1YXDA

Structure of e. coli dihydrodipicolinate synthase bound with allosteric inhibitor (s)-lysine to 2.0 a
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of native and (S)-lysine-bound dihydrodipicolinate synthase from Escherichia coli with improved resolution show new features of biological significance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords dihydrodipicolinate synthase
total genus 110
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2005-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1yxdA00
1IF2A 2KZHA 3DGRA 4KWWA 4JTIA 3YPIA 3UWWA 1KM0A 4O10A 3NQVA 2E5CA 3K30A 2WJZA 3MHUA 4MZ8A 4NNBA 3KX6A 5BMXA 5LHEA 4TR9A 2J24A 4Z1BA 3SR7A 1ICPA 3W7OA 1RPXA 3C2RA 4O16A 5D38A 1JCLA 4RKAA 1LRNA 1W0MA 1G69A 3QH2A 5I3JA 4A2RA 3M5YA 3T4CA 3O1NA 4NJIA 3M0ZA 3UWQA 2VFFA 5CZJA 1F05A 4UFHA 2CLHA 1AK5A 1YLVA 3MP5A 2C3ZA 1WV2A 3L67A 5FEPA 2A21A 3KAOA 4BF9A 1K02A 1M7PA 2E1DA 4JTEA 3FYOA 3NQ7A 1K8ZA 1PV8A 5G5IA 2CLLA 4MY8A 1BWKA 5LNUA 5FF4A 4LC6A 2G97A 4K6AA 3W1MA 2YXGA 4DBDA 1W5NA 3BLEA 3HPZA 1VLWA 3TDFA 1W1ZA 3TW6A 3CU2A 1ME8A 4KKXA 4YCPA 3BV4A 4U28A 2H8ZA 3PG8A 3L5AA 1FWNA 4IMCA 2ZBTA 4O52A 4WOQA 1MEIA 3W7PA 4PFMA 4GUJA 4LS0A 1LBMA 1TPDA 1VGAA 1W3IA 4O57A 4WQ6A 5E93A 4E38A 3P8JA 3GXTA 1ALDA 3IV3A 5C6MA 3QM3A 1XKYA 4HPXA 3TC6A 3PULA 4WX2A 1LORA 1SSDA 1W56A 1EUAA 1RV8A 1KBIA 3L65A 3NM3A 2BSLA 2DP3A 3UPWA 4MZ1A 2PRMA 3SSJA 5KITA 1P0KA 2CU0A 4MY9A 5LKYA 2VFGA 1YADA 3S1XA 5KSWA 1DOSA 3C61A 3P61A 1B4EA 1S5TA 3U8GA 3E49A 3FFSA 3TU9A 2XFWA 4ALDA 2J88A 4M7SA 1G4TA 2XN1A 2YSWA 4XTIA 5DCDA 3LDVA 1G4PA 1PCKA 3W1UA 4UIOA 3N73A 4LVGA 5K9CA 1SUXA 3NG3A 3GAYA 3CEUA 2JGYA 4R34A 1YDOA 2DJXA 3ANYA 4M7TA 4K39A 3DAQA 2VEKA 2E5BA 2E6YA 1FCUA 1HO1A 2PCQA 2ZA1A 1QO5A 1QNVA 2H3BA 1ZCOA 2QCDA 3BG3A 4UTWA 1TIMA 1I2NA 3NQ8A 2CLMA 3PM6A 1KM5A 4JTUA 2OT0A 1NFBA 1KFJA 3LXBA 1VPXA 4GNJA 1Q3NA 1TTPA 2V2CA 1P5BA 2EGZA 4PTNA 2CZ5A 2CLKA 4ORMA 3UY8A 1JQVA 5DCEA 1PS9A 3QW3A 1EPXA 4S2CA 2RKXA 4GFSA 2QUTA 4LVAA 5LNSA 1J2WA 2OX1A 4UTKA 1W3TA 1H7RA 4O1AA 1GZGA 1RQBA 5CGQA 3RF9A 5KMYA 1G4SA 1QOPA 5DY2A 2A5HA 3STCA 5AHMA 3CWNA 4N4QA 2CZDA 2YPIA 1R47A 2A2IA 1OK6A 1FWRA 4E2BA 5DXYA 4BI5A 1MO0A 4RZ5A 3KVMA 4FNSA 1R2TA 5K9XA 1A5SA 3W1LA 3TC7A 4O28A 5LGXA 1DL3A 2UV8G 1AW2A 5D05A 2B0MA 1M6JA 1G6CA 2YFNA 3T78A 1OYCA 3EWXA 3JR2A 3VKJA 1DVJA 4M5PA 4QNWA 2FDSA 1SW0A 4OT7A 2DZUA 3SGUA 4GUGA 1SQ7A 2CWNA 1VC4A 3KRSA 3HGRA 4DF1A 2C6QA 1C8VA 5C55A 2ZQ0A 2NXGA 1VCVA 1FXQA 2HS8A 2YZRA 3LGEA 5I3HA 3PF3A 4ZQNA 3W1XA 5BNKA 4GJ1A 1QPOA 3C52A 2AGKA 2P1FA 1TTJA 3NZRA 1S5WA 4EIVA 2QCMA 2ISVA 4PL2A 3PUDA 4CNNA 3PY2A 2ABAA 2ZFAA 1ZHAA 1DQWA 3W2MA 1TQXA 1OYAA 1OFRA 4L4MA 4XUGA 1DJNA 5FEWA 3QMSA 2V81A 3G18A 2C0AA 3E96A 3LX9A 4IGHA 3A21A 3LOTA 3N3MA 1AG1O 1AL7A 1RD5A 2C14A 1DQXA 1O95A 3S5ZA 2FFCA 3C2VA 8TIMA 2EAWA 4FNPA 2B7NA 3NDOA 3I68A 3TCEA 4IXHA 4Y9AA 4AMAA 2CW6A 1XC4A 2QCHA 3W74A 2CLIA 3ATYA 3LXAA 4XKYB 3IGXA 5G4WA 3W7QA 4AAJA 2ZRUA 4CQ8A 2WO5A 4GXMA 4HT3A 3S9YA 1XDMA 1VJIA 3C2OA 2FPTA 4OU1A 2Y85A 1CW2A 3C2FA 4GC4A 4CCDA 4YXGA 2R8WA 4AB4A 5AYXA 3RU6A 4NJHA 4IMEA 1YPFA 2QJHA 2ZRWA 4JDBA 3NA8A 3L0NA 4NZJA 2C15A 4WY0F 5G1YA 1GWJA 1W37A 2JKEA 1XXXA 4AVFA 1SO6A 1TPEA 3UWYA 1JRBA 2WQPA 3QC3A 1L6SA 1OX4A 3W2NA 5H91A 3WJSA 1LOLA 1QPRA 1OFDA 3W2UA 5EYWA 5HQEA 1UJPA 1JCMP 3G8RA 4O53A 4CCCA 4NVTA 4JX5A 4GE8A 3L5LA 4FNTA 3KHJA 2ZRXA 3B0PA 3I65A 1TPB1 3FS2A 1RVGA 4QIUA 1ONRA 3GR8A 1ICSA 3W1AA 3PWAA 4O54A 1JJKA 1N8FA 3CPRA 3W88A 3NGJA 4YL2A 4DF2A 1LOSA 3W73A 3DENA 2A4AA 4TMCA 3E02A 3V75A 1KFCA 4X3ZA 4CNPA 5KZEA 5CSRA 2Z6JA 3MHGA 3G1VA 3LI0A 4ONVA 1MSSA 3UZ5A 3UQNA 3NVTA 1OABA 2FB3A 3OG3A 4U4MA 1H7XA 3EKZA 4RX0A 5A8GA 3LHYA 3W23A 2JKPA 5AHFA 2HS6A 3SZ8A 1VYSX 3HO8A 3THQA 3L0KA 3F4NA 3FKKA 1QR7A 2VOMA 3L68A 3P7YA 4UNLA 1NAL1 5AC7A 1EP2A 3GKFA 5HINA 3PS7A 4AXKA 1OK4A 1SFJA 3ELFA 4BI6A 4A22A 1YYAA 2I1OA 1FBAA 3RMJA 4EWND 3OVRA 1EUNA 2VC6A 5DBTA 3UY7A 3W7CA 4X2RA 3N9SA 4C1LA 3DFQA 3BGGA 3PBYA 3CWOX 3Q37A 3TUUA 3EX3A 2DZWA 2GOUA 4JTFA 4O8RA 3T55A 1O94A 4ZQPA 2VXNA 3G24A 5AYYA 3GKAA 5KZDA 3P62A 1H7WA 3QQ1A 4CCEA 1AMKA 4P2VA 4JS3A 5FI8A 1LROA 3DFSA 3W3OA 3DZ1A 3G1HA 4N9CA 3W7IA 2LLEA 2DZPA 3N14A 4JYFA 5CPNA 4UFMA 5FF0A 3W1QA 2QUVA 2AQWA 4HNVA 1M7OA 1H62A 3L2IA 3HGSA 3C4UA 4NUWA 4JIQA 3GYEA 4AWUA 2E6AA 3UZJA 3BK0A 3TW7A 2E09A 1N55A 3L9CA 2DZSA 3LRKA 1ZAJA 4JY9A 4O12A 3TV8A 4Y90A 2ISWA 3VE7A 3LB0A 2ISSA 2GUUA 2V5BA 3NL2A 1QDSA 2QCGA 4GUFA 4ORIA 5TIMA 1G4EA 5AYZA 1DBTA 2GQ9A 2Y89A 2F7FA 5D09A 2X2GA 3B03A 2NWRA 5F4SA 4Q32A 4H6KA 3IGUA 3OBKA 1WXJA 3EWYA 3JS3A 5F4XA 4IMDA 1I45A 2ATMA 5AHEA 3VFLA 1ZNNA 1TQJA 4UNKA 3OA3A 1KTCA 5EMUA 2NXIA 4QITA 3OVQA 4NZFA 1TV8A 4JTKA 3LM7A 3MP4A 4YMZA 4XTDA 1UASA 4LS1A 4N6EA 3IVTA 4MJZA 2W79A 4JTSA 1Q6QA 4CNOA 3M16A 5J5DA 2I14A 4E2DA 2WNNA 3T7VA 4HHPA 3NYZA 4JD4A 5F2IA 5AHNA 3WK3A 1LBLA 5AHIA 1GG0A 1YTDA 3EX1A 3A22A 2NV2A 3S1VA 4RR4A 2Y7DA 4AEOA 4PCFA 3QPYA 5EA9A 1C9DA 4HPJA 2R91A 1XBXA 3TKFA 1GT8A 4TU1A 3W87A 1YTKA 3CM4A 1JQXA 3P5YA 1SFLA 1X1OA 4I7WA 4IX0A 3V1PA 4FB7A 