3C56A

Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(3-hydroxypropyl)-glycolohydroxamic acid bisphosphate, a competitive inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
307
structure length
297
Chain Sequence
MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIAVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Synthesis and Biochemical Evaluation of Selective Inhibitors of Class II Fructose Bisphosphate Aldolases: Towards New Synthetic Antibiotics.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 112
structure length 297
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c56A00
3P62A 3S1XA 3W1MA 3BW4A 1VS1A 1TJRA 4BWLA 4PL2A 3F4NA 2DZTA 1T8XA 1YPFA 4QAIA 2BTMA 3PSWA 4I7UA 5HWNA 4MZ1A 2E6YA 5D37A 3GR7A 5AHIA 5I3JA 4UFIA 3QF0A 4LVGA 2C19A 4CQAA 1A53A 3E0IA 4IUOA 4QISA 4HNUA 1GQNA 5BW6A 3A21A 2DZXA 2EGZA 1MO0A 1W1ZA 3W2KA 5K9DA 4DO5A 4Z1AA 4JTKA 1K8YA 5AN7A 5HWMA 1TRIA 3NPXA 3PWAA 3V75A 3LI0A 3W83A 4YCOA 2NX9A 5G2HA 3W1NA 1X6UA 4XZ9A 3M44A 3KFTA 3L5LA 3CHVA 3VCRA 2QUUA 2RFGA 2CU0A 5LSMA 2X1TA 1QPRA 5AOUA 4IPJA 3HGOA 3R5EA 5K9CA 3G1HA 1P0NA 1FWRA 3O1NA 2NX3A 3TKFA 3R13A 3MHFA 3MUXA 3QQ1A 5F1VA 3G18A 1OFOA 4MYAA 1E51A 2Q3OA 2JK2A 1W37A 3LCWA 8TIMA 4MLRA 1VCGA 3JRKA 4XKYB 1JRCA 4LW7A 2VFHA 3A22A 1LM1A 1I4NA 2FPTA 1BWKA 5IBXA 1H62A 3CIWA 2H3DA 3EXSA 1EWEA 1HFBA 1Q45A 4RZ6A 7TIMA 4I7VA 4O52A 2CWNA 4QJ1A 4CCEA 2DZUA 2PRMA 1EP2A 5A8GA 4UTKA 4JD4A 4LWWA 1WQ5A 2J24A 5CZSA 4B5NA 3KVKA 5I3FA 1QWGA 1WA3A 2ISWA 1O5XA 1S3HA 3QSRA 4E2BA 3M47A 3JS3A 4MY1A 1B9BA 3KOFA 4JXCA 5LGZA 3G22A 1LDCA 3QW3A 4O4WA 3TMQA 3EX6A 3LHTA 2DJXA 2A2IA 3PSVA 2ZYFA 1W5MA 4RKAA 1SSGA 3NQ8A 3PBVA 2ZA3A 2CLHA 2QDHA 1RD5A 1KM2A 1OFRA 3BG9A 1ML1A 2QJIA 3IGSA 1F5ZA 4Y96A 1G67A 5D33A 3DKLA 1H7OA 4IXXA 2F7FA 1P5BA 3GK0A 2RDTA 3OHIA 2WOQA 2ZZ6A 5BOOA 4MJZA 1OF8A 2E5DA 3JR2A 3M43A 3L65A 4LS0A 3LERA 2YZRA 5G5IA 4N2YA 1IXQA 1RR2A 2X1UA 1RQHA 3WJSA 4HIBA 2E77A 1KBIA 4W9TA 1LLZA 2QAFA 1KM5A 3DFOA 1GTEA 3H55A 1KFJA 2B7NA 5D09A 4FEZA 3EX3A 4L4LA 3QZEA 3LXAA 5G2IA 5HWJA 2FIQA 2YPIA 2P10A 2ZCGA 1MEWA 1Q6QA 4IX2A 1C9DA 4LS2A 4UR8A 1EP1A 4R34A 1LBLA 3G0UA 3PY2A 5G2WA 3AJXA 3G0XA 2BXVA 2NUWA 2HTMA 2CLMA 2YXGA 1X1ZA 1KFKA 2ZRUA 5AC6A 4XTIA 4GC4A 1FWSA 3B06A 2YFOA 5AFDA 3MI3A 4FNUA 3DKJA 3MBFA 4OT7A 2NV1A 3TMLA 3TNOA 1ADOA 3TQ0A 4LOCA 1I2PA 2QCGA 3VE9A 1F6KA 3FYOA 4IMDA 3DFQA 1KM0A 2GVJA 5K4XA 5G4EA 1RPXA 1GVQA 3WJWA 3TX9A 3W88A 2GQ9A 3NYZA 4LV9A 3T40A 1LROA 4AHQA 5DY2A 3N73A 3B04A 3NM3A 1LORA 4FXRA 1I2QA 1R47A 3QMSA 1W3TA 1TTPA 3GAKA 5HR7A 4YCPA 3GDLA 1H61A 3M16A 3P67A 5EL1A 2ZZ1A 3DGRA 4LRSA 4LUIA 3W7KA 5I3HA 1TMHA 1TPUA 4YWIA 1EPXA 4N4PA 1ME8A 3UYCA 4N4QA 2CZ5A 4AWUA 4MZ8A 1P4CA 4FX6M 5CZTA 4XKYA 1KTCA 5D2XA 5K7JA 4KFNA 5F4WA 2V82A 3TK7A 2A6LA 3TJXA 4XBSA 4JYFA 1R2TA 5LNWA 2GVGA 1G4TA 2DZVA 4OWGA 3E12A 3IRDA 4K6AA 3W73A 2ZTKA 4O1DA 2E6AA 1WV2A 2CZFA 3VE7A 1CW2A 3HPZA 4J9JA 4XTDA 3TAKA 3GDTA 1OG0A 1PE1A 1OX4B 3QC3A 4NQ1A 1VCVA 2CLIA 5CSSA 1LRQA 4I7WA 3KXQA 4U28A 4CLMA 1WYIA 2VENA 5FEZA 4OGZA 4DO4A 1D3HA 1DVJA 1PCWA 3W1TA 2YX0A 4Y6GA 2X1SA 3UXDA 4NJKA 1JUKA 5EKYA 3SECA 2J9YA 3W3OA 2ZQ0A 3GX9A 2ZA1A 2RKXA 4UNKA 3RLUA 5C6MA 4MIMA 1LOSA 2E68A 1XXXA 4IMFA 3V1PA 3LHUA 5TBOA 4DO6A 3PAJA 2B0MA 1H51A 1JCNA 3C61A 4WY0F 2QDGA 3A5FA 2QR6A 3W71A 1XL9A 4BI7A 4POCA 3P5YA 4JGDA 3ATZA 3OVRA 1W56A 3LLDA 4AWSA 1OABA 1SW0A 4HNTA 1QDSA 4CCDA 3W9ZA 2ABBA 1JCXA 2J9ZA 1UCWA 1JCMP 1VH7A 4LV4A 5KZMA 4KWWA 3ELFA 1TQXA 4LVDA 4XBKA 3A24A 3RLVA 3T4CA 1Z48A 3RF9A 4LVFA 4M19A 2GVLA 2WV8A 4QITA 4LRTA 4A2RA 5EY5A 4EF8A 4RR4A 2YW3A 5CSRA 1V7YA 2OX1A 4K38A 4ALDA 2DP3A 3S5YA 4ORMA 3WK1A 1XBYA 4N9CA 4QNWA 5FF7A 1WXJA 5LNUA 4UMCA 3BV4A 3L5AA 2QJGA 2QCFA 4MOZA 1ZENA 4S2BA 2VFDA 1SZNA 2WKJA 2JKAA 5U4NA 1GVFA 3P84A 3NM1A 1W3NA 4ZQNA 1SO5A 4CNOA 3IV3A 3LCHA 1L6YA 5HJLA 1D3GA 3PVFA 1LRTA 4JTLA 2QCEA 1QNVA 2V8ZA 4A21A 3LLFA 4RXGA 3BARA 3G0SA 4FX7A 1K7XA 1PS9A 4GUJA 3DZ1A 1VYRA 3KVMA 2NZLA 1AW2A 1ZNNA 3KX6A 5F1UA 4WJEA 4ZZ9A 3WFAA 1H63A 3NPWA 3SGUA 3E49A 3THAA 3CWOX 4LY8A 4M6QA 3W7OA 3IIZA 2VFIA 3M0ZA 4EIVA 2I1OA 3TV8A 1A5AA 5BRBA 3HIJA 1I8JA 5FEWA 1F7BA 1HUVA 1W54A 3NQCA 2JBMA 1GVRA 3W23A 1OFDA 1YYAA 4FHAA 3M5YA 4N6EA 3A9IA 3GLCA 2UV8G 3W1LA 1TIMA 1L6WA 4FNRA 2BLEA 4UTHA 3W74A 1OX4A 3PM6A 2G97A 4A29A 3OG3A 3HOJA 1WOBA 2VEPA 4FNPA 3UZ5A 3FJ6A 4ONVA 2GUUA 1XC4A 1JCLA 2TPSA 3UD6A 1QPQA 2QJHA 1ICSA 4EF9A 4A3UA 3LCIA 4TMBA 2Z0IA 3TSBA 3NQ6A 1JJKA 4JX4A 1JULA 5CPLA 5KSWA 5E93A 4AHOA 3H53A 1BTMA 3MP3A 3GVGA 3RFAA 4WZHA 5DBUA 1LP6A 3I7RA 2XN2A 1DOSA 3SZ8A 4EVZA 4QQ3A 1WOAA 3DFNA 1KTBA 1CX9A 3U2OA 3W7GA 1DQWA 3TW7A 2ZTJA 1KV5A 4FNQA 3U6WA 1T96A 1JUEA 3W2NA 1PL9A 2CW6A 2X16A 1Q3NA 4JIPA 3IIPA 3PB0A 1SW7A 3HB9A 5AYXA 1VLWA 1VCFA 3DHFA 3G24A 3VKJA 1A5CA 3NL2A 2XFWA 3W7DA 2ZZ2A 2FFCA 4PL1A 3FA5A 1K7EA 3NQ7A 5LKYA 3TC7A 5I3KA 5LGXA 4UTJA 2ISSA 3F4WA 1QO5A 3N14A 3M5ZA 5KITA 3UWVA 3PS7A 2ZRXA 3ZFHA 2R8WA 1ZY9A 1EP3A 1ALDA 1WBHA 1TPB1 1F6PA 1ZAJA 3DU0A 3SSJA 4NJJA 3FIGA 2RH9A 4MY9A 5J5RA 1ICPA 2FJKA 3GNDA 3M5XA 3UWQA 3ZWSA 2A21A 