5M3WA

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-1,2-dideoxymannose and alpha-1,2-mannobiose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
350
structure length
350
Chain Sequence
NNNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase family 71
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
total genus 131
structure length 350
sequence length 350
ec nomenclature
pdb deposition date 2016-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m3wA00
3VUPA 2WVVB 5A94A 4MB3A 1K9DA 5A2CA 3ZM8A 2OYLA 4LYQA 1UWSA 5FD0A 1ISXA 1G94A 1OBAA 1C90A 3VD9A 1J12A 3GXFA 3WD4A 3M7SA 1MVYA 4KRUA 3VIPA 2BXZA 1MFUA 3T08A 2J77A 1KBKA 4Z2KA 1H49A 4GZJA 1JNEA 3BXWA 3FHQA 2GJXB 3VIJA 3OZPA 1QNSA 2VMFA 5EFFA 1SMAA 2CIPA 1WZMA 2VZVA 2CESA 3T2QA 3QR3A 4MNJA 5FOOA 3CHFA 1DTUA 2BY1A 3VU2A 3LPPA 1JXKA 4HP5A 5A6LA 4X9YA 3DHUA 4W85A 1MQRA 1C7SA 4J3VA 3AIWA 3I3BA 3IK2A 4B9ZA 3CGTA 1PZ3A 1K9EA 2BHZA 1E6NA 3AHXA 1B3YA 3PZNA 3W27A 4N0RA 4AMCA 4CCCA 4YHGA 3VINA 2Y8KA 4H2CA 1E56A 4PYSA 5A8QA 3U7BA 1QPKA 1H41A 1UD6A 3AFBA 3WH5A 2O9OA 1AQHA 1E1EA 2YDRA 4QLLA 1MQPA 3SCOA 1E72M 3FXYA 4B3KA 5EFDA 1QI0A 3G6LA 1LWJA 1RD6A 3WNPA 1PIGA 5CXPA 2XYLA 4ATLA 3CUGA 1BTCA 4KMQA 3MV01 1Q6CA 2VURA 3FW6A 3WF2A 3VDAA 1BSIA 4Q22A 4J3TA 1G1YA 3VDHA 4OOUA 3AJ7A 2GDUA 4HA1A 4CU7A 2E3ZA 3NJ3A 1VJSA 2O9TA 2QV4A 1CGUA 4JFWA 1VEOA 3UG5A 3WDPP 2BFGA 2C0HA 1V03A 1GOKA 4MNKA 1E43A 1CBGA 2WW5A 3AMLA 3S6TA 3CTTA 1VJZA 5HPCA 3WL1A 1GQJA 1FP9A 5DEZA 1AQMA 4HOWA 2DSWA 4U2ZA 2FHCA 4TVUA 3ARXA 4NZCA 3GH5A 3B9AA 5A6SA 1BVZA 5I78A 4W7WA 5DMYA 5IHRA 4D6CA 3BCFA 4BQ3A 4CD8A 4OJYA 3OBAA 3D3AA 5LA0A 8CGTA 4TTGA 3SUSA 2CYGA 2YKKA 1R87A 4C7FA 2JEQA 2VRQA 3HN3A 4CN1A 1CXKA 3W0KA 1CXFA 2J7HA 2WKLA 4FF5A 1GJUA 3K8MA 2VX4A 1C7TA 3AQUA 5I3DA 3VTRA 3KL0A 3EMZA 3DYPA 3T0AA 5A95A 3OG2A 1DWFM 2WC3A 3CUJA 1JDCA 1V3LA 1TFVA 1B3XA 4GPNA 1G9HA 2DIEA 1XD1A 1YHTA 4CUCA 5F7UA 3IJ9A 1B30A 1VFFA 4AC1X 3WD2A 4UQCA 1OIFA 3SCQA 3TTOA 1MWOA 2BV9A 2DT3A 2G3MA 3W53A 2EEXA 4ACZB 3WBEA 1VB9A 1NOFA 2GUYA 1UQZA 7A3HA 3ARTA 1SFSA 3WDIA 1VF8A 4U3AA 4FMVA 2VZTA 2PBGA 1U33A 1QHPA 2J7CA 1JNDA 2VOTA 3ALGA 1FP8A 1JFXA 4PTXA 1W9VA 3TTYA 2EXOA 4W88A 4PMRA 4ML4A 2XVGA 4W93A 1WP6A 2XVNA 3W29A 1GHRA 5I5RA 2CITA 1XYZA 4C7DA 4BS0A 1BGGA 3DC0A 2CERA 2XHYA 1HL8A 1US3A 3AMCA 4AEEA 3W82A 1JZ2A 2DSZA 1M01A 1QHOA 2OYMA 4GO9A 4MADA 3ZT7A 4PTVA 2VQTA 2Z1KA 4EE9A 3RCNA 1NOWA 3UR7A 1DWJM 1DP0A 3TOPA 1UR4A 4JHOA 2DSVA 3GXMA 5AYIA 3RJYA 4AD1A 3KZSA 3LMYA 4PMZA 4M24A 4IM4A 4EK7A 3SCUA 1CXEA 4WK9A 3OGSA 1BYBA 4ATDA 2B31A 3GXDA 2BY2A 1E4LA 1CENA 2NW0A 4LXFA 1MW3A 4P7LA 1HVQA 1FHLA 2FDMA 3VGBA 3MO4A 2XIIA 1MW0A 2ZOXA 5A1AA 1QI5A 2V38A 1UKSA 2D0GA 1ODZA 1E3XA 4W7UA 4D6EA 2CBVA 2GFTA 1H0GA 3WNLA 1W9BM 1QHZA 7CGTA 1HJVA 5CG0A 2WMJA 3UR8A 1KGWA 5E6ZA 2VCCA 3BAWA 4AZIA 4PN2A 2ZUWA 2J78A 1WDQA 3WUEA 3MSGA 3K8LA 1M04A 1WZAA 3UESA 5EMYA 2WPGA 1HKJA 3MUIA 2E4TA 2WZIA 3WNKA 2V3FA 3AS0A 3AI0A 4AZCB 4CGTA 4MB5A 4KRTA 5ECUA 4B15A 1BLIA 1IZKA 3WD1A 3ZSTA 1EO5A 2CPUA 1TUXA 2WK2A 3VILA 2WCSA 3VPLA 5GNZA 2WBGA 1GQKA 1W3KA 1MQQA 2ZXAA 3GNRA 5A69A 3AMGA 2A3AA 2YOCA 5DT5A 3RM8A 3SURA 3CUFA 5IDIA 2J7FA 2JE8A 4UTFA 4W5ZA 1UWRA 4DWSC 2OSWA 5C70A 2ZUSA 1WE5A 4D1IA 3AROA 4AD5A 3W6LA 2W4XA 4AZ5A 3AXIA 4K68A 4J7RA 4RE2A 4U33A 5D9NA 2G4FA 1JFHA 1ZB5A 2D0FA 4P7NA 3MUAA 1BG9A 2VNCA 4PTWA 3W28A 3WEMA 3UG4A 3CZEA 4B9YA 1ZL1A 4UOQA 3VD5A 2F8QA 3AHZA 3BMWA 1DHKA 4GO8A 1J0JA 4P8XA 2PF0A 1KXTA 2XWDA 5A6AA 3GNOA 1E6RA 1HXJA 1KFWA 3ARUA 2YL9A 3SUUA 4P7RA 4QCFA 2X2YA 1XYFA 1OD8A 3ZT5A 3WMBA 4U5KA 4DWSD 3UETA 2XIBA 2J47A 1OT2A 4MAZA 2J7BA 2Y5EA 1TVNA 4DWSA 3L4TA 3WSUA 2E0PA 4Z2HA 1ISZA 1BVNP 1KQZA 1UD2A 2E9LA 1HKIA 3W81A 2ZUNA 1OINA 4L4PA 3SEPA 3EMQA 4HMDA 4NRRA 4TOQA 4GQRA 4TTUA 2BY3A 3PTKA 4QFUA 2JEPA 2VI0A 2Z1SA 1B1YA 3ZJ8A 3CZKA 3WF0A 3CZLA 1IV8A 3F5LA 1SYTA 3ZR5A 3AXXA 1LJYA 1FHDA 3OB8A 3SUWA 4JKKA 4WKAA 4UQEA 3OIHA 4AIUA 2DSUA 1BYDA 3JUGA 3VIHA 1V0NA 1J11A 4PEEA 1M03A 5E09A 2YL5A 1KQYA 4F9JA 1J10A 4U3CA 1LG2A 2VR4A 1NARA 2BY0A 4MNLA 2XJ7A 1FOBA 4HA4A 3PZIA 1SMDA 2ESCA 4IPLA 2Y4SA 3WF4A 2WCGA 1NM9A 4MAVA 2D3LA 4PSRA 2XSBA 2PWHA 1UR9A 1WDRA 2OWWA 1V3HA 5E0FA 2J8FA 1YQ2A 3ZOAA 1JDDA 3K46A 1QBBA 3PZQA 3LPFA 3VMOA 4HU8A 3APGA 1CTNA 2XFRA 1PX4A 2YJQA 1CLXA 2ZUUA 5I0DA 1UA3A 1EDTA 5BRPA 2W61A 5HPOA 3AIBA 3WQVA 1H11A 5M17A 3WQ8A 1Q6FA 3WQ6A 1P6WA 1OM0A 1JIBA 2VTFA 2VX5A 3SCTA 4TXEA 1NP0A 4AIOA 3AMDA 3WQ4A 4PMYA 1EQPA 1ISVA 1NOUA 4E8CA 5CJ5A 2YA2A 1DEDA 1GOMA 4D6DA 5IHSA 2WKGA 3ARYA 2V3GA 1HX0A 4UFHA 2AAAA 4HU0A 4JHZA 2DH2A 1V3MA 4UOZA 5DO8A 4M81A 2BHYA 1MYRA 3ECQA 3KEHA 1TR1A 4DUXA 1XGZA 4AYSA 1QW9A 3AHVA 5M3WA 4D72A 5HBFA 4DM2A 1HJWA 2WBKA 1C3FA 2WMIA 1JF6A 2VT0A 1R7OA 4PRWA 3VGEA 4L4OA 4LPCA 2FHBA 5IFTA 5M03A 3BSHA 1VFOA 3CMJA 4J3XA 4A3YA 1W9PA 5GPRA 4J27A 1HJXA 3OLIA 2OWCA 2Y8VA 5CQ1A 2PB1A 3ZJ6A 5E70A 4M82A 2WNWA 5FL0A 1WZLA 2BVYA 3AIRA 5FIPA 3ALFA 4AY1A 3DYOA 1OB0A 4LQ1A 1EQCA 4PMXA 3WMCA 3IANA 1EOKA 3NSMA 1B90A 1BHGA 1VIWA 1KBBA 3CLWA 2GK1A 2WLYA 3AZTA 3B8SA 2WHJA 1KGUA 