5TD4A

Starch binding sites on the human pancreatic alpha amylase d300n variant complexed with an octaose substrate.
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHNNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
publication title Evaluation of the Significance of Starch Surface Binding Sites on Human Pancreatic alpha-Amylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2016-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5td4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5td4A01
3PZOA 2XWEA 3HN3A 1GOQA 3WSUA 1VENA 1CTNA 5AC5A 2W66A 3DX3A 2F7RA 2PWDA 5A8NA 3BXWA 3MSGA 3UETA 1V02E 2X2JA 4QLJA 2J75A 3WF1A 6TAAA 3AS2A 2DH3A 3LXBA 5FL1A 1UR0A 1M7XA 5A6LA 2YDQA 1GVIA 5IDIA 2JEPA 4Z2IA 1J11A 4JL2A 5D8ZA 3ZM8A 2ZUTA 1HJVA 3LXAA 2WLYA 1J10A 1LG2A 2WZEA 4U3CA 1C7TA 3M7SA 3AXHA 1HVQA 3FY1A 2X8RA 3MUY1 1G01A 3MMDA 3GH7A 2XG9A 5ECUA 3AMCA 4ATWA 4YPJA 1UG6A 1V3MA 4LPCA 1E55A 1W32A 2VTFA 3O6AA 2HISA 4WSKA 2YL5A 5I6SA 4GZEA 3OZOA 1W1PA 3ARYA 1H3GA 2VCBA 1HNYA 1OCQA 2VQTA 4D6JA 3GXIA 1UKOA 3WH6A 4V28A 4OZOA 2ZXAA 2FHBA 1HJWA 1UWRA 3AS1A 1PIGA 5TD4A 1SMDA 3BH4A 4TXEA 3VGBA 2VRQA 1XH0A 1OD0A 5HDRA 2CXGA 4PMRA 1V6XA 1W9VA 4D6HA 3TONA 1DWJM 1JXJA 1EDQA 2WC3A 1HP5A 1R46A 3KL5A 4OOZA 2D1ZA 5HBFA 5E70A 3UEQA 3WF0A 2FGLA 4WIWA 5M03A 2F7OA 1JI1A 4HMEA 3MS8A 3MMUA 1X6LA 4XZWA 1BSIA 4AXNA 3SUUA 1BYAA 3WMCA 1YHTA 1ZBKA 1E71M 5E0FA 5F7UA 1UWUA 2VR5A 1US3A 4MB4A 5D9NA 1V3IA 2FHFA 4C7DA 1J0IA 1W9DM 1JIBA 1WZKA 3D4ZA 3ALGA 2VUYA 3WQVA 3VIPA 4P7NA 3VSVA 2DIEA 3AIVA 2O9RA 4PTVA 3WDQA 3GXPA 3WD3A 2F7QA 3GXTA 2X05A 1HJQA 2F61A 1EGZA 3EMZA 1TZ7A 4NZFA 1RH9A 3D50A 3NYDA 1GQJA 1DEDA 3IAPA 4UFMA 1CGWA 3F4VA 4F79A 2WPGA 2XFYA 1V03A 4S3JA 4WLCA 2DT0A 2QMKA 1UR8A 1K9EA 4HZ6A 3AS3A 4MDPA 3JUGA 5DMYA 1JI2A 3N04A 1E6QM 1WZLA 4AMCA 3M6DA 2E8YA 1V6UA 1QNPA 1J0JA 3SUWA 2WXDM 4W5UA 3AHZA 3W53A 1E3XA 2Y2WA 4AIEA 4CKQA 3VVGA 1C93A 1HL9A 5C8BB 2GJRA 3HG4A 2BXZA 2F18A 2JIEA 1J18A 3AZRA 1B30A 1R7OA 3WFLA 3LXCA 1HJUA 4YHEA 1TQUA 2VX5A 1NWRA 4N42A 3VM5A 5HOSA 1ZJAA 1JG9A 4R5EA 3MV11 1HL8A 3U7BA 1WDPA 1LQ0A 3EJQA 1MQQA 3AMDA 1WP6A 2GJXA 3AFBA 3W27A 2OLHA 2QPSA 1WDQA 4Q22A 3RM4A 2J7EA 2B31A 3PHAA 4URIA 1Q6EA 2X2HA 3A47A 1W3JA 1E40A 3GTNA 4CUCA 3CLWA 2WHLA 1G9HA 1WPCA 3O2LA 4UFHA 1BFNA 1HXKA 4Z2JA 4J3UA 4OJYA 2XVPA 1HF6A 3CC1A 1B3XA 4PTWA 4DWSC 2PBOA 3L4UA 2AAAA 5LYRA 5CLTA 4CU7A 4AD4A 4CN6A 5GNYA 4KMQA 1LG1A 1CYGA 2FGZA 4AC1X 1B3WA 1ESWA 4JFVA 1BLIA 2GSJA 4MNKA 1JYXA 2BV9A 2CPUA 3W28A 1UH3A 3CMJA 5BXRA 1KCKA 2DPEA 1GUVA 2DT2A 4QLLA 2XPKA 4V2XA 2BNJA 3W6LA 2O92A 3CO4A 4UZUA 3OB8A 1GOWA 4UR9A 1BF2A 5FL0A 2ZWYA 1SZNA 4W8LA 4LGXA 3OA5A 4PMUA 4NSBA 5DT5A 1UKSA 3A5VA 1W9XA 4Z2KA 1XSIA 4HOWA 2OYMA 2AOSA 5HXMA 2CBUA 2DT1A 1V3KA 2QPUA 2YFOA 4QFUA 4EE9A 1FH9A 3BUDA 2J8GA 5JBFA 4FNUA 1S46A 2CITA 1CZ1A 2W62A 3OG2A 5CSYA 3EDFA 4IPLA 3BAJA 5FCZA 4NXKA 2V3GA 1BVZA 3WMBA 3PZIA 1LF1A 1QWNA 1VJZA 5CPQA 2PWHA 3FXYA 2YLLA 5M17A 1J9YA 4QCFA 1EO5A 5IHRA 2XSBA 1QW9A 4MAZA 1VEPA 1OBAA 1XYFA 2VI0A 4C7GA 3OLIA 2X09A 1PBGA 2GJXB 3QR3A 2J79A 1KBBA 1U2YA 1WB0A 4NXSA 4KH2A 3AROA 4GINA 1J0KA 3UG3A 3AS0A 4BZYA 2E9LA 2WVTA 5DO8A 2DDXA 2QF8A 1DHKA 3ZIZA 2VNCA 3DECA 3G6MA 3UCQA 4HZ7A 4B9YA 3WQ8A 1M03A 2YFNA 4UOZA 4KGLA 1NARA 1W1YA 1QHPA 3K8KA 3ZSSA 1VF8A 4ZXLA 1ITXA 4BS0A 3DDGA 4DO5A 1W9UA 3W29A 4JFWA 2XJ7A 1UD2A 2VZUA 3SCUA 3POCA 3GM8A 3UESA 2WHMA 3FN9A 1HKMA 5ABFA 4A3HA 4IUGA 4GI9A 2DGAA 3WL1A 1KTCA 3EJTA 4PBGA 4HZ8A 4FNPA 3ECQA 2V5CA 1N82A 4KRUA 5M3WA 5DT7A 4H8HA 2ALWA 1QW8A 3CH9A 4HA4A 4CD4A 3BMWA 2VX4A 2EPNA 4D6CA 1RP8A 2C7FA 3DDFA 4JHZA 5HNNA 4TOQA 1FOBA 5GQBA 1HWWA 3TOPA 2NT1A 2XVNA 3OGSA 2ZX6A 3RM9A 5I3DA 1E73M 4PN2A 4ZXOA 2XWDA 5A6KA 3TA9A 1JYNA 4GQQA 2WMHA 2YL9A 3GNPA 3FHAA 2W91A 2ZUVA 3IJ8A 1WAWA 2FH6A 2WKGA 4AY1A 3VX1A 2XN2A 5C71A 3S5ZA 3WF2A 1WE5A 4AZ6A 3D5HA 5LA1A 1E43A 2Y4SA 2ZX8A 4H2CA 1ITCA 2BFGA 4B15A 4U31A 1Q6DA 1BYCA 1DWHM 4UFJA 2GFTA 2D22A 4DUVA 3DYOA 1NOUA 1BG9A 1EQPA 3TP4A 4P8XA 2WMIB 1XSKA 3ZJ6A 1XSJA 2PBGA 4LXFA 1FH8A 3N13A 1LWJA 2DSKA 1JF6A 2J25A 4UQCA 1PPIA 2WK2A 5EMYA 2QLYA 2ZX7A 2JEQA 1OD8A 3A4WA 2V3EA 3VD5A 5IFPA 3PTKA 3BUIA 1H41A 4KGJA 2WC4A 2XM1A 1E1EA 1V3JA 2GK1A 3CUJA 4UCFA 4UQBA 5EB8A 2UY4A 2J47A 2XFRA 2O9PA 1NWTA 2IXUA 3CPUA 3BVUA 5ABFB 1PEZA 3N1AA 3WY1A 3WBEA 4J3VA 4BQ2A 1HJSA 1E6RA 2XVGA 1EDTA 4M80A 3CMGA 4E8DA 4CVUA 5KZ6A 4CN1A 1B3YA 1UH4A 1CNVA 1JNEA 3PTMA 4JFTA 4YN5A 4MB1A 2PF0A 2X0YA 4X9YA 1BYDA 5CG0A 1O6IA 3WY3A 4NX0A 4E8CA 1X6NA 1E9LA 3VUPA 1LL6A 3L4WA 3OLDA 1XV8A 2FDMA 1CXLA 3WNNA 1TMQA 1XD1A 3AIRA 3LRKA 4UQAA 2VOTA 2G41A 4RE3A 4TUFA 4CGTA 4JKLA 4PCSA 3BVTA 2WVVB 1I1WA 4QP0A 4Z2HA 2J74A 5BXSA 1V6YA 1J0YA 3WBAA 1UKQA 3U7VA 3LRMA 1B0IA 4GZIA 2Y8VA 1KQZA 3AIEA 3PZQA 4MNJA 3KLKA 4UFIA 3VX0A 4HMCA 4XV0A 5AYIA 1E0VA 5BRPA 1BGAA 2UWFA 3A3HA 2A3HA 3NSNA 4JHOA 4MDOA 2BY1A 3ARQA 2Y24A 1E6XM 3BC9A 1BHGA 5JIWA 3MU7A 1W9PA 3CBWA 1ISVA 1R34A 5CLWA 4AZGA 2CBVA 1GOIA 3MUIA 3UG5A 2A3BA 5A6JA 3AMLA 3K8LA 3T2OA 1P6WA 4GXPA 1QNSA 1SYTA 3PZVA 2J77A 5D9OA 2F1BA 1UR2A 4V27A 