1OY0A

The crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
262
structure length
248
Chain Sequence
RTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFTPGDAAEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFSGAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ketopantoate hydroxymethyltransferase
publication title The Crystal Structure of the First Enzyme in the Pantothenate Biosynthetic Pathway, Ketopantoate Hydroxymethyltransferase, from M. tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 87
structure length 248
sequence length 262
chains with identical sequence B, C, D, E
ec nomenclature ec 2.1.2.11: 3-methyl-2-oxobutanoate hydroxymethyltransferase.
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02548 Pantoate_transf Ketopantoate hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1oy0A00
1Z6KA 1KBLA 1S2UA 1PKYA 1XG4A 3KHDA 1O5QA 2KX9A 4QG9A 3QV6A 1M1BA 4YNGA 3N25A 2DIKA 1IZCA 3KTXA 3LYEA 3QV9A 3SRHA 4FXFA 3FA4A 1UJQA 3QZ6A 3SRDA 1F61A 4QG8A 1A3WA 4L80A 1T5AA 4QG6A 2XZ9A 3HQPA 3B8IA 1F3XA 4KRZA 1PYMA 2G50A 3QV7A 4QGCA 4JPGA 1GGOA 1O68A 3BJFA 3OYXA 1DIKA 5JVLA 3H6OA 1A49A 1AQFA 1F8IA 3E0WA 1OY0A 1A3XA 3BJTA 3MA8A 4MG4A 1JDEA 4DRSA 1VBGA 2R82A 1PKLA 3EOLA 2OLSA 4KS0A 3EZ4A 3QTGA 2QIWA 4HYVA 4TV6A 3GG8A 4L9ZA 1U5VA 3IS4A 4B5UA 1E0TA 1ZLPA 4RPPA 2L5HA 3VAVA 4IP7A 1SGJA 1A5UA 4ROQA 3I4EA 2V5KA 3T07A 4L7ZA 2HRWA 3FA3A 4KCTA 4YJ5A 1DXEA 4FXJA 2HWGA 3HQOA 2VWTA 2XZ7A 2DUAA 5TAOA 3M0KA 1MUMA 2VWSA 3E0VA 1KC7A 1DXFA 4KCUA 3GQYA 3QLLA 1S2TA 4B5SA 3T0TA 3OYZA 1F8MA 2XDFA 4B2DD 1OQFA 2HROA 4B5VA 4HYWA 2VGGA 1PKNA 4B2DA 1XG3A 3LG3A 4LSBA 2WQDA 2X0SA 1DQUA 1ZJHA 3HQNA 3M0JA 3T05A 3U2ZA 2V5JA 3EOEA 3PP7A 2VGIA 4IMAA 1PKMA 4KCWA 1S2VA 4KCVA 3SRFA 4B5TA 3EOOA 3P0XA 2BG5A 1U5HA 1VBHA 3E5BA 4G1NA 4B5WA 2ZE3A 1M3UA 3QQWA 3GR4A 3G2GA 2HJPA 2VGBA 2E28A 4IQDA 1S2WA 3PUGA 4B5XA 3ME3A 4L9YA 3R4IA 1F3WA 3OQ8A 4WJ8A 4IQEA 4TV5A 1IGWA 3SRKA 1O66A 2VGFA 1E0UA 4MF4A 3QV8A
chains in the Genus database with same CATH superfamily
2AOSA 1MW2A 4AZHA 4P7OA 3VM7A 4HA3A 2X09A 1I75A 2NXGA 1X8CA 1SSGA 3SIMA 5EU9A 1V02A 3AXXA 4HK5A 3DUGA 5CSUA 3LXBA 1S39A 4EIVA 1R46A 1P4CA 5I3GA 3OVRA 3W7DA 3JRKA 2ZZ7A 1IT0A 4GGBA 3WLSA 3C3UA 1B3OA 3F4VA 3GVWA 2F9RA 3TYZA 2NZLA 1YEYA 1L6YA 3GDBA 4F0LA 1G4TA 3M0KA 2NWRA 1MUMA 4N42A 2B7QA 1IEVA 4TO8A 5I3IA 2DVXA 1TWZA 3IIXA 4JN6A 2WKGA 3NZQA 5I7GA 4O10A 1TSIA 2QCHA 2Y88A 4ERGA 3Q94A 4UR8A 2Q3OA 4C6EA 3TXVA 4NAEA 3SURA 2QDGA 4ZZ9A 1BGGA 4KEMA 3N6JA 1OCBA 3C61A 1QUMA 3EB3A 2NUYA 4JKMA 1W5PA 1UH2A 3VZZA 2H9AA 1ZUAX 3WUEA 2DIEA 4WJ8A 3W3OA 4LUIA 1WBJA 4R9OA 4CU6A 1Q6EA 1CXFA 2AL2A 3WDQA 1FWJC 4GIYA 2VC7A 5J8LA 3OHIA 4HNUA 2YDSA 2C16A 1Q8JA 3KL0A 3ZOAA 2YCJA 5CJNA 3DGBA 1GJUA 1XI3A 3TN6A 2INFA 1QHZA 4AX6A 3CHEA 1O5KA 3MI6A 2RFGA 1VYRA 4F2TA 1PKLA 1ZAJA 3V75A 4PUEA 3LZ5A 1OWQA 1ZBVA 4I8DA 3S1WA 4UQDA 3GNOA 3UERA 2R1LA 2C7FA 3EMQA 2CERA 2ZC8A 1GVYA 1FCQA 3A23A 3ITLA 3BW2A 2ZIDA 3M16A 4XZIA 3T81A 3GVGA 1C93A 2X0HA 1RVGA 1C7SA 2ALRA 1ZHAA 5EYWA 1TWDA 3NGFA 1XBYA 3RDKA 2WJDA 2I5IA 3GKFA 5IM51 3UVIA 3W7RA 3NCOA 1YBQA 2CLPA 2VUNA 1LQAA 1KA9F 3T4WA 3QMTA 2XUCA 2JK2A 4GI8A 4J28A 2WM1A 1VBHA 1EJRC 1M3UA 1VF8A 1OC6A 3ALFA 2CESA 2Y7GA 3AIBA 4UTFA 1VAHA 1IT8A 3S3GA 2EPHA 4PUJA 3H23A 3UF9A 1DWHM 4X63A 1EFZA 4LVBA 1DJQA 3TN3A 1NDZA 3AROA 1L6GA 1VZWA 3MBFA 5A8PA 4IMDA 2HISA 3QSRA 4MAVA 4RK8A 1H1ZA 1I2PA 1DIKA 4AD2A 3GH4A 2HK0A 3RR4A 4C1KA 3VGFA 4FF5A 4IX0A 3W22A 1H4PA 5E5CA 4B5UA 3GC5A 3BC9A 3AMKA 3KRUA 5I77A 4K8HA 5D2XA 4P61A 5BOEA 2QAPA 3RG6A 5ABFB 3W7NA 3M5YA 5A8MA 3QR1A 1LUCA 1CLKA 4DBSA 2W9MA 1QAPA 3LNPA 2PDXA 1EHAA 3EA1A 2PDWA 3OGVA 2PWUA 4AW7A 3BGJA 3DFQA 2WZHA 5GJMA 3VIJA 1TPUA 1YHTA 3D0CA 4BK9A 2HROA 1RQBA 3W1AA 1TRDA 4TMBA 3N73A 4FALA 4IH3A 1XX1A 2J66A 1RSCA 3PP7A 1JPDX 1OF6A 4J5NA 4PMUA 1UR3M 3VE9A 3NZ1A 4HNLA 3WNKA 1BEUA 1JDDA 3W2JA 2IPJA 2VGBA 5HPCA 4Z2KA 3G77A 4IIHA 2DZTA 1UASA 1QJWA 1Q6OA 1C8VA 1EO7A 4JTRA 1KQZA 3NOYA 3RU6A 5FOOA 6REQB 1PKYA 2J24A 2OJPA 4V33A 2D0HA 1ALDA 3H2NA 3PZUA 4JTAA 1QNOA 3BJSA 4PUDA 4V15A 5D30A 3K4DA 3KBNA 3AZRA 4UCGA 2V81A 3WJXA 3N3MA 4LWWA 3EXSA 4XKYA 1JD7A 2O0TA 3UCQA 3VDCA 2H6RA 3E0WA 2OYKA 5BWFA 2PLCA 4M8UA 3BLIA 3CLMA 2RJHA 1LL7A 1RJPA 5CEWA 5DANA 3CMGA 1REQB 2JEPA 4US6A 2PBGA 2IMRA 4DJEA 2VZOA 4O1FA 1FHLA 1MQQA 3PR2A 4FLSA 1FKWA 3T1GA 3EDDA 1A5CA 3RM4A 4XZMX 5C7HA 1AL7A 1FWNA 2VM8A 3L4UA 3W76A 3HTWA 1XWYA 1ZBKA 1FWIC 1G1YA 2C13A 1S2VA 2V69A 3QLDA 3SRFA 3A24A 3POCA 2ZA1A 1Z42A 4GX9A 3AHTA 1UUQA 3RNDA 1UHVA 2PDJA 4NZFA 1P0NA 4YPJA 4UTKA 1KBIA 4LTSA 3NL6A 1DE6A 1TWWA 3M0MA 4KEVA 1Z8AA 4GBDA 2EBNA 1F07A 4WK9A 3IIOA 3BOFA 1XS2A 2WKLA 4KWVA 1CBGA 1E6PA 1IXNA 4GGHA 4UQCA 4QFUA 4GINA 3TN4A 2OZ8A 4YU1A 1AW2A 3RAOA 1OT1A 3KUMA 3MJYA 2TYSA 3IJ7A 4DRSA 5M5DA 4HA4A 2Y7FA 1GZGA 3GU2A 4OUIA 4TVDA 4REQB 1PWMA 3JU2A 5KEZA 3DI1A 4H9ZA 1KXTA 1M04A 3EWXA 1E4MM 2TPSA 4N7QA 4DLFA 4IXXA 4K39A 2PURA 1XKYA 2DSVA 2P0OA 3R7MA 1W3HA 2P50A 2IQTA 3P8JA 1FCBA 1T7LA 4IPNB 1KCLA 3NIYA 5F2LA 3QOMA 4RZBA 1JJKA 3TWAA 6PTDA 2P8CA 3E9AA 3RO6A 3W7HA 