5M3WA

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-1,2-dideoxymannose and alpha-1,2-mannobiose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
350
structure length
350
Chain Sequence
NNNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 71
total genus 131
structure length 350
sequence length 350
ec nomenclature
pdb deposition date 2016-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m3wA00
4JFUA 4CVUA 2DSKA 2G3NA 2BY3A 5A8OA 2QMKA 3RDKA 3EMCA 4UQCA 3VDAA 4MDOA 4AISA 1JXJA 4DUXA 2E0PA 4PCTA 1W1PA 2DSUA 2EJ1A 4M81A 1AQMA 3FXYA 1OINA 2UY4A 1ITXA 3L4ZA 1WB0A 3GNRA 4V2XA 2WSKA 3K8KA 2WYSA 2O9OA 3AQUA 2VMFA 2AMGA 3VO0A 4MPKA 1E6SM 4AZHA 1JAEA 3SCWA 3WDJA 3WL1A 3AI0A 4YHGA 2WC4A 2ZX8A 1HX0A 3NJ3A 1QHPA 4UFJA 3U7VA 1GQIA 2X1IA 1ODZA 3TTQA 4LGXA 3VINA 4AD3A 3WL0A 4M24A 3W29A 4AYSA 2E40A 1TZ7A 2IUZA 1GZJA 4P7RA 3ZOAA 4DM2A 1JAKA 3UR7A 2DT1A 1RH9A 3AHZA 3WDIA 1EDQA 1E6PA 3VGFA 5A8NA 1E72M 3MUY1 3LPPA 5A6BA 4TUFA 5A8QA 3RILA 1J0IA 5E6ZA 2ESCA 1KXQA 4FMVA 4BA0A 3CH9A 2XIBA 5ECUA 1K9DA 3VUPA 2YA0A 2FH8A 1FH7A 2D0GA 6A3HA 2VTFA 1B9ZA 1E0VA 3KL3A 4P8VA 4F66A 1XRVA 3B9DA 4JKLA 5BRPA 1MFUA 1R8LA 5HBFA 2WVUA 4ZEPA 4R5EA 2J7EA 1HJXA 2ZUUA 3RIKA 4MAZA 5A95A 3PZUA 5D8WA 1GONA 5GPRA 1WO2A 3ARXA 3MKKA 4KMQA 1KGUA 1MWOA 4MB5A 2J7GA 5E9AA 4D1IA 1JZ6A 1QI0A 4UFKA 4P7LA 3CZLA 4JKKA 1GUVA 1WKYA 3SUUA 3WQVA 3WH9A 4PMQA 4P8UA 1E6QM 2Y8VA 5E0CA 1JFHA 2VRJA 2Z1KA 1NWSA 1OT1A 1UD3A 2XPKA 4MNKA 4WK9A 3II1A 1M7XA 2RGLA 4A3HA 1NWRA 4M56A 2PWHA 7CGTA 4KRUA 1OT2A 1W9PA 3WFLA 3BCDA 3PZ9A 4UTFA 3O9NA 2DIEA 1J10A 4QFUA 1N82A 1TR1A 1BPLB 1JDAA 1W1VA 1LJYA 1UHVA 1WDRA 4XZWA 3GZAA 1HKKA 2XFFA 3PTMA 4AZ7A 3D3AA 1E1FA 4D6DA 1ZB5A 4NI3A 1IZJA 4HA3A 4D6EA 4H2CA 5I0DA 1C3FA 3OZPA 1VEOA 4HU0A 2BHZA 2PWGA 1LWJA 3E1F1 4NF7A 2D20A 4PUEA 1U33A 3SCNA 1PX8A 3WFZA 2J8GA 4WKFA 4AIOA 2BY2A 4U33A 4IPNB 4TXEA 1EIBA 1V3JA 1UWUA 2B31A 5A6KA 4PTMA 2WKGA 3U5YA 1BVZA 5CZKA 1E6NA 3VIIA 3F5KA 2DSWA 1QI5A 4M8UA 1CPUA 3FW6A 2DT0A 2A3HA 4AZ5A 1W3LA 4UQBA 5A6JA 3F4VA 3ARZA 1PX4A 2V3DA 3W38A 1KXTA 3BLPX 4RE3A 4PSRA 2X0YA 5I24A 1WNOA 1XSIA 1UZ1A 3K46A 3TP4A 3WMSA 3OZOA 4PUDA 3BH4A 1JGIA 3ZMRA 3I3BA 4LPCA 5A69A 3AIBA 3KL0A 5HPOA 4AZGA 4BCEA 4GQQA 2DH3A 4OOUA 1UH3A 2QMJA 1J12A 1EOMA 2E4TA 2JIEA 3U57A 1NOUA 2W63A 1VJZA 2VURA 3WD3A 2VL4A 1JZ8A 1JD7A 2ZXBA 3JUGA 1CGVA 5I78A 3GNPA 3RM8A 3VNZA 1MXDA 5AC5A 6CGTA 1WZLA 1H0GA 4WKAA 3T0BA 2Y2WA 4L4OA 3BCFA 1GVYA 3CLWA 3IAQA 3EDKA 1AQHA 2PWFA 2WLZA 3W27A 4W8BA 1IZKA 2XWEA 3WUGA 5M5DA 2J7FA 3TOPA 2A3CA 2YBUA 1C8XA 1NM9A 3ZO9A 2D1ZA 1V03A 3S6TA 1NWTA 5CLWA 4UFMA 2Y5EA 1QW8A 3ZT7A 5HOSA 4TX6A 3L4VA 1G9HA 5D8ZA 4QLLA 4AD0A 2GJXA 2EO7A 3SUWA 3W4RA 3N18A 1EQCA 2D0HA 1VB9A 4JKMA 5ABEA 1JIBA 2V5CA 1W91A 4X9YA 5BXTA 2PC8A 4GZJA 1GQJA 3GH4A 1OCQA 2YIHA 2GVYA 5HNNA 1VFOA 1UKPA 1QW9A 4DM1A 2Y24A 4A4AA 3FAXA 1GOQA 3BLKA 3F5JA 1B3WA 5I23A 2C0HA 1E1EA 2DIJA 3VM7A 1CDGA 3QOMA 1Q4NX 2GJPA 1EQPA 3SCVA 3DYOA 3T09A 3VMPA 3GH7A 1TE1A 2CBIA 2XVNA 3NSXA 2VOTA 2D0FA 3VGBA 4B15A 5D9PA 5ABHA 2BVYA 1HKIA 2X09A 1QI2A 4CU7A 4JL1A 2XIIA 1H5VA 4AZBA 1XYFA 1ESWA 2XUCA 4D71A 4MB4A 4JCMA 4DUWA 3G6MA 2WK2A 1F4HA 1DTUA 1NH6A 4ZENA 3L2LA 3BAYA 4D72A 3WKZA 3KE0A 5A2AA 4E8DA 4CGTA 1CWYA 4J3SA 4F8XA 3O6AA 1TUXA 1A47A 4WSJA 4ATWA 4JFVA 4ZE5A 4H8UA 1HJVA 1W2VA 5DFAA 3TTSA 3NIYA 4W89A 1ISZA 3MS8A 1KGXA 2CKRA 3CUHA 5CSYA 1JDDA 1SMDA 4JHOA 3B9AA 1R7AA 3S2CA 2WMGA 3CZGA 2ZE0A 4W8LA 1G01A 1XH2A 4AZCA 3N11A 1H1NA 5A6AA 1M04A 4C7GA 2BY1A 3SUVA 4ACZA 1B90A 1J0ZA 3VDHA 4PTVA 1P6WA 4Y7EA 3VD3A 3BC9A 1CLXA 3AJ7A 1SYTA 1NARA 2GUYA 1GQKA 1KXVA 2GDVA 1RD6A 2EPMX 6TAAA 2QPSA 2YDRA 4GI6A 2OSYA 3A4XA 1EO5A 3AHXA 3WD1A 3ZJKA 1CXFA 4H7VA 1ISYA 5D4YA 4EK7A 4WKHA 2WW5A 4OJYA 1J01A 2VRKA 1DWFM 3AICA 4E4PA 2DQXA 2NSXA 3RPMA 4HMEA 1UD4A 1VJSA 3SEPA 4QLJA 4Z2KA 3HMCA 1UD6A 3SCUA 3RCNA 3K4DA 4XV0A 3KWXA 2WZIA 2FGLA 3OLEA 1C92A 1VBUA 2X0HA 2YL9A 3EBVA 1JXKA 2WZEA 1HL8A 4UCFA 4BZYA 2VRQA 5HPCA 3WQ4A 3N17A 1W1TA 4WIWA 3UG3A 2EPKX 1HNYA 1UWQA 2YLAA 1CENA 1ZBWA 5JIPA 2RGMA 3VGEA 2VQTA 4PTWA 1EDGA 3WEMA 2OYLA 2CERA 2YL8A 3HN3A 1MQQA 1QHZA 1V3LA 4W7VA 2CKSA 4V28A 2XVKA 2WB5A 4JIEA 2A3EA 3AYRA 3IAPA 4MNLA 3ZR5A 1UA3A 3CUGA 1QNPA 1K9EA 1BHGA 2YDSA 3BAWA 2CYGA 1JF5A 1VEPA 1LG1A 4PMVA 2VCCA 4W86A 5GNXA 1ODUA 2WCGA 3NUKA 4K68A 4JHZA 1E9LA 2WHLA 1UKTA 1Z32X 2YL5A 1JD9A 5DT7A 3OIHA 3QR3A 2BV9A 2IXUA 1BTCA 4H41A 1LL7A 3WMBA 2V38A 1QHOA 3B9EA 3NSMA 3PHAA 3SUSA 4TVDA 1JL8A 4W7UA 3ARPA 4WLCA 3L4YA 4TVCA 3AHYA 3WUBA 3AMLA 4AD4A 2DDXA 3VU2A 2WWDA 3L4XA 2W62A 5DF0A 1V02E 2XM2A 2XVGA 4LYQA 5BYWA 1TA3A 1Q6CA 4B3KA 2CBJA 5JUVA 1AMYA 2OWCA 1VFMA 3WNKA 4Z2GA 1W3KA 3PZNA 2EPOA 3GXDA 1GOWA 2V3FA 3GDBA 5CPTA 2XVLA 2J7BA 1PEZA 4M29A 1B30A 3ARUA 2CCRA 2WXDM 1GW1A 5E70A 5BXSA 5FOOA 1VFUA 1PIFA 3AZSA 1XC6A 2WHJA 4N0RA 3LPOA 1W3HA 1Q6DA 5DO8A 3THCA 4M80A 2EPLX 4YHEA 3DECA 1X6NA 1XV8A 2CHOA 3VIKA 1CGXA 3ALFA 2BXZA 4PMNA 4W5UA 4NRSA 3PZTA 3CHEA 8CGTA 1OD8A 1IV8A 2FHFA 2ZWZA 1I1XA 4AY1A 3CZEA 1E6XM 1VFFA 3CZKA 4FLSA 3ZT5A 3BSHA 