3W75A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-149
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-149
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w75A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w75A01
1RZMA 3CEPA 3LDVA 3W7NA 3HF3A 2VFIA 1KM4A 4Y96A 3W1LA 5A5WA 3SR7A 4UTTC 2GPTA 3L5MA 4CLMA 3Q37A 5D2TA 4AWUA 3L21A 5K9DA 1VHNA 5BMXA 5KZMA 4TMBA 1KLZA 1R2SA 2G5WA 2C13A 3NL5A 4N4PA 5FEWA 3LBMA 2ZRXA 4RZ4A 3QPYA 3W1XA 1G7VA 1EEPA 4P2VA 1YYAA 1SSGA 4O52A 2CLFA 2EPHA 3M5VA 3TDFA 2GJLA 4QM1A 4MFEA 2FPYA 3NG3A 4UUIA 3W71A 5HUPA 1NVMA 4HHPA 3TCEA 4LOCA 4UNKA 1KFCA 2YGYA 1XL9A 3I68A 1N8FA 5F4WA 3HMJG 2VENA 4NXSA 1ZALA 1TPEA 1M7OA 3UQNA 1QAPA 3PM6A 3EX3A 5BMWA 2PCQA 3L5AA 3LTSA 4A22A 3TR2A 1KFBA 1SZEA 3BG5A 2HS8A 2X1UA 5F2MA 3DXIA 3NM1A 4Y9AA 2Q3OA 3U2OA 1I2OA 3ABQA 3BW2A 1HO4A 4FEZA 5EMUA 3EEGA 3M0ZA 1EA0A 1GVFA 3M41A 1I8JA 1SO5A 3EX2A 3UZ5A 2CLLA 1P5BA 3R89A 1LZOA 2PC4A 3MHFA 1TPH1 1JRBA 5E1QA 1TV7A 2W79A 4I7UA 3W7LA 2ALDA 4FB7A 4PC8A 1T0OA 4FNPA 2NUXA 1W5MA 4IPIA 3NPUA 4QISA 4MLJA 4WOQA 3ZS4A 4KWWA 3T7VA 3GAKA 2A85A 5ABTA 1O5KA 1P1XA 3L0KA 2ZZ1A 5BNKA 4I7WA 4Q33A 3C2OA 3UPWA 4GUIA 3W85A 1H7XA 3C3NA 4K8HA 4UR8A 4N6EA 5EKYA 1ALDA 1ZY9A 4Z0SA 5D03A 1RPXA 4UC5A 5KINA 3DI0A 5LSMA 2JGYA 1WYIA 2HTMA 3OVRA 3G1VA 2ATSA 1IIHA 1XKYA 3NZRA 3E96A 1XFBA 4MZ1A 1SQ7A 2NV2A 4JTJA 1GPWA 3HPXA 3NVTA 4GBUA 2TYSA 1H63A 4UFHA 2H3DA 4LC6A 1A5SA 1UASA 3CHVA 2YPIA 1F2JA 3UXAA 1GVSA 3N9SA 3EWWA 3QEZA 4N2YA 4HPJA 1AL8A 3EXSA 3W70A 5FF3A 2ZA3A 4ADTA 1XUUA 2DZSA 1YXCA 5T26A 3NGJA 1W31A 3C2FA 2WSRA 3PB0A 3QJAA 1SW3A 3LHZA 4JIPA 3GR8A 4N9EA 1Z42A 2OJPA 3E9AA 1VCGA 1TTPA 1PS9A 5AC6A 1Y0EA 2QKFA 1G4EA 2NX3A 4EF9A 4O4VA 4JTGA 3F03K 3TQVA 4A29A 3PULA 3PF3A 3PUEA 1EB3A 2ZTJA 3FKKA 1ZAIA 1TB3A 1A5CA 3HO8A 3W1UA 2WNNA 1C29A 1LCOA 2QUUA 4LC8A 4ZQRA 4I7VA 1EP1A 3GDLA 4UR7A 1NEYA 1WA3A 5EYWA 1KTBA 3W7GA 3IVTA 5A8GA 3G1AA 5AYZA 4JS3A 6TIMA 1YDVA 2JKPA 5K4XA 3NR0A 5I3JA 1WBJA 5G4EA 4IJBA 2Y88A 5D2XA 4K6AA 3HG4A 4AWTA 3BG3A 5DCDA 2DU2A 2Y89A 5LNUA 3LRLA 2GVGA 1XM3A 2X1RA 3QQ0A 4DPPA 1KV5A 5F2GA 2VKZG 5LGZA 1EWDA 1NF7A 4JYDA 3P7YA 3EWXA 3P5ZA 4QIUA 4AHOA 4JTSA 3QYQA 4Z08A 3W72A 1FWSA 4PODA 1KW1A 4FX7A 1W8SA 4LVBA 4CNPA 1SO6A 3VE7A 3NDOA 1OHLA 5FEZA 4LV4A 1I2NA 2QAFA 1F05A 4M6QA 3E02A 1XC4A 3G1SA 4IXHA 3BPWA 5HNRA 1PHQA 2R94A 3DHFA 1OX4A 2E6YA 3ATYA 3MI6A 1QPRA 1ME9A 1E51A 4IGHA 3C56A 1Q6OA 3QRHA 1LLZA 1PL9A 2QJGA 5HULA 3LCHA 2ZZ5A 4LT9A 2ZRUA 1T8XA 1DQXA 3FEMA 5DN1A 4DEFA 3E49A 4NJKA 4AWSA 2RDWA 3QFEA 3HGSA 3PWAA 3GK0A 1D9EA 3B0VC 2X1SA 1B57A 1K7FA 5AB3A 3IIOA 5AOUA 1OX6A 3GX9A 5EL1A 3FFSA 2B7NA 3F4WA 2V2DA 4FNQA 3PBWA 3HPSA 1QR7A 4JGDA 4DF1A 3UWYA 3BLIA 1DBTA 1EPXA 2ABBA 1JQXA 4MZ8A 5LNSA 4EF8A 3LLFA 4HPXA 1QO5A 4XBKA 1VHCA 2ZZ7A 4UFKA 2B7PA 4LS1A 4BWLA 2NWSA 2OT1A 3V75A 4O4WA 2H3BA 1OF8A 1PHWA 3MYOA 3P62A 4PFMA 1G4SA 3OVQA 3NQMA 3FJLA 1LDCA 2CWNA 4FO4A 4GJ1A 1ME7A 1GG0A 3IIVA 4O8RA 4K37A 2QCHA 3DKLA 3PSWA 1A50A 1JCNA 4KKXA 3F4NA 3SI9A 4NJJA 2F7FA 3UWWA 3ABSA 3OA3A 2WV8A 1OFOA 2EF9A 1OFQA 4K7YA 2QCCA 3P82A 3IVUA 5FF4A 4OV4A 3DGRA 4M6PA 2FDSA 3TNOA 2H8XA 1HG3A 1K02A 1LRQA 2WSQA 2CZ5A 2PRMA 1U83A 1EP3A 4PTNA 3OHIA 3QSRA 3EKLA 3GZ3A 3CIXA 3LTYA 1XUZA 1KTNA 5LZLA 3W1TA 4ZQCA 3FS2A 1ICPA 2B7OA 2VFEA 1QNVA 3HIJA 4O10A 3KRSA 4XBSA 2CLEA 3QW3A 3W1MA 3S8HA 3FIGA 3FYOA 5D33A 3PBUA 1OYBA 3PSVA 3A23A 3TJLA 1UUMA 1AW5A 3UYCA 1GOXA 5HJLA 4AEOA 2B0MA 1UJPA 1RV8A 2CU0A 1LOSA 4RX0A 2Z6IA 4IXXA 2Z1BA 1QCWA 5AN7A 1VYSX 3S5OA 3B05A 4O11A 5J5DA 4I9AA 1XI3A 3LOTA 3KOFA 5SWUA 3HJZA 4HNTA 4KFOA 1JJKA 3TSMA 4GWEA 1VCVA 1ADOA 4WJEA 1JULA 3O07A 3SSJA 3SGZA 5GVJA 1GYLA 4CNOA 2QAPA 3DFSA 4HKPA 1FDJA 1GEQA 3BGGA 1LTDA 3PC0A 3N14A 2I9EA 4GUJA 1YTEA 3VE9A 3HQ1A 5IBXA 4N9BA 4AAJA 3CT7A 2QDGA 4JDYA 3DENA 1OABA 4EVZA 4ZQNA 5LKYA 3OG3A 1H7RA 1TPUA 1N7KA 2DJXA 3NEVA 2A7PA 2C6QA 3W86A 2WKJA 5D05A 3GDRA 5CPOA 2V82A 4UTKA 1H61A 2YW3A 1FX6A 3YPIA 5AYYA 4R33A 2ZRZA 1GVOA 3EXRA 1UB3A 5HR7A 2E5CA 2VELA 2J88A 4FNUA 3GKAA 3G0SA 4DO6A 1VYRA 4WQ6A 3NM3A 1KM2A 2AGKA 4CCDA 1XBXA 3ELFA 4UTHA 3WJZA 4IMDA 3LI0A 1TREA 5D38A 3O16A 4LVAA 5F1UA 2V5LA 3A5VA 2FPVA 3P61A 1OVDA 4UFIA 5DY2A 4DF2A 1SZGA 4K38A 1Q6RA 1KTCA 1NAL1 4LNYA 4O1BA 2J9ZA 4FNSA 1L6WA 3WJWA 3ANYA 3WK2A 3M43A 5HR6A 1TPDA 5HUOA 3I7RA 3IGUA 1G4PA 2G97A 4E2DA 3W7RA 1RD5A 2X2GA 4ADSA 5K3VA 2Y7EA 3G1YA 1Q45A 3IVSA 5CZTA 3KXQA 2DZPA 3PS7A 4GXMA 2RH9A 3NPWA 2CLMA 3NQ6A 3M1ZA 3I7SA 4PA8A 4AVFA 2PURA 4O1CA 4EIVA 2Y61A 3UXDA 2BXVA 3PBYA 4FIRA 3B0PA 4IMCA 1QPNA 1J2WA 4RLIA 3USBA 3W74A 1JUKA 3IV3A 4UFJA 1CX9A 2CLOA 4IMGA 1DORA 1GTHA 2GUUA 3P5YA 1LM1A 3G3MA 5DELA 1RR2A 4ICNA 2Y6ZA 4WX2A 1SZNA 2YZRA 1OFPA 1LP6A 4JTHA 1NFBA 4GC4A 3LI1A 5CPLA 3G22A 5CZSA 3EWBX 2Y63A 4JY8A 2JK2A 2YFOA 4OV9A 4CCCA 3L2IA 1TCDA 1VLIA 1GYNA 4YWIA 3P80A 1VCFA 3NO5A 3TIMA 2A7RA 4JD4A 1VGAA 4A2RA 2J6XA 3E0IA 3HB9A 4ADUA 4NNCA 3WK0A 3T55A 4H3DA 4N6FA 5CPMA 3PY2A 2I1OA 1AW2A 1F76A 3ABRA 1ICQA 4FX8A 5I3KA 4DO4A 2R14A 2QF7A 3RMJA 3ZWTA 