4C6MA

Crystal structure of the dihydroorotase domain of human cad bound to the inhibitor fluoroorotate at ph 7.0
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
363
structure length
360
Chain Sequence
KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGRPPPGFPGLETMLPLLLTAVEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CAD PROTEIN
total genus 116
structure length 360
sequence length 363
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6mA00
3UPMA 1FWGC 3RCMA 1NFGA 4LAOA 2YXOA 4IFOA 3URNA 2DVUA 4DLFA 2HNHA 3LA4A 2DVTA 1FWHC 4XD6A 1XRFA 1PTAA 1RJQA 2ICSA 4BJHA 1UIPA 5HMDA 4DI8A 4NG3A 3CJPA 2PGRA 1RAKA 4GX8A 4KF1A 1UMLA 3F2CA 2Z29A 1POJA 3UF9A 4H9MA 1QXLA 3F4DA 1A5KC 4RDZA 3NEHA 4LFYA 4OFCA 4CEUC 4C6MA 3E2VA 2D2GA 1ITQA 4LCRA 4IH3A 4GY0A 3K2GA 3LS9A 1V7AA 1YIXA 1EJUC 4H00A 2O4MA 1V79A 2F6KA 4GY1A 3LGDA 3K5XA 2Y1HA 4XAGA 4UBPC 3F2BA 4RZBA 2FVMA 3QY7A 3GUWA 2P53A 3ISIX 2HPMA 2RAGA 4IG2A 2AQVA 3RN6A 1M68A 3A3XA 1EJXC 4QS6A 2R1NA 4L9XA 1WXZA 4QROA 4G7EB 4C6QA 2Z2BA 1KRCC 2ZC1A 4PCNA 1A4MA 4XD3A 4GY7A 3GTXA 2HQAA 2Z25A 2QVNA 1PSCA 3GRIA 2GWNA 2D2HA 2Z26A 3LNPA 4KEZA 3ITCA 3S2MA 4F0SA 3UR2A 4NI8A 2YB4A 1EJVC 3N2CA 1V4YA 1V77A 4CQCA 2PUZA 3A4JA 1FWAC 3IV8A 3E3HA 4IGNA 4PE8A 1P6BA 4G2DA 1GKPA 4WGXA 4DZHA 2Z4GA 2Z27A 4CNSA 4L6DA 3URBA 2G3FA 1IE7C 4HJWA 2EG6A 4YIWA 2VM8A 2E25A 4GBDA 2R1LA 4LCSA 3MDWA 1FWJC 3OJGA 1ONWA 4RE0A 1NDZA 4KEUA 3B0YA 4XD4A 3GU2A 1DPMA 2OB3A 3O0FA 3OVGA 4KETA 3AUOA 4ERGA 2R1MA 1QW7A 1HZYA 1XWYA 2FVKA 1RK6A 1YRRA 1J5SA 1YNYA 4I6VA 3TN5A 4R88A 4INFA 5LXXA 3IRSA 3OODA 4KERA 4GK8A 2ANUA 4QSFA 2BB0A 3LSCA 3TN4A 1FKWA 3T1GA 3NQBA 1O5RA 3CAKA 2Q09A 4EPKA 1M7JA 2OQLA 4BKNA 4WHBA 2Z00A 2WJEA 1PO9A 3LGGA 4XD5A 1W1IE 3HM7A 3HPAA 2Z7GA 4LANA 4DYKA 1EYWA 3IARA 1XRTA 4QRNA 4DNMA 4GYFA 4E3TA 4H9UA 3TN3A 3URAA 4C6OA 5FSEC 4V1YA 3K4WA 1R9YA 3R0DA 1GKRA 3O7UA 5G4HC 1NDVA 4DZIA 1J6PA 3T8LA 3UBPC 3SFWA 3BE7A 2VR2A 4IFRA 1EF2A 4H01A 2DVXA 1O12A 4UB9A 1EJRC 4CQDA 2KAUC 1V51A 1P1MA 1UIOA 4GXWA 3S2LA 4J5NA 1FWIC 3MVTA 4WVXA 4ZSUA 3PAOA 3TN6A 2E1WA 3EGJA 4B3ZA 4LEFA 4IQJA 3T81A 1EJTC 1GKQA 4LALA 3E74A 1FWCC 4IGMA 3WZ0E 1A4LA 2Q01A 1J79A 2FTYA 2A3LA 3MKVA 3MPGA 4PBFA 4F0RA 4GOAA 3URQA 4D8LA 3QY6A 3AU6A 1E9YB 4C5ZA 4LAKA 1EJWC 3GTHA 5AKQA 4C6DA 1RK5A 2HBVA 1S3TC 4PBEA 4IFKA 4P5UA 1BF6A 3EWCA 5HMEA 4C6IA 4H9YA 1RJPA 3B0XA 4H9VA 5E5CA 4C6KA 2UBPC 1YBQB 1R9XA 1RA5A 3FDGA 4LCQA 2IMRA 2FTWA 2CZVA 4C6FA 5HMFA 4C6EA 4QS5A 1P6CA 3GU1A 1ONXA 4EPBC 3ORWA 1FWEC 1FKXA 4BY3A 3G77A 2EG8A 5CH9A 2YB1A 3MJMA 4IG2B 4ERIA 4GX9A 4Z42C 1FWBC 4CQBA 2GZXA 2Z28A 4HK7A 4C6BA 3LY0A 2WJFA 1ITUA 4KESA 4V1XA 4AQLA 1A5MC 2FFIA 1I0DA 4ERAA 4XAFA 1YMYA 1UBPC 3MVIA 3KM8A 4F0LA 1RA0A 4LAMA 4IFKB 4C65A 2I5GA 4H9ZA 4AC7C 1RJRA 3V7PA 3OU8A 3S2NA 3LU2A 1ADDA 3GG7A 2VC5A 1EZ2A 3ID7A 4JOMA 3SO7A 2R1KA 2WJDA 3IJ6A 3DUGA 4B90A 3WMLA 2HPIA 4PCPA 4H9TA 3PNZA 2YZ5A 1PB0A 4HK5A 3UR5A 2PLMA 4GC3A 4HK6A 2GSEA 3MDUA 4B91A 1K1DA 4C60A 1FWDC 3LSBA 3CS2A 3ICJA 3FDKA 4M51A 4C5YA 1M65A 4R85A 3S2JA 1KRAC 1E9ZB 4R7WA 2VC7A 3GTFA 4CNTA 1VFLA 4DLMA 3E0FA 1XGEA 4XAZA 2R1PA 3IACA 3A3WA 3DC8A 2PAJA 2VUNA 3MTWA 4HA0A 1FWFC 3AU2A 3E0LA 1NDYA 3QY8A 1NDWA 1J6OA 1JGMA 1A5LC 3RHGA 3PBMA 3QGKC 3GIPA 3C86A 4XAYA 2Z2AA 4KIRA 3RYSA 4G7EA 4EP8C 3QGAC 3D6NA 4J2MA 5FSDC 1YBQA 2I9UA 2QS8A 3HTWA 2PGFA 1K70A 4LH8A 3OOQA 2GOKA 2W9MA 2AQOA 4CEXC 3MSRA 1K6WA 2EG7A 2ADAA 2BGNE 3EWDA 3IPWA 3F2DA 2OODA 4IF2A 4QTGA 4NP7A 4KEVA 1WXYA 4H9XA 1A5NC 3E38A 5A6TC 2VHLA 3DCPA 4ICMA 2OGJA 1R9ZA 2Z24A 4C6LA 4I6KA 4C6CA 2OOFA 4EPDC 4GZ7A 4RDYA 4C6NA 3PNUA 4DO7A 3GTIA 4RDVA 4RDWA 2WM1A 2HBXA 3PANA 3FEQA 3S4TA 4B92A 3IGHX 4MUPA 2P50A 4DI9A 3GIQA 2O4QA 3NURA 3F4CA 4EPEC 2D2JA 4TQTA 2GWGA 1KRBC 3TNBA 1ZZMA 1KCXA 2QT3A 4CNUA 1EJSC 2QPXA 3GU9A 4KQNA 2AMXA 1KRMA 3B40A 1I0BA 2XIOA 4C6PA 1POKA 4ZSTA 1A5OC 3WYZA 4DIAA 2UZ9A 4C6JA 3OQEA 4J35A 3JZEA
chains in the Genus database with same CATH superfamily
3FEMA 7XIMA 2TAAA 1FCUA 3GXPA 2PF0A 2XG9A 1CB2A 2ZUSA 2QUNA 2XGIA 1LQAA 3QHNA 2XSXA 3OA3A 1AL7A 5C2XA 1NH6A 5TQLA 3OHIA 1WAWA 1DWJM 1V5XA 4H8VA 4XSMA 2Z29A 1XQLA 5MKGA 4AIUA 4MAVA 1WZAA 4QJ4B 4D6EA 1L9WA 5HMSA 3FVDA 3FAXA 4AYGA 4CVWA 5I79A 4QCEA 4E8CA 1FQ0A 2PBOA 3GQYA 3PK7A 4ZVJA 3DERA 2R94A 2GDVA 4WSJA 1PZ0A 1Q7QA 4XAGA 2FVMA 1BWLA 1XF0A 3U3HA 2VDIA 4GQBA 4LB4A 5KMYA 5A6JA 3WF4A 4U2YA 1YPIA 3TH6A 1JULA 7ODCA 3S9ZA 4JN7A 4XD3A 1EYEA 2HQAA 3SQLA 3DFNA 3VOHA 1VFUA 1DXIA 4K8GA 2A3BA 2QHAA 4G56A 3WLPA 5AC7A 1RCOB 3UCQA 1BVWA 1MRQA 3WY1A 4J3ZA 1DL3A 3SN1A 4Q4SA 1FDJA 3N4FA 2WMIB 2NV1A 3IV8A 3VNMA 1T7LA 3WSUA 3JVAA 3TQKA 5A6MA 4CNSA 1W5OA 5CSYA 2VP8A 4H7ZA 4B5TA 4MWAE 2VM8A 4CCDA 3EA3A 4JIQA 4AF0A 1ADSA 3CB3A 5A3HA 3B8SA 1HZYA 1ALDA 4XKYA 3WLMA 4A8RA 1AD4A 1UP2A 5BMXA 5CPQA 4PTDA 1U22A 4AIBA 1XYCA 4XISA 4KERA 2WVSA 1EO7A 4WOZA 1XSKA 2JALA 4GACA 5HA7A 4DELA 2XJ7A 3TTQA 3IJLA 1I9CB 4LQ1A 3VCRA 1WE5A 1RP9A 3LGGA 3HGRA 1V08A 5I3HA 3U7BA 3QJAA 3HM7A 3UESA 4GYFA 4E3TA 5BU6A 4D72A 2Y8VA 4RV3A 1UD2A 4F40A 4O1FA 3DFQA 1MDRA 4L7ZA 2VR2A 3C2OA 