4AF0B 4DBDA 3YPIA 1OYCA 1KW1A 1QCWA 4IQLA 3SY5A 1B4KA 3EWWA 1VYPX 5HMSA 1KTNA 4NZJA 4DELA 3C56A 4LUJA 1HL2A 1O5KA 1K02A 1ONRA 2NUXA 3DFSA 1TJPA 2JKEA 2W0UA 3DI1A 1H50A 3G1AA 4JIQA 4O14A 3T7VA 5D04C 2V2HA 1UUOA 4UFKA 1WDWA 4NNBA 3W7NA 2VOMA 1FXQA 1O4UA 1UUMA 3OVPA 3MI6A 3GZ3A 3NL5A 2Y89A 1VLIA 3IIOA 2YDAA 1G7UA 3SGZA 3G1XA 3VNDA 4EOUA 4YLWA 2GOUA 4TO8A 2Y7GA 2BWGA 4R53A 5AYZA 2GJNA 3A5VA 1TTQA 1H7RA 2V2DA 3W76A 3CEUA 3PUEA 1SFLA 4JICA 3TSMA 2GQAA 4HSOA 3LCFA 4FF7A 5T26A 1NVMA 2YGYA 2G96A 3RU6A 1UJPA 1LOQA 4O54A 1O95A 3LX9A 4IOTA 3QH2A 4JTHA 2EKCA 4ZQPA 1R30A 1JCYA 3O6DA 3F1QA 4GE8A 3ATYA 1QOQA 2C3ZA 3P8JA 4UTTC 1AW1A 1KFLA 1QR7A 3G1DA 1XCFA 3LTYA 3NQMA 3SI9A 4FB7A 1NAL1 4I9AA 4WOZA 1LOLA 4BWLC 4Y8FA 3UY8A 4UTIA 4RXFA 1FBAA 3ZR4A 1KFCA 3STEA 1I2RA 1EA0A 3MW7A 2ZA2A 1RZMA 2R91A 4JDYA 3EWUA 5H2ZA 3BG5A 3S5NA 3O6YX 3P74A 3MYOA 3HG5A 3CWNA 3QSTA 2O7QA 1KFBA 2ZZ7A 2HSAA 4A22A 5LNSA 3S42A 2I9EA 3CM4A 1GOXA 1SZFA 5D2VA 4Y90A 1IF2A 3S5OA 4D2JA 3Q37A 1NSJA 1SR9A 4HPJA 4YMZA 4UMAA 3W7PA 1TV7A 2E6FA 4O19A 2Y63A 1F2JA 2YR1A 2Z6JA 4AMAA 4XQ6A 3QFEA 1FY6A 3LRKA 1TQJA 3NQDA 3MHUA 3CC1A 3NAVA 1ZHAA 2O7SA 2CFFA 3WK2A 1DV7A 3NQGA 3SJ3A 3LBMA 3W2JA 1M5WA 2DU2A 3E02A 4WQ6A 2EHHA 1GYNA 4O8RA 4NU7A 3EWBX 3PF3A 3RMJA 4EWND 1QPOA 2V0TA 2Y7EA 1XKYA 3DI0A 4AF0A 3B03A 4AHPA 2ZZ5A 1GWJA 5EPDA 2NXHA 3QMTA 1OX6A 4XUGA 1RQBA 4FO4A 1FCQA 3HJZA 2ZRVA 5IBXC 5DBTA 1OHLA 1SQ7A 3S0CA 1FCUA 2WNNA 2YCEA 1WBJA 6TIMA 1LCOA 2J9XA 5FF3A 1YDVA 1HO4A 2AAMA 4N02A 5G1TA 3DH7A 5K2ZA 2GJLA 3G8RA 3KRUA 4LU0A 2VEMA 4H6KA 4MY8A 4ML9A 2Y62A 1LLWA 3LCLA 2OCZA 4CNPA 4OQVA 1R2RA 3HG3A 3QRHA 1YLVA 2AGKA 1GEQA 4RCXA 4E38A 3TA6A 3EXTA 1ME9A 3NPUA 4K8HA 5AC8A 1GT8A 3GXNA 3LHZA 2EAWA 3STCA 1JQVA 3EX2A 1DQXA 1T99A 4Z1DA 1XDMA 1QO2A 3TXVA 3G1SA 3STGA 3INPA 4UFJA 3W2MA 1XBZA 4UFMA 1EX5A 1VGAA 1KM4A 3HGSA 3WJZA 2QCMA 4DF2A 3QPZA 6ALDA 2ZZ4A 4K36A 1JQXA 4LS1A 1O94A 4Q32A 3UXAA 1H1ZA 3L5MA 4N9EA 5D05A 2NX1A 1X7FA 3ABQA 1VPXA 4JR5A 4JTUA 5K4ZA 3TAOA 4UCGA 2YFNA 4OE7A 3TH6A 1HTIA 3TDFA 2C15A 2H8ZA 2VFEA 2QEZA 2JGYA 3LBCA 5GVJA 2CLLA 1G69A 3CIXA 5D2WA 3I7SA 1C29A 4AXKA 4UIOA 4PTNA 1Y0EA 2Y88A 2CZEA 3EKLA 2B7QA 1DJNA 2QKFA 5DLCA 4UUIA 1FDJA 1XFBA 1PVNA 3BLFA 5DCDA 3S9YA 1F73A 4NXSA 4WUIA 4MFDA 3TROA 5CZJA 2E5BA 1XUZA 3SFKA 4MYXA 2KZHA 4PCFA 4BK9A 3CU2A 1DJQA 1OF6A 1OJXA 3NOEA 3ABRA 3NQ2A 4GRSA 3O63A 1XBXA 3I6RA 3RK8A 4GFSA 4GXMA 4UC5A 5EA9A 4FIQA 3MP5A 1OX5A 5LNVA 4Z08A 4CQ8A 2QCHA 4Z1CA 2ZFAA 1FDYA 4JTJA 4WXYA 5C54A 2Y7FA 3BPWA 3FYPA 2HS8A 5G1YA 1MXSA 3PG9A 1B4EA 4DEFA 1OFEA 5C55A 4NXKA 5CPNA 3NPVA 2DJLA 5C2XA 4YXGA 1U83A 2QF7A 5FEPA 3B05A 3IIXA 1FXPA 4RZ5A 1JR1A 4AVFA 1J5TA 1TRDA 4NX0A 3S1UA 1O60A 4E2DA 3H54A 3W7IA 3NG3A 1SO6A 1YXYA 3C2OA 3T55A 1P0KA 2OT1A 2XN1A 2PC4A 4N9DA 3MO7A 3G3MA 5BMXA 2E1DA 3BLIA 3TFXA 3P80A 1G4EA 1UBSA 3E96A 2CZDA 1ZALA 3THQA 5CPMA 1LZOA 1VHCA 3DFPA 2OT0A 4DXVA 3UPBA 1VR6A 3W75A 1KLZA 3GIYA 4ADUA 3ZS4A 2ZRZA 3CPRA 2V9DA 3L68A 2Q3RA 3LGEA 3GR8A 3QPYA 3EWXA 3GDKA 3L0NA 4PEKA 2C14A 2VXNA 3L9CA 4BF9A 1OFBA 4CNNA 4JTEA 4DBEA 2Y7DA 3EEGA 2TRSA 3MMTA 3STFA 2R94A 4MKNA 4IXHA 3EX4A 1YDOA 2BZNA 2NLIA 3LDVA 4HKPA 5CPOA 5HINA 3S6DA 4AWTA 3W72A 3KVLA 2DZWA 4PH6A 3PBYA 2QUTA 4IWWA 4HNVA 3MBDA 5ABTA 3PUDA 4O10A 5LHEA 3EKZA 5I3IA 3W7LA 3CLMA 1JUBA 3E9AA 4JYEA 1GTHA 2RHGA 3PR2A 3FOKA 4UTWA 5DELA 2D73A 1SO3A 2R14A 5KZEA 2WNQA 1L2UA 2YYTA 3GXTA 4UFLA 1SZEA 1AW5A 1TPEA 4KWVA 4GUGA 2NXGA 3EWZA 3EWYA 3PBWA 3DBPA 1FWTA 4OV4A 1ZAHA 2EF9A 3NDOA 2VC6A 3W1UA 5AHNA 5FF4A 5HR6A 1UASA 1JVNA 3B0UX 1OYBA 5HQEA 1G7VA 2PE4A 3CT7A 2RDUA 3LTSA 4O15A 3CEPA 3KRSA 3WK3A 4NJIA 3NQFA 5K9XA 4H4IA 5D38A 2C0AA 3GXPA 2B7OA 5HUPA 3HPXA 3QMRA 3UWYA 4PODA 1M6JA 1H7XA 3LRMA 4Y9AA 1IXNA 2YSWA 5EMUA 3B4UA 4TIMA 1K8XA 3NXFA 4OU1A 1PV8A 3HO8A 5G4WA 3TU9A 1BWLA 4O18A 3NEVA 3OIXA 4FIRA 1X8FA 2C6QA 4K7YA 2ZDRA 4O11A 1FQ0A 4A2SA 4GBUA 4K39A 4JDBA 3R89A 2E09A 1LRNA 4PA8A 1DKWA 2TYSA 4FX8A 5BMWA 3Q58A 1EUAA 4JX5A 4M6PA 1MSSA 2QCNA 4RZ4A 4CCCA 3W1PA 3MYPA 2G5WA 3FKKA 4GJ1A 1U5JA 1FUYA 2FLIA 4O50A 1FCVA 1GVOA 5FESA 2Z2UA 3UWUA 3UQNA 1AMKA 4WD0A 1OFAA 1WX0A 1NFBA 3PUOA 3TJLA 5D02A 2C13A 4JY9A 3R2GA 4UXDA 4JTIA 4YL2A 4TR9A 3L2IA 1DBTA 3BLEA 3TUUA 3UPWA 4K8EA 3EB2A 4HN4A 5E0KA 4Z0SA 2Z1BA 4MLJA 3BO9A 3HGRA 4H3DA 4IMGA 4ZMGA 5HUOA 3ABSA 1OVDA 5D30A 5AHFA 4ZL1A 3GDMA 1EUNA 3KHJA 1GG1A 4JX6A 4RLIA 2P0OA 2NUYA 3LCGA 5AHMA 2Y85A 4O13A 2XN0A 2LLEA 1IXOA 1W5QA 4TU1A 1ICQA 2A4AA 3G3DA 4ZQRA 4QM1A 4WX2A 2B4GA 4IPIA 1N55A 1R2SA 1OFPA 3IVSA 1HG3A 4MUZA 3W1RA 2CLFA 4NVTA 3W7MA 1S5WA 2X1RA 2YYUA 1FWWA 3W7EA 2DZPA 3HMJG 2QAPA 4WY0B 2ZBTA 3D0CA 3M6YA 3QM3A 1SSDA 3MWAA 3PULA 5KINA 3W86A 4NZFA 3HGJA 4L4MA 1QOPA 2ZRWA 5CG7A 4QIUA 3M1ZA 1Z41A 2RDWA 5E1QA 3NNTA 4KFOA 3IVUA 4WOQA 1YTEA 5LNRA 3VI2A 1K7FA 3HBLA 3LHYA 4NJHA 4PFMA 4JN6A 1H7PA 3S1WA 4O1BA 3NZRA 4M7TA 1IIHA 2FPVA 2QCDB 3FJLA 4ZQOA 3S5ZA 5F2GA 4JEQA 4IX0A 5EYWA 2Q8LA 1VJIA 1OFQA 2A7PA 3G1VA 5FEXA 3W1QA 1GZGA 5AYYA 3TCEA 2ZZ3A 4UTUA 1TTIA 3PC0A 5U7SA 5I3GA 2Y6ZA 3WJYA 3OEXA 3TC6A 3LXCA 4AAJA 3N19B 1EIXA 