1EQPA

Exo-b-(1,3)-glucanase from candida albicans
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAASRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Minor structural consequences of alternative CUG codon usage (Ser for Leu) in Candida albicans exoglucanase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords EXO-B-(1,3)-GLUCANASE
total genus 153
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2000-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eqpA00
4WF7A 4Z2IA 1GQLA 3VD5A 2VCCA 2W67A 4NSBA 3ARRA 1S46A 2J7GA 2WB5A 5C8BB 5F7UA 1MW3A 4JL1A 4F9JA 5FIPA 5I5RA 2Y8VA 3SUSA 3K8KA 1H41A 3NUKA 1Z32X 1H2JA 3VIGA 1TVNA 2PWEA 3AHXA 2EPNA 3W25A 3CBWA 2GJXB 4OOUA 4P8UA 3GXDA 1C90A 2WKLA 2JEPA 1W3HA 2A3AA 2FHCA 3TOPA 1RH9A 3BAXA 3WQVA 5AYIA 2YL8A 1V0LA 3F5KA 4AYSA 1JZ3A 4ML4A 1FFRA 4HA3A 1FFQA 1GQKA 1GCYA 1HJXA 2WBGA 2GJXA 2GUYA 3JUGA 4HZ6A 1XRVA 3A4WA 3LPPA 5CG0A 3WF4A 5DT7A 3WNMA 3A4XA 5D9OA 4D6HA 2ZX6A 8CGTA 1WDPA 2VZVA 2DSVA 2DSKA 4FLQA 4L4OA 2BFGA 5ABFB 1C7TA 1NH6A 1HKKA 1JI2A 1LG2A 1CGUA 4W89A 3IANA 1BSIA 2V5DA 2BHUA 4RL3A 4M56A 1J0YA 2E4TA 1E6NA 3UR8A 1UR2A 1W1TA 4W7WA 3K8MA 3WNNA 4PMNA 1CTNA 3VDHA 1WPCA 3K4DA 4AW7A 4B9ZA 5BRQA 3GNOA 1J9YA 4J7RA 1V6YA 4KRTA 1V6WA 1HJQA 1QI4A 4D6CA 4XB3A 3CO4A 1JDCA 3WQWA 3RJYA 1IZKA 1Q6EA 3NSNA 1X6NA 1HP4A 1ZJBA 3HU7A 1D7FA 4ATDA 1AQHA 4U5KA 2ZXAA 1W1VA 1XYFA 3L4VA 2ZXQA 4PRWA 5BXPA 5AY7A 1E73M 1IT0A 1VAHA 4DUWA 5FKYA 1BAGA 3CGTA 1L0PA 5E6ZA 2VQTA 1KCKA 4MADA 4JZ5A 2JE8A 2XFFA 2ZUTA 2WMFA 1G0CA 5I3DA 4EAMA 4W7VA 3WNLA 1CGVA 1XC6A 5A6AA 3U57A 5E0CA 3CHDA 5JBDA 1XSIA 1I75A 2PBOA 5E70A 4TX8A 5I79A 1JYXA 4W85A 5D8ZA 1VENA 1E0VA 3ZJKA 4TTGA 1QW9A 1LL6A 3VIJA 1CLVA 5CQ1A 1QHPA 3RIKA 4MPKA 1W9PA 2J7DA 3BMWA 2WC4A 3AIQA 1AMYA 4GZEA 2WMIA 2YDQA 3GNPA 3VMOA 2YL5A 3NIYA 2X05A 4GPNA 3PTMA 2IUZA 1WNOA 3LPGA 1UWUA 3KL5A 4C7FA 1QVBA 3MUAA 1CXFA 3GBEA 1OT2A 3GH4A 1UQZA 2J4GA 3CPUA 2Q8XA 5CPTA 2PWDA 4MB3A 5DEZA 1UWSA 3SCQA 1V3JA 4UFLA 4MTVA 2PF0A 4W84A 4ZFMA 4HU0A 1NQ6A 1W9XA 3VGHA 1V08A 1XD1A 2DSWA 4XV0A 1WB0A 1KWKA 4LXFA 1F4AA 1XYZA 1JZ6A 5IFTA 5CZKA 4J3SA 4AZBA 4ZXOA 1E1EA 3BSGA 1QOXA 3O6AA 3UG4A 5BWFA 3L4TA 1EQPA 3VDBA 3F5JA 1BYDA 1CXIA 4B9YA 4QLKA 4H41A 4D1IA 4U31A 4MNKA 2DGAA 4AEEA 3ZSTA 1Q6DA 4KRUA 4TTUA 1GQIA 2E0PA 4HOZA 4DWSB 4WSJA 3CUIA 5BCAA 1ZB5A 2FHFA 3AYRA 3AXXA 1GZJA 3O9NA 4K68A 5JUVA 3PTKA 5CGTA 4R5EA 2ZWZA 4MB5A 1J10A 1XCXA 3OZOA 4AD4A 1W9UA 2DEPA 3WN6A 2PWHA 3GH7A 1UD6A 3CUFA 4CD6A 2A3HA 1B3VA 5E9AA 2DT0A 3FY1A 2AAAA 1HL9A 1MYRA 2CBVA 2VO5A 1E56A 1U33A 1GHRA 2J7HA 1B90A 4Z2JA 4ACYA 2J7EA 1XH0A 4HTYA 2ZICA 2CHOA 2W5FA 3ZOAA 2XVGA 2XUCA 3KE0A 2VRQA 1QNSA 1BYBA 1HKIA 3M6DA 5AC4A 1QHOA 4CD5A 1W2PA 1JFXA 4Z2GA 4D6FA 5CSUA 2F61A 4H8UA 4PMXA 1GOMA 3ARTA 1E6PA 1ISVA 7A3HA 4CN4A 1LWHA 4UZSA 1J01A 4ATWA 1ITXA 4MB1A 1JIBA 3AS3A 3MMUA 4OJYA 3AFBA 1GVYA 3K1DA 4P7QA 3VMNA 2ZWYA 5JIWA 1J0IA 4J3XA 2CNCA 1B1YA 5HPOA 3CLWA 3GBDA 3B8SA 3M07A 2WNWA 2G3JA 3VO0A 2X1IA 3A6OA 1UKSA 2RGMA 2XPKA 1JG9A 3MMWA 3CZLA 3PZNA 1HL8A 4U5IA 5HOSA 4JKMA 2Y8KA 4CN6A 4UNIA 2RGLA 3U7BA 3SUWA 4AZGA 1HKJA 3OA5A 3BC9A 1OB0A 3MMDA 1OSEA 2E9MA 3WUFA 1VFUA 4E8CA 3WD3A 5D4YA 2O9OA 2WCGA 4V2XA 1BGAA 2JALA 1M04A 3PZUA 1E4IA 1CWYA 1UQYA 5D9PA 5D8WA 4UQBA 1UH2A 4M81A 2EO7A 2XVPA 1B2YA 3VOCA 1DEDA 4F66A 1V0KA 4C7DA 1G5AA 5HPCA 5FL1A 5M3WA 4MDPA 2VL4A 1RD6A 2XG9A 1QNQA 1VJZA 4MJ4A 4J3VA 1C7SA 1PPIA 3WUGA 2W4XA 5IFPA 1FHDA 1DWIM 3WF3A 2D0FA 3HMCA 1TCMA 3AMGA 1UR0A 3CHCA 5A6JA 2WVVB 2WBKA 3PN8A 1ECEA 2VX6A 5HNNA 2EPOA 1TFVA 3BAIA 3CUJA 2NT1A 3VGFA 1KFWA 5A8NA 4U3AA 4TVDA 1UHVA 2WMIB 2JIWA 1J0ZA 1XV8A 4PCTA 5BXTA 3WDQA 2WKGA 1D2KA 4GO9A 2CYGA 3LMYA 3WUBA 2HVMA 2WPGA 4NI3A 2VX5A 4L4PA 4IPNB 1VFMA 1OWQA 3PZTA 3W24A 2QF8A 5EB8A 2HISA 4P8WA 4XX6A 1GW1A 3N13A 4NF7A 1J11A 3T2OA 2PWGA 3AHTA 1OBAA 1EXPA 1E5NA 3UR7A 2YA2A 5JBFA 1A3HA 1UOKA 4P8XA 3VIMA 3VINA 2CBIA 3BH4A 4N42A 1E4NA 1E72M 1UG6A 2EPLX 1BGGA 5ABFA 1E15A 1GORA 2ZUVA 3T0DA 1B3ZA 4W87A 4MJ2A 4A4AA 1VBRA 4A3HA 1UR4A 1UYQA 4KGLA 2G4FA 2WHKA 3CHEA 4EE9A 1FP9A 3QR3A 3BLPX 3U7VA 4U2ZA 2ZXBA 3I3DA 3F4VA 4U33A 3PZIA 5A3HA 1G94A 5C71A 5I0DA 2GJPA 2WVVA 4AZ7A 4ZE5A 3VGBA 4J3WA 1LWJA 4CN1A 2FH8A 2J79A 1EDGA 2YBUA 2DT3A 1ZBCA 4P7RA 3AIVA 1E0WA 1UKPA 2VC9A 1E40A 4HMCA 1JD9A 4M82A 3L2MA 3RO8A 3ZIZA 2CXGA 4TOQA 2OWCA 3CUGA 1H5VA 1O7AA 1UA7A 5A6KA 3W81A 7CGTA 1CENA 2AMGA 1H0IA 5GPRA 1H0GA 3AIEA 4P7OA 2FGLA 1JZ4A 4AIUA 2WMKA 1XCWA 1NWUA 4TVUA 4UFIA 2D1ZA 3CMGA 3TP4A 1J0HA 3N04A 1UKOA 3A3HA 2O9TA 1JFHA 4Q7NA 3LPFA 2EPMX 3E1F1 3OIHA 3BMVA 1OCQA 3WIJA 4AEFA 3VMPA 3BLKA 4IM4A 4F8XA 3GXMA 2WLYA 1W32A 4WK9A 2JF6A 2TAAA 1W1PA 1LL4A 3AQUA 3ARUA 3L4XA 2J75A 5AYBA 5M17A 3CZEA 2YDRA 3ARWA 4OUEA 2QV4A 1CGTA 3AMDA 3WMCA 1K9TA 3AHZA 5D9NA 1SYTA 3T2PA 1SFSA 5M03A 2J8GA 1VJSA 1H4PA 4H04A 3TONA 2J78A 2X0HA 1E6SM 3THDA 1HJWA 3WD0A 1OIMA 3KL0A 1TE1A 4JIEA 3VNZA 4CCDA 3VIKA 2W66A 2JF7A 1ODZA 1NWRA 1Q6CA 4QCFA 4URIA 4WLCA 1UD2A 5D9MA 3G6LA 2W62A 5LA1A 1W9VA 4W7UA 3ALGA 1G01A 3WF2A 3VNYA 4DM1A 4W93A 2BS9A 2VOTA 