5M3WA

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-1,2-dideoxymannose and alpha-1,2-mannobiose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
350
structure length
350
Chain Sequence
b'NNNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase family 71
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
total genus 131
structure length 350
sequence length 350
ec nomenclature
pdb deposition date 2016-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m3wA00
3KE0A 4UZUA 3MU7A 2J7HA 1F4AA 2D3NA 1XGZA 4JL1A 2CBUA 3HN3A 1MW1A 4UFMA 4MB4A 3T2PA 3SCUA 3OZPA 5CSUA 1BGAA 1E9LA 1ZBWA 3ZT5A 3A4AA 4P7LA 4UQAA 4UFJA 1ZBVA 4J3XA 5IHSA 4TVUA 3N9KA 2DT0A 3MANA 2WBKA 4CUCA 2ZUVA 3OGVA 1C7TA 1BG9A 5HNNA 1UHVA 5A8QA 3TTOA 4ZFMA 1IV8A 4QAWA 5IFPA 1UR0A 1UH2A 1ODUA 1E6SM 3U57A 1EIBA 1QNPA 3WMCA 1UA3A 3AYRA 4R5EA 3NJ3A 1Q6CA 1ISZA 3AJ7A 7CGTA 3GXFA 3B9AA 2DEPA 3W27A 4F66A 1Q6FA 5DMYA 1E56A 3VGBA 3THCA 1NOWA 2DIJA 4EKJA 3T09A 3UG4A 5I79A 4MTVA 1V0KA 1VB9A 2YKKA 1MW0A 2A3CA 1NWUA 3CZLA 4J3WA 3PHAA 3OLDA 4CCDA 4JCLA 2GSJA 3LMYA 1TFVA 2IXVA 4L4OA 4A3YA 2J7EA 3W28A 1JF5A 2CCRA 1OGGA 4WSJA 4CCEA 1CBGA 3RILA 1K9EA 1GJWA 1KWKA 3VIHA 4ATDA 2PWEA 5E0CA 1QI3A 1V6WA 5A8PA 1GOOA 4BQ4A 2XFRA 2WMGA 3QOKA 2O9TA 4P8XA 4MNJA 4JKKA 4CD7A 3MUIA 4UFKA 3VX1A 2VC9A 3AMGA 3VTRA 4FLSA 3WKZA 4ACYA 1V08A 1U30A 2YBTA 1JAEA 4JFVA 3RJYA 4PN2A 2JEQA 3GH7A 4TUFA 3WEMA 4KWUA 2WMIA 1QHZA 2OSXA 1DWGM 1UUQA 5CGTA 4W84A 4MNKA 5FL0A 1KQZA 3BH4A 4HA3A 2XVLA 4QP0A 2DDXA 1QHOA 2VT0A 3GZAA 4PEEA 1FA2A 3AISA 2BFGA 5I0DA 4BZYA 3NUKA 2Y8KA 4GO9A 1FHDA 3LPPA 3S2CA 2BS9A 4H8HA 3E1F1 4H8UA 1VEMA 3WF0A 5BXTA 1MXGA 1FHLA 5IFTA 2VR5A 2WCSA 4P7NA 1VBUA 1O6IA 2WZEA 3VM7A 1TCMA 3WEOA 5A8NA 2CBJA 3L4VA 4AD5A 1CXFA 1QVBA 4GI6A 2W63A 1CXKA 2J7GA 3DECA 2YIHA 3WH6A 4W7WA 1O7AA 4M80A 1EQPA 4XB3A 4IUGA 2E9LA 1J18A 3NSNA 6TAAA 4PMDA 2VR4A 1LL4A 4B9ZA 3VVGA 3ALGA 4U31A 4AIUA 5CLWA 3AXIA 4U33A 4AZ6A 1VRXA 2BXZA 4NSBA 4EK7A 1DHKA 2CEQA 2V3DA 2D22A 4WKFA 4U2ZA 3VX0A 4ZENA 4CVWA 3AHZA 4CCCA 4CD4A 4UCFA 3PTQA 3VM5A 2OYKA 1XC6A 1W9UA 4MB5A 4W5ZA 3ZOAA 1KR1A 3WDJA 1J01A 5A95A 4AZBA 3BGAA 1ECEA 1E1EA 1W9VA 4OOZA 2JIWA 1AQHA 1H49A 4FMVA 1JZ8A 1EO7A 2OSWA 4S3JA 2XUCA 1HVXA 3SIMA 5AYBA 2DSKA 1V6YA 2VVNA 1TVNA 2VQUA 2G3MA 4HOXA 3PZTA 4JFTA 4GQRA 3WNNA 2DIEA 3RDKA 2BHYA 4N42A 1G5AA 3A47A 4GKLA 3SEPA 3I3DA 1PZ3A 2D0GA 4PBGA 2WVTA 3WQ4A 1D3CA 2XSBA 3CGTA 4AW7A 4AY1A 1UR8A 3CBWA 5FD0A 1MYRA 3LPFA 2JIEA 3UG3A 1E4MM 1DP0A 2ZOXA 1IT0A 2D3LA 1BPLB 1EA9C 4PUEA 1WKYA 1B3WA 1VENA 2EBNA 3U7VA 4PCTA 4ML4A 4YN5A 1JI1A 3BLKA 4GI9A 2UY5A 4YPJA 3APGA 2D23A 1BLIA 4PTMA 3W24A 1FH8A 2BHZA 3VU2A 4ACZB 3EDJA 1GZJA 3OZOA 4MJ2A 3L4XA 4HZ6A 1W1YA 4TTUA 5BYWA 3MUAA 4MJ4A 2WHKA 2GJXB 2VRQA 3FW6A 3VD9A 2WBGA 3EMQA 4ZE5A 1JYVA 4LGXA 1V0MA 3WNLA 3VOCA 4GINA 2WMFA 3T0AA 2XPKA 3WD2A 1F4HA 5D8WA 2PWHA 2DQXA 2WVVA 4HOZA 4RL3A 1CGVA 2CIPA 1JDAA 1ODZA 1E6NA 1Q6DA 4XZBA 4LYPA 1CXHA 2WAGA 1W32A 3WDRA 1UWQA 3GBEA 5GNZA 1KBBA 1SR0A 1E5NA 3CHFA 1BQCA 4CU8A 3CUFA 3W6LA 3SUTA 4UFLA 4AIOA 1OINA 5D4YA 5HXMA 3CZJA 3AS3A 1R7OA 3VGEA 1PX3A 1J12A 1B3VA 1ZJBA 3WNMA 3O2LA 4M1RA 1ZBCA 3GNPA 4MADA 2WM0A 5E6YA 4IPLA 1HP5A 1W9BM 1NP0A 5EFDA 1UKTA 1E43A 2X05A 1U2YA 2ZWYA 4D6GA 1V3KA 1PPIA 1XYZA 4RE3A 2V3FA 4GZEA 3WELA 3ZR6A 4HPGA 2EXOA 1IZJA 3PZ9A 2W67A 3QGVA 4W89A 4WKHA 3GBDA 3NYDA 1OSEA 5A69A 3BAJA 1R87A 2CHNA 1KB3A 4MNLA 1GJUA 3WH7A 3CPUA 1QBBA 4HZ7A 3RM4A 4F9DA 2WMJA 2OLHA 3ECQA 2QPUA 2CESA 1UQYA 2J7DA 1C90A 1HXJA 2XIIA 3CZKA 3AIBA 4AXNA 2WLYA 3KWXA 4CU7A 3VIIA 1CPUA 2VZTA 3W81A 4PYSA 3GH5A 2CPUA 1KCLA 3W37A 5JIWA 1NARA 3VILA 1CXEA 4AISA 1EHAA 1V03A 4KH2A 1GOQA 2VTFA 2X8RA 4ZE4A 1E6PA 4QCFA 4H41A 3W25A 2BV9A 1EOKA 4D6IA 1JFXA 4W87A 3AS0A 1UOKA 2YA0A 1V02A 2A3HA 3GH4A 4AYSA 4M82A 1MW2A 5LA0A 3MO4A 3DYMA 4OKDA 1CECA 1GHRA 2GDUA 1XV8A 3T08A 1KGWA 1BF2A 4Z2LA 2DH3A 4J3VA 1E6QM 1QPKA 1BAGA 4JL2A 4KRTA 4W8BA 2DH2A 1WDRA 4BQ3A 2CBIA 1HKMA 4E8CA 3AI0A 5AC4A 1OM0A 2WK2A 1GQKA 1AQMA 4PRWA 3OA5A 3OLEA 5D9OA 1JFHA 3SCTA 1VFOA 2PBOA 1GORA 1UR1A 1UD6A 3A4XA 3U7BA 2BNJA 1OB0A 3WDPP 3ALFA 2PF0A 2O9PA 1HL9A 5E70A 2YA1A 1JI2A 4AD4A 4ATWA 3ZM8A 3MSDA 5D9NA 3ZIZA 3LPOA 4LYRA 4AZGA 3CHDA 4LQ1A 4M81A 1OBAA 1R7AA 2E8YA 1WPCA 3SCNA 2F61A 1H41A 4WIWA 4C7FA 4Z2JA 1WZAA 4UFIA 4P8UA 2FH8A 4S3KA 1UA7A 5I23A 4W86A 3RCNA 1DEDA 4E2OA 2WMKA 4JFSA 3IJ8A 4PMNA 1UKOA 4PTXA 3CTTA 2J74A 3WDHA 1KXQA 3WBEA 1XCXA 1JXJA 4DWSB 1GVYA 1K6AA 3WH9A 1JYWA 1XSIA 1JNDA 2YA2A 1OIMA 3M07A 4D6JA 3VGHA 1KGXA 3D5HA 3UG5A 3K46A 2ESCA 4CKQA 1K9DA 3OGSA 2AAAA 1QI0A 1UD2A 1QW8A 3WMSA 3TP4A 3OB8A 4UR9A 1UZ1A 2J7BA 2WMHA 1VBRA 1CGTA 1G1YA 4D72A 4YHEA 3O6AA 3L4ZA 4W7UA 1GHSA 4IM4A 3IJ9A 1AVAA 2X1IA 3OLIA 2D0FA 4D1JA 4HMDA 4MAZA 3WH8A 3SCPA 3CH9A 4ZXOA 1MFUA 4X0NA 3VIFA 2J77A 2WLZA 1V0LA 3CLWA 2WKLA 3W38A 1OD0A 2ZX8A 3WBAA 3ARZA 2E9MA 2XVGA 2Q8XA 2ZX7A 3ZJKA 1GONA 3N1AA 2G3IA 2ZUNA 5ABHA 2G3NA 5AY7A 3RJXA 3MSGA 4GZJA 1FH9A 1CENA 1JG9A 3FAWA 3SCQA 3KL0A 2NSXA 2ZUSA 3N15A 1UKSA 4AMCA 3LPGA 1ITCA 4OZOA 4DUXA 5A6BA 