5M3WA

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-1,2-dideoxymannose and alpha-1,2-mannobiose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
350
structure length
350
Chain Sequence
NNNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 71
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
total genus 131
structure length 350
sequence length 350
ec nomenclature
pdb deposition date 2016-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m3wA00
1XV8A 3CH9A 3EDEA 5I3DA 1HJSA 3L4TA 1E5JA 2BFGA 1WPCA 1HKJA 4GINA 5FL0A 3WUFA 2XSBA 2XIIA 4M29A 3QR3A 3SCWA 3EMQA 4U3AA 3WF4A 3QOMA 3T2PA 1R86A 3L4XA 2W63A 2J8FA 4EE9A 2WSPA 3WNNA 3BLPX 1ECEA 1UH4A 1SYTA 1A3HA 2YA0A 2ZX9A 4AISA 2VCBA 4M80A 2ZUUA 1GJUA 2D3NA 3AYRA 1J11A 4PMOA 1KWGA 2WCSA 4CD6A 2BY0A 3WSUA 1B30A 2WSKA 4H7VA 1CBGA 2PC8A 1CZ1A 4X0VA 2ZUTA 1QHOA 1UWIA 2UY3A 5DT7A 4W85A 1C7SA 1E4IA 1FHLA 1GOIA 3A4XA 3FHQA 2BHZA 3WNLA 1ZBKA 4HTYA 4JHZA 3QHNA 1OGBA 2FHCA 3ARWA 3OGSA 1BYDA 2YL6A 2XFYA 4KWUA 3WH7A 2WZIA 2ZIDA 4PMXA 3VDCA 4AMCA 4PEEA 4AIEA 2E9BA 3HU7A 7CGTA 1JAKA 5F7UA 3AIRA 3MUY1 1QPKA 2ZUVA 1OIMA 3TTSA 4F8XA 3UG3A 2MANA 2ZX8A 2FGZA 1GQLA 2DQXA 3L2MA 2VL4A 3VIGA 3WD3A 1JYVA 3N18A 9CGTA 3SCRA 1PPIA 2EO7A 5D9PA 3WQ6A 1E4MM 1GVIA 5AC5A 1EIBA 1WDPA 1XD1A 2GJPA 1E15A 3AIEA 2WMHA 3BLKA 4MDPA 1M53A 1C3FA 1TVPA 2DGAA 4U31A 1WKYA 2WWDA 4ACZA 2E0PA 2CBJA 1ZBCA 2J7GA 2YDRA 3D3AA 1GCYA 1TR1A 2X8RA 1H0IA 4PMDA 1VRXA 4E2OA 2G3IA 3VX0A 1RPKA 1KXVA 1EQCA 2C8NA 5BRQA 4W8AA 1R7OA 3EDKA 2ZXDA 4AZBA 1E56A 4AZHA 2CHNA 1C8YA 3TTQA 1HKMA 3WDRA 1SFSA 1XCXA 3VD4A 1H0GA 1UZ1A 5M03A 5I77A 5A94A 4GZEA 4D1JA 1PX8A 5TD4A 1W2VA 5BROA 5FD0A 2XSAA 3WMBA 5I5RA 1M01A 4JFSA 2BVTA 2Y2WA 4P7RA 3AICA 3EDDA 3CLWA 3SCUA 1UH2A 2DSWA 1K9DA 1VEMA 1W1YA 2VI0A 5JBFA 5A6MA 1W91A 1HX0A 3CZGA 1HJUA 4W7UA 3WMSA 2FHFA 5M17A 2G8ZA 3BMWA 8A3HA 1W1VA 3GNRA 4YPJA 3M46A 1FFRA 4UFJA 3NDYA 1GPFA 6TAAA 2J62A 2GJXB 4JFVA 2VCCA 2Y24A 2ZX7A 3BAWA 1VAHA 2OSXA 2CERA 1ISZA 2IUZA 5ECUA 3CBWA 1EOMA 1WNOA 1E72M 3OGVA 4ZXLA 4HU8A 2VQUA 2DSVA 4A3YA 1JZ6A 1GW1A 3CPUA 3N13A 1WZLA 3RIKA 1UQZA 2BY2A 3AQUA 2UY5A 1K6AA 1CGUA 5HXMA 2EPLX 2ZWYA 2V3DA 1E0VA 2CCRA 3IJ8A 5DO8A 3W25A 2PWEA 1JIBA 2WMKA 1ITCA 3CUJA 3F4VA 4UNIA 3VNYA 2AMGA 1E1EA 3WKZA 1UA3A 1EO5A 2EPOA 3MUIA 1MXDA 3A4AA 3A47A 4TOQA 1NOFA 5CGTA 1AVAA 3WDJA 5I78A 3GNOA 2WVVB 4MB5A 1J18A 4XX6A 4QP0A 1JZ5A 1W9BM 1JD7A 2IXUA 3CHFA 4JHOA 4WKHA 3CUGA 2WC3A 4X0NA 3VVGA 1J0JA 4NRRA 1WDSA 3GDBA 2J77A 1TUXA 1JAEA 1BYBA 4AZIA 4V2XA 3T2OA 3PZVA 4AZCA 1WCGA 5A2AA 3GH7A 2YA1A 3T0AA 1RD6A 1F4HA 4AZ6A 1AQMA 4GZIA 5C70A 2D2OA 4CVUA 4CGTA 1H49A 1CGYA 3WNPA 5IDIA 1J9YA 5IHSA 1R85A 3K8LA 4NF7A 4WKFA 4PTVA 1OT1A 3SUUA 3BAJA 1QI2A 3W6LA 2DIEA 3A6OA 5I24A 2XG9A 2YBTA 1PX4A 1EGZA 1MWOA 4TXEA 1KCLA 3PN8A 2CBVA 3EDJA 4KRUA 3A4WA 2VX7A 4UTFA 5FCZA 1EDQA 4PMRA 1MQQA 2AAAA 4KGLA 3AIWA 4ZXOA 2J8GA 1W3KA 1V0NA 2WPGA 5CPQA 4N0RA 4JFWA 1HF6A 5CSUA 1G0CA 3GZAA 2ZUMA 4J3UA 4RL3A 4M24A 2Q8XA 5DFAA 1WP6A 1UKOA 4HOWA 5IFTA 3BSGA 3W81A 2OWXA 3CUHA 3WQ4A 3O9NA 3NIYA 3GBEA 5HBFA 2YL9A 4HA3A 1V6WA 2BY3A 3RM9A 1E3ZA 3AXHA 4RE3A 4CKQA 2VZSA 5A8OA 3W4RA 1XH2A 3T0BA 1XSJA 4ATWA 2XIBA 2A3EA 1GHSA 4AY1A 4D6DA 2YIHA 3AHXA 3WBEA 4UQ9A 2ZXBA 5CQ1A 4C7FA 2W92A 3TOPA 3W28A 1OT2A 2YA2A 3TP4A 3T0DA 3VKKA 3IAPA 1NOWA 3FXYA 3WFLA 3M07A 1HJXA 1KFWA 2J7CA 1OCQA 3WD1A 5BXPA 4TVDA 1MFUA 2J74A 3ARUA 5A95A 1VIWA 3WF1A 3PTMA 1V03A 4AIOA 1BAGA 3AS2A 2WMIB 1TMQA 1XH1A 1E6PA 3W0KA 2WHLA 5E6ZA 3WDPP 2YJQA 3L4VA 4MNKA 5BRPA 2PWDA 5JUVA 4PTWA 2VVSA 3CHEA 1BFNA 1VFOA 4OZOA 4L4PA 2DH2A 1V3MA 4W8BA 1TA3A 1D2KA 3KWXA 2QLYA 4MJ2A 2XVLA 1B2YA 1DWJM 3VIKA 3VD3A 2QPSA 4CN4A 3AOFA 3MS8A 1W2PA 1KBKA 1NP0A 1CXIA 1C90A 4UQBA 2D0GA 1W32A 4HPGA 1CIUA 3WFZA 3ALFA 5EBAA 3WQVA 1HVQA 1MW1A 3OB8A 5IHRA 3QHOA 4C7GA 2ZUWA 4D72A 5C71A 3CZLA 1D7FA 4WSJA 4UQAA 1RH9A 4YHGA 3WEMA 4FLOA 3UESA 2OYMA 1OBAA 3GM8A 4PMNA 1UR2A 1J01A 1W3JA 4UCFA 3GXIA 4UFKA 1CYGA 5JIWA 1PAMA 3IJ7A 4ZE5A 4AYSA 1OWQA 3SUSA 3TONA 3T08A 3U7BA 4PMVA 1W3HA 2D0FA 5ABGA 1JNDA 2VQTA 2JALA 2PBOA 4W5UA 4Z2JA 5JBDA 1E6NA 1DWGM 4H41A 2WLZA 3PHAA 2WAGA 1W9PA 4A4AA 1E40A 3B9EA 1J0HA 4OUEA 1KR1A 4EANA 2D24A 4BQ4A 3QOKA 5CGMA 2E9MA 1U2YA 3FNDA 1FH7A 3VNZA 3VGDA 4WIWA 3AHTA 5A3HA 4Z2HA 1DWFM 1VJZA 4TX8A 1KXQA 3OLEA 1XD0A 2ZWZA 1VJSA 1GZJA 1W9DM 2AOSA 2GVYA 1DEDA 4D6HA 3SUWA 3RO8A 2FH8A 1BQCA 1W9XA 1OGGA 3VM5A 1CGXA 1LLOA 1UD2A 3BMVA 3RJYA 1G94A 1E3XA 1GQKA 1M7XA 1TFVA 2YKKA 4XUYA 3W53A 5LA0A 4J3XA 1OSEA 3LPPA 4BCEA 5AY7A 1NWUA 4P8UA 3ZT5A 1Q6FA 2FH6A 4TTGA 4AWEA 3FHAA 2IXVA 2YBUA 2UY4A 1N82A 1JF5A 2W91A 1Q6EA 4IM4A 1M03A 4MAZA 4JCMA 4P7LA 3UETA 4ZE4A 1NWRA 3N04A 1CENA 2BXYA 4GQQA 6A3HA 2XFRA 1VB9A 2WKLA 2OWWA 3VMOA 3WUGA 1QNSA 3F5JA 2CYGA 3WMCA 4J3SA 1CDGA 3NYDA 3WENA 3T09A 5DEZA 1TE1A 5DF0A 7A3HA 3DECA 1E71M 1GHRA 1PEZA 3SURA 1H2JA 1V6YA 4JAWA 2OLHA 1Q6CA 2WVTA 1ZS2A 3EMCA 1WZKA 3VIJA 3VGGA 5GQBA 4EK7A 5BWFA 3ARVA 1HKIA 5A1AA 2BHYA 4DWSB 1OGSA 1V3HA 3OZPA 1ZJBA 3AXIA 1WZMA 3RCNA 3VD7A 2X1IA 1OM0A 4B3KA 