4I6KA

Crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
267
structure length
267
Chain Sequence
b'MNCIDTHAHVFSTQDHSIETARYAPDYEATVQSFISHLDEHNFTHGVLVQPSFLGTNNQAMLNAIQQYPDRLKGIAVVQHTTTFNELVNLKAQGIVGVRLNLFGLNLPALNTPDWQKFLRNVESLNWQVELHAPPKYLVQLLPQLNEYSFDVVIDHFGRVDPVKGIEDPDYQKFLSLLNVKQHWIKVSGFYRLGATPSNINIAQQAYNIFKEKGFLHKLIWGSDWPHTQHESLITYEDAIKAFKQIVFDKHEQCLILNQNPTELFGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amidohydrolase family protein
publication title CRYSTAL STRUCTURE OF PROBABLE 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE (TARGET EFI-505029) FROM Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 100
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4i6kA00
1ONWA 4LCSA 3HTWA 3LSBA 3A4JA 4ERIA 3QY6A 4IG2B 2PUZA 2Z26A 1DPMA 2FVMA 3F4DA 1A4MA 1POJA 4LCQA 4HA0A 2YB4A 1V7AA 4G7EB 2HPMA 1M68A 1O5RA 1EJUC 2UZ9A 3C86A 2YB1A 2HBXA 4IFKA 2WJFA 4QS5A 1QW7A 1V77A 4DIAA 3IJ6A 3OODA 3PNZA 3FEQA 1XRTA 3MPGA 4E3TA 1JGMA 1A5KC 4IFKB 1UIPA 1ONXA 3LGDA 4QTGA 1PTAA 3IARA 1V4YA 1FWJC 4IH3A 2KAUC 2Z28A 3URAA 4C6PA 1NDYA 2VC5A 4RDWA 3NURA 4RE0A 4LAKA 4QS6A 1W1IE 4JOMA 4C5ZA 4DNMA 2YZ5A 4YIWA 1EJXC 2OQLA 1UIOA 3TNBA 4RDVA 4NP7A 3MTWA 3MSRA 3R0DA 3UBPC 2CZVA 3GRIA 3B40A 2Z00A 5HMDA 3K4WA 4I6VA 1KCXA 1BF6A 4J5NA 1WXYA 1M7JA 1I0BA 4L6DA 3EWCA 4UBPC 4PCPA 4BJHA 1V51A 2QPXA 3IV8A 4C6DA 4C6JA 1KRAC 4XD5A 1FWEC 4H00A 2OB3A 2Z4GA 4H9TA 4KETA 4XAZA 4H9VA 1P1MA 4B92A 1J6OA 4GK8A 3N2CA 3F2CA 4PE8A 2BGNE 3KM8A 3GUWA 1EJRC 1E9YB 4CEXC 4EPEC 2PAJA 2Y1HA 3MKVA 3ITCA 2FFIA 3GIPA 4HK6A 4DZHA 3RCMA 3B0XA 3LNPA 5FSDC 4DI9A 2QT3A 3CJPA 3GTXA 1P6CA 3PANA 1R9XA 3PNUA 4DLFA 4KERA 3UR2A 1GKRA 4QROA 1EJWC 4H9UA 2UBPC 2RAGA 2QS8A 3AU2A 4EPBC 3WZ0E 2GZXA 4BKNA 3F2BA 1YBQA 2ICSA 1K6WA 3K2GA 2WJEA 2VHLA 4GBDA 4C60A 3NEHA 4C6BA 4C6OA 2E25A 3B0YA 3IGHX 4XD3A 3RHGA 3F2DA 1RA5A 2Z25A 3LY0A 1K70A 4ZSTA 5G4HC 4KEVA 3FDGA 4CQCA 2PGFA 4UB9A 4R85A 3QGKC 4ERGA 2R1PA 1FWAC 4CNTA 1GKPA 3QY8A 4GYFA 4DZIA 1V79A 3MJMA 2YXOA 4IGMA 3URQA 2Z2BA 3MDUA 3PBMA 