4I6KA

Crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
267
structure length
267
Chain Sequence
MNCIDTHAHVFSTQDHSIETARYAPDYEATVQSFISHLDEHNFTHGVLVQPSFLGTNNQAMLNAIQQYPDRLKGIAVVQHTTTFNELVNLKAQGIVGVRLNLFGLNLPALNTPDWQKFLRNVESLNWQVELHAPPKYLVQLLPQLNEYSFDVVIDHFGRVDPVKGIEDPDYQKFLSLLNVKQHWIKVSGFYRLGATPSNINIAQQAYNIFKEKGFLHKLIWGSDWPHTQHESLITYEDAIKAFKQIVFDKHEQCLILNQNPTELFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amidohydrolase family protein
publication title CRYSTAL STRUCTURE OF PROBABLE 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE (TARGET EFI-505029) FROM Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 100
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4i6kA00
1RK6A 4XAYA 1ITQA 1EJTC 1ONXA 2Q09A 4IFOA 4HK7A 4XD6A 4DLMA 2QS8A 3FDKA 2HBVA 2P50A 2Z28A 3PANA 5HMFA 3G77A 3DC8A 4BJHA 1S3TC 2XIOA 4DIAA 2VR2A 4EPEC 4C6EA 2ANUA 3N2CA 1V51A 1FWAC 3GTXA 3OU8A 5G4HC 4E3TA 4F0SA 4GX8A 4LAMA 1NDVA 4F0LA 1I0DA 1ADDA 4B92A 4C6FA 4XD3A 3O0FA 4PBEA 1FWIC 1A5NC 1RA0A 4WHBA 1XGEA 3CAKA 1PO9A 3TNBA 4C60A 3FDGA 1E9YB 3A3WA 4C6MA 4ICMA 2IMRA 4H9VA 1YRRA 3GG7A 4CNUA 4GZ7A 1FWGC 2HPIA 2Z00A 3MVIA 3QY7A 3AUOA 4H01A 2FFIA 4C5ZA 4LANA 1O12A 2ICSA 4BKNA 1M65A 1ZZMA 1FKWA 3SFWA 1VFLA 1FWDC 2PGRA 4PBFA 4EP8C 3HTWA 4QROA 4LEFA 4DYKA 3E0LA 3LGDA 4XD4A 1EJWC 2BGNE 3C86A 4AQLA 3FEQA 1UMLA 4C6OA 3IGHX 2VC7A 4GOAA 4OFCA 4KIRA 2Z7GA 3T1GA 4LAOA 4H00A 3UF9A 4H9YA 1E9ZB 3LGGA 5E5CA 3GIPA 1J79A 2R1NA 5LXXA 2VM8A 3K4WA 1WXYA 3OODA 4XAZA 3HM7A 3MDUA 1A5LC 3A3XA 3T8LA 1I0BA 4L6DA 3DUGA 3MKVA 2R1LA 4ERGA 3A4JA 3TN3A 4KEZA 4CNTA 2GZXA 3IJ6A 4HA0A 4YIWA 2RAGA 4QTGA 4KF1A 2D2HA 2FVKA 3E0FA 3LA4A 1GKPA 3CS2A 2PUZA 2UBPC 4LALA 2WJFA 2DVUA 4QS5A 1FWFC 2EG6A 1M7JA 2YZ5A 1EJRC 1KRMA 3D6NA 2AQOA 3ORWA 4NP7A 4GY7A 3LU2A 4KETA 1NFGA 1EJXC 2Y1HA 3HPAA 3RYSA 3K5XA 3EGJA 3UR2A 4CEXC 2Z27A 2HPMA 2YB1A 3UPMA 3GIQA 1K6WA 1EF2A 2CZVA 4DLFA 1GKRA 2PLMA 4R7WA 4C6JA 4IH3A 4NG3A 3URBA 2AMXA 3F4CA 2YB4A 1P6BA 4M51A 4RDVA 4PE8A 1FWEC 1RJQA 2ZC1A 4IGMA 1P1MA 4D8LA 3B40A 2OGJA 3EWCA 3MVTA 4R85A 3S2LA 1A5MC 1BF6A 4TQTA 1KRBC 4HJWA 3UR5A 4JOMA 3URQA 1YBQA 4MUPA 3RHGA 1ONWA 4C65A 1V77A 3IV8A 2D2GA 1KRCC 4I6KA 2EG7A 4LFYA 4KQNA 1HZYA 4CQDA 5HMDA 3RCMA 4XAFA 1NDWA 4ZSTA 1NDZA 3RN6A 3S2JA 3JZEA 4G7EB 2WJDA 3OQEA 3NEHA 5FSDC 4B90A 4R88A 3EWDA 4DI8A 4C6KA 1EJUC 4AC7C 4GX9A 1NDYA 4KERA 2KAUC 4IFKB 1GKQA 1EJVC 4C6PA 4DZHA 4RZBA 1IE7C 1W1IE 3GTFA 1R9YA 2Z26A 1XRFA 2GWNA 3ICJA 3MPGA 4IGNA 2Z2BA 3B0XA 1POKA 4LH8A 1J6PA 2Z4GA 3ISIX 2FVMA 4H9MA 4IG2B 4DO7A 4LCQA 3GTHA 1FWHC 2Z29A 2QPXA 3IACA 3O7UA 4J35A 4XAGA 3F2DA 3TN5A 3IRSA 5AKQA 4PCNA 4HK6A 1QXLA 2I5GA 1V4YA 2OQLA 3S4TA 3URAA 4GBDA 1A5OC 3GTIA 4DNMA 5A6TC 4H9ZA 3F2CA 1PTAA 2EG8A 2F6KA 2GSEA 2I9UA 3V7PA 3S2NA 1P6CA 4F0RA 5CH9A 1A4MA 1RJPA 3QGKC 4P5UA 1RJRA 1UIOA 4C6BA 3OOQA 3TN6A 2R1PA 3AU6A 2WJEA 2FTWA 4C5YA 3KM8A 2DVTA 4UBPC 2R1MA 1POJA 4QRNA 4PCPA 4H9XA 2OODA 4LCRA 2OB3A 3B0YA 1J5SA 3OJGA 4G7EA 4ERAA 3LNPA 4LCSA 3IARA 2QVNA 4V1XA 3F2BA 2DVXA 3GU9A 3PNZA 4C6IA 3MSRA 3WZ0E 4RDYA 3LS9A 1FWJC 1RAKA 1UBPC 4C6NA 1FWBC 1EYWA 4LAKA 4IFKA 1RK5A 2G3FA 1FKXA 3NURA 4V1YA 3WYZA 4KESA 4B3ZA 1KCXA 2HNHA 1WXZA 3IPWA 4ERIA 4DZIA 4H9TA 3PAOA 1A5KC 2GWGA 3CJPA 2A3LA 2AQVA 1PB0A 1R9ZA 3GUWA 2OOFA 1ITUA 4I6VA 4UB9A 3AU2A 2ADAA 4CEUC 2FTYA 4RDZA 2GOKA 1UIPA 4INFA 1PSCA 3F4DA 3QY6A 4CQCA 3LY0A 2R1KA 5HMEA 4C6LA 4IG2A 2PAJA 1EZ2A 4L9XA 4GC3A 4CQBA 4Z42C 1J6OA 4KEUA 4NI8A 4RDWA 4EPDC 3S2MA 2QT3A 4QSFA 4IQJA 3LSBA 2E1WA 1JGMA 2P53A 4CNSA 4B91A 2VUNA 1XWYA 4G2DA 1V7AA 4HK5A 4C6CA 4EPBC 3MJMA 2Q01A 4BY3A 3NQBA 2D2JA 3K2GA 3E74A 1YNYA 3E2VA 4IF2A 4KEVA 2Z24A 3MDWA 1M68A 3E3HA 1QW7A 2BB0A 3BE7A 4GXWA 1R9XA 2PGFA 1EJSC 2VC5A 1XRTA 3ITCA 3TN4A 3URNA 2HBXA 3QGAC 1YIXA 2VHLA 5FSEC 3WMLA 1K1DA 3E38A 4C6QA 4ZSUA 4H9UA 2O4MA 4WVXA 1KRAC 4GY0A 3OVGA 3DCPA 2E25A 4GY1A 4J2MA 3GU2A 3QY8A 1RA5A 3PNUA 4GK8A 1DPMA 4XD5A 3T81A 4RE0A 1O5RA 1YMYA 1A4LA 3PBMA 4QS6A 3GRIA 2UZ9A 2O4QA 3SO7A 4DI9A 1V79A 1YBQB 4GYFA 4IFRA 2YXOA 2HQAA 3UBPC 4EPKA 1K70A 3R0DA 2Z2AA 2W9MA 4J5NA 3MTWA 4C6DA 1FWCC 2WM1A 3GU1A 2Z25A 3ID7A 4WGXA 3LSCA
chains in the Genus database with same CATH superfamily
3QSTA 2JIEA 4GYJA 1BKHA 3IEBA 4WEVX 4KPLA 1F76A 5DBUA 2QS8A 3MUAA 4JBRA 4V28A 4K39A 4OV4A 4HNCA 1UZHA 3NL3A 5E0CA 3AXXA 3ECQA 3IUIA 1XICA 4W5UA 3LMZA 4M81A 4Z08A 1EGVA 4LAMA 1P0DA 4OWGA 1BVNP 5C9ZA 2RDXA 1ADDA 3WD0A 3VUPA 3O0FA 3XINA 3UZXA 4NRRA 2O9OA 4LBUA 4O16A 5FJOA 1B3VA 5C6MA 3GVRA 1G7VA 1AQ0A 1PX3A 4X61A 2ZRZA 2GUUA 2QF7A 4DM1A 1EBGA 4JQ1A 3VNJA 4O13A 3DGRA 3NPXA 4XVEA 4Y90A 1Q6DA 2E3ZA 1J0ZA 4CD5A 4XZHA 1H60A 3QY7A 1GVRA 2FFIA 5L6UA 2Z1SA 4L6OA 4Q8WA 6ENLA 2BXZA 2WVVB 3CQ0A 4KW2A 1AQHA 3PN8A 4RL3A 4FX8A 5LIXX 3WMBA 2ABAA 3QKEA 3GK0A 1QVBA 2CLPA 1KWGA 2PTWA 1Q6LA 3N18A 3L0KA 6REQA 1Q2RA 3AHYA 1KKOA 3B0VC 2Z7GA 5CG7A 4Q22A 3GIYA 3BGGA 3W2UA 3WNPA 2XIMA 1V0NA 1L9WA 3RLUA 1RR2A 1RVGA 1T0OA 3HM7A 5BXSA 3LHUA 3S5SA 3MKVA 2Y8VA 3GR7A 3M0YA 2X40A 5C71A 2VQUA 4CN4A 2ZE0A 3OB8A 1B4EA 1MUWA 3VKDA 3TFCA 2HJPA 1FHVA 4FB7A 3GX9A 3GWQA 