3C56A

Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(3-hydroxypropyl)-glycolohydroxamic acid bisphosphate, a competitive inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
307
structure length
297
Chain Sequence
MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIAVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Synthesis and Biochemical Evaluation of Selective Inhibitors of Class II Fructose Bisphosphate Aldolases: Towards New Synthetic Antibiotics.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 112
structure length 297
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c56A00
1QPQA 1ZALA 3LLDA 2H3DA 3EX3A 1QWGA 1T96A 1R47A 3IIXA 5AHFA 4UTKA 1S5TA 5D2WA 5KINA 2V5LA 3H54A 3P74A 3N2XA 5HQEA 1F73A 4JIQA 4NZFA 3NOEA 4UR8A 3W1XA 2VFIA 3NQ7A 2D73A 3V75A 2YDAA 3ATZA 5AC8A 5EKYA 4QQ3A 2VFGA 4K38A 3QMRA 3TJLA 1EUNA 1UUMA 3A24A 3W1PA 2DORA 1YXDA 3S5NA 3FOKA 1AW2A 3M5VA 1MEWA 2ZRWA 4Y96A 1W56A 3F1QA 3W73A 1VJIA 2X1TA 3MI3A 3CB8A 1LRQA 2W79A 1OFQA 1I2OA 5I3FA 2FDSA 1SFLA 2FB2A 3LTYA 4ZQCA 1TTQA 5CPLA 4GJ1A 2VENA 2ZRXA 3W2NA 1JQVA 2GVLA 1RV8A 1YADA 2A0NA 1JRBA 3GXTA 2C3ZA 2B7OA 5HWMA 2V2CA 1ICQA 4MPQA 2JKEA 1MO0A 1UASA 3W7QA 2XN0A 4FEZA 2ZDRA 1L6SA 2QDHA 5HINA 1RQHA 3WK1A 4H3DA 1ZNNA 1K7XA 2Y7EA 1K02A 3CEPA 3NVTA 3RLUA 3W7LA 3W23A 4LC6A 3UZJA 3L9CA 3IGSA 3MP5A 1R2TA 4OGZA 1YPFA 5FF0A 3OBKA 1XFBA 2DZWA 1XBXA 4MZ1A 1PCWA 4RXFA 2ISVA 4BWLC 1M6JA 4JYDA 4MIMA 4NU7A 3FIGA 2NX9A 3NYZA 4FX6M 3W76A 1KFJA 1H7WA 1WAUA 2G95A 1I45A 3TQKA 3W07A 2YFNA 2HMCA 3NL3A 1XC4A 4CLMA 1WOBA 3N34A 3Q37A 5D38A 5HULA 3W83A 1QOPA 2FB3A 4EIVA 4O57A 4TO8A 1KBIA 4GBUA 4IX2A 2Z6JA 2VOMA 3GVGA 1SO3A 4AHPA 2QDGA 3EWYA 2WNQA 2X30A 5I3IA 4TU1A 3NQAA 3E02A 3PS7A 3TMQA 2ZRUA 3W88A 2YSWA 2DZPA 3I6RA 4WY0A 1ICSA 4FNPA 3BLIA 2E6AA 2PC4A 1VCFA 4MJZA 1T8XA 2VELA 4MVAA 3SECA 4Q4KA 1SZEA 2X1UA 3BLEA 4WX2A 4HNTA 1OFRA 3BG5A 4RZ4A 3QPYA 3NPUA 2BLEA 1TPB1 3NA8A 3UY7A 3O16A 2GVGA 3TNOA 2V5BA 1FY6A 2EAWA 1LYXA 5D2YA 3EX6A 1NEYA 3S1UA 2FLIA 3SGZA 3TJXA 5FF3A 1TQXA 1FUYA 3GK0A 3GKFA 4UC5A 4RLIA 2WKJA 3O6DA 1OFBA 5I3GA 3KOFA 5U4NA 1H7NA 1R46A 2WNNA 4UTWC 1W37A 4JX6A 1BKSA 4O28A 4DQWA 3L65A 4ALDA 5CG7A 2XFWA 1IF2A 1GZGA 4S2CA 4JY8A 2QUUA 4IMGA 2E77A 1RQBA 2J88A 3TUUA 2OT0A 3TR2A 1HO1A 5T26A 3LXBA 5CZ0A 2J6XA 2VFDA 3NQCA 3W84A 2QJIA 3FLUA 3BVJA 1TPH1 3S8HA 5EA9A 3DZ1A 2ZA3A 3BG3A 1LTDA 3UPWA 3W2UA 3SSJA 3W86A 5IBXA 3ABRA 4S2BA 3TCEA 1LZOA 1W5NA 2E68A 4Z08A 1F05A 3L2IA 2X16A 2X1RA 5LZLA 2QCCA 4U28A 3LTPA 1X1OA 2V81A 1I2NA 3RMJA 4JYEA 1H60A 1W3NA 1ME9A 1OFDA 2DZSA 3FJLA 3LBCA 3QFEA 3BW2A 2A85A 4E0CA 3W7GA 2EKCA 2ZZ6A 1VYSX 3M5YA 1OFEA 2QUTA 3W3OA 1XDLA 3NQ2A 2FJKA 3LB0A 1UCWA 3RFAA 3M5ZA 5D2XA 2R94A 3UWQA 3QJAA 1LBLA 4E38A 1K8YA 2C0AA 3DI0A 1TPWA 4PTNA 3NL5A 1BEUA 1FWSA 2C14A 1TCDA 1GVRA 3IVTA 5HJLA 4I7VA 3WJXA 5FESA 1MEIA 3TH6A 3ABQA 3NQFA 2GQ9A 1KV8A 3W7HA 3C2RA 3ZWSA 4NJIA 2Z6IA 2NV2A 3CIXA 3LHTA 1EX5A 4RX0A 4BI5A 3SY5A 1JCNA 2C6QA 1G6CA 1WX0A 3CLMA 1DBTA 3FS2A 1QFEA 4GRSA 1G4EA 1H62A 4JTLA 1KM6A 3FYOA 2KZHA 1LP6A 4NX0A 3TW6A 3NPVA 1W5QA 1LLZA 4YWIA 4R53A 1W3TA 4IGHA 3TE9A 4FNTA 2Q8ZA 1AW1A 5AHMA 3LCLA 4GUGA 4Z1BA 1NVMA 1YDVA 4HKPA 1OX6A 1W54A 3L5LA 4FNSA 2B7NA 2CLFA 1XUZA 3G0SA 3CEUA 2ALDA 3H55A 1WYIA 3S5YA 2Y7DA 5EPDA 3O1NA 4O50A 5D09A 3NXFA 4L4MA 4M7TA 1YTKA 3G18A 3QQ1A 2JBMA 3QMSA 1VCVA 5F4WA 1SW0A 1AMKA 2NXHA 3NNTA 2QEZA 2J9YA 3GIYA 4L4LA 3HPZA 3P8IA 1L6YA 2ZA1A 1VPXA 5GVJA 1JCXA 3QPZA 1M7PA 2FPYA 3E12A 1SW7A 3D0CA 3BK0A 5HR6A 4XUGA 4JYFA 4UTHA 3TDFA 1PVNA 2ZCGA 2GQ8A 3T78A 4MYAA 4CNPA 4WUIA 5D37A 1G7UA 3C2OA 3NZRA 4PA8A 3UNDA 3C56A 1XBYA 1XDMA 1JUEA 3CPRA 3HPXA 1RR2A 3GB6A 1RD5A 1TRDA 3IIVA 5AYXA 4R33A 3EWXA 4QM1A 3HGJA 2NX3A 4IPIA 1GQNA 4LVAA 2WSRA 4X22A 3M1ZA 4N9EA 1F6KA 2R8WA 1YLVA 2VFFA 4DO5A 1QDSA 1YXCA 5CZTA 5F1UA 3KVMA 3O06A 3PBYA 2I1OA 1QR7A 2V2DA 2EPHA 4HSOA 3FYPA 2B7QA 4BWLA 4XBKA 1ZCOA 2J27A 4WY0B 3MYPA 3DGRA 2CZEA 1YDOA 4JDBA 2FPVA 4XQ6A 4RKAA 3LHVA 1TTPA 1SO5A 2A7PA 5DBTA 2RHGA 2QCNA 5DCDA 2ZZ1A 4O54A 2WOQA 5AC7A 3S1WA 4FX8A 1IXQA 2DZXA 1IXOA 1JUKA 4GUHA 3Q2DA 4LWWA 3TV8A 3W7RA 4XWUA 2QUVA 3E9AA 5DXXA 1X8FA 3PBUA 1Q3NA 3S42A 5C55A 1KTBA 4GXMA 3EX4A 3S5ZA 4QJ1A 4FIRA 3LI0A 3NQ6A 1OVDA 2WJZA 1JJKA 2CLIA 3IVSA 5A8GA 2RH9A 4GUFA 5IBXC 4S1FA 1SU5A 3C2FA 4XTIA 4RR4A 4HNNA 1VLIA 2AAMA 1F2JA 4UMAA 5DELA 1S3HA 4LS2A 5AYYA 5A5WA 5IM51 3A22A 1TTIA 3DU0A 4K7VA 2Y62A 3KAOA 4MY9A 3WJZA 4IWWA 4QNWA 1SFJA 2A6LA 2QAPA 1A53A 3KRUA 1SR9A 1LRNA 3L0GA 4IJBA 3CT7A 2C19A 1JUBA 1JCMP 1RZMA 3DHDA 3M6YA 3LBMA 4IMEA 2C13A 3GZ3A 1G67A 2ZA2A 3HO8A 4IQLA 3WK2A 3B05A 4AWSA 3HIJA 4PFMA 2JK2A 3MHGA 3G1FA 3G1VA 5K9DA 3GDKA 3MWAA 4JTTA 1TV7A 1V7YA 2GUUA 1QNVA 1J2WA 5CZSA 4LT9A 1YTEA 3R12A 1DL3A 1EWEA 3GLCA 4DBDA 4ONVA 3W9ZA 4OT7A 3NO5A 2G5WA 1GG1A 1TB3A 4ORMA 1XL9A 4M19A 3P60A 1VYPX 3MBFA 3DFOA 2YW3A 1VRDA 5E1QA 3EXSA 3W22A 1Q6QA 3NL2A 1ZAHA 3MHFA 1LOLA 4HN4A 4AWTA 4LRSA 2ISWA 3DH7A 3BLFA 5HNRA 1QAPA 3N3MA 4H4IA 1P4CA 5F4SA 5AHEA 1CX9A 1TPFA 3B4UA 3ABSA 3NEVA 1HG3A 4O1AA 3VKJA 4AVFA 5FF2A 