4C6MA

Crystal structure of the dihydroorotase domain of human cad bound to the inhibitor fluoroorotate at ph 7.0
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
363
structure length
360
Chain Sequence
KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGRPPPGFPGLETMLPLLLTAVEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CAD PROTEIN
publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 360
sequence length 363
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6mA00
2Z7GA 4AQLA 2VHLA 4GY7A 2GWNA 4GBDA 4XAYA 1YMYA 3S2LA 3CAKA 1WXZA 2PGFA 3FEQA 4H01A 2ANUA 1R9XA 2DVTA 4KEVA 1J79A 1PO9A 4QS5A 4XD5A 3A3WA 4EPKA 1KRBC 4DZHA 4DLFA 4J35A 1J5SA 1NFGA 4CEUC 4GX9A 4DO7A 4V1XA 3PAOA 3G77A 4OFCA 3B0XA 3K5XA 3LNPA 4H9XA 4HK6A 1W1IE 3HM7A 1EJVC 1K6WA 3QGAC 4GY0A 1YRRA 2GSEA 3E0FA 1M7JA 3NURA 1EJWC 5LXXA 3MKVA 4XD3A 3B40A 3MSRA 3A3XA 4ICMA 4B91A 1UIPA 1E9YB 4C6MA 3TN6A 2HPIA 4LANA 4XAFA 2R1NA 4LCRA 3WYZA 1A4LA 1A5KC 4DYKA 2UZ9A 3R0DA 2A3LA 1IE7C 2Z24A 1RA0A 5FSEC 4B3ZA 4LFYA 3CJPA 3D6NA 3IJ6A 3IARA 3SO7A 4CQDA 3WZ0E 3UR5A 1NDZA 2XIOA 3MDWA 1VFLA 3JZEA 1POKA 4C5ZA 3OODA 4EP8C 3F2DA 2ZC1A 3OOQA 1P1MA 5A6TC 5HMFA 3GTFA 3IRSA 3AU2A 3OJGA 3URNA 3QY7A 3EWDA 4QS6A 4PBFA 1EJUC 3ISIX 4DI9A 4C6BA 4R7WA 4C6KA 4M51A 4R88A 4I6VA 1K70A 3GTHA 4TQTA 4E3TA 1UBPC 2VC7A 2D2HA 3F4DA 3SFWA 1EF2A 4V1YA 4QTGA 3TN5A 4RDWA 4CNTA 4C6JA 1O5RA 2O4QA 2VR2A 3UF9A 2YB1A 4B92A 4BJHA 2GOKA 4C6LA 4KEUA 3OVGA 2HBXA 4IFRA 1POJA 2QT3A 3GIPA 4H9YA 2PAJA 4IGMA 2Z25A 2HNHA 4C6CA 4LEFA 1PSCA 3NQBA 5G4HC 4KQNA 3E2VA 3URBA 2Z4GA 4UBPC 4BY3A 3O7UA 1EJRC 4C65A 4MUPA 1V77A 2VC5A 4C6DA 4C60A 2OB3A 4C5YA 2Y1HA 4GK8A 1RAKA 4ERGA 1QW7A 3FDGA 4J2MA 3ITCA 1NDVA 2DVUA 2O4MA 3CS2A 1KRAC 1A5OC 2EG7A 2EG8A 4WGXA 4HK7A 1ITUA 3LGGA 4GYFA 4C6OA 4LAOA 3TN4A 3A4JA 5HMDA 2EG6A 2WJDA 3HPAA 1NDYA 4PBEA 1BF6A 1FWJC 2BB0A 4IFOA 2WM1A 3PNUA 2E25A 4DIAA 3F2CA 2DVXA 2FVMA 4EPBC 3E38A 3DUGA 1FWEC 3GU2A 4H9TA 3QGKC 4DZIA 2PGRA 2FFIA 3T8LA 4GXWA 4UB9A 1A5NC 4LCQA 2R1KA 4C6FA 2Q01A 4XAZA 3F2BA 3LU2A 2W9MA 4IGNA 3V7PA 1XRTA 4QSFA 3E0LA 3GRIA 1UIOA 1FWFC 1GKPA 2Z29A 3E74A 2HBVA 2D2JA 2Z2AA 3OU8A 3DC8A 4IFKA 5E5CA 1I0BA 4F0LA 3N2CA 3IPWA 1HZYA 1ZZMA 2AMXA 1XGEA 1EYWA 3MJMA 4WVXA 2AQVA 1P6CA 2Z00A 1FWCC 2I9UA 3PANA 1QXLA 3QY6A 3MVIA 1XRFA 1PTAA 1J6OA 2IMRA 4GOAA 2R1PA 2YXOA 2ICSA 2HQAA 4GZ7A 3PBMA 4IQJA 4B90A 3NEHA 1NDWA 4H9MA 3GU1A 2D2GA 2G3FA 4CQCA 3MPGA 1FWBC 1GKRA 4JOMA 4PE8A 3ICJA 1J6PA 2R1MA 1O12A 3MDUA 4KF1A 1JGMA 4IF2A 5FSDC 1YIXA 2BGNE 4XD4A 2OGJA 4IG2B 1RJPA 3TNBA 3EGJA 4L9XA 3EWCA 2Z28A 4KEZA 3PNZA 1P6BA 3URQA 2AQOA 2QPXA 1GKQA 1YBQA 3T81A 3GU9A 3LSCA 3MVTA 4DNMA 3GUWA 1V79A 4KIRA 3RHGA 3K4WA 1ONWA 1FKXA 4CNSA 1WXYA 4IG2A 2HPMA 1V51A 4PCPA 3UBPC 4XD6A 4KETA 4HJWA 3RCMA 4KERA 1FWDC 1RK6A 1K1DA 4EPDC 3UPMA 4WHBA 2UBPC 4H00A 2R1LA 3FDKA 1M65A 4RDVA 3GIQA 1DPMA 4QRNA 3LGDA 1RJRA 3ORWA 5HMEA 3LY0A 3S2JA 3ID7A 4EPEC 3AU6A 4LAMA 1FKWA 4F0RA 1FWGC 2F6KA 2Z27A 1ONXA 4RDYA 2GZXA 3QY8A 4CEXC 3GG7A 1V4YA 2Z2BA 4HA0A 2OQLA 4IFKB 2KAUC 3IV8A 4RE0A 4C6QA 2I5GA 3C86A 3LA4A 2CZVA 2WJFA 2FVKA 2WJEA 1XWYA 3HTWA 4KESA 4AC7C 3LS9A 3KM8A 2FTWA 2P50A 3AUOA 2P53A 4LALA 2ADAA 3TN3A 1FWHC 4NG3A 1EJXC 3O0FA 2Z26A 1R9YA 3B0YA 2OODA 2VUNA 4G7EB 1ADDA 1M68A 4P5UA 3RN6A 1A5MC 3IACA 4ERAA 1EJTC 2PLMA 4ZSTA 2Q09A 2PUZA 4LH8A 3DCPA 4J5NA 1YNYA 4D8LA 4H9ZA 4DI8A 4RZBA 3OQEA 1RA5A 3GTXA 4I6KA 4C6EA 4ZSUA 4Z42C 1S3TC 2QS8A 4G7EA 5AKQA 1V7AA 4INFA 2RAGA 4H9UA 4HK5A 3GTIA 3K2GA 1FWAC 4C6PA 3S2MA 4RDZA 3BE7A 4C6IA 1YBQB 4DLMA 3MTWA 1KRMA 4CQBA 3WMLA 1EJSC 1A4MA 2OOFA 4GX8A 3RYSA 2YZ5A 1ITQA 1I0DA 2YB4A 4NI8A 3S2NA 1KRCC 2FTYA 4GC3A 2QVNA 4CNUA 4H9VA 4YIWA 4BKNA 4NP7A 4QROA 4IH3A 5CH9A 1UMLA 1RK5A 2VM8A 2E1WA 4LAKA 4ERIA 4PCNA 1FWIC 1E9ZB 4R85A 3T1GA 4C6NA 3E3HA 3S4TA 3LSBA 4LCSA 3URAA 1PB0A 3F4CA 4F0SA 1EZ2A 2GWGA 1A5LC 4L6DA 1RJQA 3UR2A 1R9ZA 4GY1A 4XAGA 3IGHX 4G2DA 1KCXA
chains in the Genus database with same CATH superfamily
1TQJA 2DSKA 2KX9A 1XIFA 5C6MA 3O16A 4V2XA 3R10A 1QWKA 4NXKA 1MZRA 2DGAA 1OZQA 4GI8A 2C1HA 3OO2A 5AYYA 2DUZA 4JCMA 3ZYZA 2H6RA 4JY9A 4RV8A 3Q2DA 1NVMA 2JF7A 3L0GA 1JI1A 1Q6CA 3NSXA 1TJ0A 1K6WA 4GY0A 4FR1A 5LGXA 1F07A 3VMPA 1W1B1 3W28A 2HE5A 1D9EA 4WXZA 4U33A 4FK9A 1HW6A 2X42A 1SW3A 1JGIA 1UMYA 4MB3A 1A4LA 1LLWA 3G1VA 3WUBA 4LJ3A 4HCLA 3K8MA 4UFJA 4D2JA 3LCFA 4LFYA 5G2IA 3DX5A 1KXQA 2NT0A 3RG6A 4KH2A 3LUTA 2WC7A 1YPIA 2DUAA 3E02A 4XX6A 3LDVA 4LRTA 1GGOA 2WVUA 2INEA 3PS7A 1Q3NA 1OM0A 1AW2A 1U83A 1K70A 3EKLA 1B3XA 1ME7A 2BVDA 1EQPA 3S5NA 5LA2A 2CZFA 1EF2A 3TN5A 1WNOA 2D1ZA 3W02A 2BX7A 3VUPA 3SJ3A 1OABA 5I02A 3O1NA 4MGGA 2OKTA 4F66A 3NFUA 3DI1A 4G6CA 3OZOA 1GHRA 4BY3A 3I3BA 3VOJA 1DJYA 2W62A 5G1TA 3WLSA 1BQCA 1JUBA 2WC4A 1FDYA 1XLCA 1UKPA 4DJFA 5K3VA 1BWLA 3PB0A 4TTGA 3TWBA 4V33A 5DFAA 4C5YA 4OGZA 3S5SA 4Q8OA 3H7RA 2O4MA 1GVQA 4QX4A 4UOQA 1O5KA 4QG9A 1OF8A 3ZLGA 1TKKA 1JZ3A 3ARZA 3OYZA 4MJ2A 3AWNA 4A2SA 1DJHA 5FJTA 1C7SA 5CLWA 2WMIA 3AROA 3POHA 1FXQA 5SWUA 1B3WA 3ZQ9A 4KWSA 5IXEA 2D3NA 2DZVA 1CT5A 2REQB 4IPIA 