2IUZA 4GUJA 5FF0A 1E72M 3Q37A 4LYRA 3CS2A 4LALA 1E6PA 2EG6A 2I5QA 3WELA 1M7JA 1OB0A 3UYCA 1IXNA 1XLBA 2XSBA 1L8NA 2NVAA 2GL5A 3BSHA 2EPKX 4O1FA 3RLVA 4A8IA 1EJXC 2O0TA 3TZNA 3MI3A 1OQFA 1SPQA 3TYAA 4ZQRA 3QBUA 4M1RA 1YNPA 1WA3A 1ADOA 3AS0A 3GE7A 4PUUA 1ISYA 3LOTA 4N6FA 3MP4A 6XIMA 1MZRA 3I3EA 1X6LA 4NL1A 5I3IA 2BY0A 4BS0A 3G1XA 2J7HA 1LORA 3ITYA 2D22A 2I16A 4JDYA 2CITA 3GXFA 1X98A 2NUWA 3SSZA 1F8MA 3SCTA 2JKEA 3CL7A 3VIFA 3VM7A 1S2VA 5CC3A 3M5VA 1QPQA 3HG3A 4Q8MA 4EWND 1I2PA 2C18A 3EMZA 3DENA 4HJFA 4PMRA 1TV2A 3D47A 4KCVA 3VX1A 4W93A 2GYIA 3E5BA 3ZQ9A 1TPDA 4WKFA 2NQZA 2H3BA 3GAKA 4HN4A 3FOKA 3HU7A 2QJHA 5BXRA 3AXIA 3PS7A 1P6WA 1UD3A 4MPQA 4CKQA 5ECVA 1PIFA 1QPOA 5T91A 1VAHA 1S2CA 3VDBA 3IAQA 5FOOA 4Y8EA 3LHZA 3ZOAA 1DJQA 2VT0A 1C8VA 1Q3NA 4PUMA 4XAGA 4JQ2A 3RILA 4CD7A 2PRHA 4JQ4A 3IRSA 5D38A 3I7QA 4HK6A 3T2PA 4QJ1A 4GFSA 4HPNA 3WBAA 3IWPA 1I45A 2D69A 3M6YA 3WDQA 4HMEA 4RNFA 2EGZA 2Y7DA 1PTAA 4L4PA 2I9UA 1H7PA 4F0RA 5CH9A 1VB9A 4EAMA 3WDRA 2AAMA 2YOCA 2WZIA 4UOQA 5BWAA 4XKYA 5JIWA 2NWSA 1XBVA 2VGGA 1KFJA 1AL8A 2XFFA 3WL1A 4FNUA 4G6CA 3CUIA 3CPGA 1EIXA 3ZR6A 1BD0A 5FL1A 1XISA 4N0RA 1T5AA 1BRLB 4RDYA 4W7UA 1FWJC 1UBPC 4Q7IA 2XVNA 2BOFX 2CBIA 1V3MA 4X3ZA 2ZX8A 1N8IA 1XQLA 3FYPA 1W3LA 4OHQA 3CJPA 4UIOA 4A8RA 4YCOA 3B06A 2VGBA 3WEOA 5CSSA 3KBSA 1TWSA 2R1KA 3DKJA 4TOQA 5AC4A 2HEJA 3OO2A 3TVAA 4PRRA 4N02A 3BAJA 3W84A 2OKTA 3BAYA 3QR3A 2X09A 3GVGA 3TIMA 4D6FA 1NFPA 1HL2A 2HROA 3N6JA 1GWJA 2QGHA 3UR7A 1JZ4A 3N4FA 4JFUA 4O1DA 1XS2A 5H6HA 1RBOB 4ACYA 9XIMA 3MHFA 1H62A 3RF9A 4O28A 3HGOA 3WJWA 1WBHA 2NT0A 2ISSA 3W7EA 1F4HA 1Z7AA 4HHPA 3TDFA 2HBXA 1F6PA 4MADA 1YIXA 4I9AA 5JVLA 3W2JA 3ZMRA 1ISXA 4HN8A 2XU2A 3EB4A 4MTVA 3S46A 2VZOA 5BXTA 1DWJM 4GY1A 4J2MA 3KOYA 3AROA 4ATWA 4K8GA 2YXGA 3LYEA 4J28A 1A4LA 2DIJA 3A22A 4P61A 4UQDA 1XG4A 1XFCA 2YXOA 4X2RA 3CO8A 2GPTA 3M41A 4GI9A 3GR4A 4JKLA 4WSKA 2YW3A 4O15A 7REQB 1O94A 3W01A 3AAMA 4P7OA 5FJUA 3B4UA 4DLMA 2ISFA 2PGEA 1TPH1 1KM2A 4X0VA 3WH6A 1Z8AA 2P8BA 2ALDA 1V6WA 5CC6A 5JBEA 4QLJA 3C0LA 5HNRA 1M7PA 1SJAA 3VILA 3R12A 4F8XA 3WNMA 3GTXA 1JRCA 1KTCA 4F0SA 1QI4A 3CGTA 3A9BA 3NNTA 3I68A 3MMWA 1HKMA 4UCFA 1VRXA 3S83A 5BCAA 1CPUA 1XGEA 5EFDA 3JS3A 1VS1A 4O0ZA 3GFXA 3B8TA 1EA9C 3A5FA 3A3WA 4ICCX 3AHVA 3ZT5A 1JXJA 3HA1A 4HNNA 1QNPA 3Q45A 3ES8A 3C3NA 2I9EA 5DRCA 5MKGB 4CNUA 4MY9A 3IV3A 3ITTA 3HJEA 1J0KA 4YU1A 3R58A 5CKSA 1ZZMA 4HNUA 2YGYA 1JD7A 4PBFA 5FJRA 4EP8C 3EXRA 3WJSA 3LGDA 4YWIA 3M5XA 2FTPA 2Y70A 7TIMA 4DUXA 4BA0A 5LNRA 3EWUA 1DXEA 2X1UA 5HDRA 3TQKA 3C0JA 5IHRA 4TTUA 1XPYA 1TA3A 4G1NA 4J3XA 4AWEA 2PI6A 3UF9A 3OA5A 5A95A 3O6YX 2IQTA 1XUUA 3K4WA 2NWRA 3A3XA 2NX1A 2OXNA 1DKWA 1CGTA 5EMJA 2XTKA 3ZT7A 5LIWX 4O1AA 5FEPA 1JNEA 2EKGA 3QV8A 3LCHA 3UG3A 4H41A 3VOGA 1EJ7L 4Q8OA 1JG9A 1CXEA 1FDJA 1W9VA 2BZNA 2W62A 4QGCA 2VUYA 4QIUA 1M53A 3CV2A 3U2CA 3NYDA 2NX9A 4RPPA 4D6IA 1CENA 4XZNX 4W8LA 4ZFMA 3AUJA 1ZP4A 2QVHA 5AC8A 2VMFA 2EPOA 1YEYA 2D3LA 1QOPA 4NZ1A 2PDGA 3RYSA 5I07A 3PULA 3BAWA 1AMYA 2DQXA 2XH4A 3GO2A 3Q58A 4CVWA 3RMEA 4R7WA 5DX7A 1O7AA 2PDJA 4M0XA 1GUVA 1GT8A 5FESA 3FXGA 1MEIA 3BOXA 3TJLA 3H4WA 4Z2JA 4O52A 3G0XA 1Q7ZA 3NSXA 4LRTA 1W3TA 1V6TA 1QT1A 1VBRA 4KFOA 5FAJA 4YCPA 3TYEA 4POCA 3NYZA 2UY4A 3W7JA 4ZEPA 9CGTA 4ZB5A 4MZYA 3U7VA 3F4WA 2ZRYA 3W3OA 4FF5A 2FZDA 2Z0IA 4G7EB 2XVGA 5CSUA 1W1VA 2WZTA 3QHNA 1NF0A 3RJXA 3STPA 3NVTA 4AC7C 3H12A 3L21A 1ZNNA 3L9CA 3BV7A 1I8JA 3VA8A 3MQTA 3OG2A 3V16A 1JL8A 4DZHA 1J5TA 1F3WA 1OFDA 1VFTA 2BXYA 3C8NA 3MPGA 1LQAA 1FHLA 2X0YA 4A3RA 2Z2BA 1THFD 3PSWA 1VHCA 1MQQA 2FVMA 3WQOA 3CUGA 1TPFA 1D8WA 4LEQA 3P3BA 1HKJA 1DXFA 1GW1A 3MKCA 3N4AA 3O3RA 4GRSA 5HULA 4F66A 5M5DA 4FNRA 4S39A 1J01A 1PIIA 4DJDA 2VX5A 5I7GA 1HO4A 5FJJA 1YHTA 3N13A 3OGVA 2REQA 3N9RA 3ANVA 3EA3A 3GHUA 1YLVA 3M64A 1FCVA 2GSEA 4M5PA 3PZIA 3EOSA 3M46A 3S8HA 4CU8A 1YTEA 1KC7A 4WIWA 1EZWA 1RCXB 3NJ3A 4M80A 2OLSA 3LNPA 2XIQA 2PRMA 3RMJA 7PTDA 4DJDC 2DVXA 3AOFA 3C8FA 3WZ0E 2VZVA 3LS9A 3LTPA 1FWBC 1EYWA 3R6IA 4CU6A 1ICSA 2CPUA 3WQGA 5H8PA 5J8LA 2CCRA 5LA1A 1IEXA 1W6TA 3ERPA 3LXBA 5LIUX 5C9RA 1VFUA 2G3IA 1QNSA 3T09A 3SCOA 3KAOA 3NR0A 3KOWA 3WFLA 3WLMA 4C6LA 3WUEA 1EO5A 5ENLA 2QJGA 2I7GA 2QGYA 1IXPA 5FD0A 3VKAA 2CLEA 1O66A 4PEEA 5A3HA 4F4RA 2WW5A 1FH8A 1ZJAA 1H41A 2BDQA 3WH8A 4J40A 4IJBA 4HK5A 1LCOA 1ZL1A 3BMWA 3R5EA 1OY0A 4UQ9A 4RX0A 2PGWA 3UWYA 3UXIA 2Z24A 5GNZA 1LQ2A 2PB1A 4NJGA 1QW7A 1JI1A 3CHVA 3O2LA 5CJ5A 4WDXA 4M6UA 3KHDA 5AZ0A 1E9IA 3L67A 3VXGA 3LZ3A 3QV7A 1V7YA 2ATSA 3WMLA 1FBAA 5D2VA 3TJIA 3DGBA 1EWEA 1JUKA 1XLAA 1ZUAX 3S5ZA 1OVDA 1F74A 4Z2GA 3WK3A 1UWSA 5A5WA 3GNNA 1ZBVA 1BGGA 1VKFA 5EU9A 4XQ6A 3HPFA 5C2XA 3K8LA 3R0DA 1N8FA 2VVSA 4FI4A 1XLIA 1UUMA 2DZAA 4C1NA 4IXXA 3S1GA 4JTGA 1GOIA 1IEQA 4DJFD 1Y0EA 2WQPA 2Q09A 2WAGA 1DJWA 2BVYA 1LYXA 4L5ZA 3W28A 4BFAA 3CMGA 2HBVA 2Z28A 2PWFA 2V81A 1HKKA 3EMQA 4LYQA 1RP8A 4FZIA 1X96A 3R4IA 4X2PA 1QK0A 4UFMA 5KZEA 1OBAA 3ZSSA 2Y88A 3SCRA 3B9DA 3R1ZA 3W02A 3S2CA 4QLLA 2XWEA 3HQNA 2V3FA 4Y9MA 2PDCA 4NNBA 1JQXA 4ZGYA 1C93A 1Y5XA 3QFWA 1CLKA 4QP0A 5DF0A 3WLRA 3LENA 4GKTA 1XL9A 2DIKA 2D73A 3Q94A 1H11A 1E4NA 