3VO0A 5LA1A 4E2OA 5BXRA 1JZ8A 4MNMA 1C93A 2XPKA 1GVYA 1H3GA 2WXDM 4UZSA 1UYQA 1Y7VA 3L2MA 3N12A 3VNYA 3GBDA 1Q6EA 3EDKA 1GOOA 1OGGA 1BAGA 1VFMA 2O92A 2A3EA 5BROA 4HA3A 6CGTA 2FHFA 1EXPA 2QMJA 1LLOA 4PMUA 4WLCA 3II1A 4D6HA 2QMKA 3EBVA 5AC4A 1ZBCA 2WLZA 2ZX9A 3SCWA 4H04A 1RH9A 1H1NA 4JAWA 2XVLA 4CD5A 3AMKA 1KGXA 2WHLA 2YL6A 5A8NA 3CHCA 3CZGA 1GORA 4CVUA 2WHKA 4XZBA 2J7DA 1HIZA 1UR1A 3VOCA 1KCLA 6TAAA 1E70M 4URIA 2G3IA 2ZICA 2W63A 4MB1A 4QLKA 1V0MA 3WQ5A 1E0WA 2DEPA 3VGHA 3VM7A 4AZ7A 1DWIM 2AOSA 1EO7A 3UEQA 1CGVA 5D4YA 4W8AA 1A3HA 5ABGA 2EJ1A 4CD6A 2D24A 5JIPA 1JZ3A 1NP2A 3WFZA 3VX1A 4CD7A 1UKOA 2ZX8A 3J7HA 5GNXA 1XH2A 5BXSA 5CPSA 3L4VA 1J0IA 1TMQA 2XVKA 2VRJA 3RM4A 3FY1A 1OIMA 5JBDA 5I77A 3BSGA 4PUDA 3AYRA 2Y2WA 1E6QM 4YPJA 1E4MM 5I23A 5ABFA 1QNOA 1HL9A 4DUWA 1BPLB 1CXLA 4ZXOA 1G5AA 1FFRA 3NIYA 1GPFA 2UY4A 4F66A 3SCNA 2JIWA 3ARPA 1LWHA 5BYWA 3FN9A 3ZR6A 4JCMA 3W6MA 2V3DA 4QP0A 1CNVA 2WB5A 3EDDA 1W1VA 2OSYA 1ZS2A 2RGLA 3AISA 1W32A 4UR9A 2CNCA 1NQ6A 4KWUA 3VIIA 2YDSA 2XTKA 3BCDA 3WH9A 4UFKA 3S2CA 3VMPA 1G0CA 1HP5A 3BAJA 5D9PA 3N15A 4V28A 3QHMA 4H7VA 1H2JA 3TONA 1HNYA 1IZJA 3UG3A 3NSNA 4MTVA 3GYCA 3VMNA 1HJUA 4D6FA 4J3SA 3ARZA 5GNYA 1PAMA 1QOXA 2ZUMA 1EA9C 1C91A 1E4IA 2Y24A 1JI1A 3ARQA 1FFQA 4OBRA 2YIHA 4JL1A 1V6XA 3MUZ1 4FLSA 2GVYA 1VFUA 3I3EA 1HVXA 4E4PA 4C7GA 3A6OA 1E6PA 4A3HA 2FGLA 4TVDA 3RPMA 3T2OA 3WDQA 3FAWA 4HMCA 4W87A 4BQ5A 2W62A 3B9DA 4H41A 3WY1A 4CKQA 3EDJA 1GW1A 5IXEA 5BCAA 1E1FA 4HZ8A 4AD0A 3DYMA 2W67A 4WKHA 1ZJAA 1E15A 3AS1A 4FLQA 2EPMX 3SCVA 1R86A 2HVMA 4CCDA 3AZRA 1MW1A 1BYAA 3CO4A 3PTQA 3O2LA 1XCWA 3QOKA 3VGGA 1EOMA 2G3JA 4H8VA 1W2PA 2ZXDA 3K4DA 4V2XA 2WMKA 5E6YA 2CHNA 3ZMRA 4XV0A 1JAKA 1WNOA 2PC8A 4XUYA 1W1PA 3NDYA 5JIWA 1AMYA 3OA5A 1W3JA 1CGYA 1E6XM 3EDFA 1CECA 3GH4A 3ZJ7A 1I1WA 3WEOA 2EQDA 3ARVA 1OT1A 5D9OA 4LX4A 3PZVA 4JKLA 1WPCA 1ITCA 1Q6GA 1E0XA 1V0LA 4TX8A 4HPHA 1PX8A 1CDGA 4P7OA 2C8NA 3NYDA 1SR0A 1CGXA 2A3BA 4GI8A 3AIEA 2OWXA 3WKZA 2J25A 1PBGA 4EAMA 1FH7A 3HMCA 4XB3A 3MU7A 3GXIA 3OZOA 4AZCA 3BAXA 3WF1A 4W86A 5A2AA 2QPUA 1GONA 2O9RA 4CD4A 4Q7NA 1UOKA 4QLJA 1CXHA 3WNNA 3MSDA 1ZBKA 2GJRA 2X09A 2BS9A 1Z32X 5DF0A 4NSBA 4YN5A 2J4GA 1BF2A 5JBFA 1QVBA 4OOZA 1UR2A 4JFTA 2J79A 1C92A 3WIJA 4HOXA 2FGZA 2J7EA 1W91A 4MDPA 1KXVA 1V02A 4FK9A 2YL8A 1GOQA 3MV11 3MKKA 2WVTA 1VAHA 1GJWA 1ESWA 1BFNA 3L4YA 3SCSA 1B3ZA 4HTYA 2YBUA 1EH9A 4PMQA 3A3HA 1CWYA 3SUVA 3PZGA 2C7FA 2ZX5A 2BHUA 4U5IA 2E9MA 1J0YA 1UZ4A 3ZQ9A 1VBUA 4MB4A 1W9UA 4DUVA 3L4WA 1D3CA 3WMSA 2VQUA 3M46A 5BWFA 2ZX6A 1K9FA 2J8GA 1BG4A 1RP9A 3WH7A 5IFPA 3BLKA 4GIAA 3VIKA 4BF7A 1TA3A 2XFYA 4QAWA 4DWSB 3WH8A 4U2YA 4TUFA 4IUGA 5I24A 4UFJA 1LL4A 4W7VA 4RL3A 5DFAA 3RMEA 2JIEA 4M29A 1MW2A 1UD4A 3EDEA 3KE0A 2VZSA 4AWEA 3MMWA 1ZBVA 2UY5A 4GZEA 5A6KA 2CXGA 1B31A 1GHSA 2PWEA 2WC7A 3QGVA 3PN8A 1AVAA 2V5DA 1WZKA 4AD2A 1C8XA 3DHPA 1TVPA 4XX6A 1TCMA 3F4VA 4B16A 2D3NA 5I6SA 1VENA 4WJXA 1XD0A 3U5UA 1UH2A 3T0DA 2JF6A 4AD4A 3ZO9A 2W91A 2XWEA 4EKJA 3RDKA 2DPEA 3PZTA 3TTSA 4FLOA 2WZEA 2VVNA 3O9NA 5HXMA 1JZ4A 1JZ6A 1IT0A 1C8YA 2ZE0A 4U31A 1V6VA 1EHNA 3GNPA 4PTMA 1B9ZA 4F8XA 1HJQA 1V6YA 1XRVA 3POCA 3AS2A 1UR0A 3W4RA 2VVSA 2XM1A 3WN6A 4CU8A 3VDCA 1RP8A 3FHAA 3MMDA 3ARRA 1E71M 4GQQA 1GQLA 4EANA 3FNDA 3L2LA 4IPNB 4J28A 1JYXA 1XSIA 3FAXA 4P8WA 5A6BD 3U7VA 3PZ9A 2ZWZA 1UWTA 4H8UA 3IJ8A 2JF7A 4ZFMA 4TVCA 3LPOA 1WB0A 1GZJA 1VEMA 2CBUA 5A6BA 4JZ5A 1B0IA 1J18A 1VBRA 5FL1A 3VM5A 4AZ6A 1KXHA 1W1YA 3GDBA 3VIGA 3AYSA 2MANA 2X0YA 2DT2A 2E40A 2QHAA 2ZUVA 1UWQA 1U30A 3BH4A 4KGJA 4HZ7A 1OGBA 4ZE5A 1JDAA 2W5FA 2D0HA 3HU7A 1W1TA 2F61A 1BQCA 4AW7A 1BYCA 2IXVA 3PZMA 4AIEA 1R85A 4PBGA 2WWCA 1GQIA 1J0HA 5E9AA 2VL4A 3WFLA 2EPLX 3CHEA 2WVVA 2A3HA 2WYSA 3A4AA 1OGSA 4AZGA 1UWUA 2YDQA 3W38A 1KXQA 2FH6A 3ZIZA 4GI9A 1CEOA 1G01A 3GM8A 5A2BA 1QNQA 3VD3A 1OD0A 4XZWA 1I75A 1V02E 3VIOA 4ACYA 1QI2A 4D71A 1UD8A 2WMHA 4MDOA 1CIUA 1XV8A 3WNOA 2GJXA 2GK1B 1MFVA 3N04A 4N42A 4W8LA 2GJPA 2JFEX 4LYPA 5AY7A 2WC4A 4UFLA 1XCXA 2WM0A 1MXDA 3LPGA 3VGDA 2WVUA 1WCGA 3W24A 3BLPX 4M1RA 1ISWA 3OGRA 5JUVA 1E9LA 4BCEA 5KEZA 4F9DA 1US2A 3BC9A 4WIWA 2YA1A 3AHYA 3AIUA 5D9MA 4F79A 1EGZA 3K4AA 5ABEA 1HP4A 1WO2A 4PSPA 4IISA 3QHOA 3VD4A 2UWFA 4JFUA 4PCSA 5KZ6A 2WSPA 4OBSA 3BAKA 1K9TA 1LL6A 2X05A 4Z2IA 2VCAA 4BZYA 2DT1A 1GOIA 5BRQA 2XSAA 1XH0A 1PIFA 5HNNA 3WF3A 1UZ1A 3UERA 4OUEA 3CIVA 4P7QA 4UQDA 1ZU8A 1E3ZA 4PUEA 3BMVA 1DWGM 1WAWA 4UQ9A 5LA2A 4CN4A 1E6SM 1EDQA 3G6MA 3AHTA 2XG9A 1C8QA 3CZJA 2VO5A 1VEPA 1UG6A 2G41A 2YA0A 1V6WA 4NF7A 3WEZA 3RILA 3VX0A 3OLDA 2OYKA 1JGIA 1TZ7A 4JFVA 5D8ZA 2VX7A 2X8RA 3WD0A 2CKSA 3SIMA 2CBJA 2CHOA 3MS8A 3IAPA 3ZT6A 3A4XA 4AXNA 2WVSA 5I79A 3VVGA 3PHAA 3WENA 4WF7A 3WUGA 2J7GA 2RGMA 2X0HA 2QPSA 4AZHA 4BA0A 2DDXA 3AS3A 5AC5A 1TG7A 5CLTA 3W37A 4CU6A 1UKPA 2BXYA 2GSJA 4GKLA 4WSJA 1B3VA 5A6MA 1ODUA 3L4UA 3PZUA 2ZX7A 3F5JA 1UQYA 3VIMA 1QI3A 4A4AA 3U57A 2WCAA 1UH4A 5ABFB 1E5NA 3PBGA 1ITXA 4P8UA 1NH6A 5CZKA 2XGBA 4KGLA 3M07A 2EPOA 3SCRA 2YLAA 3N11A 1M53A 3MANA 1V0KA 1UD5A 2OSXA 5CGMA 4NI3A 3CHDA 1GCYA 1UA7A 1CPUA 5HDRA 4D6JA 5A8OA 