3WNLA 3ARYA 5CPSA 3N9KA 1E40A 1UR4A 1AVAA 4Z2IA 3WQ6A 3AMCA 4F9DA 3N04A 1KR0A 1C91A 5IDIA 3VGGA 1G1YA 4P7OA 1QBBA 3UETA 4FK9A 2GK1A 4ML4A 2G8ZA 1TCMA 3N13A 1MYRA 4FF5A 4R27A 2V5DA 1PAMA 3N12A 8A3HA 2ZUTA 3SCOA 1NWUA 3GM8A 4P8WA 4LX4A 3WD2A 5A8PA 3EDFA 4EKJA 2EPNA 2WMIA 1BAGA 1DWIM 2YDQA 1WZKA 3MSGA 3ZR6A 1UOKA 4U5IA 1QPKA 2G3JA 4EAMA 3A3HA 3MUAA 1JZ5A 1E4LA 1H41A 2Y4SA 4OKDA 3WBEA 1H0IA 1DWJM 1DEDA 1CNVA 2WKLA 4AIUA 1V0NA 3AZTA 3M6DA 1QVBA 3PN8A 4XUYA 1R85A 2J75A 1KGWA 2CIPA 1PZ2A 2A3AA 1J9YA 2E9MA 1MFVA 1V6XA 3OGSA 1V6YA 1H09A 2CBVA 5JBDA 2ZX5A 3RJYA 3VM5A 5DT5A 1D2KA 2WBGA 4KRTA 2BXYA 5IXEA 4H04A 3J7HA 2WVVB 1WDSA 3VDCA 2BS9A 4JFTA 3CHDA 4AMCA 3VIFA 1UR0A 5CG0A 2WMJA 1BSIA 1GOOA 1JZ3A 5HDRA 1DWHM 1E0XA 3CGTA 3GBDA 3CTTA 3WEOA 1OIMA 4HMCA 3W6MA 5IFTA 4IISA 4UQ9A 2G41A 2Y8KA 1W2PA 1GORA 5LA1A 2J8FA 4ZE4A 2J79A 2E8YA 4C7FA 3GTNA 4YPJA 1W9VA 3T2QA 3SCQA 3WSUA 4MNMA 3PBGA 3RM4A 4AXNA 1FFQA 2WC7A 2WSPA 4ZXOA 5A2CA 1DWGM 2YKKA 3MMDA 1BGGA 1HJQA 1PIGA 3WENA 4AW7A 2WNWA 5CSUA 5EB8A 1BG4A 4W85A 1R87A 3AS2A 3VX1A 5C8BB 4UOJA 1HIZA 5CGTA 3ZJ6A 2J7CA 3AIUA 3GH5A 1TG7A 1HXJA 4URIA 4B9ZA 1CZ1A 5I3DA 4PBGA 1WE5A 2VZTA 4UR9A 3BAIA 2VVNA 4CVWA 2E9LA 1FHLA 3WUEA 2DT3A 3W81A 2WHMA 3SCPA 1CGUA 3D5HA 3AIRA 4AEFA 4UOQA 1XSKA 1TMQA 1GQLA 3CZJA 2A3BA 3ZM8A 1JYNA 5EFFA 2YA2A 4W88A 1UYQA 4DUVA 4TTUA 4OZOA 4B16A 1B0IA 1V08A 2YOCA 4LYRA 2MANA 5E6YA 1WDPA 3NCOA 2XYLA 3A4AA 3WBAA 1FHDA 1CGTA 1CXIA 4JZ5A 1XGZA 3AIQA 5ABGA 9CGTA 4MJ2A 3GYCA 5BROA 4OOZA 1ITCA 3DYPA 5AYBA 2D3LA 5A6BD 4JFWA 3VILA 1G94A 4UQEA 5I6SA 1H2JA 1EOKA 3CO4A 1J0HA 1LWHA 2XSBA 3OBAA 1JZ7A 1HF6A 1UR2A 1C90A 1QBAA 4TOQA 3VOCA 1JZ2A 2JALA 3GXMA 1QOXA 2ZUSA 1H49A 1XD0A 1UWRA 1BLIA 2VZSA 1HJSA 3RM9A 2W4XA 3WMCA 2DSVA 1JZ4A 4CUCA 1UQYA 2WM0A 2C8NA 1Q6FA 3FY1A 1X6LA 1HJWA 1W9UA 1CXLA 5IFPA 2W91A 2X8RA 4PMZA 3THDA 3K4AA 4TX8A 3UG5A 4CN4A 4BQ2A 2NT0A 4KGJA 4W5ZA 2WWCA 1R86A 1BQCA 2J47A 5C71A 1GCYA 2OLHA 4LYPA 1UH2A 4W84A 2WMFA 1YQ2A 2ZICA 4YN5A 1KCLA 1W32A 1H11A 3WF4A 2HVMA 1WDQA 3WF1A 2XTKA 1HT6A 1V6VA 1HVQA 2OSXA 4GPNA 3AROA 2VR4A 5A6SA 1C93A 5CXPA 4ATLA 3CMGA 3HJEA 4PTXA 5AYIA 3VIMA 1JYWA 2E8ZA 3RJXA 4FLQA 4CD7A 4Q22A 2JF6A 1BYAA 3PZGA 1ZBVA 3FNDA 3MV01 4E8CA 4L4PA 1PZ3A 4QCFA 1H3GA 1DHKA 1E3XA 1HL9A 3IJ8A 2WLYA 3GBEA 5I77A 2WMIB 2J77A 1QNQA 4HP5A 1GOKA 5IHSA 2ZIDA 3ZJ8A 1C8QA 4J3WA 3VD4A 1JI1A 4UFIA 2WMKA 3ZSSA 1UD8A 2FDMA 3VD5A 1HP4A 3BMWA 4OUEA 2EXOA 3A4WA 1EGZA 2O9PA 2WVVA 4ATDA 4W8AA 4J28A 4F79A 4PMRA 2J7DA 4J7RA 4U3AA 1MW3A 4CN6A 1TA3B 2ZX9A 1RP9A 3K8MA 1HN1A 4D6FA 2BFGA 4ACZB 2UY2A 2EEXA 2YLLA 1UKOA 1K9FA 2XVPA 1E3ZA 3TTOA 5E09A 1WP6A 2O9RA 2DSZA 2OYMA 2G3MA 2QPUA 3AHVA 3WH6A 1B31A 3UEQA 2IXVA 4UNIA 1UG6A 2CITA 1XCWA 4TVUA 4CKQA 3W26A 4QCEA 1ZBCA 3DHPA 3CHCA 1FH8A 5CLTA 4CD6A 4Z2HA 1JYXA 5GNZA 5FL1A 4C7DA 3AS1A 1IT0A 2JEPA 3M07A 1CXEA 5BXPA 4X0NA 4HOWA 3T2OA 1CBGA 1ZJBA 2ZX6A 2F61A 4TTGA 1B2YA 1CXKA 3TA9A 5EFDA 4ZFMA 3W82A 3VGDA 2FHBA 4D6IA 2XGBA 4U31A 1CEOA 2QHAA 1V6UA 5M3WA 2VO5A 2X2YA 1Q6EA 1UKQA 4HZ8A 1ZU8A 4RL3A 1V3MA 1CLVA 3VIGA 1B3XA 1FFRA 1MW1A 1UD2A 3RO8A 4GIAA 1WPCA 3M46A 1NP2A 1M53A 5GQBA 1M01A 2E9BA 4OBRA 3SUTA 3G6LA 3WD4A 1BYBA 4EANA 1EDTA 2WZHA 1JYVA 5CGMA 2BVTA 1QNOA 5EMYA 2CPUA 2F8QA 2DEPA 4BF7A 1SR0A 3ARTA 1OD0A 1XD1A 3WN6A 1ZL1A 4PCSA 1V0KA 1W1YA 2PB1A 4GZEA 5BCAA 1G0CA 1OB0A 2AOSA 2CNCA 1U2YA 1GVIA 2D22A 3WY1A 4MTVA 4BQ4A 2OWXA 3WDRA 1KFWA 1XYZA 2CESA 3L2MA 3VIJA 4PMXA 1Q6GA 3WIJA 4NRRA 3WF0A 2BNJA 2YBTA 1GOMA 4S3KA 5D9OA 1HP5A 1UR9A 3DYMA 5A6MA 3PZQA 3L4UA 3EYPA 3OA5A 3NDZA 1GHSA 4HZ7A 1MQPA 4DWSC 4H8HA 2PWDA 5TD4A 3QGVA 4AD1A 4MADA 1E0WA 1FOBA 3EDJA 4CD4A 2JE8A 1LL6A 3ARRA 3CUJA 1LQ0A 1I75A 1ISVA 2XGIA 2XWDA 4PYSA 1ZBKA 4P8XA 3VIOA 5A3HA 3ARWA 3ZQ9A 1EHAA 3W6LA 4CD8A 4D6GA 3IK2A 2VX5A 1PPIA 4H8VA 1B3YA 3LMYA 1GJWA 1VRXA 4J3UA 2VVSA 2ZX7A 5FIPA 1UQZA 4U5KA 4E2OA 2G4FA 1JNEA 2VX4A 4UZUA 5C70A 4IM4A 1E70M 5FL0A 1Y7VA 3MANA 4P7QA 3W53A 4LXFA 3FN9A 1V0MA 2PBOA 4J3VA 3OGRA 2GDUA 3EMZA 1VF8A 1BGAA 4UQAA 2W92A 3WNOA 1E5JA 2O9TA 2WVTA 1EO7A 2PWEA 4MNJA 3PZOA 1ZJAA 1LF1A 2XFYA 5JBEA 3DC0A 3WELA 3VNYA 4KH2A 3SIMA 1UR8A 2VR5A 2VZUA 3QOKA 1OGSA 2V3EA 3VPLA 2F2HA 2UWFA 3AHTA 3AXXA 4IUGA 1PBGA 4HU8A 3CHFA 2J78A 1OGBA 5M03A 2ZWYA 2FHCA 3BGAA 1UWTA 1H4PA 3NYDA 4QP0A 1BFNA 3MU7A 2VT0A 2ZOXA 3IJ9A 2XHYA 2GJXB 1O6IA 1VIWA 2J25A 1BYCA 4FLOA 3W25A 3AIWA 1S46A 3WQWA 1GOIA 1LLOA 3EMQA 1CGWA 2GFTA 4D6JA 3OLDA 4CU6A 4U3CA 5ABFA 2CEQA 3WH8A 3ZIZA 1US3A 5HXMA 5LA2A 4PMUA 4NZCA 3T2PA 7TAAA 4OBSA 1MVYA 2W61A 1UUQA 2Q8XA 4Z2JA 3N1AA 4JCLA 5GNYA 4QLKA 3AXHA 1GHRA 1B3ZA 3K1DA 4HMDA 4BS0A 2W67A 4KGLA 1RP8A 4PSPA 1CIUA 4N42A 3KL5A 3BAXA 1J0JA 1E6ZA 3OG2A 1FP9A 3AS0A 2QLYA 4P7NA 4QAWA 2J7HA 1FP8A 1ISWA 2WPGA 5CPQA 5I5RA 1UA7A 3WNPA 4AZIA 2VNCA 3VD7A 3GXFA 3W0KA 4MJ4A 4F9JA 1E71M 1K9TA 3RMEA 1TFVA 1BVNP 3KEHA 3WQ8A 3UG4A 3UCQA 4D6HA 2UY5A 4AZCB 1QI4A 1GJUA 1BF2A 1E15A 3WDPP 3FAWA 3EDDA 2D3NA 1RPKA 3MSDA 1JNDA 2ZXDA 1KWGA 5F7UA 2FH6A 1KR1A 3GNOA 3ECQA 4AD5A 3BMVA 1WCGA 2CXGA 3U5UA 2VX7A 2WMHA 