4M7SA 3MJYA 1L6SA 1VZWA 3TE9A 3Q2DA 3G8EA 3K30A 3UY7A 1LBMA 3FS2A 4UMBA 1YXDA 3LV5A 4OV9A 4QSHA 2J27A 1L9WA 3W6YA 5MHBA 5L6UA 4ZVJA 3P5ZA 3QYQA 2A0NA 5KZDA 3W84A 1KV8A 1H1YA 3LHVA 3O8AA 4G1KA 4GUIA 3HF3A 2VELA 4LC6A 4O53A 1YDNA 3DENA 4JS3A 1FX6A 1B3OA 1KBJA 1Q6LA 1GYLA 4DPPA 1T0OA 1J4EA 3BGGA 1SFJA 4O0KA 3C2FA 3HG4A 1PHQA 3PG8A 4UR7A 5IM51 3W85A 1B57A 1SPQA 3U8GA 1F74A 1H60A 3W2UA 1OK6A 4ADSA 3W7CA 3I65A 1A5BA 2PRHA 4O12A 2CLOA 1MZHA 3GNNA 4KFPA 2FB2A 1Q6RA 4M5PA 1KM1A 2ALDA 4LTSA 3CTLA 4HNNA 4BR1A 3MI2A 2E6DA 3PB2A 3O06A 4AB4A 3N2XA 1EWDA 3T44A 1WAUA 2QCLA 4O57A 3S1VA 3W07A 1M7OA 1SZGA 3OVQA 4JNMA 2ATMA 1K8ZA 4PC8A 1ME7A 4DF0A 2FB3A 4O1CA 4KKXA 1EEPA 3GB6A 3SIZA 4IGHA 3O6CA 3TIMA 4RV8A 2V5BA 3SR7A 1W8SA 1VRDA 1YADA 1N7KA 1NF7A 1XDLA 3HG2A 5LHFA 4S2CA 5TIMA 1PHWA 3KVJA 3C2RA 1YTDA 3UWZA 5DN1A 2V81A 1VHNA 4UFHA 1QMLA 3P81A 5D32A 4FNSA 1KFEA 2HMCA 3NO5A 1TB3A 2OJPA 1TPWA 2NWSA 3C0JA 5D03A 2WSQA 1QAPA 4HSNA 1KLYA 4MPQA 4Q4KA 4CQ9A 3L66A 1CI1A 4WY0A 2WSYA 4RJEA 2WQPA 1SU5A 5TQLA 4C1KA 4GUFA 4Z0JA 4N6FA 4S1FA 2QCCA 2WJZA 3NA8A 5J5DA 1Z44A 3GKFA 3LCXA 3M7WA 3GDRA 4ADTA 5KMYA 1Q6OA 4JY8A 1H7NA 3RNDA 5CKSA 1FWNA 4HPXA 3PBUA 3O16A 4O0ZA 5A5WA 4MVAA 2P1FA 4JTFA 5DY3A 3P61A 4IMCA 3EX1A 5DXXA 3W22A 3M41A 2QCDA 4M6VA 1HO1A 2PCQA 4R33A 3B8DA 5HULA 3LTPA 3QQ0A 5D2YA 3BVJA 3LOTA 3NQVA 3GYEA 3IIVA 5D2TA 1YPIA 2J6XA 2ABAA 1JCJA 3IGXA 2HS6A 1G4SA 5FF2A 3P7YA 1C8VA 3L0GA 4NJGA 1W0MA 5AHEA 3FLUA 4K7VA 2NWRA 3ANYA 3ABOA 5F2LA 1SUXA 3NL6A 4O4VA 5BNKA 4K37A 3C8FA 2WPBA 1KM6A 1VC4A 1ZCOA 3DAQA 4O28A 5FI8A 3G1FA 1QFEA 4Q33A 4NNCA 4MZYA 3AO0A 2I14A 2X2GA 4ICNA 3G1YA 5F2IA 3C52A 1W31A 2CLEA 1A50A 1SW3A 1VQTA 2H90A 5L9FA 3R8RA 3DHDA 3C2EA 2W6RA 1AG1O 1XUUA 1QPNA 1XBVA 3LI1A 2H3BA 3O07A 4P61A 1NEYA 3BG3A 4O16A 1M7PA 2C1HA 1TTJA 1J2WA 4RK8A 3IVTA 3W7QA 4MFEA 1ZJIA 3NQAA 1W3IA 4AH7A 3NR0A 1I45A 2BX7A 2PRLA 2A6NA 4DPQA 3HPSA 3USBA 1TPC1 4NX5A 1S5TA 1TSIA 3T78A 3TR2A 1S5VA 4X22A 2CLKA 4GUHA 1OYAA 2VEKA 2W79A 3BW3A 3TSDA 1AL7A 3W1AA 2FPYA 5HNRA 3FFSA 1IIGA 1BEUA 4JTSA 1P1XA 1IXPA 5F2MA 2E5CA 1PIIA 3OBKA 3S8HA 4FNTA 1FDZA 2FDSA 1TO3A 1AL8A 3EXRA 3I7QA 2H6RA 2AQWA 3DFTA 1G6CA 5DXYA 3LXBA 3R12A 3W2LA 4XWUA 1V5XA 3N9SA 3BGJA 3SW6A 3UWWA 5AB3A 2V30A 4GNJA 2VFGA 4IJBA 3BK0A 4JTTA 2ISVA 2J88A 3TXZA 2VEIA 1W5OA 5SWUA 3B0PA 3CB8A 4LVAA 1H7WA 1K3UA 2C16A 4C1LA 4LNYA 3A23A 2Y61A 1LYXA 5KTLA 2TMDA 1PCKA 3IGUA 1ZAIA 2WNZA 3CQ0A 3MHGA 4E0CA 4JYDA 3TFCA 1RV8A 2H8XA 4FXSA 4JTGA 3NQEA 1TPDA 1KM3A 3GAYA 3C6CA 1TV5A 3LB0A 4TMCA 1MEHA 1TYGA 3L67A 1R46A 4QNEA 5FF0A 3C2VA 5AC7A 4HHPA 3P60A 2DORA 4IMEA 2YW4A 4OHQA 1ZFJA 2F84A 3TQKA 2Y70A 3UNDA 3Q94A 4N9BA 1JRBA 1DORA 1UB3A 5F4SA 2G95A 4NT0A 1DL3A 3M5VA 1LTDA 3DXIA 3MP4A 3C3NA 3N2MA 2OZ0A 1SO4A 3N9RA 1TV8A 1XI3A 3GKAA 4RX0A 2QUVA 4LC8A 1FCBA 4O17A 3F03K 3P82A 2JGQA 1G4PA 3L0KA 5CGQA 2PURA 1Z42A 2C18A 2WO5A 4DQWA 4P2VA 3W87A 5C5YA 3KRZA 3WK0A 1DHPA 2A5HA 2GQ8A 4BI5A 2V2CA 1IGSA 2JKPA 4Z1BA 4BI6A 3TW6A 2A85A 1F76A 1X1OA 1XM3A 2Z6IA 5LZLA 1K03A 4ZQCA 2B7PA 2ZRYA 3W7RA 3LHWA 1GJPA 3NZ1A 5DCBA 4R7JA 4LVBA 1GVSA 4LT9A 3QEZA 1N8FA 2DZSA 1NF0A 3W7HA 5DCEA 3LM7A 3N3MA 4NNAA 4UTLA 2IQTA 3O15A 4U4MA 2A7NA 3N34A 3VFLA 4TX9A 1W5NA 2VFFA 3ZWTA 1VYSX 2FQIA 2FTPA 1GPWA 1D9EA 5K3VA 1RQEA 2EPHA 3IEBA 4NUWA 3NGJA 4BFAA 1THFD 1W5PA 3NVTA 2X30A 3O05A 3W7JA 2GPTA 4O1AA 3W1XA 4ZQMA 2A7RA 2NXIA 4WXZA 3OA3A 3FKRA 1RVGA 2A1YA 5H91A 3C4UA 3HQ1A 4UNLA 2BSLA 3M9YA 4ORIA 1I2NA 1YXCA 4UTWC 2NV2A 3NL3A 3UZJA 3KAOA 1TREA 3W70A 4AEOA 5F4XA 3WJXA 4GWEA 1TPH1 1TPVA 2OMAA 3L21A 1OK4A 4HT3A 5AHLA 1F05A 1TCDA 5CZ0A 3QJAA 2WSRA 1YTKA 4X2RA 4X9SA 4UTMA 4DF1A 1TPFA 3BW2A 1I2OA 3QW4B 5EBUA 4MJMA 4OBTA 3TQVA 1H5YA 3P8IA 1KA9F 3B0VC 2ATSA 3LV6A 3FEMA 1AK5A 1BKSA 1LBFA 1EB3A 2VKZG 1GG0A 2Q8ZA 4X3ZA 2V5LA 1MEIA 3I68A 3LRLA 4UTTA 2TSYA 1A5SA
chains in the Genus database with same CATH superfamily
1V93A 3SUSA 3SSZA 4H9VA 4YIWA 3B3DA 2O92A 1T8XA 1YPFA 4OBRA 4LSBA 1V6WA 4MZ1A 2WM1A 2NVAA 3PJXA 5AHIA 5I3JA 1V6XA 3MC5A 2PDWA 4CQAA 3CIVA 3E0IA 4S38A 4HNUA 1RCXB 3H2NA 1IE7C 2X7VA 3A21A 2DZXA 2OGJA 3W2KA 5K9DA 3ARXA 1K8YA 3NO3A 4MJ4A 1KR0A 3VOHA 3W83A 3LI0A 2NX9A 5G2HA 1NJJA 3W1NA 1B3ZA 1M68A 1BGGA 3L5LA 3PZIA 2RFGA 3E2SA 2CU0A 4JOMA 3DFYA 3ZXWA 4IPJA 3HGOA 2G3NA 1EPVA 4P7NA 1CGVA 4N7QA 1FWRA 1KXQA 1VENA 3AYSA 2J8GA 4D9PA 2HE8A 2Z1WA 1I1WA 1JD9A 4PB3A 1E51A 2JK2A 1W37A 1XIGA 3UVAA 4AX6A 8TIMA 4RNHA 4MLRA 3VABA 1JRCA 3W37A 5CJNA 2C1IA 3A64A 1BWKA 4DZ5A 3CIWA 3TYUA 3V36A 4ASTA 2DSKA 7TIMA 4I7VA 2X09A 3N4FA 4G1NA 4QJ1A 2DZUA 4UTKA 4JD4A 3THDA 4AZBA 1WQ5A 2J24A 5CZSA 1E6QM 4C6IA 2ISWA 1UR2A 2G0WA 3QSRA 4E2BA 2WAGA 1PTDA 4LAUA 1XLLA 3WEZA 4B9YA 2FMNA 5LGZA 1WXZA 3G1RA 2W5FA 3F2CA 3EX6A 1X8CA 2DJXA 4GQQA 4FS9A 2PDBA 1V6TA 4ZE4A 3PBVA 2ZA3A 3KCJA 2QDHA 3BG9A 4Q8WA 3URBA 3WENA 3GUWA 2EPNA 1F5ZA 4Y96A 1G67A 3DKLA 5H1WA 4I8DA 2A3CA 4IXXA 1DQUA 2RDTA 5BOOA 4DI9A 3SDOA 2SFPA 3LERA 1E0VA 3GG7A 5G5IA 1RR2A 4YYCA 3SJNA 1GTEA 4DZHA 1KFJA 2B7NA 5KEZA 1MRQA 4GHRA 1UD2A 2UY2A 4FEZA 3EX3A 3QZEA 3VGHA 5HWJA 2FIQA 2YPIA 