4I6KA

Crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
267
structure length
267
Chain Sequence
MNCIDTHAHVFSTQDHSIETARYAPDYEATVQSFISHLDEHNFTHGVLVQPSFLGTNNQAMLNAIQQYPDRLKGIAVVQHTTTFNELVNLKAQGIVGVRLNLFGLNLPALNTPDWQKFLRNVESLNWQVELHAPPKYLVQLLPQLNEYSFDVVIDHFGRVDPVKGIEDPDYQKFLSLLNVKQHWIKVSGFYRLGATPSNINIAQQAYNIFKEKGFLHKLIWGSDWPHTQHESLITYEDAIKAFKQIVFDKHEQCLILNQNPTELFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF PROBABLE 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE (TARGET EFI-505029) FROM Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
molecule keywords Amidohydrolase family protein
total genus 100
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4i6kA00
3CAKA 1E9YB 2I9UA 3ITCA 2HNHA 3E0LA 3URAA 1R9ZA 2QS8A 4J5NA 1FWCC 3MVIA 4DNMA 3FDGA 2PAJA 1RJRA 4EP8C 4H9ZA 3OOQA 3TN3A 2WJDA 4LCRA 4RDWA 1EJXC 3GTFA 3SO7A 1FWAC 4EPBC 4D8LA 1A4LA 3IRSA 4IF2A 2UBPC 2QPXA 3QGKC 4CQCA 4F0LA 4V1YA 3IPWA 4C6EA 4XD5A 2QT3A 2XIOA 2YXOA 3S2LA 2FVMA 3D6NA 1I0DA 2Q01A 3GU9A 3E74A 1A5KC 1O12A 3K5XA 1V7AA 3NQBA 4IG2A 5FSDC 2ZC1A 1M68A 4C6IA 4H9XA 5HMFA 2Z27A 3QY6A 2R1MA 5A6TC 2YB1A 3MJMA 1NDVA 1GKPA 3F2BA 1ZZMA 4XAYA 3UBPC 2QVNA 3JZEA 4DIAA 1P1MA 5FSEC 2PLMA 1O5RA 2FTWA 3GU1A 4KERA 4ZSTA 4C6OA 2VM8A 4KESA 1YNYA 3O7UA 1EJUC 1XRFA 3S2JA 2Z00A 4JOMA 4XD6A 4WGXA 2EG6A 4XAGA 3IJ6A 2VC5A 2E1WA 1J6PA 1KRCC 1GKRA 1YBQA 4CEXC 4L6DA 3PAOA 2AQVA 3RYSA 2YZ5A 2ADAA 1ITUA 2VUNA 1EJSC 4RZBA 4HA0A 4GY0A 5LXXA 3HPAA 1PB0A 2GOKA 2OODA 3MVTA 3S2MA 4RDYA 1K1DA 3GU2A 4H9MA 2AMXA 4HK7A 3GUWA 4GK8A 3E38A 1KRMA 2Y1HA 3MPGA 1V79A 4P5UA 4IFKB 3URBA 2OB3A 2Z24A 2WJEA 4CNUA 1UIPA 4OFCA 4DI9A 2YB4A 5HMEA 4DYKA 3UR5A 2A3LA 3NURA 2O4QA 4YIWA 4RE0A 2ICSA 4RDZA 4C6BA 4H9VA 4V1XA 1FKXA 2RAGA 1PO9A 4LAMA 4LEFA 3TN6A 2GWGA 2DVXA 3IACA 2BB0A 4B3ZA 4QRNA 2KAUC 3K4WA 4KEZA 4LAOA 2PGRA 3FDKA 2HBVA 3BE7A 3B0YA 4KIRA 4GX8A 1QXLA 3E2VA 4I6VA 2Z2BA 4PBEA 2VR2A 4KETA 4M51A 4LH8A 1PTAA 4KQNA 4KEVA 4XD4A 4C6QA 4C6FA 2DVTA 4NG3A 4EPDC 3RHGA 4IG2B 4DLMA 2OQLA 1EJWC 2AQOA 4UB9A 4L9XA 1EJTC 3FEQA 1A5LC 1ADDA 2HQAA 4PCNA 2EG7A 3UF9A 1FWGC 1NDYA 4DO7A 4J35A 1J79A 4C6NA 1K6WA 2G3FA 2P50A 2Z28A 3K2GA 2FVKA 3LY0A 3O0FA 1R9YA 3QGAC 3R0DA 1FKWA 2O4MA 1BF6A 2R1KA 3RCMA 4QSFA 3C86A 2ANUA 1UIOA 1S3TC 3OODA 4GX9A 1EF2A 1A5MC 4LALA 1POJA 3F2DA 3B0XA 2GZXA 1QW7A 2D2HA 4F0SA 3LGGA 4G2DA 4C6CA 1J5SA 2BGNE 3LS9A 3DCPA 2Z29A 3S4TA 4UBPC 4CQDA 2OGJA 2Z26A 1P6CA 4GXWA 3T81A 3ISIX 3RN6A 3PNZA 2PUZA 4I6KA 4PBFA 4C6DA 4C5ZA 4RDVA 3A4JA 3MDWA 4GC3A 3T1GA 3F4CA 3F4DA 3PANA 2WM1A 1POKA 4IH3A 1VFLA 4IFOA 4ICMA 4LFYA 4DI8A 2CZVA 4QS5A 1E9ZB 3A3XA 4CEUC 1HZYA 4HK6A 3IV8A 3WZ0E 2VC7A 4R85A 4TQTA 2FFIA 2E25A 3LU2A 5E5CA 4DZIA 4NP7A 1RA5A 1FWDC 1A4MA 1P6BA 2Z4GA 2DVUA 3S2NA 1RK6A 1WXZA 4G7EA 3AUOA 3GIPA 3OU8A 1YMYA 4LANA 3LNPA 4B92A 4ERIA 4WHBA 4XAZA 2R1NA 3IARA 4H00A 3GTIA 2OOFA 1ITQA 2FTYA 1FWJC 3CS2A 5CH9A 1KRAC 3PBMA 1NFGA 2Z7GA 4R88A 1NDWA 4KF1A 3EWCA 4QS6A 4GY1A 4HJWA 3LGDA 1M7JA 4DLFA 3N2CA 4C5YA 2PGFA 3F2CA 3OVGA 3TNBA 4G7EB 4C6MA 3ORWA 2HPIA 4XD3A 3G77A 3EGJA 3URNA 4GOAA 1UMLA 4WVXA 2GSEA 2R1LA 4CNSA 1V51A 4IGMA 1V4YA 2HBXA 1GKQA 1EZ2A 4NI8A 4MUPA 1K70A 4INFA 1W1IE 2W9MA 2HPMA 3WYZA 3NEHA 3LSCA 4BY3A 4R7WA 3HTWA 4PCPA 3DUGA 2Q09A 4GBDA 3AU2A 2Z2AA 3E0FA 4GY7A 1EJRC 3E3HA 5AKQA 4EPKA 1FWHC 2WJFA 4LCSA 3MKVA 1FWEC 1M65A 3UR2A 1I0BA 1DPMA 3PNUA 3DC8A 4IFRA 3SFWA 1FWIC 2EG8A 4KEUA 4ERGA 3TN4A 4C65A 4IQJA 2F6KA 3MSRA 1RA0A 4GYFA 4H9YA 3EWDA 1V77A 4C60A 3GG7A 4BJHA 4EPEC 3ICJA 2VHLA 1WXYA 1R9XA 4IFKA 4C6PA 1RAKA 3IGHX 3WMLA 1XRTA 1KCXA 5G4HC 4XAFA 4LAKA 5HMDA 4B91A 4AC7C 4CQBA 3ID7A 4HK5A 3HM7A 4E3TA 4C6JA 3QY8A 4H9TA 1FWFC 4H01A 3URQA 1YRRA 2Z25A 4GZ7A 1RJQA 3TN5A 4LCQA 3KM8A 4B90A 2R1PA 3V7PA 4QROA 2D2GA 4IGNA 3AU6A 3GIQA 1NDZA 4ZSUA 1RJPA 3CJPA 1XWYA 1YBQB 4QTGA 3UPMA 3MDUA 2D2JA 3MTWA 2IMRA 3A3WA 1A5NC 1PSCA 3OQEA 4H9UA 3GRIA 4J2MA 3LA4A 2UZ9A 3OJGA 1FWBC 4AQLA 1KRBC 4DZHA 1IE7C 4F0RA 1EJVC 4C6KA 3GTXA 1XGEA 2GWNA 1A5OC 4PE8A 1ONXA 2P53A 1RK5A 3GTHA 3B40A 4Z42C 4C6LA 4ERAA 3QY7A 3T8LA 1J6OA 1EYWA 3LSBA 1JGMA 4BKNA 1YIXA 1ONWA 2I5GA 4CNTA 1UBPC
chains in the Genus database with same CATH superfamily
1GOKA 4W9TA 3GDBA 3ITCA 1OD0A 3QHNA 4LS1A 3UGRA 4DNMA 5AFDA 2WNWA 3SM0A 2YCJA 4MHBA 3QKZA 3FJ6A 4H9ZA 2WMIB 4A35A 3TN3A 4UWMA 3QC0A 4V28A 1GVFA 4XTIA 2XIOA 1MI3A 1PIGA 3EOLA 3WF0A 2FVMA 1XPGA 3VMPA 4FIQA 4A8RA 2Y61A 1EWEA 4NU7A 3F7JA 3U57A 1VB9A 3CHFA 3ZT5A 1US2A 1PX3A 4MB4A 5HMFA 3BLLA 1L0PA 5I79A 4HHPA 5A6TC 1GQIA 1QPQA 1P5BA 1GKPA 2VCBA 1OHLA 2DIEA 3KVLA 4O1AA 3GU1A 3AS0A 1UR3M 4XO7A 5A8GA 3O6YX 3WQWA 1TQXA 1UW9A 3S2JA 5F4XA 2IQTA 2YX0A 2PP1A 1KRCC 3QYSA 4MDPA 5KZEA 1R2SA 2AQVA 4I9MA 1CXEA 4DJFD 3UW6A 1A0EA 2OX4A 1J93A 4W93A 4GY0A 2J7DA 4BQ2A 3U8GA 1DJZA 4MAZA 3S2MA 3WLIA 3WFLA 4F79A 2X41A 3TJ4A 1A0DA 1KRMA 1M7OA 4K39A 2ACUA 4YIWA 3T6CA 2YPIA 4HHHA 3W70A 4DF1A 4GIAA 1UD5A 1YTKA 3IUDA 1XKYA 2CLLA 3CV6A 2XVKA 1UPPA 5BMWA 4GD0A 3B0YA 5BW6A 4GHRA 3SDOA 4K8HA 2GQ9A 1WKDA 4PMRA 4GUHA 4CVWA 4K8GA 3KVKA 2VVSA 2W79A 4M7TA 5BYWA 5AC4A 4NZ5A 