4Q33A 2PCEA 4BHYA 1XDLA 4MADA 1FFQA 2CIPA 5H1WA 4IGNA 3VE7A 4QSFA 4V27A 2YBTA 4QLLA 4MDOA 3PG8A 4Q7NA 4E4UA 2EPMX 4BS0A 3SI9A 1XINA 5IHRA 2VFGA 3GXNA 4IFKA 4FXJA 4GH1A 4PL2A 2ZADA 1UJPA 3PANA 4J40A 1AQHA 4HNLA 3GDTA 1Q66A 2J9YA 2J7DA 4E8DA 3L4UA 2V68A 4I5XA 1UD4A 1ZUAX 2DSUA 4QNEA 1S5TA 4L4OA 2QCLA 4DXXA 1FWBC 4QM1A 5DCDA 3MKCA 3ICJA 3FLUA 5AHMA 2DT1A 4HQVA 2CKSA 3Q37A 1CDGA 1W8GA 4AZ6A 4KF1A 3NYDA 4P7RA 3EXRA 2HS6A 3PZMA 4GINA 1UHVA 4BI7A 3CM4A 5E1QA 1N55A 3LSCA 2QEZA 1Q6LA 2LLEA 1GVEA 2X30A 3WNPA 3GO2A 5HWMA 1R6WA 3WL0A 1JYWA 5BW6A 4K1GA 4HJWA 3W1XA 1H2JA 1RK6A 4B2DA 2ZA1A 4HOXA 3ABOA 1BSIA 1XFBA 1XRSA 3HQNA 4N7QA 3GG8A 4GFIA 1RXOB 5CQ1A 3AOFA 3UYCA 4LAMA 1IXPA 3HA1A 4AMCA 4H8UA 3UQNA 4RDYA 4MM1A 5FD0A 2Z6IA 1FTXA 4N6FA 3QMSA 4L6OA 3DG7A 3MYOA 3AISA 1HGWA 3ANVA 4LT9A 2WNQA 1VPYA 2EHHA 1FUYA 2V3FA 1PDZA 3CPGA 5BWAA 2Q02A 4JTFA 1OCJA 1EWEA 4HPNA 4NG3A 2D0HA 5E09A 3AIRA 3CZGA 1J10A 2ISVA 3CWNA 3ES8A 3O9NA 4TX6A 1EJTC 3VM7A 4WIWA 3BCJA 5K2ZA 1TIMA 2DQWA 1CB7B 1RA5A 1BSLA 1JG9A 1VCVA 5K4XA 1JIBA 3IK4A 2MANA 4GRSA 2V3GA 1G1YA 1M04A 3GTIA 3M6DA 3W29A 4N9DA 4GCAA 3TKFA 4WKHA 1K02A 2BXZA 2G37A 1A4MA 4O28A 4N42A 2KZHA 1TPUA 5I5RA 2WO5A 3SRKA 4LPCA 1I6NA 3S5ZA 1WKDA 2G50A 5DCEA 3VNJA 5T9CE 4XQ6A 1GOWA 1GCYA 1PX4A 1UH2A 3L5MA 4ZO9A 2HRWA 3XISA 3NQGA 1ODZA 2E9BA 4PCNA 4LNYA 1E9ZB 4C6NA 2YR1A 1UOKA 4PFHA 3L2MA 1NF0A 4JCLA 1IIGA 5FJRA 5DN1A 4OTKA 2RFGA 4B4HA 1KFCA 2ZA2A 3ONCA 1EIBA 3UR2A 1J11A 4P7LA 2Y7GA 3IGHX 2QDHA 2FH8A 4WXYA 4JTQA 2OG9A 1ZNNA 3GY1A 3UG5A 2PGFA 2IPGA 3NPUA 1JFHA 2NX3A 3LMYA 2Q8ZA 4QS5A 2BVWA 2P0OA 3F4WA 1J5SA 3SIZA 4B5NA 1DQWA 2WSQA 7A3HA 1CXLA 2NX1A 1H7OA 1SJAA 4H9XA 1W1IE 1Q63A 2X0SA 5BOOA 4IP5A 3ME3A 5E0KA 3WK3A 1RALA 3EX2A 2ZRUA 3CYVA 2GUUA 3E0VA 5M17A 1WO2A 3KE0A 3WYZA 4ZB5A 1DWJM 4QDPA 6TAAA 4RW5A 2QR6A 2PTYA 5I03A 4MYXA 3MSYA 3HMCA 3WCZA 4CQDA 4DX3A 4NQ1A 2GVEA 3EOLA 2ABAA 3MY9A 2REQA 1GG0A 5AZ1A 1FH7A 4J3UA 5AZ0A 4ZQCA 2NX9A 3T07A 4Y6GA 2H3DA 3BMWA 2P76A 5A6BA 5BYWA 1XICA 4S38A 4K8EA 5AC4A 1M53A 3MI6A 4AD0A 3WEZA 4JHMA 2GGGA 3CIWA 4UUIA 3WQGA 5AHFA 1BFNA 2CLEA 3IJIA 2XH4A 3OLDA 3D3AA 2WW5A 2ZUSA 4GNVA 1BG9A 4Z2GA 1SR9A 2PAJA 4YTQA 2OLSA 4D8AA 3DZ1A 3AALA 1SZRA 3P8IA 1LTDA 2ZA3A 3T6CA 4EKJA 2GOUA 3ITXA 2QULA 1SW0A 3E1F1 3GDBA 4WKFA 5TNVA 1PHQA 3HN3A 2HVOA 4LBRA 3G1SA 4J3XA 2QCMA 3AMKA 2INZA 2G41A 2XSAA 3WD2A 1Z42A 1OINA 1QW7A 4JKKA 3H2FA 3TNOA 2EG8A 3A4JA 1EQCA 2VZVA 1LBLA 1XBXA 2WM1A 3VXGA 2WM0A 3NZQA 2EQDA 5DEZA 3FJLA 2WMHA 1LT7A 1OG6A 2Z6JA 3CAWA 3MHFA 4DZIA 2FFIA 3WBAA 2QMJA 1DWHM 4F40A 2HE8A 3K46A 4XUYA 1SSDA 3AXIA 4H6EA 2Y70A 4ZE5A 3SCQA 1WDDA 2XN1A 5HUPA 3N14A 2Z2AA 3JU2A 1U33A 3QC0A 3DC8A 1AH4A 1D2KA 2VRKA 3MJMA 4FOJA 3HFTA 5A8GA 2Z1WA 5CLTA 4UNIA 3AS1A 3MJYA 3O6CA 1H11A 1WXJA 3OVPA 5C2GA 1HJVA 4PBGA 2EPNA 3NIYA 5FIPA 3LHYA 2A6LA 1ESWA 3CYJA 1GVOA 1UWQA 4CCZA 3FOKA 3QKZA 4Y9MA 2Y85A 4FNTA 4AZGA 1FWSA 4FNRA 4H9MA 2J7FA 3LV6A 3VNIA 5AHEA 2V30A 3VNDA 1O7AA 4NJIA 2YGYA 4C1KA 1F9CA 2J27A 4IF2A 3TE9A 1PV8A 3O2LA 3KRZA 3VOGA 4L9XA 3VGBA 1PBGA 1A3XA 4KRUA 1AL7A 3GU9A 3MVTA 1SO3A 4DNMA 2RHGA 4MNMA 4JTHA 2ASHA 4HU3A 4R33A 2ZX5A 2ATSA 1JCYA 3LLXA 1E6NA 4OUEA 2D69A 1JNEA 4KERA 3KP0A 3KVLA 3CC1A 4EPDC 4ZR8A 3CUJA 1YPFA 3ARSA 2E5BA 2BOGX 1M65A 1FX6A 1X1OA 3NM3A 1DHKA 1JRCA 1ZTVA 3PTKA 3W7PA 1FKWA 2W66A 1KFKA 4PR4A 1QTWA 3LM7A 4GI9A 3CUFA 3LPFA 3BICA 5AC6A 4RE0A 4HP5A 1SYTA 1EEXA 1GOIA 3POCA 1LG1A 1V6WA 3SGZA 3CUZA 1NOUA 2FTWA 4FX7A 3S9IA 1VIWA 3EX4A 2ZE0A 4Q4MA 3M07A 1EOKA 4FS9A 3VIKA 3KOWA 1LZOA 5A95A 3GVWA 1ADDA 1NFPA 2E67A 3I6TA 1E40A 4QQ3A 4MWAC 1QUMA 4Q8MA 4HU8A 4U3CA 1PIIA 4PTNA 4ONVA 1HVQA 3CWHA 1I60A 1UD6A 3VIGA 5GJMA 2CHOA 5H91A 3QLDA 3F4NA 2GVLA 2HZGA 4INFA 4B16A 2VDHA 1GONA 2CITA 3DFQA 2O55A 5FA5A 1YBQB 3PBGA 1MEHA 4HCHA 4PYSA 1GZ1A 3T2QA 4DO5A 4NI8A 3WD3A 1QBBA 4WDUA 4CNUA 3T0DA 1IEIA 3P81A 2AL1A 3KEHA 9XIAA 1JUEA 5CH9A 2NVDA 1IZJA 3I7SA 2QIWA 3MO4A 3DECA 2Q3OA 3QLLA 2X1RA 4RZ5A 3WLOA 3WJSA 1VYPX 7CGTA 4MNKA 5HQLA 2HEJA 3CZKA 3NZRA 3OG3A 3HG5A 2GWGA 1X96A 4ECLA 1OT1A 1ZAJA 3MZ2A 1U5HA 2BBFA 1R38A 5C2CA 2NT1A 8XIMA 2ISWA 4AWSA 4TVDA 3F5JA 3PZQA 4GACA 1IEQA 2ZZ4A 2QJHA 2J62A 2QCEA 1A5AA 5H6HA 3N3MA 1DP0A 4H01A 1Q6OA 2CLPA 4D1IA 5BNKA 2X8RA 4GISA 3DGRA 4M81A 4DM1A 3T2OA 4DO7A 1B54A 3LNPA 1XC4A 2XPKA 3TQKA 1C29A 4M1BA 4PODA 5C7VA 4Y96A 2H9AB 3MBDA 2PODA 2CZEA 5F2GA 4JIPA 4S1FA 3SSJA 4AWTA 1JD9A 3E9AA 1TJ2A 3TN6A 3DBNA 2ZQ0A 4GQQA 4LVFA 2IKJA 2WZTA 5CZ0A 4JTTA 2OZ3A 1I8JA 3IAQA 1H62A 3ZIZA 4B15A 1TWWA 8RUCA 3W1QA 1OHLA 3W7NA 2GJNA 3LTPA 2G5WA 4O57A 4ACYA 3SZ8A 2YL9A 1VFHA 1DBTA 3WH9A 5A6KA 3TYBA 4QP0A 5CPQA 1P1MA 3IRSA 3Q67A 3GTNA 2G3NA 4F8XA 3O6YX 3BLEA 2WV8A 2B4GA 1UR8A 1TELA 4R7OA 3B8SA 3VIPA 1GEHA 3SFWA 4CN6A 4X63A 2ZX7A 4JX5A 4DM2A 3CQ0A 4BWLC 4LS1A 5D38A 2GOKA 4LC8A 1ICSA 3RU8X 5DX7A 2BGSA 1EA0A 4YU1A 3DHPA 4GGBA 3OLIA 1KFEA 3NA8A 3T05A 2GQ8A 1SGJA 4LC6A 4UQDA 1DHPA 2OLAA 4ZQRA 4MUPA 4ZFCA 3W2NA 1Z3NA 2QUTA 1VEPA 2ZRXA 3T0CA 2Z1SA 3PG9A 1S2AA 1HUVA 4MG4A 3TA9A 3UVIA 2V5BA 1T8XA 3GIYA 1CCWB 4AD4A 3GHRA 5FEZA 4IHCA 