3WH5A 1VEPA 4HSHA 4AZCB 5LA1A 4IX2A 1C9DA 1HKKA 4LS2A 4UR8A 3VGDA 3E74A 3AJXA 1TA3A 2PWHA 3ZSTA 3S2JA 4QS6A 4R7WA 4F0SA 4XTIA 2GVYA 3B06A 4LCRA 3C2YA 5C7VA 3WY1A 4FNUA 3DKJA 3RXZA 3CHCA 3RAOA 4OT7A 1XSIA 1ADOA 1V4YA 4HHMA 1I2PA 4LOCA 7TAAA 4WIWA 3KDOA 3T2PA 5FJUA 2P53A 3M07A 3CAQA 2QULA 1NTHA 1RPXA 1GVQA 4M1BA 1DJGA 2DVTA 3W88A 2P0IA 4LV9A 1LROA 2BVDA 4AHQA 1UP0A 2OWXA 3NM3A 1YKWA 3PPHA 4FXRA 1I2QA 1R47A 1PX8A 2WVVA 1FVPA 4WJXA 3GAKA 2EBNA 3KTXA 1H61A 3P67A 3WBXA 4PUMA 4N4QA 1P0BA 2R24A 4MZ8A 5CAHA 4FX6M 4XKYA 3WSUA 5F4WA 2V82A 3TLQA 2HVNA 5T91A 2FFIA 2GVGA 3LENA 1ZZMA 2EG8A 8XIAA 4QDPA 4GVIA 3E12A 4NI8A 3VKCA 1E4MM 2E6AA 1B3WA 3B9OA 1WV2A 3AALA 3PZNA 3HPZA 4J9JA 3WUFA 4GH1A 3QZAA 3TAKA 2ZUTA 1OX4B 3SRHA 1BXNA 3KXQA 4I7WA 1TX2A 4OGZA 4DO4A 1DVJA 3EPOA 3AIVA 4Y6GA 3UXDA 5EKYA 3SECA 1EJWC 4CNSA 3LZ5A 1JGIA 1EOKA 1LOSA 2JIEA 3IJ6A 1XXXA 2YXXA 2OEMA 1X1NA 2PP1A 4PMXA 1DXFA 3AYTA 5CEWA 1D7KA 5FOOA 4KIRA 4BI7A 4POCA 2I7GA 3P5YA 5EMKA 3WQ5A 5A6LA 1CPUA 3A4XA 3FSTA 2WMJA 2D2OA 3LLDA 2WANA 4HNTA 1QDSA 3RGTA 1UCWA 2OLSA 3SEPA 3EA1A 2ZC8A 3OZPA 3T9PA 1RAKA 3ELFA 1TQXA 4XBKA 3A24A 1OCQA 3S46A 3TP4A 2D0HA 2I5IA 4LVFA 5BZAA 3QOMA 2X0YA 4L64A 2YCLA 4M19A 3QXBA 3EOOA 1SMDA 5EY5A 4Q4SA 4RR4A 2YW3A 2WSPA 5CSRA 3MKCA 3MCNA 1S2UA 3UVIA 4ALDA 4L9YA 2XH7A 3WK1A 5B7YA 4HZ7A 1XBYA 4UMCA 3BV4A 1ZJHA 2QCFA 1SMAA 1SZNA 5U4NA 2FHFA 1EOMA 2HVOA 1OG6A 2A3EA 4D8AA 1UMYA 3D46A 2OODA 2V8ZA 3KP1A 4RXGA 1GVEA 3BARA 4FX7A 1PS9A 4JHMA 4GUJA 1NP0A 1AW2A 4W5ZA 1PTGA 3EWCA 4BEUA 1A5LC 3HMCA 4IM4A 3GW0A 5F1UA 4C6JA 1UWUA 3UJSA 2J62A 2V63A 3UJ2A 2J77A 3NPWA 4DX3A 1P7TA 3E49A 4HGXA 4W7WA 1C93A 3NSXA 5DFAA 1PTAA 5FD0A 1UKQA 1I8JA 1BF2A 4MB3A 1HUVA 3AMGA 3W23A 1QW9A 3BSMA 5DMYA 3SM0A 1LWJA 3A9IA 3GLCA 4EKJA 1L6WA 2BLEA 5TF0A 3TTSA 3EDJA 2CYGA 4FNPA 2EJAA 1CCWB 1YQ2A 1XV8A 4MTVA 5LA0A 1JCLA 3GR4A 1KWKA 2YCJA 2NT1A 2TPSA 3UD6A 1QPQA 1REQB 3OGSA 4HNOA 3WH6A 4TMBA 2YL9A 3VKAA 4NASA 1JULA 2GYIA 4V15A 1KRAC 5KSWA 3F5KA 5E93A 4AHOA 1JD7A 2FGZA 3BAJA 2VGFA 2FZ8A 1BTMA 1KRBC 4H9MA 3DHPA 1LP6A 3I7RA 3FY1A 1DOSA 1Q8AA 3DFNA 1U1UA 3KL3A 1KFWA 3W7GA 3K4AA 4FNQA 3VIOA 4IIEA 4JIPA 3PB0A 2VCAA 2V5KA 3G24A 2GGGA 1P6WA 2Z26A 2FFCA 3II1A 1JPHA 3VPLA 3O0KA 1QO5A 4GYJA 3UWVA 1M41A 5FKYA 3PS7A 3ZFHA 3GWQA 4L1WA 4HJFA 3ZVIA 3BICA 3VKBA 3VOCA 3WYZA 2Y5EA 4W7UA 1F6PA 4QS5A 3DU0A 1XS2A 4NJJA 2A3BA 2RH9A 3FIGA 2UWFA 4V27A 3RLGA 1ICPA 4KCUA 3RX2A 4RE4A 1DJHA 1XRVA 3CWHA 3M0JA 2A21A 1GK8A 3ISIX 4AF0B 2GWNA 2CLPA 4IQLA 1I1XA 3SY5A 1B4KA 2E3ZA 5CAKA 4IP4A 3MMWA 3OODA 1HL2A 1ONRA 3VUSA 2JKEA 1H50A 1TV2A 6XIMA 1FH7A 2VDGA 3G1AA 4JIQA 4KEMA 3MVIA 1WDWA 5E6ZA 5BXPA 2BBFA 4AD1A 4AD4A 1O4UA 3PZGA 3OVPA 3NL5A 4A6GA 1VLIA 3IIOA 4HTBA 4PMRA 1G7UA 2WMGA 1GNXA 3SGZA 3VNDA 1AFSA 4MGGA 1XRSA 2OX4A 4TO8A 4R53A 4QLJA 3I10A 4TUFA 3MS8A 4QCEA 3LCFA 1WNOA 2VX5A 3GBDA 4IOTA 3QH2A 2EKCA 1CGXA 3BWWA 3WLIA 1TCMA 2V3FA 3F1QA 3GVWA 1YMYA 2C3ZA 2XFYA 2DDXA 3PPCA 5JBDA 3G1DA 1XCFA 4QJ4B 5IHSA 1PAMA 3LU2A 4I9AA 1UD6A 4GQRA 1LOLA 4L9XA 3UY8A 2J7FA 1FBAA 4GA8A 1H3GA 1ZBWA 3GRIA 4WHBA 2AL1A 4HU0A 1TKKA 3MW7A 3RM8A 4PRRA 3QHMA 1RZMA 2HK0A 3DC8A 3GNOA 3U5UA 4I5XA 3G6MA 2QHAA 2FZNA 1RJPA 4Y7EA 1O66A 2ZKMX 1KFBA 2JEPA 2J4GA 2ZZ7A 4JKLA 4A8RA 3NO1A 1UKOA 4N0RA 3CM4A 3M0HA 4V2XA 2ZXDA 1SZFA 5D2VA 4LGXA 1R3WA 2OO0A 5DANA 4LEQA 4QJ3B 1F3XA 4H9XA 5PTDA 1V77A 1EC7A 3QFEA 3WDRA 3CO8A 3VM7A 3OOQA 3L12A 4QEEA 4HHHA 3LRKA 1TQJA 2PWFA 1TZ9A 2VTFA 1XF0A 4AZHA 2CFFA 3BGAA 3W2JA 4O8RA 4GNKB 3POCA 4NU7A 5I06A 3PF3A 2V0TA 4A4AA 3CGTA 2PWVA 3OIHA 5XIMA 1UG6A 1GWJA 5EPDA 1A3XA 4CD6A 4FO4A 1H09A 4GNVA 3VZXA 5IBXC 3MUY1 1OHLA 1TUXA 4HMNA 3VDBA 1JIBA 6TIMA 5FF3A 5G1TA 3DH7A 2V38A 1JDEA 1OGSA 4MY8A 3B8WA 4ML9A 4WSHA 2YXOA 1CWYA 1R2RA 3SUTA 1POJA 2R6OA 4LAMA 2Z4GA 4W4QA 2HCVA 1RA5A 3TYBA 3NZPA 4AY1A 1JQVA 3EX2A 1EDGA 3L23A 1XDMA 1QO2A 2QLYA 5HMFA 1RSCA 4U5KA 1EX5A 1Q7QA 4DF2A 1WZMA 3I4KA 1SJBA 4I8YA 2ZADA 3XINA 3UXAA 1E6XM 3NUKA 4GACA 5CQ1A 3DOPA 4XISA 5XINA 1X7FA 3VDCA 1VFMA 3VCCA 2DEPA 4JTUA 2XFFA 4PBFA 5T9CE 4TTGA 3S47A 5KETA 3LBCA 3RR4A 1XD0A 4G7FA 4B5XA 4W88A 5HANA 1Y0EA 2CZEA 1AH3A 1HKIA 2NW0A 2QKFA 2DV0A 3QR1A 5DLCA 4UUIA 1FDJA 3JUGA 4OTKA 1XFBA 1R9XA 1FWJC 1VFOA 3VMPA 1S1PA 4P7OA 4IZGA 3LYEA 3VGGA 3EA2A 1OINA 2QS8A 3A6OA 1HVQA 3CT2A 1OF6A 3BAWA 4WRHA 4JBRA 1XBXA 3I6RA 3RK8A 4F0RA 3BUVA 4B5UA 3N1AA 5A8PA 4GVGA 4YTQA 5LNVA 1R3YA 2FYMA 3VDHA 2QCHA 2L5HA 1BTCA 5CZKA 5C54A 4WXYA 2PU0A 3RITA 4MWAA 1IWAA 3WLKX 2HS8A 2P3ZA 1MXSA 1B4EA 4DEFA 1GQJA 4NXKA 4RE2A 1G1YA 2O9OA 1O1HA 4F2BA 3KZSA 4ZA0A 1GQIA 1W9DM 4C7DA 2DSZA 4UQDA 5G4HC 1FXPA 3WNKA 1EX1A 4GIAA 3UFYA 1TJ0A 4DZIA 2EPOA 1TRDA 1K1DA 1O60A 2WVUA 4OUEA 3CTTA 1SZRA 3C2OA 4HK5A 3BMVA 3FNDA 3MO7A 3U4FA 2ACQA 2WJEA 1NDWA 2Y8KA 3SN0A 5CPMA 1JYNA 5REQA 4M8UA 3CLWA 3VX0A 1RA0A 4DXVA 1FWFC 1KLZA 3GIYA 3R94A 1RLCL 1WP6A 2BV9A 2Z1VA 2HROA 3LGEA 4ZTXA 4CU8A 1P1MA 3EWXA 3L0NA 5ECUA 1MRAA 1OFBA 4JIEA 5I02A 4DBEA 2Y7DA 1UROA 4QFUA 3ORWA 3RLHA 3S2NA 1QW8A 4HKPA 1B30A 2DZWA 3KVLA 4PH6A 1GOIA 2QUTA 2NQLA 1J0IA 5LHEA 1W9UA 5I3IA 