4C6MA

Crystal structure of the dihydroorotase domain of human cad bound to the inhibitor fluoroorotate at ph 7.0
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
363
structure length
360
Chain Sequence
b'KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGRPPPGFPGLETMLPLLLTAVEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAD PROTEIN
publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 116
structure length 360
sequence length 363
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6mA00
3G77A 2W9MA 2Z26A 3PBMA 1RK5A 4DZHA 3AUOA 5HMDA 1JGMA 2R1NA 3UF9A 4G7EA 3F2BA 3IJ6A 3F2CA 4RDYA 4G2DA 4D8LA 4IG2A 2PUZA 4IGNA 3UBPC 3QY8A 1FWGC 2DVTA 3EWDA 1KRMA 3LGGA 3OODA 4LEFA 4CQBA 2BGNE 3CAKA 4QS6A 1K1DA 2FTYA 4KIRA 4C6IA 4CEXC 1NDYA 1ZZMA 3PNZA 2VHLA 2Z2BA 3LS9A 4ICMA 1FWDC 4NI8A 2Z27A 4LAMA 3S2NA 2D2HA 2GOKA 2FFIA 5FSDC 3HTWA 3ITCA 4H9XA 1FKXA 4XAYA 3IACA 3MDWA 4H01A 4B91A 2R1MA 2O4QA 2AQVA 2HPIA 3OVGA 3A4JA 3MPGA 4C6DA 4H9UA 4E3TA 1PSCA 2ANUA 1EYWA 1P1MA 1YIXA 4IGMA 2PGFA 3LGDA 1NFGA 3IGHX 1UBPC 4GY0A 4QSFA 1R9YA 4C6BA 4AC7C 1FWHC 4R85A 4CNSA 2EG6A 3T81A 3V7PA 4DLFA 2UZ9A 1PTAA 2HBVA 2Z28A 3QGAC 4J2MA 1V79A 4XD5A 3UPMA 4QS5A 2ZC1A 3S2JA 1WXYA 4DLMA 3O7UA 5A6TC 4CNUA 3LU2A 4GX9A 3GU2A 3B0YA 2VC7A 4F0RA 4HJWA 2OQLA 4ERAA 2E25A 1POJA 1V51A 3E74A 4EP8C 4EPKA 1ITUA 3RHGA 3LSCA 4XAGA 4H9TA 3SO7A 3PANA 4BJHA 1FWEC 4KQNA 3T1GA 4GK8A 4CQDA 1R9XA 2VR2A 4YIWA 1XGEA 1EJRC 2D2GA 3MDUA 1A5KC 3K5XA 4PBFA 4DO7A 3C86A 2O4MA 4B3ZA 3A3XA 1DPMA 5FSEC 1EJVC 3EGJA 2EG8A 3ID7A 3SFWA 2FVMA 1I0BA 1ONXA 2VUNA 3F4CA 1HZYA 3NEHA 3LA4A 4DI9A 3S4TA 3LNPA 1FWAC 4IFKA 4KESA 4JOMA 1EJUC 2G3FA 1J5SA 3TNBA 4C6OA 4B92A 3S2LA 3KM8A 2GWGA 3NQBA 1M7JA 2HNHA 1P6CA 1IE7C 4HK7A 2Z4GA 1NDZA 1O5RA 3URBA 4NP7A 3B40A 4H00A 4BY3A 4DZIA 4C6LA 2Z24A 1RK6A 4QRNA 4LCRA 1NDWA 3WMLA 2PLMA 4OFCA 1K6WA 4L9XA 4C6FA 4PCPA 1POKA 2WJFA 3CJPA 4DYKA 4C6KA 5G4HC 4IFRA 3TN5A 4KEVA 1A5LC 2DVUA 4WGXA 1S3TC 1RAKA 3MSRA 3GG7A 2WM1A 3URAA 4DI8A 2I9UA 4QROA 1YBQB 2AQOA 3IARA 3K4WA 4C5ZA 3NURA 3LY0A 3QY7A 4L6DA 4H9YA 4J35A 1UIOA 2R1LA 2GWNA 1YNYA 2WJEA 3D6NA 4INFA 3GRIA 3FEQA 4GY1A 4LALA 4F0LA 1A4MA 2HPMA 4KF1A 4AQLA 2Q01A 3GUWA 4XD4A 1BF6A 3LSBA 3PNUA 4H9ZA 4NG3A 1A5MC 2R1PA 3IRSA 3URNA 4G7EB 4C6NA 4C65A 1YMYA 3EWCA 3GTFA 4XD6A 3MKVA 2QT3A 4IG2B 3URQA 4QTGA 1XRFA 3FDGA 3GTHA 3MVTA 3MVIA 4C5YA 1VFLA 2QS8A 4C6PA 3RYSA 1EF2A 4H9VA 1XRTA 4V1XA 4TQTA 1KCXA 1O12A 1UIPA 1FWBC 3O0FA 4GXWA 4RDVA 1KRBC 2CZVA 3FDKA 3F2DA 2PGRA 3IV8A 4XAZA 4J5NA 2FTWA 1M68A 2OB3A 1FKWA 4GC3A 4EPDC 2WJDA 1FWIC 3CS2A 2QVNA 1YRRA 4KERA 1FWCC 2OODA 1NDVA 2VC5A 4LAOA 1EJTC 1KRAC 4EPEC 4PE8A 1PB0A 3A3WA 4HK5A 1UMLA 2YXOA 2BB0A 2P53A 4C6MA 1J79A 3DUGA 5AKQA 4M51A 5HMEA 1M65A 1WXZA 1XWYA 2QPXA 1EZ2A 4ZSTA 1RJRA 4LAKA 4RDWA 3MTWA 1RA0A 1RA5A 3ORWA 4C6CA 4C6EA 1K70A 2YB4A 2Z25A 2DVXA 5CH9A 3AU6A 3WYZA 4GBDA 4GYFA 2ICSA 1RJPA 4XAFA 3S2MA 2PAJA 4IH3A 1J6PA 1QXLA 2RAGA 3DC8A 3R0DA 4H9MA 2Y1HA 4ZSUA 4IQJA 5HMFA 1A4LA 1ADDA 2D2JA 3ISIX 2OGJA 4CEUC 4B90A 3RCMA 4BKNA 1J6OA 3T8LA 3TN4A 1FWJC 2F6KA 4LFYA 4MUPA 4WHBA 2Z29A 3UR2A 3HM7A 1GKPA 5E5CA 2IMRA 3E3HA 2P50A 1EJXC 2GZXA 2HBXA 1ITQA 2Z00A 4WVXA 1PO9A 3GTIA 1RJQA 2I5GA 4LANA 4PCNA 2Z7GA 4GZ7A 4GOAA 5LXXA 3GU9A 2HQAA 4IFOA 4IFKB 3HPAA 2EG7A 4C60A 4C6JA 4V1YA 4GX8A 4LH8A 4GY7A 4UBPC 4I6KA 3N2CA 3OU8A 3WZ0E 2YZ5A 2GSEA 3MJMA 1GKRA 4RZBA 4Z42C 1QW7A 2UBPC 3IPWA 4KEZA 2Q09A 1FWFC 4R88A 4PBEA 2KAUC 3E2VA 4HA0A 3RN6A 4I6VA 4LCQA 2A3LA 3B0XA 4IF2A 1P6BA 3TN3A 3UR5A 2VM8A 3E0LA 3OQEA 3QGKC 4C6QA 4ERGA 3AU2A 1W1IE 4P5UA 3E38A 4RE0A 2XIOA 1E9YB 3BE7A 3OOQA 4KEUA 1A5OC 2AMXA 4UB9A 2R1KA 2YB1A 3TN6A 1A5NC 1R9ZA 4R7WA 1KRCC 4F0SA 3GU1A 1YBQA 3GIQA 2OOFA 3OJGA 4XD3A 3QY6A 4DIAA 3ICJA 1I0DA 2E1WA 4KETA 2FVKA 3GTXA 3K2GA 3F4DA 4CNTA 4ERIA 4EPBC 2Z2AA 1ONWA 1GKQA 4HK6A 1V7AA 4RDZA 1E9ZB 3PAOA 4CQCA 1V4YA 1EJWC 3JZEA 2ADAA 1V77A 3DCPA 4LCSA 4DNMA 3E0FA 3GIPA 1EJSC
chains in the Genus database with same CATH superfamily
1C8XA 5G4WA 4DZHA 1M41A 3MP3A 3UXIA 5CZTA 1F05A 3UF9A 1TIMA 3GH7A 3CB3A 2IXUA 3VX1A 3RNDA 1EOKA 1JCXA 5HOSA 1SJBA 4UTIA 2G4FA 3CAKA 3HJEA 4J3XA 1LTDA 3M0ZA 1L6YA 1UKTA 4MY8A 1FWDC 2XGIA 3MMDA 1TFVA 1AJZA 1X96A 3SQSA 2VP8A 5M3WA 4L9ZA 3WQ5A 4XAYA 2Y5SA 1R87A 1IR1A 4B91A 5LA0A 4LJ3A 4N6EA 1LZOA 4ROQA 4WY0A 4O10A 2E6FA 3GVQA 3PHAA 3NQ8A 1Z3NA 1XM3A 3BMVA 3ABQA 4P7OA 5I3GA 1JIBA 1QPOA 4EKJA 1FWHC 5KZMA 4Y9NA 2GVJA 4FF7A 1SSDA 4Q8QA 2CPUA 1BPLB 4GVHA 2O0TA 4I5UA 2ZC1A 1X7FA 4AXKA 1LQ2A 4AD5A 4P8VA 2YW3A 2FDSA 1UD6A 2VC7A 3G1XA 4YU1A 1LT8A 4CKQA 5IOBA 3M6YA 4D6HA 4FIRA 3ERPA 3ALGA 1POJA 1XDLA 2WNZA 3ABSA 1OK4A 1TX2A 1XIMA 4PL2A 4G5DA 2ZUSA 1LWHA 1R9XA 4G9PA 1QNSA 5HA7A 2PF8A 2IQDA 2CU0A 2WKLA 3VA8A 4G8TA 4OVXA 4B2DD 4DO6A 4AISA 1HO4A 5D32A 2NV2A 1UH3A 3VXGA 1DPMA 4UMAA 3KW3A 2QPSA 1VLIA 3CUGA 4L4MA 1XIIA 3R11A 3B8UA 5E9AA 1FWAC 1UOZA 4MSSA 4DJFA 2PRMA 9XIMA 3LCXA 4NILA 2HNHA 3KTCA 3URBA 2YL9A 5JVLA 1MW2A 2G95A 3SUUA 2QJHA 1FUYA 4A3HA 1JVNA 1RSCA 2NSOA 5AYZA 2ZUTA 3RIKA 4L9XA 4JFWA 4XG1A 1W3JA 