1EQPA

Exo-b-(1,3)-glucanase from candida albicans
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
394
structure length
394
Chain Sequence
b'AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAASRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-B-(1,3)-GLUCANASE
publication title Minor structural consequences of alternative CUG codon usage (Ser for Leu) in Candida albicans exoglucanase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 153
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2000-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eqpA00
1JAEA 1R8LA 2XUCA 4AYSA 2YBTA 2J25A 3BSGA 3K8MA 4AEFA 2VRQA 2D20A 4JHZA 5E09A 3CUHA 4GINA 3II1A 2VJXA 4ZE5A 5LA2A 5A6BA 4Z2GA 3A47A 4RE4A 3AHYA 5ABFB 5EMYA 3B8SA 2JEQA 2WZIA 3AROA 4TVDA 2A3AA 3OLEA 1UWSA 4JIEA 1ITXA 1JAKA 5FL0A 2O9OA 1JDCA 3VIMA 2E9BA 5A6BD 2J7BA 3PZOA 3WELA 1NOFA 4XZBA 1UD4A 1EQPA 4UZUA 2VX5A 2OYLA 5M17A 1GCYA 3RM8A 4NZCA 1PX4A 3IJ8A 3NIYA 4XB3A 3CTTA 1L8NA 4P7LA 2W61A 1B30A 3SCTA 1HJXA 2VX4A 1CTNA 3ARZA 1E4IA 2FGLA 4HA1A 1HJWA 5I79A 3WSUA 1IT0A 2CXGA 1UKTA 5JIWA 4D6EA 3CHFA 3MMUA 4W7WA 1EOMA 1WO2A 1XCWA 1UR9A 1DWJM 2EPNA 4F79A 3MV11 2DPEA 5JUVA 1CIUA 1W91A 3WF4A 1E6NA 2WCGA 4N0RA 1PPIA 1JF5A 4OOZA 3BLPX 4BZYA 1W9PA 5KEZA 4GIAA 4QCFA 4J27A 1BAGA 4JFVA 2NT1A 3QR3A 5CSUA 2QLYA 2XVNA 4PMRA 1W32A 1W3LA 3POCA 1OWQA 4W5ZA 4D1JA 3WQVA 1HX0A 1NOWA 4B3KA 4HOXA 4L4PA 3WY1A 5I23A 2RGLA 3IJ9A 1I1XA 4B9ZA 2EPLX 1XH2A 5BXRA 4AD2A 1NWSA 2ZUSA 2YL6A 1VFFA 4HTYA 4M29A 5HPCA 1H1NA 4RE3A 1XD1A 4YPJA 3OB8A 3M46A 3AZRA 4XUYA 2ZX8A 2WXDM 5BWFA 5JBFA 4UFJA 3AHTA 5FIPA 1VFUA 3QHNA 4M82A 2WVUA 2F61A 3OZPA 4AWEA 3O9NA 2J7CA 4ACZB 1J0HA 3VO0A 1B3ZA 4HOWA 1KXHA 1BYDA 1CGTA 2ZX6A 3EMCA 1ODUA 3PZTA 1UD2A 1MVYA 2HVMA 2Z1SA 3MUY1 5M03A 3ZQ9A 1C3FA 5A6AA 1E6PA 3ZOAA 4AZBA 4HU8A 1CDGA 3RPMA 2WKLA 3BCFA 1JZ2A 1SMDA 4IM4A 5D9MA 4JFWA 5IHRA 2FH8A 2JIEA 5M3WA 1NH6A 4LGXA 4J3TA 4P8XA 2O9PA 3A4WA 1PJ9A 2V3GA 3GH7A 1VAHA 1C93A 3WNLA 4YHGA 2IXVA 1TVNA 4HPGA 4M1RA 3WQ6A 4QAWA 5EFFA 5DMYA 2J8FA 1E71M 1GZJA 1H11A 3T0DA 2XJ7A 1JFXA 1V6VA 5C8BB 3VM7A 4JL2A 5DT5A 4V28A 1JZ8A 1K9TA 1VIWA 1E0XA 5AYBA 3ALGA 3N9KA 4QP0A 2XIBA 1HP4A 3GDBA 1R87A 2D1ZA 2C0HA 2PBGA 1DP0A 1BHGA 1US2A 1ZJAA 1HN1A 1UQZA 1CEOA 5A8MA 6A3HA 1VB9A 3ARQA 2CKRA 4F8XA 3VGGA 4AXNA 3VVGA 5EFDA 1WZLA 3POHA 3NDZA 2A3CA 4ZEPA 4MB5A 4UQDA 2EPOA 4X9YA 3T2PA 3L2LA 3NDYA 1NOUA 3EDJA 1W1TA 4H04A 4OBRA 4H8UA 2CYGA 1HF6A 3AMLA 3N15A 4IPNB 4UFIA 4WF7A 3AISA 2YL9A 5FL1A 2O92A 2QV4A 3PZNA 4W88A 1UA3A 2WBGA 1LWJA 3PZQA 3CGTA 3I3BA 1HKKA 1V6UA 4AD0A 3OA5A 4P8VA 2A3HA 4MADA 3G6LA 2QPUA 1BGGA 1CXHA 1UQYA 1X6NA 2ZIDA 4H7VA 1ITCA 2J4GA 3MKKA 1J18A 3AMDA 2WSPA 1V3IA 3NYDA 2Y8KA 3DYPA 4S3KA 3CHCA 3F5JA 3NSXA 4PUEA 3MV01 3DECA 5A8OA 3WD1A 4KRUA 3FW6A 1E56A 2GJPA 2X0YA 3K8KA 1ISYA 3ARTA 4UQ9A 1XC6A 1OSEA 1QW9A 4D71A 4DM2A 4B16A 1E9LA 1UR2A 2WHMA 1ZBCA 3GXIA 8CGTA 3PZ9A 5JBDA 1RPKA 2QHAA 4W93A 1MFUA 1WB0A 4FLQA 4ACYA 3AXHA 1GOIA 3IANA 3RO8A 4BQ2A 1BG9A 1JZ3A 3VDBA 3WQ5A 3WF3A 3NCOA 2YDQA 3BAWA 2PI6A 2EJ1A 3MMDA 1G9HA 3CIVA 3KL5A 3WMCA 3NUKA 1UD5A 3IJ7A 3ARRA 3WMBA 1UKOA 1O7AA 5A3HA 2VX6A 3WUFA 1HIZA 2O9TA 2X09A 3PTMA 1HJVA 3K46A 1OD0A 3VIGA 4AC1X 2ZX5A 1BYAA 4CCDA 2WCAA 1J9YA 4D6GA 3MSDA 1UKQA 2DT3A 2JE8A 3W26A 5A6SA 4HMEA 2DH2A 5LA0A 2WMJA 1NP0A 3AMKA 1HXJA 4OKDA 1H49A 2VL4A 3CZJA 1VBRA 1KGWA 4D6FA 4TTGA 4FLRA 2EPKX 3SCQA 1DWHM 4GZIA 4WKHA 2V3DA 1B1YA 1OM0A 3LPGA 1U2YA 4TVCA 2D3NA 1E1FA 3MUZ1 2WC3A 1BLIA 1B3YA 4V2XA 1XGZA 1TA3A 2OYMA 4AZIA 1GOMA 1LG2A 4IPLA 1B2YA 2OSXA 3ARXA 4JKKA 1O6IA 4PSRA 1UR0A 4KMQA 1XYZA 1CXEA 4JFTA 3CLWA 2V38A 1E15A 3WQ4A 2E9LA 5ABHA 4BQ4A 4WK9A 3QGVA 1ZU8A 1QBAA 3N12A 1W9XA 2WYSA 3WF1A 1FH8A 2JF6A 1E3ZA 3ZJ7A 2QMJA 1VF8A 5BROA 3W81A 4B9YA 3CMGA 4AZ7A 3DHUA 5ECUA 1PZ2A 1XYFA 2XGBA 2J77A 1Q6GA 1E3XA 3FNDA 3T0AA 1GOWA 1XRVA 3GBDA 5I0DA 1JFHA 3AYRA 4BQ5A 1AMYA 3VX1A 5A8QA 4DM1A 1E5NA 3GYCA 3VDAA 3CO4A 3I3EA 3WQ8A 1WE5A 3IAQA 1EDTA 3WNPA 5BRPA 5LA1A 5C70A 1Q6CA 1CLXA 3B9EA 2XGIA 4HOZA 4PTVA 3EDKA 2PWDA 3ALFA 4W8BA 5A2BA 2CEQA 3AXXA 5FOOA 1B31A 2W92A 2Y5EA 3WD2A 5D9PA 2VZSA 1UH3A 3VU2A 3ZR5A 3AHXA 3U5YA 1W2VA 4DUVA 3WDPP 4Q7NA 3VPLA 1NP2A 1SMAA 4WKFA 3WF2A 1QBBA 2XVKA 2C7FA 3U57A 4TX8A 4Z2HA 4E8CA 1VRXA 2XG9A 3CHEA 3VIPA 1BYCA 3MO4A 4U2YA 5IFPA 4AZCB 2VVSA 4GZJA 6CGTA 3W27A 3PZUA 1MQRA 2ZUNA 1V6YA 2EO7A 1Q4NX 3CUJA 4PBGA 1HNYA 7TAAA 4UR9A 1V0MA 3DHPA 3M7SA 2XIIA 4Z2LA 5D8ZA 2DH3A 3W82A 4MNMA 3FAXA 1SFSA 1N82A 2YLAA 1UWQA 2PWGA 1K9DA 4KGJA 3F5KA 2W4XA 3GNPA 1J0IA 3BAYA 1DWGM 1OD8A 4TX6A 4J3UA 1E5JA 6TAAA 3G6MA 2WMKA 4J3WA 5A1AA 3CZKA 3ARSA 4UQAA 3UERA 2CHOA 4Y7EA 3PZVA 3AHZA 3QHOA 3VIHA 4H8VA 3K4DA 3VIOA 4UOZA 1CXKA 1PIGA 3ZIZA 1GVIA 4QDMA 5CZKA 5BYWA 4K68A 5JIPA 2FGZA 3UG4A 5GNZA 3WNMA 1UR4A 3WEZA 2DGAA 3SEPA 2CHNA 1QOXA 2GDUA 1E4LA 1TG7A 3GM8A 2WWDA 5CPQA 3WEOA 1JZ4A 4W89A 4ZENA 2OSWA 2J7EA 2WWCA 4HZ6A 2XWEA 3QOKA 5A6MA 4P7QA 3AXIA 5IDIA 3CPUA 4CGTA 4MAZA 4Q22A 5ABEA 5HNNA 5BXPA 4GPNA 1G94A 2PB1A 1LJYA 2G4FA 4M8UA 2ESCA 2BS9A 1UD3A 1YQ2A 