4AH7A 4FX6M 3NQFA 2ZZ3A 3W9ZA 4WD0A 4QQ3A 2G96A 3IEBA 4XKYA 4JX5A 1FWTA 2NXGA 5DCBA 1DV7A 3TE9A 5IBXC 1K8ZA 4RZ6A 3TFCA 1WQ5A 3W2LA 1O60A 5F2LA 3CEUA 4M7TA 4IMFA 1VYPX 3GNDA 3MHGA 1KM5A 1LBFA 4MOZA 3G1HA 2PRHA 3TA6A 3DU0A 5AHEA 4EOUA 1FWWA 2WJZA 1V5XA 3NQGA 3P81A 5E0KA 2CW6A 4MFDA 3HG3A 2TPSA 1EWEA 5BW6A 4O14A 3NQAA 2YSWA 5CPNA 4JTUA 3GDTA 4HSOA 2UV8G 4DF0A 3BV4A 3G1DA 1QPOA 1T96A 2CZDA 5D37A 2G95A 1IXPA 5HWJA 2ISSA 2ZDRA 3L0NA 3UD6A 2JKEA 3NL3A 3W7MA 1A53A 4MYXA 4UFLA 1GQNA 4AF0A 1K7EA 3KAOA 4FNRA 2X16A 4WXZA 1SUXA 2GVLA 2V2HA 1KM1A 2DZVA 3JR2A 4JYEA 2ZFAA 3MMTA 4MZYA 5MHBA 1FXPA 1SZFA 1TQJA 3S9YA 2ZRVA 3KHJA 4MY9A 5CGQA 5L6UA 1I45A 1IIGA 4IUOA 3G8EA 3T44A 5J5RA 1Q3NA 3W7IA 1OJXA 1QPQA 1W54A 1BWLA 4YXGA 3FLUA 3W2NA 2WSYA 1W5QA 3R12A 3O8AA 1KFLA 2C3ZA 1MXSA 5CZ0A 5FF2A 5CKSA 5C5YA 1DKWA 3LCGA 3OBKA 5AYXA 4HNVA 3LGEA 2JGQA 1VH7A 3N2XA 3STEA 1FCUA 1H1ZA 3QQ1A 3KRZA 1TJRA 2FPTA 3K30A 4JTIA 4LY8A 4RV8A 2F84A 3GXNA 3C6CA 1KM0A 2E5DA 1VLWA 1O95A 1AK5A 3CLMA 2ZRWA 4CCEA 2H6RA 3PUDA 3DAQA 4LVFA 3H55A 3NQEA 3SJ3A 3JRKA 3FOKA 4O15A 1LBLA 3QC3A 4XTIA 3TQKA 4FIQA 4XKYB 3STGA 3GKFA 3PAJA 1FDZA 2NLIA 3LRMA 4D2JA 3W7JA 3DBPA 1LBMA 4R34A 1TRIA 2QJIA 4XUGA 1XCFA 4JN6A 4DO5A 4P61A 1HL2A 7TIMA 2A2IA 5C2XA 4Z0JA 2Q8LA 2VEMA 3IGXA 3RF9A 2VFGA 4WOZA 3EX1A 3SY5A 3VI2A 3M44A 5EBUA 4NNAA 4OHQA 2BSLA 2IQTA 2A4AA 3O05A 3NPXA 1P4CA 4N4QA 1GWJA 2VFDA 2NXIA 4PH6A 4UTWC 2GQAA 3MHUA 4C1LA 2RHGA 4LVGA 5D04C 1IF2A 1OG0A 1EIXA 1W1ZA 2QCNA 2QCEA 5BOOA 3W1PA 1KFEA 2E6AA 4WXYA 2R91A 3BG9A 1J4EA 1TMHA 4GUHA 3N9RA 3SZ8A 3BW4A 1QWGA 1OK6A 2QDHA 1J5TA 4ZZ9A 3O06A 3O6DA 3LV5A 2A0NA 2W0UA 1LRTA 1TTQA 5G1TA 1H7WA 3GDMA 4UNLA 1KLYA 4WY0F 3SECA 4AHPA 3S0CA 1TTIA 1ME8A 1GT8A 2J9YA 3Q58A 3WJXA 3AO0A 1DJNA 4O16A 1JUEA 2BZNA 4DELA 1MSSA 1ICSA 3EB2A 1AW1A 5G2HA 1EP2A 3TW7A 4Y6GA 1SPQA 4O1DA 4Z1BA 5K9CA 1VS1A 5AC7A 1OFDA 4MLRA 2C14A 3TKFA 3MO7A 1BTMA 4OWGA 1QMLA 3PVFA 3T4CA 5EA9A 4NX0A 3C52A 2ABAA 1FQ0A 1XBVA 2VEKA 1VC4A 3DH7A 3P67A 5KITA 2V8ZA 3LXAA 4GFSA 4YCOA 1L6YA 2Z6JA 2FB3A 1GG1A 2D73A 5F4SA 2B7QA 2RFGA 2C1HA 3C2EA 3L68A 1YTDA 1WBHA 3FJ6A 4ZMGA 1RQHA 1JUBA 5HQEA 4TR9A 2O7QA 2QCGA 4NJIA 1B4EA 4OGZA 4UTUA 1LOQA 1SO3A 3EWZA 1XXXA 3BK0A 3LHVA 2CFFA 1OFBA 3ATZA 4O13A 1A5BA 1FCVA 1SU5A 4GUFA 1JCJA 2NUYA 4NJHA 3W7OA 5CZJA 1SR9A 1I4NA 1WV2A 4BI5A 1CW2A 1KM6A 5KZDA 1C8VA 2WO5A 3GB6A 2ZTKA 4N02A 3NNTA 2NX9A 2P1FA 3P84A 4MKNA 2WOQA 3A24A 1VRDA 3O1NA 3ZFHA 1T99A 4PL1A 2XFWA 5K9XA 2X30A 3OIXA 2LLEA 3G24A 4IPJA 5TIMA 4O18A 5FF7A 2BWGA 4WUIA 1QFEA 4RZ5A 1W56A 3NQCA 3UWQA 3W3OA 2FIQA 4JIQA 3S1UA 3TJXA 5CSRA 5TBOA 4XZ9A 5F2IA 4GRSA 1KFKA 4CQ9A 4UTIA 3DFPA 2A1YA 3QH2A 3R2GA 4JICA 2J27A 4AB4A 2EKCA 3RU6A 2CZFA 2Y7FA 2HS6A 4JEQA 2YDAA 3S5ZA 1TV8A 4W9TA 1JCXA 2YW4A 3G0XA 3W88A 1PCWA 1YDOA 4ZQOA 3SGUA 1OFRA 4YL2A 2ZZ2A 2JBMA 4O28A 4ALDA 1BWKA 4ONVA 4IX2A 3W7DA 3C2RA 3S1VA 3B4UA 4WY0B 4X3ZA 3BLFA 5FI8A 1KM3A 1S5WA 1YXYA 1VPXA 1ZAJA 2OMAA 3LHTA 3TC7A 1W0MA 3O6YX 3GDKA 3S6DA 1VR6A 5G5IA 1VJIA 3RK8A 3H54A 2YYUA 3VKJA 3MWAA 4YMZA 2HMCA 4WY0A 4MIMA 2V5BA 4X9SA 4Z1DA 3QPZA 5HWMA 3R13A 5DXYA 4CNNA 1KBIA 4JY9A 4ZQPA 3P8JA 1S3HA 3W7HA 4LS0A 3TK7A 4NNBA 1B4KA 1FCQA 1H7NA 1H7PA 2XN1A 4OBTA 2GQ9A 4WZHA 4BWLC 4M7SA 3TMQA 2A6NA 3TSBA 4RR4A 5I3FA 1GZGA 3T40A 4E2BA 1K3UA 3F1QA 4JNMA 4AF0B 2QJHA 4LU0A 3CM4A 4LWWA 3MBDA 4RJEA 5FESA 4QITA 3FA5A 3I6RA 4UIOA 2A21A 3LB0A 1M7PA 3GYEA 1Q6LA 4AMAA 4JTLA 3TMLA 1Z48A 3L0GA 1O5XA 8TIMA 5HMSA 4M19A 1LYXA 3IIPA 4N9DA 4Y8FA 4ZQMA 3M47A 4X2RA 2R8WA 5KZEA 1JCYA 4K7VA 1H7OA 3TXVA 2ISVA 2V9DA 4N9CA 2C0AA 4H6KA 1FXQA 4Q32A 3MP5A 1C9DA 1I2RA 3NOEA 4POCA 1SW0A 1WOAA 3I65A 5D30A 4HT3A 4MY1A 3GR7A 3MBFA 3MUXA 2DP3A 2ZA1A 4L4MA 1GVRA 3NPVA 2C18A 3W7PA 3W73A 4ORMA 1JQVA 1RQBA 2DZTA 4R7JA 2A5HA 2YFNA 1F6KA 2E6DA 3L67A 5D2WA 3LLDA 2E5BA 3GXPA 1TJPA 3NQ8A 2ZRYA 1DL3A 1D3HA 2ISWA 3TAKA 2XN2A 4UCGA 4O0ZA 3TQ0A 5AHFA 3N2MA 1IXQA 3FKRA 3M5YA 2Y7GA 2WNQA 2BLEA 1EUNA 1LROA 3UY7A 2I14A 5F1VA 3TU9A 4OU1A 3IIXA 4O53A 1ZNNA 2VEPA 1XBYA 4QAIA 3N34A 5G2WA 5FEXA 1TYGA 3SFKA 5KMYA 1FWRA 3D0CA 3LCIA 2QCDA 4MY8A 4GE8A 4OT7A 4PCFA 1OK4A 1LORA 1W3TA 3A22A 4M5PA 1JVNA 3QW4B 5AHMA 2AQWA 5CG7A 5K2ZA 1R2TA 3WJYA 1K7XA 1W3NA 4S2BA 3GVGA 1H50A 3THQA 4CQ8A 4TX9A 3ZR4A 1W37A 1FY6A 1WOBA 2P10A 3HG5A 5U4NA 4AHQA 1DVJA 3MYPA 3U8GA 4QSHA 4UTTA 4JXCA 4XWUA 3LCFA 2RDTA 4QNWA 5D2VA 2A7NA 3WJSA 3NXFA 2V81A 3A9IA 4LRTA 3O6CA 3NZ1A 4ZVJA 1QDSA 1FDYA 1YADA 3W83A 3GNNA 4UMCA 1SSDA 4Q4KA 2V2CA 1PV8A 2YXGA 3W87A 3W2KA 3CIWA 1YPFA 4FHAA 4EWND 5AHIA 4ORIA 1ZHAA 3L5LA 1TPWA 2GJNA 1XDLA 4UTJA 2TMDA 3TW6A 3LHUA 4BF9A 4L4LA 3CTLA 6ALDA 3HGRA 4IWWA 2O7SA 3BARA 1YPIA 2C19A 1QOQA 5DBUA 4JX6A 2BTMA 3B06A 5AC8A 2VC6A 3EKZA 1Z44A 1UCWA 1G69A 2W6RA 1W5PA 1JR1A 1UBSA 3R8RA 5FF0A 4LVDA 1H51A 5AHNA 1ZAHA 3NQVA 4NZJA 3PG8A 3AJXA 2PE4A 3W6YA 2Y70A 2B4GA 5C6MA 3HGJA 1RQEA 1YDNA 4U28A 4E38A 4KWVA 2V0TA 2OCZA 2VFHA 3S42A 3TFXA 4O19A 4PL2A 1DHPA 3M5ZA 1WX0A 1GTEA 2DJLA 3HGOA 4KFPA 4MJZA 1X1ZA 4B5NA 1P0KA 4GUGA 1JRCA 