3EDEA 3TN4A 5BRQA 1K9TA 4ZOCA 4JTGA 3BGAA 4P8UA 1C91A 4EX4A 2VT0A 4YWSA 4LAUA 3W1AA 4Q32A 1JXJA 3H26A 3VTRA 2YCLB 1L6SA 3GD6A 1JRBA 2X16A 1DJXA 3W7QA 4QJ5B 2FH6A 1EP3A 1J5TA 1PVNA 2XVGA 7ODCA 5LIKX 2ZXDA 3C4UA 3NXLA 1VHCA 1XKJA 4RK8A 1RBOB 4JL2A 1TA3A 4MNLA 2OSYA 1F6KA 3BV7A 4GKLA 4O12A 1OEPA 5D04C 2FHCA 4L1GA 1CZ1A 1GW9A 3OQ8A 1YE6A 2O7QA 1ZZMA 1KLZA 3IUDA 4WVXA 1UASA 4O50A 3STEA 2O92A 4U10A 3B4YA 1QXLA 3RRAA 2ZZ6A 4KBXA 3DG3A 4S2BA 2QIIA 1HKMA 4PB5A 3K13A 1WYIA 6XIMA 4PN2A 1KM5A 5U4NA 3LI0A 4NYYA 2CBIA 4POCA 3C0QA 3BG5A 4A29A 2G3FA 1MI3A 1JEZA 2OX1A 3W26A 1UR1A 7XIMA 5GJNA 4PE8A 3RX3A 2R1MA 4GQGA 1QAPA 1MNSA 4MMWA 4JTDA 3IJDA 2VVNA 4BQ4A 3WJWA 3GDKA 4L6HA 1XLBA 3TA6A 3T0AA 2JF6A 3BJFA 1HKWA 2QPXA 1GKQA 2XVPA 1YBQA 3VGDA 4AAJA 1A5CA 1Q6RA 1XBVA 3EXTA 1QDSA 3RHGA 1O1ZA 3VNLA 3WQFA 2QQ6A 5DT7A 1BPLB 2GJPA 4L56A 2VRJA 2RUSA 1D7KA 1JF6A 4MFEA 4WSJA 4XD6A 1PEZA 4CGTA 5BRPA 1E6PA 1Y5XA 3ENLA 4XZNX 2UY3A 3QC3A 3C2EA 2QXWA 1TV4A 3EA1A 1XPGA 4UTMA 5IFTA 4FNPA 4AD5A 4IUOA 1FFRA 2BV9A 2X2GA 2Y61A 1RCOB 2JKAA 1IGSA 4K39A 4O8RA 3PUGA 1R2RA 2Z2BA 3WMSA 2QJMA 4NAFA 4C6QA 1G5AA 3UWQA 1P43A 2NQZA 1CLXA 3WNOA 4AC7C 3JZUA 1JZ8A 3CAVA 2JIWA 3S5OA 1RBLA 2P53A 2QCNA 1UKTA 2QCDB 1QT1A 5JH1A 3L7RA 3RF9A 1XL9A 3M0XA 1OFQA 2B7PA 4P5UA 1FCUA 2DZUA 5MKGB 2YL6A 2GGIA 3RN6A 3WQEA 4JY8A 3TFCA 2PLMA 5H8MA 1JUKA 3SBFA 4J5NA 5CBIA 2GFTA 1UA7A 4A05A 2H9AA 2Y5EA 2ISFA 2A7RA 1W9BM 1KM6A 3VKCA 1F3WA 1ZSXA 3I68A 3SCRA 3LHUA 3VD9A 4G7EA 1I2OA 3QTPA 1FWAC 1FWTA 4RDZA 4C6IA 2J7HA 3GXDA 4CQBA 1V8EA 4DJEC 1EJSC 3PFMA 2QUNA 4GMEA 3WLHA 5KTLA 1O5QA 3GBDA 3RYSA 3IK2A 1MNZA 5LNSA 5I3DA 2YB4A 3N4FA 4AYSA 1KBJA 3FA3A 1UD2A 1V02E 2E9MA 4UTTA 3WNMA 3AICA 2XZ9A 4NZ1A 4P8XA 4M56A 1SMAA 1RK5A 4RPQA 4LAKA 3WBWA 1KFBA 1YEYA 3ITVA 3KHDA 2A85A 5LA1A 1KWKA 5BXSA 1CECA 1M7OA 1DEDA 1JDAA 2BTMA 4HNUA 4WSHA 3AIWA 4F0SA 3UZWA 1M5WA 1F5ZA 1XYAA 4L6DA 1T96A 3CASA 4BZYA 3M6YA 4EE9A 2ONEA 3W87A 3R8RA 1RLCL 4GFSA 1FWWA 3ATZA 5G4EA 4S3FA 4UCFA 2V63A 1ME8A 5HJLA 2V3EA 3TH6A 1BGAA 5KSWA 4KKXA 4Q7IA 3LCWA 3LD5A 3KBVA 2VO5A 4AEEA 1V08A 3TSDA 1DJIA 1P7TB 2XM1A 4CEUC 4GXPA 1CXFA 3GZ3A 1XDMA 1W6TA 4H6QA 2L5HA 1UC5A 1W5PA 1ISYA 3G8RA 3DBPA 1EJWC 3Q94A 4XD3A 1QHOA 1CTNA 2OEMA 3MSRA 4ICMA 3COTA 4JQ2A 2RH9A 2E8YA 1OY0A 4LUTB 4WJEA 1PX8A 3EAUA 4FXSA 3VCNA 4X61A 1SU5A 3T0BA 1IR1A 2F8QA 3R7MA 4DYKA 1PXGA 2UZ9A 2YCLA 1E3ZA 4FNUA 2F84A 4O53A 3FVMA 3VNZA 3IARA 5K9XA 5B80A 2G3IA 4KGLA 3GK0A 1Z41A 1WKFA 3V1PA 2W27A 3WNLA 2PF0A 4G56A 1XH0A 2V9DA 3M0VA 3LEPA 1DV7A 1EO5A 1ICQA 4Q6JA 4K8HA 1K4HA 2GDQA 1HP5A 4C6KA 1OFAA 4I6VA 3VK5A 1EC7A 4H8VA 3R0KA 4TQTA 3HBLA 5FF0A 1C9DA 3KBNA 3ITLA 4Z1YA 4ACZA 3A24A 3F4DA 1ZJBA 4QTGA 1IZCA 4MPKA 4GXMA 4CUCA 2AL2B 3TU9A 1EHAA 4MIMA 2DW7A 2Y2WA 1W17A 3GDMA 3OVGA 1KNWA 1LOQA 4C1LA 2NQLA 1YXDA 3TV8A 1L2UA 5FL0A 4S39A 3LENA 3OYXA 1KA9F 2BNJA 4DYEA 2BLEA 3QYSA 2CWNA 2R14A 1NAL1 3QGVA 3R5EA 4OBTA 3VC5A 2J13A 3H22A 4BI6A 1KR1A 4HHMA 5D8ZA 1NDVA 1XYLA 2EG7A 3DOPA 3QMTA 3UZJA 2WJDA 5DXYA 2FZMA 4HNVA 2Q8LA 2IPWA 3PB2A 2JGQA 3T44A 3W53A 1AH0A 4LW7A 1OGGA 2DVXA 2ZUTA 1GYMA 1KTBA 4E3VA 1FWEC 3UXKA 1DJZA 5FF3A 3BVJA 4HSNA 3B9DA 3P14A 2X41A 1TFVA 4LCQA 1W2PA 1K03A 1V0MA 3G24A 3E0WA 2Z29A 2XN2A 2Y24A 3WH6A 3DN5A 1HJUA 1J2BA 2AMXA 5JH2A 4R53A 1XD1A 5DY2A 2OJPA 3NDZA 2YX0A 4WX2A 4TTUA 3R94A 1TMHA 1NEYA 5CSRA 4Q22A 1AQMA 2Y7DA 1ITCA 2QCDA 1RUSA 1E9IA 3C2OA 4J4KA 3RR4A 1W1ZA 4PMVA 5MKGA 2WBKA 3BSMA 4IL2A 2E8ZA 5JBEA 2W4XA 3NQMA 1GW1A 4Z1CA 4E2DA 2JBMA 4AHOA 4IPPA 3MDUA 5EBAA 2HWGA 1JGMA 3DENA 4I8DA 1F3TA 2XUCA 3MI3A 4HPXA 2Z28A 3W74A 4WY0F 3N3TA 3EWBX 2ZRVA 1J0YA 3MSDA 4JNYA 3TK7A 1XLLA 4CD5A 2VQUA 4LV9A 1NWTA 3LXCA 2VI0A 3K4WA 1QI5A 1KB3A 3ABXA 1SR0A 4OQVA 3R43A 2WZIA 4UTHA 1S39A 3EMQA 1LG2A 1S2TA 2ABBA 1CLVA 4NZ3A 3SN4A 3IANA 5HA7A 1A49A 1XCWA 3ABZA 3ARRA 1X7IA 4IIGA 5J04A 2OPJA 2O56A 3MYPA 1RP9A 3OBKA 4CNOA 1XF0A 4OV4A 1W3JA 2VR5A 3BLOA 1FWGC 2Z27A 5C70A 2NWSA 3GG7A 1MUCA 4Q8TA 2KAUC 3IV8A 3G18A 2RDUA 2NW0A 3UWZA 1V0NA 3DERA 2YA1A 2RGLA 4LVDA 3RCYA 1W1TA 5L9FA 2OZ8A 2ZRZA 3N1AA 2R91A 2CU0A 4JQ3A 1R9YA 2YCEA 5XINA 1P7TA 3AZTA 3RILA 3OVQA 2VEIA 4HVXA 1AZ1A 4U2YA 4G7FA 3FCPA 1TUXA 2XZ7A 1OG0A 3WF0A 3W70A 3IGSA 1EPVA 2YXGA 3SUUA 1BXNA 1KXHA 4QE5A 3GTXA 2F38A 3RUBL 1WZMA 3ELFA 3ZSSA 4GIEA 4HK5A 3TYEA 1LWJA 4NT0A 4LUTA 3UWUA 2ISSA 3CH9A 4JFUA 4JKLA 3WMLA 4R3UA 3PZOA 3KBSA 2PP0A 3QPYA 3Q45A 2ZZ1A 1MWOA 5CCZA 1ITQA 3ABQA 1EZWA 1XH1A 2J25A 5K7JA 1XIJA 3VCCA 2V6AA 1VZWA 4TV6A 1NTHA 1GG1A 3LM3A 4X3ZA 4ERIA 3SB0A 5F2LA 1EL3A 1CIUA 2FJUB 1PL9A 4JDBA 5DMNA 5IM51 4IT1A 4PMUA 1W5NA 2Z1BA 4MFDA 5I3KA 3W01A 5AHLA 1T0OA 1MSSA 3RR1A 4GQBA 3VGEA 1A5BA 5KEZA 2HK1A 1RR2A 1CBGA 3XIMA 3BH4A 3H24A 3K4DA 2OT0A 3OZMA 4GCXA 2H8ZA 4KEVA 1TPH1 3R12A 3W7DA 3PF3A 4GX9A 3WQ8A 2B7QA 3BLPX 3K5XA 2DU2A 3A23A 4DWDA 1US3A 4IJBA 3QV6A 1ML1A 2J7GA 3NURA 2VNCA 4A8NA 3WUEA 3A3XA 1VD6A 4AHPA 1ISVA 1UIPA 1K7EA 4MSSA 2FLIA 1JDCA 1GOMA 1UPPA 4PMJA 4D6HA 1W54A 1WPCA 1UZ1A 3HZ3A 2CWXA 3JRKA 2R6OA 2IQTA 5C5YA 1TV8A 3PUEA 1Q7MA 2YCIX 1N82A 3GH5A 2ACUA 