA 1JK8B 4WV1A 5C2BH 2VN3A 2GBTA 2HN7A 3UU0A 2YQ3A 3VWKB 5E5RB 2VXVH 3NCEB 1A5BA 2FJHA 5C9JB 3BKCH 3X2QB 3ZLFA 1U95B 3HAEG 3GUTA 1FNLA 3UPWA 4AZCB 1RVGA 1JF6A 2WYSA 3O45B 1DIKA 4JRXB 4DETA 3R79A 1NWSA 4OGXH 3QJSB 1H2JA 2ZAHA 1K1DA 2FVMA 1MCRA 2XWRA 3CQKA 4JREB 1IBFA 3OAYH 4L1LA 4LEOA 5D1QA 1NIBA 2RDUA 4Q6JA 1GZHA 3V36A 3TC9A 3WOVA 1OTSC 1Z7JA 4MCMA 2NX1A 1Q90A 4KQ4H 3EFDH 2Y24A 3L9RB 4HFUH 4YSCA 5I0DA 3RCYA 1TIUA 4XC1H 4RCAA 4UFKA 3HS8A 2GY7B 3EBGA 4I3SL 3WXWH 5LGZA 5EMMA 3QISA 3ITOA 3RWHB 1KN2L 3IMTA 3JS3A 3M6YA 1LRNA 1RQEA 5E03A 5HHOA 4OF6A 1RSCA 3TKFA 4FTDA 4PJGE 3SJVE 3ARQA 2FO8A 4ZOCA 1A7PH 1YPZA 1S4IA 3RWCB 4JFOA 4IFOA 2X6MA 4A8RA 3RNQB 1QSFB 1HG3A 4NC0B 1XIWB 4JS3A 2CAKA 4QOKA 1XDLA 1ZT7A 3RYMA 1YDPB 3QWNA 3POHA 4Q2ZB 2XWBA 4HK0B 4ZXBD 1DFBH 4N0YH 4DGIH 5AW3B 2C1IA 1OGTA 3G1VA 4MWAD 2WBGA 1R3HA 4NNXB 2PLTA 2VDNL 4MA8L 4I90A 5D8WA 4WUUE 5ABAA 4HIJA 3NUKA 1OAUL 4PG9A 5IOPB 2IANB 5GJSH 5FA3B 2WHLA 3K6SA 2ZT9C 1H3PH 1X5MA 3WSUA 4MNLA 4R33A 1TZ8A 1CDUA 1YNTA 3BQUB 2Y07L 4FNRA 4C6OA 3FHAA 3MBED 4F8LA 2WLZA 3TU9A 3U82B 3IMBA 3QRHA 3CHXA 1GCYA 3W2MA 2E7LA 5I1EL 4N5ED 5MENB 3M0IA 1NQKA 3RTQD 1R24A 2J55A 3U5YA 1LZOA 4F7CB 5T5NF 1W3NA 2CLVA 4UQ2A 5ESQB 1KLUB 2VISB 4PJ5E 4FERA 3QEQE 1RJPA 3FNDA 5BWFA 2CR0A 3AT0A 4FNSA 1RXOB 3Q4DA 4FABH 4F0MA 5C9RA 4F57H 2AGJL 1MFNA 2E7DA 3AMGA 2FSEA 1GGUA 2ICEC 4A3HA 4I7ZC 5DMMA 4GZEA 5BPPA 4RDQF 4APXB 4PTUB 1QAWA 2OWCA 3V4VB 4M8RA 2HRHA 3R10A 5T1LA 4KBXA 2FEJA 4WY0B 4NN6C 4A2RA 2D0HA 3KXFE 4UIOA 3C52A 5CLTA 3BZGA 4O58H 4OQ1A 3M6DA 2D03L 4ORGA 5L2JA 4M03A 5ANMB 1E8YA 2KC0A 3RMJA 2F0CA 4YSOA 3CUGA 3MUY1 1UQZA 1Z9PA 3U6WA 1YDYA 3QSTA 2NY6D 1G7JB 4J3OC 3C2FA 4FX6M 3DTXB 3SI9A 3WLWD 3BAXA 5AB3A 4IGMA 4R53A 4F7EA 5DD5H 5ALCL 1W1IE 4JG1L 5AOUA 3WMBA 1A21A 5HYSA 4QDGA 2J4WH 2NRDA 4FYQA 4DERA 1NOAA 2ADIB 4KIRA 1OQOA 5LGJB 1N19A 4Y4FD 1U4FA 1DXFA 1QA9A 4XR8C 3M46A 2X6CA 2CO1A 5DR5L 3GBMH 3SECA 4CDGC 4KRLB 2CIPA 1CXKA 1IEBB 1GYNA 4X7TA 4AMWA 2PTWA 2LLNA 2HRWA 3D39D 1NDYA 2ICWA 1WZAA 4B5EA 5C7XL 1KN2H 2C1PA 3GSNL 4PB0L 4AG4L 3TEWA 3F7KA 1T89A 4Q7NA 2UXFA 1PXGA 2BNUB 2XFXB 2ZOTA 5GSVA 4J4PC 2GFBB 3FQ1A 5CG0A 4YDIL 1MCFA 4I89A 2TSAA 3R8QA 3Q94A 3FT2B 4ABWA 1U8KA 1UYQA 4GI9A 3MGAA 2CGRL 1FZMB 1CE6B 1OE1A 4J3UA 2EIDA 2VDNH 3F03K 5BU9A 4DO5A 3H0TB 1CD0A 1E6OL 5EU7E 1F41A 3TN0C 1FE8L 1OAUH 4Y9AA 4YQXH 5DRCA 3W7KA 2R9HC 2ABBA 3S4TA 4MJZA 1XF2A 3D34A 1HO4A 3IRDA 3BHBB 3I75A 3PANA 2K45A 4LSQH 2MTAA 3MO7A 1SO4A 1FZKA 3VKBA 1BBJB 5LG1A 3CWNA 3O3EB 3TAOA 1WC7B 4ZQOA 3T6XA 1K8ZA 4W7UA 3N1PC 1BXCA 2BASA 1UD5A 3RVUD 4DK3A 1EIBA 2V0TA 2W61A 4GUGA 4Z3EA 4A3RA 8XIAA 4JUSA 5IHBA 3KZSA 5GRWA 2C1OA 5I73B 2NY5L 3PS6A 1K6AA 5D2VA 3HQ1A 1BVLA 4PLNC 3EGJA 3LRMA 4PY7B 3KPOA 1S9YA 3DUSA 1ADSA 1CK0L 1ME7A 1OCOB 2FB4H 2D2CC 4UAOB 4RX4D 1SR0A 2FGZA 3AB0C 3TV3H 3MHGA 4ZO9A 2PD5A 1G6RB 3LKOA 1D3HA 4UXDA 2NY3B 5A6LA 4XZLX 2Z8SA 3THDA 1OX4B 2KPNA 5CD5C 2PDQA 2IIJA 1I8AA 3SGJC 5IFJA 4YDLC 3NCYP 3X1GA 1MZRA 4TRPH 1XYLA 2GIMA 5EZPA 3QVAA 5F3HA 5I6PA 2WM0A 4MAVA 4NU7A 1Z5LB 4WNQB 2VOMA 4ZZFA 1YVLA 1XLJA 1QLFB 4KCVA 1X5HA 4QRBA 3UTPD 5J1SC 1RK0B 3N85L 4D0BB 3ZRFC 3OBKA 2A4ZA 3C9NB 3QJTB 