2C16A 5LNRA 3LV6A 1Z41A 1P0NA 2OT0A 4UMAA 1LLWA 5CSSA 2ATMA 3HG2A 4FXRA 4JTTA 3W22A 1NSJA 4NXKA 3W75A 2Q8ZA 2ZZ6A 3M6YA 1TQXA 2E6FA 1TPVA 3O63A 1GVQA 1H62A 5HINA 3W7EA 3LCXA 1F7BA 1M6JA 4ZL1A 3INPA 3M16A 5G4WA 3TAOA 4GNJA 4FF7A 3L65A 3G18A 5DCEA 4UMBA 2X1TA 3QSTA 3S5YA 2DZUA 1F5ZA 3NYZA 2RKXA 1WXJA 1TPFA 1R30A 2QCFA 1MZHA 2KZHA 4JTFA 2BX7A 1YTKA 5I3HA 5TQLA 4FXSA 3STCA 3THAA 3VNDA 3PG9A 1THFD 1G4TA 1LOLA 1ZCOA 3CQ0A 1TPC1 3G3DA 4NT0A 2GVJA 4MJMA 3UWVA 1X7FA 2PRLA 1A5AA 5C55A 1EUAA 5U7SA 1TV5A 3DFNA 1DOSA 3ABOA 4UFMA 3QM3A 2FJKA 3LX9A 4OQVA 1VZWA 2QUTA 3W7QA 3MP3A 1YLVA 1W3IA 1EX5A 4DBEA 5LNWA 3B04A 3HPZA 4TIMA 3NQ2A 4NUWA 4FNTA 1OFEA 1TRDA 1HTIA 1X6UA 4NQ1A 5LHFA 4PEKA 1HO1A 3CWNA 2CLIA 3C61A 4NX5A 1TTJA 3LCLA 2VFFA 2FB2A 1M5WA 3BGJA 1L9WA 1SO4A 3GAYA 1QOPA 5LNVA 4ML9A 3EX4A 4XTDA 4LW7A 1LRNA 1DJQA 1D3GA 3DFTA 1S5VA 3MI2A 4O17A 3B0UX 4UTLA 3LHYA 1FBAA 4G1KA 5FEPA 1O94A 1F73A 4HIBA 1JCMP 4DPQA 3R5EA 3VFLA 4TMCA 1XBZA 1MEIA 4J9JA 2V30A 3P8IA 4IMEA 3SW6A 3C0JA 1IXNA 4O0KA 1I2QA 3BW3A 5D32A 1KV8A 1SFLA 2NXHA 3STFA 1V7YA 3QMRA 4XQ6A 3A5FA 1KBJA 3LHWA 2NX1A 3WK1A 3O15A 3TUUA 1TSIA 3P74A 3RFAA 2NUWA 3W07A 1SFJA 3GXTA 4M6VA 1I2PA 1FCBA 4HSNA 3BLEA 3W7KA 1O4UA 5KTLA 2QCMA 3S1WA 2XN0A 2RDUA 1H5YA 1K8YA 2EHHA 4LUIA 4U4MA 2Z2UA 4JX4A 3QF0A 3S5NA 3LCWA 5H2ZA 3E12A 4NU7A 4E0CA 4JYFA 3DKJA 1H60A 1PCKA 2YCEA 3G1XA 2J24A 5BRBA 2DZXA 3KFTA 3NAVA 3LXBA 3LRKA 4NVTA 1IXOA 1G7UA 3W2JA 5G2IA 1L6SA 5AHLA 1K03A 5KSWA 4Y90A 5D2YA 4LTSA 3QMSA 4RXGA 1ZJIA 1G67A 4JTEA 1ZENA 2AAMA 2QR6A 3GLCA 3PUOA 4IQLA 4S1FA 4K36A 3LBCA 1XDMA 1MEHA 3RLVA 1PE1A 2ZA2A 5IM51 1ZFJA 4QNEA 1OYAA 1QO2A 5LHEA 4X22A 2HSAA 3PB2A 2NWRA 3W1RA 4LS2A 1U5JA 1UUOA 1VQTA 4AXKA 4RCXA 1WDWA 3Q94A 2YR1A 4RK8A 2JKAA 3JS3A 3W7CA 4YCPA 2TRSA 2ZQ0A 3CPRA 3PR2A 3BVJA 3BO9A 1YXDA 5DLCA 1TIMA 3W1AA 4NZFA 1KFJA 4UTWA 3W76A 3V1PA 3QMTA 3MP4A 3DZ1A 3EX6A 1OF6A 4O12A 5F4XA 4OE7A 3B8DA 4K39A 2FQIA 3FYPA 1R47A 3TH6A 3TC6A 3HBLA 1K8XA 2QEZA 3TX9A 1AL7A 3CC1A 2DZWA 2E09A 3KRUA 5EPDA 1TPB1 2OX1A 2QUVA 4A2SA 2YYTA 3UWUA 3H53A 3I7QA 4RXFA 5G1YA 2Q3RA 1FWNA 1HUVA 2C15A 4O50A 3W1NA 1X1OA 2NV1A 4Z1AA 4IX0A 3G8RA 3DFQA 2GOUA 3CU2A 1AG1O 1OYCA 3WK3A 1PVNA 3W2UA 2EAWA 5D09A 3A21A 1R2RA 4H4IA 1B9BA 1X8FA 2WPBA 5D02A 2YX0A 1WAUA 2VEIA 5DBTA 1TO3A 4JDBA 4Z1CA 3W1QA 1G6CA 2OZ0A 3C4UA 1KA9F 3RLUA 4MVAA 4HN4A 4R53A 3N19B 3T78A 4UTMA 1NF0A 3S1XA 3NL6A 3UY8A 2QCLA 3M9YA 2E77A 5LGXA 4HNUA 3MI3A 2CLHA 1PIIA 1ML1A 2WQPA 3NL2A 3PBVA 3TV8A 4O54A 4C1KA 3N73A 3TROA 2TSYA 2H8ZA 4S2CA 3NQ7A 4BFAA 4MYAA 3IRDA 5EY5A 3SIZA 4DBDA 3CB8A 2VOMA 2NZLA 3Q2DA 4QJ1A 1CI1A 3MW7A 3P60A 3LTPA 2CZEA 3HOJA 1W5NA 4DQWA 1F74A 2E68A 2Y7DA 3EWUA 3G0UA 3KX6A 3KVLA 3VCRA 5K4ZA 2EGZA 3B03A 1OX5A 4JTKA 2ZCGA 1F6PA 3UPBA 4O1AA 3EXTA 2GQ8A 1DQWA 2WNZA 4A21A 4BR1A 1H1YA 5I3IA 4BK9A 2J9XA 1GJPA 5K7JA 1OX4B 1BKSA 4BI7A 5I3GA 1AMKA 5E93A 3WFAA 3CWOX 4TU1A 3EWYA 1FUYA 3KVJA 4KFNA 4IOTA 2FFCA 3UZJA 2Y62A 2H90A 3W84A 2ZZ4A 3M5XA 4YLWA 3IGSA 1IGSA 1B3OA 1N55A 3MJYA 5DXXA 5HWNA 3W2MA 3C8FA 3TSDA 5H91A 1OFAA 2DORA 4LV9A 3UNDA 4RKAA 3L66A 4NJGA 4HNNA 4O57A 3OVPA 2E1DA 2QCDB 2Z0IA 4TO8A 5L9FA 2ZYFA 3NQDA 4LRSA 5C54A 1SW7A 3M7WA 3NA8A 1HFBA 3KVMA 3L9CA 1MEWA 3N3MA 1W5OA 3LM7A 2Y85A 1BEUA 3LXCA 2FTPA 3TXZA 4BI6A 3U6WA 2FLIA 5DY3A 1ONRA 4MUZA 3UWZA 3DHDA 2VXNA 1Q6QA 1R46A 3KVKA 4LUJA 3RNDA 3DFOA 4DXVA 3LERA 3C2VA 4A3UA 1MO0A 5AFDA 3OEXA 1JCLA 2CLKA 3ZWSA 3DI1A 3G1FA 4K8EA 2ZBTA 2A6LA 1RVGA 1S5TA 3IIZA 3W23A 3GIYA 4UXDA 2P0OA 4JR5A 3QZEA 1L2UA 4CQAA 4MPQA
chains in the Genus database with same CATH superfamily
1RZMA 2PTXA 3CEPA 4JTRA 1J0ZA 2X7VA 3HF3A 3LDVA 7PTDA 2QVHA 3HV9A 3WLPA 3W1LA 1WZKA 4UTTC 2GPTA 2WANA 4CLMA 1GONA 3SQSA 1NQ6A 5K9DA 5KZMA 4EWJA 2QV5A 1R2SA 2HV5A 4MWAE 4Q8QA 1AQMA 4H8VA 2DH2A 4N4PA 3DC0A 1TV4A 3GHSA 5CPQA 3V36A 5EMJA 2ZRXA 4MB3A 3QPYA 1X8CA 4WGHA 1XV8A 3WIJA 3LSCA 1EEPA 1F3XA 1SSGA 2BVTA 1Z8AA 1E1FA 2CLFA 3FVDA 3V35A 4XKMA 3PZNA 2JF7A 3CQJA 1CGXA 3ONBA 1RLDA 3FJ4A 3VINA 3GNOA 5HUPA 5DMNA 1XL9A 4L56A 3HMJG 3WLJA 4QS6A 4NXSA 4JHMA 2O9PA 4MKVA 3WELA 4J3VA 5CBBA 1ZJBA 3N2OA 3TR2A 1XYMA 2ADAA 2X1UA 3U5UA 3V5OA 1I1XA 4FXJA 1GVFA 3DCPA 2J7BA 4Y7EA 1TE1A 3CL7A 3EX2A 1EHNA 1B9ZA 4HHMA 1P5BA 1GUVA 2E1WA 3R89A 3HN3A 3OU8A 1KGXA 5I06A 2ZUVA 2P3EA 3EOOA 1XW8A 1TV7A 1UD4A 1E70M 4GISA 3E3HA 1ZGDA 2NUXA 3L12A 1V4YA 4MLJA 3MVIA 4KWWA 2Z1SA 3GAKA 1RP8A 3JU2A 1O5KA 1QPKA 3L0KA 2BVYA 2VO5A 1NWTA 1ISYA 5C9ZA 3RLGA 4D8LA 4W8LA 1F3TA 3WDPP 1H7XA 3C3NA 1ALDA 4M82A 1YQ2A 1UP2A 3VZZA 1WDRA 1WYIA 2HTMA 3COTA 2J62A 3OVRA 4WF7A 3G1VA 2WZMA 2ATSA 1XKYA 3RX2A 4JTJA 1ADDA 1LWIA 1RCOB 4QHRA 2HBXA 2OQLA 3UXAA 4AMCA 3N9SA 3EWWA 1KKRA 4NRSA 4DWDA 4Q7NA 2W63A 3GRIA 3ZVIA 4O1FA 4ZSUA 3W70A 2ZA3A 3DEQA 4ADTA 2DSKA 1BG4A 3RUBL 4Q4OA 1HIZA 3NGJA 3HV8A 1AH3A 3ZJ8A 2WSRA 1QOXA 4F2TA 3LHZA 1HP5A 4CU6A 1VKFA 3AI0A 3E9AA 1VCGA 1TTPA 2ZWYA 2QKFA 1M04A 2NX3A 2HPMA 3TQVA 3EGJA 4A29A 3H2NA 1ZAIA 1TB3A 3W1UA 1M3UA 2WNNA 4KQNA 4P8XA 1LCOA 4Q4MA 3XIMA 4ZQRA 