1A53A 2W66A 4IMEA 3R8RA 1E55A 4NY2A 2EHHA 5AVHA 3VIGA 1EJWC 5F2LA 3WQDA 1QUMA 2ZUTA 1ADOA 3GDRA 3NA8A 1HJWA 3BOFA 3OYXA 2FFCA 2FHCA 4O50A 3O0FA 3QZAA 1VYSX 4K68A 3IV3A 4PRWA 2ANUA 4DXVA 4J28A 1DORA 1BWLA 3WH5A 5JU6A 4IMFA 1R3SA 3GKAA 1J5SA 3HFTA 4IPPA 3LUTA 2WCSA 3C0QA 1FDZA 2OZ0A 1EBHA 1R3YA 3PG9A 5AHEA 1W1ZA 4GQQA 3W7LA 3EA1A 4Y9MA 4WIWA 4JDBA 4QP0A 3VDHA 4I6KA 2PUZA 4FO4A 4LVFA 1XBXA 2H90A 3LD5A 5IOBA 2DDXA 1PHWA 3IJQA 4JTUA 3RO8A 4B4HA 5C6MA 3KOWA 1DKWA 1GZ1A 1XJBA 1BKHA 2DT3A 5U7SA 1RVKA 2A3BA 3SSZA 3W7KA 4R85A 3OGVA 4XG1A 1MFUA 1RZMA 3PBUA 3WBYA 3MBDA 3IAQA 4U10A 3A24A 4HU3A 4NJKA 4LC8A 4WHBA 1SPQA 3V5CA 4S3KA 1R30A 1PWLA 1HVQA 3W0KA 1ZGDA 1PV8A 4QIUA 3WLKX 3RR1A 3S5OA 4OUEA 3SAZA 1JUEA 1DQXA 5DRCA 3GAYA 3HN3A 3D0CA 4R88A 3W2JA 1NOUA 2WNNA 2I5IA 3VOIA 1F3EA 1PJ9A 4TXEA 4Y9PA 4FI4A 4N42A 1HIZA 2DY3A 3W7DA 2HVNA 3CO4A 1AJ0A 1DIOA 5EMJA 2O0TA 4RL3A 2DZAA 3W7JA 4B5XA 1UB3A 1XYLA 3EB3A 3J7HA 3WLRA 3MB9A 1KD0A 4LB4A 4A22A 2GDVA 3ALFA 4IX2A 4R7WA 4W4QA 5BU9A 1OBAA 3E0VA 4H8NA 2Q3OA 3IEBA 3RLGA 1T8QA 2WCAA 4D6IA 4YXGA 1DPMA 4LQ1A 3T0CA 2DQWA 3VD3A 2PDGA 3B06A 5DBTA 4ERGA 1TA3B 1DWFM 3OTRA 5ECUA 2E09A 4UTMA 2QJNA 3NEVA 4R7OA 3EWDA 1X1ZA 3H2NA 1KTBA 3RCYA 2J4GA 4MG4A 3ABXA 3TYBA 4Z1AA 4RV3A 5J04A 5CSYA 1FCQA 2ONEA 4H9TA 4ZEPA 4H01A 1KGXA 1SJCA 4Q3MA 5GNYA 3PJUA 3FGCA 3PB2A 3R10A 1GOOA 3FCPA 1K7XA 5M17A 1SU5A 3BURA 2G97A 3WK0A 3T40A 3KBMA 1JI1A 3L9CA 1AMYA 3F5KA 4UFIA 1W54A 4WF7A 3W22A 4LUSB 3K46A 3JUGA 5HR7A 3BL3A 2IKJA 1M04A 1W17A 1F3WA 1XDLA 3GTHA 1X8FA 1BVWA 1W9PA 3LCLA 4TOQA 2BY0A 4ERAA 3T8LA 3QN3A 1TVPA 4GKLA 5AC8A 4NRRA 2WCGA 2BVYA 4AD0A 1S1PA 3DFTA 3H54A 3CAKA 2Y4SA 2WC7A 3NWRA 4GZJA 3L7RA 1GYNA 5A69A 5DMLA 2G3MA 3H2OA 1H49A 2PAJA 2BODX 3DFOA 5KINA 2HISA 2J8TA 2W61A 3OOQA 4AZGA 1BXBA 4NX5A 2OMAA 1UR2A 1F8MA 3TA9A 1OX4B 1CCWB 3MSDA 1ZJIA 8RUCA 1QPOA 4F0LA 2O56A 1EDGA 4XD5A 2QT3A 4YWIA 4HMCA 1UUMA 1Q3NA 3SN1A 5A6JA 5D9OA 5HQLA 1GORA 3GU9A 2J9YA 4FIRA 2PDIA 1BRLA 1XLKA 1TPUA 4E2OA 1XUZA 3IGXA 1TO3A 4OWGA 2DFAA 3PBYA 2DQXA 4N9DA 3MU7A 3WLMA 1ZZMA 3PTMA 4IUOA 1XH2A 3UFYA 3K1GA 4S23A 3G0SA 2VL4A 4DVOA 3MKCA 3HZ3A 1EKOA 1HO4A 3NM1A 1OCQA 1I1XA 1RQEA 4XZWA 1C92A 2YXGA 3TTQA 1KFBA 1NOWA 1HJVA 5J5DA 3OLIA 3VFLA 4HA0A 3RPTA 3IK4A 2WMHA 4D6EA 3OIHA 4GYKA 4IM4A 2XZ7A 2FZMA 2VOTA 4PUUA 1DIKA 3G1YA 3JVAA 3MW7A 1PX4A 1D8CA 2CC0A 4DBWA 1CBGA 4MKVA 1UWUA 4PEKA 1MEIA 3WFAA 2VGBA 2OJPA 3UG5A 4DQWA 2NX3A 1RVGA 2DVXA 4B3ZA 4TU1A 4CVUA 5TNVA 4KEZA 5FKYA 4H4IA 3TYDA 2VURA 3BE7A 4ZXLA 2Z1BA 4ZQOA 1VKFA 3QLDA 3S9ZA 1I75A 5C9XA 1JCLA 5IHRA 4C6FA 1QK2A 1X97A 3WDJA 1TUFA 3M41A 3G8RA 3EPOA 3MA8A 1FWGC 2V5BA 1AW5A 3EMCA 2G3FA 1QDSA 3DYOA 4WQ6A 4HHLA 2JEPA 4GABA 3APYA 4QSFA 5A8QA 1IT8A 4EACA 3IJ7A 4BF5A 2B81A 4GX9A 3GWQA 2JF6A 2ABAA 2WLYA 2PDLA 1OFEA 4XQ6A 3USZA 4C6CA 4MPKA 3UERA 3LS9A 3W2UA 3MANA 3UP8A 2JE8A 1IXPA 2YYTA 1ZSXA 3KX6A 2PDBA 3VDBA 4E2DA 2PTXA 2ZIDA 1BHGA 1M9HA 5H8PA 1V6YA 4S3AA 3SCWA 3EAUA 2O9OA 4GA8A 2VTFA 2E5DA 3DFSA 1H7PA 1Y5XA 5FEPA 1W91A 4U5IA 2QGHA 3WQ4A 5HINA 2Y2WA 1HZYA 3HPXA 3I6EA 3OZPA 1XG4A 1CENA 4QBXA 4DZIA 4R5EA 3R8HA 3NO5A 3KS5A 5D8ZA 2NZLA 1X1OA 3GZAA 2HVOA 2E7FA 3V16A 2BDQA 4GFIA 1TR1A 5BCAA 5DCBA 4TMCA 1UYQA 4Q8MA 4D1IA 4JTAA 5FF4A 2F7FA 4UNKA 1XISA 1XGZA 1VYRA 2V63A 4AHPA 1TTJA 4KF1A 5K4XA 1I60A 4DLFA 4PMZA 1EC7A 3N2CA 2BOEX 4ZQRA 1W56A 1Q7MA 1WUFA 1KW1A 5LIYX 1UMLA 3KEHA 3NIYA 3GG8A 2B7PA 3RMJA 3HV8A 2HBXA 5DMMA 3RU6A 3R94A 4E5TA 2V2CA 3TXVA 2CLHA 3DHDA 4O8AA 2PD5A 1Z42A 2O92A 2HPMA 1MQRA 3PZNA 2Q09A 3DUGA 3CB3A 4TVDA 3AU2A 5K7JA 3DDMA 4Z1BA 3E0FA 3R11A 3UNTA 3B9AA 4HYWA 3E2QA 4W7UA 5CPOA 1BKSA 3KBNA 1YDVA 2R94A 4L7ZA 3VOCA 1I0BA 3QLLA 4K38A 1B0IA 2DUAA 4HSNA 1XQLA 2F6KA 2ZWYA 1PAMA 1UR0A 3I3BA 6TAAA 1T41A 3ICJA 2EPNA 3H70A 9XIAA 2VHLA 5HNUA 3A23A 3PG8A 3RNDA 3VIFA 2Q8ZA 4UMAA 1B30A 3OG3A 4QEHA 5M5DA 1XLBA 4LAKA 3PJWA 5C9WA 4YMZA 3WQOA 1DJGA 3OBKA 3WH8A 3AJXA 4JIHA 2D24A 4IGNA 3BJFA 4GC4A 1TFVA 1ZY9A 3P60A 3TW9A 3VGFA 2XFFA 1MZRA 4WDUA 4PSPA 1EQCA 2PD9A 3CH0A 3MTWA 1GVYA 5DY3A 2E68A 5DO8A 1IR1A 3SZ8A 3HG4A 5C5YA 1KGUA 5EB8A 1TPC1 4LV4A 1IZKA 2UV8G 1EJVC 3ITXA 3E12A 2X0YA 1RY8A 2Q71A 2P53A 4UQEA 4WD0A 4GIEA 3SFKA 4PEEA 2AMGA 2EPOA 3VKJA 4MIMA 1VFUA 2G37A 1OGBA 2P3ZA 4ADUA 3CPUA 1GJPA 4U3CA 5FL1A 1ZALA 2YDSA 3TXZA 3O05A 5D37A 1Q13A 5D9PA 2OELA 4EF8A 4MWAC 4A8NA 3W29A 2X1SA 3HGJA 3CAQA 4HN8A 3SSJA 4JBRA 3LRLA 1O5KA 3NQ6A 4RDWA 5CXPA 4Q8UA 1EL3A 1YE6A 1MNSA 2J79A 1H1NA 2POTA 1ICQA 2YXOA 4PTWA 4DWSC 3GVWA 3IUIA 1QHPA 4LUYA 1GZJA 3IIZA 4AZCA 1GQLA 1GTEA 3VKDA 1NF0A 3B05A 4GO8A 3N9SA 4O19A 3H2FA 1ML1A 2JKAA 3WQ6A 3WDHA 3SQSA 2R9RA 1VFFA 2DH3A 3O8AA 1WDPA 5LA2A 1O5RA 5HXMA 4XVEA 1AQ0A 2XIIA 4YTRA 3UD6A 1EJUC 2DSUA 3C2YA 3WLSA 1C7TA 1GKRA 1TB3A 3BXWA 1Z48A 3AZTA 3VUSA 1TPWA 1AJZA 3W7NA 2J47A 2FYMA 2V3GA 5B80A 1XD1A 4H9MA 5LNVA 4IJCA 2Q3RA 2FTPA 4XISA 2Z24A 4LYRA 3F03K 4M1RA 4RZ4A 5A6SA 4B5VA 5T9CE 1I2NA 3UR5A 1WZAA 1R3RA 1S2AA 4C6BA 2RDXA 2C14A 4LWWA 1MDLA 3P74A 1I9CB 5ABFA 3DIPA 4L1WA 3UXLA 2WVTA 1FH8A 1KR1A 5AHNA 4ZO7A 3PZVA 2PRLA 4URIA 4YCPA 1FVPA 3E5PA 