3C56A

Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(3-hydroxypropyl)-glycolohydroxamic acid bisphosphate, a competitive inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
307
structure length
297
Chain Sequence
MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIAVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
publication title Synthesis and Biochemical Evaluation of Selective Inhibitors of Class II Fructose Bisphosphate Aldolases: Towards New Synthetic Antibiotics.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 112
structure length 297
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c56A00
2DZUA 3TV8A 3LHTA 1A5AA 2B7OA 5U7SA 1W5MA 3B4UA 2QDHA 4YCOA 1ZAHA 1G6CA 3BLFA 1TB3A 1C9DA 3S1VA 3TQKA 4XBSA 3R89A 4MUZA 3DAQA 4Y90A 2ALDA 3L68A 2G97A 3FYPA 4LU0A 4BWLC 5DY3A 4JTFA 1CW2A 1BKSA 1J5TA 3HBLA 3MJYA 1GOXA 5LZLA 3WK1A 4YLWA 3YPIA 3LXCA 1G7UA 4LT9A 3IVTA 2VEPA 5KTLA 1LLZA 1LORA 1YPIA 4GUHA 4LVFA 3O6YX 1N7KA 3NQCA 1OF8A 4LNYA 4DBDA 1SW0A 1GJPA 3TFCA 3NA8A 4AHOA 1ICQA 3T44A 4FXRA 3PF3A 3BV4A 4O11A 1WYIA 3QMSA 1FWNA 3IIXA 2QUUA 4MZ1A 2DP3A 1DQXA 1WAUA 1GTHA 1JULA 1R47A 3P7YA 3W2LA 1LRNA 1AW2A 2QCHA 3W74A 2PE4A 4FIQA 3PUDA 2LLEA 3G1VA 4Z08A 4O0ZA 1LROA 1UB3A 4JTJA 3W1LA 3MHFA 1QPRA 2Z6JA 4ORIA 2E09A 3QSTA 2WJZA 4HNTA 1OX6A 3W75A 4M5PA 1RZMA 1H63A 1KFKA 4LVBA 3W2UA 5HUPA 4X3ZA 5J5DA 4IX2A 1AMKA 1BWKA 5HULA 4Y6GA 3C61A 1QAPA 3W7EA 6TIMA 1VYPX 2RDWA 3BPWA 5BMXA 1F6KA 5LNUA 3ELFA 1TPDA 4FX6M 1XFBA 1VC4A 4AHPA 4GE8A 4JS3A 3HGSA 5D30A 1CX9A 3TKFA 5EYWA 3O05A 3WK3A 3W88A 5FF4A 3M7WA 1ALDA 5F2IA 1EPXA 1PHWA 2X30A 1VLWA 3KVLA 1Z42A 1NSJA 1YYAA 4N6FA 4JTIA 3TSBA 2NX9A 3GDKA 5KZEA 2Z0IA 3QSRA 3K30A 3G8RA 5IM51 1H1YA 3P5ZA 1W31A 4IXXA 4OQVA 1XKYA 4KWWA 4C1KA 4MFDA 3SR7A 2PC4A 1Y0EA 1I2OA 2G95A 3L66A 3MO7A 5FF3A 3W7RA 3R5EA 3LDVA 3M47A 1VYSX 1FCUA 2YDAA 3RMJA 5K4XA 3GXNA 1TV8A 3P60A 2RFGA 4X2RA 4R7JA 3A21A 3SSJA 3EKLA 1TPEA 2B7PA 3DFQA 5E1QA 1OJXA 3A23A 4QITA 1VHNA 5FEWA 1F73A 3KFTA 3OVQA 1IXPA 2W79A 2YX0A 3TU9A 4JY8A 2QKFA 2NXHA 3BO9A 3S1WA 1XUZA 3M6YA 3S5NA 3TA6A 4BI6A 2ZQ0A 1VS1A 1OYAA 3W1AA 3M5ZA 4WY0A 1QOPA 3TK7A 1JRBA 2CZ5A 4HIBA 2Y6ZA 2HSAA 5I3JA 5C2XA 1HFBA 1FXPA 3LCHA 3DI1A 3NM1A 5AC6A 5HWNA 4XKYA 1ZAIA 2Y63A 2A6LA 1Q6QA 3I6RA 4GUIA 3KRZA 4EWND 1O95A 3PB2A 3SZ8A 5DBTA 5LKYA 1F76A 2A85A 4UTWA 2XN1A 1P0KA 3M43A 4CQ9A 3SGZA 2D73A 3IIPA 3JR2A 4BFAA 2NX1A 1EWDA 2QCDA 4JTUA 4N9EA 4ZQMA 1FWSA 2H6RA 3O6CA 3IEBA 3W1TA 3G1HA 1KA9F 4LVDA 5EBUA 3NQ2A 3CU2A 4RR4A 3OG3A 1SW7A 4E2BA 1F5ZA 3FYOA 4KWVA 5BMWA 4NJIA 3C2RA 3WJSA 1YTDA 2CZEA 1H7OA 5G1YA 3HG3A 2TPSA 1H7WA 5TIMA 1JRCA 4UTWC 3L0KA 3C2VA 1NAL1 4BF9A 4M19A 1QPQA 3N73A 3Q58A 2WNNA 3BARA 2DORA 1TO3A 4OE7A 3C4UA 1JUEA 3IIVA 5D32A 1PCKA 3GVGA 3NZ1A 3QC3A 3HMJG 3I7QA 5AOUA 2C3ZA 1X8FA 2YSWA 4YL2A 4NX0A 2C15A 1WX0A 1QMLA 5HQEA 5FEXA 3UY8A 5C54A 4HSNA 3BGJA 1PE1A 4MLJA 1DOSA 2FJKA 4UCGA 3SI9A 3E49A 2DZXA 3MHUA 4ZZ9A 4Y8FA 3WJXA 2PRLA 3LGEA 5F4WA 3ZFHA 4IMCA 1NF0A 4ZQCA 5F1UA 2VXNA 4K7VA 3VE7A 4UTUA 1I2RA 4JX5A 4AWTA 1C29A 6ALDA 4HNVA 3DHFA 1LOQA 3EEGA 3W7KA 3G1SA 4E2DA 2Y7EA 3IV3A 3NZRA 2HS8A 3T78A 3QEZA 4I7UA 3W7MA 1YTKA 5AHEA 2X1RA 4JTSA 2Q8ZA 3W72A 4FF7A 3PR2A 3C6CA 3VI2A 2VOMA 3C2FA 1XCFA 3GNDA 1T99A 3E9AA 3RFAA 5BW6A 1O94A 1EEPA 1JUKA 1AG1O 1G67A 3LV5A 1JCJA 4RKAA 4PTNA 1P0NA 1X1ZA 3ANYA 1T0OA 1LM1A 2E6DA 2P1FA 4HPJA 1TPVA 4K8EA 1K3UA 1XI3A 2WO5A 1UUMA 3FLUA 4TX9A 2ZRVA 4RCXA 2YCEA 3S0CA 4BI7A 4IMFA 1WV2A 1X6UA 3W6YA 3R13A 3LCXA 1TTPA 4DELA 2H3BA 1EP2A 4HHPA 3MP4A 5HR6A 2J88A 3OA3A 2CLEA 5AYXA 4IQLA 3NGJA 5AYYA 1FX6A 1KTCA 4DQWA 3ATYA 1H7RA 5GVJA 4N9CA 4EF8A 1KM2A 2YR1A 3W7DA 4MJMA 2PCQA 4O28A 3P80A 3OVPA 3PC0A 1OFAA 3STGA 4DPPA 4NZJA 2P0OA 1OK6A 1IF2A 2H8ZA 2ZFAA 3RF9A 3W83A 8TIMA 2ZZ2A 1W3TA 1QDSA 1RR2A 1TRDA 2NLIA 5CKSA 4RXGA 1KV8A 2I14A 4UXDA 3W7HA 3D0CA 4UFHA 4UR7A 5DCEA 5AHFA 4ZQOA 4JTGA 2ABBA 2X1SA 3OHIA 2Y7DA 4JYFA 3NQGA 3W2NA 4OV4A 1G69A 4HNUA 2ZRWA 4ADSA 3VKJA 2Y85A 3NQVA 4HKPA 3B06A 4RZ5A 4IPIA 3CPRA 3U8GA 2X1TA 5AHMA 1SO6A 1K7XA 4M6QA 4M7SA 4JYDA 3TQVA 4CCDA 4FEZA 1FWRA 2NXIA 3O16A 2TMDA 2CLHA 3W86A 4FNRA 1L9WA 3G1XA 3QPYA 1YTEA 1IXNA 3C8FA 3TC7A 3P61A 4O4VA 5G2WA 3IIOA 1V7YA 4AWSA 3LHZA 4I9AA 4A2RA 4JD4A 3A24A 1W0MA 3C52A 2H8XA 3DENA 4Z1AA 1OFOA 1IXQA 4KFNA 2EPHA 1LLWA 4KFOA 3LTSA 3MHGA 1I8JA 5CGQA 1G4EA 2G96A 2WNZA 4NX5A 1H61A 3B0VC 5K9CA 1F05A 4PL2A 3CWNA 1Q6LA 3GK0A 3O8AA 3GYEA 3STFA 1QOQA 2YYTA 5AFDA 4ICNA 1QO2A 3G1FA 3QMTA 1SU5A 3W73A 4POCA 5F2MA 3TJLA 2V30A 3GAYA 3W1UA 4L4MA 2ZZ7A 4WX2A 4WXZA 3HG5A 4WOQA 4DEFA 1VYRA 4UFIA 2GVGA 5CZJA 1XDLA 4X22A 2C18A 3I7RA 3HJZA 4O17A 4KKXA 3EX4A 1I2QA 3TR2A 2ATMA 3RNDA 4JIPA 4O15A 4O50A 5F2LA 4OU1A 1EX5A 1IIHA 3GDTA 3NL6A 5F4SA 1FDJA 2TSYA 1ZCOA 1TQJA 3ZWSA 3P8JA 2DU2A 3G1AA 4PH6A 2QUTA 4GUGA 3HGJA 1SSDA 3LTYA 2FQIA 5FF2A 1FDYA 4GRSA 1WXJA 3LXBA 1SUXA 3NQ8A 1ZNNA 5DXYA 1TQXA 1W5OA 4A29A 1KFEA 4FNUA 3M9YA 2E1DA 3DFSA 4UIOA 1OX4B 5D04C 3NPWA 4MY1A 1TTIA 3RK8A 3FEMA 1I2NA 4IMGA 1DHPA 1LBMA 3C56A 1YXYA 3NNTA 3W85A 2FTPA 5D2TA 