1EQPA

Exo-b-(1,3)-glucanase from candida albicans
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
394
structure length
394
Chain Sequence
b'AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAASRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-B-(1,3)-GLUCANASE
molecule tags Hydrolase
publication title Minor structural consequences of alternative CUG codon usage (Ser for Leu) in Candida albicans exoglucanase.
pubmed doi rcsb
total genus 153
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2000-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eqpA00
1DWGM 4CD7A 3AHTA 1XSIA 3EDEA 4Z2GA 5AC4A 2CKSA 4WK9A 3LPGA 1BHGA 4LYQA 4AIOA 4AZ7A 3ARXA 4D6DA 2ZXBA 1UKPA 2A3HA 5KZ6A 2QPUA 3W82A 2J62A 1Q6CA 3UCQA 2JEQA 3OBAA 3WD2A 4A3YA 4ATLA 4U5IA 1CBGA 2E9MA 2DGAA 2RGMA 1GQIA 3JUGA 3TA9A 5GNZA 3PZNA 1QNSA 2ESCA 2O9TA 5D9MA 4CKQA 5A6SA 3NSNA 1V3IA 1A3HA 2WNWA 1QI5A 2XFFA 3GXIA 1HKKA 2BY0A 4PMUA 2WHLA 2ZXAA 1UHVA 2VX4A 3ZR5A 5CQ1A 4JFUA 5HXMA 3ZOAA 3ZO9A 1UA3A 4KWUA 1MQQA 3T2PA 1JYWA 1AMYA 1OINA 3SCNA 1E1EA 4TTGA 4J27A 1X1NA 1VRXA 3QGVA 3WF0A 2YDSA 3L4TA 3LPOA 1SR0A 1DWHM 1EDTA 2DEPA 1AVAA 4PMQA 1LWHA 1KXTA 3T09A 3SUTA 3AMDA 1Q4NX 4A3HA 2ZX7A 4NI3A 3BSHA 5A8QA 1V3MA 2OSXA 3PTMA 2YL9A 3VIPA 1FFRA 2PC8A 2VX5A 4X9YA 5IHSA 1OCQA 1CEOA 1JAKA 4JCMA 2WCAA 1UD6A 1H2JA 2OYKA 1DEDA 1MW0A 1B31A 1QHPA 1FP9A 5IDIA 4F9JA 2O9OA 3SCWA 1WZAA 3W6MA 2YL6A 3AHYA 2DH2A 1E0VA 4H41A 2C7FA 1XGZA 1WZMA 1VEMA 4W5UA 3PZMA 3IJ8A 1D3CA 2J78A 4GO9A 1QNQA 4P8WA 1ISYA 3AMLA 5FOOA 3U7BA 1TCMA 1C8QA 4ZXOA 4KRTA 5CG0A 3W29A 3T0BA 5GQBA 4R5EA 4AY1A 1JZ4A 2WMJA 3GH7A 2W92A 4EE9A 3PZ9A 4DM1A 1L0PA 3RPMA 1HT6A 3VGFA 3WNOA 2Q8XA 4NRSA 1W1YA 1E72M 2O92A 3F4VA 1E40A 4WIWA 3RM8A 4IUGA 1V0KA 3ZQ9A 5I3DA 1TG7A 3WL0A 2V3EA 3A47A 5CSYA 1DWJM 3BMVA 1W3JA 4JAWA 4J3UA 3UR8A 1JFHA 2DSVA 2WBKA 4BS0A 3AIBA 3VNYA 1XYZA 2WCSA 3NDZA 1TA3B 3WDQA 3POHA 3AIEA 2DSWA 1HX0A 4GI6A 3TOPA 1WKYA 3NUKA 1UH4A 1CXEA 4OBRA 2X0YA 3N13A 1GQJA 2TAAA 1WPCA 3U7VA 3WH7A 1ISXA 4MDOA 4X0VA 5CLWA 4PTWA 1QPKA 1J10A 2J8FA 4CVUA 3RJXA 5BCAA 1HJWA 5GPRA 3CGTA 5I6SA 2WVVB 3VINA 1E15A 2VCAA 3WEZA 3WMSA 1E55A 2XVLA 5M17A 3AOFA 4JL2A 1MVYA 8A3HA 2GFTA 3EBVA 3AXIA 3VMPA 4CN6A 1KGXA 3PZOA 4HPHA 3BSGA 3TP4A 3A6OA 2IXVA 4H2CA 1BPLB 1QVBA 3MUY1 1E4LA 2CIPA 1JZ5A 1UUQA 1LG1A 1GVIA 1G1YA 4HOZA 1V6XA 2EEXA 4XB3A 2XIBA 5EFDA 3QHMA 1H49A 3ZSSA 3DHPA 3SUUA 2W5FA 4AZCA 2FHFA 4UR9A 4UFLA 3B9AA 4PMNA 3BH4A 1BYAA 4AD2A 4UNIA 1MXGA 1CPUA 3W4RA 4Y7EA 4N0RA 1GONA 4B16A 4E8DA 2VR5A 2D23A 3MV01 2WBGA 2WMGA 1ISZA 2VRKA 3FAXA 1PZ2A 1R8LA 3VDHA 1MW1A 4P7RA 1RH9A 2WHKA 3SURA 2YL5A 1GNXA 5BROA 1TMQA 2NW0A 3CUJA 4GO8A 1QBBA 4CU6A 4HMEA 2YOCA 3WY1A 2WMFA 5A8MA 4OOUA 1F4AA 1EQCA 2D2OA 3OIHA 4BCEA 4PUEA 3WDIA 1NWTA 5AY7A 5E9AA 1UR2A 4UFJA 2EPNA 5HDRA 3WEOA 2Y4SA 4FK9A 1TUXA 2PI6A 3RCNA 1VBRA 1OM0A 1DP0A 4FLRA 4GQRA 4H7VA 2DSZA 2J7CA 1DWAM 1NARA 5CLTA 2XJ7A 2VMFA 3FHQA 4W84A 1GQLA 1FH8A 3APGA 1UR9A 5M5DA 1OD8A 1HJXA 3AISA 3ARYA 1JZ3A 1TE1A 1OT2A 5A94A 1EDGA 3PZQA 4UFIA 4M56A 3WSUA 2BY3A 1XC6A 1M53A 1DWFM 3T2OA 1WDSA 3UG4A 1V02E 1MFUA 2CETA 4GI8A 3WD1A 3WMBA 2PWDA 3SCRA 3IK2A 1UOKA 2WHJA 1BF2A 4UFMA 2BS9A 4TVDA 3DHUA 2Y24A 2XVNA 5HPCA 5A69A 1SYTA 4QLKA 3N04A 3BMWA 4GINA 1E6RA 2VZSA 1US3A 3CBWA 2C8NA 3ZJ8A 1ZJAA 3AS2A 1GOIA 2G8ZA 4P7QA 4OOZA 1NOUA 1VIWA 1LJYA 3CZGA 4GZJA 4JHOA 2VI0A 4M80A 3BLKA 1HJUA 1HKIA 1XSKA 1BYDA 1ZS2A 1VEOA 2J8GA 1YHTA 3L4ZA 4NSBA 1UWUA 3M6DA 1YQ2A 2DIJA 1V02A 1E1FA 4HPGA 2E0PA 1R7AA 1V6UA 3B9EA 3ARWA 2FHBA 3M46A 3GBEA 1LF1A 1VFFA 2VVNA 3TTQA 3WBAA 1C7TA 1JI1A 4PMVA 3A3HA 5JBFA 2CEQA 1EHAA 2D22A 1EH9A 1CNVA 4D6JA 2D24A 3VIJA 1E70M 4U33A 2WWDA 4QCFA 1E0WA 4F66A 2G3IA 2UY3A 3WF3A 1GHRA 1CWYA 2XTKA 2D1ZA 1ZBWA 3VIMA 1FA2A 4DUXA 1KCKA 1H09A 3BLPX 4FLSA 2J75A 1E6QM 3AFBA 3AICA 3CHEA 4GZEA 4QCEA 4J3SA 2ZOXA 3WNKA 2DQXA 1QW9A 4TVUA 4AMCA 2WZHA 4D6CA 1KWGA 1UKOA 3AJ7A 2EPKX 5AYBA 1TFVA 3BAWA 3ZMRA 1W1PA 5A6KA 2VQUA 4QLLA 3PZTA 4BZYA 4JKKA 3AYRA 3GNPA 3CHFA 3K8LA 3WDPP 1M7XA 1QOXA 1W9DM 2WCGA 3BAKA 5C71A 2A3CA 3LPFA 3UERA 2J79A 4Z2JA 5D4YA 4CGTA 1TVNA 2GJXB 4WKFA 1LLOA 3CHCA 1CXLA 3DYMA 3RMEA 1KR0A 3VGHA 1R86A 1BQCA 2VL4A 3CUIA 5JBEA 4W85A 3OGSA 1IT0A 9CGTA 1B90A 1L8NA 4P7LA 1BAGA 2V38A 1VENA 1CYGA 2GJRA 4D6EA 1MXDA 2QMJA 3WQ5A 1B3XA 3CUFA 3AI0A 4W5ZA 1E4IA 2G3JA 3VDCA 1JG9A 1BSIA 4AD1A 1J0KA 1E71M 4MPKA 1UZ4A 1QNPA 2W67A 3MKKA 4JCLA 3K4DA 4U3CA 1HL8A 3AZRA 3WUGA 2BY2A 2WVTA 1ODZA 4MAVA 5HNNA 3QOMA 4YHEA 3HMCA 1E5NA 2D0FA 1LL6A 3KZSA 3UG3A 2V3DA 3WF2A 1OB0A 1TR1A 3U5YA 2BFGA 2UY2A 3VIIA 5TD4A 1H41A 3WUBA 3L4VA 5A6BA 1FP8A 2FH6A 1WDQA 5D9OA 2AAAA 3A4AA 1W9VA 2PWEA 3TTSA 3VIGA 3EMCA 4IISA 5LA0A 4DUVA 5ABFA 2ZX8A 3I3BA 3AHVA 4AZ6A 3K8MA 4J7RA 3ARSA 3FAWA 4AZBA 2EJ1A 1E73M 3HJEA 1CLXA 3EDFA 5I2UA 2EPMX 1DWIM 3ZIZA 4AZIA 5I23A 2WVSA 1WNOA 2XIIA 2OLHA 4LYPA 1QI3A 4GKLA 3W37A 2J7FA 3AMKA 1JNEA 3VIFA 3VVGA 3G6MA 5JIPA 1M01A 3ZR6A 3CMGA 4D71A 1WCGA 1XD1A 1UKQA 3NDYA 2WSKA 2W91A 5ABEA 5CXPA 2E3ZA 4E4PA 1ZBCA 1GOOA 2FDMA 1JDAA 3QHNA 1C8XA 5EB8A 