1ZJAA 3GDLA 3VDCA 1KXVA 1WA3A 3M6DA 3G77A 4FI4A 4JS3A 2QT3A 2FVMA 1YDVA 2JKPA 1E5NA 5I3JA 2Y88A 3WUBA 1V6VA 2WVUA 2OWCA 5DCDA 3N25A 4XIAA 3G6LA 3AZRA 2PWUA 3GNXA 2GWNA 4DPPA 1KGWA 4WJXA 2VKZG 1AD4A 1EWDA 1NF7A 2R82A 5CGMA 3P7YA 4H9TA 4QIUA 4AHOA 4Z08A 1J6OA 1UZ1A 1TWZA 1FWSA 2G37A 5FJPA 4BS0A 4JPGA 4W5ZA 4ACYA 1XDJA 4PUJA 5EMKA 4PGLA 1UPMB 3NTYA 4CNPA 5HMDA 1OHLA 4R3UA 4WIWA 4BEUA 2VZOA 4LV4A 4GYJA 4XAGA 3TYUA 5AVHA 1FHVA 3OGVA 4Z2IA 3DHFA 4BHYA 4IPPA 2E6YA 1UZ4A 3ATYA 3KHDA 3WLRA 1ME9A 4L4PA 4YTTA 1XH1A 4DJFA 1PL9A 3LCHA 3GC5A 3GTXA 1BPLB 1ZUAX 3O3RA 3A9BA 5HPOA 3MB9A 1IR2A 4NJKA 5EU9A 4LGXA 5CC5A 3RYSA 1Q6GA 2JFEX 3W28A 4A35A 1B57A 1LT8A 4WHBA 1WZAA 3VIGA 3B8VA 2V2DA 2W91A 4D6DA 1FHLA 3M0KA 3EWCA 2V68A 3UWYA 3BLIA 1R9YA 1PKMA 4B9YA 4EF8A 1DJWA 4XBKA 1VHCA 1Q7MA 5GJMA 1E0XA 4LS1A 1W8GA 5HOSA 4O4WA 4U33A 1B31A 1PHWA 3R4IA 2PU0A 3P62A 4Q8OA 4PBFA 3BMWA 1G4SA 4GJ1A 1GG0A 4HPNA 2PD5A 1JEZA 2YA2A 1W17A 2HROA 4BEQA 3WLLA 1F07A 1W3JA 1OFOA 2EF9A 5E9XA 2QCCA 4MTVA 4OV4A 3DGRA 2FDSA 3NQBA 3CQIA 1HG3A 1TJ1A 2FYMA 4PTNA 1EP3A 3VO0A 1N8IA 2WC7A 4YPJA 4IJCA 1H09A 3LTYA 3L7RA 3W1TA 1WKEA 4GI9A 1ICPA 2X0YA 2XM1A 1WDPA 1FWEC 4RZBA 3FYOA 1Z32X 1OADA 4ECLA 3A23A 1UUMA 4Z1YA 1OCQA 3UYCA 1GOXA 3WKZA 1LG2A 1G0CA 2B0MA 4QLKA 3AUOA 4GABA 1HN1A 1XQLA 4XISA 3PUGA 3AOFA 1VYSX 7TAAA 1TZZA 3LOTA 4IM4A 1NP2A 4KFOA 4J2MA 3SSJA 5GVJA 4CNOA 1FDJA 3LNMA 4GUJA 3WQFA 3TLLA 3HQ1A 5IBXA 3CT7A 3BJSA 3DENA 1OABA 2VDIA 1KB3A 1XIJA 3VIHA 5C9WA 3OG3A 4RUBA 3FN9A 1VIWA 2GK1B 4CNSA 2A7PA 2C6QA 3W86A 1F8MA 2YW3A 2WMIB 1X1NA 5AYYA 1K8CA 4C7FA 2C1GA 3GSMA 3EXRA 3U2EA 1TR9A 1UB3A 3CH9A 2E5CA 2VELA 3R1ZA 2VQTA 4DO6A 3PBGA 2AGKA 3ELFA 2J7HA 1IEQA 4UTHA 4IMDA 4TX8A 5D38A 3VK5A 3CJPA 1UA3A 3O16A 3QZAA 1HKVA 3GFXA 3RMEA 5CLTA 2DT0A 4F8XA 4K38A 4LNYA 1J6PA 4FNSA 3WK2A 5HR6A 4GO8A 3UGVA 3KL3A 3U4FA 3DDMA 1CDGA 3VUPA 5BWAA 2PZ0A 3T0AA 3G1YA 1EHAA 3MCMA 3CUIA 2D69A 1A47A 4ZODA 4CQDA 3QV9A 4JIEA 3T4WA 3R0UA 2XFRA 3MUY1 4BY3A 4M8UA 1EH9A 2XVGA 5BROA 4AY8A 2BXVA 1PYFA 1I0DA 4ZOEA 1MXDA 4FIRA 3B0PA 4XSLA 3UU0A 4ZOBA 4RLIA 3M64A 4B5UA 3IV3A 3THCA 1CX9A 4IMGA 4URIA 3P5YA 5BXTA 4ICNA 2J47A 3WNOA 1SZNA 3SUTA 3KRBA 1LP6A 3WH7A 3AHVA 2WKLA 3CYJA 3LI1A 4O8AA 1UC5A 3RX3A 5A6MA 3N12A 3NFUA 5KEZA 4DI9A 4ASTA 2JK2A 2FMOA 4OV9A 3RN6A 4CCCA 2ACUA 1UWQA 2XSXA 2D0GA 1MQPA 2PDLA 3P80A 4B5TA 3IAPA 4QG6A 3NO5A 3RO6A 1MRQA 1QK0A 1LQ2A 2J6XA 2OYMA 3E0IA 3SAZA 4F4RA 3PWIA 2VTFA 2INEA 3S47A 2I1OA 4PUMA 3QVQA 4GYKA 2NV9A 1AW2A 5CPSA 1VEMA 1L8NA 2QF7A 3R11A 4Z2JA 3NQFA 2ZZ3A 5B7ZA 3GS6A 2HE5A 2AKMA 2PBGA 1R3VA 5FOOA 3WDIA 3AS2A 6ENLA 3W2LA 1O60A 3SCVA 4LAZA 2QHAA 3MHGA 1MUWA 3UJSA 2PRHA 2PZNA 3DU0A 1QNSA 3PTMA 1FWWA 3DESA 3EB4A 1DJIA 4MFDA 3TYCA 3E38A 3NQAA 2YSWA 3DFYA 4JTUA 2AL2B 1UWIA 3UESA 3VZXA 4DZIA 1ZU8A 3BV4A 1XRTA 1QPOA 4HCHA 4HA1A 2DSWA 4V28A 4TXEA 1MUCA 3NCOA 2G95A 2ISSA 2ZDRA 5CQ1A 2BV9A 4KESA 4PRTA 1Y5WA 4AF0A 4P7NA 3KAOA 2DIEA 3BZJA 4FNRA 3LYEA 3MU7A 5JH1A 4WXZA 1I1WA 4CNTA 5A3HA 1UD3A 3KE0A 1KM1A 2DZVA 4JYEA 2OLAA 3H7VA 2XFFA 2ZFAA 1UIOA 4N42A 1TQJA 5E9AA 3S9ZA 4I8DA 1R6WA 5L6UA 1I45A 4MKSA 1IIGA 1BYBA 3KBJA 1Q8JA 4BQ4A 2E9LA 4LNCA 4KMQA 1PX8A 3V1HA 2EO7A 3H2OA 1CIUA 1KFLA 1Q6EA 5C5YA 3GBDA 3AAMA 1DKWA 3LGEA 1XISA 2O0TA 2WW5A 2JGQA 3AQUA 3LEPA 3CPUA 4GZJA 3NO1A 1TJRA 1R38A 4JTIA 4RV8A 2F84A 3GXNA 3SO7A 2J25A 2IW0A 2ZRWA 1WCGA 3H55A 4GI4A 2PDNA 4CGTA 3ITCA 2EXOA 5LIKX 1US2A 4W86A 4ENLA 4FIQA 2O92A 2P5NA 4D2JA 4UB9A 2BVDA 4OTKA 1LBMA 3DG6A 4R34A 4PYSA 1XCFA 4JN6A 4Z2GA 5C2XA 3MUAA 3IGXA 4V27A 1AZ2A 1OG6A 4QX4A 2YBUA 1A5NC 3H70A 5HJYA 1J0JA 3CZGA 3GWQA 5BWFA 2OKTA 5CC7A 2PLCA 4OHQA 2BSLA 4L9XA 4GMEA 1ZP3A 2A4AA 1XLBA 2BFGA 3O05A 4XK2A 1GWJA 2NXIA 3EBVA 1OEPA 2BGQA 4PUUA 1EXPA 1V3MA 2FHFA 1UWAA 7REQB 3TEVA 3MHUA 4C1LA 2UY4A 8XIMA 1AQFA 1OG0A 4GO9A 2QCNA 3GG7A 1RP9A 4IPNB 4CEXC 2E6AA 3ZJKA 4PMOA 2J66A 4WXYA 3UT0A 1TMHA 3WQ6A 4KWSA 1XLDA 2V38A 1UC4A 3IGHX 3GH4A 2ZX6A 1J5TA 4ZZ9A 2YLAA 3NSNA 1YNYA 4Y9PA 1LRTA 3BWWA 3TQPA 5LA1A 2QV4A 1H7WA 2FKPA 1QI4A 3W37A 3THDA 4AHPA 2XVKA 1Z6KA 3WD4A 3Q58A 2BZNA 4DELA 1MYRA 1AW1A 2PLJA 2GOKA 2PWDA 1FVPA 2YKKA 1VS1A 2WC3A 2GSJA 5AC7A 4WGXA 4FOKA 5D9OA 1KO0A 4D6FA 2PB1A 1IHIA 3CZLA 4KRTA 3MUCA 3H6OA 1ISZA 3MKVA 3T2PA 2XIBA 4C1NA 5ABFA 1HW6A 3PVFA 2E8YA 1JDAA 2VCAA 1XBVA 1U5VA 3B9NA 1ONXA 3P67A 1KRBC 2V8ZA 3LXAA 3NSMA 4YCOA 5FD0A 2Z6JA 4ATLA 4KERA 2D73A 4XAPA 2B7QA 5F4SA 1PZ1A 3MMWA 3Q4DA 1V3HA 4IG2A 1TWDA 3WN6A 4PMVA 2QCGA 4NJIA 1B4EA 3FA4A 4UTUA 4MADA 1TWWA 2OKOA 4G7FA 3MV01 1UR2A 1DWGM 1GVEA 1OFBA 3ATZA 3NDYA 2NUYA 3NEHA 3QFWA 1SR9A 3RJYA 4ZE4A 1KM6A 2WO5A 2PDJA 5DF0A 5DX7A 4N02A 1ITXA 4HA3A 3VGHA 2NX9A 1CBGA 1MZRA 3P84A 1OIMA 3O1NA 3ZFHA 3PZVA 1ECEA 4BQ2A 2XFWA 4QSFA 2LLEA 3G24A 4J3WA 1QFEA 4RZ5A 4C6FA 1RJRA 4QCEA 4J35A 1CENA 3OTRA 3S83A 3WMCA 2FIQA 5CSRA 4YVXA 5A94A 3ISIX 2P8BA 2PF0A 2QPSA 2HS6A 4JEQA 1XFCA 3W88A 4BCEA 1GOKA 4ZQOA 1JAEA 5DRCA 4YYCA 4ONVA 3W7DA 2CBIA 3FK4A 3S1VA 3PZMA 4X3ZA 1TV2A 2BP1A 3O6AA 1UJQA 3MSRA 1PXGA 