4OUEA 4AIEA 2NT1A 1E0WA 1R85A 4UFHA 4F79A 1XH0A 2WKGA 3W53A 3QHNA 1KWGA 1WCGA 5BXSA 1GVIA 1VAHA 2FDMA 3WF2A 4Z2GA 1LG1A 1J10A 3UETA 1JZ3A 1E4NA 1QNOA 1JNEA 2EO7A 1QHPA 4JAWA 3W82A 5JUVA 4QLJA 4IPNB 1XHGA 1V3IA 2EEXA 1WO2A 4D71A 1HL8A 1W9XA 3TA9A 4D6EA 3F5KA 1XD0A 3N04A 4BQ2A 2WW5A 3PBGA 1H09A 3AIEA 2ZX6A 3WUEA 4EAMA 4LX4A 2D24A 6CGTA 1HJQA 3EDDA 4H2CA 4U3CA 4LPCA 3CZEA 2JALA 2WPGA 1EHNA 2VX6A 2W91A 1Q6EA 4F8XA 4WKAA 1BYCA 1YQ2A 3T2QA 3CUIA 3L2LA 2CKRA 1C7SA 1VFUA 1BG4A 2YBUA 1HKKA 1CIUA 2EPNA 2EPMX 1VFMA 5M5DA 1TUXA 1TVPA 1V3JA 3U5YA 4UNIA 1W1TA 1TZ7A 3WD3A 1XH1A 4UQDA 3AFBA 1C3FA 1US3A 1WAWA 5BXRA 2FGLA 4U5IA 3AIWA 1KXHA 2VZVA 4KGLA 3SCRA 3PZNA 1B90A 3VMNA 1BGGA 2Z1SA 2WHMA 1YHTA 3F5LA 1V6XA 1VIWA 3AS1A 2BVYA 2VUYA 2YDSA 1JZ4A 1JXKA 1VF8A 4D6CA 3EMCA 2GVYA 2WCGA 3ARYA 5E6ZA 2ZXDA 5EFFA 3K4DA 3AHYA 2X0HA 4P8VA 3FHAA 1H11A 4JFUA 1KXVA 4XUYA 3CUGA 4ACZA 4CN6A 4W85A 2A3EA 2CYGA 3MMWA 2GJXA 1R86A 3PZMA 4UZSA 1OWQA 2J8GA 3FHQA 4UQ9A 5DEZA 1A47A 3ARUA 4CU6A 4HMEA 2XG9A 2F8QA 1RD6A 2V5CA 1EOMA 2VOTA 3CMGA 1HJWA 3KL3A 3SCSA 1E5JA 3K1DA 2WB5A 4WF7A 1ISVA 2O92A 1OGSA 1E0VA 4QLKA 1HT6A 4AD0A 3AIUA 4MB1A 3EBVA 5F7UA 4U5KA 1DWHM 3EMZA 2VX4A 2ZWZA 1WDPA 2VVSA 4OIFA 2ZIDA 1Z32X 4M8UA 3WF1A 1N82A 4PMVA 1HP4A 2AOSA 2D20A 2EPKX 5AYIA 3WQ6A 5JBDA 3VD3A 5GQBA 4DM1A 4B15A 1CLVA 1NM9A 2F2HA 5CQ1A 2JFEX 1TR1A 4PCSA 1M53A 4L4PA 1VFFA 2VI0A 2XGIA 2A3BA 3GNRA 3VIPA 1E15A 5I77A 4DUVA 1GNXA 1GOWA 1KR0A 1OT2A 1PZ2A 1UH3A 3WD0A 2WC7A 2D0HA 2BVDA 1HJXA 4M56A 2V3GA 3II1A 5A6BD 3NSMA 3HU7A 2PWDA 2OWCA 1US2A 1WP6A 3KEHA 2QMKA 4LYQA 1V3HA 5BRPA 2XSAA 4D6FA 5FCZA 2XGBA 1KFWA 1OT1A 3VGDA 4N0RA 2WYSA 2VZOA 2QHAA 1JL8A 1GW1A 3BLPX 1H1NA 1UH4A 4ZEPA 2VJXA 4HA4A 1HJUA 1GQJA 2ZE0A 3RO8A 1M7XA 3A6OA 3PTKA 1MQPA 3L4WA 4Z2HA 2CERA 5JBFA 2X2YA 1NWRA 1JZ6A 4E8DA 4OBSA 1SYTA 1NP2A 4FK9A 1C8XA 2WHJA 2VO5A 4KRUA 2W4XA 1HJSA 1E6XM 1H0GA 5A6JA 1E70M 1MQRA 1K9FA 2E8ZA 3WUFA 1JYXA 5E9AA 4PSRA 3SCVA 1C8QA 3TONA 2DSZA 2CXGA 2CKSA 2GUYA 3IAQA 4U2YA 5C70A 2G4FA 4PSPA 5LA1A 4HP5A 1XD1A 2XYLA 1XH2A 3WN6A 2VNCA 3K4AA 1D7FA 4URIA 4RE4A 5LA2A 1C91A 7A3HA 1ISYA 1G0CA 4P7QA 2XVPA 3GXIA 2X09A 5LYRA 2YDRA 1MFVA 2XFYA 3SUVA 3UCQA 4GPNA 1AMYA 5D8ZA 5HDRA 4AZ5A 2ZX5A 3AROA 3TOPA 3GDBA 1CZ1A 3KL5A 4HOWA 3FY1A 3GYCA 2G3JA 1H2JA 3BCDA 4WJXA 1VEOA 4J3SA 2E3ZA 3T2OA 5BROA 1MVYA 2Z1KA 3PZIA 1BVZA 1E55A 3T0BA 3QR3A 5CZKA 3EYPA 2V38A 3RIKA 1WZLA 5TD4A 5I6SA 3CMJA 3ARSA 3CZGA 3K8LA 5BWFA 5BCAA 3GNOA 2JF6A 3MUZ1 1BHGA 1PEZA 3THDA 4F9JA 4PUDA 4CD8A 3A4WA 5GNXA 2DT1A 4CN4A 3WQ5A 3AMDA 4MNMA 2CNCA 2PBGA 1FP8A 3UESA 3WD4A 4MDPA 3QHMA 4DWSA 4P7RA 1PIGA 3W26A 2GJPA 2HISA 4D6DA 3AHVA 5IDIA 3ZJ7A 3T0DA 3SURA 1UQZA 4HU8A 5A8MA 1UWUA 4AZCB 1BFNA 4QFUA 1P6WA 1ZB5A 3OG2A 2OYMA 3ZSTA 2EPLX 2BY1A 1E6RA 1AQ0A 4CVUA 3VNZA 3WFZA 3WNPA 3IJ7A 1G94A 4H7VA 4PMUA 4CGTA 1GOIA 2CITA 1D2KA 2J75A 3OBAA 5HPCA 2VCCA 2PC8A 1OD8A 1H4PA 1I1XA 1JZ7A 1I1WA 4J3TA 1XYFA 1UWRA 4A4AA 1QI4A 1QNQA 3WFLA 3WNOA 3O9NA 4W8AA 1TE1A 5CPQA 1Q4NX 4V28A 2W5FA 1GQIA 3AS2A 4M24A 3BAXA 1V0NA 3DYPA 3M6DA 4BF7A 4PMZA 4TX8A 1HF6A 2XVNA 4JHZA 3N13A 1H5VA 1KBKA 3EDEA 5BXPA 1M04A 4CD6A 2XVKA 1LLOA 3WF3A 4JHOA 3WDIA 2VX7A 1ISXA 1TMQA 2FHBA 2JE8A 3DC0A 2G8ZA 1FFQA 2CETA 1LWHA 2YLLA 4GIAA 2DT3A 3VKKA 1DWIM 4PTWA 2E4TA 1XSJA 2BHUA 4TX6A 1TA3B 1B3YA 1E73M 2O9OA 3AQUA 2XTKA 5M17A 3S6TA 5E0FA 1DWJM 5FKYA 1GCYA 2V5DA 2FGZA 1DWAM 1MXDA 1J0IA 3NCOA 2WWCA 4B3KA 9CGTA 8A3HA 5M03A 4FLOA 1HN1A 3B9EA 4UQBA 2WANA 5IXEA 4J27A 2GK1B 2ZICA 5CGMA 5A2AA 4WSKA 2XM2A 1JZ5A 2YL6A 3HJEA 4PMYA 5A3HA 3NDYA 4KGJA 3WUGA 1W3JA 3F5JA 1W3KA 2Y4SA 2DSVA 1JD9A 5CSYA 1UYQA 2C8NA 1UR2A 1DWFM 5A6KA 3UERA 3AZRA 5AC5A 2VURA 1B30A 3UR7A 3BSHA 3NSXA 2VX5A 2VZSA 4X0VA 4J28A 1E4LA 1JGIA 1KQYA 2YDQA 5ABFB 1SMAA 3FAXA 1SFSA 1QNRA 1HKJA 1W91A 1RP9A 2PI6A 2J62A 4JCMA 2ZXBA 2J4GA 4XZWA 3VPLA 2YOCA 3UEQA 2XJ7A 3AIRA 3AXHA 3CZ8A 4IISA 3QHOA 4YHGA 3RM8A 3VD5A 1E72M 4J3UA 4C7GA 4XX6A 1UWTA 3BAKA 4W88A 3WF4A 1W9DM 2E0PA 1M03A 3K8MA 5A6LA 1ISWA 4MAVA 4R27A 2J8FA 3VMOA 1X1NA 1GPFA 4BA0A 3AMLA 3MMUA 5E09A 3ZT6A 1XSKA 3J7HA 3PZGA 2ZXQA 1B9ZA 1CXIA 3ARPA 1C92A 3OGRA 1E6ZA 3L4TA 3VIJA 4UQEA 3DHUA 5HOSA 1RPKA 4DWSD 5A2CA 1BYAA 4MPKA 5CJ5A 4P7OA 1B3ZA 3SCOA 4UTFA 2W61A 1QI5A 1LF1A 5A6SA 2W92A 4PMRA 3VDHA 4CD5A 4KMQA 3AOFA 3F4VA 1CYGA 1VEPA 5JIPA 2J7CA 2V3EA 1CGUA 4QDMA 2HVMA 2WHLA 4JFWA 5I2UA 1JAKA 4DUWA 1J0ZA 2D1ZA 3VD7A 4H04A 3CUHA 5EB8A 3PZUA 3VGFA 1LWJA 2J7FA 4UOJA 2FH6A 2ZUTA 2Y8VA 4PMQA 5M3WA 1H0IA 1EO5A 5I3DA 1KGUA 2UWFA 3BSGA 1S46A 3CO4A 1CTNA 4UQCA 1ESWA 4ZXLA 5DFAA 4GI8A 3VNYA 5DT7A 1LJYA 1LG2A 1QW9A 3BMWA 2DSWA 1R8LA 3VDAA 4WLCA 5D9PA 1W2PA 1UD5A 3VMPA 3VD4A 4AD2A 4BS0A 2MANA 3AMCA 3AMKA 1PX4A 2QPSA 2RGLA 4TTGA 2VCBA 3GXDA 4P8WA 4NI3A 4XV0A 4ATLA 2O9RA 2QV4A 3AZTA 5CPTA 1E71M 5A6AA 1EDTA 5BRQA 1C93A 5I5RA 3B9DA 3PZQA 2A3AA 2RGMA 3FXYA 4Z2KA 5CPSA 3UR8A 1EGZA 4OJYA 2C7FA 4BQ5A 2EJ1A 2JEPA 4TVCA 4NRSA 4Y7EA 4AEFA 5DO8A 2QLYA 3ARXA 5A6MA 1W1VA 1BTCA 3DYOA 1FOBA 2XM1A 1ZBKA 3RPMA 4TOQA 2OSYA 5ABGA 1B1YA 4DWSC 