1QHOA 1IZKA 2J25A 4W7WA 1HP4A 1V6WA 4L4OA 3VX1A 1UD8A 3NCOA 3OGVA 5E09A 3WENA 3ZJ6A 1J0HA 2VZUA 4W88A 5E6ZA 2YLLA 3OLDA 1JF5A 1X6LA 4AEFA 4CN1A 4GIAA 3WF4A 4HA1A 4AIEA 1JXKA 4F79A 1QBAA 2UWFA 4LXFA 2E9LA 2JIWA 4PN2A 3GTNA 1ITCA 3WQVA 4TX6A 3RIKA 4PCSA 3ZJKA 1ZJBA 2WHMA 3RDKA 3VNZA 1E0XA 1GOKA 1C7SA 2FGLA 2YLAA 4D6HA 3VMNA 3QR3A 4U2YA 3SUSA 3VPLA 4HU8A 2BVYA 1J11A 3SUWA 3N18A 2G4FA 4JHZA 1NQ6A 2ZX5A 4ZEPA 4PCTA 1PBGA 4UZUA 1WAWA 4UQCA 1N82A 4AZCB 2V5DA 3W53A 3ARVA 3WUEA 3K46A 4F8XA 3WDJA 2BY1A 4UFHA 5IHRA 1V0MA 7TAAA 4B9YA 1HN1A 1GZJA 2FGZA 3GDBA 4LQ1A 2VCCA 1CIUA 1UD5A 3EMQA 1D7FA 2BHUA 4BF7A 4V27A 3L2LA 4ZFMA 3BCDA 4OUEA 1I1XA 1GPFA 1GW1A 3W26A 3IJ9A 2WVVA 1G94A 1HL9A 1PX4A 4J3VA 3WL1A 1E6ZA 5EMYA 3VX0A 4W86A 1EQPA 4JFVA 1EIBA 1WO2A 2VO5A 1TVPA 1DTUA 1UH2A 1R85A 2MANA 2WM0A 1JXJA 2JALA 3PZVA 2BNJA 3VUPA 3BAYA 1UD2A 2WXDM 1JYNA 3BAXA 3RJYA 1BVNP 4M81A 1B3ZA 4MJ2A 3WH5A 2PWFA 3FN9A 1XYFA 4FLOA 4W7VA 1VJZA 3GNOA 3WH8A 1KWKA 5DEZA 4GZIA 1UWSA 3W81A 1UD3A 1UKTA 4E8CA 1Q6DA 1B3YA 3CTTA 3FY1A 1GUVA 2ZXQA 1ECEA 4P8UA 2CBVA 3WQWA 1JDDA 2ZIDA 4TUFA 3MS8A 2VR4A 2HVMA 2ZICA 3IAQA 5BXPA 3K1DA 2YDRA 2XSBA 4J3XA 2BHYA 2YA0A 1CGWA 1NOFA 3PTQA 3F5JA 3CO4A 4PBGA 4C7DA 4W8AA 1TZ7A 1LL4A 2W62A 1W9UA 2GUYA 6A3HA 2YDQA 4P7OA 3MO4A 4KGLA 2XVKA 1Q6EA 3MU7A 3WELA 1PX3A 1UKSA 3WUFA 1FHLA 1H4PA 5C70A 3VO0A 4MB1A 1VFMA 3GZAA 2GSJA 4MAZA 1GJWA 3IAPA 3U57A 2NT1A 1CLVA 1GOWA 1W2PA 4PUDA 2XWEA 1KBKA 2CKRA 1P6WA 1W32A 2J77A 3VMOA 3VIKA 2D0GA 2JEPA 1V03A 4JL1A 2OWWA 1OGSA 4FLQA 2ZUVA 1QHZA 3UETA 4EAMA 1J0IA 1VJSA 1J0ZA 4W7UA 2VURA 2VZTA 3UR7A 1X6NA 1GCYA 2ZUMA 1SMDA 2WK2A 4YHGA 1B30A 4UTFA 4HOXA 2VX7A 4XUYA 4Z2KA 3AS1A 2IUZA 2G3MA 3WNNA 1BGAA 3PTKA 3W6LA 1E4NA 2WMHA 1NP2A 2Y8KA 2YA2A 1W1VA 4CD8A 3AZTA 3L4XA 5E6YA 4CU8A 1BG4A 1HJQA 1MW2A 1EHNA 4R27A 3CH9A 2QHAA 1V6VA 1G5AA 1HXJA 4GPNA 1WDRA 1B3WA 3HU7A 4UQAA 5A95A 1CXKA 5A6JA 1XH2A 2AOSA 1ESWA 1ZU8A 3QOKA 5FL0A 3F5KA 2XUCA 1G0CA 2CNCA 1CENA 3AIWA 1OIMA 1A47A 1QI4A 2F2HA 4U5KA 1NOWA 1WP6A 2XVGA 4W8LA 1UWTA 2A3BA 1KGUA 4OBSA 1KBBA 4ML4A 3MSGA 2GVYA 3CLWA 3N12A 4GQQA 3OGRA 4W8BA 4KGJA 4DUWA 4Z2HA 1JZ6A 2D3LA 4K68A 1FFQA 2J4GA 3VD7A 5I0DA 5I78A 5E0CA 1HIZA 3D3AA 2D0HA 5DMYA 2WKGA 7A3HA 1MWOA 4DWSD 4WKHA 3T08A 3POCA 2EPLX 1WE5A 4JIEA 1EXPA 3CMJA 3UESA 4EANA 1V6YA 3OLEA 3MV11 4UOZA 3ZT6A 1RPKA 1PIFA 1S46A 3BC9A 2WMKA 4DM2A 1OWQA 3AIVA 3L4YA 4PTMA 3ZSTA 5CGMA 1LL7A 1B2YA 4PRWA 4HA4A 2XFRA 4NZCA 5M03A 2W66A 1GJUA 3KE0A 4LGXA 1CECA 3GXMA 2WZIA 3SUVA 2VQTA 4U31A 3WD3A 1MW3A 4TXEA 2WMIB 2VRQA 1BG9A 1UYQA 1JAEA 4Z2IA 1UWRA 3ECQA 5BYWA 3M7SA 1E3XA 2WB5A 3AIRA 3UG5A 3VDAA 4DWSB 4H8HA 3NJ3A 4AD0A 2ZE0A 1W91A 3T0DA 3TONA 3NSMA 3GH4A 5E70A 3VOCA 1JDCA 5A1AA 1E56A 3CIVA 5A2BA 4PMDA 2BXZA 1V3HA 4B15A 1VF8A 4UOJA 1ZBVA 4YN5A 1XH0A 1EO7A 1J01A 1Y7VA 3VDBA 1XH1A 1K6AA 2OSYA 2E9BA 3FXYA 4CUCA 3LPPA 3EYPA 3ALFA 2ZUNA 4NRRA 4KRUA 5CZKA 4XZBA 1O7AA 5BXTA 2PBOA 1J12A 1GOQA 1VEPA 3KL0A 1JGIA 2QPSA 4JKMA 2WANA 1W3KA 5BXRA 1CGTA 1ODUA 3T0AA 3N11A 2WC7A 1KXVA 1SMAA 3MMWA 1KQYA 1W3HA 5A8PA 6CGTA 3MANA 1G9HA 4AWEA 2FH8A 1HVQA 3MUAA 2AMGA 2VT0A 1XSJA 2RGLA 1HKJA 1H1NA 2ZUTA 1FOBA 3AROA 4URIA 2VJXA 3BCFA 3S2CA 3ALGA 2ZWYA 3PBGA 2J74A 4X0NA 3ZJ7A 3AS3A 1FH7A 3VILA 1UZ1A 5I24A 2Y5EA 4RL3A 1JIBA 3CPUA 1B9ZA 2OWXA 4UCFA 4AW7A 1CGYA 3DYOA 4IM4A 5A8NA 4MB3A 4ATDA 4V28A 3WMCA 3W24A 3OG2A 3VD4A 3KWXA 3PZUA 3N15A 3RO8A 4Q22A 2X8RA 3VIHA 4AZ5A 4QP0A 2WWCA 4FF5A 2Z1KA 4MADA 5HOSA 2O9PA 3KL5A 5HBFA 3AMCA 2X05A 4AD5A 1AQHA 3WNMA 1CGVA 4YPJA 1W1TA 1UR4A 3OB8A 5BRPA 2XG9A 4AZHA 2ZUWA 4WF7A 2WVUA 1VFOA 2PB1A 2A3EA 1BGGA 4WKAA 2OSWA 3UEQA 2IXUA 4QDMA 2D3NA 4QLJA 5IXEA 1BVZA 4H8VA 2WPGA 3WNPA 3HN3A 4QAWA 1G01A 3I3DA 2WC3A 3CUGA 1C90A 5DT7A 4RE2A 1HF6A 4HP5A 4PMZA 3AQUA 1UR8A 3ARQA 5IFTA 5DO8A 3VM7A 2PBGA 2F61A 4WSKA 1E6PA 4JZ5A 4HOWA 1KGWA 2XGBA 5M3WA 2CERA 2ZX6A 1C8YA 5A3HA 1H11A 3VIOA 3GXDA 4AD4A 1NWUA 4PMOA 4J3WA 5EBAA 4CD6A 1UWQA 2GK1B 2X1IA 3J7HA 1MQPA 4H04A 3CZLA 3WNLA 2DT0A 1OT1A 5JBDA 1RD6A 3VD9A 2ZWZA 4HTYA 1ZB5A 3ZM8A 1OD0A 1JD9A 1FHDA 4TVCA 1CZ1A 5AC5A 1I1WA 3RILA 1V0LA 2VTFA 2ZX9A 1VFUA 2XSAA 4QFUA 4M82A 1DHKA 5E0FA 4AYSA 5C8BB 4LX4A 4JFTA 5A6BD 2BV9A 3B8SA 3AIQA 1QNRA 1KR1A 2DT3A 3AXXA 4MNLA 1US2A 1UG6A 2VZVA 2BVTA 4LYRA 2OYMA 1UQZA 3BXWA 2ZUSA 5BXSA 1CXHA 2XGIA 1HJSA 4CD5A 3ARTA 2NSXA 1SFSA 1MQRA 3MSDA 2XVPA 2W63A 1JZ8A 1HJVA 3F5LA 1GOMA 1V3LA 2QMKA 2WYSA 3TTYA 5ECUA 3EDDA 3N9KA 2J47A 1H0IA 3L2MA 4AC1X 1E6SM 4J3TA 3GNRA 4PTXA 1WZKA 2CITA 3THCA 2J7GA 3VGBA 5LYRA 1NWSA 2E4TA 3ARPA 4ACZA 3W25A 4OJYA 3PZIA 3SCQA 2D20A 1NP0A 3ZT5A 2EXOA 4MB4A 5HPOA 2XHYA 3VD3A 1KCLA 3M07A 4PTVA 3FW6A 1C93A 3O2LA 4ZE4A 4HU0A 1UD4A 1OGGA 2WAGA 2VUYA 3WQ4A 1K9EA 4M29A 3SCOA 4M24A 2JIEA 4UFKA 2Y8VA 3IANA 4MNKA 4J28A 1ISVA 2X2YA 2DT1A 3KL3A 1LWJA 3WN6A 2B31A 1E9LA 3CHDA 3AXHA 4IPLA 3GYCA 2EQDA 3SCVA 3SIMA 2DSUA 3W27A 3WKZA 1AQMA 4XX6A 3WFLA 2GDUA 1UR1A 4MNJA 4UZSA 1LG2A 3GXFA 5I77A 2GK1A 1PJ9A 1ZL1A 3ARUA 3VU2A 3MUZ1 2YJQA 2DIEA 4TTUA 4B3KA 1CTNA 2PWHA 4TX8A 2FHCA 4HMDA 1UA7A 2NT0A 