1EQPA

Exo-b-(1,3)-glucanase from candida albicans
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAASRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-B-(1,3)-GLUCANASE
publication title Minor structural consequences of alternative CUG codon usage (Ser for Leu) in Candida albicans exoglucanase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 153
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2000-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eqpA00
3VGEA 1WDQA 4M82A 1X6NA 9CGTA 3UERA 3EYPA 4LYPA 3MO4A 4UFHA 2Z1KA 5AC5A 2F8QA 3GBDA 2WW5A 1C7TA 3FAWA 3CTTA 1OGSA 1BFNA 2CETA 2ZUMA 4AEEA 4D6FA 1FH7A 1HKKA 3NDYA 1TCMA 2DT2A 2EBNA 3EMCA 1E0VA 1V3IA 2ZICA 2ZUNA 4AISA 2VZVA 1Q6GA 2JIEA 3M46A 3VDHA 4W7WA 3ZT5A 1HKMA 1LG2A 5DF0A 1FOBA 1WB0A 4ZEPA 4HOXA 5E6YA 4MB4A 4X0NA 3AMLA 2QPSA 1TR1A 3AFBA 1KWKA 3WD4A 2X1IA 3BMVA 4UZSA 3SUUA 2V38A 3WQ6A 1MXDA 1GJWA 4HOZA 4D6CA 1GHRA 2OWWA 3W4RA 3VD3A 1KR0A 4XX6A 5A3HA 1VRXA 2O92A 3CZKA 3W29A 5A8PA 2Y5EA 3OA5A 4DUWA 1NWSA 4YN5A 4GIAA 3SURA 1A3HA 4E8CA 1DWJM 3QHNA 4U5IA 1UA3A 3UG3A 4WLCA 5BXPA 3VX0A 1H4PA 4UQEA 1MQRA 2BVDA 4HMEA 2E8ZA 1W3KA 2WMHA 3PZGA 1E6SM 1LL6A 4W5UA 5IXEA 4UQAA 2VX4A 1W32A 2BY3A 1V0MA 5CQ1A 2FDMA 2WVVB 3WFLA 2X09A 2XVGA 2X2YA 1GHSA 4W89A 1LWJA 4CU8A 5CZKA 4IPLA 4JFTA 1H0IA 3PN8A 4D71A 4P8VA 1JAKA 4W7VA 1QVBA 5CG0A 1F4HA 1FFQA 4ATLA 3UCQA 4BQ4A 2YBUA 2D20A 1KXTA 3TA9A 2WVUA 2FHBA 4ACYA 1J0JA 2EJ1A 4IPNB 5EB8A 2CKSA 2ZX5A 5A6LA 2NT0A 3OB8A 1B30A 1BGGA 1E6PA 3OLIA 4J3SA 2PWDA 5BXTA 2GVYA 1CZ1A 2WZEA 4W8LA 2DSVA 3ARQA 1V6UA 4W88A 2VO5A 1QI5A 5ABEA 1XH0A 1TE1A 3VMNA 2J7HA 2GDVA 1HXJA 1B90A 1TZ7A 2J74A 1PX4A 2GUYA 3CBWA 2YBTA 3CZLA 1JDDA 3TTQA 4MNMA 4AEFA 1GOOA 1KQYA 1G0CA 4J27A 5JBDA 2UY5A 2XGIA 3FNDA 5BRQA 1L0PA 1C8XA 1HJQA 2A3BA 3CUHA 1E9LA 1YHTA 2WC4A 4HTYA 3B9EA 1MW3A 1TVNA 1PZ2A 2ZXDA 2DEPA 4JKKA 4W8BA 2ZWYA 5DO8A 4CUCA 1BF2A 5M3WA 1WZKA 2GDUA 2CBUA 2OSYA 3SUVA 2GFTA 2TAAA 1UD4A 2BFGA 1US2A 4AD1A 2BS9A 3EDJA 1RP8A 4LYQA 1QHOA 4P8WA 1CGXA 3VM7A 2PB1A 3GXDA 4OIFA 2PI6A 3AIVA 2QLYA 3JUGA 1KGWA 5JBFA 2WWCA 5EFFA 3M07A 3RM4A 3WH9A 4CCEA 5I3DA 1G5AA 3WELA 3SCOA 2ZX6A 4BCEA 3MUIA 4QCEA 1J0ZA 1HF6A 1ZJAA 4GXPA 1GOIA 1QPKA 2WBKA 3BSHA 4GINA 1BGAA 4WIWA 3NJ3A 3GBEA 4AD5A 1H2JA 3N1AA 2VT0A 3IJ9A 4AMCA 3W26A 5FCZA 1V0KA 2OSWA 5FL1A 4W7UA 3PTKA 3VTRA 1QI2A 2X05A 2VQUA 1PX8A 1Q6EA 3EDFA 3CHEA 5I0DA 7A3HA 3W37A 2E4TA 3NSXA 5I6SA 1HJSA 1TA3A 1QNSA 3AS0A 2AMGA 1JD9A 3W24A 1HN1A 2ZX9A 3WF2A 4Z2LA 2WVVA 3SCNA 3SIMA 3ARZA 5ABHA 2VX7A 3WBAA 4CVWA 5AYIA 3WD3A 4D6HA 2J7FA 1E55A 2O9TA 1E1EA 2EPMX 2OLHA 1IZJA 1E5NA 3AIUA 4V27A 3VOCA 1XSIA 2WMIB 4UZUA 2XGBA 5BYWA 1XCWA 1NOFA 3WUEA 2XYLA 1CGYA 3AHVA 1UR1A 4CD4A 1QBBA 3GH7A 2GK1B 3RMEA 2FHCA 3WEMA 5I77A 3OBAA 2OYMA 2G8ZA 4PMXA 1EDTA 4BQ2A 1W2VA 4EK7A 4MTVA 2WXDM 4IM4A 1E5JA 1VEPA 4AWEA 4AIOA 1VFFA 1PPIA 4RE4A 3OLGA 4MDPA 1KWGA 3UESA 5GNZA 4PMUA 1BQCA 4HPGA 1US3A 2VZUA 2YL9A 3AXIA 3WNNA 1HJWA 4CVUA 4DUXA 1ZBWA 4GI8A 2WHJA 1CENA 1GQKA 3MKKA 1EIBA 4M80A 3QHMA 4FLRA 3G6MA 1MW2A 1ITCA 1LF1A 1CBGA 2ZXAA 3A4XA 4P7OA 2BHYA 2CPUA 3LPGA 3AJ7A 4EE9A 3PZNA 4HU0A 4JCMA 1X1NA 3ARXA 4J3VA 1GOQA 3U7BA 4UFKA 2V3EA 2YLAA 5FKYA 5HBFA 1BTCA 3T08A 3B9DA 1DTUA 2CIPA 2W91A 5BWFA 5CGMA 3AMKA 4D6GA 1E72M 4B3KA 1QNOA 1PEZA 4PTXA 1CGWA 2DSKA 2Y4SA 1V3JA 3KEHA 3RJXA 4CD7A 1K9EA 4R5EA 3PTMA 2BV9A 3K8MA 4GQQA 1UD2A 4UQDA 4W93A 3CHCA 4UTFA 3WQVA 4U5KA 4AZIA 1ISYA 1XC6A 4GPNA 3VMPA 1C90A 1OB0A 2J47A 2Y8KA 1V03A 2ZXBA 2O9PA 1KGXA 2JE8A 3GH5A 4AD4A 5D9MA 1DP0A 4MAZA 3T2QA 4B9YA 4BF7A 1W9UA 2FGLA 3ECQA 1E43A 3WF3A 5BCAA 5ABGA 4ACZB 4MNKA 1V02A 3AI0A 1UYQA 2JFEX 3S6TA 3VD4A 3L4VA 3T0AA 4TTUA 2E9LA 6TAAA 2JIWA 5EBAA 3CUGA 4M29A 1UD5A 1BVNP 1CTNA 4Z2GA 3CPUA 4XUYA 1VFOA 1F4AA 4F79A 3WDJA 1AQHA 3POHA 3N13A 4P7RA 3WH6A 5LA2A 5FL0A 5GPRA 5I24A 2WMIA 5BRPA 4Y7EA 1FH8A 1JFXA 1KBKA 4PTWA 1GPFA 3AQUA 1JNEA 2GK1A 1M01A 2D2OA 3WNMA 1H0GA 4FLSA 4HMDA 4GKLA 3RM8A 3OGVA 4UNIA 1UR8A 3KL0A 1UUQA 3T0BA 2W5FA 3W81A 4PMQA 1OD8A 4BS0A 3N9KA 4YPJA 1U30A 2WSPA 3WENA 1MW1A 3BAIA 4AD2A 1V6WA 1V3LA 3SUWA 1R8LA 3PBGA 4MB5A 4F66A 4UQ9A 1W3JA 4FK9A 1V3HA 3TP4A 1HJUA 1JL8A 1M53A 1PIFA 1WAWA 1OT1A 3CLWA 3L4YA 4KRTA 1D2KA 1E6QM 1JYXA 3AS3A 1LQ0A 4BQ3A 1E1FA 1W1TA 1O6IA 1UR0A 1WZMA 2YL5A 3BAJA 2D0HA 4AIEA 1HP5A 3VUPA 3WF1A 4MB3A 5DMYA 3NIYA 4Z2HA 1J9YA 1W9BM 3CZJA 1E0WA 3G6LA 3GNPA 2CBVA 1MWOA 2X0YA 2DQXA 1RD6A 4H8VA 1KQZA 1OGBA 2XPKA 4HA4A 1V3MA 3ZM8A 5CSYA 1H41A 1GUVA 1W9DM 3O6AA 3AYRA 1PJ9A 4M1RA 2J77A 2CCRA 2CESA 4DWSD 3BLKA 2XVLA 4GQRA 1HVXA 4TUFA 3IANA 2XWDA 1JZ6A 1G01A 3OIHA 1MW0A 4JFUA 3EMZA 1UKPA 2WBGA 1EH9A 1MFUA 1J0IA 4S3JA 4N42A 3FW6A 3K4AA 3I3BA 3WH5A 1E3XA 3L4TA 2YL6A 3GXIA 3SCUA 3GM8A 4QLLA 1VF8A 4UOJA 1ECEA 4WSKA 1OSEA 1E70M 2WZHA 5A8QA 5E09A 4C7DA 3TTSA 6CGTA 2VZOA 1B3WA 2WC3A 1CXFA 5E0CA 2VMFA 1BHGA 4PTVA 1KXHA 2DT1A 2UY3A 2UY2A 3FY1A 4OZOA 4DWSB 4AW7A 5E0FA 4ACZA 2BNJA 1EDGA 1AQ0A 3B9AA 4JKMA 4AYSA 1E56A 1XSKA 3WH7A 2VRKA 3KL5A 3AXXA 1GOWA 3CHDA 3VIIA 3KZSA 4N0RA 1WDSA 3IAPA 