3VZZA

Crystal structure of pcrb complexed with fspp from bacillus subtilis subap. subtilis str. 168
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
226
structure length
226
Chain Sequence
MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
pubmed doi rcsb
source organism Bacillus subtilis
total genus 74
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 3vzzA00
3VKAA 3VZXA 3VZZA 3W01A 3VK5A 3W00A 4NAFA 1VIZA 4MM1A 3W02A 2F6UA 4NAFB 3VKCA 3VZYA 3VKDA 4NAEA 2F6XA 4JEJA 3VKBA 4NAEB
chains in the Genus database with same CATH superfamily
4AYGA 1V6YA 3IJLA 3THCA 4PMYA 4WHBA 4HGXA 2J62A 4WK9A 2Y62A 4DJFA 3OBKA 3T0BA 1SZEA 1QI0A 3U7VA 1TYGA 3BAJA 3WNMA 5D09A 4WF7A 3P61A 1Z3NA 1R6WA 1ME8A 1K8XA 3CPRA 2QIWA 1XLMA 3BSGA 4M6VA 1TUXA 2Z4GA 4XKYB 3A23A 1XV8A 1RXOB 3WQEA 1KM6A 4OV4A 3WLJA 3GK0A 4MIMA 3MJMA 4CQBA 2PCQA 4KEZA 3IJDA 1IEXA 3GO2A 3B0YA 1ISVA 2WMGA 1RY8A 1H1YA 2DH3A 4PSPA 1GYNA 2PZNA 2VDHA 1PTAA 3AYSA 4NG3A 3DC8A 1LL6A 3ERPA 3GNPA 5JBDA 3DG3A 2I17A 4I6KA 4QNWA 3S6OA 4UUIA 2GVYA 4YTUA 3D3FA 2Y6ZA 4ZOEA 2Y4SA 3S2JA 4Q6JA 4LSBA 2XIBA 4KIEA 3V0TA 4U4MA 3O16A 1M3UA 1OFQA 4WSJA 4N9EA 1MXSA 1EJWC 4AU0A 3IPWA 1SGJA 1UZ1A 2WHLA 4C1LA 2VOMA 5JBFA 3CV6A 3TX9A 2R82A 4S2BA 1MO0A 2FIQA 1VENA 4A8LA 1GW9A 1P1MA 3D0CA 4FXRA 1OG6A 3LEPA 4IIHA 3VNKA 3SEPA 4NZ1A 4E3TA 3R1ZA 1XBXA 4N2YA 1DORA 2ZDRA 1LRQA 4UTLA 3SECA 2EG6A 3WLLA 4QDMA 4ASTA 4H9VA 5F4XA 4JNZA 3N4EA 4DM1A 1P5BA 3RFAA 1ZRQA 3CIVA 4LF2A 1V0KA 1ONXA 3FX4A 3NM1A 1FHVA 1XDJA 4YIWA 2G3FA 4LVFA 4N6FA 1RJQA 4U2ZA 3WF3A 4LUYA 1GOOA 3A4XA 1BTCA 4YWSA 3WLNA 3SCPA 4LVBA 3NL6A 5HULA 4R27A 1RH9A 4JPGA 3DECA 3A3HA 1YX1A 4WY0A 1FWCC 3D47A 1ZJHA 4HOZA 4J3WA 4AWSA 4R7WA 4UTTC 1WZLA 2VP8A 2B7OA 3EA1A 5XIAA 4AMCA 4X2PA 2YXGA 2CETA 3AICA 3CB3A 3PUDA 3GH7A 5G1YA 4IMCA 1NOFA 1KV5A 5C71A 1LBFA 3R89A 3VGDA 6A3HA 1EX1A 1XC6A 1R3RA 3WH5A 2YCJA 2OSXA 3K46A 4QROA 3LS9A 4IJCA 4AQLA 1H7XA 3N12A 1XC4A 2BODX 3M0LA 1A3HA 2HE8A 4MWAB 5A8MA 2QZRA 3BSHA 5IHSA 4A3HA 3W1LA 3S9IA 2DSZA 3E96A 3K5XA 3WENA 2JKAA 2BLEA 1JFHA 4KETA 2DIEA 2QCHA 1ZAHA 2PDBA 2LLEA 3FFSA 3WBXA 1T8QA 4FNTA 4NJKA 3CMGA 3CPGA 1P7TB 3VTRA 3ZJKA 1JEZA 4IG2B 1K9DA 4IZGA 2YW3A 2JGQA 4KERA 4A3YA 3PTQA 2VC5A 1EPVA 3E5PA 3UR8A 3EOOA 3WDQA 5AYXA 4DB7A 3VD7A 3TNBA 1TCDA 5EMUA 1VJSA 3GNDA 3L5AA 1R2TA 2YFNA 3W7LA 4FIQA 2WO5A 1TV7A 3VKAA 5M2FX 2ZX5A 5D05A 1XS2A 4XD4A 3UG5A 3L4WA 3UA3A 3VGEA 3I7QA 3FKRA 3RLVA 4QJ1A 2PU0A 3PAJA 4J4KA 3UNTA 5D32A 3UYCA 4UTHA 3GDKA 2W67A 1CGYA 1NARA 3H7UA 2QCNA 3MBDA 4U31A 3FN9A 5M03A 1KRCC 3NA8A 4ZZ9A 3UD6A 4EK7A 3EKGA 2ZUVA 4E5TA 1JCMP 4FR6A 1F4AA 4MDPA 1ICQA 1DIDA 5LKYA 5EMJA 1BVZA 1MWOA 1X6LA 1NWRA 3WDHA 1ZLPA 2EAWA 1KCLA 4ZBCA 3NQEA 3CQJA 4Y8EA 4NAFA 1VBGA 1HL9A 1YLVA 1P6BA 4WJEA 1RR2A 4DM2A 3CUIA 2Y1HA 2CKSA 5CKSA 2J7DA 2CYGA 1A5NC 3FYOA 4IH3A 1WKYA 1BF6A 2PLJA 3WQ4A 1VD6A 4QNEA 1BFNA 4HNUA 1LP6A 1WZKA 1EA0A 5M1TA 3CLMA 3H24A 2GSJA 3S5YA 5C54A 1W3TA 1YPIA 2RFGA 4AVNA 2TMDA 4IISA 1E4NA 5AHIA 1E9IA 4D2JA 3M44A 3KVLA 1TWSA 3R0KA 2J4GA 3N1AA 2J9ZA 3CBWA 5D2YA 4Z2IA 3BLKA 3U3HA 3ATYA 2C3ZA 4P7LA 4IP4A 1VHCA 4KWVA 4B5UA 3ZWTA 1UPPA 3AWNA 2JGYA 3UZ5A 5BXRA 2GJLA 3BO9A 3GXDA 4B3LA 2MUCA 4KCWA 4MYXA 1C7TA 2FZ8A 4ZQCA 2O4QA 1XYLA 1GWJA 5IDZA 3RX3A 1L0PA 1DJGA 4HMNA 3E5BA 1HFBA 3APGA 3R43A 4UNIA 3GDLA 1LWHA 3S8HA 4ZA0A 1F76A 4O11A 3REQB 2PDLA 3G1FA 1KGUA 3CHCA 1EUNA 1MXDA 3AI0A 4I7UA 3C2FA 2Y7DA 4IMAA 2E7FA 4E8DA 4FLQA 2BVWA 2VVSA 1VBRA 2ZZ6A 3B9DA 4O18A 1J8VA 5AYZA 2YSWA 4LPCA 1E6SM 2ZXBA 1E6XM 3MP3A 3NQ8A 4BWLA 4JEJA 4GI6A 1N82A 3NFUA 1XIJA 3ORWA 3DESA 3TCEA 4XAGA 2CLLA 3LPGA 4EF8A 3T4WA 1ZU8A 3BOXA 4EAMA 3E2RA 4UMAA 4MNMA 5G4EA 1DEDA 2NVCA 5D2VA 5JVLA 2O9PA 1W9PA 3SY8A 2PZ0A 4Q8QA 1KXHA 1M5WA 3N6HA 1JCNA 3J7HA 2V81A 3CAWA 3O0KA 4MZ8A 3MMTA 3POCA 2D0HA 1GZJA 1Y65A 4ZTXA 1S2WA 4Z2JA 5BU9A 4C5YA 5BOEA 3G1XA 1XPYA 1EHAA 3M1ZA 4WX2A 3THAA 1A3WA 1TA3A 4HSOA 3WN6A 4D6JA 5MKGA 1FWAC 5FCZA 2XIMA 2FKPA 2ZC8A 1A5BA 1BHGA 2A7PA 1FWDC 2ACSA 1WX0A 3GW3A 1FDYA 2PDQA 2AL2A 1FFRA 1LBLA 4C6KA 5DLCA 3D6NA 4MG4A 1UBSA 2C1IA 3SRFA 1KFEA 1B0IA 1UROA 3DERA 3APYA 3PTMA 2VD9A 2CLHA 1SU5A 2NSXA 1NIUA 4NRSA 4Q3MA 1UR1A 5LXXA 3WLOA 3GAKA 4ZOCA 4M51A 2V2CA 3H2MA 3B06A 3RYSA 1E4MM 2NLYA 4R33A 3TLQA 1J0JA 3CC1A 3BCFA 4LC8A 5K7JA 1UKPA 1ONWA 2VO5A 3IS4A 1BQCA 3SI9A 1HJSA 2W3ZA 3LTPA 3BH4A 1IT0A 3P62A 1DWGM 1QNSA 1SVDA 3RR1A 2XIJA 2BV9A 4GZEA 4HTYA 5EMLA 3IIOA 1IEIA 4AZ7A 1GZGA 2RH9A 1H7RA 1XIGA 2OLSA 3PP7A 2GJXA 2ZCGA 1RP8A 1TMHA 2UWFA 4GHRA 1I1XA 1B5TA 1XLJA 3FHAA 2PURA 3RAOA 3VKBA 4RDYA 5EPDA 3EA3A 4S3CA 3HFYA 4HKPA 2V5BA 3GVVA 2E9BA 2F6KA 1I0BA 3H2EA 3UJEA 4B4HA 3UGVA 1I6NA 4JAWA 3UZJA 3N9SA 3C2EA 4L6DA 3KHJA 1UD4A 2QPUA 4HCDA 2VC9A 4MADA 3QW3A 1JF5A 2PMQA 5LNSA 1NEYA 1OC6A 1XJBA 4QHRA 4JBRA 5ENLA 2O7SA 3PZOA 2XIOA 1MW3A 2DZBA 1EDQA 3EBVA 3HGSA 3E2VA 3DHPA 3KE0A 5BZAA 1SYTA 4H9XA 3GXPA 2YZRA 1KGWA 4MKSA 3W22A 4JD4A 4XIMA 3WLPA 2QQ6A 1E9LA 3RMEA 2Z29A 2WM0A 3TIMA 1I2RA 1VGAA 4H8VA 2BZNA 1K7XA 3STCA 2IQTA 2IW0A 4GXMA 2J7FA 3B40A 4NRRA 