1A50A 4MLRA 4MKNA 2XN2A 2FLIA 3BG5A 4FIQA 3WK1A 3P80A 4K8EA 4YWIA 2Q8LA 4UTWC 3HF3A 5FESA 3H54A 3M1ZA 1ADOA 2YYTA 4TMBA 3I6RA 4LW7A 1DV7A 4DPPA 3NPWA 1DORA 4ZZ9A 1JUEA 1W3NA 3TROA 3LBMA 2I9EA 4IPIA 4UTLA 4G1KA 4K8HA 4EVZA 3QF0A 3PC0A 2WSYA 1TTIA 1YXDA 2AAMA 3SW6A 1F5ZA 3GDRA 5FEZA 3C56A 2NV1A 3C3NA 3T44A 3TR2A 5LZLA 1HFBA 3GNNA 5G2WA 3TQVA 3OEXA 4L4LA 2CFFA 3KVJA 2Q3OA 1BEUA 3TFCA 1R2SA 1X1ZA 1LLWA 2V82A 4IXXA 3G0XA 4LU0A 2CZFA 3R2GA 4XKYA 3B06A 4UCGA 5AC8A 1L2UA 3PBUA 1XBVA 2NX9A 3DBPA 3W70A 4JTLA 3A23A 1SZEA 3M5XA 3DKJA 3O6CA 3QSRA 4UTMA 2GVGA 3DKLA 3NXFA 4O0KA 3FYPA 1FDYA 2XN0A 4BK9A 1WQ5A 1OFAA 4XBKA 1SW3A 3M47A 1H7OA 4FEZA 3O6DA 2J9XA 4W9TA 3HPSA 3LV5A 4MVAA 2H90A 3IIZA 1T99A 2G96A 1SR9A 4NJKA 4K38A 3G1FA 4K36A 3ZWTA 5HNRA 3G1AA 4DQWA 2Y7EA 1FUYA 4M19A 3O8AA 2BLEA 3UD6A 2O7SA 4RXGA 2RDTA 1ZAIA 5DELA 3CLMA 1WDWA 3FA5A 2PC4A 4PC8A 4RK8A 4TX9A 4JY8A 4O14A 1F6KA 3ZR4A 3W75A 5D2XA 3M7WA 1Z41A 2RDWA 1TPVA 3PR2A 2CZEA 4ZQRA 4B5NA 1GVFA 1TB3A 3TA6A 1ZAHA 1R30A 2ZA3A 3TFXA 1C29A 1QFEA 3STFA 1TPFA 1GVRA 3CTLA 3UNDA 1K03A 1WA3A 2G5WA 1KV8A 2R94A 3QFEA 2E6FA 4HNUA 5C5YA 1P1XA 3PSWA 4DEFA 3MJYA 2V2DA 4DO5A 3MP3A 3RNDA 1U5JA 4KFPA 3TE9A 1W5MA 3PSVA 3HOJA 3PBWA 2QCNA 3R13A 5DBUA 3CIXA 1H63A 1X6UA 1W5QA 3HBLA 3NQFA 2PURA 2JK2A 3S1UA 4LOCA 4DBEA 1ZJIA 5DY3A 3F4WA 3TH6A 4IUOA 3AJXA 3NPXA 4ZL1A 3W7MA 4NU7A 1IXPA 2A1YA 1EP3A 3SGZA 1KA9F 2NLIA 5D04C 2VFHA 1GJPA 2VENA 3QYQA 3HG4A 3QMRA 4BR1A 2QJIA 2WNZA 5AC6A 3PB0A 2J6XA 6TIMA 5HR7A 3QEZA 2Y88A 4LRSA 3RLUA 3M5ZA 1W5PA 2QUUA 1HO4A 7TIMA 2BXVA 5CPMA 5BW6A 3I7RA 3B8DA 2A6NA 2Y6ZA 5LNVA 1IXOA 4JTHA 4Z1CA 5A5WA 1GYNA 1F6PA 3TAKA 1XCFA 3TK7A 5F2MA 1IGSA 3NQ2A 3HB9A 5EPDA 4S2BA 1OVDA 2DZTA 3P67A 4FXSA 3QPZA 3QW4B 4MYAA 1E51A 3NPVA 3TX9A 3GVGA 1GTHA 5KINA 3S1WA 4Q33A 5F2LA 1G67A 3M5VA 4FX6M 3MW7A 1EB3A 5DXXA 1A5CA 2QKFA 1V5XA 3IIPA 1VYRA 1YDNA 5C2XA 3MWAA 4EF8A 1TMHA 3STGA 2FQIA 3U2OA 1XL9A 1GPWA 1H1YA 1XUUA 1RR2A 1R2RA 2GPTA 4JGDA 3TQKA 3LLDA 4O1CA 1JCNA 2X1RA 3QJAA 1H50A 5EKYA 1F2JA 1K3UA 2F84A 3T40A 2VEPA 1L9WA 3GDTA 1Z44A 4FIRA 2NX1A 4FNQA 2OJPA 3SI9A 4S1FA 3BW3A 4QNEA 3MO7A 1K7EA 1UBSA 2QCCA 4YLWA 2WSQA 2ZZ3A 4WOZA 3RK8A 3M6YA 3UWVA 1K8XA 1MZHA 4WZHA 2QCLA 3CC1A 3VNDA 2QCEA 1TPWA 4HSOA 5U7SA 3W7NA 4FX8A 1D9EA 4K7YA 3W2JA 4GRSA 3EWBX 1OX6A 5KZMA 3W84A 3I7QA 4BFAA 1V7YA 1PE1A 4ADUA 1GTEA 1F7BA 1XM3A 3M9YA 3SFKA 2HSAA 4IOTA 3PUEA 1ME7A 1KM4A 4UMAA 2QR6A 1EIXA 1H1ZA 2NUWA 4FO4A 3PB2A 2WPBA 3GR7A 2V30A 1QCWA 4MY1A 1Q6LA 4TIMA 4UR7A 3W72A 1LRTA 2WNQA 1LM1A 1FXPA 5DN1A 1KV5A 3FKRA 2EPHA 2Q8ZA 3FJLA 3GIYA 1QPQA 4O0ZA 2ZRYA 1J4EA 3KOFA 1ML1A 1GG1A 2X1TA 3EXTA 5FF2A 3EX6A 3DFOA 3SY5A 4PODA 3MUXA 2JGQA 3GB6A 5CPLA 3B4UA 5IM51 3MI2A 4O19A 1AW5A 3P8IA 4WUIA 4OV4A 2FPVA 1D3GA 3G1XA 4X22A 1H7PA 4OGZA 1TPUA 1LP6A 3PVFA 1FDJA 2Z0IA 3B0VC 1Q6RA 4XWUA 4DPQA 5I3GA 4O15A 5HR6A 1VZWA 3UYCA 3W22A 5D02A 3E9AA 4KFOA 4I7VA 3CQ0A 2ZZ2A 3IVSA 4X9SA 4I7UA 1ICQA 1QAPA 2NXHA 2QDHA 4POCA 1TV7A 1NF7A 3HQ1A 4AF0B 5K4ZA 4O50A 4GUHA 3A5VA 3UXDA 1MXSA 1KW1A 1JUKA 1F76A 2EKCA 2ABBA 1TREA 5CKSA 5LNWA 1GQNA 5CZTA 3R5EA 1PHWA 1LBFA 3NL6A 4RZ4A 3C2EA 3DFTA 1VHNA 2Y7GA 1H61A 3L5MA 1VCGA 3S8HA 3BPWA 3LLFA 5CSSA 3E0IA 1XBYA 3F03K 4RLIA 4UXDA 3W7EA 3HPXA 4O4VA 3H53A 3DHDA 3ABQA 5I3FA 3EX2A 3LXCA 5D32A 4UMBA 2P10A 1I2OA 3FOKA 4KFNA 5LSMA 1KBJA 3E12A 1O4UA 3LERA 5T26A 3W1NA 4DF0A 2PRLA 4O18A 1P4CA 2OT1A 3P82A 4N4PA 1PCWA 1FWSA 2V8ZA 5BRBA 2YDAA 4DXVA 3G22A 3W1RA 1LTDA 1JRCA 3CIWA 1U83A 3H55A 2TPSA 2W6RA 4O1BA 4ZVJA 4QQ3A 4ICNA 3BG9A 4IX2A 3N19B 2WKJA 3U6WA 1OFEA 3LCIA 2FIQA 1TV5A 4UMCA 5F1UA 1I2RA 2IQTA 5H2ZA 1XDLA 5CG7A 4EF9A 3IIXA 1THFD 3TMLA 1BTMA 3DXIA 1VCFA 3EKLA 4O1DA 4NJJA 5LNRA 2QCFA 2VEMA 3MMTA 2O7QA 5HWNA 3WJZA 4NT0A 4QAIA 4TO8A 2Y62A 3W1PA 3QRHA 3TSDA 1JUBA 3O6YX 4LV9A 3S5OA 3C0JA 1W8SA 4UC5A 5I3KA 4UTJA 2VELA 4HNTA 3B0UX 1T0OA 1X7FA 3MI3A 1K7FA 3IVUA 2C19A 3G0SA 4UFJA 5HWJA 4CQAA 3R12A 4UFLA 2TYSA 3TXZA 4LV4A 2NWSA 2H3DA 4UFIA 1CI1A 5AN7A 5CPOA 3G1DA 3S5YA 4BI7A 1H51A 2QEZA 3LBCA 2GJLA 2WOQA 4NJGA 2YR1A 3TNOA 3GNDA 5D03A 2ZZ5A 5FEXA 4Y8FA 1EWEA 1ZENA 4HN4A 4LRTA 4GWEA 3PBVA 4XBSA 4AWTA 3BVJA 1KM3A 2ZCGA 3QZEA 4CQ9A 5D2YA 3BLFA 4QISA 4ZQMA 1LCOA 3NEVA 4DO6A 4UTTA 2J9YA 3TAOA 4LWWA 1VHCA 4A3UA 5HJLA 3UPBA 1XFBA 4EOUA 4KWVA 3HG5A 1W5OA 2E77A 3PUOA 4HSNA 2Z2UA 4WJEA 3MHFA 3WJYA 3DI1A 4K7VA 4AHPA 4LTSA 5TBOA 3W07A 5F1VA 3W7DA 3NZ1A 2YGYA 3HG2A 3GXPA 1NF0A 1VQTA 3BW4A 4Q4KA 2J27A 4O13A 3NAVA 5E1QA 1OHLA 3LCHA 2NUXA 1X8FA 4RXFA 3VCRA 1VLIA 2RDUA 2BTMA 5KTLA 2Y63A 1KM1A 1FWTA 1UCWA 4Y6GA 3TMQA 4E0CA 3LHWA 1O60A 4FF7A 3A5FA 5F2GA 1OX5A 1KLYA 3M44A 4JTJA 3BW2A 1GVQA 1H60A 4ADSA 1FCQA 2HMCA 4Y96A 2B7PA 1VR6A 3NQCA 5SWUA 2GVJA 2FB2A 3Q94A 2ZRVA 4UTHA 2VEIA 1YDVA 2WV8A 1WAUA 1W31A 2WSRA 3W71A 3R8RA 4YCOA 2R14A 3UWUA 4WY0B 3TJLA 1KFBA 4XZ9A 1TRDA 1OFBA 5AHLA 1XBZA 3GZ3A 1EX5A 1T96A 5HMSA 3W76A 1KM2A 3GDMA 1K8YA 1FQ0A 3C6CA 2ZYFA 1LRQA 3M41A 3VE9A 3FLUA 3W6YA 3FJ6A 4Z0JA 1ZALA 2V5LA 5EBUA 3EXRA 4A2SA 3EWWA 3NQEA 1TPC1 5IBXC 4QSHA 4OWGA 4RV8A 4R33A 