1YXDA

Structure of e. coli dihydrodipicolinate synthase bound with allosteric inhibitor (s)-lysine to 2.0 a
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords dihydrodipicolinate synthase
publication title The crystal structures of native and (S)-lysine-bound dihydrodipicolinate synthase from Escherichia coli with improved resolution show new features of biological significance.
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2005-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1yxdA00
2GJLA 3EEGA 3KX6A 4GC4A 3DFOA 3S1UA 4MZYA 3NQMA 4XKYA 5LZLA 4JIPA 1R46A 2CZDA 1JCYA 4JX6A 4XQ6A 1BWKA 2CU0A 3LHUA 1YADA 4DPQA 1UB3A 3N2XA 3TAKA 1SO4A 4HPJA 3DHFA 3P8IA 2YX0A 1KM3A 1FDYA 4H4IA 3SIZA 3CQ0A 3EWYA 2KZHA 3P67A 3W7DA 3TMQA 3C56A 1C29A 2Q8LA 2W79A 3W1RA 2J9ZA 3W76A 3DGRA 2DZSA 3MWAA 1ML1A 3CM4A 5KZEA 5E0KA 5K9DA 1OFDA 4LW7A 3DBPA 4JTLA 3S1VA 1DHPA 3MJYA 1TTQA 2Z1BA 1X7FA 4Z1DA 4XTIA 3M44A 5DBUA 1OFEA 3CEPA 1W31A 2YZRA 4IMGA 3LI0A 1UJPA 3MI2A 4AEOA 2B7NA 3NL3A 2EAWA 1JULA 5HUOA 3IEBA 3SGZA 1SSGA 1FUYA 5D05A 3Q2DA 3LCIA 4FNSA 2WNZA 3C2OA 1MXSA 1TB3A 2PCQA 5AYXA 3CWNA 5FF4A 2YYTA 2X16A 3TQKA 2FTPA 2AAMA 4YL2A 2G5WA 2ZZ6A 4CNPA 4N6EA 3GR8A 3ZWSA 4ONVA 3TK7A 3W7HA 1F05A 1KFJA 3GR7A 3W86A 1B4KA 2ZYFA 5FI8A 4WD0A 1VZWA 5D33A 5LNWA 3PG9A 3R89A 5I3FA 1FWRA 2YFOA 4WOQA 5G1YA 3GB6A 4FX6M 2WNQA 1F6PA 2NZLA 2FB2A 3MHUA 3RU6A 5AC8A 4PL2A 1GG0A 2PRLA 3EWUA 4O4VA 1AW5A 5G2HA 2R14A 4LT9A 1Q6RA 2Y62A 1QOPA 1TCDA 4IX0A 3W1XA 3C4UA 3HBLA 1SUXA 1TPH1 1TRDA 4UR8A 1ZFJA 1DOSA 4AHPA 4MYAA 3HOJA 3L66A 1J5TA 4N9EA 3UWQA 3TFXA 5EYWA 1VCVA 1NF0A 5BRBA 1OFBA 5LKYA 1QCWA 4S2CA 5AHMA 2W6RA 3LERA 1FCBA 3SR7A 1LLWA 3W22A 5DCBA 3W72A 1A5SA 2H8XA 1HO4A 1TPC1 4OWGA 1WBHA 1OHLA 3O07A 4UFIA 2QUTA 1TRIA 1EP3A 3LTPA 2NLIA 2VFDA 3TX9A 1QPRA 2V2CA 1XM3A 3B4UA 4O4WA 5H2ZA 3LV6A 5TBOA 3S1XA 2E5CA 1SZEA 2ZZ4A 3HJZA 3W7QA 1D3GA 2Y70A 1LP6A 4N4QA 4Q4KA 2EPHA 2WJZA 3LGEA 4UFKA 2VKZG 5LNRA 5EMUA 4AXKA 4LV9A 4EIVA 4LY8A 1NF7A 1LROA 2YFNA 3CIXA 3P84A 4AB4A 4XBSA 4YCOA 4LS0A 1FWWA 2V81A 2H90A 1HTIA 5J5DA 3B06A 1F76A 3THQA 1JR1A 2EKCA 2ZZ1A 3S6DA 5CSRA 1EUAA 4HT3A 3IIOA 2GQ9A 3SI9A 4L4LA 3QQ0A 2UV8G 1LZOA 2X30A 3V1PA 1PIIA 3NQGA 2ZRUA 1WA3A 3HG2A 4S2BA 3BLFA 5I3IA 1TMHA 3CWOX 3F4WA 1LOSA 1UASA 3QH2A 3HPXA 5HWNA 4GJ1A 3HG5A 2Y6ZA 5EKYA 4NZJA 3EX6A 1H7NA 1FBAA 1H7WA 1TTIA 3TV8A 4CNOA 1PHWA 1SW3A 2B0MA 1T96A 2V9DA 3KVLA 3W2LA 5C5YA 1T99A 4OV4A 1JUKA 1YDVA 3CEUA 4O57A 3L65A 1F7BA 4LRSA 4O1AA 1XXXA 1TV8A 3G1HA 5A5WA 4JIQA 5DELA 2VELA 3TFCA 2XN0A 3KHJA 4JTJA 1M7OA 3BPWA 3VCRA 4PA8A 1KFKA 2OZ0A 1W5QA 4A29A 3P8JA 4O8RA 5E1QA 3QW4B 5HULA 1LRTA 1QR7A 4NUWA 2WSRA 4M7SA 1PCKA 3W87A 1JCJA 4K8EA 2RH9A 2CFFA 1G4PA 5I3GA 1P1XA 1W5PA 1R47A 2JGYA 2I14A 3O6DA 1G7UA 3IIPA 2J24A 3I7SA 1KFEA 2VFEA 2H3DA 1O94A 4NNCA 2ZQ0A 4RJEA 4LS1A 2X1SA 4LU0A 4PTNA 4WXZA 4ZZ9A 1H7PA 3CIWA 3SFKA 3LBCA 3S9YA 1GVQA 5HINA 4IMFA 1TJPA 1Y0EA 1ZNNA 4N9BA 1JQXA 4KKXA 3MO7A 3STGA 3M6YA 1FWNA 2ALDA 3IVUA 5DCEA 4JTEA 3M47A 1P0KA 3ABQA 4OBTA 4QNWA 1WV2A 1ADOA 4JDYA 4AF0A 2V5BA 4Z0JA 3MBFA 5G2IA 4A21A 4BI5A 2ABAA 1KTBA 3RF9A 1IXPA 3PWAA 4DO6A 5CSSA 4Q33A 1GVOA 3W1QA 3HF3A 1HO1A 3G1AA 1Z48A 5AHNA 3BG5A 3W74A 3NPVA 3G0XA 4Z08A 2GJNA 3N3MA 3T7VA 2V2DA 3H53A 1H5YA 2GPTA 4EVZA 1WX0A 3GLCA 2R91A 4LVFA 3CT7A 3T4CA 4JTHA 2Y7DA 4X3ZA 3Q37A 4QAIA 3THAA 3PB2A 3ABRA 3M5YA 1LDCA 1NAL1 3O63A 2ZFAA 3UPBA 2ZA2A 3W07A 3LRMA 2ZA1A 2C15A 4KFPA 4OU1A 1OABA 2Q3RA 2QJHA 2WNNA 2VFIA 5KZMA 2FPVA 4MYXA 3I7RA 4RX0A 4NZFA 1UCWA 5KINA 4RK8A 4DXVA 3NQFA 4DEFA 1IXOA 3W7GA 3MP4A 1Q6LA 2QEZA 1KM4A 4HSOA 3UYCA 1G4SA 5AHIA 3L5LA 4FX7A 1BWLA 1W8SA 1OK6A 3MI6A 1D3HA 3NR0A 3OA3A 3OVRA 5G1TA 1YXYA 3TC7A 3KXQA 3W2MA 4JYFA 3B0UX 3HGOA 3W1TA 3S5NA 3WJYA 3EWZA 3DXIA 1O5KA 2VEMA 3P60A 2A6NA 4I7UA 2QDGA 4AH7A 3S1WA 3HIJA 3LHTA 2V2HA 3R13A 4RLIA 1ZJIA 4N6FA 2BLEA 2QCMA 4DQWA 1RQHA 3F1QA 2GVLA 1VCGA 2A5HA 2CLIA 3MHFA 4UTTC 2Z6IA 4FXRA 4L4MA 3LCHA 1XDLA 4RZ4A 5U4NA 5HQEA 4Z1AA 2DORA 2E6FA 4ALDA 4ICNA 4ORIA 1FXPA 1OJXA 4AVFA 1YDOA 1I2NA 1WYIA 3NQDA 3SY5A 3IGUA 3EKZA 2YR1A 3K30A 1TPVA 5CGQA 5DXXA 4K7YA 4GNJA 3TMLA 3LHZA 3O15A 2CLOA 1AMKA 4UFHA 5F1VA 1I2RA 2GVJA 1LORA 5LHFA 5KZDA 3OVQA 5K4XA 4A3UA 3DH7A 3CHVA 1LLZA 3G0UA 4ZQRA 2NXIA 4AF0B 1X1OA 1VR6A 2A4AA 1TPEA 3PG8A 1LRQA 1TO3A 3C0JA 1SO3A 1W1ZA 3CTLA 1B57A 2FIQA 1LBLA 1KM2A 4EF8A 3NAVA 2WSQA 4HKPA 3UY8A 5DY2A 4E38A 2C13A 1RQEA 1VYRA 4HNTA 1V5XA 4R53A 3QYQA 3W71A 3G24A 3NQVA 3W7OA 1GOXA 3G3MA 3GAKA 4KFNA 1LOLA 1S3HA 1W56A 5AHLA 2G97A 2PRHA 4W9TA 1JJKA 1YXCA 1OVDA 3M43A 4TO8A 3YPIA 3EB2A 3C2EA 1TPUA 3PM6A 4NX5A 3QMSA 3V75A 2FJKA 3KRUA 1QO2A 1Q6QA 5F4SA 1I2PA 5AYYA 1IGSA 4QISA 3WFAA 4RZ6A 4GWEA 4N9DA 4O12A 4P61A 5L9FA 3UWVA 3TSDA 2CLKA 2VFGA 3L9CA 4A22A 4HNUA 3S5YA 2CLEA 3W73A 1EP2A 3WJZA 3A24A 1JCMP 4Z0SA 3QRHA 3W7EA 3LOTA 1ZCOA 2J88A 3MUXA 5A8GA 4N2YA 3BW3A 4QIUA 3SJ3A 2J9YA 3O1NA 1XI3A 3WK3A 4JNMA 3LXAA 2J27A 3L67A 1YYAA 2ZDRA 3TU9A 3T44A 3TAOA 1C9DA 3EKLA 1H63A 4NNAA 1XUZA 1OX6A 1O5XA 5BOOA 2C6QA 3TJLA 2X1UA 