3M5XA

Crystal structure of the mutant v182a,i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
219
structure length
212
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGPGETLRFADAAIVGRSIYLADNPAAAAAGIIESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 83
structure length 212
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m5xA00
5G2HA 2GQ8A 1ZNNA 1T0OA 3BLFA 1EWDA 1H50A 1ZENA 3YPIA 4N02A 2TPSA 4AWUA 4R33A 3S1WA 3EX4A 4DO4A 3GR8A 3M16A 5EL1A 1Q45A 3NL2A 2E1DA 1R46A 5AYXA 4GUHA 3G1XA 2GQAA 4QQ3A 3W7PA 1MSSA 2QUTA 3LXBA 5ABTA 2C6QA 1AMKA 1EUNA 5SWUA 2I14A 4IMEA 1VYRA 3DXIA 1QOPA 4QAIA 5FF2A 1TCDA 2Z1BA 4LT9A 3DBPA 2QF7A 1DQXA 4K8EA 3TH6A 3W7JA 2CLEA 3W71A 1OK6A 2EPHA 3W75A 4UTUA 4ZL1A 2EAWA 1H60A 3LM7A 2QCDB 3BG3A 3L65A 4J9JA 2GOUA 3LCXA 1SZFA 3HF3A 2FQIA 1J4EA 2QCEA 4NX0A 4XQ6A 2Z2UA 3WK2A 5LSMA 4R7JA 4EVZA 3C52A 1FWNA 1F76A 1HTIA 3QYQA 3UWVA 3N9RA 3GDRA 4FNTA 1FXPA 3HJZA 1B9BA 1GJPA 1SSGA 1V7YA 4MPQA 1ICQA 3TXZA 4O1AA 3PB0A 3R89A 1KBJA 2J24A 3VKJA 2BX7A 3FIGA 4OQVA 4ORIA 3MWAA 2VC6A 1TSIA 4A2SA 3DGRA 2RHGA 3VCRA 1F2JA 4UCGA 1SW3A 3M5YA 2OMAA 4DBEA 1LRTA 1AW1A 2J6XA 5J5RA 2BZNA 3NL3A 4DQWA 3A9IA 1JUKA 5FI8A 2A4AA 1AK5A 2DP3A 1S3HA 3BLIA 5F1UA 1GYLA 3W7MA 1L6SA 4TR9A 2VEMA 3P80A 3UXDA 3STCA 2DZUA 1O94A 3UNDA 1KM2A 4QNEA 3KVLA 1DKWA 2V8ZA 5KZDA 1FCVA 5D04C 3HPSA 4NT0A 4NJKA 3TC7A 3QW4B 4FIQA 2W6RA 1TTPA 4S2BA 1LOLA 2ZDRA 1KFCA 2GVJA 2ZA1A 1KFLA 3DFOA 1X7FA 4FXRA 4MYXA 1IIGA 3TSMA 3HG2A 1FCUA 3SZ8A 2CFFA 4RLIA 3W70A 2WSQA 4EIVA 4IMDA 4FB7A 4IXHA 3EKZA 4JY9A 4NXKA 3NM1A 3HPXA 3CHVA 3P8JA 3HMJG 5G4WA 3MBFA 1NEYA 3Q37A 1D3GA 4UR7A 2WPBA 3TMLA 2J88A 2WO5A 1EIXA 3S9YA 1PV8A 4JTEA 4UTHA 5AC8A 4RR4A 1XBVA 3C2OA 4NJGA 4P2VA 1PHQA 3KOFA 1GTEA 2QJHA 1H7RA 4S2CA 4Y6GA 1X1ZA 3DKLA 3ATYA 1LLZA 5CZJA 4RXGA 2OX1A 7TIMA 4GE8A 1HO1A 1UBSA 4IXXA 3NGJA 4FNPA 5AFDA 4UNKA 4HNUA 2CLIA 3TIMA 3UZJA 4PH6A 2NUYA 4LUJA 1CW2A 5EBUA 1VHCA 5KMYA 4LW7A 4IX0A 2CLLA 3IEBA 1VR6A 1I8JA 1K03A 5TQLA 3S8HA 6TIMA 1ZY9A 2E09A 1FDZA 3MI2A 3QEZA 4RZ6A 3CPRA 3UY7A 4AF0A 3MHFA 5HINA 3HPZA 1DJQA 3S5OA 4EF8A 4AHOA 3BARA 4NQ1A 1SFLA 4XKYA 1BTMA 3MW7A 1BEUA 1FWTA 2QJIA 3SSJA 3C6CA 4JD4A 1G4SA 3MHGA 4XBSA 4EF9A 3ZR4A 4HT3A 2BSLA 4PEKA 5AHMA 4BR1A 4O10A 1H63A 3W88A 4X3ZA 1JUEA 3BGGA 2HMCA 3PR2A 2JKPA 3W7EA 3TK7A 3LXCA 4TMCA 3P81A 2FJKA 3OIXA 2P0OA 4LVGA 3DH7A 5D02A 2RFGA 4JTHA 1FQ0A 3LERA 2Q8LA 1C29A 5AYZA 3D0CA 5AC6A 3B0PA 4N4QA 2E6DA 3UPBA 3LCIA 4O0KA 1DV7A 3G22A 4GJ1A 5F2IA 1DOSA 1GYNA 5DCEA 2YW4A 4JYFA 1UUMA 1O5KA 1R2TA 2Y7GA 1XUZA 3I68A 4MJZA 2GJLA 2JGYA 3PG8A 5G4EA 3B0UX 3LI1A 5CZSA 4NU7A 1H1YA 4MKNA 1I2NA 3PBVA 3QPYA 3G1SA 3LXAA 4LRTA 4FNSA 4H3DA 3B4UA 3MP4A 3LCLA 3LX9A 1DJNA 3BLEA 3N14A 4Z1CA 1QOQA 4K39A 3G1VA 2ZA2A 4O1CA 3TDFA 4U4MA 5DY2A 2E5DA 2QCLA 3C8FA 2QR6A 3FYPA 3N19B 5E0KA 3LCHA 5D2XA 3QW3A 1AW2A 3QMRA 4GFSA 3L0KA 4Q32A 3ABRA 2R8WA 2JK2A 3GXTA 3ZS4A 5D03A 4AXKA 2NXIA 1TV7A 1LLWA 5DELA 2NZLA 2QKFA 5CG7A 1RR2A 3PWAA 2B4GA 4XKYB 4LUIA 1KV5A 1L6YA 5FESA 4UTIA 4ICNA 3O6DA 4K37A 2GVLA 3N9SA 1THFD 3M0ZA 3PSVA 4WUIA 4AHPA 1LTDA 4KFPA 3BGJA 1KA9F 4UMBA 4YWIA 3U8GA 1Q6QA 1K8ZA 1X6UA 2AGKA 3W6YA 4WJEA 1YLVA 4QIUA 4Y8FA 3IIZA 3C2FA 2Z6IA 1JRCA 2A7NA 3MP3A 2BTMA 1TB3A 2ZYFA 1VCVA 1MEHA 3ABSA 4ADTA 1KFKA 2NXGA 5IBXC 1ME9A 3T78A 1EP2A 4L4LA 3VNDA 3DFNA 3MI3A 4DF0A 5HUOA 4DF2A 3L66A 4ONVA 3CEUA 3Q94A 1W5PA 5HUPA 3CU2A 1R47A 1ZJIA 3AO0A 3GXNA 2DZSA 1IXOA 3IGUA 4LRSA 2KZHA 2LLEA 3WJWA 1EB3A 1FWSA 2GJNA 2E77A 1KLZA 2ZZ5A 1SUXA 4O18A 1GTHA 2V2DA 2E6YA 3LBCA 3M43A 4QITA 3W84A 1KM4A 1OYBA 2VFGA 1W5QA 4O12A 2YDAA 3MBDA 3OHIA 4MUZA 2FB2A 3NDOA 1DL3A 3W86A 2E6FA 4NNAA 5FEXA 2TRSA 4TX9A 1VLWA 4O52A 1F6PA 1R30A 1IXPA 5D2TA 4GUIA 3NQ2A 3VE9A 4BWLC 3NG3A 2ZZ1A 4OWGA 5F2MA 1SO5A 4ADSA 1G69A 3U6WA 1TQXA 4NJJA 1Q3NA 2F84A 2ISVA 4O4VA 1F74A 4B5NA 5KINA 2FFCA 3B8DA 3CIWA 3G8RA 3PVFA 3W83A 3EKLA 1PCWA 3S6DA 2RDUA 5CPOA 1D9EA 1VQTA 4DBDA 3M5XA 1J5TA 1QO2A 3DAQA 4YXGA 3CT7A 1NVMA 4N2YA 3W2UA 3W2LA 4I7WA 4NNCA 2YW3A 2GUUA 5D09A 3MYPA 4AH7A 3U2OA 1OX6A 4MZ1A 3W1AA 2A85A 4NJIA 3CB8A 2QDGA 1Q6OA 1W8SA 1UASA 4DO6A 2C19A 3OVQA 2FIQA 4GWEA 5C55A 4CNPA 2JBMA 1TTJA 3LLFA 1QWGA 1UUOA 1QO5A 2B7OA 2TYSA 3LV6A 2GPTA 2YPIA 2YCEA 1SQ7A 3NPWA 2YYTA 3L0NA 1Z41A 5AHNA 4OHQA 1B4KA 1KFBA 2C18A 1NF7A 1EPXA 2B7QA 3EWZA 4JTGA 5DBTA 1S5VA 1SO4A 1H7PA 3NA8A 4GC4A 1QR7A 2CLFA 2A21A 1XBXA 1W31A 5CGQA 4A29A 2QCFA 2HS6A 4HSOA 1WOAA 3BG9A 3QM3A 3PBUA 3MP5A 3SECA 1W3TA 4HKPA 4JX4A 1WBHA 1K8XA 1I4NA 1OF8A 1TYGA 3IVTA 3E9AA 4GUFA 3BVJA 1EX5A 4CCCA 1QPNA 1I2OA 1O5XA 5AHLA 3KAOA 1X8FA 4JTTA 1ZCOA 3W7DA 5AHEA 3V75A 4N9DA 4FNQA 2PRHA 3W7KA 3G1DA 4KFNA 1QMLA 4IJBA 3CEPA 2V0TA 3USBA 3GIYA 5LGZA 3CIXA 3PUEA 4RCXA 2V30A 2P1FA 4U28A 2RKXA 2G96A 1VS1A 3L0GA 2B7NA 1QAPA 5F4SA 4Y9AA 1OK4A 2CLOA 3Q58A 2GVGA 2DU2A 1FUYA 3A21A 1TV8A 3DZ1A 4QNWA 3TAOA 3KHJA 2OT0A 3TROA 3QPZA 5CPMA 4O28A 2H8XA 1XBZA 4IOTA 4NVTA 3G1HA 2ABBA 1YPIA 2O7QA 2VENA 1F6KA 5I3KA 3SJ3A 3G1YA 2Y88A 3HB9A 4MLRA 4ALDA 1QFEA 1YDVA 3H53A 