2YKKA 5ABGA 5ABHA 8CGTA 2YBTA 4OZOA 4MJ4A 5CPQA 1U2YA 2GJXA 1EOMA 5LA2A 1BTCA 3T2QA 4CCDA 1J0JA 4W87A 4F9DA 3WQ6A 3VGGA 2CPUA 3D5HA 1F4HA 3AYSA 5BRQA 5A6AA 2WMIA 2CHNA 1MYRA 5FD0A 1XHGA 1U33A 5F7UA 1KQZA 1CGUA 2BVDA 4B9ZA 1BLIA 4PYSA 2CESA 3W28A 5D9PA 5D9NA 1GORA 2J7DA 2YBUA 4EKJA 2VRJA 2EBNA 4RE3A 2XWDA 1E6NA 2ZXDA 3S6TA 4U3AA 1WZLA 4V2XA 1PPIA 3GM8A 4GXPA 4Z2LA 2VC9A 3IJ7A 4PEEA 3SCTA 2ZUUA 5FKYA 2PF0A 5A2CA 5D8ZA 4BQ2A 1JF6A 3VTRA 1QI0A 3PHAA 2C0HA 5CGTA 2WZEA 1JD7A 5GNYA 4CCEA 3N1AA 4JFWA 1W9XA 5A8OA 4ZENA 1CXFA 3BAIA 2J7EA 1RP9A 1AQ0A 3W38A 1BYCA 5FIPA 1IZJA 2CCRA 3CZ8A 4UQEA 3II1A 2JFEX 2OYLA 4KH2A 5DFAA 5CPTA 1GHSA 2QLYA 4P8VA 4MDPA 4B3LA 2YL8A 5JIWA 3AS0A 3W0KA 2VZOA 4MTVA 1EA9C 2E40A 3B9DA 2UY5A 2VVSA 5I79A 1B1YA 2E8ZA 4ZE5A 1PEZA 3AMGA 2G41A 4XZWA 1ITXA 3ZT7A 2JF6A 1HP5A 4DWSA 2DH3A 3AHXA 1CDGA 5FCZA 2W4XA 1PZ3A 4PMXA 1OIFA 1W9BM 3VGEA 3A4XA 4IPNB 4C7FA 1J0YA 1UH3A 2DSKA 1C91A 2CBJA 1B0IA 1PAMA 4L4PA 3A4WA 3CUHA 2EO7A 3NIYA 3OLIA 1UWIA 3K8KA 3WH6A 5KEZA 4HZ7A 2XFYA 4PMRA 3E1F1 1UR0A 1OGBA 5AYIA 6TAAA 3CZKA 3EDKA 3WQ8A 2V5CA 1U30A 4A4AA 1K9FA 1J9YA 2WKLA 3OZPA 2Z1SA 3SCUA 3CZEA 3DYPA 2CXGA 2A3AA 2QF8A 5A6MA 3EMZA 2O9RA 3WDRA 4BQ3A 1BFNA 1KXQA 3L4WA 1OSEA 1LQ0A 4WSJA 2V3FA 5CPSA 4D6GA 3DECA 4BA0A 1JYVA 1WDPA 4WLCA 1EOKA 4MB5A 3L4UA 4FMVA 2JF7A 3NYDA 3SCSA 3EDJA 2CYGA 4HZ8A 1O6IA 1E5JA 3MUIA 4Q7NA 4AISA 4D6FA 4JFSA 2EPOA 3SEPA 4D72A 4PSPA 4D6IA 4AZGA 5A2AA 1QNOA 3WD0A 7CGTA 4AEEA 3WBEA 2E8YA 3MMDA 4EK7A 4UQDA 3VD5A 4P7NA 1GQKA 3O6AA 1GVYA 1M04A 2YA1A 4PMYA 5FL1A 2XPKA 2DT2A 1EDQA 1CGXA 3BAJA 4CD4A 4HA3A 3CZJA 3GBDA 1OBAA 2XM1A 1TA3A 3NSXA 1HNYA 3O9NA 1C3FA 4HZ6A 2PWGA 1H3GA 3THDA 4ATWA 1CXIA 1E4MM 4W89A 1B3VA 3VKKA 4AD3A 2CBIA 1JNDA 2UY4A 1E3ZA 3WIJA 4D1IA 3SCPA 2J7BA 3U5UA 4E2OA 4BQ4A 4DWSC 1KXHA 3K4AA 3VM5A 3WH9A 1RP8A 1KFWA 1I75A 1Q6FA 3LMYA 1V3JA 2VNCA 3WFZA 1K9DA 5A6LA 1NWRA 4XV0A 4W93A 4CCCA 4RE4A 1W3LA 2HISA 1JI2A 3RM9A 4OKDA 5D8WA 2WC4A 3ARZA 2WLYA 2XYLA 1XCWA 3KEHA 1XD0A 3AHZA 4M1RA 3OZOA 5CSUA 1JZ2A 1WB0A 2GJPA 2WW5A 2W61A 4OIFA 2VX6A 1JYXA 4AIUA 2CBUA 4H8UA 1JFXA 5JUVA 2OWCA 2VCBA 1R87A 3TTOA 2DPEA 1ISWA 1EGZA 5DF0A 5IFPA 1PIGA 3OLGA 4U2ZA 2X09A 2GDVA 2WSPA 2QV4A 2VOTA 2F8QA 1XV8A 1IV8A 4UOQA 4AXNA 3AIUA 1HVXA 4BQ5A 3VGDA 1VBUA 4WJXA 3WD4A 5CJ5A 4LPCA 1R7OA 1VAHA 1VB9A 1FH9A 2J7HA 1QI2A 1QW8A 2G3NA 2XM2A 3AZSA 3RM4A 4D1JA 4KMQA 4JKLA 3PZGA 4P8XA 2BHZA 2CHOA 4UQBA 4PSRA 1XRVA 4M8UA 3WF1A 4CVWA 5I5RA 1E6XM 1M03A 3WEMA 5LA1A 4CN4A 1XCXA 1V08A 2YIHA 1Q6GA 3G6LA 4ACZB 3N17A 1H5VA 5BWFA 1V3KA 1PX8A 1V0NA 3BGAA 1E43A 1HKMA 1ZBKA 4NF7A 2BXYA 1NH6A 5GNXA 2JE8A 5DT5A 4S3JA 4C7GA 3ARRA 1NM9A 1UQYA 2Y2WA 1Z32X 1J18A 3DC0A 1JL8A 1K9TA 4MNMA 3QHOA 3GH5A 1W9PA 2X0HA 5ABFB 1EO5A 4CU7A 1C92A 4HMCA 4GI9A 3OA5A 3FHAA 1KB3A 1BYBA 3FNDA 4N42A 1W2VA 3WDHA 4ACYA 4ZXLA 2WLZA 5EFFA 1MFVA 4S3KA 4UQ9A 2DDXA 1D2KA 4TOQA 2V3GA 1JZ7A 3MMUA 1H0GA 3I3EA 3PN8A
chains in the Genus database with same CATH superfamily
5FJJA 3AHTA 2ZKMX 3K5XA 1XSIA 3EDEA 3S9ZA 5AC4A 3VZXA 1DE6A 3B8DA 2ZXBA 4E38A 1OYCA 5KZ6A 5AKQA 2J62A 1AODA 3NQ2A 4K7YA 4M3PA 4R34A 2XIJA 1JJKA 2CLLA 1GGOA 1Q7ZA 1EC9A 4FX6M 3WD2A 1VIZA 5D09A 4YTUA 4WQ6A 2E9MA 2DGAA 4GNJA 2RGMA 4BI5A 2FIQA 5AVNA 1QNSA 3V18A 3VUSA 5T9CE 5A6SA 2HSAA 2QCFA 4S1FA 1QI5A 2FLIA 3HGSA 2XFFA 3DKJA 1DQWA 4EOUA 2R1PA 1HKKA 5H8UA 2VX4A 1Q66A 4WY0A 4ERAA 5CQ1A 1GT8A 5F1UA 1UA3A 5DQPA 3EX2A 1AMYA 4DJFC 2ISDA 3EX4A 1X1NA 1VRXA 4LH8A 2YDSA 2DEPA 1AVAA 4PMQA 4RX0A 1LWHA 3WLNA 3SUTA 3CV7A 2ZX7A 4DJDA 4OWGA 1K7EA 3TH6A 3QY8A 2YL9A 2FQIA 2OELA 5EKYA 1OCQA 1CEOA 5D05A 5H8MA 1JAKA 4JCMA 3CWOX 4ZO7A 2OYKA 2D2HA 4C1NA 2YCLA 2OMAA 1EB3A 3QLDA 3NYZA 4F9JA 2O9OA 1T8QA 4AYGA 4EPKA 1IEVA 7PTDA 2GYIA 4K8HA 3W02A 2YZRA 2ZDRA 4JD4A 1Z44A 1XGDA 2ABAA 1VPXA 1WZMA 4W5UA 3IJ8A 5EMUA 8XIMA 1D3CA 1ADOA 1ISYA 3AMLA 2EG7A 1KBJA 4KRTA 5CG0A 2TYSA 3RFAA 1HG3A 2VENA 4AY1A 1H1ZA 4LAUA 3WG6A 2QJJA 4X2RA 4EWJA 3PZ9A 1L0PA 1HT6A 3VGFA 3WNOA 1E72M 2O92A 3F4VA 3BARA 4IUGA 3OQ8A 1TG7A 3N4EA 5CSYA 4F2UA 5K9DA 4Y2WA 1M68A 3EPMA 4KERA 3LGGA 2I16A 2F6XA 1JFHA 1JPIA 4OU1A 3AIBA 2PWUA 4KWOA 4GX9A 2CLOA 2IPJA 3N4AA 3WDQA 3POHA 3AIEA 2XU2A 4DIAA 4MWAA 3QZEA 4GI6A 2IKIA 4IX0A 5LIKX 1UH4A 1CXEA 2X0YA 4NJGA 3U7VA 3U4AA 3N34A 4XAFA 3LHYA 3WK2A 3T9PA 4PTWA 3PJUA 3RJXA 1ONWA 2J8TA 5I6SA 2ATSA 4IIFA 1FTXA 3CNYA 3R8RA 3LCGA 2XVLA 5M17A 3P61A 5G1TA 3W7RA 3AOFA 4NG3A 3R58A 1BKHA 3CAQA 8A3HA 3W72A 2YCKX 3AXIA 3EOLA 4Q4RA 2RFGA 1WUEA 3G1HA 1TWIA 1QVBA 3TWBA 2CIPA 5K9CA 1UUQA 1LG1A 1EWDA 1G1YA 5FJIA 1XUZA 3FVMA 4XB3A 2PUZA 4XZIA 1F05A 1J79A 1YTKA 4PBEA 4F2TA 4EP8C 5D2WA 4JIRA 1XQKA 1VFHA 4AZCA 2FHFA 1QUMA 1D3HA 1J6PA 2X2GA 1AG1O 2F7FA 4R7JA 1KV5A 1B9BA 3MV01 2WBGA 4D8LA 4C6QA 3H7UA 3FAXA 1MW1A 4P7RA 1GK8A 1L2UA 1JULA 5TBOA 3GR4A 1QBBA 2H3DA 3DFSA 4HMEA 2AGKA 1TELA 3CMFA 2OVLA 3L21A 1TPH1 2E67A 3OIHA 4O52A 3QR1A 2BP1A 4KCVA 4RDWA 3WDIA 5E9AA 4UFJA 4JY9A 5HDRA 3G77A 1S2TA 2PI6A 2YYUA 3RCNA 1DP0A 4FLRA 2J7CA 1DWAM 1NARA 1TYGA 2VMFA 5D30A 1GQLA 5FF4A 3P74A 3APGA 1H51A 4G6CA 