4HNUA 4JTHA 4UB9A 2KAUC 4Q3MA 3PY2A 3B9OA 2G37A 1EQPA 3KL3A 4M6PA 1F3TA 3TN6A 5FACA 4A35A 4B3ZA 2R8WA 2PP1A 2QKFA 1EJTC 4DZAA 2HISA 3DN5A 4NJKA 4AD0A 2O9RA 3TIMA 3LQLA 2Q01A 3FK4A 3HGJA 5HAOA 1EOKA 4M29A 4WJ8A 2UY2A 2MNRA 5LNUA 1UR3M 1AQFA 1ZBVA 1LROA 4I5XA 4KCUA 1W56A 4C6DA 2XISA 7PTDA 2G4FA 4DBEA 6REQA 4IFKA 2Y2WA 4QG9A 4H9YA 3VZZA 3L21A 1EGVA 3MI6A 1GJWA 3CTTA 1VB9A 5GPRA 4QGCA 1FCVA 1TJPA 1YBQB 3WELA 5BXPA 4ZBCA 4LCQA 2FTWA 3NSXA 2J47A 3P2VA 2ZXQA 4CU6A 5A2AA 3ORWA 3K8KA 9XIAA 5F1VA 2EHHA 1LUCA 2YL8A 1ZCCA 2B7QA 2ZXBA 4J3WA 4CQBA 3FN9A 3KEHA 4MYXA 1WXJA 2VI0A 3BLOA 1P48A 3EOOA 3EB2A 3B9NA 1DWAM 1M41A 1W1A1 4DUXA 2FZMA 3CT7A 1CWYA 3UR7A 3W6LA 1E72M 2XZ9A 1RD5A 4EXAA 3RXZA 4HA4A 4JTKA 4LB3A 4LJ3A 4GI4A 1TV5A 2IKIA 1W3TA 1HN1A 1MVYA 4F66A 2ZUVA 3U9IA 1J93A 2O56A 3E12A 1G7UA 4Y9NA 4HB7A 2DZTA 1PTGA 1ZLPA 3TU9A 4Q8TA 3LTYA 4XAZA 4QEHA 3BCJA 2ZC8A 2YCEA 3UXAA 3NA8A 3B97A 1FWFC 2DW6A 4MWAA 1A5LC 1DWFM 4W5ZA 1H1YA 1K9EA 1O5XA 3ONCA 4UXDA 1W9DM 3LXAA 1XBYA 4CU7A 1H7RA 3KLKA 1SUXA 4UFHA 1S2AA 4NJGA 5CGQA 3KS6A 3CUIA 4LH8A 1DJYA 3FJNA 1UD8A 3QQWA 5HNRA 4MY9A 1C7SA 4N42A 3T0BA 4ZXOA 1R2SA 3QW3A 3CT2A 1V03A 1DORA 4L1WA 1ZS2A 2ALDA 3VNYA 2VQUA 1R9ZA 3RRXA 1N55A 3SUSA 5B7ZA 1X97A 3G8EA 5LA0A 1R5YA 1XGDA 1KM2A 2EAWA 3GIQA 5CZJA 1DIKA 3SGZA 2YBUA 1E0XA 4DO4A 4E2VA 1RBAA 1XLLA 5JBEA 3MI2A 5KZ6A 4X22A 1IWAA 1ZZMA 2DGAA 3MS8A 1OGGA 4H8NA 2PRHA 2YCKX 1POKA 4DIAA 3N25A 4KMQA 3LHTA 3QFWA 3TW9A 4E2BA 2JIWA 2C13A 3P0XA 4Y8FA 2QIIA 5D2YA 4IFOA 4N7QA 5BYWA 1XYZA 2NV9A 2FLIA 3EDFA 1OG6A 1Q6OA 4F48A 1XRFA 4I7UA 4FXRA 2ZXDA 4Y96A 4C90A 1XLGA 1V3KA 3PBYA 4PB3A 1GEQA 2DT1A 2V5KA 3MUIA 3N6HA 3LPFA 3LLXA 2G3MA 4LY4A 1RY8A 1QT1A 3W6MA 4IH3A 1B0IA 4Q4OA 5CC6A 2C16A 3L2LA 4MPKA 2O4MA 3PBUA 5DXYA 1LL7A 3JW7A 2F2HA 4D71A 2Y1HA 1R38A 1UZ4A 3G1AA 3ISIX 4UNLA 1SO6A 4RZ4A 5BOEA 2WBGA 3OP2A 4YJ5A 3RFAA 2Z2BA 2P8CA 1ML1A 3V16A 1PCKA 1A4MA 3A4AA 1N82A 5TAOA 4EWND 1L6YA 1F9CA 4J28A 3WENA 3I4EA 3GRIA 3R25A 1PEZA 1R3YA 4ZE4A 1BF2A 4MPQA 5LGXA 3UD6A 4LY8A 3R1ZA 2DORA 4HHMA 1HKIA 3PM6A 4YWIA 3KE0A 3KRBA 3BZJA 2WO5A 2PUZA 2C19A 3A4JA 1FWAC 3SY5A 3GTNA 4PB4A 2E6DA 3AJXA 4XZHA 1P6BA 5B80A 4GRSA 1QPOA 4DZHA 3PJXA 3WUBA 4L6DA 4B2DD 7REQB 4IL2A 2CZEA 4O52A 1QNSA 4F2TA 1FH9A 2YXXA 4Q7IA 2VGIA 1TPC1 4AZ6A 1SFSA 3C2YA 3GDTA 4KWWA 1JAEA 3KTSA 3OVGA 3KP1A 4FOJA 3N2TA 2QJJA 3NR0A 2OZTA 3DEQA 5HK4A 3AAMA 3MKCA 1QW7A 2IKHA 4O8AA 2XN0A 2DZPA 1YNYA 3L5MA 3LPPA 5LYRA 4ADTA 3PF3A 2JEPA 4OKDA 1IHIA 3NWRA 4UQEA 2E3ZA 4JNZA 2EXOA 4G5DA 1I60A 5K9CA 4JQ1A 4IIBA 1ZRQA 3CQKA 4ATWA 1KR1A 4WHBA 3QF0A 2XZ7A 1UC4A 1W1IE 4K7YA 1ZBKA 2XVLA 2P3EA 1B4KA 1JCTA 3MCOA 3TN3A 3BW4A 3IK4A 2QW5A 4V2XA 2CPUA 3WBXA 3U0HA 2QDDA 1KBJA 1HL8A 3PBGA 5MF5A 2XVGA 4DWDA 3UXKA 3RNDA 3S6DA 4AMAA 4LYKA 1NP2A 3M43A 5E93A 3H54A 3DU0A 4NZCA 3LUTA 3PAOA 4HSHA 2Q71A 1R30A 3F5JA 3FVMA 3KRUA 4F4RA 5D32A 4GMEA 6TAAA 1TZ9A 2W5FA 4D9PA 5KEZA 2XIJA 3R7MA 1UR1A 1VEOA 3VZXA 1VPYA 1E0WA 3NVDA 3QY6A 3O3RA 3ZR4A 1BG4A 4K7VA 3TC3A 4LAKA 3VILA 1RK5A 3OBAA 4RE4A 3WIJA 5CG7A 4JN6A 3R11A 3L4ZA 2GVJA 1GTHA 4C6FA 1BGGA 1K8CA 1B57A 4I5UA 2V3EA 4NRRA 3OQ8A 4NJHA 2QDGA 5FJTA 3G77A 3QHMA 1DVJA 3QPEA 3W86A 5REQB 1A3XA 2VKZG 3UNDA 1S2CA 5LIXX 1G6CA 1UZHA 3IIXA 3O1NA 4O4WA 4C6BA 2DZAA 3GXNA 1BXCA 2ZOXA 1UBPC 5JXQA 2J25A 3NQAA 5LGZA 5HANA 1YLVA 3VCCA 1RJRA 4WJXA 3ALGA 3MT1A 4JFTA 2BVDA 2PURA 3CPUA 1XW8A 1XH2A 2QAPA 4EKJA 3VD3A 1WOBA 3GB6A 4PCPA 3MP3A 4HKPA 3UR5A 2PLMA 2PTYA 2V82A 3SCSA 3S8HA 5A69A 2FPTA 2NLIA 1A47A 2MANA 3HQ1A 4RNFA 6XIAA 1J12A 4DVOA 1TZ7A 2Y4SA 4RKAA 2INEA 5HJYA 1E15A 2HMCA 4FI4A 4CN6A 2PGEA 3LNMA 3ZQ9A 1UP0A 2QULA 1CXIA 3BL3A 4CLMA 2PTZA 2B7NA 3MY9A 3PBMA 2CERA 3G1HA 2VCBA 3RYSA 3UVIA 1JDAA 3BAKA 3V4BA 1JCMP 4I5RA 3RMEA 1O1HA 3M64A 4RXFA 1TV3A 4E4PA 1A5CA 3GC4A 1CENA 5LIWX 4D1JA 4JIPA 4MG4A 5DMNA 3AALA 1LJYA 5H8PA 4MZYA 1XLJA 2XN1A 4LXFA 4OV4A 3DHUA 4AHPA 1NIUA 4M5PA 3AMGA 3DYMA 3DFYA 2WNNA 3HPZA 4FPSA 3MW7A 4HNNA 4H83A 3QQ1A 2IUZA 2YCLB 3C0LA 3GTIA 4RDVA 4XO6A 3WUGA 1E73M 4EPEC 1DOSA 3WQFA 3C2EA 4FB7A 3P6LA 2PRMA 3S5OA 2YA0A 3SQSA 3O16A 1EA0A 3TLLA 4A3QA 2C91A 1FWNA 3N14A 4AFYA 2AMXA 4K37A 2UZ9A 2V0TA 4US6A 3V75A 2Y24A 2R82A 4LAOA 3GNDA 4IIFA 2DVUA 1E1FA 4CN4A 2WK2A 1KBKA 3VXGA 4K8EA 4FNUA 5D03A 1KTBA 3QMTA 4I7WA 2HDJA 4HMNA 4NG3A 4P7OA 4GX8A 3ABSA 4JQ4A 4YVXA 3S1VA 4HSNA 5G1YA 1JPMA 1KBBA 2X1RA 3E2SA 1RPXA 4MLJA 3H2CA 5FJOA 4PMNA 4Q4QA 4G7FA 1XJBA 3CWOX 4J27A 3BURA 3PPHA 2H9AA 2VWTA 3ZOAA 3BCDA 1FWRA 3I7QA 3KWXA 2W0UA 3LCGA 1YW1A 5H2ZA 4AX7A 2F6KA 3A23A 2VCAA 3WNLA 3RPMA 2QF7A 4MB1A 3CQ0A 2PDKA 2R1NA 4IISA 2OTDA 3LDVA 4C7GA 4PEKA 4AF0B 3OVPA 3TZFA 1RXOB 2ZX7A 3WQ8A 1XLHA 1QOXA 1PBGA 1K4GA 3KVJA 4W7UA 1W1TA 1O1ZA 2YB4A 4PUNA 1V4YA 4DJFC 3WX7A 3ANUA 4RW5A 1KKOA 1GG0A 5G5IA 3QYSA 5CPNA 5KZEA 1U33A 2NVAA 2VJXA 3PBWA 3UG3A 3CHCA 1KNWA 3OLDA 3FAWA 3TXVA 4J1OA 4GBDA 4QSHA 1VH7A 1FWJC 3NM1A 1IQ8A 4AH7A 1IGSA 3I10A 4KEUA 1JZ6A 3R2GA 3O0FA 4ZQOA 3EPMA 4O50A 5HXMA 3RLGA 1WNOA 3G1XA 4EXQA 3A21A 3S46A 1YDNA 5I3IA 3I3BA 5E0FA 1KFCA 3TN4A 3P80A 5BCAA 