3W75A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-149
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-149
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w75A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w75A01
3DFTA 1CI1A 1A5SA 3LTYA 1SW3A 1ICSA 3G1FA 2RH9A 3G0UA 4PL1A 3NQCA 4W9TA 3HF3A 3HPSA 4RKAA 1TJRA 5AB3A 3M7WA 7TIMA 4AXKA 4CQAA 2OX1A 1LOLA 5FESA 3DBPA 3NEVA 5KZDA 1GVRA 1X6UA 3OEXA 1VYSX 4ICNA 3TQ0A 4RZ5A 1JUEA 5FF4A 5FEPA 4LVAA 2ZZ1A 3DKLA 4JY8A 4OE7A 3UWQA 1Z42A 4ZVJA 2QJGA 3P81A 3W71A 3UZJA 1DL3A 3BV4A 5FEZA 1GTHA 4WY0F 1OFEA 2DP3A 4RK8A 2ZA1A 3LHUA 1KFLA 1Z48A 3IIZA 3GVGA 1FWRA 1AL7A 1GVOA 1ZENA 1GYNA 1TQJA 4JTLA 2E5DA 1H62A 1GVQA 2YW4A 3GKAA 2Y7FA 2H6RA 5AYZA 1Q6OA 4UR8A 3MHGA 1OABA 3D0CA 3E49A 2ZRUA 2F84A 1F73A 2NXGA 1QOQA 2H90A 2ISVA 3VFLA 3S6DA 2C16A 3NL6A 4YCOA 4KFOA 3M9YA 1FX6A 1JR1A 3C6CA 4IPJA 3V1PA 1VCGA 3SGZA 3W86A 4YCPA 1LYXA 2YZRA 2PE4A 3W75A 2FDSA 3W1LA 1TCDA 3ATZA 3M1ZA 1SSDA 3LX9A 1G7UA 4AF0A 3P60A 3W1QA 3NQFA 5D2WA 2B7OA 1M7PA 4O4WA 1K8YA 3CEPA 2GJNA 4P61A 1KA9F 1UASA 5I3GA 1LOQA 4RXGA 4LY8A 4E2DA 1KM4A 3NQ7A 3T55A 3MYOA 4FF7A 1ZALA 4IX2A 3GDMA 4N02A 3STFA 3BLIA 4M5PA 3IGUA 3S5NA 5H2ZA 3KRSA 4NZFA 4UXDA 2NWSA 3R13A 3UYCA 1KFKA 4GUHA 3QFEA 1GT8A 1LM1A 2NX9A 1KM0A 4NQ1A 1YPFA 3NM3A 2QKFA 1W37A 1XUZA 3R2GA 3MHUA 2NV1A 3JRKA 2VEMA 4LS1A 1VQTA 4O19A 3KAOA 2ABAA 4IGHA 2C18A 3S1VA 5KITA 2YR1A 4UTMA 4Z1BA 4MFDA 1QFEA 3TW7A 1ML1A 3FKRA 1KM6A 3LHWA 3QMRA 2ISWA 2YDAA 4MY1A 4TMCA 3OHIA 1X8FA 3GR8A 4A2SA 2Q8LA 1WA3A 5K9XA 2VELA 1OVDA 1K02A 3CT7A 3QPZA 2GVLA 2H3DA 3ABRA 2V0TA 3I7QA 3N2XA 2Q3RA 4MZYA 4O15A 1KV5A 4RCXA 4JX4A 2O7QA 4CCEA 1X7FA 3B0PA 1TIMA 3LCWA 1Q3NA 1HG3A 3W7LA 3PAJA 5K2ZA 3BG5A 4LU0A 2A1YA 3P61A 4N6FA 5EBUA 1T99A 3B0UX 1FBAA 1W5MA 4Z0SA 4CQ9A 4LUJA 5CZ0A 1B3OA 2ABBA 4LS0A 3PR2A 4TR9A 2QCEA 4IMFA 1H7XA 4KFPA 4UTHA 2B7NA 4DPQA 5LHEA 1A50A 3N34A 5EL1A 3EKZA 2CLMA 4O8RA 2C15A 3KVJA 3EX6A 4NVTA 4UUIA 3USBA 2WPBA 1V7YA 1EP3A 1KFCA 4UR7A 2NX3A 4TU1A 3SZ8A 2EF9A 2H8ZA 1IXQA 1KBJA 4O13A 1N7KA 4XQ6A 4ZQPA 5D2YA 3LCHA 3QC3A 5SWUA 1NVMA 3TX9A 1H7WA 3W7RA 3DKJA 1J4EA 2W0UA 1Z44A 4IMDA 4CNOA 1TB3A 3KXQA 1HUVA 3TFXA 2Z6IA 3FFSA 3EX2A 4N9EA 4UFLA 5G4WA 3L5AA 3S0CA 1Q6QA 1TYGA 3IGSA 3W07A 2DU2A 3T78A 2C0AA 2ZZ3A 3BW4A 2BZNA 3PB2A 5DELA 4LVDA 3KHJA 4PA8A 3KRZA 3W73A 3W7DA 1OK4A 2OJPA 3TROA 1NFBA 1G6CA 2Y7GA 2GVJA 2WV8A 4RLIA 2E6YA 3MWAA 3SIZA 5AC7A 3CEUA 3GXPA 4I9AA 5D09A 1OK6A 4WQ6A 2YXGA 3L66A 4GBUA 4DF1A 1VC4A 5F4XA 4JDBA 1A53A 3B03A 4DO6A 2WNNA 1GTEA 4ADSA 4FNRA 1Q45A 2ZZ7A 2Y85A 3O6CA 5D32A 1D3GA 3PUOA 1I2PA 3T4CA 2ZZ2A 3TH6A 3DI0A 2RDUA 4PFMA 4XKYB 2FIQA 4IUOA 5FEWA 1YPIA 1C9DA 3LI0A 1NEYA 3TMLA 3NGJA 3PM6A 3INPA 3C61A 3BG3A 1TPWA 2TRSA 1XBVA 1OX4B 3DFOA 3KVKA 4BF9A 5U4NA 3SR7A 1HFBA 5G1TA 2QEZA 4BWLA 1VYPX 1SO3A 3E96A 5EMUA 1LP6A 1S5WA 2J27A 3UWZA 3NPVA 4WUIA 2VFHA 1KFEA 1MEIA 3TXVA 4LW7A 1YDVA 5AHNA 2QCDA 4O1AA 2B7PA 4RR4A 2EKCA 2WQPA 4JTFA 3CLMA 3DFQA 1ZFJA 3HPXA 4MLJA 4C1LA 5HUPA 3NR0A 2FJKA 4LOCA 1LRQA 4L4MA 1XC4A 4YWIA 4O28A 3MW7A 1C29A 2GOUA 1M6JA 4UTTC 3HGSA 3WJSA 5LNUA 1QR7A 3NL5A 1VCVA 5I3KA 1ONRA 1JRCA 1H50A 1VGAA 1XI3A 2C6QA 2C14A 3F03K 4M6QA 1P4CA 5LNWA 2XN2A 3B0VC 3C2VA 3PB0A 2Y6ZA 3TE9A 3W2MA 1JCNA 2V2CA 3G8EA 4TMBA 1Z41A 4Z1CA 4N4QA 3GAKA 4OWGA 3NQDA 1K7FA 1MEHA 2CZFA 5D04C 2WNQA 1FCVA 1LBMA 2YX0A 1G4TA 3OVRA 1X1ZA 4QSHA 5DBTA 4LS2A 3CHVA 5BRBA 3FYOA 3WK0A 5D33A 3P80A 5C5YA 3PC0A 1H63A 5AOUA 4TO8A 3W2LA 3BLEA 3G0XA 4BI6A 2J9ZA 3M16A 3WK3A 4EIVA 5CSRA 5CKSA 1OF6A 3O8AA 4RJEA 3PUDA 3MBDA 1DV7A 1JCMP 1XBYA 2DZVA 3P7YA 4DBEA 5CG7A 3TR2A 4MY9A 1W3IA 2YCEA 2DJXA 2QCLA 4O17A 4A3UA 1GVFA 1S5VA 3G24A 1OX4A 3B04A 3NNTA 3VE9A 3RNDA 3LI1A 3W70A 2B7QA 4JY9A 4LRSA 4OQVA 3CM4A 3QYQA 1GG1A 4MOZA 5TBOA 3G1SA 5ABTA 5A8GA 3VE7A 1XBXA 2GUUA 1BEUA 4XUGA 3ZR4A 4N6EA 4E0CA 1KM3A 1XL9A 1HO1A 3N2MA 3QZEA 1ICQA 2W6RA 4HSOA 4O52A 3KVMA 1YXYA 1GG0A 3SSJA 3U8GA 4ORMA 4PEKA 1G67A 2V8ZA 3ZFHA 4N9DA 2JGYA 5E93A 3HGRA 5FEXA 1OFDA 3LRKA 3PBWA 3C52A 2B0MA 4IMGA 3OBKA 2EAWA 4ZQRA 4OV9A 3UNDA 3EX3A 2VEIA 4NZJA 1Y0EA 1RR2A 2O7SA 1EP1A 3PSWA 4IJBA 1EIXA 2YFOA 3FJLA 3R89A 1DORA 2J9XA 4XBSA 3Q37A 2X1RA 4XTIA 4WXYA 1VZWA 4WXZA 3S9YA 2UV8G 3GDTA 3MP3A 3RF9A 2IQTA 2FFCA 1ZAJA 4NNCA 3OG3A 3P62A 4MYAA 2B4GA 2PURA 3O6YX 5F2MA 3N3MA 2BTMA 3EWUA 2V30A 2FPVA 4PCFA 4K7VA 3N73A 1B9BA 3THQA 4LRTA 2E6DA 4R34A 3A9IA 5TQLA 1NF7A 2X30A 2CLOA 3MBFA 3LERA 1GEQA 4MJMA 1YTEA 1JULA 2V82A 1JCLA 1WOBA 3TC7A 5CPNA 2TMDA 3DFNA 1GQNA 1TRDA 5E0KA 1HL2A 3P67A 2NUYA 5LGXA 4LT9A 3W72A 2ZTKA 3LM7A 3ZWTA 3NQMA 1ME8A 5K4XA 3NL3A 3T7VA 5LKYA 4FEZA 2CLEA 4UMBA 3O1NA 5F4SA 1WXJA 1L6YA 1YDOA 1QAPA 2CZEA 2QCFA 2CLLA 1I2NA 2WNZA 2OMAA 3N14A 5IM51 3LOTA 3O07A 3C4UA 4ZZ9A 4HN4A 1F7BA 3HQ1A 5F1UA 4IMCA 3FJ6A 4KKXA 1BWKA 4UMCA 4UNKA 5T26A 3HGJA 4CQ8A 2DORA 4MZ8A 5J5RA 5KSWA 4ORIA 3LCXA 5BMXA 3FEMA 4AAJA 3S8HA 3EWYA 2QDGA 5L6UA 4BI7A 3A21A 3SW6A 1JJKA 3C2FA 2BLEA 3CU2A 4B5NA 1OYCA 3NQ6A 5AN7A 3B4UA 5G2IA 4AH7A 