3BLPX 1EHAA 3UEQA 3VM5A 1XV8A 3DECA 5IHSA 2C8NA 1HKJA 4LX4A 1SMDA 1HX0A 5HDRA 2JALA 3PZ9A 5IFPA 3ARRA 1MQPA 1EOKA 1UWRA 1VIWA 4OKDA 1WDRA 1JXJA 3W6LA 4UQBA 4L4OA 4QLJA 4AXNA 4XV0A 4B15A 4ATDA 2MANA 1BPLB 1CLVA 1CYGA 5HPCA 2WHMA 1KBBA 1KCKA 1G94A 2EPNA 1MYRA 1GQLA 1TVPA 2J8GA 3FXYA 1R7AA 4TVDA 2D3LA 3A4WA 4EKJA 3WMBA 2Y8VA 3VNZA 4A4AA 1JYWA 2CXGA 5M03A 1JDAA 4JKLA 1OD0A 1WE5A 4P7QA 3ZR6A 3K1DA 4IUGA 3WL0A 4GO8A 2WANA 3PZMA 3WNPA 4J7RA 2B31A 4PSRA 4UFMA 3THCA 1M04A 1E6ZA 3AISA 4E4PA 2J79A 1Q6CA 5I23A 3NDZA 4M8UA 1TUXA 1UWUA 4JHZA 2J62A 2RGMA 2ZUSA 3CH9A 1I1XA 2VL4A 4P7LA 5A6KA 4ZXLA 1TFVA 1C8YA 1R86A 3DC0A 4AZ6A 1K9DA 3TTOA 4HZ8A 2WHKA 2DSZA 4PMRA 3VIMA 1DWGM 5A6MA 4URIA 5C8BB 5HOSA 1G1YA 3ZIZA 3AMDA 2VZTA 1RPKA 1B3ZA 1ZJBA 2J78A 3ZSTA 1CGTA 3WD0A 2XFFA 1FHDA 4GZEA 2VVSA 5AYBA 1GVYA 3F4VA 2JEPA 1CWYA 4UCFA 4PMYA 4F9JA 4GI9A 2IXUA 3ZT7A 1KCLA 1EO7A 3SCWA 1KGUA 3GNRA 1BYDA 2X0HA 1GNXA 1Y7VA 3VIOA 4F9DA 2ZUTA 1C3FA 4HP5A 1VBUA 1J11A 1E73M 4UQCA 1QHPA 1XD1A 4UR9A 2HVMA 2VC9A 1H11A 5LA0A 3GDBA 4CN6A 3EDDA 1JIBA 4DWSA 3W0KA 1C91A 3T2OA 2WCSA 3AIRA 1B9ZA 1D7FA 2XM2A 3AHYA 4M81A 3THDA 3WSUA 1J12A 1JG9A 3EDKA 4NRRA 3IJ7A 3RILA 5LA1A 3WNLA 1V0NA 4MDOA 1U2YA 2G3NA 1EQPA 3W6MA 2IXVA 3OZOA 2XFRA 2WAGA 5D9PA 1G9HA 3VIKA 1J18A 1EA9C 4J3XA 1H3GA 2D24A 4PTMA 3K46A 4CCCA 4CD5A 5M17A 2XVPA 2XUCA 4AZCB 2WCAA 3RJYA 1UH3A 4OOZA 3L4WA 1VB9A 3VVGA 3ARUA 2A3HA 4PSPA 3UETA 5CGTA 2YDQA 4JHOA 3MV01 3IAQA 4TX8A 2GJXB 3VKKA 3AZSA 3AIWA 2RGLA 3MUAA 5A95A 2YDSA 2ZUUA 4WKHA 1CGVA 1V02E 2CKRA 2VX6A 3WDRA 5E6ZA 2A3CA 2WCGA 3AS2A 3VDAA 4W8AA 4FF5A 4OBRA 2V5DA 4CN1A 5HPOA 3WUFA 2CBIA 4U3CA 1Q6FA 3WIJA 5HNNA 2QMJA 5D9NA 3UG5A 4ZE4A 4A3YA 2BXYA 4GZIA 1NM9A 3W82A 1UG6A 3AHZA 1Q6DA 2VVNA 4AD3A 3PZIA 3ZQ9A 3TONA 4AZBA 1CLXA 1AMYA 1M03A 2BXZA 5DFAA 2BVYA 3OLEA 4ML4A 4TTGA 2W67A 3VIJA 2F2HA 2PWFA 1UZ1A 5CPTA 2D0FA 4JAWA 2XG9A 2DT0A 4U2ZA 1LG1A 3OGRA 1XRVA 3AHTA 4H7VA 5EMYA 3VGBA 4J3WA 4ZE5A 3VGFA 1GVIA 2E3ZA 2C0HA 3LPFA 3WUGA 5LYRA 3A47A 3QHOA 8CGTA 2VTFA 4HZ6A 3ALFA 3CUIA 2OWCA 4AZHA 2YOCA 2EEXA 3AZTA 3BXWA 2AAAA 4LPCA 3ZOAA 1JFHA 2Y24A 2Z1SA 3L4ZA 1CXEA 1UKSA 2GJRA 2WB5A 2YL8A 3QOKA 4W5ZA 3WEOA 4LYRA 4QFUA 1DWAM 3WN6A 3N04A 2QHAA 4HU8A 2Q8XA 2ZOXA 2FH6A 3W53A 3VNYA 3O2LA 2V5CA 1WZLA 3VX1A 3CZEA 1UKOA 3SCSA 5IDIA 2FHFA 3LPPA 4PBGA 2E40A 3ZO9A 3VDBA 4P7NA 3AYSA 1BAGA 4RL3A 3RO8A 1UWSA 1M7XA 4Q22A 2VI0A 1B31A 1QI4A 3MSGA 1JXKA 3K4DA 5D4YA 1IV8A 2CERA 3D3AA 3RPMA 3HMCA 4DM1A 1K9FA 4XZBA 4PN2A 3FAXA 3BC9A 2YA2A 2D1ZA 1W91A 1W3HA 3RM9A 1XYFA 5A6SA 1GCYA 5E70A 2VOTA 3WF4A 5C70A 4FMVA 3L2LA 5F7UA 1EQCA 2J7GA 4GI6A 4J3UA 5FIPA 3WNKA 4AZCA 3I3DA 5JIWA 4RE2A 3BAYA 1X6LA 1XSJA 3SCRA 1NWUA 3ARYA 2GJXA 4KMQA 5A6BD 1V6XA 2HISA 1BYBA 1OIFA 5I2UA 4V28A 4MNLA 1CIUA 1TMQA 1OWQA 1UQYA 2YIHA 2CBJA 3ZJKA 5A8OA 3ZJ8A 1XH2A 2YA0A 3L2MA 3WEZA 1E71M 1JI2A 2WPGA 4X0VA 3ZJ7A 1H09A 4B16A 1D3CA 2EQDA 2XVKA 1LJYA 3CMJA 1GW1A 1AQMA 5TD4A 4XZWA 1K6AA 1KFWA 1QW9A 1EXPA 1CDGA 4TOQA 3APGA 3PZQA 1UA7A 3HN3A 5A6AA 1YQ2A 1FP9A 1R7OA 1QNQA 1FHLA 3MV11 4AZ7A 4BZYA 4AC1X 5GQBA 7TAAA 1XH1A 3SUSA 2GSJA 1WP6A 2J75A 1UR4A 1ISWA 4L4PA 1R87A 1ZBCA 3BAXA 1EOMA 4RE3A 1J10A 3LMYA 2VCBA 2XIBA 5GNYA 3W38A 4PMDA 4X9YA 5ECUA 1CXHA 4P8XA 1NP2A 3LPOA 5KZ6A 4WKAA 1VJSA 1HKIA 4UFLA 4JFWA 1SR0A 2XFYA 3BAKA 5CPQA 3TOPA 1Q4NX 2W61A 1EDQA 2BHUA 3VINA 1B3YA 2PWHA 3I3EA 2J7CA 5D8WA 4JL2A 4HA1A 1ISVA 3DYMA 3KWXA 3U57A 1QI0A 2XTKA 2DDXA 5CPSA 5DT7A 3T09A 5CLTA 4ZENA 4D1JA 1B2YA 1H5VA 4NF7A 4W85A 1ZL1A 2OWXA 3GTNA 3GXMA 2WNWA 3VIHA 1HL8A 4AD0A 1E6XM 5A2AA 3L4UA 1MVYA 4W84A 2DIEA 4PMOA 3W27A 2AOSA 2W62A 3WY1A 1MXGA 4NI3A 3WQ5A 4ATWA 3GH4A 5CXPA 1JYNA 2WWDA 1WDPA 3SUTA 2WM0A 3ALGA 1NWRA 2O9RA 1E4MM 3CGTA 3NCOA 5JUVA 5IFTA 4AZGA 2BHZA 2OYLA 1JGIA 1QW8A 1DWIM 2DIJA 1WO2A 4WSJA 4A3HA 5KEZA 1JNDA 1DWFM 3WDQA 3MMDA 2XHYA 2YA1A 3F5JA 4U3AA 1J0KA 3DHUA 1CEOA 4J3TA 1W9VA 2VRJA 4QAWA 4KGLA 1GQJA 5CSUA 1V0LA 3SCPA 2XWEA 2Y2WA 4PYSA 3ZMRA 1O7AA 1OCQA 3J7HA 1UQZA 1ZB5A 4MAVA 2VR5A 4QDMA 3KL3A 1HNYA 5ABFB 2CEQA 4NRSA 4JFSA 3VILA 3VPLA 1SMAA 2NW0A 1B0IA 2ZIDA 3D5HA 5C71A 4CN4A 4TVUA 2E8YA 3GYCA 4CU6A 3EBVA 1BLIA 2ZE0A 1UD6A 5AC4A 2EPLX 1DEDA 4MPKA 2WMJA 1EHNA 1UH2A 1KXVA 1UD8A 4WKFA 3WD1A 2ZUVA 1GJUA 1GOMA 5FOOA 5A69A 1S46A 4Z2KA 1JI1A 1PX3A 3MANA 3F5LA 3AMCA 4EAMA 2XJ7A 1XD0A 2EPKX 3PZUA 4CD6A 5A6BA 2X8RA 1ESWA 3MUZ1 1ITXA 3AICA 3CMGA 5D9OA 2ZUWA 2YLLA 3NYDA 2YKKA 2JF7A 1OGGA 4E8DA 1DHKA 1H49A 2G41A 1FP8A 4NZCA 3UG4A 3ARTA 2BY1A 2WKGA 4XB3A 2CITA 1JZ2A 2WK2A 1GZJA 3N18A 1VFMA 1B3VA 1RH9A 1C93A 1CPUA 2PF0A 5BXRA 1CXIA 1LL4A 3WKZA 1JZ7A 1TA3B 2ZX8A 3SCQA 1GOKA 1V08A 1EO5A 4V2XA 2WZIA 4D6EA 4WF7A 3CZGA 3CHFA 1E4LA 3VMOA 3N17A 4PMZA 5FD0A 2J4GA 4J28A 1ODZA 1PAMA 3M7SA 7CGTA 4U31A 5JIPA 4AIUA 3AIBA 5CJ5A 2QMKA 1U33A 4H04A 1DWHM 2BVTA 2DSUA 4PRWA 2PBOA 2WVSA 2DSWA 5CLWA 1E6NA 4QLKA 1JD7A 6A3HA 2W63A 3WUBA 2WLZA 1UH4A 1KR1A 3CUJA 4D72A 1VEMA 2WVTA 3ZJ6A 1WNOA 1ZS2A 3AIEA 2ZWZA 1RP9A 1HJXA 3M6DA 3N11A 4HOWA 1ODUA 1JF5A 4IISA 3K8KA 1SYTA 1MFVA 3VD5A 1W2PA 