4I6KA

Crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
267
structure length
267
Chain Sequence
MNCIDTHAHVFSTQDHSIETARYAPDYEATVQSFISHLDEHNFTHGVLVQPSFLGTNNQAMLNAIQQYPDRLKGIAVVQHTTTFNELVNLKAQGIVGVRLNLFGLNLPALNTPDWQKFLRNVESLNWQVELHAPPKYLVQLLPQLNEYSFDVVIDHFGRVDPVKGIEDPDYQKFLSLLNVKQHWIKVSGFYRLGATPSNINIAQQAYNIFKEKGFLHKLIWGSDWPHTQHESLITYEDAIKAFKQIVFDKHEQCLILNQNPTELFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Amidohydrolase family protein
publication title CRYSTAL STRUCTURE OF PROBABLE 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE (TARGET EFI-505029) FROM Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
total genus 100
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4i6kA00
2YZ5A 3QY6A 4KQNA 3LGDA 4R85A 3R0DA 2GWNA 2P53A 2FVKA 3UPMA 5HMDA 4XD4A 1R9ZA 1UMLA 1J6OA 2Y1HA 3ISIX 3NURA 2Z28A 4F0LA 4WGXA 4RDWA 1PSCA 3GRIA 3GUWA 2RAGA 2YXOA 3B40A 5CH9A 4LAKA 1GKPA 3F2BA 1EJVC 2E1WA 3IV8A 4KESA 1R9YA 4NP7A 4HJWA 4QS6A 1KRMA 4PCPA 3SFWA 2GWGA 4GY7A 4KETA 1I0BA 2Q01A 2QT3A 1O12A 2VC7A 4C6DA 4IGNA 3K5XA 4H9ZA 1NDZA 4XD5A 1KRCC 1V77A 2Z27A 3S2LA 1EJTC 2QVNA 1EYWA 1JGMA 1M7JA 3MDUA 2EG6A 4I6VA 1FWIC 4LH8A 1YBQB 4OFCA 1RA5A 2O4MA 2F6KA 4XAYA 4E3TA 3IRSA 3IGHX 4C65A 1UBPC 3T1GA 2KAUC 1UIPA 4QRNA 4H00A 4ERIA 1RJPA 1A5MC 3PANA 4EPDC 2ADAA 1P1MA 3LS9A 1I0DA 2OOFA 3B0XA 3URQA 2UBPC 4WVXA 3T81A 3LNPA 1P6BA 3PNZA 4GXWA 2Z29A 4M51A 2OB3A 1XWYA 2FTYA 3OU8A 4IFOA 2XIOA 1FKWA 4EP8C 1ITUA 4BY3A 3F4CA 3CAKA 2HPIA 3ICJA 4IGMA 4NG3A 1S3TC 3MPGA 4IFKA 1V4YA 3UBPC 2CZVA 1A5OC 4GX9A 4C6LA 5FSDC 2HBVA 3QY7A 4P5UA 2I5GA 4J2MA 3GU1A 2VR2A 4LAOA 4LCQA 3GTIA 3HPAA 4LAMA 4GC3A 4GY1A 4G7EA 4GBDA 3T8LA 3TNBA 4RDYA 3UR2A 4IF2A 4QTGA 1FWJC 4QS5A 3S4TA 3ID7A 1YMYA 2W9MA 3JZEA 1RK6A 1IE7C 3GU9A 4H9TA 4KF1A 4H9MA 2G3FA 4ZSUA 4J35A 3F2DA 2I9UA 3MVIA 2DVTA 3DC8A 4EPEC 4H9VA 4GOAA 4KEVA 3C86A 1NDYA 1ONWA 2OGJA 2YB1A 4KEUA 2R1PA 1FWGC 4GYFA 4CNTA 4DZHA 4DI8A 2R1NA 1EJSC 4LCRA 1V7AA 2DVXA 1EZ2A 1GKQA 4R88A 3LY0A 4DI9A 2DVUA 3QGKC 2D2HA 3LGGA 3GIQA 4C6BA 1K6WA 1P6CA 4H9UA 3UR5A 5AKQA 2GOKA 2Z26A 3AUOA 3IARA 2P50A 3EWDA 3URAA 1V79A 4BJHA 1A5KC 1E9ZB 2AMXA 3N2CA 3CS2A 4GK8A 3S2NA 1KCXA 3AU6A 3GIPA 1PB0A 4B3ZA 4C6NA 3LSCA 4KEZA 4RZBA 4KERA 3OODA 3MVTA 4HK6A 1A4LA 2Z4GA 1EJWC 3OVGA 3LA4A 1J6PA 2R1MA 3E0LA 4DNMA 2R1LA 2EG8A 3B0YA 4Z42C 4MUPA 1UIOA 4ICMA 3TN5A 3G77A 4CQDA 4ERGA 2A3LA 3A3WA 2HPMA 1WXZA 3S2JA 2FFIA 3O7UA 3A3XA 2Z25A 4C6PA 2E25A 4IG2A 4C60A 1YRRA 4V1XA 4DZIA 2BGNE 2WJDA 4PE8A 3MKVA 4CQCA 2PGRA 4C6IA 3AU2A 2PAJA 4LEFA 1NDWA 1ONXA 3OOQA 4EPBC 3V7PA 2YB4A 1FWBC 3TN4A 1RJRA 1V51A 2WJFA 2PUZA 1FWHC 2Z2BA 1A5LC 4UB9A 4LALA 1M65A 1POJA 1XGEA 2BB0A 3IACA 4XAZA 4IFRA 3GG7A 4C6MA 2ANUA 4LCSA 2QS8A 1PO9A 2D2JA 3URBA 3OQEA 4H9XA 1RJQA 2VUNA 4YIWA 3IPWA 3RYSA 5LXXA 4L6DA 1KRAC 1FWEC 2UZ9A 2HNHA 4C6CA 1O5RA 3MSRA 4CNSA 3QGAC 1ADDA 4AQLA 5HMEA 1QXLA 4H01A 1KRBC 4NI8A 2WM1A 3D6NA 1FKXA 2O4QA 4C6QA 4IFKB 1RK5A 2GSEA 4UBPC 4B90A 1GKRA 3GU2A 1EJUC 3MTWA 3EGJA 3OJGA 2VM8A 3WMLA 1XRFA 1POKA 4J5NA 4C6OA 2AQVA 1A5NC 1QW7A 2ZC1A 1YBQA 2FVMA 3NEHA 3RN6A 1EF2A 4XD6A 4CEXC 1VFLA 4G7EB 4DLFA 1K1DA 4PBEA 4CEUC 4F0RA 1RAKA 3K2GA 2Z7GA 2QPXA 4L9XA 3ITCA 2Z2AA 3MDWA 3A4JA 4TQTA 4B91A 2D2GA 3KM8A 2Z24A 1EJXC 4QSFA 1FWDC 4D8LA 2VC5A 1FWCC 4JOMA 1YNYA 2IMRA 3E0FA 4XAGA 4PCNA 4CQBA 4QROA 1E9YB 4C5ZA 2Q09A 4C6EA 2GZXA 2HQAA 4BKNA 1R9XA 1NFGA 3PBMA 1A4MA 3URNA 5FSEC 4XAFA 4I6KA 4DIAA 3E38A 4ZSTA 3TN3A 2PLMA 1XRTA 3HTWA 2OQLA 3LU2A 4LFYA 1J5SA 4C5YA 3F2CA 3CJPA 3BE7A 4LANA 4DLMA 3GTFA 3O0FA 4R7WA 1DPMA 3F4DA 1FWFC 3FDKA 3RHGA 4V1YA 1HZYA 2HBXA 2R1KA 1EJRC 1WXYA 4C6JA 2Z00A 2FTWA 1BF6A 3IJ6A 4G2DA 3TN6A 5G4HC 4HK5A 4AC7C 3EWCA 4WHBA 4IH3A 4RDVA 4GX8A 4CNUA 4F0SA 4H9YA 1J79A 4HK7A 2OODA 1W1IE 3GTHA 3E74A 4KIRA 3UF9A 5HMFA 4RDZA 4GZ7A 3LSBA 5A6TC 1K70A 4INFA 4RE0A 3RCMA 1NDVA 3NQBA 2PGFA 1PTAA 5E5CA 3S2MA 3PAOA 3E3HA 4PBFA 3DUGA 4XD3A 3WZ0E 4C6FA 4C6KA 4EPKA 4DO7A 3FEQA 3MJMA 4GY0A 1ITQA 3WYZA 4B92A 2WJEA 1M68A 3HM7A 3DCPA 1RA0A 4IG2B 3SO7A 3FDGA 4IQJA 2VHLA 2AQOA 3K4WA 4DYKA 2ICSA 3QY8A 1FWAC 1ZZMA 3ORWA 2EG7A 3PNUA 3GTXA 4HA0A 1YIXA 4ERAA 3E2VA
chains in the Genus database with same CATH superfamily
3RAOA 1DWIM 4QNEA 2DUZA 4JTGA 3S6OA 4E3VA 4FK9A 4J3WA 4PMQA 3OLDA 3TYAA 4AAJA 4F0LA 5C9UA 1PYMA 2VDHA 5KEZA 1TE1A 3AHZA 2Y7EA 3GSMA 1GTHA 3NL3A 1XS2A 1XLMA 5DY3A 3W7NA 3NL6A 4MB4A 4W88A 2Q01A 1GVYA 2WVSA 3N9SA 5C71A 1GHRA 4C6DA 3HZ3A 1QHZA 4PUMA 2OCZA 2R6OA 2YGYA 3R8HA 1RBOB 3RCYA 3W9ZA 3STGA 1F9CA 1FH8A 3T42A 4J2PA 4HU3A 4EX4A 4Q6XA 4IQEA 1JAKA 3UY7A 2CHRA 4QAIA 1CLXA 1JVNA 1MXGA 1RA5A 3P6LA 1ONRA 3T09A 3D47A 2KAUC 3CUJA 4L65A 5DX7A 2NQHA 2XH0A 2INZA 4EAYA 3ME3A 4Q4MA 2BXVA 1F3WA 3T0TA 3MO7A 4W87A 1P6BA 3CV2A 5DLCA 1T8XA 1ZB5A 3BOFA 3LLXA 2CBVA 1HNYA 2V81A 1S5NA 3K8LA 5KZEA 1WDDA 9RUBA 1V4YA 4A3RA 2AL2B 3NPWA 1TRIA 5CZTA 4HHLA 4DF1A 4YTQA 2YCLB 3ARVA 2QUVA 4GUFA 2DSWA 3N6JA 3BMWA 4RKAA 2Y7GA 2VZTA 3OVPA 2WCAA 5B7ZA 3GE7A 1DIDA 1NY1A 2E28A 4DXXA 1DJHA 3T8LA 4NZ5A 2DZUA 1G7UA 2OZ0A 7A3HA 3PUGA 2P0IA 4DEFA 4NJHA 1MW0A 