1OY0A

The crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
262
structure length
248
Chain Sequence
RTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFTPGDAAEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFSGAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ketopantoate hydroxymethyltransferase
publication title The Crystal Structure of the First Enzyme in the Pantothenate Biosynthetic Pathway, Ketopantoate Hydroxymethyltransferase, from M. tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 87
structure length 248
sequence length 262
chains with identical sequence B, C, D, E
ec nomenclature ec 2.1.2.11: 3-methyl-2-oxobutanoate hydroxymethyltransferase.
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02548 Pantoate_transf Ketopantoate hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1oy0A00
2VWTA 3H6OA 3IS4A 1M1BA 1O66A 3QTGA 3LYEA 1U5HA 3OQ8A 1XG4A 4L9YA 1PKLA 4QGCA 4B5VA 4KCWA 2XZ9A 1E0TA 3PUGA 2ZE3A 2VGIA 1ZLPA 4YJ5A 1JDEA 1SGJA 2WQDA 3QV8A 3B8IA 2VGFA 4KCUA 4QG6A 1OY0A 1KBLA 3M0JA 1PKMA 3PP7A 3HQOA 2XDFA 4B2DD 1PYMA 3I4EA 3KTXA 3SRHA 3SRKA 2HRWA 4FXJA 3EZ4A 1GGOA 3HQNA 4B5TA 4B5SA 4L80A 3SRFA 1F61A 1S2TA 3LG3A 3QV6A 4KRZA 3E0VA 3T05A 4HYWA 3ME3A 5TAOA 4MG4A 4TV5A 1E0UA 3KHDA 1F8MA 3QLLA 4L7ZA 1F8IA 2HROA 2E28A 4IQDA 3QQWA 3N25A 2L5HA 3BJFA 3BJTA 1O68A 3VAVA 3OYZA 3FA4A 1A5UA 3MA8A 2G50A 1F3WA 4B5WA 4B2DA 4KCVA 2OLSA 2HJPA 1VBGA 1A3XA 4G1NA 2VGGA 3GG8A 3HQPA 1OQFA 3QV7A 3M0KA 4WJ8A 2BG5A 2VWSA 2X0SA 1PKNA 3T0TA 1F3XA 3GR4A 3OYXA 1S2VA 1T5AA 1MUMA 1U5VA 4L9ZA 1A3WA 1O5QA 2KX9A 4TV6A 3GQYA 3SRDA 2QIWA 1M3UA 1PKYA 4LSBA 4B5XA 2V5JA 1VBHA 3R4IA 1DXFA 4RPPA 2DIKA 2HWGA 1XG3A 4QG9A 3G2GA 3FA3A 4KS0A 2DUAA 4HYVA 2XZ7A 4ROQA 4DRSA 5JVLA 1DIKA 3QZ6A 4IMAA 1IGWA 4FXFA 3E0WA 1DXEA 1ZJHA 1IZCA 4IQEA 3E5BA 1A49A 3EOOA 4JPGA 1KC7A 4B5UA 2V5KA 1AQFA 3U2ZA 3T07A 1S2UA 2R82A 2VGBA 1UJQA 3EOEA 1Z6KA 4IP7A 4YNGA 3EOLA 4MF4A 1DQUA 3QV9A 3P0XA 4KCTA 1S2WA 4QG8A
chains in the Genus database with same CATH superfamily
3SFKA 1G0CA 1UR9A 1LT7A 1CWYA 3XIMA 2OOGA 2VUNA 4M7TA 3E2RA 3TV8A 4GYJA 1XI3A 4MZYA 4PMNA 4PZVA 4X3ZA 3TFXA 3C0JA 3PM6A 2EHHA 3LOTA 3SR7A 1OX5A 3E0VA 4A29A 4H7ZA 2NXHA 1AQHA 2OYKA 4MFDA 1C29A 1SJBA 2OTDA 3T81A 5D05A 4M51A 2QCFA 4J9JA 2WC3A 4H2CA 3COTA 2CZ5A 4XK2A 3CO4A 4IIHA 4UQBA 3LCWA 1W3NA 1VFMA 3UFYA 3J7HA 3NZQA 1UKPA 1XYLA 1ADSA 4PBEA 4GMEA 5JMUA 2QCDA 8XIMA 3ITXA 4MYAA 2P3EA 3GZ3A 4FSAA 1GYMA 2R1NA 5IM51 5C9ZA 3ICJA 5A6BA 1JXJA 3DHUA 3WH8A 2BP1A 2GOUA 1Q85A 4YWIA 5E0FA 3WZ0E 1DBTA 4H7VA 1REQB 1JFHA 1KCXA 2B0MA 5BOFA 4JS3A 1JCNA 3L7RA 2QCNA 2YLLA 4H04A 1N7KA 2DORA 3KWXA 4RNIA 4Z1YA 3GR8A 5I79A 3UJSA 3AFBA 5BMXA 1EJRC 1H7XA 1FKXA 1JCYA 5EMMA 4XIAA 1V8EA 3IS4A 4H6EA 4FF5A 3NZGA 3QTGA 1OHLA 3B06A 3QR3A 4A35A 3D3FA 4NIRA 3MT1A 4R7JA 3ABZA 1VEMA 4QEEA 4IZGA 3GNNA 2FMOA 1C91A 2RHGA 3PZGA 1TR9A 4N9CA 1QJWA 2XG9A 1PVNA 3CYVA 1A0DA 3EKZA 1TSIA 1OGGA 4GQRA 4LY8A 1TRIA 2FGBA 1W1ZA 4BWLA 5LIWX 5HQMA 1GQJA 2XGBA 4AHQA 2HMCA 3WFZA 1OCNA 2X0YA 2XIOA 1HL9A 3F1QA 3MA8A 3TSDA 4ZO8A 3NJ3A 5LZLA 2E6FA 3ARXA 3VU2A 2WV8A 1R85A 4RL3A 3M47A 5LKYA 3M0KA 1FWBC 3LHTA 3IANA 1XRFA 4LAKA 1CIUA 1BD0A 3P62A 4TU1A 3MHGA 2CESA 1UOZA 4J3XA 1BFNA 2VUYA 3NFUA 2V2DA 3MHFA 3C0QA 3VTRA 4US6A 5JVLA 4IPIA 4E4PA 2BXZA 3GNRA 3H53A 5HR6A 3MCNA 3TFCA 3H2FA 4Z2LA 3N2MA 1QTWA 3NZRA 3SQLA 3G3DA 1LOLA 1KRBC 4R34A 2VFFA 3M5ZA 4Z2IA 3W7KA 2ZZ4A 1ESWA 2RDXA 3IK2A 1C7TA 2FZ8A 2ZZ5A 3AYRA 4IFKA 2Z1KA 1XC6A 1K4HA 2I14A 3ATYA 1BRLA 1W3HA 1YTEA 1EWDA 3ITOA 1X8CA 5DLCA 3HB9A 3SSZA 1R3WA 1A80A 2WJEA 3CB8A 1VKFA 3C5QA 3FJNA 3WNOA 1YE6A 2J8GA 4YTUA 1UIOA 3W22A 4ZZ9A 1FWDC 1EXBA 4TVUA 5H8PA 2V38A 2PZ0A 1GQIA 4QLKA 4H6QA 1QHOA 4RCXA 4AMAA 1HUVA 1RV8A 2OWWA 3CS2A 3GG1A 2YA2A 4KEVA 1Z9AA 4JTJA 2FGLA 2BX7A 3HGRA 2VGGA 4QCEA 2BGNE 1N8FA 5BU6A 4NRSA 4U10A 1XH1A 3CASA 4NT0A 2PURA 3LBCA 3ZWSA 2QAPA 4QG9A 1QPKA 4GVIA 4L1GA 4FI4A 4LF1A 4JX4A 3G0XA 4GFIA 1XJBA 5AHEA 3E0WA 3DKLA 1C93A 2O7SA 4JTGA 4G6CA 1PJ9A 5LA2A 2Z25A 3BH4A 4G1KA 4ADTA 1EJWC 4MKVA 1UZHA 1Y0EA 2R1PA 1S38A 3UG5A 3LQGA 2FH8A 1I9CB 3AMLA 5JBDA 5LXEA 3MZNA 1UD5A 1HFBA 1W54A 4YJ5A 1EF2A 1MUWA 1CXFA 3QPYA 1B90A 4Q6XA 2OYLA 1ADDA 4ROPA 4O53A 5C2GA 3NSXA 3V18A 2ZDSA 2NUYA 2ALDA 4P7RA 4XO7A 3VILA 1I2RA 1DWAM 1GHRA 3MUY1 4IFRA 4UXDA 4EK7A 4CKQA 1RXOB 2F61A 4C1LA 4KGLA 4LUIA 4JTSA 2O4QA 2IQ0A 1O1ZA 1TWZA 3GC4A 1W2VA 2I17A 1E40A 2BDQA 4KESA 4S1FA 3T0TA 3UERA 3GH4A 3L4XA 4HGXA 4XUGA 5EL1A 1GOIA 1OX6A 2GGHA 2FB3A 4S2CA 4DELA 3VDGA 4F2BA 1WBJA 1F6PA 1CXEA 5H6HA 1WP6A 1QPQA 4WZHA 3W0KA 1QNSA 4R7OA 5LNRA 2G4JA 5IRPA 1C9WA 4CD4A 1XRSA 3ANUA 1IT8A 3WDPP 1OD8A 1PTDA 2PWUA 3CWHA 5FJPA 4JPGA 1UP3A 4PMVA 2EPNA 3T40A 3UCCA 4JX5A 4Q7IA 2VYOA 4PMJA 3VGDA 1OZMA 4QG8A 2VWTA 3ZO9A 5D33A 3EB2A 4URIA 1A53A 4F9JA 4MDOA 2BVYA 4L9YA 1V02A 3L5AA 3OQEA 1YADA 2AL2A 3W7QA 1ECQA 3KEHA 2DUXA 1ONRA 2QNEA 1Q6RA 2QDEA 2QEZA 1TX2A 1UWUA 3BLLA 2E6YA 3V1PA 3T8QA 1Q13A 3DU0A 3VIJA 3VKAA 3GDTA 4TV5A 2PLMA 1XR2A 1XIBA 2Y85A 1G4PA 2Q71A 4O19A 3L68A 3KLLA 2GL5A 2FZBA 3QMTA 1TRDA 1OCBA 