1KRAC 1QPRA 1ONXA 4HPJA 1JZ3A 1OT2A 1J5SA 1LBFA 2BY3A 3SO7A 1V7AA 1GVOA 3UG4A 1V02E 4GI8A 3OU8A 3GB6A 2PWDA 3SCRA 3IK2A 3TEVA 4AWTA 2WHJA 2BS9A 2I14A 2YCEA 4X9SA 3FIGA 3DHUA 4IL2A 3HQOA 2FYMA 4HQVA 3MTWA 1FVPA 4Y9AA 3N04A 3WMLA 1VKFA 4GYPA 3AS2A 3W1UA 1Q4WA 4P7QA 1O68A 2NX1A 3SI9A 2WSRA 1GPWA 1XRTA 3E2QA 2OO0A 4M80A 1QFEA 1UJPA 1XSKA 4LC8A 1UWUA 3M6DA 2PP3A 2DIJA 4MWAB 4HPGA 3QPEA 1JDFA 3BWWA 2FHBA 3M46A 2VVNA 2W3ZA 4XD6A 3WBAA 2ZADA 1EHAA 3BZJA 1M7OA 2D22A 4U33A 3IV3A 2G3IA 3FYOA 1ZSXA 3WF3A 1K70A 1FA2A 4DUXA 5RUBA 1KCKA 3MP5A 1H09A 4Q4QA 3BLPX 4FLSA 2J75A 1OK4A 1OYAA 4UCGA 3LY0A 5DX7A 1ICQA 3AFBA 4L9ZA 4PCPA 3AICA 1R9XA 4MG4A 1M41A 3UXAA 1TJPA 2EPHA 2FVKA 4HK6A 2PE4A 3CQJA 4OUIA 5BU6A 3V0UA 5JH2A 4TVUA 2P50A 3TV8A 1NEYA 5REQB 2EPKX 1X8CA 2H8ZA 3ZMRA 1W1PA 4OT7A 5A6KA 2VQUA 5B7ZA 4QLLA 4JKKA 3M5ZA 1KV8A 2GLKA 4JX5A 1QOXA 1PZ1A 1S2VA 1TPWA 3OP2A 2J79A 3CK5A 3CHCA 3RMEA 3H70A 4HNUA 1P5BA 5AHMA 1R86A 1BQCA 4UBPC 4WY0B 2RKXA 3TYBA 3KDOA 9CGTA 2Y8UA 4Y9NA 3JZUA 5LKYA 3MP4A 3KBJA 3CV1A 3M0ZA 1X1OA 1MXDA 2QMJA 1WKEA 4DBWA 4W5ZA 3STFA 2CZEA 4AD1A 1ZCOA 2QCEA 3R43A 1YPFA 1UROA 3DI1A 4L65A 4C6CA 1T99A 4NJKA 1RHCA 2BTMA 3DFYA 1IGSA 4TMBA 4AF0A 3T78A 4QJ1A 3GQYA 1WBHA 4NUWA 3FX4A 1TX0A 1SO6A 2FZBA 3MVTA 1OB0A 1ADDA 4PE8A 4KQNA 5C54A 2BFGA 2UY2A 3P8IA 4W4QA 2Z24A 5TD4A 4DY1A 4H6QA 3S1WA 2VEPA 4WXZA 3T7VA 3UBPC 5D9OA 5MKGA 4XAGA 3TTSA 2G0WA 5FEWA 2XDFA 4QGCA 2YFOA 4DLFA 5I3HA 1RQBA 3HQPA 4ONVA 3PUGA 1BF6A 3C52A 3CPRA 3NZRA 3AHVA 3KBSA 4J7RA 1L6GA 3ARSA 3FAWA 2F6KA 5G1YA 2EJ1A 4Q8TA 1E9YB 1I2OA 4A3QA 1CLXA 1PCKA 4DJEC 5I2UA 4LFYA 1YDNA 3ZIZA 2XIIA 4LYPA 3NL6A 3W37A 4GYJA 1A0EA 5CKSA 3NQCA 2AGTA 3LENA 4HIBA 4L1XA 4H00A 5JIPA 1OEPA 3R8GA 3ZR6A 1WCGA 2IKGA 1UKQA 3NDYA 3ZWSA 3LI0A 5ABEA 1EWEA 4E4PA 5EYWA 3EOSA 2FDMA 3VOGA 3AXMA 4UTKA 1JDAA 1GTEA 1IZKA 2J9XA 4GVIA 3R4IA 2ZFAA 5AC8A 4IOTA 1JRBA 4L4OA 5EGRA 2VWSA 4U4MA 1VBJA 4C65A 1K8XA 4XZNX 5E09A 3NPUA 2PDWA 2VZUA 4W88A 1NFGA 3EB4A 5E6ZA 4AEFA 5CC7A 4RCXA 3QQ1A 2EHHA 3N29A 3GR8A 3HB9A 4GUJA 3WLHA 2Z2AA 2QGHA 2JIWA 3GTNA 1ITCA 1XW8A 4ZVJA 3R8HA 4L5ZA 5TF0A 3RIKA 3ZJKA 1E0XA 1A5SA 1LBLA 4D6HA 2DZVA 4S2BA 3QR3A 4U2YA 1MZHA 1XUUA 4JHZA 3LB0A 3ARVA 3WUEA 4O1AA 1RR2A 5B7YA 2BY1A 2Z7KA 3BMXA 4UFHA 3UU0A 4IGMA 4B9YA 1V77A 1WKFA 2P3EA 2FGZA 1DXEA 4E2BA 3KXQA 2BHUA 1FWCC 2XH2A 4BF7A 1ME8A 2QUTA 2H9AA 4LTSA 3K30A 2CU0A 3W26A 4AU0A 1QK2A 4C6FA 3DFPA 1PX4A 1ADSA 5EMYA 1EQPA 1OZQA 3FFSA 3MCOA 2VO5A 2YB1A 3LU2A 4KCUA 2NV1A 4DZ5A 1DTUA 2TRSA 2ZE3A 1UH2A 2MANA 2WM0A 4H4IA 4ZB5A 2BNJA 1A5OC 2WXDM 4ZQNA 3BAXA 1JYNA 4GXMA 1NTHA 1IXOA 1BVNP 1C9DA 4M81A 1B3ZA 2PWFA 1TIMA 1CI1A 2B81A 1Q6DA 4C1NB 4GY7A 1B3YA 3R5EA 4P8UA 1XIDA 4J2MA 3EZ4A 4I5XA 3WLTA 3MS8A 1GJPA 2HVMA 3BLLA 4GJ1A 1KLZA 1W37A 4HPXA 4MLRA 1RAKA 1P43A 4G7EA 3K1DA 2YDRA 1L2QA 5DANA 2ZYFA 3PTQA 1ITQA 1TMHA 2W62A 2YDQA 3CIWA 3MO4A 1IXPA 1Q6EA 1Z48A 3HPAA 2I57A 4LVDA 4JNYA 2BSLA 3BJSA 1VFMA 1L6WA 1TV7A 3MCMA 3KCLA 2NT1A 4PUDA 2XWEA 2CKRA 3VMOA 3WLQA 4PB3A 5HQMA 4KFPA 2GDQA 3MCNA 3DC8A 5D2VA 4FLQA 3UETA 1J0IA 3N4FA 4WOZA 3PULA 1X8FA 2DUZA 2VZTA 2PDFA 3W70A 3STEA 1SMDA 4YHGA 1E0TA 4UTFA 4HOXA 3CUXA 1YADA 1BEUA 1H1YA 2G3MA 4F40A 3PUDA 2JGYA 3PTKA 1A3XA 2QJNA 3TJXA 4Y9MA 1NP2A 3E6EA 2INFA 1YW1A 4UNKA 4R27A 3WO8A 3G3DA 1P1MA 4Q32A 2ZTKA 1CXKA 5DXXA 5A6JA 3IGSA 3LA4A 1XH2A 4O8RA 3RYSA 3S5OA 3PBUA 2DJXA 3IJ6A 3EKZA 3BGGA 1CENA 1S5VA 1RZMA 1G67A 4GH3A 3EA1A 1WP6A 4EPEC 2Z29A 1UWTA 1XF0A 2A3BA 3W88A 1KFCA 2HE8A 1XLEA 1VLIA 3O6CA 1T96A 4GIEA 1XLCA 3CLWA 4GACA 1KA9F 3N6HA 7REQB 2C1HA 3OGRA 4HHPA 4W8BA 1RVKA 4Y8FA 1Z3NA 4Z2HA 2V68A 2D3LA 2NUXA 2J4GA 5GJNA 5I0DA 4PRRA 5I78A 5E0CA 3D3AA 3UJSA 2WSYA 2EGZA 2ACQA 1KBIA 1Q6QA 3BOFA 4DWSD 3M0KA 2HJPA 4JIEA 1DE5A 3CMJA 3QTGA 4O16A 5DRIA 4EANA 2NWSA 1EJ7L 3QC3A 3WCZA 1O5XA 3H22A 5K7JA 1DBTA 2VEMA 1S46A 1GVRA 1LL7A 4XK2A 1KTCA 1DIDA 1T41A 2ZDSA 4NZCA 4GGBA 1MUMA 5M03A 1CECA 1WKDA 3DX5A 3OVPA 1TPC1 3SUVA 3B0VC 4ZO9A 2G4JA 4MJZA 3GDTA 3VZYA 4JTEA 3USZA 1DJHA 3SJ3A 3WD3A 2VRQA 3MBDA 1UYQA 2ICSA 5BYWA 5F4SA 5IBXC 5JXQA 4H8HA 3UY7A 3O6DA 2ZE0A 2HXUA 1L8PA 3TONA 4HNTA 1P0NA 3GUGA 5E70A 3VOCA 1TRDA 5A1AA 2A6NA 3FCPA 4B15A 3I7SA 1PWLA 2PDMA 2NQZA 4UOJA 1ZBVA 3KOFA 1J01A 4DBEA 1GKRA 2QXWA 1FWIC 3LPPA 3ALFA 1XJBA 4NRRA 2DZBA 5CZKA 2YXGA 1F3TA 4H9ZA 5BXTA 3UZXA 1BRLB 1UMYA 2RHGA 3P6LA 3KRZA 4PODA 2KAUC 1CGTA 1XYLA 1ODUA 3T0AA 3UWYA 3EEGA 5LNWA 1KQYA 4Q7IA 5A8PA 1QMLA 5KZDA 3MANA 1HVQA 3QW3A 2QUUA 1AUSL 3GS6A 1HKJA 2WKJA 5A5WA 2VJXA 3BCFA 3WLSA 2NVDA 1S1RA 3PBGA 2J74A 3UGVA 4XZ9A 3I6EA 5E1QA 3VILA 4TMCA 4Q4SA 1P0KA 1XLAA 4C6NA 4Y90A 3WK0A 4IM4A 2NV9A 1IIHA 4MB3A 4KBXA 1VCGA 4ATDA 4RW3A 2P5NA 3WK3A 3W24A 1KLYA 1WXJA 3OG2A 3VKBA 2R9RA 4AZ5A 1XRSA 5HATA 4FF5A 1ZENA 3UF9A 1OC5A 5FJTA 1I2RA 4MWAC 3NXLA 1W5PA 3KL5A 5HBFA 4YL2A 2X05A 3UW6A 1AZ2A 1CGVA 4K3ZA 3U2ZA 3RRAA 2ZUWA 3VOJA 2A5HA 2PB1A 3PPGA 4WKAA 3H2AA 3LLDA 2IXUA 4AEOA 4R9OA 4EX4A 3V16A 1CB2A 3O7UA 2VXNA 4U10A 3HN3A 3EA3A 3TN5A 2B7QA 5CEWA 1C90A 2CLHA 5DT7A 4RE2A 5LGZA 4PMZA 3O06A 4LBUA 1YBQA 4XAYA 