1HKIA 2VURA 7CGTA 3TTQA 3MUZ1 1EOMA 4TVCA 4FK9A 2GK1B 4PSPA 2EEXA 3ZJKA 5JUVA 1MFUA 2WVUA 2FE0A 4HTYA 4NRSA 2F7PA 3VDAA 1CIUA 4D1JA 1A3HA 4NRRA 3CZEA 1ZBCA 3U5UA 1XRVA 1Y7VA 1A47A 2DSWA 1JFXA 3M46A 6A3HA 3SUSA 2EPMX 4JCLA 1R8LA 5A2AA 3IK2A 3WDIA 2UY2A 1C8YA 3D52A 1KQYA 2ZWZA 3W38A 3VO0A 5CGMA 4TX8A 1Q6CA 2BHZA 4Y7EA 2WBGA 1B1YA 4AMWA 1FP9A 4NZCA 1OGBA 1AQMA 4AD1A 3A4AA 4H8UA 2J7GA 3WD4A 2QV4A 1MQPA 2JF7A 3I3EA 3DX1A 4XUYA 5CPTA 2EPKX 3VIOA 1PJ9A 4FLSA 1UD6A 1E72M 4AYSA 3AQUA 1J0HA 5I24A 2VZVA 4W89A 3LPOA 1JD7A 3RIKA 3U5YA 3VM7A 3VPLA 2D2OA 4W7VA 1NH6A 2A3EA 4GI8A 3EMQA 4A3YA 2YIHA 4F9JA 1AQ0A 3WNLA 1G0CA 2JE8A 3L4ZA 1KGWA 1BGGA 3NJ3A 5EBAA 3NSMA 1VFFA 3WDHA 1R86A 3DC0A 1JGIA 1C90A 1ISYA 4CVWA 2W4XA 3PN8A 2VCAA 3GXNA 1J0ZA 3A6OA 3W24A 4LYRA 1WDRA 1DWFM 2UY3A 4K68A 2X2YA 4BQ3A 4IM4A 4XB3A 3PZUA 3SCRA 1H1NA 3LX9A 2VZTA 2C8NA 4AZ7A 3A22A 2X1IA 1UD5A 3RILA 1T0OA 3ZOAA 2WYSA 1TQVA 1E6ZA 1GPFA 2JIWA 1CDGA 3VSTA 1E1FA 1H49A 2DSVA 1JFHA 2ZIDA 3NDZA 3SCWA 5A8PA 1NM9A 5A6BA 1QNRA 4CD8A 3ARVA 5D8WA 2CKSA 1QX1A 2YLAA 4OGZA 5I77A 3WELA 5ABGA 3WH5A 3CUHA 2X2IA 3UERA 1HTYA 1K9FA 1V0NA 1BVNP 4GO8A 2GJPA 3ZT5A 3PZ9A 4CD6A 1GOOA 1W3KA 1WNOA 5M5DA 3J7HA 2BS9A 1U33A 4PMZA 1WDSA 3ZR5A 1RD6A 1TFVA 2YOCA 1JF5A 1OIFA 3A21A 1GHRA 1CXFA 3GNRA 3VD9A 3VIFA 3WD2A 2J62A 1KCLA 1O7AA 2ZUNA 3CHCA 3ZO9A 3A23A 3AHYA 1CECA 2D73A 2RGLA 3MO4A 4DM2A 1V02A 3WFZA 1V0MA 1E5NA 3MSDA 3BLPX 3EDKA 4DUXA 3BVVA 2E3ZA 4UQEA 1ZB5A 1OB0A 1UQZA 3VU2A 3M07A 3EJRA 2CIPA 1C3FA 1KBKA 4OBRA 5A3HA 4X0VA 3N15A 5GNZA 4U5IA 3WD1A 4JFSA 3ARTA 1W3LA 4DM1A 1MW1A 5D9PA 3CUGA 1JYWA 3WF3A 3DX2A 2OSWA 1OT1A 3SEPA 1R75A 2QHAA 4JKKA 2WMGA 1E5JA 3GH4A 3GXDA 1VBRA 3DX0A 1BAGA 4M82A 1F4AA 3AZSA 3PZMA 2XN1A 2ZOXA 2WC7A 3HG3A 1R87A 4WKHA 2VQUA 3T2PA 3FHQA 3VDHA 3DHUA 1UASA 4L4PA 4ZENA 3GZAA 4AISA 1UA3A 3WUEA 1KXTA 2OSXA 3II1A 4DO6A 1H0GA 4L4OA 4PMOA 1WKYA 3B9EA 5AC4A 4TTGA 2DEPA 3A24A 4AZ5A 2YJQA 2OYKA 3AIWA 3GYCA 2DT3A 1IZKA 1UOKA 4B9ZA 4N0RA 4GKLA 4CCDA 5JBEA 2VC9A 4AD2A 3KE0A 1W2PA 2VX7A 1I1XA 2A3CA 4AD5A 2RGMA 2EXOA 3BMVA 4DUWA 3H55A 1W1VA 4HU0A 2WMFA 1UWSA 2D3LA 4Z2GA 5I5RA 4FLRA 3BVXA 4D72A 5ABEA 1PZ3A 2XFFA 1SMAA 2E4TA 1NOFA 2VRKA 5A6MA 1B31A 1JZ5A 1FFRA 3T08A 1NWSA 2CETA 1W1TA 3RMEA 3IAQA 4P7OA 4BQ4A 3SCPA 2E9BA 3THDA 1QI5A 3OIHA 5I23A 1CBGA 3G6LA 3CV5A 2EACA 4ACYA 3WUFA 1KXQA 4AZCA 4LYQA 3AMKA 1G94A 1GZJA 2ZXDA 5LA0A 1F4HA 4W8BA 4MJ4A 2JFEX 2WBKA 1KB3A 1FHLA 1PIFA 4PMQA 3PBGA 1XHGA 3CZSA 5HPCA 3VILA 3BAYA 3VDBA 4XX6A 1H11A 4W86A 5FKYA 2DIJA 4PUEA 5D9MA 2VZOA 4RE2A 1HN1A 1HP4A 1E0WA 5FD0A 3HZ3A 3BLBA 3CHFA 2XUCA 3AI0A 3QHNA 4M1RA 1W91A 3F5JA 4WJXA 4U3AA 3EDDA 4GQRA 3ZT6A 1OM0A 1CGXA 3B8SA 2G4FA 3VD3A 3T0DA 1GW1A 3D51A 1MXDA 9CGTA 4J3WA 5A1AA 3WIJA 1OGSA 4EKJA 3BSHA 1GNXA 1HX0A 4B3LA 1OWQA 1X1NA 4PYSA 2UY5A 1JXKA 3VGHA 1JZ3A 3AYRA 1JL8A 2J7FA 2WKLA 1C8QA 3QOKA 3ZMRA 1W3HA 4J3SA 1ISWA 2WM0A 1UUQA 3NCOA 1D3CA 2J4GA 4AD3A 4GIAA 3NDYA 3GH5A 1CGTA 4DWSA 4BCEA 2NW0A 2YL8A 1GOKA 5AYBA 2DSZA 1FA2A 1LL4A 1UQYA 2FH8A 3WDRA 3N18A 3RM8A 1PZ2A 2ZXQA 5E09A 3RO8A 1OINA 5A6BD 5IXEA 4MNLA 3TTOA 3AJ7A 2BHYA 2FYVA 3VGDA 2Y5EA 3THCA 3W0KA 4M24A 2EABA 2D0HA 3SCTA 2EJ1A 1LLOA 3GDBA 5AY7A 3UR8A 4J3XA 3GNOA 3EJSA 5BROA 4IISA 4AD0A 2XGBA 1MXGA 4W84A 1B3ZA 3GXMA 4AZCB 3BUQA 1KR1A 1R85A 3K46A 1DWGM 3PZGA 5A6AA 4CD5A 4OOUA 2EPLX 3PZTA 1PX8A 2DSUA 3NSXA 3CZNA 1JZ8A 3ARPA 2OW7A 2D20A 1JYVA 3S2CA 3VKKA 2BY0A 3L4YA 1GVYA 4CCCA 1KGUA 2Q8XA 1UD4A 2XGIA 3KL0A 1GJUA 2HVMA 3ARZA 3HG2A 2IGTA 1V0LA 1DP0A 3FNDA 2ZE0A 3DYMA 4U5KA 3L4TA 1NP2A 2CESA 3CHEA 8CGTA 5A2CA 4S3KA 1US2A 3VNYA 1ODUA 1OT2A 2J7HA 1E4IA 4TVUA 1FFQA 4W7UA 3IJ7A 2BHUA 4ZE5A 1PX3A 2WNWA 1CGYA 4H04A 1AVAA 1TQSA 2YBTA 4PMYA 1ZBWA 5IFTA 4W7WA 1GHSA 1VFUA 4EANA 4E4PA 4P7RA 5JBDA 3VGEA 1TQTA 2O9TA 1JDAA 1EOKA 3WY2A 2CHOA 4AIOA 4AW7A 4PUDA 2ZX9A 4Z2LA 3BAWA 2CCRA 1TR1A 1QBBA 3BAKA 3AIQA 4PMNA 5C70A 2C0HA 4BA0A 1D2KA 3APGA 4DWSB 1WZMA 2F1AA 3QHMA 4UFLA 2ZX5A 5IHSA 4UOQA 2XSAA 3WNKA 5D4YA 2EPOA 4BQ5A 1VIWA 2EAEA 3OBAA 2YA1A 1H5VA 2PC8A 1QOXA 4AYGA 3CIVA 1V3LA 2WWDA 3WUGA 4WKFA 1GONA 1GQLA 5A95A 4ACZA 4UQ9A 1E6PA 4M8UA 4GI6A 5E0CA 4CCEA 2VVNA 2E0PA 4PMXA 2IXVA 3WQ5A 2WCSA 4D6EA 3TTYA 1EO7A 3OGVA 1KWGA 2YBUA 2PWGA 3W81A 5BXPA 1CGVA 3D4YA 4H41A 2JALA 3EJPA 3TTSA 5BRQA 1Q4NX 3RJYA 1KWKA 3ARUA 1JDDA 2EQDA 3SCOA 1JZ4A 1GQKA 3WH7A 2GDUA 3WNPA 3WN6A 3DYPA 4LQ1A 1FHDA 2NSXA 3A4XA 2W63A 1H4PA 5A8OA 1QI4A 2NT0A 4LX4A 1NP0A 1DTUA 1H2JA 3L2LA 4HA1A 3AMGA 2WZIA 1QHZA 1UZ1A 1GCYA 1ZL1A 1XYZA 3VTRA 2YA2A 4JIEA 1TE1A 4HU8A 1CXEA 3AHVA 1KR0A 2D0GA 1E0XA 1R47A 2ZUUA 3VIHA 3MKKA 4B3KA 1MYRA 3WQ4A 3WF4A 2XVKA 2XHYA 4HP5A 5E6ZA 2XTKA 1EHAA 1HVXA 3AICA 4WSJA 3WDPP 3MV01 3W6MA 2OWXA 3AHXA 3WQ6A 3N12A 3T09A 1WO2A 3SCQA 1M01A 4XZBA 3EYPA 3CUIA 4QLKA 3ZJ7A 2EADA 2WMJA 4PTXA 3CZ8A 1V6VA 1YQ2A 7TAAA 2CKRA 2WB5A 4TVDA 1MWOA 1BG4A 3NUKA 5E6YA 5GNXA 1AMYA 1EIBA 3HU7A 4WKAA 2PWFA 4OIFA 4JL1A 3AISA 4EAMA 4JKMA 4U33A 1NOWA 1ISZA 1UR4A 4AMXA 2WLZA 3W26A 1E70M 5A8MA 1E15A 3L4XA 3N17A 4W5ZA 2BXYA 4ACZB 1UZ4A 5CGTA 