3C56A

Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(3-hydroxypropyl)-glycolohydroxamic acid bisphosphate, a competitive inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
307
structure length
297
Chain Sequence
MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIAVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Biochemical Evaluation of Selective Inhibitors of Class II Fructose Bisphosphate Aldolases: Towards New Synthetic Antibiotics.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
total genus 112
structure length 297
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c56A00
1K8YA 3YPIA 3CQ0A 3I7QA 4FHAA 4MYXA 3BG9A 5F1UA 3IIXA 4O11A 1MO0A 3G1SA 1WAUA 4WY0B 1E51A 4GNJA 3W84A 1P4CA 2A6NA 5D05A 1TPB1 1OK6A 3EWXA 1IIHA 3W7HA 4QITA 1QWGA 2R8WA 2NXGA 3R5EA 5CSRA 4O12A 3WJWA 2V82A 1VCVA 1OFAA 3M5ZA 3INPA 1O60A 2VFGA 3QRHA 1H50A 1LCOA 3TA6A 2PRMA 5CKSA 2JBMA 1EB3A 2VENA 4BR1A 4CNNA 5H91A 2CW6A 1ZY9A 4CQAA 2A2IA 1F2JA 5FI8A 3QPZA 3STCA 3RLUA 5DCBA 3LI1A 1OFPA 3KHJA 1Z41A 2ZA2A 4JTGA 3H55A 3PG9A 3G1YA 1B9BA 2YYTA 1M5WA 1QO2A 5CPNA 1IGSA 4WQ6A 3UQNA 1CW2A 4A29A 5LGXA 3SSJA 1NF7A 3IV3A 1WDWA 4AMAA 3PBYA 4FNSA 3PUOA 4UFJA 5I3IA 4IPIA 3W73A 3PB0A 1PIIA 2W79A 1K8XA 4R7JA 4FNUA 4Q32A 2Q8ZA 2H6RA 1JUBA 3H53A 1HO1A 1FWNA 1VJIA 1YTDA 1R47A 3OVPA 4LU0A 1JCYA 1TV5A 1GWJA 1SO4A 4KFPA 4UFIA 3GB6A 2HTMA 1MSSA 3W9ZA 2WNQA 4UMAA 3T4CA 3C3NA 4MJMA 1SZNA 5LSMA 3PUEA 3I7SA 4HSOA 3TMQA 2DZWA 5EKYA 1R2TA 3LTSA 4LWWA 2I9EA 1LRQA 1TPDA 2JGQA 3LRMA 3W2KA 5KMYA 1WXJA 3NR0A 4UNKA 4O54A 5AHEA 1TTPA 1A5CA 1EWEA 1ZFJA 2XFWA 3N73A 3GDTA 1R2SA 3DFNA 3LHZA 2ZZ5A 3KVLA 4JR5A 4LUIA 3ZR4A 1OF8A 1GVQA 3Q37A 3S5NA 3LLDA 3S1WA 3FYPA 1S3HA 1TB3A 3V75A 1G4EA 2E6YA 5U4NA 4GJ1A 1ALDA 1QR7A 3UPBA 4IMGA 1VLIA 5I3FA 4EWND 4J9JA 1GPWA 1ME7A 2CZEA 4JX5A 3NQGA 3TROA 3STEA 1H7XA 1H60A 2PCQA 4N4QA 4HIBA 4PFMA 2P10A 3UXAA 1PHQA 3BV4A 4GC4A 3DFPA 4PL1A 2ALDA 3DI0A 4HPJA 1IXPA 1TO3A 3DENA 3OVRA 3U8GA 1OHLA 2ZRWA 4FNRA 5DCEA 3HG3A 1XUUA 2HMCA 2X30A 1HTIA 1RQHA 3ZS4A 3IIOA 2QAPA 1TRIA 2TPSA 1NFBA 4DPQA 3G1XA 1DQWA 2GUUA 5G2IA 1SR9A 4X22A 4AAJA 2ZQ0A 4DXVA 1SSDA 4GRSA 5G4EA 2JKAA 4O14A 2FFCA 1GEQA 3LHUA 1B57A 3AO0A 1PV8A 1R2RA 1UJPA 2YR1A 1KTBA 1LDCA 4E0CA 1LOQA 3ZWTA 3Q58A 4MZYA 1AW5A 4MFEA 5D2YA 3G24A 1ICPA 3HPXA 4U4MA 3WJZA 3G3MA 1XBZA 2A7RA 1H7RA 4X3ZA 4NXSA 3W7KA 1KA9F 5L9FA 2OMAA 4O10A 5KINA 3HGJA 3QW3A 1PE1A 1P0NA 5LKYA 1H5YA 1K03A 1X1OA 5C2XA 5F2MA 3RFAA 3B0UX 3KRUA 3USBA 1YXDA 5LNUA 1SQ7A 4JYEA 4X2RA 4UFMA 2BZNA 1KFLA 1W56A 3R2GA 3W2UA 3L2IA 3UZ5A 4QJ1A 3LRLA 3T78A 1F6KA 1O5XA 1X7FA 3P84A 1KFJA 4PH6A 3TSDA 4E2DA 4MFDA 3K30A 2DZXA 2ZA3A 4LVDA 5L6UA 3PM6A 2V2DA 3CM4A 4O1BA 3TMLA 3P82A 3DHFA 1KFEA 3CWOX 3FEMA 3WJXA 4RZ5A 3DFQA 3MYOA 4UTIA 3LV6A 4PC8A 5AC7A 3GDMA 5AC8A 3GNNA 5C5YA 3W2LA 4DBDA 5EA9A 4UTTA 2FJKA 2VFEA 3L21A 4GE8A 2Z2UA 1G4TA 4O53A 1AL7A 1YDOA 4DBEA 1JQVA 2X2GA 5D2XA 2VELA 3LHWA 1X6UA 2GVGA 2RH9A 2W6RA 3W7RA 3ABRA 1DJQA 4O8RA 2Y88A 4RV8A 1LTDA 3W7MA 2J9XA 2BWGA 3G3DA 4IX0A 1H7OA 3M9YA 4RKAA 2WQPA 3NDOA 3BO9A 3NXFA 2X1RA 2JKPA 4JTEA 4XZ9A 2R91A 5D37A 5DBUA 4AWSA 1XBVA 4UTJA 1TPH1 4N9CA 3VKJA 4S2BA 3DFSA 5G4WA 3L68A 4DO6A 4K8HA 5LZLA 5KSWA 2ATMA 2XN0A 1FQ0A 3EWBX 1QMLA 4UC5A 3EX6A 2EGZA 5J5DA 1ICQA 4JD4A 4YLWA 1QOQA 1TTIA 1W31A 4GUJA 4H3DA 2JGYA 4ZQPA 4IPJA 1LM1A 5BNKA 3C8FA 4PODA 4ADUA 5HUPA 4CCCA 3C2RA 3E9AA 3TNOA 2QCDB 4R53A 4N6EA 2YZRA 3AJXA 1B3OA 3DH7A 3HQ1A 3O07A 3HMJG 5FEZA 3HBLA 3W07A 4FB7A 3QZEA 3A5VA 3CTLA 4MY8A 3E96A 5LHFA 2GPTA 4OV4A 4UTKA 3I7RA 2V5LA 1LOLA 3M6YA 3GAYA 4A2SA 5AYYA 5F2GA 1EIXA 1OFDA 3NO5A 1KLZA 4OWGA 1OYAA 3LCGA 2OX1A 5EL1A 1OK4A 3P81A 2C14A 2YW4A 3NEVA 2B7QA 4O1AA 1Q6QA 2G96A 4JTTA 3C2FA 1W5NA 5FF4A 1RQBA 4TX9A 5BOOA 3B0VC 4JIQA 3C61A 1TV7A 1WBHA 3HG5A 5KZMA 2PRLA 4N4PA 3EWYA 3FA5A 3MHFA 1H1ZA 4JTSA 4ICNA 3W23A 4DF0A 4H4IA 3H54A 4FNPA 2ZYFA 2RDWA 3QMRA 4MYAA 5DXXA 3ELFA 2FDSA 3LXBA 1CX9A 2VEPA 3LBMA 1GVRA 4WJEA 5HULA 4FF7A 3MP3A 3LB0A 2Y7EA 4JEQA 5AHNA 1ZHAA 4O1DA 2QJHA 5CGQA 2J9ZA 3E12A 2ZA1A 3CLMA 1RVGA 3WJYA 3KVJA 1KBJA 1QO5A 3WFAA 3BLEA 3UNDA 1THFD 1N8FA 2DZSA 4BI7A 3UWUA 1QCWA 2Y7DA 1DKWA 2DZPA 3FS2A 3P60A 4YL2A 1N7KA 3PSWA 3DXIA 1TYGA 3W1XA 1YDVA 3HG2A 1AK5A 3C6CA 5AYZA 1TPUA 4DO5A 4DF1A 3C2OA 2ZZ2A 1W1ZA 1TQJA 3NL3A 4K38A 5D04C 4M6QA 2V8ZA 4UCGA 3RMJA 4Y6GA 4GUIA 4G1KA 4YMZA 5HWJA 1UASA 3QFEA 2D73A 3O15A 1TCDA 2ZRUA 2E5BA 3W1MA 4BFAA 3HPSA 4YWIA 2B7OA 5FF2A 3TX9A 1WBJA 2B0MA 4MY9A 3G0SA 3TV8A 2WPBA 3S8HA 2O7QA 4LRSA 1M6JA 3GDKA 4NX0A 2ZRXA 1RV8A 2FB3A 4X9SA 2O7SA 2YXGA 2NLIA 3KOFA 1JQXA 3STFA 1SFLA 3W22A 2QCHA 4D2JA 5IBXC 3KRSA 2Y7FA 1T0OA 4NXKA 2WV8A 4O57A 3TR2A 2WNZA 1FX6A 1YDNA 5DY3A 2CZ5A 4Y90A 3G8EA 3W6YA 3M5XA 1KM2A 3TSMA 3LRKA 4HNTA 2RFGA 3LXCA 3A23A 3UYCA 1BKSA 2NWRA 3VE7A 4RX0A 3GXNA 3DHDA 3W88A 3S5OA 3QSRA 3LCFA 4ZZ9A 3HGSA 3LLFA 3LV5A 3UZJA 1J5TA 4A2RA 3SR7A 4FX7A 3ABSA 5AB3A 5DXYA 2QCCA 5K2ZA 3LDVA 4GFSA 5BW6A 1HG3A 2P1FA 2ZZ6A 2B4GA 4ZQNA 1XKYA 4LV9A 1TV8A 3GDLA 3M43A 3FYOA 4TO8A 2PRHA 4DEFA 1Z44A 3P7YA 