1S5TA 1TIMA 4UFLA 5G1TA 2X1SA 3HBLA 3RFAA 3JRKA 3IIPA 2H8ZA 3LRKA 1LRQA 4BWLA 3GVGA 1ZAJA 4JYEA 3FKRA 2W0UA 3S0CA 4XTDA 3O16A 2NV2A 2YZRA 1J2WA 5A5WA 2WJZA 4A21A 5FEPA 3O63A 4HSNA 5HWNA 2VFDA 3O15A 3NQGA 1AL8A 3MYOA 3KRZA 1OX4B 1KM1A 1MO0A 3L5AA 1A50A 4N4PA 5DXYA 1H61A 2H90A 3M1ZA 4AHQA 1ADOA 4DPPA 3PF3A 3SY5A 2EHHA 3MO7A 3NQDA 2Q3RA 1KM6A 4UTLA 2CLMA 4CNNA 5BW6A 4JTUA 2ZRVA 4CNOA 3W7CA 2X1RA 3I7RA 5C2XA 4IQLA 3S5ZA 1OX5A 3EWUA 3NL6A 5FF4A 5CPNA 3TMQA 3IVUA 4LVBA 3JS3A 3N34A 3NQ7A 3HQ1A 3UWYA 3C0JA 4OV4A 2FLIA 3DFTA 3ABOA 3W7GA 3IV3A 3WJYA 1I2PA 2DORA 1GPWA 4TU1A 1W5NA 2E6AA 3GR7A 4A3UA 2ZTJA 4E2DA 1A5BA 5G5IA 3SR7A 1W54A 2NWSA 1SPQA 2WV8A 2DZWA 5AYYA 1K7FA 4O14A 3UZ5A 3THAA 2YFOA 4Y90A 2ZRZA 2FPVA 2ALDA 1PVNA 3QMSA 1IF2A 5TIMA 2NX3A 3SGUA 3S1VA 3W1NA 1TPDA 2CZEA 3W76A 5CSRA 4M7SA 4AWSA 4UTWC 3FYOA 3LTSA 1Z48A 2G5WA 2V81A 4JX6A 3TC6A 3A24A 1IIHA 3B06A 4O1DA 1XC4A 5CPLA 1DQWA 4PC8A 2VFFA 1OFBA 1KM0A 3CTLA 4RZ4A 5I3IA 2VXNA 2PC4A 3EXSA 3NEVA 4LS0A 1ALDA 1ZAHA 1TJRA 1XL9A 3NQAA 3TW6A 5KZMA 4PTNA 3OEXA 1KFEA 1EEPA 4ZQNA 1BWKA 1I2QA 3C2EA 4JY8A 1HG3A 3BW2A 3G18A 1JQXA 3L5LA 3RU6A 3LB0A 1K3UA 3HG4A 1T96A 3PB2A 3E96A 5DCDA 5AC7A 4TO8A 3W73A 1W56A 2CLKA 4YL2A 3W22A 3LHYA 1FCBA 2Y6ZA 4PODA 1TJPA 1LCOA 1LYXA 4EWND 4NZJA 4H6KA 4IPIA 2H6RA 5F1VA 3NOEA 4UFJA 2PE4A 4XZ9A 3W1PA 5H2ZA 4YCOA 1YXCA 1WAUA 1NFBA 3NNTA 1OFOA 4JEQA 1QPOA 2OJPA 3HGJA 3I7QA 5MHBA 1N8FA 3EEGA 1FCQA 3UD6A 4Z1DA 1TTIA 1S5WA 3DFPA 3GKFA 3LHZA 4ZMGA 1LZOA 3QQ1A 3NPXA 3INPA 1O60A 2FPTA 2NWRA 4UFIA 1KLYA 3QF0A 2QAPA 3TA6A 1BWLA 2VKZG 4HNTA 2DZVA 3B03A 4ZVJA 4UXDA 1K02A 4MY8A 2Y63A 2Y61A 3IGXA 3L5MA 4FF7A 3W23A 1H7OA 4E2BA 4RZ5A 3LV5A 1W3IA 4RK8A 2CW6A 1QDSA 4JR5A 1JCLA 3KFTA 4DPQA 3M44A 4WY0F 4LY8A 2ZRYA 5D2YA 4ZQMA 4QSHA 4GUJA 4O19A 3K30A 4Q33A 1LRNA 3NM3A 2Y89A 3KVKA 5KSWA 3GB6A 2C15A 2V82A 1SO6A 1KM3A 4MVAA 2JKEA 1K7XA 2BWGA 2X1UA 4MFEA 2PRMA 1N7KA 5DLCA 3UYCA 1LOQA 2ZZ3A 4NX5A 1RD5A 3OVPA 4PCFA 2DJLA 3I7SA 2VELA 5KTLA 1TPVA 5DCBA 3AJXA 5D30A 3O6CA 1YXYA 4AWTA 4WXZA 5C5YA 3R13A 3GAYA 3RMJA 4LVFA 2P10A 3MHUA 3NO5A 2Y7FA 5HR7A 1VH7A 1FX6A 3PUDA 4DELA 4UTWA 1PE1A 3PG9A 3PULA 4FX8A 3W1MA 1XXXA 4LC6A 4K36A 5KITA 4X9SA 2NUXA 3N73A 2A2IA 5G2WA 2VFIA 2ZFAA 4N9EA 3L21A 5AOUA 1YYAA 2QEZA 4LNYA 3RF9A 1SFJA 3OBKA 2YFNA 2YXGA 3G3DA 3ZWTA 4AF0B 2QAFA 2A7RA 4D2JA 2C1HA 2Q8ZA 1ML1A 3EXRA 1WBJA 2Y7DA 4JTFA 2DZPA 4ORMA 1A5AA 4OT7A 3KVMA 2CU0A 2C13A 2E5BA 1H62A 1OFQA 2DJXA 4M7TA 3GK0A 2WKJA 3CLMA 4M5PA 2Y7EA 3F4WA 3G3MA 5K4ZA 1XKYA 3BPWA 4DO5A 2V5BA 3M41A 3P67A 2CZDA 5HR6A 5HJLA 3LRLA 2V5LA 2RH9A 4JTSA 1GVFA 4A22A 1XI3A 1NF0A 3ELFA 4UMCA 1D3HA 4K7YA 4R53A 3T4CA 1WA3A 4LV9A 1M5WA 4YCPA 5K4XA 4K38A 4MZYA 4O1BA 4OE7A 1W37A 1YTDA 2GQ9A 3CC1A 3NYZA 1FY6A 2ZRUA 3NPUA 1TREA 3QFEA 2PCQA 4ADUA 1GVQA 3RK8A 8TIMA 1ZFJA 5I3FA 4O53A 4UTMA 5E93A 1H51A 4OGZA 4CLMA 1XBYA 3TFXA 2ZZ7A 1TQJA 2IQTA 3TQVA 2A7PA 3NQEA 1JCMP 2J9XA 3P7YA 2OT1A 3S42A 4JNMA 2XFWA 5LZLA 4MY1A 3O07A 2X16A 3A22A 1PCKA 4FHAA 2QCCA 3S1UA 4NNBA 2E5CA 4QM1A 2ABAA 1OYCA 2QJGA 4GRSA 1JUBA 4RJEA 2VEPA 1VC4A 1AL7A 1NAL1 3IIVA 1WOBA 4JGDA 2H3DA 1Z44A 3CWOX 5BOOA 1OHLA 4MYAA 4LVAA 3LGEA 1G7VA 1P5BA 3LRMA 2W79A 1OFPA 4XUGA 1P4CA 4XTIA 4ZQPA 1SR9A 1EWEA 2OCZA 1L9WA 2Z0IA 3C2VA 4WY0A 2XN1A 1RPXA 2J27A 4NZFA 5F2LA 3GDTA 1BKSA 4DXVA 3QMTA 3CM4A 2NLIA 1MEIA 2C14A 1OJXA 1LBFA 2OZ0A 3M9YA 4XWUA 3T44A 3E12A 3NQFA 3TUUA 1FWWA 2A6LA 3G1FA 3FEMA 1FBAA 2V2CA 2AQWA 3STEA 1DBTA 5LNWA 3TCEA 2RDWA 3LHWA 1GVSA 2YSWA 1NSJA 1ME7A 3PAJA 3MJYA 4GUGA 3RLVA 3UXAA 1EP1A 3BK0A 2X30A 4X2RA 1VCGA 4MJMA 4OV9A 1T99A 3P5YA 1G4TA 1UB3A 1OYAA 4RV8A 3PC0A 3ZWSA 5D2WA 2R14A 4JDYA 1YPFA 4KFOA 5K9XA 4S1FA 2D73A 3I65A 3ZFHA 3MUXA 3TSBA 3NQMA 3PS7A 3W2NA 2ZZ6A 3UY8A 3B04A 2XN0A 4N9CA 3NXFA 4QJ1A 6ALDA 3W1QA 3VFLA 1W5MA 2X1TA 3IVSA 2Y85A 3Q2DA 3NZ1A 3N2MA 2EF9A 4WX2A 3DENA 2ZZ4A 2BXVA 5HNRA 4LV4A 3GKAA 1VCFA 3C56A 3IIOA 3TW7A 5BNKA 1V5XA 3HG3A 1OF6A 4O11A 1GZGA 4L4MA 4WXYA 2VFHA 1TPB1 1DHPA 4M6QA 1M7PA 2A0NA 3NQVA 4N6EA 3G0SA 2B7PA 4M6PA 3QC3A 5K9DA 4BFAA 1QCWA 1QNVA 1WYIA 1CI1A 1TRDA 3HGRA 4KWVA 1OFAA 5FEWA 3G0XA 4FEZA 3TSDA 5HMSA 5EA9A 1C8VA 1SW0A 4MIMA 5DY3A 4IMGA 3P84A 5HWJA 2FTPA 2ZRWA 2ZRXA 4XBKA 3TJXA 4WY0B 3UWUA 3W7NA 2WOQA 1LORA 4EOUA 3W7QA 5LNVA 1P1XA 2HSAA 3PUOA 3TE9A 3LTYA 5LHFA 1XFBA 4O13A 1RV8A 3V1PA 3LHTA 4PL2A 3NL5A 4Z1AA 1FXQA 1GQNA 4O54A 3LCGA 3SFKA 2CZ5A 4LVDA 4O15A 1U83A 4WD0A 5U7SA 5EYWA 1JJKA 5EY5A 2DZXA 3EXTA 1QPRA 3B05A 5IM51 1M6JA 1SW7A 3FJLA 4JICA 1Q6LA 4O8RA 3R2GA 1KV8A 4IPJA 2V9DA 3I6RA 1U5JA 3DU0A 3F03K 4M19A 1K7EA 3KXQA 3EX1A 1H1ZA 3EWXA 4JTJA 5GVJA 2G97A 5CKSA 2QUVA 1W5OA 1E51A 3LLDA 3W3OA 4LC8A 1L2UA 5BMXA 4WOZA 4KKXA 1FDYA 5CZ0A 4BI5A 5LGXA 1VPXA 1TPFA 4N6FA 4UTKA 4GNJA 2ISSA 3KRUA 3SW6A 3GX9A 4UFMA 3E0IA 3W07A 4Z0SA 4IMFA 3C61A 2CZFA 1A5SA 1TPWA 2CWNA 4JYDA 3GYEA 1LOSA 2EGZA 3P74A 2C0AA 5K3VA 4MFDA 3GDKA 4O16A 5E1QA 2ATSA 3IRDA 2VOMA 1F7BA 1GWJA 1YXDA 3HG5A 3EWYA 4JX5A 1EP3A 3TXVA 3OVRA 3C2RA 3ATZA 1M7OA 3PM6A 3SGZA 4WQ6A 4Z1BA 