3GXNA 3UT0A 1BGAA 1KFKA 4WJ8A 3ZFHA 4GYJA 1W5MA 3QPEA 1LUCA 3FVMA 1XV8A 1T5AA 4I7UA 3A22A 1P0BA 3MJYA 4XSLA 3TJLA 1QOXA 1EGMA 4Y9OA 1VYPX 5TQLA 1H0GA 1D7FA 4XZ9A 1GOXA 4DM2A 3I4KA 4WKAA 4HCDA 1NM9A 1W3JA 1KC7A 4QXIA 3KTCA 2FVKA 1SVDA 2BG5A 4RV8A 3ZO9A 1SO3A 2VRKA 1MXSA 2WZHA 2CITA 2WVVA 1DL3A 3OODA 3AWNA 4ROPA 1NSJA 4US5A 4A29A 4XB3A 3CZKA 4G2DA 2Y70A 1FCVA 4XSMA 1G7VA 1F9CA 4LRTA 2A3CA 1RUSA 4ACZB 4O1CA 1GVEA 1GVOA 5CPQA 4JTJA 1V7YA 4DJDC 3ISIX 4D6FA 4MWAB 1KM0A 4C1NB 5E0CA 3VDAA 1F3TA 2PU0A 3H4WA 3W73A 4O14A 4KT2A 3ZJ8A 3VNLA 1EPXA 4LRSA 7ODCA 1I4NA 4ROQA 4YNGA 1OFQA 3F4VA 1AD4A 4ICMA 3QW3A 4O57A 3RUBL 3TV8A 3SJ3A 4LTSA 3RF9A 2P88A 1Q5MA 4N9EA 1OFDA 1Q6RA 1OCBA 3VE9A 3H12A 3W7IA 4D72A 2Z4GA 2OZ3A 2QDDA 5C70A 1C9DA 4J27A 3U2ZA 4G7EA 3SCRA 1LL7A 1P6WA 4B92A 3UWZA 2JALA 1ICSA 2PC8A 2W3ZA 4QNWA 5BRQA 2XJ7A 4JIRA 5IFTA 3FNDA 1YPXA 4FALA 4JL2A 4O1EA 3MMUA 2DSVA 1B3VA 3AO0A 5DF0A 3WCZA 4JIEA 4IL2A 1KQZA 4M3PA 4OUIA 2PS2A 2PZ0A 3VCRA 2H8XA 3BLKA 5CKSA 1E1EA 4U28A 1WOAA 3ZJ6A 3CHVA 3C2OA 4DPPA 1XBZA 2R1LA 5HWMA 2VGGA 5IBXC 3AHVA 1VPYA 3C2EA 3MT1A 3V0SA 3FJNA 4AY8A 3SGGA 3NSXA 1AQHA 2XYLA 4HYVA 2RGLA 5D9MA 3CL8A 4Z1DA 2WM0A 1MEWA 1HNYA 1QPKA 3EDKA 5F2MA 1MW2A 2TYSA 3ZYZA 4BQ4A 4D8AA 2SFPA 4NNCA 5FJPA 1EJRC 3E3HA 3SRFA 3CPGA 1JDFA 4J9JA 1FWEC 3BMXA 4MNKA 2NLYA 2E77A 1NARA 5DX7A 4JTCA 5F1VA 4YL2A 2WMGA 2VEFA 1KBBA 1LRQA 3RM9A 2HZGA 1D3GA 2WPGA 3W1AA 1NOFA 1VLWA 4MNMA 1W9XA 4N6EA 4C60A 3TOYA 4L61A 3USBA 1E6XM 2ZX7A 4IICA 4H1ZA 5CPNA 5HA7A 4K37A 3IGHX 1TPDA 1X7FA 1KFJA 2WPBA 4WSJA 2X40A 3UZYA 1ZBCA 2XN2A 5EYWA 4UR9A 4K1GA 4ZOAA 3GS6A 1ZUAX 4H7CA 3K4DA 5A2CA 1I2RA 2NUWA 3LQLA 3THCA 4S3EA 1Q6QA 2JF7A 4JFWA 1IHIA 2D2JA 4MWAE 2CLEA 3KRBA 3CZ8A 5C9RA 3WJWA 3LPPA 1OT1A 2NUXA 2NT1A 1KRBC 3NDZA 4GXPA 3VIJA 1WOBA 9XIMA 4Q4MA 1GPWA 3P8IA 3W2NA 2BY1A 3B40A 1MFVA 4HPGA 1MWOA 3BQ5A 4JEJA 1J6OA 1JEZA 3K4AA 3TAOA 1F3XA 4IIFA 3W76A 4FNUA 1MSSA 2ZKMX 5A95A 3ANYA 1MZHA 3LI0A 3B9NA 2D73A 3VD9A 4PTXA 4DJDD 3S6TA 3VD7A 4DUXA 3N18A 1EP1A 2WJDA 3ABQA 4I90A 2VT0A 2REQA 1W3HA 4LU0A 4CQCA 4MAVA 4GGBA 3UJFA 5MKGA 4FOJA 1KTCA 4QG8A 3P8JA 1P0DA 3GFZA 3EX6A 1QATA 4B9YA 4EXAA 1XIBA 2VO5A 2E40A 2WKGA 2Z27A 4P8VA 1J5TA 3IIXA 2OGYA 3HQ1A 3VUPA 3GY1A 2ZA3A 2OSXA 3UVIA 1NWUA 2FTWA 4YTQA 1JCYA 1AQFA 3EBVA 1GJWA 4S38A 4AF0A 3SIZA 2QLYA 1YNYA 4MB5A 5I3GA 2Z00A 4LGXA 3Q2DA 3IIOA 1YBQA 3NPXA 3M1ZA 5AC6A 1NFBA 1PYMA 3UG3A 3W71A 4CU6A 4XKYA 1KM5A 4KMQA 2GPTA 3RIKA 5LXXA 2V8ZA 3MVTA 3SB0A 3Q67A 2AMXA 1XLHA 4LEQA 3U7VA 1XIIA 4RXGA 2V5DA 3S6OA 3H2CA 6A3HA 3URBA 4CNUA 4QLJA 3HQPA 3GX9A 2IKGA 3GW0A 4DYEA 3ZT7A 3O2LA 3AIBA 4V1XA 3I10A 1E56A 4YYCA 4RR4A 2NX9A 4LEFA 1UROA 4IIDA 5E9AA 3DH7A 4KIRA 2ZUVA 5E70A 1FFQA 3W2KA 3ENLA 3QMSA 1VCGA 1O60A 1EA0A 4PBEA 3DBPA 3IANA 3P5ZA 2VWSA 3GVGA 4MVAA 1F61A 4AXNA 3DENA 3ARRA 3P84A 1UR1A 2CKRA 3VCCA 1G7UA 2BZNA 4B4FA 1DTNA 3STCA 2XH0A 3GR8A 2HQAA 1WUEA 2ZC8A 3WLQA 1NDYA 4HA4A 3QEZA 4C6NA 3I68A 4LVBA 1PX8A 4JXCA 2DEPA 1UHVA 2AL2A 3P61A 2PEVA 5A6AA 3HG3A 1XIEA 1TYGA 1L8NA 3FFSA 3RJYA 3CV7A 1XH0A 1Q2RA 4P2VA 1EF2A 3H2EA 1JCTA 3R43A 4UFJA 2Y62A 4C7GA 4D2JA 1W3NA 4UTUA 4NZJA 4J2PA 4PMOA 2XHYA 3UNDA 3MCMA 1P0KA 3R4IA 3NPVA 3SN4A 2J8FA 1EUNA 1B3YA 3EYPA 2W62A 2GJRA 3Q65A 3CXOA 3FIGA 5FESA 3TTSA 1XYBA 3G6LA 3QSRA 5M3WA 3PANA 1H7XA 1E5JA 2GJPA 4HOWA 3BC9A 4FP1A 3AYSA 4AWEA 1LLWA 2OPJA 4HNUA 5DMYA 1RV8A 1UWSA 3N1AA 1TREA 3C0SA 4WKHA 4PCFA 4C90A 1KNWA 3M0LA 1FWTA 5LIXX 4RE2A 3HMJG 3WDRA 1VFHA 3DFPA 3GHUA 5CC3A 1N7KA 3BLOA 4M6QA 2D2OA 3OVQA 1L6FA 2NXGA 3NOYA 2YJQA 1PPIA 2F8QA 2ZYFA 5D4YA 5ABEA 4W87A 1GVIA 1WYIA 2EEXA 5HPOA 4JIPA 1HN1A 2RKXA 3ZVIA 1F5ZA 4C1KA 2IKHA 3S1XA 4W8BA 1K6AA 2QNEA 3AZSA 3M0IA 4I5RA 4AZHA 2V38A 3LGDA 3VC6A 1F4AA 2NUYA 4JICA 3F2CA 2QDEA 1ENUA 4UTLA 2OKOA 1BGGA 5HJYA 3VOFA 4J40A 4CNNA 1C8QA 3PJTA 1NTHA 4KFNA 5A6MA 1W8GA 4IGMA 4D6JA 1E40A 1BFNA 4NNAA 2J77A 1PZ2A 4PMNA 2A1YA 3N34A 3LSCA 5FJTA 3O1NA 2PF8A 1PZ3A 4L65A 4Q8WA 2CXEA 3OPSA 5K9XA 2G50A 1GYMA 5AYIA 1Q63A 3XISA 2YGYA 3MCOA 1V93A 1NIUA 3HF3A 1XYFA 1NF7A 1ITCA 4AB4A 1YDYA 3LG3A 5FAJA 2ZE3A 3ITVA 5GQBA 3U2OA 1XRSA 1TVLA 2CNCA 5FL0A 1EEPA 5CGQA 4KCUA 3NQEA 2WHKA 1GTHA 3KTSA 3M46A 4N9CA 3UA4A 1JZ7A 1L6GA 2HE8A 2Y7GA 3SADA 4G8TA 1SO5A 1QO5A 5HMDA 4CQBA 3L68A 4NSBA 4E3TA 2QMJA 1GEHA 3C6CA 3FXYA 4G7FA 1H0IA 3DFNA 4JTSA 1AW2A 2O7QA 1NY1A 4NYUA 1H60A 3WIJA 2C91A 5A6BD 1ISWA 4MFEA 3N9KA 5CJMA 3UPMA 3TONA 4XBSA 3L2MA 1UH3A 1E0VA 4Q32A 4B5SA 3WF2A 2DSWA 2YL5A 3MSGA 1PSCA 4Q8PA 4J2MA 5C2GA 4AX6A 1OC7A 2X1IA 4PUJA 4AQLA 1WXJA 4JCLA 4DJFC 4F0RA 4A4AA 5FCZA 4RXFA 5HK4A 2QQ6A 3GTXA 4UFHA 4WOQA 4IISA 3LENA 2R24A 1A5UA 2A6LA 5EMLA 4PA8A 4ZTXA 1UH2A 4QQUA 1YIXA 1A5SA 4J3ZA 4UOZA 2E6YA 2Y5SA 4ZQPA 1VPXA 3TIMA 3L2LA 4WY0F 3TKFA 2P1FA 1J8VA 3PUOA 5BRPA 5CAKA 4RZ5A 5M1TA 2ODOA 4JQ2A 3ARZA 7ENLA 1ZJHA 4OBRA 2WO5A 1R3WA 1S3HA 3SO7A 4EPBC 4CD8A 2DT1A 3CQIA 1Z44A 3M5VA 1JDAA 3IPWA 3FAWA 4NILA 2WNQA 4U5KA 3CO8A 1LT8A 1B2YA 4D9PA 2YCLA 2QCLA 4DWSD 1XLIA 3QF0A 3S1VA 2CHNA 4HZ6A 2ZZ6A 4NAFA 2ZC1A 3K13A 3QGVA 3B8DA 5LZLA 2VGFA 2B7NA 4RZ6A 2P5NA 