2O9RA 5LA1A 1J10A 3ZJ7A 1BHGA 1JNEA 2DIJA 1RP9A 3TTOA 1DWHM 2VTFA 3OA5A 1HJWA 1FH9A 3KZSA 4JIEA 1CXFA 4H8HA 3O6AA 3ZQ9A 5M3WA 1HVXA 2F2HA 2XUCA 2Y8KA 5BXRA 5D9OA 1R7AA 1B3VA 2GSJA 3IANA 2JE8A 3RM8A 2J47A 4ZENA 3SCTA 5A6KA 1KXTA 2E3ZA 2GUYA 1TCMA 4D6EA 1DHKA 4PCTA 3OGRA 3PZUA 2OWCA 3AMCA 4H04A 2XYLA 1H4PA 1VFFA 3LPOA 4HZ6A 1SMAA 4GZJA 4W5ZA 2VUYA 3WDQA 3OG2A 5EFFA 1XYFA 2WHKA 4HZ7A 2XFFA 1E9LA 1ZU8A 3AMDA 5A8PA 3FAWA 4UFHA 1B90A 2V3EA 1FFQA 1J12A 1QI0A 2WCAA 4QLLA 3DYPA 3U57A 1LL7A 2WVUA 1MXGA 5E0FA 5A6BD 3L4YA 3ALGA 2O92A 1GJWA 4URIA 4MPKA 5BYWA 1CXLA 2VX4A 4ACZB 3W82A 4Q7NA 4W8LA 3II1A 4GI6A 3THDA 3WQWA 2VNCA 1WAWA 1PBGA 2A3BA 2VRJA 3CHCA 5I0DA 3AZTA 2J78A 4KMQA 4DUWA 1ISWA 1MQRA 1UWUA 1BTCA 5M5DA 4BA0A 4PCSA 5I6SA 1P6WA 1NH6A 2F61A 4R27A 1V3JA 3WF2A 1KXHA 4WLCA 4L4OA 4D6CA 3VIHA 3SCSA 5KEZA 1OD0A 3JUGA 3NUKA 4Y7EA 2BVDA 3RMEA 1A47A 5A8MA 2VR5A 1R8LA 1GOWA 1W9VA 1ZBVA 3OZOA 4W86A 4BQ5A 3ZR6A 4JFTA 1RP8A 1M04A 1CLVA 5HPCA 2XWDA 2WM0A 2GK1A 1CXEA 1V08A 5BCAA 1XYZA 1C8QA 2BNJA 1KBBA 3RILA 2XVGA 3GBDA 2BXZA 1QI3A 4QDMA 1PZ2A 4JCLA 3CHDA 4J7RA 5D4YA 1BG4A 2XM2A 3VD5A 4LQ1A 2A3AA 1OINA 3G6LA 1XSKA 1QW8A 1ISVA 2DEPA 4WF7A 1JDDA 1CTNA 5A69A 1IZJA 4V28A 4Z2IA 3W37A 1HKKA 2E8ZA 1GQJA 1GOKA 3EYPA 1UOKA 3OLIA 1JFXA 3ZJ6A 3ARYA 4HZ8A 4DWSD 4IPNB 4K68A 3E1F1 1EQPA 4RE2A 1OB0A 5HOSA 4R5EA 1XCWA 2YOCA 4MADA 3VMNA 1X6NA 3KL5A 3THCA 4OBRA 1G5AA 1ZBWA 4D71A 3QGVA 2NT1A 3ARTA 3NCOA 2DPEA 5GNYA 4BQ3A 3ZMRA 2W62A 3B8SA 3ZM8A 2XPKA 3VMPA 4GKLA 3UR7A 4CCCA 3UG4A 1LQ0A 4AZ7A 4U33A 1LWJA 1VENA 3N12A 4Z2LA 5FKYA 1US3A 1MW3A 2QMJA 1WB0A 3VGEA 3WELA 4LYQA 4TUFA 5BXSA 2D23A 1JDCA 1VEOA 4M8UA 4ZEPA 4GIAA 1KCKA 1PIFA 3GXMA 2XVPA 1GORA 3WQ8A 3K8MA 1W1TA 3RJXA 4HOZA 5HPOA 1E0XA 2YDSA 1UZ4A 3UR8A 1S46A 3SCNA 4W7WA 4AD0A 3UEQA 4QLKA 3WUBA 4D6GA 1I1WA 4MB1A 5EMYA 1UG6A 1CXHA 2EBNA 2VR4A 4U3CA 2EPKX 1V6XA 2J25A 1W3LA 1GQIA 3WY1A 2WXDM 4CU6A 1TVNA 3PZMA 3VIPA 1XRVA 1QOXA 4LX4A 2WNWA 4IISA 4CD7A 1D3CA 2PWGA 1J0ZA 2E9LA 2W66A 2X2YA 1HL8A 4E4PA 3GXFA 3WNOA 1QVBA 2VZUA 1GOQA 2OYKA 1QNPA 3CIVA 2C0HA 4AD5A 3CO4A 4AZGA 2WMFA 4FLRA 1FHDA 1GOOA 2UY2A 1H41A 2D1ZA 1LG2A 3F5LA 3LPFA 2WK2A 2ZXQA 4W7VA 2CBUA 4D6FA 1BVZA 4GPNA 4H8UA 1V6UA 1E4NA 3BAKA 4QCFA 2GDUA 3CMGA 4PMZA 3MO4A 1C8XA 4H8VA 4GXPA 2WB5A 3GXDA 3MUZ1 3CGTA 2HISA 5CSYA 2WMIA 2YL8A 2WMGA 4UQCA 3W24A 1ODUA 3W6MA 3OIHA 4B3LA 4C7DA 1LWHA 1HJQA 3BCFA 3CMJA 3AIBA 1DWAM 2XHYA 1EO7A 2XM1A 3VUPA 4MTVA 5A2BA 4DWSC 3K4DA 4CCDA 2DT1A 2X0YA 2JF6A 3BAYA 4N42A 2GFTA 3AIUA 5LYRA 2FGLA 4HA1A 1JG9A 4QAWA 2VZVA 4GI9A 1FH8A 3WH8A 1O6IA 1US2A 3VX1A 3ECQA 3WD2A 1PX3A 3AYSA 1DWIM 4GO8A 1JL8A 1JXJA 4CN1A 3AS3A 5KZ6A 1MYRA 4CU8A 3A3HA 3AROA 1K9EA 2ZX5A 4PMYA 1UD5A 4MNLA 1TZ7A 5D8WA 4ACYA 2DSUA 5DMYA 4WJXA 3W38A 1AQHA 3HMCA 3N17A 3MMUA 3AIQA 1WDQA 1H1NA 4P8WA 3WD4A 3WDHA 2G4FA 1KGUA 3RM4A 1UWTA 1PJ9A 4TTUA 2EEXA 1JZ7A 1BGGA 3OLGA 2ZUNA 2WC7A 3NDZA 5LA2A 4KH2A 1UKQA 3AMGA 4U2ZA 4MAVA 2CPUA 3PZNA 2C7FA 4OOUA 3WEOA 2YDQA 3AS1A 4AD4A 2V5DA 4D1IA 5I2UA 1ISYA 3W26A 3U5UA 3PZQA 2PBGA 2OSWA 4V27A 2W61A 5C8BB 4HMDA 4NZCA 3N9KA 3PBGA 4F9DA 5AYIA 5IXEA 5I79A 1VBUA 4FF5A 5ABFA 1Q4NX 3POCA 1V3IA 1H5VA 1EDGA 4PMQA 1MW2A 1HNYA 2OYLA 2Y8VA 4PRWA 1E43A 1XGZA 3AISA 1QNRA 2X09A 4W93A 4UOQA 3WEZA 1JYWA 3GYCA 3WD0A 1NP2A 2GDVA 1ESWA 3KE0A 3VIFA 4E8CA 2Y4SA 3UERA 3AZSA 5A6AA 3CZKA 1EXPA 3DYOA 2NW0A 1DP0A 1C93A 2D20A 3U5YA 3VD9A 1ODZA 1B0IA 3VIMA 2UWFA 1HIZA 3VPLA 2J7EA 2PB1A 3MSGA 3AIVA 1Z32X 4IPLA 4UQDA 5E9AA 1JXKA 2PWHA 3VGFA 3CTTA 3WL1A 4H2CA 5CZKA 1BG9A 2XJ7A 2VJXA 2VRKA 3BSHA 3ZOAA 2WC4A 2Z1KA 4D6JA 5GNZA 2YLLA 1HJVA 4XZBA 2X0HA 4HOXA 1JYNA 2JEQA 1NQ6A 5D8ZA 1W9UA 1IV8A 4QLJA 4ATLA 2V3FA 1FOBA 5FL1A 4Q22A 3ARZA 2EJ1A 2D22A 3L2LA 3WIJA 1IZKA 2BV9A 1BVNP 3VU2A 4TVUA 2A3CA 2NT0A 3W27A 1GVYA 3DC0A 1E4LA 2XVNA 4UOZA 2Y5EA 1LJYA 4JZ5A 3RDKA 3VGBA 1NWTA 3M6DA 5E09A 1UR9A 5CXPA 2CKRA 4XZWA 4DWSA 1H11A 2CBIA 2WMJA 3BAIA 1H3GA 2OSYA 3VO0A 4U5KA 2WBGA 3AI0A 4UFIA 2G3MA 2JIEA 1BLIA 2CNCA 4NRSA 4OIFA 4FMVA 4B9YA 4AEEA 2V3GA 1J0KA 2GJRA 4HPHA 4OKDA 2EPMX 3VGHA 5A8NA 1K9FA 3VDHA 3ARXA 5CPTA 2YLAA 1VF8A 3W29A 3AHYA 2JIWA 2J75A 3CZJA 5E6YA 4BQ2A 2WHJA 3DYMA 4CUCA 1E70M 3WF0A 2CKSA 1E55A 1UR8A 2WVSA 1F4AA 3MV01 4UR9A 5CJ5A 3NSXA 4OJYA 5HDRA 1AQ0A 4QFUA 1B3XA 1H09A 5FOOA 4GO9A 5JIPA 1KGWA 5CG0A 3PZTA 3OBAA 1UR1A 3VILA 2Z1SA 1UWRA 3SUTA 1ZB5A 2QMKA 1C7TA 3WH9A 3I3DA 1ZL1A 4S3JA 1CEOA 1GUVA 5E70A 2E8YA 1YQ2A 4PYSA 1UKTA 3OLDA 3NSMA 5FIPA 2J7HA 3DHPA 5EFDA 1NM9A 4W87A 5I23A 1X1NA 3VDAA 1VEPA 4QCEA 3MMDA 3VINA 2DT2A 4AC1X 3K4AA 1B9ZA 2RGMA 1QHZA 3ARPA 1CLXA 5JBEA 8CGTA 1B3WA 2TAAA 3I3BA 4PBGA 1UWSA 1GONA 2WHMA 3FW6A 4M82A 1BYCA 2WYSA 2DT3A 1VBRA 4ML4A 1JZ2A 4AD2A 3GH4A 1QNQA 2VT0A 3WN6A 1BF2A 3AZRA 2XGIA 4CCEA 2JF7A 1FP9A 1HL9A 4CVWA 3N11A 5AYBA 4AXNA 2EQDA 2ZE0A 1UD8A 4Z2GA 1SR0A 4HMCA 4DM2A 1KWKA 3IJ9A 3WNKA 1L0PA 2FDMA 1BYAA 2J7BA 4OBSA 3MSDA 3SIMA 2GJXA 2XTKA 1JGIA 1WE5A 1WZAA 5HNNA 3SCQA 1NWSA 4CN6A 2DT0A 3DHUA 4OOZA 2DSZA 4M1RA 2CIPA 2EPNA 5ABHA 6CGTA 3B9DA 1KGXA 1WDRA 