1OY0A

The crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
262
structure length
248
Chain Sequence
RTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFTPGDAAEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFSGAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ketopantoate hydroxymethyltransferase
publication title The Crystal Structure of the First Enzyme in the Pantothenate Biosynthetic Pathway, Ketopantoate Hydroxymethyltransferase, from M. tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 87
structure length 248
sequence length 262
chains with identical sequence B, C, D, E
ec nomenclature ec 2.1.2.11: 3-methyl-2-oxobutanoate hydroxymethyltransferase.
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02548 Pantoate_transf Ketopantoate hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1oy0A00
1JDEA 1XG3A 3SRHA 1Z6KA 3KTXA 4B5XA 4B5TA 2E28A 1U5VA 1F3WA 4QG8A 3E0WA 3T05A 3BJFA 2KX9A 3IS4A 4B5UA 3EOLA 2ZE3A 2XDFA 4QG6A 3QTGA 3HQOA 4QG9A 4KCTA 4L9ZA 1A3XA 4QGCA 3M0JA 2VGBA 3PP7A 3SRFA 4LSBA 4IMAA 1DXEA 3HQPA 1M1BA 1AQFA 2XZ7A 3M0KA 4FXFA 2DIKA 3P0XA 4HYWA 3BJTA 3SRDA 4B5VA 1OQFA 1M3UA 4KCUA 4ROQA 3N25A 4WJ8A 4KCWA 4KCVA 1E0TA 3ME3A 3OYXA 4L7ZA 3H6OA 3GG8A 2OLSA 2HJPA 1F61A 1IZCA 4KS0A 1OY0A 4G1NA 3EZ4A 3T0TA 3PUGA 1S2TA 2R82A 4IQDA 1ZJHA 1DQUA 4L80A 1VBHA 1U5HA 2VWTA 4B5WA 3HQNA 1F8IA 2BG5A 2L5HA 4FXJA 1O68A 2VWSA 2X0SA 1PYMA 4TV6A 1F3XA 3FA4A 4KRZA 2VGGA 1KBLA 1O5QA 4B2DA 2HRWA 1PKNA 4B5SA 2XZ9A 4DRSA 1DIKA 1PKLA 3SRKA 1T5AA 1A5UA 2V5KA 3B8IA 4MG4A 1GGOA 4IQEA 2DUAA 3I4EA 3OYZA 3E5BA 3QQWA 1S2UA 3OQ8A 4JPGA 3MA8A 3GR4A 1MUMA 1PKMA 1DXFA 3U2ZA 3G2GA 3R4IA 3VAVA 3QV6A 1XG4A 3GQYA 4L9YA 3T07A 2HWGA 4HYVA 2V5JA 4IP7A 4RPPA 5TAOA 1O66A 1SGJA 3QV7A 1A3WA 1PKYA 1ZLPA 3QLLA 2WQDA 1KC7A 1E0UA 3EOEA 4YJ5A 3LG3A 1S2WA 3LYEA 4MF4A 1S2VA 1VBGA 3FA3A 4YNGA 2QIWA 2VGFA 1A49A 4B2DD 2HROA 3KHDA 5JVLA 1IGWA 3EOOA 3QZ6A 2VGIA 1UJQA 3E0VA 3QV8A 2G50A 3QV9A 4TV5A 1F8MA
chains in the Genus database with same CATH superfamily
7ODCA 4FNQA 1H3GA 1GVEA 3F1QA 1X7FA 1OK4A 3ZVHA 4ZB0A 3UP8A 3WQ4A 1LG2A 3AZRA 4RK8A 1IZJA 3W1QA 2VENA 3PTMA 3KX6A 1YX1A 5DCEA 4MDPA 4DWSA 5A8QA 5GQBA 5E70A 1B0IA 4ZCWA 4EAMA 4EWND 2VKZG 4M1RA 4W7VA 5GJPA 2YPIA 5LHEA 2R14A 4BEUA 5G2HA 1Z3NA 1WYIA 2RGLA 2VZTA 1JF5A 2FB2A 3A4JA 4UTIA 2W67A 7ENLA 2E5DA 2GQ8A 3FDGA 2PDNA 2G3IA 4AZ7A 4MPKA 4CQCA 1TJ2A 5A2AA 3TCSA 1ITUA 5G5IA 3LSBA 4P8UA 1LTDA 3LPPA 1JQVA 3K8LA 3EWDA 3B04A 3IJQA 4LS2A 1QNPA 4ZA0A 2RDXA 5H8UA 3O06A 3NQ7A 1FH7A 1T6MA 5FIPA 4D9PA 1AJ2A 2QULA 3ZYZA 1KM6A 1KW1A 3QGKC 1J12A 1VBGA 3BAKA 3UYIA 3NTYA 5CZJA 1GEQA 2IS7A 3U7VA 5HR6A 1EGMA 1ZGDA 2QJJA 1PCKA 4X9SA 2PA6A 2XHYA 3ABXA 4C6LA 4QJ4B 3PJTA 4JL1A 1OYBA 5C9ZA 3GTNA 1C92A 3VZXA 4JNZA 3FYYA 1VLIA 1YPFA 2XIIA 4Q22A 2ZC1A 1PAMA 2HNHA 1BYBA 1JVNA 1WDSA 2WKLA 1ZAHA 3LA4A 2JALA 3VIFA 4J5NA 3AHTA 4JN6A 4LEFA 2J8GA 2WKJA 1A47A 3R94A 2PTXA 3GXFA 5CZ0A 1TMLA 3WEOA 2EJAA 3R13A 4M6QA 2QV5A 5EMJA 1V4YA 1CXHA 1FWSA 4DO5A 3TFCA 1OCBA 4O16A 3ZR5A 4DXKA 3BLIA 3E0LA 1DIKA 3WFLA 4ZSUA 3NVTA 3TLLA 3BAYA 3WUBA 1C90A 3OYZA 3DFOA 2PGEA 4LGXA 4HZMA 2FH6A 1TTJA 3R0DA 1DJZA 3CASA 3SM0A 2AGTA 1EC7A 3IK2A 3S1UA 2OZ8A 3N17A 4WY0F 4LBRA 1EXBA 3QGAC 4IICA 5I06A 5XIAA 3ES7A 3UXAA 5K7JA 4LUTB 4XZ9A 1IGWA 4LNCA 1OGSA 3IJ6A 5BCAA 2P8CA 1JDEA 3NL5A 1QNOA 1B90A 3BJFA 3LHTA 1XIIA 1UR1A 4BF9A 1P0KA 4M6VA 1N2VA 1LQ2A 1BF2A 4Z08A 2ATMA 1Z44A 4GCAA 4C60A 2EKGA 1GOXA 4A2RA 5U4NA 3DCPA 1TJPA 5IOBA 4H9VA 4PEKA 1YXDA 3EXSA 1P43A 4AIEA 2FMOA 1G4SA 1E0TA 2PTYA 5C55A 3MKKA 1LL6A 3EDEA 1A5LC 1UQYA 5CJNA 3HURA 3B4YA 3BGGA 3PSWA 1F8IA 3TYAA 4IIGA 2WYSA 3GVGA 1I45A 1XIHA 1V6TA 1F3XA 2EO7A 1BGGA 1E0WA 4P7RA 4RZ4A 3TH6A 1YDVA 3OZYA 4GOAA 5DO8A 5CPTA 3QQWA 5A6KA 3FVMA 1HKVA 2WQPA 5LZLA 2QUTA 4GC4A 5GNZA 1JRCA 4JS3A 5FKYA 1OHLA 2VX5A 4GZEA 5C70A 2VD8A 3CAWA 1EC9A 5HQLA 3HG5A 3V16A 3MBDA 1JAKA 3POCA 9XIMA 3QV9A 3PAOA 1LL4A 3W28A 1E6PA 4KESA 4JD4A 3C2OA 8A3HA 2ZRWA 5ECVA 3H26A 3ID7A 4DZHA 1FWHC 3SUWA 3AIUA 3VK5A 5MKGB 3W88A 4Z2LA 2ZTJA 1AQFA 1AFSA 2X2YA 1UW9A 1AL8A 1US3A 2OOGA 2VC9A 1R7AA 1NH6A 3KRSA 4DQWA 4UFMA 2GQ9A 3STFA 1FWFC 4MAVA 2VR4A 4LUYA 1F3TA 1O7AA 5C9WA 4IUOA 3GG1A 2Z4GA 4LUTA 3B8WA 2ON3A 4XO6A 4J3UA 1GUVA 3CC1A 3L12A 4DX3A 1JXJA 2OEKA 2WMFA 3G1DA 3BICA 1FCVA 1PWMA 3W25A 2NV1A 3PPGA 1QT1A 4TMCA 4S3CA 2Z6JA 3GC4A 3BLOA 3QXBA 3WN6A 4UTMA 5EKYA 2OZ3A 4LUSA 1WV2A 3BTNA 5T9CE 3VC5A 1XC6A 3CQ0A 4CCEA 5EBAA 4JCLA 4QNEA 5FAJA 2QGHA 4IP7A 4IIFA 4UZUA 3BLPX 3WELA 1OZQA 1R7OA 1TV8A 2GJPA 2FFIA 2CWXA 5AHLA 1XLJA 3G1XA 2FPVA 1JPMA 1HQTA 1REQB 4C90A 3P80A 1XQKA 2PUZA 1KGXA 3W1TA 5AC6A 5C8BB 1OVDA 3WNLA 1WB0A 4IP4A 5BXSA 2V3DA 3LPGA 4RE2A 5KZEA 1E5NA 3IVUA 3ZLFA 1XC4A 3N73A 3S5ZA 4H2CA 2FTPA 1DTUA 1EJWC 2C0AA 1XP3A 4RW5A 1I8JA 3B4UA 4A3QA 4DO7A 5I3FA 4UQDA 4XK2A 1N8WA 4R5EA 1BVWA 5I5RA 2KZHA 4FK9A 3UG4A 4GFIA 1L9WA 1DIEA 1KB3A 4XB3A 4PB4A 1ZFJA 4U4MA 4XIMA 3BG3A 4GJ1A 2HZGA 3JR2A 4MJ4A 4C7GA 1BG4A 4CU6A 2F2HA 1UKSA 4LS1A 2ASHA 4HTYA 4CNNA 1I2QA 1XRSA 2EPNA 2ZRYA 3RYSA 1W9VA 1F2JA 3OQ8A 3WQCA 