3M5XA

Crystal structure of the mutant v182a,i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
219
structure length
212
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGPGETLRFADAAIVGRSIYLADNPAAAAAGIIESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 83
structure length 212
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m5xA00
2ZTJA 1JCLA 1X6UA 3FLUA 2OT0A 3P7YA 2V8ZA 1ME9A 4S1FA 2C15A 2FLIA 3UNDA 3W7IA 4MY8A 3L68A 5HQEA 1NF0A 4EOUA 4AWTA 5LKYA 4AHOA 4UR8A 3EX3A 2G97A 1TPH1 4MKNA 2NUXA 3H53A 1DHPA 4UIOA 1A5BA 5EYWA 2X2GA 3CEPA 1T0OA 3DI1A 4MOZA 1DORA 2A6NA 2E6DA 4WD0A 3P84A 2JKAA 1JUBA 1F05A 4N9BA 7TIMA 3SSJA 2V30A 1PV8A 3TR2A 4IX2A 4O10A 3WK0A 3EKZA 5DCBA 4GE8A 4S2CA 1KFBA 5F4SA 3U8GA 4UTKA 2Z6JA 2V81A 4ZQNA 4O16A 2NX1A 3W6YA 3HBLA 1SUXA 3EWUA 2E6FA 1QO5A 1KM5A 3I7SA 4PTNA 4DF2A 4NJHA 3GXPA 4AMAA 3NL2A 3QMRA 4EF8A 3LDVA 3GDLA 1J5TA 5D37A 3UD6A 1TYGA 1FUYA 2FJKA 4PA8A 3N14A 3W1RA 5AC8A 1WDWA 3K30A 3W7OA 1VZWA 2B7PA 2WKJA 2QEZA 4M6PA 3W7PA 1A53A 1XBZA 5K7JA 4YMZA 4BFAA 3INPA 4LRTA 5CZJA 4DELA 3G1VA 5A5WA 1OK4A 2GQ9A 3C3NA 4OBTA 3W1TA 3L0NA 1W3NA 1YDVA 1KM1A 2A4AA 3QQ1A 4QAIA 1KM3A 2DZWA 3QW3A 5HUOA 3LCGA 4O15A 3TUUA 2G5WA 1FXPA 4TIMA 4OQVA 2ZZ3A 3EWWA 3LCLA 4QIUA 3LHYA 4E2DA 1LOQA 2FTPA 4A21A 3CT7A 4H4IA 3W1PA 3TW6A 1MEIA 2YR1A 3TKFA 3STFA 1VCFA 4N9EA 5CKSA 1IXQA 2C14A 3W7RA 5F2MA 1UCWA 3NEVA 4LOCA 3CWOX 2E5CA 1IGSA 3USBA 3GIYA 5MHBA 5BW6A 4NUWA 1VQTA 2I14A 5IM51 3GAYA 5DELA 4K37A 2A7PA 3P5ZA 2CFFA 4L4LA 5LNVA 5EY5A 5E93A 4O8RA 2CLHA 2V2CA 1W37A 2BX7A 3W22A 2WQPA 2Y7EA 1HTIA 1PHQA 2ZZ4A 1OFPA 4FNPA 1KFJA 4OT7A 1UBSA 1XBXA 3GR7A 5KITA 3FS2A 1C29A 3P5YA 1HO4A 2C16A 4XKYA 3NXFA 1OYBA 3WK3A 5HUPA 1VS1A 4I9AA 2ZA3A 2B7NA 1QOPA 3Q58A 2J27A 2ATSA 4TO8A 1QWGA 1OABA 2Y7FA 2X16A 2A7NA 4DF0A 5K9DA 1K02A 1BTMA 1B9BA 2V2DA 3F4WA 5D2XA 3KXQA 3HPSA 3RFAA 1XI3A 1OVDA 4H6KA 4XKYB 4UTIA 4KKXA 2LLEA 3LRKA 1H50A 3HG4A 3IVSA 1RQHA 2B7OA 1F74A 1W56A 3OA3A 1H7PA 5IBXA 3OHIA 4WXYA 4I7VA 4JD4A 2RFGA 4UTTA 4NT0A 3RLUA 2Y63A 1LBFA 1W31A 4WOZA 1GVSA 2VEMA 3TQ0A 3DHDA 2WNNA 2GJLA 1DQXA 4AWUA 5K9CA 4PCFA 1KV8A 4O11A 1F2JA 1WOBA 5ABTA 3S1WA 4LVGA 3SI9A 1K03A 4Q33A 2QAFA 3G1AA 4NNCA 3LCHA 4HNNA 4KWVA 2Y88A 2NV2A 1ME8A 2WJZA 3UY8A 4B5NA 5E0KA 2CLLA 1ZHAA 3SFKA 3LHVA 3P60A 4YL2A 1L6WA 1GVFA 1EUAA 3NM1A 1VCVA 3QFEA 3W74A 3MI3A 1ONRA 2XN2A 3W75A 4ORMA 4XQ6A 3R2GA 3JS3A 2B4GA 5LSMA 3W07A 3TDFA 3O06A 5FEXA 1SZNA 1PVNA 5D2YA 3EEGA 3OVQA 5AYYA 4PL1A 3GNNA 3NO5A 5FEPA 3A9IA 3NOEA 4BF9A 3TSBA 2ZRZA 2I1OA 4RCXA 1QPNA 1F76A 3A5FA 1YYAA 4POCA 3NQAA 4M6QA 3JRKA 2ZDRA 2P10A 2ZCGA 3ABOA 3M47A 3IRDA 3W7KA 3DGRA 2CLFA 2WV8A 2HS8A 3VKJA 1ZENA 2WSYA 4JDBA 1OHLA 5K3VA 1OFOA 4MJZA 5AHLA 1QO2A 5DCDA 4ZL1A 1JQVA 5FI8A 4S2BA 2NUWA 4GJ1A 3CB8A 4ONVA 2VEKA 4FHAA 2CWNA 4JNMA 3HJZA 1TRDA 1TSIA 4JTIA 3HGRA 5HULA 1O60A 4AHPA 4MYAA 3QC3A 4ZQMA 4Z0SA 4UTTC 5F1VA 1DV7A 1TB3A 3BLIA 3FFSA 4O17A 1TPFA 3O6DA 2EKCA 3UXDA 4D2JA 5AC7A 3M9YA 1R30A 1F73A 2GJNA 2ZRWA 4NZFA 1GPWA 1GVOA 2GVJA 4GBUA 3WJZA 4MZYA 5K4ZA 4IGHA 5L6UA 1S3HA 2ZA2A 5AOUA 2ABAA 3MP4A 2DU2A 3KFTA 4XTDA 1I4NA 3DFNA 1RD5A 3ZS4A 2R14A 3NR0A 4JTKA 2DZXA 3GAKA 3B0VC 2GPTA 1MO0A 2C19A 4M19A 4IWWA 4IXXA 4FNQA 2RH9A 2QCFA 2PCQA 1D9EA 2W79A 1ME7A 3W7CA 5I3GA 4O12A 3NQEA 3V75A 2FFCA 2TPSA 4XUGA 3DH7A 3HGOA 1I8JA 3IIVA 4UNLA 4TR9A 3S1XA 3N19B 1TPWA 1KBJA 1EPXA 3IEBA 4JTEA 2J24A 1B4EA 1YADA 2QCDA 3LBCA 1Q3NA 4IOTA 3PBYA 3IIPA 4YCOA 4MUZA 3HPXA 3NQMA 1A5AA 2E77A 4BI5A 1OFAA 5CG7A 4AWSA 1XBYA 4LUJA 4MJMA 1HO1A 4X2RA 1TPVA 2ZBTA 1P0NA 4IMCA 4M5PA 4E38A 2CLKA 3G3MA 1Z42A 3M0ZA 4RJEA 1QDSA 4LC8A 1TJRA 4C1LA 4RK8A 1LZOA 4TMBA 3N9RA 3BVJA 3SGZA 1V7YA 3TJXA 1HFBA 2QCDB 3JR2A 3VE9A 2Y6ZA 3E49A 5KINA 1VHCA 1G6CA 5AHNA 4CNPA 1QNVA 4UMAA 2Y7DA 3ANYA 1FWWA 3TE9A 4IX0A 3VNDA 1AW1A 2YFNA 1FDZA 4JTHA 4M7TA 1LRNA 5FEWA 2X1TA 4FX7A 4E0CA 3QMTA 2QCEA 1U5JA 3FKRA 4JEQA 3HIJA 3BARA 2X1UA 4JTLA 5HR6A 4BR1A 2Y89A 4QNEA 1AG1O 5D32A 3EWZA 4UTLA 4PODA 3PR2A 1Z41A 3W70A 3W1MA 5EBUA 3MHGA 1GZGA 1LORA 3M16A 3S5NA 3LTPA 2F7FA 3PAJA 1NF7A 5KTLA 1OG0A 3ABSA 1LOLA 1C9DA 4P2VA 1K7XA 2DZPA 2FDSA 1FCBA 3NQDA 1IIHA 2ALDA 1M7OA 4O1BA 4MFDA 2NXGA 3I68A 1KV5A 3S1VA 5DBTA 3KVKA 3WK1A 2YW4A 2CLIA 1G7UA 4N6EA 1WBHA 3W3OA 2X1SA 1SSDA 3AJXA 4UFLA 2Y70A 1OJXA 1VLWA 3EX4A 2W6RA 4AF0B 1KBIA 5DXXA 4A3UA 1FCUA 1FX6A 1OYAA 3PWAA 4CLMA 5EPDA 3TW7A 3F03K 4U4MA 1ZAIA 5LZLA 3QEZA 1TTIA 5D04C 3KRUA 4GFSA 3QPYA 1K7FA 3LGEA 3C6CA 1TTQA 1IIGA 4BWLC 4AXKA 1SZEA 3KOFA 1WOAA 1KFKA 2R91A 2ZRUA 1W54A 3EXSA 4N6FA 4RZ6A 5I3IA 5F2LA 3NDOA 4O28A 2QDHA 1GG0A 1OF8A 2CZEA 4JIQA 4O0ZA 4UUIA 2WNZA 1JCXA 5G2IA 3G3DA 1HL2A 4YXGA 1GTEA 4QSHA 1XXXA 2YCEA 3C56A 1TQJA 3MHUA 3NYZA 4K38A 3W86A 3RK8A 3CTLA 1SO5A 3W1QA 3UZJA 1YPFA 2E5BA 3GDMA 4O54A 2EHHA 1R47A 3ZWTA 4QNWA 1M5WA 3QSRA 2IQTA 2YPIA 2Z0IA 2ISVA 1Q6LA 2YZRA 3GYEA 1VYSX 3PBWA 2NUYA 2C18A 3LTSA 2AAMA 1DVJA 3FYPA 1EA0A 5DBUA 5LNRA 2Z6IA 3FJLA 4IPJA 5AC6A 3M5ZA 3MW7A 3NZ1A 3B06A 3OBKA 2FB3A 3O8AA 2JGQA 1N55A 3TU9A 4O57A 