3W6YA 3B03A 4UTWC 3QEZA 2A7RA 1GTEA 3KFTA 1OF8A 4UTJA 3LI1A 5FEXA 3TROA 2CZFA 2Q3OA 4K38A 1TSIA 3EX2A 3TJXA 4FO4A 3M1ZA 3NNTA 1O95A 4WUIA 3W75A 4ADSA 4NXSA 3G3DA 3S8HA 4UIOA 1XBVA 5F2LA 1J4EA 2ZRYA 3QC3A 1L6YA 2X1RA 5G4EA 3GDLA 1LYXA 2O7QA 3QJAA 4GBUA 3S5ZA 2YCEA 2B4GA 2ZTJA 1ICSA 2A21A 2OX1A 1M6JA 2NWRA 3OG3A 5FEPA 1TJRA 1QPOA 2E6DA 4NJIA 3I6RA 5KTLA 4AHQA 5K3VA 3KVJA 2NWSA 3N14A 1SPQA 4AHOA 1P4CA 3LBMA 1HL2A 3DENA 4O19A 1LBMA 1PHQA 5D03A 2EHHA 3LXCA 5DLCA 1FCUA 1QWGA 1YTKA 3BK0A 3DU0A 3PULA 1IIHA 1YXDA 2ISWA 4OT7A 2CZ5A 4MFEA 2WSYA 4PEKA 3R12A 3W7IA 2ATSA 4Q32A 1ICQA 2NUWA 5HWJA 4Y8FA 4R7JA 1FX6A 1XC4A 3H55A 4DF1A 4HSNA 2EGZA 1TPFA 4JYDA 3GXPA 1H62A 3NL6A 4GE8A 4FNUA 3IGSA 4JEQA 3VNDA 3HPZA 2PC4A 3O6YX 3NG3A 5EBUA 2QCDA 3G1XA 1KV5A 3W1NA 4IJBA 1GWJA 5CPOA 1Q45A 4LUJA 3TSBA 1CW2A 4Y90A 3DKLA 3M41A 1UBSA 4AAJA 2NX1A 2E5DA 4MJZA 1F5ZA 3GX9A 4JS3A 1M5WA 4RXFA 4XKYB 1HG3A 2OCZA 1FY6A 1EUNA 5HNRA 3LCLA 4O1CA 3W88A 2QCCA 3EXTA 2FPYA 2VXNA 4ZQNA 4IXXA 3QSTA 3FS2A 4TX9A 3ZR4A 1SU5A 3T78A 1RD5A 3M16A 6TIMA 1AW1A 1OYAA 2A0NA 1H60A 4POCA 3D0CA 3NXFA 1GYNA 1KLZA 5FF3A 3RLUA 2NX9A 3USBA 1WQ5A 1FCVA 4FNQA 4WY0F 4K39A 1JCXA 3DI1A 4O0ZA 3VE7A 2OT1A 1VYPX 3ATYA 4DF0A 3F03K 3HG4A 3A5FA 4DO4A 4M6VA 1TQJA 3RLVA 4DPPA 3LB0A 1VGAA 3DKJA 2QCFA 3TSMA 1CX9A 3MYPA 3W7KA 5IBXC 1HFBA 4HN4A 5DXYA 2DZWA 4M6QA 2ZZ7A 4JTFA 3W2NA 3CC1A 5FESA 3IV3A 4UCGA 1FQ0A 3GKAA 3L5AA 5C2XA 3UXAA 3W70A 4YCPA 2QAPA 1WXJA 4QITA 4DELA 1R30A 3MMTA 3SZ8A 3LHWA 3IIVA 4NJGA 4UR7A 1QO5A 3TA6A 2JKAA 2GOUA 1NVMA 1KM1A 4MFDA 3Q94A 3NQAA 2V82A 3LTYA 2Y7GA 4NT0A 2B7OA 3W7MA 4IUOA 3HQ1A 3E96A 3G1FA 3LDVA 5EY5A 5AB3A 4U4MA 1ZAJA 4PH6A 4WJEA 4NJJA 3OBKA 5FEZA 3ELFA 2NUXA 1TPDA 5MHBA 4PCFA 1F6KA 4RV8A 4TMBA 4IOTA 4CQ9A 1AW2A 1KM6A 4LWWA 2VC6A 2NV1A 3STEA 1J2WA 1DL3A 2QCGA 2B7PA 3L5MA 1RZMA 2ATMA 1VYSX 3FJ6A 5HR6A 1ALDA 1OG0A 3F4NA 4BWLC 1WOBA 3O8AA 1KW1A 1OFRA 4XBKA 3GYEA 3GDTA 3W7JA 4AWSA 1DJQA 1DQWA 5AFDA 1H1ZA 3L0KA 3Q58A 1ME7A 4LC8A 4LRTA 3TIMA 2DJXA 3NDOA 1EPXA 4O50A 1OX4A 3S0CA 5LNSA 3ABSA 1K03A 4AMAA 3LTSA 2R8WA 3UZ5A 4A2SA 4BF9A 1KV8A 5CPNA 1XKYA 3U6WA 3NEVA 3M7WA 3TCEA 1DORA 5FF0A 2I9EA 3SGUA 3PS7A 4BFAA 4UFMA 2A1YA 4ZQCA 5G5IA 3QPYA 2CLMA 4XZ9A 2CLHA 4N02A 2JKPA 4JGDA 3NVTA 3OEXA 4RZ5A 2LLEA 3BV4A 3NL2A 4ZMGA 1PE1A 1XCFA 4BI7A 4UTUA 3UZJA 3B0PA 5T26A 4M19A 4UTTA 1VJIA 1VQTA 2BSLA 3HO8A 1CI1A 1RPXA 4LTSA 2BXVA 2DZUA 3FIGA 4X9SA 1GVSA 1G69A 5KITA 1WAUA 3PY2A 5CKSA 3B8DA 1TTJA 1NEYA 5HUPA 3BG3A 1AL8A 3N34A 1DV7A 1KFLA 3BW2A 3LCXA 1FDZA 5BMWA 4O15A 1SQ7A 2RKXA 2ZA3A 1XBZA 1PVNA 2B7QA 1A53A 2V0TA 4NX0A 2I1OA 1BEUA 3P74A 1GT8A 2YSWA 4JX5A 1MEIA 4GRSA 4WOZA 1FDJA 2V30A 1GPWA 2VOMA 3STFA 1SZGA 3VI2A 3UPWA 1DJNA 1WBJA 3ANYA 4JTUA 3W7RA 2E6AA 3I7QA 4PODA 3LV5A 2H6RA 4HIBA 2WQPA 2AGKA 1XFBA 1H50A 3DFQA 2YW3A 4N4PA 3B05A 3PF3A 4M5PA 4CCCA 2G96A 2E09A 3HGJA 5BW6A 3IRDA 3LLDA 4XWUA 4IQLA 5AHEA 2A85A 1IIGA 2EF9A 2A2IA 4G1KA 3T40A 3VFLA 2QKFA 3FEMA 1ICPA 3GVGA 3HG3A 3MBDA 3GNNA 1X1ZA 4IPJA 3PBVA 4HNVA 4UTKA 1OFOA 3NQ2A 3PSVA 5CZJA 3C2VA 3NQ8A 4CQ8A 3WJSA 5D2WA 3W3OA 3MW7A 4P2VA 3TXZA 1GQNA 3PAJA 3LM7A 4QM1A 1A50A 1YTDA 3PUEA 4JX4A 2VEPA 4JTSA 1I45A 5TIMA 1OK4A 5HWMA 3PUDA 1SO6A 4LV4A 1MO0A 1OX4B 5DY3A 2XN1A 3UY7A 4JY8A 3W1LA 5I3KA 3TW6A 2HSAA 4R34A 4OQVA 1EX5A 4CCEA 3BLIA 2ZZ2A 2C0AA 4MZ1A 4O10A 2F7FA 4FIQA 1UUMA 4K6AA 3TH6A 4UUIA 4TU1A 3IVSA 2CLLA 3G8EA 1VPXA 4UNKA 4LC6A 1H1YA 4M7TA 4KWVA 1JUBA 1G7VA 3FKKA 4ZQOA 3NZ1A 1FXQA 1TQXA 4IGHA 2Y85A 3LCGA 4UTWA 1H7OA 1SW7A 4O1BA 1PL9A 1WDWA 4LNYA 1TTPA 1S5VA 1EWEA 1W5MA 5F4XA 4ZQPA 1ZHAA 5D38A 2QDHA 3N2MA 2QR6A 2Y7EA 2E1DA 2BZNA 5F2IA 5LNVA 5AC6A 2C1HA 1XBXA 4EOUA 3I65A 4O13A 2WO5A 1IXQA 3FOKA 1DKWA 1OFPA 1QAPA 1QMLA 1TREA 1M7PA 2ZRWA 3P80A 1P5BA 2X1TA 3G1SA 1JUEA 3EWBX 3H54A 1IXNA 2Y61A 1P0NA 4MKNA 2WPBA 1G67A 3LXBA 4WY0A 1FWSA 3W84A 2HTMA 1ZAHA 3U2OA 2QCNA 3W2UA 4QSHA 3JS3A 4LS2A 5CG7A 5FEWA 3W7LA 3EX1A 3FYPA 5LNUA 4K36A 3PBYA 4MVAA 3AO0A 2ZZ5A 3M9YA 4JYEA 2YW4A 2DZVA 1YDNA 3GDRA 2TYSA 1W3TA 4MY9A 2ZRXA 1YPIA 5L6UA 3LHVA 1GVFA 3E0IA 3L68A 4GUJA 1K3UA 4BI6A 1ME9A 3LX9A 1KFBA 4DBDA 5F4WA 1WOAA 2P10A 4MUZA 5D04C 4RKAA 4LVGA 3P5ZA 2FPTA 3DFNA 3NYZA 4ZL1A 3M5ZA 1W5OA 3C8FA 4D2JA 2CLFA 3BG9A 2NXHA 4RR4A 3C61A 1W3NA 1YPFA 3QW3A 4B5NA 3PSWA 4MZ8A 3W85A 5DN1A 1QFEA 4NVTA 1ZALA 3TQVA 3NPWA 1JRCA 4GXMA 4EWND 2IQTA 2NXGA 2QCLA 5KMYA 1SFJA 4AWTA 2C18A 3NO5A 2A7PA 2E6YA 1OFQA 3U8GA 2J9XA 3QF0A 1NFBA 1HUVA 3IGXA 1R2TA 4GUHA 3MI3A 3TE9A 1JCLA 4NXKA 1VCFA 3UWYA 3FFSA 4FIRA 1E51A 1I8JA 1GZGA 3HGRA 2GVGA 2BTMA 1H61A 3QFEA 1D9EA 4IX2A 1S5TA 1Q3NA 1UUOA 3DFSA 4MY8A 4WXYA 4LUIA 1GEQA 1K8ZA 3EXRA 3G1DA 5CPMA 1ONRA 4ML9A 1KTNA 5BNKA 4K7VA 2E77A 4NNBA 3SECA 1SFLA 4C1KA 3A21A 3FLUA 1IF2A 2NX3A 2VEKA 3QM3A 4OV9A 3QPZA 1QDSA 1S5WA 5D37A 2F84A 3MHGA 1KA9F 1ZAIA 2VFHA 2E5BA 3FJLA 4O52A 1L6SA 4RCXA 4MOZA 3FA5A 2OMAA 1QOQA 4X2RA 4O53A 5D30A 1R2SA 4WX2A 2YGYA 4NJKA 5SWUA 2RDWA 2TRSA 3R5EA 3NM3A 4ADUA 3HPSA 3LCWA 8TIMA 1SZFA 1LOQA 3NQEA 3JRKA 4PL1A 2DZTA 2ZTKA 2A7NA 5IBXA 4WY0B 