4F66A 4W88A 2V5CA 4ATDA 2DH3A 1L8NA 1E0WA 3ZJ8A 2G3NA 3EDFA 1DTUA 2CITA 4Z2KA 3AXXA 2E4TA 3PZGA 4WSKA 1MFVA 2ZUSA 1KB3A 3VDBA 3ARQA 3KEHA 1V0LA 1V3KA 4JKKA 3AJ7A 4J27A 4MNMA 2VRQA 4DUVA 1NOUA 1Y7VA 2A3HA 3IAQA 1XSIA 2O9TA 4JL1A 4S3KA 1LL4A 2RGLA 3WL0A 4W89A 3WDIA 1JZ4A 4JKMA 2VVNA 3AMKA 5D9MA 1CNVA 3TTYA 3L4UA 4UZUA 2WVVA 4E8DA 2WANA 4JL2A 3BAXA 2G3JA 4GQRA 4LYRA 3AMLA 4DUXA 3BC9A 1EHAA 1ZJAA 3CUFA 4KRTA 5CPSA 2NSXA 2GK1B 3CZEA 3S2CA 4PUEA 3ARSA 1E6SM 5D9NA 3ZT7A 3PZIA 1JI1A 3UG5A 4A3HA 4AZ5A 3MKKA 1CPUA 4MB3A 1EDTA 4JKLA 1B3ZA 1U30A 2ZXAA 3EBVA 3AFBA 4MJ4A 1QNOA 1Q6DA 5A8QA 1UYQA 1JYXA 2VZTA 1E6RA 1MW0A 5E0CA 4GI8A 2EXOA 3WBAA 3PZ9A 2JFEX 2WW5A 2PF0A 1MVYA 1JD9A 1KQZA 1QBBA 2ZICA 3N1AA 4UQEA 3VIIA 2PI6A 1JI2A 1QHPA 4JFUA 4PTXA 2VX5A 1XH0A 3GH5A 4AZCB 1UKSA 2CEQA 2QF8A 4U2YA 1R87A 2WCGA 2VURA 1EA9C 3BCDA 2J79A 1V02A 3FN9A 4F9JA 3VTRA 2VMFA 3NSNA 3G6MA 1FP8A 1V0MA 1UD6A 2D3LA 2O9PA 3LPGA 7TAAA 4XB3A 3ZSSA 4P7QA 1G01A 4MNJA 4CU7A 3K1DA 2XGBA 2XWEA 4RE4A 1QI5A 4ZFMA 3L4ZA 1IT0A 1BSIA 2VOTA 3VM7A 5A2CA 1BPLB 1LL6A 1EHNA 4PN2A 2WBKA 4LGXA 4KGJA 3SEPA 4CD8A 4NI3A 4FK9A 1HP5A 3I3EA 4CD4A 4J3VA 5A6LA 1YHTA 2BVYA 3PTKA 4UFMA 3NJ3A 4W84A 4HA4A 1UD4A 1B31A 1C91A 1JFHA 3K46A 1WO2A 2QV4A 3MANA 3MV11 3CUIA 4WK9A 1Q6GA 1X6LA 1SMDA 2CETA 4YHEA 3GNPA 1K9TA 4M56A 3VOCA 3J7HA 2X05A 4X9YA 3LMYA 1G1YA 1G9HA 4LYPA 2WZHA 2YL5A 2J4GA 1B1YA 2VC9A 1V6VA 3WNMA 1VFMA 4MB4A 3AS0A 2ZOXA 2WKGA 3BH4A 1B3YA 4B9ZA 3ARRA 4P7OA 3M7SA 5GPRA 1C92A 2BS9A 3B9AA 1XC6A 3PZOA 4B15A 2J7DA 1AMYA 1UR0A 4J3TA 4TVCA 1JZ8A 4P8XA 5IFPA 1XHGA 4FLQA 1EH9A 4LXFA 1E1FA 5EB8A 1E6XM 3ZIZA 4BS0A 2WWCA 4PSRA 3BXWA 3QHMA 4PTMA 4P7NA 2DDXA 3BGAA 3S6TA 3IK2A 4J3WA 1NARA 2BHUA 2WZEA 1V0KA 2WLYA 1I1XA 5GNXA 3ZR5A 1UWQA 3U7VA 1CGVA 4P8VA 1KQYA 3O2LA 3ZO9A 1E6QM 4FLSA 5CLTA 1O7AA 4CD5A 1GNXA 3ZSTA 2DSKA 2W5FA 1E5NA 4HMEA 4HP5A 1QBAA 2CESA 1CWYA 5A6JA 1JZ3A 1TA3B 1E73M 2VCAA 2W67A 4UOJA 3FAXA 1QW9A 2E40A 1HN1A 3WQ5A 4AW7A 3VIOA 2FHBA 1GOMA 3K8KA 4NSBA 5DT5A 4YN5A 2J7FA 3WH6A 1UQYA 3WF3A 3RPMA 1CECA 2QPUA 3GTNA 3WH5A 4F79A 3CZ8A 5CLWA 1ITXA 2V38A 1TG7A 5A6SA 3MMWA 1U33A 3APGA 4BF7A 1CGWA 4UFLA 1EOKA 1LF1A 2G41A 1LG1A 4PUDA 4BZYA 4LPCA 4PMUA 3POHA 3ZJKA 1V3LA 4AD3A 3KL0A 1OD8A 1UH3A 1V02E 2XVKA 2BY1A 1UA7A 2VO5A 4IUGA 1HP4A 1J0YA 5A6BA 3WUEA 1W1PA 3ZT6A 4D6IA 3SUVA 1FA2A 3AHVA 1UR4A 2ZX6A 4PSPA 1OIFA 4AD1A 2JEPA 2O9OA 1E6ZA 4J28A 2PWFA 2QHAA 4MDOA 4TX6A 4XV0A 1KR0A 3SCOA 2VZOA 3EMZA 4AIUA 3FY1A 1HT6A 1BGAA 4AEFA 3MU7A 5ABFB 5ABEA 1MQPA 4HU0A 3UCQA 4WKAA 3AHZA 2D0HA 1CXKA 1JDAA 1VFUA 1ISXA 3F5KA 1PZ3A 2HVMA 1I75A 1QI4A 4U5IA 3D5HA 3HN3A 3HJEA 1CGTA 2CHOA 2VX6A 5AC4A 2F8QA 4UZSA 1UHVA 3SCPA 4M81A 1J0IA 3PTQA 3TA9A 3KL3A 2B31A 1UD3A 4DM1A 1HXJA 1PIGA 1JF6A 1UKPA 2ESCA 4B16A 2W4XA 3SCVA 3MUAA 5BXTA 3L4WA 1UUQA 3T2QA 4EKJA 3N15A 4EAMA 2CXGA
chains in the Genus database with same CATH superfamily
2HXUA 1LRQA 1HJSA 4QQ3A 1E5JA 4GINA 2XSBA 3ZVHA 2YCLA 3GW0A 3WF4A 2GUBA 1R86A 3IV8A 3L4XA 3QV6A 5HWNA 4UR7A 5FF4A 3WNNA 5HK4A 1LQAA 5C9ZA 1SYTA 2AGKA 5I09A 3KRZA 2ZX9A 3NVTA 2VCBA 4AISA 1A50A 4M80A 4AB4A 3T42A 4O14A 1ADDA 3AYRA 1KWGA 2PDJA 3SGUA 4NJHA 3GG1A 4F0RA 4KWWA 2WSKA 3NWRA 4H7VA 1W1A1 2ZUTA 4QJ1A 3THQA 3PPFA 2UY3A 3C3NA 2VFEA 2EF9A 3LHYA 5DT7A 4CQDA 1FHLA 1TWIA 1H62A 3FHQA 2NLIA 4LAUA 3URQA 3LXBA 3DFNA 4HHMA 2POZA 4JHZA 3GTIA 3SY1A 3Q2DA 3WK1A 1Q7MA 2PGRA 3OTRA 2UZ9A 4KWUA 3LLXA 3HV8A 2TODA 1XISA 2WNNA 1VPXA 1BWLA 3GXPA 5AYXA 4LUIA 2E9BA 2BTMA 1JAKA 2PF8A 3QQ1A 4FZIA 3OOQA 2ZUVA 4WD0A 2NUXA 2CLIA 2FGZA 2B7QA 2CZEA 2DQXA 3EWZA 3XISA 5AECA 1X8CA 2Y7DA 3BJFA 3LGDA 2ZRXA 1PHQA 5IOBA 1GVIA 1EIBA 1WDPA 1OG0A 4I8YA 2GPTA 3AIEA 1M41A 4MLJA 4YLWA 1C3FA 4QX4A 4IG2B 3PPCA 4HU4A 5FEWA 2CBJA 1ZBCA 2J7GA 2YDRA 1TR1A 3I68A 1SJDA 2VDIA 2NQHA 4A21A 2YCIX 3CT7A 4PMDA 3EKLA 2BXVA 2G3IA 3N2XA 1KXVA 2WJFA 2CLMA 3H6OA 2R1KA 3IGUA 3GX9A 1E56A 1LUCB 3NQCA 1C8YA 5PTDA 2Z0IA 4GH1A 3WDRA 3NAVA 1SFSA 3VD4A 1H0GA 1I6NA 3N4EA 2RJHA 5A94A 3N25A 2PA6A 4FS9A 3GTHA 4QRNA 1W2VA 5BROA 4BWLC 2XSAA 3WMBA 5KETA 3LERA 4JFSA 3N6QA 2VFIA 1UH2A 3C86A 1W1YA 4YTSA 4MY1A 5JBFA 1HJUA 3FIGA 4MWAE 3N9RA 3U0HA 2FHFA 4R85A 5DQPA 4YMZA 3B8TA 3BMWA 2J9XA 8A3HA 4YPJA 1H1ZA 3W87A 2CLHA 2FDSA 4QITA 2I1OA 3BAWA 5F1VA 3ABZA 3SSJA 5ECUA 2QCEA 3CBWA 3JW7A 4J5NA 3WO8A 3G1XA 1F61A 2VQUA 3F1QA 2A6LA 2OO6A 1JZ6A 3AO0A 3CPUA 1WZLA 3IIZA 2J24A 3COTA 1UQZA 3D6NA 3NZRA 1CGUA 2F6XA 5HXMA 4AWSA 3WBYA 2ZWYA 4PODA 1O5KA 4PE8A 2VKZG 2PWEA 4DBEA 4F2TA 3QV9A 1A4LA 3QLLA 3TC6A 3TMQA 3TNBA 7ENLA 3WKZA 1EO5A 3MUIA 1MXDA 3A47A 4K8HA 3WDJA 3LQGA 3SGZA 3LCIA 5GVJA 2V5JA 4QP0A 1X7FA 2IXUA 3QEZA 3VZXA 3CUGA 4FOUA 4X0NA 4HB7A 1RJPA 1J0JA 4IPIA 3GDBA 4QISA 1BYBA 2EGZA 4AZIA 3IJ6A 1XICA 2PDFA 4IH3A 4AZCA 2WZMA 3O06A 3V1PA 3L23A 3S1UA 1MEIA 1KM1A 1RD6A 4AZ6A 3QTGA 3P93A 1L6GA 1XJBA 3C8FA 1H49A 2C91A 3DU0A 4ZFCA 1R85A 3K8LA 4NF7A 4WKFA 3OHMB 3N6HA 4HK6A 3USZA 5HR7A 3A6OA 2YBTA 1LQ2A 4KCVA 3LXAA 1GVOA 3SBFA 2CBVA 4EF9A 3EDJA 4XD6A 1E9IA 4KRUA 4UTFA 3U2OA 3WLTA 1EDQA 2CZVA 4S3GA 