1EQPA

Exo-b-(1,3)-glucanase from candida albicans
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAASRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EXO-B-(1,3)-GLUCANASE
publication title Minor structural consequences of alternative CUG codon usage (Ser for Leu) in Candida albicans exoglucanase.
pubmed doi rcsb
total genus 153
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2000-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eqpA00
4MB5A 3CUFA 1E56A 1IV8A 2J7FA 1UD8A 1RP8A 4CN1A 3N11A 5CZKA 2Y8VA 3AS2A 3CMGA 3VDCA 3BGAA 2W62A 4U2ZA 4ZE4A 5IFPA 2XTKA 1ISWA 5M5DA 4CCCA 2BVTA 3WH6A 3OLIA 2QLYA 5KEZA 4XV0A 1QHPA 3AS3A 1HKKA 4ZENA 2YKKA 2E9MA 1JZ2A 2X0HA 3SCUA 3UESA 3WMBA 3UCQA 2WM0A 1LL6A 3SURA 3AMLA 4UZUA 2IUZA 4PSRA 1OT1A 4WLCA 3EDEA 3IJ8A 3WDJA 1AQHA 1K9TA 2CHOA 4HP5A 2J8GA 3NJ3A 5BXPA 3AOFA 1RH9A 1ZS2A 3W25A 4YPJA 5BROA 4RE2A 1E73M 3MMUA 3BXWA 1KQZA 2VVSA 4PMVA 2X05A 4XX6A 4FLOA 1V0MA 3WMCA 1OT2A 2VL4A 4WKHA 1W2VA 4BQ5A 5A94A 3OZOA 4HOXA 3UERA 1UH2A 3WENA 5DT7A 3KZSA 2GSJA 3CUJA 1ZBWA 3GM8A 3VNZA 3ZJ8A 5HNNA 6TAAA 4J28A 1W1TA 2GK1A 1ITXA 4W5ZA 1UWIA 4AD5A 2XVLA 3MMDA 4CGTA 1VFOA 3QGVA 2ZX7A 3WF0A 3AS0A 2DDXA 2J75A 4AISA 2WBGA 4P7LA 4GKLA 1MXDA 3RO8A 3M7SA 4TUFA 5A6LA 4LXFA 1BQCA 1MQPA 1E6XM 1YHTA 1CNVA 2VX5A 2DQXA 4WF7A 3LPPA 4D6DA 2JIWA 2BXZA 3AIWA 4M56A 2TAAA 2A3EA 4ACZA 1HVXA 2RGMA 2JFEX 1EDGA 3RPMA 3ARYA 1W9DM 5JIWA 1QNSA 2CNCA 3GXMA 1H3GA 4MDOA 3VIKA 2DSWA 1X1NA 5A2BA 3VMOA 1B3ZA 5ABGA 3CZKA 1FHLA 3W24A 3A4XA 2W66A 2F8QA 4CVUA 4UFJA 4CU8A 4M24A 1XD1A 1FA2A 2WANA 4P8UA 3AIRA 1WDPA 2WNWA 3WY1A 4P7QA 4UFMA 3N12A 4QDMA 1UD2A 3TOPA 2V3FA 3AIUA 2V3EA 4MB3A 4AZCB 1SR0A 1JL8A 1EO7A 2VZVA 4F8XA 2DH3A 4AZGA 1W3JA 3IK2A 3BMWA 3VGBA 4W7WA 4HMDA 4MADA 4M82A 5E0CA 3W38A 3BCFA 1B31A 4UOZA 1G0CA 2CESA 2XFRA 4GO9A 3TTQA 1B30A 4GI8A 1XGZA 3GZAA 4NI3A 1JFHA 2WWCA 4LGXA 1FOBA 1OD0A 1VFFA 4W93A 4IUGA 4B15A 2ZOXA 1KQYA 3SCOA 4D6JA 3VILA 4CN6A 1ZU8A 4IPNB 4WJXA 4K68A 3LPFA 3EBVA 2FDMA 2D2OA 1W3KA 3RIKA 3T08A 1WO2A 2DT1A 1TFVA 1MW0A 5HOSA 4RL3A 4Z2LA 1XC6A 2GFTA 5A6KA 3ECQA 2FHBA 4UOJA 4MNJA 2WCAA 1OINA 1XSKA 3KEHA 3WH8A 4D6CA 4GO8A 3GH5A 4S3KA 1UZ1A 1W3LA 4ML4A 1OGBA 3ARPA 2FH6A 3VD9A 3SCQA 3ZO9A 1GQLA 4P7OA 4DWSD 3ZSTA 2J7BA 1EOKA 1E70M 1UD3A 1TR1A 4QLKA 1MW1A 3POHA 3GTNA 4P7NA 4M1RA 1MW3A 1ESWA 1HL8A 4E2OA 4UZSA 1V3LA 5JBFA 4D1JA 4AZHA 3NYDA 2VC9A 1VAHA 3D3AA 2ZX9A 5I3DA 5BXRA 3UG3A 1KBBA 1UA7A 1JZ5A 4UR9A 4WK9A 4R5EA 4XUYA 1HP5A 3QHNA 1BVZA 3ZR6A 2OWXA 1QI0A 3W4RA 2QF8A 2YLLA 4N0RA 2WMIA 1DWFM 2C7FA 2D3NA 4CU6A 3K46A 1FH8A 1VBUA 1WDQA 3VX1A 4CVWA 1DWHM 3ARRA 5JIPA 2XPKA 3OB8A 3A6OA 1OCQA 4CCDA 3HMCA 1E6RA 2ZUNA 1HJUA 2VNCA 4KGJA 1HJSA 2E4TA 1C93A 5A8NA 2Y8KA 1W32A 4HOWA 4AZCA 2WVUA 2WK2A 3LPOA 1DEDA 1E40A 4AZBA 1JDCA 5CGTA 1JD9A 4MJ4A 1OIFA 2DSUA 3RCNA 4AC1X 4CD7A 1UZ4A 1NARA 3SCWA 2WZIA 1E0WA 4PMDA 1HL9A 3OBAA 1E6ZA 4AIUA 3VU2A 2UY4A 4ZFMA 3VM7A 3U7BA 1I75A 2FH8A 3K1DA 4PN2A 3WUBA 4MNMA 2ZUSA 3L4ZA 3FAXA 4BF7A 1J0ZA 5GNXA 5CSUA 3HN3A 1CXHA 5F7UA 3VIOA 2WCSA 1U30A 3WUFA 2WAGA 1B1YA 2GJRA 1JNDA 1CECA 1NOFA 1JF6A 3ZOAA 3EMZA 1M03A 1R7OA 1QBAA 3CZ8A 4RE4A 3ZMRA 2GDUA 3SUUA 1C91A 4KMQA 3N1AA 1KBKA 3FNDA 1JAEA 5E0FA 5LA0A 2BHZA 4PCSA 4U2YA 1NP0A 4L4PA 3ZQ9A 3WD2A 2WXDM 2OYMA 1E6NA 4IPLA 3CZJA 4GQQA 5GPRA 1HKIA 3AHZA 2CPUA 2XWEA 4KH2A 4W8AA 4D6HA 4CD8A 4U5IA 2VRJA 2X0YA 2Y5EA 3I3EA 2OWWA 2D22A 1XV8A 3WF3A 3TTOA 1HKMA 5BRPA 1XRVA 4TVUA 2ZUVA 2ZUMA 4MJ2A 4JKLA 2FHCA 1PIGA 3NSMA 1EOMA 3M46A 1UQYA 4HZ8A 3WD0A 4DM1A 4LYPA 3W27A 4WSJA 2UY2A 5BYWA 5A8MA 4V27A 1ZBCA 5HDRA 4AEFA 1BVNP 3VIMA 1V6XA 4EE9A 4TVDA 4DWSC 1LWJA 1J10A 2XYLA 1PZ2A 1E4MM 3K8MA 2GVYA 3WEZA 2XWDA 3MUAA 4DWSB 4MAVA 4OUEA 4KRUA 1JXKA 3AIQA 1I1XA 9CGTA 3WH9A 1LJYA 1GCYA 1CGTA 3SCSA 2D3LA 4JFVA 5CSYA 4H04A 2EEXA 3AS1A 5GNYA 3DYMA 1E4LA 5CLTA 3S6TA 1UR4A 3WN6A 1UD4A 2PWHA 4PMXA 3WBAA 2VCAA 3SCTA 3WFZA 2W5FA 4GQRA 1BG4A 4NRSA 1K9DA 1QVBA 2XGBA 2ZWZA 1MXGA 1E3XA 1E6QM 1TMQA 4UFKA 2V5DA 3T0DA 4PTMA 3AIEA 3KL3A 4W89A 3WQVA 3WL1A 1GJUA 5C8BB 2XGIA 3KWXA 4U3CA 2NT1A 3PTKA 2WVVA 1B0IA 1GQKA 4WSKA 5ABEA 3SUSA 4B9ZA 4UFHA 2FHFA 3ZJKA 3NUKA 1LG2A 1HXJA 5E9AA 3T2OA 3MV01 2V5CA 4UOQA 1R8LA 1RPKA 3WNNA 4GXPA 1ISVA 5FOOA 3AHVA 1NOWA 2ZICA 3OG2A 3CUIA 1CXFA 1E6PA 1HJVA 3GNRA 1NWUA 2DPEA 3IJ7A 2YBUA 3OIHA 4LQ1A 4J3SA 1LLOA 4XB3A 5CPTA 2YL6A 4PUDA 2EPOA 1EHNA 5DF0A 4D6GA 4ZXOA 1W1YA 4LX4A 3SCVA 2CETA 2XSBA 3MANA 4GZEA 3AIBA 4CUCA 2EQDA 2G3JA 2BV9A 2ESCA 1VEOA 4Z2KA 3W26A 2G41A 1A47A 4GZIA 5EBAA 3VDAA 3RM8A 1HJQA 1U33A 3W37A 1F4HA 4TOQA 3AMDA 1UWQA 3B9AA 1MYRA 2EXOA 3VGGA 4QCEA 1WZKA 1FFRA 1CLVA 2PWFA 4URIA 1SMDA 4C7FA 1TE1A 1EA9C 3WELA 4GI6A 1B3VA 4PMZA 1HJXA 3PZQA 1SMAA 1JZ8A 4A4AA 1G94A 4W88A 4YHGA 5HPCA 2XFFA 1LQ0A 3PTMA 5E6YA 2JEPA 3FHAA 4PRWA 4BS0A 5BCAA 1V3KA 4W84A 1JYNA 2W91A 1CTNA 1JI2A 4GPNA 3WQ4A 4R27A 3OGRA 4RE3A 1C7SA 2YDQA 4ZXLA 1US2A 1Y7VA 1Q4NX 3DHPA 1LG1A 1G5AA 1H1NA 1UKSA 2YDSA 5GQBA 3RJYA 1WP6A 3VO0A 4AWEA 2J74A 5A3HA 1WCGA 3VX0A 1Q6GA 2O9OA 4E8DA 2CEQA 4AXNA 