3EWXA 2FQIA 1GTHA 3GIYA 2Y7FA 5D2YA 3C52A 4FXSA 5EL1A 5DCDA 1RV8A 2V8ZA 4Y96A 2HS6A 3BGJA 4CLMA 4IPIA 1TYGA 4UTLA 3QMTA 1G4EA 4WQ6A 4RXGA 3NA8A 1QPQA 1XDMA 4O54A 3NPXA 3T55A 3S5OA 1MZHA 1LM1A 3PR2A 5C55A 2DZXA 3W7NA 2RHGA 3R2GA 5AYZA 2WV8A 1Z44A 3RFAA 4O17A 2QUUA 3G1YA 4H3DA 3ZWTA 2QUVA 4YLWA 3P81A 1G6CA 5AN7A 1H7XA 1EEPA 4A2RA 3EX4A 3HMJG 4IXHA 3G0SA 2H3BA 3KRZA 2VEIA 1OFAA 4JY9A 2JGQA 1L2UA 1LRNA 1OF6A 1SZNA 3B04A 2Y63A 1I2QA 4OE7A 2V5LA 3HB9A 1N8FA 2YDAA 3P61A 4CCDA 2AQWA 2ZRZA 2BX7A 4NU7A 5ABTA 1I2OA 1B3OA 2TMDA 1H7RA 3W1UA 4PFMA 3NGJA 2GQAA 1K8XA 2ISVA 3W9ZA 1KFCA 3ATZA 2Y88A 3TQ0A 2Z0IA 4BWLA 3GKFA 5K9CA 1K8YA 2GQ8A 5EPDA 3VKJA 3PC0A 1W37A 4JICA 4FNRA 5D2TA 2E68A 4YMZA 3MP3A 3G8RA 1BTMA 3R8RA 5IM51 5G4WA 4QNEA 4FF7A 1SR9A 2D73A 4ZQMA 3WK1A 1O60A 5HR7A 2JK2A 2TPSA 2Y89A 4WZHA 3UWZA 3RK8A 1JRBA 2C3ZA 3C2RA 4E2DA 3QZEA 2OT0A 4DO5A 2ISSA 3PVFA 4E2BA 1EWDA 5DBTA 4TMCA 3E49A 3L0NA 5LGZA 1N55A 3STCA 3IIXA 4TIMA 1L6WA 1MSSA 5K2ZA 4CQAA 3KRSA 1SW0A 5KSWA 2PE4A 2W0UA 2ZZ3A 4UTHA 5D09A 3NOEA 5C6MA 1X8FA 3EXSA 4E0CA 3GDKA 5D32A 2HS8A 3RNDA 2QCEA 3W7PA 2QJIA 3P5YA 5C54A 3G1VA 3QQ1A 1MEHA 3I68A 1A5BA 3ABOA 3W2KA 1RVGA 2J6XA 3GDMA 2ZBTA 1TPWA 3M5XA 2DJLA 3IIZA 5FF2A 4FHAA 2Z6JA 2Q8ZA 1TIMA 1YLVA 5F1UA 4DBEA 2C19A 4IMDA 3M0ZA 1LCOA 3LRLA 1ZENA 5CZTA 1YTEA 2FB3A 1W54A 3BO9A 2QF7A 3BW4A 1VHCA 1I4NA 1MEWA 5F2GA 2QCDB 4IWWA 1Z41A 4DF2A 2R94A 2DU2A 5K4ZA 1VRDA 3P82A 3NQ6A 5CZ0A 4I7VA 4C1LA 3HGSA 2DZPA 3DHDA 5LSMA 3OVPA 1QNVA 2YPIA 4O16A 3S42A 1K7EA 1B9BA 3MP5A 3N9RA 4JTGA 4GFSA 5J5RA 1JVNA 3TDFA 1ME8A 1VHNA 4KFOA 1TV5A 4O18A 3O06A 1H51A 2QCHA 4M6PA 3A9IA 3JR2A 4ZVJA 3DFPA 2NV2A 5BMXA 4K8HA 1KTCA 3NQ7A 4MJMA 4UXDA 1QPNA 3UWUA 2QAFA 4MIMA 3WJXA 4GUIA 2CWNA 2G95A 4UTIA 4Y6GA 1RQBA 3O6CA 1R2RA 4FX8A 3PUOA 4BK9A 3VE9A 1FCQA 2ZCGA 3PBWA 4H6KA 3OHIA 2A6LA 1NSJA 3LHYA 3O16A 3TR2A 1V7YA 4LOCA 2VFFA 2QJGA 1K02A 3CPRA 4BR1A 3G22A 1OX5A 1LBFA 1AG1O 1JQVA 3M5VA 3BVJA 4R33A 5D2VA 4O1DA 4FB7A 2C14A 1SSDA 5G2WA 3PB0A 1X6UA 4O28A 4IMCA 3GK0A 4FNPA 2ABBA 5LHEA 3P62A 4JXCA 1FWTA 3WK2A 3KVMA 4UFJA 5HMSA 2P0OA 4XTDA 5TQLA 1T0OA 1SO5A 3QMRA 1K7FA 4JTKA 3G18A 4CNNA 4X22A 3MYOA 3BGGA 5GVJA 2RDTA 4HPXA 4LVBA 4JDBA 5D02A 4QQ3A 3QSRA 4Z1BA 4JTTA 3SW6A 2VENA 3OIXA 4UMBA 3E02A 4LVAA 1W3IA 1KBIA 5F2MA 2FFCA 3GNDA 2WKJA 1GYLA 1EIXA 4Y9AA 3KAOA 2BWGA 4HHPA 3W1MA 3SSJA 1XBYA 3N9SA 3FKRA 4Z1CA 1AK5A 1DQXA 3NQCA 1A5CA 4KWWA 1Q6OA 2ZRVA 4FNTA 3NPUA 2CZEA 2Z2UA 1F2JA 1U5JA 3L2IA 1PV8A 1K7XA 4OGZA 3DZ1A 4JTIA 3ZFHA 1VH7A 4NQ1A 3UD6A 1GVRA 2WOQA 3C3NA 4HNNA 4N9CA 4FEZA 2FLIA 3P7YA 1W0MA 1EB3A 4MY1A 1KBJA 2JBMA 3TKFA 3IVTA 1THFD 3UQNA 3C6CA 3RMJA 1AL7A 2PRMA 3DI0A 1RR2A 3LLFA 3B0VC 3E12A 1KLYA 4UMAA 1BKSA 1A5AA 4MPQA 3A22A 2HMCA 1F74A 3E9AA 4MLRA 4UC5A 4S1FA 2FDSA 4UNLA 2YYUA 3GXNA 3TUUA 3FYOA 5CZSA 1N7KA 2JKEA 5I3JA 3BLEA 2TSYA 4ORMA 5EA9A 4YXGA 3CB8A 3NM1A 5D2XA 1PCWA 1EP1A 3CLMA 1EA0A 4PC8A 1T8XA 4ADTA 3TW7A 3N73A 1XUUA 1TPB1 2CW6A 4I9AA 3NL5A 3C2FA 3A23A 4O11A 1VS1A 4JR5A 1C8VA 3TNOA 1DVJA 4LVDA 1F73A 2NUYA 1VC4A 7TIMA 3A5VA 5LGXA 3EX3A 3GAYA 3DFTA 3PBUA 5U7SA 3EWWA 4AWUA 2YXGA 4EF9A 4O0KA 5CPLA 3GXTA 3W7CA 1TV7A 2C16A 2P1FA 3GZ3A 1KM0A 4UTMA 5AC7A 3L21A 5HJLA 1U83A 3DAQA 1OYCA 2RFGA 4GUFA 1LTDA 5E93A 1GJPA 3WJWA 3AJXA 1B4EA 5H91A 5K9XA 4JD4A 4JN6A 4YWIA 1O4UA 3O05A 2O7SA 4TR9A 3UWWA 2RDUA 4IMEA 1DBTA 2XN2A 4U28A 3W1AA 1KM5A 2OJPA 3N19B 1W5NA 3KOFA 4QJ1A 1L9WA 2H8ZA 4UMCA 4OHQA 3KVKA 3TXVA 4XUGA 1VLWA 3LCFA 3BARA 2X2GA 5AOUA 3UXDA 4I7WA 4NJHA 3LRKA 1GG1A 1XL9A 5FF7A 4UFLA 2GUUA 1G4TA 3W1PA 3WK0A 3TC6A 2DP3A 4O14A 1OYBA 1PS9A 4J9JA 4MLJA 3W23A 1ZY9A 2XFWA 3INPA 5I3HA 3CU2A 5AHFA 3ZS4A 1Z42A 3W2JA 5K7JA 2PURA 6ALDA 4K37A 4GUGA 3L0GA 1JCNA 3NZRA 3W83A 1VLIA 3UNDA
chains in the Genus database with same CATH superfamily
1FWHC 2GJLA 4NY2A 4MDPA 4GC4A 3ARQA 2YDQA 2DFAA 1GJWA 2BODX 5CC7A 3CHEA 4I8YA 4XQ6A 2CU0A 2FZ9A 2ZX8A 1BYDA 3LHUA 3N6QA 3FVMA 3DHFA 1GQLA 1KM3A 4W7WA 3CHFA 2EPOA 3W7DA 3TMQA 3C56A 1U33A 1D3CA 4HCLA 1VENA 4PB4A 1M04A 3VIMA 3DBPA 2CERA 3S1VA 5JBEA 3MJYA 1TTQA 1AMYA 2Z1BA 1SFTA 2VTFA 4I9TA 4DZAA 2X2YA 3B8VA 4MWAE 2X09A 4M3PA 3WQ5A 2J8FA 2OPJA 3NL3A 4QE1A 1HF6A 5BXPA 1FUYA 1V6VA 4EAYA 3CQIA 3WELA 1KR0A 1WB0A 4YVVA 4KWSA 1TB3A 5AYXA 5ABGA 1FH9A 3HQPA 3LUTA 2YYTA 1YPXA 3TQKA 3AHTA 4F0SA 4EPBC 4YL2A 2G5WA 2V3FA 3HJEA 4CNPA 3C0LA 3GR8A 2FVMA 2FGBA 5D8WA 5MKGB 3IUDA 3GUWA 4GI8A 3AAMA 5LNWA 1UP3A 3T8LA 3Q67A 3PG9A 3SRDA 1L6GA 3R89A 1FHVA 1ITXA 5I3FA 4IFOA 1TJ2A 3RPTA 4G7FA 2WNQA 3PZIA 4O8AA 2AOSA 3UF9A 4EX4A 3HPFA 4ZGYA 1E71M 4U2YA 4CVWA 1L2QA 3N4FA 1Q6RA 4J3SA 4KESA 1VIWA 4IX0A 3BQ5A 3V18A 3C4UA 4WK9A 3HBLA 2GFTA 2G4FA 1TRDA 2SFPA 4DAFA 3GHRA 1NJJA 5LKYA 2POZA 4CD5A 3OLEA 1UWRA 3BGAA 2YL9A 2ZWYA 3ZVHB 1FCBA 4NASA 4Y7EA 2OGJA 5DCBA 3SR7A 2Z2BA 3F4CA 1A5SA 2H8XA 3CMJA 1XLHA 1NDWA 3E2VA 5E0FA 2QUTA 1TRIA 1QHOA 2OWWA 1EP3A 3LTPA 2DSWA 2Y5JA 2VFDA 4DUXA 5M1TA 2MNRA 5H2ZA 3N04A 1GKRA 3HJZA 1ITUA 1D3GA 4N4QA 1BQGA 2ALRA 4A3YA 3BAYA 5LNRA 3QV8A 2NLYA 4LY8A 7XIMA 3PPGA 3SCTA 