3AALA 1K8XA 2ZZ2A 4OKDA 3CL6A 4GUFA 4MPQA 1DWJM 3SIMA 3MUZ1 1IXOA 1QI2A 1HF6A 2GDUA 4JQ4A 3QPYA 1K9FA 3IRDA 3PPCA 3FHAA 1UPMB 5CZTA 4G5DA 5BZAA 3PPGA 1VENA 1JZ5A 3BZGA 1Q4WA 3P93A 4LW7A 2Z1KA 3VINA 3VIMA 5BXSA 3TC3A 2E1WA 4S2CA 1VIWA 1XLEA 4UXDA 4AU0A 2FGBA 2YZ5A 4ATDA 4BWLC 2VUNA 1EJSC 3GR7A 1ME7A 4V33A 5TD4A 3MC5A 1TV3A 1CPUA 2Z6JA 3WBXA 3ZMRA 3PZQA 4LJ3A 3U2EA 1V6UA 3M07A 3LI1A 2VJXA 2A3LA 2ICSA 4HGXA 4DELA 1J2WA 4LBSA 4S3DA 2XFWA 3G1SA 3M16A 1Y5VA 2XN1A 4QRNA 4E38A 4U31A 3GM8A 2HBVA 1UA3A 3NDYA 4LX4A 3DECA 2VZVA 1ESWA 1VAHA 3BPWA 4Z17A 4EOUA 1KQYA 4JKLA 4REQA 4E8GA 3ZLHA 4Y9NA 2J7BA 2QGYA 3NR0A 5LIWX 2E28A 1LQ2A 3TROA 2ZZ5A 1CNVA 3OZMA 2C8NA 2WZMA 4NL1A 1GVQA 4J35A 1TJ1A 3MWAA 3L66A 3QFWA 2A7NA 2PI6A 3G1AA 4HP5A 4OTKA 1QJWA 1FKWA 1ZAJA 3MMWA 4I3GA 1XFBA 1UIOA 2BMBA 1V03A 3NQCA 2B31A 1JRCA 4US5D 2VRJA 2PTZA 3ZT6A 1V6TA 4B5NA 3B0XA 4Q4OA 3VILA 5ABHA 3LGGA 4GNJA 1KCKA 4PYSA 5K2ZA 4ML4A 1DQUA 4PTDA 3UEQA 2ZZ3A 1K4GA 4IIBA 1E9LA 4K6AA 5H6HA 4QFUA 3AXMA 1B5TA 1TV5A 3OB8A 4DPQA 2CBIA 4R33A 2FJUB 4PBFA 1KBKA 1RPKA 3GDLA 4C6DA 3QV8A 1JDCA 1R8LA 1N55A 3HPZA 2QCNA 1MYRA 3LMYA 5E0FA 3A3XA 3AMCA 1S1RA 2FFIA 4PTNA 1ODZA 1XLCA 3AQUA 3KWXA 4OOUA 1EP3A 5DT5A 3LNPA 4NKCA 1J0YA 1XIJA 1HO1A 1FP8A 3M43A 2VUYA 1H7WA 2B0MA 2GQ8A 1KM6A 3FXGA 3PBGA 3ATYA 3W88A 1NWSA 4HJFA 1XGDA 2PA6A 3B9EA 2Z7GA 4PMQA 2VEKA 4KCWA 2ZRZA 3M5YA 5GJPA 2DT0A 4GCXA 2R8WA 2YXXA 1XG3A 3URNA 5H1WA 4Q7BA 1DWHM 4ZZ9A 1LL4A 4GO9A 4X0NA 2E67A 5DEZA 3I4EA 5T91A 1SYTA 5IDIA 2NX1A 2JBMA 3O3RA 2C19A 1CDGA 5ABGA 4NI8A 2CZFA 1W1IE 2IUZA 4WXZA 4DY1A 1EFZA 3SUSA 1KFLA 2WQDA 2VZTA 2G96A 2JQXA 2XVLA 5H8MA 3N4FA 3POHA 1FWHC 5I07A 3STGA 2A6NA 2VEPA 3VZZA 1OVDA 1AL7A 2E0PA 4MFDA 5FF3A 1WDWA 2VEIA 3QQ0A 1IEQA 1OM0A 3GIYA 3QJAA 3GVRA 2INZA 1D3CA 4ZA0A 3WG6A 2ZTJA 1YYAA 5HUOA 1WXYA 1R9XA 1E43A 4C6PA 1K7FA 3MO7A 3HMCA 3DAQA 3K8MA 1KCXA 5CZSA 3OBAA 1U5HA 3ID7A 5D02A 4ZOCA 3HA1A 3URQA 3W1TA 1GQKA 1HL2A 4LB3A 4DRSA 3AC0A 2D2GA 4UTKA 3TTOA 3UJSA 1FX6A 2A7RA 1A5AA 1GGOA 4ZSUA 1YQ2A 1FBAA 2ZRXA 1BWKA 2XVNA 3ES7A 4YTUA 4RLIA 4UQAA 1AUSL 1W6TA 4J3WA 3AOFA 1PCWA 4NVTA 2XIJA 2DZXA 3W7PA 5FF0A 3JS3A 4A3UA 2GSJA 1RBOB 3H4GA 4MZYA 2DZTA 3DKJA 3MHFA 3VO0A 4WX2A 2QUTA 3KAOA 4PMXA 1NJJA 3NQFA 3BG3A 2ZZ7A 3CWOX 2C18A 1B3OA 3BICA 2GJNA 4OE7A 3GXPA 1AW1A 2HV5A 1RY0A 5G2HA 2NWRA 1S2TA 2WAGA 1SSGA 1R38A 4DZ5A 3TYEA 2QS8A 2VZOA 1OIMA 3TZFA 2GL5A 4QDPA 4ATWA 2PODA 3S9YA 1LOSA 3D46A 1FWAC 4UQ9A 1H7NA 1QNSA 3G1FA 4DO5A 1J0KA 3AWOA 3PZ9A 4FB7A 4L64A 1DJQA 3RX2A 7PTDA 5A8PA 1E6QM 3FW6A 3M0XA 3AMKA 1C91A 3K5XA 1M3UA 3DXIA 2ZRUA 2P8CA 3SRHA 1VH7A 3STPA 2BBFA 2XIQA 3SQMA 2BGSA 3L2IA 3CU2A 4AWTA 4HNOA 5EL1A 5H8UA 2GVGA 4ALDA 3VVGA 1OFAA 2QVNA 3AIQA 4PUMA 3PHAA 2GDQA 2OXNA 2VM8A 1IGWA 1DHKA 3RM4A 1Q45A 4O16A 2FLIA 3ZQ9A 4QCFA 2PB1A 2VELA 4K7VA 3IJ8A 4JTLA 1OINA 1UBSA 4PBGA 3IJLA 2NW0A 3HPAA 3A4WA 2HSAA 4QNEA 2A0NA 2I16A 4NJJA 3R0KA 2H9AA 1S2VA 3BLIA 1Q65A 2ZXDA 2OB3A 5FF2A 3WBAA 2QCGA 3HFYA 3PUGA 3U2CA 1NEYA 1RP9A 2Y8KA 1YKWA 5C8BB 5CLTA 3CZGA 4X60A 1PO9A 1HJUA 1R46A 4NJGA 3P81A 3BAIA 4MB3A 2WMFA 5CLWA 2RH9A 4F3HA 3N19B 3V3WA 4X9SA 2HNEA 1W1YA 2OWCA 2VR2A 2MNRA 5D2TA 1PXGA 2VGIA 1T99A 4FOUA 4C6QA 3DYMA 3TCEA 3EX3A 1MXDA 2J74A 4L1GA 2BX7A 3SEPA 5E1QA 3T09A 2AQOA 2PC4A 7CGTA 4KGJA 3UXKA 4Q33A 3UF9A 4DO7A 4P61A 4BF9A 2P50A 3H53A 5FAGA 4JZ5A 3THQA 1A3XA 1R9YA 3C5QA 3RCMA 4OZOA 2IPWA 3FS2A 4DJED 3U5UA 4CNPA 3RITA 1R5YA 2VMFA 3CEPA 5KSWA 3MYPA 4B16A 4W5ZA 1C8XA 3AIUA 1MW1A 2DJLA 3SI9A 1VBJA 3SUUA 3CWNA 3EEGA 2FQIA 1HJXA 2F2HA 4FLSA 4GXMA 1OCJA 2VDGA 2VX4A 3ZVHA 4OBSA 3P62A 1M6JA 1VFLA 3APGA 1LG2A 1AODA 1WP6A 3GG1A 3N2BA 3NQGA 4CEUC 1TIWA 3GTNA 2O9TA 1ZP3A 5A6BA 4TQTA 4E3VA 5E5CA 1UMYA 3WNOA 1P6BA 1GW9A 2R6OA 3DC0A 2DVUA 1BYAA 4LS2A 4TV5A 3WQEA 2QYGA 4AW7A 4Z2IA 3V0UA 2P0OA 3QR0A 5D04C 1HTIA 3HG5A 1BTCA 3BV4A 5L6UA 4H2CA 1L6SA 2GGJA 3N4AA 2VYOA 2XIMA 3VGEA 2ZX9A 1AFSA 3NXFA 1CX9A 2GVEA 5BMXA 3PK7A 3VD5A 2OT0A 3REQA 3MZNA 4FLRA 4Y96A 4AIOA 5LSMA 3V5FA 3RPMA 3QFEA 4N0RA 1W9UA 3LPOA 1R3TA 1V51A 5C7VA 4O28A 4FF7A 1OK4A 3VU2A 1UQYA 4AY7A 4TTUA 2CLKA 2WSQA 4HHMA 3GH4A 4QISA 2WK2A 1R87A 1OFBA 2XWEA 4GIYA 4F48A 2A7PA 2WSPA 4LUSA 4JQ3A 1EDTA 1M65A 3PFMA 4CUCA 4GNVA 3RLUA 4CD4A 5BXRA 3KS6A 2JKEA 3QYQA 4XZNX 1G94A 1EBGA 1P48A 2YA0A 3A4XA 1J0JA 2CWNA 1DYSA 1CI1A 1EA9C 2WSKA 3UVAA 1B54A 2CLOA 4EF9A 1E73M 2V3DA 2D0HA 5FOOA 4ZO6A 4AH7A 1VEMA 2ON3A 3G1RA 4HPHA 1QTWA 4IFKA 1EH9A 1EZWA 1RAKA 1W5PA 4TVUA 2WANA 4GJIA 4QLKA 4DWSB 6PTDA 3VCNA 2ZA2A 2A3HA 4AIBA 4C6JA 4H6RA 2QEZA 3TZNA 2VEMA 4AX7A 2TMDA 1US3A 3N6QA 3L5MA 3RR4A 7REQA 4JN8A 2EPMX 4Y6GA 1Z9AA 1U30A 4YLWA 1V3LA 2WMJA 3LN3A 4O4WA 2PWEA 1S2CA 4XBJA 1A5BA 3IVSA 1O66A 1MQQA 2O55A 3L0KA 4DJEA 1XDJA 1DTUA 4BI7A 1A49A 3UYIA 4LV9A 1MRAA 2CLIA 1AA1B 1XGEA 4RNIA 1HKMA 4MNLA 4OV9A 2BLEA 5A3HA 2QUUA 4IIHA 3YPIA 1CB7B 3VNYA 1I45A 5LNRA 2FB3A 3QV6A 3Q94A 1E4LA 3QM3A 3CV1A 1G4EA 4B2DA 2NSOA 1ZLPA 5C71A 1GEQA 4BI6A 5G2WA 4R7JA 1OF6A 2WMKA 3S1UA 1JUKA 1TPFA 3W7MA 4IF2A 5ABTA 3WMSA 4W86A 4V1YA 3BAXA 2WXDM 3KBJA 3PTKA 4J1OA 1I2PA 1Q66A 4L9YA 