4GC4A 3NDOA 4ALDA 3OIXA 3TKFA 2QCHA 1G4PA 2A0NA 3A23A 3UY8A 4GUFA 4PL2A 3WFAA 5D30A 3W7HA 2QF7A 4K36A 3LTSA 1XXXA 4ZQCA 1R2SA 1EP2A 1J5TA 3QQ0A 1W5NA 3NZRA 3NXFA 2G95A 1DKWA 2WJZA 1LDCA 1D3HA 1G4EA 4RZ6A 1I8JA 4Z1AA 1EWDA 3M5VA 3RMJA 3BG9A 2NZLA 5G1YA 4JYEA 5LNRA 1F5ZA 2PRMA 3TSBA 3W1AA 1VHCA 3EXRA 1SFLA 3IGXA 3TCEA 3IVUA 2GQ9A 2Y88A 2A7RA 5U7SA 2A85A 4Q4KA 3GDKA 1LBLA 1FWTA 3W1TA 1R46A 3LXBA 3MP5A 2VOMA 3LDVA 3I65A 1BKSA 1SO5A 4IMEA 3NQ2A 5G2WA 1TV8A 3CIXA 1TRIA 2CU0A 3LCIA 2RDTA 4JTIA 1RPXA 4FNPA 1B4EA 5KTLA 1LCOA 5LGZA 1GZGA 3HG5A 3UPBA 2QJIA 3UXDA 4DO5A 2Y63A 3N9SA 1W5PA 4JR5A 2CLIA 3N9RA 3LV5A 4JTKA 3LHYA 4I7WA 1QDSA 3N19B 1PHWA 2ZTJA 1H7OA 2PRLA 5HR6A 4GUJA 3GNNA 2DJLA 4S1FA 4UFKA 1CX9A 4LUIA 1N8FA 2ZYFA 3H53A 3CIWA 3M5ZA 4XWUA 3S5ZA 2ZBTA 1QPNA 2E5CA 1VHNA 4JD4A 4BI5A 1EPXA 1SPQA 5LNVA 1UJPA 5CZSA 3UXAA 2QJHA 1FXQA 3G1HA 2CFFA 5BMWA 3IIOA 1K03A 2RDWA 1LOSA 5CPOA 3BW3A 3W7CA 1EUAA 2ZZ4A 2CW6A 4NNBA 5K3VA 4OV4A 3HBLA 3EWXA 2VFFA 5D38A 1P0KA 1PL9A 3ABOA 5G5IA 3QW4B 2VC6A 3O63A 4S2CA 3UWUA 2BXVA 1OX6A 3SFKA 1YXDA 1VR6A 1UBSA 3DXIA 3A22A 3LLDA 4GUGA 3PVFA 1GOXA 4D2JA 1W31A 4NXKA 1VJIA 1J2WA 3MP4A 3MI3A 2E5BA 3P8JA 1G4SA 2P10A 4NT0A 3W85A 4GUIA 1ALDA 4CNNA 3PG9A 1MO0A 1F76A 4FX6M 4FX8A 2W79A 3CWOX 4WX2A 3M5YA 5K4ZA 3L67A 3E0IA 1GPWA 1U5JA 3FOKA 1N55A 1XM3A 5H91A 3FLUA 3TA6A 4CNPA 4EWND 3O6DA 3AO0A 5F4WA 4EF9A 3G3DA 2GVGA 4HNUA 2ATSA 4AMAA 3G22A 5HUOA 4MLRA 1PV8A 3L0GA 2NUWA 1W0MA 1TTIA 1OFBA 2BX7A 4LVFA 3HG3A 1BTMA 2HS6A 1TTJA 3LXAA 4CLMA 1KTCA 4FNTA 2R91A 2RKXA 1H51A 3GX9A 4NJHA 4R53A 4KWWA 1VPXA 2ZRXA 1PE1A 4Q32A 3IV3A 1K7XA 1SFJA 5LSMA 1WAUA 1VLIA 3I7SA 4K8EA 4IXXA 3MI2A 4NJGA 5D2XA 2XN0A 4K37A 4JTGA 3F4NA 3CQ0A 2LLEA 3W87A 5A5WA 3W3OA 3S1UA 1P1XA 3TJLA 3HB9A 2WSQA 3IIXA 4LWWA 1EB3A 4XKYA 3LHVA 1PCKA 4FNSA 4IWWA 3BVJA 4XTDA 5HMSA 3LCFA 4YXGA 3IIPA 3UZ5A 2ZZ6A 4IX0A 3STGA 1B57A 4O10A 4YMZA 1TREA 3GIYA 3WJWA 1IXNA 2V5LA 1LLZA 2I1OA 2G97A 3PSVA 1DJNA 1VH7A 1T8XA 1OFPA 2NXHA 1YTKA 3FYPA 1GYLA 5HJLA 5CPMA 2NWRA 4M6PA 3BW2A 1K8XA 1QOPA 3CC1A 3TDFA 4K8HA 3HMJG 2QAFA 3WJXA 4H6KA 5BOOA 3RLUA 3NL2A 4NX0A 4N4PA 2EGZA 3L0NA 3VNDA 2QCMA 3L21A 4UNLA 1H7RA 1YADA 1TPEA 4UC5A 1H1ZA 1RQHA 1I4NA 3NOEA 3G1XA 1OJXA 2E68A 3R8RA 1WBHA 3P82A 2JKAA 1PHQA 4X9SA 5KINA 3C3NA 1EEPA 4DQWA 4QIUA 4UIOA 4ML9A 5HNRA 4JNMA 4GJ1A 3DU0A 1ICPA 3GXTA 3LHZA 4A21A 4AF0B 4N2YA 1A5BA 4JX5A 2TYSA 1DVJA 3IEBA 2NX1A 4UTKA 3PBYA 4LV9A 5D02A 1QMLA 5DLCA 3HG4A 4AWUA 5AC6A 1ADOA 3E02A 1L6SA 2YSWA 3GYEA 2JKEA 2WKJA 5AHMA 3NQ8A 5DY3A 3MMTA 3GB6A 1F74A 3BPWA 1VYRA 5GVJA 3YPIA 1DJQA 4DF0A 5DY2A 2BSLA 4AEOA 3W1MA 3Q58A 1KV8A 1FUYA 2J88A 1S5TA 3C2EA 3BARA 1KM1A 3W7KA 2PCQA 1XUUA 2DZXA 1G69A 2X16A 4PH6A 3W2JA 2QUTA 4GNJA 4E2BA 5AFDA 1VLWA 4MY8A 1O4UA 1W5QA 5E1QA 3FIGA 2ZRVA 2P1FA 2CLFA 5FI8A 2CLHA 4J9JA 2NUXA 4ZMGA 2OT1A 4R7JA 5DCDA 4I7VA 1WBJA 2ZA3A 4A22A 1YTDA 3SGUA 3V75A 3GDLA 2BWGA 2I9EA 1K8ZA 3MHFA 4HNNA 1S3HA 1JCXA 3QPYA 3QW3A 4M6VA 2QR6A 2GJLA 4HKPA 3TK7A 2A5HA 1FCQA 2TPSA 4UMAA 1AW2A 1KM2A 2J6XA 1W3TA 4NNAA 4UFHA 3QF0A 1OFRA 2AGKA 2FB2A 1XBZA 3DZ1A 1W54A 2E1DA 3STCA 2DZWA 1Q6RA 2HMCA 3F4WA 2XFWA 1OYBA 4AHPA 5I3FA 1ZJIA 2JBMA 3W84A 5MHBA 1VRDA 5I3JA 1K3UA 4QISA 4CCCA 3PY2A 1JUBA 1SZNA 2Y61A 3P5YA 6ALDA 1IF2A 3TMQA 3FS2A 4UTUA 3KFTA 3HGOA 2PRHA 2A6NA 4HNVA 4UFMA 3TSDA 2Y70A 4O14A 1WOAA 2I14A 1L2UA 4M7SA 3PUEA 3LCLA 1FY6A 3DHDA 4Z0JA 4MPQA 1R2RA 3IVSA 2YGYA 3PULA 3NQVA 3G8RA 1W5OA 4NX5A 3VCRA 4UTJA 3GAYA 3A24A 4WOQA 3SECA 3NO5A 2R8WA 4IXHA 3MYPA 2J24A 1EUNA 3DAQA 3KOFA 4NXSA 8TIMA 3NPUA 5AHLA 1AL8A 4JYDA 2G96A 5LHFA 2NV2A 3UWVA 2VFGA 3ATYA 6TIMA 3S5YA 1TTQA 3LBMA 3LCGA 2ZCGA 3TU9A 1OHLA 2OZ0A 3W7JA 1H1YA 2FB3A 3E9AA 1KLYA 5BNKA 4PTNA 3S1WA 2X1SA 2A4AA 1SW0A 1X1OA 3L9CA 4AWTA 2Q3OA 4A29A 1KFJA 3TAKA 4BWLC 2DZPA 2VFDA 5KZMA 1JQXA 4MKNA 3PF3A 2ZRWA 2QCDB 5C54A 3NPXA 5EY5A 1DBTA 1FCBA 4JTJA 3TSMA 2RFGA 2FQIA 1LZOA 1SZEA 1G7VA 4LVGA 2ZZ5A 1QCWA 4WY0B 3M47A 2VFIA 4HSNA 1GVSA 3LRMA 4NU7A 4FHAA 4I7UA 4Z08A 3QH2A 3I7RA 1XDLA 2QCNA 1NSJA 1SQ7A 3W6YA 4HT3A 1NF0A 1TPFA 2QUVA 3MO7A 3WJZA 4DBDA 1QPOA 1TSIA 4RZ4A 3TC6A 3PBVA 3QMTA 4FNQA 3G1AA 4JTEA 1R47A 1C8VA 1RQEA 1ZAIA 3G0SA 2CZDA 1FWNA 4UTTA 4JICA 4U4MA 3FKKA 4HIBA 4WOZA 4O4VA 2WOQA 5DN1A 2FPYA 3O05A 1WV2A 4K39A 1L9WA 1H5YA 5LNSA 4QJ1A 2CLKA 4HPXA 3RU6A 2F7FA 3M6YA 1ME7A 3W7GA 4FXSA 1QO2A 3KX6A 3L68A 4MYXA 1A5AA 1KLZA 5CGQA 4O57A 1QPRA 3THAA 3FA5A 2YW3A 4QNWA 4E38A 1XFBA 5KZEA 3LXCA 3JS3A 3H55A 1DOSA 2NXIA 3S5OA 2EHHA 3L5LA 4Z1DA 2QUUA 5G2HA 3WJYA 3DFPA 4LNYA 3B06A 4QITA 2Y7DA 3VKJA 3W83A 4P2VA 2H8XA 5DXYA 3HJZA 1IXOA 1Q6LA 3E12A 3ELFA 4HHPA 3UQNA 3GZ3A 4NJIA 1AG1O 4JGDA 2YYTA 3L65A 4TIMA 2DZTA 5D2TA 1TO3A 5HQEA 3SJ3A 1TMHA 1FQ0A 1B4KA 2AAMA 3LV6A 5HINA 2X1TA 3C2OA 4NUWA 3Q94A 3ZS4A 1SW7A 3EEGA 3QSRA 5CZTA 2JKPA 3W2UA 1GWJA 2GPTA 3RLVA 1SU5A 4YLWA 1UUMA 3IIVA 4O50A 2HS8A 3W7PA 1LTDA 3QEZA 1PVNA 2GQ8A 3JR2A 1LROA 5IBXC 3RK8A 3TQVA 1M7OA 2A7PA 2HTMA 3LB0A 3W22A 3O06A 1RZMA 4DEFA 3UY7A 4WY0A 3U6WA 3SI9A 