4MB1A 2A3EA 1KXQA 1QHZA 1E15A 4OJYA 1E6RA 4TXEA 3QGVA 1OM0A 3MSDA 1W1YA 2VZSA 1XGZA 1UKQA 3UR8A 5A1AA 4WJXA 1HIZA 1NQ6A 2YJQA 2WHLA 5EFDA 4OUEA 2F61A 2G3IA 3A3HA 4MJ2A 1XHGA 2OSXA 5A6JA 3BCDA 1ISXA 1V3KA 1BG9A 2ESCA 3CUFA 1CXKA 1A47A 4CCDA 3GZAA 1OBAA 3VO0A 4AY1A 4MADA 4B9ZA 4NSBA 4QP0A 1E3ZA 1UWQA 2WMGA 3UR7A 5ABFA 3S2CA 8A3HA 3E1F1 2EXOA 1E40A 2O9OA 1WKYA 4ZXOA 1V6VA 1C7SA 2J25A 2VCCA 3OGSA 4MJ4A 2XM1A 4KWUA 1J01A 4B3LA 5D8ZA 4D6IA 4CGTA 1UR2A 2D3NA 4BA0A 1J0HA 4PCSA 3WDPP 3VGDA 4JFVA 5JBEA 2QPUA 3NSMA 1EGZA 4R27A 1B1YA 4M56A 3WDIA 2ZXQA 2WKLA 3VIPA 3A6OA 4DM2A 1PIGA 1UWTA 3PTQA 3U7VA 3POCA 3WH8A 1WCGA 4UFIA 1JZ5A 1ZBVA 3CO4A 4D1IA 1JF6A 2UY4A 3WQ8A 4JIEA 4K68A 1CGUA 3SCTA 4BQ5A 4DWSC 1VAHA 4PMVA 2W4XA 4MNJA 1J0YA 2PWGA 3QR3A 3ZR5A 1QNRA 2XVNA 2DT3A 3DYOA 2D22A 2JEQA 1L8NA 3BMWA 5I78A 5E9AA 3GXFA 4D6JA 3SCVA 1TG7A 4PMNA 2QF8A 3IJ8A 3W25A 1ISZA 1E4IA 1UR9A 2J7EA 2VRQA 3WDHA 3MUY1 4PUEA 2XSBA 5BXSA 3ARSA 2G3JA 2W92A 2J7BA 2VUYA 1UD3A 4H8HA 1XCXA 3KE0A 4H41A 1VENA 3WBEA 1VFUA 5GNXA 2BY0A 3VGGA 1OT2A 1SFSA 5M5DA 1MQQA 1HP4A 3GNOA 1P6WA 4P8UA 1CXLA 2VQTA 3BAWA 1UZ4A 4GO9A 1W9PA 1PBGA 1WZAA 1C8QA 3SEPA 1UKTA 2DH2A 3RDKA 2EO7A 1QOXA 2PWEA 1QI3A 2GJPA 4JL1A 5IHRA 4EANA 3VD9A 1W9XA 1WPCA 3VD7A 1JDCA 3AIQA 1BSIA 1W1PA 4PEEA 3WQWA 4Z2JA 1JAEA 2VX5A 3N15A 3AROA 3HU7A 5A8NA 3PZOA 3VIGA 2D23A 1V6YA 5A2CA 3ZT6A 1JZ8A 1AVAA 1UHVA 3L4XA 3FHAA 2E9BA 4UFJA 3ARPA 1BG4A 1QBAA 3OZPA 4YHEA 4U2YA 3BGAA 1GONA 2J7DA 4F8XA 1N82A 4LGXA 3VDCA 1LWHA 4CD8A 3WQ4A 4WK9A 1GQIA 4JCLA 2WLYA 1BYCA 4S3KA 2XSAA 4UOQA 1XYZA 4C7GA 2W66A 2G4FA 3WNOA 4FLQA 1OINA 3EMQA 4Q7NA 1HJVA 1HT6A 5AY7A 1LLOA 2DPEA 1E4NA 3MU7A 4LQ1A 3B8SA 1I1WA 4FLOA 4GZJA 2WSKA 1QNPA 1FA2A 3AS1A 4M24A 1IZKA 3F5KA 3QOMA 2A3AA 4JZ5A 2V3FA 3ZSSA 2FH8A 2V3DA 2CNCA 2D0GA 3RIKA 3MMUA 1UWIA 2BY2A 5A8MA 4E2OA 1CECA 2WYSA 1VJZA 2VURA 4HMCA 5HXMA 1CNVA 3WMSA 3A4AA 2XIIA 3DHPA 1NOWA 2E0PA 4LXFA 4U33A 3WL1A 1FFRA 2CHNA 2QV4A 3EDEA 3II1A 4KRUA 3FN9A 2J8FA 1C92A 1K9TA 1BVZA 4YHGA 1UOKA 3PZTA 3WF0A 1HL9A 1E0XA 2JF6A 1I75A 1VBRA 2VR4A 3WD2A 3PZVA 2OYKA 1B3XA 4TX6A 3RCNA 2CYGA 3AXHA 1NWTA 5I79A 1JZ3A 2E9MA 4KH2A 3O9NA 5I5RA 4H2CA 1IT0A 3ARWA 3NUKA 1BYAA 2IUZA 3HJEA 3DYPA 2VJXA 1FH9A 3T0DA 2DH3A 3U5YA 4W86A 2PBGA 3AOFA 2C7FA 3OLDA 2NSXA 4OOUA 4HPHA 4H8UA 3WFZA 1KB3A 3FHQA 5A94A 3BSGA 1JYVA 4PUDA 1H1NA 3CIVA 4CU7A 4C7FA 3T2PA 3U5UA 1ZU8A 1HVQA 4KGJA 3K8LA 3VU2A 2YDRA 5BROA 1NH6A 2NT1A 2V3GA 3AMGA 5DEZA 1OIMA 1NARA 5DT5A 2UWFA 2WC7A 3OG2A 4HZ7A 3AHXA 1LL7A 2FGZA 1ZBKA 1Z32X 1NOUA 2VCAA 3IK2A 4HA3A 2WMFA 3TTYA 4OBSA 4DUVA 4PCTA 3ARVA 1W3LA 3BCFA 4ZFMA 1GORA 2VNCA 3AZRA 1PZ3A 3N12A 3MMWA 4TVCA 3W28A 4D6DA 5A2BA 3NSNA 1NP0A 4CKQA 4Z2IA 2PC8A 4UOZA 4QCFA 2CHOA 2EPOA 3PHAA 4W87A 4AZ5A 1VEOA 3BH4A 2WMKA 1R85A 1W1VA 2G3MA 3MS8A 3VGHA 3VIFA 2DGAA 3CZ8A 2ZX7A 3WMCA 1JZ4A
chains in the Genus database with same CATH superfamily
1RQHA 1X6NA 4ECLA 1GW9A 3GC5A 1T7LA 3P8JA 2F8QA 4C91A 1B9BA 4AU0A 1OX4B 1XDJA 3CTTA 3MJYA 4IGMA 2A3LA 4GK8A 3FJLA 4R3UA 1XQKA 4X2PA 4NXKA 3M43A 3W1PA 1V3IA 2JIEA 2HXTA 3P60A 5U7SA 3PWGA 1LG2A 3EKLA 4ZEPA 5XINA 4GYFA 3SW6A 4FR6A 2EJAA 3W2KA 1TR1A 3AFBA 1MEHA 3WLRA 3BMVA 1IYXA 1Q6RA 5D2XA 1WDDA 3CHVA 4Q8PA 5PTDA 3SUUA 2V38A 5DBTA 4Q32A 2Z27A 2QZRA 4A2RA 1DV7A 1NAL1 3SADA 1MXDA 2Y63A 1GJWA 4YXGA 4JTKA 1J96A 4D6CA 2QUUA 1W56A 3W29A 3WJYA 3RLUA 1NWSA 4YN5A 1Q45A 2FVLA 4E8CA 4MY9A 2DVTA 4Z0SA 1JJKA 3OW1A 1LLWA 3UZ5A 4RDWA 3TQ0A 3QF0A 4LUYA 1ITQA 4Y9NA 2WMHA 2C79A 1F6YA 1IGSA 1W32A 4JTUA 2FDMA 4MYAA 1LQAA 2A85A 4FX7A 3UWVA 2Q3OA 3WFLA 2XVGA 4MWAE 1LWJA 4CU8A 2PPGA 2VR2A 5CZKA 3UCDA 4JFTA 1H0IA 2WZMA 1Y8BA 4D71A 1V7AA 3S5NA 1JAKA 4KFNA 4W7VA 1QVBA 2OEMA 5BRBA 5CG0A 1F4HA 1FFQA 3HQNA 1KXTA 3MP5A 2FHBA 2EJ1A 3MCNA 2CKSA 4G6CA 4WXZA 1VBGA 4WGHA 2JGQA 3Q4DA 5CH9A 1BGGA 2OQLA 3VFCA 4J3SA 2GVYA 2PDJA 2DSVA 3C5QA 2VO5A 1JVNA 3AAMA 1Z42A 5ABEA 3QC3A 4QS6A 4H00A 5JQ9A 2J7HA 1HXJA 1B90A 3NL6A 1F3XA 3F1QA 3GC2A 1FX6A 4J27A 3OP2A 2DZSA 5JBDA 2UY5A 1N7KA 2XGIA 1DL3A 4PULA 1L0PA 3M41A 2QW5A 3CUHA 3WJXA 4UTTC 3PF3A 4XVEA 4HTYA 2ZZ6A 1TVNA 2ZXDA 2DEPA 4I90A 2PF8A 5DO8A 3CNYA 1D8WA 2X1UA 1BF2A 1WZKA 3S3GA 2BGQA 3UD6A 2BFGA 1R2RA 4LYQA 1XIDA 1CGXA 1H63A 4PC8A 2REQA 3JUGA 3RU8X 4NZ4A 5EFFA 4A35A 3WH9A 5I3DA 1G5AA 4RDVA 2ZX6A 4BCEA 1HO1A 1JCLA 4QCEA 1HF6A 3W72A 3QYSA 2Q01A 3UPMA 1GOIA 3P6LA 2PDIA 3ZYZA 3UXIA 4JIIX 1K7FA 1E1CB 2NQHA 2VT0A 4E0CA 1ONRA 3IJ9A 3BZJA 3IACA 4KS0A 3HB9A 5G1TA 2Y0FA 4W7UA 3PTKA 3LSBA 1TVLA 1QI2A 2VQUA 3WG6A 3RG6A 2IPGA 2QUVA 1ONXA 4XK2A 5CZJA 3A5VA 1UBPC 5C9RA 4K8GA 5I7GA 3W24A 1V5XA 4DBUA 4M6VA 2VX7A 4CVWA 3MPGA 4WSHA 2GJNA 3WD3A 4N9EA 1S39A 1OJXA 4Z1BA 2UBPC 4QBXA 3AIUA 1C9WA 1P1XA 3HA1A 1KW1A 1IQ8A 1YLVA 4G56A 1HL2A 3W85A 3GH7A 5K9DA 2E67A 4AY7A 4XG1A 2QVHA 2OYMA 2YW3A 4EF9A 4BQ2A 2WXDM 3L0GA 1LRTA 2PDHA 3HJZA 1XPGA 1CLKA 3TDFA 4RE4A 1KWGA 2Z26A 5D33A 1RVGA 4OV4A 2PGFA 5D32A 4K1WA 3W9ZA 4M80A 2YSWA 3QHMA 1EBHA 3HQPA 2OGJA 4RDYA 3A4XA 4P7OA 3LPGA 1FWHC 4EE9A 3LOTA 3PZNA 1V6TA 3BG9A 1X1NA 3LLXA 5AYXA 