3AS1A 5AYXA 4A6GA 3S9ZA 4MKVA 4DI8A 3QV9A 4IPPA 1J93A 3CZLA 1MI3A 1KWGA 4AX7A 3MW7A 1DWFM 3EMCA 4GA8A 2VEGA 1RD5A 1DJXA 1S38A 4UUIA 3DFNA 1B3OA 3H22A 2P10A 3LSBA 1UPPA 1U30A 2D22A 1P0KA 4JTCA 4E8DA 3CLMA 2WV8A 3NZPA 2YSWA 3ZZ1A 2PDFA 4PMYA 4RKAA 2V2DA 1TA3B 4ZB2A 3ZWSA 3TH6A 4DJED 1VJIA 2CIPA 3GXTA 1E6ZA 3MVIA 4C5YA 5LIUX 4GABA 2B7NA 5A95A 1BAGA 2OU4A 3N17A 2YXXA 4QE1A 3L0KA 4N9DA 4WQ6A 2BGSA 5C54A 4NZCA 3OLEA 5F4SA 1M01A 4A3YA 1WZAA 3WQVA 1VGAA 4J5NA 3EMZA 2FTWA 1OBAA 3AXKA 3M7SA 1OY0A 3E2QA 1FWCC 2FH8A 3T42A 1XYMA 1V0NA 4OECA 5BOEA 2NVAA 2P8CA 3W1RA 3PFMA 3TIMA 4EF9A 1UD4A 4GO9A 1RJRA 2QCMA 6ALDA 3RPMA 4ZCWA 4RK8A 1ZBCA 3SIMA 2EJAA 1V6XA 3STGA 4XUYA 4AYGA 2PAJA 4IH3A 4O1CA 3EMQA 2Y1HA 1B4KA 1OF6A 5C9ZA 4E38A 2WZIA 3TTOA 3W23A 1U1HA 2OGJA 4MVAA 3WF3A 3R0KA 2PDUA 3GNPA 2CXEA 3AUJA 4UOJA 1HW6A 4M81A 3DGBA 3TA6A 4MZ1A 3B4UA 2A3CA 4H83A 3N3TA 3HM7A 1GKPA 2EQDA 4LTSA 3RK8A 4C1NB 3KXQA 1PO9A 4PA8A 4LVAA 1CXIA 4LUTB 3F03K 5EMYA 3R5EA 5LIXX 3NAVA 3PWIA 1IWPA 1JG9A 3CMGA 3KFTA 1TX0A 3WJYA 4GY7A 4I6KA 5CPSA 2QF7A 1S2VA 1XYAA 5T91A 1KM0A 3BAYA 1OX5A 2CESA 3CQ0A 2PB1A 3LXCA 2UBPC 4HHHA 4E3VA 1PX4A 2ZX6A 1GJPA 2PPGA 2KAUC 1SU5A 1Q8JA 1TTJA 2O9OA 5DMLA 3IGUA 1S39A 2OJPA 1K7XA 3QGKC 4F4RA 4MOZA 3UCCA 4F3HA 3WQDA 2PWHA 1A5OC 2E1DA 3EDKA 3CO4A 4N0RA 6TIMA 1TPVA 4JFTA 2E6AA 3OJGA 1HJSA 1ZUAX 4PFHA 1J18A 3QBUA 5F2IA 3BW3A 4W8LA 1QBBA 3K8KA 1PX3A 1R3VA 5DELA 1E4MM 4ZVJA 1DJYA 4LCSA 5EBUA 5G2WA 1XYBA 2YDQA 1ADOA 3H70A 4FOUA 2VVNA 1QWGA 5D03A 3AMGA 2Z26A 3PBMA 5A2CA 3EX3A 4US5D 1H5YA 1F3WA 1ZAIA 5D30A 3GHTA 4G7EA 4JTEA 2PDMA 2CKRA 1CDGA 3Q65A 1FWWA 3OYXA 2DSVA 1V3KA 4XIMA 1C8QA 2A4AA 2WMGA 3MO4A 3W37A 1O4UA 1HKKA 1EB3A 3SGGA 4BCEA 4QXIA 3NOEA 4O12A 3AHYA 1HVQA 1S46A 4OGZA 1R85A 4IGHA 3R8HA 3RM9A 4FB7A 5FI8A 4B2DA 5ECUA 1S1PA 3VZXA 2QCLA 1AH3A 4CU6A 1E15A 3IIZA 4WR3A 3M0HA 3WIJA 2D0HA 4GD0A 1VFOA 2OFJA 3EKZA 3CL8A 2D2OA 2C3ZA 2E9MA 4L56A 4QSFA 5BYWA 2WKJA 3MHGA 3WQFA 3B8SA 3S46A 2QVHA 3QHNA 4S1FA 2ZDRA 3UWZA 1QOQA 4DLMA 3WH6A 1W2PA 3U2OA 3KZSA 1UUOA 1IZKA 3TAKA 3PG8A 3S1UA 3LZ5A 3MT1A 3OIXA 4O17A 5IBXA 2YBVA 2J13A 3V5FA 3M07A 4ERAA 1C8VA 1P48A 1F6YA 3E74A 1LLOA 1C92A 3SO7A 2WJZA 1SQ7A 3VZZA 4J7RA 5MKGB 1LBMA 4GI4A 3T1GA 1JUBA 4GK8A 4CQDA 3CQJA 1FP8A 2GVLA 3GBEA 4YIWA 3FCPA 2PGWA 4IIGA 1A5KC 2MUCA 3L4UA 4J3UA 1EDGA 3HFTA 3KZPA 3S9YA 1TPC1 1YTDA 2VD8A 2BY0A 4ICCX 3ID7A 1GTHA 3S1VA 2FVMA 5HR6A 1OCQA 3CL7A 2DT0A 4QCFA 2VO5A 4GVFA 1AH0A 2G41A 4GBUA 3TNBA 3GHSA 1M7JA 4K37A 1WO2A 2QUUA 1OX6A 3W38A 3WDIA 3WO8A 3WLTA 4DWDA 2FJUB 3QR1A 3HGJA 4QNWA 4DJEA 4C6LA 4QE5A 3RU8X 3THCA 4WKFA 5M03A 4QCEA 2FIQA 1G4TA 3F4NA 3EOEA 2MANA 4IHCA 2VGFA 3CJPA 1DE5A 3HBLA 5G4HC 3QKEA 1JUKA 1RAKA 2GDVA 3PG9A 3N6HA 4WDUA 5BXRA 3EB4A 4EAYA 3QC0A 5HPOA 2VRQA 2Y89A 4J4KA 1XLMA 7REQA 4ZZ9A 3B06A 1VRDA 2QV4A 4M56A 4XZWA 1UG6A 3W1UA 4AD0A 4Z1BA 1TWIA 1YE4A 4Y6GA 3BSMA 3NGJA 1JNDA 1FDJA 1UR3M 1IXOA 2J47A 3SN0A 3T9PA 2RUSA 3IGXA 3BG5A 2A7PA 5A8OA 3H8AA 3GW3A 4HHLA 4NY2A 1D7FA 4AMCA 2BS9A 4KPLA 4U3AA 2QDHA 4B4HA 3C4UA 3VIIA 3ZM8A 4ML9A 2WHKA 3W7LA 3QZ6A 4RXGA 1BSLA 1AW2A 4Z1DA 1PDYA 4N9BA 1ISZA 4K36A 4O14A 3IVTA 1Q7MA 3PZMA 3AIBA 1CLKA 4FZIA 3APYA 3CAWA 3LEPA 4GQRA 5FEXA 4PRWA 4B5NA 1VS1A 3WLLA 5I5RA 4GUHA 4Z0JA 5I06A 1RCOB 3GWQA 4IJRA 3WBWA 4F9JA 3T0BA 4L65A 4OV9A 4IIEA 4B5WA 4KBXA 1XIGA 2R82A 1KRAC 1WDPA 4A22A 3B8VA 3ARQA 5CPNA 2VEMA 3QLDA 3WUFA 3AXIA 4HNVA 2XIIA 3CIXA 3N1AA 2JIEA 3M4HA 1US3A 4BWLC 4KCUA 2E67A 3WENA 3DFOA 2FDMA 3TLQA 1B54A 4GH3A 2ZUVA 2KX9A 5HAOA 2QCCA 3WDPP 3LZ3A 2XWDA 1RJPA 3L0NA 4H7ZA 4NAEA 2BOGX 3MP4A 2CLEA 1OFAA 2IS7A 1R2SA 4TXEA 3ITTA 5HNTA 3NZGA 3QMTA 3WF1A 4K68A 3C3UA 3UNTA 4IMDA 3B8DA 2CZFA 2PWFA 1B3YA 2DZTA 2F6KA 2QCEA 1BYBA 4TX8A 1A0DA 3I3DA 2OYKA 3I7QA 1E4LA 4ICNA 3KRSA 3O05A 3WFLA 5D05A 2Z00A 1CT5A 5DXYA 1XG4A 3BJTA 4UC5A 3KBSA 1KBKA 3ANYA 5G2IA 1R3TA 4GZ7A 3BG9A 3TCSA 3LCGA 4ZR8A 1W3KA 5EMMA 2EF9A 2VQTA 3VZYA 3UQNA 1DWJM 1O95A 1SZRA 1W9PA 1S5VA 4NJIA 4FLOA 2QGYA 2QGHA 3STFA 4AVNA 3AZTA 3NZRA 4DHGA 2AMXA 4HYVA 3CUZA 4LAZA 3FVMA 1TKKA 3P2VA 3GU1A 2NVCA 5CCZA 3AS3A 3STEA 5AZ1A 1VYSX 3P0XA 4GPNA 4QISA 3JS3A 2ISWA 3WJXA 2YL5A 1LORA 3JU2A 1OG0A 3GUGA 3NM1A 5I2UA 1GZJA 3ITLA 3L4WA 4PMUA 1TPEA 3CPGA 4HCLA 1WAWA 1ZRQA 3AC0A 3UGVA 2PTZA 3M9YA 4QM1A 4A3QA 1V3LA 1GONA 4AF0A 3UP8A 2GVYA 3VFCA 4XO7A 2DP3A 1PCKA 4LEFA 3BPWA 4GZJA 1JD7A 4QS6A 3CK5A 1K1DA 2NX3A 2CFFA 1ISVA 3OHIA 5M1TA 2CW6A 3NTYA 3I3BA 2XN2A 2YLLA 4DY1A 3ATYA 1LG1A 1KKRA 2PD5A 2WNQA 4HA1A 4QITA 2ZCGA 4D1IA 2GUUA 4XVEA 1ME8A 4IUGA 1GW9A 2J27A 4S3JA 3V3WA 2AQVA 1W2VA 1JXJA 4GUFA 1YDNA 3ZYZA 3C0JA 3HU7A 3T8QA 4D8AA 3P5YA 4HPXA 2CETA 1DQUA 4JKLA 5ENLA 3LGDA 2VURA 3O06A 4Q22A 4CNSA 2ATSA 1UBSA 3V7PA 4DLFA 3HQOA 3N6QA 5DT7A 3ME3A 4GJJA 3ARSA 2I9EA 3QSTA 2BV9A 4LYPA 1Q6GA 1W1YA 1OF8A 3GSMA 4IMCA 3ITXA 2DSWA 1XLBA 3TZFA 3IK4A 1HGYA 1Y5WA 4MHBA 1G1YA 4H9TA 1PZ0A 4HNUA 1KLZA 3FYYA 5AC5A 1E1FA 3L0GA 4ZQCA 3HQ1A 4P2VA 1BHGA 4RE3A 2CBUA 4GHRA 1YPFA 1L6GA 3OIHA 1QNPA 4TTUA 3S5OA 2DW6A 4Q4RA 4ZB0A 1ZCOA 1M03A 2I16A 3K4DA 2BHUA 