1QSEA 4X42A 3WV0A 7PAZA 4GG9A 3QUHA 3NA9L 3WAJA 1Z32X 2A83A 4GRWF 5CCKL 1WQ5A 1A1OA 3HC0B 4Q4PA 2NQCA 2J25A 2VWEC 3Q01A 4ZUUB 1Y8BA 3T4WA 5B7ZA 4E36A 1IT7A 4KCTA 2JI3A 1KM5A 1OEZW 5L2KA 5D4IA 4W5UA 2E86A 1RALA 5HVHC 5KYXA 3HA0A 5F44A 3T6VA 4JPKH 1J0KA 2IKHA 5EF2A 3VIKA 1WLHA 3GK0A 1O7VA 4P7NA 1VR6A 2DLTA 3T0VA 3FF7A 3O0RH 4GVFA 2I25N 4X2UA 1P7TB 2XN0A 4ICCX 3ORWA 4OCSL 1E90A 3BEWB 3W1RA 4LVEA 1THFD 2NSXA 2CGRH 4ZO6A 4W6WB 3VVGA 1PJWA 5F1NB 2EVGA 3VXRA 3DO4A 4ABVA 1FE8H 1U5VA 4N4PA 1WEJL 4PJEE 4OFCA 2Y5SA 4E41D 2R29H 2WBXA 5GVJA 4GKTA 4JZ5A 3B4NA 4EI6B 3MTXA 4JFWA 1JYVA 2VT0A 1QPQA 5ICUA 3W4RA 2FVNA 4J5VA 4Z7QF 3HW7A 3UZWA 3Q65A 2KS0A 5A6JA 4HWBA 3B9DA 1WAAE 4NQEA 3VXPB 3T0EC 2CGZA 3S9DB 2XSBA 4ZUSA 5GRYA 4YZFE 1E0UA 3M1BA 4C1KA 3GDCA 3I84A 3H2OA 3AXMA 2NY5H 4NFBA 4PJAB 2CZVA 4JG9A 2AVGA 3SGGA 1PAMA 1GVYA 3KPPA 5A40E 2EAEA 4ZO8A 5D4JA 2Y5EA 4XBEH 4GX9A 3S8WA 1PSCA 2JB5L 3UWYA 3EDJA 2QCEA 4EI0A 1RK1B 4YDNA 3N2CA 4HTBA 1JHLH 2J1WA 4GBXD 4PR5A 1AQKL 4BKLB 5FW6A 2FLIA 4IPIA 5E00A 5AALA 4LLUB 3FK3A 3VKCA 3ZR6A 1TQXA 4GG6A 5FESA 3VWJD 1E4XL 1GJWA 4L4OA 3KWSA 2DGAA 2GK2A 4GYBA 2G3ZA 4OD2B 3FTYA 2B77A 3BIAX 3VIMA 3R6IA 4O5LL 4KKRA 3BD4A 3RZCC 3T1FA 2C9AA 1TO5A 5CP3H 2PDUA 2OT0A 3WE1A 1YEDA 3O9NA 4IHBA 4Y7OC 2YC1B 3LB6D 5CF3A 4FKEA 3N85H 2CCVA 4HISA 4R84A 3APMA 3T3ME 1BJ8A 4AVNA 4PTWA 3CPUA 2V9UA 1RL1A 2B8OT 1X8FA 1LEGB 5DGRA 1ET5A 2X4TB 3N11A 5FAAA 4F79A 2OX1A 1FJ1A 3CAKA 1JCXA 3UTTD 5AC5A 4J28A 4OHQA 3IRCA 4XZUA 4H01A 3LB0A 5FGBA 3L3OB 4ACZB 1PKMA 4P8VA 3PYCA 3QV9A 5BZDB 5D70L 4PREA 1TVLA 2YUXA 3IXAA 4QXIA 4NI3A 4UI2A 4M02A 3V6ZB 3TASA 4BYHA 1UP0A 1F86A 2XXGA 1VGKB 1XZWA 4O19A 4DY1A 1TTRA 5T3ZE 2DQEH 1AAJA 1D2KA 5CWSA 5KSUA 1T21A 1IFRA 1NFIA 4RNJA 4RFEA 3TJEH 1QLEL 4OZIB 1T4WA 1ISVA 4U7SA 4ILSA 3E5BA 2CDFA 3DI1A 1JYXA 3QIWD 4MB4A 4HOMA 2JIXD 4HPYH 2XISA 4AH2B 5GRXG 5C0JB 3WS3B 4X83A 1CG9B 5KSAC 4YS1A 4K7FB 2VDGA 1IGCL 3R19A 2R1YB 5BROA 3DHMA 4HWZB 5MEOA 1WEJH 2V4LA 2UXGA 3Q2NA 3QIBA 2AABH 1YEIH 1JNDA 1AZZC 4XBPB 3VFGL 3BZ4B 4EZLA 4IRZA 3DGGB 3NIYA 4MMZA 5JMRA 2C3ZA 2PLJA 4R0LB 3D0CA 4QQUA 1K03A 5K9JL 2E28A 1CFTB 3KVMA 5E8DH 3BXNB 5JXAH 5CPLA 2I5IA 2OB3A 3W83A 3RM8A 5HWJA 3HE6C 4D9QE 1BEXA 3VB9A 5DS8B 3LNDA 3NM3A 1TZIB 5SX4H 7TIMA 1SJEB 3KLKA 1QI3A 3PS7A 4Z1CA 3MV9E 4JZNB 3EHBC 9XIAA 3AXKA 3HG1D 1ZD6A 2QZ5A 4X6DE 4F15B 4JQIA 5IUSA 1JMXA 3UBXB 1AQKH 2B9BA 1HE8A 1KFBA 3LTPA 3WUWG 3TIDB 1UTDA 4UM9B 3IKCA 5I8EB 4IFKA 2ZXEB 1CEOA 3AZSA 3EWBX 1BREA 4Y16C 1SO5A 2ON3A 3QY7A 5CJ5A 4Y2DD 4K07A 1JK8A 2N3JA 1E4XH 3M9YA 1BFVH 3DWTA 4XN7A 3VWKA 1EPVA 1U8HB 4S3FA 2L8AA 4F0KA 3ARBC 5C9JA 2PDFA 1NCDL 3CE1A 3QHTC 2C5DC 1U95A 3KNBB 5FAGA 4AZCA 1WISA 5J6GB 1DJHA 3TM6A 3O45A 2DZBA 3A3WA 2YWZA 4JRXA 2YD3A 3LQMA 3DSFL 4MY9A 5C08B 1ZDQA 1RZJC 3QPYA 2YN3A 1M7XA 4ELKB 3MCLL 1EZUA 5L6YL 2JKXA 4V2XA 1E55A 1VBGA 3MUIA 4PUNA 1S5HB 1YECH 3L9RA 2ORBL 2VW6A 3BUYB 4AD5A 1HWGB 2YFNA 1PY4A 2ZF8A 4JIHA 2ESVE 2FQGA 2IOOA 2A1YA 2VLRB 4B15A 2CC0A 5CPNA 4Y2LA 3L66A 1AIZA 1TJGH 4PJ8B 3RWHA 3KJ4B 5LAXB 1V0LA 3U1PA 1B4TA 3RI5K 2XHYA 4PW9A 1ZJIA 1R6VA 3NA8A 1X5IA 1XXDC 4P46D 5CLWA 2AQWA 3RWCA 1Y07A 4P7RA 4H5SB 4G5DA 4EJ1C 