2D3NA 1E6NA 4ZEPA 1BTCA 1C7SA 3W37A 3ZT7A 1L0PA 3MMWA 5A69A 4ML4A 1VJSA 4M56A 3LPGA 1QHOA 1JAEA 2OW6A 4DWSD 4PCTA 2GUYA 1UR9A 3B9DA 3VMPA 4RL3A 1SFSA 1MVYA 4M81A 3VIJA 1JZ7A 1UWIA 1XCXA 4DO4A 2VT0A 1FP8A 1ZS2A 3EDJA 3KLLA 3SUVA 4UZSA 4CN4A 2VX6A 1XD0A 2ZUMA 1NQ6A 3VIIA 3BAIA 1JZ2A 2F8QA 5BWFA 3VIGA 2J8FA 2QMJA 5E1QA 2PI6A 3WH9A 3VDCA 2V3FA 4D6GA 1OIMA 3D3AA 3LMYA 4KWUA 2V5DA 3ARRA 3BLKA 2BVYA 2V3DA 4P8UA 4FNSA 3GXFA 4MNMA 1L8NA 5I78A 1LWHA 3E1F1 1TG7A 2VR4A 3QGVA 4P8WA 5I2UA 2WVSA 3CGTA 2GDVA 2CBIA 3DX4A 5KEZA 1GQIA 4WF7A 2D0FA 3H54A 4PMVA 4HOZA 1KTBA 1XH2A 4FNRA 3VIKA 1BYBA 3AIUA 1QNOA 2XYLA 4R27A 3NIYA 5I79A 4FNQA 5DF0A 1HIZA 1VRXA 1EA9C 1KXVA 2MANA 1E6SM 4GPNA 3GBEA 3ZR6A 2BY2A 3I3DA 1Q6FA 3CZLA 2BVTA 2XIBA 3CZJA 4YHGA 2XIIA 1TVPA 4NZJA 1ODZA 3CUFA 4NF7A 4F9DA 1JAKA 1QI3A 1K9DA 2WW5A 3F5LA 4MPKA 2VO5A 3F5KA 3K4AA 5BYWA 2G3IA 3T0AA 3BUBA 3PZNA 4FMVA 3U57A 1G1YA 1H09A 1I75A 3UR7A 2CYGA 1G5AA 3ARWA 1QPKA 2OSYA 1TQWA 3I3BA 3ARXA 2YKKA 1MQRA 1XCWA 1LJYA 1QWUA 3AXIA 3DHPA 3WEOA 3B9AA 7A3HA 1HT6A 3VD4A 1W9BM 5FOOA 1J01A 4UOJA 3WNMA 3OGRA 4F8XA 4F66A 4HOXA 3BCFA 1IT0A 3LPFA 4TTUA 1B90A 2WWCA 4D6FA 4FNTA 1B2YA 4GZJA 1ECEA 4M29A 1E4MM 1XH1A 4QAWA 3VMOA 4ATDA 1IZJA 2ZUWA 2XM2A 4P8VA 1MW2A 1WCGA 4FLQA 2ZXBA 4HA3A 1TCMA 1CENA 3WKZA 2E8ZA 1WZAA 1OSEA 2IUZA 3EBVA 4IPNB 4AZBA 4ZE4A 1KXHA 5JIPA 1CPUA 2PWEA 4HPHA 3RDKA 2EO7A 3AIBA 5A94A 4MTVA 2TAAA 5A8QA 2G3MA 4QCEA 4PEEA 2F2HA 3KL3A 2VL4A 3KWXA 3TV8A 1UKPA 3ZQ9A 2G3JA 1O7DC 1JZ6A 1TA3A 2VCCA 3OLGA 3W82A 1HKKA 4UTFA 5CXPA 3N11A 3PTQA 3VINA 3QOMA 3MI6A 1SR0A 2BVDA 2YA0A 4AWEA 4WK9A 4C7FA 3WY4A 2YL6A 1UA7A 3AHTA 1RP9A 3SIMA 4AIUA 3WEMA 2CEQA 4W87A 1NWUA 3WQWA 1CLXA 4W85A 4QDMA 1OGGA 1CEOA 2D24A 4NI3A 5ABHA 4EK7A 4PRWA 2EBNA 5HPOA 3SUTA 1MW3A 4P7QA 4AEEA 1JNDA 2J7BA 4ATLA 1VAHA 4GO9A 3VMNA 1PAMA 2WMIA 4MADA 2W67A 2W61A 1M53A 2V38A 3WDJA 2WMKA 5DFAA 4AEFA 4JZ5A 3QHOA 2WHKA 1UWTA 1DWIM 3T2QA 2VJXA 6CGTA 2CBJA 3OZPA 4PSRA 2E9MA 3O9NA 3ARSA 3BUPA 1IV8A 1D7FA 1UWQA 3SURA 1KGXA 3VSUA 3VOCA 1VB9A 3KEHA 1MFVA 3L2MA 3VD7A 4D6IA 4P7LA 4W88A 4OUEA 1RPKA 3BGAA 4D71A 2O9OA 3CZGA 1QNQA 3IJ9A 2ZUSA 4UQDA 3W25A 4UFKA 5CQ1A 4U2ZA 1JD9A 1V0KA 3ZJ8A 4OKDA 1AQHA 1QVBA 2VRJA 3T0BA 1H0IA 5A2BA 1XC6A 2G3NA 1VEOA 5I0DA 5GPRA 5CPSA 1QBAA 1CGUA 4X0NA 1TA3B 3UG4A 4MAVA 4JFUA 4J3TA 1HJXA 3EJUA 1C8XA 1ZJBA 1VFOA 2CNCA 3MUAA 1UKTA 3IGUA 2W92A 1Z32X 2VVSA 1HKJA 4HPGA 3RJXA 3VGFA 3AYSA 3AXXA 3WNOA 3FAXA 2ZICA 1CLVA 1EHNA 3EDEA 1J12A 3CHDA 2VMFA 3BVWA 1CWYA 3K1DA 2Y8KA 1R33A 3LRLA 3FAWA 2OWCA 2Z1KA 1DWAM 2DQXA 2WVVA 3KZSA 5FIPA 2WZHA 1VFMA 1VEMA 3MANA 4TX6A 4PTMA 5DEZA 1EDGA 1ISXA 1B9ZA 3BAXA 3WMSA 1EH9A 4H7VA 4AZHA 2XVLA 1V3HA 3HMCA 1XGZA 4BF7A 1C91A 4MB3A 1TUXA 3S5YA 1K6AA 2CERA 3ZSTA 5BXTA 3WD0A 4W93A 3WENA 8A3HA 1UR1A 4E2OA 3SCVA 2FHCA 4OBSA 4J7RA 1GJWA 5CJ5A 2WAGA 1HXJA 2DH2A 3RCNA 1M04A 1TVNA 2WCGA 3WEZA 1BQCA 4FF5A 2W5FA 5E9AA 2WSKA 1E3ZA 3CTTA 1U30A 4J27A 3VGGA 3GBDA 2Z1SA 4LYPA 4CD7A 3SCSA 3WH8A 3HJEA 1UHVA 4W8AA 4JCMA 2AMGA 4D6DA 3FW6A 4CU8A 3POHA 4JAWA 1GORA 4AZIA 5CSUA 2WCAA 3VNZA 1FH7A 3AOFA 1E4NA 3W4RA 3WUBA 2WSPA 1CXIA 1VBUA 1EQCA 4A4AA 3N9KA 1JDCA 2J7CA 1QI0A 2PB1A 4Q7NA 1B3VA 1UD8A 3BCDA 5LA2A 2WHJA 1V08A 2G8ZA 2OWWA 1ZBVA 4CU6A 2J78A 5EFFA 1BPLB 2BY3A 1UD3A 3WL0A 4RE4A 2CHNA 3H53A 1K9TA 1PX4A 3HG5A 1MW0A 4B16A 4MJ2A 3SCNA 4J28A 3RPMA 1V6WA 3K4DA 5EFDA 1EXPA 2YDSA 3VIMA 1E4LA 5A6SA 4H8VA 4PMDA 1UYQA 3EMCA 3L4VA 3BSGA 2J7DA 3AZTA 3LPPA 1Q6GA 1PS3A 2VZSA 2OYLA 1GOMA 1W2VA 4D1IA 3K8MA 2YDRA 4HMDA 4U2YA 2ESCA 5CZKA 2JF6A 3S6TA 1CXKA 5BCAA 2XN0A 1UH2A 2GVYA 2WANA 1KFWA 4FLOA 1ZU8A 2A3AA 2D23A 4ZFMA 1C92A 1CXHA 4UNIA 1E56A 2E40A 1LL7A 2X0HA 3CZKA 4KRTA 1QI2A 3OLEA 3IANA 4MB5A 3ALFA 1R7AA
chains in the Genus database with same CATH superfamily
5HWMA 2HJLA 1J48A 2R0LH 4FFTA 1FFPB 3HKZA 1T7LA 3EYOA 2FB4H 1F8TH 1NCDH 1NEUA 2VR2A 1AJ7H 4OLVH 4LESA 5CCKH 2J9XA 4AIZA 4BBWA 5HYJB 4DPBX 5KVDL 3VCLA 1FFNB 1XGYL 4PB0L 4JIRA 1S7SA 4WRHA 2ZZ4A 4WRLA 4B3ZA 2BVEA 1JCNA 1E7VA 3G8RA 4Z8FH 1Q7ZA 4L64A 3T6QC 4TXEA 4FF7A 1PTAA 1X44A 3CPGA 4XTIA 3KCPA 2BGSA 3LHTA 3VKBA 4GBDA 1MLCA 1EZSA 5HULA 2B0SH 4XMTA 1ZTMA 4FX7A 1P9MA 2GK0B 5GRVL 3SDAD 1DQKA 2PPGA 2CGZA 4WTQA 4HHMA 5TJWK 3MSYA 5LXGL 3VFNB 1UT1A 1AO7E 1SFHA 4H83A 3CLFL 5I1LB 1IZCA 4JFDD 3ETTA 3ML9A 4N0UB 3GSOA 1HAUA 2W81C 4JHUA 3QHFH 3SOBL 2R69A 4QRQA 1NFIB 4G7VL 5IEKA 4R2GD 3BP7A 3RZWA 3VI2A 1UR8A 3EAKA 3DMMA 3FFDA 2DQCL 3QJFB 1J0JA 4MNQB 5LCVL 5C8BB 3U7WL 2JIEA 4Z7UE 3WFLA 1QFOA 1C12B 4W81A 4PEKA 1UGNA 2HYMA 3VWKA 4RRPM 2BVOA 4G72B 5I1GL 2WZTA 2YPIA 1OFAA 4XXDA 3SPVB 1E5YA 4FG0A 1PV8A 1G1CA 4MAYC 3GDKA 3TZFA 3PR2A 2UZYB 1EMTH 1F1GA 4LSDA 3NGBB 4LNVA 1WPCA 4LPUA 1T80A 3FJNA 1HXKA 3ESVF 5DT1H 2A4CA 2ILLA 3FSUA 3GVGA 3RF9A 2RJHA 3BJTA 3H21A 2AEWA 3SSJA 4KMTH 5DA0B 4XZUB 2QCGA 3AG3B 4L0ZA 4EVNB 2OL3H 3VGAB 4N1EA 1XZ0B 1LO5A 1O6SB 2QCCA 1JNNH 1PQZA 5SX4H 3BWAB 2PU1A 3WLKX 3FSWA 3SDDA 2QKIC 2QKSA 2O5XL 4FTVB 4A3QA 4DN1A 2E25A 3F5WB 4MDJA 2J8GA 2CITA 4ABQA 3S6DA 4M1GL 1IKFH 4NXKA 4WI6A 4J6RH 