3BZGA 5HNUA 3KVJA 1R3SA 1SZGA 3W0KA 1E0TA 4J2PA 4ZO6A 1LWHA 5A6TC 2Q8XA 3HPFA 2D20A 1CWYA 1XYZA 5I3JA 4LGXA 2GVYA 3U2ZA 3QW3A 2WSKA 4E2BA 1G01A 3MCMA 4B5SA 4HMNA 1E4LA 1OYAA 3OZYA 4QXIA 4V1YA 5ECUA 3UA4A 3ZWSA 1GTHA 4B5WA 2Y8VA 1NF7A 1UZDA 2XFYA 3SM0A 1XBZA 4GGHA 3GIPA 4XO6A 2J8FA 4QDWA 1T99A 2HNHA 3I65A 1LBFA 2XH7A 1CI1A 1JCXA 4ADTA 4DXVA 3H7UA 4KCVA 1UKQA 1I9CB 3NUKA 1V3LA 3QVQA 3QZEA 3W4RA 3LG3A 3DKLA 1M1BA 1SMDA 3MV11 2AQWA 5EY5A 3BSHA 5AYIA 1K8XA 5FACA 1A5OC 3GC5A 4JFWA 3GB6A 2G3MA 1YHTA 3H2NA 1S2WA 4GBUA 4MB1A 1U1JA 1IXOA 3NQVA 4WOQA 5C8BB 1R3YA 3HV9A 1P48A 5G2WA 3BCFA 3SY5A 4AHQA 3VX0A 3BC9A 2X7WA 4H9TA 3M0HA 4MZ1A 4OHQA 3NM1A 4Q8PA 4CD7A 4P2VA 3L4XA 4U3AA 4AIEA 1GPWA 4WGHA 2IUZA 4DWSA 5ABEA 1A5NC 2R1KA 4QCFA 2DQXA 3WD0A 1TUFA 2ACSA 1C90A 3M0YA 4H2HA 1V3KA 3LOTA 1XM3A 3OU8A 1R3QA 1TG7A 4PCFA 3N2CA 4GO8A 1EC9A 5EB8A 5MF5A 2Y4SA 2BHZA 3FSUA 1HGYA 1K8YA 1DYSA 2XHYA 3KRUA 2DPEA 3AHTA 3NOEA 2HXTA 2CLFA 1J2WA 4B90A 4W8LA 3QTGA 4LUJA 4FOKA 1FQ0A 3M0LA 3RDKA 5A1AA 3V4BA 4X60A 3TJLA 1NWSA 2YIHA 1XISA 4PULA 2WNWA 3CZ8A 3NO3A 4O4WA 3RJXA 3BXWA 3RITA 2XGBA 1PYFA 2IKGA 4HD5A 4JNZA 1AJ2A 4HA4A 4WLCA 3MP3A 3UR8A 2WANA 4ZQMA 1WXYA 1ZAIA 3UXLA 2IW0A 1W5MA 2WCSA 3E5PA 5IBXC 1EIXA 3CTTA 1M41A 4LY4A 3G8EA 1FCQA 3M1ZA 3C0SA 2W61A 3OVRA 2QF7A 1E0WA 1CGYA 1MUWA 4WHBA 4O16A 4L7ZA 4H00A 3HGOA 1KGXA 1XH2A 2DZAA 4H2CA 2WSRA 3HJZA 3VC6A 1T5AA 3LGDA 5HMEA 1EGMA 2FMNA 2WHJA 1LCOA 2OKOA 1GJWA 1VLIA 4GJJA 1H7PA 1C92A 1V4YA 2FDSA 2VDGA 3ZVIA 1ZQ5A 3CUHA 1KV5A 4DJDC 3KDOA 3LA4A 1GOKA 2C8NA 3PUDA 3B4UA 3NQCA 4CQAA 4AY8A 1A0DA 3QN3A 2QKFA 3U7BA 3W3OA 4W84A 1NFBA 3BJTA 3UW6A 4BEUA 2Z26A 3WQDA 5DMYA 3RPTA 3BMXA 3WQPA 4A3QA 4HNTA 3A64A 1A47A 1OIFA 4ZSTA 1L8PA 1HKVA 1CGXA 5DMMA 4S3CA 1W0MA 3ZO9A 1B9ZA 4O52A 2WWDA 1GZJA 1TCMA 4W89A 5F1VA 4GZEA 4ZB2A 2VYOA 2WNNA 2GJXB 2QJJA 9CGTA 3SECA 3ZR4A 3DC0A 2ZUWA 3A12A 1KBKA 3EPOA 3NCOA 4K1WA 4DZ5A 3PJUA 4WY0B 1KXTA 3VNMA 2QVNA 1CB2A 1QMLA 3M44A 3QV7A 3NZ1A 5DRIA 3KRBA 3ITTA 4GVHA 3FY1A 3P0WA 3S4TA 3T42A 4AUBA 2I1OA 2I14A 2PGEA 5CAHA 3B8IA 3VX1A 3SGUA 5HOSA 1V7YA 4G1KA 3SW6A 2YLAA 1W3LA 1V6XA 3HGSA 4G2DA 5HR7A 4HKPA 3KL3A 2YJQA 4XZIA 2BVYA 1XYMA 3TYAA 3L4ZA 3AHXA 2D23A 3VIMA 4S3DA 3UZYA 1XC6A 4O10A 3FGCB 1OT2A 3SCTA 3M0IA 2YL8A 1J79A 3SCSA 1E4MM 4JAWA 1NOFA 1H4PA 4Y9OA 5FJPA 4HB7A 4AZ5A 2ZKMX 3EMCA 4HBKA 1F2JA 5C9WA 4W5UA 2GSEA 2ZIDA 3GNDA 4HPJA 1TTJA 4DO4A 4XSLA 1PKMA 4R7JA 3BGJA 4RV3A 1S1RA 2PTDA 4FLOA 2E28A 4HGXA 3OGRA 2QLYA 2DJLA 4ZEPA 2GLKA 3IIPA 4LCRA 3FN9A 3ZJ7A 2Z24A 1W9UA 5AECA 5FSEC 3E96A 3IS4A 3FHQA 2NVAA 4GNKB 3L65A 5DBUA 3WZ0E 1B9BA 2IXUA 3CMFA 3LPOA 3S1XA 2R24A 3Q4DA 2ZYFA 4FMVA 1P0EA 5AHNA 3AU2A 4ASTA 1ZY9A 1U22A 4QS6A 1R0MA 4K68A 5LZLA 1WAWA 3WNNA 4D6GA 5FJIA 3BTNA 2VC7A 2D2HA 3QSRA 3VIIA 3OA5A 2NUWA 4CNTA 1W1VA 3ARTA 4GA8A 2PDQA 1WX0A 1O66A 4ZXOA 1HL8A 4W7VA 1JCTA 3XINA 2DZPA 4IOTA 3GE7A 3RFAA 3UGVA 4IIFA 4JD4A 3WH8A 3PBUA 3N18A 4FA3A 2Z25A 1QVBA 3QOMA 3BW2A 3E0IA 2PBGA 5E93A 4DPPA 1G4TA 5FOOA 1OYCA 3NQBA 1KWGA 4FEZA 3NL3A 4PGLA 4LU0A 2FPYA 5D09A 4WF7A 2WKLA 3GWQA 4C60A 1H0GA 5IHSA 4ERGA 2H8XA 3TJIA 3KDNA 1TRDA 1KRAC 4OOZA 3MMUA 2C1IA 3PZGA 3PZVA 1XD0A 4GYFA 4C6OA 4RW3A 3AIBA 5CG7A 3TQ0A 4J3VA 1BF6A 1ISXA 1JYXA 1S5NA 3C6CA 1QPOA 2DY3A 5CJ5A 4JTIA 3NQEA 4GIYA 2FVMA 3S8HA 4KMQA 5BOFA 3ZZ1A 1MEIA 4RPPA 2J75A 5CPMA 5CGQA 4LVBA 4IIBA 4XTIA 1REQB 3KTXA 3DIPA 3LRKA 3PR2A 3T8LA 4E4PA 4MYAA 4NNAA 4N9EA 1VBJA 2HK0A 1H41A 2PP3A 3HPXA 4QITA 3RU6A 4FLRA 1XIMA 5DLCA 4YWIA 3SJNA 4US6A 2ZZ5A 2D2JA 4W5ZA 4K3ZA 4N02A 1HZYA 3B8WA 3UY7A 1GORA 4NNBA 1HKJA 4H7ZA 4JQAA 1TPEA 4Z2HA 1XSIA 4L5ZA 2AMGA 4YLWA 3MVIA 1XRFA 3FFSA 4B5VA 3R4IA 3C2YA 4WR3A 3ZT7A 3EDJA 1EBGA 5PTDA 1BEUA 5FAGA 3DAQA 4XZBA 3S5YA 2D2GA 3BLIA 1H1ZA 1WOBA 4LUYA 2CKRA 1XG3A 2JE8A 3JS3A 5CSYA 4RXFA 3GX9A 5CEWA 2VP8A 1R85A 4LX4A 4UWMA 1WQ5A 1V02A 2GJXA 1EA9C 4UMCA 2WHMA 4IISA 3MMDA 3GXTA 4KIRA 2ISDA 1ONWA 4YXGA 5CAKA 4U31A 3EOOA 3RNDA 4WY0A 2FZNA 2YYTA 3M0JA 4JXCA 2BVTA 1PCWA 1HP4A 1E4NA 1VBRA 3GC4A 1WDQA 5TAOA 1W9DM 1CEOA 4NKCA 1XI3A 3NO1A 4AY1A 4HZ8A 4GE8A 4O17A 3VKJA 4PUMA 3W07A 2ZUMA 2DSWA 1MRQA 2VX6A 2VC9A 1YADA 3QHOA 1UR0A 2GZXA 5TBOA 1EB3A 3U57A 4HA0A 1QPKA 5AYZA 3IRDA 3C86A 5A6LA 3GHTA 5KITA 3VA8A 4XWUA 3S9ZA 4IPNB 1Z32X 1QK0A 2FZBA 3FGCA 4AZIA 3WDHA 3K30A 3PJTA 3FJ6A 4MKNA 3GHSA 1OFOA 1J0ZA 1DE6A 5HNNA 1B3VA 2QCGA 1VGAA 4QEEA 3PM6A 4ERAA 1I2QA 2DORA 2OQHA 4LBUA 1H1NA 3WK2A 4ZVJA 2YA2A 3MUIA 1KO0A 5AC5A 4C6EA 4Z42C 4PUEA 5I0DA 1XGZA 2RAGA 1OX5A 4L1WA 4AZBA 1BXBA 5E0CA 4TMCA 5ABTA 4NRSA 3PAJA 4H8HA 4IICA 4DJFD 2IQDA 2VEKA 5JQ9A 1ME9A 2OOFA 4QEHA 3USBA 1AQFA 3VCRA 4FLQA 3WLIA 6ENLA 1EUNA 3P5ZA 3B9NA 2FTYA 1S2VA 3AFBA 1JQVA 3NQFA 3W75A 4XSMA 4BKNA 4Q8WA 5TQLA 3IIXA 5C0QA 3SADA 3TDFA 4F9DA 4O19A 3FJNA 3AAMA 3PFRA 3R2GA 3TMQA 1E56A 4PCTA 4K7VA 1AMYA 1IWPA 4DQWA 1H5VA 1OCNA 5TF0A 4PUNA 4GC4A 2FFCA 2GGHA 1RJQA 2Z1VA 3E2SA 1OJXA 2PDHA 2VJXA 1XRVA 4ZOAA 4H6RA 2YL5A 2Z7GA 4WD0A 3I7RA 2PZ0A 4CVUA 2VOMA 4CN4A 3H53A 3N2MA 2Q71A 3QF0A 3MO7A 1KRBC 3C5QA 5AN7A 1R47A 4GABA 3H23A 