4O1AA 3NO5A 5E0KA 4O54A 2WV8A 3FKKA 4TU1A 4O18A 2ZZ6A 1P4CA 1S5WA 4LUIA 3L2IA 5AHNA 5CSSA 3UZ5A 3B05A 1GG1A 4JYEA 3E96A 4UFMA 4ONVA 4UTJA 3TXVA 5A8GA 4ZMGA 3W23A 1OFDA 3UPWA 5KZMA 1UASA 3EWBX 4AH7A 5HMSA 5J5RA 2ZCGA 1DV7A 3L5AA 3GKAA 4MKNA 2BZNA 2NX3A 3W22A 1KM3A 4NVTA 3G1YA 1A5BA 1TV5A 3GAKA 3KXQA 3NDOA 4GUFA 2C19A 2Y62A 1WBHA 3DZ1A 2QF7A 5D38A 1FDZA 2VELA 3HG2A 3THQA 2I9EA 3P81A 5FESA 1RPXA 2JK2A 4FNTA 4UMBA 2FIQA 4YMZA 4IGHA 2WQPA 4Q4KA 5D03A 3NVTA 3GDLA 3C2EA 2OMAA 5LNRA 1XUUA 1XM3A 3LHUA 3W1XA 2DZPA 2J27A 1KBIA 3TW7A 1GG0A 4QQ3A 3TAKA 2ISSA 2BTMA 1KFJA 4N02A 1FUYA 2ISWA 2Z1BA 1TJPA 3O07A 3FKRA 3KHJA 4MZ8A 1YADA 3TAOA 1LYXA 3R8RA 3THAA 5DXXA 4XWUA 3I7SA 2IQTA 1F2JA 5G2HA 3RU6A 3QM3A 1SZGA 3O06A 1Z41A 1LRTA 4GUJA 1MEWA 2ZRZA 3NM3A 2QJGA 2YW3A 3GX9A 1X1OA 2OT0A 3PAJA 2VFHA 1S5VA 2QCFA 3TMQA 1H51A 5ABTA 3TW6A 4ADTA 1VQTA 2I1OA 4AHQA 4AF0A 5F2GA 3S5OA 4JIQA 4GBUA 4RLIA 3GR8A 3UD6A 2O7QA 3MWAA 2A6NA 4EF9A 5BRBA 1YLVA 1KM1A 2RH9A 3MI2A 4IMEA 5CSRA 3NAVA 1ML1A 2YGYA 2QDGA 2V0TA 4HN4A 3WFAA 3NQDA 2KZHA 4RV8A 5E93A 1KFLA 4UTKA 1R2SA 3BG5A 2XFWA 4Z1CA 3HPSA 1PS9A 4HPXA 1PCWA 3BLIA 4QSHA 1QCWA 4FNSA 1YXCA 4NT0A 1SO5A 2WNQA 3W70A 4QNEA 2V2CA 2DZWA 4JX4A 1FCVA 4UFKA 3FIGA 3PSWA 4RZ4A 2CLIA 1WBJA 1R2RA 3W7NA 2GJNA 2NUXA 4LC8A 4JICA 4P61A 2HTMA 4OWGA 4L4LA 2JBMA 2RDUA 4WJEA 3CEUA 2J24A 3WK2A 5CPOA 1PHQA 1DJNA 1JUBA 3INPA 1LP6A 2A2IA 1MZHA 2C13A 2XN0A 3ABOA 4MZYA 2A4AA 1L6YA 4A3UA 1VPXA 2O7SA 5BOOA 3EWXA 4TIMA 3UPBA 3W1MA 1T8XA 4LRTA 1I45A 3I68A 4K36A 1WOBA 5FF0A 4YWIA 1QPOA 4ALDA 4PODA 1IXOA 1W1ZA 3O15A 2H3DA 2CLMA 2R8WA 3IIZA 1JR1A 1EA0A 1B4KA 4PC8A 3NEVA 5HWJA 2J9XA 4UTHA 5C55A 2NV1A 4JEQA 2WOQA 1AL7A 2PURA 2EAWA 1OYCA 3OIXA 2CLLA 1XXXA 3U6WA 2WSRA 2V9DA 3LCIA 4LRSA 3DFPA 3W2KA 2J6XA 2Y61A 1O4UA 2HS6A 3ABQA 4QIUA 4O52A 4GFSA 1SFLA 2AGKA 3EWYA 1A50A 3GR7A 1TPFA 1GYLA 5EY5A 1VCFA 3WJYA 4N4PA 4WUIA 1Q6RA 1RQEA 4NUWA 3PBWA 1QFEA 2A1YA 1YXDA 3ATZA 3S9YA 2ZRYA 1D9EA 1K03A 1DQWA 4LV9A 1BWLA 1J2WA 3M5VA 3QH2A 3Q37A 4LS2A 3B0UX 3GZ3A 1K8ZA 5D05A 4ZVJA 3TDFA 1LCOA 4JTLA 3F03K 1DJQA 4WQ6A 4JX6A 5CZ0A 1M7PA 4CCEA 2RKXA 3STCA 4UUIA 1SPQA 3VE9A 3G8EA 4MIMA 2DZTA 1B9BA 3OVRA 2Y89A 4LUJA 3UWZA 3BVJA 3L9CA 2NUYA 4IUOA 4LS0A 3LERA 5EA9A 3DKLA 5BNKA 2DZVA 3C0JA 1N55A 3NYZA 1G4TA 1W56A 1PV8A 2NV2A 4LY8A 3LCFA 4QJ1A 1SR9A 3G18A 3B8DA 4R53A 4LC6A 3BW3A 3W1QA 3UNDA 3M16A 2AQWA 3GDRA 1UUOA 5G4EA 3GNNA 4NNAA 3B04A 4R33A 3CTLA 3M5YA 3NXFA 2J9ZA 1GVSA 3GXPA 4NNBA 3S6DA 3G0SA 5D02A 4U28A 4K37A 1RV8A 4JY9A 2QCMA 7TIMA 3LB0A 4LV4A 3B0PA 2HMCA 2E6AA 3NPUA 2VFEA 4LTSA 5H2ZA 3SJ3A 2QJHA 2B7QA 3B03A 3E12A 1RD5A 2AAMA 2GVJA 4Y96A 3G0XA 4DF1A 3R12A 1QNVA 4IJBA 4MPQA 1H1ZA 4PA8A 2E5DA 2E6FA 1TTQA 4CNNA 3LXAA 2NXGA 1THFD 4XZ9A 4J9JA 2VC6A 1XBZA 3DFNA 1XBYA 2EF9A 1FWWA 4MOZA 3UWUA 4JDBA 5FEZA 3EXSA 1KFCA 3W3OA 3GB6A 1MEHA 1KTNA 3LLFA 3PVFA 3N3MA 5T26A 3M44A 2B7NA 5AHLA 4IXHA 4AXKA 1G4SA 1IGSA 5L6UA 4HSOA 3LBMA 3L5MA 3O63A 4O1BA 2Q3RA 5I3IA 2QCGA 1K8YA 1Z48A 2NUWA 4E38A 4GJ1A 5CPNA 3L0NA 3TH6A 2J9YA 4UC5A 3GKFA 1TRIA 4ADUA 2V82A 3OBKA 3NPVA 2ZZ1A 4RXFA 2ZA1A 2RDTA 1A5CA 1R2TA 1ICSA 3TSDA 3DFOA 4TR9A 2FFCA 1VJIA 5FI8A 4U4MA 3HPZA 2V8ZA 5FF7A 1OK4A 3FS2A 2FB3A 3FFSA 4WY0B 2ATSA 2JKEA 3O1NA 1SFJA 4ZQRA 2C0AA 1XDMA 3QPZA 4AMAA 1ZENA 4LW7A 4XKYB 4YCPA 5F1VA 2GPTA 4FO4A 4PEKA 4UTIA 3I65A 3L67A 3P67A 4OT7A 1HTIA 1QWGA 3KVMA 3TUUA 1H7NA 1P1XA 3N34A 3L0GA 2EKCA 3HGOA 3DH7A 2Y70A 4A22A 2W0UA 2FDSA 2C1HA 2QCDB 5LGXA 1VR6A 4K38A 4TMCA 3TCEA 3PULA 2XN2A 2CU0A 3ZWTA 1S3HA 1H7XA 3BK0A 3UQNA 2V81A 4RJEA 1W5PA 3EWZA 3U2OA 3EXRA 1KTBA 5AB3A 5HWMA 3WK0A 3CWOX 1JCNA 2A7RA 3DBPA 3UWQA 1EUNA 2CLOA 2EHHA 3GIYA 1C8VA 1OFEA 5A5WA 3AJXA 1D3HA 1TMHA 1HO4A 4RX0A 1WQ5A 3HGRA 3JRKA 4A2SA 3DI0A 3PM6A 1ONRA 1RQBA 4O10A 2QCNA 4P2VA 1JQVA 1B57A 3E02A 3FJ6A 2VFIA 3W1RA 3PWAA 1H62A 3N9SA 4DPQA 3IVUA 1T96A 3RLVA 3W7OA 1JJKA 4IWWA 4FNPA 3W84A 3G24A 2FLIA 2H90A 5LGZA 3F1QA 5KITA 3QMRA 3PUOA 4OHQA 3S1UA 4O13A 3LBCA 3HG4A 3QQ1A 3TQ0A 1HG3A 3MUXA 3MW7A 3NL2A 1XC4A 2YW4A 1Q6OA 1S5TA 1QPNA 3P8IA 1H5YA 4UTTA 4IOTA 5DY2A 2V5BA 2F7FA 4NJJA 3IRDA 4H6KA 1M6JA 1UBSA 3M0ZA 3STEA 4UTMA 1UCWA 4O0KA 4LWWA 2C14A 2EGZA 4DF2A 4JNMA 4S2BA 3NQEA 5G2IA 1SZFA 4EOUA 2QJIA 2VEKA 1R30A 1SZNA 4Q33A 1GTEA 5HINA 2GOUA 3A5VA 1TPB1 3NL5A 1YDVA 4FIRA 4BI5A 3DHDA 1I2PA 3LX9A 3ZR4A 1BTMA 3N2MA 1MSSA 1EWEA 2GVLA 3G1DA 4FXSA 3QRHA 4CCCA 4E0CA 5EKYA 1KM0A 5EL1A 4FNQA 3W7QA 1SO3A 1O60A 2X16A 3W7IA 3G3MA 5KSWA 4UTTC 3PUEA 1BEUA 1SZEA 4YXGA 5KZDA 1AW1A 1WOAA 2JKPA 2DZSA 3FJLA 3W1PA 5G5IA 1SQ7A 4OV9A 2ZRXA 1FY6A 2GQ8A 5K4ZA 4JN6A 1KM6A 3TNOA 1VCVA 5IBXA 2BXVA 4PFMA 2YZRA 2CZFA 4ORMA 1F7BA 4Z0JA 3EWUA 3EX2A 4DO4A 3SFKA 4DXVA 3LM7A 1H60A 2Z6IA 1LBLA 1M7OA 3H53A 3DKJA 2OT1A 2VEMA 1DKWA 2C6QA 2C16A 2V2HA 1ZFJA 1JCMP 3ABSA 3TSMA 2PRMA 4NJHA 3QW4B 5AYZA 5K3VA 4JXCA 3Q94A 3UY7A 4N9DA 4O16A 2QCEA 1JCLA 3DGRA 5I3HA 4K8HA 2QCLA 4H4IA 1HUVA 2BSLA 4O1CA 1W37A 3SECA 5L9FA 3BGGA 5IBXC 3W7PA 1KM4A 5G4WA 3CB8A 3W76A 2CWNA 5DELA 1GZGA 3PS7A 2QAFA 4WXYA 5KINA 2ZYFA 4S2CA 3M41A 