3M5XA

Crystal structure of the mutant v182a,i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
219
structure length
212
Chain Sequence
b'RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGPGETLRFADAAIVGRSIYLADNPAAAAAGIIESIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase
source organism Methanothermobacter thermautotrophicus str. delta h
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
total genus 83
structure length 212
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m5xA00
1KFKA 4RR4A 3MBDA 3HB9A 2V9DA 4WX2A 3UQNA 5HR7A 1LRNA 5KMYA 4QAIA 1TPH1 2OT0A 2GVGA 3G1SA 4Q33A 1C8VA 5LNVA 1EP1A 3ABQA 3STFA 2CLKA 3W7MA 4M7SA 1XBZA 2DJXA 1K02A 5BRBA 3W73A 3LHUA 4DO4A 4GUJA 1KFLA 1VH7A 1SW3A 3TUUA 5CZJA 3BGJA 3G0XA 3LLDA 3RF9A 5K9DA 1SW7A 4YCPA 4JICA 5CKSA 1EWEA 5L9FA 3DHDA 4A3UA 2A6LA 3G0UA 3M43A 3M7WA 2P0OA 3E49A 4I7VA 1Q45A 4FXSA 4O4WA 1R30A 3O63A 3VI2A 3NZRA 3EX4A 2ZDRA 3FLUA 3M16A 3SGUA 2NWSA 1JVNA 2Y7FA 3PF3A 3UY8A 1H5YA 3L5AA 3FIGA 5DLCA 1JRBA 3O05A 1YDOA 2R94A 3I68A 4N6FA 4Z0SA 4NJGA 4JX5A 1AW1A 1K03A 2NXHA 5D38A 2J9YA 1BKSA 3R13A 4UTJA 1K8XA 5DXYA 1AL8A 3CU2A 3DXIA 1TPC1 4ORIA 5EA9A 3LBCA 1XKYA 4JNMA 3IIVA 3UPWA 3W86A 2X1UA 2Q3RA 2QCFA 1RQHA 3MHGA 1DL3A 1AL7A 1TQXA 3VCRA 4R53A 1AG1O 3QMRA 1H7RA 3TIMA 5H91A 2PRMA 5F2MA 3W75A 3GXPA 5CZSA 3P7YA 4LC6A 3MP4A 3ELFA 5A8GA 3NQ2A 3BV4A 1O4UA 1QWGA 3W2JA 5EY5A 1TRIA 4LT9A 4IX0A 1H50A 1EEPA 1FBAA 2A1YA 2VEIA 4IMEA 2VFGA 4AXKA 1L6YA 3I65A 3TW6A 3KX6A 5F4SA 4K37A 2A7PA 3QW3A 2ABAA 2OT1A 2B7QA 5E0KA 3LV6A 4WUIA 5AYYA 4MOZA 1HL2A 3W71A 3IVUA 3M0ZA 1GVQA 1TV5A 2WPBA 1OF8A 3HGJA 1MXSA 4CLMA 4MLRA 4MPQA 3QF0A 1H61A 3W74A 5HMSA 3L0GA 1SO3A 2FB3A 3HF3A 3NQCA 5DBUA 1ZALA 3TXVA 1JCJA 3JS3A 1OYBA 3UZ5A 1NAL1 3G24A 3W7GA 4GRSA 2FPVA 2DZUA 1KM2A 3CC1A 1IXPA 5D02A 1M6JA 1P1XA 1GT8A 3NPXA 3LI1A 3QMSA 1OX4B 4ZQPA 2G96A 5J5DA 1FDJA 3IGUA 2LLEA 2NXIA 1XXXA 3GDTA 3LTPA 3PG8A 3OEXA 5FESA 1R2TA 3W1AA 2ZRVA 3RNDA 4IQLA 2DZSA 2DZVA 3PULA 2WKJA 1EP2A 4JTJA 4A21A 4LVFA 3G1FA 2FDSA 1TPB1 1LBFA 5EMUA 1ML1A 3MWAA 3M1ZA 3UWQA 2GQ8A 1TJPA 2JGQA 3IRDA 2P1FA 4UTMA 3NYZA 3S1UA 5K9XA 2HS8A 3LCXA 1WYIA 4XUGA 1K8ZA 5EKYA 2Q8LA 1FWRA 2VFEA 5E93A 5D37A 5LGZA 3A24A 1JUEA 4EOUA 4ZL1A 1QPOA 4JTFA 1BWKA 3C56A 2J27A 2QAPA 4NQ1A 1GJPA 2ZZ2A 2Y89A 1W3IA 3NZ1A 1TTPA 3NQMA 4Y9AA 1KFCA 1LLWA 4GE8A 3W84A 3UWYA 3S5NA 3AJXA 3LCHA 3KOFA 4WY0F 3W7PA 2ZYFA 1FDZA 1FCBA 4J9JA 3HG5A 1QOPA 2RKXA 3NG3A 3W9ZA 3OVRA 2NLIA 3JRKA 1ME9A 4GWEA 1TMHA 3BGGA 4HNTA 1DVJA 5AOUA 5KSWA 4MFEA 4IXHA 4EF8A 1F6KA 3TAOA 1KM0A 2ZTKA 3GYEA 4HNUA 2D73A 2ZA2A 3A22A 5C54A 2ZQ0A 3A21A 2RDTA 1KTBA 4TX9A 3UPBA 1CX9A 2TRSA 2A0NA 3WJWA 5BMXA 3CQ0A 1OFBA 3ATYA 3OBKA 3EWZA 3PUDA 3G8EA 1ME8A 3D0CA 3C4UA 3C2EA 3MHUA 2OZ0A 3CPRA 2CWNA 1T0OA 3UXAA 4MUZA 3EEGA 3B0PA 1W0MA 4HSNA 2HTMA 3M5YA 2CZFA 3IIPA 1G4PA 4K8EA 1EUNA 3BLEA 4Y8FA 2YYTA 3TQVA 4XKYA 4YLWA 5AHFA 2C15A 1OX5A 4O54A 4FNTA 2TSYA 4K7VA 4OGZA 1TRDA 4DPQA 5G2WA 3DFNA 3CB8A 4OV9A 5I3FA 3TX9A 1C9DA 3W1PA 3S1WA 4UFLA 3W7OA 5K2ZA 4IPIA 3GB6A 1ICPA 4Q4KA 3DBPA 4QITA 5FF2A 2Z6IA 4CCCA 3W6YA 3GR8A 3SIZA 4I9AA 4M6QA 3N9RA 1WOAA 1SZFA 3IIXA 2QCDB 1QFEA 1TJRA 1PE1A 4R34A 3M44A 3O1NA 2A7RA 3SJ3A 2YR1A 3EWYA 1UASA 1DJNA 1MSSA 1WBJA 3KRSA 1IIHA 3O15A 3T78A 3U2OA 3QPYA 1NFBA 2F7FA 3TXZA 1J2WA 1O95A 2EKCA 2ATMA 4A2RA 4X9SA 1ICSA 3NPUA 1DORA 3CT7A 1A53A 5CG7A 2FPYA 4M5PA 3HG2A 4O15A 3N14A 1K7FA 1VQTA 4ML9A 4NJHA 4UFJA 5G2IA 4N02A 3MHFA 3M41A 3SGZA 3UWWA 1Q6RA 4JYDA 4IXXA 4NNCA 3TW7A 1K3UA 1TB3A 7TIMA 2DZPA 3R5EA 4OT7A 4UMBA 3RMJA 4DF2A 3BK0A 3EXRA 2E5BA 1M7PA 4JXCA 3DKJA 3QJAA 4NUWA 2E77A 1VS1A 3S9YA 1L6WA 3LERA 4CQAA 5LHFA 1B9BA 3O6YX 4C1LA 1XUUA 4IX2A 4TMBA 4UFHA 4O1AA 1DBTA 2ZFAA 1DHPA 4UCGA 3BLFA 1FCUA 4LRSA 2CLHA 2V2CA 1Z44A 3IGXA 4B5NA 4UR8A 2C1HA 5CZTA 1F76A 1GTHA 4RZ4A 4RKAA 3DFSA 4KKXA 4MJMA 3LXBA 3CWNA 1GVOA 4JTKA 1DOSA 1H1YA 1PCWA 3BG9A 3GXNA 3TSDA 5BNKA 2FJKA 3W7HA 4Z1CA 3ABSA 3PC0A 1T99A 2Y63A 3FA5A 4RZ6A 4LRTA 4K7YA 5KTLA 2W0UA 1OYCA 2RHGA 3DFQA 3LHWA 2C19A 4XKYB 4WXYA 2WJZA 3PG9A 4LVDA 1YDNA 3TCEA 1LBLA 3W1XA 5IM51 2NXGA 3BARA 4OHQA 5FF7A 4DF1A 3I7RA 2Y70A 4CNPA 4UTHA 3GZ3A 1A5BA 3L68A 2I14A 4JY8A 3NPVA 1YLVA 3L5LA 2TMDA 1I2QA 1W3NA 1H7XA 4ADTA 3FOKA 5DELA 4O53A 3M9YA 2C14A 5D2WA 3MUXA 4K8HA 4O1BA 3M5VA 4O19A 4XWUA 3WK1A 4AVFA 3UY7A 2FTPA 4PC8A 2R14A 3TQ0A 1DJQA 2V5LA 1ZENA 3MJYA 2NZLA 1G67A 1QPNA 4O16A 4N2YA 1SO5A 3FKKA 1KFBA 1LZOA 4MZ1A 2BSLA 4LS0A 3PUOA 1F05A 5F1UA 2IQTA 3VKJA 2CW6A 3O16A 3W7QA 2H6RA 1I2PA 3F4WA 2VELA 4Z0JA 4LOCA 3P80A 5AHIA 2Y61A 3UD6A 1EP3A 2JKPA 2FIQA 1WQ5A 4LUIA 3L9CA 3GAYA 1FX6A 4O17A 4EIVA 2GVLA 3NQ6A 1WX0A 4BI6A 4FX8A 1K8YA 1X7FA 3TSMA 3JR2A 1TPUA 5CPMA 3L5MA 1JJKA 3PSVA 2O7QA 4FF7A 3M5XA 3LXCA 1HFBA 4LW7A 5EYWA 5LGXA 4FXRA 4IMFA 3W2KA 2F84A 5AHMA 1GG0A 1S5VA 1MEHA 3NM3A 1DQXA 3LCWA 3MYOA 1TPVA 1YYAA 1TREA 1ZAJA 4JTSA 2GJNA 2QCDA 1W56A 3BG3A 3GAKA 3A23A 3HJZA 1TIMA 4ZQOA 5I3HA 1ICQA 1Y0EA 1YXYA 3CHVA 5D03A 1Q3NA 1R46A 1AW5A 3H53A 3TK7A 2ZZ6A 4M6PA 4OV4A 3F1QA 3WJXA 