4J3VA 3GE7A 3OO2A 4O28A 4QNWA 2W6RA 4H2HA 3MB9A 2HEJA 4DBDA 2QCNA 2C14A 3EXRA 4XKYB 5HBFA 3E0VA 1LRQA 2OODA 1OHLA 3LCFA 1Q8AA 3JZEA 3V75A 2BVWA 4D6GA 4JQ1A 4C6JA 5IDZA 3IS4A 3NZGA 1XPYA 1X8CA 3DI0A 4LBUA 4CD7A 4R5EA 1P6CA 2OEKA 3K8MA 4BHYA 1C29A 1UD2A 3TYEA 1TV8A 4Y96A 1Q65A 3WQVA 3UVAA 3KRSA 1R3YA 3VMPA 3CYJA 1YTDA 1C90A 2J24A 2JKAA 3ZWTA 1BXNA 1OB0A 2J47A 2Y8KA 2ZXBA 1KGXA 2JE8A 4HN8A 4NZJA 1BVWA 4GHRA 3ECQA 4IIHA 5FEPA 3AI0A 3S6TA 3VD4A 8XIMA 4ZODA 4TTUA 3CUGA 3K4WA 4AEOA 2PWUA 1I0BA 4GH1A 4F79A 4L9XA 1AQHA 3POHA 3N13A 4ZTYA 4P7RA 1RK5A 5I06A 3GZ3A 5FL0A 3ZLFA 3R43A 2WMIA 4JTIA 1FH8A 4QNEA 2GK1A 3ANVA 3WNMA 4FLSA 4IQEA 1L2QA 4PBFA 3RLHA 4GKLA 1UUQA 3T0BA 2W5FA 2E77A 2QS8A 4PMQA 4YPJA 3WENA 1MW1A 4GNVA 4AD2A 1V3LA 2YXGA 4JHMA 3SUWA 4UQ9A 4A8RA 2NQ9A 1T8XA 1T0OA 4ZA0A 1JL8A 3GVRA 3S4TA 1WAWA 4KCVA 4TX9A 2X7WA 1O94A 4KRTA 4LOCA 4NNCA 3AS3A 1JPHA 3PBUA 3W2UA 3H53A 3GR7A 5LIXX 3LXCA 1UIOA 3C8NA 3DFSA 4AIEA 1H7PA 1FCUA 3TYZA 4HYRA 3NIYA 4A05A 3KHJA 4TU1A 4WJEA 4YTRA 2CBVA 3DFQA 3F2CA 2X16A 6TIMA 1OGBA 3V0SA 3DENA 1V3MA 3WJZA 2PU1A 1VS1A 3S9YA 2YPIA 3EAUA 3UCCA 1GUVA 3L21A 1A4MA 3N9RA 3LXBA 4RXGA 1OVDA 3BVJA 4TUFA 2XWDA 5F4WA 3OIHA 4IPJA 1XLEA 4GBUA 5LXXA 1SFTA 3R58A 1POJA 3TWAA 1XLLA 3ISIX 3GXIA 3SCUA 1VF8A 1RPXA 4UOJA 1ECEA 1F74A 4DVOA 3WLOA 4OBTA 4I8YA 4IMCA 4ASTA 3M64A 4C7DA 3TTSA 2VZOA 4DXKA 3GHSA 2X40A 3CMFA 4GISA 4JNMA 1CXFA 4DAFA 1BHGA 4LC6A 4PTVA 2DT1A 3FY1A 3NZ1A 4JKMA 2QIWA 1XSKA 4L1XA 3KL5A 4I7WA 1R9YA 3CHDA 3LCHA 3VIIA 1HGWA 4QEEA 3B8VA 5D2VA 4O11A 5HMFA 4N4PA 3BLPX 3W1AA 3IJIA 1XV8A 3DECA 1FWIC 2C8NA 2GWGA 1HKJA 4LX4A 5IBXA 3VDGA 3CT2A 5IFPA 5AB3A 3VNIA 5I00A 1VPYA 2NUWA 3PUOA 4L4OA 3TZFA 4AXNA 4F40A 4XV0A 4JNZA 1N8IA 2J66A 4L9ZA 1CLVA 5HPCA 2EPNA 3FDGA 2ZKMX 7TIMA 1GQLA 1TMLA 3VNZA 3ONCA 3IV8A 2CXGA 4GFIA 1M7PA 3RU6A 5M03A 3W1RA 1SGJA 5K3VA 2QUNA 1GTHA 3H2OA 3LD5A 3BV7A 4NXSA 1YKWA 3V1PA 2A7RA 3K1DA 3WL0A 4OE7A 3FJ4A 3G1YA 2R8WA 3WNPA 1SZEA 2ZZ7A 4JYDA 3W7GA 2B31A 1S38A 2FGBA 7REQA 3IJ6A 2ANUA 3ABQA 4ES4A 5HMDA 1Q6CA 5HNRA 2PRMA 1IWAA 3ID7A 1I1XA 2VL4A 4P7LA 1R86A 4F3HA 3DC0A 1D8CA 3V3WA 2WHKA 4PMRA 3VIMA 2PDPA 1IHIA 5HOSA 2I5QA 2OLSA 3ZIZA 3AMDA 4HCDA 2VZTA 1RPKA 2R6OA 3WD0A 3LHZA 5AFDA 1WOAA 2E6AA 1DJGA 1NDYA 1TTJA 1KCLA 1EWDA 3MZ2A 1EO7A 4ROPA 4EVZA 3PM6A 1V7YA 3GNRA 3E6EA 5DQPA 2XIOA 3VIOA 4F9DA 4HP5A 2YCKX 4B3ZA 1J11A 1KM2A 4LUJA 1QHPA 1RLDA 3ITLA 2WJEA 1EA0A 1H11A 4HHMA 3S8HA 3GDBA 4S39A 2VFIA 4DWSA 1VYPX 3T2OA 2WCSA 3PPHA 3AIRA 3CTLA 4AH7A 3EWDA 3R25A 3AHYA 3M47A 4M81A 3NXLA 3C2EA 1WAUA 1PIIA 4HSHA 1NTHA 2OOGA 2Z1XA 3HPZA 3WNLA 4LH8A 4MDOA 3F4WA 2IXVA 2FPVA 3OZOA 5CKSA 2XFRA 2R24A 3GIPA 3LUTA 1QK2A 1EA9C 4AG0A 4GY1A 3WLMA 2D24A 3HURA 2XVPA 2WCAA 3RJYA 3T4WA 1TE6A 3L4WA 3VVGA 3ARUA 2A3HA 3WLPA 1EXBA 1RK6A 2YDQA 5GVJA 2GJXB 3VKKA 3AZSA 3H12A 1RY0A 3AIWA 3BUVA 4HKPA 4O4WA 3O06A 4WKHA 4HQVA 3CEPA 4K6AA 1V02E 2QEZA 3W7CA 3CV2A 1Z89A 2WM1A 1DXIA 1BRLB 2QKFA 3UY7A 3SY5A 2A3CA 2WCGA 4X60A 3UWUA 4M3PA 3SO7A 4LAMA 5B7ZA 1OQFA 4HCHA 1NM9A 1Z44A 1HFBA 3NPXA 4N7QA 3FSTA 2PTDA 1R9XA 2ZRYA 1D7KA 3TQPA 3W86A 1OZQA 2QF7A 1PCKA 4AZBA 1S2VA 3M0KA 1J93A 2ATSA 3OLEA 4I9AA 5CZ0A 1U5JA 4LB4A 4ML4A 3VIJA 1UZ1A 4RZ5A 3P7YA 4LAUA 4QE1A 2ICSA 2OO6A 4JTRA 3O6CA 4H7VA 1P7TB 5EMYA 3VKCA 5BMXA 2NZLA 3CUXA 4YCPA 2ZTJA 3LPFA 3WUGA 1NEYA 4UUIA 3QJAA 3AU2A 3CUIA 2IPJA 3S1XA 2OWCA 2RAGA 4MYXA 5LIKX 4B5XA 4XISA 2EKGA 4LPCA 1JFHA 2Z7KA 4O52A 3L4ZA 4Y8EA 5T9CE 2GJRA 2WB5A 5DXXA 1KO0A 1TJPA 4PZVA 3GHUA 4HU8A 2ZOXA 1VIZA 2FH6A 2ACUA 3FEQA 2ASHA 2V5CA 2O0TA 3AUJA 2QYGA 4DO7A 1RV8A 4JIPA 4UBPC 3SCSA 1JCXA 3TJIA 3I68A 3KVKA 4FXSA 3C8FA 1FCVA 2PGWA 1P6BA 1W3TA 2OX1A 3NQ8A 4Q22A 5K9XA 4RNFA 1GYLA 4TMCA 2D69A 3KCLA 4LWWA 1ZHAA 3MSGA 1Q6QA 3LX9A 5D4YA 3UNDA 4LF2A 4PN2A 2P8BA 4E2VA 4FA3A 1W3HA 2PTXA 3CL7A 3BW4A 1A5CA 1W8GA 4JIRA 3WF4A 5C70A 3FA4A 1EQCA 4L65A 3NPWA 1L8PA 4J3UA 5FIPA 5JIWA 1X6LA 4LJ3A 4NAEA 4ZFCA 1BXCA 1XSJA 3G1XA 4Q4KA 3T81A 4UMAA 5A6BD 4P2VA 1V6XA 3ZS4A 3GTFA 5I2UA 4V28A 3LMZA 3BARA 3PFRA 2AKMA 1XH2A 3L2MA 1E71M 1RJPA 3G1DA 4B16A 4LS2A 3TLQA 2Y70A 2XVKA 4JNYA 5TD4A 3GX9A 3TC3A 4LUTA 1TV4A 4XZWA 1KFWA 3IJQA 2PE4A 3B0XA 4AWSA 3PZQA 1UA7A 1UJPA 4KEZA 1FHLA 1TREA 3DX5A 3RO6A 3N9SA 3B4YA 3ICJA 2I14A 7TAAA 1JPMA 3DAQA 2VC6A 2YR1A 1RJRA 5HNTA 1K8CA 5RUBA 1R87A 4L61A 1EOMA 2PURA 4RE3A 3HPAA 1PCWA 4D8AA 4OECA 2XIBA 3LZ3A 1AW2A 4X9YA 5FEWA 4QX4A 2VC7A 4NP7A 3T8QA 1M68A 1F7BA 1HKIA 3SM0A 4JFWA 3WQCA 1IXQA 1EDQA 2BHUA 3MUXA 2OT1A 5GJPA 4HT3A 3GDMA 1GYNA 3W7IA 4XZNX 3U4FA 3BWWA 3U57A 4IG2A 4M0XA 2QNEA 3QMSA 3A3XA 2F6XA 5CLTA 1EJSC 2MUCA 2OEJA 4D1JA 1B2YA 1X6UA 4W85A 3OBEA 3GTNA 1KM1A 1I2NA 3VIHA 1A0EA 1YNYA 1KM5A 3IEBA 1OFAA 2H3BA 2PRLA 5A2AA 2AQVA 2AOSA 4AWTA 1MXGA 3PAJA 4KWVA 3WQ5A 4S3GA 1YTEA 4ATWA 3GH4A 4YU1A 5I3HA 2HS6A 1Q6OA 2O9RA 3CGTA 4Y8FA 1K7EA 1PYFA 3Q65A 3HG4A 1DWIM 3A23A 4L6HA 4CNTA 1WO2A 4WSJA 1WYIA 2ISSA 3V7PA 1FY6A 1DWFM 3F5JA 5F2MA 3W7PA 2I1OA 4O15A 3KZPA 1KTCA 4H8NA 1GQJA 5CSUA 1GJPA 3GAKA 1V0LA 3K1GA 2XWEA 3ZMRA 1K1DA 4HNLA 4DF1A 