4I5RA 3CS2A 1VPXA 2VX6A 4ILSA 4EXAA 4LJ3A 4U3CA 2IQDA 3GIPA 4XVDA 3GDKA 1A3WA 4CQCA 3BAJA 2E67A 3H4WA 2ZE0A 1P6BA 2Y8VA 3VKJA 3WUFA 3MWAA 4YMZA 2HMCA 1V0KA 2V5CA 4Z1DA 2C8NA 4GIEA 4RV3A 3C0QA 5GNXA 3LG3A 4TVUA 4OFCA 1XYBA 5HPCA 4OBTA 4WZHA 5LA2A 3H7RA 4BWLC 2J74A 2PGEA 5MKGB 4QEEA 3BURA 2HBVA 2J6VA 2DW6A 4B5SA 2A6NA 3TSBA 3VIMA 3CV6A 3XINA 3T40A 1G9HA 5FJUA 3CBWA 4JNMA 2BDQA 3EDDA 4LU0A 3CM4A 3BTNA 4TV6A 4HMDA 3LY0A 1M7PA 3GYEA 4AMAA 2PTYA 1QJWA 4PTDA 3Q45A 3L0GA 3I6EA 8TIMA 5CXPA 5HMSA 4M19A 4N9DA 1S38A 4X2RA 1XC6A 5KZEA 1JCYA 4K7VA 1H7OA 2J79A 3H8AA 3IANA 2R1MA 1S3TC 5DT7A 3UZYA 3THUA 3L4WA 4POCA 3NOEA 1WOAA 1R9ZA 4HT3A 4MY1A 3ZYZA 1XCXA 3GR7A 3MBFA 3GH7A 1GVRA 3UERA 3GG0A 4ORMA 4C5ZA 2DZTA 2A5HA 3B8SA 3NQ8A 5IDIA 5FJRA 4ICMA 3MY9A 3WMLA 4O0ZA 1UKQA 3N2MA 2YA1A 1IXQA 3N6HA 1OWQA 2DY3A 5REQA 2QJJA 4HMEA 2BLEA 4IFOA 2I14A 3A3WA 1G5AA 1XLAA 3ZLFA 3DUGA 3ITXA 3AFBA 1MNSA 4EP8C 1D2KA 3EPMA 3SFKA 3K13A 2BY0A 4KPLA 4PTVA 4U10A 1W3TA 2XIOA 1JCTA 4XZMX 3N4AA 3QW4B 5CG7A 4DWSC 4CD7A 1R2TA 3WJYA 1CXHA 1K7XA 2DVXA 1GJUA 4GVHA 2POZA 4DLMA 4UQEA 4TX9A 4Q8VA 4HMCA 3HG5A 2Y0FA 4TUFA 4E3TA 3REQB 1HJSA 1YNQA 4GVIA 2HJPA 3C2YA 3KS6A 3MTWA 3KDNA 3U8GA 3FNDA 2CXEA 3BUVA 4YIWA 4XWUA 3LCFA 2RDTA 5FSDC 2D2OA 1SJAA 4ML4A 2V81A 1RH9A 3T8LA 4MAVA 2GL5A 4LRTA 3NZ1A 1B3XA 4ZVJA 3ARSA 4FF5A 4RPQA 3ZQ9A 1B2YA 4UMCA 2YOCA 2V67A 1VJSA 4HZ8A 4IF2A 3CH0A 1C8QA 5J8LA 3OZPA 2VX7A 1MVYA 1DE6A 2ACQA 3M0YA 3CIWA 3ERPA 3T1GA 4B5WA 1EJ7L 4DUWA 4MUPA 1EGZA 1AJZA 1V6XA 1QW8A 1XDLA 1CGYA 3GHUA 3BSHA 4UNIA 1KNWA 4GGBA 2YL9A 2D3NA 4L4LA 3CTLA 4E5TA 3HGRA 2V5DA 3BARA 3R25A 3VM7A 2PA6A 5DMYA 2J8TA 1LL4A 3PJUA 4PR4A 5FF0A 5AHNA 1XPGA 2DH3A 3I4EA 4F9DA 2XGIA 4C6NA 1V02A 2ZX9A 1RQEA 4U28A 4E38A 4KWVA 1Q6DA 1BYDA 2PLMA 1OQFA 2DSVA 3HGOA 4KFPA 4B5NA 1P0KA 1JRCA 2C16A 1YMYA 5CSSA 2VMFA 3HG2A 1JGIA 4FXRA 4R7OA 3S2CA 4NI8A 2NQZA 3TTQA 2XWEA 4JTCA 2CERA 3CK5A 1TPVA 3CZEA 1H62A 1BYCA 3OBEA 4DJEC 3SSZA 1M6JA 3B0YA 6REQA 1NDVA 4GNJA 4FF7A 3L65A 3G18A 4OECA 2YCLA 3SQLA 3S5YA 5IXEA 4U2YA 2HE8A 1F5ZA 3GNRA 2EPMX 2Z1VA 1OY0A 4IUGA 4JTFA 3V18A 4UOQA 3DOPA 3B9EA 4R85A 1ESWA 2BOEX 1THFD 1LOLA 4UQBA 1NFGA 1ZCOA 3UWVA 2ZXAA 1X7FA 2H9AA 2PRLA 4D72A 4AWEA 4DWSB 3EZ4A 5U7SA 3DFNA 1XLFA 2Y24A 3R10A 1XLEA 1AJ2A 4UFMA 3OOQA 3CNYA 4RNJA 4WKHA 3QLLA 4BKNA 3UNTA 4OIFA 1EX5A 2DUZA 1XLIA 4H41A 3NQ2A 4WJ8A 3D46A 1Q6FA 4QROA 4FNTA 2PU1A 1OFEA 2W66A 4UWMA 1X6UA 3AMLA 4PEKA 2R6OA 4V33A 3MC5A 1NOFA 2B81A 1TTJA 2E0PA 4QP0A 2FB2A 2WWDA 2PPGA 2UWFA 3MSGA 1V0MA 3L4UA 2XVNA 1TUFA 3DFTA 3GTNA 2BY2A 1FBAA 5FEPA 4C91A 1N8WA 4HIBA 5C9RA 1JCMP 4AFYA 3VFLA 4TMCA 4FR6A 4U5IA 3C0JA 2I57A 1JZ4A 1R85A 1PKLA 2GLKA 4HCDA 3BW3A 2NXHA 3STFA 5FSEC 3AYVA 4XQ6A 1KBJA 3LHWA 3WK1A 3DERA 3DIPA 1M9HA 3RFAA 3HZ3A 3BLEA 3HPAA 3UJRA 4AZGA 3JZEA 2IXUA 3VTRA 1LWJA 2C71A 2XN0A 4IFKA 2RDUA 2EHHA 1JZ6A 1POKA 5HA7A 1E71M 3LCWA 2SFPA 4E0CA 1IWPA 5I02A 3G1XA 3GUWA 3KFTA 3LXBA 3TNBA 4H9UA 4NVTA 2G3IA 1G7UA 5AHLA 1PIFA 4Y90A 3XISA 4HJWA 1WZMA 5E6YA 2F6XA 5FL0A 2AAMA 3PUOA 3U9IA 1MEHA 4GJIA 1ZFJA 4QNEA 1QO2A 5LHEA 4X22A 3AXHA 3PB2A 2NWRA 3F4DA 2GDVA 3L4TA 3T0TA 1EOMA 4NSBA 2JKAA 3BVJA 4DN1A 3BO9A 1IZKA 3W76A 3DZ1A 1Z69A 4IP7A 4BA0A 2YXXA 1DP0A 4R88A 2FQIA 3FYPA 3VGEA 3TH6A 1QNQA 4ZO6A 2QEZA 2FFIA 1RCXB 3KRUA 1NP0A 4M29A 1UROA 1VEPA 3PZIA 4AZCA 3IUHA 1BYAA 3H12A 3TWAA 1HUVA 3H2MA 3QR3A 1A3XA 1ZBVA 4XX6A 3G8RA 4DHGA 1OYCA 3WK3A 3WBWA 3W2UA 1J0YA 2EAWA 3SCQA 2BOGX 1MWOA 4I9MA 1PAMA 1R2RA 1X8FA 1WAUA 4AX6A 2EPOA 1TO3A 5DBTA 3V5CA 2QJMA 1GJWA 1W3HA 1BWVA 4R53A 2VURA 3RO8A 3T08A 4UTMA 5HMFA 1MFUA 2P53A 3CL8A 3NL6A 1MQRA 2W3ZA 3M9YA 4H7ZA 2E77A 2XH4A 2Z27A 3MI3A 3VD4A 4CN6A 4U2ZA 3NL2A 4P5UA 3F2DA 4J1OA 2H8ZA 1J8VA 3SADA 4BFAA 4MYAA 4XD6A 4G7EA 2VOMA 3Q2DA 4B2DA 1QTWA 1Q7QA 1NWRA 4QJ1A 1CI1A 1G1YA 3LTPA 2OSXA 2V3FA 3HOJA 4B5XA 1HJQA 1HL8A 2E68A 2W67A 4DJEA 3KVLA 4LB3A 4B2DD 2PFHA 3B03A 1YDYA 1JL8A 3DHUA 3WH9A 4IQEA 4I9TA 4NYUA 4W8AA 3QC0A 5CPTA 1XRVA 2WNZA 4A21A 1E4IA 1H49A 4BK9A 5HMEA 1GJPA 5K7JA 1GCYA 1BKSA 4A8NA 4D6GA 4ZXOA 1JYNA 5E93A 4DM2A 3TR9A 1S5NA 2Q8XA 1BVZA 4X9YA 5E5CA 3SCTA 1EGMA 3ZVHB 4IOTA 1IT0A 2PDPA 1ITUA 2Y62A 3W84A 1QNRA 3M5XA 2I56A 5HNNA 3VABA 3EA3A 3C8FA 3T09A 1REQB 4NJGA 2HVOA 4HNNA 4MNLA 2E1DA 1NJJA 1UWUA 4TO8A 3KLLA 3V3WA 3LPPA 5C54A 1SW7A 3M7WA 4R5EA 1MEWA 3N3MA 1W5OA 1Y5XA 3LM7A 1NARA 4QBXA 4K1GA 3LXCA 2FTPA 4BI6A 3U6WA 1XIMA 5IRPA 4IIDA 2PLKA 4NG3A 3WSUA 3WFZA 4LUJA 7CGTA 3UZXA 3KWSA 2F8QA 3PJWA 4Z2LA 1JCLA 4GIAA 4H7CA 1GKPA 2CLKA 5GJNA 3DI1A 3ZWSA 5HAOA 1B3WA 2ZBTA 1EJWC 3RPMA 1RVGA 4EPEC 3U0HA 1S5TA 1S2VA 1GZ1A 1ZP4A 3W7NA 4GPNA 4ZSTA 3WQEA 2GYIA 2UZ9A 3QR1A 2CPUA 3L21A 4B91A 2G5WA 3W00A 3NL5A 5A6KA 1HJUA 5J04A 3UBPC 4RZ4A 2WBKA 5HBFA 4JKMA 4O52A 4XZHA 3M5VA 4HTYA 3A3XA 2GJLA 3HFTA 4NF7A 2FPYA 3FDKA 3NG3A 3W71A 1NVMA 4HNOA 1B0IA 4UNKA 5DQPA 1KFCA 4GIYA 1N8FA 3ZJ6A 3L2MA 2ZE3A 1W9DM 1TPEA 1M7OA 2Q01A 2WK2A 1OD0A 1U1JA 3ZOAA 3EX3A 1PZ3A 3L5AA 5CH9A 4A22A 3CHCA 3N6JA 2CBJA 1XH0A 2HS8A 5BRQA 4QE4A 