3RNDA 4N6EA 4MYAA 3H6OA 4QJ3B 3TLLA 1MDLA 3ERPA 1C8YA 4E0CA 4YVXA 4D2JA 3VOIA 1AH3A 5EBAA 2X1IA 2GK1B 1Q7QA 3KFTA 3CZLA 3WNLA 3VDGA 5LNVA 1RD6A 3ZM8A 4L61A 2PF8A 1EXBA 4R3UA 1LQ2A 1RBOB 4H9TA 2NVCA 2ZX9A 1IXQA 2QCGA 2XSAA 2XIOA 1H62A 4CNTA 4LYKA 4M82A 5KMYA 3LXAA 5A6BD 2GSHA 1UUOA 4FXSA 1YMYA 3OHMB 1QNRA 2DT3A 4MNLA 4KWWA 2CWXA 1UQZA 2PLKA 4EVZA 1HJSA 1TWSA 3GFZA 4CD5A 3ARTA 2V2HA 4GMEA 1MQRA 2W63A 3FGCA 4DO7A 2C3ZA 2C15A 1HJVA 3Q4DA 1XBXA 3SADA 1ZY9A 2VC5A 3N9KA 2V8ZA 2DIKA 3NNTA 2I9EA 4IXXA 1F6KA 2OU4A 4Q8PA 3K13A 4UNLA 2ZZ4A 2QCNA 1WZKA 2CITA 3UWEA 3PC0A 3VGBA 2XZ9A 1NWSA 3A12A 4ACZA 1XIIA 3B0YA 2D20A 1NP0A 3H2FA 1UJQA 4QSFA 3DI0A 4PBFA 2GGJA 3OOQA 1LRNA 1TQJA 1XLKA 3FW6A 4WGXA 4XG1A 3QYSA 2F2KA 4XKYB 2Z1BA 1K9EA 1TTQA 4M29A 5CPNA 3RU6A 2DFAA 2JIEA 2Y8VA 1AL8A 1ISVA 2YW3A 4KFNA 1BQGA 1KRCC 1YEYA 3LHTA 2B31A 5FAJA 2QULA 4O1BA 1DQXA 4JYDA 3CEUA 3SCVA 5DCDA 3RGTA 2J9ZA 3WFLA 2GDUA 1UR1A 4ZOCA 1LG2A 1TMLA 3D47A 4DJDD 3ARUA 1NFBA 3KDNA 4TTUA 1KM4A 3WQFA 4ZZ9A 1Y8BA 2QJHA 3P2VA 4DUOA 1EC7A 2A7NA 3HO8A 3DG6A 2WNZA 1F2JA 5ABHA 2YBTA 2YW4A 3UXKA 1KW1A 1NQKA 1U2YA 2GJXA 3GHSA 3AO0A 3EX1A 1J0JA 3L68A 2PRHA 5D37A 3EOOA 4DBUA 5H2ZA 5CJNA 3I68A 3KVLA 1MYRA 5FD0A 4RV8A 4NZJA 5F7UA 4HYRA 4F0RA 3WQGA 1O60A 1Q45A 4O19A 3W28A 3W1LA 3LHUA 1GORA 3PG9A 1QPOA 3KP0A 2ASHA 3GVRA 2A6LA 2VRJA 4NT0A 4RE3A 2ZXDA 4LUSB 3U3HA 1J2BA 4ZR8A 3O8AA 1WZLA 4GXPA 4Z2LA 3I7QA 9RUBA 4C90A 4QR6A 4WR3A 4XO7A 3R1ZA 5EMLA 3SCTA 5FKYA 5A2CA 4IMEA 4BQ2A 3UZJA 1QI0A 4Q6XA 5CGTA 1FWGC 2KX9A 1H7OA 1L6SA 1W9XA 5FIPA 3WQOA 1IZJA 3DG3A 1PHQA 3OQEA 4MDPA 4B3LA 2DUAA 3DKLA 3E0LA 2AL2A 2EKCA 2VZOA 1RK5A 4MTVA 3ABOA 1XLFA 4OFCA 5I79A 3DAQA 3B03A 3EOUA 2O0TA 4BF5A 2G41A 3HV9A 3ZT7A 3MA8A 4O18A 2VR2A 1YBQB 3I65A 1XL9A 2QJGA 4JR5A 3RO6A 2X40A 3VGEA 2E7FA 4IPNB 4C7FA 4EAYA 3PSWA 1YXDA 2CBJA 1PAMA 1IEQA 3NIYA 5DMLA 1S38A 2OG9A 4ZQMA 7TIMA 5AYIA 6TAAA 3E2RA 3RF9A 2V5CA 4YCPA 1XDLA 4A4AA 1P6CA 3DYPA 2CXGA 3TYDA 3QTPA 1Q2SA 4WY0F 3WDRA 2DZWA 4B5XA 2XH0A 2ZZ5A 2GUBA 2TMDA 3M5XA 1GEQA 4L80A 3UZWA 3MI2A 1XRFA 4BA0A 4RUBA 2QV5A 3GVWA 3LXBA 3KBVA 4WLCA 3PBWA 4FMVA 2JF7A 4N2YA 2PP1A 3G2GA 3GNNA 4YLWA 2CYGA 3SGGA 1E5JA 3MUIA 3QSTA 4QROA 4Q7NA 4C6LA 4TV5A 1ZNNA 4RXGA 3SEPA 5C9WA 4GIYA 4D6IA 1QNOA 1R3SA 4E8GA 1Q13A 5D03A 3WBEA 4EK7A 4RR4A 4P7NA 3GYEA 3O6AA 1M04A 1ME9A 4PH6A 5C7VA 1TWZA 4JTKA 3S1UA 3W1MA 1OBAA 3EB3A 1TA3A 1Z9AA 1FCVA 2HQAA 1HNYA 2PRMA 2RDTA 4DEFA 5EMJA 3UZZA 5HR7A 3FK4A 5AC6A 4JN8A 2CBIA 1ZALA 3UR5A 2UY4A 1E3ZA 3S9YA 4B5TA 4D1IA 6TIMA 4IIBA 2OQLA 2Z6IA 3TWAA 3WH9A 4N9DA 1XI3A 1I75A 3GVVA 3F4DA 1XR2A 3HPFA 4QNWA 4CCCA 5U7SA 2HISA 4NVTA 3LV5A 4CEXC 3IARA 3QRHA 1FHVA 1XCWA 2XYLA 1TX2A 1XD0A 2XN1A 4FOJA 5CSUA 1JZ2A 4LS1A 4NJHA 1WYIA 3W87A 3DZ1A 5H1WA 1D3GA 5HUOA 1JYXA 2QS8A 2OWCA 3ZLGA 4BF9A 5AC7A 2E6FA 3SY1A 3W7DA 1R6WA 2X09A 3PB0A 1LLZA 4DF0A 6PTDA 3TJLA 3N25A 5C5YA 1XV8A 4AXNA 3AIUA 2PZ0A 2NXGA 1LROA 1SSGA 3RG6A 4WJXA 1OABA 4UXDA 2EG8A 3G18A 1BVWA 1VB9A 1QI2A 1FWJC 3W7LA 4LS2A 3RM4A 4G7FA 2ODOA 3HPZA 3DCPA 4D1JA 4JKLA 3HURA 4P8XA 5DN1A 4PSRA 3VC5A 2PWVA 1E6XM 5LA1A 1EYWA 1OX6A 4CN4A 2A7RA 1LLWA 1P6BA 3UXDA 3MC5A 1V08A 2YIHA 3EWYA 2PD9A 1Q6GA 4FR1A 3DG7A 5BWFA 1KM5A 2Z2BA 1WA3A 4NF7A 1T5AA 4QITA 1FWHC 1RY0A 2JE8A 2WJEA 4L6DA 4C7GA 3S5SA 3TSMA 1EUAA 1Z32X 2D73A 1XX1A 5HWMA 3DC0A 1JL8A 4MNMA 4LV4A 1Q8JA 3KP1A 5HNUA 5ABFB 1C92A 2PZNA 4A8RA 1FWWA 3OA5A 1PKLA 4N42A 1TJ2A 1XC4A 4O14A 2BDQA 4CLMA 4UQ9A 3QV6A 3L5LA 1M65A 4DB7A 3M0LA 4CQDA 4CD7A 3KVKA 4CNPA 2GSEA 4AX7A 3BK0A 4Z2GA 3IRSA 2CKSA 4WK9A 4JTQA 1NVMA 1BHGA 1AW2A 4UR8A 2REQB 4AIOA 2QPXA 4QG6A 4AZ7A 4L4LA 5AHNA 3ARXA 2REQA 3PJXA 3FYYA 2A3HA 4S3DA 3QH2A 4JTHA 4JTIA 4LNYA 3WJSA 3UCQA 3W7JA 3FJNA 4MY1A 1I2QA 1LWIA 3H4XA 4IIHA 1R38A 2Z2UA 1A5MC 3NQBA 1WQ5A 2ZC1A 5GNZA 2PDJA 3DUGA 3LX9A 1JRCA 2D2GA 3GXIA 5HMFA 1JUKA 4PMUA 2ZXAA 4AFYA 4X22A 4O8AA 1V7YA 5D38A 3R12A 4O53A 4J35A 4ICMA 3C0JA 1K8CA 4ZFCA 4F0SA 2Z4GA 1OADA 2Q02A 4J27A 2IW0A 1SR0A 1DWHM 5DELA 1IT8A 4DAIA 3M0IA 1J6OA 3KHDA 1IQ8A 3P0WA 2JGQA 3GXTA 2QCCA 1KTBA 1DIOA 5HR6A 1UASA 2ZCGA 1LOSA 4HN8A 4LEFA 2V82A 3IJDA 2PC8A 4MPQA 3QPYA 4X9YA 2CZFA 3JS3A 2WCAA 4C1KA 8RUCA 1KRBC 1DEDA 3KLKA 1QHPA 2VFGA 2BLEA 5F1VA 1A5NC 2FZMA 2XZ7A 1XKJA 2ZZ1A 3LHVA 4NZ3A 3AHYA 1AD4A 3M9YA 1E0VA 4H41A 1XGZA 1TTJA 2WNNA 2VKZG 1VFLA 3VYLA 1PSCA 2E5DA 1QNQA 4P8WA 2J27A 2IS7A 3W29A 3DFQA 3FKRA 2OEJA 5GQBA 4DO6A 2WMJA 3KCOA 5M1TA 4EE9A 4DM1A 3UA4A 2ZVRA 3RPMA 2Q8XA 2NQHA 5I3DA 3AJXA 2TSYA 4LOCA 1ME7A 3WL0A 1QU4A 3A47A 2YCJA 3WQDA 4JAWA 3LMZA 1OCJA 2WBKA 1U22A 4BS0A 3ABXA 3VNYA 4G8TA 1XYZA 2Z1WA 2WCSA 4RXFA 1UR3M 4M5PA 5C2CA 3NDZA 3A64A 2DSWA 1HX0A 1D7KA 3KRBA 5IM51 1QATA 1WKYA 5K2ZA 1EJWC 4Z1DA 1GQJA 1U5HA 3VK5A 4GVHA 3VZZA 2FZDA 1SO5A 3W6YA 3S9IA 3TZFA 2BXVA 4HT3A 4B5SA 2C1GA 2WVVB 3VINA 4ADSA 3WMSA 3WEZA 3IACA 1E55A 1RQEA 1M1BA 4JL2A 4P2VA 4X63A 1UIPA 3QMRA 2BB0A 1EPXA 4QE4A 1KFJA 1KGXA 1DHPA 3BSGA 4DQWA 3GZ3A 5LSMA 2BASA 5BOOA 1BPLB 3RMJA 1JZ5A 1F9CA 3LI1A 3ONCA 2HS8A 3M64A 3S46A 4QTGA 1Q5MA 1JCJA 2EEXA 5EFDA 2XIBA 