3SGUA 3CC1A 4OU1A 3VI2A 4N2YA 3DENA 4WQ6A 3SZ8A 3O6CA 1JR1A 3W1XA 1G7VA 5CPNA 1LDCA 4O0KA 3E0IA 1PS9A 1KFEA 3PULA 2JKPA 4RLIA 2RKXA 3LCXA 5C55A 3O16A 1QPQA 2HS6A 3NVTA 2H3DA 2VEIA 3BW2A 3IIZA 5FF4A 3MI6A 1ICSA 5LNUA 3STEA 3C2OA 4Z1AA 2JK2A 1B4KA 1EWDA 2Z2UA 3DKJA 1I2QA 4HN4A 1P4CA 1W3TA 5F1UA 2P1FA 3S0CA 1EX5A 1FWTA 1JCNA 4FIRA 5AHIA 2Q8LA 4JTUA 1RQEA 3FOKA 4JIPA 5CSRA 1H7XA 3L0KA 3LLFA 5BOOA 3EX2A 3OVRA 2XN1A 1H1YA 1ADOA 4LS1A 3HG2A 3O6YX 3DFPA 4XBKA 1AL8A 2A6LA 3ATYA 4FNRA 3C2EA 1M7PA 2DZTA 3LXCA 3NA8A 4UMCA 1HG3A 3TA6A 4ML9A 1KTBA 3I7QA 3FA5A 3GDTA 4M6VA 2RHGA 3UY7A 3N3MA 1YTEA 4ZQPA 2JGYA 2H8XA 1IXOA 2QKFA 4JTTA 3KX6A 1C8VA 1OF6A 4GWEA 3C8FA 3M5VA 1JVNA 3QF0A 3GNDA 3GLCA 4LC6A 1E51A 1DJNA 2HSAA 5CZ0A 5BNKA 1W5PA 2DZSA 3C2FA 3NL3A 4NX5A 4JX6A 1EUNA 1UB3A 3P81A 2DZVA 1W3IA 3T55A 3NL6A 1UJPA 4DQWA 3W1LA 3NM3A 5DN1A 4LRSA 5D30A 4DBEA 4EWND 3KHJA 2UV8G 3M5YA 4FB7A 5K4XA 3QYQA 5F2IA 2ZZ5A 3HB9A 4NNBA 2ZA1A 3A5VA 3W83A 4HKPA 5F4WA 3TK7A 1J2WA 2NLIA 4X3ZA 1GG1A 5AHMA 2NWSA 4OGZA 5K9XA 3MI2A 3SW6A 2VC6A 5KZEA 2BLEA 2RDWA 1GWJA 4JYDA 1G4TA 1THFD 3E9AA 1ML1A 4A29A 3TNOA 3EXRA 3WK2A 2PURA 4JTFA 2FPVA 3GDRA 4MIMA 3GK0A 4PL2A 1U83A 2ZFAA 1ALDA 3P8JA 2J9ZA 3GZ3A 1TJPA 2YW3A 3EX6A 1Q6RA 5TIMA 2QR6A 4JX4A 1J4EA 3HMJG 2QF7A 2V82A 3LLDA 1LBLA 2GOUA 4MY1A 1O5XA 2A1YA 3LCFA 3GB6A 3UWQA 1LLZA 1W1ZA 3LRMA 1OX5A 1XDLA 2O7QA 3MBDA 4O52A 4XTIA 2H6RA 2PRHA 4A22A 3CEUA 3LTYA 2B0MA 5SWUA 4DO4A 5G5IA 1I45A 2A7RA 4A2RA 4PEKA 3BG9A 3TQVA 4DEFA 5EMUA 4UC5A 1VCGA 1L6SA 1TRIA 2NX3A 1OK6A 5I3FA 2RDTA 1W5OA 3S5ZA 4MY9A 3BGGA 2P0OA 1GVRA 3S6DA 4GUJA 4YCPA 3GVGA 5CSSA 3EWYA 5D38A 3WJXA 1AW2A 5TQLA 4WY0B 1H7WA 3MYPA 1YTKA 3L5MA 4JDYA 3L65A 5FF3A 1D3HA 4ZMGA 4QITA 4QM1A 3C4UA 2ZTKA 3U2OA 4I7WA 4OV9A 1SFLA 1W0MA 5T26A 4MLRA 3DFTA 3GDKA 5LNWA 3STGA 3O07A 1SW7A 3V1PA 3Q37A 3RNDA 3ZR4A 2OX1A 4CCCA 2H3BA 1DQWA 4RR4A 1GJPA 4HSNA 3W76A 4JYEA 2G96A 3LHTA 5HR7A 5I3KA 2BXVA 4XBSA 4JN6A 1WQ5A 4RXGA 4NJGA 3PC0A 2CU0A 1DL3A 4NX0A 1TCDA 1I2OA 3UWUA 1WYIA 3NQ8A 1YDNA 3P61A 1AL7A 1TREA 1OFDA 4Z0JA 4UMBA 4FX8A 3W2JA 5I3JA 5EKYA 4CQ9A 3PUEA 4X9SA 3G1SA 4OHQA 2F84A 3LXBA 3SIZA 1TPUA 3BW4A 2YXGA 2GUUA 2A0NA 1OX6A 3DFOA 3DBPA 5KZMA 3E02A 2FB2A 3TFCA 3NPWA 4RX0A 3ZFHA 5CPLA 2R94A 3DZ1A 3L67A 2ABBA 2QAPA 3PS7A 1OYCA 2YYTA 3SECA 4M7SA 4JTGA 4JGDA 1SQ7A 2C1HA 1JCYA 1O5KA 1YLVA 1FXQA 3L21A 1DBTA 1LROA 3LI1A 1IXNA 3W7QA 4PC8A 1XDMA 4LT9A 4NJIA 5H91A 1W5MA 1SO6A 2E5DA 2ZQ0A 4WX2A 3W7HA 1XM3A 2PRLA 1CW2A 2TRSA 3KRSA 1H62A 2YDAA 3W9ZA 3N34A 1OX4B 1SR9A 1TV7A 4XWUA 2X1RA 1PHWA 3MUXA 4ZQCA 4IPIA 2H8ZA 1Q45A 2NX9A 5I3HA 1B3OA 1G4SA 3TAKA 3LRLA 1N7KA 2NWRA 4IMGA 8TIMA 4YLWA 4K39A 5KZDA 3G1DA 1X8FA 3CLMA 4DPPA 4ZZ9A 3GKAA 2C3ZA 1LLWA 4Y9AA 2E09A 5BMXA 2E1DA 2VXNA 3O05A 1FCQA 3H54A 4IXHA 1KW1A 3NQ7A 3TH6A 1QOQA 5DCEA 5HWMA 1X1OA 4MVAA 1QPOA 3CQ0A 4WOQA 3TXVA 3C2VA 2WOQA 3HO8A 3L5AA 4RXFA 1BWLA 4ZQOA 1H1ZA 3A23A 1QCWA 5EL1A 4Q32A 3NQCA 1TQXA 2DZUA 1LP6A 3UPWA 2GQAA 3LM7A 2QUUA 5G2WA 1SW0A 4LV4A 5CZSA 5FF7A 2TSYA 1NAL1 3C61A 5BRBA 5LHEA 3GXNA 2OJPA 4BWLA 4R7JA 1OFEA 1JCMP 3DFQA 2Y85A 3SY5A 2YGYA 2V2HA 1QAPA 1NFBA 2X30A 1TPB1 2BWGA 3ELFA 1WXJA 2A21A 2W0UA 2ZYFA 3B04A 4Z1CA 3TCEA 4DF1A 4JICA 1F7BA 3WJSA 4JXCA 3ZWSA 4GRSA 4XZ9A 5FF0A 4RV8A 2PRMA 3S9YA 1S5VA 3LOTA 3EB2A 1X1ZA 4C1KA 1G67A 1T99A 5DXYA 1TV8A 4KFNA 4ADSA 3AO0A 4WXZA 2EAWA 4WZHA 4FNUA 2B7QA 1XUUA 3P8IA 3UPBA 3LHUA 4O19A 1K8XA 2QCHA 3P62A 2GVGA 4AF0A 2Z1BA 1LTDA 3W84A 1Z48A 3IV3A 2NXIA 3R89A 3G8EA 1Q6OA 4UXDA 3QM3A 3UWYA 3HG5A 3EWXA 2C6QA 5AB3A 1LRQA 1EB3A 1RV8A 3I65A 4N9CA 3TV8A 4FNTA 1NVMA 1YXYA 5KMYA 3IIXA 3MBFA 2ISWA 4J9JA 3MWAA 3P67A 3M7WA 1R46A 3FYOA 1TIMA 4UTUA 3W7EA 3C2RA 4K8HA 3OEXA 1GQNA 4FF7A 3A21A 2WO5A 5E1QA 1N8FA 1W8SA 1VH7A 3Q94A 4N4PA 2Q3OA 1SO4A 4N4QA 4NZJA 1L9WA 4Y6GA 4WUIA 2AQWA 3LCIA 2ZZ7A 1G4PA 2VOMA 3S1UA 4UFIA 4ALDA 1X7FA 3M41A 1WAUA 2ZRXA 1H7RA 3M43A 3FJ6A 3W85A 3G0SA 2DP3A 4CCEA 2E6AA 1RQBA 4H3DA 3BG5A 4PFMA 5HMSA 4MZ1A 3I7RA 1I2RA 1GTHA 3HG3A 3PM6A 1YXDA 4IJBA 3BK0A 3QRHA 4MPQA 5FESA 1WV2A 3QQ0A 2QJIA 3W87A 1FDYA 2XN0A 1VC4A 4AHQA 4BK9A 4HSOA 1GT8A 3TC7A 1XKYA 3W1AA 1UASA 3CPRA 2DJXA 3F4NA 3MO7A 3BG3A 4A2SA 4DO5A 2V5LA 5D33A 1KM6A 3R5EA 1TPC1 3C52A 4ICNA 1P5BA 2CZ5A 5LGXA 4LY8A 3FEMA 4AVFA 4UTWC 4GUIA 4CNOA 4LVAA 1SFJA 3QW4B 1ICQA 3Q2DA 2NV1A 4LWWA 5DY2A 2DJLA 3SR7A 4N9DA 3CM4A 3RF9A 4HNTA 1XC4A 5C2XA 5D2TA 1FBAA 3W1UA 3TXZA 2O7SA 3PY2A 4IMDA 1XUZA 1YDOA 3IGXA 1WBJA 3UWZA 1JUEA 3KRZA 3QMSA 1H61A 1JQXA 2J9XA 1B57A 4K36A 4TX9A 3LHZA 4FEZA 4O13A 5LGZA 2Y62A 4IMFA 2QCNA 3EWBX 2HMCA 3OVPA 3HGSA 1T8XA 1KLZA 4JTJA 2XFWA 3KVLA 2OMAA 3HF3A 2J9YA 1A50A 3G18A 3TX9A 3ATZA 4UFHA 3G1FA 3L66A 5L9FA 3PBVA 3IVUA 4EVZA 1UUOA 3NG3A 5AHEA 3PUDA 4JS3A 3G1XA 3THAA 3MMTA 4K7YA 2WPBA 1ZFJA 3NGJA 3OIXA 1NEYA 3KAOA 2VFEA 1W5QA 3A22A 3BGJA 1HUVA 4FO4A 1OFBA 1JRBA 3GXTA 2FPYA 3LV5A 1TTJA 1ICPA 4IUOA 1CI1A 1F5ZA 3S5YA 1TO3A 1TPEA 3NQ6A 5HNRA 1DOSA 1W5NA 4Y8FA 2JBMA 3B03A 5KSWA 2CW6A 4NVTA 5D2WA 4ZQRA 1MEHA 2A2IA 4HIBA 1FWSA 