7TAAA 1ZS2A 1L0PA 3BAIA 2GDVA 3TTSA 3JUGA 2UY4A 3HMCA 3N18A 2ZUUA 2WC4A 3G6MA 3U5UA 1EDGA 4AWEA 3PTMA 4GO8A 1CGWA 1WE5A 2YLAA 2YL8A 3FNDA 1BYBA 3N12A 3VIKA 1E4IA 2WZIA 4Q22A 3RMEA 3GXMA 3WL0A 1CXLA 3GTNA 3ARTA 3SCWA 3W0KA 4HPHA 2J78A 1QI2A 4QCEA 4EE9A 2FHFA 1XRVA 5D9MA 2DSUA 1EXPA 1E1FA 1GOKA 1W9PA 4HTYA 4U3AA 2YL9A 2J79A 1ZJAA 3WIJA 4RE2A 3AYSA 1EDQA 3WEZA 1TG7A 4X9YA 2WMIB 1VJSA 3BXWA 2WC3A 2C0HA 4EANA 3ZJ6A 1CDGA 4OOUA 3MV01 3MUY1 2XWEA 3L4UA 5C71A 3BC9A 1W1PA 2OWWA 3B8SA 5A94A 4GZIA 2FHCA 2PB1A 1GOMA 2VL4A 3AZSA 2Y2WA 3MV11 3WH5A 2Y5EA 4GQQA 1OIFA 3SUWA 5A2BA 2VRJA 2VCAA 3ZQ9A 1FFRA 4J7RA 1HX0A 4PTVA 4JZ5A 2WVUA 2ZUWA 2BY0A 1PBGA 1RH9A 4AD3A 3WDQA 3GM8A 1J0HA 3PZOA 1NOFA 3KZSA 3ARVA 5FL1A 1B31A 1UD8A 1BVNP 3W6MA 1UR4A 2G41A 4OBRA 2XHYA 4HMCA 3G6LA 2J47A 4MB3A 4HA1A 3VIGA 3MS8A 1WZKA 1GQLA 3D3AA 1ZL1A 2X0YA 3AICA 2QMJA 3WQVA 1EQCA 2BY3A 1KXTA 1X6LA 1WDQA 3ARRA 3WNKA 4AEEA 2B31A 2XFFA 5A8OA 3L2MA 1WB0A 2IXUA 4C7DA 2UY3A 1E3XA 2NW0A 1IZKA 2CBVA 4AZCA 3ZMRA 1LQ0A 3DHPA 2QF8A 5ABEA 3PN8A 1BYDA 3VINA 4Z2IA 1NOUA 1Y7VA 3A3HA 1MWOA 1QNSA 3PZVA 5KEZA 3AIQA 1E40A 1UKQA 2NT0A 5JBEA 3OIHA 1MQQA 2ZXAA 3TTQA 4UOZA 3M46A 1DTUA 2E40A 3MKKA 3K8KA 2BVTA 4W8LA 1UD3A 5KZ6A 4PMXA 4E4PA 4FLQA 2J25A 1UR9A 1HKIA 4AZ7A 4AZIA 1U33A 3ARWA 5FOOA 1J9YA 1CGXA 4CN1A 3SUUA 1HJVA 3OLGA 4NRRA 4TXEA 3W4RA 5A1AA 2WVSA 1CNVA 3POCA 8CGTA 5GPRA 1HIZA 2IUZA 3VIMA 1W2VA 1JZ2A 3ZR5A 3WQ8A 2WXDM 1KCKA 1G01A 1K9TA 1W3LA 3BCFA 4V27A 1VJZA 1HVQA 1WZMA 1XCWA 1MW3A 1NQ6A 1FP9A 1HNYA 3ZJ8A 3VGGA 2GJRA 3FN9A 1V02E 3AHXA 1OCQA 2EPOA 2BXYA 1UWSA 4A3HA 4FF5A 2AMGA 1WNOA 2W66A 2E9BA 2VMFA 4TVDA 3QOMA 2XWDA 1A3HA 4M29A 1JDCA 4FLRA 2WWDA 3BAWA 3ZO9A 2WZHA 4Q7NA 5GNYA 3AIVA 1CEOA 3CHEA 1TA3A 1NWTA 3L4YA 1C8YA 3EDFA 5I78A 1JF6A 4LXFA 5EBAA 1OGBA 1X6NA 1CGYA 2ZX9A 3RM9A 2DGAA 1V6UA 3I3BA 4AD1A 1NH6A 3CUJA 1UD4A 4H8VA 1JDDA 4MDOA 1I75A 1NWSA 1V3MA 2GK1A 3ARQA 3WQWA 1RP8A 3BAYA 4JKLA 1UWIA 4W7VA 1UKPA 2VZUA 5EMYA 5DF0A 3IK2A 1QOXA 2WSKA 2UY2A 1QBAA 3IANA 3SUSA 3EDKA 4UOQA 3MMDA 2WVVB 2TAAA 2BY2A 1ZU8A 3WSUA 1FH7A 3WY1A 5CLTA 5IHRA 4DM2A 3IAPA 3BMVA 1B2YA 2CHOA 1B0IA 4B16A 4BCEA 3WL1A 1CWYA 3VIOA 2D2OA 5ABFA 2VQTA 1WDSA 1E0XA 4D6HA 3VUPA 4QLLA 5ECUA 1B3XA 1J0JA 1J0YA 5FIPA 3I3EA 1JD7A 5HPOA 1UG6A 2PWGA 1PX8A 2OWXA 3N11A 6A3HA 1J11A 3VDBA 1PIFA 2Y24A 1LL7A 1V6VA 3N17A 1CLXA 1SMDA 4HU0A 4AC1X 4JKMA 2EQDA 4NF7A 1E3ZA 1JYNA 2WNWA 2YJQA 4B9YA 5I24A 4HZ8A 3WUBA 1GUVA 2OYLA 4K68A 3NDZA 1G9HA 2WSPA 3NIYA 3WD1A 3CHCA 1UZ4A 3POHA 1L8NA 2XIBA 3VDCA 1M01A 4AZHA 2YL5A 2DPEA 3M7SA 3ZSSA 1LL6A 4D1IA 4W5UA 3WENA 2GFTA 1J0KA 4NZCA 1PAMA 3VO0A 2W62A 4PMOA 5CG0A 3AXXA 3WMBA 2JF7A 4W93A 2DT2A 3ZT7A 1ITXA 1JIBA 5CXPA 3CIVA 1V3LA 1H3GA 2VRKA 3AHTA 3TTYA 2PWFA 1Q6GA 5C8BB 1W3HA 5DT5A 4GXPA 1BSIA 4JIEA 4WK9A 1PJ9A 3W29A 5HBFA 2WCAA 2ZUMA 4B3LA 4V2XA 1EH9A
chains in the Genus database with same CATH superfamily
1PV8A 4B5VA 3KE0A 4KFNA 2AKZA 5DELA 3OVQA 4GCXA 1F4AA 2D3NA 1XGZA 4JL1A 2OCZA 4UXDA 1MO0A 3T2PA 3TXZA 3R89A 2BASA 1LBFA 5CSUA 1BGAA 3UP8A 2ZRYA 3A4AA 4UQAA 1XLLA 1MEIA 2AL1A 2HJPA 4NZ3A 3ISIX 2DT0A 1TPEA 3MANA 3LCGA 3RCMA 4RZ6A 1FWRA 2ZKMX 4UR7A 3V16A 4J40A 3N6JA 4RNJA 3U57A 1QNPA 4FZIA 2OT0A 2VGFA 3WMCA 2TODA 5C7HA 4R5EA 3M0VA 3PBVA 3AJ7A 7CGTA 2YYUA 3B9AA 2DEPA 3W27A 1Q6FA 3FYPA 4J9JA 1E56A 4HK5A 2DIJA 4EKJA 2J13A 3VI2A 5I79A 1RSCA 4MF4A 5AHIA 1NWUA 2H90A 1OFRA 3CZLA 1EIXA 5LNVA 4MYXA 3PHAA 1R3VA 4CCDA 3GTIA 4JCLA 4BHYA 3ABXA 4IXHA 5FESA 3W28A 1JF5A 2CCRA 4WSJA 3L9CA 4CCEA 3FOKA 3ZWSA 1I2QA 3KXQA 4OU1A 4Z1DA 4ATDA 2PWEA 1YTEA 4NX0A 1R2RA 1V6WA 5A8PA 4IP7A 2AL2B 2PTXA 1OFQA 2HWGA 1XIMA 3MUIA 1XIDA 5CC6A 4JY9A 3PJTA 3MCMA 4ZOCA 4FLSA 1V08A 2D69A 3UWWA 4S3DA 3O6DA 1U30A 5JXQA 1MRAA 4I5XA 1HO1A 5CPMA 3WEMA 4DJDC 3QV8A 4C5ZA 1UUQA 2B7OA 4MNKA 3K1GA 4HA3A 3OODA 5HWJA 3UQNA 3GZAA 1BXBA 2PTDA 1OK6A 1XYCA 4XO7A 2Y8KA 3GS6A 3N2BA 4FALA 4GO9A 1ZQ5A 4H8HA 4GISA 5IFTA 1EA0A 4FXJA 2FVLA 3LCIA 2CBJA 3L4VA 2WOQA 4E8GA 1Z8AA 4POCA 4GI6A 6TIMA 5CSRA 2ICSA 4H19A 1S2UA 3HZ3A 3L5LA 4H83A 2J7GA 4MIMA 3H2EA 1O7AA 5DMMA 3G1AA 4O1EA 5DLCA 3S1VA 2EG6A 3GXTA 3H55A 3LB0A 3WX7A 4PMDA 5FEXA 1VP5A 1Q65A 4B9ZA 3MPGA 4QEHA 4U33A 3CUZA 3P80A 4FNQA 2PDLA 4AZ6A 4JN6A 2XISA 3LENA 1EJRC 2BXZA 1VYPX 3SGZA 3TLQA 1DHKA 1W1B1 2CEQA 4U2ZA 4JTIA 2E1WA 2ZA3A 4Y9OA 1YXCA 4RZ5A 4JTDA 3PTQA 5HINA 3GX9A 3SJ3A 1XC6A 4MB5A 2RKXA 3EB3A 3ZOAA 5KZMA 1Y5WA 1KC7A 5A95A 4AZBA 2V67A 4UTLA 1W9VA 2JIWA 1AQHA 3OZMA 9XIMA 3RX4A 3B05A 2XZ9A 2ZRWA 4M0XA 4Z1YA 4UTJA 4JQ2A 4GY0A 2GGJA 2QS8A 2Z00A 2G3MA 4HOXA 3PZTA 3C52A 4Z17A 4F40A 3WO8A 5D38A 4GKLA 1PZ3A 3LHUA 5AYXA 2WVTA 2XIOA 2BXVA 3GR4A 1SFLA 3L0KA 2ZZ4A 4AW7A 3GNXA 2VXNA 4N4PA 1MYRA 3LPFA 2FMOA 4GVIA 3HO8A 4DWDA 3WLKX 3PBUA 4Y96A 1EA9C 3H24A 1B3WA 1UJQA 1RJPA 3H21A 5AHNA 2CZ5A 1PKNA 2NVDA 4GI9A 2UY5A 3KDOA 1L6FA 1M68A 4PTMA 3IIOA 1KLZA 1F3XA 4NAEA 2ZTKA 3GHRA 1L2QA 1FH8A 3VOJA 4A8RA 3GXPA 3PNUA 1IXPA 5BYWA 4MJ4A 2XDFA 2GJXB 5B80A 3NVTA 1VBHA 3FW6A 2WBGA 3UVAA 3EWDA 5CGQA 4ZE5A 3TYBA 1K02A 2OZ8A 5DCEA 