5TBOA 2V2HA 1N55A 1RQEA 4I7VA 3NR0A 2PRLA 3WFAA 2QCHA 1Q6RA 5K9CA 1WV2A 4MZ8A 4AMAA 3LHUA 3STFA 4MOZA 4LU0A 1VGAA 1XM3A 5HWMA 1F73A 1GEQA 2BLEA 3G1AA 2ZZ2A 3UQNA 5DBUA 3KX6A 3W1LA 4CQAA 1LP6A 5LKYA 4RKAA 4IGHA 3A5VA 3LI0A 5G2IA 3TNOA 3G24A 3FKKA 1VRDA 4CCEA 3N2XA 3H54A 3TJLA 1GT8A 3OA3A 1C9DA 2I1OA 5D2VA 3E02A 2PURA 1DVJA 2I9EA 1CX9A 3W7IA 3EX6A 3THQA 4AEOA 2A1YA 4Z08A 3W1RA 2R94A 3EX2A 1GVOA 4POCA 3O05A 3SIZA 3W2KA 1YDOA 3CQ0A 1QPQA 4G1KA 4Q4KA 4WOQA 3L2IA 4O0ZA 4AAJA 3NQ6A 2AAMA 3MMTA 1MEWA 3W7HA 1IXNA 1P0KA 4HN4A 1FWRA 3DHFA 1MZHA 4QISA 2HS8A 3VE7A 3BW4A 3QJAA 5AN7A 1I45A 2QUUA 3HGSA 3DI1A 1F05A 1ICSA 1H7XA 4P61A 2HTMA 4GXMA 5I3HA 3FS2A 1MXSA 5CZTA 1EA0A 4UIOA 4ZQOA 4PFMA 1G6CA 1HO4A 1Z42A 3DI0A 1TMHA 3QZEA 4KWWA 3S5YA 1LROA 2FDSA 1JCXA 3C4UA 5HQEA 3IGSA 4Y96A 2QDHA 1SU5A 2O7SA 2VFEA 3LCWA 1G67A 3M6YA 2YR1A 4W9TA 1TO3A 3DFQA 4BI7A 4JS3A 4K6AA 1OABA 1RQBA 1LM1A 3F4NA 1R2RA 3OG3A 1IXQA 3NPVA 4H4IA 3TV8A 4FO4A 1JRBA 2YX0A 3P8IA 4UTTC 3GDMA 5AB3A 1G4EA 1ZALA 3W1XA 3NQCA 3IIXA 1JCYA 3FJ6A 1TPH1 2ZQ0A 3MI6A 3W2MA 4FIRA 3WJZA 3UPWA 4C1LA 1WX0A 4YMZA 2QCGA 3LDVA 4LWWA 5AHIA 2WNQA 3DKJA 4FNUA 3W7OA 3NAVA 1TPC1 3WK0A 4K7VA 3W72A 2FB3A 4UC5A 5DXXA 3S5NA 1WQ5A 2A6NA 5L9FA 1Y0EA 1DORA 1H7NA 3NZRA 4WZHA 3BV4A 1O95A 4UUIA 5DN1A 5F4WA 1RZMA 4NJHA 1ICPA 1TTQA 1B4EA 4RX0A 1IGSA 1T8XA 2EKCA 3GNDA 1GOXA 1OFDA 3BO9A 3HOJA 4AB4A 3E49A 3T7VA 1TV5A 2VEKA 1HFBA 3DHDA 1VYSX 2J9ZA 2Y62A 1X1OA 5FF7A 1OFEA 3FFSA 4GBUA 3P62A 1SZEA 4JDBA 3R12A 3RNDA 1WXJA 3HO8A 4BF9A 5G1YA 1YTKA 4E0CA 5FF0A 1LDCA 1W3NA 3TQKA 1SSDA 2QCNA 4TIMA 4BK9A 5KZEA 1I2RA 1PS9A 4R34A 1LBMA 3DFSA 3GZ3A 3TKFA 1R2SA 3PBYA 1JQVA 1VJIA 5K7JA 5AHFA 3TX9A 2JGQA 2WNNA 1B3OA 2E68A 2WSYA 1KTBA 1YDNA 1JCNA 4O4WA 3A23A 1HUVA 2H3BA 3W1TA 1F5ZA 2ZBTA 3BG5A 3QSRA 2TSYA 4LOCA 4LTSA 4HNVA 3WK1A 3L67A 3TAKA 5D33A 5D38A 3P61A 2QCMA 4O17A 1ZAIA 1SZGA 4UR8A 3GLCA 1P0NA 1YADA 3NQ8A 1KFJA 3W87A 4NXSA 5U4NA 5LNRA 3W1UA 1JULA 5EMUA 4JTKA 1SZNA 2ZA3A 5D05A 2WNZA 3F1QA 4CQ8A 3ANYA 4N9BA 3WJXA 4A2RA 2Q3OA 4K8HA 1A53A 3LTPA 4OU1A 1EUAA 3G0UA 2RDTA 5LNUA 3LBMA 3TFCA 3W2JA 3O6YX 2Y70A 3O1NA 2ZTKA 4HHPA 2VEIA 1O4UA 1JCJA 3GNNA 1TPEA 5I3GA 1GG0A 5EKYA 1XDMA 5T26A 4HPXA 3WK3A 5I3JA 3T40A 1VZWA 5L6UA 5C6MA 5J5DA 4UFHA 1UJPA 5LNSA 3P82A 1KBIA 4UTTA 3W74A 1PL9A 2UV8G 3KVJA 4UMAA 1ME8A 2C16A 4CQ9A 1HL2A 1KTNA 3L68A 3QH2A 3QQ0A 2WSRA 1OFRA 3WJSA 4FX6M 4FX7A 3STGA 4FXSA 3TR2A 3M47A 1AG1O 2NV1A 1KTCA 4LS2A 3W7LA 1KM5A 1K8YA 3P5ZA 1YTEA 2B0MA 4MLJA 4JIQA 4YLWA 4IMCA 1TPUA 1RVGA 5BMWA 3R8RA 3EWBX 1PIIA 1UCWA 5D37A 3EWWA 3UWQA 4JTIA 1GG1A 4M6VA 4I9AA 5K2ZA 3RLUA 3ABQA 3UWWA 2NXHA 5CSSA 5F2GA 4PA8A 4X22A 4LS1A 4JTLA 3FOKA 2CLHA 3BW3A 4DEFA 3L9CA 3A5FA 2NX1A 3C3NA 3H55A 1XCFA 3R5EA 3EX3A 2NX9A 1GVRA 3QSTA 3JR2A 5FEZA 3M7WA 4Z0JA 4DF1A 5HULA 2ATMA 5LHEA 2G95A 4CCDA 5F4XA 1VLIA 1LBLA 1W1ZA 4ZZ9A 2TMDA 3GAKA 5FF3A 4TMBA 4UTJA 5H91A 3UWZA 2J9YA 4E38A 3FLUA 2X2GA 4UFKA 2DZTA 1JR1A 3CWNA 3N3MA 1VYPX 1JVNA 3PY2A 3TU9A 3G8EA 3W7RA 1B57A 4ZQCA 1FDJA 2F7FA 3M5ZA 3T55A 1AW5A 1W0MA 3HIJA 1G4PA 2XN2A 2A5HA 4JIPA 4NUWA 4IWWA 2C3ZA 3O8AA 3LHVA 3W9ZA 2YYUA 5D32A 4I7UA 3GDLA 2ISWA 4ZQRA 3FA5A 3P60A 3PSWA 3S1XA 1OX4A 2JKAA 3SI9A 2WQPA 4AVFA 1SO3A 4MY9A 3M5VA 4ML9A 3B0VC 1OVDA 4JN6A 1KW1A 2QCDA 2Z6JA 4RXFA 5EPDA 3TQ0A 3LCFA 4HIBA 1PHWA 1L6WA 4BI6A 3PBWA 4O50A 3KRSA 1H5YA 2R91A 1RQHA 2FPYA 1WDWA 1XUUA 1VHNA 5BRBA 4HNNA 3EB2A 2ZCGA 1OG0A 5C54A 1H7WA 3QRHA 3VI2A 4FNRA 4O57A 3GXPA 1G7UA 4OBTA 4IUOA 3LOTA 2YGYA 1ONRA 2NUWA 3W85A 4UNLA 3HGOA 5IBXA 4PL1A 4JXCA 4HPJA 4C1KA 1A5CA 1XDLA 5A8GA 3O06A 1ZHAA 3NVTA 4IX2A 1TRIA
chains in the Genus database with same CATH superfamily
4ERIA 2OXNA 5G2HA 1YQ2A 4JPGA 1T0OA 4HU4A 3QV9A 4A6GA 5KZ6A 4AWUA 1EGMA 1E5JA 3S1WA 3H4XA 4TX8A 1HVQA 3AZTA 4W84A 3M16A 3S5SA 1Q45A 4EXQA 2WWDA 3QVQA 2EPNA 3H6OA 4GYPA 4GUHA 2FZDA 3TYCA 4QQ3A 2J7CA 3CWHA 4AZIA 3BOFA 5ABTA 4PUKA 1RJQA 2G4FA 3SUUA 2V5CA 3K4WA 5JQ9A 2J75A 5DT7A 4WVXA 5SWUA 1QOPA 5IDIA 2Z1BA 2QF7A 4K8EA 3CV2A 1FFQA 2CLEA 2O4MA 3LEPA 4TXEA 4UTUA 5HMFA 4ZFMA 2HWGA 5ABHA 3EPNA 3OZOA 3LCXA 5I0DA 1SZFA 2QCEA 3DIPA 4EVZA 4I9MA 1UZ1A 1F76A 3UWVA 4GCXA 2I5IA 4NASA 1FXPA 3HJZA 2R1PA 3L4WA 1SSGA 1OWQA 4MPQA 1VFOA 1GEHA 4H2HA 2WMIA 3PB0A 4WHBA 2ESCA 8RUCA 2BX7A 1HZYA 3MSYA 2X8RA 1PX4A 2J66A 2IPGA 3RYSA 4IP4A 4ZO6A 1F2JA 3M5YA 2OMAA 5J5RA 1DJXA 3SM0A 1AK5A 2DP3A 4DHGA 1L6SA 2Z26A 1SR0A 1GQKA 3UXDA 3WL1A 2DZUA 1XPGA 3MWCA 3CTTA 3SAZA 2OEMA 2Z29A 4NT0A 3TC7A 2DQWA 1OQFA 3QW4B 4ZOAA 4S2BA 1XFCA 3TZNA 2BOFX 2CC0A 3K4AA 1YKWA 1GOKA 3DFOA 4B9YA 2PWDA 2XVPA 1FCUA 3FHQA 3VIGA 3ICJA 3W70A 2WSQA 4EIVA 1DWAM 2IQ0A 4YWSA 5I06A 1W3KA 4ACZA 4RE3A 3QTPA 4IXHA 2W3ZA 4FB7A 4Q8VA 2WJFA 4GH3A 4AD5A 2GDQA 3CHVA 5G4WA 1NQKA 3MBFA 3PUGA 3PJXA 3RHGA 1EH9A 1VF8A 1D3GA 4UR7A 2J88A 4B9ZA 1FFRA 4CU8A 4DWSC 4JOMA 5AC8A 4CEXC 4RR4A 5H8MA 2WZIA 4W8AA 4OTKA 4MKSA 2QJJA 3VOJA 1H7RA 2BY0A 1OSEA 1PYFA 1XWYA 2J7EA 5AYIA 4IXXA 2GDUA 4FNPA 3N12A 3EYPA 3NDYA 4HNUA 4PH6A 1M3UA 2GGHA 4ZO9A 5A3HA 