3JUGA 4X2PA 4H9MA 2VO5A 1HZYA 3H53A 4RZ5A 3F2CA 3PBGA 4DBDA 4GNVA 3SQLA 3O7UA 4H8VA 4IL0A 2PURA 1R0MA 3E6EA 2D24A 3DESA 3HOJA 2G41A 2OODA 2QDDA 3PBWA 1Q8AA 4U2ZA 2ODOA 1HP5A 3VIHA 2Z1KA 3GR7A 4H7CA 3DYOA 2P0IA 4LWWA 3SIZA 4D1JA 5CC6A 5GNXA 1KWKA 2WVTA 4MKSA 3W85A 4O50A 2ACUA 1P5BA 2NWRA 2QDGA 3W1PA 4NNCA 1KXTA 4KCTA 4QLLA 1RV8A 4LJ3A 4UQ9A 3G6MA 4PGLA 3F4CA 3WH6A 3TTEA 1BPLB 2DIKA 2X1RA 1NTHA 3A24A 1GNXA 1XIFA 4AZCB 1XLGA 3GM8A 1SQ7A 3SCTA 3CMJA 4M1BA 4IFKB 5EFFA 4DJEA 2PB1A 3GK0A 4R9XA 3O6YX 3UJFA 2C18A 3WCZA 4MLJA 3LM3A 3AUJA 3MHFA 4B5SA 2BOFX 4C6QA 1K8XA 3Q65A 2CC0A 3MJYA 5H8PA 2RDTA 1C3FA 1DJHA 5EMMA 6PTDA 2IQTA 1R46A 1LG1A 5CSUA 4ZE4A 3WQFA 1MUMA 1PKMA 1P7TB 1SW7A 2NX3A 2VQTA 3TC6A 2Y5SA 3B9NA 3DFNA 4GY7A 4NYYA 2E4TA 4NP7A 3KZSA 2WVVA 4QS5A 4A29A 4PZVA 4DVOA 3CHDA 1KQZA 3IIZA 5FEPA 3CH9A 3BSHA 1ONRA 3P8IA 3BMVA 4RNHA 3SB0A 2ZZ5A 4O0ZA 3AJ7A 2W3ZA 4UOQA 2A0NA 3AS1A 1RALA 3OHMB 2I17A 4B5TA 1DWGM 1KLZA 1XBXA 4L6HA 2QMKA 2EAWA 2VEGA 4EP8C 5LIKX 5CSYA 1W9DM 1VEPA 1IYXA 1VFUA 3A4AA 4RW3A 4HNCA 3ZT6A 1FTXA 5EU9A 5ABGA 2QF8A 1MYRA 1AQMA 2E6AA 1KGUA 4PMRA 4OTKA 1V3JA 1UUMA 3W74A 3VIGA 4QDMA 4ZQCA 4XIAA 2NQ5A 3IGUA 4H7ZA 4S3DA 3DFYA 4GVGA 2BG5A 4KGLA 1ME7A 3OU8A 4JKMA 4XZBA 5CAKA 5LXEA 1GZJA 5IBXC 3LB0A 3LHUA 2C7FA 3H4GA 2I57A 1C29A 4CUCA 3SRKA 4Y96A 2VFIA 4QEEA 1K8CA 5KINA 4MNMA 1OT2A 2QCGA 4P61A 1RBLA 3TTYA 3NQFA 6A3HA 1A4LA 3PTKA 1NAL1 4NRRA 5CSRA 1G0CA 2AQVA 5E6YA 2NT1A 2CXEA 1S1RA 3POHA 1N82A 1TR9A 4L4PA 2VZOA 3TXZA 5AVNA 3N4EA 5LNUA 3CPGA 3VD7A 3WLMA 4PH6A 3A9BA 4AZCA 2UBPC 3UG5A 2OQYA 2WK2A 3RLGA 4BZYA 3RX4A 4A2SA 2Y24A 2XFRA 1MO0A 3WQPA 1C93A 4UFIA 2ABAA 5HMSA 4IFKA 4O1EA 1Q6FA 3KS6A 4MJ2A 3S1XA 3W1RA 5M03A 1CXIA 1I2OA 1TCDA 1W1IE 3AC0A 4XQ6A 1BYCA 2JFEX 1I9CB 4NVTA 4J3WA 1UR8A 2DSKA 3HQOA 3AYRA 5C0QA 2W27A 3DHFA 4A05A 4E4FA 4RE0A 3FEQA 4C6BA 3NVDA 2OR2A 3O3RA 3GU1A 4XKYA 4K8HA 3VCNA 2KAUC 4KMQA 2AGKA 4HU4A 2DZUA 2IPWA 2PLCA 3KVKA 3AXMA 4Q8TA 3V36A 1UH2A 2O55A 1BTMA 1W2PA 2R94A 4OJYA 1A5MC 1NQ6A 1FWRA 3CHCA 1J0YA 4DUVA 1WE5A 2WNNA 4PUMA 4GX8A 3A5VA 4X22A 4AXNA 3A4WA 4O4VA 4MTVA 1GYNA 1E43A 4XAYA 3I4EA 1SSDA 1AD4A 1EIBA 1FWTA 3VNJA 1S1PA 5LSMA 4Y8EA 2XM1A 3E02A 4HA4A 4H6QA 3N11A 3B0PA 3ARXA 3QLLA 2C0HA 3EOEA 3DFTA 1S2VA 3WK1A 2YL5A 4E2BA 2SFPA 4D1IA 1P0BA 4B2DD 2PTWA 4S3JA 4DZIA 3GB6A 1F6YA 3H4WA 1RUSA 2XSBA 4GUFA 4YHEA 5AFDA 2WPBA 3BZJA 4NNAA 1AJ0A 4HPJA 4GG9A 3KLLA 3R10A 3PS7A 3PBUA 1IF2A 3M0JA 1IR2A 2EBNA 4CCCA 3UR7A 4MM1A 1EJUC 2OXNA 1NEYA 3PPHA 4ZO7A 1HKJA 1BRLA 3SRDA 3NSXA 4HNNA 4K2SA 3ZSTA 1K4HA 4E4UA 3BCDA 1RCOB 4ZO9A 3URNA 2EPOA 1SPQA 4V15A 4PCFA 2GGGA 1H60A 2DSWA 2OQLA 5D02A 1ITCA 1XISA 4KKXA 3CL7A 3OB8A 1U2YA 4WK9A 3L68A 3H2CA 3HPAA 4RCXA 1EPVA 3T9PA 4H6EA 3IV8A 3NWRA 3LV6A 1QCWA 3MUCA 3GIYA 3GY1A 3N19B 3GTIA 5JH2A 2J6VA 1Q2SA 3IV3A 1UCWA 4S3AA 4NZ5A 1BAGA 1QDSA 3N13A 4WZHA 3M5XA 1FDJA 5KZMA 5BROA 4HIBA 4C7DA 4GIEA 3PNZA 1CXEA 4H1ZA 3N9SA 4PCPA 2DZWA 1EBHA 2Y88A 4GE8A 1M03A 1VPYA 3EAUA 4D6EA 1WDWA 2VZVA 3VUSA 4M6UA 3NSNA 4LY4A 1OIMA 4NY2A 3RPMA 3KCOA 5F1VA 2NUXA 3E0WA 3R12A 2V67A 4OGZA 3WJSA 1ZU8A 1IEWA 2R6OA 3LLFA 5T8GA 2GUUA 3UNDA 3MP4A 4UBPC 4FXFA 3CYVA 4C1LA 3L2LA 1TWIA 4WDWA 3TZFA 4HCHA 4S2BA 1AH4A 1KXQA 4UIOA 4B90A 1OFOA 2VRJA 3GNDA 3TR2A 2DW6A 3SCSA 3T08A 2OU4A 1FWBC 5D2VA 4FXSA 3UJ2A 4WIWA 1UC5A 3FLUA 4DIAA 1K7XA 1HJQA 2XN1A 4CLMA 2YJQA 3N2CA 5FEXA 4JN8A 3MSGA 7A3HA 3U6WA 3VIKA 4RNJA 5AN7A 3MUXA 1X6NA 1MUCA 1KFLA 1WUFA 1V6YA 3CV1A 1J8VA 4R9OA 2D0GA 3ABSA 3TSDA 7PTDA 2FZBA 1ZUAX 3VFCA 2GPTA 1OC7A 1O5RA 4H9UA 2QKFA 4I5UA 3CWNA 3QTPA 4NSBA 4Q8PA 4W84A 1ZCCA 1KCXA 2WSKA 4PMJA 5E93A 3CL6A 2PC4A 4B15A 1HW6A 2HROA 3WLNA 1W5NA 1MQQA 3FSUA 2PD9A 1TV7A 3EBVA 3M0VA 2PWEA 4QQUA 4ZXOA 5JIPA 3OQEA 3R8GA 5CLWA 3H55A 1TVNA 3SAZA 1E1EA 1RA0A 3F03K 1B31A 4AYGA 1W1ZA 1ZY9A 1ZTVA 2E68A 4QQ3A 3D5HA 3W7JA 1HF6A 2A1YA 3W2JA 4XG1A 5HPOA 2ZUUA 2LLEA 1IEQA 1TTQA 3E3HA 3NDYA 4OECA 3TNOA 4IL2A 4KFOA 1VJSA 1L8PA 3MCMA 2ZE0A 4AHQA 4W8AA 4A3RA 3PHAA 2YXGA 4M3PA 1E70M 1JYWA 5JH1A 4AY8A 3B9EA 4N02A 2XH2A 1HKMA 1K8ZA 3Q58A 5DMYA 4F8XA 1AODA 5A6MA 1Z48A 1Y5XA 1IZKA 3DBPA 1TA3A 4J2MA 3F5JA 1FQ0A 3PG8A 2VOMA 1PIIA 4JPGA 4C65A 4A8LA 2BXZA 1M65A 3R8RA 2JEPA 1KM3A 3M64A 3IVTA 4FO4A 3N1AA 1JJKA 2BMBA 3CNYA 1PO9A 4U31A 2YBTA 1R3TA 4WUIA 5BRQA 2A5HA 1ZRQA 1E0UA 2J8FA 4P7LA 3AHZA 4DWSC 4W88A 3B0XA 1DWFM 4ICNA 3N29A 1P6BA 2Z7GA 3NDOA 4TTGA 2B7QA 3UZWA 2YB4A 4JEQA 1Z6KA 3T05A 4AHPA 3EPMA 2IKHA 1JRBA 3KRUA 4TX9A 1MSSA 1R3YA 1YQ2A 2J62A 2A6NA 3TC7A 3P82A 1LJYA 2E6DA 2J77A 4YCPA 3DKJA 3GTFA 4ZQMA 4RKAA 1KFCA 3ATYA 3DG7A 4PSRA 1Y65A 4DBSA 3ARZA 1BXCA 3RUBL 4K3ZA 4Z2GA 4QITA 3NJ3A 3CS2A 3PY2A 4LAMA 3DYPA 2H3BA 1NF7A 4KRZA 3VM5A 4F2BA 1H62A 1VIWA 1OK6A 3MWAA 3FY1A 4G2DA 2PGFA 3C6CA 1CTNA 4OT7A 1L6WA 3WEZA 1FKWA 3I7SA 1JZ7A 3U5YA 3CB3A 1UUOA 4D72A 2GZXA 4TX6A 3E2VA 4MWAB 3AIRA 1B3OA 3GXIA 1KR1A 1G01A 3VD4A 4HU3A 2WMHA 1V77A 4O52A 5FOOA 3AUOA 3S9YA 2GGJA 1H7WA 3C3NA 2INFA 2YDQA 1KKOA 3S2CA 1VCFA 2DSUA 1OFQA 2VGIA 1VRDA 1OCNA 3T09A 3STEA 3T2PA 4KEZA 4W5ZA 4PB3A 1BXBA 3DZ1A 1EZWA 2W0UA 5LIXX 