3CUFA 4JICA 3B9NA 2Z1XA 3AYRA 1ISWA 4GZ7A 3PBVA 3VO0A 4FAMA 1VCGA 1BWLA 2Z00A 4WCJA 1OZQA 4TX8A 3QV6A 4P7LA 1Y5VA 5CPLA 3A6OA 1ITXA 3DHFA 1EDQA 4AY1A 4C7GA 4QROA 4KWOA 1KBKA 4XD4A 2E9LA 1H2JA 1VPXA 2BGNE 3PF3A 4M29A 4ES4A 2BXVA 4CN6A 3KCLA 1XLFA 5HPOA 3WNNA 3WDIA 1JAKA 1DJNA 4ACZA 3VNMA 1TV5A 1XRSA 5LIYX 2ZKMX 5C0QA 1E9ZB 3LGGA 2G95A 4Y9NA 1VPQA 2DZVA 5I3FA 5C5YA 1TMHA 1W8SA 1ML1A 2ZZ3A 3MDUA 1I0BA 3T40A 5AHFA 1TCDA 1W5QA 1TX0A 4PB3A 4GO9A 5AOUA 4GABA 1YKWA 4DZ5A 1XLHA 1UR3M 4UXDA 1K6AA 4RJEA 4YHEA 2ASHA 4JXCA 3KBMA 2DY3A 1LOSA 3ABXA 2OLAA 3TQPA 3OIHA 6A3HA 3SUWA 2WVVA 5CPOA 3SN1A 5JBDA 2ZXBA 1MZHA 1E70M 3UR2A 2PLKA 4DBWA 3II1A 2YB1A 1UWAA 1EF2A 3W6MA 2VR4A 4LVFA 4GZIA 4PR4A 3F4CA 1XP3A 3SQSA 4M51A 3GZ3A 3SDOA 1ONRA 5LNSA 3LHWA 4XX6A 1TJ2A 2BHYA 1JXKA 4N9EA 3R25A 2A79A 3LPPA 1P1XA 2A21A 5DXYA 3SCWA 4RK8A 5LNVA 1J10A 1GCYA 1ZCOA 1VBUA 2D24A 1H0GA 1LLOA 2YPIA 3WQDA 4UTFA 1ONWA 3GC2A 3IV8A 1K03A 1KKRA 1PBGA 5EBUA 3BSMA 3LK6A 4JTHA 1HZYA 3RCMA 3RLHA 2BGSA 1EWDA 5BOFA 2CESA 4MB1A 1PUDA 3S6TA 2HK0A 3OP2A 4Q8QA 4DO6A 2DV0A 4NXSA 1A5CA 1JCXA 2QR6A 3TWAA 3A4WA 4Y9PA 1C91A 4O1CA 3W81A 3NZGA 2CIPA 2TMDA 4C6PA 4RZBA 1FFQA 2QCNA 2NSOA 4DVOA 2DSZA 1Z6KA 4FEZA 3PZUA 3PZMA 9RUBA 4PSRA 5HJYA 1A50A 2X1SA 1F07A 4U5KA 3BCFA 3WBEA 2QCCA 3SZ8A 3B8WA 3HO8A 2ZA1A 2VCCA 2OCZA 1LTDA 3M16A 3M0JA 3BXWA 1V4YA 1US0A 1LOLA 2QCGA 3UWEA 3SCSA 4S3AA 4M19A 1J93A 1EB3A 1WUFA 1IV8A 2P3ZA 1TTJA 3POHA 4M56A 3W1LA 1E1FA 4GXMA 2SFPA 1R38A 3DZ1A 1S1RA 1ZBCA 1YPFA 4OV9A 4FOKA 3DHPA 3NQ8A 1POJA 4CQAA 4MIMA 2OB3A 3OJGA 4J3VA 4H6RA 4L56A 1WP6A 5AC7A 1OF6A 3JUGA 1JZ6A 3TR2A 2BFGA 5EMMA 1A3WA 1UH3A 4BF7A 1MNSA 3QPYA 1GG0A 1NWRA 2GWGA 3C5QA 4IMGA 1NVMA 2ADAA 5M17A 4U28A 1WKDA 3TMQA 2CXEA 2AKZA 3F4DA 4RV8A 3O63A 2WC7A 4R27A 2FYMA 4JNMA 4KKXA 2ZUMA 1TIMA 1TVNA 4FXSA 3W7QA 5HJLA 1JCMP 3KLKA 2HXTA 3ITVA 3KCJA 2HE8A 1XWYA 3O15A 3W7MA 2Z1BA 3MP3A 1PYMA 2DZSA 4EPBC 3SIZA 1V3KA 5HQEA 2CC0A 3P5ZA 2OZ8A 2NQJA 4ROPA 2VC9A 1K4GA 4JTSA 2DQWA 2W4XA 2QCLA 4IMCA 5G4EA 1AJZA 2YL5A 1PL9A 3URNA 2V2HA 2GK1B 2IPFA 3RJYA 2ON3A 4WVXA 1CGWA 3AZSA 4HB7A 3OZPA 2EPHA 3DCPA 3B97A 3GLCA 1TX2A 4GQGA 3TQ0A 3PB0A 1DPMA 4BZYA 4UZSA 4NJKA 2OR2A 3WK1A 3A13A 2X1RA 1FFRA 5CPSA 4JL1A 4PUEA 2OYLA 6XIAA 3NQGA 3G3DA 1P7TB 1GHRA 1Q63A 1K7XA 2I17A 4JN6A 3ZR4A 1OG6A 2W61A 4EPEC 1VIWA 1XH0A 3PPHA 4K8HA 3VD3A 1UKQA 4AD4A 5LIKX 1U83A 4GX8A 2GQ3A 4MNMA 2R24A 2INEA 1KBBA 1ZAHA 3LXCA 3MHGA 4C6FA 1H09A 1RA0A 2PBOA 3AWOA 3HQOA 2OELA 1TKKA 1XCFA 3VGDA 2AGTA 3VI2A 1CWYA 3V35A 1QBAA 3PUOA 3DHUA 4ICMA 2CFFA 1W9DM 1MDLA 2V38A 3BLPX 4M8UA 1MDRA 3RGTA 1WB0A 3O16A 1ZRQA 4XK2A 1T41A 4TXEA 1F6KA 3SJNA 1XYBA 2ZTJA 3AHZA 3BMVA 1J8VA 3CUHA 4N9CA 1EF3A 4DJEC 4HBKA 4A29A 4JCMA 1R3QA 5I3GA 3ITLA 3QMRA 3RX4A 4R3UA 2J9YA 1GTEA 5HXMA 4PODA 2I56A 1XH1A 3HIJA 2BSLA 2A7PA 4GH1A 2VEKA 2FJKA 2YCJA 3DEQA 2WKJA 1W2VA 3UFYA 4UWMA 1R3YA 2C3ZA 4NILA 3STCA 2XVKA 4EIVA 2G3NA 1W0MA 4U10A 1U33A 1XYZA 2WCGA 1V93A 1B3OA 3RLGA 4E2BA 4UTTA 2X2GA 3P5YA 4ERGA 3A4JA 3CHFA 4HA0A 3W25A 3QFEA 3U8GA 2PTXA 3EYPA 1J11A 1P43A 4Z0SA 4NZCA 1VBGA 3NUKA 1OFBA 5MKGA 1PS9A 3C6CA 4B16A 3BWWA 1WDWA 5A94A 4PTXA 5EGRA 1KFBA 1DXIA 1XH2A 2VFIA 4N2YA 3QR1A 3GQYA 1NFGA 4LOCA 2J13A 3K5XA 4HIBA 4UTTC 5A6SA 5K9DA 4UTHA 2HPMA 1XSIA 3EXSA 1PV8A 1OABA 2PLMA 4HHHA 3S5OA 3W82A 1P6BA 3LM7A 2PDXA 3T07A 4NYYA 4ZA0A 4B4HA 1Z3NA 1P1MA 2YL8A 1GQLA 2XM2A 3EZ4A 4UFIA 3UR5A 4WXYA 4QDMA 3TP4A 5FEWA 3LV6A 4AVOA 4LF1A 1Q6OA 1I2NA 4I6KA 2EG7A 1NTHA 4CQDA 4OE7A 1BEUA 4D8ZA 3W24A 4H7VA 2PC8A 1FWSA 2VX6A 3OQEA 2VX4A 2NUYA 3EWDA 4S3CA 5I3KA 4H83A 3CUZA 3KBNA 4WOQA 2QDDA 2OT0A 1SFLA 3AXHA 3A21A 4IMDA 2WNNA 3WO8A 1WZMA 4LNYA 4NUWA 1BAGA 2OWXA 4UR8A 2GWNA 3W83A 3ICJA 1VIZA 3PUGA 4AHPA 1UYQA 1GVIA 3C61A 1YDOA 4FO4A 3HB9A 2DZTA 1PKYA 4XO6A 3W87A 1OD8A 4IGSA 4IIHA 3CIWA 5KZMA 3BTNA 1FH7A 3B3DA 5AKQA 4XTDA 4NAEA 4J4KA 2F6XA 2WC3A 3M6DA 4HYRA 5BNKA 3L65A 3SGGA 3TTQA 4H9ZA 1OG0A 3GNXA 4XIAA 8XIMA 1IGWA 1QR7A 3PWGA 5K7JA 4OECA 2WNQA 2CWXA 2XZ7A 1E51A 3EX3A 4Q3MA 2W91A 1XD1A 2DVTA 4UBPC 2H9AB 3VNKA 3MMUA 4DWSB 4AC1X 4G7EA 3SCPA 2J8TA 1HW6A 5GQBA 3ARUA 1UG6A 4FXFA 3GC4A 1NP2A 4DJFA 4MZ8A 3DECA 4WD0A 3VM5A 2OKOA 2ZBTA 1FOBA 2A1YA 2WMGA 4AZBA 1WXZA 2GDQA 4RNJA 1L2QA 2BTMA 1TJ0A 2B7OA 4A3HA 1VJIA 4KS0A 2BODX 4HT3A 2VEGA 4GVIA 5CLTA 3LY0A 4JFTA 3GH4A 3DYOA 4JTRA 2VELA 3HMJG 2GJPA 3ZWTA 5D2YA 4CN1A 3VIPA 2DT2A 1CT5A 1O68A 4IQJA 4CNSA 1CDGA 3A23A 5C55A 3HBLA 4JPGA 3H2MA 4C6CA 2PF0A 3CYVA 3EKZA 4XVDA 4GZEA 3QF0A 1LL7A 1TRDA 3U9IA 4XZMX 4QEEA 3BE7A 4GXWA 2EJAA 3UJ2A 1MEHA 1R30A 1XIHA 2QMJA 3EPOA 4REQB 2E6YA 3HFTA 1IWPA 2WPGA 1J0YA 4QX4A 3CZ8A 5AHLA 4YVPA 4WRHA 4CGTA 3SY5A 4U3CA 3UJSA 1QW9A 3VDAA 4QJ5B 1HJXA 4R9XA 3LEPA 3T2QA 4HGXA 4BCEA 3TJXA 3M43A 2PDQA 1LP6A 4GQBA 3W7DA 1MVYA 1OFEA 3TV8A 2W9MA 4J5NA 2FDSA 4IIGA 1PWMA 3G1FA 1XIBA 1WAWA 4GZJA 4ZXOA 2NLYA 3OG3A 1E56A 4F3HA 2RUSA 2P50A 3CZGA 1V03A 1MW0A 5CPNA 4LS0A 2V5LA 4IQEA 3HQ1A 2ANUA 1XGZA 4E3TA 2HISA 4Q6JA 3ZVHB 3QH2A 4JYEA 3U5YA 3N12A 2Y0FA 4AVFA 1RV8A 2UY3A 5A8NA 5TAOA 3B04A 4K1WA 5I0DA 3VGFA 2E1DA 2HS6A 