1B4EA 1AVAA 3ZM8A 2ZADA 3OJGA 4GZJA 3VFCA 4YTRA 3MC5A 4V2XA 1FBAA 4S3JA 4JFSA 4YCPA 2WLZA 1A5KC 1MUMA 1KM5A 3ZT7A 2OPJA 1U1HA 2FVLA 3OODA 5CPLA 3DZ1A 1K8CA 5C9WA 4YTSA 1GORA 4O0QA 2RJHA 3AU2A 3PJTA 3KL5A 1FWHC 3KBSA 2HK1A 3LM7A 2OXNA 4RV3A 4MMWA 3MP5A 2C0AA 3NQCA 4UZSA 1E55A 4ZB0A 4XKYB 3PPHA 5G4EA 1AL8A 3V35A 3HV9A 4NF7A 4IP7A 3O3RA 3QR1A 3U8GA 1CGXA 3PUGA 3SIMA 4CNSA 4E6MA 1HKMA 1UG6A 1AK5A 3UESA 1ODUA 2ZE3A 3VNLA 4I6KA 4G7EA 4UFIA 4PEKA 3NQ8A 1QO5A 1R2SA 2XSAA 3TQPA 2GVYA 2OZTA 1L9WA 4D71A 4MWAA 4LRTA 4Z0JA 4JCLA 4QFUA 4N6EA 2A3EA 3N12A 4DBEA 3OVRA 2PMQA 2E1DA 2ESCA 2BOFX 4M29A 1WB0A 4ZCWA 4AZIA 4XIMA 3PZUA 3A12A 1FTXA 2CYGA 1E9ZB 3UPBA 2ZRYA 2C91A 3CMGA 2X09A 5DMNA 3PTMA 2BS9A 1Q4NX 3NQGA 4P7LA 4UTJA 2VR4A 3NVDA 3IPWA 3IGXA 3BLOA 4O28A 5EMYA 1RQHA 5LIYX 2J62A 3WUGA 1IIGA 2FH6A 4GZEA 3M0ZA 2V67A 7ODCA 3UEQA 1J93A 4UTMA 4GH1A 1I2PA 1WXJA 2FIQA 1FY6A 1RA5A 3PSVA 3FA5A 2EBNA 4QS5A 1GTEA 1BGGA 1IXNA 2YL5A 4WRHA 3VKDA 3QQ0A 3TAKA 3BOLA 2E67A 3HMCA 1XYFA 2NUXA 1Z32X 1LRNA 3S83A 4ERIA 1QASA 1MNSA 3BURA 2WNWA 1XIEA 7XIMA 3NPXA 2B81A 3GTXA 2Y89A 2FB2A 1Q6EA 4IPLA 2RUSA 4AMCA 1XL9A 2H8XA 2PPGA 1UD2A 2VVNA 3K5XA 2ZZ7A 2LLEA 2YDQA 4FLRA 1F4AA 2CHRA 4OJYA 3U6WA 1XLMA 1OABA 4AXNA 5IDIA 1UW9A 3L65A 2XFWA 5CZTA 1WAWA 3W02A 4IIGA 4Z2JA 1E1CB 4L64A 4DJED 1QRQA 2GVLA 4K37A 2CLKA 3V5OA 4PRWA 1CXKA 2J79A 3OVPA 4O54A 2Z00A 3VGFA 1E3ZA 3PZIA 2O0TA 3BZGA 1E6PA 3BCFA 4KIEA 1V0LA 2AKZA 1JFXA 1IEIA 1CGYA 4GD0A 1BAGA 1VHNA 1AQ0A 3FAWA 4OT7A 3USZA 1TJRA 2FHBA 3VC5A 3GVRA 1VEOA 3AIVA 3GYCA 4DLFA 5DBUA 4N4QA 4ATDA 1IT7A 2Y7GA 4XD4A 5BOEA 1OM0A 3EDFA 4X9SA 3PB0A 4AF0B 1W1VA 1Q6LA 4AZ7A 1MUCA 1E51A 1FDYA 2GQ8A 1KBIA 3B05A 4NNCA 1CLKA 3E6EA 4H9ZA 4LS2A 2H6RA 2PWHA 3CNYA 2Y61A 2DSWA 1EA0A 4JQAA 2DW7A 2HXUA 1OFPA 2DSZA 4RZ4A 3KOZA 1M6JA 4CU8A 3CMJA 4HMEA 1XKYA 2V68A 2Y63A 5KZDA 4H6KA 4JFTA 5K3VA 3SRFA 2ZTKA 1ONEA 1F61A 1BHGA 4UTLA 4US5D 6XIAA 4Y90A 4US5A 2VCAA 1CX9A 3PG8A 1W32A 2UY3A 2BHYA 4GINA 2HCVA 1TTIA 4LVAA 4PB3A 3M0YA 4Q8WA 4JHOA 4PC8A 1UPMB 1HO1A 2OLHA 3Q4DA 3CQ0A 4GH3A 2G0WA 4CD6A 3PBYA 1F7BA 3MWAA 4O18A 5CGQA 2WWCA 2ZXAA 4GXPA 4RPPA 3ARPA 4CNUA 3BTNA 3G2GA 3OW1A 3WUFA 2JE8A 4Z2GA 1P1XA 2QUVA 4PMQA 4AIOA 4P8XA 1E6SM 1C8VA 3CQJA 1ZAJA 2QV4A 2YCJA 4IQLA 4B9YA 4LH8A 1YNPA 2VX5A 1C8YA 5BXRA 3CEPA 4CEXC 3EPOA 4UTWC 2GJPA 2CCRA 3EDJA 4NZ5A 3P0XA 4GXWA 1VS1A 3M6YA 4U3AA 1U5HA 3NDYA 3KL0A 2V3FA 4WDWA 4I6VA 3RXZA 3KVLA 1NH6A 1SQ7A 1JDEA 3SZ8A 2J8FA 3VIPA 1FWTA 4GJIA 1RJPA 2PDKA 2WMJA 3WJXA 3O06A 1E4IA 2FZNA 1ME8A 3SRHA 1YTKA 3TTQA 3BVJA 4HK6A 3V36A 2YX0A 2WMGA 1VP5A 5CKSA 4F8XA 3E49A 4IUOA 2ZUUA 3BZJA 3M5YA 3MP4A 3T0AA 1XIFA 4W7VA 1Q5MA 3FGCA 3G1AA 3FHQA 3Q45A 4H9XA 3FSUA 4C6EA 1GKPA 3OG2A 3M44A 4AU0A 1P0BA 5HAOA 3ZSTA 2V6AA 1WNOA 2P88A 4ZGYA 1FH7A 5AC6A 3VIGA 3WQ6A 4L5ZA 2NV2A 3U4AA 3SN1A 1KFCA 2X41A 3N2XA 1E0VA 1RP8A 4HU0A 2E68A 2RJGA 2D2JA 3M4HA 2Z1SA 1OFOA 4ROQA 3ZR5A 1CGTA 3GNOA 4R53A 4RV8A 2E4TA 3CPGA 3TONA 4AHOA 3P7YA 4IJRA 3AXXA 4QAIA 3SECA 1MW1A 4D6JA 3VDHA 2V5KA 1NWUA 2VCBA 4KBXA 4WF7A 3QVQA 1HVQA 3RMJA 3PFMA 1KNWA 1RR2A 3S9ZA 1XG4A 3A3XA 3IJIA 4CCZA 4BZYA 3WF4A 2VFIA 3RJXA 2BVDA 4JNMA 4KWWA 4R3UA 5JBEA 1U1JA 3AICA 1LG1A 1XIHA 2E9MA 4HPJA 4WSKA 4LS0A 4XZLX 1OSEA 3OVQA 2YYTA 3EA1A 3JS3A 4PFHA 2A7PA 3EBVA 4H83A 4UMBA 3RLGA 3S3GA 3O6CA 1PO9A 3KZSA 3T05A 3P2VA 2O9RA 1NM9A 2XVKA 1ONWA 5AC7A 3OLDA 1U22A 1SZEA 2YBTA 3AQUA 1X38A 3QQWA 3PUDA 4RK8A 3P0WA 4GOAA 3VIFA 1W3JA 3ARVA 1BF6A 1N82A 2EPHA 3G1YA 2FPVA 2HPIA 3LERA 5B80A 3O05A 4O8RA 5DRIA 1H4PA 3R7MA 4A3HA 1MEIA 3DC0A 2OMAA 2OELA 1UMLA 3ES8A 1Q2RA 3FA3A 5M5DA 1TYGA 2WSKA 2PDBA 4BQ3A 3IGSA 5J8LA 3QZ6A 4GGBA 3DI1A 3NPUA 1PPIA 4OU1A 3MBFA 4GACA 2V69A 3ID7A 5AHFA 1BTMA 2XM2A 1E6QM 4XZ9A 4GNVA 1OCJA 4IJCA 5BOOA 3QZAA 2XJ7A 4LXFA 3OQ8A 5BWFA 2UY5A 4ZQOA 1GQLA 4GQ0A 3WLIA 2IKGA 3W26A 5K2ZA 3W85A 2CWXA 2CU0A 3PZQA 2JQXA 3S0CA 2WCSA 2ZRZA 1E9YB 3OZYA 2UWFA 2PE4A 3OO2A 3KRBA 4JTUA 1VJIA 1ME9A 2D1ZA 3NZPA 3OIXA 1DJHA 3ECQA 1ECEA 4QROA 4JY9A 3WQPA 4KFNA 3SY5A 3M41A 2NQJA 4JZ5A 3GVWA 4UOZA 1K02A 1MEWA 2W0UA 5TD4A 3RU6A 3OLEA 1HO4A 2CZVA 4PA8A 1V3IA 1IGSA 4DZIA 3VGGA 3GHTA 4GCXA 3FJ6A 4RLIA 4RPQA 1BKSA 3WG6A 2YDAA 1B3OA 2IXUA 4MB4A 2X7VA 1DWJM 3LPFA 4UTIA 4ZSUA 2A7NA 1VEPA 1JYVA 2JK2A 1MNZA 4FOJA 5I00A 4DWSA 3M07A 4DWSD 5ABFB 1GVSA 1R9XA 3E0IA 1DIEA 1KCLA 2C18A 4KH2A 3VZYA 3RX3A 5D32A 1JAEA 3PTQA 2BSLA 3VFLA 4JTAA 2WOQA 3SUWA 1OYCA 4MB1A 4X60A 2J27A 4E8CA 1EJTC 3R8RA 4PSRA 5HWJA 1CLVA 3ZYZA 1R86A 2CIPA 4EVZA 3MSGA 1RVKA 4L1WA 1IWBA 3LUTA 2WVVB 3QW4B 4UFLA 4MNKA 3QY8A 3V3WA 2CLIA 3UXKA 3QV8A 2ATMA 4LUTA 1GVEA 2C1HA 1TKKA 1YPXA 4BF7A 4DI9A 5BCAA 3I6EA 1T6MA 3WLMA 3MCMA 1F2JA 1VJZA 1VIWA 2WW5A 1QNOA 1A4MA 2R8WA 4AVNA 3CAVA 5M17A 2YIHA 5FJUA 2VX6A 5MKGB 1S39A 4Q7NA 1GEQA 2HBXA 4FNRA 2ZX8A 1UKQA 1F76A 4F0SA 4UOQA 3UU0A 2Y7DA 3F5KA 1J6PA 3SN0A 5EKYA 3GBEA 1LL4A 4MPQA 3E0FA 3H4WA 4PL2A 2YCLA 4W9TA 2DZSA 1U5VA 2QJGA 1TJ0A 1XBXA 1YNQA 3ARWA 4ICCX 4CCDA 3URBA 3MTWA 1I0DA 3O63A 3W7OA 3NUKA 3WQ8A 4IPJA 3B97A 4BKNA 5F2MA 2ISDA 5DT5A 1LQ0A 1BYAA 1MXSA 2PFHA 3TCSA 