3QHMA 3B4YA 1XLIA 1R3VA 1H49A 1CX9A 2IPGA 4UR9A 2E68A 2WJFA 4UFLA 2DY3A 1K7XA 2OO6A 5J8LA 3QFEA 3W4RA 4YWSA 4B16A 4E8DA 1A5AA 2B4GA 2D23A 4ZL1A 2Y5JA 2DZXA 1UIOA 3LRMA 4NJIA 1EBGA 1GNXA 2NW0A 1E51A 3CUJA 4GO8A 1QK0A 1YPXA 4DXVA 4LUSA 4OOUA 1CT5A 3W9ZA 2D2OA 4HN4A 3EB2A 3QMSA 3AU6A 1RD5A 3W2LA 3PFMA 4US6A 1RCXB 1TV8A 1UP0A 2X0SA 2IKJA 4GQRA 1MZRA 3TTEA 2PGEA 5AHFA 3FHQA 3QEZA 3T05A 4W84A 1POKA 1M7PA 3E2VA 1OD8A 1HJXA 1J8VA 3LM7A 3R0UA 4GZ7A 3AISA 4YTRA 1KFKA 3KBMA 1TE1A 4Q8QA 5A94A 1EDGA 3MZNA 4M56A 3WSUA 4QRNA 4FP1A 3UCDA 1XC6A 1OFOA 1M53A 1DWFM 1HZYA 2CHRA 1WDSA 3T2OA 3WMBA 2CETA 3JRKA 3UPBA 4H7CA 4UFMA 4N4QA 3NURA 5FSEC 4I5RA 3N9RA 5HPCA 4LRSA 3BMWA 5CC5A 3NM1A 1XIMA 4QBXA 2VZSA 2XFWA 3S6DA 1Z41A 2X1SA 4C6KA 3CHVA 2C8NA 1ZJAA 2WJDA 3WBWA 1HFBA 1VIWA 4DAFA 2EG6A 1HQTA 1BKSA 2PLCA 4JHOA 3BLKA 3P0XA 4FB7A 2J8GA 3L4ZA 4WJEA 3S5ZA 2AKZA 4O28A 5JU6A 1V02A 2E0PA 1Y0EA 3ARWA 3MHFA 4QG8A 1MEIA 4I5UA 4PA8A 1LF1A 3NTYA 3OZMA 3TTQA 1C7TA 3A3HA 4IFKA 2R91A 2CEQA 4KS0A 4TQTA 1CNVA 4QCFA 1GHRA 3H24A 1ZBWA 3VIMA 1MSSA 3QSRA 4ZBCA 1X96A 1SU5A 3JW7A 4MZ1A 2LLEA 3PBYA 2QT3A 3NGFA 1YNYA 3VC6A 2PGRA 4AXKA 3LCXA 4XZMX 1OCBA 3MHGA 3QV8A 2VFFA 1TPDA 3MY9A 3NQGA 2FB3A 2DQXA 1QW9A 4UMCA 4AMCA 1KFBA 1ZJIA 5FF0A 4MF4A 1UKOA 8XIAA 5AYBA 1TFVA 1YE6A 2IPWA 3KWSA 3VFLA 5HQLA 3H4WA 4NL1A 2V69A 4FZIA 4JQ2A 1A4LA 1U1HA 4BY3A 3PZTA 4IMAA 3QYQA 3CHFA 3K8LA 5TAOA 3U8GA 3LS9A 1EJTC 1M7XA 2NZLA 3UXLA 1W9DM 3BLDA 3BAKA 3B8VA 4CEUC 1JPDX 1Q85A 4Z2JA 4CGTA 1LLOA 1BWVA 4MGGA 2FFIA 3N6QA 3CUIA 3LBMA 5I3JA 2PURA 1OX4B 2IQDA 1L8NA 1W0MA 4P7LA 2V38A 1JCNA 1GW9A 4IP5A 4D6EA 3WQ5A 3CUFA 3AI0A 4JTRA 1QPNA 5C9UA 2G3JA 5G4HC 3VDCA 3S1XA 4MFEA 2YX0A 5U4NA 3SRDA 4MPKA 2QCDA 1W3IA 1UZ4A 4MLJA 1GVQA 3UXIA 3C8FA 4FF7A 3MKKA 4NYYA 3SM0A 3STCA 1HL8A 3AZRA 1MDRA 2Y88A 3R79A 4AH7A 3W1XA 3GRIA 4J5NA 3UPMA 3U5YA 3T6CA 2R6OA 3VIIA 3L4VA 2FJKA 4NX0A 5FA5A 3V5FA 4O15A 1QJWA 3NQEA 1V51A 1E0UA 1TUFA 2AAAA 2PWEA 1SZNA 5MKGB 3QJAA 4IISA 5KZMA 5LA0A 4DUVA 1SJCA 3RX4A 4GE8A 3BPWA 1H63A 2ZX8A 4M19A 3BV7A 1FXQA 3I3BA 3TFXA 2QCLA 2QF7A 1GG1A 3NQ7A 2WSQA 4N6FA 1EJSC 5AHLA 5B80A 7XIMA 2JKAA 4P5UA 4JQAA 2OLHA 4B2DA 1QI3A 2F84A 4J4KA 2J7FA 3AMKA 1JNEA 3L66A 3OZYA 2ZA3A 3GG7A 1I9CB 1M01A 2ISSA 2FPVA 1K77A 1RCOB 3MJMA 4PFHA 1G4PA 4D71A 3P80A 4I9JA 2NXIA 3LBCA 2W91A 1TE6A 5CXPA 4INFA 3FJLA 2P8BA 5EB8A 1QHOA 4IFKB 3PB2A 2GQ3A 3N9SA 2FZNA 3O63A 4B91A 3HA1A 1UWAA 4LY4A 3LNPA 2J25A 1V6WA 3VX1A 3OGVA 1J93A 3A3WA 5CZTA 3GTIA 4DLMA 2QKFA 5EBUA 4F48A 3IWPA 1LOQA 2GPTA 4AIEA 4F79A 4LUYA 3TOYA 1Z69A 3CH0A 4LXFA 2E9LA 1H7XA 4PCSA 3W2UA 4Q6JA 1SQ7A 1YDOA 4H6RA 2BGNE 4E5TA 1C7SA 2FGLA 3R11A 2C14A 4EXBA 3IK4A 3W1PA 3SUSA 3REQB 4KT2A 2ZA1A 2G4FA 3HPXA 1NQ6A 2ZX5A 1R3TA 2GVGA 3MSRA 4UQCA 2PP0A 4IT1A 3FSTA 3K2GA 4F8XA 5GVJA 5JVLA 7TAAA 1D9EA 3KM8A 1X7IA 3TC6A 1ZTVA 2VCCA 1M6JA 4LUIA 3NZQA 2C18A 4V27A 2G95A 1R2TA 3L2LA 3KTCA 3W7CA 3FXGA 4FAMA 2ANUA 1GW1A 4GISA 1OY0A 3CYVA 2IMRA 2WQPA 3NO1A 5HINA 3W85A 2PDYA 4W86A 1EIBA 3UFYA 3KS5A 2E1DA 3PAJA 3BAYA 1UD2A 3WQPA 5A6TC 5LIWX 3U6WA 1R46A 4IIEA 2FMOA 3RJYA 4ADUA 3UJEA 4MJ2A 2V63A 2PODA 3FN9A 4W7VA 4FLOA 3TC7A 5DEZA 1XCFA 1E9ZB 1KC7A 3CTTA 1REQB 3CYJA 3EPOA 1JDDA 1NU5A 5CZ0A 3GFYA 1O12A 2ZICA 3KAOA 3OPSA 3IAQA 3NWRA 3L67A 4DPQA 3D0CA 3CO4A 2QDGA 2BOFX 2GUYA 3C2YA 5I3FA 4P7OA 2VD8A 3MU7A 2V67A 3NPWA 2HZGA 2Z26A 2X7WA 2PU1A 4QS5A 5C70A 4PUJA 3QQWA 3LGEA 1W2PA 1BD0A 2C71A 2I56A 1AMKA 2J77A 1FHUA 2PRLA 2D0GA 2JEPA 4ADTA 1OGSA 4QISA 4RJEA 3B9OA 3T0TA 1N8WA 4EAMA 1ECQA 4MMWA 1ZAIA 2VP8A 3UR7A 5L9FA 3TAOA 1X6NA 4HA0A 1PIIA 2WK2A 1B30A 2VX7A 1G6CA 2XIMA 4Z2KA 2VC6A 5SWUA 3E9AA 3P3BA 3AZTA 4CU8A 1HJQA 1EHNA 3P62A 1G5AA 2A79A 4PULA 2BOEX 4Q7BA 1WDRA 5G2IA 1B3WA 3MP3A 4MKNA 4N4PA 1R9YA 3H2NA 1I0BA 2OZTA 1UPPA 3T8QA 1ZU8A 5FL0A 4AWSA 2XUCA 4JICA 2B0MA 2CNCA 3AIWA 1OIMA 4GNKB 6XIAA 4XTIA 1QI4A 4U5KA 1G4EA 4ZSTA 1BXNA 5AN7A 1F8MA 4JTCA 4OBSA 4MIMA 4JX6A 3HG3A 3MSGA 4B5WA 2GVYA 1ZZMA 4GQQA 4PUKA 4KGJA 1JZ6A 1K4GA 1FFQA 4EF9A 2ON3A 1XIJA 3IJQA 1IWBA 1LT7A 1O5KA 4DRSA 1HIZA 1SJDA 1K8YA 2OTDA 4B5NA 2E09A 3ZVHA 3POCA 1XYCA 2HBXA 3TUUA 2O56A 3M0XA 2OX4A 4XZHA 3EGJA 1OZMA 3ZT6A 4UOZA 4XQ6A 3BC9A 4LF2A 3WLJA 1OWQA 3ZSTA 1EPVA 2FZ8A 1FDJA 2PDPA 5CGMA 1B2YA 4HU3A 5C7HA 1XDMA 2AMXA 1GJUA 3KE0A 3C2RA 6XIMA 3H53A 4F3HA 1W5OA 4XIMA 4TXEA 1VYRA 3ZS4A 2OPJA 3ECQA 1E3XA 3VDAA 3UG5A 1W31A 3TW7A 4XVEA 4IP4A 3QVQA 4Y6GA 1W91A 1XLDA 2E77A 4XAPA 1JDCA 2PTZA 3DXIA 4IWWA 2BXZA 2GL5A 2Y0FA 2WZTA 2R8WA 3BGJA 4NQ1A 3CWHA 2E9BA 4LALA 4CUCA 1VP5A 2VGFA 3EYPA 1MEWA 3W07A 2QCMA 4KRUA 3CQKA 4C1LA 1Q8AA 3V36A 3W2JA 1M7JA 4QS6A 3VFCA 1JGIA 2QPSA 3CAKA 4JEJA 3NZ1A 4JKMA 2VFDA 1TPFA 1W3KA 4C6JA 4N02A 5K9XA 1KXVA 1HKWA 2ZBTA 2HCVA 6CGTA 2PA6A 4AWEA 1DJYA 1XS2A 3GC4A 4Y9OA 4FO4A 3E0FA 3ITVA 3S42A 2ONEA 1H1NA 3AROA 1RLDA 1PYMA 4URIA 2ZWYA 4UTLA 2NQ5A 3GW0A 3GFXA 3LHZA 1RBLA 1EJUC 3AS3A 2MUCA 3TR9A 4HHLA 5I24A 3URNA 1JIBA 2OWXA 4UCFA 4AW7A 1VC4A 3N2CA 3IIPA 2GWGA 4C6MA 3M0JA 4JYEA 4GWEA 3NOYA 3CWNA 4EXAA 3VD4A 2RDXA 1QWGA 4ASTA 3RO8A 3VIHA 