1HVQA 6TAAA 4OOZA 4CD7A 3AZSA 1PX4A 1KCLA 4M8UA 3PZOA 5AC5A 3B9EA 3WD2A 1EOMA 2XJ7A 4GINA 3UETA 5A69A 3AMKA 1WKYA 2YDSA 3OGVA 4BQ5A 5CLWA 2UWFA 4CD4A 1VRXA 2XGBA 3PBGA 2EPKX 3T2QA 2A3BA 4M1RA 3WELA 4H8HA 5I24A 2WLZA 3FHAA 3G6MA 3WQ5A 3WUEA 1UH3A 1MW1A 1ZBKA 2OSYA 1H1NA 4HPHA 4DWSA 4HA1A 1VBUA 1UZ1A 1TG7A 1V3LA 2G3IA 1QNOA 5CJ5A 2WM0A 1WZKA 2OYLA 5CSYA 4PSRA 3QHOA 3AICA 1AQMA 1HIZA 4PSPA 4B15A 1MWOA 3OLEA 3RM4A 4HMEA 5A8OA 2V3EA 1UD4A 1HNYA 1BYAA 3OLDA 2J7BA 1R7OA 3GXIA 3I3EA 4PCSA 1UA3A 2DPEA 1C8QA 1HJSA 3KWXA 2CPUA 1XSJA 2VUYA 5E6YA 3W6LA 2CKSA 2QMKA 4DUXA 1DP0A 4CCEA 1YHTA 4PUDA 3W28A 3VIPA 1RP8A 3ARZA 2A3EA 3RPMA 2BVDA 2FHBA 1B3XA 4NZCA 3L4ZA 3BAWA 1CLXA 1SMDA 2VZUA 4AZHA 3AMLA 4XZBA 3RCNA 2QMJA 5IDIA 5LYRA 1JZ5A 1VB9A 4WKAA 2QHAA 2DT2A 2UY2A 2PWFA 1QI0A 2CKRA 4LYRA 4PMUA 2VX4A 4HA4A 3TTOA 4D6JA 3K8LA 2VRJA 3ZSSA 2VR4A 4R27A 2OSWA 3PTQA 4HZ8A 3AS2A 3VGDA 1HJUA 3SCPA 1WP6A 2E3ZA 4QFUA 4BS0A 2X2YA 1W2VA 3HJEA 4GI8A 4UOQA 1OD8A 1M7XA 2GK1B 5ECUA 3VPLA 3I3BA 2J62A 2WSPA 3MUZ1 4JFSA 5A95A 2YBTA 2J7FA 2ZE0A 2FH6A 2O9PA 3CZGA 3WH7A 2WW5A 4GIAA 4FLRA 2EQDA 1WZAA 1B3WA 4CUCA 3AROA 3T09A 2XSBA 3FN9A 4J3UA 4P8VA 4UQCA 1JYWA 1PZ3A 1GNXA 1VEPA 2OYKA 1LG1A 1BHGA 5CPSA 2E9BA 1HJVA 5E0FA 1JF6A 5FL0A 2YL6A 3VDAA 4PUEA 1OGSA 4GO8A 3PZMA 3SCSA 4YPJA 1KGUA 3SEPA 3VM7A 1TR1A 1JXKA 4PTVA 4C7GA 3SCTA 3AZRA 3ARPA 1WE5A 1VFFA 5DFAA 2NT0A 5LA0A 3WF0A 5ABHA 3ZO9A 2G8ZA 3W53A 4UQ9A 3U5YA 2B31A 3VDCA 3WH9A 1US2A 3NDYA 3WEZA 4M29A 1UR9A 2O92A 3DHPA 4H2CA 3GM8A 1GOOA 3AIBA 1BTCA 1ZBWA 3W0KA 1PIGA 2WANA 3EDJA 2XWDA 5FOOA 5EBAA 1SR0A 4AIEA 4UFKA 2ZUMA 1Q6GA 1QBAA 1UR8A 3DECA 2G3NA 2VVNA 1RPKA 2WZIA 1DWGM 2CHNA 1GOWA 1CGYA 4U3CA 3WMBA 5HDRA 3WENA 1E0XA 3SURA 1DWHM 3NDZA 2D23A 2OWXA 5E09A 1QW8A 1CGXA 3WH6A 4AZ6A 4PN2A 1CIUA 2VR5A 3ARYA 1KBKA 2J47A 4IUGA 3GNRA 2Y5EA 1UWIA 4LQ1A 5IXEA 1E6RA 3EMZA 2WZHA 3A47A 4PMZA 2WK2A 4M80A 2XVLA 3CIVA 1QI3A 3T08A 2WYSA 2DH2A 1UWTA 2WC7A 4JCMA 2AOSA 4BA0A 5BXRA 4Z2KA 3SCOA 1GOIA 2XSAA 1GUVA 1V6VA 3MS8A 3AIUA 3GH5A 2XHYA 3D5HA 1LF1A 3POCA 3RJXA 4W8BA 5I78A 2CCRA 1G9HA 1I1XA 4W5ZA 1LQ0A 2WAGA 4PBGA 2BVTA 3OZPA 1PX3A 1V03A 2ZUWA 2GJRA 1EHNA 3MANA 2DSZA 1JGIA 4CVWA 1MW0A 2BV9A 4BCEA 5A2CA 2F8QA 2C7FA 1V0NA 3MV11 3U5UA 1V6UA 1HXJA 1HT6A 3WNKA 1MVYA 2UY4A 1HKMA 4MNLA 1FOBA 3VX1A 1TVPA 2WMHA 2PBGA 4KH2A 2CBUA 3D3AA 1JNEA 5LA2A 3MU7A 4WIWA 4E8DA 3VD3A 4JFVA 4Y7EA 2CBJA 5EMYA 1MQPA 2BY0A 2V3DA 1C8YA 3TTYA 1B9ZA 1FP8A 3FHQA 4ZE4A 2XYLA 1CNVA 2J77A 3GXFA 4W8LA 1X6LA 1WCGA 2XIIA 4V27A 4TXEA 3L4UA 1JYVA 4KMQA 1EA9C 1C93A 3AI0A 5TD4A 1C3FA 2BY2A 3NJ3A 2EBNA 4UCFA 4PTMA 1E5JA 2JEQA 2V5CA 8A3HA 1R87A 4X0NA 1M53A 4OBSA 4UOJA 5DMYA 1WO2A 3N12A 1M01A 2BY3A 1W9DM 4DUVA 2XVNA 4JAWA 4GI6A 2O9RA 2BHZA 3KEHA 4AXNA 3VKKA 2D24A 1GOKA 2X09A 3WMSA 1V3MA 2YJQA 4Z2HA 4IPLA 5ABGA 4OZOA 2GK1A 1W3JA 1ISXA 1MFUA 2YLAA 1EDTA 2WSKA 4CKQA 1WAWA 4AWEA 3IJ7A 2OSXA 1B3YA 3EMQA 3W27A 2YL9A 2BHYA 1Q6FA 3ARVA 4WKFA 5A6SA 2BVYA 1B0IA 2ESCA 2W91A 4CD8A 4D6IA 1ODUA 2VZTA 2F2HA 2PI6A 3PZVA 1V3IA 1MQRA 3W29A 2DH3A 1NOUA 1KQZA 3N9KA 1CBGA 4LX4A 4QCEA 1LJYA 3SCUA 2ZXDA 1MXDA 1K9DA 4QAWA 1JF5A 3VIFA 1J0JA 1GJUA 3AIRA 2J25A 3SUTA 1M03A 3EDFA 1LLOA 4JFWA 4LYQA 1PEZA 1EHAA 4QLLA 1NP2A 5FD0A 3WBAA 4F9DA 4QLJA 4WJXA 3MKKA 1UWRA 4AISA 4MNJA 3QOMA 1BG4A 4EKJA 5HBFA 5KZ6A 1EOKA 2XVKA 2J8FA 1CECA 1NOWA 4UR9A 2WVUA 1WZLA 2XFYA 1KR0A 1W9BM 1VEOA 2WC3A 2BXYA 3WF1A 3RILA 2QPSA 1CEOA 3AZTA 1UD5A 3IK2A 4OKDA 4AMCA 3CZ8A 4UFMA 4AZIA 4JKKA 3W4RA 2DSUA 5A6BA 1JDDA 2VCBA 7TAAA 4B3KA 4PTWA 1XD0A 4FLSA 5I23A 2GFTA 1CXKA 1K9EA 1QNRA 1AVAA 1QNPA 2XM2A 4S3KA 3VIOA 3UERA 4UOZA 3WH8A 3L4WA 3OG2A 3N15A 4CU6A 3M7SA 3GZAA 2WHMA 1NM9A 2W92A 4P7NA 4FMVA 2X0YA 5DO8A 1IZJA 1E4MM 4H7VA 1ZL1A 5GQBA 3MSGA 3ZR5A 4MAZA 2D0HA 4P7LA 1PAMA 3CHFA 4TUFA 1BVNP 2J74A 2XFRA 4D6GA 1DWAM 3NSMA 4QDMA 1FH8A 5GNZA 2WHJA 5A6BD 2Y4SA 1I1WA 3FAXA 4MB4A 1R86A 4DWSC 3UG5A 2OWWA 1VEMA 2CETA 4EANA 3BCFA 2D0GA 3II1A 4UQEA 1EO5A 4H8VA 4BQ3A 1D3CA 3AHYA 3BAKA 4DM2A 3GTNA 1PX8A 1BLIA 2YKKA 1XH2A 2VMFA 3CMJA 5BROA 3WY1A 3T0BA 4U2YA 3AJ7A 1ISZA 2Y2WA 3W26A 1OT1A 1PZ2A 2WHLA 4GKLA 4CU8A 1XSKA 2XGIA 4M24A 3SUUA 4OBRA 1MW2A 2E8YA 4MNMA 5CXPA 3SCWA 3NCOA 5GNYA 4JHZA 4YHGA 3NSXA 1UZ4A 1FA2A 9CGTA 1FH7A 3SUVA 3WDJA 1E9LA 2DQXA 5A94A 2WWCA 1ISYA 1H09A 1KGXA 4RE2A 2UY3A 5HXMA 3IJ8A 3AXHA 1CXEA 3CZJA 4ZEPA 3VIHA 5DT5A 3MV01 3WL1A 3OGRA 4D6DA 3MUIA 3CH9A 1ZBVA 2CESA 2J7CA 2BXZA 1C8XA 5KEZA 3NYDA 2VNCA 2ZUUA 4N0RA 4BZYA 1E6XM 1CXHA 1CZ1A 3FW6A 2VCAA 3WEMA 3RM9A 3VX0A 4PMOA 2E8ZA 4S3JA 3SCVA 4AZCA 5I77A 1G1YA 3ZT7A 3AMCA 3WNPA 4LGXA 1EDQA 1K9FA 1V0MA 4B3LA 4NRSA 4PMYA 4ZXLA 3OB8A 1ITCA 1E3XA 2WWDA 2ZX7A 3VGEA 4HZ7A 3WD4A 4ACZB 1UH4A 4JCLA 5JIPA 2ZX9A 2ZUSA 2ZX5A 3OBAA 4CCCA 1IV8A 4JFTA 3K46A 1BPLB 3EDEA 4UQAA 1W3KA 3S6TA 2BY1A 4RE4A 1L8NA 1R85A 1B31A 1ESWA 1J0KA 1HX0A 1KQYA 3EDDA 1UD8A 4AIOA 1E71M 2JFEX 1OD0A 1K6AA 2WVTA 3THCA 1NARA 1KBBA 5BRPA 1OGBA 4HMDA 4PEEA 1YQ2A 5A2BA 4PTXA 2FGZA 2Z1SA 1E70M 4AD3A 5A1AA 4AC1X 1GPFA 1QI5A 2IXVA 1EGZA 1KXTA 