1JULA 2TSYA 2YX0A 3P74A 1R46A 2OMAA 4NX5A 3MBDA 1WX0A 3P5ZA 3USBA 1EP1A 3FEMA 5L9FA 3KVKA 2A7RA 2BX7A 2HTMA 2E5DA 5I3IA 4FNRA 3QSTA 3A24A 2GJNA 2ATSA 1KM6A 4JX6A 1TJPA 3LCLA 5BMWA 3N34A 1FCVA 1KLZA 3GAKA 4JIPA 5D2WA 4MOZA 1O5XA 4K37A 2DZVA 3EWZA 3HJZA 5D2VA 3NQ6A 3OVPA 3W2LA 1I2PA 3W86A 1TSIA 5MHBA 2Y7FA 4Z1AA 4ADTA 3L0GA 3G8EA 1B57A 1JCYA 1I8JA 1HL2A 3FIGA 5D30A 1SW7A 4N02A 3W7RA 4PEKA 4MUZA 4UTUA 4AHQA 1OFQA 1H5YA 3KXQA 3LRLA 1NEYA 4PL1A 4JYEA 3BLIA 3N2XA 4MYXA 5IBXA 4Z08A 3W83A 4QM1A 1UUMA 1A5BA 4OV9A 2RHGA 4MZYA 3EWUA 4AF0A 3A9IA 1TRIA 2C18A 3EB2A 1GVSA 3DU0A 2Q3RA 5E0KA 4MFDA 3GDKA 2TMDA 2PE4A 1YPIA 4LC8A 2EHHA 3ATZA 3THAA 5AB3A 2X1UA 4OHQA 1I2QA 1SSGA 2QCDB 3LI1A 3W1TA 3EXSA 1LZOA 3M43A 4JICA 3B05A 4RZ6A 2V2HA 4LNYA 3KRUA 2YYUA 4JEQA 4N6FA 3UWZA 3ZS4A 4UTIA 1EWDA 3O07A 4MPQA 1JCXA 1SPQA 3CB8A 4BWLC 2Z1BA 2H8XA 1PL9A 2X30A 3GX9A 3NR0A 2ZA2A 3TQ0A 3LCGA 4OQVA 5TQLA 1TYGA 4CLMA 4IPJA 2X1SA 6ALDA 4A29A 4NXSA 4D2JA 3WJXA 3W7KA 3STEA 2DJLA 3MBFA 4LY8A 1TO3A 3IRDA 1GYLA 1QO2A 1J5TA 1F73A 3IIVA 3G3DA 2BZNA 3NL3A 3GXNA 4H3DA 1JVNA 4O17A 4ML9A 4IJBA 4QJ1A 2RH9A 1OF8A 2PRHA 4P61A 4UUIA 1SU5A 4UTTC 2ZZ1A 4WD0A 5K2ZA 1A53A 4ZQOA 4JDYA 3O63A 3TSMA 3W7HA 1LYXA 1OJXA 3ABRA 3ABSA 1T8XA 1XUZA 2BWGA 4I9AA 3TJXA 2YW4A 3BGJA 4WY0A 1D3HA 1MEWA 2QAPA 1Z42A 4MFEA 3LCXA 3WJWA 5D2TA 2QJGA 5DLCA 3PG9A 5EL1A 3KRZA 3GLCA 2G95A 4ZMGA 4JXCA 2A7PA 5AOUA 1KFKA 4LUIA 1KTBA 4JTTA 5HUOA 1QMLA 1TJRA 3TSBA 4UR8A 4JR5A 3WK2A 5BOOA 2VFDA 2E68A 5HUPA 3EEGA 4NXKA 1OX4B 2A6LA 4GUIA 2VFIA 3INPA 3MI6A 5HULA 3SIZA 3G3MA 2VFEA 3NO5A 2A0NA 5U4NA 3NM1A 4BWLA 1ZFJA 3D0CA 2A7NA 1VS1A 3RFAA 1AW1A 1YTEA 3HIJA 4PH6A 2YFOA 2DU2A 4O4WA 1SO4A 1IXNA 2A85A 1NVMA 1VYPX 3LCFA 4LVFA 4OBTA 1QPNA 2ZZ4A 1Q6OA 5LHFA 1HUVA 4N9DA 4LUJA 1FCBA 4JN6A 3LCWA 1CX9A 3JRKA 3LRMA 1G7UA 4MJMA 1TTQA 1B9BA 2GQ8A 5CZ0A 4IQLA 2C1HA 1SZFA 1MEHA 1ZY9A 5LGZA 4LVBA 4XQ6A 3HMJG 1B4KA 1OF6A 5CZSA 3OHIA 1M5WA 2X16A 1RZMA 1NSJA 1TCDA 2JBMA 1GVOA 3VI2A 5K4XA 2FPYA 1DHPA 1OYBA 3SECA 4OE7A 4AWSA 3LV6A 2CLEA 1IIHA 2ZTKA 3CEPA 4M6QA 1LDCA 4LT9A 4HNNA 4NNCA 2E6DA 5FF7A 1RQHA 1Y0EA 3IIOA 5K7JA 2C13A 2CLFA 3ZFHA 3HGJA 1AL8A 1BWLA 1RQEA 5FF3A 3BARA 3I7SA 1S5VA 1LOQA 1OFOA 1LLZA 3MYPA 1F74A 3NQAA 4JNMA 5D37A 2B4GA 4AHOA 2D73A 4IMGA 3B04A 3L66A 1GOXA 4FXRA 2B7QA 4NNAA 4J9JA 3DH7A 3R89A 2VKZG 4UFKA 1W54A 4LS2A 3O15A 2TRSA 3LHTA 3S5NA 1IXQA 3LTYA 4Z0SA 2V9DA 4R53A 5F4WA 3Q58A 1DJQA 1FX6A 3G0UA 1FWWA 3KVLA 3P84A 3BO9A 2QF7A 4O11A 4FNUA 3ZWSA 1KFEA 1SZNA 1GEQA 2EF9A 3CT7A 1FY6A 2P0OA 1VRDA 1L6YA 3KFTA 3LTSA 4NQ1A 5DCBA 1SZGA 2B7OA 1FDZA 3G1YA 2Y61A 1UUOA 1G7VA 3W7JA 3LTPA 1XI3A 1WBHA 1L6WA 5D33A 3Q2DA 3PAJA 1YXYA 4WXZA 3ABOA 3EX4A 3OIXA 2V0TA 3P60A 4FX7A 3GDLA 3NQDA 2DORA 3TIMA 1DKWA 4JX4A 1K7XA 4MIMA 4NX0A 3W7LA 4N2YA 4Z1DA 3NQMA 5J5RA 5HWMA 3WFAA 4JTGA 4PA8A 3N2MA 1HTIA 1EA0A 1ME9A 4ZQCA 1I4NA 2ZZ6A 3O16A 4JYDA 1OG0A 5G1TA 3TXVA 4C1KA 3S42A 1HG3A 2H6RA 3DFPA 3F1QA 2FJKA 2OCZA 3O06A 1VH7A 4HKPA 2YCEA 2GQAA 4LVDA 1KTNA 2ZRZA 3L21A 4GBUA 1OFPA 2FTPA 3N9RA 3S6DA 1SO3A 1WBJA 2NX3A 4M6PA 1H7NA 2Z6IA 3W7GA 1WOAA 2Y70A 1SO5A 3NPUA 5K3VA 2ALDA 2C16A 2NZLA 5K9DA 1PIIA 5G4EA 2OZ0A 1YXCA 3NL5A 3O05A 3DHFA 1N7KA 4RCXA 1JCJA 1IIGA 1WYIA 2QAFA 4HIBA 1QWGA 1PVNA 3C8FA 2CLOA 2ZTJA 4WXYA 3SJ3A 1KFLA 3S0CA 5AFDA 3LHZA 1B3OA 3HGOA 2RFGA 2W0UA 4RJEA 3W85A 5C54A 1UB3A 1TPH1 3IGSA 3QMTA 1A5AA 3LHVA 2DZXA 3RLVA 4AH7A 5ABTA 4DO4A 1O5KA 3HG3A 3UXAA 1QOQA 3DFNA 5EY5A 5L6UA 4R7JA 4DELA 3NOEA 2JKAA 3NNTA 2GVLA 3WK0A 1WOBA 1Q45A 4IMFA 4IWWA 1EEPA 1Z48A 2YW3A 3G1SA 4MLJA 1S3HA 3MYOA 2ZZ7A 3AO0A 2ZDRA 3CHVA 4A21A 1PHQA 3DI0A 3NQGA 4N9BA 4H4IA 3LHUA 1JR1A 4FHAA 4N9EA 2NUYA 2J9ZA 3W2KA 1P0NA 3P81A 5G2HA 4M6VA 3QQ0A 1BKSA 3W9ZA 3GK0A 2QDGA 5GVJA 3IEBA 5G2IA
chains in the Genus database with same CATH superfamily
3N29A 3DGRA 3UWWA 2WJZA 4NNBA 3KX6A 5LHEA 1TUXA 3SR7A 1TJ0A 1ICPA 4WDTA 3W7OA 3QV6A 4HYRA 5I6SA 1WZMA 2HDJA 1LRNA 3RCMA 4JPGA 1KXHA 3QHNA 3QH2A 3ZR5A 4PMZA 1EF3A 4NJIA 2NV9A 3WH5A 3B9NA 2VFFA 4JIHA 4UFHA 3CL7A 3H4WA 4AZIA 1AK5A 5FEPA 2OOGA 2G50A 2A21A 2WBKA 3KAOA 3SUSA 4BF9A 3F2BA 1M7PA 1H4PA 1A5UA 2BASA 2E1DA 4KCWA 2V67A 1HVXA 5BWFA 3QC0A 3W24A 1BWKA 5LNUA 5H6HA 5EMKA 4KF1A 2G97A 3W1MA 2YXGA 3TJ4A 4AY1A 4IJCA 1VLWA 3TDFA 2TAAA 3B8SA 1CZ1A 3TW6A 3E0FA 3CU2A 1ME8A 4KKXA 4YCPA 1BHGA 4U28A 5B7YA 3KBJA 4OOZA 2ZBTA 1LQ2A 1KRMA 2VZVA 4OECA 1GZ1A 1TPDA 3BAKA 1FOBA 2GVYA 1OC7A 4WQ6A 1XIGA 3P8JA 4H6EA 1DYSA 4IM4A 4XD4A 3QM3A 1XKYA 1W1IE 4HPXA 3UESA 1RV8A 3L65A 1KBIA 3WQOA 2DP3A 1XH2A 3BURA 2VFGA 2IMRA 5KSWA 1DOSA 3P61A 4Q4SA 3E49A 3U57A 3H2NA 1ITCA 4ALDA 1JZ8A 1CXKA 2J88A 4M7SA 1VENA 2F2HA 1R86A 4QCFA 2YSWA 3LDVA 3UR7A 3H6OA 3REQB 3VMNA 4WGXA 3BMVA 4RNIA 1SUXA 4QGCA 3GAYA 4ICCX 3ZYZA 1XYBA 2DJXA 5CC7A 3BOXA 2CETA 4K39A 1W91A 2E5BA 1ZBCA 2VD8A 1PX8A 2X05A 4C7FA 2PCQA 1XR2A 1KKRA 4A8NA 2ZA1A 1QO5A 2ZKMX 2BGSA 1PZ3A 1VP5A 4PUEA 3NQ8A 3PM6A 4JTUA 1XV8A 3V4BA 1KFJA 5A2AA 2ZUWA 1TTPA 4PTNA 1EC7A 2CZ5A 4ORMA 3UY8A 3QW3A 3D6NA 3R4IA 1R6WA 1TV3A 2QUTA 5LNSA 4H6RA 