4PBGA 1WNOA 2F61A 3ARSA 2WYSA 4AZ6A 2VUYA 3T2QA 4HPGA 1GOMA 3N18A 3VIIA 5BXSA 3RM4A 5CPSA 3VPLA 2VX4A 4OBRA 5C71A 8A3HA 2WMJA 2XVPA 1OBAA 1JG9A 3WSUA 5CQ1A 3WKZA 2J79A 5CLWA 2ZUUA 3RMEA 4PSPA 1NOUA 1KGUA 1JZ4A 1M01A 1BPLB 3WH5A 5A6SA 5A95A 1XH2A 3VMPA 1J9YA 3NIYA 4JL1A 1ECEA 4JFWA 1QI2A 3PZTA 2VQTA 2A3BA 1VIWA 1WB0A 1KCKA 1HP4A 4MTVA 1QNQA 4PYSA 2J25A 2WZHA 1UR8A 4PTVA 3N04A 5C70A 1CWYA 2YA2A 5DT5A 4F79A 1VEPA 2WB5A 2PWEA 4YHEA 3DECA 2PWDA 2XM1A 1UG6A 1XYZA 5GNZA 4TTUA 5EMYA 2PBGA 5I23A 5LYRA 1JI1A 1BYDA 2BHYA 1JF5A 3ARVA 3AZSA 4U3AA 3L4UA 5FL0A 5A8OA 1KR0A 5FKYA 3MU7A 1ODZA 2EPKX 3BMVA 1WZAA 3GYCA 2J7GA 2OSWA 2OLHA 4PMNA 4TTGA 2ZUWA 1CGWA 4MNKA 4QAWA 3RDKA 1QI5A 4WIWA 1GQJA 1FP8A 1BAGA 4OZOA 3WDHA 1KCLA 3U5YA 2IXUA 1V0LA 3EDKA 2J7HA 2DT3A 2YL8A 1WKYA 1EGZA 4BCEA 3AHYA 1RP9A 5CJ5A 4XZWA 5A2CA 3CHFA 2CCRA 1JFXA 4PMYA 3UG5A 3N9KA 1CPUA 3PZGA 3WF4A 3VIJA 4TX8A 1GQIA 1PX4A 4HOZA 1B2YA 4W85A 3WH7A 3L4YA 2E8ZA 2WHJA 1E4NA 3CZGA 1K9FA 2PF0A 3AZTA 4HPHA 1B90A 2VQUA 4JZ5A 1I1WA 1WZMA 1FHDA 1M7XA 4QCFA 1V02E 4FK9A 1EH9A 3GNPA 3VUPA 1AMYA 1KGXA 1V6VA 2OYLA 3E1F1 4UQCA 4P7RA 1WAWA 5D8ZA 1BYBA 3CLWA 2YBTA 3WQ8A 4BQ2A 4J27A 1VJSA 1DP0A 1W91A 3AMCA 1QI4A 1TVPA 3POCA 1M04A 1EXPA 4OOZA 1UKOA 3OGVA 4Z2JA 2WSKA 3AROA 1BSIA 2XHYA 3AYSA 2ZXQA 5BWFA 3CBWA 3WNKA 3CUGA 4OKDA 1ZBVA 3ZR5A 1ISXA 8CGTA 3O9NA 1DWIM 1KFWA 1LL7A 3MS8A 2IXVA 2NSXA 5A6JA 3AYRA 1SFSA 4ZEPA 2Y24A 1KGWA 4EAMA 1FFQA 3W6MA 1E9LA 3CIVA 1GW1A 5D9MA 1JYWA 1OM0A 2QV4A 1OGGA 3BSHA 4W5UA 2J7CA 4BZYA 4MNLA 4DUXA 5DFAA 4UQDA 1UH3A 3CPUA 4AD3A 4UQBA 3NCOA 4B16A 3AMGA 1IZKA 1GJWA 2O92A 1BLIA 1OGSA 5CGMA 1JZ3A 3F5JA 1MWOA 2X09A 4JCMA 5D8WA 3VKKA 4YN5A 2GDVA 1VF8A 2Y2WA 3W0KA 4W8LA 3VINA 2QHAA 1ZJBA 3GBEA 1WPCA 3O2LA 2DGAA 5IHSA 5IXEA 1D3CA 3BSGA 5E6ZA 1ZJAA 4FLSA 1GPFA 1GOIA 1DWJM 2CBUA 3IAPA 4F9DA 2Q8XA 1KB3A 1BYCA 4J3XA 3L4XA 4M81A 3DYPA 2HISA 1W9XA 1VFUA 2J7DA 1V6WA 3ARUA 4ATWA 3T0AA 3N13A 1MQRA 3VNYA 1VEMA 3TA9A 1J0JA 5LA1A 4A3HA 4ZE5A 5E09A 2JIEA 4CCEA 2YA1A 2FGLA 5AC4A 2XG9A 3WNOA 1W1VA 3BAXA 1TCMA 4CU7A 3U57A 4X0NA 4B3LA 1UQZA 4C7DA 3IJ9A 5DMYA 1J0HA 1H41A 2CIPA 1UWSA 4N42A 3PN8A 4UTFA 2UWFA 1HNYA 2WHKA 4PMUA 3T09A 5HBFA 3SUWA 2ZXBA 1DWGM 3FXYA 3ZT6A 4PCTA 4W86A 3THDA 4L4OA 1IT0A 2WCGA 3ARXA 5A6BD 1UA3A 1CLXA 3CO4A 3WNLA 3PZIA 5D4YA 2ZX8A 3WIJA 1QHZA 4BQ4A 4PEEA 2CBVA 5KZ6A 1O6IA 4PMQA 1V3HA 3W81A 4EK7A 4HTYA 3AXIA 3TP4A 2ZE0A 4KWUA 2G8ZA 2DSZA 3VD3A 1KXHA 3EMQA 1PAMA 1W9UA 5JUVA 3KL0A 4PTWA 5I2UA 4QLLA 1GVIA 1VFMA 1O7AA 2EBNA 3CTTA 3CHCA 3DHUA 2WHMA 4C7GA 4Z2HA 7TAAA 1UD6A 3NDYA 4D6IA 1BGGA 2GUYA 1C8YA 3K4DA 2CBJA 4JL2A 4Q7NA 5I0DA 3BC9A 1W9BM 1V0NA 3RILA 3CGTA 4MAZA 5FCZA 1MVYA 4PTXA 1E5NA 4HZ6A 2WMHA 1ZL1A 3MMWA 2J4GA 3VD5A 2EJ1A 2OSXA 4ACYA 3B9EA 5CXPA 2G4FA 1F4AA 1JYVA 2VJXA 2D1ZA 4UNIA 4PUEA 6A3HA 3VD7A 1V3JA 2Y4SA 2CYGA 1UR1A 3VIPA 1S46A 4ATDA 2UY5A 3BAYA 4H2CA 2VVNA 7A3HA 2JE8A 1UOKA 1J11A 4IISA 1UYQA 4MDPA 2J77A 1W1PA 3IANA 1BTCA 4GZJA 4JHZA 2BHUA 2WSPA 4AD0A 3WD4A 3G6MA 3EDFA 3MO4A 1MFVA 2XUCA 2XVNA 2CERA 2G3IA 2O9RA 3MV11 1XH1A 1W3HA 4TXEA 5D9OA 1KWGA 3EMCA 3CHEA 1J01A 2J62A 1IZJA 2D0GA 3SUTA 4CD5A 2VI0A 2CKSA 3CMJA 3VGEA 5E70A 1C7TA 3AQUA 5EFDA 2E8YA 1GUVA 5I6SA 3UG4A 3VD4A 1NP2A 3OLDA 3U5UA 1G9HA 4JIEA 3AXHA 4J3UA 4W7VA 1CGVA 4JFUA 2X1IA 5HPOA 2VOTA 1JAKA 4B9YA 3BH4A 4GINA 1Q6CA 3ALFA 1DWAM 2DIJA 2AOSA 4D6EA 2WLYA 1QOXA 2VMFA 3QHOA 5AC5A 1L0PA 4H41A 3M6DA 2WPGA 3GXFA 4KGLA 1PPIA 1X6LA 3WFLA 1CIUA 4QP0A 3WNPA 3MUZ1 1H49A 2XM2A 1Z32X 4P8XA 3II1A 1W2PA 4AZ7A 3NSXA 4CN4A 1OSEA 3BAIA 4JAWA 2CKRA 3FN9A 3WUGA 3MKKA 2Z1SA 1FP9A 3PHAA 1XHGA 3FY1A 1JDDA 3VGHA 1XCWA 2E9LA 4J3VA 2JF6A 3CUHA 1NWSA 4DWSA 3WL0A 1KWKA 2BS9A 1TUXA 3TONA 1PEZA 1H0IA 1J0IA 2YJQA 1R85A 4OOUA 4X9YA 1CDGA 2J78A 1E3ZA 1E72M 4AD1A 2YL9A 1JZ6A 3LMYA 4J3TA 3TTYA 4Z2IA 3ZSSA 1H4PA 3AXXA 2BFGA 3UETA 3IAQA 2F2HA 1CGXA 1N82A 2B31A 3L2MA 4Q22A 1C8QA 3THCA 2ZX6A 4M29A 2JF7A 2ZWYA 2PB1A 4IM4A 1V02A 3OLEA 1D2KA 1XSJA 2VRKA 3AMKA 2EPNA 5EB8A 4OBSA 2WKLA 1V0KA 3ALGA 5I77A 1CENA 3QOKA 1WE5A 2VX6A 5ABHA 1C90A 5CG0A 3FW6A 1MW2A 1VBRA 1JNEA 1U2YA 3GH7A 3BLKA 1QNOA 1YQ2A 2YLAA 3W28A 2YA0A 3A4WA 1GOOA 4AYSA 1CXIA 2E40A 4FF5A 1E55A 4LPCA 1XYFA 3WDRA 1D7FA 4D72A 1HX0A 2XJ7A 1C3FA 2A3HA 3L2LA 4NZCA 3WD1A 2WMGA 5A8QA 1R87A 4MPKA 2VR5A 1DTUA 1WDSA 1EHAA 3ZT5A 1KR1A 1UKQA 1PZ3A 5TD4A 1W9VA 3GNOA 2EPMX 1MQQA 1B9ZA 2C0HA 3MSDA 1WDRA 3WF2A 1NH6A 2WZEA 2DT0A 4OJYA 3A47A 1BFNA 1E0VA 1UWRA 5ECUA 4A3YA 1J12A 1OWQA 4CD4A 2ZIDA 4F66A 3VDBA 1UKPA 2BY3A 5I24A 4AZ5A 4EANA 2VTFA 3FHQA 5BXTA 1PJ9A 3BLPX 2W92A 4AD4A 4M80A 2ZXAA 2W61A 3VIGA 2QPUA 5FD0A 1J0YA 1OD8A 1QI3A 4U33A 1E6SM 1GOWA 3PZUA 5FIPA 1GORA 2YDRA 2BY2A 3L4VA 2DT2A 3EYPA 5A6BA 1UHVA 1BGAA 1Q6FA 3D5HA 3K8LA 2CBIA 1V03A 3WMSA 5A8PA 2WMIB 3QOMA 4NF7A 1J0KA 3MUIA 4FMVA 3I3DA 4OIFA 1QW9A 2XFYA 2JEQA 1QNRA 1H09A 1H11A 1W9PA 3ZT7A 4AIEA 4Y7EA 4DUVA 1A3HA 2DSKA 3SCNA 1AQ0A 1NWTA 3L4WA 1EQPA 1VB9A 1LL4A 1NWRA 3VMNA 3WD3A 2W67A 1E4IA 1HJWA 2XIIA 2XSAA 2J8FA 1SYTA 4QFUA 3AI0A 3FAWA 4H8HA 