3PAOA 4OFCA 3A9IA 4ZFMA 4M6QA 4X2RA 2VEFA 5GPRA 3P3BA 4Y9AA 3B9OA 4I7VA 1HQTA 3SN0A 3HG4A 1ZBWA 2PWFA 2X1IA 3MKVA 4PMYA 2GSJA 2EPHA 3G1XA 4JFSA 3VILA 3STFA 2QPSA 3VDGA 4W87A 1YDVA 2PWVA 3P67A 4S23A 4FXFA 3HOJA 5C71A 2AAMA 3L2LA 3G3MA 3TUUA 4JHOA 4LUSB 3M4HA 3KWSA 3VFCA 5AOUA 3VOHA 1REQA 3CJPA 4AFYA 3TAOA 3TLQA 1H7WA 2ZUNA 4O14A 3U2EA 3WO8A 5DELA 3C8FA 1POKA 3OODA 4JGDA 3O07A 2ZC1A 1SFLA 4IIEA 3GTFA 1E0VA 1Q13A 5BMXA 1GK8A 4B2DD 3HJEA 3M16A 4F79A 4C7FA 4D1JA 4WSKA 4QISA 1OFDA 4PMQA 3QRHA 6XIAA 3V35A 4PMZA 3LHTA 1BKSA 2DDXA 1E6ZA 2BOEX 3ARVA 3UJRA 4F2BA 2PD5A 1WP6A 4DXKA 1Q4WA 1OIMA 2IKIA 5BMWA 2WKGA 4C6LA 2XIIA 4EAMA 2G4FA 3PHAA 1EYEA 3F03K 2POZA 1Z69A 2IPJA 3MUXA 3U0HA 1XFCA 2VFEA 4FR6A 5M03A 2AKZA 4A3HA 2Z1KA 4GNJA 4DEFA 4F3HA 3LERA 1D3HA 2WVTA 4NX0A 1R3VA 2FZ9A 4I7WA 2BG5A 2YDQA 1V77A 1I1XA 3CV7A 3CXOA 3WENA 1H60A 3NO5A 1VR6A 2ZFAA 3QW4B 1UWSA 3P7YA 4FF7A 4ZA0A 1ITUA 4IGHA 4YYCA 3GVQA 1B3OA 3LN3A 1DTUA 4HMCA 1ZJAA 4DF1A 2UV8G 1KBBA 2WLZA 1KFLA 3LCHA 1TE6A 4AVNA 3SCNA 1P4CA 1NP0A 3S83A 1HO4A 2OR2A 2WQDA 3IWPA 4YTRA 3W7HA 1UH3A 3CT2A 3WQCA 4BQ5A 3RM9A 1I2RA 2Q01A 2P5NA 3TROA 3T4CA 2J66A 1FDZA 1TWIA 4CD6A 3GRIA 2J9XA 3B05A 3QMRA 1V3JA 3W1NA 2QUUA 4HJFA 4AW7A 4E5TA 1XXXA 4TV5A 3NPWA 3VDAA 1RQBA 1TWZA 5CSUA 4NY2A 2YSWA 4HNNA 1H7RA 1JPKA 2J7CA 2PDKA 1TO3A 3VOIA 1J6OA 3H12A 5ABGA 1OC5A 3WK0A 3KS6A 4JKMA 5AVHA 1FHVA 1PKNA 4HIBA 3PBMA 4XZHA 4FLSA 3SUTA 2FIQA 2E1DA 5LHFA 1I45A 2C6QA 2X0YA 4PMOA 2DZBA 2BY3A 2C79A 4Y8EA 1TB3A 1SJDA 1EEPA 3AYRA 3SURA 1JPHA 3L4TA 1ZRQA 4TVUA 4XD4A 1EGVA 1D8WA 2CEQA 1ECQA 4KEZA 3CQIA 4JIRA 3T81A 4F0KA 1S38A 1YTKA 3VMNA 5LIWX 2YDRA 3E2QA 4LB3A 2P8BA 3VABA 1QPRA 1XX1A 4HT3A 2NZLA 4MNJA 3MS8A 1HX0A 3O63A 5JBDA 1OC6A 1B4EA 2W67A 2E40A 3C2FA 2GUYA 3FS2A 3KL5A 2GSHA 4A3YA 1S2CA 3ZMRA 2Y5JA 3N6JA 4PFMA 1F8MA 3KXQA 1Z9AA 4UQEA 1SO5A 2H3BA 4WDXA 1RJRA 3RO8A 4KWOA 2P3EA 3ANUA 2ZTKA 1VFMA 4F0RA 3PBVA 2CFFA 3UCQA 3QY8A 3FV9A 5A6AA 4CNPA 1KKOA 3WMBA 1V6UA 3MANA 2BXVA 1F6YA 3F4VA 4FX8A 4AB4A 3E2RA 4A22A 5A6BD 1NWRA 4Z2JA 1ZJHA 3ABRA 1NELA 1XSKA 5FI8A 1VFSA 1XIIA 1R87A 3M7SA 2ZX8A 3KM8A 4M80A 3WNKA 2XFFA 4E8GA 3CV6A 1J0JA 3V75A 3OG2A 1DJWA 5A69A 2VUNA 3U2OA 1KCLA 4WKAA 5D05A 3UESA 3HQ1A 1K7XA 3MCOA 1IEXA 2RDWA 2C0HA 1KLYA 3KOXA 3O15A 2ODOA 3D47A 4NF7A 4L9YA 4GH3A 5GQBA 4AX7A 4W93A 3S2MA 3BE7A 1I75A 2B7OA 2VGIA 4LUSA 5CJMA 3MUCA 1CXEA 4DUOA 3NQ8A 1FH8A 1M03A 4MHBA 3MHUA 4QE1A 4L64A 4P7NA 2JKEA 3M5YA 1HJQA 3TC7A 1O95A 3PSWA 3TQVA 4AMAA 1MW3A 3W27A 4JS3A 1XV8A 1B5TA 3NWRA 3CO4A 5I7GA 4J3TA 2XVLA 4MUZA 5LA0A 3TSBA 1B0IA 1YNPA 3CQJA 3EXSA 4XAGA 4Q4QA 3WMCA 6CGTA 2GWNA 4GVIA 2X7VA 3UWVA 3EA3A 2G3JA 2QDGA 4Y9PA 3EA2A 2PBOA 4U5KA 3VKDA 1TJ1A 2CBUA 4XAPA 4AX6A 2HS8A 4D72A 3E49A 4UZUA 4XD5A 3HO8A 1KM4A 4GLEA 4MVAA 2EPOA 4U2ZA 3G77A 1PDYA 2X05A 2WNZA 3HM7A 2VRQA 4ZQPA 4RZ6A 3KLKA 3B40A 4AZHA 3L66A 3BQ5A 3T8QA 1P0DA 5CZKA 2DIJA 4NU7A 4UOZA 1R3RA 4Z08A 2OLHA 1CX9A 2QPUA 3P74A 4XZWA 1A5KC 5U7SA 2CLKA 1Z8AA 3UPBA 4O0ZA 2WMGA 2OYLA 2WZEA 4JQ4A 3V36A 3APYA 4W4QA 3D6NA 5MHBA 2V8ZA 2DUXA 1QNVA 2PRLA 3G0XA 1ZAHA 1B3YA 3ALFA 2IQ0A 3GNXA 1B3ZA 3KS5A 2OVLA 1TVNA 1W5OA 3T7VA 4R9XA 3QY7A 2PP1A 4JL1A 2PA6A 3ZVHB 1J96A 1QU4A 1BQGA 2VX4A 5A6JA 3KBMA 3WBYA 2PDFA 4EVZA 4W8AA 4DPQA 3VIJA 1O5RA 2FGLA 1SZNA 1MZHA 3G3DA 1M7XA 2QT3A 5D9NA 4J7RA 1VIZA 4C6CA 3TYUA 4JTEA 4ZCWA 2CLOA 1X1NA 3OBEA 3CLWA 1BYAA 2Z4GA 1XCFA 4A3RA 1PAMA 3N2BA 1WAUA 1EJRC 3TIMA 3W72A 5I3HA 1DTNA 4C65A 1LT8A 2XIMA 2A7NA 1Q45A 1NM9A 3O3RA 4C6DA 3MW7A 2Y1HA 4GK8A 1RAKA 4LYKA 3FDGA 1SM9A 1BLIA 5ENLA 5TD4A 4GJ1A 3LGGA 3R8GA 3EYPA 1OD8A 2ZWYA 2DZSA 4JTLA 3F2CA 5BU6A 1WCGA 2OOGA 2WQPA 5HNRA 3PJWA 3GU2A 1NU5A 3QGKC 3VIOA 1RVKA 1IR2A 3VNKA 1VENA 3SR7A 3B0UX 3B8VA 3PPCA 3F2BA 1RQEA 1N8IA 2VL4A 4S2CA 4BR1A 1RVGA 4US5A 2A4AA 2JFEX 2ZZ3A 5AHIA 3WQ4A 4W9TA 2VUYA 1LORA 3MWAA 2FJKA 2BWGA 4JN6A 4K38A 3TQPA 1A50A 3NEHA 1E6XM 3EPNA 3EEZA 3BURA 1DOSA 3KWXA 5REQA 4UFIA 3L2IA 4I5UA 3FA4A 5GNZA 5C2XA 3PC0A 1T6MA 3ARWA 2F2HA 4MB5A 1LWIA 5CKSA 3MB9A 5LIYX 1RJPA 4MJMA 3BJSA 2VGFA 3MI2A 2EBNA 1UWUA 1WV2A 5D2WA 3WH7A 1IQ8A 3DDMA 1UUOA 2WSYA 3GVGA 4C90A 5I06A 1FCBA 4IG2A 1O68A 2PLJA 3HPZA 3DFYA 1V51A 3AXXA 1F3EA 4ZB0A 3CU2A 3N15A 2PTXA 1FWDC 3KCLA 1K1DA 3EBVA 2OYKA 1L6YA 1FHDA 3SSZA 4UTFA 3GNNA 2POTA 1DJGA 2VDIA 4JYFA 2VQTA 3NZPA 3H4GA 2CCRA 4PTDA 4D6JA 2CW6A 2WKJA 1ISWA 2V81A 3W7RA 2WC3A 2C13A 3VMOA 4ENLA 3IJQA 4PSPA 1VJZA 3AIUA 3MUAA 3BL3A 3H7VA 3TONA 1HJXA 2AOSA 4A21A 4Y2WA 3U8GA 1UUQA 4KESA 3VZXA 4GZJA 1CPUA 4Z0JA 1DL3A 1HL9A 2W79A 2WB5A 4H8NA 4OBSA 4KS0A 1Q65A 1NY1A 5CZTA 1XLMA 3MUY1 2PC4A 3ZJKA 4E0CA 2PWEA 1EF3A 2WHLA 4DI8A 2GDUA 1XLAA 1TPFA 4DBSA 4FB7A 3ZXWA 3GG0A 1V7AA 2PTZA 5JIPA 3UJSA 4Y7EA 4MJ4A 1ZBKA 3IUHA 4UOJA 1W9XA 3STGA 3V0TA 1NIUA 4UXDA 2NSXA 2PPGA 4RL3A 3TW9A 1QK2A 3KHJA 1JYVA 4Z2IA 2ZZ7A 4MKVA 1NWUA 2EJ1A 3JW7A 4LVGA 3WD4A 1Q2SA 4GUFA 4LAZA 3SCPA 2I5IA 4OBRA 1OF6A 3RMJA 4YTSA 2JQXA 2PCQA 2XSXA 3E6EA 3ZVHA 3BSGA 5JMUA 2XVKA 2F6XA 4GUIA 3GAKA 1AL8A 3UXAA 4ZO7A 4M7SA 2WLYA 1R3WA 4WJ8A 4GY1A 3WY1A 