4B92A 3WBEA 3UFYA 1JD9A 5DY2A 5AHMA 2JEPA 4GK8A 4E2BA 2VX4A 1C93A 3KOYA 1B54A 1DJGA 3MUZ1 1HGWA 1I1WA 3TC7A 1DL3A 2UV8G 3UNTA 1ZU8A 1UHVA 4S38A 1G6CA 1OYCA 3EWXA 4GJIA 1VIWA 5BYWA 3SGUA 4GUGA 4FF5A 1OWQA 1FXQA 3LGEA 3W1XA 3PF3A 4ZQNA 1XQLA 3OLGA 1A5MC 1TTJA 1EJWC 2DZAA 2ZFAA 1OYAA 1OFRA 2XH7A 3GXIA 5I2UA 4MB3A 3VFCA 4L4MA 4W87A 2PTXA 4KERA 1QHPA 5DFAA 5FEWA 1WDQA 1XS2A 4H41A 2W91A 1MQRA 3LX9A 2Y24A 4ZE5A 4GCAA 4IGHA 3AMDA 3A21A 3LOTA 3N3MA 1AG1O 1NH6A 1V8EA 3FYYA 4CQBA 3AICA 4LBSA 3CUZA 3VDAA 2FVKA 2EAWA 4XZHA 2J7HA 4XZLX 3VK5A 1R3TA 1X38A 4Y9AA 4AMAA 1XC4A 4PFHA 1D7FA 1XYMA 2Z00A 5C8BB 3IGXA 4J5NA 4GXMA 1VBJA 1E3ZA 1QRQA 3FN9A 4HT3A 3C2OA 3CUXA 2FPTA 4OU1A 4NG3A 3UJ2A 2XVNA 2VCAA 4JHZA 5A6TC 1KRCC 3F7JA 7ODCA 4AB4A 4M6UA 1JZ3A 1XGDA 4IMEA 3N9KA 2ZRWA 1RJQA 2OWXA 3KBVA 4AZ6A 3MWCA 1KGXA 1W37A 4AYGA 1A3HA 1TPEA 1JRBA 1OGSA 1OX4A 3W2NA 3N6JA 2CC0A 4ZO6A 1I0DA 1POKA 4BQ4A 1DTUA 2AKMA 1UJPA 3G8RA 4O53A 3A4JA 2WJDA 4JX5A 4GE8A 3BUVA 3L5LA 1H41A 4FNTA 3B0PA 4GNVA 1YEYA 1RVGA 4QIUA 5PTDA 1DP0A 4C6CA 2NT1A 4HCLA 4M1BA 4DNHA 4F40A 4O54A 5C70A 1N8FA 3CPRA 3W88A 3R8HA 2WVVA 1KFCA 3ZOAA 4X3ZA 2IPJA 1XHGA 5KZEA 5CSRA 2Z6JA 4B15A 1KGUA 2XPKA 3UQNA 5LIUX 1OABA 1RAKA 4XG1A 4GCXA 3TNBA 4RX0A 5A8GA 3S83A 2HS6A 3SZ8A 3THQA 3L0KA 5A6JA 4L9YA 3FKKA 5H8PA 2VOMA 2PZNA 5LIYX 3PZ9A 4JCLA 5AC7A 3T4WA 1EP2A 4IIDA 3PS7A 2PB1A 4DUOA 4NRSA 4Q7NA 1ECQA 1J0YA 2ZIDA 3LYEA 5A6AA 4BI6A 2I1OA 4PUMA 4OBSA 2OSXA 2PEVA 3R79A 2QJMA 1XIIA 1IWBA 2PDXA 3EX3A 2NLYA 2O9PA 1XIHA 1R5YA 4NAFA 3ZT7A 1AFSA 3N1AA 1R3QA 4O8RA 3FHQA 3JVAA 3T55A 1UZ4A 2I16A 3AQUA 5AYYA 3GKAA 2YL9A 1UD6A 3QQ1A 3GU9A 1V6YA 2PDLA 2WZEA 3CPGA 3DZ1A 3G1HA 3M0JA 4N9CA 2LLEA 2DZPA 4LNCA 1UIPA 4HNVA 2PF8A 1CLVA 1JEZA 1EF2A 3GYEA 4AWUA 5FSEC 3OODA 3UZJA 4XD3A 3SGGA 3LRKA 5C9ZA 1GEHA 1T6MA 2DVTA 6ENLA 7TAAA 2GUUA 2QCGA 1G4EA 2C1GA 4IJRA 5AYZA 2VMFA 4AZHA 1WNOA 3NUKA 2VL4A 3PZTA 5D09A 3B03A 3OBKA 1WXJA 1WE5A 1BPLB 3JS3A 1I45A 3TTQA 1K70A 5AHEA 2ATMA 3C86A 4H1ZA 3OA3A 4LUTB 4R3UA 3QOMA 1AJZA 3ZJ7A 4F3HA 4NZFA 4REQA 3WKZA 1TV8A 3LM7A 3MP4A 3VKAA 4PB4A 4JCMA 3ZT5A 4MJZA 3PNZA 2KX9A 1Q6QA 4CNOA 4B4FA 5GNZA 2OYLA 2DUAA 3H70A 3ITYA 3NYZA 2R9RA 1Z3NA 1V3IA 3DG6A 3WK3A 3UVIA 2FH6A 3UR2A 1O1HA 4W89A 4GO8A 1GG0A 1XSJA 3EX1A 3A22A 5FA5A 4RR4A 4XIAA 4NP7A 4AEOA 4PCFA 5EA9A 3N18A 1C9DA 3TKFA 3N2CA 1GT8A 4TU1A 2BHYA 2YA2A 1YTKA 1JDDA 3CM4A 5AECA 4HU0A 1TVPA 1EOKA 3S5SA 1PX3A 2P3ZA 4FB7A 1A50A 4MKNA 8RUCA 1P0DA 3WK1A 1IWAA 1JF6A 4E4UA 4QP0A 3WYZA 1TV4A 5GJMA 1B30A 3H54A 2BVYA 1ADOA 1UR3M 2YYTA 4LW7A 3CYVA 2O4QA 5C0QA 4HU4A 1HP4A 3NIYA 1UKPA 3TROA 2I9EA 1V51A 4KEMA 4EVZA 3CUJA 3QF0A 1TTIA 2ADAA 3ARPA 1F5ZA 3BANA 1J0KA 5EMMA 2NV1A 3DYPA 3MCMA 4FPSA 3T44A 5LZLA 1G5AA 1BYCA 6REQB 3W37A 3OEXA 2P76A 1P7TA 3IUDA 1BEUA 1JZ2A 2EG6A 3V35A 4TTUA 1X1ZA 4C91A 3G0XA 4LU0A 3R2GA 3EDEA 1XCWA 5AC8A 4FR6A 5AC5A 3DBPA 1CGWA 3TYUA 4EAMA 1RLCL 1SZEA 1TMQA 2W4XA 3LBOA 1OC6A 2XSBA 2RDXA 4KGJA 1WKEA 2NQHA 3R10A 3DKJA 1NP2A 4B91A 3BZJA 3WBYA 4IZGA 2G4JA 3EA1A 3H7UA 4UTMA 1DE6A 2IKHA 2J8TA 3NXFA 3GTNA 1NDVA 2XN0A 4Z2IA 3CO4A 1X96A 4XBKA 1B3XA 1XLDA 4M51A 2IUZA 4RE3A 5IXEA 4HNLA 3GNPA 1JYXA 3B3DA 1SR9A 3G1FA 4K36A 3ZWTA 4J3XA 5A1AA 4M19A 3O8AA 2BLEA 3TR9A 4RXGA 3LM3A 3THCA 5A3HA 1Z32X 4KESA 4TX9A 3BJFA 3QOKA 3ZR4A 4GYKA 3W75A 3KBMA 2RDWA 4B5NA 1ZAHA 3WLJA 3STFA 4MGGA 3VD3A 1KCXA 2E67A 2R94A 3K4DA 2E6FA 2PUZA 4DEFA 2V2DA 3FW6A 1ZP4A 3PSVA 3RO8A 4ZCWA 3R13A 4UZUA 5BU6A 1W5QA 3NQFA 4C6DA 5DF0A 4KBXA 5DY3A 4NYUA 4ZL1A 2QW5A 4NU7A 3TYEA 3WG6A 1IXPA 3MY9A 2A1YA 3B9DA 1EP3A 4DB7A 3UEQA 4NAEB 2NLIA 4H9MA 3QYQA 3QMRA 2QJIA 5AC6A 3OQ8A 3PB0A 6TIMA 2Y88A 3PPFA 1UKQA 2E0PA 1Y8BA 2VQTA 2NT0A 2CXEA 5A8QA 2ZXBA 3I3DA 3SY1A 2WSPA 5A5WA 4HB7A 4WRHA 2DW7A 4G2DA 1IGSA 5F2MA 3TWBA 5EPDA 3B8VA 4IIHA 1OVDA 4U31A 3KCOA 2GJPA 1KCKA 3NURA 4MTVA 1AH0A 4GQQA 4BY3A 5ABFB 1CIUA 4MNMA 4FX6M 4KPLA 3WLRA 5DXXA 2RJHA 1VYRA 2PDYA 3CS2A 2NQ9A 4EF8A 1FWFC 2ZC8A 3MV11 3STGA 1XIEA 3L4XA 4DWSA 1H1YA 2W3ZA 2HROA 2ACSA 1RR2A 4GKLA 1R2RA 3AZTA 3LZ3A 3ITLA 5CLWA 1F8MA 4JGDA 4P7NA 1C90A 3SCPA 3WLSA 1E4MM 4ICMA 1H50A 1F2JA 3WUFA 3SUUA 4JQ2A 3RPMA 2F84A 3T40A 2VEPA 1L9WA 3D46A 3FEQA 2OJPA 2XM1A 3OQEA 2QPXA 2PDPA 3GHUA 3BW3A 4QNEA 1UBSA 3KOZA 3B9EA 2RUSA 4XB3A 2WW5A 3BMXA 5EBAA 2AL2B 1MZHA 1ESWA 4WZHA 2QCLA 3GSMA 4HSOA 3TZNA 2XU2A 4FX8A 3WLOA 4GRSA 3E3HA 5JH1A 3EWBX 1OX6A 1V0KA 1V7YA 3LS9A 1F7BA 1XM3A 2WMIB 3SFKA 2HSAA 1KM4A 2QR6A 5EMJA 1E6PA 5IFTA 2VZSA 4XAYA 2V30A 3MT1A 2J79A 4MY1A 4WSKA 1NFPA 2GFTA 1MMFA 3LNPA 4X2PA 1FXPA 2I57A 3WMSA 2JE8A 5DN1A 4AQLA 2EPHA 2QXWA 1HL9A 2PCEA 5J8LA 4B5SA 1ML1A 4WCJA 2BXYA 3EXTA 1E9IA 3AFBA 3DFOA 1OBAA 3MUXA 2NSOA 1DJIA 3OA5A 4ZO7A 3ISIX 3B4UA 1QI5A 4L7ZA 1JDFA 4WUIA 2DVUA 3CAVA 2HRWA 3VNMA 3M0YA 1NDZA 1EO5A 2E3ZA 3LEPA 4A35A 2P8BA 3SRKA 1L8NA 5I3GA 5HR6A 1VZWA 4XO7A 1Q6CA 4Q8OA 2YL8A 4J27A 2P50A 2ZZ2A 4I7UA 4KIRA 1TV7A 3PZGA 3NYDA 4IL0A 3HQ1A 5K4ZA 2YDSA 3HPFA 4GUHA 3BAWA 2VT0A 1MXSA 3FSTA 1KW1A 1AJ2A 5A8OA 5LNWA 3LY0A 1XWYA 3PJUA 2BVDA 3WD1A 3AU6A 1PHWA 