3EWZA 1G7VA 5LHEA 3TQVA 2DORA 4O13A 5FF7A 5J5RA 2CLOA 3FKKA 3BGJA 3HGOA 3A21A 3IIVA 3NQFA 5GVJA 1D3HA 1H7PA 3JS3A 2FPTA 1FWWA 4RZ4A 5A8GA 2DJXA 2V5BA 1XBXA 3SIZA 4C1KA 4K8EA 3TW7A 1OYBA 4JYFA 4W9TA 1A5AA 2WO5A 5AC6A 3EX3A 3WK1A 1DJNA 4LVFA 3MP5A 4C1LA 2CLFA 3GZ3A 2VXNA 2EAWA 4I7WA 4R33A 2NV1A 3T44A 1DV7A 1YADA 2QJGA 2GVLA 4MUZA 1Z42A 3M5VA 4O4WA 1OX4A 1YXCA 1U5JA 4JICA 5EY5A 3KRZA 3RK8A 4QSHA 1GVOA 3C56A 4FXRA 3LOTA 2EF9A 3UWWA 2QCNA 4JGDA 2WSQA 3G0UA 3G1VA 5E1QA 3EKLA 2FPYA 3NQ7A 4MY1A 1K7XA 3NL6A 1GG0A 3G8RA 1JULA 2BXVA 1HUVA 4XKYB 4BF9A 1K02A 3NNTA 2E6DA 2E5DA 2E68A 1JVNA 3NPWA 5AHLA 3ZFHA 1BWLA 2Q8LA 2EKCA 3FLUA 3DKLA 3W83A 4XQ6A 2QF7A 1AW2A 1H7WA 2R14A 2NZLA 3L5LA 4L4LA 5DN1A 4K37A 1X8FA 3W72A 3I6RA 4HNNA 4RK8A 4JYDA 4UTUA 4PA8A 2QUVA 1SO5A 2Q3RA 4O16A 3T7VA 2V9DA 2E6AA 4NVTA 1F5ZA 4RCXA 1W3NA 1JUKA 3DU0A 2NXHA 4JTKA 1U83A 3MO7A 3W7EA 4S2CA 1JUEA 4YXGA 1V7YA 2CLHA 4Z0JA 4O28A 3GXTA 1JJKA 3C2EA 2A1YA 3E02A 1GTEA 1ZNNA 2PC4A 3JRKA 4LV4A 3CIXA 3LHVA 3HJZA 3CC1A 1YPFA 3L0GA 1IIGA 3DFOA 2YGYA 4RZ6A 5D03A 3IGXA 4OQVA 3B05A 2GOUA 4JTHA 3NQCA 3UY8A 4NJGA 3L66A 5HUOA 4CQ8A 1AG1O 2X1UA 2H90A 3QM3A 3NL2A 3PB2A 3W7OA 2DZUA 3SZ8A 4UTHA 3EXTA 4UNLA 3HO8A 1MEIA 4QQ3A 1L2UA 3U6WA 4LC6A 1LP6A 3MMTA 5E0KA 3W1PA 5C6MA 2C19A 1T99A 1VRDA 4LTSA 4ORMA 1SPQA 3EKZA 3N34A 3FIGA 2FQIA 4Z1BA 5IBXA 3P80A 1FY6A 3TAKA 4XUGA 3GYEA 3W1QA 5K3VA 1LOSA 3I65A 2X1TA 1FDJA 4NNCA 4DO4A 3OA3A 2A7PA 3GVGA 4QIUA 2QCMA 4BWLC 4UTMA 3O6YX 3B03A 1XI3A 1C8VA 3N19B 3S1XA 5DCDA 3LHYA 1K7EA 1QAPA 2F84A 2OZ0A 3NQ6A 1GJPA 2V30A 3MP4A 5LNRA 1PVNA 2WKJA 3OVQA 1LROA 2V0TA 3W7JA 2J88A 4PEKA 1TPFA 1A50A 3GKFA 1B4KA 2RDTA 3LM7A 1D3GA 3PAJA 3FFSA 4DQWA 1IXOA 3EX1A 1SU5A 2GVJA 3W7GA 5HINA 2BSLA 4OE7A 2GQ8A 2X16A 4JTUA 4CCDA 1SZGA 3RLVA 3MBFA 4E38A 2ZRZA 1QOPA 1RPXA 5IM51 1TTJA 2Y89A 1GG1A 1JRCA 2ZZ7A 3NG3A 1J2WA 5AFDA 3GLCA 1GVSA 1TRDA 4WXYA 1GT8A 1FDYA 3EX2A 4LS2A 4LOCA 2RKXA 3G22A 4JY9A 4S1FA 2ZBTA 4K39A 3W7IA 1NAL1 2RHGA 5CPLA 3TC6A 4IMCA 3C0JA 4BI6A 1WOAA 3A24A 4AVFA 5K7JA 2YFNA 4HNVA 3VCRA 4LY8A 1JCJA 1MEWA 4MJZA 1TPEA 4ONVA 2YCEA 4EF8A 2I1OA 2LLEA 1TPVA 4O52A 1H63A 3W7QA 3NQEA 3NOEA 1OVDA 4Q33A 4WOQA 4N9DA 1P1XA 5D2TA 1FXPA 5HJLA 4EOUA 4OV9A 2NUXA 5TBOA 5CPMA 3TQ0A 4MOZA 4UMBA 2FB2A 2G97A 3TC7A 3F4WA 4AHPA 4O15A 4LUJA 1I8JA 1KM0A 4OHQA 1YLVA 3IIZA 3O1NA 1XXXA 4Z1DA 4ML9A 3BLIA 1VHNA 1VYSX 3W1LA 4ZQRA 3O8AA 3LCHA 1NSJA 1GTHA 2XN2A 3PBVA 3VE9A 2QCFA 5DBTA 1SW0A 3RF9A 1XL9A 1GZGA 5AOUA 2CZDA 5HWMA 4FO4A 4O18A 2PURA 4PTNA 4KWVA 2CLEA 3TUUA 2Z6IA 2VFDA 4IX2A 3W1RA 1YTEA 4TMBA 3ABQA 2ATSA 1L9WA 4P2VA 2WSYA 1K3UA 2QCLA 5F1VA 5D33A 3NQMA 1XDMA 3MHUA 2Y85A 4M6VA 2CU0A 3UWQA 2YYUA 4JN6A 4FNQA 3NYZA 3A22A 1XDLA 3UWZA 4HPXA 4UTLA 4CQ9A 1A53A 4N9BA 2IQTA 3KXQA 4WX2A 2A0NA 5C55A 3LTPA 3M44A 2QAFA 3EWUA 3Q2DA 1LORA 4ORIA 4UFLA 5CG7A 1R30A 5HMSA 4MLRA 1MXSA 3O06A 3NPVA 1OYCA 1BWKA 4UTTC 2NV2A 3NPUA 3PUDA 2NX9A 8TIMA 3O6CA 2QCEA 3O16A 3SFKA 3PS7A 4JTLA 3LCXA 1LBLA 2A21A 2CZFA 3HB9A 1FCUA 4NJKA 4XKYA 3PBUA 1SUXA 1OX6A 3D0CA 4N6FA 2C16A 5EYWA 3Q94A 2UV8G 3PY2A 2CLMA 1QNVA 2QUUA 2VC6A 5CSSA 1I2QA 3P61A 1ZAIA 2DU2A 2Y63A 1JCLA 1YTKA 1OJXA 5DLCA 5F2IA 4HN4A 1VC4A 3S9YA 4POCA 1W54A 3S0CA 1LLWA 1EPXA 1G7UA 4HT3A 1VZWA 4A21A 3LERA 3BVJA 3BW2A 1TREA 3THQA 4GUGA 4QAIA 1I2OA 1YXYA 3WK2A 1XM3A 5F2LA 3IRDA 1JCXA 1PS9A 6ALDA 1HFBA 3P8JA 3OG3A 2C15A 1EP1A 1OFEA 2OJPA 4FXSA 2HS6A 4NUWA 3NZRA 4N2YA 1WYIA 2V2HA 2YFOA 4HKPA 3PC0A 1ZAHA 2NX1A 3LCIA 4JDYA 4LC8A 3NQ8A 3THAA 3IVUA 3NQDA 1F76A 4O19A 3IVTA 3EWWA 4JDBA 5D32A 3QH2A 3W7CA 1EX5A 3P62A 1A5SA 3NAVA 5D09A 5HR7A 1Q45A 3TE9A 4N9EA 3KX6A 2A7NA 1GOXA 3QW4B 1EEPA 4ZL1A 4NJJA 4L4MA 5D30A 2E6FA 1AMKA 2ZZ3A 4FIRA 3QF0A 3IEBA 4DELA 4P61A 2E5CA 3EXRA 3TFXA 3QC3A 1EUNA 4NZJA 4UFKA 4UTWC 3OEXA 4XBKA 1OFOA 4NJHA 4AEOA 2A6LA 2WJZA 1AL8A 3R12A 2VFHA 2QDGA 5I3HA 4BWLA 3LI0A 1T8XA 3EXSA 5AHFA 4M7TA 1I2NA 2EHHA 4ADTA 3RNDA 3KVMA 5BMXA 2ZCGA 3F4NA 3GXPA 4MIMA 5T26A 1Z48A 4LS1A 3GKAA 4IQLA 3TXZA 4KFNA 4MZ8A 3G1DA 1KM3A 1RR2A 5HQEA 3TFCA 5CZSA 3M16A 4QNWA 3MBDA 4LNYA 4CLMA 4JX4A 4TR9A 3GAKA 2BTMA 4FEZA 1FDZA 4CNOA 4HHPA 4UUIA 3VNDA 2E1DA 3EX4A 3GNDA 3B04A 4MKNA 3W75A 3P8IA 1H1YA 2WSRA 4U28A 1TPC1 3LCLA 2FLIA 5AHMA 5TQLA 1VGAA 2A4AA 4UR7A 2V81A 3KVKA 3MUXA 4FIQA 4KWWA 2HS8A 4TU1A 4PL2A 4ZMGA 1ZCOA 3TCEA 1XBYA 1ZALA 3W1TA 2VFFA 1W5MA 2J24A 3OIXA 2G95A 2GJLA 3SY5A 3G1FA 4NZFA 3TJLA 5LNWA 3BARA 2BLEA 4XBSA 4Z08A 2Z1BA 4BI5A 1LBMA 2TMDA 1SO6A 3CEPA 1ADOA 4WUIA 3L5MA 3TDFA 2Y62A 1OFQA 1VCFA 4KFOA 3FJLA 5LNVA 3M5YA 5FF3A 3LGEA 2JKEA 1CI1A 4TMCA 3R8RA 5AHIA 5KITA 3E49A 3QPYA 1VPXA 6TIMA 2C1HA 1ZJIA 4EIVA 3UPWA 2ZTJA 1DHPA 4IMEA 1W8SA 1VYRA 3W86A 3SJ3A 1QPRA 3TK7A 4I9AA 1O4UA 1XFBA 3QQ1A 3W1UA 1EUAA 3W7LA 1XCFA 4MZ1A 2J6XA 3KFTA 3TXVA 1WX0A 1P5BA 3BPWA 3W2JA 5BMWA 5K9CA 3ZWSA 3CPRA 1EA0A 3FOKA 2VEMA 1FBAA 5F4XA 4OU1A 3R89A 3MI6A 3MI3A 2NX3A 4E2BA 4O4VA 3NQVA 4UIOA 4XTDA 3W87A 1I2RA 2ABAA 2VKZG 2QEZA 4NU7A 3S6DA 1DQXA 1BEUA 1VQTA 1QDSA 2QCDA 2TSYA 1KFCA 3S1VA 5I3JA 3M47A 3STGA 4HNUA 2C6QA 1JR1A 