3TSMA 3IV8A 1UR9A 1VKFA 2Y24A 3G6LA 2A6LA 3BV4A 3RCYA 4ADTA 1GVFA 3R89A 3VIFA 3L4TA 2G97A 4GI4A 1GW9A 3CWHA 2J7GA 4V2XA 4QJ4B 1E3XA 1FH9A 3OO2A 4JQ2A 4MF4A 5HMEA 1VD6A 4JY8A 1V0MA 1WAWA 3T0AA 1B0IA 3WENA 4FXFA 1XIEA 3Q65A 2PDCA 3HQ1A 4N4QA 1F61A 2CW6A 3NQFA 3L5AA 5A6KA 1M5WA 1US3A 1LWHA 5E93A 4ASTA 3DC8A 2E6YA 3W7PA 3VPLA 1U2YA 3QN3A 3S47A 2FGZA 5LGXA 1XRVA 3EOLA 3SUUA 3UA3A 1RR2A 4FR6A 1GKRA 1FHDA 2R8WA 1UWQA 2J75A 2UV8G 3LRMA 3ES7A 2DDXA 4Q32A 2HXUA 3HOJA 5LHFA 2X30A 4IXHA 2V6AA 3W2MA 1E1EA 1OG6A 3EWCA 5FEZA 1GK8A 1H49A 1EO5A 1QO2A 3BLLA 1TTQA 1I2QA 1MQRA 2Y85A 2PCEA 3FSUA 3QZAA 3CZJA 4AISA 1ZP3A 4PRRA 2AQVA 2PDUA 4ORMA 4XD4A 1UPPA 3EDEA 1V0LA 2P10A 1YXCA 1O5RA 1GZJA 1BXNA 4YMZA 1FDYA 2AQWA 3I4KA 4WIWA 4EWND 2CWXA 5A2CA 2PLMA 1GYLA 2QV4A 1VH7A 3SUVA 3LGDA 4EX4A 1TR1A 1H61A 4RUBA 3M0HA 3EX2A 2XFWA 1VCFA 2OZ0A 3VNJA 3KHDA 5I79A 1SSDA 1S5MA 2FB3A 1X1ZA 1TPH1 1QU4A 3B0UX 3SM0A 3BQ6A 2YL5A 1HP4A 3LM7A 2ALDA 1KV8A 1PHWA 1X7IA 3ZSSA 5LIXX 4MY8A 2FYMA 2ANUA 4GIAA 3L4ZA 1OC7A 2A1YA 3VKCA 3SCVA 3SI9A 3L2LA 2VD9A 1QFEA 4N2YA 5C9WA 4Y6GA 1Z3NA 1KM4A 4RPPA 2V5KA 2CYGA 3TFXA 4GABA 5KSWA 3H2MA 5DCDA 4J2PA 3BUVA 4F9DA 2E6DA 3C0JA 1IXOA 3AWNA 4N02A 3BCDA 2E4TA 3REQB 1L2QA 1MNSA 4DAIA 3G1XA 3PULA 1JDFA 1CGXA 1PVNA 4IGSA 1NY1A 3QBUA 3CIXA 4MYXA 3G8EA 3WF1A 1JPHA 1JRBA 2WANA 5KZMA 3OGSA 3BPWA 2OCZA 3VU2A 3A64A 3FCPA 1BXBA 3U2ZA 2R24A 4IMAA 3LEPA 3UJSA 4O17A 1JPIA 4KQNA 3A6OA 5BOOA 4WKFA 5HANA 4ZXLA 3PAOA 3S6OA 3STPA 5JBFA 1W9BM 4POCA 1K9DA 4LYRA 1VENA 1ZJBA 4C6DA 1XXXA 2QCEA 4C6KA 4HNCA 4QIUA 5C2GA 1W1PA 3GY1A 3VX1A 4ZL1A 5D09A 3CS2A 2DIKA 1XSKA 3ID7A 2HPIA 2Y5JA 3DDMA 4GISA 4U33A 3LTPA 5FSDC 1E9ZB 4JN8A 4JY9A 3SADA 1WCGA 4KESA 4LUJA 3WIJA 3NVTA 2HVOA 4I90A 4ZO8A 4AD0A 3OGRA 1OHLA 3ES8A 3C8NA 1XDMA 4ROQA 3I4EA 3L12A 3TVAA 1YPIA 3DGRA 3TH6A 2CCRA 4KCTA 3A4AA 2XGBA 2OQLA 4OWGA 3INPA 2XZ7A 1A5KC 1ZALA 3LPFA 1W8SA 2VWSA 5CH9A 4BEUA 2PGFA 1GOIA 1K6AA 1HKJA 1KRBC 3WD2A 2NW0A 2Y7DA 4B5SA 3WL0A 1DWJM 4DM1A 2VEPA 1F8MA 2OSYA 5FA5A 1PSCA 2RJGA 4FIQA 3RJXA 3HGJA 3M46A 1SMAA 3P14A 2WV8A 3MI3A 3FS2A 2YXGA 2HMCA 3LHUA 1XFBA 4AY1A 4YYFA 1R9XA 4EAYA 1RA0A 2A5HA 2Q3RA 3SIZA 1EDGA 2CHOA 3UZYA 2QR6A 5T26A 4L5ZA 2QZRA 1Q2SA 4C65A 3KOYA 1NSJA 1A80A 3SQSA 4EAMA 5FF4A 3LDVA 1P48A 2WAGA 2YA2A 2Z24A 3APYA 1IR2A 3L2MA 3PBGA 3GHUA 3V5CA 1E6NA 4L6HA 1XD1A 3MSRA 4LCSA 2C1HA 3POHA 3T0BA 4ZMGA 1O7AA 2GFTA 3BE7A 4IL2A 5TNVA 1SFLA 4RW3A 1EX5A 3FOKA 4JYFA 3NYZA 1LWIA 1SFSA 2IQDA 1TMLA 3WKZA 3CV7A 3VNKA 1F3XA 5HWJA 1PTDA 1U1UA 3PFMA 3U7BA 1JAKA 4LNCA 2YL8A 4Q8UA 3PAJA 4DO7A 4Z1DA 3MV11 3GUWA 3LI0A 4I7WA 3IS4A 4MWAA 3UETA 1D3GA 3T07A 1KGUA 3MO4A 1S3TC 1LT7A 4WUIA 4H01A 4REQA 4KFOA 1RY0A 2UWFA 3LCWA 3U6WA 3DFHA 1GNXA 4NZ4A 3ZT7A 1F5ZA 1KB3A 3PS7A 4H7VA 1VFTA 2JIEA 3M07A 2REQB 1J18A 4LEQA 3MW7A 2XIBA 3SAZA 4AF0B 4H2CA 3BLDA 4UTWA 3DH7A 3WK3A 1N8FA 1TQXA 4U31A 1XLEA 3GIQA 3M64A 2BMBA 3TK7A 3WFZA 1ONXA 2QUMA 1XYMA 5A8QA 3MY9A 4US5A 3BLPX 4ORIA 3F7JA 2E09A 3W02A 3N29A 1TO3A 1QNQA 4WOZA 1AA1B 4GE8A 1HP5A 3R10A 3TR9A 3FJNA 4KWOA 3A9IA 1M6JA 4NYYA 5D03A 1VGAA 2FTWA 4IWWA 1JGMA 1JYVA 4JHZA 4M5PA 2QDHA 3SO7A 4NJIA 4UR9A 5E70A 5I07A 3GG8A 2PTZA 3N4AA 1ZLPA 1M7XA 3U57A 4HHPA 3RLGA 4GYPA 4WKHA 1H5YA 4Q3MA 3E0FA 2Y89A 2ZWZA 3STFA 1EL3A 4Z2GA 4LBUA 7REQA 2ZUWA 3UESA 4BQ2A 3BW3A 5EGRA 3GQYA 2CKSA 1Q6LA 1XLFA 4JTUA 1TUFA 4ZE5A 2W0UA 1ICSA 4B2DD 4DHGA 2EQDA 3IUIA 4J3TA 4DELA 2O7QA 3OHMB 4WY0B 5DBTA 3CT2A 1NOWA 5A1AA 5E0KA 2CLIA 3C52A 4RE2A 4EPEC 5BRPA 4NX0A 3DG6A 2CKRA 4UFHA 1SO6A 4B3KA 1QPNA 3NDOA 2NX9A 3AYVA 3BAYA 2B7PA 1IIHA 1EF3A 3TYDA 3BLFA 1UR0A 4J4KA 4N9CA 4GQ0A 4CD6A 5A6LA 1NQKA 3FNDA 4JTJA 4PCSA 3U5YA 1RJRA 1M7JA 4C6QA 2O56A 4I9AA 1UPMB 1VJIA 3KBJA 2FZDA 4G1KA 4TIMA 3RITA 4NY2A 4OT7A 1CI1A 2QULA 3WQGA 1BXCA 4FNUA 2HQAA 1F4AA 3APGA 2XVPA 4U3AA 3F4DA 1ENUA 5LIWX 3THUA 1VFSA 1JCNA 5G2IA 1LROA 1JAEA 2PUZA 4FNQA 4IMFA 2QXWA 4IMCA 3DC0A 3HO8A 3WBXA 4DXKA 1M53A 1V93A 1EC8A 1GT8A 3AS3A 3A3HA 3T55A 2VDIA 4XTIA 3LGEA 1O12A 3IACA 4CGTA 1BYDA 3B9DA 1EC9A 4PA8A 1H0IA 4GYFA 4ZR8A 4JEQA 1R5YA 4MDPA 3P81A 4ZO9A 2QCDB 1R7AA 3REQA 2P5NA 4Q8PA 3ARWA 3FEMA 3DFPA 1NELA 4CCEA 3ZT5A 4UTLA 3TTYA 3UA4A 3CWOX 3H12A 1J9YA 3FVDA 3TROA 1H7XA 4HA1A 4IGHA 3CUXA 5F4XA 2UY5A 3PWAA 3RPDA 4M6UA 2V68A 3BSGA 3GTFA 3W7EA 4O54A 3S5SA 2WSPA 1XRTA 1BKSA 2RHGA 3O15A 4GUIA 3IJDA 2VFGA 2HJPA 5K9CA 3CTLA 4S3BA 3BZGA 3HG3A 2W61A 3TKFA 4EOUA 1U33A 3VIPA 5REQB 1OFRA 4W85A 3QTPA 4P5UA 1BYBA 3WDRA 1NFPA 3SFKA 4C6CA 1HJQA 4HTBA 1ADSA 1V51A 4YVVA 3GXMA 2I17A 2GQ3A 4AWUA 3WZ0E 3S9IA 2A3HA 1QRQA 3CC1A 1NU5A 1JI2A 3W1LA 3BJFA 4LAOA 4TVCA 4O1AA 1XYLA 3UU0A 3CNYA 3GNRA 4HCLA 1DYSA 3L9CA 1XIJA 3BLKA 4W9TA 1MWOA 5EMMA 1ZNNA 4AD4A 3N15A 3EB4A 4H1ZA 5C70A 5AC7A 3B8DA 5CGMA 2EJ1A 1GOMA 1YMYA 1DEDA 3AJXA 5L9FA 1KLZA 1E4IA 1OIMA 3RN6A 3VE7A 3HV8A 3STEA 2VFFA 2Y8VA 4G7EA 4QSHA 1EA9C 4IF2A 1SW7A 1IZJA 2W5FA 3LS9A 5BZAA 3CEPA 4GO8A 4L6OA 3UPBA 1KM1A 5EA9A 3NL3A 4MIMA 2A3EA 1PPIA 3B8WA 1IEWA 2ZXAA 2CBJA 3FJ6A 3CHVA 1J0IA 2CXGA 1EP2A 2HTMA 1AQHA 3CZEA 3ARUA 2VR4A 2WMKA 3HPXA 3QVQA 4ENLA 