4XX6A 1HIZA 4UR8A 1R2TA 1TMHA 2YXOA 4EOUA 5I3IA 3ZT5A 2Q8XA 3VE9A 1TJRA 4XKMA 1CGTA 5CC5A 4JQ3A 4HHMA 4GUHA 4C6NA 2JGQA 1RCQA 2Z00A 2OPJA 2E3ZA 3HG4A 1CEOA 2E6FA 1V8EA 3SECA 1EJTC 1Y0EA 3A9IA 4HA1A 3OPSA 3D47A 3VZYA 3ARUA 2OT0A 3E0FA 4J3XA 3T40A 4XZWA 3W27A 4DZAA 5HMFA 4ZOEA 3ZOAA 4C6FA 2OO6A 4Q4OA 4HCLA 1T0OA 1XGEA 2Y5EA 2BTMA 3CHFA 2EF9A 1OWQA 4R53A 2QCCA 1F74A 3WQ5A 4HPHA 1AK5A 3ANUA 3NXFA 1IIHA 4KPLA 3CMFA 4Q8MA 4XAGA 1VBRA 3TJXA 1EPXA 5FACA 5A69A 5K2ZA 2FMNA 5A5WA 2CXGA 3GG7A 1TV3A 4PUEA 1L6SA 3CB8A 1EGVA 4RUBA 4B16A 1SO6A 3UA4A 4RJEA 2CWNA 4GQ0A 3EOUA 4Q32A 4Q6XA 3GW3A 1I75A 1S3TC 1OB0A 3E1F1 2YFNA 4B5UA 2A7PA 1D3GA 3DHDA 4CGTA 2QCNA 3N34A 3OZOA 3QHMA 4N42A 5HNNA 5FSEC 1E6SM 4BF5A 2CITA 1GPFA 4IGHA 2BX7A 2OWXA 2JGYA 1HKIA 1A50A 1YHTA 4LQ1A 4C1NB 4N7QA 2E9LA 2QS8A 4V27A 1GEHA 3ENLA 3NPUA 4IUGA 1YXCA 2CBVA 3P62A 3MKCA 3R7MA 1FOBA 2ZRXA 3NL3A 2Q6ZA 5DLCA 1BG9A 4TV6A 1FFQA 4FIRA 3OBAA 4OVXA 1JYVA 1E0XA 1LBLA 1EEPA 3MV01 3MC5A 2VOTA 3W75A 3KBSA 2YCJA 1JDCA 4ZOAA 4FX6M 3MKVA 4RLIA 4XTDA 3QHNA 1KGWA 4UFKA 3W2KA 2XVGA 3ONCA 3VX1A 5FJUA 4HPNA 3MANA 2VVSA 2A4AA 3PB0A 2XVKA 1J0ZA 2OEMA 2P10A 3WBYA 1FCBA 1W3TA 4CNUA 2CBIA 3KOXA 1EBGA 1UD3A 1B3XA 4JIRA 5A6LA 2A6LA 3AROA 2NQZA 4JTFA 1XDMA 2IUZA 1B5TA 2J78A 4GFSA 4D8LA 4IT1A 4KQNA 1H1YA 3II1A 1FWDC 4ORIA 3AMKA 1ZS2A 3WDHA 2P0OA 2FIQA 4UCGA 4L65A 1UMLA 4Z42C 3THQA 1H49A 4HPGA 2YW4A 1KFEA 3APYA 3ELFA 3UFYA 1MNSA 6ENLA 3DAQA 4MY9A 2I7GA 3HTWA 3TN4A 4POCA 3EKGA 3N25A 1MUWA 3WNNA 4S3BA 4YU1A 3VDBA 3RCNA 4JX6A 4FOKA 2PBOA 1LL7A 4FX8A 3UXKA 3O6DA 2JF6A 3WF0A 1U22A 4ZB5A 2JBMA 3ITVA 4IF2A 3O05A 1QHOA 3W7GA 1GOMA 4JL2A 4AEOA 1FX6A 1QWKA 2WZIA 2QZRA 1Y8BA 4ZBCA 4U28A 4ILSA 1EDQA 4U3AA 3ALGA 1WA3A 5CPOA 4BI5A 1PEZA 3VAVA 1E9LA 3GQYA 4C1NA 1LBFA 3LCXA 1ME8A 4FNPA 2PDCA 4B3KA 2O0TA 1BYDA 1G94A 2V2DA 3EMZA 3QMTA 4QNWA 3QZ6A 3STGA 1Q45A 3N3MA 1LWHA 4LEQA 1GJPA 2UY2A 4LAZA 5C5YA 3I6EA 4HZ6A 1VFSA 1NDZA 4WCJA 4GXPA 1AW1A 1FDYA 2WSPA 2VURA 5I3KA 1VS1A 1B3YA 3CIVA 3M7WA 1X38A 4UTTC 3HV8A 4ZQNA 4DY1A 5C2GA 3A12A 5EFDA 1XD0A 3WLTA 8CGTA 4GY1A 1WDDA 4X63A 3VGDA 3QY7A 3W23A 1X1OA 3GVWA 3M16A 1JFXA 3N3TA 3U4AA 4M0XA 3KCLA 3VOCA 3XISA 1Q63A 3GTHA 3VVGA 1J5TA 1DHKA 1T96A 4UR7A 4BHYA 2ACRA 4GVFA 3CK5A 2OGJA 4D6JA 1VCVA 1GQKA 3W2UA 4KERA 1W1TA 1XV8A 3ANYA 5G2WA 1NARA 3TMQA 4AC7C 4K6AA 3J7HA 4N9BA 3WD3A 4GLEA 2NVDA 3DERA 2OYMA 3FDKA 1I2PA 1KM2A 3UWWA 3RU8X 1ZHAA 3DBNA 4GH3A 3AXHA 1LRTA 3IUIA 4J2PA 1BWLA 3IGSA 2PSNA 1EH9A 2XSXA 1RHCA 4DAIA 3WJZA 4F3HA 4MJMA 3T4WA 3CZEA 1NSJA 1GWJA 3VC6A 2BNJA 5AZ0A 1GHSA 1OZMA 1QPKA 2DT0A 2P3ZA 3QEZA 4B91A 1GORA 5E0FA 2W63A 2W66A 1PS9A 2HXTA 4C7FA 3EWBX 1Q6LA 4JN7A 4UTJA 3PVFA 4JTJA 4JZ5A 1VYRA 5D9OA 3WF3A 3WNKA 2ZBTA 1CXFA 4I6VA 1VFMA 3H2NA 4QCEA 3S2JA 3DKLA 2BXYA 5A6AA 1WAUA 3KFTA 1E9IA 3CEPA 3L2IA 1OC5A 4GJIA 1I60A 2ZXBA 3H12A 1A0DA 2GOKA 2NWSA 3VKAA 3S83A 2FQIA 2C14A 3T0BA 1H0GA 1BHGA 4Z2JA 1QBAA 3LMZA 3NEHA 4UFJA 3KVJA 2VWSA 4P7OA 3PF3A 3WH7A 1SSGA 4YVXA 4PMXA 5FJPA 6ALDA 4AEFA 2Q01A 3KZPA 2DSZA 3L4VA 2EEXA 4DPQA 1CWYA 4XUYA 4LYPA 1N8FA 3GO2A 2V5LA 3H70A 1WZAA 3H21A 2BY1A 4UTHA 2PDKA 4YWIA 1RQHA 2P88A 2ZA1A 2DT3A 1S3HA 2AQOA 3R25A 5T9BG 5LHFA 1F4HA 3N4FA 4ZMGA 4LB3A 7TIMA 5LIUX 4NZ1A 3NNTA 2Z29A 1KFBA 4WOQA 4HSHA 1ZJIA 3JRKA 3L23A 2E67A 2QPUA 3S1WA 1QNVA 4WDTA 1D9EA 3SCQA 4J4KA 3SGGA 3NQVA 2BOEX 4GA8A 1F07A 4F2UA 4W85A 1A5AA 5A94A 1YMYA 3RLUA 2HE8A 3DEQA 2DPEA 1TUFA 1TWDA 3ABZA 3M4HA 2QVNA 3CHVA 2PRMA 2Z1SA 1FWGC 1EYEA 1EOKA 1R9ZA 3MV11 3RILA 1UKPA 3GIQA 3FS2A 3SCPA 3M43A 3BC9A 2B4GA 1Y5VA 3AMGA 1JZ4A 4WD0A 3GKAA 5LIWX 3G1SA 1JR1A 3E5PA 3VDCA 1I6NA 5LGZA 2ONEA 3RFAA 1JCLA 3UNTA 3TW6A 3GG0A 5BW6A 4MZ1A 1RD6A 3VIOA 1OX5A 3WLJA 1ZBVA 1MW1A 4DO6A 1L2QA 3E74A 4EPEC 2E5CA 3E96A 3BOLA 3EDJA 3MHGA 1B9ZA 3KAOA 2AL2B 1VAHA 3VNYA 1J0HA 3ZR6A 2FZ8A 2D0FA 3BZGA 3L7RA 4URIA 2GVJA 2Y7EA 1W17A 3CUJA 3IJ7A 3LS9A 3NQ2A 4ML9A 5IFPA 4QE5A 4WJXA 2XN2A 2YDRA 1MW3A 1SUXA 1FHLA 4AXKA 2C8NA 3WJYA 1W5QA 5LGXA 1XM3A 1XGDA 2ALDA 4S38A 5HOSA 3AFBA 3QTGA 3ITTA 4OFCA 4QTGA 2OSXA 3HG2A 3I3DA 3V4BA 5I09A 3UPMA 3ZLGA 3GH7A 2QDEA 3KM8A 3LRMA 1E9ZB 3KEHA 2BVDA 4LCQA 3S9ZA 4Y9MA 2C91A 3AXXA 1IWBA 3WY1A 4GKTA 4P8VA 1TTPA 3BAXA 1HJSA 4K37A 4O15A 4O1AA 5I02A 4Q8NA 1PYMA 3FA4A 4E8GA 4GQQA 1Q6EA 2CLFA 4IHCA 1Q4NX 2J74A 2PF8A 3N14A 5HMEA 3URBA 4AC1X 3N9KA 4S39A 5DT5A 3VX0A 4S3KA 4Y9OA 1Q4WA 1XXXA 5D05A 1ISXA 1RA5A 3UWVA 2PWHA 4NZCA 1XICA 2J9XA 5ECUA 1ONEA 3RGTA 3VABA 4PMVA 4X2RA 2H8ZA 1ZP3A 1UQZA 3T2OA 1GQJA 1UPPA 4MF4A 4J27A 2ADAA 2ZUVA 3FFSA 1UWTA 2J25A 3GLCA 3QMSA 2UV8G 3RM9A 1J0JA 4BI6A 2ZTKA 1WKDA 4EPBC 5D9NA 3DI0A 1MQRA 4YTSA 1QJWA 5HJLA 2VCBA 4ZB2A 2ZE3A 3MS8A 3W7QA 3I6RA 4CNSA 4GKLA 3B8UA 3NIYA 1TG7A 2P50A 3GDLA 4JFVA 5JUVA 2C15A 3BGAA 4AAJA 1DPMA 4M6PA 3OOQA 5CGTA 2YX0A 3KVMA 1V5XA 3UGVA 3B9OA 4QJ3B 4XV0A 2A21A 2A3BA 3LTYA 3TTSA 4DWDA 5AECA 1O1ZA 3OIHA 3USZA 1HUVA 3AIEA 3LHWA 1UP3A 3G1RA 1EJXC 3UPWA 1YTDA 4PUKA 4EIVA 3EEGA 1SVDA 2O9PA 4P7NA 5G2IA 1XDJA 1C9WA 1YRRA 1LRQA 3OBEA 2W79A 1I0BA 2FVKA 3W01A 5B7YA 3WUGA 1ICSA 1DWHM 1W0MA 2VQUA 3S5OA 3PZUA 