3RXZA 1P7TA 2WWCA 2Z1KA 4MADA 3SN1A 2ZRXA 4K39A 1ZFJA 4AD5A 1AQHA 3WNMA 4KPLA 1N7KA 1UR4A 3H7RA 3TN6A 3A9IA 4RE0A 2A3EA 1XINA 3JZEA 3UEQA 4QDMA 4MHBA 3KUMA 3AWNA 4QLJA 4H19A 2WPGA 3G8RA 3I3DA 2WC3A 3M0HA 3P5YA 3CUGA 5FJRA 5LNUA 4HP5A 2GZXA 1UR8A 3C2EA 2Y5SA 3ARQA 5DO8A 1YTEA 2PBGA 4WSKA 3UPWA 3GDRA 2J66A 1KKOA 3C56A 4GVGA 1KGWA 2XGBA 5M3WA 3BQ5A 3BUVA 4JOMA 1ZHAA 4WDWA 3GXDA 3GG8A 4AD4A 1QXLA 4PMOA 1XQLA 1RCQA 1SGJA 5HMEA 3VNLA 4H04A 3KTXA 1TTIA 2DT0A 2FFCA 4QG9A 1OT1A 5JBDA 4M6UA 5E5CA 3PM6A 2ISFA 5LIYX 4L4MA 4MJMA 1OD0A 3E38A 4TVCA 5AC5A 1IEIA 3KRUA 4MM1A 3HIJA 2OLSA 4Z1BA 5TNVA 5KETA 3F2CA 1QDSA 1TV2A 3GE7A 1DHKA 5C8BB 4LX4A 4GUFA 2BV9A 3B8SA 4QXIA 2PFHA 3P93A 1KR1A 1US2A 2V2CA 1UG6A 5MHBA 1FX6A 1HKVA 3BXWA 3CL7A 4Q8WA 3C6CA 5BXSA 2POZA 2EKGA 3OVGA 2NSXA 4HNCA 4RZ6A 1QTWA 5CBBA 4H7ZA 3UWWA 1VZWA 2QMKA 4H9YA 3NQ6A 3VCCA 3L2MA 3K1GA 4PCFA 4AC1X 1HTIA 4RPQA 2H90A 3SDOA 4HHMA 2J7GA 3M41A 4JEQA 2FVLA 2VFEA 3E02A 5FI8A 3W25A 3C0SA 1CW2A 3PZIA 1HW6A 1BRLA 3ZT5A 3B06A 4MFDA 4O12A 1RXOB 1LT8A 3M5VA 1C93A 3EAUA 3STGA 3VNDA 3O2LA 3CT2A 3H4GA 2I17A 1OGGA 2VUYA 5LHEA 3WQ4A 2NQJA 3VXGA 2WNQA 4NNCA 3A3XA 1GYLA 3B97A 2YZ5A 4V15A 2X2YA 4DF2A 3NZPA 3CHDA 1XIEA 2OZ8A 3A22A 2FPTA 3UNTA 1EA0A 1AQMA 2W27A 3PNUA 1JUEA 1XG4A 1PVNA 1KCZA 1PJ9A 1EF3A 3TYZA 2F38A 1OG6A 3C3NA 1D8WA 1DJNA 2DIEA 1CTNA 3T55A 2VEFA 4RNIA 4TX8A 4S3AA 5I07A 2J6VA 4BHYA 2NT0A 3QBUA 2YKKA 4JHMA 4CNSA 4IMDA 3HFTA 4PMJA 5HA7A 1EOMA 3SW6A 3D6NA 3DGRA 1SPQA 2QVHA 4HNOA 4DHGA 4XD5A 4DX3A 1F4HA 3GY1A 5BRQA 3MMTA 3BICA 4Z0SA 5A6AA 4UMAA 4Z1YA 2PDLA 1U33A 1T8XA 2WOQA 2INEA 1CGUA 3PS7A 3KBNA 3LBOA 4NKCA 5K3VA 5PTDA 5D9NA 3NQFA 2VDHA 4Q8UA 3WLKX 1XKYA 3WLRA 3F4CA 1SZEA 3TW6A 2EBNA 1NDYA 2A1YA 2XWDA 1DOSA 4I6KA 3TZNA 4A22A 1NDZA 4V2XA 2PGFA 4DZHA 1JPHA 3IJ7A 1RBAA 2ZUUA 4NAEA 5D8ZA 1JF6A 4D9PA 2C0HA 3AU2A 1OFEA 5I02A 3EWDA 5GNYA 2QDHA 1S2WA 3N6JA 1A5BA 2G50A 3N1AA 3CU2A 1YIXA 5A8OA 3E49A 3W38A 1TKKA 4N9EA 3CZ8A 4UQEA 3PUEA 2OYLA 1XFBA 3TROA 3GIPA 2A2IA 5KZEA 3BJTA 2BBFA 5MF5A 1SUXA 2E40A 1PV8A 2Z1XA 4LV9A 4ZE5A 1PEZA 1NAL1 3AMGA 4XZWA 1ITXA 4DWSA 2DH3A 3AHXA 3SRFA 2W4XA 1R3RA 4GKTA 1UH3A 3MHUA 2HVNA 2AAMA 1C91A 3G1VA 1B0IA 4OTKA 3CUHA 2EO7A 3LEPA 3OLIA 1UWIA 3K8KA 4DJDC 4FXJA 4DYEA 2XFYA 3LYEA 1TIWA 2GQ9A 1HUVA 3WQ8A 3UWVA 1U30A 1J9YA 3SCUA 1E1CA 4DJEA 4K8GA 1JPMA 3A4JA 2O9RA 5TQLA 2YBVA 1K4HA 3KOZA 4AVOA 2B7NA 4B3ZA 1KXQA 3GXPA 1LQ0A 1EJVC 2V3FA 3RUBL 4D6GA 4GABA 2INZA 4DWDA 4KWVA 1JYVA 5LHFA 5HMSA 3HQ1A 1TV3A 3UYCA 3CM4A 1J5TA 2IQTA 1DQUA 1PTAA 2FTWA 1O6IA 4Q4KA 1JQXA 4O10A 4AISA 3GW3A 4NXKA 4JFSA 2EPOA 3B0PA 3I6TA 4O11A 1BXBA 2G97A 4D72A 3S0CA 5XINA 4AZGA 5A2AA 5T91A 5AYYA 2ZTJA 4A2SA 3RCMA 2XIQA 4FI4A 1GQKA 5I03A 4S3FA 3BLIA 1Y5XA 3W76A 2BZNA 3BDKA 4BWLC 4CQAA 4CD4A 4HA3A 3IIVA 3CZJA 2XM1A 3UP8A 4X2PA 4J9JA 1W8GA 3NSXA 3IUHA 4KWSA 1C3FA 2PWGA 3URBA 2QEZA 1H3GA 3L0GA 4ATWA 1E4MM 1X98A 3NQDA 5D04C 3VKKA 1S5TA 1JNDA 2Q01A 2J7BA 3HM7A 3AUJA 2PDQA 4DWSC 2Y6ZA 2QQ6A 1R3YA 1W5NA 1FWDC 1XLLA 1V3JA 4G56A 2Y85A 1ALDA 4PEKA 1NWRA 1DJZA 4XV0A 3C2VA 4RE4A 1JI2A 2A7PA 5D8WA 4KKXA 2VFIA 3CV2A 3KX6A 4DELA 4REQB 3AHZA 4M1RA 1R30A 3PBVA 3TJIA 3PSVA 2W61A 6REQA 3RLUA 4FHAA 4AIUA 2CBUA 2XH4A 4L7ZA 1EP1A 3UQNA 5IFPA 1PIGA 4U2ZA 1H7PA 1PDYA 3FVDA 3WJYA 4OQVA 1RPXA 2Z00A 4R7OA 2F8QA 3I4EA 3XINA 1SW7A 4PB4A 4ERGA 3FKKA 3VGDA 3WD4A 2JK2A 1VAHA 3NOEA 4NY2A 2NUWA 3AZSA 3KLLA 4KMQA 4QE1A 4M6PA 2CHOA 4UQBA 1XRVA 4GFIA 3WF1A 4CVWA 4PL2A 3WEMA 1V8EA 1YE4A 2QVNA 1KRMA 3CPGA 4ACZB 4TU1A 3G24A 1V0NA 1HKMA 5CZSA 1E1CB 2BXYA 3ANYA 3AUOA 1H5YA 3PTDA 2F9RA 3G0SA 3SQMA 5EA9A 2ZQ0A 4EWND 1UQYA 5FJPA 1QOQA 3BW2A 1AQFA 1XYMA 1EKOA 1W1B1 3QHOA 3QGKC 1W9PA 1F3XA 3IVUA 5ENLA 1EO5A 2E5CA 1K02A 2OEKA 4GI9A 4RV3A 3M47A 1KB3A 1BYBA 1RJPA 4ACYA 3G1AA 4K37A 1XYBA 3R13A 4S3KA 4ORMA 1TPVA 1EZWA 5BRBA 4DYJA 3MMUA 3W81A 1JEZA 1W54A 2W9MA 3C3UA 3LCLA 4QQUA 1F74A 3LERA 3TXVA 5XIMA 1PHWA 1R5YA 4IIDA 4IL0A 3LPGA 4LYQA 2A85A 4ES4A 1UKPA 2QPUA 2ZRYA 1NJJA 1Q6CA 2HBVA 1MUWA 1XLBA 2C91A 1F07A 2JEQA 4NU7A 4H6KA 2WM1A 1NF0A 1FWRA 4C60A 3DENA 4U5IA 3CUZA 3TA9A 3PZNA 4DO5A 2ESCA 4DJED 2I5IA 4G2DA 3NSNA 2WNWA 1A3HA 3MI3A 4NAFB 1WUFA 1R3QA 2V0TA 2FTYA 3OVQA 2WHLA 1XYAA 2BODX 1S5WA 3H2EA 3ZOAA 5FJOA 3R10A 4KWUA 1MQQA 2WZMA 3EPNA 3T1GA 3T2PA 3B3DA 1YXCA 1TCDA 1LQAA 4F0LA 1EP3A 2CXEA 4XAZA 1OINA 1E1EA 5BW6A 3NQAA 3W2KA 1DVJA 3WF0A 1EDTA 1TZZA 2I5GA 2OEMA 1MNZA 3R0KA 4NP7A 3FLUA 3T09A 4BI6A 3BSHA 4AHQA 5A8QA 1V3MA 2X7VA 3A21A 3PTMA 1ZAHA 1TTPA 3VKAA 1FFRA 2VX5A 2BGQA 5IHSA 4ZB2A 1XICA 5T26A 2G3FA 1ZJHA 3VA8A 3GHUA 1UPMB 1MW0A 1B31A 3RCYA 1VFSA 4C6BA 3SB0A 3SCWA 4B4HA 2VFHA 3M1ZA 2DH2A 5I00A 2C7FA 3TNOA 1FKXA 2J78A 1PS9A 3W83A 1XM3A 3Q45A 4ROQA 3U7BA 1TCMA 4I90A 1C8QA 4RNHA 1W1A1 3T0BA 4GUIA 2QIWA 5G4EA 3DU0A 4R5EA 3GH7A 2W92A 3FJ4A 4JS3A 4NRSA 2OQYA 4WIWA 1V0KA 1F7BA 4AY8A 2PTXA 1DWJM 3BMVA 3FDKA 3H2CA 1X39A 4HKPA 1FWTA 4GQ0A 1TA3B 3KHJA 1NFPA 1TVLA 5AECA 3SY5A 4IQDA 2OJPA 3V75A 1YDYA 5CCZA 3TN3A 1VS1A 3NUKA 3N13A 1EEXA 4HB7A 3OYXA 3SSZA 3UD6A 4MDOA 3DEQA 2ZC8A 