4WZHA 1WE5A 1Q7QA 1EWDA 2XU2A 2ONEA 5KINA 2OLHA 5D9OA 2XJ7A 4JTKA 4FI4A 5EFDA 4ECLA 3EWBX 1FWRA 4M7TA 4C1NB 1EDTA 2VQUA 4QDMA 3HF3A 3O06A 1CWYA 4KMQA 1QNSA 3NFUA 3KVMA 3QZ6A 4XK2A 4GJIA 1BHGA 1FP8A 5CC7A 5CC6A 5LYRA 4A21A 3BVJA 3S5ZA 4MPQA 4D1IA 3IJQA 2ZDSA 3E1F1 5MKGB 4PTDA 3KOWA 3UCCA 3TA9A 2EXOA 1FA2A 3RU8X 3NQCA 3EZ4A 3N11A 2NLIA 1Z89A 1QNVA 3B8VA 4AWSA 4D6EA 2ZX9A 3WQ4A 3T78A 4YJ5A 4BEQA 3URNA 2AGKA 1UOKA 4M29A 1P6WA 3B05A 2RKXA 3GFYA 5BMWA 1X1NA 2ZX6A 4MMWA 3U8GA 5FJPA 5D9NA 2V38A 1KR0A 3IIVA 2WC7A 5F1VA 1WZKA 3WO8A 3GYCA 3B40A 4HYWA 3RM9A 1CGWA 4HT3A 4JFUA 2QGHA 1DIOA 1X7FA 4B3ZA 4JN7A 1DQUA 1JIBA 1BG9A 5IDZA 2YXOA 4Q7IA 3WQPA 4V1YA 4F9JA 8TIMA 1FWSA 5HWNA 5LNUA 1GVEA 3ARRA 2Z6JA 1K4GA 5U4NA 1M03A 4ZQRA 2J8TA 1GEHA 4YS1A 2NQJA 2VX4A 2HS8A 1BKHA 2H3BA 3WLLA 2ON3A 5G1TA 4W7VA 4MJMA 1ZL1A 4LUYA 2RDXA 4MWAD 1QW8A 4QHRA 3AAMA 3CB3A 3KLKA 3KDOA 2G96A 3HGSA 1LRTA 2WB5A 3S1XA 1EB3A 2AMGA 4MADA 3H4WA 2G95A 3VKJA 3R43A 1PL9A 1OY0A 1HIZA 4JTTA 2W3ZA 4WDTA 2WHMA 1KGXA 3AWOA 2VCAA 2C1IA 1N55A 3TQVA 3B9EA 4CKQA 1W37A 1JQVA 5B80A 3MI2A 4NI8A 1H7PA 5TBOA 9CGTA 3H4GA 4LGXA 1WDPA 4R3UA 3OVQA 1EJSC 3PTQA 1K8YA 3WQWA 1JF5A 1QPKA 1FXQA 4US5D 1FWGC 4C6FA 3R2GA 1L0PA 3TW7A 1J79A 3QHMA 4V1XA 5DCEA 2PDLA 3UG3A 3WUGA 5CAKA 4AYGA 1Y5XA 2YA1A 7ENLA 2Y4SA 4LUTB 1FQ0A 1Z9AA 4IL0A 3M43A 2JQXA 1VFFA 1YKWA 4GY1A 1UYQA 3RGTA 2XFRA 3UJFA 4XB3A 2GVEA 5BWAA 1G9HA 1DPMA 2WK2A 3EDJA 5DMYA 3FEQA 2IKGA 3UNDA 3SRKA 3GUGA 4R7JA 1ZBCA 1FKXA 1J0KA 3NGJA 3SSZA 3QPYA 1E0WA 4CNPA 1DJWA 1KCKA 3MHUA 3KX6A 3T44A 3TONA 2GVYA 2V2HA 2G4JA 3TQKA 4AIBA 2PDQA 5GNXA 3MSGA 5ECUA 2XIMA 1TJRA 1HT6A 3PPHA 5K9DA 1XPGA 4DN1A 4U10A 4B90A 4E2BA 2KAUC 4B92A 1ODZA 3ZR5A 3OOQA 2PDBA 2BVWA 3LBMA 3L68A 4FLOA 5G2HA 2POZA 4IP7A 4Z1AA 4Q22A 3WLKX 1Z69A 3FA3A 4JYDA 3PK7A 3RO8A 2TODA 4L4LA 1EF2A 2GGIA 2J47A 2VC6A 4J3WA 1NOUA 1Z41A 1ECEA 5T9BG 4FNRA 3W1QA 3MHGA 2GVJA 4Y9AA 1LOSA 2VNCA 1JXJA 2FZMA 3EA2A 2BDQA 1W1A1 4E8GA 2VC9A 3DIPA 3LX9A 1VEMA 2VEGA 1ZCCA 1X6LA 2W66A 4JDBA 2BY3A 4DJFA 3K1DA 5HA7A 3F4CA 1UKQA 1G5AA 3U3HA 1XF0A 5HQEA 1F05A 4D8AA 3C2FA 4O57A 4EWJA 4IQDA 4X22A 3P80A 3E74A 3HPSA 3NDYA 2VFDA 8XIAA 3MUZ1 4B4FA 5CBIA 1E43A 2BB0A 4NZ3A 5REQA 1CX9A 1Q45A 3TW9A 1GQNA 4N9EA 3RLUA 1H51A 3I10A 4M56A 1VFUA 1YW1A 3NVDA 2E8YA 2XISA 4J3SA 3CB8A 5HNRA 1GGOA 1E55A 1XIHA 4UFLA 2EPMX 4E4PA 2Y61A 1FUYA 1FRBA 2FHCA 3RYSA 1YTEA 2Q71A 7XIMA 2J7HA 5A5WA 3WJSA 3W7GA 3R11A 4IZGA 2FJUB 3S6DA 4E3TA 4Q8WA 3OG2A 4QQUA 1HKIA 2YL6A 2Z29A 5JH1A 2ZUMA 2WLZA 4MGGA 4E4FA 3Q58A 3BTNA 4J9JA 4F0SA 2Y1HA 4WR3A 4H8NA 3QHNA 4GUJA 5FF3A 3WBAA 3HGOA 4FNSA 2C19A 1G4SA 3LXAA 4BWLC 1JZ6A 3MPGA 2BWGA 4B3LA 1GQJA 4E8DA 3FHAA 1DHKA 4BR1A 3AMDA 4DUXA 4IG2A 3EDKA 4AZCA 4OOZA 4KGJA 2DZPA 3WJYA 2HZGA 2ZRXA 3TJ4A 3OZOA 3PTMA 1P7TB 1FH7A 1M68A 4FIRA 4Q7NA 3DKLA 1V6YA 4KWWA 4Q33A 3O6DA 4JTFA 4C7FA 2TRSA 2B81A 3SUWA 3KZSA 2VENA 4L1WA 4DPPA 1Q2RA 3SZ8A 4HN8A 1YDVA 1JCYA 2D3NA 2QUUA 4HMDA 3MZ2A 3FJ4A 1AQFA 4HB7A 3N04A 3T7VA 3WLIA 3QPZA 3MUAA 1W8GA 4TV6A 3CL6A 1FHUA 1UP3A 1MFVA 2I56A 1D8CA 1IXPA 1EGZA 3GNDA 3M4HA 1XBVA 4QDPA 1ZAIA 1L6WA 3RX2A 1W1B1 3T0TA 5DQPA 1IEIA 2BNJA 2Z1XA 3NURA 5ABHA 5JU6A 3DG3A 3NQ7A 8A3HA 2X1UA 4QISA 3APTA 1N8IA 5I02A 5G4HC 1UWSA 6CGTA 3F2DA 2NT0A 3V0TA 1EGMA 3W1XA 4KCVA 3W85A 3BLEA 1KCZA 3UWUA 4O1EA 1Y65A 2X1SA 1R8LA 3VNMA 1E4LA 3ANUA 3BANA 3LERA 1KXQA 2GVGA 3VIHA 4HCHA 1XBXA 2D22A 2I5QA 1N82A 3DFNA 1KTNA 4B91A 1PV8A 4XD6A 1HKWA 1W3LA 3SCOA 5JQ9A 5EPDA 4GQBA 2XPKA 1AUSL 5I3JA 5CBBA 2YGYA 2HXTA 3F1QA 1R3TA 1YNPA 2WZEA 3PB2A 3PPCA 3WD1A 2PA6A 4FX8A 1TKKA 4PRTA 3E49A 4OHQA 2PS2A 3UXKA 5LZLA 3VAVA 4D1JA 4FNPA 1OINA 1BF2A 1W3KA 1Q65A 1BQCA 4W93A 4NNAA 4DY1A 1QNPA 4AD5A 4C91A 4F48A 4CD5A 2C0AA 4DZAA 3FSTA 2Q01A 1BG4A 1V08A 1KM5A 2X7VA 5C71A 2XSBA 4S3GA 1U22A 5FJOA 5GNYA 3CAWA 5J04A 4XZBA 4PEEA 4F40A 3IAQA 1TV3A 3CHDA 3OW1A 3H8AA 3P0XA 3BOLA 4PB3A 3PZ9A 3SQLA 4H41A 2Y5EA 3QOKA 2YBUA 3BK0A 4TX9A 5CG7A 4RZ5A 3SECA 2JALA 4JTCA 4BQ4A 1MUCA 4C6IA 3DYOA 5AVHA 2YA0A 3B0PA 3W37A 3SR7A 4V28A 3D3FA 1ONEA 3SRDA 4QEEA 5E0FA 3HQPA 1UB3A 3TTQA 3CAVA 2Y70A 3NYDA 4C6MA 2E9LA 1F73A 5F2IA 4XD5A 1D9EA 3G0XA 1A3XA 1ISVA 1JDEA 4JHOA 2ISWA 7ODCA 4MPKA 2NVDA 5C6MA 1S46A 5CGTA 4DYKA 2G3FA 1PB0A 5A2BA 3G22A 2Y5SA 1QBAA 2D2GA 1RXOB 1UD6A 4E2OA 3NPXA 1RK6A 3OODA 4R88A 5EMUA 4WX2A 1LCOA 4EKJA 4JTDA 3TZFA 1Q4NX 3MANA 3GRIA 4ZODA 2E40A 1PZ0A 3NOEA 2F6UA 3G8RA 4A2RA 4GACA 4GI9A 1E6RA 3O3RA 4X2RA 1OFOA 2ZDRA 3U4FA 4RKAA 2PZNA 2PWGA 4CLMA 1XLAA 4NZ5A 3AXIA 2J79A 3L5MA 3Q45A 4F4RA 3O1NA 2I9EA 1ITXA 5E09A 3ARQA 5AHMA 4QM1A 1E70M 4A4AA 2Y63A 2YB1A 3CUZA 3FA4A 4JYEA 3GDLA 1C90A 1A3WA 2WJEA 1LRNA 2ZA3A 4KRZA 1AJ2A 2Q8XA 2FPYA 4QP0A 2QQ6A 4IJRA 3R13A 5HQMA 5AYBA 5C2CA 4Q8NA 1RJQA 1X98A 2HV5A 2ASHA 4CVWA 1DJZA 4NX5A 2X1IA 1RVKA 3JZEA 3WDPP 2D2JA 1S2AA 2CNCA 1NDYA 2EG7A 2C6QA 2F7FA 4JFWA 1MXGA 4DJFD 3SCTA 1CEOA 1QHOA 4PUWA 4FHAA 1WKFA 3LRLA 3VKBA 3M7WA 4DVOA 1IHIA 1FOBA 5XINA 2IKJA 3N9KA 2ZUTA 4RDWA 2F2HA 5AHEA 2YZRA 1QCWA 3OZYA 4KETA 4F3HA 5CJ5A 1PTAA 3G5EA 1CPUA 3GXDA 2EO7A 3CQIA 4B15A 3MSYA 1EC7A 