1YXDA

Structure of e. coli dihydrodipicolinate synthase bound with allosteric inhibitor (s)-lysine to 2.0 a
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
292
structure length
292
Chain Sequence
b'MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydrodipicolinate synthase
publication title The crystal structures of native and (S)-lysine-bound dihydrodipicolinate synthase from Escherichia coli with improved resolution show new features of biological significance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 110
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2005-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1yxdA00
3RFAA 3GR8A 3I65A 4OV4A 4QJ1A 3C4UA 2JK2A 2C16A 3IVSA 1LM1A 1L6WA 4ORIA 3BG3A 1ZALA 4M19A 1L6SA 1WOAA 3O07A 2ZCGA 2R91A 4O1DA 1OHLA 1SQ7A 3UYCA 1W5PA 3PR2A 3G1AA 4GUIA 3GXTA 3GR7A 3O6CA 1S5TA 5D30A 4EF8A 2VC6A 5LNVA 4JX4A 4NVTA 1SU5A 3BPWA 3E0IA 3LI1A 3PB2A 3DU0A 4FNTA 4O17A 1SO4A 2CZDA 1VGAA 3MI3A 2Q3RA 2C15A 1OK4A 1FBAA 2OT0A 3M47A 4OE7A 5G4WA 5KZEA 1E51A 2NZLA 3NR0A 4RK8A 4UFHA 5DCBA 3QW4B 1N7KA 4M7TA 2JKPA 4NXKA 2ZTKA 5CZTA 5KZMA 4ICNA 2NXIA 4GUJA 5K3VA 5BMWA 3T55A 2YZRA 3WFAA 1DQXA 2NV2A 4GC4A 1MEIA 1O5KA 1OX6A 4B5NA 2A7RA 3OVRA 1YDVA 3WJWA 1KTBA 1AMKA 1KM6A 5L6UA 4DPQA 4K37A 4LS1A 3CIXA 1VCGA 3SW6A 1F7BA 3W74A 2E6AA 3UQNA 1QO5A 1NFBA 3NGJA 1OFQA 3UZ5A 5HNRA 1AG1O 1XI3A 2Y6ZA 2PURA 3L68A 1KTCA 4BWLC 3NQDA 3MBFA 2ISVA 1YYAA 4Q32A 3GVGA 4LW7A 3B4UA 2BX7A 1AK5A 5AC8A 1O5XA 4RZ6A 3DFSA 1R30A 1KTNA 1MEHA 3JS3A 4XKYB 4AHQA 3N34A 3S42A 5EMUA 1EB3A 3LI0A 3QYQA 4N9DA 3ANYA 3W2KA 2E5DA 4NJJA 1YDNA 4JX6A 3A9IA 2DJLA 3BLIA 1BTMA 2B0MA 3EB2A 3W1LA 1TPB1 1I2OA 5A8GA 1PHWA 1TJPA 2CW6A 1QR7A 5CGQA 5IBXA 1Q6LA 5E1QA 4LVDA 2ZZ2A 1I2PA 3H53A 2QCGA 4MZ8A 5FF4A 2X30A 1MXSA 2QCDA 3MW7A 3ZFHA 5SWUA 1H7RA 3LXAA 4WX2A 3PUDA 1RVGA 5LHEA 5D2TA 2C19A 1TPC1 1OFAA 1FDJA 3SGUA 4LVAA 4WD0A 1TSIA 3O1NA 3GAYA 4I7VA 1U83A 5L9FA 5MHBA 1B4EA 3NQVA 1FWSA 5G5IA 2WNQA 3FEMA 2C13A 3G8RA 1U5JA 1WX0A 2BLEA 5G2HA 2D73A 2E5BA 4Z1AA 3OHIA 3ZS4A 4HPJA 2TSYA 1MSSA 3LCWA 4X9SA 4U28A 3HGOA 3GKAA 3ABQA 3UPBA 4UR8A 5E0KA 1T8XA 3C52A 3MBDA 5CPLA 1FX6A 3TMLA 2A5HA 1OJXA 3M5VA 5BRBA 5LKYA 4IXHA 8TIMA 1GVRA 4A21A 3W88A 3FKRA 1ZENA 4YXGA 4LNYA 2X1RA 4WJEA 1YXYA 5LHFA 3TSDA 3BG9A 3CQ0A 5HUPA 3W7GA 3O6DA 3L2IA 1G7VA 5HQEA 1LLZA 3EKZA 5F2GA 5K9DA 1HL2A 4UIOA 3QW3A 4AXKA 4HHPA 1ZNNA 4NQ1A 3WK0A 3A24A 3DZ1A 4L4LA 2VOMA 4XBSA 3EWUA 3QSRA 5DCEA 1LBMA 1XXXA 3W1NA 4UTTA 4N9CA 2QJHA 2QKFA 1DBTA 3S6DA 4JICA 1TV7A 1K3UA 4JTJA 4Y6GA 3OG3A 1EP2A 1EP3A 3L5LA 3CIWA 1R2TA 3RF9A 5D2WA 3SGZA 3QQ1A 2C14A 2GVLA 3R89A 5CZ0A 2G97A 2Y85A 3FLUA 3G24A 3HG3A 3LXCA 4MOZA 3UZJA 3TXZA 1H7WA 1TPVA 4Z08A 4XBKA 2EPHA 3IVTA 3MJYA 4UMAA 4ONVA 4QM1A 1BWLA 3B0UX 3OEXA 3P62A 4UMBA 3HG2A 1EWDA 4O57A 1LOLA 3MWAA 4MY9A 1P1XA 1TPDA 2NLIA 3W7QA 3G1SA 1VYPX 4LUIA 3WJXA 3QMRA 3IGXA 1T96A 2OJPA 3W7DA 3TU9A 3FJ6A 1PV8A 1VCVA 4S2CA 4ZMGA 3AO0A 2ZRZA 1OK6A 4QQ3A 4IMDA 3DXIA 4O0ZA 1G4PA 1QNVA 4AH7A 2TMDA 2QR6A 1ME7A 1JRCA 1M7PA 4PODA 3W7RA 3GDRA 3T44A 1GEQA 4OQVA 1PIIA 4BF9A 3ABOA 4XZ9A 4H4IA 4O8RA 1G67A 1KV8A 3NQ2A 4NZJA 4UUIA 4EOUA 4JTLA 1JCLA 2GQAA 4FX7A 4TIMA 3S1UA 6TIMA 1LDCA 4NX0A 4PA8A 1KFCA 1K03A 1QO2A 3MYPA 1BWKA 1KLYA 3IIOA 5LGZA 3NPWA 3CLMA 3FJLA 4MY8A 1OFRA 2RDWA 4E0CA 1ICSA 3NZ1A 1KM0A 2C1HA 3W83A 3OIXA 1M7OA 4GUGA 4L4MA 3ZWSA 1W3NA 5AN7A 3TQKA 6ALDA 1TPWA 1OX4A 2J88A 1GTEA 1SW3A 3MYOA 3O16A 4CNNA 3BGGA 2V30A 3EX2A 2ZA3A 3MI6A 3W7MA 3G1VA 3P81A 1KM5A 3G1DA 1A50A 1OFOA 1LBFA 3VNDA 3T78A 5FESA 3Q2DA 4WUIA 5LGXA 2G95A 1H5YA 4DPPA 3P82A 5EKYA 2OX1A 3LCLA 5G4EA 4Z1BA 2WKJA 2DZTA 2QEZA 2W0UA 3MHGA 1JRBA 3UWUA 3A5VA 1B57A 3IIZA 2CLFA 2ALDA 4O16A 4IWWA 3L0KA 2OMAA 4PTNA 4M5PA 4KFNA 2A6NA 3NL3A 1QCWA 5F2IA 4Q33A 4JYEA 1TJRA 4NJKA 5DXXA 1ZFJA 2ATSA 2J9XA 4TMBA 2XN0A 3C61A 3QPZA 2NV1A 2DP3A 3O06A 4JTSA 2FIQA 1UCWA 2PC4A 3DFTA 1G69A 4UTKA 1TPEA 3L0GA 3P5ZA 3O05A 1TTIA 3Q37A 3RLUA 3NXFA 3A23A 1Q45A 3HO8A 4PCFA 3NQMA 1G4EA 1PHQA 1FWWA 1J4EA 1H7PA 2IQTA 2Q8LA 1H62A 3W1RA 4AMAA 3NL2A 4K8EA 4BI6A 4UFIA 3STEA 5TIMA 2ZFAA 3HF3A 3W73A 4UTMA 1NSJA 3QEZA 3QH2A 4K36A 1J2WA 1F73A 5K4ZA 4Q4KA 1T0OA 3IVUA 3DHFA 1B3OA 2I9EA 3C56A 4FNPA 4FNUA 2AAMA 5I3KA 4JTFA 4IMCA 1THFD 1KFEA 1VPXA 3W7IA 1WBJA 3FYOA 1KFKA 3W9ZA 3C6CA 1TIMA 2QCMA 1TPH1 5AC7A 1N8FA 3GNDA 3LERA 3M1ZA 3PBYA 2NUYA 2ZYFA 2Y62A 2Y88A 3VFLA 1EEPA 4JDYA 4UTJA 3LHZA 3UNDA 3W1UA 4JTUA 4XUGA 4JTKA 2V2CA 2QCHA 4NUWA 4TU1A 4AB4A 2YFOA 4FB7A 4O15A 3M6YA 4UFLA 2GVJA 5CPMA 1UJPA 3EXSA 3G0SA 3LTYA 5DELA 2R8WA 1DOSA 1ML1A 3UY8A 3TH6A 5FF3A 1F76A 1SUXA 3W7OA 2E77A 1YADA 4UC5A 1OFEA 3IRDA 4QITA 2VEIA 1AW5A 1XDMA 4JXCA 3BGJA 4UFJA 1XUZA 2E1DA 3PULA 2OCZA 1KM3A 3P67A 1TRDA 3PSVA 2Y7FA 5DCDA 4QAIA 2QCEA 1TQXA 1AL7A 2CLOA 2PRHA 3DFOA 1LZOA 7TIMA 3NG3A 4K7VA 3U8GA 4CCDA 3NM3A 3MMTA 2V5LA 1LTDA 2XN2A 4Y9AA 3TC7A 1C9DA 3QZEA 4MKNA 4O14A 3I68A 3TDFA 3VCRA 2GVGA 2YR1A 2FJKA 2H6RA 3EWBX 1LRNA 1W5OA 3O6YX 2QCLA 4TX9A 2PCQA 3EXTA 1TPFA 4N9EA 1SO3A 4UTUA 2ZRUA 2VFHA 3BG5A 5EBUA 