4TIMA 1LOSA 4LVFA 3E96A 4M7SA 1C29A 5F1VA 2Q3OA 1E51A 4O1DA 4MZ8A 1G4TA 1TPC1 3YPIA 2H8ZA 1OHLA 5AOUA 3MI2A 4O8RA 4JD4A 5LNUA 3MP4A 3DFSA 2F7FA 2CZ5A 3F4NA 3T55A 1HL2A 4LC8A 2RDUA 4LY8A 1ME7A 3BW3A 4PH6A 4FHAA 4XKYB 5L9FA 2OMAA 5KZDA 3NAVA 1KFKA 2E6YA 3FFSA 1O5XA 4H6KA 1EP1A 4YLWA 1A5AA 4EF8A 3SW6A 4PL2A 4O0KA 4C1KA 1VR6A 1VHCA 1OFPA 3NQGA 3S9YA 5D2VA 3R5EA 3CC1A 4AHOA 2TPSA 5D02A 4UUIA 1NFBA 3HGRA 1XXXA 2J24A 2Y63A 3GX9A 5CPMA 1GG0A 4MJMA 3STFA 3QQ0A 3L21A 2A7NA 1H1ZA 1I2QA 2TMDA 4O12A 2O7SA 2QF7A 2OT1A 3QF0A 3P62A 3Q94A 3DFNA 4UFKA 1OK6A 5L6UA 1WDWA 2Z2UA 3BARA 3P7YA 4A29A 5I3JA 1H51A 5F2IA 1PHWA 1UBSA 3W1LA 4O4VA 1OYAA 4Q32A 2YPIA 3T44A 5BW6A 1KTNA 4EVZA 3GXPA 4AMAA 1G7VA 4MOZA 2YGYA 4PC8A 3M7WA 5BMXA 1YPIA 4N9BA 4UFIA 4CQ8A 4FXSA 5LHFA 4NQ1A 4FNRA 2VXNA 3NM3A 4AXKA 1FCBA 2YZRA 4RCXA 2CZDA 4YCPA 4NJHA 3NQVA 2VC6A 2ZTKA 1G69A 1MXSA 3G24A 2ZFAA 3U6WA 2WNZA 2V2HA 3L66A 4N4PA 2YW4A 5KITA 1Z41A 2DU2A 2QCMA 5LGXA 3SI9A 1ZAJA 3LCHA 4FNQA 1UJPA 3HG5A 4NJGA 4MFEA 5KSWA 3GXNA 3BO9A 1GYNA 1FDJA 2A7RA 2J9ZA 2W0UA 1XKYA 3ATYA 4G1KA 2P0OA 5FF4A 3O63A 1W31A 3QSTA 1ICPA 1A5SA 2NXIA 4UMBA 1K7FA 3USBA 2DZUA 4ADUA 3TIMA 1QO2A 4O19A 1DQXA 3MI6A 3TSMA 5DBUA 1H7RA 5LNRA 1SUXA 1TMHA 1Z48A 3OIXA 4QNEA 1MEHA 5AHIA 1QCWA 1SZNA 1SW3A 1B3OA 5H91A 3PUEA 1LOQA 4BFAA 1RVGA 3KVJA 5G2WA 2YYUA 4FX7A 3VE7A 4ZZ9A 3DFTA 1NF0A 3QSRA 4OWGA 4X3ZA 3W7CA 5U7SA 4DPQA 3QH2A 4X2RA 3PULA 1FCQA 3G1HA 4GNJA 4ML9A 1GJPA 4W9TA 2Y6ZA 1QMLA 3TX9A 3G22A 4A22A 1OX4A 1JR1A 4IUOA 2Z0IA 2C1HA 4GFSA 5DLCA 3VFLA 5FEZA 4IMCA 4O14A 5C5YA 1JQXA 1W0MA 2H8XA 5EBUA 4NNCA 2AGKA 1LBFA 3NL6A 3E49A 3I65A 1EEPA 4UFJA 4Z0SA 1X1ZA 3LHYA 3S1VA 2C15A 5DY3A 1VS1A 1GEQA 3G1SA 4X9SA 3P8JA 3M43A 1ML1A 1IIHA 3HF3A 3P80A 2ATMA 1FCVA 4KFNA 1GT8A 5C54A 1FWWA 2NLIA 4GE8A 1YXYA 3LXCA 4I7WA 2CLHA 1H61A 4UR7A 4NZJA 3W2MA 4JR5A 4JICA 1A5CA 4ZQNA 4A2RA 4Z1AA 3TK7A 3G0UA 3HGOA 7TIMA 1F76A 3T4CA 3O6CA 1JVNA 4OE7A 4WY0F 2VFEA 2Y61A 3THAA 4MFDA 1I8JA 3IV3A 4RZ5A 3A21A 3W1TA 4TX9A 3NR0A 5F4XA 2O7QA 4P61A 5KTLA 2CW6A 4I9AA 4NXSA 4ZMGA 3DXIA 1TV5A 2VEMA 1GVSA 3C61A 5G5IA 2QCHA 4AEOA 1KBJA 1LDCA 4HT3A 1EP2A 2JKAA 2A1YA 3KXQA 4NUWA 1P0KA 1B57A 1NSJA 3G8EA 2CLEA 1SSGA 1QOQA 3Q58A 3R8RA 3NPXA 3PSWA 3NDOA 2W6RA 4NX5A 4PCFA 3W85A 3DBPA 3V1PA 2YYTA 4WZHA 3TFCA 1LORA 2WQPA 3KFTA 3B8DA 3EXTA 3GDTA 4CQ9A 3PF3A 2VEIA 4K8HA 3RK8A 3A9IA 4O17A 4R34A 3KHJA 4ZL1A 3TROA 4O11A 4O1CA 3PM6A 4UCGA 2Y7FA 5TQLA 2PCQA 1HFBA 3W7NA 4JS3A 3QZEA 4CNOA 4DF0A 3B03A 2PE4A 1G4SA 5HUOA 3MBDA 5G2HA 4UNLA 4XTDA 5BMWA 4XKYA 3W7PA 4MY8A 1K3UA 1PV8A 4K39A 5MHBA 3B0UX 3EB2A 5G4EA 3O15A 5CKSA 1C8VA 2CLLA 4KFOA 4LW7A 1TSIA 1VCGA 4KWVA 5J5DA 1W3IA 3TU9A 2FPTA 1P1XA 3HG2A 5D32A 4TMCA 5HWNA 3SR7A 1GTEA 3QRHA 4AWUA 4UMCA 4JGDA 4ADSA 1M5WA 2JGYA 5K7JA 1WQ5A 4Q33A 3WJWA 2QCFA 1TO3A 4LRTA 4TR9A 2NWRA 3UYCA 2BXVA 4UTUA 4A21A 3BPWA 3L68A 2VFHA 3L0NA 3S1XA 4YMZA 3KRZA 1H50A 3UXDA 1SQ7A 2BX7A 3LDVA 5ABTA 1R30A 1JCJA 1OYBA 1TQJA 2E6DA 4IOTA 3TKFA 1ZAIA 3G0XA 1GVOA 1R2SA 3EWUA 1FWNA 4MYXA 5AB3A 3O6YX 4JXCA 5G1YA 1KV5A 3PVFA 3LLFA 4Z1DA 5LNSA 1NF7A 1WV2A 3LV5A 3N14A 2DJXA 3DFQA 3E0IA 3GYEA 5I3KA 1FQ0A 5C6MA 1P5BA 4WXYA 4UTJA 3BW4A 4JTKA 1DJQA 2QJHA 3W2JA 1DV7A 4JTGA 4JIPA 1PE1A 3LCXA 4BI7A 4AH7A 4DELA 2NUXA 4LTSA 3F03K 5HWJA 3P82A 3UWWA 1TPUA 3QMTA 3UWVA 3CQ0A 3MUXA 3HPSA 1VC4A 1OG0A 4HNVA 5LHEA 2I14A 3IGXA 3R2GA 1OFAA 1S5WA 3FA5A 4GWEA 3MYOA 3EWZA 2AQWA 3F4WA 3NZ1A 4O53A 2E5DA 2I9EA 1GVFA 3LOTA 3FKRA 3PB0A 3QYQA 1OFOA 4JTFA 4LV9A 3M9YA 3NG3A 1DORA 2ZTJA 5FEPA 3BGJA 1XCFA 5CSRA 1TPDA 1TV8A 5F2MA 3INPA 4Y6GA 3W7IA 1W1ZA 2TYSA 3CU2A 5FF7A 1SZFA 5AYZA 3IRDA 4N9CA 5J5RA 1OX4B 4WOZA 1XBZA 1AL7A 2QCEA 4DPPA 3AJXA 4CQAA 4ADTA 4AF0A 2P1FA 3S6DA 3B06A 3W74A 5E93A 1KM0A 3ANYA 2DJLA 4P2VA 3A5VA 3TSDA 1K8XA 1UB3A 3GNDA 2OX1A 3PC0A 2QCDA 5D33A 2XN1A 2ZZ4A 3BG9A 2OZ0A 4OBTA 2QKFA 2EF9A 2YX0A 3WJSA 2ZZ5A 3VNDA 4K6AA 4N4QA 2WSQA 5LSMA 1YYAA 1PCKA 3UXAA 1GPWA 3HG4A 3T7VA 5HMSA 3PY2A 3N9SA 1SO4A 1TJPA 4A3UA 5DN1A 4QISA 2BZNA 4EF9A 3DAQA 1ZY9A 3KVKA 1JULA 1O4UA 1OX5A 5HUPA 2Y7GA 2XN2A 3KVLA 6ALDA 1BTMA 3EKZA 4LVGA 3I7QA 1ALDA 2H90A 4Y9AA 4BR1A 4XBSA 4UTTA 2YFOA 2Q3RA 2OCZA 4JEQA 1KW1A 3UY8A 2EHHA 2V9DA 2TSYA 2YCEA 1NAL1 1UUOA 5E0KA 3HB9A 4ICNA 3W1AA 4UNKA 3PB2A 4DF2A 3I7RA 3W70A 1W5OA 2C18A 1IIGA 4IXHA 4N02A 1IXNA 4XZ9A 3HGSA 3UPBA 4CCDA 3LGEA 1FXPA 3N2MA 4OU1A 3U2OA 1TTJA 1X6UA 3K30A 4O1BA 5CZJA 2JGQA 3DI1A 3EX1A 3QEZA 4LVDA 1H7XA 3CWNA 3L5AA 3TQVA 1Z42A 1F5ZA 3I68A 2H6RA 4JN6A 2V82A 3H53A 2EGZA 5I3HA 5LNVA 1LM1A 5CPNA 4JTIA 1V5XA 3DKLA 3T40A 2Q8LA 4PODA 3G1YA 3HJZA 3ZWTA 3NQEA 4JTSA 4LOCA 3PSVA 2CLMA 4K36A 3LM7A 1KFCA 2JKPA 3JRKA 2ZBTA 1Y0EA 1KFLA 2F84A 2FIQA 5SWUA 5C2XA 4LUIA 3SJ3A 5EY5A 1Q6LA 4D2JA 1WOAA 1P0NA 2E09A 2FFCA 3PAJA 4QIUA 3PG8A 1GVQA 5DXYA 2P10A 4DO4A 1EWDA 3C3NA 2QAFA 3PUDA 4LNYA 3IEBA 2HSAA 2NUYA 1YDNA 1N7KA 1K03A 1PHQA 1EIXA 1D9EA 1WBJA 1VYRA 3NM1A 1OJXA 4UFMA 1D3HA 4RZ6A 1SO6A 2ZZ3A 3GR7A 4JTHA 4HPJA 3DKJA 4Z0JA 3W1UA 3GAYA 4LV4A 1L6WA 2PURA 1TJRA 8TIMA 3IIZA 4BI6A 6TIMA 3GDRA 