1HX0A 1E6NA 1JZ6A 2VC5A 1QPNA 5AYZA 1V3LA 1DQWA 4QDPA 2ZCGA 7REQB 4ALDA 4CD5A 1KTBA 1R86A 1P0NA 1ZPTA 4HN4A 2VFGA 3W2MA 1GYLA 5AYIA 3AIQA 3L4TA 4Q8QA 4KWWA 1KQYA 3HMCA 3S8HA 1QASA 3ARRA 4NQ1A 4TOQA 4AISA 2NXHA 1CYGA 4IMGA 3R43A 3F2BA 4IPNB 5HMDA 1XH1A 2WNZA 1JD7A 2J7CA 3W0KA 4QG6A 4PB5A 2GGEA 5E0CA 3LBMA 4HYWA 2XSAA 2IKGA 4W87A 3WMCA 1EEXA 4HCDA 3LHVA 2ZXAA 4KS0A 2EPHA 3EZ4A 1J0IA 2O92A 3BLEA 3HGJA 2WCGA 1UHVA 4PMZA 3EWXA 4LRTA 4GZJA 1FP9A 5C9XA 4GISA 3IIVA 3HGRA 2XZ9A 3UF9A 3EXTA 4XAPA 5DY2A 4BJHA 3WLHA 2C79A 3RRAA 3GC2A 3E5BA 1XSJA 3N18A 3AXKA 1XF0A 3O0KA 3S47A 1SZFA 2OJPA 4Z1DA 4PYSA 2XUCA 3BCFA 4LXFA 3R11A 1QK2A 3F4NA 2NQLA 4Q8UA 4CCDA 3OA5A 1CGYA 3SIMA 1K9DA 2Z7KA 3V0UA 3GFYA 3TONA 2YKKA 5M5DA 4UQCA 4WVXA 2WC7A 2V3GA 4O19A 5REQA 1JULA 3ARWA 3M47A 3TOPA 1ZZMA 4B5XA 3DG6A 2P76A 3U2CA 1OG0A 5CG7A 3WX7A 2WHKA 4ZO8A 2AQWA 4HMDA 3AYVA 5HA7A 1VB9A 3DN5A 4GK8A 3B97A 1XIGA 1OYCA 4B9YA 1HT6A 3IPWA 3UWEA 1MVYA 3SGZA 3K2GA 4LVFA 1S5WA 1H2JA 7REQA 4GCXA 4GNJA 3GIPA 3RLHA 2O7SA 3CHEA 1VFTA 4W7UA 5BYWA 1B54A 4WRHA 2CLEA 3U5UA 5HNUA 2A3CA 1H11A 2OSYA 3HJZA 3SFKA 1QU4A 3AZTA 4CQBA 2J79A 4HYRA 5HAOA 3LOTA 4JTCA 3QJAA 4JCMA 2GWNA 4RNFA 1NOUA 1UR0A 4Q4KA 1ITQA 5HULA 2DUAA 1FWAC 3PPCA 4DXXA 1CLXA 4DNHA 3CUHA 4S3GA 4AUBA 1DJXA 5JU6A 2CW6A 4MFDA 4K38A 1TQXA 1QI2A 2ISVA 2WBGA 3DX5A 4L4MA 5FF4A 2J24A 2PDFA 2FJUB 2CFFA 3CZKA 1SR0A 2X16A 3I7RA 2I9EA 3KHJA 2YR1A 4EPDC 3PZQA 3CUZA 1MQPA 1EJSC 6XIMA 4Y8FA 3TSMA 3M0IA 4BCEA 4LRSA 4G9PA 5AYXA 3U8GA 1YYAA 3LLXA 4AD3A 4O1BA 2WZMA 2R8WA 3ISIX 3MI2A 2NSOA 3OJGA 2HQAA 3W7HA 2OO0A 4IMAA 2OEJA 3VIIA 3SI9A 3GUWA 4QX4A 3U4FA 5C2CA 1GJWA 4KEUA 4Q6JA 3LX9A 3THCA 3HF3A 3SCUA 4IXXA 5LA0A 2A2IA 3WLPA 3DHUA 4YIWA 2CIPA 1TKKA 4PBEA 4Y7EA 4F40A 4RDWA 2J27A 4FXJA 1W3KA 1JPHA 1ICQA 1OM0A 1FRBA 1SJDA 3WF1A 1D2KA 2H9AB 3RJXA 1OSEA 5IBXA 3MHUA 5KMYA 4DF2A 2J6XA 3UBPC 4WKFA 4O1FA 2VUNA 3W2NA 3BARA 2R1KA 3Q37A 4AZIA 3RMEA 4DJFC 1OBAA 5FA5A 2PDUA 3W1UA 3AI0A 3LPOA 4H9TA 1UWQA 4J7RA 2WNWA 2MNRA 1ZQ5A 2OTDA 4ICMA 4YXGA 2XFFA 2QT3A 2CLPA 4C6JA 1C8QA 3PULA 2YZRA 2XVLA 3MQTA 3RXZA 5XIMA 2PDLA 4QG8A 3C3UA 2XISA 2X41A 4DF1A 1TPFA 4IPJA 5I24A 3PWIA 1LYXA 2HTMA 1WOBA 4GH1A 1S2AA 1H7NA 1JPKA 3V5OA 2PZ0A 2BDQA 3SUUA 2ZZ6A 1CENA 1E71M 4MWAE 1JZ2A 3FA5A 2R91A 5HANA 4EXBA 2NVCA 3K46A 2ZUWA 3TYEA 3FCPA 4UNIA 4QSFA 5K9XA 5F2MA 1WQ5A 3PG9A 4JQ2A 2X0YA 2QCDA 2FHBA 5DANA 4C5YA 1P48A 3W6YA 3NZGA 4YCOA 3BSMA 4DRSA 1M01A 1VBJA 4DNMA 5FSDC 3WDIA 1YDNA 5DRIA 1C8YA 1QWGA 3L4ZA 3BK0A 4YVPA 2R9RA 1FBAA 1XYFA 1XCWA 1J2BA 4NZJA 3PWGA 1S2CA 1EWDA 3ZMRA 1KXHA 3L0GA 2F6UA 1GKRA 5AYBA 5JXQA 4FR1A 3P14A 1JDFA 5EPDA 4DYJA 3W29A 4L9YA 5CQ1A 3R0KA 3TR9A 3NGJA 3PFMA 1JI2A 2Z1WA 4GYPC 4H9XA 3KHDA 1ZALA 2BY0A 2GJXB 2VT0A 4H41A 1W37A 1SM9A 3I3BA 4NHVA 4ASTA 2XDFA 3LV5A 4UTLA 4CQ9A 5CZTA 1XR2A 3ANVA 1Q13A 3VGEA 4OZOA 2AMXA 3E38A 2Y63A 3OYXA 1QOXA 4K7YA 3W84A 4ACZA 4GD0A 4EE9A 3URQA 1VEOA 2Y7FA 4B5WA 3TN5A 1N8IA 4ZQPA 3QFEA 1GOQA 2J9ZA 3EA1A 3SZ8A 4FXRA 4UTUA 4V2XA 4GZ7A 4BFAA 3O6CA 4CD4A 4Z2HA 1GOOA 1RCXB 2VZSA 3UU0A 1ZJBA 2PLMA 3LK6A 3PANA 3G3DA 4H7VA 3NQ8A 3UR2A 1FA2A 1OABA 1P0EA 4IIDA 2W4XA 1X39A 2Y2WA 5M3WA 4V28A 4CN1A 3G2GA 3SURA 3WBWA 2F61A 3FSTA 1XKJA 1IR1A 4FLSA 4RNIA 1EJRC 5LNWA 2QJNA 5J5DA 4MIMA 3BE7A 1VKFA 3AIWA 1TRDA 3VD5A 1DWJM 3TX9A 2NV9A 1NDVA 4HK5A 3MTWA 4G7EB 5LNRA 2ZX7A 2QJIA 2XVNA 1QVBA 3ZFHA 1DVJA 2HVOA 2PDGA 1V7AA 1QNSA 4IPIA 1JCNA 1SMDA 1WZKA 2CHRA 1SJCA 3GRIA 1QOQA 3K30A 3LERA 2J7HA 3UYCA 2H8XA 1YTKA 2QUNA 4ROQA 4UQAA 1WAWA 1OT1A 3D6NA 3AMLA 4O8AA 3W7KA 4NKCA 1RPXA 4MB1A 2QCEA 2PWUA 5TNVA 1YDYA 1TO3A 4B9ZA 3S46A 1NP2A 3E9AA 4GUGA 3OVRA 5IDZA 4A8NA 1DKWA 3HPFA 3USBA 2ZDRA 3MUIA 4U33A 2ICSA 4DWSB 4OKDA 3WLOA 5I79A 2DVUA 2BVTA 3KTSA 4R88A 3RITA 3DOPA 4UTFA 1XQLA 4J3VA 5IXEA 1GGOA 4ZTYA 2G4FA 3CO8A 4ERIA 3GR4A 1EF3A 1E6RA 4XD3A 5IDIA 1FHDA 5CBBA 4H2HA 1EXPA 4AFYA 1TV5A 2UY3A 5EYWA 3MY9A 3VYLA 1BXNA 1UJPA 2YYUA 2OX4A 2CHNA 1EGZA 4HNVA 5LXXA 1X1ZA 3V0TA 5CPSA 4LPCA 5CEWA 1DORA 4YN5A 5BWAA 1YXYA 1UIPA 3GXNA 3E12A 1HJVA 4PFMA 3C61A 4Z0SA 4S3FA 2DUZA 4K39A 1TIMA 5D9MA 4IISA 3JZEA 1TPDA 3GDKA 2PMQA 1B2YA 3EWZA 3M44A 4HMNA 2BWGA 2J7BA 4I8YA 2CEQA 1A5KC 2PDMA 1K1DA 3UCQA 5M1TA 3FXGA 4HJFA 3TN6A 3E2RA 4E3TA 3BL3A 2R82A 4AVNA 2X09A 3S2LA 4M80A 1U5HA 1V02A 1AZ2A 4HHHA 4G7EA 2PZNA 4GX9A 5AHFA 2XG9A 2PLKA 4L6OA 3M7SA 4A22A 1R38A 3B8IA 1GQLA 3BV4A 1MRQA 3S0CA 3H8AA 2GFTA 1DP0A 5JQ9A 5CPNA 1FWJC 3CWHA 2IPJA 1K6AA 1EA9C 1RZMA 3U2ZA 3U9IA 2E09A 1R8LA 3ITYA 5F1UA 3KL5A 4GMEA 4OE7A 1I1XA 3ZIZA 3TQ0A 1S5MA 1D3CA 1LT8A 1XI3A 3FA3A 3NM3A 3RN6A 5JBFA 3QM3A 1M53A 4NIRA 2Z1VA 4IGNA 4RXGA 5G4EA 3RX3A 1L6GA 1KFWA 4PC8A 1QHZA 4JYFA 3SCNA 1J4EA 5HQMA 3QY8A 3C5QA 4UZSA 2NLYA 4O53A 3SFWA 1VJZA 4IGSA 5HWNA 3W7NA 3GVRA 1W8SA 2VVNA 8TIMA 2NQHA 5D8ZA 3WG6A 2YA1A 2HBXA 3EA2A 2BY3A 3APTA 4Y2WA 4I7WA 4JFWA 4LBSA 4LC6A 2VD9A 4L61A 4O4WA 3S9IA 1XLBA 4JTGA 3GW0A 5AC5A 5HNRA 3MT1A 1E4IA 4HSOA 4CEUC 2Y5JA 1OY0A 3QVQA 3MJMA 3G1FA 3BO9A 3P5YA 4HK6A 4PL1A 1XRFA 4BK9A 2TAAA 4DJFD 3P2VA 3M0LA 4RZ6A 1ENUA 3FAXA 3K1DA 1RSCA 5A8GA 