4PSRA 4NLHA 1OD8A 2DEXX 1IIGA 3QMSA 3RNQA 1QSFA 1AS6A 4M7LL 4IBUA 3NSMA 1X4XA 4RRPM 4Q2ZA 4HK0A 2FVLA 2K3TA 4URKA 2Y06H 5DD3H 2E5CA 1QLEH 3MNDA 5GHWL 2YD8A 4NNXA 1RFDH 4XXWC 1YUKB 1F0LA 5IY5B 3SKMB 5IOPA 2IANA 2JQAA 5FA3A 3VGEA 4K15A 4DGYL 4OF8A 2GDQA 3H23A 1W16A 2D4DA 3QEHB 4ODXB 5TQLA 4EI5B 4TLTA 3BQUA 4G8GE 1FC1A 2DT2A 1ZE3C 2VX5A 1PU0A 3WXVH 2DBLL 1KDJA 1A6UL 2Z6JA 4PJFB 5D7LB 3ELQA 5MENA 3P60A 3C60B 1OFDA 4JRYB 4P5TD 3MV7B 3KZ8A 3VFGH 2EYSB 4F7CA 1KMGA 3UYPB 2JJVA 4P48A 2XICA 1ZHLB 3B2UD 3P0XA 5D71H 5ESQA 1KLUA 2VISA 4X8JB 3DETD 3KE0A 4JFHD 3VVWA 4RAVB 5C0ND 2ZP0T 4LYRA 4RXGA 5F1SA 5AUMB 1L0PA 1F3TA 2QHAA 4EIZC 1G6VK 1YEFL 3SD2A 1ZV2A 4GY1A 4APXA 3L2IA 4PTUA 4MLJA 3A6CH 2KX9A 2H3KA 5LLIC 3V4VA 4GSDL 4PULA 4PIRF 1Z9MA 3EPMA 4WY0A 5C0CD 1F8IA 4DOHE 3MRJB 5I6OA 1TIWA 4MHBA 1MI5D 1LBFA 3OHMB 3OAUH 3LKRB 2DZPA 5FFOA 4NO0D 3N1GC 3S1XA 5DO2D 5D2XA 5ANMA 1J86A 3MJWA 2PYFB 4HJEA 3RIKA 4G2DA 5KZMA 2FBJL 2NY0C 1L9OA 3GHTA 2LFEA 1G7JA 5A8NA 2C0HA 5D2NB 4WGWB 1C7TA 4XD3A 4Z0SA 2D22A 1GZQB 3DTXA 3RL1B 1A4CA 5GS0C 3L54A 2V5KA 3U0HA 1BPLB 4N8PA 1NCDH 1M05B 2R15A 1TB3A 3ABOA 4ZZ9A 5LZLA 3WG6A 4QRRB 5ISZE 2WZPA 2CUHA 3UA4A 2VXSH 2CHRA 1BSIA 4PCKA 2ADIA 3ILDA 3TO2B 4OM1H 4RISH 3A24A 4PS3A 5LGJA 1DBAL 3OBAA 4DGWC 3MCLH 1LEIB 4HHAB 5L6YH 5DVKA 5D93B 1VRDA 3IVUA 1UWFA 1I31A 4I9WE 1G7UA 4LQFL 1CLOL 4V27A 1T0MB 1IEBA 4YFDB 3WDPP 4I1PA 1KBJA 1B3XA 4WHDA 5D7JD 2VYOA 3VE7A 3AJ7A 3ARGD 1XD0A 2CK0L 3KGUA 3G1YA 3WLBB 3FK4A 5GZND 2WUBH 4LGPB 1ZJHA 2BVQB 1KUMA 1LYQA 5FB8B 4KTEH 4KFNA 4UT7H 2ZUQB 4ERSL 5C9WA 1NGXB 2BNUA 2XFXA 2B15A 4EN3C 5L4MA 3EOBB 3CSFA 4YTUA 3GDMA 1A0DA 3M7OA 1O5KA 4P7LA 2GFBA 3VSVA 3RIFF 3F2LA 5H8DA 1LWIA 4WRHA 2Q76B 4KX7A 4M7LH 4AFYA 4N8CL 3ULUF 3VXUD 2J66A 5ETUB 3I02B 1ORSB 3V0HA 3ARWA 4YDJB 3TW9A 3FT2A 2COQA 4RNHA 2A74B 4BBWA 4ONHB 3N4AA 1FZMA 2MQ3A 3NCCB 4FQPA 1CE6A 5GHWH 2D9QB 3UJSA 4GJIA 4LSVL 2VMEA 4NN6B 1LQSR 3H0TA 3MN8A 2F6KA 1GEHA 3U4AA 3D4YA 3TC7A 3PU7A 1NEPA 4Q8OA 1MCJA 4F2ME 2RUSA 3KS0H 5E94B 1O6SB 3C5SB 4PB4A 3TA3B 3BHBA 3KDPB 1S5VA 2WINB 3DX8B 1BBJA 3O3EA 3WDJA 3QTGA 5GGRY 1WC7A 3CV2A 2WQDA 2VLJD 2IXUA 2FO4B 3RURA 4G7VL 4P2OC 3S37L 2WQRA 2VMDA 3FEMA 4A67A 3B7YA 2INZA 1P6WA 3O7UA 3NACL 1FCUA 8RUCA 1EJ6A 3QUML 3V3WA 2B81A 4D6FA 3ISIX 4PLJD 4M1GL 1WE5A 4XNXL 3NQ6A 2YDAA 1SN5A 2NSMA 4PY7A 1DIOA 1SGKA 2HWZH 2W62A 1V7MH 3AMDA 1YEFH 2AEWA 2PP8A 3K8MA 2RJGA 1JZGA 5C7HA 5DJYB 4BEIA 4LQ1A 3BXWA 5JLZB 4W86A 4GSDH 3UZJA 3QH2A 2A1WH 2DW5A 2GTQA 1WICA 1G6RA 5A69A 3FT1A 3CFMA 2APVA 5T3XD 4QRNA 4FC3E 4S1RH 1AIFB 1OX4A 3EJRA 3R94A 2XWTB 1JGUH 1JXGA 6REQB 4ZTYA 4GUCA 5DURB 3MVIA 1OIFA 4EF9A 4WCJA 4LWWA 3QDJE 4V28A 2XGBA 2I60L 4PW4A 2OMTB 2QJIA 1Z5LA 3DURB 4WNQA 1YW1A 3M17B 1F2QA 2FHBA 4KK5C 3QY8A 3IMVA 3VFPB 3DC8A 1QLFA 5E6IB 1RURL 3LRGA 4JCLA 1RK0A 4NQDD 4L1SA 4D0BA 1TZZA 4HCHA 1CQKA 3TN0B 3C9NA 3AQZA 4FG4A 3U7YL 2XZQH 4JXCA 4WKAA 3SUWA 1OKEA 1O12A 2W66A 4CW1B 3HJ0A 4N2BA 4F24A 3MOQA 1DBAH 2UY4A 5D8ZA 4TUOB 2BOBB 3T55A 3HC0A 1I1RA 4MPQA 4LIQL 4LQFH 3QJAA 4YXKL 4Z0JA 4IPNB 2CWXA 4ZUUA 1CUOA 4IP7A 3GE7A 1CS6A 3A12A 1E9IA 4X6CB 2Y7QB 4OIIL 4DQAA 2EEDA 4Y9FA 2ZYIA 1JVKA 2CXKA 