2WV8A 3TJXA 4H7ZA 1K8CA 2C16A 1TPVA 5CPQA 2A7PA 4POCA 2CWXA 3GZAA 4DQWA 3I4KA 2Q8XA 1SQ7A 5DFAA 3UGVA 3XIMA 2UV8G 1VH7A 2CWNA 3CH0A 1I9CB 3CQHA 1HO1A 4WQ6A 3HPAA 3BSGA 3GUGA 4KFOA 2QJIA 3E0LA 2OWXA 3BJTA 3CUHA 2NQ9A 3O9NA 1XCFA 4PTDA 3AWOA 4B5NA 2YL9A 4O12A 2Y85A 1V6WA 2BY3A 1E3ZA 3DENA 2C1IA 4CKQA 1CCWB 3G8RA 1FBAA 4RV8A 4LBSA 1XSJA 4KQNA 3G1AA 1GHSA 4C5ZA 2EJAA 2QDDA 4K38A 4FX7A 2W92A 4ZOBA 3TOPA 4TV5A 3W28A 1OT2A 2YA2A 3TP4A 4IL0A 1W3NA 1ENUA 1POKA 3A5VA 3KCJA 1KFWA 3PWAA 1OK6A 3WD1A 3MP5A 3IUIA 3FCPA 3C3UA 1PB0A 1K02A 2JGQA 1FCQA 3THUA 1I0DA 3CV1A 1BD0A 3TFXA 4AIOA 3TJLA 3W1NA 1BAGA 2Y5SA 4IGSA 3RLGA 1TV8A 3GUWA 3W0KA 3M0KA 5E6ZA 3PPGA 3LEPA 4YTRA 4EXBA 2KZHA 5A6TC 4IGHA 4DEFA 1X6UA 3W7LA 4AHQA 3FS2A 2FMNA 4WX2A 3NGFA 2B7PA 2V5LA 1ZP4A 1QATA 1TA3A 1B2YA 3QW4B 4B5UA 1E1CB 1OX5A 5CZJA 4CN4A 2NUYA 3AOFA 4GC4A 4XTDA 1CX9A 4O0KA 3G77A 2JQXA 3QQ0A 5IHRA 3WJSA 3ZLFA 5IRPA 4P2VA 2ZUWA 3S2JA 3EX4A 5C71A 3N73A 4H6EA 1DKWA 3N4FA 1BXCA 5LXXA 3UESA 5FJPA 3G1DA 1O5XA 2DVTA 4K39A 1W3JA 2QJNA 2CLPA 3IJ7A 3TONA 3QMTA 1Q2RA 1A4MA 2FPTA 1QWKA 2BG5A 4UNLA 3KTXA 2JALA 3C0QA 1EJWC 4WR3A 4RZ4A 3BLEA 5F1UA 4ECLA 1DWGM 4I9AA 4IQLA 3CYVA 4WVXA 5C7HA 3PHAA 1GJPA 2WQPA 2PDBA 3B9EA 4X60A 3T6CA 2D24A 3URAA 3QOKA 4BQ4A 4O53A 3EA3A 3FNDA 4GYKA 3VGDA 4KEUA 4MFEA 3GIQA 2A4AA 4Z2HA 2V69A 3CLMA 4A3UA 1VJSA 3QH2A 3GAKA 4I3GA 2GVYA 1WQ5A 5IBXA 4ZGYA 1JUBA 4PTNA 4NNCA 1KFEA 2FH8A 4F48A 1CGXA 3QLDA 3BMVA 1GQKA 2HWGA 4XUYA 3G3DA 3R5EA 1MO0A 3GAYA 3LPPA 1RLCL 3ZR4A 2ZA1A 3LHWA 2A21A 1HO4A 3U2ZA 1Q6FA 1IF2A 4CCZA 2FH6A 3EWUA 2YBUA 1IHIA 3A3XA 1HUVA 1N82A 1Q6EA 1XIHA 1GGOA 4ZE4A 5LNRA 2NQLA 1UROA 1PV8A 3WUGA 4FXJA 4IPPA 2IKJA 2CYGA 3WMCA 4S2BA 3P84A 3KFTA 2A3LA 3IARA 3W6YA 4S23A 5K7JA 1WKEA 3TYEA 1B5TA 4O4WA 2VD8A 4I9MA 1OZQA 4LUTB 5GJMA 1OF6A 5DF0A 4ZSTA 2QUUA 1GHRA 2FZ8A 4AY8A 1DORA 4NX5A 4GGBA 4DNMA 2GDQA 5LHFA 4EPKA 1FWNA 4Y8FA 1HZYA 2R8WA 3HPZA 4IHCA 3AXIA 3VD7A 2X1IA 1OM0A 2O9RA 4B2DA 5E93A 3ZJ7A 4J40A 5FF7A 3W72A 3PP7A 4Y9MA 3W00A 3H54A 1OFDA 3FVMA 3GNDA 2PTYA 3PUOA 1V93A 3TYZA 3ANYA 2WNQA 3TVAA 1RK5A 4ES4A 1HVXA 1DE5A 3L5MA 1PHWA 3E9AA 4YJ5A 5H8MA 1B3VA 2GSJA 3H2MA 3WJZA 3IANA 1PWMA 1FCBA 3SCTA 2R24A 3MJYA 1TKKA 4R88A 3U9IA 3NL2A 1TCMA 3U2EA 4IG2A 5AHIA 4QGCA 3AMCA 5D30A 1QT1A 1H4PA 1VFFA 3LPOA 5D38A 3PR2A 4GIRA 1PDYA 3HPSA 4HZ6A 4IWWA 2VOMA 3WDQA 5EFFA 4J4KA 3MBFA 5KINA 2FVMA 2XFFA 1LUCA 1P7TB 1US0A 4LS2A 3IUHA 3SY8A 3TSDA 1S1PA 4QLLA 2V82A 1A53A 1SFJA 2EAWA 5E0FA 1KM4A 3L4YA 4TMCA 5CPNA 3V16A 1NDWA 1A3XA 3QBUA 3U4FA 3G24A 4HQVA 4W8LA 4AMAA 2PP3A 1XXXA 3RPDA 4GI6A 2ZZ5A 4P61A 3WQWA 2VNCA 1WAWA 4XO6A 4YVVA 2A3BA 4JTAA 3TQKA 2D73A 1ISWA 5JH2A 1BWKA 3KCLA 5I6SA 1KCZA 4AQLA 2F61A 4DF1A 5AB3A 1R38A 5FAGA 3WF2A 3CQJA 3CAWA 1KXHA 4WLCA 3W2MA 4F3HA 4D6CA 3VIHA 4O4VA 2HZGA 1D8WA 3DAQA 1KV8A 3IJQA 4Y7EA 1RR2A 1KM5A 3W7KA 1Z7AA 5A8MA 1HQTA 4MVAA 1R8LA 3H26A 2QQ6A 4W86A 1LZOA 1GG1A 3V3WA 1XS2A 4MWAD 3FA3A 2GK1A 4I5XA 4Z1AA 1V08A 3RILA 2FB3A 2R1MA 4S3AA 4L6HA 4J7RA 4D9PA 4UC5A 2WPBA 3VD5A 4LQ1A 2NV1A 2A3AA 1ISVA 4WF7A 5DCDA 1OF8A 4DZIA 4V28A 1HKKA 3R43A 1A5SA 3V5CA 3MI3A 3ARYA 4DWSD 4K68A 5AC6A 5HOSA 2YOCA 1X6NA 3KL5A 2GWGA 1ZBWA 2NXGA 1XIGA 4QBXA 1FX6A 4GUGA 1QW7A 4JTJA 3ZMRA 2QUVA 1OCJA 4L56A 3TEVA 4PB3A 4GKLA 4CCCA 1Q13A 3W86A 4AZ7A 1LWJA 3N12A 1MW3A 1UBSA 1WB0A 3VGEA 4TUFA 5AYZA 4GA8A 3URBA 4M8UA 1DYSA 4CEUC 3K8MA 3G1HA 2PDGA 4Z0SA 3G1FA 4TR9A 2Y88A 4AD0A 1H1YA 4G5DA 3WUBA 1BXBA 4D6GA 2JGYA 4Q7IA 5I3KA 3FJLA 2EBNA 2VR4A 4U3CA 2WQDA 4DBUA 4Y8EA 3WY1A 2WXDM 3A9BA 2VEKA 2XFWA 3RMJA 4E3TA 2G97A 3RO6A 4G9PA 3O05A 4JTTA 4A8NA 1S3HA 4CD7A 4KFPA 4G7EB 1HL8A 1OG6A 4G1KA 1NFPA 4XK2A 4JQ4A 4QQUA 4DB7A 5HA7A 3CIVA 2C0HA 1UUOA 3DCPA 2PDYA 3EXRA 3TNOA 3CO4A 2DORA 4XSMA 3TFCA 4CQBA 1GOOA 2D1ZA 3C2FA 2WK2A 3A12A 4CNTA 3LX9A 3TU9A 4E4UA 2QKFA 3TJ4A 3ABXA 4CNOA 4PMZA 1HW6A 4E8GA 1C8XA 4GE8A 1J6PA 3V7PA 3MUZ1 3E0WA 4YYCA 2FFIA 4REQB 2HISA 1R0MA 2GQ9A 2OODA 3ZLHA 5REQB 3W24A 1NELA 3H2EA 3CB8A 3CASA 1ODUA 1U5VA 4Q4RA 3T0CA 1KLYA 4DO6A 1DWAM 2XHYA 2IMRA 1EO7A 4LUJA 4MTVA 1ZAIA 4HZMA 3K4DA 4CCDA 3K4WA 2DT1A 4M19A 2PD5A 1WXZA 4KF1A 3LRMA 3GVVA 4I5RA 4GI9A 3NXFA 1US2A 5C9WA 3EXTA 2PTXA 1DWIM 3VNIA 3DI0A 2PDQA 4H9YA 3AS3A 5LIUX 1JEZA 3A3HA 1K9EA 1TPDA 4PMYA 4XAZA 1I60A 1M9HA 4Z42C 4IFOA 1K8YA 4LRTA 4QJ5B 1AQHA 1ZTVA 1ZENA 4CQ8A 1KRMA 1WDQA 4JTLA 3R6IA 4P8WA 3WD4A 1YKWA 1KGUA 3DIPA 3T9PA 1UWTA 1PJ9A 1BGGA 3OLGA 3WLJA 3AMGA 4MAVA 5KITA 5D33A 2BZNA 3KOZA 4OOUA 2YDQA 3AS1A 3WEOA 5J04A 4J2MA 4D1IA 3TKFA 3W26A 3EA2A 3HPXA 1XDMA 2W61A 3N9KA 3PBGA 5IXEA 4NKCA 3LLFA 4DWDA 1YTKA 5ABFA 1Q4NX 3EB3A 2QR6A 2CLOA 3TZFA 1F3TA 1XGZA 3N3TA 4W93A 3TMLA 4INFA 1JYWA 1TZZA 3T4WA 3VIFA 1W1IE 3R4IA 1E0UA 1LROA 5D37A 2V9DA 3DYOA 1DP0A 3CV6A 2D20A 2B4GA 4LVDA 2UWFA 4O15A 2GOUA 4O0ZA 1Z32X 5DBUA 3C0LA 4DVOA 1IR1A 2PWHA 1I0BA 5CZKA 2IQDA 3M47A 4FX6M 2XJ7A 2VJXA 2VRKA 4A8LA 3ZVIA 1VFHA 3V36A 4QJ4B 4GY0A 1HG3A 1W9UA 1DL3A 4QLJA 2VFFA 2V3FA 4Q22A 2YGYA 2D22A 3KTCA 4IX2A 5ECVA 1LBFA 2BV9A 1PS9A 1BVNP 3ABSA 1BEUA 2BX7A 