3ITVA 4XZNX 4ASTA 3QLLA 3IRDA 3T0AA 2XPKA 3WD2A 2GJNA 4OFCA 2QZRA 2DQXA 2PRHA 1CGVA 5AC6A 2CIPA 3WMLA 1XLCA 1E6NA 1W54A 3MI6A 3B3DA 2DW7A 1Q6DA 2ACSA 1SO6A 1QOPA 3W1XA 2FMNA 4MPQA 1EC9A 1XUUA 3F2BA 1SR0A 4KRZA 5FF4A 1JULA 3L68A 1VPXA 5CH9A 4NL1A 1OINA 5D4YA 3LX9A 4RW5A 3AS3A 4LFYA 3M0YA 1PVNA 1B3VA 1Z41A 1KBLA 4ZQNA 3HGRA 1H51A 4MWAA 3O2LA 3UR2A 3W7GA 5E6YA 3BLFA 3NZRA 1GEHA 2C0AA 1QAPA 3W01A 1KCXA 1NP0A 1YYAA 2X05A 3W84A 1BSLA 3B8TA 1V3KA 3ME3A 1RK6A 2XU2A 1XYZA 4RE3A 4YMZA 3QC3A 3NYZA 3WELA 4AU0A 4A6GA 2E6DA 1XLHA 3NXLA 4HNOA 4XSMA 3G1YA 5G2IA 2YCLB 1RHCA 4WKHA 5HULA 4E3VA 3NYDA 4MNLA 4AEOA 1GJUA 4AH7A 4GKTA 1QBBA 4PCFA 3E12A 4HZ7A 4N7QA 3TXVA 4IQDA 5K3VA 3PPCA 2OLHA 2Q09A 2QPUA 1UQYA 1HXJA 4HVXA 1TTQA 4C1NB 4DUOA 3HG2A 3VCRA 3FVMA 2FPYA 7XIMA 3V7PA 3VIIA 1CPUA 4KCWA 3KTCA 4RDYA 1NARA 4G8TA 3T07A 1UC4A 1CXEA 2IKJA 1RVGA 1V03A 4KH2A 3DG3A 5HANA 4HK7A 1E6PA 2IS7A 3M43A 4D6IA 4IGSA 1V02A 1JUKA 2NWRA 4J1OA 3GH4A 3P14A 1EL3A 2H9AB 4M82A 1MW2A 3MO4A 4OKDA 4ERAA 1KGWA 1OCJA 4JTCA 4Z2LA 3UT0A 3UR5A 2DH3A 1KM0A 4J3VA 1QPKA 3NNTA 2E5BA 4KRTA 3W2LA 2DH2A 1WDRA 4QR6A 3R43A 1OM0A 4FX6M 1K7FA 3LGDA 1JFHA 3PBYA 5D9OA 3K13A 3W1QA 1OVDA 2PBOA 1ENUA 4EPBC 1TELA 4HNNA 4Y90A 4B92A 2GQ9A 2BNJA 1OB0A 3OEXA 4PBFA 2O9PA 5E70A 4QISA 3ZIZA 1QXLA 1FDYA 3BICA 4GQ0A 3COTA 2FYMA 5AHEA 1WPCA 2ISDA 4XG1A 3SRHA 3SCNA 5G1MA 1G4EA 3N6HA 4P8UA 2FH8A 2Y62A 1QUMA 3EA2A 3CXOA 4L9ZA 4A22A 1GOXA 3IJ8A 4PMNA 1BVWA 1SFJA 2RUSA 4PTXA 3SRDA 1BWKA 1VPYA 3WBEA 3PTDA 4F0LA 3Q2DA 3WH9A 4QXIA 1XSIA 4ZSUA 1JNDA 3LRKA 4D6JA 3VGHA 2Y5SA 5C9RA 1SO5A 2OR2A 2ESCA 4ROQA 3GAYA 4FSAA 2IQDA 4X2PA 3LCXA 1VHNA 3OGSA 1W8SA 1IR2A 1F5ZA 1QWGA 2C3ZA 1UD2A 3KZPA 3TSBA 1QW8A 2O56A 4UR9A 1TV4A 2OXNA 3O6YX 5DQPA 4OQVA 4C6EA 3PB0A 3GXNA 3IIPA 1ZALA 4L4LA 4W7UA 4PULA 1EJTC 4IM4A 4MFDA 4QEEA 3OLIA 1EP3A 2D0FA 3STFA 3ITXA 4MAZA 4LUSB 3CH9A 3R8RA 3VIFA 4WZHA 3CLWA 3WBAA 1L9WA 1Z6KA 3CWOX 2E9MA 1LOQA 2XVGA 2Q8XA 3ZJKA 1GONA 2Z1VA 2G3NA 4FHAA 3MSGA 4ZB0A 4U10A 2PP3A 4PUJA 1UKSA 4IFKB 1ITCA 3GIQA 1IXQA 4OZOA 2P8BA 2YBVA 3R4IA 2P0OA 3TR2A 3EA1A 1R85A 4BI7A 4F79A 4LCSA 4C91A 3AU6A 1AZ2A 1TZZA 1ZY9A 4BEQA 1WCGA 4ZCWA 1A5AA 5AVNA 3UETA 1JZ3A 3IGSA 1JNEA 4NQ1A 1H5YA 3TYCA 3S5SA 2RJGA 1SZEA 3TA9A 3A4JA 3F5KA 3TYDA 1XD0A 1KM6A 1T7LA 2NUXA 2P5NA 4BQ2A 3DGBA 3WUEA 3PBGA 2OOFA 3MW7A 2VGBA 3W86A 4PFMA 2Z7KA 4AWSA 2PDQA 4LPCA 4U3CA 2ON3A 1XIHA 2VR2A 3E6EA 4LRTA 3HIJA 1RBOB 2YFNA 4QJ4B 1IGSA 4F8XA 3LN3A 3UF9A 4S3CA 3URBA 1VFUA 2YSWA 1CIUA 4UTUA 3HGJA 2PDGA 1YDYA 4DX3A 5M5DA 4NAFA 1JCMP 3WD3A 4AC7C 3AFBA 1TPDA 4KWOA 1WAWA 5BXRA 4U5IA 2AQOA 4ZSTA 4MLRA 3QF0A 3VMNA 1SJAA 2VD9A 3W1AA 2WHMA 2YB1A 3N34A 2RDTA 1UP0A 3W2NA 3L67A 3F5LA 1XINA 1VIWA 1ZENA 4NIRA 2VUYA 2OQYA 3HPAA 3PG9A 4D6CA 4US6A 1TIWA 2ZXDA 4GYPC 4P8VA 1RZMA 5TBOA 4JFUA 3MDWA 2ZC1A 4CN6A 2CYGA 4DXXA 4AXKA 3WLPA 3RLVA 3BZGA 4UZSA 2J8GA 3E5BA 1B54A 1GG0A 1SJBA 2Y1HA 2I17A 2XG9A 3N73A 3CMGA 4DPQA 2WB5A 4Y8EA 3SSJA 3IJDA 2W79A 1HZYA 1ISVA 3HTWA 4G9PA 1TWZA 3I6TA 4NZ5A 1K3UA 2G3FA 3IIXA 4MB1A 2A21A 3BJSA 1D7KA 1GJPA 1AJ0A 1WDPA 2VVSA 4O50A 4CCZA 4M8UA 4E2BA 1P0NA 3VD3A 3NPWA 1NM9A 4FF7A 5CQ1A 2JFEX 1DQXA 1TR1A 4PCSA 1M53A 3N4AA 1KTCA 2P8CA 1J6OA 3UJFA 5CG7A 1WUEA 4DUVA 1UH3A 3IGXA 3WD0A 1RQHA 2WC7A 2BVDA 1HJXA 2V3GA 1UMYA 1K8CA 3NSMA 3HU7A 2PWDA 3H7UA 2G4JA 1US2A 4MYAA 1WP6A 3KEHA 1WQ5A 4ZO7A 4NZJA 5BRPA 4ORIA 4KWSA 5FCZA 2XGBA 5KSWA 1LBLA 4YU1A 3G1VA 4XZIA 2QHAA 2VFHA 4LNYA 1XLDA 4O1DA 3UD6A 1JJKA 4YCOA 1H1NA 1ZHAA 2BOGX 1LBMA 4DZAA 1OC6A 4ZEPA 2VJXA 1W3NA 2ZE0A 3RO8A 1M7XA 3VKCA 3PTKA 2E7FA 2RFGA 1MQPA 2YZRA 1PKMA 4Z2HA 1S3TC 2R8WA 1IR1A 2GJLA 3W88A 1J96A 2X2YA 1NWRA 3MWAA 5D05A 1EYEA 1NP2A 4FK9A 3WK1A 4KRUA 5D37A 3HPSA 3N2CA 4MG4A 1E6XM 1H0GA 5A6JA 4JYEA 4PSRA 3TW9A 3N29A 3EWYA 4JNMA 3KTSA 2DSZA 1JGMA 2GUYA 4A3QA 5LA1A 3QMTA 1VBGA 1LLZA 1HGYA 3UWYA 2PD9A 3BE7A 3CV1A 5LA2A 5A5WA 3M0HA 4D2JA 1NU5A 1G0CA 3FJNA 1ZNNA 5LYRA 2XFYA 3SUVA 1K03A 3DFTA 3DBPA 2QJMA 3UCQA 1AMYA 4ZQOA 1FVPA 3LXCA 2HCVA 3E2QA 3RITA 3CU2A 3GYCA 2G3JA 1V5XA 3HFYA 4J3SA 4LBUA 4A3RA 1TJ2A 4RZBA 3AU2A 2Z1KA 3FK4A 4OV9A 3PZIA 2YX0A 5CZKA 2AQVA 2V38A 5AC8A 5I6SA 3W85A 3K8LA 5BWFA 2BBFA 4WOQA 5BCAA 3GNOA 1FCQA 3MUZ1 4PUDA 3WQ5A 4MNMA 1ZUAX 4S3BA 1MSSA 2VFEA 3QHMA 4DWSA 4IWWA 4P7RA 1PIGA 2FZDA 1DYSA 1UQZA 3KVLA 5A8MA 3QR0A 3E5PA 2A2IA 2V82A 5FAJA 3KVKA 1XS2A 3OG2A 4RNIA 3VNZA 4GA8A 4K8HA 2ZZ7A 3MJMA 4HPXA 4K37A 1G94A 4M5PA 2AGTA 4ZGYA 5HPCA 2YCEA 4UB9A 5HMFA 2E5CA 2B7PA 4OGZA 1I1XA 2ZYFA 1JZ7A 2VDIA 4J3TA 1UWRA 3GFXA 1QNQA 1YBQB 3WNOA 7REQB 1SSGA 1Q4NX 2D2GA 3AS2A 3QV7A 1V0NA 4HHLA 3DYPA 5EY5A 3M6DA 3MZ2A 1A5LC 4JHZA 1B5TA 4IFOA 2BVWA 3M5YA 4I5UA 3B4UA 4JTGA 2X41A 2XVKA 1LLOA 4AG0A 4NJIA 4KEMA 4N9BA 1NFGA 1NFPA 1G7UA 2VX7A 1TV3A 4AFYA 3BO9A 3STGA 2JE8A 3DC0A 2G8ZA 3ATYA 2OPJA 1A0DA 4GIAA 1FFQA 2CETA 2GVLA 5E5CA 2E4TA 1XG4A 1XSJA 4TIMA 2CZFA 3RLHA 3P82A 4TX6A 5CBBA 2Y8UA 9RUBA 5M17A 5J04A 3S6TA 3SGGA 1ZJIA 4QSFA 2FGZA 2IKHA 9CGTA 1NFBA 8A3HA 4FLOA 5AHMA 3UZWA 3B9EA 4JTRA 4UQBA 3TN3A 1JZ5A 3C0SA 