2RDWA 3I7SA 3DZ1A 1YTEA 2ZBTA 5DXXA 3ZS4A 1OFAA 3NR0A 1UB3A 4RX0A 3QM3A 1H7NA 1R2SA 3OA3A 5G1TA 3T55A 3THAA 3LBMA 1H7OA 2G5WA 4FX6M 1W5NA 3NQGA 1PIIA 3W1MA 2A4AA 4NX5A 4P2VA 2E68A 2FFCA 2V82A 4UTIA 1SZGA 3SW6A 3E9AA 2Z0IA 3RLUA 1U83A 4JTUA 1PHWA 4IGHA 4MKNA 3LX9A 2WNNA 1FWSA 4X3ZA 3LCFA 3VE9A 2ZTJA 3UWUA 1GQNA 4RV8A 3O06A 4S2CA 1N55A 1R2RA 4DO5A 1RV8A 1FCVA 4ICNA 4WOZA 1IF2A 3W7LA 4IMDA 4R33A 3NQEA 3E12A 1I2NA 3EWBX 2QUUA 3LCIA 4M7TA 2YDAA 3IGSA 5CPNA 3TA6A 3EWWA 4N4QA 4DBDA 4ZZ9A 1AK5A 3PB0A 1FXQA 4JX6A 4NZFA 5G1YA 2GUUA 3W2UA 2PE4A 3K30A 4TO8A 2A85A 3KVJA 2ISWA 3TC7A 1TTIA 3HO8A 5AYZA 3A9IA 3V1PA 4UNKA 3TQKA 5I3IA 3FYPA 4NU7A 4YXGA 5TIMA 3DKLA 1KM6A 3NNTA 3GXTA 5DN1A 1PS9A 4RCXA 4GUIA 1J5TA 4AMAA 4BI5A 1K7EA 1XM3A 3G3MA 3P8JA 1J4EA 3P82A 4JY9A 1OK6A 1GZGA 2OCZA 3UWVA 2EAWA 3LHYA 4XBKA 2OJPA 2YW3A 1MEIA 2QR6A 3P8IA 4IMCA 4Z1BA 3NVTA 2YZRA 5F1VA 2C16A 1XC4A 1VRDA 3C6CA 1LLZA 2PRLA 2H8XA 1TQJA 5DY3A 2V2DA 3G22A 3H55A 5AC7A 4KFPA 3P5YA 4LC8A 4AWUA 5FF4A 3MI3A 4TMCA 3A5VA 4PH6A 1T8XA 6ALDA 5ABTA 1W31A 1KFJA 3W1LA 4UMCA 3P61A 2VFDA 1OHLA 1ZAHA 1Q6OA 2ALDA 1IXOA 1OX4A 1KM4A 1VHCA 1YTDA 3EWXA 4QISA 3U6WA 5K7JA 5AHLA 1TO3A 4NJJA 1WXJA 3KFTA 2KZHA 4LV9A 2GOUA 3CM4A 1K7XA 2QUTA 5LNRA 3L0KA 3MBFA 3UNDA 2VFHA 1G6CA 1Z48A 1OG0A 1WDWA 1KV8A 3P60A 1YXCA 5K3VA 3WFAA 4O28A 3L66A 4XTIA 3RFAA 2NUYA 1XI3A 2B0MA 4I7WA 4NZJA 3GDRA 1NF7A 2A2IA 2AGKA 3KXQA 4AHQA 1LRQA 1IXQA 5U7SA 4A22A 4M19A 2OX1A 1LOLA 1KLZA 2ZRZA 3W2NA 1I8JA 1U5JA 2DZWA 1JCLA 1N8FA 1EIXA 4AH7A 4N6EA 4PCFA 2W79A 5DCEA 1ZNNA 3L67A 2CLEA 2X30A 5FEWA 3N2MA 1LTDA 2GQAA 4LUJA 2AQWA 3G3DA 4AHOA 2I9EA 3NQFA 4ADUA 3SI9A 1EUAA 3WK3A 3LM7A 4DPPA 3B05A 4Q32A 4MZYA 3ZFHA 5G4EA 2QUVA 1H7WA 1R47A 2BZNA 2Y7DA 2ZZ5A 1ZHAA 4WJEA 5C5YA 3LGEA 5AYXA 4AWTA 2ZRWA 1OF6A 1LCOA 1UJPA 1QPRA 1XCFA 3UWZA 4FHAA 4JTHA 1G7UA 2DZTA 4TIMA 1ALDA 4QNEA 1LOSA 3TKFA 4UR7A 4MLJA 3LTYA 3W72A 4LVAA 2WNQA 3C2OA 1OFPA 3EWUA 1OFQA 2YPIA 3NQ8A 4ZQNA 4UIOA 2YX0A 4E0CA 1G4EA 1QAPA 4O0KA 1Q6QA 4NXKA 3SFKA 1JUKA 4KFOA 3W88A 4OU1A 4IUOA 5FF0A 4MY8A 4RXFA 2DJLA 3DENA 3DFPA 3PBYA 2YYUA 2V5BA 4MZ8A 2C6QA 4JTLA 1OK4A 4N9DA 4GNJA 2DZXA 3G1XA 2YGYA 4IJBA 1I4NA 3HBLA 1SSDA 3QRHA 2WSRA 1WOBA 1YADA 2ZRUA 5AN7A 1PL9A 5LNWA 3P81A 4JGDA 2C13A 3L21A 3E02A 3EX2A 2NV2A 2NX9A 3KAOA 4A2SA 2Z1BA 1XBVA 4X2RA 5C6MA 2CZEA 1XBXA 3C2VA 4Y96A 3YPIA 3KRZA 3Q2DA 4EWND 3QFEA 3IIOA 1NF0A 5KITA 3PS7A 4X22A 5AHEA 5HQEA 3S42A 1JQVA 5C2XA 4RXGA 3PBWA 4YMZA 1OX6A 2QJIA 2Y85A 3BO9A 3TMLA 2H3BA 3T7VA 3C2FA 3CLMA 1D3GA 1FUYA 5TBOA 1O5KA 3FJ6A 4RLIA 5EBUA 1S5TA 4A29A 3ZWTA 3W1TA 3G0SA 5KINA 4U28A 3Q94A 4N9BA 3BLIA 3IIZA 3W1QA 2NUWA 3P67A 1FY6A 3UZJA 3U8GA 3R12A 4K39A 1RD5A 4FIRA 4QNWA 3W7IA 4HNVA 1QMLA 2XN0A 4DXVA 4JDYA 5HWJA 1TV8A 3HG3A 2Q8ZA 1TCDA 1TTQA 4BF9A 4XBSA 4O12A 3W07A 4MFDA 3AO0A 4JYEA 3MMTA 2ABBA 2JBMA 2Y62A 2WOQA 1P0KA 4WY0B 1LDCA 3S5ZA 1OFRA 4S1FA 3GKAA 3NPWA 2CZ5A 3HG4A 2V81A 3S6DA 1AMKA 4IPJA 1SW0A 1JCMP 2E5DA 5DCDA 3QSRA 3W85A 3GDKA 1XFBA 4Z1DA 3W7JA 3CEUA 4HPJA 1UBSA 3EX1A 3NM1A 1FCQA 4UFMA 3GDLA 1H60A 3P84A 1QO2A 2H3DA 3LDVA 2JKAA 2V30A 4HIBA 5BOOA 4KWWA 1ME7A 1VGAA 3BPWA 4AF0A 3MI6A 2YCEA 5DBTA 4C1KA 1B4KA 1CW2A 2PCQA 3HPZA 3W1RA 2HSAA 2CU0A 4CCDA 2WV8A 1HO1A 2QKFA 4QSHA 5CSSA 3M47A 1OYAA 1VHNA 1X8FA 4UTKA 4ZQCA 1GWJA 1VJIA 4OE7A 8TIMA 5LHEA 3B06A 2RFGA 2UV8G 1JUBA 4QM1A 1EPXA 3CWOX 4LVBA 3W22A 3QEZA 5AC6A 2CLIA 3F03K 1GPWA 4XZ9A 2A6NA 3TDFA 2A21A 4AWSA 4JS3A 4JDBA 3W1NA 4FEZA 4NJIA 2ISSA 4OQVA 3O6CA 1B3OA 4K36A 4PTNA 5U4NA 1IGSA 4WXZA 1F2JA 1VYSX 3TMQA 2HS6A 3G1DA 4UFIA 4RK8A 2X2GA 4L4MA 1O94A 3T44A 2BX7A 3FYOA 4O1DA 2ZCGA 1W54A 1QR7A 4CQ9A 5D2YA 4ZQRA 4O0ZA 4BFAA 4MY1A 5HULA 2E6DA 3FEMA 4IMGA 4IWWA 2ZRXA 1JR1A 4LS2A 1XBYA 3LV5A 1SFJA 3GIYA 3LB0A 1A5AA 4OBTA 3KVMA 1FQ0A 4NNAA 3NQAA 3EX6A 2CLLA 4WD0A 2A7NA 3GVGA 5K4XA 4KWVA 1VZWA 1OFEA 2FLIA 4PL1A 1F6PA 1WA3A 3H54A 3LRKA 2CLOA 3Q37A 4FX7A 3LCGA 4JIQA 3R2GA 1RR2A 3LCLA 4BR1A 3NOEA 4N9EA 3SZ8A 3W70A 3E0IA 4NT0A 2QCMA 3LI0A 2WO5A 1TYGA 1VCFA 1EB3A 1ZAIA 4H6KA 3C52A 2P10A 5CSRA 3FFSA 4IOTA 2XN1A 4WY0A 4JTIA 3UYCA 4HHPA 2AAMA 4Z1AA 1YXDA 1F7BA 3NQ7A 2QF7A 1OABA 1TPEA 2YW4A 1V7YA 2JKEA 3ABRA 3TFXA 2QJGA 3VE7A 1RZMA 3OG3A 3OIXA 5H2ZA 3MO7A 3B0UX 1S3HA 1N7KA 3W7KA 2QCGA 1UUOA 4LS1A 2V2HA 4ALDA 3W3OA 4LWWA 3NL2A 2I1OA 3EXSA 2X1SA 1H51A 3IVTA 4ZMGA 5G4WA 3FJLA 4MVAA 3STCA 2BTMA 5F2IA 1DQWA 3O8AA 1LP6A 3R8RA 3PWAA 4BWLA 4DF0A 5HJLA 4MY9A 3W7NA 4AHPA 1KM3A 3G1AA 4FNPA 2DORA 1CI1A 3W2LA 1SU5A 4O18A 4CQ8A 1SO6A 3QZEA 3HPXA 4LV4A 4K38A 2Y6ZA 4FIQA 2VFIA 4JTTA 1VLIA 1EX5A 3S5OA 3B4UA 5FEPA 3INPA 3EKLA 1XDMA 3QMTA 1JRCA 3FS2A 5A5WA 4UXDA 3NQVA 3VFLA 4E2DA 3HQ1A 1TTJA 3B0VC 1EWDA 3E96A 5L6UA 4Y90A 1LBMA 3TE9A 4E38A 3DU0A 3C8FA 3KVLA 2Y7EA 3B8DA 5G5IA 2QDHA 2VFFA 3CIWA 3EB2A 3TR2A 5EPDA 1A50A 4DBEA 1ZY9A 3NXFA 2FPTA 3USBA 2NWRA 4UNLA 1XUZA 2Z2UA 3NDOA 2H90A 1KM1A 3N34A 1XL9A 2VC6A 1HTIA 1WAUA 2B7NA 4UMAA 3PBVA 4O11A 4PL2A 3GR7A 4UTWA 3W83A 1H62A 4MYXA 2YFNA 3CEPA 1RVGA 4GUHA 2EGZA 4UTTC 3TC6A 3DHFA 4O14A 3EXTA 