2G37A 4W93A 3QGVA 1H61A 3S8HA 2WVSA 5CSSA 2L5HA 1C7TA 3KWSA 2Z27A 3H4XA 4O4VA 1E43A 4M1RA 4PMUA 2AAAA 5D32A 2F9RA 3RILA 1PWLA 4UMBA 2YCKX 2A3AA 1KBJA 5T26A 4DF0A 2PRLA 5LIKX 4N4PA 1PCWA 1FWSA 3MO4A 3G22A 1LTDA 1XRVA 3EPNA 4GI9A 3VIHA 2TPSA 2W6RA 1CB2A 2Z2AA 4O1BA 4MWAD 4QQ3A 3ZSTA 1DTNA 4IX2A 2R1PA 5M5DA 1IT0A 3RUBL 3ARYA 5I77A 4ATDA 2IQTA 3OLEA 1VB9A 1UD3A 2GSHA 2ALRA 3BCJA 4B90A 1RCXB 1VCFA 2VP8A 5A8NA 5H8MA 1AQ0A 2X8RA 4ACZB 5HWNA 5DMLA 2XTKA 1LG2A 3O6YX 4LV9A 3S5OA 1W8SA 4WHBA 3B0UX 1VIZA 3BL3A 1K7FA 3IVUA 3KP0A 4JQ4A 2C19A 4UFJA 4KIEA 4M8UA 1GHRA 4CQAA 3R12A 2TYSA 4LV4A 3PJXA 4UFIA 1V0LA 2QGYA 5AN7A 3G1DA 4BI7A 1H51A 4PRRA 1BRLB 3RCYA 2KAUC 2GJLA 1IYXA 2WOQA 1YQ2A 5D03A 4XBJA 4LEFA 1V6XA 1ZENA 1YNPA 3K4AA 4LRTA 3WLIA 5CJMA 3BVJA 2Z1VA 3JZUA 4P8XA 4F9JA 3BLFA 1Z9AA 4QISA 4ZQMA 3NEVA 2CXGA 1BTCA 2J9YA 3TAOA 2Y0FA 3PUOA 4DI8A 4Z42C 4IUGA 3WJYA 4AHPA 1QW7A 3NZ1A 3M0XA 3HG2A 3VNKA 4MDOA 2WMHA 1OHLA 3N2TA 1AQMA 1X8FA 1QNSA 1L2QA 1C8XA 1S3TC 4FXFA 2GK1B 1EXPA 4E0CA 5C9RA 5HAOA 4FF7A 5F2GA 1KLYA 4P8UA 4JTJA 3AC0A 1GVQA 3OPSA 4YTRA 1BFNA 3A3XA 4EACA 3TN4A 3L2LA 4HP5A 1VR6A 3UXKA 5SWUA 2C0HA 8CGTA 1KXTA 3SUVA 1YDVA 2GJRA 3DHUA 2WV8A 3TTEA 3W71A 2DIKA 1HKVA 3S6TA 4GH1A 4I5XA 1KFBA 1OINA 1TRDA 5AHLA 3SRDA 2PWUA 1EX5A 3W76A 4BZYA 1QI2A 3DG3A 1JPIA 2I7GA 1K8YA 2PP3A 2J7CA 4WJ8A 4E3VA 3K46A 1LRQA 3FLUA 4Z0JA 3SO7A 5G4HC 1NOFA 2V5LA 3CAKA 3EXRA 4PB3A 3ZQ9A 3EWWA 2NQ5A 3NQEA 3AXXA 4QSHA 4KCVA 2D69A 4MHBA 4JTRA 4R33A 1V3MA 2TSYA 2E8YA 4AD4A 3MBDA 1WX0A 3GU1A 1V3KA 1GOWA 1CNVA 5L9FA 1V08A 2BX7A 1I75A 2HTMA 2Z7GA 3GIPA 1CEOA 4WJXA 1I9CB 1KM6A 1UWUA 3AS3A 1GQIA 4EX4A 4Y9NA 5GJNA 2XIMA 2PDBA 5IHRA 4GX8A 2QMKA 3UGVA 3TYZA 4ATLA 3NQ6A 3OVPA 2EPKX 4IFKA 1LWIA 1JCYA 3GVWA 3MUCA 1HL2A 3FIGA 1SW7A 4QBXA 2FZNA 1CXFA 4AHQA 1OFQA 1UOZA 1H5YA 4JFVA 3AIWA 1NEYA 2QHAA 1JXKA 4Z2JA 3U9IA 1UP2A 1XFCA 2BY0A 2OKTA 4OV9A 3IWPA 2WMJA 3A9IA 4AX6A 2MANA 4ERIA 1EL3A 1WDRA 2J77A 1GVIA 2VTFA 5HMEA 3A12A 2TMDA 4BS0A 1K9FA 2X1UA 1I2QA 1R87A 2QCDB 3CZ8A 4Q4MA 2VD9A 3W1TA 3M43A 4B3ZA 3AXMA 3WF3A 4RZ6A 2V2HA 4LNYA 5C9WA 1QTWA 2JFEX 4JEQA 2VNCA 4NZ1A 2H9AB 3O07A 3VNZA 3L4VA 4MPQA 1SPQA 3CB8A 4QE4A 2Z1BA 1PL9A 5E6YA 2X30A 3LCGA 3HQNA 3N12A 5AZ1A 4CLMA 1A80A 4IPJA 4XSMA 4S3KA 3NZQA 1NWRA 5JVLA 4XZIA 4PTMA 4D2JA 3WJXA 2DJLA 3MBFA 4LY8A 4W8LA 1QO2A 1F73A 4S3CA 4HK7A 5EGRA 4ROQA 2ANUA 4P61A 5KETA 1SU5A 4UTTC 4PMOA 1D8WA 4WD0A 5T8GA 5E0FA 4ZQOA 1XISA 1ZQ5A 2GVEA 4R27A 1VEOA 1E0UA 3ABRA 4UQBA 4E6MA 1T8XA 1XUZA 4J3ZA 1CXIA 3SCUA 1B3ZA 3TJXA 3IPWA 1IEVA 1D3HA 3EBVA 1MEWA 5CXPA 1W17A 4XAGA 2BOFX 4ILSA 3ES8A 4JEJA 3WJWA 2PSNA 3Q4DA 1GYMA 1PAMA 5DLCA 4HK6A 3KRZA 4MUPA 1AH4A 3OGSA 2FH8A 4DJFA 1S2UA 3BJSA 1ZJBA 1GZJA 1XRFA 1W3HA 4JTTA 1XYCA 1QMLA 1TJRA 1UWIA 3T2PA 3OZOA 1F61A 3EEGA 2CBUA 4D1JA 1OX4B 2A6LA 2FGLA 2WZIA 4GUIA 3T42A 4GVFA 4AEFA 1PB0A 4QHRA 3MZNA 3PANA 3V16A 4V1XA 3AYSA 1WP6A 3HIJA 3WNNA 3BLOA 4DWDA 1IXNA 2A85A 1NVMA 1MFVA 4FLQA 2OXNA 1HUVA 4HCHA 4EANA 4NI3A 1OGGA 3LRMA 3D3FA 1EJVC 1UD8A 3PZVA 5C9UA 1QNQA 1J0JA 4IQLA 1SZFA 1E3XA 1O5QA 2DT2A 4IFOA 1B4KA 1JFXA 5CZSA 1M5WA 2X16A 1NSJA 1TCDA 2R6OA 2DQXA 5I79A 1DHPA 3VIMA 1RUSA 3AROA 3U5UA 3SECA 1E5JA 4OE7A 1EBGA 3LV6A 4M6QA 5LYRA 1LDCA 4LT9A 3CXOA 4NNCA 3VUPA 2E6DA 4L4PA 4K1GA 3PPCA 3SRHA 2HNHA 1BYAA 1Y0EA 1XIMA 5K7JA 2BVTA 2C13A 2CLFA 4KW2A 3ZFHA 3EOSA 1RQEA 5FF3A 3H2FA 3VIPA 1OFOA 2IKJA 1F74A 2H9AA 5A69A 4IMGA 4W84A 2Q6ZA 1GOXA 1XSKA 4NAFB 4WIWA 2B7QA 3GG7A 4LCSA 5EMLA 3B97A 3DH7A 3R89A 2CERA 5A2BA 1W54A 3O15A 4B5WA 3S5NA 4TX8A 1PJ9A 5FSDC 1DJQA 2W66A 2GZXA 2QF7A 4O11A 5AC4A 3ZWSA 3GHTA 1GEQA 3PFRA 2P0OA 1WUFA 3CL6A 3L4UA 2VWTA 5HQMA 1E0WA 4OTKA 4V2XA 1V6UA 7REQA 1G7VA 3WBXA 3LTPA 4XK2A 2O92A 4FK9A 3CLWA 5C2CA 3NQDA 1REQB 3KUMA 1DKWA 3ORWA 1SJDA 2WQDA 4V1YA 1V02A 2DDXA 4Z1DA 3NQMA 5J5RA 2GSEA 1M01A 4JTGA 1RK5A 4IG2A 1AH3A 2P88A 4H6QA 4CU7A 3EKGA 3TP4A 1ME9A 2BB0A 1TWZA 4ZQCA 2W61A 3U4FA 3RPTA 3TXVA 5MKGB 2ACQA 2OCZA 4JTQA 1MDRA 3TTYA 1T5AA 4U2YA 1V0NA 3TC3A 4MNKA 2YLLA 3UETA 2YA1A 1WOAA 4GXWA 5I06A 1PKLA 5K3VA 2C16A 2NZLA 3M0MA 1NOUA 4Y9MA 2OPJA 4JOMA 1PDZA 1N7KA 1WYIA 4YTQA 4HIBA 1PVNA 1ADSA 2CLOA 2ZTJA 1KFLA 4GVHA 2EBNA 4OVXA 3VKDA 3SUWA 1ZJAA 5C54A 1UB3A 5CH9A 2X42A 5ABTA 1UROA 2OQHA 3UXAA 1QOQA 5L6UA 3MMDA 4IMFA 3G1SA 2XZ7A 4GMEA 3AO0A 1JYWA 5HOSA 1A49A 3M0HA 1JR1A 3KW3A 3N25A 3P81A 5G2HA 2PP1A 1J2BA 1G1YA 1BKSA 3W9ZA 3GK0A 2YBUA 5GVJA 2UY4A 3IEBA 2KZHA 4KWWA 3GVVA 3AMCA 3YPIA 1KM0A 3HMCA 4EPBC 3K30A 4MZ8A 4Z2HA 5BMXA 1KQYA 2OSYA 4HGXA 4TR9A 3VKBA 2EPMX 1T8QA 3CO8A 1VFUA 4O16A 5D38A 1JCLA 2J13A 3GG1A 4RKAA 1Q65A 4HK5A 4AIBA 1J6OA 3O1NA 3M0ZA 3CT2A 3WH7A 2CLHA 2PZ0A 1E0XA 3L4TA 4LCRA 1AMYA 1K02A 1UZHA 3S47A 1P6BA 3A3HA 1K8ZA 1PV8A 2HZGA 2CLLA 4MY8A 5G5IA 5DMYA 3R0UA 4G6CA 1AD4A 2ZXAA 3HJEA 2PLCA 3EMCA 3L23A 1UWTA 1TZZA 2YCIX 3GTIA 2WB5A 3CQKA 2H8ZA 2OG9A 1GONA 1V02E 1FWNA 3NCOA 1QNOA 4LS0A 3FDGA 1M53A 3OB8A 5E93A 4O57A 1V79A 3GXTA 3WQ6A 2ZWZA 2WAGA 3IARA 3VGBA 3PULA 4C6PA 1LORA 1A0EA 1VFLA 5REQA 1HJUA 2BSLA 3VABA 3UPWA 3UCQA 