2XVGA 2V81A 1TUXA 1HTIA 2ZOXA 4GLEA 1QRQA 3THQA 5FJRA 1JR1A 2EKCA 1W6TA 3QTGA 1R0MA 1TX0A 5CSRA 2C1IA 3SI9A 3S2MA 2UV8G 1W9XA 1AODA 3HG2A 2OSYA 2Z1SA 1TMHA 4KW2A 3LPPA 3M46A 1VPYA 5A2CA 3S2LA 1RVKA 3QH2A 4YJ5A 5HWNA 3UXIA 3WH9A 1T5AA 2Y6ZA 1P7TB 1U1JA 3DC8A 5GJPA 4BY3A 3EX6A 3M0MA 3B9OA 3TV8A 2GUBA 3KWSA 1PHWA 2V9DA 3KVLA 4M6UA 1T99A 5HNTA 4PTDA 1YDVA 3CBWA 3CAVA 4Q3MA 1F7BA 1V3JA 2C71A 3N3TA 2VELA 3GD6A 4L64A 3TFCA 2XN0A 4JTJA 4PUJA 1VEPA 3IAQA 3RXZA 3E5BA 1I9CB 3PZQA 2DT0A 1WKEA 5E1QA 5HULA 3FXYA 1DYSA 1LRTA 3WLSA 1AH3A 2WSRA 4X61A 1PCKA 1JCJA 4IQEA 2RH9A 4P7LA 1X38A 3B8SA 2I14A 3PANA 2J24A 3VIGA 3DFYA 3W27A 2H3DA 1E6QM 4NNCA 4IFRA 4WXZA 4RE2A 4ZZ9A 2FTWA 1GVQA 5HINA 3V0TA 4Z2IA 1S1PA 4AX6A 4V15A 4WDUA 4DB7A 1OCJA 3MO7A 3STGA 2IMRA 2DVTA 2ZXDA 3A3WA 4LGXA 3QC0A 3OA5A 4JTEA 3M47A 3ANUA 1AJ2A 1WE5A 2J25A 3GU9A 4OBTA 1PEZA 4M8UA 4QXIA 2PWFA 1H0GA 2WAGA 5G2IA 1HJWA 4A21A 1TA3A 2ABAA 1KTBA 1IXPA 4DO6A 4Q33A 3W1QA 3HF3A 1HO1A 1PUDA 4OKDA 1RUSA 3BANA 4WKHA 3G0XA 3K13A 2V2DA 3H53A 2GPTA 2QUMA 1WX0A 3WENA 1RSCA 1ZBWA 2R91A 4HPNA 3K8KA 1WDPA 3T4CA 5M3WA 3MDUA 4QAIA 3PB2A 3ABRA 3W07A 3UPBA 3PAOA 2WCSA 2C15A 4QQUA 2WNNA 4XSMA 2VZTA 3I7RA 4US5D 2REQB 4RK8A 3N1AA 1X1NA 4W4QA 3MP4A 1WZMA 3P0XA 4LCQA 1KM4A 1YE4A 5A6KA 5M17A 1G4SA 4WGHA 3QGKC 4ECLA 1BWLA 3VINA 1J79A 1W8SA 3MI6A 1K9FA 5IFPA 3KXQA 5CAHA 6PTDA 4IIGA 4H6QA 7PTDA 1CGXA 2OSXA 1VJSA 2VDGA 2VQUA 5E0CA 3VOFA 5D9MA 3CZGA 1JDEA 1O5KA 3L4WA 2A6NA 3R94A 1ELSA 1E1CA 2QDGA 4XZBA 2I9UA 3W26A 3HIJA 3LHTA 2V2HA 3ZJKA 4AD2A 4AXNA 4DQWA 2GVLA 2A5HA 3N9KA 2Z6IA 5EFFA 3LCHA 1W1YA 4RZ4A 5HQEA 1G01A 4F8XA 2JALA 3BCDA 1A49A 1CGYA 1TVLA 4GGHA 5M2FX 4ICNA 1O7AA 2R1MA 1OJXA 3GC5A 1WYIA 3NQDA 3TW9A 1PIFA 3SY5A 1MW0A 3EKZA 1LJYA 2VC7A 1NELA 4GNJA 2VR4A 3UG4A 5F1VA 1LORA 3PNZA 2ICSA 5K4XA 3REQA 3DH7A 4ZTYA 4JQ3A 4A3HA 1US2A 1PKMA 3S3GA 5XIAA 4AF0B 1ZU8A 4YHEA 1MNZA 1VR6A 1LRQA 3KL0A 5AECA 3C0JA 3PZGA 1SO3A 1W1ZA 3CTLA 2FIQA 1LBLA 4K1GA 1KM2A 2VP8A 1Q13A 4QS6A 3WMSA 1DXEA 4PCSA 5I07A 1J0JA 3UZYA 3UY8A 4XV0A 5DY2A 1MQQA 1NWUA 3HZ3A 4HNTA 4JQ1A 4R53A 1CIUA 3GC4A 3QYQA 4REQA 3W71A 3NQVA 2J62A 1LL6A 4ATWA 2FMOA 5CGTA 1S3HA 1S5MA 1U2YA 2JEPA 4TO8A 1R6WA 2IKIA 4NAEA 4RL3A 4QBXA 2ACQA 4NX5A 3KRBA 2AKZA 4QDPA 3OLGA 5AYYA 4KGLA 4QISA 2V3DA 2F38A 4N9DA 3PN8A 3UWVA 3LM3A 4ZOCA 4HNUA 4ACYA 2XFRA 4V28A 4XZMX 1PX8A 3WJZA 1JCMP 4PB3A 3CMGA 2J88A 3R7MA 3BW3A 3SJ3A 1X8CA 2DSUA 2ZDRA 3O3RA 4NNAA 4QP0A 4XB3A 1B9ZA 3VOIA 5AVHA 1KCKA 1EC9A 3QEZA 3AYTA 3WDQA 3MSRA 3KFTA 1W3JA 3BCFA 1ZRQA 3BAKA 3UZWA 1Y65A 4HYVA 1EGMA 1RK6A 5FEXA 3KM8A 4K38A 3EX2A 3TQPA 1O95A 3ZM8A 3W75A 2WM1A 5F2LA 1XIBA 2ZRYA 3QC3A 4AC1X 2XVLA 2QQ6A 1LYXA 3QJAA 4UTFA 4W5ZA 4GBUA 2YXOA 1M6JA 1R3RA 2E8YA 3HPAA 3K1DA 4K1WA 3KOZA 5KTLA 2X7WA 3ZLHA 4P8UA 4AYGA 2WANA 4AHQA 4MNJA 4HMDA 1SPQA 3AHYA 1P4CA 1HL2A 1EZWA 4O19A 3LS9A 2DUXA 6TAAA 3BK0A 2PC8A 3K4AA 4CNUA 4OT7A 4NZ1A 3F5KA 4WDTA 1HL8A 2VGIA 2VZSA 3M0KA 4TV6A 4JQ4A 3UCCA 2CXGA 5HWJA 4R7JA 1FX6A 4DF1A 2PBOA 4HSNA 4C7GA 1UD3A 2EGZA 2WW5A 4JYDA 1MNSA 3H4WA 2HISA 2V67A 3NL6A 3T09A 3O6YX 2QCDA 1ECQA 3V1HA 3WNKA 2QIIA 1Q45A 3FY1A 1CW2A 1TE1A 2PODA 4D6DA 3PZNA 3T0AA 2D20A 3G2GA 2FH6A 4JS3A 2VVNA 4FMVA 1M5WA 2YCIX 4RXFA 4XKYB 3HFTA 1HG3A 2GSJA 4H9XA 2WZIA 3LCLA 3W88A 4V33A 3EXTA 3ITVA 3L4YA 3WEZA 1MRQA 3ONBA 2YB4A 4TX9A 2QMJA 1P0DA 3M16A 6TIMA 4LANA 1OYAA 3GNXA 3N4EA 1H60A 4POCA 3TCSA 3F2BA 1GYNA 5FF3A 3RLUA 8CGTA 1DJIA 2D3NA 4D8AA 3AIBA 3MJMA 1WQ5A 4FNQA 1HJQA 4K39A 4MWAD 3DI1A 3APTA 4O0ZA 1WKYA 2OT1A 4HK7A 3B9NA 3ITOA 1TQJA 1GNXA 3THDA 1JPMA 3PP7A 4NG3A 2NSXA 4CVUA 5IBXC 3PZTA 4M6QA 1HJSA 3IV3A 3N12A 5C7VA 3FJNA 4IF2A 3W25A 3L5AA 5C2XA 3UXAA 2NSOA 2QAPA 1WXJA 2HK1A 5AYBA 3C0SA 1DP0A 2VWTA 2HNHA 3PZMA 3R6IA 4NJGA 2JKAA 1XR2A 4DUOA 3AJ7A 2V82A 4WLCA 1ZUAX 4NT0A 3W7MA 3AYSA 2OG9A 4JIHA 3HQ1A 5HQMA 1C3FA 4U4MA 1XIDA 4PH6A 1XD0A 4S3FA 2YA1A 4L56A 2C7FA 3GVWA 5MHBA 3K1GA 3OBEA 1QWKA 1F6KA 4IOTA 2VT0A 2NV1A 6REQA 4H7VA 4QE4A 1I60A 4W85A 1DL3A 2VQTA 2PDKA 1RZMA 1GK8A 3KLLA 5CGMA 3E1F1 2ONEA 4PUEA 1M41A 4AEFA 4ZO9A 1OG0A 1E9YB 5BU9A 1OFRA 2OYLA 4FOUA 5FJUA 4JTRA 1VFHA 1FRBA 4DJDC 1AH0A 2GVYA 4AQLA 3Q58A 5KZ6A 4LC8A 5FL0A 2DJXA 2WWCA 4IH3A 4LUSA 3F7JA 4O50A 1OX4A 3AOFA 3IUHA 3AIVA 3PJWA 1IEXA 1QTWA 3LTSA 1KGUA 2VMFA 4A2SA 1KV8A 4CKQA 1OGBA 3CLWA 4AY1A 1BAGA 1HKIA 1CCWB 3KE0A 4UFMA 1GEHA 4JPGA 2JFEX 4ML4A 3OO2A 2CLHA 1X97A 2G4JA 2LLEA 1ADDA 1FP9A 5BXRA 1VQTA 2FZDA 2BSLA 3HO8A 1RPXA 5CLTA 4MMWA 3VUSA 1V51A 2EBNA 3IARA 4DWSC 1DWFM 1G69A 3HU7A 4B4HA 4D6JA 1NEYA 3V5FA 3VKDA 5A8QA 4GG9A 2IPGA 2ZA3A 1PVNA 2QGYA 1BEUA 3P74A 1GT8A 4R9XA 2PDNA 2RJHA 3RCNA 4WOZA 1VPQA 2V30A 1W1TA 1SZGA 3FGCB 1DJNA 4JTUA 4DI9A 4PODA 3IK4A 2H6RA 4PB5A 2WQPA 2QYGA 2A3CA 1UHVA 1GVIA 1K77A 1H50A 3JU2A 2YW3A 2ZE3A 2IPJA 3B05A 1UZHA 3OZPA 2E09A 3HGJA 3G1RA 3IRDA 3LLDA 4IQLA 4QRNA 2EF9A 3T40A 2PDWA 4LYKA 3HG3A 3UR5A 1MZRA 1X1ZA 1C8YA 4R7OA 3NQ2A 2WVTA 2VI0A 2PDLA 4GMEA 4ERIA 3PK7A 3R79A 3H8AA 3NQ8A 1RCQA 2PGRA 3BLDA 3WJSA 5D2WA 3MW7A 1PWMA 3LM7A 1E4NA 4QM1A 