3H4GA 1U5JA 3BURA 4D6FA 3OG3A 1FWGC 4DXVA 2IS7A 5BRQA 1W9VA 1VFMA 3RK8A 3ITYA 3RDKA 5C9WA 1TPEA 1P6CA 3GYEA 4AY1A 3LSBA 5BW6A 4O4WA 3LBOA 1CCWB 3F03K 2J9XA 3AROA 3FK4A 3TP4A 3VCNA 2DFAA 4GVGA 1AJ2A 2R1LA 2XWDA 1R85A 3VVGA 4GCAA 3ZYZA 1OZQA 5H8MA 1QI3A 5HQLA 1HKIA 3LCWA 2H8XA 3KXQA 5AC7A 3W02A 8XIMA 2QMKA 2Z28A 4R7OA 2VOTA 2X42A 3B4YA 2YFOA 2BXVA 3WUGA 4XV0A 1S2VA 3CNYA 1GEHA 1ZB5A 4HNVA 5FAGA 2IKGA 3UZXA 2C19A 3V35A 3G24A 3T05A 1GVSA 2IPGA 2P0IA 1JYXA 4FK9A 3EWBX 3MT1A 2ZE0A 4HHLA 3M0KA 5E5CA 3VMPA 2I5IA 4CQ8A 4WDWA 3QV9A 1JCTA 1KBJA 2ALRA 3VUSA 3AIEA 2CZ5A 3MSDA 1GCYA 1PYFA 1Z6KA 3ID7A 3O07A 2J74A 2QUNA 3RGTA 3VAVA 2WLZA 2RHGA 3AZRA 3PZNA 1CLKA 4LBUA 2FQIA 2F6XA 3GIPA 2UY2A 4R85A 2RAGA 4G7EA 3W53A 3EX3A 1MRAA 3PG8A 4JHMA 4PRWA 4EF9A 3PANA 3W00A 3SRKA 4C6PA 3G3MA 2P0OA 2VFFA 1S2AA 1F7BA 2W92A 2VELA 3EX1A 1UUMA 4M56A 1WOAA 2FTYA 4NI3A 2YCIX 3CTTA 3EOSA 1PVNA 4QIUA 4B3KA 1XDLA 1PCKA 2X2GA 4Q8NA 3GHRA 1M03A 1LBMA 4TU1A 5TAOA 4LCSA 4MWAD 1KFJA 2FGZA 1FP9A 2IQ0A 3I3DA 2OZTA 4C6DA 1GYMA 3LUTA 1R2SA 3G18A 4IGSA 3W7CA 2BSLA 3L68A 1GVEA 4GG9A 3SFWA 2ZUMA 5LGXA 1V6WA 3VZYA 1DJIA 5H2ZA 2Y89A 4Z1DA 4OUEA 3HPFA 3TYDA 1EP2A 2WNWA 3ZIZA 1MI3A 1PS9A 2ZX7A 6XIAA 5JU6A 1M7JA 3B3DA 5DY2A 3KM8A 1AQMA 1KLYA 3M43A 3PM6A 3WL0A 3AXHA 4PBEA 1HN1A 3MWCA 1AK5A 4WLCA 3VFCA 3UJFA 4QCEA 1UWIA 1J2WA 3SN4A 2I56A 3LXAA 4GGBA 3UY8A 1DWIM 4AWUA 2QJNA 2ZUWA 7REQB 4QISA 1HNYA 2AAMA 2D23A 2PI6A 4Y7EA 4B5WA 3FJ6A 4QG9A 4JIQA 5CGMA 1OX4B 1GGOA 4L4OA 1WBJA 4JTRA 1GQKA 5REQB 4FOUA 1ITCA 1Q6QA 3V3WA 1Z69A 3IRDA 2QCFA 2R91A 2R1PA 2QCGA 4LUIA 1PKMA 4Y6GA 3QR3A 3RF9A 1YW1A 4B5TA 2G96A 3GU9A 4B15A 3MSRA 3SB0A 4GA8A 4ENLA 1Y5VA 1RA5A 1VC4A 1QWKA 3V16A 4NZ4A 1VCFA 1XBVA 3L4VA 2HS8A 3N3TA 3FAWA 3PY2A 2MNRA 2NW0A 3HO8A 1WDSA 4KWUA 1W0MA 3CYJA 4J3XA 5LNRA 3JZUA 1G69A 5J5DA 4K68A 3GUWA 1ONRA 1HGWA 2V2DA 3L21A 4ADUA 1UP2A 3WH7A 2ASHA 4ZOBA 4DO4A 3GDBA 3PF3A 2QF8A 1D3CA 3GDTA 4Z2KA 2VWTA 3W27A 1GQLA 4IJRA 4NHVA 1UH2A 3AISA 4JN6A 1P0NA 4GXPA 1QBBA 3LCLA 3VIJA 4P8XA 4PBFA 4MNLA 3AIQA 5EYWA 1OX5A 3VE7A 4F2UA 3WLIA 2ZVIA 2PRMA 4M7SA 2VX6A 2L5HA 3B8DA 1WBHA 1GORA 5HWMA 2QAFA 2VEMA 5TIMA 2A7NA 2OX1A 3R8RA 1TG7A 2WJFA 3RXZA 1TPWA 3WK2A 1PE1A 1OCJA 2ZXQA 1M01A 1E3XA 4RE0A 3MUIA 4M1RA 3WH6A 3A21A 3GWQA 4CU6A 5A8OA 3PPCA 1QI2A 1XG4A 5CPSA 4DO7A 2Q3RA 1V6TA 1JGIA 4BI6A 3WQVA 1C8QA 3H21A 1X39A 3FKKA 4QSFA 2XH4A 4K3ZA 1O66A 3H54A 4IUGA 4RJEA 1L2UA 4P8UA 1W9BM 1CECA 3GD6A 3B4UA 4YTQA 8A3HA 1JDEA 3HFTA 3GNNA 3EB3A 3W71A 3KX6A 4M8UA 4Q7NA 4MWAE 1WQ5A 1AJ0A 2WBGA 3SGUA 4OKDA 5E6ZA 5FJRA 5CG7A 1QJWA 1FCUA 4TR9A 1RBAA 3VIOA 1K70A 1M04A 4CQAA 4MSSA 2XDFA 3TJ4A 3M5YA 1X6UA 4D9PA 4GIYA 3N17A 4M80A 3AHZA 1XRSA 1KA9F 2GQ9A 3S5ZA 2BP1A 4K1GA 4TQTA 3EB4A 3WFLA 4D8ZA 3F4DA 5DCDA 1CNVA 1LZOA 2PEVA 1JCLA 3WQOA 3W4RA 5HINA 3MHUA 5HNNA 1TX2A 4IX2A 2EJAA 4KT2A 3GFXA 1ZAJA 1SO5A 1ODZA 1TJ0A 4X0NA 4MHBA 1E1FA 4G8TA 3QZEA 4RNHA 3PWGA 5A6BD 4MWAC 3I3EA 1KLZA 1M9HA 1PJ9A 3CO4A 4QQUA 2QF7A 1JI2A 1AMYA 4CD4A 1E0WA 5EMKA 1KBLA 4E8GA 2Q02A 4ZE4A 3CHDA 3EWDA 2G8ZA 1LLZA 3SW6A 2BVYA 5BCAA 1WA3A 2BHUA 2HXTA 1UMYA 3M64A 1TTPA 5A69A 3TJLA 3SUUA 3KL0A 4CD6A 4UR9A 2J75A 1FOBA 2ADAA 1W1YA 4JQAA 5C9UA 3W7IA 2FPVA 5LIUX 4FB7A 2H3DA 1EPXA 1DJWA 3IWPA 4HU0A 4E2OA 3F5LA 2OWXA 3S9ZA 4WJ8A 3RIKA 3ZWSA 1FUYA 2QV4A 4PMJA 1XCWA 4Q4OA 1MW1A 4R53A 4D6EA 3S3GA 4HYWA 1IZCA 1CGXA 1VCVA 5CG0A 4CQDA 2A2IA 2WQPA 3VIFA 3BZGA 4GNJA 4GKTA 4IWWA 3RG6A 1FH8A 2RJHA 3FYPA 4HMEA 3VGHA 2X7VA 1E1EA 2Z2AA 3ARXA 2G3IA 2E1WA 3IRSA 4YHEA 4MNJA 3BCJA 4A3RA 3KTSA 3CH9A 3OZPA 1FH7A 4DJEC 5AZ1A 1IGSA 4EE9A 3BDKA 3UCQA 1R38A 1KRBC 3GE7A 3L0GA 3IGUA 1QPOA 3GB6A 1JYVA 2XVNA 2PDKA 3MCNA 1CLXA 2X16A 1D9EA 4Q8MA 2X40A 1XLAA 2WCGA 2R6OA 3G1SA 2XGZA 4RDWA 1IXPA 1NDWA 1WUFA 3DX5A 1US3A 1FWWA 4WY0B 3VKDA 2C14A 1DJXA 3KZPA 3HG5A 2QW5A 1MEWA 1T5AA 3IJ9A 3L67A 3GY1A 1J2BA 4J28A 5T8GA 3R79A 4L1GA 4ES4A 2ZA3A 1KBIA 3L5MA 4CLMA 4PMVA 3L2IA 3P80A 2PP1A 3WJYA 1H41A 3VKCA 3UWUA 2ZA1A 4BEUA 4QDWA 3L0NA 3LNMA 2VHLA 2V67A 4RNJA 1KM4A 4E4UA 2FH8A 4JFUA 4PB4A 4DF1A 5G4HC 3NDYA 4E4FA 5FL1A 1XR2A 2CWXA 3CZGA 1GTEA 3EA2A 3VINA 3WDRA 3G3DA 1ICSA 3MO4A 2WJDA 4GXWA 1EIBA 3AHXA 3EXTA 2GL5A 4QQ3A 2FFIA 4IPNB 4NZCA 1SMDA 1T41A 4NXSA 4OBTA 1WXJA 2FPYA 1W3NA 3VD3A 2DT1A 3WF1A 3IACA 3SAZA 1E4LA 1D3GA 2XVGA 1W5QA 3MQTA 1PAMA 3T40A 2ZE3A 3NQGA 2BDQA 3CASA 3TE9A 4DHGA 3OLEA 1IWAA 3TQ0A 3AFBA 2CC0A 1RUSA 3OZOA 1P0DA 3LMZA 1OM0A 1H7PA 4CNTA 1S3HA 2OJPA 4AC1X 3LZ3A 2F8QA 3LGEA 1TELA 4X60A 3KOYA 2QULA 1B2YA 3W7RA 3JS3A 2Y88A 4QEEA 3N29A 3LA4A 3L2MA 3BOFA 3PBYA 1EDTA 3W25A 4MPKA 1AW5A 1VP5A 2VMFA 3MCMA 5BOOA 1N8FA 1TO3A 1V5XA 1E0UA 4HQVA 4B90A 2Y85A 1F3EA 1TQXA 3GTXA 3K4AA 1V02A 4MOZA 3AMGA 5HBFA 4DBDA 3UG8A 4EACA 2ZRYA 4NAFB 3L0KA 1YE6A 5CJ5A 1QW7A 2CU0A 1VEMA 4MLRA 1ISXA 3T09A 4FMVA 3M07A 4Z1CA 5T9BG 1BWLA 1A5CA 1S3TC 2E67A 4C6QA 3M0MA 2PDHA 3G0UA 2FZMA 5AB3A 1XLHA 4Z0SA 4DLFA 2JF7A 3WMSA 3LV5A 5CBBA 1Q5MA 1JZ6A 1AW2A 2QV5A 3MMDA 5A94A 1JDFA 4GY1A 2FFCA 5ABHA 4XG1A 2YXOA 1KWKA 1PX8A 