3GDBA 5DEZA 1HT6A 4H8VA 3WDIA 1CXLA 3PZVA 3SIMA 3AISA 2OYKA 1E1EA 3CZLA 3AHTA 2WC7A 3T2PA 2WBKA 3ZM8A 1CGUA 3W29A 1B3XA 1UR9A 2VCCA 1BHGA 1V6UA 1E5JA 2WC3A 3F5LA 1AVAA 4MB1A 4CKQA 1JIBA 4NRRA 1VRXA 3EDJA 1JYXA 4JKMA 2UY3A 5LA2A 1ISYA 2GJPA 3UR8A 5FL1A 3PZMA 3VIHA 4MB4A 2QPSA 3RJXA 5M3WA 3WDPP 1QW8A 1M53A 1AQMA 1TA3B 2VRQA 2D0HA 2V38A 2EPLX 4J3WA 2W63A 1J18A 5AYIA 2YOCA 2OSYA 1HF6A 3J7HA 3KL5A 2RGLA 4V2XA 3K4AA 1ZBKA 4U31A 2V3DA 4HMCA 1GOKA 4HA3A 2EO7A 4UQEA 1E43A 4P8VA 2O9TA 3T0BA 2VURA 4WKFA 1OIMA 3AHXA 2MANA 1HIZA 4GI9A 7CGTA 2HVMA 4HU0A 1JD7A 2Z1KA 1UR2A 1H5VA 1WZLA 1GNXA 4H8UA 3M07A 4AD2A 1JDAA 2WHLA 4CD6A 5A6MA 4DUWA 1CEOA 4JFTA 3VIFA 3WDQA 5JBDA 4NSBA 1NM9A 1JGIA 2PI6A 3PZNA 3HJEA 3DYOA 3UEQA 2AMGA 3AIVA 5D9PA 1ITCA 3K8KA 1VJZA 4TX6A 2WC4A 2E0PA 2DSVA 4F9JA 2YIHA 1KXTA 1PIFA 1C92A 2WLZA 1E1FA 2G3NA 4KRTA 4HA4A 2X2YA 3OLGA 1OB0A 2BY1A 4FLRA 3APGA 3ZJ6A 3ARQA 3ARWA 5A2AA 3WF1A 3OGSA 1KXQA 2AAAA 1H2JA 5ABFB 4H7VA 2PBOA 2XVGA 4W7UA 1ZB5A 3A3HA 4X0VA 2WVVB 3WQ5A 5I5RA 1GHSA 5AYBA 3A4AA 1FH9A 5DO8A 1Q6EA 2BY0A 1E15A 4UCFA 3QR3A 2A3AA 4AMCA 5D9NA 1EO5A 5M17A 5M03A 1TG7A 4AW7A 3VOCA 1XCXA 4W87A 1PX3A 2PWGA 2WVSA 3G6LA 1RD6A 3OZPA 3PTQA 1JZ7A 2WMFA 2V3GA 1UD5A 3VM5A 1EDQA 2GJXB 4DM2A 1E0XA 1P6WA 1UKTA 4Z2GA 4W8BA 3ARZA 1TVNA 5IDIA 3BAWA 1XH0A 3NSNA 4UFIA 1EDTA 4GIAA 2J7EA 4QLJA 1LWHA 2VR4A 3WNMA 3S2CA 3WUEA 3AFBA 3U7VA 2WVTA 4TVCA 2PC8A 3QHMA 2ZUTA 3VGFA 1TA3A 2D0FA 4HZ7A 4AZIA 4ATLA 4U5KA 4JCLA 1LF1A 1PBGA 3MSGA 1X6NA 3GXIA 2VCBA 4HU8A 2NW0A 1B3YA 3BCDA 1C8XA 5IFTA 4HMEA 2XIBA 3WEMA 5A6AA 2E9BA 2ZXDA 1ODUA 1E71M 3BAJA 1HKJA 3KE0A 5EFFA 3WQ6A 4BQ3A 3ARTA 2X8RA 1K9EA 3N15A 2YL5A 4AY1A 4J7RA 2BVDA 2WWDA 3WEOA 2WKGA 3OA5A 4S3JA 5I79A 4PMRA 4JHOA 3W82A 3I3BA 6CGTA 3CHDA 1US3A 4LYQA 3AZRA 3JUGA 3DC0A 4PMOA 1QPKA 3EDDA 1K6AA 5I78A 1R7AA 4V28A 3B9DA 4EKJA 3GH4A 2D24A 3SCRA 2NT0A 3SUVA 2QMKA 3CZEA 3SCPA 1BF2A 1GONA 2VZSA 1UWTA 3B8SA 3ZJ7A 1V6YA 3GXDA 3VDHA 3F5KA 3VGDA 2O9PA 3RM9A 1UUQA 3VTRA 1CZ1A 3PZOA 1NQ6A 4XZBA 3F4VA 5BRQA 1V3IA 4WKAA 5CPQA 1CBGA 2E3ZA 2D23A 1QHOA 3GBDA 4D1IA 4D71A 5ABFA 1GHRA 2D20A 1R86A 4P8WA 5A1AA 3CH9A 1CYGA 1HVQA 1UWUA 2VX7A 5IHRA 5JBEA 4JFSA 1MFUA 1CXKA 2CHNA 2A3CA 2CITA 2ZX5A 3VVGA 1V08A 3AICA 2DEPA 4D6FA 4AEEA 3MUY1 2VZUA 4HA1A 2C8NA 5A69A 3AJ7A 4B3KA 1QBBA 2GJXA 1HN1A 3SEPA 3L4TA 1BYAA 1DHKA 2J47A 1L8NA 4E4PA 1GOQA 1XD0A 1XSIA 2JALA 2QMJA 3LPGA 5HXMA 2WMKA 2GK1B 1H0GA 1Q6DA 1CGYA 3HU7A 3WQWA 2W4XA 1TZ7A 2BXYA 1VENA 2FGZA 3WBEA 2DH2A 4E8CA 2VZOA 3NDZA 3TTSA 1UR0A 2VT0A 2WW5A 1EQCA 1EIBA 4BA0A 2XVKA 1BG9A 1KXVA 1JXJA 1GVYA 2DIEA 1GZJA 2CXGA 3BAKA 1ISZA 4UQAA 1G1YA 2G3MA 3W6LA 4ACZB 1CXEA 1V3MA 4LYRA 2OWCA 4UFLA 4UQ9A 3ZIZA 1B3WA 2VZTA 1PX8A 4FLQA 3N17A 3W53A 2VO5A 3PZ9A 3UR7A 4M8UA 4AIOA 3PBGA 3O6AA 2BVYA 4JKKA 1FH7A 1UH4A 2BNJA 1G01A 1QNPA 5AY7A
chains in the Genus database with same CATH superfamily
4MB5A 2NQJA 1E56A 3LCLA 1AL8A 1IV8A 2J7FA 2VDHA 4CN1A 3CHVA 1DQXA 4IICA 3W00A 1XS2A 2OEKA 2W62A 4CCCA 2WQPA 4H3DA 3IS4A 3W7JA 1QHPA 5K9XA 4D2JA 3KDNA 1YTDA 2YKKA 2E9MA 1T99A 4X22A 1QO5A 1AJZA 3UESA 3UCQA 1S3TC 4JQ4A 1TMLA 2XH4A 5F1UA 3KVMA 3NZGA 4IGHA 1J2WA 4XVDA 3U9IA 1K8XA 4CNSA 2QW5A 1LRTA 1VYPX 3JZUA 3BW3A 3LXAA 1IGWA 2A1YA 2YFOA 2H3DA 1RH9A 1BKHA 3CB8A 5H6HA 5BROA 1BWLA 2V30A 3SY5A 4XX6A 3NQCA 1A0EA 1IEVA 1M1BA 1OT2A 1PTAA 4UMAA 3LXBA 4ZZ9A 4REQB 4WKHA 1W2VA 1K03A 4BQ5A 5A94A 3VXGA 3FEQA 1OF8A 5C6MA 3FX4A 5LKYA 3WENA 3NOYA 4IJBA 7PTDA 4NZ3A 3CUJA 3GM8A 3VNZA 4LUIA 1W1TA 5M2FX 4W5ZA 1UWIA 3MHGA 4A35A 4AD5A 1VFOA 2ZX7A 4HSNA 3RO8A 5A6LA 1MDLA 1E6XM 1YHTA 4WF7A 1JCJA 2ZRVA 1OADA 3RPMA 2B0MA 1Q45A 3VNKA 3GU2A 3G1SA 5JIWA 4FNPA 3TN3A 3GXMA 1H3GA 1XLCA 4I9TA 2DSWA 2DZTA 1EJUC 4PUKA 3FA5A 7ODCA 3UWQA 1U1JA 5H8UA 3LK6A 3EWYA 5JH2A 3RRAA 1D3HA 2V2DA 2RDUA 5B7ZA 4DZIA 1XD1A 2ODOA 5KMYA 4P8UA 1W3TA 3GG1A 1W6TA 1H5YA 4DYKA 3UYIA 1I8JA 2G3FA 3NQEA 4S2BA 1EJSC 4MB3A 4B90A 8TIMA 1YE6A 1TZZA 4HNVA 3KBJA 2J9ZA 4OQVA 4AZGA 3BMWA 4Y96A 1DE6A 3VGBA 3DFPA 1OHLA 3ABRA 1EX5A 1IR2A 1B31A 3OA3A 1SZEA 1B30A 3PG8A 3E0IA 1JPDX 2BX7A 1V8EA 4XKMA 2VELA 4B15A 1LROA 1OABA 1TV4A 1T96A 3A5VA 3LCXA 3SCOA 1P43A 3HA1A 3KW3A 3DESA 4JIIX 3VCCA 2FDMA 4GC3A 1UR3M 3W2JA 3W73A 3RIKA 3T08A 1WO2A 2NXHA 5T9CE 1GZGA 1RJPA 1H7WA 3ECQA 3IVSA 1MUWA 5I06A 5D2TA 2Y8UA 1F76A 2IQ0A 4ZFCA 1O4UA 4S3KA 1XLBA 1ZFJA 1UZHA 3ARPA 1MEWA 2FH6A 3N2TA 2FTWA 2QIWA 2XDFA 4MG4A 3BVJA 4GJJA 3LHZA 4DWSD 2PS2A 1V79A 1E70M 3POHA 3UU0A 2ZRWA 1ESWA 3BOFA 2QAFA 4E2OA 4UZSA 3TN5A 3QGAC 4F3HA 4HYWA 4B5NA 3N34A 2BZNA 3TW7A 1O1ZA 1TMHA 2E68A 4RDYA 4AWUA 3QHNA 3E0WA 3P84A 3W4RA 4S3CA 3WLKX 3FDGA 5LSMA 2D3NA 4CU6A 3HJZA 1FH8A 3VX1A 4CVWA 3VCNA 4DXXA 3ARRA 5JIPA 3OB8A 3UR5A 1L2QA 4JS3A 4RZ5A 1W32A 4K1WA 3UWWA 5CGTA 4AC1X 5DLCA 4KWVA 2X7VA 1HW6A 2WZIA 4PMDA 4MYAA 3G8RA 3W1PA 1E9IA 1QWKA 3K2GA 3TYZA 5CG7A 1I75A 3WCZA 4PN2A 4H00A 3W76A 4MOZA 2XIOA 4OTKA 1F3XA 4NJHA 1O5QA 2VEPA 3ABSA 2WCSA 4PH6A 3WUFA 1QNVA 2QT3A 1XBXA 1B1YA 4A3UA 3ZOAA 3R10A 3Q37A 1XLGA 4JYDA 3ZMRA 2A0NA 3SUUA 5CSSA 