4MZ8A 3ABQA 4GXMA 2FIQA 1EEPA 1QPRA 3P74A 4GUFA 1SPQA 1MSSA 1P1XA 4E2BA 3BPWA 5F2GA 1LYXA 1TV5A 3P82A 1I2NA 5J5DA 5J5RA 3PG8A 5K2ZA 3DKLA 3W7LA 1AK5A 3B4UA 1R2RA 5AYZA 4K7VA 4AAJA 1UUMA 4KFOA 3N73A 1EWEA 3TC6A 1R2SA 5D05A 2G95A 3W88A 3B05A 1VLIA 3DU0A 3W1NA 2VFIA 2I9EA 4UR7A 3B8DA 4N02A 1ZY9A 3NZRA 3BO9A 1VYPX 1MXSA 3W71A 3TSMA 4AB4A 5H2ZA 3RLVA 4O1CA 1A5SA 3UWVA 4ADUA 4Q4KA 1S5TA 1VYRA 3I6RA 4RZ5A 5D02A 4FIQA 1PCKA 4KFPA 3W7NA 4JX5A 3FKKA 5DLCA 2ATMA 3VCRA 2GVLA 3W2KA 1ZCOA 4GC4A 3DHFA 1FWNA 3F1QA 1F6PA 3W7DA 2HTMA 3W7MA 1PIIA 1WA3A 1O4UA 4I7UA 5F4XA 4P61A 3TMQA 5U7SA 5G4EA 5HJLA 4EIVA 3HGJA 1IXPA 5LNSA 4NJJA 4QISA 2EPHA 3WFAA 3H55A 5CPOA 3KVJA 3TIMA 3NPUA 1PE1A 3LI0A 3NQFA 1ZAHA 1A5CA 1XCFA 4KWWA 4LV9A 5G4WA 2CZFA 3E96A 4NQ1A 4BI7A 1SU5A 2C13A 2OCZA 3TAOA 4HNVA 1H7NA 4QJ1A 1GYNA 3T7VA 1FDJA 2A5HA 1ZALA 3TSDA 3P80A 3QSTA 1I2PA 4O1DA 1Z44A 3TQKA 3N2XA 3CU2A 1LRTA 3EX1A 3NQGA 3G1YA 2EGZA 4NNAA 3VE7A 2QUTA 5AYXA 3STCA 4WY0A 4DXVA 1G4EA 3L9CA 3G1HA 3GR8A 4UTJA 3BLFA 1SW3A 4Z08A 4UCGA 3FIGA 4JYFA 1LBMA 1EP1A 1H5YA 1YPIA 4OV4A 5TBOA 3DFSA 5AFDA 3QZEA 5C5YA 1OFRA 3W72A 4MYXA 2WSRA 3NPXA 4LS2A 2V5BA 2J6XA 3DAQA 1TPDA 2QDGA 3DXIA 4HPJA 2BSLA 3L2IA 3TFXA 3LX9A 3O15A 4BI6A 3PSVA 1ZJIA 1RVGA 3UXAA 3LCWA 2D73A 4YWIA 3G22A 4TMCA 6ALDA 1L6YA 5C54A 1FWRA 3CIWA 3PF3A 2VELA 3U6WA 1MEWA 1IF2A 1SSGA 4UTHA 3W2NA 4QQ3A 3B0PA 3MP5A 3NQ2A 2ZZ6A 3CWNA 1OFQA 4O53A 1RZMA 2YX0A 3WJYA 2R8WA 4FNSA 3HOJA 2V9DA 3O1NA 4JTSA 3MHFA 1XL9A 4HNUA 1BKSA 2VKZG 2KZHA 5EA9A 2CLMA 3M5XA 4Y96A 1JRCA 3HPZA 2ZRYA 3W73A 5GVJA 2H90A 3VFLA 4JY8A 2QCCA 1LCOA 4FXRA 3G24A 2VENA 4G1KA 3D0CA 3NQVA 3R8RA 3NAVA 2QCGA 4R33A 1KM0A 1NSJA 2Y7GA 3MJYA 4NU7A 1PL9A 5D03A 4W9TA 3HQ1A 4LNYA 2C0AA 5HINA 4MFEA 4OWGA 1O94A 2A85A 2Q8ZA 1OX4A 3M44A 4EF9A 2QCLA 1VPXA 5G1TA 1JJKA 2NZLA 3N9SA 1K7EA 3BLEA 3CHVA 4LVBA 2AGKA 5IBXC 1F6KA 1GEQA 5BMWA 1AMKA 1BWKA 3N2MA 1L2UA 3W7JA 4O4VA 2J88A 5C6MA 4LVDA 1M6JA 3NL5A 3IGSA 4ADTA 3M1ZA 3L5LA 4K8EA 1S5WA 5D2VA 3UWWA 2FQIA 3T4CA 2WNQA 3THQA 5DY3A 3EKLA 2DORA 3UYCA 1FCVA 3OG3A 1K8ZA 1LOSA 4Y90A 1AW5A 1GYLA 1QR7A 1T96A 4CQ8A 1TMHA 2QJGA 3PUOA 5A8GA 3YPIA 4AH7A 4O14A 1Q6QA 1QFEA 1EP3A 2VEPA 4DBDA 3T40A 4AEOA 4FX6M 1K3UA 3O63A 1EIXA 2ISSA 5FF2A 1EP2A 1TTPA 4IMEA 3LBMA 3M6YA 1R2TA 4HPXA 1RPXA 2WSQA 2ZRVA 2Y61A 1CX9A 1MZHA 3NPVA 3TROA 4DPQA 1SO3A 2EF9A 2YYUA 3W2MA 4RZ4A 3A24A 3G0UA 1PCWA 1FQ0A 3ABRA 5AHFA 2QJHA 4O4WA 2OZ0A 1Y0EA 3R12A 1VJIA 2RDUA 1LM1A 4JY9A 1GVQA 1KA9F 1KFLA 4LVFA 1VRDA 3L0GA 4UNKA 2V0TA 3S42A 3T78A 5HWNA 1ZAJA 3LERA 1K8YA 1VR6A 3UZ5A 3MYOA 1JUKA 4TU1A 2NXHA 3W2UA 4ZVJA 4U28A 3SJ3A 2E6YA 4WY0F 3CIXA 1P0KA 3IVTA 4CCDA 5D09A 3G8RA 4LW7A 2PC4A 1KM4A 1YXCA 1O95A 3W2LA 2OT1A 2Q3RA 1SZGA 4UTMA 1DKWA 4O1AA 1GOXA 3B0UX 2YSWA 3W23A 4Z1DA 3TJLA 3BV4A 3KVMA 4GNJA 4UTWA 4OE7A 5HWJA 1H51A 1QMLA 2CLEA 3WJWA 2TYSA 1WX0A 3RU6A 2VFFA 4NXSA 2YFOA 3LHWA 5CPMA 2E68A 3IGUA 5CZTA 2VFHA 4PH6A 4RKAA 4HT3A 6TIMA 3MP3A 4JR5A 1JCJA 5CGQA 1G69A 3UQNA 1VHNA 3PB2A 3S5OA 3T44A 3GX9A 4UFKA 5G1YA 3TMLA 3DI0A 4R53A 2CZDA 1D3GA 3QPZA 4NXKA 4CQAA 1XBVA 3NNTA 3GKFA 5G2HA 4GUHA 3PBUA 4UFJA 3PSWA 4WJEA 4LUIA 4O18A 1H7OA 4K6AA 4HHPA 4FXSA 4LS0A 1ZNNA 4UFMA 1H63A 4L4MA 2FPTA 2PE4A 3C0JA 5AN7A 3QH2A 4Z1BA 3LXAA 1KTCA 4NJKA 3QJAA 3RMJA 3R13A 1VGAA 4MLJA 3IIOA 4IQLA 4ORIA 5FEZA 1KLYA 2GQ8A 1H60A 3PB0A 3PVFA 3EXTA 4GUGA 2TMDA 1KFCA 1KTNA 3LV6A 3BW3A 4R34A 1FY6A 3PG9A 3E12A 2VFGA 1XFBA 2ZZ2A 2BTMA 2QCMA 2JKEA 1YTDA 2VFDA 2BZNA 2ZZ1A 1KM2A 1BEUA 4LTSA 3S8HA 4O50A 5LHFA 2CLOA 4CNNA 4LU0A 3LB0A 5U4NA 1JULA 1RR2A 1DJQA 4X22A 1V5XA 3G0XA 1SZFA 3W7GA 4DO6A 2QUVA
chains in the Genus database with same CATH superfamily
1XLJA 1PWLA 2PGFA 3FLUA 3SCTA 2D2HA 4XAZA 4MKSA 5HQEA 1NF0A 4ATLA 3ZSSA 4F40A 4UR8A 3EX3A 3URNA 2G97A 3WG6A 3EOEA 1A5BA 4ERAA 4LQ1A 5EBAA 1US3A 1UA3A 2X2GA 3CEPA 3DI1A 3NZGA 1ONXA 5AVHA 4KCUA 2E6DA 1DJYA 3MSRA 3ARWA 2P8BA 2VYOA 4O10A 3EKZA 5DCBA 4GE8A 1L8NA 1KFBA 5F4SA 2FHCA 5ENLA 3GC4A 3W6YA 3C0LA 3HBLA 3QV7A 4YVXA 5DMYA 3UA3A 4ICCX 4AMAA 2X09A 3NL2A 3LDVA 4L9XA 2OR2A 3FA3A 3NZPA 1FUYA 2ZIDA 3W1RA 3CV2A 1HGWA 2WKJA 3O6AA 3CASA 4YMZA 1EH9A 3N12A 4XVDA 3G1VA 4DELA 3RHGA 1KD0A 3TLLA 1AQMA 3C3NA 4OBTA 1D3CA 3KOWA 1WKFA 1W1IE 3TUUA 1R9YA 4TIMA 3EWWA 3LCLA 1LOQA 2FTPA 3TYBA 3W1PA 3RR4A 1B31A 3MCMA 3CV1A 3STFA 2Z1SA 2XVGA 3CUIA 2BP1A 3KEHA 1KXTA 3N2BA 3NEVA 4PUDA 3CWOX 2E5CA 1NDVA 3USBA 4LNCA 2HPIA 5MHBA 1ENUA 4NL1A 5DELA 3RO8A 1GZJA 2PBOA 1BHGA 4M81A 3K4DA 2XGZA 1WXYA 3M0MA 1IZKA 2GDUA 4OFCA 4LF2A 2EO7A 3OGVA 3BWWA 1UR3M 1OFPA 3LMYA 3CHDA 1EDQA 1KFJA 4FNPA 2NQ5A 3AIUA 2YCKX 1OADA 4YTRA 2VOTA 2DIKA 2E0PA 3OBEA 3NXFA 3WK3A 4DM1A 1PKLA 2B7NA 1QOPA 5JBDA 1OCJA 1U22A 2FVKA 2X16A 4NG3A 1JDEA 5I09A 1BTMA 1AH3A 1B9BA 3A4AA 4AY7A 3IJLA 2PMQA 5D2XA 4IHCA 1XI3A 1B2YA 1UW9A 1UPPA 2B7OA 3KDNA 4H9UA 3RPDA 4R9XA 3DBNA 4WXYA 4I7VA 1Z32X 3T0TA 3DIPA 4KERA 3RLUA 3GUGA 2Y63A 1W31A 4WOZA 2VEMA 3STPA 3ARVA 3L4YA 4AWUA 4PCFA 3CT2A 3VGFA 3VNYA 1F2JA 1DJIA 4B92A 4HNNA 1JF6A 2QDEA 4KWVA 