1OCQA 3VCCA 2HNEA 1HNYA 3LERA 2NV1A 3KDNA 1WXJA 4AX7A 1ZJIA 2ZIDA 4CN4A 3GYCA 3EEZA 4IQLA 1BLIA 2QUTA 1UD6A 3R2GA 1EHNA 1W5NA 1UH2A 4HNTA 1GJUA 3C2OA 4Z2KA 3E0LA 3MANA 3UJFA 3F5LA 4DZHA 1H7WA 2EPKX 3EX3A 3IVTA 3WLJA 4Q4PA 3AICA 3CMGA 5D9OA 1FTXA 2ZUWA 1XIHA 4E8DA 2ON3A 3B3DA 2G50A 4JEJA 1GVRA 2E5DA 2C3ZA 2E1WA 3MKVA 4RX0A 5BXRA 3QY7A 1CXIA 3WKZA 3C3NA 2WQPA 1XDLA 4IJRA 3SCQA 5CBIA 3TC6A 4J2MA 3CZGA 3CHFA 4PMZA 5FD0A 1IXOA 5IBXC 4J28A 4FSAA 1R5YA 4JX6A 3G2GA 5D38A 1DIKA 1UMLA 3PUEA 5CJ5A 3NM1A 1DWHM 3ONBA 4RR4A 1KBIA 4PRWA 1CX9A 1CCWB 3H2FA 2POZA 1E6NA 3S2LA 1JD7A 3TX9A 5BNKA 4G8TA 3W1XA 2ABAA 2WLZA 1CB2A 2R1MA 1WNOA 3UWEA 1OYBA 4JTQA 3AIEA 1NY1A 5TBOA 3VOJA 4H83A 1EJRC 3W7EA 1F73A 5E0KA 2B7NA 4A8IA 1TWSA 3O8AA 2F9RA 3QGVA 3THAA 1UKQA 3UR8A 5HQEA 3TZNA 4WJXA 1HIZA 2YZ5A 1TPDA 3WLKX 1NQ6A 4OUEA 3STCA 2G3IA 4MJ2A 1XIMA 2C1HA 1RXOB 3DKJA 1V3KA 4FOUA 3CUFA 3UJ2A 1IEVA 3RCYA 4KEUA 4GFSA 2FMNA 3QFWA 1UWQA 3UR7A 3MCOA 3S2CA 2BOFX 4Z42C 8A3HA 1B5TA 2EXOA 1E40A 5G4HC 3H55A 4CCZA 2PZ0A 3OG3A 3TK7A 1C7SA 5I3IA 2J25A 2VCCA 4R88A 4E8GA 1A53A 4H1ZA 4J5NA 1AJZA 2D3NA 1F6PA 3WDPP 3VGDA 4I5XA 4POCA 1B1YA 2V82A 1QK0A 4DBSA 1LYXA 3BJTA 3PTQA 4X22A 4UFIA 2P76A 3WQ8A 2DIKA 1EUNA 2ABBA 3URAA 2ZRVA 9XIAA 4QROA 3TXZA 4DWSC 4Y2WA 2ZE3A 2X1SA 2W4XA 2VWSA 3G8RA 2PWGA 3BLOA 3ZR5A 1QNRA 3INPA 3DYOA 3MW7A 5D2WA 4YVPA 4EPBC 1K8YA 1ZPTA 4D6JA 4CNPA 1AH4A 1J5TA 5BOOA 4MWAA 3W22A 4HHPA 3IJ8A 3VA8A 1EJVC 2OLAA 3OVQA 5HUOA 5CSSA 1XLHA 1TPWA 2X30A 2BP1A 3V35A 1ZP4A 2G3JA 5CCZA 2YFNA 4XQ6A 4C5YA 4H8HA 4S3FA 1XCXA 1YTKA 3S6DA 3NQFA 4GRSA 3MUCA 4AF0A 3N3TA 3DFYA 1Y5WA 4P8UA 2W9MA 4NKCA 1F76A 1TO3A 4ZOAA 3BQ5A 1FBAA 4YMZA 3CL8A 4H7ZA 1WZAA 2ACSA 2E6YA 2DH2A 1LUCB 1XUUA 3OHIA 3SN0A 1T41A 3E49A 4ENLA 4RCXA 2Y85A 3A9BA 1P0BA 2PWEA 4NY2A 1VGAA 3OYXA 5A5WA 5HQMA 3VD9A 4GUHA 3T7VA 1DTNA 2Y7DA 1NDVA 4ZO9A 3N15A 2Y89A 5LXEA 3N25A 1LBMA 3H8AA 3QYQA 2O4MA 1LZOA 1JZ8A 2QIIA 3VNJA 2CLEA 1QASA 4OWGA 2OX4A 1EP3A 1PTAA 5M2FX 3AU6A 3ARPA 3KRUA 1TELA 3FGCA 4CEUC 1I2QA 4CD8A 4WK9A 1CI1A 1GQIA 4O12A 2OZ8A 1BYCA 3GXPA 1W1A1 3CO8A 3WO8A 4OT7A 4ZTXA 1XYZA 4C7GA 1S2CA 1XIFA 4RV3A 4PRTA 3GFXA 3MU7A 4LQ1A 2EPHA 1WUEA 2PWVA 1QNPA 5DCEA 3AS1A 4QJ1A 4ZZ9A 4JPGA 3UYCA 5BOEA 4DXVA 3MMUA 4IICA 1TX2A 3OBKA 3UY8A 4UTWC 1DOSA 4E2OA 4J35A 4L6DA 4RE0A 3TOYA 2E1DA 4RPPA 4JN8A 3MTWA 3NPUA 4HMCA 3ES7A 4CQAA 2XIIA 3DHPA 3PULA 2R1LA 3D47A 3EDEA 2CLKA 1XG3A 4YHGA 1QOPA 3P0WA 1FWFC 2JF6A 3GC4A 3ITTA 1VBRA 3WD2A 3VOIA 1G7VA 3PZVA 2VEFA 2OYKA 3H24A 3DERA 2CYGA 3TXVA 3AXHA 1OFPA 1NWTA 4GVIA 3UPBA 4MKNA 4F0HA 1DKWA 3FKRA 3O9NA 5I5RA 4K37A 4OU1A 1XRFA 3AYVA 3WK2A 5EMMA 4MY1A 4DPPA 1XISA 1HW6A 1EJ7L 1PHWA 4C6EA 4W86A 2PBGA 2JKPA 1ZCOA 3BLIA 3OLDA 1K8ZA 4HPHA 2PRHA 2Z4GA 4YTQA 4IMAA 2YBVA 2YCIX 4PUDA 2R1KA 2X7VA 3L7RA 4C7FA 3RX2A 3L68A 1K6WA 1KFCA 1VRDA 4JTCA 3L9CA 3C56A 1ZU8A 1Q5MA 4O0ZA 4KGJA 3K8LA 3VU2A 1NJJA 1RHCA 4G5DA 1NH6A 4QG9A 4GA8A 1KKOA 4U28A 3AMGA 4IP7A 1MZRA 1JGMA 3N2TA 3UT0A 2P1FA 4MGGA 4ZO7A 4HZ7A 3AHXA 1ZBKA 3PFMA 4N9DA 1KBLA 4HA3A 2WMFA 4JX5A 4HCLA 1Z8AA 4PCTA 2GQAA 1W3LA 3GDLA 4D8LA 1S2WA 1GORA 3N12A 4WUIA 4DO6A 2ONEA 3TAOA 1NELA 4TVCA 1ADSA 5JXQA 5GJNA 1H7OA 3NSNA 2GSEA 1NP0A 3BTNA 3EOOA 3PR2A 5CC7A 3RXZA 4QCFA 4EACA 2AL1A 2AQWA 4W87A 5D05A 1VEOA 4C6BA 2WMKA 3VZZA 2BGNE 1W1VA 1GKQA 4NILA 1PB0A 2G3MA 3S2JA 4GUJA 2DGAA 2HVNA 3CZ8A 1JZ4A 4EPKA 1WDQA 1SZGA 4LYPA 3MO4A 4UFHA 5E93A 1L6YA 4A29A 3E5PA 1PHQA 3GVWA 5C54A 3VK5A 1C7TA 4QQUA 1OGSA 2ZUMA 1YXDA 3PUDA 1FH7A 3T9PA 1QJWA 3SGUA 2VDGA 3GK0A 3EMCA 4WY0B 4MUZA 1XRTA 3EPNA 1XYLA 2GQ8A 4C1NA 3VDHA 1DXFA 4W7WA 1FOBA 4L1WA 2VGGA 4LT9A 5REQB 1S2UA 3QKEA 4QISA 1AL8A 5FF4A 3AMLA 2C6QA 2QPSA 3RRXA 4E38A 5AYYA 3IIPA 3ATZA 4REQB 4UZSA 1AK5A 3QW4B 5L9FA 1I2PA 1S2TA 3WX7A 3WQ6A 1RA5A 4HOZA 3GUWA 2YZRA 3S83A 1JCTA 4S23A 5A3HA 5HWMA 1VRXA 3KVMA 1AD4A 2B81A 5A8PA 2Y5EA 7ENLA 4DUWA 1TPH1 3WBYA 3R10A 3UG3A 2P0OA 4UQEA 5EKYA 2E8ZA 4CNOA 2C16A 1W3KA 3F7JA 1LL6A 1Q3NA 2E09A 3SQLA 4W5UA 5IXEA 4UQAA 1V0MA 4DI9A 4O1EA 1TKKA 5EGRA 2INZA 4IPLA 2B7OA 1XF0A 4JOMA 1FHVA 4IMEA 1HO4A 1H62A 4P8VA 4ERGA 3QQ0A 3HMJG 3SSZA 1TTPA 1OF8A 4YS1A 3UCQA 2BG5A 3TA9A 4AFYA 1EX5A 4ACYA 1J0JA 4IPNB 5HR6A 3GFZA 2NT0A 4MZ1A 3NXFA 5CEWA 1E6PA 3E5BA 4LU0A 5BXTA 3TNOA 1CZ1A 3ARQA 1H50A 4W88A 1XH0A 5AHIA 3VMNA 2GDVA 2WSYA 2GUYA 3QGAC 2YBTA 3CZLA 1JDDA 3TTQA 1WDWA 1GOOA 1G0CA 5FF0A 4ZO8A 5CAHA 3FNDA 3W1MA 3C0LA 1EBGA 2QULA 4B4FA 2WC4A 4AMAA 2X2GA 3FYPA 3T0TA 4FIRA 1QW7A 1MW3A 1OX4A 3HM7A 1JDEA 1R30A 2G37A 3IVUA 4JKKA 4W8BA 1BKSA 2ZWYA 5I3FA 5M3WA 4GUIA 2GDUA 3CAKA 2ZVIA 3SUVA 3MO7A 2QJIA 4AD1A 2BS9A 3EDJA 1RP8A 2V2CA 1LDCA 4NX0A 3CT7A 3SDOA 4D2JA 2KX9A 2WWCA 3M07A 4CCEA 4FEZA 1GPWA 2GYIA 3W07A 2OELA 3DBPA 1ZJAA 4GXPA 3BSHA 1X7FA 1LRNA 4GINA 4AD5A 1H2JA 1FWTA 1MDLA 5FCZA 3W2JA 1V0KA 2PDMA 1MUCA 5DLCA 4L80A 3TJ4A 1VCVA 2X05A 3EDFA 3CHEA 3E12A 5I0DA 4O0QA 3W37A 1NDWA 2E4TA 4XZMX 4M6UA 1HJSA 4NJJA 4DWDA 3V0TA 5EMUA 1OX6A 2A5HA 4X2RA 3IJDA 1Q2RA 1LQ2A 3ARZA 5ABHA 5G2HA 1SR9A 5AYIA 4D6HA 3BJFA 2F6UA 2C0AA 