1RZMA 2TYSA 2NUYA 2TRSA 1LZOA 1FWRA 1H7NA 4RJEA 1EP3A 3M1ZA 3N2MA 1OFRA 2A85A 1TMHA 1KM6A 1NF0A 1OX5A 5G1YA 3B4UA 4O1CA 3DZ1A 2B7PA 1H61A 1PCKA 4OT7A 3G0XA 1G4SA 2ISSA 4JTIA 1MEHA 3L9CA 3DKJA 1H51A 1P0KA 1VH7A 4NT0A 1FCQA 3G1HA 4M19A 4OGZA 2OCZA 3W7PA 3PULA 4KKXA 5A5WA 2NUWA 5D38A 3L0KA 5FEWA 1SZEA 3BLFA 4K6AA 2C13A 1FWTA 4UTWA 4EF9A 3MWAA 4AHQA 3QYQA 1KFKA 2PE4A 2Y70A 2KZHA 1SW7A 5G2HA 5K9DA 5K9XA 2ZRYA 4K7VA 3OBKA 1C9DA 1G6CA 4JTFA 1TQXA 3LBCA 2HSAA 1F7BA 3V1PA 2ISVA 5D2VA 1UBSA 3QQ0A 3GIYA 5TIMA 4Y96A 3LXAA 4GUHA 5FF0A 1KM1A 1PCWA 5HR6A 5C54A 5FESA 1AW1A 5I3KA 1YYAA 1C29A 3IIPA 2GQAA 4IXXA 2FIQA 3DFTA 5KZDA 3NZ1A 4Z0SA 4IUOA 1Q6OA 1PHWA 3CWNA 2C18A 2NXIA 3HG4A 2H3BA 1I2PA 3NQAA 3O6DA 1KTCA 3IGUA 2ZZ1A 3DAQA 1KM5A 2P0OA 2QR6A 3NL5A 5CPOA 3CB8A 1S5TA 3TJXA 4CCEA 2VOMA 3ANYA 2V2CA 2DZTA 4IMFA 5H2ZA 4QNEA 1TJPA 4H6KA 3I68A 4TIMA 3GR7A 5D2WA 3UD6A 1W5OA 3CT7A 4A3UA 1UUMA 3W76A 5ABTA 2QCGA 3F03K 3E0IA 3IVSA 4JIPA 3DGRA 4UXDA 1G4PA 1I4NA 4CNPA 3QMTA 3GX9A 1NVMA 1ME8A 3F1QA 3S5YA 3QSTA 2NWSA 1WOBA 3M7WA 2GJNA 4O0ZA 3TU9A 2VFIA 2CWNA 2FTPA 3BGGA 1IXQA 4NJIA 2Z0IA 3MI2A 4LT9A 4GWEA 2H8ZA 5CZJA 2VEKA 1OX4B 2XN1A 3N3MA 3TSBA 3WK3A 2RDUA 4LS0A 3UWVA 2OT0A 3WK0A 3A5FA 3B0PA 3N14A 1KM4A 1OG0A 4ZQCA 4LRTA 3N9RA 4IWWA 3SGZA 1F05A 1LLZA 1EP2A 5HWNA 1Y0EA 1HO4A 1SZFA 4B5NA 2ZTKA 1FCVA 3ATZA 2Y6ZA 2CFFA 1SSGA 1VLWA 1W37A 2ISWA 1KTNA 1LBFA 3GDRA 1JRBA 2H8XA 2E09A 2ZZ4A 3UXDA 4AH7A 1OF6A 1TIMA 1KBIA 3PBWA 4XWUA 3T55A 3W71A 4AB4A 3NQ2A 2GQ9A 1FCBA 4BK9A 5CZTA 1WQ5A 4YCOA 2YW3A 1L6WA 2AAMA 1DL3A 1QPQA 1W3TA 2Y7GA 3EEGA 4HSNA 4DF2A 2ZFAA 1LRTA 3QMSA 4Y9AA 1WA3A 1KV8A 5KZEA 1W5QA 2OT1A 1KFBA 3PSVA 1V5XA 2QJIA 1GQNA 1L6YA 2A5HA 2EPHA 2Y61A 3BW4A 2C3ZA 5AYXA 5G1TA 3N9SA 5DELA 3L65A 5F4WA 3C52A 1D9EA 1OFBA 3S1UA 5HNRA 2ABBA 2FPVA 1UB3A 5K4ZA 1F6PA 1ICSA 1H62A 5MHBA 4QISA 3PR2A 1DVJA 2ZRVA 4O0KA 4JTJA 2Q3OA 2YX0A 3T40A 1O95A 3FJ6A 4GBUA 3NM1A 3LCWA 4M6PA 3NPXA 1RD5A 2I14A 3SECA 1SW3A 3RU6A 4ZQOA 5D02A 4NQ1A 1M7PA 4EVZA 4JX6A 3TW6A 2X1SA 1BTMA 1RQEA 1W0MA 1Q3NA 3HGRA 4QM1A 2Z6JA 4RXFA 4AF0A 3L0NA 1Q6LA 2CLLA 2YPIA 3CIWA 4O50A 4WZHA 3W2MA 1ZENA 3TQKA 1ME9A 3O63A 4WOZA 4NNAA 4UFHA 3OHIA 4K7YA 3B06A 4A22A 4IJBA 5FEXA 3W1AA 4JS3A 1SO3A 3MHGA 4DPPA 3KAOA 1UUOA 4LVGA 3UWYA 3SGUA 4NNBA 3NA8A 3L5AA 4LVAA 4AF0B 5K4XA 3BK0A 1KLYA 1TPWA 3NVTA 3N2XA 3PG8A 4UR8A 3W2NA 4GUFA 2QDHA 1UCWA 2DJLA 3PWAA 1OABA 2BX7A 1A5BA 4MLJA 4AWTA 5CZ0A 5AN7A 1ONRA 3MW7A 4OBTA 3W3OA 1W3IA 5EBUA 3M41A 5LNSA 1TJRA 3MYPA 2WNNA 1FWSA 3CEUA 5LGZA 1XC4A 1ML1A 1S5VA 5BRBA 3P74A 3TAOA 2AGKA 3TKFA 3G1AA 1KW1A 4I7UA 1ZAJA 3R13A 4LW7A 2H3DA 2QKFA 3P67A 3P5YA 3FKRA 1DOSA 3HIJA 1N55A 2DZVA 2C0AA 3BW3A 4UMCA 1F73A 1FXQA 2QUTA 1QFEA 5EPDA 3CU2A 1W5PA 3P5ZA 2W0UA 1VS1A 4R34A 3W1NA 3PF3A 4IMDA 3HPZA 1TTQA 3LHTA 1I45A 5SWUA 4ALDA 3DBPA 2JK2A 4JY8A 3W7DA 5KTLA 4N02A 3W85A 1G69A 4O17A 1GVFA 2CLIA 1QPOA 3O05A 4MVAA 1NEYA 4RLIA 4ZVJA 1HL2A 1O94A 4RR4A 3JR2A 3B8DA 3QJAA 1JCMP 1VHCA 1VR6A 1B4EA 1EWDA 2J9YA 3IGSA 1QPNA 3S42A 4YCPA 4IOTA 1DBTA 1Q6RA 4WY0F 4NX5A 3L67A 1K8ZA 1K7FA 1L6SA 4I7VA 2VEIA 2ZDRA 4ADSA 2B7NA 4AHOA 4Q4KA 4MPQA 1XUZA 3C2VA 1MZHA 4Z1AA 1YPIA 1T96A 1TSIA 1R46A 1GYNA 3GR8A 4WXZA 3SI9A 4M7SA 3VFLA 4IXHA 3VI2A 5I3GA 3A9IA 2CLKA 4GXMA 5G5IA 2R94A 1G67A 5G2WA 1VYPX 4ZQMA 3TIMA 3W70A 4AXKA 1J4EA 5DY2A 1SFJA 1S5WA 5F4SA 5U7SA 1DORA 5FEPA 1IF2A 1GYLA 3MJYA 3LTYA 4XTIA 3ATYA 4FX8A 1O5KA 2WOQA 4AWUA 3C4UA 3NGJA 3GK0A 4M5PA 3ABOA 4RXGA 5E93A 3SW6A 3W74A 1F74A 1LRNA 2F7FA 3HF3A 4WD0A 3TH6A 4PCFA 3M0ZA 3BG3A 2G5WA 4LVBA 4FNTA 3NM3A 4Z1CA 1PL9A 3G18A 3U2OA 3S5ZA 2DP3A 3CHVA 4JXCA 1JCNA 2YSWA 3LX9A 1FUYA 7TIMA 2E77A 4Y8FA 2J27A 3BG5A 3UY7A 1WV2A 4FX6M 4K36A 3PVFA 1X1ZA 3WJSA 4WY0A 3HOJA 4JNMA 4IGHA 3QEZA 1LYXA 1VCGA 1M7OA 1KV5A 3DI1A 3W7NA 2YDAA 1IXNA 3EB2A 2AQWA 5EMUA
chains in the Genus database with same CATH superfamily
3IJ9A 3YPIA 3IANA 5F1UA 3BG9A 1KNWA 4O11A 3G1SA 4G5DA 5I2UA 4GNJA 2YL6A 3W84A 4HOZA 1ZS2A 4X60A 2R8WA 3R5EA 2V5JA 1CTNA 2WZTA 4YU1A 1VCVA 1OFAA 1O60A 2ZADA 3VIKA 4EAYA 1H50A 2CHRA 2QW5A 2JBMA 3R0KA 2BVYA 4F0HA 4BR1A 3UG8A 1CZ1A 2A2IA 3URQA 2UY5A 2E4TA 1L8NA 4QJ3B 1PZ0A 1E9YB 1DJXA 1Z41A 2ZA2A 1V3KA 3H55A 3G1YA 3QOMA 2A3AA 1TA3B 2YYTA 1M5WA 2VOTA 1IGSA 4WQ6A 3UQNA 2GWGA 3ABXA 3RPTA 1ZBVA 3RAOA 1NF7A 1KD0A 1WDWA 2V38A 3WBYA 3UT0A 1RCXB 5FCZA 3VNLA 1K8XA 4R7JA 4Q32A 4GPNA 2VX4A 2Q8ZA 2H6RA 1JUBA 1HO1A 1VJIA 4GO9A 1R47A 1TV5A 3LMZA 1GWJA 4HNLA 1TZ9A 4HK7A 4UFIA 3FN9A 3CAQA 1NDYA 1MSSA 2ZUVA 2CEQA 4UMAA 4MJMA 1C91A 3CMFA 2CKRA 3CB3A 1E1CA 4ATLA 1R38A 2P5NA 1TPDA 2JGQA 2YL9A 1GVIA 4B5UA 1EQPA 2CWXA 5AHEA 1TTPA 3WCZA 3LYEA 2XFWA 4D6GA 5BWFA 1W9UA 3W81A 3J7HA 3KVLA 3ZR4A 1AH4A 3Q37A 1G4EA 4GJ1A 1ALDA 1QR7A 1DXIA 1XRVA 2G3JA 3RM8A 3L4ZA 1BQGA 3L4XA 5LIYX 1IEVA 1W3KA 1OZQA 1FVPA 4QP0A 4JX5A 2OLHA 4E3VA 3TROA 5A2AA 4MWAD 3WLHA 1UH4A 4PFMA 4IPNB 1R7AA 1PHQA 4GC4A 3THUA 1EIBA 3FDGA 4HPJA 4YYFA 4IPLA 1C7TA 3DENA 8XIMA 1OHLA 2ZRWA 4FNRA 5DCEA 3N6QA 2HMCA 2X30A 4TTUA 1RQHA 4F66A 4DUWA 1EO5A 5HA7A 2QAPA 3QHOA 1UR2A 