1MW1A 2OT1A 5BOEA 2AAAA 2VHLA 4Q6XA 3CV1A 3GH7A 5HR6A 1BGGA 5A94A 4OJYA 1HIZA 4PB4A 2YYUA 4EPKA 3GH4A 3N04A 4Q4OA 1E6SM 3EX1A 3PPFA 4HPGA 4H19A 3T08A 3A4WA 5FCZA 2XGIA 4EK7A 5HJYA 2A7PA 3H2MA 4K7YA 3UT0A 3MA8A 5EMUA 1E9YB 5GNXA 3NOYA 3CL6A 3ZR5A 3Q65A 4BQ3A 2ZTJA 2XFWA 3R0DA 3BG9A 2J24A 4M6VA 4ML9A 4TO8A 4IP7A 3GXIA 4B3ZA 4DJEA 2V67A 1K9FA 3BAJA 3DYOA 3PPGA 3NQ7A 2VEMA 3LXAA 3PTQA 2V5JA 1ODUA 1RSCA 3RIKA 3LRLA 4MZ8A 1J0IA 4L4MA 2P10A 3PBWA 3N17A 3RGTA 1W3HA 4PBFA 1EJUC 3MT1A 5D2VA 4EACA 2V5LA 3SGGA 4GIAA 3W84A 2P8CA 1HF6A 4P8WA 4PUDA 2A6NA 4I5RA 3KVMA 4URIA 1OFPA 5I09A 2J79A 3MC5A 1RY8A 3TJ4A 4O1AA 4A4AA 3BWWA 4UC5A 3R13A 2Y8UA 1ZP4A 3NPVA 3W85A 3CTLA 4GI4A 1B31A 4LXFA 3WH5A 3E2VA 3QPEA 2BDQA 4CLMA 3OTRA 3G0SA 4WEVX 4EAYA 5H8PA 1V3MA 1B2YA 3NGFA 3G1RA 3C8NA 2NV9A 4UTJA 3WQ6A 2X09A 2IXVA 3GFXA 1JCMP 1E0XA 1QWGA 4EXAA 6ALDA 3SCOA 3UU0A 1NQ6A 1R2SA 3HPAA 4PBEA 3W2KA 1K8ZA 3ZLHA 2BP1A 3VO0A 2I9EA 2X40A 5CXPA 3KZPA 1PYMA 3R25A 4DIAA 4UQBA 1V93A 1TA3B 3P0XA 2OU4A 1JCJA 1GYNA 3LRMA 4U4MA 3GXMA 1VH7A 1UD5A 3KLLA 5CJNA 2DSZA 2DH2A 4A35A 4AD1A 4AH7A 4HA1A 5DY3A 2A3BA 3FYPA 4S3GA 1UIOA 3TYZA 1U1UA 3CWOX 2FQIA 3IPWA 1XGEA 3QZAA 4YHEA 1E1EA 4S3KA 3CL8A 1YDYA 2VZUA 2BASA 1PZ0A 3L12A 1E3XA 3W88A 1E51A 3M41A 2OWCA 1XLKA 3VINA 1HL2A 3LCIA 1TYGA 3APGA 4DHGA 1NDWA 4PMNA 1WUFA 3GU1A 1THFD 3MP5A 4P7QA 4CQCA 3U5YA 3V5CA 4ML4A 3W7MA 1UP3A 3TC3A 1XLGA 1W8SA 2BOFX 4YJ5A 4S3JA 3TNBA 2YCKX 3D5HA 3EGJA 1A80A 4M7TA 2VOTA 1P0NA 4P61A 2NQJA 2PDLA 3GW0A 3FAWA 1ZJIA 2O9RA 3THDA 4OUIA 2J4GA 2ZUVA 2HPMA 7ENLA 4HA3A 1WOAA 4I9JA 3UBPC 1LBMA 2XH0A 4TOQA 3TCEA 3BAKA 4ZBCA 1E72M 1QNPA 4Q3MA 3QKEA 2V69A 4KCTA 1LRTA 4XVEA 4DBUA 4XBKA 3PVFA 4NAFB 3I4EA 2PMQA 1PIGA 3WX7A 3U6WA 3TCSA 3VFLA 3ORWA 4ZO8A 1S3HA 3LBCA 3S42A 4M6UA 3BMVA 2C15A 5BROA 2PB1A 4WCJA 2YDAA 3W73A 1G9HA 4AVOA 4DVOA 4ES4A 5CC6A 3UGRA 2VEGA 5EMMA 3GHUA 3B8TA 3E5BA 4P7OA 2WJFA 3UJEA 1XW8A 3VAVA 3SUSA 3AXHA 3BO9A 3RRXA 2XG9A 3VVGA 3K4AA 3DFSA 1IXQA 1QBAA 4NJJA 4V15A 2BODX 4JTRA 1EJXC 3WQWA 1ONEA 3B0YA 4Y9NA 4G7EB 4PTWA 2DJXA 4NUWA 1HKKA 3D3FA 3WKZA 2C14A 1SW7A 3MP4A 3VM5A 5AC8A 1X7FA 4QDMA 3LK6A 2PUZA 3GC2A 4GIRA 1WB0A 1YNYA 1XJBA 1A3HA 1KC7A 3C0JA 2ATMA 3EX3A 1FOBA 2GK1B 4GYJA 4ZSUA 1D7FA 1E43A 3QHMA 4ATLA 2E77A 3ONBA 3N9KA 1PS9A 2ZOXA 4JFTA 4YS1A 4UTKA 4LV4A 2H90A 3VI2A 4DLMA 1VYSX 3N25A 3LMZA 3RO6A 7PTDA 1XQKA 4D6EA 3AHYA 5BZAA 2VCBA 4WZHA 1I0DA 3PZTA 1EX1A 4R5EA 3SUWA 1UG6A 4XV0A 5A8PA 2Q3RA 4PRTA 3M5ZA 2VM8A 4ATDA 1JDFA 3R8HA 3T1GA 3THQA 3E3HA 4TUFA 3B3DA 5RUBA 3LSBA 2PRMA 2BY2A 1DQUA 2OQYA 3ZJ6A 1MEWA 3URAA 1PB0A 3T4WA 4QJ4B 4AC1X 4J3WA 4N2YA 1A5LC 3VD4A 3ALGA 3NQAA 5T91A 1FP9A 1MQPA 5LGZA 1KM2A 1HJWA 2WZMA 3WF1A 3S2LA 3R0UA 2BSLA 1WXZA 1DWFM 3U7VA 1YTDA 1JAEA 3ARXA 2GJLA 2CPUA 3RCNA 4IX0A 3TR2A 4J35A 5ECVA 1NFGA 4OOUA 3IUIA 3MZNA 3DHDA 2OELA 3DGBA 4OE7A 4B5XA 1BRLA 3GXPA 2PRHA 1QPNA 3E0FA 3M0ZA 1W3TA 3GKFA 4S3AA 1JVNA 5KZEA 1VQTA 2ZCGA 2QMKA 2VGBA 4WRHA 4DF0A 1VB9A 4AYGA 2HVMA 3R1ZA 1XLEA 3M7WA 4LRSA 5I23A 2WCGA 4KWWA 4UFLA 1SPQA 2EAWA 3MQTA 3LGEA 3B0PA 3ZLFA 1RA0A 4UZSA 1WKEA 2NXIA 3W1MA 3MSGA 5C9XA 1IEWA 2E5CA 3MDWA 3KL0A 3P82A 1EDGA 4GYKA 4ACZB 3F2DA 2ALRA 1UWAA 2VCCA 1DVJA 3AJ7A 3NL2A 5HMFA 4FSAA 5F2IA 1WE5A 3N2OA 5E9XA 1C9WA 3WLKX 5EMLA 1GPFA 3E12A 1H7NA 3JUGA 3W81A 4AU0A 2VFFA 3TVAA 3WLRA 2GJRA 3BG3A 3VZZA 1OFBA 3W25A 1A3WA 4I9TA 1O94A 1UZHA 5D32A 2XWDA 3PBYA 1QOQA 1M3UA 2E6AA 3P62A 3PN8A 4M24A 5HXMA 1PSCA 1L6GA 3UVAA 3G5EA 5G4HC 4M8UA 3CZJA 3LQLA 1EGZA 1Y5WA 2NLIA 3O7UA 4PRWA 2PS2A 4NL1A 4KWVA 2C71A 3VKAA 2ON3A 3A4XA 3AIEA 5C9UA 1R7AA 1QOXA 5FJJA 4UMAA 1Q8AA 5E6YA 3GG1A 3KTSA 5HPCA 1XG4A 4HSHA 2DIEA 4N9BA 4PUUA 2V5DA 2ZWZA 5D2YA 4QQUA 2BHUA 3APTA 2ZUUA 4AXKA 4Z2KA 3BLFA 5CG0A 5AVNA 2B7NA 4DO6A 1ZALA 4JTCA 2HJPA 3GKAA 6PTDA 4F4RA 3CUGA 1KD0A 4YCPA 4MLJA 4UFKA 1XUZA 3I6RA 3NL5A 4UR9A 1JZ6A 3V7PA 3NZGA 1E0UA 4NAEB 3OEXA 1TZZA 3NPXA 4D71A 5FEXA 3ZOAA 4NJHA 2I5QA 1QR7A 4NIRA 4Q7BA 1I0BA 4XZMX 1W91A 3J7HA 1EYWA 1MO0A 1QO2A 3ABSA 4M29A 3A3HA 1FWCC 2I9UA 1JF5A 3C52A 4MOZA 5CBJA 5CPOA 1G7VA 1UQYA 4FF5A 1K9EA 5BXTA 2EEXA 3RXZA 4REQB 4LEQA 3VIHA 2G0WA 1SSGA 1JR1A 4HNOA 1FWRA 1BF2A 1OK4A 4JOMA 4GD0A 3SIMA 4HSOA 4HCDA 2QJIA 1CENA 1ZBVA 3PWGA 3VYLA 2FGBA 6REQA 1PTGA 1SFJA 2GK1A 1MQQA 4PCSA 3EWCA 5K4ZA 2VXNA 2VZOA 1Q5MA 3PNZA 1PKLA 5C7HA 3W22A 3K8LA 2PEVA 3LZ5A 3N2XA 4GG9A 3TEVA 3LPGA 1OK6A 3GUWA 1S5WA 4UTIA 4K36A 4QBXA 1FKXA 1DQXA 2Y88A 4AD3A 1BVZA 4A8RA 1ZU8A 1VCFA 2Z1XA 1S5MA 5A5WA 5HQMA 4W7UA 5T9BG 1TWSA 3NXFA 3W37A 1JCNA 3K8KA 4RDVA 2QUMA 3GIQA 1DPMA 4GWEA 4QRNA 2W92A 5D03A 4WOZA 1XYCA 2QGHA 5JUVA 5HWJA 4Z1AA 2XYLA 1QRQA 1Z48A 3ID7A 4RCXA 2D22A 3L68A 1JXKA 4W86A 3QR3A 1CXKA 1TCDA 1EP2A 2OXNA 2RKXA 3VGFA 1E9LA 2FVKA 5I3IA 4L65A 5KZ6A 4H83A 3LCLA 4MY1A 2CZ5A 1PKYA 4XTDA 3VOFA 4DELA 3W83A 1MDLA 2E6DA 2XDFA 4NILA 5C55A 4G5DA 4ZTXA 1JFXA 2NXHA 3EWUA 1UH4A 2OODA 4IXHA 1KGWA 2NV1A 2PDNA 2Y7EA 3CIVA 4FO4A 4O1BA 2X1TA 5M1TA 4D8LA 1WA3A 4GZIA 3GFZA 4H9ZA 5HATA 2DZWA 3TTYA 4LSBA 1SZFA 3U2CA 4YCOA 5DT5A 5A8QA 3EB4A 2CLIA 