3I3EA 1KCKA 3CMJA 1TVPA 2VZVA 1YHTA 2ZUMA 1KQZA 1W9XA 4W87A 1DP0A 3M7SA 1DWAM 5EBAA 2JFEX 4M82A 1GNXA 1HVXA 1UKSA 2VQUA 1V0LA 2BHYA 1R7OA 1E4IA 4CCEA 4LQ1A 4RE2A 3WH7A 1E4NA 2V3GA 3AISA 7A3HA 1NQ6A 2J74A 4HZ6A 1I1WA 3MUIA 1OSEA 3L4TA 3SCTA 2WAGA 3TONA 4HTYA 3U7BA 3POHA 1C7TA 1UR1A 1E5NA 3OGVA 2XFRA 4GI8A 5KEZA 3F5LA 4DWSD 4CCDA 2QF8A 1E6RA 2OSWA 1FA2A 1QNSA 1KWKA 2VZOA 4PMDA 4D6CA 3ARQA 4B9YA 1EH9A 3POCA 5IHRA 2WHKA 1V3KA 1V3IA 5D9MA 3A47A 1J18A 2NT1A 1CTNA 1D7FA 1B3VA 4Q7NA 4HOXA 2HISA 3VIPA 1KXHA 1UWSA 1TVNA 3SCRA 5I2UA 3EDEA 3WDHA 3VKKA 1SMAA 1MQRA 4WJXA 1LG2A 2BY0A 3CBWA 4U2ZA 1XSJA 3QHOA 5JIWA 3W37A 4J3TA 3WDQA 4JAWA 4PMOA 2CETA 3BAJA 5FD0A 3ALGA 1UZ4A 2VX6A 3QHNA 4JL2A 4FLRA 2DT2A 1NOWA 3WD0A 4W7WA 3SURA 3CUFA 1UD5A 2ZUVA 3LPGA 3I3DA 4HA4A 1V6WA 4XX6A 1NP0A 2FGZA 5AC4A 3ZT6A 4WSKA 3ZJ7A 1CGYA 4BQ3A 3IJ7A 4GO8A 4PRWA 1V02A 1UH4A 3A6OA 3MUZ1 1QI3A 3MO4A 5JBFA 1U30A 4MDPA 3AMGA 5BRQA 3ARSA 2XM1A 5BXRA 4GQRA 4AZ6A 3CPUA 3VX0A 2WVSA 1ECEA 1WAWA 5DMYA 1C8YA 1JFXA 3MMWA 3BSGA 2WANA 1EA9C 2XJ7A 4M1RA 1VAHA 5ABFB 2XG9A 2JIWA 2ZXQA 2ZUWA 4AIEA 4AWEA 4Z2LA 2GK1B 3T08A 2VJXA 3MMUA 1J0YA 3VIHA 1E55A 1PJ9A 3AFBA 1F4AA 1E43A 4DWSA 5E0FA 2Z1SA 3ZSTA 3NSNA 1ISXA 4XZBA 2EBNA 4A3YA 4GI9A 4DWSB 1LL4A 3AYSA 2J62A 4MB3A 3SCSA 4GINA 4HPGA 2D24A 1GPFA 4AC1X 5KZ6A 3N15A 3B8SA 1XHGA 3UESA 3PZIA 3BAKA 1HJUA 4PEEA 3CZ8A 1KBBA 2JEQA 4S3JA 4ZXLA 1KBKA 5BWFA 1JF6A 1MW2A 3AXIA 1D3CA 4U2YA 2PI6A 1G5AA 4J27A 2VUYA 5I79A 5CJ5A 3KZSA 1JI2A 4AD2A 4CN1A 2AAAA 4NSBA 2EQDA 2VCAA 4W93A 2CBUA 3FHAA 3GXIA 3OB8A 5FKYA 4GXPA 1XCXA 1BYDA 4UZSA 2DH2A 3VDBA 2J4GA 1K6AA 4XB3A 3UR8A 1E73M 4GZIA 4X0VA 2W66A 4UOZA 5DEZA 3IANA 2YJQA 1MXGA 2D23A 1FH9A 3AIVA 3WNNA 1L0PA 5M17A 1B1YA 3ARVA 2G3IA 1ZS2A 1L8NA 1WZAA 2C7FA 3MV11 2OWWA 5A2BA 4ACYA 3VTRA 5CQ1A 1PX3A 4QDMA 2ZUNA 2DGAA 3QHMA 3WF3A 5A94A 4MB1A 1CXHA 2E3ZA 4D1JA 2DPEA 1WZMA 3TTYA 3WUFA 1OIFA 4PN2A 1VENA 2VC9A 1W3JA 3FHQA 1CYGA 2O92A 2WCSA 2UY3A 3W24A 3WF2A 1AQ0A 4CD5A 1M03A 4HPHA 4GKLA 4UFLA 3VGHA 2BHUA 5FCZA 3PZVA 3AS3A 3AMKA 1V3HA 3OLGA 3WNMA 1E4MM 1W9DM 1VEMA 4OIFA 1XH1A 3VMOA 1O7AA 5A6LA 1XH0A 4CCCA 4KWUA 2GJRA 3AMDA 3AZRA 4JFSA 2GSJA 1US2A 2NW0A 1OWQA 1CECA 3AIEA 1NOFA 3T0AA 1KQYA 3APGA 3PTQA 2TAAA 1C7SA 1W9BM 2CHNA 1JG9A 2WBKA 2YL6A 4WF7A 1QNRA 5LA0A 3O2LA 1HKMA 4UQDA 4BQ5A 3AOFA 3CUIA 4HOZA 2BVDA 1J0KA 1VBRA 3K8LA 3OLIA 3T0DA 2ZXAA 2X05A 3HU7A 3UERA 3CIVA 1EXPA 3LPFA 4GO9A 1X1NA 1OBAA 2PF0A 1MW0A 1OGGA 3VVGA 4J3XA 4RE4A 4UFHA 3WQ5A 2VI0A 2D2OA 3NDYA 2YA1A 5AY7A 5A8MA 4MAVA 1SFSA 1HKJA 1OM0A 2WC3A 4HA1A 3VMNA 4B3LA 1J11A 5D9NA 1KB3A 1E56A 4AEEA 4PMYA 4IPLA 1EHNA 4CU8A 2WCAA 3PZMA 3BXWA 2W5FA 2XSAA 3PTKA 1BG9A 1JDCA 5A1AA 4V27A 2OYKA 2QV4A 3L4WA 4EE9A 2PBGA 3W28A 3VD9A 2JF7A 1A3HA 1UWIA 2VCBA 3WH5A 3DHUA 3WEZA 5LYRA
chains in the Genus database with same CATH superfamily
3H8AA 3EXTA 3H22A 4CVUA 2DSKA 2BY3A 2GPTA 3NPUA 5D2WA 3S47A 3SJ3A 4NNCA 3EMCA 3EWBX 1KM3A 2Z27A 1W1PA 4M5PA 4OV4A 4F2BA 5LHEA 2EJ1A 4M81A 3V7PA 4Z0JA 1FCQA 1W1B1 3LQGA 3V36A 3KTCA 3UZ5A 3I7QA 2VELA 4IIFA 1EJUC 1WX0A 2I9EA 4AYGA 1X6UA 3BZGA 4REQB 3DG6A 3BOFA 2G96A 2Y7EA 4AZHA 1JCJA 3I68A 2W79A 5HULA 4WOZA 3VFCA 4KKXA 4UFJA 1CLKA 3V1HA 1QASA 3FJ6A 3U7VA 5C6MA 5HR6A 2QUTA 3C86A 2C18A 3I4EA 3SN1A 3G3MA 4M24A 1O60A 4AYSA 4O19A 1U1UA 1VLWA 2IUZA 4P7RA 1XGEA 3WDIA 1E6PA 3ITLA 4H2HA 3RCYA 4O4WA 3LPPA 4GUGA 2CZVA 4IL2A 3S2LA 1KRBC 5FF4A 3LG3A 3BGJA 4GG9A 3UPWA 4FOKA 4FMVA 3TXVA 4C1NB 5ECUA 1K9DA 2J6VA 3F4WA 2FH8A 1FH7A 2D0GA 6A3HA 4DBDA 2PDJA 5FF3A 1ME9A 3IIVA 2ISFA 3H23A 4JKLA 5BRPA 1M7OA 4QNEA 1Y5WA 4R5EA 5TIMA 1DQXA 5D8WA 2ZE3A 4FI4A 1GONA 2E6AA 1LM1A 2QGYA 2VYOA 3MKKA 1DQWA 1MWOA 5E9AA 3DHFA 1T96A 4UFKA 3LN3A 3OYXA 1WKYA 3N6HA 3A5FA 3WQVA 3WH9A 2Y8VA 1VJIA 3BG9A 5E0CA 3R58A 3MJMA 1JVNA 1OT1A 1UD3A 4MNKA 4WK9A 3URQA 3MHGA 1NWRA 2B7PA 2F84A 4H9YA 3EOEA 3NG3A 3O6CA 1Z8AA 3UZXA 3O9NA 4RPQA 3DFQA 5DMMA 1TR1A 1JDAA 1LJYA 1WDRA 3FCPA 1E1CB 1MZRA 2XFFA 3EXRA 5TF0A 4Q7BA 4AZ7A 3IGUA 1JCTA 1K7XA 4D6EA 1C3FA 4HU0A 3GDMA 3SCNA 4PUEA 2D20A 4WHBA 1U33A 1PX8A 5D30A 5D38A 1KFLA 1Z69A 3G1HA 1ZJHA 1BRLA 2CZDA 4MWAB 2B31A 4PTMA 3U5YA 1A49A 5CZKA 3LERA 3F5KA 5CAKA 5AVHA 1KRMA 2A4AA 2Z2AA 4JQ4A 2A3HA 2V9DA 1OVDA 4UQBA 1W3LA 4RE0A 3QRHA 3LA4A 3F4VA 5REQB 2BWGA 4H1ZA 3W38A 3T40A 2QJIA 1VPYA 3H4XA 2HDJA 5I24A 1Q2SA 1WNOA 1XSIA 1UZ1A 3OZOA 3BH4A 1JPMA 1WV2A 1I2OA 3KL0A 1VBJA 3C8FA 2QMJA 1J12A 1YE4A 1UR3M 3Q94A 4O4VA 2EKGA 4UB9A 2E6YA 3V5FA 4S3GA 2E4TA 3U57A 1ZALA 2VURA 3MUCA 2VL4A 4BF5A 5T9BG 4Z42C 4PR4A 2FQIA 1J2BA 1WXZA 4LVGA 5AC5A 6CGTA 4L4OA 5BW6A 5FJUA 3CC1A 1KKOA 2XGZA 3PUGA 4HCDA 4OWGA 4W8BA 3WUGA 3TOPA 2A3CA 5DXYA 4Z08A 1AW2A 1C8XA 1NM9A 2E7FA 3ZO9A 2V82A 1SFTA 1OK6A 4PZVA 1F6KA 1SJCA 3MC5A 1D9EA 2BZNA 3L4VA 4QLLA 1XIFA 3KXQA 3CEPA 3SUWA 2YB1A 1NQKA 3S5NA 2YSWA 2D0HA 2B0MA 4I6KA 1GKPA 1W91A 4X9YA 4ZQCA 3GC5A 5BXTA 2OOFA 2AL2A 4GMEA 5H8UA 2GVYA 5HNNA 4HGXA 1JQXA 3E96A 3A22A 2V69A 3DESA 1JUKA 4Q8WA 4B2DD 1DJXA 1JPKA 1G4TA 3CT7A 1B3WA 1POJA 1E1EA 2DIJA 4JTUA 