1R7AA 3KZSA 1CXLA 1TMQA 4AZ5A 1GVIA 3ZR6A 1DHKA 2VI0A 4J28A 2PC8A 3PZQA 3DHUA 2GSJA 4Q22A 2D22A 3MSDA 3EYPA 3ZJ6A 1V3KA 3LPOA 4TX6A 5CPQA 5IHSA 4UTFA 4DWSD 3CTTA 1UR1A 4A3YA 1NOFA 1UWQA 2BNJA 4RE3A 5C70A 3VILA 1PJ9A 3AXIA 1QHZA 2WCSA 3IJ9A 3N11A 3WD1A 3PZ9A 2WZEA 2EJ1A 2IXUA 2YOCA 4HOXA 5JBEA 4KWUA 4FF5A 3ALFA 1KB3A 4LPCA 2C0HA 3A4AA 2E9LA 4GZJA 1JL8A 3BXWA 1ZS2A 3DYPA 4IISA 2YIHA 1JYNA 3AHVA 4PMDA 1KR1A 2GDVA 1NWTA 2D20A 2C8NA 1MFVA 5A6LA 4J3TA 1E43A 1WDRA 1GHSA 3QOKA 3ZJ7A 2XTKA 3WDPP 4B16A 2V3FA 3SCNA 4F79A 2DIJA 2YA0A 2NSXA 4V28A 4OIFA 3VU2A 1UD3A 4PMVA 1HN1A 3T0AA 1QBBA 3ARXA 1ZU8A 4YN5A 1W3LA 4HP5A 5FCZA 3EDKA 4BF7A 1KXVA 3TTQA 2VZOA 1TA3B 1E1FA 5IHRA 1WDQA 3MUY1 1CPUA 1XHGA 3WDHA 1US3A 1Y7VA 3L2LA 1W1YA 3EMCA 3APGA 3VUPA 2Y24A 3UCQA 5A2AA 1J12A 3UG3A 3OLGA 1C92A 1SMAA 1H3GA 1E55A 4CVUA 1UUQA 4XUYA 3OGSA 3VTRA 1GQJA 4ZENA 4J27A 1V02A 3AS1A 5M5DA 4YHEA 6A3HA 3AISA 1GONA 1U30A 2ZOXA 4BQ2A 4AD5A 3VD4A 2UY5A 1CDGA 4PMRA 1JI1A 1GJWA 3WKZA 1JZ8A 1X1NA 2W61A 4E4PA 3RM8A 1JZ2A 3VD9A 3RMEA 2W63A 4HPGA 3DYOA 3WDRA 3WFLA 4PYSA 3PHAA 4X9YA 4LYPA 3WSUA 3F5LA 2OYMA 2G3MA 3IAPA 2WMJA 3RDKA 2JIEA 1OIFA 2A3CA 1QPKA 3W38A 1F4HA 4D6EA 1J18A 3ZMRA 3GYCA 4D1JA 1XGZA 4JHOA 4D71A 3L4YA 1OGGA 1BG9A 4AZCB 4UFJA 2G41A 2YA1A 5A8MA 1PBGA 3POHA 3FNDA 3WFZA 5I6SA 3WH5A 4E2OA 4CGTA 1R8LA 3EBVA 2ZUNA 1E6QM 1V6XA 2MANA 3ZQ9A 3TTSA 1KXQA 1U2YA 4JKLA 1WDSA 3PZGA 4AD2A 1P6WA 3SIMA 4FLOA 2XIBA 1HVXA 3WL0A 1O6IA 1DWJM 1DTUA 5GNXA 1KGWA 1V02E 5EFFA 3WQ4A 1W91A 5CLTA 2WXDM 1XH1A 1AQ0A 4CU7A 6CGTA 3BCDA 4UQDA 1UKTA 3W37A 4D72A 2DIEA 5A6MA 1E4LA 1GOQA 1VIWA 4XZWA 1MXGA 1E3ZA 2WCAA 1PIFA 2E40A 3ARSA 1Q4NX 1EIBA 2ZIDA 2V3GA 4JFUA 4WSKA 1BVZA 4UFHA 2Z1KA 3MO4A 1N82A 4FK9A 4KGJA 3BSHA 1CGWA 1JDAA 3QHMA 3M46A 1VF8A 3WDIA 3QHNA 3DC0A 4GQRA 2CITA 2WMGA 2DT1A 4MDOA 3K4AA 3WQ6A 4ATLA 3AIWA 2GVYA 4X0VA 1BYCA 2VQUA 2CEQA 3CZKA 3N17A 3ZJ8A 3O2LA 2FDMA 5ABEA 3VVGA 5A8QA 3SCRA 2YLLA 3OLIA 5BXSA 2VURA 1B30A 1H49A 1OM0A 2V38A 2XM1A 3ARQA 3ZT6A 4AD1A 5DF0A 3FXYA 2D3LA 3VM5A 4JL2A 1KWGA 1KXHA 3DYMA 4GXPA 3TA9A 4QP0A 1V3HA 4AD0A 4EK7A 1FH9A 1UKQA 2GDUA 2XWEA 5A8PA 2VJXA 2NW0A 1QI2A 1VFOA 4TVCA 2PB1A 1DWFM 3B9DA 3ZT5A 2QPUA 3ZM8A 1RP9A 3HN3A 1JD7A 3N1AA 4UZUA 2OLHA 1JNDA 1OINA 4GI9A 3ECQA 4HU8A 4HOWA 5CGMA 1HF6A 1A47A 3IAQA 3BAJA 4PMQA 3WNOA 4Z2LA 3B9AA 2D3NA 2VRKA 1ISWA 3VGGA 1TZ7A 1JAEA 3WEOA 3QGVA 5BYWA 1E6ZA 1MQQA 2DDXA 1ZJAA 1EO7A 1BF2A 1JZ7A 3FAWA 3S2CA 5EFDA 1HP5A 1TA3A 2D2OA 1H11A 4GQQA 4MAVA 3W82A 3N18A 2EEXA 3BAYA 3GDBA 4AY1A 1BFNA 4ACZA 2CIPA 2VX7A 2WVSA 4WKHA 1TUXA 1C91A 3J7HA 1CYGA 4GZIA 3WBEA 3VD7A 3BGAA 1NP0A 1JXJA 2VTFA 3WQ8A 1WZMA 3W6MA 1LL7A 3VIIA 1NWSA 2X8RA 3KL3A 1BQCA 2VVSA 2ZX8A 4NRRA 1FHLA 2VZSA 1EQCA 3AS0A 2EXOA 3CUHA 2VT0A 4BQ4A 1EH9A 3UESA 5I2UA 2CERA 1JAKA 4W5UA 3UEQA 3AOFA 4W86A 4W8AA 2QLYA 3AYSA 4W88A
chains in the Genus database with same CATH superfamily
1K8CA 2B7OA 3GKFA 1DTNA 1S2VA 1R3SA 1PE1A 1IXNA 2WB5A 5C8BB 2ZDRA 2QQ6A 3ABXA 2YXGA 4JTUA 3NO5A 1PB0A 3OBKA 1RCOB 1Z32X 3VIGA 4OV9A 2WKLA 3W74A 1K4GA 3TC7A 5HQLA 3BAXA 3WQVA 1F9CA 1D8CA 3F5KA 3UYIA 4AYSA 2EG7A 1JZ3A 1GQKA 3M0JA 1HJXA 1D9EA 4FIRA 4FB7A 2J6XA 2HPIA 2GJXA 4HZ6A 3A4WA 4GVIA 1YADA 1LDCA 2E25A 4HK5A 5DT7A 4RDYA 3A4XA 1OFDA 5D9OA 3OTRA 3WK2A 2OZ3A 2OEJA 8XIAA 3I4EA 4L4OA 5ABFB 1BXNA 3APTA 3IUDA 4KQNA 5AHMA 2WO5A 4XD6A 1BSIA 3OOQA 4UNLA 5FJUA 3ZXWA 4KWVA 3A23A 3ES8A 1J0YA 2E4TA 5D32A 4TV5A 1E1CA 4I9MA 4NY2A 1QAPA 1ME7A 4XG1A 5TQLA 3VXGA 1CTNA 2POTA 3KVKA 2YCLB 3K4DA 4AW7A 1JPMA 4UCGA 3GNOA 1VH7A 4EVZA 2WPBA 1V6YA 3SY1A 3V18A 2WJEA 4ZCWA 3ZVHB 1HJQA 4D6CA 4IT1A 2OO6A 1IZKA 1GGOA 3MJMA 1Q6EA 3NSNA 1QPQA 2ZXAA 3LHZA 3KBJA 1XYFA 5BXPA 3GFYA 1L0PA 2FFCA 3BV7A 1X1OA 4MADA 5RUBA 2HS8A 4JIIX 1H51A 3HPFA 1G0CA 1S3HA 4DZHA 3TMQA 3WNLA 3R0KA 3T8QA 1UP2A 4HN8A 4GZ7A 5JBDA 3CHDA 5BOFA 1XSIA 4TX8A 3TYDA 1JYXA 1N8FA 1S5WA 3T4CA 2QCDA 1QW9A 1UOZA 5AHIA 3AJXA 1YE6A 3MSYA 5DXYA 5BOEA 3LA4A 3WQFA 1QHPA 1W5PA 4QEHA 3QBUA 3BSMA 4QE4A 2WNNA 3BMWA 3W7GA 4EOUA 3G1YA 2WMIA 3UZJA 3VMOA 4GPNA 4PCPA 3LHWA 4YVPA 1CX9A 1Q85A 3LPGA 4Q4RA 1QVBA 4DJDD 5DRCA 1TTPA 4W9TA 5D2XA 2DW6A 5F4SA 1QRQA 1PS9A 4JTJA 4MPQA 4GH3A 1V3JA 4JYEA 4MTVA 3LTSA 1EEPA 3DFOA 1U1UA 1UR3M 4W84A 1IEIA 4ZFMA 1NQ6A 3VGHA 4XO6A 2XIMA 1SZFA 1WKEA 1XD1A 3NZPA 4XV0A 1WB0A 1KWKA 1EL3A 2PDFA 1QK2A 3UJEA 1QOXA 5MHBA 1M9HA 1A5BA 1OK6A 1SW7A 1WXZA 2CWXA 2WNQA 2XH4A 3DH7A 3M0YA 3O6AA 4ZSTA 3H8AA 4P2VA 1CXIA 4B9YA 1GK8A 1N2VA 4BFAA 1RPXA 2DGAA 2JK2A 2H8ZA 4WSHA 3MPGA 2HMCA 4JBRA 1Q2SA 1FKWA 2E0PA 2ACRA 2E68A 5BCAA 4WY0F 4G1KA 3R8GA 2DIKA 4A8IA 3PTKA 1REQA 4HIBA 4MB5A 3PPFA 1J10A 1RSCA 4AD4A 1P0BA 4KEUA 2DEPA 3WN6A 3ZWSA 3MCMA 3W1RA 1S1RA 4DYKA 2LLEA 4IFOA 2CBVA 4Z0SA 3N2MA 4YCOA 2Y62A 4DB7A 1YTDA 3G0XA 4HSHA 3RLGA 2ZICA 2CHOA 1TCDA 2XVGA 2XUCA 4OECA 3KE0A 2YFNA 1F73A 2CZEA 2BGQA 3TJIA 5CPMA 4HHLA 5AC4A 2CZFA 4YWSA 4YL2A 4CD5A 1NFBA 4C1KA 3EX1A 3R79A 2KZHA 4PMXA 4Q4KA 4KT2A 1A5SA 3ARTA 4ZOBA 3PM6A 1VYPX 2A7RA 1WDDA 1RK5A 2QJJA 1ITXA 5AVNA 2ALRA 3AS3A 3STFA 4OJYA 