4YVVA 1QI4A 3V1HA 2Y5EA 3W9ZA 1J11A 3V5OA 5E09A 1FH7A 1CTNA 2ALRA 3CGTA 2ZDRA 3PVFA 2BTMA 3OA3A 1OY0A 3BVJA 3C52A 4POCA 4QJ1A 2YA1A 4BZYA 5JH1A 2PLMA 2PE4A 4A3QA 4KESA 3GC2A 2PWVA 4XD6A 3IJ6A 1T96A 1LYXA 2VFHA 2AAAA 1VBUA 4PTVA 2PDXA 1UG6A 1YADA 4EVZA 1PEZA 5AN7A 1JD9A 3NQAA 1K1DA 1UWRA 1PE1A 1JQVA 4BS0A 4E8CA 1V79A 4HNTA 2HXUA 2Z7KA 2CZDA 3BSMA 4MB1A 1UIPA 4M7SA 3EWBX 3GHSA 4UOJA 1CXLA 2DZWA 1PDZA 3UYCA 4A8IA 2PCEA 3DFQA 4FX8A 1LRTA 1ZS2A 5IXEA 5LA1A 2V69A 3TX9A 3BMWA 3H2MA 5EY5A 4QJ4B 5CBBA 4GX8A 3E2VA 3PFRA 2W91A 3R58A 4ZR8A 4XD4A 2GQAA 2J62A 3DESA 4UTTC 2DVTA 1ECQA 1AH0A 1DJYA 1QPRA 4IX0A 1PKMA 1ME8A 5CSUA 3N3TA 2CEQA 3QV9A 1J9YA 3AXHA 1XSIA 1D7KA 2TRSA 3GC4A 5C0QA 5FI8A 3KVMA 4MDOA 3G24A 4PRRA 3Q45A 2XZ9A 1V02E 3N9RA 1L6WA 2R1KA 4JQ1A 3L67A 1WQ5A 2FHFA 4Z2KA 3ITTA 3M0MA 1B57A 2VDIA 3ANUA 4JHMA 2BHYA 3MMTA 3THAA 4PRTA 4F0SA 2Y85A 1W37A 1FDJA 4E4FA 2BGNE 5CG7A 4GQBA 2GYIA 3GNNA 2A3AA 3PZUA 4ZMGA 2GVJA 1XLFA 1UWTA 2F84A 3Q4DA 1CGYA 3KRSA 2BFGA 3T81A 2X2GA 3WF4A 1MNZA 4C5ZA 1LT7A 1ZBKA 4D8ZA 4RDVA 4Q6XA 3F4DA 2WM1A 3EWYA 1UWIA 4Q22A 2DORA 5KZMA 1XPYA 3AS3A 2WBKA 4CGTA 1J0HA 4H6KA 1RR2A 2QJIA 3N17A 3NL5A 1G67A 1TJ0A 3CT7A 3DGRA 3ZR5A 3FKRA 3PTQA 3U7BA 4MOZA 3GYCA 1VCVA 1BQCA 2OOGA 2Y7EA 3A47A 1I1WA 3AUOA 4X61A 1E3ZA 3A5FA 3G22A 1LBLA 5D05A 4LUTB 2WB5A 3B4YA 3RGTA 1V6XA 3EWZA 2GUBA 3AS2A 3T0TA 5I3IA 2Z0IA 3HGSA 2GK1A 4AD5A 3MHGA 1J12A 2D3LA 3WQ5A 3C56A 2PDWA 4IPLA 3R5EA 2HPIA 1W5OA 2FGZA 1Q7ZA 3G77A 2ZOXA 1Q2SA 2AL2B 1UASA 4MJ2A 5D03A 2ZX5A 3W2MA 3NG3A 4ZO9A 4E6MA 1U2YA 2DZSA 3A9IA 3SGUA 3SN0A 4C7FA 3WLHA 1TELA 3WELA 3C3UA 4UR8A 2HXTA 2WWDA 2F6XA 3LZ5A 1PUDA 1E15A 3GXIA 1MW3A 4D6GA 4M1BA 3FOKA 1TPEA 1SUXA 4ZFMA 4JTEA 4MJ4A 2WJFA 3FAXA 5IDZA 3WD0A 3W1PA 1EEXA 1SQ7A 4NASA 5AC5A 1KGWA 1FWIC 4DHGA 3VK5A 1DJNA 1W31A 4NT0A 4O0ZA 1FXQA 4PMYA 4H9YA 5D09A 4HD5A 1SZGA 3PZGA 2VZUA 2NXIA 1D3HA 2D20A 4FHAA 2XWDA 1VGAA 1ISZA 2YFNA 3CUJA 3CM4A 5IBXA 3WLPA 3BLEA 4HK5A 4L56A 3VGBA 3QY8A 3N29A 3NUKA 2CLMA 2H3BA 1RJQA 1W2PA 4LBUA 4LCQA 3V7PA 4KRZA 2QUMA 4IOTA 2P8BA 1UKTA 3GXDA 1OYBA 3MDUA 4I8YA 5CC5A 2W67A 2P3EA 2G95A 5I00A 2IMRA 2QZRA 3DZ1A 4P7OA 4IIEA 2NQHA 2V2HA 2QUVA 4WDXA 2GVLA 3IWPA 3MQTA 3BAWA 4H6QA 2WSYA 2OR2A 4GMEA 3A6OA 1RSCA 4I7WA 2WOQA 3C4UA 3UWWA 3S83A 1UBPC 4LUJA 4U2ZA 3N14A 2HNHA 3TA6A 4ZENA 1CXFA 1G6CA 4Q6JA 4GUIA 2PCQA 5I2UA 1JPKA 3RPDA 3RMEA 3U6WA 4FMVA 5KETA 4WCJA 1GPFA 2Q8XA 4JN6A 3VMNA 2NV1A 1GW1A 2E8YA 3G1DA 1FH9A 3BAJA 2BY3A 2CZ5A 3GVQA 4C6EA 1XLAA 7XIMA 1UC4A 3IJIA 3UXAA 2JKPA 4GQGA 3D6NA 3TMLA 4PMVA 9RUBA 4HIBA 4B5TA 1BG9A 4KIEA 4X3ZA 1JAKA 2XINA 5FSDC 5CAHA 2GJXA 3TJXA 5CEWA 3PWGA 4PH6A 4IIGA 5AHLA 1PL9A 1NDVA 2PDJA 1MQPA 4DZAA 1OIFA 5FSEC 3KE0A 1LQAA 4AD3A 4MGGA 3ZWSA 1TPVA 4WGXA 3W7HA 3FJ4A 2OWWA 2ATSA 5FA5A 4F0HA 1ZP4A 5EBUA 3T2QA 1R47A 4L6DA 2FZDA 5CQ1A 1PWMA 3VTRA 2ADAA 5H91A 2DSZA 2VD8A 3CIVA 3TYZA 1PB0A 2GOKA 2BXZA 1MO0A 4HK7A 3GUWA 4UTJA 3AI0A 2QIIA 4OJYA 4EANA 4IFKB 3D3FA 4CQ8A 4MKNA 4FZIA 3RLVA 4FR1A 2O4QA 2YSWA 4YCOA 1JR1A 4NUWA 3BW4A 1H50A 4AMCA 1G4PA 5LNWA 5AHIA 2INFA 2CCRA 4Z2HA 3STFA 3P14A 4UTWA 1XIGA 3GH5A 1WCGA 3BDKA 3S8HA 3LCGA 4XZLX 1NU5A 4L4PA 3UWQA 5IRPA 2IQDA 4PCSA 1PTAA 2C1HA 2Z6IA 1ZHAA 2E3ZA 2QMKA 3WK2A 3P3BA 1E1FA 2OLHA 1EXBA 4L4OA 2CHRA 3QMTA 1H09A 1BRLB 5JBFA 1UD8A 4LVGA 3CUGA 3FEQA 5CBIA 4QG9A 1LOLA 1ADDA 2YCLB 2EG7A 2ZUMA 1IEWA 2YW4A 4FNTA 1FCUA 2Z1SA 3DBNA 4AZIA 2EKGA 1AH4A 3KP0A 4Z0JA 1H3GA 2GFTA 2DW6A 3MY9A 4KRUA 1LORA 1BF6A 3B8UA 2NQJA 4H04A 2R82A 3QXBA 3HIJA 3EB2A 2GSHA 1JPDX 4KWOA 2WZTA 4JFVA 5HR6A 1OX6A 5AZ0A 1B90A 2FPYA 3TE9A 3C8NA 3KOZA 3D5HA 4LSBA 1LOQA 1K8ZA 1S5VA 2OSYA 5KMYA 1JGIA 4ZQMA 2VVNA 4WUIA 2CW6A 3TW6A 3VE7A 4IJRA 1RD6A 4XUGA 1GG1A 2L5HA 4GBUA 4J7RA 3WNLA 3TP4A 3THUA 1B1YA 1RA5A 3WEOA 1WV2A 1Y7VA 4F9JA 8XIAA 4M19A 5AOUA 3MBFA 2J88A 4KCVA 1U1JA 1GYLA 5I0DA 1E6RA 4W7WA 6ALDA 1ZENA 5B7ZA 1TV4A 3BTNA 3T0DA 4AZBA 2RFGA 4JY9A 3POCA 4DXXA 1ZTVA 3ABZA 1TWZA 3NYDA 1O5XA 1TUXA 3MCNA 4CCDA 3OVGA 4G7EB 4PMUA 5DRIA 4FNSA 3EWWA 5D8WA 1MW0A 3LV6A 3SQLA 1UCWA 4EK7A 2ZZ1A 3LHVA 4GPNA 4UUIA 1V4YA 3LLFA 1H5YA 4PC8A 4HA3A 2HVMA 4DF2A 4MUPA 1K70A 3EZ4A 4YU1A 2QCFA 2VFGA 2NV2A 3VIPA 2CXGA 2J27A 1Z8AA 2VX6A 5LYRA 2I5QA 1JRBA 2YL9A 1XRVA 5I24A 2GVYA 2E9BA 3DYPA 3ZIZA 4LCSA 4IHCA 3EMZA 3CASA 3A9BA 3UR2A 1CEOA 4P7NA 3WMBA 3VX0A 1U1HA 3FX4A 3MV01 1Z69A 3LXAA 3F4WA 5D33A 4PUEA 3W86A 1YXYA 3P80A 3GDMA 2XM2A 3PBWA 4AISA 3RG6A 4B2DD 4JTDA 1V77A 3OA5A 4EXQA 3NZGA 2C3ZA 4H41A 2Y6ZA 3N15A 3ZZ1A 5HJXA 5FJOA 2WHLA 1TV2A 4ACYA 1MVYA 3OHMB 1QW9A 1KM4A 1JZ2A 4AZ6A 4FXSA 2VD9A 1VBRA 3PZIA 4DWSA 1KFEA 4EAMA 3ARWA 1FWFC 3S47A 1NH6A 2RDUA 3UGVA 4PB5A 4CCZA 4JGDA 1WZMA 2J78A 3NZ1A 1L2UA 4QEEA 4Y9AA 2FGLA 3VX1A 1B3ZA 3ECQA 3LDVA 1RJPA 2NSXA 3WH7A 3WENA 3W1RA 4QE4A 1Q6DA 3BANA 1Q4NX 1DJWA 2CFFA 4RPQA 1WE5A 4JX4A 4IMGA 3TC6A 3OGSA 1L9WA 4GE8A 3QZ6A 3U3HA 4C6KA 3BV7A 4PB3A 2GWNA 3AROA 3LHTA 4DXKA 3TLQA 1XLGA 2NT0A 4C6LA 4KKXA 4YVXA 5EBAA 5C9UA 1DJIA 3GB6A 3M0JA 2EPLX 4Z2LA 4AC1X 2I9UA 3AXXA 1OX5A 2DP3A 3LGEA 4UMCA 1FHDA 1XIDA 2OFJA 1YXCA 1GONA 