3HMJG 3FKRA 3VM7A 1EQPA 3QQWA 2GQ3A 3SCVA 1IYXA 4EP8C 3VMPA 5E9XA 1A4MA 3QEZA 4C6DA 4C5YA 2ZZ3A 3LOTA 2PLKA 4A8LA 4K37A 5D9PA 3THQA 2AKZA 3UGRA 3EA2A 1B54A 2X09A 1WQ5A 3PPCA 4JL1A 4NZ5A 1XYFA 2WSQA 4O1CA 2ZQ0A 1ZAJA 4KFOA 3W86A 3CV6A 4DNMA 2POZA 4N2YA 3EX4A 3GKFA 2FVMA 5EMJA 5A2AA 4O8RA 5DELA 4HKPA 1CWYA 4JGDA 1DYSA 3P93A 3W7NA 4O8AA 4E3VA 1XPGA 1SVDA 4AX6A 1KTCA 5B80A 2PTYA 4MLRA 1LTDA 4Q8MA 2V5BA 4H8UA 1W2VA 4YWSA 5DFAA 5CZ0A 2CLLA 1EWDA 4HNTA 4W89A 1KGXA 2CKRA 5CSYA 5I02A 1JDDA 1KM0A 1OX6A 4IJRA 1R7AA 3S2CA 3NZRA 4HHMA 2A85A 3VNDA 3H55A 3QGAC 2PDYA 4C7GA 1D7KA 1V5XA 2JKEA 4QE1A 5HAOA 3VDHA 4HHPA 4Y7EA 2X7VA 1S2UA 3B0YA 1NARA 2R6OA 1LLWA 4HJFA 1GQKA 1YE6A 4LBUA 5FESA 3A4XA 1EO5A 5MHBA 2Y63A 3WD1A 2YW3A 3QFEA 4UNKA 4A29A 1O1ZA 1O5QA 5I7GA 1ISYA 4R34A 4EK7A 4KCWA 2GQAA 1HO1A 3RF9A 4QE5A 1M5WA 1DWFM 4B91A 1SJBA 4E4PA 4QAIA 4IP7A 3E0WA 4XK2A 1UD4A 3K2GA 1F6PA 4DB7A 2VKZG 4J2PA 4XBJA 3K4DA 1XLDA 1LBLA 2PDWA 1EUAA 5DN1A 2FGLA 3OLEA 1VBUA 4CNTA 3ZZ1A 3G77A 1ZLPA 4E8GA 2WZEA 1RK6A 1HL8A 3BVJA 1TPUA 3ENLA 4BZYA 2VRQA 1W1TA 2Q02A 1HNYA 1UB3A 4DYEA 1CENA 4JOMA 5JIPA 4ROPA 4XKYB 4DF0A 4PTWA 2Z1BA 2ADAA 2Z28A 3ABSA 2CERA 1G7UA 4UXDA 3ZXWA 3ZVHB 4V28A 1XLEA 3LSCA 2OZ3A 2V63A 3BW2A 1TMHA 4B5UA 4DI8A 5FJJA 3KOWA 1H7PA 4K3ZA 3HG2A 4PULA 3CUGA 1QNPA 4Q8UA 1K9EA 1GK8A 4O14A 4MZ1A 3CT2A 2CYGA 1Z7AA 4JBRA 2FDSA 2VEFA 2YCLA 1IEIA 7REQB 1S38A 2WM1A 4X22A 5GNXA 2XU2A 1ODUA 3NUKA 4JTHA 3NTYA 1E9LA 4JHZA 1UKTA 1Z32X 1JD9A 5H91A 3OIHA 5G4WA 2BV9A 3WLJA 4DIAA 2G3FA 3OP2A 3B9EA 1NFBA 4LW7A 4W7UA 3F4DA 4O17A 3NEHA 1Q85A 3L5MA 4LUYA 3L4YA 2EJAA 5JH1A 1IWPA 3VU2A 1V02E 2FKPA 3H2OA 3UQNA 2KX9A 4ASTA 3VKAA 1LWIA 1OZMA 2VEKA 1QRQA 3GX9A 4Z2GA 3PUOA 3LDVA 2WNQA 1RZMA 3GE7A 4LCSA 4YTTA 1MEWA 2PZ0A 3HQPA 2CCRA 1GW1A 1EP2A 5HK4A 1GZ1A 2G97A 3S9ZA 1VFUA 5JU6A 1Q6DA 3T55A 5DO8A 2EPLX 3KOXA 4YHEA 1I2QA 2DP3A 4QHRA 1GTHA 2PDBA 1R2TA 4CQBA 4JNYA 3PZTA 3INPA 3CHEA 3TSBA 3L21A 1OD8A 1IV8A 1Q8JA 4GYPA 1I1XA 2ZC8A 1E6XM 2PDMA 1HTIA 3WNLA 1HGWA 4NL1A 1REQA 3W2JA 4L4LA 2L5HA 4ZB0A 3KBJA 3R0DA 1KR0A 3VGGA 2GGIA 1G1YA 4P7OA 1QBBA 4ML4A 4MJMA 1TCMA 4K1WA 3C0QA 1VPXA 3DI0A 1MYRA 4ZQOA 3S42A 3N12A 2ZUTA 1FDZA 3GM8A 4RX0A 2Z2UA 4BJHA 3M0XA 4EKJA 1Z89A 4GOAA 4U5IA 2G3JA 3A3HA 1H41A 2Y4SA 5FJPA 4KEMA 4I8YA 1OFPA 4KS0A 4HJWA 1OG6A 1DJYA 5CG7A 3ES7A 1V8EA 4UR8A 4JQAA 5T9CE 3D47A 3NWRA 3SGGA 2A3AA 3STEA 4M7TA 5D32A 5LIXX 5D02A 1WUEA 1AFSA 2QAPA 3LV6A 3QR1A 4LAKA 1FXPA 3JRKA 3USZA 4WY0F 4REQA 5JBDA 4LF2A 3GLCA 1WDSA 3LTPA 3VDCA 3NZ1A 1BSIA 5HDRA 4ICCX 4M19A 4MSSA 4CQCA 3W7DA 1XYLA 4GNVA 3NNTA 3CTTA 1W6TA 3WEOA 4S3EA 1OIMA 3TJLA 3RK8A 3M43A 8TIMA 3QYSA 4UQ9A 2HXUA 4GACA 2Y8KA 4HPXA 1W2PA 2QUUA 1GORA 2J8FA 5HJLA 1UJQA 1BXNA 3FOKA 3M5ZA 1MO0A 3A3WA 3SR7A 3SCQA 3LU2A 1QOQA 2IW0A 3MI3A 3MJYA 4MNMA 3GVQA 1AJ2A 4WZHA 3TX9A 3W1UA 1A0CA 1FFQA 4ZXOA 1BGGA 2ZA1A 2ZVIA 2WNWA 1TX0A 1KBIA 5EB8A 2VFEA 4W85A 3VX1A 1HIZA 1WXJA 4K8GA 2PSNA 3WO8A 2QV5A 3VCNA 1NF7A 2VGFA 4URIA 5CPOA 4UIOA 1WE5A 2VZTA 2P88A 1F3TA 4KT2A 9XIMA 2VVNA 1RUSA 4MMWA 4WY0B 3TZNA 3VXGA 3W81A 1PCWA 3D5HA 1IXNA 3VCRA 5T8GA 4FS9A 3LI0A 1OFQA 5LHFA 1JYNA 3IJQA 1W31A 5EFFA 2YA2A 4QDPA 4DUVA 4DJDA 4CQDA 1XYMA 1NEYA 1YEYA 4OZOA 1H7OA 1B0IA 1BSLA 2MANA 3JR2A 1WDPA 1QMLA 5BMXA 3CQIA 1FUYA 2ZKMX 2WZTA 3WBAA 2XN1A 1CGTA 2E25A 1QO2A 3TFXA 4Y9AA 4JTKA 5BROA 1G67A 2D3LA 5I3HA 4JFWA 4UTUA 1MXSA 3T1GA 5AHMA 1EOKA 1J0HA 1JZ7A 3PFRA 3VDGA 1XBXA 3P2VA 1UR2A 3RLGA 1QBAA 4TOQA 5J8LA 3GXMA 4FNSA 2RDXA 3P67A 1UWRA 1RVGA 2W4XA 3KP0A 1I4NA 1SUXA 4X61A 1B57A 1V77A 6ALDA 2PTXA 3FGCA 2WM0A 1PTDA 5CZJA 1OQFA 3V18A 5CPLA 1KC7A 3W7GA 1JCMP 1CI1A 5IFPA 4FP1A 1WBHA 1E0TA 4KGJA 3BCJA 1BWKA 3C2OA 1SQ7A 4IZGA 1OYAA 3K1GA 3PPFA 1BQCA 1GCYA 2OLHA 4JIPA 4LAZA 2XN2A 3E2QA 5LSMA 1K8CA 3MSYA 4ERAA 1UH2A 1KTNA 5TQLA 3ITCA 4N6EA 3G0UA 1H11A 1VFLA 2XTKA 2A3LA 1V6VA 1W8SA 3TVAA 4R7OA 4GPNA 3COTA 2VR4A 3UF9A 1C93A 4BEUA 4DWDA 4M7SA 1N55A 3HJEA 4LNCA 4H7ZA 1F3XA 1XR2A 5AYIA 4L56A 4Q4PA 3RJXA 4FLQA 1ZBVA 3FNDA 4LFYA 4IG2B 4L64A 1DHKA 1E3XA 3VUSA 1L6YA 3L5LA 2WLYA 2WMIB 4PBFA 2ZIDA 1QWKA 1PTGA 1S5TA 2RUSA 2OZTA 3TC7A 1UD8A 4WEVX 3DFTA 4U4MA 3VD5A 3HOJA 4NX0A 4MHBA 4XZ9A 2X1RA 5A5WA 4W8AA 4J28A 4F79A 3FDGA 4JEQA 3KCLA 4J7RA 3NGJA 2D2JA 1MW3A 3TW6A 1RP9A 4S1FA 2R8WA 3RRXA 3PSWA 4D6FA 3H24A 2BFGA 1UKOA 2XVPA 4PCPA 3TTOA 4LAMA 1Y65A 2O9RA 2OYMA 1Q5MA 4QE4A 1FWEC 3BANA 3UEQA 3S4TA 1UG6A 2CITA 1S5WA 2HWGA 2DVXA 3C61A 3W26A 4QCEA 3LB0A 1LRNA 1R2SA 3E5BA 3S2NA 3VNLA 4H00A 1FH8A 4ZOBA 1XS2A 2EF9A 4JHMA 3LLDA 3AS1A 3VZZA 2FPTA 3DENA 3GW3A 3T2OA 1ZJBA 2ZX6A 3GFXA 4TQTA 2NUWA 2REQB 2A21A 1OHLA 5LIKX 4MWAC 4GYJA 4QSFA 3EA3A 3PFMA 4ZFMA 1F9CA 3S1WA 3VGDA 3WZ0E 4H6KA 1P5BA 1KRAC 1CEOA 1TKKA 1C8VA 1IGSA 2VO5A 3TYBA 1C29A 4HZ8A 2ALRA 3WYZA 3R11A 1H7RA 3R0UA 1FFRA 1EX5A 1MW1A 4L7ZA 2GLKA 4GIAA 3M46A 4O1AA 1XIBA 1M01A 1X8CA 5IDZA 2WNZA 4OBRA 1Q65A 3WD4A 1SW0A 4NY2A 1EDTA 3DDMA 1JYVA 5EMYA 2CW6A 3PAOA 4Q8VA 3CQJA 4WUIA 4F40A 1V0KA 4GZEA 1ICPA 4XTIA 2ZTJA 2D2HA 4DJFC 3WY1A 5HMEA 3S5OA 2V5JA 