4LUJA 5E6ZA 1CW2A 3ITXA 3W28A 5KMYA 4LW7A 4IX0A 3IEBA 1VR6A 1I8JA 1ZY9A 4JFTA 3WFZA 3WQVA 2PDNA 3HPZA 3V0TA 1DJQA 3WMLA 1X97A 1SFLA 2GGEA 3EA2A 1S2CA 3MW7A 1AMYA 1BEUA 3SSJA 3BSMA 4JD4A 4XBSA 3ZR4A 3CS2A 3TLLA 2CLPA 2BSLA 5AHMA 1QU4A 2IXUA 2QF8A 4ZXOA 4B2DD 1CB2A 1Q65A 4IQJA 3BGGA 2PU0A 1EDQA 1W3HA 3W7EA 3VGFA 3P81A 3TR9A 4L56A 4REQA 1EZ2A 3U2EA 5CGMA 2XPKA 3MKVA 1JYNA 4JTHA 4L1XA 2Q8LA 5AYZA 4QJ5B 3D0CA 4F0RA 3RU8X 1EC9A 3E0FA 1PTAA 1DV7A 4A8IA 5F2IA 1DOSA 3F2DA 1KRCC 1PDYA 2HK1A 4J2PA 1TR9A 2BS9A 1W8GA 3VKKA 2DPEA 4Q22A 4MJZA 3VNLA 2JGYA 4XZHA 2WWCA 5G4EA 3LI1A 1BYCA 2ACQA 2VDIA 1XLGA 2VX5A 2XVGA 2XJ7A 4MKNA 3PBVA 2DUXA 3T07A 3G1SA 4E4UA 4H3DA 1S2VA 1G0CA 1DJNA 3VO0A 1NJJA 2VUYA 4U4MA 3C8FA 2QR6A 5E0KA 4B5VA 4AVOA 3QMRA 1B3ZA 3ABRA 2NVAA 1JGMA 4AZCB 3ZS4A 2HQAA 5D03A 3OGVA 1VP5A 3H12A 4OZOA 4R85A 1TV7A 2NZLA 1GOIA 2V68A 3PWAA 2B4GA 4XKYB 5A6AA 4LALA 4F0HA 3SBFA 3N9SA 5CC5A 4KFPA 1KA9F 3E5PA 1K8ZA 4KCUA 2AGKA 1LWJA 3W6YA 4QIUA 1JL8A 3C2FA 2Z6IA 1JRCA 2QNEA 4CVWA 5CJNA 2ZYFA 1VCVA 4ADTA 4BQ5A 1ME9A 1EP2A 4AISA 1C3FA 1ZSXA 4B4FA 1JDDA 5HUOA 4CN6A 3L66A 1EL3A 1E0TA 3BMVA 3IGUA 2KZHA 3H70A 3OG2A 1EB3A 3ZT7A 3UJRA 1SUXA 1IT8A 4QITA 3W84A 1FTXA 2DSWA 4JTAA 1W5QA 4ZXLA 1X8CA 4WRHA 1TVLA 5DO8A 3BSHA 3NDOA 2BOGX 3RAOA 3SSZA 1DL3A 4E4PA 1XX1A 1J0HA 1R8LA 3EMQA 1DHKA 4NNAA 2TRSA 4TX9A 4GBDA 5CJMA 1F6PA 1TWDA 4AZHA 4GNKB 3VE9A 5F2MA 2PD5A 3U6WA 1VAHA 1UR0A 4QS5A 4O4VA 1F74A 3BAJA 5KINA 1WZKA 1A5MC 3CL8A 1LQ2A 3W83A 1AJZA 3EKLA 3S6DA 3MT1A 4CNTA 2W67A 4DBDA 1V6YA 4CD4A 2DZAA 3DAQA 1UP3A 3CT7A 1NVMA 4DWSB 2QV4A 3MC5A 1YDYA 4NNCA 2GUUA 4NI3A 3GHRA 1I1XA 1HJSA 2MNRA 1BYAA 3MO4A 3WELA 3KOZA 3OVQA 4NAFB 4GWEA 2WMHA 4GXWA 1TTJA 2D3NA 3VD9A 1FH9A 2PWEA 3G2GA 1C90A 5BYWA 2YPIA 4OBRA 2DDXA 1SQ7A 3APYA 3IARA 1KFBA 3IRSA 4U3AA 4Y9MA 4BQ3A 3RXZA 1EPXA 5CLWA 4ZB0A 3VU2A 4F9DA 1ZBWA 3GQYA 3A4JA 1J9YA 4F2TA 1H7PA 4XIMA 4A29A 3MDUA 3PZOA 4MNLA 4Q8OA 1WP6A 4XD4A 2HS6A 2IUZA 3BG9A 1F9CA 3WEZA 3SECA 4Q3MA 4R7WA 5LIUX 1I4NA 1L8NA 3LUTA 1JPIA 3THDA 3AU2A 3WH9A 4EK7A 1HW6A 4Z2IA 3ARYA 2GGGA 4WSHA 1QPNA 1UHVA 3CASA 2QULA 1XKJA 3W7DA 5AHEA 4D6IA 1GVEA 5M1TA 3T2OA 3QZ6A 4GIYA 1XLJA 3SIMA 4IL2A 3W7KA 1QMLA 1TX0A 3GIYA 5LGZA 1PKNA 4UZSA 1EZWA 3IWPA 4PB4A 1YHTA 2RKXA 1VS1A 3L0GA 2B7NA 4TOQA 2GVGA 1TV8A 1OADA 3HU7A 3FA3A 2OT0A 5C9WA 3UZZA 1V6XA 3UR7A 4U2ZA 4QS6A 4IOTA 1GNXA 3G1HA 4MWAA 4ICCX 1V77A 2VENA 3SJ3A 1NDVA 1EPVA 2RAGA 4FF5A 2XFFA 1JD7A 1BD0A 1O1HA 1KBKA 1QW9A 1TIMA 3UG8A 1H49A 2QYGA 2H8ZA 2YL8A 3GVGA 4UR9A 4XTDA 3Q67A 4RE0A 3O16A 2NV2A 2YZRA 1J2WA 5A5WA 3OBEA 3VIKA 3O15A 3CQJA 4W8BA 2ZOXA 3L5AA 4N4PA 4BEQA 3M1ZA 1QATA 4W93A 3OZMA 3SY5A 2EHHA 5JMUA 1KM6A 4UTLA 3RM8A 2CLMA 6TAAA 3AQUA 4JTUA 3U9IA 2ZRVA 1W3LA 3I7RA 4Q8WA 4XO7A 1XRFA 4O0QA 3JS3A 4H8HA 3HQ1A 3WDIA 3C0JA 1GJUA 3QPEA 3TA9A 3BZGA 2F8QA 3ABOA 4QLLA 3IV3A 4L64A 3EMCA 2QMJA 3GXMA 4RNFA 3HV9A 4A3UA 2ZTJA 2ZC8A 3R43A 4HTBA 5G5IA 5HPCA 3AS2A 1OGGA 2WC4A 1W54A 4L61A 1R3YA 3AZRA 3UZ5A 5I00A 2VD9A 3VOFA 2ZRZA 4ZENA 3QMSA 4QX4A 4Q8MA 5TIMA 2NX3A 1RH9A 3SGUA 3VC6A 3GFZA 3W1NA 1TPDA 5CSRA 4M7SA 3FYOA 1XICA 1Z48A 4JX6A 4GZIA 1IIHA 4KS0A 1OC5A 3XINA 1FWEC 1W9XA 2VFFA 1SZRA 4RZ4A 2VXNA 2XH4A 4ZCWA 2P3ZA 3EXSA 1DIEA 3NEVA 4LS0A 1W1IE 4B92A 5JBFA 1GVYA 1I2QA 4JY8A 1JQXA 4EAYA 3GXFA 1CXHA 4MSSA 2MANA 1IE7C 1BSIA 3RILA 2TODA 2X0YA 5DCDA 3W73A 1AJ0A 4ICMA 4YL2A 4G8TA 3OTRA 3T6CA 2Y6ZA 2GUYA 1LYXA 3ARTA 3SN4A 1D8CA 4W86A 3NOEA 2ACSA 1UD5A 1WAUA 3NNTA 3HGJA 4MAVA 1WB0A 1FHLA 1S5WA 4ZMGA 2EJAA 2PF8A 3NPXA 5CJ5A 3FSTA 4HMEA 1XIDA 3L4TA 4ZGYA 1KLYA 3QF0A 3D3AA 4Q7BA 1BWLA 2PGWA 3B03A 3BLPX 3QR3A 2BDQA 3MQTA 3R8HA 4E2BA 1UMLA 4RZ5A 3QV7A 3OW1A 2ZUTA 1RHCA 1HGWA 2CW6A 1QDSA 1NWTA 5E9XA 1ITXA 3NFUA 3M44A 2ZRYA 1IR2A 2J74A 4QSHA 3OLDA 1JPHA 1BFNA 3NM3A 3VOHA 2E25A 2Y89A 1FHDA 4H41A 3WQGA 2C15A 2V82A 1SYTA 3IAPA 1S38A 3S9ZA 3VDGA 3THCA 3EA3A 1Q4WA 3FYYA 4MVAA 4GQ0A 2SFPA 2PRMA 3NZGA 4KEUA 2UY4A 4NX5A 1B0IA 2PZNA 2ZICA 3AHTA 3I7SA 5KTLA 5EGRA 1DIKA 2AMXA 4D6CA 3ZJ6A 2GOKA 1MQQA 5D30A 4W89A 2DY3A 3ITOA 4JQ1A 2QDDA 2C0HA 3R79A 2PDMA 3MHUA 1Q8AA 5B7YA 1FX6A 1BKHA 1QWKA 4DELA 3OA5A 4UTWA 3TYEA 4FX8A 3CMGA 3W1MA 3RRXA 1PZ1A 4K36A 4KW2A 3KP1A 1S2UA 2ZFAA 4DJDA 2G3FA 1UIPA 4DYEA 4H9XA 3W53A 2QEZA 4LNYA 1AODA 1SFJA 2YFNA 4AF0B 1W1VA 4QG6A 2A7RA 4D2JA 2C1HA 1C8QA 2DFAA 5C70A 1ML1A 1E6RA 3WD4A 4H19A 4YS1A 4W7UA 4JTCA 1L2QA 1HKWA 3PPCA 4OT7A 1TG7A 2CHRA 5I77A 4I8DA 4C7DA 3G3MA 4IMAA 4GD0A 1TV3A 1XKYA 1EFZA 4F79A 5HR6A 3LRLA 2PD9A 2V5LA 3LZ3A 2XZ7A 4HA3A 3SN0A 3ITYA 4UMCA 1GQJA 4K7YA 4R53A 5D8ZA 3UT0A 4H9TA 1M5WA 3AIVA 1A80A 4OE7A 1XC6A 5T9CE 5FKYA 1Q2RA 2GQ9A 3M6DA 4XZMX 1PYMA 4AZ6A 3M4HA 4ADUA 1GVQA 5I3FA 1XP3A 4UTMA 4GHRA 3T2PA 3PFMA 3LZ5A 4HTYA 5F7UA 4CLMA 3HZ3A 1TQJA 1E15A 1XS2A 2A7PA 3VNKA 2INEA 3P7YA 3S42A 5LZLA 1IEQA 4G2DA 2X16A 1EJ7L 4J4KA 4NNBA 4F2BA 3GTFA 2ABAA 4U10A 1DJHA 2QJGA 4GRSA 1A5NC 2VEPA 1EGZA 4CD6A 3SCPA 3IIVA 1WOBA 3NSNA 4GY7A 4IFOA 3WFLA 2GVYA 2A3CA 1HKIA 3OQ8A 4PTVA 3N6JA 4HPGA 1C7TA 4NIRA 4XUGA 