4K8EA 5F2LA 5DCEA 1FWTA 3G3DA 3P84A 4JX4A 1JCYA 3SZ8A 4WOQA 4LS0A 5AC6A 3HBLA 1K8ZA 1OK4A 1VH7A 4IMDA 4QSHA 1SSDA 1F74A 1L2UA 3PWAA 4MY1A 2BSLA 1XUUA 3CTLA 3RF9A 1KTCA 1O95A 4KKXA 1TRIA 4GUJA 1LBMA 3SIZA 4NJKA 1XI3A 4MLRA 1FCUA 4MLJA 1WBHA 2VEKA 5FEXA 5FI8A 3G1XA 3U8GA 1A5BA 3R89A 2X1SA 1KM4A 1FXQA 4JTEA 3VI2A 1MZHA 4Y8FA 1GWJA 1Z44A 2E5CA 3NQDA 2IQTA 5K2ZA 4E2BA 4NT0A 1B4KA 5BOOA 5D03A 2YR1A 3HMJG 1Q6RA 2CZFA 1QPNA 4LU0A 5EYWA 1IXPA 3STCA 2NX1A 4HIBA 1KM3A 3CIWA 4AAJA 3W87A 1B9BA 1W8SA 3VE9A 2PRMA 3S5OA 3LCFA 3ELFA 4JTUA 3WK3A 1DVJA 2E1DA 3ZR4A 2WV8A 1KM5A 5K4ZA 4N6FA 3WFAA 1VGAA 3R13A 2GQAA 4M6PA 4TMBA 2RKXA 2FTPA 2A5HA 1LCOA 3LI1A 1H7PA 3EX2A 5LKYA 3KRSA 3M44A 2ZRZA 2NWSA 3BV4A 3NQMA 2ZZ2A 5EMUA 4YCOA 3C52A 3IVUA 2BTMA 2ISSA 3GNNA 3LCGA 3B0PA 4AF0B 3FJ6A 3SFKA 3UWYA 3OG3A 4IPJA 3JS3A 3FEMA 2WO5A 2CWNA 5G4WA 1KFEA 1TIMA 1PL9A 1ADOA 1AL8A 2QCDB 1OABA 4FF7A 5TBOA 3UWUA 4PL1A 4ZQRA 3STEA 4N6EA 4WD0A 1U83A 4UTTC 3IIOA 5CPOA 4IX0A 3PUOA 5AN7A 1RQEA 3KX6A 3LRMA 1WXJA 1HUVA 4RV8A 1L9WA 1HO4A 2E5BA 2PRLA 4CCCA 3UQNA 4M5PA 4NVTA 3LHZA 2VKZG 4DBEA 3VCRA 2WPBA 2CU0A 2ZZ7A 4WXZA 3TAKA 3W7MA 5D04C 3G3MA 3C4UA 1OF8A 1FWRA 1ME8A 3LCWA 3UZ5A 1QO5A 2BWGA 4IXXA 1C9DA 2NUWA 4I7UA 1AW5A 1ZJIA 4KWWA 4HNUA 4O16A 5F2GA 3TFXA 3DFPA 3W7KA 1U5JA 1Q45A 1DHPA 3MHUA 5K9XA 1PIIA 3O8AA 4M6VA 4O4WA 2HS8A 3AO0A 2VEPA 3A23A 4BK9A 2OJPA 1LLWA 3TXZA 2ZQ0A 3EWBX 5D2TA 4C1LA 4E2DA 4EOUA 3HOJA 1T99A 1J5TA 2B4GA 3DENA 3GDLA 3M47A 3MO7A 2CLKA 3ZFHA 1SZGA 3GR8A 3C2VA 2RFGA 4YXGA 2Y88A 4J9JA 3SGUA 1BWLA 3NPWA 3TSBA 3N9RA 1I4NA 1H63A 2QCGA 3L5MA 2A4AA 1QPOA 4NJJA 3A5FA 2CFFA 4O15A 1M7OA 1ONRA 3N73A 4DF1A 3EWWA 3IGUA 4Z1CA 3QM3A 4FO4A 1VZWA 4HSNA 2ABBA 3TC7A 1ZFJA 2Y89A 1JCLA 4POCA 3B04A 3MMTA 3LV6A 1THFD 3GDMA 3WJYA 5BNKA 5K3VA 2NV1A 3ZS4A 3W75A 3LXAA 2DP3A 3L0KA 4UFHA 3RU6A 3TQ0A 1J4EA 5KMYA 5AHLA 5LGZA 3STGA 2C16A 3M5XA 2CLOA 4O18A 1VHNA 1MSSA 1WA3A 1IGSA 5KZEA 1DOSA 3JR2A 4DO6A 1I2PA 3B0VC 1D3GA 4N9DA 2RDWA 1O94A 3PBWA 3TAOA 1XBVA 4K37A 1H5YA 1DKWA 3G1AA 4O52A 4N2YA 3LHUA 4RJEA 2J9XA 5CGQA 3LTSA 3W1QA 1EUAA 4WJEA 3LCIA 4HHPA 2LLEA 3LRLA 4GC4A 1Q6OA 5CSSA 1FDZA 3MP3A 3P5ZA 1FDYA 4JX5A 2QR6A 4MUZA 5G1TA 4ZQMA 3C6CA 1S5VA 2PRHA 2YXGA 1GYLA 3OVPA 4FB7A 1AK5A 3W7OA 3LRKA 2GPTA 2B7PA 1OF6A 3P61A 1OYCA 3OHIA 4QITA 5AHNA 4O10A 2GJNA 3TW7A 1GOXA 2DZVA 1EB3A 1O60A 3I7SA 4UFLA 1XM3A 1A50A 1EPXA 2RDTA 3LHWA 1LROA 4DEFA 1YTDA 3RNDA 3PR2A 1VQTA 4A2SA 4OQVA 1KA9F 2NZLA 1JRCA 3GAKA 3TXVA 3O05A 2Z1BA 1AG1O 4RK8A 1B4EA 2Y85A 5HR7A 4JDYA 5TIMA 2GVJA 1F6PA 3QW3A 2NXGA 4M6QA 2GOUA 4MKNA 5K9CA 3W2LA 4B5NA 4O0ZA 3EEGA 5KZMA 2QCLA 1TYGA 4UTIA 3C8FA 2B0MA 1O5KA 1VLWA 2ZRYA 3W71A 4UTMA 3EKLA 2QJGA 4PEKA 3DHFA 4NXKA 1RPXA 3W2KA 3OVRA 3W1NA 2HS6A 1ZHAA 2ZYFA 2Y70A 3QC3A 4AB4A 1KLYA 3EXRA 3HG3A 3P81A 4BF9A 4OHQA 1W5MA 2X2GA 4ZQOA 1BWKA 3UWZA 3MW7A 3NGJA 3O07A 1LRTA 3OA3A 1N8FA 4Y90A 3W7JA 4ORIA 1N55A 3TC6A 2V8ZA 4O13A 2A2IA 4FNUA 3OVQA 4FIQA 3IIPA 1ZENA 3ABOA 4JNMA 4UTLA 4ZQPA 1TPEA 2E6FA 3WK0A 3P5YA 3CM4A 3QW4B 4CCEA 3C0JA 3PG9A 4DXVA 4HPXA 3TA6A 4U4MA 5BRBA 5FEWA 4QAIA 3N19B 1F7BA 1T0OA 2WSYA 4ZVJA 1GTHA 1EA0A 1G4PA 3LX9A 1KFBA 3PBVA 1R2RA 4EWND 4UIOA 3THQA 2A6NA 1SPQA 3W7DA 2V30A 4YL2A 3S0CA 4LUJA 3RLVA 4KFPA 3W1RA 1CW2A 3W6YA 3W72A 4UXDA 3HQ1A 5DY2A 4RXGA 3LERA 2HTMA 3CWOX 2ATSA 4GUIA 4JY9A 1QPRA 3MJYA 1EP3A 1DQWA 3C2EA 2GJLA 1I2RA 2R91A 4OV4A 2G97A 4K7YA 1X7FA 4UTWA 2TRSA 1HTIA 3W7EA 4IMFA 4LVBA 1TREA 5LNWA 4WQ6A 5D05A 2H3BA 2ZRVA 3GKAA 5G2IA 2DZTA 4MZYA 1H7OA 3UD6A 3G8RA 2FQIA 3FKKA 4JTJA 5EL1A 3M0ZA 3NQ8A 1K7EA 4NNAA 1KLZA 2V0TA 4R7JA 2A21A 3M41A 1CI1A 4CNNA 3P67A 5DCBA 2R14A 1DJNA 3OEXA 3CHVA 3M16A 3TMLA 3W1MA 1FBAA 1KM1A 4NNBA 2ABAA 2UV8G 5AFDA 4AHQA 1W5PA 2G96A 3G1DA 1PS9A 1TPVA 3L67A 5K4XA 1H1YA 4OV9A 1KM2A 5H2ZA 1FX6A 4LS1A 4FXRA 5D30A 3BGGA
chains in the Genus database with same CATH superfamily
3STPA 2X2YA 1ZALA 2H3DA 4LBUA 1ZUAX 3CL6A 1R47A 3RMEA 3IIXA 4RW5A 4R88A 3H54A 5HQEA 3VZZA 3EOUA 3M0KA 1V6TA 2VFIA 4GZJA 4X0NA 1PZ2A 4QQ3A 3W29A 3TJLA 3MJMA 1YXDA 3BMVA 3S5NA 2DQXA 2NQLA 4XZHA 2ZRWA 3VNMA 4HB7A 3V5CA 1VJIA 3MI3A 3CXOA 1QXLA 2IS7A 3MV11 5DANA 3WLIA 3LTYA 4ZQCA 2YLAA 1TTQA 1E56A 3A4WA 2J75A 5CPLA 2VENA 1JYNA 2ZRXA 3AALA 1JQVA 1LWHA 1RV8A 5BOEA 1BKHA 3GXTA 2C3ZA 4IMAA 2J8GA 3AISA 3B40A 2XN0A 1L6SA 4H3DA 1K7XA 4CN1A 4GLEA 4HPGA 1RVKA 3NVTA 3CEPA 3RLUA 5IHRA 3L9CA 3GU2A 4CN4A 1YPFA 5FF0A 1V77A 1CXHA 1XFBA 2GK1B 2E9BA 2O9RA 3GIPA 4GI6A 4RXFA 4B5VA 4WKHA 2NX9A 4FX6M 5DFAA 5JH1A 4PMYA 3W76A 3IUDA 3LLXA 1L8NA 1VBUA 3VDBA 2YFNA 2HMCA 4XD4A 1H11A 4ZSUA 3UXLA 4TOQA 1M7JA 3T05A 1QOPA 4EIVA 4O57A 3TTOA 4TO8A 3VIKA 2ISDA 1UD5A 4GBUA 2Z6JA 2VOMA 1BF2A 4P7RA 1F3TA 4KIEA 2X30A 2J74A 3PS7A 3TMQA 2ZRUA 4F0SA 2YSWA 3I6RA 4WY0A 3BLIA 1JXJA 1ZBCA 2PC4A 1I6NA 2FDMA 4JL1A 1SZEA 2X1UA 3B97A 3AYVA 3NA8A 1S38A 3UY7A 1WUFA 3GUWA 3TNOA 2V5BA 1FY6A 1LYXA 1UROA 3EX6A 2Y5EA 3S1UA 3BAKA 4X60A 5DEZA 3PJUA 3SGZA 5FF3A 1TQXA 3GKFA 1W91A 4UC5A 3OP2A 2WKJA 1OFBA 1H7NA 1RBOB 2ZKMX 4UQDA 1W37A 3VA8A 1BKSA 4ALDA 1GZGA 2XVPA 