3VDHA 3AWOA 2YOCA 5I00A 3GVRA 1KQYA 4GX8A 3BOFA 1P5BA 4NZ5A 3W2LA 5G5IA 3GDRA 3L67A 3GS6A 4PZVA 2Q6ZA 5A6SA 4NNCA 4XVDA 3T0TA 4PMRA 5IBXA 4PEEA 4X0VA 1WBJA 3AHZA 2VR4A 3HB9A 5KZMA 2J88A 1GWJA 4U28A 1UW9A 2GQ3A 3C61A 1KM0A 3AHVA 2ZXBA 3C3NA 3T2PA 3ANYA 3IIZA 4JHZA 2FZ8A 2HSAA 4DWSD 3P8JA 1UCWA 3N9RA 1ZL1A 3A21A 4AY7A 4UTWC 1PZ2A 4AQLA 4YTUA 1VPQA 2XM2A 3NQDA 3KW3A 1OCQA 4DJDA 5XIAA 1UKOA 3FEQA 2ANUA 3W6LA 1O60A 2ZX6A 1IIHA 1TX0A 5DBTA 4GUGA 2YCJA 4KPLA 1UROA 3B0XA 5HANA 3T9PA 1IV8A 4UCGA 5KMYA 2CHRA 5LXXA 1FDJA 4B4FA 2PF8A 1O6IA 4JEQA 3C56A 2EF9A 1J8VA 3N29A 3OHMB 2E5DA 2HXUA 1DKWA 1Z6KA 2VFDA 1UBSA 3NL6A 3RLGA 4W85A 3HFYA 4FALA 3NTYA 4CU6A 3HGJA 3WIJA 1QHZA 4H04A 3SO7A 3DYMA 2GGJA 3G1FA 1K4GA 4UQCA 2XIOA 4DY1A 1OFRA 3VPLA 1E1CB 1LQAA 2YFNA 4QAWA 4N4PA 4EP8C 1GQLA 3GYCA 2D24A 3QV8A 4R9OA 4NAEA 1U5VA 3M46A 3URNA 5F4SA 1CGWA 4DI9A 3P80A 3G1DA 3H2CA 4YHGA 4DBEA 1TPDA 2OFJA 1V3IA 3QZ6A 3WQOA 4JIQA 1UBPC 5A2AA 3H6OA 2VTFA 1SZEA 2PDIA 2O4QA 2VR2A 1DXFA 4BJHA 2HTMA 4A2RA 2JALA 1VJIA 4REQA 3CQHA 1S2UA 4LEFA 4AZCB 3L4VA 1HJSA 3FYYA 4UBPC 3EB3A 1FHUA 1LRQA 2XWEA 5CGTA 3VIFA 2XIJA 3QQWA 5KZDA 3CO8A 1BAGA 1MFVA 3CHEA 1AQ0A 1UYQA 3CPRA 4E2OA 3C3UA 2R82A 4JTAA 1UUMA 3N34A 4J2MA 2C18A 1X97A 3QQ0A 2P88A 3CS2A 3T55A 2NUYA 3UFYA 5LIUX 5HMDA 1QPQA 4Y8FA 3IV3A 4CN1A 2FZDA 2A3CA 4IFOA 4DWSB 3LCGA 2E25A 2VFHA 3W7CA 1VYRA 3HQPA 5CPNA 2VC6A 3W76A 3QEZA 5E0FA 1V3HA 1VBGA 3VDCA 3QOKA 3W82A 2PE4A 2TAAA 1VRDA 3QXBA 3MV01 4MAZA 1BD0A 1OVDA 3GNOA 1KR0A 3EWWA 3S3GA 2WOQA 1K6AA 4JPGA 2EPKX 3OLEA 4ADSA 4H6KA 1GQKA 2BZNA 4XAZA 4O8AA 1AH3A 1VBUA 3E74A 8TIMA 3B03A 1TV3A 5I6SA 3W38A 3DFNA 3H4XA 4MJZA 3NVDA 2VURA 1SVDA 3TXZA 4H7CA 2RDXA 4O1CA 3NG3A 1LL6A 1F05A 3M47A 4N6EA 1US0A 4HZ6A 4W7WA 3TZFA 2Y8KA 5HINA 2ICSA 4JNMA 4ROQA 3TOYA 4P8VA 3M5XA 4A6GA 2CZDA 4J28A 1KCKA 3W23A 3RM8A 3F5KA 4EF8A 3WFLA 1P1XA 1RCQA 2ZVRA 2OGJA 3BDKA 2VX7A 1HVXA 1PCKA 4IMAA 4M3PA 3DHUA 4AISA 4PH6A 2AQOA 2E6YA 1DORA 1K7FA 2ZVIA 3PJXA 4Q4PA 1FHLA 1G4PA 4GPNA 1EKOA 3I7QA 2VKZG 2BY1A 1TMQA 2DP3A 3ITGA 3RPMA 2BMBA 3RCMA 3EWYA 4M0XA 1NH6A 2EGZA 3O0KA 1MDRA 4RNJA 4HZMA 1XP3A 4LYQA 2IKHA 1F7BA 5M2FX 2W0UA 3UG3A 2PU1A 1IWAA 4F9JA 3LHWA 3WUFA 3WDQA 2DW6A 4UTUA 2F9RA 3N6QA 2ALDA 1W3IA 2HCVA 5LNUA 1ADSA 3NQ2A 2WJEA 2A0NA 5F4XA 1BYCA 4ZODA 1C8XA 3W00A 1FBAA 3GXFA 4N9CA 2OZ0A 1H0IA 2ADAA 4UTLA 2PWUA 2TMDA 4UNLA 4JIEA 1KFWA 4HHPA 1XR2A 2CETA 2G4JA 1JZ7A 3K1DA 4KW2A 4MY9A 1E55A 3KRSA 3WDIA 3DFHA 3EWZA 3B06A 1GZGA 4PTXA 4IQLA 3OQEA 2BGQA 3C0LA 3A4AA 3NYZA 1D8CA 3W1RA 4XIMA 1UR3M 2PWDA 2V5CA 4FX6M 3K2GA 4LTSA 1C8YA 3WBEA 3W7OA 1J93A 1EDQA 3LNMA 3OHIA 4OWGA 1TVLA 4D9PA 1OYBA 1RCXB 5IFPA 3UCCA 5K9DA 3TX9A 3WF2A 3VE9A 4GC3A 4MF4A 1E1CA 4GVFA 2OZTA 4YIWA 3VU2A 3PULA 3NEVA 3CEPA 1EX5A 4O1EA 3KAOA 1FWIC 4FIQA 1MYRA 1G67A 2PLKA 1XQLA 3KBWA 3F4CA 4RE4A 3UG8A 3KTCA 4HN8A 1EZ2A 3G2GA 3UZZA 4HMEA 2FDMA 3VD3A 1R9ZA 5F1UA 5HJXA 2NLYA 1UWTA 1YPXA 2SFPA 1YMYA 2QCCA 5CPSA 5LYRA 1TMLA 4AZCA 1RV8A 2XH2A 3EWXA 3CIXA 3L0NA 4L9ZA 1K3UA 2HMCA 3KFTA 3LHZA 4DJFC 3I6EA 1M6JA 5CSSA 2QZRA 3MWCA 3ZFHA 4CVWA 1RPXA 3CHCA 4I90A 5EKYA 2ESCA 3P5YA 4MWAE 4FNQA 1CGVA 1SFTA 3CZLA 1XGDA 3OZPA 1FY6A 4KRZA 4XZLX 5E9AA 3GAYA 3WF4A 1R86A 2HPIA 1Q6FA 4AVFA 4AXNA 1TIWA 4XAFA 4B9YA 3II1A 2GPTA 2ZDRA 1R8LA 4HYRA 4AWEA 3OW1A 1QI4A 4ZTYA 3H55A 3JZEA 3QQ1A 4IGSA 3QJAA 1BXCA 4KCWA 3CPUA 4O0KA 4ZENA 1M7PA 3GSMA 3PZUA 3OIHA 3DHFA 2TSYA 1UPMB 4CU7A 3EWDA 4JICA 4MY8A 4CKQA 4M19A 1GOQA 1MQRA 1CGUA 3AJXA 5DMLA 5D02A 3VGGA 2IPFA 4JX6A 2Y5SA 3GTHA 3ZT6A 1FVPA 1DJQA 4X0NA 3ERPA 1CXIA 1VCGA 3G6MA 1E6RA 3WJXA 1MXGA 4K2SA 2WMFA 1RLDA 4JYEA 4KWUA 1UD8A 4IGMA 5DXXA 7TAAA 3UZ5A 3DU0A 2PSNA 4LQ1A 4KQNA 3URBA 3WLJA 1XLIA 3MMTA 2E3ZA 3GW3A 1VS1A 3WDJA 4BQ2A 3DI0A 4HTBA 4CCEA 2WK2A 2DT3A 4IL0A 3WDPP 2QF8A 4PMDA 3VKBA 1ZS2A 2VC5A 3WLTA 3L5AA 1K8CA 1B30A 1WDSA 1G69A 1Q4NX 1OGBA 5FF2A 4UR8A 3G22A 1NSJA 4ZOBA 2C7FA 2Z7KA 3TWAA 1Y5VA 1FWJC 2RDTA 1KXVA 1O4UA 1IEVA 2CYGA 1IYXA 2HDJA 4JX4A 1UP2A 3CK5A 1ZENA 1SO4A 2D3LA 1XIHA 4X9YA 2JIEA 2YXXA 3MMWA 4GI6A 4M82A 1C7TA 4NI3A 1QNOA 4MB4A 1F76A 3ARPA 4DUWA 4V28A 4L4PA 1E5JA 1QJWA 1MFUA 1MUMA 1QO5A 1W3NA 5AB3A 1RZMA 5EYWA 5E5CA 3AYSA 1PHWA 2FPTA 5I3GA 1Z44A 1AMKA 3U48A 3QY6A 1KGUA 3EPMA 4UQ9A 2PI6A 1YX1A 5HULA 1LOLA 1QW8A 2R1PA 2O9OA 4HOZA 2CESA 1EHNA 3L21A 4PB3A 4O1DA 3WN6A 1EP1A 1YDOA 1W56A 3M0KA 1RH9A 3KOYA 1LYXA 5K9CA 3M0MA 3P61A 3BARA 1C3FA 1TV5A 4A8IA 1Z89A 5DRCA 3VUSA 5JVLA 1HXJA 5FSDC 1XPYA 4PUJA 2PURA 3BLDA 1BKHA 3S1WA 1A0CA 2W91A 3K1GA 3UEQA 2PDGA 1L8NA 1XYBA 4O54A 2QV5A 1PX3A 2F6UA 5HDRA 1UR2A 2QCFA 4RNIA 4CNSA 4E6MA 4TX8A 5BXPA 3UXIA 1FH9A 3R6IA 2W5FA 4KETA 5FAJA 1G94A 3SAZA 2CC0A 5EPDA 3ZT5A 3IGUA 2V5KA 5DF0A 1SJBA 1AK5A 5A8MA 4WK9A 4NXSA 3S2JA 4TIMA 5G1YA 3WFZA 1V6YA 5FEWA 3RLVA 1F8IA 2F6KA 5FEPA 5IRPA 4WQ6A 2I7GA 1UC4A 3S46A 2ZC8A 3IIVA 3QFEA 3P2VA 2CZVA 1XIEA 3QH2A 1G6CA 1B1YA 3MBFA 1VLWA 1JPIA 4XK2A 3O0FA 4CCCA 3ZSTA 5EU9A 1RPKA 2DV0A 1TPWA 2W6RA 4ZGYA 4AZ7A 1XKYA 4BFAA 1GJUA 4FOUA 2PDBA 5F4WA 1V6VA 3CT7A 2V38A 1QNQA 2A5HA 