5I2UA 1OB0A 5I24A 2NW0A 1XHGA 2VVNA 2JF7A 4GO8A 1EOKA 2HISA 3BAKA 4D1IA 1KCLA 5E0FA 4CD7A 4PMXA 4TUFA 5GNYA 3N17A 4PTMA 3BMWA 1EH9A 4UOQA 2J78A 3L2MA 3W29A 1BTCA 4OZOA 3WUEA 1OCQA 4AIEA 1C92A 5A6JA 4GZEA 4NSBA 1UR1A 1Q6EA 4H2CA 5C71A 3VD5A 2VCBA 3LPFA 1JYXA 1TCMA 2C8NA 5DFAA 4H8HA 4W8AA 3ZJ6A 2XFFA 2J47A 5KZ6A 2OWWA 4JAWA 4UCFA 4B3LA 3TTQA 4CD6A 4WSKA 2OYKA 1V02E 4NRSA 4MNJA 2GFTA 1UA7A 1HVQA 1QW8A 2AOSA 3AIWA 2QMKA 1KQZA 4E8DA 3GH5A 3SCWA 1RD6A 2EPMX 2CBIA 3SUVA 3TONA 1EDQA 4HMDA 4TTUA 4GO9A 3TA9A 3EYPA 1ZBKA 1XSKA 2QPSA 3VD7A 3WDRA 1NM9A 1ZJBA 4MTVA 1BQCA 4WLCA 2CESA 3NJ3A 5TD4A 2O9RA 2NT0A 4P7NA 1KWKA 2B31A 3ARYA 1QVBA 3GXDA 4AZ6A 1W9DM 4C7DA 1RP9A 1FOBA 3WIJA 4BA0A 4TOQA 1TA3B 4N42A 1RP8A 3ZSSA 1V6WA 2BY3A 4BS0A 3AZTA 1ZBVA 5A6KA 2XSAA 5I6SA 2WANA 1KXQA 3B9AA 1GOQA 2VNCA 1LL6A 4JKLA 2PF0A 4M80A 1VFMA 2VQUA 1HJQA 2BY1A 3W6LA 1V0LA 4LX4A 1Q6FA 1GHSA 2CPUA 3QOMA 3PHAA 2VZUA 3HN3A 4A3YA 3D5HA 1H2JA 4UNIA 2OWXA 1HT6A 2E40A 3U7BA 4EE9A 2VI0A 4GI8A 4KH2A 1XH0A 2F2HA 1W9UA 3T0BA 2MANA 4F66A 1UHVA 1U30A 5FCZA 5CXPA 4PCTA 3SURA 3KWXA 3S2CA 4QLLA 1F4AA 2GJRA 3ZSTA 3AS3A 4IISA 4DWSD 3VGBA 2GK1B 4AIUA 3AMGA 3CZ8A 4KWUA 2VMFA 4QLKA 1GOKA 4ML4A 1KGUA 2WHLA 3GNOA 1CGVA 4PMZA 1FP9A 3GXMA 3HMCA 1GJWA 2BHYA 2EEXA 4TVUA 5DO8A 1CWYA 5F7UA 3O6AA 1GQKA 2WK2A 1LWHA 1XD0A 3AIQA 1AQMA 1PX3A 2GJXA 3APGA 1BF2A 3LPPA 1IV8A 4IUGA 4D6JA 4RL3A 2WMHA 1M7XA 1GVYA 4AD1A 2JALA 2YL8A 1E70M 2G3MA 1GORA 3L4UA 2ZXQA 1J01A 5CLTA 3RM9A 3T08A 3L4TA 1HVXA 2CKSA 4GQQA 4CUCA 2BXZA 2J7DA 4LPCA 1V03A 3JUGA 2XSBA 5HPOA 2YL5A 3VIIA 3WNNA 3PBGA 1JYVA 2ZOXA 1QNOA 4PMDA 3N1AA 3SIMA 1G01A 5EBAA 1V6XA 5HBFA 1EHNA 4JFUA 2W91A 2WVVB 1HKIA 3AIVA 4M56A 1LG1A 3TTSA 4J3XA 3BXWA 3UG3A 1KCKA 3GXFA 1J0KA 2PBOA 1XSJA 3BSHA 2UY2A 7A3HA 1DWFM 3UR8A 3MUIA 1C7SA 2A3BA 3PZIA 2WKGA 3WDJA 1D7FA 2YBUA 3M6DA 1W1VA 5FD0A 1QNQA 2WMIA 3EDEA 4UQEA 4WSJA 5I78A 3LMYA 1RH9A 3ECQA 5I77A 2WVTA 4HZ8A 3FY1A 2V5DA 5JBEA 1PEZA 2OSYA 1OGGA 2VTFA 3SCPA 1JD7A 2WC7A 3WUGA 5AYIA 1GUVA 4ATWA 1OGBA 3VTRA 5CGMA 3AQUA 4WIWA 1CECA 1JNDA 3UETA 2VUYA 5A6LA 1H09A 1B3XA 2VQTA 1M04A 5D9OA 4CU7A 1KFWA 2VURA 1KGXA 2PWFA 2G41A 3ZT5A 4BCEA 1JYWA 1TVPA 1WZMA 2XVGA 1F4HA 1V02A 1M01A 5E9AA 4ZXLA 2F8QA 4MDPA 2VC9A 3PZGA 1K6AA 2V3FA 3RMEA 1GOOA 1JG9A 4ZE4A 5A8NA 3WH7A 4Z2IA 5D8WA 2VO5A 3VDHA 2WPGA 4HU0A 3F4VA 4URIA 1MWOA 2RGMA 1FHLA 4PMQA 5I5RA 1A47A 1E6RA 2FHCA 2VZTA 2GSJA 2ZE0A 1GQJA 3SCVA 4UQBA 1UH4A 2CETA 3WNKA 1ESWA 3PZMA 3MMWA 3OGRA 1BFNA 2YIHA 4PMYA 2WAGA 3KEHA 3N04A 2WSKA 4CN6A 3VGDA 3A4AA 4R5EA 4X0NA 3VMOA 3SCUA 1IZJA 2ZXAA 2BHZA 2D0GA 1UWRA 3AIUA 1B3VA 1CBGA 1PBGA 4PMVA 3U7VA 3DYOA 1SYTA 1J0JA 3B9DA 4HA4A 2BNJA 8A3HA 4JHOA 4MB4A 2NSXA 4A4AA 3L4ZA 4FMVA 1ECEA 1UWIA 2DIEA 4QFUA 1MXGA 3RJXA 4HZ7A 1E0VA 3FHAA 4Z2JA 1MFVA 4P7RA 4D6CA 1CXIA 1GQLA 2BXYA 1FHDA 2YJQA 1J12A 1MW1A 1VJSA 1CNVA 3PN8A 1JF6A 3MUAA 2W67A 4YN5A 4CD4A 3K4AA 5CSYA 2Q8XA 1R7OA 1CXFA 3KE0A 3ZJ8A 3FXYA 2CITA 3OLIA 2WHJA 2VT0A 5DEZA 1V3MA 1MXDA 1V3JA 2E0PA 5GQBA 3OLDA 2VZVA 1E73M 3AIEA 1C8QA 4A3HA 4J3VA 1BVNP 4CD5A 3ARVA 3BAXA 4M24A 1SR0A 2ZXDA 3VIJA 2DSVA 3HJEA 1HL8A 4QLJA 3VGEA 1H0GA 3KL0A 3UG5A 3MSGA 2EBNA 3EDDA 1QHZA 2XM1A 1EO7A 4U2ZA 3W0KA 1JDAA 4W86A 4AZGA 1EHAA 4PEEA 1WAWA 5BXSA 2BVDA 1CGUA 1GQIA 2DSWA 4GXPA 3WD3A 1HJUA 1VBUA 3ZR6A 3WD0A 2X2YA 1OBAA 3L4XA 3RM4A 1BGAA 1E4MM 2D3LA 1UKSA 3UESA 1WDPA 1EGZA 4U5IA 2DT0A 2UY4A 2VRJA 1JDDA 3WD4A 1W9BM 4WKAA 4L4OA 3MANA 4E4PA 3EDFA 1EIBA 2G3IA 4F9JA 4ATDA 2VR5A 1ODZA 3AOFA 3QHMA 4EK7A 4D72A 3WFZA 1KB3A 1PZ3A 1JXJA 3ARPA 3FAWA 2DSUA 5AC5A 1YHTA 4M81A 1MW3A 5D4YA 5DF0A 2ZXBA 1JYNA 1UG6A 3VGFA 3A3HA 1CGXA 4PSPA 2FHFA 4AEEA 3T2QA 3GZAA 1ZL1A 1QNSA 1R7AA 3THCA 1KWGA 1GW1A 3ZJKA 3SCOA 5HXMA 1W3HA 1TMQA 5IXEA 4UZSA 1E6XM 1XCXA 4MJ4A 2IXUA 1W1YA 3WDIA 2ZUVA 1E6SM 2ZX9A 1KBKA 2XVPA 4R27A 1GNXA 2DT2A 4NI3A 1DWIM 3GTNA 3W53A 3L4YA 1EA9C 4UTFA 1G5AA 2XM2A 2UY5A 4ZXOA 5A2AA 4OJYA 2WLZA 1UZ1A 1L0PA 2YOCA 3CUIA 1HJSA 3SCSA 1QNRA 1NWRA 1E1EA 1QPKA 1S46A 3F5LA 1MW0A 3DYMA 1ISVA 2WC4A 3OG2A 1TZ7A 2G8ZA 4W5UA 3RILA 2WMIB 3BCDA 1B0IA 1KXVA 3WL1A 2WZHA 4WJXA 2XYLA 5AC4A 1KBBA 3BMVA 1NARA 1C7TA 2VCCA 4PTWA 3W38A 3VINA 2J74A 3CZGA 3WL0A 1WDRA 3O2LA 1ZBWA 1OIFA 3WH6A 4BF7A 1GPFA 5A94A 4PMNA 1Z32X 1W3KA 2CERA 3FN9A 1VEMA 2X0HA 3ARWA 4TXEA 5CPTA 2CNCA 1UKPA 3N18A 1GHRA 2W5FA 1X1NA 5BCAA 1WKYA 2J75A 4PTXA 1U33A 1JZ6A 3VIFA 3SCRA 3NSMA 1Y7VA 2Y8VA 2J62A 3WDHA 4MNKA 3RIKA 3K1DA 2PWHA 4PUDA 3W4RA 4B15A 4W8LA 1K9FA 5IHSA 2BHUA 4AZ5A 3L4WA 5HDRA 1CGWA 4PRWA 1G1YA 1H0IA 3AS2A 3TP4A 2VCAA 2WCSA 1JI2A 4C7FA 4CU8A 1G0CA 5A2CA 1LLOA 4FF5A 3UR7A 1WP6A 1V0NA 4FK9A 1D3CA 2IUZA 4OIFA 1BSIA 3WBEA 3VOCA 2VZOA 4QCEA 4OBSA 2UWFA 1BYBA 5IFTA 1V08A 4NRRA 3MU7A 3ZO9A 3SUSA 1Q6DA 5CGTA 4KGLA 4AD4A 3VX0A 4JKMA 2X8RA 4PMUA 3CBWA 1OT1A 4AIOA 1H41A 4AY1A 4CN1A 3TOPA 4P8UA 2W63A 4JZ5A 2XHYA 4X0VA 3IK2A 1UUQA 1MYRA 5CG0A 1J0YA 4D6IA 3AHVA 1FH7A 2XTKA 1J0ZA 3PTQA 3WH9A 2YLLA 4AZHA 2EXOA 1JD9A 2CBVA 2ZUUA 1TUXA 2XFRA 5M5DA 3GNRA 2E9MA 2XWDA 1CENA 4MAVA 4DWSA 1JXKA 2DT1A 4EANA 