4E2VA 3TMQA 2E0PA 1QBBA 3DG3A 3G3DA 3GDBA 3FAWA 4KGLA 3L0KA 3PBVA 4KEVA 3C86A 3NZRA 1J0HA 4MNLA 5T26A 2J27A 3AICA 3UNDA 4Q4KA 5E9AA 4MY8A 1G94A 5AECA 3IVUA 3DX5A 4N0RA 1XLGA 4QM1A 4F8XA 3S1XA 1Q8AA 2A3AA 2VCBA 3DU0A 3USZA 3N25A 1UP0A 2HE5A 3J7HA 1TQXA 1KXQA 3P60A 5D8ZA 3FKRA 4C6BA 4PSPA 3C3UA 2DJXA 1EL3A 4XZHA 4PTMA 2FIQA 3EDDA 4WXYA 7TIMA 1EP3A 1MRQA 1MZHA 1A5KC 5K9XA 4MGGA 4AB4A 1O68A 3V18A 3MI6A 3EAUA 1K9EA 1EO7A 5BXTA 1KFWA 2V68A 1RP8A 1QPKA 4MYXA 2W5FA 4QCFA 2C6QA 4GKLA 3NM3A 7ODCA 3TSBA 4HNUA 3NQ2A 4REQB 4JIIX 2VO5A 3ZMRA 3RJXA 1D3HA 3OP2A 4NX0A 3TC3A 4C6PA 3KX6A 1HF6A 3A21A 1A0EA 2PLCA 4NAEA 4C1LA 2DUAA 4F2TA 2FGLA 2PGRA 4US5A 3VFLA 5C9WA 1BTCA 3Q94A 4DAIA 1NARA 2OWWA 5HUOA 1XL9A 3L4VA 1MEHA 4K8HA 4IL2A 1F8IA 2V5CA 2GJXA 2ZX6A 1XLKA 3C2EA 3OZPA 1Z42A 3DGBA 5CG7A 2PWHA 2X30A 1QJWA 3DI1A 2DP3A 3CH9A 1PO9A 3ZT7A 1BRLA 5K3VA 3LCFA 2XWDA 2I5IA 3W22A 4ASTA 1R3VA 2X41A 5C2XA 4L6DA 4W5UA 3SDOA 1VCGA 5L9FA 4GQGA 4NAFB 1O5RA 2JKAA 3CO8A 4PUDA 2PTZA 1SW0A 1ZPTA 5HATA 1GYMA 1XG4A 4GC4A 2X1IA 2OJPA 3PBGA 1POKA 4KRUA 2DZVA 3TW6A 4HOWA 3SQSA 4B5UA 3TP4A 3AS2A 2FHFA 1PHWA 4D8ZA 3V16A 1S5MA 4JPGA 1US0A 1X1ZA 3G6LA 3F5JA 5EMMA 1UQYA 2HE8A 4NT0A 4B91A 1VGAA 3KS5A 1OYCA 4WJXA 1GPWA 1FDYA 3ARUA 1UUQA 1B9BA 4C5ZA 2FTPA 1BFNA 3LK6A 4HMEA 2F6UA 1U83A 3VM5A 2WLZA 4Y9PA 1V3IA 1UR2A 1ME8A 4MSSA 3GYCA 3W02A 3ZJ6A 2PGWA 3BG9A 3WCZA 2HBXA 3LV5A 5BYWA 5LKYA 3S5NA 3QV6A 1F4AA 1ICPA 4S3EA 3EWCA 2EF9A 1NAL1 3U48A 4NRSA 4GX8A 4I9TA 2CZ5A 1V0LA 3FNDA 4MNJA 1J79A 2VRKA 1M53A 2Y7FA 3DG6A 4J3SA 4Z2HA 1HKVA 3BVJA 4O52A 4KWUA 4O0QA 3TW9A 3G6MA 5TNVA 3C2FA 2W63A 1S5WA 4XD3A 4C6FA 3WNKA 2TAAA 1SZGA 2EQDA 1RHCA 2V3DA 5JH2A 2WJEA 1A0DA 2OG9A 4UFMA 5F2LA 1GCYA 2ZWYA 2NUYA 1JZ2A 3WQ6A 3N29A 3LRLA 3N3MA 3RXZA 2IQ0A 1DJWA 5AC7A 4WXZA 3GXFA 3FLUA 2YZ5A 3EDFA 3WLNA 4JICA 2RDWA 3TDFA 1YLVA 1IEVA 3NYDA 1R9ZA 2FGBA 3BGJA 4H1ZA 1K6AA 3OPSA 5DMYA 2XIMA 3S5OA 2WZTA 2WMHA 1FUYA 3TQPA 3F5LA 1JZ8A 2CFFA 3GUWA 3M1ZA 3CTTA 2PDHA 3B40A 2OYMA 4D6GA 2VFHA 2NLYA 1NU5A 3WBYA 3I4KA 3B97A 1AJ2A 2ZICA 3JZUA 1QNQA 4ZQOA 3E5PA 3GDMA 3NXFA 4LVDA 4JL1A 4O17A 1TCMA 2V69A 3R4IA 2QT3A 3UQNA 1YDNA 1QBAA 1PTDA 1LT8A 3EA3A 2V5JA 2VEGA 5A8GA 2FVLA 3LB0A 1M7JA 1T7LA 1W3KA 4IOTA 1EOKA 1JXJA 4HSOA 2EXOA 3H70A 4HNLA 1MNSA 8A3HA 1D2KA 4IIBA 1VRXA 4PMYA 3IRSA 1EOMA 5LZLA 3A22A 4OBSA 1SYTA 1HP5A 3OA5A 3E0VA 3L4UA 2VRQA 2OOFA 3URQA 4WVXA 3L2IA 2XVGA 5CLWA 1GOIA 2JFEX 1AW2A 5ECUA 1FKWA 1V7YA 5E9XA 2O92A 3CMFA 1OC5A 4LBSA 4B2DA 1TVLA 4P5UA 4AYGA 2O7QA 2DUXA 1I45A 1R38A 4OOUA 4GC3A 2XSBA 2TPSA 3R13A 3LHWA 1VD6A 3MUXA 4L56A 1AG1O 4JIEA 3EMCA 1FWSA 1AMKA 2OZ8A 1JF5A 1B2YA 4H9TA 1XLFA 4JHOA 4MB1A 4ZCWA 3H21A 4J3XA 3WJWA 1OX6A 1XCWA 5C9XA 3OA3A 3GNOA 4QGCA 3ZIZA 4FHAA 3PZMA 4AWUA 2GGEA 4G9PA 2DIKA 4HZ7A 4Q7BA 3SN4A 2QJMA 2DFAA 1GQJA 1RBLA 4WY0A 4D6HA 4AG0A 4AU0A 2OFJA 3AS3A 4NIRA 3CASA 1Z6KA 3C8NA 3VDCA 1EC7A 1ME7A 4O13A 4UQCA 1LOSA 4L1GA 4CCZA 4IJCA 4W5ZA 1E9ZB 2D20A 3LI0A 1VR6A 4BEQA 5AHLA 3ABOA 1JRCA 5KMYA 3S46A 1CT5A 1N8IA 3MVTA 1KFJA 3B06A 4Y9MA 1WDQA 3W25A 3PUOA 3GG1A 4JTFA 4UCFA 3EXSA 2VWSA 2WSQA 3MCNA 1IEWA 3M0IA 3FJNA 3AZSA 4ICMA 4DUXA 3M47A 5CZSA 2VENA 1TPVA 3WQEA 1Q6GA 3S2JA 3SQMA 3GH7A 3EX2A 4GIEA 3QQ0A 5M2FX 2OLAA 1ENUA 4HIBA 1JD7A 1MW3A 2XH2A 3EBVA 3GM8A 2PFHA 4XKMA 3R0UA 2XVNA 1XLLA 4DJFC 1LLWA 1DTUA 2G37A 2X8RA 2YDRA 3HGRA 4E2DA 2CNCA 4ZOEA 3WK3A 4H8HA 1A49A 4DWSB 3GHSA 2FKPA 1PDZA 2ANUA 3VKAA 1B57A 1GOWA 2ZRZA 2CITA 3UFYA 2VUNA 1W8GA 4H6QA 1H7WA 3IPWA 3AIBA 3PZ9A 3SJ3A 3KP0A 5GVJA 2F84A 1BWKA 2XIJA 3THAA 1YDOA 1KM3A 4HHPA 3EYPA 5C8BB 3W86A 2B81A 3ATYA 3LG3A 1WA3A 1FKXA 1AJ0A 4QBXA 3OIXA 4AMCA 2GSEA 1RQEA 3OEXA 4LV9A 1PDYA 4LUTA 3EGJA 4YTRA 2W62A 2B7NA 3LBMA 2ABBA 5GNZA 1AD4A 3NEHA 3QR0A 4AYSA 2O55A 3IGUA 1EYEA 1JYXA 5BWAA 1MUWA 1XKYA 1SU5A 3D46A 1CLVA 1FH9A 3WSUA 3VTRA 4P8WA 4H19A 4LW7A 1JPMA 3KZSA 2QDHA 4L4LA 2PBGA 5D09A 2VUYA 3VAVA 2G95A 3OBKA 3E0FA 3MW7A 3S8HA 4XIAA 2GZXA 3GBDA 1OGBA 1SZEA 4BKNA 1C7SA 3W83A 3UWWA 3BANA 4XG1A 1SR0A 3FEMA 3FW6A 5D32A 1XM3A 1U33A 4LFYA 5MF5A 4HA3A 1XC4A 1YXDA 4R7WA 3FDKA 4U2YA 4ZO8A 4O8AA 1I60A 1UR1A 5I03A 5DANA 4JTQA 4HYVA 3NL2A 3E96A 5FEZA 3W70A 1VEMA 1W1PA 4A3YA 2VI0A 1HGYA 3HQ1A 1Y0EA 4TTUA 4GCXA 2FFCA 5DRCA 3ZWSA 3K4DA 3HA1A 4MJ2A 4UZSA 2EAWA 1H7OA 2O0TA 9XIMA 2QJNA 4HCLA 2PGFA 5E5CA 3PAOA 1S38A 3VD5A 3PR2A 1QK2A 3DFPA 4MLRA 2ZUVA 1HKIA 4BA0A 1VPYA 3CHDA 3HF3A 4LU0A 3DCPA 1RA0A 3LI1A 4KGJA 2NX1A 4LNCA 4FX7A 1JGIA 4G56A 1KBLA 4CD6A 2YDSA 1E4LA 3RRXA 5J04A 3H2MA 3ZVHA 3WJYA 5A6AA 5DT5A 5AYBA 3P5ZA 1LJYA 1EGVA 4XISA 1D8WA 3CV6A 1OGSA 2V2HA 4XD4A 1UQZA 3EOOA 2Z28A 1VQTA 3UR8A 4RDWA 4BS0A 2KZHA 4LBUA 5CPMA 5GPRA 2E1WA 3H7VA 4M81A 4GIRA 3AHTA 3MP3A 1MQPA 1WCGA 4N02A 4CD4A 4WDUA 4GY7A 3I7QA 1O12A 3CL7A 3D3AA 5CPNA 2GJPA 3WJXA 3IRDA 1US3A 2WOQA 3UYIA 4K2SA 1XXXA 4WX2A 1I2RA 3AI0A 4JDYA 3CPRA 3HPZA 1YPFA 3DKJA 3EX6A 4Q3MA 5CJ5A 2JIWA 5FL0A 3CZ8A 4D8AA 2G41A 5EB8A 1ZJBA 1LBMA 1K02A 3IIZA 4QE1A 4ERIA 4S38A 2PDPA 4XZBA 5H8PA 3WENA 1I0DA 1QNPA 3THUA 3BO9A 3S1UA 1VS1A 4M51A 5F2IA 2X1UA 4OTKA 1H7NA 2VC6A 