1QOPA 1TPUA 4RJEA 5C6MA 1I4NA 2E6DA 3SY5A 3IGSA 2X1SA 3ABSA 4JS3A 1MEWA 5AHMA 3LBMA 4Y90A 4FXRA 1FCUA 4YLWA 1YLVA 3DKJA 5EYWA 4YMZA 4O0KA 3HGRA 3G1XA 3UWWA 3S5NA 3SECA 3W2LA 1JCMP 3STGA 3BW4A 4EVZA 5F1UA 3I7RA 3PS7A 3I7QA 4O18A 3QM3A 3TA6A 5DN1A 4HSNA 3W7NA 1IGSA 4LTSA 3T40A 4UCGA 3IV3A 3ABRA 3W71A 1XC4A 3P5YA 4OU1A 3MO7A 5T26A 4XTDA 4IQLA 1ZCOA 1A53A 1XFBA 3LM7A 2UV8G 4FF7A 4WY0A 3W2JA 1TYGA 3HPXA 2NWSA 1A5SA 3FYPA 4PH6A 3G3DA 3LCXA 4X2RA 3W1TA 3TUUA 1P5BA 3WJZA 4H3DA 4NX5A 1GT8A 3MP3A 3MI2A 1H7NA 2RKXA 3PG9A 2JBMA 5U7SA 1GYNA 4BK9A 2JGQA 3NAVA 1OVDA 3GDTA 3NQ8A 4HIBA 1VLWA 5HUOA 3M9YA 1VHNA 5K2ZA 1FCVA 3GK0A 3KOFA 3DGRA 1W56A 4ALDA 4FXSA 1JULA 2ISWA 4K6AA 1OG0A 3GDKA 4A2SA 3E02A 5KMYA 3N73A 5HULA 3U6WA 3KAOA 1NF7A 2ZDRA 3RLVA 1EUAA 1X6UA 4JR5A 2V2HA 3EWYA 4PL1A 3GXNA 4G1KA 5LNUA 4RKAA 2A21A 3ZR4A 1ZY9A 1H1ZA 2FFCA 1JUKA 1SPQA 1OABA 3I7SA 1FDYA 5F2LA 1LORA 3CEPA 3W23A 2A4AA 4O12A 1RZMA 4MVAA 1G4SA 4JTTA 4YCOA 2YW4A 1RR2A 4PL2A 3BK0A 2WJZA 2CLEA 3NQEA 1G4TA 4ZVJA 1JUEA 3L5MA 3G22A 3UWZA 2QUVA 2Y63A 3P80A 3EEGA 4QISA 1VYSX 3B03A 1H7OA 3LV5A 3FKKA 2NUWA 4N2YA 3LCFA 3F1QA 4ADSA 3TIMA 1BKSA 4FX6M 3N19B 4TMCA 1OF6A 2B4GA 1D9EA 5D33A 2FB3A 2R14A 1C29A 3YPIA 4ZL1A 3W1AA 3E12A 4IXXA 4A22A 1OYCA 4IGHA 4AWUA 4IMEA 3N2XA 1KBIA 3PBVA 2X1UA 3FA5A 5HWNA 4GWEA 4IX2A 1JCXA 1JCNA 4QIUA 4YCPA 1Y0EA 1W37A 3M44A 1GVSA 5CZSA 4GUHA 4EWND 3EKLA 1DQWA 1O94A 3PWAA 3PAJA 3Q94A 4WOZA 3LHTA 5EPDA 2ZZ3A 3GB6A 1DL3A 3W7CA 3H54A 3E9AA 3N2MA 2FPVA 3W75A 1SZFA 4KWWA 4E38A 4EIVA 5FF7A 3M0ZA 1FWTA 3TROA 4JTEA 3NQFA 4A29A 5I3GA 1JVNA 4X3ZA 2A7NA 4FHAA 4DQWA 3B0VC 4JGDA 2PE4A 4LVGA 4IOTA 4UFMA 4YL2A 3TFCA 1L9WA 1A5CA 1PVNA 5AFDA 3M41A 3TFXA 4O10A 3UPWA 1GJPA 2H8ZA 5HINA 4IMFA 5G1TA 4WXYA 3KHJA 2XN1A 1DJQA 3G8EA 1ICQA 3BV4A 4ZQCA 4LV9A 3EX4A 3NEVA 1Q3NA 2G96A 4FX8A 2ZBTA 3TX9A 1S3HA 2ZZ1A 3W87A 1V7YA 2YPIA 5AC6A 2YX0A 2F84A 1TTJA 3L21A 1R2RA 2TRSA 2GOUA 3O15A 1XBXA 2C0AA 4LUJA 4LC6A 4POCA 1CX9A 1B4KA 3L0NA 1RPXA 2H8XA 1DHPA 1PL9A 4XKYA 3QF0A 3BARA 3PB0A 3S8HA 1YXCA 1KLZA 3EWZA 4WQ6A 4PEKA 1FDZA 1W54A 3WK1A 3WJYA 4HNTA 2A2IA 3M16A 4R34A 2HSAA 3C2VA 4HN4A 5F4XA 1KV5A 3N9SA 3BLEA 3FS2A 4UTLA 3FOKA 3SSJA 1XL9A 5BNKA 1QPNA 2GQ8A 2CZFA 1FCBA 3GAKA 3QJAA 2G5WA 5KZDA 3DFQA 5CPOA 4GRSA 2ABAA 4LY8A 2VXNA 1QDSA 3PG8A 5G1YA 5F2MA 1R2SA 2Y7EA 3TAKA 2V8ZA 2VEPA 4R7JA 1X7FA 2RDUA 4RX0A 2W6RA 4JX5A 2O7QA 1KBJA 4HNNA 1NVMA 3TMQA 2HTMA 4JD4A 3IEBA 4ZQNA 3W2NA 4QSHA 1JQXA 3W70A 3S1XA 1A5AA 2V81A 4Y8FA 3M5YA 4MJMA 4LT9A 3W7HA 1H1YA 2Y89A 2V5BA 4LRTA 3DAQA 2CFFA 3LTPA 4PC8A 4MLJA 2WPBA 3R8RA 3GX9A 1HG3A 1QAPA 3HG4A 3P7YA 4UMCA 4DELA 2HS8A 1F74A 5CG7A 1EX5A 3RU6A 3N3MA 4XQ6A 4J9JA 1W5NA 3TJLA 3W1XA 2I1OA 3NYZA 5D2YA 3W1MA 4DO6A 3KRZA 4YWIA 4N4PA 3R5EA 4NJHA 2A85A 3W84A 4WY0F 2GQ9A 4LS0A 5AOUA 5IM51 1H7XA 3RNDA 1TMHA 3SIZA 4E2BA 1D3GA 1H63A 5DY3A 3LDVA 4BWLA 3RK8A 3DH7A 3HG5A 1IXQA 3CB8A 5EL1A 1MZHA 1V5XA 5I3FA 4AVFA 2VELA 2X16A 2VENA 2EHHA 4KFOA 1ONRA 3W6YA 1D3HA 4NZFA 3HGSA 4WXZA 5AHFA 1K7FA 3TE9A 3HOJA 3F4NA 1X8FA 1ME8A 4CQ8A 1IXOA 2EAWA 2B7NA 5LNWA 1EWEA 2JKEA 3EWXA 2ZRYA 4K38A 3NQGA 3D0CA 4JNMA 2VKZG 4XTIA 3LCHA 3TJXA 1R47A 3W1PA 2QJIA 2ZZ5A 1S5VA 3S1WA 2Y61A 3C2RA 4GUFA 1GG1A 1AL8A 2A6LA 2B7OA 4FNQA 4LU0A 4O1BA 1YDOA 1GVFA 3NL5A 4I7UA 5K9XA 2CLLA 2BXVA 1TO3A 2VFEA 2ZTJA 2VFGA 4Z0JA 1HO4A 3OA3A 3R2GA 4CNPA 1H50A 1FCQA 5H91A 3NL6A 5U4NA 1AW1A 1SR9A 2O7SA 3THAA 1DKWA 2QDHA 3KX6A 5KSWA 1K8ZA 3SJ3A 2V9DA 4BI7A 2Z6IA 3PUEA 3BO9A 4OT7A 4TR9A 2WNNA 2PRLA 3DI1A 2CLHA 3BLFA 3NVTA 3UXAA 4C1LA 3NDOA 3TW7A 4AHPA 4KKXA 2RDTA 5GVJA 1W8SA 4HT3A 3F03K 2Q8ZA 4JY9A 2VFDA 3STFA 4DBEA 2A1YA 4LVBA 4MPQA 2GUUA 5C2XA 2WOQA 1TB3A 3QFEA 4M7SA 4K8HA 1FUYA 4JDBA 1XM3A 4NJIA 4HNVA 2W79A 1L6YA 2CLKA 3L66A 3TK7A 3M43A 1Z41A 3TKFA 1ZJIA 4ML9A 1WA3A 5LSMA 1FWNA 2C18A 2NXHA 3SI9A 3GXPA 5D37A 1WOBA 1XUUA 3SR7A 4RR4A 4RXGA 5LZLA 3GNNA 2QCFA 2ABBA 3LV6A 1WV2A 4WY0B 2XFWA 4GJ1A 3W07A 1W1ZA 1GOXA 2QUTA 4O4WA 3UWVA 4O1CA 2FTPA 4GBUA 1I45A 4Z1DA 3TV8A 1KFLA 5LNSA 3P61A 4ZQPA 5EA9A 4P2VA 1LOQA 1VS1A 2P1FA 3JR2A 3QPYA 3LRKA 3NNTA 3M7WA 4UTHA 3NQ7A 3NPXA 1YPIA 1GZGA 5D09A 3DI0A 1GVOA 1SSDA 2A7PA 3MHUA 4Z0SA 1DORA 1H61A 3NQCA 4CLMA 3W1QA 1Z44A 4WZHA 4FNRA 4AF0A 2GJLA 2BZNA 2ATMA 1KM2A 1PCKA 1O4UA 2VFIA 4UTTC 3UWYA 1Z48A 4N6EA 3RMJA 3PY2A 4CCEA 1QPRA 3EXRA 2QDGA 5F4WA 3DENA 1HUVA 1EPXA 1XBVA 4MUZA 3N14A 2TPSA 2E09A 3GLCA 4LV4A 4AHOA 1N55A 2ZRVA 3C8FA 3W3OA 4KFPA 2V0TA 4CCCA 4NXSA 4BFAA 5BOOA 3HGJA 4KWVA 4RZ4A 1K7EA 4IPIA 3A5FA 2WSRA 1VH7A 4JEQA 4ADTA 1FXPA 1G6CA 1A5BA 3KVMA 4O53A 4UFKA 3TNOA 4I7WA 3TR2A 5AHEA 3VI2A 2DJXA 3C0JA 4MYAA 3A22A 2DORA 4MYXA 5KINA 1S5WA 2QCDB 1TV8A 1IXPA 1GYLA 3PM6A 2QAFA 4HPXA 5FEPA 5J5DA 2LLEA 3W2MA 1VZWA 3EX1A 2P0OA 4WOQA 3WJSA 1L2UA 3IGUA 1SZNA 3GIYA 2C6QA 5CPNA 1DJNA 5AB3A 1NEYA 1YTDA 3HIJA 4RXFA 2ZZ4A 4S1FA 2CU0A 4D2JA 5D32A 1PCWA 1WAUA 2YXGA 3QMSA 5LNRA 4CNOA 2H3BA 5BW6A 4ZQMA 1UBSA 3LRMA 4ZQRA 2FDSA 5I3JA 1X1OA 3L65A 1IF2A 2ZA1A 3CWOX 1WYIA 1VQTA 4O13A 2GJNA 3IIPA 1UB3A 1W31A 3W7LA 5DY2A 1QOQA 2YFNA 1LBLA 