4HMCA 3UY8A 1ZHAA 3P60A 1L6WA 3QFEA 3AJ7A 1EFZA 5AC5A 1SJDA 2XN2A 3H2CA 3WDIA 3JS3A 4GJIA 3UYIA 5LSMA 3BAYA 3O06A 5H6HA 5D2YA 4GACA 5AYYA 4PL1A 3GNNA 3A9IA 1W9BM 3S6OA 1E5NA 4ZOCA 3NQAA 1EA9C 4M6QA 3JRKA 3M47A 3OTRA 2ZXQA 3SGGA 3W7KA 2PP0A 2WV8A 2DSUA 5K3VA 2PDJA 1V6WA 3IUIA 4HCHA 1A0EA 4R85A 1AH4A 1OFOA 5DCDA 4ZL1A 1JQVA 4ONVA 3GM8A 3VIIA 4CU8A 4EACA 2YCIX 5IHSA 4LYRA 2QPSA 3LQGA 3OPSA 4AHPA 4US5D 3KZSA 5F1VA 4PULA 1WP6A 4GZ7A 4LCRA 2EKCA 2PF8A 3M9YA 3KCJA 1E6RA 4RDZA 2WZMA 2WZEA 3BICA 1VIWA 2NLYA 1GVOA 2PDHA 3H7VA 4MZYA 4IGHA 1K4HA 5L6UA 2ZA2A 1NDWA 2DU2A 3KWSA 2HROA 1I4NA 3DFNA 3GUWA 3ZS4A 2DZXA 2J8FA 3GAKA 1EGVA 3TTYA 2C19A 4S3KA 1E3XA 2G50A 1X6LA 1J6PA 2KX9A 1XRFA 3N15A 2PCQA 1ME7A 2NVDA 1TJ0A 4ZOAA 2YXXA 3NQEA 4QAWA 3OBAA 2BGQA 1I8JA 2FZ9A 5D9MA 2PP3A 3AIWA 3N19B 1O1ZA 2C7FA 3IEBA 3QV8A 1B4EA 2D2OA 3LBCA 1YKWA 2QPUA 2XVKA 3IIPA 4GIAA 3RLHA 4ZA0A 1FTXA 1TWWA 1KR1A 1OFAA 5CG7A 4LUJA 4MJMA 4X2RA 3AWNA 4WHBA 3BJSA 4S3JA 3D46A 4IMCA 4B9ZA 3L12A 3G3MA 3M46A 4RJEA 1QDSA 4LC8A 3SUWA 4U10A 1XS2A 4TMBA 3N9RA 3T42A 1V7YA 1NOWA 3G5EA 1XLFA 4NKCA 3E49A 1G6CA 5JIPA 1K9EA 4UMAA 4B2DD 1FWWA 3EEZA 1GQLA 2YFNA 2VZSA 4W5ZA 5CGMA 3H26A 4Q8QA 4PBFA 4FX7A 3AZSA 3WCZA 1U5JA 2C0HA 4F0MA 3RPMA 4V15A 4LX4A 3GXIA 3MC5A 3U9IA 5CJNA 3W1MA 1ZLPA 5EBUA 2OQYA 3ZR5A 1UZ4A 2ZX8A 2WJFA 1LORA 3M16A 2NQZA 2HBXA 3S5NA 3LTPA 3BMWA 1A0DA 2Q01A 3ABSA 3UG5A 4P2VA 2DZPA 3WN6A 1UR8A 3RXZA 1M7OA 2NXGA 3I68A 1KV5A 4WDWA 3VNIA 3IAQA 3S6TA 1G7UA 1WBHA 2NQJA 3AJXA 1MZRA 2Y70A 2PPGA 1P6BA 3BQ5A 2OZ3A 2PAJA 4GH1A 1NFPA 3PWAA 4I9MA 3BMXA 3F03K 5LZLA 4QLKA 5IFPA 1TTIA 1C91A 3KRUA 4D8ZA 2DT2A 3LGEA 4R3UA 1C7TA 4KRUA 1WOAA 1KFKA 1H4PA 3QQWA 4RNJA 2DVXA 1B3YA 4XZWA 3EXSA 5E70A 2DZBA 4RZ6A 1QU4A 2VHLA 3AXMA 4O0ZA 1VBHA 3G3DA 1YRRA 1OD8A 3C56A 5E0FA 3TWBA 5I2UA 3GXFA 4U5IA 3RK8A 3WYZA 5EMKA 2YKKA 1U5HA 1H49A 4UBPC 3GDMA 1DJHA 1R47A 1XHGA 3JZEA 2NV9A 1M5WA 3QSRA 5H8MA 1SVDA 5EMJA 2C18A 3FYPA 1E0UA 5LNRA 3FJLA 4IPJA 2E25A 3GC2A 1ESWA 3MW7A 1CGUA 2FTYA 4H83A 1TMQA 2MUCA 1RA5A 3PZMA 4C6MA 3SGUA 3CC1A 2WVVA 4N2YA 3ZR6A 5I79A 4DWSB 2WCAA 3WLSA 3ARXA 4CUCA 3W1XA 1G7VA 2EPKX 1PS9A 1JYVA 1KFEA 4RLIA 3CS2A 1XG3A 3O16A 3V16A 3BZJA 1QPQA 3NVTA 3OGSA 5FF4A 3STEA 4Z1AA 1BRLA 3PAOA 1B4KA 1I2QA 5LIWX 1M1BA 4FIRA 5TF0A 1Q63A 3K4WA 2ZUVA 4XKMA 3FOKA 5CSRA 2DPEA 1NDYA 1H7XA 3L0KA 2JALA 3EX2A 5MKGB 3RJYA 1PZ1A 1H1YA 2ZADA 3MKCA 3HG2A 1RUSA 1HJQA 1CLXA 4GIRA 5DANA 2J8TA 1ISZA 1FWAC 2YCLB 5LYRA 1K1DA 4PTVA 3V36A 2WNWA 3KBJA 2DZTA 3NA8A 4UMCA 4ML9A 1AVAA 1KTBA 3I7QA 1IT0A 3MSGA 3UY7A 4C1NB 2VZVA 3SIMA 2X0HA 2OVLA 4ZQPA 2JGYA 2VD8A 1MUCA 2XM1A 4QRNA 1HQTA 2I17A 1EQPA 1C8VA 4WRHA 3C8FA 4NRRA 1NP0A 1UD4A 1MVYA 1DJNA 1X7IA 5IDIA 2DZSA 3NL3A 1RBOB 1AJ0A 4LANA 1UB3A 5H8UA 4EP8C 1V77A 4DQWA 5DN1A 4LRSA 3MT1A 3O0KA 5E09A 2YBTA 4DBEA 4FB7A 2UV8G 3VX0A 4I8YA 1Y5WA 4I9TA 3FEQA 4NNBA 4WF7A 2ZA1A 2XINA 3HN3A 5F4WA 1XD1A 1XIEA 4X3ZA 1GG1A 1ODUA 4U2YA 5AHMA 4M80A 6XIMA 5K9XA 1CLKA 2CKRA 4GZIA 5JQ9A 4ZSTA 2VC6A 2RDWA 4JYDA 4ZB0A 1EZ2A 3EXRA 3P3BA 1XKJA 4JTFA 4DJEC 1NDZA 3PFMA 1ALDA 3P8JA 1TWIA 4S39A 4NZCA 1VJSA 5I7GA 5DFAA 1J4EA 3HMJG 1HKWA 2QF7A 4JKMA 4OBSA 1PKNA 5A6LA 2VZTA 2YDSA 4MY1A 1EJ7L 1O5XA 2A1YA 3LCFA 4XK2A 1LLZA 4GYPA 1A5KC 1R5YA 4Q4OA 4GQBA 3H4GA 1V4YA 1QNRA 4O52A 4LF1A 2H6RA 2PD5A 5C9RA 3LU2A 1EOKA 2B0MA 2Z1VA 4WKAA 2JQXA 2FZDA 5A6AA 3HURA 2GSHA 3BG9A 4DEFA 4UC5A 1VCGA 4J35A 5CLWA 2PWHA 2DSVA 1W5OA 4MY9A 1N2VA 1DYSA 3UJRA 2HK0A 1E3ZA 4GUJA 4AVNA 1E4NA 4ZB5A 3WL0A 3UG4A 3ARQA 3BSMA 1REQB 1AW2A 4JTDA 2W3ZA 1F4AA 4ZMGA 4QITA 4QM1A 4MMWA 4OV9A 4HCDA 3QR1A 3E74A 4NY2A 3F4CA 4UQAA 1W0MA 1XH1A 1UWTA 2OOFA 1B3ZA 5FACA 2PDQA 2WVSA 1AODA 4XSMA 3O07A 3V1PA 3Q37A 2Z1WA 1OB0A 4D1JA 1R3QA 4CCCA 2XYLA 3CPGA 1E15A 1IZCA 2WKGA 3UBPC 4B3ZA 4JYEA 2G96A 1R86A 3LHTA 4JN6A 4UQDA 4IIBA 4NX0A 2DQWA 6A3HA 1LT8A 3NQ8A 2PTDA 3GTIA 3II1A 5BWAA 4UMBA 5I3JA 1LJYA 4X9SA 1W1A1 2VI0A 3SIZA 2OU4A 4G7FA 3VNKA 5LIKX 2O9RA 5CH9A 3GFZA 4Z2KA 4BCEA 1X39A 4LB4A 2XHYA 4RX0A 1T6MA 2VX4A 3MA8A 3B9EA 4H01A 4QBXA 2QAPA 3SECA 1UD2A 4M7SA 1XIHA 4LCQA 4HSHA 4Z2GA 5D8WA 1Q8AA 4PC8A 4C6CA 1XDMA 2ZICA 4LT9A 5H91A 1BVZA 2WMKA 4REQA 3GTXA 2ZQ0A 3WQGA 4BEQA 2ACSA 1Q6GA 3CUZA 2ZKMX 3N04A 2YDAA 2X1RA 3T0CA 3OZPA 2WVUA 2VP8A 3AXKA 5EMLA 2RAGA 1G4SA 3LRLA 2CIPA 8TIMA 4C6JA 1LUCA 3CNYA 4DPPA 1OGBA 2XGIA 3GKAA 1TVNA 3VGHA 1FCQA 2D2GA 4GVHA 3DECA 4OTKA 3CAWA 3TH6A 1YQ2A 3EMCA 4F48A 4F0LA 1O6IA 2FZ8A 3M7SA 3C2VA 3HO8A 4L64A 3L5AA 4HNOA 1BWLA 4INFA 2H9AB 3A23A 2XH4A 2DZUA 2VGFA 4YPJA 4HVXA 1LP6A 1RP9A 2GQAA 4JFWA 3URBA 1AQFA 1TFVA 1CXFA 3SUSA 4NHVA 2Q71A 4GNKB 3OGRA 4GXWA 1UH3A 4TTUA 4GK8A 2V2HA 1RK5A 1QAPA 1XW8A 4JFVA 1TPB1 4D8LA 2BWGA 3THDA 2PTXA 2A21A 1HX0A 4UZSA 3B04A 3ES7A 3FA4A 3UJ2A 3VZZA 1QNPA 4F2UA 4GRSA 4XZ9A 1QI4A 4NAEB 1KKRA 3S9YA 1S5VA 1GQIA 4D6EA 4PN2A 2WQDA 3G77A 5M17A 1DIDA 3HV8A 2JEPA 2PZ0A 1TV8A 3AO0A 5M5DA 4FNUA 3P8IA 2J62A 3VOJA 3LHUA 3TTOA 3W84A 5T8GA 2ZUMA 5ABHA 1Q7QA 1OM0A 2Z1XA 1Q6OA 3S46A 5I03A 3UWYA 1W1B1 3PJWA 1GHRA 