1S3TC 4POCA 5BCAA 5EY5A 1UZDA 3XISA 4LCRA 3CGTA 2QJMA 3ZVHB 1E15A 2HK0A 4LVBA 3KOXA 2GFTA 2B7OA 1IYXA 3TP4A 4O4VA 3A6OA 2R1KA 2IXVA 1UBPC 3MUY1 1E4LA 4DYKA 4ZQRA 2DZPA 3CIXA 1BTMA 4K38A 4JIPA 4O0ZA 1OHLA 5F2IA 4QAIA 5KINA 3ZSSA 4FNQA 5DY2A 3SUUA 2W5FA 4GY1A 3B9AA 4PMNA 3BH4A 4ZODA 1BYAA 1JCTA 4AD2A 5BU9A 3M7WA 4UNIA 1LRTA 1GQNA 4Y7EA 4N0RA 1TB3A 1GONA 5AHIA 2WMGA 1N8IA 1R8LA 1RH9A 3O0KA 2WHKA 1TPEA 2YL5A 3ES8A 5BROA 1XLJA 1TMQA 2V5LA 4NI8A 3N14A 1WDDA 1ICSA 4LNCA 4QJ5B 1RK6A 1R9ZA 3NG3A 2YOCA 3LN3A 3MUXA 4JGDA 2WMFA 5A8MA 3NL2A 2DVUA 1EQCA 3STPA 4HYWA 3S6OA 1W3NA 2O7SA 4GBDA 3THAA 3EWZA 3H26A 1NF7A 3WEOA 4FK9A 1FXPA 2BOGX 3N2TA 1OM0A 4H7VA 4Q8NA 5HNRA 1BWLA 3BANA 5CLTA 2XJ7A 4AVNA 5M2FX 4LUTA 1FH8A 1UR9A 3QGAC 2DUXA 3CV6A 3W7MA 4BFAA 1TPUA 3RN6A 4AIBA 2PPGA 1I0DA 2O4QA 3PZQA 2L5HA 3S1GA 3ABRA 3M4HA 1BF2A 5D2TA 1TR9A 2IQ0A 3ITCA 5A69A 1VLWA 1SYTA 1FCQA 4QLKA 4GINA 4ILSA 2Y89A 2PDKA 1Q65A 4I7WA 3CBWA 4CNNA 2VGIA 1GOIA 1G7VA 3BZGA 4GJJA 5I3GA 2XN2A 4OOZA 1JCMP 1NOUA 1XBZA 2Y70A 3CZGA 3NAVA 4REQA 1I60A 5AOUA 3I6RA 4ICCX 3QQ0A 1UUMA 3KS6A 9XIMA 3SN0A 4NSBA 1YQ2A 4GYPC 1M3UA 4NZ4A 1E1FA 1R7AA 1RA5A 2RH9A 3P67A 1DJGA 3G8EA 4L9YA 2QUNA 1JI1A 3F03K 4PMVA 3LGDA 5D32A 4H3DA 3HZ3A 4IX2A 1I8JA 4UR7A 4HJWA 2D24A 3VIJA 2WWDA 3NA8A 3R94A 2UY3A 1FWAC 3MYPA 1CWYA 2D1ZA 5T8GA 3DESA 3TNBA 4HHHA 1PZ0A 3G1DA 1I4NA 1VPYA 3DDMA 3AXKA 4H6EA 3W1AA 2R1MA 5E93A 4GZEA 5XIAA 2ZA2A 1H60A 1OC7A 1KO0A 4J3SA 2ZOXA 3ZR4A 3WNKA 3TQ0A 3OEXA 1F61A 3M43A 2WZHA 3REQA 4D6CA 3WQEA 1P0DA 2P8CA 2O4MA 2GVJA 4HMNA 4R9XA 3HMJG 1V93A 4H9XA 1VD6A 3AYRA 2J13A 3WDPP 3DFOA 4A3RA 3PY2A 2WPBA 1ML1A 2WCGA 3LPFA 3UERA 5D4YA 4WRHA 1TVNA 4HBKA 2GOKA 2QUMA 4NAFA 1TJ0A 1KR0A 3H2MA 4H2HA 3MYOA 4Y96A 1AFSA 2DV0A 3VGHA 3C5QA 3W7EA 4AMAA 1A3WA 4W85A 4H83A 3OGSA 3T44A 4LW7A 3OBEA 4LVGA 1N2VA 2MNRA 2E6YA 1Q6RA 4F0HA 2Q8ZA 2AL1A 1DJXA 1B3XA 1FWBC 1LZOA 2DJLA 1E4IA 1BSIA 4NYUA 2H9AB 3NEHA 4AWUA 3VAVA 4A05A 1E71M 3QC0A 3RLGA 1EF2A 1RQHA 1QNPA 2W67A 2GQAA 3BTNA 4U3CA 2HPIA 3UJRA 3MQTA 3W84A 3WUGA 2YXOA 2WVTA 1ODZA 1UBSA 4DPPA 4MAVA 5HNNA 3QOMA 3S2NA 3HMCA 1E5NA 2C13A 1LL6A 2V5JA 3UG3A 2V3DA 3WF2A 1VYPX 4OECA 1TR1A 1LM1A 3DIPA 1H7WA 1UP2A 2QCHA 1H41A 3GNDA 4K6AA 2V5BA 3VNIA 1UOZA 4IXHA 4AHOA 1WDQA 1OK6A 1EZ2A 4UC5A 2VWTA 4O1DA 1W9VA 4CQ8A 3W75A 4Q4OA 4KIEA 5J5DA 3H23A 3CT7A 5ABFA 4IQLA 4E4UA 1AA1B 5FAGA 3DH7A 4ZQOA 3K8MA 3W1NA 4AZBA 5AVHA 3VOHA 3EDFA 4MZ8A 5H6HA 2Q8LA 1C9WA 2EPMX 1DWIM 3AALA 4AZIA 1WNOA 4UB9A 1TV4A 5BMWA 2CZDA 3IGHX 3TR2A 3VIFA 3VVGA 5K4ZA 5DMNA 4YWIA 3G6MA 2PCQA 4WCJA 3ITXA 4KFOA 3CMGA 1THFD 1CLKA 1TWWA 3WYZA 2E3ZA 1ZBCA 3EX3A 3ANVA 1GOOA 1GYMA 1Y5WA 1C8XA 5BZAA 1AJ2A 1XIFA 4HNLA 1X7FA 2NVAA 2OT0A 4IGSA 4PL1A 5FEPA 3TCEA 1XWYA 4A8IA 1HP4A 5FF2A 1UD8A 3NCOA 4PUUA 3WENA 3HGRA 4HVXA 4A6GA 4BJHA 2YLLA 1O95A 1AZ1A 1X6LA 4IF2A 3WF4A 3VCNA 3C8NA 2UWFA 4L6HA 4PN2A 3WQVA 4TX6A 4EIVA 1U1UA 2OR2A 3MT1A 2FMNA 1ZJBA 3RDKA 1FRBA 2GVEA 2YLAA 4GQBA 4I3GA 4MYXA 3VPLA 3CQIA 3SUWA 3N18A 5JMUA 4ZEPA 2V9DA 1PKMA 4PCTA 4UZUA 4AX6A 2Y61A 3BJFA 3W53A 3NQ8A 3WDJA 3EWCA 5IHRA 3CO8A 4LJ3A 3GUWA 3PPFA 3GDBA 1EGVA 4LQ1A 3UNDA 1CIUA 1UD5A 3BE7A 4KRZA 1NELA 3U9IA 3QW4B 2HNHA 2P10A 2PTDA 1F6PA 3BCDA 1GPFA 1FWNA 2PLMA 2TPSA 2WVVA 1HL9A 3WL1A 1ITUA 3F2BA 1E6ZA 3VX0A 4JFVA 1FUYA 1TJRA 5JQ9A 4PTDA 1R85A 4L1WA 3PZVA 3VUPA 2OGJA 2XN0A 3EXTA 2FVMA 3IGXA 2UZ9A 4NJJA 1FBAA 2CFFA 1XYFA 1VJZA 3GNOA 3WH8A 3P14A 4GZIA 1L6FA 5HJXA 2Q6ZA 3GWQA 3EXSA 3FY1A 3O07A 1ECEA 2CBVA 4FSAA 3DN5A 4WDTA 4RNJA 4TUFA 1TSIA 1FCBA 2VR4A 5T9BG 5BXPA 4X60A 4J3XA 2YA0A 2P3ZA 3F5JA 3T4CA 4PBGA 5CAHA 1VCVA 1MO0A 1LL4A 5FEZA 1POJA 1W9UA 1K03A 2E1WA 5CPLA 2XVKA 3F1QA 4XIAA 4LSBA 1H4PA 4MB1A 4QIUA 4IGNA 2E6DA 2GQ8A 3GZAA 2GSJA 4MAZA 2GJLA 3U57A 1GOWA 1KBKA 1P6WA 1EP2A 3VIKA 1VH7A 2RJGA 3ZXWA 4OVXA 4HCDA 3FYPA 3GAYA 4JL1A 3O05A 3B9NA 1A49A 3EEZA 3BW3A 2ZUVA 1QHZA 1VJSA 5IOBA 1J0ZA 4BR1A 3G22A 2VURA 4W7UA 5F2GA 1GCYA 1O5QA 2ZUMA 5EU9A 3NEVA 2IKHA 1NSJA 4YNGA 2P1FA 5DY3A 2AQOA 3NL5A 4DZIA 3B40A 4IFOA 4AQLA 3W6LA 2WMHA 2Y8KA 2YA2A 1W1VA 4CD8A 1GKQA 5E6YA 4IMGA 2V30A 1MW2A 2PS2A 3CH9A 4A21A 1V6VA 2NLYA 1WX0A 1JCXA 1G4SA 4GPNA 3HU7A 4UQAA 4Q8OA 5KITA 3QOKA 5EMMA 4YIWA 3ITYA 3F5KA 3ENLA 4O54A 2EF9A 2YFNA 4RZ5A 3HG2A 3TQKA 2Y63A 3AYVA 1RJQA 4DO4A 1S2UA 1NOWA 4NASA 4I7UA 4GK8A 1IE7C 2H6RA 3AAMA 2ZZ3A 3N2MA 4C6DA 1OFAA 1AW1A 1ZLPA 4LCSA 3N12A 1ICPA 1WOBA 4K68A 2HK1A 3W2MA 3AWOA 1GWJA 1X6UA 1FWFC 2D0HA 2WO5A 5DMYA 1WDWA 2WKGA 2XSXA 4M6QA 2VUNA 4S3EA 2EPLX 1RSCA 4AUBA 1V6YA 4K1WA 2ACRA 3OLEA 1A5CA 4D8ZA 4FNUA 3MV11 3VKDA 1RPKA 2WMKA 5G2HA 2G5WA 3E96A 4DM2A 5HWJA 4O50A 1MEHA 4PTMA 3SFWA 3C4UA 2HEJA 1XG3A 3IUDA 2VM8A 2W66A 3W74A 4LGXA 4K7VA 3GXMA 2AL2B 3MI6A 2HROA 2QNEA 3VNKA 4CQBA 1PUDA 4Z2IA 1V4YA 4RK8A 3P7YA 2CLKA 1N55A 4YTSA 5CAKA 4ZOEA 4AD0A 2OZ0A 1VPQA 4MUPA 4ZTXA 3LLXA 4FIQA 5GJMA 2Z0IA 3W86A 3PNZA 4B5UA 1Q63A 1OJXA 4PMDA 1QT1A 1V3HA 1VF8A 3SIZA 1XH0A 3TE9A 1Y7VA 4HK7A 2ISWA 2X42A 3GG0A 2ZRUA 3VDBA 4FNRA 1K6AA 2OSYA 4I7VA 3FXYA 1R2SA 2ZUNA 2BGSA 4XZBA 2HXTA 2PBOA 3