1PIFA 2W62A 3CH9A 2Y4SA 4D6HA 1LQ0A 2GDVA 2OWCA 3E1F1 1HKJA 2Z1KA 2OLHA 1JL8A 4HP5A 2WMFA 1LL7A 1OINA 1E40A 2X1IA 3EMZA 4AZCA 3AMCA 5EB8A 2BFGA 3TTOA 4EKJA 5A95A 3WNOA 1V3HA 3A6OA 4UFHA 3WFLA 1V3LA 4ATLA 2J79A 1MQQA 1W3JA 3WN6A 5BRQA 3ZMRA 2FHBA 3OBAA 3VD9A 1WCGA 2ZUTA 4JFSA 4OOUA 1B90A 3M07A 3NSNA 4AISA 4MNLA 5FKYA 4CD8A 1AQHA 1E6ZA 3UEQA 3BAIA 4BQ3A 1KR1A 1GJUA 1EO5A 2ZUWA 3AI0A 3OGSA 5DT7A 1E4NA 2BVTA 1CXLA 3WF0A 4W84A 2AMGA 1MW2A 5CPSA 3SUTA 4W85A 1E55A 1UD8A 1BG4A 3VM5A 4CCCA 5CJ5A 3SUUA 1QNPA 1JZ7A 3RCNA 3VMPA 3CUFA 4DWSC 1ZB5A 3VILA 4EAMA 1DEDA 1TR1A 1WDSA 4HA3A 1AQ0A 3EMQA 3ZM8A 5BXTA 2BY2A 1V0KA 4H41A 2D0HA 4U31A 4AD3A 3ZT7A 2J7GA 1UD6A 2JFEX 3WKZA 1UH2A 1CYGA 2DDXA 3AS0A 3GH4A 4UFMA 1I75A 4V27A 4F9DA 1BPLB 3BH4A 3VNYA 4PMOA 1W9VA 4MDOA 3I3DA 4DUWA 4E2OA 3BAJA 2DSKA 3FHQA 3RJYA 2AAAA 4UOJA 3MS8A 2DEPA 1HKMA 3WDQA 3LPOA 3CZEA 5ABFA 3VMNA 5AY7A 1OGSA 1E43A 1E72M 2FDMA 1E6QM 1FP8A 1UYQA 4AW7A 1ISWA 2A3EA 2ZWYA 1XH1A 5D9NA 1CGYA 3TTYA 1EDGA 4UQCA 1FH9A 4NF7A 2V5CA 1NWTA 2XVLA 2BVYA 1I1WA 4J3SA 3PTKA 4XV0A 2E8ZA 1QI5A 5E6YA 4CVWA 2ZUMA 3S6TA 1WNOA 3WMSA 3WENA 2CBUA 3BGAA 3BLKA 1J11A 1VFOA 3AJ7A 2EQDA 4U33A 1C91A 2BV9A 4PYSA 2VOTA 1B3WA 1A3HA 3W37A 1TE1A 1NWUA 1QI4A 1LL4A 3L4VA 4W87A 5HOSA 5GNXA 5A8PA 1XSIA 1VEOA 5CQ1A 2WLYA 3UCQA 1QI3A 2DIJA 2WBKA 1PX8A 1TFVA 1UOKA 4LQ1A 1VENA 1P6WA 3CHDA 4GI6A 4C7GA 1WZKA 4MB1A 2WZEA 2E4TA 1UWTA 4AMCA 1ISXA 2VR4A 1R86A 1UWUA 2WW5A 4P8WA 2D23A 3ZT6A 1CLVA 4AD5A 2YDSA 1VEPA 3CUGA 1DTUA 5E0CA 4JL1A 1KXTA 2WM0A 1EXPA 2YDRA 4FLOA 1ZS2A 7CGTA 4CU6A 3DC0A 1WDQA 2YA2A 4LXFA 1FA2A 4HMCA 4PCSA 4LYRA 2QF8A 1IZKA 1GONA 2Y24A 4KRTA 3VIKA 1FFQA 1JNEA 4ACZA 4Z2KA 3U5UA 1E0WA 3T2OA 1K9EA 2J8GA 2PC8A 3W6MA 2D22A 2CIPA 2WB5A 2BY0A 2VX7A 2E3ZA 4UFKA 3WUBA 1ISZA 3W24A 3OZOA 2WHKA 2YA1A 4RE2A 3VGHA 1C8YA 1KR0A 1NQ6A 1V3KA 3OLGA 2ZWZA 2G3NA 1WPCA 3HU7A 4JCLA 1JZ5A 4GKLA 3N11A 5E70A 1QI2A 2E8YA 1AVAA 3W25A 4GQRA 3W28A 1DHKA 1WZAA 3D3AA 5GPRA 4MB3A 2YA0A 4J7RA 5I3DA 5ABGA 3AYSA 3VUPA 4MPKA 4PN2A 2G3JA 1PAMA 3AS1A 3WQWA 4LYQA 4GI9A 1W2PA 1BVZA 4YHEA 4UFLA 1JGIA 2GK1A 4OUEA 5A69A 1B9ZA 4FLSA 3VKKA 3WEMA 4U3CA 1H5VA 3AICA 3IAPA 3CMJA 2V3EA 3SCNA 2WNWA 1XV8A 1JIBA 1QHOA 2WVSA 1US3A 1X6LA 1JI1A 1H3GA 2CCRA 2GVYA 3BC9A 3N13A 1UR8A 2WMGA 4DWSB 4DUXA 1LF1A 5LYRA 1EQCA 2FH6A 2W66A 3WH8A 1CPUA 2ZX7A 1W1PA 3ARUA 1C8XA 2XFYA 1M53A 2JEPA 3RDKA 1HL9A 2UY3A 3SUWA 4P7OA 2DSZA 4S3JA 3T09A 4W7UA 4MJ2A 2J7FA 3GBEA 3AIRA 1OT2A 3CZLA 3VDCA 4D6DA 1D2KA 2TAAA 4W7VA 1J10A 2CBJA 4HPHA 2D24A 4CCEA 2JIWA 2ZICA 2VRKA 4JCMA 1VJZA 3VD4A 3A4XA 1H4PA 2GJXB 3AZSA 1FFRA 1HP5A 4CN4A 1M03A 3VD3A 1C90A 2D0FA 2WVVA 1MQPA 2PWEA 2DQXA 3AIBA 5E6ZA 2X05A 2J7HA 3AFBA 3OIHA 2D2OA 2YKKA 1R85A 1QHPA 9CGTA 1DWAM 4U3AA 2GUYA 3KL3A 3WBAA 4CKQA 3VNZA 4CVUA 2Y2WA 4ZFMA 3KZSA 3THDA 3J7HA 1UZ4A 4J28A 1QI0A 1CZ1A 5CLWA 1OIMA 4U5KA 4LYPA 3WH5A 3OGVA 2XPKA 3K8LA 1KQYA 4XZWA 3EBVA 4XX6A
chains in the Genus database with same CATH superfamily
1JAEA 3UXKA 2VGIA 4L9ZA 4J35A 2XUCA 2WSQA 2DU2A 2YBTA 1I4NA 2J25A 3BSGA 3K8MA 1YMYA 4IIEA 4AEFA 3CUHA 3ID7A 4GINA 3II1A 1KRCC 5FACA 1EC9A 5FF2A 4RE4A 3GDKA 4WJ8A 5ABFB 3N25A 4L1XA 5EMYA 3WJYA 1S3TC 5B7YA 1TJRA 3UT0A 3AROA 4JIEA 3H24A 3LLFA 1JDCA 3VIMA 4AF0B 4XZBA 3BE7A 2VX5A 2OYLA 1GCYA 1PX4A 1TZ9A 4ZCWA 3C2EA 3EWDA 2W3ZA 1B30A 1MRQA 3L67A 1CTNA 3PS7A 2FGLA 5I79A 3CV1A 1IT0A 2HROA 3Q37A 4TIMA 2CXGA 3R1ZA 4ZOBA 1P0EA 1AJZA 3U0HA 4IUOA 2AGTA 1UR9A 1DWJM 4F79A 2OO6A 3H4WA 3BPWA 3E74A 4GC3A 2QZRA 3WF4A 3CWHA 2R6OA 2WCGA 3QPYA 1JF5A 3KOZA 1EYWA 3BLPX 3GNXA 1W9PA 4GIAA 4BFAA 1R46A 4AWTA 1JCJA 4Q6XA 5DX7A 3BQ5A 1HX0A 4B3KA 3S42A 1W1IE 3WY1A 1K03A 3LNMA 4E3VA 3FA5A 3UR2A 5D2WA 3WLQA 2XGZA 3PNUA 1UASA 4GOAA 2EPLX 4AD2A 3GTXA 2ZUSA 4YPJA 1OC7A 3AZRA 4WXYA 3B4UA 2V8ZA 4C6FA 3KHDA 4RDVA 1A5NC 4IIGA 3CJPA 4PE8A 1VFUA 3QHNA 4Z0SA 2F61A 2CZDA 3MCOA 3WQCA 3O9NA 2FDSA 2J7CA 4ACZB 3VO0A 1RJRA 3N2XA 1EZWA 2B7QA 4FI4A 2WJZA 1ODUA 1MVYA 4K3ZA 1TPUA 3ZQ9A 3OHMB 4HNNA 2HZGA 2P88A 1PKMA 4AZBA 4I5UA 1RK6A 5JMUA 2WKLA 2QCMA 3CK5A 5D9MA 5M3WA 1NH6A 4FF7A 3DFOA 4J3TA 3SM0A 1G7VA 3EA2A 1PJ9A 4MWAD 2V3GA 1C93A 3WNLA 2NWRA 2PGFA 1NSJA 5T26A 1TVNA 3TEVA 2R82A 4M1RA 1W5QA 5DMYA 5EFFA 5KSWA 1E71M 1GZJA 4A6GA 1S5TA 5EMLA 3DKJA 1K02A 4J5NA 3VYLA 1Z9AA 1VYSX 3W71A 1JFXA 1V6VA 3VM7A 3QLDA 5LIUX 4QP0A 4QISA 5TNVA 1HP4A 4N02A 3BZJA 3UA3A 4Q8QA 3LG3A 5D32A 1US2A 1OFOA 2YXXA 3NPUA 4ZQNA 4F8XA 3QY7A 1FWGC 3VGGA 4AXNA 2Y7DA 3U2CA 1WX0A 2F38A 3A21A 3MQTA 4QIUA 4ZEPA 4UQDA 4Y9PA 3T2PA 2WNZA 2D73A 3APTA 4H04A 2PDUA 2ISWA 4H3DA 2YR1A 2QUTA 5KMYA 2YL9A 2VFIA 2XH2A 1OYCA 3NQAA 3USBA 3W2JA 3RPDA 9RUBA 1ECQA 2A3HA 2QPUA 3AJXA 5HJLA 4DI8A 1LZOA 1POJA 1UQYA 3QKEA 3SJ3A 2ZIDA 1UPMB 2J4GA 1J18A 2PA6A 4KPLA 3L0NA 4MKNA 2V30A 4EACA 1N7KA 2QYGA 2QQ6A 1FWWA 3DECA 5A8OA 5E93A 2ABAA 4KRUA 3PFMA 1KRMA 4NX0A 3R13A 1X7IA 1RCOB 3HQPA 1UR2A 2WHMA 3GXIA 1IT7A 8CGTA 4BI6A 4MZYA 3DG3A 2GZXA 4E2DA 2YXGA 4Q4MA 4W93A 1QATA 3DFNA 3H2MA 3IANA 5C9UA 2I56A 3WF3A 2Z2AA 3M0KA 2GDQA 1ONXA 3BAWA 3I6EA 4GYPC 4JTJA 