4LT9A 1JCNA 1JGIA 4Q8WA 2VX6A 4UR7A 5IFTA 3PSVA 4F2UA 5FOOA 2V30A 5DCBA 3CAKA 4C7DA 2WKLA 3ZVHA 1C8XA 3AS0A 1HKJA 2Z00A 2ZRXA 4OE7A 1VLIA 3C0SA 1W1YA 2A2IA 3S42A 2ZA1A 4LANA 1UA3A 4DAIA 3W1RA 5FSEC 4JL1A 4BQ3A 7A3HA 3W23A 3QHOA 3G1YA 4Q8OA 4QAIA 3W07A 4EF9A 2JEQA 2NZLA 3UBPC 4H7CA 3IGXA 5AYIA 1W5MA 2FIQA 2JKEA 2RDWA 1H49A 1HIZA 3DGRA 3MV01 5E0KA 4GQ0A 4OV9A 4OU1A 4PMRA 3LXBA 3VTRA 1BSLA 5DLCA 4DJED 4P7NA 2VDGA 2CLPA 1UWSA 4BF5A 4CN1A 5FAGA 1WBHA 1AMYA 5I5RA 4WF7A 5LHEA 3MSYA 5CBBA 4F0RA 2Y70A 3WMSA 1Q66A 5HWMA 1R0MA 1E9YB 1OCBA 2EPMX 4C5ZA 1CGWA 4QE5A 2OCZA 3OLEA 4QXIA 3CHFA 1W1VA 1W32A 3V0TA 1REQA 4KWSA 1DXEA 4C6KA 3BV4A 3NTYA 1XD1A 3I6TA 5TBOA 3WEMA 3BAJA 3PVFA 2VTFA 1A49A 4L4LA 1FKXA 2DW7A 2EG8A 1U5JA 1E6SM 3G0SA 1TV2A 3QPZA 4ERIA 1DYSA 1J4EA 3XIMA 1Q4NX 4L61A 1JDFA 1YEYA 4V1XA 2ZICA 3OA5A 5ABGA 4A2SA 2W92A 4QAWA 1C90A 4LAMA 4F0LA 4GNJA 2Y7DA 4AC7C 4S3JA 2YX0A 4K6AA 3VDCA 1E6PA 1DJQA 3PTKA 3EA2A 4X9YA 1XINA 2R1KA 3P3BA 1KXVA 1OCQA 3LRLA 3NYDA 4DAFA 1DEDA 3GBDA 2VGGA 1OYAA 4ML9A 3HFTA 4XX6A 4HK6A 4O1EA 4S3GA 1F07A 3LCLA 3MDUA 3FJ6A 2XH2A 3AIWA 4PA8A 1M65A 3SSJA 3HV9A 2VFGA 4OT7A 4UQ9A 2WVVB 4DJDC 1XGEA 3AIEA 3FHQA 1DJNA 1XGZA 4ZTXA 2CZDA 1W3JA 3KOZA 3WLOA 4XKMA 1ZNNA 1TIWA 3E9AA 1BYAA 3RF9A 4AUBA 4J9JA 1WZLA 1LLOA 4PSRA 2I9UA 3PP7A 4ZQNA 2HV5A 2D0FA 4PULA 4JFWA 4A29A 3OOQA 1KTNA 2F6XA 3WQ5A 2AQOA 3UZXA 2EG7A 2J27A 5K4ZA 3L65A 1MXSA 5T91A 1WXYA 1V7YA 5F2LA 5A6TC 1QI0A 2WSYA 2J8TA 4I6KA 1C9DA 3GFYA 3PNUA 2PEVA 4KFPA 4W93A 2E28A 2HS8A 3GH4A 4LYRA 1OABA 2TYSA 2D2JA 2AQWA 4IP7A 3QV9A 1F3EA 5IDIA 3GG0A 4B16A 1KCXA 2BWGA 3NUKA 1QJWA 3A9BA 5C0QA 1A3HA 3ITTA 1I2NA 4NL1A 1OC7A 1XISA 3VI2A 3ZJ7A 3WLJA 4CD5A 2F6UA 3EB3A 1GOMA 4AYSA 1XIHA 1IWPA 3K8LA 4HZ8A 3CUFA 3AWOA 3N9RA 1QI5A 1FRBA 5JUVA 1CCWB 1DWIM 2CBIA 3G1VA 2PGRA 4Z1BA 1VYPX 2YCIX 5AHLA 3KOFA 4O4VA 1JDCA 1FWSA 3OO2A 5D8ZA 2BVTA 1WBJA 2PDMA 2P0IA 1I75A 5HINA 1RH9A 2WNWA 5EYWA 4GY0A 1XIDA 2GGIA 3WNPA 1LOQA 4ASTA 3BG9A 5E0CA 2FB3A 1UUOA 3NZRA 2ZA2A 2PMQA 4JTAA 5I07A 5LA1A 5CJNA 1BKHA 3GR7A 1G7VA 3FSTA 5AN7A 1TWDA 3B8VA 1WXZA 2FB2A 4QROA 3U8GA 1H0IA 4QNWA 4UC5A 1H5YA 2PCQA 2ABBA 4AB4A 1RHCA 4L1GA 1GVYA 4PMXA 2OG9A 4DWSD 5JBDA 2ZX5A 4B15A 2Z26A 1AW2A 7ENLA 3GHSA 4MOZA 1A5BA 1XXXA 2PDQA 1N8IA 2V9DA 5CZSA 3F5LA 2H3BA 1OT1A 5HWNA 1C8VA 2VELA 4GCXA 4MKVA 3AHXA 1H1ZA 1SSDA 1W1PA 1RZMA 1H50A 3H7RA 5CAHA 4O0QA 3M1ZA 5KZDA 1KFKA 3UWVA 1VRXA 3NYZA 3CHVA 1AD1A 2FPYA 3GDRA 2GGJA 3OHMB 3DFHA 3AMKA 3R13A 3M0ZA 3BWWA 3PFMA 3L4XA 5CGTA 4FNSA 1UROA 4HYWA 2Y85A 1G4PA 3DFSA 2WZMA 1JZ2A 2QDEA 3ERPA 3CMGA 1UH2A 1W54A 3W27A 3WEZA 2A21A 3UERA 4K3ZA 3QW4B 5JU6A 2IQDA 2BXYA 3NZ1A 3W2MA 3ZIZA 5D02A 3KS5A 4BKNA 2XN2A 3NVTA 3ITYA 1Q3NA 4IUGA 2PU0A 3P8IA 4Q8UA 2FHBA 2Z7GA 3BGGA 3H2EA 4DYKA 5EFFA 3OBEA 1ODUA 2CNCA 3URAA 1E3ZA 3GVVA 3R6IA 3W7KA 3BMXA 3OZPA 2VD9A 4L64A 2WPGA 2ZVIA 3BUVA 1V93A 4IFRA 3UZWA 5JIPA 1CZ1A 1IXQA 1O12A 5REQA 3T0DA 2QLYA 3NZGA 4GKLA 1MNZA 3WBEA 1U5HA 3PG9A 3TJ4A 3FSUA 1I2OA 3E0WA 1XIGA 3CTLA 5DRIA 1CGUA 1JJKA 4LS0A 1JZ3A 4IMGA 2BY2A 4M3PA 1NTHA 3AU6A 3WQWA 3EB4A 3A9IA 1Q6LA 1ITXA 5I3FA 2OPJA 1UC5A 1T5AA 1JRCA 1TPWA 3B0VC 6PTDA 5G1TA 4PGLA 5LXEA 4NRSA 3LLFA 3VDHA 1N2VA 2VFDA 1DJHA 4B3LA 3BAWA 3V36A 4N9EA 4J40A 3CLWA 4FX8A 3WD1A 5HMFA 2PLKA 3GAYA 4QS5A 5A5WA 4XZWA 1OBAA 1M7OA 1QRQA 2VURA 4PUKA 2GSHA 3EEZA 3BAIA 2C71A 3L66A 1IT7A 4JIRA 3AJ7A 2WJFA 2WMGA 2Q8LA 4D6FA 3D0CA 4UTTA 3ZVIA 3TSDA 1GOQA 1PCWA 2E77A 5HJLA 1GTEA 4H9ZA 4YVVA 5LIUX 1UD5A 3KHDA 2Y7EA 1BQGA 1EQCA 3S2NA 1JYNA 1D7FA 2BLEA 2UY5A 2VC5A 5FJIA 1LOSA 3VM5A 3RJXA 3W7HA 4G1KA 3H12A 3SO7A 2DY3A 3RGTA 1A53A 3ZVHB 3NL2A 2ONEA 2WJZA 3DOPA 1UCWA 3ARPA 3VVGA 3WUFA 4FOKA 3UVAA 4KT2A 2PWEA 3OYZA 3N3TA 2FMNA 1KBIA 3B8TA 1K1DA 4M51A 2G95A 4BS0A 3B4YA 1NOFA 1AH0A 3GTFA 2OEMA 2VFFA 4WSKA 1XPYA 3VDGA 3WH7A 2D24A 3VMPA 3V0UA 1US3A 4GC4A 4HA0A 3QY8A 1GYMA 1EB3A 4NSBA 4NYYA 3AIRA 3WJXA 1ONRA 3MZNA 4JGDA 1J10A 3H2OA 1TCMA 4MF4A 3W29A 4E6MA 4MFEA 3VCNA 1TVPA 3ITLA 2XU2A 4IJBA 1YHTA 3PSWA 5T9BG 4JQ3A 2C7FA 4ZE5A 3MQTA 3G8RA 1OC6A 4YS1A 2O7SA 3IPWA 3H8AA 2OODA 1P43A 2D23A 1WKDA 1Z41A 1I6NA 3CMJA 4NP7A 5HQMA 1XLFA 4N9BA 4XB3A 5AYYA 4XZBA 1OVDA 1RALA 3MMUA 1ME8A 2WM1A 4KCVA 5JMUA 5AZ1A 6CGTA 3EMQA 3EMZA 3CEPA 1MW2A 1B4EA 2GWGA 3E49A 4D6HA 4ATDA 1PPIA 5XINA 3PZMA 1GEHA 4LU0A 4UQAA 2QPXA 4UQCA 2ZCGA 1XC6A 4DPPA 3NO3A 3RUBL 4DJFA 4J35A 3AXHA 3GO2A 1JFXA 3UPMA 3FGCB 2ALRA 4B9YA 4AZCB 1CTNA 1VBRA 3W2NA 4DLFA 1J01A 4O14A 1WKYA 2HNHA 3SN0A 1AJ0A 1CLXA 3UWZA 2OSXA 2X8RA 1XSJA 1PTAA 4MAZA 3OZMA 4S38A 3TONA 5GNYA 4ICCX 4OQVA 3GFZA 1WOAA 3LG3A 3AICA 4A3YA 3KBJA 1NU5A 4K39A 4IZGA 1HKVA 1AQ0A 3KCOA 2G50A 3N4EA 1W3IA 2ZZ6A 2OT0A 4FLRA 1PIIA 1TQJA 3B06A 2IXUA 2EEXA 1UH4A 4DJDD 4ZZ9A 3LEPA 1ECQA 2HRWA 3LI0A 4UBPC 2BMBA 1M7PA 3UA4A 2V2HA 1TZZA 3GY1A 3ARRA 3M0IA 3CUZA 4NI3A 3IJ7A 5FJPA 4GY7A 3MCNA 3GTXA 4GUGA 2GOUA 3JRKA 4JTLA 2GK1B 1QNQA 3T44A 1VCGA 4NT0A 4CQCA 1O95A 3W26A 3SR7A 4DX3A 3TMLA 1BKSA 3SUUA 3HMJG 3UZ5A 3TCSA 3DXIA 3GM8A 2H9AB 3BJTA 5ABEA 1MEIA 4RLIA 3ZR5A 4ZOCA 