5DANA 3I6RA 3HG5A 8RUCA 1XIMA 2V69A 3W7NA 2QCNA 3TN6A 3DFYA 4J3XA 4XAPA 2CNCA 1VCFA 4N6EA 3M0HA 3B8SA 3B0XA 2G3JA 3P3BA 4S2CA 4JDBA 1FCVA 4GX9A 4LWWA 3VE9A 2WNZA 1GZ1A 4O52A 3CZLA 4IHCA 3W88A 5C54A 2RGLA 3U7BA 3SUWA 2ISDA 1HKJA 4EPBC 3BC9A 3MMDA 2GPTA 5CZ0A 3IJDA 1R46A 4FAMA 3MW7A 1NU5A 3SRKA 1BGAA 3KBWA 2JALA 1YBQB 1UQYA 2OZTA 5D9PA 3TYUA 2EO7A 4NAEB 1B2YA 4F66A 4C7DA 2VHLA 4M51A 1G5AA 4RNJA 5DY2A 1NDZA 3GVRA 4DEFA 1EPVA 2Y6ZA 1K7XA 1TPEA 2HTMA 2IPFA 1QNQA 4H6QA 1Z44A 3COTA 1SPQA 3WUGA 4N02A 2PCEA 3UPBA 2D0FA 3EZ4A 1TCMA 2O56A 1UR0A 3AMGA 3CHCA 5A6JA 1ZJIA 2WBKA 3LEPA 3FOKA 1OZQA 4GUHA 3PN8A 2VX6A 4Y9MA 4H1ZA 1XYCA 1B5TA 1SO6A 2ABAA 1KKOA 3R12A 5A8NA 1VHNA 1EKOA 1PKNA 1J0ZA 1W5MA 4Q32A 3K30A 3UZYA 2WKGA 4QG9A 3D6NA 3LMYA 2HVMA 5BW6A 3W71A 1N8WA 2Q09A 3GDRA 4IICA 4Q3MA 4PUJA 2QF8A 4S23A 4G9PA 2HISA 1GW1A 3N13A 4E4UA 5AYXA 1J11A 3GAYA 3VYLA 1GTHA 4LYKA 1OBAA 3RNDA 3PY2A 4KWOA 3K13A 3BH4A 4N42A 1BGGA 5ABFA 3TFXA 2ZUVA 2AL1A 1I2PA 2VD8A 1EYWA 3N2CA 7PTDA 4XO7A 3T4WA 1QPRA 4UTMA 4HPXA 3PBYA 1XLJA 3O6YX 3U7VA 5A3HA 4U33A 5AHEA 5C71A 5XIAA 1VCVA 4MZ8A 4FNQA 3C52A 4ZE5A 4TR9A 2FH8A 4CN1A 1EDGA 1ZBCA 4OU1A 4YVXA 1REQB 1XDMA 2ZRXA 3H54A 2I1OA 4HMCA 1US0A 4M82A 3KTXA 3ZIZA 3F2DA 7CGTA 2XZ9A 1H0GA 1XL9A 4ONVA 1WDWA 2HSAA 2QAFA 2WMKA 3GG1A 5FEPA 1Q6QA 1IZCA 3CMGA 5G5IA 3TP4A 4GFIA 4E4FA 2MUCA 1BWLA 1XLFA 2O9TA 3TQKA 2CLKA 2ZVRA 1P43A 4N7QA 3E1F1 2VELA 5G2HA 1MMFA 2ZFAA 3BLKA 3WQGA 2WZMA 3ABZA 4LC6A 3NEVA 5J5DA 2JF6A 3LNMA 3S9IA 1TTJA 2DZAA 4AH7A 3L4XA 4PA8A 5AYBA 3CMFA 2NXGA 2O55A 4O1EA 3AMDA 3WMCA 1XPGA 1K9TA 3TYBA 4WOZA 2Z1BA 5D9NA 4JTHA 2RJHA 1E51A 3BLDA 1VJSA 4AX7A 3LRMA 4H04A 3QFWA 3O15A 1DV7A 1DJYA 1QUMA 2CZVA 1HJWA 1XQKA 2V2DA 1OIMA 3W87A 3VOHA 3BMXA 1SSDA 3BURA 5EGRA 1H1YA 7ODCA 1ZPTA 4LUIA 2W66A 4E2DA 3RGTA 4I6VA 4WLCA 2FMOA 8TIMA 2J8TA 3ES7A 1OG0A 4GY0A 3VNYA 1R3WA 1R38A 4HMNA 1HVQA 3HV8A 6TAAA 2R1NA 4CD7A 1POJA 1KCLA 4PR4A 1XXXA 4A05A 5H8MA 2PDNA 4IFRA 2XJ7A 3UETA 3AMKA 4NG3A 1WKYA 3OZMA 5CEWA 3EEGA 4PCFA 4PODA 4NAFB 2XGBA 3PG9A 3R10A 4LS1A 3W7OA 1KFBA 4C5ZA 4ZQPA 2OGYA 3O3RA 4HPHA 1I4NA 1UZ1A 2G3IA 3SB0A 2OLSA 1QNOA 5LIWX 1DVJA 2WM0A 4LAOA 4YTUA 4RZ4A 5CSYA 3H2NA 2IPWA 4FOUA 2CHRA 2W0UA 4HMEA 3H4XA 1SM9A 3R0UA 5A8OA 1IEVA 1BYAA 4JX6A 3I3EA 3QPZA 3TC6A 5E6YA 3UFYA 4DUXA 4CCEA 4PGLA 2GVEA 1TVLA 1ONRA 4GIEA 1SJAA 2FHBA 4JYDA 1DIDA 4FXFA 3BAWA 1CLXA 3QV8A 2VZUA 3P0WA 4AUBA 4N4PA 4US6A 4LYRA 4WOQA 3BCJA 3DG7A 2XIQA 3DGBA 4D6JA 3LOTA 1F2JA 1XLLA 4XZNX 3VDGA 4XZ9A 3SRDA 4HZ8A 4C6QA 4L80A 4GUGA 2AMXA 3REQB 2E3ZA 2ACUA 2AL2A 3WYZA 2X2YA 3HJEA 1TWIA 4GVFA 4UOQA 1M7XA 2GK1B 1TV3A 3B97A 2C1GA 4A8NA 5FJRA 2VDIA 3CZGA 2X7WA 2Y70A 4E3VA 1OYCA 3JZEA 2EQDA 4M6VA 4C1NA 4ZB5A 1KM4A 4CUCA 3AROA 4QE1A 2Z24A 2XSBA 1RVGA 3FN9A 3W83A 4UQCA 3E6EA 1JYWA 3AXMA 1PZ3A 1GNXA 3V7PA 3F4CA 2I16A 3EB4A 1BHGA 2E9BA 3TN4A 1O66A 1PYFA 4YPJA 2VEFA 1A5NC 3MYPA 1TR1A 3SCTA 3AZRA 3ARPA 3MCNA 4M6QA 1XLMA 4B5TA 2B0MA 4G7EA 1XLDA 4RPQA 2G8ZA 3W53A 1R2SA 3QGKC 5J8LA 1FTXA 4M29A 3WLJA 1NIUA 3E02A 4H2CA 3L5MA 5EKYA 4DO5A 3QMTA 2H3DA 2A4AA 2YGYA 3ZLGA 1PIGA 3EDJA 3FXGA 5K2ZA 1MI3A 1SR0A 2OJPA 1ZALA 1UR8A 1QBAA 3DECA 2G3NA 3G8RA 2CHNA 4A21A 2D2GA 1CGYA 3PS7A 3QM3A 3VK5A 4HGXA 2DUZA 1DWHM 1LT7A 2PRMA 4PN2A 4HCLA 2DZWA 2PDLA 1LRTA 2VR5A 3CQIA 4PRRA 1KBKA 4C6BA 1TJ0A 4B4HA 2Y5EA 1S2AA 4MWAE 2ZKMX 5AHNA 3VOJA 1XBVA 2PTZA 2HWGA 3EMZA 1P4CA 4GRSA 4MY1A 4PMZA 4NQ1A 4DF1A 6TIMA 4ZL1A 3R11A 4LUJA 4PUMA 3TZNA 3CIVA 4LALA 3T81A 2PU0A 3T08A 4GYPA 4NNAA 3KP0A 3DFPA 2Y89A 3MY9A 4JCMA 2AOSA 4Y8EA 3LRLA 3MS8A 3EOSA 2G97A 2G95A 5FSEC 1I1XA 4W5ZA 4A29A 3OQ8A 4OV4A 4PBGA 3GDKA 2ZCGA 3B9OA 1G7VA 5JVLA 2BV9A 1DQWA 3SRHA 3UYCA 3SADA 4REQA 4IWWA 1V0NA 4L9YA 4ES4A 3HMJG 2GOUA 1HXJA 4XBSA 3HG4A 3U2OA 3WQOA 3WNKA 1AK5A 4I7WA 3LI1A 5LHEA 3VX1A 2WMHA 4ZQOA 3CPRA 2RAGA 1K8YA 1UP0A 3JS3A 4LVGA 3BQ5A 5LA2A 4Q7BA 4E8DA 4Y7EA 3T8LA 4K3ZA 3RRXA 4TO8A 2V3DA 2ZYFA 4PUNA 1C8YA 1FP8A 3CL8A 4DJEA 4DUOA 1FWSA 3TKFA 4W8LA 1HW6A 1X6LA 4H9UA 3WK3A 3QLDA 1EA9C 3AI0A 1Q13A 2FZ9A 1L8PA 6REQA 5LXXA 4PTMA 1E5JA 2JEQA 4C1LA 8A3HA 1R87A 4X0NA 1M53A 3DERA 3F4DA 4ECLA 3LTYA 3N9SA 3O0FA 1W9DM 2BSLA 3H7RA 4QSFA 3LZ3A 3KEHA 2NQZA 1BKHA 1OC7A 2ISWA 1E0TA 4OZOA 1OFAA 1MFUA 3OJGA 1SFJA 3HQ1A 3QC3A 1V7YA 1IT7A 3EMQA 2VD9A 4AQLA 5A6SA 5HAOA 2I56A 2NQ9A 2XGZA 5IOBA 1BVWA 2W91A 2VZTA 2F2HA 3QQWA 4JIHA 4S1FA 3FDGA 3I6EA 1DL3A 5DELA 1F8IA 4JR5A 4LW7A 5ABTA 2A0NA 1IR2A 1K9DA 3VIFA 3SO7A 3KAOA 4ZFCA 4NAEA 1QFEA 4JFWA 2CW6A 1N8IA 4LYQA 4QLLA 4HCDA 1CI1A 4CQBA 4WJXA 3T9PA 4AISA 4MNJA 3QOMA 1BG4A 5HBFA 5KZ6A 1EOKA 4C6CA 2NLYA 3CL6A 1WX0A 2XVKA 4C6MA 4I8DA 4C60A 4HKPA 3NGFA 2WVUA 1ME9A 4IXXA 4B91A 3KCJA 1GVRA 1KR0A 1W9BM 4GKTA 1ZAIA 3P67A 3WF1A 3GW3A 4EIVA 1DXFA 2J24A 1EF3A 2RDTA 3K2GA 5AC8A 4OKDA 4UTIA 4AZIA 1YYAA 4JKKA 3LLFA 3Q58A 2ONEA 1EZWA 3W4RA 3BE7A 1PVNA 2VCBA 7TAAA 3QQ1A 1CXKA 1IEWA 1K9EA 5I02A 4UOZA 3WH8A 2EF9A 3L5LA 3OG2A 4AWUA 2QCEA 4F40A 1TZZA 4QJ3B 3M7SA 2WHMA 3G22A 1NM9A 3KTCA 4E3TA 2Z25A 3P60A 4H7VA 4MAZA 4O8AA 1EF2A 3BG5A 