1CYGA 2GUBA 3W7LA 1JZ4A 4BHYA 1GTHA 2OKOA 3IACA 3CZ8A 4ATLA 1B0IA 4NAEB 2DT2A 5DELA 2D73A 2R14A 3SRFA 3REQA 4DYJA 2YYTA 4PUEA 5DO8A 3FX4A 5C71A 1XRFA 2VL4A 4KBXA 1PDZA 2NXGA 3GFZA 1FRBA 2PSNA 1K6WA 5DQPA 5D9NA 3LPOA 1W2PA 4X60A 2A3HA 3MMDA 1J9YA 1S2TA 5I77A 2ZUUA 4DM2A 1EL3A 1FWIC 3WK3A 3UXIA 4KEZA 2B7OA 5HUPA 3HPXA 4H7ZA 3UWYA 3U3HA 4L7ZA 1RCOB 2VO5A 3LRMA 4IICA 3UR5A 4B3KA 4DXXA 3OJGA 4S3FA 1K8XA 3KL0A 3AUOA 1J93A 2WMFA 5I23A 3AROA 4K7YA 4O11A 4A2SA 3AIEA 3URQA 1HL9A 3AIUA 4PA8A 2TYSA 4FX8A 1JAEA 2QCNA 2YL5A 3LK6A 1E9IA 4BQ2A 3T0CA 3ITTA 4CCCA 3W1PA 3OA5A 1U5JA 1FUYA 1TV4A 3VU2A 1US2A 1KD0A 2FLIA 4O50A 1FCVA 4MG4A 5FESA 5I2UA 4XK2A 3UQNA 4EXAA 4YPJA 1M65A 3W0KA 3PZTA 3ERPA 1XLEA 3PUOA 1VKFA 2C13A 1CT5A 3R2GA 3LS9A 4YL2A 3EB2A 2R1NA 4HN4A 2Z1BA 1BYBA 4DAFA 4ZMGA 5HUOA 1JZ8A 5D30A 2QT3A 2QMJA 3GDMA 1TWWA 4JX6A 4RLIA 3LCGA 3SCSA 5AHMA 3IJQA 4XIAA 4C6FA 5A6KA 4O13A 3Q67A 3WDHA 3QY8A 1ELSA 1PX4A 4QM1A 2F8QA 3STPA 5LIXX 1OFPA 4GVHA 1HG3A 2D2HA 3W7MA 4WEVX 2X1RA 2YYUA 3PPFA 1TVLA 1B2YA 1UKSA 3DHUA 3HMJG 2QAPA 3DC0A 3D0CA 3M6YA 1SSDA 3MWAA 1I75A 5KINA 2P50A 3LLXA 4L4OA 3NDZA 2IXVA 1QOPA 1MDLA 4NIRA 3C3UA 2ZRWA 3WDIA 5CG7A 4AVOA 3UG5A 2RDWA 5E1QA 2D24A 1K7FA 2PDXA 4L61A 4MNMA 3R7MA 3V16A 1H7PA 4F0KA 3S1WA 1B3VA 4DLFA 2ZXBA 5HNUA 1UOZA 3HU7A 4ZQOA 3S5ZA 4Y8EA 1W1A1 2GSHA 3MUAA 1TZZA 2AMXA 3CUZA 4PTXA 1VJIA 3GIPA 4PCSA 2JALA 1O12A 4A8IA 2WMKA 2HPMA 1U2YA 4RUBA 3W1QA 3WZ0E 5HXMA 5AYYA 1QHOA 2VC7A 7PTDA 2ZZ3A 4XG1A 3PC0A 2Y6ZA 3OEXA 1KBBA 1XLGA 3BZGA 4GG9A 2XU2A 4LFYA 4ZBCA 3UYIA 5I00A 3MJYA 3G8EA 3PJUA 3MVTA 3IK4A 3UY7A 2REQB 4Z17A 4UMBA 5E0CA 2VD9A 5MHBA 3P5ZA 1US0A 1CB7B 3LHVA 3O8AA 4GUIA 3DENA 2J13A 1QRQA 1KBJA 1LL6A 1Q6LA 1GYLA 4DPPA 3BJTA 1WB0A 1J4EA 1SFJA 2XH0A 4NRRA 4UNIA 2G37A 1B57A 5IXEA 3U8GA 1H60A 4UQBA 1TR1A 5J04A 2PRHA 3WLTA 1ITUA 1ZTVA 4O12A 2CLOA 4M29A 1AQMA 3ALFA 4KFPA 1XLCA 3NGFA 2FB2A 3WBAA 4JFSA 3L2MA 4IFKA 4L1XA 3MI2A 3T44A 1E6NA 4AIOA 3JZUA 3S1VA 1M7OA 1C7TA 4EANA 2ATMA 2QPUA 1UKPA 3BOLA 2VT0A 2XISA 4FLRA 4PC8A 4DF0A 4O1CA 2DT1A 2HQAA 4DWSB 2VUNA 1UR9A 2R1LA 1MQRA 1AJ2A 3GG8A 5C8BB 3ZMRA 4DNMA 5ABHA 2GSEA 4YN5A 2PC8A 3IUIA 1YTDA 1B31A 3VXGA 4UFHA 4C65A 1A47A 3OZOA 3RCMA 3PPGA 3NO5A 5DT5A 3C0JA 2NWSA 4CKQA 4HCDA 3TYCA 1KLYA 4MPQA 4ML4A 2F38A 1E73M 1YNPA 3ARSA 2WSYA 4RJEA 1SU5A 3GW3A 3WEMA 2QCCA 3OPSA 1Z44A 1EJUC 1S3TC 1YX1A 3GDRA 3PTDA 1Q6OA 1K4GA 4JY8A 3VOJA 4E4PA 1O7AA 3PBUA 3VNMA 3DIPA 3UZXA 1J96A 4ATWA 4MVAA 4W87A 1UH4A 2P1FA 3R25A 4JTFA 5DY3A 4OFCA 4AC1X 1HJUA 1LUCA 1A5KC 1GUVA 3BV7A 3M41A 4H83A 3WH8A 4GPNA 3DCPA 1XIHA 2PCQA 5HULA 3QQ0A 5A2AA 4Q6JA 2Q8XA 4YJ5A 1ITCA 2J6XA 2ABAA 5FF2A 4D6CA 1JXKA 2NLYA 3N6HA 4NJGA 1W0MA 1ISVA 3GS6A 4E2OA 4H2HA 4AIBA 3KL5A 3NL6A 1KM6A 1OCBA 4E4FA 1XYBA 3DAQA 4IG2A 1IT7A 1MXGA 4UZSA 2OU4A 3B8UA 3FK4A 5F2IA 4H9YA 3C52A 1W31A 2CLEA 1A50A 1A5NC 3LSBA 2H90A 2BGNE 3C2EA 4B9ZA 1DIDA 1AG1O 4W85A 1QPNA 5MKGA 3O07A 4UZUA 1W32A 4O16A 4MKSA 5T8GA 2PCEA 5BROA 3CJPA 3CZGA 3H4GA 3GU9A 5HMDA 2CBIA 3QGKC 4DUOA 1ZJIA 3NQAA 5BXTA 1W3IA 4JTQA 1XIEA 4DPQA 3LPFA 1E71M 4IL2A 3ID7A 1TSIA 1S5VA 4X22A 1Y7VA 2CLKA 4XUYA 3M0XA 2D22A 4ILSA 1OYAA 4C6PA 3W24A 3VD9A 1PKNA 3OBKA 4F40A 3S8HA 1FDZA 1TO3A 4J28A 1IR2A 3DFTA 1RJRA 3CHFA 3W2LA 1UMLA 2G50A 4PMDA 1BGAA 2G3MA 1YE6A 2P5NA 4D1IA 5AB3A 4NG3A 2YIHA 2GK1B 1CLVA 3AC0A 3SFWA 3A23A 1J0YA 3GXFA 1EJSC 2Y61A 1LYXA 4NKCA 4GISA 4KT2A 2WNZA 4E0CA 2QXWA 2EKGA 3TFCA 1D3CA 2NVDA 1A0EA 1GHRA 3JZEA 5ABEA 2Y8UA 4HA4A 4R9OA 5CBIA 4QE4A 4FSAA 3R6IA 1TV5A 4D6JA 2F6KA 3LB0A 3MCOA 5AKQA 2ALRA 3PWGA 5FF0A 3P60A 4OHQA 2YW4A 1ZFJA 3Q94A 4JQ3A 1TE6A 4N9BA 1JRBA 5F4SA 3N4EA 4V33A 1DL3A 3M5VA 1C3FA 3W26A 3KTCA 1SO4A 1FCBA 1MXDA 4YWSA 4AEEA 3P82A 2JGQA 3MU7A 1G4PA 3WFZA 1CGWA 3L0KA 2J79A 1V51A 1EYWA 1EBHA 1HXJA 3QV8A 3MSDA 4DQWA 5C5YA 1CBGA 4QGCA 1DHPA 3MUZ1 1FFQA 3T05A 4Z1BA 1UPPA 1K9FA 3H2CA 2Z6IA 1K03A 3LHWA 1GJPA 1WKFA 4Q4QA 5CPSA 1JAKA 4LVBA 1VD6A 8CGTA 3LG3A 2I5GA 2DZSA 4HYWA 3S2MA 1WKDA 4U4MA 2A7NA 3VFLA 4HPHA 1PYFA 2VFFA 1VYSX 3KLKA 4H01A 4WDWA 2OLAA 3GFXA 2AKZA 4XZLX 2ZE3A 3HURA 3SQLA 1W5PA 3NVTA 2VCCA 3ZSSA 4EPEC 2A7RA 1OBAA 2NXIA 3TYEA 3FKRA 4RDYA 4IQJA 3C4UA 3ZJ6A 3ZT5A 2BSLA 4R9XA 4AUBA 5IFPA 4ORIA 2D3NA 1YXCA 3W29A 2X41A 3RO6A 3VNLA 2BASA 1TREA 4AEOA 3WJXA 4GWEA 3L21A 3MKKA 3FSUA 5HA7A 4HT3A 4BF5A 2BDQA 5CZ0A 3WQWA 4NL1A 4X9SA 1TPFA 3QW4B 4RW3A 1Q6CA 3T4WA 3GC2A 2FVLA 2ATSA 3LV6A 4IJCA 1AK5A 1AD4A 3QLLA 2FJUB 1UWQA 2PF8A 2CITA 5JMUA 4GYPC 1LL4A 1UC4A 3I68A 1EXPA 3LRLA 4UTTA 4W8AA 4CN1A 3B0YA 3RJXA 4KCTA 3P62A 1XLHA 2GGHA 3BW4A 1VS1A 1YE4A 3RUBL 4DZAA 4BWLA 4JAWA 3L4TA 4PL2A 3F4NA 3ITXA 2BTMA 6XIAA 3A12A 1XLAA 4XD3A 1TELA 5D37A 3RX4A 3VIFA 4I5UA 3TN5A 4UFIA 2DSVA 4LVGA 2C19A 3K4DA 2WLYA 4IUOA 1TA3B 1U5HA 3M0LA 3LQGA 1GQNA 3LGGA 4HCLA 4H41A 5AN7A 3CUJA 2OYLA 1G9HA 3V75A 3WF3A 5E09A 4LBUA 1PWMA 2CERA 4XZ9A 1CEOA 4GOAA 3M44A 3KFTA 1UZ1A 3NEHA 4AD3A 3CHVA 2I16A 2HE5A 1QASA 4EK7A 5XIAA 2X1TA 1XLJA 2R82A 5AOUA 3MDWA 4GABA 1KC7A 3V5FA 4CCZA 3R5EA 5K9CA 4M3PA 4CEUC 2BVYA 1P0NA 3O1NA 2NX3A 