3TR2A 4WSKA 1T5AA 3LXBA 3MVIA 2DQWA 2PDUA 3UZXA 2IW0A 3SAZA 4GINA 4GVHA 3BG3A 1UR8A 3ANUA 3GTFA 1YW1A 2OEKA 4PBGA 3B0YA 1E40A 3W86A 1BPLB 3ABRA 2J7FA 4U5IA 2E68A 1F05A 1V6XA 4DLFA 3ITXA 3BLLA 2QCCA 4U28A 4XAPA 3LTPA 3ZSTA 6REQB 5LZLA 2P53A 1X1OA 3M0JA 4JYEA 1W3NA 1ME9A 1OFDA 2DZSA 3ECQA 3QFEA 2PDBA 2A85A 2WVVA 3W7GA 2EKCA 3RITA 2QUTA 5JBFA 1UCWA 3RFAA 3M5ZA 1LBLA 1PZ1A 1LQ2A 1K8YA 4U3CA 1TPWA 4UOJA 1BEUA 3ARZA 3WJXA 2QQ6A 3FN9A 4AMCA 1KV8A 3W7HA 2ADAA 3AOFA 3LHTA 4GIRA 4LX4A 1YBQA 2D2GA 1PIGA 3BJFA 1FWAC 3N2CA 1RCXB 2G8ZA 3UWEA 1KFWA 1TWZA 3PZQA 4FXFA 1H62A 1KM6A 1EZWA 4GO8A 2XFRA 1BGGA 1LP6A 3UP8A 3CMFA 2GYIA 4S38A 1LLZA 4FOKA 2Z2BA 1J6OA 3VC6A 2P50A 4LBSA 4TVDA 5A8MA 5AHMA 4U5KA 4DYJA 1FWEC 3GC4A 4GUGA 3K4DA 3G0SA 2OSYA 1BXNA 1EH9A 4G1NA 4HMEA 1PPIA 2Y7DA 2I5GA 5D09A 4CUCA 3NXFA 2OEJA 3CBWA 4L4MA 4WK9A 3RM9A 4DJED 4M7TA 2REQA 3G18A 1MUMA 4DYEA 3A6OA 4AUBA 4F2BA 1HJXA 2HCVA 3QTPA 2DIKA 4S3EA 4L4LA 1G1YA 4AZGA 5GVJA 1W2VA 4BF7A 5H1WA 2V3DA 3B3DA 1WKDA 4NAFA 3BK0A 1B3YA 3QQWA 3QR1A 1WZKA 4UTHA 1TE6A 1JDEA 3UJSA 1PVNA 2ZCGA 1FKXA 4P8VA 1DJYA 3WQPA 3V35A 3UG8A 2WHMA 1U30A 4PA8A 3C2OA 1RLCL 3C56A 2J8TA 1M03A 5CXPA 1W6TA 5B7YA 4QM1A 4HNOA 3HGJA 1BLIA 2NW0A 1VFHA 3TTQA 2NX3A 3ZJKA 1JDFA 4LVAA 2GVYA 3M1ZA 1F6KA 3BOFA 3S5SA 1YXCA 1IR2A 3R1ZA 5H8PA 1QW7A 3PBYA 2I1OA 3GW0A 1QR7A 1FP8A 4RE0A 2B7QA 4BWLA 2J27A 4WY0B 3DC8A 1GKRA 2FGZA 4DAFA 2CZEA 4JDBA 2YA0A 4OVXA 4F0RA 3CH0A 5JBEA 4LCSA 2PWEA 2A7PA 5DBTA 4H8UA 1OCNA 1XPGA 2DUXA 2QCNA 5DCDA 2J7EA 4GQQA 1IXOA 1JUKA 3TEVA 2PTYA 1A4LA 1IQ8A 5HAOA 3VOIA 3Q2DA 3TV8A 4O1EA 3RXZA 1EL3A 1X8FA 4UQ9A 3S42A 5C55A 4GXMA 2W3ZA 2BXYA 4ML4A 2YDRA 3U2EA 3CMJA 1ZSXA 2WJZA 2WJEA 1JJKA 3IVSA 5A8GA 3CS2A 4GUFA 4CD7A 4KWOA 1IR1A 4RR4A 1VLIA 4AQLA 3CT2A 3ITCA 4LS2A 5AYYA 2G4FA 3A22A 4XBJA 1Y7VA 1YMYA 4MY9A 1SFJA 1A5UA 3EPNA 2WVTA 4XAZA 4GBDA 4W85A 1SR9A 3GS6A 3S3GA 3ARTA 3CT7A 1OCJA 1CLXA 4IMEA 2J7GA 1RP9A 4TQTA 4EPDC 2BGQA 4ZE4A 5CPQA 1X96A 5FCZA 1ZP3A 4PE8A 1UH2A 1FWDC 3G1FA 2WVVB 1IV8A 3MWAA 4DJDD 2GUUA 1QNVA 4PTWA 4H9XA 5CZSA 3ENLA 3H2CA 3KOXA 3GLCA 4DBDA 3W9ZA 2WCSA 5HK4A 1SJDA 3AZRA 4M19A 1VYPX 4GIYA 3MBFA 1RXOB 2YW3A 3H22A 3QOMA 3LK6A 1V6UA 4PZVA 3NQBA 2PLKA 1YBQB 2PWFA 3MHFA 3N6QA 1CZ1A 2CHOA 3BLFA 5HNRA 1P4CA 5AHEA 1CX9A 1N8IA 2RUSA 3C0SA 2I56A 3WENA 4IT1A 1NP0A 4FZIA 2D23A 3MI2A 4O8RA 5LNUA 4HYWA 2ZE0A 4W7VA 4FOUA 4ZSTA 2PGRA 4EXQA 7A3HA 3D3AA 2CZ5A 3M0MA 5A1AA 3F4NA 4LC8A 4LY8A 1ME7A 1JFHA 4QE4A 1MNZA 2UWFA 5HPOA 3TA9A 2E6YA 3RPDA 1O5XA 1UWIA 4M29A 4EF8A 4GXPA 2REQB 4E4PA 3AXXA 5A6JA 4C1KA 5ENLA 1REQA 1OFPA 1PJ9A 3NSXA 3TOYA 2FMNA 3S9YA 1BG9A 5D2VA 4HP5A 2BMBA 4AHOA 3CC1A 5D02A 2TPSA 2Z00A 4N42A 1I60A 2Y63A 3FNDA 3WH5A 1EC8A 1GG0A 4H7CA 3L21A 1I2QA 1ADDA 2TMDA 2O7SA 2DT0A 2QF7A 2OT1A 3P62A 2PTWA 5I6SA 2Z2UA 4NYYA 2J13A 2XIBA 3CV6A 4R5EA 1LL4A 5I3JA 5IDIA 4O4VA 5IHSA 1JGIA 1JPMA 3NO3A 4Q32A 2OGJA 1PKLA 2UY4A 4TX6A 4CQ8A 4UFIA 3RU8X 4FXSA 3QLLA 4IPNB 2MUCA 4CNSA 1FCBA 2CZDA 3LUTA 4ZCWA 3TYZA 2OU4A 1Z6KA 4R7WA 3D5HA 3WNOA 1DJXA 4LCQA 1Z41A 1OT2A 3O2LA 3SI9A 4W93A 3DFYA 3SCOA 1ZAJA 3BCDA 4NJGA 1OGSA 4GO9A 2J9ZA 4QJ3B 2AGTA 4H2CA 3CPGA 4QBXA 1PKNA 3VIMA 2HZGA 1BRLA 3VU2A 1HVQA 4UMBA 3SRFA 1V0KA 1QO2A 4O19A 5DBUA 1UHVA 1CGYA 3KL5A 1RAKA 5LNRA 1TMHA 5DT5A 3TP4A 4GZ7A 1XLJA 2WSPA 5AHIA 1QCWA 4PB3A 2W92A 1MW2A 4BFAA 3L4YA 4C90A 3RGTA 4ZZ9A 3DFTA 1NF0A 2P76A 3PULA 1GJPA 4W9TA 4A22A 1TX2A 3U5UA 1OX4A 5TD4A 3PTKA 3A3WA 4Q4QA 4W8AA 2J7CA 5FEZA 4IMCA 1JQXA 4XZIA 1J18A 1LBFA 3BLPX 4XZMX 3E49A 3MO4A 1EEPA 3DYMA 3IK4A 5BRQA 1VS1A 3TWAA 1GEQA 3G1SA 2ZUMA 2VI0A 5M5DA 4R27A 1IIHA 2HVOA 4QJ4B 1PIFA 4QG9A 1JDCA 1U1JA 3P80A 1FCVA 2QGYA 5A6SA 3NOYA 3POHA 3DN5A 1P48A 3BCJA 4UR7A 4NZJA 3MPGA 1NOWA 5FJIA 3EZ4A 4R9XA 3VKAA 4Z1AA 3NCOA 4ZTYA 1K4HA 4XAGA 3PFMA 2PD5A 4EACA 4WY0F 4EK7A 3U7BA 1I8JA 3IV3A 4TX9A 2AMXA 2OX4A 4NXSA 3DXIA 2VEMA 4TTGA 2WMKA 3MSDA 2O56A 4GI8A 1KBJA 3SEPA 1TZZA 1PBGA 3WLSA 5BU9A 3PSWA 4BY3A 4F9JA 4H8VA 3HPFA 4WZHA 1CXKA 3GDTA 4ES4A 2HQAA 3RK8A 4LNCA 5KZ6A 3L4UA 1QBAA 5CJNA 1RA0A 3KHJA 4HQVA 1W1IE 4M82A 4O0QA 4S39A 2PCQA 4CNOA 4GACA 3UG3A 3LBOA 3KOWA 3GG1A 5BMWA 5JIPA 3W7PA 2QF8A 3RJYA 5MHBA 3FDGA 4XZNX 1REQB 3EB2A 4PSPA 3W38A 4KFOA 1TSIA 1C3FA 3PBMA 4AY7A 1MRQA 4FA3A 5J5DA 1W3IA 2GUYA 2FPTA 2C0HA 3SR7A 1GTEA 2R1MA 3WZ0E 4AX6A 4UMCA 4IFRA 4WF7A 4WKAA 1M5WA 2JGYA 3WELA 1G0CA 3WN6A 2YL9A 2ISFA 1VRXA 2AL1A 4ROQA 2Z2AA 4A21A 3L68A 2Q09A 4IGMA 2HE5A 3UXDA 1SQ7A 3LDVA 1F6YA 2E6DA 4IOTA 3DX5A 1B0IA 3TYDA 2FZBA 1WO2A 3FV9A 1R2SA 1WKFA 2GGJA 3EWUA 3M46A 4JFVA 2HVMA 4Q8TA 3LLFA 3RG6A 1NQ6A 3N14A 3VKCA 1HXJA 4W4QA 2OYLA 1FQ0A 2PLCA 1P5BA 4GD0A 3VC5A 4D1JA 1C9WA 5A2BA 3W25A 1ZGDA 2NVDA 2QJJA 4JTGA 2OLHA 4DELA 2NUXA 2WJFA 4GGBA 3CQ0A 3MUXA 1MFVA 2EG8A 4RV3A 1OG0A 1SMAA 1S5WA 3SN4A 4W88A 1P0BA 2DY3A 3EDJA 3K8LA 1BRLB 4YYFA 3EWZA 1M68A 3GWQA 5AYIA 5MF5A 1XD0A 3SRKA 2I9EA 3LOTA 3FKRA 1UUQA 4AZ5A 1OFOA 4B5XA 3CZLA 2DVUA 1GONA 4JTFA 3APGA 2Y1HA 3TTEA 3NG3A 4CD6A 5CSRA 5F2MA 3INPA 3CZKA 2TYSA 4GQ0A 1CWYA 3CU2A 1HJSA 5AYZA 4H04A 1UZ4A 