2J8GA 4WOZA 1TPVA 4L80A 5J04A 1H7RA 1XD0A 5AN7A 1DVJA 4MVAA 3S5YA 3DKLA 2GDUA 1UHVA 1DJGA 1SFSA 3SSJA 5CSYA 1XI3A 1J2WA 1US2A 4LT9A 2Y2WA 5CGTA 4CCCA 4UMAA 1K9TA 3FEQA 4NAFB 5A8MA 3CZJA 4QE4A 1JD9A 2YDSA 3PB2A 3PFRA 4AEEA 1OYCA 3NPUA 3WIJA 2OGYA 5GNYA 4AYSA 4I9TA 1IXQA 4H00A 4YNGA 1ZALA 3RNDA 4ZR8A 1NOWA 2MNRA 3ARPA 2JQXA 4U2YA 2HE5A 4YN5A 2EJ1A 4S38A 3V5CA 4NZ4A 2PBGA 4BWLA 3VIMA 1W9XA 3BH4A 1DWHM 1V0MA 3SM0A 2A85A 3LA4A 1WDPA 1GHSA 1U5VA 4QS5A 2YDRA 2CLKA 4YL2A 2VEFA 3Q4DA 4NP7A 4Q8VA 4GMEA 4D2JA 4MJ4A 3DFOA 2Y1HA 2QXWA 1EDTA 3WLJA 3QZ6A 3PJXA 5DCBA 1UH2A 3LI1A 4NG3A 5K3VA 4ZCWA 2QJJA 2JF6A 3A3HA 2QEZA 3CV1A 4RLIA 5A8PA 4DAIA 3GDTA 2XWDA 4O11A 4U33A 1JDDA 1OYAA 1Y8BA 4P8UA 3R10A 3KP1A 5A69A 1BTCA 4RR4A 3W2NA 2ESCA 5I78A 3N73A 5T9CE 5FL0A 1LRTA 3UCCA 1ZBWA 4WJXA 2PTYA 1WDSA 1S2WA 2JGYA 3AICA 3AS3A 4IPLA 3NEHA 1EHAA 4FNTA 1V0LA 3LLXA 4H7ZA 3KUMA 5IRPA 1V08A 2WBGA 4A35A 3NOEA 3FGCB 4UZUA 3OIXA 1OZMA 1J96A 1M3UA 3KHJA 1XRFA 3UCDA 1FCBA 3W7GA 4IGNA 3LN3A 3V0UA 4LH8A 4LV9A 1OSEA 1YPXA 2A5HA 5LHFA 1MRQA 3L4YA 1Q45A 3DFTA 8TIMA 3M0HA 4J35A 4NNAA 3F2DA 4C90A 1R3WA 3LCGA 4RE4A 3O07A 1RD6A 3IIPA 5LNUA 1C7TA 3ZM8A 4LPCA 2V2DA 4GBDA 3ARXA 4IX0A 2OZ3A 3IJQA 5BRPA 4ZQNA 3WX7A 4K68A 2HDJA 3V7PA 3GHRA 4U31A 3R7MA 3QGVA 3QTGA 1L6SA 4BQ2A 1O5QA 3MKKA 3KM8A 1XHGA 3V18A 3HV8A 4WJEA 1NP0A 4DELA 3CNYA 2QYGA 1A47A 3ZS4A 3P0XA 5BZAA 4KMQA 4J7RA 6REQB 4GYPA 3NSNA 1YXCA 2ZICA 3WKZA 5KITA 1RK5A 2FZBA 3SCQA 2W92A 4DZIA 1ISVA 3EX6A 1E4LA 3IVTA 1OD0A 4BQ4A 1R9ZA 4I6VA 4LSBA 1DL3A 4M24A 4A2RA 1EC9A 1VC4A 4PCTA 1G94A 3G8EA 4MKNA 4JTTA 4PFMA 3H55A 3NAVA 1EBHA 1XX1A 1E5NA 4GXPA 3TXZA 2XFRA 3QV9A 4XZLX 5HOSA 4V2XA 1OIFA 4QSFA 4AIUA 3BLLA 4GYPC 1A53A 2V5CA 4MZ1A 5CZKA 2DZWA 3K4AA 2A6NA 4KEMA 1S5TA 3RR4A 4Q7BA 3VFLA 1T8XA 4G2DA 1GQJA 2F38A 3MJMA 1A5AA 3I7RA 3K2GA 1CX9A 1YE6A 1OX4A 2Y5EA 3M5YA 4QR6A 1TG7A 3GB6A 1QAPA 2V9DA 4H7CA 2XIIA 1VFHA 2B0MA 2PGFA 2VNCA 4JTUA 4B9YA 3BC9A 3P0WA 1XRTA 4ZO9A 4OIFA 1XUZA 3HURA 1UASA 2EQDA 4B3KA 2DP3A 4MJMA 3RCYA 3V36A 1KM0A 4PFHA 4UTJA 3JZUA 3QW3A 4D6EA 3TX9A 3BSGA 3GTNA 4H8VA 4HP5A 4A2SA 3RXZA 4ZO7A 1W3IA 3EOEA 5E09A 2DSUA 4XD5A 1M7XA 3M0LA 1HNYA 1G4EA 1VCVA 4JTAA 3FSUA 2PSNA 3LCIA 4PMQA 4GINA 5C9WA 1BHGA 2VURA 2P1FA 4FNPA 5D9MA 1WZLA 2E40A 3OYXA 1CZ1A 3W29A 3CLMA 1TWDA 2YA2A 4AD2A 1R2SA 1L6YA 1JDFA 3TZFA 4GWEA 2A7NA 4MB5A 1TPWA 1ONXA 4Q4PA 3NXLA 4I9MA 4JX4A 4OBRA 4HNTA 5JIPA 5REQB 4MHBA 3WQ4A 5D05A 1O4UA 3W7IA 4BJHA 4LV4A 1IHIA 1GJUA 5J5DA 1ECEA 2WKGA 1VGAA 1Z69A 2YLAA 4O8RA 3OGRA 1XSJA 3BURA 2OX1A 4S3BA 2X1TA 2QCDA 2VX7A 1H5VA 3MSDA 3T4CA 3TFXA 1QOQA 3U3HA 4GI8A 1O1HA 1WXJA 2WZMA 1WO2A 1E4IA 2KZHA 3ZSTA 1LJYA 2ZUUA 1M7OA 1JZ7A 1E40A 4OUIA 5HWNA 1L2UA 4ZFCA 3DIPA 1K77A 3L4XA 1CECA 1TSIA 1QNQA 2FKPA 3QRHA 3GG7A 1VEPA 1LBMA 4CCZA 4Q4KA 2G0WA 3RR1A 2XUCA 4W87A 1VJZA 1S5MA 3AI0A 3LD5A 4DPQA 5JQ9A 5DEZA 2G41A 2ZXAA 1XF0A 4LEFA 1SSGA 3N15A 1Z32X 2DIEA 3ZJ6A 2RHGA 3F4NA 4AQLA 4FIRA 3F4VA 1QO5A 1ZB5A 4GCXA 4ZBCA 1OK6A 1HXJA 3MC5A 3BG9A 4BI6A 1XM3A 5DN1A 3QC3A 2C79A 3GDKA 2YCKX 2XJ7A 4LVBA 3M0MA 5E5CA 4NY2A 1J79A 4IJCA 2Y7EA 3BJTA 4UUIA 4AZGA 1EQCA 4L6DA 2Z6JA 2J6XA 4HKPA 1XCXA 4Z2LA 3LHTA 4IPNB 4I5RA 2Y24A 3TN3A 1E1CB 1TR1A 1EEPA 4JGDA 1WDQA 4JR5A 1EX5A 1PWLA 1EPXA 4U4MA 5A2AA 4R53A 2V3GA 3JVAA 4GH3A 1QRQA 8RUCA 3NCOA 4CD4A 2ODOA 1LT8A 3RDKA 4LVGA 4RNIA 3VMPA 1H4PA 5AYZA 4NQ1A 4ZB2A 3HPAA 5D9PA 3SI9A 5E93A 3A64A 3I6TA 4NVTA 4JD4A 4JTLA 3AWNA 1IZJA 1B1YA 2F8QA 1ZSXA 2TODA 1OC7A 3SGZA 3OEXA 2ZRWA 3PPFA 2NVCA 4RDVA 1JF6A 3W1XA 2J7DA 4GNVA 3EX4A 4D8LA 3THDA 1VFMA 1DBTA 1BF6A 4FR6A 2XFWA 1JCNA 5IDZA 1GYNA 3C4UA 1R3TA 2RJGA 3U2EA 1EP3A 1RCOB 4NJHA 2FGLA 2G5WA 2ZVIA 5AVNA 1UC5A 4XIMA 4Y9OA 4PMYA 1MNZA 5E0KA 2PEVA 5FSDC 4J3UA 4R88A 1PJ9A 4DI8A 1D7KA 4L1GA 2FPTA 2HS8A 4GX9A 1DHKA 2C1GA 3CL8A 4IP7A 1RD5A 1XINA 4F0MA 4WSJA 2QUVA 1WX0A 3PPGA 4KIEA 1NOUA 1K02A 4FX6M 5EB8A 3GH7A 2QULA 1QTWA 3RO6A 3S9ZA 2C13A 3MV01 3ISIX 4AD5A 4H9MA 1XIGA 5FF2A 1DYSA 3WK0A 1HKIA 1PIGA 4YYCA 2EPMX 2FH6A 1GOMA 3GVVA 2C0AA 4PCNA 5CPMA 3L12A 1A3XA 1E71M 3ABZA 3QHOA 2NZLA 3LBMA 4KRUA 2E68A 3D3FA 3WLQA 1DQXA 5B7YA 2Q6ZA 1UIOA 1AW5A 3FW6A 1JQVA 5KMYA 1VCFA 3S42A 2WZHA 2PODA 3AU6A 5D2XA 1XLCA 3QJAA 1U5HA 2EEXA 3P60A 1ZJIA 3M1ZA 1GGOA 3STEA 3LCWA 5HUOA 3MJYA 4GQQA 2DJXA 1WZAA 1G7UA 1MFVA 5E0FA 2PTZA 2Y85A 1T6MA 3OHIA 1FKXA 2Z1WA 2VTFA 1MUCA 4QXIA 1ZPTA 3G2GA 4AHQA 4B5UA 1W9UA 2WM0A 3AFBA 1TTIA 4HPGA 4CEUC 4WKHA 1TTPA 2YJQA 3LQGA 3GW3A 3GFZA 3KTSA 3TMLA 3BGJA 4E5TA 1QO2A 1DWIM 2FIQA 3F03K 4Z42C 5C9UA 1C7SA 3L5AA 2W3ZA 5T26A 3UT0A 4L61A 2PE4A 2RJHA 1XC6A 2J6VA 1F4AA 1V3IA 5CJNA 1S5WA 1JZ3A 1EL3A 3CU2A 2X7VA 3TTSA 2QAFA 3TCEA 1UR4A 4AX6A 1ADSA 1RPKA 2HNEA 4HQVA 2PPGA 3TLLA 1NWTA 4KEVA 3BQ6A 2H9AA 1AH0A 2YKKA 2XISA 3MMTA 3IIVA 3QXBA 4KCUA 4M7SA 4UTWC 3DI1A 3ITCA 1X8CA 4ZQOA 1OCBA 3FHAA 4Q33A 1TCMA 1I1WA 3KLLA 2O4MA 5AB3A 4KT2A 3E49A 3VCNA 5KZ6A 3OVGA 4ORMA 3VOHA 5GJMA 4GNKB 1RA5A 3USZA 3RRXA 4C1KA 1KXVA 1PKMA 4EXAA 1O5RA 5JH2A 1Q4WA 4QS6A 1TV8A 2O4QA 3WF3A 1DEDA 1H61A 4I7VA 3VE7A 4DWSC 2ONEA 4X9SA 1Q7MA 