2XH0A 4KRUA 3W7QA 4GLEA 1C29A 3OZYA 1GW9A 1ZJIA 3TDFA 5F4XA 3GU2A 5BXSA 1GZJA 3T8QA 2R1MA 3M7SA 3ZWTA 1UKTA 2XVKA 3L5AA 2PDLA 5D4YA 1U5VA 4GYJA 3KHJA 4BR1A 5AHNA 2BGSA 4W85A 2Y88A 4HD5A 2BB0A 4W88A 2JK2A 4JD4A 3W6YA 2E7FA 4WDXA 1BTCA 1DTUA 3RU6A 1E9IA 1WUEA 2E8ZA 4HMDA 3HQPA 4QE4A 4WUIA 1H7XA 4F0KA 1VF8A 4DXVA 1UR4A 1DIEA 4H9UA 1V6VA 3ITVA 1KR0A 4C6OA 4CCZA 1E6RA 3W1NA 2HVNA 2VGFA 3Q65A 4I90A 5C9RA 4TIMA 4GJJA 3VOIA 4LWWA 1J6PA 3T8LA 4GKTA 4ZQRA 4TUFA 2NVDA 1EF2A 3BLKA 1DP0A 4WDWA 1UIOA 1FCQA 4F3HA 1AZ2A 3OPSA 3WH9A 4J5NA 5BZAA 1SZRA 4GGBA 4WIWA 3UGVA 4LEFA 3LZ5A 4BF7A 3Q58A 5ABTA 4JQAA 3TJIA 1IZKA 1K8ZA 4LALA 2TSYA 1X39A 1R6WA 1Z89A 4LF1A 2GGGA 1Y5WA 3W37A 4M82A 3WNKA 1BYBA 3TC7A 4MTVA 3WQVA 2WHJA 5I7GA 1ZFJA 3N17A 2ZZ2A 4O1BA 4S23A 1WCGA 4B5VA 5D38A 4D6IA 3LK6A 3TK7A 4H8UA 3GUGA 3KL5A 3E0VA 4JCLA 2OLAA 1EA9C 4P5UA 3AISA 1OYCA 3WFZA 3ANYA 2IPJA 5E5CA 5DY2A 5DN1A 4S3BA 3S5SA 3ARUA 2PFHA 5EFDA 3N73A 1DJXA 1TV8A 2Y7FA 1AUSL 1QPNA 2VNCA 5CH9A 1Q6CA 2V5JA 1C8QA 4M19A 5DFAA 4WY0F 4OOZA 3QLLA 3R8GA 3N11A 1A5MC 2PDBA 3AHYA 2Y7GA 1I0DA 5IM51 1OFQA 4P8UA 4RL3A 5A6AA 1UR8A 3CIXA 4IFKB 2BV9A 4DJFD 1ZP4A 4KBXA 2DQXA 5JQ9A 4ZB2A 3LMZA 3GNPA 2J78A 2NUXA 5G4EA 2HJPA 4OVXA 1W5NA 3IIZA 1IGWA 4PCTA 2YSWA 5CG0A 3NQ2A 1UHVA 1FA2A 4Q4KA 4HNLA 1W3KA 4H9TA 1BWKA 3K4AA 3HMCA 2WZIA 3RILA 1XDLA 4M81A 1QBBA 4BK9A 4U3AA 3WMBA 4C5YA 3OEXA 3LI1A 3S2JA 3SAZA 1EDQA 5E6ZA 1B54A 4CU8A 3HGOA 4HTBA 5A8OA 3RK8A 3PBVA 5D2TA 2QV4A 2X41A 3QV6A 4EOUA 3UJFA 4ICNA 3INPA 2GJNA 4XAYA 4YVPA 5I09A 2A85A 4I9MA 3VGHA 5FSDC 3SUVA 1DXFA 1RBOB 5I02A 2VEIA 2GUBA 2Y61A 3W72A 4LUIA 2WWCA 1CDGA 1GOOA 3DFTA 3NZQA 1V3HA 1ZGDA 1UASA 2Z0IA 3DGBA 2WV8A 3LHVA 3U48A 3F4NA 3U5YA 4J3UA 3W1UA 3QZ6A 3WD0A 5J5DA 3LTSA 2Z6IA 4CNPA 2HBXA 3SCWA 4HOXA 4CQ9A 4QJ5B 2Y5EA 2X7WA 1H2JA 1Q7ZA 5I3JA 1OFAA 4US5D 2WKGA 2J7DA 4LYPA 4PBGA 3FY1A 4KQNA 3B40A 1GVQA 1XDJA 4O12A 1XYAA 4NY2A 1U2YA 1H09A 2F8QA 4XQ6A 4A4AA 3PB2A 4EX4A 1NSJA 2C8NA 3NO5A 4IQDA 4UWMA 2O0TA 1XM3A 1G4SA 2OSYA 2J66A 1KB3A 2G96A 3T7VA 4M0XA 1JZ4A 2YDQA 4OGZA 3ZS4A 3N18A 1CBGA 4OOUA 2HS6A 1UUMA 1TFVA 1QXLA 3P5ZA 3CL8A 5RUBA 1TO3A 1Z3NA 3M0XA 1YE4A 4OFCA 1MNSA 2HXUA 5DMLA 4IL0A 3E2VA 2O9TA 2P10A 4ZO8A 4LCRA 1SJAA 4S3DA 3GFXA 3IEBA 5AOUA 1W37A 2ZKMX 3DENA 4C7FA 1FY6A 4GQRA 5EGRA 1H63A 4JIIX 4QLLA 3DG6A 2EKGA 2RAGA 2OVLA 1FXQA 1UBSA 4Z1AA 3RN6A 3VUPA 4QS6A 4L9ZA 2NQLA 4DJEA 3C2VA 4U2ZA 1KM4A 3UFYA 3RO6A 4ORIA 3EX6A 4X60A 1EJVC 3PR2A 3PZTA 3AFBA 2GDQA 2BTMA 5DEZA 5I00A 3UWEA 3T6CA 1GKPA 2DP3A 1EUAA 4YLWA 1B9ZA 4XK2A 3MCMA 3UGRA 1NAL1 3CHEA 3O0KA 2OX1A 4V27A 1LYXA 1E6QM 4YIWA 2Z1WA 4E4UA 1XH0A 2WQDA 1EIBA 1TB3A 6ENLA 2H90A 3GS6A 2GPTA 3QYQA 4RE0A 1NDZA 2QJNA 2DSZA 1E1CB 1MUWA 2OLSA 3WD3A 3WLLA 4MJ4A 3AUOA 2CLOA 2GFTA 4WDTA 1D9EA 4R7OA 1OCNA 5DO8A 5AFDA 1SMDA 5EKYA 4IJRA 3GKAA 4GZEA 4UCGA 4AD1A 4GK8A 1UYQA 5F1UA 4IQLA 3QLDA 3EKGA 3W25A 3WL1A 3LB0A 2V3GA 5JIWA 4JN8A 4M6VA 2ZZ7A 1EFZA 1QW8A 5IXEA 2UV8G 2WVVA 3LBOA 1KQZA 3BCFA 4QG6A 3MJYA 3W87A 4JL2A 4KRZA 2QGYA 5T26A 3OVQA 4JFSA 5E6YA 2QNEA 2DQWA 2J4GA 3VM7A 1NOWA 1EIXA 3SFWA 1KD0A 3G0XA 3KZPA 2BHZA 2VX4A 3WUEA 1PHQA 2QEZA 4H6EA 2GVYA 1P5BA 1LWJA 2YYTA 2BSLA 3GWQA 4W87A 3TROA 3W28A 4IX2A 1GOWA 4GYPC 3A47A 3EOLA 3L7RA 3ANVA 5CC5A 4YL2A 3T81A 3KOWA 2PE4A 2QCLA 2REQB 3GHUA 1VRDA 2YL5A 1S5NA 4UIOA 3T05A 1FP8A 4O1AA 2GVEA 4UTLA 1J79A 5FKYA 3TYAA 2A3LA 3BARA 1O68A 4HIBA 3TQ0A 3W7JA 3BG5A 4X61A 3P0WA 1EJWC 1A0CA 1E6XM 5SWUA 3FLUA 2HBVA 3O05A 3QZAA 1DQXA 1PVNA 1UR9A 3LHWA 1JDDA 4A8NA 3F1QA 4NNBA 3V5FA 3EWCA 3DG7A 3MHUA 2PA6A 1LT8A 3TYEA 1WDSA 1SZGA 2EJ1A 3QTGA 4M6QA 2WYSA 3VD5A 1FWEC 1GQIA 2OFJA 2CXEA 4QIUA 3O6DA 4LUSA 2W63A 4Z42C 5FI8A 3ABRA 4HK7A 4XSLA 3NQCA 3IS4A 3O6AA 4ZEPA 3SRDA 1GVEA 2EPHA 3B0PA 3H6OA 3WF1A 4H4IA 4PC8A 1UKPA 2ZUNA 1RA0A 4JTGA 4C65A 5D2WA 2PD9A 1H51A 1TJ1A 3TKFA 1JPKA 3BOXA 3VOGA 4NNAA 1ADDA 4LVDA 4WJEA 1EZ2A 5AVHA 2VYOA 1P0DA 1VFSA 3SECA 1CX9A 1YDOA 1RR2A 1P7TA 2HPIA 3W1PA 3NGFA 3HJEA 2J7BA 4QM1A 2Z1BA 1KFWA 1PYFA 2QAFA 5HWJA 1X6NA 3H26A 2CU0A 3LSBA 4QBXA 1UG6A 3NXLA 2R1PA 4GJ1A 3IVSA 2PAJA 1OZMA 3TTYA 3W02A 1IIHA 3T2QA 1H7OA 1LZOA 3R5EA 5FD0A 4A3HA 1YADA 3WDHA 8XIMA 2J6VA 4JDBA 3WF3A 3QGAC 3BOFA 1L2UA 3AYTA 2XIQA 5EBAA 1ICPA 1R3QA 3HTWA 1K70A 1NJJA 4IPPA 3W70A 1LBLA 1AH4A 2ACSA 2GL5A 1KM5A 1XD0A 3UPWA 2W9MA 4A21A 1YYAA 2CLIA 1K6WA 4AMCA 3E2RA 4IF2A 4BI7A 4QTGA 3MUXA 3NAVA 3I6RA 4DNHA 1SZFA 4Q6XA 4Z1CA 1TPFA 2I16A 1KWKA 5CSRA 3DCPA 4NQ1A 2OGJA 4ADUA 5FF2A 3VIMA 1SZNA 4IOTA 4CD4A 4EPDC 4GZ7A 4JEJA 4JEQA 4ZB5A 4XBSA 3GZ3A 4B92A 4DI9A 2DV0A 4G8TA 1UOKA 4DZ5A 1JCLA 3W7EA 3QR3A 4LS1A 1MEWA 1T8QA 3TNBA 1M01A 2QMKA 1AQMA 1YXDA 1W9PA 4N9CA 3W85A 3WH6A 1I0BA 1EX5A 2XIOA 4L4OA 1SYTA 3TA6A 4LUTB 5E9AA 3JZEA 4H04A 3RU8X 2ZADA 1JNDA 3W75A 2ISWA 2NSOA 3A5FA 1HJVA 3LA4A 2X2GA 1HP4A 3OTRA 4B2DA 2NX3A 1SU5A 1V6XA 4AY8A 3PTDA 3D46A 6ALDA 4YYFA 3STPA 3ARWA 3W76A 4S3CA 1R7AA 1Q85A 3NGJA 5F4WA 4O0KA 2ZDSA 3LS9A 3W2KA 1UR0A 1E5JA 3S1XA 4GY1A 1OK4A 2Q6ZA 2RKXA 2DZBA 3QY7A 2BY3A 4X9SA 3UWUA 1AZ1A 1XLIA 2V8ZA 