1TV2A 4UR7A 2REQA 1Q7ZA 3EA2A 4DX3A 1TO3A 1BVNP 4RDZA 2FTPA 2VDGA 3DFHA 1S5NA 3I65A 2NUXA 3MHUA 3N6JA 1FH8A 1K03A 1JGMA 3V16A 2VWTA 2E6FA 3VFLA 4RX0A 4P61A 4LVFA 1IGSA 1VEMA 4XAYA 1GW9A 2I5GA 3BCFA 3II1A 4UQEA 3AO0A 3EWCA 4H8VA 5CPOA 3S9ZA 1RUSA 3BAKA 1FWTA 1BLIA 5C55A 3GR8A 1LRNA 4QHRA 3C0LA 3V3WA 3KFTA 5BROA 2X1RA 1ISZA 3W26A 4PTNA 4RKAA 1XLGA 5IDZA 3QW4B 3R2GA 5I00A 1PZ2A 2OCZA 3FGCA 2QVHA 4W4QA 4HJFA 4MNMA 3NL3A 4NVTA 4FPSA 4QAIA 1VBGA 4NJGA 4JTQA 5GNYA 2A5HA 4UTKA 2I5IA 1UZ4A 2F6XA 9CGTA 1VPYA 1EPXA 4PRTA 2VEIA 4QIUA 1H09A 3CJPA 4NZ5A 1LTDA 1PO9A 2CXEA 5LGXA 4ZEPA 3G1SA 2HBVA 5HULA 3MUIA 1MRQA 2QULA 2GLKA 3NYDA 2VNCA 4C6FA 5CPNA 2PWVA 3KRSA 3T44A 2VCAA 3VX0A 2E8ZA 2I17A 3SCVA 5E1QA 5HNTA 4MLJA 1PTDA 7REQB 3W1UA 1AG1O 4ZXLA 3S9YA 1E3XA 1KM6A 2ZX7A 1Z9AA 1V4YA 3WD4A 2XH7A 5JIPA 4O18A 1W5OA 3BW3A 2ZX5A 3SQMA 3FSUA 3V5OA 3TCSA 4L1XA 5T91A 2PGFA 4PMJA 1KQYA 3QSTA 3U9IA 2JFEX 1K6AA 4JEJA 5G2IA 1OGBA 2PODA 2V63A 3GR4A 5C9WA 4DJED 3WJXA 2Q8LA 3QTPA 5LGZA 4GQGA 3EOEA 1DIEA 1IWBA 1KXTA 4BF5A 1CXLA 4XVEA 3ZR6A 4AZ5A 1DHKA 3RX3A 3HOJA 1TX2A 4FNTA 4Q22A 5GVJA 3RLVA 3EYPA 1H7WA 3CH0A 1L6SA 1V3KA 3EWZA 4ADUA 3QW3A 3WBXA 5CPQA 5IHSA 4DWSD 1XI3A 2J27A 3GHSA 2ISFA 3ITGA 1WBJA 2PUZA 3NL2A 1JJKA 1FXQA 5C70A 3VILA 4IIGA 2C1IA 4UC5A 2WCSA 4OFCA 1IQ8A 1NEYA 3KW3A 1KD0A 5K4ZA 1RALA 2BMBA 1XRFA 3IIXA 2VGIA 4LRSA 4H9TA 4LSBA 4UTWC 3H2AA 5HUOA 4GACA 3LCLA 4A2SA 2FPTA 3OZYA 1KB3A 4MF4A 1PZ0A 2QEZA 2OX1A 5LIUX 2QVNA 3AHVA 3KS6A 1KR1A 2C71A 3B4YA 1QK0A 4ZQNA 3W85A 2C8NA 3SGZA 3NM1A 2F6UA 1BEUA 2F9RA 3CS2A 4WY0B 5KINA 5EU9A 2QJMA 3NTYA 2IQ0A 4FXJA 3SCNA 4F79A 4B5XA 3TLQA 1QU4A 3PTDA 4PULA 1EJVC 4OIFA 1UD3A 1L6WA 2VFGA 1HN1A 1ZU8A 4HP5A 3LD5A 5FCZA 2RUSA 3G18A 1FHUA 2OOGA 3KRBA 4RXGA 5IHRA 1F07A 3HPSA 2AL2B 1Y7VA 5I3JA 1MNSA 7REQA 1JQXA 3VNLA 3GXPA 3LV6A 4QTGA 1QDSA 4XUYA 3OGSA 3VTRA 1V02A 3AS1A 4XZMX 2NQJA 2GGIA 5HJLA 1SZEA 1GONA 2R82A 3AISA 4GCXA 4AD5A 3VD4A 3TN5A 3A22A 1NSJA 4YWIA 1JI1A 1JZ8A 4GY1A 1DJHA 1WXYA 1X1NA 3RMEA 1UIPA 3GU1A 4AYGA 1Y65A 4QS5A 1VIZA 1SW0A 1QPKA 5CCZA 3V75A 2PA6A 2VXNA 1EX5A 3GYCA 3ITYA 4D1JA 4JDYA 4JICA 4UFJA 2G41A 3BJTA 4FP1A 3MUXA 4H8NA 4HNLA 3FNDA 2PDXA 1R8LA 1E6QM 1QO5A 1MUMA 3PJTA 1KXQA 1U2YA 4JKLA 5KMYA 4AD2A 5F4WA 2OQHA 2BBFA 4FLOA 1HVXA 2PGWA 2NV2A 3RR1A 4LVDA 3QVQA 1ADOA 1AQ0A 4R85A 3W1PA 4DO6A 3RMJA 4GE8A 4UTLA 4FF7A 4A35A 1ICSA 4RW3A 3N73A 1VIWA 4XZWA 2FZMA 1Q3NA 1I60A 1F8MA 5A5WA 3W70A 4JFUA 1EIBA 2PLCA 3SM0A 2UV8G 1BVZA 4MHBA 3MO4A 2NWSA 3AYTA 4WDUA 4H9ZA 4RPPA 1G4SA 4JXCA 4UTHA 3BICA 3B8WA 4MDOA 2NUYA 4MY8A 4F0LA 2ZRWA 4RNIA 1H50A 2WJFA 3N17A 3ZJ8A 4X3ZA 5ABEA 4QS6A 3SCRA 1IIHA 3BOLA 4A3RA 4DBDA 3V4BA 1OM0A 3ZT6A 4AD1A 5DF0A 2VR2A 3DENA 3FXYA 5G1YA 3SJNA 1KXHA 4N9EA 4R53A 2E5BA 4DJDA 3TA9A 4L6HA 1A5CA 3IJQA 1SZNA 2GWNA 3R58A 3TIMA 5DMLA 1JUBA 3IJ6A 2Y61A 1U5HA 3G2GA 1FH9A 1UKQA 1MEIA 2YDAA 4JYFA 2NW0A 3TR2A 4TVCA 4Y90A 4S3AA 1RP9A 3HN3A 3N1AA 1JEZA 4NZ1A 1WKDA 1JCJA 4GI9A 1PKLA 1F05A 3MQTA 3IAQA 3TVAA 2GL5A 3W2UA 1TPFA 3WNOA 3U2ZA 1XX1A 5EMJA 4ASTA 1A5LC 2ZTJA 3M5VA 3B9AA 2D3NA 2CZ5A 4KCTA 5ENLA 3UR2A 3VGGA 3UWVA 4Q8QA 1T8QA 1ZJAA 3RFAA 3FAWA 3OP2A 1XLHA 1T5AA 2EEXA 3W7CA 1RQBA 3LCHA 2WVSA 1TUXA 3BPWA 3GDLA 1VZWA 1K1DA 3VKDA 3PPHA 1VP5A 3KL3A 4KCUA 1S2CA 4K8EA 2BZNA 4GYKA 2EXOA 3RRAA 5FJTA 3FIGA 3AOFA 1K8XA 3B05A 4L7ZA 3WLIA 3SR7A 1X7FA 1XUZA 3AYSA 5CC3A 1MO0A 4WF7A 5FJPA 1NQKA 3VD5A 2W67A 3DIPA 4AHOA 2CLOA 1KC7A 1VR6A 4JTRA 3K8KA 3NUKA 3M4HA 3AC0A 3UVIA 3LYEA 1ZNNA 2PWEA 3VCCA 3W25A 4OOUA 2GJXB 3GXDA 3APYA 1C90A 2JEPA 1W3HA 2FYMA 4KETA 5LSMA 1MUWA 3Q37A 5BOOA 1FFRA 4HA3A 1RZMA 1VLIA 3CK5A 3A12A 3UG8A 5CG0A 4BI7A 2VGGA 2V67A 2DSVA 3DEQA 1XUUA 2DSKA 1DJZA 2PS2A 2BFGA 4XIMA 1C7TA 1NH6A 1U5VA 3MI6A 1EIXA 5D30A 4W89A 1FBAA 3C0SA 2V5DA 2BHUA 3VOFA 3W1TA 6ENLA 2Q02A 2C1HA 1P0KA 4LBRA 1BRLA 1E9ZB 1UR2A 1W1TA 4W7WA 1ZCCA 4XUGA 3GWQA 1P5BA 3W84A 3W72A 1KM0A 1WPCA 4B9ZA 1A3XA 2PTDA 4G2DA 1DJWA 1JRBA 4JHMA 3WQWA 1VS1A 4C6EA 2EKCA 2AGKA 1C9WA 2PRHA 1W5QA 1H60A 4ATDA 1AQHA 4X63A 3P5YA 1U5JA 3LBOA 3M5XA 1E73M 2C15A 4MSSA 1BAGA 1TWZA 1F7BA 3D46A 1KCKA 5I03A 2OMAA 7XIMA 4JZ5A 1YBQA 1LOSA 1FUYA 1EJWC 1HQTA 4JQAA 1W8SA 2QDEA 1LOLA 1YPXA 1XC6A 3LTPA 5A6AA 3AWNA 3F4NA 1YW1A 3OVPA 1I75A 2PBOA 3P5ZA 3OVGA 3W1QA 4FS9A 3PWAA 3ZJKA 3RO6A 1W0MA 5CQ1A 4PEKA 1J93A 1W9PA 1FWRA 3VOGA 2J7DA 1XISA 3EX2A 1X98A 2YDQA 2YL5A 2ZZ7A 2X05A 1XDJA 2IUZA 4GH1A 1WNOA 4Q8VA 3GW0A 4LEQA 3NQCA 4MZ1A 4RV3A 1UWUA 2HROA 4KRZA 2CLLA 3MUAA 3CIXA 5FI8A 4B5NA 3GBEA 4IIFA 2J4GA 2Q8XA 5CPTA 5DEZA 1UWSA 5HMFA 3LHTA 4RZ5A 3NQ8A 4H2HA 2NXIA 3VC6A 2NV9A 3EPOA 5C0QA 4HU0A 4N2YA 5FJIA 1JZ6A 3MA8A 4H6RA 5IFTA 5CZKA 2HS6A 4JN7A 4AZBA 1TV4A 2HJPA 2ZZ2A 5CC6A 3BSGA 3DN5A 1VBJA 4Z1BA 3VDBA 1BYDA 1J96A 3BLOA 2GQ3A 1UMLA 4QLKA 1POKA 5D2TA 4U31A 5C2CA 3T78A 4MNKA 1XQLA 1V77A 4TU1A 4KRUA 2Z7KA 2YX0A 3L66A 4NZFA 4HOZA 4WSJA 3CUIA 4ZOEA 4XBKA 2FHFA 3LXAA 3AXXA 1F3XA 1GZJA 3O9NA 3MBDA 4K68A 4NNCA 3A9IA 3ERPA 2ZWZA 1XCXA 2G50A 1XCFA 4UWMA 3CUFA 4DZ5A 1B3VA 3FY1A 2TPSA 1HL9A 3IGHX 