2XINA 4DEFA 4PMOA 5FOOA 3U48A 4HSNA 1O94A 3AOFA 5D2YA 3QSRA 1DIOA 2VJXA 3W7GA 3L21A 5EY5A 2Q8LA 4CVWA 2WB5A 5REQB 4W7WA 4LANA 3N2CA 3OLGA 3VOJA 3KS6A 1KXHA 5CZJA 1XBYA 3W01A 3I68A 1J5TA 3T2QA 5HINA 3B0YA 4MUPA 1J5SA 3QY6A 5ABEA 4AB4A 4AX6A 1TCDA 1EXPA 1OX4A 2YW3A 4Q4MA 4DZ5A 3RUBL 5F1VA 3QV6A 3CC1A 3VOCA 2OB3A 3IGUA 5T9CE 1HJXA 3QMSA 3VGBA 4J3TA 2X1RA 4JYDA 2RDUA 3V7PA 3MI2A 1WDPA 3VXGA 1A3XA 5D9NA 4NZ3A 1XF0A 4D6IA 2VP8A 4CQCA 3KBVA 1F3XA 1JGMA 3SGGA 4P7NA 5TQLA 3EEGA 3PZNA 1M3UA 4GYPA 2PC8A 2VDIA 4UTFA 3BLFA 3M16A 4WOZA 3BLIA 3BLKA 3MV01 2VZSA 1EZWA 3TYBA 3WD1A 3TEVA 1SVDA 3W07A 2OZ0A 3EXRA 3MHUA 3TQKA 2CPUA 1WZLA 1CBGA 1H7OA 4S3BA 3ARQA 2Z1XA 1DQUA 1PYFA 1W9UA 3H22A 4MB5A 4KWSA 5JIPA 3OGSA 1KGWA 2C1IA 4F3HA 3JW7A 1EH9A 2NZLA 1KM3A 3VZXA 4M24A 2YOCA 1HX0A 4Z08A 4PMZA 4O52A 5C2XA 3BAKA 5GJPA 2QPXA 4WY0B 3ITYA 2CXGA 4CCCA 1V6UA 4MIMA 4BEQA 3CH0A 5K4ZA 3VE7A 2QJMA 3APTA 3NEVA 1SO5A 3WBEA 4HYWA 4ECLA 2HNEA 1FVPA 4MG4A 3M0LA 7REQB 4ZXOA 1H3GA 3QF0A 3NR0A 3SGZA 2G96A 4IMCA 5D2VA 4KERA 5HMEA 2EPKX 2QKFA 3TR9A 3GFZA 5EYWA 1TUFA 2TYSA 4E0CA 2BG5A 3A24A 3BARA 4TTUA 1SJAA 1YBQB 3GR4A 1ICQA 3BW3A 2NSOA 1Q8AA 2ON3A 5DELA 1XCWA 3QYSA 2I16A 4L4OA 1A47A 3L4WA 1M03A 3ZLGA 5HPCA 3W6YA 1QHZA 5CQ1A 3H54A 2NQLA 2PF8A 3K13A 1WV2A 4HA0A 4UR9A 3T42A 3U2EA 3B0PA 3KP1A 4EWND 2GVJA 1KC7A 4JGDA 4ACZA 1S5TA 5F4WA 2VO5A 3T07A 2R91A 4JTKA 1EIXA 1NOWA 3GVGA 3SI9A 3ZQ9A 1K8ZA 3EOLA 1QXLA 4MJ2A 4MTVA 2V3GA 3H6OA 3SUTA 2QF8A 4RNJA 3LLFA 1VBUA 2EJAA 1WDRA 2QS8A 4XX6A 1ICSA 1NU5A 3GDLA 3MSDA 2OEJA 3AIQA 2GSJA 3FX4A 1FCBA 3AHVA 2XDFA 3N6HA 1J79A 3TW7A 5CC6A 4CN4A 1JPMA 3MO4A 2PD9A 4W87A 4P61A 2E6AA 2WJDA 5HK4A 2CITA 1X1ZA 3BV7A 1EP3A 4PMRA 1FFQA 3QLLA 4D2JA 1JPIA 3PR2A 3Q94A 3WD4A 1DJZA 2E8ZA 1LP6A 3EPMA 3PHAA 5FESA 1QU4A 2ACUA 4FLOA 3SUVA 5KETA 4UCFA 1V7AA 2X0SA 1KD0A 4JEQA 1YEYA 3PAJA 3ZJ7A 3SRDA 2H9AA 3FOKA 2CERA 4HTYA 3CB3A 1M01A 2G4FA 1GPWA 3CZJA 2FPYA 4GLEA 3UWEA 4PTNA 3STFA 1KFBA 4IQEA 2FJKA 4UQ9A 3VABA 4GPNA 2ADAA 1QHPA 4BY3A 1EJ7L 5BRPA 3ZR6A 1E6NA 5ECUA 3NOEA 2F6KA 3HO8A 4EX4A 3FJLA 1TTJA 1H7RA 3M0IA 3KBJA 1P0KA 2XH2A 3KTCA 1GYLA 3WBWA 1GOXA 1SO4A 2PEVA 4F66A 3BGJA 1H60A 3SO7A 4LS1A 3ZT6A 1AG1O 1Z48A 4PUUA 4YL2A 1SFJA 4JYEA 4HNCA 2WBGA 1ZENA 3CV1A 1DPMA 4ZSTA 3L0KA 4C7FA 1VPXA 2VFHA 4I90A 3TXVA 2NX1A 3M6DA 3WLHA 1EX1A 3PBGA 4PBFA 2FZMA 1J0IA 1US2A 4S3AA 3EWWA 2Y5SA 4AY8A 3AI0A 5AECA 2RKXA 3WJSA 1HKJA 3AIWA 1TUXA 3STGA 2W92A 4V28A 3B9EA 3PPFA 2ATSA 3LM3A 3PS7A 3N29A 1OK6A 3STPA 2P3ZA 4CEUC 3CHEA 2MANA 2AAMA 4YS1A 4H8UA 2IUZA 2AQOA 1KBKA 2EF9A 2ZOXA 4M5PA 1QI2A 4E2VA 3LI1A 4X9YA 1QMLA 1VFTA 3S1GA 2KZHA 1DIKA 3KLKA 4A22A 4MUZA 4PULA 4O0ZA 4WQ6A 2NSXA 4HQVA 3N34A 3NM1A 3FYOA 1YXCA 3N2BA 1UWTA 2HXTA 2VC9A 3G1XA 2QJJA 1H1ZA 4YNGA 3GD6A 4EOUA 1VB9A 1JCMP 1BVNP 2E0PA 4MFEA 4AXKA 4B3KA 4Y9NA 3GC5A 4F0LA 5JXQA 3UVIA 1CXHA 1BSLA 1LLOA 5CLTA 2Z2UA 3SY8A 2X2GA 2TAAA 3LV6A 4MOZA 3R8GA 3EXSA 2V2HA 1WOBA 2JF7A 3S6DA 3TJ4A 4TQTA 3GH7A 3C8NA 1Q7QA 5BWAA 1TIMA 1J2WA 4XQ6A 4W89A 2WZEA 3CBWA 4UC5A 1KRMA 1G7VA 1ZJAA 4QIUA 2DVTA 4XISA 3WQCA 2CLHA 1KM0A 2HJPA 4LYPA 4J28A 3L67A 5FI8A 2J7FA 2ZVIA 2J6XA 3A4JA 4RE4A 3CL6A 4DO4A 4CQDA 1A3WA 3N4EA 7ENLA 1DXIA 3KVMA 3RN6A 1DJNA 3BAJA 1VFSA 3TJLA 1XLDA 1VYSX 1UB3A 4NU7A 4HYVA 3VNYA 4PL1A 4HNUA 1HNYA 5JH2A 1EEPA 6CGTA 2YB1A 4JNYA 3VMOA 4GI4A 3TQ0A 2CNCA 2ASHA 1XQLA 4E38A 1PZ2A 4EPBC 1W31A 3RCMA 3R1ZA 1B5TA 2CLMA 2VR5A 2O92A 5HNTA 5A1AA 4PTMA 3LCFA 3RO8A 4LJ3A 5BZAA 1S5NA 5BU9A 4PCNA 2AMXA 1JDDA 1TTQA 3C2YA 3FEQA 3VNJA 1WE5A 3L4ZA 2YYUA 1CYGA 2AL1A 3I3DA 4LUSB 1E0TA 1QR7A 3LLDA 2X1UA 1DJWA 2D3LA 4H3DA 4WSJA 4R9XA 3BW2A 4Y9MA 1EDGA 2NT1A 4PTVA 5D2WA 2NX3A 3H55A 4J4KA 1DIDA 3TWAA 3PZ9A 1V0MA 4K36A 3AYTA 4EIVA 5C5YA 5GVJA 1HN1A 3WLOA 4WDUA 2X1SA 1XPYA 4UFJA 3IJDA 4PUMA 3L66A 3D46A 4JY8A 3OEXA 3UCQA 4C6CA 4BHYA 1E9IA 4F0HA 5HMDA 1EB3A 1Q45A 3QH2A 4IF2A 1O4UA 4RDVA 3DCPA 2Y0FA 1EO7A 4ZEPA 4DM1A 2ZA2A 4NHVA 1QOXA 1S2VA 3A13A 3GE7A 4J3SA 7PTDA 1TPFA 1I2NA 4TV6A 2A4AA 1YPIA 3TJIA 2V5JA 3LXCA 4AVFA 4S3CA 3TJXA 5A6SA 4K1WA 1Y5XA 4J5NA 3GTNA 4CQBA 2YBUA 2G3NA 1PS9A 1N8IA 3LHYA 1S5WA 1V0NA 1RPXA 3VNMA 3EDKA 3IGHX 5AFDA 1PZ3A 1HG3A 3W7HA 1B0IA 2WMIB 4NNBA 4S3GA 3OPSA 4HPHA 2PB1A 4H9UA 3Q58A 5XIAA 3G24A 2EJ1A 3QR0A 5LNUA 3DC8A 1SZGA 2GJXB 4JYFA 2Z1WA 2JGYA 1B3WA 1BPLB 1IR1A 2W91A 2Z7KA 1DJQA 4FPSA 1XICA 5E0KA 4HPNA 5I06A 2FDSA 4ALDA 2R6OA 1SM9A 3R89A 1K1DA 1FWJC 2VVSA 4Z0SA 1X97A 1MQPA 4PUDA 1Y5WA 1HF6A 3LCLA 2BWGA 3WSUA 3A5VA 3WO8A 3E02A 4Q8UA 3HA1A 5I3DA 1WUEA 3UZZA 3SY1A 4H1ZA 4NQ1A 2OQLA 1QWGA 5AZ1A 3WNPA 4HHMA 3TN4A 1OINA 1SYTA 1DJYA 2D2GA 2DT3A 2OX1A 3B3DA 3TSBA 1F6YA 4OQVA 2NLYA 3FLUA 2P76A 5A8PA 4LCSA 4NAFA 2Z0IA 2ZZ6A 1HL2A 5I3FA 4DPQA 4RE0A 4ML4A 4LAZA 3RGTA 2PZNA 4E8DA 1TPC1 4HP5A 2GVGA 3N1AA 3WEOA 3GG7A 4GY1A 2Y5JA 3LD5A 4XZWA 2HISA 1CNVA 1AD4A 1FWCC 3NQMA 3Q65A 3UCDA 1EHNA 1I45A 1U83A 3BPWA 1MO0A 1XS2A 4JIRA 1HQTA 4DJDC 2J47A 4DUXA 3KW3A 3BSGA 3QQ1A 4E8GA 3OTRA 3VIIA 1JXKA 3RNDA 3FYYA 1AW5A 3PANA 1ZUAX 2OKTA 1WPCA 3CQHA 3QZEA 1DHPA 1RY0A 4GX8A 2FGZA 3LRMA 1NY1A 1S5VA 2QCDB 