1C91A 3VABA 3FNDA 1JAEA 4KBXA 3G2GA 4LVGA 2BHZA 4PCSA 3L21A 1NP0A 3EOEA 4AB4A 2HS6A 4IPLA 4GQQA 3AHZA 2ACRA 2WM1A 1ZALA 2XIJA 5HATA 4O16A 4CD8A 5RUBA 2VRJA 2Y5EA 4GACA 2OWWA 4EXAA 2D22A 4S3AA 3WYZA 4F0SA 3IIZA 3WF3A 3TTOA 3KRZA 1HKMA 3KHJA 2A7PA 4MJ2A 3N2CA 4FO4A 3UCDA 3W7CA 1UQYA 4HZ8A 4CCZA 4DM1A 3L0GA 5BYWA 1V7YA 2DIKA 4V27A 2Q8LA 2ZZ4A 5HMEA 1ZZMA 1A5NC 3VIMA 4Y2WA 5LNVA 3SAZA 3K8MA 2VEMA 2V6AA 1GYLA 3WEZA 5C9XA 1XCFA 2RUSA 4NAFA 1G4EA 3N19B 2D3LA 1GTHA 3H7VA 4DPQA 2QCNA 3AS1A 5D03A 4KEMA 3DYMA 3STFA 2Z1XA 5B7YA 5D33A 1YTEA 2PWHA 4PMXA 5I00A 4AC7C 1YTKA 4KFNA 1AFSA 1GVEA 3KL3A 4W89A 4ZL1A 1RPXA 3CIWA 4DZ5A 3QC0A 4KCUA 5C8BB 3KWXA 1FWNA 1PCKA 1W3NA 3PTKA 2R9RA 2Y1HA 1XINA 1A4LA 2INEA 3M0LA 3W2NA 1L6YA 3ITLA 5IBXC 3TLLA 3ZJKA 3GAYA 4GX9A 4QR6A 1HXJA 1DPMA 3S2JA 2DVTA 1RPKA 3ISIX 1ISVA 1NOWA 3SI9A 1Q6LA 1SO6A 1BWKA 4NI8A 2X2GA 1HJVA 1OFPA 3NQ7A 2DPEA 1UJQA 3IJ7A 1GVQA 1KV5A 1BKSA 1FX6A 1GQNA 3BK0A 3S2LA 4XB3A 3UWUA 2YL6A 5DY2A 1W5OA 3KZPA 5DF0A 1A3WA 2XZ9A 2WV8A 4K8GA 3AIBA 3G24A 4CUCA 2EQDA 2PWUA 3C8FA 1LZOA 4EACA 3W26A 1QMLA 4GZIA 3PP7A 4O50A 5EBAA 1F4HA 4TOQA 4IFKB 3SW6A 2VFFA 5LGXA 2EXOA 4Q7BA 2QAPA 1WZKA 2PWFA 5KITA 4URIA 5CZSA 1SMDA 3W22A 3WLLA 2DV0A 3O6YX 3LCIA 3DHDA 3DN5A 4QEEA 1EA9C 3WELA 3BJFA 3CUXA 1B3VA 4R53A 8XIMA 1XP3A 1HJXA 2FYMA 3DGBA 1PTGA 3FJLA 4LCRA 3W7LA 3PZQA 4JNZA 1SMAA 1JZ8A 1OFEA 1RY8A 3STEA 2CLFA 2VUNA 1XKYA 4HKPA 1XICA 5BNKA 2VFEA 2F6XA 4PRWA 4M6UA 3QV9A 4GZ7A 4YMZA 3H26A 2VC7A 3FDKA 3KRSA 4INFA 4W84A 4LS0A 2QUUA 4UXDA 2W91A 4IIFA 2PTYA 4KFPA 4GPNA 5LXEA 2YFNA 1C7SA 1FHVA 4ZXLA 5T9BG 3REQB 3GG8A 1G5AA 1K3UA 1Q66A 1WP6A 3RITA 4UTWC 1PZ1A 3VX0A 4MWAA 2HRWA 5GVJA 1EUAA 1KM4A 2XH0A 1TREA 3H55A 3EB4A 1W1A1 3T2QA 4ZGYA 1GOMA 3T8LA 3N18A 3VIIA 1Q8JA 1L6WA 1EUNA 4B5WA 3RG6A 4E0CA 2QNEA 3OZYA 1JDEA 4PR4A 4DJDD 1AW2A 1WKFA 4K38A 4PZVA 3IEBA 1NOUA 2ISSA 5G2IA 2OMAA 1BPLB 4IIBA 4WD0A 5A95A 4O11A 3DC8A 4JTKA 4FS9A 3IUDA 3NIYA 4JL1A 3ZLHA 1ECEA 1ZP3A 3WFAA 2VQTA 1VIWA 1XLFA 4HYVA 4MTVA 4PYSA 1VPYA 4NHVA 1UR8A 2ACUA 1QPNA 3QSRA 4PTVA 3VFLA 2E28A 4F48A 4F79A 2Q3OA 1WYIA 2WB5A 2PWEA 4MY8A 1GPWA 3A22A 5FF3A 5D32A 3S1WA 1ELSA 5G1YA 1W54A 3ARVA 3L4UA 3MU7A 4N2YA 4X63A 3OVGA 3BMVA 5IM51 3GYCA 1FWWA 4B5UA 4N9DA 3PJTA 4XSMA 3BQ6A 1QI5A 4OZOA 3ZR4A 3QY6A 2QCHA 4O28A 5CPNA 4RPQA 3LTYA 1SO4A 4TO8A 1G7VA 3EDKA 3R11A 2YCLB 2YL8A 3CIXA 1EGZA 1NQKA 1A5SA 3EX3A 3H2OA 3CHFA 4XZWA 4PMYA 3N9KA 4PBFA 3GDKA 3TC6A 4JN6A 1VYSX 3INPA 1EC8A 3W88A 3NQ2A 4M1BA 4QJ1A 1GQIA 4AHQA 4PB3A 4HOZA 3BSMA 4W85A 1KKOA 1SGJA 1JPHA 2RAGA 3OBKA 1KD0A 3CL8A 4HPHA 1G7UA 3GU9A 4L1XA 1M7XA 1J79A 1YNPA 2D2GA 4LNCA 2ZVIA 1V02E 5HUPA 1Y65A 1SJAA 3VUPA 1AMYA 2BLEA 1GKRA 1U5HA 2Y62A 2FDSA 4LY4A 3EA3A 1NIUA 1KRCC 2VGIA 5FSEC 3CPGA 3WLTA 5EGRA 1YIXA 1QI4A 1K8CA 1TVPA 3MSYA 3ZVIA 3KOXA 4ECLA 1UKOA 5AHIA 4US6A 2WSKA 5HULA 3AROA 2G97A 3AYSA 4UMCA 2ZADA 3WNKA 3CUGA 5G2WA 3QV8A 2P10A 3ZR5A 4DPPA 8CGTA 1NTHA 3M0YA 3IUHA 4H4IA 1LL7A 4WY0B 4DELA 4L6OA 2EPHA 2QV4A 2GSHA 3OQEA 3GIQA 4AWTA 3DFYA 4W5UA 1E1CB 2QCMA 4AD3A 1TO3A 3VA8A 3ZYZA 5HJYA 3AMGA 1GJWA 3SFKA 2PDFA 3M7WA 3F5JA 2X09A 2BOEX 5D2XA 2YB4A 1VF8A 4L56A 2DZAA 2QHAA 4E3TA 3R13A 3B0PA 1QATA 4GBDA 4GY7A 1D3CA 5H91A 3UBPC 3L66A 1S2WA 5E6ZA 1Z42A 4FLSA 1KM6A 3C86A 3UY8A 4IQDA 3GVWA 2F38A 1PE1A 3IPWA 3IAPA 3EEGA 4F9DA 5GJPA 4M81A 3RHGA 2ABAA 2J7DA 1V6WA 3ARUA 1F9CA 4LS1A 3CV7A 4ZMGA 3T0AA 2CU0A 1YDYA 3N13A 1MQRA 3FYOA 4PUMA 4GC4A 4GCXA 3VZYA 4MM1A 4QE1A 3F4NA 2JIEA 3G1VA 3UA3A 3BE7A 3R7MA 5AC4A 1VKFA 3TQKA 3WNOA 4H7ZA 1W1VA 2E5CA 3U57A 1XGEA 2Q01A 3WLQA 4NZ1A 4O4WA 2YZRA 4V1YA 4XAFA 2UWFA 1HNYA 4M7SA 4PMUA 3SUWA 2ZXBA 4Q6XA 1FWCC 2NV2A 5T91A 3CPRA 1IT0A 2WCGA 3TN6A 3FOKA 4LTSA 4HJFA 4NVTA 5AVHA 3N4FA 3WNLA 1EGMA 1X7FA 1YEYA 3HG3A 3TYCA 5KZ6A 3SR7A 6PTDA 3AXIA 3C0LA 4HBKA 4LAZA 1V77A 2G8ZA 3SQMA 1KXHA 3EMQA 3QEZA 4G56A 1PAMA 3TOYA 4DO5A 3KL0A 3D46A 1G6CA 4IIHA 5I2UA 2PGEA 3TU9A 4AVOA 1GK8A 1VHCA 3CTTA 4H6EA 3GHTA 1V6TA 2WHMA 3TCSA 4C7GA 3KX6A 4Q7NA 5I0DA 5IOBA 3BC9A 1POJA 3M6YA 3WG6A 3T4WA 3B97A 3OIXA 2ONEA 3USBA 4IGNA 4MUZA 3MMWA 2J4GA 4IL2A 4R9XA 3B9EA 1TPC1 3HIJA 3BLLA 4XO7A 2G4FA 1XI3A 4ZR8A 1RBLA 6A3HA 2QJMA 3VD7A 1V3JA 2Y4SA 1S46A 4ATDA 1IT8A 2F6UA 1PKMA 2Z1WA 2C14A 3C8NA 4MDPA 1M6JA 1M7PA 2QULA 1I2NA 3IANA 3S5OA 1LUCB 1BTCA 1EZ2A 3A21A 4FIQA 4AD0A 3WD4A 2VFGA 3MO4A 1HFBA 2C6QA 1K4GA 3FIGA 3JR2A 4ZOAA 1W5MA 3R0UA 1KWGA 3CHEA 1J01A 3QVQA 2V69A 1IZJA 1T8QA 4CD5A 1HO1A 1RVKA 5EFDA 2E8YA 3QQWA 5I6SA 2HS8A 3QY8A 4K8EA 2ISVA 4Z17A 4GINA 3T6CA 3AJXA 3GR8A 5A8GA 3ALFA 3G1DA 1P0EA 3M0VA 3FJ4A 1RD5A 3RRXA 4ZVJA 2YCKX 3K1GA 1ZHAA 5AC5A 3GXFA 1PPIA 5T8GA 1X6LA 2E25A 3WFLA 1RA5A 3V0TA 3WNPA 4DRSA 4Q8VA 1H49A 3II1A 2ALDA 1SW7A 1QXLA 2YW4A 3V0UA 4M0XA 2SFPA 1C9WA 3HURA 3M1ZA 4CLMA 3H21A 2Z1SA 3S9YA 3QF0A 4J3VA 3B0VC 2JF6A 1KWKA 1TUXA 4I8DA 4ORMA 5LIWX 2JK2A 1JCTA 4CQAA 2XIQA 4JIQA 1KBJA 2OELA 3WQFA 4L9YA 1E72M 1JZ6A 1TWDA 2GGHA 1A49A 1TWWA 3ZSSA 2ZRUA 4Y8FA 1UWAA 1CX9A 1ONRA 1DQUA 2DUXA 2F2HA 3IAQA 4UTTC 2P53A 3P0XA 1UOZA 5B80A 