3N18A 5I2UA 2OLHA 3T09A 2D1ZA 3TA9A 1NWRA 4E8DA 1H4PA 3L4ZA 2IXUA 1QNRA 4AD3A 2PWDA 1CGTA 3RIKA 3QOMA 4ACZA 1UKTA 1CYGA 1ECEA 2XGIA 1V08A 2CBIA 4R27A 3VNZA 4CN6A 1KWGA 4LGXA 4H8HA 3WUBA 1LQ0A 2YBTA 1V6UA 5D8WA 4DM1A 5AYBA 4AEFA 3VIFA 1XSKA 2PI6A 4CCEA 1PZ2A 2X1IA 3WNMA 4GI6A 2DSKA 3A4WA 1X1NA 2ZXBA 4B3LA 2WWDA 1QBAA 1PEZA 2NT1A 1XH1A 3N13A 2WHMA 4W89A 2WMGA 1MXGA 2CKRA 2V5CA 4PCTA 1JL8A 3PTMA 2NT0A 1H5VA 1UHVA 2XVPA 1HJSA 3OLEA 4D6IA 1KWKA 4JIEA 5FKYA 1JYVA 3BAYA 2IUZA 1B3WA 1V3JA 2BVDA 1HF6A 5A8MA 1OSEA 3QHNA 1A47A 4BQ4A 1QW8A 1KB3A 4J3UA 3RM9A 2G3NA 4ZENA 1CXIA 1GOWA 3U5YA 4JFSA 1DWAM 3THDA 1I1XA 1V3KA 1W2VA 2BNJA 2PWGA 4GZIA 4ATWA 3WDJA 3N17A 2D23A 3MMUA 3IAQA 5A3HA 1TE1A 4UQAA 3WL0A 5ABHA 1GUVA 1F4AA 2AMGA 4AZBA 1ZBWA 4Z2GA 1N82A 4UFIA 1GNXA 5CGTA 2JALA 4UNIA 4JCLA 3CH9A 4MPKA 4JKMA 3VGFA 3MUY1 1E5JA 1GVIA 4Y7EA 3N9KA 2WANA 4J3WA 2EPKX 4P8VA 2HISA 1H09A 1HT6A 3SUTA 3I3DA 1JG9A 1D7FA 2CETA 2Q8XA 1JAEA 1E55A 2WMFA 4UFMA 4Z2LA 4MJ2A 4BQ2A 2EPNA 4UZUA 1E40A 3IJ7A 1FH8A 3D5HA 3DECA 5CPTA 5FCZA 2VUYA 1UH3A 4GINA 2UY2A 2WZHA 2VZUA 1J9YA 3ARSA 3TP4A 4W8BA 5GQBA 2CCRA 4MJ4A 2VC9A 1XSJA 1X6NA 1L8NA 2J75A 3L4XA 3ZJKA 5EB8A 1LG1A 1R7AA 6A3HA 3ARWA 1LL7A 1JYWA 1E6ZA 3KL5A 3AICA 2XM2A 4OKDA 3AIVA 4RE3A 1W3LA 1JXJA 1RPKA 4HOZA 3A47A 3AXHA 1J01A 3CMGA 4M80A 2E8ZA 4PMNA 5CSYA 1AQ0A 2J62A 3GBEA 4W84A 3ZSSA 5CLWA 4S3KA 2J74A 1EIBA 5BXPA 3VD7A 2VRKA 1JI2A 4X0NA 1UWIA 4M8UA 1PPIA 4UCFA 2BVTA 3VDBA 3OLGA 5EBAA 3WBAA 1OWQA 1UR8A 2E8YA 3KWXA 1V3IA 1F4HA 3NCOA 4JL2A 1J0ZA 3N1AA 2F2HA 4ZE4A 1D2KA 3E1F1 3GZAA 4M56A 1K6AA 3K8KA 4PMOA 1EHAA 1NWTA 1WDPA 2VZOA 1PX3A 3CUIA 5JBEA 8A3HA 1W9XA 1CLVA 1EDGA 1Q4NX 2GDVA 3NUKA 1JYNA 4R5EA 2D22A 1FH9A 4RE4A 4HPGA 2ZUTA 1TA3B 9CGTA 5HOSA 3POHA 1KCKA 2VCBA 2ZXQA 1CZ1A 1WKYA 4LYRA 4Z2JA 2DGAA 3WDRA 1UD3A 2PBOA 3EYPA 3B9EA 1O6IA 2VJXA 3W26A 2NSXA 3PZOA 1E73M 2G8ZA 1S46A 5TD4A 4ZXLA 2E9BA 3CPUA 4NRSA 1WDSA 3CUHA 3WH6A 1HKKA 2DQXA 2ZWYA 1KR1A 1XHGA 3AZSA 2TAAA 2WSKA 1NWSA 3O6AA 3W25A 3VKKA 1JD9A 1X6LA 2D2OA 2QF8A 5CPQA 2XFFA 1HKMA 5A6JA 4FLRA 4PMDA 1J0KA 5DT7A 3GTNA 1UUQA 1PJ9A 5CSUA 1QNPA 1B2YA 5E0CA 7TAAA 5C71A 3WD3A 1KR0A 4D1JA 1XC6A 2D20A 1BGAA 5A8PA 1JZ7A 2PWFA 1CGWA 3BAIA 1LF1A 1ISYA 1HN1A 4WSKA 3AIQA 2VR5A 1E0VA 3BGAA 3TTQA 1W3HA 2DT0A 3M6DA 4QDMA 4CVWA 3WDHA 3THCA 4UOJA 3NDZA 1ZJBA 4HZ6A 3K1DA 2W66A 4TX6A 2XUCA 5LYRA 2EO7A 3RJXA 3CBWA 1QI4A 1FA2A 1H0IA 2DH3A 4PMVA 1R8LA 3HJEA 4KH2A 5C8BB 2UY3A 1DWHM 3T0BA 2FH8A 2WAGA 3EMCA 2ZIDA 3WQWA 2QLYA 4ZEPA 3KL3A 3GH7A 1E4NA 4X0VA 2O9PA 3T2PA 3RO8A 5M5DA 1NWUA 4D6GA 1JD7A 3SCPA 4UQBA 1JF5A 3WELA 2EBNA 4AISA 5BXTA 3OGVA 4GXPA 1L0PA 3UCQA 2YLLA 2CEQA 1Q6DA 4QCEA 1U2YA 1JZ5A 1UKQA 1M7XA 3CZ8A 3WUFA 2VX6A 1O7AA 1OCQA 3NSXA 2V3EA 2W92A 2WMIB 2A3CA 2DIJA 4OIFA 4OZOA 4V27A 1W9DM 1VRXA 4S3JA 4YHEA 4W5UA 4HMEA 3AOFA 4WKFA 3F5KA
chains in the Genus database with same CATH superfamily
3GG1A 5A94A 3PWIA 1JPMA 3FJ6A 2Z2BA 1K9DA 1O68A 3EOOA 3GR7A 4LYQA 4Y9PA 1IEWA 4HA0A 4G1KA 3T6CA 2ZZ4A 3WD4A 3M7SA 3W1RA 4R53A 1BTMA 3ORWA 4Z2KA 1H49A 4ZO6A 4GZJA 2OMAA 3W7NA 3IJ6A 5GJNA 4UTMA 2VMFA 4QX4A 3TYDA 1PYFA 3NQAA 2Q09A 3QR3A 4IFOA 4NNBA 1DTUA 4UXDA 1A3XA 1VCVA 2BX7A 1DKWA 3DHUA 4W85A 1QAPA 3K4WA 3GXNA 3CGTA 1TJ0A 1TPDA 1JQXA 3UF9A 1UPPA 1JCXA 3PZNA 2Y7EA 4PRTA 2DZWA 1RSCA 3U7BA 5I00A 1H41A 2O9OA 1AQHA 5KITA 3JS3A 1ME8A 4S3CA 4B3KA 3B0PA 2HXUA 1LWJA 3VNIA 1PIGA 2TYSA 2PUZA 3TMQA 3DAQA 1OCBA 3N3MA 2YB4A 1ECQA 4HYWA 4J3TA 4O17A 3VDHA 2PC4A 4WOZA 1VJSA 4X63A 1EJWC 1XYBA 1Y0EA 5J04A 4XIMA 2NV1A 5FJJA 3EOLA 3HM7A 4MNKA 1E43A 3R8GA 4DX3A 5CKSA 4QJ3B 3CTTA 1R9ZA 2VGBA 1MNSA 5AHNA 2XH0A 2QV5A 3V4BA 2D69A 3S1XA 1OZQA 1XKYA 5DELA 2PZNA 4OQVA 3ARXA 3Q45A 4LYKA 3UWYA 4NZCA 3ZZ1A 5A6SA 4XBJA 2WZMA 3T81A 5I78A 5PTDA 2CW6A 4JS3A 4BQ3A 2FZDA 4C6BA 2WJEA 1WX0A 4GD0A 4OJYA 3D3AA 4IPIA 5LA0A 4TTGA 4PE8A 5H2ZA 3LA4A 2JEQA 2VRQA 3HN3A 4PCNA 2PGEA 4FF5A 1GJUA 1AG1O 4G2DA 1LP6A 2QULA 3RLHA 3DYPA 4XAGA 5I02A 4QE5A 1M5WA 3G0XA 1DWFM 1EUNA 1JDCA 1QJWA 1YHTA 2FDSA 4DB7A 3EXRA 3RPTA 4AC1X 2A85A 4BY3A 2DT3A 2ZQ0A 2G3MA 4DI8A 4ENLA 2Y0FA 3N3TA 3DI0A 1VB9A 1NOFA 7A3HA 3ARTA 5MF5A 2B7NA 2B4GA 1PIIA 2VZTA 1U33A 2J7CA 4UTIA 3KOYA 2Y8UA 1OJXA 1FP8A 1W9VA 5CC5A 4KEZA 4W93A 4IQJA 4NYUA 5CAHA 3B3DA 1BGGA 4Q4PA 1N8WA 2CERA 1HL8A 4WQ6A 3JW7A 1D8CA 1M6JA 4AEEA 1JZ2A 3UVAA 1QHOA 4MADA 3IPWA 2Z1KA 4EE9A 1RBAA 3G3MA 1DWJM 4BEQA 4EPKA 3TOPA 1UR4A 3IJQA 4JHOA 1TWZA 4KIEA 1FWIC 4JQ1A 4AD1A 3S6DA 2EF9A 3PJXA 4IM4A 3LCGA 3MDUA 1CXEA 4WK9A 5HAOA 2B31A 2YDAA 3GXDA 2BY2A 1E4LA 4HK7A 3VFLA 1VFLA 3HOJA 1FXPA 1XYMA 4V1YA 4FIQA 4O0QA 2FDMA 3MO4A 2J24A 4NJHA 1RQBA 1TX0A 2V38A 1UKSA 1F8IA 2D0GA 3TTEA 3B8DA 4D6EA 1IXQA 4K8EA 5LSMA 3UY7A 2V68A 3EWBX 4HPNA 7CGTA 1HJVA 2GVGA 3UR8A 4HJFA 1PDYA 2VCCA 4GYFA 3R79A 4PN2A 2ZUWA 2J78A 3WUEA 3KHDA 3DFPA 3FX4A 4DBSA 3BG5A 3E74A 2XISA 4G6CA 4J4KA 3CQ0A 3AI0A 2DW7A 3N73A 5I3KA 4KRTA 4XSLA 5ECUA 3DC8A 2HQAA 3ZSTA 4N9CA 3W76A 5D2VA 3PFMA 1TUXA 4DZHA 4L6HA 2WBGA 2ZA2A 3DESA 3R25A 1W3KA 2Z29A 3M44A 3BGJA 3ITLA 