4JFVA 1XR2A 2UY2A 4YXGA 2VC6A 1ZQ5A 4JHOA 5FJPA 3ARQA 1Z41A 1EJTC 4NI3A 5EA9A 4NJIA 3SQLA 3CM4A 1M1BA 1NM9A 4WUIA 1OGBA 4ZOAA 3M9YA 1K8YA 2YL6A 4A21A 1RBAA 5D8WA 2PWHA 3CHDA 3LI0A 5G4HC 1VR6A 2WQDA 2BMBA 3I4KA 2PDLA 1V6XA 3TK7A 5DXXA 2ZXDA 2F2KA 5A6LA 4B92A 5KZDA 1L8PA 1ZP3A 1FWIC 5IDIA 4EACA 2OQHA 4JDBA 1RLCL 3BPWA 3GKFA 3FFSA 2CLOA 1S5NA 1UZ4A 4UNIA 1OCJA 2REQB 3QMSA 1GEHA 3RU6A 3KE0A 1K4HA 1PZ1A 4K38A 1SFJA 2Y8KA 2C15A 1XIIA 1DWFM 2NXGA 2WZEA 5EL1A 2PTDA 3NQCA 3QLDA 1VFLA 3PG9A 2OPJA 1XV8A 3VINA 4PCSA 4DYKA 2VJXA 3WJYA 5CGQA 3VCRA 4JS3A 4NKCA 1KO0A 3GAYA 4NX0A 1XIFA 4P7QA 3ABQA 4AEFA 1J12A 2ATMA 1TJ1A 4YS1A 1DIDA 1NF7A 4E4PA 1KV8A 1W3KA 4NSBA 3IAPA 4HOXA 3ZVHA 3DYMA 4IQDA 1JULA 5LXXA 2NV1A 4UFHA 4PN2A 3AZTA 1W3NA 3SEPA 3USBA 3C56A 3OVPA 3GXTA 3MZ2A 4M6PA 4U3AA 2KX9A 3AYVA 3IJ6A 3N14A 1AFSA 4QTGA 1QU4A 2OMAA 2E5DA 4IX2A 2NW0A 4LGXA 1EJRC 4WX2A 2V3EA 3BZGA 4GNJA 4H04A 1VYPX 1ZAJA 3MI6A 4GQ0A 3AC0A 4BK9A 2VI0A 1AG1O 4O4VA 4RUBA 3BV4A 3KOFA 4AIBA 4AFYA 3EGJA 2QUMA 2QV5A 2GGGA 1LLZA 4ML4A 2JF7A 4JIIX 3VZZA 3FHQA 1BYAA 2FJUB 1G1YA 2RDUA 2XGBA 1M03A 4H4IA 4PUJA 4L6HA 1QMLA 1TE1A 4HNOA 1HO1A 2ZC1A 4IP5A 4V27A 3G1AA 2FB3A 1S5VA 4KGLA 3MANA 2BVTA 2PDWA 2DT1A 3GNDA 4HJWA 1DIOA 4XTIA 3WCZA 1WKYA 2J79A 1YBQA 4ZE5A 2FQIA 5HJXA 1IT0A 3V4BA 1LT7A 5G1YA 3VPLA 4O18A 2ZX9A 2PF8A 1HKWA 1NDWA 3LCLA 2O9RA 2GFTA 3G0UA 1Y5WA 4ICNA 1B9ZA 4PSPA 4BR1A 4C6KA 5U4NA 1QI3A 3C0SA 1MW2A 1E9LA 3VD4A 2KAUC 3GUGA 4DO5A 4NX5A 4WDTA 3NM3A 4UQEA 1WKFA 2DFAA 1UH4A 2IS7A 4TX6A 1R7OA 3U6WA 1EDGA 3HJZA 1KM1A 2DH3A 1E4MM 1I4NA 3KFTA 1W3JA 3PVFA 3TTOA 2VGIA 3NL2A 2DJLA 1OM0A 1Q13A 3BOFA 3U7BA 4YTTA 5HNTA 2H3DA 2OQLA 3HGJA 1JYVA 3BVJA 3PJWA 2QUTA 1SO4A 1IIHA 1A0CA 3PZVA 1OINA 4QISA 2Z6IA 2GSHA 2ZZ2A 2WVSA 4WDUA 1AK5A 4EX4A 5HA7A 1Q65A 2FDMA 3QKZA 3TN6A 2W6RA 2OEMA 5IBXA 1UJPA 2OJPA 3UVAA 3EOOA 2JEQA 5LA2A 3S9IA 3ATZA 4YLWA 1AJ2A 1JF5A 3I7SA 3WFAA 4ACZB 3FGCA 1T99A 1H1YA 3IPWA 2WPBA 2TRSA 1OFAA 3VKCA 4UB9A 4K2SA 4JHMA 3PZOA 1VLIA 2GOKA 4P7NA 4CQCA 3H8AA 4H6EA 3N2BA 1UCWA 3U0HA 1UR2A 1TWWA 1CW2A 2YDAA 3MU7A 2MANA 4L9XA 1J18A 3QHMA 4FSAA 2VFGA 3NO5A 3VGBA 4URIA 3C2OA 1SJBA 1ALDA 3IS4A 1JZ5A 1QI5A 2G96A 1TR9A 3H54A 4EAYA 1XLGA 1QFEA 3CK5A 3MV11 1AD1A 1C8QA 1BYDA 3CZKA 3WD3A 3H2NA 1UP2A 1W8GA 1ZY9A 3N25A 5CBBA 3KS5A 4AD3A 3VZXA 5T8GA 4DXVA 2JBMA 3DAQA 1E43A 5SWUA 3FKKA 4W84A 1CI1A 3ZWSA 5BYWA 1XLEA 2V67A 5E70A 5EBAA 4D6DA 3S5NA 3LCXA 2YL9A 2G4FA 1QNRA 3UA3A 3ITXA 1ODUA 3IJ7A 5AYBA 4C6QA 2VOTA 5DMMA 4FMVA 3OZMA 3B4YA 2GVGA 4PMZA 4S3DA 2DEPA 4FF7A 3PNUA 3ATYA 3LQLA 4YTQA 1HL8A 1SO3A 3GXPA 4Q7NA 5CC7A 1RLDA 4GYFA 4WZHA 1TO3A 4EPKA 5AFDA 2QPSA 3MUIA 1LWIA 3NGJA 4HK7A 5I5RA 3ZJ7A 3MT1A 3FDKA 5E6YA 2XVLA 4N7QA 3CMFA 4J3TA 2D0HA 3GG0A 3EPNA 2DH2A 2PC4A 2ISVA 4DX3A 3DXIA 3UCQA 3MMDA 1TPC1 1JDCA 4PEKA 3LZ5A 4IZGA 4AZ6A 2POZA 4UTKA 2CLHA 3NQ7A 3R8GA 4ZQPA 4GI4A 2VEPA 2VO5A 4PUWA 2X8RA 1UZDA 1FCQA 1YXYA 2Q8ZA 5DT7A 1VHNA 4PMNA 1UKPA 2PCQA 1JEZA 3FV9A 1W37A 1QASA 1WOAA 1UWIA 3VCCA 1FWGC 2WNZA 3CL6A 4CVUA 4IMAA 2VRKA 3M5ZA 1LUCA 4M6QA 1WE5A 3QYSA 1YTDA 1TV3A 1YTKA 2G3JA 4OBSA 4MWAD 2NV2A 3E02A 4LC8A 5REQA 4A8NA 1UMLA 4HSNA 4ZTXA 2W27A 2NLIA 1MFUA 2V5DA 5JXQA 4DB7A 1R87A 2CNCA 2ZUSA 4LAOA 2YBVA 2ZUNA 4QLKA 3GS6A 4O50A 3APTA 4QNWA 4W4QA 1OFRA 1KD0A 4BI5A 2EF9A 4NHVA 2BASA 1DJYA 1LOQA 3CV6A 5RUBA 3B0PA 2XN2A 3K1DA 4WJ8A 1SVDA 4CCDA 2GZXA 5L9FA 4YIWA 4FHAA 2AQWA 1EP1A 3MI2A 3GY1A 3CIVA 3OLDA 4JNZA 5CQ1A 3QYQA 4DBDA 3ALFA 5ECUA 4JTIA 1W1PA 4N9BA 2WHLA 1CXHA 3WF4A 2XHYA 1GW9A 5EMLA 4HYWA 4PL1A 1TB3A 2PDBA 3BLFA 4MOZA 2FH8A 4GCAA 5FA5A 5M2FX 4MPKA 3HMCA 4TV5A 3SY1A 8CGTA 8XIAA 1C29A 3N9SA 1K8CA 4ECLA 4DF0A 3RRAA 3WQPA 5M3WA 2ACSA 3EDDA 4KFNA 1E0XA 1D2KA 3VKKA 2ZUTA 3W26A 4H3DA 2WMJA 4PL2A 1A5MC 1KRBC 4JOMA 1PHWA 3CH0A 3HPSA 2QPUA 4FS9A 2NQHA 5FACA 3RCNA 3ARZA 4ASTA 3R89A 4LFYA 1E1CA 4WR3A 3K8MA 4ZSTA 2ALRA 3SRKA 4UQCA 1LQ0A 3P14A 4RE3A 1REQB 1EJUC 2JKPA 3KL3A 1UPPA 1W1B1 2J7BA 2INFA 4HSOA 4IIBA 3WSUA 1EJVC 5H91A 5HAOA 3G0SA 2C91A 1NELA 4IPPA 1TWIA 4HHMA 1QW8A 3HGRA 4XISA 4NNCA 4HCHA 3NQVA 3AALA 3V0SA 4RNHA 2Z4GA 3UWUA 4B2DD 2GOUA 3WDHA 4WY0F 2E9MA 3WJZA 3CYJA 5CZ0A 2TSYA 1KXTA 3I3BA 3LRLA 3ITGA 4U2ZA 3GNRA 1OCQA 4AD0A 1US3A 1A5OC 2H8XA 5C2GA 4TV6A 3FIGA 7ENLA 1KGWA 3QGKC 3WMSA 3REQB 3H70A 2H6RA 4YVXA 1OFQA 4LWWA 3LPGA 2EPLX 3CQJA 3L68A 2UV8G 2CW6A 4LCSA 2QVNA 2V68A 3WUGA 3W0KA 1VF8A 1X6UA 2PD5A 1GYMA 4Q4SA 3O6DA 4GKLA 2E6AA 1Z9AA 3TR9A 1KCXA 2HNHA 3QVQA 4E2DA 3NQMA 2I14A 1P0BA 3GFYA 3GUWA 2FTYA 2XPKA 1D7FA 1JUBA 1OEPA 4AZ7A 1HJQA 3AIWA 3A24A 3QQ1A 2X42A 1EQPA 3UNDA 3ONCA 3K4DA 4GD0A 4I90A 3M0VA 4XBKA 1KBIA 1KTBA 1VBJA 3AS2A 5K9CA 5CZJA 1ZBKA 1H1ZA 1XW8A 4XSMA 1BFNA 5F2LA 2CHRA 3I10A 4IUGA 1PCKA 1BQCA 1UA7A 3CPUA 2J9XA 3MDWA 2RKXA 1UW9A 3P8IA 1R9XA 3H26A 5A6AA 3VNYA 2I1OA 4XZIA 4Y7EA 3AMGA 4LW7A 2GUYA 5AC5A 2CBVA 2UY5A 3NPWA 3L5MA 4JIQA 4GY0A 3VMNA 3G1DA 1KLYA 1VD6A 4AWTA 2MUCA 1QUMA 3NQ6A 2HZGA 3L66A 5FCZA 1PTDA 1F3TA 1K70A 4QJ4B 3GSMA 2QUNA 1YNQA 4D1IA 1IXOA 1HKVA 3ZYZA 3V5OA 4HYVA 4WGXA 3L2IA 1RK6A 4YPJA 4A22A 4IUOA 