2FPYA 3PY2A 4N6EA 1OFQA 5D2XA 5LHFA 4XTIA 2Y7FA 3TMLA 2CZDA 3MMTA 3UZJA 1EP1A 4H3DA 4W9TA 4ZQPA 1LBFA 4O57A 1ZHAA 4K7YA 5K7JA 1TTJA 3LCWA 1GVRA 1K7EA 3P82A 5K2ZA 1DL3A 3ZS4A 3S5YA 5CZTA 3KRUA 5EPDA 1SW3A 3NL3A 1GT8A 4LOCA 3C2OA 4JR5A 5C6MA 2BX7A 2GJLA 1VCGA 1FBAA 1XL9A 4NQ1A 4Z1BA 1D3GA 1EB3A 1F6PA 1MO0A 3QF0A 4DO5A 4OBTA 2B0MA 1TPUA 4MFEA 4ZQNA 5DBUA 5DCDA 3EWWA 1KFBA 1OVDA 2OJPA 4JDYA 3EXTA 1ZAJA 3DFTA 4TO8A 3PB0A 2ZA3A 3FOKA 4NZFA 1SO4A 4K6AA 2BLEA 3V1PA 1QR7A 1DBTA 4EIVA 1ZJIA 4CLMA 1LZOA 1VLIA 5FEPA 1OX5A 2A5HA 3G3DA 4WD0A 3LHVA 2X1UA 3NQMA 4DBEA 2JGYA 2P10A 4XQ6A 3BW4A 3QYQA 2WSQA 3R2GA 2JKAA 2RHGA 1VZWA 3JS3A 5H91A 5D33A 2VEIA 1B3OA 4GNJA 4UNKA 2GQ9A 2A21A 3HO8A 3LV6A 3SY5A 3PBYA 1OF6A 3SW6A 2NZLA 5I3KA 5LNVA 3DXIA 3UXAA 1K8XA 3TJXA 1KLZA 3GXTA 4JTEA 3WJWA 1PVNA 1IIGA 1W54A 4DF0A 4UTLA 1G4PA 1NF7A 3W71A 1YDNA 4M7TA 1KV5A 4JTTA 2DJXA 1FCQA 1P5BA 5AN7A 1Q3NA 4UFLA 5LSMA 3PBUA 3KVJA 3PG8A 1U83A 4GXMA 5CPMA 4O19A 1OHLA 3UWVA 2YFOA 2CFFA 1XBXA 3M1ZA 5F4XA 5KMYA 3P84A 3HB9A 4D2JA 3W7JA 1JQXA 4N4QA 3E0IA 4XBKA 1WDWA 3CLMA 5AHIA 3LRLA 1Z44A 3L21A 4MVAA 3HPXA 2W6RA 3UXDA 1SSGA 2CLFA 3LRMA 5C5YA 4O1DA 1V5XA 1VHCA 1H7PA 3MI6A 3AO0A 4R34A 2OZ0A 5CG7A 3CEPA 3KOFA 4K39A 4MLRA 1FQ0A 1GEQA 5D09A 1OABA 1A53A 2B4GA 1W8SA 5HNRA 2CW6A 1ZALA 3MP5A 3TX9A 1KW1A 1W5QA 4RK8A 5DN1A 1W5NA 4UMAA 3LHWA 3HF3A 1F74A 3BG9A 4BR1A 1DORA 1TPWA 1L6SA 1PL9A 3TIMA 4JTKA 1ME7A 3BLEA 3CIWA 2TYSA 3USBA 4AVFA 3UWWA 3LRKA 3CHVA 3N9RA 5CZSA 3F4NA 2A7NA 3NOEA 1J4EA 1WA3A 3EB2A 4RZ6A 1QO5A 2ZRUA 1KBJA 5MHBA 2GUUA 2VFGA 4CNPA 4FHAA 2YFNA 4G1KA 4C1LA 3N14A 1ME9A 1G7VA 4AAJA 4M6VA 3W07A 1NFBA 2VFDA 4EVZA 3NQ6A 2E5BA 3GLCA 3S1XA 3W2JA 4QNWA 4ML9A 2DJLA 5DLCA 2Y88A 5K9DA 2FPVA 1O5XA 1OX4A 3KRSA 4QISA 3O6DA 5I3FA 2JGQA 4GWEA 1HL2A 3LI1A 3LHYA 3CQ0A 1KM5A 1TCDA 3CT7A 4IPJA 3NR0A 1RVGA 4I7WA 3BW2A 1LOLA 5U4NA 2ZTJA 5DCBA 4A21A 4S1FA 3S42A 2Y7GA 4IX0A 5SWUA 1L2UA 1KLYA 1U5JA 4WZHA 1JVNA 4UFJA 2V5LA 3T4CA 3ABRA 1LOSA 4NXSA 1MXSA 2YPIA 3EX1A 4O14A 4MJZA 3LCGA 2ABAA 1NVMA 2YYUA 2Q3OA 5LHEA 5AC8A 1N8FA 1TYGA 3T40A 1R46A 4ZL1A 3VCRA 1PIIA 1OFRA 1OYBA 2QUVA 3W9ZA 3MI3A 2ZTKA 1TREA 3IGUA 4QM1A 2E6YA 1ZY9A 1X7FA 1B4EA 4AF0B 2TRSA 3W1NA 2ZZ5A 3VNDA 1GVOA 3NG3A 2WPBA 4AB4A 3QZEA 3TXZA 3EX6A 4IMDA 2QEZA 2ZZ3A 5HJLA 4Y9AA 2ZBTA 4FX8A 5HUOA 3PBVA 2PRHA 3HIJA 3NQFA 4O4WA 1FWTA 3PG9A 4PL1A 4XUGA 5AC7A 5LNWA 4MYXA 1YDOA 4NJKA 3QJAA 1RQHA 3LCLA 3H55A 3KVKA 3LI0A 3P62A 3G0UA 3TC6A 1UJPA 3W7LA 2ZDRA 3EKZA 5TQLA 5D37A 1TPH1 1GQNA 1GPWA 3WJZA 1FCBA 1NEYA 3W7GA 4HNNA 2BWGA 1VH7A 2E77A 2ISVA 4LS1A 1EP3A 3P74A 1AW5A 5TBOA 3UWYA 1I4NA 4X9SA 3W7CA 5K9XA 1GWJA 4QAIA 3BG3A 3FA5A 1GYNA 1EIXA 1TV7A 2OX1A 4XTDA 3V75A 2FB2A 3NPXA 5EMUA 3TFXA 3IGSA 2A7PA 1FXQA 2WSYA 4O53A 3RLUA 4FX7A 3C3NA 3HOJA 3VFLA 1ADOA 2Z2UA 3NQAA 3A22A 4PCFA 3SIZA 1OFPA 4NU7A 2QAPA 3LTPA 4UR8A 1XBVA 1K7FA 1Q45A 3MBFA 3M5XA 2YXGA 3A5FA 2NWSA 1YPFA 4WY0F 4BK9A 3CIXA 4Z1DA 3SGUA 2R14A 4DO6A 2WKJA 2X2GA 3DU0A 2OCZA 1TSIA 2QCCA 1CI1A 2FPTA 4M6PA 4AEOA 3LOTA 4O8RA 3QQ0A 1E51A 5D2YA 3S5ZA 3QFEA 2ZA2A 1ME8A 3IVSA 4LVAA 1HO1A 4LVGA 4O12A 1W3IA 1AK5A 1JCYA 3S8HA 4Z0SA 2VKZG 5D2VA 3W87A 3N2XA 1L6WA 1LDCA 3KX6A 3F4WA 4N9BA 2VENA 2ZZ4A 4UMCA 4NNCA 2A0NA 3HQ1A 4JGDA 4KFPA 3A9IA 2E68A 3TROA 4GC4A 5CPLA 4Q32A 2CLKA 1TPC1 3GDMA 3KAOA 4OGZA 4MYAA 1H50A 3P5YA 4MY9A 1VRDA 3EX3A 4NJGA 1K02A 1OFBA 1TJRA 4UNLA 3OEXA 5D2WA 3MYOA 4I7VA 3TE9A 3CM4A 3T7VA 1JCXA 4N2YA 4NXKA 2G5WA 1DVJA 1GVQA 2E5CA 5LNSA 3Q2DA 4AWUA 3MBDA 1MEIA 5I3GA 1M5WA 1LRQA 4CQAA 3N19B 3LLDA 4FB7A 1OG0A 3MP3A 2GQAA 2NWRA 4B5NA 2Q8LA 4TMBA 3W2MA 3MYPA 1A5SA 3PSVA 5G1TA 3UYCA 4JTHA 4CNOA 4WOZA 1GVFA 4MY8A 1O5KA 4BWLA 3T55A 4CQ8A 5HR7A 2QR6A 4HT3A 1TIMA 2F84A 1LTDA 2V2DA 2R94A 1VGAA 2UV8G 3H54A 3L65A 1W3NA 2R91A 1ICPA 1EUAA 3L5LA 3CC1A 1AL8A 3QW3A 3NQ7A 3IGXA 2VFFA 3G22A
chains in the Genus database with same CATH superfamily
2DZUA 2VDHA 4Q8OA 1A5AA 1DYSA 3MKKA 5U7SA 3B4UA 3R79A 3GUWA 1UJQA 2QGHA 4F79A 2FZ9A 1ADSA 1TB3A 2CCRA 3NQBA 1DE5A 4XBSA 2XIOA 3ARPA 2ALDA 3L68A 3AHYA 4EP8C 1KR0A 1E6QM 2Z27A 3FCPA 4C5YA 2QJJA 2FVLA 3MJYA 4YLWA 3YPIA 3LXCA 1G7UA 1K8CA 3L4UA 3IVTA 3PZTA 2VEPA 1OGSA 4Q7NA 3THDA 4X61A 1LORA 2X2YA 1I1XA 4BEUA 2D0GA 4LBSA 4L61A 1OF8A 2OGJA 4LCRA 4DWSC 3NA8A 4HK7A 2A79A 4C6CA 3CZLA 4FXRA 3N6HA 1RH9A 1FP8A 1VFHA 1FWNA 3IIXA 1TZ7A 1HL9A 1P0EA 3EOOA 2NW0A 1YIXA 2QCHA 3SM0A 4R7WA 1XRTA 2PE4A 3LGGA 2P3ZA 1V93A 4PMZA 4Z08A 1LUCA 3WQGA 2Z6JA 3W81A 2G4JA 4M5PA 2JIEA 3EOSA 3QXBA 5HUPA 1XIJA 5HULA 4DJFA 2VOTA 4C6EA 2PLCA 3HQPA 5BMXA 5LNUA 3P0WA 3ELFA 4FLRA 1XFBA 2XZ9A 1MFVA 4GE8A 3HGSA 2ZE3A 4KH2A 1ALDA 5LA0A 5EBAA 3KVLA 1Q6GA 1YYAA 4R7OA 2NX9A 1E4NA 2Z0IA 3QSRA 3K30A 3ZM8A 2KAUC 3H7UA 3T8QA 4KESA 2OWXA 2VNCA 1I2OA 3CJPA 1JCTA 4MSSA 5FF3A 3W7RA 5T9CE 2E3ZA 1VYSX 3ARSA 1FHLA 2Z1XA 3P60A 3DC8A 8XIAA 2ZE0A 3A21A 1TPEA 1YBQB 2HK1A 2B7PA 1QPKA 4BHYA 2WK2A 1DWFM 3KFTA 1IXPA 1E3ZA 4GPNA 4PCSA 4MGGA 1T7LA 2NVAA 4F2UA 4HHLA 3TA6A 4E8GA 2E25A 2ZQ0A 3W1AA 3M5ZA 1J79A 3SCPA 2HSAA 1OIMA 3LCHA 1E73M 5HWNA 1ZAIA 