4MZ1A 4AHQA 3NQAA 3P8IA 3GDRA 4KFNA 1E51A 4QNEA 4JS3A 4UFJA 3ANYA 3HIJA 1WYIA 1DHPA 5LZLA 3UPWA 5DCBA 1XDMA 1F6KA 3MI6A 3U2OA 3T44A 1LBFA 3EX4A 4U28A 3LTPA 4ZQMA 4N9CA 3OA3A 5CZJA 1OFAA 4O0ZA 4G1KA 4FO4A 3F1QA 1TPVA 4MFEA 2VFEA 1TV7A 3NZ1A 3PBUA 3QMSA 4QM1A 4JDYA 5I3HA 4UFIA 2TSYA 2CWNA 3C8FA 2ZQ0A 5F2LA 4YL2A 2HSAA 1TTPA 3DGRA 2PC4A 3EX1A 4PC8A 4H3DA 3BLFA 1QWGA 3Q2DA 2VXNA 3TV8A 3HPZA 3S1XA 4OGZA 4ZQOA 2OT0A 5D37A 1WQ5A 3DENA 4ONVA 3P84A 5J5DA 1JVNA 4FIQA 2RHGA 3W76A 1IGSA 5AYYA 4JTHA 1MSSA 2EPHA 2FPTA 2WSYA 3BK0A 2V5BA 4LV4A 1W3NA 2A21A 2QCGA 1W1ZA 1WDWA 3TAOA 3WK1A 2D73A 5AC8A 3TUUA 3NYZA 1FDZA 2ZFAA 2ATMA 4DELA 5L9FA 4PODA 1XKYA 4GFSA 1H60A 5AHFA 3TXZA 5K7JA 1RV8A 2G5WA 4LTSA 3W7MA 5D03A 2A2IA 5C2XA 1LORA 3SY5A 3OVQA 4O16A 2DZSA 2VENA 4BFAA 2E09A 1TPDA 1KW1A 2VEKA 3S42A 2Z2UA 2ZDRA 4AHOA 1BWLA 2C13A 2JGQA 4BK9A 4O11A 4LC8A 1QNVA 1TV5A 2ISSA 4FX7A 4WD0A 1F6PA 3CTLA 3EWBX 4ADTA 5HWNA 3QM3A 4DO4A 5FF0A 3C0JA 5F2GA 4FXRA 3LGEA 3A5VA 2OCZA 1T96A 1QPQA 3BGJA 1LRTA 3C56A 4JN6A 3L2IA 2KZHA 4NJJA 2E6AA 1KBIA 1YLVA 1MEWA 1IXPA 4OU1A 3QSTA 3GXNA 5EYWA 3WK2A 3BGGA 3EKLA 1CW2A 4AWSA 5CSSA 3EXTA 5FF2A 4Y8FA 4K7YA 4M7TA 1HTIA 1IIGA 4JTTA 4QAIA 1RQBA 1LLWA 2Z6JA 1YDNA 1RD5A 3G1YA 5AHIA 4MVAA 3P74A 4LC6A 1ZAHA 1H7PA 2NLIA 3CWNA 3KVLA 3UWYA 1O5KA 2YPIA 4JIQA 5K9DA 2WSRA 1OFQA 2P0OA 2JK2A 1SUXA 3QQ1A 4HNTA 1V5XA 3HG2A 1T0OA 5DXXA 5CPLA 4H4IA 4C1KA 4IOTA 3G1DA 4X2RA 1AW1A 1A5CA 1AW5A 5AHEA 4EVZA 4UTWC 3W7EA 3W1NA 4N9BA 5K9CA 1MZHA 1W56A 2X1UA 3R12A 4Y9AA 4TX9A 4A2RA 3NA8A 4FB7A 3NG3A 2FLIA 4UCGA 4OT7A 4Y6GA 1R30A 3H54A 2WO5A 4FIRA 1VS1A 3DFSA 3L5MA 4ZL1A 3W7QA 4MIMA 2Y89A 3BO9A 1MXSA 1LRNA 3KRUA 1TPUA 1EA0A 1NAL1 4S2BA 4JTUA 3QJAA 5DCEA 1TPC1 4GE8A 5HWMA 3GKFA 2Z0IA 3PWAA 4JIPA 1O60A 4M19A 4Y96A 3W7NA 3IVTA 4MUZA 3M5XA 5FF3A 5DBUA 1PIIA 1L6WA 1FCUA 2R14A 3W7OA 1SZGA 3UD6A 3NM1A 5HULA 1P5BA 3HOJA 1PCWA 1SR9A 2AQWA 1JRBA 3L0KA 3K30A 5AYXA 1F05A 1OX5A 4EOUA 4MJZA 1FXPA 4AVFA 4JXCA 4X3ZA 3B8DA 3W1PA 3TNOA 1IIHA 3CB8A 1OF8A 1P0NA 1O5XA 4JX6A 3STEA 3W7IA 1AMKA 4XZ9A 4Q33A 3OVPA 3NQGA 2YFNA 2FTPA 1FWSA 4CCDA 1JCJA 4JTSA 1VCFA 4LVBA 3HO8A 4O1CA 1ZNNA 3EWZA 3EB2A 4NJKA 3M43A 1JCYA 3A5FA 1YXCA 1ME9A 3PS7A 3B05A 1OFOA 2E77A 1R2TA 1TJPA 3DH7A 4IPIA 3GLCA 3VI2A 1SO6A 1TPH1 1THFD 1SO4A 3G18A 3QRHA 3CPRA 2GQAA 5C55A 1RVGA 5BW6A 2ALDA 4GXMA 4XBKA 4UTLA 4GRSA 4ZQNA 3EXSA 1U83A 2C1HA 1DQWA 3C2RA 1I2QA 1I2OA 3W1RA 3I68A 5HR7A 5HWJA 1KTBA 5F1VA 3DHFA 1WX0A 4O12A 4RV8A 3W23A 2ZA2A 3R5EA 1KFBA 4POCA 3M0ZA 2A6LA 1H7NA 4WZHA 1SSGA 2QDHA 5D2VA 3LHTA 5TIMA 1EX5A 1UUOA 2Y62A 1OYAA 3NPWA 3NVTA 3LRLA 3LBCA 1FWWA 1I2RA 2J9YA 1O95A 3NQEA 3ABSA 5FF7A 3ZWSA 2C19A 2ZRZA 1OG0A 1JUKA 2H3BA 3DI1A 3M41A 4K6AA 3NAVA 2C3ZA 1O94A 2VKZG 4K38A 4FNUA 3AJXA 3RFAA 3W1UA 3W88A 2ZRYA 3W9ZA 1H61A 4O1DA 2R94A 1JQVA 3W1XA 3T40A 3P5ZA 3EWWA 2V81A 4OHQA 2CZ5A 1TPB1 4JEQA 2V2HA 1F2JA 1TQXA 4KWVA 3LLFA 3GR7A 3UWWA 3TW6A 1K7EA 2YYUA 4DPPA 1FDJA 4OBTA 4HPJA 1PS9A 1D9EA 4O0KA 1EWEA 4O53A 3IRDA 4X22A 5G4EA 1YYAA 3TJXA 3W2NA 3G3MA 3O15A 2A7NA 5F2IA 3TIMA 1I45A 2V2DA 3MUXA 5C6MA 1UCWA 1KM5A 1ZY9A 2E6FA 4QQ3A 1KTNA 1SZFA 5D05A 5EA9A 5KMYA 4IQLA 5EPDA 4RXFA 3I6RA 1DQXA 4AB4A 3M44A 1UB3A 4DXVA 1QO5A 1W8SA 3G1VA 1ZCOA 5EKYA 4GWEA 1XCFA 1AK5A 5I3IA 4UTWA 2XN1A 2QCCA 1GJPA 3GNDA 5IBXA 2VEPA 1M5WA 3TFCA 3W74A 1FDYA 3PG8A 4JYFA 4UTIA 3TQKA 4O54A 2Z1BA 4DF2A 2QAPA 3O16A 3GK0A 4O18A 4R33A 1HO4A 4Y90A 4L4LA 1ZHAA 4BR1A 4EF8A 2V9DA 4ADUA 2DZUA 2Y7EA 4RX0A 4WJEA 2Q8ZA 4O1BA 3W2KA 3ABQA 3MJYA 2X2GA
chains in the Genus database with same CATH superfamily
3SN4A 3LTYA 1ICSA 1NFPA 1F3WA 1RJQA 2OR2A 3KM8A 4W9TA 4F2TA 3HPSA 1TJRA 3SJNA 1US2A 1V0NA 1FRBA 2A3HA 3RXZA 2BXZA 1XD1A 3QVQA 1LOLA 5FESA 3NEVA 5DRCA 3OEXA 4ICNA 2NSXA 4H8UA 1QNOA 3TQ0A 3A12A 3D5HA 1BQGA 3BOFA 3DKLA 4H7VA 5HMDA 1P48A 3H24A 2QJGA 2CYGA 2W92A 2Z4GA 3RIKA 3G6LA 4GNKB 5FEZA 2V3FA 4WF7A 1OFEA 2DP3A 2UY5A 2ZA1A 3GVGA 1GVOA 3E3HA 2O92A 3FX4A 1TQJA 4XZWA 3GUGA 3GKAA 1REQB 2ZX8A 1WDPA 4KH2A 3E2SA 2VT0A 1PDZA 2F84A 1DJGA 1ONXA 3N17A 3VGGA 2NXGA 4NHVA 3VFLA 4KWOA 1NY1A 4ICMA 1FX6A 1QI0A 3C6CA 3V1PA 3POHA 2OEMA 4M8UA 3BAJA 4FOUA 2QMJA 4ZXOA 2PE4A 3W75A 3FGCB 3W1LA 3SN1A 3ATZA 3M1ZA 1SSDA 3LX9A 4AF0A 3P60A 3CUGA 4QLLA 3CEPA 2E3ZA 1KA9F 1IWAA 3ITXA 1LOQA 3WLHA 3RHGA 3DYOA 4DJDD 1RALA 4W84A 1ISWA 1UP0A 1ZALA 3VIGA 5A8PA 1U5VA 4TVCA 4M5PA 4G7EB 3EPNA 1PX3A 4L61A 4ZB5A 1OGGA 4UXDA 4MJ2A 3GNXA 5IFTA 2GWNA 2NWSA 4K68A 3UYCA 2Z29A 1PKLA 1UR8A 5KEZA 4V2XA 4JKMA 1HJVA 3OOQA 2AL2B 4NQ1A 1V0MA 4H9TA 2WMIB 1Z69A 4O19A 3VA8A 1NWUA 3CB3A 3HM7A 3CMJA 3OGVA 3VK5A 1TZ7A 3GFXA 1TZZA 3VIOA 1XRSA 3QMRA 1M3UA 4F0SA 3CL6A 4Q7BA 4JFWA 4QDMA 3T0AA 2OSWA 4TMCA 5A6JA 3VINA 1O12A 1X8FA 4E3VA 3B8VA 3G1RA 3A3WA 3WQOA 5C70A 3S2LA 1K02A 3JU2A 3GTHA 4F40A 2V0TA 2HVOA 3N2XA 3TYUA 2PZ0A 1LG2A 3SIMA 1Q3NA 3ITLA 1GZJA 5GJPA 3MCNA 2OQLA 3PAJA 1YMYA 3OIHA 2PFHA 1IZKA 5JBDA 2HXUA 5HDRA 3GBEA 4DAIA 1E4LA 1W5MA 2IPJA 1VBHA 4D8LA 4LS0A 4WLCA 4TR9A 2NQJA 1UR3M 