1P4CA 4XTIA 3UJFA 3PHAA 4GI8A 2OCZA 3C2VA 2REQB 4RV3A 4NZFA 1BKSA 3CM4A 5FJTA 2AL1A 1MEIA 2C14A 3UW6A 3TTSA 4XWUA 1V6VA 4H1ZA 4F40A 3G1FA 2PDBA 2AQWA 3ENLA 3STEA 1JZ7A 3TCEA 3BMWA 1IEVA 1NSJA 3I4KA 4MNKA 1A47A 3KBMA 4GUGA 1RJRA 3RLVA 3UXAA 1TZ7A 1EP1A 3EDDA 3Q65A 3WBYA 4MJMA 3P5YA 3VDHA 1GW9A 4RV8A 3VCCA 4HMNA 1A0CA 2YOCA 1MI3A 3PC0A 4UQDA 2R14A 2G3NA 4KFOA 4S1FA 4HOWA 1EJUC 2NT0A 2VWSA 3NQMA 3PS7A 3TSBA 3MMDA 3NXFA 1W1YA 3QV6A 2X1TA 1FRBA 2Y85A 3U7VA 4PMVA 3Q2DA 1E6SM 4XVDA 4NILA 4WX2A 5HNRA 1UWSA 1VCFA 3WLRA 2WCSA 3IIOA 1UWUA 3UA3A 5A8QA 3E2SA 3UJSA 1D3CA 1TPB1 1R3TA 2WLZA 4B3ZA 3SADA 3S2JA 4PUNA 3WO8A 1O12A 1TR1A 3DGBA 4N6EA 1FWCC 2B7PA 4DJEA 3FXYA 1TELA 1HL9A 1QCWA 2PP0A 4TTGA 4P8UA 1CI1A 2OKOA 5FEWA 5HMSA 4GYKA 3WLPA 2ZVIA 1C8VA 1SW0A 4Z1YA 3AUOA 1BVNP 1IHIA 2ANUA 4GZJA 3DERA 4ILSA 4ZSTA 4EOUA 1ENUA 1KWGA 1BVWA 2F6XA 3LTYA 5LHFA 2O55A 3L12A 3WY1A 3SCOA 3LHTA 3NL5A 2CBIA 1GQNA 4LCQA 3QLLA 2CZ5A 4LVDA 2ONEA 1JXJA 3FDKA 3URNA 1PTDA 3WQDA 3TYAA 5EYWA 4B5XA 1JJKA 3V35A 3ZLGA 1B3XA 1KXTA 3MSRA 4JFUA 9XIAA 2Y4SA 3IV8A 3W27A 1VBRA 3RLHA 2W4XA 1SW7A 4C6MA 1VFHA 1K77A 1GGOA 4QCFA 3S2CA 3QV8A 3OLIA 3I6RA 4D6HA 1HNYA 3OODA 4ZA0A 2G97A 4LANA 1UD4A 4QQUA 3ES7A 4P7RA 4HHLA 4KRTA 2Y2WA 1Q6GA 1FP9A 3EOLA 1HVXA 1FDYA 1QBAA 2VCBA 4E8DA 5LGXA 1TPFA 3HQOA 3S3GA 4UTKA 2OO6A 5TNVA 4L9ZA 2XHYA 2H9AA 3GX9A 4UFMA 3IK4A 2QDEA 5DMMA 2YA2A 4IMFA 2XUCA 3C61A 1K1DA 2OSWA 2WM0A 2CWNA 5K3VA 1M03A 4MFDA 3GDKA 4O16A 4E8GA 6PTDA 5CSUA 1IT7A 3ZJKA 2J8FA 1IQ8A 3V0UA 3QHMA 1EP3A 2YCLA 2AGTA 3ATZA 1BAGA 1M7OA 5HAOA 3SGZA 5HNTA 3ITLA 4ACYA 2V2HA 1N55A 1GK8A 1R5YA 2QCHA 3WQ8A 3V3WA 4JNYA 4MOZA 4PTWA 3DUGA 5LIXX 2D0FA 3A13A 3VNJA 2ZZ2A 4XZIA 5LA0A 4UTFA 3A5VA 4F0SA 3G24A 1E0VA 1VRDA 1CIUA 1US3A 4JHMA 1RK5A 3TJLA 1GT8A 3OA3A 3URAA 2I1OA 5D2VA 3WNMA 3W7IA 3EX6A 3RX2A 3THQA 2BODX 3EX2A 1GVOA 3O05A 1E55A 1PKLA 3SIZA 5BRQA 1YDOA 1E5NA 1QPQA 4G1KA 1UH4A 1MW3A 2OQLA 3WQ4A 3NQ6A 3WSUA 4ZOEA 1VFTA 3WLQA 1P0KA 1FWRA 3DHFA 2AAAA 3VGGA 1F05A 1M04A 2WM1A 4GXMA 4GGBA 4RNHA 1MXSA 4ZFCA 3E0WA 4UIOA 2O4QA 9XIMA 1HO4A 3DI0A 1P0BA 2E9LA 4E2VA 1JDAA 2QZRA 5HQEA 5EB8A 3B0XA 4E4FA 4Y96A 8XIAA 2GSJA 2GJXA 2YR1A 3DFQA 4K6AA 3NO3A 4MPKA 4PCNA 1OABA 3ERPA 1A5UA 3P8IA 4BQ4A 3W1XA 3FJ6A 1F07A 3MI6A 3S47A 1VBGA 4YMZA 2QCGA 3LDVA 2XIMA 1V02E 2O9TA 1ZP4A 1TCMA 1M68A 4LWWA 5AHIA 1R6WA 2BVDA 1XLMA 1TPC1 4HYWA 4YU1A 2GJPA 3WQPA 3S5NA 1WQ5A 3OBAA 1DORA 4WZHA 1NP2A 1O95A 3O7UA 4TV6A 3GIQA 4NJHA 1WDRA 3V16A 3EOOA 1T8XA 3OJGA 3GNDA 3BO9A 4AB4A 2IPJA 4H8NA 3E49A 1TV5A 2VEKA 2WZTA 1CPUA 1TV4A 1VYSX 5FF7A 2OWWA 4RZBA 1OFEA 2OWCA 1E43A 3SCNA 4QXIA 3TQKA 2QS8A 4YHGA 4BK9A 3WDHA 3QN3A 2BBFA 5JIPA 1PX8A 1I6NA 2XH7A 3GZ3A 1WDQA 8CGTA 3TKFA 3CBWA 2BB0A 3PBYA 1JQVA 1CGTA 5AHFA 2JGQA 4ZBCA 5CGTA 3WQEA 1B3OA 3LGGA 3WF0A 2Q01A 2IKIA 1SFTA 3MB9A 1YDNA 1MRAA 5E09A 3VPLA 3LU2A 1XSIA 2CYGA 4XVEA 4LTSA 1US2A 2Y5SA 3WLIA 1H41A 4N0RA 5CPQA 2JIWA 1E6XM 1OZMA 3N11A 4KCWA 5GNXA 1SZGA 1Q13A 1VEMA 1WKDA 1P0NA 2VQTA 1YADA 3M64A 3ARSA 3NSXA 2WNWA 3NQ8A 1Z8AA 2PDKA 3W87A 5U4NA 4QHRA 3SQLA 1H4PA 1JULA 2PGRA 4DWSA 2ZA3A 4WJ8A 2WNZA 2VURA 5LYRA 4GG9A 4KRUA 3BLKA 1RXOB 4RDZA 2X0SA 4GNVA 3KCLA 3O6YX 2ZXQA 4AD0A 1C8YA 4HHPA 3C0QA 1W9VA 3GNNA 1TPEA 5TD4A 1NWUA 2J13A 3MUIA 3WH6A 2GL5A 1J18A 1VZWA 5L6UA 2JE8A 4ZTYA 4MNJA 1CXFA 4UTTA 1OEPA 1E9IA 5HDRA 2F2HA 3KVJA 3GH5A 1OFRA 7ODCA 1XYZA 2D0GA 4GYPC 3AHYA 3CMFA 5T9BG 3F2CA 4FX6M 1TA3B 3GS6A 2D2OA 4FX7A 2WBKA 4FXFA 4LF1A 1JPKA 3BAKA 3MVTA 2NV1A 1KTCA 2YL9A 1HL8A 6CGTA 1EC8A 1K8YA 1VIZA 3PFRA 4JIQA 3W38A 5BWFA 1TPUA 3JW7A 1RVGA 1CNVA 3KS5A 3R8RA 1A5KC 3EWWA 3CH0A 1GG1A 3QLDA 4B16A 1EKOA 3UWWA 2NXHA 5CSSA 2YLAA 1NOUA 1U33A 1T8QA 4LS1A 2BV9A 1GHRA 4DEFA 4KGLA 3A5FA 3KTXA 2NX1A 3C3NA 3MUAA 2V5KA 3R5EA 3ZYZA 3ANUA 3FHAA 3JR2A 5FEZA 4Z0JA 4DF1A 1GW1A 1SMAA 4C6OA 2G95A 5LHEA 3OOQA 3E6EA 1W1ZA 2C8NA 3RPDA 3O9NA 3VINA 5H91A 2J9YA 4U5KA 3WQ5A 3FLUA 4UFKA 2DZTA 1JR1A 4DJFC 4YYCA 3T2QA 3W7RA 1B57A 4W85A 1WE5A 2VR4A 4Q4MA 3GVRA 1E0XA 2YCJA 3GG8A 3RO6A 4BJHA 2XN2A 2AQOA 2A5HA 4JIPA 4IWWA 4GQQA 4KPLA 2YYUA 4J35A 3AMCA 4ZQRA 2JKAA 4AVFA 1IR1A 4MY9A 3B0VC 4HVXA 5I6SA 5LIKX 1D7FA 1N8WA 1QXLA 3LCFA 4HIBA 1PWLA 4H7ZA 3KRSA 1RQHA 3C3UA 4HA0A 2XFRA 2DQXA 3RO8A 4I6KA 4HNNA 1S2TA 4M81A 5C54A 3VI2A 4FNRA 4US5D 3GXPA 4Y9OA 3WLNA 3APTA 3LOTA 3MUY1 4DJDD 4ZEPA 3GTIA 3BC9A 4UNLA 3UR5A 4PL1A 3DFYA 5JUVA 1CENA 2OYKA 2BGSA 3K5XA 3V5FA 1QW7A 3NJ3A 5A8GA 4E3VA 2VQUA 2UY3A 1XV8A 1AFSA 4ERGA 3QBUA 5EMYA 3BLFA 1EWDA 1NOFA 4R33A 2QVNA 3EX4A 2E9BA 4IGSA 1B1YA 2G0WA 5ABFB 1R46A 2C91A 2J8GA 2GQAA 4MMWA 3VGEA 2FKPA 1T41A 2C6QA 4TQTA 3D47A 1AMKA 3VZXA 1C7SA 4RPPA 4QAIA 1GKPA 3KHDA 3E3HA 1TCDA 4DAFA 1UWIA 3ITGA 4LT9A 4DLFA 2F38A 2DSUA 4CKQA 3HURA 3AHVA 2HCVA 2G3IA 1V03A 2G37A 3LM7A 3UXKA 3JZUA 4GVIA 4EWJA 3BG3A 4LUSA 1UR1A 2FQIA 2EQDA 4NX0A 4XQ6A 2Z2UA 3WK2A 5LSMA 4C65A 1FWNA 1JYXA 1HTIA 3N9RA 3GDRA 3DC0A 1B9BA 3BCDA 1V7YA 1JXKA 3LSBA 2BY2A 4O1AA 2R1NA 3TYUA 3V7PA 2NQ5A 1KBJA 2J24A 3OLGA 4CQDA 2Q6ZA 4OQVA 