1SSGA 5D4YA 4EAYA 4JN7A 4HJFA 3MBFA 2HDJA 5AFDA 2XVLA 2PPGA 2OO6A 2EJ1A 2BOGX 3VKJA 1XBYA 2DORA 2XTKA 4D1IA 4AFYA 4UTWA 2KZHA 1TWWA 2Z6JA 3VC6A 3BUVA 1XYFA 3GW0A 1B3WA 4IQLA 4WKAA 4IFKA 1WZMA 1X98A 1HW6A 3AU2A 3NL3A 4MKNA 1I4NA 4LY4A 1IXOA 1J6PA 4CNPA 2XVKA 3VOJA 3P7YA 1XGDA 3I4EA 1ZNNA 2W66A 1NJJA 2DU2A 2DZPA 3GR7A 4MJZA 4L64A 4L4PA 3TAKA 1SW7A 1HGYA 1KKOA 2DQWA 3BW2A 1ZENA 2Q6ZA 5D9OA 4B9ZA 2TSYA 4LB3A 2CHNA 3UCCA 3GIQA 3OGSA 2OELA 5FF4A 4AZBA 4P7RA 3E0WA 2NWSA 4AD3A 1VRDA 2Y5SA 2NQ9A 1ZS2A 3IJIA 3LOTA 4RXFA 3SCVA 3IIVA 1ZJBA 1YXYA 5I3FA 3A64A 1H7OA 4H83A 3CHFA 4BFAA 5SWUA 5F2IA 3NR0A 5GNZA 2ZXDA 1O1ZA 3W24A 3W1UA 1CGTA 4AZ6A 2AGKA 3MYOA 4LOCA 5CBJA 1CWYA 1W56A 1VPXA 2B4GA 4C7FA 1PCWA 2POZA 4D6GA 4QJ3B 1P1XA 3DAQA 3DBPA 1BGGA 2JFEX 4LUSA 2PC4A 3GTNA 1F3WA 3BV4A 5E93A 3MO7A 3VIMA 3FW6A 3S1WA 1J0IA 1G4PA 2ZRZA 1EJSC 1KM3A 1FWEC 4GYPA 1M41A 3KOXA 4LGXA 4A2SA 3GLCA 5AN7A 3W0KA 3Q4DA 3R0DA 2D2JA 1DBTA 1TA3B 4HA3A 5AVHA 2NX1A 5MKGB 2OOFA 3TZNA 3QGAC 3NOEA 3IUIA 5T26A 5CC3A 3AMCA 3O06A 3KVKA 3HPZA 3ABZA 5BU6A 3ARPA 1W17A 2ZYFA 4HYVA 3MWAA 4LEFA 2AL2B 2W4XA 3O9NA 2VZUA 5CGTA 4NJGA 4PCFA 3K8LA 3RCNA 4GNVA 1KM0A 3ES8A 1S5TA 3OZYA 1U2YA 3Q37A 1WXZA 1IE7C 4GRSA 5ABFA 2E9LA 3CWHA 3HV9A 1MNSA 1KB3A 1K4GA 4IXXA 1HF6A 2IPWA 4IPPA 3ONCA 3CT7A 4YTRA 2BGSA 1IHIA 1DWAM 2CXGA 1TPUA 3A5FA 4B2DD 5FACA 1B3VA 4GO9A 5I5RA 1DTNA 1DQUA 1M65A 3H55A 1H62A 3M0VA 4HCHA 1W3LA 3W81A 3GNXA 4GYFA 4PMUA 2ISVA 1NAL1 1TE6A 4A4AA 3WD1A 4S23A 2VD8A 3FEMA 3F2CA 3S9YA 4J2MA 3LCIA 4A3UA 1F9CA 4UFLA 4DJDD 4PCTA 2VQUA 2OODA 2CFFA 4W87A 1J0HA 2J7GA 5DT7A 1EKOA 2FGLA 1OADA 2ZQ0A 2GJXB 1RA0A 2VWSA 5I78A 3S4TA 1H1NA 3UWWA 2GVLA 3N2XA 2B7QA 3GTFA 3HG4A 4HTBA 4XO6A 2PUZA 4U33A 1K03A 1C3FA 2XWEA 1HJQA 1F07A 2TYSA 2FDSA 4HA4A 1MUMA 4JTGA 1I1WA 3ZSTA 2PRHA 2W62A 2OEKA 4G5DA 2HS6A 5FI8A 4A35A 4MYAA 2JKEA 4H4IA 1JCJA 3OEXA 2QCEA 5TBOA 4O17A 4EIVA 1DTUA 2WSYA 1OC7A 1JD7A 1QNRA 3W1AA 1JG9A 4PA8A 1GG0A 3UESA 3W7EA 4O10A 3BAXA 1R47A 4LUJA 2JF6A 2WC7A 1KTBA 1CDGA 1ECQA 2YL8A 2YPIA 3BG9A 4AY7A 4KCUA 1J0KA 1NWSA 2YCLA 4Y90A 4YYCA 3A6OA 1R3SA 2RUSA 2DQXA 4X22A 2ZWYA 4KPLA 5KZEA 3QTPA 3V5OA 2QDDA 2VCAA 4Y9OA 1O4UA 1VF8A 1A50A 4UFMA 1Z44A 1I2NA 4F48A 2Z6IA 4RV3A 2VCBA 1BXBA 5C9ZA 1VIWA 3R94A 4H2CA 2C71A 1J79A 3U2OA 4DBUA 1HUVA 3BJFA 2J7HA 1GNXA 5K4XA 4S3JA 3SQLA 5BWFA 5ABTA 3KVJA 1LLWA 5HA7A 3ARQA 3A3XA 4I5RA 1NU5A 2XH0A 4GZ7A 3L4UA 1X6NA 1UR3M 2Z0IA 2ZUSA 4MLJA 4WCJA 1S5NA 3VGGA 4M0XA 2E28A 5EBAA 1KXQA 1QNQA 3WUBA 1EEXA 2Z1VA 1NWTA 1R3TA 3WLQA 2CPUA 2YBUA 1Z89A 2BGQA 1CB7B 2W91A 5JQ9A 4G1NA 1WDQA 1WOBA 4BCEA 5DEZA 2Z1KA 3S1GA 2BXZA 3MS8A 2PP3A 1A5KC 3SCWA 3DENA 5L6UA 4CD7A 3V1HA 3WF0A 7TAAA 5I3KA 1G94A 2V3DA 2XGIA 1PL9A 1E1CA 1NDVA 1R9YA 3E0IA 5EFFA 1PZ0A 4DNHA 1QPNA 3HGOA 1JZ7A 5FJTA 3W1MA 2JQXA 1HKWA 1K7EA 3QQ0A 5HMFA 3LQGA 4KWOA 1IQ8A 3KZSA 4IQEA 1KFLA 1XXXA 2PDNA 2HJPA 3QKEA 4HK7A 1OINA 1BLIA 3LHWA 3WD3A 2QUUA 3QGVA 1FWHC 2W63A 1UR2A 1D3HA 3S5OA 4G7EB 2VZVA 3F4CA 4PMOA 4Q6XA 5C55A 3BLFA 3EDDA 3H23A 2VR2A 1HL8A 1Q6EA 4GQ0A 1MEIA 3PC0A 3ARWA 2PF0A 4O12A 3CXOA 4DAIA 3O05A 5D8WA 5KZMA 1GQJA 1DE5A 2E68A 3OVPA 3OVQA 2C1GA 2WZTA 1J11A 3S6DA 4IIFA 4J3ZA 3ZJ8A 4JX6A 3W83A 2PWGA 4Z1YA 1GYLA 1UB3A 3CL7A 2G4FA 1PZ1A 2ZRXA 4UWMA 1PKLA 2VUYA 4FNQA 3VD9A 1SJCA 4MGGA 5FL0A 1QOPA 5DRCA 2QUTA 1MW2A 3AS1A 4DQWA 4BF9A 3S42A 5A8GA 3U6WA 5HQMA 3WD2A 4ML9A 3E38A 4HU3A 2E5BA 2QGHA 1UA3A 3OJGA 1EBHA 2V5CA 3GXMA 4NP7A 1PDYA 4WQ6A 1MXGA 3IANA 3CHVA 3AS2A 4NYUA 4DY1A 2WZMA 4RLIA 3PZTA 1DQXA 3ANYA 3CUHA 2A3EA 3S2NA 4JL1A 4JIPA 4NZ5A 1SUXA 3T9PA 1PZ3A 4UQCA 1NVMA 5I06A 1Z42A 3RUBL 4JX5A 1IIGA 5EA9A 4Q33A 3MA8A 3P2VA 3K2GA 3W7QA 1MUCA 2YLAA 4EXQA 5F2MA 4K8EA 2DP3A 3GYCA 2NT0A 5D9MA 3U0HA 7XIMA 1OGBA 3BWWA 3R12A 4J5NA 2WV8A 4PEKA 3WY1A 2PP0A 3CIXA 3QQWA 1V3LA 3KFTA 3QOKA 4W8BA 4Q4MA 3BW3A 4BI5A 1OT1A 4JNMA 3TTOA 3QZ6A 4EXBA 3RRXA 2IPJA 3L23A 4GUHA 4UXDA 2ZICA 1B1YA 1JZ2A 2P88A 3W6MA 1AZ1A 3LXCA 3TOPA 4O19A 2V5DA 1AG1O 4EWND 4OIFA 1TCMA 4TXEA 1E72M 2WPGA 4JTSA 4NJJA 2ISDA 3OHIA 3AJXA 3EDFA 3PJTA 4AD4A 4XAYA 3GG7A 3HIJA 3TTSA 3KBSA 4H1ZA 2FHBA 4FLRA 3HA1A 1LT7A 4GX8A 4E2BA 4GZJA 1I75A 4AVOA 4MAZA 3SY1A 2X0HA 4QGCA 5HWNA 3O6AA 5HAOA 2UBPC 4PUWA 1W37A 4DEFA 4Q7IA 1DJQA 2QNEA 3GHTA 1PIGA 4I9JA 4GIAA 5AC6A 2PCEA 2H6RA 3F2BA 2VQTA 2NQ5A 4W5UA 1SR9A 2XM2A 3OQ8A 2FGBA 1VCGA 1AUSL 1XIDA 3K1GA 4Z1BA 4UFJA 5LZLA 4KH2A 3IJQA 1VFLA 2XH7A 2PWUA 2WWDA 1GPFA 4KWSA 4W7UA 4C7DA 1AQFA 2G37A 4QR6A 3WG6A 1U1UA 2EGZA 4HK6A 4HN8A 1WKFA 4AMAA 3AAMA 3OYZA 3KP0A 4DUOA 1MSSA 6XIMA 3BLPX 3NTYA 3WNLA 1F4HA 1YIXA 5EGRA 2VI0A 3EEZA 2FMNA 3UU0A 3XISA 4JX4A 3JR2A 1TQJA 4H9ZA 4UBPC 3N04A 1TPB1 2ZC1A 3G77A 3W7HA 2EHHA 3LM7A 2YBTA 1DHPA 3D5HA 3C8FA 5EMMA 2FMOA 2NUWA 3W70A 1F3TA 1R30A 4LCQA 5DANA 4ZXLA 2BG5A 1PO9A 2QJIA 5G1MA 1VQTA 4H01A 1E9YB 1A5SA 5JH1A 2A6LA 1EGMA 3UYIA 4F66A 1XD0A 4F9DA 1Z48A 1TFVA 3AYTA 2Z1SA 3V18A 1DQWA 1Q6OA 1UWSA 5D04C 5A5WA 1QWGA 4RE2A 3EMZA 3TH6A 1R5YA 1KFBA 3UXLA 2CBIA 3DHUA 3GRIA 2YJQA 4X9YA 4PTXA 1W32A 