3HO8A 2Z1WA 4DZ5A 4IGMA 4HMNA 3WLIA 2ZRWA 4RNFA 2FGZA 1OHLA 1UH3A 1DKWA 5HR6A 3P74A 3L4WA 4GYJA 3MP5A 4LCQA 1DIEA 1UJPA 3SCNA 4N7QA 4LEQA 1KCLA 4HTYA 4MMWA 3ZJKA 1A53A 4FB7A 3V4BA 4HHHA 1JUBA 2D2OA 5I00A 4Y90A 1AQ0A 1QHPA 1CCWB 3KWXA 3O0KA 3QZEA 3NZGA 4EPEC 2V38A 3P82A 2YKKA 3W71A 4UTMA 1QWGA 1TRDA 2BY0A 1KFKA 1JCMP 5T91A 2R1PA 3R1ZA 1JNEA 4UFJA 1Q2RA 4UOZA 1JF6A 3R5EA 3PBYA 2YA0A 4PCSA 3GR7A 3VIIA 5I7GA 4LV4A 5FI8A 3W7MA 3ABRA 3FK4A 1XYCA 2V9DA 3TTYA 1EEPA 5HANA 3CT2A 2J8FA 2D0FA 1OX4A 3GS6A 5FKYA 2V6AA 3GIPA 1PCWA 1R2TA 3WDRA 3VCRA 2J6XA 4KEZA 2NW0A 5HNTA 3W53A 3KVLA 4ZQPA 4XO7A 4N6FA 4LS0A 3JUGA 3BW2A 4CN4A 4E8CA 5I3DA 3L5MA 3QYSA 1LOLA 4A6GA 1JCNA 3MCOA 1UR0A 3A3WA 4DBUA 1K9DA 4Z2IA 3LHVA 1GW1A 4AISA 1J0JA 4ZXOA 4FMVA 4PUJA 4C1KA 3BW3A 4CQCA 4L4MA 4J7RA 2WQDA 3W7CA 1XX1A 3DDMA 2Y89A 3WLLA 1B3XA 1ZCOA 2OT1A 5IHSA 2GUYA 2WK2A 2Y6ZA 1A5LC 3T08A 3LTPA 4JTJA 4B9YA 3DHDA 2QEZA 2D0HA 4PB3A 3QJAA 3TXZA 1A50A 1RQHA 1GTEA 3GW3A 4MPKA 2PD5A 3UXDA 1C90A 4IX0A 1H60A 2ZCGA 1ESWA 1UB3A 3EB2A 3W26A 2DH3A 4WSJA 1ADDA 4QEEA 3EKLA 1GVQA 3AWOA 3CBWA 2XPKA 1K4GA 1EIXA 1YYAA 4Y2WA 1R7OA 3EZ4A 3B05A 2VD9A 5AN7A 1W5QA 2H9AA 1UH4A 4UBPC 2DIEA 3H2CA 3HU7A 3LPGA 1VFFA 5LIYX 3UT0A 3WF4A 1UR3M 2QQ6A 1A5NC 3HB9A 3VIOA 4KCWA 2FVMA 4GNVA 2WHMA 1Z89A 4YWIA 1XRSA 1KR0A 4GQ0A 1NOFA 3CWHA 4AIOA 2B7PA 3K1DA 3PG9A 2QZRA 2Z7GA 4IIFA 1XPGA 4L9XA 2XN1A 4NNCA 1YKWA 1TIMA 4IM4A 3CUZA 1HKMA 2FPYA 1TPB1 3N2BA 2PDXA 4KH2A 3KUMA 1YEYA 3QZ6A 3G1AA 3NYZA 4H83A 2WZEA 1R9XA 5KZDA 2X05A 2CZEA 4AZCA 2XWEA 4DIAA 1QPNA 3UXIA 4GKTA 5FF0A 4L5ZA 1Q85A 4EXQA 2CZDA 1TWWA 4MM1A 1OBAA 3QSTA 1PZ3A 4U3CA 4CU7A 4R3UA 4YVXA 1LG2A 1P0NA 2Y4SA 1LT7A 3IIVA 3CWNA 3KBMA 4GQBA 3TN6A 8XIAA 1K8XA 1EPXA 4HPNA 5HNUA 2YOCA 2PTWA 2ISVA 5BXPA 4J1OA 1PV8A 1X96A 1A5UA 1TPEA 2R24A 4ONVA 2I14A 3IIPA 4UNKA 2HCVA 5AY7A 1BGGA 2VVSA 3C3NA 1UWAA 3E3HA 3RX4A 1QOQA 4IZGA 3W1NA 1E5NA 4DAFA 2C79A 2ZTKA 3P8IA 3BCDA 4DJFA 1OF8A 1L6FA 2YL6A 3G1DA 2WXDM 1M68A 4WDWA 2ISDA 3NIYA 3WD1A 2AQWA 4NY2A 1E0TA 2INEA 1FOBA 2WBGA 1ZZMA 4GVGA 5T9CE 3GNDA 5CBBA 1UD4A 5E6YA 3WLKX 3NVDA 4I9AA 4Q8UA 6ENLA 4M80A 4KQNA 5CC5A 3BJTA 2P53A 1QR7A 3UPMA 4ML4A 5HMDA 2QMKA 2Z1KA 2E9LA 4OIFA 1JNDA 3WLMA 3BAIA 5BOFA 2CLOA 3NURA 4XZIA 1SSGA 4HHMA 3L9CA 3B9OA 1L6YA 1PSCA 1W1A1 3EA2A 2CCRA 3UEQA 3H54A 2WHKA 5FJPA 1YQ2A 2E68A 1EJVC 4TVCA 3IV8A 3BLEA 3LXAA 1W1TA 4NP7A 4NASA 4W8AA 3SAZA 1OFOA 1TJ0A 3NQMA 4E4FA 3P67A 3VD7A 3WH8A 1W91A 3S1GA 3TU9A 4BF7A 5C9ZA 3N4FA 3WD4A 1K7EA 1KBJA 3ZSTA 4TX8A 1EYWA 3ES8A 1PIFA 3U8GA 2Y2WA 4G1KA 3UGVA 3KVKA 4OFCA 4X63A 4E3TA 9XIAA 1FY6A 1C8XA 4TR9A 4QRNA 1KM0A 3ARTA 2VVNA 3MBDA 1OFEA 2CBUA 1AVAA 3QQ1A 2JGQA 5CZKA 4UMAA 1DTNA 2E9MA 4GE8A 2OGYA 5A95A 1H2JA 3LPOA 4JY8A 4LWWA 1XIIA 4ZTXA 3II1A 3M46A 3GHTA 4GUIA 2HBVA 4RPPA 2Y88A 2VGIA 1XHGA 4FXFA 1OFAA 2G5WA 2XZ9A 3KCLA 1X97A 1FFQA 5JH1A 3GXDA 7PTDA 3V1PA 3S4TA 4AIBA 1I4NA 2E67A 3W2JA 5CAHA 5B80A 4IL0A 3RX2A 2DVTA 1ZSXA 4CNPA 1OK6A 1UWRA 3U57A 3CH0A 1Y5XA 2XN2A 1U5JA 3VIJA 2VKZG 1EFZA 3KRBA 1K4HA 1W31A 1TUXA 5AYIA 5A2BA 4GYKA 4ZZ9A 2G3JA 2P5NA 5C7VA 2R1NA 3SUTA 4JFTA 1KM4A 3BPWA 3A23A 3SN1A 2VMFA 2PDWA 3GDLA 3GIQA 2W67A 1IR2A 1SO6A 3BLFA 1BGAA 2C3ZA 3PSVA 2DZPA 2PC8A 2OZTA 4CN1A 2H90A 4GD0A 1QI5A 3AAMA 3CQKA 1M1BA 3ZR5A 2GK1A 3GNNA 5IDZA 2XIQA 2QCDA 2VGGA 1SZNA 2OYKA 3REQA 2IQDA 4CCDA 2CYGA 4MUPA 1HXJA 4F3HA 2WNZA 3WLJA 4ERGA 5E1QA 3L67A 4W84A 2ZUWA 2GYIA 4JTDA 2FFIA 4XIMA 4LNYA 1KO0A 1VFSA 3A12A 3W0KA 4TV6A 2E25A 3OYZA 4ECLA 5CGTA 3HQNA 1LZOA 3BAJA 4LEFA 3A9IA 1ODZA 4ZOCA 2OLHA 3IAPA 3Q65A 4Q7IA 1FWBC 1HO4A 3CC1A 2ZC8A 3DFNA 2NX9A 5AVHA 5RUBA 1L2UA 1OY0A 1W2VA 1IT7A 1LQAA 2PUZA 2Z2BA 4UWMA 1X6UA 4F0KA 1W9PA 2XH4A 1RLCL 1TKKA 3MUY1 1OCNA 1PL9A 3NUKA 2I57A 3WK1A 4DN1A 4YYFA 3L23A 3NG3A 4HZ8A 5LSMA 2PCEA 1CXFA 3GNXA 4B5TA 4XQ6A 5K2ZA 2QHAA 4IPJA 2QR6A 3QGAC 2VRJA 3WBWA 2DV0A 5DRIA 3MSDA 3KLLA 3N18A 1XLJA 1XDMA 1RK5A 2Y70A 3UZXA 5JIPA 3ITGA 1Q13A 3AJ7A 5I78A 3WEOA 3LBOA 4W85A 5D4YA 1P0BA 4J3VA 1WAUA 1XCFA 3HPFA 1SJCA 4CEUC 4NVTA 1V8EA 1GOKA 2J74A 5K4ZA 4AY8A 3ITCA 3YPIA 3CK5A 5XIMA 1KR1A 3UA4A 4IISA 1WDRA 4QSFA 4D8LA 4NZ3A 4DWSC 4I9MA 1H7XA 1TMLA 1AW1A 1E6PA 1TVNA 2IS7A 1VBHA 1I1WA 1XIBA 3U0HA 4L4OA 1Q63A 3W1UA 5FL1A 2AL2A 4FA3A 1XW8A 5PTDA 2YCLA 3TR2A 3ITTA 4HT3A 1IQ8A 3H2NA 4HVXA 6TAAA 4HBKA 4V1YA 4XZWA 1KD0A 1W9BM 2RDTA 3VOFA 4PMDA 3S9YA 2NSOA 2NXIA 3GH5A 4JIPA 4IH3A 3SFKA 8XIMA 5CGMA 4P7QA 1ZJHA 4IXHA 4XTIA 5D2XA 4L9YA 4GZ7A 4M3PA 4P8VA 4WLCA 5IOBA 2RKXA 1PTAA 3Q67A 1NFPA 1I75A 4ACZB 1VENA 3UZJA 4PCFA 4H6RA 4MNMA 3WYZA 2VTFA 1P0KA 4LRSA 3GXMA 3T40A 3VGFA 4OZOA 5HPCA 5EBAA 4Z2LA 3PNUA 4NZ4A 3WEZA 2D1ZA 3A4WA 1UWSA 3EWZA 3GXPA 4S3CA 2GWNA 4AXNA 1LWJA 1TJ1A 3N14A 3M43A 5I3HA 2EJ1A 3UW6A 3EPMA 3STPA 3GFYA 1WZLA 4MWAD 3T2PA 6XIMA 1BQCA 4REQA 1Q7ZA 3O3RA 3R8GA 1JYNA 2FB3A 3UCDA 5HXMA 3C6CA 1CW2A 1FHUA 1SPQA 2BV9A 2DT3A 2P8CA 4X3ZA 4QJ5B 1TO3A 3GZ3A 2YPIA 1PKNA 3A6OA 4X0NA 4A35A 2CWXA 4CD7A 3B8DA 3AYVA 4WJ8A 3B4YA 1LBFA 4CN6A 4CNOA 4DNHA 3UETA 2C0HA 2OVLA 4D6IA 3MDUA 1ODUA 4O53A 4AZ5A 3QRHA 3WD0A 5BWFA 