1VEOA 5GJPA 3KP0A 2OX4A 4WKFA 4ES4A 4UCGA 3IANA 4PZVA 2ZUSA 4DBEA 1LRTA 1AW1A 2BZNA 5AVHA 3U7BA 2A4AA 1S3HA 3BLIA 3SQSA 1GYLA 3W81A 3A4XA 2VEMA 1EEXA 3B9EA 4WK9A 3UEQA 3MCMA 3P80A 3W01A 2G50A 3N3TA 1O94A 1KM2A 2EG8A 2WK2A 3GC5A 1D2KA 3KVLA 3WQWA 3HPSA 4JHZA 4WDTA 3T0BA 3QKEA 2XSBA 1LOLA 1ITUA 4KEMA 3RPTA 3ZZ1A 2OZTA 2GVJA 1KRAC 1WXZA 3WBWA 4MB1A 2P53A 2IW0A 1X7FA 3TSMA 1VD6A 3B8SA 3WD0A 1OINA 4RLIA 4PB3A 1PTGA 2IPWA 2BOEX 3EKZA 4JY9A 2ZWYA 4TTUA 3NM1A 2NSOA 3HPXA 3ABXA 3P8JA 1I9CB 4UNIA 4D8LA 1NU5A 2CKRA 1R87A 2WPBA 2AL2A 4JNZA 2QIWA 3NURA 2QXWA 3FAWA 4UTHA 4NJGA 2AQVA 3GBDA 1UR4A 1BHGA 2VZOA 4M56A 3QOMA 2FZMA 2VL4A 1XGDA 3ATYA 4RXGA 2OX1A 2ZDSA 3OO2A 4GE8A 1CEOA 2WMIB 1J6PA 5JVLA 1PSCA 2VC5A 3AS1A 1UD8A 5I07A 3RJYA 5XIAA 1SJBA 1UP0A 1VHCA 1F61A 1YRRA 1ZTVA 2CLLA 1BQCA 1K03A 1J11A 2DH3A 4GX9A 4H7VA 4ZB2A 4J3TA 5TQLA 6TIMA 1XLBA 3I6TA 1Q63A 3GXDA 1KB3A 4PRWA 5CC6A 3UY7A 4AF0A 3P2VA 1J5SA 3S5OA 4EF8A 4AHOA 1QI4A 4QE4A 3KOYA 2PBGA 2WCGA 4KQNA 1Q2SA 4CVUA 4JIHA 4XBJA 4HT3A 4F8XA 1H2JA 1A5OC 1EF2A 2OB3A 4X3ZA 3SRFA 2HMCA 3PR2A 2JKPA 2L5HA 3TK7A 5A6KA 3SUWA 3BCFA 4B5TA 3OIXA 4M51A 2P0OA 4Z17A 4Q8NA 4NZCA 2XGZA 3DH7A 3WD1A 2RFGA 4NL1A 2QQ6A 2YBVA 1C29A 2BGNE 4OJYA 4N4QA 3KL0A 1GYNA 1FKXA 2Y7GA 1XUZA 1AH0A 4LNCA 3PG8A 5CZSA 3K2GA 4L1WA 5EU9A 4V1YA 3AXMA 3QPYA 3BV7A 2I16A 1DXIA 4LRTA 3B4UA 4LBUA 4FOKA 4IICA 4YVVA 4X63A 2O9RA 3KBJA 4QEHA 2YDSA 2ZA2A 3ITCA 4Q4SA 1UIOA 5DY2A 1VFMA 3N19B 3K46A 4AY7A 1JNEA 3QW3A 1O68A 3AWNA 1FP8A 3MSDA 3L0KA 2WXDM 3RLGA 2CXGA 3GXTA 2NXIA 1H1NA 1X6NA 2QKFA 1ZP3A 1EA9C 3AHZA 4MJ4A 2VVSA 1J0JA 4GO9A 2J7GA 2PPGA 3RMEA 1L6YA 1PUDA 7REQA 5FESA 3ARVA 3O6DA 2GVLA 3QC0A 3M0ZA 4U31A 2QPXA 4Z2GA 4JTQA 3AOFA 4YWIA 4UMBA 1Z6KA 3ZLHA 4B4HA 4TV5A 4G9PA 4WJEA 2IKJA 1BPLB 3FX4A 3T0DA 3SGGA 4REQB 2FZNA 3N15A 1MEHA 1EYEA 1XLEA 1ZCCA 5IBXC 3E1F1 3CPUA 4L4LA 4DF2A 4ONVA 4FLSA 5HOSA 1H0GA 1XW8A 2PDJA 4FALA 1ZJIA 3GXNA 2DZSA 1IXOA 3KCOA 5EBAA 2E77A 5XINA 1GTHA 2OZ8A 2PTWA 2VFGA 1OYBA 4MWAC 4PMDA 2Y1HA 2YL5A 2CBUA 2PTXA 4PUDA 4AWEA 2ADAA 3NTYA 4J7RA 3OHIA 4MUZA 4W88A 2E40A 4YTUA 5CC7A 3IAQA 1VLWA 4LF2A 4O52A 4IG2A 1MNZA 1F3WA 3H2MA 4QLJA 2TAAA 3I4EA 5MF5A 1G69A 1TQXA 4U5IA 3LA4A 1KRMA 3OGSA 4ROPA 1EJTC 3TEVA 4B5NA 1ISWA 1V3KA 4M1RA 4GKLA 1P6WA 3PVFA 1ISZA 3CUIA 4PFHA 4NY2A 3U48A 2GGJA 1RBAA 3BQ5A 2D20A 3UZWA 4PE8A 4J28A 3WENA 1QUMA 3U2OA 5LA2A 4RNJA 2W27A 4I6VA 3S2NA 5A2CA 1TWSA 2A85A 3P14A 2YA1A 4V33A 3BWWA 4ZODA 1W6TA 1K4GA 1I60A 4KWOA 1BF6A 1JZ4A 1QO5A 2TYSA 2Z4GA 1NDYA 2D22A 2GPTA 2YCEA 2Z2BA 3NPWA 3RR1A 3KOXA 3L0NA 1D8WA 1Z41A 5AHNA 1V4YA 3VZYA 3UA4A 3WF1A 2B7QA 4JTGA 1KCZA 1HIZA 3SEPA 1KXQA 1SO4A 3IJ8A 2PGEA 2FGZA 1LUCA 1WUEA 1B3VA 3MP5A 3PBUA 3IJ9A 1TMQA 3H2AA 2OG9A 1W9BM 4LUTA 5AZ0A 3TN6A 3E9AA 2J7HA 4GUFA 2HK0A 2GUBA 4AIBA 1EX5A 1O5XA 1ZCOA 3V75A 4N9DA 2WKGA 1W9UA 4KFNA 4IJBA 3CEPA 3AMDA 3CIXA 2VYOA 1CLVA 2P1FA 2Z00A 1PZ3A 2G96A 2OGYA 1QAPA 3U57A 2DU2A 1FUYA 3A21A 2VVNA 4QNWA 3TAOA 4MM1A 3KHJA 3TROA 5D9PA 1XINA 1B30A 1KGWA 3GZAA 3QPZA 4NVTA 2PSNA 2X09A 2A3EA 1V7AA 2Q71A 1LWIA 5AZ1A 2Y88A 3VILA 3AMLA 3S46A 3H2CA 4ALDA 4DWSD 3GC2A 3H53A 3GH4A 4QAWA 3GM8A 5G1TA 3B9NA 4LJ3A 3JRKA 3LRKA 5A6BD 4NF7A 3N4EA 3FKRA 2W0UA 2WC7A 1RPKA 2PDPA 1VEPA 1BVZA 4WJXA 2PUZA 2VFDA 1FWGC 3KRZA 2FZ9A 4N7QA 1XYFA 1R3RA 1WZMA 4XX6A 2POTA 1H61A 4AHQA 2OWXA 1ADOA 3LPFA 3OZYA 3N9KA 2ASHA 4GOAA 1B2YA 3GG7A 5JH2A 5C2XA 4EPDC 3VIHA 3IVUA 3NQ7A 1EDTA 4OV4A 3STPA 3DG6A 3DHUA 1XSJA 4Q6JA 3V0SA 1W5NA 4KRZA 2Z7GA 2A3LA 1A5BA 3LG3A 1R9YA 2NWSA 1SPQA 2WV8A 1BF2A 2OYLA 1XH2A 4QR6A 2Q09A 3CUFA 2F6UA 4L6DA 2YFOA 1QHZA 5A1AA 2ALDA 3GWQA 1IF2A 1PB0A 5HA7A 2PAJA 5B7ZA 2WC3A 3N29A 4MWAB 3BAWA 3W76A 4UTWC 1MYRA 3W82A 4IIHA 3UXIA 5H1WA 3TTQA 3B06A 2VZTA 1RUSA 4O1DA 1DQWA 5FJOA 1KM0A 2OTDA 1RP8A 3AIUA 4EX4A 5I3IA 3VMNA 2PC4A 4TVCA 4AX7A 3M0IA 4HNOA 1XL9A 2C1IA 1B5TA 1KFEA 4ZQNA 4AXNA 2GVEA 3UCCA 2CETA 3C2EA 4LAUA 4W8LA 3S2MA 1Q7MA 1T96A 2HE8A 2NLYA 3PN8A 4TO8A 2ZUUA 1ONWA 3LHYA 1LQAA 1TJPA 1GKQA 4WSKA 1ZU8A 4FR1A 4GZEA 1R85A 3MVIA 4HZMA 2H6RA 3BJFA 4HZ7A 3VTRA 3ZXWA 3GC4A 2PE4A 4JIEA 3G6LA 1FWJC 5IDZA 1OFOA 3G77A 1QPOA 1OGBA 3I7QA 1N8FA 1U5VA 2Q8XA 3HPFA 4Z1DA 2XH2A 1HP4A 4AD2A 3DFPA 1VPQA 3GKFA 3WLLA 3PNZA 1YNPA 1O60A 1UJQA 1RVKA 2QAPA 3C8NA 2HISA 4GY1A 2PFHA 1XRTA 2P88A 1XGEA 4UZUA 3B8UA 2Y61A 5GJNA 4J1OA 3W23A 3WUGA 1HF6A 2XINA 2NVDA 4RK8A 1JEZA 9CGTA 4JR5A 1JCLA 3KFTA 4DPQA 4DZIA 1E4MM 4K3ZA 4LY8A 1IZCA 4WY0F 4ZQMA 3TYDA 2JEQA 3K30A 3CQKA 1A3HA 3FA4A 4AY1A 5KSWA 3PAOA 3GB6A 4HBKA 4JQ3A 4F0LA 1VENA 3ORWA 1JZ5A 4C6IA 3AISA 4PUMA 3UGVA 4LYPA 2FHFA 5AC4A 1N7KA 3A12A 5FJJA 3PPGA 3TWBA 1CGYA 4Y8EA 2ZZ3A 3KDNA 3N13A 1R3QA 3OVPA 4PCFA 2DJLA 3N04A 1TPVA 3M7SA 5DCBA 2A3HA 3SCUA 3M46A 1NH6A 2FZ8A 3BAYA 1FWDC 3KWXA 6REQB 1YXYA 4AWTA 3R13A 2ZX7A 1JDFA 1S39A 4JTRA 3GVWA 5DANA 3RDKA 3RCYA 5A2BA 4FR6A 4HZ8A 3NO5A 4XV0A 1VH7A 4JTDA 1PE1A 3PULA 3A4AA 1XXXA 2AKMA 5KITA 4X9SA 3CAVA 2B81A 5G2WA 5FCZA 4ATLA 4N9EA 1YYAA 2DVUA 1S1RA 1TA3A 2PEVA 3JZEA 1O5QA 2Q8ZA 3S2LA 