2VJXA 5FF3A 3T6CA 3OU8A 4IM4A 3FCPA 1X8CA 3HPSA 1OB0A 2CW6A 3DDMA 1JUBA 5IBXC 1OF6A 4BF5A 1RAKA 1FHUA 2EG8A 3C5QA 4NX0A 1OFRA 2P5NA 4G9PA 1HVXA 2OLAA 5AC4A 1UA7A 2QDEA 3EOUA 2JIEA 2Z2BA 4Q7BA 2BXYA 4I90A 4D8LA 5D38A 1FXPA 3C8NA 4O15A 3UWYA 5LNUA 1EJRC 1A5MC 4UTJA 1VIZA 1OFAA 1ZBCA 3LK6A 3TLLA 4UMCA 1V6UA 3OBEA 3B9EA 1P0BA 2GZXA 3GR4A 3TEVA 2AMXA 3HQPA 1H5YA 1FWRA 2XFFA 4PYSA 1OIMA 3C0JA 3LHUA 4C5ZA 3CZEA 3LD5A 3HPXA 2VFGA 3GBDA 3SUTA 4X61A 4HK5A 4B5XA 2INZA 3ITLA 4AX6A 1PV8A 5RUBA 4HA0A 5DMNA 3WQWA 3E9AA 1ISWA 3H70A 3PG9A 2HE5A 3TA9A 1DP0A 5EMYA 3W75A 3H8AA 4IFOA 1H4PA 1VYSX 4RW3A 4QM1A 2JEPA 3OODA 4CGTA 4IHCA 3VOCA 3NQAA 3Q65A 3TA6A 3IIPA 2YA0A 3O8AA 1JULA 4HPXA 3W3OA 4OBSA 5A8PA 3WQ6A 4R34A 1ISZA 3WMCA 3BGJA 4IMDA 3OB8A 2G0WA 2WZIA 2BY3A 3A5VA 5E1QA 2E9MA 3M47A 5AHEA 3PULA 3V5FA 4GZIA 3UG4A 1EA9C 4IIGA 3W1TA 3T0TA 4IL0A 1V3KA 4AH7A 4M6PA 3STFA 4H9MA 1U30A 2YL6A 4JQ3A 1NOUA 2WC4A 4GQQA 3SUWA 3KCLA 1B90A 3N2CA 4AIUA 1FCQA 3SUSA 1UQZA 3T2OA 4LCRA 3HV8A 4HMDA 1J93A 1R7OA 4N6EA 1XKJA 2Q09A 1UR0A 1EGVA 2D2HA 1KCXA 1IV8A 1XSKA 4QDPA 4W7WA 4PUDA 1T0OA 2IXUA 3K13A 1E5JA 5C2XA 5FF2A 5ABGA 4DI9A 4EANA 1SJAA 4M1BA 4GJ1A 3B8VA 3WZ0E 2ESCA 4GQGA 2CIPA 5BROA 3LHZA 1W3JA 4UQBA 1SR0A 2R14A 4HBKA 4XVEA 3VFLA 2VTFA 1YRRA 4N9DA 1DWJM 3P82A 1R86A 2RDUA 4JTFA 2CLFA 3B9OA 1KCKA 5CPTA 2OO0A 3VOIA 4HA1A 4FOKA 1UWTA 2ZZ1A 1KCZA 3WLTA 3LU2A 3ZR4A 3VABA 2WMHA 2DIJA 3K8MA 4UOZA 4H8NA 3ATZA 1S2UA 5DX7A 1TVPA 1EP1A 1U5HA 3PJUA 5LNWA 3WDIA 4Q4KA 1F3XA 3RITA 1UZ4A 2GQ3A 1BD0A 4NKCA 2EPHA 1C7SA 2OXNA 3VPLA 4FS9A 1HJVA 2NZLA 4D6CA 2Y0FA 4LBSA 1F74A 1BYCA 3ITOA 3CMFA 1XKYA 4IIBA 2ZFAA 1XLLA 4AZCA 3TTYA 4Y9PA 3TDFA 1WDPA 2YCKX 1TZ9A 1RCQA 3IEBA 5XINA 1EHNA 4PTVA 4JEQA 3UVAA 2YXXA 3WEOA 2ABBA 4A2RA 1EZ2A 1BVNP 1JQVA 2PLMA 3EWWA 2CZVA 3BMWA 1HKVA 4BWLC 3V1PA 4CCZA 1CEOA 2WVTA 1MDLA 4TTGA 1Z9AA 5A2CA 1EIXA 4ORIA 1EYEA 4P2VA 3OHMB 3MCOA 1EQCA 4TIMA 2NT1A 2NUYA 4IMEA 1MMFA 2UV8G 4B3ZA 1CGVA 4PCPA 2X2YA 2XYLA 3TC6A 4HCLA 1YYAA 1P6WA 2HVMA 4I9MA 4I5XA 3QPYA 5GNXA 1PTGA 2ZRWA 4YL2A 1TMQA 4ZQNA 3C6CA 1WDRA 1UWRA 3WLHA 5JMUA 1F8MA 3A9BA 3KS5A 1ZQ5A 3B0UX 3T4CA 1B3ZA 2GK1A 5A6MA 4HNNA 1QNPA 2A21A 4Q22A 4W8AA 1NY1A 1QPQA 2VX7A 1XLBA 2NX9A 4FOJA 4ROPA 2YB1A 1E0VA 3NPVA 5HPCA 4GH1A 1TMLA 1Z8AA 1UP0A 4DWSD 1W31A 4JY8A 2V5JA 1K1DA 1PWLA 2ZUTA 2BVDA 3UT0A 5K2ZA 1R8LA 2VRQA 1XH2A 1XLIA 1TWZA 2AQOA 1QCWA 3V4BA 3AMLA 2GQ8A 3E0FA 3UF9A 2ZDSA 2P1FA 2R1NA 4I9TA 2DSVA 2GDVA 2E77A 2FTWA 1B30A 4IFKB 1AL8A 2B7NA 2ZUNA 3LBCA 3FA5A 5HXMA 1OIFA 3SUVA 1SW0A 2QDHA 3WLMA 3SCOA 2V5LA 4F0SA 4H6RA 4GFIA 1X38A 4A21A 4S3BA 1A4LA 1W54A 4AD1A 4DELA 1L9WA 1H0GA 3TW7A 3DFQA 3WL1A 1HIZA 4O4VA 3PR2A 4CD8A 1ZBVA 2PTXA 4O52A 4HVXA 1JYWA 4D1JA 3MVTA 2XIIA 1H7WA 3CQ0A 1JPHA 2WLYA 3FVDA 3LPOA 1K02A 1RQEA 4GUGA 3T81A 3BPWA 2F9RA 2ZZ4A 4MKVA 3U2ZA 3EKZA 1UD6A 2Y8VA 4U28A 3NURA 2DZWA 2C15A 1TTJA 4GUJA 2CBUA 2E0PA 1KRAC 3I7SA 1XL9A 3P0XA 4LUSB 3W7KA 3SCNA 4PR4A 4ZB2A 4Q32A 3DI1A 3C86A 1OFDA 1KWGA 4BKNA 1XFBA 4KRTA 3SADA 1RLDA 2OMAA 3VX1A 3HG3A 4YJ5A 2X0SA 3MB9A 1EL3A 8TIMA 3RLGA 4LQ1A 3P0WA 3C2RA 4XZNX 1V3HA 1ZL1A 4PEEA 5D2WA 4OQVA 1UOKA 2WVUA 2HMCA 2PTDA 1GW1A 1NP2A 2PDYA 3ITTA 4W84A 1QPKA 4UR7A 1PDZA 3NQ6A 3HGJA 1A49A 4ADTA 3HU7A 2ACQA 2IKHA 2J25A 4H7CA 4PTDA 2J27A 2ACUA 4LXFA 2Y8KA 2ZVRA 4RDVA 1OCNA 3B05A 1C90A 4HD5A 3FEQA 1HP5A 3CWNA 2WQDA 3N11A 4DF0A 3TK7A 4U3CA 1F6YA 5ABFB 2TPSA 1P4CA 2DSWA 4D71A 1YNYA 4D6DA 4KFOA 2BHZA 4C7GA 3RJXA 3F4NA 3TXZA 3BANA 3ARUA 3BLIA 1T99A 4DZHA 1OFOA 1WZAA 5LIXX 2XFRA 3TONA 3VXGA 4Z08A 4XQ6A 4CVWA 3LV6A 3EAUA 2D1ZA 3QJAA 3DZ1A 4US5D 4DYJA 5LNVA 1BKSA 2J8TA 2R9RA 3VA8A 1B3OA 3QMSA 5D9PA 4L4MA 5JXQA 3W6LA 3NXLA 1JUEA 1PX3A 4O0QA 3NQCA 4K2SA 3S0CA 3V36A 2QS8A 4RZ5A 3R7MA 4LB4A 1E6NA 3UJ2A 4F2TA 3R5EA 4MUZA 2W9MA 3PWIA 3T0DA 4Y8FA 3S47A 5AHFA 1TV5A 3P81A 3BLDA 3POHA 1P43A 1ZALA 2ATSA 2PDGA 3PTDA 2OKTA 1VEOA 2BHYA 1CZ1A 3WH8A 4FAMA 1KM2A 3OZMA 5MHBA 3SGZA 2JKPA 1Q65A 1XHGA 4C6JA 1QOXA 3LBMA 4TUFA 2QJMA 1GUVA 5CLTA 4GLEA 1HO4A 2DZXA 2VGGA 1CXEA 3DGBA 1XX1A 3QEZA 2VZOA 3N9RA 3MUCA 3UPMA 2P10A 1FA2A 4DWSC 3U9IA 2WOQA 1R2RA 1PX4A 4DYEA 4HYRA 4IJBA 3UWQA 2YCLB 4UC5A 1TVLA 2J9YA 4MPQA 3UZZA 3E12A 1RLCL 2FLIA 1K6AA 2GVJA 4IX0A 2A1YA 3NZ1A 5A6AA 3W72A 1XF0A 1EB3A 4Z0JA 5U4NA 5IFPA 4F9JA 2QJHA 4AXKA 1T7LA 2C18A 1R46A 2ZTJA 1OFEA 2PWHA 2PDWA 3QY6A 3EDKA 4MZ1A 1BYAA 3KOWA 5BWAA 2YIHA 3F5KA 4HB7A 5CZTA 3AS3A 4H19A 4AZGA 1AQ0A 1HO1A 4M19A 1UOZA 3E02A 1NQ6A 4QEHA 1ADDA 1AH3A 5C9RA 1ITQA 1JFXA 3MYPA 4GYKA 4GFSA 2E5DA 3M0YA 3ES7A 4BHYA 3C52A 4OJYA 1OT2A 4J35A 1JAEA 3T44A 4O1CA 3TROA 4JQ4A 5FESA 3H4WA 5TF0A 1KV8A 3MKVA 3LRMA 2WCAA 3CM4A 2HVOA 3U8GA 3ZOAA 2OQHA 5CSUA 6ALDA 1XBZA 3R58A 2GJPA 1KTCA 4TX9A 1L2QA 1W1IE 3LQLA 2J7BA 1ECEA 4E0CA 1VLIA 3NSMA 5MF5A 3JVAA 4QTGA 4XD6A 2G97A 3NCOA 5F2LA 1ZSXA 2HXUA 1H61A 1OHLA 3GKFA 1TWIA 4R9XA 1VYRA 3QY8A 4ZO9A 1HKMA 4BQ2A 1JGMA 1E1CB 1UHVA 1OD0A 3NQVA 4S3DA 4J3UA 4H8HA 1V79A 5E70A 1XDMA 4JDBA 2PDMA 4B4FA 5LIYX 4TO8A 4LFYA 4N9BA 3FLUA 1DV7A 