1PVNA 4O0ZA 3TW7A 3U4AA 1XYZA 2EHHA 5E93A 2CESA 3L2MA 4PMXA 4NRRA 4FB7A 1IR1A 3WF0A 3VABA 1HP5A 2ZRZA 3DYMA 1WUFA 3BDKA 4G9PA 4HZ7A 1GHSA 4H8HA 3C3NA 1E0WA 1LL6A 3ARRA 4LAOA 4PEKA 2XGIA 2XWDA 4PYSA 4P8XA 4DJFA 4J4KA 4NZ1A 3DIPA 5I3JA 3ZQ9A 2AAMA 4QS6A 3CLMA 2VEGA 1LRQA 2WJDA 4L9YA 1VKFA 3MMTA 2VX5A 3SRFA 4XQ6A 1LLZA 3DX5A 4FNPA 5DY2A 1PPIA 1E9ZB 3GXPA 4C6PA 4GISA 3E0FA 2C3ZA 5C0QA 1B3YA 4IFRA 4I7UA 4ZSUA 3BICA 3SY8A 4HMNA 2FJKA 4NAEA 2ZX7A 4UTWC 5FIPA 4I9JA 2J66A 5C70A 1KM4A 1Y7VA 4F0RA 3W53A 1BTMA 1P0KA 4LXFA 5C9XA 3FN9A 2DUXA 4TO8A 3N2CA 2GDUA 1BGAA 2W92A 1ZNNA 1BQGA 1E5JA 1QPQA 2O9TA 3DG3A 2BLEA 3ZLFA 1LF1A 4KRZA 2PFHA 3DC0A 3WELA 4PFHA 4KH2A 3KTSA 1FCVA 1O12A 1VP5A 1MRQA 3USBA 3N34A 8XIAA 1OGSA 3RG6A 3M16A 3W01A 3UWVA 3N3MA 2P76A 4JTEA 5KINA 3CHFA 1VS1A 4N9DA 3PNUA 4IGMA 3DC8A 1F61A 1PL9A 5M03A 2FHCA 1UWTA 1BFNA 2OLAA 3UT0A 2Z1XA 4US5D 4XVDA 4O10A 2ZZ4A 2J25A 3W25A 5EA9A 3H4WA 3I65A 3EMQA 4RK8A 3HO8A 1YNQA 2GFTA 2NQ5A 3W7JA 1PKYA 3WH8A 2QCDA 3BWWA 4PRRA 3T2PA 2C0AA 2Y7FA 4GABA 3W23A 4RR4A 1BVWA 1W5QA 2ZZ7A 4O53A 4GH1A 4ZVJA 3N1AA 4JCLA 5GNYA 4A6GA 3PAJA 2PDPA 1JCXA 1GHRA 4HMDA 3GVVA 4WD0A 1KFKA 1GOXA 4KGLA 4PSPA 3BV7A 1CIUA 3KL5A 3P81A 4QAWA 4KCTA 4LUSA 4P7NA 4HVXA 2OPJA 3OYZA 1M9HA 3MSRA 4I6VA 1Q6OA 4QG9A 1ISWA 3L66A 5CPQA 3HPAA 3RLHA 1NVMA 4AZIA 4RKAA 4F9JA 1K9TA 1BVNP 4ZTXA 1WAUA 3KEHA 3WQ8A 3UG4A 4D6HA 3B8TA 1GJUA 3IIXA 1E15A 3FAWA 2D73A 2PGFA 2PD9A 1RCXB 1RPKA 1JNDA 4Q8OA 3LCLA 3M0HA 2ZXDA 2ICSA 5F7UA 2B7OA 3KBVA 3GNOA 3KHJA 1FWCC 3AYTA 3JVAA 2WMHA 4US5A 3S2JA 2NXIA 3CU2A 8XIMA 3PB0A 4CEXC 1W9XA 2ASHA 4GQBA 2ZZ1A 3GSMA 4HSHA 3DI1A 1MSSA 2BGQA 1E4IA 1V7AA 4LQ1A 1EA0A 3TMLA 1F07A 1AD4A 3MUIA 1OSEA 3W88A 2NWRA 3UJRA 3PTDA 2OZ8A 4GVHA 1YXDA 3TKFA 1XRTA 1U1HA 3WLKX 3OGVA 4GJIA 1IEXA 4B4HA 3GVRA 4GI8A 4IJBA 1FWJC 5KEZA 4DWSD 4R33A 4CCDA 4YVPA 1RXOB 4B5VA 4XAPA 4C6QA 4RV3A 4A8RA 4B5XA 3TYAA 3SQMA 3NQFA 5EBUA 1P7TA 3A12A 1EH9A 1W1IE 3POCA 3VFLA 1DKWA 3A47A 3BW4A 2NX9A 3KOYA 3GG0A 4S2CA 1XL9A 2W9MA 4HOXA 3W9ZA 3PSVA 4PRTA 3GDRA 5HJYA 1TVNA 3TOYA 5I2UA 1SMAA 3N2OA 1MQRA 4WJXA 2G0WA 2YGYA 3VAVA 4C65A 1RPXA 3W73A 5JIWA 1BXBA 3BQ6A 4BR1A 5XIAA 4YTRA 2CETA 3M5XA 3UJFA 1EX1A 2R1PA 1AZ1A 1NOWA 3AUJA 1JULA 3WD0A 4W7WA 5XIMA 3LYEA 3SURA 3CUFA 1UD5A 1EF2A 2ZUVA 3E38A 1NP0A 3CAWA 2PE4A 2OLSA 3M0VA 2OELA 1AW1A 4PRWA 4HPNA 3A9BA 3RLUA 3OG3A 3VNKA 1OK4A 2E28A 1QI3A 4QX4A 3MO4A 3AC0A 1XIJA 5JBFA 3RO6A 5BRQA 4DAIA 2WZMA 5EMMA 1G7VA 1R30A 4Q4SA 1WAWA 1FY6A 3MMWA 1EC9A 5CH9A 1EA9C 4KFPA 2ON3A 3G5EA 2DZXA 2ZRYA 1A53A 2HBVA 4KESA 3RLVA 2ZXQA 2ZUWA 4AIEA 4F2TA 1KNWA 2VJXA 3QC3A 4DWSA 4HSNA 3R7MA 4UBPC 3OPSA 3QSRA 4DWSB 2ZRUA 4MB3A 4GINA 4HPGA 2IPFA 2D24A 4P2VA 5KZ6A 3CK5A 4XZMX 1S2TA 3N15A 3B8SA 1XIMA 2UZ9A 2VR2A 4A8IA 2JEQA 2GGHA 1H62A 1MW2A 1LQAA 2XH0A 4KWWA 2PI6A 1G5AA 3FX4A 2VGGA 5I79A 1JI2A 4AD2A 4Q6JA 4NSBA 4Z1DA 3FHAA 1XLCA 3GXIA 3W1MA 1EZ2A 4LRSA 3Q4DA 4E5TA 1J4EA 1IEVA 1OABA 1BYDA 1J6PA 1MI3A 4JIRA 1R3TA 4ZOAA 2TPSA 2R1LA 4JQ3A 3HGOA 1R6WA 2C71A 1B1YA 4C90A 3ARVA 3I7SA 1KM1A 3GVGA 3TN3A 1ZS2A 3M0LA 2P50A 5A2BA 1QXLA 4R3UA 1MZHA 4GGBA 1A5AA 3LEPA 3G2GA 3LMZA 1SZRA 1P1MA 4D1JA 1WZMA 1ADDA 3R8HA 1AD1A 2VC9A 2ZC1A 1P7TB 4AY7A 1AQ0A 1J2WA 1PZ1A 2FFIA 4CD5A 4G7FA 4GKLA 4UFLA 3VGHA 3PZVA 3KVLA 3AMKA 1MNZA 4DZAA 3H7VA 4YYFA 1AMKA 3LBMA 4G5DA 1XH1A 3FJNA 1O7AA 5A6LA 5MKGA 4DHGA 4O16A 4KWUA 3ZLHA 2V2CA 3FEMA 1FBAA 3T0AA 1NOFA 4J5NA 3PTQA 1W9BM 1JG9A 5DRCA 3P0WA 1QNRA 4PTNA 3N19B 3UWWA 1HKMA 3TN4A 4UQDA 2DJLA 3CO8A 4G7EB 3W72A 1F05A 2BVDA 3K8LA 3CUXA 2ZXAA 4DBSA 3HU7A 2GJLA 2QAFA 5C9ZA 3UERA 4GY1A 2OCZA 3CIVA 1SZFA 4HCHA 5XINA 1ELSA 1OFDA 1Q7MA 1QFEA 1XDMA 3WQ5A 3R0KA 3NDYA 1XIEA 3P6LA 5A8MA 1SFSA 3KDNA 4B3LA 2WC3A 1KFEA 1E56A 4AEEA 4CU8A 3LS9A 2Z0IA 2QKFA 2WCAA 3PZMA 5D37A 3M7WA 3FKKA 1JDCA 4V27A 2OYKA 4QG6A 2YYUA 4LRTA 2AGTA 1S5VA 4QS5A 1AJZA 4Y8EA 4XD3A 3MO7A 2PTZA 2PODA 2CU0A 2QMKA 1H5YA 5LZLA 2JQXA 3QC0A 3S8HA 2YYTA 4AISA 4MDOA 4DUXA 4AC7C 3P82A 1UC4A 4A2RA 2FYMA 1YYAA 2CWNA 1XQKA 1KCZA 4QR6A 3FXYA 3W1LA 1XLJA 1WB0A 4XVEA 1YPFA 3I6EA 1EPVA 4IMFA 4NAFA 3HTWA 3K8KA 1OYBA 1XLLA 1TPDA 3IV3A 3KX6A 4LU0A 1JRBA 3HURA 2C1IA 3WJWA 1GPWA 2AMGA 1ZP3A 3S6OA 5JXQA 4F3HA 1JAEA 3SCWA 3WDJA 3LX9A 3WL1A 3GYEA 4LV4A 2WC4A 4OBTA 4YS1A 5HMSA 3TFCA 2PDQA 3OVQA 3GHSA 1GQIA 2X1IA 2NQHA 3F7JA 3IJLA 3TTQA 3H2NA 4AD3A 2YXXA 3HF3A 4LSBA 3IVUA 4AF0A 1PZ0A 3ZOAA 4A35A 3EKGA 3AHZA 3VGFA 5A8NA 2OX1A 1E72M 3L68A 2Q01A 3F2DA 1ONRA 4TUFA 5A8QA 4LYKA 4O1EA 1KFJA 2NQLA 4GVFA 2ESCA 1G6CA 5CC3A 1ITQA 2D2GA 1XP3A 1PWLA 3LTSA 3EPMA 1EZWA 1E0VA 3KL3A 3TQPA 1O1HA 3R12A 4PGLA 3QR0A 5C2GA 1PO9A 1K7FA 2VGBA 1MFUA 1R8LA 5HBFA 3XINA 4ZEPA 1HJXA 2ZUUA 5FJTA 5A95A 3UY8A 2V2HA 1FWDC 3ARXA 2VC7A 4WDWA 4MIMA 1U5HA 1AG1O 4Y6GA 1FWAC 1VCFA 5CZSA 3CZLA 3REQA 4UTWA 7ENLA 3WJSA 1Z3NA 3MP3A 4GJJA 2Z1KA 2XPKA 1M7XA 4A3HA 3UXLA 2PWHA 7CGTA 1OT2A 1W9PA 4QQUA 5J5RA 2NZLA 3C8NA 3IIOA 1OFRA 1BPLB 1UHVA 1ICSA 3GXTA 3GU9A 3LTYA 4NT0A 4KIEA 2PWVA 3S1GA 3B8WA 4S3CA 3LXAA 2PA6A 1IZJA 3CS2A 5I0DA 