4HMDA 1OX4B 1XRVA 2D3NA 4JQAA 3GTXA 3N6HA 1AL7A 1E0TA 4JIRA 3AJXA 4ADTA 2XIQA 2P1FA 3WLMA 1ISVA 1UB3A 2OX1A 1V6WA 3MCNA 4ZO8A 3R11A 4QXIA 2XN1A 2QKFA 3GRIA 2YX0A 2ZZ5A 4NZ5A 4K6AA 3GH5A 4N4QA 1XQKA 1WXYA 2WSQA 4Q4MA 4EP8C 3E2SA 3PY2A 4Q8OA 2BZNA 4PMJA 5CGMA 1JEZA 3KVLA 1X7IA 2E8ZA 4LVGA 4KF1A 1ALDA 2H90A 2VD9A 4Y9AA 4BR1A 2YFOA 3W0KA 3KEHA 4C6QA 3PJXA 4UQCA 4PCTA 4GC3A 2F61A 3TONA 3KBMA 2TSYA 4UCFA 3CJPA 1WE5A 3HN3A 3HB9A 3W1AA 3A64A 1M65A 2GGHA 4DF2A 3W70A 3UJ2A 4YVXA 1IIGA 3BQ5A 3UPBA 1FXPA 3N2MA 3B9EA 1JPHA 5D9PA 5EMKA 1Z89A 1X6UA 2GQ3A 4O1BA 2JGQA 2X0SA 3EX1A 4LVDA 4K1WA 4I5RA 3SN1A 3G5EA 4JHZA 3H53A 5I3HA 3A4JA 2HV5A 3T40A 4LANA 3NQEA 4AX7A 5BWFA 1VFSA 3H2NA 5AKQA 1FFRA 1XGEA 3WLKX 4UZUA 2F84A 2PCEA 5SWUA 5HJXA 5C2XA 3SJ3A 3GQYA 3DIPA 4IQJA 2WMIA 3LPFA 2WZTA 1EWDA 5LXEA 2P8BA 2WMHA 2JE8A 1PKYA 3MKVA 1N7KA 3RR1A 1K03A 1PHQA 4PFHA 3NSNA 3NM1A 2ZUNA 4MNMA 4FS9A 4RZ6A 3LNMA 3OPSA 3GR7A 4HA3A 3LQLA 1YE6A 5CAHA 2FFIA 1YX1A 3LU2A 3WQWA 3W1UA 2WBKA 1UWRA 3EB4A 2OEMA 3GDRA 2ZUTA 4K8EA 5AVNA 3UF9A 4XX6A 1JCYA 2F38A 3UZYA 5TF0A 1K8ZA 1UD4A 4B9YA 2OSXA 2YBUA 2PLMA 1F74A 2FHFA 1XSKA 2BGNE 2JEQA 4RE3A 1JDAA 3AU6A 2E4TA 2WLZA 1LBMA 2XFYA 4NJKA 1R3QA 1XI3A 2ZVRA 3WQ5A 2VEKA 1YE4A 1AQHA 3R89A 4ZBCA 3NO1A 1GWJA 4E2BA 3BXWA 3WY1A 2GJXA 1MW3A 4C6NA 1Q6RA 3S6TA 3CASA 4LU0A 1IXPA 2NX1A 3ORWA 4HIBA 1KM3A 3GBEA 3H12A 2GFTA 1W8SA 3IV8A 3VE9A 1Q7ZA 1RK5A 2BY1A 3S5OA 2YCKX 1LG2A 3E6EA 3WK3A 3VO0A 2E1DA 1W1TA 4IP7A 1X39A 4IL2A 3UETA 2QDEA 3ZR4A 3FA4A 5LIUX 5A6KA 4TMBA 3EDEA 2FTPA 2Y5JA 1FHUA 3IUIA 4XO6A 3U0HA 3KUMA 4QJ5B 3MSYA 1GPFA 3UU0A 1WZLA 3NZGA 1B3WA 1BHGA 1GKPA 5LKYA 3KRSA 3BV4A 1E1FA 2NWSA 1R7AA 4YCOA 3IVUA 3LCGA 2B81A 3EKGA 3ABZA 3FJ6A 3ZVHA 4IPJA 2PP3A 5H6HA 5C7HA 3PBGA 2XSXA 1EDGA 3FEMA 5G4WA 2FVMA 1KFEA 1TIMA 1K6WA 2PF8A 1PL9A 3AICA 3W02A 4ZQRA 1GCYA 3HPAA 4IG2A 3UR5A 3ID7A 4WD0A 7REQA 3IIOA 4IX0A 4MWAC 3VUSA 1RQEA 2WSKA 1HUVA 5I06A 1BYAA 4H41A 1KD0A 3AROA 1Y8BA 1YRRA 2E5BA 2PRLA 2QVHA 4REQB 3L4XA 1U1HA 4WEVX 4CQDA 4YS1A 4PSRA 3WLQA 1X6LA 4YHEA 3D47A 4QS6A 4TX8A 1ME8A 3AC0A 3LCWA 3WUGA 3UR7A 1QO5A 4H6RA 3S2CA 1C9DA 2NUWA 1AW5A 5LXXA 2ACUA 4AY8A 5HA7A 1S39A 2ZXDA 3OGSA 4ZOAA 5FAJA 4CEUC 3MHUA 1JXKA 1CGTA 3ITYA 4BK9A 1AMYA 4XD3A 1J9YA 3AXMA 4XIMA 4EOUA 3DENA 2R9RA 4FSAA 1E9YB 1U5HA 4OIFA 3ZO9A 3GY1A 4I5XA 3ZJ6A 1SZGA 3WDPP 3C2VA 2RFGA 2Y88A 4MG4A 3SGUA 1I4NA 1W1YA 2QCGA 2E0PA 1TJ1A 2CFFA 5A8OA 2HBXA 4IICA 5AVHA 4DF1A 4HN8A 2WMIB 1X97A 3QM3A 2YZ5A 4FO4A 3A4XA 2ABBA 1ZFJA 1JCLA 3QHNA 3B04A 2ZUWA 2OKTA 1UOKA 1KXHA 1THFD 1DTUA 1GNXA 3GC2A 3WJYA 5BNKA 2NV1A 3W75A 4E5TA 3PFRA 4B3KA 4DI9A 5A6AA 3L0KA 4M8UA 2CEQA 3TNBA 3TQ0A 5LGZA 2G3NA 1XCXA 1VKFA 1IGSA 1J8VA 3AIVA 1DOSA 3JR2A 4DO6A 3B0VC 5FL0A 4N9DA 4HHHA 1ZTVA 1PUDA 5CBBA 1Q13A 4F40A 4K37A 1XLDA 3CUGA 3LHUA 3LTSA 4AZCA 5FKYA 3W1QA 3H8AA 4WJEA 2R1PA 3MP3A 3WLLA 2PF0A 4RDWA 5HMDA 2PDGA 1UA7A 1MZRA 2YXGA 3OVPA 1JD7A 3NVDA 3K4AA 1SYTA 3WNMA 3OHIA 3KTCA 3TW7A 4F79A 1M53A 3FAWA 1EB3A 4PUWA 3U4FA 4LF2A 1EPXA 1TMLA 3PP7A 3WUBA 4CD8A 4WR3A 2C91A 1UC4A 4ICCX 3RNDA 3PR2A 4BZYA 1VF8A 3VFCA 2GJXB 2QPSA 5HR7A 7PTDA 1NH6A 3QW3A 4AEEA 3CUFA 4M6QA 2GOUA 4MUPA 2VEGA 4GHRA 3IJLA 4D6IA 3C8FA 3T2PA 1O5KA 4UTMA 1M9HA 1GOKA 3EKLA 2QJGA 5BWAA 1TJ2A 1E5JA 3PZIA 1A5OC 5DRIA 5HANA 2HS6A 1TVPA 2GVEA 3ZR5A 2Y70A 1ZRQA 3MSGA 5HNTA 2VURA 3P81A 4TUFA 1US3A 1ZBVA 1BWKA 1UP3A 3UWZA 3NGJA 1LRTA 4FR6A 3ZVHB 1R3RA 2O4MA 4FNUA 3PPHA 3IIPA 1OC5A 3QKZA 1N82A 4YN5A 3ABOA 2DW6A 4UTLA 3WNLA 4IG2B 1UR2A 3UG4A 3PZOA 7REQB 3PG9A 2FJUB 4ZR8A 4U4MA 4XAFA 4QAIA 1UWTA 4DUWA 1KFBA 4A8IA 4B16A 4BQ4A 2P8CA 3THQA 2A6NA 1SPQA 3S0CA 3MVTA 3ZM8A 1IT8A 3W1RA 3L2LA 4ACZA 1POJA 1W32A 2YXXA 4UXDA 1H4PA 1R9YA 5DY2A 4XK2A 2HTMA 4CNTA 3CWOX 9RUBA 2ATSA 4C6JA 4GUIA 2POZA 4JQ1A 4ACYA 4C6IA 3E0VA 1QPRA 1CB2A 3MJYA 4DNMA 2G37A 1XV8A 2GJLA 3L4WA 3OW1A 1CLVA 1X7FA 4JAWA 1MW1A 3W7EA 4F8XA 1KBBA 1TREA 3OA5A 4PTVA 4LXFA 3GKAA 3M0IA 4QE1A 1MMFA 3CHDA 1IZJA 1V02A 4LAUA 5EL1A 3NQ8A 1KLZA 4EANA 3K2GA 1E6QM 3KE0A 2A21A 3M41A 4R9OA 4KIRA 3QV7A 1JGMA 2QMJA 5DCBA 1YIXA 5LYRA 1DJNA 4DZHA 1JZ7A 1QWKA 2ABAA 1CXIA 2OQYA 4AHQA 1DWIM 3V5OA 1PS9A 5K4XA 1FFQA 1NWUA 5JQ9A 5D30A 2YDQA 2BHYA 2W67A 1QPQA 4K68A 4ZOCA 3RX4A 3UJFA 1T96A 2ICSA 3GZAA 5D2WA 5T9CE 3OO2A 2GGIA 3LSCA 4JIQA 4NZFA 3NOEA 4FLRA 3W1XA 3N2OA 2OQHA 5I79A 2D73A 3V75A 1V6YA 2YDAA 3ATZA 1IT7A 4Y2WA 3ZOAA 3FXYA 4B91A 3C0LA 3RDKA 4K38A 1EUNA 1ZJBA 2OZTA 1KRMA 3ZYZA 4S3JA 1A3HA 4C6CA 3MCMA 2YKKA 4LYQA 4Y96A 2WWDA 4W7UA 3W73A 5C2GA 3A3HA 4AZCB 1MUWA 2W79A 1I2OA 2FDSA 5E0FA 1SFLA 8XIAA 2D2JA 4EPBC 4DX3A 4M1RA 3POCA 4GJ1A 1J2BA 2VUNA 3W2NA 1VP5A 2GVLA 1JRBA 3WMCA 1HX0A 3H7RA 3HU7A 4QCFA 4AZ6A 2CPUA 5HWMA 2XVGA 4GVFA 1LJYA 3SSZA 1OC7A 1ICQA 2JKEA 2GGEA 3ITOA 2ZDRA 1RQHA 4QEEA 3WK1A 4KEVA 2Y7EA 2FMOA 3WQDA 3RO8A 3W7LA 5JUVA 1XISA 1LT8A 4AXNA 3IGSA 3HJEA 3SIMA 3CH9A 3KP0A 2QXWA 4O1FA 3SCNA 3OBKA 3MT1A 2DZWA 2I7GA 4Z2HA 1XBXA 3CQKA 1PCWA 2ISVA 3OU8A 4DBUA 1M6JA 4TV6A 1V03A 4NU7A 3COTA 3SQLA 1KFJA 1H7WA 1KGXA 3H2FA 1M41A 1PSCA 3NL3A 1XC4A 