2PPGA 4J3WA 5IXEA 5ENLA 1Q6QA 4ZGYA 3KBMA 5LA1A 1ELSA 5I24A 3ZLFA 3SZ8A 1H2JA 2JE8A 4HU3A 5DBTA 1JAEA 1F76A 1YW1A 4UTWA 5CH9A 1P0KA 4RNFA 3VGGA 1CLKA 4CQ9A 5A8OA 1LWIA 4B3LA 1Q2SA 4Q4RA 3V5CA 7REQA 2NX1A 5HMDA 2AL2A 2QCDA 4I5XA 1B3ZA 4BEQA 2CETA 3O6CA 4LVDA 1JZ3A 3IK4A 1P1MA 4ZO6A 2QJMA 3C2RA 3FNDA 3MU7A 1POKA 1XD1A 5G1YA 5TIMA 2EJ1A 1BYBA 2X8RA 2XGIA 2MNRA 4D72A 3VO0A 4X9YA 1QPQA 4LAMA 4HMCA 2DORA 5JIPA 2E1WA 1NP2A 3IIVA 1CPUA 4KEVA 3GVGA 5BWAA 4R5EA 6REQB 3I7QA 1Y8BA 1Z32X 5AOUA 4YL2A 2DQWA 5DEZA 2REQB 5C54A 4HSNA 2L5HA 1PE1A 3ZVHA 3PZUA 4MLJA 3CUIA 3BZJA 4QRNA 3SI9A 5CZKA 4ZZ9A 2OXNA 4I8YA 3TTQA 3WJXA 3LGEA 5CG0A 5A2BA 4PB4A 4GQBA 1IEQA 1NF0A 4DLMA 1FWFC 1M7JA 1QW7A 4MAVA 5XINA 3V5FA 3GIQA 3VVGA 4AWTA 2FVMA 4CCZA 3R94A 3RILA 1CENA 3ARVA 3OZOA 2HS8A 3W7MA 1YTKA 1I1WA 3D3AA 5AHEA 4B15A 2R1LA 3PR2A 4AD4A 2WM1A 2HE8A 4RDWA 3RFAA 1UR4A 1EEPA 3R1ZA 4PTVA 3GHSA 3NGFA 4RKAA 3SB0A 4D6FA 3DYMA 4DZIA 4H9VA 2P1FA 3M0MA 2DVUA 3ZT6A 3WMCA 1XSIA 4AWEA 3LSCA 1K3UA 4QAWA 3R7MA 5CGTA 3FLUA 3VKDA 3TTOA 3SY1A 3W6YA 3WEMA 2F38A 1UWTA 4DELA 3W0KA 4BCEA 3H4XA 1EP2A 1R3VA 3ES7A 3MP4A 4HHPA 3CPGA 5HR6A 3V1HA 4GO8A 1PTGA 3CQHA 5GVJA 4EF8A 5FJTA 4WGXA 3NZGA 3GYCA 2HEJA 4O28A 1F3TA 3BJFA 1KRBC 4XAYA 5A6TC 1OFAA 4KCWA 4DPPA 4NZJA 2P0OA 1IF2A 2WBGA 2HE5A 8TIMA 4JKLA 3CHDA 1HQTA 3W00A 3AC0A 2NQJA 3D0CA 4UR7A 4CD4A 1XRSA 1BYCA 3DC0A 3FAXA 1CGXA 3AIEA 2ABBA 3OHIA 2Y7DA 4GABA 1UH3A 1G69A 3VKJA 3NQVA 3AHVA 3BLPX 3B06A 4Q4SA 3SCTA 4Q7IA 3TTEA 4GVFA 5EMKA 4E8CA 3BANA 2QGYA 3FY1A 4M7SA 3TQVA 1GYMA 4NZCA 2CLHA 1YTEA 3DHUA 3C8FA 3P61A 3IJDA 3KP0A 4JOMA 4I9AA 4A2RA 4CEUC 1N82A 1W0MA 1R9YA 4U3AA 4RNIA 4E4FA 2EPHA 3LTSA 2OSXA 4QCEA 1M65A 2WJEA 1HVXA 4Z17A 4FXJA 2Q71A 1F05A 4PL2A 3CWNA 5JUVA 2V3EA 2XPKA 3GK0A 3GYEA 1CDGA 2PMQA 1Y65A 3T9PA 4ICNA 1QO2A 1M3UA 2UY5A 3W73A 5F2MA 3TJLA 3NO1A 3CMJA 5D9OA 4MDPA 4WXZA 3UGVA 3H4WA 3HG5A 4WOQA 4DEFA 3F2BA 4WR3A 1DTUA 1E5JA 4X22A 1C7TA 1BYDA 2C18A 2XSXA 4ZA0A 4P7OA 1WO2A 4IIGA 2ATMA 2NLYA 1EF2A 3RNDA 4JIPA 5F2LA 1FDJA 2TSYA 1ZCOA 3ZWSA 3N25A 1TJ2A 2DU2A 3G1AA 3VOGA 3V0TA 3B40A 3BLOA 1UQYA 2FQIA 2VQUA 1RHCA 4XZWA 3EMZA 1W9PA 2V3FA 4AZ5A 4GRSA 4JAWA 2FMNA 1KXVA 1WXJA 3NQ8A 5FSEC 1PO9A 1XH2A 1MQPA 4FNUA 5CPTA 3M9YA 3M4HA 2E1DA 3DFSA 4UIOA 1OX4B 5D04C 1BXCA 3NPWA 1TTIA 2YCLA 1DHPA 2WJFA 1GJWA 2ZUTA 2XTKA 1QNSA 1JF6A 4O1AA 1T40A 4QE1A 3NO5A 1XGEA 2PGEA 4O18A 5DX7A 1KWGA 1S5WA 3L2IA 1RCQA 1XC6A 4P8UA 1JGIA 2X0HA 3AIBA 4UTJA 1WZKA 1MXDA 2Q01A 5HNNA 1JDAA 4IP5A 4AH7A 3WH8A 3W37A 3MVTA 3PBMA 1HP5A 3L5AA 2OOFA 1J10A 4BQ4A 2BZNA 2OZ8A 2NX3A 4KGLA 1DWGM 4NVTA 2XIBA 3V4BA 1HJQA 3KXQA 3NDOA 4F0KA 2C19A 2Y62A 4H83A 2QF7A 1JDDA 1FDZA 3AISA 3HG2A 3THQA 1BKHA 1O68A 1NOWA 1R3TA 3UR5A 5TNVA 4IGHA 4PCTA 3NVTA 1QW9A 4DWSD 1PX4A 2DT0A 3E2QA 4IT1A 1XM3A 3LHUA 3W1XA 3MKVA 3LUTA 4LPCA 1GW9A 3VGHA 4ZFCA 2ISWA 2Z1SA 3O07A 3ID7A 3FKRA 3KHJA 1YADA 2ACRA 5AECA 1LL4A 2I17A 4GVGA 1EPVA 4Q7BA 1Z41A 4GUJA 3SRDA 3MA8A 1MEWA 4PZVA 4WKFA 3NM3A 3GX9A 4PUEA 2VFHA 3BJTA 4AX6A 4HD5A 1VEMA 1XLGA 4L6HA 4EXQA 3TW6A 4ADTA 1VQTA 1HVQA 4AHQA 2J7DA 4LXFA 4AF0A 1C8YA 4JIQA 4RLIA 5I79A 3GR8A 1JL8A 5FL1A 2A6NA 1UOKA 3BCJA 1RLDA 3WFLA 3ITYA 2PDCA 4MJ2A 1H49A 4B2DA 2ZX6A 4E4UA 1XLBA 3Q65A 1ML1A 3WFAA 3GTHA 3WDIA 5BU9A 3NQDA 1ISXA 2CWXA 2KZHA 3FX4A 1X98A 1DE6A 1BF6A 2W3ZA 3UXIA 1M01A 2DSZA 1IE7C 4UQEA 3HPSA 2J62A 1PCWA 3BLIA 4QSHA 1L8PA 4IFRA 1XDJA 4FNSA 3WUBA 1YXCA 4NT0A 5M03A 1IT7A 4UFKA 3WF4A 1PTDA 1R2RA 3CUGA 1Z89A 2YB1A 4JICA 3TYCA 3THUA 1IT0A 3TLQA 4WKAA 2J7CA 2RDUA 3WLNA 1V8EA 1NJJA 5CPOA 1J01A 4W84A 2A2IA 4US5A 1VPXA 1BPLB 3DBNA 1X7IA 4MNLA 2HNEA 3APTA 4TIMA 4KT2A 4K2SA 3QOKA 1TE6A 1I0DA 4ZO9A 2XH4A 5HPOA 1IXOA 1LWHA 4HJFA 5XIAA 3E2SA 3O15A 1SM9A 1B9ZA 1REQB 2CLMA 1JR1A 2D2OA 5C2GA 1POJA 1EOMA 4GXPA 2NV1A 2WOQA 2IXUA 3FGCA 3GNXA 2CLLA 1GQLA 2HPIA 3WQPA 3GH4A 1BXBA 1X39A 2HS6A 1HJXA 4LUYA 3OLEA 4GFSA 4IQDA 1SFLA 1A50A 1V6UA 2Y5JA 2OB3A 4WUIA 1WCGA 4NUWA 3PBWA 1QFEA 3I6EA 5FSDC 1K03A 2B81A 3RG6A 2V5CA 3WNLA 2PDUA 3B0UX 1K8ZA 1OBAA 3OA5A 8A3HA 3K4WA 4L80A 1TX2A 1LCOA 2C1GA 3IJ6A 2P50A 3ORWA 3CTTA 4WQ6A 3BURA 4CD5A 3PANA 4I5UA 2V5DA 1B1YA 3RCYA 3T6CA 4UUIA 3C86A 1H09A 3VUPA 2DZTA 4PCPA 1NU5A 1B9BA 2Y89A 4DN1A 4IUOA 4V1YA 5EA9A 2FTWA 3ZOAA 1AA1B 4DI9A 1KFWA 1SR9A 3G18A 1EJRC 2BODX 3DN5A 3UNDA 3DIPA 4YJ5A 4EAYA 2XG9A 4R33A 3CIVA 3EDFA 1Q65A 3HV8A 3GXPA 3PFMA 4NNBA 3T2PA 3XINA 3WQEA 3UT0A 1O66A 1DHKA 4S38A 2P8BA 4JY9A 3GH5A 2EBNA 3U0HA 3B0PA 4LTSA 3F4CA 3A47A 3SJ3A 1EO5A 3GO2A 3E2VA 2B7QA 2NQ9A 1XLCA 3QTGA 2AAMA 2GVJA 4REQA 2Q8XA 4LQ1A 4GIYA 4DF1A 4IJBA 2IXVA 2G3NA 4PA8A 2JF7A 3II1A 1ZQ5A 5TD4A 4MB4A 2XVNA 2WCSA 4GOAA 1XBZA 2XH0A 2IS7A 3QLDA 1KFCA 3GB6A 4RNJA 4RE3A 1KTNA 2B7NA 5AHLA 3BH4A 4LUSA 1G4SA 1Q8AA 1K8YA 1PYMA 2NUWA 1P7TA 3PTDA 4E38A 2WBKA 4GJ1A 1VFMA 2E8ZA 2PI6A 4B4HA 1TRIA 1FFQA 1WP6A 3AOFA 1TCMA 1ICSA 3DFOA 4TR9A 3REQB 4IIHA 3HU7A 3WQ8A 3HPZA 5G1MA 4DAFA 3GBEA 2FB3A 4DXXA 1E0UA 2C0AA 3QPZA 3D3FA 4AMAA 4A6GA 4F0LA 4XKYB 4Y7EA 2J66A 5F1VA 4A3HA 4F9DA 4FO4A 4UTIA 4W7WA 4BQ5A 3AZTA 1G5AA 