2TPSA 4LBSA 1J96A 2GUUA 1NJJA 2IQ0A 4DXVA 1SSDA 5XIMA 2JKAA 1M53A 4QXIA 3VIMA 4O14A 3LHUA 4WJ8A 2NT0A 4Q4MA 1E9ZB 1F6YA 1R2RA 1RPKA 1D2KA 3R0DA 4G1NA 3OO2A 1LDCA 4GVFA 1LOQA 3AIRA 2J79A 2KAUC 3WQ6A 3SQLA 1A3HA 3UFYA 4X3ZA 4NXSA 2OYKA 2J8FA 1M9HA 4AZCB 5IHSA 5KINA 3HGJA 3SGGA 3HJEA 1P0NA 4C5YA 1JZ4A 3QV9A 1H5YA 1K03A 2CESA 1X1OA 1AD4A 4V15A 3W02A 5C2XA 5F2MA 3WD2A 3RFAA 3B0UX 4W7UA 3USBA 1SQ7A 2R1NA 1SJCA 1W56A 3R2GA 3W2UA 1JGMA 4G7EB 2NW0A 4QJ1A 4MJ4A 2YCLB 2A79A 1F6KA 5A1AA 2YBVA 4PH6A 3MKKA 3BAXA 4P7LA 3UCQA 3PM6A 3N4AA 4A6GA 3DHFA 1GCYA 1KFEA 3IUDA 3RM4A 1IYXA 3FEMA 2PDIA 4B92A 4KCVA 1CXFA 3W2LA 2D3NA 2NVAA 1WCGA 2J75A 2JIWA 3V5OA 1KCZA 3L21A 4GE8A 1AL7A 1EYWA 1YDOA 2ALRA 2VELA 2OTDA 1RA5A 2GVGA 3W7RA 4DI8A 2J7CA 2A3HA 1LTDA 3N2CA 3GH5A 1OCBA 1R9XA 5TNVA 4UQBA 3L4UA 2OQYA 4IF2A 1YMYA 2JKPA 4XZ9A 2PDPA 3TA9A 4ECLA 5G4WA 1E0XA 4DO6A 4K8HA 3I6EA 3XIMA 1VEMA 2XN0A 3N2BA 4PGLA 1DP0A 1QMLA 2EGZA 1QXLA 3UG4A 2WZEA 1ZQ5A 1P7TA 4JD4A 4F40A 1TTIA 1W31A 1OEPA 2GYIA 1E55A 2JGYA 1Q13A 5BNKA 4ADUA 4BEUA 3VNJA 5CJ5A 5CEWA 1G9HA 1EJTC 4XO7A 3QGVA 3L23A 4ICMA 4N6EA 1B3OA 1CXEA 3WUBA 2HE8A 1KFWA 3ZR6A 4GNKB 4KWSA 4FB7A 3QZEA 4C5ZA 1JZ2A 2HK0A 3AISA 3GDBA 3E96A 5JXQA 5LHFA 2E3ZA 3AUJA 1REQA 3ZZ1A 1KLZA 2YL5A 1OK4A 2PDJA 3R11A 3QN3A 2G96A 4IT1A 4JTTA 2JF6A 3E5BA 3ANVA 5FF4A 4S38A 4TX9A 3WLIA 1TV7A 1WBHA 3AWOA 2PRLA 1G01A 4Y2WA 3FA5A 1F9CA 4JTSA 4GLEA 3KDOA 1HZYA 4H4IA 2CITA 3UF9A 2PGEA 2ESCA 4B9ZA 1QRQA 2RDWA 4XAPA 3WDJA 3CPUA 2FDSA 3EDDA 3LMYA 3LXBA 2YA2A 3DUGA 4J3WA 4UQDA 1K70A 3GW0A 3VOCA 3MP3A 1E1CB 4HHMA 3WD4A 2XH0A 3W27A 2I7GA 2WCAA 3H8AA 4MHBA 2QJHA 3H4WA 5FL1A 2C1IA 5DRIA 3GNPA 1H0IA 1RVGA 4GHRA 3WJYA 2HVOA 3WFAA 1IZCA 3ITYA 1THFD 1N8FA 1CXLA 2DZSA 1DJZA 1QCWA 2V3EA 3FS2A 1NTHA 3P60A 1N7KA 1B0IA 4J4KA 3UU0A 5AYZA 4DF1A 2EEXA 4DYEA 4K38A 4TVDA 3RM9A 4IG2B 3S6OA 4B2DA 1U1JA 3ARUA 5ENLA 4GUIA 4G1KA 1UASA 3QFEA 4D8LA 3OP2A 4HMNA 1TCDA 2E5BA 4CU8A 2B7OA 2VD9A 3TV8A 1YRRA 2CBIA 3MSYA 4LRSA 3MA8A 3S9IA 2FB3A 2YXGA 1JZ6A 3KOFA 4AXNA 5C9ZA 1SFLA 1UD6A 3W22A 2QCHA 4D2JA 4QJ5B 3QR3A 2NQHA 5BOEA 2WV8A 1Z69A 4O57A 1Q7MA 1E0TA 4ROPA 5DY3A 4Y90A 3K5XA 1MI3A 3W6YA 2RFGA 3AMGA 1EQCA 2QZRA 2WWDA 3A23A 3GXNA 3WSUA 1WXYA 1UIPA 3LV5A 1J5TA 1HGYA 4A2RA 3SR7A 1XV8A 5PTDA 3NDZA 4DJFD 4X0NA 3JZEA 3AHZA 4HB7A 3LY0A 4DLFA 4GFSA 3TNBA 5E0CA 1XKYA 4LV9A 1X97A 4PCNA 4JQAA 1TWZA 1QNRA 1G7VA 5LHEA 1XGZA 2VVNA 4UB9A 1VB9A 3FXGA 4TQTA 3UVAA 5FF7A 5HQMA 2CLOA 3EAUA 3BGJA 3A21A 9XIAA 4WDTA 5GVJA 2Z1SA 3JS3A 4EANA 3QHNA 3P6LA 7REQA 2HISA 4K8EA 3U5UA 4F3HA 3BH4A 4UZSA 2DPEA 2BDQA 4P8VA 1TJ1A 3QYSA 1DJNA 5DO8A 4LVFA 1J9YA 4QSFA 1E3ZA 3N4FA 4LUSB 4DJDD 3GG8A 2EAWA 4I7WA 5D8ZA 1PXGA 4R33A 2NV1A 1YADA 3VGHA 2GVLA 4MUZA 4AD5A 3M5VA 4Y8EA 2UY3A 5EY5A 4FXRA 2OYLA 3PJWA 2ZX6A 2EF9A 3UWWA 4JGDA 4ZB0A 2WSQA 1HL8A 1J8VA 3OZYA 3V5CA 3EKLA 3T2PA 4MY1A 5MKGB 2PB1A 2GOKA 4BF9A 6REQA 2Q8LA 2EKCA 4YVVA 4QG6A 2D0GA 2OEKA 1H7WA 2R14A 5HXMA 5DN1A 4LF1A 4BF5A 1FWGC 4PMJA 4JYDA 1WKEA 4HK6A 3WF4A 1JUKA 4JTKA 3GSMA 7A3HA 1BTCA 3GXTA 5KZ6A 1JJKA 2HVMA 2EQDA 1GTEA 1ZNNA 4ZSUA 1V6TA 3NEHA 3BCFA 1BYCA 2PEVA 3L0GA 1JEZA 4RZ6A 2NQLA 3ITTA 3G1RA 1NOWA 1D7FA 4CQ8A 2PD5A 3TW9A 3AXHA 1R8LA 1JI2A 3PZVA 1MEIA 1AQ0A 3VA8A 3MMTA 1E1FA 3W1PA 1NM9A 4Z1BA 3SCUA 3TAKA 3GYEA 3BV7A 3O9NA 2Z00A 4NNCA 4DO4A 1V6WA 2D24A 5E5CA 3UJRA 5CC5A 3WL1A 1C8VA 1OSEA 5HDRA 1YE4A 1K7EA 2OZ0A 1MUWA 1G1YA 2PDFA 1A47A 2V30A 1PVNA 3M0IA 4FR6A 1UD2A 3W7JA 3UA4A 3WLJA 1BSIA 5CJMA 1RP9A 1TPFA 3PTDA 3KWXA 1IR2A 3LM7A 4P8WA 2PODA 3FFSA 3PZTA 1SR0A 2GVJA 3W7GA 3GVVA 3UCCA 3TJ4A 2G4FA 2BSLA 3BLDA 2GQ8A 2Z1KA 4ERIA 4JTUA 3TCSA 3RO6A 1W3JA 4NI3A 3EMQA 3B8UA 2WB5A 1J0KA 1RBLA 4ZCWA 1ZP3A 2XVLA 4DVOA 4H2HA 1TTJA 1GG1A 1RAKA 4RDWA 2ZZ7A 3NG3A 1J2WA 3JW7A 4YS1A 4L80A 4WXYA 2VR4A 2RKXA 3G22A 3QR1A 4FLRA 3LN3A 2P3ZA 1XGDA 2ZBTA 4XUYA 2AMXA 3GU2A 4NZCA 1NAL1 1V0KA 2NSXA 1V03A 5GPRA 2VEGA 4BI6A 1WOAA 4W88A 3DC8A 4LY8A 1JCJA 1MEWA 2IKGA 1RSCA 3B9OA 4L64A 2IW0A 2I1OA 1KQYA 2LLEA 4HU8A 1KQZA 2R82A 1ISVA 5RUBA 3N12A 4D6FA 3MMDA 4EOUA 3TQ0A 4MOZA 4UMBA 2G97A 2CKSA 1ONEA 3FJNA 5A2CA 5GJPA 4AHPA 4O15A 3TN6A 4LUJA 1KM0A 5EGRA 3IIZA 1C3FA 1XXXA 1TUXA 4RNJA 3RN6A 3R6IA 1PSCA 4ZQRA 3O8AA 3BDKA 4IIEA 1GTHA 3VE9A 2QCFA 5DBTA 1ZGDA 3RF9A 4L6DA 1OGSA 4L9YA 2O55A 5HANA 3GUGA 4NASA 3HM7A 1VF8A 4IFKB 3SRKA 1R87A 3BL3A 4YTSA 3W26A 3TUUA 1VRXA 4B16A 2YKKA 4TMBA 3ARVA 2PLCA 4LSBA 1ELSA 2G50A 3SCSA 1K3UA 2WSKA 4YVPA 1XSJA 1A80A 5D33A 3NQMA 5LIUX 3I10A 4QAWA 1K9EA 3UWQA 2YYUA 3UR8A 2DY3A 4FNQA 3NYZA 3A22A 3UWZA 4E8GA 4CQ9A 2BOEX 4N9BA 3KXQA 2R1MA 1O1ZA 1B3ZA 1UKSA 4JQ1A 3LGDA 1FTXA 4Y9MA 3M44A 4J2MA 1FWAC 2QAFA 2Z7KA 3MV01 5CG7A 3CHFA 1R30A 2QV5A 5HMSA 3O06A 3VNZA 3GXIA 2NX9A 1VFUA 4GVGA 2VTFA 2X7WA 4R9OA 2VR5A 2PWEA 4JTLA 3LCXA 4S3EA 2CZFA 3A9BA 4NJKA 1SUXA 1OX6A 1UPPA 3MCNA 2XDFA 2C16A 4HNOA 2UV8G 1QNVA 4AEFA 5FL0A 1ZTVA 5CSSA 3ONBA 4DIAA 3WLSA 1J12A 3GW3A 3ZLHA 1V3JA 1JCLA 1J0HA 3G5EA 3UR7A 1VC4A 3NCOA 3S9YA 5E6YA 1XYMA 1GUVA 4QG8A 2CHOA 4HT3A 1GJWA 1VZWA 3LERA 4GXPA 1HP4A 1TREA 