1XLFA 1BSLA 3KBVA 1GGOA 4X61A 3AIBA 2P3ZA 3Q37A 5D38A 4S3FA 1KO0A 1W3JA 5HULA 3W83A 2FB3A 2ZE3A 3ERPA 4IX2A 1WZMA 1SO3A 2R1KA 1S5NA 3AUOA 3RPMA 1JYVA 1UC5A 3ONCA 1GORA 4W87A 1TKKA 4HZ7A 4RE2A 4LUSA 3I4KA 4MJZA 1T8XA 2CBUA 2NV9A 2VELA 4UOQA 1E0XA 4XKMA 4Q4KA 4PRTA 4HJWA 3SECA 1QRQA 3OQEA 3AHYA 1N2VA 5CLTA 2YCLA 3BLEA 3VPLA 1FOBA 2J7BA 4WX2A 4WDUA 4D6HA 4HNTA 4RZ4A 3QPYA 2BLEA 3VZXA 4AY1A 3OZYA 3W28A 1NEYA 4URIA 4I9JA 2E28A 1UWUA 1HKJA 5C71A 4HZMA 5I3GA 4EE9A 4LH8A 1O66A 4JIHA 2DIJA 4V28A 4DQWA 2WKLA 4XD6A 2XYLA 4C6LA 4S2CA 2J25A 3EWDA 4CEXC 2CC0A 1V79A 3W84A 3A3XA 3I6TA 2XIIA 2JIWA 4H9VA 1MQRA 3S8HA 2OOFA 3DZ1A 3MSRA 2JF7A 2Y8UA 4ZO7A 3SCPA 3CUJA 3SSJA 4Y9NA 1MI3A 3R94A 1JI2A 1RSCA 1UW9A 1DQUA 2VVSA 1TE1A 1L6FA 2X1RA 4FP1A 3V16A 4PUDA 3TOPA 4PBEA 1B31A 2VTFA 1GEHA 1AZ1A 2V81A 3TN5A 1I2NA 3DGBA 4LALA 3EA1A 2GLKA 3LGGA 5CJMA 1V3KA 1VYSX 1E4NA 1OFEA 1XDLA 3ALGA 3LB0A 3GNPA 2R94A 3BGAA 1XLIA 4C6PA 4U2ZA 2PDNA 2OQLA 2C0AA 4HCDA 4PTNA 4DRSA 3KCLA 2WMFA 3IVTA 2EG7A 3IJQA 3TH6A 2GQ9A 3C2RA 2Z6IA 3P0WA 1EX5A 1E0UA 4RX0A 4ZOEA 4P8UA 4RNFA 1O6IA 3UNTA 2C6QA 1WX0A 4MHBA 5DMNA 1C92A 2VZOA 4B4HA 1R38A 4MB1A 5BYWA 4GQBA 1PDZA 3NPVA 4L4OA 4R53A 4DLMA 1W3TA 5GQBA 4FNTA 4HMNA 1AW1A 1XH0A 3LCLA 1C90A 1NVMA 1W54A 3L5LA 2B7NA 1OB0A 3CEUA 2ALDA 3H55A 3SFWA 4JHMA 5LIYX 3S5YA 4S3DA 3O1NA 4E8DA 3S2MA 2PMQA 3EMQA 3N4AA 4Z2IA 4PMVA 1E0WA 5H8MA 1AMKA 2NXHA 3GIYA 4MWAE 1L6YA 2ZA1A 4IGNA 1RLDA 4DWSC 3E12A 1SW7A 2VRKA 3IANA 5HR6A 3ARVA 4C6FA 3VILA 4JYFA 2X09A 3AS3A 4IQEA 3UNDA 1VBHA 3U7VA 3CIVA 3BMXA 3VMNA 1VIWA 1XBYA 4PB5A 2E9LA 1OCQA 3GB6A 1TRDA 3IIVA 3E74A 4EKJA 3URAA 2XH2A 4QG8A 3WDIA 4DWSB 4ZXLA 1RJQA 5FOOA 4IPIA 4AD0A 3SY8A 4IL0A 4GCXA 1XKJA 1YLVA 2R8WA 1WDDA 4DO5A 1QDSA 4HK5A 4PMXA 3R8GA 3WSUA 3KVMA 1KGUA 1GOWA 2V2DA 3N04A 4M6UA 2UZ9A 3MUCA 2DT1A 1XYLA 4LUSB 1H0IA 4RKAA 2F9RA 4MF4A 1LQ0A 3VIGA 2YCLB 1O1HA 1WZAA 1EFZA 1K8CA 3CZGA 2ZZ1A 2WOQA 3C8NA 3S1WA 2BOEX 5FA5A 3RPTA 1I75A 3VIIA 4LWWA 4CVWA 4MM1A 3E9AA 3WLHA 1Q3NA 1LUCA 4J1OA 3S5ZA 3L4ZA 1OVDA 1E3XA 1A5MC 3KM8A 1WXZA 1G5AA 4ZGYA 3ARUA 4BF5A 1R9XA 2PI6A 1F2JA 3PUGA 3M0VA 2HWGA 1S3HA 5A5WA 2DVXA 2WC4A 1QNSA 1TTIA 3DU0A 2Y62A 3KAOA 3WJZA 4J28A 1Q6FA 5ECVA 1A0EA 1A53A 2NVAA 3WBEA 4Y9MA 2GJRA 3V36A 4IJBA 5HDRA 1SZRA 4XSLA 1JCMP 3M6YA 2C13A 4GPNA 4ZO6A 4MNJA 1G67A 2CBIA 1ZS2A 4AWSA 4PFMA 1UR3M 3CV2A 1DJZA 3MHGA 2PU1A 3GVRA 3G1VA 3VKBA 3DG6A 1VFFA 1UJQA 3R12A 5EMYA 1GKQA 3AYRA 2RGMA 1EWEA 3PPGA 1OWQA 2G5WA 1WDSA 4JBRA 2V63A 1GG1A 5A6BA 3A9BA 1XL9A 2Y2WA 1DHKA 1PEZA 3CV7A 2FZ9A 5E1QA 2XIOA 1X6NA 3EXSA 3CL7A 3W22A 3NL2A 4HN4A 3IJDA 1BGAA 1Y5WA 4UNIA 4P7NA 2ISWA 5LA2A 5C0QA 4E8CA 1XR2A 5LIXX 1GQKA 1TPFA 5H8UA 3AMDA 1V3IA 4O1AA 4Q6JA 3P93A 2ZXQA 2WZEA 4LVFA 1GQIA 5F1VA 2BOGX 1VBJA 3TTYA 2XSAA 1W2PA 1DWHM 4ZO9A 2H8ZA 3V3WA 5AOUA 1M7XA 4S3BA 1NTHA 4JD4A 3MP4A 5FJPA 3EDFA 4GX9A 2RDUA 3WMSA 3BW3A 2PBOA 4WGHA 5L9FA 1K9FA 3L23A 4HA4A 3FFSA 5EB8A 1X98A 4K8GA 5BRPA 5CJ5A 4H6KA 1I0BA 4E4UA 3QHMA 3DFHA 4A8RA 3SW6A 3RRXA 2WCAA 5CEWA 1VR6A 2OLSA 3NQGA 1QNPA 1SJAA 1Z9AA 2FKPA 3VMOA 1V0NA 3B8VA 1NFBA 1XXXA 2J24A 1XHGA 4MJMA 2L5HA 3VOFA 3S4TA 4O12A 1U33A 1KCZA 1GUVA 1GJUA 3W37A 4E4FA 3Q94A 3RR4A 4UFKA 1OK6A 4GIEA 3WH7A 5CPTA 4NSBA 2V68A 2Z7GA 2QIIA 3P7YA 2WWCA 2G41A 4YVPA 1QI4A 1PHWA 1OYAA 3OGRA 1KTNA 1Q7QA 1K77A 2BG5A 4FLOA 4MOZA 5BOFA 3M7WA 4PEEA 2XM2A 3BE7A 2VXNA 3NM3A 3FVDA 5A95A 4HU0A 3IJIA 4Q8VA 1S2VA 1MXSA 2ZFAA 3F4CA 1OGBA 2BY2A 2V2HA 4N4PA 3QTGA 3CV1A 1HW6A 2GDUA 5KITA 2DU2A 2Y4SA 3PPFA 3VCNA 4FNQA 4HPHA 5HQLA 3HA1A 3T0DA 3BO9A 1GYNA 4B15A 2BDQA 1CXEA 3ATYA 4G1KA 5FF4A 5I0DA 3AIQA 3QSTA 1ICPA 1SJBA 1A5SA 3ZR6A 2Z1XA 2ZX6A 1Q63A 3WLNA 3DCPA 1DQXA 3MI6A 1GOOA 1Y65A 1H7RA 1SUXA 1Z48A 4FK9A 3OIXA 3H4WA 1J6PA 4QHRA 1F3EA 1MEHA 4QNEA 1LUCB 1JIBA 1SW3A 1XD1A 3MU7A 1RVGA 3AMKA 1GVIA 4C7DA 2HROA 4OWGA 4PYSA 3W7CA 4HBKA 2VX6A 1AD4A 1ODUA 2Y6ZA 1QMLA 3G22A 3SRDA 3EMCA 1JR1A 2Z0IA 5DLCA 4MDPA 4D8LA 4AFYA 3N29A 1YNYA 4UQBA 4NNCA 2ONEA 4Y7EA 4Z0SA 2D69A 2C15A 3ITGA 3AS2A 4DO7A 3TJIA 5GJPA 3WBAA 3BSGA 2PDMA 2VX5A 4KBXA 1WP6A 2Y0FA 3TYCA 4JNZA 1YXYA 1E4IA 4L1WA 3T9PA 3SUSA 2CLHA 1OSEA 4IIBA 4HK7A 3BQ6A 4PR4A 5D8WA 2V5CA 3W2MA 2F6KA 4A2RA 4H9UA 5I03A 4ATWA 1V4YA 3G0UA 3HGOA 1GW9A 4UQAA 3O6CA 5JBDA 4OE7A 4L6HA 2Y61A 3THAA 2DT3A 2PWGA 3WFLA 1A3WA 3GNOA 4MSSA 1VFUA 5KTLA 2CW6A 1XX1A 4KEZA 4U31A 1GVSA 5DRCA 1UWAA 1OQFA 4UBPC 2KX9A 1QATA 1LDCA 1HGYA 4W86A 2JKAA 4S3KA 3WLTA 2A1YA 3KXQA 5E6ZA 1FH8A 4UB9A 3OIHA 2CLEA 1QOQA 4IQDA 4MB3A 4B3ZA 4PCFA 1HJQA 4HGXA 4KESA 2E7FA 3TYBA 4IFKA 3W85A 3FA3A 3V1PA 3I6EA 1MUCA 2WQPA 3KFTA 3H4XA 4LCRA 3A9IA 4GY0A 4IJCA 4PMZA 3QZAA 3WQ8A 2D24A 3UA3A 3SY1A 3PM6A 4QROA 2Y7FA 4DHGA 1HFBA 4UTFA 3CAVA 4JS3A 4DUVA 1C7TA 1G4SA 3MBDA 4XTDA 3QGAC 4XKYA 4MY8A 4KCVA 4HHLA 3O15A 4LW7A 2WK2A 1VCGA 3MKCA 3TU9A 9XIMA 5D32A 4TMCA 3QRHA 4C7GA 1PYMA 4IIFA 1BYDA 4J40A 3U3HA 3UZZA 1H2JA 1XICA 5K7JA 1HL8A 4Q33A 1DE5A 4U2YA 1RJRA 3WJWA 4TR9A 1TJ0A 2NWRA 4CKQA 3UYCA 2IPWA 5E70A 3BPWA 2QHAA 7CGTA 1NDWA 3S1XA 2D22A 2OGYA 2BX7A 3DEQA 3P2VA 