4R53A 4G7EB 2VZVA 5D9NA 1OF6A 2ZYFA 4EK7A 2QVNA 2Z6JA 2GWNA 3WFAA 1XG3A 3RCYA 1X38A 3Q37A 3WF2A 5HR7A 3UR2A 4HOWA 4UOZA 5EL1A 1F6KA 2AAAA 1BEUA 1O4UA 1HT6A 2W3ZA 1ZUAX 4HVXA 2WM0A 4WXZA 3IAQA 4G2DA 3C5QA 2YZRA 1YQ2A 1UWQA 3BK0A 1B3YA 2A7RA 1ME9A 4GD0A 3UCDA 3GZAA 1EJ7L 3AIVA 4HU4A 4EVZA 4GUFA 4N2YA 4JY9A 4LVFA 1BFNA 3AZTA 1Q6EA 3AXKA 1O60A 4HSOA 4W84A 5DX7A 3VIKA 4KWOA 1MQQA 4INFA 1NWRA 4P7QA 1A5UA 3GXFA 3L4VA 3KW3A 3DC0A 4WSHA 3H4WA 4I9JA 4F0MA 2NX1A 3EWUA 5FF3A 1BVZA 2WPBA 5H91A 4HN4A 3DHPA 2D22A 1E40A 5U7SA 1PAMA 4GO9A 5LA2A 5J5RA 4M1RA 3CAWA 3AZSA 3VGDA 1TWWA 2JBMA 3G1FA 4DJDA 3LBMA 3UJSA 2YKKA 3VABA 4YCOA 1E0UA 1MWOA 5AYBA 3R0DA 8CGTA 4UTJA 1B9BA 4H2HA 2CLFA 2PCEA 1H61A 4UFJA 3B3DA 2VC6A 1VD6A 1EHAA 4AIOA 2ATSA 1R3TA 2C18A 5E1QA 4TVUA 2DUZA 4AEFA 1ME7A 3R0UA 1B31A 3AZRA 3P62A 1UQYA 5HJXA 1V02A 4AVFA 2V38A 4EANA 4KKXA 1NARA 4GA8A 3E74A 4ZODA 2ZDRA 4DO6A 1NP0A 1ISZA 2VZUA 3KBNA 4TTUA 3DHFA 4HGXA 5A8PA 5M5DA 3WLNA 1EP1A 2GYIA 3GTHA 1MEHA 3TYDA 1DIOA 3KP0A 1S3HA 4N0RA 1TA3B 4M24A 4A22A 1Q4WA 3OW1A 8XIAA 2BXZA 1B90A 4H1ZA 2EQDA 4DF0A 3AO0A 2HK0A 2VT0A 4PR4A 3CAVA 2RDTA 4MWAD 5HQEA 1ONXA 1JVNA 4BI6A 5HDRA 1OK6A 4PMZA 4UFKA 2A3CA 3RM4A 3EDJA 3F4WA 1B1YA 4JFUA 1FWBC 1K8YA 3HPSA 4S39A 4FLOA 2BOGX 3EMCA 1M53A 1MW1A 1VS1A 3B03A 2DSKA 4AQLA 2NXHA 4IT1A 4RXGA 4MHBA 3FKRA 4AWTA 3GDBA 1B3VA 2WSQA 3IJ9A 1E43A 1WAUA 1HJSA 3USZA 3GH7A 1HFBA 4LBRA 3RG6A 3ID7A 3N6QA 3N2MA 1OF8A 1OFOA 1YE6A 2ZFAA 1TTJA 5DT5A 3HB9A 3L23A 2FYMA 2FH6A 3AYSA 3PTQA 3T4WA 1IYXA 2RHGA 2ASHA 4PMUA 3A4XA 2E5DA 4MJMA 3GYCA 4B91A 1EOMA 1FWDC 1PZ2A 3IGUA 3FDKA 5F7UA 1TRIA 4R85A 3LV5A 1UKOA 5I78A 3T0TA 3GKFA 1VFLA 4DLMA 4JTSA 3TSMA 2Q8ZA 1W6TA 1NFPA 3UU0A 3AU2A 3OGRA 3V35A 1SVDA 1W9UA 5IOBA 2YA2A 4J3VA 5EMMA 4ZTYA 5LZLA 3KCLA 3N04A 1QTWA 2ODOA 3APTA 4GQQA 1JZ7A 3S6TA 1W1ZA 2QCEA 2CKRA 4TMCA 3T55A 1CECA 4HYVA 1TUXA 2AL2B 3SM0A 4CEXC 4Q8VA 5H6HA 1FHUA 1XLEA 3O6YX 3EWDA 3NM3A 4UZUA 4Y9MA 4W4QA 4IQEA 5H8UA 1XIMA 1FXPA 4IICA 4Q4MA 1LP6A 1JPIA 1MSSA 3BW2A 4DO7A 2ZVRA 4MUPA 2VFHA 4GH1A 1Z48A 2OXNA 3W01A 1S2VA 2PRLA 5K9DA 3MUAA 2EBNA 1TR1A 2GJPA 4FSAA 2DSUA 4DYJA 1GONA 4ECLA 3WYZA 3VGGA 1KV5A 1E4LA 3M7WA 4KS0A 4JOMA 2HE5A 4JTCA 1FWGC 5CBJA 2YXOA 3S1WA 5DF0A 3UY8A 1ZCOA 1EXBA 4UNKA 3V1HA 1J18A 1VR6A 4P7LA 1YX1A 1RAKA 4GISA 4GWEA 4LVBA 5J04A 1M1BA 2POZA 2V6AA 1PUDA 3NEHA 1RCXB 2PWFA 4M56A 2ABAA 3WJWA 5A1AA 2ZA3A 2E9BA 4CEUC 2OWWA 1PKMA 3CO4A 2PWUA 3ZO9A 4GFSA 4CQAA 3UNTA 2GVGA 1XBZA 1KTCA 3OLIA 3W2JA 1JR1A 2W67A 3VA8A 1VLWA 4Z0SA 4B5XA 3W83A 4Q33A 4X63A 2C0AA 4CKQA 2DIKA 2CHRA 1TQXA 2PWDA 3K5XA 2CCRA 3AXMA 1XP3A 1YXYA 2HPMA 2E6AA 3CMFA 3KTXA 3MC5A 2I14A 3A3XA 1X6LA 1MFVA 1Q6RA 2B0MA 4ORMA 1LDCA 1G94A 3WBYA 4P7RA 1WDDA 4OWGA 1TPH1 2D0GA 3S3GA 3WK3A 4QDMA 1TPEA 5LNRA 2EPOA 3MSGA 4P8VA 2D2HA 2CLKA 1TMLA 4GBUA 2KZHA 4K1GA 4X0VA 1PIFA 4Q22A 1YDYA 1MMFA 2V3FA 2P5NA 2VEKA 3TJLA 1ZL1A 2VEFA 2XVPA 3O9NA 3IJQA 2GQAA 2YIHA 2G3FA 1CIUA 2XTKA 2E68A 2J9YA 4FX7A 3KOXA 3QKEA 1JNEA 4A05A 4DHGA 1GCYA 3CZJA 3E5BA 4D6JA 1V0KA 3CLMA 3SCVA 1EO5A 5EMYA 3O6CA 3CIWA 2IPGA 1Q45A 2X30A 4JYDA 4R88A 5LXXA 2BP1A 4AY7A 2QCHA 1J0YA 3OODA 3LD5A 4PTMA 2E40A 3CL7A 3LSCA 3SCTA 3BSGA 2X0SA 4W7VA 4Y9PA 3TOYA 2QCMA 2ZQ0A 3LCXA 4RNIA 4OECA 1GUVA 1WP6A 4P8XA 1GNXA 5LNVA 3DZ1A 3IVUA 2OZ0A 2PWVA 1XV8A 5HATA 4GYPA 1JF5A 1CXFA 4NZ1A 3E1F1 1XLDA 2UWFA 4RW3A 3WQEA 3WLKX 4N4QA 2CLEA 4POCA 4HA1A 2R6OA 1KLZA 1OHLA 4Y90A 4FNPA 4AAJA 3MUZ1 1PKLA 1V02E 4CQDA 3W7DA 1Q13A 1C91A 3PZUA 3M0JA 1KLYA 1QPKA 2NT0A 6A3HA 1F3WA 2BY0A 2CLLA 2X0YA 3P8JA 1I1WA 3KBWA 2QYGA 4PMJA 5CZTA 4MIMA 5T8GA 3BJFA 4UQBA 2A7NA 4UMCA 1NWSA 1GORA 4JKMA 3ECQA 4FP1A 4D8LA 4N9DA 3EWZA 4ZB0A 4QLKA 1ZBCA 1RCQA 3WF0A 5CBIA 1TJRA 1C92A 2A0NA 2GDUA 1OJXA 3Q45A 1XIEA 3SUWA 1BF6A 4UTWA 1Q5MA 3VKDA 1H11A 1R9XA 3H53A 4MKNA 3W1QA 1PDZA 1OD0A 3H70A 1JCJA 2YYUA 2WXDM 3QH2A 4MZ8A 1CXEA 1HTIA 1X8CA 5HULA 4IUOA 5HNTA 4NZFA 5CLWA 1OY0A 3RMJA 4PCFA 1T0OA 2NWRA 3M5YA 2PZ0A 1O5QA 2DIJA 2FFIA 4LAZA 1CXHA 4H41A 1R46A 4NKCA 4A6GA 3KDNA 4L9YA 5D33A 4P61A 3SCUA 3MVIA 3VU2A 2BVWA 3EX4A 3KXQA 1TVLA 4DXXA 3BAYA 1KM1A 1JFHA 2BGQA 3W7IA 2XYLA 2CZ5A 2OJPA 2J74A 3RJYA 3WDIA 3RX3A 3LX9A 3ZSTA 1NQ6A 4YTSA 1K9DA 3B8IA 3O15A 1XLBA 1Y65A 5ABHA 2VMFA 3FKKA 3U5UA 3ABQA 1OWQA 1KRAC 2VC7A 4LVAA 2NW0A 3L67A 3A3WA 3FJLA 4NX5A 5K7JA 3A3HA 4REQB 2CHOA 3E0LA 1QDSA 1NDYA 4NUWA 1J6OA 2H8XA 1V8EA 4F9JA 1CGXA 1H7NA 3GIPA 3C86A 4RE2A 4LSBA 2VR5A 3GHTA 4EP8C 1LLZA 4KFNA 1REQB 1GPWA 1A0EA 3E2QA 5BOFA 3QVQA 2C1IA 5J8LA 4TR9A 3J7HA 1OD8A 4PB5A 3SUTA 3V0SA 2EKCA 2DFAA 4AIEA 1GW1A 4H9XA 3MSDA 3S0CA 2AGKA 3UJ2A 1JQVA 2DU2A 4Z1DA 1CW2A 5XIAA 2F84A 3S9IA 1JXKA 4FA3A 2E0PA 1XFBA 3L0KA 1V0LA 3G2GA 1R87A 5D9MA 4BWLA 1AMKA 2G0WA 2O4QA 4NU7A 2BHYA 4FMVA 3R4IA 5A8QA 3N15A 4HCLA 4LGXA 4O54A 3M0HA 1W5QA 1U1HA 1KRMA 2QUUA 1QBAA 2YL9A 2WHLA 3PUOA 3FV9A 3CUXA 3B8WA 5TF0A 3CWHA 3OIHA 1Y5XA 3BH4A 3WD4A 1GZGA 1S2WA 1Q6DA 2Z1XA 3LCHA 4XD6A 1PV8A 4UOQA 1Y0EA 5AHIA 1HO4A 2YGYA 2F9RA 3FJ4A 5AECA 2TMDA 5A94A 1BSIA 1JDEA 2LLEA 3BMWA 3GNRA 4HQVA 