2Z2AA 1FKXA 1YNYA 4CNUA 3E0FA 2Q01A 3URNA 3OU8A 3SFWA 2GOKA 4RDZA 3G77A 5HMEA 2DVXA 3MDWA 4D8LA 2GWGA 3T8LA 4C6IA 3UPMA 4BY3A 1ADDA 4B91A 4LCRA 1FWFC 5HMFA 4LEFA 1S3TC 4V1XA 1EJTC 4H01A 4NI8A 1RK5A 4R88A 3LA4A 1A4LA 4DLMA 2BB0A 2HNHA 1RK6A 1NDWA 3LS9A 4PCNA 1E9ZB 4CQBA 3QY7A 3PAOA 2AQOA 1P6BA 4WHBA 3ISIX 4C6KA 3F4CA 2WJDA 4F0SA 4J2MA 4XAGA 4GY7A 1YMYA 3A3XA 4H9ZA 4IGNA 4KEZA 4NG3A 2VUNA 1EYWA 2ZC1A 3GU2A 3EGJA 1KRMA 2DVTA 3OVGA 4HJWA 3OJGA 3AU6A 2WM1A 3K5XA 4H9MA 3O7UA 4ZSUA 4RZBA 2Z27A 4DYKA 4KQNA 3FDKA 3OQEA 4C5YA 3LGGA 4P5UA 3ORWA 3JZEA 2GSEA 4M51A 5E5CA 3DUGA 4WGXA 4GX9A 4L9XA 3HPAA 3EWDA 4TQTA 3UF9A 3WMLA 1FWDC 4LH8A 3TN3A 5LXXA 1QXLA 5A6TC 4GC3A 2R1LA 3LU2A 3S4TA 4GY1A 3RN6A 4C6CA 1FWIC 4GXWA 3A3WA 2HQAA 2P53A 2QVNA 3GG7A 4XD4A 1YIXA 4GOAA 3LSCA 4G2DA 3URBA 4H9YA 1A5MC 3IRSA 2ANUA 3DCPA 4C6QA 4ERAA 4HK5A 4PBFA 3UR5A 4IF2A 2VC7A 4AC7C 4DI8A 1R9ZA 3HM7A 1YBQB 1WXZA 4XD6A 3AUOA 4IG2A 1FWCC 1XGEA 3WYZA 3S2MA 2I5GA 4WVXA 1PB0A 3E74A 5FSEC 1XRFA 3RYSA 1KRBC 3GTHA 2R1MA 4G7EA 3IPWA 3GIQA 4LALA 2VM8A 1RJPA 1O12A 4J35A 3E0LA 4DO7A 2D2HA 4HK7A 1YRRA 2P50A 3OOQA 4ICMA 1I0DA 3TN5A 2G3FA 3NQBA 4IQJA 3TN4A 4KEUA 2O4QA 4MUPA 4EPDC 1KRCC 1UBPC 2O4MA 3IACA 2ADAA 2HBVA 2XIOA 3T1GA 4LFYA 2EG6A 2R1KA 1ITUA 1K1DA 4RDYA 3DC8A 1A5OC 1ITQA 2A3LA 2AMXA 1PO9A 1J6PA 1FWGC 4INFA 3TN6A 4EPKA 4CQDA 1RJRA 1J79A 1NDZA 2VR2A 2Z7GA 2OGJA 1EF2A 1XWYA 1NDVA 2EG7A 4KESA 1FWBC 2I9UA 4F0LA 4PBEA 2FVKA 4LAMA 5CH9A 4F0RA 2AQVA 1J5SA 4XAYA 1FWHC 4B90A 1RA0A 2D2JA 3BE7A 3E3HA 1HZYA 4GY0A 4EP8C 1R9YA 1M65A 1NFGA 1EJVC 2Z24A 4C6MA 4B3ZA 3MVTA 3S2LA 4I6KA 1A5NC 3E38A 1VFLA 3O0FA 5AKQA 1EZ2A 4GZ7A 4C6NA 2PLMA 4Z42C 2DVUA 2FTYA 2PGRA 4C6EA 1A5LC 3ID7A 4LAOA 1POKA 2Z29A 2IMRA 3V7PA 4OFCA 3GU1A 2R1NA 4LANA 3D6NA 4C65A 2HPIA 3GU9A 4C6LA 1FKWA 3QGAC 4CNSA 3GTFA 1ZZMA 1RJQA 2OODA 3E2VA 4H9XA 3CS2A 1UMLA 1EJSC 4R7WA 1GKQA 2GWNA 4V1YA 1PSCA 2D2GA 2FTWA 3S2NA 2W9MA 4C6FA 4GX8A 4QRNA 4IFOA 3GTIA 4QSFA 4KIRA 3S2JA 2OOFA 3T81A 4AQLA 3CAKA 3ICJA 2E1WA 4KF1A 3MVIA 1RAKA 2Q09A 1IE7C 4XAFA 2EG8A 4CEUC 4IFRA 2F6KA 3SO7A