3LTYA 4C7GA 3SFWA 2FFCA 3SGZA 1E3XA 1AMYA 1WPCA 4NRRA 1EIXA 3SCNA 3WDRA 1R2RA 4MZYA 1JFXA 3C61A 2PDXA 3UG8A 1UZHA 4HK7A 2FYMA 5MF5A 1NDZA 1H60A 2OCZA 3W07A 4RL3A 2YFOA 4O54A 4O0ZA 3ARPA 3SJ3A 3LX9A 2WSRA 1EH9A 3B03A 4TR9A 4YWIA 4ATLA 2ISVA 1VQTA 5A2BA 1HN1A 1CGWA 3VX0A 4X22A 3PZGA 4Q7NA 2WM1A 1GQJA 2VFGA 3NVDA 3VKKA 4QROA 3QOMA 3W2KA 2FGBA 4PZVA 1DVJA 3EWXA 5HUPA 3TJ4A 4YYCA 3H55A 1DJWA 1NEYA 3TLLA 5GJPA 3PBUA 3GRIA 5DRCA 1JI1A 4LALA 2J7EA 2XVLA 3XINA 1YNQA 4XD4A 2FJKA 3T0TA 4C90A 2BG5A 3PNUA 4CCCA 1KGWA 4C6NA 3GR4A 1K8CA 4XD6A 2QT3A 3S5YA 2VZVA 1QBAA 5EBAA 2H9AA 3DFSA 1E51A 2V2HA 3THQA 3GAKA 5FOOA 1UKQA 1F3TA 2C1HA 2F84A 3CV1A 3NO3A 3IEBA 4DWSD 1O12A 2A7RA 3IIXA 3TQPA 4AHPA 1UA3A 3FDKA 1I2PA 4I5XA 3FHAA 4DUVA 1XSKA 4QNEA 2NXGA 5DN1A 4J27A 1REQA 3CU2A 3BG3A 2J62A 3U3HA 3R89A 1AD4A 3P8IA 5JBDA 5EA9A 4D6CA 3GXFA 2Y8UA 1FH8A 2XSXA 2DIKA 4U5IA 2E5DA 3PPCA 5G1TA 1PWMA 3QXBA 4PBGA 4PODA 1M65A 1QVBA 2EHHA 1XLHA 4LAKA 3E2SA 5FF4A 1TTQA 3SM0A 3QPZA 2EJ1A 3FV9A 3LCFA 2CYGA 1DV7A 3M0VA 4XAFA 1RP8A 3S2MA 1QW9A 3G3DA 3H26A 2J6VA 3VOHA 2IPGA 4ZSUA 4HYWA 4Y9PA 2ZXDA 5A8MA 1FXPA 5BRPA 4DXXA 5C9WA 3BAJA 1TMLA 4WY0F 3ZXWA 3HG4A 3TU9A 2X09A 1OCBA 3ZJ8A 1TJRA 2ZXBA 3GS6A 5U7SA 1K77A 1UP3A 4NL1A 3EAUA 3IAQA 5FJJA 1CXLA 1XLAA 1B3XA 3W7MA 3GM8A 4DUWA 4PCNA 1ZALA 2Z7GA 2AL2A 3BZJA 4IFOA 1W3IA 4IFKB 3SY1A 2Y85A 2EGZA 4LNYA 4O57A 1OB0A 3N2CA 1JAEA 3SIZA 3S6TA 1QPRA 1FXQA 1CCWB 3SRKA 2VTFA 2ZDSA 5BOFA 5BZAA 4L80A 3UW6A 4A05A 3B0XA 1QATA 2FVLA 4QJ4B 2ISSA 4BR1A 5CGTA 3Q58A 1W1IE 2PI6A 4RE0A 4PMDA 1E6NA 3T4CA 2BVYA 1K6AA 1YTKA 1A5NC 1XIFA 4F8XA 5D02A 1VYPX 3QY6A 1MQQA 3WF4A 5F4WA 2UWFA 1C3FA 2PDIA 4CNTA 4L1GA 4NF7A 4LVBA 9CGTA 1X1ZA 4ADTA 2HSAA 2DZSA 1BWKA 4H7CA 2WB5A 3I6RA 1VD6A 2Q6ZA 1PWLA 6A3HA 5CJNA 1HL9A 5FL1A 5BROA 1YPXA 1O1ZA 3DI0A 1LRNA 4JKMA 4NXKA 3P8JA 3AYVA 3CH9A 3IJ6A 1ZCCA 2IUZA 4RDYA 3T4WA 1J11A 2GJNA 4IG2A 2PUZA 3EA1A 5F1VA 4D6EA 4DAIA 5CZ0A 1JDAA 4UFKA 1EC8A 5LYRA 2FTYA 3CWHA 1KM1A 1TVLA 6REQA 4A2RA 4W5UA 3PZIA 2ZRXA 3REQB 4GGBA 3OGVA 1E55A 1XSIA 1Z8AA 4XTIA 4BK9A 1H51A 3KP0A 4KIEA 1CGVA 4GNKB 4H8HA 3NL3A 2WVVA 4HNLA 4KFPA 4U31A 1JYWA 3AMLA 3A9IA 3A13A 4IL0A 2YLAA 2ZXAA 3V36A 2G8ZA 5HNNA 4C6BA 4NYYA 5C9UA 3LRKA 2V69A 1XX1A 3W7OA 3QGAC 4XSMA 4J2MA 3KRZA 4GO8A 3A5FA 3IUHA 5CGQA 5GJNA 1XRSA 1QNVA 1RVGA 3R43A 2D1ZA 3FKKA 2TYSA 3IRDA 1V3HA 2PP3A 2WQDA 2UY5A 4PUNA 4ZXOA 2PTDA 1NOUA 4U3CA 1NAL1 4GIEA 4W7VA 1W1B1 2D0GA 3NXFA 5D9NA 4Q7IA 3TYDA 2Y7GA 1XQKA 1PEZA 4O52A 4R9OA 1KM2A 2C16A 3Q67A 4B3ZA 4IX2A 3ZLFA 1ZB5A 5D2XA 5E0CA 4W9TA 5H91A 4LBRA 4GVIA 3PUOA 2E9LA 2VUNA 1NU5A 2OEKA 1M7PA 2ZVIA 4WK9A 3O6DA 1I75A 3TROA 4ZE4A 1NIUA 2PZ0A 5E1QA 2GWGA 2OLAA 3EOUA 4NU7A 5IDZA 4HMCA 3AQUA 1LBLA 5ABHA 5CGMA 3N15A 1O5RA 5FESA 4DM1A 4LV9A 2XJ7A 4QBXA 4DZIA 1AH4A 1SMAA 4ZO9A 4CQAA 4PCSA 3KBNA 4DWSA 1XH2A 4YXGA 2WKGA 3TYCA 2QDGA 1SZEA 3FGCA 4WOZA 1JDFA 1EP2A 4S3GA 3I6TA 1F73A 4A29A 1H0IA 4MF4A 3TC7A 3S42A 1OYBA 1RR2A 2NUWA 4Q8NA 3K4WA 5AC7A 4QJ1A 3LY0A 1DWGM 1OIFA 4FNRA 1XDJA 3IJQA 1UIOA 4KCWA 5L6UA 1XPYA 2J9XA 2WBKA 3SADA 1HP4A 3BVJA 2GWNA 3W7KA 3BLOA 4INFA 2EXOA 1XP3A 4WKAA 4OTKA 3ARTA 3CYJA 2DZUA 3K46A 4ZGYA 2E0PA 1FHLA 3KVJA 5GJMA 1XINA 1YDYA 3C56A 3MSYA 4J2PA 4UR8A 4O1EA 4PMJA 3QYQA 8RUCA 1Q6RA 3AYSA 1BSIA 3LTSA 3I68A 4LYKA 1FFQA 2VDGA 1UQZA 2C79A 1MQPA 2PDJA 1MYRA 3GTHA 3N4EA 2IPJA 4C6PA 3RYSA 2O9TA 3GDBA 3CV6A 2OSYA 5K4XA 2RDWA 3IVUA 4E8CA 3O0FA 3CPRA 3DHDA 2FHBA 4ALDA 3ARZA 5FJUA 4UCGA 3G1AA 4J28A 3WLQA 1KBLA 5CAKA 2WJDA 3E96A 5FF2A 2QVNA 2PTWA 2WVUA 1R0MA 1VR6A 4FOJA 3RDKA 1PZ3A 1GW1A 2WAGA 3MUZ1 4BF9A 2YDRA 4UFJA 4MWAD 2C15A 5AOUA 2JKPA 5IBXC 5I0DA 4UXDA 3DZ1A 3ZMRA 1XWYA 1H1NA 1E9LA 4UTWA 1K70A 1CZ1A 7ENLA 3HMJG 3A64A 4LPCA 2OYMA 3DERA 1G5AA 1Q2SA 5JUVA 1NWTA 3LMZA 1J5TA 4UZSA 4CEUC 5C9XA 4D6DA 3ITGA 3AIEA 4MUPA 2H8XA 2RJHA 2BTMA 1AW1A 2B0MA 1KBBA 4GKTA 2HXUA 4UQCA 3M5VA 2QUNA 1T0OA 1P4CA 4B15A 2FZ8A 3ES8A 4HOWA 3QR3A 3LHTA 3N3MA 4NNCA 2V3GA 3QW4B 5BXTA 2ZUUA 2JKAA 4W89A 3SI9A 4Y7EA 2BFGA 5DF0A 3SR7A 3W7IA 4RNHA 4UTJA 2Y0FA 4PBEA 3A12A 2RHGA 1Y5VA 1CX9A 3C3NA 1GVYA 3IV3A 3UR5A 2B81A 3N73A 2X1SA 1JZ2A 2VD9A 4AIOA 4KEUA 1FH7A 1DIEA 1WDWA 2PF0A 3SSZA 2WC3A 3UT0A 2PBOA 1BVZA 2ZWZA 3GDTA 4MB4A 2E28A 3PK7A 3A6OA 1F76A 3CZGA 3ICJA 1JCJA 1I0DA 1O7AA 4WSHA 1VC4A 4ZO6A 1W8GA 4YTTA 4DJDA 2W4XA 3ARUA 1N55A 1KFCA 1WAUA 1BQGA 3UJSA 1H4PA 1ALDA 2PCEA 4DNMA 3UWWA 3G5EA 4PB3A 3SCWA 4NZ3A 4B5SA 1LM1A 4HZ7A 3UYIA 1JXKA 4CN4A 1XGZA 3V4BA 3SB0A 3GVVA 4ZE5A 3LPGA 1VFSA 3UBPC 3WNOA 3GFZA 5I7GA 3NR0A 3O16A 3BOLA 3N18A 4YJ5A 3R12A 4ONVA 4GXPA 2HE5A 4GVGA 5AHLA 4JIPA 4LUSB 1OX4B 1OFDA 3P84A 3A3HA 2PS2A 2GOKA 5ECVA 2C0HA 1ZAHA 3WUGA 1W9XA 5T9BG 1UUMA 3OTRA 3FS2A 2BX7A 3N2XA 4HN8A 2EPKX 3MI6A 1ME7A 2DV0A 1TCMA 4RXFA 3WLOA 2HTMA 3ZT7A 1OABA 2VX7A 4EAMA 2MNRA 3NPUA 2GFTA 4L6HA 2XH7A 1UBPC 3NWRA 5D2YA 4PL1A 4RZ4A 3D3FA 2BHZA 5A5WA 3FOKA 4DAFA 2O7SA 1JZ5A 5AY7A 1KM3A 4BEQA 1KCKA 3UVIA 3QF0A 3H4WA 1GG0A 3N19B 3B0YA 5K4ZA 2PDLA 1OM0A 1H61A 1LUCB 1W9VA 2C14A 4QHRA 1FRBA 2WCSA 3K1GA 4E2DA 3LSCA 