4FNRA 5HNRA 4RZ5A 1G4SA 1YDVA 1SUXA 4ZVJA 4QJ1A 5AFDA 3F4NA 1LRTA 1GVRA 3LRLA 1YTKA 1KLYA 1TPDA 3TJLA 1QDSA 3TNOA 2QCCA 1W37A 5J5RA 3IVSA 4POCA 3SECA 2QCLA 1P0NA 3MW7A 3NQDA 4JTEA 3W1UA 3N2XA 3PM6A 1TPWA 1VC4A 3W7RA 4UTLA 4PA8A 4G1KA 3Q58A 4O57A 3BVJA 3TJXA 5EL1A 4HNNA 2NV1A 1BTMA 4NXSA 1F74A 1AW2A 1LM1A 3ABOA 3DI0A 4GC4A 4RJEA 3ATZA 3VNDA 1X1OA 1PVNA 3KHJA 2R8WA 2QDGA 2DP3A 3G1YA 5FEZA 5AB3A 1TV7A 1VR6A 1KV5A 1W5MA 4NNBA 5BMWA 1B57A 1GG1A 5I3KA 2ZZ3A 3NL6A 1JCNA 2BXVA 2J9XA 2RH9A 1PV8A 2B7OA 3KRUA 4OWGA 1NSJA 3G1VA 3QPZA 1SSGA 1D3HA 1ONRA 1H1ZA 2W6RA 1FXPA 4UFKA 4JN6A 2BWGA 1LORA 4I7UA 3HIJA 1W5OA 3W7DA 2QEZA 5HWNA 3NAVA 1ZFJA 2V8ZA 3C2RA 1XDLA 1L6SA 1KBIA 3I6RA 5LNUA 4NVTA 5KZEA 1JCYA 3HGOA 1OFDA 2TPSA 2E6FA 5AHNA 1VPXA 2CFFA 2QCNA 3P5ZA 2PRHA 3IEBA 2C18A 3DGRA 5K4ZA 4GJ1A 1T96A 4DO6A 2VXNA 3PR2A 3THQA 4XQ6A 2E6YA 5D09A 5FEXA 4HKPA 4WOQA 3HOJA 2WNZA 3SY5A 1SQ7A 1SZEA 1JCXA 1GVSA 1QO5A 4DQWA 4KFNA 3LHZA 2J88A 4GBUA 3HGSA 4M6VA 3N3MA 3PVFA 4HSOA 4MIMA 2XFWA 2Q3OA 1P5BA 1W8SA 4FNSA 4JTGA 5CPOA 5AC8A 3BG5A 4O13A 3GKFA 3RLVA 4UUIA 4UTUA 5IBXA 2GPTA 1O60A 3HPSA 3DI1A 4L4LA 3L2IA 1ZCOA 2XN2A 3DFOA 2J6XA 2QJHA 2YXGA 5HR6A 2ISVA 5F4WA 3RK8A 1UCWA 4UTTA 1D9EA 2J9ZA 1IXNA 3PY2A 4TR9A 3C61A 1SFLA 3NGJA 1HG3A 4WZHA 4ADSA 1W5PA 3OHIA 1TSIA 3W23A 2WSQA 4AB4A 2QAFA 3HMJG 4PODA 3MYPA 1NVMA 1RQBA 2OMAA 1VCVA 1W3TA 2GQ9A 2J24A 5LKYA 3N73A 2VEKA 3GDMA 4UC5A 2Z6JA 2C3ZA 2PURA 3QW4B 3PSWA 2RDUA 3TSBA 5LNSA 3WJSA 4TU1A 3SR7A 5DY2A 2VENA 1FWNA 3NEVA 1BWLA 4ORMA 1BEUA 1KW1A 5D04C 4BI7A 3V75A 1HUVA 3NA8A 2EPHA 4LNYA 1LYXA 2ZA1A 1YPIA 3GNDA 1QNVA 3A5FA 3QC3A 1QPQA 4DELA 4O4VA 1VYPX 2R91A 2DU2A 3S1XA 4CNNA 1F5ZA 1PCKA 4O52A 5T26A 1IIGA 1THFD 3S5YA 1RPXA 3EX3A 3QYQA 4O10A 1PHQA 3C0JA 3BW2A 4LY8A 4P61A 4O1CA 4DEFA 1L9WA 2YSWA 2Y7GA 2ZRYA 2ZZ4A 2NX3A 4Y6GA 4YL2A 1X1ZA 3BW4A 5I3GA 2X1RA 2B4GA 3C3NA 3GNNA 2E5CA 2X1TA 4XTDA 3QH2A 4JR5A 1GTEA 4YWIA 3KVKA 3TFCA 4CNOA 1GVFA 3W2MA 4JX4A 4E2BA 1M5WA 4K6AA 4ZQMA 2X16A 2ZZ1A 4AF0B 1B4EA 1E51A 4AAJA 4H3DA 5D2VA 1Q6LA 1OJXA 5D2TA 1VLWA 2BLEA 3SSJA 2H8ZA 5F2GA 4FNUA 3BW3A 1KFEA 4LU0A 5K9CA 3WJZA 2E6AA 1H63A 1QCWA 1L2UA 1ZJIA 5FF3A 1DKWA 3OVQA 2QCEA 4EVZA 3LRMA 1I45A 5LSMA 4JEQA 3B03A 4GUGA 4HT3A 3G1HA 4BK9A 5GVJA 4HPXA 2HMCA 5D2XA 3G8RA 3PB2A 2NUXA 4FO4A 6TIMA 3G18A 3MP3A 2VKZG 1F73A 2E1DA 5CZ0A 3P62A 1I2OA 1OFOA 1VYRA 3W87A 5HUPA 2CZDA 1HO4A 1WV2A 2GVJA 3LHVA 4MJZA 3GK0A 5D05A 3P74A 4GXMA 4N4PA 4Z08A 1FWTA 1M7OA 3LTSA 1KA9F 4MYAA 4YCOA 2CLFA 4FB7A 2C0AA 4ONVA 1KTNA 3O07A 3NO5A 2O7SA 2QCHA 2V0TA 2GJLA 3IV3A 2ZA3A 5KZDA 1X6UA 3B04A 3GX9A 5E1QA 4HN4A 4D2JA 4JYFA 4LTSA 3TROA 2VEMA 1GEQA 2VEPA 2Y88A 3MI2A 1JQXA 1QOQA 3QQ0A 2NX1A 1FWWA 1GYNA 1MZHA 3TH6A 1EA0A 1C29A 5G2HA 3T4CA 1V5XA 5D30A 1MO0A 3S0CA 3N19B 1UUMA 5BW6A 3M5ZA 4EF9A 5HUOA 2EF9A 4GFSA 3RU6A 4R7JA 5I3JA 2G95A 3I7QA 3NL5A 3DAQA 4PEKA 3EKZA 3LLFA 3TAKA 1SPQA 2WSYA 2ZZ7A 1I2RA 3HGRA 5TQLA 5DCBA 3UXDA 4AEOA 3ZWSA 1A5CA 3W7CA 2EHHA 5MHBA 4BWLC 1H7PA 1A5SA 1SO4A 5FI8A 3O6DA 3STEA 4FNQA 2G97A 3GLCA 3QQ1A 4H4IA 4W9TA 1TPFA 4QQ3A 3TV8A 5KZMA 3S1VA 4PFMA 2FB2A 4NJKA 3T40A 1DV7A 4O50A 1O5XA 4O8RA 3DH7A 5HWMA 3R89A 4U4MA 1VCGA 4NX0A 5CPLA 5SWUA 4QIUA 1KTCA 3MP5A 3PBUA 3W7EA 1LROA 3CTLA 3PUEA 4S2BA 1G69A 1FDYA 3LHTA 5D33A 3W76A 1OVDA 1ADOA 1NEYA 2JK2A 1LOQA 2B7PA 4GUFA 4UTWC 4N9CA 2YFOA 1Z41A 4JIPA 3LOTA 1SR9A 1MEWA 3DFTA 4LVGA 1SZNA 3LXAA 1GYLA 3L65A 2FQIA 5IBXC 1W1ZA 5C55A 5LZLA 1RQEA 3NL3A 2PC4A 3WJYA 5CGQA 1JULA 2VOMA 2E09A 3ANYA 1YPFA 2WQPA 3S8HA 1GOXA 3QSTA 1W5QA 2ATSA 5F2LA 5F4XA 5HINA 1G4TA 1G7VA 3OVPA 4CCEA 3WK0A 3ZR4A 3N9SA 1P4CA 3STGA 1KBJA 1KM5A 1Z42A 3CIXA 1S5WA 3L0NA 2JGYA 3TU9A 3FKRA 2CLMA 3PAJA 2A5HA 4JD4A 2TYSA 1WBHA 3M6YA 4WQ6A 5D32A 3WK2A
chains in the Genus database with same CATH superfamily
1XJBA 5E0FA 2V9DA 4QAIA 1UZHA 3G1SA 3N3TA 4Q33A 4MNLA 1JG9A 2WCAA 3W7MA 3STFA 5LNVA 5EU9A 1JPHA 3N9KA 1A5NC 4L4PA 4DO4A 1K9TA 1SW3A 3TUUA 5A6KA 3BGJA 5K9DA 4UQDA 3V0SA 4JICA 1XLIA 5CKSA 4LCSA 4A6GA 3TW9A 2PDNA 4NRRA 1LWHA 3KWSA 3M7WA 1RUSA 2P0OA 2WWDA 3N11A 3VX1A 1A80A 1R30A 4G8TA 3O63A 3FLUA 3SGUA 3UY8A 1UZDA 1OIMA 1DJWA 3FIGA 5DLCA 1YDOA 4A35A 3LQLA 4XZNX 1H49A 3CAQA 2A3AA 2VL4A 4FOUA 4AZCB 2NXHA 1EZWA 3URAA 1AL8A 5EGRA 2OODA 4X60A 1IEVA 3B8IA 4CNUA 3T2OA 1AH4A 4ZB0A 5BZAA 3UPWA 2Q3RA 2QCFA 3AIBA 4LAMA 1AL7A 3WLSA 1H7RA 3ES8A 3RGTA 3LPOA 4IM4A 5F2MA 3GXPA 4XD5A 3P7YA 4LC6A 3ELFA 2HDJA 1MW1A 5A8GA 3EDKA 1QWGA 3W2JA 5IXEA 1TA3A 1CBGA 2VEIA 4IMEA 3BOLA 2IKHA 1E3ZA 1XDJA 4KERA 3I65A 2FHCA 1O68A 3KX6A 2CEQA 4HVXA 3MB9A 3JU2A 2P88A 1RY8A 5IOBA 2I5IA 4GZJA 1EO5A 1TV5A 1OF8A 3HGJA 4YPJA 1LLOA 3UGRA 4CQDA 1H61A 3SUVA 5FJOA 3KBMA 2QJJA 3NQCA 2VGIA 3H22A 3WLIA 4GACA 1ZALA 3JS3A 2X41A 2DV0A 5T8GA 1CTNA 5FIPA 3MKKA 1HVQA 3ZVHB 2GWNA 3M46A 5D02A 1M6JA 1DWHM 1GT8A 3NPXA 5MKGB 3LN3A 4U10A 4XAFA 4TV5A 4Q8PA 4G1NA 1A5OC 4GX8A 1FDJA 2YXOA 2QGYA 3GDTA 1P48A 2E28A 4DN1A 1ZGDA 3RNDA 4DI9A 4IQLA 4LFYA 2WKJA 3AMGA 2FDSA 5EMUA 1ML1A 3UWQA 4AD5A 5T9BG 2PMQA 3NYZA 5K9XA 4BJHA 1E0VA 1WYIA 