chains in the Genus database with same CATH superfamily
2DDXA 4PGLA 3H12A 4KRTA 4Q7IA 1RVGA 2BOFX 2EF9A 3S42A 1A49A 4NYYA 2FYMA 1DPMA 3L23A 1V0NA 2F8QA 3UT0A 2A3HA 3B05A 1KKRA 1M68A 4GUGA 4JDYA 4NRRA 3UXIA 4R9OA 4LV4A 1BQCA 1OFEA 2VX5A 3UCQA 3IJ6A 3AROA 4JQAA 3S6OA 3DGBA 2J24A 1VYSX 4W86A 1ONXA 3ES8A 4X22A 1PTAA 5JXQA 1HJWA 2Q3RA 3OZPA 3WDJA 3URAA 4LBUA 3L12A 2Y61A 2FTPA 1G4SA 1XS2A 2FQIA 2VURA 1NP0A 1TB3A 1NFPA 1JDEA 1UIOA 4BA0A 2Z1BA 3MTWA 4NVTA 3HB9A 1O95A 3SN4A 2OEKA 5D33A 3RCYA 2XFFA 4A8NA 3STPA 3ZO9A 2PWHA 1ONEA 2Z2UA 4NASA 2QZRA 1KV8A 2QF7A 3PPGA 3AOFA 1M7JA 1NWRA 1I0BA 3ITLA 3O6YX 4ORMA 3GZAA 3AHXA 5EMKA 4UCFA 4E3VA 4JXCA 4TVCA 2AKMA 4UTFA 3W7QA 4L1XA 4QJ1A 1F4HA 3RJYA 3GC2A 2Z4GA 4JX6A 1XIBA 4EANA 2WWCA 5C7HA 3P6LA 5E1QA 4UR8A 4G7FA 4LTSA 3VCCA 3VIGA 3N4EA 4NXSA 1YLVA 1TQJA 3BLDA 5I79A 3MHGA 4Z2GA 3M5XA 4ZB5A 2QUMA 3QLLA 4QROA 3N2TA 3VGGA 2F6XA 4URIA 4W5UA 2OYMA 1W3NA 1TR9A 2CLPA 3BLKA 3GDTA 3PZTA 1CLVA 1YBQA 3GNNA 2E77A 2FJUB 5JQ9A 3RCNA 1REQB 3C61A 1V3MA 1TELA 3BURA 3B0YA 3RHGA 1O5KA 4RR4A 1VFHA 3E0IA 4MY9A 4H8HA 1GZJA 3CH0A 1JCXA 1HN1A 1TPDA 1VP5A 5CPMA 5HMSA 2WZMA 4JNZA 3VGEA 1A50A 3QR3A 4LB3A 4MYXA 4NILA 1J0YA 4Z2HA 5AB3A 3SRHA 7TIMA 3KCOA 1JCMP 3TV8A 1UBSA 1E73M 3E0FA 1WKFA 3RX4A 1A80A 4GYKA 4QP0A 1VEPA 2J74A 4AD4A 3V5FA 2Z6JA 7REQB 2I1OA 2GGGA 2OWCA 4I9TA 1FWFC 1S3TC 4XZ9A 3SIZA 3UEQA 3CC1A 3EB4A 1NWTA 4WKAA 1L8NA 4GBUA 4DYEA 3QXBA 3STEA 4PCNA 3L2LA 1ICSA 3CWOX 3LTSA 1HG3A 1LWJA 3QW4B 4ORIA 3NWRA 3TE9A 2WMIB 3IJDA 4PBGA 2V67A 2D73A 4PUMA 4WZHA 4XKMA 3NOEA 4UWMA 4KT2A 3L4UA 3C0LA 3AU6A 1UZDA 1J0KA 3PBVA 3N2OA 2E0PA 4F48A 3APTA 1JD9A 3NQEA 4JTTA 1RP9A 3WMLA 2V68A 2OELA 1W3LA 4R33A 1OX4B 5CZKA 1TPH1 1GYMA 4O57A 3GVQA 2FGBA 5GQBA 3Q45A 1UWQA 4L56A 2HS8A 2ANUA 4ZE4A 3WLSA 5AC6A 3POCA 2VC7A 2JF7A 1R9ZA 5D4YA 3GQYA 4IPIA 3GNRA 3HPSA 5DCEA 3LDVA 1ZSXA 1E51A 4OBRA 4AWSA 1KRBC 3GX9A 3TW9A 3U0HA 4LALA 4DO7A 2DU2A 3EDKA 3QHNA 2G97A 4QBXA 3VNIA 1FFRA 3GC4A 2J9XA 1FWTA 