1U33A 4AEOA 1EJTC 2J7EA 2V5LA 9XIMA 1XIGA 2VRQA 4WR3A 4S3DA 1QNSA 3OA3A 1YX1A 1QHOA 1JUKA 4HSNA 1JULA 2H90A 1AJ2A 2F61A 1JCNA 1FWWA 2QUMA 3HGJA 2CLPA 3NOYA 3BLFA 3GC4A 4Q4SA 1D8WA 3DI1A 2YSWA 2P10A 4UZSA 1GVFA 2EPHA 4XZHA 3SQLA 3TV8A 3MMUA 1B4KA 4JTCA 2R1KA 3L7RA 2QDGA 3CLWA 2YB1A 4YYCA 2X1IA 3REQA 2AKZA 2RGMA 1T96A 1U83A 3BLEA 3NQVA 3IGUA 4ZTXA 3L67A 3S83A 3I7QA 3WMLA 5FEWA 2G0WA 2ZA1A 1HL8A 5HOSA 2QYGA 4UNIA 4AZGA 1KBJA 1ZP3A 1TPDA 3WUFA 1D7KA 3WD3A 3H4WA 1WQ5A 2WCGA 1UCWA 1QWGA 1M04A 4GGBA 1CWYA 3LENA 4UQBA 3E5BA 3MB9A 5B7ZA 1V0KA 3LCWA 1I0BA 4AX6A 2RFGA 3W1MA 1S3TC 1UBPC 4QG6A 5FL1A 1IR1A 5FJJA 1VJZA 4NNBA 4CNOA 4XD4A 1GYMA 4J3VA 1C7SA 3CT7A 1VRDA 1JUEA 5IFPA 2D69A 1FHDA 1XFBA 4L1WA 5HNNA 4FHAA 3TWBA 2C79A 1TFVA 2PURA 3VGFA 1KFWA 4ROQA 1CB2A 2IQTA 3LCGA 5K9CA 1YXCA 4RLIA 5BXTA 1GEHA 4ZB2A 3BLIA 3WDQA 4U10A 2CYGA 3OO2A 4JN8A 2WPGA 3VAVA 1VFMA 1IE7C 5MF5A 1A49A 3TNBA 3NFUA 5EB8A 3M64A 2E6DA 4NF7A 3IUHA 3G1FA 3AHTA 2YA2A 3WLHA 1UOKA 5JBFA 1J5TA 5AYZA 3VIMA 9RUBA 4JY8A 3VINA 1E72M 1UG6A 3QZEA 4ICNA 4GHRA 1RQHA 4LV4A 2Z2UA 4HPJA 3USZA 2R14A 2WHKA 3CHEA 3G77A 4EE9A 1FP9A 1IXQA 4U2ZA 1RHCA 1G94A 5I0DA 2VOMA 2WVVA 4AZ7A 3VGBA 1LWJA 2DZTA 2FTWA 2DT3A 3QY8A 3AIVA 1UZDA 1UKPA 5D02A 1SU5A 2VC9A 5BU9A 1CW2A 3IRSA 3RO8A 2CXGA 4TOQA 1YLVA 3CUGA 3WJYA 5A6KA 4LF2A 2X41A 3M16A 2AMGA 1H0IA 5GPRA 1J6PA 1VFHA 4MKVA 5DN1A 2V6AA 2DP3A 1H61A 1NWUA 4TVUA 2QGYA 3VOIA 1DYSA 3N04A 2PDHA 4LUTB 3NQ2A 2WJDA 1LUCA 3OVRA 5IRPA 3LPFA 1F61A 3P81A 3BMVA 1OCQA 2EAWA 3OHIA 3NQAA 3M1ZA 4IM4A 1PV8A 3Q4DA 1XLIA 2ZRYA 2TAAA 1T99A 3GVVA 3KLLA 1W1PA 4DIAA 2J75A 3UXKA 3PBWA 4BKNA 2VFFA 2YDRA 1ONWA 4WXZA 4LB4A 1CGTA 2DZBA 4DRSA 1TWDA 2INZA 2HVOA 1O95A 3LM7A 4IFKA 4LS0A 3W7QA 4LH8A 1IYXA 2DZVA 4UB9A 3DHFA 5M03A 2X0HA 3THDA 4O13A 4DBWA 2BGSA 2ZZ4A 3GY1A 3C2RA 5BMWA 3QTGA 4CCDA 3B04A 2JF7A 1KFKA 4QCFA 4LS2A 4DXKA 4URIA 1W9VA 1SVDA 3LN3A 1MDRA 3WF2A 1O1ZA 4W93A 2BS9A 3U48A 3KVMA 1Q5MA 4OOZA 1PX4A 4CNUA 4M8UA 4I9AA 1KV5A 4LT9A 3WD2A 1LM1A 1XIBA 5A69A 2CZDA 3T2QA 4M1RA 3M9YA 3WELA 3ITLA 4H8HA 5I24A 2WLZA 1AUSL 3FHAA 3G6MA 2VEKA 1UH3A 1MW1A 3HQOA 2OSYA 1H1NA 1M1BA 3H70A 1V3LA 1TG7A 1P6CA 1UIOA 1QNVA 2Y7DA 2NLIA 1DIOA 2QKFA 2OFJA 1WZKA 1M3UA 3H6OA 2XDFA 2OYLA 3N2XA 3O1NA 3UXLA 1FWDC 3AICA 1THFD 4WDXA 3MBFA 1MWOA 4R7OA 3RM4A 3U6WA 2IKHA 4YTQA 1P0NA 2V3EA 2ZZ3A 3FFSA 1P0DA 5LNVA 5CJNA 2FVKA 5AHFA 3RPDA 3OLDA 3LGGA 4PCSA 2DPEA 2FZDA 3EWDA 1XSJA 3FDKA 1DP0A 4MMWA 3W28A 2IW0A 1J2BA 1JPKA 2YW3A 1OFBA 3ARZA 4OGZA 1WKFA 4NZCA 2GGGA 4NXKA 3L4ZA 1XLBA 2PDGA 3TZFA 1SMDA 2WOQA 1W8GA 4DQWA 4JTGA 3AMLA 4NX0A 4AZHA 3PVFA 3N9RA 3RCNA 5IDIA 1M68A 3N2TA 2GVGA 1Q45A 3W07A 5C9XA 1RAKA 2UY2A 3TXZA 4PZVA 4HA4A 2EKGA 4J9JA 5G1MA 2O7QA 2VRJA 3ZSSA 4R27A 1OFRA 2NVCA 2V5KA 3VGDA 1HJUA 1UW9A 1WP6A 4PBEA 4QFUA 3VNDA 4BR1A 5E5CA 2GGHA 5DY3A 1SUXA 5CJMA 4B5SA 5HWMA 3TSBA 1RJPA 5ECUA 3VPLA 3GNNA 2OEMA 3CAKA 3URNA 3NO3A 3LHYA 1A5AA 1TIWA 3WH7A 2WW5A 2FDSA 4FNRA 1PKMA 1OEPA 2E77A 1WZAA 1B3WA 3N4EA 3W1XA 2WSYA 4C5YA 3DUGA 1TE6A 1I2OA 3VC5A 1VEPA 1SO4A 1XKJA 2EG8A 1I9CB 1HKVA 1KFCA 1HJVA 4G6CA 5T8GA 5FL0A 2IKIA 4LVBA 1FWIC 1OGSA 1ICPA 2Q3OA 3TX9A 2HE5A 3UGVA 1VFFA 3UWQA 1TPB1 4PH6A 1GYLA 2NT0A 3WF0A 4MKNA 3T0CA 5ABHA 4AC7C 4LRTA 4I90A 5CPLA 1US2A 4AVFA 2ABBA 4US5A 2W9MA 5D2VA 3IIPA 1PYMA 2ZC1A 4NHVA 2C18A 1Y8BA 1ZBWA 3W2MA 3W0KA 2XWDA 5F1VA 4MFDA 4UFKA 2ANUA 1Q6GA 2VVNA 2RH9A 3T40A 4HT3A 3E9AA 2ZVIA 4U3CA 3AAMA 4Z1YA 3SURA 2R6OA 2RHGA 1XYLA 3VNIA 4TV6A 4G5DA 4RDVA 1FWNA 3GG0A 1CGXA 4C6KA 2FB3A 1XG4A 3ARYA 2YB4A 2J47A 4LQ1A 2X0SA 2PP3A 1E6RA 3BOFA 4Y2WA 2VEMA 1OVDA 1LZOA 4F3HA 5BMXA 1GVEA 2PDJA 3GS6A 3S2LA 4XZLX 5K9XA 1QI3A 4DPQA 2QUTA 4HNVA 3WBWA 3K5XA 4EXAA 2QJHA 2XSAA 1GUVA 1V6VA 1H7OA 1UB3A 1W6TA 3EXTA 4HHMA 1NY1A 5AFDA 3AUJA 2XHYA 1LF1A 2BASA 2WZTA 4WQ6A 4L1GA 4K2SA 3CAQA 4GXWA 2BVTA 1PX3A 2ZUWA 1L9WA 4C6PA 2GJRA 1EHNA 3MANA 1JGIA 3DKLA 2EJAA 5A2CA 3LHVA 2DJLA 2OVLA 5HINA 4ZOCA 3AU6A 3MV11 3U5UA 1BTMA 2PP1A 1V6UA 1HFBA 1HT6A 1L6FA 2BVWA 1MVYA 1HKMA 4MNLA 1FOBA 2CBUA 1OHLA 1UZHA 3EOOA 1XLEA 3C8FA 2D73A 3CV6A 3MU7A 4WIWA 2D2HA 2CBJA 3W22A 4P5UA 4QDPA 4ZSUA 3WQEA 1W1ZA 3FHQA 3V0UA 2XYLA 4O12A 2J77A 1G69A 3UT0A 1GVOA 2V30A 5DCDA 2XIIA 1TQJA 3GG8A 4V27A 1JYVA 4KMQA 1DOSA 1GG1A 1C93A 3EWYA 3NXLA 1L2QA 3MSRA 2BY2A 2QXWA 2EBNA 3RITA 4S2BA 3UWWA 3U3HA 3ITCA 4UOJA 2QCGA 1OX6A 3HIJA 5DMYA 1M01A 2BY3A 3WLNA 2XVNA 4JAWA 4RCXA 4GI6A 4C91A 1ALDA 1E9YB 1YMYA 3URQA 3UJRA 3UW6A 4AXNA 3VKKA 4WUIA 1EFZA 2Z1WA 2X09A 3DC8A 2WSRA 3WMSA 3IJIA 4A22A 2GK1A 3NPVA 2POZA 1DPMA 5I3GA 5HMDA 4LAZA 4GY7A 1EDTA 2WSKA 4CKQA 4MWAD 1Q65A 3DGRA 5LNSA 3WJZA 4DI8A 1T6MA 3LXBA 2BHYA 1Q6FA 2Z6JA 4WKFA 1GKPA 4JTEA 3KRZA 2BVYA 1K8ZA 4YLWA 5F1UA 4IGMA 2CLEA 4D6IA 5KZMA 3PZVA 1V3IA 2FVLA 3GD6A 3W29A 4LX4A 4GYJA 3G5EA 4JNYA 3W73A 4WGXA 5B7YA 5HUPA 3NZGA 3VKAA 4ML9A 3WLPA 2QJIA 1GJUA 3AIRA 4A3UA 1YE4A 2J25A 3SUTA 2ZQ0A 1LLOA 2PDCA 3PBVA 4Z1DA 4DNHA 3WBAA 2YW4A 3EOUA 4QLJA 1B4EA 4Z17A 3MKKA 3HQNA 2YZRA 5FAJA 2XSXA 1QATA 4IIDA 3GC5A 3ONCA 5EY5A 2CFFA 