4QEEA 2DZPA 4ORMA 2C13A 2E0PA 2E5BA 4P7LA 2CESA 1H62A 2Y8VA 2P8CA 2DJXA 4M7TA 3GK0A 4D8ZA 3CLMA 2E67A 4UQ9A 4M5PA 4PSPA 4XSMA 4DO5A 3MKCA 3L23A 5HJLA 2RH9A 3UGRA 4XAPA 3WMSA 2ACUA 5DRCA 1QI2A 1NF0A 1XCXA 4RE2A 5FA5A 1P0EA 3B8VA 4LV9A 4YCPA 3CUZA 5K4XA 4K38A 3S83A 1REQB 4F0MA 4IM4A 2PDHA 2X41A 1W37A 3TTOA 1MFUA 3PZUA 5GNZA 4M80A 3BXWA 2D0HA 1FY6A 4DY1A 1Z7AA 2PCQA 4UQEA 1A0DA 3GIPA 4F66A 4O53A 1TV2A 1Q85A 5E93A 3THUA 1WO2A 1H51A 2PTZA 3NQBA 3TFXA 4HU8A 2IQTA 3TQVA 3NQEA 2OODA 2J9XA 4JNMA 4NP7A 3EWDA 2GJRA 4LFYA 4B90A 1CXIA 3O07A 3T0CA 3QQWA 4E6MA 3A22A 2QCCA 2RJGA 3E2QA 1A3XA 5E6YA 2VZUA 3WQFA 1JUBA 4C6KA 1K4HA 1R7AA 4RJEA 5EMLA 3AYVA 3NCOA 1DE6A 2H3DA 3WLSA 1Z44A 4W7VA 2PMQA 3FAXA 1P5BA 1G94A 2DSZA 4CGTA 4ZQPA 2HV5A 3APGA 1JDCA 1EWEA 4WY0A 4A05A 3VD4A 1UR3M 1EXPA 4L9XA 4DXVA 3RITA 1OJXA 4FLOA 3T44A 3E12A 3TUUA 3S9IA 3B8TA 1EHNA 3DYMA 3FEMA 1PKYA 2F6KA 4LB3A 5LNWA 3D5HA 1XG4A 2RDWA 2GK1A 3W6MA 5ECUA 4LYRA 1EJXC 1ME7A 3MJYA 3PAJA 4TX6A 2A3BA 4GQBA 1B3YA 3BK0A 1T99A 2NW0A 1OYAA 3KBWA 5ABFA 1VKFA 3HJEA 1PIGA 5D2WA 4JDYA 1O7AA 3USZA 3QYSA 5K9XA 3I65A 3ZFHA 3MUXA 4NSBA 3UY8A 1P0DA 4N9CA 1UWQA 6ALDA 3ZR5A 4FOUA 1H11A 3H21A 3NZ1A 1JNDA 2EF9A 3K1GA 5C9UA 2BXVA 4LV4A 3C2YA 3GR4A 3TW7A 5BNKA 1CLXA 3EZ4A 4XAFA 1RCQA 3FK4A 4JN8A 2A0NA 1EIBA 1X38A 1GYMA 4M6PA 3QC3A 4QFUA 1WYIA 1QNVA 4W5ZA 3HGRA 1AQMA 2Z25A 1SMDA 4IFKB 2J62A 4EPKA 3UP8A 4MIMA 2VX6A 3C86A 5C8BB 4GLEA 3P84A 2FTPA 3S6OA 5M5DA 5TF0A 2ZRXA 3TJXA 5LNVA 1J6OA 2HSAA 4LBSA 3PUOA 1XFBA 2E3ZA 4O13A 5FJUA 4PL2A 4Z1AA 4PRRA 3SFKA 4JAWA 5TAOA 2NV9A 3TJIA 3WH8A 3DG7A 4WD0A 5U7SA 2DZXA 3B05A 3VYLA 5CBBA 1M6JA 3WDJA 1XG3A 5IHSA 5A6MA 3O3RA 1Q6LA 1QNSA 3R2GA 4NAEA 3GNRA 4EXBA 1U5JA 3DU0A 3F03K 3MTWA 3KXQA 4PMNA 1LJYA 4JTJA 3WNKA 4A35A 4AMCA 2VCCA 4PN2A 4DM2A 3SRDA 1U2YA 4LC8A 1UYQA 3I10A 5XIMA 2VRQA 3CAWA 3WF2A 2EBNA 3WQCA 4BI5A 2ZUMA 1DXFA 4H7CA 4S3JA 1DTUA 3T08A 2ISSA 2PTDA 3SW6A 3E0IA 4IT1A 3FVMA 5ABGA 3W07A 4GPNA 4MB5A 1GPFA 3H23A 2CZFA 1A5SA 2ZUWA 1XGZA 4R27A 3J7HA 4JYDA 1FVPA 3P74A 2EGZA 2WAGA 2ATSA 4HU3A 1F7BA 1YXDA 1FWHC 2J47A 4NZ3A 3HG5A 4HYVA 4JX5A 3PZVA 1ZBCA 4F0KA 4F48A 3C2RA 4XG1A 4D9PA 4IF2A 1KRBC 1CTNA 4DJFA 3PM6A 2DT3A 3M07A 2CBJA 3KL3A 4DNHA 3T05A 2DVXA 3WD2A 1HQTA 2OELA 4KERA 1PPIA 3VOGA 5K9CA 3DEQA 1LT7A 1ECQA 5DEZA 4KETA 4L6OA 5IFTA 5HWMA 2BLEA 2WMJA 1M7JA 3GHSA 4GO8A 3B9OA 1LP6A 1POJA 5LKYA 4HOXA 3UZYA 5RUBA 4L4OA 4IGHA 3N2XA 3VM7A 2XVLA 2PURA 1YNYA 1Y65A 2A1YA 4IGNA 5IOBA 3GO2A 4POCA 3W2KA 2PP1A 1KC7A 1E4LA 4Q4KA 4WOQA 3L2IA 4O0ZA 4S3BA 4PUJA 3MMTA 1ZRQA 2PDQA 2GYIA 1IXNA 2FMNA 4LAMA 1MZHA 2HS8A 1LL6A 2VWTA 2H9AB 3T0AA 3PZIA 4CU7A 4CN1A 1B3WA 3GDBA 3AIBA 3FY1A 1YX1A 3SN1A 2HTMA 1LT8A 3PPHA 4GI6A 3AYSA 5CZTA 2D69A 5E5CA 3W00A 5CCZA 1G6CA 3AS3A 1TMHA 1LROA 1M9HA 1JCXA 5CPTA 3IGSA 1HKMA 1BYDA 3TP4A 5FJPA 3LCWA 2PBOA 2BFGA 3BLOA 3R25A 4URIA 4BI7A 2ZX6A 4FA3A 3H8AA 3OG3A 2YCLB 1G1YA 3QHOA 4BCEA 3NPVA 4H4IA 4C90A 4FO4A 4UTTC 3GDMA 5AB3A 1ZALA 3NQCA 1JCYA 2YZ5A 1WX0A 1RSCA 3ID7A 3SB0A 2IMRA 1HKVA 1V0LA 2WNQA 3DKJA 3LSCA 3WK0A 5HPOA 4LBRA 2FB3A 5BU6A 3WH5A 5KETA 5DXXA 2ICSA 4AEEA 2A6NA 4DLMA 5L9FA 3NZRA 2WVTA 3BV4A 2W9MA 2PWVA 5DN1A 4C6JA 1DEDA 1ICPA 1SM9A 4H83A 5C0QA 2YLLA 3AMKA 1IGSA 4DZHA 1OFDA 4GVGA 2PC8A 3O0FA 2ISDA 3DHDA 1V6UA 2HXTA 2J9ZA 3FFSA 1HX0A 2R1KA 3TN4A 1SZEA 3L4ZA 4XAYA 1P1MA 4JL2A 3AFBA 4EANA 3N25A 1Z89A 3DX5A 3HO8A 1X96A 4V1XA 4JZ5A 4IQEA 1SSDA 5KZEA 1PS9A 4KMQA 4A3YA 3N6QA 4A8RA 1UW9A 4PBGA 4FAMA 3L2LA 3TYZA 1DIOA 1C8XA 4NYYA 1DE5A 2BVWA 3CL6A 3PWIA 2E68A 4B5SA 2WSYA 4GVHA 4HCHA 4KF1A 4AC7C 4EP8C 2XWDA 5CBJA 1JCNA 2GJXB 2H3BA 3W1TA 4ATDA 3CZEA 3QSRA 3FJNA 1JF6A 5CAKA 3SCWA 3UXLA 4PUUA 3WK1A 1UMYA 4DUVA 3CIVA 4RL3A 3VD5A 5D38A 3FSUA 4O17A 3VDBA 1MRQA 2FH8A 2PWGA 4UR8A 3GLCA 3AICA 3R58A 1N8IA 5D05A 1XIHA 4CQ8A 3ANYA 2X42A 3WJXA 2VM8A 1GOQA 1AD1A 2HJPA 1RY8A 2P8BA 4OU1A 3VK5A 3TFCA 3LS9A 1PIFA 4QG8A 1VB9A 4LH8A 2Y70A 3O1NA 2CERA 2ZTKA 3WDRA 1O4UA 1JCJA 5I3GA 1GG0A 2J7BA 4M24A 5T26A 4AQLA 4HPXA 3PTQA 3UR8A 5C6MA 3WNOA 5J5DA 4FK9A 1ODUA 4IIGA 4AU0A 5AECA 4UMAA 3FCPA 4CQ9A 4P7NA 1HL2A 1KTNA 4HYRA 3MZNA 4GC3A 4XZBA 1A49A 4QTGA 1E40A 2WSRA 3UF9A 1ISXA 1SVDA 5CEWA 5DF0A 3CHFA 2EPKX 1F8IA 2D1ZA 3E38A 3M47A 3IK2A 1DWHM 3ZVHA 2Z1SA 1AG1O 1CT5A 4LS2A 1RJPA 1N2VA 4NHVA 4JL1A 1YTEA 2OR2A 5HMEA 2NT1A 4TUFA 1KGXA 3BJSA 4Z42C 2FVMA 1V6WA 3UWQA 4JTIA 5HQMA 4I9AA 3RLUA 3ABQA 4PTDA 3WIJA 5F2GA 3TQPA 4PA8A 7A3HA 4JTLA 1A5LC 5T91A 4HHHA 3BW3A 1EGVA 3VAVA 2FH6A 1PZ2A 4M6UA 3F5KA 3GHUA 1IEIA 5HULA 4XAGA 3ARZA 3CV1A 3EA1A 2WCAA 5FF3A 1E56A 4GXPA 4EPEC 3FN9A 6XIMA 1XYLA 2ZUNA 4E38A 3V18A 3QTGA 3UETA 2PP3A 3G8EA 4CNSA 1H3GA 3P6LA 4EXAA 5BROA 3M5ZA 4Q8TA 3COTA 1S3TC 3CZ8A 4J3WA 3CAQA 4AYSA 5A69A 2VGIA 2C3ZA 3O8AA 5D32A 3VM5A 4I7UA 3GDLA 1E71M 5HANA 3PSWA 4C5YA 1PEZA 4QE5A 2WQPA 4AIUA 1OVDA 4A3QA 4JN6A 1KW1A 2QCDA 1E1CB 2IKGA 4GJIA 5EPDA 1L6WA 2XM2A 4BI6A 4ROQA 1UWRA 4O50A 2PDCA 3ZQ9A 3V1HA 4IIBA 1XUUA 4D6GA 2NVCA 2F2KA 4OBTA 4KT2A 3ZJ8A 3NGFA 1NY1A 4MTVA 4PRTA 