1PYFA 2AKZA 2G8ZA 3SJNA 3P3BA 1WUEA 2OO0A 2WQPA 2XVKA 5DBTA 5GNYA 4FF7A 3SZ8A 3VNDA 4C65A 1KXHA 2BMBA 3PN8A 5BROA 1HW6A 2X1RA 3V1HA 1KXTA 3PTMA 1H09A 5KZMA 2DSKA 2C0AA 2JEQA 4QXIA 4NAFA 1CENA 4F79A 5CSYA 2OEMA 1PKLA 5CJMA 4IFOA 5FAJA 3AQUA 4EP8C 1MW2A 3GVVA 4CD8A 1B1YA 1CECA 1EZWA 5E09A 1E70M 4DVOA 3NGJA 2I5GA 2DSZA 4J2MA 5FACA 3MZNA 2A7PA 1G67A 1QTWA 3ELFA 3QC0A 3BDKA 1R3QA 1YE4A 3DAQA 3BCFA 2PDNA 1YDVA 4K36A 5BNKA 1TPUA 3BH4A 4H9MA 4UQ9A 1X38A 3G18A 3M5XA 6ALDA 3MVIA 1SM9A 4NQ1A 1IWBA 2EKGA 3FV9A 2VNCA 5CPSA 2BXZA 2DZBA 4HPXA 2VL4A 1UA7A 4M8UA 1JDCA 2BHZA 1EJSC 3AMCA 3HURA 3BLLA 4LSBA 4RNIA 3L12A 2PF0A 3G2GA 4GUHA 1ISVA 4NUWA 3GQYA 3DESA 3QV8A 1KQYA 5AKQA 2HSAA 1V3LA 1J0KA 3N2MA 3M41A 1JPHA 4JNYA 1VHNA 4BJHA 4XK2A 2AMXA 3S2NA 4V15A 3A5VA 4B3ZA 1MQQA 3PZVA 2CBJA 2P10A 4MKVA 1JZ5A 2ZA1A 5LGZA 3W87A 1XR2A 1TWZA 1G1YA 1YNQA 4RZ6A 2H6RA 1TWSA 1PCKA 4D72A 1XDLA 4AX7A 1UUMA 4K7VA 4Q6JA 2R8WA 1TE6A 3P7YA 3IK2A 3K46A 1GVEA 3AUJA 1HUVA 3CUHA 3TJIA 4ORIA 2D73A 3G1RA 4FAMA 2D0GA 2QDDA 3F4VA 4A8NA 2ZXDA 1CLKA 2VZVA 1CB7B 3VMNA 1IGWA 1F61A 2I9EA 1JQXA 3VGBA 1CDGA 3TN4A 2V3EA 4XZMX 1SW3A 4GISA 4DX3A 1GZ1A 4ML9A 3UPWA 4I8DA 1L6WA 3QPEA 1ZRQA 1POJA 3THDA 2JF6A 3HV8A 4JKKA 3H2FA 1TIWA 2NXGA 4JZ5A 3NSXA 3N34A 1JR1A 1LCOA 5HBFA 1C29A 3C0JA 1O1HA 4M1BA 2YXXA 4PEEA 1TWIA 1Q4NX 3WLQA 1Z44A 3VE9A 4GCAA 1ZP3A 4AQLA 3VUPA 3TC6A 3VNKA 5DXYA 3GVGA 4Q8WA 4KWWA 3NR0A 1XQKA 3POCA 3TTOA 2Z6IA 4PODA 3AXIA 4W8LA 3KOWA 1R3RA 2J24A 2W27A 5LHFA 4NHVA 3MTWA 4WZHA 2CETA 3WQ8A 3ARPA 3LZ5A 4YVVA 3IS4A 1UD3A 2ZC1A 1JCTA 3UWUA 1XRVA 2E1DA 4DLFA 1XQLA 5I3JA 4PBEA 1RAKA 1RCQA 4GWEA 3AHXA 3MKCA 1R46A 2HMCA 3M9YA 4JTLA 3KZPA 2CLIA 4LUSB 3KM8A 5I5RA 1EDQA 2J25A 3TFXA 3BOXA 2H8ZA 4PCNA 1EBGA 3PPHA 4GJ1A 3SCOA 3NJ3A 1ZNNA 3PBMA 4JQ2A 4UC5A 3O16A 2EPLX 3NCOA 1X6LA 3LN3A 3ANVA 2BS9A 3MT1A 3H2AA 2RUSA 1CYGA 2QUNA 2XVPA 2GVLA 2X09A 4IT1A 3R7MA 2GDVA 3UVAA 1GVIA 5FESA 3PY2A 5G4HC 3VIKA 3AIUA 4RDVA 1QCWA 1AH4A 1BHGA 3WBXA 1CIUA 1XSIA 4ZQMA 1JCJA 4RDZA 3LOTA 2W92A 1EWEA 3VKKA 3VIHA 3AOFA 3PZUA 3L4ZA 3S2MA 3SY8A 2GFTA 2DT2A 3T4WA 3BWWA 2C1GA 3IVTA 5MKGB 1Q6RA 3VKCA 1MFUA 4FLRA 4XZLX 4Z1YA 1DE6A 4JHMA 3SCWA 4LPCA 2WANA 1R0MA 4QG8A 1PZ1A 4NSBA 2ICSA 3QY8A 4O57A 5A6JA 3ABQA 1KCZA 4A3UA 3UESA 3AYSA 3SR7A 1G0CA 3IV3A 1EC9A 2Y5JA 4P61A 2WVUA 1UASA 2BBFA 4QG9A 4XV0A 3TR9A 3FJLA 1HL8A 4XZNX 3PTQA 3QV9A 1WZMA 1ZAHA 2PRMA 1C9DA 1Q6QA 3TC7A 3EWUA 2VZOA 2RHGA 1R9YA 1SW7A 4H6KA 4UIOA 5G5IA 1J12A 3OZMA 2W4XA 1SUXA 5A6BD 2C13A 2VC7A 4WKFA 3USBA 4RW5A 1H49A 3STEA 3MYPA 3HG4A 5DN1A 4FI4A 4RX0A 1IZJA 5IXEA 1SFTA 3EB4A 1GYNA 2HRWA 3CUIA 3UP8A 2YL5A 6TIMA 4OBRA 3XIMA 2EG6A 3NA8A 3TV8A 3THCA 3VI2A 4DWSA 1EDGA 2O4MA 4O1CA 4V28A 1ZS2A 1NIUA 1UBPC 2V5LA 3DYMA 1TMQA 3VU2A 3QKEA 2OR2A 4HP5A 4JS3A 2TSYA 3L66A 4QHRA 2EGZA 4RLIA 4AZHA 1L8PA 4UR8A 3T81A 5AC6A 2QUUA 3EX1A 3ZLFA 5EU9A 1J0IA 1A47A 3Q2DA 2XIOA 3W1TA 1J0ZA 2V63A 5EMUA 3T78A 4IMEA 2GVEA 3CAKA 2ZRVA 4J3TA 3OG3A 2ODOA 2OEJA 1FDJA 3BOLA 1L8NA 1IXPA 4A29A 5JMUA 3VMOA 2Y0FA 3STCA 4ZE5A 2BTMA 3P93A 4IUOA 4Q32A 4PH6A 4PSRA 1V3JA 2GDQA 4F9DA 4IIEA 4XWUA 2E7FA 3TNBA 1ECEA 2NUXA 1HVXA 3LM7A 4EE9A 2W9MA 2VQTA 1KWGA 1XFCA 3HGJA 1U1HA 3W75A 2J77A 1BPLB 1HX0A 4IPIA 4ICCX 3UG8A 1ZLPA 2FJUB 1VJZA 4JTUA 1ONWA 5D2TA 4JN6A 2OGJA 4W7WA 4L61A 3WQCA 4YTSA 3PHAA 3RG6A 1DBTA 2UY2A 3S6TA 4DI8A 3N12A 4AFYA 1TYGA 4MKNA 2JKEA 2GLKA 1K8YA 3LGGA 3TKFA 3VINA 3WMBA 4CKQA 1MWOA 1XLEA 1QI0A 3GB6A 4UQEA 3G3MA 3DHFA 3BG5A 4AX6A 3NGFA 5C70A 5C6MA 1PB0A 5M17A 3LGEA 4JCMA 4KERA 3A3HA 4GGHA 4R7JA 3OZOA 1KV8A 3WJZA 3E0LA 4D9PA 1EX5A 1OJXA 1Z69A 3G1SA 1AQHA 3CWOX 2FHBA 4FNQA 1K3UA 1H7RA 2RH9A 4WQ6A 3RLVA 1VFMA 3A3XA 4GG9A 2XM2A 4DZIA 2RDUA 3B8UA 2DZWA 4WOQA 3VGHA 1NDWA 1D3GA 1A80A 3B8WA 3UGRA 4EPBC 5CBIA 3F7JA 3W23A 2Z6JA 4HN8A 1QI3A 4Y7EA 4ZTYA 1U22A 1FWHC 3AZTA 3V5FA 5EFDA 4S3KA 5FJTA 2PF8A 3WQVA 4EXAA 1W5MA 3TH6A 4S3FA 3AC0A 3FYYA 3LXBA 4FZIA 4WKAA 2D2JA 1BYAA 4AEOA 5A3HA 1OABA 1VEPA 4Q8TA 5G4EA 3TYDA 5AZ0A 3FJ6A 1IT8A 3S6DA 3EWBX 3QOKA 4EANA 3UJSA 4CNSA 4JTEA 3TVAA 3AMKA 3N17A 3VD3A 2G3MA 1EGMA 2V67A 4Q8PA 4RZ4A 4W8BA 1CXHA 3CHEA 1VIWA 2OX4A 2YCIX 4GRSA 1EJUC 2ZZ6A 1IWPA 3PUDA 4ZB2A 3BG3A 1HKJA 3U3HA 3IIXA 3ZOAA 3W27A 2YCKX 3W1PA 4Z1DA 3BV7A 4K1GA 4AUBA 2GJRA 4LBRA 5IBXC 1F7BA 2O9TA 1N8FA 1MO0A 1K7XA 2HS6A 2XZ7A 2PE4A 4Q8QA 2ZBTA 4WKHA 2PTDA 3IUDA 3VIPA 3SRKA 3EOEA 8TIMA 1OG0A 1VFOA 2PDIA 1A4MA 3R79A 1RXOB 1RD6A 4GH3A 4Z0JA 4JIHA 4Q8MA 3HTWA 2D3LA 1J5SA 3CJPA 4V27A 2BVWA 4JTAA 5L6UA 2AMGA 3M64A 4C6JA 4PL1A 1BF6A 5GQBA 4GFIA 2WW5A 4LXFA 1N2VA 3EOSA 1UUOA 4WF7A 3GX9A 1W3TA 1X1NA 2W66A 1ZAJA 1J2WA 3I10A 1KBBA 3W1LA 4RE3A 4NZFA 1R30A 3E0IA 3UCCA 4D6DA 4TMBA 4MZ1A 2B7QA 3N6QA 4DO7A 3WG6A 2ZUTA 4QCEA 4UQDA 1O1ZA 1IEIA 1WDWA 1N7KA 4O1DA 4V33A 5DMLA 2ZYFA 5IFPA 1J2BA 2QCGA 2WWDA 3WQFA 3BLIA 3QY6A 3R0DA 1F6KA 4CD5A 4Q4QA 1UWQA 4H6EA 4WDTA 5FF2A 2CLMA 4K37A 3IEBA 5A6KA 2ACSA 1BEUA 1UMLA 3KBJA 5FAGA 4K3ZA 3T9PA 2F8QA 3PTKA 2MUCA 3TJXA 1TREA 3A5FA 3VDHA 2QGYA 4YLWA 5CH9A 2PPGA 1V6TA 1XISA 2GSJA 2NLIA 1LLOA 1LORA 5HK4A 2PODA 3UXAA 