3MQTA 3RCYA 3THQA 4QAIA 3E38A 1YXYA 3S47A 1PUDA 2IPJA 3ZQ9A 4D8AA 4HYRA 3UR5A 2ACRA 4RNFA 3P8JA 1EP1A 2HS6A 4NUWA 1EH9A 3NZRA 4A3YA 3AXMA 4U5KA 2YFOA 2NX1A 3LCIA 1WP6A 3NQ8A 1F76A 1XD1A 3P62A 3VAVA 3DYMA 2P53A 3KX6A 7XIMA 2XZ7A 3PN8A 2XIJA 4LALA 2ZZ3A 5CPTA 1TVPA 1KR0A 3S2MA 1BXBA 3QF0A 3IEBA 2WLYA 2GJXB 4ATDA 5XINA 3AI0A 4UFKA 2E40A 3RMEA 3PZOA 3ZO9A 2A6LA 4PUMA 5AKQA 3E1F1 5BOFA 4BWLA 1BLIA 1YIXA 4BKNA 4CNSA 3MUCA 3UNTA 4M7TA 3ARRA 2PZ0A 4ADTA 3W82A 2P0IA 3GXPA 3H2MA 3GWQA 4QROA 4GGBA 1A5OC 3TXZA 4KFNA 3G1DA 2BOFX 4DAIA 3PAOA 1RR2A 3TZNA 1V02A 3VM5A 3MBDA 1NWSA 3T0AA 4CLMA 4F0KA 1NP0A 1WDQA 2BTMA 4M0XA 4FEZA 2GZXA 4CVWA 1JZ3A 4HHPA 3VC5A 2E1DA 3GNDA 1DWGM 4MKNA 3P8IA 3KZPA 2FLIA 3LENA 5TQLA 2A4AA 4KH2A 4X61A 3THDA 4WIWA 4KWWA 3PPCA 3TCEA 4LCQA 1PIGA 3JUGA 4RE3A 3NQBA 1XPYA 4QTGA 1JCTA 3A3XA 3G1FA 5JH2A 1L6FA 3TJLA 4OJYA 3BARA 2GWNA 1V3HA 2XVGA 3P93A 2D1ZA 2BLEA 4PCTA 3L4WA 2Z1BA 1IZJA 4I5RA 1UWUA 3BOLA 1ZUAX 4CUCA 3CEPA 4J35A 5TF0A 3ARSA 5J04A 3C86A 4KFOA 1WXZA 3QY8A 3MWCA 4GG9A 1JZ8A 1J93A 4KEUA 3VMNA 4R85A 4EIVA 2OWCA 2ISFA 1VYRA 3SJ3A 4QDPA 1XFBA 1XIHA 3QQ1A 5A6BA 1X98A 4MZ1A 4S3GA 2J6XA 3CYVA 1QWKA 3TXVA 1B5TA 3WNOA 5IFPA 2HXUA 2VEMA 5F4XA 4OU1A 3T0TA 1S3TC 4O4VA 1W1VA 4MWAE 2OEMA 2G3FA 3M0LA 3L2MA 1BEUA 3WQDA 2TSYA 1KFCA 4UWMA 3STGA 4QE4A 3B9AA 4HNUA 2I5QA 4NZ5A 2TYSA 1LZOA 2CZVA 3DYPA 1WDDA 2G3IA 3REQB 1FWRA 1H7NA 1PX8A 2BGSA 1EP3A 5JIWA 5JBDA 3NO3A 3M0VA 1ESWA 1XG4A 3PNUA 4O1CA 1H61A 3R1ZA 3S2NA 1QNOA 4LAZA 4JTIA 4C6EA 1EZ2A 3H26A 3MV11 5F7UA 2PGFA 1WZMA 2PPGA 1XLCA 4JIEA 4NT0A 3G1HA 3GFYA 1E71M 3PULA 3LQGA 4W8BA 2NUWA 2DIEA 4EF9A 3MWAA 4HYWA 2PE4A 3D47A 1SW7A 5K9DA 4FLSA 2WANA 3OBKA 1G6CA 4MB3A 4D1IA 3VM7A 4YHGA 1TKKA 3QQ0A 5TIMA 1HT6A 1RY8A 1Q4WA 5C54A 5FESA 1AW1A 3GVRA 3ARQA 3RRAA 4IXXA 3AIEA 3GHSA 1XIMA 3OGVA 3UWEA 3CWNA 1NOUA 2C18A 2IXVA 2H3BA 4EX4A 1PBGA 3IGUA 4IP4A 1VBGA 4H8UA 3DAQA 3H7UA 4XZBA 4NZ4A 4ZEPA 3CB8A 4GH3A 1S5TA 3TJXA 2VOMA 2DSUA 3E0WA 3AJ7A 4IQJA 4F48A 1BGAA 2DZTA 3CAWA 5H2ZA 2PDHA 4LYQA 4BEQA 4TIMA 1HIZA 5A94A 1Q2RA 5DMLA 3W76A 3OGRA 2ZOXA 4AC1X 4CNPA 3QMTA 4DJED 1E70M 3QSTA 2E1WA 3BGAA 3WD3A 1WOBA 1POJA 2QV4A 2J7HA 3BGGA 5AZ0A 1GOOA 3ENLA 2O9OA 3SUTA 2H8ZA 5TD4A 3EEZA 2VEKA 1OX4B 1EC9A 3TOYA 5A95A 1E9IA 2XGZA 1JNDA 3N9RA 3G2GA 3SGZA 1LLZA 4IGSA 2VC7A 1HO4A 5HNNA 1SZFA 2YL8A 2I5GA 3GG1A 1FCVA 3ATZA 2Z28A 3S6TA 4KF1A 1LL7A 2O9PA 1HKKA 2F38A 2ONEA 4QJ4B 1VLWA 1LBFA 1JRBA 2H8XA 4NILA 2WCSA 2ZZ4A 4C6CA 4L6HA 1WDPA 3PBWA 4Z2KA 1YPXA 4R9XA 4LF2A 5CZTA 3KOZA 4XISA 2YW3A 3SN1A 2AAMA 2Y7GA 1G0CA 4DF2A 1R86A 4Y9AA 5KZEA 3GM8A 1KFBA 3ME3A 1KKOA 2J7DA 4YHEA 1YHTA 1GQNA 4V27A 3BAIA 3BW4A 3N9SA 1HF6A 3KS6A 2Y8UA 2XYLA 3PPHA 3WEZA 1QW9A 3S1UA 5TAOA 3SCNA 5K4ZA 1F6PA 4GYFA 2YBUA 1FHDA 1Y5VA 4O0KA 4S3DA 3WQPA 1EEXA 4GBUA 2CNCA 1IV8A 1RD5A 4Q8NA 4AY1A 3BLLA 2D23A 3POCA 1ISXA 4GI9A 2PS2A 4NYYA 1RQEA 4W5ZA 1W0MA 1Q3NA 3H2EA 1R3SA 4F0MA 5JU6A 1VJSA 1W3HA 1ME9A 2R24A 4IJBA 1SO3A 4HOWA 4J3UA 2W91A 3NURA 1W9PA 3KAOA 1BFNA 1HVQA 1BYAA 2GGIA 3L5AA 2OZTA 3PZNA 5K4XA 3B8VA 2IXUA 3F4DA 3FV9A 4UR8A 4AZ6A 2QDHA 2DJLA 2EPKX 3M07A 1E40A 2OR2A 1IR1A 4FR1A 3AS2A 3V16A 1H49A 1CT5A 1KWKA 5LNSA 2E25A 2WNNA 3MYPA 4L6OA 1NELA 5LGZA 4BQ3A 1M68A 3AS0A 3REQA 3L7RA 4XD6A 3TKFA 2GUYA 2C7FA 2QKFA 1I0DA 5LXEA 5AYBA 3FKRA 4TXEA 2DZVA 2C0AA 2G37A 4UMCA 3VOHA 1FXQA 2Z2BA 1UKPA 1QFEA 4PR4A 1KRAC 1DJIA 4XZHA 2DUXA 3NXLA 2JK2A 3QGKC 3AROA 4JY8A 1RUSA 3P3BA 1NDVA 3EGJA 1QPOA 1XIJA 3WMLA 3O05A 4I9MA 4MVAA 1HL2A 1O94A 2PAJA 4RR4A 4FXFA 2Y2WA 4JKMA 1VR6A 4RW5A 1EWDA 3AWNA 2XUCA 4WDUA 3D5HA 4YCPA 1WKYA 4GYJA 1Q6RA 4WY0F 3K1GA 1K8ZA 1REQB 1XLAA 1L6SA 3QR0A 4I7VA 2FTYA 2QLYA 2PLJA 3KBSA 4X2PA 4LQ1A 4DXXA 3C2VA 4K3ZA 1MQPA 3GR4A 2UBPC 4EACA 1YPIA 1VFOA 3TP4A 4DZ5A 4Q8VA 2W9MA 4KW2A 3MVIA 3VFLA 2POTA 3VGFA 1XRFA 4A35A 3BSMA 1AZ2A 1G67A 2ZUUA 3TIMA 4AXKA 4US5D 1V6UA 4RPPA 4NAEB 1S5WA 4QHRA 5F4SA 1IF2A 3RG6A 2ANUA 1QI5A 3LTYA 3ATYA 1O5KA 2ZUMA 3NGJA 3CASA 1EC8A 3GK0A 3N2TA 4M5PA 2EXOA 3WH6A 1K6AA 3ZT7A 4HK5A 4LH8A 2OGJA 4L65A 2GJRA 3W74A 2C1GA 4WKHA 3MSDA 8CGTA 1F74A 3UJEA 1QTWA 2BY2A 1EGZA 5HBFA 4IG2A 4XG1A 6TAAA 3NM3A 4A3QA 3S2CA 3MKVA 3S5ZA 3V18A 1QNSA 4I6VA 4JXCA 2BBFA 4AIUA 1ITQA 1JCNA 1PPIA 1FUYA 1BF6A 1J0YA 2ACSA 3BG5A 4MPKA 1WV2A 4DWSB 1X1ZA 3WJSA 4WY0A 3S46A 2GJXA 4HJWA 5BRPA 1M7OA 1KV5A 4D8ZA 1OINA 4U5IA 3ANUA 4GA8A 1K8YA 2ZX5A 4HA1A 4QLKA 3CQ0A 2HPIA 3I7QA 4MYXA 3IIXA 2Q02A 4S3AA 4C7GA 1L0PA 1P4CA 2A6NA 1OK6A 3UERA 2H9AA 4IP5A 3EDKA 2VRQA 2BB0A 4RDYA 2VGIA 1E0WA 1QPKA 3VILA 3WJWA 4I8DA 4HJFA 2XSAA 3DC0A 2VFGA 3THCA 1LCOA 1JPDX 2YCIX 1EHAA 4W89A 4TVCA 2VRJA 1P43A 4A8NA 3T81A 4CNNA 3PJUA 3K8KA 5DT5A 1F4HA 1AODA 1F2JA 3QPZA 4JNYA 3RLUA 3ZSSA 4B90A 1OFPA 3BE7A 1I1WA 1P0BA 1QT1A 4BA0A 1HXJA 3PK7A 2FZNA 4JTGA 5FJUA 4GABA 1B9BA 3XINA 1HJUA 2VDHA 3VD5A 4CVUA 4GIYA 3WQGA 4S23A 5LGXA 3N6HA 3PBYA 4FNSA 3F4VA 5I3IA 4IPIA 1I60A 2E28A 1O6IA 1UWSA 1SFSA 1UWAA 3VGEA 1RK5A 4LBRA 3H53A 1FWNA 4AD3A 1JCYA 7PTDA 3UZZA 3GU1A 3GBEA 1SZNA 2OU4A 2HNHA 3I7SA 2DZWA 2D69A 1HKWA 3WLRA 