1A50A 4RV3A 1YTDA 4JTSA 2V63A 3DN5A 3VVGA 2Q8XA 1O5QA 1MO0A 1XCXA 1XLJA 5DY3A 3VAVA 4OJYA 2C0AA 4MZ1A 4PGLA 1UUMA 4DVOA 4TU1A 4AX7A 5I23A 1BYAA 1VPXA 4G7EA 1UC4A 3N17A 1JUBA 3GE7A 4B16A 1YQ2A 4ZQOA 5D9OA 1K4GA 2Z7KA 4IGHA 4RNIA 1RJQA 5JIWA 1TKKA 3AZTA 5B80A 1EJRC 4JFWA 2XDFA 4IIHA 1JF6A 4GNKB 3VIOA 2O55A 1ISYA 1W5MA 1POKA 3VKCA 2QR6A 3MKVA 3QXBA 4JKLA 1JYVA 1UR4A 5LNVA 5AC6A 3VYLA 3O6AA 2NQLA 2W91A 3HM7A 3W02A 4H19A 2JF6A 2J7BA 2JE8A 3I65A 4O13A 1IXQA 3ORWA 4F66A 1QAPA 4L1WA 1XLBA 1Q85A 2ZRWA 3P80A 4IGMA 1JUEA 1ZJHA 4WKAA 4JL1A 1W1A1 3WLPA 5MKGA 3WUEA 4B2DA 2W63A 1IEVA 1FTXA 2ZVRA 4MG4A 3AO0A 1WKDA 3RYSA 1FWCC 4JYEA 2YW4A 4GH3A 3WLHA 1DJHA 2E9LA 1EJVC 1BFNA 3GSMA 4MY9A 4AIBA 4AYSA 4A05A 2DGAA 3EPOA 2J74A 4OBSA 4RW3A 1EZ2A 5L6UA 2KX9A 4IZGA 1CB2A 5A69A 1GVFA 4ZBCA 3GS6A 3L68A 4HK5A 4BI6A 4FALA 3LX9A 4UR9A 4H8VA 5HXMA 3H24A 4MUZA 2BMBA 2YB1A 4HYRA 5JUVA 3NYZA 4HOZA 3G6MA 3O9NA 3HQNA 3M5ZA 1W5OA 3L4ZA 3C8FA 3UGRA 3H7RA 4HPGA 3ITXA 1EOMA 4RR4A 4Y8EA 1YPFA 3B9EA 3QW3A 1XYLA 3WO8A 3SO7A 3VCNA 1P48A 3W85A 4C6JA 4BHYA 1JRCA 4EWND 2IQTA 1LUCA 4Y9OA 2FH8A 5KMYA 1EC8A 1HKKA 2J9XA 1NFBA 1HUVA 3SCUA 4NKCA 3MMDA 3WQGA 5AY7A 4NXKA 1VCFA 5DMLA 2Y8VA 3QY6A 3B8WA 3HGRA 3DDMA 1UR8A 2XJ7A 3PFRA 1Q3NA 1XPGA 5CPMA 1ONRA 4LUYA 4K7VA 3BXWA 3FA3A 2V38A 4NNBA 1SFLA 3A21A 5D8ZA 4AG0A 2VEKA 4HNLA 1JXKA 1PTGA 3NCOA 3MHGA 4GGBA 4FI4A 2PAJA 1BPLB 1EBGA 4MOZA 4C5ZA 3QN3A 1TJ0A 2CESA 3CL8A 4WX2A 2YGYA 2TRSA 1ONXA 2A3LA 4UOZA 4ADUA 1RA0A 4L6OA 1LOQA 3KCLA 2DZTA 2ZTKA 3FK4A 5IBXA 4WY0B 1GTHA 2Y7FA 2PGFA 3WQVA 1Z69A 3WQDA 4CU7A 1XGDA 4CLMA 1TYGA 4UTLA 5DANA 3DEQA 4RXGA 1XDMA 4M56A 3T42A 4FR1A 5E70A 2ZUUA 5C55A 2DZXA 2DVXA 3K2GA 1YDYA 4O17A 2QUUA 3G1YA 3W6MA 1YBQA 5AN7A 2YBUA 3EX4A 4RNJA 3G0SA 3SCOA 2H3BA 3CZKA 1OFAA 2GUYA 2DVUA 4JY9A 4GKTA 2PU0A 2QJMA 5A6MA 3IJDA 4FLQA 1OF6A 1SZNA 5LA1A 3H12A 2V5LA 1N8FA 4B3ZA 2YDAA 1UUQA 2ZRZA 4JIRA 1ITQA 1CGUA 2BX7A 5ABTA 3M0YA 1E5NA 2O0TA 2TMDA 4XX6A 2RGLA 3R1ZA 4IPLA 1E0WA 3NGJA 4J3XA 2GQAA 3CUZA 4NILA 1WXZA 1J0IA 2Z0IA 1KXTA 3OLDA 2GQ8A 3VKJA 1W37A 1UOZA 2F61A 4FNRA 5D2TA 3VA8A 4DJDA 3G8RA 3R8RA 2GK1B 4QNEA 4JHMA 1SR9A 3SCPA 4P5UA 3WK1A 4XZWA 1V6UA 4WZHA 3RK8A 2C3ZA 2PWGA 3QZEA 3VZZA 2ISSA 3I3EA 2DEPA 5LGZA 1A0EA 2VCBA 2QV4A 1JZ5A 1LLOA 1SW0A 5LA2A 4ZE5A 3MQTA 3NOEA 1S2VA 1EOKA 2YCKX 1W17A 1CT5A 3WF0A 3WH7A 4E0CA 2HS8A 3SRFA 2F2KA 3P5YA 3I68A 1AZ2A 1A5BA 3WQOA 1KGXA 2J6XA 4Q4PA 4ZO7A 3EOSA 3LZ3A 3M5XA 4DWSA 5CPTA 4TX8A 2Z6JA 4PFHA 2Q8ZA 1TIMA 4DBEA 2C19A 1QNOA 1DIEA 3M0ZA 3QGAC 1ZENA 4UOQA 3VNZA 2FB3A 3RU8X 3WQCA 3BO9A 2QF7A 2PGWA 4DZIA 1Q4NX 5F2GA 4YHGA 2DU2A 3ANVA 1UMYA 2H9AB 3PBGA 5FJPA 4YU1A 2XIIA 3H22A 3NQ6A 4GQ0A 4C1LA 3HGSA 2OZ8A 2EPLX 3DHDA 4LXFA 4S3BA 1K7EA 3N9RA 1SMDA 4HZ7A 1JVNA 1ME8A 1FWIC 1H51A 1TWSA 2IPFA 5DEZA 4ZVJA 4AZ5A 4BS0A 3NDZA 3DFPA 4WGXA 5A6LA 4K8HA 4MJMA 4GUIA 4ZEPA 1B3VA 3EOEA 1GOMA 3CIVA 4E8DA 4DJFC 2A6LA 2AL2B 1K6AA 4I9JA 3C2YA 1V7YA 1K02A 3GG8A 1WDDA 4BR1A 3LEPA 3H23A 1K9DA 3M5VA 4RE0A 3BVJA 2Y4SA 2VUYA 4MJ2A 4FB7A 4GFIA 4HYWA 1GORA 3L4XA 5G2WA 2F8QA 3ARXA 1E4MM 4O28A 3WBXA 4TV5A 3N18A 3TONA 1AFSA 5DMNA 1UROA 5TQLA 1G1YA 1SO5A 4D6FA 1K7FA 7REQA 1UPPA 2E1WA 3O7UA 3OIHA 1ZBKA 3U5UA 4XD4A 1RP9A 3BC9A 4GCXA 4GHRA 4X22A 5I7GA 1XLAA 5CAKA 4OBRA 2P5NA 3NXLA 2WSPA 3TJ4A 3E02A 2G8ZA 1W3IA 1KBIA 1TFVA 5F2MA 2DUAA 3GXFA 3MKKA 1CZ1A 1J8VA 2BV9A 2FFCA 1HGWA 1EIXA 4AZCA 4DY1A 2D2GA 4HB7A 3UA4A 4HHPA 3MANA 3D3AA 6ENLA 3NWRA 3DYMA 1OD8A 1QU4A 2FDMA 3C86A 3FKRA 4Z1CA 4G6CA 1DQXA 3NIYA 3NQCA 1A5CA 1Q6OA 1KXVA 2Z2UA 1F2JA 5LYRA 2QIWA 1PV8A 1WZKA 3DZ1A 4RUBA 5TNVA 1H49A 4G1NA 1E4IA 2JBMA 1PXGA 3UQNA 3RMJA 3I3BA 3H2EA 3GXDA 4WR3A 4ZFCA 3QKZA 1BKSA 1E55A 4B90A 4FPSA 1F4AA 5CCZA 3AALA 4UNLA 3VGFA 4MNKA 3GXNA 3FYOA 3KEHA 3V16A 2QXWA 3BLEA 3NJ3A 3IJQA 2D2OA 2O4MA 4YXGA 3CB8A 2VX4A 1GCYA 2MANA 3NM1A 1PCWA 3A9BA 1XSKA 3CLMA 2WMIB 1N8IA 3TW7A 4ZB5A 1XUUA 1TPB1 3QR0A 4ASTA 2XZ7A 2CW6A 4LYQA 3GQYA 3NL5A 3C2FA 3EDDA 3OTRA 1VS1A 4YTUA 1C8VA 3TNOA 4CU6A 3DHPA 1XG3A 1H41A 2XFFA 7TIMA 2V5DA 3GAYA 1JI2A 3AU2A 3RITA 3QV9A 5U7SA 4ERAA 4AWUA 3O0FA 4J4KA 4FK9A 3UU0A 2P53A 3W7CA 2P1FA 1TX2A 3GZ3A 4L6HA 4UTMA 5HATA 5HJLA 1U83A 3VD4A 3A12A 4A6GA 5E93A 4F48A 5H91A 3QV6A 3ARVA 3DESA 1XQLA 2WMJA 1SM9A 4TR9A 4O1EA 3WUGA 4FLOA 1DBTA 2OJPA 3N19B 4GZIA 3KOFA 2H8ZA 3KZSA 4UMCA 3KVKA 3TXVA 1VLWA 1RAKA 4R85A 4QLLA 1GVEA 2Q01A 4I7WA 3UR8A 4DLMA 1GG1A 4Z2KA 1DPMA 1QVBA 3H2CA 3SCRA 1OYBA 2QJJA 4MLJA 1ZY9A 1J96A 5XIMA 2VZUA 4MB1A 3LG3A 5AHFA 4KF1A 1C92A 3CZ8A 4LAMA 1CPUA 3KX6A 3DIPA 1IEWA 3NQMA 4XKYA 5LZLA 2CZDA 3VD3A 1TJ1A 1JCYA 3TYUA 1KWKA 1WXYA 5HAOA 1A3WA 1SZRA 1EJXC 1V6YA 2IKGA 3ZJ7A 5JBDA 2GZXA 4OTKA 1YADA 3IS4A 3NZPA 1S2AA 3O0KA 5FACA 1YNQA 3N15A 3P8IA 2YX0A 3SUSA 4DM1A 3SIZA 3CQ0A 1GW1A 4PUWA 1UA7A 3EWYA 3EMZA 2WBKA 2YLAA 4N42A 1VJZA 1C29A 1V3MA 2Q02A 3DGRA 4QG8A 2D0GA 4OIFA 5E0KA 2W5FA 3CZLA 4M80A 1X98A 4LW7A 4JTLA 2Z27A 5BWAA 3UJSA 2HBXA 1W2VA 1K70A 2R6OA 4PUKA 4Z1DA 3PPFA 5DBUA 5A2AA 1NDVA 3VNMA 4NHVA 2FMNA 3RLHA 3GFXA 3FHAA 4HQVA 2EAWA 