4RW3A 1WAWA 3SFWA 2OELA 2CWNA 3WH5A 2YBUA 1BQGA 4IGNA 4H9ZA 1R3YA 4YJ5A 5E93A 1E71M 3IJQA 2V30A 1NTHA 5KETA 4ZQNA 2OQYA 1F4HA 3KBVA 3IIOA 1W3JA 1J5TA 2P0OA 4JQAA 4I6VA 4W7VA 2PWFA 1F05A 1KFBA 1W56A 1W5NA 1JFHA 3IGHX 5E0FA 2PI6A 2V2DA 2OSWA 1FWRA 5BXRA 2WSYA 4P7RA 1QFEA 2L5HA 3CAQA 1E6NA 4IJRA 3O2LA 2W79A 4Z0SA 2YZRA 2UBPC 4QDPA 5E0CA 3M0LA 4JX4A 1Q3NA 4KKXA 5F1UA 1HTIA 3MPGA 2O56A 3F1QA 3WNOA 3GXIA 1R2SA 2QYGA 3LPFA 1G5AA 3I3EA 3TZNA 3CM4A 3UJFA 3GTIA 3HPAA 4JEJA 5BRQA 5DO8A 4GY1A 5AVNA 2V5KA 1Y5WA 5FCZA 1QU4A 3EXRA 5H1WA 3RFAA 3AIRA 1YMYA 3AXKA 4IMFA 3GU9A 3CV1A 2E8ZA 4IIGA 4JTKA 1DJZA 2BASA 4IICA 1NDYA 1UOZA 4FLOA 4M6QA 5M03A 5CBJA 4HA4A 4JTSA 2XYLA 3ZYZA 4WSKA 2DVXA 4FIQA 2VOMA 2D2HA 3TQVA 5I23A 2PU1A 3KBNA 2Y8UA 1ZL1A 1SO5A 4UMBA 1JI2A 3GFXA 3NVTA 4ZB0A 1AODA 4M56A 4F0HA 2AOSA 1IXOA 3AIWA 4TUFA 4C6NA 4C7FA 6A3HA 4ATDA 1VLWA 4RZBA 5D2YA 3CZGA 3K1GA 4XBSA 4HK6A 1A4LA 4KRTA 2Z0IA 3OVGA 4Z17A 3SN0A 3AYTA 5LIUX 2ZX9A 3FXYA 4DF0A 3S47A 3SCUA 4DUVA 3CQHA 4OOZA 1YPXA 4IXXA 3ZJ7A 3H26A 1HIZA 3GC2A 2AAAA 3TQKA 1YADA 2IUZA 1YRRA 1OCQA 3R10A 2A7RA 3K30A 3I7SA 2BXYA 3BMVA 4NJJA 2WMGA 2R9RA 1C8VA 3VABA 4IPPA 4LAZA 4L6HA 2HISA 5DCBA 3MBFA 1N8WA 2ZADA 4HQVA 3RDKA 2DPEA 3H4XA 4UB9A 4AD4A 1DWJM 3EA1A 1BAGA 1S2UA 2POTA 4LCSA 4JIQA 1VB9A 3RK8A 2CLKA 3NWRA 1JIBA 1CI1A 2HVMA 4MAZA 4LVAA 2QNEA 2QJIA 5JVLA 1UW9A 1RQBA 3WQ4A 2VXNA 5DXXA 5J5DA 3TE9A 4EOUA 1V0MA 3BLDA 3E12A 4A22A 3W85A 5I3FA 1EHAA 1RR2A 1PIGA 3RM4A 2WM1A 4LUIA 2FZMA 4FX6M 2J62A 2FB2A 3WMSA 4UR7A 3DYOA 1WKEA 2Y62A 1T6MA 3UJRA 5GNXA 3ANUA 4N4PA 4U5KA 4I8YA 3GG0A 1DQUA 1W0MA 3QHMA 4MY1A 4IP7A 2WMIB 4PUUA 1E1CB 4G6CA 2BOGX 1EF2A 3FAXA 4MOZA 4US5D 1KW1A 3TK7A 1H1YA 4Z2GA 5BOEA 4UTKA 3IUIA 4PUWA 1OCBA 5LNRA 2UY5A 4AD1A 3VE7A 1O5KA 4F4RA 5DY2A 1X1OA 2OOGA 3UCQA 3MYOA 5FEXA 1MEWA 1OYAA 4Z08A 4C6EA 4EXBA 4K8GA 1UWTA 1RCXB 3SECA 1TZ7A 4D6EA 2HV5A 4ATLA 4C91A 4KW2A 3M16A 2ZZ7A 2YFOA 4X61A 3KOXA 1WYIA 3LU2A 3R58A 4ZGYA 3NNTA 4DYEA 1NF0A 1EHNA 4LANA 2XN0A 4LY8A 4PULA 4R7OA 4PBGA 5FF7A 1WXYA 1OVDA 3R0KA 4JDBA 3LTYA 1B90A 2VDGA 1X39A 1GOXA 5HOSA 2P8BA 3CYVA 3ZWTA 5HMFA 3C2VA 5HWNA 2X2YA 2A3HA 3WH7A 1JCLA 5JXQA 4P7NA 4HB7A 4OWGA 3TZFA 3S5YA 2PWUA 4K38A 4QDMA 1JEZA 3A13A 3U2OA 3DUGA 3N11A 1RSCA 4BCEA 1FRBA 3TIMA 4E4PA 4PB4A 2FZBA 2OU4A 2YSWA 2ZFAA 4CVWA 4LS1A 4WEVX 4O1AA 1IXNA 4JCLA 4TV5A 1DWGM 4HA1A 1XYFA 3KTXA 4JQ4A 3W7KA 1NOUA 3W2UA 2BY2A 1DJNA 1G9HA 4E2BA 3DBNA 2XSXA 2Y85A 1DXEA 4H04A 2AKMA 2EKCA 1B0IA 1UP2A 4B4FA 3ISIX 4H41A 1W1VA 1DOSA 4TOQA 3NL5A 2Y5SA 4U31A 1UKOA 4EF8A 4K6AA 3MZ2A 4RCXA 3VGDA 2CESA 4WCJA 4JX5A 1WKDA 1EJ7L 1KGXA 2P3ZA 1TR9A 4PCPA 3TCSA 2AAMA 1I0BA 2CLEA 4JNMA 1JFXA 1BKSA 5IBXA 2Z27A 4LC8A 3S2LA 4Y8FA 4YS1A 3JS3A 2QXWA 4K1WA 1TR1A 5BMWA 3UG3A 3UG5A 3AZRA 4S1FA 4I5XA 3W29A 4JAWA 1XYLA 5EL1A 1DIOA 1TA3B 3LBCA 3PP7A 3T1GA 2J7GA 4UTWC 4BQ4A 3IJ7A 1Q6FA 2WYSA 3DFOA 1QVBA 2J7DA 3CQ0A 4IGSA 3DN5A 1EA0A 3P14A 1H63A 2QPUA 3MCMA 3NQGA 4I7VA 3O05A 1F8MA 2CLLA 4J3ZA 2OB3A 1AH3A 3V5CA 1XWYA 5BMXA 1VEOA 3DIPA 3U9IA 5FD0A 2HPIA 3ICJA 2H3BA 4IX2A 1S3TC 1XIFA 4BK9A 2CZVA 3VGGA 3WLOA 2XG9A 4OGZA 1WZKA 3OLEA 3CPUA 4Y9NA 4J9JA 1R2RA 1V03A 3S42A 1A5AA 1C7TA 1O7AA 1OG6A 4N9EA 3S1VA 3ID7A 5A6LA 2QPSA 2Y7DA 3PFMA 4JX6A 1RK6A 2WSKA 5F1VA 5HNNA 5C7HA 3W7GA 1E4IA 3L68A 5H91A 4LAUA 2HK1A 2VT0A 3MUZ1 1Q7MA 4F2UA 3VPLA 3CEUA 1DWAM 2A2IA 1RBAA 4YWSA 3WLHA 4U10A 1CXIA 1QT1A 3L4YA 2YA1A 3LMYA 1BYBA 4FNPA 2YW3A 4CQAA 4L64A 1B3VA 4Y8EA 3JRKA 3ZJ8A 3W6LA 3EWDA 4O10A 3URAA 4PMUA 2CKSA 4B2DD 1GVFA 3EOUA 1B30A 1UKQA 2DZAA 3MMDA 3CS2A 4GK8A 5CZJA 1KCXA 2IPJA 5CEWA 4FEZA 3VZXA 3PZGA 1HKKA 4YXGA 4M6PA 4GPNA 3MUAA 1PUDA 3LA4A 1FH7A 5FJUA 4IP5A 3H55A 3EX4A 3E1F1 2PEVA 1EXBA 1OB0A 1W32A 5G1YA 4ACZA 3TN5A 2X7WA 2JK2A 4RR4A 1N55A 2HS8A 5HJYA 2Z25A 3SY1A 3M7SA 1FP8A 4L7ZA 3T0DA 2ZZ5A 3LD5A 1UMYA 1ISYA 2OTDA 3MKVA 1JZ3A 1B3WA 1QDSA 2GGJA 1VAHA 1DQXA 6XIAA 5JIWA 2YBVA 3W37A 1V51A 4IIDA 3L65A 3MUIA 4Z1CA 4QIUA 4AHQA 4H2HA 3TOYA 1KKRA 3HPXA 3GY1A 1YE6A 1DXIA 3SCSA 4C6MA 3UZZA 4J28A 3GKAA 3M0HA 2WSPA 1GJUA 3JW7A 4JN8A 3MMUA 1GONA 2XFWA 4PUKA 1M41A 4MDOA 3HFYA 3RM9A 5LXXA 4A21A 1LROA 3TJ4A 4JXCA 3RIKA 5D9OA 4JGDA 4JHZA 1HQTA 3CV7A 3MUCA 4XSLA 3QF0A 4CGTA 3OYXA 2GPTA 5A69A 2JEPA 1E40A 1H11A 4PTXA 1Q66A 2GVGA 1DXFA 1EP2A 2W6RA 3PTDA 3W7RA 3UD6A 4B90A 2VM8A 4I90A 3CAWA 2AQVA 4M6UA 1OF6A 3ES7A 1LOQA 1PX3A 2JBMA 4H8UA 4FOUA 3MS8A 3P5YA 1OFRA 1R5YA 3PJWA 4DQWA 1C9WA 1JPDX 3SUVA 2NV9A 1FWCC 3VOGA 2WPGA 1OT1A 1E51A 1CGUA 1M7XA 2ZIDA 3OGRA 2HQAA 4JFUA 2IKGA 2R14A 5U4NA 3E38A 3GHRA 2DORA 3TN3A 1VBGA 3AISA 1W17A 1W1ZA 3O0FA 4PMRA 3BSGA 1J96A 4JYFA 2KX9A 4GQRA 5D9NA 3T55A 1TB3A 5EA9A 3NO5A 1J0YA 4OU1A 3GC5A 3D3FA 5LIKX 3QVQA 3LDVA 4EACA 4M19A 1U2YA 4WHBA 2E5BA 4ZE4A 5KITA 1SZRA 4F0SA 4HK7A 1TCDA 1QWKA 5H8MA 3SUWA 1K8CA 4GI9A 2C18A 5HULA 3EX3A 1RPKA 1CEOA 2PBOA 1G4SA 3SGUA 4RE0A 1PX8A 3RCMA 4C6KA 4LYQA 2WAGA 1UD8A 1BLIA 1ZALA 3IAQA 2F2KA 4PN2A 4PUNA 4DJEC 2WC4A 2GOUA 1S3HA 3VZYA 4BQ5A 4JEQA 1XDJA 2AQOA 8RUCA 1WOBA 4AY7A 3AHVA 3AMLA 4NJGA 2J7HA 4BR1A 1YIXA 1FWWA 3M44A 