1TQJA 3RYSA 1ZAIA 3G0XA 1P6CA 2RJHA 4PGLA 1S2TA 3V1HA 1CNVA 3O6YX 2FVKA 3EPOA 4JXCA 5G1YA 3WG6A 3UW6A 1KV5A 1V02E 3OJGA 1PTDA 1R85A 3WBXA 2DJXA 3E0IA 5F7UA 4LAOA 4WXYA 3TQPA 4H2HA 4JTKA 4OKDA 3VNJA 3K8KA 2BS9A 3O0FA 3N4FA 3FYYA 4JIPA 3WDHA 1PE1A 3LCXA 1EA9C 4BI7A 4AH7A 4EAYA 3RCMA 4LTSA 5HWJA 3MUY1 3UWVA 1WPCA 2ESCA 1KWKA 1XS2A 1J0ZA 1VC4A 2GZXA 1XP3A 3IGXA 1OFAA 3FA5A 3MC5A 1QHOA 5A2CA 4D8AA 1G01A 1UP0A 2AQWA 3NZ1A 1GOIA 4O53A 2OZ3A 5A6LA 1E9ZB 1GVFA 1OY0A 3KZPA 3PB0A 4KCUA 1A5NC 1ODZA 4QRNA 3M9YA 2HPIA 1DORA 2ZTJA 4AISA 2CXGA 2W63A 3BGJA 3KOYA 3OVGA 5FEPA 2X7WA 5XINA 1TV8A 4F4RA 3W7IA 2XPKA 1PZ3A 3W81A 3MQTA 1HT6A 5FF7A 3IRDA 5J5RA 3VVGA 3UJRA 2XIJA 2QCEA 4DPPA 4AF0A 3M07A 5A8PA 4KEMA 1E6ZA 3N18A 4P2VA 3A5VA 3TSDA 3GNDA 3UBPC 5D33A 2ZZ4A 3ZMRA 2OZ0A 1MQQA 2EF9A 3AIEA 3WJSA 3EPMA 3IRSA 3WEMA 2IPFA 3FGCA 1YYAA 3UXAA 4QFUA 3HG4A 3KDNA 3T7VA 5HMSA 1QHPA 1SO4A 3D3FA 4A3UA 3B9NA 5DN1A 4EF9A 5M1TA 3VKKA 1JULA 5HUPA 6XIMA 3IJ7A 3PTMA 2RJGA 3E1F1 4L9XA 4JZ5A 1KW1A 2V3EA 1NAL1 2NQ9A 1WKYA 2DIEA 3T07A 2FZMA 4ICNA 4HYVA 4UNKA 3PB2A 3I7RA 1P6WA 4N02A 4IXHA 2CKRA 3EYPA 4US6A 2XSBA 4OU1A 3U2OA 2PEVA 4D9PA 3K30A 3WEOA 1L0PA 1RPKA 3QEZA 4V33A 1H7XA 1V3HA 3TQVA 2ZWZA 4YTRA 4F3HA 5I09A 3I68A 4JN6A 5D9NA 1LM1A 1VPYA 2FGBA 2OWCA 3DKLA 2Q8LA 1UZHA 3ZWTA 3SQSA 3KRBA 4IFKB 4S3AA 4JTSA 3USZA 3WNPA 2ZUVA 3JRKA 3T8QA 1BWVA 1Y0EA 1KFLA 4LUIA 1K1DA 1Q6LA 3M64A 4QIUA 2E09A 2FFCA 3MMWA 3PAJA 1GVQA 3CWHA 3II1A 2QAFA 1UR1A 2HSAA 1KGWA 4MB5A 2EO7A 1W3HA 1EIXA 1SM9A 1D9EA 4AC7C 1WBJA 2WJDA 1JPKA 2Z1KA 3IPWA 4P5UA 3KL0A 3RJXA 3AWNA 1D3HA 1V3MA 1EJUC 2JQXA 4HPJA 1L2QA 2C8NA 5AY7A 3GAYA 2PDHA 1L6WA 4MTVA 3V18A 4KRTA 2PURA 1TJRA 4GYKA 1OBAA 1MDRA 1KWGA 5DCEA 1FWTA 3G3DA 2VGGA 1EDQA 1CECA 2P5NA 3ALFA 4WOQA 2EPMX 3H2EA 3VXGA 3CK5A 2VUYA 2XWEA 3J7HA 4Z1YA 1OK4A 3I3BA 2G0WA 3DYPA 4IMDA 2VR2A 4G5DA 2OB3A 3S83A 5JIWA 3WLRA 3A47A 3CTLA 3RF9A 1J0IA 1BQCA 4NILA 4GUJA 3ES7A 1JF6A 1AA1B 1HGWA 1FCUA 3WQVA 1DJGA 4E3TA 5E6YA 1FH7A 5FI8A 1UR0A 3BC9A 3F2DA 1EF3A 4JTAA 4EXBA 2PZ0A 1MZHA 4S3CA 4OBSA 3R43A 3NQDA 2GDVA 5K2ZA 3WQGA 1DJWA 2NSXA 1FP9A 1KC7A 3GO2A 3OOQA 4J3SA 4RNJA 1B4KA 3TN4A 3WQEA 2KAUC 5EYWA 3STCA 5EBAA 3W87A 3DG3A 3T4WA 1ITQA 3SB0A 1VFMA 3PTQA 1UZDA 3LCFA 2XH7A 1HKIA 2D2OA 1JYXA 1WAWA 2WV8A 1WDQA 1EC7A 3FJ4A 1FHVA 4N6FA 1VGAA 1JPDX 4ERGA 4WDXA 4DZIA 4PMDA 2A5HA 4FLQA 5ABGA 4G7FA 4D6FA 3NXLA 1XPYA 2C1IA 4E2VA 3BTNA 1M04A 4L64A 1KBLA 1UKQA 3CL8A 3NQMA 4LYRA 5EMUA 2BTMA 2OSWA 1O12A 3GNNA 4AVNA 3B0PA 3S9IA 4AF0B 1XLBA 3DOPA 2CWNA 2BGSA 4FF7A 4JEJA 1OABA 4R3UA 3UWUA 1E6XM 1YPXA 1E3ZA 2FTYA 2C79A 2WBGA 4N6EA 2PDCA 4HPNA 4GH3A 2ZVIA 3PUOA 4FMVA 3VABA 2G3JA 3FGCB 3WKZA 2VQUA 1J96A 4AIEA 1F8IA 2ASHA 1L9WA 1HO4A 3U4AA 3PNZA 6A3HA 4ATLA 3LHZA 1H41A 2IUZA 2WB5A 2PFHA 1DEDA 3K13A 1BXCA 2F2HA 2ZZ7A 1W9DM 2EEXA 1DIOA 1OF8A 1XFCA 2BWGA 4IXXA 1UWQA 1AJZA 3GXIA 4AC1X 5F2GA 3KWXA 3TFXA 2HK0A 3VDAA 1AJ2A 1PX3A 1AJ0A 3W7KA 4NG3A 5K9XA 4O4WA 4M6VA 3AO0A 3A23A 1JYWA 3AYSA 3TXZA 1FWHC 1EO5A 5I77A 1W3KA 3WD2A 3EWBX 2XGBA 4E2DA 1N8WA 3VKDA 1XG3A 3GDLA 3MO7A 3APTA 3SJNA 1JFXA 2CLKA 4FPSA 3GR8A 3A13A 3VDCA 2VZSA 2PLJA 3TLQA 2ZUUA 5JH2A 4J9JA 2O4QA 2A4AA 5LA0A 1J10A 1QPOA 2CCRA 1M7OA 2PBGA 2D0FA 4LB4A 1ONRA 1UR9A 3N73A 3FDKA 4QLKA 4QE5A 3KLKA 3TC7A 2Y89A 4OJYA 1J0KA 3MMTA 1KB3A 2BV9A 5K3VA 3NZQA 4R7OA 4JIIX 3LXAA 2DP3A 4UFHA 4LF1A 1A80A 3N12A 2PPGA 2W5FA 1HNYA 3EOLA 1J4EA 2PSNA 2IPJA 2CLOA 4GXWA 4O18A 2W91A 1MSSA 4DM2A 1I2PA 1D3GA 2INFA 3WF2A 1XBVA 3V5FA 1H5YA 1DKWA 4LUYA 4N2YA 4J3XA 3MUIA 3C2YA 1F4HA 2J9XA 4RJEA 4JL2A 4V1YA 3KDOA 4C6BA 5CSSA 1ZJAA 3AFBA 2O55A 4I6KA 3CHFA 3P5ZA 1FDYA 3GC5A 2OR2A 4J3ZA 5G1TA 3GNRA 3C6CA 5GJMA 3RLGA 1R86A 2EQDA 4FR1A 1GOMA 3ARSA 5AHNA 4ZEPA 5E9XA 4WSHA 1A50A 4DWDA 5HOSA 2RDTA 1BG4A 3CZEA 4W84A 3GFXA 2YOCA 1K6AA 3KBJA 3H24A 2WANA 4MADA 1YTDA 2Z29A 1PYFA 3MUAA 4A8NA 4A2SA 4GZEA 4I9MA 1JCTA 4I90A 1JRCA 3TXVA 3O05A 2Z1BA 3QC0A 1AG1O 3EA2A 1CB7B 3IK2A 2GVJA 5CH9A 3S47A 5C2CA 4MKNA 4B5NA 3EEGA 5KZMA 3E3HA 3UERA 1F8MA 2VYOA 4M81A 2P0IA 2ZRYA 2XISA 3NGFA 1J93A 4PEKA 2VCAA 1RBLA 4NXKA 2G50A 4QLJA 3QY6A 4NZ4A 2ZYFA 3QC3A 3SCWA 1DWFM 3P0XA 1EJXC 1K9EA 3EXRA 2XM1A 3T2QA 3E0LA 1PAMA 4JFUA 4ZQOA 3B9OA 1UP2A 2YXOA 3MW7A 3O07A 3OA3A 1KBKA 4Y90A 4ORIA 2GWNA 3TC6A 2V8ZA 2YJQA 4IPPA 2GSEA 1JZ6A 4MWAD 1R3VA 1ZENA 1P0EA 2HDJA 4JNMA 4X2PA 5M17A 3P5YA 4PCNA 4CCEA 1XRSA 1EHNA 3EA3A 3BV7A 1R7OA 4HPXA 5FEWA 3N19B 3AU2A 1HJVA 4ZVJA 2VJXA 3LYEA 1Z3NA 1EA0A 1G4PA 4NHVA 2QYGA 1HP4A 4DJFA 2UY5A 2ZOXA 1R2RA 4UIOA 3URBA 3AAMA 2ACQA 2OVLA 4AG0A 2Q6ZA 3W6YA 4Z42C 4AZHA 1MFUA 3VNLA 4Q4OA 4RXGA 3S6OA 5EMMA 4NZ1A 3CLWA 1T8QA 3FHAA 3ME3A 1I2RA 1XYBA 2R91A 4OV4A 2G97A 4UTWA 2TRSA 2ZC1A 3IS4A 2BY0A 2G3FA 4LVBA 2A3CA 3VM7A 5D05A 2H3BA 5FSEC 5G2IA 1S5MA 3UD6A 1H7OA 4Z2JA 1E1CA 1K7EA 3GH7A 3BJSA 1R9ZA 2VM8A 3MANA 8CGTA 2PWVA 3P67A 1O5QA 3S46A 3M16A 2XINA 2IQ0A 3W1MA 1FBAA 1KM1A 3VNIA 2UV8G 2XU2A 1W5PA 2G96A 3T8LA 5H2ZA 2VGFA 4LS1A 4LGXA 4FXRA 1UYQA 3WLOA 3BGGA 4Q4PA 3CUHA 3LLDA 4LJ3A 1KCXA 1LQAA 2DT2A 2INEA 5KINA 