4OOZA 4DQWA 2W0UA 3O05A 2PWGA 2Y5SA 2GJXB 3P84A 4ZMGA 3JU2A 1UKSA 1H5YA 3A5VA 3THCA 3ANUA 4PA8A 3E1F1 1UOZA 1U1HA 1UJQA 1XLKA 2XIJA 1FX6A 1JR1A 3SRHA 2F84A 5HNUA 3RM9A 1F5ZA 2CLFA 2CKRA 1W3HA 3ME3A 1IF2A 2TAAA 1B5TA 1KQZA 1O5KA 3H7RA 4S3EA 1E9YB 1UA3A 9XIAA 1GPFA 4NAEB 3QQWA 4H8UA 3TAOA 2B31A 2X7WA 1CIUA 3W7HA 4YYFA 3Q2DA 4H9VA 3OYZA 1YRRA 4Q8PA 4AW7A 4P8XA 3MVIA 3O06A 3DG7A 4BKNA 1PTGA 2XYLA 4X63A 1UQZA 5IFTA 1ZS2A 4J2PA 5A2CA 3OZYA 5M1TA 4B5TA 1A5SA 3PM6A 1RALA 3E0LA 3GVWA 4KWSA 3FVDA 1EJWC 3THQA 1GZGA 3BMXA 4LXFA 7A3HA 1JDEA 1KXHA 4MJZA 4GYKA 2VC7A 2J75A 1V3HA 1YQ2A 1XIDA 3L7RA 5D2WA 1B57A 1YDVA 2ZDRA 1G01A 3KEHA 4RE2A 4R33A 5F2GA 2XSXA 3OQ8A 1EP2A 4IPJA 2PS2A 1WAUA 5KINA 4QDPA 5EYWA 3AJXA 3OODA 3LNMA 4XAZA 2X30A 4TVUA 2YFOA 2VFFA 4W88A 3H2OA 3KVKA 2V63A 5D9OA 3VNZA 1DIEA 3QQ0A 2QZRA 4B4FA 2TPSA 5GJPA 1XIJA 1U5JA 4Z0JA 2WVUA 1GZJA 4MNKA 1KCZA 2XN0A 2HCVA 3NL5A 3AIRA 3HZ3A 2BLEA 2B81A 4Q8UA 3GYCA 1PX4A 3AIBA 1H1NA 4OQVA 4K6AA 3MUY1 4WGHA 3EWXA 3OBKA 1W5NA 3PTMA 3BLEA 1Z89A 4IM4A 3GIQA 4DF2A 3KBWA 4AB4A 5DELA 3LB0A 2VDGA 2DSKA 5GVJA 3LMYA 2J88A 4HMDA 5BU9A 5HATA 2E8ZA 5A1AA 3KVLA 3MVTA 4Z1YA 2ZVRA 1TUXA 1FA2A 3FXYA 4AD1A 4HZ8A 4UMBA 3W86A 1CXIA 5HMSA 3UXDA 5AVHA 4GC4A 4WK9A 2G50A 4NF7A 5EKYA 4JKMA 5HMDA 1FXPA 3WDPP 4XAFA 5IM51 1RY0A 3NQ2A 1H63A 4IMEA 2CZDA 4JY9A 4TMCA 2J74A 3T05A 3G8RA 2Z1KA 5I23A 4ML9A 3UWQA 1MYRA 3ARSA 1BYBA 1UOKA 2OO6A 2CEQA 1S2AA 1Z48A 3K8KA 3S6DA 1NIUA 4QE5A 1J6PA 4JN8A 4QG6A 3W71A 4IG2B 4LCQA 2UWFA 4FOUA 3PP7A 1SZFA 1EGZA 3PBWA 3UZZA 3N17A 1EGMA 3O7UA 4Q8TA 4DYJA 1DP0A 4B5NA 5LKYA 1QXLA 2X0SA 3LHVA 3IVUA 1W9PA 5LSMA 1PAMA 5ABHA 1ITCA 1I6NA 5A6TC 3F2CA 1W54A 2BBFA 4P7RA 3U57A 3IK4A 3UD6A 3AIVA 2BV9A 1O60A 4C6BA 2OX4A 3MCNA 3UERA 3ANYA 2WMFA 3LXAA 4Q4MA 1Z44A 2TYSA 1TMLA 1GONA 4H9XA 4UTLA 1J5SA 3VIKA 3U5UA 3R94A 4Y2WA 2VWTA 7TAAA 1XLDA 3VC6A 1P0NA 1B30A 4C6NA 4AEOA 4MDPA 2C0HA 3WYZA 4Q4QA 1VFOA 3TSMA 1RQBA 3WLNA 1NOFA 3VGEA 5DBTA 2A3LA 5FF7A 1PB0A 3W7RA 3S1XA 1B9BA 3QY6A 2PU0A 4LQ1A 4QFUA 4AX7A 5CGMA 3ONBA 3MB9A 4GC3A 3IGXA 2Y7GA 4G1KA 5DY3A 1JPIA 3NA8A 1SSDA 2ZADA 1DHPA 3J7HA 4YJ5A 1SO5A 3W07A 3AMCA 2E1WA 3DHDA 4WDWA 1X7FA 3KOXA 3WUBA 3W74A 5D4YA 3CQHA 1ISZA 4FPSA 1GQIA 3KXQA 3N2TA 1C9WA 5G4WA 1ZJBA 3RX2A 5TNVA 3AHXA 4O10A 1GZ1A 3B9OA 5E9AA 2BB0A 1OK4A 2PDIA 4I3GA 3P7YA 4DN1A 3IGSA 4AG0A 5FSEC 3RPDA 1A3HA 4MYXA 4WF7A 3O8AA 4LJ3A 1R5YA 4R9OA 1NH6A 2E25A 1OFOA 3NOYA 1FP9A 3RX3A 1HX0A 1YX1A 3K30A 3WQ5A 3HN3A 3PBMA 3XISA 3GRIA 4XZWA 1L0PA 3UETA 3CAVA 1T8QA 1XYCA 1UD2A 4I5XA 4L64A 2ZDSA 1BTMA 1FWCC 2ZZ1A 3AIUA 2A3EA 1IEIA 1GVQA 3GYEA 3EKGA 3EPMA 3AIQA 4H2HA 4FNQA 7ODCA 1PKNA 4AF0B 3JR2A 2RDWA 2O56A 1IT8A 3DC8A 1HUVA 2VWSA 3T0CA 4MSSA 1XKJA 4Y6GA 3BG5A 4TO8A 3W85A 3WMCA 1GQKA 4CNNA 4BF5A 3UY7A 5AC6A 2VZSA 4TU1A 3B8UA 2PZ0A 2C8NA 3W7OA 3TSDA 4PBEA 3ABOA 4QBXA 2DUAA 4XKMA 2QCMA 5EPDA 3CAQA 5K2ZA 3Q65A 2GGEA 4EOUA 3KWXA 5A8QA 1XC4A 4J3ZA 3WLOA 4PC8A 5LNWA 2ISWA 1A5UA 1MQPA 2AKMA 2WCAA 4GGBA 4ZO8A 2QJNA 3EX2A 1SR0A 1IZKA 5K9XA 2AGKA 3P2VA 3SECA 1LRQA 2BGQA 4MAZA 5DMNA 4C5ZA 3LLDA 4RXFA 2CWNA 1SR9A 1G0CA 1P0EA 3H2AA 3VIOA 1BVZA 5C9XA 3VD5A 2XINA 4Z2IA 1H51A 2HXUA 3MYOA 3BOLA 1VRDA 4MY1A 4DJDD 4GG9A 2HWGA 4C6OA 5HR7A 3PHAA 4OT7A 5CJMA 1LM1A 5LGZA 1KM5A 4GOAA 1FWRA 2ZRXA 1G4TA 4B5VA 4ATDA 3UWZA 1AQFA 4Z17A 3AIEA 3VNLA 3VIHA 3KL0A 2A2IA 3PJTA 3KZPA 1HVQA 2VM8A 1WXYA 1TV7A 1FDZA 2IPJA 5D9NA 1GVOA 1VBHA 4RKAA 4B2DA 3LBCA 2X2YA 1OF8A 3NDOA 1GKPA 5D30A 2XZ9A 3IJ9A 1FWFC 3CLWA 4P2VA 3DESA 1OX4B 1XIEA 4FA3A 2PP0A 3VYLA 3TNOA 2A4AA 5D04C 3BAIA 4BEQA 1QHZA 4QAWA 4DM2A 2A3BA 3MW7A 2WSQA 1X8FA 4CEXC 2Z27A 3N6QA 1P4CA 2H90A 1TPUA 2Z7KA 5CLWA 4C6JA 5C2CA 4CLMA 1NEYA 1GG1A 1TZ9A 2BY3A 1A5BA 4Q32A 3HF3A 2OGJA 1W31A 4CD6A 2QCEA 4GPNA 4A6GA 2OU4A 1ME7A 3PPCA 3NQDA 1KRCC 2QIIA 4KQNA 1OCNA 2VFEA 3COTA 1UD8A 3DFPA 2ABBA 2G3MA 3HOJA 1BSIA 2BHUA 4GGHA 4KERA 4W7VA 1B31A 3BLOA 1OFPA 1C3FA 4HU4A 2XH0A 5KETA 3P67A 1AW1A 2QCDB 3QLLA 1JRBA 2WSKA 1TUFA 3R8RA 3QOMA 2QDEA 3WQWA 1X1ZA 4JIRA 3R0UA 2ZX7A 4DUWA 3TROA 3UXAA 1FWHC 3GW0A 1JCTA 3T0BA 3W6YA 4LUJA 3NWRA 3PY2A 3M47A 5A2BA 1XBYA 4B5WA 1K3UA 3G1RA 2V30A 2VRQA 1ONEA 3PUDA 5CAKA 4AXKA 3E5PA 1G69A 2V5BA 5C8BB 3IIZA 3TW9A 3VVGA 1I2OA 4YTSA 4L9ZA 3URAA 3FYYA 3GTIA 3VDGA 3VE9A 4MWAE 2F6KA 2Q3RA 2FZ8A 4IOTA 1TJRA 3OLEA 3OHMB 1E0TA 4NU7A 1KNWA 2VFDA 4O54A 2FTWA 3IUHA 4UR7A 2FMOA 4QRNA 3CMJA 3B0YA 1GPWA 4WLCA 1REQA 1N2VA 4R34A 4S2BA 3TYCA 3DDMA 4D6GA 4FK9A 1J9YA 4V1YA 3FAWA 3ZIZA 2IW0A 4ERIA 4LC6A 2XVPA 3CT2A 3HQPA 3KBVA 2IKJA 4PBGA 2AQVA 2JKAA 1UWQA 2OOFA 2WKLA 3FEMA 3WNKA 1H7NA 3MSYA 3D3AA 3WH7A 2Y5JA 4GIAA 4KBXA 3GD6A 4PULA 2C16A 3KOZA 4JTKA 1QDSA 3S9YA 2ZCGA 2PRLA 1EH9A 4X60A 3B0UX 2PA6A 1EOKA 4AIEA 1V6YA 3LSBA 1GNXA 3SW6A 3P82A 4B91A 4DHGA 2FHBA 4C91A 2OQYA 2QQ6A 3WLHA 2GLKA 4LX4A 1RP9A 4CCEA 3L0NA 3RK8A 1RZMA 2RGLA 3REQA 4HZ6A 1KGXA 4LU0A 3E3HA 4IL2A 1EPVA 3GM8A 4A8LA 1OADA 2O7SA 2EAWA 4GVHA 2QUUA 3WLPA 3PUEA 1UD4A 3LDVA 1TQJA 1Q66A 3GU2A 4EXQA 3IGUA 4RE0A 1GTHA 4PMDA 1BWKA 1UR9A 4DI9A 4IFRA 2V0TA 2JGQA 2FZ9A 3VC5A 4W89A 2C71A 