4NRRA 5ABGA 4BQ3A 1GQLA 1QASA 2E5DA 4FXRA 4O12A 5JIPA 3A3XA 2JGQA 2ZQ0A 1JYWA 3ALGA 4M3PA 2XINA 2GUBA 3UWEA 2WSRA 3HMCA 1VP5A 3FVMA 3RX3A 2OEJA 2PWEA 4B5XA 3RCMA 4K7VA 3IRSA 4QLLA 4ZOCA 1C8XA 4GK8A 1BQGA 2PD9A 1EQCA 3WDJA 3G3DA 3UYCA 4AG0A 1IWPA 1NQ6A 4G2DA 1P7TA 4LANA 4FMVA 2D2HA 3LYEA 3MYPA 1QWKA 3HG5A 2PWDA 4WSHA 4BWLA 1PYMA 3IARA 4B9ZA 3MVIA 3L23A 1D7FA 3A5FA 1X1OA 1WKEA 4LF1A 3UYIA 5IDIA 5JBEA 3T6CA 3RF9A 4JIPA 2OYMA 2WVUA 1MSSA 1R9ZA 2PRLA 3M0YA 3W7IA 3GDTA 3WFAA 1HGYA 3P93A 3PSWA 4EXQA 4TVUA 3GVRA 1LLOA 3AICA 1FTXA 2PP1A 2VWTA 3KOZA 4HD5A 3T8LA 5A6JA 3EA3A 1S38A 4KCUA 3CQHA 4GWEA 3WEMA 4PUNA 3NWRA 1EJ7L 4NI3A 5BW6A 3QHOA 5D38A 3MU7A 4XBSA 4TTGA 5DXXA 2WVSA 4LJ3A 4TUFA 2TAAA 4HKPA 4AH7A 3W82A 1KKOA 3IJ8A 4S2BA 4KF1A 3S4TA 2DW7A 3G1YA 4Q7BA 4MFEA 2CZDA 3KHJA 3I7RA 1SW3A 2O9OA 4TOQA 4LS0A 1IGWA 1LBFA 3EEGA 2QJIA 2V5CA 1XICA 3K8MA 4MLRA 4MJ4A 4OGZA 1ZZMA 1CGTA 2E8ZA 3F5LA 5JXQA 4CU7A 3E2VA 3CUFA 1GZ1A 2WOQA 1F8IA 5ENLA 1TWIA 3GIYA 1W2PA 4UZUA 3WQVA 5FF2A 5CZJA 1HGWA 2OT1A 1V6XA 3SY8A 4XV0A 1HF6A 4GLEA 3ABSA 4TXEA 3RX4A 3WX7A 1JPKA 3QMSA 2VFIA 2Z4GA 2NX1A 3EX4A 2ZICA 1F7BA 2V2CA 3PFRA 4UTTA 4L4OA 4UTJA 1B9ZA 1C9DA 3UEQA 1TTJA 2G41A 2WMIB 4IPLA 1FDJA 2BXVA 2V3EA 5EY5A 4EE9A 1W1VA 3GDMA 1XLGA 3L0KA 4AIEA 3W24A 4LB3A 2UY2A 3ZS4A 2OQHA 4H6KA 1UR8A 2VXNA 3ITTA 3F5KA 4C6NA 4Z42C 4NG3A 2QEZA 3VNZA 1PXGA 2VZSA 3SCQA 5LNSA 3FAWA 1MW1A 1K8CA 3KBMA 2J7FA 3P61A 1OCQA 5M2FX 3LGGA 3C6CA 4TV5A 5F4WA 4ZB2A 5FJUA 5HR7A 2VO5A 2DV0A 3VO0A 3WF2A 3QFWA 3FHQA 3WMSA 1IZCA 1RQHA 5DN1A 4W8BA 4EPBC 4XAFA 4O18A 3LPGA 3LHYA 1OD8A 2RDUA 5HNTA 2ACRA 1T40A 4H9TA 5DRCA 3TOPA 2E0PA 1F2JA 2V5BA 3CZGA 3RCNA 3QTGA 4L9ZA 1UG6A 3XIMA 3M7SA 3SFWA 3OJGA 3UWYA 2XVNA 2G0WA 3LUTA 4FXJA 5CPSA 1V7YA 1H60A 3NQAA 3WH9A 1H11A 3WD3A 4HNOA 5A6SA 4DI9A 4BQ5A 1OZMA 3MZNA 3GTNA 2OOGA 1MUWA 1OF8A 4Y9OA 3UZWA 2PTWA 4UFKA 2BXYA 1OGSA 3IJLA 4MZ1A 2XHYA 3GBDA 3C56A 4NILA 2ACSA 3NPVA 2WC4A 2DPEA 3I65A 4BKNA 4W8AA 5G4WA 1IR1A 1W9PA 1DORA 3SGUA 1PUDA 1QK2A 1KM0A 3P2VA 1EUAA 3PNZA 2FH8A 4U5KA 5CXPA 3J7HA 4YHGA 3EKZA 3ZQ9A 3SW6A 3BOXA 4IPJA 4P8XA 5CAHA 1H09A 1T6MA 1PE1A 1NAL1 4QLKA 1X97A 4PMRA 2GUUA 4UIOA 1B3WA 1EA0A 4O16A 3RMEA 3TMQA 3W4RA 1A0CA 1W5MA 5CLWA 3E3HA 1S5VA 2YBTA 3CO4A 3ITYA 1NWTA 5A6MA 2O9RA 2MNRA 1TELA 3BJTA 2ZE0A 3GR8A 4LYPA 5I6SA 3NM3A 5A3HA 2C79A 5LIKX 1OVDA 3NQBA 3WMCA 1QWGA 4PB4A 3VKKA 4PBEA 2ESCA 4P7RA 4W5ZA 5IRPA 2HWGA 5KZ6A 3SB0A 3WF0A 4QXIA 1HNYA 4OOUA 1G0CA 2H9AB 4NF7A 4ZB5A 4A22A 1LLZA 2OG9A 3WQ6A 3S6TA 2BSLA 1CW2A 1TV5A 4ATWA 1W91A 4QROA 3MT1A 2J8GA 2OR2A 3DENA 1V77A 4ZQNA 2GQ8A 4Z2IA 3KAOA 3SUSA 4UZSA 4AEFA 4XWUA 1EKOA 1RA5A 5CG0A 1KO0A 2WHJA 4UTMA 1DTUA 1F3WA 2WZTA 3ZLHA 3BAKA 2ICSA 3ORWA 3TTSA 1VQTA 2ZZ6A 5AOUA 3BSMA 1E1CB 4AZIA 1ZTVA 3IGUA 2DGAA 2HNEA 1A5SA 1NEYA 3SCPA 4S23A 3BCJA 1CLXA 1QXLA 3V18A 3S2LA 5AKQA 3UW6A 1GHSA 1O5XA 2YLLA 4JQ3A 3W1TA 3HPAA 3WYZA 1YBQB 1E0XA 4O0ZA 4WF7A 4M6PA 1PJ9A 3OB8A 3G18A 3WD0A 1J6PA 5BOFA 5I00A 3PZGA 2OSWA 1ZPTA 1G69A 2D69A 3C3NA 3GNNA 1TJ1A 4PTVA 1ME7A 2VFEA 3E0VA 2DH3A 1XH1A 2P88A 1ONRA 4H9MA 1X39A 4U2YA 3KBWA 4IIFA 3L65A 3UWWA 1OFAA 3ARSA 3WLRA 3ARYA 3PJWA 2F6KA 1VRXA 3QW3A 4H8UA 5D05A 4JX6A 4S3DA 3A4JA 5K3VA 4CCCA 4CQ9A 4DJDA 4DNHA 1SW0A 4P8VA 1RBAA 3HZ3A 1DL3A 2PP0A 4JTLA 1Q63A 4J3XA 4ZOEA 2OKTA 3R58A 3W7KA 5CPMA 3G1VA 1AMKA 4U3CA 1A50A 3R4IA 3P82A 3UVAA 1VEOA 4OECA 3W81A 4M24A 2E5BA 2NXIA 3VIIA 1S2UA 1FCVA 1XSIA 3VABA 2DJXA 4I9TA 1V5XA 5A95A 2I16A 3F5JA 1ISYA 2INZA 2PDYA 5J5DA 3PHAA 1LUCB 4QG6A 2QDEA 1YE4A 5E9AA 1JUBA 3H26A 1GUVA 4GZJA 2X1TA 4NL1A 1O4UA 1QDSA 4PCTA 1NFGA 2OLSA 1XD0A 3N2CA 4S3EA 4PULA 1MFUA 1JCXA 1GORA 3QF0A 2QPXA 1LQ0A 4PMNA 4K8GA 4QDWA 3XINA 2YBVA 1E6XM 2Z25A 3RPTA 4D6IA 1XDLA 1N8WA 3O0FA 5FEPA 1A5NC 3WJZA 2PGRA 3QLLA 2OZTA 4IFRA 1AJZA 4XBJA 5HR6A 1O95A 3N12A 1PKNA 3GH5A 2ZYFA 2MANA 1W32A 2QJJA 3NEHA 2J13A 3GKAA 1TCDA 2E9BA 4KCWA 1XH2A 4ICMA 2BG5A 4H6RA 4GI6A 4UB9A 2GJXA 3EX6A 3BH4A 2GGHA 4XKYB 1RAKA 3GYEA 1Q85A 3KVJA 1MZRA 1ZCOA 3FGCA 4GY7A 4HNTA 3AO0A 3IANA 2OWCA 2PGWA 1Q5MA 3K30A 3R8GA 4XVDA 5C9RA 4Z2JA 2WYSA 1UUMA 3H2CA 2VRKA 2OX1A 1ISWA 4NNCA 5CSYA 4PMJA 1VFOA 2XIQA 3B97A 2BVYA 1HJWA 3T40A 3LLDA 2VX6A 4GY0A 3W1RA 1W0MA 3M1ZA 3PZQA 1A49A 2XFFA 1AH3A 2JE8A 4PSRA 1FWWA 1S3HA 5FCZA 5HJLA 4XG1A 3AIEA 1TQJA 4MY9A 4JOMA 1CLVA 2CU0A 3SN0A 3GXPA 3HQOA 3WLOA 3T9PA 2Z00A 4XAZA 1TZZA 3W07A 4JKLA 5D2TA 1SJDA 4FO4A 4EACA 3IJ9A 2VELA 4PEKA 4WDWA 2QCCA 4PCNA 1RPXA 2V0TA 4L61A 4W89A 1MXSA 4ZFCA 3KVKA 3W7MA 4LFYA 2WVTA 3M6YA 4Q6XA 3UBPC 1PDYA 5CC5A 4YL2A 4IGNA 1HUVA 4GD0A 3KE0A 1V6UA 4CU8A 4CNNA 2VEMA 5AHLA 3YPIA 3WCZA 1SFTA 3G3MA 4JKKA 2OWXA 2ZZ2A 3PUDA 4R85A 3VOIA 4NQ1A 2ZTKA 5RUBA 2VKZG 3ZO9A 4F66A 2G3JA 4WDXA 4Z1BA 7TIMA 3C2OA 5AB3A 1SO3A 1SZFA 3CH9A 3B0XA 1JYNA 1US0A 3F4NA 4KRTA 3WQ5A 3B3DA 1JCJA 4AVFA 2D3LA 2QMJA 4AYSA 3ZJKA 3PWGA 2V67A 5BMXA 1MRAA 4K37A 3AYRA 4BS0A 1B54A 2HBXA 3N9RA 2FLIA 3E0IA 3OVGA 2ZZ3A 4FOKA 2DUAA 1X38A 4TX6A 4IIGA 1JXKA 4XQ6A 4AZGA 4HHHA 2DIJA 5FESA 3UWVA 1ZENA 4Z0SA 4QS6A 1P0BA 3AYTA 3F03K 3L5LA 3GVVA 3USBA 3GC2A 