4KWSA 1ZJAA 3GH5A 4G7FA 3R8HA 3A21A 4CD7A 4JTEA 2BHZA 1MXGA 2VM8A 4L56A 3F5KA 2HVNA 4ERGA 3DHPA 7XIMA 1NDWA 3WO8A 2POTA 1JCMP 2D3NA 3CMGA 1ODZA 3OGSA 3UW6A 1HO1A 1Q6RA 1OX6A 2OZTA 4L4OA 3R58A 1ZLPA 3LBOA 5I3HA 2E5BA 4LB4A 3WDRA 3A13A 3EDDA 1W91A 2PDHA 3ZJ7A 1A4MA 1NOWA 4JIPA 4F0RA 1UH4A 1W5MA 4UNKA 1NFGA 1BLIA 4FMVA 3W7LA 1VFHA 2YBVA 1CX9A 4PFHA 4ZGYA 2ANUA 3HZ3A 4KWVA 3KLKA 4LH8A 4W86A 1XH0A 2YYTA 3IGHX 3SRFA 4TVUA 1X6UA 1UYQA 1E3ZA 3LTPA 1HN1A 2FTWA 2FDMA 3SW6A 1QI0A 1W9BM 3QW3A 1EWEA 3ES8A 1F61A 4LALA 2WSQA 4AZGA 4QR6A 1BVNP 1J10A 4GBUA 3NUKA 2VCAA 4P8XA 2QGYA 4TTUA 2Z2UA 2A3AA 4RZBA 5I23A 2XGZA 2X7VA 1PZ2A 1EIXA 2CLKA 4PMQA 1S46A 1T8XA 4NF7A 4PTDA 3CH0A 1EYWA 3TV8A 3MA8A 4JXCA 1DXFA 4MOZA 2FKPA 2J4GA 1VQTA 2QUVA 3IWPA 4FP1A 1ZBWA 4FLRA 3RPTA 5KITA 1C8VA 3CUIA 1UR9A 4TMBA 4DHGA 4HBKA 4JHMA 4D6IA 2VZUA 2BHYA 4LUSB 2OSWA 4K1GA 4G5DA 1XYBA 3M9YA 2W61A 3GD6A 3V1PA 1UPMB 1F8MA 2JKPA 4EF8A 5J5RA 3G24A 4JX4A 1R3SA 2Z6IA 1RP8A 1P0DA 3NQAA 4LVAA 2Z24A 2H3DA 3QH2A 3GXMA 3A6OA 3CZ8A 3MB9A 3OGVA 3ZWSA 3IRSA 4AQLA 4IX2A 3RK8A 3GHRA 4NL1A 4JBRA 2GOUA 1JL8A 1RK5A 4KCWA 1CBGA 3WSUA 2PCEA 4P5UA 5FEZA 4XSMA 4AD2A 4UC5A 3O8AA 1HO4A 1Q6CA 1TZ9A 2GQ3A 4WSJA 1PE1A 3W83A 4XBJA 4ES4A 1MEHA 4YTQA 3HO8A 2H6RA 3MI6A 1NDYA 3PBVA 5HINA 3G3MA 4QDWA 5AB3A 2IKJA 2XH7A 2ZZ2A 4QE4A 4MB4A 1PZ1A 2GVLA 4HTBA 4NILA 3SJ3A 3AU2A 1IHIA 1U5JA 3JZUA 3QY6A 2CZDA 3K4DA 1XLAA 3QMRA 2UY4A 4JDBA 4L5ZA 2RJHA 1GZGA 4AY1A 1DWIM 3UZXA 4GGHA 4A6GA 2ZZ1A 3P61A 4LTSA 3LBCA 3QN3A 2CPUA 2WC3A 4P7QA 1UR3M 4FF7A 2XWDA 3LZ3A 2ZOXA 3CQJA 5CZKA 2AL1A 3WK3A 3H2EA 4QLJA 4JQ4A 1QPRA 3VD9A 4A8IA 3Q67A 5C9UA 3BJTA 3UY7A 5C9RA 1W3NA 5HBFA 3HJEA 2Z1BA 1DEDA 1NWRA 1OCQA 2OX1A 1VZWA 3VNKA 3V0SA 4AVOA 3TIMA 2QAPA 2PD5A 4QEHA 3RCYA 1VEMA 1DQXA 2L5HA 1KRAC 1VPQA 2AAAA 5G1MA 3CAVA 4LYKA 1X97A 4Z2KA 5H6HA 5HR7A 1V7YA 3PJXA 5BMXA 3TP4A 2YIHA 4C6EA 4BQ3A 4CCZA 3UCDA 3W1XA 1H1ZA 1BGAA 2V5CA 4E38A 3FIGA 3WDJA 2Z2BA 2ZC8A 1NVMA 3T8LA 4J9JA 1EO7A 1HVXA 3FJ6A 1P1MA 2WPGA 3PUDA 3MO7A 4FNUA 4EKJA 3CZLA 3U2EA 1A0CA 2DU2A 4L1WA 2GSEA 2GGIA 2C3ZA 1SGJA 2PFHA 1V0LA 3TTOA 4QRNA 2W5FA 3LM7A 2GVEA 4JTUA 5CCZA 1E4MM 5E1QA 2WMIB 1E6ZA 4HP5A 2WVVB 4GYJA 4LVGA 3DFHA 1R3VA 3NQBA 2FJKA 4LS0A 1GVOA 2A3LA 2D2JA 4DJDD 4CD8A 1KV5A 4HK7A 5ABEA 4ZOCA 1O12A 1K9FA 3I7QA 1BWVA 1GG0A 4DUOA 3MBFA 1NFPA 3ZR4A 2ISSA 1RQEA 4UTTA 3G1HA 1TV2A 1EA0A 4DYEA 2V2HA 4G1KA 3MWCA 3FN9A 1S2TA 2C71A 4HZ8A 4PUWA 2DZTA 4ADTA 2V38A 4I5XA 3WIJA 3T1GA 4IJBA 2QYGA 2WANA 2YBUA 4IMDA 2Q8ZA 2CLMA 1F05A 3WMLA 4PEEA 4QJ1A 1OD8A 4E8CA 2VDIA 1US0A 4IQEA 4L4LA 2VDHA 1W3HA 1IXQA 1LOLA 1FH8A 3RAOA 1TCMA 5GNYA 3NA8A 2GJRA 1G4EA 4F0SA 1BKSA 1IWPA 1V3HA 2VC6A 3V7PA 4W4QA 1R85A 1XH2A 3G6LA 4WGXA 5DBTA 2BGSA 4DI8A 1EQCA 2O4QA 3QYSA 1TWZA 5B7ZA 7TAAA 4CKQA 4TX8A 3N12A 3U48A 3W26A 2J13A 2C1HA 3KE0A 1J9YA 4NJHA 3TJIA 1KRCC 3MSDA 1VYPX 4AEEA 2F7FA 5FF0A 3LMYA 1OADA 3QR1A 1AQ0A 5ABFA 4PTVA 3VIMA 5EGRA 6XIAA 4MYXA 4U5IA 1W2VA 2C19A 2GK1B 1JZ3A 2QQ6A 4ZO6A 4XD6A 3FKKA 2PAJA 4Q8VA 2GWGA 4A8RA 4PCNA 4H83A 5AHIA 3TYDA 1H51A 2HEJA 2D0HA 4XAFA 3HPZA 1IXNA 2RAGA 4PODA 3GWQA 2WMIA 4TU1A 4XKYB 3UEQA 5EY5A 4IQLA 2QW5A 5LA1A 4LANA 2PDIA 2VUYA 4AZ5A 4LF1A 2INEA 3SUVA 3VNZA 1JCXA 2QCFA 1KBBA 2OB3A 3M41A 3MSRA 1XWYA 4AF0A 1NY1A 2RDUA 4JTLA 5BWFA 3VM7A 2V5JA 4GXWA 1TIWA 3WDPP 3L65A 1O5KA 1ME9A 3L2MA 1KM4A 1ZL1A 3IVSA 2VGFA 4AWTA 3FV9A 4FEZA 1AJZA 2YL8A 3SGUA 3H23A 3MP3A 2HNEA 3TC3A 1OF8A 4KBXA 1MW0A 3HN3A 3W86A 4ZEPA 3H4XA 4FLOA 3WLRA 3VCRA 4XD5A 4O11A 4MB3A 3C2FA 1XSKA 1RLDA 1UWIA 2J7GA 2VGBA 1FWWA 3MW7A 2Z27A 5BZAA 2RGMA 4N4QA 3M0KA 5TIMA 1Q7ZA 1M3UA 2QCLA 1X8CA 4IH3A 3BAIA 3EYPA 3L4YA 3V75A 3H7UA 3DC0A 2E9BA 4O13A 5H91A 2CETA 3W2LA 3I6TA 5HATA 5F2GA 4JYDA 3PTDA 3TU9A 4YHGA 1BRLB 4BF7A 3KBNA 4CD6A 1O5QA 4HOWA 3CTLA 2ZRZA 4OWGA 4GQGA 4IPPA 1ML1A 1W6TA 4OOZA 4UB9A 3MYOA 4LCSA 5F4WA 3UZJA 1YE4A 3AS0A 3NPWA 1H4PA 1S5VA 4PTWA 3DGRA 4Y90A 4YTUA 4ATWA 2YCIX 2GK1A 4JGDA 1M7JA 3QV7A 4CQAA 3ZJ8A 1H50A 1YADA 5DELA 2A85A 1S2WA 3NEVA 4O54A 1TVLA 1U83A 2VR5A 1ZP4A 3V18A 3SSZA 3W73A 2Y8KA 3E0VA 4AWSA 1S5NA 1UP2A 1FP8A 1VC4A 1FY6A 5DXXA 1UWRA 3WBXA 4HOXA 4A3UA 3IIPA 1H41A 3WFAA 4Z1YA 2XIBA 3KUMA 1A5NC 4HKPA 4IMFA 1UD6A 1B3VA 3GZ3A 1PTDA 2D2OA 3RJYA 3LN3A 3WK0A 4HU0A 2E6YA 2OVLA 4Q3MA 2Q3OA 3OG2A 1EDGA 2VTFA 1DYSA 3DI1A 1YPIA 1VRXA 3B8VA 2ZZ3A 4A3YA 4GNKB 4GO8A 3T44A 3LPFA 1JYNA 1MNZA 2OG9A 1XYMA 1R3QA 1EB3A 1POJA 2I5QA 3UJEA 3ZT7A 3M5VA 2ZA2A 3KDNA 3ITOA 1XBVA 3CV7A 1H7OA 4C6CA 3U2OA 4GYFA 1UOKA 4ERAA 1RK6A 1F4AA 2NXGA 3S1GA 5IM51 3CLMA 3BH4A 3CL8A 1OFEA 2QR6A 5CJMA 2QNEA 1XCXA 2DEPA 4KRUA 2G5WA 1CPUA 4LW7A 4ZXLA 5LNVA 4GC3A 5H8MA 5AHMA 1GTEA 1OJXA 4E6MA 2GSHA 4NAFB 2R1LA 3GDBA 3M0HA 3IJ9A 1G4TA 1P4CA 4S3EA 1QR7A 4WDXA 3ERPA 2G37A 2OYKA 4IGMA 5I07A 3A23A 3IUDA 4QSHA 3VOHA 4MGGA 3FEMA 3VNLA 4LY8A 1GHRA 3UGRA 4ZSTA 3SRHA 3WLSA 2BOGX 3N2XA 1G6CA 3BUVA 4BQ5A 5M17A 1Q6DA 5CLTA 4F79A 2GVGA 3HQPA 3CM4A 3ABRA 2XZ7A 3P60A 4GYKA 5E09A 3VFLA 2B7NA 5GJMA 3L21A 1VJIA 1GVIA 4K8EA 3C52A 4ZFCA 1KA9F 4Y9NA 3GHSA 2NQ9A 4RDVA 4E2VA 1LWIA 5FAGA 2PDXA 4MZYA 