2ZQ0A 4ZZ9A 1XBZA 1SZGA 1AW2A 3G1YA 4NNAA 2Z6JA 1YTEA 4QNEA 2CLIA 4XWUA 1K02A 4K7YA 3LB0A 4JYDA 1FQ0A 2QAPA 2VFFA 4BR1A 2DZWA 5AHIA 5TQLA 1OF8A 3CU2A 5FEWA 3KVLA 3GKFA 5G2WA 1LRQA 4NU7A 1GVQA 3NQAA 2WV8A 1LOSA 1RV8A 2YSWA 5HWJA 3UD6A 3S9YA 3BW3A 2NUXA 1VR6A 4RV8A 5D38A 3GDLA 4JY8A 1VRDA 1GWJA 4I9AA 1XCFA 3T4CA 1F5ZA 3R13A 3NPVA 4Y96A 5TBOA 1ZAHA 1NF0A 3C2EA 3LCIA 1VHCA 1EUNA 1PE1A 2Z1BA 1KM4A 3W7KA 2FLIA 2BWGA 5ABTA 3B05A 3QQ0A 1C8VA 1GTHA 1KFBA 3QRHA 5J5RA 2PRMA 1LLWA 3S5OA 1RQEA 1GQNA 4DXVA 5DBUA 3V1PA 2WQPA 2WNZA 3S5ZA 3VE7A 3PBUA 4A3UA 1LCOA 2H90A 3B06A 3B8DA 3ATYA 3G1FA 4RCXA 2NX1A 4IJBA 4ZQOA 3MHFA 4Z1CA 1SZEA 1CI1A 3USBA 2AQWA 4RZ5A 4FIRA 1H51A 3PBWA 3MP5A 4LS2A 4UTWC 3DFPA 2ZZ7A 1KM1A 5AYXA 4TO8A 5CZJA 4PFMA 3W76A 3LOTA 3O63A 4OV9A 3HJZA 4P61A 3W85A 1SSGA 1M6JA 5KITA 5K7JA 1Q6QA 3PUOA 1JJKA 3R12A 3LHWA 2DZXA 3HPSA 1I2NA 2QF7A 3LBCA 2NX3A 3PF3A 1YTKA 3KVJA 3P8IA 1TRIA 3L5AA 3PVFA 3LHYA 2CWNA 2QCNA 3EWWA 3MP4A 2BTMA 2DZSA 3CHVA 4E2DA 1RQHA 3M5ZA 5I3HA 1H60A 2RFGA 4R53A 2ZA2A 3T7VA 3S0CA 3LTSA 3LHUA 3SZ8A 1P0KA 2DZUA 5D05A 2F7FA 3W7EA 3CPRA 5C5YA 3S1VA 4R33A 1I8JA 3AJXA 4W9TA 1OX4B 2JKAA 2TYSA 5FF2A 4JTHA 4NJGA 3UY7A 1IIHA 4DF1A 5CSRA 3CEUA 3OVQA 4JIQA 3CC1A 3ATZA 2QJGA 1JR1A 2CLMA 1W0MA 1UASA 1O95A 3G0XA 5HMSA 2YYUA 1KW1A 5A5WA 3DKLA 4IUOA 1VJIA 3P60A 4DF2A 2EF9A 3G1HA 4IPJA 3IIXA 3LLFA 5DLCA 5DBTA 5H2ZA 4O1AA 4GE8A 4LOCA 4LWWA 4GFSA 1QWGA 4OGZA 1QPOA 2NX9A 1QFEA 4DO4A 3TC6A 4X22A 1LYXA 3CM4A 3FIGA 3NA8A 1TTPA 5FI8A 1PS9A 3Q58A 2H3DA 4AEOA 5E93A 1SW0A 5D02A 3KRUA 3G18A 4OBTA 4O19A 2J9YA 2B7PA 3ELFA 5F1VA 3QSTA 1W3IA 2C3ZA 5I3IA 3WK2A 3CTLA 3O8AA 1B9BA 3P84A 4M6QA 4N02A 3NPUA 2J9ZA 4GNJA 1VYRA 1YPFA 5HR6A 4O54A 1KFJA 4O4VA 3W7PA 1I2RA 3QC3A 3GDMA 3IIVA 2Z0IA 3KRSA 2P10A 3W22A 5EY5A 2VEKA 1T99A 1OFPA 5F4SA 1SO6A 1OYBA 3LXBA 4CQ9A 2KZHA 1TREA 4FNSA 1DVJA 4M6PA 4UXDA 1VCFA 1XDLA 2WSQA 4FIQA 2DZPA 5AHNA 3P74A 1CW2A 1WDWA 3TSBA 3LGEA 1JCYA 3LLDA 2E6FA 2Y7GA 2WSYA 3E49A 3I6RA 4ADUA 1ZAIA 3QMTA 4MZ1A 4AAJA 2I14A 2VEMA 2YGYA 3V75A 1OYAA 3UXDA 4EF9A 3TXVA 5HJLA 1JCJA 2BSLA 3W7JA 1WXJA 4LVFA 2FQIA 1UUMA 5K9CA 4UR7A 2EKCA 5DXYA 1TCDA 4JIPA 2AGKA 2ZRXA 3ZWTA 1VC4A 2YCEA 3GYEA 3VKJA 2QUUA 3TW6A 1J5TA 3SFKA 1ICPA 1P0NA 1W5MA 1ZAJA 3CWNA 2DU2A 3G0UA 1FY6A 3B0PA 1LROA 3PSWA 1SW7A 1W5QA 2RHGA 1FWRA 5HWMA 4HKPA 2Y7DA 3TQVA 1K7XA 4CQAA 2E68A 4O50A 3HQ1A 1BEUA 3HB9A 2DZVA 3GZ3A 3CT7A 2WO5A 1F2JA 3C2FA 3EX3A 4MIMA 1JUBA 3F4WA 4HSOA 2CZEA 1EIXA 1F6KA 4JTIA 5D03A 2YYTA 4K39A 5G2IA 5FEXA 1WBHA 4IMGA 2FPTA 4MFEA 4BI5A 2YW3A 1LP6A 4LRSA 3W72A 2HMCA 2B7QA 3W86A 2OT1A 3EX6A 1HTIA 1TV5A 1ME9A 2OZ0A 2ZZ6A 3G3MA 4AF0B 1FXQA 2NXGA 2R94A 4UTWA 3NM1A 2X2GA 2Y70A 4UNKA 4UTIA 3INPA 4JTGA 1TTQA 1JQVA 1QMLA 3MUXA 1HFBA 1GPWA 3UWQA 3M5XA 5C54A 5CKSA 1QPQA 3B04A 3JRKA 4H6KA 1XBYA 2V2DA 3DHDA 4QNWA 4DO5A 3LHVA 1R46A 4LC8A 2J27A 3TAOA 2A0NA 1SFLA 1ADOA 3KXQA 2ZRWA 4U4MA 5FEZA 2X1TA 1EA0A 1YXDA 3DFNA 5IBXC 4A2RA 4N6FA 3LCGA 4M6VA 3LX9A 2JGYA 3E96A 3NQ6A 2NWRA 1XKYA 2ISSA 1UUOA 4N4QA 1SFJA 1TQJA 3P8JA 3H55A 1G7UA 3NOEA 5D2XA 3WK3A 2Z2UA 3VE9A 3NZRA 5HR7A 3L67A 1K8YA 3U2OA 2QCCA 4MZYA 3THQA 1NAL1 4FO4A 3W2UA 1P4CA 3C2OA 2Q3OA 1W3TA 2E6YA 5KTLA 2J24A 1ZHAA 2FB2A 1OX5A 1Q6RA 3HPZA 2YDAA 3A21A 3FFSA 3STCA 4DBDA 2FPYA 3L9CA 3DBPA 4O11A 1IIGA 3OVPA 4UNLA 4JN6A 1RD5A 4NT0A 4NNBA 4MJZA 4C1KA 4MY1A 3N9RA 4IX0A 1MO0A 1WQ5A 5FF0A 1EP1A 1SO5A 3KVKA 2CZ5A 3K30A 1KA9F 4OHQA 4MFDA 4JYFA 5D04C 2GPTA 5K4XA 4AWTA 2RH9A 3KFTA 3NO5A 3BW2A 3C3NA 3TQ0A 5AYZA 1F05A 1F6PA 1M5WA 4GXMA 4N9BA 4O52A 1GG0A 5AHLA 1RQBA 2EGZA 1O60A 4AWSA 1K8XA 3HMJG 5D2VA 4FEZA 4OWGA 2HS6A 1I2QA 1ALDA 3S5YA 3PC0A 1OFBA 1X1ZA 2J6XA 3LRLA 5CSSA 4S2BA 1IXNA 2E5CA 5AYYA 1DV7A 1OFDA 3HBLA 3OBKA 3TSMA 4O28A 4RLIA 4DF0A 1VLIA 4HNUA 3TCEA 4ORMA 1LRTA 1HO1A 2V82A 4MLRA 4NNCA 5BMXA 3BVJA 1Q6OA 4DEFA 5C55A 1Z42A
chains in the Genus database with same CATH superfamily
3CHDA 4OV4A 3BURA 4QJ1A 4DXKA 3C5QA 1EYWA 4L6OA 1O1ZA 3HA1A 1LM1A 4A3RA 1U5HA 1Y5WA 3OG2A 1OD0A 1RLCL 3O07A 3LA4A 1SQ7A 3R11A 2QIWA 1B3XA 2ACQA 3F2CA 3GR7A 3O6CA 1S5TA 2YXXA 1SU5A 4JIIX 4O17A 4HHMA 2CZDA 3GM8A 3ARYA 3ITVA 5DMLA 2OT0A 5G4WA 1E51A 3NR0A 4RK8A 4UFHA 5DCBA 1FHUA 3QW4B 4M7TA 1CNVA 2JKPA 5CZTA 1XINA 4E6MA 1JZ3A 2NXIA 1LG2A 2PDUA 4XAZA 1MEIA 1UMYA 4IIFA 1O5KA 1F6YA 2HV5A 1OX6A 3OVRA 2J62A 1KTBA 5DRCA 4IP7A 4JPGA 4V27A 5L6UA 3FAXA 4K37A 1V0KA 2ZX8A 3SW6A 3WQPA 2V3FA 2E6AA 3D3FA 3UQNA 1NFBA 3NGJA 1OFQA 3UZ5A 2OEKA 1ZPTA 1AG1O 4AZIA 2Y6ZA 5HMDA 3URBA 2PURA 1KTCA 3A4WA 2Z1WA 2HVNA 2X1IA 2JIEA 1UBPC 1AK5A 5AC8A 2Z4GA 4ZSUA 3DFSA 3UNTA 1EJRC 1QI2A 2DT0A 3N34A 3S42A 3CL6A 2PS2A 1EB3A 2PD5A 3LI0A 3ES7A 2E5DA 4LB3A 2VWTA 1YDNA 1E5NA 4JKKA 3SCTA 3DGBA 1QHOA 1PHWA 1EGZA 3VIGA 1AZ2A 4PUUA 4LVDA 3AS3A 4AD1A 3HQOA 3H53A 4MZ8A 3WO8A 1YQ2A 5FF4A 1PKLA 1ISXA 1LLOA 2VI0A 5SWUA 4XSLA 4AWEA 2C19A 1OFAA 1FDJA 1J8VA 4W8LA 2J7HA 1WUFA 1U83A 2F6KA 4BS0A 3NQVA 4IQEA 1UC4A 3THUA 1LT8A 3WX7A 2C13A 1U5JA 1PX3A 3BH4A 1ISYA 5BXSA 3RJYA 3ZLFA 1PPIA 1WXZA 1HNYA 4DY1A 2G3FA 2P8BA 3B9NA 5I79A 