2AOSA 3IJIA 1PPIA 3B9OA 3U9IA 4NX5A 5IDIA 3LV6A 1UP2A 3C0SA 4U28A 5FKYA 1OYCA 3H2MA 1PE1A 3BGGA 3NIYA 1ZENA 2E40A 1QI0A 1AD1A 3RO6A 2Y5JA 4JTJA 1E0VA 2DQWA 2VFHA 4R5EA 3L4YA 1KNWA 4PMOA 3L4VA 5AC6A 2GSJA 4MAVA 4UTUA 5F4XA 4CCZA 3CHDA 2FMNA 4W5ZA 1CB7B 1EXPA 4WX2A 4LT9A 1LRQA 5AC4A 1IEXA 1Q6DA 5CPMA 5EMLA 2BXZA 1TWDA 2JF6A 3W27A 4BI6A 4H3DA 5BW6A 3VO0A 4J3TA 2C91A 4AEOA 3SCTA 4G6CA 2FPYA 3R94A 1E40A 2Z24A 5IRPA 2WPGA 4Z08A 5REQA 3SN1A 4OFCA 3TONA 2PEVA 1TVNA 3NNTA 5KETA 1POKA 8CGTA 4HNOA 1Q6QA 4MB1A 1GZGA 4W86A 3CZKA 2VVSA 3CEPA 2C8NA 1TG7A 4IIFA 3ARWA 3A24A 2VRJA 4NNAA 4V2XA 3A9BA 4YLWA 3VD9A 2EBNA 1BTMA 1Q6LA 1YNYA 1ODZA 3WD1A 1G67A 4MWAA 4WDWA 3AAMA 4AQLA 1DL3A 3DGRA 3DFTA 1CW2A 2I5IA 5AHFA 4P7LA 1LL7A 4Z2IA 1TREA 3IRSA 3M0KA 3U48A 3HG3A 5C7HA 1TMQA 2P1FA 4WLCA 2I56A 3FEMA 3PY2A 4C65A 3L68A 3DHFA 4S3EA 2W66A 2G50A 4AW7A 3LMYA 1W5PA 5I02A 4HNCA 1VFLA 4X60A 4QJ5B 2I17A 5T9CE 4GINA 2ZE3A 2B7PA 3BSGA 1IT8A 4X9YA 2PP0A 1Z7AA 5J5DA 3F7JA 1B3VA 3T05A 3LI0A 3S6DA 3LENA 1FKWA 1BVWA 1I60A 1YRRA 5F1UA 3PTQA 3QQ1A 5CSUA 1Q13A 1YNPA 2VCBA 3R10A 4FLQA 3BXWA 1JF6A 5A8PA 4C6MA 4WCJA 1XBYA 1DYSA 2YKKA 2Y4SA 3USZA 2C13A 4A4AA 2QPXA 1WXZA 5D8ZA 1U5JA 1CWYA 3BLKA 2FZNA 2ZICA 1XLIA 4IPLA 4ZOBA 2CZDA 3CNYA 1HKWA 5AN7A 3R1ZA 4NT0A 3NSXA 4GYFA 1F2JA 1OZMA 4NIRA 3E49A 2XIQA 3QQWA 3W28A 4PCTA 2D2JA 3RCYA 2OELA 1GYLA 1T6MA 4BKNA 1PX8A 2Z6IA 3KDNA 3N9KA 4I8DA 3UR2A 5CZJA 3KHJA 1EHNA 1LROA 3N9RA 4AXNA 1QO5A 1P0DA 3NUKA 2J8GA 3H2AA 3FHQA 3T2QA 5CC6A 5RUBA 5G1MA 5I77A 2QMKA 4L5ZA 4C7DA 1NM9A 1VF8A 5LIYX 1EJ7L 2D73A 1UH4A 1H5VA 3WUEA 3CGTA 4D72A 2GSEA 3MJMA 1HF6A 2J66A 2INEA 3SCPA 2CKSA 4Z42C 4MFEA 1DEDA 3QKZA 2XIBA 1Q45A 2ZX7A 4M24A 1XLDA 3TQ0A 1V5XA 1A5BA 2ZZ1A 1PV8A 4X2PA 4FNQA 3E2VA 1W9BM 5DFAA 4FX8A 2OZ0A 1O68A 4HCDA 3MUCA 1B30A 1SVDA 1ICSA 4AWTA 5B80A 4OBSA 3W87A 1GQNA 3KX6A 1JCTA 2GJLA 4MG4A 2R1KA 3ZT5A 4PTMA 1US0A 5LNVA 1V02A 1ZP4A 3WDHA 4B9YA 5IFPA 4JS3A 4BEUA 4DIAA 2FH6A 1XF0A 2A5HA 2YW4A 3UY8A 1RCQA 2NUYA 1HTIA 2PLKA 5AHMA 2W62A 1PIIA 2XM2A 2E6DA 3E0FA 3BLDA 3KL5A 4KRUA 5I00A 1L2QA 1XFCA 3VDHA 5FJTA 1ZU8A 5FAJA 3ZLHA 2DFAA 3W7QA 3G0UA 1TA3A 1TRDA 4G2DA 2W67A 4D8LA 4O8AA 3LXAA 2VOMA 3EB3A 5I3JA 3RM4A 1FWGC 2IKIA 3ABOA 3G8EA 5DY3A 3VUSA 1W5NA 1C7TA 4F0MA 2GYIA 3SURA 3WNMA 4GQQA 1UC4A 1G4EA 4UCFA 3VE7A 1EX1A 1DXIA 3NL5A 2Y88A 3EOSA 4AZ5A 3UNDA 1LLWA 2D2HA 1X7IA 3MI2A 3W25A 3JRKA 1E3ZA 1H7PA 3OBAA 3FX4A 4MJ4A 1B4EA 2QR6A 2R94A 2H6RA 4FNTA 4I9MA 3PFRA 3RR1A 1ODUA 3CUFA 3MSDA 2QLYA 4N9EA 4ASTA 2DZWA 4W84A 1ISXA 3W1LA 4AYSA 3VNLA 3M0MA 4BI5A 4UQEA 4JPGA 3PBGA 2OQHA 4GYPC 1XW8A 1OEPA 2GDQA 2X40A 4Q4OA 2G4JA 1UR8A 3PVFA 3WEMA 2QCDB 4PUUA 1YADA 3IS4A 3WMCA 2G96A 1I6NA 4JTUA 4Q32A 3TYZA 4P8UA 1GEQA 1J2WA 3U6WA 1SR0A 1XBZA 4KCTA 1Q2RA 5CLTA 1PL9A 4FIQA 3UETA 1P43A 2BOEX 3AOFA 4HU8A 1UB3A 4BJHA 4QE4A 4WIWA 5ABFA 3AS0A 4YMZA 3LHZA 2CBIA 1UQYA 1GOQA 3T55A 2ZRWA 2ZZ2A 1VPYA 3UEQA 3E02A 3RRXA 4ZO7A 1XIHA 3RPDA 1X6UA 3A3XA 1ME9A 3I10A 4C1NA 3P80A 5JH2A 4NASA 5B7ZA 3WQEA 4LUTA 4PMVA 4IWWA 4CCDA 1I0BA 2ISFA 4DELA 2QJJA 1H0GA 1RALA 5HJYA 4YWSA 4UTKA 4Z2KA 4F2TA 3WELA 5HWJA 3CUJA 3FSTA 5AB3A 2YIHA 1J5SA 3JZUA 1WZKA 2B31A 3CBWA 3FYPA 2GLKA 4RPPA 3NQBA 8XIMA 3IIPA 1K4GA 1IE7C 1PS9A 2A2IA 2PDQA 1SZGA 3GE7A 3MC5A 3VE9A 4JQ3A 4FK9A 3W0KA 2PWUA 3C5QA 3CV7A 3ZJKA 3R0UA 4H19A 3PSVA 3LB0A 2GK1B 3WX7A 3WK1A 2BVTA 1JDDA 1K6WA 1YXYA 3VDAA 2VMFA 3BLPX 4HPJA 1S3TC 4KCVA 3AMCA 2QF8A 2I9UA 1YBQB 1NF0A 2WC7A 1GOWA 3QY7A 4G56A 1CTNA 1JCYA 4K8GA 3C2RA 3W2LA 1QO2A 3F1QA 3WD2A 2QJNA 3UA3A 1L6FA 4HSHA 5K9CA 2J8TA 2EKGA 4GUIA 3CTLA 4A3UA 3CMFA 3EX6A 2NV1A 4C7FA 2OEMA 1KFBA 1XCXA 3MYPA 1N2VA 3ECQA 3WLMA 4Z2HA 2GL5A 4AZBA 4AD1A 1ZFJA 2D20A 2HCVA 4MNJA 3MVTA 3G1RA 1QAPA 4CN1A 1QK2A 3LLDA 2CITA 3LQGA 2Q8LA 1O94A 1O5QA 2OYLA 3W2UA 3WD4A 1OFRA 1S2CA 2AKMA 4QG6A 5BNKA 1FWIC 3NQFA 4MYXA 4KERA 1H11A 1PVNA 1WZLA 4H7VA 4JHZA 4WSJA 2QNEA 3V1HA 3C2EA 1L2UA 4QDMA 4PE8A 2YXOA 4PMXA 4XKYB 2GQ9A 3W85A 4POCA 4WJXA 4DXKA 3KL0A 4HTBA 4EK7A 3AIRA 1LOSA 2WMFA 1NFPA 2IKHA 4N4PA 1RA0A 1E1CB 1TZ9A 4PSPA 2CLFA 3TQVA 2XFYA 3AISA 3M5ZA 1Q65A 3NQDA 3TYUA 3W70A 2WANA 3PB0A 3OLIA 2P76A 2FHCA 2VFEA 1KV8A 2NT1A 2QHAA 1EC9A 3IIOA 5HQEA 3LRLA 3V0SA 2RDUA 1EUAA 4GJ1A 1E72M 5DBUA 3HA1A 2IW0A 3LUTA 1V0LA 5MKGA 4UQAA 3LM7A 4CN6A 1DKWA 3GQYA 2BMBA 5DXXA 1A3WA 5DEZA 4FPSA 1CLXA 3DDMA 3GC5A 3T0CA 4JX4A 1T40A 1LJYA 1HKMA 2VX6A 1EJXC 2HBXA 1GVIA 3U5UA 1E0TA 3WK3A 3Q2DA 4MPQA 4B5UA 3VOCA 4GOAA 2GQ8A 4H41A 3QTPA 2F38A 1TV2A 1VJSA 2WQPA 3FSUA 3BAXA 3OBEA 2E8YA 1T8QA 4Y8EA 3GXPA 4JQ1A 3HPSA 1NP0A 4O0KA 2ESCA 4OQVA 3OGRA 2Q09A 3VNYA 1FWFC 4MLJA 1OCJA 3SUVA 3RUBL 3B9EA 3T2OA 3WH9A 4M8UA 3WH7A 2PWVA 2C19A 2WLZA 1IEIA 3QOKA 1XI3A 2XIOA 3OOQA 4P61A 2OMAA 3U2ZA 3RLHA 2NV9A 1OHLA 4L4LA 1CBGA 1A80A 3CIVA 4MNKA 4MGGA 3VMOA 2PTYA 2WW5A 4JN8A 1SJDA 3W72A 1JQXA 1DJHA 3K2GA 1RXOB 5AVHA 3T44A 4KKXA 4A21A 2BSLA 3IJLA 3KS6A 1BRLB 3R8GA 1UWAA 1SO6A 3G77A 2W9MA 3WD0A 1KFEA 5H8MA 4JIIX 2R1NA 3C8FA 2GVGA 2WMJA 2Y24A 4O8RA 5GNXA 5KZEA 1VFHA 4XZHA 3W2MA 1Q7QA 1GJUA 