5KMYA 3K2GA 3LBOA 1LUCA 4UNKA 2NVCA 1O68A 1UPMB 1A5CA 1EWEA 3COTA 3N73A 1R2SA 4W4QA 3NDYA 4LUIA 1OF8A 1M04A 4M56A 2QPUA 3FYPA 3S1WA 3V75A 2XIOA 2WVTA 4PTMA 1QASA 1Q8JA 1VLIA 3BUVA 4C6DA 4HU4A 4J9JA 1KBBA 2CCRA 1FH9A 3NQGA 3STEA 3UXAA 4LBUA 1HKVA 4GJIA 4QFUA 3DFPA 3DI0A 2DDXA 1JDCA 1D8WA 5I06A 2YA0A 4OUEA 1XUUA 4EXBA 3IIOA 1TWWA 2CIPA 2X09A 3WLLA 4DPQA 3FA4A 1IGWA 1XWYA 5G2IA 2DT1A 4X22A 4EPEC 2HDJA 4AAJA 3WLNA 4IQDA 5MF5A 3LQLA 3QV7A 2WSPA 3VZXA 1B57A 2YR1A 3QHMA 4E0CA 4CD4A 3CIVA 3B0YA 1AW5A 3F7JA 4OECA 5D2YA 3QY7A 3G24A 1ICPA 3VNIA 3HPXA 3WJZA 2A7RA 3SY1A 2WVSA 3W7KA 5L9FA 3VNKA 3S2JA 4O10A 1TZZA 3MCOA 5LIKX 4US6A 1N8WA 3MUY1 3WLOA 5LKYA 3SO7A 2HPMA 4XAYA 5CSYA 2F2HA 2RAGA 1OQFA 1GQIA 1R9YA 2XSBA 4JYEA 3U3HA 2BZNA 2W92A 3L2IA 4W84A 1B9ZA 1OT2A 3APYA 3UZXA 1EJ7L 1O5XA 3P84A 3VC6A 2OKTA 1RALA 3MMUA 4KEZA 4MFDA 2OWWA 3EDJA 1PKYA 1TZ7A 3CM4A 4O1BA 2GGEA 3TMLA 2AL2B 3P82A 2WMGA 1US0A 1GNXA 4QG9A 5C8BB 3WJXA 3DFQA 3MYOA 1AH3A 2D22A 3LV6A 5AC7A 2FGBA 4QDWA 5AC8A 3GNNA 4DBDA 4FSAA 2WVUA 2EG6A 2Z2UA 1G4TA 2OXNA 1JFXA 3SURA 4LAUA 4FMVA 1JQVA 2X2GA 5D2XA 2CBUA 1X6UA 2RH9A 4UR9A 2W6RA 3HFTA 2GVEA 4ZBCA 1LT7A 3MUIA 3W7MA 3EMCA 4LB4A 3G3DA 4HTYA 4RKAA 2WQPA 1UIOA 2X1RA 3TWBA 3PTQA 2ZVRA 4UTJA 4S2BA 3SCTA 3L68A 1ISZA 5LZLA 5KSWA 2CHNA 4PMYA 5J5DA 4UCFA 1GOIA 3GXFA 3QTGA 3MTWA 1V51A 2PTDA 6XIMA 4ZQPA 1J0IA 3VD9A 2OO0A 3C8FA 4PODA 4CCCA 5HUPA 5DMYA 3TNOA 2QCDB 1T40A 4KEVA 1O5QA 3EA1A 3TVAA 4H9VA 1XG3A 3CH0A 3HQ1A 2VCCA 3HBLA 3KCOA 3W07A 4MADA 1W2PA 1PB0A 4GCAA 3KCJA 4FOUA 3CTLA 3PANA 3M6YA 2V5LA 4IJRA 3GAYA 2OOGA 3FY1A 3R10A 4NKCA 1EIXA 1OFDA 3QKEA 1PZ1A 2ZWYA 5EMLA 1OYAA 1RBOB 2OX1A 5C2CA 4Z2JA 2PP3A 3W6MA 1RK6A 3OYXA 1UBPC 4M6UA 3B0VC 4KETA 4JIQA 1XLJA 3DDMA 3HG5A 5GJMA 5KZMA 3E2RA 4LCSA 4JQ3A 4N4PA 3IRSA 1MWOA 3MHFA 1H1ZA 4DJFA 2V6AA 3H54A 3TEVA 2ZYFA 3QMRA 4MYAA 4C1NA 3KCLA 3HMCA 1CX9A 2VEPA 4QGCA 4WJEA 2HWGA 3G6LA 1GORA 5HULA 1LL4A 2NQ9A 1UZDA 1PYFA 4J2PA 4L56A 1RJPA 5M3WA 4CD5A 1R6WA 4O1DA 3PWIA 4DUXA 3E12A 3CLMA 5DMNA 2EBNA 3KVJA 3TTQA 1J01A 2QQ6A 3IWPA 3CWHA 3BLEA 1QBAA 2BY3A 3UNDA 3AZRA 3G77A 2XFRA 4PUNA 2Y7DA 1XR2A 1DKWA 2DZPA 4PB4A 1GZ1A 4Q7NA 1P6CA 3PSWA 3WDRA 1TYGA 5ABGA 3IGHX 1PTAA 3C6CA 4LEFA 1BSLA 4DO5A 3C2OA 2ZZ2A 1W1ZA 5CSUA 3SCOA 4J1OA 4UCGA 2WYSA 4ZXLA 1TELA 4H00A 3I4KA 4YMZA 5HWJA 4I8YA 3WBXA 2D73A 4PRRA 4BFAA 1AZ1A 3G0SA 2WPBA 3W01A 1HN1A 1ZU8A 4JCLA 3GDKA 4X9SA 2NLIA 2AMGA 8XIAA 2C8NA 1WZAA 1UC4A 2YZ5A 8A3HA 3OLDA 3TR2A 1FX6A 1YDNA 3G8EA 3M5XA 3AOFA 3TSMA 4HNTA 4P7QA 4URIA 2E7FA 5C0QA 3UYCA 3R43A 1ONWA 3DHDA 3E0VA 3S5OA 4MDOA 2X40A 2Y24A 3LCFA 3QSRA 1V02E 1IHIA 4GC3A 3UESA 1NARA 1GGOA 1UROA 5FSDC 3CHEA 3BJSA 5A6KA 2WVVA 2YDSA 5K2ZA 4GQQA 3LDVA 5BW6A 1ZBWA 3NTYA 5AC4A 3QKZA 1CGTA 3ORWA 4B15A 2J7EA 3AZSA 4HN8A 2R1LA 2DW7A 3MDUA 3P7YA 3EWZA 5H8MA 1Z32X 3CUFA 3Q4DA 4O13A 4RNHA 5J5RA 4HPHA 5E70A 3NQFA 1FWWA 3LUTA 4RZ4A 2DJXA 1W91A 3SIZA 4C1KA 3TW7A 3BSHA 4JYFA 3OW1A 4W9TA 4B5TA 1X1NA 2GQ3A 2POZA 3DIPA 4TX6A 4WDXA 3OA5A 2DZBA 3N15A 3EA3A 3T44A 1DV7A 2HJPA 1Z3NA 1T5AA 2QMJA 4WCJA 2WPGA 3WQ4A 3ZOAA 4JICA 3RK8A 4QSHA 1GVOA 3C56A 1V79A 2QHAA 3LOTA 1YDYA 2DEPA 4A8RA 3EWCA 2QCNA 4JTAA 4DBSA 3G0UA 4L1GA 1IEXA 3UETA 5FJRA 1ITCA 1UH3A 1K7XA 3NL6A 1GG0A 2F9RA 3G8RA 3PFMA 3BOFA 3W25A 3WX7A 5MKGA 2BXVA 2VGGA 4XKYB 4ZGYA 5DEZA 4UQ9A 4QX4A 1JVNA 2BGQA 1AJZA 3DKLA 3W83A 1GKPA 5FOOA 4XQ6A 2ZXBA 3VNMA 3DN5A 2NZLA 3L5LA 4H9XA 1X8FA 3KBNA 4NHVA 2X0SA 4CEXC 3I6RA 2V63A 4PA8A 4H6QA 1E4LA 1SO5A 3T7VA 4DUVA 4HGXA 1KCKA 1F5ZA 1U30A 4ZO7A 3W7EA 3CXOA 1XLGA 2NXHA 3DU0A 4QCFA 1V08A 2J66A 1JUEA 3RIKA 4I9TA 3BCJA 2SFPA 1O1HA 4O28A 4YPJA 1S5NA 4MUPA 1OIFA 4B3LA 2PC4A 3HTWA 3LHVA 2CBJA 4HCHA 2JALA 1YPFA 1A3WA 1IIGA 3CL8A 3UGRA 3VINA 1SVDA 3IGXA 4OQVA 2WC4A 4JTHA 1A5KC 3B4YA 3VVGA 1GQKA 4IL0A 2H90A 3QM3A 3RXZA 3CTTA 3E0FA 2E8YA 3SZ8A 4F0RA 2J62A 4UNLA 1L2UA 2BVDA 1UG6A 5E0KA 1XF0A 4BS0A 5C6MA 4WLCA 4N0RA 4W93A 1FY6A 1W9VA 1TVNA 3B8SA 3W1QA 3WF1A 1LOSA 4K68A 1FWJC 2FGLA 1FDJA 4GD0A 1OM0A 1A49A 2TAAA 4JKKA 2OYMA 2PC8A 3N19B 4BQ2A 3B8WA 4MNJA 1W1YA 3LHYA 1ZBKA 3NQ6A 1GJPA 5LNRA 3N1AA 4ICCX 2QUMA 2WKJA 2J88A 1AQHA 1ZPTA 4PEKA 1PKLA 1UW9A 1V7AA 2F6XA 1B4KA 1JZ5A 2X0YA 3H2NA 1DWAM 2RDTA 3A12A 3U2EA 4DQWA 2X0HA 4FOJA 4AY7A 3EX1A 4H83A 3AHXA 4GVHA 3ITLA 1LWJA 4MWAB 4CCDA 4Z1YA 1BVNP 2NQJA 4Y9OA 4I90A 3MBFA 4PB5A 4E38A 3CQKA 4KPLA 4R5EA 1QOPA 1RPXA 2Y89A 1P0EA 4O1EA 4WK9A 3CHDA 2QPSA 4D6JA 1KBKA 2EPOA 2IKJA 3EX2A 4JN8A 4HPGA 3F2BA 1RXOB 3M0XA 1JD7A 2VWSA 3ALFA 1QI3A 4G2DA 1YNYA 4JEJA 2HZGA 1ZLPA 3A24A 4AVFA 4FPSA 2BS9A 3A4AA 4MJZA 4EF8A 2BVWA 1TPVA 4Q4QA 3WDIA 2CYGA 4KRTA 3U48A 4QS6A 4Q33A 4W85A 4WOQA 1RY0A 3WQCA 5HJLA 2NUXA 5REQB 3MJMA 2DUZA 4ZB2A 2VI0A 3F4WA 2XGIA 4OHQA 4JNZA 3PBMA 4HHLA 1VHNA 4AFYA 1XIEA 1R3RA 1VYSX 3W1LA 2D0HA 3LCHA 2XN2A 4A3HA 1R3VA 2VC9A 3L2LA 1GZGA 1Q6GA 3S3GA 4PFHA 3GRIA 1EBGA 4EXQA 2VFDA 3DHUA 3IPWA 5AVNA 1AVAA 2O9TA 2ATSA 4B9YA 1W17A 2QCLA 4WR3A 3OIHA 2Y85A 1KGXA 4M6VA 4CNUA 1VIZA 2PLMA 4Q4SA 1EDGA 1XDLA 4HPXA 4IICA 1XIFA 2IQTA 4ZR8A 4WX2A 4GIEA 