1DQUA 4X9SA 2TODA 3L4VA 2PWEA 3UPBA 1TE1A 4GXWA 4PBGA 1T8XA 3NZGA 3AHXA 4V1YA 3UZYA 2QIIA 3TQPA 5LKYA 1GVRA 2G41A 4G56A 5LHFA 1SMDA 3CQ0A 4IJCA 4CGTA 3UEQA 3DZ1A 4FXFA 4L4LA 4XBSA 3V7PA 1LWHA 4R9XA 5I5RA 1QW8A 1REQB 3B4YA 4JICA 3S47A 1K3UA 5AECA 4C91A 1MQPA 1EP2A 4KEVA 4DYEA 1R2TA 3QQ1A 2C14A 4DJEA 3FLUA 2Y85A 3UZJA 4IPPA 3TXZA 1TPVA 4KF1A 2FGBA 4S3DA 2IKHA 4UMAA 4JFSA 4YPJA 2OGYA 4GFIA 3UJ2A 1EWDA 3REQB 4QP0A 1Q2RA 3M46A 4HD5A 3WNOA 1LOLA 3W7QA 3VINA 3NDYA 5DEZA 2IPWA 4B92A 1NDWA 4LUIA 1JYVA 1PEZA 1T96A 2E67A 2XUCA 3W7DA 1A3XA 3H4GA 4HU0A 2P5NA 4AH7A 3MUY1 3NWRA 3W7RA 3QGKC 4JCLA 1LUCB 4HHLA 4P7QA 1KV8A 1F3WA 4EOUA 3S3GA 4JTLA 3S1UA 1H4PA 2EBNA 5DT5A 1LDCA 4NX0A 3PZVA 5I78A 2DSKA 3MYPA 4CD7A 3IIOA 5LGZA 3NPWA 1J12A 1OFRA 4E0CA 5I24A 1ICSA 3NZ1A 1KM0A 3EWCA 4B91A 4BQ2A 1K4HA 4DWSA 1M7OA 1UP0A 2ZXAA 3UESA 1TPWA 1YNPA 1SVDA 1TJ1A 1SW3A 3MYOA 1HKMA 3N11A 4RPPA 2GYIA 3ZYZA 2HNHA 4LEFA 3THDA 1ECEA 3E38A 1JAEA 3VOIA 3TTOA 2OSWA 3Q2DA 3BJTA 5LGXA 2OFJA 1H5YA 1XRVA 1YKWA 3N2TA 2OX1A 4A3HA 3WNPA 5G4EA 2ZXBA 4MF4A 5E9XA 5T91A 4Z1BA 2DZTA 2F8QA 2QEZA 2W0UA 3OQ8A 3C0LA 3F4DA 3B8WA 3PWGA 5T9BG 4EPDC 4GVFA 4O16A 4IWWA 2WCGA 4RZBA 3LMZA 4KFNA 5F2IA 5EFFA 3C3UA 2VDGA 4KGLA 4EPKA 4LYKA 2JF6A 2XN0A 5DX7A 2WSPA 4JQ4A 3K4WA 1KXQA 1KXVA 4XD3A 1W2VA 1TPEA 3P5ZA 1JDEA 3O05A 3Q37A 1ZJAA 2J13A 1UWRA 3BE7A 3A23A 2Y5SA 3CXOA 1Q45A 3HO8A 1TJ0A 2JEPA 4PCFA 3NQMA 1R9YA 1G4EA 5DFAA 1OGGA 1J4EA 2Q8LA 1H62A 3NL2A 3SUWA 3KRBA 4PEEA 4K8EA 3PFRA 4BI6A 3WBWA 3STEA 1A49A 5TIMA 3VX0A 2ZFAA 4K36A 4Q4KA 5AC4A 3PJXA 4C5YA 1XYCA 2VUYA 2I9EA 3C56A 2NSXA 5I3KA 3ZOAA 3SSZA 1WBJA 1RA0A 5AC7A 1N8FA 3E2RA 3GNDA 1DXEA 3PBYA 3U7BA 2FZNA 2GSHA 2VVNA 1JDDA 2NUYA 1VB9A 2EQDA 5BROA 3B0YA 5BU6A 9RUBA 1EIBA 4HVXA 3VFLA 1EEPA 4JDYA 3F5LA 3UNDA 4MWAD 1ZBWA 4JTKA 4E2VA 2QCHA 4NUWA 4TU1A 3TYAA 3AHTA 5D9MA 3ZJ8A 4FB7A 2OZ3A 2OYKA 3GXIA 3M6YA 1PBGA 3EMQA 3S46A 4S3KA 2I9UA 3LTYA 1LWJA 3F4VA 1XYFA 3WLRA 1R3YA 3L4ZA 2E77A 4GH1A 1KGUA 1KCXA 2PZNA 1MUMA 3SQSA 3TR9A 2VEIA 4JXCA 2OWWA 3W24A 4MKVA 4IFKA 3PSVA 2Y7FA 3T8LA 1OGBA 5EMKA 1C7TA 2AKMA 4HK5A 2V5LA 4HK6A 4WVXA 3F2DA 2GSJA 4RDZA 4O14A 3TDFA 3M0XA 3VCRA 2YR1A 3GHSA 2WVVA 2YCLA 3O6YX 2QCLA 2PCQA 3LEPA 4N9EA 1V6VA 3LNPA 4WDXA 5EBUA 1TPUA 4AIBA 3OLEA 4L56A 3EOLA 1L6FA 4ZO9A 1D7FA 4AVNA 4FXRA 3BICA 1M7JA 3GC4A 2GDVA 4YMZA 3WMCA 3HGRA 4XD6A 3GG1A 3S5NA 4RE3A 1JCMP 3STGA 4PYSA 5M5DA 3PS7A 4O18A 4CNSA 1IGSA 5E9AA 3C0SA 2WM0A 3IV3A 4F0RA 4NZ4A 1QNPA 2C0HA 1XC4A 3MO7A 4IQLA 2NWSA 4WSKA 2W9MA 5T8GA 3EMCA 1A5SA 4H8NA 1PXGA 1ISVA 2VT0A 3FYPA 3W1TA 1EDQA 3D46A 4J4KA 1P5BA 1HW6A 4KH2A 3CL7A 4NIRA 3MP3A 2A3LA 1H7NA 2RKXA 4YVXA 2JBMA 3G2GA 5PTDA 1GYNA 2Y8UA 4GXPA 5J8LA 4CQCA 2JGQA 3NQ8A 1OVDA 2YCIX 5A6MA 3SUVA 1A5MC 1VF8A 3WLMA 3WZ0E 1W56A 2PB1A 5C2GA 4FXSA 1DJGA 3E2SA 2AKZA 1V77A 1MRAA 4K6AA 3GDKA 4A2SA 4IZGA 3U6WA 5GNYA 2ZDRA 1XIMA 3PZOA 3HPFA 3LS9A 3CT2A 3SCVA 1K6AA 2ZKMX 4RKAA 2A21A 4FOJA 1R3TA 3LZ3A 3TONA 1OABA 2X8RA 2NQJA 1CCWB 1LORA 2A4AA 3CASA 4O12A 5HXMA 2BOFX 4MVAA 4YCOA 5BU9A 4CCZA 2WJZA 2P3EA 3WQ5A 2CLEA 1MXDA 1G4TA 1PYFA 2IPFA 1YMYA 3G22A 3UWZA 4KERA 3XISA 3FKKA 4N2YA 3LCFA 4ADSA 1JFXA 4DJDC 4TMCA 1D9EA 1KQYA 2BY2A 3W1AA 4Q4SA 1PKYA 2QZRA 2R82A 1DJXA 4IGHA 1KBIA 4QJ4B 3WMLA 3L4UA 4C7GA 3WQCA 1PB0A 2PTXA 4GWEA 4YCPA 1Y0EA 4ATWA 1V3JA 3ZVHA 1O94A 3PAJA 4HPHA 3MUAA 5EPDA 3GB6A 3W7CA 1DIOA 1E15A 3N2MA 3V35A 5A6AA 3WQVA 1Y5VA 2V68A 3BJFA 4E38A 3M0ZA 3V4BA 1N2VA 2QUNA 3TC3A 2Z7KA 4A29A 1O66A 2Q02A 4LF1A 2BFGA 1JVNA 4X3ZA 4DQWA 2PE4A 4LVGA 4HMEA 3KCLA 3BLPX 1BYCA 3TFXA 1TZ9A 2DIEA 4WXYA 7A3HA 2FVKA 4PMYA 1DJQA 3G8EA 1HJXA 2GL5A 1WDPA 1E6QM 3A64A 4LV9A 3EX4A 1E72M 3NEVA 4N42A 1Q3NA 5B80A 1O68A 5E0FA 5CBBA 1XBXA 2C0AA 4LC6A 4NI3A 1RLDA 2FH6A 4WSHA 4PFHA 4CD4A 1V0NA 3UJSA 1DHPA 1OC6A 3CUZA 3BARA 3S8HA 3NURA 1YXCA 3QV6A 1EX1A 4S3JA 5G4HC 3WUGA 4DJED 1W54A 3V18A 3RR1A 1CGXA 4XSMA 1FA2A 4HN4A 1G9HA 5F4XA 2ON3A 4WEVX 1PZ0A 2DSUA 2BGSA 3FOKA 3R6IA 4FP1A 4HCLA 3ZJ7A 3QJAA 1QNSA 3UA4A 2YA0A 4GRSA 2VXNA 3QHNA 2MANA 4JCMA 1QDSA 3PG8A 4XD5A 5G1YA 1YDYA 4OKDA 3MB9A 1R2SA 2Y7EA 1BVZA 1JPKA 2V8ZA 3OU8A 2VEPA 4R7JA 2RDUA 1B31A 1H1NA 3FY1A 1LQAA 1NVMA 3TMQA 2I7GA 4JD4A 1EOKA 3AIUA 3W70A 3S1XA 4B4HA 4MJMA 1JDFA 3II1A 3JU2A 1DIEA 2PI6A 4D6DA 5ABFA 3N15A 3PJTA 2CFFA 3WNMA 2WPBA 3GX9A 1RVKA 4WKHA 1HG3A 3ZLHA 4UMCA 1CLXA 4J3TA 2HS8A 1F74A 5I07A 5CG7A 3RU6A 3N3MA 4XQ6A 3M07A 3TJLA 2I1OA 4WKFA 1JZ7A 4YWIA 2WMGA 4RW3A 3UJRA 1BYBA 2A85A 4ML4A 2FGZA 3D47A 5AOUA 3AMKA 4FLSA 3RNDA 3VZZA 1K6WA 4K1WA 5LIUX 1C8XA 1D3GA 1TIWA 1EJXC 2GGGA 3BCJA 2XIBA 3HG5A 1IXQA 2VZOA 5EL1A 4BZYA 4DWSD 4ZOBA 1MZHA 4AVFA 2VELA 5M1TA 1ADSA 1FRBA 4WXZA 1K7FA 1IWPA 3HOJA 5KZ6A 2CEQA 2HK1A 1IXOA 1KCKA 5LNWA 1EWEA 4K38A 3AZTA 3KS6A 4PB4A 3WD0A 4XTIA 1AJ2A 1NDYA 3BL3A 2PBOA 2ZZ5A 3SRFA 7ODCA 2PP0A 3VGEA 2Y61A 4GUFA 2Z7GA 3SN4A 2A6LA 4O8AA 4NF7A 3VMNA 4GK8A 4F48A 4PMXA 3H2CA 1XF0A 2BXVA 1IQ8A 1K9DA 1V8EA 1OADA 1TO3A 1Q8JA 5DQPA 2GK1B 3BUVA 5A8PA 4IFOA 2VX5A 1GGOA 3R2GA 1H50A 2OQYA 1E0WA 2PTDA 4DIAA 3PTQA 2O7SA 3THAA 1PJ9A 