3UY7A 3N6HA 4RW3A 1QT1A 3H26A 3GTFA 1O95A 5CSRA 5CZJA 4D8LA 3IRSA 4O18A 2HCVA 3ABOA 5I77A 3R0UA 3FKKA 1KBIA 1ME9A 4EIVA 3VC5A 4O54A 3UJ2A 3VKAA 3C0LA 4DAFA 1KR0A 3E74A 3KCOA 3TW7A 1AZ1A 4NHVA 2TSYA 1QK0A 1EHAA 3NQBA 3N25A 2VXNA 1IXQA 4WGHA 5E9XA 4KW2A 3WLOA 1JQXA 3QY6A 3DI1A 4EXBA 2Z2UA 1UQZA 4I9AA 1P1MA 3M9YA 3FA5A 4UQDA 3P0XA 4S1FA 1R2TA 4DO4A 4K3ZA 1GVRA 2WC3A 4GUJA 3TDFA 4ENLA 1E9IA 3TFXA 3GNPA 1WDRA 1ADSA 2PGWA 1H7OA 1ITUA 1KXQA 3UCQA 4DF0A 5LA0A 4HMDA 1QAPA 1X8CA 2GK1B 1QFEA 2ZADA 1RD5A 3S6DA 4UFLA 4P5UA 1HJQA 3TEVA 1WDQA 2JIEA 4OFCA 5HMEA 1WBHA 4V2XA 1NWTA 3U9IA 1TVNA 4RE0A 3LCHA 5EMUA 1P0NA 1MEHA 2RAGA 2B4GA 4WSHA 1JNDA 3GXMA 3R6IA 4UR7A 1VFOA 2NLIA 2Z1VA 1LM1A 5BWFA 4Y8EA 3QKEA 3VKKA 5DQPA 3EOUA 2Z2BA 4BF7A 2WYSA 1W1B1 2HJPA 4LH8A 1XS2A 1Q6LA 1KXTA 4BQ3A 2R14A 1TRIA 3BW2A 1ALDA 1QO2A 4CN4A 1HL9A 1LLOA 2JK2A 2ABBA 5KTLA 3AJ7A 4O0KA 1X96A 1ZU8A 4IWWA 1E71M 3VPLA 4GGHA 5T26A 1NQKA 4HVXA 3LOTA 3M7WA 1TWIA 5FD0A 2ZXBA 1YPFA 3CV2A 3N13A 4ASTA 1YTDA 3O63A 2VRQA 3LBCA 4FNRA 4HZ8A 4HOXA 3L23A 3EX1A 2PURA 3LY0A 1Q8AA 2JGQA 1O7AA 2G3IA 3CBWA 4OECA 5AYZA 1OFRA 3GDTA 3GFYA 2WWCA 2GGIA 4O4VA 1A5MC 1UD3A 3SCPA 2DZUA 4PUNA 4WLCA 4HPNA 1TTPA 3A3HA 1KWGA 2BOFX 2PMQA 4HT3A 3SCTA 3SUVA 4OV4A 2VFEA 4B5WA 3SR7A 1KA9F 4XWUA 3MI6A 3MZ2A 1A50A 4O52A 5EFDA 4IL0A 3BAKA 3C8FA 3MSYA 2VR4A 4QM1A 2X16A 4AVFA 5BWAA 4Z1YA 4OT7A 2X30A 3S5YA 2WZIA 3ZWTA 1W9DM 3VMOA 1SMDA 1OD8A 5CPTA 2QF8A 2PP0A 4DI8A 1LTDA 4DNHA 3P5YA 3EX4A 1ZL1A 5DBUA 3IV8A 2ASHA 3TC7A 1TCMA 3CAWA 2E25A 4CD6A 1E72M 1H41A 1FWDC 1GQJA 3AXKA 3LK6A 2NVDA 3GHRA 2O7SA 2VZSA 3VGDA 1YMYA 1ZQ5A 1VD6A 1V0MA 5HNNA 1TMHA 1GT8A 1W9VA 4ZB5A 3WJYA 3IARA 3MUIA 1LWJA 1TKKA 2UY3A 1JFXA 1EX5A 2POZA 3S2CA 1R86A 2DZPA 2ZXAA 3TNOA 3BG9A 3C2RA 3W82A 2GJLA 5EA9A 3W26A 4C5YA 4IGHA 4Z2GA 3K1DA 1PS9A 3TYCA 3HGOA 4JAWA 3DFHA 3QOKA 4A8LA 3L0NA 1IZJA 3NGJA 2QIWA 1WKFA 3QQWA 4C1LA 1RQBA 4MY8A 2PP3A 3WN6A 1WX0A 1XBYA 3TJIA 1VCFA 1XR2A 3SURA 3MI3A 3UPWA 1GVSA 3NCOA 1K03A 3ZR4A 1JJKA 1K8YA 4P8XA 2F2KA 1NWRA 1XYZA 3ARXA 3R2GA 2V5LA 3SRKA 3CHEA 1FDYA 1EO5A 1REQB 1W0MA 4LVAA 4P7QA 1JDDA 3EKLA 2WLZA 1V3HA 2IS7A 4EWJA 5LIUX 3HB9A 3WQPA 3WUGA 4F2TA 3D3AA 8TIMA 2P0IA 2NV9A 5K4ZA 1JULA 2DGAA 4IZGA 4WR3A 1HGWA 3RO6A 3IAPA 2QAPA 3S46A 4PUDA 3KXQA 4L9ZA 4B91A 1K3UA 3G3DA 3W7OA 3HM7A 1RP8A 3LQGA 1KLZA 3T0BA 1ISXA 5HNRA 2D1ZA 1KFWA 3T08A 3DERA 2E9LA 4S3GA 5D2WA 3FA4A 1V6VA 1YLVA 3PAJA 1NDZA 4ICCX 3NXLA 1JL8A 3RRXA 4YTSA 5CPLA 1UD4A 1NP2A 1FFRA 2OO0A 5JQ9A 1BVZA 2NVAA 3OJGA 1FWBC 5A94A 4JKMA 1IEIA 3M4HA 1IE7C 3A5VA 3EOSA 3APTA 1NP0A 1GUVA 3RXZA 1KM1A 5G1YA 1NQ6A 3ZR6A 3CYVA 4MYAA 3FYOA 4UTWC 3BSGA 3PUDA 1Z6KA 2YW3A 3QC3A 4OHQA 3EWXA 3V35A 4QCEA 2FMNA 1UC5A 1ONWA 3W85A 1VC4A 3B3DA 4IT1A 4TV6A 5GJMA 3COTA 4GZEA 1FWCC 2QCHA 3QH2A 1OX4A 1SJBA 2PLJA 3H23A 3VNMA 4G56A 4IPIA 3GYEA 4ORMA 1CGXA 1QBAA 3WLNA 1LDCA 3WFZA 4CU7A 2XUCA 1JD7A 2QPXA 3HV9A 4DO6A 2QR6A 2HDJA 1EF3A 4ZE4A 4WKFA 1I0DA 2AGKA 1I2QA 2J8GA 4QE5A 3WL0A 2QCMA 4F8XA 1A5KC 3BOLA 1SM9A 3RM8A 3B0UX 2IPFA 4MKSA 2XH7A 3IK2A 1DV7A 4QDMA 2C79A 3SY8A 4IGSA 4PULA 4EKJA 3QSTA 4XVDA 3GR4A 5I3KA 1VRDA 2C7FA 4TX8A 4C6OA 2QF7A 3A12A 3B8SA 4YWSA 2YBUA 4YVPA 1XRFA 1BEUA 1V3IA 3NOEA 2VENA 5DCEA 1HQTA 4AIUA 2XN0A 3PAOA 1E4IA 4JDYA 4J3XA 3L12A 1MUMA 5DN1A 2BVTA 2HEJA 3KBVA 4KFOA 2YCEA 3ARPA 2VC9A 1H63A 3AZRA 5KITA 4ATLA 5GJNA 1VEPA 1R7AA 1ZNNA 2WJEA 1XCFA 3HPFA 4DYKA 5D2YA 4ADTA 3SECA 1DJHA 1CWYA 3EPMA 4UOQA 3VI2A 3PF3A 4WZHA 4F66A 4Z1CA 2KZHA 4LAOA 2ZRWA 3FDKA 3EKZA 1BYCA 1UZ4A 4CQ9A 3SRDA 3B9OA 3GAKA 3GDKA 3UXDA 2OVLA 3BGJA 1W2VA 1TIMA 3B8VA 1J96A 1AD1A 4M51A 4ZQNA 4XK2A 1O1HA 1JYXA 3LCFA 2V3EA 3L4XA 3CAVA 2IW0A 5FEXA 1SFJA 4AHQA 4K2SA 3O15A 5PTDA 3RRAA 1TJ2A 4REQB 4JL1A 1HT6A 3S5NA 4DAIA 3GVVA 1OF8A 1G5AA 1C29A 4N4PA 1V3JA 5MHBA 1E4NA 4N9BA 3C3NA 3CQ0A 5JIWA 1W1A1 3THDA 3CUIA 1SMAA 3R0DA 5A8OA 3C86A 3LTSA 2EBNA 3H7VA 5C54A 2PWGA 3BMVA 5CJ5A 3N3MA 2EQDA 1G01A 1KKOA 1JIBA 4WJXA 3AMLA 1IWPA 1GCYA 3E0IA 1QW7A 2PDKA 4NXSA 2ESCA 2Z29A 1BXNA 1NELA 3PR2A 3OGRA 3W02A 1J10A 1VFSA 3W01A 4QAIA 3OHIA 4TUFA 3OZOA 2PLCA 3QVQA 3JW7A 4MSSA 1FHLA 4GC3A 5CC7A 2Y88A 1IQ8A 5G5IA 4IH3A 9CGTA 1YNQA 2VC6A 3L4TA 3DG3A 5HATA 2QVHA 5U4NA 4HK6A 4HNCA 1BWVA 4NP7A 1OEPA 2FZNA 3HGRA 4E4PA 2VCAA 1HVXA 1RK6A 1WXZA 1VFMA 3VA8A 4UTHA 3OU8A 5TF0A 4IQLA 4KPLA 3VGGA 3AAMA 2QV5A 1E1CA 2CZEA 3L4UA 4KWVA 1H51A 3H7UA 3HG2A 4PSRA 3LM3A 4D6DA 1WZLA 2CU0A 4XBKA 4XV0A 3W7CA 4IXXA 3CS2A 1XX1A 2EXOA 3BSHA 4A2RA 4EAYA 2C71A 4QS6A 2G4JA 2Y24A 1M7JA 3CTTA 3P0WA 3ORWA 1F74A 3EGJA 4PMJA 4H7VA 3W53A 1MRQA 4GOAA 3W1UA 2NQ5A 3RX3A 2GOUA 3W87A 4J3TA 1A0CA 1GKQA 2ZTKA 4JHZA 3L21A 4DBEA 4HZ7A 2H3DA 3NEHA 4HNNA 1KCLA 1XIMA 5AY7A 4PCPA 4QSHA 2Z2AA 1RALA 4GY7A 3C2FA 4EPKA 3VM7A 3OBEA 1QPNA 5F1UA 1JAEA 1AK5A 3WF3A 4S3CA 3WK3A 3UZXA 4R9OA 3UZJA 2E5CA 5EMMA 3BOXA 3TN4A 2UY2A 3B97A 1RA0A 3GG7A 4R3UA 2AOSA 3M44A 3CNYA 3H6OA 1ZCOA 3N04A 3WMLA 1FHVA 4GACA 4CN1A 3N2TA 3LPFA 5CJNA 1CIUA 1GOIA 2AAMA 3TN5A 1QHZA 1V08A 3PS7A 4NI3A 4N4QA 3LLDA 1F2JA 1ONEA 3QV7A 3JR2A 3S0CA 3I6RA 4H83A 2CWXA 