2OODA 3CEPA 3UQNA 1M9HA 1GGOA 3G1AA 2VRKA 2BGNE 4OBSA 3S6DA 1V0KA 1UC4A 1XLMA 1CENA 5I3FA 3GNNA 5CG0A 3NVDA 5LIUX 2EKCA 4MFEA 3FGCB 1J2BA 3W28A 2YA0A 4AY7A 4AYSA 4HZMA 2QDHA 1DIDA 1SPQA 3WDRA 2UV8G 4RNJA 2BOFX 4NZCA 3WD1A 3GB6A 2VR5A 1WDSA 3QW3A 3NQFA 4GXWA 3I7SA 1PZ3A 4V1XA 1MQQA 1YPXA 4JQ3A 1V5XA 3WF2A 2GGEA 4UTLA 4LY8A 3WZ0E 2E5BA 3QPZA 2WZEA 5MHBA 4NJGA 3RLVA 3SB0A 1N8WA 3UWZA 3OHIA 3A47A 4LV9A 4LS2A 1E0VA 1PO9A 5ECUA 1OWQA 4CD4A 4KERA 1UKPA 3LA4A 2R91A 3BUVA 3LDVA 4RR4A 3S1UA 3ABZA 2OQYA 4E4FA 2NVDA 5BXTA 4AD4A 2OZ3A 3B04A 3PY2A 4O18A 5EMJA 4KCVA 1OD8A 1JDFA 3FKRA 4U33A 5XINA 1GOWA 3V1HA 1XYBA 5FIPA 1DJHA 1GORA 2A5HA 2YDRA 3EYPA 4FB7A 1UHVA 3M5VA 1WKEA 4NF7A 4PUJA 4RW3A 2P3ZA 3CQJA 3IJLA 1QW9A 3GQYA 1XG4A 4PL2A 3H2CA 4DJFC 1TUFA 3ZT7A 1W5NA 4DUVA 3O05A 3N9RA 3BG3A 4O1BA 1XIMA 4MMWA 4GK8A 3L4WA 1EQPA 1XFBA 3CL7A 4WHBA 3RXZA 3WD3A 4OE7A 2FMNA 2C79A 1OC6A 1TPDA 3N9SA 2J8FA 4QFUA 3LU2A 3NTYA 1GVOA 3HG4A 1JR1A 4WY0F 2CFFA 3I4EA 3HQOA 3RGTA 4HSOA 4NNAA 3AISA 4O19A 1ML1A 2FVMA 2WC7A 1YNQA 2WNNA 2F9RA 3HBLA 1X6UA 1BXCA 1H62A 4MB1A 1QT1A 4CKQA 2W6RA 3EDJA 1JYXA 4HYRA 4NX0A 5LA2A 1ISYA 4NIRA 4DBSA 5FL1A 4MB4A 5M3WA 1HTIA 3WDPP 1QW8A 3HPZA 5C54A 1LLWA 4GIRA 1WQ5A 4GIYA 5HR6A 4ZODA 1XIEA 3UZYA 1J18A 1JCLA 2OSYA 3AU6A 3QR0A 4V2XA 1R30A 4HMCA 3KP0A 2O9TA 2A85A 2E1WA 3NXLA 4GXMA 3SQLA 2WSQA 1HIZA 3B06A 3S1VA 4GI9A 2EF9A 7CGTA 3MKVA 4B2DD 1F3TA 4NNBA 2X0SA 4US5A 1JUKA 1UR2A 7REQB 1H5VA 1GNXA 5A6MA 1JDAA 3H8AA 4DUWA 2I16A 1W1ZA 3Q67A 3WDQA 4FPSA 2WNQA 1T6MA 2FZBA 2ISWA 1W5QA 3T81A 1JGIA 2PI6A 3R25A 4B5XA 2C1GA 3DYOA 5EL1A 4UR7A 2AMGA 3AIVA 1QCWA 3K8KA 3LN3A 4AYGA 2EG7A 3WLSA 4F9JA 1KXTA 4OV4A 3QTPA 4ADTA 2WLZA 1E1FA 1JQXA 3DG3A 9XIMA 4HNCA 4FLRA 1EGVA 5SWUA 1YXYA 5MKGB 3GHUA 3B0UX 3A23A 4AX7A 3IJ6A 2PBOA 1JUEA 3IIXA 1EL3A 1MUCA 5F2IA 2VFHA 4X0VA 3UZ5A 2BTMA 3KUMA 3A4AA 3PSVA 3QR3A 4ZQPA 3RPTA 5M03A 1PX3A 1B4KA 2PWGA 5D2WA 3G6LA 1RD6A 1EWDA 2WMFA 2V3GA 4DM2A 1EC9A 1OYCA 1XQKA 2DZSA 4W8BA 3ARZA 3NGFA 4F40A 3MT1A 1UZDA 4EIVA 1REQA 3TNOA 1QASA 1X1ZA 4GGHA 4GIAA 2ZDSA 4LF1A 3RN6A 3OOQA 4QLJA 2VR4A 2XU2A 2ISFA 4XTDA 3AFBA 3U7VA 2CLHA 3VGFA 1BD0A 3P8JA 3LNPA 4Q8NA 4U5KA 1MO0A 3LSBA 1LF1A 3LTSA 1AUSL 2A7NA 1X6NA 1OZQA 3P60A 2OZ8A 2LLEA 2VCBA 3BICA 4TQTA 2C91A 4CQBA 3ES8A 5KETA 1JQVA 1C8XA 4M3PA 2E9BA 1E71M 3W1RA 4Z1BA 4ZBCA 3WQ6A 3MZNA 3WLRA 4E8GA 3ARTA 2OEJA 1M5WA 2YL5A 1YADA 3ZFHA 3OA5A 4S3JA 4PMRA 3ANUA 3WMLA 4ROPA 2D2HA 1US3A 3CHDA 3JUGA 3DC0A 1QPKA 4J35A 1LWIA 4HNLA 1R7AA 3SCRA 3SUVA 3SCPA 3KM8A 3PPHA 3VDHA 3VGDA 5K3VA 1DJIA 7ENLA 1CZ1A 1SU5A 4PUUA 1IXOA 1RAKA 3H7UA 3C0QA 1F6PA 2NUYA 2D23A 2V5JA 4MWAC 1TCDA 4QJ4B 2NX1A 1S5TA 1XW8A 2D20A 3VI2A 5A1AA 4KETA 1CYGA 1UWUA 1FWSA 4D8LA 5IHRA 3FK4A 5JBEA 4JFSA 4XAGA 3DDMA 2QGHA 3PFMA 2HROA 2HPMA 1IF2A 3U6WA 2YCEA 2WSRA 4HTBA 2O4QA 3NL2A 3AICA 2DEPA 4HA1A 5A69A 3AJ7A 1QBBA 3TLQA 1HN1A 4QJ5B 1KTNA 3B8IA 3P8IA 1XD0A 2JALA 3HFTA 1WX0A 2GK1B 4LYKA 4NJJA 3NFUA 3DFTA 3G3DA 1TZ7A 2BXYA 4K37A 3S5NA 3WBEA 3EOOA 2HBXA 2DH2A 3NVTA 4XUGA 3TYEA 1O68A 1Z41A 2Z26A 3F1QA 1JXJA 3BAKA 4GUJA 4UQAA 2G3MA 2OWCA 1V3MA 4AVFA 1PX8A 4FLQA 3M47A 1K7XA 1PS9A 2ICSA 3UR7A 4M8UA 4JKKA 3PBGA 3O6AA 1W37A 1PDYA 1XIIA 3E2VA 1XRTA 3U4FA 3CUFA 1E51A 3UPBA 4HPXA 4Q4KA 1EF3A 1UD8A 1VFTA 1A5LC 1RP8A 3N11A 5CZKA 3GLCA 3SGZA 2OO0A 2Z1VA 3BGAA 4IH3A 5C9UA 3W2MA 3B4UA 5K4ZA 2BVTA 1FDYA 1DOSA 3W1TA 3AS3A 1HKKA 1H7OA 1JZ2A 3VKCA 1EF2A 1VLIA 3SCUA 2QF7A 1LL6A 3UJRA 2HQAA 2QEZA 1OT1A 4WLCA 3IJ8A 2HNHA 2CZFA 1K9TA 5F4XA 3N4EA 5AOUA 1LT7A 2J8GA 3EX6A 3D3FA 3M5XA 5TAOA 3G3MA 4WGXA 1ZS2A 3W25A 5E9XA 1VGAA 4YPJA 1Q13A 3LRLA 4RE2A 4PB4A 2X41A 5MF5A 2PA6A 3W70A 3BXWA 4B4FA 5EMLA 1V0MA 3WMCA 1SO3A 1K7FA 2C1IA 2VL4A 4HT3A 1AQFA 1KV8A 4LAKA 3OZOA 3UERA 4DI9A 4Q8TA 2H3BA 4H6KA 5DT7A 4U10A 3LMZA 4E2BA 3O7UA 2FKPA 3R94A 4RDVA 3ZJ8A 4L1GA 3OW1A 1CLKA 2DUZA 5I03A 3MMDA 3GFZA 3AS0A 4LAUA 1KCZA 2WBGA 4P7LA 2NX3A 1P6BA 4TUFA 4LXFA 3VYLA 1OQFA 3NZQA 2OT1A 1S5WA 3T0TA 4D6DA 2WKJA 2JIWA 9XIAA 4LAMA 4M56A 2A3EA 4ACZA 2JFEX 1XPYA 3C0SA 3ARYA 1JCMP 4ZQNA 1QNSA 2HK1A 2XISA 3WBYA 1ADSA 4LEQA 1OK4A 1EJRC 1B3ZA 4Q6JA 3BJTA 3LXCA 4DXKA 5K2ZA 3A4XA 3G22A 4CVUA 2QCGA 4CU8A 1L6SA 4M24A 4RUBA 2WANA 4Q4OA 5JMUA 1WDPA 4GABA 2W3ZA 2WNWA 3MO7A 1Y0EA 1UD2A 1UPMB 2V3FA 3AIUA 2V3EA 1SR0A 1Z44A 1BXBA 2B7PA 5FI8A 2CWXA 2VGFA 1W3JA 1MEHA 3IK2A 4S3FA 2DZWA 1ECQA 3C3UA 4Q4RA 2PUZA 3W38A 3QFEA 1OJXA 4UOZA 2XFRA 1TV8A 3TTQA 3CWNA 1GTEA 3GZAA 1FOBA 3L5AA 4LF2A 1UIOA 4ZB0A 2R6OA 3W85A 1Q6RA 3U0HA 1PKLA 1IHIA 3VILA 1WAUA 1ZU8A 4C65A 1W3KA 4RLIA 1FCBA 5DX7A 4P2VA 3HPFA 5HOSA 4Z2LA 3CL6A 1SSDA 5A6KA 4MWAE 3RF9A 3V0SA 2P76A 4JY8A 4REQA 3LLFA 4KPLA 1UPPA 4C6PA 1R0MA 2QVNA 4HU3A 1NELA 4GI4A 3VFCA 3SCQA 4G1NA 4DF1A 5GJNA 1GQLA 4P7OA 1UD3A 2DY3A 4R3UA 3NQVA 4XBKA 3DERA 3P7YA 3KOFA 1MW3A 3KRUA 3K30A 5JBFA 3HB9A 3CH0A 3ID7A 5M1TA 4AZHA 3ONBA 3NYDA 3IK4A 1VAHA 3T9PA 4TMCA 5F4SA 2ZX9A 3UG3A 4R9OA 2HJPA 2QGYA 1UA7A 4UR9A 1HP5A 2C13A 2Z6IA 4HQVA 1BVZA 3T40A 3TAKA 3ZR6A 3UJFA 2PZNA 2GGJA 2QF8A 4M6QA 