4NZ4A 3LI0A 3UNTA 2VFHA 2A3AA 3TA6A 3APYA 3O6DA 1T6MA 3UXKA 4REQA 3W07A 3T0CA 5IDIA 2J7FA 1IT7A 2JE8A 1UWRA 4DF0A 2ZUSA 1WE5A 4RNJA 1Q6OA 4NZ1A 4D1IA 1DIDA 3VC5A 4Z42C 2YCJA 4AZ5A 1US0A 2ZZ3A 4GY0A 3ZFHA 4C65A 1S2UA 5LKYA 4U33A 4YNGA 1RCQA 4GH1A 1JFHA 3OQEA 1ZB5A 3QQ1A 2ZBTA 1BG9A 3UCDA 5KINA 2DJLA 2I57A 4ZOBA 3UG4A 4B9YA 3A5VA 1EL3A 3S9ZA 3BMWA 4M1BA 4JQ2A 1IWPA 4LNYA 5A6AA 3W7PA 4ONVA 2WOQA 2YL9A 3SUUA 1AW2A 1RK6A 4HIBA 1JEZA 5M1TA 4MAZA 2J7BA 1LQAA 4DWSA 4QE1A 2OO6A 2CWNA 4F0MA 4Z2HA 4FXJA 1W1B1 3SM0A 2E9LA 3C2VA 5MKGA 1W1IE 1TSIA 2Y6ZA 3W81A 1LUCB 2H3BA 1EYWA 3BQ6A 3EMQA 3SEPA 4I7UA 1ICQA 3GG0A 1TWIA 3CT2A 1B1YA 5H8UA 4KCUA 1P7TB 4AFYA 1S2VA 4LJ3A 1CT5A 4F0HA 2P5NA 3BV4A 1DJXA 3WF0A 1IV8A 4RE0A 1LJYA 2IKIA 2Y61A 2X16A 3OB8A 3SUWA 4AC7C 4WKAA 4UQEA 3OIHA 3H53A 3VIHA 5FJPA 4QEEA 4WOQA 3S46A 4PEEA 4JTIA 1M03A 4F9JA 4ZSUA 4A22A 2BY0A 3NQMA 3Q67A 2ESCA 2X1UA 1Z6KA 3GIQA 3BW3A 2O0TA 2WCGA 1SSGA 4PSRA 4C6LA 1WDRA 3L9CA 3IIPA 1UC4A 5FJTA 3PZQA 3LPFA 4HU8A 1ME7A 1QO2A 3M4HA 1D9EA 4IG2B 1EFZA 4FR1A 1REQA 2XN0A 4W9TA 2GUBA 1N8IA 3WQ8A 3FSUA 1P6WA 4WR3A 3SCTA 3TQVA 1NP0A 4Z08A 3STGA 5J5DA 4S3BA 5CJ5A 3RYSA 1DEDA 3L21A 5CPLA 2V3GA 1WXYA 4H6KA 1TPEA 3CO8A 2W6RA 2ZRXA 3ECQA 3GKAA 1TQXA 1UPMB 1GK8A 1QW9A 1VJIA 3UYIA 4QJ1A 4D72A 2FB2A 2ZC8A 4Y8FA 5BMXA 2YSWA 4KBXA 1UJQA 1C3FA 2WMIA 2PLCA 2X2GA 1JF6A 2I5IA 2VT0A 1R7OA 5G1TA 4DI9A 1KV8A 3C3UA 4B92A 2FHBA 3BSHA 1KM6A 1VFOA 3CMJA 4J27A 1CB7B 1WDWA 3OBEA 3QXBA 4ZQNA 3ZJ6A 1NDVA 5E70A 4GQ0A 1S2CA 1Q45A 4AY1A 3DYOA 1OB0A 4PMXA 1EOKA 3PPFA 2ZZ5A 1S38A 1JCMP 4EACA 4DZIA 4C6OA 5LA1A 2PAJA 4E2OA 1JZ8A 2E09A 4MNMA 3W7QA 1H3GA 2WXDM 3L0NA 1XQLA 1H7OA 1QWGA 4LF2A 3SFWA 2D2JA 3EDKA 2GVEA 3QMSA 2RHGA 4PMUA 3QW4B 3TJIA 3II1A 2A1YA 2XN1A 3V35A 5AC4A 1ZBCA 4YTRA 2VFDA 4WDXA 4WY0A 3FOKA 4QNWA 3C0SA 3GSMA 1W56A 1XYCA 2J88A 4JAWA 4K2SA 4GK8A 2HE8A 1RUSA 3TZNA 3PNUA 2QEZA 4LS2A 3EWYA 2OLSA 1VGAA 3I68A 2R8WA 2V5KA 3URQA 4YMZA 1E70M 4URIA 3IIOA 4QLKA 4AUBA 2DEPA 2PWUA 4ROPA 3DKJA 3VM7A 2ACUA 2RJGA 4AZ7A 1EO7A 2CC0A 5D4YA 3TDFA 3WCZA 1JRBA 5ABGA 5JIPA 1DJYA 1NP2A 3WFZA 4IXHA 5SWUA 1FDJA 3J7HA 5BXSA 3V0UA 3NVTA 1XIDA 3STFA 1J0IA 2VRJA 4M6PA 3V5OA 3EGJA 1RQEA 2MNRA 2V2HA 3V16A 5JBDA 2CLEA 3S2LA 1C8VA 4MF4A 2Y2WA 3W1NA 3PPCA 5I23A 1UCWA 5I07A 3A3XA 3N6HA 4YL2A 3H54A 2ODOA 3C0JA 3BLDA 1G5AA 3D47A 3MP5A 3WG6A 4DBEA 3NIYA 1T5AA 2PF8A 1QTWA 2YW3A 4I3GA 5T9BG 4LUSB 5BOOA 1FHUA 3ARPA 2RDUA 3FN9A 4M6VA 2V3DA 3EDDA 1W1VA 2WQDA 2OSYA 3OU8A 1W32A 4UR9A 2O4MA 1Z89A 2QPXA 3MUCA 4IMCA 3VIIA 1ZTVA 2OCZA 3GR4A 4GI4A 5DBTA 4CQBA 1T41A 2YZ5A 1DIKA 4KKXA 3W7DA 4LY8A 1Z8AA 3N15A 2XIOA 1VCGA 3QHMA 1VFHA 3OVRA 5I3GA 3UG3A 3NSNA 4RDVA 3R0DA 3VMNA 5HMFA 2REQB 3CM4A 4D6FA 5FJRA 5KZEA 4ZO9A 1X7FA 5AC8A 5GNYA 5D02A 3M0MA 4JIRA 1EA9C 4HHHA 4LUIA 1Y5XA 1E4IA 2VEFA 1JI1A 1QU4A 4A3UA 4LW7A 1NFPA 4Q4MA 3TOYA 3MUZ1 4O1FA 1KO0A 3HGSA 2GVYA 1VFUA 1ZUAX 4IGHA 4E4PA 1DVJA 4C7GA 1BKSA 3A6OA 1E6PA 2FGLA 1SW3A 3LV6A 1A0DA 3RPMA 3T2OA 1F3XA 2CZ5A 2ZTKA 1RHCA 4W87A 3QYQA 3WQFA 4H41A 1EC7A 2NQLA 5EL1A 3W2MA 4J2PA 3AWOA 5IXEA 2OR2A 2R6OA 1ZJAA 3AS1A 3TLQA 2QCDA 2IKJA 1A5AA 1M9HA 1MW1A 1TMLA 3CO4A 1YPIA 4IIFA 1VFTA 3QOKA 3TW7A 3K4DA 1FVPA 2WMKA 5E6YA 2CHNA 4M3PA 3VOIA 2B7OA 2I16A 4ZQMA 3DDMA 2OGJA 4ZB2A 5HR7A 4LANA 1W3JA 1CGYA 1E6XM 4XSMA 1QCWA 4CNNA 4E2DA 1SO5A 1F3TA 2J9ZA 1AODA 1Q6GA 2C8NA 3VKDA 1XCFA 4GI8A 3STEA 2OWXA 1PBGA 4DRSA 1F6KA 1XIFA 3W3OA 5A2AA 4IPJA 4XD6A 1GONA 4I9TA 4ROQA 4LB3A 4QLJA 1CXHA 4HPXA 1H5YA 3V0SA 2PDIA 1MDRA 1IEIA 3M5ZA 1U83A 3LHVA 4ZR8A 5IBXC 4HBKA 2WNQA 5JBFA 1W5OA 4ZZ9A 4I5UA 3IARA 3E3HA 3N6QA 3WIJA 4HOXA 1V02A 3HFTA 3TNBA 2EG7A 3P8JA 4JYEA 1TWDA 4DN1A 2YL8A 3L66A 3MKKA 4MWAE 2WVTA 1ONRA 1VBJA 3TYCA 1GJWA 3GDMA 3M41A 1B3ZA 4HTYA 2YBUA 1EH9A 2YXGA 2X42A 3SUVA 1G4PA 3CQHA 4DJFA 3BO9A 1NTHA 3GG7A 3ZQ9A 4DUVA 3RHGA 3WMSA 4DO4A 4XTIA 1Y5VA 1EZ2A 4IGNA 1GG1A 4JOMA 1U5VA 5KZMA 1X38A 3AYVA 4WVXA 4JHMA 3VIKA 4O10A 3FA4A 2XFYA 3QRHA 3GUGA 3TZFA 2W27A 1PKNA 4U2YA 4X9SA 5TQLA 4H9YA 4GCAA 1X6UA 1LT8A 4XG1A 2JIEA 1UD4A 3EDEA 2GYIA 2PMQA 4GCXA 5C7VA 5AHMA 1YMYA 1I0DA 2PWEA 1XR2A 2ISVA 4DJEC 1MEIA 1AVAA 5FI8A 4ZA0A 1C8XA 3LHZA 3R10A 5I6SA 3B8WA 1AQFA 1AK5A 1X8CA 3U5UA 3HQ1A 4LRTA 2JF6A 3TJ4A 1XKJA 1SM9A 2XWEA 4A05A 3UG8A 2WZEA 3VYLA 3O9NA 4D8ZA 5HXMA 3S42A 1JZ6A 1C8YA 2CLLA 4POCA 3NNTA 1V6YA 1UOZA 1XRVA 5FJOA 4LBSA 4NZ3A 5JVLA 4DJED 3AS2A 3BVJA 1UR0A 3V1PA 4WJ8A 3WN6A 2OQHA 4FXFA 3B04A 1JULA 1ZAJA 3QJAA 4KERA 4MZYA 3ARRA 1JRCA 1LLZA 4EANA 3FS2A 3AO0A 1GVOA 3CT7A 1S5TA 3LTYA 5G2WA 3ZWTA 3E2VA 1YKWA 3IJ8A 2FQIA 1WB0A 3C8NA 3SADA 5C9RA 1VEMA 5A6BA 5E93A 2PLJA 4AF0A 4AZ6A 2E6FA 3NGJA 2X0YA 1XG4A 4QG9A 1U30A 4B5TA 3QH2A 4KGJA 4OWGA 4GRSA 4ZE5A 2W5FA 2F61A 4NJGA 4AW7A 1KM1A 2DUAA 4I8DA 3MQTA 1PXGA 1J0HA 1KRMA 5E9AA 2Y1HA 5LIYX 4WCJA 2EPLX 4DYEA 1KCZA 4MYAA 3TROA 2IKHA 2CZVA 3A4AA 3B0VC 5CG7A 1OGSA 3TYUA 1LBMA 3T4WA 4HGXA 3CWHA 1YTEA 3TAKA 3P82A 4ZCWA 1OD0A 2Z6IA 4DF2A 4JDBA 4C6KA 4GNKB 1CIUA 1XV8A 4PFHA 3WNOA 1C29A 3PWGA 3N04A 4W8LA 4I9JA 1MXDA 3W24A 