4MDOA 4DYKA 2J66A 3P74A 3IJ8A 3T09A 1V0MA 2BHZA 3NQ7A 1HQTA 3DC0A 5AC8A 2GL5A 4LBRA 5EKYA 4YWSA 2VFGA 3QMRA 2DORA 4JNYA 3Q4DA 3M5VA 1MEWA 1IEQA 5BU6A 2X1TA 4PMUA 4V1XA 5HJYA 2QJMA 3CB8A 1LRQA 1OFQA 3AMGA 3HZ3A 5FJTA 3UA4A 2FB2A 4OECA 2VCBA 2WHLA 2PA6A 1NDVA 1H49A 2NT1A 4HK6A 2A0NA 1VFLA 2A3LA 2XVKA 5TNVA 4XZBA 3PZ9A 1TV4A 4GK8A 1MO0A 1UASA 2F2KA 4H8HA 3QYSA 4BA0A 4FEZA 2QDHA 1ZNNA 4ILSA 1PZ0A 4NAFB 1TFVA 1PX4A 3WBWA 3ITVA 1NFPA 3UZJA 3MP5A 2Q01A 4OGZA 1YKWA 1ZU8A 1DIDA 1T6MA 4MZ1A 5G1MA 3DUGA 4BWLC 4CCZA 4US5A 3FIGA 3RX3A 2X41A 2PC8A 3NYZA 3N4EA 2UY3A 4GVGA 4ECLA 1WAUA 2G95A 5LIWX 2X05A 1RHCA 2I16A 2WLYA 4EX4A 1L8PA 1V8EA 3CO8A 1UKPA 4NF7A 1KBIA 1TVNA 1UKTA 4FXJA 4J3VA 3GVGA 4AHPA 2QDGA 2WNQA 1YNQA 2Q71A 4RPPA 4HCHA 4TU1A 3E02A 2E25A 3W88A 4PTMA 4HNLA 5CPSA 3VGGA 1E4MM 1ZP4A 4DJFC 3ZZ1A 2E6AA 1P0DA 3KBNA 4MVAA 4XV0A 1TELA 1OFRA 4Q7NA 1TPB1 3O16A 4P8XA 4YTSA 4RDZA 1F3WA 4BHYA 2B31A 2EAWA 3UVAA 3DBNA 4RL3A 1EQPA 3L4TA 3TJXA 5CSUA 2YA1A 4ZODA 4HOXA 1FUYA 3TTSA 2OYKA 3W00A 4RLIA 3THDA 4MGGA 3O6DA 3KOFA 5U4NA 3GVQA 2WNNA 5AC5A 4UTWC 4FLSA 2PDFA 1VIZA 3IARA 4HCLA 4MJ2A 3L65A 1E15A 3JVAA 4HYRA 4DZAA 1IF2A 1O1ZA 1IWBA 4JY8A 2QUUA 3GUGA 4IMGA 2E77A 2RGLA 2BB0A 1HO1A 5T26A 4HD5A 5CZ0A 4GYJA 2VFDA 1UMLA 1FWFC 2BHUA 2QJIA 1IEVA 1TPH1 2NLYA 1ENUA 5EA9A 4YTQA 5GNZA 2XVNA 1W1VA 4KEUA 1GHRA 2PS2A 2DDXA 1X8CA 3RILA 1LTDA 3UXKA 4TXEA 5A6MA 5IBXA 3TCEA 5C9UA 1LZOA 1W5NA 1E1CB 3L2IA 4GNVA 3UR2A 1ITXA 1VENA 3GSMA 3RMJA 2UY2A 1H60A 3T0TA 3VDHA 3AHVA 3FJLA 3REQA 3LBCA 3BW2A 2J79A 4LEFA 3H26A 4W7WA 3M5YA 1IGWA 4IIDA 3NQ2A 2FJKA 1FHDA 1XIJA 5D2XA 3UWQA 3QJAA 1Q8AA 3N6JA 3RRAA 2XGIA 1DXEA 3DI0A 3NL5A 2C14A 2VOTA 2AL2A 3CYVA 1TCDA 1GVRA 1KQZA 4RDVA 1MEIA 3D46A 3ABQA 4G6CA 1ZQ5A 1PO9A 3ZWSA 3CIXA 2EPNA 4MAZA 4BI5A 3SY5A 4KRZA 2VC5A 1G6CA 3CLMA 2NQ5A 5HPCA 1DBTA 3N1AA 3FS2A 1QFEA 2Q02A 1G4EA 2BXZA 2BASA 4DY1A 4JTLA 1UOZA 3FYOA 2KZHA 4JOMA 5HQMA 3QPEA 3ZSSA 4B5TA 5BCAA 4YWIA 4IGHA 2OWXA 4HHMA 3TE9A 4UWMA 3KBWA 3NTYA 4H7ZA 1M01A 4A8LA 5E9AA 3BAIA 3WBYA 1OADA 3WL1A 1NWTA 2C71A 3KZSA 1Y5VA 2CLFA 5HMFA 5EPDA 1CXFA 3GTNA 2ANUA 1YTKA 3UYIA 4EAMA 2QEZA 2J9YA 3H70A 4FOJA 1JCXA 4GFIA 5M03A 3QPZA 4RNHA 4C1NA 1AODA 1M7PA 2FPYA 2WHJA 2IQDA 3WLJA 4XUGA 3AWOA 4D72A 2GQ8A 4DNHA 3T78A 4MYAA 3WD0A 5D37A 2VZVA 5BXSA 3WMLA 5CBIA 1G7UA 1QI3A 3NZRA 4MKVA 1TWWA 1Q6GA 5CG0A 3ARXA 2DZAA 1XDMA 5A8NA 1JUEA 1EXBA 1RR2A 3HPXA 5B80A 3GVWA 1B1YA 4R33A 4F9DA 1B30A 3BSMA 3THUA 4XUYA 4JHOA 4J35A 3JZEA 1GQNA 4LY4A 1Z32X 4X9YA 4X22A 4N9EA 2OO0A 4A3RA 4Q7IA 4I9TA 3RLHA 4Q4RA 3MB9A 4JKLA 2XIMA 5CZTA 4BQ5A 4TVCA 5F1UA 1D8CA 2EPHA 4HSOA 2Y5SA 4WDWA 1R0MA 5BZAA 1TZ7A 1NWRA 3DGRA 4IIEA 1YDOA 1D7KA 2FPVA 4XQ6A 4DM1A 4UR9A 3LHVA 1JI1A 1SO5A 5CQ1A 1EJTC 1GYMA 3K5XA 3VUPA 3QOKA 1UMYA 1GZ1A 2DZBA 3WD1A 4DUXA 4Y9OA 3WO8A 1J11A 1IXQA 1OD0A 3H21A 3W7RA 4XWUA 3QR3A 4R85A 5DXXA 3PBUA 1SGJA 1P1MA 5CC7A 3EX4A 2FZNA 4Q3MA 1QTWA 4QJ1A 3LI0A 2PWHA 3NQ6A 4GQRA 2J7DA 1J12A 1XF0A 2RH9A 5IBXC 4M80A 1DTNA 1TZ9A 1SU5A 4XTIA 2IXVA 7ODCA 4HNNA 4V2XA 2EPLX 2AAMA 4UMAA 5DELA 4AZBA 5IM51 2E8YA 1K9TA 4QNWA 4NL1A 2QAPA 2YCJA 3SUVA 3B8IA 2QPUA 3AXKA 1ISZA 3L0GA 1F3XA 1TUXA 2E1WA 5D9OA 3LBMA 3GIQA 5C8BB 3HO8A 4IQLA 3B05A 4ZFCA 1EJVC 3HIJA 3UJEA 2JK2A 4E3VA 3UFYA 3QXBA 2DSZA 2CITA 3REQB 2FZDA 1HL9A 1XINA 1VEPA 4JTTA 2JEPA 2QPXA 2R82A 3HM7A 3OYZA 2FH8A 3AHZA 4KQNA 3EGJA 3WH9A 1IEXA 4L1XA 3NO5A 1KRCC 1LT7A 3P14A 1TB3A 2AL2B 1FH9A 3VX1A 3QV8A 3DFOA 1B9ZA 1VRDA 3WH8A 3WF0A 2BY3A 1BF6A 5G4HC 1TVLA 3SURA 4LRSA 2VNCA 3VK5A 1MXDA 1EDTA 1Q7MA 4N0RA 3T1GA 4H4IA 3AQUA 3SUTA 3ABSA 3NEVA 1HG3A 4TIMA 4ZE5A 3UVIA 3E96A 3R25A 4M7SA 4O1DA 1G4TA 1TPC1 3YPIA 5EFDA 9XIAA 3K4WA 4BQ2A 2V3GA 3DFSA 3WCZA 5DMMA 2E9MA 1SR0A 3A4AA 3T55A 4DXKA 3PJTA 4DI8A 4FHAA 1Q66A 4A6GA 1C91A 3NAVA 1CGWA 1KFKA 2X0YA 1XW8A 1EP1A 4JKMA 1IEWA 1IWPA 3PK7A 4XD5A 2CLPA 4PL2A 4DWSD 4O0KA 4INFA 3TZFA 2P88A 4PCSA 1FTXA 3U57A 1XYFA 3R5EA 3GNXA 5CPMA 1VAHA 4C1NB 1JL8A 1B54A 2A7NA 1H1ZA 3IAPA 1D3CA 1SFSA 3EB3A 3AXIA 3LPOA 3QF0A 4LFYA 3DFNA 2VWTA 3F4VA 3F2BA 3GU1A 4GYPA 3BARA 4A29A 3KS6A 4M56A 4HJFA 1H51A 2NQJA 4U10A 2YPIA 3NZPA 5M3WA 2VGIA 1G7VA 2YGYA 4PC8A 1IZKA 3LNPA 1IWAA 1ADSA 3HFYA 3QHOA 5REQA 4L7ZA 1YPIA 1JDDA 1LG1A 3ZJ7A 2V38A 2WKGA 2WC3A 2XH0A 1R5YA 1XIIA 4AXKA 4RCXA 3CQIA 4YCPA 4NJHA 3NQVA 4LAMA 4YNGA 5JVLA 3G24A 4L5ZA 1EF2A 2WNZA 3L66A 1KRAC 2YW4A 1KCLA 4DUOA 5LGXA 5KETA 3LCHA 3NSMA 4C91A 3HG5A 3U5YA 4MFEA 3VNKA 5KSWA 3SADA 2A7RA 1FDJA 2INZA 1B3VA 3B8UA 2W0UA 3VDGA 1XKYA 2P0OA 2NXIA 3PZGA 1K7FA 4QSFA 1WKEA 4J3UA 3USBA 2DZUA 2WVSA 2NQZA 4GG9A 1JZ8A 2HBVA 1C8QA 4LQ1A 4NASA 4MNKA 5I7GA 1KNWA 3ZLFA 1SZNA 2EG6A 1B3OA 2J62A 5H91A 3QBUA 3KVJA 1UIOA 1OZMA 2YYUA 4FX7A 3VE7A 4K3ZA 1EYWA 1J5SA 2JALA 5U7SA 4GJJA 3N25A 1FCQA 3G1HA 4GNJA 3TX9A 2CKSA 2PGWA 3VD9A 4WDTA 4RPQA 2C1HA 1V7AA 4GFSA 5D8ZA 4O14A 5CLWA 5C5YA 1S2UA 2H8XA 5EBUA 2HVNA 4H19A 4A3YA 4AU0A 3NL6A 3I65A 2OZ8A 4LAKA 4UFJA 1QPKA 2OOGA 5ABEA 5HATA 5GNXA 3GE7A 3VIFA 1ITUA 4X9SA 1W8GA 3W82A 1ML1A 4MMWA 1US2A 3URNA 1QU4A 3CAQA 3HFTA