1AW1A 2OGJA 4JL1A 2XN2A 4LX4A 2XU2A 3WNMA 2CBJA 3B8UA 2PDNA 4LYQA 2ISWA 3P8IA 1JUKA 1F4HA 4LOCA 4GRSA 2I56A 3RM9A 1JCJA 4WSHA 3U2CA 3QHNA 1AJZA 1EQPA 5CLWA 3H4XA 4N6FA 2X8RA 2ZZ2A 3P74A 2XTKA 3WBYA 3FDGA 1B30A 1PSCA 2DDXA 5XIMA 1Q3NA 4PUNA 4MY8A 2DT2A 3EMZA 1GOKA 2A1YA 3F7JA 5HWMA 4EACA 1UBSA 4A8RA 3EOSA 3V0SA 4JIPA 3S2LA 1OIFA 1VF8A 4O12A 5AVNA 1DXFA 3LZ5A 1XLIA 3R12A 2D73A 4ZQCA 1E3XA 1P6BA 4LAUA 4OFCA 2W62A 5CBBA 4H4IA 4MNJA 4GYFA 1GKRA 2WJZA 1JRCA 2HNHA 4UMAA 3BMWA 3W7DA 3NCOA 4EXQA 4J27A 2PLKA 1CECA 2FTWA 3UG4A 3TSMA 1H7WA 4MF4A 1R8LA 4L65A 4AFYA 3OU8A 3W7EA 5C55A 5IXEA 1W1TA 3O8AA 4GBDA 3CHVA 3P6LA 4GIAA 2EKGA 3FDKA 1M41A 1OYBA 1VZWA 2J7GA 4FZIA 4D6HA 1Y7VA 5HMSA 4W5ZA 1W3TA 1TPVA 2I9UA 3CQIA 3U0HA 4DJFD 2PRHA 3QBUA 3AUJA 3AMCA 3PN8A 2PP1A 3IWPA 1O5RA 1PXGA 4IXHA 1X6LA 4REQA 3PY2A 2CETA 1GVYA 5FA5A 4TO8A 3VCRA 3WK2A 1J96A 1TREA 1TA3A 2YB4A 4IFKB 3W2JA 2PRLA 3LBOA 4KFPA 5L9FA 1BRLB 4W93A 2G3MA 4D6EA 3VKBA 2R94A 1NWTA 1VGAA 4DJDA 4IG2A 1NQ6A 1YDYA 3VOHA 6ALDA 1J2BA 3VX1A 1POKA 5A5WA 2W66A 4KWUA 1NFPA 1JZ4A 2YXXA 3B8SA 4RDYA 2GJLA 4NX0A 1XCFA 3VM5A 4DAIA 1L2UA 4OGZA 1V03A 2DU2A 1UC4A 2NW0A 2PDWA 5EFFA 4IIEA 3KRZA 3EYPA 1KLYA 3W28A 1J12A 2NVDA 4UR8A 3F03K 4LBUA 1MQQA 1PBGA 2X7WA 3DFTA 4QCFA 4NKCA 2QDHA 2Y70A 4UIOA 1Z7AA 4EXBA 3NPWA 4JCMA 3W73A 4JL2A 3E2QA 3LCGA 1KTNA 4LVFA 1B3XA 2PDIA 1JNEA 2IW0A 3D0CA 4GO8A 5G1TA 5MF5A 2V3EA 5CBIA 3P3BA 3GAYA 4ZENA 4MZ8A 3GNDA 4NASA 1GKQA 1JRBA 1QCWA 3B8VA 4FNPA 3WMCA 1IR2A 3VINA 3VIOA 2ZUMA 1CCWB 3WH7A 3BCJA 1ML1A 5CPTA 3NQ7A 1NEYA 1V93A 3HG5A 3MWCA 3FNDA 2WKJA 2FFCA 1EX5A 4KKXA 2V5CA 3RDKA 3CXOA 3GIQA 5I77A 4JEJA 3BDKA 4YIWA 3E96A 1PEZA 3KDNA 4B5NA 4DBSA 4XV0A 4GE8A 3NGFA 1IWAA 4P5UA 3IVUA 2BTMA 1KV5A 3UG8A 1C9DA 1L2QA 1UYQA 1BTCA 4KW2A 3IIOA 1D8CA 1XBVA 2R82A 1L6YA 3I3BA 4HTBA 4MLJA 2A3AA 1SZRA 5KINA 2WNNA 1XM3A 3VOIA 4HHHA 2ZYFA 1SFTA 1JIBA 5LIUX 2Z2AA 3ARUA 3EWUA 3VK5A 3EWYA 4QSFA 3ALGA 3FEMA 1VBRA 2AQWA 1UP0A 5E5CA 2Q3RA 1LWIA 5CZKA 3PJXA 2WZMA 3VNZA 3KWSA 3MVIA 1SO3A 3NXLA 4F9DA 3S1XA 3H2OA 3WDJA 4W88A 4IIBA 4Q33A 4LB3A 3NL2A 1UA7A 3REQA 2Y2WA 1KFWA 4QXIA 5AVHA 9RUBA 2AGTA 3OZPA 2YXGA 1V3HA 2AL2B 3O2LA 4PGLA 4W8LA 3NO1A 3VCCA 3NYDA 4K38A 3B9NA 3QC3A 5ABHA 3JR2A 3RILA 3TYZA 2EGZA 4LPCA 3LLXA 1XD0A 3G1FA 1QDSA 1A5OC 3QEZA 2BGQA 3TH6A 1H63A 1E15A 1O5XA 1EFZA 3BQ5A 1FWGC 1UR4A 5FD0A 5A8QA 3NL3A 1W9DM 3SUSA 4IX2A 4ZVJA 4PMXA 2IMRA 3F5JA 3LXBA 2CWNA 1W6TA 2ZXBA 4MAZA 4MY9A 5HR7A 4M7SA 3IJ6A 6PTDA 4QGCA 2C15A 4YVVA 4FALA 1P1MA 5K9DA 3T44A 2BOGX 4JDBA 4DYEA 3F2DA 4HHLA 2G95A 3CHCA 1YDNA 4J3WA 4TVCA 1S5MA 4AEOA 2NT0A 3LV5A 3VKKA 3TXZA 5FF2A 3EZ4A 1QBBA 3KOXA 3W7CA 1EUNA 3WUEA 3SCOA 1JAKA 2DJXA 3ZR4A 3HTWA 4ZR8A 3KVJA 3GX9A 2W61A 3W3OA 2D0FA 4AWTA 2FYMA 9XIMA 2V81A 2BXYA 1O1HA 3PNUA 4PBGA 5EBAA 1NQKA 2DZBA 4G7EB 3BQ6A 4RJEA 3SCRA 3GY1A 1EPVA 3S6TA 1L6SA 2VEMA 1OVDA 4IM4A 3I65A 1K9TA 4DBDA 4MWAB 4NNAA 3V5FA 1YHTA 3LX9A 5HJLA 1F74A 3ANVA 1ZJHA 5FEZA 6TIMA 3LDVA 1XYCA 1H0GA 4V1XA 4IP4A 1QFEA 4FXRA 4JX6A 3A64A 2INFA 3H7VA 4MHBA 1T41A 3NQBA 2PDLA 3CT2A 3LYEA 1XRTA 1RUSA 4Y2WA 3JUGA 1EIBA 2VMFA 3VNIA 2E5BA 5T8GA 2BLEA 3TTSA 1M53A 1BG4A 1WOAA 4J35A 4KWOA 2YCIX 4MPKA 4WXZA 4J7RA 2EPOA 1GGOA 2PTZA 1H62A 3P93A 4Q6JA 1K7FA 4CNPA 2HE5A 2X0HA 1UR0A 1KFJA 4L6HA 2H3DA 2VEIA 3CU2A 3NQAA 4A6GA 4PUEA 4B2DA 4ZB5A 1VPQA 2WM1A 1IF2A 4I5RA 1UP2A 4WJ8A 3MKVA 3STEA 2NXGA 4O1AA 1EJUC 2WSRA 1R6WA 2FMNA 3FCPA 1EYEA 4OECA 4P7OA 3SB0A 3WK0A 3AXKA 2HWGA 4WIWA 4WX2A 3EMQA 1FQ0A 4MVAA 3P14A 2B31A 5E6YA 3UZYA 4GKTA 2VD9A 1AUSL 5D8WA 4D72A 3G5EA 1N55A 2WHMA 4QE4A 4GJJA 3GHUA 5CBJA 4EF9A 3FJ4A 1WDWA 1WZKA 1YTDA 2V5BA 4AYGA 1YLVA 2EG7A 3V1HA 2WHLA 1ZBKA 3AHTA 2PDPA 4C6OA 2YDSA 3AYSA 3VDAA 6TAAA 1TMHA 4JXCA 4O1CA 3KTSA 4IIDA 2W67A 2NQ9A 3TWBA 3CAQA 5C9XA 5IFPA 2Y7FA 3T8LA 3AZRA 3H2EA 3EWZA 1PHWA 4C7GA 2PBGA 3N17A 3PF3A 1JZ2A 1QPOA 4OOUA 1TMQA 5HUPA 1TV3A 2O9TA 5FKYA 1UD4A 4YU1A 4Z17A 4BJHA 2XWEA 4UQEA 1BGAA 3H2CA 1P0EA 4GY0A 2QMKA 3WLKX 1G6CA 3CZKA 2BOEX 4IP5A 2D24A 3KBMA 5TF0A 1JPHA 2E77A 3VD4A 3OA5A 1UHVA 4M0XA 3LN3A 2WVUA 2P50A 1OFDA 1D3GA 3SCSA 1VBJA 4JN8A 1WUFA 4YN5A 4C1NA 2DH2A 5AYYA 5I07A 2XSXA 3AAMA 3NXFA 2PGEA 2RFGA 1O60A 4L4MA 1GQKA 4IMFA 4FX6M 5CZ0A 4NAEA 4DF2A 2VT0A 4K8EA 4QX4A 1DVJA 4BI5A 1F05A 4Q4SA 3RCYA 3VA8A 4H7CA 5CPSA 4YTTA 3ITGA 2DVXA 3ZVIA 1KCKA 4LVDA 3AXMA 4UTHA 3IEBA 2W6RA 1UC5A 3CK5A 1K9FA 2E8YA 3UZJA 3U2OA 1XGDA 1R7OA 1JF6A 2QLYA 4P2VA 3PNZA 4QHRA 1M1BA 1NDWA 4GYKA 3OBKA 1UOKA 2RDTA 3A21A 1R38A 3WNKA 4F40A 3OLIA 3WH6A 2BVTA 2ZRUA 2IXVA 4C7DA 3K1GA 4IQJA 4HPGA 5D09A 1HJWA 3POCA 3AIBA 3DYOA 1B4KA 2QCHA 1XD1A 3R25A 3DGRA 1RD5A 1KLZA 3SFWA 4NZ4A 3CQKA 4A05A 1XFBA 2PP3A 4QP0A 4MDPA 1TWIA 3KM8A 4HCDA 4D6GA 5I24A 1B3YA 4KQNA 1D3CA 3MB9A 2VEKA 5LA0A 1T5AA 2RH9A 3C0LA 4CU6A 3ANYA 1X1OA 3IVTA 3II1A 3T4CA 1WZMA 4AW7A 2B7OA 5LIKX 3OP2A 1OFBA 5EU9A 3HF3A 2ZIDA 2Y8KA 2QDGA 1DL3A 3JVAA 1F9CA 2E3ZA 4R88A 3TLQA 3CZ8A 4K3ZA 2J77A 1UR8A 2F7FA 2AMGA 5TIMA 2D0HA 3QN3A 4H00A 1JNDA 4U4MA 3PK7A 4Z1AA 1Q8JA 5BNKA 3LPGA 2J66A 1W9VA 4IOTA 1V3KA 3FGCB 3APYA 5HNUA 