2PDWA 4A8IA 1SO6A 1E9LA 2NVDA 5KEZA 3CQJA 4F9DA 1V4YA 2YR1A 3G77A 2YA1A 3GUWA 1SJCA 5D9MA 5C9XA 3TYAA 1HP4A 4FALA 4IISA 2C16A 4GHRA 2NLIA 2G97A 1WBJA 2AL1A 1MZRA 2W9MA 1TV8A 4Q4RA 2C91A 3W7OA 3PBUA 1XH0A 1PIFA 4EXQA 3EB3A 5EGRA 3UZJA 3EX6A 1TIWA 4UQDA 1W1A1 1WAWA 2OEMA 3IUDA 1EDQA 2NUYA 2HSAA 2Y5SA 4PB4A 3EX4A 3VKCA 2V82A 1VEPA 1UG6A 2G41A 4KT2A 4NF7A 2QQ6A 3QV8A 2GPTA 1F07A 2OYKA 1GVSA 2DVTA 4R88A 1OCNA 2X8RA 4LALA 3WD0A 5FA5A 3W87A 2B7QA 3ZT6A 3U6WA 4JXCA 4ZOCA 3EZ4A 3WUGA 2CXEA 3EWDA 5AHFA 1UP0A 2RGMA 4TO8A 4AZHA 4BA0A 1XFCA 1S5NA 3W37A 4E3VA 2DVXA 1O1ZA 4DO6A 1FWTA 3BLOA 3L4UA 1ZCCA 2ZX7A 4US5D 3VK5A 4C6CA 3TC3A 3VIMA 3B0UX 1QI3A 3U57A 2I7GA 2PLMA 3W2NA 4WZHA 3BL3A 1XG3A 1XQKA 4PMJA 2Z0IA 4KGLA 3M07A 1D3GA 3SCRA 1AJ0A 3B9OA 3H8AA 5FJIA 4Y6GA 5A5WA 1J79A 5D09A 1T40A 4NI3A 1GCYA 3TC7A 4HZMA 5A8OA 3R11A 5I2UA 3T09A 3TA9A 3K1GA 3S2JA 4AD3A 6ENLA 2DZBA 1SFLA 2PGRA 3CEPA 1UKTA 2WZTA 2XGIA 1V08A 2HNEA 3QSTA 1W5QA 3V1HA 1UZDA 2D2HA 3KUMA 1X39A 2QUNA 5AYBA 4AEFA 3VIFA 2WKJA 4CCEA 2FYMA 2X1IA 2OXNA 1ICPA 3CUZA 1R2SA 3G1VA 1LROA 3PJUA 1XRTA 2WWDA 1A3WA 2NT1A 4Q33A 4H83A 3GR8A 4W89A 2WMGA 2GLKA 2EJAA 2V5CA 4PCTA 5LIKX 4AY8A 1YEYA 1K8ZA 1H63A 3D6NA 1K8CA 2NT0A 2VDIA 2XVPA 4JIEA 4N2YA 2HVNA 1B3WA 4IP7A 1YRRA 5KTLA 4Q8TA 5A8MA 1OSEA 1OFDA 3QHNA 3IGSA 4BQ4A 3CL8A 4HVXA 4RJEA 7ODCA 3RM9A 2PTWA 4QJ5B 1CXIA 1XIHA 4IWWA 3H2FA 2J9YA 2BNJA 4GZIA 2H6RA 1XLLA 2BWGA 4IIBA 3WLIA 4GXMA 1VYSX 3PBYA 1KLYA 4ZODA 3BPWA 1LDCA 5CGTA 2JALA 3TXZA 1E5JA 2Z27A 4Y7EA 3N9KA 4JQ4A 3E02A 3RG6A 2WANA 3E0IA 2IW0A 3W7LA 4J3WA 1QNVA 4YYFA 4E2BA 5D2TA 2HISA 1BKHA 2HPMA 1D7FA 4K3ZA 5IM51 2R94A 1O5KA 1E55A 4UFMA 3A5FA 4UZUA 1E40A 4LUTB 2HS6A 4AVFA 3VKBA 4S39A 3DECA 5CPTA 3FEQA 4W8BA 4MJ4A 2VC9A 1XDMA 4TX9A 4LAMA 3BZGA 1XBYA 3E2SA 5HNUA 3ARWA 3NZRA 4HNUA 3KL5A 1EZWA 2XM2A 3GDTA 1W3LA 1JXJA 1W37A 2P3ZA 2E6AA 1FTXA 4GXWA 2XIQA 1BEUA 3M16A 4H9VA 1J01A 4KCWA 3H70A 1TV4A 2E8ZA 1YDNA 1QT1A 3T7VA 1A5KC 1FUYA 3H2NA 4AMAA 3P8IA 1EIBA 3UU0A 2A7NA 3VD7A 2GOUA 4UTJA 4G5DA 4X0NA 4M8UA 4HMNA 1PPIA 3VDBA 1XLGA 3WBAA 5C55A 1OWQA 2R1NA 4JX4A 2B7PA 3UT0A 1V3IA 3NCOA 4R9OA 1XS2A 3N1AA 2EHHA 4ZE4A 2GGHA 4Y9NA 3CQKA 2DZXA 1M41A 1LOSA 2PSNA 3CUIA 4HT3A 3ANYA 1EDGA 5CGQA 1VIZA 1BXNA 4Q4SA 4X2RA 4TV5A 3PC0A 3BK0A 4HPGA 3DCPA 1XW8A 1T0OA 1TA3B 5HOSA 2VCBA 2ZXQA 1P0NA 1CZ1A 3E49A 1WKYA 3MB9A 3REQA 1TV2A 4LF1A 4Q4KA 2H3DA 2NSXA 1A5NC 2ZRYA 1ZQ5A 2E9BA 4D8AA 1M1BA 5F2MA 1F73A 4RNHA 3WH6A 3QY7A 1HKKA 2DQXA 2OPJA 5DANA 2ZWYA 3AZSA 2BGSA 2QF7A 1OX4A 3O6YX 4ZL1A 2G50A 4GACA 4LC8A 3PP7A 3JU2A 3PB2A 4FLRA 3M1ZA 1AH0A 1K02A 3GTXA 1AZ2A 2INEA 1KNWA 5C71A 4D1JA 1XC6A 3H21A 3AIQA 3TVAA 2XZ7A 2FZ9A 5BOEA 4GJ1A 4KPLA 4CVWA 3WDHA 1LM1A 3BW4A 1KM2A 4UOJA 1VH7A 3NDZA 4FAMA 3Q2DA 1PB0A 2FPTA 3CV2A 3N2CA 2W66A 3CBWA 1FA2A 4KH2A 2QUUA 2UY3A 2FH8A 3L65A 3LMZA 2QZRA 4LBUA 3KL3A 2ZA3A 4X0VA 3D0CA 4Q6XA 3T2PA 3C4UA 1TUFA 1JD7A 4UQBA 2EBNA 4RNFA 4AISA 3WBWA 1L0PA 3UCQA 5AECA 1Q6DA 1T8QA 1EIXA 2XH4A 1M7XA 4YCOA 1VZWA 2FVKA 3W1LA 2VX6A 4O1BA 1OCQA 3NSXA 1L6YA 2V3EA 1MDLA 2YGYA 1QXLA 3BOFA 4S3JA 4YHEA 4HMEA 3AOFA 3SQSA 3QF0A 4RW5A 2VXNA 2WVVB 4O1AA 3LCHA 3W85A 2I56A 4MB3A 5A2CA 3ZM8A 4GFIA 2HJPA 2Q8ZA 1UWSA 3VD9A 1RLDA 1ZLPA 1S2TA 1B3OA 1MVYA 1OYAA 3N2OA 3T08A 2GUUA 4JYFA 2ZDSA 1KBKA 3MY9A 3W1QA 2HS8A 3VIJA 3OZPA 2QDDA 3NXLA 4L9YA 5EFFA 3QC0A 2BY1A 3LXBA 4H7ZA 3GC2A 3LPPA 4KESA 1ZZMA 4RCXA 1JXKA 1FWEC 3W2JA 3DERA 2P0OA 3W1AA 4J3VA 3AIWA 3I3BA 3IK2A 4B9ZA 3CUXA 1YBQB 1K9EA 2BHZA 1K70A 2YCKX 1PO9A 1ZJIA 4NP7A 1B3YA 2PP3A 2VEPA 4E8GA 3W27A 4N0RA 4AMCA 2INZA 4YHGA 2Y8KA 5ECVA 1UD6A 3LRKA 2ASHA 3FXYA 3THAA 3G6LA 3WNPA 3PVFA 4UTUA 4HSHA 2XYLA 1V6TA 1Z41A 4KMQA 4ZGYA 3MV01 1Q6CA 1AH3A 2VURA 4PUJA 3A4JA 4NIRA 3W86A 2ZZ1A 2HXTA 3RX4A 4OOUA 5HWJA 4QSFA 2ACQA 5KETA 1WKFA 3SRKA 1BVWA 5AHEA 2VP8A 3U0HA 2Z1VA 1CGUA 1DOSA 3UG5A 2BFGA 2C0HA 4DZ5A 4P5UA 1K77A 2IPJA 1U5HA 2QDHA 3WZ0E 1VJZA 5CC3A 2V2CA 2BODX 3ATYA 3WL1A 3HA1A 1FP9A 5DEZA 3LGDA 4IFKB 2DSWA 1Q63A 3GXPA 4TVUA 3GH5A 3B9AA 3HB9A 1V7AA 4PRRA 4DLFA 2UBPC 1KTCA 5IHRA 4PB5A 1VYRA 4GOAA 3C52A 3PSWA 8CGTA 3SUSA 3W70A 5BU6A 4C7FA 7REQA 3H2MA 3UZZA 2Y7DA 1DQXA 3W0KA 3VNLA 1MI3A 2XIMA 1ELSA 2BG5A 2RH9A 4OV4A 1R0MA 3AQUA 3H55A 2IKGA 3KL0A 3T0AA 3OG2A 2WC3A 4IJRA 2DFAA 2AGKA 2OZTA 1V3LA 2GGJA 1XIBA 4F2UA 5I06A 3M0ZA 1MUCA 5F7UA 5JXQA 3IJ9A 1XBVA 1VFFA 2W3ZA 1OFQA 3NL2A 3WD2A 4UQCA 4O4WA 3RF9A 3SCQA 3RPDA 3W53A 2EEXA 3ES7A 1A0CA 4L7ZA 5KSWA 1VF8A 4FMVA 1GYLA 4L80A 1G69A 4E0CA 4RR4A 3E5BA 1EX5A 5JH2A 1WBHA 2ZVIA 4GUFA 2VOTA 1JFXA 3TTYA 2EXOA 4PMRA 4ML4A 1WP6A 3W29A 3NG3A 2VFFA 3L0GA 5I5RA 2CITA 3DC0A 2XHYA 4JNMA 3PSVA 3HFYA 3S3GA 4GO9A 1EF3A 4UMCA 3RCNA 1NOWA 1DP0A 2XU2A 4DIAA 5AOUA 4XWUA 5HMSA 1H62A 2CWXA 5AYIA 3HURA 3UJEA 1TR9A 3KZSA 2UV8G 2CZFA 4H00A 2P1FA 3T44A 1W3TA 3L67A 4MKNA 4EK7A 2G37A 3CS2A 1QPQA 1Y8BA 2V30A 3LX9A 1B4EA 3G1AA 1H7PA 4DBDA 1A50A 4LXFA 3L5LA 1MW3A 4P7LA 4E6MA 4LCRA 4ZQCA 2VM8A 1HVQA 3QZ6A 3CL7A 3VGBA 1CCWB 1NU5A 2ZOXA 5A1AA 1T7LA 1T8XA 4JIPA 3B06A 3P5YA 4K38A 4GVFA 