7A3HA 3TVAA 3LHWA 4DJFA 2WHJA 1XIHA 4H83A 5PTDA 3E0VA 3FVMA 2XIOA 2WO5A 2X42A 1UR4A 5A6LA 1A5OC 3G3DA 4EAYA 3K8MA 4O1DA 3UJSA 3Q65A 2ZC8A 4IMGA 1CGUA 1F7BA 1IEQA 3IIOA 1KFLA 2WC4A 3HO8A 3MMTA 1NDZA 3QQWA 3EZ4A 1QR7A 1XWYA 2EG7A 4KESA 5JBEA 4DZAA 1KBJA 4Q8PA 5CPNA 5DMNA 3LZ3A 1LOSA 3B4UA 4DBDA 1J9YA 2QMKA 4TMCA 1UOKA 2GQAA 3AIVA 2ZWZA 4B3ZA 2FZ9A 3PZNA 1FVPA 4NZJA 2VFHA 2QCHA 2V0TA 2FTYA 1YDVA 3M1ZA 4WXYA 4C6EA 2G50A 2VYOA 3RM9A 3PZQA 1CGXA 1F76A 3MKKA 3LLXA 4XWUA 3I3BA 3A64A 3A9IA 1HFBA 3FFSA 2A3AA 3N3TA 3PSWA 4C65A 2HPIA 3GU9A 3V0TA 4CNSA 5TIMA 3WLKX 3SJNA 2OODA 5CZSA 3TDFA 1CYGA 3WNKA 4KCVA 4KRUA 1HKIA 3R12A 3N9KA 4JTJA 1CXLA 2OX1A 2B4GA 5DRCA 1O6IA 1HP4A 1Z32X 4JTGA 3MU7A 1B4KA 2FVLA 4IFOA 2X0YA 3UG4A 1GW9A 1KC7A 2WB5A 3N19B 1RAKA 3P61A 4LUYA 3CAQA 5T91A 3EWXA 2FFCA 1LG2A 3VI2A 3H2OA 4IPNB 3S47A 1IR1A 4PL1A 2HV5A 1UZHA 5C70A 5F2GA 3OVRA 3K1DA 1WOAA 1OF6A 4D2JA 1U1UA 2EPKX 3WFZA 3KRUA 4Q8NA 4BQ5A 4XO6A 4ZE5A 2ODOA 3WD0A 3LV5A 1F5ZA 5XIMA 5CC5A 1L6YA 3UXLA 3OODA 5GNXA 4QJ4B 2X16A 1BGAA 1XBYA 2UWFA 1A5KC 3NYDA 2C6QA 1W9DM 2Q6ZA 3R79A 3USZA 3GBEA 4IM4A 1PE1A 4QLJA 1AQFA 3CQ0A 3MZ2A 4PUJA 5EA9A 4EXQA 1E5NA 3MMDA 1ZCOA 4RDWA 4O16A 4RE0A 2X30A 2W67A 4FLQA 3HFYA 1OINA 1GG1A 3S5ZA 3AWNA 4RDVA 1NF0A 3OEXA 5TF0A 4YVXA 4POCA 1P7TA 3E9AA 5I78A 1HGYA 3FK4A 3OVPA 3QC0A 2G3JA 1VJSA 2OFJA 3SI9A 3RILA 4MG4A 4C6JA 2C16A 1FWEC 5LNVA 5F4WA 5HNNA 2D69A 1Q6FA 4US5A 4GIYA 3ARPA 1BHGA 2F7FA 3KM8A 3W86A 1QW9A 3GW3A 1LORA 2QMJA 3OTRA 3HG5A 5EY5A 1O4UA 4PSRA 4C90A 3A22A 5AN7A 3WH6A 4W89A 3PNUA 1YPXA 4PMNA 1AW5A 4Q8TA 2FKPA 2OYKA 2GZXA 2DH2A 1XBXA 3IGXA 2GGJA 3ZVHB 1GOQA 2WOQA 4NKCA 1JCLA 1RA5A 1KV5A 9XIAA 2Z25A 3B0PA 3EB2A 5G4HC 4Q32A 3S83A 3KLLA 2DSKA 3SY8A 4DZIA 4Q8MA 3E5PA 1KR1A 2Z2BA 3STCA 4CU7A 2CCRA 3V4BA 2C13A 3IJIA 4S23A 1MXGA 4N2YA 3W29A 2FHBA 4JCMA 3LBCA 1J8VA 3DBPA 4RV3A 4O19A 4GRSA 2J6XA 3GDBA 3O2LA 4S3JA 1CGYA 3NUKA 2HTMA 1RK5A 4GYPA 4QQ3A 3WLTA 1SZEA 3CV2A 1XKYA 3ECQA 4OIFA 3AYRA 2Y7DA 1TPUA 3PZOA 1W37A 3GAYA 5CPSA 2E4TA 1UJPA 