1JPMA 3WBWA 3VQMA 2YA0A 1IEXA 3FCPA 4X9BA 4ERSH 1UZHA 5AAWC 3QDMD 4QAIA 4NZTL 3GNDA 2WWMD 4I48B 1CGSL 4K7PL 4L2LA 4UMBA 4AEFA 3GU2A 4HT1H 4N8CH 1P7TA 1KM6A 1X8CA 4HNTA 1KCVH 1A9VA 3BEWA 2VDPL 3AB0B 5GGQL 2XVNA 2VSMB 4G9FD 1H1NA 5DO8A 5CGYC 1IGIL 5TE4H 4LSVH 3RILA 2CLIA 5F1NA 5IHWA 4O17A 1C1EH 1U9KA 2IG2L 4UTBL 1TETL 2BNRB 3AGVA 5GS3A 1S5IL 4YDLB 3PPCA 2PURA 3V1HA 2Y7OA 4H2HA 4EI6A 5D30A 2FLRT 2D7PA 3EYSL 1YMYA 2JKJA 1SXAA 4HNOA 4AQEB 3P84A 4UTWA 1VIZA 2PRLA 4AJ0A 3VXPA 5F7EH 3V6OC 4G7VH 3TROA 3S37H 5C2XA 1KFLA 2YEQA 4JHAL 1KSRA 1R33A 2ZZ3A 2D9CA 3Q58A 4LC8A 2EKGA 3OAWA 3EOLA 3HV9A 4WO4D 4PJAA 5H8MA 3NIDB 4QIUA 2E6JA 4OFYD 4WKZB 1Z0MA 4M1GH 1FRGL 1H11A 2BGSA 3RLSA 1RK1A 3OV6A 4ZO7A 1G87A 1KTRL 3E2HB 4BKLA 5DFVD 3KLLA 4LLUA 2XIOA 1BV8A 5LBSA 3B0PA 4QNPF 5JBDA 1P9MA 3NGJA 5EBMB 3VYPA 3NPWA 5K69A 5HVHB 1OYCA 5GZOC 4NZ4A 1IT8A 1IBBA 1BF5A 4EOWH 3A4DA 3F65A 1N82A 1ACYL 1SYVB 2I7OA 5A6IA 1MEXL 4XC3L 1LP9B 4OD2A 2WIIB 1F18A 5XINA 3OGVA 2PLKA 3WQPA 3V79C 1XBYA 3HV8A 3UDWC 1AH3A 3CN0A 4HMEA 3ZX1A 2WJEA 2H1PL 3KBNA 2XU2A 5EKYA 1ADQH 2B5IC 3SUVA 3U2ZA 2FT8A 4OF3A 2F68X 4F9PA 2YC1A 4J12A 2DN7A 3U1SL 5E5LA 3QG7L 4B3LA 3U7YH 2JKPA 4KTYA 4YCPA 1LEGA 1XISA 2X4TA 1SUJA 3FOLB 4XNYL 1FO0L 5I1JL 3DK2A 4QRSB 4NJIA 4P5UA 4B0MM 5BXRA 3MQTA 2CBOA 3R0MA 3L3OA 5A8OA 1E2WA 1F6LL 4TUJB 3QBUA 4ANUA 5FF2A 2OSYA 3T0EB 5BZDA 4KH2A 1G4MA 4TVDA 4YXKH 1Q6FA 1DQML 1NC4B 5DX7A 1LO0L 2ZKYA 4OIIH 3V6ZA 3ASOB 4GXPA 4UTKA 1DE5A 1VGKA 3VU2A 4YBLC 5IT2H 4PGLA 2Z6IA 4LALA 3VMNA 1LL1A 4ZFFB 4OZIA 4XCCL 3PDOB 1WAWA 2QFPA 3JYCA 3HZMB 3RFZC 1TR7A 2YB1A 1CGSH 4K7PH 4OT7A 4J3WA 3SODB 2CJSA 4Z7IA 4AH2A 1ZV5A 4XBSA 5C0JA 4HU8A 5AYTA 3WS3A 4ASTA 3UJIL 1CG9A 5CU9A 3AS3A 1B4LA 1YN7B 4K7FA 2RJHA 3BICA 1E5ZA 1IGIH 3REWB 4QP0A 2R1YA 4HWZA 2XWXA 2IG2H 3KL0A 4ATWA 3FT4B 1TETH 4BQCA 4PRHD 3QAQA 3FQTB 4XBPA 3RY6C 1B0IA 1D7DA 3BZ4A 3KPSE 4Z7QE 4Q33A 3DGGA 1E56A 2WKLA 2E7CA 2VR2A 5IQNA 1RZGB 4TV5A 4LL4A 2WKJA 5FEWA 1HOCB 1QRNB 4R0LA 4IIBA 4HYTB 4PTTB 2OA9A 1B4JH 4ORIA 1CFTA 3BXNA 3ESPA 3VSQA 2IGFH 4BRVA 3O6KL 5G4EA 5DS8A 3QB7C 3W1QA 1TZIA 2PGWA 3MBXH 3W1PA 3W85A 3CMGA 1SJEA 3MNWB 3QWRD 1A4MA 1B90A 1RJLB 2IDQA 1KBKA 1FC2D 5GJTL 2GQ9A 3UBHA 4PPTA 4I0KA 4JZNA 5EORH 4UMAA 4U4IA 3MRLB 2CKBB 4I0PC 3QI9D 2H8ZA 1B2WL 4R7DB 1YDOA 1YEJL 4S3GA 3UBXA 3QCVL 2V81A 4MBRA 3TIDA 3GTTA 4NP4L 1R6WA 4MD4B 4UM9A 3NZUA 3BKYH 5I8EA 4QHUB 5FYJU 1NFBA 2CESA 5BZZA 1U8JB 2DEWX 2X9ZA 3WKMH 5IFHL 1ZCRA 1LYXA 3KL5A 4NSKB 5MHSE 3DROB 4KXZI 1U8HA 4AM0Q 1D6VH 1ACYH 5MI0C 1QFWM 4TXEA 3KNBA 3AJXA 2CNYA 2J74A 5J6GA 3GY1A 1IAIH 3FBKA 3IGFA 3LKPB 2H1PH 2ICWJ 3GRWA 5C08A 5LXXA 2YQGA 4ELKA 4KKBD 5F9DC 2CKSA 3T77B 3U1SH 1L9NA 3OB8A 2Z93B 1ME9A 4KZDL 4KCUA 1S5HA 1WS8A 1Q9KB 1ZJBA 3P30L 4BDVB 3BUYA 3J2PA 3UMTA 1TYEB 4XNYH 1G9EA 4ANWA 4PJ8A 4OZFB 2PN5A 4IBWA 4CL7A 5DMNA 3CUFA 1W2PA 5C2BL 1Z42A 5LAXA 3LD8C 1H51A 4EBQH 4X60A 1WIOA 3Q8BA 1I2PA 1MG3C 4NHVA 4LHJB 1L6SA 4H5SA 2K1MA 3W82A 1ISWA 3HE6B 1JDAA 1KKRA 3F8UB 1H0GA 1L3NA 4AZGA 1INDH 4CUCA 2EDKA 4K5NA 1RHFA 5F1UA 3BWZA 1AZUA 2AJSL 2BCKB 3SQOH 2ZWLT 4Y8EA 4WWID 3BUBA 2XSXA 2ZZ1A 4FHAA 2DSWA 3EWXA 4DP7X 3PQYE 4G82A 3QC5X 