2TODA 3TROA 3BV4A 5AC8A 4XO6A 2GVGA 4EF8A 4UTUA 1FVPA 1HJUA 3NEVA 4JY9A 5DXYA 1HJSA 1ME7A 1X8CA 1Q2RA 3LPOA 1EXBA 4AZBA 4GD0A 3GIPA 3RCNA 4CD7A 3VNMA 4HHMA 2UY4A 5DQPA 1IR1A 3SDOA 5EBUA 3VM7A 3U7BA 2ZUSA 2B4GA 3LS9A 3EOSA 3G0UA 3VZZA 5GNXA 3QZAA 3WLNA 3WQEA 4A8RA 1CXHA 5E0KA 4Z08A 3L0NA 2WAGA 2GJRA 5KZMA 3GKFA 1CECA 1JF6A 3ITGA 3A13A 3OVQA 1M03A 1M65A 3I4KA 1SUXA 2H8XA 1NAL1 1DJZA 4Z42C 2GDUA 1JCXA 2QS8A 3QLDA 4MZ1A 5D02A 4JX4A 3W7NA 4AQLA 3N1AA 4JX5A 1LP6A 1KBKA 2IQDA 2PDYA 5LHFA 3GU1A 2Z4GA 3EOLA 2QDDA 3ATYA 3WD2A 1DXIA 2HBVA 2OYMA 1I2RA 5GPRA 1HKIA 2CPUA 2XWEA 1KLYA 5CJNA 1TVLA 4QG9A 4CNTA 1XV8A 2B7NA 1O66A 5BRPA 1EZWA 1TJ0A 1XRVA 3M44A 2JKPA 4EPBC 4KW2A 3SGUA 4LYPA 1IYXA 4WSJA 1TR9A 5A8MA 4DUOA 4M6VA 3BANA 5HDRA 1A5OC 4EE9A 4TVDA 2HSAA 4R33A 1LWJA 4HSHA 1VBJA 2ZZ6A 1E4MM 2CW6A 4MAVA 3AIQA 2P0IA 5LIKX 1EPVA 5BOEA 3EX4A 1Q3NA 5CSYA 4GYPA 1D8WA 1T8XA 4H9YA 3BWWA 1OZMA 4IF2A 1E4LA 3GXPA 1ZCCA 3WN6A 3LUTA 4F0LA 3LHVA 2ZTJA 4LANA 4AXKA 2VCAA 1UROA 4MFDA 4QHRA 4HNNA 2YPIA 3WFZA 4GQRA 1BG4A 4NRSA 4ERAA 1WXYA 1O12A 1E3XA 1TMQA 4UFKA 3VCRA 4PTMA 2QUMA 3OVPA 4GQGA 4B91A 2XGIA 4JIRA 1JJKA 2WVVA 2FPVA 2C1HA 4NZFA 3HG2A 4B9ZA 1KFBA 3O3RA 4UFHA 2VYOA 2FHFA 3NUKA 1LG2A 1YXCA 2V68A 4UOQA 3UWVA 1R8LA 3WNNA 3W7RA 5FOOA 1FCVA 1MZRA 3AHVA 3OG2A 2J6XA 3SN1A 3WLMA 3GNRA 4GE8A 3NNTA 2YBUA 1W8SA 1FDJA 5AZ0A 4P61A 2FTPA 4AU0A 4ZOEA 3W84A 4CQDA 4PUDA 2XZ7A 4G1KA 1EHNA 4GJIA 2GGIA 1ONWA 3SCVA 1JCNA 2CETA 5DMMA 3UF9A 4GZEA 3QBUA 2PDHA 3UZWA 2ESCA 2FTYA 4LFYA 4GNJA 2G41A 1EIXA 1MNSA 2DJLA 1QPRA 4QAIA 3RM8A 3BO9A 1WKDA 3KFTA 1MYRA 3C2VA 3TJ4A 4QCEA 3CV1A 4G2DA 3EAUA 1QRQA 4FXJA 3M16A 1QDSA 3NYZA 2O55A 1UJPA 1J96A 3LLXA 5H2ZA 3LI0A 2BB0A 4GH3A 4ZTYA 3DENA 2C19A 3THAA 2XFFA 1LQ0A 4IMAA 5HNRA 3OZMA 4NJIA 4AVNA 1V3KA 2RH9A 3BOLA 3QKEA 1JI2A 3TC3A 3CV2A 3WQ4A 4G6CA 3YPIA 4R27A 3OGRA 3WJZA 1EP1A 1UCWA 5EU9A 2QCLA 3PBVA 3TH6A 4S3GA 4C6KA 4AWEA 1TSIA 3URQA 3ITXA 4E8DA 4A8NA 4EF9A 3ANVA 2FFCA 3ARSA 4AZ6A 4DI8A 3PTDA 5BXSA 1FWDC 3RX2A 4JDYA 3NM3A 4OBRA 5C71A 3GHRA 5ABTA 4EXQA 4I9JA 4MKVA 1JG9A 2DVUA 4QG8A 3WSUA 4C6IA 2J79A 4PSPA 1TJPA 3KS5A 4IP5A 2FFIA 2OLAA 3LY0A 5A6SA 1YPFA 1XH2A 2VC5A 3CNYA 3H6OA 1J9YA 1TB3A 3IRDA 2POZA 1DBTA 2OKTA 3EX2A 1VRDA 3GZ3A 1AW1A 1WXZA 2A3BA 2XH2A 3GVVA 4H9MA 2OTDA 4RNFA 1QNQA 5TBOA 5TQLA 4EX4A 1B3OA 3N6HA 4IFKA 2VP8A 2ZA2A 1BRLB 4ZA0A 2Y0FA 1UG6A 5GNZA 3PWIA 5I23A 2INZA 5LYRA 1A5MC 5D2YA 1BYDA 2PDBA 4A05A 4E38A 4KS0A 5FKYA 3ITVA 1RA0A 1WZAA 2J7GA 2VDGA 5KZDA 2Y7EA 1X7IA 3LBMA 1CGWA 4HHLA 2ZTKA 1P0KA 3R43A 1KCXA 5K9DA 4C6OA 2X42A 3QTGA 3TSMA 1IWAA 1A5KC 3EGJA 2IXUA 1V0LA 4XTIA 2J7HA 1WKYA 3RR1A 3KHDA 4BR1A 5A2CA 4Z1CA 4GY1A 3CWOX 3CQKA 4WJ8A 3W71A 6REQB 2REQB 5E93A 4IIEA 4OUIA 3PZGA 3WF4A 1PTDA 1OEPA 4TX8A 1RCQA 2NSOA 4IPIA 4AHOA 2NVAA 4UTWA 3WH7A 2E8ZA 1E4NA 3CZGA 2PF0A 4JZ5A 3IV8A 3TQ0A 1KFJA 3AU2A 4LVAA 4FK9A 1EH9A 4PC8A 3AWNA 1GEQA 3R2GA 3WBXA 3P5ZA 3LQLA 1KM0A 4MF4A 5HK4A 3GNXA 3CLWA 2PZ0A 1F3WA 1IGSA 1VJSA 5C2GA 1DP0A 1X8FA 2WJZA 3BZJA 4KCWA 3POCA 3W1NA 3BG9A 1EXPA 4OOZA 4Z2JA 1DTNA 4GYKA 1M3UA 4DEFA 2ZXQA 3FSTA 5BWFA 4OKDA 1XRFA 1TIMA 4EWND 3CAKA 4DBWA 2WOQA 3Q94A 1PDZA 2X40A 3S4TA 4JTIA 1DWIM 5K4XA 3MS8A 1KRAC 4GGBA 5A6JA 3ZS4A 3AYRA 3NQMA 4ZEPA 4EAMA 1FFQA 1GW1A 1JYWA 3A9IA 3R1ZA 3MUCA 4J9JA 3MW7A 3BSHA 2DZVA 1R2SA 4MNLA 3NO5A 4UQDA 2PU1A 1Q7MA 3KLKA 3EWCA 3GSMA 4I9MA 4B16A 1OVDA 5BU9A 2GVEA 3O06A 4RV8A 1JZ3A 3CB3A 4ADUA 4YN5A 2GDVA 2Y2WA 4PB5A 2CLOA 4H19A 4PGLA 1GEHA 1ZJBA 3GBEA 1WPCA 1SVDA 1XLHA 3QC3A 3DI1A 4BY3A 4QX4A 1SZRA 3NXFA 1GOIA 4CQ9A 2YCLA 1EPXA 1BYCA 4XAYA 3DYPA 2HISA 1W9XA 2VFDA 1MDRA 3U4AA 1EWEA 1J8VA 2AQVA 1HQTA 2XGZA 3TA9A 4PFHA 4HHPA 3U48A 1TV5A 3RU8X 3GUWA 3FFSA 3PPGA 3FKKA 4HIBA 3AYVA 2FGLA 3W9ZA 3HGRA 4KEZA 1HO4A 5HANA 3BAXA 2B81A 5HMSA 4C7DA 2YYTA 1J0HA 1H41A 2CIPA 4UTFA 3PN8A 3PAJA 4TIMA 1ZQ5A 1XLLA 1R9YA 5L6UA 3T09A 3NZPA 1FXQA 1DWGM 3ZT6A 2E09A 4KEUA 4PCTA 3THDA 2I57A 4L4OA 3ARXA 3H2AA 2QCCA 1CLXA 1R3WA 4JTHA 3CO4A 3PZIA 4A21A 2ZX8A 3WIJA 4DYEA 1QHZA 1MMFA 3LZ3A 4IG2B 2CLLA 3OYZA 1IEIA 3W1QA 4NYUA 1O6IA 3RNDA 2PLMA 4PMQA 1V3HA 2OCZA 5AHNA 3C5QA 4EK7A 1LRQA 1R5YA 1KO0A 3NO1A 3TP4A 4FNRA 2G50A 3VD3A 2G4JA 4WY0A 4CNNA 5HMDA 4NJKA 1HZYA 5JUVA 5JVLA 1E0TA 3TJIA 5F2MA 4PCNA 4M7TA 3BURA 2EBNA 3CHCA 1XIFA 3H2FA 1WOBA 1RSCA 1E1CA 1LDCA 4Z2HA 3W87A 7TAAA 1UD6A 3RCMA 2GUYA 2CBJA 3DBNA 4JL2A 4JICA 3S8HA 4PTXA 1TX2A 4HZ6A 2FPTA 2NV1A 4C6MA 4QSHA 4W4QA 3UP8A 1W3IA 3G0SA 1ZAJA 1DXFA 1XLEA 1IQ8A 4ACYA 3V1PA 3DFOA 1F4AA 3STGA 2D1ZA 2Y85A 2A6LA 4JTFA 2CYGA 4NXSA 1UR1A 3VIPA 3XIMA 3BAYA 1RK5A 5KZEA 2VVNA 2ATSA 1VCGA 2JE8A 1UOKA 3MKCA 1F6YA 1UYQA 3EWZA 2ALRA 3W7DA 2RHGA 2C15A 4WQ6A 2J27A 4ROQA 2CERA 5DBTA 2O9RA 4RXGA 2HV5A 1XH1A 2OVLA 1W3HA 3TJLA 1ZAIA 2NZLA 3GTFA 3EMCA 5G5IA 2DZUA 1Y5WA 2D0GA 4QBXA 3SUTA 5BMXA 3CMJA 3RX4A 3AQUA 1GUVA 3HQ1A 3IGUA 1DJGA 5KINA 1AODA 1VJIA 3W7HA 1G9HA 4J3UA 2OT0A 5C55A 5AB3A 5CPOA 3WJWA 5HQEA 1DWAM 3W1AA 1F8IA 4D6EA 1FWRA 1OFOA 2FJKA 1QOXA 2VMFA 2Z2UA 4H41A 1GKPA 3M6DA 2WPGA 1YBQB 1VP5A 