2G0WA 1E1EA 2EPMX 4WCJA 1IZJA 3E2VA 1UUMA 2H6RA 4QIUA 2VEGA 4UZUA 4CNSA 2FJUB 4JTTA 4S3BA 3CV7A 1XCWA 1XP3A 4ZQMA 4U4MA 2QDEA 1QBBA 1J79A 2FHCA 3WEMA 3LDVA 4C6CA 3GRIA 3LBOA 4HNNA 4XTDA 1BD0A 4DQWA 2TRSA 3ANYA 4MTVA 2QGHA 4IFOA 2XISA 4AVOA 3LQLA 1MEIA 1P0DA 4MWAC 4QE4A 5GNZA 4HPGA 1Y5XA 2YL9A 4HU4A 3WNNA 5HJXA 3CIWA 4PUJA 2E25A 4US5A 1LM1A 2P88A 4FLRA 1MW2A 1XLJA 4IL2A 2FKPA 1LF1A 1G67A 4ICMA 3U3HA 1MXSA 1CBGA 5KZMA 4ML9A 4A21A 5I3JA 2NX1A 2CPUA 1KLYA 1N55A 2PD9A 3OHMB 4JCMA 1M6JA 1GOQA 3U7BA 3GU1A 2YLAA 1O5KA 3KOXA 1RA0A 4FNQA 5HQLA 2GVGA 3PBYA 4X61A 4MUPA 4XIAA 1UP2A 2ZBTA 4DJFD 4J4KA 4AB4A 1U83A 2FZBA 5CGMA 1M7OA 3AMKA 1GT8A 4FR1A 4B3KA 4DNMA 1PEZA 4Q4MA 1CGWA 2DY3A 2DSKA 3E0IA 3T42A 2EAWA 5JVLA 1RQBA 3CJPA 3ENLA 5KINA 3KEHA 4INFA 1XC4A 2BV9A 2WOQA 4NVTA 1XBXA 4UQDA 4FX6M 1R3TA 1X97A 3D3FA 4W93A 4YCOA 3QLDA 4U5KA 2GGGA 5SWUA 4I9TA 1A0DA 1XC6A 4IZGA 3OYZA 1S5WA 5G4EA 3W7HA 3PS7A 1V03A 2GUUA 1NFGA 5D9MA 3CAWA 4BF7A 2RDXA 2VKZG 3WF3A 5ABGA 4MNKA 1V02A 3IGHX 1UYQA 4EXBA 2VDHA 4L4MA 1XLGA 4FXFA 4CQ9A 3L4VA 3LCGA 3T0AA 3QV8A 5EBAA 1O95A 2XH4A 1BVNP 3CPUA 4AUBA 1F4AA 5U4NA 3UGRA 4G9PA 4GVFA 2FZNA 3M0LA 4RZ4A 5LA2A 3KWSA 1ZP3A 3B04A 2V5LA 3ZXWA 5GPRA 4B5NA 4GI4A 3P14A 3CQHA 4BI7A 1GPFA 5C7HA 1M01A 1UC4A 1QR7A 1OC7A 3RM8A 3TN3A 3VNLA 3NOYA 2VUNA 5TIMA 4Q8QA 3R1ZA 1OD8A 1U5HA 2WSPA 5H1WA 2C19A 1PWMA 3A21A 3URQA 1DJQA 3KFTA 4QS5A 1B3OA 1PDYA 1V4YA 4O16A 3UGVA 3PBGA 3C4UA 1W3JA 1H5YA 3RGTA 3GKFA 2HROA 2I16A 4E2BA 1VHCA 4DYEA 1SPQA 5K4XA 1D2KA 1E6QM 1LQ0A 4B5SA 3BG5A 3O05A 3R11A 1W1TA 1ML1A 1O6IA 1UR0A 2Y6ZA 2YL5A 3MVIA 3BAJA 3TCSA 2IS7A 3WF1A 4MB3A 1SZRA 3RF9A 4Z2HA 4JTGA 1A50A 1W9BM 1O1ZA 4N9BA 3LCIA 1E0WA 1UB3A 1KLZA 1TJ0A 3KOZA 2ATMA 1RD6A 4UC5A 4H8VA 1GVQA 4BY3A 5HUPA 5XIMA 2E6FA 4IPPA 5CSYA 1H41A 3GDTA 1W9DM 4XKYA 3U2ZA 1O4UA 1LCOA 1PJ9A 2IMRA 4FALA 2J77A 2BXVA 4Q8MA 3BLKA 4GQRA 1HVXA 4ROQA 2BTMA 3BLFA 1G01A 1KCXA 1W5OA 1EH9A 3N19B 5I3GA 5FF2A 1J0IA 4S3JA 4N42A 3PC0A 5DELA 2RDWA 2D73A 3QTPA 2TSYA 3MVTA 1RCQA 1WUFA 2WC3A 2FDSA 2SFPA 3S1WA 2JK2A 4R9OA 2UY3A 2UY2A 4OZOA 3TJLA 4NG3A 2BNJA 1EDGA 4H9TA 4HSOA 3B9AA 4AYSA 1THFD 2HQAA 1M5WA 3AXXA 1GOWA 2NQZA 2R1NA 4MG4A 4TIMA 4IIGA 1XUZA 3UEQA 3VM5A 1W5PA 3P5YA 3TKFA 4O1FA 3KRBA 4ZOEA 1DIDA 5FAGA 3SBFA 1QRQA 3KBVA 1SMDA 2ZDSA 3V16A 4H9ZA 1IGWA 2JALA 3PZ9A 4B92A 3HBLA 1MQPA 3NZPA 2NVCA 4RK8A 1UWRA 4OKDA 2QGYA 1WDRA 1WKFA 5CPMA 3N4FA 4G7FA 3GNXA 4IHCA 4J1OA 4WXYA 1JRCA 4ATDA 1VFHA 1CYGA 2WHMA 4JTAA 1KCKA 4DJFC 4WD0A 3FXYA 3A4WA 3R79A 1YEYA 4NJGA 4B5VA 3R5EA 1JYWA 1VLWA 3VE7A 2G96A 3NEVA 2VENA 1JDAA 2E68A 3JW7A 4JKLA 3RCMA 1HZYA 1WE5A 5CZTA 1EC9A 4IUGA 4GO8A 4D8ZA 2OQHA 4J7RA 5AHMA 5FJTA 1DE6A 1FVPA 4GQGA 3WZ0E 3SGGA 3V5OA 1SZFA 1ECQA 1SJBA 1TUXA 2I9EA 1TZ9A 2IKIA 3ZZ1A 1DVJA 4XO7A 1PE1A 3LYEA 4QR6A 4ZXLA 1TFVA 4C6IA 1K9DA 4HZ8A 3SRHA 3TYUA 4G1NA 1DWGM 5A6MA 2J78A 4RNJA 3ZSTA 4QJ4B 2EKCA 4KETA 2VGFA 5L6UA 2XFFA 3GG8A 1IXNA 3I10A 3W75A 2VVSA 1XYCA 3W01A 3F4VA 2JEPA 1S1RA 4O17A 3H7UA 4E4FA 1XICA 3CASA 1R6WA 1CWYA 1J8VA 1ICQA 4UCFA 3ITVA 1K03A 2P5NA 3BCJA 1FXQA 2O7SA 3G22A 5BZAA 2F38A 4C6PA 1GNXA 3OJGA 3MC5A 1C3FA 4M1BA 2ZUTA 1VH7A 2FPYA 4LUSB 1SO6A 1VBUA 3I4KA 2FB3A 3WYZA 3CPGA 4JTLA 5C2GA 3QH2A 1QPRA 3G3MA 2X0SA 4IX2A 4CN6A 1JIBA 1FWAC 4FP1A 1IZCA 3W0KA 3TMLA 3HFTA 3HGSA 4AWUA 2NWSA 3E0WA 3W7LA 3PVFA 2WQDA 2XM2A 3WSUA 4M19A 1J12A 2WKJA 1JG9A 3EDKA 3RPTA 1E9YB 5LA1A 2Y5SA 4R53A 3W6MA 1KFBA 3LB0A 2AGKA 2WAGA 5D9PA 4BI6A 4R34A 2IW0A 1K3UA 1J18A 1UPPA 2DUZA 4J3XA 2UZ9A 4CCCA 5M17A 4AZCB 1OFDA 4JICA 1NQKA 4PSPA 5CGTA 4JHOA 3MV01 3IAQA 3U2EA 3A64A 3HQ1A 5AHLA 3USBA 5A95A 2YDSA 3TIMA 3IGXA 4NYYA 1CGVA 4LVAA 2ODOA 4DXXA 5K9CA 3PJTA 5E6ZA 1K8XA 3GU2A 2OU4A 1BEUA 4W8AA 2TYSA 3NQMA 2V5DA 4CN1A 4HPNA 3UZJA 2CBIA 3WUFA 4U3CA 1Q6FA 5HNNA 3L67A 3ORWA 4UMCA 3WMLA 4A3YA 4GZIA 2F6KA 1MRAA 1UG6A 5D04C 2VVNA 3NVDA 2OJPA 3KBMA 3ZQ9A 2XN2A 3TONA 2BGSA 4EWND 2BXZA 5DFAA 2BVYA 3S42A 5KZDA 1OFQA 3GYEA 3NNTA 2FPTA 4TTGA 2W67A 2F2HA 1N2VA 2PWFA 4F0SA 1A3WA 1MO0A 2D0FA 4JAWA 5IRPA 4DNHA 4DHGA 4U2ZA 4JN6A 2GQ3A 1NIUA 1IT8A 3C2VA 1XRVA 1DJIA 3AHTA 3OVRA 3M0XA 4J3WA 4ERAA 5LYRA 3QV7A 3TYDA 2ACRA 3PPFA 5DXYA 2EEXA 4DX3A 3BSMA 4K2SA 4A3QA 3HG3A 4HYVA 3AXMA 3C52A 1RJQA 2Y24A 2YXOA 3RUBL 2YL8A 4O1BA 3WN6A 3AWOA 1P5BA 4UTUA 2ZRWA 3JZUA 4LFYA 3O0KA 1YBQB 2YFOA 3CZEA 1PO9A 1UKOA 2FTWA 3QR1A 1HGYA 3K5XA 1E51A 3F4NA 3ZO9A 4Q7BA 3RO8A 1XLFA 1UWSA 1W31A 4OTKA 4I5UA 1QI4A 1JXKA 3K4DA 4DYJA 2E6DA 4DM1A 3KOWA 3FAXA 3ITYA 5AC8A 1W91A 3GD6A 3R0KA 4MF4A 4RJEA 3BGJA 1XYFA 5A6SA 5E70A 4XVDA 5C9UA 4PB3A 1F2JA 1RZMA 2QJJA 4MPQA 4YVVA 1US0A 4U10A 2QUMA 3SCRA 1NWUA 5G1MA 3CM4A 2GJXA 3CC1A 1FWJC 3G1HA 2BLEA 4MNLA 3EWYA 3QV6A 1OWQA 3W1LA 3WEZA 1JI2A 1BRLA 3ZJ7A 4BF5A 3UR2A 3TROA 2EQDA 1AQMA 3VABA 3TU9A 3I7QA 1G69A 2Z1BA 3UWWA 5CPLA 1PZ0A 1U5VA 3HN3A 1FP9A 1QNQA 4H7CA 3MV11 1NU5A 4C6OA 4JR5A 4MVAA 3MSYA 1VFSA 1A5UA 3SUSA 1MI3A 1F61A 3G1SA 3P80A 2OB3A 4I6KA 4L4PA 1ZBCA 3BAXA 2PSNA 1XKJA 1TWIA 1XGDA 2PCQA 1H7XA 3WLSA 3L5LA 3U6WA 3IGUA 4P8XA 1P7TA 