3SB0A 4XUGA 4DB7A 4CN4A 1FWRA 3SQSA 1D3CA 4AW7A 3RYSA 1BWKA 5CH9A 3AHTA 2QAPA 5CBIA 3UT0A 2ZZ2A 1JCTA 2PWFA 2EJ1A 3NZ1A 1VFHA 1SJDA 3PZVA 1LLWA 4A8RA 3EWCA 3W84A 3UWYA 1IZKA 1SM9A 1FKWA 1UIPA 3IARA 2ZYFA 2VC5A 3RM4A 3TCSA 2RKXA 1LT8A 1C92A 1VIWA 4KETA 3M0KA 4AVOA 1TMHA 1DVJA 4MFEA 3SUWA 2UBPC 1F6KA 3TAOA 4J27A 3PPCA 1PZ0A 3VZZA 7CGTA 1PZ3A 4GCAA 3A21A 1KTBA 4TX9A 1U5HA 4V1XA 3QQWA 2J7HA 3EOSA 3GNOA 3CQ0A 5A8OA 3PUDA 3D0CA 3C4UA 4AD2A 1DJHA 1SMAA 4MADA 1PX4A 2OZ0A 4JNYA 4RV3A 2OB3A 1C93A 3B0PA 4JIHA 2HTMA 3IIPA 4RNFA 2FH6A 3BLEA 4DUWA 2YYTA 2PDIA 1EA9C 2C15A 1OX5A 3TN4A 2TSYA 3N6HA 1OD0A 3LY0A 1SVDA 3CB8A 4PMZA 3LU2A 2VYOA 3W1PA 4B5VA 5AVNA 4A3YA 5J8LA 4UFLA 4WHBA 3GB6A 5A8MA 2X05A 4LJ3A 4RPQA 2PDYA 4OJYA 4IQEA 2DUXA 4QITA 4HGXA 2A79A 4G9PA 4AX7A 3W6YA 1T7LA 3GVRA 1DE5A 4G6CA 1UR3M 2Y2WA 1W3JA 2VZTA 5DT5A 3W6LA 4R34A 2HISA 4HCHA 3EPNA 4QHRA 2YR1A 3EWYA 1WBJA 1DJNA 4LAKA 3PJUA 3QPYA 1NFBA 2UZ9A 2F7FA 1IWAA 3TXZA 4PTXA 4BKNA 2XGBA 4AD0A 2F6UA 2C0HA 1CGYA 1XLFA 1F4HA 3CT7A 2R1NA 3GIQA 3N4FA 3HQOA 3N14A 1K7FA 1VQTA 4M0XA 4NJHA 1S38A 3KBJA 1RALA 3AYRA 3M41A 1Q6RA 4IXXA 4NNCA 3TW7A 2GJXA 1TB3A 1ZL1A 3PZ9A 3NDYA 3HA1A 4QGCA 3QJAA 3MMUA 3S9YA 2Q02A 3S46A 2CHOA 1W17A 1CGXA 4C1LA 5M03A 3B9DA 4GZEA 2ISFA 4TMBA 4UCGA 3BLFA 3T9PA 3T2QA 1FCUA 4LRSA 3VILA 4E8DA 1Z44A 1M01A 3IGXA 2XPKA 3UU0A 1BQCA 3AXIA 4YTUA 2ADAA 4RZ4A 4HN8A 3CWNA 3RX2A 3B8WA 1GVOA 4JTKA 3BG9A 2FJKA 1SGJA 3WNNA 4FLRA 3H4XA 2Y63A 3TN3A 3GG7A 4EACA 3SN0A 4LRTA 3HV8A 1OYCA 3LHWA 1V3KA 1EEXA 4ZB2A 2Y5EA 1NDZA 1KXQA 3ZVIA 4NKCA 4H19A 4M56A 3EA3A 2I14A 2J8FA 1MZRA 4XX6A 5JBFA 3CT2A 4GINA 5E5CA 4NHVA 5H1WA 1TR9A 3H7VA 2HPIA 2P3ZA 4ADTA 1JXJA 4RPPA 1G5AA 4O53A 3M9YA 3MUXA 4AY1A 2QMKA 4W86A 2W5FA 2IKGA 4FF5A 4D9PA 3CV6A 4HMEA 5FJUA 2R14A 1ITUA 1S2TA 2NVDA 3TQ0A 4P8VA 3QZ6A 1BGAA 3MJYA 3UJSA 1E1EA 4DUXA 4OIFA 1QPNA 1HXJA 4O16A 3WH8A 2F6XA 1QI2A 1SO5A 3K4WA 2BSLA 3VOIA 3UETA 3PUOA 3AFBA 4QJ3B 3ZM8A 1UD8A 5C71A 2Q8XA 2P5NA 3W0KA 3DHPA 4KRZA 4QX4A 2CW6A 3O16A 1AVAA 4L64A 2VWTA 1I2PA 1TWDA 1N82A 4Z0JA 5AHIA 2W67A 2Y61A 3QHOA 3MVIA 1WQ5A 4LUIA 3GAYA 1EXPA 2QXWA 4QJ5B 4O17A 4EIVA 2VZVA 3MUAA 4BI6A 3EOLA 3U2EA 3TSMA 5A6BA 3JR2A 3IAPA 5CPMA 5FSEC 3B97A 3OZPA 5AVHA 4IMFA 1XP3A 3W2KA 2F84A 3SURA 2PDQA 3CHCA 2FGLA 3VIMA 4GI4A 1OSEA 3WDPP 3T42A 1TPVA 1TREA 3GAKA 1AD4A 4DNMA 1DIEA 2PAJA 4ENLA 1ICQA 4YJ5A 4ERIA 1YXYA 3CHVA 3AZRA 4H9YA 2IUZA 3V5FA 5M5DA 2ZZ6A 4M6PA 4F9DA 3F1QA 3WJXA 3I7SA 5H8MA 3FVMA 5DXXA 2Y1HA 3AIVA 2P8CA 4XIAA 4AD1A 1JDCA 5HMDA 5JMUA 2ALRA 1FKXA 5G1TA 3T55A 3THAA 1H7OA 4QQUA 2G5WA 2XIBA 1QATA 1W5NA 4UOZA 1K9DA 2QVNA 3WBAA 3WUFA 1X7IA 5CLTA 2E68A 2FFCA 4M1BA 4UTIA 1SZGA 5PTDA 2Z0IA 4JTUA 3S47A 5JBDA 4IGHA 1OIFA 4NAEA 3CXOA 1LQAA 1MQPA 1W9PA 4X3ZA 1QASA 3UWUA 1CXLA 4IMAA 4PMVA 4EANA 4FR1A 3SDOA 1XYFA 4MGGA 4YNGA 3UCCA 1M41A 3E12A 3LCIA 4M7TA 1OCJA 2PGRA 2WJDA 3EWWA 1AMYA 4GXWA 4DBDA 4ZZ9A 4GIRA 2KAUC 3B8TA 1HJWA 3UWEA 1TJ0A 1S2WA 4M6UA 3IACA 2OZ3A 4Q6XA 3S9IA 3KVJA 5HQLA 3ANUA 4PCPA 3TC7A 1TTIA 4UNKA 2ACSA 6XIMA 1Q2SA 4YXGA 3DKLA 4KRTA 3NNTA 5DN1A 1PS9A 4WEVX 2QPSA 1J5TA 2QHAA 4BI5A 3TYUA 1JYXA 3G3MA 4WSJA 3P82A 1OK6A 3UWVA 3EZ4A 4XBKA 3HQPA 2ICSA 2YLAA 4HB7A 2FTYA 3NVTA 3ZQ9A 2YZRA 2PTYA 3SY8A 2PRLA 2H8XA 1ZU8A 3H55A 5AC7A 3R6IA 4KEMA 4NL1A 4LC8A 3W81A 2WSKA 4M51A 3VNLA 5FF4A 5IRPA 1JEZA 4TMCA 4AC1X 3FJNA 3RCMA 1YHTA 3ME3A 3U7BA 4Y9PA 4JFUA 3E0WA 3U3HA 2E9MA 2VFDA 3DGBA 2YL5A 1EJXC 1XH2A 1EJUC 4H01A 3MCMA 1KM4A 5HBFA 2G3NA 1YTDA 5CJMA 3EWDA 3EWXA 2NQJA 4AEFA 4QP0A 4L1GA 1BXNA 2PLJA 4FR6A 5LNRA 2FZMA 3MBFA 1NIUA 1OT2A 5KETA 2Z2BA 1G6CA 3CK5A 1Z48A 1E6SM 4F0RA 4ZR8A 2OTDA 2B0MA 4I7WA 5CLWA 4DM1A 1NF7A 1OT1A 4K1WA 3N12A 5ABGA 4TV6A 1XYCA 4HMDA 2IMRA 1LOLA 3E5BA 2YL6A 3CUHA 1U5JA 1CGUA 1EIXA 4GZIA 4UNIA 4N6EA 4FXJA 2W79A 1V0MA 1EGZA 3BCJA 1KD0A 4RUBA 3L4TA 2GQAA 3F5KA 1A3XA 3A3HA 3MT1A 4I90A 3IK2A 2XH0A 3B05A 4MZYA 2QVHA 1P43A 4WJEA 1GNXA 3V3WA 4URIA 2ZRWA 1XCFA 1V3JA 2WM1A 3QV7A 3KCOA 1D8CA 3TKFA 2PF0A 3LTYA 4A05A 3W72A 3PTMA 1OFQA 3N2CA 3V1HA 3GH7A 1TIWA 3QXBA 4IICA 4Y9NA 1UD3A 4NSBA 4Y9OA 1EBHA 1HGWA 1UKPA 1EC8A 1JD7A 2A3CA 2J7BA 2D20A 4ERGA 4NXKA 2EQDA 1XR2A 3W88A 2OLAA 1P0EA 4IUOA 4RXFA 3DENA 4HOWA 2V5BA 1JPMA 4JTLA 1OK4A 4ACZB 4AWEA 5XINA 4RZBA 1MUWA 3VKKA 3W53A 2ZRUA 5AN7A 1KC7A 4FSAA 4IJCA 3L21A 2PTXA 2BODX 2NV2A 5LIKX 2DEPA 2NX9A 4GO9A 3LENA 3KAOA 5CGTA 4A2SA 2QV4A 4Z2GA 1OC6A 4P7NA 4MMWA 5C6MA 3EBVA 5CGMA 4Y96A 3WDQA 3Q2DA 4R5EA 3QFEA 1KXVA 1JGIA 3PS7A 2DY3A 5D9PA 4B5WA 4ATWA 1J18A 3LBOA 1JQVA 2DGAA 4K1GA 4BY3A 1PZ1A 3QGAC 4S3AA 1OX6A 5I2UA 3KLKA 3C3UA 3OYZA 2H3BA 3AQUA 4F79A 1D3GA 3AHVA 1F3EA 1FUYA 4GFIA 3WN6A 4RLIA 1R3WA 5BU6A 1TCMA 5KINA 1RP9A 3FEQA 3Q94A 4N9BA 1M53A 3NO1A 4NZ4A 4H00A 3WLOA 3P67A 1B3VA 2E67A 3OGRA 4NF7A 4K39A 1E6ZA 3AMLA 2W66A 3D46A 4NYUA 4KCWA 4GI8A 1JYVA 1TV8A 3UGVA 1TTQA 1PX8A 2G41A 4BF9A 2GLKA 2ZUNA 1P7TB 2ZUTA 4O12A 3W07A 1F3TA 4GXPA 4GNKB 3KBVA 1B31A 5FL1A 5I78A 1MFVA 4NRSA 4HCDA 2JBMA 3DESA 3DN5A 4L6HA 1R85A 2WOQA 2ACQA 1P0KA 4ICCX 3MSDA 1OFRA 