5FAGA 3TC3A 5A94A 3N14A 4CNTA 4UQAA 2E09A 2XFFA 3GXFA 5E9AA 1XDLA 5F4XA 3RITA 1J8VA 3L9CA 4OHQA 5GNYA 5C54A 3RPMA 4KCUA 2YCKX 3BSHA 3WQDA 1LUCA 3FKKA 4XD6A 1M7XA 4N2YA 3T0DA 1EOMA 4OTKA 2ICSA 1E0WA 1E1EA 2TSYA 1TJ2A 4D8ZA 4LWWA 2NWRA 3VVGA 1HKKA 3DX5A 2OYMA 1W0MA 5A6BD 1QAPA 3WDQA 4OWGA 4XZHA 3HJZA 3LY0A 2DT1A 1IWPA 5K9CA 5A6AA 1XLFA 3TOYA 1A5LC 3PWIA 5JH1A 3G1DA 3GIYA 1FUYA 4YLWA 1T8XA 4L61A 3L0GA 1C92A 3E9AA 2NQ5A 3W2MA 3KE0A 4A8LA 3M64A 1NJJA 2DIKA 4RXFA 3HM7A 1R7AA 4C5YA 2EO7A 4WKAA 4DPPA 1LZOA 3UGVA 2RGMA 2WZHA 1OBAA 1RLDA 4H9MA 3ALFA 1S1PA 5AHMA 2C3ZA 4DNHA 3LZ3A 3MSYA 1G69A 4I8DA 2PS2A 3C8FA 3B0XA 2OODA 4AZBA 5I78A 4ENLA 2OEMA 3KRSA 4UZUA 4RW3A 1MZRA 2F38A 2BVWA 4B5VA 2VC6A 1PTAA 4HMDA 4E4UA 1VC4A 5D37A 3S2CA 4WDTA 4HKPA 2ZZ3A 3KOYA 3B04A 2DEPA 2VL4A 4P8UA 3GK0A 1SSDA 4BI7A 1I60A 4U5IA 2YW4A 4O57A 3PJUA 5CJ5A 3WD0A 8XIAA 2GOKA 1SW3A 3PG9A 4Y8EA 3DHPA 3BJFA 3LS9A 4HZ6A 2WVTA 2GSHA 2DP3A 2GZXA 1B57A 1G4EA 2YDRA 4ORIA 2PA6A 3I4KA 5FEPA 1SW0A 5K9XA 2C79A 1PKNA 3SGUA 4ZQMA 4ML9A 2WCGA 2R24A 5LGZA 5F7UA 2GJRA 1X7FA 1YYAA 3P80A 3TZNA 3UY7A 2KAUC 3UZWA 3NG3A 1K3UA 1JDAA 4HHPA 3Q2DA 4QISA 4WJEA 3QY7A 1OADA 5I3HA 1G5AA 1QI4A 2X05A 2VOMA 3WN6A 1Y8BA 2YBVA 5G2HA 1VAHA 4Z2KA 1JQVA 2ZDRA 3FW6A 3TC6A 1UJPA 2OCZA 2H3BA 2VM8A 2I57A 3DHDA 3KX6A 1S46A 1TV2A 2VC5A 4ZBCA 3FXGA 4GCAA 3WELA 3H2NA 4GKLA 2BHUA 5I5RA 3G6MA 1ZLPA 2HZGA 4RUBA 4UTKA 4DWSB 3ELFA 1TFVA 1W3LA 3CUGA 2TMDA 3EX1A 1H49A 4B15A 2VX4A 2J7HA 5GPRA 5DT7A 2V63A 3SW6A 2DQXA 1FX6A 1UWRA 2HVOA 4ZA0A 2WSQA 4PCFA 2PDXA 2ZX7A 1ZNNA 4X61A 3GDBA 1LBLA 1U33A 1JEZA 2L5HA 4Q4KA 1AL7A 3RJYA 2VZUA 4O1EA 1JYXA 8RUCA 1Z3NA 1B2YA 3G1HA 3GXDA 2DZTA 2OR2A 2ZUNA 1O5QA 1A0CA 4HOZA 7A3HA 4AG0A 1PKYA 4LUTB 3WQGA 1JF5A 1P5BA 4EE9A 3CPRA 3W87A 1A5MC 3L2IA 1E6RA 4XZBA 2IPGA 1CB7B 2WM0A 4M6QA 3LTYA 1KKRA 3BGAA 1W5OA 3UP8A 1ZP4A 4O1DA 3ZS4A 1Z89A 3RAOA 3PZVA 1X98A 1Q6QA 3BLEA 2Z29A 5I3GA 3VNKA 1S2WA 3CV7A 5CSUA 3PWGA 4S23A 3VOGA 3W1QA 2WKLA 1BXCA 2J25A 3P5YA 1UUOA 2YCLB 2DW6A 4Q4RA 5A6MA 3HPZA 1D9EA 3NIYA 4DXVA 3DKJA 1W1PA 2NLIA 4DO5A 4M1BA 3EWCA 1R30A 2Z27A 3C2FA 3TMLA 3F4VA 1DJGA 1PUDA 1YE4A 3LB0A 2RAGA 3NL6A 4XVDA 1KBBA 1EGMA 4ZQPA 4D8LA 2OWXA 4Z1DA 4NYUA 3CZGA 1H1YA 1XQKA 2VRQA 4Y6GA 3VDBA 4XO6A 4Z42C 4AD2A 1IYXA 4LYRA 4Z2HA 2ZX9A 3EXTA 3MVTA 3UWYA 3M7SA 1MDRA 4L1XA 3KUMA 3IUDA 1NVMA 4KT2A 1QW9A 5AHLA 1W2PA 2ZTJA 4O50A 2YKKA 2Q8ZA 3BO9A 5U7SA 1QATA 2I9EA 1EPXA 3R11A 1DHKA 3F4CA 3CUJA 4AAJA 4CGTA 3MBDA 3W76A 3HFTA 2G41A 4UFKA 1CW2A 3SQSA 1ZCOA 3DAQA 2PDYA 1ALDA 3M46A 5AOUA 3RCNA 3UR8A 1OX4B 1J0YA 3HN3A 3GO2A 4ZQRA 2YFOA 4CVUA 1HGYA 3PZTA 3PUEA 3LXAA 1SFSA 3SN4A 1LQAA 3TX9A 3MJMA 1E73M 2OQYA 1JCXA 2GPTA 5I23A 1Q66A 1MDLA 1IE7C 4K2SA 2G3FA 4F79A 4HD5A 2OGYA 4CCEA 2GUBA 2P0IA 1FFRA 4OKDA 1XLHA 1HKWA 5EBUA 3O0KA 4GZIA 1DV7A 1F73A 5CSYA 1CGUA 4M6VA 1FH9A 1LORA 5CC7A 3DG6A 2PP0A 4LT9A 1ODZA 4QSHA 4DO6A 1TZ7A 1LG2A 1J9YA 2VEPA 3UW6A 3K1DA 4X2RA 3UQNA 3P81A 4CN1A 1F8MA 2Y62A 2C71A 5DCEA 1FWEC 4IISA 4C65A 5CGMA 1R0MA 2NX9A 5LIXX 3FYPA 3AS2A 3E38A 4LQ1A 3EWXA 5EB8A 4OUEA 1ZY9A 5DY2A 1R47A 1TPUA 3N73A 3GU9A 4G8TA 1L8PA 3C61A 3FAXA 3DFHA 4JN7A 1V0KA 1SMDA 5AZ0A 1XIJA 3FXYA 4DY1A 1GVOA 4QEHA 4UWMA 1V77A 3W1TA 3DFPA 4S3DA 1ISXA 3RO6A 2IKIA 2ZWZA 5CC3A 1MFUA 3BLDA 3LHWA 1DTUA 4WGHA 2VOTA 4I7UA 3UVAA 1DWHM 3GTHA 3W2KA 4PSPA 3MU7A 1FWRA 1UJQA 3CL8A 1SFLA 4JTTA 3UYIA 4JQ1A 3ITVA 5HUOA 2Y24A 3PTKA 1W3KA 3OVGA 3C4UA 4GUHA 2BY0A 4MWAD 3PZOA 3LK6A 4HCHA 1TPDA 3K2GA 4E4FA 1ZCCA 1AZ2A 1KKOA 3KXQA 3RM4A 4WKHA 4H9TA 1XP3A 2YCEA 3NDZA 1KBLA 3T0BA 1Q7ZA 1OB0A 3P82A 5A69A 1Q65A 3HQOA 3K30A 5EMKA 3W38A 1E6ZA 1RCXB 3LMYA 3WUBA 5I7GA 4YPJA 4RDZA 1HGWA 2DT0A 1OC6A 1TVPA 4R9OA 1SSGA 1UKTA 3LG3A 2PWDA 1NAL1 1W91A 1GW1A 3R2GA 4LV4A 2ZZ1A 4FNUA 1V3LA 4ZOEA 4ACZB 2GGIA 4NXKA 1A50A 2POTA 3BCDA 4CQ9A 5KEZA 3DXIA 1KV8A 1ZAHA 2G50A 1EP1A 4XWUA 3PBUA 1J18A 1KWKA 3WBAA 1BVWA 3RX4A 3DFYA 4XKMA 2NUWA 1QBAA 4B91A 3ZVHA 2ISVA 4D6FA 4QDWA 5A8MA 5CJMA 5M2FX 5FJJA 4HT3A 5C7VA 4X0NA 2DFAA 1ISWA 3K4WA 3VMNA 4ZOBA 1QPNA 2FVMA 4LU0A 1AH4A 2CFFA 4BF9A 3GM8A 4PUWA 4FHAA 2J7CA 4AWUA 5BXTA 5IDZA 2QJIA 4U5KA 3EOEA 5D38A 1IEWA 1JD7A 1Z6KA 4I9JA 3STCA 1QUMA 3OZMA 1ADOA 4DBWA 3FS2A 2E25A 1GWJA 1LLWA 5D2TA 1XLAA 1JL8A 1VCVA 4S2BA 1RQBA 4LYKA 1KFKA 2QVNA 2H9AB 2B7PA 3K8MA 3BK0A 4DHGA 1TELA 1ZHAA 3PWAA 4XAGA 2VFDA 4IFOA 5DFAA 3S5ZA 1UUMA 3GXNA 1BQCA 4L80A 3NWRA 3LNMA 2A3HA 4WXYA 1OC5A 3W7JA 1B1YA 4Q4QA 3N9KA 3IRSA 4AH7A 1RZMA 2VURA 3ARYA 2VFGA 3EKLA 2QW5A 1VCGA 1ISZA 3TN5A 4NRRA 4Q8VA 3O1NA 3ITCA 2PWFA 3MZ2A 1VBGA 2WO5A 3SBFA 5FL1A 3R43A 1FWSA 3H21A 4C91A 2A2IA 1CI1A 3NOYA 2RDWA 3MW7A 2QIWA 4YMZA 4FP1A 4LRSA 1W56A 1FHVA 4WJXA 5HWNA 1XIGA 2ZC8A 1NIUA 1Z8AA 2YR1A 4OV9A 1I0BA 1TVLA 1JJKA 4Q8QA 5BXPA 1R3TA 4E2BA 2WC4A 1P48A 4QJ1A 3QJAA 3UT0A 1TV4A 2VCCA 2PF0A 5A95A 3GZAA 3GAKA 3UXIA 1WYIA 3I7SA 3CIWA 4DYJA 3TW6A 3NGJA 6XIMA 2YL9A 4TX8A 3SQMA 3TN6A 4IJBA 4XTDA 2J13A 2OOFA 2ZX5A 3HPXA 1ZGDA 2G3JA 2Z28A 1S3HA 5LYRA 3A9BA 1NTHA 4AY1A 3F2CA 2GFTA 1NELA 4O13A 2REQA 1QK0A 1XYAA 1US0A 1FCQA 3LGDA 4AIEA 3NM3A 5LGXA 