2C13A 4X61A 3RLVA 4E4PA 3HA1A 2VGGA 2PTDA 1PL9A 5GPRA 2NUYA 3VKBA 1B1YA 2NZLA 4RL3A 1F7BA 3BW3A 1M5WA 4FB7A 3W7CA 3ZSSA 2VFFA 3OLIA 3WDQA 5CPMA 2ZRUA 3EB3A 3TJLA 3AISA 1TA3B 1I1WA 5D8WA 3T2QA 1ECEA 2PDJA 1UB3A 2H90A 4QFUA 4DYKA 2QHAA 2P8BA 1BQCA 2VR2A 1XBYA 1ISVA 3F7JA 2FDSA 1JCJA 3HPSA 3TMLA 2E28A 3ZO9A 1YIXA 3WH8A 1D3HA 2GL5A 3DECA 4JTIA 2RH9A 4HD5A 4U5KA 3AHXA 1SZNA 3LCIA 5HDRA 5JBEA 1KM5A 2OLHA 2EXOA 3PB2A 3N6JA 2IMRA 2V2CA 1KXVA 4KETA 3KW3A 5U7SA 3KP1A 1QW9A 3GNXA 5HUPA 4XZHA 4NAFA 4LV4A 1XSIA 1NWSA 1R6WA 1CB7B 1MDRA 4ZL1A 5HUOA 3VMOA 4MDOA 4S23A 3XIMA 2ZUNA 4N9CA 6TAAA 3IEBA 2CZFA 2XINA 3C2YA 2NT0A 4CVWA 1K7EA 3KBJA 3NGFA 1YNYA 3BV7A 3WQ6A 1DJGA 3THAA 4GJJA 3T0AA 5K9CA 1FWNA 3QZAA 4Z1CA 3SCWA 5HK4A 2ZDSA 3GFXA 5FJTA 1QPOA 3EX3A 4KH2A 3QGVA 4QIUA 3NO1A 1O6IA 4AU0A 3KL0A 1DIOA 1NU5A 3CJPA 3A47A 2GDVA 4M7SA 4FLQA 3L0NA 4KWUA 2WLYA 4C5ZA 1GQNA 3M0MA 5FEWA 1RJRA 3L5MA 4BKNA 1U5VA 2V9DA 4GIRA 4AG0A 2UY5A 4OBTA 2JEQA 1RP9A 4WY0A 4OUEA 4F2TA 2VC7A 4W9TA 2YCKX 3AS3A 2DJLA 3RCMA 2EPMX 4ZOBA 1J6PA 3K1GA 2QJHA 2BASA 3O9NA 1R87A 1XFCA 2VHLA 1Q8JA 1YW1A 1JUEA 1JDAA 3S1VA 3AS2A 2Y4SA 1AD1A 2J7FA 4M81A 1NFBA 2J88A 4B4FA 4PL2A 3L5LA 1W5PA 4NG3A 3W72A 2JK2A 1WX0A 3VGGA 5FJRA 4CN4A 4BS0A 3UETA 2V3EA 2V63A 1IWAA 2D20A 3HGSA 3T0CA 2FGLA 1EO5A 3ONBA 5K3VA 3LU2A 5CXPA 4AZHA 3B8SA 4I7UA 2MANA 3DFQA 2NXIA 3S5NA 1JUKA 1J79A 4AMCA 4H9YA 2REQA 2E9MA 2PWFA 1PSCA 5GJNA 5A1AA 4GINA 1LUCA 3EKZA 3WNOA 1LCOA 1SFTA 3EPNA 1SZEA 1QW8A 2PLJA 1F3EA 3GAKA 3V1HA 3TQVA 2QDHA 1FCUA 2PP0A 2F38A 3WLKX 1YBQA 5D2YA 4DF0A 1EJ7L 3VOIA 1IT0A 3C0LA 2FGBA 3ATZA 4LAOA 4TVCA 4H6RA 4O1CA 3RPDA 3R5EA 4XAZA 4NAEB 1YPXA 3PM6A 3W70A 1GVQA 1K4GA 4HOZA 4EK7A 3RG6A 2X1UA 1PV8A 1DJYA 4Q8WA 3LHYA 4H19A 2G0WA 4UMAA 1CT5A 1W32A 2XIOA 2B31A 4NNBA 3B0VC 4P8WA 3PNUA 1EX1A 3BOFA 1EP1A 2WHMA 4K1WA 3EWUA 1ZJHA 1GVYA 1J5SA 1FH9A 4AD0A 3CU2A 4UOJA 1SFSA 5G4HC 1O60A 2DZBA 4I8DA 2NV2A 2C6QA 4JIIX 1Q7MA 3GNPA 1KM0A 1UBPC 3WQDA 1E5JA 2GDQA 2PF0A 1PX8A 5DMLA 5BOOA 5K4ZA 1NF0A 5DN1A 3MMDA 6REQA 1RJQA 1IEXA 3L0KA 1BFNA 4W8LA 1EC8A 5AY7A 4DJFA 4DN1A 3A3XA 5FL0A 3C2RA 4PTXA 1I2NA 1OX4B 3BW4A 2D69A 2XIJA 4OIFA 4GI4A 5FI8A 2ACQA 5EMYA 3UWQA 1IQ8A 5XINA 4DELA 3AXIA 2X1SA 1NWTA 1DJIA 3WMBA 1TSIA 1LOSA 2NX1A 1V3MA 5D2WA 4MWAD 3RO6A 2EPKX 3GU9A 1K8YA 3IACA 1KR0A 3PBMA 1X1NA 1JUBA 3DENA 3GDTA 3ORWA 3HQ1A 2ZX8A 2BODX 3ZVIA 3NYDA 3THUA 1UOZA 3LUTA 5HNTA 1PB0A 2DH2A 2CHOA 5AHEA 5DRCA 3W3OA 4X3ZA 3ITXA 2Y62A 1S5TA 3KWSA 3WLIA 2VEFA 4V1XA 2TRSA 5ABTA 1MFVA 1J6OA 1JEZA 2ZQ0A 3GNNA 2DQWA 5LKYA 2VXNA 1T7LA 1JD9A 5C6MA 3WL1A 4LYQA 4TR9A 1EHAA 3PZGA 3TA6A 4M56A 1RY0A 1YTEA 4JHOA 1RAKA 1UD8A 3C86A 2RDWA 2BLEA 1W1PA 1XFBA 1W5OA 4NAEA 1C9DA 2R1PA 1W1VA 1QBBA 4LF2A 4HJWA 3WQOA 1Q85A 3DYMA 3I4KA 4YLWA 3FYPA 2PGRA 3NOYA 4LAUA 4ZQOA 2HS6A 4GI6A 1SFJA 2WMKA 2F84A 3NDZA 1LLWA 3RNDA 5D2XA 1PHWA 3UR8A 5DEZA 3SQMA 4ECLA 2BBFA 3UA3A 2G50A 4GYPA 5AYYA 4K8GA 1KBKA 4IIHA 5HJYA 4CNTA 1HL8A 1QNRA 4HA0A 4OOUA 4GGBA 4LUIA 3G0SA 1XYLA 3NAVA 1BQGA 4HN8A 3VTRA 1K9TA 1GOIA 1CLVA 2OCZA 3FAWA 4NZFA 4CNOA 3VGFA 4Q4SA 3EMCA 2WNQA 3MVTA 3ECQA 2DIJA 1ADOA 3SR7A 3WYZA 3SQSA 3TFXA 1OX4A 1XIEA 3QLDA 1WUEA 2GSJA 1QRQA 2DORA 5D30A 3BMWA 1OD0A 1JCTA 4YS1A 2V68A 4D6GA 3GYEA 4J35A 1DJWA 5HWJA 3COTA 3P5ZA 1VFOA 3WUEA 1I0DA 4LCRA 1MXDA 3L4WA 4DM2A 3W7MA 4M19A 1AW2A 1VH7A 1OGBA 3DXIA 5ENLA 3VCCA 1PIFA 1TPC1 3GAYA 3NL6A 4I9MA 2NUWA 1UZDA 3H24A 1MWOA 4H8UA 3VKCA 4US5D 5TAOA 1A3WA 1PKYA 4WGHA 3WEMA 4B3LA 4ATLA 4NZ3A 2J66A 1H63A 3V3WA 1QI3A 2QCMA 3H2FA 1OF6A 3CV6A 2E77A 1XIJA 1H1NA 2VELA 4FOUA 4TV5A 3SCOA 4FI4A 4JFTA 1DOSA 2D3LA 2B0MA 4MVAA 2Z28A 3LLDA 3VILA 1V79A 4BY3A 3W02A 5D32A 5CBJA 1VGAA 4R85A 5BOEA 2Z26A 1ECQA 1X98A 4R7JA 2G3MA 3G8RA 7CGTA 3MO4A 4WJ8A 4FA3A 4NXSA 2WC4A 3WQGA 3VDGA 3NFUA 4GHRA 3PZIA 4HNTA 1IZCA 3SCRA 1PDYA 3T0TA 1EP3A 3QZEA 4D6FA 1RR2A 1WPCA 2INZA 2XM2A 3TW9A 4ZENA 3R89A 3T78A 4O0KA 2JKEA 3BSGA 2V82A 1R5YA 2Q09A 2NLIA 2XIQA 1FHUA 4GI8A 4QAWA 4QS6A 3G5EA 1JF6A 3W1AA 2DZSA 2DZVA 3BQ5A 3IGXA 3VMNA 1HXJA 3FGCB 2YXXA 3EKLA 2OFJA 3WFZA 2E40A 3RDKA 5D09A 2DJXA 3PZTA 9RUBA 3DH7A 4I3GA 1W9UA 4UOZA 1M04A 4UTKA 1LT7A 2F6KA 4QISA 2D2GA 5BXTA 1A49A 1ICPA 4EACA 2FTYA 1WOAA 2D2HA 5MKGA 3IUHA 3L66A 4RPQA 4ENLA 1LLOA 1XKYA 3ZJ6A 5F4XA 2FB3A 5CG0A 1W8GA 1DV7A 2IKIA 3MMWA 1E6XM 1QO2A 1M68A 3B05A 1DJNA 1W9XA 3LDVA 1OIFA 1WNOA 3AMDA 3WBEA 3PK7A 3W7RA 4LYRA 3T0DA 4J3ZA 4YWSA 1VCGA 1AW5A 3W7EA 4JIEA 4B5VA 2VP8A 2ZUSA 1AQHA 1TB3A 1MFUA 1GQIA 4IM4A 3GG8A 3OVGA 3FYOA 4PCTA 2PDQA 2BXVA 1HL9A 3ZS4A 5MHBA 4YYFA 3A64A 4JTDA 2QUUA 5I6SA 4DJDA 2OWCA 2DQXA 1O1HA 4BWLC 4DLMA 3ALFA 4DBWA 5B80A 2CZ5A 3V35A 3EA3A 4EAYA 3KS5A 1T5AA 3CQKA 1IXPA 2V5KA 1Z89A 4US6A 1WBHA 3T4CA 3WD1A 2QIIA 1IE7C 1DBTA 4FNSA 3MUZ1 3O0FA 1B9BA 3EOSA 1REQA 4NX0A 3LHZA 3M6YA 1O94A 1XUUA 1VD6A 2OMAA 1EL3A 1NOFA 1VIZA 5HJXA 2WQDA 1MZHA 1CW2A 3S5SA 3SUTA 3SJNA 1PTGA 3N4AA 1EX5A 3WQVA 4DAFA 1ITXA 1XUZA 3QR3A 3M46A 2QJGA 3AJXA 1HP4A 4RDZA 3JVAA 3RIKA 4DB7A 2KX9A 3N2MA 2QPSA 2Y8VA 4Q7NA 4W8BA 3FGCA 5HPCA 1E56A 1F73A 1U33A 3TLQA 4O0QA 3OTRA 3S2NA 