4AQLA 3W7NA 4YVXA 3F5JA 4PB3A 1W56A 1AD1A 1UYQA 2C8NA 2IKGA 5A6KA 4HBKA 4Y9NA 1RA0A 2XN0A 5BMWA 5HMEA 1W1ZA 2AQWA 2PEVA 3KS6A 4X0VA 4J28A 1E4LA 4NASA 1KQYA 1MNSA 2YDQA 4K38A 1SFSA 4TR9A 1EC8A 2Z4GA 1HKJA 2PI6A 1JCXA 3MHGA 4JCMA 1O60A 2J4GA 5T9CE 4F2UA 4LVFA 4XZWA 3VPLA 4RDWA 3GDKA 3AIRA 3QHOA 5FJPA 1OHLA 5BU9A 1HKVA 1TKKA 4J3UA 4REQA 4XX6A 4CEUC 1DORA 3WF4A 1W9DM 2E0PA 2REQB 1Y5XA 1M03A 3PC0A 3SAZA 3K8MA 1TVLA 2J8FA 1X1NA 2ZZ6A 3P5ZA 1FCBA 2BGNE 5E09A 3ZT6A 1N55A 1X8FA 5BZAA 4B5NA 1C92A 4XAGA 5C6MA 3OGRA 3MSRA 2VKZG 3I6EA 1ZAJA 2X1TA 3W2KA 3WLIA 2W61A 3C0JA 4I7WA 5A6SA 2GSEA 5AFDA 3TSMA 1U1UA 4RXFA 5J8LA 3GU2A 3H54A 3VDHA 4XVEA 1NSJA 3AOFA 2Q6ZA 3W2JA 4KF1A 3M0LA 1PIIA 3HBLA 1JAKA 3B0VC 5CPNA 4WRHA 4DUWA 3WCZA 1J0ZA 4ENLA 2D1ZA 1A5BA 5LXEA 4K7VA 3CUHA 4P2VA 5EB8A 1A0EA 4HHMA 4UOJA 1UIPA 4Z1CA 2ZDRA 4O4VA 1H0IA 4HQVA 1EO5A 5GJPA 5I3DA 1KGUA 3CO4A 4V15A 1ESWA 2PCQA 1LJYA 1MEWA 1SJDA 4UTHA 4WDUA 3H2MA 4O8RA 1R8LA 4GG9A 3G0SA 4WLCA 3KRSA 4US5A 3FA3A 3VD4A 2MANA 2C14A 1PX4A 4O18A 2RGLA 4GFIA 2O9RA 1E71M 5HATA 1EDTA 4E2DA 3C8FA 2A3AA 5CPSA 3UXIA 1EGZA 4BQ5A 1YMYA 2CZVA 1TPWA 3QRHA 2R1MA 2XSXA 5DO8A 1VQTA 2QVNA 1RJRA 4PUUA 1JR1A 4N9CA 1AMKA 1ZBKA 1C29A 1JPDX 3KOYA 3TTSA 2P3EA 1YADA 2WC4A 3G6MA 3TDFA 4UNLA 4GO8A 1RALA 3EWBX 1VYRA 3CLMA 1NJJA 5G5IA 3VNJA 3NQFA 2YLAA 4RKAA 3M4HA 1BYBA 2QUUA 2WZIA 3NO3A 4Q8PA 4OVXA 3QZ6A 1K1DA 2C91A 4IG2B 3SCWA 2PDPA 3A13A 3TCSA 2C1GA 1XPYA 2ISVA 4C6OA 1R5YA 2POTA 1XRVA 1KM4A 1X7IA 2DSUA 3MP4A 4BY3A 2A1YA 4JIRA 1Q2SA 2YL9A 2J79A 3UWVA 3GVRA 1XGDA 1TG7A 2WMIB 3MO7A 2FJKA 4IICA 3RLGA 3F03K 3UZZA 1XX1A 1R47A 3AC0A 5C2GA 3O16A 3BLEA 3UCDA 3FV9A 1X96A 3EX2A 3UGVA 3WYZA 3B0PA 2OWWA 3B8SA 4P61A 4V33A 4GZIA 3HA1A 1S2WA 3AZSA 3GG1A 5AECA 5I07A 3CM4A 3WH5A 4O0KA 1LLWA 3SUWA 1OIFA 1GKRA 3OBKA 1U5VA 3ZQ9A 1E0TA 3VOIA 2ZVRA 3USBA 2ISSA 4JZ5A 2ZUWA 2C71A 4LVBA 3INPA 1RH9A 3WDQA 3GM8A 3WJZA 1M6JA 1BF6A 4B2DA 4NXKA 2XHYA 4HMCA 4MWAE 3W1PA 5C9UA 1GQLA 3NTYA 4JQ4A 1ZL1A 3IUIA 2QMJA 3VKDA 4GHRA 1KXTA 3TNBA 2QCNA 5HJYA 3RR1A 5A6TC 1SZNA 1EZWA 5A8OA 3L2MA 4IMDA 1IZKA 1VYSX 2CBVA 1A0CA 3DHPA 1BYDA 4E0CA 4ORMA 3AIQA 3IEBA 3LLFA 3KHJA 1E40A 4E2VA 3G1SA 1TREA 3G2GA 3QKEA 1S2VA 2WQDA 3K8KA 3W7KA 4RLIA 1UPPA 3W7JA 2GUBA 4PMXA 4RV3A 3ZR4A 3S2JA 4H6QA 5IBXA 1EP2A 3O06A 1J9YA 2PUZA 3E74A 1YPXA 3IWPA 4GX8A 1HJVA 3OG3A 4NRRA 4TXEA 5BU6A 2WQPA 3DFQA 1CB7B 3N9RA 8CGTA 3ANYA 1W2VA 1LYXA 4WJEA 3RPTA 2C13A 4BF5A 4XTDA 1R3TA 3C0LA 1WKFA 3LRLA 1VJZA 3TQPA 1XCWA 1QU4A 4XWUA 4NXSA 4QG9A 3U2OA 3VGGA 4WDTA 2GJRA 3FN9A 1V02E 5A8GA 2OT1A 2QUMA 5AYYA 2BXYA 1UWSA 4EIVA 1VBJA 1QRQA 3OPSA 1E1CB 3B8UA 3FKKA 4KQNA 3H4WA 4M29A 1JDCA 4FLRA 2WWDA 1FCUA 3MYPA 1GZGA 4Q7NA 2QW5A 4O28A 4HNCA 1CI1A 3GZ3A 1NWTA 2J9ZA 1DIOA 4GBUA 5EBAA 4PRRA 2CLHA 1FWFC 2QCFA 2ZA2A 1X39A 1NH6A 4YYCA 2PDUA 3T0TA 1P0DA 1HFBA 3LCWA 4MDOA 4IIEA 3ARQA 3WQWA 3KVMA 1XM3A 5EMYA 2WJEA 3A5VA 3A22A 1QOXA 2PDJA 3R10A 1QBAA 1W5PA 1PSCA 3EDKA 3UPBA 4UOQA 2GVGA 2WV8A 3WY1A 1Z69A 2Q8ZA 3LNMA 1HGWA 3WLNA 2Z28A 3FSUA 1B2YA 3ABOA 1DXIA 3VIOA 2KZHA 2D2OA 3OW1A 3H6OA 1E0XA 2Z1WA 3VUPA 5IRPA 4ZVJA 4QLLA 1Q13A 4MZ8A 1B3XA 5JU6A 2P1FA 2Z27A 1JD7A 3W71A 1UG6A 2PWGA 1PX8A 3BK0A 3N11A 4O8AA 2Y24A 3GIYA 4L64A 1SMDA 2XH7A 3KOXA 3R11A 2R6OA 1M41A 4NF7A 4I5RA 3QVQA 3QW3A 2AGKA 4ZZ9A 3SFWA 1IEIA 5M1TA 5I24A 4HZ8A 3W9ZA 1ME8A 3HPFA 1GUVA 5F4SA 4C6QA 2WSPA 3CHCA 3POHA 1XGEA 2YCJA 2Z7GA 2DUXA 2NXGA 3LHVA 2Z2BA 4WDXA 2DPEA 3D46A 3E49A 4LTSA 2GFTA 3QPZA 4Y2WA 4QQUA 2GSHA 5G1TA 3F7JA 3MHFA 2IPFA 3SQMA 1RUSA 3NR0A 2DT2A 5LHFA 1KRCC 1JRBA 3CIVA 1FWNA 1TZ9A 1PCWA 1NDZA 1Q6GA 3PWIA 5C8BB 5AKQA 5DT5A 3FFSA 3QV9A 2J27A 1PJ9A 1FKXA 3URAA 2ZUMA 4O13A 1EH9A 3BZJA 3MU7A 2CBUA 4DVOA 2ATMA 1MUWA 1NAL1 4QG6A 3SCUA 5FA5A 1G4SA 1AH4A 1DPMA 3LM7A 5LIUX 4GUGA 3ZT5A 4P7LA 3RGTA 1PWMA 4J3XA 5I3KA 3MMTA 5IHSA 4TVUA 3ANVA 4PBEA 1H63A 2ZUVA 5KMYA 3TJ4A 3OGVA 4XSLA 1UHVA 3BDKA 4ZFMA 1ODUA 4M6PA 5CZJA 5DBUA 1M1BA 4KFPA 1UA3A 3NJ3A 4UTTA 1RCQA 4MFEA 4F66A 4AWUA 3THCA 3DC8A 3CIWA 1NOWA 1IWPA 1LOSA 1XYLA 4WQ6A 1VB9A 3DG7A 2A3CA 3KWSA 3G24A 2HS6A 5ECVA 5XIAA 3P67A 3TVAA 1RQBA 5REQB 4RNFA 2GSJA 2IXVA 2F84A 4JNZA 2J7EA 3EB2A 2QCDB 1VHCA 4DYEA 3PJWA 3RILA 1GJWA 3AUJA 2ASHA 1Z89A 3QEZA 1KWKA 3NQVA 4MOZA 3BPWA 5LGXA 4WR3A 3B04A 5E0CA 1QI3A 3KUMA 5KTLA 5FSDC 4BQ4A 2HBVA 2OLSA 4P8XA 4MNJA 2I5IA 3NO5A 3MUXA 2V5BA 3VX1A 3AMGA 4LUYA 5HAOA 2XINA 4ACYA 3H4GA 4ZOEA 2HPMA 2E6AA 3P0XA 2DZXA 2YBTA 2Q71A 1TV8A 1MXSA 1JAEA 3S5YA 5G1YA 1KM1A 3BG5A 4KWUA 4LBRA 1E9ZB 2CLPA 1DWGM 1AA1B 3NVDA 1NQKA 1EJVC 5B7ZA 3C2RA 4DB7A 1MMFA 2PTZA 4PODA 2A7NA 4QP0A 2DDXA 4PEEA 3LU2A 1EPVA 4IH3A 4DZ5A 5BMXA 4WGXA 3S2CA 4XBKA 3AO0A 3MP5A 1VEMA 3S4TA 2WCSA 4P7NA 1O6IA 2JKPA 1TCMA 1OABA 1O1ZA 4AD5A 5K4ZA 4WOZA 2EKCA 3AXMA 1QVBA 2DU2A 1XJBA 3DESA 2YIHA 3OU8A 1TO3A 4W7WA 5MKGA 1UBSA 1XLFA 2RAGA 2QQ6A 4EPEC 4IUGA 4IJCA 2JGQA 3WLJA 3NSNA 6TAAA 1XIFA 2IW0A 1LL4A 2ZZ5A 5FJRA 3ALGA 4U31A 4AIUA 3AXIA 2Y85A 2G37A 5ABTA 2CLOA 3OYZA 2XH4A 5RUBA 3LLDA 3VX0A 4B91A 1XYBA 4CVWA 3HB9A 4UCFA 4NNBA 