4RLIA 1VEOA 2BHZA 4NF7A 2J8GA 2BVWA 2BY2A 4AHQA 4K38A 5A6KA 2X40A 4QEEA 1HZYA 3HV9A 1E9IA 4WY0A 3U2ZA 4ZB2A 2CLOA 2BG5A 4BF9A 2OQLA 4X60A 3FW6A 1YDNA 2IPWA 2CZEA 3MW7A 3VK5A 2FZDA 4RE3A 1BF6A 3TU9A 4QNWA 1XYAA 3N9SA 4NJJA 4PSRA 2C91A 1KV8A 3WMSA 3ZMRA 2NV1A 4PUDA 4LPCA 5A69A 1H1YA 1R38A 4BCEA 2DH3A 2YX0A 1EOMA 3BE7A 3GD6A 4NZFA 9XIAA 4O57A 1SFJA 4L9XA 4G6CA 1VJZA 3ABRA 4E4UA 5K2ZA 4JNZA 2A1YA 2YZ5A 1JZ8A 3E3HA 3F2CA 2ZXBA 1PIIA 5I78A 3ITOA 3FA5A 4ALDA 2CLPA 4H83A 1DBTA 5HUPA 3T0BA 5HQMA 1IT7A 2XH7A 1RCOB 1XLAA 3CLWA 4JN7A 1K03A 2PDIA 1OFAA 4Y2WA 1KFBA 1DV7A 2IQTA 3K5XA 2D1ZA 1IIGA 2FLIA 3A3XA 1QW8A 1NFPA 3ZT7A 4TX6A 3P62A 1G9HA 3KOZA 1AH0A 1QR7A 4AQLA 2G5WA 2GJXA 4AD0A 4MPQA 1UROA 3PWAA 4JKMA 3V3WA 5ABEA 3E6EA 2HMCA 3SM0A 2PC8A 2VOMA 4RV8A 2BB0A 3N6JA 5G2WA 4AIBA 1YBQA 1UKPA 1XBVA 3TR2A 4A4AA 1GOQA 1J8VA 4Z1CA 3F2BA 5AYXA 1XYBA 4HB7A 1X38A 5DY3A 2YCIX 4LWWA 5AOUA 1D8WA 2GWGA 3DYOA 3GH7A 2XZ9A 1TE1A 2CBIA 3NSXA 1KBJA 2VOTA 2D0FA 3VGBA 5BOFA 2ZVRA 5ABHA 1QCWA 2QCFA 2VDHA 3W3OA 1QU4A 4GFIA 4RZBA 3FS2A 4HN8A 5FAJA 4CU7A 3UPBA 1FCUA 2XIIA 4C6NA 1VGAA 4MB4A 2GOUA 3W76A 3G6MA 1OZQA 1DTUA 1NH6A 4MG4A 2P10A 4ZENA 3LXBA 3UYCA 1XIIA 4D72A 4CEUC 3M0IA 4G1NA 3WKZA 2J9YA 4WGXA 3UGVA 1XFCA 1A50A 3KS6A 4GYKA 1TMLA 7TIMA 1BXCA 1AA1B 3O6AA 3MYOA 3PWGA 4ZE5A 2H9AB 3LNMA 2Q8LA 1EJSC 2QQ6A 3E74A 4H6QA 3NIYA 3GIPA 3KBWA 4NILA 1ISZA 3DHDA 1N8FA 3W1QA 4AAJA 4O54A 3QTGA 3CUHA 3THUA 5EGRA 2XIJA 3CZGA 4GC3A 3EKLA 4M6QA 1G01A 2BY1A 1L2UA 3SUVA 1B90A 1J0ZA 3LHYA 4FR6A 3I6RA 5K7JA 1CLXA 2BP1A 4JQ1A 1SYTA 3WLHA 3V35A 1KV5A 2P8BA 2GUYA 1GG1A 4PCFA 1RD6A 2EPMX 3O07A 2GVEA 4LB3A 1VIZA 4O0KA 1QNVA 2H3BA 3HPSA 4TU1A 5D04C 3VNJA 2CZ5A 4NP7A 2PRHA 5D4YA 1VBHA 2GDQA 4QIUA 4WOQA 4OJYA 1J01A 2VRKA 4IMCA 3RR1A 1YDYA 2NSXA 3BG5A 3RPMA 4HMEA 3SEPA 3WQFA 3HMCA 1UD6A 4H8NA 5C2CA 3O6YX 1ONWA 4XV0A 4R7JA 1ZRQA 2XDFA 1I8JA 5G4EA 2VEIA 1M68A 2RH9A 3O1NA 3NQCA 4UCFA 4YTSA 1LDCA 1F74A 5HPCA 4US6A 4WDXA 4WIWA 2EPKX 4IT1A 1UWQA 1TV3A 2GVGA 2YLAA 2RGMA 1IWBA 3VGEA 4JX4A 1K8XA 2PAJA 3C56A 3WEMA 2Z2BA 2YL8A 3L5AA 3M0MA 2CKSA 2ACQA 2XVKA 3B8VA 2WB5A 2A3EA 4FIRA 3H2FA 4DNHA 4C6LA 1FDYA 2YDSA 3BAWA 4IIBA 4Z1AA 1JF5A 3HQ1A 1CB7B 1C9DA 2QVNA 2VCCA 5CGQA 2WCGA 4K68A 4F0SA 3W1RA 3QR3A 1H63A 1BTCA 3B8UA 3B3DA 2YCKX 3PHAA 1K02A 2NUYA 4TVCA 3WUBA 3AMLA 4YJ5A 2UV8G 1SZNA 4CQ9A 1HUVA 4AHOA 1GTEA 1Q6CA 4GK8A 2BX7A 3LBOA 4ZOEA 3B03A 4RUBA 2HBXA 2CBJA 1AMYA 3WNKA 4EOUA 1W3KA 2EPOA 2ZADA 4JIIX 1YPXA 4PODA 5HQLA 3NYZA 4M29A 1B30A 3WLSA 2WXDM 3PR2A 2A5HA 3BK0A 2NUXA 1DTNA 1PIFA 2WHJA 5F2IA 2GZXA 4M80A 4IMEA 3WLOA 3TCSA 1X6NA 1XV8A 3M44A 3VIKA 3BO9A 1DIDA 3DFOA 4AVFA 5HWNA 4PMNA 4W5UA 4ZB5A 1E0UA 5EMKA 2QUMA 2FHFA 3GTXA 2WOQA 4QITA 5H8PA 3DFHA 3GIQA 1I60A 3DFYA 1ZHAA 3E0LA 3UJSA 2VFFA 2YCJA 3CQKA 5IDIA 2P3ZA 3UETA 2GK1A 1T41A 4LBRA 3Q65A 1PWMA 3QY6A 4R27A 4AVOA 3SCOA 1PE1A 1UPMB 3WD2A 5A8PA 4S39A 1OX4B 5FEZA 1WZKA 3MSGA 3ZR6A 1E4LA 3CASA 3GR7A 1H0IA 1DWJM 3B05A 2RJGA 4LANA 1VCVA 1V0NA 3BARA 2P0IA 4GJ1A 1R85A 1XF0A 1KGWA 1PZ2A 5BU9A 3PK7A 1VC4A 2BMBA 4FNQA 1D3GA 2QCCA 3WMLA 1SO6A 1XLBA 3OGSA 1V6YA 3HFYA 3ONBA 3UZWA 3H6OA 1Q66A 2HZGA 2ZX5A 4M0XA 3VM5A 5DT5A 1F2JA 2WBGA 4KRTA 5IXEA 4H04A 2WVVB 4IQDA 3GU2A 5HQEA 4BKNA 3CHDA 3MVTA 4AMCA 5CG0A 2W27A 2WMJA 1GOOA 4OUIA 4B5NA 2QJNA 4X63A 2IMRA 4JNMA 4DPPA 3DAQA 5IFTA 1BKHA 4IISA 3EZ4A 8RUCA 1GKRA 5LA1A 2O0TA 3FA3A 1GZGA 3GTNA 3E2RA 4YPJA 3EPOA 2B7QA 1W3TA 5AECA 1JDFA 3PBGA 3R5EA 4AXNA 5KSWA 1DWGM 3LQLA 4O50A 3OHIA 3C2FA 1PIGA 4ZTYA 2NQZA 3S0CA 1R87A 3AS2A 1Y8BA 3E49A 3GH5A 3ABXA 2DZPA 3GTHA 3N6QA 1K3UA 1S2AA 4B9ZA 3C0JA 1CZ1A 1UOZA 2IKGA 1WKDA 3A4JA 2QIIA 3BAIA 4AB4A 2E9LA 4GLEA 3TZFA 3WUEA 3IJIA 1CGUA 3CEUA 3PG8A 2H3DA 3HM7A 4IMGA 4AEFA 3C0LA 1XSKA 4EXBA 1GQLA 5C7VA 1JRCA 4MWAA 1SJAA 4NJKA 3LZ5A 1UYQA 3MWCA 3VC5A 4B16A 1L9WA 3C6CA 4Q6XA 4LYRA 6REQB 4ICMA 3VNIA 2XYLA 1LOQA 4H6RA 1T6MA 3NQ2A 4NJGA 3QPEA 1XGZA 3AIQA 1PKLA 4MJ2A 4OOZA 3DYPA 3G3DA 4L9ZA 4LT9A 3LNPA 2P1FA 4ZMGA 5I6SA 5AHIA 4FOUA 1EEXA 2RKXA 2PDXA 4D8AA 3VOCA 3TNOA 3IV8A 4E3TA 2ZUSA 1XLMA 1H49A 5I00A 3VKCA 4EPDC 4N6FA 2VZSA 3ABOA 1HJSA 4RJEA 1UBPC 3M5VA 3WMCA 2DZTA 2DSVA 4CUCA 1OF6A 2C6QA 4ZBCA 2C8NA 3FY1A 1TWIA 2PDUA 4KFNA 3PJXA 3EWXA 2X8RA 4PMZA 3R2GA 5C9UA 5KTLA 4AMAA 2NT0A 1R86A 2EG7A 2J47A 4DXKA 5ECVA 4UUIA 3HQOA 4K6AA 1YQ2A 1VLIA 2F6UA 2ZICA 4ICNA 2QCEA 2HVMA 3WF1A 2V5LA 1XXXA 3WQPA 3STCA 2Q3OA 4ATLA 3TAKA 4MWAD 1RSCA 4ML9A 1WXYA 4NJIA 4PTXA 4L1XA 3SECA 1GVEA 1HFBA 3ITGA 3FLUA 3VIMA 4H9MA 3M6YA 2BASA 4OU1A 3WLQA 3LCIA 2QCGA 3MV01 4E8CA 4QCFA 4EF9A 3PVFA 3IJ8A 1QNQA 3CV7A 1OX4A 1C8QA 1XLFA 2IKJA 4J3WA 4L6HA 4UFIA 1TPC1 1KRCC 3AXKA 2R94A 4ZODA 3GVWA 4JEJA 1W0MA 3BMWA 2EXOA 3A4WA 4RZ5A 1FWSA 3WLLA 3W6YA 3UXAA 3M0ZA 3K8MA 1HN1A 1FHUA 3MDUA 4G8TA 3GB6A 3KLKA 1UASA 1VQTA 2UY2A 4ACZB 2YLLA 4O28A 2XFWA 3U2CA 4C6IA 5HWJA 1XG3A 3AHVA 3V4BA 4LUSB 3WH6A 4LBSA 2IXVA 4JYDA 1XCWA 3SSJA 5D33A 1T8XA 4HK5A 2A6NA 4IQEA 4KF1A 4CKQA 4DELA 1VR6A 1ZBCA 3O6DA 3CL7A 3DHPA 5CLTA 3DZ1A 4FZIA 4IICA 4CD6A 4FO4A 