2VR2A 4IMFA 4GA8A 2NQLA 4LAUA 2B7NA 4DPQA 3BLPX 2ACQA 8RUCA 1Q5MA 4C91A 1EQPA 4OBSA 3EX6A 4NVTA 2FMOA 2BOEX 2AGTA 2IPGA 4KIEA 1XYCA 4UR7A 5JU6A 3THDA 3SZ8A 3BJSA 4PMNA 4HMDA 1N7KA 3FHAA 3LCHA 3PJWA 1V3KA 3U5YA 3QC3A 4MPKA 3WQFA 3DEQA 3W7RA 1TMLA 4RDYA 3DKJA 4IJCA 2W0UA 1Z44A 4CNOA 1TB3A 1MW1A 1IEVA 1HUVA 2JF6A 3H8AA 4K1WA 1PIFA 3SRKA 3WUFA 2BVYA 4HP5A 1ISXA 3L5AA 3S0CA 2E9MA 3SUSA 2DU2A 2ZZ3A 1A5KC 1DE6A 5DELA 4LVDA 5H8MA 1QI4A 1MWOA 4PN2A 1JDDA 1MDRA 5G1MA 3S5SA 3W7DA 3I3DA 2R1KA 3FXYA 1G6CA 3QY8A 3ZT5A 1TJ2A 3F4DA 2W3ZA 4RLIA 2E6YA 5AC7A 4Q4PA 4CD6A 2ASHA 3NEHA 3SQLA 3B40A 4KRZA 3BV7A 3TZFA 3E6EA 5I09A 2O9PA 2VX6A 1OB0A 4JFTA 3IWPA 1A53A 3B03A 1V0LA 3D3FA 4ADSA 2ZZ7A 2Y85A 5HNTA 1XW8A 3T4CA 1Y7VA 3EB3A 3TH6A 2RDUA 2GSJA 4XKYB 1C9DA 3A47A 5XIMA 3NGJA 2QVHA 1V7AA 3BG3A 1TPWA 3S6OA 1S2AA 4M1RA 3ZLFA 3EDKA 2HCVA 3WQ4A 4BF9A 1S2VA 5A6LA 6XIAA 4F66A 1PZ1A 1HFBA 1TFVA 2YBVA 1KFEA 3AIQA 3ARQA 3TXVA 4LW7A 1W1IE 3CQHA 4Q8WA 4ENLA 2QCDA 5LXEA 2OLAA 4PGLA 2VCAA 2WQPA 3CLMA 4JKKA 4MLJA 4GVIA 2WVSA 5HUPA 1FWJC 2FJKA 4LOCA 3OQEA 5JXQA 3N12A 2RAGA 2O0TA 4UTTC 4LPCA 1G0CA 1ONRA 1CGTA 3F03K 3ZJ7A 4CN6A 1V93A 4Z2JA 5M3WA 4L4OA 1CENA 1LWJA 2Y6ZA 3TR9A 5CGTA 2V2CA 1JYNA 2DT3A 1K1DA 3BOLA 4H9XA 2QMKA 2CZFA 4Q6JA 2R1MA 4D6GA 4C7DA 2YIHA 4HJFA 2PGRA 3OVRA 1H41A 1P1MA 3P80A 3WDIA 1XRFA 2JEQA 3HQOA 4A3HA 4LYQA 2J9ZA 4M6UA 3WK3A 3BAXA 4DUVA 1UD5A 5CKSA 1KBLA 2EPLX 4XD4A 2ZKMX 3TR2A 3TVAA 3LPGA 4FLRA 4D6FA 2OLHA 3G24A 1OX4A 3B04A 1WZAA 2R1LA 2B7QA 3F5KA 3CM4A 2CBIA 4S3CA 3WQGA 4LUSA 1GG1A 3HU7A 1EQCA 2OYKA 1DWIM 3A6OA 1BQCA 1BEUA 1MFVA 4C1NB 3ZR4A 5E6YA 2VUYA 2PWFA 1K70A 4WR3A 3N2MA 4W7VA 1K6AA 2W6RA 2YZ5A 3KVMA 3SSJA 4M51A 2X8RA 4PEKA 2V8ZA 2C91A 4E4PA 1JPHA 3LRKA 3PBWA 3C52A 3TN3A 4IMGA 3OBKA 2EAWA 3T8QA 4ZQRA 3EGJA 3UNDA 4E4UA 2O7SA 1VPQA 2HZGA 3MVIA 1EIXA 2YDRA 2X1RA 1Q7QA 2W61A 4AD3A 2G4FA 4P7QA 4UQ9A 1WZKA 3CMFA 4NNCA 4MYAA 4DJDA 4FALA 4GIAA 2RGLA 2OEJA 1XH0A 1VFLA 3AIUA 2FPVA 3VDAA 4W85A 2OKTA 3HFTA 1B9BA 1M04A 3BMWA 4H6QA 4LRTA 4NL1A 3U4FA 2VR4A 2CLOA 4MJMA 3TC7A 3DFNA 4U2ZA 3GVQA 3GE7A 1XLDA 5LGXA 3G5EA 2Z00A 3W72A 2J66A 3CUIA 1LG1A 4S3BA 1HKMA 5K4XA 1YBQA 3T7VA 5LKYA 3WUGA 1D8CA 2CLEA 5IDIA 1TVLA 3AZTA 5F4SA 1S38A 1YDOA 2WNZA 2OMAA 2ZXAA 2YB1A 3C4UA 3WQCA 4AU0A 4ZOCA 1GOMA 4GOAA 3FJ6A 1BWKA 1E0TA 3O0KA 3HGJA 4CQ8A 5A1AA 3DYPA 1U2YA 2R1NA 5KSWA 4ORIA 1E6XM 1XHGA 3RM8A 4AAJA 4F48A 2QDGA 4XIAA 4E8DA 1JJKA 3VMPA 2BLEA 1G1YA 4HGXA 1F4HA 3NQ6A 2X0YA 4GI4A 4AH7A 2QCHA 3W0KA 1FWCC 4W8LA 1QT1A 4GUFA 5IHRA 3W7HA 2QF7A 4BQ4A 4C7FA 3WH7A 4DRSA 1CGVA 3NZRA 3NXFA 2G95A 1DKWA 5EU9A 2WJZA 3UWEA 3M7SA 3ABZA 4JQ2A 2X42A 4Z1AA 1EWDA 3C2YA 3RMJA 3S2MA 2NZLA 4BZYA 2PDIA 1A0DA 4REQA 5LNRA 1UH3A 1NIUA 1F5ZA 1MUWA 1X6LA 2BP1A 3VGEA 5ECUA 1J79A 3EXRA 3VOFA 1EJSC 1VJSA 3WDPP 2GQ9A 3WZ0E 3LZ5A 5U7SA 4Q4KA 4WDWA 1LBLA 1FWTA 3SUVA 2QPUA 3MP5A 1ZQ5A 1SO5A 1JPKA 3DDMA 3IS4A 5A6SA 5G2WA 3CIXA 1TRIA 4G8TA 3LCIA 3UJRA 1EA9C 2J7CA 2HE5A 2QJIA 3WDRA 4DO5A 3N9SA 2GSEA 2OQHA 2HVNA 4C6NA 1EJXC 1D8WA 3LV5A 1H7OA 2PRLA 5HR6A 2DSVA 5HJYA 3NCOA 3MSRA 2DJLA 1EBHA 3GG0A 3M0KA 4IQJA 2ZYFA 3CIWA 4XWUA 2ZBTA 1QPNA 4BI5A 1AUSL 4XUYA 1UJPA 2QNEA 1OT2A 1K8CA 5ABFA 1YQ2A 5BMWA 2CKSA 3MUZ1 2V63A 4JTRA 3UR2A 2JALA 3GD6A 3W28A 4QQUA 1DHKA 2DDXA 4NNBA 5J8LA 5REQB 5K3VA 3HBLA 5D38A 3H26A 1P0KA 4JKLA 4UQBA 3BMXA 3QW4B 1GKQA 3GNPA 2VC6A 3UWUA 2BXVA 1OX6A 2WMJA 2VZOA 3A22A 4CU7A 1QPKA 3THUA 4D1JA 2F38A 3TN6A 2VX4A 3MI3A 3D3AA 3CZJA 3R10A 4Y8EA 3HFYA 5HA7A 3C3UA 4CNNA 2I17A 1F76A 3B3DA 4FX6M 4FX8A 2DVXA 1MXDA 1L2QA 3M5YA 3L67A 3VD5A 1N55A 1XM3A 2V5CA 5H91A 8CGTA 2D20A 1WO2A 3AIBA 5F4WA 3WMCA 4C7GA 4XZLX 4TX6A 4H8HA 1Q85A 4MLRA 5CGMA 3VUSA 3DHUA 5GQBA 3VIJA 3HV8A 4GI8A 3E74A 1GGOA 2ZXDA 3TWBA 1KTCA 2R91A 2E28A 4NRSA 1H51A 3GX9A 1WKDA 4NJHA 4G2DA 3MUIA 2ZRXA 3SURA 4Q32A 3WENA 1VFHA 3IV3A 5LA0A 1SFJA 2EKGA 3ZJ6A 4V1YA 3I7SA 1UIPA 1UWIA 2QW5A 4NJGA 1IGWA 4BJHA 3FVDA 3SUWA 4J3ZA 4IL2A 4Q8TA 2Z7GA 1W8GA 1P1XA 1RCQA 2G3MA 1QNRA 2OFJA 2QQ6A 3NZGA 3BVJA 4XTDA 3BCDA 3LCFA 4YXGA 2ZZ6A 3WNLA 4WJ8A 3REQB 3WJWA 2V5LA 2I1OA 4DUXA 1T8XA 1RLDA 1YTKA 5I3DA 1VBRA 1C8XA 3LENA 3BW2A 5CBBA 2WJFA 3RLUA 3NL2A 2HBXA 4OKDA 3L21A 4UNLA 1RCOB 4WVXA 1PBGA 1H1ZA 1RQHA 1I4NA 1V3IA 4GY0A 2E68A 1UKQA 1PHQA 1I1XA 5KINA 4QIUA 2WSKA 2QDEA 2QGHA 3TOPA 3WH6A 3GXTA 5CJ5A 1BSLA 3OLGA 4O1FA 4HNOA 4A21A 1GOQA 1R7AA 1XIHA 1FP9A 3QPEA 4RE0A 3IEBA 3MKCA 3WLTA 4GZJA 3HG4A 5AC6A 1L6SA 3SCPA 4CNSA 2JKEA 3L4ZA 1FVPA 3NQ8A 1FWIC 4W5ZA 3MZNA 3GB6A 1F74A 1VYRA 5GVJA 3YPIA 3H2MA 4CKQA 1V3HA 3RLHA 3W1MA 3Q58A 2J88A 1FH9A 3H22A 2YL8A 4B92A 4PH6A 3W2JA 4G5DA 1V3JA 2F8QA 5AFDA 2BDQA 1O4UA 4L6DA 3M0JA 5E1QA 5FCZA 2F6KA 2CLFA 4HVXA 4FS9A 3USZA 1AODA 3BSMA 3GHSA 1YTDA 3GDLA 3CT2A 1GVYA 4P8VA 1IE7C 3M0IA 2XFYA 4PRTA 4HKPA 2TPSA 1AW2A 4L5ZA 2J6XA 5AZ1A 2W67A 3QF0A 1XQKA 1OFRA 4C6LA 3NXLA 3DZ1A 1VFMA 1XLKA 2E1DA 3GU2A 3N18A 3RPTA 3STCA 2DZWA 4CUCA 3WF4A 3CV2A 2XFWA 4PYSA 4AHPA 1E5NA 1AH4A 1ZJIA 2PUZA 4WDTA 3ARVA 2JBMA 5MHBA 