4MZ1A 2PRMA 3SSJA 5A6MA 2XGIA 2PU1A 3WLQA 3SSZA 5CSUA 3R0KA 1JI1A 3S1XA 1YE6A 3C61A 3HA1A 1B4EA 3FFSA 4AD2A 3TU9A 1XGZA 2BOGX 4LUSB 2HE5A 3ABZA 4JTAA 1FA2A 1JFHA 1K9EA 1G4TA 2XN1A 4IGSA 1D3CA 1QPKA 5DCDA 2WHLA 3OBAA 1G4PA 4D72A 3HQOA 4UIOA 5K9CA 2R82A 2FZBA 3CEUA 3NVDA 1IEXA 1YDOA 4IQJA 4RW3A 2C7FA 4U5KA 1FCUA 1FH9A 4AVOA 2YB4A 1YX1A 5TAOA 2ESCA 2CZVA 3KL5A 1ZCOA 4UTWA 1J11A 2VZOA 2OT0A 1HJQA 5FJJA 2AQOA 3ARVA 1VPXA 1WO2A 1EEXA 4B2DD 3UCDA 2CLKA 1F6YA 5I0DA 1PS9A 4UOZA 4S2CA 2RKXA 4UTKA 3P3BA 2FVMA 3UPMA 1GZGA 1RQBA 1W9DM 3RF9A 4L6OA 1G4SA 1QOPA 2A5HA 3KHDA 4N4QA 3NGFA 1KXQA 1R47A 2A2IA 1OK6A 4GD0A 1FWRA 1VFOA 3FNDA 3EZ4A 2XVLA 4QX4A 2J62A 3KVMA 1A0CA 2PDGA 2ACUA 3W1LA 4O28A 1AW2A 5D05A 1JXJA 1S38A 3HM7A 3T78A 4TVUA 4MADA 4OUEA 3WQEA 4KMQA 4M5PA 4OT7A 1SW0A 2CWNA 3KRSA 3ARXA 1K4GA 4DLFA 5C55A 2ZQ0A 4GIAA 1R85A 2HS8A 3OG2A 1UR4A 2GUYA 4GJ1A 2IPFA 3FAWA 3NZRA 4G7FA 1RJRA 3DX5A 1Q6FA 1FFQA 1S5WA 2QCMA 4EIVA 2ISVA 4PL2A 2P8CA 3S46A 1F3XA 1CGXA 3PY2A 1DQWA 3W2MA 1TQXA 3QZ6A 4L5ZA 4J3SA 4XUGA 3G18A 4ACYA 1ELSA 2BS9A 4EPKA 1M41A 2PWGA 3RM9A 3ANVA 1IGWA 3CV6A 3SCSA 2AL2A 3BZGA 4UQEA 4Q8VA 3ME3A 1O95A 2FFCA 4R7OA 1AQHA 4JKLA 2HQAA 4IXHA 2DT0A 4YU1A 1AVAA 3W74A 1ISZA 3ATYA 1CBGA 3T0AA 4P7RA 4PCNA 2ZRUA 2PWHA 4CQ8A 1DIDA 4UCFA 1O5RA 4JQ3A 2I5GA 4YPJA 4JFTA 1VJIA 5B80A 1CW2A 1GOIA 5E9XA 5CZKA 1CGUA 3UZXA 3VMOA 4GC4A 4CCDA 3VIJA 4YNGA 3RU6A 3C8NA 1Y5XA 2C15A 4WY0F 4GNKB 5G1YA 4H9UA 1GWJA 3W00A 4UZSA 3QC3A 2WQPA 5D9OA 1L6SA 1OFDA 1UH4A 3CUGA 1ITQA 4N42A 1QI4A 1EC8A 4R85A 4X0NA 4TOQA 6PTDA 4NVTA 1XLLA 2P0IA 2J7GA 4F2TA 1A5LC 1L6GA 3UZYA 5BU9A 4Q8MA 2OSWA 2PDCA 4B9YA 4P7OA 1V6VA 3PWAA 4BQ5A 4YL2A 1Z89A 4DF2A 1DE5A 3W73A 3DENA 4TMCA 4UOJA 4CNPA 3C5QA 2WCGA 3E2SA 1HKKA 3PWGA 3LI0A 3H8AA 4ONVA 3T0DA 1XLKA 5M2FX 2VRJA 2FB3A 2EJAA 1TMLA 3GHRA 3U7BA 1QWKA 3EKZA 3LHYA 2A3EA 4GXPA 1EFZA 1Q2RA 4HPNA 2JKPA 1VYSX 3HO8A 1EDQA 1F8IA 4Q3MA 3P0WA 5HINA 2FHBA 4AXKA 2ZUVA 1FVPA 3OVGA 4FLOA 3ELFA 4EE9A 1MW1A 4FA3A 4A22A 1YYAA 4IQDA 1FBAA 4D6GA 3RMJA 4EWND 1WZKA 3OVRA 1EUNA 1XD0A 5DBTA 3MC5A 3MCNA 4MMWA 3N9SA 1JGIA 5C7HA 1E6SM 1EBHA 3TCSA 4LY4A 3Q37A 3UR5A 4DWSB 3VKCA 4JKKA 1VPQA 1E6XM 5FJIA 3E0VA 4CD4A 3G24A 3WEZA 5LIXX 5KZDA 1H7WA 1TR1A 4IT1A 4B3KA 1RCOB 3OGVA 4JS3A 3CUFA 4JKMA 2V5KA 3DC0A 5HK4A 4JYFA 4JQAA 4UFMA 2QUVA 5FJPA 3U2EA 2Z24A 4FOUA 1H62A 3HGSA 2HE8A 3C4UA 1HZYA 3BCDA 4HZ6A 4KEVA 3TW7A 2YA0A 1E6ZA 2PDMA 1YIXA 4HPGA 2DZSA 1XPGA 3MKCA 2OTDA 4IIFA 2WC3A 2ISWA 1A3WA 3TVAA 3RITA 3RX4A 4HHLA 2ISSA 4S3BA 1DBTA 4HMDA 2Y89A 2F7FA 3H23A 3SCVA 3VM7A 2XGZA 2X2GA 2NWRA 4YVXA 4H6KA 4AZ7A 4TVCA 1BRLA 1UWQA 3VFLA 1TQJA 2NVCA 1WDDA 2D23A 5EMUA 3SDOA 2NXIA 3AYVA 3OVQA 1BLIA 5IRPA 3SEPA 2ZOXA 2QPUA 4JTKA 3ARQA 5CGTA 3E0LA 4JTSA 2YBVA 3E2RA 4E2DA 3T2OA 5F2IA 4QXIA 1EJRC 5AHIA 5A6BD 1LG1A 2ZX6A 2J8GA 4CN6A 1L6FA 1BVNP 3N04A 2NV2A 1OZMA 3S1VA 2E7FA 3A4XA 1VRXA 1KWKA 3S9ZA 2GGHA 1CXLA 3AAMA 5M1TA 4J3VA 2WMIA 3E5BA 2YL6A 3VIFA 4BF5A 3P5YA 3B8UA 1SFLA 1X1OA 1YBQA 3IAQA 4I7WA 3WLHA 3V1PA 4AD1A 4YHEA 2XN2A 5J04A 4DBUA 3XISA 3BG5A 2VUNA 3VIGA 1LF1A 2QDEA 1GORA 4K8EA 2Q8LA 3HF3A 1PWMA 3NDZA 3DECA 4GI6A 1IT8A 4TMBA 1S5MA 1DV7A 4FS9A 4W7WA 2PTYA 5FIPA 3RAOA 4DPPA 1EO7A 1JUEA 4W5ZA 3BCFA 2HXTA 2QPSA 4DBWA 4XSLA 4G1KA 3PC0A 1HKIA 2CBIA 2HBXA 2YKKA 3WQCA 4J7RA 2FHCA 5C71A 4HZMA 3U2ZA 3C3NA 1HFBA 3GNNA 2PDHA 5G2WA 5EB8A 1TX0A 3QHOA 2NQJA 1HQTA 1A4MA 2PD5A 1LLWA 2CZFA 1Q13A 4AIOA 3B06A 1MW0A 3TA9A 2DUZA 4JTLA 3A23A 4GFIA 2WVUA 1CTNA 2GVGA 3D47A 4J28A 3K5XA 4BK9A 1WQ5A 4B3LA 3G6LA 1SW3A 2ZX5A 2WKGA 1H7OA 2PLKA 4C6EA 1DJYA 3HPSA 4MVAA 3SN4A 3HQPA 3IIZA 3PZUA 1IEIA 2REQA 4NJKA 4K38A 4H83A 3MJMA 4CNUA 1X1NA 4URIA 5HNRA 1N2VA 3W02A 1IEWA 1ZGDA 2QJNA 2OO6A 3FCPA 5DELA 3CLMA 3FA5A 4RK8A 4PC8A 1EQPA 3VINA 5DRIA 3N2OA 1F6KA 1TZ9A 4BEQA 1Z41A 2P53A 2I9UA 3AHTA 4LUSA 4C65A 3UXIA 3KL0A 1KXVA 3TFXA 1DJXA 2A3HA 1K03A 1WA3A 1XQKA 4HNUA 5C5YA 1RLDA 1JIBA 4ZTXA 3MJYA 4GACA 1XLAA 3JU2A 4KFPA 1W5MA 1XYAA 1AA1B 1W3KA 1PX4A 5DBUA 1K6WA 3CIXA 1H49A 5TD4A 3SM0A 4ZB2A 3ARTA 3SCWA 2PURA 5EMYA 3S1UA 4XZWA 2W63A 3F4WA 1GOOA 4IUOA 4LYQA 3WLTA 4EPDC 5FL1A 3SGZA 1KA9F 1E1FA 1GJPA 2VENA 4CVWA 2JQXA 3HG4A 4IG2B 4BR1A 1LT7A 4C6BA 3W29A 2WNZA 4WSJA 4LRSA 1W5PA 1XYZA 2QUUA 7TIMA 4KRUA 3I3EA 1EX1A 1FP8A 3NSNA 4L61A 4C7DA 4CD6A 1K9DA 1KQZA 1IXOA 4M82A 4JTHA 3SURA 4H19A 2C8NA 3UF9A 1J8VA 3NQ2A 1IT7A 4AY8A 1U1UA 3P14A 4LFYA 4PB5A 3QPZA 1ODUA 4G7EB 4Z2LA 4MKSA 4MYAA 1E51A 5CBIA 3G5EA 1W1YA 3S1WA 4Q33A 3QHMA 3M5VA 3MW7A 3UZZA 1V5XA 3MU7A 1YDNA 2WHJA 1K9TA 4BEUA 1TMHA 2DZBA 4LAMA 2FQIA 4JFSA 4Q8NA 5BXRA 1XUUA 1NIUA 5HMFA 5T91A 4X63A 3P93A 3OLIA 3PFMA 1JCNA 2X1RA 1UR8A 3ZZ1A 1Z44A 2NX1A 1OADA 3VD9A 1DWIM 1BKHA 4P8WA 2DW6A 2VWSA 1JDEA 2PF0A 2QUMA 3BV7A 2FZDA 3AXHA 2VEGA 4JN7A 1TPWA 4PUUA 3W7NA 1FWCC 4KQNA 1D9EA 1JAEA 1F3TA 3W2JA 4Q8QA 3PWIA 4F2UA 1F3EA 4V28A 1Z69A 2PLJA 4ZSTA 1PE1A 3M9YA 1KC7A 4IOTA 5T9CE 3AIUA 3PUEA 4EXBA 5LA2A 3V0UA 1RK6A 1TE1A 3BH4A 4KCUA 1NARA 1U2YA 4FO4A 3G77A 2WANA 1JZ5A 4AIUA 3OO2A 4TIMA 2YJQA 3IJIA 