1MNSA 3HG4A 5E6ZA 2V81A 1ZCCA 2Z1XA 2UWFA 4GISA 1DJXA 5E0CA 2P50A 3W24A 2ZVRA 1J0IA 3NM1A 4AU0A 1FCQA 3EDDA 1H60A 1QNSA 2H3DA 4AUBA 4HIBA 5FJJA 4KWWA 4XAGA 3BPWA 5HDRA 3TJIA 1B4KA 1D8WA 2CXEA 2DIJA 1CW2A 3W1RA 5IHSA 4TVUA 3VMNA 3CPGA 1R3TA 4UTKA 3N6JA 3E6EA 3ZMRA 3R0KA 4HHLA 7REQB 1JUBA 1J9YA 1R9ZA 4CU8A 1K6WA 1E3XA 1EXBA 1YNQA 1GPWA 1FP9A 4PFHA 4JDBA 4FEZA 1M03A 3WUBA 4LUSA 3K4AA 1B3OA 1ITQA 4WXZA 4HQVA 2HS6A 5CPQA 2X2GA 2QMJA 3UVIA 2HE5A 1K9FA 4C6LA 2W9MA 4EAYA 5FAJA 4B4HA 1ITXA 4O0ZA 4BFAA 4MY1A 2ZWZA 4CEUC 2VCCA 2FMNA 1F3XA 1VEMA 2NLYA 3VGBA 1FWCC 2OEKA 1SFJA 4NZ5A 4YVVA 2I7GA 1RCOB 1FQ0A 3VDCA 4WR3A 5EMYA 3CAVA 1FWAC 1MFUA 2P3EA 2CLLA 4LYKA 4ZCWA 2A7NA 2PA6A 3VOHA 1DWAM 2G37A 4HPGA 3W27A 4BQ4A 3AU2A 3LCLA 4N9EA 3W82A 4IJRA 3W70A 4NT0A 1KRBC 3GVQA 2OZ8A 3S9ZA 2BY2A 1OADA 3NZPA 1ZBVA 2DT2A 1X96A 2P10A 1BTCA 2WZEA 3RR1A 2O4MA 3N1AA 1BVWA 1MW2A 4HOXA 1NOUA 4WY0A 1Q6DA 2AAMA 3AICA 3R1ZA 1UR2A 3ZJ8A 3SRFA 2PWHA 4C6CA 4XD3A 3ABRA 3TFXA 3AHXA 3CMGA 3TA9A 1MRQA 3AZTA 5CJ5A 4ATLA 1S3HA 4F40A 2E8YA 2GDVA 1WXZA 3LNMA 2QCGA 1FWJC 3BLOA 3W3OA 3EXSA 3VGDA 4B4FA 3VD4A 3O8AA 1LP6A 4INFA 3N04A 4QS6A 1AQMA 4H8HA 5HJLA 3BOFA 4PUJA 5BRQA 3EPOA 4LV4A 4K38A 4FIQA 1GK8A 1EX5A 2NT1A 4KS0A 3INPA 3UR2A 4LAOA 1JRCA 5AYBA 3S1GA 3ENLA 5F7UA 3NQVA 1W1VA 4AEEA 1TTJA 3V18A 4AIBA 1CGWA 4E38A 3KBNA 3B8UA 3CQIA 3AS1A 4D6DA 4EPKA 3DDMA 2VFFA 3EB2A 3U2CA 3TR2A 3RXZA 1A50A 2OR2A 4O8AA 2YOCA 4C7DA 2WBKA 1FH7A 2O55A 3NDOA 3N34A 4WLCA 2VC6A 4MM1A 5CC5A 1B3ZA 1HTIA 2WSPA 1WAUA 3B3DA 4HA0A 4UMAA 1FH9A 3PZMA 1KB3A 4BS0A 3W83A 1PAMA 3P2VA 2GK1A 4MYXA 5EBAA 2YFNA 5M2FX 4GUHA 2EGZA 4C90A 1I0DA 1SUXA 3GC5A 3LRLA 2XIIA 8CGTA 5HJXA 1TPDA 3UG8A 4J3UA 3S2CA 3AIQA 1J0HA 3SECA 3FGCA 2E8ZA 2JEPA 3Q58A 4PCSA 2PDFA 3BVJA 1UWTA 3TJXA 4HNNA 4QG6A 1O5RA 1BTMA 4NXSA 3DI0A 4GC4A 3AIRA 2CKSA 1X1OA 1PVNA 3G1YA 3PZOA 3AXMA 1KV5A 4NNBA 1GG1A 4Z2LA 5I3KA 3G2GA 4M24A 3WF4A 1JCNA 2J9XA 1H11A 3I4EA 4NYYA 1ONRA 2W6RA 3RCYA 1FXPA 1LORA 4P7RA 3NAVA 2F38A 2V8ZA 4W93A 1L6SA 4GKTA 4PMDA 1QU4A 2O92A 1WDDA 4R3UA 1GVIA 1VPXA 2CFFA 2HWGA 4B2DD 5K4ZA 1UIOA 3THQA 3A4JA 4LANA 5D09A 4HHMA 1SQ7A 1ZZMA 1AFSA 1SZEA 3OTRA 1QO5A 4EPBC 2W91A 2J88A 4GBUA 3BWWA 3C86A 2WLYA 1P5BA 1CNVA 1NP0A 3P0WA 4RDZA 5AC8A 2JF7A 3GKFA 3SCPA 1VIZA 3HPSA 2J8TA 2PDXA 1ZCOA 4E8CA 2XGZA 2YXGA 3BAKA 5F4WA 3VX0A 1FHDA 4YYCA 4AIUA 3FY1A 4HNOA 2DIEA 2J9ZA 1IXNA 2HXTA 3IJ7A 2J66A 3O6AA 1EYEA 3GTXA 1F8MA 3NGJA 1HG3A 3VD5A 4AB4A 3OO2A 4PODA 4WKFA 4PTMA 1R7OA 1A47A 2OMAA 3AMDA 1VCVA 1W3TA 3RUBL 2XWEA 2J24A 3VIKA 4AZBA 3GDMA 3HFTA 3QW4B 3CLWA 4Z1YA 2I56A 3GU2A 3UESA 1A5LC 3WJSA 5DMLA 2IS7A 1GGOA 3AROA 1FWNA 3NEVA 4BI7A 3HJEA 4Q3MA 5EMKA 2EPHA 4LNYA 1LYXA 3I6TA 3A5FA 3QC3A 1QPQA 1XIMA 4HZMA 4CNNA 1JF5A 5ENLA 1PX3A 1PHQA 2CZVA 3C0JA 4P61A 4O1CA 5BXPA 3AI0A 4TQTA 1WNOA 1OZQA 2D69A 1Z7AA 4Y6GA 3R25A 3I3EA 2X1RA 2B4GA 2OEMA 4UZUA 5IDZA 4JR5A 2AGTA 4YWIA 4BEUA 3KVKA 4F0SA 3VOCA 2QDDA 2PWDA 5HK4A 3L4VA 3COTA 4N0RA 4I8YA 4JX4A 3GIPA 3QZAA 3R94A 1M5WA 3SQMA 2XGIA 4AF0B 3U2ZA 1E51A 4OECA 4H3DA 3G6MA 3E2SA 1M1BA 5F2GA 3OA5A 5A8QA 2NV9A 1KFEA 4RNHA 4LU0A 5K9CA 2E6AA 4I8DA 1L2UA 3WMSA 2NVCA 4UBPC 4EVZA 1G94A 4JEQA 2BV9A 3WDHA 3G1HA 3GUWA 3WF3A 3PK7A 4BK9A 1E1FA 3H2NA 1VBHA 5GVJA 1PTDA 4W8AA 2OSXA 2PBGA 5D2XA 4CEXC 3G8RA 3BCFA 4XZLX 4DY1A 2VVNA 6TIMA 3KBWA 2E1DA 3IAQA 4HYRA 3P62A 3R58A 1OFOA 3SCVA 2I9UA 5EMMA 3R8HA 4GQGA 3SM0A 3OGSA 2BXZA 5C8BB 4N4PA 5CAHA 3WLMA 3PAOA 1W1A1 1PUDA 1M7OA 5GNYA 1NJJA 3RIKA 4MYAA 3WFLA 3C0LA 3KWXA 2CLFA 2WMGA 1H3GA 4LQ1A 4CU6A 4Q8OA 1HJUA 4ONVA 2ZICA 3OZOA 2ZA3A 3B04A 2VRJA 1ITCA 4AXNA 3MSYA 4HN4A 3UG5A 5JBEA 3TROA 2VEMA 1I9CB 3FVDA 3WD2A 3VNJA 2UY5A 1QOQA 4JCLA 2NX1A 1GYNA 1EA0A 1C29A 1SJCA 4K68A 4B5UA 1MO0A 1WUFA 4D6CA 2PPGA 4JHMA 4DYJA 5HUOA 4EF9A 1O1HA 3PPHA 4ATDA 4R7JA 1TZ9A 5I3JA 5FKYA 2JEQA 1F07A 1TJ1A 4PEKA 1R3RA 2CBIA 3VFCA 3KOWA 2WSYA 1I2RA 4R85A 2PWEA 5DCBA 1GYMA 1UROA 2OYLA 3W7CA 4UOJA 2EHHA 5MHBA 4BWLC 3E74A 1SO4A 4FNQA 3A4XA 1MW3A 4H4IA 1TPFA 4KWUA 6A3HA 4LAZA 1YRRA 1OCBA 4X63A 2FB2A 1O5XA 1B90A 4U4MA 3LK6A 4NX0A 5SWUA 3GG0A 4QIUA 1KTCA 2EG8A 1T5AA 3W7EA 1LROA 2VT0A 4JCMA 3ZIZA 1JDAA 1G69A 3GTHA 1XGZA 3LHTA 5D33A 5GNZA 4WJ8A 4ZBCA 4DO7A 4GI6A 3LOTA 4QE1A 1ELSA 1HJSA 5C55A 2D23A 3ZLFA 4FA3A 4AZCA 5CGQA 4ZO6A 1JULA 2VOMA 4IP4A 5FACA 5JUVA 5B7YA 1W5QA 2ATSA 5F2LA 4E4PA 4DVOA 1G7VA 1BGGA 1KCKA 3ZR4A 1P4CA 4J28A 1KBJA 1J6OA 5A6SA 2CLMA 2YXXA 4L6OA 1XH1A 4YTRA 2TYSA 1Q65A 2IQ0A 4H83A 2VX4A 2VZSA 4RR4A 4HP5A 5I77A 3HB9A 3UQNA 3AJ7A 2ZOXA 3VD7A 2OT0A 2GVGA 2J4GA 1XSJA 3U7VA 3ABQA 2CLKA 1CENA 4M7SA 1REQB 1OY0A 1CYGA 4YVPA 3W73A 3RN6A 3LHUA 3RG6A 1AZ2A 1KFLA 3ARRA 1HT6A 4FLSA 4HA1A 5CZJA 1XINA 2XDFA 3LGDA 4YN5A 3RF9A 4YCPA 2BFGA 3MCOA 4NASA 3DHDA 4RE2A 1IEQA 4J3XA 4E3VA 5BXRA 3M43A 2OGYA 1VENA 3BUVA 1IHIA 4FXSA 2X0SA 3UEQA 1QHZA 2ZDRA 3M16A 2INFA 3U4FA 4BEQA 3PF3A 1WKYA 3TNBA 4D8ZA 3N17A 3ARUA 5EFDA 1VJSA 4KQNA 4NJGA 1E43A 3H7UA 2G3MA 4Q8UA 1XIBA 1CWYA 9XIAA 1QRQA 5D38A 4OKDA 2AMXA 1E9ZB 4UTJA 1K8XA 5DXYA 3DXIA 