3I4EA 3DC0A 2A5HA 2XVNA 3GR7A 1LJYA 5F4XA 3GFXA 3M6DA 4K8EA 1AD1A 3TWAA 3P8IA 1X38A 4LS0A 4XZWA 3G22A 3N2MA 2BOFX 3K1GA 4G6CA 2WMJA 2CBIA 3O3RA 5XIMA 2Z4GA 5C2XA 2V5BA 3U8GA 3VO0A 7REQB 5K9DA 2G3MA 5LIWX 2CNCA 2FZDA 3QN3A 2V3GA 1J0KA 2GOKA 1KRAC 3TW6A 5D04C 3TAKA 4ZA0A 1UB3A 3ARXA 3BSMA 3UYIA 5CG7A 4ZQNA 3HPFA 3LA4A 4O1FA 4ZQMA 3P60A 3PBYA 4MUPA 4AWTA 4UTHA 2WHJA 4JN7A 1H61A 2CKSA 2WVSA 3P2VA 5MKGA 6PTDA 3NQ7A 3NSXA 3B04A 1J8VA 3M43A 3O07A 5CG0A 3WLLA 3I3DA 1ZL1A 1Q45A 5E70A 4E2BA 2VENA 3CQKA 1LDCA 3OLDA 5FIPA 2J7HA 2PLMA 5D02A 3VINA 3Q94A 2Y89A 4UR8A 1IT7A 5JBEA 1S2AA 4GNVA 4JTSA 2WHMA 4ML4A 1BYCA 3NM3A 1VBRA 1WA3A 5H2ZA 4AD2A 3GH4A 1SO3A 1QNQA 3VI2A 1B3OA 4N02A 2FJKA 3MI6A 3O6YX 1F74A 5FF2A 4KESA 4LUSB 1V8EA 4CVWA 4AXNA 2EQDA 3LK6A 1SR0A 4NP7A 1L0PA 2FDMA 2J7BA 3SIMA 4KS0A 3SCQA 3FYOA 2FJUB 5XIAA 1T8XA 1AZ1A 3R10A 4ZOAA 3VKAA 2XGZA 6CGTA 2ZA3A 4ZZ9A 5FACA 4W88A 1EUAA 1EWDA 3OJGA 4GK8A 1L8NA 4GVFA 2ZZ2A 1K3UA 2G3NA 1G7VA 2YXOA 4JDBA 5JVLA 2CITA 2J6XA 2C79A 3PZGA 4LV4A 4FNTA 4WSKA 1PYMA 3RR4A 1M6JA 2HK1A 3QTPA 3KEHA 3C8NA 2VC7A 4J27A 2E67A 2VEPA 1N2VA 2VRQA 3B97A 3WL0A 1JZ4A 1PUDA 5D9MA 4DJEC 4WXYA 1UJPA 3V18A 4E8DA 1Z3NA 1Y5VA 4HK5A 2G3JA 2QJGA 3UF9A 3MDWA 4GQRA 4MSSA 1M1BA 1LT8A 4LYRA 3ITCA 3KOYA 1WAUA 3GVQA 4XSLA 4GJ1A 3FVDA 3GU1A 2X1SA 4PUEA 4XBSA 4HNOA 3PZIA 4XVEA 4DYEA 1P0DA 4MB3A 5H8PA 2Q71A 4JKLA 1B3ZA 2Q8LA 3NL6A 3PWIA 3T0TA 2Y62A 4MJ4A 2X40A 2HMCA 1JCTA 2YXGA 4ERAA 3GVRA 3UR5A 2VZTA 2CC0A 4JX6A 2PRMA 2PTDA 6XIAA 5GJPA 3GLCA 1Q66A 1EKOA 4C6KA 3VIIA 1QBBA 2FZBA 1E0TA 3WFAA 1JI2A 2AQOA 4PTXA 2G96A 1XRTA 4U2YA 3ELFA 1DQWA 3EX2A 3BCDA 3APYA 3A24A 2J79A 1V02A 2C6QA 3G1SA 3DFHA 5FESA 3WQGA 1SJCA 2NSOA 3NSNA 4GKTA 3C2EA 3AWNA 3GYEA 2J27A 4D8ZA 2O9PA 4UTWC 4B4HA 4UMCA 4FA3A 1G01A 4G7EA 4A05A 2XWEA 3B8DA 1QI5A 4ZFMA 3L4ZA 1BSIA 5D05A 1VRDA 4N4PA 2RDXA 1JQVA 1RUSA 1C29A 2OZ8A 1EHNA 1V51A 1KO0A 2EKCA 4J2PA 4H00A 3PVFA 5AVHA 2TSYA 3GHRA 4UB9A 4CD8A 2ZZ4A 3OBKA 4D8AA 1XYBA 1RK6A 3ONCA 3KOFA 4ZSUA 1ZUAX 1WO2A 3CUIA 4WK9A 3LCXA 3IEBA 1LOLA 5B7ZA 5LNSA 1ICPA 3W76A 2AKMA 4JIIX 4JHMA 3VOCA 2X05A 3CHVA 4DZ5A 1G1YA 1K77A 2WZHA 3NQMA 1H5YA 3G5EA 3TN3A 2DFAA 1VFMA 2W6RA 2E1WA 4MUZA 1WDDA 1R6WA 1S2UA 3VOFA 1A49A 5HMDA 2E5CA 1KM6A 4BR1A 2I57A 1P5BA 1JZ8A 4US6A 3TR9A 5IFPA 1GVFA 2G3FA 3BQ5A 4LXFA 1XIDA 1NQKA 5JMUA 4H9UA 2WWCA 4PEKA 4BY3A 4U4MA 4LYKA 4ZB0A 4DJEA 3BGAA 3NQGA 3S6TA 3EKZA 4J3WA 4JX4A 2PZNA 2WLYA 1VJIA 1I1XA 4B90A 1R9YA 5GNXA 1ZALA 3O2LA 1E6QM 3GG0A 1GNXA 1ONEA 3HG3A 3ZSTA 4LANA 4HP5A 2W5FA 3HG5A 3ITTA 1NJJA 1XBXA 4XIAA 1OYAA 2GQAA 3RLVA 4AW7A 3VIOA 2NXHA 1GOMA 3K8KA 3GIYA 2VD9A 1LRTA 3IJDA 1O5QA 1R3RA 3H4WA 3UA3A 3WH6A 3WF3A 3RPMA 3WQCA 5L6UA 2PDNA 4ZB5A 3CZ8A 3AALA 1TG7A 3T05A 3MMWA 1AH0A 3LOTA 4WSHA 3CU2A 2FIQA 2ISWA 4LUYA 1FWDC 1OX6A 3HFTA 4PUDA 2HJPA 4KCTA 3ZJKA 1UH3A 3LRKA 5E9XA 1FKWA 2L5HA 4IUGA 4LSBA 1TE6A 1WUEA 1J0YA 3UVIA 1V5XA 3NOEA 1LTDA 1DJGA 2GGEA 5K9CA 4EXAA 3ENLA 1E6ZA 3DEQA 2R14A 5HNUA 4TX6A 1O60A 2VZOA 4KCUA 2R9RA 4G2DA 3DFYA 5HINA 3QJAA 3UCQA 2AL2B 1VFUA 3I6RA 2I9UA 2X41A 1EX5A 3VOIA 2Z27A 2BBFA 3D5HA 4O54A 3E0IA 2F8QA 1NF7A 1UPMB 1AODA 4Q4SA 1J79A 1NFBA 3M0MA 3KL3A 1EWEA 2B31A 1GPWA 1M3UA 5ABTA 1AH4A 1HXJA 1JF6A 4UUIA 5KZEA 3UZYA 4LAOA 2R1PA 1MUMA 2W4XA 4Q8PA 1Z44A 4K2SA 4MWAA 4OU1A 3UY7A 3UW6A 3UWQA 2AAMA 3T2QA 3N15A 4H01A 3QQWA 2CXGA 1YXYA 4Q4QA 1W54A 1CB7B 1XV8A 1XLIA 3L4TA 3ZWTA 1HKJA 1PYFA 2XIIA 4GNJA 4JTIA 4U3AA 3VC5A 1VR6A 4Q7BA 1IT8A 7REQA 2B0MA 1F6PA 2WSPA 1F05A 5AHNA 3LZ3A 1ECEA 1EP2A 1UH4A 3MZNA 1A3HA 4KFNA 1KD0A 4ENLA 4A35A 3DN5A 3PWGA 3DBPA 1VS1A 4MZ1A 1EBHA 3FSTA 3P62A 3WSUA 3VNMA 2I14A 1GTEA 1F3WA 1IYXA 1QHOA 3BQ6A 1C7SA 1YRRA 3FKRA 3C5QA 3E49A 5LNWA 3VOHA 3A4XA 4LALA 4ORMA 1GOXA 3W83A 1FWAC 3ARWA 4WJ8A 2YL6A 3RRAA 3UQNA 2WZIA 4LBUA 1FWGC 4S3BA 1FKXA 3S9IA 3VDCA 4AMCA 4PEEA 4L6OA 3TE9A 3T4CA 2XN2A 2H3BA 4LAZA 3G0SA 4JOMA 3SQMA 1GQLA 3WD3A 3KVMA 1X7IA 9CGTA 3SCRA 1FWBC 1YDNA 1PPIA 2A2IA 5HANA 1E4MM 3W7RA 3E5BA 1E15A 2ISSA 4XAGA 4IICA 1C9WA 1WYIA 3A9IA 2ACRA 2ISDA 3RCMA 3D3AA 1GCYA 2X8RA 1VRXA 4A29A 4H19A 1RPKA 2J88A 1R7OA 1HL2A 3TTQA 2R6OA 2HXTA 1SO5A 1JDEA 4GRSA 1PKNA 1L8PA 2G95A 3DUGA 3HOJA 2NUWA 5I77A 4Y2WA 4GZEA 4D1JA 3K13A 1PX8A 2Y70A 1JPHA 1GEQA 1M01A 4O1AA 2Y2WA 4P7RA 2RAGA 3CLWA 4FPSA 4LNYA 1K9DA 3KX6A 3GU9A 2P88A 1W91A 4I6KA 3WMSA 4YXGA 2G8ZA 3NDYA 3VNLA 1GPFA 3GD6A 1VZWA 3R13A 2GJXB 2C14A 2VCCA 1RXOB 1MDRA 1NDZA 2ZX7A 1KA9F 2CERA 3Q67A 2P1FA 1QPRA 3NO5A 1KV5A 1SO4A 2E1DA 2TYSA 3OEXA 2GGIA 3S9YA 2YBVA 1N8FA 5FI8A 3C4UA 4A3YA 3QY7A 3N13A 4Z17A 4KT2A 1OHLA 3GRIA 1XC4A 2QGHA 1V77A 3OQ8A 1ICSA 1KM0A 7PTDA 2EPLX 4C6CA 2CCRA 1C9DA 2A6NA 5DO8A 4V1XA 5EL1A 3I6EA 1F7BA 2WMKA 4GOAA 4NIRA 3B40A 3W9ZA 3RCYA 1REQA 4HSHA 2EPHA 1W5MA 4C6PA 5D2WA 4RE0A 1FRBA 5HJYA 4BF5A 2BWGA 4XZMX 3LI0A 4Q6JA 3SB0A 2J77A 4PUMA 4AHOA 4F0LA 3Q65A 2PMQA 5AHEA 2VGGA 3GH7A 2YA1A 5CEWA 2A7RA 4CGTA 1CGYA 3RYSA 3WNPA 1P1XA 4RV3A 3KBMA 4PTVA 3SUUA 3BAJA 1QI2A 2DIEA 1MNSA 5I24A 1Y65A 2XG9A 1TV3A 2YB1A 2VYOA 1PX4A 3STPA 4E4FA 