5E0QA 5E9XA 3SKMA 1G0XA 2CCLA 4WI2A 3QEHA 4N25A 4ODXA 2NQDA 4EI5A 1Q6EA 1FNAA 3FTUA 3P3UA 4WW1B 4Y16B 1RUKL 1VF5C 4W9EC 1KM3A 3IJLA 5CXPA 3BANA 2R39A 2VXNA 5CZVL 1LE5B 2KLTA 4KDVA 1A7PL 4LLVB 4PJFA 5D7LA 4BZ2A 2PDLA 3RNKB 2YD0A 5IB2B 3WSQL 3RN6A 3C60A 3LJ3A 2Z4GA 4JRYA 3MV7A 3LLXA 4YTTA 2EYSA 3P3RA 1UWUA 4FQ1H 1T66D 3UYPA 1YDNA 1EJXC 1WZ1H 4N6QA 4EWJA 1ZHLA 2FD6L 1P7QB 5JA8B 4RSVA 4B3VA 3JWNE 1XSOA 2AAMA 2F6XA 4X8JA 1A3WA 3DOHA 4N0YL 4DGIL 4ML9A 1VFAB 3FB8B 2Y5JA 3NH7L 1BYDA 4LBRA 4KUCD 4RAVA 2VAJA 2GK1B 3FB6B 1X7IA 4GYPC 2G3MA 2YBVA 5AUMA 4O02H 4QRPB 1IZKA 4N2YA 4W6XB 4AD0A 4LUYA 1FGVL 1KM4A 1R8LA 4KKCD 1YUHB 4JFFB 3LM7A 4MPKA 3VYOA 5GJTH 4PJ9D 4O0KA 3CHQA 3STLB 2E46A 3LYRA 2ZXDA 3I10A 3MRJA 3P8JA 4WEBH 3MMTA 1E40A 5ID0B 2HSIA 1VHCA 3LKRA 2NXIA 4NQCE 4NP4H 3MUHL 2PYFA 2PB1A 3TCXA 3FB7B 2V30A 3TVMD 2P1FA 4KWUA 1J4EA 5IFHH 5D2NA 5FFLA 3Q8AA 2GJ6E 1GZQA 3RL1A 2G3IA 1WP6A 3QDGE 1FWEC 2H0FA 1FIEA 4FABL 2ITCB 4YSRA 4YK4C 4F57L 1M05A 3O8XC 4IPPA 4HQVA 4I9XA 4QRRA 1S46A 3MSYA 2DB8A 1OK0A 3VM7A 2HK1A 3P67A 1J11A 3CH1B 1XEUA 3TO2A 4WTZA 2P42B 5G5DB 4P9MH 5CQ1A 4BHYA 1LEIA 1XYZA 3DGBA 4JY6B 4HHAA 4GP8B 2FE0A 3O07A 2VEMA 2GGHA 2ACQA 2OQHA 1XYAA 4O58L 1T0MA 2Y5QA 3DPBB 3G9VA 2FMNA 1U2CA 5E6YA 3H9SB 2FZ3B 3MRGB 3BG3A 3WLBA 1VH7A 2XVGA 3N12A 3MWCA 2BVQA 3VKDA 1SOKA 5FB8A 1SZRA 5DD5L 1PV8A 4PR4A 1XF4B 3QR3A 3EOBA 2Q7NA 4BFFA 1SYSB 1AGBB 2J4WL 5F96H 4Q6YA 1OIOA 5B4MD 3RUGB 1J1XL 2Q76A 4LUJA 3NQ2A 5ETUA 3I02A 1ORSA 2Z1KA 5E4IA 1GT8A 4YDJA 4S1DC 3QG6B 2QGEA 3AADB 2AJSH 2B7PA 3ZJ8A 1EAPB 2A74A 2DLIA 2X44D 4ONHA 2A7PA 4BELD 4XMPL 1BZ8A 5K1JA 4AQOA 1B3JA 3RQ3A 3GBML 4ZQRA 4B9GA 5D9PA 1XRTA 2E7BA 3GHEH 2P50A 3PL6C 2DQTH 4FFYA 2KUTA 4N2CA 3GQYA 2YLHA 1BBDH 4TXVB 5E94A 2NY0B 1O6SA 3C5SA 2QPUA 3TA3A 2AEIT 4PH6A 4JD4A 1RUKH 2WINA 4QRUB 3DX8A 4KTDH 1SHXA 2GB2A 1DQLL 5CZVH 1PSKL 4DX3A 3BD5A 3R06B 4XP5H 4P4KD 3WSQH 1P4BL 1TUPA 2FO4A 2OL3L 1ZEAL 3BUQA 4NAEB 1E4XI 4WJG3 2DZTA 5BYWA 4PJIF 4BZ1A 9PCYA 2FD6H 3NCXA 1I1CA 4JNMA 1KZQA 3V5KB 4C8XA 4C6EA 5D5MB 3NH7H 2FH6A 4I9AA 4H04A 2CD0A 2DICA 5EN2B 4YQXL 3QFWA 3P2BA 5GJMA 1FGVH 5DJYA 3B0UX 2YL9A 1NA8A 3VXSB 5CJ8A 5JLZA 2C9UA 6PTDA 1UWAA 1GYLA 1TQVA 1CCZA 4LSQL 2LR4A 1KZYA 1ITUA 3L45A 3WNMA 2BO0A 4NT6B 3B7SA 2PPGA 1AIFA 4P3CL 3W5MA 2XWTA 2X89D 4P8UA 6REQA 4J4PA 5LG6A 2WQ8A 2FJFB 3URQA 3N6YA 3CYVA 3NDYA 5KSBF 2HFTA 1A8ZA 4ZQNA 4H0IA 1DZ0A 2OMTA 4GH3A 3DURA 3M17A 4XVTL 3VFPA 4FLRA 5E6IA 1M42A 3AROA 3FT9A 5GGTL 4HCRH 1OFQA 5BUAA 4ZAKC 2ZC8A 2N7BA 3TN0A 3GMNB 2FB4L 4JTCA 1YE4A 1BD2E 3KBPA 5EZLB 1OPGH 5B22A 4CW1A 3TV3L 3V95A 3P1VA 4H6KA 1RAKA 1A3ZA 4UNVA 4TUOA 3O9WB 1G1YA 2BOBA 3JU2A 2DWXA 4NKCA 2EXTA 3WELA 5KOMC 5J56B 1ZSXA 3E96A 4P2OB 1O60A 1AUSL 4X6CA 4DTGL 2Y7QA 3KRUA 2Q2EB 4TRPL 2BP1A 3TPUB 2GJXB 1P53A 4QQ3A 3IJSB 4OJCA 5LHEA 4A7SA 1RUMH 3HLAA 5GS1C 5F6HJ 4FZIA 5FGSA 1UKSA 5FYJL 3EH4B 3AIQA 3NSNA 4TLUA 4XMUA 2RHGA 2X6BA 3ULUE 3NL5A 3SAZA 1UCWA 4I48A 4LUIA 4WK4B 3FFDB 1J1XH 3LV3B 4R90H 3QE5A 4RR4A 4E9TA 1UWEL 7REQB 4Y1SA 1V6YA 3US0A 4XMPH 1HHIB 1ZTXE 1QSEE 3A3XA 3L17A 3LXUX 2JJWA 2BNRA 3HBQA 3ROLB 3SGJA 1DLHB 2GVYA 3TFKD 2B4CC 3NQAA 2X0VA 2DQFB 1FIGL 2ISVA 