2WMHA 4GOAA 3CMJA 1I2OA 3ABQA 3BW2A 1IWAA 1HO4A 4QFUA 4B4HA 5EMUA 3EEGA 3BE7A 1B54A 1EA0A 3M41A 2CXGA 4D6IA 3AS0A 4OBSA 4QE1A 4GY0A 3UJEA 2PC4A 3KOYA 3MHFA 5FIPA 5E1QA 4I7UA 3W7LA 3SRDA 2ALDA 2GK1A 4FB7A 4PC8A 4WK9A 4ATWA 1W5MA 1WXYA 3T7VA 3LLXA 1AODA 1E55A 5RUBA 4KCUA 2ZZ1A 1Q2SA 2NQJA 5A2AA 1DWIM 4GUIA 4MSSA 4JBRA 1W1A1 1ZY9A 1TE6A 4Z0SA 5KINA 1LQAA 1E9IA 3QZ6A 3R0DA 1GQIA 1FHUA 3E96A 1XFBA 1SQ7A 1A5MC 2NSOA 3HPXA 2QVNA 4GBUA 3WNNA 1KR1A 2H3DA 1E0WA 1QXLA 1FWBC 1A5SA 1J9YA 3BMVA 3CHVA 3NDZA 1K4GA 3FA3A 1XLMA 1FWIC 4DZ5A 2WHJA 1AL8A 3EPOA 1B90A 1GKQA 3EXSA 3UFYA 2A3AA 5T26A 4LAUA 3S1GA 2HVMA 2VNCA 1CLKA 2GGIA 2WC4A 4LCSA 3IJ8A 5AC6A 3L4XA 4BQ5A 4INFA 4H2CA 3HMCA 4O4VA 4JTGA 1O6IA 3C3UA 3C5QA 3OW1A 3PULA 5JU6A 1EB3A 2XPKA 1H3GA 2QUUA 1BD0A 3M0XA 3AIQA 4UR7A 1KTBA 3W7GA 3OZMA 1W1B1 1YPXA 4DLFA 5AYZA 4DUXA 3VNIA 3CLWA 4G9PA 4W89A 3NR0A 1WBJA 4IJBA 4K6AA 3ARPA 2GUBA 4M56A 1GHSA 2E40A 2XG9A 1XM3A 2X1RA 3GC2A 4JYDA 3EWXA 2PDBA 2EG8A 3B3DA 3B8TA 2OLHA 4PCTA 3F5JA 1IR1A 2VRQA 4P8UA 1KW1A 4MB5A 2VGFA 1X39A 4JHOA 1W8SA 1PX4A 1UOZA 4C6EA 4S3AA 4XZIA 3VE7A 4E2OA 1PYMA 3AHTA 2GDUA 1I2NA 3L23A 3AXKA 3H4GA 4M1BA 4M3PA 3MI6A 1NWUA 1RJQA 5HQMA 4IGHA 4IP5A 1OCJA 3C56A 4J40A 1Q6OA 3QRHA 2GGHA 4HA0A 3DYOA 1R3TA 4DBUA 1FWJC 2J7DA 4ZO9A 3I3BA 1DQXA 3NXLA 1ODZA 2CWXA 3RRAA 2VZUA 4PE8A 2RDWA 3HGSA 4IIHA 1JYWA 1H41A 1D7FA 2PTDA 1OZMA 4FR1A 1D9EA 5AB3A 3IIOA 2WLYA 3WH8A 3F4WA 3FFSA 1I9CB 3BH4A 4FNQA 5DEZA 3OODA 3HPSA 4ACZA 2XVLA 4DF1A 3C86A 1P1MA 4L6DA 1GQJA 1DWJM 1O5RA 1KRCC 1EPXA 2ABBA 4MZ8A 5LNSA 1V79A 3VMPA 3LLFA 2GJRA 1SMDA 2I5QA 2Z7GA 2B7PA 2P3ZA 2H3BA 4CVUA 5HANA 3M0MA 1E0VA 4EK7A 1RALA 1HZYA 2PSNA 3GR4A 2IPFA 4PFMA 2WSPA 3NQMA 4AU0A 2CWNA 4FO4A 4O8RA 4K37A 1R3QA 3VVGA 2IKHA 3F4NA 3NJ3A 5FJJA 3RDKA 1YNPA 2DZBA 2WV8A 3H21A 4K7YA 1PB0A 4OZOA 4M6PA 1IT7A 1K02A 3WZ0E 4MWAB 2VGGA 3QXBA 4PFHA 2NVAA 3QSRA 2VUYA 2ZVRA 1UR8A 2J7CA 1PWMA 5ABGA 1XUZA 3EMCA 3PZ9A 4ZQCA 1A0CA 2B7OA 4W4QA 3MZNA 4E8CA 3HIJA 3KRSA 2FVKA 2CLEA 4B3KA 3QW3A 3QTPA 4EKJA 2ODOA 5LIYX 4C7DA 1AW5A 1SFSA 3WLQA 1W3KA 5HJLA 1V6UA 2GVYA 4UQ9A 1C7SA 2CU0A 1BSIA 4MNMA 1Q2RA 2Z6IA 1QCWA 1JNDA 4ZEPA 4O11A 1EJUC 5HXMA 4I9AA 1O7AA 1XI3A 4NAEA 2OZ3A 1ADOA 2QDDA 3AYSA 3BLKA 1VFOA 1XIIA 5I09A 2QAPA 3DFSA 4LXFA 4ERAA 4L4OA 1GEQA 4IJRA 1VIZA 4I8YA 3N14A 1AJ0A 1YTEA 2OZTA 3VE9A 1FP9A 1CT5A 3E6EA 1XJBA 3KL5A 1DJXA 3AMKA 1IV8A 3UXIA 4DYKA 1N7KA 1QASA 4KIEA 1OIFA 5CPOA 5F7UA 2PI6A 1H61A 1RK6A 1OC5A 4PSRA 4R33A 1PDYA 1GNXA 1HGYA 2F61A 1GVOA 4P7OA 3GVWA 1V02E 2J88A 1JDDA 2PDXA 3G0SA 2RUSA 1XBXA 3ZT5A 3HA1A 1E6PA 5F1UA 1XYAA 1XD1A 3P61A 4UFIA 5DY2A 1SZGA 4O1BA 1XSJA 2BHYA 5A6TC 1PUDA 3ANYA 1V08A 3M0IA 2G97A 1CEOA 1IWBA 1RD5A 4NAFA 1UKSA 1QNPA 2Y7EA 1TMLA 1Q45A 4GXMA 1EPVA 3CUZA 3SM0A 2RH9A 5AZ0A 2XH7A 2CLMA 5FAJA 2X40A 3NQ6A 1UH3A 3I7SA 3M1ZA 3K46A 1JDEA 3UXDA 5C2CA 3PBYA 4IMCA 1J2WA 3USBA 2E9BA 1HT6A 1UWSA 4JQAA 2DFAA 4AY7A 4Q8WA 1DORA 2WHMA 2GUUA 1CWYA 1V0NA 4JOMA 3MKKA 2Y6ZA 4N7QA 4WX2A 3TN5A 2B31A 4C6QA 3QV8A 3OB8A 1OFPA 5IHRA 4K8GA 5CPLA 4LAOA 3PZTA 2YBVA 3G22A 1RPKA 2Y63A 4F0RA 3WNPA 3AMDA 1KQYA 4M0XA 5A95A 4S3DA 1GYNA 4YWIA 1YX1A 1VCFA 1V03A 3I3DA 5FCZA 4ADUA 2OOGA 4NNCA 3T55A 2WJFA 4I3GA 4JL2A 2OOFA 5CPMA 3PY2A 1CZ1A 4E3VA 5A6BD 4EX4A 2WLZA 4DUVA 4EXQA 4FX6M 1TKKA 2HK1A 4JX5A 1FWTA 3HURA 2W9MA 2NXGA 3E2QA 4QLJA 1DV7A 3TE9A 3DGBA 1K8ZA 1M68A 5IBXC 2J13A 1NDZA 4RZ6A 3TFCA 5F2LA 2FZ9A 4IMFA 1VYPX 3GNDA 1YE4A 2PS2A 3AIBA 4MOZA 1UW9A 3TA6A 3AC0A 5AHEA 4EOUA 3WDQA 2WHKA 4GXWA 2TPSA 1EWEA 3GG1A 4O14A 1QI0A 5JBFA 3UZZA 1OCBA 3H2AA 4F0LA 3G1DA 4M24A 2CZDA 2YL8A 3UG4A 3L0NA 3K4WA 5BXRA 2JKEA 4MYXA 4E4UA 1GQNA 1BRLA 3CASA 3II1A 1K7EA 2DT1A 2I9UA 2E8ZA 1SUXA 2V2HA 5LXEA 2D24A 4Y9OA 4FSAA 1FXPA 4L7ZA 4DXXA 2ZRVA 3KHJA 5CGQA 3RAOA 3WEMA 4IUOA 3LS9A 1BGAA 1XS2A 3N15A 5J5RA 1Q3NA 3EDFA 4FLRA 2WCAA 4PB3A 2WSYA 1W5QA 3R12A 3OLIA 1WKDA 4LALA 2VR4A 3EMQA 4JTQA 1TVNA 5CKSA 1F4AA 2D2JA 4XO7A 1AD1A 4LBSA 3S2MA 1HGWA 3ZIZA 3WF3A 3TYAA 3VNKA 1JPIA 3FAXA 3IARA 3BCDA 2DUXA 3KRZA 3GU1A 2C7FA 4H04A 3WLKX 1KM0A 2E5DA 4AZIA 1EYEA 1O95A 1AK5A 1EOKA 3PUDA 3UWEA 3DAQA 1U1UA 3CO4A 3NQEA 3IJQA 4ZO7A 3SJ3A 4O15A 4XTIA 3CHFA 1LUCA 1FDZA 2NLIA 3LRMA 4RNIA 1KCXA 3W7JA 1TRIA 2QJIA 4P61A 7TIMA 4HJFA 3N18A 2VFGA 3EX1A 4HYVA 3M44A 3NOYA 2WPGA 2PWFA 4JNZA 1HJVA 2CIPA 5EBUA 4NNAA 2PCEA 1DWHM 4KEMA 4MDOA 3ZSSA 3NPXA 4N4QA 2WJEA 3O7UA 4MNKA 1UD2A 4D6JA 4GBDA 4F48A 3PZOA 1J0KA 2GQAA 4CD8A 4LVGA 3UF9A 1Y65A 3OPSA 1IF2A 4J5NA 2BGSA 1W1ZA 1XYZA 3QQWA 2WAGA 4HZ6A 2QCEA 2WMKA 3W1PA 1XIFA 4LF1A 3BG9A 2PDHA 3URAA 4GUHA 2XWDA 2EQDA 3N9RA 3SZ8A 3L4ZA 4UOJA 4XAYA 1W6TA 1TTQA 2XINA 1JYVA 1Y7VA 2OR2A 3GDMA 1SZRA 3S0CA 1JPMA 1TTIA 2PAJA 3F5KA 1ME8A 3QR0A 2OYLA 1GT8A 2E3ZA 3S6TA 3WJXA 1DJNA 2UY2A 3SIMA 1Y8BA 1U22A 1JUEA 2P76A 2ZIDA 2J8FA 3CUXA 1ZSXA 3EB2A 1EP2A 5I77A 1XLHA 4Y6GA 4O1DA 3M0VA 1N2VA 4ZB0A 2YB4A 3R8HA 4AXNA 1RK5A 1ZPTA 2DV0A 4GCXA 1F3EA 4HK5A 2Q02A 2C14A 3UJFA 2AKZA 3IJ6A 1BTMA 1QMLA 1OM0A 1NQKA 1ZQ5A 4H19A 