3IVTA 2W0UA 3T7VA 4J7RA 3R8GA 3GX9A 1SJDA 2PDUA 4F0KA 3QV7A 3LMYA 1YBQA 1U1JA 3WDPP 4OT7A 1DPMA 3STPA 1LL4A 4EKJA 1ZCOA 1W6TA 2I9EA 2OSWA 1FWJC 3EMCA 4DJEA 3TU9A 4F40A 3BXWA 4J40A 1JPMA 1PZ2A 3IJ7A 1UR9A 5FOOA 3KRUA 3OIHA 2WJZA 2VRJA 3PPFA 3THDA 3RLHA 3PHAA 1UCWA 4JFSA 2D24A 4QS6A 5D02A 4IGNA 4J3SA 3KW3A 3CH0A 3H22A 3WQ5A 2CZEA 2Y5EA 3C2VA 1W3HA 4NNBA 3H7VA 3NGJA 4FNRA 3AHYA 2WJEA 2JBMA 2PWFA 4M5PA 1UYQA 3MDWA 3DEQA 4AIEA 1I60A 1UP3A 4K6AA 3N4FA 3O2LA 5CZJA 2NV2A 3P93A 4L56A 3VDAA 4YMZA 2QGYA 3IJ6A 4RZBA 1CPUA 1RCOB 4U5KA 3QKZA 3NZRA 4AD5A 3G1RA 1J0YA 1TUFA 3LLXA 1KXVA 4YLWA 1LWJA 4J3TA 4XIAA 1JR1A 3GS6A 4H04A 7ENLA 1BKHA 3CL6A 3COTA 4GIEA 2HV5A 3SQSA 3OP2A 3ZS4A 1HKKA 5I6SA 5JH2A 1PIFA 3L12A 3TFXA 1RQHA 5DF0A 3G0XA 4QG8A 3W29A 2ISWA 1DOSA 3SDOA 3ICJA 3EZ4A 4LTSA 2JEQA 2WKLA 4KWWA 1H50A 3OVRA 3SZ8A 3V75A 1F05A 1UWUA 3BG5A 3M16A 4P5UA 1XD1A 2P3EA 4CD5A 2CLPA 3O7UA 2VENA 3M0XA 3ABXA 1KD0A 3O15A 3NPWA 1QTWA 1W5MA 1VPQA 1E6QM 1C8YA 1CENA 3QGKC 4MVAA 4S3FA 4RR4A 3G22A 5AVNA 5H8PA 4NASA 2HBXA 2C79A 2RDTA 3EXRA 2PBGA 2WSRA 3HZ3A 1CB2A 1Y7VA 1FWTA 3AWOA 1QNOA 4HN4A 5EBUA 1BSIA 5DT5A 4QAWA 3DFNA 2NQJA 3TOYA 3SSJA 2OVLA 3VO0A 2OT1A 3PUEA 4K1WA 2BY2A 6CGTA 2HNEA 2CNCA 2QR6A 2V3FA 1D7KA 2B0MA 3B8WA 3UR7A 2GGJA 1QAPA 4XZWA 3PAOA 3C2YA 1B57A 1QHZA 4L7ZA 3VM5A 5H6HA 1PXGA 4XSLA 3QHNA 5C6MA 3EPNA 1JXKA 5DRIA 3O6DA 8CGTA 5A6BA 5KEZA 4A05A 3CV1A 4UNLA 2XIQA 3DHDA 4ORMA 3IK2A 4PFHA 1Q7QA 5AHMA 1VLWA 2RDWA 4JYEA 1OY0A 4TMBA 1RALA 2EPMX 3TQVA 4AYSA 1XPGA 2GQAA 3CYVA 3W2LA 3IAPA 5K9CA 6PTDA 5FEXA 5EKYA 2CZDA 4L65A 3LYEA 1J18A 3PSWA 4FO4A 2BASA 5A8QA 4B5NA 4L6HA 4GH3A 4JIHA 4JTKA 4EOUA 1VKFA 4C1NA 4HPGA 4RNFA 3ONBA 3UXIA 1L6GA 2WVSA 2DUAA 3N9KA 3O63A 4JTIA 1Q6CA 3A22A 1C91A 2CKRA 1XRTA 2J7EA 7ODCA 4QS5A 3KOZA 2J79A 3PZVA 4O1EA 5LA2A 2WNZA 4NJIA 2F84A 2QPSA 2E3ZA 1GONA 4UTFA 1UH4A 1SO6A 2XINA 3MMUA 1V6VA 1Q6GA 1W91A 1E6RA 3WMLA 4UNKA 3WKZA 4DUWA 1A0CA 4WOZA 1JPIA 3BLOA 3CTLA 4S3GA 3MKKA 1GVFA 3BCDA 1MRQA 2VKZG 4OVXA 3UQNA 3W2MA 2A3BA 4GQRA 2OGJA 3TWAA 4F4RA 2D2GA 3NM3A 5DFAA 3BK0A 3HQOA 3B9AA 3PUGA 4P7QA 5KZ6A 1CBGA 2V3GA 3S2CA 1HXJA 3BOLA 5LSMA 1MNZA 2QJGA 2P50A 3GXNA 1DXIA 1DE6A 1VYPX 3FXYA 4AC7C 3CS2A 4KIRA 1R87A 4AWEA 1N2VA 3JZEA 1GJUA 4ZSTA 4HNTA 3B0PA 4P7NA 3GQYA 4KRUA 2FJKA 4K38A 1OFPA 3B8IA 1BXNA 2HCVA 2PF8A 4JY9A 5A6KA 1W1TA 3PTKA 1EFZA 1IEVA 1F6PA 4J27A 1TJ1A 1O5KA 2OTDA 2D73A 1XLEA 2JIWA 1V02E 1ML1A 1XYAA 2YOCA 3ZMRA 5EL1A 2NXIA 2QMJA 1TTIA 3CUXA 2VDGA 1PPIA 1JDAA 1G4SA 1XIIA 4GBUA 3G1HA 2CITA 4BY3A 3M0ZA 2OYMA 8RUCA 4URIA 1PUDA 4W9TA 4JFVA 3EOEA 1XUUA 4XSMA 1RV8A 4CNSA 2INFA 4Q8VA 3OA5A 4H6QA 1YEYA 5HANA 1MQQA 1R7AA 3AIUA 1ONEA 4PUEA 1TPC1 1V03A 2HWGA 3VKKA 1XFCA 4GVFA 1XRFA 2R24A 1XYZA 4UCGA 3RPMA 3GSMA 3QYQA 4JS3A 3OBAA 1IT7A 1PKYA 1PYMA 2AMGA 3EWYA 4U5IA 3QQ1A 5JIPA 2VZSA 3WJWA 3AYRA 3PBGA 2X8RA 4LS2A 3LI1A 4P7OA 4IXHA 4UCFA 1HVQA 3WBAA 4O16A 4FXJA 3NYDA 4OECA 2VDIA 1MUWA 1IR2A 3EGJA 1YPFA 2EF9A 5AC8A 3GFYA 1W1VA 5EB8A 3W26A 1V0NA 1LYXA 1FXQA 3TMQA 4QCFA 3RNDA 4Y2WA 2G95A 3VZXA 1BG4A 1UD5A 4HU8A 3UPBA 4K7YA 3N2BA 1TPVA 1YADA 5I00A 2NQZA 1ZY9A 3DBNA 3O3RA 2G3NA 4DYKA 1LWIA 4MB1A 3VNDA 1PKNA 3VGFA 1LUCA 1ZFJA 3TN3A 5DN1A 2DPEA 1XQLA 1AZ2A 1MFVA 4QE5A 1VFSA 4DZ5A 1YDVA 3KCOA 4P8WA 2EBNA 4FP1A 1UKOA 2I9UA 2Z27A 3ALGA 3WX7A 3NOYA 2GGGA 4JKLA 3G8RA 4XUGA 4DWDA 5JBEA 1XYBA 5F4WA 1LQ2A 5F1UA 1TPH1 1O94A 5E09A 2SFPA 4V15A 5AYBA 3PB2A 4RPPA 1J4EA 4H3DA 5G1TA 5C9XA 1V8EA 1B3YA 1XGEA 1MW0A 4FZIA 2H8ZA 2OEJA 3BV7A 2R8WA 5DCEA 4PGLA 1OEPA 5K3VA 2WANA 1UR8A 1TV2A 4JTQA 1KFWA 1E70M 4Q4QA 1ELSA 1OYAA 1XLKA 1VR6A 3GNOA 3CUJA 4I5UA 5AECA 1T6MA 4AZCB 4RPQA 2W6RA 4WOQA 1BGAA 1FH9A 2HISA 3MDUA 1MVYA 4DXKA 3NZGA 4OZOA 4PRTA 2FVLA 3UETA 2XUCA 1OWQA 3BICA 3GR8A 2PC8A 4JTHA 3QN3A 4UB9A 3SY5A 1GG1A 2UZ9A 2WHKA 3WEZA 2BX7A 4QFUA 5HPOA 4DBEA 1Y5XA 2GFTA 5A2AA 3PZQA 2F6UA 1AMKA 3BQ5A 5EFDA 5CC7A 4O54A 4JCMA 2OYLA 3SJNA 4A6GA 3W1PA 2J8FA 3DGRA 3UVIA 1V0LA 3TNOA 4BR1A 3KAOA 2E4TA 1X7FA 2VGBA 3SCQA 1QDSA 3SSZA 2FH6A 3RPTA 4PH6A 5G2WA 1ZUAX 4GYPC 1UJPA 4D72A 4IGHA 4JDYA 3WBEA 1VHNA 3VGBA 1K9TA 3USZA 2GK1B 1Q45A 4M6UA 2ZZ3A 3KLKA 4LV4A 5I3GA 1FQ0A 2D0FA 1B4EA 4YN5A 4O1AA 4UZUA 2C8NA 1F6KA 4YNGA 1EOMA 4NIRA 7A3HA 1OQFA 4OUIA 4KW2A 4WDTA 2DZSA 1VBJA 3G5EA 2C7FA 4CKQA 4PN2A 3L4ZA 4HZ7A 4RKAA 3OO2A 2NVDA 3LHTA 1IWPA 1H7NA 4X3ZA 1KBBA 5K9XA 1WUEA 1E51A 3GNRA 2CBJA 2YB4A 1YQ2A 4O1DA 4U2YA 2FZ9A 5LIWX 3R10A 3BC9A 1BSLA 2MANA 4WGHA 1PB0A 1PHWA 2F2KA 4X0VA 3B9NA 3MV11 3HPAA 3R25A 4AD2A 4MMWA 3F4VA 3W85A 3I6RA 2CLIA 4B2DA 2Y7EA 3AJ7A 1LJYA 2G50A 2NLIA 3M0HA 3TTEA 2I5GA 3QH2A 4HPHA 1QO2A 4GBDA 1OZMA 1JCYA 1U1HA 5E0CA 3AXIA 1KGXA 4EPKA 3QRHA 4ZL1A 2VL4A 4PMDA 3VNJA 1LCOA 4NZJA 6REQA 1BPLB 1WKDA 3EWZA 3LCFA 1H51A 3G0SA 4OU1A 4Z2HA 3GVQA 4GGHA 3R4IA 4GISA 3WNPA 4TX8A 4LY8A 1GOIA 2XFYA 1M7PA 2J66A 5A2BA 2DVTA 4DO6A 4R3UA 3C0LA 4I6VA 1NFGA 1X8FA 3OVGA 3NSXA 2OU4A 5E9AA 2WHMA 3INPA 4EXAA 4WD0A 1T40A 3ZZ1A 1LT8A 1QT1A 1J5SA 2VFHA 4KCVA 4ATDA 3M7SA 4J2PA 4J9JA 2HK0A 