5DY3A 1KCLA 2VX7A 5FCZA 5HJLA 4PMRA 3UVAA 1MQQA 4ZTYA 1W3KA 1V0NA 2WPGA 4BI5A 1U1HA 4C1NA 4D2JA 4CEXC 1G0CA 4GMEA 5I7GA 2ZUMA 5LIYX 4M24A 5CSRA 1ZCCA 3NO3A 3W81A 3WQ4A 3NIYA 2E09A 2HV5A 3I7QA 3LCLA 4ROPA 1PO9A 2E5BA 4ZO6A 4Z1YA 3OYXA 2F6UA 3RM9A 1O68A 2RHGA 3VKDA 3FSUA 1E9YB 3CEUA 4QG8A 4X3ZA 2IPGA 2W9MA 4CNUA 3UJFA 2OR2A 3N2TA 4RPQA 3LLDA 2XIBA 3FDKA 3MW7A 1QFEA 4AY1A 4D6DA 2QJMA 4IMFA 1QRQA 4LBRA 5CQ1A 1RLDA 3ES7A 1N55A 3T0DA 3L12A 3SM0A 1DIEA 3W01A 3IAPA 1S39A 4MHBA 3IIPA 3WFLA 3L9CA 2J7CA 1OCQA 4ZQCA 5BXPA 4TVDA 1HTIA 3CEPA 4KCWA 2VHLA 1MFUA 5A95A 2ZRYA 3QZAA 1FWIC 2GWNA 3LNMA 4CQ9A 2XINA 2WMIB 3ME3A 1TMQA 3TCSA 4LB3A 2WHLA 2Y6ZA 2YJQA 2WJDA 2DV0A 1AZ2A 4MNKA 3CV7A 5BRPA 3QW3A 5JUVA 3CHEA 1BFNA 2HS8A 4L4PA 4C6FA 3MCMA 2WSRA 1FWRA 3M5XA 3VC6A 1SW0A 2VP8A 3VIKA 2QPSA 1F5ZA 4QXIA 3WQPA 5AFDA 4DBSA 1W2PA 1NP0A 4FIRA 3REQB 4HPGA 3VDGA 3B4YA 2QCDB 3ALFA 2V6AA 4N7QA 1MW1A 3OB8A 5TBOA 4C7GA 4BEUA 2VR2A 3U3HA 4X63A 2OZTA 4MM1A 1SZEA 3W2JA 3ONBA 4WSJA 1B9BA 1MRAA 4YHGA 4FLOA 2NLYA 5JU6A 2OYMA 1OBAA 1UASA 4O57A 2ABAA 2CLEA 4UCFA 1KLZA 4OECA 3GXIA 4UFKA 1GKQA 4C6DA 1CYGA 4PUUA 4ZE5A 4AYSA 4PBFA 3T08A 5EMJA 3JZEA 4ADUA 1W3HA 3UCDA 3TXZA 3P5YA 2Y8UA 3P67A 2V5KA 5D32A 5G4EA 5EU9A 5JBDA 2X1TA 2VWTA 1W9PA 1E40A 4OUEA 4EANA 5CGMA 2VEMA 4YWSA 4LTSA 4WIWA 4QSFA 3AHTA 3UPBA 2AL2A 2ZC1A 2OO0A 1YBQB 1TJ1A 1WOAA 3KS6A 4TX8A 3OLEA 1XD0A 4OUIA 4NAFB 2AOSA 4XVDA 4PB5A 1GTHA 1ONRA 4D6HA 5FF0A 1EJSC 2ACUA 5I3HA 5CAKA 3RO8A 4WDUA 2IW0A 4MKVA 1FCUA 2OU4A 1TREA 1LLOA 1UD2A 3GS6A 3MVIA 3RJYA 1G94A 1E3XA 1UIOA 2PLKA 1J93A 4RNHA 4J3XA 5C5YA 1XLDA 2HTMA 1GYNA 4BCEA 1WKFA 1MRQA 4AF0A 4YNGA 4DHGA 4P8UA 2F6KA 4C6EA 5AHFA 1PTDA 4AWEA 2IXVA 3M44A 2W27A 2NQ5A 5C9XA 1YXDA 2ZRWA 2PC4A 1RBAA 5DRCA 4JCMA 4P7LA 1NWRA 3N04A 4D8LA 1F2JA 2OWWA 4U28A 3H4GA 3F5JA 1YNQA 2AKZA 1SZRA 4UTMA 3ITYA 4HNLA 3TYCA 3MSYA 2H9AB 1DHPA 1MMFA 3BLOA 2GGHA 2VEGA 3DECA 3SURA 3L0GA 4I7VA 4JAWA 4EAYA 3KRBA 3NTYA 3ZVHB 4GIEA 2YCLB 5EY5A 5F2LA 4QAIA 3VGGA 1P1MA 4EK7A 3ARVA 1H7PA 1OGSA 2E7FA 4V15A 3DH7A 3OZPA 2ZTJA 4OE7A 3SRFA 3F7JA 3RCNA 5H91A 4DZHA 3LHVA 1JNEA 2DIJA 1RP9A 3G8EA 3TTOA 4N9BA 1RD5A 3AXKA 3OA5A 1FH9A 5EMUA 2REQB 3KVJA 4JIEA 4EACA 4HNCA 1UR3M 4LY4A 3UNDA 4Q8VA 1LT7A 1A0CA 4HVXA 3GW3A 2Y8KA 2C1HA 5AHMA 3RU6A 1XF0A 1R7AA 3ES8A 3I65A 3ITXA 3U6WA 1AW1A 3BWWA 5FA5A 3SSZA 2JE8A 2F7FA 4NYYA 5HQEA 3MCOA 1Q4WA 1KXTA 2E3ZA 5FSDC 4I8DA 4I5UA 3NNTA 1OYCA 2FTPA 5AN7A 3OGRA 4H04A 3EOSA 2XYLA 1GVRA 3UXKA 2CW6A 3E2SA 1G4EA 1SMAA 3C2OA 3L2IA 1W31A 2OX4A 1XYFA 2GL5A 2OJPA 1E9LA 1U5JA 3RR1A 1KBIA 4IIBA 4ASTA 1B90A 3P82A 1FFQA 1QI0A 3U57A 2QCLA 3CB3A 1LL7A 1MXGA 4DRSA 1PKLA 4GXMA 5C9UA 4HIBA 2D69A 3SI9A 1UC5A 5BYWA 1CXLA 4KIRA 3BZJA 4Q7NA 4AH7A 2DP3A 1QPQA 3TW9A 3GKFA 2P3EA 1M5WA 1ML1A 3NQAA 1PBGA 2VRJA 5I0DA 2J78A 4DUWA 2ASHA 2XIMA 1MQRA 2CZFA 1IEXA 4BA0A 8RUCA 1NH6A 2J66A 4ZCWA 3RX4A 5E1QA 2NV9A 3VXGA 4I7UA 4G7FA 4L4OA 1QUMA 3SCSA 1OD0A 4F40A 4JN6A 1DQXA 3JUGA 3B8VA 2BVDA 3C52A 5BWAA 4H9ZA 1A47A 3UT0A 1FWTA 1GOWA 3OZOA 1UWAA 4WEVX 4JFTA 1P6BA 3O6DA 4OTKA 3G18A 1SGJA 1M04A 5HPCA 3F4DA 1JCMP 3UY8A 3WLNA 4ZBCA 1JQXA 1XYCA 5LGZA 1MEWA 2FZNA 2XVGA 3GBDA 4QDMA 3MWAA 3QF0A 1PZ2A 3B03A 1I2RA 1BG4A 3WLSA 1UZDA 2XM2A 4DYJA 1P48A 2QDEA 1JDDA 3NQDA 3W1XA 1EEPA 1VYSX 5HQLA 1GQJA 2ACQA 3INPA 3GTXA 4M6VA 3E1F1 3ZWSA 2DZTA 4R5EA 1VBJA 3THCA 4OBRA 3R89A 1FXPA 3CT2A 3DKLA 3UZJA 3ARTA 2DUZA 4DJFC 3M0LA 4H6RA 2DPEA 1S5TA 2W62A 3B8SA 3VMPA 3LV6A 2PDHA 1S3TC 1R2RA 3UXDA 1LQ0A 4RZ6A 4U33A 3W71A 4Z2LA 3E5PA 2QMJA 5G1MA 3QGKC 4GLEA 3HQNA 4LYQA 1JDCA 4ZEPA 1X97A 1KCKA 2Z2AA 3GXMA 4FO4A 1GORA 1DJQA 1W1TA 3B0PA 5HPOA 2YDSA 1XG3A 4L80A 3GDLA 3UEQA 1XPGA 1RCOB 5CH9A 3S6OA 5EMYA 5LGXA 1CXHA 2ZVIA 1VBHA 2RDUA 5KSWA 3OBEA 1KNWA 3EA1A 2QJHA 2JBMA 1DJNA 3WK3A 1L6YA 4Q6XA 3PZMA 3VIPA 1QOXA 3UA4A 3W3OA 2WNWA 4IISA 1AQFA 4Q8NA 5D03A 3RUBL 5D2VA 3LCFA 3M41A 2QULA 3BL3A 2VZUA 1GOQA 1QNVA 2TPSA 4AD5A 4E2DA 3R0DA 2ZZ6A 2OEJA 1H41A 4V33A 5AZ0A 3LPFA 2E28A 3EB2A 3LBOA 1K8XA 3P14A 4NILA 4D6FA 2EG7A 4PB4A 4GHRA 4K7YA 1E4NA 2OQYA 4QCFA 4WY0F 3MO4A 4LS1A 2OFJA 4PULA 4R53A 2WB5A 2C15A 2YZRA 3RN6A 1ZP3A 3BVJA 5CSYA 4HPNA 2WMIA 2YL8A 1YMYA 2WMGA 2QAFA 3OIHA 3TYAA 3SN1A 4GUIA 4L9ZA 1HJQA 4GXWA 3MUCA 2XM1A 1DJZA 1XQLA 1J96A 4L6DA 5A2BA 3NZPA 3WLHA 2JF6A 4PCNA 2G37A 1BVWA 2GFTA 2QGYA 5EYWA 3WLMA 5LYRA 5BOEA 3P7YA 4HA1A 3REQA 4IFKB 3ECQA 1PX3A 2QCDA 3AYSA 4KPLA 4GO8A 1JL8A 4UTLA 1JXJA 3LM7A 4CN1A 4PL2A 1XRSA 3KZPA 1XUUA 1MYRA 4CU8A 3AROA 1TZ7A 4HCHA 5LNUA 5D8WA 2FMOA 3QRHA 2DSUA 3HF3A 5DMYA 2A1YA 2P3ZA 4X9SA 2Y0FA 3W38A 4KBXA 1WKDA 1WXYA 3LS9A 3MMUA 3AIQA 1T40A 4JTGA 5FJRA 3SECA 3W1LA 1XLLA 2EEXA 4DXXA 1JZ7A 4B5WA 1WXJA 2WC7A 2B7OA 1L2QA 4U2ZA 4AIBA 1DXEA 2CPUA 1KFBA 5ENLA 3PZNA 3S4TA 3LQLA 3M9YA 3TYBA 2V5DA 4RPPA 4LAKA 3QKZA 4LEFA 3NQ6A 5C8BB 4NZCA 2OKTA 5AYIA 4NXSA 1ZY9A 2QV5A 1VBUA 2VDGA 4DF2A 4UTJA 3A3WA 1IWAA 2CZ5A 1Q65A 2Z00A 2QPXA 4PMQA 1HNYA 3PC0A 2IKHA 2Y8VA 3LHTA 4PRWA 1E43A 4Q4OA 3AISA 1QNRA 5I06A 5G4WA 1ESWA 2Y4SA 2PURA 3FEMA 3AZSA 