3VOHA 1U5HA 2PRLA 5A8OA 4X22A 4YMZA 3TMLA 4NILA 1O66A 1W1YA 3GW0A 4DBWA 5CQ1A 1V3KA 2J9ZA 3WF1A 5HQMA 1S2CA 2Q71A 5A1AA 4WGXA 1I2QA 3VZZA 2YL9A 3AHYA 3R25A 4XSMA 3BW4A 2QW5A 1MYRA 3PJTA 3F2BA 5SWUA 2ZDRA 1HVQA 2V82A 1XLIA 3TWAA 2QIIA 1FP9A 4KETA 3UPBA 4A4AA 1PPIA 2VZSA 4HU0A 2PDCA 4QE5A 2RGMA 4GJJA 4DWDA 2G50A 4JY9A 3SB0A 3BARA 1NWTA 1VCVA 3RPTA 2HNEA 4RPQA 3PBWA 2WHJA 2PU0A 5A8QA 1KM1A 2ZRYA 2REQB 5FJRA 3CLWA 1L9WA 3WL0A 4UTUA 2QF8A 4WGHA 1WE5A 2WBKA 3Q58A 3TYBA 1FHVA 2NQ9A 1BF2A 3CNYA 1DWFM 3G5EA 3UU0A 3SM0A 4DZAA 3OU8A 1GEQA 3QQWA 3OZYA 3KRZA 3RX3A 3O6CA 4AWSA 2CKRA 1ZENA 3U4FA 2VP8A 4C6LA 5FSDC 2VR2A 4QNWA 3A64A 2J9YA 3E2RA 3WK2A 3KXQA 2J79A 5A94A 2DH2A 3G1XA 1PE1A 3PPFA 4IF2A 4QTGA 3VUSA 4RV8A 4M6VA 3ZT6A 4LF2A 3WDPP 2C8NA 4LUSA 4GNKB 4HNTA 4AF0B 2Y5EA 3GTNA 3MQTA 2AL1A 1GHSA 4DXKA 4AWTA 3VC5A 3V0SA 2GL5A 5ECVA 2VX4A 1WO2A 4AD5A 2Q6ZA 4QP0A 1DORA 5D30A 4PUEA 3H4WA 3OGSA 4DO4A 2GGGA 3PBUA 4PL2A 1X7FA 3ECQA 1E43A 1Y5VA 1KFLA 4DJDC 1T8QA 2EJAA 3BQ6A 4U28A 3I3BA 2D69A 1P6CA 4R53A 2Z26A 3ZLGA 3W1RA 2P50A 2XDFA 1HJUA 2DZXA 1Y65A 1ME9A 2E77A 1HT6A 4XAPA 5H6HA 5I79A 4H7CA 2F61A 5CC3A 1PWLA 4YTUA 1CXKA 2Z7KA 1JUKA 3NEVA 4C7GA 3FHAA 2FZDA 3WD2A 1HJWA 1ZQ5A 3V3WA 1UH2A 2RDXA 2E3ZA 4PA8A 1U30A 5BU9A 4DNMA 1SO3A 4UTJA 4G7FA 4ADSA 3T0CA 1UZ4A 5DFAA 1XYMA 3F5KA 5D2WA 3WDJA 5AHFA 4FNRA 3K8KA 4MJZA 5MKGA 2HPMA 1UCWA 1YHTA 2FHCA 1PZ2A 3TA9A 5DT7A 1G4EA 1KBKA 3KOZA 1WBHA 4WIWA 3OHIA 1REQB 4LT9A 2FDSA 1MDRA 4JTTA 5A8MA 1AZ1A 5DF0A 1KFEA 4UTFA 2DW7A 4MB3A 1XIDA 1S1RA 3W74A 1DJYA 2VDIA 4MJMA 4MLJA 4UTWA 1KTBA 3QC3A 2VEMA 3N4EA 2FZNA 3TAOA 3CUXA 4LALA 1M65A 2CERA 3CB3A 4JKMA 1EH9A 3IACA 3CEPA 4IFRA 1FCQA 3URBA 2WB5A 3T2QA 4JYDA 2Y61A 1V3HA 2DSVA 2VCCA 5C5YA 3VMPA 4TO8A 4GFSA 3S1WA 1GVOA 4LYPA 1KRAC 4GI8A 1EKOA 1FWEC 1GZGA 2PD9A 2BLEA 4DUOA 1KLYA 4FXSA 1P6WA 2YLLA 1HJQA 4MZYA 1KRBC 1E0WA 4FNUA 3PF3A 3LNMA 2Y8VA 1WNOA 2A79A 2D22A 2BNJA 1GQNA 1TPFA 1MXDA 1V6VA 3E6EA 3H8AA 4J5NA 1W9VA 4C6OA 3C2RA 3IJDA 4UTLA 3WQDA 1IR1A 1XD0A 1Q6DA 3WF2A 4CEXC 2A6LA 3O8AA 2PDFA 4AHOA 4F0RA 3UJEA 3GC4A 2OEKA 1X98A 2CXGA 1XP3A 3S0CA 5F4WA 2NZLA 3BZGA 4F40A 1OINA 4TQTA 3PWGA 4A3HA 3KLKA 1GGOA 3MMWA 1EJXC 4E2OA 4JOMA 3V0TA 2HK0A 1RPXA 3JU2A 3LENA 2F6XA 2QJHA 1ZJIA 3SCRA 1B5TA 5CAKA 1XJBA 3G1YA 1QPQA 2J7CA 1XSJA 4XBJA 3LTSA 4XO6A 4ZENA 3RHGA 3P61A 4J27A 4QDWA 3MJYA 5T8GA 1L6SA 4NL1A 4ROPA 2Z00A 1E3ZA 3ZS4A 3DFTA 3WDQA 1OIFA 3HG5A 4HK5A 4NX5A 3TXVA 5C2GA 2ATMA 2Q02A 3M0ZA 2WO5A 3CIVA 2OSYA 3TFCA 3VNYA 4AZIA 1H5YA 5A8NA 2X16A 1NWRA 3XISA 3W88A 2WKJA 4S2BA 2NV2A 3G0SA 3QFEA 4PBFA 3FEQA 3CHVA 4LC6A 1QASA 1WDPA 1CX9A 2HXTA 4B92A 4MB5A 2V3FA 4UFIA 4GI4A 4B5NA 3LRKA 1L2QA 4ZFCA 3L5AA 4URIA 4HOXA 1OC7A 4UFLA 2W3ZA 3W07A 1SMAA 3ITLA 4MPQA 2YDAA 3E02A 3B9NA 5HQEA 4NNAA 4OUEA 5D04C 1V5XA 2VGFA 1ML1A 4JL2A 2Y1HA 3ZR6A 7TAAA 4EF9A 1KM2A 2UY4A 4KPLA 1XLCA 5IFTA 2AGTA 1CPUA 3UG4A 3LX9A 1CGXA 4LAKA 4AD3A 1ZBKA 3AIVA 1BKHA 3FGCB 3C61A 3GH4A 3LCGA 3LHUA 1F5ZA 1TJRA 3E0WA 4D1IA 3DERA 3NO1A 1O5XA 5FJIA 1E1FA 2H3DA 3C2YA 3QV7A 5G1TA 2BVYA 3NQ8A 3BICA 1KRCC 5IRPA 5DBUA 2QMJA 1PAMA 2PURA 4WY0F 4DJFD 2G4JA 4S39A 5A2CA 3DFHA 3C56A 3O6YX 1Q7QA 2A3BA 3QGVA 1EXPA 5D37A 2WWCA 2XIBA 4S3AA 3BL3A 3E5BA 5HNRA 4MFDA 1E3XA 4FX8A 3A47A 4EPDC 3M5ZA 1I9CB 1P7TB 5HWJA 4QR6A 5H2ZA 2HVOA 3G22A 1G4PA 5CPQA 3LHYA 3M6YA 4BY3A 4D71A 4GYPC 3D0CA 4OUIA 4P7OA 4KEMA 3W7QA 3T7VA 2BHUA 1A5OC 2JGYA 1NF7A 3QY7A 3QR1A 5TD4A 1W3IA 4PZVA 1OX5A 4CUCA 2JKPA 2WNNA 4LAOA 3CLMA 1DHPA 2OYLA 4DJDD 1XBVA 3KS6A 4LUJA 1XIEA 3CYJA 4GUGA 2PB1A 1GVSA 4B5WA 1FWJC 5I6SA 3SY5A 1P43A 4PTVA 1I2OA 2GUUA 1IZCA 1V6UA 4AXKA 3QW4B 3W2KA 5KINA 4LJ3A 3KE0A 3V75A 4DJEA 2OWXA 5AC4A 4OE7A 3WUBA 1JUEA 3SCQA 3VOJA 5HINA 3UWEA 4CNTA 4DPQA 3AXHA 3MWAA 4YN5A 4DZHA 4NKCA 4HKPA 4AEFA 2HZGA 2FH8A 3LY0A 4H7VA 3WIJA 3GR8A 4L1WA 1VFUA 1GQIA 3JVAA 1R85A 3RR1A 1C92A 4AZ7A 2ZKMX 4OQVA 4MG4A 3UR5A 1FHLA 4UZUA 3AUOA 3NPUA 4I7UA 2ZRUA 3BJSA 3GXTA 3AU6A 1LL7A 2F38A 1UKTA 2WVVB 1UPPA 3Q37A 3HGSA 1B4KA 4U2ZA 2YCJA 4K68A 3VOCA 1ZGDA 5I24A 3WLSA 4CCCA 2R82A 1RLDA 3MB9A 4S2CA 1EB3A 1T0OA 3SSZA 1UIOA 4E0CA 3APYA 5KZ6A 1GVRA 5HQLA 1TZ9A 1BXNA 3RU8X 4CVUA 1JQVA 1WKYA 1LQ2A 3KBWA 4HNCA 2BGNE 1TJ2A 3AS1A 4U4MA 2WJDA 3PZIA 4OJYA 2DDXA 4KCTA 4F48A 3B9DA 2J8GA 3BSHA 4TTGA 4DBEA 1XSKA 3C0SA 3E9AA 5BZAA 1GJPA 4NU7A 1NQ6A 1ZBVA 4AMAA 3WMCA 2CIPA 3W7EA 4E6MA 1TV7A 2WJFA 1PJ9A 1JDEA 4GVHA 1XH2A 1A5SA 1NWUA 3KTCA 3ABZA 1EPVA 4PFMA 4PMOA 5DEZA 3GG8A 1FVPA 4AH7A 2A3EA 3ITVA 1J93A 1KV5A 1XBXA 3KBSA 4W7UA 3TUUA 3AIQA 3A24A 3KCJA 4ZXLA 4B15A 2HNHA 1A5BA 1XIGA 3MSRA 2ZUNA 4BI6A 3NSNA 4W89A 2NQ5A 2QCEA 3TSMA 1RVGA 1JL8A 2EHHA 4HNVA 3ZR4A 3S9ZA 3PWAA 4O1BA 2C15A 3AMDA 1ZY9A 2UV8G 2PDYA 1MQRA 1BTMA 1UZDA 1AK5A 3W73A 1MXSA 5BCAA 1TV8A 3KL5A 2WC7A 4RZ5A 2VFDA 1US2A 2Z1BA 4XKYB 2PRHA 1HJXA 3UXKA 1R86A 1MUMA 2C71A 3ARWA 1PXGA 5ABGA 4O8RA 4DJDA 1E4NA 5EMLA 4JTHA 1NVMA 4QROA 2PZ0A 3MMTA 2Q09A 4Y96A 1DHKA 4GABA 3JR2A 4J40A 4EKJA 5JQ9A 2FPVA 5HMSA 3N15A 2FLIA 3SIZA 1XICA 2VX7A 3NDOA 2IPFA 1JYWA 3LPPA 3I6EA 2NQJA 4I9JA 4AD0A 1OFPA 3RILA 