3DFOA 3O3RA 1WOBA 5KZMA 1Q65A 4C6KA 3WSUA 4J7RA 4Y9NA 4JCLA 3TTOA 3HGSA 2PWDA 1ITCA 1KQZA 5LGXA 3C56A 2NUWA 3VA8A 4ZO9A 5FF0A 1QBAA 2C15A 4JYDA 4AVNA 1QASA 4GJ1A 4H9MA 4HU0A 5LSMA 3RX2A 4ZEPA 3NL6A 4C5YA 3L5MA 3THDA 3OQ8A 3D3FA 2V6AA 4GI6A 4MJMA 4L9XA 3G0SA 2ATSA 4MM1A 2NXHA 8CGTA 1R3WA 3EXRA 1QI0A 3WQFA 5JH1A 1OC5A 1U5VA 4H2HA 4Q4RA 3ZIZA 3AMDA 2YCLA 1FTXA 4TIMA 3B06A 4PMYA 3LYEA 3RLGA 2QULA 1DHPA 3RFAA 3ZZ1A 3UP8A 1X6LA 4Q4QA 4HYVA 3DFHA 1NWSA 4JFWA 4A8IA 2CPUA 1LBMA 3PFMA 3W07A 3G2GA 4UQEA 4MLRA 4IWWA 3LCXA 3SCQA 4JTFA 5H2ZA 4QFUA 3VGDA 3ABQA 4WY0A 1QTWA 3SQLA 3C0QA 2P8BA 3EX6A 3DHFA 3QOMA 3JR2A 4O50A 3RU8X 1JPIA 4NIRA 4AD3A 4LW7A 2FIQA 4FOKA 1UZ1A 3OOQA 4ICMA 2CZFA 5D8WA 4GCAA 4HMCA 3BJFA 1HW6A 2H3DA 3CL6A 2VQUA 4MUPA 2DZBA 4GQGA 3OA5A 2EKCA 1TVNA 5LHFA 4D71A 3P3BA 1ONRA 3IUIA 3N15A 4OJYA 3G0UA 3OHMB 1KKOA 3HJEA 2A3LA 4BEQA 2ZUSA 3OYXA 1VHNA 3G1SA 1JD7A 3L9CA 2Y7FA 1AW1A 1AQ0A 1ISZA 1J2WA 3TXZA 1FWBC 3ITYA 4PBEA 4K38A 1IV8A 2WYSA 4OUIA 1OT2A 1C3FA 3F4WA 2HZGA 2O92A 4OUEA 3TC6A 1RCQA 3MVTA 2X09A 4LOCA 3CU2A 3S1XA 4QJ5B 1LL4A 1TE1A 2PLMA 2EPHA 1P1XA 4Z42C 2ACQA 1XLDA 5A6SA 1XLCA 2PGRA 3DC0A 2DZXA 2YXXA 1RHCA 3SZ8A 4FNPA 2R82A 2TYSA 3THQA 5HPOA 4D1IA 1DE6A 5TNVA 1YE6A 2JALA 4CCEA 3D6NA 3BCDA 1T5AA 7CGTA 3PBUA 5BXRA 4GI9A 2OR2A 4B5XA 2VZUA 2P0IA 1UMLA 7XIMA 2B31A 1XD0A 3R89A 5I06A 5T9CE 3SN0A 3VMPA 1XYCA 2ZRYA 5GJPA 2AL1A 2E1WA 3MVIA 2FMOA 3C0SA 4Q8WA 4CN4A 1VFTA 3C8FA 4HCDA 4UC5A 2GPTA 3YPIA 2J9YA 5LGZA 1BPLB 4MJ4A 2DGAA 3MI2A 2Z26A 4FNRA 1CZ1A 4V28A 4Y96A 1TG7A 1JCNA 4FXJA 1AJZA 1EJUC 4KPLA 1WNOA 3C86A 1TX0A 1SPQA 1TJ0A 2WJFA 3OLDA 2Q8XA 2GL5A 3IRDA 1SYTA 4I90A 1WDRA 1QPQA 3GK0A 3GHTA 2ASHA 1T96A 3SSZA 3UNTA 5C54A 1U5JA 4QQUA 1HJUA 4HSNA 5C71A 3W1UA 3BCFA 3L65A 3IJ9A 2WHMA 1EC7A 1BVNP 3WD1A 2BV9A 3WQWA 3ZSTA 4PUEA 1F6YA 4HU3A 4AXKA 3I4EA 3QH2A 3MO4A 2PFHA 3R43A 2YCKX 1GOWA 3DHDA 1VBJA 4O12A 4PMRA 3KBVA 3EEZA 1RLDA 2PF8A 2ZTKA 1B3ZA 4C6DA 2JBMA 4DNHA 4DM2A 2GJXB 2IQDA 3PUOA 4O28A 1XDLA 1Z6KA 1QJWA 1TIWA 3PUDA 3SRKA 1RQBA 