4AD4A 1V3LA 1VEMA 2ACRA 2ZRYA 3BTNA 4PMQA 3W1XA 2XH4A 5BW6A 3MBDA 2X1UA 2O9OA 1RVGA 3IIVA 1GG1A 3CH9A 2CBUA 2R9RA 5XIMA 1Q6FA 4J3SA 3UZYA 3HOJA 4W7WA 5FJJA 3H4GA 3C3NA 3GNNA 3C8NA 4LVGA 4DBWA 1ICSA 4LEQA 1DKWA 2ZBTA 1L6SA 4UCFA 2OZ3A 4DBSA 9CGTA 4GVGA 1L0PA 5EB8A 2FJKA 4GYKA 3B4UA 2WCAA 4XZLX 2WLYA 2VD8A 4XZNX 4D6CA 5M03A 1XC4A 3VIIA 2YDAA 2ZC1A 3H2NA 4GPNA 1FHDA 3WQPA 1YDVA 2E5BA 1PTDA 4BEQA 2E8YA 2AGTA 2XIBA 4LPCA 3OLGA 3U4AA 5AHEA 4DM1A 1A50A 3N2CA 1XR2A 1V0MA 1ZSXA 2QCDA 2TRSA 5C71A 3K1DA 5AY7A 3UT0A 4O1CA 3EXSA 1L2QA 3RLVA 1R3SA 1TCDA 3F7JA 2JFEX 2E25A 4AD2A 6XIMA 1JG9A 3MDWA 2VFIA 4FXSA 3IANA 3G3DA 1U83A 3L68A 1FDYA 4KETA 4WK9A 4XV0A 1O6IA 4MY8A 4OUEA 1XG4A 2EO7A 5DMYA 1BWVA 3TJXA 3UJRA 1ELSA 3VX1A 2JKAA 4O8RA 3G0UA 3SRFA 1JCYA 1KKRA 1G69A 4LW7A 1WV2A 4RNHA 1KM0A 5FA5A 1YNQA 1VGAA 2J7HA 1QPRA 2VX7A 3WJSA 1G9HA 4MB5A 1E3XA 2OQHA 5C8BB 4DQWA 2OO6A 2WJEA 1CEOA 5CPMA 1GVIA 5FEWA 1JYVA 1D8CA 4AZ5A 3IARA 1XRTA 1TE1A 3ALFA 4DNMA 5AC5A 3EX3A 4JQ2A 3EZ4A 3GK0A 4FXJA 2O92A 5C7HA 4L1XA 2W91A 3ZJ8A 2AAMA 4FR6A 4XWUA 2RGMA 4OBRA 3IV3A 1EPXA 1J0IA 3SY8A 1ISWA 4HA3A 2DT3A 3II1A 4ROQA 3PWGA 1NFBA 4ZSUA 2CW6A 2E1WA 3SIMA 1VHNA 3HBLA 3QMRA 3DYOA 2OEKA 3PPCA 4MB3A 4AXKA 3ZT5A 3H7UA 2FTYA 1NF0A 2WZTA 3MPGA 2EPKX 2VRKA 3URQA 2O7QA 1J0ZA 2UY4A 2WW5A 1JRBA 1LM1A 4LNCA 1OFRA 3PHAA 2C3ZA 4UNIA 1Z69A 2WQPA 1V3IA 4AG0A 5HNUA 3S1UA 5FF7A 1CXLA 1G01A 3TTOA 1V6YA 2VR4A 4HYRA 4H9VA 4JTFA 1IZJA 1F8IA 3LGEA 2J9ZA 4ZMGA 7REQA 1N7KA 4JICA 1KWGA 1OFBA 2FHCA 2OZ8A 1IEQA 1YXCA 4CUCA 3KX6A 5KINA 4GQGA 4MNJA 4IG2B 3THUA 2GZXA 4UFIA 3EAUA 3DYPA 1BYDA 1GHSA 3C3UA 3L0NA 2ZZ5A 3WCZA 2F38A 1VPQA 1NOUA 1QWKA 3RX2A 3AMCA 4Q8NA 5BU9A 4CNOA 3KOYA 4A3RA 3LU2A 3GG7A 4ML4A 3GXMA 5LHFA 1SO4A 2IKGA 1SO3A 5T9CE 4XVEA 1AODA 1OCJA 1EZWA 3VMOA 1F76A 4JTEA 2B7OA 2WANA 2XGZA 3EX2A 4N4PA 4JHMA 3KTCA 4PFMA 1VHCA 3Q94A 4PMYA 1JCXA 3CEUA 1UB3A 1KBLA 2JIEA 2X1TA 1UZDA 3G1DA 2RDXA 1D2KA 3QZEA 4R7WA 3KVMA 4AU0A 4E8DA 3GIYA 7CGTA 1V6WA 1OFEA 4XO7A 1DBTA 1S5MA 4LRSA 4B5SA 5A95A 4KIRA 4G7EA 4ACZB 5TNVA 4HMCA 4I9TA 2QS8A 1VBUA 4QJ3B 3QOKA 3AXIA 4IM4A 1K4HA 2I9EA 1TSIA 2PTXA 2V5CA 1TREA 2FZDA 5I77A 2J7FA 2P1FA 1OT2A 3T09A 5G2WA 3VC5A 3ZSSA 1GJPA 3HN3A 3M0MA 1EDGA 1J96A 3BQ5A 7TIMA 3MKKA 2GQ9A 2VHLA 4IPLA 2DT0A 3T2OA 5BWAA 3ZFHA 3IK2A 1G67A 3FCPA 4RDYA 3WD2A 3WLTA 3UWQA 4PTWA 1NEYA 1VIZA 3IGHX 2P50A 2GGEA 1Z32X 1BTMA 5FEXA 2Z7KA 2DSVA 4H19A 1F6PA 1TR9A 4ZSTA 1VBJA 4GVFA 2X09A 3VYLA 2YLLA 1SR9A 4NXKA 1CYGA 3DKJA 3BLDA 2WVTA 3KCJA 2VEGA 3NQVA 1K7EA 2DPEA 2ICSA 4FK9A 3L4TA 1U1JA 3F2CA 5CPTA 4HU3A 4IMFA 4AZIA 1WQ5A 4HZ7A 4IP5A 5A6BA 1Y8BA 4MMWA 4XVDA 1BVNP 4JHOA 4ZL1A 2AOSA 5EA9A 1KFJA 3M6YA 2PC4A 5DXXA 2V68A 3VAVA 4JFVA 1EJUC 2OKTA 4H00A 3QV7A 2ZWZA 2QJGA 2DSWA 2V3DA 3MMTA 3R43A 1RQBA 1E4IA 2E4TA 4JTDA 3I6EA 1Z8AA 1M6JA 5HR6A 2BHUA 2I56A 4M1BA 2B31A 1O7AA 1GOXA 9XIMA 1GVOA 5CAKA 5LKYA 3W4RA 2I5QA 3QGVA 3KBSA 3NDZA 4PCNA 1LL4A 2NVCA 2ZZ1A 4Q8QA 3ITGA 2D1ZA 3BPWA 3K13A 1ZPTA 1PSCA 1XS2A 2Q8XA 2QCCA 4ZOBA 4IHCA 4JTUA 1XIBA 1XKYA 1HF6A 1KQYA 3P67A 2YCJA 3S2MA 1P4CA 1R85A 5HPCA 4PH6A 2GJXA 1THFD 4QEEA 3B9DA 3FHAA 1JUBA 2H6RA 4IGNA 4PE8A 3OB8A 1QFEA 3PWIA 1X98A 4DO5A 3CYVA 3SDOA 5IHSA 4MM1A 2Z4GA 2Z27A 3HGSA 3WQ4A 5KZMA 2CFFA 3GX9A 3WH5A 1DTNA 1T6MA 3NQ6A 3CIVA 1TTIA 5BMWA 4G6CA 3THAA 5BNKA 3B0YA 1IXOA 1DPMA 3FIGA 1CI1A 2QR6A 1T8XA 4IGSA 5IBXA 4Z0JA 1XWYA 2VZOA 4NZ4A 3WDPP 3TN5A 3W71A 3TMQA 3C56A 1I4NA 5G2HA 3Q67A 2Z1VA 3BLIA 4GVHA 4P8WA 4IXHA 4GGHA 3VMNA 2OQYA 4OBSA 3CUHA 2Q09A 1PWMA 4JYFA 4IPJA 1KC7A 3QBUA 3CXOA 4K2SA 2B7PA 3B8DA 3E0IA 4PODA 3VIFA 3PZVA 4TV6A 2WC7A 2XDFA 1LBFA 1KO0A 3NJ3A 3GDKA 2C1GA 4GCAA 2OELA 4ZGYA 4Z2KA 5CPSA 3SI9A 1BD0A 2PU1A 1TWIA 1N8FA 2PDIA 3W1MA 3B0UX 1HKWA 3LPGA 3M0KA 4DYEA 3TQVA 5FL1A 3EKLA 4PL1A 1V51A 4K36A 4GIAA 1HJUA 3MUCA 3LCWA 1VP5A 4E0CA 4GINA 2IS7A 3QMSA 3ZJKA 4TX8A 3AYRA 5IFPA 1GKQA 2QIWA 3W1AA 5EU9A 3EDDA 4IGMA 3NPXA 2PI6A 1EBHA 4U28A 2NQZA 2VUYA 2NSXA 1LLWA 2HK1A 3HZ3A 2ZUTA 3STEA 3NDYA 4UTTC 2DZXA 2J24A 2NUYA 3CASA 3N2OA 3KZSA 1JZ5A 1H60A 3ARSA 5CC3A 1I2QA 4IP4A 4JX6A 1EC9A 1GQLA 4OUIA 2D2OA 1ECEA 4F2BA 4ZQCA 2FPVA 1QVBA 2C6QA 3WJZA 3CZGA 1FWTA 2V63A 4LV4A 2FZ9A 1OZQA 2CZVA 3VDAA 4GI6A 4B5UA 4O17A 3AHZA 9RUBA 3TA9A 2Q3RA 2VCCA 3AROA 3VC6A 1MZRA 3BICA 1CPUA 1XBXA 3U2EA 2G3IA 4AWUA 1WYIA 3CV7A 2GQ3A 4XAFA 1MDLA 2X05A 2I5GA 4MFDA 4BHYA 2FH8A 5JVLA 1OG0A 1XX1A 1LRQA 3VKJA 3ITXA 1QOPA 1P6WA 2E1DA 3GAKA 3R94A 3PNZA 2YZ5A 3UQNA 1Q8AA 2XUCA 1OGSA 1EGMA 2WMIA 4AHOA 3DBPA 3VE9A 2QCDB 4QE1A 4Y8EA 1SPQA 5GJNA 1FOBA 2P76A 3ICJA 1XL9A 1CB7B 3A6OA 4Y6GA 4LUYA 4CD8A 2P0OA 3QFEA 3BXWA 1FWWA 5A6BD 4ALDA 4CNTA 3E0FA 3M4HA 3AMDA 3IACA 3SRKA 1PKNA 3M5ZA 4BFAA 4TVCA 1NDWA 3VNDA 1JGMA 3P14A 4Z1YA 3RHGA 4PZVA 4HNCA 5GJPA 4Q4PA 1F7BA 2GJXB 4EAMA 1EC7A 1QATA 3L2IA 4C91A 1ODZA 4W9TA 3HG4A 2EPNA 3TWBA 3MSRA 1JXJA 3SB0A 4O18A 3FNDA 3F2DA 2HVMA 4LTSA 1VKFA 3KL0A 1XIJA 3WDJA 4ICMA 1NM9A 2E6YA 2OOFA 4ZO6A 1HGWA 3HG3A 1EUNA 5D30A 1X7FA 4GNVA 5F4SA 3H2FA 4CNUA 1EJSC 3Q2DA 1P7TB 4EE9A 1AQHA 1VJSA 3GG1A 