4I9AA 1PKMA 2ADAA 2CBVA 2GFTA 3WNLA 1QHZA 2OTDA 3UZ5A 1KGWA 3Q4DA 3BAWA 4AZIA 3DXIA 4C90A 2OU4A 3UESA 1MEHA 2Y5JA 4ML9A 3RN6A 2GGIA 3MUIA 2E4TA 3USZA 2WZIA 5FF2A 4XIAA 1WDDA 3LN3A 1F76A 2Z1BA 4AZCB 1EKOA 1EWDA 1P48A 1BWVA 1H50A 4LVFA 3UJRA 4S1FA 1IWAA 3UGRA 1IIHA 3TW9A 4ZSTA 2C18A 2Z7GA 4G7FA 4YVXA 1D8WA 2EKCA 4GJIA 2PE4A 2RDXA 5A69A 3MKCA 3AMGA 3SN0A 3APTA 3LLFA 5DT5A 3QMRA 3R43A 3SURA 3CUFA 2X41A 5D05A 2Y63A 2NQ9A 3PWAA 4W5ZA 4UTFA 3NQ2A 4DWSC 4LEQA 3TJLA 1HZYA 4AD5A 3W6LA 2W4XA 4ZMGA 4C6FA 1OFEA 4N9EA 3LI1A 2E67A 5D9NA 3HG2A 3H2OA 2VNCA 4PTWA 3CK5A 7TIMA 5HATA 1ZL1A 4UOQA 2F8QA 4ORMA 3N4FA 4F0RA 2XWDA 3GNOA 1F74A 3GHSA 1KFKA 1E6RA 3OTRA 3R6IA 1KFWA 4JN8A 3BJFA 3WMBA 4U5KA 4DWSD 3UETA 4MOZA 1S1RA 1XISA 2A3LA 3L4TA 3BOLA 3VE9A 3UR2A 3ONCA 1TPFA 3WK3A 5T8GA 1EJTC 4H9UA 5DLCA 1KQZA 2V81A 3IUHA 3N2XA 4WY0F 1VPQA 3OBKA 4S38A 2VR2A 1OINA 4HMDA 2VI0A 2PGWA 3IIVA 4PUNA 1J93A 3ZJ8A 1SJAA 1TE6A 4HD5A 4LH8A 3ZR5A 3GWQA 4EX4A 4PODA 1FHDA 5F1VA 4PFMA 1UUOA 4Z0JA 3STPA 1WKEA 3LQGA 4AIUA 3HV9A 2DSUA 1BYDA 3JUGA 3L0KA 3EPOA 1LTDA 1V0NA 3UY8A 1LT7A 1KQYA 1J10A 2QJMA 2VR4A 1NARA 2XJ7A 4J5NA 4QGCA 3DN5A 4HA4A 3PZIA 3THQA 3TN6A 2PU1A 4HN4A 1R46A 2Q3RA 1RA0A 1NM9A 4MAVA 3GIYA 2V63A 2IPWA 4MY9A 5E0FA 5TNVA 2QGYA 3TSDA 3VCNA 1QBBA 2Q8LA 4S23A 4DJEA 1OX5A 1EDTA 2W61A 4HTBA 1XLBA 9XIMA 2Z2AA 2DUXA 2Z26A 1Q6FA 3WQ6A 1OM0A 3XINA 1OZMA 4TXEA 2YFNA 1XLHA 4AIOA 1PKLA 2HZGA 4PMYA 2YA2A 2ACRA 4UWMA 1GOMA 4D6DA 5IHSA 1HX0A 2AAAA 3RRXA 1EP1A 4UOZA 4GE8A 4NX0A 4FNTA 1ONEA 1TRDA 4NHVA 2AMXA 5J8LA 4G9PA 4DUXA 1XGZA 3T42A 5DXXA 3S0CA 3AHVA 3CEUA 2NWSA 4DM2A 4DBWA 4IFRA 4PRWA 3VGEA 4L4LA 3G1XA 4L4OA 4NNAA 1OYCA 2PA6A 5IFTA 1W9PA 1G7VA 4GWEA 2Y8VA 5CQ1A 4JN7A 1SGJA 1CW2A 2WNWA 2BVYA 4HK6A 1TO3A 5FIPA 3ALFA 3GU9A 4O18A 2JKAA 4RXFA 1DYSA 3N9RA 1SZGA 2PDCA 4DNMA 3NSMA 1B90A 4GFSA 2GK1A 2FLIA 2WHJA 2WM1A 3KM8A 3NURA 3O6CA 1ONXA 3IIXA 1Q4WA 5BXRA 2XPKA 3GFZA 2ZE3A 2Y7FA 1GTEA 2WNZA 2XN2A 1UYQA 3W71A 1Y7VA 4Y9AA 5EBUA 4Q8PA 1SZFA 1FX6A 3U8GA 3MA8A 3MZ2A 2JGQA 1Q6EA 5DMLA 1PV8A 1GOOA 2A2IA 2X30A 3XIMA 2QDGA 2O92A 2A3EA 2PD5A 3EB4A 4MYXA 3ABQA 2FHFA 1JCTA 1LLOA 1DJWA 4WLCA 4B5WA 1LYXA 1N7KA 2J6XA 5FSDC 2NX9A 2ZX9A 4CNTA 3CV6A 1RH9A 3G8RA 2QCEA 4JN6A 2XVLA 5LNRA 1NDYA 3QLLA 1L6FA 2WHLA 2YL6A 3CHCA 2P10A 3CZGA 3UWWA 3WYZA 1RXOB 3S47A 2WHKA 1YDOA 4XZBA 1HIZA 1UR1A 2P88A 4NU7A 6TAAA 2ZICA 4FXRA 3LERA 1E0WA 2VDGA 4WHBA 3SW6A 5H1WA 2AOSA 3UEQA 4UMBA 2GQ3A 4YU1A 4CD6A 1JZ3A 1FWFC 3SSJA 1UKOA 2ZX8A 3TR9A 5GNXA 3V7PA 3SR7A 1TMQA 4E38A 2HEJA 3NQVA 2CLKA 3KLLA 2PFHA 3VNKA 3QFWA 5I77A 3BSGA 4PUDA 2H90A 1E6QM 4YPJA 1E4MM 1GJPA 3PAJA 3DFHA 5TIMA 5ABFA 3R8HA 3T9PA 3BG3A 3BG9A 3CPRA 3D46A 3BICA 3NDOA 2D2GA 1GPFA 2UY4A 4F66A 1LWHA 3DFYA 3IRSA 4QP0A 6XIAA 1WUEA 1TKKA 3VOFA 7XIMA 1ML1A 3DFNA 2OLAA 3BLIA 2HTMA 2C79A 3KRUA 1EYEA 2HBXA 2XTKA 2YDSA 3WH9A 4UFKA 2Y7GA 3IACA 1QASA 3MHUA 3S2CA 1R30A 3E0LA 5D9PA 3O0KA 3PM6A 1DORA 4WRHA 3T78A 3I10A 1IZJA 5LXXA 3WJXA 4DPQA 4MTVA 1JCJA 3HPAA 3KS5A 3MI6A 1PE1A 4AYGA 4QTGA 2ON3A 3R58A 3QN3A 5LZLA 1PAMA 2XIJA 4HB7A 2Y24A 3ARQA 1FFQA 4MVAA 4JL1A 3BV7A 4FLSA 4JTFA 1HO1A 2ZRZA 8TIMA 1EBHA 1ZRQA 1L6GA 5IOBA 2OVLA 1EF2A 1H51A 4HU4A 2QJNA 4Q4QA 4QG8A 3S2NA 2W62A 3B9DA 1P6CA 3NQBA 4PL2A 3WY1A 4CKQA 3EDJA 3GKFA 3LHWA 5BCAA 1E1FA 5DCDA 3DYMA 4WKHA 3SI9A 1EPXA 1E15A 2XH7A 4FNRA 1HKVA 3N29A 3SCVA 1FCUA 3QGKC 1BYAA 3PTQA 1XLIA 2C1HA 1G4SA 4UC5A 3M0JA 3QV7A 3NQFA 4HCLA 1W2PA 3U3HA 1L8PA 3FK4A 1WNOA 2PC8A 4XUYA 1M65A 1VCFA 1PDZA 3WJSA 2BLEA 3M47A 3FDGA 1R6WA 3GH4A 1EWEA 2EQDA 3I65A 5CC7A 1XUZA 3ARVA 3SJNA 3PZVA 1WPCA 3SRHA 2Q6ZA 1XJBA 1E0XA 1V0LA 4TX8A 3UWUA 1CDGA 3QTPA 3NYDA 4V33A 1SR0A 3ZVHA 2J25A 4EAMA 1C9DA 2R82A 4LV9A 3OZOA 4AZCA 3BUVA 4LVDA 3KVJA 4XAYA 3BARA 1KD0A 2O9RA 3B97A 1Q66A 1I0BA 4Q7NA 1RZMA 1UOKA 3W7IA 4B5NA 3MSDA 1ZBKA 1EJXC 1H60A 1QDSA 2VFEA 5DF0A 4GVHA 4REQB 4YN5A 5G4EA 4CNPA 1UR2A 4JFTA 2J7EA 3OVQA 2PDHA 1KXVA 3TWBA 2XZ9A 3CV7A 2RJHA 5BW6A 4DJFD 1BFNA 3SCSA 3R7MA 4PMQA 1DJHA 3W23A 2WV8A 2QS8A 2EAWA 1JCLA 5FEZA 1FWRA 5LIUX 4H01A 2E9MA 1BXBA 2VFIA 4C6EA 1KM4A 1VBUA 1XGEA 1W9UA 4UNKA 4L6DA 4L56A 1K9FA 2J8GA 1XLJA 4GQGA 4O16A 1H7XA 4N6FA 2NZLA 3BSMA 4BF7A 3FEMA 3QSRA 2ZTJA 4QAWA 1AW5A 3EOEA 4DWSB 4UFJA 4NAFA 5B7YA 1LL4A 4RL3A 5GVJA 1OFRA 3EX3A 3M64A 3RMEA 3CASA 4YIWA 3NEVA 2A21A 1ZBVA 5A6KA 3G1FA 3H7VA 4LV4A 2WC7A 3QGVA 4S2CA 4QDWA 3CAVA 2V5DA 2Z2UA 1WZKA 4AD2A 3TN3A 1TVPA 4IP4A 1XBXA 5JH1A 1TCMA 5BWAA 2CLIA 5I3IA 3LBMA 1XD0A 4AD4A 2J66A 2Y88A 5J5RA 3WK1A 3GFYA 1LOQA 4EKJA 3RCMA 3PZTA 4KS0A 3CIWA 4BI5A 4NJIA 1IT0A 4U31A 3ZYZA 1HJQA 1TV3A 4C5YA 4JNZA 3MPGA 3AJXA 2BOFX 3EA3A 2FPYA 3W4RA 5AZ0A 2XM1A 1XINA 3OYZA 1TMHA 1RP8A 1ZCOA 3MMDA 4Z1YA 4LAKA 4B2DA 4GQQA 5A6TC 1GQLA 4HKPA 3ENLA 5LIXX 1REQB 1XIMA 3MZNA 1Y5WA 4ADSA 4IPNB 3GU1A 4J28A 4GX9A 1Q5MA 5A6BD 2FMOA 3BZJA 1SW7A 2CBUA 3F2CA 3H26A 1TPH1 3T05A 3FFSA 3VM5A 4LEFA 1IHIA 2OQYA 1G4TA 3T07A 3BH4A 3DGRA 4IMEA 1YTDA 4HZ7A 4DJDC 4QS5A 3LGEA 3HU7A 1BQCA 3UXDA 2I5QA 5C7HA 1OK6A 3BGGA 1E1CA 2XGZA 1K8XA 4PBGA 