1DXEA 2XIMA 2F2KA 1AK5A 4HPHA 4XZ9A 4GGHA 4YN5A 4MM1A 4AC1X 4KIRA 3WK0A 4GUGA 3ZT6A 4KWWA 4GQ0A 5CBJA 3FLUA 4NI8A 2Y63A 4LAMA 5J04A 3B8WA 2PA6A 4ECLA 3TMLA 2WMIA 5CJ5A 3QV6A 5H1WA 1IXQA 1GGOA 3W4RA 5I07A 4EX4A 4JDBA 2VZSA 4GY0A 1O6IA 4P8XA 4NAFB 3RF9A 3ZQ9A 3OVRA 2EPHA 4D6JA 3L5LA 2POTA 1HJXA 3M43A 3H6OA 2I14A 5EB8A 4MPKA 3GVRA 2NQHA 4M82A 2ASHA 2OQLA 4IPIA 3K13A 5FEZA 4GLEA 4X2RA 4X63A 1P7TA 1UKOA 4NKCA 1E71M 4XZNX 1WDRA 4S39A 1EO7A 4AVFA 1PHQA 2FGZA 1HL8A 4UTMA 2XH0A 1EHAA 1KGXA 3C86A 1OG6A 5FCZA 2YCEA 3WQ4A 3WNNA 2B4GA 2WK2A 3G0SA 4AAJA 4F48A 4UQDA 1E0WA 4HPNA 3RU6A 2EG8A 1Q7ZA 1Z69A 2VCCA 4MWAE 3ABXA 3F4CA 1LLZA 3SRDA 1VEOA 1LG2A 2F9RA 3NEHA 1W54A 2WBGA 2ZOXA 1EF3A 1NARA 2GQ3A 3KM8A 5CSSA 3WK2A 4KW2A 1UWSA 1QTWA 1M6JA 3GXNA 2VC9A 3THDA 4JL1A 5CPOA 2FB3A 2FLIA 2CZ5A 4ZBCA 4L4OA 1M1BA 2P88A 5HJLA 3CXOA 3FA5A 4LYQA 3VCNA 3H7UA 4L1WA 1S5MA 4DJDC 3B0UX 2DJXA 5D37A 3MSRA 1Q3NA 2TRSA 4CGTA 4JNYA 1JL8A 2QUMA 3QC3A 2VKZG 2EKCA 3L2MA 1V0KA 4LS2A 4M1RA 2R1LA 3POHA 4NVTA 3KBMA 2ZA3A 3TW7A 3LLXA 1YHTA 4EOUA 4HMDA 2PSNA 2NT0A 4OJYA 4JQ2A 3NL2A 3OVQA 4DEFA 1UROA 3O6CA 1FH9A 4BQ5A 3UJ2A 2HZGA 1XICA 4EWND 1XRFA 3FDGA 1WOAA 3BSHA 4DVOA 2QIIA 4H6EA 4Z2GA 3PTDA 2BVDA 4TQTA 4N02A 1EXBA 1ONEA 1JPIA 4GXWA 3GNRA 2XM1A 4HPGA 4M1BA 4XAZA 1KXTA 5IXEA 3VOGA 4UFHA 2XGZA 3OZPA 1V6WA 4EPDC 3STCA 1ONRA 1I1XA 3IJ7A 3LCIA 1CLVA 4XSLA 4PSRA 1EJTC 2PU1A 3G1VA 2X0SA 3MHFA 4MAZA 3WJZA 1KR0A 1J79A 1R3RA 4DF0A 5I78A 3AO0A 4FF5A 1DTNA 3DUGA 1J0JA 2NQJA 2HEJA 3HPXA 1GQIA 5XIMA 2POZA 3EDEA 5LZLA 3QPEA 3PR2A 1KQYA 1H3GA 1WV2A 3ORWA 1A3XA 3EWYA 1K9DA 4GC4A 2OZ3A 4QGCA 4BS0A 4MLRA 4RNJA 3QMSA 3ES7A 2G3MA 4FO4A 2ZUNA 4QDPA 1B57A 3CHEA 3TYAA 2ZZ6A 3PZUA 2OT1A 3P7YA 3T0DA 5KINA 1OGBA 2D69A 3V1PA 1XDMA 5A6AA 3TSBA 3MWAA 2BASA 4DPPA 1CGUA 4EVZA 4JN7A 2JKEA 3QH2A 3PP7A 1K4HA 2J75A 5A6LA 4S38A 4JTAA 3U4FA 1BXBA 3VAVA 1P1XA 3GHUA 3PZTA 4P7RA 3WUBA 1Q85A 2FPVA 2HISA 3U8GA 4V27A 4CCEA 1SFJA 1US2A 1MWOA 3U0HA 3EDFA 1G0CA 3HPAA 4WJEA 4C6JA 3TW9A 4GI9A 1CGXA 4X3ZA 3H12A 5E93A 3EXTA 3TSDA 1HQTA 3WDQA 1TVPA 4XBKA 4QLKA 4HHPA 3RMEA 3CV2A 1U5HA 3E0WA 1BGAA 2DSKA 2ODOA 3ZR4A 3OBKA 3L2IA 3TWBA 2VM8A 2W6RA 4C6QA 1KFKA 3W75A 1JNEA 2Q3RA 5D9MA 1NOWA 1P5BA 2J7CA 3G1YA 4UB9A 1MVYA 2G3JA 3BGJA 3AIVA 3B9NA 5LNRA 5AECA 1TUXA 4GMEA 1WZMA 5GPRA 3NQ6A 1GK8A 4DZAA 4ZQMA 4QDWA 3IAPA 1OJXA 1ZP3A 1X1OA 3MP5A 4Q8PA 1GHSA 1P0EA 4ERIA 4EPBC 1DHPA 1I4NA 4O53A 4W4QA 4WF7A 3NQEA 5H8PA 3B8TA 4RDZA 4JTDA 3P62A 1BG4A 3ANVA 4Q33A 2VWSA 1UWIA 4ZA0A 3WY1A 1EO5A 4QLLA 2PZNA 5A6BD 3HPFA 2FZMA 1JRCA 4B4FA 2YCIX 2CEQA 2IQ0A 2XHYA 5E6ZA 1TZZA 4M6QA 2X8RA 1Z41A 5GNYA 3K30A 1R6WA 2F8QA 4KWVA 3OODA 1PZ1A 5FA5A 3IJ9A 4UQ9A 5LNUA 1UYQA 2PD9A 4KFNA 1I2RA 4NXSA 1NTHA 1F61A 2C1GA 2HNEA 2R9RA 5G1YA 2INFA 4YVVA 4QIUA 1QNQA 1QPNA 1NOFA 3WMBA 3ZR5A 2R1MA 2HPIA 3MUY1 1JZ4A 2G97A 2QW5A 4H2CA 3WD3A 4GYKA 2OSXA 4F40A 2BP1A 3WQGA 1E73M 2AAAA 1V6YA 1JCNA 5XIAA 4ENLA 1MEHA 3VCRA 4CNNA 4ZO8A 3FYOA 4FSAA 3N13A 4NJHA 2G37A 1VBUA 4JTQA 3LU2A 1GT8A 2Y7EA 3RO8A 1W3LA 4D71A 1I2NA 3M41A 4D2JA 4HJWA 3NO1A 4IMGA 1LCOA 4AVOA 1ADSA 1VYRA 3RJYA 1RY8A 4UOZA 3PANA 4IIDA 1F74A 4QEEA 2NX1A 4QQ3A 5M17A 3OPSA 3LD5A 4ZOAA 2WLYA 4QSHA 3GKAA 1R7AA 1EJRC 4P7QA 2A3AA 3VGFA 5AVNA 3W86A 5J5RA 2V5LA 3BZGA 1V6VA 5E0KA 2VRKA 1NF7A 2JGYA 4J1OA 1W9UA 5ABTA 1PXGA 4XO6A 2ZRUA 1L8NA 4IJCA 5EKYA 4AZ6A 4FLSA 3UVAA 1RUSA 4IFKA 1WE5A 4JOMA 1V3MA 3TR2A 1VLWA 3S2LA 3UJFA 4U5KA 1DWIM 1VP5A 2ZADA 4YTUA 1N8IA 3TMQA 5U4NA 4JTFA 3THAA 4IJBA 5I6SA 4UQBA 1KXHA 1UD5A 4MZ8A 3UZWA 2YGYA 1SGJA 3R13A 3WMLA 4X0NA 3GR7A 1FTXA 4S3FA 4ACZB 4O1BA 5LKYA 2WJFA 4DYKA 1E6QM 4C6KA 3F5LA 1JCLA 4MNMA 3P93A 3NVTA 2QKFA 1CXKA 3P81A 3RITA 4J35A 4YTQA 5BOOA 3PJUA 1H49A 2E09A 2RFGA 5BU6A 3USBA 4O4WA 1LT7A 1V6TA 4O19A 5HINA 2BXVA 3ONBA 3T40A 1UR9A 5I3HA 1FWSA 4HYRA 4GCAA 3P67A 4Y96A 3VK5A 1QFEA 1U2YA 1SFTA 2YCLA 4AHQA 2FGLA 2ZA2A 1V8EA 2TODA 6XIMA 3H4GA 4Y9MA 3HF3A 1F3XA 3QHOA 3ZLGA 4LF1A 1KW1A 1BXNA 3OGSA 2Y6ZA 2YYUA 3VDCA 4H8VA 1HP5A 2VEKA 1UIPA 3LV5A 1EP3A 2IPFA 2W27A 2DQXA 1QWKA 3H2CA 3M6DA 3RFAA 4UTTC 3VGGA 1MMFA 3A4AA 1M68A 3VIJA 5CC7A 3U2EA 4DBEA 3VOJA 3V5OA 1F4HA 2AGTA 4DO4A 3ZWTA 4S3DA 1FCUA 4LAOA 5DT5A 3WFAA 2PTXA 4HK5A 2BB0A 3UR7A 1XRVA 4Q4KA 3NQVA 4WDTA 4YHEA 3EOLA 3R79A 4U4MA 3UWVA 1TQJA 1UA7A 5EYWA 4RCXA 3H53A 3MTWA 4CQ8A 4AZGA 3KEHA 1XUZA 3BLFA 3H54A 3CQIA 1ISWA 3GB6A 2QCFA 3OG3A 1MO0A 1HO1A 3PZQA 2CXGA 1VBRA 1TPWA 3TW6A 4ZEPA 4PMQA 4AD4A 1HVXA 2DH3A 1RVKA 3KTXA 4I9AA 3AICA 3GH4A 1GYMA 2EPMX 1G6CA 2PODA 1TWWA 1F5ZA 5EMUA 1IEQA 1FA2A 4ADUA 4LFYA 4Q4MA 1D9EA 2XTKA 4HHMA 2Q3OA 1TRIA 2XPKA 4Q8WA 1PAMA 3W82A 2INZA 3E5PA 4DX3A 2X42A 3A21A 4MNLA 4ZFMA 4EXBA 4DPQA 1H7RA 2HWGA 1NSJA 4MB3A 3PZVA 4YPJA 4WGHA 2J7DA 1DJGA 2YL8A 3HJZA 2X1IA 4LH8A 5KZDA 3CH0A 4UBPC 3W2JA 3QEZA 3QRHA 4GH1A 1Q66A 4UTHA 2V3EA 3M44A 3GLCA 5H8UA 2UY3A 2DU2A 4JAWA 5TAOA 3ZO9A 1HG3A 1VIZA 3PPGA 1ZNNA 2VL4A 2WHMA 3VD4A 4FOKA 3SY5A 4MY1A 4PB4A 3GNXA 3POCA 1E4NA 2HMCA 3BE7A 2WVVB 3U7VA 4GQGA 3QSRA 3TN6A 2NLYA 2ALDA 1BWLA 1ITXA 2WCAA 1D3HA 