3AXMA 4EPDC 3CZKA 3HBLA 3LHZA 3U5YA 1B0IA 3O0KA 3JVAA 3AIVA 4HTBA 3PPHA 4UQDA 3GXTA 3Q58A 5E9AA 1JXKA 4DJDC 1AJZA 3VGFA 4H2CA 5K4ZA 1XLMA 4GFSA 4C6IA 3QZ6A 3PM6A 3T07A 5FJIA 1HJVA 5CC6A 2OT1A 1DXFA 3O1NA 3PNZA 1EF2A 1H7OA 3MDUA 5KMYA 3PJUA 1GZ1A 1JRBA 1D7KA 2X7WA 4ATLA 3OZMA 3TR2A 1FOBA 2QCMA 5FL1A 2ZKMX 3ARZA 5CKSA 4PZVA 2RDTA 2Y7FA 4TVUA 3RNDA 3NQ8A 1LP6A 1E4LA 4HYVA 1D8CA 3UWEA 1KTCA 4JZ5A 3WLKX 3BUVA 3VGBA 1Q8JA 4A8IA 1RBOB 4IJRA 4L64A 3KHDA 4JTQA 1H11A 4C1KA 4K1GA 3BAIA 1H3GA 4EF8A 1QOQA 2OSYA 2YFNA 1W37A 3LDVA 2IKGA 1BLIA 4DXKA 3G0UA 4NRSA 1YE4A 2FB2A 4FX8A 4EX4A 4B9YA 2CHRA 2REQA 2Z29A 2EPMX 4EP8C 5A8NA 4FOJA 2QCNA 3GHSA 3PSWA 3AHYA 3M5YA 3W29A 3DHFA 4BQ2A 2R82A 1O4UA 3DERA 3DYMA 3WF0A 4NVTA 3GDMA 1JPDX 4UR9A 3OYZA 1UMLA 4NUWA 5CJ5A 3S3GA 4OJYA 4PUNA 3NQ2A 1AQ0A 4O17A 1VGAA 1B3XA 1SW7A 1H09A 4IIHA 3F2BA 5F2IA 2HK0A 4O1EA 2CLLA 5KZMA 1UWRA 1DV7A 1C7TA 2RFGA 3WH9A 3W70A 1CEOA 3ICJA 1GUVA 2YW3A 1YQ2A 1ZNNA 8TIMA 4GABA 4PYSA 5A8GA 3DBNA 2PU1A 1X96A 4C6BA 2VC6A 4NZ3A 3LCWA 4KEZA 5EBUA 1NM9A 2ZDSA 1VEPA 4QCEA 4GZ7A 3MMDA 3GIPA 4LW7A 1U1JA 3MVTA 1XWYA 5FAJA 4KIEA 3K4AA 3PJWA 4Q8UA 4LCQA 1CLXA 1PCWA 1B3WA 3I3BA 4PBGA 1GONA 4PRTA 3FW6A 1JZ2A 2DT3A 1OFBA 2R1LA 3WN6A 1UPPA 3AZRA 1Q6QA 1R3QA 1KTBA 3M0YA 2JF7A 3PY2A 1HL9A 3N11A 1S1RA 5AYBA 3UGRA 1UD8A 2YSWA 3U4AA 4Z2GA 4JEJA 3TQPA 2Z1XA 4DM2A 3WNKA 1I2QA 4YTUA 3PAJA 1L6SA 1LOQA 5F2GA 3U2CA 3O7UA 1X1ZA 4C6NA 3CL7A 4JNZA 3ITVA 1POJA 1JGIA 4DJDA 4GWEA 4CNPA 1SUXA 4CN6A 2DT0A 3DHUA 4JS3A 5M2FX 1NIUA 3L68A 3I6TA 3OVPA 1QDSA 1WDRA 2H3DA 4DIAA 1TPWA 2DH3A 4N2YA 4OV9A 3ZJ8A 1YEYA 3T8LA 4N6EA 1DTUA 4GIYA 4NJGA 3KVKA 3LENA 3CIWA 1ECQA 2XH7A 2ZUSA 2V2CA 4JKKA 3GB6A 1H60A 3VUSA 4DUVA 1A5CA 4S3KA 3I7RA 1TCDA 3DFQA 1NAL1 4LVAA 4W89A 3WDIA 4JKMA 1TR9A 3M64A 3VKBA 3TTYA 2WVVA 4JL2A 1IIGA 3BAXA 1EFZA 5HJXA 3KLKA 1SFLA 4Q8QA 1D3HA 1ZJAA 3CUFA 4RZ5A 3CPRA 2GK1B 2XIOA 4QTGA 1SJAA 3M1ZA 3ARSA 3ZT7A 1JUEA 4AZ5A 5E0KA 1EDTA 4JIHA 2ZE3A 3WQFA 2O4QA 3H2AA 2Y61A 2XSXA 2OXNA 3NQEA 4HN4A 5E0CA 4LF1A 3PG9A 4QG6A 2PPGA 3N9SA 4WOZA 3ORWA 2V67A 4IOTA 3LTSA 1MVYA 1TIWA 1QPOA 1JD9A 4TQTA 4K7VA 3W7EA 1KQZA 2ZICA 3N1AA 4FP1A 2P50A 3DOPA 4JFUA 3S47A 3LBMA 1ZFJA 2X2GA 4Y9PA 1GKRA 1SO6A 3O63A 1VFSA 3L66A 4PL1A 3UXAA 5H6HA 3G3MA 4LB4A 1QPNA 3FN9A 1Q5MA 3N34A 3OVRA 3VTRA 1TELA 1LBLA 4HJWA 3KBWA 2TMDA 1UD6A 2HQAA 7TAAA 4XB3A 5HR6A 3MP3A 1TWWA 4MNJA 3MTWA 2XGBA 4GQ0A 2GSEA 2DQWA 1W5NA 1IT0A 4GVGA 1Q6RA 3VM7A 4FNPA 1Y0EA 3TLLA 1BPLB 1LL6A 2OLSA 3NPXA 2WBKA 3S2NA 4FI4A 3I3EA 4XZNX 4CD4A 5IBXC 4S38A 3N14A 1Q3NA 1YNYA 1YHTA 5CBJA 4UFMA 4AG0A 3A64A 4BK9A 3B0VC 3CAVA 2XIQA 4X61A 1UD4A 5DLCA 4BI7A 1T6MA 3OVGA 1JFHA 2FTYA 3K46A 1TYGA 3MANA 3ITLA 2OT0A 3CWNA 2CETA 3G1VA 1K9TA 1YDYA 2ZFAA 5M1TA 3TOYA 5DMMA 1A80A 1Y8BA 4H1ZA 1GVQA 1PXGA 1G9HA 2ZVRA 2PTZA 2X1RA 3H55A 1OFQA 2VC9A 3AYVA 4MB4A 3AS0A 2ZOXA 2WKGA 2PDUA 2G4JA 3BH4A 4C6OA 3ARRA 2WKJA 5D2XA 5GPRA 1K7XA 3VOGA 2J7DA 3VNDA 1AMYA 1UR0A 3GHTA 4TVCA 3VOJA 1PZ0A 1EH9A 3R11A 4IFKA 1RY0A 1E6XM 1EC9A 2ATMA 1PTGA 1YDOA 3W1AA 4ICMA 3D3FA 1NARA 1Y5WA 1MNZA 2G50A 1XX1A 1UWQA 4HCLA 4FLSA 3V1HA 1JPKA 3V4BA 1E5NA 1QBAA 2QUTA 5HATA 1E73M 1LYXA 6ENLA 4RR4A 1HN1A 4IPJA 2FHBA 4NSBA 4WCJA 2J7FA 3H21A 2O7QA 1YE6A 3GTNA 4J3ZA 3WH5A 4S3CA 3MPGA 4IGMA 3W74A 3HGSA 3UJSA 4LCRA 3SO7A 1CGWA 1UJQA 1LG1A 2GQ8A 3TWBA 3TUUA 3KL0A 3UD6A 2FVLA 2XVKA 1Z8AA 3USBA 1HP4A 2E25A 3UZZA 3WUEA 1A3WA 1W1PA 1R46A 3ZT6A 2HNEA 1FA2A 4JTKA 3ZFHA 3MHFA 1ME7A 1FXQA 4DPPA 1J2BA 1ZCOA 4PSPA 2JEPA 2GVJA 4F0MA 2PWFA 4WZHA 2QHAA 1O1HA 4IIEA 3BANA 2QYGA 1CB2A 3BE7A 3EWBX 3EMZA 4AIUA 3FY1A 1HT6A 1BGAA 4AEFA 3MU7A 5ABFB 2H90A 5ABEA 2RKXA 4XD4A 1EEXA 2ISFA 1CXKA 2VWSA 3OPSA 3CL6A 3F5KA 4K37A 1AD4A 1XW8A 4YCOA 1EGVA 3EWXA 3HN3A 3HJEA 1CGTA 2CHOA 5C6MA 5AC4A 3HZ3A 1UHVA 3S42A 2IPJA 1K4GA 1O12A 1GZGA 3TA9A 2Y1HA 3NDOA 1FWFC 5CSSA 3KW3A 2X7VA 5I00A 5LHEA 4O1DA 2QAPA 1IXQA 3GZ3A 1UKPA 3W75A 4B16A 3GR8A 1LRNA 3RLUA 4RNFA 3L4WA 1UUQA 3LV5A 3MCNA 2FQIA 4EKJA 4EAMA 3CH9A 1WOBA 3EDEA 3PUEA 5I3DA 1F6KA 2P76A 4PC8A 1WPCA 3MA8A 5FF3A 5FL0A 3WUFA 3A4JA 3HV9A 2BMBA 4AEOA 3WQOA 4FNSA 2FVKA 3QOMA 1AW2A 3T2PA 2W63A 2J8FA 2P5NA 3IGHX 4ERGA 4EE9A 4IMDA 3A23A 3BLPX 3SRHA 5G2IA 3BOXA 3UPWA 2ZUUA 4ALDA 1GJUA 2I5QA 1J11A 3GFZA 1V79A 2WCSA 5BU9A 4CD6A 2BY0A 3B9OA 3A22A 2J8TA 1CBGA 1R5YA 1CZ1A 1IXNA 3IUDA 3FX4A 1RQHA 1SU5A 4WY0A 4XQ6A 1GOIA 4DBWA 4DAIA 2FZ9A 4I9TA 3WNLA 2FGBA 2W0UA 3PF3A 4HTYA 3HGJA 1PDZA 1RPXA 3GSMA 3WBXA 2FHCA 3OGSA 2E6YA 1BYDA 2XFYA 3WH7A 5U7SA 1SZNA 4MJMA 3VCNA 1T99A 4PMXA 2DUAA 5EMMA 4MKSA 2HVOA 4AIEA 3KS5A 4HSOA 1I2NA 4O1CA 3B0XA 3AIRA 3QSTA 1BWVA 1TPH1 5CZ0A 2BVWA 3MUY1 1QPKA 5MKGB 1XFCA 4F8XA 3UG3A 2MANA 2ZX8A 4GX8A 3B8WA 3VCRA 1WBHA 3VIGA 1NDVA 4Q4KA 4QS6A 3CV2A 3N18A 3NPUA 1WBJA 3N2OA 4YS1A 1A0DA 4IQEA 5D9PA 3WQ6A 3M0VA 5AC5A 1Q2SA 1XD1A 1DBTA 1S5NA 5AYYA 2WMHA 3BLKA 1M53A 1TVPA 1PTAA 1IWPA 2DGAA 4U31A 3V5OA 1WKYA 2KAUC 2WWDA 2E0PA 4ACZA 1XLCA 1D9EA 3P6LA 4C6QA 5G2HA 4M6PA 3VX0A 2C8NA 2FPVA 3CAQA 2ZXDA 4AZBA 2CHNA 1ZAHA 3CMFA 1XCXA 