3A3WA 1BXCA 2QKFA 1BG4A 4DZHA 1PCKA 2IXUA 2ZUSA 2NQ9A 1GK8A 2XSAA 2XH4A 5G1TA 4US6A 5HULA 3T4WA 4A3YA 1TJRA 5I3FA 1G4SA 4QITA 3KOYA 4LYQA 3K8KA 1EYWA 3QHOA 2YDRA 2WQPA 3LCIA 1HJSA 2X0SA 4W88A 1THFD 5TBOA 3LX9A 4LYPA 3URAA 2I56A 3E5BA 4L6OA 4XZBA 1W5NA 4O13A 1QW8A 2C0AA 2X7VA 4KEMA 4NJHA 5BNKA 3G6MA 1PIFA 1EJXC 4ES4A 1W1VA 1XHGA 1OK6A 3W7EA 2I14A 5HJLA 5XIAA 3W7GA 3VIIA 2PTYA 4Q4SA 4PB4A 3P6LA 5LKYA 3W28A 3SY1A 3V36A 3BARA 5JXQA 4DBDA 2XSBA 3ZXWA 2CKSA 3W1NA 1H62A 2V5CA 3DU0A 3AHYA 3CIWA 4UC5A 4YHEA 1OYAA 5IHSA 4DIAA 1BLIA 4P7RA 5KZ6A 3T0AA 1W32A 1EIBA 1HKKA 4AD4A 4XAGA 5AYXA 3RILA 2VC5A 3JZUA 1JCMP 3SUWA 1K8CA 4E8DA 2PDMA 1UKQA 3B03A 3RDKA 3EDEA 4MYXA 3KHJA 5K9DA 3NDOA 1UP2A 4PL2A 3MPGA 3VM5A 1PVNA 3B8TA 4MZ1A 2YB4A 3NQ8A 1JI2A 3EB4A 2G4FA 2FPTA 2HK1A 2QJHA 1Q6FA 4JNYA 1R7OA 1Z32X 3TN6A 4GG9A 1OCNA 2ISWA 2KAUC 4V15A 4DN1A 1EHNA 1SZFA 5HQEA 4DWDA 1WB0A 4LBRA 4AWUA 1WBJA 2ACQA 4RJEA 1XCXA 3ES8A 6REQA 4JYEA 3K8LA 1W3LA 4ZE5A 2NWSA 2V67A 4JTFA 1LQ0A 3W4RA 4XO6A 4UTIA 2ISSA 1IT7A 3WQVA 4NAEA 1TE1A 4DX3A 7A3HA 3WX7A 4QR6A 1J79A 1LWIA 2G41A 1K6WA 4GJ1A 2XGIA 1KM3A 2GGEA 1UR8A 2D69A 3VFCA 1IXNA 1XYAA 3WSUA 3ANVA 4C7DA 2VEGA 2YL8A 4ECLA 2ZVIA 5D9NA 5DCDA 3F2DA 3QBUA 1M41A 1TPH1 2D2HA 4WXYA 1WKYA 2PWUA 3NQ7A 2YOCA 3F5LA 1XLMA 3S4TA 1IGSA 3W72A 3PZMA 3B0VC 1BYBA 2EPHA 1LJYA 1P6CA 1VJSA 3U5YA 2X09A 1DBTA 3W3OA 4TTGA 1YX1A 3RN6A 5JVLA 4ZGYA 2ZQ0A 1SGJA 4D1JA 5BOEA 1FXPA 1TX2A 2ZRVA 4CCCA 5AYBA 3G1VA 3FEMA 3W2LA 3WK1A 3M0ZA 4KWSA 1HW6A 2WVUA 5FIPA 2J7EA 4MJMA 4BFAA 2BNJA 3NSNA 4GCAA 4NRSA 1EOKA 5AYYA 4QS5A 1TX0A 5HWJA 1A4MA 3NFUA 4D6CA 4JFUA 3GW3A 2J9ZA 1K4HA 3VZYA 3REQB 2QUNA 1H61A 1XINA 3LLXA 1X6UA 4HU8A 2WV8A 3GTIA 1KXVA 2OOFA 5JH2A 2PRMA 3G5EA 1GQNA 2JIWA 5MKGB 2YLAA 2J6XA 1B3WA 3TK7A 3PBMA 3FVDA 4GYPC 2GLKA 2YL6A 3DX5A 3P2VA 4GY1A 3R8GA 3GFXA 1CXIA 3ABRA 4PMDA 1KB3A 3PZOA 4W5UA 4JPGA 1DOSA 3BGGA 4KFPA 2V2DA 1IWBA 5AVNA 4XD3A 1U22A 5A6KA 3BWWA 4HTYA 3S5ZA 4X22A 1T7LA 3UQNA 1OGSA 4PL1A 5I02A 2Q02A 3S42A 1OYCA 1PIIA 4FOKA 1W1TA 2X42A 3M0KA 3IJ9A 1WKEA 2CBUA 3TYUA 2BSLA 1E0UA 3T8QA 3ZVHB 4LNCA 3KBWA 1PZ1A 2EPKX 3HTWA 3PBVA 2Y5JA 1R0MA 1J01A 3I3DA 4FSAA 1JZ6A 5IM51 4HMEA 5FACA 3LHUA 2J7HA 2ZBTA 4LS0A 4W8LA 5E93A 3DFYA 2QXWA 3DG6A 1TWWA 3UU0A 2PFHA 4C65A 1QRQA 1VP5A 1YDOA 3MUXA 4PFHA 3UY8A 1XRTA 2PDYA 4XAFA 3A4AA 3L4ZA 3HQOA 3AHTA 4JS3A 2PZNA 1JCNA 3BLPX 4H8HA 3WNKA 2Z25A 3PPFA 4B90A 4J3UA 3AU6A 3UWEA 2HS8A 3BJSA 4CD7A 4U2YA 3AIWA 4FXJA 2ZUUA 1EP2A 3LRMA 3SBFA 5CC6A 4HN4A 2QW5A 5CZ0A 4N7QA 1CECA 1JF5A 3S5SA 1EYEA 1FP9A 2OEMA 3OEXA 5I06A 3LCWA 2VDHA 3V4BA 1A5CA 4JHOA 4PTMA 5IFPA 4Q4RA 1JGMA 4FXFA 3WUFA 4HPXA 4BKNA 1QBBA 4OGZA 5EPDA 2C6QA 2I5GA 1XC6A 4R34A 1YE4A 3L4WA 2GUYA 4NZ1A 1N8FA 2RGMA 3T2PA 1RH9A 4L80A 3W81A 3E0LA 1QI5A 3ZJKA 3ARUA 3QPZA 3CUXA 3KBSA 3OP2A 1RJRA 3NO1A 3CTLA 3GXTA 3W75A 4D6HA 2UBPC 1SR0A 1XI3A 1BSLA 1OWQA 4U3AA 5FEZA 5JBEA 4ZTYA 2HMCA 4XZIA 2IPGA 3QHMA 1Q6EA 4MZ8A 4EWND 3L0GA 1R3QA 2DIKA 2QDGA 4GVIA 2OZ8A 3R1ZA 3W37A 3L65A 5HDRA 3VGHA 4ILSA 3CQKA 4H9XA 3WLJA 6REQB 3E0WA 4JY8A 3NGFA 2YB1A 3MJMA 1XQKA 3H4XA 2CBJA 4DJDA 1CGTA 5CG0A 1F6YA 2PU1A 1WAWA 2QCCA 3DHFA 5CPSA 3WLTA 4HB7A 1QNVA 3O06A 5LNSA 4WDWA 5CGTA 4MY9A 1GOWA 2NXHA 1MUCA 3O7UA 2NQZA 2VQUA 4JTIA 3O6AA 2ZUWA 1J6PA 2ZICA 4IMDA 5CCZA 4CEXC 3CEUA 2A3EA 2XU2A 3NSMA 1R3VA 4S2BA 1FQ0A 3PM6A 5HANA 4EX4A 3CQJA 1DVJA 4A6GA 1S38A 4Y90A 3UZ5A 3RX4A 1JDEA 3T55A 3E38A 4M81A 4KBXA 1CXHA 5F7UA 1CYGA 1YXDA 1MMFA 2W63A 1L6YA 1W1PA 1UR9A 1BSIA 1TE6A 4DI9A 3KFTA 3VAVA 2OWXA 1CGUA 1PTDA 4YN5A 3R25A 3MO4A 4PUKA 1HGYA 1A80A 2OTDA 1GOMA 4XTDA 4I7VA 1TA3A 4WEVX 2GWGA 3ONCA 1HXJA 3LM7A 5SWUA 1PYFA 3K4WA 1O6IA 1O68A 3MP3A 2WVSA 4FNPA 3FK4A 2V82A 1D9EA 5ENLA 2ZCGA 2PSNA 4ZB2A 4ICNA 5E0KA 2C1IA 2J7GA 5G2IA 4FEZA 1TMLA 1DJXA 4YYFA 1JZ4A 2ALDA 3PWAA 2I9EA 5I5RA 4ZXOA 2OQLA 3LB0A 3SJNA 3GNDA 1V3MA 3T7VA 2IPJA 3FJLA 4L9XA 4UNLA 4GUGA 3NPWA 1S46A 4YHGA 3ZOAA 2FDMA 3I7SA 4O8RA 2F38A 2XVPA 3AFBA 2UWFA 3ITYA 4S3JA 2X1RA 1S39A 3B4UA 4GINA 3LYEA 5F4WA 1Q6GA 3WUBA 4LALA 4AYGA 1OT2A 3KCJA 4MLJA 2E9MA 1J0IA 2QCEA 5HMSA 2X05A 4GISA 2RJHA 3PWIA 4RUBA 3TYAA 1UR4A 2HWGA 1JYVA 2FKPA 2PDCA 3NL2A 1TJPA 1TZ9A 3FV9A 5L9FA 3PNZA 4Q8OA 5DLCA 2E5BA 1XICA 2E6FA 3EOOA 3PSWA 4RX0A 1PZ0A 1RCXB 1LF1A 4CNOA 2OEJA 3UG8A 1Z7AA 1KWKA 1V0LA 1F07A 4LFYA 1C8VA 1JPMA 3I7QA 4E0CA 1YEYA 2D23A 1QNOA 1EPVA 1V3KA 4M80A 3OVRA 1GJUA 3GD6A 2V5JA 2VNCA 3KL5A 2VFFA 1B9BA 4IPJA 4IQDA 3I3EA 1FY6A 1TZZA 3OLGA 4O53A 4GH1A 2G0WA 2R1NA 3MS8A 1IF2A 3IVUA 3F4NA 2BHUA 2FTYA 1LP6A 3SUTA 2PDHA 1Y0EA 1US0A 3WEZA 1RLDA 1E0WA 2J9XA 3KTXA 5TIMA 5ECVA 1V0NA 3EWCA 3BW3A 4JTGA 4DBSA 4UTTA 4NYYA 3TNBA 4C6MA 4PCTA 4PR4A 1VS1A 1C93A 4AD2A 1DWGM 2GSEA 1HKVA 4RPPA 2BY2A 4FX7A 1RPXA 3FA3A 2ZZ4A 4XZMX 4GI4A 1RBAA 1CLXA 4INFA 3N12A 1RCOB 5LHEA 1K77A 1B9ZA 3WYZA 5BOFA 4F2BA 1FHUA 3U4AA 3TCSA 4HNVA 3NVDA 4QDWA 5HQMA 1QASA 1OG0A 4OBTA 3MP4A 2XGBA 3LHWA 4G1NA 1A3WA 4AUBA 5FJIA 3TQ0A 4GLEA 5REQB 3T05A 3DC8A 4QX4A 4IFRA 3DHUA 1UKSA 2BGQA 3SFWA 1DXFA 2EG8A 4LT9A 4I8DA 3EKGA 3MSRA 3WJSA 4GYFA 2QCDB 4YTTA 