1UQYA 3MTWA 1DTUA 2Q3OA 3GU1A 1EXPA 4V15A 4Q6XA 1P5BA 1BKSA 1MXDA 5HWMA 3KP0A 2BX7A 3WQVA 5BRBA 3CUJA 4FP1A 4O0QA 3R13A 1Q6FA 4XUGA 1XLMA 3B03A 2VD9A 3FJ4A 2NUXA 3KRSA 1SW0A 3VOJA 1S3TC 2JEPA 2P3EA 3WNLA 2PMQA 4S3GA 2QLYA 4XAPA 4C6EA 3M7SA 3OU8A 3FK4A 3W88A 1S38A 1HF6A 2P10A 3UZ5A 1GVYA 3E6EA 1YE4A 3VFCA 2BY1A 3H23A 5H1WA 4XB3A 2C1IA 5A6JA 4PMVA 5DCDA 5ABTA 1HFBA 4IISA 2HVNA 5DRIA 4HSHA 3C2VA 2ZC8A 3LLFA 3FJLA 3APGA 3HG2A 4H8HA 4LANA 5DLCA 1O12A 2A7RA 3WBWA 4AH7A 2ZZ6A 4LS2A 1NJJA 4L4OA 1G9HA 2QV4A 3UU0A 3STFA 1DJIA 1LLWA 1QWKA 1BGAA 2GJXA 4LBSA 3G5EA 3NXFA 5BROA 4F2UA 2J24A 3U4AA 1JUEA 4XBSA 2OWCA 3OLGA 4KIRA 4E8GA 4UNLA 2NXIA 4LBRA 2BY2A 1CTNA 4GACA 3RM4A 1ICQA 4O4WA 3ELFA 2QHAA 2ACQA 2IXVA 4UC5A 5DT5A 2NVDA 3LPFA 4H2CA 5H8MA 4GUIA 4HOWA 4DBUA 1A5LC 3T8LA 1C9DA 4GUGA 5LXEA 3MUXA 5A8GA 1TE6A 1X1NA 3F7JA 3MO4A 3KWSA 3TXVA 3UG5A 1UBSA 1BWVA 3BAKA 5LA0A 2PUZA 3CB8A 1DOSA 2VCBA 3UEQA 2E5BA 3WBYA 1SW3A 5CC5A 3V75A 2GGHA 3D0CA 1IEWA 2VQTA 2Y6ZA 4O14A 3UZWA 1TIWA 3ZJ8A 1D3CA 3UNTA 1TTQA 4E3VA 3UPMA 1TPEA 2CZVA 1CGYA 3FAXA 1M01A 3TW7A 3BW3A 1AA1B 1LROA 1E6RA 1GORA 3SGUA 3LTYA 2YCIX 4LS1A 4HNVA 2WSPA 3N9KA 1AJ0A 5IXEA 1JCJA 3K13A 2QW5A 3KX6A 3B8DA 4OGZA 1AVAA 2ZZ4A 1V0KA 3EMCA 3LPOA 3EEGA 1V5XA 4MUPA 3RHGA 2D1ZA 4DBEA 5CCZA 3VD7A 3I6EA 3UESA 3UJRA 3R79A 1MW1A 3L0GA 2O55A 4DJFC 3TJ4A 3ARTA 3E2RA 1FH9A 1K7EA 3RN6A 4S2CA 3MBDA 4MAVA 2QCHA 2WJDA 4ENLA 1N55A 3PC0A 4GO8A 3SY8A 3O6CA 3BZJA 3I4EA 2QJMA 1X39A 3UP8A 1IE7C 1W1IE 3TUUA 4CQ8A 1JI2A 3VDCA 3B8SA 4Q8NA 2YCEA 3W38A 2CZFA 1R2RA 4MYAA 4P8WA 1POKA 4O8AA 6PTDA 3ARWA 2DT0A 1KTNA 5AYIA 2A3HA 4MGGA 3N2MA 3GXMA 3YPIA 3MY9A 3RUBL 2X16A 2I5GA 5I3DA 1W1YA 2EKCA 1BG4A 1S39A 3DG3A 1SMDA 3BO9A 1XYFA 5CZTA 3MA8A 4OBTA 1JPHA 5E9XA 1QHOA 3UA4A 2GGIA 3N04A 2NSXA 1P6CA 3OBAA 2D0FA 3TEVA 2PLCA 5CAHA 1LZOA 3ZR5A 1XDMA 4Q4OA 2CLMA 4JTEA 4LUSA 1E3XA 4DJED 2OODA 1XXXA 1B4KA 3VK5A 1LBFA 2W5FA 4JY8A 4Q4RA 2XH2A 3F2BA 1LG1A 3WLLA 3PNZA 1LDCA 3TC6A 4D9PA 3KRZA 1RAKA 4PMJA 3L2LA 4TTGA 2G3FA 4B5SA 4K8EA 1VZWA 3W7CA 2YLLA 3E96A 3NQAA 2LLEA 2C6QA 3CBWA 2WOQA 2WJZA 1EYEA 2OSWA 1UR0A 4IG2A 5FF3A 3PTQA 4PTMA 4KFPA 1E5JA 1J6OA 1GK8A 1S2UA 4LUIA 2X0HA 3GDBA 2QT3A 3NQFA 1IGSA 1CGUA 1BQGA 2QIWA 5DMYA 3B9EA 1BLIA 1CBGA 3LTSA 4A05A 4EXBA 3BDKA 1V7AA 1FQ0A 3PZ9A 4AAJA 2I5IA 3CQIA 4QEHA 1NARA 1H7XA 5HANA 4QCFA 4LTSA 3SN0A 4G56A 2PWVA 3N4EA 4GA8A 5D2TA 3L4UA 2GJNA 5HQMA 3M7WA 3D46A 4O1BA 1R46A 1LRNA 1FHUA 3QGAC 3T42A 1U30A 4LF2A 3ZLGA 1T40A 2EHHA 1AMKA 3LRKA 4AMAA 2GJRA 1R47A 1S3HA 4UOZA 3N3TA 4AUBA 3N34A 1IR2A 1HJUA 2ZWZA 4JAWA 3WH5A 1YBQB 4MJ2A 3BJFA 4E8DA 1CGXA 1Q85A 3G1YA 5G1TA 3P62A 1QATA 4C6DA 4ZL1A 3IVSA 2A3AA 1IWAA 4BHYA 1F05A 3UY8A 3BLDA 5E1QA 5HUPA 4GJJA 3S6OA 2E0PA 5A6KA 4WY0B 4E38A 4HPHA 3PANA 3ARYA 3G77A 3VGGA 5D09A 1RBLA 1JFXA 3VIIA 4Z2KA 1A49A 4ZXLA 4RW5A 1KFKA 4L4LA 1NDVA 2E77A 1I0DA 4BWLC 3AQUA 3N2OA 4XD3A 2H8ZA 4WHBA 3LERA 4BQ5A 1HIZA 2CU0A 1ZTVA 3NZQA 3TSBA 3DX5A 3WD1A 4C60A 3NO1A 3M4HA 4HHLA 1RCQA 3WENA 2YX0A 4Y8FA 3PBGA 3EAUA 4NJJA 2CLLA 1CCWB 4OJYA 1XRVA 1RSCA 2IMRA 1HG3A 2YA1A 2ZUWA 3IRDA 3ZLHA 4ZTYA 4N42A 1MXGA 2HPIA 4DNHA 1LBLA 1PZ2A 1XPGA 4L1XA 3AUOA 1W32A 4TX9A 4XBJA 1Q2SA 1CXLA 2VP8A 4IIEA 1M65A 4YWSA 1FWDC 3QZAA 1QOXA 3KRBA 4GHRA 2PDNA 3WBXA 2P0OA 3EWYA 1M6JA 1V3LA 4KCTA 2A0NA 2WBKA 2NV9A 4C7FA 5HWJA 4AF0A 4CD8A 4LB3A 1B90A 1IT7A 1IZCA 2R91A 1UR1A 2HRWA 4QM1A 4N9DA 4HOZA 3CQKA 5AYXA 1RH9A 3EOLA 1VEOA 1TZ7A 1JFHA 3BQ5A 4EE9A 3EDKA 4O17A 5MHBA 1E0VA 4K7VA 3UWVA 1UB3A 2R1NA 2Y8UA 3KVMA 4XV0A 1UD6A 3UW6A 5GPRA 3UPBA 4DXKA 1FVPA 2ZWYA 4MLJA 1DE5A 1B2YA 1EC7A 4MB4A 5JBFA 4OU1A 4BEUA 1C8XA 2VGFA 4UFLA 2E6DA 3H2CA 1KRMA 2E67A 5A6MA 5B80A 5D8ZA 3R2GA 3VOIA 1V02A 5B7ZA 1UWRA 1KM4A 4AYGA 1Q6CA 1E0WA 4F2TA 3AS1A 3GZAA 1ECQA 3F5LA 4HMNA 3G24A 3MSGA 2PCEA 3URBA 1RY8A 3UZJA 3SUSA 1IIGA 3NGFA 3CT7A 4FX7A 1BXCA 4J1OA 3FA3A 3VD9A 4IGMA 1XJBA 1TMQA 2WWDA 3E9AA 3OBEA 3EWCA 1MW3A 1TRIA 3BCJA 3ITOA 4EWJA 1X1OA 5BOOA 3GNPA 3G1HA 1GYLA 3UXKA 1AH3A 3GDRA 4RV3A 4JTDA 3E2QA 3S2JA 4RPQA 3ARRA 4IJRA 4RW3A 4CQ9A 1XIMA 1T96A 2WSYA 1WKEA 5F1UA 4ZE4A 4XG1A 4BQ3A 5BMXA 4M3PA 4NASA 5HNNA 3EEZA 3QPEA 5HK4A 1R9YA 2JALA 2CZ5A 2QNEA 4I9JA 1ZENA 1ZGDA 5AHNA 5CBJA 3W27A 4O19A 2V5JA 3S0CA 3GTHA 4ZOBA 3EWWA 2WB5A 2FPVA 4D8AA 3W2KA 5ABFB 3OTRA 4AY8A 2POTA 3FS2A 4LAZA 4JFSA 4FLOA 5XIAA 3FVMA 1M04A 3W2LA 4JN7A 3TOYA 3SUVA 3WQFA 2HVMA 3H4XA 3QEZA 4DNMA 4DUVA 3HPZA 3WQ8A 1CXFA 2YDQA 3S2NA 3CWOX 4M6VA 1HJVA 2OG9A 2VOMA 3CEUA 3K1GA 4P5UA 3PWIA 1LUCB 2QAPA 4JKKA 1EA0A 2PP1A 2WJEA 3WF2A 4N6EA 1OX6A 2R1MA 3MBFA 2ACUA 1IWBA 4RZ4A 1CEOA 4H6KA 3W7LA 1ZU8A 1ICPA 3IARA 4V1XA 1UUOA 2FGBA 4AZ5A 3GU9A 2YBTA 1UMYA 2NX3A 3G3MA 3M44A 1KQYA 6TIMA 3GHTA 1KR1A 3CO4A 3NURA 1MUMA 1MO0A 2F61A 3I3DA 4WXZA 3NEVA 4J27A 1UPMB 1A5KC 3MUCA 1W56A 4A3UA 3AU2A 3V0TA 3FNDA 4INFA 1QI2A 5HMEA 1E6ZA 2PU1A 4D6JA 3LUTA 3LHYA 1SO6A 2FFCA 1WQ5A 5FJIA 2AOSA 8A3HA 4KEUA 3KVJA 4Y9AA 1R3RA 3S2MA 3RU8X 1VYRA 3W1UA 4ADTA 2VR5A 2OZTA 2VUNA 2DW6A 2CHOA 2BWGA 1H49A 1XQKA 4IMFA 2OLHA 3PZQA 3EXTA 3NQBA 3QOKA 3UGRA 3OW1A 