2IKIA 1F07A 1V6WA 2Q8ZA 3GIYA 1I6NA 1LQ0A 1QPQA 2W5FA 3KOWA 4AY7A 3SY5A 3EDDA 3O0KA 4PODA 3GB6A 1E5NA 5CPLA 2D3LA 5HPCA 3P8IA 5A6KA 1M7JA 2OZ8A 1R3RA 1P7TB 4FMVA 3SUTA 1Q5MA 4X22A 4WKAA 4RDVA 4RZBA 1RH9A 1EKOA 1TPUA 1GCYA 1LP6A 3PVFA 1XLFA 1FDJA 1JL8A 3CV1A 3RRXA 5D9MA 4XWUA 1R0MA 3EOUA 4QE1A 1MRAA 1Q85A 4UQ9A 3E9AA 1QXLA 4DZAA 3APTA 1KCLA 2JALA 2AL1A 2GUBA 1V4YA 1LT8A 1PO9A 3IVSA 4X9SA 1NF7A 4AF0B 1CGYA 1E4LA 2VGBA 1I0BA 1C7SA 1CECA 1GQNA 5CC5A 4QDMA 3R5EA 1IV8A 1B1YA 4RZ4A 1UJQA 1MUWA 4H00A 3C2EA 3WX7A 4I6KA 3BPWA 3RXZA 1P0EA 2ZXQA 4D8LA 3E0IA 5A6BA 1QASA 4GY7A 4JHMA 4FZIA 3W7EA 4AC7C 3CZLA 3UA4A 3H53A 2OFJA 1U22A 4GVGA 3EX2A 3LXCA 1NQ6A 4I9TA 1UR2A 1I2OA 4KFNA 9XIMA 5LSMA 3TEVA 3LERA 4O18A 3DOPA 1B3WA 4IPLA 3MSDA 1EIBA 2V8ZA 3ITXA 3VPLA 4LGXA 3T6CA 4H9XA 3H55A 4O0QA 2GDQA 1R7OA 3VAVA 4ZVJA 4Z2KA 3D3AA 4RDWA 3N19B 3MKVA 3PTQA 2FJUB 2V68A 1OGBA 4GLEA 3GY1A 4FP1A 3WCZA 1S1PA 1EPVA 2AGTA 5H2ZA 1XDLA 3IIXA 4KWUA 3PZNA 1THFD 3FXYA 5TNVA 2ZUTA 3GFXA 3EKLA 4O1DA 5DT5A 2QCFA 2PGEA 4QAIA 4IFRA 5A94A 2Y62A 3LPOA 1JUBA 3NTYA 4W7UA 1EH9A 1E0TA 4UC5A 5I3KA 4UTJA 4FLSA 2Q71A 4OFCA 2VELA 4BCEA 4F0SA 4HMEA 4W88A 2JF6A 5HWJA 4UFLA 1S2TA 2NWSA 3QFWA 1W9PA 4S3FA 1CI1A 3S5YA 5CPOA 3VGGA 3UJEA 2QEZA 2HXUA 3LBCA 4DX3A 2NSXA 7A3HA 3H22A 2YR1A 4PZVA 3RLGA 5FEXA 4XZBA 1QU4A 1EWEA 3H21A 2XM2A 4HN4A 4GWEA 1H5VA 1ONWA 4B5UA 1KM3A 2ZCGA 3QZEA 2OR2A 3AISA 1US3A 4XAZA 2VC5A 3DEQA 2E8ZA 3GDBA 1Q6GA 1VHCA 4A3UA 4KWVA 3HG5A 4B5XA 2E77A 2Z2UA 3QBUA 3R0DA 2XGBA 3VOCA 1QOXA 4LAKA 1DHKA 1R3WA 3NZGA 4Y8EA 5TBOA 4DYJA 1WDPA 1UUQA 2J7DA 1XSIA 7CGTA 3CH9A 2MUCA 4LBUA 3ZLHA 3ZO9A 1QHOA 3NAVA 2AMGA 5HNTA 1R9XA 3LCHA 1J01A 2NUXA 1TWDA 2UWFA 4DY1A 3K2GA 5FJRA 2RDUA 3CWHA 2BTMA 3AIBA 2Y63A 1UCWA 1O60A 1OX5A 1J0IA 1EZ2A 4CD8A 3M44A 3IS4A 4GQRA 1UD4A 5H8UA 2HMCA 2B7PA 1VBHA 4HOXA 2W92A 2FB2A 4PRWA 1RBOB 3H12A 2SFPA 3RPDA 1OCBA 5HANA 3MQTA 3GHSA 1W31A 5IDZA 1LL7A 2ZADA 3UWUA 4XZ9A 2PBGA 5M03A 5HMSA 3GDMA 1T40A 2GQ3A 2F6XA 1US0A 3WNKA 3C6CA 1GQJA 4QEHA 4V33A 3M41A 4QS5A 3VE9A 1JPMA 4CEXC 3KBSA 4HMCA 1QBAA 1ZALA 4OWGA 4RV8A 2V6AA 3VOHA 3VU2A 2DV0A 2OMAA 4NX5A 3USBA 3FEMA 3UW6A 2WHKA 1OT2A 2E5DA 2XDFA 2ZE3A 2YXOA 4J2MA 1EC9A 3J7HA 4HNCA 3WD4A 2ATSA 4JX6A 4BA0A 4HU8A 4F4RA 3VNJA 4K37A 2DZVA 2D0FA 3EWZA 1MQQA 4IP5A 4QR6A 3W86A 1TSIA 3POCA 2Y7FA 3Q65A 3G8EA 4GI4A 2GGGA 4LUTA 8XIMA 1M3UA 3ZIZA 5C2GA 3TLQA 4PL1A 2EPOA 3BLIA 2FGBA 4Z08A 3GXDA 1F3WA 2CITA 1V3JA 3SBFA 2RHGA 3EWUA 1DIKA 2J78A 4TV6A 3CB3A 4XKMA 4S39A 2R24A 1YPIA 3IACA 3ATZA 3REQA 1MWOA 3EWDA 4F48A 1ZTVA 4OHQA 5AB3A 2BP1A 1JPKA 3L7RA 5GNXA 4MF4A 3EXSA 3AWOA 4JICA 4N6FA 4W8BA 4NAEA 4UTIA 3FA4A 4IF2A 1S1RA 1JCXA 1TUFA 5E09A 2H8XA 5BOEA 2Y8VA 2OLSA 1BQGA 2VC9A 1EJSC 1HL8A 4OQVA 2D20A 4CU8A 3OLDA 4RUBA 1M7XA 1N8WA 3BGAA 3ECQA 3GYCA 2OQYA 4ZE4A 1TJ2A 3W7KA 1UKTA 1A0DA 3STEA 4E4FA 2JIEA 3UT0A 3TONA 1J5TA 6CGTA 1JF5A 2BHZA 3V3WA 3K4WA 3ITTA 1H1NA 2PWFA 4H3DA 1JVNA 4ML9A 3DDMA 1MXGA 1OF8A 1MFUA 4BQ3A 4X61A 3AMKA 2ZZ1A 5K2ZA 2R1LA 1A53A 2POZA 3WQWA 3SCRA 1LYXA 1OJXA 2GWGA 1XW8A 3ABSA 1KD0A 5ECUA 1VKFA 2YW4A 4WY0A 3RJXA 5KZ6A 3IRSA 2IPGA 2PAJA 3BSHA 1E70M 3WMLA 2V5DA 3E5PA 4NL1A 3GS6A 3ZR6A 1H0GA 4DZ5A 3FX4A 3KLLA 2QJGA 5BXTA 1E72M 3NQBA 2OGYA 4ZMGA 1RSCA 4HZ8A 5BRQA 2A7PA 4CU6A 1FP9A 5AOUA 1KTBA 3ALFA 4S3DA 4Q8UA 3TSBA 4UR8A 4JR5A 5IHSA 3KP1A 2E68A 2VZUA 3GW3A 3WNOA 3MI6A 1XJBA 3G3MA 3SIZA 1UYQA 3SQSA 2CKSA 1XC6A 4BWLA 1N8IA 1ZFJA 3CAQA 3D0CA 4D6CA 3LG3A 4L9XA 1GJUA 2OO0A 3NEHA 2G3NA 4O4WA 4BF7A 4PSRA 2JEQA 1BSLA 3VM5A 1X6LA 1Q6OA 2ZZ4A 4UB9A 4NI8A 4IICA 5LHFA 4N9DA 4JN6A 3M7SA 1CX9A 4W8AA 1JDAA 4HPHA 4PBGA 1TTQA 2GQ8A 3M0VA 4QE5A 4Q7BA 1MEHA 4QG8A 3NJ3A 5LGZA 3CHCA 1PUDA 4NF7A 3FK4A 3OHIA 2WYSA 2JBMA 3W25A 3VI2A 3B4YA 2FPYA 3U3HA 2AKZA 2EO7A 4HTYA 4AWSA 4I5RA 2CLEA 3CEPA 4KRTA 4XUYA 5FF7A 4C6JA 3QGKC 2WBGA 1M9HA 1AL8A 3IJ7A 3QTGA 1R9ZA 3R58A 3I7SA 1CYGA 1LOQA 3MYPA 4YYFA 3NQAA 4JNMA 4ZB5A 2D73A 2O9TA 3ABXA 1XG4A 3NSXA 3B04A 4NNAA 4PUDA 3UERA 3CUIA 3LHTA 4Q6XA 1IXQA 3VGEA 1HJXA 2BV9A 1ZBWA 1NWTA 1PDYA 3G0UA 2RGMA 3BO9A 3VD7A 3R6IA 4FNUA 4LAUA 1KFEA 3LQLA 1VRDA 5DCBA 4IPPA 3LMYA 1E9ZB 4Q4RA 1UUOA 4GC3A 3W7JA 1QK2A 1U5HA 1E1EA 4W7VA 1WB0A 1HKJA 3ABOA 3EX4A 3SN1A 3OIXA 2V0TA 3P60A 3GR4A 4FX7A 5CGMA 3K1GA 3TIMA 2C71A 4PYSA 3W7LA 4QROA 3URAA 1Q6EA 3E74A 4EXQA 2DIEA 5CPQA 4PA8A 2Z28A 2E9LA 5AZ0A 2EJ1A 5CCZA 2D2OA 3NO1A 1V0MA 4PUNA 4ROPA 1UWAA 1I4NA 2ZZ6A 1UD5A 4JYDA 2PTZA 3GU2A 3GVRA 3W26A 4C1KA 1KGWA 3VZXA 3O06A 1DWHM 2GQAA 4GBUA 1OFPA 2FTPA 1KBLA 4ERAA 1NWUA 1WBJA 3EB3A 3WO8A 4QSFA 3W7GA 2O55A 5GPRA 1XLIA 1SO5A 3NPUA 2HPIA 2QMJA 5K9DA 1PIIA 5G4EA 2OZ0A 5HQLA 3H2AA 3CK5A 1B9ZA 1JCJA 1A5OC 3WUBA 4OOUA 2E9BA 3C8FA 4GYJA 3SJ3A 5AFDA 2W0UA 4RJEA 5JH2A 4HNOA 3RLVA 3WD3A 4AZBA 3BLLA 4DO4A 3WLLA 2QIWA 3NOEA 3KM8A 3WK0A 1WOBA 4LUYA 5A2CA 4IWWA 2YW3A 4MLJA 3MYOA 3A3WA 1B3YA 3CZJA 3PPGA 5AY7A 4A21A 4K68A 4MSSA 4N9BA 3UA3A 3WELA 4PTXA 4CD7A 3WD0A 4N9EA 1P0NA 1MXDA 2FZMA 5G2IA 1IF2A 1W2PA 3ITGA 3NQVA 2E5CA 2XVGA 4DAFA 3RM8A 3ZLGA 2J24A 4Z1BA 