4WSJA 4B16A 4Z2KA 3UPMA 1JUBA 1SZNA 2Y61A 3P5YA 3WLSA 1W1B1 4G7EA 2CZVA 1RUSA 2QJNA 4H9VA 5CPQA 1FWHC 3PUEA 5AVNA 3RR4A 2ACRA 5IDZA 1YHTA 4MPQA 3UG5A 1OC6A 3IJLA 1M68A 3D47A 3GU9A 1W5OA 1FHLA 3VCRA 4UTJA 3A24A 3IUIA 3KTXA 4GQGA 3WL1A 1X1NA 1M7XA 3OYXA 1XYLA 4PCTA 3B0XA 5T8GA 2J24A 2VZUA 5AHLA 2DVTA 4DUOA 2XWEA 4XAFA 1X39A 1NOUA 3LK6A 2VFGA 3ATYA 2EG6A 1V3LA 5EMLA 3S5YA 1B9ZA 4M56A 1I1WA 4DI8A 1TR1A 4ROPA 3E9AA 3VM5A 3IV8A 4MF4A 4DI9A 3R4IA 4GGBA 2A4AA 4AWTA 3L9CA 4DN1A 4OECA 4A29A 2DZPA 5KZMA 1E6NA 4MNLA 1BXBA 4MKNA 1T8QA 4TTUA 5CC6A 5EY5A 3PNZA 4MMWA 5DEZA 4JTJA 3QKZA 3KBMA 1LZOA 3WLJA 3VABA 1DEDA 2ZZ5A 1DE5A 1G9HA 5C0QA 2VFIA 4YVVA 1GVSA 1OIFA 3M4HA 5CG0A 4HU4A 1NF0A 3MO7A 4DBDA 5I0DA 2P8CA 5ABEA 1FA2A 3EWCA 2PDQA 4FNQA 5I79A 3G1AA 1R47A 1C8VA 4PBFA 1UQZA 3VNYA 2GDVA 3G0SA 1FWNA 1NDZA 1J0YA 4GABA 4UTTA 3XISA 3EOLA 1E6PA 1ISYA 3FKKA 4WOZA 4PCSA 3PZUA 1NQ6A 4WGHA 1V79A 5DN1A 2OZ3A 3LQGA 3O05A 5BOEA 5LNSA 3CIVA 2CLKA 1VIWA 2HISA 2F7FA 3L4WA 3MKKA 5HK4A 3UGRA 3M6YA 2DZBA 5CC5A 4MYXA 3GFYA 4E6MA 1XCXA 1A5AA 2QIIA 2W62A 2E0PA 4O57A 4B3ZA 2VHLA 2XIQA 2XVKA 4AIOA 1EJTC 4GYKA 1CB7B 3VX0A 2V38A 3H55A 4Q4OA 3TEVA 3S5OA 3AXKA 4Z1DA 1J0HA 4I9JA 4NAEB 1XH1A 3VKJA 5MF5A 2WLZA 4P2VA 3KL5A 1FFQA 1GHSA 1W3KA 3PPFA 4NJIA 1AG1O 2YYTA 5DF0A 1ONEA 4GPNA 1QBAA 3SJ3A 3B8IA 1TMHA 3TLQA 7REQA 3SN0A 1YDYA 2AKMA 2X1TA 5I07A 4JZ5A 5EGRA 3EEGA 4KCWA 3ICJA 2JIEA 3RJYA 1Z32X 1UPMB 4YLWA 1A49A 3IIVA 3GNRA 4ZCWA 3AZRA 2WHKA 2WHJA 3JR2A 4GXWA 2A7PA 4BCEA 3O06A 1RZMA 3UY7A 3KE0A 3RILA 4AXNA 4H7CA 2WNWA 2PWVA 1IT7A 3TJ4A 1JYXA 1E0WA 5LZLA 1QNQA 3UPWA 3N1AA 3U2OA 1O6IA 3NIYA 3T44A 1XSIA 3KLLA 4LAKA 1ZGDA 4F4RA 2G3NA 3WO8A 2Y4SA 4W8AA 4JFSA 1MRAA 4AYSA 2XWDA 1ITXA 4FO4A 4MFEA 3WLIA 2WHMA 3NZ1A 3PBUA 4F9DA 2FYMA 1HJQA 1GW9A 4YL2A 1TTPA 4PC8A 3UG8A 4H3DA 5AVHA 3OGSA 3Q2DA 2VXNA 4RDVA 2WVUA 2WBKA 5D37A 3FJNA 4ZB0A 4LBRA 3DENA 1XICA 5J5DA 3VAVA 1JVNA 4FIQA 3C0QA 5AYYA 4JTHA 1MSSA 2EPHA 2FPTA 2V5BA 4J35A 3TAOA 1WDWA 2FDMA 1ZBVA 1YEYA 2PU1A 5L9FA 1KCLA 2C1GA 4JEJA 5FSDC 4AC1X 4Q6XA 3VZXA 4XKMA 4OZOA 2G5WA 3W7MA 1IHIA 5D03A 1LORA 2GDUA 3R7MA 4O16A 2VENA 3UERA 3SCSA 1A4MA 3GH5A 2VEKA 3U2EA 4AHOA 4ZA0A 4NAFB 4H6EA 2ISSA 2ZUMA 2BGSA 1F6PA 3CTLA 4H8VA 3QM3A 1IR2A 5FF0A 4FXRA 1U1UA 2CNCA 1DQUA 3ABXA 3A4JA 1T96A 4MNKA 1J0JA 3C56A 4JN6A 1NOWA 4NJJA 3UBPC 4Q8VA 3FSUA 3QSTA 3BGGA 1XH2A 3R94A 3VO0A 3EXTA 1UWUA 2WCAA 5LYRA 4LBUA 1RQBA 3LNMA 1LLWA 2Z6JA 2V67A 3G1YA 2FTYA 5AHIA 4B4FA 4YHEA 4HK7A 3P74A 4LXFA 5FJIA 5C9WA 3CWNA 3KVLA 3AICA 4JIQA 1CIUA 3OU8A 1I9CB 3H4GA 2C71A 3CH0A 3IK4A 3NTYA 2XH2A 1V5XA 1V77A 4PTVA 1J0ZA 4PUDA 4C1KA 4HPNA 3AFBA 1A5CA 1J2BA 5AHEA 2OXNA 2Y0FA 3LM3A 4TX9A 4F0KA 3NA8A 3NG3A 2FLIA 3QC0A 3WFLA 4FIRA 3IK2A 1VS1A 3DFSA 1EOMA 3E2QA 2Y89A 1MXSA 4TV6A 4R88A 1VRXA 4DWSA 3LEPA 1EDGA 4N7QA 4S2BA 3SCRA 3VKKA 2CPUA 1JZ4A 2YCJA 3PWAA 5I77A 3R8GA 4M19A 1M9HA 3W7NA 3WKZA 1E6SM 1SFTA 1PIIA 2BV9A 2Z7KA 2QGYA 2CESA 4B5SA 3UD6A 4Q4MA 5HULA 3HOJA 2AQWA 1JRBA 3L0KA 5AYXA 3PUGA 2ONEA 4EOUA 1JZ7A 4LUYA 4MJZA 5CH9A 4JXCA 4P7NA 1V6VA 3V5OA 3EB4A 4JX6A 5HJXA 2J7FA 3W7IA 4IGNA 1EJRC 2GZXA 4J3WA 2WYSA 4EPDC 4PULA 2FTPA 3W4RA 4CCDA 1I0DA 4FOKA 2MNRA 3K4WA 4D9PA 1QATA 2OQYA 3K46A 1P0EA 3VC6A 3OLIA 1VCFA 3HMCA 5I7GA 3EWZA 1JGIA 5AKQA 4NJKA 3R79A 3A4XA 3B05A 3W53A 1W9BM 4IPIA 1SO6A 4GACA 3G18A 1XLIA 3UJ2A 4IICA 3AISA 4ZQNA 4L6HA 5FL0A 1DQWA 3C2RA 2PODA 3W1RA 4OTKA 4JIIX 3OP2A 2DSZA 1KFBA 3M0ZA 2A6LA 3WIJA 5D2VA 5TIMA 1VBJA 1UUOA 2XZ7A 1BG4A 2WHLA 2FGLA 2NQ5A 3NPWA 3NVTA 5C9XA 1FWWA 1E43A 2J9YA 4AD0A 3MTWA 4HA0A 1KBBA 2IKJA 1JUKA 1S2WA 3DI1A 3V5FA 4GC3A 1JAKA 3FGCA 4YHGA 1O94A 2Q8XA 3QTPA 2CXGA 3B9NA 5LIUX 1E9LA 3AJXA 4J2MA 3PP7A 3W9ZA 1H61A 4LJ3A 2R94A 1E0UA 3LUTA 2G37A 1ISVA 1PPIA 4C6JA 1GOOA 1TPB1 1F2JA 4V28A 4XISA 3LLFA 1JDAA 3UWWA 5FAJA 4MG4A 4DIAA 1WDQA 4TVUA 3FHQA 1FDJA 1DJYA 1W1A1 4HPJA 1CLVA 3ITCA 1EWEA 3IRDA 2A3CA 5DRIA 3CPGA 5C9ZA 2NT0A 2G0WA 3G3MA 4R5EA 3VGHA 3V5CA 4ATLA 3A9BA 3CHDA 1ZY9A 2E6FA 1UC4A 5I2UA 5D05A 1J0KA 4IQLA 4L80A 4DAFA 4B15A 2E1WA 3R58A 4UCFA 1Q66A 1CDGA 1JPDX 2VGIA 2DY3A 4TTGA 1XCFA 1IEIA 1CB2A 2INFA 4ZENA 3GNDA 1GJPA 3MT1A 2PDBA 3UP8A 1OG6A 3TFCA 4C6CA 3W74A 3PG8A 4JYFA 1NWRA 4EPEC 1AZ1A 4O54A 4ZTYA 1AH0A 4DF2A 4Q4RA 4RNJA 3Q4DA 3LLXA 1RPKA 4OVXA 1ZHAA 2ZWZA 4BR1A 1P6WA 2V9DA 2WZIA 2Y7EA 4MM1A 4WJEA 4RDZA 4O1BA 1GJUA 3BICA 1NOFA 2XJ7A 3DFTA 1NDWA 4XZHA 1CI1A 3G1FA 4MWAA 2Y24A 1LQAA 2RH9A 4GQBA 4AZBA 3AXIA 1SGJA 3NQCA 3RAOA 3HF3A 2GOKA 4RKAA 1B30A 4GH3A 3M7WA 3WLMA 7TIMA 2R24A 4NSBA 1BKHA 4E8CA 1KGWA 4CQAA 4EACA 5LIXX 4KBXA 2Z2BA 1X6UA 1VYSX 3OZOA 3CL8A 5FF4A 2ZZ1A 4OE7A 2FHFA 4ZVJA 3NUKA 3P81A 2PDGA 3ZYZA 2PDPA 1GTHA 4RK8A 3LHUA 1Z48A 3IIZA 3WDQA 5CJMA 2DT1A 1GVQA 4KRUA 2H6RA 1Q6OA 1H0IA 1OABA 4B5UA 3E49A 4J4KA 2ZRUA 1FWGC 2EO7A 2VC9A 2H90A 4AIUA 1V6XA 3RPMA 4KFOA 4DX3A 3R8HA 4IPJA 1TWSA 3WDHA 3QR0A 1HKVA 1VCGA 1P6BA 4JIEA 2DW6A 2YZRA 2FDSA 1K9EA 2GK1A 4F0HA 1QRQA 3NQFA 5D2WA 2B7OA 4FZIA 1HP5A 1JNDA 1A4LA 2OWCA 2Z1XA 3F2BA 