1DIKA 1R3WA 3GW0A 5FJIA 1LRQA 1EB3A 1RV8A 3I65A 3ZLFA 2QV4A 4B5TA 1BD0A 2OSXA 2NW0A 2IKHA 4WGXA 1TIMA 2CC0A 3W7EA 3WNNA 3C2RA 1TE1A 5JXQA 1UHVA 2OPJA 3ORWA 3WSUA 2WO5A 3S47A 4MUPA 1KQZA 5E1QA 3MUCA 5AECA 3CWHA 4CD7A 4PUUA 3R4IA 4S3FA 3DN5A 4UFIA 4E2OA 2YL5A 1WAUA 3MUZ1 1ELSA 3W85A 1J0HA 2ACUA 3VM5A 3I7RA 1GTHA 4JBRA 4IJBA 3QRHA 5FESA 3QQ0A 3WF1A 2XN0A 1UMLA 4HSOA 3SRKA 5IOBA 3F4NA 3R0UA 4A2SA 1W3JA 1D7KA 4B9YA 3R5EA 3N17A 1FWBC 3U57A 2BY1A 1W6TA 4CNOA 1SFJA 3DX5A 2I9UA 1ICQA 2NV1A 5DY2A 3B9OA 2DJLA 4N9DA 5CXPA 1XC4A 2O9TA 3W1UA 1R38A 3K8KA 2O7SA 3PY2A 1JI1A 3IGXA 1JUEA 5A95A 5G4HC 1JQXA 2J9XA 3FN9A 4FEZA 4O13A 1CNVA 3OZYA 5LA0A 1KGXA 4Y2WA 4QR6A 4IQDA 4JTJA 2XFWA 2VNCA 2VGGA 3WNKA 4C91A 2J9YA 1A50A 1J2BA 3TX9A 3G1FA 3WQDA 3AHTA 1VFHA 3IVUA 3PUDA 3THAA 1O68A 4MWAE 3NUKA 4LEQA 3NGJA 3OIXA 5M3WA 1NEYA 2GL5A 3KAOA 4FO4A 3CXOA 3P0WA 4FLQA 1JRBA 4GC3A 1Y7VA 2FPYA 1J8VA 1OZMA 3AS2A 1ITCA 3E0WA 3S5YA 1TPEA 3NQ6A 1Q6DA 3ITXA 1F3TA 3I4EA 1DOSA 4IH3A 2P5NA 1A49A 2Q6ZA 3KS5A 2JBMA 3PP7A 3B03A 1B5TA 4GA8A 4M3PA 1ZUAX 4ZQRA 1MEHA 4HIBA 3ABQA 4GXMA 2FIQA 1QPRA 4GUFA 2E8YA 1P1XA 4CNSA 2XIBA 4F2TA 4XIAA 5J5DA 3LUTA 3B4UA 1UD3A 3B0YA 4GI4A 5AYZA 2IPWA 3KOZA 2D1ZA 3ARPA 3GH4A 5BWFA 4IP4A 4K8GA 3W1NA 3GG0A 4N02A 1CT5A 3W71A 3TSMA 1W9VA 4O1CA 4ADUA 3QY8A 4KIRA 4J1OA 4GKLA 1PBGA 3SQMA 2Z4GA 1RAKA 3LBOA 4IPNB 1UWQA 1FHUA 3BSHA 3VCRA 1X38A 4M29A 2REQA 3CZJA 3GTNA 4C7FA 4C6LA 4AG0A 5J04A 3F1QA 2QMKA 2ZUUA 2PCEA 3GU9A 2CESA 3W7MA 1PUDA 5C9WA 3PHAA 5U7SA 5HJLA 4FR6A 2V6AA 2AL1A 3GTFA 4MNLA 1OCBA 3IUDA 2DV0A 4QISA 4D9PA 3BC9A 3N11A 3NQFA 2OWXA 1XYLA 4GQ0A 3MB9A 4IG2A 4LV9A 2CZFA 3R0DA 3QOKA 3KP0A 4BI7A 3CV7A 1WZAA 3VMOA 4HNVA 4R27A 4QJ1A 1GYNA 2A5HA 3P80A 4HYVA 3TQKA 3N2XA 4XISA 3EX1A 3G1YA 3MKVA 1GJWA 2EGZA 4NNAA 3VE7A 1H09A 1ZBCA 2PDUA 4WY0A 3M0HA 4DXVA 1G4EA 2X7VA 3G1HA 3GR8A 3RRAA 1B3WA 3QKZA 3GU1A 1YPIA 1GORA 3QZEA 4HP5A 3S5SA 3W72A 3F2CA 3VGBA 3U4AA 3M6DA 3S4TA 4HPJA 2BSLA 2DVTA 3N4AA 1AQ0A 3KM8A 5E9AA 1ZJIA 1V08A 1L6YA 5C54A 1FWRA 2VRJA 3CIWA 3U6WA 5XIAA 2XSBA 1A3HA 4FAMA 3PBMA 2VWTA 3AU2A 2W4XA 3CWNA 3BLPX 3GU2A 5A2CA 1RZMA 3WJYA 4D6HA 1BAGA 2BMBA 1PTDA 4FNSA 3HOJA 2V9DA 1BYAA 1XL9A 1JZ3A 3GVQA 3OOQA 5DMLA 4K2SA 3T0AA 4PMXA 3WFZA 2ON3A 2ZRYA 4HA0A 2E7FA 5GVJA 3B8VA 3VFLA 2Z00A 4JY8A 2ZUNA 2QCCA 3KP1A 1T5AA 5AKQA 4DVOA 1E6PA 3R8RA 2QCGA 2Y7GA 3MZNA 8RUCA 1ZSXA 3USZA 4WKFA 4B5SA 3L23A 1J9YA 2A85A 1RP8A 2A3AA 1OX4A 3ZT7A 3EOOA 4EF9A 1K6AA 3B8UA 3CIVA 1JJKA 4FF5A 2NZLA 3VD5A 1ITUA 2UY3A 5GJPA 3BLEA 1I9CB 2D0HA 3NYDA 1GEQA 4IJRA 1AMKA 1J0KA 4H41A 2J88A 1M6JA 3AYRA 1VF8A 3IGSA 4FZIA 3M1ZA 1P48A 3UWWA 1GOWA 2D69A 3DFYA 4A3HA 2GGJA 2WNQA 4X9YA 2XJ7A 4V1YA 4XAYA 2WCGA 1KR0A 1FCVA 4NZ5A 4TQTA 5DF0A 1GYLA 1QR7A 2G8ZA 3VC6A 4A4AA 2HNHA 3AIVA 5A8QA 1Q6QA 2VEPA 2V5CA 4ZXLA 4BF7A 2Q02A 1EIXA 3AFBA 1EP2A 4E8GA 1OGGA 3LBMA 1R2TA 4Y8EA 2ZRVA 3GG1A 2R1LA 3I4KA 4MADA 4DPQA 2Y5EA 1R3SA 3B8TA 3QC0A 2YLLA 4Y9OA 1S39A 1D2KA 3TP4A 1UKSA 2FYMA 3OLIA 1E6ZA 1HL8A 2Y4SA 1KFLA 1VBJA 5XINA 2HPMA 3LERA 1CBGA 3MYOA 5EMYA 3NWRA 3KLLA 2NXHA 3W2UA 4BQ4A 4ZVJA 4U28A 4KGJA 3UXLA 1P0KA 3P6LA 5D09A 3CQJA 2PC4A 1KM4A 1YXCA 1O95A 1X8CA 4Q7BA 4Z1DA 2X41A 4J2PA 4QJ3B 5ECVA 3KVMA 4UTWA 1XP3A 2JEQA 2WW5A 3RDKA 1E4LA 1J10A 1FOBA 2E9BA 2TYSA 1WX0A 1R85A 3ZZ1A 3RLGA 4NXSA 2NQ9A 2PBGA 2EKGA 4UQEA 4PH6A 4HT3A 1IT8A 3LS9A 4W85A 2XWEA 4FOKA 4PTXA 5H8PA 3UQNA 5C7VA 3T44A 4IFKA 1LQ2A 4LFYA 4UFKA 5G1YA 4TX6A 3TMLA 4R53A 3T81A 3VKKA 1W9UA 1J93A 3WBYA 5GJMA 4ERIA 1TZ9A 1EHAA 1U33A 3PSWA 4G1NA 4DHGA 1H7OA 3Q45A 4FXSA 4MWAD 4N0RA 1AD4A 5AN7A 3RMJA 2XH2A 1KLYA 1E6NA 4IQJA 3PVFA 5BXRA 4GUGA 1KFCA 3WDJA 2P8CA 4WIWA 1WDSA 3URQA 3SQLA 2WPGA 4PRWA 3OIHA 3WDPP 3PZIA 4QS5A 3HFYA 1JCTA 2VFDA 2ZZ1A 4PUWA 3S8HA 5T9CE 1XIIA 1PX3A 5GPRA 5LHFA 1UP3A 2DT3A 1JULA 3GC5A 4IL0A 1M53A 4CN6A 1W3LA 3VK5A 2QUVA 2ZTJA 3MUAA 2YBVA 3ANUA 3PJXA 1JCLA 4MF4A 3W26A 2DW6A 1C93A 4DBSA 3P7YA 2OODA 1ME9A 1QOXA 4S1FA 1F4HA 2C15A 3UNDA 1W1VA 1VBRA 3W7IA 4MY8A 1U5VA 3VAVA 4S23A 4XZHA 2QHAA 4JTRA 1JGIA 1XYMA 2NUXA 4HPGA 4HZMA 3W25A 1EYWA 1DORA 2A6NA 1XRTA 4WD0A 1C92A 7TIMA 3MUIA 3SSJA 4IICA 1PV8A 3TR2A 4IX2A 3WK0A 1XLKA 4Q8NA 4S2CA 3U8GA 1L8PA 5LIYX 2Z6JA 4HK5A 1WDRA 2WXDM 3QTGA 4KEUA 4ZQNA 4O16A 2NX1A 3RM8A 4P7OA 1SUXA 3EWUA 4UR9A 2MANA 1W9XA 4DF2A 1BG9A 3I7SA 1B1YA 3N6HA 3KTCA 2F6KA 2WVVB 3CPUA 2PWFA 3UD6A 3VNJA 1TYGA 4PA8A 5AC8A 3R6IA 1Z8AA 3K30A 3W7OA 1K70A 3TJIA 2B7PA 1DWFM 2QEZA 4M6PA 4BQ5A 1BWVA 1XBZA 5K7JA 3WQWA 4BFAA 1BRLB 4AZBA 4JKKA 1TIWA 3TEVA 4FALA 3EWDA 2OKOA 1W3NA 4DZHA 1KM1A 1TELA 2A4AA 3QHMA 1KM3A 1MDRA 2DZWA 3QW3A 3LCGA 1GGOA 4YN5A 4OQVA 2VRKA 2ZZ3A 3TTQA 3LHYA 4H4IA 4QE4A 3TW6A 3AYVA 5DX7A 3TKFA 1FWJC 2QVNA 3MV01 3NZQA 2GFTA 1IXQA 4JQAA 3E6EA 1HJUA 2C14A 1IGSA 1E56A 3GIYA 3VIMA 2E1WA 4H6EA 2HV5A 3E2QA 3HA1A 5IM51 3BAWA 3QLDA 2A7PA 4EX4A 3HQPA 1UD6A 1O1HA 3T4WA 2XH0A 5LNVA 2ODOA 5E93A 2CLHA 2V2CA 1DWAM 2BX7A 2ISFA 2FVLA 7CGTA 2Y7EA 1HTIA 1PHQA 2GJRA 1DHKA 2ZZ4A 4QGCA 4GJJA 3PFRA 4JCMA 3XIMA 1XBXA 