4Z1AA 3OW1A 3B9DA 2CZVA 1DTNA 3Q4DA 4LBUA 1MDLA 4TIMA 5CGMA 3WL0A 1UKOA 3G22A 1ZBKA 4YTRA 1E1FA 2W62A 2CERA 3RHGA 3A5FA 1ONWA 1LRNA 3JU2A 2G3JA 3A4XA 1DQUA 3UY8A 1QI5A 3CAQA 3W24A 1QOPA 3KCJA 4WXZA 3AHVA 4IXHA 1JZ8A 2CLHA 5FF7A 4UTWA 1SZRA 3HU7A 4F0LA 4ADUA 3M1ZA 1PYFA 1CLKA 3MSYA 2CBUA 1KM1A 3FVDA 4WEVX 1V3IA 1HGWA 2VI0A 3GNRA 3RO8A 3T81A 2WAGA 3GXDA 2V8ZA 3DIPA 4L1GA 1G7UA 3TW7A 1YEYA 4J3TA 1KC7A 2XWEA 4GUJA 4YPJA 1R30A 3LG3A 5DXYA 3UPBA 3UCCA 3W38A 2FZ9A 4O12A 1XLLA 4UFLA 3RRXA 2VX4A 4DBUA 2BB0A 3G1AA 4NXKA 2Y8UA 5CPQA 3QOMA 3AQUA 1HKKA 4TVDA 4J3SA 3EDFA 3W00A 1THFD 4NYUA 4LX4A 4AZBA 4RE3A 2PPGA 3WQ8A 2GJNA 1D7FA 5FF3A 3N2BA 4MNLA 4EANA 1UKTA 5DBUA 1BSLA 2J47A 4H3DA 3NM1A 2Q8LA 4AY7A 4GBDA 4JTQA 2G3FA 3VDAA 1PIGA 3F4DA 2X0HA 1KWGA 1AMYA 4F9DA 1UUQA 4QLKA 3HBLA 5EL1A 2FLIA 5FJOA 1QNQA 1JIBA 4G1NA 5A6JA 1PBGA 2ZX9A 2OWWA 3G18A 3TQKA 4IQDA 4PN2A 3K4WA 4NJJA 3OGRA 1JNEA 1G4PA 1P7TA 2C16A 2TSYA 3GDMA 3O63A 4LFYA 3LXBA 1UASA 3BPWA 2D1ZA 4B5NA 2HMCA 5IFTA 3UWYA 3FJLA 1GW1A 4GZIA 2OKOA 3FK4A 2Y1HA 4HSNA 4Q4MA 3BGJA 1PTAA 4GVIA 3LGGA 4PUNA 4KRTA 1TPVA 3BG5A 2QPXA 3LRLA 3OA3A 3K8KA 3UWUA 3R0UA 2G97A 1DWAM 2JIEA 2IQDA 1ESWA 2X42A 5JVLA 4MLRA 4YMZA 2O56A 4NZ4A 4PUDA 4CNPA 1Z9AA 3LNPA 1HKWA 4ZE5A 3QC0A 4RDYA 4UCFA 1LBMA 5JIWA 4IX0A 3JW7A 5FESA 3D3FA 3KTXA 2ISDA 4LUJA 1ZAJA 3DUGA 3NL2A 4IIEA 4I90A 1CIUA 4IMCA 2VFHA 3LCHA 1OEPA 1F6KA 1X6LA 2XGIA 2HK0A 1UH3A 3GSMA 3NQCA 4D8AA 3C0JA 3N6HA 1OFAA 5A6BD 2B81A 4QXIA 3KRBA 4CEXC 4L7ZA 3DFPA 1TPEA 3U3HA 3UR5A 2CBJA 1WKFA 4H01A 1KCKA 2X30A 5D9PA 3PR2A 3UERA 3GHTA 3HFTA 1FDZA 3M0ZA 4HGXA 1PJ9A 3JS3A 3TYUA 3WD4A 2PP1A 4XO7A 1TPB1 2TYSA 3ARPA 4A4AA 1PKNA 2VEKA 3GVVA 4M24A 1RBOB 5G4WA 2R1MA 3U0HA 1PKLA 3I3EA 2DVTA 2VYOA 3CT7A 3RM8A 1SJAA 1GOKA 3H7VA 1K70A 1GVSA 1WCGA 4V1YA 2WM1A 1E6QM 2J7DA 1GOWA 2I56A 1MMFA 1FKXA 4WR3A 4WX2A 2OKTA 1HTIA 4GQRA 3ZWTA 4E3VA 4FHAA 3O16A 1MEWA 5M2FX 4KEMA 3VZZA 1GKQA 4EPKA 3SSJA 4DM1A 3VIJA 3WMSA 2PU1A 3KOWA 2HCVA 4OHQA 1BEUA 2I16A 1JXKA 5CAHA 2HE5A 4PTMA 2BVWA 4Z2IA 1M6JA 1HVQA 4AIOA 3EX1A 2NW0A 3TYBA 5AKQA 3VD3A 2V81A 3QPZA 1OFBA 4HNLA 1L0PA 3HB9A 4PBFA 1DJQA 5REQB 2XH0A 1V6VA 4AVFA 5I03A 4UXDA 1UWSA 4IFRA 2YSWA 3QR0A 5DCDA 4B4HA 3C8FA 3RMJA 3OLEA 3GBDA 1F5ZA 2ZX5A 2GUBA 2QLYA 1CGVA 1QK0A 1VBUA 4FPSA 3NPVA 5G1TA 5E5CA 3W9ZA 4QCFA 4UFHA 1A80A 4XD4A 3UVAA 2X7WA 1GONA 1Z41A 2GUYA 3OLGA 1TMQA 2XVPA 3NQEA 1UKQA 2ZZ7A 4JTHA 4MSSA 3IARA 4E2OA 1ZSXA 4K68A 3AU6A 2WVUA 5ABHA 1RH9A 3WLLA 3BJSA 2YLLA 4QAIA 3R4IA 5JMUA 2NX9A 1XINA 3W37A 3P74A 4FAMA 1LQ0A 1FUYA 2WOQA 1V0MA 4ORMA 4F66A 1B3ZA 3NZQA 3L9CA 4AWEA 3CPUA 4H8HA 1KLYA 3IJIA 3WH5A 3H2MA 3IJDA 1UP0A 3B06A 1R2RA 5A2CA 1UJQA 3IAPA 4KIEA 3SN1A 3KOFA 4C6OA 3QKEA 3MYPA 1XLIA 1P6CA 2XIMA 1KRBC 4F48A 2A3HA 2PRHA 1VR6A 5I3GA 2P53A 5C7HA 4IFOA 1CECA 2TPSA 4E5TA 3ZJKA 2E1DA 2VEMA 1BF6A 1XCFA 1MXSA 1OYAA 3M5ZA 4AIBA 4N2YA 3THDA 2YZ5A 4D6DA 3PUEA 1V3KA 3QHOA 5H2ZA 2EQDA 4JNMA 3ITGA 1CDGA 1L2UA 3AYTA 2VFEA 4IP5A 1WO2A 4PMNA 3G77A 2VRKA 3PTQA 2X2GA 3QOKA 4EWJA 2VWTA 4XUGA 1M7PA 2DP3A 3SDOA 4B92A 4V33A 4XWUA 2Q02A 1XDLA 3BANA 2Q3RA 4QE1A 4BQ2A 1A5UA 2EPLX 1E51A 3P84A 3W22A 4S1FA 4JQAA 3C2EA 1L8NA 4FNRA 3NOEA 5I7GA 5C7VA 3AO0A 3ZZ1A 5TF0A 2I14A 2HPIA 2ZXDA 5BU9A 1EUAA 1I2RA 3QV6A 3MZ2A 4EX4A 1TFVA 2Q71A 2ZYFA 1LZOA 3NSMA 1ONXA 2E25A 1XLEA 2QIWA 2FH8A 3PAJA 2GQAA 3EWYA 2WLZA 4MB5A 3TAOA 1SZGA 4JKKA 3W1MA 1VHNA 4AB4A 2AMGA 2DT1A 2AKZA 2C1IA 1NQKA 1RXOB 3T6CA 3VNDA 3TN3A 3BLDA 4JDYA 4GACA 3RR1A 4INFA 4XBSA 4XVDA 4Y9AA 3RF9A 4ACYA 4QGCA 3VU2A 4DLFA 2P1FA 1V6XA 4GQBA 3TOYA 1R9YA 2YDAA 3B03A 3VA8A 2BP1A 3HM7A 1J11A 5RUBA 3FW6A 3NXLA 1B30A 3GVQA 2YCEA 4HB7A 3W7IA 1HG3A 3ZLHA 2XPKA 1V0NA 1VFLA 3OEXA 2VRQA 2PDBA 2DIEA 2YB1A 3K5XA 4XSLA 1EKOA 3UD6A 3PBYA 3N2OA 2QXWA 4TQTA 3GBEA 2JF7A 1KBJA 1GZ1A 2DDXA 5AHNA 4L64A 3IK4A 1OINA 2ALRA 1Q2RA 1TJ0A 1T41A 3G0XA 4OUIA 3UG8A 4J40A 4WKAA 4JICA 5T26A 1ELSA 4M51A 3TCEA 1R2SA 3NO3A 4RX0A 2QCDB 4JEJA 3CBWA 1IT8A 4U10A 2GVYA 3W1LA 3BVJA 1W3LA 3CIWA 2QJMA 2YA0A 5I00A 1VPXA 3LTSA 3TVAA 4PCSA 4YJ5A 4MKVA 1TTIA 5HQEA 4EXAA 5EMUA 5A95A 3GXPA 5K9DA 3REQB 2ABBA 4KT2A 1E4LA 4WJEA 3N6QA 5SWUA 1CI1A 3KWXA 2IQ0A 3EWWA 2D73A 6CGTA 1AG1O 2O9TA 3CAKA 3GH4A 5KZDA 2PDWA 5A6TC 3VXGA 4AMAA 1OFDA 1Q6OA 1BWKA 4PRRA 3R2GA 5E9AA 3IJLA 1QPQA 3CEUA 5FCZA 3B3DA 1DE5A 1CXKA 2RJGA 2DSVA 3OVQA 2XN0A 2ZFAA 4M29A 3WZ0E 4PTNA 3NZPA 3BXWA 3I10A 2ZUTA 3SY8A 5LNSA 3CZJA 2Z0IA 1VHCA 4LOCA 2XH4A 3W76A 2QAFA 4RXFA 3O6AA 2WJFA 1UZHA 3GE7A 1Q66A 3F4WA 4IG2B 3W53A 1QI4A 4ACZB 4PMOA 3C0QA 1U30A 1NJJA 4NU7A 4NI8A 3BCJA 2Y7GA 4H6KA 2VEIA 4F0HA 3FX4A 3HMJG 4WSHA 1HL2A 4K7VA 3EB4A 1B4KA 4HZ7A 4UQBA 2JQXA 2ISFA 5PTDA 4XTIA 3B0UX 1K7FA 3PN8A 2YL9A 1KV8A 1V51A 1D7KA 2VDGA 5TBOA 4YVVA 3AIBA 2WHLA 3OP2A 3OLDA 4QM1A 3VNIA 4X9YA 5DF0A 3S6DA 4R7WA 1MEIA 1LDCA 4DI9A 4NJGA 3T7VA 1O5XA 3BLLA 3BAJA 1J01A 4QBXA 3B9AA 1SJBA 3LENA 3FNDA 1QUMA 2WV8A 5L9FA 2VJXA 5BXRA 4DPPA 4PA8A 4NT0A 2PGWA 1WBJA 3GU2A 4S2CA 1W9PA 3TROA 3LGEA 4FSAA 4XZIA 4NASA 2Z1XA 1KO0A 2CLOA 3VI2A 4KCUA 2J9YA 4R7OA 4GI9A 3F4VA 4MAZA 4I7VA 