3GLCA 4GYPA 2O9TA 4D6IA 2X0HA 1EUAA 1HO1A 3U9IA 1RHCA 5CBBA 4UIOA 3UPWA 4QJ3B 3GM8A 4IMDA 4EXQA 2PWHA 1HT6A 3LCXA 1W1PA 2XJ7A 3TLLA 1XIDA 3NDOA 2YZ5A 5G4WA 2ZX9A 3O05A 1IT7A 2OSWA 3F1QA 1TQXA 2CBJA 4H9VA 4F2UA 3HU7A 4Z1DA 1X39A 2ZE3A 3N9SA 5AYBA 3H54A 3V18A 1WDPA 1BYBA 4R85A 2NXGA 1L6FA 1Q6DA 5D37A 3VD5A 3H2OA 4LCSA 2VWSA 1CLKA 1G7UA 4RJEA 2JEPA 2J8GA 4N0RA 4E8CA 2RJGA 3QPZA 3VZYA 4ICNA 1T41A 4LB4A 4YVXA 2J77A 2YA0A 4I7UA 2XN0A 2HISA 1ZLPA 3NDYA 5J5DA 1HKIA 3RK8A 4O18A 3EDKA 4G8TA 3AC0A 4IIHA 2DVTA 3W2MA 3A3WA 3TC6A 4OECA 1SJCA 3WL1A 4AIUA 3FK4A 3UJ2A 4NSBA 4AEFA 3DFPA 1H09A 3TJXA 4XBSA 4DUXA 1EJVC 1UZ4A 4IJRA 2V2CA 3QGAC 4IQEA 4FAMA 1M7JA 1W3KA 3R58A 4BF9A 4IPLA 1X6NA 1R3TA 4X22A 1I4NA 1UP0A 1AZ2A 1GJPA 3THCA 3FYOA 3OB8A 3R11A 5BWFA 3B0VC 3U3HA 2TPSA 3LQGA 1AD1A 4BCEA 3CUIA 5JIWA 3SCVA 3V16A 4NZCA 2XINA 3IJ6A 1LLOA 3MKKA 2GVGA 4ICCX 1NDZA 2HVNA 4NASA 1W9VA 1VFLA 3WLLA 2OTDA 1ZP3A 1TJRA 4M1RA 2VEPA 3GBEA 1U30A 2X2YA 3ZR6A 5IDZA 5FJOA 1C8VA 1FCVA 1U1HA 1V5XA 3ARUA 3CB3A 2OWWA 3WLMA 3M43A 4R7WA 3A5VA 1T7LA 4R88A 2XIQA 1W9PA 3GNRA 3KBJA 3BQ6A 3Q58A 2R8WA 2PDMA 1DE5A 1WBHA 4S3EA 2J47A 3CHFA 3SQMA 2V2HA 4YNGA 3CMJA 1CXHA 2B0MA 2ACRA 2CLHA 4WJXA 4S3BA 2PFHA 2YB1A 2R94A 1GOXA 1POJA 4XBJA 9RUBA 2FGZA 2JKPA 4M5PA 1YXYA 3PWAA 3UG4A 1KCZA 1QI2A 4Z0SA 4JYDA 1LP6A 4FIRA 1AVAA 2XU2A 3W1PA 1FA2A 2W3ZA 3I3DA 3REQB 5J8LA 4YYFA 2OB3A 1SUXA 4J27A 1JDEA 4J9JA 4GO9A 1WUEA 2D0GA 3S0CA 5D9PA 3THUA 1G4EA 2QV4A 4LS2A 3H2EA 3PK7A 1F4AA 1V03A 3W24A 3H4WA 2VENA 2WPGA 1Z7AA 1UD3A 3VGHA 2A21A 5G1MA 2WYSA 3IVUA 1US2A 1DIOA 4IX2A 4E4FA 1R30A 3BW4A 2W63A 1IWBA 5HWNA 4UB9A 3SFKA 5AC7A 5EMKA 2D2OA 3M64A 1KBIA 3E0LA 2OEKA 2OSXA 1X98A 3LI1A 4LBSA 3GYEA 4FNSA 4TMBA 4PA8A 2AGKA 2VGGA 3V1HA 1TSIA 3VDBA 4H1ZA 3S1VA 1P6CA 3GR7A 2ZRYA 5HMSA 1XIBA 4XKMA 2E7FA 1GTEA 1IT0A 1X1ZA 4ZXLA 4GZ7A 1KKRA 5D33A 2YFOA 4GQ0A 5CZJA 2PD9A 2J7EA 8CGTA 3A5FA 3UZXA 3WUGA 1J6PA 4FI4A 4KT2A 3KCJA 4YL2A 2JEQA 3CUXA 2I57A 3G0UA 1VPXA 3LHVA 4ZE4A 3A9BA 4RZ4A 4XUGA 3FKRA 4QSHA 1T40A 2XTKA 3DH7A 5F7UA 3INPA 1LOSA 1A5UA 1OQFA 1JAKA 3UWEA 1V79A 5BCAA 4UMBA 4MWAD 3THAA 3CEUA 1P0KA 1H1YA 2XSBA 1H5YA 2DZXA 4IP4A 3ZM8A 1H3GA 4PCPA 4D6DA 4QE4A 5GJPA 4OU1A 1BWKA 1JNDA 1Q8JA 3RX4A 4J3ZA 5T8GA 5D9MA 5C54A 5BU9A 4BK9A 2FPVA 1VEOA 3EOEA 3T09A 4YTTA 1TPB1 3G1YA 5EA9A 5JU6A 1N7KA 1OBAA 3N6HA 1XUUA 3RLUA 4CEXC 4JQ1A 4B5UA 2WBGA 1F4HA 4Q4RA 4Y90A 2Y0FA 3O8AA 4JIHA 3S6TA 3P6LA 1XWYA 2OMAA 4LUIA 3LX9A 1AW1A 3FIGA 4LALA 3OPSA 3TSMA 3MCNA 3TZNA 1ECEA 3ITOA 5FKYA 1IHIA 4GVGA 4LY8A 3IACA 3GNPA 3DCPA 1YYAA 1H51A 1IF2A 4NJGA 1Y65A 3SQLA 3QBUA 2YLLA 2J74A 2QS8A 1XIGA 2WJZA 1VKFA 2X1UA 3KZSA 3NJ3A 2O0TA 3FW6A 3PZ9A 1XS2A 4A8LA 3QHNA 4CQ8A 3OGVA 1DWIM 1KRMA 1GQNA 1HG3A 3H2AA 2WPBA 1CW2A 1H63A 1OX6A 2NQ9A 3DFOA 2PDXA 2QDEA 1KRCC 2GGEA 1QNRA 2VZTA 1AA1B 2QYGA 5HBFA 1JI2A 4RNHA 4PSRA 3S1UA 2UY5A 3GR4A 3SY1A 1JQXA 3AS2A 2WHKA 5LKYA 3CZEA 1X38A 2WZHA 5A8OA 2HV5A 4JN8A 3R79A 1I2PA 1VAHA 3AYVA 4WDTA 3UA3A 1PIFA 4R34A 2CXGA 2VVSA 2I17A 4CCDA 1DWAM 2MNRA 2NVCA 4XAYA 2B81A 3W86A 3S6DA 2YBUA 5E70A 3KVKA 1XSJA 3CMGA 4BI5A 4US5D 4MWAB 3WDRA 1R9XA 4DBDA 2CLLA 4AF0B 2IS7A 4DZHA 4DLFA 1L9WA 3V3WA 4V1XA 4IWWA 3REQA 4EXBA 1RD5A 3BAXA 3TTOA 5M3WA 1JJKA 5C9RA 5AYXA 1ZCCA 4UFMA 4EIVA 2J8TA 3B9EA 1WKYA 3QYQA 3EZ4A 1ZGDA 3A6OA 4B91A 1F73A 3SRHA 2F61A 1P0BA 1W2VA 4AWUA 2NWRA 4PRRA 4RXGA 3BAWA 4KCUA 3BAYA 5CC7A 3UXDA 1AJZA 1EXBA 5ABFB 2R1NA 1HFBA 1OZMA 2R9RA 1DJNA 3WG6A 1QHPA 4C7DA 2X1SA 4DYJA 2O9PA 1AJ0A 3UR5A 2NQ5A 1OWQA 5J5RA 4QGCA 3LXBA 1YDNA 2XVNA 1LUCB 3W1UA 1RP8A 4ZOEA 3OOQA 1J0HA 3OJGA 3B97A 5I77A 1IT8A 4C6BA 1Y0EA 1ZB5A 1LRNA 2BS9A 1A0EA 5LNWA 5HPOA 1JZ5A 4W88A 3PUOA 1GQIA 4RDWA 1QOPA 4F48A 2J6VA 5C9ZA 3GQYA 4B92A 2VCAA 1N8WA 1W32A 4KEUA 3IGXA 3QM3A 3NVTA 1BVWA 4QR6A 1R46A 3D46A 3ECQA 1Q6QA 5H2ZA 1Q6EA 1TVPA 3FX4A 5EBUA 3M9YA 2AL2A 3TTEA 3B8DA 1YNQA 2YBVA 1TV2A 4UFHA 4CNNA 1XLDA 5F2MA 3U4FA 3TR9A 3RMEA 3AMCA 1A5SA 1R5YA 3KCOA 4HNCA 3O6AA 5A8NA 4FXRA 2EG6A 1NDYA 4DNHA 2BB0A 3SCUA 3AQUA 4LWWA 1PTDA 5EGRA 3S1GA 2DIKA 5DCBA 1KM1A 4LF1A 1TPC1 3ITYA 2HNEA 5EMYA 4NZ4A 4O11A 1D3GA 2CERA 1LLZA 1AW5A 4R27A 3LU2A 2PU0A 4OKDA 2WCAA 2P3ZA 1S46A 1FWFC 2VX5A 2HBVA 3KOZA 3WLPA 1VF8A 3V0SA 2BY0A 1ADOA 4QLJA 5L6UA 2PTWA 4LYRA 3W71A 5LSMA 1J0KA 4PL1A 4GUHA 3STPA 1UB3A 5REQB 3WJYA 4I9AA 3UR7A 2GVJA 1CNVA 3BV4A 3FEMA 4F2TA 5LIXX 1MW0A 3WBXA 3IVSA 1I2NA 1JZ4A 2VFIA 4O13A 3W1TA 3SRFA 1VHNA 1W1A1 4CD8A 3S9YA 4EF9A 2D73A 2QJNA 3DG6A 4O4VA 5JBFA 3EKZA 2A1YA 1JCLA 4OZOA 4HHHA 3BK0A 3AUJA 4IG2B 2C1GA 3OP2A 2A3AA 1C8QA 3QV9A 3CL7A 3AYTA 3AMDA 4N4QA 1EJ7L 3URQA 1H7XA 1E1FA 1W5QA 3DESA 3BANA 5I2UA 4NX5A 2BHYA 3NAVA 1UWIA 1N2VA 3UETA 2INFA 2QUVA 4LF2A 4I3GA 3IJ7A 4UTTC 1WZAA 4KRTA 3GVVA 2GUBA 1PWMA 2A79A 1KV8A 2FYMA 4DAIA 3JVAA 7REQB 2QAFA 1E70M 4RE3A 1C93A 2OGYA 5CPTA 1DXIA 5A2BA 3EOSA 2QNEA 4DJED 1EO7A 3H21A 3UWWA 2ZZ2A 4AD2A 4DRSA 3CB8A 1NJJA 3UCDA 1I1WA 3AU6A 2VMFA 3AS0A 1JPDX 3PTDA 4B3KA 2OQLA 3HMJG 1GHSA 2GQ9A 2I5GA 1E4IA 2GQAA 2NV2A 4ROPA 4WUIA 2G97A 3HG2A 4JZ5A 3AIQA