1NP2A 2C18A 3LPOA 1AH3A 5KZ6A 2XIQA 3LZ5A 2CLPA 1RVKA 3DFOA 1R0MA 4NNAA 4I3GA 1YDVA 5CPQA 3BAKA 3DCPA 2DVUA 1XIJA 2W61A 3M0ZA 3VINA 3VOFA 2G5WA 4GJ1A 1WXYA 3TN4A 1TTQA 2VFEA 5DMLA 1VCGA 3IPWA 3HG2A 1QI0A 1JPIA 5CPSA 3T09A 2Q8LA 4ZENA 4XD6A 3HPSA 4NF7A 1X1OA 4IGHA 2FQIA 3W7DA 2WNWA 1EJWC 4CQBA 2DIEA 3WQFA 4P61A 3M5ZA 3VNDA 3PBMA 1JYNA 5TAOA 3SUTA 1GVOA 2WM0A 3VZXA 2QCHA 3H23A 4LVDA 3TV8A 3QC0A 2Z28A 3DGRA 5C7VA 1ZQ5A 3NCOA 5JUVA 4AZGA 1I4NA 2BHZA 2OYLA 1QW8A 1PS9A 2DIJA 4FX8A 4Q33A 5C55A 2QR6A 1SJCA 1BWLA 3BPWA 1JNDA 3WDQA 2XHYA 3S2NA 3U4AA 2FFIA 4LBRA 5T8GA 1J0KA 4J3TA 1EF2A 1W9VA 4HNUA 5DRIA 4QAWA 2Y7EA 2XH7A 4KGLA 3SCPA 2Y2WA 4PYSA 2POTA 3W7JA 1YE4A 3J7HA 3BLDA 1UQZA 2OOFA 5ABFB 1SMAA 3MYOA 4MOZA 2E8YA 5CBJA 1I2OA 2A4AA 2ZE0A 5AC4A 3W70A 3W1TA 3CAVA 4WKFA 3S9IA 3WD1A 2ZUVA 3EX2A 1R2TA 3GHTA 1S46A 2PDLA 2PCEA 3ITGA 1PX3A 1LWIA 2Z00A 1VYSX 4EAMA 2HV5A 2NV2A 3O07A 3HPXA 1A5KC 3DIPA 3A13A 3F4DA 4G2DA 4IL0A 2YCLB 1ITXA 4XSLA 1JDFA 2YLLA 2JF7A 2RJGA 2C1GA 4O8RA 3PUGA 4S2BA 2HZGA 4XZLX 2HSAA 2WKGA 1JUBA 1S3TC 1RR2A 4GWEA 4XB3A 2GGEA 2CITA 2DORA 2WK2A 1OFOA 4K3ZA 1L6SA 1VFMA 1B3VA 1RH9A 1C93A 4FS9A 4AYGA 1LL4A 1JZ7A 1EEPA 2ZX8A 1V08A 3KBJA 4HIBA 3RAOA 4D6EA 5EBUA 1H7RA 1ODZA 4I5RA 3M7SA 4PB4A 5JIPA 4DJDA 4AIUA 2QMKA 4DF0A 3E2RA 4NL1A 4DN1A 4JTJA 5BW6A 3IRDA 5CLWA 4HPXA 3WUBA 3WLQA 1UH4A 1ENUA 4D72A 2LLEA 3ZJ6A 4NJIA 4IIBA 1ZS2A 1Q7ZA 4IXXA 2ZWZA 1J6OA 1HJXA 3M6DA 2ISFA 5AYZA 3QMRA 2YX0A 1XI3A 2R9RA 3HIJA 3MA8A 3K30A 2ZFAA 3W88A 4N6FA 3QY8A 1QHZA 2TMDA 4OJYA 2TPSA 4XAPA 1SJDA 4JGDA 4TXEA 5HATA 3MSDA 3O0FA 3GVVA 3W74A 2A6NA 4RKAA 3GB6A 4QSFA 4PH6A 1UBSA 1ZRQA 2G4JA 3KRZA 3FS2A 3PB2A 4NJHA 2WHLA 4ERIA 3A3HA 1XHGA 3BCDA 1BG9A 2ESCA 3N2BA 3W1QA 2ZRXA 4CCDA 7ODCA 2VEPA 3I7RA 3VO0A 4AY1A 3WLTA 4IMDA 4MADA 3ITXA 4NSBA 1FKXA 4QP0A 1JCJA 4TV6A 1OFEA 2BBFA 3GKAA 3IWPA 1V6VA 4JTDA 1OK4A 5HULA 5J5RA 3W1UA 3OGSA 4GNJA 2XM1A 4KWUA 3WK0A 1ELSA 4K36A 4D6IA 1J0HA 3GS6A 2QAPA 3BO9A 4C6KA 3NSMA 1YXYA 1FWNA 3XISA 4R33A 1ZNNA 5FA5A 4M56A 3WDIA 3QQ1A 2ZXQA 4HN4A 4PB5A 3F4CA 2NSOA 3NQ7A 1UWTA 4QJ5B 4GYPA 1X7IA 3RR4A 4PODA 3POCA 3WH8A 3S5ZA 2WV8A 1JF6A 3MHUA 4KPLA 1ZY9A 3UJEA 2VC5A 1WKDA 1MUMA 4KIEA 3SCTA 1UMYA 4IP5A 1FWDC 3GW0A 3E74A 3PB0A 5KETA 2RDUA 3DI1A 4JTHA 2E28A 2R94A 2D22A 4WJ8A 3WK1A 3BMWA 1OABA 3SIZA 1TTIA 1BXBA 2I56A 3FVDA 3LTPA 4YL2A 1AW5A 3SCVA 3SFKA 1GVSA 1VJIA 5F2IA 2ZDRA 4ICCX 3W25A 3W6YA 2J7EA 3FV9A 4N02A 2GUBA 2XSBA 5BXSA 1B54A 1U1JA 2VM8A 3FVMA 2A79A 2VOMA 3KE0A 4H41A 4UMBA 5ABTA 1VENA 2F2KA 1DQWA 1EZWA 2BY0A 1OT2A 2PDWA 1SFSA 1MQQA 4K8HA 2BB0A 3L23A 3Q2DA 2DV0A 1K7XA 3NDOA 2Z6JA 4FI4A 1J6PA 3TFXA 4DLMA 3HGRA 3RNDA 1JCMP 2EG6A 1C8QA 2VEKA 3SEPA 2Y7FA 2YYUA 3TR9A 2QVNA 3RDKA 1GK8A 3GQYA 3NQDA 4E3VA 1QI3A 4EANA 4A8NA 3TQKA 1A5AA 1DXEA 1JDCA 1S5TA 4A3RA 3BW3A 5H8UA 1JAEA 3R13A 2TODA 3HU7A 1QAPA 4EIVA 3PZOA 3VIGA 1V6YA 5A2CA 3ZT6A 4BEUA 1UHVA 3C0JA 1T5AA 3L4XA 1OC6A 1QBAA 2OXNA 1LOLA 4YHEA 5I3KA 1GONA 3H4XA 2J7DA 1A5BA 4F8XA 3VDCA 3WQ4A 4TQTA 1IR2A 2KZHA 4TO8A 2XSAA 3C0SA 3NQ6A 1XCFA 4CNNA 2PLMA 3NGJA 2DZUA 2OMAA 1D3HA 1FA2A 3VI2A 2ZQ0A 3UBPC 4A2SA 3QOMA 6XIAA 3GIYA 2FH8A 2V3DA 3NL3A 3RK8A 3B9NA 3N4AA 5A8MA 3NQVA 3VFLA 2WYSA 4E2DA 3ABSA 3DFPA 1VJZA 1QUMA 5HXMA 1CNVA 1NOWA 2E0PA 2GVEA 2QV4A 1L6GA 5FJJA 3G18A 4RDZA 4XZHA 3FN9A 2J8FA 4LYKA 3I6TA 3Q94A 4ONVA 1CB7B 1UOKA 3PZTA 3P2VA 4UTMA 2VR4A 1KKRA 4P5UA 1PYMA 5LNUA 4EAYA 1TX0A 6ALDA 1JZ3A 4ZB2A 3U2CA 4H2CA 4IFKB 3LXAA 3PSVA 3UWYA 4AXKA 3S5OA 2D2JA 5E5CA 3CEUA 1FH9A 3KBWA 2DH3A 2XSXA 3EB4A 3U5YA 3ERPA 1M41A 4XAGA 3NGFA 4H8UA 3WFZA 3FHQA 2I5GA 4GCAA 5FAJA 1H1NA 1RLCL 3CIVA 4CU7A 4R7WA 3BLLA 1XBVA 2PUZA 2OGYA 3P82A 3WLLA 2EF9A 3CAQA 1LUCA 1SO3A 3DG7A 2V3GA 3C2YA 1OIMA 1XW8A 2UWFA 1XQLA 1RD5A 5A8GA 1A5LC 4F2UA 2FGZA 1ME7A 1T6MA 1NOUA 2QCLA 2NX9A 4RNIA 3OZMA 2OCZA 4F4RA 4OBSA 3RHGA 2Z2AA 4XUGA 1XKYA 4ZFMA 4M7TA 2VNCA 2GGIA 3MMWA 4WGXA 4B5TA 4E6MA 4E3TA 5MF5A 4B4HA 4IGNA 1YDOA 4OFCA 1G4SA 2JGYA 1EZ2A 4CKQA 1V51A 4Z2IA 4UOZA 3NFUA 4NJKA 1NDZA 2EPOA 3IK4A 2JKEA 3CQKA 4ZBCA 5FF3A 4H01A 3KTCA 3LV6A 2IQDA 5MKGB 4BF9A 3G24A 2Z1WA 2ZX7A 3WMCA 1XLKA 3VGEA 4M82A 3EYPA 2P3EA 3CQJA 5AC5A 1MRQA 4FXJA 3GBDA 3MZNA 4GUFA 3DG3A 3UF9A 2QDHA 1MNSA 1BFNA 2CETA 4AEEA 4D6FA 1HKKA 3NDYA 2Z6IA 1TCMA 2DT2A 1JQXA 4EF8A 3R89A 4DEFA 2ZUNA 2CZ5A 2YCJA 5JU6A 4AVFA 1Q6GA 3M46A 3ZT5A 4LV4A 1QXLA 1T96A 1JRBA 1WB0A 4MMWA 5E6YA 4MB4A 2XU2A 4X0NA 3T40A 3WQEA 1PTDA 4K1GA 1KWKA 3KBNA 3WD4A 2OKTA 3KTXA 3N2OA 4FOKA 1BWVA 2A2IA 3P81A 4FHAA 4UIOA 3DKLA 3B0YA 1F3WA 3TNBA 5KSWA 1BSLA 2OWWA 3MDWA 2OR2A 3AJXA 3VD3A 3EZ4A 2O92A 3M0HA 2AAMA 5G1YA 3OA5A 4HNOA 2DZPA 4UR7A 1DWJM 3QHNA 4U5IA 4WLCA 3QVQA 3MI2A 1H4PA 1MQRA 3W84A 4O1AA 5EL1A 1XGEA 2PMQA 3PZGA 1E6SM 5I07A 2V30A 2BY3A 5DN1A 3LNPA 5CQ1A 2WVVB 4PUMA 2X2YA 1GHSA 5FJIA 3GDRA 4QG8A 3RPDA 3WBWA 2GJLA 1H1YA 4HVXA 3EOUA 2OPJA 3ME3A 1PTGA 2OVLA 4ATLA 4UTTA 4BQ4A 2D20A 4CLMA 3FEMA 1TPVA 2WVUA 1YX1A 6XIMA 5EB8A 2ZX5A 3CYVA 5A6LA 3OB8A 3H4WA 4A6GA 1FHUA 3OLIA 2PWDA 1DHPA 2WZEA 2FZ8A 1T99A 1TE1A 