1GPFA 4I5RA 3W7DA 2A3EA 4US6A 1ZBWA 3G1FA 4HK6A 3MHUA 1E56A 2R14A 1V4YA 3ZSTA 2ADAA 1V77A 4DUOA 4AUBA 4AY7A 5JU6A 3H2EA 2OWWA 4DBWA 1HJUA 4E4FA 2VZTA 3QMRA 2BHYA 1E0XA 3AUOA 1LWIA 2WSQA 4JTRA 1HKIA 3F2BA 1WOBA 2V5BA 4LV4A 3F2CA 2V5DA 2ZX5A 3FNDA 3EWDA 3TAOA 3W1AA 1UP0A 3MCNA 3W76A 4WDXA 5IHRA 5EMJA 2R24A 1O1HA 3PNZA 2XINA 3PWAA 4Y2WA 1GQLA 5A6SA 4R34A 2FFIA 1T99A 1E6RA 4D8ZA 1XLCA 1ZLPA 4O18A 4HMNA 3A4JA 2YJQA 4RE2A 3MPGA 1E6PA 4ZXLA 1B9ZA 1EYWA 4PB5A 5DBTA 3AIWA 3ITOA 4KGLA 2JF7A 1R9YA 1ML1A 3T6CA 3TJLA 6TAAA 2UZ9A 1PTAA 2ZX9A 1VRXA 2HBVA 2PDKA 3UJRA 1BVNP 4FXJA 1AL7A 3O7UA 3MUIA 4DBSA 4F0HA 3NGFA 2VEIA 4RUBA 4EP8C 4EPKA 4OBRA 3NCOA 2OTDA 4MMWA 3BCDA 3CIWA 1R46A 3QHMA 3WL0A 1TQXA 2XSAA 3L23A 2R6OA 3BTNA 3VDGA 1MXSA 1AQFA 1H41A 3HGSA 2D2GA 2J77A 4JTGA 2YPIA 1AQMA 3KOFA 3VTRA 1SR9A 3AI0A 1K7EA 4AG0A 3TQKA 4KRTA 1D8CA 2YL6A 4B5XA 5C8BB 4AIEA 1EJVC 3LGEA 3LHWA 4I7VA 2V2CA 5G5IA 1DBTA 4JTHA 4XWUA 4H4IA 4DI9A 4NJKA 3S4TA 5KMYA 3N14A 3D3AA 4LB4A 4JTKA 2G3FA 3PBWA 4C6OA 4FXSA 2WXDM 3MZ2A 1BD0A 3DC0A 2WHJA 3VFLA 1A5SA 2ZZ5A 5T26A 2V81A 3FIGA 3VGHA 4PC8A 2YR1A 1WNOA 3LPFA 3L5AA 3ZR6A 1NDWA 4AZCB 2QDDA 3WLSA 3TFCA 4GFSA 1ZBKA 4TOQA 2DVUA 2VDHA 3KRUA 4WGXA 3F4WA 5AFDA 4K7YA 3CPUA 3IARA 3NURA 4TV5A 2YCJA 1Z6KA 3BOXA 5BU9A 4U2ZA 1PKMA 1MEIA 4LAUA 2OGYA 5D9PA 3VKJA 1PYMA 2ZTJA 5C0QA 7XIMA 4D9PA 4KF1A 2Q01A 4A8NA 4L1XA 2JIWA 3CWOX 3E6EA 4JTSA 1GOKA 5HQMA 3URNA 3W22A 5M5DA 1UR4A 3W1NA 1IHIA 4NYUA 3TTEA 4US5A 5FL0A 1EWEA 1IWBA 1XR2A 1H1YA 1R3YA 3SRHA 6PTDA 1QK0A 4DB7A 3APGA 1W31A 2ZUWA 1SJCA 1MDLA 3XIMA 3OQ8A 2G3NA 1IYXA 2B7QA 4J40A 1VHNA 3WQOA 1XRTA 1V08A 2CLLA 2DT3A 4S3KA 3W88A 1NFBA 3TCEA 4G1NA 1XYLA 4RDVA 4LUSA 1OX4A 1KRBC 3I7RA 4ES4A 2B7OA 2YA1A 4E2OA 4REQB 4GZEA 1W9DM 1MW1A 2PGEA 5DO8A 2YDAA 2GQAA 4GIAA 1EEXA 3DYPA 2J88A 3ANUA 1GZ1A 2J7BA 1GNXA 3UESA 1SW3A 3G1HA 4E6MA 3LXBA 3C2VA 3VKCA 3V75A 1SFLA 4Q8TA 2VZOA 1RA5A 2DZXA 4ACYA 3M47A 1U5VA 1S2TA 2Z25A 2DVXA 3BW2A 3CTTA 3NO5A 3RG6A 4XZBA 2OOGA 3KVKA 3RILA 1LUCA 2DSZA 2VGGA 3W1MA 4IPNB 4Z1CA 1FCBA 5FJIA 2W5FA 2OWCA 4JQAA 1TPFA 4WUIA 3W9ZA 3AHXA 5F7UA 4DBUA 3CQHA 3W1QA 5CZSA 3LHYA 3OO2A 8A3HA 1JDCA 1MXGA 1ELSA 4B16A 4DQWA 3C0LA 3LERA 2BODX 2P50A 1OFPA 3FA4A 3BCJA 1H50A 3O1NA 2WC4A 3FJLA 3PZ9A 1RJQA 3C0QA 4HA3A 3FJ6A 3WBEA 2DIJA 1RBLA 3GDLA 4HTYA 3ARVA 3ZS4A 4KWOA 3SCSA 4OHQA 1UKPA 3I4KA 3RN6A 4NZFA 1B90A 7TAAA 2WMKA 1M3UA 2VZUA 1V03A 3GXMA 3UD6A 5E9XA 3AU2A 3WBXA 2Q02A 2F6XA 2WSPA 2W61A 2O7QA 3WLNA 3LNMA 1T5AA 2FVKA 4IQEA 5EPDA 4Z1AA 3VKDA 5HBFA 4B5VA 4UIOA 1E9ZB 2ABBA 2V8ZA 1TIWA 3E1F1 3UXLA 4WD0A 1EJWC 3JZEA 3HPZA 1E9IA 3RLGA 3GC2A 2P0OA 5E09A 5A6KA 3BGAA 1UWRA 3RCNA 5K7JA 2NQLA 2PDCA 4NX0A 4URIA 1Q63A 3W6MA 2Z1KA 3RLVA 3D0CA 1HXJA 5EL1A 2WSYA 4JFUA 2DVTA 4DF1A 4M3PA 3H2FA 1EUNA 1G4SA 3RXZA 1XBVA 1NWRA 4Y90A 5I79A 2XVPA 4LOCA 1NDYA 4M7SA 3ELFA 1EQPA 4ICMA 4CQ9A 5A3HA 1BGGA 4HP5A 4PUKA 1HFBA 1RV8A 3O6YX 5FSDC 3HTWA 3UG4A 3G6LA 1TPB1 4FP1A 3G8RA 5I3FA 1OZQA 4Q8UA 4HU0A 1VENA 1VFUA 4LWWA 2PURA 1JAKA 3GO2A 1IT0A 1DTUA 3BQ6A 2PC8A 3KLKA 1SYTA 4ZODA 3LBOA 4C6DA 1K9FA 4E3TA 1PSCA 2ANUA 5BRQA 2EPNA 3PJWA 3Q37A 1QMLA 3TE9A 2WO5A 3DYOA 3IGHX 4H8UA 2OWXA 3S2CA 4FS9A 4RLIA 1I1WA 1QOPA 1TELA 3RLUA 2WYSA 3EKLA 3GDKA 4FNUA 2D23A 4X0VA 4P8WA 2CLMA 2JE8A 4PMRA 1OYAA 5LA1A 1AG1O 3NQ7A 2Y61A 4Q8VA 3W1XA 3N04A 1BF2A 3BANA 1EC7A 5ABEA 1EGZA 1K8XA 2VFFA 3RHGA 3IGSA 1QR7A 3M5XA 3MSGA 3L5MA 1UASA 1VBHA 3DHPA 2A6NA 4M7TA 1TO3A 4TU1A 4K1GA 4ORIA 4J3SA 1R3QA 3ITYA 1G94A 4I7UA 4PBFA 3WNLA 3O9NA 3GY1A 4PR4A 4JX5A 5FSEC 4R7JA 2QYGA 3VUPA 4GE8A 5H6HA 1ZJIA 3L4XA 4KESA 2V82A 1XBXA 3VGEA 5MHBA 1R30A 1GOOA 3CT2A 4QJ3B 1DXFA 1P6CA 3O15A 1MW0A 3NZQA 4LQ1A 3B40A 3AIQA 3OVPA 3NQCA 3ZVHB 4TVDA 4QRNA 3CQKA 4LCRA 1YDVA 2ZRZA 2NW0A 1JPMA 3W1TA 2Y8KA 4PCPA 2XZ9A 2Y62A 3TZNA 3OYZA 1OT2A 3TN5A 4A2SA 1DIKA 5AC8A 1LYXA 1JPKA 1XIDA 2OT0A 2PRHA 1W3TA 3CUXA 1XKYA 2AGKA 4XZMX 1Q8AA 4HGXA 1ECEA 2BY2A 3TSMA 3WJSA 3PUGA 4DJFC 3B05A 1EA9C 2VI0A 1V0MA 2PWGA 3N6JA 3VD3A 4D1JA 1JGIA 3QYSA 2QV5A 4GY1A 4IQDA 3UERA 3HV9A 3OZYA 2PDHA 4IQLA 1XL9A 1ZL1A 4K39A 3GX9A 2RGLA 1RLCL 5IFTA 1JFHA 1MEWA 1A5MC 2CLKA 5T8GA 1XIJA 1MW3A 3TVAA 2I1OA 1TPH1 1YMYA 4X9SA 3EWCA 3KWXA 4IP4A 3SQLA 2YX0A 1WBHA 3NA8A 4LB3A 1PDZA 1RPKA 3DH7A 3I6EA 3HN3A 4AX6A 1KCXA 3LG3A 1N7KA 4RV8A 1Z89A 3EEZA 2XIJA 1F6KA 4O28A 3NEVA 3BDKA 3RX4A 3EWBX 1PYFA 5A8QA 1PKYA 1K7FA 2VC5A 4MDPA 3W7PA 4FALA 4OZOA 1XD1A 1FBAA 3KOZA 3A3WA 3TXVA 4BF5A 4OBTA 1UCWA 3KP1A 4O1FA 3S0CA 3KBVA 2O92A 2BDQA 3W84A 1GVQA 3W7EA 2GJXB 2Y2WA 1W1ZA 4RDWA 4C6CA 4W7WA 3DESA 1EQCA 2QCDA 2FZDA 2J25A 4Q4QA 3EZ4A 4GBDA 1L8PA 3KVMA 5C6MA 3NQAA 2R91A 1CEOA 1NELA 2TAAA 4H9MA 4GNVA 1XKJA 4L4PA 4E0CA 4GNJA 4IQJA 1NH6A 4AWSA 1Z42A 3ISIX 1FHVA 4OU1A 1OWQA 3PN8A 3WLIA 2R8WA 3RCMA 2O9PA 2ON3A 3JW7A 3PTMA 4YYFA 3VILA 4WKHA 1HIZA 1RY0A 1IZCA 4FA3A 2OO6A 2CWNA 5E5CA 4DO5A 3TX9A 1FWNA 4KRZA 3GTIA 2YYTA 4O0QA 3DU0A 2OKTA 4S2CA 3B9DA 1JRBA 2X41A 5LXXA 1VPQA 3GU9A 4BI7A 2EG7A 4AIUA 4RZBA 4H6RA 3MA8A 3DXIA 3BW4A 3OG2A 5KZ6A 4OKDA 1XSJA 3S1GA 2D0FA 