3WJXA 3R6IA 3CIVA 3AYVA 3NUKA 3IJ7A 2HJPA 2XFWA 5REQA 3QMRA 1R6WA 3SGGA 4E2BA 3LERA 4HNLA 1TR9A 3LRMA 3HMJG 4XTIA 3HA1A 2FZ8A 4C6JA 2WCAA 2PDIA 3M0IA 4D6GA 2JE8A 4GVHA 5DRCA 5A6SA 4HMEA 4ROQA 3JU2A 1A49A 4B2DD 5LA0A 3TQ0A 2L5HA 1N8WA 3MT1A 2VL4A 4D6FA 4TTGA 1M65A 1ME8A 4JY9A 4GZIA 4WKHA 2V3DA 1B1YA 1QO2A 4DJFC 4GE8A 2OZ8A 3MBFA 4S1FA 3LPGA 1IQ8A 3NQMA 3FJNA 1RXOB 1VKFA 3THQA 1XGZA 4AZIA 4FS9A 1V7YA 1GOMA 1LG2A 1B2YA 2OSXA 1VC4A 4PSRA 4WDUA 1D3HA 1UR0A 3P6LA 3FEQA 1XYZA 4JFTA 1A4LA 5ABHA 1W8GA 1ZU8A 3N12A 4PMJA 3WX7A 3GLCA 1H62A 2EKCA 2YW4A 2JF6A 1VF8A 5BROA 3GFYA 3DHUA 5ECUA 3GX9A 7XIMA 1V7AA 2PURA 1XYFA 1KCXA 1NDWA 1H7OA 1XRVA 4R85A 1OVDA 4JTTA 3AYRA 4BQ5A 5A8QA 2PAJA 1KM1A 3GYCA 1JCLA 4HCDA 3VDAA 4JOMA 3IAQA 5BRPA 2Y63A 4RNJA 4EWJA 2QUNA 3M5XA 3W7HA 4GUFA 5HR7A 3B9EA 4GQ0A 1WQ5A 4PTVA 3UG8A 3LU2A 3WLSA 1XUZA 2CXEA 2CEQA 2ZFAA 3UWZA 3TN4A 2W92A 3VU2A 3AHXA 2OVLA 1W2VA 4XD6A 4DUVA 3PSWA 2AL2B 2VP8A 1P5BA 2C7FA 4IG2A 3TJXA 2Z2UA 2ASHA 4ILSA 3U57A 3FEMA 4Z2HA 3CL8A 3W2UA 5G4HC 4P61A 3DG7A 4GQBA 3G1AA 1NF7A 1QDSA 2Z1WA 3QQWA 1V6YA 1E0TA 2EO7A 3B8VA 1DJZA 4UR9A 3LENA 3ERPA 1SZRA 2DVTA 2PEVA 2DH3A 2XIIA 3W82A 4Z2LA 1K7EA 1H1ZA 1W3NA 4H7CA 3T4WA 3LQGA 4C5YA 4HGXA 2J88A 2HPMA 4ZGYA 2A85A 3THUA 3B03A 4GVGA 4PGLA 3SN1A 5A1AA 2QPXA 2CHOA 5CH9A 3W1MA 3PZVA 4LBUA 5K9DA 3AYTA 1JR1A 4UOZA 2OEKA 1TMHA 1PIGA 1AFSA 5IBXA 1S2TA 1FCVA 2VGFA 5JIPA 3HGRA 3UG4A 1XICA 1UR4A 3WEZA 2DGAA 5G4WA 3LBOA 1YKWA 5H8UA 5C9RA 4AG0A 7ENLA 1PHWA 2ISSA 3UU0A 1GYLA 2VM8A 3IIVA 3QOKA 5EY5A 3BQ6A 5HNNA 5BXPA 4N9BA 2Q8LA 2G4FA 3H7UA 1MUCA 1YQ2A 1OB0A 2NW0A 1Q8JA 5BMXA 1FWSA 4GA8A 1M5WA 4GO8A 1R3QA 2VEFA 3KBSA 3P84A 4CD7A 2P8CA 5GNYA 4PTMA 4ZQOA 3H70A 1EH9A 2INFA 1OX4A 2J78A 3R5EA 2E67A 3W29A 4MKSA 5A6JA 3ZWTA 1UR1A 3L0KA 4ICCX 1Q6EA 4H2CA 1PCWA 2VCBA 4R88A 4KWVA 2NXIA 1JYXA 4O19A 5CJNA 2QULA 4UUIA 4KF1A 4XKYA 4H8HA 3ZJ6A 2YX0A 3W83A 3S5SA 4LAOA 1I2QA 2XFFA 1H60A 3F2BA 4ORMA 1K7XA 3C52A 4BEUA 4B3LA 2OYKA 2E6FA 1V02E 1F05A 4MNJA 2GFTA 4IXXA 4RPPA 3NYZA 3CAVA 3L65A 2AOSA 3AIWA 3HO8A 1LBMA 2V6AA 2QMKA 5REQB 3DU0A 3KS6A 1RD6A 3PM6A 1MNZA 4PRRA 1UP2A 3ITLA 4TTUA 3S2LA 3NZGA 2QCDB 3ZVHB 3TSDA 3NZQA 3F4CA 1Z7AA 1ZBKA 2XIMA 3IACA 3VD7A 1NM9A 1XUUA 3TU9A 1O95A 3M0MA 2CESA 5TD4A 3CAKA 1IR1A 3SB0A 2NX9A 3MCNA 1AUSL 1RP9A 1PYFA 4E6MA 3SY8A 3BG3A 3AXMA 4TOQA 1M6JA 1WBJA 3G2GA 2E6DA 1XIHA 1XGDA 3TN5A 1V6WA 3AAMA 3D6NA 5HINA 3FVMA 2ISFA 2R1MA 5LXXA 4QRNA 2OELA 4LY4A 3ITGA 3DFQA 1P0KA 5HMEA 3QOMA 5BOEA 1Y65A 1ZZMA 4I3GA 4Z1YA 4A3YA 1JUKA 1H2JA 1XLKA 1TZZA 3W85A 3U7BA 3ZLGA 4H4IA 4GIYA 1OFAA 1ZFJA 2VI0A 4IQJA 1OC6A 1JCTA 1XH0A 5AB3A 3OVRA 4PCTA 2A6NA 3SURA 1DIDA 1RZMA 3LTYA 2FLIA 2W27A 1IXNA 3OP2A 5LHFA 2XN0A 2WHLA 1A5LC 3GNOA 3E0WA 3GXMA 2EEXA 1K4GA 5F7UA 4G8TA 2RKXA 3BCJA 3CAQA 2PODA 2X30A 3C2YA 2E6AA 3T78A 3HPSA 4Y8EA 1AQMA 3W7JA 2R1LA 3RRAA 3HGJA 4IUGA 4AH7A 4D6JA 2JALA 2OQLA 1ICQA 2G96A 1SW3A 4UNLA 2G3MA 3L4UA 4GMEA 1VS1A 3T08A 3L4TA 2G97A 5T91A 3TR9A 3TXVA 4XBJA 1FHUA 4CUCA 5CC5A 1OZMA 1V03A 3JUGA 4O18A 2ATSA 2XSBA 1PVNA 5BWAA 3WNNA 5A6TC 4PMDA 1G01A 1R2RA 3P60A 1V6XA 3I7SA 4JQ3A 2W91A 3RO6A 3A5VA 2WVVB 1HKIA 1F6PA 3AIVA 3E12A 1LG1A 4J3XA 3BXWA 3EWUA 4DO7A 3WQDA 1RY0A 1T40A 3GXFA 4UTUA 2PBOA 2XDFA 4KEUA 1GOXA 2R94A 1MZHA 3PUEA 4OVXA 4WY0F 1DWFM 2R1KA 3PC0A 3MUIA 4JQ2A 2PMQA 1DIEA 2A3BA 1QNQA 5FEXA 3QC3A 4WSJA 3LMYA 1US0A 2GOKA 4WQ6A 4IIBA 4HZ8A 2V5DA 1PSCA 2VTFA 1UUMA 2DVXA 3Q94A 4FNTA 1JD7A 2WC7A 2E7FA 1FXPA 2GLKA 4NP7A 4MM1A 3RU6A 4HNOA 3VTRA 4MGGA 1DE6A 1CECA 3EPOA 4H6EA 1H09A 4NYUA 3NEVA 4NZ1A 3MDUA 4XQ6A 4S3GA 2Z28A 4QJ4B 2VURA 3L12A 2PWFA 3ZT5A 1TVPA 1WZMA 3KTCA 1OX4B 1V02A 4DZIA 2VC9A 2NLIA 2O4QA 4JTHA 5F2IA 1K6AA 2V3FA 1VJIA 3WK2A 3ITTA 5A8NA 2ON3A 7REQA 3EGJA 2DORA 2PTYA 4K2SA 3SDOA 3VDHA 2WPGA 1DJGA 4QDPA 4XKYB 4HU0A 3F4VA 4UIOA 4GH3A 3UY7A 4PMQA 1PZ0A 4LC6A 3WLHA 4ZSTA 3IJ6A 2OX4A 1E6RA 2P3EA 1QJWA 3KP1A 4GZ7A 1GQJA 1NFPA 4UTKA 1FDZA 3WNKA 1ZTVA 2Q3OA 3OGRA 2YIHA 4PMYA 1OQFA 1X8FA 2WAGA 5K9XA 3IJQA 2ZADA 3W1LA 4EP8C 4X0NA 4LVDA 1SPQA 1YPXA 4DJDC 3PPCA 1O60A 2Z4GA 4HA4A 4MOZA 1Y5VA 8A3HA 4MB4A 2DUZA 5FJOA 3NPWA 4A4AA 5MHBA 1A5BA 2QKFA 4QFUA 4FA3A 3FHAA 1EP3A 5AYYA 1MFVA 4M6UA 1GZGA 1FHDA 4RZ5A 1J12A 5H1WA 3CO8A 2V5KA 1BKSA 3PN8A 3MUAA 4IPIA 3WLNA 5CSYA 4JIIX 1R7OA 3KE0A 3MVTA 4FNSA 2FJKA 3LCHA 2Y62A 3DI1A 1ZP4A 3GXTA 2OKOA 3VC6A 4KT2A 4S38A 2Q09A 1MXDA 5GQBA 2VZVA 1E73M 3PPGA 3AIEA 2C91A 1Q13A 1BVNP 4CD5A 5B7ZA 4A3QA 2XN1A 2FVKA 1YPIA 3U2OA 1ENUA 4JTEA 2DSVA 2C1GA 4QLJA 2ONEA 4OFCA 1FCQA 4DPPA 3UG5A 2EBNA 3EDDA 4X63A 1QHZA 2XM1A 3R10A 1R3SA 3KTXA 1V4YA 1SFJA 4PUWA 1WAWA 3FYYA 1GQIA 1HJUA 4HJFA 3ZR6A 1QWGA 4HHHA 1EEXA 1UKSA 1GWJA 1HGYA 3UESA 3KOWA 4U5IA 4V1YA 5HUOA 3W76A 1J8VA 4QDWA 3TNOA 1DQXA 2VRJA 4ROPA 3WD4A 1IIGA 3D3FA 4H6KA 4L4OA 4E8GA 3SW6A 1EIBA 3QHMA 4EK7A 3WFZA 5TBOA 3WQFA 1GG0A 2MUCA 2ZXBA 4XK2A 1UG6A 1J2WA 3H12A 4IJCA 1TVLA 4ZZ9A 1CGXA 3PJUA 1FCBA 4ZOEA 4F2TA 4GVFA 3GZAA 4ADSA 1R7AA 1E0UA 3UA4A 1GW1A 1W3HA 1TMQA 3W1RA 1OY0A 3FSUA 5IXEA 4EXQA 3GG0A 3KBWA 1AG1O 3JZUA 