1NOWA 3W1AA 4UR9A 3GX9A 1XIFA 3TCEA 1EA0A 1O5QA 4OE7A 4WJ8A 1VEOA 2WC3A 1F6KA 1UD5A 3DCPA 3IK2A 3LLDA 3CZ8A 4J5NA 1XIIA 4S3EA 4B3KA 4BI6A 4I8YA 5F4XA 2BGNE 4JTAA 4PTWA 3OU8A 4NILA 4UNKA 4Y9PA 3P80A 3S46A 2GFTA 4AG0A 3CC1A 1QNRA 2XM2A 4S3KA 3UERA 3L4WA 3VKCA 3BDKA 3GZAA 1QWKA 2G3FA 5KSWA 5J5RA 3IIOA 2X0YA 3A4JA 4C6DA 1XF0A 3QMRA 5GQBA 2QIIA 3DOPA 1VQTA 3ZR5A 4GQBA 2PEVA 3RPTA 4TUFA 4MIMA 4CQCA 4JY9A 1DWAM 3NSMA 4MKSA 4QDMA 3W7KA 3TOYA 4HNTA 1L6GA 3W01A 4F2UA 3MI3A 3VCRA 1I1WA 3Q94A 1KRBC 2PFHA 3NPWA 3VABA 1TRIA 5D33A 2QR6A 4NL1A 3UG5A 2ZRZA 4EANA 5DMNA 4BI5A 4FALA 3AHYA 3QPEA 4DM2A 3GTNA 1PX8A 2GQ8A 5CBIA 1XH2A 2VMFA 3CMJA 4PBFA 3WY1A 4IIBA 5KETA 1OT1A 3SIZA 2XGIA 3UZZA 3FX4A 3LBCA 3B0PA 2Z27A 3NM3A 4CQ9A 4ENLA 4YMZA 1FHVA 1SFLA 3UNTA 3SCWA 4DAIA 3NCOA 4YHGA 3W75A 3H26A 3ABSA 1MDLA 1UASA 1FH7A 2GGJA 1I45A 5FJOA 1W56A 2WWCA 3ZZ1A 1Z48A 4RE2A 3CQJA 1CXEA 3CZJA 3W76A 3WL1A 4QRNA 3PUOA 1ZBVA 1FDZA 1C8VA 1BKSA 2BXZA 1C8XA 3SI9A 5KEZA 1J79A 3N6QA 3Q45A 2RDWA 1E6XM 4IF2A 1CXHA 1JR1A 2PGEA 1CZ1A 1XP3A 2UBPC 3FW6A 2E1WA 3RM9A 3W2KA 1QOQA 3MZNA 2QJNA 1A50A 1G1YA 4XIAA 3ZT7A 4GFSA 2J66A 1K9FA 4RUBA 3G0UA 1M5WA 4LAKA 1WBHA 3C2EA 3CPGA 3VGEA 2B4GA 3V1PA 1UH4A 4JCLA 4H83A 2ZX9A 2ZUSA 1SJDA 1FXPA 1KNWA 4CCCA 2P8BA 1IV8A 4JFTA 4OWGA 2BY1A 3ZWTA 4LANA 4RE4A 1L8NA 4AFYA 1R85A 1ESWA 1HX0A 2VC6A 4EF8A 3SQSA 1OYAA 1F6PA 4JQ2A 4AIOA 2A79A 2ATMA 4GYPC 4QX4A 1KBBA 3UWUA 4HMDA 2W6RA 4UMAA 5A2BA 4PTXA 1JDEA 1FRBA 2FGZA 4AD3A 1ZRQA 4AC1X 1GPFA 4BHYA 3DFQA 4N6FA 3KZSA 1J2WA 1GVIA 2VI0A 2XIJA 3XIMA 4XISA 1RCXB 3M0MA 3QRHA 2OU4A 2D22A 3MSDA 4QEEA 3MMTA 3ZJ6A 5G4EA 3L68A 5PTDA 4C6OA 3CTTA 4AVOA 3A5VA 1EWDA 3QKZA 4XK2A 4D2JA 3UWEA 1UWQA 2BNJA 4B2DD 3D3FA 4EPEC 1UJQA 4G7FA 5AOUA 1PJ9A 4Y9AA 4ZZ9A 3AXIA 3UGRA 4IMCA 1QHZA 4O8RA 3V0TA 3U4AA 3PZ9A 4I5UA 9XIAA 3P62A 2WZEA 4LU0A 2BOEX 4I9TA 4HOXA 4K7VA 3ELFA 1Z41A 2E9LA 2J9ZA 3A24A 1JL8A 1ZS2A 3DYPA 3NYZA 2C91A 4O10A 2GGEA 1IIGA 3R8RA 5A6LA 4J3TA 3WG6A 5C2XA 2VGFA 4ZQCA 1T41A 3ZJ7A 3CASA 1KBIA 3ZS4A 3EWWA 4KEZA 3SDOA 2OKOA 2ACSA 2NSXA 4ICMA 5AB3A 3MCOA 1OC6A 4PMVA 3PJUA 1QBBA 4H7ZA 1V5XA 2ZZ5A 3EDKA 1KXVA 3INPA 3S42A 1E1FA 3NNTA 3S1VA 3LSCA 1K6WA 4L9ZA 1XHGA 3L2LA 1EUNA 4LVAA 1X8CA 3G3MA 1KKRA 1KV8A 1Q8AA 2Y24A 3VCNA 3VUPA 1J12A 5LNRA 3OLGA 1DQXA 1N55A 4RZBA 1FWBC 4EXQA 4I5RA 1UUQA 3GKAA 4ZENA 3LGDA 3SECA 3STCA 3DESA 1KM1A 4KEMA 2HV5A 1Q6OA 3TE9A 2SFPA 1V79A 3EXSA 4BQ2A 5JXQA 1CDGA 4PMRA 4MUPA 2HNEA 1GJWA 3WKZA 2W61A 2H9AB 4E4PA 1FCBA 4ZA0A 1PTAA 1EBGA 1GKRA 1JZ2A 1EC7A 4HPGA 3DYOA 5C7HA 3WFLA 3GDMA 2ZA3A 4EF9A 2QZRA 2CLMA 3WSUA 5DBTA 3SJ3A 4N9CA 2OYMA 3QYSA 3S2NA 1W31A 3Q65A 2JIEA 3UQNA 4X9SA 3A3XA 1B54A 1F4HA 1J18A 2Y0FA 3SY8A 3WK1A 3HV9A 3BW4A 4D71A 4C6NA 1NVMA 3RAOA 1BG9A 4AZCB 5JH1A 2YA1A 1PBGA 4F2TA 4Y8FA 3WFZA 3MVTA 5CZSA 3EBVA 5AYYA 4TX9A 2OPJA 3IACA 2GVJA 2NUWA 2MANA 2Z7GA 3TTSA 2YCKX 3W2NA 3PZGA 3W7PA 3C0QA 2GYIA 4DNMA 1IF2A 3SIMA 1YTEA 1DWJM 1DTUA 3PNZA 3OBEA 2X16A 3WQ4A 1W91A 5CLTA 4JTIA 3UWYA 2FPYA 1EB3A 1YNQA 4UQDA 1WAUA 3CXOA 4D72A 2JGYA 3QN3A 3MWCA 1GOQA 4ILSA 2GUBA 2NX3A 1DJXA 3ARSA 3KUMA 4S3CA 2ZIDA 4WSKA 1FKXA 4YXGA 4UFHA 2Z1KA 4KGJA 4WDTA 1O4UA 3BSHA 3QHMA 1AH4A 4ZO7A 2R94A 3T07A 1L2UA 4D8AA 4GQRA 2CITA 2WMGA 2DT1A 2TSYA 1UPPA 4ATLA 4Y9OA 3QPYA 1BD0A 2GVYA 1ZZMA 3UXAA 2A6NA 3BZJA 2FDMA 3MDWA 2Z28A 1P1XA 3OLIA 3PR2A 5BXSA 2QCFA 1B30A 5HR7A 1H49A 2V38A 3ARQA 1ML1A 1QTWA 3VM5A 5K4XA 1KWGA 2CLIA 3DYMA 4O4WA 3E0VA 3RHGA 4V33A 1V3HA 4KF1A 4HB7A 2DZUA 8XIMA 4H4IA 1HKWA 2GDUA 3S8HA 1ONXA 3R5EA 1Y5VA 1PIIA 2PB1A 2OEKA 4IPJA 2DQWA 1LLWA 1JD7A 4UMCA 3WBYA 2GSHA 4GGHA 1JNDA 2C13A 1OINA 3L5AA 1Z89A 3ECQA 4HOWA 2IQDA 1HF6A 1A3WA 1A47A 1G7UA 1Q8JA 4CNNA 3BAJA 3WFAA 3FYPA 3W1LA 1X8FA 1S1PA 3IUIA 4GIRA 1ISWA 3HPZA 3GQYA 1SGJA 3VZZA 5T9CE 5DBUA 5BYWA 5HANA 1VYRA 4LUYA 2DDXA 2X30A 1XM3A 3W7RA 4Y96A 3KCLA 2YZ5A 1HP5A 1H11A 4GQQA 4MAVA 3W82A 4LBSA 3BAYA 1XBXA 1OF6A 2NSOA 4ACZA 3M43A 4WKHA 3J7HA 3FA5A 1R9YA 1CYGA 2AQOA 1H7NA 4HHHA 4K1WA 2WQDA 1JXJA 2VTFA 3GSMA 4JTFA 4NJHA 3SBFA 3W6MA 1LL7A 4DO7A 3VKJA 3NVDA 1EBHA 1VKFA 2BTMA 3VIIA 1NWSA 4RV8A 5EMUA 4XBJA 2X8RA 3PNUA 2ADAA 1BQCA 2ZX8A 1FHLA 3FGCB 3E0IA 4BQ4A 1EH9A 5I2UA 2CERA 4W5UA 3UEQA 3VFCA 4X2PA 1M65A 5B80A 4W86A 3P0XA 4W8AA 2QLYA 4GBUA 4W88A 1W1IE 4Z2IA 4EPKA 1GQLA 2VCCA 2OQYA 4NSBA 3W7DA 4C65A 1S46A 2BXVA 5IBXA 3UF9A 3S2JA 5CSSA 5F7UA 1ADDA 2I5QA 4F9JA 1QR7A 2Y8VA 1EC8A 4O0ZA 3UXDA 3QC0A 3SGUA 1TVNA 3AHXA 4XVDA 1M7OA 2GQ9A 3CBWA 2HPMA 4P8UA 1RLDA 2Z1XA 1N7KA 3PB2A 4L9XA 1RH9A 4GYFA 1CB7B 4UBPC 1V0LA 4GNJA 1G67A 1GCYA 3C61A 3NWRA 1RV8A 4QXIA 2W79A 2WBGA 3WLSA 2GUYA 3JUGA 1DJNA 3B4UA 3LPPA 4D6HA 3UY8A 3CO8A 2OZ0A 2VZVA 5D03A 4LNYA 2PTXA 1HKKA 1YXYA 5TF0A 1LG2A 4CNPA 3TW9A 4FX8A 2PAJA 3S5YA 3MDUA 4OUIA 3C5QA 3QH2A 1XIDA 4AWSA 4O1DA 3W86A 3P82A 1XLCA 1EJXC 2C19A 2A7NA 3E74A 1WV2A 3CHVA 1XYAA 5GJNA 3SN0A 3WLMA 4FR6A 4O4VA 3H21A 1NJJA 3VDHA 4INFA 3G0SA 1J9YA 4J7RA 4KRTA 3WLLA 1QI4A 4XB3A 3CO4A 1JDCA 3RXZA 1XRTA 1X6NA 4AF0A 1ZJBA 2F38A 1D7FA 4MGGA 4QJ4B 4U5KA 1W1VA 