1J12A 1HL8A 5LA2A 4FXSA 1JI1A 2DFAA 2NV9A 1SJCA 3ANYA 1ESWA 3NR0A 1NP2A 5HMSA 2ACQA 3UR7A 3TTOA 3VDBA 3DFOA 4Y9MA 3RRXA 3JZUA 1CB7B 2G3NA 3B8TA 3LENA 1XIDA 3WNOA 5C0QA 1R0MA 3MMWA 3QC0A 4LPCA 1ITQA 4JIQA 2PC8A 3QSTA 3FXYA 3O16A 1Z44A 3MDWA 1E1CA 3PC0A 3E5PA 3MQTA 4GXPA 7CGTA 1TPDA 2BLEA 4H19A 4PC8A 1R2RA 1A53A 3T42A 3EWDA 4S39A 3TJIA 1UR2A 3DZ1A 4AD3A 1A5MC 1HFBA 2OEMA 4F79A 4GNKB 3S42A 1F6PA 1DJXA 1AG1O 4IP4A 5LA0A 3O8AA 4ICNA 4JS3A 3PZIA 3CK5A 3A3WA 3TYUA 3EKGA 3EWZA 4YIWA 5G1YA 1ZJIA 4RV8A 1OJXA 7A3HA 4BZYA 4WKAA 4RV3A 5D8ZA 1KWKA 4BF7A 3A12A 3IUHA 3KP0A 3PBWA 3S9YA 1A0DA 2CZVA 2J9YA 2X0SA 3K2GA 1YIXA 4MB3A 3I3BA 1KKRA 4JICA 1P5BA 2PRHA 3L21A 3KCOA 1TZ7A 4JCLA 5GNZA 3NQDA 4AFYA 3MHFA 2GGGA 4PCPA 3S0CA 4LBRA 1K9EA 1Q6QA 4ACZA 4X0VA 2E5CA 1TV8A 3QYSA 4YWIA 3UNTA 2PF0A 3GHSA 3MUXA 3KCLA 5KZEA 5L6UA 3LB0A 1HO4A 1Q7ZA 2WBKA 2PODA 3OYXA 5I24A 3AMLA 1XRFA 5CPLA 7PTDA 1U30A 5FF0A 3W7JA 2R1NA 4XUYA 5CPOA 2BHUA 2ISSA 4JHMA 4L1XA 3P8IA 1H1YA 1F9CA 4XD3A 1CGUA 1Q4WA 4PCFA 4NXKA 4DJDD 1PO9A 2LLEA 4F0KA 3ZT6A 2V5DA 3A21A 1B3ZA 3N3TA 5CSSA 2ZVIA 5A69A 4GH3A 1G6CA 3VGDA 2EG6A 4UC5A 2A2IA 1TRIA 4E8CA 2QHAA 4IOTA 4IUOA 3Q4DA 3ZVHA 1GQKA 4UWMA 2IKHA 1FP9A 3MVTA 4X9SA 2GWNA 1C91A 2X42A 5KITA 1TZ9A 1WB0A 4ZCWA 1D7KA 2HCVA 3N18A 1G7UA 1V6VA 5E6ZA 3D5HA 3WQOA 1R3YA 2D24A 5AZ1A 3PJTA 3H70A 4AMAA 1EBHA 1EIBA 2WZIA 3W26A 3KRBA 5LKYA 1MZHA 4AXKA 4LAMA 4C6PA 2WNNA 4C1LA 3H7RA 3N17A 5J5RA 4YTRA 4Q4OA 2NWSA 4WCJA 1YRRA 4LB4A 4BCEA 1XSJA 3WL1A 5GQBA 2CLEA 5M3WA 3U2OA 3TTEA 4R5EA 1RHCA 3KRZA 3IGSA 4HNVA 4LUSA 5FSEC 1ZSXA 2OZ3A 1IWBA 3HJZA 1JYXA 3DX5A 1E0TA 2R9RA 3BAWA 4XAYA 3QGVA 2AGTA 2DT1A 4QTGA 4IMGA 1FHVA 3WUFA 4XZNX 4GIEA 4F2UA 2VD8A 3CQJA 3TXZA 1GTEA 1V0KA 4XIAA 4C7DA 5DX7A 4AHOA 4GBUA 4UOQA 1OGBA 2BOGX 4WGXA 2GOUA 4R7OA 2W62A 4NZCA 4MWAC 4J3UA 2GJRA 5FD0A 2A7NA 1J2WA 5DRIA 3W2LA 2PDNA 4IIDA 1SYTA 1N2VA 1XLJA 1CIUA 4AC1X 1K4HA 5C7VA 3WBYA 4PR4A 4HZ7A 2NUWA 2HDJA 5DFAA 1PDZA 3SN1A 4C7GA 4HPHA 4HMEA 1GKPA 2EPOA 4ERAA 1I6NA 1ML1A 3QY6A 2GWGA 2FKPA 3O0KA 2FVMA 1MI3A 3VXGA 4AZ6A 3EB2A 3W1NA 4ONVA 1UCWA 2XN1A 4JX4A 2YLAA 4MWAB 4D9PA 1QPOA 4DX3A 2CZEA 1HN1A 4D72A 4M19A 4UTWC 4O53A 1Y5WA 2OO0A 1O6IA 1DWGM 3I6EA 4XZ9A 3P5ZA 1TMQA 4IISA 1OIFA 2G3MA 4PZVA 3LK6A 1SMDA 2V3DA 3NQGA 3SCUA 1GVQA 3ZIZA 5DEZA 3H2EA 4KWUA 2BY0A 3TYCA 4GJ1A 1OK4A 3BDKA 1LJYA 4S3CA 3W7LA 3WG6A 3UZXA 4MLJA 1BF6A 3V36A 3GXTA 3LBCA 4H00A 5AC4A 2VEFA 2AAMA 2D2OA 3B9AA 3WBEA 2EEXA 3NNTA 3GSMA 4AWEA 3PUEA 1MW0A 2XH0A 1UZDA 2E7FA 1N7KA 2WMGA 3ZVIA 1XIIA 1WUFA 4UNLA 1PIFA 4MJ2A 3HN3A 4B2DA 5F2MA 4GYPC 8CGTA 2DW6A 1OEPA 3DYMA 1B9BA 3NUKA 3BXWA 3M0LA 3HFYA 3OBAA 1L9WA 1E9IA 3S1VA 4PFMA 4G56A 2Z2UA 4M1RA 3E96A 1JNEA 1IEQA 2WM0A 2QF8A 1KFBA 3FJLA 1XIGA 3QYQA 4MDOA 1UA7A 3M41A 3KL5A 4LRSA 3LCGA 5LNWA 4UMCA 4GYKA 4LYQA 3THQA 2XM1A 4KIEA 3RIKA 4CNTA 3CJPA 1TR9A 1XBZA 2J6VA 4N6EA 7REQB 1BTMA 5KMYA 3VYLA 3L7RA 1AFSA 1LOQA 2W92A 2KZHA 4IFKA 1E4NA 3GHRA 2CLMA 2ZZ1A 4BF9A 2BHZA 4D6DA 1WXJA 2J9XA 6XIAA 2VTFA 3VIKA 1ZJAA 1V6WA 5SWUA 2BS9A 4ZEPA 1P1MA 4DWSA 3LI1A 1MO0A 3OQEA 1EP3A 3GD6A 2WKJA 4W84A 1UUOA 1C29A 3O9NA 4RDZA 1B57A 1KGWA 3KTSA 4D6FA 5T91A 3NO3A 4MNKA 5FEXA 3NZGA 3ONCA 3LA4A 2IUZA 3C2YA 1UH3A 5I23A 5A6BD 2WNWA 4J1OA 3ITGA 1TX2A 3N6HA 4HZ6A 4B16A 1JF6A 4RCXA 1QHPA 3S2CA 3G2GA 1LTDA 2OYLA 3RPMA 1WKDA 4QE1A 3M5XA 3RJYA 3KBSA 3ZWTA 5FI8A 4UBPC 3OP2A 4IQEA 2FFIA 1UZ1A 3CUGA 3N1AA 3O63A 3RFAA 3WEZA 2WVVA 3GTHA 2EJAA 3A5VA 1I2OA 3RM8A 1KFEA 1R2SA 1DWAM 2IPGA 4AIUA 1W3NA 1SUXA 2P1FA 2ZZ5A 3URAA 4GXMA 1JZ4A 2VEKA 4NASA 4EP8C 5HNNA 5DCBA 1TE6A 5D32A 1OX6A 2Q8LA 4GVGA 2PP3A 1UIOA 2VZVA 4HIBA 5CZ0A 5K2ZA 4E38A 1FXPA 2NLYA 1J0YA 2Z2AA 4CN6A 5AVNA 2HSAA 3AMGA 2BODX 4B5NA 5BXSA 3N34A 1ONWA 1JVNA 4UFMA 4CEUC 3R6IA 3GX9A 3DYPA 1XLKA 2Z1VA 1XFCA 3N4FA 4N0RA 4B5VA 2CWNA 1P0KA 3C4UA 3H2OA 2DJLA 4JEJA 3A13A 4I6KA 1Q13A 1UWIA 3OLDA 3EOSA 1VC4A 1YTKA 1BPLB 4K68A 4L56A 1OADA 2PTXA 5HOSA 1HQTA 2DZUA 3QQWA 3VIOA 2GK1A 2F6XA 1NARA 3WD4A 5MF5A 2Z7KA 3PJUA 4G8TA 4TTUA 4AUBA 1H41A 1JGIA 1LL6A 4JIEA 3VGHA 1JEZA 3IJIA 5HK4A 4UFIA 1VCGA 3QPEA 1TVNA 2WZMA 2W67A 4DYJA 4XSLA 3MCMA 4NU7A 1XPYA 3AUJA 4G7EB 1W3TA 5JVLA 3WFLA 3VC5A 3O05A 1H50A 5EBUA 5C2XA 1OB0A 3QKEA 4X3ZA 2D0FA 2RGLA 3TCSA 1G4EA 3PPGA 3VUPA 2I5GA 1KFJA 1M7OA 2QCNA 4JTQA 3N2TA 3T08A 1GPWA 4EXBA 3EPNA 1LLWA 3MMTA 4GX8A 2PF8A 1GOXA 5C5YA 3KL3A 3CZ8A 3LV5A 2VT0A 3KTCA 2HVNA 1SZRA 3TSBA 1ZRQA 1XGDA 1KLYA 1Q6GA 3LN3A 4O4VA 5BXTA 2PEVA 4O0KA 2IKIA 1JCMP 1VLWA 1WOAA 2WPGA 3WLTA 1ZJHA 2EPLX 1SO4A 4F8XA 1D2KA 4IGMA 1P43A 1U5HA 3USZA 3SUTA 1XUZA 1MMFA 2ZUSA 1WDRA 1S2WA 2VZTA 3KVLA 3L66A 4YXGA 1FWDC 1KFLA 2J8FA 5CLTA 4J7RA 1IYXA 1X6UA 1OX4A 2QCLA 3VOHA 4WOQA 2EGZA 3QV8A 4K6AA 1PTGA 4PMYA 2ADAA 2FTPA 1XRSA 1JR1A 3LCLA 3V1HA 5BXPA 2WQPA 5I09A 5TD4A 4O8RA 1IGSA 4Y90A 1A5BA 2VDHA 3LTSA 4WHBA 4JTIA 3U7VA 2HK1A 2GZXA 3K4AA 1EP1A 2CITA 3HG2A 3QQ1A 4R53A 2FGLA 5HULA 8XIMA 2NQZA 3QKZA 1HO1A 1ZAHA 3ENLA 4XO7A 2DP3A 5FF7A 2ZXQA 4HPNA 5C55A 2TMDA 1LL4A 4OIFA 3L2IA 4DLMA 1L6SA 4IX2A 3MC5A 2PU0A 3MWCA 3W6LA 5LNRA 3LLXA 5ABTA 3W2UA 