1W1YA 3W2KA 1GNXA 1TELA 4AHOA 4NI3A 4XBSA 1IGWA 4INFA 3NQ2A 1JCNA 3R43A 3GTNA 4K37A 3W53A 1EA9C 4ZBCA 4ZXOA 5I00A 1A5KC 2R1PA 3MWCA 3GNDA 4GYKA 4DRSA 1O5QA 3EA1A 3OU8A 1E1EA 4H9XA 2OMAA 4LUYA 5U4NA 2PD5A 2GVJA 4JEJA 4WX2A 4HHMA 4LCQA 5FESA 3OG2A 1LDCA 3TJIA 2G8ZA 4W5UA 4Q4RA 4O53A 2VDGA 3HURA 2DIKA 2ZA3A 5LNSA 3ENLA 3P3BA 1RBAA 4JTQA 1YYAA 1KO0A 3TCSA 5BOFA 1BTMA 1WDRA 4NJJA 5D03A 3GW0A 2NWSA 4BF7A 4KCTA 1GPFA 3SRFA 5C0QA 4PMNA 1YXDA 1SW0A 5AC7A 4MZ1A 3S83A 1BWLA 5CPTA 3N18A 1X1NA 2VEIA 5BCAA 4LRSA 2XH7A 3GUGA 3GG8A 4PTXA 4F0LA 1S5VA 2QR6A 3R7MA 1KLZA 4XZIA 4Q6JA 4MNKA 3DBPA 2FQIA 4PUDA 1YXCA 2PU0A 5AHNA 5DMMA 4B15A 1GEQA 3W6YA 3LXCA 2IKIA 3CYVA 3VCNA 1AL7A 7REQB 4HN8A 5FJTA 5D2XA 1H0IA 1W6TA 2WCSA 4MKVA 1JI2A 3OEXA 3B04A 4GXMA 4FF5A 2XSXA 4G2DA 1D3CA 1Y0EA 2OU4A 3H2FA 3WBYA 1T96A 1V08A 3MU7A 3ZO9A 3SUSA 1Q6DA 4KGLA 3I6RA 4OU1A 3R0UA 1F6KA 4S3EA 3RX2A 2R8WA 4M6QA 4TV6A 1H41A 4AY1A 1DPMA 3I7QA 4P8UA 3T9PA 4JQAA 5CG0A 5JXQA 5KZEA 3AHVA 1FH7A 1J0ZA 3WH9A 1HW6A 2QGHA 3GNRA 3SY5A 1SVDA 4O1FA 1LQAA 2H90A 3V0UA 2H8ZA 3K30A 3A22A 4MAVA 1JXKA 3A64A 2WPBA 2Y4SA 1LQ0A 3YPIA 5CKSA 3E5BA 3CUZA 1JL8A 4GHRA 1K8XA 5I03A 4JD4A 1E40A 3EMZA 1LOQA 3W00A 4AZCA 5EB8A 2BFGA 4F40A 4EKJA 3WNOA 4WCJA 5HWMA 4UFHA 1V3LA 2I7GA 1JULA 2J6XA 5BRQA 1FDJA 3Q67A 4RXGA 5LIWX 3CYJA 4OOUA 3V3WA 4PH6A 4MNLA 2V2DA 1AQHA 1TIWA 1E6ZA 3ORWA 4BQ3A 4O50A 3IS4A 4BR1A 3OGSA 4RDYA 4Q32A 4CQDA 3V4BA 3C8FA 3OODA 3RLHA 1EGMA 5CPSA 1YW1A 3S6OA 3SUTA 5AOUA 1E55A 1MDLA 3G18A 1T5AA 3GXPA 3ANYA 2C71A 4DWSC 3R11A 1H7XA 4EAMA 2FVLA 4DVOA 1PV8A 1DEDA 4HA3A 4LFYA 4LVGA 3N3MA 1ML1A 1MEHA 2D0HA 2DW7A 2O4MA 4JYDA 3ZT7A 1QRQA 3INPA 2QXWA 4ONVA 1UD6A 3WMLA 2JFEX 4GIEA 3NNTA 1BWVA 1EB3A 4GBUA 2DDXA 2ZZ5A 4JICA 1I75A 4V27A 3MUXA 4F9DA 2ZRWA 4PMOA 3QV7A 4DUWA 3S5YA 1T6MA 2OLAA 3P81A 2A3LA 4PUMA 4AHQA 2DSKA 5G5IA 3WDQA 3GVWA 3FX4A 4HCHA 1ZAHA 5AY7A 2B7NA 1OGSA 1E43A 4ASTA 3EWYA 1UYQA 4AW7A 2QDEA 2BG5A 2ZWYA 1XH1A 3KBMA 4LCSA 3QY6A 1CGYA 1FWBC 2BOEX 5A5WA 3TTYA 3TWBA 4MSSA 4UQCA 2V5CA 4C6BA 2XVLA 1R9XA 3CQKA 2BVYA 2J8TA 3VKJA 5E0KA 5LGXA 1RQHA 1M7JA 2FB3A 4XV0A 2C0AA 3AUOA 2E8ZA 4H7ZA 4IIFA 4GY0A 2ZUMA 4W4QA 4X2PA 2CWXA 1Q66A 4Q33A 2CBUA 6ALDA 4Z0JA 1XIBA 3NA8A 3BLKA 1J11A 3AJ7A 2R24A 4DF0A 4YNGA 5T9BG 1C91A 2BV9A 1G4SA 2VOTA 2J9XA 4ZQCA 5DCDA 1A3HA 3ZFHA 4G7EA 4AIBA 3GDMA 1LOSA 1XS2A 4WRHA 1MEIA 1E1CB 2ADAA 3DIPA 3RLVA 1TFVA 1UOKA 2I5QA 4S3DA 3CHDA 4GI6A 4C7GA 4MB1A 2GGJA 4AMCA 4JTRA 1A5OC 3TROA 4A21A 4P8WA 3ZT6A 4H9UA 4AD5A 1VEPA 2V5JA 1DTUA 1SZGA 1EXPA 4LJ3A 1B9BA 2W79A 1EJWC 2HQAA 2XZ9A 1IZKA 2TYSA 3EWWA 4JQ1A 3SADA 3FKRA 3VIKA 2PP0A 2CZFA 3TAKA 2PCEA 1E0WA 1NY1A 3NVDA 2PC8A 3W6MA 3LRLA 5LNWA 2WB5A 2BY0A 1D7KA 3I65A 4Q7IA 3WUBA 1BXNA 2WQDA 2FTYA 3F4WA 1EWEA 4PULA 1UP3A 2PDQA 2PD9A 2OGJA 3ONCA 3WQOA 4XAGA 1EC8A 3CT7A 4UCGA 2HDJA 3M0JA 3W7EA 2E5BA 1JZ5A 4GKLA 2A7RA 3M9YA 1WUEA 3W25A 3FYOA 3KVJA 4M6PA 1WZAA 3ITCA 2NV9A 3D3AA 1D9EA 4MB3A 3NQEA 5ABGA 3AYSA 4KEZA 4MPKA 2G3JA 4BY3A 3AS1A 3QSTA 3LSBA 2DZUA 4NXSA 4PB4A 2PDGA 1W2PA 4QBXA 2WJFA 1JGIA 2GK1A 3WQEA 2ZDRA 3VKKA 1P1XA 3WEMA 4PCFA 1SJAA 1QTWA 3IAPA 1KNWA 4Z1AA 4G7FA 3W87A 2WVSA 3N14A 1X6LA 4LOCA 3NGJA 2GVYA 4WR3A 3CPGA 2H8XA 3ES7A 1NAL1 2FH6A 1RLDA 3O6CA 5HNUA 3WH8A 4B5XA 3LCWA 2A6LA 3A3XA 4H9MA 3BW3A 2F7FA 1JRCA 4FAMA 4KFOA 4IFRA 4DBWA 3RDKA 1QAPA 2OXNA 3UNTA 4S3JA 2QAPA 4W7UA 3TR2A 1OT2A 1D2KA 2TAAA 1UJPA 1J10A 4L61A 2H3BA 2CW6A 4XZLX 1Y5XA 5GVJA 4C1KA 2GJXB 1HO4A 4RW5A 6XIAA 3AZSA 1FFRA 4B4HA 4CN4A 4IWWA 3O63A 2NVDA 2PWEA 1W37A 2C79A 5E6ZA 3DUGA 2Y85A 2J7HA 2D2OA 4KESA 4Z1DA 4MMWA 3N19B 1R85A 1QHPA 4U3AA 2GUYA 3KL3A 3WBAA 3EPMA 4O14A 4CKQA 4ZR8A 2PGWA 4ZFMA 5AECA 1KBIA 4F0RA 1XRTA 1LRQA 4MLJA 4S3FA 4IGSA 5TF0A 3KZSA 4GNVA 3KVKA 3OA3A 1UZ4A 3LM7A 1MUWA 1CZ1A 5CLWA 1XLEA 5PTDA 1OC5A 1VFLA 3QQ1A 2X41A 4R3UA 4NJIA 4FX7A 4IX0A 4FXSA 1IWPA 2AMXA 4JIHA 3SR7A 4DNHA 2VRQA 2Z27A 5E09A 3W2LA 3GFXA 3R79A 3N3TA 5IDZA 3LHTA 2VJXA 5LA2A 3H2AA 4Z2GA 3AHYA 2PDXA 3I10A 3KRBA 3SN0A 4H6QA 3UQNA 2WZIA 4TVDA 2A3AA 5C2CA 1ITXA 3MTWA 5FL0A 2O9OA 4FALA 1GGOA 3VZZA 5FJUA 3W7PA 3TJLA 1UIPA 3DBNA 3PWGA 1EQPA 1KD0A 4NZCA 1PIIA 3NIYA 1L8NA 4IGMA 4O16A 4QGCA 1HJWA 5H8MA 3QV9A 1A0DA 3WSUA 4H00A 2FMNA 3CHFA 1X98A 2YCLA 4W7WA 3STPA 4O12A 3KVLA 1WO2A 1XCWA 4A2RA 2EPNA 4ZVJA 4MJMA 2P53A 1CB7B 1QO5A 4Q8OA 2RAGA 4GCXA 4PC8A 1CIUA 4AY7A 2PDBA 3DENA 1AH4A 4K6AA 3DFTA 2PDKA 1PPIA 4C1LA 3FA4A 4G7EB 4DI9A 8XIMA 3FOKA 1UJQA 4JFVA 3QR3A 2WSYA 5CSUA 4F3HA 5CGQA 4PMRA 5LSMA 1W3LA 1TJ2A 5M1TA 1AJ0A 1NOWA 1QCWA 1DOSA 4HOXA 1ME9A 4RV8A 3CHVA 2RGLA 3P7YA 4BHYA 1I1XA 3TC7A 4B9ZA 1W5OA 3PR2A 4IOTA 1XH2A 1U5VA 5BXRA 1NWSA 4UTMA 2FZMA 3N2MA 1VFFA 4M29A 3WO8A 4D8ZA 4KEVA 4CQAA 3DFSA 3S2JA 3OB8A 1EL3A 1S5NA 4PTNA 3UVIA 1DHPA 4OQVA 2ZX8A 2WXDM 3S6DA 4CNOA 2BLEA 3FCPA 4LBSA 1WOAA 5FIPA 3M64A 4HPXA 3EOUA 3T44A 1J0HA 1I9CB 3KOXA 3OQ8A 4UMBA 3MUY1 1DXFA 4IX2A 1C3FA 2PDWA 3ZOAA 4MWAA 4O1BA 3QKZA 3RPMA 3L5AA 3BCFA 1TTQA 2JIEA 2QT3A 2ZQ0A 5CEWA 5DMNA 4P8XA 4RR4A 3GH7A 1YDYA 4AU0A 3SQSA 4YHGA 4V15A 4HPGA 3WQ6A 