2Y6ZA 3N4AA 1M7PA 2FZDA 4YHEA 4B5SA 3GS6A 2J74A 1F3EA 1R3VA 2GK1A 3M7WA 1GG1A 3M0VA 1TPWA 3CPUA 3TE9A 2DSKA 4FO4A 3R5EA 4DUOA 2OO0A 3LSCA 2OLAA 3G1VA 1JDFA 1RAKA 1EF3A 1TX0A 1XLKA 2JBMA 3SEPA 3VKCA 4C60A 2DZWA 3BGGA 1ITXA 1P4CA 3CWNA 3CT7A 2VRJA 1B54A 3WY1A 2A21A 4LVGA 5DQPA 1KFEA 3GHRA 3WKZA 3JRKA 3BAYA 2ZXQA 2Y1HA 3F4DA 1QOPA 4GIEA 2GGGA 4D9PA 4AD4A 2VEFA 2GQ9A 1NARA 3E12A 2F2HA 3CUXA 5HNRA 1LRQA 3SCTA 3BC9A 3EOOA 3CHFA 4EAMA 4Q22A 3PFRA 2VGBA 3THDA 1J0HA 4O1FA 2GSEA 3BOXA 1LRTA 1P43A 1Z42A 1SU5A 3O07A 4JKMA 3UETA 5G4WA 3OBEA 2A85A 2ZKMX 3C86A 1XFCA 4QRNA 4GVGA 3S47A 5IHRA 3WLQA 1P0DA 3TTEA 3VPLA 3CAWA 1TQXA 5HJXA 4XSMA 1BWVA 2WMKA 3VDCA 4C1KA 2J7BA 4AVOA 2MUCA 2HVNA 3GBDA 4ES4A 1OF8A 3CYJA 1PIIA 5KITA 2IPFA 1I75A 5TAOA 4K7VA 1JZ6A 2QUTA 5ABGA 3GC2A 4GNKB 4V15A 1XH0A 3ABSA 1FWNA 2ZUTA 3ITTA 5C7HA 2WMHA 2OLSA 3S2MA 1WDDA 3R10A 2P8BA 5C6MA 1L0PA 1NP2A 1J01A 2O56A 4XBSA 3CUIA 1W1A1 4S38A 1P7TA 1K6WA 4H41A 2EEXA 4W86A 4JN6A 4Y9OA 3ZLFA 3H2AA 2JIWA 2X42A 1GZJA 3GHSA 2GUYA 4AQLA 5U4NA 2GJNA 4L56A 3IACA 3NL5A 3A9IA 5CCZA 3QHOA 4Y9PA 4NJKA 4GISA 4O17A 4IGSA 3EA2A 5I0DA 3LU2A 3THCA 1PKLA 1H7NA 5D04C 3T7VA 3WF1A 1HIZA 4H01A 2TRSA 2PWEA 2FFIA 2PGWA 5LA1A 4GC4A 3T9PA 3LCXA 2VGFA 4QG6A 1NWSA 1RP9A 1EJSC 1C8XA 2X2YA 1G4SA 2HSAA 4AC7C 1PYMA 1FWFC 1GK8A 4UFHA 3SRKA 4RX0A 4CD7A 4CU7A 1LT8A 1LWHA 3W24A 4J1OA 1O7AA 5HATA 3BJSA 4S39A 1XLLA 3SCQA 3W86A 2QF7A 4UTWA 5HMFA 3BSMA 4XD5A 3A4XA 3WF2A 1J0ZA 2GQ3A 2NXIA 3OYZA 4C6DA 5BROA 1P0NA 3DEQA 1V3MA 4NZ1A 5TBOA 2C16A 3U57A 4RZ6A 3H4GA 4UFMA 4XBKA 2QVHA 3CL7A 3R0KA 1M7JA 3E3HA 2CLPA 5FF0A 1VRDA 1E4MM 2OG9A 1DYSA 3DBPA 4A8NA 5LHFA 1YXDA 4NZJA 1RALA 2HBVA 4IH3A 1F6KA 2E40A 2QQ6A 3HU7A 4BWLC 4HZ7A 3OA3A 1LDCA 2QUUA 1KTBA 3N6QA 2PBOA 3W29A 2JFEX 2P0OA 5BMWA 1DWIM 3SCVA 3KRUA 3THUA 4NAFB 3LCIA 4F48A 4FR1A 4GVFA 2D3NA 2WQDA 4FS9A 2CKSA 2HQAA 2WQPA 3HOJA 4POCA 3CM4A 5A2BA 1TPH1 3LCHA 3K46A 3DH7A 4GQGA 5H8UA 1TZZA 1JYNA 1HL8A 1S3TC 4MSSA 1VFOA 3RIKA 2XVGA 2VWSA 1K7EA 4YYCA 2JF6A 4O10A 4GX9A 1XSIA 2Z6JA 1EL3A 4DNMA 1MVYA 1GTHA 3GDRA 1SO6A 3VD9A 5FF3A 3QC0A 4LB4A 5H2ZA 4OBTA 2XZ7A 2J24A 2GGJA 3LBMA 1T40A 4NI8A 3C2OA 3GU1A 3ZFHA 4X22A 3S1UA 3BMXA 4IGNA 2BY3A 4M56A 3RFAA 3W71A 5HNNA 4EF8A 3PAOA 2CEQA 1Z69A 5J04A 3IJQA 1XCXA 4F4RA 1XXXA 4PFMA 3BG5A 4WOQA 2X1TA 5CJNA 1KA9F 2I5IA 4XTIA 5HDRA 1A5SA 1NDZA 3L5LA 4CQ8A 5I02A 2XM1A 1F07A 2PWVA 1HZYA 3GB6A 1SZFA 1JPDX 3DI0A 3CTLA 2JGQA 4ZOAA 3S9YA 1XDMA 1LLZA 3ZZ1A 3W53A 1V08A 4OE7A 3W84A 4LEQA 3N25A 1GJWA 3W70A 4B5WA 3RHGA 3HJEA 1GOOA 3GXMA 3WF0A 4FIQA 5CPOA 1XGZA 3URNA 3VUPA 2GDVA 3AHZA 3LGGA 3AZTA 2QAFA 3W1UA 1I6NA 2D20A 1DQXA 3K8LA 2I5QA 5RUBA 1TV7A 2QT3A 1XG3A 1J0JA 1JGIA 1VCFA 3QYQA 4Q8NA 3H23A 4TIMA 1BYBA 3VNDA 3CZEA 4LY4A 3GH5A 1HJQA 1MQRA 4HJWA 4J3UA 1W1B1 1MWOA 4REQB 3B9OA 4NL1A 3RLVA 3JZEA 3OB8A 4LC8A 3QOKA 2G8ZA 4JTLA 4MGGA 3L4TA 2XHYA 1XRVA 3SJNA 3EWBX 3OGVA 1TA3B 3URAA 5GNZA 3B9AA 4BS0A 4Q4PA 3ARZA 4NI3A 4S3FA 4IG2B 1I2QA 1XLJA 1HJVA 1K7XA 3TKFA 1I2OA 4KEMA 3UA4A 3WQVA 1AODA 3EDDA 4GI6A 4MADA 3BWWA 5F4SA 3POHA 4XAYA 5D2XA 2Y8VA 1FCVA 4RW5A 4AEEA 4IWWA 4O16A 1VENA 2ZBTA 4U2YA 3W25A 3WQFA 3HZ3A 1DP0A 2V82A 2F9RA 4ACYA 2R14A 2WPBA 3MKCA 2WPGA 1A5UA 4PEEA 4QITA 4Q8TA 4ZTYA 1AMYA 4EANA 1EEXA 4LCQA 2R1MA 4W7UA 1LL6A 5D03A 3GW0A 1FH8A 3VGHA 2VELA 3L4YA 3QPZA 1W3IA 1W9BM 1NWRA 3LRKA 3NA8A 5I3JA 5EA9A 4NYYA 3S46A 1W17A 1GOQA 4CNOA 1UWSA 1GVRA 1S2CA 1PB0A 2W63A 4A3QA 1XIDA 4BQ2A 2ABBA 1Q63A 1UZ4A 2E6DA 4XG1A 5AC4A 4D6CA 3R0DA 2ANUA 5F2GA 5D30A 4JTQA 1FOBA 2HE8A 2V9DA 5A2CA 3QGAC 3AMKA 1LCOA 4HVXA 3KFTA 4MM1A 4X0VA 1GQNA 1L6WA 4GUGA 4N42A 1X8FA 1M68A 5M03A 5DANA 3UWWA 1BLIA 4GC3A 3GYEA 3RU8X 4E2OA 2QCCA 3W75A 1H41A 3DBNA 2C14A 1ENUA 5D9PA 1TR1A 2E5CA 2ZUVA 2DQWA 1I8JA 5IBXC 4B3LA 5CAKA 1FDJA 3P60A 3WNNA 1ISVA 2VR2A 3KP0A 4A2RA 3WMBA 2ISFA 2WMFA 4AEFA 5H91A 9XIAA 3HV8A 4HN4A 4JFUA 2AKMA 3QHMA 2A5HA 4AY7A 1JPKA 3W72A 4A3YA 3GG8A 3HQPA 4W4QA 1EWEA 3GUGA 3QKEA 2PUZA 2FDMA 1IHIA 3TYDA 6REQA 1M65A 2HTMA 4N9DA 2QGHA 1E72M 4KWVA 2A6LA 2PSNA 4AZCA 4CUCA 4I9TA 3HPFA 4ZO9A 4PTXA 2IKJA 1MRQA 3IIVA 5XINA 2NV9A 4A4AA 6ENLA 1RPKA 3L2LA 3UXDA 2PC4A 3ZJ8A 3H8AA 1NOUA 4MWAC 3AALA 3VUSA 1EYWA 3B0UX 1R9ZA 3QPEA 3N9SA 3VX0A 1T96A 2IQTA 1QNVA 4PB5A 3EGJA 3REQB 1ZS2A 4KCTA 4Q3MA 3GU2A 4OVXA 3A3HA 2XZ9A 1OFEA 2V30A 5C9UA 2Z1BA 4KIRA 3MUCA 2EXOA 1LROA 2ZC1A 2P10A 4H8VA 1OD0A 4EWJA 3W83A 1TV5A 2HV5A 3GR7A 1I1WA 4JDYA 5GJNA 4HMCA 1UR2A 2ZA1A 3DG3A 1DORA 1TO3A 2CBIA 2IPWA 3KHDA 3EB4A 1ZL1A 1OT2A 4UR7A 3OBAA 3FA4A 3GG0A 1EBGA 5FCZA 1NSJA 1WXYA 3LPPA 2XYLA 4MYXA 2Q09A 7TIMA 5HOSA 4E3TA 3U5YA 4Q32A 2XIIA 1XH2A 4PE8A 1Y65A 2E9LA 4DUWA 3O9NA 4C6IA 2TPSA 2FZ9A 4TX9A 4KS0A 4M80A 1W1YA 4QNWA 2Z7GA 1GOMA 5AC5A 5KZ6A 3U7BA 4WKFA 3TROA 3WLJA 1UWAA 2A3BA 1A49A 1IT0A 1XUUA 2ZICA 3W4RA 3UY8A 4DJEC 1Y5VA 2CHOA 1CDGA 3BLPX 3QV9A 2F2KA 5IBXA 3TW9A 3CJPA 3SURA 1XKJA 1XHGA 4M1RA 3RLHA 2OU4A 3QFWA 3SCNA 3R94A 1SJDA 2V5LA 1Q6GA 1LF1A 2W9MA 3GSMA 3TP4A 1XYZA 2HVMA 2OO6A 2ZCGA 1L8NA 4KF1A 2EKCA 3KTXA 2ZRVA 1BXNA 3NQ2A 4UOJA 4N7QA 1JZ7A 3LHZA 1NFBA 5C71A 