3PBWA 3TZNA 4ONVA 1TV5A 3CQ0A 3FLUA 1NF0A 5LIXX 4H9XA 1XL9A 5I5RA 2QVNA 3R58A 2BVTA 5CJNA 3AICA 3EDDA 3Q4DA 1VPYA 2VI0A 2ZA2A 4R7JA 5AKQA 5A6MA 1TV4A 1HX0A 1NFGA 2VUNA 3GNXA 5HWJA 4O0QA 1XKYA 1W1VA 3VFLA 4UFJA 2J62A 2BOEX 4JFVA 3SJ3A 2QCCA 2Y24A 5T26A 1VAHA 4XUGA 2OSXA 4XZHA 5K4XA 4AX7A 2PP0A 1HGWA 2PS2A 4B92A 1WNOA 4PUWA 3OGVA 5EPDA 4ZXLA 4HU8A 4Z08A 2C19A 2OCZA 4K3ZA 5HMSA 3MO7A 1E51A 2AGTA 2DSVA 3O0FA 3IRDA 2NV2A 6REQB 3PJTA 3ITGA 4TIMA 2FTWA 2BY2A 3AQUA 1OQFA 1K6AA 2C3ZA 3IJ8A 4DELA 1JIBA 4UNIA 3VNYA 2Q01A 1MZHA 3CUJA 3RG6A 3R2GA 1T7LA 1UA3A 2PUZA 3S2LA 2EPOA 4PRRA 5CGTA 2BODX 2CLKA 5I78A 4MB5A 1J18A 1PE1A 3AJXA 1EIXA 4N4QA 1JD7A 3F2DA 4WKHA 1DVJA 3VVGA 3VZZA 3CWOX 1QTWA 1TUXA 2V2DA 1OC6A 3GXNA 4V2XA 3WK2A 1TB3A 4JDYA 1T96A 1S2VA 3T0AA 2BOGX 1F4HA 4OGZA 4EXQA 3EXSA 1AQMA 1DPMA 2PLCA 4GZIA 2D2OA 5C70A 2UBPC 3BV4A 1AJ0A 4CVUA 4AAJA 2O0TA 4DX3A 5IHSA 3MKCA 1FY6A 2PGFA 3DGBA 3W6LA 3DGRA 2RH9A 4XAFA 4RUBA 5CBIA 1PCKA 1MWOA 1TPB1 4QIUA 3PN8A 1FWHC 4GUJA 2J8GA 5L9FA 3LRLA 1EZWA 3FOKA 1KC7A 4JFWA 5CSUA 1W0MA 5DXXA 5TF0A 2QUMA 2NXIA 3CAKA 3BMXA 3QFWA 3HO8A 3N29A 4J3UA 4WJEA 4RJEA 1L6FA 1WP6A 3CO8A 1FQ0A 4AVFA 5IFTA 4GBDA 4JX5A 1F6YA 1PSCA 5HQMA 2XU2A 2YR1A 3ZYZA 1E9ZB 3FDGA 5A8OA 4R3UA 1LLZA 1XH2A 4JD4A 4ATWA 2DW7A 3WBEA 1P6CA 3W1QA 4UQ9A 2ZXBA 4C7FA 1GVEA 5LSMA 2XDFA 2VFHA 1NOWA 1W5PA 1HJXA 1TX0A 4NI8A 3A13A 2INZA 2PDLA 2J74A 3ARUA 1VIWA 5FJJA 1ZSXA 1K6WA 2PDIA 3RXZA 4TMBA 3WF1A 1XLAA 3AS2A 1XH1A 3WDPP 3L4VA 2J9ZA 2D2JA 1S5VA 2V81A 3RAOA 1VFOA 4OZOA 3R8RA 3D0CA 3TQ0A 3QPZA 1V3MA 4DNHA 1D2KA 3KWXA 2QLYA 4O28A 3VD3A 3PANA 2Q3OA 2NVDA 3MS8A 4NL1A 1CXIA 1C90A 4UQBA 3NFUA 3PNUA 3DG7A 3WQVA 4ORIA 1EC8A 2ZCGA 3TX9A 4D72A 2VXNA 3H7UA 1K03A 3AU2A 3W1UA 1P0EA 3CZLA 3ANUA 1JCLA 1D7FA 4UQAA 1RH9A 1AJ2A 4AVNA 1XDJA 2BASA 1OY0A 3GM8A 4XKMA 4PMNA 1BXNA 1EA0A 1J01A 2PDWA 2BLEA 2QT3A 4IMGA 3BO9A 3SUSA 3S2MA 3NO1A 1I8JA 4YVXA 1Z48A 4PMVA 2D0FA 4FAMA 2VQTA 2DVUA 1JCYA 2X1UA 2PBOA 3EX6A 4W5UA 4Z2JA 1E6NA 4H41A 3KVLA 1SZFA 2WLZA 4IXXA 1XRFA 4A4AA 2B7NA 2PDPA 3MKVA 3NYZA 5BU6A 1Q8AA 1L9WA 1RJRA 1U2YA 3F4NA 3PTDA 4DY1A 1G4TA 4MFDA 5DCEA 2I7GA 5A3HA 2PAJA 1DWFM 2IPWA 1KXQA 1QO5A 4GI4A 3G0XA 1GZJA 4S3DA 1W9DM 1BKSA 3GG8A 1MI3A 1XFBA 1ZGDA 3SUWA 3JR2A 1TTJA 5I3FA 2PEVA 3O6CA 4H7CA 1W9XA 1OGGA 1EC7A 3UJEA 3R8HA 1YLVA 2YKKA 4B3ZA 1H7NA 3MSRA 1NWUA 5H1WA 3S5ZA 3ZT5A 3SQSA 3FHAA 1RV8A 2QXWA 3EPMA 1GG0A 1JF5A 1TO3A 2QDHA 4O19A 1M03A 4MAZA 3UETA 2C1GA 4O16A 2BXYA 4GQQA 6A3HA 3MWCA 2WKLA 4ZQRA 1UW9A 4WOQA 3VMOA 3Q45A 1TWZA 4J3SA 3BGJA 1ICQA 3B05A 2PDKA 3T09A 3TN5A 3VZYA 2GSHA 4MWAB 1B57A 7A3HA 1E71M 3WJWA 1PEZA 4GH3A 4BKNA 1V6YA 2OLHA 4MOZA 1Q6CA 3QGAC 2GJLA 2WVTA 1ZS2A 3H7RA 4Q33A 1R3VA 3PJXA 4NASA 1WZKA 3VIJA 3QC0A 3VNJA 2YCKX 5GQBA 1RHCA 4LCSA 2QIIA 1HKIA 4GYPC 5A1AA 1GWJA 3KXQA 4DWSB 3WQDA 1V3HA 5B7YA 1ZJBA 1TV7A 4B3KA 1J10A 3R79A 3MMTA 1R9XA 2Q8ZA 1DWHM 2VTFA 4GYJA 1XIIA 1SZGA 3H12A 4QSHA 4H8HA 3I10A 3MC5A 3WBWA 2F2HA 2OOGA 1SJBA 3H2FA 2DUXA 5A5WA 5D9OA 3IWPA 3TN4A 5DELA 2C13A 3FV9A 4JQ2A 2J47A 2Z1WA 3FYYA 5A6KA 2C0AA 4FHAA 2GUYA 1ITQA 4UMAA 3CTLA 2XN0A 4FNUA 4PCTA 3L65A 3PZUA 4K1WA 4L1WA 3MZ2A 1MSSA 1ZAJA 1YX1A 1A5KC 4FR6A 4XZ9A 4GZJA 2VUYA 3U48A 3T40A 1XDLA 3H70A 3OG2A 4PGLA 4HZ7A 1ZU8A 4UFHA 4DLFA 2WOQA 4AFYA 3W2LA 2SFPA 5C2GA 2V3EA 2FPYA 3DYPA 4PFMA 3LN3A 2WVUA 5A6BD 1XM3A 4GUFA 1TPEA 1V4YA 4YL2A 1OEPA 3PB0A 3GKAA 1B54A 4XBKA 3WK0A 1MXSA 3GHUA 3II1A 3W1PA 1GYLA 3S1GA 3THDA 1EPXA 2Z24A 3QKEA 3NEHA 4ILSA 1UWUA 1BTCA 2PRLA 3CS2A 4ZO7A 4PCSA 1Z41A 1EBGA 2PGWA 3BLIA 4R27A 4ADTA 1V3JA 5C2CA 2J13A 1IIHA 2W3ZA 5KEZA 3NUKA 3BOLA 3RMEA 2PZ0A 3OIXA 5HWMA 2NX1A 2BP1A 2VR5A 1SPQA 3BARA 3KBVA 2Z2UA 1VPQA 4FR1A 6REQA 4O8AA 4QNWA 1ZBVA 4BQ5A 5DBTA 4LF2A 3SDOA 4LNCA 1RP8A 3HJZA 4JQ1A 4NZFA 1CLVA 2XWDA 2OTDA 4OT7A 2WM0A 2X0SA 4BI6A 3IIXA 3F03K 5AZ1A 2X16A 1C8QA 2BNJA 2Z25A 1I45A 1KBBA 1ALDA 4HT3A 2P8BA 3KM8A 4RXFA 5D4YA 3M4HA 3NZQA 3G6LA 1XSKA 2WJEA 1QW8A 3PS7A 5A69A 1JCJA 1CTNA 4RX0A 1IZJA 3EKGA 1XIFA 4Z2IA 3W37A 2E8ZA 4UBPC 3ATYA 3EYPA 3UWZA 1JFXA 1OX4B 3ZJ6A 4HZ8A 1GK8A 4OQVA 4IPNB 1BF6A 5TAOA 1EQPA 4RE2A 3NZGA 4WDWA 1XCWA 4GYPA 3FJNA 4MADA 3VMNA 4Q4PA 1G5AA 4JPGA 2Z1BA 3QGVA 5GJNA 1XGEA 2NT1A 3NCOA 3LBCA 3RU8X 1QASA 4IQJA 3M0JA 4OV4A 3ZM8A 2XPKA 1H50A 3G2GA 4YVPA 4FXRA 3UR7A 3UG4A 4DUOA 1UBPC 1VENA 1US3A 4QS5A 4QNEA 1REQB 1SVDA 3TC3A 1VEOA 1T0OA 2F2KA 3K30A 3LNPA 4GIAA 3DFPA 3WQ8A 1KM2A 1UZ4A 4YWIA 2HROA 4W7WA 3P5ZA 2GUUA 4NJIA 3C6CA 3E74A 2BSLA 3L7RA 5G1TA 1IEIA 2EPKX 2J25A 1W3LA 1GQIA 4NZ1A 4CU6A 1BQGA 1TVNA 3UJRA 4C65A 4LX4A 4FB7A 1D3CA 2PWGA 3VCCA 4LC6A 2X2YA 4C1NB 3APTA 4GNKB 1Q7QA 3PUGA 4Y9AA 1QVBA 4FSAA 5K3VA 9RUBA 3B9NA 5CJMA 1PVNA 1A5NC 4BWLA 4L5ZA 8XIMA 1FHDA 4WHBA 2UY2A 2A85A 1JUKA 3AYTA 3F5LA 2G0WA 1GW9A 2HBXA 4W7VA 3LXCA 3ERPA 1XYMA 3NEVA 4M1BA 1BVZA 4GPNA 4NYUA 1DJYA 3HMJG 3CMGA 1R2SA 4H8VA 4GXPA 4MWAC 1XGDA 5CC5A 1KBLA 3GXDA 1TV2A 4HPJA 4XD3A 3V0SA 4FALA 3VKCA 1EP1A 4UQCA 3BV7A 4B3LA 2QUNA 3BURA 4C7DA 1LWHA 3L67A 3BCFA 1JJKA 4GX9A 4MLRA 3FA5A 3VUP