5HUOA 3CZEA 4C6MA 3WQPA 3IEBA 2WPGA 2OQHA 1SSGA 4IFKA 3LCIA 5HJYA 1JPIA 2XVPA 1E0VA 2PWVA 3C2OA 3QKEA 4GNVA 3CWNA 5E6YA 3S2NA 3VPLA 2AAMA 1C8QA 3EYPA 3QOMA 4N6EA 2CKRA 3SUUA 3TK7A 1V4YA 1F05A 1KFJA 8RUCA 3W86A 4FOJA 2ZYFA 1NWRA 1VZWA 4FR6A 1BLIA 1GUVA 5G1YA 4FX6M 3SCVA 3EDJA 4IUGA 2NZLA 3MHUA 4HJFA 5AC8A 4PL2A 1R9XA 1O1HA 2VRKA 1E15A 1CENA 1VKFA 4KEZA 3P0WA 1UWAA 4O4VA 4Q8NA 5G2HA 4QJ4B 2Y62A 3WIJA 3W28A 2DT1A 3F5JA 1SUXA 2VR2A 1XV8A 1Q6CA 1P0BA 1R38A 3VDBA 4JQAA 3TFXA 1RA5A 4B4FA 4TUFA 3SUTA 2DSKA 1NF0A 1UR9A 5BRBA 1TELA 5B7ZA 2D0FA 1UH3A 3QHOA 4S2CA 1V0NA 4B92A 3LERA 2EG7A 1F07A 3KDOA 2Q71A 3KL3A 1TPC1 4OWGA 1J11A 2O9PA 2GWNA 1OHLA 3O07A 4UFIA 2PDUA 4U31A 2GGJA 2NLIA 3PZUA 4C6KA 1Q66A 1W9VA 2V2CA 1XM3A 3B4UA 4O4WA 3V36A 3VFCA 5TBOA 1SZEA 4L4PA 3LSCA 3W7QA 2Y70A 1LP6A 4UFKA 2WJZA 4ACZA 2GJXA 3TVAA 2VKZG 4AXKA 1MUWA 1XSIA 1NF7A 1LROA 3DYOA 4A3QA 4EPKA 4DYEA 4AB4A 4ZSTA 1Q65A 2CBIA 1O5RA 3FW6A 1S2UA 3B06A 3GU2A 4BA0A 2BNJA 2CNCA 4GVHA 1TZZA 3N4AA 2ZZ1A 4NF7A 1BG4A 1EUAA 5KEZA 2GQ9A 5D4YA 4TTUA 3MUZ1 4DJFA 1PIIA 4NRSA 4YTTA 1MXDA 2IUZA 3NQGA 2ZRUA 1XINA 2X1IA 3CWOX 1LQAA 3W29A 3PWIA 3OZYA 4GJ1A 1XLCA 5A95A 4AD1A 4HU4A 4L9ZA 1H7NA 1FBAA 4IIDA 4J40A 2OB3A 4EWJA 3R8GA 3W2LA 4X2PA 3MO4A 4D1IA 1B3ZA 3S5SA 4EP8C 4HHHA 3WMCA 3L4UA 3F4VA 3RR4A 3G1HA 1TG7A 4JIQA 5DELA 2WHLA 4GI9A 1M7OA 1QJWA 2RDXA 3BPWA 1KFKA 3NURA 4AU0A 5I0DA 1W5QA 4ZO8A 4AWEA 3JZUA 2WXDM 1A4LA 4XISA 4NYYA 1Q7MA 3ZMRA 3CH9A 2DT2A 3A4AA 2CFFA 1FWAC 2PDGA 5I3GA 3I4EA 3U0HA 2JGYA 1RJRA 3IIPA 2VFEA 4JFVA 2ACUA 2ZQ0A 4ZR8A 2E40A 4RJEA 2Z1KA 3I3DA 5A6TC 1H7PA 3CIWA 3OQ8A 4GY7A 3LBCA 2XH7A 3S6OA 1ZTVA 1ZNNA 3NSNA 1JQXA 4KKXA 3M6YA 1WUEA 2ALDA 4TOQA 4JHOA 5BCAA 1UC5A 4HHMA 4MKSA 1P0KA 3MUAA 1EXBA 2JEQA 4ES4A 2V5BA 5HPCA 4KQNA 2RUSA 2W67A 3EDKA 4BI5A 1EQPA 3RF9A 3PWAA 5CSSA 1Q6GA 3EOLA 4UQEA 1Z48A 5AHNA 1QK0A 2J4GA 3MV11 3N3MA 3T7VA 4BEQA 2J77A 2FZBA 2J79A 3P14A 5A2BA 5MF5A 2G41A 3EDFA 4H6EA 3THAA 4QLKA 1ISWA 3ENLA 2XM2A 4UB9A 3KZPA 1R85A 5KZMA 2VFIA 4QHRA 2FPVA 4MYXA 5EMLA 4NZFA 4GYPC 3AWNA 5KINA 3W7GA 2NVCA 4AD4A 1MWOA 4PMVA 2FGZA 1D2KA 4E2VA 1LT7A 1UZ4A 4HSOA 3UYCA 3L5LA 1AZ1A 1S1RA 3URQA 4QCEA 2XIQA 1BG9A 2ADAA 1OK6A 1XLMA 4S3CA 3LPGA 5G1TA 4G9PA 4PUNA 3W2MA 1GKPA 2J6VA 3WF4A 3HGOA 3S5NA 2XGBA 4OOUA 1XG4A 3P60A 1FFRA 4Z2JA 4I7UA 4H9YA 3TN4A 4XD3A 1U1UA 1QBBA 3AWOA 4WVXA 3UGVA 2HVOA 1ZJIA 4EXAA 4N6FA 1VBJA 2J8TA 2XSXA 3MHFA 2GGIA 4UTTC 2OQLA 3PJTA 2CHNA 4L4MA 2YKKA 1XDLA 2E6FA 3KBWA 4ALDA 3E0VA 4RDVA 3RRAA 1S46A 4PMQA 4NIRA 1YDOA 1I2NA 1HKWA 3KWXA 1JEZA 3WMLA 1XGZA 3WQ6A 1JZ2A 2PGEA 1TWWA 1BRLB 3AICA 5CSUA 3TMLA 2CLOA 1K6WA 1I2RA 2GVJA 2WSKA 3OVQA 1E56A 1J10A 5HK4A 1BSIA 5C0QA 1V3LA 1SJDA 2NXIA 4C6DA 3A4JA 1B90A 3RO6A 3KCOA 4B5WA 1X1OA 3ERPA 5FOOA 1YEYA 3I6TA 4J1OA 1TA3B 3QOKA 1TPEA 4D1JA 2ACRA 4XZIA 3RM9A 2ON3A 1NP2A 2EPKX 1P1MA 4A3RA 4P7RA 2WSQA 4HKPA 1E4LA 1JZ7A 4E38A 2V6AA 1RQEA 1VYRA 1GHSA 2R1NA 3AXKA 4IP7A 3G24A 3HV8A 4DI8A 3BQ6A 4AY7A 1R3YA 2E3ZA 3UZZA 5T91A 2E25A 4PSPA 2PRHA 4W9TA 1VBHA 2BP1A 3C2EA 2C79A 3A3HA 1ZQ5A 3V75A 3KRUA 4MWAC 3EBVA 2PWEA 2VRJA 3GH7A 4RZ6A 4O12A 5L9FA 4P61A 3L9CA 2CLEA 4GZEA 4J3ZA 4W7VA 3W73A 1ESWA 4GIAA 4Z0SA 3QRHA 3W7EA 4UZSA 3AMLA 1Q8JA 4LAZA 4QIUA 2J9YA 1XI3A 4L9XA 1E1CB 3LXAA 4O1FA 1YYAA 1C9DA 2OLSA 3DHUA 4D8LA 5DT5A 3TJLA 2X1UA 4IL0A 3CV7A 3VKKA 2A7RA 3CPUA 3KTXA 4EE9A 4Q8VA 4Q6JA 4C6NA 2G50A 4V1XA 3UG8A 2XVNA 4PRTA 1R3QA 3QY7A 4WUIA 3IRSA 2O9OA 4NXSA 2PBGA 3G3DA 1XBVA 3OGVA 1J4EA 3WLMA 4PBFA 3RUBL 5REQA 1GHRA 2NW0A 3T81A 2O7QA 2YCEA 1E9LA 2A21A 2OX1A 4C6IA 3OG3A 1OSEA 2JIEA 2E6DA 3REQB 1V77A 3I6RA 1PDYA 4US5A 1IZJA 2Y5EA 4XD6A 1NOWA 3KVJA 3PTMA 1NU5A 2NWSA 3VGHA 1GYMA 3DENA 4CD6A 5BRPA 2PCEA 1QWGA 1YTKA 4GACA 2PUZA 3LZ5A 3E2QA 2ISWA 4PMUA 3BICA 2CLPA 2CZ5A 1IE7C 4MFEA 2PDFA 3AYRA 4L4OA 3KS5A 1LL7A 3W7IA 3SADA 1BD0A 4C6OA 4Q32A 4REQB 1I0BA 4GABA 4Y8FA 4HGXA 3ECQA 3CO8A 5EMJA 1EDGA 3H55A 1J0KA 1DXFA 1K9EA 4GIRA 4L1GA 3GXPA 4JKMA 1H62A 2BHUA 3IGSA 5EFDA 3VDGA 2PC4A 3WH5A 5EBUA 3U2CA 3L7RA 4B5UA 5CPOA 4JTCA 4A8LA 3TSBA 4WCJA 3MVTA 2EEXA 2NX1A 5HANA 1F5ZA 3H6OA 2OEMA 1B3XA 2OXNA 2UY3A 1FY6A 3WLTA 4H01A 5HNRA 1EF3A 4GVIA 2PDYA 2QCCA 3BOLA 2VXNA 4LYPA 3WQWA 1GOKA 3T78A 3A4WA 3UXLA 1RD5A 3XIMA 2WKGA 4OZOA 2A0NA 1XLDA 2D23A 3V5OA 3KP1A 1EBHA 3S1GA 4NAFA 1POJA 3VZXA 2Z29A 1A5LC 1R7OA 3DOPA 3BLKA 1Z8AA 3GIPA 3ATYA 1B3YA 4DF0A 3HG4A 4AZHA 4M6VA 3UPMA 3LB0A 4PMDA 3N6HA 1VGAA 3GH4A 1H5VA 1CX9A 3W7KA 1OCBA 4MNLA 1HFBA 4I6KA 2DZWA 1JD9A 4Z17A 4JTFA 4QFUA 3W2NA 3CC1A 3H4GA 3VOJA 1FQ0A 5I77A 3GKAA 3NSMA 3WEOA 3W70A 2BGNE 3BMVA 3SZ8A 1EXPA 4IIEA 2QT3A 3LENA 3Q94A 1CDGA 3AUOA 1EJSC 5LA0A 2Y7GA 2B7OA 4MGGA 1PZ3A 4IUOA 2CWXA 1R3VA 4J5NA 4YVXA 3E96A 3THUA 2OODA 3LDVA 4MADA 2Z24A 4GZ7A 1W8GA 2Y1HA 1UA3A 1WP6A 4WJEA 1IT0A 4D8ZA 4WKFA 2VHLA 1OC6A 3BMXA 4TMBA 4CQ9A 1KM6A 1TV4A 1AD1A 1V03A 3SN1A 3Q65A 1VFMA 3MS8A 4CD4A 3SCWA 2B7PA 4GYPA 1CLKA 5HR6A 4PULA 1ALDA 3MU7A 3F4NA 5TF0A 1WOBA 3W7JA 1PIGA 5ENLA 1GOOA 2NQHA 3L0KA 1ME7A 4ROQA 1EPXA 2A79A 3OVGA 5LNSA 3ZLGA 