3K5XA 3V36A 4RXGA 4LY8A 1B5TA 4MB1A 3DG7A 2QPSA 2WCSA 1RHCA 3WEMA 2VEGA 3IGUA 2D3LA 2D3NA 3S5NA 1EO5A 4HYVA 4NZFA 1OBAA 1EEXA 3ES7A 4IH3A 4DZ5A 3FY1A 1ECEA 1WNOA 1KQYA 1PUDA 4GZIA 2BVDA 3OA5A 2ZUNA 1LM1A 2NX9A 4HN8A 3TYDA 1XUZA 3R2GA 3MHUA 4GY7A 2ZUSA 2ABAA 3JZEA 2C18A 4CVWA 2YR1A 2E8ZA 4MFDA 3W6MA 3TW7A 4GKLA 1A5UA 4Q3MA 3TN4A 3AMGA 4OOZA 5A8OA 3LU2A 3EYPA 4G7FA 3OHIA 4KEVA 3TA9A 3BOXA 4IP5A 3UVIA 3GR8A 4Y9NA 3MCMA 2Q8LA 4W8BA 3NFUA 3UA4A 4PMVA 4CD7A 3FAXA 5DMMA 4QS6A 3D6NA 3QPZA 1UUQA 1VP5A 2GDQA 1ZPTA 1CXKA 1ZJBA 3RM9A 3ABRA 1P6CA 4Y2WA 4RCXA 3IANA 3RJXA 1X7FA 3B0PA 2V3EA 3LCWA 1F61A 2WC4A 4WHBA 4LU0A 4N6FA 1U1JA 1LWIA 3WNOA 1T99A 3B0UX 1AMYA 1FBAA 4FP1A 2YL9A 5A3HA 1UWRA 4CQ9A 4A3QA 2OO0A 3KEHA 5CZ0A 3PHAA 2HXTA 3PR2A 1A5LC 2C79A 4ES4A 2XG9A 4UTHA 5LHEA 2ZICA 4XZNX 2UY3A 1A50A 3EKZA 3F5JA 3AYRA 4O8RA 4AZHA 2IW0A 4HD5A 3MSYA 5DMNA 2C15A 4R27A 4JQAA 1ZCCA 4Q8OA 1K4GA 3KBNA 2QT3A 1KFCA 4XD5A 4C6OA 2AMGA 4V33A 2NX3A 4TU1A 2H8ZA 1RY0A 1IXQA 1KBJA 3DECA 4O13A 3MZ2A 3GH7A 4OUIA 1XIGA 5SWUA 3TX9A 4S3AA 1UP2A 4IMDA 4YTUA 1AD1A 4IFKA 3EX2A 3B8UA 3BANA 1TYGA 1Q6QA 1TMQA 3T78A 1NFGA 1E3XA 2C0AA 3BW4A 1MNZA 1QW9A 4U31A 2QS8A 4C6DA 3W73A 2YXXA 4WGXA 3TTYA 3TROA 2HK1A 1A47A 1NFBA 3WQVA 2OEKA 1K4HA 1V3MA 2VWSA 1GOWA 3SIZA 3GXPA 4I9AA 5D09A 3BLOA 2YXGA 3P6LA 2QDDA 2P76A 1I75A 4ERGA 1VF8A 5F4XA 4DO6A 3H2OA 4Q8PA 3AU6A 5DMLA 3PUOA 1EGVA 4LQ1A 7REQB 1I2PA 2VO5A 1E3ZA 1PX8A 3DI0A 2ZX6A 4JAWA 2J7DA 3N6HA 1ECQA 4HK5A 1EDQA 3PFMA 4H9ZA 4IUOA 5FEWA 1KRBC 5EFFA 2TRSA 2OOFA 1XBVA 1OX4B 1BYDA 2DIJA 3BTNA 3H2AA 4YJ5A 2YBUA 1TUFA 3TTEA 2ZX9A 1SO3A 5EMUA 2J27A 4AVNA 4B9YA 1OM0A 2XVNA 4IISA 2PBOA 2MANA 4DLMA 1YW1A 4XK2A 5AHNA 2V68A 4XAYA 1A0EA 1J5SA 1BRLA 4JTFA 1DWHM 3DFQA 1ZFJA 3AYVA 3W24A 3MA8A 3NR0A 4JQ4A 3ZO9A 2YA2A 1JXJA 4L4MA 1XC4A 3IRSA 4PSRA 4Q8UA 3SCOA 3AXXA 1VCVA 3COTA 2C6QA 4M6QA 1OIMA 3B0VC 3S83A 3TJIA 4AIEA 4JTQA 1BFNA 4N4QA 4OWGA 3KCLA 3L12A 5TF0A 1K7FA 4I90A 2QZRA 2WNQA 2X7WA 1W3JA 5A69A 1LBMA 4ERAA 5DBTA 1DWJM 4HOWA 2E40A 5D33A 1J01A 1RA5A 3PC0A 4PMYA 3VVGA 4TO8A 1EJUC 3BLEA 1XLJA 1QUMA 4BI6A 1UR4A 1CT5A 3M16A 1LLOA 1JAEA 4EIVA 5I78A 1OF6A 4CNTA 3PUDA 4PTWA 5M1TA 3DC0A 1XBYA 1CLXA 2D22A 4DBEA 3BC9A 1AD4A 1W3IA 4FMVA 2YCEA 2DJXA 2QCLA 3NNTA 1R3WA 2WPGA 3W70A 4JY9A 3WQ6A 4LRSA 3OLEA 3MV01 4OQVA 1GQKA 5A2CA 1F4AA 3DOPA 3H70A 2YJQA 5ABTA 3FA3A 2QJJA 2GUUA 2P88A 2G41A 2OGYA 1UKPA 3SO7A 3SCUA 1PX4A 2QXWA 5A8NA 3U8GA 5CEWA 1MVYA 1V6YA 1WB0A 1EPVA 3VNJA 4UQAA 2B0MA 4Q7IA 1L6GA 2FVMA 2VEIA 3WNNA 3GBDA 1RR2A 3LA4A 4IJBA 1PZ2A 1UZDA 2XIMA 3FJLA 4XBSA 2PWDA 3Q37A 2YA1A 4IPNB 4NZ4A 4WXZA 3S9YA 2UV8G 3GDTA 3MP3A 2OYLA 1Q8AA 3P62A 2B4GA 4A8RA 3O6YX 1OINA 4NKCA 1PWLA 4US6A 2GGIA 2VCBA 5D9MA 4O8AA 2WVVA 5TQLA 1BVZA 4D1IA 3RX3A 3LERA 4PBGA 2OB3A 3AS3A 6XIMA 1GEQA 4UOQA 1YTEA 1WOBA 4GD0A 5CPNA 3ISIX 1GQNA 5E0KA 1HL2A 1EX1A 2VL4A 3SBFA 3WF0A 3ZWTA 4EAYA 1ME8A 4YU1A 3KZPA 3O1NA 4CQCA 3ZT6A 4H9MA 1L6YA 3AS0A 4Z1YA 3ITGA 1R8LA 1MQPA 5IM51 3LOTA 4N42A 1MNSA 4ZZ9A 4CVUA 2O9OA 3HQ1A 2ZXBA 5T26A 5AC5A 4A3YA 2WM0A 3PZVA 1XD0A 4I6KA 1D7KA 3LCXA 4BQ5A 2A3AA 2QVNA 4H41A 1XGZA 3MCOA 5L6UA 2PP1A 3DFHA 2CITA 2BG5A 2VGGA 3I3BA 3OQ8A 3CV6A 1Q6EA 2EJ1A 4MWAB 5AN7A 2CETA 3NDOA 4ALDA 3OIXA 1C7SA 2A0NA 3OG2A 3A23A 3WFAA 4PL2A 1XFCA 4DBWA 5D30A 3ITVA 4FXFA 4H2HA 1H49A 4ZQCA 1R2SA 1EP2A 3QQ0A 3GWQA 4PRWA 3U48A 4UNIA 4JTCA 1G4EA 1MUMA 5EMKA 5G4HC 4BHYA 3BG9A 2X0HA 4JYEA 4HMNA 2XZ9A 3TSBA 1A5NC 3W1AA 1VHCA 4YN5A 3TTOA 4UBPC 4KMQA 3A3XA 4H1ZA 1NARA 4K1GA 2A7RA 4LALA 4ACYA 2A85A 5D8ZA 3N2TA 4KEZA 3WX7A 3W1TA 2O55A 1R46A 5FOOA 3I65A 4ZODA 3LN3A 4JTIA 4FNPA 3POCA 1B4EA 2BVTA 1LCOA 3HG5A 1FHVA 3UPBA 5HPOA 2Y63A 4JR5A 3N9RA 4EPKA 3WCZA 4QHRA 1QDSA 4EXBA 1PHWA 1LQ2A 2R9RA 4IP4A 5H8PA 4S1FA 4ZB2A 1HN1A 1N8FA 2QV4A 3H53A 1XG4A 3M5ZA 4O0QA 4Q4SA 3S5ZA 1EPXA 1SPQA 4Y9OA 4DJEA 2XISA 3UXAA 3G1HA 2FZBA 4M1BA 1VAHA 5H8UA 2E4TA 5CPOA 3ZR6A 1OADA 2TODA 3RX4A 1RJRA 3UVAA 2VFFA 4QDPA 1PL9A 1MW3A 4D8ZA 3O63A 2ZWYA 3SFKA 1YXDA 3BXWA 3DXIA 4HPGA 1GOXA 4D2JA 1Y5XA 4QCEA 4G6CA 4K2SA 4NXKA 1J2WA 1V0KA 3LSCA 3ZLHA 2ZX7A 3GR4A 4UOZA 1XLGA 3CJPA 3N25A 4XVEA 4GUIA 1BLIA 4Z17A 2W79A 3CWOX 4HTYA 1XYBA 3WQ5A 4LGXA 2FVKA 1U5JA 1ODUA 4HQVA 3W82A 3WQPA 1W9PA 3C86A 1XJBA 3WEZA 3JW7A 4CNPA 3O6DA 2XFRA 4GQ0A 2WZTA 2GVGA 3UEQA 2ATSA 1CLKA 3G22A 5HUOA 1NU5A 1PV8A 1L8PA 3WELA 3LMZA 1W0MA 1KB3A 2QV5A 1TTIA 1OFBA 2BX7A 4LVFA 1HW6A 3HG3A 4X61A 4IIHA 4ZE4A 5GNZA 3RYSA 2RKXA 5CPSA 4AWEA 2Y2WA 2NQHA 4R53A 3QYSA 1J12A 1PE1A 3GTIA 1K7XA 1PYMA 1WAUA 1VLIA 4IXXA 3MI2A 2XN0A 3VDHA 4X9YA 2H9AB 3EA2A 4AVOA 2LLEA 3W87A 4Y9PA 1OC5A 3VD3A 3W3OA 4LSBA 5D9PA 1EHAA 3TJLA 2WSQA 3IIXA 2VC7A 3DERA 3LHVA 1PCKA 5HMSA 2I9UA 1ELSA 3UZ5A 2F6XA 4IX0A 3STGA 3V18A 1B57A 4O10A 1TREA 1R0MA 4GYPC 3H6OA 4C1NA 3CQKA 2G97A 3R0KA 1OFPA 3FYPA 2PS2A 1GYLA 4QJ3B 1JD9A 1TV2A 2XTKA 1UZ4A 1UD8A 3VOJA 3DBNA 1QOPA 1SJDA 1XIDA 4W5UA 2REQA 2J8GA 3WJXA 1E1FA 2W91A 2EGZA 3L0NA 3VNDA 1EOKA 4HCHA 3N2OA 3V0UA 3G1XA 4Y7EA 1OJXA 1WBHA 