3CU2A 4GY0A 1TPC1 5CCZA 5AC5A 4FLQA 1XKYA 4YYFA 3I4KA 1E1CA 1L2QA 3IIVA 1R0MA 4QAWA 1DL3A 1TQXA 4HHHA 3SCWA 4A3RA 1P7TA 3QMRA 4ES4A 2Z25A 1YIXA 1E0UA 1CXIA 1BG4A 5E09A 7ODCA 1NOWA 2YZ5A 3UG3A 5EY5A 1TRIA 1QW9A 1H50A 4PB3A 2A1YA 4ZFMA 4HA3A 1BSLA 2DPEA 1L6YA 2DSKA 1MVYA 3QW3A 2DQWA 3VDAA 5ABFA 4WUIA 5AYYA 3MDWA 4KEZA 4MOZA 4TUFA 2RGMA 1VEOA 1W3KA 1RLDA 4GA8A 1CIUA 1U1JA 5HMEA 1SO3A 3KP1A 4BCEA 2CXGA 5C9ZA 4L5ZA 5DBUA 3TXVA 3WD3A 3W7GA 3RRXA 1Q85A 2DZUA 4B5XA 1AUSL 1E9IA 4LYQA 4C6DA 3QMSA 4LF2A 4JTDA 2NXIA 3IS4A 3LTPA 4GH3A 3PG8A 5FESA 1DPMA 3W1AA 2ZRVA 2DZVA 3UJFA 1EP2A 4A21A 4J3SA 1TPB1 1LBFA 1LWJA 4GIAA 3MWAA 5H6HA 1TJPA 3BURA 2P1FA 2O4QA 5LIWX 2PWUA 4PMOA 1QHPA 1WZMA 5EKYA 2Q8LA 4QE4A 2J7DA 4LALA 3VCNA 3T6CA 3DOPA 4JTFA 3C56A 2J27A 2W3ZA 3UA4A 1UR0A 1CB7B 4JN7A 2CYGA 4US5A 1UMYA 1KFCA 3CQHA 3A4AA 1U2YA 2UY2A 3AJXA 3LCHA 3KOFA 3W7PA 3GHRA 1R87A 3NG3A 1J0YA 3OVRA 1QUMA 3AHYA 3JRKA 1X39A 1P6BA 3OIHA 4HNTA 4RW5A 4YU1A 4I9MA 2ZTKA 3O9NA 2ZE0A 4HNUA 2D73A 3UW6A 3DG7A 3GNPA 3E2VA 2ZA2A 1FFRA 4N7QA 4R9XA 3WDJA 4DAIA 1E5JA 1JZ5A 2WKLA 2A0NA 1OFBA 3GW0A 3VYLA 1XLCA 1DEDA 1DYSA 3EWZA 1S46A 3GVWA 2X40A 3VDBA 2FZ8A 2CWNA 1T0OA 5BU9A 5A6AA 4MUZA 1NWSA 3AALA 3EEGA 3PZIA 1IT8A 2CZFA 3WIJA 1EUNA 3TQVA 2G4JA 4YLWA 4O54A 2PTDA 5CBJA 1XLMA 1TFVA 4OGZA 5LA0A 4DPQA 5G2WA 4GJJA 4OV9A 2ON3A 4W8LA 4IFKB 2AKMA 2QT3A 1B3XA 5K2ZA 4Q4KA 4JFWA 5FF2A 4DLFA 4CNSA 1CLVA 3OLGA 3GR8A 4Y8EA 1UR4A 4I9AA 4M6QA 1WOAA 3PZTA 4IIGA 1R5YA 4G5DA 4DUOA 4E3TA 3IIXA 2G3IA 1PE1A 1V6UA 1TE6A 1PWLA 4P7OA 4GI9A 1PWMA 3CQKA 1JAKA 3E0FA 7PTDA 1IIHA 3K5XA 3T78A 1I1XA 4NZCA 1YW1A 1UKQA 3GG8A 5I5RA 3IANA 4H41A 5LIUX 1ICSA 1LUCB 4G56A 1KKOA 5CG7A 4S3EA 1UQYA 3TOYA 4M5PA 2DT0A 4O15A 4ML9A 3MMDA 3KDNA 4N02A 1NP2A 1PO9A 4ZTYA 4IUGA 1HN1A 4OT7A 4UMBA 3M0LA 3WMBA 3RMJA 4H2HA 4DF2A 1JZ3A 1M7PA 4JXCA 4KBXA 3LS9A 2XTKA 1EJ7L 2X42A 3SGGA 2HK1A 2IPJA 3S5SA 3FAXA 1B9BA 1XUUA 4BF7A 3LNPA 4O1AA 4JKMA 2ZFAA 1DHPA 2V2CA 1PKMA 1MQRA 2WM0A 3D6NA 3ZT5A 4XVDA 1ZP4A 1F76A 1WAWA 3CJPA 4JBRA 4RKAA 4KKXA 3LXBA 2P76A 3LM3A 5GQBA 5BNKA 1H1YA 1ONEA 4AVNA 3W7HA 4Z1CA 3ABSA 3PC0A 1T99A 2DQXA 4RZ6A 4MB5A 3RPMA 3DFQA 4LYRA 4V1YA 4XKYB 4WXYA 4XD6A 3PG9A 4XVEA 5TAOA 3QV6A 3IJ9A 3W1XA 4NAEB 3FN9A 5IM51 4AMCA 4OHQA 4DF1A 1WUEA 1V02A 2Y70A 4CNPA 3TYDA 1XQLA 2W27A 1W9DM 1WDQA 3CASA 3QLLA 4NP7A 4M82A 3NFUA 4AZIA 3DBNA 3PZUA 3NPVA 3I10A 3GXFA 1I2QA 2DDXA 1W3NA 1H7XA 5DELA 4RL3A 3T8LA 1VRXA 1EKOA 1KCXA 4K8HA 3RITA 1ISXA 3WK1A 2G3JA 1Y5XA 3GNRA 4MB4A 2BOEX 3UY7A 1MXDA 4DZIA 1DJQA 1ODZA 1ZENA 1G67A 4ICMA 2Z1SA 5I06A 1LZOA 4MZ1A 2EXOA 4NIRA 1EFZA 1VPYA 4D1JA 1XLLA 1XRTA 2OXNA 5F1UA 3IJDA 1CDGA 3VKJA 1ISZA 2DIKA 3D3AA 2YBVA 3GU9A 2PEVA 1EJTC 3P80A 5A6BD 1Z6KA 1C8QA 2FIQA 1UR1A 3VKAA 1AZ1A 2GVLA 1V7AA 3NQ6A 1K8YA 1IYXA 1X7FA 1TPUA 1WP6A 1ZBWA 3L5MA 1JJKA 3PSVA 1KNWA 4XBJA 1HFBA 4LW7A 5LGXA 1S5VA 4LBRA 1C8XA 2GJNA 1XLDA 3HJZA 1LQ2A 4ZQOA 1Z9AA 2FVLA 1QW8A 4D6HA 5REQA 6REQA 1AQ0A 1JZ4A 1AW5A 1EJWC 4OV4A 2RDWA 2HJPA 2ZBTA 1L8PA 4RDWA 4HD5A 1OFAA 3QN3A 1R2SA 3OA3A 1JD9A 2PWGA 3NQGA 3UCQA 3VOFA 2V82A 1LL4A 1RP8A 5FOOA 3SW6A 2PP0A 2PCEA 2YCJA 4OVXA 3RLUA 1U83A 3QC0A 2H9AA 1P0DA 3UP8A 3SY1A 3FDKA 5JXQA 3H24A 2HVOA 1OINA 1DXIA 4RV8A 1UP3A 1R2RA 4DO5A 4ICNA 3W7LA 2HROA 1HP5A 3UZWA 3EWBX 3NIYA 5CPNA 2JF6A 4CD6A 3VDGA 3RM9A 7A3HA 5LXEA 1FXQA 4JX6A 4Y9MA 5G1YA 3CIVA 3N4EA 4M8UA 3W2UA 4F0KA 4UQ9A 1RCXB 1UYQA 2DSVA 1GORA 4Q8VA 2JQXA 3HO8A 3A9IA 3V1PA 3HPAA 3NXLA 1FWBC 3WNKA 2BGSA 3T05A 1NFGA 4KF1A 1KM6A 5LXXA 1GJUA 2I5QA 4RCXA 4GUIA 1X6NA 4AMAA 1L6FA 4J3WA 3P8JA 2QUMA 1J4EA 4JY9A 5D8WA 1XLEA 2OCZA 2YW3A 1MEIA 2BHUA 5F1VA 4QCEA 2BVDA 1LLZA 3C6CA 4B91A 3G22A 2V5DA 3SCTA 4WDXA 1JPKA 1ADDA 4PH6A 2HQAA 4JL1A 1T8XA 6ALDA 5ABTA 5JH2A 3P61A 4QCFA 1OHLA 1Q6OA 2ALDA 1NDYA 4QEHA 1WZKA 3POHA 4S39A 4IQDA 1KRCC 2AKZA 4QISA 4I5XA 4MWAB 5A6MA 1WXJA 4R88A 3CBWA 3TQPA 1JPIA 1U33A 4UR9A 1K7XA 2QUTA 3L0KA 3UNDA 3N2BA 3ZJ7A 1WDWA 2PLKA 3ZXWA 2CIPA 1IZJA 2ZX6A 3WO8A 3P60A 1EZ2A 4O28A 4XTIA 3RFAA 1CXEA 1WDPA 1XI3A 2DT3A 1VFMA 2A2IA 3WNOA 4AHQA 1LRQA 4M19A 2GUYA 4L4OA 2JIWA 2OX1A 4O1EA 4V28A 2HBVA 4PBEA 1VKFA 1N8FA 1ENUA 3FX4A 2OEJA 3GH5A 1OGBA 1BQGA 4CNTA 1V0LA 3CV7A 2X30A 3N2MA 2QULA 3PZQA 2ASHA 4CD8A 1W1TA 1WZAA 2AQWA 3G3DA 3AS2A 3ZSSA 1QWKA 3SI9A 4OBRA 4Q32A 3LZ3A 2Q71A 3ZFHA 4PMUA 1H7WA 5AYXA 4XZMX 1LCOA 1UJPA 2ANUA 3UWZA 2ODOA 4FHAA 2W4XA 3BZJA 2DZTA 4WDWA 1UR9A 8XIAA 4TIMA 1ALDA 5C9UA 1JGMA 1R3VA 3HV9A 4UR7A 2OO0A 1JL8A 4IIFA 3AMCA 4LVAA 2PP1A 2WNQA 3AHZA 1P1MA 3C2OA 2J62A 3BJFA 2G8ZA 4V27A 4PBGA 4MAZA 3NQ8A 5D4YA 2VCAA 4E0CA 1QPKA 5C2CA 1QAPA 4GPNA 1OBAA 3VUPA 1Q6QA 1JUKA 1US3A 1T40A 4U3CA 1H4PA 3M0JA 4KW2A 1QVBA 1JAEA 4NAFA 2YYUA 2QJMA 2Z1KA 2KX9A 4I9JA 1E56A 1WOBA 3SUUA 2AL1A 4JGDA 1BHGA 2VD9A 1UWRA 1XSKA 3RILA 3IV8A 3B9OA 3FNDA 5I24A 3VM5A 1J5SA 5A6TC 3QOMA 5FAGA 2BY1A 2E9BA 3KE0A 3YPIA 4EWND 4QROA 1EQPA 1MW0A 1Q6GA 5KITA 4AISA 3WQWA 5CEWA 5HQEA 2V3DA 3S42A 4B15A 2YBUA 1XCWA 5C2XA 4H7ZA 1LG1A 4MWAD 1JZ8A 4YMZA 2EPOA 3ITCA 2X7WA 2Y85A 5ECVA 1NFPA 