3MB9A 5F7UA 3AISA 4V1YA 3RILA 3LGGA 4BF9A 2UY4A 5CPNA 4I8DA 3U6WA 4MAVA 4DRSA 2C8NA 2I9EA 4BEUA 1UZDA 1Z7AA 2Y8UA 2CLMA 1W3KA 2OOGA 2Y5SA 4N02A 1VFLA 4PUDA 2B31A 3CQKA 4JGDA 3F2DA 1VP5A 3WBYA 5HMEA 4YTRA 1JCTA 1XCFA 1K4HA 4BI7A 4Q8MA 4KCUA 4H8NA 3UZJA 4UTTA 3M64A 1CI1A 4LTSA 4JIIX 1V02A 4X9SA 1GVSA 5KITA 5CKSA 1IZKA 4NP7A 1MW2A 3N34A 3OODA 2YXXA 1XCWA 1KFLA 3LCXA 1UW9A 3APGA 4O15A 1SQ7A 2RKXA 3WNNA 4QTGA 2I1OA 3BZGA 3SEPA 3NTYA 1NM9A 1H11A 1ZLPA 4GRSA 4U3AA 1QASA 3MZNA 3VI2A 3I7QA 3ARWA 3LV5A 1BVNP 4F2BA 4HIBA 3IK2A 2AGKA 3DYPA 1XFBA 3DFQA 1T40A 4MB3A 3TTSA 4IJRA 1XHGA 1V6TA 3ARPA 3B9DA 3PF3A 4CCZA 4M5PA 3D47A 4DYJA 3R4IA 1NIUA 5BW6A 2WMKA 2CBVA 1Q6EA 4CN4A 3WDIA 1IIGA 5TAOA 1QT1A 4G1KA 4F0RA 2Y0FA 4NRRA 4A8NA 4H2CA 4D72A 5CC6A 4HJWA 1QI0A 2CC0A 1E6ZA 1ONEA 2GJRA 6REQB 2D1ZA 3GU1A 4LSBA 3U4FA 1F61A 4IQDA 3GHUA 4CQ8A 1TR1A 4W84A 3W3OA 2BOGX 1B5TA 1GQNA 3FAWA 3T2QA 2WMFA 1DTUA 3PUEA 1BSLA 2HV5A 5C8BB 2WVVA 1US0A 4MWAA 1I45A 2VX6A 3T0TA 1Y5XA 2WLZA 3PUDA 4GOAA 4LV4A 4LUSB 1OX4B 3CGTA 3UY7A 1NQ6A 3LY0A 1E6RA 3CUGA 3TW6A 4R34A 4OQVA 1EX5A 4CCEA 3BLIA 2DH3A 2PP1A 4O10A 2F7FA 3TH6A 5FSEC 3VMPA 1RP8A 3CTTA 7A3HA 1UIOA 1G7VA 2G0WA 3ID7A 1JGMA 4ZB0A 3GDBA 2Y85A 2Q6ZA 3LCGA 5LIYX 1H7OA 2J75A 4RDYA 4RPPA 3CAWA 1WDWA 2WJFA 4XAFA 1TTPA 1EWEA 3FDKA 4ZQPA 2QDHA 3N2MA 8A3HA 3L2MA 4NZ3A 1IWBA 3WBWA 1UKQA 3ZZ1A 1VF8A 4TVUA 3FEQA 1RBOB 3CZJA 3FOKA 1HT6A 4MSSA 1IXNA 2Y61A 1P0NA 2VEFA 1WAWA 1E3XA 1D7FA 4F3HA 1EO5A 1XIGA 4F9JA 2YJQA 3JZEA 2DH2A 4QSHA 3SJNA 3JS3A 4X60A 2J13A 5FEWA 3UW6A 3EX1A 3FYPA 4I5UA 2GVEA 4E4PA 4U10A 4Q4RA 3M9YA 4HTBA 2DZVA 1YDNA 4Q4SA 3S6TA 2TYSA 4ZFMA 1Q4WA 2Y24A 3IACA 1NFPA 2ZRXA 4PCPA 2IXUA 1M53A 2WZHA 3LHVA 1K3UA 3GRIA 4Q8PA 5IXEA 3E38A 1UD6A 2QW5A 1EJTC 3VDCA 1PJ9A 2FPTA 3M4HA 3HN3A 1FKXA 3UG5A 2CLFA 3BG9A 3CV2A 5BOFA 4NYUA 1QI5A 4XG1A 4B5NA 5H8UA 1CXEA 3PSWA 4EXQA 5DN1A 1QFEA 3BLPX 2R82A 1GGOA 1H0IA 1Z89A 2QCLA 3RCYA 1SFJA 2HK0A 3SUWA 1W9DM 1RCOB 3IGXA 1JCLA 3NO1A 2R1LA 4G7EB 2HRWA 3WFZA 1SFSA 3QR1A 2ZXAA 2I17A 5LXXA 3G5EA 2BTMA 3GG1A 1JFXA 1H61A 3QFEA 3QPEA 1D9EA 2HNEA 5A8NA 3DFSA 1GEQA 1KTNA 1LL4A 2E77A 4LPCA 4C1KA 4FXJA 1PSCA 1PB0A 4IJCA 1OY0A 2E0PA 1SJCA 1IF2A 3VC5A 3A47A 4OV9A 3Q4DA 1QDSA 4DXXA 3U2EA 3C3UA 4GCAA 1OZQA 1IR1A 4M1BA 4X2RA 4O53A 2VM8A 3QGVA 3VNIA 2ZWZA 1SZFA 8TIMA 4F2UA 2ANUA 4PL1A 2A7NA 3AZSA 3NSXA 3EWXA 2FQIA 3GIYA 4KS0A 2QLYA 1I6NA 5D2YA 4F0LA 1RV8A 4Y96A 1FH7A 4GKLA 4IPIA 3WF3A 4DAIA 4GY0A 3TP4A 2ZUWA 2PF0A 1EX1A 2I56A 4HZMA 4DN1A 2RHGA 4JBRA 2INEA 5C70A 1P6WA 2WV8A 3RFAA 5LIXX 1RY0A 4ZSUA 3GNRA 2WCGA 2R24A 5H8PA 3ZWTA 2QUVA 4YLWA 3P81A 1EEPA 2EG8A 4A2RA 3GVRA 4IXHA 3KRZA 2AGTA 4ZOEA 1GQJA 1IGWA 4QEHA 3HB9A 3P61A 1JL8A 4WF7A 4HMNA 2YDRA 2Z2AA 5DRCA 4NU7A 2BOFX 1I2OA 2FHCA 1H7RA 1F3XA 5AKQA 3COTA 3W9ZA 2ZKMX 2Y88A 3TQ0A 1ISZA 4E3TA 5K9CA 5FA5A 4PMXA 4X63A 3WD4A 1LUCB 3PC0A 4YPJA 4TQTA 2E68A 3LU2A 1TWDA 7TAAA 1O60A 5HR7A 2GSEA 3UWZA 1NY1A 2X41A 3C2RA 1EWDA 5HDRA 3L0NA 1N55A 3STCA 3IIXA 4TIMA 3B8TA 4XD5A 5DX7A 1H2JA 1JPDX 2VVSA 3AHXA 3WX7A 4FS9A 3N29A 5C6MA 1XS2A 1X8FA 3EXSA 3GDKA 4HSHA 4I90A 5DQPA 3RPDA 1GW9A 1OCQA 3G1VA 3GXIA 4B9ZA 1UP2A 3T07A 3GDMA 2Z1VA 2VUNA 3MCNA 5FF2A 3NYDA 3CPGA 4IMDA 3LMYA 3LRLA 3BLLA 4DM2A 3CUJA 1VFFA 3BW4A 1JFHA 1P43A 5H6HA 1I4NA 5CPSA 8XIAA 3PTKA 1MEWA 4MM1A 1M68A 3LBOA 4GYFA 2P8BA 2FJUB 1VRDA 3TN5A 2AQVA 4N7QA 5CZ0A 4I7VA 2DZPA 5LSMA 4KPLA 1YBQB 3OVPA 1QNVA 4O16A 5E9AA 1X6NA 3IJ9A 4JTGA 1FP8A 4GFSA 1XF0A 2PS2A 3A9IA 3NDYA 4HVXA 2A3BA 3NQ7A 4UXDA 1O12A 2P0IA 3WJXA 1AD4A 4QR6A 2OO0A 4UTIA 4Y6GA 4FX8A 1KCZA 4BK9A 3VE9A 2ZUSA 2YIHA 1FFQA 2ZCGA 3QZAA 3TWBA 3OHIA 1NSJA 4H04A 4LOCA 2QJGA 3CPRA 1BRLA 1RJPA 2QULA 5FSDC 1OX5A 1TE6A 2CEQA 1KQYA 1LBFA 4GZJA 1J0HA 1TMLA 3OBAA 2YZ5A 4WSJA 5T9BG 3WH8A 4O1DA 3PWGA 1IHIA 1XLKA 1J9YA 1C93A 4DBWA 1X6UA 2J66A 4IMCA 3C8NA 2C91A 1TMQA 5RUBA 1V8EA 4AZ7A 3TEVA 3GTIA 4AIEA 2G3IA 4QEEA 2XTKA 4DJED 2WVSA 1FWBC 1J2BA 4CN6A 1H3GA 2BVYA 3MYOA 4LVBA 4JDBA 4ZO6A 4H8UA 5D02A 2PZ0A 2VENA 4UMBA 4LVAA 3UT0A 2AMXA 4GJJA 1V3HA 4DWSB 1J6OA 2HJPA 1GJUA 2IW0A 1AQ0A 3V0UA 3WMBA 1MYRA 3KAOA 2BWGA 2INZA 1NOFA 2PLCA 1PO9A 3AYVA 2J7HA 4HNCA 1AK5A 1OBAA 4GO9A 5LIWX 2CZEA 1U5JA 2GWGA 2W4XA 2OWXA 4OGZA 3TC3A 5ABHA 1G9HA 2BOEX 2WOQA 3GYCA 4HNNA 4D6CA 2FLIA 2O4QA 4M0XA 3VILA 3GTNA 1EB3A 3QZ6A 4XAPA 3VMOA 3IVTA 5C2GA 3C6CA 2PRMA 4WIWA 2PDXA 4PSRA 1QBAA 4RNFA 3B0VC 3E12A 2QMKA 4UMAA 4M1RA 3U7VA 1A5AA 1F74A 4MLRA 2EG6A 4KH2A 4J28A 1FHDA 4LX4A 3TUUA 1CNVA 5CZSA 2JKEA 4LF1A 3H21A 1FHLA 1BHGA 4ORMA 5EA9A 2OR2A 4J27A 1EP1A 4M82A 2X8RA 1EA0A 1EDQA 1T8XA 4GINA 4XVDA 1CTNA 2IQ0A 3N73A 3CQHA 3VZYA 1FWGC 1E5JA 3WLQA 4C5YA 3P2VA 4JR5A 3T1GA 3V35A 1F73A 3SRHA 1VC4A 3EX3A 1ZZMA 3M07A 3CUIA 2X0SA 3GXTA 4AISA 2C16A 1KM0A 3SY8A 3L21A 4W8AA 3DAQA 2TODA 1SJBA 3LQLA 1LTDA 1GJPA 7REQB 1UP0A 3AJXA 5K9XA 3DCPA 2XG9A 3AROA 1ISVA 3UWWA 1G0CA 2RDUA 2R9RA 3TZNA 3LPOA 1Q6FA 1BYCA 4QJ1A 3G77A 1XW8A 2W62A 4XUGA 2BXZA 4R88A 4AZCB 3UXDA 4NJHA 3KOWA 1Q6DA 1HKVA 1GVYA 1M7JA 4B9YA 2GUUA 1G4TA 3TC6A 2DP3A 