3N13A 3IJ9A 4F2UA 3EMCA 2IQ0A 2Z27A 4AD2A 1EEPA 4ML9A 5FAGA 3DU0A 1ICPA 1B1YA 5E9XA 2SFPA 4N2YA 1A5BA 4GHRA 3F2CA 2CWXA 2TYSA 3WBWA 2PDKA 4LV9A 1DJWA 2GGHA 1NP2A 1QMLA 3VNZA 1X98A 1O5RA 1KFWA 2Z1SA 4CD8A 1MW0A 4C60A 2DZAA 3E02A 3DC8A 3GYEA 4XIMA 2XPKA 3CUXA 2BOFX 5DY2A 2BSLA 4AEOA 2WB5A 1FUYA 1KV8A 3C2EA 1S5TA 3B9AA 5DO8A 2YCIX 3QGAC 4MKVA 1VJZA 2XVGA 3HV9A 1XLEA 1XIJA 4GNJA 4GO9A 4GVFA 4GISA 1VLWA 1JDCA 1W5QA 1WE5A 4PRRA 2P1FA 4ZMGA 2YLAA 2OT1A 4I7VA 2ZA3A 3CGTA 5BXPA 1LT7A 1XG3A 3QOKA 3V75A 1S3HA 3QPYA 3QW3A 1V51A 3LS9A 4EKJA 1KBKA 4LX4A 1EXBA 1FCQA 2J8TA 3T1GA 3L4YA 4UMAA 1EBGA 1W3TA 4UFHA 2PLCA 3ARYA 3TC3A 4TQTA 4LFYA 1DXFA 2AQVA 4HCDA 1JI1A 4BF5A 1Q6RA 9XIMA 1ADDA 1UMYA 1SR0A 1ZP4A 4YIWA 1E4NA 4JN7A 1K3UA 1XRVA 1QI5A 4QISA 3PY2A 4OFCA 3FS2A 1M41A 5E70A 3HQNA 3DFYA 2Z1WA 4HNVA 2XU2A 4YTSA 1MZRA 6ENLA 2WKGA 3HN3A 1CXFA 1PZ3A 1XYZA 2C1IA 2AQOA 4GX8A 2VDHA 1NWSA 3LCLA 4MWAC 3DHDA 4Z0JA 4CEXC 2IQDA 1ZTVA 3WF3A 1R87A 4GNVA 1R3VA 3WQWA 3GG1A 4AX7A 2R8WA 1LT8A 3R6IA 1EUNA 3DAQA 4J2PA 3NPUA 1R86A 3U5UA 4PMDA 3T2PA 3KCJA 1BAGA 5LHFA 2NV2A 4LF2A 1MW2A 1AQHA 1D2KA 5AECA 2DUAA 3ARZA 4GCAA 4WDXA 3WG6A 3TU9A 1Q7MA 2EXOA 4QP0A 3AHXA 3VU2A 2ZOXA 5CBJA 2ZC8A 2IUZA 1H1YA 1KLYA 3KLKA 1G01A 3SQMA 4CCZA 4LNCA 3S1WA 1SW0A 5F7UA 3T09A 1KFJA 2AMXA 2ZE3A 3S47A 4BWLC 1JQXA 3TYEA 1R3SA 3SRHA 1ZS2A 4GIYA 1KXQA 2XDFA 2PDYA 1DBTA 2JQXA 3TSMA 2NT1A 2XVLA 4DLFA 3T4WA 1QK2A 3BZGA 4LVGA 2BHYA 2HK0A 1PSCA 7PTDA 4W93A 2V5JA 4Z08A 1K6WA 3L4XA 3QH2A 4D6CA 5I24A 2QCNA 3BCFA 4HYRA 1Q8JA 3BQ5A 1TPFA 2QUVA 2WWDA 3T07A 3XIMA 3PBVA 1H1NA 5GJMA 1N8WA 3QMTA 1UC5A 1EGMA 4JTEA 1ZAIA 1QHZA 1R9XA 2D0HA 4FAMA 4O4VA 1CWYA 2ZXQA 1Q4NX 3VGBA 1YIXA 1WV2A 1L9WA 4CQBA 2F9RA 4QJ1A 3RU6A 4PCNA 1ME7A 3L68A 3GVWA 1WUEA 2WAGA 2P5NA 3BLDA 3NOYA 4L7ZA 4C6KA 5CGQA 2PGFA 4M24A 2YW3A 1PJ9A 3KDOA 4GYFA 1R9YA 3PZ9A 5KZEA 1VPYA 1CZ1A 2J7EA 1SFSA 1S5MA 4DHGA 4KGJA 3QV9A 2DSWA 3DFPA 2ZUUA 3MV11 4LNYA 4QITA 4H9UA 1N82A 5IHSA 1LUCB 2WKLA 3GVVA 5DXYA 3VKAA 1Q6LA 3ELFA 1DTUA 3GZ3A 4PUJA 1QI2A 4FXJA 3VOCA 4TIMA 2DZTA 4JTDA 2D0FA 4A6GA 4IP7A 3LV6A 3QV7A 2R6OA 3V16A 2OX4A 3GTFA 5LA2A 4NUWA 3SCQA 1VFFA 4KPLA 3ZS4A 2PDNA 3ENLA 3W2UA 3B4YA 4DWSD 4F3HA 2PDJA 1UG6A 4CEUC 2CHOA 1SU5A 2Z28A 2HS8A 1PVNA 6CGTA 4L1GA 2O4MA 3S2NA 3I4EA 3VOIA 3WQDA 1M7OA 1FOBA 1BG9A 1CXLA 1EJWC 1KXHA 3SI9A 4MZ1A 1E15A 4WKHA 3NQAA 3P8IA 2VI0A 5HBFA 1CXIA 4UFJA 2WZEA 4PTXA 3HIJA 1WYIA 1MYRA 3ONCA 4ZE5A 1W1YA 1U22A 1RLCL 5DCBA 3CAVA 1F6KA 3MI6A 3EX4A 4JNYA 4ZQMA 1NH6A 3EPMA 3ANUA 3UG3A 3DUGA 5CZJA 4C6FA 3GFZA 2Z1VA 2Q01A 2BS9A 3F1QA 3GVRA 1UD6A 1TV7A 4ZOEA 3BSGA 4JDYA 2TSYA 3CWHA 1VEMA 1H0GA 2CWNA 2HSAA 3VMNA 4QR6A 1GVIA 2PC4A 3KCOA 4JPGA 1ZBCA 1H3GA 4ZQOA 1AQ0A 1VFSA 1A3HA 3GW3A 4ONVA 1ZB5A 3CUHA 2ADAA 2E9LA 5C7HA 1WAWA 3T8LA 3WN6A 2DH3A 4GZEA 4FLSA 4GGHA 2DGAA 2WSYA 3QFWA 3AMDA 1Q4WA 4LV4A 4HOXA 2A21A 1W1ZA 1ZRQA 5AC8A 2PDHA 3NYZA 4UQDA 1MDLA 2CCRA 3BMVA 3N15A 3UCCA 4XD3A 5AHFA 4GI6A 3ZR5A 2J6VA 2VD8A 4C90A 2GGGA 3MMUA 1UIOA 4ECLA 5C2XA 2YCLA 4ZSTA 3PBGA 2KAUC 1VFOA 1GKRA 2Z2AA 3KTSA 4DM1A 3VFCA 1BWLA 2INZA 3GHRA 4O11A 4LC8A 4AZ6A 1QNVA 1TV5A 1UWAA 2W4XA 3T42A 1WKEA 3AZSA 3HQPA 1E73M 4DO4A 4GQRA 5F2GA 2V5KA 1KR0A 2QULA 3P0WA 2H9AA 3EZ4A 4N0RA 2OCZA 3GC4A 2AL2A 3Q67A 3OB8A 3LYEA 1KCXA 3AS2A 3PZGA 3T0DA 1MEWA 1IXPA 1X38A 3PTKA 4NP7A 5EYWA 1R3RA 1TELA 4V15A 2NVAA 2PLJA 4AWSA 5CSSA 5FF2A 5CLWA 4K7YA 1E72M 4QAIA 1YDNA 1RD5A 4TVDA 6REQB 2BFGA 3UXLA 3KBJA 2HQAA 2NLIA 1TIWA 4KRTA 1O5KA 1F3XA 1EKOA 5K9DA 2WSRA 3NSXA 4HTBA 1OFQA 4RDWA 2JK2A 4GJJA 1SUXA 3QQ1A 4HNTA 1HT6A 1XWYA 3HG2A 1T0OA 4IOTA 5M03A 5H6HA 1HKJA 3U57A 1RSCA 5RUBA 3PBMA 1AW5A 4UTWC 3W7EA 5K9CA 4N9BA 5FJUA 3OODA 3ARUA 4A2RA 1R7OA 1EZWA 1E1CB 2PDCA 3OZPA 1TE6A 1E71M 1QXLA 3QXBA 4LCQA 3BO9A 4NI3A 1NAL1 4DXKA 1HKWA 4IJRA 5DCEA 4GE8A 3MDUA 3RDKA 3GKFA 4AZCA 1T41A 2VOTA 3IVTA 4MUZA 3M5XA 1AQFA 1UBPC 3QR1A 2R14A 3T2QA 1TWDA 5D9OA 5CJNA 4CGTA 1PCWA 1SR9A 1KKOA 1OX5A 3WLKX 4KETA 4BF7A 3W1PA 3TNOA 2BGQA 2WJEA 3REQA 4PTMA 4Q33A 3GHTA 4KCUA 9CGTA 1FWSA 1Q6GA 3H2FA 3WLPA 5GPRA 3P2VA 4JCMA 4BY3A 3EB2A 3M43A 5IFPA 1ZZMA 4BQ2A 3FEQA 2CBVA 1UH2A 3PS7A 2E77A 2F61A 1R2TA 3DH7A 4XVDA 2OU4A 3GTXA 1BVNP 4KF1A 4S3FA 1ESWA 1RVGA 4R85A 4GXMA 2GVYA 1U83A 1I2QA 2EPNA 3FA4A 1H09A 3I68A 3PK7A 4PUWA 4HU8A 5HR7A 4RW5A 3PN8A 5HWJA 1KTBA 1P43A 1WX0A 4O12A 4RV8A 2ZA2A 1YRRA 4LUSB 3M07A 4WZHA 1SSGA 3PNUA 3LHTA 2QYGA 2Y62A 4LAZA 4DWDA 1E70M 3LBOA 4JL2A 4NG3A 1S2UA 5BROA 1GPFA 4L64A 2C19A 3SAZA 3A64A 1C90A 4C6BA 1Q6CA 4QX4A 3SB0A 2BXYA 5AY7A 4K38A 4FNUA 4S3DA 1OZQA 3AALA 3SY8A 1K9DA 3W88A 1J9YA 3I6TA 4KEUA 2VDIA 4JHMA 1RBOB 5CBIA 1L8NA 3P5ZA 3RM4A 2Y5SA 1UZHA 5HMEA 2CZ5A 3DHPA 2BY1A 5TNVA 4JEQA 1BYBA 1TQXA 4KESA 4KWVA 3VIMA 3TW6A 1K7EA 4S38A 1PIGA 1D9EA 1EZ2A 1QU4A 5G4EA 4LF1A 1UH4A 5DFAA 4YPJA 4XSLA 1NTHA 3QZ6A 4TUFA 3CAKA 5A94A 4I9MA 2DV0A 5C6MA 1UCWA 3LPFA 4AIBA 3GXDA 2O9RA 5EA9A 5KMYA 3BAIA 5EPDA 1PDYA 3CAWA 4HA3A 4AB4A 3O9NA 3M44A 3WQEA 4W86A 1UB3A 1J18A 4UQCA 1QO5A 