1VJSA 4NAFB 2FTWA 3AWNA 1F8MA 3SCOA 4GO8A 4GVIA 2Y5JA 1QBAA 5BYWA 3NVTA 1LUCA 1GK8A 3TYBA 4HNCA 3S9ZA 3TW7A 4AHPA 2Z2BA 3BQ5A 3F03K 4L5ZA 4JY9A 2PWVA 4DBEA 1F4HA 2A1YA 2GUUA 5C2XA 3PK7A 2O4MA 2GWGA 2WOQA 3QFEA 1T40A 1R3RA 3KLLA 1OBAA 4HNVA 4GBDA 2IXVA 2W79A 1OCNA 4B5XA 5H8PA 3L66A 1G0CA 3TKFA 4YTRA 4ML9A 1WA3A 5LSMA 3KEHA 4AIOA 1XUUA 3SR7A 5CBIA 2BG5A 3GG0A 4RXGA 3CUXA 1UQYA 1UUQA 2QCFA 4GG9A 1UA7A 1FHLA 3LV6A 4US6A 1WV2A 3AIVA 5LIXX 4NZ3A 4P8WA 1W1ZA 1GOXA 4KCWA 3UWVA 3UR7A 2FTPA 1I45A 3QFWA 1OB0A 4MWAE 1XLHA 2A3EA 3N2BA 5EA9A 4YYCA 3DECA 3VVGA 2G37A 3C0QA 3KM8A 4AZBA 4QTGA 1KC7A 4MPKA 3NQ7A 1YPIA 2Z1SA 1EJTC 2OVLA 2PDNA 1LQ2A 5GQBA 5D09A 1J18A 3CZ8A 2P3ZA 4ZFCA 4ZENA 1H61A 3NQCA 5TD4A 1Z44A 3W1QA 3DG7A 4C6BA 4FNRA 5HPCA 4AF0A 2GJLA 4F9JA 4C6OA 2XZ9A 2ATMA 1PCKA 2G3JA 1Z48A 4GQRA 3B97A 1JG9A 3VCNA 3EXRA 2QDGA 1HUVA 1XGDA 4AHOA 3GW3A 3EDEA 5KEZA 2Q71A 1M41A 3U9IA 2J7CA 4BFAA 4KWVA 4PRWA 2J74A 3KL0A 4IPIA 2FYMA 4JEQA 1FXPA 1G6CA 3CV1A 4XZNX 6ENLA 3VC5A 3ZSSA 5AHEA 1KRMA 3SRDA 1E4NA 2DJXA 2CIPA 4MYAA 3A22A 1S5WA 2QCDB 5M3WA 2D2OA 3QKEA 3BWWA 3O9NA 3N4EA 4JQ3A 1C3FA 4OBSA 3P3BA 4R85A 1W1IE 1Z89A 1PAMA 3PPHA 3GIYA 5ABEA 2CKSA 5CPNA 4B3KA 1DJNA 3T42A 1QK0A 3LG3A 4IIEA 1PCWA 3NZPA 3SCQA 3QMSA 4ERIA 2H3BA 5JIWA 2QPXA 1JL8A 1E6RA 1NU5A 1NOWA 3L65A 4J3WA 4B9YA 2ZA1A 1L6GA 1WYIA 1VQTA 4XZLX 3IIPA 3W7LA 1SFTA 5A6BA 1AH3A 2YFNA 4D6JA 4Q8QA 4J3XA 1BQGA 5IHSA 3LLXA 3W37A 2BASA 2CLIA 4XWUA 3LB0A 2VL4A 1JPHA 1FQ0A 1C7SA 4BR1A 1E4IA 5FEWA 3AU2A 1GVQA 1V79A 2PDKA 3TEVA 2YSWA 3UD6A 2ZC8A 3F4CA 4NG3A 5CGTA 2Y8KA 2INEA 3UJEA 3VDGA 3LPGA 1DYSA 3GDLA 1P7TB 1E9LA 1ZTVA 2NVDA 1ZQ5A 3T4CA 1F5ZA 1MDRA 3R13A 4Y96A 3O3RA 1VHCA 1EUNA 1PE1A 3EOSA 1KM4A 5DO8A 3N29A 3AICA 1F07A 2BWGA 3B05A 1H41A 3K8MA 3QRHA 5J5RA 3T0AA 3O7UA 5EBAA 1GKQA 3AISA 5LIKX 4AEFA 4MAVA 5REQB 1Z32X 3B3DA 1UR4A 2W91A 1RK5A 3EKGA 3IRSA 2WQPA 2E9BA 3VE7A 2Q09A 3B8DA 1RCQA 1NP0A 4KCUA 4IJBA 4Z1CA 1CT5A 2WMIB 2D0HA 4ZB0A 2AQWA 3H70A 4W84A 4MTVA 2DEPA 2QJNA 3IJIA 4UTWC 2DY3A 2ZZ7A 3IJQA 4DNHA 3VM5A 5AYXA 1SYTA 3LK6A 4PFMA 1XLAA 3PJUA 4XZMX 3KTSA 3CK5A 5K7JA 1FHVA 3FK4A 2ACRA 3N9KA 3VIOA 4Q4RA 3CZJA 1I2NA 1M9HA 3CUGA 2XISA 4J1OA 5I2UA 1UR3M 1YBQA 4RE0A 2C1IA 2XZ7A 3L5AA 1ZL1A 2CWNA 2QCNA 2OOFA 1MQQA 2O0TA 1H60A 3STPA 3S0CA 4LYRA 3ITLA 5EB8A 4JNYA 1NARA 3S1VA 1PTDA 2BVWA 2Z27A 3S6TA 1OX4B 4W5ZA 3UY7A 2HCVA 7PTDA 1POJA 2ZUTA 1UHVA 3CEUA 3OVQA 1UZ1A 4LBUA 3T2OA 3CC1A 2GUBA 3PPGA 5LA2A 3H22A 1NM9A 4EK7A 1D8CA 1JR1A 1R3SA 2CLMA 4Z17A 5C9ZA 5HMSA 4X0NA 1KW1A 4PBFA 3DKLA 4HJFA 1M3UA 4IUOA 3P60A 4DHGA 4IPJA 2FVLA 1WP6A 4O1AA 1LL6A 1JZ4A 4GFSA 2FJUB 2VCCA 4PRRA 3GU2A 4IMAA 3TTEA 3WMBA 4D6IA 3PANA 1I9CB 5D02A 1JZ5A 4OBTA 4O19A 5C9XA 3SGGA 2VZSA 3PPCA 3ELFA 4FOKA 1UROA 2GGEA 1W3IA 1VPQA 4WHBA 1CB7B 4P7RA 3O8AA 2XVGA 4PR4A 3PWIA 4R27A 1XQLA 3RYSA 4AZGA 1KD0A 1WUEA 3WQ4A 3P84A 2J9ZA 5A8OA 1EKOA 1UD4A 3ITOA 1YPFA 5HR6A 4O54A 4Q6XA 3W7PA 8XIMA 1NDVA 3GDMA 3KRSA 3TN4A 4IPLA 4C5ZA 2WANA 5EY5A 3GNOA 3RGTA 1Q4WA 4IQDA 3GG7A 4Q7BA 4FOUA 2KZHA 1UW9A 4FNSA 1DVJA 4M6PA 5E6ZA 1XDLA 4FIQA 1F8IA 3WG6A 1WDWA 3LGEA 2Y7GA 2YL8A 4ADUA 4MZ1A 4AAJA 4L64A 1ZRQA 5DMYA 2YGYA 4DJFC 1UA3A 4EF9A 2E8YA 2REQB 2XSXA 4B2DA 5LA0A 5HJLA 4FSAA 3W7JA 2BSLA 1GYMA 1WXJA 4YWSA 3N2OA 4LALA 1XIDA 3W82A 2OSYA 5K9CA 2EKCA 3AROA 3TOYA 2X09A 1GVEA 1UG6A 3SN1A 6REQB 3G0UA 1QI0A 5A69A 3VNJA 2EEXA 4R7OA 1RP8A 3TQVA 1AH4A 2HJPA 3HQ1A 1BEUA 3HB9A 3GZ3A 3GSMA 4DJDA 1GW9A 4HSOA 4LEQA 2WLYA 1UMLA 5CSYA 1GJWA 1BFNA 4R3UA 3H4WA 3AS2A 2YYTA 2W66A 4MFEA 2DVUA 3AHVA 3V3WA 2H9AB 3BAJA 3K1DA 3W72A 2B7QA 3GRIA 2OT1A 3EX6A 2ZXDA 2YXOA 2XFRA 1E9ZB 1FXQA 1E3ZA 3VIMA 3DCPA 6PTDA 3INPA 1TTQA 1JQVA 4IPNB 4REQB 5CG0A 3N13A 1XKJA 2A3CA 1QPQA 2F2KA 4H6KA 4GH3A 3KS5A 4JN7A 4C6JA 4DO5A 3LHVA 4GYPC 2J27A 3UXIA 1U22A 2V69A 1SFLA 3PTMA 3BANA 4RNIA 3FAWA 3CO8A 4D1JA 1E40A 1UD6A 4NASA 4I9MA 4HU3A 1XLLA 3LX9A 3ARXA 2JGYA 3E96A 4Q22A 4H6EA 5E6YA 3MSRA 4IL2A 3USZA 3OHMB 1A80A 3LN3A 5JBDA 2YZ5A 3T07A 3WK3A 2Z2UA 3NZRA 3L67A 1D2KA 2OYMA 1A4LA 3U2OA 2QCCA 5D4YA 3GNPA 3WDHA 4V15A 4GMEA 4LPCA 4QJ5B 2J24A 2FKPA 3RX3A 1OX5A 3GTXA 4C6QA 1TWZA 2A3BA 2YDAA 4X63A 1QUMA 2OTDA 3EEZA 2OLAA 4O11A 4UNLA 5D8ZA 4JN6A 4GIAA 4L4OA 4MJZA 4MY1A 3W4RA 3T81A 4KRTA 1V3MA 4IX0A 3TZFA 4PCPA 5FF0A 4Z2HA 4F8XA 3RM8A 2YJQA 3RAOA 2X2YA 1RY8A 2RH9A 5CPSA 4Z2LA 3M0VA 4GXMA 3FJ4A 2GK1A 1GG0A 1RQBA 3CWHA 4NZCA 1R38A 2VC5A 4JBRA 2YLLA 5D2VA 3DC8A 2HS6A 3F5KA 3LRLA 4L6HA 1DV7A 1Z69A 3WQEA 3OBKA 1I75A 4RLIA 4DF0A 4IT1A 3W28A 5HJYA 5FIPA 2WVTA 4ORMA 4HOWA 5C0QA 3AMLA 4H2CA 2CBVA 1S2CA 4N0RA 4GZJA 3NSMA 3MTWA 3DEQA 3EDDA 4WSJA 4DUOA 4GI4A 3CAKA 2JK2A 2C16A 3IVSA 4ORIA 3BG3A 3VD3A 1F3EA 1P6WA 1X8CA 3RCYA 3MDWA 4M19A 2R91A 3ANUA 3RLHA 1J9YA 3BLDA 1OHLA 3UYCA 1W5PA 2QYGA 3G1AA 4XAFA 4M29A 4EF8A 2VC6A 3BPWA 3DU0A 4I8DA 4FNTA 3IANA 2J66A 3L23A 1V3KA 3F7JA 1OK4A 1FBAA 2HPMA 4GC3A 2NZLA 1N7KA 4NXKA 1KNWA 5KZMA 2ACSA 1JNEA 4FZIA 4ICNA 4DZAA 2VR5A 1JPDX 5BMWA 5CC3A 1Z3NA 4QR6A 3T55A 1E0TA 2YZRA 1HVXA 1HJQA 2NV2A 4GC4A 1E4LA 1MDLA 5A6BD 5DMNA 