1A5OC 1S1RA 1OIMA 4FNQA 1S39A 3STGA 3W9ZA 2WMFA 1FH7A 3K4DA 3P84A 2PDCA 8A3HA 3LRKA 4NILA 4PMDA 5AZ0A 2Z2UA 2V5DA 3V5OA 1N8WA 4NNCA 1BRLA 2VZSA 4RDZA 5IDZA 1XQKA 3ZYZA 3WQGA 4YTQA 1W17A 1GOKA 1KW1A 2A4AA 2Y89A 3WL0A 3VIPA 2D2GA 4R34A 3YPIA 2W79A 1OYBA 2XIIA 2YBVA 4FIRA 2XINA 3LTPA 4DUWA 3GBEA 3IIOA 4QFUA 1Q65A 3V3WA 4N6FA 3QRHA 4NAEB 4YMZA 3WLIA 1AJZA 1W8SA 1RVKA 5D09A 3F2BA 5CXPA 4GABA 4B9ZA 4MJZA 3PS7A 2R91A 4PUDA 4C6QA 3IWPA 5AB3A 3M9YA 4DEFA 1AK5A 4M7TA 1K3UA 4AHQA 3T0CA 3PG8A 3LNPA 1CXKA 4UTHA 1ZALA 4PL2A 1H4PA 3ITCA 1GYLA 1SR0A 2GQ8A 1DE6A 1HKKA 4OHQA 4NX0A 4DUVA 3IJDA 1TIMA 5A6SA 5LIKX 2FHFA 2VWSA 1D3CA 1HJXA 2XVNA 5K9XA 1PL9A 1TKKA 1LG2A 3I68A 3PJWA 4AC1X 1TVNA 1IE7C 4HJWA 3BO9A 1SFLA 2PP0A 4GO8A 4PTXA 4PFHA 3VIHA 3OJGA 4KFOA 1MXGA 5K4XA 2CHNA 4DY1A 3KBVA 2XSAA 3UWWA 2YXGA 3MP4A 2DJXA 3EX1A 1W31A 4ZA0A 1QASA 1RK6A 3HPFA 4JTTA 4YTUA 3RR1A 2QMJA 3EPNA 5M17A 4O1DA 3WG6A 3VOCA 2BX7A 2G3NA 4KH2A 3KRSA 5I3KA 4J7RA 2P88A 3NQBA 3BLPX 2OSWA 4RX0A 4WY0A 1J8VA 1M7JA 2QCGA 3DFPA 3NL3A 3UA3A 3PFRA 1HX0A 3KFTA 1E6ZA 1TUFA 1UD6A 2ZX6A 2VFEA 2OWCA 4PUEA 3H55A 3O06A 3CZ8A 1ZAJA 4V1YA 1OGBA 4C1KA 1HKMA 1KFBA 4HBKA 2E9MA 5ABFA 3O7UA 2DIEA 2PWHA 1Z7AA 2GSJA 3WLQA 2DZSA 1L8PA 1IT8A 1L6FA 3GNOA 3STCA 2IKJA 3BDKA 1WDWA 4G1NA 4XAPA 2EGZA 3QSTA 1VCVA 3SCRA 4K8HA 3GNXA 4XKYB 3SCNA 3BANA 1XLAA 3EGJA 3S2CA 1UJPA 3PJUA 1XCWA 5HPOA 2JF7A 4Y7EA 1JPDX 3UXLA 1MZHA 1S1PA 1ZTVA 1H62A 4X2RA 4JCMA 1EEPA 2F7FA 2X16A 3SCQA 3VE7A 4MUZA 2ISFA 3CV6A 1W8GA 3AIQA 3IVTA 3B04A 1VPXA 3TFCA 4XG1A 5DY3A 1XI3A 3ZLHA 2FZ8A 1KCKA 5HMEA 4XIMA 4ACZA 5AC8A 3M5XA 2X1SA 5ABFB 4JDYA 2IPWA 3ONBA 3LYEA 3GU1A 4UFLA 3RX4A 3MUY1 3CGTA 2C0HA 2EF9A 2QF8A 3P93A 1G4TA 1ITCA 4X0NA 3WDQA 2XSBA 3MHGA 2GGHA 1OFPA 1RPKA 4UOJA 1HXJA 4QQUA 4HNTA 1BG9A 3VDBA 3KM8A 2PS2A 4KGLA 1R47A 3EXTA 3OU8A 2VL4A 2VO5A 4DN1A 2PC8A 2WC4A 2VRJA 3W7CA 5KETA 5KITA 5DRCA 3W7NA 3WMLA 2GJRA 2WNQA 1WDRA 3WQ6A 3L9CA 3N1AA 3RRAA 3LRMA 4QQ3A 4QDWA 3M0YA 4E2DA 3WLHA 3EOEA 3T4CA 4MLRA 3WK2A 2XWEA 4RJEA 1ZY9A 2JGQA 4RK8A 4WEVX 3H2MA 4FX6M 5CPLA 1IV8A 3ABOA 4A2RA 4NAEA 1I1XA 1PYMA 3VGEA 1M5WA 3ARTA 3RM9A 4UTWC 4XTIA 4C1NA 4ZO7A 3DG3A 3I4KA 4B5NA 3P7YA 4RE3A 4BZYA 3GR4A 4BEUA 3S83A 1XCXA 4NAFA 3CH0A 2CLHA 3HG5A 4O10A 5FCZA 1XCFA 2GOKA 3ES7A 4HPJA 4V15A 1C93A 1TELA 3A22A 2ADAA 2OO0A 1K8XA 4M6UA 4XBKA 4KEVA 2OWXA 1VYRA 1GGOA 1WZMA 3MMWA 2WSRA 5D2VA 4LS2A 4WD0A 4C1NB 2EPLX 4KIEA 1SFTA 3E5PA 1AH3A 3S5ZA 2GUYA 4FOUA 4W89A 4CCEA 5AHFA 2XFFA 3C2FA 4JX5A 1PDYA 1KRBC 4KEMA 3EWWA 3SJNA 1GVSA 2XH7A 2QPUA 1WA3A 1HQTA 1RD6A 1UD3A 3VOFA 3M47A 3H7VA 3HF3A 4WY0B 1NF7A 4L6OA 1EEXA 1XLKA 3EDEA 4HPXA 4D6DA 1PXGA 1WO2A 3AHTA 1H0GA 4DJEC 1K77A 3MYPA 4JKLA 5I2UA 3UXIA 1BAGA 3RPDA 1DJZA 3SW6A 4P2VA 2FGZA 3CPRA 3RDKA 5CJ5A 5HBFA 1E71M 5FJUA 2QV5A 1B3XA 2PBGA 3LHZA 3RR4A 3U4FA 5DCDA 1RQEA 2CIPA 4MZ1A 4HP5A 3FOKA 1ZQ5A 4PTVA 4MDOA 4F8XA 4J3TA 3LCIA 3IRDA 3FW6A 4U5KA 1JQXA 1OSEA 3W22A 3TQPA 4NZ3A 4EXBA 2C1HA 4JTRA 3G5EA 1A3WA 3R0KA 2Z25A 3ITOA 3TSBA 1UQZA 2PPGA 5FEPA 4QLJA 2FGBA 4YN5A 2PDPA 2PTWA 2YFOA 4F0SA 2V5LA 3QC3A 2FKPA 1M3UA 3KUMA 2RJGA 1HNYA 3TR2A 1OINA 1V3MA 1KGWA 3L5LA 2VVNA 3FXYA 4DPQA 3RITA 3BG3A 2WSKA 2HROA 1JPHA 1XRSA 1DJWA 3NL6A 4S1FA 4K68A 3GH5A 3REQB 2IQTA 2E67A 4FNRA 3VIGA 1F05A 4OZOA 2QJHA 5HNNA 1WX0A 4DBDA 1CNVA 2A1YA 5H1WA 3MYOA 4WLCA 3N6JA 1SJBA 3NDOA 4HN8A 4DF2A 5KTLA 4XD4A 4GE8A 4CD7A 4TX9A 3GVWA 1TMHA 1EX1A 5IRPA 1YRRA 2DUAA 2QZRA 2NX9A 3H23A 2FTPA 2DH2A 2QVHA 1XICA 2RH9A 1KGUA 3APGA 5JH1A 4GG9A 3C52A 1PO9A 1Z42A 1OC5A 2J88A 1PHWA 2FVLA 4DWSC 1IEWA 3BW3A 2GJLA 3WN6A 2W4XA 3UY7A 1C7TA 1EDTA 4W8LA 4ES4A 3K4WA 1GKRA 1SSGA 3W81A 2VOMA 4PMVA 1KCLA 1W3HA 4PCSA 3DKLA 1GQJA 2INZA 2DVXA 1TYGA 1EJRC 3B9EA 4FXFA 4G9PA 4JY8A 3AMLA 3DECA 2WCSA 2ZZ4A 1JI2A 4L5ZA 3GVGA 1W9BM 3BLLA 4RR4A 5D9PA 2XWDA 1J5TA 2QUMA 3PWAA 1G1YA 1E1EA 4IMEA 1FWCC 1F2JA 1EHNA 4L80A 1YPFA 1PJ9A 2VEMA 2XIMA 3EYPA 4GVIA 3W7RA 4BQ4A 4Y9OA 1B30A 1P0BA 3SFKA 1F8MA 4WKFA 5AKQA 1S3TC 1UWRA 3I7SA 1GYNA 2A79A 4PBEA 1G5AA 5HUOA 1QI4A 3SRHA 5C5YA 5D04C 5ENLA 3PZNA 4HOZA 1SMAA 1P0KA 3L4UA 3JUGA 4QITA 1C3FA 4B4FA 1TE6A 5C55A 3FDGA 2AL2A 4C6EA 2HNEA 2ZRUA 4PYSA 1FP9A 3PUDA 3VOJA 4M8UA 1EKOA 1QWGA 2A3AA 4E5TA 4JTQA 3EWXA 1FX6A 3TYBA 2HCVA 2J9XA 3CU2A 1FBAA 4HZ6A 1ITUA 1PX8A 2QPSA 3DAQA 4KESA 5H8MA 4JYEA 4YPJA 1B3OA 1HL2A 3WNOA 3JZUA 4Z2IA 3UXDA 3PZ9A 4O11A 5CZKA 2A7PA 4DF1A 1SW3A 4OTKA 3TEVA 1R3RA 1W3NA 2PLJA 3IJ6A 4GJIA 3UW6A 2L5HA 1YTDA 1VJZA 1BLIA 5D05A 4UZSA 1F3XA 1SGJA 1UOZA 3VINA 1IR1A 2RFGA 2BBFA 2FQIA 4Z08A 2E5CA 1AA1B 4S3KA 3B05A 4XTDA 3U6WA 2NQ5A 1L6WA 2OX4A 3LPOA 1WB0A 5DELA 3G6MA 4UQDA 1H7WA 3TR9A 1Q7MA 4FLQA 3VD9A 1V0NA 4RCXA 3A12A 1FDZA 5D8WA 1HVQA 1BRLB 5FESA 4Q7NA 3K30A 3AS1A 2ISDA 1RUSA 4US5A 3D6NA 3OIXA 1SQ7A 3CL6A 1XH1A 2PGFA 2IPFA 1EGZA 1QNVA 1K6AA 5G4WA 1R3VA 3TV8A 1KFLA 1UPPA 5CSUA 3QC0A 2EJAA 4UTKA 2UY3A 3G1RA 3IJ8A 1HL9A 3W74A 1DWHM 2I1OA 3K1GA 1E5NA 1UKSA 5FL0A 1NWTA 1UP3A 4PSPA 1Q63A 3AQUA 1ZAIA 3QEZA 1LORA 4J2PA 2X0HA 2Z1SA 2Z24A 4E2OA 2X40A 1E51A 1F73A 