3LHPH 4BFNA 3FXYA 3MZ2A 2XWBB 2GCYA 3BH8A 5H8UA 3PRZA 4JN1L 4OIIL 2R1KA 1FYTA 4BRJA 1OB1B 3O6ML 1R3YA 4ZD3L 4IOIA 3AS0A 3QNFA 1KSRA 4C57C 3URQA 3S96A 4KH9A 4L3EA 4BK5C 4OI8A 3L6FA 5DJXB 4NRXA 1OP4A 1I1RA 1W9UA 2H2PD 4LT9A 4BR1A 4PFEA 1E27B 1KTCA 3W7KA 1H6TA 1N82A 4HIHB 4K5OA 4LF2A 3VQMA 5IB2A 3DDFA 3DIFA 4ZW6A 3AO0A 1CG9B 1XMEB 1SYVA 4EI0A 3N29A 4MA3A 5I3DA 1RERA 1REQA 4KOBA 1JPTH 5KSAA 3SPJA 1SFJA 3RZCD 1EFQA 3BVNA 5GGUA 4IGNA 2DWDA 2H1PL 3L3HB 5F88A 4BIKA 3N73A 4PRPA 3RWJB 2YQGA 3C2AL 3EG9B 4EO5A 2VDRB 2D22A 3DYOA 2D7MA 3ARBA 4JFPA 3US9A 5LNGA 2PTTB 2MOQA 1X9LA 1E30A 3NIFB 1D8CA 3UBXI 2ZT9C 2HKFL 2NPLX 3L16A 4O2CB 1A3WA 4X4ME 3HPJB 3RK8A 4Z0XA 5G5DA 5HDBF 1TZGH 4HXAL 4Y8AA 1T7WA 4J3VA 4EI5A 1C1EL 3KPTA 4NAJA 3FCPA 2XZ7A 5T5FA 1UH4A 5EU6A 1T7XA 2P76A 3V4VA 3AGWA 4MB1A 2V5MA 5EN2B 1GA2A 4MMYB 1ZUAX 1UWAA 3PCYA 4IJCA 3VOHA 3C5QA 2BNRE 3VD0A 2I26N 4WR3A 4PRNB 2HT2C 4MMZA 2VC7A 3CAQA 5IM7B 1YNKH 3HW7A 4ZUWA 4Q7BA 4UFIA 5AYIA 4MDOA 1PG7L 3K74B 2Z91A 3QUMB 5JHBA 2FJKA 2ZTBA 2PLTA 3K8LA 4N6RB 4E3TA 3O4OC 4JTKA 4RXGA 6REQB 1G6RH 1D7BA 1O66A 5DJAA 2YBGA 4KKCC 1IEBB 3C52A 1UROA 4NQED 4QT5A 1KJ2L 4M7JL 3CNYA 3UW6A 3M46A 3BX7C 1U58A 4PJEA 4QNPF 5A2AA 2UY2A 5AL0A 5F6HI 2W0KA 1C8YA 3OC5A 4RA3A 1FORL 1ONQB 2R39A 4F5CA 2V30A 3DEQA 3I3EA 3N9SA 3ET9F 3VIOA 4BJLA 1E72M 3AQUA 1JHTA 3US0A 2RGSA 1U3HC 3QNYA 1F18A 3PP3H 2A3EA 4XZIA 3WHE1 4DHLA 2R9RA 1AQ0A 1YEJL 1YEIL 4ZS6C 1VFFA 1C90A 3FO2B 2W4XA 4X9BA 4WJG3 3GUTB 1LCOA 3HC4H 1B4KA 3W2UA 3BZFB 1YEKH 1K70A 5DQJB 1OWRM 3ITOA 2C8NA 3IKCB 1LZOA 1CDGA 1JDEA 2WB7A 1QKZH 4GKNB 3FSZA 3WELA 3WH5A 4HNVA 3IDGB 2PGWA 4JJOA 2G4GA 1BVNP 4GO8A 4KNTA 4YDKL 4REQB 2YD1A 5INDA 1MFMA 1KCVH 5M5DA 3J7HA 4FJYA 3KJ6H 2BOCA 4AXWB 2QT3A 2YZRA 5DMNA 4NENB 3NA8A 4PMZA 2V2WB 2FWOB 1BVKB 2GJ6E 1JF5A 5C08A 3VD9A 4PJ7E 4NBZB 4M62L 1NAMA 2HG5B 4X7CC 3P5ZA 5FKAB 3V7AE 1HE8A 4MA7H 4FHBD 1X7QA 1ZIAA 4ZO9A 4WAFA 1W5PA 3D3VD 1C3FA 1PHWA 2C6QA 3QAQA 3KBMA 1L2UA 4WWNA 3N40F 4JFSA 3CUGA 4O1AA 4XMPH 4AV4A 4YXLL 3CAKA 4WY0F 2LTQC 3U7YL 3CWNA 2FYMA 4AL8L 2W59A 3ECBB 5CIPB 4P2OA 1F3EA 2DQ6A 4CNUA 1H1YA 3DHUA 1MQ8A 4KT2A 3INUH 4ODVH 4JQ4A 3TIEA 4DO6A 4LSUH 4Q6KA 3V0FA 3FQRB 4YIQB 2GJNA 4HK0A 3U4AA 3QHZL 1FH2A 3FT4B 4GKLA 1SUHA 3KR3L 4P3CH 2DEYX 3SIZA 2P80D 1KC7A 4HZAA 1SOSA 4L8CA 3H6AA 2BASA 1GGYA 2C9UA 2YRZA 3UDWC 1AO7A 1HCYA 3BHBB 4XB8A 4M6OH 3O4LD 4MUPA 5J3HD 1W1TA 1MRDL 1N70A 3L3OC 1KB5A 3ATEA 5D7LD 4XVJL 1CBGA 3CV5A 2XZ9A 3ABQA 5I76A 4PWGA 1KB3A 1FHLA 4PMQA 5D02A 2UZXA 4RZ4A 1XR8B 2J13A 4AF0A 1RKRA 3FT3B 4DZBA 3T2NH 4JPVH 4G8TA 3ZGHA 5FDYA 5FD0A 4ODUA 1WUEA 1W5QA 4Z7UA 4IXXA 2Q2EB 3FCUB 5ICYB 1Z8AA 3EDDA 3D47A 2PO6C 4Z7VF 3QPQD 1F45A 4UTKA 5C0BB 4YCPA 3D51A 1DLHA 5AB0A 2V63A 3IWPA 4KDTA 4JREC 4LKCA 5E6IB 5TE7H 3WIJA 2EYTA 5D9SB 3LLXA 2D7TL 1NEZB 3H7BB 3O41B 2WM0A 1XIGA 3ZRFC 1M4KA 1IBZA 5HAOA 5FSDC 2WBJA 3S35X 1KMGA 3M43A 1Q3NA 3VFLA 3N18A 3H2WA 1SNRA 3GQYA 4Z77B 3QPYA 4YS4A 3MRFB 5JHLL 4YHYC 3DENA 5DURB 4DZ8A 4RZBA 2YB4A 4ABWA 1OAUL 3BE1H 3HRZA 3R0NA 2ZF9A 4K5PA 1XRTA 3PXHA 1KR1A 1OFEA 2J6EA 2YJLA 4TU1A 1PX8A 5MKGB 3QFJB 6FABH 3DVIA 2PDQA 2P52A 4L4JA 5DRXB 3WLWC 4N8VG 1F3XA 5CZSA 2HVMA 5DD3L 2EC9T 1DVFC 2ZE0A 1NIUA 5GRUL 5IBUB 4NY2A 1XIWB 5I73C 4U1LB 2PP3A 3MKCA 3B8TA 2W9DL 4K8RC 4AV0A 4MJ5B 4TUKL 1ZHBB 1CGYA 2ICEC 4XNDA 2YBTA 2K8QA 1LHZA 5I18L 2Y72A 4E41E 1YMME 2CLRA 3BAWA 1YAIA 5I8EA 4DWSB 4HJGA 1P9MC 3HKFA 1CFQB 3QHMA 5IHSA 5BV7L 2XWZA 4G7EA 4DEWA 2OEMA 2AQ3A 3KM1A 4AYGA 4IMKA 3X13B 5IFAH 1UVQB 2NNCA 4EUPA 3RVVD 3RWEB 4FULA 4PC8A 2PTZA 1F3RB 1IHIA 4MCZA 2J7LA 3OBEA 3S1UA 3NZ8A 3TVMB 1DZBA 3KYNA 4I7WA 2VABA 3GHPA 2O56A 5GS1C 2EQDA 4FMFA 4LLVB 43C9B 3CFIC 3MRLA 5TGBA 2W63A 1H4PA 1QPXA 2X3BA 1OO2A 4LX4A 4O0KA 2OTWB 4I0PB 4X6EB 1H8NA 2VSKB 3VTRA 2H5UA 2ZZ1A 2Z3FA 2NY2D 1GEQA 3D69B 4LPXA 1BJ8A 5KJRH 1EHAA 4WSJA 3CHXA 3GRGA 2OWXA 2QADD 4FA7B 4Y2DD 2J44A 3BDKA 3TO4B 1QG3A 1XGTB 5EIIA 2EDEA 1NC4D 2CKRA 1MWOA 1L7IL 4MBRA 3PNUA 3Q8AA 4X4MA 5I75B 2E27L 3ULSB 1NGYB 3AXKA 5FEZA 5K9KB 2RQ8A 2OI9B 1RA0A 1QFEA 4GMEA 1ADDA 4BWTA 5KS9F 4YTQA 1IAOB 3UAEA 4F80A 3VFRA 4DKFH 4LB3A 2WWNA 4JVPA 4ML4A 4RE0A 5AW9B 3LPGA 1BZQK 2JB5L 5DQ9A 2V7HA 4IU3B 2A2QT 3ZDYF 3PWUB 5IROA 2DYSB 4DO4A 3ZL1A 1NCBL 1FN4A 4UZSA 3BAIA 5B7YA 4TMBA 2BZ7A 5C0CD 4L29B 3QWRA 4PG9A 3S97C 3FKRA 3CM4A 4BGDA 2BNRA 3LMYA 1FDLL 4KWUA 2WYIA 2G95A 4Z7WF 4AXKA 5AOIA 4GC3A 3GFUA 3CV1A 3AM8A 3WE6A 1L8NA 4NUJB 1INQB 4QDGA 3NQDA 4R7WA 2VR4A 2YUVA 2V68A 2XDHA 4QPEA 3QPXH 1L6WA 5DHVB 4WF7A 2D0FA 3I9PA 4C6BA 1MY7A 5FWQA 5FJUA 2Y63A 4WCYH 3C0JA 1DXFA 3GSWB 3CFDA 3KCOA 1YJDL 2BWQA 2IMRA 3M0MA 3ATAA 4OI7A 3IMTA 3QC0A 4Z42C 5GGRB 3T05A 2Y89A 1Q8JA 3CU1A 1G5AA 3OJVC 2P42B 2BRRH 3ZYOA 4DVRL 2BOEX 1ZLSL 2OEKA 3CLEL 4MKVA 1CBJA 1IT0A 3QJVB 2NY5C 2XDFA 2PWVA 4LUYA 4M29A 5JQ9A 1HYSD 4L1GA 4GRLC 1VFBB 3VD2A 4LNRA 5TQ2L 2J24A 1W31A 3LHVA 3MKGA 1WXYA 3VU1A 1GGIH 4P2RE 5F7DB 3EBVA 3RWCA 3WYZA 2EE0A 4C4BA 3KL3A 3QDJE 3TV8A 4NRYA 5DYOA 2UUDK 2EG6A 4KY2A 3F7RA 3LIZA 3N11A 1NLBH 3MI6A 3ARBC 3R18A 4IGHA 3ULVC 3Q2VA 2ZOTA 