1XCWA 3G2GA 3N25A 4EANA 2EQDA 3AOFA 1A3XA 4PR4A 1OYBA 4MKVA 4MB5A 1CLVA 4I9AA 2F6UA 4P7QA 4NAFA 2X42A 2ZUSA 3AIBA 2X0SA 2AQOA 1PDZA 1OABA 1PX4A 3LPPA 4RE2A 2A7NA 3WQVA 1ZPTA 5HPOA 2V2DA 1TWZA 3KXQA 4ZOBA 4XKYB 3C2YA 2LLEA 2PWVA 5FJRA 3IVSA 9XIMA 1W56A 4GI6A 4HB7A 5HMDA 5IBXA 3OHIA 2X40A 1RXOB 1A5OC 2C1IA 1A80A 1PAMA 2Y8VA 2C8NA 3TQ0A 1HT6A 3FX4A 2WNNA 1DQXA 5K9CA 1O7AA 4HOXA 1G9HA 2JF6A 1MUMA 3TVAA 3TW9A 1K03A 4HK7A 4Q33A 3A9BA 3G1AA 4AFYA 1HF6A 1ME8A 5E0KA 4S3DA 1UKQA 3W74A 1BYDA 3MI3A 4MWAC 4TX8A 2XIIA 2V68A 3R2GA 2VQUA 4KGLA 1A5MC 1E9YB 2YXOA 2GQ3A 3EEGA 3OVQA 4H7ZA 3ZJ6A 3NO5A 1TMLA 2ZRZA 2I1OA 4RCXA 4POCA 3A5FA 3MUY1 3JU2A 2P10A 2ZCGA 3ABOA 2J7DA 2F9RA 2G0WA 1Q6EA 3DGRA 2CLFA 4H8VA 1KRCC 3GE7A 3VKJA 1ZENA 2WSYA 4NRSA 1KCKA 4HYWA 1QI0A 4MJZA 5I00A 3NOYA 1JXJA 4S2BA 4FHAA 3LM3A 2CWNA 4JNMA 2E40A 2AQVA 2PF0A 1T7LA 3HJZA 1TRDA 1TSIA 4MHBA 3GIQA 1O60A 1XSIA 4F0RA 4MYAA 3QC3A 4ACYA 4ZQMA 2J7HA 2ZWYA 4N42A 3O6DA 3WNPA 3UXDA 1EF2A 1F73A 4IL2A 1DJXA 4C6PA 1S1RA 5K4ZA 4ILSA 2WMIA 3MP4A 3RYSA 4GOAA 4XTDA 1F8MA 1RD5A 2R14A 1S2TA 5EU9A 1E4MM 4JTKA 4FXFA 2RJHA 3OP2A 2GPTA 3QOMA 2IKJA 3H12A 3SCQA 5REQB 4PUEA 4IWWA 1P6CA 4FNQA 1QJWA 1D9EA 5CGTA 2VQTA 4GYFA 3K2GA 3CLWA 2CHRA 2FJUB 2TPSA 2PTYA 2DUZA 3A3WA 3HGOA 4REQB 1B0IA 4QROA 3IIVA 3S1XA 1EPXA 5C71A 4DN1A 5D4YA 2EG6A 1S1PA 2J24A 1YADA 3PZQA 4KCTA 1Q3NA 4ZR8A 3PBYA 4AEEA 1MNZA 4BI5A 2FHBA 1XBYA 3AI0A 1LUCB 2ZC1A 4IT1A 1HNYA 1Q7ZA 1GEHA 2BVDA 1P0NA 4PTDA 4M5PA 3GHRA 2CLKA 1Z42A 4ML4A 1TJRA 2PDGA 4XIMA 4RK8A 3JR2A 2BY2A 3FSTA 3TTSA 4DX3A 1VHCA 3CZLA 5AHNA 4GXPA 1A4LA 2Y7DA 3S2CA 3VNDA 2PD9A 4DI8A 3WQ5A 4JAWA 3LENA 2AMGA 5CPTA 4MAZA 3QMTA 3DOPA 3HIJA 3BARA 3QLLA 3RCYA 3AS0A 4JTLA 3TC3A 5HR6A 4BR1A 5M03A 1M7JA 2Y89A 3H24A 1KFWA 4QX4A 5DMNA 5A8NA 1Z41A 2FH8A 3MHGA 1RPKA 2PDIA 4U31A 1VKFA 3SJNA 4I6KA 2OYMA 1C9DA 2FDSA 1D8WA 2OO0A 4O1BA 1QNOA 3KBWA 4JN8A 3LK6A 1JZ8A 1MI3A 3UZYA 5DBTA 3WK1A 2YW4A 3ENLA 1VEMA 1SSDA 1OJXA 4GIEA 5D9OA 1VLWA 3EX4A 4DJFA 4RE0A 1KBIA 3ZVHA 1W8GA 1IR2A 2VEGA 1EO7A 4W5UA 1KO0A 5EPDA 1ZAIA 3SAZA 4CD8A 1XR2A 2UZ9A 5D04C 1CXLA 4GFSA 1W91A 4L1GA 3LY0A 1SZEA 3VKCA 3FW6A 2ZRUA 4WDUA 4E3VA 1EQCA 5I3IA 2Z7KA 5F7UA 4V33A 3NDOA 2QDHA 4EPKA 4UUIA 1IEXA 1JCXA 3WH5A 5G2IA 1HL2A 1GTEA 1R3RA 3MHUA 3W86A 1TQJA 5A94A 3ZJKA 4P7NA 1DPMA 1TX0A 4A3RA 1UPMB 3VDHA 2ZE3A 5E0CA 2PLCA 3UZJA 4O54A 3MDUA 2GJXA 2GSEA 3MMUA 4QNWA 4NI8A 2IQTA 1Q6LA 3KZPA 1TUXA 3AIQA 3VUSA 4JIEA 3WUFA 2WM1A 2YOCA 3M5ZA 5AC6A 3NZ1A 3B06A 2BB0A 2FB3A 2JGQA 3CV6A 3ITVA 4XO7A 5AVNA 4OKDA 3PJTA 2QGYA 4OU1A 3VI2A 2NVAA 4WQ6A 1FWDC 4GZJA 4IPPA 4MDPA 3E0IA 4PMZA 1IEVA 2UBPC 4OOUA 4ZFMA 3LCXA 3SCVA 5C55A 2HS6A 3R7MA 2H3DA 3MSDA 3IIZA 3MI6A 1ICSA 4A3YA 4HJFA 1M3UA 1V02A 3CL6A 2PC8A 1UH4A 1OD0A 5AHIA 3PPHA 4HCLA 1CDGA 1Q4NX 5BOOA 9XIAA 4GGHA 3W00A 2A3EA 1UR1A 2ZVRA 4A8IA 3DFPA 4W87A 4XBKA 4CQCA 4AEFA 4AZGA 1QNQA 3LXCA 3CAQA 3TA6A 2WVTA 3GDTA 3D3AA 3W29A 2HXTA 2D2JA 4F66A 1YTEA 3T09A 3EDDA 4JTTA 1QASA 2D20A 3WH6A 2CHOA 1VP5A 4Z2IA 3VGDA 1JVNA 4J3TA 4DBWA 3GNDA 4ZEPA 3MKKA 2P0IA 1PIFA 4XZIA 4FLSA 5CZ0A 5BNKA 4L6HA 3TYCA 1ITXA 4PMDA 1W5PA 4HOZA 4F0SA 4NX5A 1M7XA 1W3IA 1UJPA 5HPCA 3VOFA 4BF5A 3WNLA 3I10A 5K4XA 3M5YA 2G4JA 2D23A 3GTHA 3HB9A 2E8ZA 4TV6A 4KESA 1UH2A 3GHSA 4RNIA 4OGZA 3MI2A 1KRMA 2VJXA 1G4TA 1THFD 1ML1A 4A29A 5C8BB 4H8UA 1UKTA 2PURA 3V5CA 4MB1A 2ZFAA 3ITLA 2FMOA 3AICA 1TJPA 5T9BG 3EX6A 1Q6RA 4JX4A 2I16A 1AJZA 2GOUA 2REQB 4AD4A 1EHNA 3GB6A 5HAOA 4J3VA 4IMAA 1A5LC 3CHEA 5BROA 3UZWA 1JFHA 2G3IA 1RY8A 3PZ9A 2PRHA 1HKVA 2C1GA 4HOWA 4IG2B 5G5IA 3BOXA 1XLBA 1E9ZB 3U2EA 5HJYA 4L1XA 3TQVA 2VURA 4WJ8A 2PODA 3DDMA 2NX3A 3C3UA 1OK6A 1PPIA 4JQ3A 3EGJA 3S5ZA 4FLOA 3TZNA 1KRBC 3BGGA 6REQB 3RMEA 3GXMA 2BOFX 3E2RA 3GVGA 3EWYA 1K77A 3WJXA 4QG9A 5TQLA 4WY0B 3W82A 3PPFA 4PZVA 1E5JA 1YTKA 3L5MA 4JDYA 3L65A 5FF3A 4DZIA 2PGRA 1AZ2A 2ZOXA 4YVVA 3U2OA 4M56A 3UXIA 3BCFA 3FJ4A 4MLRA 2GWNA 4AZ6A 5CJ5A 1CYGA 3STGA 1BSIA 3CO4A 1FP8A 2OX1A 1V6UA 3EDJA 4RR4A 3GNRA 3HPFA 3VA8A 5I3KA 3WKZA 2BXVA 1WKDA 5HNTA 4NJGA 1CXHA 3BL3A 4FP1A 3F5JA 1TCDA 1I2OA 4XAGA 4LJ3A 2FZNA 1YDNA 2O55A 2ADAA 4FX8A 3VGEA 5I5RA 4CVWA 1U1HA 3WMLA 4CQ9A 3PUEA 3BW4A 2DY3A 2YXGA 1OX6A 1ZBVA 4MJ2A 2OGJA 3M07A 1C8QA 1SM9A 4C7GA 4WKHA 2Q09A 5CPLA 4MGGA 4HHLA 1N8WA 1W32A 1I0DA 3UEQA 4AZCA 1OYCA 3MMDA 5D9NA 1FXQA 4AZ5A 1HGYA 2XPKA 1JZ4A 1LROA 3QGVA 3WF2A 1IXNA 3WFLA 3WF0A 4MNKA 2GGEA 2WK2A 1RH9A 4HMDA 1VFMA 1YX1A 3W7HA 2BHUA 4DYKA 2PRLA 3KRSA 1CW2A 4HMNA 1WNOA 3N34A 1OX4B 2D0FA 1TV7A 4XWUA 4FA3A 1DTNA 1Q45A 2NX9A 2PU0A 4CGTA 2H9AA 5LXXA 4H19A 4K39A 5JMUA 3G1DA 4IM4A 3WMSA 1U30A 3RG6A 2GDQA 2E09A 3EDEA 3K5XA 2VXNA 5BMXA 3VDBA 4IXHA 2PDPA 2X8RA 2CERA 5DCEA 5HWMA 3S1GA 2PDCA 4ATDA 3CQ0A 1NTHA 3ANVA 3REQB 1H1ZA 3BLLA 1QCWA 1JAKA 4Q32A 1LG2A 1TQXA 1J18A 2HISA 2WB5A 4Q4QA 1SW0A 5FF7A 3N18A 2O92A 5LHEA 3I6TA 8XIMA 4R7JA 3DFQA 3EMZA 1NFBA 3SCWA 2QPXA 1UQZA 1FHVA 3ELFA 1MRAA 2ZYFA 4IIEA 2X1IA 1R87A 3TCEA 1DE6A 4JICA 1EF3A 2QMJA 4JXCA 4GY0A 4JN7A 3ZWSA 1J12A 4GYKA 4KEMA 4IJCA 