2WVVB 4GBDA 2QV4A 3H2AA 3R0UA 3MHFA 5B7ZA 4JTCA 5F1VA 2Z7KA 4H8HA 4MYAA 2IS7A 4XKYB 3BCJA 2GVEA 4LW7A 1REQA 1LM1A 2FPTA 1H62A 3UEQA 4GCXA 4Q8UA 3VGEA 1EWEA 1HFBA 1Q45A 3NZQA 4IUGA 2CWNA 5AZ0A 4CCEA 5A8GA 3QVQA 1Y5WA 3KVKA 4PCNA 2PDJA 2XUCA 1WA3A 3L4UA 4J3XA 2OSWA 5MF5A 4UOQA 1MQQA 3H2FA 2Z29A 5AVNA 5C70A 3TNBA 1RALA 1B9BA 3UG3A 2PD5A 1KBLA 2OEJA 3G22A 1LDCA 5GNYA 4J1OA 2GGJA 3TMQA 1VFLA 1EF3A 4Q8PA 5I0DA 3CB3A 1J12A 1HZYA 1KKOA 1W5MA 1RD5A 3SCWA 1KM2A 1XH2A 4MDPA 3F2BA 1O6IA 1H7OA 3ARZA 1P5BA 3GK0A 3OHIA 2WOQA 1OF8A 2E5DA 3JR2A 3M43A 4JN7A 2QQ6A 2Z2AA 1EBGA 4W9TA 2YA0A 2QAFA 1B3YA 2WHJA 3RHGA 1Q66A 2TAAA 4L4LA 3ZJKA 2ACSA 1XFCA 2DZBA 3EPNA 2ZUSA 4WGHA 3H21A 2VX4A 1MEWA 2ZCGA 3AU2A 5TAOA 1AQFA 2YCLB 1QBAA 2WJFA 2DW7A 1XIFA 3G0UA 3G0XA 2EPLX 2BXVA 2HTMA 2CLMA 4DJDC 4ZXOA 1FWSA 3ARQA 2G4FA 2VX6A 1OEPA 2P76A 3AZSA 1J5SA 3THUA 4DJDD 5A6MA 4J2PA 1M7JA 3V18A 4TX6A 4OVXA 2BB0A 3VE9A 2JFEX 1F6KA 3HM7A 5IRPA 4S3BA 5K4XA 5G4EA 4OBSA 1I0DA 3AIWA 5DY2A 4QEHA 4X0NA 3B04A 3MV11 1YHTA 4FZIA 4I6VA 2PF0A 3SCNA 5EL1A 2ZZ1A 3DGRA 4LUIA 3W7KA 5I3HA 2W61A 3I3DA 1T6MA 5GJPA 2WVSA 1P7TB 1EPXA 4N4PA 3UYCA 6REQA 1KCZA 3QBUA 4LB3A 5K7JA 4KFNA 5HNTA 4H8VA 2IQDA 1K6AA 3TJXA 4JYFA 4G2DA 4MM1A 1G4TA 2DZVA 5DRIA 5FA5A 4LY4A 4OWGA 1PSCA 3BZJA 4I9TA 4B4HA 5BU9A 3VE7A 3WN6A 2IQ0A 5A6SA 1OG0A 3BSHA 3SO7A 3QC3A 1F3WA 2CC0A 2OZ3A 1LRQA 3VAVA 4U28A 4CLMA 4GD0A 2PWEA 4EP8C 1D3HA 1PCWA 1Q5MA 1F4HA 3CNYA 3QZ6A 4L9ZA 1DPMA 3RYSA 2E40A 3LPPA 5A3HA 3W3OA 4UNKA 2J7BA 3MA8A 3RLUA 4BY3A 2F6UA 3UZYA 3V1PA 3E2RA 4IPLA 2W4XA 4IFOA 1H51A 3CHEA 1W9PA 2FVMA 1Z69A 2QDGA 2Q71A 5JVLA 4DM1A 4UR9A 3G2GA 1KNWA 3S83A 1W56A 4C6CA 1OABA 1KB3A 4CCDA 4DYEA 5FACA 4LV4A 3LMYA 2PDMA 2R1PA 5KZMA 3FGCA 1XCWA 3QGAC 1KGUA 3CASA 4HMEA 1OC5A 2O55A 2O4MA 4RNIA 3FXGA 4HCHA 4UCFA 2GVLA 4J2MA 4ZXLA 3TZFA 4LRTA 5FJPA 3CK5A 4EF8A 4HHLA 3L7RA 3BSGA 2OX1A 3ITYA 4K38A 3KBVA 1H2JA 2DP3A 3E0WA 4ORMA 3B8IA 4N9CA 3VC6A 1WXJA 3AQUA 1J10A 1V6UA 3K8MA 5LNUA 1R3VA 4WR3A 2QJGA 3HV9A 4S3JA 2YLAA 3CQKA 4MOZA 1P48A 2VFDA 4H04A 2W91A 3P84A 1W3NA 1O1ZA 3KWSA 3TA9A 1L6YA 1D3GA 4UOZA 1GJUA 2BGQA 4A21A 3LLFA 3TC3A 1A5UA 4FAMA 4YVPA 1ZNNA 3OYXA 1K77A 1H63A 4HA1A 3AJ7A 3MWCA 4RDWA 2V5DA 3RRAA 3W7OA 4D6IA 2XINA 4DWSC 4JL1A 3TV8A 1E0WA 3MPGA 1F7BA 4HU8A 5FSEC 2P8BA 1GVRA 1J0ZA 3VDAA 4JNZA 4FHAA 3GY1A 4HMDA 4MPKA 2WSKA 4DWSD 2F6XA 4GINA 4N6EA 4W5UA 3RG6A 3CUHA 1MVYA 3W1LA 2GDVA 4UQ9A 1TIMA 4Q8NA 4MF4A 1Q7MA 3FAWA 3PM6A 3VO0A 4A29A 3OG3A 1WOBA 4MAVA 5DMMA 3IRSA 1P0DA 3FJ6A 1JXJA 1LF1A 4ONVA 4W8LA 5JBFA 1XC4A 4IGMA 2OZ8A 2DGAA 4J5NA 1LG2A 4A3UA 1VPYA 3TWBA 3UF9A 1DP0A 4QJ5B 3TSBA 1JJKA 5CPLA 4NAFA 2BOFX 1EGVA 2X2YA 1XDJA 3ARPA 3MP3A 5H6HA 1KXTA 4WZHA 5DBUA 2W9MA 2XN2A 5LIWX 1N2VA 4ZB5A 3VILA 1MW2A 3ITOA 2RGMA 1R0MA 3U2OA 3MY9A 3TW7A 1KV5A 3U6WA 5M03A 3EDFA 2JQXA 2X16A 1F3EA 5AYXA 1VLWA 1VCFA 5BOEA 4IF2A 1J6OA 4AD0A 3DHFA 1V03A 2O4QA 3VKJA 1JZ6A 1FWCC 2W3ZA 3NL2A 2XFWA 3W7DA 3TCSA 3FA5A 1K7EA 4LUYA 5LKYA 5LGXA 3F4WA 3N14A 3M5ZA 3WQVA 5KITA 3CZLA 1UQYA 4OOUA 2PA6A 3RPDA 2R8WA 1R86A 1ALDA 2UZ9A 3M4HA 1E43A 2FZBA 1UJQA 3N04A 4DUXA 3BXWA 4I5RA 4FALA 1O68A 3PHAA 3UWQA 1U30A 3SADA 4C6QA 1M01A 3I6TA 1QCWA 1V79A 1EJVC 3PN8A 2F61A 3COTA 3QY6A 1WZLA 1JNDA 3H8AA 4DELA 1AUSL 3GHRA 1K02A 3SAZA 5A2BA 3W6LA 1R3TA 1C8QA 2NUXA 1VJSA 1TJPA 1B1YA 3EB4A 5EMJA 5D04C 1KR1A 1E4IA 1E3ZA 2XZ7A 4UFKA 3HFTA 3W7NA 1J8VA 3GO2A 4D6HA 3SN4A 3SUWA 3VNYA 1RBAA 3G1XA 1KGXA 4YLWA 4ZOCA 1JZ3A 3WQGA 2ZOXA 2GJNA 3K5XA 3T0BA 3WLPA 3W76A 2YCIX 3PUEA 1Q6FA 4JICA 3TSMA 2HNEA 4BF7A 4HSOA 2DW6A 2YBUA 4DYKA 4FF7A 2G96A 3RU6A 1UJPA 4O54A 2F9RA 1O95A 3R11A 2WKLA 4ZQPA 1R30A 3IUDA 2C7FA 2IPGA 3O6DA 4GE8A 3ATYA 3VNZA 1MDRA 1QOQA 2W63A 3P8JA 1AW1A 2ZUVA 3M0IA 4L1GA 3B8SA 1KFLA 1QR7A 4Z1YA 3ZLHA 3LTYA 1NAL1 4QG6A 2PDUA 2TODA 4TX8A 3D3FA 3HFYA 3IJ9A 4AC7C 1HGWA 3D47A 1TUFA 1ECEA 2PLJA 1NIUA 1EKOA 2OEKA 2R91A 3KOYA 1AZ1A 4JDYA 4I9JA 3QTPA 2YOCA 1CXIA 3S5NA 3P74A 5DEZA 2O7QA 2HSAA 1XCXA 3V0UA 1BQCA 5A69A 3IANA 3MSYA 2XVPA 4IGNA 1GOXA 4DJDA 3T08A 1NDZA 1DJZA 4PMVA 5LXEA 1UH3A 4D2JA 2FH8A 3AYRA 1SR9A 1VJZA 5CJMA 4YMZA 4UMAA 1XPYA 4I9MA 2E6FA 3DESA 4O19A 3K46A 1S38A 3A4JA 2IPFA 2YR1A 2Z6JA 2I5QA 4MWAB 2XIIA 1A3HA 1FY6A 2GGIA 3BJSA 2O7SA 1ZB5A 3WK2A 3NQGA 3SJ3A 3LBMA 4F0LA 3MUIA 1KBKA 1VFFA 4WQ6A 2XGBA 5HBFA 4EE9A 1E0UA 1ZGDA 2ZZ5A 3QMTA 3N2TA 3KUMA 3PJWA 1FCQA 4LQ1A 5FCZA 2ZRVA 7A3HA 2QDEA 1JZ2A 4IIHA 1FCUA 1UQZA 4KH2A 1LCOA 3PZQA 4PMOA 3ANUA 3GIQA 4N02A 4PUDA 2GJLA 2B31A 3KRUA 3AUJA 2VEMA 3DYPA 5REQB 1LLWA 3LCLA 4PYSA 4QTGA 4OQVA 3M0KA 2AGKA 1EF2A 4S3AA 3SB0A 3IGHX 3TA6A 1J6PA 1ZS2A 5HPCA 3STCA 1R6WA 3SIMA 3GH7A 5TNVA 1ISZA 3INPA 4UFJA 4GMEA 1BLIA 1KM4A 2QCMA 4F66A 3MB9A 3QPZA 1A49A 2ZZ4A 1JQXA 3W82A 4B3LA 4B2DA 2WWDA 4N9EA 1IWBA 4FPSA 1VEMA 5D05A 5D9PA 1FH9A 4JR5A 5AYBA 1VBUA 4ZOAA 3WUEA 1QHZA 3TAOA 3UW6A 2VRKA 4OE7A 1A80A 3TH6A 4RDZA 1BRLA 3GTFA 2VFEA 1DIKA 3UA3A 2QEZA 4CQCA 1P6BA 1V3HA 5GVJA 2CLLA 3CIXA 1FWEC 3EAUA 3T0DA 3I7SA 5HOSA 4JQ2A 4PTNA 4GIRA 1G5AA 2Y88A 4UQEA 2B7QA 1DJNA 1TG7A 3VINA 