1TV2A 4HBKA 3H23A 5C9XA 1B3WA 3EWUA 3UZWA 4UFLA 1FHUA 4YTTA 1BWKA 1HKIA 3WO8A 2QCEA 3O16A 3GU9A 1UMYA 3PS7A 3FX4A 2REQA 1LBLA 4RW3A 1FCUA 3D0CA 4N6FA 2ZUNA 3KL0A 5EYWA 3N6JA 1FH8A 2FZDA 2GSHA 3FHQA 3WLPA 1AJ0A 1CLKA 1XQKA 4FOKA 5BROA 3AQUA 2IUZA 1I2QA 3GZAA 3P61A 1R0MA 2Y63A 1OJXA 5DLCA 1QNQA 3ZJ8A 4ACZA 3I4EA 2EPLX 1UA3A 1J10A 1TV4A 1UR1A 1XIIA 4WRHA 4A21A 4J3XA 3BTNA 3GFXA 4GJJA 1BRLB 2FZ9A 1TJ0A 5HATA 1I2OA 2ZIDA 1XM3A 5F2LA 2OODA 4Z2IA 3IRDA 3PZMA 3N29A 2C0HA 2YDRA 2BMBA 2C15A 3F5LA 4FXSA 4IJCA 4H7CA 4D6EA 1VD6A 5I09A 2AL2A 4N2YA 1WYIA 4B5WA 3EDEA 4WSKA 1CB2A 2PD9A 4B2DD 4L4PA 3HV9A 3CZKA 1GKRA 4JDBA 3QH2A 3W7CA 1NQKA 3LZ3A 3FAWA 2NT1A 3NAVA 3VZZA 5D09A 3TE9A 2A7NA 3QW4B 4ZL1A 3VIFA 3H7RA 1AMKA 3AHYA 3VYLA 3CV6A 1XJBA 3KOWA 2ASHA 4DELA 1GW1A 4P61A 2E5CA 1CLXA 1UKQA 3SCQA 3OG2A 3QC3A 1EUNA 2YXOA 3CUHA 2IPGA 1OFOA 2WJZA 4GISA 2DVTA 5C2GA 2VFHA 4J27A 3T08A 3V5FA 5AHFA 3ZVHA 4LJ3A 3RNDA 3KVMA 2ACQA 3MDWA 3QFWA 2O4MA 1EJUC 1Z48A 1X6NA 1LWHA 1TR9A 3EB3A 3GC2A 3W37A 4G9PA 4H6EA 4QNWA 2Q09A 9RUBA 7CGTA 1J0JA 5BXTA 4JX4A 5EMKA 4GIAA 5HPCA 4CNOA 4UUIA 2I9UA 3EX4A 4UZUA 1S2VA 4U28A 2HVNA 3LCLA 1VGAA 3MUXA 1ZL1A 4FIQA 2QGYA 4PL2A 4CQDA 4YTQA 3W1TA 2VFFA 1OIMA 1ECQA 1W5MA 4FS9A 1DTUA 2G95A 4BCEA 3RITA 3SY5A 5LNWA 3H21A 4CEUC 3C5QA 1SO6A 1HL9A 1ADOA 3RJXA 2ZXAA 3RHGA 4QLJA 4XBJA 3TDFA 1OFQA 1VCFA 2WBGA 3FJLA 5LNVA 3M5YA 2Y5EA 3LGEA 2JKEA 4TMCA 3R8RA 1CYGA 5KITA 1VPXA 4GXWA 2BXYA 2ZE0A 5A8OA 1WUEA 2GK1B 4C6BA 1WNOA 3UPWA 2BOGX 1MW2A 3TK7A 1XRSA 1W1B1 3W7LA 4AWEA 3FXYA 1WX0A 3DFYA 3W2JA 5K9CA 3EB4A 3FOKA 1FBAA 4M81A 3SAZA 4HTBA 2V3GA 1XD0A 2WMJA 4M8UA 4JN7A 3NQVA 3TJIA 4D9PA 1KO0A 1T8QA 1N8IA 4XTDA 3ITCA 1UP0A 1UMLA 2VKZG 1XLFA 5CGTA 2QEZA 4ZOBA 4S3KA 2YJQA 3KHDA 3NSXA 3RGTA 3S1VA 5HAOA 3SBFA 3FK4A 1B30A 4DWDA 1DQUA 4MNLA 1UWTA 4RJEA 4WF7A 3M1ZA 3GUWA 4UTFA 1KM6A 1OX5A 1RBAA 4L9ZA 3DZ1A 1PX3A 4HA3A 2OGYA 4NAFB 1PCKA 2ZC8A 3A47A 1MEHA 2FVKA 2EJAA 3L9CA 3ZVHB 4KIEA 4Q4PA 1P0KA 5LA2A 3R79A 1L2QA 4ZA0A 4P8XA 3RPMA 5D9MA 5FJOA 1RP8A 5D38A 4K6AA 2C13A 5BCAA 3U0HA 1FWTA 2A3EA 4UTWA 4AHQA 2KZHA 1CENA 4A4AA 1KGUA 3ITGA 5K9XA 3B8IA 1IQ8A 3UJFA 4DO7A 1C9DA 4JTFA 1Q6EA 1OCQA 2HSAA 3VMPA 1ZSXA 4AISA 4QCEA 2X42A 2ISVA 4RZBA 3TR9A 1EGMA 1DE5A 4Z2LA 1JDFA 2OZ8A 4D72A 4HCDA 1XRTA 4Y96A 2VM8A 3G6MA 5FF0A 5HR6A 1PCWA 3WIJA 2PP1A 3LZ5A 3S1GA 3VABA 3IIPA 2OFJA 5D4YA 2FIQA 3DFTA 2V3DA 1VBJA 4Z0SA 1Q6OA 1PHWA 1I2PA 1A0EA 2FHCA 1CB7B 1KM5A 2QR6A 3VMOA 2VZTA 1EOKA 2OO6A 4LAOA 2ZUSA 2HROA 4U3AA 2V2CA 3H4XA 4GINA 3WBAA 4DI9A 1TJPA 2ON3A 4H6KA 1XYBA 5D2WA 1W5OA 5KEZA 2QCGA 3F03K 1TFVA 3IVSA 4Q7BA 3R8GA 1A0CA 5H1WA 1RH9A 1G4PA 1I4NA 4B3KA 1MVYA 3WQFA 3BMWA 3N18A 1K4HA 3M7WA 2ZC1A 5A6MA 2CWNA 3WNLA 1IXQA 4NJIA 2Z0IA 3MI2A 1VEOA 2XN1A 3N3MA 3WK3A 3FEQA 3URNA 1XFCA 3T8LA 3UWVA 4XD3A 2OT0A 4QQUA 1E6XM 2ZXDA 1KM4A 4LRTA 3WLTA 1UP3A 1AUSL 3GXMA 3RPDA 3STPA 1W8GA 2INEA 3RUBL 5DX7A 2CFFA 1SSGA 2ISWA 1KTNA 1QOXA 1FRBA 2W63A 1YE6A 3UXDA 4GYKA 2OX4A 1OF6A 4AZIA 3KL5A 4XWUA 3W71A 3MS8A 1C93A 3WD1A 2Z7GA 2GQ9A 1FCBA 4BK9A 4YCOA 5A8QA 1DL3A 1QPQA 2PDGA 3EEGA 4REQA 4HSNA 4DWSC 1UD8A 4WEVX 1WA3A 1KV8A 4Z42C 2YDQA 4FP1A 4H9MA 2JFEX 2QJIA 4ZO6A 1L6YA 2Y61A 2C3ZA 5G1TA 3FW6A 3L65A 4KS0A 4MNKA 2JEQA 4PUEA 4PUJA 2Y5SA 1C7SA 1XKJA 5T9BG 1PKNA 3NWRA 4U33A 4KWUA 5LYRA 1H62A 3VZYA 4IMAA 4JTJA 2Q3OA 2YX0A 3T40A 1O95A 1RHCA 4F2UA 3I3DA 1E6QM 1MUMA 3AUOA 3SECA 5GNYA 3CNYA 1SW3A 1BWVA 1N82A 1T7LA 3AMLA 4H01A 1GEHA 2P8CA 4F9DA 2X1SA 2J25A 2VZSA 1KWGA 1SFTA 2X41A 4RXFA 2OLSA 4DY1A 1GOKA 3URBA 4HZ6A 2YPIA 4O50A 3W2MA 3TQKA 4WOZA 1YKWA 4K7YA 4UQAA 4DJFC 3WUFA 4EPKA 1OG6A 3QGAC 3W1AA 6XIAA 2O92A 4DPPA 3NA8A 1E4NA 2V68A 1AFSA 3ZSTA 4LVAA 2FTWA 5HMEA 2BHZA 3AIQA 1QATA 3CV7A 4H2CA 4JIHA 1VIWA 3N2XA 4XX6A 1F3TA 5I78A 4GUFA 2EG8A 1OABA 4AIOA 2BX7A 3QLLA 3FCPA 4MLJA 1JD9A 5BWAA 4JHMA 5CZ0A 3WYZA 5AN7A 1CDGA 1QI4A 4OBTA 4AVNA 1GQLA 2WMIA 3W3OA 2ZE3A 2P8BA 1TJRA 4OIFA 3DOPA 4RE0A 1FWSA 1QHZA 3NZGA 1XC4A 4DJDC 1Q7ZA 1R3WA 1FOBA 3UG3A 1TE1A 3SCWA 3R13A 3KBJA 2F2KA 1UC5A 1DOSA 4UQCA 3CJPA 2QUTA 3VIPA 4IMDA 4WHBA 1P48A 1HJVA 1AQMA 4GIRA 3L12A 3L4TA 5C9UA 4GX9A 3F4CA 4N02A 3W85A 4O17A 1GVFA 2Z1WA 1TV3A 5C70A 4XD5A 4ZVJA 4G8TA 2PLKA 4EP8C 3QJAA 1B4EA 3HFYA 2BY0A 1R85A 3LM3A 1DBTA 4MTVA 1QHPA 3WH9A 2ZDRA 4ADSA 4TVUA 4W86A 4JTQA 4Q4KA 1XUZA 3WENA 3IV8A 3VDCA 4JQ2A 3SADA 4Z1AA 4D1JA 1TSIA 1R46A 3VUSA 4PSRA 1JPKA 3UJ2A 4IM4A 4WXZA 5JMUA 3SI9A 3SIMA 2J13A 4IXHA 3A9IA 5G5IA 2CLKA 2R94A 4CN6A 4ZB5A 1UD4A 2R6OA 4GZJA 3B3DA 3M0MA 4JFVA 2I5IA 4H19A 3CYJA 1BYDA 6CGTA 3EYPA 4L1XA 1H0GA 3SCVA 5A2BA 1BXCA 2CBVA 3WH7A 3ABOA 1LG1A 1W1IE 4M80A 5E93A 4DJEA 3SW6A 1JF5A 1LRNA 2YCJA 4DWSD 2F7FA 1PIFA 3HF3A 4IISA 3N25A 4PCFA 3M0ZA 1DWIM 1U1UA 3GVWA 1HP5A 3ALGA 4PTXA 2O9RA 4PCSA 4YYCA 4K8GA 2DP3A 3CHVA 1K77A 1F3EA 1MMFA 2DSZA 4IUGA 4Y8FA 2J27A 2RGLA 3UY7A 3GE7A 4K36A 4F2TA 1CGXA 1XHGA 5M1TA 2WQDA 4JNMA 1LYXA 1TUFA 1VCGA 1MUCA 2YDAA 1IXNA 4F0SA 2HRWA 3EB2A 4GI8A 1JPHA 4WKAA 1M7XA 1RLCL 1MO0A 4WY0B 3PPFA 1LWIA 1UOKA 5D05A 5EFFA 2NQZA 4PRWA 4RDZA 