2RDTA 1PDZA 4C7DA 2JEPA 1CXEA 1K4GA 4BEQA 4X0NA 2LLEA 4GGHA 4HOWA 2P8CA 4TTGA 3EA1A 1CXKA 2QZRA 4MKSA 5KITA 4PB5A 4IIGA 4ZCWA 5AC7A 2QPXA 1KKRA 1KM6A 3IJDA 2QHAA 5M3WA 3GU1A 3ANYA 2X2YA 1Q6EA 4PB4A 3KZPA 3WBXA 1AL8A 3DKLA 2EG6A 4A2SA 1M53A 5GQBA 1AZ2A 3G6LA 1BYBA 1QPOA 2BSLA 4ZQMA 5CGMA 2BVTA 5K9DA 2CPUA 2DEPA 1HL2A 4BF7A 4DO5A 1O95A 1ZL1A 4PCSA 5E0KA 4YCOA 5I3FA 3VKDA 5BCAA 2AOSA 4EXQA 2CNCA 1U2YA 1JEZA 4MTVA 4BHYA 5FJIA 3RGTA 2OWXA 3KS5A 1KFWA 2TYSA 4Q3MA 3SRHA 1G4SA 3A21A 1O66A 4FEZA 1P1XA 2YBTA 2HS8A 3PZQA 3L4UA 6ENLA 4NAEB 1LOSA 3O3RA 5TD4A 4MADA 1FOBA 1TPFA 2JE8A 4Q4QA 4XBSA 1ISVA 2HEJA 4RCXA 3R4IA 3W6LA 3Q2DA 1VPQA 4D6GA 3IK2A 4A8NA 3S9IA 3G1YA 4UTLA 1NTHA 1R5YA 4YWIA 2QNEA 5LKYA 3NQ6A 5C54A 4Y9NA 4J2MA 3ZLGA 4I9TA 4I7VA 2V81A 4JTLA 4K36A 4IM4A 3DERA 4F0HA 4HNVA 4P7QA 3S1UA 2VP8A 3OGRA 2C15A 5D2VA 1P6CA 5J04A 2Z00A 2WVTA 5F4XA 1GVRA 4M51A 4NYYA 3PZOA 5EKYA 1L6FA 5H1WA 3WFAA 1K1DA 3VNYA 2H9AA 1YIXA 3SIMA 3CQHA 3TCEA 3NDOA 4WXZA 1DJHA 1O94A 3T42A 3R10A 1N8IA 5G2HA 3W1PA 3AHTA 2J78A 3IEBA 3QJAA 1OGBA 2CLEA 1A3WA 2XIMA 3BGAA 1H4PA 5LIUX 2H8XA 1KM2A 2VT0A 1SU5A 1Z41A 5F1VA 3CAKA 1CX9A 2GJXB 1VIWA 3V0UA 3ABZA 1BYCA 3AIWA 3PBUA 3WQWA 1DQUA 1F3WA 1GOIA 1LLOA 3OLDA 4I5RA 2PDNA 1NDWA 4FXSA 4TV5A 3E9AA 3GDTA 3ZIZA 1SZGA 4K8EA 5HXMA 4B3ZA 3DN5A 3CUZA 3ONCA 1T7LA 2ZDSA 3NO5A 1JPDX 2W61A 3LM7A 2Q8XA 4Z2JA 5CCZA 4NZ4A 3HV8A 1B3ZA 1R3VA 2E09A 1VHCA 3OZYA 4BFAA 4O18A 3BAXA 1CCWB 1YPIA 1E6ZA 2AQOA 3T4CA 4LALA 9RUBA 3OG2A 3NVTA 3W7EA 3T4WA 2Q71A 1US0A 3IARA 5I5RA 3M0KA 3DBNA 3VD7A 4ENLA 2QCMA 1GEHA 3SGZA 3RMEA 7ODCA 4E0CA 3S6DA 3NVDA 3UCQA 2ISWA 1QI4A 5M2FX 1BF2A 2BOGX 4R88A 1XUZA 4XD5A 4PMJA 4IWWA 3B0VC 3IK4A 3E5PA 1S1RA 1KR1A 5CAHA 3BMVA 3P0XA 1WCGA 2CXGA 3U5UA 5EMLA 3QF0A 2RFGA 1DJQA 1G69A 1JCLA 2VZVA 3JS3A 5FEXA 2QIWA 1WBJA 2ODOA 1M41A 1DP0A 3UWZA 1DWAM 5EBAA 4M82A 3R1ZA 1GNXA 3EWWA 3S9YA 1XIGA 2ONEA 5F2MA 3AISA 4WVXA 3UJEA 4HZ6A 3LI1A 2WPBA 1YW1A 1J5SA 4PE8A 3O7UA 4WR3A 3V0TA 5H8MA 2VM8A 2R24A 3AWOA 4L61A 4UR7A 5LXEA 3P5ZA 4NQ1A 3W2LA 2OQHA 2XFRA 4H3DA 2Z7GA 3HBLA 2FMNA 3U48A 2NWSA 2PDLA 2ZYFA 2QF8A 1E6RA 2OSWA 3OODA 1EJ7L 4PMDA 4GQ0A 3BV4A 4LNYA 3EAUA 3R8GA 4IG2A 4ZO6A 2FZ8A 1D7FA 4EX4A 1KXHA 1UWSA 2X7WA 3T0TA 3BSMA 3HPZA 2RJHA 1OC5A 4GY0A 1HKWA 3ATYA 3P7YA 3PG9A 2BY0A 2HK1A 4U2ZA 1K7EA 3GG7A 3P3BA 4J3TA 4JAWA 2Q09A 2W3ZA 3BAJA 5FD0A 5D2YA 2OMAA 1UZ4A 4JL2A 3GUWA 2J27A 1W5NA 4IGSA 3FDKA 3O15A 1SR9A 4NNBA 4TX9A 3I3DA 1P0NA 2Y70A 4LC8A 3P8JA 4WSKA 3GQYA 4OE7A 3ZJ7A 3IJ7A 3AALA 4GO8A 4ES4A 3G1SA 1EJVC 1ADOA 3FFSA 4XAGA 4EACA 3NL5A 1Q6LA 3W7CA 3PPHA 2GGEA 3LHUA 3BLFA 4GQRA 4AZ6A 3UP8A 1ECEA 1DE6A 1NFGA 4KBXA 2V0TA 3DFSA 1JPIA 3QMTA 1JFXA 4ZGYA 1NDVA 3JZEA 3W2MA 3W74A 5A8GA 4X2RA 3NO1A 3SSZA 2GK1B 3T08A 3MMUA 3URBA 1PJ9A 4S23A 4H4IA 4INFA 3CYJA 2OEKA 1E43A 2QR6A 3PM6A 3NSNA 3B0XA 3HJZA 3P84A 2EBNA 4XZBA 4A3YA 3TE9A 1GYMA 1VCGA 2J62A 1IEWA 2PRMA 4G1KA 4V1XA 3SCSA 3W7QA 3QKZA 3R8RA 3TQ0A 2JBMA 3NURA 4AUBA 2I16A 4DI9A 3UESA 3PZIA 3ITTA 2JKPA 2P5NA 3DCPA 2E1WA 3FVDA 2WJFA 3EWCA 5HA7A 2QEZA 2AGKA 5CJ5A 2AAAA 3NR0A 5H6HA 1A5BA 5GJNA 3T7VA 2QYGA 3OB8A 2YFNA 3B97A 2ZRXA 2Y61A 1GWJA 2BGSA 3EKZA 5E5CA 3UR8A 3P8IA 4LUTB 4GZIA 4D2JA 3TYEA 3O8AA 4UOZA 3IANA 3GTFA 4LVFA 3GRIA 3AIVA 3WNNA 1XLHA 5C7HA 1S3TC 1XGDA 1L0PA 3W7PA 5M17A 4FR1A 4OGZA 1XPYA 3CNYA 3H7UA 3HGRA 3N2MA 4LUTA 1L8NA 1YX1A 1WZAA 4Z1BA 2C7FA 3BLLA 4ACYA 3MTWA 4J40A 1YDOA 1PX3A 3GZ3A 2I1OA 3PBWA 2ZUNA 4CNUA 4EPKA 3A9IA 2HCVA 3FVMA 5A94A 3HQNA 3EX2A 3S5SA 3WUFA 2EKCA 4HA0A 3U3HA 3FV9A 1VENA 1W3JA 2QDHA 3FHQA 2O92A 2PP3A 1ZZMA 3WF2A 4MGGA 1OY0A 4CQ8A 3GFYA 2INZA 3CIXA 1XINA 3NQ7A 1S2VA 1CT5A 3OLGA 3WNMA 1E4MM 3TN5A 4LJ3A 2Y7GA 2FB3A 5DXXA 3CB3A 3VMOA 1XH0A 1A5OC 3AZRA 3BUVA 3RR4A 3EOSA 1OWQA 1CECA 3AIEA 1TTIA 3TLQA 4HHHA 4BWLA 2ISSA 1CW2A 4ZQPA 2C16A 2CHNA 4ZO9A 2YL6A 4D8LA 3T8QA 1OFBA 1S5MA 3TEVA 3HB9A 3AOFA 4E2DA 3U0HA 4HOZA 5HANA 3OBEA 4JY8A 1OBAA 3P14A 4BI6A 1OGGA 4MZ8A 3EWUA 3LV5A 2VI0A 3B40A 4YL2A 4F0KA 1W37A 1N2VA 3VMNA 3TC6A 2PTDA 1TIWA 3DXIA 4PMYA 5K9XA 4QISA 2W5FA 1V51A 1PKMA 4GVGA 5A1AA 3ITVA 3GNNA 1T8QA 2NVDA 1THFD 3G1RA 2PP1A 4FNUA 1M65A 3VD9A 1A3HA 1UWIA 3R25A 1S2CA 4C5ZA 4CNNA 4DRSA 3GC2A 4C6FA 4RDWA 1L6SA 1A0DA 1V6TA 2G3NA 2NLIA 5CC5A 2ZZ2A 3KRUA 4WCJA 4HNOA 3OTRA 3RDKA 5BU6A 3LGGA 3R6IA 2E0PA 3RITA 2QUNA 5IM51 5I06A 1AQMA 4WJ8A 1OINA 5FSEC 1ITXA 2IKIA 3L4ZA 4N7QA 5FJRA 1T5AA 3U8GA 4V2XA 2WSKA 2ZTKA 1MDLA 3A24A 2WYSA 3WLMA 2Z1VA 2O9OA 4IFKA 4JYFA 3NQDA 5FI8A 2DZBA 2VMFA 1TV5A 4TR9A 3VO0A 4MPKA 1E6SM 3HG4A 3LBCA 1RK5A 1P6BA 3G8RA 3LCFA 4I3GA 3S1VA 3NJ3A 1QHPA 4DJDD 3TN6A 1ODZA 4LGXA 4GXMA 3VINA 2E6DA 2XIOA 4K7VA 5I3IA 3DFPA 5DQPA 2E40A 4OFCA 3W02A 2XH4A 1XM3A 2Z24A 4IPJA 4DM2A 3UR7A 4FF7A 1I9CB 2FVLA 1QTWA 3CWOX 4LAUA 3RILA 5RUBA 5E6ZA 3L7RA 3EXSA 4JN6A 3IS4A 1SO4A 3W70A 3NL3A 2CLFA 4BA0A 1RAKA 1OADA 3W87A 2ALDA 3TYUA 3MB9A 4O52A 5TBOA 2VTFA 1VYRA 2QCLA 4PC8A 4P8VA 2ZZ6A 4F66A 1XRVA 3B9DA 4JY9A 2DIKA 1PS9A 3SADA 3SJNA 2BOFX 4NASA 3VCCA 1OX5A 4KMQA 1KGUA 1TVLA 