2PCQA 5CZKA 1XIEA 3KCJA 3N4FA 4JYDA 1OFQA 3KL3A 1DIDA 1VFMA 2ISDA 4F2BA 2GK1A 3CAQA 4P7NA 3PB2A 1ZPTA 1SO4A 1LQ0A 3TYBA 3GD6A 1XISA 3EPNA 2E6YA 4XVDA 2NXIA 2ZXQA 4R7WA 1U33A 5J8LA 1YBQA 1PTDA 2JK2A 3P61A 4JEQA 5GQBA 1TV8A 4DYEA 1PUDA 3UXAA 1RPXA 1C9DA 3WF2A 4KETA 2DY3A 3GR8A 1ONWA 4M0XA 3W7HA 5K3VA 1FCQA 3AHVA 3AHTA 1IIGA 2WZHA 4QX4A 4LRTA 4PEKA 1P0NA 3QZAA 4WXZA 3ABRA 2G3IA 2J24A 1DP0A 2ACSA 3B4YA 4WOQA 5EFDA 1JGMA 4DYJA 1DQWA 2VCAA 5D9OA 4M6UA 3S5SA 4IT1A 5GVJA 3W71A 1ZJBA 2WZMA 4M6VA 5TD4A 4BQ3A 3P60A 4JHOA 1FFRA 4UFMA 2QCHA 1CB2A 3MYOA 5ABFB 3MZNA 4CEXC 4MADA 2Z2BA 4RV3A 3GNDA 3Q94A 2Z1SA 2XVNA 4J3WA 4JQ4A 2H3BA 4J3ZA 1YW1A 2O55A 2W91A 1WYIA 2G5WA 2V67A 4LUJA 3PSWA 3O6AA 4XKYA 4IIBA 2IPWA 5KEZA 4H6QA 4OOUA 3WQWA 3MBFA 4NZ4A 1XD0A 5FAGA 1FP9A 1MZRA 2JBMA 3H24A 4AU0A 1OC5A 1E1CA 1RHCA 4IOTA 4MJMA 4V33A 1LF1A 4LVGA 3M5YA 5G2HA 3DFHA 2CERA 4AWEA 1OGGA 3B0PA 5C2CA 1WDSA 2E77A 3AYTA 3KOYA 2E25A 4I3GA 4HBKA 2CLOA 1JULA 3BAKA 4LS1A 3MY9A 1QHPA 1WXJA 4CD6A 1U1UA 4KQNA 5E0FA 5D2VA 1A53A 4HN4A 3PJXA 1IQ8A 2A0NA 3SUSA 4GIYA 1XGEA 2BGQA 2V5KA 5CSYA 2HE8A 3DENA 1GEHA 1H2JA 2YBUA 1R3SA 4CLMA 4UNLA 1THFD 3SUWA 1IEVA 4AZ7A 1BXCA 5DANA 3S83A 4W8BA 3PC0A 5DY2A 3PTKA 1HZYA 4R33A 5BWAA 3EX1A 3IUIA 4TV6A 3THUA 1VH7A 1KCZA 3EA2A 3NPVA 2A7NA 1BQCA 1V3JA 2AL1A 4B92A 5IM51 2DSUA 3FKRA 1M7XA 5DMMA 2J9ZA 4DUXA 1CENA 1JI2A 4XAPA 4YTSA 4NP7A 1FX6A 1WQ5A 2H8ZA 2FZBA 3WH8A 1EIBA 4OV4A 1RK6A 1X8CA 3ATZA 2PLMA 3CUHA 1RQEA 4PN2A 1J0ZA 1UZ1A 1VZWA 1W8SA 3FY1A 4N9CA 1W1VA 2V6AA 1QHOA 2YZRA 3VMNA 5DMNA 3GFYA 3IJ8A 2E9BA 3AALA 4FMVA 4I9TA 4L6DA 4ZMGA 3K8MA 5TBOA 2HS6A 2WJEA 3VIFA 1D3GA 3LQLA 3S6OA 1BRLA 3MV11 1M9HA 3QFWA 4MKSA 3D5HA 2X0YA 4JL2A 3MV01 3G2GA 4DJEC 2A3BA 1SO3A 4AHOA 3ENLA 3DYMA 2FKPA 2NQ5A 1XLKA 2Q8XA 1XQLA 5C71A 3AXHA 1OVDA 1A49A 5CAHA 1L6WA 1WKYA 1EX5A 2QUVA 1TWZA 3KCLA 2RGMA 3M1ZA 4PMZA 2ABAA 4H8NA 3GH5A 5D2WA 4V1XA 3PF3A 4IISA 7A3HA 1FWBC 4PH6A 1S1RA 2OG9A 4H1ZA 3VNKA 4XBJA 2DUAA 3LBCA 1DORA 3P82A 3UPBA 3CYVA 2ZZ4A 3N2TA 4CUCA 1VKFA 3BLLA 5FF3A 2W0UA 1NVMA 2XYLA 4KEMA 4LUYA 4C1KA 4EXQA 4KGJA 4NAFA 3C6CA 5HMEA 3CHFA 3NQ2A 4ZSTA 4LSBA 3UA4A 4M80A 1GOIA 1V93A 2VR4A 2PDBA 4FX7A 5HMSA 2FMOA 3S3GA 2XFWA 5HJXA 3RMJA 3LI1A 2E7FA 3AYRA 1O66A 3R25A 3SRFA 3NQMA 1MRAA 3G0XA 4K3ZA 2FZ9A 1WUEA 2VENA 3QZEA 4Z17A 3FVDA 1FWTA 1KQZA 1PIFA 4B90A 5I24A 2HVNA 2GUBA 5FF0A 1ECQA 3TN4A 4GIRA 3L21A 3N9SA 1XLGA 1C8YA 2GGEA 1SW7A 4WHBA 3T0AA 1VEMA 2CCRA 4DNHA 3CM4A 4YCOA 1AZ2A 4LVDA 5BMXA 4IGSA 3BQ5A 1UD2A 3G18A 2E5BA 1XH0A 1F8MA 1OK6A 3VC6A 2DZAA 4V1YA 3H7VA 2Z0IA 5C7VA 1J0KA 2YZ5A 3PM6A 3G22A 4ZENA 1HGWA 3HB9A 5IHSA 3QGVA 2REQB 1ZGDA 3N2MA 1UUQA 2OX4A 5DMYA 4W93A 2QDEA 3FA3A 1SMDA 4IF2A 1P6BA 1F7BA 3R58A 4P5UA 3S1WA 1Q6EA 2WMIB 3N2BA 3AHZA 3TUUA 3OA5A 3EBVA 4JYFA 1Q6CA 2X1UA 2QPUA 3H7RA 2F6UA 5F2GA 2ACUA 4AEFA 1GVSA 1JZ6A 3P5ZA 7TIMA 3P74A 4IUOA 4RW3A 1PKLA 3MMUA 5M2FX 1R86A 1MFVA 3II1A 4JTTA 2VGIA 4ROPA 1EPVA 2XFRA 4OIFA 1BEUA 4QG8A 3W26A 5SWUA 1UR2A 1EL3A 5CG0A 1WKFA 1VPXA 4GXMA 4JYEA 1IGWA 1BYCA 1HUVA 1E70M 2ZUMA 4R9XA 4ZQOA 1KRMA 3LGGA 1P7TB 4XZLX 4I90A 5HDRA 5CC3A 2BGNE 2ZBTA 2OR2A 3W7GA 1GORA 2NVDA 3RM8A 3SJNA 1QUMA 2C0AA 4DN1A 1KM4A 6ENLA 1TZ7A 3ZOAA 2WMHA 2X1TA 3TR9A 1Y0EA 5FJRA 1W3HA 2BXYA 4JXCA 3L12A 1Y7VA 1B3WA 3L67A 1K03A 1M04A 3CEUA 7CGTA 2V68A 1G69A 1SJAA 1NJJA 4FX6M 3VI2A 2OSWA 4ATDA 4IICA 4R85A 3H23A 1EZWA 3BO9A 4L9YA 3QTGA 3S9IA 2I57A 1AZ1A 4XD5A 4L7ZA 1LL4A 1WXYA 4J3VA 4F2UA 3HGRA 2AQWA 2DUZA 3GU2A 5A1AA 1W17A 2YA2A 2A21A 5AHEA 1AVAA 3WLKX 6CGTA 2HXTA 3F5JA 4FLRA 1O60A 3W3OA 1BLIA 1ZTVA 2V5JA 3GNNA 3WG6A 1FWEC 2E3ZA 2DIEA 4LS0A 4UNIA 2AAMA 4TVUA 2DGAA 1YX1A 3L7RA 3VNIA 1W37A 2DEPA 4AIBA 5HK4A 1RQHA 5FF7A 3K5XA 3Q45A 1D3CA 4N4QA 1QNOA 1E0UA 3GDRA 3WJWA 1QU4A 5K9DA 3BMXA 5FIPA 5HATA 2PDPA 4M19A 5JIWA 3FXGA 5I3KA 3COTA 1ONXA 1JR1A 4MTVA 1KFLA 2J78A 2RDTA 2JFEX 2DDXA 3LNPA 2YBTA 3O8AA 3VD5A 1CGTA 1B1YA 3VNMA 2CHNA 3UZYA 1R8LA 3G6MA 4ZQNA 5JBFA 3M0XA 3EDJA 5DQPA 1JPHA 4DRSA 1EEPA 4TMBA 2VOTA 5A69A 3BICA 1O5KA 1IV8A 3UWUA 3DG3A 1C91A 2VXNA 3V35A 4C6FA 2EEXA 4QR6A 4IFRA 4K1WA 2OQYA 1VAHA 2Y7DA 4HZ6A 3URAA 1KA9F 4OUIA 3OEXA 1D7KA 4C5ZA 4FR6A 1TV3A 1Z9AA 1JJKA 1Y5XA 4H9YA 1A50A 1MDRA 1TTPA 1NWUA 4HA4A 5A6JA 2QMJA 4R27A 3QR0A 3ALFA 2XH4A 1CXFA 4RE4A 4BFAA 4KH2A 1I9CB 3EWUA 3VDBA 4H9ZA 2UV8G 1YPIA 1YDOA 4UZUA 2J74A 2VDIA 4IZGA 3LCLA 3IIVA 4YCPA 5HWMA 4UMBA 1PCWA 4EWJA 3K1DA 3WLHA 2QXWA 4NQ1A 1X98A 2GOUA 2XH2A 3M7WA 2QS8A 4NUWA 5D4YA 1EF2A 1QOXA 3MKKA 2XDFA 3OP2A 1BKSA 2CZVA 1FVPA 3K8LA 3NG3A 3CASA 3FFSA 1XPGA 4Z2LA 4BZYA 1UPMB 1W1TA 4FNPA 3GW0A 4S23A 4JIHA 4RNFA 4EXAA 3R6IA 4JCLA 1GJWA 4CVUA 3ARRA 4WY0B 3W6LA 4GRSA 2ONEA 1KXVA 4DM2A 3UWQA 1QJWA 2NUXA 2Z1VA 2YDSA 5AKQA 1J0YA 1XJBA 3TOPA 1Z44A 3DKLA 1RH9A 1W5MA 3LK6A 3IVSA 4C6EA 3M0LA 4OOZA 1M7OA 3EWZA 2NXHA 1NP2A 2XISA 1UJPA 4IP7A 3JVAA 1SZFA 1FDYA 1IWAA 1UD3A 1A47A 2VX5A 3SAZA 5HMFA 1A4LA 3AMKA 1G7UA 3G3MA 1AW5A 1MQRA 3NQGA 2DUXA 1UOKA 4AD3A 4ZTXA 2RH9A 3PBVA 1LL6A 4K8HA 1FHDA 4QAWA 1PHWA 1D8WA 2GPTA 3EA3A 3DHUA 3ZVIA 