3OHIA 2WWCA 1GQIA 4KWVA 3RLUA 3WFLA 5C9ZA 1NY1A 2VEIA 1NFBA 2HK0A 4PUKA 4IXXA 4AHOA 2FJUB 1Q85A 4DEFA 1WQ5A 4NUWA 1KXQA 4GI9A 1G67A 1X8FA 2JKEA 1G01A 2OJPA 4GABA 3TW6A 1QNQA 1PVNA 2DZSA 3EWZA 2E1DA 3DG6A 4FPSA 1V02E 3P0XA 4DJDD 4ACYA 1QI2A 1AW1A 1IIGA 1UD8A 2O4QA 2QUVA 2WMHA 4YWIA 1F5ZA 3P0WA 2GJXA 1FHVA 1MFVA 2JFEX 4LYPA 1O5XA 5AY7A 1XF0A 4UFLA 3LPGA 1GZGA 2WVUA 2YFOA 3BLPX 4IZGA 3UR5A 4EWND 1US2A 3BC9A 3I7QA 3SGGA 4Q8MA 4R9XA 4F79A 3K4AA 3UVIA 1GZ1A 2V6AA 4PSPA 4H1ZA 4O52A 3W7CA 4PCSA 2PDYA 4O50A 4OBSA 5F2LA 2X05A 3R89A 3HPFA 4Z2IA 4GC4A 1EC8A 3G5EA 3FKRA 3UA3A 2VCAA 1PHWA 4QXIA 2HE5A 3W22A 4ZOAA 4M19A 2PTXA 3WQEA 4H6QA 1YYAA 3UERA 4A29A 3C2EA 3CIVA 4OUEA 4WY0B 3UXIA 3N4EA 1K1DA 1ZU8A 1E6SM 3G6MA 1FKWA 2XG9A 3FYYA 1C8QA 3ANUA 4LT9A 4ALDA 4J2MA 4FZIA 1OEPA 3DFQA 2R24A 3M0HA 3VX0A 3OLDA 1A5SA 4XZMX 4NL1A 4O1CA 4N9BA 1M7OA 3I6EA 2GWNA 3FA3A 4JTSA 1W0MA 2CHOA 3WLJA 3DFSA 4AXNA 2WVSA 3WENA 4TIMA 2J7GA 4J1OA 2R9RA 1SO3A 4C6MA 1I2RA 4JTTA 3WBXA 1GEHA 1GEQA 2GGGA 5AC5A 4WSJA 3W88A 5A6MA 4E4FA 1XGDA 1F2JA 4CLMA 4JEQA 3DHDA 4A4AA 3NYZA 3PBGA 4HHMA 1KCXA 3TU9A 4KEVA 1BXCA 3A9IA 4C6NA 3L12A 3GIPA 2PDLA 2EPOA 4M7SA 1V93A 2OZ8A 3RR4A 4FX6M 3OHMB 1GQNA 3EX2A 3N11A 3TK7A 4DXXA 3W75A 3UZWA 4Q8UA 2OSXA 1A53A 3S9IA 1CPUA 1S1PA 4IIGA 3HQPA 5HDRA 5H8MA 4HJWA 1SPQA 4I7VA 2OLHA 2YZRA 1KRBC 3EX1A 1NWRA 1SUXA 3RRAA 4E8DA 2OELA 1H4PA 2IXUA 4ZB0A 2PWDA 1HQTA 1CGTA 4JR5A 2TSYA 4A8RA 7ENLA 3QOMA 4ACZA 1CYGA 1ECEA 4XAPA 3O8AA 4IH3A 4R27A 4FX7A 1TVLA 4R7OA 4LGXA 3W9ZA 3WUBA 2AKZA 1LQ0A 3O16A 3DIPA 2BDQA 3FGCB 4DM1A 2R91A 4MFEA 3WNMA 2F38A 2UZ9A 2FFCA 3A4WA 1X1NA 2ZXBA 3LM7A 3UFYA 1W17A 2ZRWA 3UWZA 2D73A 1QBAA 1PEZA 4DHGA 3TLLA 3N13A 2WHMA 4LWWA 2ALDA 1OADA 4N9DA 1KWKA 3G8EA 3OLEA 3MSYA 1P43A 1RJQA 4YTSA 1JYVA 1ZY9A 5C5YA 1K7EA 1XDJA 3KW3A 3LLXA 2BVDA 1P0KA 4ZENA 1GOWA 3I6RA 1I2QA 5F4XA 1DXFA 2PDNA 3U5YA 4JTAA 4JEJA 3THDA 2OG9A 1I1XA 5JU6A 1I8JA 2PWGA 4PB3A 2QCDB 3N17A 3MMUA 3GK0A 3GNDA 3IAQA 1PUDA 1F4AA 1Q6LA 2AMGA 1H7WA 4Z2GA 1FWSA 1N82A 4UFIA 3NTYA 1GKPA 1ME9A 4UNIA 4O11A 4UTHA 4JDYA 3SRFA 4JYDA 5H6HA 3QR0A 2WNNA 1IGSA 4G1NA 1XYAA 4H7CA 1GWJA 2ZZ7A 4O57A 4RZ6A 3TJXA 4BWLC 4HYRA 2E5CA 1HGYA 1UUMA 3SUTA 1XLCA 3I3DA 1JG9A 2Q8XA 4ZQOA 3WLOA 4HK5A 1A80A 3RU8X 3IGHX 3QFEA 2WMFA 3NZQA 4MJ2A 3IJ7A 4XK2A 3B40A 3IIZA 1THFD 5FCZA 2VUYA 2UY2A 2WZHA 3MJYA 2VZUA 3TMLA 1RALA 2DV0A 1J9YA 3ARSA 3OODA 4D9PA 1LRNA 2CCRA 3D3FA 1X6NA 3V5CA 4LC6A 1J2WA 4A35A 3ZJKA 5K7JA 2VYOA 3MWCA 4AY7A 1QPRA 4PL1A 3GO2A 1TZZA 4HN8A 1IEXA 3C3NA 4OKDA 1XIEA 4RE3A 5K2ZA 2VC7A 1RPKA 2AQVA 3U9IA 3HQNA 5E1QA 3AXHA 3CMGA 4NZJA 1A4LA 4XZHA 4PMNA 5CSYA 2DJXA 1R3SA 3U2ZA 1DTNA 3GBEA 1XP3A 5HWNA 3IGXA 3NVDA 3UZYA 4S3KA 5BXPA 1MEWA 1J4EA 1OFOA 1JI2A 4US6A 1IR1A 4UCFA 2BVTA 4WXZA 3OLGA 3UGVA 5B7ZA 4LY4A 1PTGA 4LCSA 3ITTA 3QVQA 4JL2A 1J0ZA 3LB0A 1D2KA 3E1F1 3GZAA 2WQPA 4M56A 3W73A 1NWTA 1WDPA 5F2IA 1VRDA 4F0LA 5DRIA 5JBEA 3G24A 1V8EA 1W9XA 4MIMA 3I4KA 3LCXA 4R5EA 2D22A 1FH9A 3BANA 2ZUTA 1F6PA 3MW7A 4MMWA 3GU2A 2H8ZA 3A22A 4FX8A 1ZNNA 4JY8A 3WDRA 3EYPA 3LZ5A 1O6IA 2VUNA 4HNOA 3W26A 1VBGA 4AX7A 1S46A 1SW0A 2OKOA 3G1SA 3LXCA 3CPUA 4ZXLA 1X1OA 4NRSA 2V69A 4N02A 5I03A 1EEPA 2PDMA 1RPXA 1NWSA 4LB4A 3P60A 3W25A 3VKKA 4C60A 1ONWA 1AH4A 2WSRA 1UIOA 3WK0A 5AYXA 2V2DA 2D2OA 3WJZA 5CPQA 5D03A 3R5EA 2XFFA 4GY1A 3UJSA 2FTYA 5A6JA 1HKWA 4UR8A 1UBSA 3NXFA 1W31A 3MT1A 4M6UA 5DT7A 2YXOA 3FLUA 3AYTA 1SFTA 2OOGA 4B5XA 2GJLA 4YVVA 1B2YA 1G4EA 1Q2SA 1PTAA 3FYOA 2Z25A 1XC4A 1BGAA 4O8RA 2PWFA 1CGWA 3W7EA 1HN1A 1RCXB 1K8YA 4L5ZA 1E0VA 2ALRA 2GVLA 4R7WA 1P1XA 3KP0A 2E5DA 2C19A 1TCDA 2VWTA 4A6GA 1K6WA 3NQGA 1BWLA 1WV2A 2H9AA 4DXKA 3NQDA 4S3DA 3PBVA 2DU2A 2E6YA 3BMXA 4GJJA 4K1GA 2YB1A 3RJXA 1QI4A 1CI1A 3W84A 1H0IA 3HJEA 5C8BB 2I17A 3ITVA 1K3UA 3PF3A 3MP3A 1R47A 2DZPA 1DIOA 3EMCA 3GAKA 3LXAA 2CLPA 5D2WA 4JTQA 4Y90A 2O9PA 3CAKA 4J40A 4D6GA 1KBIA 4YJ5A 1EB3A 8XIMA 3SCPA 4AF0B 3OGVA 3F03K 2YLLA 4FOJA 2CEQA 4DUOA 2C71A 1FY6A 2J9XA 2ANUA 4JX5A 1RV8A 4OECA 1GW9A 1O7AA 4O4VA 4AIBA 3NOYA 3RITA 5EMUA 3KBJA 4HNCA 1H61A 2DIJA 3MBFA 4JY9A 1W9DM 4ES4A 4WKFA 4KFPA 1DHPA 3TYBA 1I2PA 2OYLA 3U48A 1P5BA 3KCOA 4PR4A 3WLLA 3T0TA 4HU3A 1ISXA 1F3WA 1OBAA 1NVMA 1J12A 4F0SA 1K7XA 3IJLA 1O4UA 1MFUA 3W1TA 3WJWA 1NF0A 2J77A 1BRLA 3SIZA 2QYGA 3OVGA 4FR6A 3LOTA 1QNSA 1SMAA 4I9MA 4QDPA 2ZZ2A 2CESA 3T2QA 2I9EA 4MNJA 2VGFA 5FOOA 3TYEA 1E9IA 3CHFA 3O05A 3RNDA 4HP5A 5A6LA 2VEGA 4MY8A 4X9YA 3CC1A 2YPIA 3CTLA 3Q58A 2HNHA 5HMDA 2PDPA 2DZVA 3AHXA 3FA5A 3PAOA 2OX4A 3U4AA 5CBJA 1SR9A 3GNNA 3PUGA 3ME3A 3VINA 3N4AA 3S1WA 5A8QA 1A5LC 3AFBA 3T55A 1O94A 3WH5A 1E1EA 2YDRA 1MQPA 3SCOA 1E72M 3ATZA 3MYOA 1AD4A 4C1NA 3GVWA 1RD6A 4GG9A 4KW2A 4ATLA 3CUGA 1BTCA 2A6LA 4MM1A 3LRLA 3VNMA 3IV8A 4Q22A 2BXVA 1G1YA 4IQEA 2A0NA 3AJ7A 2GDUA 1AD1A 4CU7A 2OT0A 3MYPA 2PDJA 3LCIA 2E3ZA 3NJ3A 2O9TA 2QV4A 5G4HC 4AH7A 4JFWA 4S3EA 1VEOA 4IHCA 3WDPP 3PJTA 4MZ1A 1V03A 1GOKA 4PZVA 1UR3M 3AMLA 5HPCA 4OHQA 1GQJA 5LHFA 3RK8A 1AQMA 1UB3A 1OABA 3CAQA 2FHCA 4JTUA 4U2ZA 1Q2RA 1BVZA 3O06A 4EOUA 3NZPA 3SB0A 