1HTIA 2HZGA 2D69A 1KCKA 2GSEA 3BMXA 2EKCA 3SGGA 3HGOA 1PJ9A 3MDWA 5FD0A 4BA0A 3GBDA 1RLCL 1UWUA 3TR9A 3ARQA 4TMCA 3TCEA 1EFZA 4DJED 2CU0A 4C91A 3BICA 3U2OA 3EWZA 1XCXA 3VAVA 1KTBA 2IQ0A 4PUNA 4I8DA 1F3EA 2XZ7A 3DBPA 5CC7A 2VC7A 1VJZA 7TAAA 4FMVA 4RPPA 2EHHA 5A5WA 3AJXA 1TMHA 1HO4A 4RX0A 2Z28A 1FH7A 4R9OA 2Q09A 1RQBA 1JF5A 4P2VA 3KTSA 1O7AA 3VD9A 4CQCA 3PWAA 3IVUA 2XVGA 3WQ6A 5H1WA 4ZO8A 1KCZA 4FNPA 3ZR5A 3SCWA 3G24A 4IG2B 2WVTA 1VBHA 5LGZA 5LXXA 2G3JA 1FWEC 4O13A 1A3XA 3LBCA 3HG4A 3P3BA 2OG9A 3QQ1A 3WBEA 1UD4A 2ZXDA 4FXFA 1VPYA 3MDUA 2ANUA 1QVBA 3P8IA 1DJXA 1ZP4A 1BFNA 5AY7A 3DEQA 2V5BA 2F7FA 4NJJA 2BHUA 3IRDA 4H6KA 4AZHA 2QV4A 1M6JA 1UCWA 3ARWA 3O6AA 4O0KA 2C14A 3KDNA 3K4DA 2VEKA 4HJWA 5AYBA 5HINA 2X40A 1YDVA 4Z2IA 1I2PA 3LX9A 1BTMA 2BOGX 3RO6A 4XD3A 1MNSA 4W87A 4J28A 1KM0A 1HGWA 2X16A 4LB3A 3S83A 3VGBA 3PUEA 3W1PA 2FYMA 4ZOAA 5CBIA 2I7GA 5GPRA 4M82A 2W9MA 3EEZA 3FHQA 5K4ZA 1KM6A 2G8ZA 5IBXA 1ESWA 1SJCA 3EX2A 2NV9A 3GWQA 2VEMA 3S3GA 1VFTA 1CT5A 3CUZA 2V2HA 1XLMA 1A5MC 2PRMA 2J8GA 4NJHA 3NSXA 3DDMA 3I3EA 3PZQA 4P7LA 3UY7A 1UIPA 1UR1A 4FF5A 1K9FA 8CGTA 1FRBA 1HUVA 1VFLA 4ATLA 5CCZA 1WDPA 3SECA 3WQVA 4FOUA 1CTNA 3FK4A 5G4WA 4TV6A 4WXYA 3WQWA 2I9UA 3M41A 7ODCA 1OFQA 2BVYA 3UEQA 4Q4OA 2Y7FA 3MMTA 3UZJA 1CECA 5JBFA 4W9TA 2POZA 2B31A 3VNKA 3OB8A 3AWNA 4FSAA 4HNOA 3VIHA 1PYFA 3S5YA 4WEVX 3VKAA 1SW3A 1RJRA 4WJ8A 1GT8A 4O8AA 1YNQA 4HB7A 4JR5A 5C6MA 1VCGA 2JQXA 2VD8A 4NQ1A 1PZ0A 1MO0A 1TPUA 5IRPA 3ZXWA 3M0VA 4ZQNA 5HJYA 2PDYA 5DCDA 3UG3A 1VFSA 2DDXA 4JDYA 4QSFA 5H8MA 3BAKA 2JFEX 1FH9A 4W93A 3H26A 3FOKA 1SO4A 4YWSA 4G7FA 5D9MA 1JYVA 1QR7A 3SEPA 4GH1A 4EIVA 2X1UA 1UW9A 2X0SA 4H6EA 2I56A 2RGMA 3NUKA 3WD2A 4AU0A 3WBXA 4M56A 1F9CA 2VEIA 4NAEB 5A6LA 4LAKA 4D6GA 1E0WA 1QWKA 4G6CA 3S47A 1K8XA 3WEOA 3TJXA 3VD5A 3UZXA 4GY1A 4DF0A 1P6WA 4UTLA 9RUBA 1G4PA 3BAIA 4M7TA 4FOJA 1FCQA 4DUVA 3UP8A 1P5BA 3UJEA 1Q3NA 5LSMA 3VIGA 2GUBA 4B91A 3TN3A 3KWSA 1U83A 2XFFA 4GXMA 1V03A 1OHLA 3M1ZA 1J8VA 5KMYA 1EH9A 2F8QA 2A3BA 3IGHX 3VGEA 3LRLA 1Z44A 1DXIA 1Y5WA 2W6RA 1SSGA 4O1DA 1KBLA 7A3HA 4GNVA 4HSHA 4QEHA 3CEPA 3KOFA 4K39A 1Q7QA 4LB4A 5D09A 4XZLX 2D24A 2O4MA 3PJTA 2WNWA 4ASTA 5HA7A 1NDVA 1QHOA 1ZALA 3KZSA 3MP5A 3HPAA 5DN1A 5EMLA 2ODOA 3LHWA 1W9BM 3WLJA 4QEEA 3GTXA 2HBXA 2R1MA 1US3A 3CIWA 2TYSA 3USBA 3TEVA 3H21A 5C0QA 4C6QA 4TTGA 4LYQA 4GA8A 1EHNA 2ZUUA 2ZRUA 1KBJA 1AFSA 2OEMA 1M1BA 2E7FA 2YL8A 1OQFA 3M7SA 2IQDA 3WH7A 1A4LA 4AAJA 4DM1A 4EVZA 2GVEA 5LIKX 1DEDA 4CNUA 2INFA 1GOIA 4WGHA 3O6DA 3SUSA 2JGQA 4GWEA 3LI1A 3LNMA 4WSHA 3AZRA 1JDEA 1RVGA 1KB3A 4I7WA 2G0WA 1JDFA 1LOLA 3VNZA 2ZTJA 2FZNA 3CUJA 1KRAC 3S42A 2D2HA 3CMGA 4IX0A 5CSYA 1L2UA 1KLYA 4FLQA 2XVKA 4JQ2A 1LL7A 3LCGA 2ABAA 1JYXA 3Q67A 4KERA 4Q3MA 5LHEA 3GIPA 1OSEA 2Y5EA 3UG4A 1KRMA 3W24A 2IPGA 1OD8A 1TREA 3AIVA 4QM1A 3IGUA 2E6YA 1X7FA 2TRSA 1FP9A 5BCAA 4AB4A 1PKNA 4B5XA 2PFHA 4L56A 2QEZA 3JU2A 3PPFA 3GC4A 3OGRA 4GI6A 3NQFA 3PP7A 1HJWA 4I9MA 4C6NA 2GFTA 4XUGA 4WF7A 4MYXA 7PTDA 1J0IA 5C2CA 3UETA 3BQ5A 1DWHM 3LCLA 3H55A 3KVKA 3LI0A 2YCIX 3T4WA 1UKOA 2XM1A 4DNMA 2WSKA 3TC6A 1XH1A 3W7LA 4V1XA 3V3WA 3EKZA 2QUMA 3DUGA 1TPH1 4JTCA 1OC5A 3R25A 4XO7A 3IV8A 2VC5A 1VENA 2E77A 3OPSA 4KRZA 1EP3A 2GVYA 3N3TA 4XUYA 3VDCA 3W7CA 1TZ9A 1GOMA 1TV7A 2G3IA 3FV9A 2DVTA 3CWHA 3NZQA 4F8XA 1MYRA 5GJPA 5A1AA 4URIA 3ISIX 1MUCA 1ADOA 3A22A 1XCWA 1XBVA 2IMRA 1K7FA 4PTXA 2E8YA 1YPFA 4WY0F 4BK9A 2VVSA 3PZ9A 2FGLA 1E0XA 1P48A 4PMUA 2ASHA 4MMWA 4B90A 2X09A 2WCAA 4Z1DA 3POCA 3FYYA 3IK2A 4DO6A 2OCZA 2QCCA 4YYFA 3NO3A 1NOUA 2QMKA 1IEIA 5D2YA 1RY0A 1I75A 4MWAD 3OTRA 3VC6A 1XLFA 4AD0A 1HO1A 4DNHA 4O12A 1W3IA 1BG4A 3QR1A 3CAQA 5GNZA 3N2XA 1Z6KA 3F4WA 3DG7A 2A0NA 4AYGA 1RVKA 5FKYA 3A9IA 2HISA 2E68A 3G6MA 3NDYA 3KAOA 1GQJA 1FHVA 2DSUA 3BLKA 3P5YA 3EX3A 4CU8A 5LXEA 2BASA 3OEXA 4I7VA 4ILSA 2D2GA 2PLJA 5BRQA 1MEIA 4HP5A 5I3GA 4CQAA 1RJPA 4JNYA 1NELA 3MP3A 1MUMA 5EFFA 4W4QA 5M1TA 2YJQA 4TMBA 3W2MA 3MMUA 4WCJA 3BJSA 3PSVA 3QV7A 2Z25A 1UD5A 3N04A 3QTPA 3T55A 4QJ4B 4PB3A 4CQ8A 2QR6A 1Q4WA 2F84A 3B0XA 4IM4A 1VGAA 2GZXA 1EUAA 3MQTA 3L5LA 1ZPTA 3QW3A 3G22A 1RP9A 3LHTA 4C7GA 4WKHA 4P8XA 1UWSA 2FKPA 3WBAA 4IPLA 3OP2A 4YCOA 1G6CA 2YBUA 1C9DA 5F7UA 1R85A 3S1VA 4HCDA 5I00A 4MUZA 1UD6A 4LU0A 5DY3A 1E72M 3PJWA 4JTFA 1CW2A 3KE0A 4FK9A 3PTMA 1BKSA 3ZYZA 5FACA 3BL3A 4GACA 1JD9A 1T8QA 3FVMA 2PTDA 3BLDA 2VGFA 2FHBA 4CD7A 4LVFA 1N7KA 3NQCA 4LGXA 4LNYA 4DBDA 5FOOA 1GCYA 3AALA 4BZYA 2EEXA 3AMGA 3PF3A 2DUAA 3BOLA 1RBOB 4QDWA 1WYIA 2Z1VA 2OO6A 1EKOA 1JULA 4U2YA 4FIQA 3PUDA 2LLEA 4HK6A 1UB3A 1QPRA 3QSTA 2PCEA 1PZ1A 4HNTA 3LYEA 1RZMA 4UOZA 2VVNA 3W2UA 4X3ZA 4HA1A 4GQGA 4IX2A 1UQZA 4C7DA 4H2CA 1AODA 1QAPA 3BAYA 3UGRA 1YHTA 2RDWA 3V35A 2F6UA 2XISA 1TPDA 3SCVA 1P6CA 3F4VA 1E1CB 1VC4A 4AHPA 1UPMB 1CX9A 1K6WA 3RXZA 5F2IA 2J7FA 5DRCA 4A8LA 5JXQA 3E5BA 1Z42A 2HDJA 3TSBA 1F3XA 5KZEA 1WDSA 5IM51 2I57A 1PIFA 4ZXLA 3P5ZA 1FWHC 4KWWA 4C1KA 3SR7A 3EWCA 4UTFA 1PDZA 4P7QA 1Y0EA 2G95A 4OJYA 5HBFA 4DI8A 3VUSA 4CNTA 2VX4A 2XYLA 1FCUA 2YDAA 4PSPA 3RMJA 5K4XA 2XSBA 4X2RA 4UQAA 4CEXC 3UR7A 3ZLHA 4K1GA 3KHDA 