4E6MA 3FEMA 4PRWA 4NI8A 3RCMA 1IT0A 1VAHA 4L5ZA 3CGTA 1WOAA 2HNHA 3I68A 2IKJA 1DE6A 5BRBA 3N19B 2JE8A 2ZUTA 2R1LA 2WMFA 4B2DA 1OFEA 5BNKA 3LQLA 5MKGA 4W7VA 4JIRA 2F84A 3L0GA 2Y1HA 2E1DA 3CL7A 5I79A 2X7VA 2EG6A 3FJ4A 3S1GA 1LL6A 5A6TC 3TYCA 3NR0A 1DJIA 2Z0IA 4K36A 1PZ1A 5G2WA 2WC4A 1AMYA 3BZGA 3LS9A 4KWWA 3HG2A 3NIYA 3QMSA 4DYEA 2KAUC 2QDHA 4ROPA 1ZQ5A 3GH4A 1UQZA 2QS8A 2PWDA 2PDMA 4JD4A 1BWKA 2OG9A 3HF3A 3SCQA 4UFLA 3W3OA 1W54A 3BUVA 2INFA 4R7WA 3E0LA 2WM1A 1W9XA 1KM2A 3VUSA 3O07A 4GD0A 1V08A 1W3NA 2DSWA 2CU0A 2OO0A 1F4AA 1UPMB 1XYZA 2FMNA 1ELSA 4IMFA 3HFYA 4J3SA 3LDVA 4ZXOA 1E1EA 1GOXA 4RK8A 5BWFA 5REQB 3OEXA 4IL2A 4H41A 4HNOA 1QXLA 2QCDB 3ZSTA 1Q6DA 1GQIA 1XGDA 4O14A 4HYWA 4GJIA 4DWSB 1ZB5A 3AYRA 2E5CA 4IQDA 2YFOA 1XFCA 3CM4A 4GK8A 5JUVA 4FNPA 3DHDA 4R5EA 4J2MA 4DJFD 1DIKA 3IS4A 1EP3A 1W9UA 3MKVA 4J3ZA 4QROA 3GH7A 1NF7A 4CD6A 2DT0A 1MYRA 3TA6A 4PTDA 3NQBA 3QYQA 2BOFX 2ON3A 1GHRA 2J7HA 1QJWA 1T0OA 3YPIA 4QE5A 1B90A 4ACYA 3BGGA 4HU4A 4HTYA 3ITVA 3KHJA 3M41A 1XG3A 2W5FA 3HURA 4Q4MA 4QDWA 1J6OA 3ABQA 2X1SA 1LUCB 3EPNA 3MP5A 4PFMA 1BYBA 1XINA 1HKIA 3M6DA 4R9OA 1KA9F 1A5KC 3RX2A 4H8UA 1GOMA 1AL8A 3QR1A 7A3HA 3TAOA 1AMKA 2CWNA 3B40A 1LWHA 3NPXA 4H6KA 3TJXA 4ATWA 1JIBA 1TV5A 3FS2A 3K1DA 4V1XA 4Z1AA 3TU9A 1O1HA 1AJ0A 4J1OA 2A7PA 1B1YA 5TIMA 5HPOA 1SFTA 1AW1A 3N34A 3M07A 1MXSA 2G37A 3A6OA 1UKSA 4YCPA 3KBVA 3ZVHA 2XPKA 3USBA 4LV9A 3PZNA 4U5IA 2L5HA 4AMAA 2Y8KA 5LZLA 4LBUA 2PLKA 3WQCA 3OA5A 1OB0A 1OSEA 4XKYA 3OYZA 6XIAA 1VFUA 3W1NA 1IXPA 4E8CA 5D04C 2FZNA 1ZAHA 1OG6A 5D4YA 2V5BA 2EGZA 1VFLA 2O9OA 4V2XA 4JX5A 5DCBA 3NQ6A 1F76A 3PULA 1RBLA 4WDWA 1TMLA 4GMEA 2DY3A 4M81A 2V5JA 1M6JA 3VOCA 1Q4WA 4GC4A 3I6TA 4GJJA 5HPCA 5KTLA 5M3WA 2VL4A 1RD6A 4NAFA 4HTBA 2Y85A 4MJ4A 4IJRA 4NT0A 4LCRA 2W4XA 1EJRC 4NZ3A 3TQVA 1A5MC 1G4PA 3QY7A 2WVVB 1EJ7L 1ECEA 2EPOA 1YKWA 3BAIA 3CUJA 2NT1A 4ZO6A 4M19A 4TVDA 4QQ3A 2WMIB 3CTLA 2OLAA 2JIWA 2YYUA 2ZBTA 4PCTA 4MWAA 3LX9A 1D2KA 4GO9A 4O16A 3WLKX 3DBPA 4V15A 4L4PA 2PD9A 1J5SA 1BQGA 3W24A 3U0HA 3M7WA 5EMKA 4IMGA 1OFOA 2Y8UA 3T2OA 2PWGA 1Q7MA 2I9EA 1GZGA 4S3FA 1B3OA 3KX6A 1E5NA 2VKZG 3UR7A 4IJCA 2VUNA 2XISA 3TW7A 3GVQA 1E4NA 1KM5A 3FYOA 3KM8A 3CQKA 1GORA 3T0DA 3UA4A 3N3MA 4MJ2A 4A4AA 3UVAA 2XU2A 3GHTA 1VBRA 3QV7A 2WKJA 1UR4A 1UYQA 5DRIA 4KCVA 3HPAA 5T26A 1RA0A 3QR3A 3BLPX 3R94A 3I3DA 3PZIA 2OX4A 4RR4A 4E2BA 2J79A 2YBUA 3HJZA 4Z0JA 5EBUA 3WLRA 1J4EA 2VDHA 5F2GA 4DXXA 1X1ZA 2FLIA 3GU9A 1JD9A 3L2MA 2OWCA 3I7RA 3MWAA 3PJWA 1H5VA 1O7AA 1XWYA 3R89A 3AIEA 3E0WA 1JZ4A 3GTXA 4AIUA 4KCWA 4C1NB 4UFIA 3EWXA 2E09A 4KBXA 3V36A 1SZGA 3RU8X 4LC8A 1HGYA 1H7XA 1UKOA 3A3HA 1XIJA 2D2JA 3ITOA 3OIHA 3GIYA 3WQDA 4RW5A 4F8XA 4KW2A 3GXMA 2WLYA 1W32A 4WK9A 4JNMA 4LUTA 3DXIA 3MYOA 3E0FA 3IJLA 1LL4A 1PCWA 3DU0A 3UZXA 5JQ9A 4R9XA 1RK6A 3V5FA 3C3NA 1SQ7A 4O1FA 3AHZA 2V9DA 3T2PA 2E7FA 1DHPA 3GVGA 3B06A 2J8GA 1RA5A 4GVHA 3PBUA 2J78A 5D05A 1NF0A 3CV7A 3ISIX 1TJ1A 1TE1A 4JIEA 3VIKA 1VLWA 1ODZA 3NZQA 1Q6CA 1BXCA 3AYVA 3T05A 4OHQA 3ICJA 5K7JA 1EP2A 3MP3A 4GIYA 5GJMA 5I07A 4XKYB 3GK0A 4IGNA 1Q7QA 1KRCC 5D9MA 4N9BA 1I2NA 4DLMA 5LA1A 4W7UA 3ALGA 2PLJA 4M1BA 3G1XA 1S39A 1IEXA 3CWOX 4WD0A 3AZSA 3O63A 1X96A 3PZOA 5AC5A 3BV4A 3B9EA 1DORA 3LV5A 4GINA 3S47A 2YDSA 3OGVA 4BQ5A 2UWFA 4CD4A 1VRXA 2A3BA 2ZC8A 1XGEA 2RDUA 3WUEA 3NQEA 4HA1A 3UR5A 2Z1VA 3CEUA 1YXDA 4Z42C 3LM3A 2PU1A 4LF1A 2PMQA 1BSLA 1QO2A 5BU6A 3CIWA 4Q4OA 3OG3A 5I09A 5K3VA 4CNTA 1OC5A 5E93A 3I7SA 1HIZA 4PSPA 4B15A 1O68A 4JN6A 3CWHA 3OODA 4IOTA 3EKZA 4A3QA 1UD4A 3LCXA 4G1NA 3I4KA 2J7BA 1R7OA 3GXIA 1UA3A 3AUOA 3CLMA 1GQNA 1C8QA 1HJSA 1PTGA 3G3DA 2CKSA 4PL1A 1S5TA 2JKAA 1PWLA 5H2ZA 1YHTA 4KIEA 1ADSA 1RP8A 3VIPA 1GWJA 2A3EA 3N14A 3RPMA 1YDOA 3DFNA 4I9JA 3GHUA 4KFPA 3L0NA 2UZ9A 4R88A 4GNVA 3QV6A 4XZBA 4E0CA 2QMJA 5LYRA 1JZ5A 1VB9A 2QHAA 1RR2A 2PWFA 3GFXA 1KCZA 2A1YA 2CKRA 2TMDA 4PMUA 1TV7A 3TTOA 1FWCC 4M6PA 4FX7A 2A3LA 1LLZA 5C9RA 3RR4A 3SCPA 3U8GA 4BS0A 4EWJA 5DX7A 1DJQA 4DYJA 4GI8A 1OD8A 4X61A 5JH2A 4ERIA 4CLMA 5KZEA 3C3UA 2J62A 3SGGA 3H55A 2R8WA 3WX7A 1QT1A 5DCEA 2YBTA 2J7FA 2FH6A 2I57A 4GIAA 1SJCA 1VJIA 3R1ZA 5LIKX 3L0KA 3T09A 3NQFA 4J3UA 2OT1A 1K7FA 2OYKA 4L6DA 5E0FA 2YL6A 4PUEA 3LCFA 3PZMA 4BK9A 1MZHA 1KGUA 3SEPA 3VM7A 4C7GA 2PZ0A 3QZ6A 1NAL1 1WE5A 3VKBA 3ZLHA 1Q66A 4OQVA 4K7YA 3TN3A 3ZO9A 2KX9A 4UQ9A 3U5YA 1XR2A 2OQLA 4UIOA 3VDCA 6PTDA 4I6KA 3P14A 3NDYA 3WEZA 5AHLA 1RY8A 3GM8A 3L9CA 5SWUA 4ZVJA 1GOOA 3AIBA 4H00A 1BTCA 4KS0A 3AALA 4HVXA 4NYYA 3UJSA 4AIEA 4L56A 5CSRA 4AB4A 3GVWA 2ZUMA 1R3RA 1XYBA 1RPKA 4DBUA 1GOWA 1RY0A 3CB3A 5HDRA 1W1A1 1E0XA 2P1FA 3NDZA 5FSDC 2D23A 5E09A 1WUFA 1XIEA 5ECVA 1TIMA 1V93A 4IUGA 3D0CA 1SJBA 1TJPA 1UWIA 3UWZA 1R3QA 3VNKA 3P6LA 2WZHA 5I3FA 3H2CA 4B92A 3ABRA 1Y5WA 4GC3A 4FSAA 2XVLA 1PDYA 1XC4A 2VEGA 4LTSA 2WYSA 2DH2A 2WC7A 3GUGA 5BXRA 3FJNA 3EKGA 5HR6A 4U28A 3GH5A 3W7JA 3RJXA 3UBPC 4W8BA 1G9HA 2Z2BA 3OQEA 1ZAJA 4QGCA 4GG9A 3OZPA 2B7QA 4M3PA 3SRFA 1WOBA 4CVWA 1MW0A 4BCEA 1CLKA 2C7FA 1XICA 2DVXA 4A8RA 1XBZA 1RQEA 3EWUA 1P1MA 3IIVA 1TYGA 3F1QA 1TVPA 2PBGA 2C0AA 3D3AA 1JNEA