2A7RA 1MNSA 5CEWA 3CZKA 1UD3A 3HURA 2E9MA 3T0BA 1P6CA 1Q6FA 4GD0A 3OZPA 1TVNA 1QO5A 3GVVA 4KCVA 1N8IA 5HNRA 1BSLA 2GJRA 4ZBCA 5BXTA 1XI3A 4BWLC 2ISVA 3N1AA 4WGXA 4RZ6A 4CU8A 1HN1A 3VKAA 4XKYB 3HFTA 3W2KA 3ANYA 3LGDA 3U0HA 4JX6A 3A9IA 1KFWA 1XICA 1HVQA 2I57A 3W1LA 1PTAA 1TJPA 2CW6A 5CGQA 5IBXA 4EXAA 4X0VA 3IAQA 2VHLA 2X30A 4D6EA 2QCDA 2V5JA 5RUBA 1TZZA 1XLKA 1RVGA 2Q8XA 1VFSA 3R94A 4A8RA 4I7VA 2OEJA 1B3VA 5L9FA 1FWSA 2BY0A 5G5IA 2WNQA 3FEMA 1E0UA 3G8RA 1WX0A 1H3GA 5G2HA 2D73A 4KBXA 2X42A 4Z1AA 4PBEA 3WMSA 1MYRA 3CJPA 4J35A 3ZS4A 1KKRA 2TSYA 3GS6A 1MSSA 1RHCA 1JYWA 4AD4A 3WFLA 4IM4A 3T9PA 3HGOA 3GKAA 2O92A 2YA2A 5E0KA 6A3HA 1C9WA 3QY8A 3TMLA 4FLOA 1XDJA 3M5VA 5BRBA 8TIMA 4A21A 3W88A 4RUBA 2X1RA 1T6MA 1YXYA 3MV01 3HJEA 4XAGA 1Q4NX 3BG9A 3K5XA 3VKKA 4JHMA 3O6DA 1G7VA 1TWSA 5HQEA 3EKZA 5K9DA 1HL2A 3WLJA 4UIOA 3QW3A 4AXKA 4NQ1A 1PYMA 1ZNNA 2V5DA 1DP0A 1ITXA 1YE6A 3EWUA 5T9CE 3W1NA 1XXXA 1VP5A 4G7FA 2YBUA 2DQWA 1TV7A 1SMAA 2JQXA 3H7VA 3AIBA 3ISIX 3OG3A 1UKSA 1IZJA 3DHUA 1S39A 4PB3A 2IQ0A 1EQCA 1J01A 4EAMA 2GVLA 2G3IA 1HL9A 4GYKA 4R7WA 1FWAC 2NLYA 3S83A 3CH9A 3G24A 3TTSA 3WEZA 4MOZA 2WJEA 1H7WA 4Z08A 4XBKA 3IVTA 1HJSA 4JFTA 4Q8OA 1IT7A 3CHEA 1XLEA 3EOUA 2WMHA 4UNIA 4YTTA 4B9ZA 3B0UX 4KEMA 2QLYA 2ZICA 4UMBA 1A5UA 4TUFA 3MWAA 1P1XA 1TPDA 3N6QA 2GWNA 3G1SA 3W29A 4LQ1A 1AJZA 1UPPA 3ZVIA 3TU9A 3FJ6A 4HTYA 4AD3A 1VCVA 2WMIA 3AO0A 2ZRZA 3FXGA 4DXXA 5EFDA 2VRQA 3VU2A 3DXIA 1G4PA 3VM7A 2QR6A 3WF2A 2D22A 4EXBA 3WH7A 1ODUA 2L5HA 3ABOA 2PLJA 4CNUA 3GYCA 1PZ3A 1XH1A 4NZJA 1BF6A 5A6SA 3FW6A 1XG4A 3VNLA 4FX7A 3ZXWA 3IJDA 3WLQA 3RUBL 1IE7C 4XAPA 1KLYA 1C90A 2RDWA 3S5SA 1OQFA 2C1HA 1JYNA 3OIXA 4GUGA 3DG3A 4GINA 4L4MA 5AN7A 3B8SA 1OX4A 2J88A 4UZUA 2BXYA 4AZCA 3BC9A 3ES8A 1WE5A 4CVWA 1CIUA 1A47A 4UOQA 2WCAA 4I9TA 2VZTA 2PDBA 2PU1A 4MWAB 1W32A 3I4EA 3MA8A 4DLMA 2FGLA 3AMDA 3P81A 1A50A 1OFOA 3VNDA 5JIPA 1UR9A 3AYVA 4WUIA 4H6RA 4NHVA 2D2GA 3LY0A 4XZWA 4DPPA 3P82A 5EKYA 2XFFA 1H0GA 3RCMA 3MHGA 2I5IA 3TZNA 3A5VA 3W26A 3ARUA 2V3DA 2ALDA 1BVWA 2PWUA 4PTNA 2A6NA 2YL9A 1MRQA 4L7ZA 4NJKA 4A6GA 1ZFJA 2ZX7A 3VGFA 2J9XA 2VGGA 5GJMA 3AUOA 3C61A 1Q13A 3QPZA 1HXJA 3O06A 3VD4A 1UD5A 4JTSA 3WYZA 2CHOA 2FIQA 3FX4A 1A4MA 2BODX 4HK7A 6XIMA 1TTIA 1HQTA 2YLAA 4GI9A 4OOUA 2PUZA 3UU0A 3HQNA 8CGTA 4ZO7A 1CDGA 2RJHA 3HV8A 3OGSA 3ABZA 1YX1A 2XWDA 3CHCA 2EKGA 1KGXA 3UW6A 3W73A 4UTMA 2G0WA 1K9FA 1T0OA 3IVUA 3BSMA 3V1HA 2Z1XA 4X9YA 4IMCA 3QR1A 1B3YA 3DOPA 1GOIA 1TIMA 1TPH1 1XLJA 3U48A 5BXRA 4ZSTA 1UH3A 2A79A 3EZ4A 3M1ZA 3V5FA 1J0ZA 2HEJA 2ZYFA 4HSHA 2CYGA 2Y88A 5A6KA 4UTJA 4UQ9A 3LHZA 3OBAA 3QKZA 5E0CA 3R8HA 2PP3A 7TAAA 3SEPA 2R9RA 4JEJA 3WDPP 3VFCA 2DT3A 4PGLA 5CPMA 2WJDA 1QHZA 1UJPA 3EXSA 1XIEA 2A3AA 2CHNA 1ML1A 3UY8A 3W6LA 5FF3A 4JKLA 3ITCA 3W7OA 1YADA 4UC5A 1OFEA 4QITA 5B7YA 1R85A 1XDMA 3BGJA 3PULA 1O12A 3GO2A 1KM3A 2WW5A 1MQRA 1AD1A 1ZBKA 2H9AA 4R88A 1TQXA 3I10A 2AMXA 2PRHA 3VUPA 3BLKA 2MNRA 4K7VA 5EMMA 1PWLA 3MMTA 3CUIA 4A8NA 1XLCA 4LUSB 1H11A 1LTDA 1BSIA 1C9DA 3IAPA 4REQA 4M0XA 3T4WA 2FZDA 3NTYA 2FJKA 5HQMA 4D8AA 1LRNA 1E6XM 1TPFA 3ABXA 4UTUA 2VFHA 5I02A 5BCAA 1EYEA 3BG5A 2PWDA 1NOUA 5C6MA 1I4NA 3IGSA 2X1SA 2Q01A 4IIGA 4RNHA 2UY2A 1ZUAX 4TXEA 1GQIA 4LSBA 1VENA 4TQTA 1UKTA 1DJWA 4E3VA 4ECLA 2PGWA 2XH2A 3UWWA 2Y8VA 3SECA 4DZIA 3W2LA 3ZJKA 1AJ0A 2WXDM 3BW4A 2WJFA 5DN1A 2G4FA 5FOOA 3B8IA 1HGYA 4LTSA 2PDYA 3ABRA 3W71A 1R6WA 4OUIA 1WZKA 1GOQA 4XTDA 3SN0A 2CLPA 4L9ZA 1HJVA 2VGBA 4WY0A 3HPXA 3M0IA 4X2RA 3P0WA 1GZJA 4PMJA 3WJZA 4H3DA 1EXBA 4NX5A 3MI2A 3AOFA 2UWFA 3PG9A 5U7SA 2CETA 1CYGA 1Q6GA 5HUOA 2VX4A 1FCVA 4D6HA 2F2HA 2XGIA 5A8MA 3VC6A 2PGRA 4D8LA 4HCDA 2BXZA 4KIRA 4GCXA 1KR0A 2GSEA 3E02A 1EFZA 3N73A 5KMYA 1DTUA 3RLVA 2V2HA 3EWYA 4G1KA 3NVDA 5LNUA 4GLEA 4DWDA 3ZR4A 5CBJA 1H1ZA 2FFCA 3VIFA 1SPQA 1HKIA 3MWCA 3CEPA 3W23A 1RZMA 5HQLA 1V02A 4JTTA 1QT1A 1RJPA 3NQEA 4GYPA 4QAWA 2GDQA 2RUSA 2D23A 2QUVA 3PZGA 2EPMX 3P80A 3EEGA 3VOJA 1VKFA 3B03A 8XIAA 2BY1A 1Z6KA 3FA4A 1BKSA 3N19B 4A3YA 1OF6A 3TYUA 4GNKB 3NUKA 2FB3A 1C29A 4ACYA 5HNUA 2J78A 1K77A 1YNYA 3G6LA 4BA0A 1NJJA 3E12A 4A22A 4NZ1A 3RX2A 4L1XA 4AWUA 3PBVA 3W25A 2V5KA 3R10A 4IX2A 3VO0A 4TTGA 1JCNA 2FDMA 1W37A 3M44A 2Z2AA 1NIUA 3L12A 3VXGA 3Q94A 3LHTA 3FV9A 1DL3A 4GABA 3E9AA 4RPQA 1I6NA 3HMCA 1A0EA 2PDGA 4Q7IA 4KWWA 1XLBA 1UJQA 1UR1A 1ITCA 4H00A 1U5VA 1FWTA 2BP1A 4W7VA 1JF5A 4RDWA 3PTKA 4ZO8A 3R7MA 2Y24A 2ZX5A 2CCRA 3A4AA 4E8CA 4YL2A 4IOTA 3VABA 1GORA 1G94A 1A5CA 7ENLA 1OCBA 4LAKA 4O10A 3UPWA 2PD9A 4IMFA 4QX4A 2AAAA 2HBVA 3KHJA 2XN1A 1ICQA 3PZ9A 4ZQCA 1RXOB 4IIBA 2ZBTA 5A1AA 1S3HA 1DPMA 4C6CA 2F84A 1R2RA 2TRSA 3O15A 4LUJA 4PMZA 2D2JA 4POCA 1FFQA 3W53A 3H7UA 2W4XA 1PL9A 2PCEA 3DG6A 4XKYA 4DZ5A 3QF0A 4F3HA 1UYQA 1KLZA 8RUCA 3EWZA 5DF0A 1FDZA 4NP7A 4GO9A 3VNZA 3TWAA 4R34A 3BLEA 3FS2A 1L8PA 2I5GA 3SSJA 5BNKA 2CZFA 5KZDA 3DFQA 2C79A 4MB4A 3RPTA 4Y9PA 3LD5A 5C2CA 5F2MA 3V5OA 5FJJA 4KIEA 3GIQA 2WZIA 3BCDA 6TAAA 2CITA 2CBUA 2W6RA 1KBJA 2XSAA 4HNNA 4W4QA 1TR1A 4QDPA 4ZQNA 3W2NA 1A5AA 3L4TA 3LPFA 3J7HA 3S4TA 1OT2A 4PC8A 4J3ZA 4MLJA 4H9VA 4H1ZA 3R8RA 1RH9A 3B8UA 