4UFKA 1QNSA 4GNJA 3QMSA 2ACUA 4X9YA 3BV4A 2FTWA 3IJ6A 4A8IA 2CLFA 2WMFA 4GZJA 2HTMA 5XINA 4POCA 3KWSA 3LCIA 3NM1A 4QLJA 2PA6A 3UWYA 3RLUA 2OODA 1E4MM 1JXKA 4G8TA 3W3OA 4BZYA 3UWVA 3LSBA 3M0VA 3U5YA 4DHGA 1WB0A 4A2SA 1NDVA 3NQBA 5ABEA 1TPH1 1AQMA 3LLDA 2ZA3A 3VCCA 3VCNA 3LMZA 5B7YA 3B8SA 3TTSA 3K4AA 5LIWX 3TJLA 3HM7A 5EPDA 1JI1A 1FQ0A 3QLLA 4AIUA 3EEZA 2OSXA 2BGSA 2GQ9A 1QOXA 5FJJA 2OLSA 1CXEA 1IGSA 1GZJA 3RRAA 1CGYA 3LLFA 2GQ8A 2GVJA 4BF5A 3UY8A 3WQ5A 2Z2UA 2QV5A 2BODX 3FS2A 1MI3A 2E6AA 1XG3A 2I5QA 2A85A 1RV8A 4KWOA 3EMZA 1BSIA 5C9RA 3PZQA 3H23A 3TX9A 3SBFA 3CMGA 4W86A 4HJWA 3O1NA 2Q3RA 3WUGA 4P7LA 1M03A 3AFBA 2QCMA 3UYCA 1ALDA 2NXHA 3QR3A 1NDZA 2XINA 2X0YA 4JIRA 1J4EA 3CHFA 2QVNA 3VIFA 3N04A 3BQ5A 3AALA 3N6HA 3ARRA 1VF8A 1SJAA 3CT7A 2F6KA 3I4EA 1OCJA 1VYPX 4I5RA 2CU0A 2CXEA 3OBEA 4LVBA 4PRTA 3FYPA 2A6NA 3SURA 1GG0A 4O1FA 4GLEA 2Z29A 3GBEA 3CZJA 5D8WA 2FH6A 3I6RA 3QHOA 3WLPA 2FTYA 4DF2A 4PRWA 1ITUA 1QO5A 2GGIA 1C8YA 4YTTA 4CLMA 2PCQA 3NZPA 2ZUMA 2BDQA 3U2CA 2WMIA 3MKKA 4AIEA 1E1CA 1VZWA 2FMOA 4GBDA 3CIWA 3PPCA 4JTIA 1ECQA 2BP1A 3DFSA 3HQOA 4A3QA 3KOYA 3HQPA 2O9PA 3N9RA 3GWQA 4MWAB 3WJSA 2QUMA 4P2VA 2IPWA 1VCFA 2ZTJA 4ZSUA 1GEHA 4NZ1A 2EBNA 2JF7A 4H9VA 1RH9A 3KOFA 2DQWA 1VBRA 1SFSA 2QLYA 4WUIA 3WBAA 1Q4WA 1P1XA 6PTDA 2YB1A 1PVNA 1YNPA 3O6AA 1X8CA 1IYXA 4HPJA 3RPMA 3SEPA 2ZOXA 3CUGA 3B8IA 1OC6A 2PDQA 3WDIA 1GKQA 5ABHA 4DI9A 4GGBA 1NWSA 3RLGA 4GXPA 1WKFA 2NV1A 4GHRA 2GOKA 4KRZA 2B4GA 1GOMA 5HAOA 1HG3A 3G1HA 3B0VC 1S46A 3NQFA 3W7DA 1OIMA 4IJBA 2CHOA 3WQWA 4LF1A 4KWVA 4Q8VA 3PC0A 4FLQA 2C14A 1KC7A 4PB5A 1QHOA 1GK8A 5A8PA 1KNWA 2VURA 3ARXA 1Q6OA 4GZEA 3UWQA 1SFLA 2WMJA 2A3LA 2WCGA 3B9AA 1LDCA 1QRQA 5AHMA 1LWIA 2C91A 2GVYA 2GQ3A 4O11A 2G96A 3WNPA 2VGBA 4GO8A 1LYXA 3KFTA 3S83A 3ONBA 2WHLA 4IPLA 3RO8A 3EDEA 3NZ1A 2QCCA 4IIHA 3RF9A 4HN4A 2YB4A 3I65A 2V5DA 1XKJA 4GACA 4US6A 1PIIA 3LRMA 3WN6A 1EBHA 3EKZA 4FR6A 1ZUAX 5TBOA 3UNTA 1E6RA 1DJXA 4XAZA 1EC8A 1P48A 1JZ6A 4CCEA 1ZU8A 3LUTA 2JALA 4H9XA 2P88A 1W37A 4GYPA 4YPJA 1HJSA 1EEXA 3GAKA 3NTYA 1DJQA 1QNRA 4YU1A 3SCPA 4CQ9A 4UOJA 4C6CA 4MHBA 4R9XA 3AS0A 2CZFA 3TW7A 1IWAA 4I7WA 4NNBA 3TLQA 5HMEA 1KWKA 5A5WA 4DRSA 1UR8A 4C1NB 3HBLA 3IJIA 3QPZA 1BYCA 3OHMB 1ZAIA 1F07A 4IMDA 5MHBA 3GU2A 4M29A 3MHUA 1QPOA 3WLTA 3WMLA 3OLGA 5ENLA 2J7EA 2HJPA 1P5BA 4Q33A 5EGRA 4O4VA 1S2TA 5IDIA 5LNWA 2V0TA 1TA3A 4S23A 1JJKA 1VRDA 2MNRA 3W76A 2Z1XA 4N4QA 4E5TA 1B9ZA 3U6WA 3T6CA 1PTGA 3I6TA 1H41A 3DEQA 1F74A 3SGZA 2E9BA 3SW6A 5CLTA 3NQVA 5CGQA 5CSSA 1DE5A 2BY1A 1UD2A 3GHUA 3ZM8A 1TWDA 2F2HA 4B9ZA 3B8TA 4I6KA 2J66A 2I16A 1LP6A 4JNZA 3KL3A 1MUCA 3GVQA 1TELA 1A0CA 1XRTA 4ALDA 3BE7A 2A3CA 1LUCB 1IIHA 2POZA 1DPMA 4A2RA 1TMHA 3MY9A 3O63A 2CLHA 2ZUSA 2R1KA 3APGA 1BVZA 1UROA 3ONCA 1HL9A 1QI4A 1ONEA 3HFTA 1V6YA 2EEXA 4D2JA 2Q8ZA 1KFCA 3SCVA 1P4CA 1MFVA 1O4UA 4O54A 5U7SA 4LY4A 5HDRA 3FSUA 3GTHA 1XIMA 3NZQA 3QFWA 5A6TC 4WR3A 3U2ZA 4PMZA 3QOMA 5T9BG 3WZ0E 4S3GA 3WH6A 1UC5A 3ATZA 4MADA 3O07A 2J88A 3MSYA 3W4RA 2A7NA 4S3DA 5BRBA 1OD8A 2V5BA 3L7RA 1F2JA 4GQQA 1L6GA 2QV4A 4OKDA 6REQB 2B31A 5G2WA 2YL8A 4MYAA 3N2XA 2YBTA 1C3FA 2XFYA 4B5XA 4FLSA 3PB0A 1WP6A 1KM6A 5I3GA 4G1NA 1R3SA 1JD9A 3K13A 3LM3A 2FQIA 4ADUA 2ZZ3A 3MHGA 3CHCA 1H50A 5K9DA 2BFGA 3QLDA 2BY3A 5I3KA 1E0XA 3M0XA 4H8VA 3WFZA 3VKDA 1GKPA 4UTHA 3IK4A 1E9LA 1KRMA 3PZNA 1SFJA 3QW3A 2ZZ1A 3TROA 2BSLA 2ZXAA 2VEPA 2EPNA 3K5XA 3SSJA 1ITXA 2XGZA 5D2VA 4UTTC 3W1XA 1WQ5A 5BU6A 3ARYA 1EJTC 1VBJA 1ZFJA 1TTPA 3WF0A 2WSRA 3W1MA 2VX6A 4ORMA 2YX0A 4HCDA 3BLKA 4ZOBA 1M9HA 4BHYA 3UR7A 1YBQB 3O06A 1U5VA 1VKFA 3P0XA 4O1EA 4XAYA 5M1TA 3ZFHA 4EAMA 1ZBCA 5DQPA 3CIXA 1QATA 5M5DA 3KTSA 1RJPA 4UXDA 3VNZA 4NXKA 4RXGA 2XIIA 3B0XA 3EWXA 3W82A 4HPHA 1HFBA 3VIGA 3F03K 1LM1A 4LUYA 1S39A 2J13A 2X0SA 1IHIA 1GOOA 4NG3A 1H1ZA 4QG6A 2DSUA 1JG9A 3KHDA 1K77A 1XFBA 1W3HA 3W7IA 1DIKA 1Z7AA 3P84A 2XU2A 4GXMA 5LA2A 3KRUA 4WK9A 3N73A 4CU6A 3VDAA 3WFAA 3TOPA 3OLIA 2DT1A 2D24A 4RDYA 3UR2A 3RMEA 4QS5A 2X40A 1D7KA 3AXMA 1T96A 2G3FA 4J35A 2DZTA 2QULA 1J18A 3HMJG 4MTVA 2C19A 3KRSA 4DWSD 3NOEA 4DM1A 1OYBA 3M07A 4KEUA 1GQKA 4OBTA 3VNLA 1M3UA 3QSRA 4GYFA 4FIRA 3W2MA 2J47A 2CW6A 1Q6LA 4LCRA 1FXPA 1VBUA 1VPQA 1J8VA 1M04A 1WV2A 3W28A 3W84A 3HMCA 1XI3A 3KVMA 2XTKA 2HROA 1KQZA 1FA2A 3LXCA 1UJQA 1W9DM 1OK4A 2B0MA 1JYVA 1V93A 3PJXA 3HV9A 1QO2A 1NP2A 3LSCA 2VWTA 3FYOA 4FO4A 3OODA 2Z4GA 3WF3A 1DP0A 4RXFA 1PX4A 3RNDA 4XZ9A 1ICSA 2HVNA 2NWSA 3WQPA 3BZJA 3AYRA 2I56A 1V0NA 1EWDA 3P8JA 1GORA 5EMKA 3MV01 5E70A 4H7ZA 2PP1A 1Q65A 4MUZA 5D02A 5ABFB 2B7OA 2VEKA 4C60A 1JPKA 1PEZA 5CPLA 3VVGA 5TAOA 3WY1A 3L21A 4DO5A 1CGVA 1H61A 4C6IA 3PZOA 4MNKA 1KLZA 3K8MA 3RJYA 1OFDA 3ITYA 3NQ6A 2C7FA 3CO4A 2ONEA 1Y8BA 3NQEA 1D9EA 3R94A 2YYUA 1NM9A 1YTKA 4J3UA 1H0GA 2AGKA 1BG4A 1NEYA 4HNOA 2VZUA 5FIPA 5GJMA 1KKOA 2QS8A 3D5HA 1DVJA 1S5TA 4Q4PA 1XUZA 1G69A 1IZKA 1EUAA 2V3GA 3S3GA 4UNIA 4TX6A 1H5VA 3BCJA 3WNMA 2Y63A 4L4PA 1Q5MA 1Z48A 3CQJA 1VLIA 5F4XA 2O4QA 4IFKB 1E0VA 2E40A 4FR1A 5G1MA 4GBUA 4JFSA 2X1SA 3EPNA 3KDNA 3LV6A 2Q3OA 1TZZA 1AW5A 4N9BA 3N9KA 5FF4A 5HJLA 5HA7A 2REQA 3W38A 4BFAA 1MZRA 