4UINH 1T66C 1YX1A 3FRUB 1I9IH 2YL6A 4KZDL 4PWJA 2PODA 2JH2A 1OC5A 2ICCA 2Y9RT 1TZIA 4BFIA 4ZUSB 1BOGA 1F97A 1GGTA 4X8CA 1HWGB 4ISVB 1L9PA 3CUPA 1G1KA 5E93A 4GFTB 3MR9A 4FG6D 5FA5A 3LAFA 1LILA 1JNDA 2J7BA 2PDJA 4JPWH 1CLKA 1KEMH 4F40A 4MADA 4X5RA 4R85A 3OTRA 1OX5A 2V38A 3D5OF 2GJ6A 3N41F 3NCCB 3TXVA 4QTGA 1Z66A 3UTOA 2BP3A 2VE6B 3MC0A 2OR9H 4PJ7A 1P7BA 4NQUA 3O3AA 4D6IA 3W5NA 3S1XA 5EBMA 1RLDA 5E2UH 2A74A 5T5NF 5C9WA 2VRJA 1T40A 3RNKB 4AZ8B 1U3ZA 3LTVA 4MMZC 5J5RA 3UZQB 1CGUA 4X4YA 3LPWA 3EJUA 2FSDA 1WF5A 3LEYL 4U4BA 4K8HA 4DLMA 3P30H 1OAZH 1JWSB 3NPZB 2VEIA 4OAWA 2K3TA 2HRPH 3ZTCC 1SSDA 3CZUB 1VBHA 4KK8D 1BKHA 2DQIH 2R1WB 3OQ8A 5IVZB 1YNTB 1LO0L 2J9YA 5CJXA 2VC2B 2Y23A 5JOEA 4AZHA 2DL9A 1VGEH 5LGJB 3MLWH 3ZKXC 1HOCA 4LSPH 2WWKT 4W93A 3IXTA 1GJWA 1A6PA 2CO6A 1RU9H 1XLIA 2WSKA 2X4RA 4MWAB 1MFNA 2JCCB 3A6CL 1IGML 2PCPA 2E7FA 3CQJA 3AQYA 3S4TA 2NUTA 1HINL 3G6JF 1ANUA 4G7YL 3QV9A 3NO3A 1Z9PA 3WUBA 4CQDA 1E4WH 3KS6A 5BOJA 1WVZA 3RX8A 4P4KD 2CZVA 2XZCH 5E1AA 4ALAH 4PRIB 3L5MA 5DJ2B 1KULA 5LAXA 5D70L 4BCYA 4URTB 4LS0A 3L3GA 3H4XA 2BMBA 1KM3A 4BF5A 1EP3A 1YUHB 1TYEB 1Z5LA 3GFXA 1J05A 3URNA 2YDRA 2L04A 3IMVA 3FCTA 1SVZA 4C4KT 4DN3H 1QI2A 3TYGH 3TW9A 2EDFA 2C3XA 4FAMA 4MB5A 2V67A 5B1CA 3C9NA 2AXJA 3FB5A 4PJCF 4C5ZA 1IT8A 3SE4A 4Q8VA 3KPRE 1OM3L 1YRRA 1VJIA 5LG6A 4PY7B 3AS2A 1NZRA 4OVVA 4IIZA 3MV7E 4N0FA 5I30H 1QLRA 1J11A 1ZIBA 5GGVH 1NTHA 4FXLA 5L2KE 4NX5A 1ED3B 3STZB 4RBPK 3K72A 5DFWH 3MUY1 4NASA 4ODWB 2XG9A 3BW9A 3CHOA 2RBLA 4BXVA 3QPZA 4F7CA 2DQDH 2VQTA 2O61A 3L7EA 3IUHA 3AT0A 5HVHC 4J5VA 2FZ3A 4P57A 4X80L 1WFJA 3K71B 4RDQF 4FZ8H 4G1EA 1IJ9A 4UTLA 1RURL 3ONCA 1WWBX 2OTPA 2Z6FA 3MS8A 3MMUA 2OR7A 4E41A 1YMMA 4N3UA 2HK0A 1US3A 5CU9A 3EYUH 4IRZH 1SMOA 5T3ZD 2NY0D 5J12B 3UZVA 3EFOA 3RVWD 4A2LA 2YX0A 2JI3A 4FXFA 1U41A 2A4ZA 1QA9B 1TQCB 2UXFA 3RLUA 1XCTA 3BGMB 3K6NA 3R5EA 3HUJE 2EH7L 5CO1A 4RXFA 3OG4B 4GAJL 3RX5A 3WJJC 2DLIA 3SUWA 3E80A 2GJRA 2CO4A 2VCOA 3VNKA 1J18A 3KOYA 4BSJA 4GY7A 2DQFB 4WWKD 3EH1A 4KNSA 2BJML 2PR4L 1H8LA 4NM8L 4IMAA 2C3GA 2N0MA 3TYFA 3UO8B 2NLJA 4HFUH 1BFOB 2DBJA 4KDTC 1G9MH 3B2UC 2IQAA 4X6CE 4JRXD 3NL5A 1CFTA 5BOPA 3E12A 3MA9H 4HPOL 3IJLA 5C3LD 5MEQB 1B4LA 4KMQA 5D33A 1SFTA 1IC1A 1GZPA 4FI6A 2BV9A 2CPUA 1KEGH 1R3LA 1Z9OA 3WU1A 2CLPA 2A5UA 4DOHB 1UCWA 1TENA 4H26B 1BF2A 4Q6IC 1A6TA 1SZNA 4M03A 3HRZC 1RZGB 1M41A 1FL3A 1M1XA 1IAKB 2V9TA 1EFXD 1TTBA 3GBMH 3BRFA 3I50L 3Q01A 3FGCA 4NO3A 1KJMA 3TWCL 2A7PA 1FCQA 1C5CH 3GIZL 2L7EA 4QCFA 4B5XA 1GZGA 4KROB 4PIBA 3O6LH 3QR3A 2J79A 4A2SA 3KPQB 1Q1JH 2R7EB 4N5UA 3FJTA 4ACTA 1JUKA 2Z28A 1J8SA 1JHKH 2DDXA 2VNCA 3G6MA 4B9YA 4TPRL 2HQAA 1ILSA 3K1KC 4KGLA 2E4FA 1XYMA 4C47A 1W1YA 4XNMB 3DDGA 5C7XL 3S3PA 5AWNH 3G9AB 3NM1A 3TN6A 2XJ7A 3RFAA 2VZUA 4MHHG 2E9WA 3UESA 3GMMA 5CC5A 3S34H 5AG9A 3WL1A 4RGNE 2R2HB 3C60B 2A77L 3WLBB 1P5UB 4IMKC 2ALWA 1QW8A 1IC7L 4JZNB 1UT2A 5TIMA 4NNPL 5HMSA 1L4IA 1G9NL 3O45B 5A16A 3DI3B 5B1JC 4EDWH 3MOBL 2WIIB 1SZEA 4GQQA 3MV8D 4IRSD 3IJ8A 5GGTH 2BSED 4N3TA 4MG4A 2C34A 3L5IA 4K7PL 2A1WH 3WF2A 2DL2A 1BFSA 2VKWA 4AZ6A 4LEOA 4P2RA 2G30A 1AP2A 1ITCA 2VITA 1MFCH 2WYZA 3F64A 1J9QA 4ORGA 1YEGH 1FGNL 5D1XD 2BLEA 3QDJA 1H15A 2CMRH 3TP4A 1J87A 3MNVA 5HNUA 4JYFA 3L2IA 2QKIA 2J1ZA 3DTXB 2DWEA 1QQDB 1HL5A 2DV6A 4D0CB 3B37A 3EPMA 4FZEH 4YN3A 1H41A 3QUYD 4LPYA 3CFNA 3G0XA 3IJQA 2GK1A 3S37H 5GS2H 2DJXA 5J11C 1BTMA 5JOFA 1F1AA 4Z7QB 5HR6A 1VPOH 3FT2B 2C9RA 2VC6A 2WLKA 3AXLB 4QHLA 1D3HA 2YQBA 4F8NA 5TDOB 5K59F 5L9DL 2FGWL 1T04A 2TPSA 4N02A 1QUMA 5C07E 2EDHA 4BELD 2PF0A 1A4CA 2NW2B 4LARL 4KIRA 5D1QC 2KYIA 4LP8A 2QGDA 2QVHA 4NX0A 3MRQB 2VM9A 1MCQA 3L4WA 3ZTJG 4U1HB 1BZ8A 2FDMA 3WNNA 4HF5H 2UWEB 3D07A 5HJ3B 4CGTA 4AHQA 5IROC 1PCXA 2WVVB 2J74A 4GP4B 1ZHLA 5J04A 4K94H 3JR2A 3WBAA 4YBQC 1Q2RA 3NN8A 3E6HB 3AIEA 3KLKA 4XV0A 4G6FD 1QNZH 2MOGA 2DQTL 2Z35B 4AZGA 1FAIH 3MCKB 3T40A 3TQ0A 5FO8B 3DRQB 5LGKA 1Q2SA 1TFHA 1JS4A 1H19A 5F1KC 5SX5K 3N1QC 2VDRL 3P8IA 4IPPA 3R43A 4YYCA 1FDJA 1PBYA 1I0BA 4NRSA 2F7PA 1GC1L 2JKRM 1IL1A 2ALAA 2H3BA 5SX4I 4JKWA 1A47A 3RNQB 1MQKL 3PWVB 2BG5A 3TYUA 3GB7A 4X61A 1ZP4A 1BF6A 3W38A 2QSQA 2BHZA 3P3SA 3VXRB 4KX9A 3BXNA 1A5AA 2F6XA 2YGNA 4UTBL 1SN0A 3CTLA 4NN7C 1CBVH 4JHAL 2Q3AA 1FJ1A 2D4DA 3WTXA 3KS0H 1CWVA 3WE1A 2LVCA 4KRPD 3WIIH 1ALDA 4NKMB 3VRJB 4UV7L 5B3JF 4WWPA 1BFTA 1KBPA 2VCAA 3GXNA 2BDNH 4XXWC 1JNJA 2JSFA 4PPTA 2WINA 3WMLA 3M5ZA 3G5EA 4YHIB 3FUEA 1PHQA 4AY8A 2XFWA 3RILA 4KETA 1W72H 4KJYA 5C6MA 2JIWA 5I8KL 1BQUA 3RB5A 1N8IA 4IPJA 4N85A 3VQ2C 1NM9A 4HJJH 2K0RA 5KSWA 4CD8A 5D2LF 1R3KB 5CSZB 3L3JA 5KYYB 5DMMA 3M17A 1NKOA 5CBEB 2Z92A 5FUOL 1ZNNA 3OJ2C 4N9CA 2BS9A 3KPMB 4ZO6A 1FWEC 1DPMA 5FCUH 3H12A 1RD6A 7PCYA 1TQXA 5J1SC 4F57H 4FJ6A 5I00A 2J8OA 3EPNA 2N59A 1CXFA 4IS6B 1XT5A 4YBHA 1SJEB 2R1XB 1XB6A 3P62A 3CHCA 3SGKA 1NLDH 1FSKC 3KPRA 3N2MA 3MO4A 4W9KC 1E5NA 5ABZA 3MV7A 1RZIA 4RRPA 3AY2A 1X5IA 3AC0A 4XO3A 1GW9A 4B7LA 4IQEA 5L2KA 4XAZA 3Q48A 1WQ5A 5GNZA 3C09C 4U5IA 3DGGB 3LI0A 4XZ9A 2NY3B 3DO7A 5F1UA 1J8HB 4NI8A 3U1SL 5FUZL 4JN8A 3PV6A 3S5LB 3DBXB 1U3HA 4N0YH 1UASA 4JYEA 