5DQPA 5I23A 4G7EA 3LPGA 4KEZA 2BOEX 3GH7A 3M4HA 2PTWA 1G69A 5I3JA 4A2RA 2Z1KA 4CNSA 4GPNA 4LJ3A 3T4CA 2XINA 1HXJA 5CZJA 4FOKA 1M04A 4E8DA 1PEZA 2C3ZA 1WV2A 1DWJM 3WMCA 1PKYA 3FYOA 1RPKA 3N3TA 1MW3A 1ODZA 5FF4A 4BKNA 1V6TA 1Z8AA 4LC6A 4DBDA 1W5NA 2F8QA 3BLEA 4C1NA 3VDBA 1RBLA 3WEOA 4XO6A 1Q66A 3GG8A 4Y9OA 1XICA 2ISDA 3MMUA 4IP4A 4IMCA 1BG4A 4O52A 1MEIA 3LQGA 1IZCA 4PFMA 3UVAA 4QFUA 2QF8A 4GUJA 2QS8A 3H26A 3B40A 2Y8UA 3MSGA 1VGAA 4E38A 1JPHA 5JBFA 2FHFA 1ALDA 3IV3A 3OIHA 4H04A 5C6MA 2XYLA 3A6OA 3TC6A 1BYDA 1SSDA 1W56A 3WNLA 4DN1A 2Y5JA 4U3CA 5CC3A 1P0KA 5KITA 3PTDA 3RO6A 4MY9A 4NILA 5HBFA 1YADA 3U8GA 1KO0A 4IIBA 1UOKA 4GIEA 2P3EA 4V15A 4HCDA 3TLLA 4ML4A 3WBAA 4XTIA 2YCLB 1PCKA 2GL5A 4Y7EA 3N73A 4MJ2A 3NG3A 1Q8AA 2JGYA 1FWHC 4DUVA 1WZLA 2VEKA 2IXUA 3MSYA 2E6YA 1HO1A 4A8LA 1WKFA 4NYYA 1QBBA 3AIVA 3ZJ8A 1ITXA 2WJFA 1QNVA 4Z17A 3KWXA 3C0LA 1I2NA 3QVQA 4DJFD 4H7ZA 1I1XA 3LXBA 3T09A 2OYKA 2V2CA 1P5BA 3CIVA 4JQ1A 4C7GA 2XWEA 1JQVA 5DCEA 4W86A 4GJJA 2BHUA 5CPTA 4GO9A 1HP5A 4GFSA 1J2WA 3DBNA 1HIZA 3AIRA 4O1AA 2DH2A 1J79A 5KMYA 4RNFA 2CZDA 2PDKA 5ENLA 3E2QA 5CAKA 3KBNA 3W38A 5DXYA 2VDGA 4BI5A 4UOQA 2VEFA 3BJTA 3AHXA 1R2TA 5K9XA 1F4AA 3UYIA 1CXHA 4QLJA 2B0MA 3BQ6A 1M6JA 2YFNA 3JR2A 3VKJA 2BMBA 4CCZA 2QVNA 4H2CA 4LPCA 4QNWA 4HHMA 1NM9A 1VC4A 3C3UA 1C8VA 2OX4A 1VCVA 1V3HA 3WL1A 2HJPA 5BNKA 1QPOA 2AGKA 1JYVA 3RRAA 1QK0A 1WCGA 3PUDA 4ZBCA 1FHLA 4CNNA 1NFGA 1M1BA 4JL1A 2J7FA 1WKYA 4XD6A 4GX9A 4CVUA 1DJNA 2BBFA 4I3GA 2WWDA 3R94A 2YIHA 2C0AA 3SQMA 4J3TA 2PLMA 3GW0A 1HF6A 4TX6A 1JZ4A 1AL7A 1POJA 1RD5A 1V7AA 1BGGA 4F0KA 4L6HA 3C2VA 1MNSA 4Z2GA 3M0LA 8TIMA 4FNPA 2V3EA 3JZEA 2W9MA 3TCEA 4K1WA 2CW6A 4AC1X 2QCHA 3LXAA 4XKYB 5G4WA 2JF7A 3W7QA 4QS6A 1C8QA 3RX3A 1SFTA 5E5CA 4JIEA 3S9YA 1MUMA 1OEPA 1T7LA 5G1MA 3GC4A 4YXGA 4NJHA 1SVDA 2O9OA 1YPFA 2QJHA 2DSZA 3AS2A 5A6LA 1EDTA 3NA8A 3GQYA 4M29A 4DJEC 5ABHA 1UC4A 1L8PA 4ZB0A 1HNYA 2JKEA 3QGAC 3TJIA 4AXNA 5H91A 3RR1A 1QPRA 4R88A 2PGWA 3W2UA 3VDHA 4Q7IA 2HBVA 3ARZA 4RPQA 4DRSA 4DHGA 4CCCA 4C6QA 3E2VA 3WF1A 4LF2A 3EOLA 3COTA 1UQYA 1U5VA 1CCWB 3FS2A 1ONRA 1XIDA 3GR8A 1ICSA 2BFGA 2VHLA 3FGCB 3W53A 1FWBC 3NGJA 3CH0A 1LOSA 4EKJA 2A4AA 4PULA 1TFVA 4ZSUA 4GG9A 3HZ3A 1TVNA 3A64A 3MHGA 2J8FA 3PN8A 3H24A 3UZ5A 3NVTA 4NASA 3OG3A 3ZXWA 2Q8XA 3DYMA 1UQZA 3VIKA 4AIEA 3BXWA 4U5IA 2CYGA 3CQIA 1GKQA 2WMFA 2D24A 2Q09A 3F4NA 1TZ7A 4C5ZA 1UMYA 3P7YA 4H9ZA 4M3PA 4DLMA 3BLDA 1PIFA 1PSCA 3BSGA 2QVHA 1SFJA 2XFFA 2VRQA 2OZ3A 3R8GA 3EDFA 1EJXC 1YMYA 2VC6A 3DGBA 4H8HA 1WKDA 4NZ3A 4X2RA 3WLPA 1CXEA 2CESA 1TG7A 3BGGA 4Q4QA 1E1CB 3FV9A 3ITOA 1IZKA 3CYJA 2EXOA 1C8YA 1CENA 1GNXA 4JTFA 4UBPC 1UMLA 3KDNA 3XIMA 4OZOA 1VEPA 3AZSA 1ZUAX 2VXNA 5CQ1A 1FWDC 3UU0A 1IWPA 5D4YA 1BG9A 1IR2A 3P62A 3R43A 1CB7B 4C90A 5FI8A 1LROA 3DFSA 1GOMA 1JPDX 3WQ5A 4KS0A 5AVHA 1TE6A 3GBDA 3N14A 2PC8A 4AU0A 5FF0A 3W1QA 2AQWA 1UR1A 3VNIA 1RXOB 3L2IA 2DT1A 4PE8A 4ERGA 2E6AA 1OB0A 3BK0A 3BMWA 2PDFA 2E09A 1N55A 4WLCA 2VRKA 3CQHA 2CBJA 4O12A 3TV8A 4GBDA 3VE7A 3LB0A 2INZA 2V5BA 4ORIA 4GUFA 3CZKA 5TIMA 1LUCA 4YN5A 5LA0A 4UQCA 1QT1A 2WCSA 3IGUA 1E40A 2AMXA 4IMDA 1QI3A 3DG7A 1O7AA 3AHVA 4OUIA 4ENLA 3II1A 3BQ5A 1IR1A 4JHOA 4YTSA 1H09A 2R1NA 7PTDA 4Y2WA 3GNXA 4H01A 4YMZA 4XTDA 4C6FA 3VOFA 4LS1A 1WDSA 4N6EA 1R38A 2A3BA 2GJXA 2W67A 2G3MA 2XJ7A 5J5DA 2DSUA 3T7VA 2DVXA 5AHNA 1CGTA 1W9XA 4PUKA 5DMMA 5LXEA 4MAZA 1W1PA 3AI0A 1E73M 2Y7DA 2I17A 1GW9A 3QPYA 3NO3A 3W87A 2J7EA 2O9RA 1JQXA 2V63A 2WCAA 4WF7A 1QATA 4AWEA 4MLRA 3RG6A 3QKZA 2FLIA 4CN4A 2CPUA 1SGJA 1S2AA 3OTRA 3HFTA 4U10A 5GQBA 1KR0A 5B7ZA 4UTWC 1BAGA 2IQ0A 3ZT6A 3WENA 2FFIA 5HDRA 4GABA 3I6RA 1AZ1A 2XFRA 4JFWA 3NPWA 2AOSA 3IANA 4ZZ9A 4WSHA 3QR1A 4F0MA 3LBMA 4IPIA 4UTLA 3IAPA 1YXDA 2AAMA 3GDRA 1NDYA 3SFWA 3TR2A 1PBGA 1NY1A 1UC5A 4Q8TA 3IUHA 1LQAA 3LLXA 3TQVA 1IEQA 1TKKA 4A3RA 4CN1A 3UG8A 1A47A 4AZ5A 3KVJA 2Q3OA 4CQCA 2C1IA 3TFCA 2BY1A 1R2SA 1RCQA 4DIAA 2V82A 3CHDA 3KCJA 4IXXA 4XKYA 4OJYA 2D2GA 1L2UA 3PBUA 4M80A 1V3LA 1XBVA 5AYBA 3W70A 1TJ1A 4LBRA 1CLKA 3M5XA 4D8ZA 3O6CA 1O1ZA 3QSRA 4LALA 4MPKA 3O6DA 4W9TA 4HJWA 3LV5A 1XLCA 2H90A 2FMOA 2G96A 1EGMA 3G1RA 3G1AA 4DQWA 3H7VA 2Y7EA 4AZCB 1EOMA 3QV9A 4MNJA 2O7SA 3UD6A 2RDTA 2AQVA 2UZ9A 2PC4A 1FH7A 5FCZA 1C92A 1S2WA 3GUGA 3BLKA 1FWJC 3PJWA 4O14A 1UR0A 2D3NA 2CZEA 1NP0A 3VNYA 1GVFA 3FGCA 1TB3A 1R30A 2ZA3A 1C29A 1HVQA 3CTLA 3UNDA 3QFEA 1KV8A 2G5WA 4IPNB 1BXCA 2QGHA 3PSWA 4DO5A 4B5TA 1UWSA 1XGEA 3EEZA 4RNJA 5CAHA 3W0KA 3RNDA 3TE9A 1UZDA 6XIAA 1ZBKA 2VZTA 2CBVA 3KOXA 3WLMA 1X6UA 4GVIA 2WLYA 1NOWA 1OCQA 4DBEA 2ZC1A 1FWIC 2QQ6A 3NPXA 3WD2A 3N2BA 2WXDM 2W62A 3MTWA 3VX1A 2PDWA 3AZRA 3R1ZA 4IISA 3URBA 4GIYA 2YZ5A 2J6XA 4EWJA 3QEZA 3RLUA 2VR2A 4GYPA 3M5ZA 3UCCA 4LX4A 2PP0A 4E3TA 5CPMA 3TOPA 5A6SA 2FTYA 3I7RA 3B8DA 4PSPA 2A6NA 2Y6ZA 4UR9A 2WVTA 1KCZA 4REQB 3EGJA 1GYNA 3TAKA 2FZ9A 4F79A 4QRNA 2DZTA 4AD5A 2XISA 2CHOA 3NPVA 3TX9A 4ACZA 1GTHA 3AU2A 4C5YA 3N6QA 1OD0A 3T2QA 2ON3A 1EB3A 3VOJA 5FJOA 3VVGA 5BRPA 5C7VA 4MJ4A 5C2XA 1SFSA 4K3ZA 3U2OA 4FLRA 1MDLA 1XL9A 2Z1XA 1DJHA 3ITCA 3PP7A 4C60A 4P5UA 3TQKA 3W4RA