4G7EB 2ISFA 1ADSA 1W5PA 2BWGA 4NXSA 4I3GA 3MDWA 1I6NA 3VOIA 3E49A 3V36A 2D2GA 2EPHA 3EXTA 2Z24A 1FWDC 1Z8AA 1XLAA 1D8CA 3TQ0A 3ALGA 1JDDA 2BGQA 3M0KA 1NFGA 3R12A 3URNA 2ZQ0A 3MO4A 4OVXA 1A3WA 3FOKA 5TIMA 1NP0A 2WKLA 4XB3A 2OQLA 3ZXWA 3BSMA 1W5OA 3R2GA 2DIJA 2DJLA 3T0AA 1B3OA 4UFHA 4HPGA 1FWFC 3QZAA 2Z1SA 4TX9A 3VIMA 1O6IA 4LQ1A 2OKTA 3EDJA 1KXVA 4XUYA 5I06A 1FCUA 1N82A 2VFEA 2TRSA 1DYSA 1JDAA 1E72M 4AF0A 3NOYA 2OT0A 1Z41A 3CMJA 1X6NA 3E74A 3UF9A 2WLYA 1MRAA 3TYEA 2MANA 4INFA 4UMCA 3DKLA 1EDTA 2QIWA 1R3TA 4OHQA 4QLKA 3O6DA 1M01A 1XH1A 5AYZA 1ITQA 1XUUA 2ABAA 4U33A 5EBUA 4IUGA 4IG2B 1OZQA 3L5LA 3FKKA 4DYKA 1FWAC 1KTNA 3ORWA 1V6XA 4NYYA 2GDUA 4BI5A 3HG3A 4YL2A 4Q7NA 1X7IA 4YYCA 1UKSA 2QCHA 2HEJA 4E8DA 5REQB 1UWUA 4N2YA 4ZVJA 3STFA 3T8QA 4ZQRA 4RE2A 1KBIA 3IVSA 3R11A 4K8EA 4JFWA 1UR4A 2YFNA 1JCYA 2OKOA 4UOQA 2INFA 3ARSA 1IEXA 3IJ9A 3VILA 3SIMA 2RJHA 2BX7A 1REQA 2Q8XA 2R91A 4W9TA 2GWGA 1Z9AA 3HGOA 2IKIA 2ACQA 1GJWA 3G24A 1WXJA 1NQKA 2G0WA 3AO0A 3V5OA 3B9EA 2BZNA 4DO6A 1VIZA 3B04A 5AYXA 5EFFA 2F9RA 4JR5A 1QPRA 3OVRA 3DZ1A 3CL8A 4LH8A 4EVZA 1W54A 3W7HA 1SR9A 4IMAA 4X0VA 3H7RA 4D6JA 4H00A 2O9OA 1A5MC 1TX0A 4NJKA 3SQLA 3VO0A 3FA3A 3LS9A 3EOLA 3NPVA 3LYEA 3PNZA 4KT2A 2J7FA 3FVDA 4Q4OA 5AB3A 2EPKX 3UBPC 3WQGA 4DELA 3OBAA 3DFQA 1XPYA 2ZWZA 1GYLA 1OADA 5BW6A 1UP3A 1F3EA 4LAMA 1TTJA 1GW9A 5LGXA 2PTYA 3EDKA 5JU6A 3WELA 1TUFA 2ON3A 4ZL1A 1W3LA 1O60A 3JZEA 5CG0A 2A1YA 7REQB 1IE7C 4KF1A 1ZHAA 2PMQA 3WFLA 3U5UA 4Q4RA 2XH7A 4XX6A 5F7UA 3BAKA 3BLPX 1SGJA 1XF0A 1B54A 3VX1A 4N9DA 4F0MA 3PULA 2J6VA 4Z2JA 5AC8A 1E6XM 4O12A 5E6ZA 4ICNA 3ZLHA 1V7AA 3GR4A 2J78A 4AHPA 5AHNA 1VYRA 2DVUA 3MWCA 4H9UA 1KCKA 1WDSA 3RUBL 4ZQCA 3V0UA 1V79A 4ZODA 1JZ4A 1E73M 3U7BA 5LNSA 2FZ8A 5EYWA 1NOWA 4N42A 4B4HA 2FJKA 1H4PA 2FDMA 2W61A 3VDBA 4GH1A 1EQCA 1YTDA 1LF1A 3H12A 1XLHA 1G6CA 3F4NA 4MWAC 2H8XA 4GIYA 3OIHA 3AIEA 3HIJA 1H3GA 1D3CA 4ENLA 4JBRA 4UTTA 3DXIA 1WXZA 3M0MA 4JQ1A 1E1EA 3FA4A 2HWGA 5BXSA 4V1XA 2VFGA 1RALA 1IEQA 2VEIA 3VFCA 1W9XA 3G8RA 3MC5A 1YX1A 3MU7A 4KCUA 3LHZA 3OOQA 2CC0A 3V7PA 1ZCCA 3LCXA 3N13A 3GZAA 3SCTA 5BRPA 1OT2A 3COTA 1Q2SA 3TA6A 4LVGA 4AY1A 2ALDA 2X7VA 1E6ZA 5A6MA 3GG7A 1AJZA 4NJIA 3BJFA 1QAPA 1OEPA 2SFPA 3DFYA 4LYKA 1K8ZA 3W7JA 1MMFA 3QBUA 1M7PA 3BAYA 2ZVIA 3GUGA 4L6OA 3FGCA 1BXCA 1Q45A 2GUBA 2QF7A 1XGDA 1NELA 4ROQA 1T5AA 2VFFA 1FBAA 1FTXA 1UR9A 4KFPA 1VPXA 1AL8A 2VEFA 2A5HA 3DBPA 1YXYA 1QXLA 3S9IA 1TX2A 4Q8OA 3DGRA 1B31A 5G2HA 1BG9A 1PKMA 3BUVA 3CU2A 5DCDA 5LA1A 4ZMGA 3CTLA 3ZT5A 3L4XA 3PK7A 3ENLA 3RGTA 3VD4A 3RN6A 2PP0A 1MSSA 1K1DA 3GDTA 2FZ9A 3ERPA 2VD8A 4JD4A 4PCTA 2DY3A 3HPSA 2QPXA 5F4SA 2ZX8A 3QEZA 1P7TA 4XBKA 4A8RA 1KB3A 1EP1A 2Y24A 5LXEA 3U2EA 1WX0A 4KCVA 2OO6A 4O4WA 1E56A 4CQBA 2WNWA 4R27A 1E9YB 4HCHA 2E09A 4Q4SA 4TMCA 4OT7A 1H62A 4IMCA 4XAFA 3MP4A 2GSHA 3E2SA 4BQ3A 1KA9F 4WDXA 3SADA 2PLMA 1S2AA 4YCPA 1SQ7A 3PS7A 4C5YA 2YDQA 4S3BA 1CBGA 2IXUA 1A3XA 4ATWA 3INPA 2WZMA 1MVYA 4KFOA 4HMDA 2E5DA 4ZFMA 1OFQA 4ACYA 1ADOA 3NO3A 2ACRA 3CUFA 5CPTA 1OM0A 1GPFA 2XJ7A 1GT8A 2VC9A 4XVEA 4EIVA 2PDJA 3MJMA 5D9PA 1GUVA 3DOPA 1AD1A 4MF4A 4UQBA 3KVJA 1ZTVA 4IQJA 2VHLA 4NAEB 1E15A 1TFVA 1A5CA 3G0XA 3EEGA 3VYLA 2P76A 3EKGA 2ZX7A 3LEPA 1RY0A 4JKLA 4O16A 5J5RA 2C1IA 3FIGA 1X8FA 2BHYA 4W93A 2WVVA 2GJXB 3LGDA 3CPGA 1EO5A 2FVKA 2OX1A 3VNIA 2OQHA 2E6YA 4RUBA 2IPGA 3GRIA 3AMGA 1IT0A 5DMNA 3H2EA 2WM0A 1BRLB 3R43A 1FX6A 1S1PA 1XV8A 5CSUA 2NX3A 2OWCA 2YXGA 3C2OA 4HZMA 3WUFA 2I7GA 1GG1A 1J10A 1AUSL 1TPDA 4D6CA 2PWDA 3ABSA 4GI6A 1H0IA 2DGAA 4XD5A 2VX5A 4BWLC 3BAWA 3OW1A 4LRTA 2A4AA 2ISWA 2O9RA 3B8VA 5JBDA 4Z1BA 1UC4A 5D05A 1UA3A 4ES4A 3VNJA 1V6WA 3UWZA 5FJOA 1FWIC 1BYDA 4FOJA 4X9SA 3SUSA 4HGXA 3WKZA 1EX1A 2DU2A 4NRRA 5CKSA 5F2GA 1ISWA 2IKHA 3DC0A 3PWIA 2PP3A 2IQTA 5HJXA 4WD0A 3DECA 5I2UA 5I07A 3OQ8A 4OV4A 1U1JA 3DH7A 3RU6A 1F3XA 5JBFA 1OFBA 5FEPA 1J9YA 1W6TA 3F4CA 6CGTA 4B5SA 3THQA 3CB8A 5D03A 3KCOA 1FCVA 4Y6GA 4PFHA 1ITCA 1VJSA 1JPIA 4FS9A 4M5PA 4S3JA 4XVDA 2OPJA 1S5VA 3C0LA 3WQOA 2WPBA 3TTEA 2NQZA 3DHUA 1T41A 1JULA 5AHEA 3KP1A 1ELSA 3QTPA 1FDZA 3M7WA 4MJ4A 2I1OA 3I68A 4XKYA 3W00A 3HOJA 2QJJA 1Z32X 4RNHA 3N3TA 5LIXX 3F2DA 5LNUA 3DC8A 5F2MA 4Y9OA 3S5SA 1ISXA 4V2XA 2VQUA 2QKFA 1W9UA 3ARQA 3FA5A 5FOOA 1Q6CA 3RITA 4KWSA 1KGWA 2WC3A 3A9BA 5GJNA 3KAOA 4GMEA 1EZ2A 1CWYA 3L4TA 5LNVA 1PS9A 2PWVA 4PMXA 3WDHA 4RV3A 1SZFA 2NUWA 4A05A 3ITOA 2NQLA 2J9XA 3CGTA 1K7FA 3G1FA 3Q4DA 1HO1A 1EJWC 4J4KA 1XGZA 3FFSA 2QDEA 2EG8A 4Z42C 3UERA 1QW8A 2PDBA 1S2VA 3O7UA 2IW0A 1P0EA 2IXVA 1OGGA 1SMDA 1HL2A 1YDYA 2D23A 2YJQA 1CB2A 2ZVRA 1XBYA 2QAFA 1U1UA 3AU2A 3UA3A 3L2MA 1ONXA 1F6YA 2TYSA 1O95A 4QX4A 1VJIA 1RP9A 1RD5A 1I8JA 1RJRA 3H6OA 1ZBWA 4AZGA 2GJNA 4FF5A 1XGEA 3EMQA 1UWIA 3DYPA 2BB0A 5K7JA 4HSNA 4ILSA 3WEMA 1B3ZA 1JRBA 4Y9AA 2CEQA 4Z1AA 3RYSA 1XYAA 1FXQA 3QHNA 3OVQA 4IPNB 3W1QA 7CGTA 5G2IA 2UZ9A 2X1TA 4H4IA 4ZA0A 1K03A 3T44A 5AOUA 5DMMA 1XBZA 4FPSA 3T4CA 5DCEA 1R3WA 3LCLA 3IJ8A 4ZO7A 3B0UX 3ZO9A 2HXUA 3P2VA 4R33A 4DYJA 1J01A 2FPTA 4WRHA 4N9CA 3I3DA 3R89A 1CZ1A 1WOAA 3OJGA 2IKJA 5D38A 1K9FA 4MFEA 1A3HA 3R6IA 2QDGA 3E2QA 1NH6A 2PZNA