1QNOA 4DAIA 3VVGA 4M0XA 2Z00A 5DCDA 3CAKA 5HJXA 3GTHA 3FW6A 2E5BA 5HPOA 3ZLGA 3NXLA 4MYXA 2G8ZA 2KZHA 6TAAA 4JKMA 2REQA 3NOEA 3ABRA 4GRSA 3ALGA 3O63A 5EU9A 1HKJA 3UERA 2DVXA 3MTWA 4GXMA 4KESA 3KBSA 2ZC1A 3CQJA 1ONWA 4Z08A 3GH5A 4E8CA 2BXYA 5CGMA 3GVVA 1FDYA 4JTJA 3WBEA 2X40A 4F9DA 2UBPC 3BPWA 1JYVA 3HPFA 1PO9A 2NQZA 1OFEA 4QRNA 3WELA 1KKRA 3DUGA 3KZPA 3FDKA 3A4AA 7XIMA 3E2VA 4EPDC 5C2XA 4YXGA 4IHCA 5FEPA 1IT8A 1WKEA 2E9MA 1XWYA 1DWIM 3IIXA 1FOBA 2J7DA 1XG4A 1ZJBA 1JR1A 2FKPA 1QPKA 2VGGA 4O8AA 1QHPA 3G6LA 4XZNX 3S1UA 3H54A 3W7IA 2XDFA 1SO6A 1YXYA 3T55A 1S1RA 5AVHA 4L6HA 2OT1A 1YBQA 5EMYA 2WBGA 1G4EA 3TJ4A 1BF6A 4AYSA 2VX7A 3DFPA 4J4KA 3UPBA 3RPMA 2XIJA 4YNGA 3ZS4A 2ZRZA 2V9DA 2E0PA 3ZR6A 2BY0A 2ESCA 1XLKA 3GR8A 4C6KA 1R3SA 3VMOA 3C0QA 3I3EA 4GVFA 3WF4A 3CHDA 4XSMA 1BVNP 3AS0A 4HNLA 2TRSA 1RJQA 3STFA 2XPKA 4FLOA 3EX4A 1OADA 3OB8A 2BZNA 3N3TA 2Z1KA 3K2GA 3NOYA 3PBYA 2ZUMA 4HNVA 1R9ZA 3APYA 3M0YA 3MBDA 5ABTA 4O10A 3EKZA 4FLQA 4KWSA 4REQA 1FWDC 1A5MC 1XH0A 1NWSA 4UTWA 2J78A 1F9CA 4E4UA 3QKEA 5KZEA 5EMLA 4OIFA 3WD4A 3PBMA 3XISA 1TPEA 3HPAA 1QK0A 3QTGA 3URAA 3N2CA 5JQ9A 3EWZA 3EMQA 3H4XA 2G41A 2HJPA 3DBPA 3P93A 4PFHA 1FWTA 4OV4A 4C6BA 2XSBA 3W1UA 1YW1A 3WF1A 3U7VA 2PD9A 3DG6A 1UR1A 4PTWA 3SCUA 1ISYA 2Z7GA 3B0UX 1OYBA 4CVUA 2NV9A 3O0FA 3LTSA 3GQYA 3CEPA 3KRSA 1UR8A 4GC3A 3WDQA 1LQ2A 4H4IA 5I79A 4PODA 5F7UA 1M6JA 3H26A 4O0QA 4GI9A 3T2QA 5EMUA 3B4UA 3SQMA 3WD3A 3S4TA 3B8VA 3POHA 3HO8A 4D1JA 3O7UA 1QK2A 3DYMA 3NEVA 2XM1A 3OIXA 4MNKA 3TJIA 4FIRA 4M56A 3OGVA 1T8QA 4LEFA 4M51A 3Q4DA 4HU4A 3UP8A 4X63A 1FQ0A 2BMBA 4CU6A 2E09A 1DKWA 1FWHC 1JG9A 3V0TA 2PPGA 3Q58A 1EUAA 3VGBA 2ZXAA 1WUFA 2JF6A 2VEFA 2FMOA 1HP5A 3MYPA 2PZ0A 2PWGA 1NQ6A 1B90A 4C6OA 5LIKX 2PZNA 4WDXA 5ABGA 3HTWA 3UWUA 5CC5A 1AMKA 1RBLA 4WD0A 5A6AA 1SGJA 4IFKB 4UXDA 3L2IA 3BLEA 1ENUA 3UPWA 1I0BA 4MLJA 2FDMA 5CLWA 3QV7A 4H3DA 4IMGA 3PNZA 2Q01A 1ZP3A 3IAQA 5IFTA 4UOJA 5I6SA 1OM0A 2P0OA 2NUYA 2PLKA 1CB2A 1XLDA 2Y85A 1UA7A 4B90A 1W5QA 3PZUA 2A4AA 3G3DA 3N11A 4WX2A 2QJJA 5A8NA 3CUIA 4JPGA 3LMZA 5AZ1A 3IVSA 5GNZA 3C86A 4F0HA 5CXPA 1HL8A 3W1RA 1PPIA 2CLFA 4NVTA 4PSRA 2BHZA 1S5WA 1FWWA 5BXRA 2DZPA 4AEFA 1Q8JA 3QM3A 3PULA 2OB3A 1FFRA 3W86A 1NWRA 4CD5A 3AHYA 4L4MA 3RM4A 3WNPA 3GG0A 3M1ZA 2QNEA 4KFOA 5LXXA 5C7HA 3OU8A 3IVUA 4A3RA 4WOQA 5LNRA 4KMQA 1JZ5A 1EHNA 2ZUNA 3VI2A 2GL5A 3E1F1 3HBLA 3LHYA 4JN6A 3QHNA 3SRDA 2WHLA 4X9YA 1GOOA 1LUCB 1H0IA 1TR9A 1UOKA 3FJLA 1LLOA 2PEVA 5F2GA 4IX0A 2IMRA 5EYWA 2GOKA 3CL7A 4GY7A 2A7PA 5FEXA 3G1VA 4E2VA 1MW1A 3MJMA 4J3UA 1CECA 3CUFA 1GZGA 4EXQA 2D2JA 1A3WA 4HZ8A 5I3GA 3CBWA 3APGA 3N19B 1IWPA 3VYLA 1EIXA 4M7SA 1VZWA 2E9LA 2WM0A 1R9YA 2J8FA 1S2VA 3V5CA 4OV9A 4IG2B 1L9WA 2AL2B 3BL3A 2ZWZA 3VUPA 3PZMA 2P3EA 2A0NA 3LN3A 5KZDA 3JW7A 3WX7A 3W84A 3GNXA 2CEQA 4LC6A 2QDDA 3MT1A 2GZXA 1XYMA 4PMZA 1LT7A 5A6BA 3BGGA 5MKGB 4WDUA 2FTYA 4O0KA 1PHQA 2V67A 1WZAA 4JFUA 1L8NA 1SPQA 1SR0A 2XH2A 1F74A 3W2UA 4ADSA 5I5RA 2NQ9A 1HJQA 3NDYA 3LD5A 4XAFA 1PYMA 1Q6RA 4L4PA 4M5PA 2NVCA 3KHDA 2GQ3A 1KCLA 4LTSA 1WDDA 3BTNA 1V3MA 3CTLA 3OG2A 4HNNA 4DNHA 4BR1A 4PRTA 4AB4A 1EWDA 1LWIA 2VHLA 1EGZA 4O57A 2GWGA 4XKMA 4JNMA 2PTXA 2ISDA 3M64A 4IFRA 4WKHA 4ZTYA 4L65A 3SIZA 4KCWA 3O6CA 4RV8A 4CU7A 3SR7A 1VRDA 1YRRA 1N7KA 1XDLA 5LHFA 9CGTA 3R8HA 8XIMA 5GQBA 1E1FA 1PHWA 4WK9A 3C2RA 3QV9A 3ZOAA 3UWZA 2V81A 3AAMA 3GXIA 4WDTA 1VHNA 2ZX7A 1UPMB 2VM8A 1KFEA 2HMCA 2OJPA 1TPWA 5D03A 3T8LA 2NT0A 2BVTA 5J8LA 4Q4KA 4GIYA 4DJEA 3L66A 1QW7A 5HAOA 1X38A 2WQPA 1WDQA 4AVNA 3PK7A 4GUFA 1VBGA 3PBGA 3GKFA 1J0JA 5M5DA 3M7WA 5E0FA 4ADTA 2RUSA 5EGRA 1FA2A 1H7NA 3RNDA 1FWNA 1WDPA 1VFSA 5A5WA 4GKLA 1W1TA 5FIPA 2J75A 4GXWA 1GVYA 1F8MA 2CNCA 2QCDA 3BC9A 1XISA 1HO1A 3B8DA 3TYDA 3LTPA 3BVJA 3LOTA 3A3HA 1DWGM 2R1KA 4W7VA 4BCEA 1JCJA 3SCPA 3BCFA 2HS6A 4HOWA 1C8VA 3L0GA 2J7EA 1QTWA 1OGBA 3FLUA 4K7VA 1OSEA 3ABOA 5BNKA 5FSDC 3U2ZA 2WPBA 1ZCOA 2YDSA 4O28A 4Q33A 4HA0A 3HV8A 2X2GA 3G1YA 2Y8VA 1BG4A 4E3VA 2C0HA 1Q2RA 5D9MA 2H9AA 5L9FA 3DHDA 1A0CA 2DPEA 3H6OA 2XGIA 3DBNA 4JQ4A 3LI1A 2H3BA 4QE1A 1VFTA 4P61A 1NEYA 2HZGA 3BG3A 3B40A 1TTJA 5DMLA 1UD4A 5CH9A 3IPWA 2YDQA 3ZT7A 1BYCA 1OZQA 3KBNA 4DXKA 2QVHA 1I45A 3IUHA 2A6NA 3IV8A 4Z2KA 1BG9A 3T78A 3AIBA 3IS4A 4ACZA 1IHIA 2VEKA 4GYFA 5LIUX 1AL7A 2Z1XA 4E3TA 3FFSA 1IIGA 1V3KA 2E5CA 2VMFA 4R27A 2FDSA 2OXNA 3E5PA 1G6CA 4QROA 3LXBA 4XWUA 1DXIA 3N9SA 3BGJA 3SW6A 1QOXA 3BLLA 4GNJA 3JVAA 4JTTA 1KQYA 4XX6A 3TXZA 5A8OA 3ZT6A 5SWUA 3B0PA 3CB8A 4LVAA 3G77A 1MUWA 1NDYA 1JZ7A 1K9TA 4KQNA 4KW2A 3IGUA 4PUNA 1C90A 1WDSA 4IIGA 3CQ0A 3MHGA 1RD6A 2OOGA 4MWAC 3WMBA 1A5OC 4XD5A 2VJXA 1VIWA 4BS0A 2PDKA 1KM3A 2FVKA 1IEQA 1ZUAX 2F2HA 3AIRA 3AHVA 1XINA 1XIMA 4MWAD 1JPMA 1TYGA 3C2VA 4Z42C 3GZAA 4J7RA 5AC7A 3VD7A 4HHPA 4RW5A 3EMCA 2Y70A 3UT0A 4LYRA 3AISA 1UB3A 4KPLA 1LTDA 1W9XA 3DXIA 3WH7A 4JTAA 2OZ0A 1XI3A 4RX0A 2QUVA 2IPJA 4GLEA 4LC8A 5E70A 3RCNA 4F2UA 3RPTA 5CGQA 2PURA 3GSMA 4J35A 2CBUA 1D8WA 1S2WA 4P2VA 1R38A 1CLXA 2HVMA 2GQ8A 2A85A 1LG1A 1F76A 3T09A 1XM3A 3TTYA 2B7PA 3W7RA 4DBSA 4R7JA 4JIRA 2WHMA 2PP0A 4H9UA 1KCXA 5HATA 1Z32X 