3HG4A 4JIEA 4IJRA 1QBBA 4G1NA 1C8YA 4J9JA 3W1XA 4L9XA 5D2YA 3W1MA 4DO6A 3R5EA 1POKA 1TWDA 3PPFA 2HWGA 3W84A 4WY0F 3G77A 2PFHA 2GQ9A 1H7XA 1H63A 4GQ0A 3W6MA 3KOZA 1P1MA 4BWLA 3RK8A 3DH7A 3WD4A 3QVQA 1J79A 3EA1A 1V5XA 5I3FA 2X16A 2EHHA 4KFOA 1GCYA 3W6YA 4BF7A 1UKOA 1WAWA 1NWTA 2QDDA 4CQ8A 2B7NA 2JKEA 4UWMA 3D0CA 2VKZG 3TJXA 1GOKA 4M24A 1NY1A 3VD7A 4ACZB 1GHSA 4WGHA 3S1WA 3TYZA 1GG1A 2BMBA 1V0LA 3UGRA 1YDOA 2DV0A 1GVFA 1XLIA 4K8GA 4RDVA 3VCCA 4D6CA 2ZTJA 4I5RA 1GW1A 3AXMA 3FXYA 4B4FA 2E0PA 3AXIA 4CNPA 5H91A 2EPLX 1PZ2A 5U4NA 3HU7A 2OO0A 2QDHA 4MM1A 4RDYA 2QVHA 1K8ZA 3SJ3A 3PUEA 3PUGA 4TR9A 2WNNA 4ZODA 2PA6A 3BLFA 1XQKA 1EA9C 4HZ7A 2ZADA 1UWSA 2RDTA 5GVJA 4HT3A 2YL5A 2KX9A 3OBEA 4LVBA 2J7FA 4XVEA 2BVTA 4DI9A 2WMFA 2XVLA 1VEPA 1P0EA 1IZCA 4K8HA 3NEHA 4NJIA 4XV0A 3R0KA 3TYCA 4NAEA 1Z41A 3R43A 3WKZA 2C18A 2NXHA 1E70M 2O9RA 4XG1A 1PIFA 5JMUA 3WY1A 2IMRA 1EJUC 5BRPA 4EACA 5A6JA 5IFPA 5JH2A 3B0XA 2WZMA 4UBPC 3TV8A 1KFLA 5LNSA 4YU1A 3P61A 4ZQPA 4P2VA 3CTTA 3JR2A 3LRKA 2ZUVA 1W3HA 1ONXA 4GYJA 2VEGA 3RM9A 5E5CA 1GVOA 2NQZA 4H04A 4Z0SA 1Q5MA 1TA3B 4WZHA 4EPBC 1CXIA 1FH9A 3MJMA 1KM2A 1SM9A 3T2QA 5TF0A 3SQLA 4N6EA 1UZ4A 1QPRA 1P6BA 5F4WA 2FHFA 4H19A 4P8UA 2OU4A 2TPSA 2E09A 1KCZA 4LV4A 3GLCA 2QMJA 3O0FA 4HZ8A 1W1TA 4I8YA 2OG9A 1RD6A 3C8FA 3W3OA 2V0TA 3KBNA 5EGRA 3HGJA 1XIIA 2EG7A 3A5FA 2WSRA 4ADTA 2VDIA 5FJPA 3WDIA 4E3TA 1F9CA 1AD4A 4H9YA 3C0JA 1AH0A 3CMJA 2J7DA 4QSFA 4MKSA 1TV8A 1Y8BA 1GYLA 3PM6A 3PHAA 2QAFA 4HPXA 4H7CA 2GOKA 3GXDA 2LLEA 3OZMA 1VZWA 3EX1A 2IQDA 4WOQA 3WJSA 1L2UA 2P53A 4AD2A 3RLGA 1GPFA 2C6QA 4F0KA 1TJ2A 2CXEA 3HIJA 4S1FA 3B8TA 1ECQA 1WAUA 2YXGA 3KBVA 5LNRA 4CD6A 4J5NA 5BW6A 2V3GA 3A4XA 2FDSA 5I3JA 1X1OA 2BVDA 3ZVHB 3CMFA 2ZXQA 1PDYA 2GVYA 3MQTA 2QF8A 4MB1A 4S3GA 5DY2A 1LBLA 3S2CA 1XBZA 1VBUA 2Z6JA 4HN8A 1CEOA 1YTEA 4QNEA 3VIPA 4P8VA 1S1PA 3HPAA 4JYDA 1N82A 1CGYA 5AHIA 3A12A 5TQLA 1EBGA 3GKFA 5G2WA 4NU7A 3NQAA 3FDKA 4C7DA 3S9YA 1CENA 1WZAA 1EO5A 2NUXA 3WUEA 1VR6A 1BYAA 4FR1A 4RV8A 3CPUA 4MJ4A 1RP9A 4GZIA 3PTDA 1VJZA 4LUSA 3KWSA 4I9AA 1XCFA 2HXUA 4PTXA 1BD0A 6CGTA 1NF0A 3LCIA 5CLTA 3IJ8A 2FZ9A 2XSBA 1E1FA 1GQLA 1XC6A 1LLWA 1GQNA 4KRZA 1KO0A 3CQIA 1JGMA 3B06A 4B90A 3N04A 4DYJA 5FAJA 2CXGA 1VIZA 4H7ZA 1SZEA 4EANA 3USBA 1XP3A 4OBRA 4XZIA 4FIRA 1RCOB 3DFPA 3GXMA 1KM1A 3KL3A 3WBXA 2V63A 1XHGA 2R1MA 5CZJA 3W76A 2HVMA 2PU0A 4OV9A 1SSGA 2JEQA 4C6EA 1O5RA 3OB8A 4IGMA 3MO4A 3LQLA 3UCQA 1FH8A 4G8TA 4B16A 3PF3A 3UT0A 5ABFB 1YTKA 3WD3A 3MSDA 5H8MA 3LHYA 2GVEA 3EWWA 4F2UA 5A95A 3EAUA 2DZSA 4E2DA 1RQHA 1JI2A 2FZMA 3AMGA 4R53A 3T7VA 2QGYA 2F7FA 3CPRA 4S3FA 4R33A 4HCHA 1IIHA 4DF1A 3ITYA 5BOFA 2J77A 3OYZA 4U2YA 2QJGA 2Q6ZA 3T09A 2D0FA 1W0MA 1UASA 3G0XA 4XO6A 4HA1A 1QW9A 2YYUA 5A5WA 3WLPA 2P50A 3GUWA 3WH5A 2WVUA 5M17A 3WQFA 1VJIA 2EF9A 2E9LA 3WD1A 5DLCA 4AZ5A 3S2LA 4GE8A 3BXWA 2OWCA 3U2EA 1QWGA 4JFWA 1XCWA 3ALGA 4MNKA 3QLLA 1GOWA 3ZT5A 3FIGA 1PS9A 2NQ9A 2H3DA 1TCMA 5E93A 3KRUA 1KRCC 3G18A 1EZ2A 2B7PA 3VYLA 3O0KA 4FALA 3SURA 3AXHA 2YCJA 1SFSA 2VEFA 3ARPA 2XIOA 1EL3A 2PZ0A 3HN3A 3IGHX 5FJRA 4V33A 3W02A 4N02A 2PDLA 3NPUA 2Z25A 4GNJA 3FHAA 1VYRA 3B8VA 2AOSA 3H2MA 3IIVA 2Z0IA 2P10A 1NQKA 1Y5XA 2VTFA 2WMJA 2HBXA 3NFUA 2DT2A 3T8QA 2CWXA 2WSQA 2DZPA 5AHNA 5IOBA 3GVWA 3PZIA 3P74A 1CW2A 2J79A 1P43A 4XUYA 5D8WA 1JCYA 3LLDA 3M0LA 3R58A 2WSYA 3I6RA 3WF3A 4M81A 2FZBA 4ILSA 3QTGA 1JCJA 3JZEA 4LVFA 3UF9A 4UR7A 1E6SM 5DXYA 1TCDA 1XSKA 4R5EA 3ZWTA 1RSCA 1VC4A 2XINA 3VKJA 4Q8VA 1XPYA 4BQ4A 1RY0A 1FY6A 1W5QA 4J2MA 4KWOA 4HKPA 3WLHA 3A3HA 1XX1A 4URIA 1K7XA 4CQAA 4JIHA 2DZVA 3CT7A 4MIMA 2WO5A 3WN6A 1EIXA 3TYDA 2RGMA 2DUXA 1ZS2A 1F6KA 4JTIA 5D03A 2QJMA 4K39A 4K68A 5G2IA 1WBHA 2CERA 4FPSA 2YW3A 4LRSA 3W86A 3MV11 2C71A 5XIAA 4E8DA 1TV5A 2WNWA 1ME9A 3BMWA 3TA9A 5AC5A 1UZDA 3HQPA 4AF0B 3E74A 3V0UA 4LUTA 3SJNA 1B90A 4UQEA 2J8FA 3TN5A 2DVTA 3MUXA 3CHFA 3M5XA 1CZ1A 2GJXB 3B04A 4JTDA 3WELA 4C6MA 4M6UA 3ERPA 3PZTA 4QLLA 3SUUA 2J8GA 4LC8A 1WB0A 1V6WA 1ADOA 3KXQA 5C9WA 2WZTA 2X1TA 5D9PA 5ENLA 4A2RA 4K2SA 2VC7A 2Y5EA 4F2TA 1XKYA 3BZGA 1J93A 2EO7A 3P8JA 3H55A 4M82A 4I6VA 5IFTA 1GVYA 3G1RA 4KRUA 3A47A 4ZE5A 5HR7A 1K8YA 1EJVC 1US2A 4DB7A 1YE4A 2D2HA 3W2UA 2VRKA 3C2OA 5ABGA 1W3TA 5KTLA 1ZHAA 5C9UA 2FB2A 4PSRA 3FFSA 2FHBA 3STCA 1V6UA 4D8ZA 3VGGA 3DBPA 3B9OA 1BHGA 3WLOA 1OG6A 3CQKA 3QZAA 4PUJA 9XIAA 4H7VA 5CC7A 2OLSA 1AQHA 4UB9A 4B3LA 1DJIA 2VD9A 1GNXA 4ACZA 1MO0A 3B9AA 1Q7QA 4MAZA 1SO5A 4BEQA 2CZ5A 2RJGA 4LBSA 4E4PA 3WH9A 3CMGA 4MFDA 4JYFA 2EPOA 2GPTA 4CKQA 5CLWA 5K4XA 4AWTA 3PFMA 1J10A 3NO5A 3TQ0A 5AYZA 1M5WA 4O52A 4XX6A 2DSVA 3E6EA 1W1VA 1OCQA 3CAWA 3QPEA 2WSKA 4CD5A 1BTCA 2EGZA 1O60A 4J3VA 3HMJG 4IL0A 1MI3A 1I2QA 3BZJA 4PUDA 4S2BA 3B9EA 3QR0A 5AYYA 2E5CA 1XGZA 4ZB5A 1OFDA 3HBLA 3E2QA 1C92A 1LJYA 1VFFA 2JALA 1EDTA 4LJ3A 1UR8A 4MLRA 5BMXA 1Q6OA 4DEFA 3M0JA 5C55A 1Z42A 2ISDA 3RFAA 3T1GA 4EE9A 3I65A 1IEVA 3W00A 4NZ5A 1NDZA 1ZALA 1XRFA 4M56A 2DUAA 2ZCGA 3V0SA 1VFLA 3T2PA 4OVXA 1BWVA 3PR2A 4GUIA 5I3DA 3AYRA 4JX4A 3E0IA 1EEXA 3LI1A 3VDHA 1SO4A 1VGAA 1K70A 3GR4A 1SZRA 2C15A 4HJWA 4L61A 3M47A 4OE7A 2W27A 