1PTGA 3H8AA 5C9WA 2J8FA 3UZZA 3AC0A 2FB2A 3MP3A 4LAKA 1GG1A 1JZ8A 3B0PA 5AYBA 4H8NA 3F2CA 4Z1CA 1T7LA 1VCVA 3K13A 3GDBA 3N2TA 4ZQPA 6ENLA 4R34A 1XR2A 2PBGA 3BICA 3LHYA 1HN1A 5AN7A 1I45A 3C2FA 3VVGA 3LCLA 3BGJA 4A35A 2PF8A 3POHA 2A3CA 1ME7A 3STGA 2OOGA 1EUNA 2EPOA 4X9YA 2X16A 3L2LA 3NDYA 1NOUA 4C60A 3CS2A 2ZTKA 4H8UA 3IARA 2I9EA 3QFWA 4WZHA 4ICMA 1TJPA 5EYWA 4IPNB 4UFIA 4WF7A 2QVHA 2QV4A 4W88A 1TYGA 4RPQA 2IKJA 3E9AA 1HKKA 1V6UA 2DZTA 4ZA0A 4NKCA 1KFJA 3FDKA 1BGGA 1CXHA 1UWAA 3IGHX 3JZEA 8XIAA 2GSEA 3RLGA 2ANUA 1ICSA 3NYDA 5C2XA 3K5XA 5I09A 3DYPA 1HTIA 3CHCA 1XPGA 3PANA 4ZO6A 3ZXWA 1E9YB 4S3BA 4PTDA 3FW6A 2X0YA 3O07A 3VKDA 1QW9A 1X1OA 3RX4A 3QW4B 3MVIA 1L2QA 1VPXA 2CZ5A 2YFOA 4JN8A 4GH1A 1MFUA 4AX7A 2OLSA 1QU4A 4JTKA 3WYZA 4JTAA 5I3GA 1BG9A 1SSGA 3GDLA 4LUTA 2WJEA 3NCOA 2PI6A 3PB2A 4A2SA 2I14A 1VBHA 5CZTA 1EBGA 4DLFA 3ARRA 3L2IA 2VX6A 4PEKA 2O0TA 3OVQA 4FPSA 3W3OA 3PTMA 2X09A 2QV5A 1C9WA 3K46A 2WNQA 3O0FA 4AC1X 1KKOA 1XIGA 4KFPA 3MSDA 1BWKA 3W26A 4DQWA 4DPQA 2WMJA 4HU3A 1HXJA 1H49A 4QX4A 1KGWA 2YCLB 2HS8A 3NQ6A 3SCQA 2VEPA 4C6OA 2W9MA 2YDAA 3UWYA 1U2YA 4WY0A 3MUZ1 1BLIA 3EPNA 4V2XA 4JX5A 2OYMA 4NY2A 1P7TA 1ZUAX 4L6HA 3HOJA 4KMQA 1UMLA 1CXEA 3RCMA 2BZNA 3IUHA 2E9LA 4LEFA 1O5KA 4XD4A 2HBXA 4H9ZA 2WYSA 3WF1A 2DJXA 3PSVA 1YLVA 4FSAA 5EMUA 1E3ZA 3PAOA 3NM1A 4HKPA 2QMJA 2BWGA 3REQA 4O1EA 1Q6GA 1E3XA 3QEZA 3VFLA 1H50A 3OO2A 1OG0A 1JPIA 3UXIA 5I0DA 1AMYA 4N9DA 3W70A 4DM1A 1UMYA 1XGEA 4GCAA 2NV1A 2X2GA 3F2DA 3WQ8A 1ZQ5A 5LA1A 5C70A 4NIRA 3GXNA 3LV6A 1QWKA 5D33A 3SSZA 5I02A 1Q6CA 1CLXA 2ZDSA 5CCZA 3MA8A 3QMTA 1RA5A 3KHJA 3SRHA 1BRLA 5A2BA 5T9CE 1EYEA 4XZ9A 5EMKA 3WD2A 4KWSA 1UH3A 3NDOA 3ZR5A 4FIRA 4O28A 4QSHA 4NAEA 2PDCA 4Q7NA 1NP2A 1SMAA 2XVKA 1J5SA 2DQWA 4BWLA 4LY8A 4E8CA 1A3XA 3W02A 1VRXA 2XG9A 3CHEA 3F4NA 4FNRA 3R2GA 3TCEA 3LUTA 1BYCA 2Z7GA 3SRDA 5IFPA 3HG5A 3W27A 2VUNA 1VGAA 3HGSA 1V0MA 4Q4OA 3TJ4A 4GUHA 4IHCA 2BGQA 4IJRA 4PUJA 4NZ3A 1UWQA 1YX1A 4NVTA 1SU5A 4BI5A 2PWGA 1K9DA 2XN2A 4C1NB 1BVWA 5C54A 5FF3A 1DWGM 4PUKA 1OD8A 4AWSA 3VUSA 3QJAA 1E5JA 3D0CA 6TAAA 4JY8A 3H21A 3ARSA 4UQAA 3UCDA 3UERA 4HNCA 3W7CA 3RR4A 3PUOA 3QHOA 4C6PA 4H8VA 1KKRA 3KUMA 1Q4WA 4JIPA 1PTDA 5F2LA 1SJBA 4CNSA 4MY1A 1NEYA 4QDMA 3OVGA 5BYWA 4K68A 1GKPA 4DIAA 3LA4A 3TNBA 1QOXA 2AQWA 2GDUA 1E4LA 2RH9A 1TG7A 1UCWA 5CPQA 3WEOA 4Q8NA 4W89A 2OSWA 4HZ6A 2WWCA 5A6MA 4P7QA 3AXIA 5IDIA 1WA3A 4MAZA 4EWND 3P61A 1UD3A 5I2UA 1GTHA 5I24A 4L9XA 1X1ZA 3A3WA 4ECLA 4DYJA 2AKZA 1D3GA 4IFOA 2Z1XA 4B92A 1W5PA 4S23A 2Z24A 4PMXA 5DXXA 3N17A 3BMWA 2D69A 1IGSA 1LBLA 4XUGA 3SQLA 3EWXA 4JGDA 3TDFA 1UC5A 1TRDA 3UWEA 2YCIX 4O4VA 3LTSA 2NVAA 1PHQA 4KKXA 4AQLA 4KWOA 4YWIA 5CC7A 3Q58A 5TAOA 2C8NA 4AY8A 2QUUA 2Y7EA 3IK4A 3G0XA 3GKAA 3SI9A 3SBFA 2NSOA 3DEQA 2OWWA 4UCFA 4N2YA 2C14A 4LUTB 3TTQA 3NFUA 3CTLA 4P2VA 5BU9A 4J4KA 1QASA 3SZ8A 1VQTA 2GVEA 1SM9A 1DTNA 4E8DA 4G1KA 4YU1A 3W1UA 4HK7A 3TONA 2CBIA 4GI4A 1XIFA 1AD1A 3TA9A 4DBSA 3O0KA 4MUPA 3EYPA 3W22A 2QPSA 1ZJBA 4N4PA 4UMAA 4IP4A 1BQCA 2PRHA 2O7QA 4PB5A 4WLCA 3VOHA 1SO5A 3MYOA 1RCXB 3ARYA 3UWVA 3P74A 4LW7A 3GXDA 1W9DM 3LMZA 4C7DA 3GTIA 1G7UA 3EKZA 4IL0A 4WY0B 1EJ7L 3SGUA 3WIJA 3KZPA 2X42A 4DBUA 1S5WA 4JN6A 3BURA 1SO6A 3EEGA 3F4DA 4L64A 1ZBVA 1KV5A 4US5A 3P0WA 4KQNA 1XP3A 1KXQA 3B9AA 2YB1A 2DUXA 1BKHA 2PF0A 5AVHA 4NYYA 3W6LA 1PKLA 4LX4A 3K4WA 3REQB 1ICPA 4Q8PA 2I17A 2PDYA 3LI0A 3HN3A 2BOFX 3P2VA 5LNUA 2ZKMX 5C9XA 5LIYX 3D5HA 4UNIA 1HT6A 1P0BA 2E40A 3O6DA 1IXPA 3NL3A 4I6VA 4EE9A 3PG9A 4C6KA 4MHBA 4KH2A 1O1ZA 2MANA 4F66A 1GTEA 2OX1A 1I0DA 1PL9A 4M19A 3VE9A 4QLLA 1GJPA 5DANA 2GJRA 4XD3A 4TMBA 3N73A 4AIUA 2VC6A 1D8CA 3R8GA 3TV8A 1KGUA 2ZZ7A 1WUFA 4IGHA 3H55A 2GUBA 2YYUA 2BHYA 3RAOA 5DO8A 2ACQA 4NAEB 3TYBA 4U10A 2WK2A 3APYA 1XD0A 1RK5A 3AIQA 1EP2A 1Z41A 4GGHA 1A3WA 1BF2A 1R2TA 1IV8A 1GK8A 2VGGA 2Q71A 1E70M 1LTDA 1GORA 5LNVA 3T7VA 5HMDA 2ZXQA 4HHPA 1RD5A 3FFSA 3DFYA 1P43A 2OG9A 1XIIA 3G77A 5C55A 2HCVA 2BXZA 1EX1A 1O5XA 4LPCA 2EG6A 1LRNA 3LHVA 3LCGA 3GUWA 3UJRA 3VIIA 4FNPA 3N2BA 5D09A 1ZGDA 3H4GA 2YB4A 4G56A 5G2WA 4AVFA 4ZOCA 3TTSA 4Y6GA 4GJ1A 1ZSXA 3UF9A 4DN1A 3JVAA 3M0VA 3E38A 4O17A 4GACA 4JTLA 1TE6A 3NGFA 2FPVA 3PJXA 3ZLFA 2UY2A 4LS0A 4JXCA 3RXZA 5DY2A 2OZTA 4QITA 1W0MA 3PZIA 2WKGA 3E2SA 4RDWA 3WDJA 3GTFA 1W1VA 5MKGB 5I78A 2IQ0A 3ECQA 2E6YA 1OFEA 5AHLA 4AF0A 3FY1A 3S5OA 1PEZA 1OGGA 4E0CA 2IQDA 5CSRA 1A5AA 1SO3A 2PU1A 4B5UA 3EB2A 3B8UA 3BDKA 4OECA 4WHBA 3DAQA 5CGMA 4WIWA 2NX3A 2WJDA 3GVQA 1M3UA 4JTIA 1S2AA 4QSFA 5A6LA 1M04A 3OHIA 2ZTJA 4I9MA 4QHRA 1KFWA 1VCGA 2QJJA 2XVGA 3IUDA 1G4PA 5E9AA 3MJYA 1S38A 1AQFA 3B97A 1S39A 4PL2A 1XBXA 1WOBA 2VO5A 3K1GA 3WZ0E 1J2BA 4RW3A 2CZVA 3CM4A 4HNVA 1VLWA 2RGMA 1FHLA 3IV3A 5DELA 5DQPA 2NQHA 3ZS4A 5SWUA 3EX6A 5F1VA 3RR1A 4YXGA 2ZE0A 4Q4QA 3N34A 3KBJA 3SCVA 4UQBA 2DUAA 3S8HA 2IMRA 2CETA 1JQVA 3FJ4A 4UMCA 1U1UA 3AWOA 4R5EA 3D47A 4IICA 4M0XA 2ZXAA 2BHZA 3TSMA 1UWRA 2VD9A 1PBGA 3U7VA 2OB3A 3ZLHA 2FZNA 4JX6A 3B9DA 2BNJA 3R8RA 1Q6QA 1TKKA 5DBUA 3KS5A 1Z89A 2ZBTA 4FMVA 1UWIA 2DIEA 4CNNA 1XWYA 4HZ7A 3RJXA 1E0VA 5EBUA 4P7RA 1P1MA 1CXIA 