2G5WA 2QR6A 1E9YB 1WDPA 4W84A 5FA5A 3WLIA 1U1HA 2ISFA 5D2XA 4M81A 4CNNA 3E1F1 2ZX6A 1OABA 4MNJA 1TPVA 3C2YA 3WNOA 1P6CA 3G1RA 1SZRA 1UC5A 1YPFA 5BYWA 3ZVHA 1DJWA 4LUJA 1KBBA 1TZ9A 4IMAA 1NM9A 4AZ6A 2G37A 2ICSA 1A5UA 3N12A 2E25A 2J7CA 3DIPA 1CXFA 3CAVA 2YBUA 2DSUA 1E0XA 1KB3A 4GXPA 4ZZ9A 3GVWA 3URQA 1OT1A 1M53A 3AFBA 1HL2A 4AXNA 4UOJA 3QLDA 4EKJA 3LQGA 3GNXA 5GJMA 8XIMA 2XVGA 4Y9AA 4GJIA 2V5BA 1W91A 1PVNA 3DYPA 1EHAA 2Y7EA 3P2VA 4MAVA 4GG9A 3VOJA 2HK1A 4GYJA 1HO1A 4LEFA 1K3UA 4H01A 3AQUA 5XIAA 4MVAA 3LA4A 3RO6A 4J3UA 3W76A 2NZLA 1UQYA 4LXFA 1WUFA 5HJYA 2V81A 1IZJA 4LS2A 1IIGA 4IQDA 1L0PA 3UR8A 4A35A 2Z7KA 2GQ3A 2YFNA 3PBGA 3FYPA 3NDOA 4AVFA 3A3XA 3M43A 2WZTA 4MSSA 4NNBA 3WUGA 3P5ZA 4NHVA 3QKZA 5I3HA 1KTCA 3N04A 2WANA 4JHZA 4EE9A 2Y5EA 2Z27A 3HGRA 5AHNA 1S5VA 5DELA 4OBTA 3WH5A 5DT7A 3FS2A 5GNYA 3GXTA 4M6VA 4TU1A 2D20A 1NARA 3S1VA 2DSVA 4CD7A 3EB3A 4GHRA 1GZ1A 3FSTA 3N4FA 2RUSA 4XD4A 2OKOA 3WQ4A 2J8GA 4ZOEA 4FB7A 3JZUA 5IBXC 2QLYA 3KS6A 1FDJA 2QQ6A 3WBWA 1RZMA 1G67A 3G18A 3ITTA 1FXQA 1TKKA 3CTTA 2I5QA 3BAIA 3WYZA 2E68A 3BG3A 2O9TA 3I3DA 5D30A 2I5GA 4JY8A 2TRSA 5DBTA 1VIZA 1JYXA 1G6CA 3NXLA 3P80A 1TSIA 3VIKA 5H8MA 2PD9A 3AWOA 3O06A 4PUDA 2PTZA 3SUWA 2FPTA 1I0DA 4BWLC 2GJNA 1M6JA 1AL7A 1HJVA 1DE5A 3VKJA 2DQWA 3AI0A 1ZRQA 4Q6JA 5CC6A 4LFYA 2EG6A 3SN1A 3VFCA 1XIGA 1DWAM 3DC8A 3USBA 4AD2A 1CPUA 2O7SA 4W8AA 1JZ8A 2E6YA 4L4PA 2WCAA 2ZX8A 5CSRA 1U83A 5D2VA 3W7MA 1RBAA 5A6BA 1QHPA 4H7VA 1C9WA 2I9UA 1HIZA 2J88A 2OZ0A 2FVKA 1NH6A 4HBKA 1CENA 3SB0A 3VKKA 1RA0A 3E3HA 4FPSA 3RU6A 4Q22A 3VMNA 3TWBA 3G3MA 3SUSA 4KWOA 2PGWA 3NQ6A 1XP3A 5BNKA 1XLFA 4FNTA 1WZLA 3TW7A 4ZQCA 3WH8A 1ICPA 2Y88A 1AQMA 1XDJA 3TXVA 3NSXA 2CESA 1BTCA 3ARWA 4IMDA 3EXSA 3A3HA 5IBXA 3F4VA 1FP9A 2R1NA 3EPNA 2DZAA 1ZZMA 3B8DA 3PB2A 2YLLA 1ELSA 3LCGA 4O1BA 3KL3A 1YNQA 2VQTA 1B5TA 4NJKA 2GWNA 4WKHA 1D8CA 1OFRA 1PSCA 3PG8A 4KWVA 3W2JA 2WNZA 3OG2A 4IZGA 1XIDA 3H54A 2OCZA 4YPJA 4DO5A 1IHIA 2Q09A 4REQA 4IFRA 4K2SA 1WUEA 2Y70A 3BOFA 1YXCA 3AS2A 1XLAA 3UPWA 5AC7A 1OFAA 3GG0A 