4LVDA 4JX5A 1ZGDA 5LSMA 2CBVA 3GW0A 3ZR4A 4HPXA 4LU0A 3M9YA 4HPJA 2Z7GA 4JGDA 4YTTA 4NJGA 1M7PA 1L8NA 2QJMA 1UQYA 3W6MA 1UMYA 4HA0A 4JFTA 4YTQA 4F0HA 5PTDA 1JFXA 4ZXOA 1V3MA 1K77A 3VNIA 2PZ0A 3E2RA 1W1IE 4O13A 1OCNA 3E02A 1VBJA 4EK7A 5DXYA 4I7UA 4DUOA 2FVKA 1WZMA 1O5QA 3MCOA 3OIHA 3VILA 1DQWA 3QV9A 2B4GA 2WNZA 1NDWA 4JFVA 2FHBA 1BRLA 5A8NA 3U48A 4DI8A 3NQEA 3THAA 4FLQA 4LEFA 5DMMA 3EDFA 4H2HA 3NO1A 1GKQA 4U28A 2PDHA 2X7WA 4LF2A 4RNFA 3TNBA 3HV9A 4EPDC 4N6FA 5E9XA 2GUYA 3A47A 3S46A 1ZB5A 5HPOA 2X0YA 3CL8A 5LIUX 4HGXA 1CXLA 1S5TA 3OG3A 2WXDM 1UKTA 3RLVA 2ABAA 4DBDA 1ADOA 1WUEA 2E6FA 1W9XA 4A8RA 4MY1A 3GAKA 1KW1A 4J27A 3W27A 4AX7A 2PWFA 2W79A 2PSNA 1J8VA 2Y8UA 1XLMA 3GG0A 4NSBA 1I0DA 3FYOA 1Q7MA 4HHMA 1TPB1 3NDZA 4NAFA 3COTA 1E15A 2WSKA 4I5RA 1B31A 1Z32X 1OSEA 3VOFA 5EBAA 1OGGA 1G01A 1FWFC 1ICQA 5I78A 3URBA 1PZ1A 3WUBA 3GVQA 2NQ5A 3O07A 1KTBA 1MDLA 1S1RA 2OX4A 1R9YA 1DJGA 2C14A 1SPQA 1I45A 2PDPA 2PLKA 3H24A 3NPWA 4DJFC 1XYAA 2Z2BA 1US2A 5IXEA 4Y7EA 1GCYA 3LLFA 4DWSD 1WP6A 4MKNA 3B8UA 3LMYA 3TU9A 3B8IA 1WBHA 1O60A 2YXXA 2QPUA 2FIQA 4S1FA 3FKKA 4CNUA 3EPMA 1VFMA 2JBMA 3AFBA 3CIWA 3MA8A 1KM6A 2DUXA 3OTRA 4UQEA 4NNBA 5D02A 2QYGA 1VB9A 3W86A 3QC3A 1KXHA 1UP2A 1OFDA 3CLWA 4EPKA 4XISA 1LP6A 3CZLA 3W1UA 4O28A 3M6DA 3TN5A 4Q4PA 3I68A 5BROA 1CTNA 4MAZA 3FIGA 2DEPA 1QVBA 1TPWA 3ZZ1A 4RL3A 3GM8A 3WNPA 1QMLA 3IPWA 2D0GA 2Z28A 2PMQA 5HINA 4DQWA 3CL7A 3THCA 3SBFA 5AY7A 5D9MA 5HNUA 3WQ8A 2QLYA 3HQNA 1Y5VA 4A3YA 3S2JA 3C0LA 1NP0A 3VNDA 1UKSA 3PUOA 1PHQA 3S83A 1JL8A 3W75A 1AD1A 2NSXA 2ZE3A 2NV2A 1P0EA 1IIGA 3FA5A 4FZIA 3NQMA 1ISZA 3VD4A 4P8UA 5CKSA 4L4MA 5H8UA 1CXIA 1LORA 3FY1A 3T0CA 3G1RA 4A2SA 1NH6A 3QR0A 1FBAA 3GNPA 1Z48A 3QR3A 1J0JA 5D33A 4M81A 3UR2A 3E2QA 4J35A 2XTKA 4D8ZA 1XIFA 3CZKA 4FAMA 3IK4A 1F3TA 3K8LA 3BZJA 2HBVA 1KV5A 3AIWA 4I5UA 3GO2A 5E1QA 4TMCA 4KERA 2DZWA 4Q8VA 2OOFA 3VKDA 4W86A 2GDUA 4ML9A 3DEQA 5CCZA 1EPVA 3TLLA 2ZC1A 1VRDA 1C7TA 2JGYA 1AODA 2PD5A 1GG0A 1I8JA 1DP0A 1TA3A 1WZLA 1WV2A 1A5AA 3PTKA 1HTIA 4AY7A 2RDWA 4AQLA 3BO9A 1SZNA 1IF2A 1Q6FA 2NV1A 3SJNA 3ZLGA 4AB4A 9RUBA 1G4PA 4IG2B 3ITXA 4AZCB 1AZ1A 3UWZA 3PZVA 1TTPA 3U0HA 2C3ZA 3NM1A 3VZYA 4WJEA 2GOKA 2QV5A 1UWRA 5KZDA 3W0KA 1XG3A 2QJNA 3PB0A 4PL2A 3W6YA 3ZWSA 1GVRA 5I06A 1B90A 1RBOB 2Z26A 5CC3A 1JZ5A 3CWNA 1VPQA 3ZSTA 2CLFA 3CQKA 4PMOA 1ME9A 2PCQA 3VCCA 1OABA 4NP7A 5H1WA 2W4XA 1AL8A 4L9YA 5EB8A 3XISA 4P2VA 3NPUA 2FZ8A 4FR1A 4ZFMA 4TR9A 1O66A 3UPMA 4H9VA 4KT2A 5LA1A 3H7VA 4JBRA 1U1JA 1H63A 2AKZA 5BRQA 4NYUA 3L4WA 4PB5A 4QCEA 5CGQA 3WH6A 1NWRA 1RP8A 2CBIA 3VDAA 2ISFA 3E6EA 2A0NA 4TU1A 3DFSA 1QI2A 3M44A 1HKMA 3WLNA 3NZRA 2O55A 2NVCA 1HJVA 1R86A 1VBGA 1UA3A 4IJBA 2X2GA 3V16A 2YOCA 3CM4A 2A6NA 3CQ0A 1XIMA 4KBXA 3WMBA 2QVHA 2C15A 3UG8A 4PRWA 3W88A 3T09A 1TJ0A 3UXLA 5K9XA 3UGVA 4YTUA 1FWBC 1SFJA 2ZCGA 2VMFA 4IICA 2PU1A 4FS9A 4N9BA 3AJ7A 1Q6RA 4CQ8A 3QMRA 4JTHA 2DZAA 2ZFAA 3BG5A 3EWYA 2PE4A 1TTIA 1XYBA 2PBOA 1WA3A 4AU0A 3OA5A 5FJTA 3H22A 4B9YA 4HK7A 1QNRA 3TYAA 3DHDA 2W63A 2Q8ZA 3IIPA 2ISDA 2I14A 2DSUA 4W87A 2V8ZA 4RXGA 4H7ZA 3GK0A 5AHFA 5JUVA 2QF7A 3OQ8A 1U83A 3IWPA 1TV2A 4ICCX 3GXIA 2DT3A 4ERIA 4HCDA 3KWXA 3RR1A 4ZO7A 2R6OA 4LVGA 2G50A 2YCLA 4A8NA 5LHEA 1TVLA 3N2MA 4WJXA 5BXRA 4MG4A 4H04A 4L4PA 4LXFA 3BW4A 1KBBA 1FVPA 5JMUA 2PTYA 4BI7A 1TPEA 3ARTA 1XUUA 1S5WA 4QE4A 3MTWA 4H6QA 5T8GA 4QJ3B 1W9DM 4G6CA 2HS6A 3E12A 4GO9A 3IEBA 4O11A 3ZLFA 5HMFA 1DQXA 2YSWA 1BAGA 4R7WA 4Z08A 1K7XA 4RW5A 4O0QA 4JIIX 2WWCA 1CYGA 2BV9A 2BY2A 3EOOA 3AI0A 3GXNA 3TIMA 3PSVA 4L6DA 1W54A 4IPPA 1TJPA 1TX0A 2E25A 3S2NA 4DBEA 4O1CA 1WZAA 1OYCA 1C92A 1MVYA 1X8FA 5I0DA 3P62A 4M6QA 5CJMA 4DZHA 1IQ8A 2AKMA 2DZSA 4OBRA 5C54A 5B7ZA 2R1MA 4TX8A 1R3VA 4DF2A 3T2PA 1EIXA 4PN2A 1WDSA 3AHYA 4C6BA 2YW3A 3SQMA 1YNQA 3LHWA 4JD4A 3TSDA 1M65A 4PTWA 4GNJA 3AHVA 2J62A 1YQ2A 4A8IA 2UZ9A 3THDA 1MDRA 2QJGA 4Q6JA 2PWVA 1R38A 2NVAA 2BZNA 5H2ZA 1L8PA 3GFXA 3FYPA 4H4IA 4GPNA 4GJJA 4ZSTA 2GGEA 4OTKA 3MBDA 1LG2A 4MKSA 4MYAA 3DBPA 1AW5A 3T2OA 4UOZA 4DBUA 3AS1A 3ABQA 1JZ3A 3CV1A 5BRBA 4LCQA 2RH9A 4ZTXA 2VEIA 1QI5A 1R3QA 4O4WA 4YVXA 3AHZA 2I57A 1OFPA 3E0LA 4XZLX 2X2YA 3T05A 4QR6A 4LV4A 5HJXA 3WH5A 1PS9A 4HSNA 4XAGA 5BYWA 2OU4A 4JR5A 4IIBA 5CPNA 4KKXA 4O50A 3CAQA 3W28A 3CPGA 2D1ZA 3TV8A 3EX1A 2PRMA 3ATZA 1A4MA 3R0UA 5AYYA 1IE7C 5FL1A 1C8QA 2VX5A 4PUMA 3TAOA 1JPMA 2OMAA 3AUOA 3W7CA 3WQDA 1FX6A 5AC8A 2AMXA 2OO6A 5IHSA 1E5NA 3CUJA 3OLGA 4EF9A 3QM3A 2QIWA 5DF0A 1QR7A 1SM9A 4YCPA 2A7RA 2R1KA 1QO5A 2PWHA 3F2CA 5AN7A 3Q67A 3PZTA 3TAKA 5XIAA 1DIDA 2ZX7A 1UD8A 3PN8A 1ADDA 3ERPA 4BJHA 1KCXA 1H5VA 1EJTC 3C5QA 2CXEA 2VR5A 3KLLA 3G0SA 4XAPA 4A35A 1KBKA 1NTHA 4WY0F 3FK4A 2CZFA 4CN4A 1YDOA 4GZEA 4I6VA 1UC4A 4V27A 4IUGA 3GU9A 4JIHA 4C60A 2ZWYA 3IVUA 3H7UA 4NRSA 1P6CA 2WJZA 1B30A 5HJYA 3TZNA 3GZ3A 1V3HA 3ZFHA 4GUGA 3KM8A 3TNOA 1JDAA 3RLHA 1YYAA 4MJZA 3ITVA 1M41A 3NA8A 2G37A 2QS8A 5HDRA 1GOOA 1B5TA 3D3AA 1KM2A 3H21A 1W56A 3UQNA 1NWSA 1H7OA 2ZOXA 2VRJA 4C5YA 4QS5A 2HVMA 4LOCA 3QJAA 3DECA 4E6MA 4O15A 1QI3A 3AIVA 1F3EA 3H6OA 2PI6A 1T41A 4UTIA 2YJQA 2H3DA 2Y7EA 4A3UA 3L4VA 4HYVA 1LOLA 1WDDA 1R3WA 1AJ0A 