4KGLA 4YS1A 1A53A 4QP0A 3PR2A 3MUZ1 1LTDA 1KBLA 3BGGA 4P8XA 3MC5A 4Z1YA 2F7FA 4DJFD 4Q33A 3BAIA 3WUGA 1IWBA 3C2OA 1YXDA 4J40A 1XHGA 3TYAA 3ZLFA 1A5UA 1F6KA 3CUHA 5DBUA 4MZYA 1L6FA 5G4EA 1XR2A 1D8CA 1XLKA 2FZ9A 3BZGA 1R85A 5JXQA 1CDGA 1GG0A 3KOZA 4J3TA 3TTYA 1KFKA 3R8GA 1H4PA 3AXXA 3W2UA 1B54A 3UETA 1KTCA 3M5ZA 2B31A 1VFLA 5GJMA 5BZAA 4WSHA 4NY2A 4R7WA 3L2MA 2X1RA 1LCOA 4Q22A 4OV9A 3THCA 4L80A 1UASA 3TKFA 2JF7A 4WXZA 3CWHA 3G18A 4QS5A 4FAMA 1XSJA 4XG1A 5EB8A 1XYCA 4QNWA 1YKWA 4GCAA 1LUCA 4LWWA 1WE5A 4JEJA 1C90A 1S1PA 1MW2A 1JNEA 1U2YA 2V67A 4Y9PA 3BLKA 3TYDA 1XLIA 1OYBA 3URAA 1CXIA 1W56A 1S1RA 1FWJC 4LPCA 1US0A 3APTA 1XYFA 4D72A 2Z2AA 5TIMA 3LM7A 2V81A 1OY0A 3OVRA 4LBRA 5A8QA 4MPKA 1R87A 1DTUA 1R3YA 1KR1A 1IXQA 1OFQA 1LRNA 3MSDA 4S39A 4OJYA 1XUZA 4FI4A 2HEJA 4J2PA 3KRBA 1BSLA 4EXBA 1B9BA 1J12A 3VDBA 3EX1A 2Y61A 4IQJA 4AZ5A 3FHQA 2I9EA 3WX7A 4ICMA 4LUTB 4GUFA 2PDGA 2ZXAA 1EB3A 4Y8EA 5H8MA 3L5LA 4ONVA 3HM7A 2BP1A 2I5QA 1GOXA 5DRIA 1G4SA 1NDVA 2BY2A 1TTIA 5K9CA 4RZBA 1Q6FA 4MLJA 4YWIA 2CBIA 3WMSA 3G5EA 5TNVA 3QPYA 4FMVA 3I3DA 2XFYA 5DCDA 4JYEA 4JXCA 1QNRA 1MXSA 5FAJA 4TV5A 2TMDA 1W9PA 5J5RA 3QLLA 3BLEA 3N25A 3UZZA 1S2TA 4Y7EA 1A3HA 3G1YA 3M0IA 4ZO8A 2YB1A 5FEXA 1NWTA 2V5BA 1R46A 1E0UA 1LL4A 4JTSA 1NWRA 1E4IA 4TU1A 4UTTA 2RJGA 5FEWA 2XIIA 1UP3A 3NL6A 3CS2A 3QQ1A 5DEZA 3WDIA 3PZVA 1TV2A 4U4MA 4XVEA 4XZIA 1E1EA 3G1FA 3FA4A 3T2PA 2WBKA 3ZM8A 2VCCA 4WDUA 4GLEA 4DWDA 1V6UA 4DJEC 4HCHA 2Z2BA 1XYAA 3FGCA 4NRRA 4MPQA 2QXWA 3W7QA 1VRXA 2UY3A 3EXSA 2GJPA 1XBYA 2QPSA 4A8IA 4UTMA 4OT7A 1AQMA 3LBCA 2BG5A 1TA3B 4GX8A 2GDQA 2VRQA 4K7VA 3ZVHB 1XKJA 2D0HA 4J3WA 4ALDA 3FEMA 2OOFA 3UD6A 3GW0A 1CI1A 1W8GA 5HR7A 3OEXA 5FEPA 1HF6A 1A5CA 3J7HA 2RGLA 1TWIA 3SJNA 4DJDC 3EB3A 1Y5VA 3K4AA 3TWAA 4HA3A 4P8VA 2QUNA 1CT5A 2IKJA 3CU2A 1OIMA 3AHXA 3H2EA 4IZGA 2MANA 3PBUA 1R3QA 1MSSA 1DJNA 4NX5A 3UWEA 2HVMA 3T55A 1JD7A 3F4CA 1VR6A 1Z89A 4Q8PA 2OB3A 4AD2A 4H8UA 4CD6A 1VD6A 3VNLA 3S9ZA 3HO8A 4JFTA 1YNYA 5JBDA 3W7EA 3GTHA 4GYPC 4J4KA 1EJTC 4NSBA 4C6JA 1IXNA 4F0MA 2F84A 3A3XA 3PZNA 4MWAD 3UEQA 2OOGA 1K6WA 2J24A 1ITCA 4JTJA 1JRCA 2WC4A 2E0PA 2ZYFA 2Y70A 3UXDA 1C92A 2G3NA 3NPWA 3N2MA 3ITYA 1QOQA 2X2YA 2PMQA 3KTXA 1OB0A 4DJFA 2BY1A 3ZJ6A 3ARQA 3ARWA 5A2AA 3WF1A 3BW2A 2AAAA 1H2JA 4LB3A 4YLWA 5AC6A 3JU2A 4IMDA 4ZO6A 3COTA 4MZ8A 3A3HA 3CM4A 2WVVB 1QUMA 4BF5A 5I5RA 5DO8A 2KZHA 1Q6EA 3WQCA 2E6DA 4BFAA 5HAOA 5CJMA 1QK2A 4K2SA 4YL2A 5D9NA 4Y9NA 4AMCA 1KW1A 1TTPA 1TG7A 2FB3A 2J8TA 1XCXA 3VOCA 2WVSA 4FXSA 3PTQA 1JZ7A 3C6CA 3UNTA 3VM5A 4B4HA 1FWGC 3M43A 3VE9A 3E38A 4GFIA 4Z2GA 1LOQA 4TR9A 4C1NB 5IDIA 4H8NA 3BAWA 5U7SA 4UFIA 2A6NA 2PWVA 3LGDA 4YTTA 1E9YB 1FWEC 1Z7AA 4ENLA 1BQGA 4AX6A 3MHFA 1EEPA 3S2CA 4ZSTA 2WVTA 4S3BA 2PC8A 3QHMA 3HZ3A 1VYRA 1KBIA 4AZIA 5FSDC 3D47A 1PBGA 4IT1A 2NUWA 3S2NA 3DBPA 2NW0A 4UMBA 3TW9A 1B3YA 5C2CA 2AQOA 5IFTA 3QQ0A 3WEMA 1A5AA 2WZTA 4FSAA 2ISDA 3KVKA 1G4TA 1ZLPA 7REQA 2Y6ZA 3CLMA 3I6EA 1XX1A 4Z1DA 2GZXA 5LXXA 2WWDA 3NL5A 4LYQA 3AZRA 3KAOA 1K6AA 3N6JA 4IX0A 1F8MA 4JEQA 4H7CA 4MJZA 3W75A 2QMKA 3B40A 1GONA 2VZSA 3CASA 1UB3A 1ZPTA 1UWTA 3IACA 1V6YA 3F5KA 3AXMA 3PF3A 1UUQA 5BRQA 3VUSA 2WZMA 3BG5A 1V3IA 3DU0A 2FMOA 1QHOA 3GBDA 3ZZ1A 3O63A 4D1IA 3QSTA 4FR6A 4DY1A 5MKGA 3PNZA 4PRRA 1R86A 3P93A 4KCTA 3S0CA 4DNMA 3G1XA 1RCOB 4ZQCA 3SFWA 4L5ZA 4WVXA 1F3EA 4WUIA 2BODX 4D6FA 5EYWA 2B7OA 3WBWA 4PODA 4YTQA 4C5ZA 4B3KA 1DHPA 3L4TA 3PBYA 4G7FA 2J47A 2XH7A 1XSIA 3QN3A 5HXMA 3EA2A 2WMKA 3HU7A 2IKHA 3EKLA 5I3HA 2IPWA 3D0CA 1I60A 2Y89A 4C1LA 2DORA 3GTXA 2VT0A 2WW5A 3MPGA 1S2CA 4KESA 1EQCA 2W9MA 3KDOA 1YYAA 1ISZA 3W7KA 1G1YA 3GIYA 1VBHA 4UFLA 3SY1A 5G4WA 3AYTA 5FF7A 3W53A 4IHCA 1Z9AA 2O56A 1PKYA 3L0KA 4AIOA 4PCPA 1UH4A 1FCUA 2X30A 1OX6A 5AHEA 4OECA 2FIQA 2FZ8A 2E5DA 3H54A 1XLDA 3R8HA 3T0CA 3ABXA 3DIPA 4IGSA 3VDCA 3AS2A 4L61A 1TTJA 3Q45A 4IWWA 1ZCOA 3NDOA 2VEFA 1B5TA 2HNEA 1OK6A 3N2OA 3ZXWA 3OLIA 2P88A 4XV0A 2FB2A 4DB7A 3QV7A 4ZENA 3NG3A 3WMBA 3TAOA 2WM0A 3EPNA 4FOKA 4O53A 3MCOA 3TE9A 3IJDA 2CZVA 2OGJA 4UZUA 4PSRA 2ZRZA 2L5HA 1QW7A 3PB0A 1L6GA 3F2BA 3TSDA 1XFCA 3S42A 4QNEA 4HP5A 5EMKA 2NLIA 3NJ3A 5D04C 5BXPA 1S5MA 4IQEA 4LALA 1T5AA 1E73M 1DXEA 2QJIA 3MMUA 3B9OA 3E02A 2VVSA 3HG5A 1XPGA 3G0XA 3PBMA 5JU6A 1F61A 2XINA 3H70A 3LNMA 4QE4A 3UXIA 2OG9A 3R12A 2DZPA 4JDBA 3NURA 1UH2A 4HN8A 4KIRA 2GSJA 1YX1A 2IS7A 4XZ9A 3UZJA 1XIJA 3CT2A 5EY5A 5HNNA 1KFEA 4J28A 2GK1A 1ITXA 1R38A 2XVLA 3WF0A 4L1WA 2DDXA 2R1KA 2J75A 1UW9A 3NAVA 4GKLA 2CZ5A 1MXDA 2H9AB 4K7YA 3OYXA 1MQPA 4PTNA 1CNVA 2VX5A 2DQXA 1V93A 3E96A 3P62A 3PAOA 2BXZA 5CSRA 3WQGA 3PJUA 1Z69A 1HVXA 3P6LA 3URNA 4DQWA 4BWLA 1TJ1A 3EWXA 1DORA 4QROA 3LHUA 3W3OA 4KWSA 1X1NA 5A2BA 3JZEA 4NU7A 3VMOA 3HQNA 3JVAA 3CZKA 1FHLA 2W66A 2F8QA 2VEGA 2IW0A 4UFJA 1G69A 1FA2A 4O14A 2NXGA 4LSBA 3M0HA 3KBSA 2EG6A 5CPMA 3M0ZA 3H24A 1FWBC 4AZCB 4BJHA 2Y63A 3UGVA 1EO7A 1DYSA 1KM3A 2VZVA 5FJRA 1ADOA 3GWQA 3N6QA 3I6TA 4W7WA 4HMDA 4N4QA 3S5YA 5E0CA 3BCFA 3T1GA 2CESA 1TV3A 1IIHA 3IIVA 4I5UA 4GI8A 1XGZA 4NI3A 4FF7A 3T05A 1XRSA 1OD0A 3IGHX 4YCOA 1VFFA 4XK2A 