3GSMA 2W63A 4HA0A 1ZBCA 1UD5A 5J04A 3T7VA 2VGGA 4Z1BA 5B7ZA 2DP3A 4FSAA 1UMYA 4B5UA 3H2NA 1DWGM 1OX6A 1PUDA 4IPJA 4IFKB 1SO3A 5KEZA 3SAZA 3E6EA 1X39A 5CJMA 1AJ0A 4E2DA 2ZZ2A 3W1NA 1GOXA 1O5QA 1KBIA 1VYRA 1DWFM 4XIMA 4UTHA 4JTKA 3BDKA 1E0WA 3NG3A 4UIOA 5JIPA 1XPYA 3K8LA 3VIFA 3W7NA 3EWYA 5ABHA 3K4WA 4P8WA 4WRHA 2DIJA 4TTGA 1K9EA 4HPHA 3VD7A 1G9HA 1KFWA 4NAEB 5AHFA 4A2SA 5LZLA 3EBVA 4YNGA 3OBKA 3FJ6A 3RNDA 4H00A 3UY8A 2D0GA 4ZQRA 1KM0A 3UFYA 4W88A 3UWWA 4M56A 3MUY1 3CV1A 4AX6A 2ZXDA 3LNPA 1UH4A 1A3WA 1HX0A 5LIYX 3PUGA 1V93A 3UR2A 1GYLA 1NOUA 5HPCA 2ZOXA 3QRHA 1T8XA 3B8SA 3BGGA 4EPBC 5HANA 3PPFA 2G3MA 4C60A 4GBDA 5AZ1A 3E2RA 2DJXA 3QOKA 4G9PA 1QI3A 3AIUA 2XGZA 3B0VC 2FZDA 3WH9A 3A4AA 5E6ZA 3QN3A 1F4AA 2Z2AA 2NLYA 4QITA 4LBSA 4UR9A 1WZKA 1VYPX 3AHZA 3C2VA 1KGXA 3V3WA 2F2KA 1BWKA 5DMYA 1SJAA 2PURA 3VX1A 2W79A 4KMQA 4XBJA 2YBTA 3GO2A 3N25A 4WUIA 2XGBA 1H7PA 4JQ2A 5MKGA 4IIDA 2QJIA 2HNHA 1NWUA 2YKKA 3I65A 3KOZA 4QXIA 9RUBA 4K37A 3H2EA 3R7MA 3N11A 2YR1A 4FALA 2WPGA 3W7DA 1V3KA 3GUGA 4JX4A 4KEZA 1EBHA 3T0BA 1YQ2A 1BWVA 3W2MA 3AXIA 1FP8A 3ANUA 4B4HA 4D9PA 4B2DA 4N6FA 2BOGX 3N29A 3GH5A 2OYLA 5KMYA 3AYTA 4ZXOA 2J4GA 1PHWA 3K8KA 3KOWA 2HDJA 3VC6A 3OZOA 4XZNX 5D38A 3GDMA 4L9YA 4LH8A 8XIAA 3TQ0A 3N73A 2G95A 2RJGA 2R1LA 3R2GA 1YEYA 5BOEA 2OEJA 5ABFA 4KFPA 3KCLA 3GG8A 3U48A 2NWSA 1ZTVA 3HV9A 3LSCA 3NDZA 2E5DA 2OZ3A 1AQHA 1K7XA 4FLRA 3A21A 4PBFA 3W88A 1BYBA 1CLXA 4WDWA 2BNJA 4HTYA 2YA2A 5C55A 4EXAA 3UJEA 1XGEA 3PP7A 1J0ZA 3WK1A 5A6AA 3WBYA 4WVXA 2CXEA 3E74A 3CIWA 3TW6A 1H1NA 1XBVA 3NVDA 2O55A 1VLWA 2F61A 2B7QA 4FNUA 2HS6A 4GVGA 2H90A 4HK7A 1SW7A 1QPNA 3VD5A 5G2HA 4EPDC 2WC7A 4LRSA 3WUBA 5HUPA 1JDCA 1S2TA 3V35A 1PBGA 3AIEA 6CGTA 2EKGA 3AAMA 1ITUA 1DHKA 1L6SA 1PIIA 3O05A 5C9UA 3UZXA 2G0WA 1EGMA 3E5BA 3RAOA 1S39A 2JF6A 2XZ9A 4O0KA 5BXPA 4CNPA 1J79A 3EWBX 4QSHA 4WLCA 3ZJ8A 3VM5A 3UY7A 2Z7GA 2OGJA 4PMQA 1GVYA 1R46A 4PMZA 3W1QA 1TJPA 1J4EA 5LIKX 3BAYA 3ATZA 3IS4A 3BE7A 5CKSA 2BTMA 2E9BA 1IXPA 3M0JA 4YTQA 2XIMA 5HNTA 3DBNA 3KZPA 4I6KA 3PM6A 