2OX4A 1OJXA 3A23A 1VHNA 4MNKA 3N9KA 3OVQA 4E6MA 3GW0A 1OWQA 2YX0A 4ZXOA 3S6OA 2FMOA 2QKFA 5T9BG 3NJ3A 2ZOXA 1XUZA 3S5NA 2V63A 3GC5A 3EA1A 1VS1A 4KQNA 3GTNA 1ZJBA 2Y6ZA 2TODA 4NF7A 4JQAA 4BQ2A 5AC6A 2Z2AA 1TMQA 1TJ1A 5CC3A 1TX0A 3QHOA 1O6IA 1DJWA 2RAGA 4EWND 4IFKB 1DJZA 3PB2A 4JEJA 5LKYA 5LIUX 5JMUA 1MW2A 1ITXA 2XN1A 4AZCA 2WZHA 3ITOA 3SGZA 3DECA 3IIPA 3JR2A 4BFAA 1EWDA 2FHCA 2W62A 1XIMA 2Z00A 4W8BA 4KEMA 1FWSA 1V6WA 3TCSA 2WLZA 3IEBA 3W1TA 1J18A 4JPGA 3ZSSA 3NQ2A 4QXIA 3CU2A 4H9UA 4RR4A 4JN8A 3QV8A 3OG3A 4F0HA 2RDXA 3DCPA 1SW7A 4KWVA 5BMWA 4NJIA 3A3WA 3SY8A 3HG3A 4B3ZA 2TPSA 1WE5A 1XLAA 3L0KA 3CZ8A 3SCOA 5M3WA 3VM7A 3B9OA 2YDSA 4DWSB 4W8AA 3Q58A 3GXMA 3FEQA 9XIMA 1JD7A 1JUEA 4EPBC 3HTWA 3C0QA 5D32A 3PZOA 5EMJA 1PCKA 2DZBA 4M81A 5I78A 3QC3A 1DIOA 5A95A 4JN7A 1X8FA 3MUAA 5FEXA 3VOJA 1YDYA 1R3YA 3E49A 2DZXA 3MHUA 4PTWA 1V02E 1JZ4A 3TYDA 5C9WA 5F4WA 4IJRA 4DO7A 4RDYA 2VXNA 4PBFA 1I2RA 4JX5A 2X7WA 4X2PA 3WDHA 3H23A 3DHFA 3GRIA 2J74A 1AQ0A 3UCDA 2PP0A 1B5TA 3QY7A 4E2DA 3V36A 4IFOA 1WUFA 2Y7EA 3NZRA 3QEZA 4I7UA 2VL4A 3RM4A 3RM8A 4Q6JA 3C6CA 2OPJA 3AMLA 3OJGA 1XCFA 3GNDA 1T99A 1O94A 1E9LA 2QW5A 3W28A 4U5KA 1G67A 1HKVA 3ITLA 1A3HA 3ZSTA 4J5NA 2BS9A 3ANYA 4QCFA 1T0OA 2IKHA 3WLMA 3B3DA 1GOOA 1KXQA 3HN3A 4K8EA 4YTQA 1XI3A 3GE7A 1UUMA 3OGVA 1IQ8A 4TX9A 3O0KA 2YCEA 4BI7A 1RCXB 3QY6A 3KBWA 4IMFA 1WV2A 4JIEA 3S2NA 3GFXA 3R13A 2G37A 1H3GA 1PKMA 3GVQA 2H3BA 1XYMA 3WNKA 1U2YA 3CYVA 3NGJA 4J3TA 5AYYA 4DQWA 1NP0A 3MY9A 3M0LA 4V33A 1KM2A 4NYUA 2PCQA 1UA3A 3AHXA 4V2XA 3QGAC 3OVPA 5E5CA 4GZJA 1OK6A 2CHNA 2H8ZA 2FHFA 3PHAA 2O9TA 2OEJA 3WEZA 4RXGA 1KV8A 3W7HA 4UFHA 4ZQOA 4GJJA 4GYPC 4JTGA 2X1SA 2J6VA 3KL5A 3FW6A 3NQGA 3W2NA 4OV4A 4ADSA 5CLTA 1ZZMA 1Z69A 4PUWA 3T42A 3QFWA 3CPRA 3U8GA 4JIIX 6PTDA 1SO6A 2UY4A 4M6QA 1UZDA 4FEZA 1KBKA 2ACSA 7CGTA 3MSRA 1IXNA 3TC7A 2XIQA 3GVWA 4GI8A 4JD4A 5BRPA 4NAFA 2H8XA 3GHRA 4KFNA 4HU8A 1IGWA 3VNIA 1LLWA 3AIUA 3MHGA 1I8JA 2QXWA 2WHMA 2PA6A 3TYAA 1GHSA 1NTHA 3VD3A 1H61A 4GGBA 4IJCA 3SDOA 3B9AA 3STFA 1QOQA 2YYTA 4LNCA 5AFDA 1SU5A 5MKGB 4JFVA 3E3HA 4WX2A 4AVNA 1UR2A 1XGZA 4E3TA 2V69A 4PMNA 2IPWA 4H00A 5CZJA 1XDLA 4ICCX 5CJ5A 3HJZA 1I2QA 3SUTA 3TR2A 4UQBA 4GMEA 4O15A 4O50A 4DUWA 5AKQA 1LQ0A 4OU1A 3GDTA 4D6EA 1B3VA 1TWZA 3M07A 2QIIA 3P8JA 2QUTA 3G77A 4GUGA 1FWGC 2R9RA 5HNTA 3HGJA 1HT6A 4YU1A 4PEEA 7XIMA 3AU2A 1ZNNA 3OU8A 3WH5A 3EOEA 2XM2A 1C3FA 4MY1A 3RK8A 1I2NA 1YXYA 3NNTA 2VMFA 1ONEA 4GCXA 4MKVA 4I9TA 4AZIA 2ACUA 5E0KA 3VCCA 4O54A 3U5YA 2WVVB 4TU1A 3CL8A 1P4CA 5CSSA 5A6MA 1PDYA 3UZ5A 4XAPA 1SJBA 1W1VA 4A3RA 1FH8A 5D8ZA 3VKCA 4UFMA 4ONVA 1EC8A 2FZMA 4WLCA 4KIEA 5KZMA 1UASA 2D2JA 3VOHA 4TV5A 4C1NA 4MKNA 1DV7A 2Z1KA 3GKAA 2BFGA 4F4RA 3FA3A 1KM3A 3G1YA 3VINA 3NVDA 2DH2A 4GUFA 3T81A 3OHMB 1WBHA 5JVLA 2I9EA 5FESA 4DJDD 1RPXA 4PMXA 2WQPA 1JZ8A 4JHMA 5D03A 3H2MA 3GDLA 3KL3A 5LIWX 3UG8A 1UKTA 3B9EA 1UZHA 2J27A 1KBIA 2VCAA 3LQLA 3G5EA 1KFJA 2IUZA 1IWPA 2Z1BA 1F07A 1UG6A 3MWCA 4GYKA 1KGWA 3I7SA 2IQTA 3NSMA 3RU6A 1EJXC 1KXTA 3O06A 2D20A 2PC8A 2ZRZA 1A5UA 1KQZA 2QJGA 2YW3A 4EX4A 1X1OA 2OT0A 4CVWA 2J75A 1H51A 2TAAA 1TWIA 4QE4A 1H0IA 5ABTA 2PP1A 4MDOA 3T05A 4GBUA 4OOUA 3UD6A 3LZ3A 1ECEA 5H8PA 3MWAA 4JFSA 4EF9A 4DJFC 5CSRA 3NAVA 4IF2A 1SMAA 2NQZA 2YGYA 2V0TA 3BQ6A 5FJJA 1HKKA 3I4KA 4CU7A 4W85A 5I5RA 1RBLA 1XQKA 4UTKA 3BG5A 4FS9A 4IP4A 4IICA 1FWDC 4AEFA 2YXXA 4GI4A 4HPXA 3M0HA 1XHGA 3J7HA 1CB7B 4QDPA 4A05A 3W70A 2WNQA 1CGVA 1Q66A 4JX4A 4BKNA 2ZUMA 4AZ7A 4TOQA 2SFPA 1W2VA 2NUXA 2BG5A 2HTMA 2OTDA 4PMYA 1QI0A 2XUCA 2JBMA 3WK2A 1XW8A 1B30A 3TVAA 4B9ZA 1OD0A 1MZHA 1MVYA 2XN0A 3ABOA 4MZYA 2A4AA 1E9ZB 4D6DA 1QNOA 1KR1A 1VF8A 1V3MA 1YNPA 3WUFA 3G1RA 3MZ2A 5XIMA 3TWBA 5FJIA 4LRTA 1I45A 1T41A 4YWIA 4PODA 3RDKA 4HYRA 2A3EA 4JL1A 1W1ZA 1XYCA 2PF0A 1E1EA 2UBPC 1B4KA 5DMNA 3BAJA 1MW3A 4UTHA 4D6CA 4JEQA 5I09A 2PURA 3CZJA 1XWYA 2ZX8A 2WSRA 3U6WA 2JIWA 1O4UA 3ABQA 5FAJA 1D3CA 4QIUA 3S9ZA 3N2TA 1OCBA 2AGKA 3GR7A 1TPFA 3CNYA 1VCFA 3WJYA 6TAAA 1UOZA 1P43A 4WJXA 3RJXA 1J6PA 1V3JA 3ATZA 5ECUA 2PDGA 3A64A 3AJ7A 3C5QA 1BWLA 1J2WA 3DFYA 3M5VA 3GZ3A 5D05A 4Q8MA 1EBGA 4YTSA 2YA2A 2WC7A 3B8SA 3F03K 4GISA 4F0MA 1M7PA 4CCEA 4Y8EA 4LSBA 4UWMA 4MIMA 3G8EA 4O0QA 5HOSA 1PB0A 2PWFA 3NXLA 3LM3A 1OZMA 3OVRA 3N29A 1AJ2A 5CPQA 3L9CA 2NUYA 3LERA 5BNKA 2DZVA 3C0JA 1Q8JA 1G4TA 1K9TA 1W56A 1PV8A 2NV2A 4QJ1A 3VPLA 1BLIA 5CLWA 3B8DA 3AI0A 3RITA 2AQWA 3GDRA 3BV7A 1UUOA 3GNNA 4NNAA 1W9DM 3CTLA 3M0JA 4AG0A 3M5YA 2J9ZA 4D1JA 1GVSA 2VEFA 3ECQA 3S6DA 3VD7A 1FOBA 1TUFA 5D02A 4U28A 4K37A 3TN6A 3VX0A 1B3WA 1XYAA 7TIMA 4LV4A 1GGOA 2EG7A 2HMCA 1DJGA 3N18A 3NPUA 4DBUA 4GLEA 2VRJA 4Z2JA 1EJVC 4IL0A 1QXLA 1IEVA 4HA3A 2PTYA 4AXNA 1NDZA 3ABXA 4DYJA 3TN5A 2RGLA 4MPQA 4BS0A 1H1ZA 5I03A 2E6FA 3CB3A 4MHBA 3WY1A 2GUYA 3WG6A 3ALGA 4H8NA 3DFNA 2EF9A 1A0DA 1U1UA 1I60A 1PPIA 2DVXA 4MOZA 3UWUA 2OKOA 4JDBA 4AC1X 3EXSA 4IGSA 1ZTVA 1MEHA 1DXEA 3MV01 3LLFA 3CS2A 3PVFA 4F40A 3EKGA 3L4ZA 3M0KA 1IGSA 1WB0A 1HKWA 5L6UA 4ZFMA 4O1BA 1RUSA 3FJ4A 2DIJA 1Z48A 3EYPA 1Q6EA 2DY3A 3GHUA 5CPNA 4C6FA 5IOBA 5C71A 3GKFA 3OBKA 2ZZ1A 3UXLA 