2OMXB 4XODA 3GZAA 5CKAA 2NUXA 5I19H 3TNMA 4L4OA 3Q3GA 4G6JH 1EERB 3HE6B 1BZ7B 2DT3A 3R8RA 1OGTB 4N0RA 5HHMD 3LM7A 2GJLA 1I8AA 1Q63A 3B8VA 4LF3B 4JB9H 4RZKA 1PZ3A 2XFFA 2IO5A 1NWSA 5IWLC 3SCPA 4LCUB 1GG0A 1UOZA 1VA9A 5I23A 1FHNA 3GFZA 2AJZB 2PZNA 4TQHA 4UM9B 2ZXGA 3ZKNC 3H3BC 2QJMA 3C86A 1Z9MA 5HPCA 4XX6A 2XG4A 5JXAH 1GJPA 1D2OA 3DUUA 1FRBA 1B2WL 1EQWA 4F7MA 4RX4A 1OF6A 4GQRA 3B8SA 3CDZA 3WG6A 1E9OB 8PAZA 1IM9B 1CR9H 4PLJC 3KYOA 2OJZH 1HX0A 2XBZA 2Q10A 2JIXA 4JM2C 1QSFE 1JXKA 2NQ9A 5HDWA 1RLWA 3GSNB 4QHMA 5IVXF 5GGSY 1CL7H 3ESMA 4ORZC 4FQHA 3QOKA 1RQHA 4L18A 5IOPB 1N2VA 3Q4DA 3K7UA 3CL6A 2J4GA 4X6CA 3TEWA 4DT2A 2G5BB 2AJVL 2V81A 1FP5A 3MRDB 1UQYA 2CHWA 4A7UA 4MAUL 4ZDHB 4GP8B 2VDKH 2BTMA 2WO5A 3P82A 5GXBB 1QATA 4IISA 4OM0H 4O2EA 1LEKA 4GUHA 3QYMA 2FBJL 1MXGA 4N8PA 1B0RB 4P23B 3J8F7 1D5IL 5ADPH 4R96B 2INZA 2VISB 3UDWA 2X1RA 2CK0H 1PE1A 1S3TC 3GYRA 2IADB 3KL0A 1YPZB 4LH8A 1QOQA 1JZGA 2HA1A 3I9GH 4BRVA 2J72A 1U92B 4K07A 3BKMH 1UXWB 3CHEA 5A2CA 1RY8A 4JTUA 3N1FC 3IJ7A 2B39A 4XO6A 1VC4A 3QC5X 4AG4L 1GHSA 3FKKA 3LRSA 2KMWA 3ZWSA 4KQ4H 4IBUA 3BSMA 4PUDA 3NOIA 1MJUH 4PMNA 3NA9H 3TJEH 1KCZA 4JS3A 4BA0A 1XDTT 3VRLE 3IAGC 4BV1A 2PO6A 4R9OA 3T44A 2K7QA 4WY7H 3R4IA 3U0PA 4UR8A 4YDJB 4WU5A 4WKFA 3GSVA 1RH8A 2GT9A 4IQDA 2DOCA 1JJUA 3HB3C 4P2YA 1KWGA 1RUQH 4UUJA 2I1OA 1Q66A 3ATZA 5TNVA 1M05B 2PLCA 2J3SA 4CSTA 4NP9A 2OA9A 4FI7A 1GQKA 4HS8H 1WBYB 2Y6ZA 5E8DH 4YHOH 4IIHA 3MLSH 5KVFL 4MNHB 1NCUA 3MA8A 3CFQA 5TFSH 32C2B 5DUPH 1MHHB 2FD6H 5CHNB 3I2CL 2D0GA 2H0FA 2KUTA 4HHPA 4UU9B 2Z7WA 3NL2A 2GTZB 1YEDB 1QEWA 2R4SH 1U8IA 1CDUA 2XWTB 2VMEA 3EOTL 2JKXA 1KNOB 1DVFA 3NUKA 4OIFA 3HQ1A 3X1EA 1HKLH 3AISA 1SEQL 1ISZA 3P54A 4LS2A 3HTWA 4OKVB 1E70M 1IGYA 2ICEA 1IGJA 1I1CA 4NIYE 3RCYA 1C7SA 4APQC 1UZ6E 2F58H 2EXSA 3TT1H 4OZFB 5C07A 2VDOH 1WIPA 3B9DA 3VMPA 5J5EA 4WHTA 4BQBA 5F7EL 4WJ5A 1A7RH 1RV6X 3QJHA 3QWOA 1ZTXE 1SN2A 3VIGA 1I1YB 4NN5B 1GYVA 1BXNA 2E56A 5DHEA 5EU7C 2AL2B 3V1HA 1ECZA 4O51A 1KCWA 1ZK9A 2AJUL 2X87A 5I9QC 1J5CA 1G0YR 5F70A 4PFMA 3IMRA 2QUMA 3CGTA 5GS1A 1DL3A 1F41A 1CFMA 5JHDD 2D69A 1HIZA 3MJ7A 3PAUA 1JPFB 3EOAA 1BAFH 4YQXL 5DD0H 3LZ3A 4K9EH 3W6YA 3STFA 2XY1A 1WXJA 3BQ6A 4KFZC 1JAKA 1FWIC 4GEIA 4AMKH 2BGQA 3NA4A 3PL6B 4XPHL 1YTEA 3LRGA 1M3JA 3X11B 2VXVH 1F9CA 1RUKL 2EZ0C 5I1JL 4N2IA 4A67A 3MBEA 3DO4A 3G22A 1HT6A 3SZ6A 4HPYL 3CO8A 1W9BM 1ZGLA 5D1ZD 4ODHH 1G7HA 3WNMA 1W2KT 4X4XA 4F8XA 5FI8A 3KXFE 4IBSA 5F9DC 3HPLA 1EHXA 5L7XL 4ATDA 1TWDA 2ZUWA 3KPLB 4ZTXA 3E8UH 4YSPA 3WKZA 2VERA 4AZBA 4MASA 3RDKA 1LP9F 4PJAE 3C8FA 3UTTB 4MQ7A 4MJIB 3PSWA 3GTVA 1FXQA 4M7LH 2CJ3A 2AABH 1QZ1A 3FPXA 2IIJA 2KERA 4U7KA 1U8KB 2QV5A 3T3MB 4GBXD 4NAEA 2X9YA 5KSBE 4MMWA 1NGPH 2YA0A 2ZYRA 5ENLA 4Y4HD 2JQMA 2IJ0C 3RDTB 3T0XA 5K4ZA 3AG4B 2VIRA 1UA7A 4UZGA 1U1JA 1GQNA 3MRMA 3KPNA 4KC3B 3XIMA 1RVKA 3KBHE 4H9YA 2NOYA 4FIQA 5DJ0B 4F9PC 3LENA 3W87A 2VSMB 4GO9A 3RI5F 1UQSA 3MJ6A 1ETA1 4GKOA 1L9WA 3KYMA 4AH2A 1GMEA 1XTMA 2J57A 4Y9MA 5T1MB 3G0UA 3DJTA 4Q6JA 3S9YA 4QXVA 5F6IC 1JZIA 3DGCR 4JY6A 4QXIA 3N91A 2CRIA 1IEAA 1KUMA 3UF9A 4D71A 1A5FH 1KTDB 3P4OA 3VI3E 2PDBA 1V0KA 3ZJ8A 3R8BB 5T1LA 1KFJA 1XC6A 3FONB 3USBA 4YWGL 1UB6B 3PBWA 3UMNA 3K5SA 5J6SA 5IHZA 3MHUA 3SSZA 5E0KA 1IBGH 3MUAA 4GRLA 3U25A 3G08B 1KPUA 4E9LA 3EFFA 4QBXA 1S3HA 5IB5B 1K85A 1SO6A 4L4VD 1EHNA 1J12A 3GTFA 1F6PA 4EI6A 4KI5C 1E9IA 2OL3B 3VFTA 4JO3H 1Q5MA 1CI5A 3N9GL 3PF2A 4R9HA 1ISXA 3LCFA 4X5PA 1AIFA 3B7YA 4Z0BL 2CERA 4XOAA 4G59C 4M8RA 4CMHB 5DXYA 4HCFA 1UB5A 4O2FA 1WCBA 3WH8A 4JOMA 4LJ3A 4NNCA 3TBSA 2Q7YB 4UBDD 1JGUL 3ZLHA 3ESUF 2LOEA 4OU1A 1FNGB 5ICZA 4ASTA 4MZIA 1XFBA 3UJ2A 3W4RA 3QY8A 4UIMB 2CKBH 3TKFA 1W5OA 2EEFA 3HPFA 5DRIA 5D1QE 3CV2A 4KS0A 5HMEA 1USQA 5GS0L 2BY3A 3BEVA 3T6VA 2GG1A 4ZMTA 1PKQB 1PX4A 2BHFA 4LRNH 1AFSA 1UWGH 3APMA 1RCOB 3P61A 5D04C 1MDLA 4XAPA 3LPPA 3OWEA 1WXZA 3K8MA 2H9AB 2XN0A 3HAEA 1QSFA 4NQ1A 5EC2B 1C92A 4HV8B 2CPCA 3GSXA 4IDJH 1DO5A 2ZOUA 1LL7A 3QMRA 1GKQA 4M7KH 4F7PB 4G70B 2PWDA 2CHRA 3PLYA 3BXWA 3C5ZD 5LBVA 2P4AB 4C6IA 1I82A 3CQ0A 2OSLA 1BQLL 3V5HA 3SGKC 2VC2L 3E96A 4RW3A 1ZJIA 3VA8A 5D5MB 3OXRB 3F8UB 3N43F 2HWGA 4HWBH 3UZEC 4UT6H 3OKDA 3NJHA 2BSRA 3WLOA 4Z7OF 2IQDA 5EOQH 1GYMA 4LPCA 3QC6X 5C2XA 2VTFA 2IH9A 1E9PB 5BU9A 4Q14A 4HKBB 4LLWA 2R29H 2VCBA 5JW3L 4R8WL 5FA4B 3WH6A 1YDPB 4PYHA 1HJWA 2AXFB 2HDJA 3AS1A 4APXB 1JP5A 3OV6A 1P7QB 2VRQA 2O6PA 3GRWH 3LLFA 1D6VL 1OZUA 3ML8A 4GRMB 2B7PA 4AQ1C 2AMUA 3L9RA 4YS1A 3VVWA 2FB3A 2DI8A 2F7OA 4UQ3A 4XP5H 4A6YH 5IQMA 2K4WA 1KENH 3EHBD 2XSXA 1QUNA 1JIBA 1K2DB 3ALGA 2WO2B 1KCRL 3WQVA 4OQTA 1IF2A 4Y16A 1ONRA 3RJQB 1PYMA 3VSVA 3G8EA 5IF0B 4PTVA 1S7WA 3QRFM 4R7NA 5F6HJ 4N1CA 1G7PB 1EHLH 1F2XK 3FTZA 1KCUH 2DQEL 1DEDA 2HB0A 3OR6B 4Q4QA 1JF1A 2C91A 1BF8A 4Z3IA 5B7MA 1FIGH 1Q6RA 2DT0A 4RR4A 5TDNA 4PGCB 5C0JB 3UPCA 2B7QA 4X9HA 4Y9AA 4IX2A 2EEBA 1CD1B 4PP2A 3BPCA 3KP1A 2B20A 2ONEA 1WEJL 4M43H 2F18A 1G6RB 5DFVD 4D9QD 4U1GB 4NZUH 1ZJAA 3MV11 2O5ZH 2WXIA 2PRLA 5JYMA 3TJXA 3E0GA 2FYYB 2X2GA 3ZVHA 1BA9A 2GJXA 1LM8V 1WDQA 2ISWA 4Q22A 3CCHA 1MEXH 2ZC8A 1W3JA 2PYEB 4ZFFA 3GMPB 