3R0DA 5HPOA 1YBQB 2O9PA 2ZTKA 1KCLA 1RJQA 1DWGM 3CZGA 3ALFA 4GUJA 1XIGA 5K3VA 3Q65A 1FWFC 1KM6A 5LXXA 3I3EA 4LS1A 1VCGA 1YPXA 4DI8A 1QHPA 3W74A 2QV4A 1OSEA 1OZMA 1TA3A 2O56A 3GFYA 2PMQA 2Z1KA 1C8QA 1MFVA 2XIQA 3IACA 1O5QA 2Y0FA 3MBFA 1P0BA 1YYAA 2C91A 1E1EA 3GVGA 4LCRA 3B4UA 5FACA 1R30A 1KTNA 1MEHA 2R1NA 4AHQA 3IK2A 1TV2A 5EMUA 2XWEA 1FWHC 3QYQA 5HAOA 4N9DA 1XD1A 5BOEA 5FA5A 4NJJA 4G5DA 1HX0A 1NQ6A 2G3MA 4Z42C 1V02E 2DUZA 3RMEA 6XIAA 1TPB1 1I2OA 5A8GA 3RM4A 1QR7A 4S3EA 4AQLA 5E1QA 2EPKX 1E6ZA 3RR4A 2QPUA 2QCGA 4QS6A 1X1NA 1MXSA 2W67A 3MW7A 3ZFHA 1OC7A 1H7RA 3LXAA 1BG9A 5AZ1A 5D2TA 3SGUA 4WD0A 3NYDA 3GAYA 1S5NA 4NSBA 4C60A 4KMQA 4DAIA 4Q4QA 2E28A 2E5BA 2PODA 4PZVA 5FSEC 3OHIA 2CKRA 1BAGA 4GIYA 3OZOA 3LCWA 3TOPA 4MJ2A 4U28A 2YB1A 4NRRA 3ABQA 4UR8A 5CJNA 2EJAA 3E0LA 3GHRA 1TV4A 1FX6A 2A5HA 3ZSTA 4IXHA 4C6DA 1IEXA 3MPGA 1ZENA 2WHMA 2PDQA 4R9OA 1DJYA 3BAWA 3TSDA 1V93A 2BY3A 2PPGA 5HUPA 1LLZA 5F2GA 5IDIA 3NO3A 4HHPA 1JD9A 2IKGA 3A24A 3VIJA 2VOMA 1PKNA 5DCEA 1LBMA 5HMFA 3BAIA 4N9CA 2QJHA 4E5TA 2QKFA 1CXFA 1QATA 4S38A 1ELSA 4CD8A 3M4HA 2QGHA 3FYYA 5FJUA 4Y6GA 4ZOEA 4IUGA 4PUKA 3RF9A 4D1IA 4AY7A 3OW1A 3H7RA 4QROA 2QUMA 2G97A 3U5UA 4HOXA 3ITGA 1T8QA 4ONVA 1TZ7A 1WDSA 3TYEA 3OEXA 3HG2A 4F66A 4JQ2A 4MY9A 2NLIA 2IUZA 3GU1A 2HISA 1VYPX 2ZUNA 1HL8A 3QY6A 4M80A 4JTQA 1EDGA 1PV8A 3PP7A 4QEHA 1O7AA 1OK6A 4IMDA 4XVDA 4O0ZA 1VFOA 2TMDA 4LAMA 2OQLA 4EKJA 4AFYA 4PODA 4BKNA 3BTNA 3GDRA 3T44A 1QNQA 4P7LA 4BF9A 3GXFA 4XZ9A 4H4IA 4NI8A 4O8RA 1G67A 1XW8A 2DDXA 3WENA 4HTBA 1ONWA 3VD5A 2VP8A 2WC7A 4G2DA 5MF5A 3AI0A 3H2AA 6TIMA 4JTAA 4GA8A 1KFCA 3E0VA 3LQGA 1K03A 1K8CA 3CLMA 5FL0A 4MY8A 4O0QA 5DMMA 3W83A 1FHDA 1RUSA 3ZWSA 1W3NA 2QMKA 6ALDA 3KBJA 3G6MA 1GTEA 4INFA 1ISZA 4CNNA 3POCA 3KBWA 3T6CA 1ZZMA 3EX2A 1V6YA 2ZA3A 1WDQA 1YNQA 5JQ9A 3TWBA 3ID7A 3W7MA 3G1VA 2DSZA 1HGWA 1GZ1A 1KM5A 3MKVA 1LBFA 1B30A 4XO7A 3T78A 5FESA 4QE1A 4W8AA 1B5TA 2OPJA 4N7QA 2G95A 2EXOA 2R24A 3VTRA 3WF4A 3U57A 4DRSA 3OA5A 4UTFA 2HROA 3DYOA 4HZ6A 3GU9A 2E3ZA 4OFCA 2PEVA 4GZ7A 1F3XA 3WIJA 4HMNA 3AIEA 5EMYA 3L0KA 2OMAA 1R87A 2VOTA 5FCZA 1V3IA 3MCNA 3NL3A 1QCWA 2NV9A 4JYEA 1TJRA 1DIDA 1HJWA 4GOAA 1EC8A 4HU8A 2WZHA 1MW0A 5C7VA 1GOMA 1UCWA 2PC4A 1G69A 3D3AA 3ARVA 2AL1A 2G50A 5JBEA 3PBMA 4LNCA 1FWWA 4C1NA 2IQTA 2Z1VA 4AMAA 4C6PA 4WDWA 2WKLA 4XISA 3UR5A 4RNJA 3H24A 3HF3A 3KP0A 3QEZA 1GQJA 1TKKA 1J2WA 5M2FX 5K4ZA 1WKFA 4AZ7A 3DHFA 4GIRA 4FNUA 3PNZA 4WIWA 1S2WA 1S2UA 2JFEX 1KFEA 1VPXA 5ABHA 2Z00A 5AVHA 4XD4A 2R1LA 3LERA 2FMOA 1E6PA 2E25A 4W87A 1W9DM 5HNNA 2Y62A 3GTHA 2Z29A 3KUMA 3W1UA 9CGTA 1EGMA 4JTUA 4PUNA 4XUGA 1WZMA 3SCSA 5B7ZA 2V2CA 4AB4A 3LM3A 5HATA 4O15A 4IIHA 4XK2A 1H2JA 3AIWA 2GVJA 3LZ5A 2P8CA 1DOSA 1XLGA 5JXQA 1D3CA 1K4GA 1UOKA 1SUXA 3W38A 1FWIC 3UFYA 3IRDA 3UVIA 1AW5A 4UFJA 1XUZA 2E1DA 3OVGA 4JQAA 3WEOA 5DCDA 3SCNA 1HKJA 2QCEA 2VRJA 3ARQA 1AL7A 2CLOA 2DQXA 3DFOA 1GHRA 2DT1A 3NG3A 2D0GA 3AU6A 4CCDA 3NM3A 3A13A 4RL3A 1JF6A 3RN6A 5DRIA 1FOBA 4IF2A 2J7GA 4MKNA 3I68A 2HZGA 5A8NA 3T08A 2W62A 2H6RA 3EWBX 2GJXA 1W5OA 4TX9A 1R7OA 3VZYA 3EXTA 2J4GA 3A9BA 2VZUA 4AZHA 4W86A 3CUJA 4RJEA 4P7NA 3ABSA 4H9MA 3AZRA 2NSOA 4QG8A 3LBMA 2YOCA 3GW0A 1FCUA 4YLWA 4LF2A 4KCTA 1YLVA 3DKJA 3VOFA 5EYWA 3UG5A 4JN8A 3CYVA 3G1XA 5I7GA 1WZLA 3I7QA 1XSIA 1SGJA 4HSNA 3W7NA 3TLQA 4UCGA 7REQA 4J40A 4PN2A 2WHJA 5AZ0A 1O1HA 1V7AA 3LSCA 3P5YA 1M7XA 3P93A 4H9XA 5T26A 1A53A 2VD8A 3WQOA 4FF7A 3W2JA 3AALA 3VUSA 1TELA 3R1ZA 2FVMA 5JH1A 4YIWA 4D6GA 4PH6A 3G3DA 3LCXA 3U2CA 1O6IA 3XIMA 1GT8A 1XPGA 4MDPA 4BK9A 1HP5A 2YDSA 1MUWA 3NAVA 3ARTA 1VLWA 3N4AA 4EAYA 1UQZA 5K2ZA 2X41A 4LYPA 3KOFA 3ZLGA 4AYSA 3DGRA 3IV8A 1FWDC 3WCZA 4ALDA 3ZT6A 1JULA 4S3AA 1OG0A 3AAMA 1WDDA 3KAOA 3K46A 1NF7A 2R6OA 3ARWA 5I09A 1X6UA 4WCJA 4JR5A 4PL1A 1QNOA 3WDQA 3GXNA 4Y9OA 4IFRA 1ZY9A 1JUKA 1GEHA 3I7SA 1FDYA 1IWBA 1H49A 3TLLA 1G4SA 3N2CA 1W9VA 2BDQA 3BK0A 4NRSA 3N3TA 3VDAA 4M1BA 2IKJA 4ZVJA 1JUEA 1UWTA 2VJXA 2ZUMA 3L5MA 2Y63A 1VYSX 4HOZA 3SCPA 4TX6A 3KZPA 1H7OA 4JHZA 3LV5A 4L65A 3F1QA 2BHUA 3CQJA 4AIEA 2B4GA 3JW7A 2QQ6A 5D33A 1XYZA 3FHQA 1Z7AA 4ZL1A 3E0WA 3NXLA 3UBPC 1FP9A 5I00A 4U5IA 2GJPA 3KWXA 4IXXA 1OYCA 2NT0A 4M3PA 3N2XA 5LIWX 3O2LA 2XVPA 2X1UA 3CS2A 3FA5A 4LAOA 4I5XA 1JCXA 3APYA 4QIUA 1IEIA 4JOMA 1I0BA 3SCWA 4EWND 3GH7A 2DSWA 3PWAA 3WUFA 4OZOA 4X2PA 5XINA 1I60A 1OD8A 4Q4MA 2X40A 3W75A 3IJLA 2XGBA 3WQGA 3K4AA 4KWSA 5FF7A 1IZKA 4AXNA 3WLKX 3H4XA 4JTEA 3LU2A 4MSSA 4JFUA 3U4FA 2OEMA 5AKQA 2A7NA 2D3LA 4JGDA 3TFCA 1L9WA 1PVNA 2WCSA 5C7HA 3M41A 1CPUA 2DVXA 1NFPA 3W01A 2H8ZA 3ARSA 1QNRA 5TAOA 4F2BA 1W3JA 4O1FA 3SUSA 3VILA 4J3SA 3BV4A 4AZCB 2OLHA 2FHCA 3QGAC 5ECVA 2ALRA 2G96A 4FX8A 3TX9A 1PDZA 2ZZ1A 1ZP3A 1V7YA 1E56A 3ONCA 5AC6A 2YX0A 3C86A 1CX9A 2W63A 1B4KA 5GNZA 3FSUA 2OKTA 1MMFA 5CPQA 3U4AA 3WLIA 2CPUA 4QE5A 4PEKA 1S2VA 1JD7A 2VCBA 3WJYA 2VYOA 2ZVIA 3C2VA 3SB0A 4JTCA 3MDUA 1TX0A 1KV5A 3DYPA 3UXLA 1NTHA 3BOFA 4CN6A 2J25A 1XL9A 3U5YA 2G5WA 4LXFA 1IT8A 4LY8A 1HKVA 1HKWA 5JVLA 2HRWA 1PSCA 4QG6A 2V5CA 4JX5A 2O7QA 3WNLA 2ZWYA 3NSXA 2HTMA 3EOOA 3GH4A 3IEBA 4QSHA 1GONA 2PLMA 1M65A