5T8GA 2ABAA 3LENA 2YXOA 4IQJA 3CIVA 2ZUWA 4GFSA 1P7TB 1L6YA 2PWVA 2FB3A 4QJ4B 2PP0A 1AH4A 3GG8A 3L68A 5M2FX 4P8VA 4ZMGA 3BQ6A 3F5LA 3MO4A 3HTWA 4M80A 1BXCA 4FP1A 4JCLA 4RDZA 5D9NA 4UZSA 1F4HA 3PANA 4NZCA 1F8IA 3N04A 2PGRA 1CLXA 4DM1A 1YBQA 1CW2A 3GB6A 1A5OC 3VOFA 3WBAA 2P1FA 2WOQA 4LB4A 2DUAA 1KQZA 1EF3A 4H9ZA 3OIXA 3ENLA 3B9OA 4O18A 1DIKA 3OLDA 4LUTA 3UWQA 2ZUNA 3ARZA 2JALA 3S1UA 3TJXA 4GRSA 1KFKA 1A5LC 1EO5A 2A1YA 1XWYA 3VD3A 5JUVA 3SRFA 2J27A 4AB4A 2TODA 2IUZA 3RU6A 2Y7FA 2WZEA 1JCXA 2P88A 4AW7A 3GDBA 1FH8A 4YL2A 2ZZ2A 4O28A 1BWKA 2I5IA 2CC0A 2VC5A 1QBBA 2QMKA 4LYRA 4WY0B 3WY1A 4DWSA 1S5WA 2GGJA 3F4VA 3GXIA 3P14A 1XPYA 1BG9A 1B3ZA 2Z24A 5KZ6A 3LHTA 2PDGA 3AIRA 1W0MA 4RE0A 4IP4A 4DZAA 1VR6A 3GY1A 3H54A 5BXSA 1JD9A 4H6EA 3WNKA 4MIMA 2OWXA 4X9SA 3GM8A 3R13A 5DXYA 3M46A 3MJMA 4JY9A 1V7AA 1UH4A 4LS0A 1B4KA 1H7PA 2HNHA 2XN1A 3KZPA 4H9VA 4IIFA 1QHOA 4OBRA 2E28A 2D0HA 3N2TA 1V8EA 1KXQA 2C91A 3TMQA 4PRWA 1U1HA 1MFVA 1GZGA 2NQLA 2V63A 1K3UA 3F1QA 2QJHA 2ZOXA 4LWWA 3U2ZA 4QITA 3I6RA 2R1NA 2R24A 4UIOA 2A21A 3VIIA 1KC7A 2OQHA 3BLOA 4LUSB 3F7JA 4DYEA 4DJDD 5A8PA 2REQB 3OP2A 1LYXA 3IIPA 5I78A 3FEQA 3M47A 4J3TA 1JYXA 1BXNA 3KCJA 2BS9A 4AD4A 2ISVA 1CLVA 4N9CA 2R9RA 1JI2A 3APYA 1PZ2A 5JBEA 1OCNA 4Q32A 2YIHA 3WMSA 1C9DA 1I2RA 1SW0A 2VEFA 3MQTA 4REQB 3KBMA 3MUXA 1US3A 4JQ1A 1E1EA 2ZA1A 2C18A 1RQBA 3OA5A 4R7JA 2E6DA 3L67A 5D2WA 2VDHA 3LLDA 2E5BA 4F0KA 5JIWA 2QDEA 3KW3A 4HOZA 3GVVA 3WLNA 4F9JA 2VJXA 1D3HA 4PUNA 4A3HA 3TAKA 2XN2A 3A4AA 3TQ0A 5AHFA 3M0JA 5H8UA 3M5YA 3VUSA 2CETA 1TA3B 2AGTA 4O53A 1ZNNA 3WX7A 2RDXA 3T42A 8A3HA 2UY3A 1FWRA 4C6PA 2QCDA 4PCFA 4S3EA 2NQHA 2BY1A 3H7UA 5E09A 1OK4A 4M5PA 1JVNA 1J0IA 4OKDA 1A4LA 3ONCA 2OZ8A 4KW2A 1H50A 3THQA 3WD3A 1GVIA 1FY6A 3AHYA 2YL5A 3RCYA 2P10A 4LH8A 1RY0A 2FGBA 3EAUA 2PDIA 2BOFX 4UTTA 4JXCA 5D2VA 5LIUX 2A7NA 1ENUA 3A9IA 3SCPA 4MMWA 1HVXA 3BLDA 4AG0A 1YADA 4FS9A 2BASA 4NI3A 3VXGA 1DJGA 3FW6A 1PV8A 1KBLA 1ISWA 2CBVA 4FHAA 3SCSA 1V3JA 4AZBA 2VRJA 3K8KA 2HQAA 5GNYA 1ZHAA 3L5LA 1TPWA 4O0QA 4XVEA 1GW9A 3MKCA 1R3RA 4UTJA 3LHUA 4BF9A 4IWWA 4PULA 4GZIA 2C19A 4JX6A 1R7OA 3B06A 2VC6A 3R6IA 1R9XA 3EKZA 1Z44A 3GHTA 1VB9A 1H1NA 2W6RA 1WDSA 4LVDA 3MA8A 4L6HA 4W87A 4JKLA 3AJXA 1CGVA 1EC9A 2PE4A 2Y70A 4IL0A 5JQ9A 4E2VA 3UETA 5C6MA 1YDNA 2V0TA 4ZB5A 3ES7A 1PIGA 4PL2A 5CLWA 4MB1A 1WX0A 2DJLA 1X1ZA 2A3LA 4XD5A 1Z41A 3LNPA 1UKPA 3W22A 1FWAC 1HL9A 1GVYA 4FXFA 5H6HA 2QJNA 2FJUB 5HINA 1F7BA 4KGLA 1K1DA 2QF8A 6A3HA 3INPA 3M16A 4UCFA 1Z3NA 5C8BB 4UMBA 3AXIA 2DQWA 3D47A 4RPPA 3NYZA 5BZAA 1WXJA 3AALA 2NQ5A 2XIIA 3LM3A 1MZHA 4G1NA 2WZTA 3CUHA 4A8RA 3EOUA 3R7MA 3OLEA 3THAA 1G4TA 4B9ZA 3TN4A 3CQ0A 3G3DA 5AC5A 4P7LA 4GHRA 2G8ZA 1A5AA 5HNTA 1EUAA 5EFFA 3ABOA 1UKTA 3QM3A 2D2HA 1OD8A 2QUTA 4WDTA 3RU8X 2X1IA 1W3IA 4DBEA 5LNWA 3CB3A 2PDQA 2ON3A 4NUWA 4HPHA 2ZXDA 3S2LA 1PKNA 2WKGA 5LHFA 3AYTA 3GH5A 2CLIA 4NX5A 3BAXA 4LSBA 3LCLA 4PUEA 2VFFA 1XCWA 5DT5A 3TN3A 1MI3A 4GACA 1SO4A 5LNVA 1QOPA 2WVVB 1UMLA 4ML9A 2PEVA 5A6JA 4WVXA 4D8AA 3OYZA 4UTLA 3LHYA 4G1KA 1O94A 1JI1A 4DPQA 1XBZA 5A6LA 2V30A 4IMEA 5E70A 3SW6A 3KLKA 1FKWA 4E8GA 3FJNA 1HKIA 4O0KA 1JPDX 2F6KA 3O2LA 2PP3A 1BKHA 1I75A 2VQUA 1L6GA 2D20A 3O15A 3TUUA 1TSIA 2PUZA 3PNZA 1UPPA 4HHLA 1GOIA 4RDVA 2X05A 3S1WA 6REQB 1H5YA 5AYBA 1V77A 4YJ5A 2FH8A 1GOMA 5H2ZA 3E12A 2NQ9A 3HM7A 2J7EA 1H60A 1S2TA 1PCKA 2DZXA 1ONEA 5A69A 2G3NA 3QY6A 4DO7A 5D8ZA 1IXOA 3SQMA 3PAOA 3GTHA 5CSUA 3W2JA 1L6SA 5HK4A 4ZE5A 5GPRA 1ZJIA 2O9OA 4AY1A 4D8ZA 2QR6A 3DBNA 4K36A 3VPLA 3SB0A 1M7JA 4EXBA 3RLHA 3S5SA 2OPJA 3RLVA 1S1RA 4X60A 2VZSA 3WQDA 1T5AA 3ALGA 2WMFA 4H83A 4LS2A 1CCWB 1VQTA 2WMGA 4AXKA 3WLIA 2Z00A 3AU6A 4KCTA 3W7CA 4YCPA 1ZBWA 5AYIA 2TRSA 1LL6A 2WMJA 3PR2A 5GNZA 4LX4A 1M41A 1YXDA 3SCRA 4TTGA 4UTWA 1VBUA 3BCJA 3NYDA 1RJPA 1VJZA 1AQ0A 4JNYA 2NW0A 1XP3A 3BMXA 1V6TA 4K39A 5HJXA 3VNMA 4CD5A 1K8XA 1OT2A 3CC1A 5XINA 3AROA 1W1PA 2QUVA 4A2SA 2ZUMA 4UBPC 3ZLGA 4GVFA 4RXFA 2ICSA 5KETA 2C1IA 4O50A 1XKJA 4IH3A 3IAQA 1DXIA 3STPA 3P2VA 3DFQA 2GOUA 3VA8A 3MDWA 4OOUA 1AG1O 5I3DA 3V4BA 3TYZA 3NZPA 4H4IA 3W29A 2MANA 5DANA 2PGWA 2WPBA 4Q6JA 5D02A 2VEIA 4CN4A 3IJDA 1V3IA 1UZHA 3A4JA 5M3WA 1K9EA 2PWHA 3KP0A 3RLUA 4MVAA 3TP4A 4IFKB 2ZUTA 3TJIA 1J93A 2EPKX 3N19B 3WDRA 3NZGA 3AUJA 3KOWA 2WQPA 4O54A 4C1KA 3ZR6A 2I5GA 4BZYA 3DYMA 3HU7A 4WSJA 4QCFA 4DBDA 1J0HA 3PP7A 2NZLA 3EDJA 3P60A 4DQWA 3H24A 5IOBA 1JFXA 1BQCA 3EWUA 3LPOA 3VCRA 5K4ZA 4JTKA 2ZCGA 1HKMA 2A3HA 4CKQA 1H0IA 1OB0A 3RR4A 3BC9A 3EXTA 4X63A 3EPNA 4BR1A 1H1YA 2Y2WA 4HYWA 2VD8A 1FWGC 2VL4A 1AMKA 1B5TA 3WFAA 4X0NA 3CWOX 1P6WA 4YN5A 5T9BG 3KVJA 3EYPA 3PJXA 3AHZA 2G41A 2FFCA 3UZJA 4GFIA 3IUDA 1CGUA 4XB3A 2H90A 1XF0A 1EGVA 1MRAA 1NTHA 4MDPA 3VX1A 4JFSA 4QEHA 1E73M 3H4XA 3O9NA 3P0WA 3UNDA 4RKAA 4D1IA 3L66A 5C7HA 2PTZA 3I10A 4O57A 3OVPA 2Z0IA 5L9FA 3RX4A 2ZYFA 3NQDA 4ACZB 1Q4WA 1JZ7A 3L9CA 2HNEA 1BEUA 2HISA 3TXZA 1I60A 1OINA 2VR2A 4H1ZA 3QV7A 1M53A 2JF6A 5FJTA 3KVKA 1ZBKA 3RNDA 3DFOA 3C2VA 3LQLA 2YLLA 1M7XA 3B8UA 1MO0A 2VZVA 4LBRA 2D0FA 4K8EA 4AZ6A 