1WAUA 3NPXA 2DVXA 1GQNA 1QR7A 2CERA 1FY6A 5LHEA 1CT5A 4IFRA 5BXTA 1WPCA 1W9UA 3EB2A 3K1DA 4WIWA 1GOQA 3QHOA 2IMRA 3PB0A 3LN3A 2PWDA 3QV6A 1YDOA 1NP0A 4TV6A 3B8SA 1TKKA 1Q7ZA 4QBXA 3QHMA 1JIBA 3UXAA 4KBXA 4JOMA 4O8AA 2X1IA 3BAIA 4GC4A 3ELFA 2IQDA 3RO6A 1Q63A 1IT8A 3HJZA 1YTEA 2G4JA 2QJJA 3UWEA 3LLDA 1SW3A 2PGFA 4AAJA 4AW7A 5G2HA 4A8RA 4EPBC 4LVGA 2QCCA 1YHTA 1F2JA 3U2EA 1EXPA 5CZKA 3H6OA 4H7VA 3PJXA 5F4SA 2YZ5A 2QCDA 1O1HA 3DYPA 1O12A 3R8HA 3NO3A 4YXGA 5CCZA 2Y24A 4GIRA 3W7DA 3PFMA 1WKEA 3W86A 4JYFA 3ZT5A 3K4DA 4IGMA 3PBMA 5EY5A 3EXSA 3IAQA 2GSEA 2Z7GA 1G67A 1R0MA 4RDZA 4W88A 3MP5A 1UASA 1VH7A 1J96A 3EPMA 3ECQA 1QW9A 3QC3A 2I5QA 4P61A 2DUXA 3VDGA 4ZQRA 3CUZA 3MVIA 4S3AA 2WCSA 3VIGA 4FLSA 4M7TA 4LAKA 2YLLA 1ESWA 2CLEA 1LTDA 4LNCA 2E09A 3ABRA 4KEUA 3WFAA 4S2CA 3S2LA 1E71M 4GUIA 3WFZA 1MEHA 3CEPA 3WQDA 1MQRA 2V5KA 1PSCA 3L4YA 5HMDA 5ABEA 4B5VA 5AOUA 4ZFCA 1IWBA 1TE1A 3URAA 2C0AA 2H9AA 4JHZA 5AY7A 4W86A 2OKOA 4M6QA 3URBA 3UEQA 2VCCA 3GHUA 3NG3A 1WO2A 1O5XA 3TC3A 4E3VA 4DRSA 1TRDA 3HQNA 1ZJIA 1LG2A 1Y5WA 2FPTA 4J3VA 3NSNA 3NEVA 1IZKA 1QK2A 3NJ3A 3O1NA 1SZFA 5BYWA 3W38A 5CPLA 5HK4A 1QPRA 1AA1B 3DH7A 1ITXA 4Q8PA 3URNA 3ITCA 1OSEA 1EF3A 1ADOA 4QJ4B 3QMTA 2YA1A 3QTGA 5GJPA 5I79A 3FS2A 4Z2GA 3AXKA 3U48A 1EGZA 1R9XA 5C5YA 5IBXA 1Q7MA 4QITA 1QBAA 4XAPA 3UG3A 3E2QA 1H0IA 4GYJA 3AMDA 3F1QA 3H26A 4ZO6A 3ITXA 4A8IA 2YW4A 3PBUA 3W7PA 2ZA2A 2RGLA 3IIZA 3VIKA 2BBFA 4WZHA 1P48A 3LXBA 2XH2A 4AY8A 3NQMA 3O6YX 2HPIA 1I9CB 1H49A 2YDRA 3BSMA 5FJUA 4PTNA 3KBWA 3RPDA 3M46A 3WNNA 4O50A 3FHQA 3SRDA 5HWJA 3P67A 3CZLA 3GH5A 5TQLA 2HZGA 2OX4A 1ITUA 3T07A 3NWRA 3W1NA 2X30A 1SSDA 3DFTA 3ARTA 3I65A 3T8QA 3SJ3A 4KF1A 3PZ9A 3W73A 4WVXA 4N42A 3WF2A 4A3QA 2ZKMX 2PU1A 1IXNA 1J9YA 5BMWA 3L4TA 4Z17A 3CQKA 4NILA 3TYAA 3V5CA 4AD0A 4GX9A 4GCXA 3APTA 2ZIDA 1P0KA 1TZZA 3Q45A 4LAOA 1Q2SA 4AVFA 1QXLA 4YU1A 2VEPA 2PDCA 3BAWA 2PWEA 4FXFA 2OG9A 3RX4A 4X63A 5CEWA 2O92A 3KBVA 2DVUA 4D6HA 1V6XA 4AF0A 3WF4A 4ERGA 1JAKA 1EEPA 3ABQA 3SGGA 1XH0A 3PS7A 5BXSA 2OT0A 5BMXA 3ZM8A 1YBQB 2VGFA 4NX5A 3NUKA 1QI4A 1EJTC 2CCRA 5I3DA 1Q3NA 3GBEA 3HOJA 3E0VA 4PTMA 1UKTA 2Q3OA 2ZX6A 5C7VA 3UNDA 1YMYA 3PBVA 4A22A 3AUOA 4YYFA 3M4HA 5CLWA 5DXYA 2XN1A 3HGRA 1UJQA 4NNCA 1G9HA 3CK5A 4BS0A 3M5XA 4LNYA 4B92A 1RSCA 3DKJA 1OCBA 4JTDA 2OR2A 1A5AA 1CXKA 3ZLHA 3VDCA 3GDRA 4G2DA 5KSWA 3LENA 3UBPC 2Y70A 2IUZA 4CCDA 1RBLA 3MANA 5DY3A 2BB0A 5HQEA 3TJXA 2AKZA 1S5MA 1BXCA 3E6EA 1KC7A 3CUGA 3ISIX 4FALA 4IMFA 3KLLA 1CI1A 3PVFA 5D03A 3I10A 2OYKA 3DIPA 5U7SA 3S83A 1SPQA 2PWVA 3DOPA 3EX4A 4PSRA 1L6SA 2G3MA 1IZJA 2JE8A 1POJA 2WAGA 3T2QA 4N4PA 2VT0A 2OCZA 1JVNA 3QXBA 4ICNA 2FHFA 3UWVA 1UKQA 4HU4A 3RRAA 3ZSSA 2ZTKA 1V08A 2UY3A 3ZLFA 1UD8A 5J04A 4MZYA 1UIOA 1S5VA 5C8BB 4ILSA 4AWTA 1K8CA 3OW1A 4ZGYA 5IOBA 3WH9A 1POKA 3KDOA 3IUHA 4C60A 1AJZA 3L5LA 1UZDA 3S1VA 1W8SA 3OA3A 5CZSA 3IUDA 4PUJA 1R3WA 3KRZA 1KO0A 5CPQA 1GOXA 1VRXA 4NT0A 2I7GA 3G8EA 1N8IA 1L8PA 1T8XA 1KXTA 2Z1XA 1Q4NX 3QYSA 1U33A 3SM0A 1EF2A 4I9AA 1SFSA 4E2VA 3BLLA 2PA6A 1S2CA 2QHAA 4TX6A 4X2RA 1O7AA 1NOWA 3I68A 5HDRA 4CNOA 3UERA 3R13A 4OE7A 5HJYA 1EDGA 2PFHA 3T42A 4KRZA 2ON3A 5LA1A 1E9ZB 3QC0A 1RQBA 4MY9A 1TV4A 1VFOA 3CEUA 2XVPA 1V7YA 4OGZA 1YNQA 4LYRA 4UTMA 2ACRA 4HNCA 2GYIA 2IKJA 4I7VA 2DEPA 5C70A 1R3QA 4Y96A 1GVYA 4XZHA 1WE5A 3VI2A 1FWSA 1ADSA 4REQA 3C0QA 4JR5A 4RV8A 4YCPA 5A6SA 1AD4A 1LQAA 4G7FA 3VNMA 2QUMA 2GDUA 5FIPA 4PTWA 2CHRA 4TOQA 2ZOXA 3TKFA 1J5TA 1OYBA 3PNZA 5DELA 3EWXA 2RJGA 4L61A 3NNTA 4JFWA 4ALDA 1DL3A 4MAVA 3NDOA 4RL3A 4OOZA 3WBYA 2XSBA 3U7BA 2X05A 1SO3A 3UR5A 2C6QA 2GJRA 3BGAA 1XSJA 1Q8JA 4PL1A 1W1B1 2P8CA 3C56A 3TCSA 3P6LA 4YTSA 3UP8A 3W76A 2I57A 1QOQA 4C1NB 4DLMA 4IPLA 4F0HA 2TRSA 4GABA 2J47A 3WEMA 3NEHA 3JUGA 1EH9A 1M6JA 1P0EA 2HQAA 5FSEC 5L9FA 2Q8LA 1C93A 1RVGA 1FVPA 3C3UA 4YCOA 3B8UA 3H2AA 2GPTA 1RK5A 3MSGA 3W37A 4ZCWA 5CBIA 3B0VC 2E25A 4RUBA 2ISFA 5I24A 3YPIA 3BMXA 4RZ6A 1RJPA 4R5EA 1S39A 1W5NA 5A6JA 4S3EA 4N0RA 1LOQA 3AQUA 4XTIA 3N14A 1UUOA 1JZ5A 4WDXA 1MQPA 4IQDA 2BGNE 1HP4A 3FNDA 2YYUA 4U10A 1SFTA 1ME9A 3TSMA 2PE4A 4CVUA 3F5JA 1CLVA 3WELA 3OIXA 1JXJA 4LVDA 5G5IA 2Z1BA 3WJXA 3CQIA 1DJZA 1UC4A 3N3MA 3LX9A 3XIMA 4AHPA 4UTIA 2GUYA 3SRHA 3DUGA 4NY2A 4US6A 2P8BA 1ZP3A 1KM1A 4MJ2A 2C1HA 2GLKA 4ZXOA 1LRTA 4GI9A 3KWSA 4FNUA 2WHJA 4MB4A 5KMYA 4QXIA 2ZUUA 4PL2A 5F2GA 3QOMA 3NVTA 3OTRA 4F0RA 3N73A 5E6YA 4BA0A 4PMXA 5CJNA 4H7ZA 3QLLA 2NX3A 4DJFD 4MY8A 4WJXA 1G5AA 4GWEA 3T2PA 4JYDA 5DBUA 3GDMA 5HR7A 2HVNA 3WLSA 4AHOA 4O0KA 3TW6A 2CXEA 2WMIA 2Z1WA 1TJ2A 2WNQA 1OD8A 4QX4A 4ZQPA 1REQA 4H00A 4FX7A 1Q6FA 3R0UA 1KTNA 4C65A 3K4WA 3TZFA 3R11A 1VPYA 3QR0A 2X1RA 5J5RA 3F7JA 1QK0A 1VS1A 1KW1A 1XIHA 5H8UA 3ARSA 1GHRA 1E4IA 5AHNA 5GNYA 4XKMA 2EPOA 1UG6A 3IIXA 1AH0A 3NIYA 1BEUA 3DC0A 4FHAA 4YPJA 1BYDA 4JTJA 1VEPA 3W84A 2VFEA 4YHGA 4H41A 2DDXA 3WQ8A 1GEQA 1GJWA 4BF7A 4TV5A 2D3NA 3K8KA 4HPNA 4JGDA 3QM3A 2E40A 3ANVA 1WB0A 1GVRA 1I2PA 1NQKA 5E0KA 1XLGA 3DHFA 5FAJA 4CU8A 3OGVA 4MJMA 3GVWA 2H3BA 1UWAA 4E4PA 1O5QA 1M1BA 2WVVA 2V2HA 4GVIA 3ZXWA 4O53A 3S5NA 1AH4A 