1VHCA 3QFEA 3V5FA 2XIOA 3MMDA 4PUKA 3TJLA 3NQ6A 1SJBA 2C1GA 3CUIA 3BLOA 4OBTA 3BL3A 3DHFA 4RX0A 3WF3A 3TA6A 2VOMA 4FF7A 2WHLA 3WNMA 3WK1A 2JFEX 5M17A 2BGQA 3TLQA 3S1GA 1CT5A 1K02A 1ITUA 1XQKA 4LCRA 1OBAA 3I7SA 1AVAA 4AVNA 4AHQA 1F76A 5HMDA 1QI0A 4C6JA 4UTTC 2XGZA 3DBNA 5ABFA 1O1ZA 1TMHA 2BX7A 4G1NA 1A5OC 1PX4A 3UY8A 1PX8A 2BASA 3OZPA 3IAPA 4PMQA 1T8XA 1ELSA 2DSWA 3TWBA 3S2MA 3TYBA 3L4XA 5I03A 4W5UA 2YYTA 2H8ZA 1LBLA 3UZJA 3VDHA 1Q3NA 3O6AA 1IXQA 1ZP4A 2PC4A 2ZRYA 3VGEA 1E71M 4PTMA 3ARXA 3T4CA 2WCGA 3T2QA 2WBGA 4HP5A 2HE5A 4YN5A 2WWDA 4M1BA 5LXXA 3WH7A 4UCFA 3CYVA 4LAZA 1XYZA 3NAVA 2GQAA 2IS7A 2YKKA 1GTHA 2CLLA 2ISVA 1CXEA 3H4XA 4I9MA 1KFWA 4FP1A 1GJPA 1SJAA 2V3FA 2VZUA 4LRTA 4RJEA 2J78A 1XLDA 2EPNA 3GC4A 3GTIA 4AEOA 1RD5A 3V0SA 1BWLA 4FX6M 6REQA 3IRDA 4ZB0A 3UXIA 1M9HA 3VUSA 3II1A 2J74A 2XH4A 3MB9A 4H9UA 1XLLA 1JULA 5AHIA 4JXCA 2J88A 1XM3A 2XFYA 3G24A 3MYOA 5G1MA 2Z1SA 1J5TA 4LC8A 3TMLA 2OVLA 2ZZ4A 3NZPA 1TE1A 4H8VA 4LNYA 2NQ9A 1HKVA 1TB3A 4W8LA 2XVGA 1NVMA 5D2YA 5AC6A 3PVFA 1JRCA 1WXZA 4H83A 5H91A 2QCMA 1REQA 3HB9A 3HG4A 2DT2A 3H55A 3EKLA 2VR2A 1VCVA 4JFSA 3B9NA 1GOWA 4WSKA 3CPRA 4MZYA 2B7NA 3NQVA 2VRQA 5DT5A 3IGHX 1U5JA 5A8OA 1AW1A 2W27A 1OYAA 1RLCL 5JH2A 3QH2A 1AH4A 4S38A 2GSJA 2Z1KA 4LV9A 2JEQA 5KETA 2VGFA 4L64A 1HZYA 3VD7A 1JZ2A 4D6JA 4S2CA 1JCTA 5IBXC 1M1BA 2DZBA 3HU7A 1RK5A 4GQGA 1ITCA 3EAUA 2BOFX 2P0IA 3QV7A 2OODA 4INFA 1LT8A 3DI0A 1A5LC 1V3KA 1W5QA 3LQGA 3VMNA 1V0NA 3ICJA 1H0GA 4J2MA 2BXZA 3GAYA 4N9DA 3M0VA 4GOAA 1KM3A 3D47A 4DJED 4E2DA 4HVXA 1P0DA 1J2BA 3L0NA 1D8WA 3UWQA 2WC3A 3HURA 6A3HA 1H1NA 4WRHA 4FPSA 3W29A 5F4SA 3CU2A 2A4AA 3CBWA 1K7FA 2Z6IA 3C2VA 1JUEA 4RR4A 3LQLA 4PTXA 1YDYA 3BQ5A 1XKJA 4ZQCA 1TV4A 4WSJA 4UUIA 1F74A 3LPOA 1OYBA 3SGGA 4M80A 1W9VA 3MUY1 1KFKA 1H3GA 3DAQA 3HA1A 1RY8A 2G5WA 1JFHA 1VR6A 3W72A 1IWAA 5FKYA 4MB1A 5DY3A 2WLYA 3HBLA 4UQBA 2RUSA 1H62A 5BU6A 3F2BA 3EEZA 4ZTYA 2IQ0A 3QXBA 3LY0A 4J40A 3WDIA 1KR1A 4L65A 1MNZA 2QPSA 2OXNA 3A4WA 2H90A 3C0QA 3EGJA 3HJEA 2ATSA 1SR0A 4AWTA 4KPLA 2A3LA 1UZHA 3R94A 1TVPA 1CGVA 1HJXA 2E1WA 1YPXA 3UT0A 2X16A 3ZMRA 2VC5A 3BGAA 3OEXA 1RCQA 3V1PA 1DOSA 3UJRA 4MUZA 1EJWC 1SGJA 3WLJA 3V3WA 1DXEA 1J01A 4ZE4A 1LG1A 4UR7A 2PDIA 1V03A 4DYEA 4X61A 5HQLA 2GVLA 2O4QA 4GMEA 2A85A 3GH7A 3GDRA 2WJFA 3CTTA 3UZZA 3UR8A 4S3KA 1FWAC 4FA3A 1TG7A 2BOEX 4OE7A 4ZSUA 6ALDA 1YE6A 1GYMA 2BGNE 1A47A 4PSPA 1E9YB 3LU2A 2QDDA 3ZM8A 4IJCA 1J0HA 3MP4A 5E6YA 1HW6A 1LF1A 2ZRZA 2P3EA 3WELA 3GR4A 3R1ZA 3W73A 4ZO6A 3JW7A 4AZ5A 3MJMA 1NJJA 1R6WA 2QCGA 5KTLA 4X0NA 2DY3A 3WK0A 2OTDA 1EHNA 4DJDC 4Y2WA 8RUCA 3M0XA 4YNGA 7TAAA 3B8SA 4MNMA 2EKGA 1TCMA 4NZ1A 1K03A 2YX0A 4MB4A 3EWUA 4ZOBA 1MEHA 1XIBA 4MUPA 1KRCC 5JIWA 4HOWA 3OBEA 3GFZA 5GJNA 5FL0A 2QJHA 4NXSA 2V5LA 3TOYA 2ZADA 3WJWA 2DSKA 2E6AA 2ZX8A 4HMNA 2H8XA 1UZ4A 3FYYA 4QCFA 4MNJA 3VGGA 2EPKX 3P3BA 5A94A 1EYEA 4QAIA 1K9FA 2GGJA 3UPWA 1KNWA 2DT0A 3PJXA 4E3VA 2J9ZA 2Q09A 1VFLA 1YLVA 2OLAA 2J6XA 3WEOA 1YTDA 2Y6ZA 4GFSA 3GDKA 4M7SA 2F8QA 4RE3A 1UD5A 1XJBA 3KEHA 1FDZA 3K8KA 4NVTA 4PMDA 4YLWA 1XQLA 3CGTA 3E38A 4YVPA 2JKAA 1MEWA 2P3ZA 2ZKMX 3V5OA 4KRUA 4I5XA 3D46A 4D6CA 1UJPA 1Y8BA 5FJIA 3SEPA 1XLBA 4DWDA 3JS3A 2DZVA 3VA8A 2WNQA 4XUGA 1MXDA 4MHBA 2PTDA 1JZ7A 2JIWA 4LVAA 1W31A 1FY6A 2WMJA 4RZ4A 4K1WA 1UD4A 3TC6A 1UH4A 2O7SA 1LDCA 3WQCA 3N13A 4XZWA 3IIZA 2OB3A 4A29A 4PL1A 2CLHA 1QK0A 4LS2A 2YYUA 1G67A 4J3VA 4FOUA 4XSMA 1HL9A 1YXDA 3ARVA 2P8BA 2OEKA 3NO5A 4ZOAA 2ATMA 5AYXA 4O52A 1V79A 3N14A 1UD3A 3EXTA 3W7QA 1YDNA 5MHBA 2GJXB 2FDSA 1WDQA 5HBFA 4AZBA 3WBWA 3VKAA 2FPVA 5IFTA 4GRSA 1WKYA 3FGCB 4PODA 3BSHA 3DKJA 3LD5A 1XCXA 2GDVA 1C8YA 3FV9A 1BWVA 5I3FA 2J7DA 4AIOA 1RCXB 3P60A 5EMLA 4NUWA 2PPGA 4GXWA 2WW5A 1BWKA 2JF7A 3M0ZA 1NM9A 1PKMA 2OT0A 1W1ZA 1ME8A 5CPQA 4DIAA 2QKFA 2E9MA 4E2VA 3RK8A 4N4PA 2GJPA 4ZBCA 4FX7A 1JNDA 1XL9A 2QMKA 1MQPA 3UD6A 4CEXC 1YXYA 5D37A 2YPIA 3LCIA 4U4MA 4GVFA 1B4EA 2FJKA 3ABZA 1JDCA 3CT7A 4PBFA 1QOXA 1CZ1A 4RPQA 2DORA 2BGSA 4QG9A 4XX6A 4OV9A 2C8NA 5CQ1A 4JAWA 3K4WA 5K4ZA 4F2BA 3GNXA 3CXOA 1SR9A 1XR2A 2E67A 4QGCA 1QI4A 3MWAA 4UTHA 3TCEA 3FXGA 1NFBA 3NL5A 2JF6A 3SCNA 2ZTJA 2EF9A 1CNVA 1GQIA 4MTVA 2J25A 3MKKA 1XGEA 3BG3A 1OFBA 3HPZA 5AC5A 3LMZA 4HPGA 3OU8A 4C5ZA 2OPJA 4U2ZA 5HAOA 2O9TA 5DBUA 5LGZA 1T8QA 1JG9A 4HU0A 2BP1A 4OZOA 1V7AA 5IBXA 1BLIA 2AL1A 3R5EA 4JCMA 3M5VA 3DCPA 4IQJA 2A3CA 1V4YA 3KOXA 2CC0A 4UNIA 1HVXA 3LCFA 1V6TA 5HWMA 3R0KA 4RDVA 3GB6A 1DJIA 4GQRA 5M1TA 4KFNA 4Q8TA 1CENA 1DJHA 2Z1WA 2UY4A 2J4GA 3V7PA 3LPPA 1OK6A 4K38A 3WNLA 3VIMA 2ABBA 3G1SA 4MZ8A 4OVXA 5D04C 1FWTA 4MFDA 3MO7A 5AYIA 3STCA 4WXZA 3MDUA 4ZQPA 2V9DA 3U5UA 1J11A 1C9WA 2EG8A 2REQA 4MSSA 4GUFA 5C9ZA 1BGAA 2IXVA 4OUEA 4AF0A 1R47A 4KEUA 2W6RA 1SQ7A 4URIA 2A7PA 1E51A 3KWSA 1GJWA 4A6GA 2J7EA 1W6TA 1CXKA 3W01A 3W84A 3G1HA 4NJKA 1PIIA 3STGA 1BYCA 1SVDA 4HYRA 4KS0A 4DNMA 3PY2A 3TDFA 1U5VA 4CNOA 4JZ5A 4H3DA 4JQ4A 2YDRA 3AOFA 1OX5A 3VDGA 5DT7A 4AAJA 2F61A 1I9CB 1BSLA 1UQZA 5CZTA 1E6SM 2FZNA 3EBVA 2R91A 1V3IA 4FK9A 4P7QA 3OYZA 2DU2A 1NOFA 1R30A 2OSXA 5JBDA 3ZYZA 3SJ3A 1NIUA 3ECQA 4HOZA 1O1HA 2V5JA 4H9YA 1XP3A 3AZTA 