1A5CA 1M7XA 1UR9A 3B8WA 3NURA 4ZE5A 2V8ZA 3WDQA 5FF7A 1OK4A 2W27A 4WY0B 4MPKA 2XU2A 4GIRA 4GK8A 2EXOA 3SCNA 4L64A 3VMPA 3ZZ1A 1NQKA 4WDXA 1ZENA 4LW7A 5C7VA 1J0KA 1EZ2A 5EGRA 1X96A 2DSVA 3RRAA 3L4TA 4CD8A 1K70A 3I65A 4NZ4A 2CYGA 3WF2A 5C9ZA 5AC4A 1KNWA 3N34A 1M9HA 4KWSA 1UWRA 2IW0A 3DH7A 1N8WA 4CQBA 3OVGA 3VZXA 4YS1A 4L9ZA 2W0UA 2FDSA 1OADA 1VR6A 2WM0A 4UOJA 2VQTA 4NY2A 1KBBA 1ZBVA 1GOQA 2ZICA 3AS1A 3ZWTA 1GUVA 1YBQA 4ACYA 3AXHA 1DP0A 3Q4DA 5AB3A 3VOCA 1MUWA 3CWOX 1JCNA 4XX6A 1NOFA 3UWQA 1EUNA 2CLOA 4W8LA 3H2OA 3H4GA 1Q7MA 3GIYA 1T5AA 1D3HA 2J13A 1WQ5A 4J1OA 4R3UA 2GWGA 4A2SA 4F2BA 1ONRA 2EG6A 1CLXA 2EPNA 4GNKB 2QCNA 2VZUA 3QZAA 2VFIA 3IJQA 3CASA 5A8QA 4Q8QA 4H7ZA 4OFCA 3URBA 3N4AA 3VNJA 3N9SA 3RLVA 2VZVA 1XLDA 3U4FA 3S46A 4GCAA 3W84A 4M80A 1GKRA 1U30A 1OIFA 3F1QA 1CIUA 5BXRA 3PUOA 3BE7A 1YKWA 4MWAE 1HN1A 1WZAA 3MW7A 3NL2A 1M68A 2YW4A 1S5TA 3ITXA 3AXMA 1J0ZA 4IOTA 4PMJA 5DY2A 2CHRA 3W82A 3STEA 3UA3A 2YKKA 2XFYA 4DF2A 4GBDA 1UC4A 4PB5A 4EOUA 2QJIA 5GNXA 1SZNA 1TA3B 3U3HA 1U1JA 1UH4A 2GOUA 4FIRA 2JEQA 2J25A 1EGVA 3V16A 3N2MA 1EWEA 3CHEA 4FXSA 3GY1A 4GC3A 4B5SA 6REQA 1O60A 2R24A 4UTTC 2DIKA 1BEUA 1SZEA 1NWRA 2DPEA 1AW1A 1WOAA 2OSYA 2DZSA 3S6TA 1TR1A 2REQA 4ECLA 1GKQA 2GQ8A 4MTVA 4JN6A 4HYVA 2NSXA 3D5HA 1S5MA 2VTFA 4DO4A 2XFRA 2XIJA 3LM7A 4L4PA 1M7OA 3K2GA 1MXGA 1PEZA 1TWDA 1UZ4A 1DKWA 1UD3A 2DW6A 3ABSA 4XAFA 5FJUA 1TWSA 3CYJA 5AYZA 4EAMA 1BAGA 5K3VA 2J4GA 4C6KA 4O16A 2QT3A 2QVHA 1BTCA 1DWAM 2QCLA 3L4WA 8RUCA 1WAWA 2BSLA 2FGZA 3WX7A 3SCQA 5L9FA 3BGGA 4KRTA 2RJHA 1HW6A 3W7PA 3XISA 1KM4A 2PD5A 3BCFA 3TJ4A 1CNVA 3JUGA 3W76A 2CWNA 3KCLA 5DELA 1BRLB 2Z29A 4RUBA 3ZVIA 2GGGA 1CGYA 3DYOA 4CN4A 5LHFA 4MWAB 3R10A 3TMLA 4TX8A 3VGDA 2OYKA 1D8CA 3FXGA 1AQFA 4ZQPA 5A8MA 1LBFA 1ZHAA 3VCNA 3ANUA 3LCWA 3R8GA 3RO8A 1GVRA 3HQNA 1K7EA 1DL3A 2YL9A 2Q6ZA 5CZTA 1RA5A 4HMNA 3A4WA 2PLMA 4LOCA 1EJWC 1XFCA 2GJLA 1E6PA 4YHGA 2PDXA 4DJFD 1D3GA 2J47A 1VB9A 3BLLA 1XD0A 1V0NA 3WLOA 2YLLA 1UWQA 4KRUA 5A6BA 1OVDA 2OJPA 1E15A 4TO8A 9XIAA 3PB0A 6A3HA 5DT5A 2ZA3A 3WF3A 4K6AA 2BLEA 1EDQA 3ALFA 5LIYX 2A5HA 3G3DA 1U5VA 3LHVA 2GDVA 4OBSA 4DBEA 2JGYA 4UBPC 1V0LA 2PZ0A 3TYBA 1OY0A 3R2GA 3WD1A 2JKAA 1E0TA 5EB8A 4AZBA 5I0DA 1WUEA 2YB4A 5D33A 4UNKA 2GQ9A 1TZZA 1TG7A 2BGQA 4AIBA 3LV6A 3SY5A 1OF6A 3SW6A 2GL5A 4MKSA 1ZU8A 1CXFA 1M03A 2WSPA 1BHGA 1KLZA 1IIGA 5IFPA 3ARZA 1NF7A 5DMYA 2VM8A 4JTTA 2DJXA 5A8NA 3QY8A 1H5VA 5AN7A 1GQIA 3A4XA 4XIMA 5CPMA 3KBSA 2YFOA 4LCSA 1ONXA 1XBXA 2ZXAA 5F4XA 6XIAA 1SYTA 3P84A 2GSJA 1U5HA 3EDEA 5I77A 4XBKA 2PDWA 1WDWA 5AHIA 4NI8A 4PFHA 4DXKA 3HPXA 3UXDA 5C5YA 3LRMA 1VHCA 1H7PA 1A49A 3AO0A 3MI6A 2BBFA 4R34A 2OZ0A 3OODA 5CG7A 4R88A 3I3BA 1ENUA 1GEQA 1XICA 1XSKA 4LEFA 1A53A 4P7RA 2PS2A 3CLWA 2I5GA 1KW1A 4RK8A 3B97A 1W5NA 3HF3A 1F74A 1S1PA 3BG9A 3APYA 2EPKX 4ZBCA 3MCNA 4ROPA 1ME7A 2C71A 3BLEA 1E6XM 2GOKA 2PWHA 3M6DA 5AYIA 1V3KA 3B9DA 1L6FA 1NH6A 3AQUA 1WA3A 3CV2A 1F61A 3EB2A 4RZ6A 3VOIA 2GUUA 1XG3A 2VFGA 3U4AA 4G1KA 4C1LA 2ZX9A 1CGTA 3NQ6A 2E5BA 1FTXA 2WMGA 3S1XA 2VYOA 1HNYA 2DJLA 1UWAA 2FPVA 2E4TA 3V5OA 1OX4A 2WZEA 3DX5A 4QG6A 3CV7A 1W3JA 3NR0A 4NI3A 1ZSXA 5U4NA 2DFAA 2XVLA 5DCBA 4LUTB 4S1FA 2J78A 2PDPA 1GKPA 3MTWA 1U5JA 4WZHA 4UFJA 2V5LA 1R8LA 5A6JA 2ADAA 1MXSA 1QJWA 2YPIA 3EX1A 4MJZA 3WQ5A 2YYUA 4RW3A 5DFAA 2NT0A 1N8FA 2HVMA 3T40A 3JZEA 4W86A 4ML4A 3VCRA 1OFRA 3W9ZA 3MI3A 2ZTKA 1LT7A 1UZ1A 2VDGA 3VNDA 3N12A 3H2EA 5HJLA 3SIMA 1C9WA 4FX8A 3T09A 3HIJA 2FZ8A 1ODZA 3CQIA 2QNEA 1AJ0A 1X97A 3PG9A 3VMNA 4NJKA 1RQHA 4XB3A 3P62A 3D46A 2CESA 4PSRA 3CUFA 4QGCA 2ZDRA 1Z9AA 2YOCA 5TQLA 4N7QA 3AYRA 1GQNA 3KWXA 2BWGA 4H9ZA 1VH7A 2PGFA 4L7ZA 1AW5A 4WDUA 5I02A 4HPNA 2CBUA 1I4NA 4DZ5A 2INZA 5K9XA 3O2LA 1ISWA 4QAIA 1GYNA 1GORA 1QASA 4PMOA 3NPXA 5EMUA 2WYSA 3GTFA 3IGSA 1FXQA 4QP0A 3EB3A 4W89A 3HOJA 2Z2UA 4PCFA 3ME3A 1QI2A 3WIJA 4J4KA 2VO5A 3CL7A 4HOWA 4TX6A 1Q45A 3AHZA 1RPKA 3A5FA 4GQQA 3V0UA 3VILA 2PP3A 4DJEC 1XYBA 3KUMA 3SGUA 2WKJA 3UJRA 3DU0A 3HA1A 1SGJA 1K4HA 2DT2A 4AEOA 3LOTA 3QFEA 2ZA2A 4HOXA 1ME8A 1IHIA 4LVGA 1GVEA 3ZJ7A 1JCYA 1KO0A 2PB1A 1L6WA 3VIPA 1LDCA 1AZ1A 1FVPA 5FA5A 4NNCA 4KFPA 3WL1A 3AZSA 4JTRA 1QK2A 2CLKA 1TPC1 3N17A 4MYAA 3QHNA 1SJDA 3ZLGA 1OFBA 1TJRA 4QFUA 2YIHA 2G4FA 3FHAA 2OR2A 3TE9A 4MB5A 3MUZ1 4A3QA 4XBJA 1MRAA 1J9YA 3Q2DA 4AWUA 1CXEA 1M5WA 4A35A 1REQA 4UCFA 1FFRA 1TVNA 1OG0A 3W26A 4FB7A 2GQAA 3ARUA 4B5NA 4IISA 3EDKA 1W1PA 1A5SA 3GD6A 1BSLA 4TVDA 4CNOA 3TP4A 5FL0A 1QBAA 5HR7A 1IR1A 1TIMA 2XVPA 1LTDA 3WCZA 2V2DA 5E9AA 5C7HA 4TUFA 4C5ZA 3L65A 2OU4A 3KEHA 4GVHA 4XISA 3T0BA 6XIMA 3NQ7A 2VFFA 1QI4A 4QS5A 3WF0A 4HQVA 4JZ5A 3OBEA 2B7OA 4ZOCA 2J7HA 1CEOA 3WH6A 2P76A 3TQKA 3DAQA 3W29A 2VX5A 1US2A 3FYPA 4BWLC 2GK1B 1AZ2A 1VIZA 3GUGA 1J5TA 1GOXA 3WK1A 1HP4A 4LT9A 5E6YA 1E6RA 4K68A 5KTLA 1LLZA 4GKTA 4D8AA 5IFTA 4W88A 3TTYA 3WLPA 5B7ZA 3TTSA 3O6YX 1X6LA 5FJPA 1GJPA 4AHOA 5HMFA 2XGZA 2QPUA 1K4GA 4MZ1A 2QUUA 4CKQA 4HPGA 1GTHA 3W2LA 3W74A 1AW2A 1XLLA 4PTDA 2IKIA 3G1VA 1MW1A 4Z1YA 3EDDA 1JPHA 3A3XA 4JTJA 3W1LA 4EPKA 3MHFA 1CXIA 5JBDA 1OX6A 3B8UA 1C8QA 3KW3A 4OZOA 1KFKA 5AVNA 1AMKA 