1BF2A 1EBHA 4IXXA 3AU6A 2DGAA 3B03A 3LHUA 3P84A 1IXQA 2CLOA 2P5NA 4PYSA 4JBRA 3V0TA 4EXAA 3AWNA 4NJJA 4IMDA 3S6OA 3ONCA 3V75A 1UIPA 5K7JA 2FTYA 3LPOA 4I5UA 2INEA 1ZBCA 1YPFA 4NUWA 2D22A 3O16A 3EEZA 2CZEA 2J78A 3T6CA 1P6WA 4PMUA 4PB4A 3U3HA 4B92A 5FEWA 3ZOAA 1JD9A 3LRLA 5G4HC 3GXTA 5AC8A 5G5IA 5JQ9A 1US3A 1JI2A 4FB7A 1R2RA 4AYSA 3RR1A 1XW8A 1ZB5A 3QLDA 1M9HA 1OCQA 4M6UA 3EWDA 5IOBA 1O5KA 3SADA 3JZUA 4LAOA 5D9OA 2G3IA 3I7QA 1NF7A 1PL9A 4MKNA 1L6GA 1FWIC 3ZXWA 2B7QA 2BMBA 1PX3A 1RA0A 4GI8A 2DIJA 4TUFA 4LFYA 3W1NA 4KCWA 1TJPA 2PTDA 3Q67A 3KCLA 4LEFA 1Q6CA 1R3SA 3U4FA 2JKEA 4W5UA 3HPAA 1PIGA 1RVGA 4MNMA 3TVAA 2GYIA 4XAFA 4IMGA 3N19B 1HW6A 1IZJA 1KBJA 2BODX 4Y9AA 1J4EA 1VFUA 3PULA 1GVQA 3IRDA 3BW4A 4JNZA 2HROA 3MANA 4A8IA 4ZTXA 3WEZA 4MKSA 3T0CA 1MXGA 5FACA 3WLPA 4HNOA 4MLRA 5HQEA 5H1WA 4A2SA 2BASA 1GONA 1YW1A 4HU3A 1T99A 1PX8A 4W8BA 1LJYA 2G37A 4DJEA 2OWCA 1B9ZA 1FRBA 4F2UA 3BANA 4JAWA 4Q4OA 3MUXA 2ONEA 5A8NA 3W82A 1K4GA 3ORWA 4FXSA 3CUFA 4M19A 3W7MA 3WF3A 2YA0A 4ZXLA 3ABOA 1OF6A 4W84A 3N2TA 1JULA 4WR3A 4KMQA 1K9EA 3DUGA 1MW3A 2TODA 1H7PA 3IV3A 4LUJA 5B7YA 3THAA 4AD3A 3EX4A 3INPA 1VFFA 4UNLA 1QNPA 4UNIA 1WA3A 3NSMA 4U2ZA 3IUIA 1Z41A 4H8NA 4ZE5A 1G94A 3M0MA 3QOMA 4C1NB 1R46A 3PP7A 3PBMA 4LAMA 1TPEA 7TAAA 2J6VA 4NAEB 5ENLA 1UR1A 1ZFJA 2R9RA 5C8BB 3JU2A 2CZDA 1GT8A 1X96A 1ZAIA 1KQZA 3TAOA 1RH9A 4DO7A 3ZJ6A 4HZMA 5D9MA 2VNCA 3VAVA 5FSDC 2OJPA 3TA9A 2PDMA 5B7ZA 1QVBA 1FP8A 4QJ4B 1VR6A 1NFGA 3LQLA 1UBPC 3EKGA 3I6RA 3SM0A 2OT0A 4Y8FA 3UWQA 4MAVA 5CAHA 3EX3A 4LNCA 4GVHA 5FSEC 3W1PA 2XSBA 4UUIA 2ZX6A 3W2NA 1H1NA 1HKIA 4IMAA 1AQMA 2VKZG 2OZ3A 4OZOA 1PX4A 3CTTA 2WYSA 3S2NA 4C6KA 3TNOA 1RK5A 1S2UA 4IHCA 3ONBA 2JEPA 2DH3A 2J75A 4AD0A 1O66A 2BY1A 1LQ2A 3AJXA 3IAQA 4ZL1A 4DLMA 2ZFAA 2DV0A 1D7KA 2GUUA 1RLCL 1AD1A 1W8SA 5DF0A 3RLUA 1CT5A 3MDWA 2DSUA 4WY0F 3H70A 3TMQA 2F84A 2C8NA 4RDWA 4GIRA 1Q6OA 2O9PA 1EDTA 3G8RA 3OHIA 4O15A 5LNWA 3AS1A 4LW7A 3L2MA 1EC7A 3IUHA 4XUYA 2GDQA 1ELSA 2UBPC 3UNTA 3BAXA 2F6XA 4CD8A 2QMJA 3MP3A 1V6XA 4AZGA 1QI3A 5E9XA 1CPUA 3C3NA 4HZ8A 4O1BA 2YSWA 3K4AA 4P8WA 1HP4A 2XISA 2QR6A 1LUCB 1J11A 4FEZA 3TK7A 2WXDM 3AIEA 5D4YA 3MY9A 1DEDA 3W1RA 2WLYA 1OWQA 4R5EA 2PI6A 1HT6A 2NV1A 3APGA 3HURA 3ARRA 3A3WA 2VTFA 4V33A 4JICA 3R13A 2GWNA 3KDOA 1MRAA 3UPWA 2ZWYA 3KCOA 4PTDA 5E93A 2W27A 3BMVA 1UKOA 3WJYA 2NVAA 1FHUA 4M8UA 3P5ZA 2W3ZA 1IXPA 3YPIA 4NG3A 4BQ5A 3E0LA 1PAMA 1QI0A 4PCTA 3W7LA 3UG3A 1FP9A 1DKWA 4Y96A 3WH5A 3CV6A 4DWSC 3N3MA 3NO5A 4TTGA 2ZE0A 4PUKA 3D47A 4ZQNA 5EMLA 1REQA 2RGLA 3TLLA 1UZ1A 3NQVA 4INFA 2QPUA 1W37A 3R8HA 4HNLA 1PIFA 4IL2A 3OIHA 1RBAA 1PWLA 3RYSA 3S1VA 4DX3A 5FAJA 1VH7A 3E1F1 3OYXA 3CLMA 3B4UA 4L9ZA 5DCBA 5T26A 5CEWA 1Q6FA 1O95A 5HXMA 4G5DA 4PODA 1MYRA 1L6FA 1WX0A 2FLIA 3I3EA 1RHCA 2Y4SA 2ZRXA 1V51A 3ZJKA 3ISIX 3DYPA 1FCUA 4ZFCA 1H0IA 3DYMA 2XIMA 2DIEA 3A6OA 4ICNA 1IZKA 2QJNA 1QK2A 4UTTC 1E5JA 2OSXA 2QGYA 1RY8A 3V0UA 3VD7A 5A6KA 2Q3OA 5I2UA 1ONXA 2IS7A 4JQ4A 4AIBA 3D5HA 1OGSA 3AO0A 2QUNA 1OIMA 3MPGA 1XUZA 2WWDA 3VI2A 2W5FA 2BHZA 2DUZA 1JYWA 2D2OA 2Z4GA 2HS8A 4FA3A 1YXYA 3ENLA 1PKMA 1PZ1A 4JTRA 4JR5A 3LGEA 3MDUA 3C6CA 3DENA 3G22A 1G1YA 1CGVA 1KFLA 3WIJA 4DJDD 4YCOA 1PE1A 2VXNA 1F8IA 3WLNA 3Q37A 1UZDA 3DESA 4G56A 2R1LA 3D6NA 4N9EA 3KS5A 3V16A 4FOUA 4DI8A 4E3VA 4HU4A 1VFHA 3HGJA 2PCEA 2VRKA 5KMYA 4HNVA 4YTQA 2V8ZA 1DE5A 1F3TA 1QNQA 3TA6A 3N4FA 3KOFA 3G1RA 4D6DA 1G4TA 1H61A 5CPNA 2ZVRA 3WDHA 3PUOA 5F1UA 4B3ZA 4H9VA 4O8AA 3C2EA 1DJXA 4J2MA 1UH2A 3U2ZA 3GNPA 1VQTA 1C3FA 4MZ1A 3HBLA 1KRCC 4UNKA 3S8HA 2EPLX 1UASA 3WCZA 1TIWA 2ABAA 3TDFA 1KM1A 5TNVA 3HG3A 2PDUA 2QXWA 3L4VA 4K8GA 4GG9A 4C6BA 2VGIA 4PTWA 2HPMA 1R87A 1KO0A 3NSNA 3DFNA 3G6LA 3VIKA 3WQ4A 3W2UA 3BICA 1C7SA 2GDUA 3ABXA 4RE3A 3R6IA 4HOXA 5AYZA 4GYPC 2WNZA 1ZJBA 3S5SA 1B9BA 4XZIA 3ABQA 2XVNA 1X1NA 2Q6ZA 2CZFA 2WJFA 3WLTA 3UNDA 3FN9A 1P6CA 4MJMA 5KZMA 1O68A 3BXWA 3ZIZA 1F3WA 1T0OA 2XFYA 1GHSA 1D7FA 3QMRA 4HN8A 1V6YA 2QIIA 3W2LA 4UTTA 1WKFA 1DE6A 4R33A 3ARSA 1MZHA 3QTPA 4OUIA 2EG8A 4FLSA 1PHQA 3UXAA 4AD5A 2V5DA 3PB2A 3WEMA 1YRRA 3RPTA 2CC0A 2XVPA 3ZT5A 3EX6A 1ZP3A 1MMFA 3N13A 4KRUA 1THFD 3TCEA 1AMKA 1FWWA 1TCMA 2YL6A 3OOQA 4UBPC 1RD6A 4W85A 2UY4A 1H09A 4HU8A 3GVQA 2PDJA 2XN1A 3H2MA 2A0NA 2HDJA 1R2TA 3GKAA 2W4XA 1D8WA 1XLCA 4TXEA 2YZ5A 4IGHA 4WLCA 3UR5A 3O6AA 4DM2A 4ZE4A 3CLWA 1MI3A 6A3HA 1PDZA 2HEJA 3N15A 5BRBA 3ES7A 3W1LA 1UQYA 3NQDA 3R58A 2XWDA 4I9MA 1IV8A 1VLWA 5FJTA 4I9AA 2HRWA 3B4YA 4FXJA 1BKHA 3MS8A 3M0HA 3I10A 1RQEA 5DCDA 3S5OA 3IIPA 2IKHA 1YQ2A 4RNHA 2POZA 4GJ1A 4WHBA 5PTDA 2E28A 4JTCA 2XGIA 2A79A 4C5ZA 4TMCA 3H26A 5D8ZA 4GY7A 3G1SA 4IIFA 3WL1A 1JCLA 1GEHA 1TQJA 1RSCA 3FVDA 3WLRA 1SJCA 5G2WA 3VIMA 3BG3A 2FQIA 4KFOA 3HG4A 4E5TA 1WKYA 2J8TA 3WYZA 5AYIA 4K1GA 4J3VA 4HK7A 3IJ7A 3N9RA 1IGWA 3P67A 1E71M 2C7FA 4RR4A 2O55A 1MFVA 1OG0A 2QYGA 5A6JA 4AWEA 2VZOA 2ACSA 2QPSA 2P1FA 3WMSA 4B90A 1S1RA 4CD5A 1TWWA 4I7WA 4TVDA 1EQCA 1R3YA 2ISSA 4J3ZA 3WMLA 2VENA 3AZSA 4QLJA 3CIXA 3GTFA 3SJ3A 1LYXA 2AGKA 1CGWA 3V4BA 3VZZA 1UCWA 3FIGA 1TE6A 4RXGA 3M5XA 1VPYA 4Q8PA 3M0JA 3E5PA 2O7QA 4JKKA 3BL3A 1EA9C 3G0UA 3MCOA 