3PWAA 4XP1H 2IQ9L 4K3JH 4DGUA 4UFHA 2VUOA 1DL7H 2DTMH 1P0SE 3F2CA 5JW4M 1B3XA 3QIWB 2CJUL 2UZIL 4CU7A 2C4FT 2DPKA 2GYIA 2GTQA 3HZVB 1ZVHA 1MHPL 1T5WA 1DZ0A 2ANUA 4PJEF 4MKSA 4EN3D 1XL6A 1US0A 3D18A 1KM1A 3F00A 1A4KB 3B8YA 2W60B 4UIKL 4LIQE 3PWNA 3QQ9C 5JW4Q 3KHQA 3SPIA 4TSBH 2A85A 3T65A 2XKNA 1ASQA 2XRAL 5C9KA 1E5CA 2KI6A 3N34A 4FNUA 2YLHA 4H1LH 3ROLA 1T21A 3GJFH 3NQEA 4KWOA 1DCEA 1NPUA 5M17A 5IHRA 3UWWA 4MAZA 4PV1C 1D3GA 1OG0A 1TJ2A 1WB0A 3WJJA 4KH2A 3KPOB 4QHRA 4Q56A 3HVDA 3QDHA 3WNJA 3MO1A 2F6KA 5ESVA 1CF8H 5F2GA 1EA0A 2Z7ZA 1ORSB 5HQMA 2QAPA 1A6AB 3ZE0E 3JXAA 4F0RA 1GZQB 2VH5H 2X30A 9RUBA 3LMJH 2C7UB 3FU0A 3BDYL 3F4WA 5AZUA 4UTAL 3RAJL 5JW5A 4HH8A 4PBGA 5DRCA 5M3WA 1WV2A 5HWJA 1DJSA 1R5WA 2XPZA 1FWTA 4TYUA 4RGNC 4TOQA 4W4OC 1AS7A 1N10A 2NT1A 4WTWA 1W0VB 3KXFA 1W5MA 2JQZA 5LIWX 5JXQA 4ZMQA 4LAUA 2V2CA 3VTMA 1TR7A 4I88A 4EXBA 5ITFB 4H2CA 2O55A 4U31A 3MROA 4PJAA 1CICD 1LEGA 3EKCA 2K7PA 4Q6IA 3ZJ6A 1SVDA 2OCZA 2BNQE 3SPHA 3PDGA 2WK2A 3V6FB 5KSBA 3O1NA 2D3VA 3CSFA 2R14A 1HKFA 3TYZA 3W7GA 1IEWA 2X4QA 1EZVX 3CHQA 3CSYA 1E1EA 3CUJA 3CT7A 2I07A 2UY4A 3QEGH 4QRRE 2J55A 4ADUA 4LVOC 3BVUA 4S39A 5CLZA 5DMJB 2BCKA 4N20A 4R7XA 3PABB 3EYVA 1TCDA 5ANHA 4KJWD 4QGTA 3JTTB 4JFTA 3U6WA 4F0MA 4LAZA 5CGQA 1XSOA 3VUPA 4TMCA 5LIYX 1PSKL 5D7JC 3ABZA 5EKYA 1CXLA 5XIMA 3UZJA 2VOTA 3IE4A 3K0WA 3RUBL 5D7SH 1A6ZA 1OARH 1I1WA 3C6EA 2QKFA 5M2FX 1V6YA 1NMAH 4BE5A 3VI3A 1OCCB 3RJDA 1E0VA 5J8LA 4XHJD 2ACRA 3DETD 4RQQB 5B1JA 2WZ6A 3NZUA 5ECVA 5LHEA 3VC5A 4YAQA 3QXTA 4Z7UF 1XLJA 4OECA 3GUWA 2X1OA 4RZ6A 5C9JB 1FWDC 1AZZC 4GQGA 3MRIA 3AALA 5DI8A 4XC1L 4XIMA 4IF2A 3MUZ1 1SW3A 1FPTH 3VDAA 3JWNG 1QMLA 4CMMB 1Q45A 3WS3A 1IXPA 1Y7VA 1UC6A 2BOGX 1ADQA 5CMAB 4DB7A 3IJEB 2IOMA 5I2IA 4AQOA 3LNHA 1HFBA 3MBEC 4WUUE 4P49A 5AVTB 1FVDA 4P5KB 4KBXA 4G5AA 4PP1C 4H88L 4WW1A 4HIJB 3WKML 3UOAB 5MENB 4OLZH 3SCMC 4NLAA 4C1NB 5EO1B 5C97A 4PRBB 1FZKA 3QDGB 4XMLH 3U5YA 4NI6A 2F84A 4OLWL 4GI8A 3AB0C 4LSQL 2JE8A 3LQZA 4LLMA 2DUAA 4A39A 4GJJA 2HK1A 1JGIA 4UTIA 4NNYA 4PG2C 1DQQB 5D1QA 3QTPA 2X42A 2FR4A 4XX5A 2UY3A 4KTDH 4L1LA 4IMLA 4PJ5B 2YCJA 3PPHA 3EJYC 4GOSA 1EJVC 4LBEA 4I1RA 5EU7E 4LL1A 1E6ZA 1D7DA 4WCJA 1H49A 2DZSA 5IREA 5HDLA 4HKXB 1ZFJA 4DTGL 5E5MB 3NBNA 3GQFA 4ZMNA 3M1ZA 3CMOL 3VXNB 4ZPVB 1LBFA 4KEZA 1I7RB 1JR1A 3ZT5A 3NEXA 1Q0EA 5AVZB 1A7QH 1MFEL 3P9LB 4Q89A 2XXFA 2IH3A 3OEXA 1OCWH 3BQUB 3QF0A 1AQKH 1V0MA 3MSDA 3BLPX 3QGAC 5CP3H 3ZDXF 1E42A 1AMKA 1RJZB 3WLJA 1BFVL 1FWHC 3PHQB 3RHWF 1A8JH 4Y4FD 5AAMA 4AE0A 4DP2X 1MW1A 5EZJA 1JYWA 2E28A 2Y69B 1OP5H 1SY6H 3C5JA 2ADGA 3EB3A 1UZDA 3DLQR 4HIEB 3WFEH 3ZYJA 1P0KA 4FX6M 3FEQA 4B3VA 3H2FA 1C16A 1N2RB 3HJZA 3KCLA 4L3AA 4ECNA 5CEZL 4AISA 3CDGA 1WKYA 2X40A 3TF7C 1DO6A 4XXWA 3ABXA 2HCVA 3CHSA 3VD1A 1I1XA 2WWMD 2A3CA 4AD5A 3BMVA 1IGIL 1A6UL 2V69A 2JJWA 4Z2GA 3UIZA 4J4PA 3UBXB 3LUTA 5ABEA 1A22B 4GS7B 4C6EA 3NFUA 4DHGA 3NJNA 2NZ9D 1IAIH 3W0WB 3ZTNL 4P7OA 4BQ4A 5EA0H 3OKLB 2W80C 1NM4A 1SJVA 3MJ9L 1JBJA 2A6NA 2XA3A 2X38A 1G94A 2ZXDA 3P0VH 3QUZC 3WAKA 4PUMA 3W1QA 2NW3A 4ZA0A 2EGZA 3MDWA 1DBJL 1YNLL 4MSWB 5BRZE 1GYAA 2H26B 2I9TB 3LQGA 5AHFA 5FKPA 5F9OH 2F54E 1FHVA 5F3BA 3CHFA 5T1DL 4M1RA 1W91A 3BAEH 4QJ1A 5T3ZH 2BX7A 4LOUC 2EIZB 4XVTH 2VXSH 1GW1A 4FFYH 3CQHA 2HBVA 1FZOB 2CWXA 4XSMA 4X5XA 1DXEA 5EPDA 1ZLWK 2HV5A 1ZT1B 4O14A 2J7FA 5JQIB 4WNQA 5KYNA 1J5IA 3NCOA 3B4UA 4S1QL 3BSZH 4GCXA 3GH5A 2Z8SA 1HCFX 4PTNA 3K0YA 3E1ZA 3DARA 5A3ID 4UQ2A 4KI5E 3M0VA 1LL4A 3NCYS 3AYTA 4MNLA 2R1PA 4AI7A 5I6NA 1TEYA 1I60A 4J3XA 1OGPA 4P07A 2F6UA 5FFLA 3V6ZB 4NKDA 5EUOE 2XGBA 4DAGL 3BV7A 1B3ZA 4AZCB 3F05A 2C3HA 3PZTA 1SHXA 2VL5B 1JYVA 4HSHA 5FM5O 1G7LB 3CXFA 1YPIA 3WL9B 3HJ0A 2MQGA 4B27A 1PAZA 2AF2A 3CPRA 5IWLA 4OT1H 1THAA 1AH0A 4CC0A 1TSHA 1WD9A 3Q2LA 1T6WA 2ZUQB 5KW9L 2GY5A 3RPIA 4JO5A 1E4KA 4A2EA 3G77A 3FBKA 3KS0J 4X8JA 2EE6A 1G7UA 4B7IA 3BO8A 5JPNB 4HK6A 5JBDA 1TJ1A 4AIOA 1ZSXA 4U6XB 4Z2LA 3OGCA 4UAOC 1PWMA 4JDVA 1ZAIA 2AC0A 3K91A 1FL6B 4O0QA 5D96C 3UABA 4M6NH 3DV4B 5A95A 4JM2A 2NXYB 4Y16C 3GSNL 4WI0B 2V5LA 2CO3A 3DFTA 3OGVA 1HKVA 4Y5VB 3W81A 4JDTL 3RO6A 2GUUA 2OT0A 2FJHB 4PJ7F 5IVNA 3FB8B 3KG5A 4P3DA 4LMQE 1AJ2A 3EFDL 1OAYH 1KXVC 4HCHA 3U8GA 3S4SB 5AW8B 5DTFB 4MDIA 4RMBA 2GWNA 4YHZH 3LSOA 4HCRH 1HHHB 1B4EA 2SEBA 2ZUUA 4NU7A 4YPGB 2Y88A 5AB2A 2ADIB 4ZS7H 2OMTB 2DKSA 3B8DA 2QV2A 1M57B 2VGLM 2X0SA 4JQIA 3WDPP 3MV01 2ICES 3WQ6A 4G9DB 2BNQA 2KHAA 2HFFB 2EADA 1EAPB 4YXHH 3QQ4A 1TELA 4MCYA 4WKAA 1V77A 2UVFA 3TWAA 2DZUA 3GGWA 4QRRA 3IFPB 2OZ0A 2GGGA 1F4YL 5FYJD 2H41A 3EA1A 1WKDA 3MMEA 3KH3A 5K2ZA 3HC3H 3TWBA 4HQQL 4GXFA 3MMWA 3IUIA 1A14L 4GG6E 2ODIA 4HWZB 1A3RH 3HPZA 1Z3GH 4TUOB 3ANVA 2ZRXA 1XCXA 4U1NA 3EDJA 2YPLD 4Y19D 3FSOA 5F0PB 5AVYB 3OAZH 2VN4A 1ACYH 2CLLA 5LBSL 3OZMA 3BLKA 1CL7I 1S9WB 2PXYD 4P46C 1BRLB 1H7RA 1EX0A 3WLPA 4MWFA 1S1RA 3H54A 1OYCA 1RQBA 2O6DA 4WFHE 1HO1A 3UZYA 2B0MA 1JN6B 1R3SA 2CR6A 2ESVB 2V8ZA 4O12A 1E6SM 1F3DH 3NL6A 2ZPKH 1LEIB 2QFRA 3P8JA 1X7SA 4OM1L 1DUYA 1TX0A 4XP9H 1R5IB 4TNVK 2V6HA 2Y36L 3F5LA 3QIUD 1MH5B 2HT3C 5E4EC 3HC0B 4G8IA 1S3RA 1AKJB 4MMXC 3UJTL 3I3BA 