4C6CA 2BS9A 5EY5A 1R2RA 2MUCA 2BVYA 3T9PA 1WDPA 3AHVA 3WLSA 4RZ6A 2ZX8A 2XFRA 3AIBA 1QHZA 3AUJA 1VJIA 3CZEA 1KGXA 3W84A 5HUPA 3GU9A 4NZJA 2CXGA 1IWBA 4QJ1A 2RDUA 4FEZA 3PZIA 3OQEA 1XLCA 1GJUA 2WWDA 2VXNA 1OADA 2A5HA 4S3EA 2DJLA 2PZNA 4BF9A 3TTSA 4UTFA 2A3EA 1Q2SA 1VBHA 2O55A 1T41A 1M9HA 4JIEA 1TPB1 4H6QA 2H3DA 4DI8A 3USBA 5F2IA 3KLLA 2J79A 2WMHA 3OZOA 1O94A 4YU1A 1IEIA 1B2YA 3MV11 2ESCA 4O19A 1B3WA 1J0KA 2TPSA 3M07A 2DZUA 3WFLA 3GW0A 1VYSX 3TFXA 1OFDA 1PKYA 1VIWA 1WDQA 3ELFA 1H1NA 4MWAC 2J7GA 5EBUA 4DUOA 2OEJA 4H2CA 1YIXA 1HW6A 3W2UA 3QM3A 3V5CA 4JBRA 4IPNB 1ZENA 2YOCA 2FDMA 4HHHA 4QNEA 4H8HA 4RZBA 4YNGA 3GUWA 4RNJA 5E09A 5DBTA 2AQVA 2ZXAA 3COTA 3NQ7A 4ZOAA 3LZ3A 4MSSA 4AISA 1W1B1 4R33A 1U1UA 3S6OA 4AXNA 1DQUA 1DJIA 3GD6A 1IF2A 4IPIA 2VRQA 2PDGA 2J6XA 4F9DA 3FYYA 1QK2A 3OGSA 4IJCA 1SW0A 3OGVA 3VFCA 1P1XA 3HIJA 2I5IA 1LL6A 3P82A 2CITA 3LHUA 2ZE0A 3ARZA 1TJ0A 4WGXA 3PULA 5M3WA 3KVLA 5C9UA 2RUSA 2P3ZA 2VOTA 1XRVA 3CQHA 2NXGA 2QDHA 4HPHA 1XFCA 1DQWA 3DDMA 5M2FX 1YKWA 2FZNA 2OYKA 5CGMA 3RCNA 3PUGA 4PRWA 1SM9A 2KX9A 4ERGA 3WBAA 1HJQA 1FUYA 3LLDA 5U4NA 1GK8A 2NQJA 3UZZA 3L4YA 5A2BA 1MXDA 2CETA 2ANUA 3D3FA 4QSFA 3BJSA 3GYEA 2Q3OA 3T1GA 4E4FA 1O5RA 1US2A 2ZTJA 3S9YA 2ZX9A 2V2CA 1A80A 1H3GA 3W88A 3POCA 1S38A 4IWWA 1G4EA 2A3HA 2QCFA 1ZU8A 5KSWA 2WOQA 3V18A 3W7OA 3UJEA 1R9YA 3N13A 2VVSA 1DV7A 1XBVA 4DZIA 3CUJA 3HQNA 1VAHA 3R79A 3UR8A 3M16A 3SCPA 1ISVA 4D8ZA 1IEXA 1E0TA 1W0MA 3TOPA 4AZGA 1X96A 3NSMA 3M0LA 1ZJBA 3T40A 1UZ1A 4LX4A 4YHGA 1LOLA 2AKMA 4N6EA 4D8AA 5L6UA 2D20A 2XFYA 3RPTA 2J77A 3GC5A 2DEPA 1F61A 4TX6A 1ONEA 2AL1A 3EOUA 4GOAA 3MWAA 3AS3A 3TNOA 5CSSA 2A6NA 2H8ZA 3VD7A 1WZKA 4WKAA 2OOGA 3PN8A 4MWAB 1VCFA 4KCTA 1BXNA 3ATYA 4ZENA 4UFMA 1B3ZA 3BGAA 3MANA 2UBPC 7TAAA 1EWEA 4PTNA 3PUEA 1R2TA 3R10A 1NQKA 3NQ8A 4AZCA 2D3NA 5K2ZA 1E4NA 2JGYA 1X1OA 1OX6A 1LTDA 2QUTA 3R89A 3EBVA 2QUVA 3U57A 2PODA 3FXGA 2FMOA 2BZNA 3WQDA 3MJMA 3SADA 4GX9A 4WXYA 4W8BA 4FAMA 2Q02A 3VGBA 2IQ0A 3WQOA 1QOQA 3NNTA 1SJCA 4Z2HA 3W00A 1EF3A 1OIFA 3PTMA 4X2PA 5I06A 5I3DA 2PDWA 4WR3A 1X6UA 2G3JA 2V2DA 1IT0A 3G1SA 3FA4A 3SQMA 4L4PA 3AS2A 4QP0A 1VENA 1VFMA 4AD5A 3MHFA 4R7JA 3WEOA 1D3HA 5LSMA 4MADA 4A8IA 4AZ7A 2WBKA 1CLKA 3GW3A 3HURA 3IUHA 5CLTA 4O53A 4KWUA 1X7IA 3TW6A 2BOEX 1OM0A 3BSHA 2BXVA 1MQPA 2B81A 1PZ3A 2RJHA 4E3VA 2FGLA 1QU4A 3DC8A 3N19B 4XZIA 2ZE3A 1EPVA 1TV4A 4MNMA 3WNNA 3CQJA 3OG2A 3QGKC 4U10A 1H7PA 5GQBA 4ROPA 1KM3A 3A24A 2OU4A 1MYRA 1EBGA 3QQ0A 3NIYA 5AC6A 3MO7A 1TPVA 2CYGA 4FF5A 5MHBA 1F4HA 1E4MM 4L56A 1LQ0A 2Z1KA 1XHGA 5BOOA 3STFA 5TD4A 4QR6A 1U30A 3C61A 2BGNE 3CWNA 5HOSA 3FX4A 4V28A 5DT7A 1NWUA 2OYMA 1GOIA 1TJ2A 1TMQA 4HU8A 4FHAA 5FJRA 4WQ6A 3VIJA 5BRBA 4BI5A 5I23A 1W3LA 1DWGM 4RPPA 1QI3A 1M7XA 3M0VA 3A5VA 1Q8JA 1UWIA 3C2RA 3T0AA 3GDLA 2WCGA 1YTKA 3RM8A 3PZOA 2YW4A 4O28A 5I24A 3L2MA 3CC1A 4YYCA 4F0HA 3N12A 1AW5A 2D3LA 2YDRA 4AVNA 2Y6ZA 3RCMA 4UTMA 1J9YA 1I8JA 3URNA 4WGHA 2PSNA 1BQCA 3NQDA 4ZCWA 1LG1A 2PDNA 5G1MA 1FWHC 3NOEA 2WAGA 4AEOA 2VGBA 3V1PA 2FDSA 3CQIA 3VKBA 2PP3A 5L9FA 1K02A 4GZJA 3AIUA 4Q6JA 3I3EA 1ISYA 3GXIA 3W7MA 1Z9AA 4H9MA 1E1CA 3F4DA 2WLZA 4IMCA 4JNMA 2NQ9A 1VZWA 3GXTA 2XPKA 1FHVA 2C79A 3EXRA 1C9WA 4PUUA 2C15A 1FTXA 5C70A 5DANA 3W53A 1TWZA 2SFPA 8TIMA 4Z2LA 1BGAA 1JYWA 3ZXWA 1P0EA 2VQTA 3G24A 3LGDA 3QV8A 1OB0A 2CEQA 4I9AA 1R8LA 4QDPA 1E9LA 1D3GA 3LERA 4Q8PA 3TWAA 1XIFA 5F2GA 4XUGA 1V3JA 2I17A 3SEPA 2D69A 1GQKA 3T2PA 1TPUA 1Q6GA 6REQB 2DDXA 4LF2A 2TODA 1XUZA 1PIGA 2Y62A 1SW7A 4CVUA 4EAYA 4ILSA 4HHPA 3F5KA 3WQCA 1FVPA 3BVJA 3TVAA 4NI8A 3LQGA 1K7XA 1RP8A 4CQ8A 4IMDA 3O8AA 1V77A 3ABXA 3ZT6A 3LENA 4UTIA 3GDMA 4GH3A 1KV8A 3RLHA 3G22A 4GUIA 2GLKA 3FA3A 4ZXLA 3L12A 1QI2A 1VFFA 3EPOA 3URBA 4TOQA 3R8HA 1W2PA 2JKPA 2ZRVA 4LCSA 2J13A 2ZUWA 3WK0A 3IIPA 4UTUA 2NLYA 5HQLA 3UWYA 2CBJA 4QX4A 2OB3A 3EA1A 2WMJA 1MW0A 5MKGB 4Q4RA 3SN4A 2XFWA 4NAFB 1M04A 1MQRA 1SJDA 3BQ6A 4K1WA 1AW1A 3C0QA 4O16A 2CKSA 3CHDA 1QNRA 1FKWA 3JS3A 3ZT7A 3NEVA 4I8DA 5C2CA 4KGJA 5DQPA 2ZZ3A 3GE7A 3VKKA 1LUCB 1VFHA 2DUXA 4EPKA 4FLSA 3REQA 2OQLA 2YFNA 1UW9A 3BLEA 2C14A 1R3WA 3NXFA 3CZKA 1TX0A 2WVUA 2YW3A 3VNZA 1FCBA 3HPAA 3MWCA 3HA1A 5CC7A 2NWSA 3WNMA 3PZGA 2XHYA 4QCFA 2BASA 4XZ9A 4Y9AA 1QNPA 3KVKA 4EWJA 4TVDA 4R5EA 4D2JA 3CYJA 3TW7A 3C8FA 4JHZA 4B5WA 1LRTA 4HTYA 1YPXA 3CAQA 4XBJA 3TYCA 3W73A 5CZ0A 4RPQA 2BG5A 4I8YA 3LCFA 1CGTA 1FWIC 2VX5A 4B4HA 1L8NA 4WVXA 1RY0A 4FIQA 1JEZA 3ME3A 3QKZA 4Q7BA 4WZHA 4DBUA 3SBFA 3NQFA 1QAPA 2G41A 4WX2A 4IMAA 4AZBA 3EKZA 4PBFA 1ZHAA 4KW2A 3WMCA 1YTEA 3EWYA 3OG3A 3O2LA 3IUDA 1OEPA 2ZTKA 1QW9A 5IBXC 1RJPA 3APYA 4MGGA 4GZIA 3ZWSA 3M44A 1UWTA 5E70A 2IMRA 1FH8A 5D37A 4HZMA 1ZP3A 1O66A 4ZO9A 2NV2A 4EPBC 3NOYA 3HG2A 1IXPA 3M6DA 4HCDA 2YB1A 3DX5A 3WH8A 3I7RA 3NSNA 1F4AA 2PGWA 2VC9A 1CGVA 3N2XA 3GVQA 3NQEA 3AOFA 4GHRA 4WDUA 4UR8A 4WCJA 1Q2RA 4A3UA 3CNYA 2GUUA 3NL5A 1VFOA 1QK0A 2QQ6A 2WJDA 4TMBA 2G97A 2WZEA 4IIDA 3G3MA 5CPOA 4B90A 2W62A 4QISA 5DMMA 3DFOA 3KAOA 4BCEA 1PB0A 4HNOA 2YJQA 3LV6A 2DZWA 4PUMA 1GVFA 4GC3A 4TV5A 2GSEA 4U5IA 1XDMA 1Z6KA 2X2YA 3THQA 1T40A 4GFIA 1WKE