1GZGA 8A3HA 3MYOA 2PCQA 5T9BG 3I7RA 4BA0A 3O6DA 1CZ1A 2FTPA 2X30A 1HKVA 3O7UA 3TYCA 3M5VA 3U7VA 4XKYA 2F8QA 2YLAA 1EC8A 3T78A 3UYCA 1CTNA 4G1NA 2YPIA 1YKWA 4IUGA 4KPLA 3TZFA 3VO0A 1LL7A 4AX7A 2ZUSA 4J40A 3WL0A 4GK8A 2FKPA 3MSRA 3QXBA 1GVFA 3MI6A 4LSBA 3CWOX 1VBHA 3GW3A 3WX7A 1ITUA 2CKRA 3H12A 3WDIA 4HBKA 3IJ9A 2WANA 4X63A 4LC6A 1GUVA 3WJWA 1WBHA 4JOMA 4QM1A 4D1JA 3UWVA 3DFQA 4R27A 1XLBA 3VOFA 2XIJA 4JQ3A 2PTYA 4H9YA 5LHEA 3E2VA 4C6LA 2H8ZA 2DZPA 2WVSA 1UROA 1GZ1A 1RBOB 1V79A 3WBXA 2PDGA 2WZTA 3ZVHB 2OVLA 1GPFA 4QAWA 3GIPA 3ABRA 1TWSA 4B2DD 1C8QA 4IX0A 1W5MA 4QTGA 2V2CA 3T2PA 4IL0A 3TN3A 3BAIA 3UA3A 5A3HA 4LBSA 2OX4A 3CEUA 3W37A 3FHAA 5H8MA 4FIRA 5EMJA 3F2BA 1E0UA 5FF7A 4L7ZA 1OFQA 5IHSA 5EPDA 2PLJA 1U1UA 3C0SA 2YFNA 4WGXA 1ICPA 2XIBA 1H50A 2FJUB 3MMTA 1JDCA 1M5WA 3M9YA 1UR3M 4AHPA 5DBTA 4QJ5B 4QE5A 3VYLA 1A5NC 3MUAA 3B8WA 3VM7A 4JFWA 1SZNA 2QCLA 1JG9A 2Z24A 2ZRWA 3BV4A 4H2HA 4JIIX 5DN1A 3CGTA 1XIIA 1YX1A 3GNXA 1DXEA 1BVZA 1IZCA 1V7YA 1ZZMA 1RCOB 1E1CA 3GDMA 2PODA 1UUQA 5A6TC 2WBKA 4LV9A 1SMAA 1XINA 1NP0A 1KM2A 1B31A 3HGOA 1W1IE 2B4GA 4MJZA 3S42A 2G97A 4N02A 4RKAA 1OFAA 3LENA 4UMCA 1Q7MA 1X39A 5J5RA 3LI0A 2NQZA 4EP8C 3C2RA 5DMMA 3TNBA 1GYNA 3MJYA 2PU1A 2QJHA 2XH7A 3CMFA 3U9IA 1BWLA 3TTOA 3S5NA 4K39A 4JIEA 4OOZA 3I6TA 3AXHA 2PD5A 5DY3A 1VYRA 3H7UA 3HPSA 1K8YA 4XAPA 4DYKA 3KBWA 1NF0A 2WK2A 3FY1A 3G8EA 2YXOA 2QCMA 4AF0A 4IQDA 5CGTA 2DZAA 4F0RA 1Q4WA 3M1ZA 4B16A 1JI1A 1W8GA 1KR0A 2CHNA 3UR7A 1IXOA 3TYAA 1ZBVA 3TIMA 1CEOA 5G1MA 2VI0A 1E6XM 2NWSA 3SCWA 3IARA 4TX6A 4S3EA 2Y5EA 3WFLA 1ZQ5A 2REQB 1IEQA 2Y7EA 3AJ7A 3PVFA 1TZ9A 4GUIA 3WK1A 1LOQA 2XVLA 1MSSA 4ORMA 3CUHA 1JZ3A 5G2IA 4XZNX 5C0QA 4QS6A 3WFAA 3T2OA 3U5UA 2GK1B 4JHMA 3DOPA 3AYVA 1WXZA 1DTNA 4NXSA 3MUZ1 2J9YA 3MI3A 4KEZA 3M43A 5E70A 2DZVA 3VCNA 3EB3A 1EJXC 1QPRA 1KGUA 3FVMA 3VC6A 1CENA 3RPDA 2QUMA 3PC0A 4AZ6A 1ZJIA 1IQ8A 1KM4A 3MYPA 3KOWA 1UQZA 3UJEA 3KBNA 3W7IA 1UD3A 3MKKA 1K8XA 2JKPA 3BG9A 1ME7A 2VEGA 1TJ1A 1G9HA 2NVCA 1J10A 3SIZA 3B40A 1GJUA 4S3KA 2VQUA 3LHVA 3GRIA 1BYDA 1UWQA 2PGFA 3QKZA 1ZU8A 4UB9A 4HA4A 1W5PA 3UR2A 4G2DA 4FNSA 2GQAA 5FJOA 2I7GA 2O4MA 4QDPA 5DXYA 3UWUA 2J9ZA 4JIQA 5LSMA 3L0NA 1VFLA 4EPDC 2JALA 1OZQA 1BWKA 1F5ZA 1KR1A 4RE2A 2VDGA 3NZ1A 2DZXA 4FX8A 2YGYA 2WSYA 3MV11 3ZSSA 3SCPA 2B7NA 3W81A 5EFDA 4O4WA 4GQQA 3T4WA 1VIZA 3WD2A 4QNEA 1SR9A 5GNXA 1G7UA 1T7LA 3A23A 3AWOA 4FR6A 3GLCA 4QJ3B 3F4WA 3PTDA 3DN5A 3WD3A 1CXIA 4XVEA 2FPTA 1R9YA 2OKOA 4ZFMA 4C6NA 3WLSA 3AUOA 1B3VA 4IMEA 3S4TA 3BAWA 3CH9A 4GZ7A 4G9PA 3WQ5A 1K70A 1YMYA 4G7FA 4U33A 5T91A 4A21A 1KXTA 3VKJA 3NYZA 3VIHA 2WHKA 1EJVC 2Z2BA 5C70A 4DZAA 4FNQA 1KW1A 3DHFA 4I7VA 5E1QA 5JUVA 5KZEA 1D2KA 1YIXA 1I4NA 4YVXA 2ACQA 2WC7A 3VMPA 1UH4A 1QOQA 4FLQA 1WKDA 4N4PA 4R7WA 1P7TB 4HMNA 4ASTA 3MO7A 4HOWA 3I4EA 3E74A 1SUXA 1H2JA 1Q2SA 2F6UA 2BV9A 4ONVA 4NZCA 3IV8A 3PPGA 4LNYA 3SSJA 3RF9A 1KGXA 3AMDA 1GNXA 3LNPA 4BK9A 5MHBA 1T8QA 3N18A 4IPPA 3KAOA 2AQVA 4ZO7A 3VD5A 5ABTA 3F5LA 2PDCA 3BUVA 1OEPA 4UTUA 5ECVA 2MNRA 1GOWA 3QV7A 3ERPA 1EKOA 1TTPA 4DN1A 1E56A 1EDQA 1JZ5A 3RK8A 2SFPA 1A4LA 1BEUA 1GW9A 4GBUA 4FF7A 3KHJA 2OFJA 4O11A 1WZAA 4JFVA 1WCGA 2WCAA 1AJ0A 3UJ2A 3AISA 1V4YA 1PDYA 4TMBA 5HANA 4YWSA 2WNQA 2I5GA 4NSBA 2BFGA 5A8OA 3O15A 1EC9A 2ALRA 1EP2A 1V6VA 2Z6IA 1A0EA 2CLEA 2Q01A 3RM8A 1KTCA 4LVBA 1PZ0A 4BI6A 2A6NA 4HA3A 1WDSA 4L6OA 1H51A 2E7FA 3GDKA 3UJFA 3TYEA 5GJMA 2VX7A 4B5TA 1RBLA 1DWFM 4QQ3A 5FJRA 4MB3A 2BNJA 1E4LA 4DUVA 3S1WA 3AMGA 2ZXDA 4GWEA 3W7PA 3RRAA 3ZWTA 3VGEA 2E9BA 3HGSA 3G0SA 3XISA 1DJIA 1S2AA 2GVEA 4JTDA 3A47A 1BG9A 5KSWA 3T08A 1OYAA 1SR0A 4Z1BA 4M81A 1POJA 4ILSA 1DQWA 5JU6A 1IEVA 3CV2A 4ADUA 5AYBA 1XDJA 4C6FA 3BOFA 4YYFA 1E70M 5A2AA 1V3JA 2O9OA 2DUAA 5CPMA 1UH3A 3SCUA 1UKSA 4KRTA 3TQVA 4CNNA 4OBSA 2BBFA 2X16A 4NILA 4L4LA 3AHXA 4HSOA 1A5AA 4A3UA 3VD3A 4DJFC 4JQ2A 4U28A 3WQWA 3A22A 1K9DA 5HJYA 1R3RA 4I8YA 5FL0A 4NJHA 1WDQA 1XX1A 1TMLA 1IEXA 3RR4A 4PCSA 4EKJA 1XYMA 5D02A 4QR6A 1G67A 2IQDA 3BE7A 3EMCA 4O14A 3CAKA 3W1XA 5I09A 5E09A 4ERGA 1NDVA 1ZPTA 3ZMRA 3TYUA 1NDYA 5AHIA 3UGRA 5ABFA 4MY1A 3W88A 3W7RA 3D3AA 4QE1A 2WAGA 2C6QA 1V6WA 2J88A 3KVKA 1JR1A 4WUIA 2OSYA 4LBRA 3V5CA 2EPMX 1A5CA 4FX7A 3N3TA 4YHGA 2J7EA 4O4VA 1HJSA 2XH4A 4HB7A 1GVIA 1JQXA 1YNYA 2QV5A 2JIEA 2ZQ0A 1VYPX 3T1GA 4KCVA 3OHMB 4Z1CA 4BCEA 2AOSA 4ZMGA 2HS6A 4C6JA 1PV8A 5FJIA 1N2VA 3G77A 1XGEA 1IIHA 2DPEA 2WVVA 4BQ4A 2D69A 4B5XA 1EO5A 4I3GA 3GKFA 3AS3A 5LNVA 5LNSA 3CUZA 1RJQA 4OV4A 2CLFA 4N9BA 2BXVA 4CN6A 2VD8A 5MKGA 4B5UA 4AZ5A 4F0KA 2QULA 1FHDA 2PGRA 1XSKA 2C13A 4GGHA 1XBZA 1J6OA 4NX5A 2PLCA 3UJRA 2D23A 4PCPA 4RZ5A 3FKRA 3W27A 1EGVA 2WZIA 2C0HA 3AXIA 4NY2A 4LCRA 3FSTA 2IPJA 2V0TA 1QWKA 3K8KA 1FWAC 1KWGA 4NVTA 1D3HA 5DEZA 1RK6A 4XB3A 1HXJA 1RCQA 1H11A 3GUWA 4DQWA 4PRTA 4WVXA 3WQOA 5CZSA 3RX2A 1R5YA 1WO2A 2PU0A 3C52A 4PUJA 2H90A 3E2SA 3NQ6A 2PTWA 1E4NA 3S2JA 1C90A 1TWDA 3N6JA 4WD0A 4DJFA 1SW7A 2ACRA 3UZ5A 1E1FA 3EA3A 3O0FA 1H5YA 2WSPA 1UA3A 4C6MA 5GQBA 5REQA 4BF5A 2XH0A 8TIMA 4NZFA 5FEXA 4FMVA 3WLLA 2YJQA 3QGKC 1OC7A 4AWSA 1QW8A 4HCLA 4D8AA 1B3ZA 5CXPA 4Y7EA 5A6LA 1M04A 4DF0A 2VHLA 3GXIA