1PEZA 1V79A 4RV8A 1MFVA 2DQXA 3ONCA 3W6MA 2VC9A 3V5FA 3EB2A 3E1F1 2PDNA 1X1ZA 5XIMA 3CZEA 5DXYA 4ADSA 4X63A 1TWSA 5JH1A 2EAWA 4GABA 3W38A 2B7QA 1XUUA 2CWXA 1W1PA 4URIA 1K8XA 2GVGA 4AF0A 1AMYA 1LG1A 4G9PA 1Z48A 3IV3A 1BVNP 4AD3A 3R89A 4DAIA 4UXDA 2WC4A 2QS8A 1JDFA 3EWXA 4DIAA 5E9XA 1UWSA 4JHMA 3TV8A 4FNTA 1YXYA 3HPAA 3FJNA 3MBFA 3H4WA 3M7WA 4UTFA 4GO8A 4JTAA 1MW1A 7REQA 4WSKA 3DYOA 1GQNA 3EA3A 3A21A 1IGWA 2BGNE 4IGNA 4LAUA 3THUA 1L9WA 5EFDA 3ITCA 3W28A 1UA7A 3ZT5A 1FWIC 3R43A 2VGBA 3UU0A 3S1UA 4ALDA 1EJSC 1HKKA 4W86A 4HNLA 1NOFA 1H7RA 2WJDA 3G0SA 4AQLA 1XV8A 2HXUA 5HMSA 4PFMA 2OEMA 4MZ1A 3FDKA 3RRXA 3HG3A 1V0NA 3V0UA 4WSHA 3BK0A 1WDQA 5I07A 2QJIA 4PMJA 3FHQA 4BK9A 4HQVA 2FZBA 1XKYA 1ZU8A 2ZUTA 1P6WA 3BG3A 1RCOB 2V5LA 1KM6A 4AY1A 7ODCA 3PZNA 3LPFA 3SRDA 2GUYA 3QW4B 4X2PA 1KKOA 2NT1A 2PDBA 1EGMA 3PZTA 3WELA 4HNTA 1K8CA 3RIKA 4IMDA 2O9OA 4QTGA 4YU1A 1YDOA 3UWZA 2BODX 1UP2A 1B57A 1XIGA 4K36A 5BU9A 5LGZA 2IQ0A 1MXDA 2QCNA 3OVPA 1YDYA 1TV4A 3DHPA 1ZRQA 5HQLA 5E6ZA 1YBQB 4IIGA 4KETA 4BZYA 3WQ4A 4HBKA 3N3TA 5L9FA 1QXLA 2YDRA 1UUOA 2WHMA 3QYSA 4DJEA 2VX6A 3S2NA 4IZGA 1DXEA 4PSRA 3BDKA 4TTGA 4LEFA 1XISA 1BSLA 2WPBA 4QP0A 2VDGA 4WCJA 4GCXA 2VFEA 3A22A 5ABFB 1HZYA 1OFBA 2EPLX 5FD0A 3EZ4A 4EK7A 4B2DA 1XLEA 3LV5A 4L7ZA 1F5ZA 1TO3A 3TYEA 1QVBA 1YNYA 3AMDA 3IAPA 4NVTA 4MZ8A 5JUVA 2XIJA 4Q4PA 4LUTB 5F2GA 2IXVA 3S3GA 1TV5A 3MMWA 1I2NA 5K2ZA 3DKLA 4QLLA 3CUGA 4ZB2A 1WZMA 3PN8A 1EWEA 2GK1B 2IKIA 3AYTA 3TC6A 4PUMA 3UP8A 1BTCA 3W88A 3DU0A 5HNUA 2VFIA 1W9DM 3M0LA 4C6BA 3VKAA 1Q5MA 3BO9A 1VYPX 4AB4A 3RLVA 4AY8A 7ENLA 1A5SA 2CETA 2GVEA 5HK4A 3I6RA 1XH0A 2F8QA 2P88A 1MWOA 1VJZA 1V0LA 1A5NC 4L4OA 5FKYA 3SCRA 2JIWA 1CECA 1VPYA 2GVLA 3W2KA 3AIRA 4W8BA 4L61A 3WENA 3I6EA 5HOSA 3W6LA 3AZRA 4H8NA 5F4XA 3TMQA 4GO9A 3K13A 4OIFA 3ALGA 1QUMA 3WLTA 4IGMA 1Q2RA 3LYEA 4C6NA 2EPHA 5CPOA 4DWDA 1ZAHA 3W81A 1XCFA 1S3TC 1EL3A 2NQHA 3SN4A 1JZ5A 2FDMA 3TR9A 2BVTA 3B8IA 3V35A 1H7NA 3SN0A 5JH2A 3GWQA 3TSDA 3QSTA 1Z44A 3WEZA 3T05A 3QN3A 2QUTA 4NILA 2J77A 2FTWA 7PTDA 3KTSA 3L9CA 4UWMA 1NARA 3VKDA 3MSYA 1SW3A 4JYFA 2QJMA 1H5YA 4OV4A 3DFSA 4QFUA 5AFDA 4UQBA 1XLMA 2EPOA 4RDYA 4KW2A 4NAFB 3Q65A 1F61A 4R5EA 1IE7C 1TPDA 2QDGA 3DXIA 4IFRA 1W2PA 3PTQA 3O15A 4BI6A 3PSVA 1RVGA 4C90A 1W1TA 3UXAA 1P0BA 3LCWA 4C6IA 4GIYA 1CB2A 5JVLA 1ZP3A 4QDWA 4RV3A 2NT0A 3V4BA 3ZYZA 1MEWA 4CKQA 5FJJA 1Q7MA 2BY0A 3B0PA 3NQ2A 3A64A 3UJSA 1TX2A 2ZZ6A 3PZVA 1OFQA 4DLFA 4O53A 1EC9A 1H11A 2GLKA 3MJMA 1UJQA 2R8WA 3O1NA 3MHFA 1MQRA 2PLJA 4LAOA 1BKSA 2VKZG 3H21A 2YZ5A 3M5XA 3KW3A 4GBDA 1ISWA 4GD0A 1JRCA 3RILA 4W93A 1TZ7A 4LYKA 4H04A 1WO2A 4LBSA 5GNYA 2WMHA 1WDDA 3SRFA 3NO1A 3IWPA 3NURA 1WUEA 4LXFA 4B5XA 5CCZA 4G1KA 1QHPA 3D0CA 5DRIA 3VD9A 4NU7A 3W27A 2J7EA 4W9TA 3HQ1A 4LNYA 1JI2A 2C0AA 4OWGA 5I77A 2PTWA 2Z1KA 4YVPA 1XLCA 5FOOA 1I1XA 3WLIA 2Y5JA 1KXHA 1BWKA 2V69A 3N2MA 4O4VA 1EIBA 4EPBC 5C6MA 4LVDA 3NL5A 3L5LA 4K8EA 3EWCA 3ZQ9A 4YJ5A 3TN5A 4YS1A 1Q8JA 1TKKA 4BQ3A 3EKLA 4TVCA 3UYCA 4OECA 4HZ8A 1AW5A 1HIZA 1TR1A 1PSCA 3IS4A 3NSMA 1TMHA 4QSFA 2QJGA 5A8GA 4AH7A 1XCXA 1T8QA 4EPDC 3K1GA 1AH0A 5FJOA 2OQLA 1EP3A 3N9KA 3GD6A 4FX6M 4FOJA 3O63A 3LZ5A 2PDXA 4AC7C 3MY9A 1C7SA 4ZO8A 1KB3A 2WMIB 1IR1A 1CX9A 1ECEA 1MZHA 4P7RA 4NASA 3CL8A 1KXVA 2EF9A 3W2MA 4RZ4A 4E4PA 4YWSA 4L65A 1FQ0A 1LF1A 2E28A 3ABRA 5AHFA 3EOUA 3VC5A 1EYEA 4F0HA 2RDUA 2BOEX 1LM1A 4JY9A 4ZODA 1VRXA 2V0TA 3MVIA 3S42A 3T78A 2OZTA 4DJED 5HWNA 1K8YA 4GISA 1S2UA 1VR6A 3H2OA 4TU1A 2YA0A 2I5QA 1UWAA 4CCDA 3M0XA 1JF5A 4GY7A 3BQ6A 4QHRA 3SCOA 4AIBA 1UUQA 2QULA 3W2LA 1SFTA 4GY1A 1DKWA 1Q66A 3PWGA 1IYXA 1PDYA 2YSWA 3OU8A 3BV4A 4QDMA 3WIJA 1V93A 1JPHA 4GNJA 5HWJA 1H51A 5CLTA 2ICSA 1QMLA 2YL6A 1KRAC 4JTQA 3WQPA 1V0KA 2YFOA 1UIPA 3L4VA 3IGUA 1E6XM 2VFHA 4RKAA 3S9ZA 3ONBA 4JR5A 3IJ8A 5KZ6A 1XGDA 4X0VA 3S5OA 4HHHA 1P0DA 4YHEA 1E0XA 2VVNA 4CQAA 2INFA 3BJFA 3Q67A 3GKFA 3MWCA 5G2HA 4GUHA 1OC5A 3DERA 4HHPA 2BNJA 1NH6A 4UFMA 2FPTA 3K1DA 3QH2A 3LXAA 5EB8A 1KTCA 3QJAA 3R13A 4MLJA 4O1FA 3SUVA 5D9PA 4ORIA 8XIAA 4AXNA 3N13A 1UIOA 2GQ8A 3GH7A 5HNNA 3PB0A 3EXTA 3OODA 2TMDA 3VFCA 1KTNA 4QEEA 3OA5A 3WLMA 3KOYA 4H9MA 2VFGA 2ZZ2A 2BTMA 1LL7A 4LB3A 2JKEA 3AMGA 1KM2A 3D6NA 3ZVHB 4LTSA 1PJ9A 4AIOA 1XINA 1JXKA 4CNNA 2ACRA 4QCFA 1CEOA 1SZFA 3EPNA 4W8LA 4DO6A 4Q8MA 1QI3A 3CYVA 3VXGA 4M82A 2HJPA 1V03A 3MDWA 2ONEA 3BANA 2E9MA 1FHLA 2OT0A 2V8ZA 3WH9A 2QJNA 3W53A 3WMCA 3WEMA 1O5QA 3L68A 3FYYA 4EOUA 3EOSA 2QUNA 3VCNA 1XYBA 4MKNA 3AROA 3T0BA 1DHPA 5AZ0A 5EYWA 2Y8UA 4L9YA 1UD8A 4MOZA 3TWAA 2WZIA 1RHCA 2JKAA 2WSKA 4DNHA 1QATA 3ERPA 2GJXB 1F05A 2P3EA 3KCOA 4N9BA 3EPMA 2V30A 4TV5A 3APTA 1MW3A 4W88A 3UXKA 2CXEA 3IACA 1EPVA 2WBKA 4GH3A 2V81A 3IGHX 3O9NA 4MM1A 2ESCA 4D8AA 1VEOA 4PB5A 1JEZA 5JBFA 4DJDC 2E6FA 3QVQA 1KM5A 4PTNA 3GXPA 3PZOA 4EF8A 4CU7A 5CAKA 4GVFA 4GVGA 3GDLA 3LPGA 3FK4A 2FJKA 4B5UA 1QW7A 1VFOA 3RGTA 3ZT6A 5AYIA 1VZWA 3WQ8A 3OG2A 4Q22A 3VDCA 1A53A 1ZZMA 2IPGA 1K6WA 5BCAA 5CZJA 1KC7A 2PGWA 3C8NA 4C6OA 3IK4A 3L0NA 4PRTA 4JTCA 1VBGA 3DUGA 3QQ1A 4M0XA 4QAIA 4R9OA 3ARYA 1JYWA 