4D1IA 2VD9A 1UJPA 4IQJA 4JKKA 3KW3A 3SUUA 1RV8A 3OQEA 4PMQA 2DZWA 4P8UA 1E6QM 3FSTA 2OG9A 4J3ZA 3PUDA 4IP4A 1NWSA 3EEGA 2WQPA 2YXGA 1X39A 3II1A 5AHNA 4KRUA 2PU0A 3WFLA 3BCDA 3PZ9A 4UTFA 1R3SA 2DIEA 4GBDA 2NV9A 3GTIA 1ZENA 4Q8NA 4B4FA 1W1VA 4XZHA 3GZAA 3D3AA 3FYOA 4FXRA 5EU9A 1E1FA 4NI3A 4HA3A 3H2AA 1A0EA 2PWGA 5AKQA 4KPLA 5AYZA 5I07A 5LNWA 3MA8A 3BJTA 1EIBA 1UWUA 3UBPC 2WKGA 3QM3A 1BVZA 3PJWA 1E6NA 3VIIA 3O05A 1R9YA 2DSWA 1W5PA 4OVXA 3UU0A 1FWTA 2F9RA 5CPMA 3VYLA 3QV8A 1AK5A 4U28A 4M6PA 3QPYA 4LV9A 1IE7C 5A6JA 3ARZA 1Y5XA 1PDYA 4XSLA 1UIOA 1KXTA 3BLPX 5DX7A 5LNSA 3NOYA 4LVDA 3TDFA 1JGIA 4UMCA 3I3BA 3WJXA 3I10A 3AIBA 4I9AA 3QV9A 5HPOA 1UH3A 1RALA 4I8DA 4NVTA 4BK9A 4GVIA 3NQEA 1NOUA 3DGBA 4HNCA 3WD3A 3JUGA 3LRMA 2CHRA 1DORA 3GNPA 1IXPA 2QF7A 1OJXA 3VNZA 1MXDA 1H0GA 5HNRA 4WKAA 4AY8A 3LLFA 3KVMA 2I5GA 4PL1A 1SZEA 3IAQA 3EDKA 1AQHA 4L6OA 2PWFA 1A5UA 2WLZA 3W27A 5M5DA 4UTHA 3G1XA 2Z1WA 3CYVA 1V03A 3TSMA 3S6TA 1NWTA 1AUSL 4JTQA 3BJFA 2ACRA 3O06A 4XD6A 2FZNA 3ANUA 5D8ZA 3DBPA 1RY0A 3KHDA 3W4RA 3N18A 1RQHA 3UZZA 1I45A 1VB9A 4PFMA 3BMXA 5REQA 1JIBA 3PULA 4GZJA 3GH4A 4LH8A 2JGYA 2YIHA 4H7CA 3W00A 2VHLA 1VFOA 4E2BA 1Z9AA 1AQFA 3M64A 3TTEA 1QW9A 4DM1A 2Y24A 3CHVA 3FAXA 5DMNA 2GL5A 3S3GA 1CB2A 4AF0B 5I23A 4XZLX 1TELA 2X2GA 4GC4A 1CDGA 4HBKA 1JUEA 1OC7A 2MUCA 4B15A 1EP3A 4MYAA 1TTQA 5LNUA 3CAQA 3STFA 3MZNA 1FWHC 4CLMA 3CL6A 3XISA 4AZBA 4D71A 1G4EA 1QATA 4JCMA 4DUWA 2OU4A 4W9TA 3L2LA 3H26A 3BAYA 1XI3A 2VXNA 4FOJA 1A4LA 4E8DA 1MUMA 1VZWA 4CGTA 3C2VA 3P5YA 1RCQA 4J3SA 1S5NA 4F8XA 1TUXA 1A47A 4WSJA 3TR9A 4ATWA 1SFLA 3GXNA 1XFBA 2C14A 3STPA 1VYPX 4JFVA 4HSOA 4YLWA 1BRLB 1SGJA 5AC8A 1MNSA 3MS8A 4FSAA 1SMDA 3WQDA 3B9AA 2CLKA 2WMGA 3VOHA 2ZE0A 1H50A 5HUOA 4W8LA 4RNHA 4AZCA 5J5DA 1M04A 3BG3A 4ACZA 3N4EA 5TNVA 3SBFA 3N25A 1GJPA 1YRRA 4HT3A 4WGHA 5FEPA 1JGMA 3BC9A 3AJ7A 1N7KA 2E5CA 3LCXA 4B2DA 1KXVA 2GDVA 6TAAA 3TAOA 3LRKA 4GI6A 2OSYA 2KAUC 4HNLA 5AHFA 5AHLA 3AHXA 3WLNA 4O12A 2X1TA 5BRBA 3QY7A 4ERGA 2GGJA 1W1A1 4Q4KA 2WW5A 5T91A 1H7WA 3I6TA 2X1SA 2DQXA 2O7SA 3SAZA 3VZYA 1UMLA 1YNPA 3QXBA 4QLJA 4Z2KA 3H2EA 2I9UA 4Y96A 1UP3A 3GR4A 4FX8A 4P5UA 3UFYA 1X7FA 2P53A 2X0HA 3EBVA 4Q4MA 1LBMA 1TPWA 3DG7A 4NU7A 4XWUA 1NU5A 3LCWA 4NYUA 4RNFA 1QHZA 1V3LA 1XC4A 2QULA 1LORA 4RW3A 4W7VA 1PUDA 1QPNA 2DUZA 2Y1HA 3BOXA 3MBFA 3RMJA 3QQ0A 1GGOA 3PUEA 1L2QA 1KLZA 4ONVA 2A79A 3TV8A 3ZR5A 1UA3A 1BHGA 3OVPA 3MY9A 3N4AA 4JTRA 2RDUA 1LG1A 4PA8A 3KWSA 4PMVA 4O11A 4W86A 4B92A 3R94A 2FPYA 1IZCA 5DT7A 2IXUA 3WMBA 2V38A 5AC6A 1QO5A 4KEZA 4TVDA 5G1MA 4WSHA 4WLCA 1U5JA 1GT8A 2AKMA 3ORWA 2AMXA 3L4XA 2W62A 2XM2A 2Y8UA 5U7SA 3QLDA 2XVGA 5BYWA 1UWAA 1RY8A 4RZ6A 3SN4A 5JUVA 2OWCA 2NVAA 1VFMA 2A2IA 3PZNA 3GXDA 1GOWA 2YPIA 5LNRA 3NZQA 3CPGA 2J7BA 3CV2A 3ARUA 4IUOA 4R9OA 5E70A 5BXSA 3MP5A 1Q45A 1YXCA 2I5IA 1XC6A 3LPOA 1W3HA 5JMUA 2V67A 1PYFA 3GNXA 1FDJA 4IGHA 3ALFA 5KMYA 3QZEA 2Y62A 4FXJA 3W84A 4GI4A 3TMQA 3OW1A 4NRSA 8CGTA 1EB3A 2PDKA 3CZEA 1VFFA 3CZKA 4Q4OA 3UWUA 3BSHA 3O63A 3ARYA 3SDOA 5CPSA 3KCOA 3TQVA 2QJJA 1NDYA 2POTA 3D46A 1AVAA 4Z2IA 3WQ6A 3GHTA 4MZYA 4F9DA 2PD5A 4DN1A 4FK9A 4I5XA 2G8ZA 2YBVA 3UWYA 1T0OA 2WSRA 2V5DA 1PAMA 8A3HA 1NWUA 2OVLA 3C2EA 1TREA 3MKVA 3EDFA 5K4ZA 1Q63A 2EPNA 2WMIA 1BAGA 2DV0A 2YDQA 1F8MA 2HROA 4MYXA 3WK1A 3KBNA 4EAMA 3IJ6A 4BY3A 5GVJA 1JZ5A 2YB4A 2FFCA 1TTPA 4XO6A 4QM1A 3KM8A 3L0NA 3V75A 1CNVA 1Q3NA 4AIUA 1MDRA 5BOOA 3CB8A 3OO2A 3AZTA 4MJZA 4DBUA 5I3KA 3PN8A 3ANVA 2J75A 4FXFA 2CIPA 3ZFHA 1J9YA 4DO6A 2E9MA 4S3FA 2XH2A 3FSUA 1MFVA 1V6XA 2INFA 3M4HA 3GO2A 2CBVA 2ZA3A 5DRIA 3MUXA 4N9BA 3J7HA 1IIHA 4RXFA 5BMWA 3NM3A 3C3UA 2BS9A 1W54A 1UR0A 3VOGA 3ELFA 2EGZA 1DWHM 3B9OA 1E0XA 3L23A 3CGTA 4GZ7A 3GBDA 4MWAE 2GQ8A 2QS8A 2ZRVA 1KCXA 2VUNA 4HMCA 4WX2A 3W6MA 1QK0A 5U4NA 2G41A 4XG1A 1B4KA 5E1QA 5AZ0A 2J79A 3SQLA 3UPMA 4GIRA 5TAOA 3T2QA 4HIBA 3WSUA 3U4FA 4B5SA 4C6BA 3N4FA 3RM4A 2WC7A 2WSPA 5A2CA 1O5KA 2YKKA 3NQMA 1HJQA 3CL8A 3WENA 5CSUA 2XSXA 4UOJA 3HZ3A 4S3AA 1Y5VA 3IGHX 3ZJ6A 1EJXC 3AIUA 1TG7A 1HXJA 4S2BA 1DXFA 4LTSA 4NAFB 3ERPA 5L6UA 4CVWA 4I9MA 1FHLA 1O68A 3NZGA 2WHMA 4GD0A 4POCA 2VFIA 3G1FA 3AIRA 1TMQA 2Y88A 3CZJA 2A3BA 2MNRA 4GY7A 3ZM8A 4KWSA 3W85A 4DUOA 1ZFJA 2QUVA 3LK6A 1EIXA 4W88A 2OO6A 4TTUA 3BPWA 1U83A 1V4YA 1V08A 2YOCA 2P3EA 3PWIA 6XIMA 2ANUA 3A4AA 3B06A 4Y9MA 1Z44A 2O7QA 4JZ5A 1X98A 9CGTA 3GYCA 5AYBA 4FALA 1G94A 4UQEA 4EAYA 3TXZA 1H2JA 3CO4A 2XSBA 3OBAA 3L0GA 4HNNA 4JICA 1C90A 1NDZA 2JALA 1QOXA 2HTMA 3MDWA 2Y6ZA 4X2PA 1BLIA 3RM9A 1GVOA 4IX0A 4IX2A 2OKTA 4C6CA 1UQYA 4I7WA 1H1ZA 2E5DA 1CXLA 2W91A 1FX6A 3B4YA 1QUMA 2JK2A 1DJWA 3K4AA 4TX8A 4JTSA 2HRWA 1YLVA 2VFGA 2ZDRA 2BXVA 2OR2A 4W5ZA 3EOOA 2QCDB 2WWCA 2DZUA 4DEFA 3VOJA 5C71A 2QW5A 1SW3A 3W7HA 3NEVA 5MF5A 5AFDA 1XQLA 4LYPA 1POKA 2AL1A 4YN5A 1KCLA 1W32A 3QY8A 1HGYA 2IKHA 3G1DA 3WK2A 1D3HA 1REQB 5A6SA 4PUNA 3TYCA 3TJ4A 3FA4A 4H19A 4H9VA 1XICA 1ENUA 3OZMA 3A64A 1QT1A 1HO4A 1TV2A 2AQWA 3QPZA 2E8ZA 4CD7A 4F0MA 3PZGA 1Q13A 2FTWA 2FTPA 4H9TA 4L4PA 1PZ3A 1SO3A 3PBYA 1UIPA 3GBEA 2J77A 4HP5A 4GYPC 1GOKA 5IHSA 3ZJ8A