5DELA 1O5XA 4W93A 2QIIA 4Q8WA 3MY9A 2ZOXA 5DANA 3UFYA 2INFA 4D6JA 2V2CA 3DHFA 1UC5A 1GYMA 4IPNB 4WJXA 3FA3A 3MWAA 3EBVA 1TPFA 2D2OA 4GA8A 3QRHA 4PE8A 2FHBA 4MNJA 2WCAA 2Z27A 2GVJA 1OINA 1XSKA 3KEHA 1BXNA 3UGRA 4PUWA 4ML4A 1SSGA 3O16A 1OGBA 2PF8A 3O15A 1KTBA 4Y90A 1BF6A 3GK0A 3KTCA 2PTZA 3MSRA 1EOKA 1R9ZA 1NDYA 1MW1A 3STPA 4P7NA 2GL5A 4M1RA 2BDQA 4ILSA 1HL8A 5HJXA 4DBEA 5DMLA 4ORIA 1V3LA 4IXXA 4D1JA 3U3HA 1OFRA 2VC9A 1JPMA 5CAHA 2BGQA 3THQA 1KBBA 3GR4A 4R5EA 5D30A 2ZRYA 2QJGA 4NAEB 1QI0A 1Q4WA 5TF0A 3UJSA 3P3BA 2IKIA 4ML9A 4N0RA 2WMIA 1DWFM 2C7FA 1LOSA 1LBLA 3E3HA 3M4HA 4JQ2A 1WDQA 1S2AA 2XPKA 4GH1A 3A6OA 4CCDA 3H4XA 1E6RA 2Q71A 2VNCA 4KWOA 1ZJIA 4FNQA 2VHLA 3SN0A 1XGDA 1JDCA 3CUZA 3S83A 1E0WA 1DIEA 3W2KA 3KOWA 3OBAA 3VU2A 2NLYA 3P82A 3LCGA 2F6KA 3L4ZA 3FAXA 4C90A 3RO6A 4BF7A 2AGTA 1J0ZA 5CSUA 3HN3A 4GMEA 1PCWA 1U30A 1IIGA 3NOEA 3G77A 2ZA3A 1OF6A 2HXUA 1I0BA 4UTKA 1R7OA 3CZ8A 1M7OA 4RE4A 4XZNX 1RJQA 4KMQA 3C61A 3B3DA 1W1B1 5E0FA 3NQAA 1TJRA 2QQ6A 2Z28A 1HG3A 4L4PA 2WXDM 3E2RA 4DF0A 1K4HA 1P1MA 3B8VA 3CTLA 3CZJA 3KBMA 5HUOA 4D6HA 4U5IA 2X0YA 4QJ3B 3IUIA 3I3EA 3AALA 2HK0A 1U83A 3LHTA 2ZUVA 3W74A 2ZUMA 1OYAA 2FHCA 1PIGA 3TXZA 3PWAA 2H6RA 4JIHA 3QR1A 1EOMA 4MJMA 2UY2A 1ZBCA 2F2KA 4AEFA 4RK8A 2VXNA 2BASA 1V6XA 3VOHA 1FDZA 3SBFA 1J10A 2YXXA 2XYLA 1PZ2A 3KP1A 3GXNA 2GVYA 3F03K 2XWDA 4JNYA 5AYYA 3RR4A 1I1XA 5LZLA 3NL3A 1LJYA 1CGTA 4EP8C 4GNKB 3SCSA 4JFVA 2GQ8A 5LNSA 1XLJA 4JQ1A 4H04A 1K8ZA 2EEXA 4LVBA 5GNYA 5CLTA 2BWGA 3NQ6A 5H1WA 3S6TA 1R2TA 1UD4A 3WBAA 3SCTA 1LBFA 2A4AA 4HA0A 2W5FA 2ZWZA 2XGBA 3T78A 1E6QM 5U4NA 3T0DA 1P0NA 3WQVA 3R5EA 5FF4A 4U3CA 2NT1A 3HF3A 2G5WA 1OFAA 3N14A 1B0IA 4JPGA 3L2IA 4B92A 4WSKA 2Y88A 3TUUA 3C2FA 1F5ZA 1SM9A 2J9YA 4JN8A 5E9AA 3T2OA 2AL1A 1DIKA 4GXPA 5FACA 3MP5A 1R3SA 4UCGA 3CUIA 2V63A 4Q4QA 3LCFA 5K7JA 4UNKA 4QISA 4HB7A 1EC7A 1FWFC 2G96A 4J3SA 1LLOA 5CPTA 4UIOA 1B4EA 1M68A 3P80A 4LUSB 4US5D 4FP1A 2P0OA 3WQPA 1GKQA 4ZXOA 4LX4A 2ZQ0A 2NWRA 2UBPC 4K6AA 3MANA 3UJ2A 5CBIA 2BV9A 4GHRA 1VEOA 4Z2KA 4RKAA 3QMTA 2GJLA 4L7ZA 1KC7A 1TTQA 3I68A 3VDAA 1HJQA 1U33A 5DXXA 4CQCA 3AMDA 1UWQA 3B9AA 3B8TA 1X39A 3OP2A 1EEXA 2R8WA 1LQAA 1UBPC 2O7SA 3MP4A 3AUJA 4DIAA 3N3TA 5AHMA 1F2JA 1IZCA 5FEZA 3EWUA 4MKNA 2PDWA 1TX0A 2W0UA 3ME3A 2W27A 3G1RA 4M6PA 1OX5A 4PEKA 4A4AA 2NQ9A 4W88A 1J5TA 4YHGA 5HPCA 1I45A 4G9PA 3PTMA 5E6YA 2FVLA 2Z00A 3UA4A 3IIPA 1VCVA 4WOQA 1WOAA 5DN1A 1QWGA 1JYNA 4N9EA 1A0DA 1CTNA 1GJPA 5C5YA 2YDQA 1US2A 1Q4NX 4NKCA 1K70A 3CMFA 1H1NA 3GDRA 3RJYA 2Y5SA 3UJEA 3F4DA 2J74A 1D7KA 2E77A 2O9OA 3W83A 3KWSA 4AXNA 4PBGA 3ONCA 1WNOA 4NL1A 3GYEA 1EYEA 2VUYA 3WJYA 1OCNA 4LBSA 4O52A 4AUBA 4HPGA 5HINA 2HE5A 3RU6A 1RK6A 3LRMA 3W23A 2WMJA 3PUOA 5D38A 1OBAA 3IRSA 4O13A 2FPYA 4KF1A 4JIPA 3WKZA 2NQHA 4RDWA 5CLWA 3RMEA 4UTIA 3N4AA 3MQTA 4OU1A 4OHQA 3GVRA 1U1UA 1S2VA 4DZHA 3AXKA 4GJ1A 1NDWA 2O0TA 4LUJA 3E0VA 1KCKA 1HP4A 3NM1A 5BU6A 4LT9A 2MUCA 1RZMA 3E6EA 4M5PA 2J25A 4AF0B 3PFRA 4J1OA 2AL2B 3N04A 4TX9A 1CWYA 2YA2A 5C70A 5KTLA 1I4NA 3A3WA 1PZ0A 1VEPA 1ZNNA 4BF9A 1JCYA 1KNWA 4YHEA 3DECA 2Q09A 2XM1A 1XYZA 5IDZA 4TTUA 5EMYA 2PBGA 4GYFA 1JF5A 3V7PA 2GVLA 3O0FA 1KR0A 2GWGA 2HPIA 2EPKX 2QCEA 5I3GA 4TTGA 3TX9A 4MNKA 3GG7A 8XIAA 1GQJA 1BVWA 1KCLA 2ATMA 3UNDA 1H7XA 4GIEA 4POCA 1PYMA 4G7EB 2DT3A 2X1TA 2OZ0A 4Q32A 1RP9A 5CJ5A 2CCRA 1KLZA 2V2HA 3WQDA 1CPUA 3NZ1A 1O60A 3LHWA 4J5NA 2C71A 3VIJA 1PX4A 1C29A 4IMCA 3V3WA 3E9AA 4I7WA 3PJWA 2E67A 3HTWA 3W1LA 3AZTA 3GO2A 3PUDA 3FXGA 2PP3A 4CNOA 2VEKA 4QCFA 1PYFA 1EJXC 4GFSA 1N7KA 3TC7A 1KGXA 3VK5A 3UG8A 4DX3A 1IEXA 3VE7A 1NFGA 2CLMA 6XIMA 4Q3MA 4UQCA 2HWGA 3GAKA 3W01A 1Y8BA 3S47A 4UR8A 5CEWA 1WAWA 5D8ZA 5T26A 3F7JA 1BYBA 2IPFA 4BQ2A 4LEFA 3ITTA 4BEUA 1F05A 2EKGA 3AMCA 2TRSA 3R8RA 3GC2A 1HGYA 3OGVA 5DMNA 1PV8A 1ZBVA 1ZY9A 4C91A 4A22A 1KFWA 4JTLA 3D6NA 3T44A 2IXVA 2Q6ZA 2NSXA 1W0MA 4O12A 1SFSA 3QW4B 1E9LA 3CIVA 4O57A 4A2SA 1BRLA 4WOZA 1X98A 4JGDA 1UH3A 3T8QA 3GVGA 4JTUA 1GYNA 5CC3A 1IZKA 2O92A 5CGMA 3ES7A 2EJAA 3GHSA 4KKXA 1SW0A 4JCMA 5D8WA 2QJNA 3PPCA 3W0KA 4W8LA 3VINA 3TQVA 3GUGA 2DGAA 1WUEA 3NPXA 3WJXA 1XDJA 1R3TA 2FZDA 3ZLGA 3BSGA 1ZJAA 3MDWA 1UP2A 3PK7A 2P50A 2ANUA 2Q8XA 2BGSA 4J3XA 4N02A 1VFUA 3LOTA 5AN7A 4ATWA 1GG1A 4XZMX 3AC0A 4F0KA 6REQA 3EB2A 2REQA 3HGOA 3VNYA 4S1FA 3DEQA 4MLRA 2RKXA 2GQ9A 4ZE5A 4CCEA 4H9UA 2YA1A 3S3GA 1Y5XA 2BBFA 1LBMA 4LVFA 1UQZA 3HFYA 1R47A 3IJ9A 5DMYA 2R24A 4N42A 3WK0A 1LM1A 5IRPA 2WHKA 2PDXA 3FYPA 4LOCA 3AO0A 2PDIA 4XQ6A 1EJWC 4W86A 2BMBA 2XN1A 1NDZA 5A6BD 3DFQA 5HWNA 3TQPA 3MZ2A 1PHWA 1VBGA 4JBRA 4FX7A 1ICPA 3ZWSA 4BQ4A 4PEEA 3FJNA 4PL1A 3NR0A 1HKVA 2FZMA 4B3ZA 3S5SA 9RUBA 3R4IA 3APYA 3W81A 2JBMA 3UXLA 2AMXA 4O0ZA 4NP7A 1G4PA 2ZE0A 3BL3A 2DSZA 1W9UA 2MNRA 4RJEA 4Y9OA 1VFMA 3IVUA 3MA8A 3UWYA 4BHYA 3DHUA 4D6IA 2PPGA 2ZZ1A 1W9BM 1V0NA 4NXKA 1PWLA 3CGTA 5FCZA 1MVYA 3TA6A 2PAJA 4I5XA 4HK7A 2OO6A 4WX2A 2WMHA 3KOYA 4IJRA 1R2RA 3CJPA 1ZL1A 2CWNA 3HOJA 1RALA 4H9XA 4QQ3A 4K8HA 1JULA 2Q02A 3LB0A 2EJ1A 4F2BA 1U22A 2OSXA 3EZ4A 4FXFA 4DVOA 4PUEA 1I9CB 1Q5MA 1H7PA 3MJMA 4EPEC 3FSUA 1ONXA