3RN6A 4O14A 3BUVA 3W23A 3EAUA 2XFWA 4BQ2A 2D22A 2PDBA 3VM7A 1U22A 3CU2A 1DQUA 3W2JA 3WH6A 6ALDA 4K37A 4GUGA 3NZRA 4HA4A 1A5MC 1OGSA 3EEGA 2FYMA 3AXXA 5PTDA 4JIPA 2PA6A 2G3JA 3EZ4A 3B3DA 2GOKA 2I5IA 2V5KA 3OYZA 4CD7A 1BWKA 1XYBA 3N6JA 1L8PA 1T8QA 1W32A 3SM0A 2BDQA 1CECA 3PTQA 1UB3A 1JAEA 3TAKA 1SO4A 4HPJA 4C6EA 2BASA 5EBAA 1PZ2A 4CNSA 2ZICA 4W86A 2VYOA 2PPGA 3MSGA 1Y8BA 4HOXA 1S2CA 5A8MA 1IT7A 3W1RA 3EB3A 1F3EA 1M9HA 2VX5A 2J9ZA 3MWAA 1ML1A 5KZEA 5JBFA 1HKJA 5K9DA 4DZHA 3GVVA 3ITTA 1DHPA 3ZOAA 3OG2A 1AJZA 1X7FA 1C7TA 3M44A 2XU2A 1OFEA 1W31A 2W61A 1UJPA 4AEOA 1K9TA 2B7NA 3ZYZA 3SGZA 5D05A 3CL6A 3POHA 3Q2DA 4FNSA 2P50A 1H1NA 5J04A 3UBPC 1MXSA 3UZXA 4LBUA 5CBJA 4P7NA 1FWJC 7ENLA 5JXQA 2X16A 4K68A 2XGIA 5A6SA 1NWTA 3V5CA 3L4VA 2A3EA 3OZMA 3ZWSA 2DPEA 3QBUA 1XIIA 3V3WA 4JEJA 4H9VA 3W7HA 3GR7A 1B4KA 5FI8A 2CHOA 1FWRA 1PBGA 3GR4A 1QATA 1E9IA 5J8LA 3GZAA 3Q45A 1EDTA 1EJUC 1E9ZB 2HCVA 4P8WA 3RU6A 3GG0A 2BB0A 2QHAA 1GG0A 2Z4GA 4KWOA 1AW5A 4LT9A 5FCZA 3N13A 4LAUA 3W1XA 4XVEA 4P7QA 4UR8A 1ZFJA 1DOSA 3KBJA 4AHPA 3HOJA 1MDLA 4AW7A 1J5TA 3GO2A 3JW7A 2E7FA 3UWQA 5EYWA 3SCQA 4J2MA 1VCVA 2BXYA 4F9DA 2OOFA 1OFBA 4G56A 3ES8A 3BTNA 1QCWA 1JD7A 2VWSA 2W6RA 1F4HA 1FWEC 2FZMA 3KUMA 2QV5A 1TUFA 3W72A 3R25A 1BWVA 1HO4A 4C6PA 5ABFA 3GUGA 3QTPA 3TX9A 4D6HA 3AXMA 3LV6A 3S1XA 2ZZ4A 1L0PA 1RK5A 3VGGA 3M0LA 1XIFA 2EPHA 3LGEA 2YCLA 1XYZA 5EMUA 3VABA 4EIVA 3CIXA 3WQEA 3P84A 4XBSA 5C9RA 1AJ0A 1BVWA 4LS0A 2H90A 2PLMA 3FAXA 3WL0A 1B3WA 2GDVA 4HT3A 3RMEA 1GOIA 3QQ0A 1LZOA 3V1PA 2FVKA 4I5RA 1W91A 4IFKB 5I3IA 3EA1A 3CK5A 3F4WA 1HZYA 1YHTA 4WJXA 1LOSA 1DE6A 5IHSA 3HPXA 3KBVA 2Z1XA 1EKOA 4F0MA 1HJVA 5EKYA 3BL3A 3WD1A 2HVNA 1PWLA 2QVNA 3SY1A 2XYLA 1H7WA 4YS1A 1TTIA 4CNOA 2B0MA 2DY3A 5C5YA 4UBPC 4F2TA 1E70M 1EA9C 2X40A 4OV4A 3IWPA 2FVLA 3VGEA 3L65A 2W3ZA 5C7HA 1MUCA 3UJFA 3SCNA 3DG6A 3ITYA 3VCRA 2GGGA 4PYSA 2OZ0A 3UWEA 3P8JA 1QR7A 2IKJA 2OQYA 4GVGA 4M7SA 1B0IA 4K8EA 3PBMA 1G5AA 2XUCA 1P1XA 3UFYA 1XRFA 1R47A 3O6DA 1G7UA 1QI3A 3U9IA 3U48A 4YIWA 1O94A 2DT3A 4LU0A 4PTNA 4U33A 2PZNA 1Q5MA 1RPKA 3T2PA 1TJPA 5FJOA 4W93A 5C9XA 2DQWA 3GH5A 5CBIA 1FWNA 3BSGA 1IEIA 4H41A 3TJIA 3LYEA 3ABQA 3G6LA 4QNWA 4ACZB 2DUZA 2GJXB 1ADOA 4JDYA 1JYXA 4Z0JA 3MBFA 4H83A 1EYEA 5FAGA 3VMNA 2OZ3A 3G1AA 1W1IE 4D71A 2NQJA 3W74A 2PDJA 1LWJA 3NPVA 4Z08A 2FZNA 2GJNA 2POTA 1I1XA 2J78A 1S3TC 3GLCA 3V7PA 4JTHA 4CQCA 2Y7DA 4PZVA 3Q37A 3K4WA 3M5YA 4UOJA 3LRMA 2ZA1A 9RUBA 4KFPA 2V5JA 4OU1A 2Q3RA 5M03A 1W1VA 3W82A 4RX0A 1UCWA 1IXOA 4I5XA 1Q6LA 3KP0A 2J7FA 1OEPA 5A1AA 5AHIA 4FX7A 1E3ZA 3S47A 3NR0A 5I5RA 1XICA 2PTXA 5EMYA 4JYFA 3B0UX 4G5DA 4ZXOA 3W1TA 2PLKA 3H26A 2WVUA 2NQ9A 3M7SA 3EWZA 2I5QA 2CHRA 3EOUA 4Q8TA 2HXUA 3L12A 3R13A 3L4TA 3UR7A 4RLIA 1TWZA 2QCMA 4OECA 5FKYA 2CZVA 1VCGA 4ATDA 1L8NA 1ZSXA 2CLIA 3IANA 3SN0A 2ZUTA 5U4NA 4Q6XA 3SUVA 4IGNA 1TIWA 2YA0A 2I5GA 2AMGA 1FXPA 4QJ5B 3VX0A 3CXOA 3PPHA 4AVFA 4JNZA 3LQGA 1DJGA 3E2RA 2YR1A 3K30A 1UBPC 2WZTA 2J7GA 5CGQA 2QPSA 3LHZA 3WKZA 1K8CA 1AMKA 5LHFA 4HPHA 3AIEA 1MFUA 4A3UA 1RBAA 3CHVA 1LLZA 1YKWA 3G0UA 1UPMB 4ZQRA 4Z2LA 1WZLA 3UCDA 3ZIZA 3NUKA 2A4AA 1LWIA 3PG8A 3EDEA 4NZCA 3U57A 4IPPA 2VZVA 1P6CA 1SYTA 2XH4A 3E3HA 4EF8A 3FN9A 2R1KA 4W87A 4DLFA 3BZJA 1UWUA 1A0CA 4GH1A 3EGJA 3GW3A 1UKOA 1GOXA 4KEMA 1KQZA 1UMLA 3N2CA 4KFNA 5AHLA 1JJKA 3ZR6A 1OVDA 4AIOA 1TPUA 3LA4A 3PM6A 1Q7ZA 1JG9A 4C7FA 4OUIA 1FHUA 1Q6QA 3TLLA 2Y8KA 3H2FA 3VGBA 3R10A 3WFAA 5HA7A 2BY1A 4GWEA 2CIPA 3V0SA 3GY1A 3TSDA 2CLKA 2VFGA 4CN1A 4A22A 4HCDA 4H2HA 4JOMA 3P6LA 3E74A 3E5PA 3A24A 4BQ5A 1ZCOA 3MUXA 2QZRA 3O1NA 3WK3A 2ZADA 4QDMA 3R8HA 1NARA 3TAOA 1QPKA 3WQFA 3EKLA 1H63A 4HBKA 2WC4A 1UZ1A 1XUZA 1OX6A 1O5XA 5A6BD 2C6QA 3MT1A 3W6YA 1A5UA 3TTYA 4A35A 1JYWA 4UTWC 5M5DA 3SQSA 1GTEA 1KKOA 2WYSA 4Y9PA 1E0XA 1OF8A 4PMJA 4CGTA 1UJQA 2PWHA 4EACA 3KLKA 2Q3OA 1W3HA 4FO4A 3NNTA 4ADSA 3H7VA 3RJYA 3AS3A 1L6YA 3GDLA 5GNXA 4PTWA 1M1BA 3S5ZA 4AEEA 2JF7A 3MMWA 1ICSA 2NWRA 5FEPA 1QHZA 1QPOA 1QW7A 4GYJA 1OC5A 1TVPA 4DNMA 2ZC8A 1EFZA 3UCQA 2CETA 5K3VA 1ZBVA 4C1NA 3ZSSA 4IMAA 1UWTA 3LBMA 1HW6A 3CUXA 3KHDA 1PHQA 5D03A 2EHHA 2ODOA 3LXCA 1FCUA 3DU0A 2D69A 1IIHA 2DIJA 3S46A 1TVNA 1EPVA 5I6SA 2WSYA 3R12A 3C5QA 3M6DA 4IIBA 1Y5WA 3OLIA 4B5VA 1XC4A 3GW0A 3PZVA 2PF8A 1Y7VA 2WWDA 4DHGA 4QX4A 2YCJA 3CAQA 3W0KA 1M3UA 4U2ZA 3PFMA 2QDEA 1OIFA 3VNDA 2G37A 3HPZA 3ICJA 2DW7A 4IT1A 3G1XA 3WQ4A 4GK8A 3W1NA 4IJBA 4PMOA 5G4HC 1GWJA 1TWIA 4RDWA 4LUJA 3DKLA 3LK6A 1S5NA 3QR3A 2E5DA 1VBRA 4MJZA 1QNSA 4LQ1A 1R9YA 1V08A 4HN8A 2ZIDA 2OLHA 4YN5A 4G8TA 3VC6A 5BRQA 3R0KA 1S2WA 1HJXA 2RAGA 4HNOA 2ZX7A 3TZFA 3ZR4A 1LWHA 1V93A 4GO8A 3ITLA 1AW1A 3BAJA 4HA3A 4F0HA 4GVFA 3VD5A 4AZBA 3GTXA 4PUUA 4PTVA 1KLZA 1BKHA 2NX9A 1JAKA 1MQPA 5REQB 1FCVA 4WY0F 1JCXA 3VE7A 4B3KA 1EJ7L 1ADSA 3F03K 2V68A 3A5FA 4DPPA 2CKSA 2WHJA 4FAMA 3DKJA 2BG5A 4J3WA 3TSMA 3WDJA 4C6CA 3E0WA 4JN8A 5I06A 4UCGA 3NZQA 4W89A 2GGHA 2NVAA 4DELA 4LUTA 2XSAA 2X0YA 2J7DA 2GOUA 1NVMA 1KM1A 1XLFA 4MFDA 4XO7A 2UY2A 2VO5A 1VEOA 3WBEA 3LNMA 5EY5A 2Z25A 5AB3A 3WDRA 4E5TA 3FCPA 1ZAJA 5C9WA 1XQKA 1GPFA 3EMQA