2QKIC 3B05A 5GJPA 1MFCL 1TEGA 2A99A 3SYPA 4AQEA 1H4PA 1ACCA 4JPKL 4FL4C 1DQLH 1PSKH 4M7ZC 2W0UA 1P4BH 1UOLA 2OL3H 1KLZA 1ZEAH 1FVEB 1GKEA 3O0RL 4QDMA 4NO5B 5C70A 4XXDB 1NWTA 1ZY9A 1NCNA 3ALFA 2PF0A 1KM2A 1ZA6B 3NGBB 4WKZA 4DKTA 2CHXA 3B8IA 3ZSSA 3OGOE 1X1OA 5FYJD 4DAIA 3VUAA 3WY2A 3MT1A 3BV4A 2JJUA 3LXCA 1L9QA 2R29L 1IM3D 1DEEB 5DANA 3TX4A 1PHQA 1XGDA 3VFUB 3SY8A 3MRQB 5I17B 2GJZB 5EBMA 2LHAA 4HMDA 4S3JA 4FA6A 4P3CH 2DH2A 4M5ZH 1JS4A 5L4JA 1RP9A 1SYVA 1DLFH 2VABB 1PQZB 1LP9A 2F38A 4JFEE 1KCZA 5I75C 2WIIA 3IANA 3LVEA 2PS2A 4TQEH 1R3QA 5CMAB 1AR1B 4WX2A 4O11A 3UWQA 2IKIA 4W87A 4XVTH 1MHHA 4BV1A 2QVHA 4XBEL 5GGTH 4UQEA 2IBZX 5FOJA 2DQ6A 1JHLL 1XTMA 2AXWA 1GHSA 2QADD 1CR9H 2YUZA 4ZNCD 2A77H 1QX1A 3FOLA 3OXSB 4U1HB 4Z3HA 4RXFA 2DVTA 3BUPA 4QRSA 3QS3A 5JIHA 5CJBA 1X3DA 5M2FX 4LAUA 4EX4A 5IWLC 5BQ7B 4TUJA 3S3GA 3T0EA 4DBSA 2D3VA 1NC4A 4M6VA 1SRDA 4DTGH 4I8YA 3RDKA 4PVNA 3RWDB 3UZVB 2EHHA 1QXLA 4BQBA 3ZTDC 4W9LC 5FV1L 1OJXA 5A6TC 3NIGB 3SGKA 2ATSA 4ANXA 3N41B 5FYJH 1FA2A 3PF2A 3ZGHA 1SVDA 4QNEA 3PDOA 5L8LB 3ARDC 3HZMA 3W9ZA 1TENA 3WL1A 2H9AB 3SDCC 5F2GA 1VQTA 4P4RB 2NNCA 1F1DA 2XJ7A 1CFSB 2DYPB 3P9LB 4KT2A 3U0TB 3NSDA 1KQYA 1UACH 1L0QA 2K70A 1UWEH 2PO6C 1MG2C 5HHPB 4WKXA 4ADJA 2BLFA 5IMLB 1NTDA 3SHSA 4KI5C 1YN7A 1FNFA 4N0CC 2IV9A 5LQBH 3REWA 2ZADA 2ARWA 4WQOA 5E8OB 3FT4A 3PN8A 5RUBA 1AGFB 3SO3C 3E6HB 3FQTA 2BWDA 5AZ1A 4DJED 1FIGH 1D5BB 5LNSA 2NOYA 3A4XA 4XB7A 2DQEL 1WOAA 3WJJC 1DJYA 1RZGA 1MFCH 1HOCA 4JG5A 2JJTC 1QRNA 3TJEL 2HLEB 4PJXB 4PTXA 4PTTA 4Y1AE 1GONA 4PD4J 2GSHA 1VB9A 2DSVA 1UA7A 2LW3A 1RIHL 4A68A 5U7SA 2YA1A 5JHBA 4S1FA 1NLBH 4HIBA 3NZRA 3GX9A 4HPYL 3S42A 1BD0A 3MNWA 3TYDA 1RJLA 4F7TB 4WCYL 4CVUA 3MRLA 5IBLD 2CKBA 4A2MA 5CEXB 5AOIA 5F9WB 2J7GA 1M2VB 1JZFA 4R7DA 3UJEA 2AABL 4QNPE 1YEIL 1NIAA 4XPBL 2R27A 4NEHB 2ZX9A 4MD4A 2NY2D 4Q6XA 4QHUA 4YBLB 2YAMA 3EYQD 3TC6A 2NXZD 3GG1A 2PR4H 1U8JA 2YSWA 3QFJD 4NSKA 2JF1A 3DROA 4H7VA 3VNMA 3LA4A 3T71A 2XN9B 5E8DL 5JXAL 3VFCA 5DHDA 4R4ND 4HN8A 1Q7QA 4FLQA 3RFZB 3WH9A 1ANUA 4LV4A 1AD9B 3W7DA 2HTKD 3EUUA 1VCAA 4KVCH 5D2LF 3LKPA 1S3KL 3AC0A 3OKNB 1DJIA 2FQEA 4XVUC 2A3EA 3SDOA 4WHBA 3T77A 4Y19B 2Z93A 1C8VA 1Q9KA 1ZBKA 1X96A 3QXBA 4BDVA 1M53A 3JSSA 3C2AH 1GC1C 1DL3A 1W37A 1GQJA 3UABA 1C8QA 4OZFA 2G75B 2WOBA 1BFVL 1OWQA 3PFQA 5DZAA 4DWSC 3LAFA 1MJUH 3HRPA 5CGBA 4NILA 1EP2A 1EDTA 3LHPL 4HG4K 3HE6A 3A4EA 1I9CB 3ESMA 1JWMB 2ARJA 2BCKA 1PPIA 1PGRB 2YRZA 1A4AA 1W6WA 2Y7DA 4IEFB 3IXTB 3LH8A 4I0PB 3ALXA 1YECL 2JNZA 4QBXA 4AWSA 3B3IB 1K6QH 2VFIA 2BY2A 1IO4C 4JDEB 1P84J 1V5JA 1TJGL 3CBWA 4WW1A 4Y16A 4BSVA 3C3NA 5D7KD 1AL8A 3FGCB 3R12A 2A9MH 2CLLA 1V05A 2FEEL 1MFUA 1R5WB 3U9WA 1Z89A 5J8OA 1LE5A 4LLVA 4YBHA 3RNKA 3F12B 1A6VL 3FXYA 1A6TB 4JPWL 1R3LB 2DKUA 3QC0A 1D5RA 1O9ZA 1P7QA 4OWGA 5KYWB 2AAAA 3KPMB 2WXNA 3CK0L 3NRQA 2Y06L 5DD3L 5IB5B 2DLFH 1VFAA 3FB8A 4ODBD 1RFDL 1RIHH 2XIDA 2GK1A 1H8NA 3FB6A 2OFQA 1LL6A 5DFAA 4I3RH 5C0BD 3WEZA 2ZOUA 1RK5A 3ZW3A 3ZTCC 4B5ZA 4QRPA 3S96B 1EJ8A 3R13A 5D38A 4JKLA 2WBJD 4G5AA 4ZMTA 1YUHA 4O2FA 4JFFA 5FUOH 2AJZB 4RA3A 1TPXB 3WXVL 3E12A 4WCYH 5HI4D 3STLA 5D55A 1J2BA 1T5WB 2IANE 3LD8B 3P77B 5BS0D 5ID0A 3NAVA 4XPBH 