2G3FA 5DCEA 4UTLA 3PNUA 3R4IA 4TTUA 2FQIA 4R5EA 4U10A 1ODUA 1V7AA 4PRWA 3NGJA 1FWAC 3WLJA 2PGRA 2X30A 2VR2A 4DJFA 3W7JA 5G1MA 1MQPA 3QN3A 1NWTA 3OA3A 1FTXA 4RPQA 1RVGA 2A1YA 5H91A 3ZM8A 4UNLA 3M9YA 1ONXA 1R8LA 1HKVA 4J40A 3VD3A 3BDKA 4ZSUA 1TPVA 1F6YA 4HB7A 5I3DA 1OK4A 3BAYA 1WE5A 1F05A 1TCDA 1QNRA 3EA3A 1YTKA 3RU8X 3EDEA 4RDVA 4KWUA 4DF1A 1XYAA 1I2OA 3AWOA 3TQVA 5HQMA 1H5YA 1QJWA 1MNZA 3OBAA 3LZ3A 1HF6A 4PTVA 1LBFA 3WF2A 4Q8QA 5JU6A 1XYCA 3GXDA 3WH9A 1YIXA 5HMEA 5A8MA 2QMKA 3CO4A 3W81A 2WC3A 3S1XA 4A35A 4PUJA 3S9ZA 3P0WA 1CXEA 4XD4A 4I7UA 1DTUA 1RY0A 2VOTA 3I3BA 3B8TA 3GR7A 2XGZA 3NQBA 3KOXA 4GO9A 3UA4A 4NSBA 4NRSA 1XQLA 5BW6A 2A79A 1OB0A 4FLSA 2EGZA 1IV8A 3DDMA 3UGVA 1W1ZA 3P14A 3BOXA 4Z1AA 4JTKA 4R3UA 5HWMA 4K2SA 4F48A 5H8UA 3FV9A 4E6MA 1X6UA 3KCLA 4RNFA 1JCTA 1P43A 1Q6EA 2ZUWA 2EO7A 2QUUA 1QNPA 5HQLA 1XLFA 1V0KA 1E3XA 3VFCA 3N18A 1QPRA 3BCDA 3WLLA 3M7SA 5C0QA 4JTRA 3L4VA 1TWSA 2YCKX 1FHVA 3G1HA 2MNRA 1NU5A 4CD4A 5E9AA 3TKFA 3R13A 3LM3A 3QQ1A 3RILA 3BLDA 2DQXA 3O2LA 2GLKA 3G18A 4PMYA 4AU0A 2X42A 2Q3OA 3ARTA 6REQB 1EC8A 3CV7A 1VCGA 3JRKA 3W28A 1ZSXA 3THCA 2HPIA 4MDOA 2H3DA 2WPGA 4ACYA 2OTDA 1TZ7A 2OELA 4H7CA 2VR5A 1EP2A 2QUMA 3GC5A 1HKWA 5I3FA 2OWCA 3XIMA 2OZTA 5E9XA 1S3HA 4IIBA 2ASHA 3JS3A 2PDNA 4JXCA 2YL6A 1ZBKA 3QW3A 4O4WA 4U33A 2YB4A 3LHTA 2A2IA 3QGVA 2ZYFA 4LCQA 4QXIA 4I6KA 3FCPA 1OFRA 1ML1A 2QJIA 5D33A 3V4BA 2F7FA 2PDHA 2V69A 3GD6A 2NSXA 2ZZ6A 4N42A 2WKGA 3L65A 3QQWA 3WQFA 4LS0A 2QIWA 4N2YA 2X1UA 1MNSA 3WJSA 1E0XA 1KBIA 1LLZA 3DFOA 1W8GA 5D09A 3FGCB 2ZIDA 1RLDA 1XIIA 1PEZA 4QDMA 5CBBA 3UXKA 3AS3A 2P10A 4H6QA 2OWWA 2XVNA 1Q6QA 2VWTA 2FZMA 1DJYA 4B5SA 3F4VA 3ECQA 3ARRA 2NUWA 4LALA 4BKNA 4P5UA 3UJEA 2ZRUA 3ZIZA 5AC6A 4GC4A 4G56A 4RNJA 1ZRQA 3H7VA 2ZDSA 2NV1A 3TMLA 1ADDA 4LUSA 3TNOA 3TQ0A 5A6TC 4Z2JA 4DN1A 1W1YA 2WW5A 4IMDA 3DFQA 4HTYA 1KM0A 2GVJA 5IDIA 1NP2A 1KRMA 3WJWA 2VZOA 2GQ9A 3GXMA 3NYZA 3V3WA 3N73A 2G3IA 1QT1A 1LORA 2FHCA 1V3LA 3QMSA 5HR7A 2W27A 3GDLA 4IQDA 4PMJA 1X39A 5KZ6A 3M16A 1GGOA 3N2OA 1TMHA 4AWUA 4LB4A 4YWIA 2CZ5A 1P4CA 4JHZA 3DN5A 5CZTA 1KTCA 1VBRA 1ZU8A 5I03A 4TVCA 3M46A 4XBSA 5LNWA 9XIAA 1H49A 4OOZA 3ZO9A 4YTTA 1I60A 1XC6A 3WQ6A 3MZNA 1YNYA 2RDXA 1CW2A 4XTDA 4XAYA 4GGBA 4NQ1A 1VCVA 5CSSA 4S39A 5FEZA 4PSPA 3W1TA 2YX0A 1VB9A 2X1SA 3O6AA 1KQZA 1HNYA 2J9YA 2GUYA 2ZQ0A 4IL0A 3B9AA 2ZA1A 1OIFA 4MIMA 1T5AA 2E68A 2AQVA 3WO8A 4US6A 4WF7A 4H2CA 3CL6A 1OQFA 4IMFA 4C7GA 5TBOA 2XG9A 4DO6A 2XYLA 4NAFB 5C2CA 3H4WA 3C61A 2ZX6A 4WY0F 1TMQA 4Q8TA 4LCSA 3NIYA 3ZJ7A 3W71A 2WC4A 4U31A 2Z27A 3N6QA 2ABBA 3QPEA 1JCXA 1JCMP 4PULA 4KWOA 4LVDA 1Z48A 3RF9A 2AMGA 3LBOA 1BKHA 3WQDA 3SBFA 1HQTA 2WV8A 4KERA 4XO6A 4A2RA 3AU6A 2W62A 1V7YA 3O3RA 3FXYA 1BVWA 3PFRA 3S5YA 4QNWA 5FF7A 3H2OA 1TVNA 1LWHA 1Q65A 1YDYA 3UR7A 3PAOA 1Y65A 4J3WA 1ZENA 1E40A 3AYVA 4S2BA 1NDVA 4WJ8A 1GVFA 3WF0A 2I9UA 3QR0A 3IAPA 2QF8A 2WMIA 3IV3A 4JTLA 1GYMA 2Q09A 2Y5JA 2HXTA 3TZNA 4KRUA 4HOZA 1K7XA 2XSXA 2PMQA 3DZ1A 2BP1A 3KVMA 2NZLA 1C7SA 1RH9A 1GVIA 3NURA 1E5NA 1FHUA 4ZZ9A 3GU2A 3WFAA 2E25A 4ZB2A 3WCZA 1AQ0A 3THAA 3VIGA 1TWIA 3CWOX 5GJMA 1EQPA 4LPCA 4FOJA 3M0ZA 3OHMB 4EIVA 2I1OA 1UYQA 4JEJA 3HIJA 2JBMA 2PGFA 4WSKA 1OFDA 2AGTA 4FP1A 3SURA 2WC7A 2R1MA 5CC3A 4IP7A 4GJIA 2UV8G 2IPWA 5DMNA 4FNRA 4UTHA 4MHBA 2FGLA 1Q85A 3PP7A 2PI6A 2VEPA 3ME3A 4U5IA 3K1GA 3GTNA 6CGTA 1IZJA 3NSNA 2GUUA 1MFVA 2INFA 1DIOA 1WUEA 1QI4A 5CPTA 4TOQA 2QJHA 1ICSA 4PE8A 3NQ6A 5C9UA 4NP7A 1OY0A 4LYQA 4NILA 4Q6XA 4DIAA 4QQ3A 1WOAA 1KTBA 1CX9A 2DUZA 4V1YA 3DECA 3B4YA 2AKMA 1DQWA 2EEXA 2ZTJA 2BY2A 1T96A 3W2NA 1PL9A 1ZLPA 2VURA 1Q3NA 1SW7A 3HB9A 4W93A 1XLMA 3MSGA 4KCVA 2GJXA 1A5CA 3DX5A 4PL1A 3SCVA 3TC7A 5I3KA 4UTJA 1LQAA 4W89A 4P7RA 2VC9A 3H70A 1UIOA 2ICSA 3T0AA 4PBGA 2ZRXA 3WEOA 4LAOA 1ZY9A 1EP3A 3VA8A 2Y1HA 4ZO8A 3DGBA 3QFWA 4MY9A 5J5RA 2FJKA 2V3DA 3G5EA 5BRQA 3ONBA 4WSJA 5M3WA 3UCDA 2BGSA 4LUTA 1S46A 3ZWSA 3LA4A 4DBDA 1KW1A 3EWWA 3V7PA 4BEQA 3LUTA 3PWIA 2IKGA 1GOWA 5HMSA 4NZJA 4A3HA 4LUJA 2NQJA 1M7XA 1O5KA 1XSKA 1QNSA 4CD8A 3DFSA 4Q4OA 3WQ4A 1QBBA 3T7VA 1XIBA 3QC0A 1UUOA 2E4TA 3WLMA 4AMCA 1VP5A 3BAKA 2VOMA 1JYWA 3TN6A 1FXQA 1UUMA 3MI6A 4QG8A 2Y89A 4TV5A 3ZLFA 4WGXA 3ONCA 4FMVA 2GOUA 2BWGA 3A5VA 1TTQA 1H7RA 3EMZA 3WG6A 2XIMA 2GQAA 1RUSA 3R79A 1UP3A 2OO6A 3IARA 3S6OA 4CD7A 3WD2A 1AJ0A 1W2VA 2BS9A 1LOQA 4NZ5A 4JTHA 1R3QA 1JCYA 1UWAA 4UTTC 3BLPX 1I9CB 3NQMA 3SI9A 4FB7A 5D8WA 2X0SA 4WOZA 3Q45A 4BWLC 1BRLB 1WXYA 1XW8A 4Y8FA 1OT2A 1LL7A 3DG7A 4UTIA 1DJWA 3MUCA 1N8IA 1W1IE 1I2RA 2VR4A 3STEA 2ZA2A 1QXLA 4Q4MA 4DLMA 4HZ6A 1F4AA 3U57A 3VC5A 3O9NA 1M9HA 1GW1A 4OKDA 3O6YX 4L80A 3HG5A 3CWNA 3CZKA 3VK5A 3QSTA 4YVVA 4YTRA 4A22A 5ABFA 5LNSA 3AMKA 4TVDA 2PDGA 4HOXA 3CH9A 4Y90A 1IF2A 3Q37A 4HPJA 4AY8A 4DO7A 2WHKA 1TV7A 3KS5A 3N13A 4GYKA 1WDRA 1Q63A 3V35A 2DT3A 3L4WA 3ZQ9A 4Y9NA 1O5RA 3U2EA 4AMAA 4XQ6A 2PDYA 1XYLA 2WJDA 3B97A 4FF5A 4PZVA 4XVEA 3MHUA 4LANA 1XKJA 4Y9PA 1DV7A 1HJWA 3OW1A 1M5WA 7CGTA 3GM8A 2EHHA 9XIMA 3VOIA 1ZBVA 3EWBX 3RMJA 4EWND 2D3LA 4FR6A 2WZEA 2CBJA 3B03A 4NI3A 2NXHA 2QUNA 4B92A 1RQBA 1QI0A 3CUXA 1SQ7A 4D72A