4JICA 3IJ6A 3GTXA 3W3OA 2ZRZA 3CWHA 4LF2A 1FTXA 3QLDA 1Q6RA 3I7RA 3WDJA 1J01A 3PG8A 1ECEA 1TV7A 4OOZA 4RW3A 5TNVA 2WO5A 1I0BA 4K3ZA 3H23A 1EKOA 2XUCA 3H7VA 1HVXA 3GHTA 4DZHA 2VVNA 3MDUA 4GRSA 1TVNA 1GVRA 4ZL1A 2J8TA 3WNNA 5HNRA 2BHYA 4N42A 3A47A 4EAYA 1OQFA 3I3DA 1TR9A 3ZFHA 4PBGA 2O4QA 3WQ4A 2UZ9A 1O5XA 2C1HA 2XSBA 4AY1A 1UR8A 3CBWA 3TSDA 5FD0A 2JIEA 5D2TA 4GVFA 4NVTA 4Q8TA 4ZB5A 3DI0A 3VZYA 3NXFA 3MA8A 1WKYA 1VENA 4NNAA 3VOHA 4PCTA 4YN5A 1JI1A 2G97A 4S1FA 4DZIA 2D23A 4L61A 2NQZA 3S9YA 6REQA 1OZQA 2BHZA 1X1OA 3EOUA 4DO4A 2QCGA 2GGHA 1GZJA 3OZOA 4HA0A 4MJ2A 1ITUA 1AW2A 2O7QA 4FR6A 1AW5A 5HUOA 1YDNA 2HSAA 3EMQA 3W1MA 4LGXA 3T4WA 2ACRA 1R3QA 3EXTA 3WNLA 1OC5A 4I9TA 2UV8G 2Y89A 3BOXA 3TNOA 2WMFA 5I3GA 1TQXA 2PWHA 4WJ8A 2PGWA 3LHYA 4HOZA 3TEVA 4CQ9A 1ODZA 3NM3A 4IGMA 2H6RA 1CXHA 2QAFA 2WAGA 3NAVA 1F2JA 2PWUA 1UWQA 3EX4A 3GBEA 3JZEA 5GNZA 3RNDA 3QM3A 1E5NA 3CHFA 1BQCA 3Q45A 4CU8A 1XPGA 3W6LA 4ADSA 4AIOA 1P7TA 2BGSA 1R7OA 4DJDA 1J12A 3CPGA 1OX4A 4AVFA 4LW7A 4M1RA 3GNPA 4FEZA 4C90A 3GW0A 3WQOA 5F2GA 1HP5A 2J9XA 1E43A 2FFCA 2ZWYA 3LGEA 4D6GA 4YVVA 1WXJA 1RY8A 3C56A 1PPIA 2VDHA 3SI9A 2V3FA 4FPSA 2NUYA 1XIIA 1DJZA 5AC7A 2A3LA 3QGVA 4I7UA 3GBDA 4C6LA 5A69A 3BAJA 5CSSA 1R87A 2NQLA 2CHNA 1KB3A 2PLKA 4DAIA 2XIMA 2QUTA 3C3NA 5I06A 3RG6A 2WMJA 4MY9A 1UPMB 1L6SA 3EOSA 2CESA 8RUCA 3CAWA 2XIIA 3CZKA 3AIBA 3KWXA 2ZFAA 4DXKA 3AUOA 2HVOA 1C9WA 4PYSA 3GH5A 1NDWA 4J4KA 1XLBA 1EJWC 4IP5A 1DVJA 3VILA 5FSEC 4GQBA 3DN5A 4MZ1A 4AISA 4C6PA 1EHAA 1GOQA 1QR7A 4ZE4A 4H41A 3W25A 5CC3A 4G7EB 4HK6A 2JQXA 3A21A 4UC5A 3QFEA 1J2BA 3AS0A 4K7YA 4PE8A 2YA0A 3QKZA 3W7IA 1PO9A 2R1LA 3L7RA 4ZQRA 4AYSA 1OF8A 1GHRA 1FXQA 3E3HA 3T08A 4LUIA 1E9IA 3SW6A 3E9AA 1A4LA 1A53A 1XXXA 4BQ3A 3MCOA 1HKMA 4E8CA 3FX4A 2WK2A 2FTPA 2HBXA 3PWGA 2QYGA 3GC2A 3FEQA 4XD5A 3SCTA 1Z42A 1VFOA 3LD5A 2PSNA 3KOZA 1EJUC 2FGBA 1L6WA 3GNDA 4AY8A 4QS5A 3ALFA 1NVMA 1XR2A 3BG9A 5DX7A 2YCIX 1HL9A 3DU0A 5BRBA 1JI2A 1U1HA 3ZM8A 3MSDA 4K6AA 3L5AA 3LPOA 4LYRA 4I8YA 4H6RA 3CHDA 4LQ1A 4WGHA 1OBAA 1R7AA 2O4MA 2DV0A 1H41A 1SVDA 3O7UA 3BJTA 2VD8A 3TQVA 3VE9A 4W86A 4KETA 1ZCOA 1XCFA 7TIMA 2HMCA 4JFSA 4LS2A 1NF0A 2V6AA 3WQFA 3GVGA 3DG6A 3B4YA 2J74A 5F1UA 3W7PA 1K6AA 1W3IA 1OIMA 1LUCA 2OZTA 4V1XA 1SPQA 3UG5A 2P88A 3PPHA 3K46A 1K9DA 1SO3A 3KP0A 3WMSA 3TP4A 4FNRA 1UZ1A 3H4XA 4YTRA 4RX0A 3KP1A 2PDWA 1CGTA 3OO2A 1G1YA 1LRQA 3WLOA 1KFBA 3L4ZA 4IFRA 4QDWA 2X1IA 3I4KA 2Q8LA 4EF8A 4D1JA 4XKYB 3HURA 4MWAD 2R91A 1DE6A 1RK5A 3WH8A 1V8EA 3SCPA 1I2NA 1JRCA 2J77A 2WLZA 3W38A 1I8JA 3T78A 1OD0A 4RPQA 4GWEA 5EU9A 3B8WA 2YCKX 2ZX7A 2J6VA 3N1AA 2G3IA 1UC5A 2WNQA 3V35A 4GZJA 4RK8A 2ALDA 3B97A 1CENA 1A5MC 2VEKA 3G1RA 1UP2A 2NSXA 1S5MA 2ZUSA 3CV7A 3TK7A 1H7NA 5KETA 5A6BA 1YNYA 2NT1A 1E0WA 4UFHA 4HYWA 1XH0A 2RH9A 4JIHA 3ZLHA 2HXTA 3NWRA 3RHGA 3QHNA 1KWGA 5BXSA 2X40A 3VAVA 2FDMA 4Z2GA 1O95A 1LG1A 1J10A 3O15A 5JUVA 4RDVA 2ZTJA 4IPNB 1V3IA 2OVLA 2EEXA 5BNKA 4D71A 1HL8A 2OOGA 4D6EA 3TCEA 4E5TA 1VFLA 2WW5A 3DERA 3AALA 6CGTA 2HTMA 2SFPA 4HPJA 5HJLA 1T5AA 5H8UA 2JALA 2WPGA 3LS9A 1Q45A 3M5VA 3BLDA 3OQEA 2ZDSA 4A8IA 2YDAA 1EHNA 4I8DA 1BYCA 4R3UA 4MWAC 1QT1A 2BB0A 3CUIA 3L2LA 4GYJA 3WLSA 4FAMA 1BG4A 1HKKA 2JBMA 1VFMA 2IPGA 4JQ3A 1EBHA 1DQUA 3EEZA 3FDGA 1XLIA 5KZDA 3DFSA 1KBJA 1US3A 1D8WA 3BW2A 1TIMA 2FGLA 2BZNA 3AIWA 3S2LA 1XP3A 3HOJA 4AVOA 4PB5A 3TMQA 5CPOA 1ALDA 1BGGA 2PDBA 3U9IA 4Q8QA 1YIXA 5EMUA 4UMAA 1S5VA 1V6XA 3AS1A 1JZ4A 1JXKA 1RA5A 3EMCA 2GVYA 1XLGA 4WEVX 5T26A 1ZPTA 3CWNA 3AHYA 3MSYA 3FSTA 3FHAA 3ITGA 2P50A 2YGYA 4XUYA 3V36A 1SO4A 5CZSA 4ACZA 4W85A 1OFEA 3B06A 2BOEX 3S1XA 4C6JA 2KX9A 1P6BA 3PZMA 4Q6XA 4YWSA 2FVKA 3VDGA 1QWKA 1PHWA 2WJFA 2ALRA 3UYCA 1GQNA 2G5WA 2Q3RA 2V5CA 3B9NA 1ML1A 2VOTA 4XBSA 2DJXA 4H7CA 4YTQA 3SCSA 3UWQA 1XLKA 4K1GA 4LAUA 3K1DA 1EFZA 2O92A 1OGSA 4UNKA 1E0VA 3UBPC 4QLKA 3EBVA 2DZUA 4U5KA 4XK2A 3S3GA 5HK4A 3EMZA 2CLFA 4B5WA 4GNVA 1GG1A 3WF1A 4HHPA 4LNCA 3C6CA 1N82A 1OCNA 2AOSA 5AYIA 3SRFA 4MZYA 2NSOA 4XIMA 5JBDA 3BURA 3E0VA 1V77A 1Q7MA 4XISA 3QQ0A 3DFHA 4OWGA 3KS5A 1VCVA 5D2YA 4KS0A 1LRNA 4Q4OA 1VFFA 2VI0A 1FWWA 2XGIA 1JCTA 1IT7A 4H6KA 4WY0A 4CQBA 3QN3A 5I3JA 2H3DA 1GOWA 1YRRA 1OT2A 1IHIA 1AD4A 5EA9A 2A6NA 1SZRA 2VENA 3M7WA 2OWCA 3S2NA 3UWUA 3DXIA 3MQTA 1LWIA 2VFGA 4Z42C 4G2DA 1BRLB 4XD4A 1V3HA 1FWHC 4FNPA 2X1UA 3VXGA 3NGFA 4N0RA 3PUGA 2WYSA 4O17A 4UWMA 4LS0A 6XIMA 1GW1A 3U4AA 3WLRA 3CK5A 3R2GA 1GQJA 3PPGA 2AAMA 2VFIA 3HG3A 3GU1A 4LVGA 2WSRA 1JZ6A 4E8DA 4OBSA 3HMJG 2FDSA 2WHJA 2VO5A 1HJSA 3SQLA 3NZGA 1VCGA 1K9FA 3GYEA 3WUFA 2PE4A 1C8QA 3GDLA 1TX0A 4R7OA 1AG1O 2PDYA 4Q7IA 3MHUA 3PBMA 3L0GA 1GGOA 2XYLA 1XH2A 1XWYA 2A5HA 1IYXA 1R3SA 4RE4A 4UMBA 7A3HA 1ISYA 1Q8AA 3GXIA 4JGDA 5D8ZA 4NZ4A 1EJSC 2ZX5A 3E2VA 3LTYA 4IL2A 1OFAA 5AHFA 1YDVA 3HQPA 1R38A 1H2JA 3BCDA 1VEOA 1LZOA 4JEJA 1U1JA 2E3ZA 4O54A 1MVYA 1BEUA 5H8MA 2DJLA 1ONWA 3H70A 3T0BA 3EYPA 3QXBA 3RIKA 5TD4A 1T99A 1HQTA 3FJLA 3DGRA 3B8IA 2JF6A 1BHGA 1PEZA 3THDA 5E9XA 4CD8A 2DT1A 3W7EA 3CH0A 3GQYA 1FP8A 4HNUA 2EF9A 3DKJA 3CL8A 3W26A 4A2RA 2GJPA 2G95A 4G6CA 4LEQA 2CHRA 4AZCB 