1BWKA 3W7EA 3P2VA 2ZUWA 3BPWA 1CB2A 4FX6M 1S5NA 4C7FA 4US6A 5EYWA 3UA4A 5BWFA 3GW3A 3O05A 3WK3A 3W88A 5FF4A 1OB0A 1EPXA 1PHWA 2X30A 4ACZB 1VLWA 5JU6A 1FKWA 4N6FA 1X6NA 1KCXA 4JTIA 3BGAA 3BCDA 4HZ6A 1X1NA 1W31A 1W1B1 1XKYA 4QX4A 3MUCA 5REQB 2QV5A 3T2QA 3L66A 4PRTA 4DYEA 5IDIA 3MO7A 3R5EA 3OQ8A 2ZWZA 3ICJA 2GJRA 3M47A 3UU0A 5G4HC 3QGVA 2H9AB 3GXNA 4XSMA 1EOKA 3SSJA 3EKLA 1F4AA 5E1QA 4H04A 5FEWA 1F73A 4NRSA 5TAOA 4JHOA 1J0YA 2W79A 2ZUVA 1EL3A 1Q13A 3BO9A 3REQA 4QJ5B 3M6YA 2PDIA 2WANA 1JAKA 2PDQA 4LX4A 1OYAA 4XKMA 4Q6XA 4AC7C 1TV3A 1KRCC 1TFVA 3TK7A 2CZ5A 4IZGA 5I3JA 1FXPA 2E9LA 2NQLA 4B2DD 4XKYA 4XV0A 2NVDA 3LSBA 2Y63A 2DZAA 4GUIA 3VC5A 1MI3A 1YEYA 3KRZA 2HPMA 1O95A 3AYTA 3WMLA 5HNUA 1W6TA 2J8FA 2A85A 4M51A 1LQ2A 1YMYA 2MUCA 2D73A 3UBPC 4EACA 3GR4A 2BOFX 2FH6A 4N9EA 2DW7A 3AFBA 1AMYA 1KA9F 3O0FA 3WMBA 1HX0A 3AIWA 3V7PA 4AD2A 3E1F1 4GZEA 5FJRA 3BAXA 5E09A 2YCKX 4E2BA 1F5ZA 3FYOA 4PMDA 3NWRA 3WJSA 4G7EB 3I4EA 3VFCA 2CZEA 4G1NA 1H7OA 1O5RA 3ONBA 5CPSA 4H41A 2HBVA 4US5D 4LEQA 2EPLX 2QVNA 1H7WA 4RW5A 4RE4A 4IP7A 4AY1A 4J27A 3F7JA 3GNRA 2QS8A 3C2VA 4UNIA 1NAL1 4LBUA 1V77A 1NM9A 2YLAA 5HAOA 4IMAA 1QOXA 3W01A 2BGSA 1IZKA 2POTA 3N73A 4W5UA 5FAGA 3BARA 4QG9A 1TO3A 1FHUA 1XIEA 1O12A 3HZ3A 2HWGA 1V6YA 3HMJG 1S2CA 2BVWA 2E67A 2YSWA 1WX0A 1QMLA 4I90A 4HTYA 2HV5A 3N1AA 4IG2A 1DOSA 4UCGA 1QUMA 4PN2A 3H2NA 4Y8FA 3WLSA 2PRLA 1D2KA 1CXHA 3ZFHA 2W67A 3PZNA 4AD1A 1NFGA 3EDJA 3KM8A 5F1UA 3MC5A 3VE7A 4UTUA 1Q7ZA 1W1IE 2OO0A 5ABGA 3H8AA 2YZ5A 4HNVA 1LOQA 2OWWA 3KRBA 4HZ7A 4R85A 1JFXA 4FI4A 3IV3A 2XSAA 2Y24A 5CQ1A 4J2MA 1OZQA 1GOWA 3T78A 4B16A 3K8LA 3BOXA 3MCOA 3SUUA 2X1RA 4WSKA 3EMCA 5LYRA 4RV3A 5CAHA 2VOMA 3C2FA 1F4HA 4JNZA 2UY3A 1TV2A 3R8HA 2Z1WA 2VUNA 5E0FA 3LV5A 1JCJA 4PTNA 1P0NA 3G6LA 1X1ZA 1E5NA 4IQJA 3MS8A 2E6DA 4HPJA 2OYLA 1TPVA 4L6DA 3N15A 2J77A 1XSJA 4AYSA 3VNYA 2ZRVA 1EJUC 3S0CA 1PZ2A 1OG6A 1X6UA 2PDMA 2W66A 2C0HA 1XISA 3AMKA 2BMBA 2AQOA 4NIRA 3OA3A 2CLEA 4XD5A 1E4LA 5AYXA 2VZOA 4GYPA 4X60A 4UOQA 1QRQA 3OZYA 1FX6A 3ATYA 1H7RA 1VKFA 4IIBA 4A8IA 2ACQA 2YR1A 4MJMA 3UFYA 1H11A 1QHZA 3P80A 2J8TA 1OT2A 2X1IA 4GFIA 5H8UA 1R0MA 4WDTA 3WKZA 5JQ9A 3EAUA 2FZBA 4HZ8A 4JKKA 3WMSA 1W3TA 1QDSA 1RR2A 2WZTA 1TRDA 2NLIA 5CKSA 3CHCA 4J3UA 2WMIB 2I14A 4UXDA 3LG3A 3MMDA 3DFHA 5AZ1A 4C6IA 4CNSA 3MCMA 4GINA 4HNUA 4ERAA 5A94A 3PZMA 3KTXA 4GO9A 1IV8A 4IPIA 2QF8A 2CBVA 2X1TA 1E3XA 4RE0A 3E2RA 3OYZA 1K7XA 3SN0A 2QZRA 2XIIA 4LH8A 2W63A 4ZE4A 2FGBA 1OM0A 4I6KA 1FWRA 1R87A 2HXTA 3O16A 2TMDA 3ZMRA 4JTQA 1L9WA 3WQOA 3DGBA 1IEXA 1B3YA 1PKYA 4O4VA 4BF5A 3AS3A 3DOPA 1H0GA 3EPOA 4LAOA 4HN8A 4MWAC 1DWJM 4GX8A 1V3LA 3ITGA 3DENA 2XDFA 1M53A 4C6PA 1IXQA 1BYAA 3KZPA 4XIAA 2GGIA 3FJNA 5JH1A 5CGQA 2G96A 1C90A 3S2LA 5DO8A 3B0VC 4KEZA 1JPIA 1H4PA 2GJXB 1Q6LA 3RM9A 3O8AA 2NVCA 4CU6A 2ZUNA 3K5XA 3G1FA 1KWKA 1W1YA 3MB9A 3GAYA 3W1UA 4L4MA 2ZZ7A 4H9TA 3TC3A 3UJFA 4V15A 4HVXA 3WN6A 3USZA 3VIFA 2PLKA 3I7RA 5M2FX 1XIBA 2NSOA 4KBXA 1SJAA 4KKXA 4O17A 1DWIM 4NZ3A 2GJPA 2O9OA 1J6OA 2I16A 5F4SA 4E8DA 1TQJA 2ZC8A 4O1FA 2WZIA 3BAWA 2AKZA 2C91A 3PPCA 2PU1A 2D0FA 2D23A 5FF2A 1FDYA 1EA9C 3CL6A 3ZJKA 5DXYA 1V4YA 2NT1A 1XYFA 1TQXA 1W5OA 4XZHA 1KFEA 2PODA 3TZFA 3FEMA 1XF0A 2QMJA 1D7FA 1A3WA 3CGTA 4P8VA 1VFFA 3W85A 2ZX5A 4PULA 5D2TA 3U5UA 2WV8A 3FKKA 4U5IA 2DV0A 4LUIA 5H6HA 3KOYA 3VIIA 3NCOA 1R9XA 5IHRA 3E96A 1GNXA 3SSZA 3COTA 3TXVA 5A8GA 4ZMGA 3QN3A 4YNGA 4XAZA 1CLVA 4E2VA 2ZCGA 1FA2A 3QQWA 1S3TC 3PNZA 4LY4A 3RJYA 3W22A 4EANA 1EJTC 4YTRA 3NSNA 4S3GA 2WHKA 3TNBA 4NASA 3VKBA 5D38A 4HGXA 3MO4A 3P81A 1P0BA 4FNTA 2JK2A 4UMBA 3IANA 3VA8A 4M3PA 3C2EA 5LNRA 4HU0A 1LLOA 1GG0A 4QQ3A 3LU2A 2VHLA 3BMWA 2FVKA 3RX2A 2BTMA 5A2CA 3T0AA 2IPFA 1E56A 2V38A 4N02A 1FUYA 4J35A 1TJPA 4HMDA 3BMVA 3VZZA 1R38A 3V0SA 4ZEPA 4GZIA 4MZ8A 3HPFA 3IRSA 3TAOA 4AD3A 3R8RA 4S23A 3THAA 2BXYA 2HCVA 4D6JA 1SZGA 1R86A 1LRTA 3EZ4A 4GY0A 2VX7A 5ABFB 4N42A 4WVXA 2XH2A 1UKQA 1S5VA 1OEPA 5AVHA 2QCFA 1CXLA 2F2KA 2I1OA 4DM2A 4L5ZA 5F2GA 1PZ3A 3S5OA 1ECQA 4ZCWA 5I2UA 3BSHA 2BGNE 1IT8A 2OLHA 4KCTA 5BRBA 1YLVA 4S3EA 1KM1A 5EFDA 4IMEA 4F66A 4XVDA 1A5KC 4HN4A 3P6LA 1OT1A 4H9MA 3KCOA 1XG4A 4RV8A 5E93A 2WWCA 4QTGA 3GU2A 3BC9A 2XFWA 3N4FA 4Z1CA 3KOXA 4NZ1A 5LA2A 1G01A 4E4PA 1PS9A 1DIEA 3B8VA 3W25A 3FDKA 1NWSA 1SO5A 2V2CA 1JZ6A 4EKJA 5CEWA 3FIGA 1TV4A 4ZENA 1ZB5A 1EQPA 3W7NA 4P61A 2VDIA 2INEA 3IJIA 4WIWA 4WJEA 3CEUA 2J24A 4AVOA 1VPQA 1IEWA 1PHQA 4OIFA 3INPA 3OG2A 3MSYA 1K9DA 6CGTA 1OCQA 2C13A 3SBFA 1L6YA 4A3UA 2PDJA 2OQHA 1FWCC 1RAKA 5BOOA 1OC6A 1TVPA 3EPMA 3SJNA 3F2CA 3UPBA 1T8XA 3I68A 4K36A 1WOBA 2I5IA 4IIEA 3LGDA 1YX1A 2H3DA 2R8WA 4DZHA 2RJGA 5C55A 4MB1A 2WB5A 2O56A 1AL7A 1FWBC 2EAWA 4F0RA 4K3ZA 4H9XA 2OVLA 1XXXA 1EBHA 5CBJA 3DFPA 3W2KA 3AHTA 4NRRA 3UWEA 2HXUA 4CUCA 3EWYA 3SQSA 1GYLA 3E38A 5EY5A 3W6MA 1W17A 2P8CA 4N4PA 1IR2A 1Q6RA 2CZVA 4K8GA 3AYSA 3S9YA 2ZRYA 1DQWA 3QH2A 3RUBL 1C8XA 1K6AA 3HFTA 5BXTA 4LALA 4JTLA 1DJQA 4JX6A 3MUIA 1QK0A 5CZ0A 3PJXA 2PTXA 2RKXA 1PUDA 1SPQA 3ONCA 2PWGA 1G9HA 4DAIA 2PWUA 3VE9A 4TXEA 1NARA 2E40A 1UP0A 1U33A 3U7BA 4XZBA 3UWZA 4LS0A 2D3LA 4