3LCFA 1BD0A 4JY8A 1H5YA 3KBVA 3EX2A 1BKHA 1J2WA 1UR4A 4H9ZA 5C54A 4KW2A 3REQA 1JZ5A 3GX9A 5E6ZA 1XPGA 4MWAA 2PODA 1YNPA 4PBGA 4C6IA 5IHSA 3F5LA 1S38A 3PFRA 1OC6A 4A21A 3LEPA 2WSRA 1PPIA 2Y70A 9XIAA 5HXMA 3LCWA 2A3EA 5E9XA 1MI3A 1QMLA 2D23A 2XFWA 2G3NA 3CQHA 3UXLA 2YCLB 4ML4A 1UROA 1GCYA 3NZ1A 4LT9A 4ZODA 4F0MA 1XW8A 1Q5MA 4D6HA 5CKSA 1C7SA 3W71A 3BWWA 1LOQA 4WHBA 3OG3A 5J04A 3PJWA 3MU7A 1N7KA 4GUIA 2BVYA 4IG2A 1W1B1 1Z42A 2O9RA 1W54A 2QVHA 3CPRA 3PP7A 3PZOA 4OV4A 3ABQA 1V03A 2WMGA 3EWCA 5DQPA 3UWZA 3SEPA 4D6CA 3RX2A 1K77A 2O9OA 2FZMA 1E9YB 2IW0A 3EX6A 4FNTA 1ADSA 3SADA 4AZ6A 2IPGA 3STCA 1XRTA 1XYCA 1SFLA 4Q7IA 2WVSA 5FD0A 3GS6A 1LROA 3A3HA 3NQ6A 2BGQA 5DMNA 3NZRA 2Y61A 2PWVA 4DBEA 1FWEC 3P7YA 1B3WA 5TD4A 2WW5A 1G67A 3E2QA 5FJJA 1V6UA 2ATSA 4JR5A 4O14A 3WK2A 4MJZA 1P6WA 1R9XA 4JX5A 3F2DA 3BDKA 1D8CA 1XG4A 3IRDA 1K3UA 3XINA 4I9JA 4BQ4A 2IXUA 4JOMA 3UJRA 3OIXA 2YOCA 4YNGA 5CGQA 4HNOA 1JQXA 2A79A 3UZ5A 1KCZA 1Y7VA 1UIOA 3WNMA 1YLVA 1ISZA 4AD4A 3UJSA 3ZXWA 1QXLA 3GDRA 3TNBA 1A5CA 4N4PA 2VMFA 4PMYA 4HVXA 4US5A 4IPLA 3ZM8A 5D4YA 3CT2A 4WQ6A 4Z0JA 1VYSX 5KETA 2CZEA 4L6DA 1W31A 2YCLA 3AWOA 3GYCA 3QBUA 5BOFA 1PXGA 3ARVA 2QEZA 3P93A 2OLSA 1MW2A 2VCCA 1RLCL 4QJ5B 3LQGA 1EZ2A 2J75A 8XIAA 4KF1A 1WZMA 3LNMA 4JFSA 1FWIC 5I2UA 2HV5A 3KVLA 3L5AA 4DEFA 2G96A 2WZHA 4JQ1A 4IQJA 2ZX6A 3VOFA 2VNCA 4JAWA 1M9HA 1POKA 2X8RA 1XS2A 3AICA 1SMAA 5I3JA 4A3HA 4D2JA 1CCWB 4C91A 1XGZA 1TREA 3VKJA 1ZCOA 3VINA 4I5RA 2CLLA 4TO8A 1XLKA 3AZSA 3CXOA 3TTQA 3O1NA 4PUJA 1DIDA 3K8MA 3TE9A 2V69A 4W7WA 3D0CA 4M8UA 4KFNA 3VPLA 3NYZA 1BVZA 3S5YA 2Y6ZA 4DWSD 3GKFA 1E73M 1SO5A 3SY1A 3C0SA 2E8ZA 3IJ8A 3TA9A 5L6UA 1XYZA 1V0KA 1AH0A 4GWEA 1XG3A 5KEZA 1QW7A 1E1CB 1G9HA 2TODA 2E7FA 2B7PA 4C6DA 3WBAA 4DJDC 4QG9A 5CBIA 3UXDA 1NP0A 4CQDA 5EMKA 1M1BA 1UBSA 5A8MA 4DO4A 3VUPA 3GZAA 3CTTA 1NELA 5KZ6A 2FVLA 3PC0A 4Q4RA 4W89A 4DJEC 1JPIA 4JTSA 3SUSA 1LM1A 3C8NA 4AX6A 2PEVA 4REQB 4ROPA 2YL6A 1HJWA 2BY2A 1TV4A 3NR0A 3S6TA 3ARSA 1E4NA 1CGXA 3INPA 1KKRA 3ARYA 5GVJA 3H7RA 5CC3A 1U1HA 3C56A 1B57A 1GJUA 1PUDA 4H4IA 4C1KA 1J0KA 2C1GA 4CQ8A 4C6MA 4WLCA 3G1VA 2FZDA 1Z7AA 1GPWA 3TYZA 1K03A 3KOZA 2PDPA 4OBRA 1AVAA 3NCOA 1H7RA 4QHRA 1SYTA 1NIUA 2ESCA 1X7IA 2ZVIA 3TAKA 2JIWA 3LGDA 4F9JA 5D2TA 3CUXA 2Y7DA 1US2A 2VFDA 2QF7A 1AUSL 2PRLA 4Q8OA 2D22A 1C7TA 2HK1A 2DW7A 4I6KA 4AIUA 2W91A 3CYJA 3EOLA 4WSKA 5EB8A 4JKLA 1BTCA 1IT7A 3UG3A 2JE8A 2X1IA 3TWBA 4UTWC 2CKRA 4IZGA 4R34A 4KCVA 3MUAA 2PTZA 3M0YA 1TX2A 4FS9A 2HJPA 4NJIA 3VO0A 3D46A 4L1XA 1XLCA 2PS2A 4DXVA 4O28A 1JAEA 3HV9A 4EVZA 1HGYA 5CZSA 5CPLA 2QV4A 5KTLA 1E1CA 3E49A 3Q94A 2PBGA 4F0KA 2F2KA 9CGTA 2X40A 3VGBA 4G8TA 1S2UA 1TX0A 2AOSA 1PWLA 1TZ7A 1U1UA 4JTKA 3QW4B 2EJ1A 3SY5A 3IIXA 4I9TA 3TXVA 4QROA 1UWAA 3MDWA 2TMDA 3T07A 2I1OA 4P2VA 2WWCA 1OGGA 1H5VA 1GVFA 2HDJA 2ZVRA 2DFAA 1FWCC 2WJEA 1CZ1A 3MMUA 3LYEA 1JGMA 2DZXA 3EDKA 1V08A 1AA1B 1EDTA 4UMCA 2HSAA 2VX6A 1JG9A 4B3ZA 1Z69A 3P8JA 4REQA 4L9XA 5KSWA 3G0UA 4TUFA 1T99A 1QFEA 3QQ0A 1LP6A 2PU0A 3BMXA 4MUZA 3FOKA 1XLFA 5BRPA 3GTXA 5DMMA 5A2BA 4CVUA 1DXEA 1FFRA 1RQBA 3FJNA 3WH9A 4WDUA 5D03A 3T8QA 4ZZ9A 1PX4A 2ZXQA 2QCHA 1CGWA 2WBKA 1RBAA 5DT7A 3M5YA 4NJKA 5C2XA 3SBFA 2OOFA 1YDOA 4IIBA 1SU5A 4FIQA 4CU7A 4GY0A 3QC3A 4JHZA 1E3XA 4FALA 2UWFA 3K13A 1TELA 4IJCA 1SO4A 3QYQA 2OGYA 5T91A 3L67A 4DUWA 4M5PA 3O07A 3CUGA 3DFSA 1F76A 1H09A 4HNUA 5EA9A 1UZ1A 2ZWYA 4FF5A 3MI3A 2HXUA 1JPDX 3LCLA 1WXJA 3BURA 2ZRVA 4D8ZA 1XYAA 1ISWA 2FVMA 3K4AA 5I3DA 5DY3A 3VMPA 2G8ZA 4MUPA 3GUGA 3B8DA 1Q65A 3AOFA 1ZB5A 2CYGA 1S39A 4UWMA 1PVNA 1PX3A 4XVEA 2G95A 2YFOA 2E8YA 3IANA 4XZLX 4ATDA 1K6WA 1XIMA 3R79A 3OHIA 3IAQA 3DDMA 3OODA 2RFGA 2WCAA 2NVAA 3AYSA 3H54A 2FPTA 3KBWA 4U2YA 1WKYA 2IPFA 1YKWA 1TWSA 1L6YA 5F2LA 3PSVA 4GPNA 4GO9A 2DZPA 1JFHA 1UC4A 1E15A 4YTTA 5HWMA 1TPWA 4OU1A 4Z1BA 3S6OA 1RPKA 3N2TA 2CNCA 4JFUA 3NG3A 3H2AA 1VENA 1EF2A 4OQVA 1YE6A 3RM4A 1ALDA 3CO4A 1UA3A 1XBZA 4LAKA 1IIGA 1IEIA 3W7OA 3MPGA 4B2DA 3LSCA 3TJ4A 2AL2A 2XTKA 3LY0A 2PP3A 3VDHA 2BZNA 1XJBA 5A6BA 4E0CA 1JYXA 4K36A 1G1YA 1KBIA 3VKKA 2WSYA 4ZQRA 1XLDA 2W9MA 3FHQA 2F6XA 1CNVA 1V6WA 3GC5A 2ZWZA 2GDUA 5I0DA 3PWAA 4Y6GA 2DV0A 3PZNA 2HPMA 3HGOA 4CU8A 3M6DA 4GVHA 3LXAA 1F9CA 2XU2A 1ODUA 3NPXA 3QSTA 4XBKA 2DY3A 3U57A 5BNKA 3UVIA 2F8QA 2RKXA 3W82A 3WJXA 2Z2AA 4LSBA 4WKHA 2Z25A 1A53A 1LF1A 3WJWA 2PI6A 2YW3A 3OO2A 4AD1A 3H2OA 1G5AA 1O4UA 3E2SA 4HU8A 4PRTA 1O95A 5FJIA 1XL9A 4H04A 3VGHA 3URAA 2EKCA 3QPYA 4DUXA 3W4RA 3QKZA 1VFFA 1G69A 3GXTA 3I65A 4PUUA 5ABFB 3UXIA 1T40A 3WNPA 1FVPA 1H7XA 2X0SA 1AZ1A 4WXYA 4C6KA 2EG7A 1KBLA 3YPIA 2HRWA 2AKMA 2V5BA 3KL3A 3QQ1A 4JNYA 4XISA 3TDFA 4C6PA 4GIYA 4ONVA 1N55A 1KFKA 2UZ9A 4PMUA 1G7VA 3QFWA 4AX7A 5I77A 4D71A 3LXCA 2DH3A 2OQHA 5D38A 1LLZA 3CUFA 3CQIA 1CB2A 3DC8A 1SR9A 3PJUA 3UQNA 4RPPA 4FZIA 5BMWA 4W93A 3UZYA 3P3BA 2P3EA 3BW2A 1TE1A 2FGZA 4G56A 2OT1A 3VOJA 3EMQA 3W6MA 2DT2A 2VL4A 3CIXA 1C8XA 1FXPA 1W3JA 1I4NA 2XGBA 3SCVA 4X0NA 4Q4QA 1CXLA 3WENA 4AF0B 4YYCA 2HBVA 4ICCX 2Y85A 3G8EA 5AC8A 2YA2A 4DJED 2FHFA 2IXVA 4MFEA 2WKGA 3S3GA 4L9ZA 3LI1A 1A0EA 1J96A 4BR1A 1PHQA 1Q6QA 4HMCA 3H22A 3MZNA