3CLMA 5CC3A 5TBOA 2EBNA 5EBUA 4UQBA 2ZKMX 3ANVA 3PZGA 3W1TA 3G0SA 3PUGA 3WQ5A 2YL8A 4U28A 3BLIA 3WELA 1BVZA 1FY6A 3UZJA 2CESA 3GO2A 2YDQA 3OYXA 1RD5A 1SR0A 4EAMA 5JQ9A 3W7IA 4HNVA 1QMLA 4FXFA 5E70A 3VIHA 3FXGA 3BL3A 4DZAA 2J77A 1AD1A 4JDYA 5HWJA 4DX3A 5MKGA 2Z24A 1F3WA 1HKVA 2GWGA 4KESA 4PTWA 2XIOA 3WQ6A 1UZ1A 2PS2A 2PTZA 2WLZA 5CAKA 5E6YA 4WY0B 3CAKA 2OOGA 1LDCA 3A64A 2WHMA 3S5ZA 3GKAA 3NPWA 3S6DA 9RUBA 3SSZA 3MA8A 5DCDA 3QOKA 3W85A 2D2GA 1GOIA 3CEUA 3EX1A 4UFMA 4Q7BA 4OFCA 1QO2A 4IQJA 3CUXA 5E9XA 3OHMB 1VGAA 3F5JA 3MI6A 5DBTA 1VAHA 4NI3A 2OSYA 2CLPA 1ZLPA 3OLIA 4CCDA 1Z32X 3IUHA 4IIHA 4ZOBA 1E72M 2QKFA 4QSHA 5CG0A 1JZ6A 4LB4A 3WMCA 1X8FA 4ZQCA 1UPPA 1E0XA 3H2FA 4OE7A 5D8ZA 2UV8G 5CSYA 3FCPA 3VIIA 3IGHX 4JQ3A 3CWOX 3W22A 3QEZA 4HSHA 5AC6A 4IFOA 4PBFA 1VFTA 5IFPA 4XZ9A 4J5NA 1Y5VA 5GNXA 3CGTA 2A6NA 3TDFA 2A21A 4B5TA 2XIMA 4GK8A 4NJIA 3CPUA 5G1MA 4ZENA 5C7HA 4K36A 4PTNA 1E55A 3JZUA 4UB9A 4CQBA 1F2JA 1VYSX 5EMJA 2ESCA 1Q7MA 3G1DA 3GBEA 4RK8A 3NURA 1IT7A 3FYOA 2ZCGA 1PIFA 1W54A 3SADA 3BLPX 3SCNA 4WDUA 5CJNA 4U31A 4CQ9A 5D9NA 2OWXA 4L9ZA 2E6DA 3FEMA 3KL5A 4HK5A 3PJTA 3I3BA 3VD9A 1FH8A 1W1B1 3EDJA 1JR1A 4D6GA 1XBYA 3LV5A 4ZSTA 5BROA 5BCAA 1A5AA 1X97A 4OBTA 4D1IA 3PPGA 3KVMA 2GSEA 4PMJA 1UH4A 4KWSA 3NQAA 1J10A 3TC3A 3GVGA 5K4XA 3FHAA 3NZQA 1FHUA 1VZWA 1P0BA 4C91A 3GHSA 1ADSA 3LRKA 2GGJA 4DBUA 3GNXA 1R3YA 3WQCA 3IJQA 4BR1A 4GC3A 3E0IA 3LGGA 3AZSA 3LI0A 2WO5A 1EB3A 2VUNA 4H6KA 2Z7KA 3D47A 1W1PA 5CSRA 4HBKA 4MWAE 1UP2A 3KTCA 4L80A 3FFSA 4IOTA 5LIXX 1KGWA 3ES7A 3VNKA 5JIWA 3T0BA 4OZOA 4GJIA 1YXDA 4D6EA 1F7BA 3I6EA 2VQUA 2QF7A 2YW4A 1U5VA 1JZ2A 2W63A 2QJGA 4JTAA 2OWCA 4GVHA 3W7KA 3BLDA 4IG2A 2ZUVA 3DG6A 1UH3A 3K4DA 4PSPA 1F61A 3L7RA 4LWWA 2X1SA 3WBXA 5F2IA 1E6QM 4G7EB 3V7PA 2PDLA 1CGTA 3PWAA 4DF0A 1EH9A 3CZGA 3G1AA 2TAAA 2FHFA 2DORA 4PMQA 2V5JA 4WIWA 3F2CA 4CQ8A 1SO6A 2I17A 3HPXA 3TWAA 2VFIA 3B4UA 4EXAA 5JU6A 3MUIA 5TNVA 3QMTA 4WSHA 3IPWA 3FS2A 1GKPA 3BE7A 3VFLA 3RX4A 3HQ1A 4JNZA 2GSJA 1J2BA 3E96A 1UOKA 2WVVB 2VDGA 5L6UA 4U2YA 3C8FA 4C6MA 3KVLA 2Y7EA 2SFPA 3VNZA 3B8DA 2E4TA 4DZHA 4Z42C 3ZT6A 3NXFA 1ESWA 3ARVA 4ZOEA 1PDYA 4UNLA 2FH8A 1E70M 1XUZA 2Z2UA 1YQ2A 2WZHA 3QYSA 2PF8A 3ARQA 3M0VA 1MRAA 4MKVA 4O11A 5DMYA 1H62A 4X61A 1V79A 2XVKA 2VX5A 3BAWA 1BAGA 3TC6A 4O14A 4G7EA 5HNRA 1B3WA 1RVKA 1YDVA 4QJ1A 1VB9A 1GVRA 1YTKA 2ZX7A 3UR7A 3TJLA 1QDSA 2PDHA 4LGXA 1W37A 5J5RA 4WKHA 4IG2B 3IVSA 3H26A 3G77A 2XUCA 4OUEA 3NQDA 4JTEA 3TYAA 3N2XA 2RAGA 3N2OA 3W7RA 4IZGA 1TV3A 4PSRA 3SRHA 3MUCA 4MKSA 5EL1A 3GRIA 3LQGA 2NV1A 3H2CA 1AW2A 1V4YA 3AIEA 1S1RA 3ABOA 4UZSA 3SIMA 4L65A 3Q65A 4PTDA 3VNDA 4GLEA 2AQVA 2BBFA 5FEZA 2DP3A 1TV7A 1VR6A 1B57A 4ZEPA 2BXVA 1QNQA 3UZYA 3KEHA 2HBXA 3LD5A 4OWGA 1X38A 1U1HA 2WAGA 1NSJA 3GTFA 5BWAA 1AJZA 3G1VA 1SSGA 1D3HA 1XLHA 4W85A 3CUZA 1NTHA 2BWGA 4H8NA 4I7UA 4S3CA 1Z8AA 5HWNA 5I7GA 1S5MA 2V5KA 4PB4A 4B9ZA 2CPUA 1ZFJA 1OEPA 3C2RA 1XDLA 3I6RA 4LSBA 5BRPA 5KZEA 3EAUA 1JZ7A 2PRHA 3WEOA 3CZ8A 3DGRA 4GJ1A 2VXNA 2D0GA 4TOQA 4W4QA 1GVEA 4BQ2A 5C9RA 1V6YA 5FEXA 2B81A 3MKVA 1US0A 5A8NA 4KIRA 3HOJA 1RJQA 1LJYA 1E0WA 3BJSA 3SY5A 1JCXA 4DQWA 2J74A 1QI5A 3N3MA 5TF0A 1E6XM 2MANA 4DWSA 5REQB 1CXHA 1W8SA 4FI4A 4FNSA 4YHGA 4C1NB 3WL1A 5KEZA 1DJYA 3TTEA 4O13A 4UOQA 2FGBA 3CO8A 5IBXA 4UTUA 1ISWA 3EYPA 2J6XA 3T0DA 3UR5A 4JFSA 2ISVA 3W6MA 1UCWA 2ZXBA 2JE8A 2DW7A 2XM2A 3PY2A 4TR9A 1SFLA 4AD4A 1ZJBA 4WZHA 3OHIA 1TSIA 3CUGA 4Z2IA 2CNCA 2FJUB 1TWZA 1UD4A 3QTPA 2ISDA 2X2YA 2POTA 3HMJG 2GL5A 3MYPA 1NVMA 4C7GA 4X0NA 3RPTA 3NO3A 1GOQA 4CCZA 3QKZA 5LKYA 3N73A 1K6AA 2Z6JA 2C3ZA 3PSWA 3MY9A 2VZUA 3CZKA 3VGHA 2OLSA 2RDUA 4IF2A 4JZ5A 1J79A 2DH2A 4QG9A 3EOEA 3SR7A 5DY2A 2VENA 1BWLA 5D04C 2VDHA 3BC9A 2A3BA 3QHMA 2AL2B 3KRBA 2ZA1A 4Q22A 4DELA 2OOFA 2QUNA 4O4VA 1GONA 3WNMA 4A8IA 4O52A 1THFD 3QYQA 2YSWA 4Z2HA 2BB0A 3V4BA 1U22A 1EDGA 4XTDA 4PTVA 3QH2A 1GTEA 4CNOA 1BG9A 1GVFA 3W2MA 4E2BA 4OOZA 1H5VA 2F61A 5D2VA 2NT0A 1OJXA 1ZQ5A 2BY0A 3BOXA 3OZYA 1VLWA 4H9MA 4PZVA 4FNUA 3BW3A 3TLQA 1M7JA 1H63A 2FTWA 1J0ZA 5C2GA 3XINA 2DVXA 1A4LA 1EF3A 3ITXA 4HT3A 4ZSUA 4R7OA 4HPXA 2HMCA 1Y65A 2NUXA 3PB2A 3M6DA 1EHNA 4GABA 1VYRA 1HNYA 3EB4A 3CUIA 1HO4A 2GVJA 3LHVA 1IE7C 1KR1A 3TLLA 3TYEA 5D05A 3P74A 4GOAA 3WLLA 4ZO7A 3TOPA 4Z08A 2VNCA 1FWTA 5I00A 1KBKA 2D2HA 3OP2A 1PTGA 4KCVA 1YBQA 1JYNA 5IHRA 3OPSA 2C0AA 2XVNA 2C7FA 3NO5A 4M80A 2O7SA 3SQLA 1H41A 2V0TA 5KZDA 1X6UA 1RBLA 3GX9A 1A0CA 4MNKA 1E40A 3FXYA 3MMWA 3M0HA 3VIGA 2VEPA 4C5ZA 1S2VA 3EMQA 4R27A 5G2HA 5D30A 3WEZA 4HYVA 1ZSXA 4L9YA 1TMQA 3H2EA 4JEJA 4JQ1A 4PCTA 5D9MA 3ZR5A 2G95A 4GYJA 1KCZA 3PTQA 2PTWA 4DI8A 3LLFA 4ZODA 1SPQA 3ARPA 3WYZA 1HKKA 1GQIA 3HGRA 5TQLA 2HNHA 2PUZA 3WD4A 4DXKA 3ZWSA 1A5CA 4B3ZA 1H7PA 4NAFB 4GY1A 3EEZA 4U5IA 3GLCA 2G97A 1H0GA 2A3LA 3QQ1A 3RO8A 4W9TA 2FFIA 1UR8A 4LH8A 4PFMA 4NJKA 3T40A 4X9YA 3IUIA 4O8RA 2NSOA 3DH7A 3R89A 3L4XA 4U3AA 1R3SA 3PBUA 4B2DA 3EKGA 4S2BA 4S23A 3W76A 2Z26A 4HZ7A 4Q6JA 3BLLA 2YFOA 1EO7A 3UERA 1MEWA 4LVGA 2MNRA 1YNYA 3LXAA 2FQIA 1W1ZA 3NL3A 2WC4A 1NWUA 3S8HA 2E09A 5AC4A 2VRKA 2WXDM 4D8LA 