1W8SA 2Q02A 3G1VA 3P14A 3KL0A 1AK5A 1NP0A 2XN1A 4UTWA 2QCCA 4LBSA 1HGWA 2DW7A 4REQB 5FKYA 4YVPA 2CHRA 2Z1BA 3O16A 3GK0A 3QY6A 1HO4A 3K4DA 4RPPA 4ADUA 3ZJKA 2OO6A 1QBBA 3LNPA 3W2KA 2X2GA 1PB0A 1SW3A 1WDSA 4PL1A 2C7FA 4AC7C 4KT2A 2ICSA 1J96A 4F79A 1E5JA 2V69A 4RW3A 4S3EA 4MNMA 4AXKA 2WMGA 1LF1A 1UR1A 1UOKA 4NASA 3AAMA 3DBPA 1GVRA 2FZNA 3GTNA 2VURA 1JUEA 3TTQA 4LVAA 3UWQA 3S6TA 3W71A 3WBYA 1DL3A 3AC0A 3BV4A 4PMZA 1O1HA 4WY0F 4JCLA 1QJWA 4H9YA 2F2KA 3CAQA 1U1HA 5LA1A 3RCMA 1ZENA 1EJ7L 3RCYA 4JTLA 3VXGA 4C5ZA 2E5DA 2YW4A 5AYZA 1BYCA 2QJMA 3GZAA 2CXEA 1F3TA 3NVDA 1F73A 4WEVX 2QHAA 2ISVA 3XINA 3S6DA 3UR8A 2YL5A 2C16A 2ZC1A 3M9YA 1JR1A 3MB9A 4NRRA 3KP0A 3SGZA 2HNHA 1X6NA 3R25A 1LJYA 2XIBA 1LYXA 5BRPA 1TCDA 1G7UA 3W1QA 4O4WA 1TE1A 2GJNA 2GVEA 5C8BB 2DIKA 4EWJA 3W00A 1UASA 2FGZA 3UR7A 5I3GA 4DVOA 3GYCA 2I5QA 4E2DA 1FTXA 2WQDA 1KM4A 3NQ7A 2WM1A 3ZQ9A 4FF7A 4IX2A 3NO1A 3STFA 3BLIA 4PMJA 3J7HA 3AI0A 4ZFMA 3R13A 5M17A 2PGWA 3F4VA 3OW1A 1GT8A 1KM0A 3QBUA 4U2YA 2QKFA 4FSAA 1W37A 2NV1A 3JRKA 1DJIA 1W9XA 3KAOA 3GS6A 3BE7A 4LCSA 4IGHA 1TWIA 2PTWA 2XSBA 4HK6A 2WMKA 3S1VA 4Z1BA 1KO0A 4MSSA 3W27A 1QFEA 3PZIA 1KM6A 3LHWA 1C91A 4WIWA 2J47A 2ISWA 2YDAA 2VJXA 3PJXA 3SM0A 1TV4A 2VWTA 4YWSA 4ATDA 3PZTA 4GYPA 2BASA 2ZVRA 3C0SA 4FR6A 2VELA 1OVDA 4NAEA 3UA3A 4AUBA 3CT7A 1V02E 3BAKA 3ERPA 2PAJA 1IEWA 2Q3RA 4O15A 1KV5A 4JX4A 4CCEA 3EOEA 1TIMA 4HU3A 1T7LA 1HG3A 3MY9A 4RUBA 2A1YA 3P61A 1XYFA 2W66A 3TW9A 1EYEA 3RCNA 2HWGA 4LUJA 2GYIA 2CBJA 2ABBA 2QCEA 1H7XA 3N2BA 4KFPA 4YTRA 1VEOA 4H2CA 1TG7A 3N34A 2J7BA 1XSJA 2CLMA 3SFWA 1GUVA 3KVJA 4Q7NA 5HQLA 2WPBA 1V7YA 3BLLA 4QG6A 2RJHA 4IPLA 1AFSA 4DWSC 3QTGA 5M5DA 4C6IA 3GNOA 1AZ2A 2EF9A 2VD9A 4IG2B 3MS8A 4XQ6A 4ZQPA 5D2YA 1HGYA 5JQ9A 4GX9A 3TYAA 4GKTA 1H7WA 2JIWA 1J4EA 2Z6IA 2VVSA 4N9EA 4UFLA 2X7VA 3NJ3A 3PB2A 1ITCA 3ARRA 3KHJA 3ZT7A 2OZ8A 1OK4A 3DN5A 2BBFA 3EA3A 5HANA 3MWAA 3CEUA 2WXDM 3VD7A 3ITYA 1H11A 4GG9A 1OK6A 4MAVA 3K13A 4FK9A 4DF1A 4FLQA 1FH8A 4LEFA 3WUEA 2WNNA 1GTEA 3NSNA 4FNRA 1HXJA 4ZSUA 5D32A 1D3GA 2ZZ2A 4ZO8A 3BAWA 4XO7A 1ZBWA 2FIQA 5ABHA 4J3SA 1R38A 4P7LA 3LI0A 3KZSA 3PM6A 3B9EA 3INPA 4XZMX 1P7TA 3C61A 3BURA 1D7FA 4QJ4B 3KVKA 3PZOA 3RPDA 3SR7A 2QEZA 4BWLA 1IT8A 3E96A 3TWAA 2ZADA 1S5WA 4WUIA 2VFHA 1FKXA 1R6WA 4AD1A 1EXPA 3CYVA 2J74A 2B7PA 3VDGA 2EKCA 5JIWA 4Q4QA 4C1LA 4GH1A 3UZWA 1TR9A 3MPGA 4YWIA 4O28A 4ICCX 2GOUA 1M6JA 3HGSA 3WJSA 4MTVA 1QR7A 3NL5A 2J7HA 1B3ZA 5I3KA 1JRCA 1H50A 1VGAA 2C14A 1XGEA 2XINA 5LNWA 3E5PA 1TA3B 1RAKA 2QF8A 2V3DA 6REQA 2WZMA 3TE9A 1JCNA 4TMBA 2BHZA 4IUGA 4PB3A 3VIHA 4PUEA 3NQDA 4XSMA 1GHRA 5TAOA 2ZUWA 5D04C 2I7GA 3SCVA 3W01A 1X1ZA 4J28A 2VMFA 5BRBA 3FYOA 3WK0A 9XIAA 1ODZA 4CU8A 4B3LA 5C5YA 4X0NA 5AOUA 5CQ1A 3PAOA 2REQB 1YNQA 3W29A 3G0XA 4QAWA 2OLSA 2WC3A 3LGDA 3ZZ1A 3DESA 1IWPA 3MBDA 4R3UA 1AQMA 1JCMP 4W88A 2DZVA 1F6YA 3P7YA 1Q6FA 2DFAA 2VCCA 4HHHA 1PXGA 4A3UA 4V27A 1GVFA 1S5VA 3UW6A 3VE9A 1EIBA 1PTDA 3F5LA 1BSIA 2HDJA 2E25A 4EX4A 3IJ8A 5TBOA 3G1SA 5A8GA 3VE7A 1XBXA 4E0CA 1XL9A 3WL0A 2DEPA 1HO1A 4YYCA 4A05A 3QZEA 1ICQA 4HSOA 4O52A 4ORMA 1G67A 2VTFA 3KHDA 4N9DA 2JGYA 3HGRA 4LH8A 5FEXA 1OFDA 1XGDA 2IXVA 4OV9A 3EX3A 3RN6A 4NZJA 2FHBA 1OSEA 4J3TA 3PSWA 4XV0A 2AKZA 3GXIA 4XTIA 1ISZA 1ZP3A 3RF9A 2IQTA 1GVEA 4L6OA 3URNA 2VDGA 3BDKA 3VKCA 3B97A 2AL1A 5F2MA 4PE8A 3RX2A 3N3MA 2BTMA 3EWUA 2HRWA 2V30A 3PWIA 4K7VA 4GVHA 4MHBA 4R9XA 3THQA 2EG7A 2E6DA 1Y8BA 2X30A 5CZKA 3R1ZA 1K9FA 4HZ6A 2V82A 3MKVA 1TRDA 3W26A 4ERIA 1AJ0A 2PA6A 1NM9A 3OYZA 3LM7A 3NQMA 4HOZA 2J7GA 2DQXA 1QAPA 2QCFA 1I2NA 3N14A 3A4AA 4HN4A 1NDVA 3N29A 4GYJA 2PDMA 4UMCA 3EDFA 4PMQA 4HSHA 3GC2A 4MZ8A 2EPMX 3FEMA 4PEEA 1IT0A 3FK4A 5JBEA 1HJSA 3AMKA 3EWYA 3FSTA 4DYKA 3A21A 3C2FA 3URAA 3ZLGA 2Y8UA 1EC7A 4GC4A 3N6QA 4DO7A 4MDOA 1G4PA 1WPCA 3FDKA 3S46A 3UY8A 3GH4A 1UD3A 4H8NA 1Q2RA 2FMNA 4K36A 2BMBA 2HNEA 3LTSA 1XXXA 3CASA 1LDCA 1Q63A 1XLFA 4D6DA 3BCJA 1I8JA 2R82A 1M1BA 2X1IA 4IT1A 3M5VA 1JZ8A 3RO8A 1Z6KA 1CYGA 1S1RA 3NZPA 3KWSA 4ZR8A 1SFLA 2O9TA 3IGXA 3JUGA 4MKSA 2Q71A 5PTDA 1BRLB 1BTCA 3IVUA 3E0FA 4XG1A 3ZOAA 4MWAD 1RCXB 2PF8A 3GDKA 5JUVA 3N11A 1W1TA 2VOMA 1T5AA 3GC5A 4IMEA 1SM9A 1TV8A 3R11A 1RPXA 1HKIA 4HA4A 5LGZA 1GZGA 4KCTA 3Q45A 3UXDA 1DTNA 1W5PA 4B90A 2HROA 2CLIA 2NLYA 4JTKA 3LHYA 4PB5A 4JFVA 2ZTJA 3GNNA 4G1NA 4JQ3A 1XLAA 4LUIA 3CO8A 4EXAA 2NV9A 3TN5A 2E5CA 4JD4A 5LNVA 3SGGA 2P3EA 5BOFA 1US0A 2CFFA 4I8YA 3IIOA 1S5NA 1K03A 4GCXA 3VOHA 2C0HA 1FWDC 3IJIA 2FZ9A 2Y5EA 1C93A 2ZZ4A 4HPHA 1IZJA 4B9ZA 3EWXA 3WMLA 3E0LA 4TOQA 4S2CA 1Q2SA 4NZ5A 4XAPA 3T0CA 3LLDA 4INFA 4GUGA 1ZU8A 3PVFA 3UU0A 4IFKB 1W31A 2HVMA 1JYVA 1EGZA 1JZ5A 3MP4A 5HAOA 3P8JA 3F7JA 2P10A 3QQWA 2HE8A 4IPPA 2E8YA 4LAOA 4NT0A 4PBEA 3MO4A 5JMUA 3WUBA 3W85A 1ALDA 1EL3A 5T9BG 3AIEA 1KD0A 1Z7AA 1ZSXA 2YA0A 1GPWA 4GFIA 3FLUA 1SJCA 4EF9A 4IL0A 3TOYA 3EPOA 4CN4A 2Y8VA 4L56A 2NUWA 3TYZA 5JH2A 3U7VA 3RU8X 4NYUA 4HMEA 3ARXA 1BTMA 3CPUA 2OSXA 2HS6A 1TTJA 3CLWA 1WKYA 1WDRA 4FNTA 1OGSA 5C2CA 4FA3A 2JFEX 2QLYA 2YKKA 3ES8A 1VPXA 2P0IA 4QDWA 4LCRA 3FW6A