2XWJA 1QFWI 1E5UI 3GNXA 3B9AA 1XIHA 3ILDA 4I90A 4P48A 3A4DA 4R4ND 1OHLA 5FOOA 3UC2A 3BCFA 1GVSA 4M8VA 1E6OH 4WUUA 3FT1A 3SKNB 4YL4A 1WTLA 4FQXB 2WQVA 2XPYA 4GH3A 3NOEA 1HH9A 4HU3A 4AGOA 2GITB 4HH9A 2YD8A 2B5IB 3CVHH 5AHEA 4QO1A 3UNTA 4HPJA 4TQ8A 4MTVA 4APQA 5A8QA 1KIQB 3K5RA 2OP4L 1LBMA 1KN2H 5FO2A 3VWJC 2IFFL 3KDNA 2OMBA 1JZ6A 4JKNA 4UDUB 3C8KA 2H3NB 4F58H 4NDMB 4UTFA 4AVIA 2A6JB 2GWGA 5B7ZA 5CD5C 4RA0C 4ZFCA 1XBYA 2PZ0A 1K4CA 1ITBB 2QBWA 2IKJA 1X5YA 4UDTB 3RLHA 2A6IA 3AXMA 3MODL 4W85A 3N0AA 4B95C 1OGGA 2Q9OA 1CEOA 4NI3A 1G7JA 1FWCC 2PUZA 3O8XC 3OZKA 4V1XA 5F21B 2R0LL 3R1ZA 3QLLA 5FYKD 4JTTA 4ATLA 2I7OA 1YN6B 2P9RA 1NCDL 3Q1SH 4HUCA 1DJYA 1AJ7L 4KOCA 4OLVL 5CBIA 5ICUA 5CCKL 1DWIM 5DZJA 4GLEA 2J1YA 4G42B 1F13A 1OSZA 2R9HD 3HIJA 1LM1A 2CLIA 3FDKA 2PP1A 3LN4A 2UX7A 4OUEA 1TV4A 1JGMA 2V5KA 1QNQA 3PXLA 2ERJC 5IBLD 3P60A 1JFQH 1A5CA 4LPVA 1NSJA 3QI9D 2PPDA 4Z8FL 3LXUX 1EP2A 1N3NB 3LIUA 5F1VA 1FCCA 3HPSA 3OAYK 3PGFH 2FL5A 3TMQA 1P5VB 3RR4A 4IWWA 4J2QA 3HFMH 1UKTA 3RJXA 3MV9D 3LKQB 4UTUA 1TWWA 2NXIA 4Y9OA 3CHDA 1CWYA 2B0SL 3K1DA 2MQ0A 2Y8KA 3LRLA 1AR1C 1SQ7A 3QJAA 3T4AB 2E6QA 4M9PA 2AQRA 4KIEA 3QQDA 4TQEH 1OCNA 3ARGA 3DCPA 4TX6A 3C3NA 2YQ2A 3QO1B 3CV6A 4H7VA 5FPIA 3HMCA 2DQMA 4JO8A 1C91A 3GHTA 1C5DA 4RISH 1IILE 1K6AA 1F07A 3SBQA 3CB8A 2VXQA 2DJ4A 2X6CA 1CMOA 4E2OA 1XGQA 4PJFE 2LU5A 4XN1A 3TBVB 3BLDA 2EKSA 3QHFL 1B6DA 4QSHA 4A2GA 4NZDA 3ALPA 4RNRA 3POHA 5C3IA 3M1CA 3UYPA 1RIVH 4F9PA 5BOEA 2C9AA 2KZWA 5GZND 1VBUA 1YBQA 2G0LA 2RCSL 4IGBB 3C75A 1JDCA 3SJVB 1K7FA 2V33A 1EGJH 1TQJA 1W1B1 2R4RH 2WHJA 1Q94A 5BRZA 1D9KA 3FN0H 5CGYD 2F54A 2BC4A 3E8VA 3WJYA 4GKSB 5AENA 4GWEA 2EECA 1R9YA 3V0TA 4WGVB 5E8PA 1KFEA 3UVAA 5A2IH 1EMTL 3GO1L 3IF1A 2VZSA 3BARA 2G2NA 4D1IA 1P69B 2JF6A 4K9JA 1HCZA 3QH2A 3G7TA 1ZLUH 2WANA 5C09E 3JWDH 2IV9A 5DT1L 5IKCB 3M1OA 1BWMA 2GUOA 3SSGA 1N67A 2VDMH 1SDYA 1FNSH 1JNLH 4I8DA 1M9WA 3UXKA 1QBLH 1EJTC 1N6UA 4KMTL 3PZOA 2XWEA 5DANA 5FC9A 3L81A 1PKNA 5I0ZA 1BWVA 2F53B 2OL3L 2GBVA 4JBSA 3AUVA 1HQ4B 3B2PA 7ENLA 4ICMA 3WF1A 3TSBA 1I8KB 2MPVA 5EZLA 5FW8A 5G2IA 5CZVH 1TYGA 1JNNL 2K6ZA 1EBHA 4LEEA 3Q6FB 4QRAA 5EUOA 2HMCA 2HT4C 1H3UA 5ECUA 1FQ0A 2GOUA 5FDWB 4OJFH 4HSNA 3SDOA 5AAMC 1IKFL 4FI8A 1DEEA 1OAKH 4J6RL 3LHPL 5MF5A 3QY6A 3AREA 2M26A 1TZ8A 4CNIA 1PO9A 1VR6A 3QORD 2RHGA 4EP8C 5C2BH 4D6JA 4CSPA 5KZDA 1NCNA 1FA4A 4YLQT 3WCZA 1KRMA 3DV6A 4AQLA 4YLBA 3VI4B 2KQNA 4J1UB 4ELME 2HXTA 5CJQL 4XGZB 1DWJM 1HW6A 2VXNA 3DKJA 2NX9A 3V4PH 3RGBA 1F2QA 4HMEA 1PLBA 4JFOB 4W9FC 3QO0B 2ZA1A 4TR9A 1LWIA 5LGXA 4ZQTA 1UWUA 5IW6A 1EAJA 2UY6B 3WFCL 4JEGB 4XAWH 3VFCA 2KZKA 2VENA 5DK2A 2HZHA 2GQ8A 2DIEA 2IAMB 3WD3A 3GHBH 4J4PC 1FVEA 1TJIH 1RH9A 4NO0A 4C6OA 4Q6YA 1CGWA 1GG1A 3C2VA 2VJ0A 4X99A 1JPTL 2CFFA 1NCIA 3T0EC 4EQ2A 4NZ8A 4I2XB 4K5NA 1MFAH 1QSEB 4A8NA 3BPNC 4AIEA 3TCEA 4ICCX 1HL9A 2JKJA 3X12B 3V4LA 4OIAA 1QP1A 4P8QA 3LXCA 3MLXH 4NJHA 3GMRB 3GD6A 3N6HA 4JFFD 4BFOA 1PU0A 3UZEA 5JNYA 5BZXA 3VOJA 1SF5A 5C0AD 3D2UA 1S7QA 4AY0A 1E40A 3D3FA 1ACXA 4DEPC 1TZGL 3CLWA 1NEPA 5DHYB 4JFHD 1XF4A 1UG9A 2GEEA 3V7MA 4QG8A 4PGLA 4BZ2H 3HFFA 3TN0B 4Z95H 5IJDC 1F6AB 3H1ZA 4FF9A 5KANG 4AQ1A 1ESWA 1JYXA 4OFPA 1Y1DA 3STCA 4NO5A 2B3IA 5DLMH 3ZZLA 1XLAA 3KDOA 2QXWA 4GG6A 3TJPA 3FCBA 3N9RA 3BRDA 4PRAA 2YPKB 1S2AA 4LUTA 1W72B 2AOSA 3B5HA 4DPPA 1FH9A 1MUMA 1CO1A 2REQA 3B7UX 4X9GA 4JGMA 4QM1A 2Z64C 1K8CA 3PZIA 1QWNA 2QVKA 4U05A 1J9YA 3WIHA 3WLWD 1S9XB 1UXMA 2QQKH 1Z89A 1X1ZA 3Q13A 1G6RL 2QF8A 1E4KC 4QXUH 1VPXA 4UOZA 1XKJA 1YEYA 3GG7A 4NKIH 3ZL4H 1FWGC 4K8RD 5D6DC 3BZGA 1ZV2A 1WK0A 3A9IA 4YMZA 1RJQA 3W71A 3GM8A 2IQTA 3WHXB 2BPBA 2N7AA 1CT8B 4KI1A 2OLSA 3L0NA 3N44F 3T0VA 5H2BA 1J4EA 2NUPA 5H35A 1GOXA 3SBFA 3BMWA 2AJYH 3NQ2A 3EGSA 2WSRA 3RXZA 3NCJH 5EB9A 3F84A 1GZ1A 5B39A 2XIJA 3ILPA 3W72A 4XQ6A 4GUIA 1KBVA 2IWGA 1Z0MA 3UZXA 1HCVA 1TV3A 2HNEA 3C2SA 3D5HA 4K23H 3HC4L 4DBDA 1YEKL 3CFBA 5C54A 1BLNA 2EAWA 5I6XB 2V5YA 3DMMD 4NFCA 5DUJA 1RI8A 2DSKA 1H6UA 3Q05A 3MRNB 3NSYA 3A3XA 4Z08A 1QKZL 5EN3A 4R4BA 1QFWH 4KO5A 4ZFQA 4A66A 1Z48A 4D9RE 5FCSH 2CO2A 5FEXA 2OJPA 2YAMA 3VWKD 1D7CA 4WO4D 5J1AB 4I5BA 3CPUA 3KJ6L 4IBQA 1HGWA 4HG4K 4L4MA 3GG8A 2EYRA 4AY7A 1HJSA 4NN6C 4PJIE 1AD9B 2UVEA 3DOSB 3GUGA 4MA7L 3X2QB 5LNUA 2DBLH 3OKEB 4K38A 5FF2A 1Q7QA 3OLDA 3W11D 3GIVA 3PNWB 4UQAA 3QJOA 4XMPL 1NDMA 4JFDB 4M7ZB 4O4WA 4JY4B 4JN2A 3B7TA 5TDPA 2GL5A 4LHJB 3SR7A 4MLJA 3HUJF 4WXYA 4R2GB 4W4OA 1MAKA 4GUQA 4LOEA 1ASPA 1A4MA 3SDDD 3INUL 4XBPB 2XQBH 4ODVL 3D46A 4PJXB 5EO0B 2D7OA 4LSUL 2NX5E 3JWOC 1DJXA 3G5YA 2YPVA 1MHCA 2FTWA 4IMCA 5CBAB 1FL5A 1S5IH 4MFDA 4F48A 4P3CL 4PSPA 2EEXA 3ZJKA 2W3ZA 5GSRA 4NBXB 1S7UB 2XUWA 2ZONA 3Q8BA 5D7EA 1FYTD 4NP4H 1TMCB 1U83A 1XRVA 5FX3A 5I5IA 1OE1A 6A3HA 3MFFB 3UJRA 2VR9A 4YL2A 4M6OL 4XCCH 4X6CF 1MDAA 3HLKA 4D8PA 2WTRB 4L3ED 1AQMA 3O6FB 4DGIH 4BH8B 2LFEA 4PJFA 4FHJA 3GSRA 4XOBA 1F6KA 4PJDB 3ZQWA 4YR6B 1JD7A 3NQIA 5AVVB 1ZLDA 2C1OA 4H00A 1SOKA 1O5DT 1FFOA 2JB6B 1XH3A 3IJHA 1JCLA 1G0CA 3T2NL 5EBAA 1TZ9A 4I48B 4CVWA 1EEUA 4OZ4B 5D7JA 4NP7A 1M7JA 1RJLA 1FV1B 5KSAD 1E90A 3WTVA 4ICNA 1H5BC