3W85A 3HGOA 1ZJBA 2V69A 5IBXA 3EDKA 4JXCA 2CXEA 5ABEA 4B2DA 1F3XA 4L1GA 3O06A 1M1BA 2P0IA 4IX2A 1CECA 1VBHA 1WKYA 2WMFA 2GQ8A 3BURA 1Q6DA 1H50A 1ZENA 4N02A 3UNTA 2CCRA 3SCVA 4JCMA 5EL1A 1WNOA 2Z1XA 1QK0A 3MS8A 5I03A 3RR4A 1JI2A 2VEGA 3NL2A 1V0MA 2HVMA 3G1XA 2JIEA 1MSSA 1FWAC 4K1GA 1H09A 3CMJA 5BWAA 2IKHA 1UR8A 1XQKA 1FOBA 1X98A 5EFDA 1VYRA 3DXIA 5FF2A 3DBPA 3TH6A 3W7JA 4D1IA 3CYJA 1OK6A 5EMMA 4C1NA 2OQYA 3ALFA 3A4WA 3SUVA 4JN7A 4ZL1A 2NSXA 4AD1A 5BXSA 1HT6A 1TE6A 3GTNA 1ITCA 2XGBA 4J9JA 2GOUA 2NQLA 3HF3A 3UFYA 3AU6A 1YW1A 4DUXA 1J4EA 1CBGA 3QYQA 4DBUA 1J0ZA 3MU7A 1ICQA 3TXZA 1HP5A 3VKJA 3FIGA 3MWAA 2VC6A 4A2SA 3DGRA 5CXPA 3VCRA 1SW3A 1KXVA 3V5CA 3NL3A 1WCGA 3A9IA 4DQWA 5FI8A 5F1UA 3W7MA 3P0WA 2EG7A 1DKWA 2V8ZA 5KZDA 1FCVA 4IIFA 1QPKA 4NJKA 2XIIA 4FIQA 2W6RA 1E6ZA 4WEVX 3PZTA 1NFPA 2IXVA 2OLSA 3GXIA 2ZA1A 2EPMX 3HG2A 2CFFA 1MW1A 4QDWA 3ZT6A 5D9MA 2E8ZA 1BGAA 1V51A 1T6MA 4WDUA 4PBFA 3HMJG 1BWVA 5FSDC 4RPQA 1S2AA 3Q37A 1Q8JA 3TMLA 1EIXA 5BXRA 3BANA 2OOGA 3RN6A 1XBVA 2HNEA 3KOFA 1YBQA 1GTEA 3PNUA 4LUSB 2QJHA 5MKGA 3LLXA 4BQ2A 6REQA 4S2CA 4Y6GA 1R9ZA 1X1ZA 3GFXA 3TC3A 4M1BA 7TIMA 3WNLA 1UC4A 3RX3A 1HO1A 1UBSA 2RDXA 1NARA 4EPBC 2XWEA 4WIWA 2CLIA 3UZJA 1Q7ZA 3VZZA 1K9EA 3RCMA 4OIFA 2UY2A 3CHDA 4PMXA 4RZ6A 2E09A 3MI2A 3QEZA 3OYZA 3CPRA 4NQ1A 4OBSA 1FWTA 2QJIA 4LSBA 3C6CA 4EF9A 4EAMA 4GJJA 4PEKA 4BR1A 3DN5A 2VRKA 4O10A 1H63A 1EOMA 3GNPA 3ZVIA 1UQZA 3LXCA 4Q8UA 3XIMA 2VZSA 4YTSA 4LVGA 1TJ0A 5D02A 2OYMA 1FQ0A 3LERA 2WB5A 4OOUA 2AOSA 3R0UA 2E6DA 3WLHA 3LCIA 4O0KA 1LLOA 1RCOB 3DHPA 1CWYA 3ME3A 3MKKA 5DCEA 5J04A 3B9AA 4JYFA 1UUMA 1O5KA 1R2TA 1REQA 3I68A 2AL2B 2GJLA 3M0JA 2PS2A 1K9TA 2Z1WA 4NU7A 4D6DA 2VGBA 4NRRA 1I2NA 1UKTA 3KBNA 4PBEA 4PMQA 3LXAA 4Q4QA 3MP4A 2QUMA 3LCLA 2QT3A 2J77A 3LX9A 3QY6A 3N14A 3H4WA 4Z1CA 4K39A 3A3WA 3G1VA 4FLQA 3GYCA 2OU4A 3A6OA 2QGYA 3D6NA 3UYIA 4V15A 2E5DA 2QCLA 2XSAA 3FYPA 3LCHA 2R24A 5BOEA 2YKKA 1IT0A 4Q32A 4ZE5A 4GVFA 2JK2A 2CITA 1EJSC 4AXKA 2VMFA 2CKSA 1LLWA 3E0LA 4H00A 4MJ2A 5CG7A 4EACA 1RR2A 3UG4A 2CIPA 2UZ9A 3VNIA 4ECLA 2HVOA 4HJFA 1ZB5A 4UTIA 5FJRA 1O6IA 1DTNA 3VABA 3PSVA 4DJFD 4WUIA 1QHOA 1BTCA 1X6UA 1MUMA 3IIZA 1XH0A 4PMYA 3MP3A 4J3SA 1TB3A 1VFSA 3ABSA 1KFKA 2NXGA 3T78A 1XLDA 3EDJA 1Z69A 5AKQA 3DFNA 1DJZA 2FVKA 3MI3A 4PB5A 1VPYA 3CEUA 1W5PA 5HUPA 2G8ZA 3CU2A 4C6QA 1TWWA 2D2HA 3K8LA 4LRSA 2BHZA 4L80A 1KLZA 2VP8A 1VFFA 4O18A 2V2DA 2E6YA 3LBCA 3M43A 6ENLA 5D9NA 2YDQA 4DO7A 2YDAA 3WUEA 3MBDA 4WDXA 2ZKMX 2VUNA 3JU2A 3POHA 1CCWB 1IXPA 1GOWA 5D2TA 1DWFM 3GTHA 1FA2A 2ZZ1A 4OWGA 1SO5A 2C7FA 2C1GA 4NJJA 1Q3NA 1QW8A 2ZXBA 4K2SA 1OIMA 5M2FX 3CIWA 3T4WA 4HU0A 1M7XA 3G8RA 1PCWA 1Z9AA 5BXTA 1VQTA 3MSGA 4IFKA 7REQB 2YCKX 3CYVA 1J5TA 3AIEA 1QO2A 2I56A 4KIRA 3A3XA 3KTSA 1KR1A 4YXGA 4YTTA 4N2YA 1GUVA 3TOPA 3W2UA 3MYPA 2E7FA 1OX6A 4DB7A 4MZ1A 4NJIA 4IP7A 3IUDA 3POCA 2QDGA 1Q6OA 4DO6A 1E4IA 2C19A 3L4XA 3LN3A 4CNPA 5BU9A 3LLFA 3AUJA 2P50A 1UUOA 1ADSA 2B7OA 3LV6A 2X7WA 4X2PA 1F6YA 1CGUA 2OFJA 1B54A 4OHQA 4QJ3B 3WF3A 2C18A 4K8GA 3VNZA 3M0YA 1A0EA 5DBTA 3UCDA 1S5VA 3BCJA 3SQMA 3NA8A 4YIWA 4GC4A 2A21A 1XBXA 1W31A 1WPCA 4IH3A 3W02A 1S5NA 4HSOA 3QM3A 4Z2HA 1XRSA 2A79A 3W37A 1QBBA 4JX4A 2FTYA 1WBHA 1K8XA 3TOYA 3R0KA 2EKGA 4KIEA 3QR0A 1OF8A 1TYGA 4IG2B 3IVTA 4C6NA 3BVJA 4CCCA 1I2OA 5AHLA 3KAOA 4JTTA 1BRLB 4FNQA 4GI4A 1LL4A 3G1DA 2V0TA 1XIIA 3OHMB 5FD0A 3PUEA 4RCXA 1U1JA 1X39A 4U28A 3MUZ1 4GGHA 4Y9AA 1JZ3A 1OK4A 2CLOA 3VIJA 2E4TA 3DZ1A 4BEUA 2OZ3A 1WUFA 5CPMA 5M17A 4BHYA 4O28A 5C7VA 3WF4A 1XBZA 4CD7A 5CG0A 2QVHA 1YPIA 2O7QA 3BDKA 1F6KA 2ZE3A 2ZE0A 5PTDA 4MLRA 3OPSA 1QFEA 3IJQA 1RK6A 3TW9A 2X1SA 3HBLA 4IL0A 1LRQA 4BWLA 3NZPA 4NZ1A 1IWBA 2E8YA 4JFWA 2WMKA 2WJZA 2KAUC 5FEPA 5HWNA 3UVIA 3NQGA 1AL8A 1MO0A 4XAZA 1UD3A 1LUCB 3ITTA 2W63A 4A8LA 4DPPA 5IXEA 3PF3A 2W5FA 3NQDA 3C5QA 2BXYA 4CNNA 4RNIA 4LUTB 2X05A 4HHMA 1UA3A 2RJHA 4CNOA 4B3LA 1MW2A 1OT2A 1OX5A 3EWUA 3NL6A 5FF4A 5CPNA 2CPUA 1EF3A 4LVBA 3N34A 4W4QA 3UWYA 1L6GA 3DFTA 3W7GA 3WJYA 1H0IA 2DORA 2ZIDA 1QNQA 3GR7A 1KXHA 2HE5A 4E2DA 3AALA 1DWIM 1K6AA 4YTQA 3WMBA 3U0HA 1K7FA 4JFSA 4Y90A 3G5EA 3GG0A 1ZBVA 1HJUA 4DI9A 5HJYA 3F4DA 4ATWA 3S1VA 4W7WA 3BL3A 3OQEA 2G5WA 2DSVA 2PB1A 2V81A 4FPSA 1CDGA 1Y5VA 3TC6A 3A24A 4GZ7A 2RGLA 3OP2A 3PZNA 1TJ2A 2GSEA 1OFBA 4WSJA 3CTLA 1JF5A 3K8KA 3F4VA 1GQIA 1ALDA 1ZAHA 5A8OA 1KD0A 1EQCA 3T42A 5KZMA 3H2OA 3OEXA 3B8IA 1EEPA 3LNPA 1X1NA 4GX8A 5DRIA 3ZSSA 1BWKA 4N42A 5LIWX 3BW2A 3G18A 2YB4A 1Q6FA 1XRVA 1K3UA 3LB0A 3HG4A 2G4JA 2FGLA 4GABA 5AC7A 3WYZA 4Q6XA 1R3WA 3W22A 3ZLFA 2VGGA 4BY3A 1XYBA 1LCOA 3B8WA 4EWND 4NZJA 2D23A 4H04A 4Z2LA 1UR2A 4IPIA 1PXGA 2QHAA 5F1VA 4UFJA 3W1PA 3KW3A 5H2ZA 1ZBKA 1YXCA 1GQLA 1NFBA 4KBXA 1WDPA 3I3DA 3UESA 2R6OA 4JEQA 4BZYA 3FW6A 5MHBA 1FCQA 5GPRA 1MFVA 2YBTA 3I3EA 2FPTA 2NWRA 3II1A 1MXDA 1Q4NX 4CD8A 3IUIA 4ZVJA 2AMGA 3OVGA 4MY8A 2Y63A 4UOJA 3T8LA 1C91A 2ZUVA 3IGXA 3L5MA 4FF7A 1H7OA 3LV5A 1NELA 4IFRA 1I0BA 2PDYA 4ZOCA 2Z1VA 1NQ6A 3C0LA 3DCPA 4O19A 4Q33A 1LRNA 4X0NA 1MDRA 1MVYA 1E6QM 3KVKA 1DXEA 1Y5XA 3PWGA 5E0FA 4GINA