2XVNA 3FA3A 3EWXA 1IIHA 3A13A 1MQQA 1UH2A 3ES7A 4QITA 4CNTA 1QWGA 1OY0A 2NXGA 5CSRA 4O12A 1TX2A 4U3CA 2E0PA 5I03A 2V82A 4XZMX 3M5ZA 2E9BA 2W3ZA 3QRHA 2PRMA 5CKSA 4DJDA 3WQ5A 1EB3A 2OQLA 2Y8VA 5H91A 2CW6A 1ZY9A 4CQAA 3MT1A 4C6MA 5FI8A 3WMSA 3STCA 4AU0A 1WB0A 3T0DA 3MC5A 1EYEA 1H4PA 4D6HA 5CZKA 2WKLA 3BAWA 4S3CA 1S2UA 3R94A 2AQOA 2O4QA 1MW0A 3OZPA 1QO2A 2BASA 4AUBA 4C6QA 3SSJA 3ZR5A 4NRRA 4PBEA 4JFTA 2OKOA 1EXBA 3W73A 1PIIA 3K4AA 3OLGA 1QK0A 4QEHA 4HZMA 4ZENA 3BJTA 4KFPA 3MMWA 3GB6A 4DXKA 2HTMA 1GOMA 3SN0A 3D3AA 2I56A 3C3NA 1RVKA 4HSOA 3TMQA 4LAMA 5EKYA 3LTSA 4LWWA 2I9EA 1PDYA 3LRMA 3IK2A 3ZXWA 1WXJA 3BANA 2VL4A 1I9CB 4KRUA 3KTSA 3H12A 3GDTA 2WZHA 5I23A 3DFNA 1JDDA 4FZIA 1VJZA 4JR5A 4DBUA 1GVQA 3S5NA 3LLDA 1S3HA 1TB3A 4MB4A 4L1WA 5I0DA 2PP0A 4JFWA 3PJTA 3SN4A 2E6YA 5U4NA 3UPBA 2DQXA 4IMGA 3A4WA 4EWND 1W9XA 2D0FA 3VIJA 3SFWA 4V28A 2CZEA 2FH6A 2J47A 4B4HA 3M0HA 4HA4A 1H60A 4N4QA 2KX9A 2P10A 3BV4A 5CC3A 3PNZA 2NVDA 3VIHA 3MPGA 1Q7QA 1IXPA 3OVRA 3U8GA 3FSTA 4F9JA 2PTWA 3UW6A 4F8XA 1O12A 4AZ7A 5CBBA 1HTIA 3ZS4A 5ABEA 1TRIA 4RPQA 3T8QA 1DQWA 1SR9A 1F4AA 1U22A 2PWGA 5AC5A 2ZQ0A 4GRSA 5G4EA 1Q63A 3BCDA 4ROQA 1BRLA 1GEQA 3OPSA 3AO0A 1JAEA 1EJVC 3N11A 1IEIA 3ZWTA 2VDIA 4UQEA 5IHRA 3V3WA 1SJDA 3G3MA 4W8AA 3WF3A 3QW3A 3MY9A 4Q4RA 4PMZA 2YLLA 1KGWA 1XS2A 4JBRA 1X6LA 4IIGA 1YXDA 5LNUA 2WVVB 4X2RA 3TQPA 1S46A 4UFMA 3B97A 5CC7A 4ZSTA 3D6NA 3UZ5A 4AY8A 2ZVIA 3LRLA 4XAGA 3T78A 4MAZA 1KFJA 1JXJA 3TSDA 1DWJM 4E2DA 2DZXA 2ZA3A 5KETA 3V0UA 2V2DA 5IXEA 4D6DA 3CWOX 4RZ5A 3E6EA 1QVBA 3GDMA 4H7VA 2I17A 4PRTA 3D46A 3M6DA 5C5YA 3R7MA 1AQFA 5EA9A 2WCGA 4O53A 2V5CA 4FALA 4DBEA 1CECA 2Z27A 1UZ4A 3LHWA 3ABRA 1V6XA 4RV8A 2Y88A 3DG6A 3VOFA 1SYTA 4IX0A 3M9YA 4H8NA 4HNCA 1DE6A 3T1GA 2XSXA 3NXFA 1EJXC 4JTEA 2R91A 5DBUA 1LQAA 5CG0A 1V3LA 4XKMA 4N42A 1FQ0A 3EX6A 1TE6A 3DGBA 1QOQA 1JYVA 3DYOA 4O8AA 1BVWA 2PI6A 3E9AA 1JIBA 5EU9A 4D71A 3FAXA 4E4UA 3AS1A 3DH7A 3AJXA 1E6SM 1NDZA 3WG6A 3O07A 1C9WA 4J28A 3R58A 2PBOA 3A5VA 3FGCA 4HOXA 5M2FX 2Y1HA 4US5A 4GI6A 4MY8A 1C8YA 4OBSA 4OV4A 5H8PA 4UTKA 1LLOA 3NVDA 4CKQA 4A2SA 5AYYA 5F2GA 3VO0A 4PMXA 1NFPA 3NO5A 1G94A 3UVIA 3KTXA 3LCGA 4IPPA 3NEVA 3VD4A 3RR1A 4O1AA 5FD0A 2FVMA 4C65A 3GHRA 1ZCCA 1W5NA 3ZT6A 2XM1A 3B40A 3L4VA 1RQBA 1CGWA 5BOOA 3M7SA 4H9TA 2X05A 4PMDA 1HX0A 4YVXA 4GO8A 4U2YA 1PWMA 2ODOA 3SY8A 1YEYA 3IJQA 1CCWB 4HMDA 1LJYA 4PMUA 4FNPA 3CO8A 1OBAA 1AD1A 4ATWA 3N3TA 2VRKA 1IZKA 4JOMA 2XIQA 3LBMA 1GVRA 4X9YA 1JDAA 3LB0A 2XH2A 3EOUA 5AHNA 1XLKA 1ZHAA 1EGVA 4NAFA 4OBRA 5FAJA 2J9ZA 2ZA1A 5A8NA 1A3XA 2OG9A 2O56A 1QO5A 4ZTYA 3VDGA 3HURA 3LA4A 3NZPA 4BI7A 3UWUA 2VUYA 2PWDA 1DTNA 2WK2A 2VEFA 4IFOA 3KE0A 3DXIA 2P3EA 3CS2A 3HG2A 1AK5A 2QVHA 4M6QA 2NQ5A 3RMJA 4Y6GA 2AOSA 3F5JA 3T0BA 3L4YA 4GH1A 4ZXOA 3O15A 2FJUB 3UXLA 3VD7A 2Z1VA 3W1MA 3HPSA 3OQ8A 4HP5A 4YWIA 3TX9A 1WBJA 2B0MA 4MY9A 1IWPA 3DFHA 3ZJKA 3BQ6A 4C91A 2O7QA 2DSVA 5AZ1A 3VDBA 2FGZA 1RV8A 3ARXA 1JQXA 4WSJA 1M03A 1XH0A 4WKFA 2Y7FA 4ZE4A 1KRCC 4NXKA 1XCXA 3DESA 1KR1A 2WJEA 3GNRA 1LQ2A 2J8TA 2CZ5A 1JPMA 7TAAA 3LRKA 5T9CE 3WN6A 3R4IA 4RX0A 4ZZ9A 4GQGA 3HGSA 5BXRA 3UZJA 1M01A 2QMKA 4EPBC 1BXNA 4GCXA 5E9AA 2VYOA 3W24A 1HNYA 5BXPA 2P1FA 2B4GA 3WDQA 1TV8A 1BYBA 3DBNA 4PULA 3GDLA 1SMAA 3M43A 1OCNA 3FYOA 4S3FA 4TO8A 4HZ8A 4DEFA 3F2DA 2AGTA 5HPOA 2QS8A 1ODZA 4PTWA 3FKKA 3GG7A 3IIVA 3OBAA 4LUTB 1D3HA 3HQOA 5ABFB 1BQCA 2V5BA 2QJNA 2E9LA 2PDWA 2WO5A 1Z6KA 3LPGA 1E5NA 3TYAA 3WK1A 2HV5A 4CU6A 3MP5A 1OD8A 1TG7A 2GK1A 2XVPA 3KBMA 5T91A 1YNPA 3V36A 3GZ3A 3TOPA 3PBGA 1DIKA 3IJLA 5A8MA 1Z42A 4JL2A 1YXCA 5BYWA 3KRZA 3T07A 2B31A 1MW3A 3QV8A 1ODUA 1DEDA 1LL6A 2QDEA 2WXDM 3TYEA 1Z89A 5E1QA 1YNQA 2WAGA 5BU6A 4LPCA 3NQ7A 2GUBA 3RU8X 2Y5JA 4FAMA 3BLPX 1K02A 3NNTA 2E6DA 2E68A 3NPWA 3ZLFA 4AIBA 1BWLA 3CAVA 5HMDA 1HW6A 3O0FA 2XIMA 3PJXA 5A6JA 4K37A 1CXKA 5CAHA 4HNNA 2QUVA 3GY1A 4O16A 2RGMA 4Q4OA 2E6AA 4Z2HA 5XIAA 4AZHA 1W3NA 1U83A 4S2CA 1Z9AA 4YXGA 1SM9A 1V7YA 1XH2A 4Z0JA 4C6KA 2DFAA 2GGHA 1DYSA 2A1YA 1GHRA 2HBXA 4LV4A 3HJZA 4NZ1A 3UJSA 2YGYA 1UQYA 3V35A 5D03A 2EPNA 3B05A 2GOUA 1AA1B 3NQCA 4QR6A 2YLAA 3GH4A 4NJGA 3M4HA 3H2CA 1VENA 4NIRA 3TYUA 3TZFA 3NL2A 2WZIA 4XVDA 3PB2A 2DZUA 1XC6A 2DH2A 4ZOEA 1FFRA 1Q8AA 1W1PA 4KIRA 3U6WA 1TMLA 1WZLA 4W5UA 2C19A 3WBWA 4LTSA 5IBXA 1SPQA 3EKZA 3FIGA 3N34A 5C71A 2GSEA 3P80A 3ZLGA 4XUGA 5K3VA 3I65A 2X1TA 3WF0A 2A7PA 2Z29A 2XINA 4XK2A 3GVGA 4QIUA 4DYJA 2QCMA 4BWLC 3O6YX 3OYZA 2D2JA 3B03A 1XI3A 1UA7A 3S1XA 4H04A 4JAWA 1QAPA 2F84A 4TV6A 3VPLA 1LROA 2V0TA 1FA2A 3GKFA 4H1ZA 4B5VA 4WSHA 1E6PA 4ILSA 4W8LA 4CN4A 1L6GA 3NIYA 1MFUA 1JF6A 5I24A 1SU5A 1IE7C 1GOWA 3RR4A 5HINA 2ZWZA 2PDCA 4OE7A 2X16A 1UWRA 3E0LA 4PUDA 1FWIC 1SZGA 4EKJA 4C60A 2PDUA 4DX3A 2Q8XA 4P7NA 3W6LA 3IAPA 5IM51 1US2A 4M3PA 5AFDA 1GT8A 4LOCA 4JY9A 1B3VA 4S1FA 4K39A 3W7IA 2OB3A 2RHGA 3TC6A 3C0JA 5GNZA 2YFNA 3VCRA 2UY4A 4ONVA 2YCEA 4O52A 1DJWA 1H63A 3AHTA 3W7QA 3NOEA 1VFTA 1OVDA 1VPQA 2PBGA 2YBTA 1P1XA 1FXPA 4KERA 3DERA 1XSKA 1UWQA 1FKWA 2ZX7A 3N04A 5JUVA 2VCBA 4AMCA 3O1NA 3PZQA 3BLIA 4F4RA 3AICA 1NSJA 3PBVA 4GNVA 4EPDC 1SW0A