2J74A 1PX4A 3CBWA 3EWWA 1RBLA 3AALA 4MNMA 4PA8A 1KQYA 4ZGYA 3U0HA 1WV2A 1UUOA 4DJDC 5BRQA 1RQEA 4H6EA 1C8XA 1HJQA 3I6RA 4F0MA 2A3BA 3QZEA 1E9LA 1YHTA 3D46A 4EP8C 5AOUA 4DF2A 3B9EA 4QJ3B 3BDKA 1A5MC 1PZ2A 1LBLA 4CUCA 1QMLA 2CBUA 5LSMA 2OSYA 1UROA 4HB7A 4WY0A 1UD4A 2ZC1A 1US2A 2NX3A 1YPXA 4JY9A 1A3XA 5H6HA 4H6KA 4OIFA 2PI6A 1VKFA 3AIVA 3PPGA 1KGWA 1YNQA 2VWTA 3UJSA 1ICPA 4L9YA 4N9CA 5REQA 4MKSA 4LAOA 3MUIA 1AA1B 4TV5A 1J0ZA 3GO2A 4REQA 1QPKA 2WBKA 2CFFA 2RFGA 4WIWA 3NJ3A 4TR9A 3GBEA 1PL9A 3LHWA 3N1AA 1FWBC 1XFCA 1SW0A 6REQB 1DBTA 2NUXA 2OSWA 1WBJA 5FL1A 5DY3A 4DZIA 3NYZA 2YB4A 3UXLA 3LENA 1G4EA 4GCXA 1Q6EA 3HF3A 4LVFA 4DZ5A 4IWWA 7A3HA 1UASA 3NSXA 5I6SA 1EP2A 3OPSA 5FESA 1EGMA 1TA3A 3AS0A 3R7MA 4XZIA 3VUSA 2V2HA 3SIMA 3UZYA 5LGZA 2J7FA 1E55A 1I2RA 2O9TA 4ALDA 4UTKA 2OLHA 1E5NA 3VOCA 2XN1A 1XSIA 1XX1A 2PDQA 4GYPC 4EOUA 3MKCA 4XD3A 3R94A 2DUXA 3AHVA 4CD4A 3G77A 3RMEA 1OEPA 1W1ZA 4HTBA 4LCQA 2A21A 3OBAA 1MUWA 2WPBA 2G8ZA 4PMXA 1VQTA 1FUYA 5C9WA 3TC7A 4KW2A 3M9YA 3SRDA 5EU9A 3QW3A 1W2VA 4EK7A 2BDQA 5D02A 4IM4A 1XIGA 1KV8A 1I0DA 4AIOA 5D09A 2NLYA 3OLGA 4MDPA 3GUGA 3UESA 1US3A 5LIWX 5FJUA 3AC0A 5AC6A 1HJWA 1TQJA 4DUXA 1ZBWA 3PJUA 1KBJA 2WHJA 4GI8A 1CENA 4A22A 3MKKA 3UA3A 5EMKA 3G6MA 3RN6A 5F1VA 4F2TA 1VR6A 2HRWA 2BHYA 2HPIA 3AJ7A 3FCPA 4HU0A 3SRFA 4XD5A 3EB2A 3JS3A 2DUAA 4UFKA 3VKDA 2AGTA 4M7SA 2ZTKA 2RHGA 1EX1A 1BTCA 3T08A 3B9DA 1EP1A 2CIPA 2W91A 3I6EA 4O14A 4H9UA 2VHLA 3QSTA 3N29A 4PTXA 2Y4SA 3CQ0A 3PNZA 3HFYA 3ZVHB 3A22A 1R3QA 4L4LA 1JCYA 3DFTA 3BANA 2EHHA 3N73A 4UTFA 3QV9A 1CT5A 1BWKA 3WLNA 1O12A 1RBAA 2IPFA 4GPNA 3EOLA 3M4HA 1M9HA 3LHTA 2DW6A 4ZO6A 2O9PA 3GH5A 3ABRA 1DP0A 4ORIA 4C90A 4MAZA 4B9YA 4QGCA 2FLIA 2FGLA 1E43A 3OZYA 4ACZB 4DELA 2OTDA 4Q8NA 1FDZA 3AXKA 5F4XA 5C5YA 4C6DA 2E9LA 2JIWA 5CPOA 4M29A 4UTJA 1VFOA 3SGZA 1MZHA 3WDJA 3EKGA 4UTLA 2QJMA 2GVJA 3WH6A 3LGEA 1AODA 4R9XA 1UJQA 9XIMA 3HZ3A 4Y7EA 2PP3A 3R6IA 3AQUA 4XBSA 2J9XA 1AUSL 1H0GA 5EA9A 1XR2A 4UNIA 1UR8A 2RUSA 3QLLA 4FOJA 3EKZA 4GQ0A 1ZALA 1U30A 2FVMA 3BAIA 5HNUA 1V6WA 4J3ZA 6PTDA 4Z0JA 1R8LA 4MB5A 1XBYA 4F66A 1RSCA 4C5ZA 4AAJA 4CQ8A 1HJUA 5TQLA 1M53A 4RUBA 1OT1A 1MDRA 2FMOA 3GIQA 4LY4A 1JYXA 4QM1A 4BQ3A 1E1FA 1WZMA 3KLKA 2D0HA 3M7WA 3VUPA 4BI5A 4Y9PA 5DMYA 4H6QA 4ZMGA 3IJLA 3CZJA 2AL2B 3G6LA 2X0YA 4KEMA 2DQXA 1TPB1 3TSDA 2G3FA 1KQZA 3C0QA 4HA4A 1W1B1 1R3RA 3ZM8A 3TEVA 3W7OA 3M5XA 2CWXA 3W2NA 3O6AA 3K13A 4F0KA 4PGLA 4ZOBA 5D03A 2CCRA 2CESA 4DWSD 1I8JA 2QCDB 2NLIA 5FSEC 1V93A 1JZ6A 2ZZ4A 4FIQA 3UW6A 4JFUA 3EMZA 4GOAA 5CZSA 2WBGA 1NF0A 4HJFA 1ZLPA 3OODA 3FW6A 3K4AA 4I6VA 3QRHA 1HUVA 3GM8A 2RKXA 3GTIA 2QCEA 3IARA 4KCTA 4WSKA 1OSEA 4ZL1A 5AHEA 1E70M 4PRRA 5XIAA 2XDFA 6CGTA 3DDMA 3T6CA 2DW7A 1B3WA 3N6QA 2VMFA 3G0UA 5G2IA 3LHYA 4GQBA 1GGOA 2QV5A 3MMTA 4IUOA 1Z48A 1AQ0A 3C6CA 3K2GA 1G7UA 3WH7A 4EWJA 4HNVA 3G5EA 2OQYA 5A6TC 1EYEA 4N0RA 3VKAA 2O55A 1WDSA 5I02A 2NWRA 3NL5A 3AYTA 5IHSA 3H7RA 2A6LA 5DANA 2INEA 1HX0A 4YNGA 3NAVA 4BKNA 4V15A 3ARRA 3M1ZA 1WQ5A 1EOKA 1VIWA 3W6LA 1UCWA 3TUUA 1YPIA 4QSHA 5LIUX 1JPDX 1BPLB 1HKWA 1KBBA 1G94A 4YWSA 1MYRA 1W54A 2CU0A 1R7AA 3GG7A 3CXOA 4EKJA 4LSBA 1X96A 1H51A 3ZVIA 5BU9A 4A4AA 1JR1A 3IRSA 1XXXA 3P61A 2ZA2A 1KM0A 4GX8A 3EX6A 3LK6A 4WDWA 2WANA 2VFGA 3PZMA 1F3EA 4JYFA 4PSRA 4UFMA 3THCA 3UXDA 3B0VC 2VELA 1E6ZA 4E4PA 2J79A 2Y8UA 5I23A 1MNZA 3NDZA 5TNVA 4S3CA 4M8UA 4JHZA 3BJSA 1M7JA 3S47A 2PDKA 2J62A 2RGMA 2YW4A 4BEQA 2ZUSA 3TSMA 3CH9A 3UZWA 3N2MA 1RY8A 1S1PA 5A6KA 1C8YA 4J9JA 1UP3A 3TTOA 4ZSUA 3RMJA 2DSZA 3W2MA 1AW1A 1EC8A 1E0TA 1G1YA 2V67A 5H8PA 3SN4A 1B3ZA 3WFAA 3MHGA 4UTIA 3KXQA 5AVHA 4PTNA 1FHDA 3N14A 1QT1A 5AYBA 4LRSA 4LVBA 4HHHA 3G0SA 4AHQA 4PMYA 4F9JA 4GI9A 2IXUA 3OOQA 3ZT7A 2DP3A 3KM8A 3SCWA 4W9TA 1L6FA 1BYDA 1P43A 2X0HA 4L1GA 1RALA 1GVEA 1AZ1A 3DC8A 4PUNA 4WX2A 3VKJA 3B0PA 2C91A 3OVPA 1TV7A 1XD1A 3MI6A 2HVMA 1AD1A 2VC9A 4B5UA 1F9CA 5LA0A 2GDQA 3SFWA 4YTTA 2X1TA 3EDDA 2NQJA 1C91A 2PDFA 1B9ZA 3M0JA 1XLCA 2HK0A 3THDA 4MJMA 1L6WA 4NRRA 2V2DA 4F2BA 2I5IA 3DXIA 3QZAA 3TVAA 2G3NA 1EQPA 1SSDA 3MWAA 1B4KA 3PP7A 1KC7A 1QCWA 5HJLA 5KMYA 2CZEA 1YXCA 1Z69A 1TPFA 3VIKA 1SQ7A 4IGSA 1H3GA 3K46A 2OZ0A 4LS1A 2NVAA 1UH3A 1XLIA 3MJMA 4O50A 1O5RA 2C71A 4GKTA 4PTDA 3XINA 1ZGDA 5JH2A 4GG9A 3UETA 2Y62A 3QTGA 3O1NA 4V1XA 5E1QA 2QDGA 3PAOA 4GD0A 3MUAA 2FFCA 1J2BA 2CKRA 4K8EA 1SVDA 4KQNA 2VX6A 2WZTA 3WDRA 3L66A 3VDAA 4AHPA 4FF5A 1IWBA 5DX7A 5BMWA 2DQWA 2QMJA 5D9NA 1PSCA 3NG3A 4ZE4A 4FO4A 3W82A 1Q6DA 3L0KA 1FKWA 2WNZA 4Q4RA 2DVXA 4Y90A 1CLXA 3PG9A 1VHNA 1AMYA 4NZ1A 2V0TA 4V1YA 1ITUA 4LB3A 5CPTA 2VXNA 4HD5A 2XG9A 4KESA 2DT0A 1LBFA 1C9DA 1LG1A 3S0CA 3OGRA 1OK6A 3NEHA 3VGBA 3UNTA 4ZE5A 5DCDA 3VGFA 1GVIA 2E3ZA 4MY8A 4UNLA 3A47A 3H70A 4HZ6A 3VYLA 4AZHA 1PKNA 1KV5A 3BXWA 2NXGA 4E4UA 3ZOAA 1W17A 3NWRA 1CXEA 3LM3A 3QOKA 4W5ZA 3WEOA 1AJ2A 3Q45A 3SAZA 3FYYA 3NZQA 4QFUA 1DWAM 4LUSA 2DZAA 5FACA 2QHAA 4GVGA 2Q8XA 3VNYA 4GXWA 3A12A 1WZLA 3VX1A 3WQDA 5LNWA 4ZQRA 5IDIA 1PKLA 2FHFA 3LPPA 2E40A 3VDBA 4P7NA 1BAGA 4RL3A 1H60A 2Q3RA 3N2CA 4UB9A 4Q8WA 2E7FA 4H4IA 2CERA 1DYSA 3CWOX