3ZO9A 3MPGA 4IIEA 3EX2A 3LZ5A 4QLJA 2VC7A 3N2OA 3NQ7A 1GQIA 2W61A 4HP5A 2C13A 4I8DA 2PGWA 2EPLX 3RO8A 3RR4A 3W7NA 2Y61A 2QT3A 1E0XA 2G41A 4LW7A 4BJHA 1LUCB 4GINA 5HOSA 4E2DA 5AKQA 5HJXA 2QCMA 2TODA 2ZXAA 4PB5A 5DXXA 1FCBA 1H63A 2DV0A 1J0ZA 1KR1A 4IL2A 1O60A 4C6IA 4H9UA 1UC5A 1JZ8A 4YVPA 3GC4A 4DWSA 1US0A 2OFJA 2PB1A 1I0DA 3BTNA 4LUTA 3S6TA 3VCCA 2X09A 2CEQA 3M0JA 3G1VA 3LI0A 4N9CA 1S1PA 1XIEA 1UIPA 2FTPA 4W5ZA 2YYTA 2ZZ7A 1E73M 3CHEA 4K8HA 5I09A 5A6LA 1UD3A 3P74A 1CGUA 6ENLA 3BMVA 1C8VA 2E6AA 1V4YA 2GWGA 1VFTA 3WQGA 2WK2A 1HG3A 1PHQA 1J10A 4Q8TA 3DFHA 2BTMA 2OB3A 2DT0A 7TIMA 4GY7A 1B9ZA 2GGEA 4GVHA 4UTTA 2WWCA 2NXHA 4XK2A 2F61A 3KDNA 2QCLA 3KVMA 1W1A1 4AIOA 1KKRA 3TSBA 3II1A 3UZWA 3WCZA 4JIIX 4JN8A 2PLCA 3E49A 2GUBA 2VX5A 4ECLA 4OFCA 3I7RA 1E6ZA 1CTNA 1EOKA 3DG6A 2E6DA 1S46A 4TVUA 3LTSA 1G7VA 4JIRA 4H6KA 2D2OA 2PLKA 1XW8A 1D8CA 3SCRA 3UFYA 2EQDA 2I1OA 1AFSA 1ZHAA 5K4ZA 4DJDC 1JCXA 3WQFA 5E9XA 4H9TA 2FVMA 2QVNA 4RE3A 4E6MA 1VAHA 1HL2A 2ZZ5A 3EKLA 5AZ0A 2J6XA 1YPXA 3BAYA 2FZDA 3T08A 1DKWA 3GUGA 2VR4A 3IV8A 4V33A 3U2CA 4NJHA 2WPBA 1ENUA 1O68A 1K9EA 4Y9MA 5CSSA 1A5UA 5CAHA 4NNAA 3ZR5A 1XWYA 3GKAA 4C91A 4DJED 3LLFA 1M7XA 5T91A 3P14A 1GVQA 1PBGA 2RDXA 3VNIA 1EXBA 3O0FA 1TVNA 3A13A 2ALDA 1JUKA 3E1F1 2PDIA 2ZWZA 4INFA 4M82A 1OGGA 3UJSA 1KM5A 1XYCA 2O0TA 2CZFA 3M5VA 1E43A 2X7WA 1G7UA 2GWNA 3IGHX 3PWAA 1QMLA 2ZBTA 3WQCA 3LRKA 3B03A 4UR8A 1TPDA 4DJFC 5HR6A 4IUOA 1Q66A 2AGTA 3TTQA 4EP8C 2ZRUA 9XIAA 4PMNA 5DCBA 3FA4A 4JXCA 1F61A 2VNCA 2XPKA 1N55A 2E8ZA 3NAVA 4AEOA 1B54A 1Q6DA 5H1WA 2REQA 3DG7A 5IRPA 2DZVA 4ZFMA 1US2A 3H12A 2V9DA 3MV01 1BRLA 3VNLA 1BVWA 1ZCCA 3ARRA 1TV8A 2ANUA 4HJWA 3BZJA 3W1XA 3WK3A 4LWWA 1HJXA 1ZGDA 3HM7A 1FKWA 4CEUC 1ZTVA 3B04A 2A3HA 3W74A 4DVOA 5GJMA 1SZRA 1L6YA 5B7ZA 4C6CA 1TJRA 4DUVA 5CQ1A 2X1TA 4XZLX 1WP6A 4B5SA 2Y2WA 4MDOA 6REQB 3DXIA 4B91A 4US5A 4HHHA 4KFNA 1TR9A 3LRLA 2OZ0A 1UBPC 2GVGA 3RU6A 1I8JA 1DJHA 3W01A 1M53A 1HX0A 1AVAA 4CN1A 5FF7A 4DAFA 3OOQA 3QV8A 5D2TA 2BOFX 1EC8A 3A47A 4WDUA 6TAAA 2WC3A 4W7VA 4DXXA 4LYPA 2DZTA 1XP3A 2C0HA 4ACZA 2FZNA 3AIRA 4H2HA 4C6EA 3RU8X 3CAKA 3G6MA 3W1QA 3L66A 5GVJA 3MP4A 2GUUA 1JRBA 4UFIA 4V1XA 3VU2A 2F7FA 1OF8A 4HIBA 2WSQA 2YX0A 3QPEA 4TVDA 1QFEA 4BEQA 5HNUA 3VDHA 2XN2A 3DFOA 4LC6A 1I45A 2DZAA 1SFLA 3DCPA 4FLOA 1GJPA 4CCCA 2NV1A 1QVBA 4ERIA 3DKLA 4JNYA 2BWGA 3GIYA 3P8IA 2BS9A 2WMKA 3A12A 4FF7A 2I14A 2V3EA 2UY4A 3H53A 1X1NA 1FWFC 4H8UA 3FGCA 3VMOA 2J7CA 4EVZA 3N18A 3KP1A 1FFQA 4IP7A 2QDGA 1YTKA 1BWVA 4FNSA 3AXXA 1NELA 2QCDB 3RHGA 5LGZA 5BOFA 3P84A 4ZB0A 2E5CA 5FKYA 2R1MA 1ZP4A 2EPNA 3RILA 3N19B 1WV2A 4NVTA 5I02A 2NWRA 3RCYA 1DJYA 1Y0EA 3WUFA 4MNKA 4GK8A 4GKLA 4J1OA 5HMSA 1YXCA 2OWCA 4NU7A 3SCSA 4AZHA 4ZR8A 4LVAA 3A3WA 2NV9A 3OLDA 1PTDA 1K8ZA 3H2OA 4C6NA 1AD1A 4U3AA 4AUBA 2FB2A 3UXDA 3NO1A 2YCEA 2WZEA 2D69A 1ISYA 2Q01A 2IXVA 1W9DM 1MDRA 1EO7A 2QUVA 3RM9A 3LCXA 1ICPA 2O4MA 4E38A 2A5HA 5ECUA 1LORA 2Y8UA 3URQA 3OPSA 2PSNA 3CV7A 4XBKA 2PGRA 4PULA 3TVAA 5C0QA 4HMCA 4XAFA 4XISA 2Q71A 4Q4RA 3IVUA 3MUY1 1FX6A 1B4KA 2VEIA 1NF0A 3DU0A 3WJSA 2H9AB 3T0AA 1A3XA 3C2OA 4S3KA 2YKKA 1FRBA 3OQEA 3WD0A 3FDGA 2OZ3A 3LDVA 1R3VA 1EZWA 3QVQA 2PRLA 3NGFA 2I16A 4HNOA 1QW8A 3WYZA 3UXKA 1FP8A 1VFUA 3JU2A 2EO7A 3W9ZA 3U4FA 5AYYA 3K30A 3NYZA 4LAMA 4HZ6A 1D8WA 1RY0A 4OWGA 3UR2A 3G2GA 3KUMA 2GGIA 1UMLA 2GVEA 1DXFA 2CLOA 5IDIA 3PZIA 1U83A 3VUPA 2DJLA 3A4AA 4XBSA 1RPKA 1A80A 4KS0A 1OCQA 2RKXA 1NFPA 3W2NA 5M5DA 2Z24A 1CXLA 2XISA 3GZ3A 3M41A 1QATA 5BXPA 2A6NA 3EEGA 1DIOA 1C9DA 2WYSA 3UZYA 4GPNA 1RCXB 1SJBA 3TMLA 1GKPA 3MSYA 1VJZA 3WQPA 3FAXA 2DIKA 3TN4A 3IGXA 2WMJA 2YL5A 3S2MA 1JZ4A 3MHFA 3VZZA 5D8ZA 3DYOA 4DZIA 3NDZA 1NDZA 1UUQA 1W3KA 2DGAA 2Z00A 1K6WA 3PNUA 2QVHA 3AZSA 2D20A 4GNKB 2VX4A 1PIIA 3PSVA 1LDCA 3P60A 2OSYA 1GKQA 2WXDM 1Y8BA 4DPPA 1XI3A 2FYMA 5FJIA 5HUPA 3AOFA 1CIUA 4UFHA 4UFKA 4BQ5A 1OX6A 1K7FA 2XG9A 4ONVA 4JTEA 5FEZA 3UW6A 5BNKA 1Q2RA 5XIMA 1HTIA 2P3ZA 2WBKA 3TC7A 4I3GA 1LLOA 3WLKX 2O7QA 3MZNA 4XAZA 2Q8ZA 2NSOA 3Q67A 4QSHA 3KS6A 3U5UA 1XM3A 2ODOA 1X1OA 1VBUA 2YGYA 1YKWA 4BQ3A 1SZGA 4FSAA 1OABA 4LAUA 3MUZ1 1X7IA 4RK8A 4R7JA 3SO7A 2HNHA 3G1DA 1N7KA 4R9OA 1KQYA 1FWBC 4Z1AA 3KRSA 5I3IA 3NO5A 3I3BA 2A85A 1GKRA 3GVRA 3M6DA 1JDCA 1EUAA 3FXGA 3OYXA 4C6LA 3LGDA 4LBRA 4CUCA 2HTMA 4AF0B 4JHOA 2G3JA 2A79A 1IF2A 3BQ6A 3KHDA 4Z42C 3QR1A 5B80A 5KINA 3MI2A 3HTWA 4GACA 1IEWA 1BG9A 1WDDA 3PZGA 3FJNA 5A1AA 1W5OA 4ZQMA 1FWNA 3D3AA 1C92A 4EX4A 3NZQA 3CZJA 1JDDA 5J8LA 5CSYA 2PTWA 2W79A 1KFCA 2CLKA 4NF7A 2J88A 3AIWA 4YS1A 3P8JA 4C6OA 1A5OC 4TTUA 1JNDA 3HBLA 2EKGA 2J24A 4ML4A 3VMNA 4DI8A 1CXHA 4HHMA 1VFHA 1N8WA 2Z2UA 5HJLA 3TQPA 2Y5JA 3BG3A 1XINA 3N2MA 4IP5A 4KCTA 4A29A 3VIHA 4P8VA 1HT6A 4GC3A 4HOXA 3MMWA 1CGWA 3TR2A 1Q13A 4PCNA 1W1PA 3VOGA 1RD5A 1PEZA 1FTXA 2HBVA 1PWMA 4F8XA 4WUIA 1DWHM 2JALA 4CNUA 1GOKA 1MZRA 3MZ2A 1FWIC 4K36A 3CZ8A 2HEJA 2YBVA 1RK6A 5KETA 2GJNA 3VC5A 1SZNA 4OTKA 5CZ0A 3OLGA 2XHYA 3WMBA 1JPDX 3TYZA 3BLEA 3VOHA 3MU7A 4NUWA 4L5ZA 2VFDA 2R94A 4C1KA 1HZYA 5LA0A 1FKXA 3VIIA 2XJ7A 1ZZMA 3ZQ9A 