3TN6A 1P6WA 2XIJA 1WKDA 1QASA 1IEQA 1YPFA 1E6RA 1AQ0A 3B8VA 3WFZA 1PWLA 1KV5A 1ICSA 3TE9A 1Z48A 3Q58A 3LERA 4PMUA 4CGTA 5H91A 1GOIA 1D2KA 2J75A 3BW3A 1BKHA 2PC8A 1FWBC 2EG8A 3W7CA 3QTGA 1EUNA 2G96A 1TCDA 1XYFA 1DJIA 1IF2A 1R3WA 4A4AA 1TV5A 2GPTA 1A3WA 4W8AA 4IGHA 4QG8A 5CPQA 2W5FA 3PNZA 1D3HA 4DNMA 4LAZA 3QYSA 3ATZA 1GWJA 1ICQA 3PJXA 4TX8A 1SJCA 1HF6A 3EX3A 5FAGA 4G1KA 1GEQA 4R53A 3HGOA 1H5VA 2DZBA 5G2HA 2HROA 4CD6A 4O0ZA 3WF3A 5LIXX 5FF0A 4IHCA 4ERIA 3BTNA 1TMQA 2FHBA 1LM1A 1WYIA 3STPA 4Y6GA 2YLLA 3BV4A 3VKKA 3WQCA 1DWIM 2Z2AA 3MP3A 3RCYA 3O07A 4O1FA 1TA3B 2IKIA 4KEUA 3UA3A 1XUZA 4ZO8A 3BGJA 1DWJM 5FKYA 2V5DA 3NQBA 2VELA 1DWAM 1MXDA 1J0IA 3P61A 3NCOA 3TYUA 5M03A 3PR2A 5D2XA 4JN8A 2E5DA 3WLLA 2WANA 1JDFA 1Y0EA 2GK1B 3TJXA 5AZ1A 5LIKX 2XM2A 3R12A 3TFCA 2OJPA 2E6YA 3GNNA 4PMYA 3N2OA 1NDYA 1W3JA 1RPXA 1ZGDA 3BOLA 3VKJA 5CSYA 4KCTA 2YXOA 1UR2A 1DWFM 3UERA 5HR7A 3KBNA 1T96A 1WX0A 3UR7A 3BSHA 2VX5A 4HCDA 2VZSA 4NHVA 1JGIA 4LRSA 5ABFB 1SMAA 3FAXA 1BTMA 1WDWA 4MKNA 2XJ7A 2F6UA 2Z24A 3NGJA 3CZ8A 3EOEA 3UVIA 1MI3A 2NX1A 1UWTA 4XD3A 1OFDA 1D8CA 4E38A 4R7WA 2ISWA 1ISWA 3BLLA 4MAVA 4BR1A 4BA0A 3AMLA 3MMUA 1DTNA 3PZGA 2OKTA 2ZXQA 1R6WA 2Y7DA 3AWNA 3TKFA 3W7OA 3BLOA 1E6ZA 2A6LA 3L4TA 4UMCA 3CL7A 4JBRA 4LOCA 5DCDA 4UQEA 1DJYA 4DWSD 2Y7GA 2I57A 1DIDA 5CJ5A 4P7OA 1VPQA 1QI5A 4AF0A 1R46A 4KMQA 4GI4A 1QO2A 1TPC1 1VRDA 5DMNA 2IQTA 1CGUA 2HVMA 5I2UA 3UJRA 5JH1A 2VWSA 3NQ7A 5FJIA 4AVNA 4KBXA 3L65A 3VD7A 3LTPA 2PRLA 4JDBA 2J66A 2FH6A 3BGGA 4W9TA 1MNZA 4G56A 4R85A 5M3WA 1GYMA 5TF0A 2G50A 1S46A 1CTNA 3EAUA 4ZXLA 5DFAA 4GI8A 3VNYA 1QW9A 2TRSA 4KW2A 2DSWA 1U83A 3VDAA 5D9PA 2QKFA 1W2PA 4YS1A 3AMKA 3AMCA 4X3ZA 4TTGA 3GXDA 3F4NA 4GUFA 4XV0A 4ATLA 1XKYA 1D9EA 3R8HA 3AZTA 1VC4A 3O3RA 4QDPA 3IUDA 1C93A 3H22A 3B9DA 3PZQA 4ECLA 2RGMA 5HWNA 3W87A 3TQ0A 3LHWA 5C7VA 2C7FA 2EJ1A 4EPKA 5JVLA 2JEPA 4TVCA 1PYMA 1DXEA 4NRSA 4Y7EA 2QCCA 4RV8A 5A6MA 1W1VA 1IXNA 3KBWA 3Q94A 2XM1A 5FJUA 3ZVHA 4TOQA 2OSYA 3EB4A 4DWSC 2R82A 1EX1A 1K7XA 1E9YB 5EL1A 4XVDA 1B9BA 1UJPA 2ZADA 5I03A 4A3UA 2V2HA 1EDGA 4AWEA 3W7RA 4ROPA 2HXUA 4IP4A 1V93A 4TQTA 5AN7A 4GH1A 2YL8A 3VIKA 3N12A 3CYVA 4JNYA 1S3HA 3WL0A 1CXLA 1XKJA 2C6QA 4Q32A 1KW1A 2Q01A 3ARTA 3K30A 1K8XA 1QI2A 4QCEA 2FHFA 2W6RA 1EXPA 2PTWA 3DOPA 1E1FA 4Z1BA 3F2CA 4WDWA 4U3AA 5HNUA 3KCLA 3WK0A 1ZJAA 2Z1XA 3WLMA 2FPVA 5M2FX 3WEZA 3BXWA 2PDNA 3DENA 4EANA 1P48A 2V69A 3MKVA 3MV01 3RU8X 3DFPA 2BODX 2Q3OA 4HKPA 3L4UA 3LY0A 4S3EA 4JPGA 3REQA 2E09A 3FGCA 2FHCA 1K6WA 2PB1A 1GOMA 2Y2WA 3C8NA 5JMUA 3MV11 2O0TA 3MY9A 4J2PA 2QEZA 5C9WA 3VK5A 4IT1A 2VCAA 2EJAA 1MZRA 3NQGA 1HX0A 1LTDA 3UZXA 2WVUA 4N02A 2BY0A 4L56A 1U5JA 4AD3A 1J0HA 3PZOA 2Z29A 3KZSA 1TWWA 3MI2A 1UD8A 3QGKC 3KBMA 3W6MA 1UR4A 3TYZA 3G6LA 3FXGA 1H7RA 4HA1A 4JIQA 3M16A 3WQVA 4KERA 1X6LA 1WDQA 3ARRA 4IMCA 4AEEA 2XFFA 3MBDA 1WB0A 1H62A 1E3XA 3ZMRA 1YE4A 1LQ0A 3DFYA 2QF8A 4C6FA 1NOUA 4PA8A 4JIPA 3MZNA 3IS4A 4JYFA 4AHPA 3HV8A 4LS1A 1UKQA 2ABAA 4JTLA 2NT0A 2PWVA 3TTQA 1Q66A 1ZTVA 3M44A 3D3FA 2E40A 3TOYA 5KZ6A 4H3DA 4FLQA 4AZIA 2KAUC 1U33A 2INZA 3RAOA 1CGXA 4CN1A 3SUUA 3OP2A 1VD6A 2MUCA 3PB2A 2V81A 1XBVA 4S3AA 3W4RA 2WVSA 1TYGA 3POCA 4US5D 3HPXA 2IUZA 5GPRA 3KHDA 2V5LA 3ZR5A 3NO1A 4EXQA 1G01A 1W3LA 3BCFA 4FS9A 1N8FA 1POJA 5LKYA 1NQ6A 4GIRA 3DEQA 4ICCX 3UXDA 3ZJ8A 1WV2A 3M5XA 1OCQA 4A3HA 2F6KA 5CCZA 3SY8A 3QOMA 3NURA 3JR2A 3HQNA 4FX8A 3BAWA 4IOTA 2VWTA 5GNYA 3E0FA 3L4YA 2BWGA 1FWSA 1KLYA 5I78A 3NQDA 4LXFA 1OGBA 4O10A 4NAEB 1X6NA 2CFFA 2DFAA 8XIMA 1V6UA 4AD1A 1SR9A 3HG4A 3CUJA 4H9YA 1UD4A 1I75A 3TAKA 4FX7A 4ZODA 4JKLA 2RDXA 4OHQA 4OT7A 3LBMA 5DF0A 4DJFD 1EEXA 2VP8A 1OYCA 3N2XA 3NOYA 1LQAA 3MMDA 2X1SA 2BY2A 2FJUB 4GYKA 4R33A 5IHRA 3RFAA 4K8EA 4AX7A 3BMVA 4B16A 1FY6A 3WL1A 2NVAA 2X7WA 4JTQA 1WDSA 3A23A 4YJ5A 4N2YA 3MBFA 1J0YA 3GAKA 3S42A 3IV3A 5CKSA 1XC4A 6A3HA 2OWXA 4I9MA 3LQLA 4DPPA 3VDBA 1PIFA 4MWAB 3PULA 1V6VA 1L8PA 1WDDA 3RYSA 4XZLX 4HU0A 4FIQA 2EHHA 4O11A 4ICMA 5HWMA 3GKAA 1ONRA 3UGRA 3THAA 1JYNA 5AOUA 2D73A 2WNWA 3W07A 4B9YA 4QHRA 4DLMA 1VKFA 3EWWA 4F2TA 3NDZA 4GJIA 4B2DD 4YLWA 5TIMA 3WBWA 1UZ4A 3F2DA 3P2VA 5HMSA 3VDCA 3EKLA 1QJWA 4DBSA 4JHMA 3WENA 4MUZA 2FZBA 4NZCA 4ZA0A 4CQCA 4F0KA 1PAMA 3E02A 3Q67A 4GMEA 4IMAA 4PMOA 2NV9A 3WMBA 2Y6ZA 3ZT7A 1ITXA 4O52A 1JIBA 2C19A 1H3GA 2F38A 4ZQCA 2CLIA 1W3HA 1TWSA 4GXPA 4G5DA 4NJGA 5HBFA 3W72A 3DH7A 3TV8A 3GHUA 3W73A 3CB3A 3NA8A 4JDYA 1DHPA 1PZ0A 2PDXA 3HN3A 2QXWA 2NVCA 3OZPA 4JTHA 2PAJA 2Y88A 4QAIA 1E9LA 1ZBWA 1REQA 2CZEA 3HV9A 4ZOBA 1ZBVA 1XBYA 1K8YA 5I00A 3A64A 3N9KA 1UWAA 1KKOA 3M64A 2PLMA 1OZMA 4CUCA 4KFOA 1X1ZA 3OZYA 5HNNA 2QR6A 2CXEA 5IFPA 1UR0A 2BSLA 3AYRA 1Q6CA 1ISZA 3QW4B 3GXFA 1KD0A 3I65A 5EYWA 4LY8A 3HPZA 1EWDA 4J2MA 4DRSA 5T8GA 3MUCA 1F05A 3T09A 5AHLA 1V0KA 1ONEA 2YKKA 2A4AA 2YW3A 1H50A 2AKMA 1MZHA 3QJAA 1CW2A 3NM1A 3TWBA 5CC5A 3OLDA 3KM8A 3M5ZA 3N4FA 2POZA 4L4OA 4XAZA 3HGSA 4IIHA 1CBGA 1K9EA 3R58A 1PS9A 1M65A 3CJPA 1H1ZA 3VIHA 1GOOA 4RE0A 3V5CA 4D8ZA 3UZJA 4ZMGA 5LIYX 1TJPA 1GYLA 1IWAA 4FXSA 4MSSA 2O9TA 2B4GA 1H61A 4G1NA 4CD7A 3SECA 3RK8A 