2BXYA 1ZJHA 3SN4A 3H2CA 1VJSA 1MEWA 1CNVA 2W67A 3K4AA 1XW8A 3GSMA 1LQ2A 3IPWA 4I6KA 2VT0A 4MZ8A 3S1WA 3B0XA 2PP1A 1V3MA 3TVAA 4JTFA 1LOLA 1V3JA 3UGRA 3OLDA 4FB7A 4PR4A 4DBEA 2NQLA 1KV8A 1VFTA 2PTWA 5EMJA 1OZQA 3EWBX 2FTPA 1SR0A 3S2MA 2ZXDA 1LYXA 3BSMA 2REQA 4JTUA 1CT5A 2BBFA 1H0GA 1R9ZA 5JH1A 3KL0A 3A24A 1IE7C 1ONWA 3QZAA 3NQVA 1XLDA 1Q8AA 4OV4A 4RLIA 1K77A 3T42A 2IPFA 4U2ZA 4YCPA 1VYRA 1JDAA 1LT8A 4W86A 4AZGA 2VELA 3PY2A 3N6JA 3TYDA 2J27A 3GHTA 3LNPA 5BXSA 4S3AA 2DSWA 3DOPA 1B4EA 3TAOA 3WD3A 4E4FA 3QQ0A 1VBUA 3W7RA 4DZHA 3L4XA 1UPPA 4O11A 1WKEA 1NDVA 1WDPA 1EGZA 2YZRA 1V79A 4XTDA 3KAOA 1S2VA 1JDDA 1Q85A 4OHQA 4L4LA 3EDFA 4F9JA 2G3IA 1OK4A 5TQLA 5GJMA 1PZ3A 2GL5A 5AC5A 1YHTA 1E9ZB 3NO5A 3S5ZA 2WOQA 4C5ZA 4GNKB 5DF0A 3KBNA 4F4RA 1RY8A 4PSPA 3VNKA 4B90A 4AEEA 3LK6A 1A5CA 5KETA 3GW3A 1XIJA 3W7OA 5HXMA 2V5LA 4MIMA 4BK9A 4ERAA 4UZSA 1E6XM 3MB9A 1XCXA 3BW2A 4WSHA 5LNRA 3OTRA 3A9IA 3WDIA 4FXFA 2XVPA 4R27A 4K7YA 2AGKA 1DWIM 4MFEA 1Z6KA 4QQUA 3L4YA 3VI2A 4UTFA 5IRPA 2WLZA 3BV4A 4O10A 3CUIA 5I3HA 1QNRA 5AKQA 1RJPA 3GZ3A 3P62A 1OCNA 3GU2A 4XAPA 3LV5A 1G4TA 3CL6A 3DYMA 4RZBA 1EFZA 3A13A 4LAZA 4DXKA 1MXSA 3TE9A 3QBUA 3V36A 1SW7A 1LLWA 3ELFA 3M16A 5IBXC 1NARA 5K3VA 2IKHA 2VCCA 3MKCA 2J74A 2PTXA 1XLMA 1ZBWA 4O1CA 3VAVA 4LAMA 2CERA 4PUUA 2G95A 2NVCA 3FN9A 1VEMA 4I7WA 4GFIA 4TXEA 1FWRA 1UKPA 1XQLA 1GHRA 2PDFA 4KERA 4N7QA 4C6EA 1JZ6A 4RV3A 1H7RA 3IRSA 4NHVA 4D2JA 2PDPA 3GR4A 2UBPC 1AZ1A 3EXTA 1K9FA 5IHSA 4HJWA 2BHUA 4AZ5A 3TYEA 5JVLA 3T07A 1G1YA 1Q45A 3UXDA 2PRMA 3AS2A 3TP4A 3N6QA 4DJEC 4GGBA 1DE5A 1TWIA 3G3MA 1G0CA 4LVFA 1JCXA 1W5NA 4GK8A 3GFZA 4C91A 1WP6A 4FK9A 1V0NA 3V16A 1EZ2A 3VOGA 4IZGA 3KXQA 2OEMA 2UWFA 5IFTA 4N4QA 2VEMA 3EEZA 1H63A 1UP0A 4GD0A 5CGTA 3IUIA 4JKMA 3N4FA 3CBWA 4LVBA 1KBJA 1SJDA 1X38A 4AIOA 1F61A 3TOPA 2W63A 3IK2A 1UUQA 4D6IA 2VWSA 4XKMA 2EG7A 4KW2A 3SRKA 2Q6ZA 2GWNA 1JD9A 4YIWA 2CBVA 2XFRA 6REQB 2XWDA 1HKWA 4C6DA 4DWSA 3AO0A 4DXXA 1PIFA 3W72A 4D6HA 2AL2A 4AUBA 2GDVA 1KFLA 1HKJA 4ZTYA 3CQHA 1F8IA 1V77A 2J24A 2IQTA 3W1XA 2WQPA 2BDQA 1EJXC 1TV7A 4Y9MA 3FGCB 5A95A 2OODA 2Z6JA 1OFRA 3WFLA 3EX1A 4DB7A 1MQQA 1W3JA 1ZALA 2FHBA 4I9TA 4A8NA 1HZYA 4WOZA 3VXGA 5FKYA 2REQB 2IW0A 4EPBC 2PP3A 4ZMGA 1E4NA 2BVTA 2VOMA 4X9SA 3WF0A 4B3ZA 3M47A 1HO1A 2ZZ2A 3TLLA 2AMGA 1MW2A 5GJNA 1SR9A 1WAUA 3S4TA 2PTZA 4W85A 1DQWA 3N2CA 1NFGA 2E25A 3SUUA 3LEPA 1FKWA 1JZ7A 3RCNA 4I90A 2DY3A 1WDSA 2YFNA 1VR6A 1EEPA 3ZM8A 5BXTA 4H41A 2J7GA 1IWBA 2ZVIA 4ZODA 1UH2A 3G3DA 3AS0A 3GH4A 1Q7MA 4AEOA 3C3NA 3VNYA 4LC8A 4HB7A 4E2OA 1SZEA 2WO5A 4ZB5A 3RJYA 3TK7A 2HPIA 4UOJA 1FWNA 3MS8A 3LY0A 1HKMA 3B0VC 1EP1A 3CZEA 3LPOA 3MI6A 3EB4A 1Y5WA 4QS5A 4I7UA 5D2TA 1XISA 1FP8A 4DO6A 3H53A 1TWZA 1ISWA 2A3EA 5HWJA 4AWUA 1I2OA 3G1XA 1ELSA 5BOOA 2OKTA 1FH9A 1NWTA 5AHFA 4DO4A 5CBBA 3WQPA 4J3SA 1UBSA 1XC4A 4UNKA 4ES4A 1QOQA 3VC5A 1QI5A 5E6YA 2GJLA 1FKXA 3WENA 4BKNA 3BGAA 1MMFA 4EAYA 2NUYA 2EQDA 5HJXA 1F73A 4U33A 4E5TA 4XISA 1TE1A 2QEZA 1M68A 1LL4A 1THFD 3W7LA 5HOSA 3OVPA 3A5FA 3UCQA 1QI3A 1XXXA 4UTWA 4QM1A 3G22A 1KBLA 1P6BA 3BK0A 4GVIA 3LBMA 1MRAA 4F48A 1FXQA 2PUZA 5C6MA 3QYQA 2QCDA 1WZKA 3ZVHA 2WZEA 1L6WA 1VD6A 4H19A 1R86A 1LRTA 4FP1A 4LB4A 1H51A 2XZ7A 3L7RA 3RRXA 2YDSA 3CUGA 4FOJA 3MY9A 3FVDA 2QIWA 3R94A 3S1GA 1XCFA 2YA2A 1FA2A 4HMCA 4AXKA 2AAMA 3NEHA 2R1NA 4M51A 1GONA 4Q7BA 1NTHA 1DYSA 4B91A 3NO3A 5HQEA 3U5UA 2E3ZA 3WLMA 1KR0A 1NQ6A 1V3KA 6PTDA 1ZLPA 5MF5A 4JCLA 2E8YA 1DHKA 4BI7A 5GPRA 2YA0A 2BMBA 4J7RA 5HATA 5AC6A 4E2VA 4UR7A 2QS8A 5DXYA 1PAMA 1TSIA 2YCKX 1VZWA 3WQWA 2GQ9A 3HM7A 4GI9A 4LYQA 3UWWA 4LUSA 3N2OA 4JR5A 4OUEA 5A69A 2O55A 3QMSA 3NQBA 3QN3A 1H5VA 3AICA 2V3EA 1I2NA 3K2GA 1JIBA 4O1AA 1QHOA 2A4AA 2WMGA 4DWSB 4GJJA 1SUXA 1ONRA 1BEUA 2W66A 1P4CA 1CPUA 1OABA 1TUFA 1C8XA 1JDFA 2XFYA 1M53A 4OTKA 3W74A 1EBHA 3HIJA 1KFBA 2DSZA 3LHZA 5F4XA 5LZLA 2J7FA 3FJLA 2BTMA 4D6DA 3WBXA 1Q7QA 3W7GA 1XLJA 3O06A 3NG3A 2J9ZA 4JCMA 4HPNA 3ABSA 3UFYA 2YZ5A 3PTDA 1S2WA 1HP5A 1L6YA 1JPDX 2KX9A 4NZJA 2WVVA 2JKEA 1TRIA 2XH4A 4WDWA 3IIXA 3G1DA 3AIBA 4HTBA 4L6OA 3AFBA 2Y7GA 4CQ8A 4KWWA 2PWUA 5FAJA 3WK3A 4O8AA 4Z08A 1Q3NA 2Y2WA 3EXSA 3EB3A 3CLMA 4R9XA 1I60A 3GRIA 4BEQA 3B0YA 3THDA 3LSCA 5L6UA 1TTJA 1QI0A 3T0CA 3QM3A 4DNMA 3NL5A 3NR0A 3OGVA 1VBJA 1XBYA 2RJHA 1U1HA 3HV9A 4N6FA 4QE5A 2NUXA 2FFIA 3G8EA 5RUBA 4TV5A 3TW9A 2HMCA 2VEGA 1W54A 4JHZA 2G4JA 2P0IA 5HNTA 4ZE5A 3BANA 4LALA 3A47A 4B5SA 3B40A 3PBYA 1VFHA 3B8SA 4O0QA 5E9XA 2NXHA 2JEQA 3C2OA 3OLEA 5A6BD 2E9BA 3PZOA 3WELA 1Q65A 5H2ZA 1NOFA 1FWDC 4I9AA 3EX3A 5CBJA 4TQTA 5L9FA 1W1B1 4ADTA 4QTGA 4P7LA 2W61A 1HJXA 2VX4A 1P0DA 4HA1A 2VHLA 3G1HA 3GK0A 5I07A 1UKTA 5JIWA 4D6EA 2ODOA 4ERIA 3BGGA 6TIMA 1SSDA 1EOMA 1X8CA 2NXGA 3LB0A 4FNQA 5J04A 3H2NA 3MUCA 3B9OA 1BF6A 3MV11 5JUVA 4N9EA 5AZ1A 1W17A 3O05A 4K1WA 1HGWA 4N0RA 4GC4A 3BLFA 1OG6A 1DV7A 1BAGA 4LRTA 2NT1A 2QLYA 4LEQA 5J5RA 1W32A 1YTEA 5EPDA 2VFEA 2XU2A 2A1YA 1UZHA 3WLLA 4C6IA 3DHFA 1XRFA 4ZO8A 5DCBA 4QNWA 4HTYA 4RE3A 1XD1A 1XYMA 3M46A 4XUYA 1EKOA 5BWFA 5JBFA 3AHTA 3G1YA 4L4MA 4Y96A 1R3RA 2PE4A 5HR6A 5K7JA 3NZRA 3HG3A 4LYKA 