3G3MA 3R79A 2DPEA 4KH2A 1QWGA 1UWAA 3VNDA 2BP1A 4KWUA 2O9PA 1NVMA 2CYGA 5G4HC 4BK9A 1BQGA 4O0QA 2E6DA 3VNJA 4AC7C 3R12A 1W3IA 3GZ3A 2ZDSA 4ZFCA 3VNZA 2R1PA 3ARSA 4QHRA 5D38A 3GIQA 1EC8A 1Q8JA 3TU9A 4OIFA 1UZ1A 4QTGA 5C7HA 1JYWA 1ZCCA 3ITLA 2INEA 3AUJA 3SCOA 1FWSA 3H8AA 1WDDA 2HTMA 4QE1A 2AGTA 1XF0A 2J24A 2UZ9A 3IGSA 4AVNA 4LAZA 1JFHA 2W4XA 4M6PA 1ONXA 4MUZA 3DN5A 1DXEA 2ATMA 4OQVA 2VP8A 3QY7A 4O11A 3P7YA 4GNKB 4WJEA 5A6LA 3Q58A 4ACZA 4OOZA 3W7RA 2C1GA 3R89A 5A2BA 3UXIA 2OCZA 1KV5A 2ZA1A 4W85A 3FDGA 2XIBA 2REQB 7TIMA 5KEZA 4ADSA 4K7YA 4L1XA 4Z08A 4LCRA 4LY4A 4CLMA 4NF7A 1A4LA 5D2XA 2PF0A 1QR7A 4AEEA 3QGKC 2QAFA 1AL8A 3VIOA 3UJEA 1VRXA 3E6EA 4ORIA 3E02A 3NZPA 8A3HA 1X1NA 2OZTA 4JR5A 1P1XA 1ZAIA 1XW8A 2OT1A 4GI9A 4I9TA 4IG2A 4Q4PA 4I5UA 3T2OA 1LL6A 2XM1A 4JD4A 4JYDA 1WAUA 5MF5A 3TTYA 4JIQA 3UG4A 1E6NA 5GNXA 5GVJA 4JFSA 3JZEA 3RK8A 4AWSA 3FYYA 1QMLA 4B3LA 4GJJA 4UIOA 5AHFA 1VF8A 3ARVA 4AEFA 3TTEA 4E4UA 1ECEA 3W83A 4MLRA 3KUMA 2GGHA 4M6VA 3ZLGA 1XIFA 3GK0A 3GHTA 1R2RA 4O17A 2XFRA 3N2XA 2OODA 3LTYA 1E3XA 2BXYA 2F9RA 1QCWA 3BJTA 1IYXA 1QNRA 3NTYA 4GK8A 1DHPA 1VJIA 2E8ZA 2WJZA 3PUEA 4O1BA 4NZFA 1WZKA 5DFAA 2DJXA 2G5WA 3UWYA 2OLSA 1P0EA 4E2VA 1SO6A 4H9VA 4S3FA 1Z41A 4LF1A 1IEVA 2Q6ZA 1M7XA 1QOPA 3W24A 1F8IA 5C2XA 2BWGA 3IACA 3F5JA 3TOPA 2QULA 3MV11 4NZ3A 1RBLA 3ZSTA 2P10A 1GZGA 1EX1A 1DQWA 3GQYA 1QXLA 1VFTA 1J18A 4KETA 3WUEA 3W84A 2IKIA 4GQRA 3KRZA 4L4MA 1LBFA 1ISYA 4NG3A 3RU8X 3RHGA 4IG2B 4UB9A 3OG2A 4JX5A 1EJTC 2QJJA 1OG6A 1BPLB 1DEDA 3CHDA 6TIMA 1A47A 5LXEA 3IIVA 1PKYA 3FSTA 4XKYB 3WKZA 5A2AA 1YPIA 4NNBA 4DM1A 3B8WA 4AIEA 1E4MM 3WBWA 3JRKA 3N73A 3W1LA 3CUHA 3EXTA 2NVCA 5I7GA 2V68A 2MANA 1TCDA 5BXTA 5HBFA 3ZS4A 1ZPTA 2YYUA 5DXXA 1AVAA 2VX7A 5HUPA 5AZ1A 3WJXA 3W25A 4XIMA 3N2MA 2BV9A 2OGJA 3TUUA 5DMNA 4LUTA 3V75A 3HOJA 4Q8QA 1DWIM 5I3JA 3UA3A 3A4JA 1TRDA 4EE9A 3T1GA 1D8WA 1TPB1 2PLKA 3G0UA 4CU8A 2P76A 3WNPA 3EPNA 2WW5A 3ZM8A 2HRWA 3CZLA 3LU2A 1GG0A 3L4YA 3LTPA 3WD2A 1V02A 1P43A 4UNIA 1ELSA 3W6YA 4GWEA 5I23A 4A05A 4N02A 4ERIA 3AICA 4RNHA 3RJXA 3LZ3A 1FWNA 2CLFA 3KW3A 2EKCA 2PWHA 3OVPA 1QNQA 4A2SA 5HAOA 1ITQA 1UOZA 2YCKX 3EDDA 3NO3A 4TVCA 3NQDA 4OU1A 1JYNA 1RXOB 4LVDA 1Q6OA 1LZOA 4AG0A 3I65A 3OLDA 4HYRA 1OQFA 2ISVA 2UY4A 4R53A 4LNYA 1JCJA 5B7YA 2FMOA 1JG9A 2VKZG 4M5PA 1XYMA 1Q85A 4H8UA 6CGTA 1OB0A 1S2UA 3GBEA 5D32A 3AYRA 3QQ1A 2YZRA 1EZ2A 1RQHA 3CMFA 2W9MA 1A3HA 4ZODA 5JIPA 1V6WA 3KVJA 4LUIA 1V8EA 1HKJA 4KWWA 4DJEC 3M0VA 3RAOA 5AKQA 3KZPA 5GPRA 3P82A 3G0XA 5I03A 5I3DA 3LEPA 1FWRA 2PWFA 3FSUA 4WK9A 3MP5A 4HA1A 4HU4A 1U1UA 2FZ8A 1XDMA 2ZUNA 3MI2A 4BCEA 2CBVA 1ZJAA 4RKAA 2C16A 2KX9A 5FJJA 3NAVA 2Y89A 1H11A 2FVLA 2ZVRA 1EQPA 2D22A 1BD0A 4UQCA 4LAUA 3WLLA 1E0TA 3EWUA 1QWKA 2JGYA 1YRRA 4BQ5A 3AMGA 1M5WA 1S5NA 4GZ7A 2CERA 4FF5A 4LPCA 1T40A 1UUQA 3CJPA 2VOMA 4HPJA 1XWYA 3QZEA 1UKPA 2W5FA 3WD1A 1WDSA 3GBDA 1X98A 4H9UA 3GRIA 3V1PA 4KGLA 3LA4A 1Y5WA 3ALGA 1XXXA 4RE3A 1B4KA 3HJEA 1XD0A 4O15A 3VYLA 3BGAA 1PHQA 4B9ZA 1A5OC 6ENLA 5JUVA 2NQLA 2FDSA 1RK5A 1BVNP 2EF9A 4UFKA 1ZJBA 3GKFA 4PUWA 2WHJA 2CPUA 1VHNA 1O94A 1OABA 4TX9A 4Q7IA 3KL3A 1XLJA 4HSHA 2W6RA 1VBGA 1NAL1 4PGLA 1R9ZA 2OG9A 3KCLA 4J5NA 5EFFA 3W00A 1XLLA 1TMQA 2XPKA 4HZMA 5F2IA 2BS9A 3GG0A 5EGRA 3TMQA 4KS0A 2G3JA 4O1DA 4L5ZA 4BR1A 1OSEA 2H8ZA 2D3NA 1EIXA 1VZWA 1KFCA 2OYMA 4IMCA 4W8AA 3HQNA 2O9RA 3BZJA 4DUWA 2R91A 5KZDA 1O12A 3IGUA 3KDOA 1E1CB 3GC5A 2QJMA 1M68A 2VX5A 4J4KA 3T07A 1N8WA 3S1WA 1BAGA 3HO8A 1HX0A 1X6NA 3G1HA 4UZSA 3UZZA 1F05A 4W89A 2J66A 3UBPC 5D30A 5BXPA 1I2OA 4FK9A 4U33A 4WY0A 4TIMA 4KERA 1ZRQA 3NYZA 4DUOA 3PZTA 4BEUA 2FZBA 1G69A 3LHZA 3VIKA 5AECA 1U83A 4ML9A 3AHXA 3CQHA 3B9DA 3M7SA 4TR9A 2OQHA 2X8RA 3TWAA 3LERA 5G1MA 1QVBA 4Y7EA 1K9TA 4RDYA 3A13A 5D2VA 3W1QA 2Y1HA 1JPIA 1UUOA 2EGZA 4FPSA 1UD6A 2XSXA 3Q37A 1SR9A 4H7ZA 3WH9A 4X0VA 3KOXA 3E96A 3WNNA 5C2CA 2YLLA 1FKXA 4AZ7A 2DW7A 3IJDA 1VLIA 1XCWA 4BA0A 3KHDA 3TH6A 1AH3A 1J2BA 5REQA 1ISVA 2VI0A 2PBOA 3GUGA 1UH4A 4JNMA 4QG6A 1JPHA 1B3XA 3CYJA 1ZB5A 3PJXA 2CHOA 4KEVA 4RK8A 1ZBVA 5ABFB 1L8PA 4M0XA 6XIAA 3WQ8A 1B4EA 3A21A 3E2SA 4JCMA 1A5LC 4F40A 4DEFA 4PCNA 1T8XA 1X38A 1F7BA 3K2GA 3NZRA 3P67A 2O4MA 2FZ9A 2TODA 1FA2A 1S3TC 4CKQA 4WRHA 3NL3A 3VABA 2GZXA 5G4WA 3WL1A 1F76A 2CESA 3N6JA 5EU9A 4QJ5B 4ZO8A 1E6PA 1EXPA 1M1BA 1KLYA 2ZFAA 3FY1A 4HOZA 2X2YA 5E6ZA 3EDFA 2A5HA 4CQDA 2DV0A 1CGWA 3WDIA 3N4EA 1E6ZA 3WNMA 4UCGA 3TSMA 5LGXA 3F4CA 3U0HA 1S2WA 3TLLA 1FRBA 1VPQA 1IT0A 1JZ8A 3UZWA 3EXRA 1OGGA 5C55A 1EUAA 2AKZA 1E9ZB 2XVGA 4MF4A 4HSOA 2F61A 3UPBA 4JTRA 3WZ0E 2VC7A 3UESA 3BCDA 4C1NA 2XISA 3S2NA 5DXYA 3B8IA 3GIPA 3HURA 3WD4A 1E5NA 1HP5A 1K9EA 2A21A 4Y2WA 2EJ1A 4H00A 3QOMA 2X1TA 4LF2A 1Y8BA 2DUXA 2XG9A 5A1AA 1VIZA 2IXVA 2PWDA 1TG7A 2J13A 2WVVB 4HJWA 1QOQA 3CC1A 4B15A 3W6MA 2D0GA 1N8IA 4BHYA 4N2YA 4FR6A 1FCBA 1OC6A 3VKBA 1XBVA 2ACRA 2QPUA 4ZB0A 4JX6A 3N11A 2QJGA 3I7RA 4MWAD 4CNSA 1P4CA 1TV8A 4JTKA 3O6CA 3MMDA 1EC9A 1ICPA 1TV7A 3ITGA 2Y8VA 5BROA 1XSKA 7TAAA 3VOJA 1P7TB 2W0UA 3E2RA 1X7IA 1UD2A 1HKIA 1AZ2A 2PRHA 2PPGA 2XFYA 2WKLA 3CT2A 1VBHA 5AC7A 1PKLA 1U33A 3PULA 4L4LA 4AAJA