3R1ZA 3VTRA 3WKZA 4TV6A 1JUEA 5IBXC 3BG3A 4JYDA 1TE6A 3DHFA 3G5EA 3BW4A 4JFVA 3M1ZA 4C6MA 3RJYA 2OLAA 2JEQA 3NZQA 3GH7A 4TUFA 4FNUA 2Z26A 5CBIA 2X0SA 4EACA 5CGTA 5HR6A 2ISFA 1W6TA 5DY2A 5FL0A 1KQZA 3BH4A 2XVLA 3GG8A 1QHOA 4LUTA 1FA2A 1AH3A 3TU9A 3AISA 2BFGA 5I0DA 5HMDA 4QRNA 3TYAA 1QW7A 1FHDA 3XINA 3LPPA 1P43A 2BS9A 5FI8A 4FOKA 4H8UA 3SY1A 3WF0A 5BXTA 4JX4A 2CLKA 2PGFA 2VR5A 3EXSA 1VBUA 1DJWA 2V63A 2WZEA 4IL0A 4D8AA 3WEOA 1TWIA 3ONBA 3T1GA 1W8GA 3PSVA 3C2OA 1CXFA 1KV8A 3WK2A 4KIRA 2B81A 3C2YA 3UXLA 4GOAA 2P3ZA 4C60A 2I16A 4M80A 3P7YA 2VR4A 4HNLA 4HNTA 3VVGA 3S1WA 1C8VA 5CLWA 4JD4A 3SZ8A 5H2ZA 4NSBA 4EK7A 3GW3A 2V3DA 4WKFA 4R88A 1OFPA 3JS3A 4IMGA 4ZENA 1N7KA 1F3WA 3W1RA 3AHZA 4CD4A 1L6GA 1A4MA 3VM5A 3NPUA 4W5ZA 2VYOA 1KR1A 3BGAA 1U22A 1QATA 1H49A 4FMVA 1EO7A 1NIUA 1F6YA 1AJZA 3KTXA 4KWVA 4S3JA 3TC6A 3PUEA 5AYBA 2DSKA 1V6YA 1EJ7L 3KRUA 1M5WA 3EPOA 2DIEA 3RDKA 5CAHA 1G5AA 4NAFB 2H8XA 3SEPA 5G4WA 5LHEA 2R9RA 3GRIA 3VNMA 1D3CA 3P6LA 5GVJA 1GVQA 4ZQMA 3UG3A 4DNHA 1DP0A 1GPWA 1K4GA 1IT0A 3I7SA 5F4XA 2QAPA 3UCCA 2EBNA 4OV4A 2FZNA 5D32A 3A9BA 3U7VA 3IVSA 3QSRA 1G67A 3BLKA 1XL9A 3APGA 4C6KA 5FJJA 5K2ZA 3ICJA 3V0SA 1XFBA 5U7SA 4Q6JA 1W5OA 1G7VA 2O55A 4Y8FA 1Q6LA 4DYKA 4DIAA 1DIKA 4L6HA 3H2AA 1OX6A 3IV8A 4TTUA 1L2UA 2FB2A 2WHKA 1FWDC 2VRQA 5FJOA 2BLEA 2XIQA 3NZPA 1Y65A 1GYNA 1V0MA 2YR1A 3OA3A 1F4HA 2V5JA 4YVPA 2C18A 4QSHA 2CC0A 3NL3A 2WVVA 3OOQA 3LCFA 1JDAA 1S5WA 2Q02A 3H12A 4LB3A 4XZBA 4GNKB 4LYPA 5AVHA 1GVEA 1B4KA 1W32A 1DOSA 3S9ZA 3ORWA 2PLJA 4H9TA 3CUFA 3QH2A 3JU2A 5HXMA 3TTEA 3W7MA 1PX3A 2QCEA 4UTWC 1Q63A 3E0IA 4IMEA 3WNMA 1XIBA 1T40A 4MADA 2WM0A 3W6YA 4UTTC 1A80A 3G0XA 4LAMA 1ICPA 4WXZA 5EFDA 4BEUA 1U2YA 3U2CA 3EWZA 2GVJA 2J88A 5TQLA 4O16A 4GZEA 3ZR6A 4HPGA 1F61A 1MEHA 4H2HA 3TMLA 3TYEA 1IZJA 1Q2RA 3LTSA 1OSEA 3S5OA 2QNEA 1R30A 2PDFA 3WH7A 4JEQA 3K2GA 3RM4A 3E2RA 4F9DA 3CAQA 1O68A 4BFAA 3ECQA 1S1RA 2J7DA 3AWOA 4EVZA 4AXNA 4WHBA 2WLYA 3VKBA 3F4DA 5BOOA 3W74A 4D8LA 4CU7A 3QMRA 1RBAA 1TB3A 5H8PA 4Y9PA 3N25A 2QCLA 2QVHA 3W37A 3GDRA 3AAMA 3P74A 2I56A 4R9OA 4DXVA 1B3OA 4XBJA 3VNIA 4ZO9A 2OU4A 1W1A1 2BV9A 2V0TA 1HO4A 4KIEA 3QV6A 4W87A 1RY0A 2E28A 3LZ5A 2YW4A 2DVXA 2OX1A 5LA0A 2Z0IA 1OFBA 3DYMA 1T0OA 3HQOA 2BTMA 3M0XA 2GDUA 1XV8A 2QIIA 4F3HA 2QGYA 1BF2A 3KOFA 2HNEA 3V4BA 3WJXA 1DJQA 1E6QM 1RAKA 5JH2A 2DZPA 1H1YA 5AC4A 1GQKA 3OLEA 1RD5A 1ZSXA 1SU5A 3CEUA 3RUBL 3GHSA 4GCAA 1LRTA 1PTGA 2YPIA 3BCJA 4IX2A 3BWWA 3O8AA 3W1NA 1XG3A 5BW6A 3U7BA 3W22A 3WDPP 2PF0A 1FDJA 5HQMA 1GKPA 3E2SA 2YA1A 3NPXA 4AD4A 4NYYA 4AZGA 3WFAA 2XH2A 4C65A 4XTIA 4INFA 4M81A 5DRIA 2QDGA 2E8YA 1FWIC 2F61A 5F1VA 4WIWA 4C7FA 1MUCA 4Z2JA 3BQ5A 4S3KA 3SN4A 2GGIA 1O4UA 5E0KA 4F2BA 3GC4A 1US0A 4X9SA 1Q5MA 5I23A 3RCNA 1THFD 2WMKA 3KRBA 4IMFA 4N9EA 1VGAA 2QV5A 3E0LA 3WDHA 5B7YA 1XCXA 4DWSB 1GVYA 1HL2A 3CO8A 3UY8A 1A50A 1IZCA 2AL2A 1TMLA 5FF3A 3RRAA 1KGXA 3OVPA 3ABSA 4HIBA 4QIUA 5CZTA 4CKQA 3EWCA 4O1CA 4GVGA 4GLEA 1F6KA 4Z08A 4JQAA 3G3DA 3OB8A 4C6DA 3GO2A 1VBRA 4LCRA 3TC3A 3NQAA 1XRFA 1GHSA 2PZ0A 3IJ9A 1AVAA 4NZFA 4DJDD 4LV4A 3SO7A 1QOQA 1OX5A 4HMDA 4MJZA 1S38A 4MGGA 3KVJA 2V30A 4X0NA 2VDGA 1V0LA 5BWAA 2WKLA 2ZX8A 5LNWA 4K2SA 3ARZA 1PYFA 4Y9MA 1J8VA 2FZ9A 1DJXA 3RJXA 3KFTA 1QPNA 3G1FA 1OFOA 1FH9A 3G77A 3SCQA 3KL0A 5FEPA 3N15A 2ATSA 4AMCA 3QYQA 4GABA 4U28A 3FVDA 3O0KA 4OUEA 3THQA 3Q4DA 1DIEA 4BI5A 1BD0A 4GXWA 4JN7A 3UWZA 1VFTA 1POKA 2WKGA 1GVIA 1VAHA 1IQ8A 1HUVA 2V2CA 1K7EA 4JAWA 1QHPA 1T8QA 1ZFJA 4O0QA 4YCPA 3R6IA 3N2TA 1XHGA 1JCJA 3IRSA 3N04A 2I9EA 3F4WA 3QR1A 1H09A 3AIEA 2ZX6A 4EAMA 3GKFA 4LX4A 4CQAA 4OTKA 4H2CA 4HJWA 1I9CB 4TMCA 3CZEA 3S1UA 2PMQA 4AUBA 3T44A 4NNCA 2VX6A 2W91A 2QCHA 4FO4A 4KEZA 3U4FA 3USZA 5HUPA 3AYTA 4LAOA 4C6NA 4NT0A 3TA6A 2CKRA 3L23A 1C7SA 4B4FA 2P10A 4O19A 2EPNA 4N9DA 4RUBA 2G0WA 4AHQA 1TVPA 3U5YA 4UNIA 5F2MA 1C3FA 2YZ5A 5C0QA 3CHVA 3GWQA 4PEKA 1P6CA 1TMHA 3ZYZA 4DJEA 3SCRA 3PZNA 4IX0A 1B90A 2Z1SA 3IUHA 3OBEA 4REQB 2NZLA 4X2RA 4F0HA 5IDZA 1UUMA 2V68A 4S3FA 1YEYA 3BQ6A 4JTSA 4QJ1A 3TR9A 1WA3A 3ARYA 4A21A 2GQ3A 5E6ZA 5EFFA 3K4DA 4EX4A 3OVRA 2X0HA 5AYZA 4ALDA 2VUNA 3N6QA 3AJXA 1KXVA 1YPIA 1TTPA 1I4NA 3W2UA 4KKXA 2HPIA 3GR7A 3MMWA 4IGNA 3IGUA 2GJXA 3GTHA 1W3TA 4PL2A 4DF1A 1OWQA 4RDZA 3W00A 4PUNA 3FHQA 4UQ9A 5CAKA 1J79A 3ARUA 4CU6A 4HMEA 1Q7QA 2EAWA 3UJSA 2F8QA 1RD6A 1EOMA 1UZDA 3VOGA 1UR3M 2IQ0A 1E5JA 1EGMA 1I60A 4D9PA 4PGLA 1HT6A 4AD0A 3AIUA 4DJFA 5CPLA 4AIBA 4HSOA 5F7UA 1UUOA 4Q4MA 3A5FA 1P0EA 1DWHM 2VX4A 1JDEA 3LSCA 2ZWZA 4K39A 4YWIA 4JTJA 2ZIDA 3UPMA 3O05A 2IPJA 3RMJA 4PMVA 2QJNA 1HP4A 2D20A 2CLLA 4IPPA 3WQ6A 2V2DA 5CZ0A 4B5UA 5EPDA 1JPMA 1CLVA 1R2SA 2XFWA 2F2HA 3NPVA 1M3UA 1BKSA 3MB9A 4L4PA 4GY1A 2A3BA 4Z0SA 2OO0A 3GNRA 4KWWA 1E15A 1GNXA 1KR0A 1PZ2A 3KBJA 2YCLA 4HD5A 4M56A 4CEXC 5A6BD 3II1A 4WVXA 5DXXA 1P1MA 3LZ3A 2OELA 2J9YA 1LQ2A 5MF5A 2QMKA 1QK2A 1XDJA 2XSAA 4D6FA 5LNRA 3RR4A 2DORA 4C1NA 3VGDA 3RX3A 1Z44A 2VZOA 1JL8A 1CX9A 3BLPX 2QULA 3MYOA 2HE8A 4M1BA 4RR4A 1UH4A 1FQ0A 1PUDA 1HJUA 1SW3A 4FI4A 2E67A 4BWLC 2YB4A 2DY3A 1ADSA 2F6XA 2BMBA 5JBFA 2PDHA 1C8XA