5HNUA 2ZKMX 3U2CA 1K02A 5L9FA 4L6OA 4B9ZA 4Q8MA 2RJGA 3AWOA 2GZXA 1OFOA 1ITQA 2BY3A 4I8YA 3EPOA 2I5GA 3O07A 4HCHA 5A2AA 3OZMA 1I8JA 2HQAA 3UCDA 1EDQA 3V0TA 1VB9A 4XB3A 2HS8A 3SCUA 3WZ0E 1TSIA 1FOBA 4JY8A 1M5WA 1UWQA 4FHAA 5KITA 4LVFA 4H2HA 3MCOA 4R88A 4WSKA 1F6PA 3IK2A 4I6VA 2DZPA 1ZJHA 3D47A 4LCQA 2A3LA 5EFFA 3TN3A 1YXCA 1JD9A 4KMQA 5CBBA 3KCOA 2CHRA 2DZVA 1V3IA 4ACZA 2GDUA 3IUDA 1TJ0A 3B97A 1XGDA 4AMAA 4ZFCA 4HQVA 4ATWA 3B0VC 1DWHM 3VNJA 2QZRA 1NQ6A 2EPOA 2J7GA 3PZOA 4PGLA 1PTGA 1M53A 1XH1A 5FD0A 4HJFA 3QVQA 3WLJA 1TJPA 3GIPA 4KT2A 5DLCA 1Y8BA 4YTRA 1J10A 3BV7A 1L6SA 2PU0A 5LSMA 1KLYA 4GACA 4GYPA 1QI4A 3GZAA 2Y8VA 1KFJA 3EEGA 2IKJA 3E12A 1WUFA 4IGNA 3QY8A 4F0KA 3KOXA 2VWTA 2J79A 3BH4A 4DBDA 3BAWA 1G7VA 4HU3A 4C6IA 4QFUA 3T07A 1XLLA 2PFHA 3VGBA 1U22A 3NFUA 5D04C 5JBEA 1F07A 4HSOA 3HZ3A 4LU0A 3FXYA 1TJ2A 4MB5A 1XC4A 4B3KA 3WMSA 2NX9A 1NWSA 3B3DA 1YIXA 1VFFA 3UFYA 1C90A 1AUSL 2HK1A 4MUZA 3FJNA 1JF5A 1VBGA 3DOPA 2PWEA 3UCQA 2IQTA 4DF2A 4AH7A 2A85A 3VYLA 3I3EA 1E5NA 5CLWA 2C18A 4G1KA 5A6TC 1AL8A 3DN5A 4CNUA 3MMWA 4E2BA 3W6YA 3LCWA 5LIKX 1QCWA 3W53A 4S3BA 3TNOA 1BFNA 3IJDA 5F2LA 3BAIA 4XZIA 2JQXA 2C6QA 3SGUA 3DEQA 2X16A 2FTPA 1HL2A 3LTPA 5ABGA 3SCOA 4RPQA 1QW8A 4KS0A 1QI2A 1K9EA 3E9AA 4S3CA 4M5PA 2VEPA 3GDMA 2Y70A 3KS5A 3EXSA 5TNVA 1ZBVA 4TIMA 2RDXA 1H62A 1OIMA 3FK4A 4AY1A 1B3ZA 3KAOA 4GKLA 3LA4A 5DCDA 4JDYA 4PRTA 3W74A 4PYSA 4WJ8A 1JPDX 1CYGA 3NJ3A 4AZIA 2YCLB 5TQLA 1IZJA 3PUEA 5CSRA 9XIAA 1ZHAA 3V0UA 3VMPA 1KWKA 5LNWA 1W56A 4BY3A 3HURA 2C71A 1U1JA 3UWYA 4Q4PA 1RBOB 3UXKA 1XYZA 3L4TA 1RP9A 2X2GA 4NZ5A 3LBMA 1H7WA 5CPLA 4KEVA 1J0IA 2VYOA 4ML4A 1OC6A 1V7YA 3WNPA 5I23A 1S2AA 5C2XA 3VU2A 1LOLA 5JIPA 4LY8A 4DJDD 2W79A 3T78A 5FJOA 1WA3A 3M64A 3NDZA 2QIWA 1X1NA 2E5CA 1QT1A 3DBNA 4JN6A 1IGSA 2ACQA 3NDOA 1EYEA 4JGDA 3YPIA 4HZ8A 4F66A 4JR5A 1A3HA 2HPMA 5I09A 1CXHA 1XV8A 5I03A 1BF6A 4FNSA 3NPXA 3N11A 4NG3A 2R1PA 5AYBA 4G7EB 1XFBA 3IANA 1SM9A 2BNJA 1GWJA 3U5YA 4DZ5A 4DWSC 3R2GA 2VR5A 1WX0A 4MY9A 4JTIA 1J12A 3NPWA 3P3BA 3MB9A 1KTNA 3UZZA 4XV0A 3RRAA 5FEPA 3S1XA 3FW6A 3EX4A 3TV8A 1SFSA 1H7OA 3DIPA 3UR8A 2OB3A 1HJVA 3EXRA 5AHNA 1OD8A 3TWAA 4CVWA 2NWRA 1SUXA 1XG3A 2IXVA 4PTNA 1DHKA 1D2KA 4Z0SA 3N12A 4F9DA 4HSNA 4MIMA 3SZ8A 1VBJA 3LHVA 4O1DA 4BA0A 1JZ8A 1DJIA 3TDFA 1JDEA 3S8HA 1MRQA 3DAQA 3AFBA 2OX1A 3N29A 5FACA 3VIMA 1TTIA 1TYGA 1QDSA 1QASA 3MU7A 3XISA 1J8VA 2X7WA 3PJTA 2ICSA 4LNCA 1ZAJA 3C2YA 3S5ZA 3M0IA 3HMCA 1YKWA 2SFPA 4EACA 4Z2JA 2GGIA 1OCNA 1VHCA 4M6PA 2PBGA 2V3FA 4PUJA 5DCEA 2JEQA 1J6OA 3LM3A 3MWCA 3AWNA 4Q6XA 1XYCA 5F2MA 3AJ7A 1MUMA 1W32A 4CNPA 1S3HA 4WVXA 4AB4A 1C7SA 3GKFA 2W92A 3EYPA 1UJQA 2DH2A 4UTWC 1QI3A 3LN3A 3C8NA 1OFBA 2WHLA 3CB8A 3GIYA 4XX6A 1A5UA 1JCMP 1Q4NX 1GVOA 1I2OA 4MJZA 2PLCA 5K9XA 1G9HA 1OFEA 1A0EA 4MFDA 3DX5A 4IXHA 1JQVA 2VNCA 2OKOA 1N82A 1HX0A 3QPYA 3L65A 4LW7A 1LWJA 3GAYA 5A94A 4GJIA 3KHDA 1DJQA 4AZCA 4UR7A 1VIWA 4YS1A 3EKGA 3E0LA 3GZ3A 3K4AA 4ERGA 4KFOA 3UZXA 3GVGA 4A8LA 1L0PA 1XC6A 3KLLA 2BOFX 1KRCC 1RCXB 4FXFA 3ZSSA 3VM5A 4HMEA 1SW0A 7REQB 1B2YA 1GHRA 3DFYA 1MZHA 3SFKA 4L64A 3NYZA 3PAOA 5LGXA 3P6LA 5I3IA 5H2ZA 3BJSA 4UWMA 1T7LA 1UWUA 4JZ5A 4YNGA 4LEQA 1KR1A 3WN6A 3S47A 3ABZA 1E6XM 4LGXA 4LC8A 2YOCA 4W8AA 1S5TA 1Q6OA 1GVFA 1B9BA 5CEWA 3TTYA 4UTFA 3BARA 3W2NA 3ARXA 3P14A 3O63A 3BL3A 3VKBA 4XKMA 4IP5A 2I5QA 3A4WA 4CQBA 2CZEA 4PFMA 4CD8A 3WF0A 5LNSA 1ZZMA 1U83A 3MO7A 3CWNA 2Z27A 1XS2A 2FHFA 4REQA 4TVCA 1BG9A 4HOZA 4N42A 1MXDA 4M29A 1YQ2A 3KOWA 3OVGA 3V18A 5AYYA 2ZZ3A 4O4VA 1ZSXA 4IGMA 1X8FA 3N2OA 1Q5MA 5TIMA 3VOIA 2DT2A 3TXZA 1IEWA 3GYEA 2Z28A 2VUYA 4FXRA 4ZQRA 2NQZA 4C91A 1V79A 4LYRA 2WCGA 3B8IA 2OEJA 3TTQA 4CD7A 4O11A 1EDTA 2QAFA 4PTDA 4ORMA 3V5CA 2WZEA 3CZEA 4NAEB 2VFIA 1C29A 4F0RA 4LC6A 3AROA 1R7OA 4JFSA 1ITUA 4TX6A 3GG0A 2Q71A 2WWCA 4LBSA 3GK0A 2QEZA 3FJ4A 1KKOA 1KXQA 3N4AA 3VNZA 2KZHA 5GNZA 1XCFA 2XFFA 4GQBA 2OZTA 1W1A1 3AZRA 3Q4DA 1W5OA 4TMCA 4PRRA 3F5KA 2ZYFA 3VCCA 3N34A 3QV8A 1C9WA 1LBFA 1H7NA 1IXPA 5C9RA 4AFYA 1W0MA 1OC7A 1MUWA 1V6UA 2P8BA 1P6WA 1XCWA 1A0CA 2V38A 1EJUC 1J01A 2QUTA 2X2YA 4A8RA 2TSYA 4MJ2A 3H2OA 3L4ZA 3TOYA 4XQ6A 5B7YA 1F3EA 3M0YA 1PZ2A 4BHYA 4Z1YA 1F4AA 3WQPA 1JZ7A 4H6KA 4CD5A 3BUVA 2HV5A 3LLFA 1GCYA 2QJMA 5HNRA 3WFZA 3QQ0A 3RAOA 1HKVA 3O0KA 1GOXA 3GG7A 2BBFA 1A5AA 1JYXA 1N8FA 4UFLA 1UHVA 3EPMA 5D38A 4WXYA 1ZJAA 3KE0A 5A6MA 3MCMA 3TYEA 1V02E 2CWXA 4WZHA 4LX4A 3E5BA 1UW9A 1LOQA 7PTDA 4NZ1A 3BURA 1BKHA 1HNYA 3MBDA 4LY4A 4PMNA 3VIKA 1AODA 3UG5A 1DOSA 4JX6A 1FWRA 1A4MA 3GUWA 3EX2A 4MYAA 3RX2A 1IF2A 4GUJA 1IXNA 4HIBA 4R7OA 3D46A 4HNNA 5HPCA 3U7BA 3CHCA 4ZOEA 2ACRA 1S5NA 2YCKX 3CHVA 4B5TA 2Z2UA 4ZQPA 4AF0B 1KGUA 2FPTA 1UH2A 2BZNA 4IIHA 4IL2A 2QAPA 4UFIA 3GNOA 4N7QA 2ZX8A 4IMEA 3WQCA 2JALA 2X0HA 3SUTA 2PGRA 1F9CA 5HUOA 3IV8A 2A6LA 1TR9A 5D09A 1QPQA 3LCHA 1J2BA 4Y8FA 1Q6FA 3BMWA 3GG1A 1TB3A 4MWAC 4LF2A 5LXEA 4YHGA 5LHEA 2OODA 5LA2A 3UWEA 2TMDA 1SO5A 1HJQA 4EPEC 1J4EA 3W7CA 2H3DA 3VIPA 1UMLA 3PZNA 4E2VA 4JIEA 2AKZA 2D3NA 4M51A 1EP1A 1EZ2A 4QQUA 3CO8A 3GYCA 3CZ8A 3T7VA 1Z48A 4RJEA 3UGRA 2WSKA 3WYZA 3WCZA 2BVWA