4D6CA 3BCFA 4CD8A 3BDKA 1PL9A 2R1PA 4XZ9A 3A13A 5T26A 3TQ0A 3S5OA 1CXKA 3F4DA 3B0XA 3L23A 1CXFA 4F2TA 2FZNA 4O1EA 3I4EA 3S5SA 3W2KA 1OCJA 2NXIA 4JTGA 3K8MA 3SN1A 3SY5A 1I60A 5I3DA 3PPGA 5LXEA 3MCOA 1E9YB 5HJXA 1FWGC 4MJZA 3CUJA 4S3GA 4B90A 2DZTA 1TFVA 1B3XA 4IIDA 4GPNA 4HNVA 4EWJA 1G9HA 5XINA 2DIEA 1DJIA 1XD1A 3LRMA 4CUCA 4XBKA 3DI1A 4XVDA 3NPVA 4WDTA 1TPWA 2BV9A 2QVNA 2BTMA 3G0SA 3NEHA 5C54A 3QLDA 1SFSA 4H9XA 3S1VA 4AB4A 3PPHA 1WUFA 3SY8A 3GFXA 2PBGA 1QHPA 2OFJA 3EXTA 1JNDA 4BI6A 4TMBA 4IL0A 1W8GA 3FDKA 5DY3A 4PTXA 4B5SA 2NQJA 4XVEA 3EEZA 4W88A 1TTJA 3CHVA 3FGCA 1NIUA 5D38A 1GHRA 3NL6A 3FVDA 1XYZA 1RBLA 1TRIA 1US3A 3M9YA 5DXYA 3FCPA 5C2CA 3AMCA 3NM3A 1VPYA 2DSZA 2OYMA 3ZT7A 2VQTA 3UR7A 4EPDC 1P0EA 5T91A 2DSVA 2QJHA 3T4CA 4DAIA 1KRCC 4LRSA 1JUEA 3LMYA 3DU0A 4M24A 4IMFA 2I1OA 3OGSA 1NDWA 2RAGA 1WXZA 1BYBA 4CCZA 2NW0A 3C0QA 3STCA 4GGBA 3GTIA 3LS9A 2P8CA 1FHLA 1HGWA 3BJTA 1MW0A 1KTNA 4HSNA 3K5XA 1QI5A 1XDLA 3WO8A 1E3XA 1KKOA 4W7UA 1QR7A 4DELA 4UNLA 1VYPX 1W9BM 3Q65A 4LS0A 1P1MA 2HVOA 5CG0A 4FOUA 3HV8A 3MSGA 3K8LA 1NAL1 1OHLA 2AL2A 3TQKA 3EA1A 2VOMA 3GXTA 2A4AA 1A5UA 4XAZA 4IGMA 3NO3A 3WNKA 4AAJA 4R85A 1RBOB 2V3FA 3AS0A 1Q65A 4H8NA 4CGTA 4MB5A 1IZKA 5CEWA 3WD1A 4LVGA 4F3HA 1FWHC 1OFPA 1EO5A 1TYGA 4Z1BA 2CPUA 1WA3A 1OVDA 1Z69A 3VILA 3VPLA 3P74A 1DE6A 1GQKA 1MQQA 1L2UA 1W5NA 4UTKA 4Q8NA 2L5HA 2YOCA 3PANA 2GOKA 3DFTA 1XXXA 3RM8A 5A8GA 3DBNA 3S5NA 2G0WA 5G1YA 1K4HA 2PLKA 1ZENA 3ANVA 1GVRA 2C3ZA 3AROA 1H1YA 4NVTA 3KXQA 3AXIA 3NQ8A 4RE2A 1DJZA 3ZWSA 2QJJA 2D0FA 5U7SA 2OEJA 2YCLB 3TE9A 3W28A 2FPVA 2FZMA 3CZEA 5HINA 1POKA 1DHKA 4GO8A 1J0JA 1XLMA 2C15A 2PF0A 4P8XA 3TFCA 3C2RA 4JNYA 5C0QA 1EA0A 4P7RA 4QCFA 2X2YA 1XYFA 3GTFA 4KFNA 3C6CA 3TYZA 2W79A 2XIBA 2J47A 1RQHA 2HK1A 4HHLA 4DWDA 3REQB 4MG4A 4ERAA 2Z4GA 1B4KA 4GUHA 1TVNA 2BOGX 2DZAA 2DVUA 3QTGA 1BVNP 2NXGA 2F7FA 1ADOA 1UD2A 1MUMA 3SN4A 4JIIX 2ZUNA 2I9UA 1TPC1 4NRRA 4TOQA 1WOBA 3TSBA 1OX4B 4R33A 4QFUA 2JEPA 1E51A 1UC5A 3G0UA 2ZC1A 3CZKA 1R3YA 3E2RA 1SYTA 3B8IA 2O56A 1X96A 1MMFA 1Z9AA 5CBIA 4WX2A 3QBUA 3QM3A 1Q7ZA 3SRDA 3IV3A 4IL2A 1RA5A 4U28A 3ZLHA 1J11A 3ITCA 5E09A 3LY0A 2OEKA 1K7FA 3IVUA 3H12A 3RGTA 1IXNA 1FQ0A 1FOBA 3F4NA 4PA8A 4U4MA 1ZPTA 2Y4SA 1TPUA 3I6TA 5EMJA 2V5BA 5LNUA 1B54A 1UR9A 2OWWA 1V3HA 5F2GA 2J8FA 2BB0A 4L64A 5HULA 1S5WA 3VMOA 1XIJA 5AVNA 5FSEC 2NV9A 5CAKA 4I7WA 1CTNA 4MKSA 3P2VA 1CLXA 2ZUUA 1I6NA 5HPOA 3AIBA 3WQVA 1LCOA 2F9RA 2Z00A 2ISWA 1H11A 1JPHA 1FWAC 3LU2A 1KBJA 1JIBA 2IQ0A 1AMKA 3WQ4A 4RZBA 3NQCA 1EQPA 4E2VA 2RUSA 1NOUA 4E8CA 3K2GA 2WKGA 3ARYA 4UFHA 4GYKA 5FF4A 4G56A 5DO8A 3G1HA 3DENA 3V3WA 3SZ8A 2X7VA 3NA8A 2BHYA 1MYRA 3KEHA 1ADDA 4GH3A 4LS1A 3DZ1A 4NYYA 2B0MA 2J27A 5M3WA 2PDQA 1HG3A 3HPZA 1HJWA 2WBKA 3TIMA 1UP3A 1XICA 2E7FA 3TQPA 1ALDA 4KCVA 3S8HA 5BU9A 1WYIA 3BJSA 3PR2A 1ZSXA 4A3YA 4J3XA 1EJSC 4YTUA 2NQZA 1HJXA 2HV5A 3OLIA 2OWCA 4LSBA 4H3DA 2PB1A 3H23A 4M82A 3MTWA 3AIRA 3P3BA 1DL3A 3KRBA 5I3HA 3VOHA 3DHFA 4LQ1A 1EQCA 3ITGA 3IANA 1O5RA 4R7JA 1VIWA 3PNZA 1R3WA 2WLYA 3BOXA 1K03A 1V5XA 4HSOA 5CH9A 3JVAA 4OV9A 1ZFJA 4DJDA 1YADA 4BFAA 2C0AA 1C93A 3GDRA 1GVYA 1VP5A 4UZSA 1YTKA 1SSDA 4JD4A 3E0WA 2PRLA 2ZFAA 2ABAA 3MHFA 2OODA 4O0KA 3UD6A 3N12A 3E9AA 1FKXA 5CZTA 3F4WA 1OGGA 1VFMA 4XBSA 4WDUA 6CGTA 3HQOA 1EXPA 4MPQA 2Z1WA 3GVQA 1MZHA 4RZ4A 1EJUC 2QMKA 3EBVA 3M0IA 4HNNA 1IR2A 2WLZA 2GGEA 4LUJA 1L2QA 2FB3A 4H04A 2PS2A 1YLVA 4YS1A 5REQA 4CD5A 3AMKA 1KGXA 4P2VA 5A8NA 3NQ7A 1GORA 1Z48A 4JQAA 4DY1A 3FIGA 2J7DA 2PDGA 6REQA 3VOCA 1KCLA 3TAOA 4UR7A 2G3IA 4MB1A 3JZEA 4NT0A 3RLGA 2I5GA 2EPHA 2E6DA 1KM3A 1A3HA 1ZAHA 4GLEA 2EJ1A 3W6YA 2HBVA 2ZYFA 4CD7A 2ZKMX 2KAUC 4GNVA 2OGYA 3E96A 5FF7A 3EKGA 5M2FX 2XVKA 3LLDA 3FY1A 2PURA 4L1GA 4TQTA 9RUBA 3QPEA 3KCLA 2YW4A 7REQB 3H4GA 4GVIA 4XZIA 1HL9A 4KRZA 4ZXOA 5C9WA 1ZALA 4M51A 1FFRA 2ISSA 2JIWA 2YYUA 5BYWA 1YPXA 3FVMA 2CLOA 4NQ1A 1CNVA 2WB5A 1N55A 4JQ3A 4IGSA 1ZS2A 4X22A 1VD6A 2RGLA 3AISA 1FDYA 4Q32A 5AYYA 5ABTA 2CNCA 8XIAA 1NQ6A 4KWUA 3S1GA 3ITYA 3F2DA 5CBBA 3N14A 5CC6A 1A5OC 1KFJA 2PP1A 4RX0A 3KOFA 1EX1A 5DQPA 1MUWA 1H2JA 3H6OA 5F4WA 3TONA 2FGBA 3GYCA 1NJJA 5HR6A 4J3SA 2QCFA 3VAVA 2A79A 3GLCA 4QEHA 3ARZA 3TKFA 1QOXA 3QMTA 3A12A 1C91A 4GMEA 4JTJA 1DPMA 4PCFA 4NXSA 3E38A 3UA4A 2VWSA 1DXEA 1XFBA 1OQFA 3I3EA 3ZR4A 3QC3A 1TX2A 4AX6A 4A3HA 4LTSA 4QNEA 3WDQA 3FAWA 3LNMA 2NQHA 2PTZA 1W6TA 4HMCA 3GW3A 4O8AA 1UMLA 1EJVC 1PTDA 2ACSA 1GGOA 4XD5A 3KS6A 2X0SA 2EPMX 3QY8A 2CHRA 2PWVA 5TBOA 1YE4A 3AZRA 1FWCC 3GB6A 3B8VA 2V5LA 3A24A 3O2LA 2XFWA 3YPIA 2DUZA 3M0LA 1XCWA 3VGGA 1Z44A 4ASTA 2G3JA 4H8VA 4V2XA 3H2AA 3W01A 1GOXA 3KWSA 3GHTA 3NWRA 4XV0A 1JAKA 4AXKA 4Q6JA 4L61A 7PTDA 2X1RA 3CQIA 1AMYA 1HFBA 3OA5A 3H4XA 1QOPA 1UP2A 3WEOA 1CECA 1EP2A 1V7YA 3NO1A 5D9OA 4JKLA 2F6KA 5T9CE 3S83A 1PX8A 1XLKA 3WLPA 4P7OA 2PTYA 1CGXA 4O14A 4UBPC 3WKZA 2VC5A 1JDEA 4XB3A 3MU7A 3HO8A 3HZ3A 3E6EA 3GXIA 3WF1A 4W86A 2QPUA 4P61A 1FXQA 3VC6A 4DPPA 4RNIA 4CD4A 1WKDA 3V0TA 4K7VA 3WNNA 5DRCA 4MUZA 4WDWA 1JPIA 3WQOA 4FNUA 3WQGA 1BF2A 3I7RA 1QVBA 1X7IA 2J79A 5XIAA 1W91A 1JCNA 4BWLA 2J13A