2HBVA 2AL2A 3AALA 4A21A 3CT7A 2OOGA 1M41A 3FHAA 1MEIA 2F38A 1RCXB 5A1AA 4DBUA 3AS3A 3QY7A 1VEPA 4Q4RA 5BW6A 1H1NA 4YNGA 4NUWA 1VQTA 1EKOA 1ADDA 3GAYA 4JZ5A 4K37A 1JIBA 4DZAA 2WHKA 2DSKA 3P5ZA 3WBWA 2CFFA 4UNIA 2G4FA 4RDWA 3KTXA 4O8RA 3HMCA 2PDFA 3CYJA 2WQPA 3TYUA 3L4UA 1WCGA 3L4TA 3BLKA 1Z69A 3WD2A 2V5KA 1MQPA 5C2CA 5KITA 1C29A 1HO4A 2I5IA 4XKYA 5GNZA 1G94A 2V3GA 1JNDA 3KL3A 5HUPA 4MB3A 1VS1A 2ZA3A 1BYCA 3Q58A 1UBPC 4TO8A 2HVNA 2Z29A 2D24A 2Y7FA 1HJXA 1HXJA 1HN1A 4B3LA 1Q85A 4DF0A 5K9DA 3M0IA 1XSKA 4W8AA 4C6EA 5A6KA 4H6KA 4ZGYA 4FR1A 1TJ2A 1AFSA 3LRKA 2FVMA 3QXBA 1H50A 3HG4A 4D6IA 2ASHA 4JD4A 1H5VA 2RFGA 4UTTA 1VPQA 1DTUA 4NT0A 1LBFA 1XLAA 3WEOA 3SUTA 3FV9A 3A13A 3OLDA 3I3BA 4O11A 1WOBA 4Q7IA 4F2BA 5ABTA 1VFSA 4M24A 4NNCA 1ODZA 3LCHA 4H9ZA 4Q8OA 2Z28A 2Y88A 1I60A 5BOEA 2CLLA 2PB1A 3WD4A 5I02A 3LHVA 1GVFA 1GW9A 5IXEA 5LIXX 1FVPA 1OSEA 1CXKA 1ONRA 4XB3A 4GHRA 3W75A 2BFGA 4ORMA 3CB3A 3W07A 3TDFA 3ITOA 1GOMA 3GRIA 1RBAA 2V38A 3OZMA 7XIMA 1SZNA 1PXGA 3CJPA 4NSBA 1I6NA 1VFTA 3NOEA 5FEPA 2VO5A 2BXYA 1QPNA 4RNHA 1ONWA 5CG0A 3GW3A 3IRDA 1MW2A 2J4GA 2WHLA 2OGYA 1BGGA 3IV8A 1OHLA 6TAAA 1YEYA 5AHLA 4BKNA 5FI8A 3HV9A 3CB8A 3UJEA 2VEKA 4XV0A 2ACQA 3B3DA 1P0EA 4JTIA 2QLYA 3HGRA 3GHTA 5HULA 4WDTA 1AA1B 2VX5A 2WMFA 1TUFA 1DV7A 5REQA 3L4WA 3FFSA 4O17A 1TPFA 3U0HA 2ZRWA 2IPFA 4NZFA 2BVWA 2GVJA 4GBUA 4ZO6A 4YYCA 4RPPA 2Z26A 3EAUA 1S3HA 5AOUA 3VOCA 1O5RA 3PANA 2EPMX 3NR0A 1QBAA 1UMYA 2DW7A 3B0VC 3HTWA 3AMCA 4AZCB 4M19A 4IXXA 3KHDA 1CIUA 1QPKA 2QCFA 3LSBA 3TOPA 3IJIA 3W7CA 1GYMA 4O12A 3V75A 2XTKA 1C8YA 4WGHA 2XFFA 3DH7A 2OLSA 2PUZA 1X1NA 1GPFA 2GGHA 3L2LA 1M01A 4JFUA 3WUEA 1FHDA 4KMQA 2XISA 4TR9A 4UNLA 1CZ1A 4KQNA 1KBJA 1Q6FA 3GXDA 5DEZA 1OY0A 4IOTA 4J27A 2Z27A 3NQMA 5CPSA 3WLPA 1O66A 4IP7A 4AWSA 4V2XA 4H6QA 1TPVA 2ZBTA 4GCAA 1RALA 3M0ZA 3TYAA 3MO4A 1BLIA 3BVJA 1HFBA 2QCDB 3OVGA 5HANA 5KINA 2QYGA 2Z24A 4BJHA 2WJEA 4CNPA 1QNVA 3ANYA 4W89A 2HE5A 5C2GA 4IX0A 2I56A 1AW1A 4Z1YA 1FDZA 2E9LA 2OQHA 4M7TA 3B0XA 2VX7A 5FEWA 1DWHM 2BASA 4IIHA 4I8DA 4LALA 4KWSA 4P8VA 4EWJA 2RGMA 4UOZA 4R88A 1AG1O 5D32A 3EWZA 4UTLA 3TZFA 3DYPA 4PODA 3PR2A 5CEWA 4NZ3A 4KH2A 3JVAA 1GZGA 3UERA 3EOLA 3TN6A 4MG4A 1NF7A 5KTLA 1K7XA 1ZTVA 3AWOA 2ALDA 3THCA 4FK9A 4MFDA 4PBEA 2J13A 4TUFA 3GZAA 3KVKA 4LBUA 3TYZA 2Z2BA 4UFLA 1CGVA 3T2QA 2ZDSA 4HN8A 2W6RA 4AF0B 5DXXA 4H2CA 4A3UA 1Y8BA 4LAMA 1FX6A 1OYAA 2XDFA 2J7GA 3QEZA 1WE5A 1XFCA 3TN4A 4D71A 1R0MA 3AHZA 3QPYA 1K7FA 3S83A 1WB0A 1TTQA 1IIGA 1C3FA 1TVPA 4BWLC 3K46A 4GVIA 3KOFA 1N8IA 3IK2A 2CBUA 3LNMA 2NVCA 2AMXA 4N6FA 1CTNA 1X6NA 3CH0A 1OGSA 7REQB 4C5ZA 5F2LA 4O28A 4ZXOA 4JIQA 1OF8A 2CZEA 2OSYA 4A3QA 2ZWZA 2WNZA 3CZGA 2YJQA 4QSHA 3NYZA 4K38A 2QF8A 3RU8X 3MCNA 3W1QA 1SO5A 4PB3A 4KCWA 5D8ZA 2VUYA 3ABZA 1YPFA 5ECUA 2EHHA 3CUXA 2Z0IA 2ISVA 4ASTA 3GYEA 1VYSX 3DG7A 3LTSA 4ATWA 1DVJA 1GVEA 1EA0A 1TA3A 3WH8A 2Z6IA 1JD7A 4Z17A 1L6FA 1MQQA 3OBKA 3NEHA 3O8AA 1TWDA 1EJWC 4PE8A 2OWWA 2YLAA 2GJPA 4Y9PA 3VIHA 3TU9A 3ARTA 3DENA 1JAEA 3SZ8A 2OYLA 1JR1A 5CPNA 4UOQA 1LDCA 4O0KA 3CMJA 1TV3A 3VPLA 3PULA 4US6A 2RKXA 3CQIA 3ZJ7A 3QZAA 4DJFC 2XFRA 4ZE4A 1LQ0A 1E1EA 4W7WA 3BW2A 1NU5A 3A6OA 2R1MA 5LNUA 4UB9A 2JK2A 3WX7A 1EWDA 3GG8A 2Z2UA 1W3TA 2P1FA 4Y9MA 3S0CA 1EX5A 2W27A 1JCNA 5EFFA 2PTZA 1E4IA 4LBRA 1S38A 3IJDA 1SYTA 3OVRA 3S2JA 4S3CA 1ADOA 4QCEA 2BV9A 2I7GA 3W24A 3PUGA 2A6LA 3ATYA 1M7PA 3KLKA 2AKMA 4OUIA 4B16A 1HG3A 4QG6A 4IGSA 2DFAA 3QV6A 4M6VA 1R7OA 4W4QA 1QWKA 3RX3A 1XD0A 5CC7A 1S5NA 1IXOA 3KX6A 4EXAA 4DWSC 3GVRA 3OB8A 4XUYA 1PKYA 4P8XA 2G3MA 4GFIA 3SDOA 3GLCA 4L80A 2GYIA 1ZCCA 2HSAA 4LH8A 2XU2A 1F9CA 4IF2A 2ANUA 4HYRA 1YHTA 2DZVA 4JNYA 3E0VA 3HZ3A 4H00A 3T55A 3SRHA 2DEPA 4C5YA 2VR2A 3W37A 3G6LA 2DIEA 3DCPA 3A4XA 4G5DA 5CSUA 4EWND 3KHJA 3LN3A 1WKYA 1DJWA 3O2LA 5F2IA 4MWAA 2J75A 2V3FA 3IARA 2X2YA 4OJYA 1QT1A 1NWTA 1J2WA 2NLIA 1IV8A 3SW6A 4PFHA 5KZEA 2BLEA 4HPHA 1GWJA 3UGRA 1LWHA 3BGAA 1QRQA 3TNOA 4I90A 3AUJA 2FPVA 4LSBA 4MIMA 3GK0A 2C71A 4XO6A 4PL2A 1U83A 3GZ3A 1IWPA 3W0KA 5TIMA 2WYSA 1M04A 2V82A 3GO2A 1LBLA 1OC7A 1US2A 2J66A 5CC3A 3UWQA 1UG6A 4H2HA 1XDLA 2VZUA 3FY1A 2O7QA 5BRQA 3MBDA 1P7TA 1QHZA 2EG8A 5T91A 6REQA 5HMEA 3OQ8A 4Q4SA 2IPJA 5LXEA 4A22A 3GS6A 3LTYA 4MDOA 4DO4A 1HKMA 1I45A 1BFNA 4HU4A 4AMCA 3ARRA 2A7RA 2YBUA 4F0KA 4A2RA 1XDJA 5A6MA 3O7UA 4PEKA 4A35A 1LL4A 1B3XA 3O3RA 1SMDA 1L6SA 1TRIA 4H9YA 3D3FA 4D6FA 2YL8A 2RDTA 1OG6A 3GR4A 2WCSA 2P0OA 4C6QA 1ISVA 1HJVA 1DWJM 3S6DA 2A3BA 4HNCA 5CSSA 1GOQA 1HP5A 4U2ZA 1BKHA 3ITTA 4LUYA 1H7WA 5JIWA 1EC8A 1D3HA 4HA3A 3C4UA 2ZTKA 4OVXA 4I7WA 1M03A 2OTDA 3FAXA 2PA6A 1KCZA 1SFLA 3QGKC 1PTGA 3DFTA 3WH7A 3FNDA 5LNWA 3IJ9A 5AC4A 1SW7A 1JG9A 1GVIA 2H3BA 3A12A 1W1YA 1DEDA 4HSNA 2G3FA 4OOZA 3BOFA 3SO7A 4JFTA 1ITQA 4XBSA 2KAUC 3CQKA 3PC0A 2CU0A 4AIUA 4QS6A 1SJAA 1GONA 4PTMA 1PO9A 3P61A 1TREA 1AQHA 1CXIA 5CAHA 3E2VA 3PTMA 5EKYA 1E0VA 3G1SA 4OHQA 3LXBA 1TPUA 3M64A 2YA1A 2GUUA 1OQFA 2PSNA 2A3LA 3DBPA 3VINA 1XICA 5KZMA 2FB2A 3TFCA 3NPWA 3GFYA 2AGTA 6CGTA 2DVUA 3MCOA 4K1GA 3ZFHA 2R94A 3DZ1A 2ABBA 3UR5A 1FP9A