1ZP3A 3C56A 1JPHA 2ZX6A 1TPDA 3EMCA 4B5NA 3U9IA 3U2EA 2ZZ3A 1TV2A 3PZTA 1EJTC 2HVMA 2Z1SA 5M03A 4PB3A 4US5D 5A6AA 1E6PA 4HU8A 1CDGA 1JZ2A 3NAVA 4IM4A 4GIRA 3KM8A 3UR5A 3UZYA 1R3TA 2R14A 4JTGA 3M0HA 3OQEA 2O9PA 1HFBA 2V82A 3A4WA 1CB2A 3BL3A 2IXVA 2P1FA 3GHSA 2FIQA 2NX1A 3BLEA 1H11A 4LUSB 3LZ3A 2XJ7A 1B3OA 5C8BB 4JL2A 2E5DA 4V28A 1VIWA 3W2MA 1E0XA 3OIXA 3PWIA 3N9KA 2XIBA 3QV6A 3CIXA 1R87A 1BHGA 1ZJAA 4Z42C 1UQZA 4NJHA 3FV9A 3UBPC 6A3HA 1XLBA 2CKRA 1Q6OA 1WZLA 4LF1A 3LI1A 1NDYA 4MB5A 3EDJA 3VNDA 1O94A 3T55A 1K6WA 4OBRA 1XIMA 2CYGA 7ODCA 4GUIA 5CAHA 3N15A 3HPZA 5I3FA 3KCOA 3AISA 4I5XA 2O92A 3PZNA 4EX4A 1N55A 2WBGA 1LWJA 3WLOA 4F0HA 1JJKA 3L68A 1Q7ZA 2ZRUA 3W07A 4GY7A 4P8VA 4MADA 1AW2A 2QNEA 1NQKA 2FJUB 1RVKA 4Q4KA 1F8MA 4H7VA 2E5CA 1ITCA 3AMDA 2WSPA 1V3IA 2Y8KA 4Q3MA 1F5ZA 4S3KA 3CV2A 3UYIA 2EAWA 4DF1A 3WD1A 1E56A 1IT8A 1ISYA 3ARTA 1XC6A 1I6NA 3TWAA 4D71A 4DM2A 3TMQA 3MZNA 1ZBCA 4XIAA 3PZ9A 1QPQA 5JBDA 2QDGA 1RAKA 3BLDA 4I8YA 4S2BA 1YADA 3RU8X 3RO8A 5DCEA 5AHIA 1JZ3A 3GC2A 2YDQA 2TPSA 3S2NA 2EJ1A 2Q3RA 1G9HA 3MC5A 4NX5A 1ZAJA 2G5WA 1UKOA 1O7AA 5A3HA 3DFHA 1HL2A 3F1QA 2Y0FA 3NPVA 2HVNA 3V1PA 1HIZA 1OD0A 4DJDD 1KM4A 4MG4A 1UOZA 1J9YA 3W1TA 1UKQA 2DT3A 4Y2WA 1NP0A 1F3WA 2QCHA 4OKDA 1F2JA 3B06A 3IVSA 4UTHA 4UR8A 2EPKX 4K8GA 2C18A 3TQPA 4POCA 2YSWA 3IGUA 3SFWA 3LM3A 2D3NA 2B81A 1XM3A 3QFEA 2Y5SA 1TA3A 4D8LA 3P0XA 3TYCA 4L6DA 4IPLA 5HANA 3N9RA 3DC8A 1G67A 2V38A 4I7VA 4V33A 3WQ4A 4XSMA 3N4EA 4WK9A 1TJ1A 3QGVA 1QBAA 1KM2A 2BASA 1W9XA 4AMAA 1DJQA 2LLEA 4YS1A 3ZJ7A 2CLKA 1PTAA 2F84A 8RUCA 4B5WA 4QJ1A 4AZ7A 4IQEA 3GG7A 2J77A 4GUJA 2NUWA 3T0AA 2V67A 2WZMA 3THAA 1GOWA 2Z1BA 3GBDA 2INZA 2WNNA 1X6UA 3ZVIA 1E5NA 3I3EA 1EDTA 3W7QA 3GS6A 3S46A 3L21A 2C16A 4ZQRA 2BOGX 2CHRA 4ADUA 2QAFA 3BOXA 2XGIA 2PWDA 2QCEA 3B9NA 2G50A 4QEEA 2RDXA 5FOOA 2Z2BA 4XBKA 1B31A 1T41A 2Y5EA 5D9PA 2FPYA 1SZNA 5LHEA 4BJHA 4WKFA 2QDDA 3WF2A 1QBBA 2YYTA 4TX8A 4K8EA 1YDVA 3KWSA 1XPYA 1DJNA 3VIPA 2QJGA 1RBLA 3TMLA 1TPEA 1DBTA 2VVSA 4GZJA 1SJCA 3BOFA 4IPJA 5FF0A 3L0GA 2ZUNA 3CUJA 1X39A 4M5PA 3H7RA 1GVRA 1K8CA 2Z29A 3BARA 4U28A 1WV2A 2NQ5A 3PWAA 1KFKA 3U3HA 4HYVA 5D8ZA 2DV0A 1N82A 3TW7A 1YDNA 2YLAA 3NL2A 4YCOA 2W4XA 3W75A 5DLCA 4GXWA 2I1OA 5G4EA 3CQJA 3JR2A 2X40A 1IHIA 4RNHA 5A8GA 5CG7A 2WMKA 4J3WA 3CZKA 3LN3A 4Y7EA 1VHNA 4B5VA 4O0KA 1HQTA 2WZTA 3VIHA 2CZEA 3K4DA 2BODX 1DXEA 3HQOA 1JDEA 1GVIA 4HCLA 5AHEA 2CU0A 4A3UA 3ME3A 4EF8A 4QR6A 3B8TA 5CZKA 3S9ZA 1OFQA 2FGZA 4LBRA 1J6OA 3TH6A 1XFBA 5GNZA 3WNMA 4O57A 3SEPA 3DXIA 3GM8A 3ONBA 1JZ4A 4ZENA 1QXLA 2J7EA 1PDZA 2XWEA 3LRKA 3CAWA 3C4UA 3E0LA 4CGTA 4Q22A 5ABEA 3COTA 3W23A 5HAOA 2EHHA 1YNQA 2FVMA 2DFAA 4L5ZA 3TSBA 1LJYA 4F2UA 2BS9A 1ADSA 4XZHA 2JF7A 2HISA 3G1SA 4D1IA 1KCLA 1IEVA 3IJLA 4XO7A 4UOQA 1EJRC 1K3UA 3N9SA 4AIEA 4C65A 4RX0A 3ABQA 2XH0A 2GQAA 1A5MC 1YXYA 3LPFA 2C6QA 1YBQA 4QXIA 4K36A 3T8QA 4LU0A 4R7OA 4C6NA 1TCMA 5DFAA 1E1CA 4W8AA 2CLLA 2I16A 5HK4A 2J47A 2HK1A 2V2HA 2ISVA 1JUEA 4CD6A 2WKJA 3W73A 1TPC1 1UA7A 3G5EA 3GDTA 3SGZA 3GIPA 1KQZA 4XD5A 1KM0A 1XINA 3GH5A 3SCWA 2QCLA 2EPMX 3MI3A 3SUVA 4O15A 4YTTA 2QJMA 3GIQA 4HMDA 1RQBA 5EGRA 4IQLA 3M0XA 1XIEA 3S1XA 2MNRA 1XSKA 1QPOA 5IM51 3A4JA 3HPAA 2O9RA 2NT0A 1UUOA 4UTJA 3LX9A 4FOUA 2B31A 4NNAA 1QVBA 4XZMX 4PFMA 4AZ6A 3HFYA 1JRBA 4UTLA 4PFHA 3EKLA 1KRBC 1TA3B 3FA3A 1RP8A 4N42A 1B4KA 2ZRZA 2BY3A 4BS0A 2F6XA 2XSAA 2WANA 3O3RA 3IIPA 1LL6A 4JKLA 1T0OA 3BLIA 2BY1A 1Q6FA 2VD8A 3G1VA 3PHAA 4J40A 2RDWA 2Q8ZA 1POKA 1S3HA 4XVDA 3MSRA 2ACRA 5IOBA 1UB3A 2F2HA 1W9UA 4ZO7A 7TIMA 3SQMA 5CXPA 3NXFA 1DORA 1F4AA 1CCWB 3ZSTA 3AS3A 2ZRXA 4YWSA 3NQ8A 4DWSD 3VGBA 3CZ8A 4IIDA 1I0BA 3PG8A 4Y8FA 1GOKA 3RGTA 4F2BA 3DZ1A 3BW4A 3C86A 4PMZA 3PNZA 1FP9A 2PGEA 1FWJC 1GJWA 1D8WA 4FHAA 1EXBA 3PBVA 2A21A 2Z6IA 4L80A 1GQKA 4LNYA 1ZCCA 1LWHA 3TW6A 3WLKX 3VOIA 2GJXA 3APGA 4CQBA 4QNEA 3LPPA 4RL3A 1M7XA 1QPNA 4AD1A 4CNPA 4CQCA 3PB0A 3M0LA 2V68A 3GO2A 1J01A 5CLTA 4MWAC 4LB3A 1JPKA 1BXCA 1HVXA 3ABOA 2C3ZA 1RA0A 1KFEA 4UTTC 4GQQA 4XO6A 4XZNX 3CNYA 2VWTA 4IPPA 4FR1A 5HPOA 3TKFA 2YL5A 3ITVA 2ZOXA 3N1AA 3SIMA 2HRWA 4LUIA 5EBAA 5HBFA 4JFUA 4LH8A 9XIMA 5LGZA 4M56A 5C5YA 3BOLA 4QQ3A 1DIOA 3M5VA 1PO9A 4LAUA 4ORIA 3RMJA 4HU4A 1J0KA 2HWGA 3W1PA 1GKRA 1XSJA 3BSHA 3M6YA 2HNEA 3E0IA 4PRTA 1AJ2A 4QJ5B 1JUBA 3ATZA 3UR8A 1C7SA 1REQB 1X7FA 1D7FA 4HK5A 2WMIA 4UQEA 5D30A 3QZEA 3ITXA 5I77A 1EJVC 4R33A 3NXLA 2AQVA 1DIKA 3ABZA 5JBEA 1HG3A 4K38A 2OSYA 4B4FA 1F7BA 1FWCC 3DFPA 3ABXA 4NUWA 1XLCA 3SCPA 5KINA 3UZJA 1ITUA 4Y90A 3W7DA 1LP6A 4IMAA 1OHLA 3WUGA 5AYIA 3GD6A 1OGBA 4IIHA 5H6HA 3AQUA 3B05A 3U4AA 3SSJA 1R3VA 4Q8TA 3NQCA 3OG3A 2VQTA 1W31A 3PPFA 1WYIA 2WV8A 4RZ6A 3V0TA 1R0MA 2FZ9A 4MPQA 4ZXLA 1XI3A 2F8QA 5G2HA 3PZGA 4K8HA 1GOOA 1JG9A 1UW9A 2XIJA 3WH7A 3TLQA 1AD4A 3HTWA 2GGIA 1YBQB 1EJUC 1AH3A 4URIA 1MWOA 4IFKA 4RKAA 3L23A 1LCOA 1G69A 5AC8A 4F0KA 2PTDA 1JPMA 2HEJA 2FHCA 2VZTA 1GYMA 4IGNA 1UH4A 1RQEA 1ESWA 3MWAA 4Q8VA 3MMWA 1BFNA 3QXBA 5ECVA 3A4AA 1RVGA 3IV8A 1IZJA 1VP5A 1GPWA 2D0GA 3BLOA 4PMVA 1SYTA 3ITOA 2VDIA 3UWUA 2C1HA 3KLKA 2VFHA 1MXGA 4Z2JA 2B7PA 3IIZA 3