4HU8A 3E2VA 1OIMA 1HJSA 3OGSA 1XBXA 4PTNA 4EVZA 3ABSA 3N29A 4QNEA 1IYXA 5DFAA 4ZENA 2VC5A 1X97A 2BHZA 2EXOA 2Y62A 1DJZA 2GJLA 3QPZA 1KRAC 1G5AA 4KCWA 3BW4A 3C3UA 4GK8A 3JRKA 2YCLB 5J5RA 1DIKA 3T81A 3H22A 3W53A 3GXDA 1WCGA 3H53A 1KFCA 3SR7A 1W1TA 1YADA 2VYOA 3VGHA 4UQBA 2DORA 4JIHA 2DZXA 3CB3A 4EF9A 3CEPA 3QW4B 3IANA 1Q8AA 4MG4A 2GVLA 1PZ0A 1EOMA 3TLQA 5AHEA 1EX1A 4JCLA 1VEMA 4IFOA 3G1SA 3L2MA 4N4QA 3WJXA 3NIYA 5HMFA 4PUNA 1FUYA 2NXHA 4JX5A 4DIAA 2VR2A 5AHMA 1EC8A 4W5ZA 1R86A 3LG3A 1V51A 1BPLB 4AMCA 4HTYA 1I75A 1WOBA 1VLWA 2V8ZA 2CETA 2XDFA 5DANA 1C8YA 3PTKA 3DC0A 2QF8A 2VENA 4NZJA 5M03A 1DJHA 1JIBA 1V02E 2BP1A 3NZ1A 3AXMA 3MWCA 3CAKA 1PO9A 3TYZA 3FDGA 1HTIA 3ZXWA 1E15A 5G2HA 2CBUA 4C6MA 1E0UA 1NWSA 2YXXA 3IJDA 3AISA 4HU3A 3GH5A 3IIXA 2WMKA 2ACRA 1MMFA 3U2OA 4LY8A 5AHIA 2ICSA 4PCFA 4UR9A 3W1AA 4ILSA 4NIRA 3EBVA 2PGRA 1J0HA 4JQAA 1KM6A 3B05A 1SZEA 4JYDA 4PUDA 3ES7A 1BXNA 1J0JA 4LVAA 1CLVA 3NSMA 2V82A 4FNSA 1JYXA 2O9PA 4OVXA 3NZRA 4TR9A 1BRLA 3VKBA 3ALGA 3PSVA 3R8HA 5LHEA 6ALDA 4QSHA 4OFCA 1PKLA 5MF5A 3CWHA 4Y96A 5HQLA 3P74A 1JVNA 5TQLA 1SUXA 1JNDA 3KCOA 1SJCA 4XSLA 3W1PA 1MXSA 2XG9A 2R1LA 2IKGA 1ZLPA 3OZOA 3CASA 3R0KA 3W00A 3K46A 2X41A 2WMIB 1KLZA 2D2HA 2FVKA 1D9EA 4M82A 3C2FA 3W9ZA 2DVUA 5F2IA 2PD9A 2YZ5A 3WEMA 4AHOA 3LU2A 3RO8A 3TYBA 2DSWA 2YYUA 1VQTA 4DO4A 1DE6A 1XFBA 3V5FA 2JE8A 3MS8A 5FIPA 2W66A 5D03A 1KA9F 4B3LA 2ZIDA 2JFEX 1WV2A 3H7VA 4ZQMA 1W5MA 5FF4A 1GKRA 1TV4A 2AMXA 2HSAA 3N1AA 3S1UA 3UJEA 4DJEA 4F2BA 3S1WA 4PTWA 2BOGX 3WLSA 1FWEC 4JFWA 1RJQA 3SBFA 1E55A 3FCPA 3DERA 4GLEA 1VYSX 5AYYA 3M0ZA 3N11A 2F6UA 3FA4A 1KCKA 1O6IA 4LYPA 4JIEA 5CPTA 4C65A 2J47A 4TUFA 4F79A 3OVQA 4W9TA 3ABRA 3ZJKA 1Q8JA 2IKHA 4JEJA 1Q6EA 5I3HA 7REQA 3WQCA 1PX8A 5LGXA 3C2EA 4R7JA 4YHGA 4MLRA 2E8YA 1M41A 3HFYA 1JAEA 1NDYA 3C0QA 3ZZ1A 1MSSA 4IFKB 4MMWA 2YFNA 4HCDA 1DQWA 3WDJA 3NO3A 4WSHA 2OFJA 1GJPA 2VDIA 1BYCA 2YYTA 3APYA 4KWWA 1EIBA 3SFKA 4PTDA 2VXNA 1DV7A 2IQ0A 3B0XA 2GVYA 2YW4A 4O57A 1AUSL 2Z29A 4NZ3A 4AWSA 3C2RA 1S46A 1BVWA 5JH1A 3RAOA 2IXUA 3CTLA 3CH9A 2J7CA 3SN4A 2NQ5A 1CB2A 3O0KA 1MQRA 3VZYA 1Q6RA 3S47A 2OEJA 1OYBA 4ATLA 2EG8A 3P61A 1LWJA 1ZJHA 3BL3A 3KTCA 2IQDA 4K37A 4JIPA 7XIMA 2WYSA 3KDOA 3MP5A 1Q7QA 2GQ8A 3EDFA 3W2MA 5DQPA 4PCPA 4JTQA 5I3JA 1HQTA 3JW7A 2OYMA 4UOJA 4HA1A 3RPMA 1AW2A 1R2TA 1B3WA 4B9ZA 4HU0A 2GDVA 4EANA 1GOWA 1OGSA 3BGAA 3GKAA 5D32A 4A3YA 2WC4A 4H9TA 4M7TA 5D33A 1MWOA 1WNOA 3CUXA 3UZYA 3T44A 3UGVA 1V6UA 1ITUA 4GJIA 4RDZA 4KRZA 1N7KA 3SRFA 4MY8A 2WNWA 4HCLA 1IR1A 1QPRA 2PAJA 1UUQA 2YZRA 4W8BA 5DO8A 3AMDA 1LG2A 2P5NA 1W91A 1EXBA 4OZOA 1VFFA 1G4PA 4J9JA 1JPMA 4MFDA 1BF2A 1XCWA 3TTYA 4RCXA 1DQUA 2VKZG 4I7WA 4ZODA 4F0HA 3O9NA 1BG9A 4L4MA 5DCEA 4ONVA 4UTIA 6CGTA 2Q01A 1UP0A 3BK0A 3BCDA 3SB0A 4E6MA 3E74A 3S1VA 2PWUA 1IEVA 2J7EA 2IPWA 1OJXA 3HV9A 1T7LA 2FVLA 3IJLA 3BG3A 3PZGA 1SFTA 4LUTB 4UFKA 5F2MA 4QQ3A 2OOGA 1FWNA 1R3VA 4L9YA 4PUKA 3T7VA 1BSLA 4S3FA 1YDYA 4ZSUA 3HG5A 2CXGA 3NVDA 4F9DA 3WLIA 2E9BA 3W1TA 1SYTA 5FEXA 2ZYFA 3TWBA 4MKSA 1YMYA 3PK7A 2B4GA 2O92A 1V79A 4W86A 3MHUA 2HQAA 4US6A 4TIMA 3WLTA 4CU7A 5CEWA 3SUUA 2B7NA 3TE9A 1N8WA 1XG3A 3E0IA 4AZCB 2WM1A 3RM8A 4DWDA 4CNPA 2WHMA 1ESWA 1CXKA 2AL2B 4O53A 5CG0A 3TAKA 3W7NA 4IGHA 3CZEA 1AH4A 2YR1A 3T9PA 2FPYA 5ABGA 3BJSA 1DJXA 2WO5A 3IJIA 4OKDA 4AWUA 6TAAA 2RDTA 1MEWA 2CKSA 3RPTA 1NWUA 3WFZA 2V69A 4R7OA 4F0LA 3M07A 2OZ0A 2GGJA 2BVWA 1SU5A 1DWAM 2DUXA 2GQAA 1CLXA 1A0EA 3TNBA 5ABEA 3TKFA 1XLLA 1XYMA 1TVLA 1D3GA 3NPVA 3W75A 1LL4A 2F2HA 4ZZ9A 3H2FA 4I8DA 1F9CA 2BNJA 2R82A 1R85A 3V1HA 5PTDA 2ZX6A 2P76A 1U2YA 3OA3A 4ROQA 1P48A 3O1NA 1E6NA 3VMOA 2E7FA 2Y4SA 1F6YA 2QMKA 3SFWA 4JL2A 3FY1A 3HTWA 3A9IA 5HINA 3R11A 1RPXA 5T9BG 5JU6A 1UD5A 3E0WA 3DBNA 4WY0A 4TVCA 3IGHX 1TELA 2J9ZA 3L4TA 4U5IA 3H21A 2DPEA 4I7UA 1P0KA 3DYPA 1D8CA 2Y7FA 4AZIA 2DT3A 3FLUA 3GIPA 1SW7A 3QSRA 2HVOA 3TH6A 1KM3A 7CGTA 4FIQA 1PEZA 4ZO6A 2PDHA 2F7FA 1V6VA 3GDMA 2QDHA 3CTTA 3DFYA 3VNIA 1FCUA 2ZZ7A 1E6XM 3STGA 5IHSA 3PTDA 2DUZA 4A3QA 1F8IA 1X6NA 4PMUA 4OOUA 4L7ZA 5F4SA 3D6NA 1OT1A 1JDAA 4GY7A 2XFYA 3ZVIA 2C19A 2WV8A 2OEKA 3H2EA 2GVJA 3ZO9A 2DGAA 4DAFA 4X22A 5DMLA 3W70A 3UPWA 3TCSA 5FI8A 4Z1CA 1QCWA 4UQAA 5G5IA 2WXDM 4IH3A 2YB4A 3SADA 3A12A 1GVEA 5FKYA 4MWAB 3DU0A 1KBJA 1W5OA 4NZFA 5C7VA 5F4XA 4QCEA 3KW3A 3XIMA 1ENUA 2FZMA 4US5D 5IBXC 1SGJA 1PCWA 2V5KA 4FLRA 4LRSA 4JX6A 5H8UA 4NYUA 4DWSD 2D2GA 2XM1A 3TA9A 5IFPA 3IUDA 2ZZ5A 3POCA 5HR6A 4UMCA 4MM1A 1NDZA 4AU0A 3H7UA 1HP4A 2WCSA 3AMKA 1JYWA 3GNOA 1NQ6A 4DXXA 3PG8A 5BXPA 1SJDA 1O1ZA 3NDYA 1JCYA 4IPIA 3W22A 3FX4A 3GTFA 2PP3A 3B8VA 3BUVA 3KTXA 4NXKA 1I9CB 3NQEA 3W6LA 1RXOB 3EOUA 1NFBA 1SZNA 2J7GA 1FWTA 3MZNA 5A8OA 5I24A 1PDYA 1TWZA 3SIMA 1VJSA 1MI3A 3DOPA 3S4TA 2PFHA 3L4WA 1K9DA 2DZBA 2HK1A 5D37A 3CV7A 1AQMA 3EDEA 4JQ3A 4IICA 4XWUA 3KDNA 3QR0A 5E6ZA 5D02A 1RJPA 1RJRA 3T08A 4C5YA 1OC6A 4XZ9A 2ZRVA 1QJWA 1Q4NX 4ERAA 1W9BM 4GUFA 3CZLA 3GDLA 4C6IA 3MSRA 3CPRA 2Z1VA 2Z2UA 3FN9A 2HV5A 3M0IA 3B8IA 1L6WA 2C14A 3W73A 3ARVA 1WDDA 5I06A 3VDHA 3VX0A 1PSCA 2ZQ0A 2L5HA 1I60A 2NQLA 3LX9A 3BICA 4QQUA 4CQBA 5ABFA 1AD4A 4NI8A 1S2T