3I68A 2CDGB 2V3FA 2IMNA 1FYTD 3GLAA 3HOGA 1L9WA 4OJAA 3FB7A 4CILA 5D71L 1HAUA 3FJLA 4KTGA 5MENE 2HX7A 1CGWA 4BEQA 3MUZ1 3M5YA 1EJUC 1WRFA 2ITCA 1YPZF 4OUEA 1VYPX 1MJ7L 4GUQA 2ZG2A 4JFDE 1KCLA 4NRSA 1GZGA 3UZEA 1UJTA 3NZ1A 3A6CL 3EEZA 1X98A 3CH1A 4TMPA 3QMTA 1S3KH 1XLBA 5G5DA 2GVGA 1TEFA 4NCC1 4JY6A 4YHYC 1K2DB 1R0AH 2G41A 5DEJA 2XVBA 3OAUL 4ZI8A 2FBOJ 3K3QA 3DPBA 3UADA 3MLVL 1EJFA 4HTYA 2NMSA 4AC2A 3SD5A 3H9SA 3V4LA 5T8IA 3KVJA 1UB3A 1HQRB 1YNTF 2FZ3A 5KITA 3MRGA 3DNKA 1U8IB 1XBDA 3FW6A 1BM3L 1K4GA 1F97A 3VPLA 1IGFH 3UH8A 1FAKT 4C6JA 4DF1A 3LG3A 4UBPC 5LIWX 4UT9L 1XF4A 1B9BA 1T2XA 3ECWA 3LHPH 1BWKA 4LASH 1UWRA 5DY3A 3S6OA 4KBPA 1SYSA 1AGBA 2HVBA 2ERJC 4ETYA 3LH2H 3ZMNA 2VXSL 3RUGA 4LEBA 3WUBA 3HG5A 1PZ1A 2MRYA 2VCCA 1SXBA 3QG6A 4OM1L 4RISL 4TOYL 1EAPA 4Q8NA 4X7EC 3WBEA 3MPGA 1TPVA 3MU7A 1JDFA 4PP1C 4FJ6A 3TIMA 4DELA 4IKNA 1UIPA 3QORC 3O4LB 1W0MA 2FMOA 3ZJ7A 2P5EB 4LOEA 2OSLB 2WUBL 4XWGL 4NBYB 1BQHB 4QRUA 2VKXA 4KTEL 2VDMB 4LBUA 4UT7L 3UL4A 3NZGA 3R06A 1SU5A 5T1MB 1A6VH 4QXTB 4YK4B 1K9DA 4S2CA 1DWIM 4JPWH 1EJ7L 4NAEA 5D1ZI 3SGEI 4Y2WA 1XIWA 5FACA 1HGWA 1YDPA 1ONRA 3T05A 2IO5A 3V5KA 3BQ5A 2KQNA 3CK0H 3GU1A 5D5MA 1WPCA 3WK2A 4PJHB 4UZUA 2X1IA 5EN2A 1NCGA 5CIPB 5LGYA 2E9GA 1NCBH 4XIAA 4K9EC 2CALA 3ILQD 4IKLA 3QR1A 3VXSA 1CBJA 3MMUA 3NABL 1JUKA 4AGNA 3P54A 1UT9A 4AXNA 1Z9AA 2B9AA 1P7KB 4NT6A 2OM5A 3LKQB 1RZKH 2A3HA 4D71A 1WGOA 4PMNA 2EDMA 3CHFA 5H8PA 1OCNA 2C13A 1ZSHA 3TCLB 2FJFA 4KOBA 2RACA 4H4NA 5I71C 2BS71 3SUSA 4Q4SA 3EJYC 2I24N 4ZMYA 1ZZMA 9CGTA 5DU7A 2PE4A 4P2CG 1CI3M 3MHFA 3VXNB 1UXMA 1IE5A 2AQQA 4UTCA 1MJ7H 4AEOA 2PWVA 2HWZL 1RHCA 1V7ML 3HZYB 4F1SA 3BMVA 3GMNA 4M6PA 5HATA 2VN4A 4YSUA 5EZLA 3F58L 4PGDB 2A1WL 1MDRA 5JW5B 3O9WA 4S1RL 1Q5MA 1KC7A 1JWSB 3GAKA 1JGUL 4LBSA 4NASA 4BWLA 3MNMA 4P2OA 5DFWH 3MLVH 4X99B 4N6EA 1MCPL 3TPUA 5CGQA 4CU7A 2GJXA 3W2UA 4FLOA 3EUDA 3IJSA 5TNVA 3B3BA 2YMOA 1WF5A 5I23A 1BM3H 3IMRA 1B57A 3GO1H 3RTQC 3RVWD 4HZMA 2OMNA 4OQTH 3G5WA 4YHLH 3SCTA 4UT9H 5FKAB 1A65A 1DN2A 5A3IC 3BIKB 2X2GA 3ZXAC 4W4OC 3MJMA 4AZIA 1SZFA 4J3BA 2XZQL 1XH0A 3PZVA 3FFDA 3LV3A 3Q43A 4K5OA 1K8DB 4TTUA 1GW1A 2VEFA 1O5DT 2VSDA 3WQFA 4TOYH 4KNQA 7REQA 3WLOA 1ML0A 4I7WA 3ETBF 1HHIA 5EEWA 4P06A 4K23H 4UFLA 5E9DE 3WH6A 4E2OA 4JK0D 4LS1A 1GPOH 1X39A 1CJYA 4PV8B 3D2UB 3ROLA 1DLHA 3W2JA 2DQFA 5DC0A 5ITFB 2Q0ZX 2Q86B 5G2HA 1I6NA 1NWUA 1PEZA 2XV0A 2OZ8A 1SEBB 4XWGH 2QGDA 3O6FD 1Z6KA 4GSRA 4ERGA 4KK8D 4PJIE 5C0AE 1S2TA 2XIMA 4JQVC 1FVEA 2VDOL 3PBGA 2ICEB 4FQ2H 2NY6C 1J8HE 4U33A 4NO5A 3A23A 4XXDA 4HT1L 2V5DA 4FQCH 1A5KC 3CZSA 1KCVL 1ZVHA 3WLWC 4BUGA 1XCQB 1MCDA 4WJ8A 5T1KB 5EBLB 4PVMA 1EOMA 3O11B 4C56D 3FU7B 4KKLC 2C8NA 1ZA6A 1GJPA 1LO5B 1BMGA 5TE4L 4R85A 5DJZB 2H4EA 2DL9A 3HC4L 1V0MA 5EH1A 1C1EL 4IWWA 4QJ1A 1LO2H 5B3JF 1EGZA 3F5KA 3G22A 5CJXC 3EKZA 3JWDH 3MTRA 4C6QA 2UZYB 4HSOA 5AFDA 4Y4FC 1DEEA 1OVDA 1IMHC 3NABH 4ZK8A 3VFUA 3MRQA 5FDYA 3B1TA 1M7IB 5I17A 2GJZA 1XJBA 1OM3H 2ZUWA 4DXVA 1NAMB 2Q71A 1O4UA 1RLDA 5F7EL 5D7HA 5F93C 5KSBE 1MF2H 2VABA 1PQZA 4HPOH 1VJIA 3FKKA 2C3WA 3PJNA 4H0HB 1AW1A 5CMAA 4F91B 2WKOA 2AQSA 5FUZL 1EP3A 3HFYA 1S5TA 5EA0H 4IM8A 1SEQL 2JCCB 2J78A 2YD5A 3B3DA 1SY6A 