2DSZA 3WQGA 5HINA 1GHSA 3GSMA 4CCEA 3WK0A 2D3LA 2XU2A 1VPQA 1W32A 2JGYA 3TU9A 1MUMA 1GOWA 2Z29A 1WBHA 2ZC8A 1XIJA 3HMCA 4MF4A 1KFKA 5DRIA 2O9RA 1LRNA 4FK9A 3PNUA 3S2LA 1EHAA 3ZSTA 4QJ4B 4C6OA 1C8VA 1EP1A 1SJBA 2DJXA 3AIUA 2YJQA 2IPGA 4GVIA 3G0XA 3LLDA 1SW7A 4JKKA 4HK6A 3ZO9A 3H8AA 2HV5A 4RE3A 3E49A 4RW3A 2PU1A 3VI2A 1FOBA 2HVNA 3CQJA 2NWSA 1YE4A 1H5YA 1JYWA 1JRBA 3O05A 1E71M 1UMLA 2R94A 4N6FA 4PUUA 4HJWA 4XUYA 2PBOA 3AYSA 1K03A 3VZYA 4IP5A 5FCZA 2XYLA 1PB0A 5EA9A 5I03A 2DZBA 3A47A 1EGVA 4JNMA 3WH9A 3VA8A 3CUJA 2X1UA 1TZZA 3PBMA 2WMFA 1RQHA 3MHGA 1ZB5A 3VCRA 4PRTA 4DJDA 4Q4SA 1RPKA 3TIMA 2REQB 2PRMA 2VEGA 3W75A 5CZSA 1K8CA 3WH6A 3NQ2A 4IIEA 1ZBKA 4IH3A 4LT9A 4IX0A 3F2BA 2HNEA 2X7VA 5HA7A 2V67A 2VFGA 4AXKA 4GY7A 3TW6A 4K37A 4L56A 1LL7A 1B30A 2ZUUA 4KEVA 2B7QA 4J4KA 5DX7A 1OGGA 5E0KA 4CD4A 3LV6A 3VKBA 1KQZA 3PJXA 4MDOA 1GVQA 4PULA 1KXHA 4CLMA 4MLRA 2D0FA 3QF0A 2Y8KA 4HPNA 1VD6A 1KRAC 3MANA 4S38A 1ZJAA 2JALA 2AL2A 1NAL1 4GRSA 2WCGA 2FPVA 2GJRA 1Q8JA 3AISA 3CC1A 1BSIA 1P1XA 1HKIA 1XF0A 1BVNP 1DWJM 2G96A 4XO7A 3M07A 3IGUA 1TV4A 3U0HA 3OEXA 1R2TA 5HAOA 2VEFA 3PULA 3VIJA 4Y7EA 4S3BA 4TTUA 7ENLA 3UF9A 5M3WA 1QT1A 1R86A 1NQKA 2GQ8A 3IRDA 5I23A 4JKLA 2FZBA 3PANA 5FD0A 4GQBA 4EWJA 3LCXA 3MSGA 2BVYA 1K77A 4GKLA 2J25A 2VD8A 5BWFA 1K4GA 2VI0A 5D37A 1REQA 2VUYA 3WSUA 1PKYA 5LGZA 3A24A 1JUEA 4EXBA 2J13A 4DXXA 2QPUA 3H23A 4NQ1A 2Y89A 1TVNA 4C1NA 3CUFA 1KFWA 1TTPA 3NQMA 4F2BA 4J3TA 1T6MA 1OGSA 4MWAC 4H9ZA 3LSBA 2BMBA 3UJEA 1FCBA 1HQTA 4MB1A 1TUFA 3VMOA 4AY8A 1ME9A 4GWEA 4ZE4A 3BGGA 5TD4A 1DIDA 1SYTA 4XB3A 3PZNA 1KM0A 4X2PA 1XISA 3GW3A 2D1ZA 3GYEA 4Q4QA 2QYGA 2GGGA 2YDRA 2ZDSA 2G0WA 3A22A 1A5UA 2WC7A 4DWDA 2RDTA 3UPBA 1CX9A 1GZ1A 2WPGA 2TRSA 1RK6A 2WZTA 1FHLA 3XIMA 5BMXA 1R6WA 2VC9A 5I6SA 4LEFA 1UG6A 1UD2A 4XAZA 1V6XA 3CPRA 4X0VA 1KGUA 3UXAA 1D2KA 4LCQA 1W0MA 3M5YA 4FOJA 1KR0A 4DNHA 3ITLA 2Y8VA 4Y8FA 4F0LA 4XKYA 5AHFA 3VU2A 1GOOA 4L1XA 5ABHA 4K7VA 4W84A 4D6IA 5I3FA 2Q09A 2WANA 3W7OA 4LUTA 1RSCA 4ILSA 1ICPA 2AMGA 3MCNA 1S5NA 2PDBA 3SIZA 4F0MA 3N9RA 2DUAA 1DIOA 1SZFA 2WVVA 3BDKA 1TJRA 3E38A 3ICJA 4F2TA 5C9XA 3BQ5A 4E8GA 3SJ3A 1QNRA 3KRSA 4H2CA 3VPLA 3O15A 2HZGA 3JUGA 4R9OA 1ISVA 4Q4MA 4WKAA 3FV9A 1J11A 3OQEA 3OZMA 1O95A 3GBDA 2J7EA 2EKCA 3U57A 2ATMA 4Q8WA 4EPEC 2WZMA 1DORA 4B9YA 1W9XA 2FPYA 4GD0A 4ASTA 3HG2A 4UFJA 3KCJA 1B0IA 2GGEA 3UWWA 1UPMB 3SGZA 2VHLA 2ZADA 4JYDA 1GOMA 1HW6A 3MJMA 3AC0A 1XYMA 1HL8A 2IKJA 3F4VA 3II1A 4K2SA 3BK0A 3EXRA 3E5PA 1JNEA 1FFQA 2F6KA 2E77A 5HANA 3F4DA 1XHGA 2J79A 1L6WA 3O6YX 1XGEA 5DRCA 2OELA 1BKHA 1FWHC 4UFHA 2X0HA 3IJ6A 1PYFA 5DANA 2CLHA 3NYDA 3QR0A 3AYTA 3ZR6A 2C1HA 5CZTA 2F8QA 2YL9A 1GTHA 3CHEA 5HPOA 4MJMA 3A13A 1PCWA 3ALFA 1MUCA 4JFTA 2XVLA 5KTLA 1K4HA 2RHGA 1XFCA 4LNCA 2WJZA 4LAUA 4LVDA 1YDNA 4PGLA 2WWCA 1VBRA 2QS8A 4J1OA 3GTNA 3RMEA 3I7RA 3WQPA 1W1YA 3NVDA 1GKQA 3DERA 4UTHA 1XGDA 3GZ3A 4JY8A 1E9YB 1PJ9A 1QHOA 3WF1A 2XISA 3BCDA 1PXGA 3FOKA 2EPKX 3N15A 3SFWA 1Z89A 2C14A 5D2WA 3VGGA 3M5VA 4XWUA 4AIOA 4AVFA 4DJDD 3P14A 2VGGA 2YKKA 3QPEA 4M3PA 4AZ5A 4PC8A 4PCNA 3K8KA 2V5LA 4Z17A 2OQLA 3AU6A 3KL0A 3AAMA 4XSLA 3FKKA 3BTNA 3TR9A 2R9RA 3CMJA 4LS0A 3MKCA 3R8GA 3F4CA 6ENLA 3H2AA 1F05A 1Q6FA 3WH5A 1OQFA 3R4IA 4F66A 2W62A 1V0KA 2PC8A 3F4WA 2XFFA 3W28A 2PGWA 1EP3A 2JKPA 3WLHA 2PP3A 3KBSA 3M0IA 3E2RA 4NY2A 1J6PA 2GFTA 1PKNA 1XLAA 3BAIA 1E4IA 2P8BA 1WX0A 1QI3A 1HIZA 3KOXA 1ZS2A 3C8NA 2O7QA 4FF7A 1V3HA 2J75A 2VZOA 1AQFA 3HQNA 4IFRA 4LB3A 5AHMA 1GG0A 1C7SA 1MEHA 3NM3A 3KZSA 1DQXA 3LCWA 2YDSA 2PDMA 3MYOA 3JVAA 1W56A 3BG3A 5G4HC 4HNCA 1TIMA 5I3HA 4DRSA 5HNTA 1Y0EA 8RUCA 1R46A 3SAZA 1CECA 3D3FA 4DIAA 4IGMA 3DUGA 1LF1A 3UVAA 4W89A 3EPMA 2E1WA 3SJNA 4MHBA 1UB3A 3QM3A 1I60A 1RLCL 3LBMA 3ARZA 1WXYA 3KW3A 3QGKC 5A1AA 4PUKA 3W1MA 4AD3A 4P2VA 4LCRA 3E9AA 3K46A 2OQYA 1PHWA 2BS9A 2WNNA 3ARWA 4TX8A 5GJMA 3VE9A 2ZTJA 1GQNA 3ARXA 4S2CA 1N55A 4IL0A 1GCYA 4S3DA 1IF2A 8A3HA 4WDTA 3PNZA 3NQEA 4J3ZA 1I2NA 2WMIA 3GXIA 1V3IA 2YDAA 5A95A 4F2UA 4O1FA 3PB0A 1XRVA 2VQTA 4U33A 4NZFA 3NSMA 3WLQA 4CU7A 3K30A 2A85A 3QY6A 3ABZA 2PDJA 1XICA 3WEMA 5JVLA 1CLKA 4W7UA 3FYPA 4NU7A 3P93A 5TIMA 4LBSA 3ITTA 5ABFB 1K7EA 3ONCA 4D6FA 4JIRA 3BANA 3TN6A 1BYCA 3LHYA 3B8SA 3IJLA 4D8AA 2OJPA 1XW8A 4Q4RA 3P8IA 4K8GA 3NSXA 4Z1BA 2EPNA 1J01A 3RDKA 1XC4A 1TUXA 1VRDA 2ONEA 4Z2JA 2V2DA 4GIEA 4KFPA 1IEIA 3MI3A 3A5VA 3G1RA 1K70A 2R82A 1VFOA 2XSXA 1KFJA 4IL2A 2BHZA 3ZZ1A 1B2YA 1ZAHA 1C9WA 3QY8A 1VHCA 3ARYA 5K7JA 4AZGA 5AHLA 2P53A 2XH4A 1BPLB 1TO3A 4NJJA 3KFTA 4LV9A 2GOUA 1G01A 4CN1A 3DCPA 4KEUA 3BLKA 5HXMA 1KV8A 2RJGA 1UH2A 3L66A 3FHQA 3QV8A 2NUYA 2A3EA 3KXQA 1UWSA 3MUZ1 1HKJA 4AYSA 1KLZA 1XIFA 2ZRZA 1I8JA 2X1IA 3V36A 1GQJA 2DZWA 1OC5A 1T41A 5J04A 4S3JA 4PCFA 1OB0A 5DCEA 1IR2A 3V35A 7TAAA 3B9EA 3L67A 5FEWA 3RO6A 1MYRA 1TG7A 1W3LA 1DXFA 1FWGC 1LTDA 4LUJA 3S83A 3AWNA 2BGQA 3B9NA 1GHRA 4AHOA 3WLJA 2I9EA 3NQFA 1X1NA 1RD6A 1HP4A 1E4MM 2PI6A 3CNYA 5LA1A 3WK3A 4DPPA 4J2PA 3XISA 1HF6A 3OLEA 3NOYA 5G4EA 2QUVA 1B54A 2PGFA 1GQKA 2Y7DA 2XSBA 2ZZ5A 1ZHAA 2FMOA 2QV5A 4GGHA 2OYKA 1KKRA 1Y5WA 2PDWA