1RHCA 3QPZA 3B0XA 4PZVA 4O13A 4NI8A 9XIMA 1XSIA 2B81A 2ONEA 3V0SA 1WCGA 3BW4A 2DUZA 5CGQA 1V7AA 1WNOA 4NSBA 2AOSA 2XM1A 3TYUA 3W2JA 1G01A 7PTDA 1GOWA 2J78A 3W7OA 4FI4A 3HF3A 4MB3A 3FSUA 3TYBA 1DYSA 1E3ZA 3AC0A 3UA4A 1ZBWA 1W9XA 5M3WA 2CLMA 3TSDA 2Y63A 1IR1A 1UZHA 3LSCA 4F3HA 3M7WA 1G4EA 4IICA 4RW5A 5IM51 1O5RA 2D3LA 3H2NA 4NAEA 4ZEPA 3AIVA 2VR5A 3GFZA 1TSIA 4AXNA 1UR4A 4POCA 4BK9A 1TB3A 1LM1A 2HRWA 4RNIA 3EWUA 2ABAA 3VYLA 3MJYA 3RM8A 4K39A 3AHTA 5D30A 3M9YA 3JW7A 4CN6A 1H1ZA 4FR1A 1WDWA 3T8LA 3EMQA 5LYRA 3UWZA 3EWCA 4IF2A 3TW9A 5CPMA 1Z32X 2O9OA 3WJZA 3AUJA 4HZMA 1OYCA 2ZZ2A 4JTLA 4REQB 2PODA 1XH1A 2CBVA 1C8XA 4XVDA 1XYMA 3CZKA 4RX0A 4JTCA 4KGJA 1WAWA 2FVKA 4PRRA 1QI5A 4JQ1A 2W27A 2NUXA 1EJVC 2C91A 4DNMA 3KTCA 4PUNA 3E3HA 3KL5A 3KTXA 5FEPA 3ZVHA 1RD6A 4WKFA 4LT9A 3DYMA 3GTHA 4AEEA 4CEXC 2QYGA 2NVAA 2V69A 3NL5A 4N4QA 3LB0A 4WSHA 4I7WA 3Q94A 1EP3A 3RMJA 3CUFA 4KEVA 3ABSA 2EPKX 4NZ3A 4FIRA 5KTLA 4LRTA 5KITA 2QEZA 3P5YA 2DH2A 4O14A 5IXEA 2WKGA 3RX2A 3LM3A 4BQ4A 4JTUA 3N6QA 1QUMA 3N6JA 3AS0A 3FV9A 5FA5A 2KX9A 4XKYA 1VZWA 4M81A 2WKJA 4R88A 2OEMA 3AIBA 3VD4A 3S1UA 2B31A 3C0SA 4E8CA 3NQBA 4DBWA 2ICSA 4L9YA 2KAUC 5F1VA 2DY3A 2GSHA 4L1XA 5DO8A 3ANUA 4DUXA 4ZQOA 5JUVA 3SBFA 3NL2A 1V0MA 2YDQA 4XB3A 2XU2A 3GU2A 1CXIA 3MY9A 3M6YA 4UMBA 3S5SA 4JTTA 2VEFA 4FEZA 4PODA 9RUBA 4RXGA 3GG1A 3W23A 1V3JA 3ARZA 3S1XA 2VM8A 4EPEC 3PBWA 3MHGA 3TJIA 1X97A 3ZR6A 3THUA 1MFUA 3S46A 4LX4A 4ERAA 4D6IA 1JNEA 1L6WA 4S38A 3O6CA 3VCRA 3CU2A 5CPOA 2WSPA 3G6LA 1EJUC 3MTWA 4HNLA 1TIWA 3WIJA 4JFTA 2GDQA 3QSRA 4PMQA 2DJXA 3QZAA 3N25A 4LRSA 1Q6RA 1V51A 2FHCA 4Q4PA 4G56A 3UY7A 1K9FA 3SN0A 4QRNA 3PUOA 3CMJA 3CB8A 5I3HA 4KEMA 5I07A 2PDPA 4YVVA 3WO8A 4M3PA 5E0FA 4F79A 3BJSA 4JICA 4DZAA 4UQAA 3UPWA 1EX5A 4XX6A 3ARVA 3LPPA 4UOQA 3T1GA 4BI7A 1L8NA 2AAAA 4XD3A 1YXDA 1XQKA 2VZTA 4WKHA 1I2QA 3EX6A 1FHLA 4Z2LA 1XCXA 1V77A 1DVJA 1TR1A 2O55A 3STGA 3DFPA 3OLIA 3GVGA 1W1ZA 2ISSA 4ZODA 3BARA 1EO5A 1RJRA 2V63A 4NXKA 2QIIA 2WMIB 4AZIA 3GH4A 3ME3A 3QBUA 4M24A 1TX0A 2INEA 3DFSA 2J13A 2V68A 1REQB 4IPIA 4X9SA 5JIWA 1A53A 5PTDA 4LAZA 3ENLA 1KQZA 3W7MA 4V28A 3NQDA 4Y9AA 4WSKA 5D9NA 5I7GA 1G1YA 2QKFA 1OJXA 2IKIA 1LL7A 3CO8A 2FJUB 5HATA 5CJMA 4ZMGA 1H09A 3MI6A 5I0DA 1A0EA 1UD2A 4PBGA 4UTKA 2ZX8A 3XINA 3N15A 5HMEA 1GK8A 4MWAA 3M5ZA 2OLHA 3BJTA 2PGEA 5CSRA 4IMGA 1ME7A 3H2FA 3LG3A 5LXEA 4TMCA 2XSAA 1E0TA 3DN5A 4QG6A 2J77A 1P7TA 2PS2A 2A3LA 4DF2A 4IG2A 3P3BA 2QXWA 3I6EA 4O0ZA 3BAKA 1JJKA 4B16A 2E6YA 3N4AA 1GOMA 1KRMA 3SURA 2WVVB 5D33A 1R3YA 3TN5A 2AL1A 4C6FA 2ZADA 5C2CA 1F73A 1XLCA 1JPKA 1V3IA 3WBWA 1K3UA 1LRNA 1E40A 5FF0A 3QLDA 4HT3A 3VE9A 4GJIA 1BAGA 4DO5A 3PK7A 2VC6A 3GZAA 3ITGA 3CLWA 5K9DA 3AO0A 3A4JA 3CAQA 1VFFA 4NL1A 3E74A 1B3XA 1XRVA 3CQHA 4I8YA 4LH8A 1EWDA 3GAYA 3N13A 3W2KA 3GTIA 4DWSB 4PB3A 4LUTB 5CAKA 3FVMA 3L7RA 1H3GA 2XZ9A 3MW7A 3E2SA 4NZFA 3NZPA 1GVOA 3TN6A 5F7UA 1EC7A 4DX3A 1FBAA 4GE8A 3GXIA 4XTDA 4F2BA 3U5YA 1S2TA 2IPFA 3F4WA 1OC5A 3W2UA 5G4WA 4ZTYA 3I4KA 1AODA 2AQWA 5A8NA 5CPNA 3T78A 4UTUA 2TAAA 4RCXA 2NXGA 3CJPA 3USBA 1SQ7A 2CWNA 5B7YA 1F5ZA 4C90A 4O28A 3FJLA 5TNVA 3WLRA 1JD9A 2VYOA 4C6BA 4JCLA 3R2GA 2O9TA 3SCUA 1H2JA 5AC5A 1EYWA 3TR9A 4ZENA 4GJJA 4YWIA 3OG2A 4ZB5A 3T0CA 3SFKA 4ATLA 4LF1A 1TWDA 3ALFA 1JF6A 1MYRA 4HOWA 1GHSA 1KBKA 3SIZA 3H7RA 1XCFA 2BY0A 1NSJA 2C16A 2XZ7A 4DPQA 1IIHA 4JTAA 3QFWA 4AEFA 1I2OA 2QLYA 4PFMA 4EPDC 5IFTA 1E15A 3AMKA 4FXSA 1SM9A 3GG0A 3FSTA 1OG0A 5LIKX 5GPRA 3QY7A 1WXYA 3W1RA 1FHDA 3EPOA 4GD0A 2CESA 1C9WA 3NQFA 3REQA 4V27A 3TYCA 2YR1A 4NQ1A 3KBNA 2BOEX 3W7GA 2OQLA 1UQYA 4D8AA 2YA2A 3EOLA 1U5VA 1TREA 2GOUA 1K8YA 5FD0A 4MFEA 2NQHA 1CW2A 1ZAIA 3PFRA 3GXFA 1AL7A 1QNVA 1W8GA 1KFKA 4XD5A 1UPMB 2WW5A 1LQ0A 4UQEA 1CX9A 3PPGA 3AXMA 3HB9A 3KWXA 3C3NA 1NF7A 3CPUA 1C29A 1DIKA 4K37A 4CQCA 1JRCA 1TZ7A 2HPMA 2O9RA 1IXQA 3U57A 1OK6A 4G6CA 3LGGA 4N7QA 5I03A 5HNRA 4OBRA 4ACYA 4WGXA 3AZTA 4W85A 1J6OA 1IYXA 3ZJ7A 4W93A 3E0LA 3QW4B 2NQLA 1K77A 3Q58A 3UCDA 2XSXA 3H2CA 5BRBA 1AQHA 2REQB 2W5FA 4LYKA 1THFD 3WD4A 1XG3A 3KRBA 1EBGA 4QAIA 4L80A 1BRLB 4PUUA 3V0UA 4XBJA 1ZBKA 1OBAA 1VBHA 1H11A 4W4QA 2H90A 3DI0A 1W3IA 4RE4A 4LS1A 3RM4A 2PD9A 2XN0A 1XGZA 2YDSA 4WXZA 4WEVX 1Q8AA 2X1UA 1LG1A 3A9IA 3CGTA 4O8RA 2OGYA 4KESA 4XWUA 4HZ8A 3FIGA 1W2PA 1YTDA 1SMAA 1JQXA 5D2XA 3IVSA 1NTHA 2ZX9A 3L2LA 1SO4A 4PC8A 2Y7GA 3VILA 1DXEA 3PJWA 2BMBA 4ICMA 4WR3A 4AB4A 4AG0A 3CWOX 4C6MA 4A8NA 4ATWA 5H91A 2DSUA 1ZPTA 3CIWA 2GGHA 3TAOA 3H4XA 1HJWA 1OFBA 4FX8A 3L9CA 3SCTA 3PPHA 1HQTA 2F38A 3HG2A 3TFCA 4ACZB 4LJ3A 1TIMA 4ZSUA 8XIAA 3P5ZA 5DMMA 3TV8A 2E6FA 3Q2DA 2WMFA 4GI8A 5C2GA 2CHOA 2Z25A 3GM8A 4G1KA 4AHQA 2F2HA 3IARA 5M17A 4Y9NA 3B97A 6TIMA 5DQPA 4PE8A 1E56A 2PD5A 1H5VA 3QFEA 4L1WA 1U22A 3HQ1A 3FDKA 1O95A 2OZ8A 4S1FA 2RGMA 2DW7A 3WUEA 1KNWA 4KMQA 4O1BA 4HPJA 1YDNA 2D0GA 1ODUA 3WNKA 3FGCB 4ZE5A 4YVXA 2BNJA 4K8GA 3W88A 5HNTA 2OQYA 3IGSA 1QHOA 4OV9A 4L6OA 4AISA 3M0IA 3PZMA 3W6YA 4GO8A 4JZ5A 3W07A 4ZOAA 2VUNA 1NWUA 1SFJA 1UH3A 3B8TA 4KQNA 3SR7A 3GC5A 3HURA 1E5NA 5AYIA 1JI1A 4IQJA 2J6VA 1YE4A