1BVZA 2GDQA 4NT0A 1D3HA 2IPWA 3KS5A 4FLRA 2NXHA 1FWHC 2J7BA 2E28A 2J27A 1VPYA 2XYLA 2HEJA 2O4MA 1AK5A 1WDWA 2DSZA 4Q4RA 4C6OA 4H6EA 1SO5A 2VI0A 4A3QA 1GEQA 4RXFA 4TQTA 4HK6A 4C6LA 2BBFA 4RE0A 2BVDA 4WY0A 4GKTA 1AMYA 3W25A 1GYNA 3HFTA 2G8ZA 3R25A 3AXHA 4QRNA 4JQAA 3MV01 2P53A 4MOZA 3HIJA 3PBUA 1PAMA 4DO4A 2PDMA 4HOXA 4PYSA 1T99A 1DVJA 2CHNA 3IK2A 3CEUA 4ZQMA 1WXYA 2R82A 4HBKA 2WMHA 2FMOA 1DWIM 3N4EA 4ML4A 4U5IA 1ISXA 3FLUA 4NHVA 1B2YA 3AC0A 4K7YA 1RP9A 2DQWA 3UFYA 4IT1A 5DELA 3NEVA 3VGBA 3N2BA 3TR2A 1O94A 3NTYA 4Q4SA 1X6NA 2D20A 2NX3A 2Y2WA 1VYPX 1J6OA 2ZXDA 3B0VC 5A6AA 1H7NA 4WVXA 4ACZB 3HGRA 2R94A 2AQOA 3GZAA 4HTYA 1R85A 3BGGA 4MVAA 2BY1A 1OD0A 4Z2HA 1DV7A 3IVSA 1L2UA 1GOQA 4KFPA 3GWQA 4GVIA 1QBBA 3VOJA 1LZOA 1TPVA 4Y9NA 3B03A 4O19A 3ATYA 5C8BB 1Q66A 3GXFA 4WQ6A 4PMZA 4QSFA 2QCDA 3M5ZA 3S8HA 1KWGA 2A3BA 4CCDA 1WO2A 2VHLA 4BI5A 4Y8FA 1VPXA 4FOJA 3AS0A 1RH9A 1WOBA 5CSRA 4ZQOA 1J96A 2KX9A 1XDJA 3P0WA 3N9SA 3SRHA 5T9CE 4QAWA 4KIRA 1EWEA 3P6LA 4QE5A 3DERA 3OBKA 4UMBA 1G94A 6XIMA 1QT1A 4CCZA 1MYRA 2X40A 3G0UA 3GR7A 1ZU8A 2NSOA 4IMEA 1UR1A 4YTSA 1P6BA 2CFFA 4PE8A 1E73M 4QJ5B 3ZVHB 1TIMA 1UWTA 2Z0IA 5TF0A 4ADUA 1E40A 1SZGA 3TX9A 3R79A 4H7CA 2YCKX 1IT7A 5AZ0A 3VZXA 3VD5A 2FB2A 4OFCA 3P84A 1TWSA 4LVFA 1HG3A 4GCAA 4HU4A 3LHZA 4FB7A 3VM5A 2XH7A 3TJXA 1KD0A 4G5DA 2GQ9A 4D6GA 3PPFA 2VVNA 5FEWA 3VI2A 1GG1A 2VGGA 4K2SA 2VJXA 4KGLA 2B0MA 4P8WA 3C2RA 5H8MA 2A3AA 2IPFA 1GWJA 3NQ8A 3DN5A 4M51A 1EX1A 2IW0A 4BFAA 4IFOA 1DJYA 1DKWA 1TJ2A 3UZ5A 4LQ1A 2XSXA 4LUSB 3WNNA 1TREA 4ROPA 2DZXA 1IV8A 2VL4A 3WK2A 2O9PA 1ZS2A 3WLMA 1RV8A 1EH9A 4NJJA 3AU6A 2FZBA 4L80A 3SGZA 2PDKA 4GIRA 3GE7A 3ZXWA 4UNKA 3RUBL 2RAGA 4W4QA 4IPIA 3PNUA 1HL2A 2VX7A 4LAKA 1UKPA 1FFQA 3UG5A 3R8RA 4D2JA 4WGHA 3ZJ6A 3K5XA 1XHGA 5B7YA 3CHCA 2VVSA 4C1NA 3TYEA 4I9JA 4YCOA 4CQAA 3SCSA 4GC3A 1GHRA 1HJUA 3BURA 3LRKA 1VYSX 5F2GA 1QATA 3N19B 4O1DA 2DVUA 3O6CA 1DXFA 3DHUA 3AXKA 3ONBA 5MKGA 1KBJA 4QJ1A 1A3HA 1D3CA 3W9ZA 3VC6A 2WMFA 2TSYA 1EOKA 2C0HA 3G1FA 2YR1A 3S5OA 3W83A 1QW9A 4DXXA 1V02E 1I1WA 1XCWA 3GLCA 3LBOA 3CAKA 3VNLA 4CUCA 5DMNA 3QY8A 4CQBA 4QEHA 2GL5A 4DEFA 1X96A 4DM2A 1UD2A 2QUTA 5FACA 3CMJA 2WSYA 4K8EA 4J3ZA 2ZUUA 5FIPA 1E3ZA 2WO5A 1DHPA 2YFNA 3NSNA 4OJYA 2VURA 1KTCA 3ARZA 4K36A 3ITOA 2Y0FA 3W2KA 2ZBTA 1A0EA 4HQVA 2OKOA 2SFPA 2CHRA 3VFCA 5FJJA 1YPFA 1W1TA 1YX1A 5A8GA 1VS1A 1VJSA 1ZQ5A 2YFOA 3V35A 4HZ8A 4CNSA 2Z1BA 4MNLA 3VCRA 2FH6A 2PDGA 5I3KA 3UXDA 2YCIX 2WPBA 4NJHA 1FH8A 4AY8A 3C2EA 1DE5A 2QGYA 4WXYA 5DO8A 4R34A 2YW4A 3TW6A 1QOQA 1EQPA 2NQLA 3AMCA 2OWWA 4NIRA 3GIPA 4GHRA 2O92A 1V8EA 4GFIA 4NKCA 2PFHA 3SCRA 3GS6A 4QBXA 1UP0A 4ES4A 2Y62A 4AEEA 1K70A 5I3DA 4GCXA 4A3HA 1DIEA 2F38A 4DWSC 1JZ8A 1F6KA 3FX4A 3BG9A 3PF3A 4K1GA 1XLHA 5A6BA 3KW3A 3IUDA 4EANA 3KP1A 2WCAA 3B9OA 1H7RA 2Y8KA 1VEPA 1UW9A 1R3SA 4A3RA 2FFCA 3TEVA 4DAFA 1G7VA 3UXAA 4HSHA 4LYKA 3ABRA 2D73A 3LCHA 4LW7A 3K46A 3OLEA 1S1PA 4IFKB 3GG7A 3WDHA 3AISA 5I3HA 1OFQA 5F1UA 3NSMA 2XVKA 1UWUA 4Q8OA 1I2RA 2IXUA 4L1GA 4UQ9A 3QV6A 3Q37A 3VK5A 4DWSB 4LUTA 1W3IA 4LX4A 2ZX5A 4DF1A 1W1YA 2GLKA 3BMXA 1AH0A 4PBGA 4DO6A 1EOMA 4OKDA 4IM4A 1T0OA 2B31A 3QGKC 3PG9A 4A05A 3AU2A 1EPXA 3S5YA 1BFNA 1TYGA 3C86A 4PTNA 1VBUA 2NQHA 2POTA 4RZ6A 5LXEA 1EDQA 2ZRUA 5ECVA 1RQEA 3GTXA 4F0MA 1PZ3A 1PCKA 4JNMA 2XGIA 1DWFM 5D4YA 3VTRA 3UP8A 1CB2A 3B04A 1RALA 4KEZA 4GNVA 3AIRA 4CD8A 4O1BA 2EHHA 1JQXA 4RE4A 1OG0A 3TQ0A 3NXFA 2FTYA 2YL9A 4DXVA 4XBKA 3H53A 2FDMA 2PDFA 3I3DA 3HM7A 1B3XA 3KDNA 2WVVB 4UTUA 1POJA 1V3LA 4X60A 4G9PA 3RMJA 4IIEA 1C3FA 1RZMA 3VNYA 5DY2A 5I5RA 5IOBA 2XIIA 2CIPA 4MKVA 3VX0A 5A6TC 4GZ7A 2C71A 2A21A 2I1OA 3DHPA 3P5YA 1Z7AA 2ZVRA 3LNMA 4HU8A 4E4UA 2CLOA 2V30A 4QQ3A 4MB5A 1Z6KA 5H8PA 3P74A 2GYIA 3SSJA 1UWAA 5EMKA 3PM6A 1RLDA 1XC4A 1OM0A 1U1HA 3NXLA 3UGRA 3SDOA 1QPQA 4D6HA 4RLIA 1PEZA 2EKCA 4GYJA 4DZ5A 4RDYA 1F6YA 2YDQA 3SY1A 4BY3A 3MS8A 1R2TA 2FHFA 1UMLA 2XWDA 2J7CA 2L5HA 4AMCA 3JVAA 3KZPA 4D8LA 3A9BA 2PGEA 1UROA 1HJSA 3BAIA 5HUPA 2ACUA 3R0DA 4S3FA 1E6ZA 5DMLA 3WQEA 3CUHA 1KC7A 1FWCC 2UY3A 3WF4A 2GK1B 3FKRA 1TV7A 4Z17A 2VCBA 3A4XA 1J10A 3C8FA 4M0XA 1RUSA 1POKA 3Q2DA 3QGAC 2NT1A 4RNHA 4I3GA 2Z27A 1I60A 3AZSA 2C91A 4LSBA 2PB1A 3W53A 4JL2A 3NJ3A 3PBYA 1EZWA 1Y7VA 5D8WA 1YADA 3GW3A 1TPC1 4JNYA 4B5WA 1DXIA 2UBPC 3WH8A 1CGYA 1RBLA 4WD0A 4GG9A 3B4UA 3NQ2A 1JD9A 1XYCA 3H54A 4MM1A 2G4FA 1PZ2A 6ENLA 4WLCA 3S9ZA 4RNIA 5I2UA 4K3ZA 4X9YA 9XIAA 1B3YA 3HPFA 3WLHA 1EJVC 3KTXA 3E2SA 1M01A 1UJQA 2QIIA 1GW1A 4EVZA 4LT9A 3DU0A 4KW2A 1GVSA 4FNTA 4UFJA 3BV7A 2V3GA 2G3IA 1WX0A 4UMAA 1K7EA 3U2CA 4ATDA 3JUGA 2E1DA 3MUCA 1EZ2A 2OGYA 3VOCA 4UOJA 5AECA 1UBPC 4AHPA 5C9XA 1CCWB 3G1DA 1A5UA 4KWSA 1Q8AA 2RGMA 4Q4MA 4P7LA 5HXMA 4CQCA 1OFEA 1W5OA 5TAOA 5HATA 1GVOA 1E5JA 2ODOA 1UBSA 4PMVA 1AQMA 1F4HA 4DPQA 4JTEA 2XVLA 1ECQA 5FJRA 1OQFA 3MKCA 3FFSA 1K8ZA 1OX4B 3EXRA 2CPUA 4WDUA 3NG3A 1Q6CA 5K7JA 2JKPA 3CASA 4ZVJA 2YZ5A 5DLCA 3KXQA 1EBGA 1WPCA 1DBTA 1AQ0A 4B5TA 1VLIA 1AD4A 2XN0A 4XKMA 1RD6A 4Z1CA 1L6FA 4ZGYA 4DO5A 5BNKA 3CHFA 3ELFA 1XLCA 2WHKA 3AXMA 3PZMA 1WAUA 4YHEA 1PYFA 3BMVA 3SN4A 2X05A 3WY1A 5ABEA 3K13A 2QUNA 4XIMA