2A6LA 5JMUA 3IIZA 1S46A 1E72M 4JR5A 3QZEA 4MPQA 1KM4A 4Y96A 1WKYA 2W27A 3SR7A 3L5MA 3WNLA 3Q37A 1KGUA 2RJGA 4MWAA 4TMBA 4QG8A 1KLZA 4JIHA 3G5EA 2PF8A 3UCDA 2C13A 3SFWA 5IDZA 5FEWA 1RBAA 4W8BA 2ZVIA 3W1XA 1W9XA 5TAOA 4Q7IA 4P7QA 3UZWA 4QM1A 3RCMA 1JGMA 3N13A 4IIBA 2DT3A 3QKEA 4RNFA 1YRRA 4HHPA 3TCEA 4RE4A 2WVSA 3G6MA 1BVNP 2VENA 1ZALA 4JFVA 1Q65A 5A8OA 2AQOA 1QAPA 3PM6A 3BV7A 1W9VA 5BMWA 3LTSA 1SZEA 1XIDA 3BG5A 4L61A 5F2MA 4JTAA 3NM1A 2NSXA 3U2OA 2DGAA 1ZRQA 3AZTA 2PMQA 3VM5A 4H6RA 3VIOA 1A80A 1I8JA 3AS1A 3VKBA 3ARQA 4WR3A 3NGFA 2CLLA 6PTDA 2FGLA 1WPCA 4D6HA 1E6ZA 2ZX5A 3W82A 2W79A 2DVTA 3CV7A 4LY4A 3B40A 4FNPA 1GQKA 4IPIA 1XG4A 3NPUA 1DQUA 1RA0A 2QZRA 2A85A 4WSHA 1W1VA 2X2YA 4I7WA 3S9IA 1PKYA 3C2OA 4NZ5A 3UPWA 3W85A 4Q7BA 1X6NA 3E2RA 4Q6XA 4N6EA 5EKYA 4HBKA 1C91A 4UC5A 5D03A 3DI0A 3TC3A 1U5HA 5LSMA 1BF6A 2WZHA 2JGYA 4WLCA 1KKOA 2AAAA 2AL2A 1EX1A 3RILA 4DJFC 5BCAA 3NZRA 4TTUA 4MZ1A 1GPWA 4WEVX 3GTFA 3IJ9A 2TYSA 3AISA 1UASA 2YPIA 1F2JA 3FCPA 1GVSA 3QEZA 1JD7A 4HPJA 3AIEA 1RLCL 5FF3A 1YXCA 4L1GA 1EKOA 1SW3A 3A4WA 3WL1A 3GR8A 4N9EA 2VVNA 2OJPA 1DIOA 3GXFA 1XLCA 2IPWA 1Y0EA 4GNKB 1CXLA 4S3BA 1N82A 1G4EA 4AIOA 1ELSA 4EAYA 2EJ1A 4IGSA 1G01A 2HVNA 1WXZA 3QY8A 4XZBA 2ZTJA 3QKZA 1A5CA 3N29A 1C29A 4W85A 3SEPA 2QIWA 1LT7A 3U4AA 4I7VA 1NEYA 5EYWA 5IFTA 3LQGA 4AYSA 2EPLX 5C7VA 4UZUA 2JE8A 1HX0A 4HU4A 1C7TA 1CGTA 5CEWA 1ONWA 5D2XA 2X09A 4YTUA 5CJ5A 3VGDA 1H2JA 2Y89A 3SRKA 5LNUA 3LRLA 3QQ0A 4D1JA 1KV5A 5LGZA 4J27A 3E5PA 4JTSA 4ZOCA 2XIJA 1W2VA 4ZENA 3FV9A 1Q7ZA 4RNHA 3WMBA 2YDSA 3GYCA 5I2UA 1FA2A 4GH1A 1SO6A 3NDOA 3W38A 5FEZA 4R9XA 3W6LA 3GC4A 1F05A 1GGOA 4ZR8A 3TW9A 3EOSA 3E02A 1RVKA 3QLDA 3UR5A 3H23A 2ASHA 3BPWA 3VAVA 4HVXA 4H6QA 1PHQA 1XD0A 2R1PA 3UYIA 2AMGA 1E51A 4PMRA 4C6BA 3F2CA 1LLZA 2ZC1A 3BOXA 5HULA 2ZZ5A 4LT9A 3BAYA 1T8XA 3FEMA 5DN1A 4DEFA 4DJFD 3E49A 5XIAA 1JAKA 3PWAA 2WB5A 3GK0A 2JIWA 1A0EA 1E9LA 3B0VC 2X1SA 5CSYA 3SN1A 4KH2A 3PHAA 3GX9A 1PTDA 2VHLA 2B7NA 3HQNA 3WUGA 1BRLB 3TZFA 1QR7A 4JGDA 1JXKA 1A4MA 1XYCA 1DBTA 3SRHA 1QO5A 2AMXA 4QRNA 5EFDA 2ZZ7A 2D2GA 1DIDA 3WLTA 4KEVA 2FTYA 2NWSA 3QY7A 3V75A 3CPGA 3N4FA 1QW7A 1OF8A 3MYOA 3UR8A 1CPUA 3BL3A 3W02A 5ABFB 3UG5A 1LDCA 4XAFA 1ME7A 3VOJA 3GE7A 3DKLA 1TVPA 4Q8TA 3PSWA 1CXEA 1A50A 1JCNA 4KKXA 1R87A 2BY3A 3BZGA 5AKQA 2F7FA 5EGRA 3AICA 3SI9A 4IIEA 1TELA 3ABSA 1UYQA 2YCJA 5FF4A 1O5QA 1W9PA 1LQ0A 3K5XA 4B3ZA 2H8XA 2WSQA 2CZ5A 2GUYA 4JL1A 2D1ZA 4XSMA 1TR1A 1BTCA 2XISA 4GZEA 4PTWA 3GZ3A 3CIXA 1KTNA 3FS2A 3R43A 4H8NA 4O10A 4XBSA 3EA2A 4YHEA 3WLHA 3VX0A 5A8MA 3FIGA 3CV1A 1C9WA 3PBUA 4F2BA 4WKFA 4F66A 4HCLA 4L65A 4KT2A 2ESCA 4XD3A 1MNZA 4AEOA 1DJYA 1RV8A 4PSPA 1PDZA 3V7PA 5AN7A 1WP6A 5AZ1A 1K6WA 5J5DA 3PPHA 5SWUA 1JF5A 4HNTA 4GXPA 1JJKA 3TSMA 4GWEA 4WJEA 1JULA 3KL0A 1X98A 4PUWA 2X8RA 1YIXA 3E2VA 4NZ1A 2PDKA 3CQHA 2WMIA 1L2QA 3PC0A 3CXOA 1LJYA 4DJDC 4AAJA 1X97A 1XR2A 2PBOA 4JDYA 4ZQNA 4HP5A 1VBHA 4FLQA 1PPIA 4TOQA 5LIWX 1L0PA 3FXYA 4YTRA 1E5JA 5D05A 2F38A 3GDRA 1FX6A 3YPIA 1QHZA 2ZRZA 3E2SA 3TWBA 3TCSA 4HK6A 3GUGA 3CAQA 3N2BA 1JPHA 4WQ6A 3S2JA 1KM2A 2I17A 3QPEA 3KM8A 4Q3MA 3LI0A 1Q66A 5HATA 1KR0A 4LF2A 1V0LA 4LVAA 2GZXA 3MPGA 3QN3A 3PTKA 2J9ZA 1L6WA 3WJWA 2OGYA 3I7RA 4E2DA 3W7RA 3JW7A 3PJTA 3CHEA 4ADSA 4NIRA 3PFMA 3IVSA 1AA1B 4ICCX 1P7TA 2XIQA 5BOFA 4GA8A 4PMUA 4C6KA 2Y1HA 4O1CA 1J12A 3P93A 1BF2A 3ITOA 3EDEA 4GVGA 1YEYA 3W81A 3GU9A 3VZYA 3S6OA 2O55A 2EKGA 2HRWA 1YBQB 1FRBA 1LM1A 3LGDA 1RR2A 4PBEA 2YZRA 5BOEA 1FP8A 4JTHA 3MUIA 1KFWA 4GC4A 2G0WA 4JQ3A 5CZSA 3EWBX 2JEQA 4H7VA 4I6KA 2OFJA 2WCSA 3ZLHA 2WZIA 3KBNA 5EBAA 4QQUA 5C2GA 3L2IA 1TCDA 4RL3A 3VD5A 4PUKA 1KCLA 2WWCA 2O4QA 3BOFA 3TIMA 1VGAA 3UG8A 3LGGA 3HB9A 4E8DA 4KEUA 2DPEA 2X0SA 3FSTA 2Q09A 4N6FA 5EMMA 3E74A 2ZUUA 3ABRA 4FX8A 4DO4A 5I3KA 2R14A 1OSEA 2CITA 1MW2A 3WF1A 3W9ZA 4WD0A 1HKWA 2XJ7A 7A3HA 3IEBA 4XKYA 3ARRA 3QGVA 5GQBA 2VRKA 4FMVA 5DCBA 1WQ5A 1CECA 1KM5A 3N1AA 4QR6A 5E0KA 1V5XA 3P81A 4NILA 2CW6A 4NAFB 3HG3A 2G3MA 1NOWA 3QV6A 4GY7A 4HPGA 5CPNA 4DF0A 3GIQA 3VCNA 2PDUA 4H9XA 1T96A 2GQ3A 5D37A 5HWJA 2RGLA 3A13A 3UD6A 6TAAA 3W7MA 4K1WA 1A53A 4UFLA 5H8PA 1JIBA 4Q4PA 3T81A 3LU2A 1ECQA 2F2KA 3W25A 2EPNA 3JR2A 2QNEA 3GZAA 2ZKMX 5B80A 4MZYA 3C0LA 1SZFA 2REQA 3S9YA 4MY9A 5M03A 3T44A 4XZLX 1ZCCA 3W7IA 1QPQA 4TVDA 1BWLA 4YXGA 3W2NA 3HFYA 2NLYA 3SN0A 5E6ZA 2IQ0A 3N3TA 3O8AA 4LYPA 4ZFMA 3KZSA 4I5UA 1MXSA 4KCVA 5CZ0A 4REQA 2Z1XA 5AYXA 4HNVA 1GEHA 1P0BA 2XGZA 4FAMA 1VH7A 2CZVA 4QGCA 3STEA 3TTYA 1FCUA 2O9RA 3A47A 5FA5A 2OB3A 3FY1A 3C6CA 3EDKA 2IPJA 3RPDA 3UG3A 1Z89A 2PDYA 5E0CA 1Y5VA 1AFSA 3VKDA 3ABZA 3BSMA 1AH0A 3JRKA 4KBXA 3STGA 3GKFA 3PAJA 2FTWA 4XUGA 4DO5A 2J7FA 1HL2A 3IJ7A 1W91A 4Z0JA 4L6OA 2G3FA 3RF9A 4QG9A 1JDCA 2IQTA 1P4CA 2YCLB 3IK2A 3WD1A 4UTWC 2QW5A 3AJ7A 3VGBA 3WEZA 1H5VA 2RHGA 1VBJA 3SGGA 4GZ7A 2VGIA 1EIXA 3BAKA 1J79A 5TF0A 3PZQA 5CAKA 1EFZA 1ZLPA 5JXQA 1C90A 2WM0A 2Y8KA 2R91A 5BXPA 2CEQA 2H9AB 1J4EA 4A05A 4PB5A 3M0LA 3V5FA 1QWGA 1OK6A 5FJOA 3IUIA 3O06A 3O6DA 3KP1A 4IZGA 5D9PA 2A0NA 2W0UA 4UNLA 5AVNA