1F00I 5H4ZA 2CBQA 2AITA 3TBTB 4HALA 2DZAA 3OSVA 3GH7A 4KI1A 4PUBH 2QKIB 3OXSA 3F58H 4B9IA 2OTDA 4U1HA 4ES4A 4A6YL 3VIGA 3OZOA 3QIUD 3RUBL 1NM4A 5BQ7A 4EOWL 4DF2A 1IRAY 4NS0A 3K4DA 5IJVB 2WAHA 4M7ZB 2DM4A 5K9CA 3PK7A 3V6OA 1EAQA 1PCWA 3EPNA 1MCPH 1MFDL 3N0PB 4PYGA 5D2WA 4KO9A 3L1EA 3RWDA 1ZGLB 1ENUA 2QTEA 3UZVA 1QNPA 5AN7A 4JM4H 1HEZB 4N90E 1ADQL 3ELFA 4NJ9L 5FF3A 4MAYD 2EC9T 1NUFA 3MQIA 3VKJA 3ITLA 3DDMA 3TNOA 2H9AA 2E9BA 4P4RA 4E9SA 2VR6A 5HJGA 1CFSA 2DYPA 4WZ9A 3P9LA 3U0TA 4IJTA 1WFIA 2MKLC 2J9YA 3OXRB 4BEUA 4ORZC 5HHPA 5DJDB 2F8IA 1JP5A 3PAZA 4HBQA 5GZOA 3FYPA 1BHGA 1GVEA 1WIPA 1I0DA 5E8OA 2E5DA 3OA5A 1MFAH 2JIWA 2HCZX 5G4WA 2JTYA 4RE3A 2ETWA 4MJIB 4FYRA 4WD0A 4NZ3A 1IX2A 3E6HA 1M7OA 5CG7A 5I75B 1OYAA 5I6XC 1D5BA 3FTVA 2D24A 3C6SB 2JKIS 3VE0B 3JWOL 5IT2L 4GG6F 2IAMC 1AVAA 1SPDA 1XIHA 3ABXA 5FR3A 5BXPA 4NKIH 4PJXA 4ZE4A 1E1FA 3Q8CA 2Q8AL 1WUNT 4OUIA 2PYEE 3AM8A 2Y1ZA 2X4NB 1A14H 2VDOH 2HVMA 3EOAB 1DJSA 3VGAC 2HPMA 2ZRYA 1S9VB 1DE4B 4MS8D 4F7TA 3UJJL 1EF2A 3QLDA 1E72M 3HC4H 5CEXA 4QWWC 2FZMA 2TSYA 1M2VA 3ZO9A 4X7CC 5ENLA 1OZTG 2VERA 1CENA 1U3NA 1V3MA 1TQSA 4PBWD 5G4NA 2R1MA 3MUCA 2X9XA 1KN4L 1KRMA 1FZOB 3QHZL 2B0MA 1M7UA 3I65A 5AEAA 1KWKA 1S78C 3WJWA 32C2B 5T5FH 3G24A 4N26A 1YMMB 4GG8B 3ANYA 4GJJA 1B4JL 2X2YA 1DSFL 2XN9A 3GYRA 4D9RE 2IGFL 1PUDA 1MZYA 5J8LA 4E0RB 1ILUA 3RFZA 3RJQB 3SDCB 3MBXL 4HC1L 3USBA 1AD9A 5FUZH 3RO8A 2I5YH 1ONQB 1ISXA 1SEQH 2H3DA 3OKNA 5EORL 2HZGA 2AF2A 2PPAA 4Y19A 4M5PA 4QF1B 1EUAA 2CBIA 3VRJB 1GJIA 4LRNH 3CT7A 2PDHA 4X5RA 2IBGA 2CLEA 3SO3B 3LM3A 5M95B 3BKYL 3RJYA 1KG0B 2DLEA 2PW2B 3LV5A 1WAEA 4A6YH 3TYBA 4AVJA 3WKML 3VXMD 3C0SA 2G75A 2J7HA 3MV8D 1D6VL 3KW3A 2YOCA 1GOIA 2DBJA 1W8GA 1MFDH 4OIFA 4APQC 4KRUA 2X0SA 2IOIA 2COVD 1IAIL 4NZRL 3LCFA 4JO4H 2V5JA 1JWMA 1CT8B 4NJ9H 4GX8A 1XMEB 3W01A 2A21A 3JVGC 1T1YB 4N1HB 2BERA 4IEFA 3IXTA 4I0PA 4JQXC 3U4EB 3B3IA 3H22A 1PZAA 1WZKA 3PULA 2Q6WB 3PGFL 3QQWA 3FUJA 4JDEA 1W54A 4LZKA 3PHQB 4XB3A 2NW0A 3FGCA 4ACZA 3CDFA 4EBQL 1GGCL 1R5WA 4Q6IC 3BJ91 4RL3A 2NR6A 3ZTJH 3P61A 3F12A 3IGXA 2MHAB 1MIEL 1A6TA 1R3LA 5LXVA 2FAUA 3G6LA 2PGEA 1INDL 3WEMA 1VGEH 2RHEA 3JWOH 3BMWA 2I1OA 3C2SA 3HOJA 3LHAA 5KYWA 3SQOL 3KPMA 3IEBA 5D1ZD 2XIIA 5IB5A 2L7EA 4ODVH 2Q8AH 5G4OA 1CU4L 3G5EA 2DU2A 2PTDA 1B30A 3B7RL 2B31A 5CCHE 1FCBA 3S96A 3TSMA 2Y7MA 3K4WA 1J1OH 5EBAA 3POCA 5D72H 5JIWA 1F6FB 4RJEA 2Y72A 5IHLB 2AJZA 3P6LA 3OR7B 3IJDA 3UJJH 3MJGX 1T5WA 3P77A 5FD0A 1HL2A 4L3EE 2F2KA 3RBGA 2CDGA 2B16A 3K0WA 5CN3A 4FQ1L 2C14A 1G9NC 3SJ3A 4A8LA 3P62A 1WZ1L 1MCHA 1KN4H 4RX0A 1TDQA 3QHZH 1B3IA 3GM8A 1U92B 4GW5B 5HD8D 1OK4A 3RZCB 3JV4B 2YAHA 2HE8A 5AKVA 2IGLA 3W2DH 4GC4A 3ZS4A 1PMYA 1DSFH 5HPCA 4GEIA 1H3XA 3SCOA 4O02L 2YJQA 4C54A 2DZUA 5D2LE 5EEVA 2YZRA 2VP8A 2E4TA 1RXLA 1G5AA 4HC1H 1CGVA 4ROPA 4Z8FL 2CCWA 4POZC 2FEDD 1NEUA 4PE8A 3A6BH 4A8NA 4CQCA 1WYIA 3ITGA 2E27L 1K2DA 3MY9A 4JKWA 2QL1A 1AG0A 2FCBA 1HKIA 4WEBL 5B39G 4HU3A 3B4UA 3FOKA 4ACPA 3ZJAA 3PPSA 1HQRA 3Q6GL 1MW2A 5E1QA 1U8IA 1HXMB 5F3BB 4R3SB 1ZRUA 5J6HB 5HNRA 4J2XA 1GPWA 3EJCA 3EFOB 1V6XA 1UCBH 3PTDA 4AJWA 5IQMA 4GYPA 1HXJA 1TQBC 4ML4A 4ZGYA 4D0DB 6XIAA 3SYAA 3ZOAA 5FKPB 4NZRH 2W1NA </