4ZFCA 1IR2A 3MUCA 2TMDA 4P7RA 1XQLA 2F2HA 3B8UA 1PWMA 2POZA 4UFMA 4NJHA 3LK6A 4RPPA 4P8UA 3LEPA 5AOUA 4MKSA 2VZOA 4RPQA 3P67A 1AG1O 1MQRA 2ON3A 3CS2A 1YDYA 3W53A 1XLLA 4R7WA 1PKMA 2GQ8A 5CJNA 4MPKA 3ABOA 1QCWA 1DORA 1OG0A 3P5YA 3H23A 4GUIA 4B5SA 5CLWA 1Q8AA 3SCVA 4BZYA 4GQQA 1D9EA 4TVDA 1JI2A 2MNRA 4UTMA 1QBBA 3CEUA 1Y7VA 3KOYA 4IGHA 4YHEA 1Y5XA 2P1FA 1UR2A 3HZ3A 2ZZ1A 1BRLB 3VZYA 2C8NA 4CGTA 3FJLA 1BYAA 3BQ5A 1E1CB 3W27A 3NQAA 2XN0A 2YYUA 3PTQA 3F5LA 1XC4A 3CZKA 3W7JA 5BZAA 4IFKA 2BFGA 2ACSA 4Z08A 5DMLA 3ITOA 4QS5A 2D2OA 3W7GA 2DFAA 2ACRA 5DT5A 3VKBA 3PZ9A 4TO8A 4CUCA 3CQIA 1IIHA 2XN1A 3FHQA 4H04A 4UMAA 3MW7A 1W9BM 5AHMA 1SZFA 1Y5WA 3OPSA 4X61A 4JTIA 4LWWA 4CN6A 4MUZA 1JDFA 3ABZA 2PP3A 1W1TA 4WDTA 4HVXA 2BY1A 4C5ZA 1QNOA 2YZ5A 2DPEA 3VX0A 4XKYA 1IGSA 3B40A 3DGRA 1YPIA 4K8HA 5HMDA 1S5WA 3V36A 2VEFA 3OO2A 1Q2RA 2XUCA 3AISA 3CBWA 3O6CA 2QAFA 4WDXA 5LA0A 3EWCA 1XKJA 3MV01 2INEA 4YVPA 3UVIA 1SFTA 1FXPA 1VHCA 1KM4A 2D3NA 4YCPA 3K13A 1LYXA 3WD3A 4IQLA 3T6CA 2VEGA 5LIWX 3PN8A 1GGOA 4PCFA 4CEXC 1ZGDA 3GDLA 5D37A 3H2MA 3TONA 2HXTA 1RPXA 3RJXA 3B0XA 1F73A 2DY3A 3MYPA 3CAWA 3C0JA 2AL2B 2VEMA 4MNMA 2ZQ0A 3O07A 1GK8A 3MO7A 4N7QA 5DMMA 1ESWA 1DBTA 3ATYA 4E2OA 1N55A 3GHSA 1LUCB 4XTIA 3UZJA 5K2ZA 5CZ0A 3G8EA 4AZ7A 4BR1A 4MJ2A 4UNIA 5FJOA 3MJMA 3UPBA 2YXOA 2YIHA 4YHGA 3R1ZA 4DJED 2RDWA 3MDUA 4U2ZA 1JJKA 3EX3A 4HSOA 4CNUA 2FLIA 1EIBA 1AD4A 4LSBA 4J27A 4L7ZA 1VFSA 5HMEA 1NP2A 3VGBA 1MW2A 4Q8QA 2NWRA 2E8YA 4AIEA 2YX0A 3DXIA 5I5RA 1VH7A 2XFWA 1J12A 5LIXX 2QDGA 4UTWA 3WENA 1XCWA 4TX6A 4HOZA 2UV8G 2GVEA 5F1UA 2GGEA 3JVAA 3K30A 3AS1A 2A1YA 5MHBA 3F4CA 5A8GA 4L4LA 1YDOA 2XIIA 5KETA 1GJPA 1EGZA 2XVLA 2ZZ7A 4LB4A 4V2XA 3U2OA 1JZ5A 1C8VA 1Q63A 3F5JA 5AC4A 2FHCA 2C0HA 3EPOA 1WDWA 1L6GA 4DYKA 1V08A 2V2HA 3C8NA 4B3LA 3JZEA 2VENA 4WGXA 1UD4A 3TN3A 4KGLA 3LMZA 3F7JA 1W1YA 2B0MA 1LL6A 2HVNA 1H09A 1KM2A 3KBJA 4DWSD 3P14A 2H6RA 2VCBA 2W6RA 5H8PA 4U28A 1M7XA 4UTTC 3NPVA 2B7NA 2HROA 2YDSA 1JGIA 4DO4A 3OZMA 3CLMA 3FAWA 3FJ4A 4UR7A 2IPGA 1WXZA 4C7FA 2J8FA 1FQ0A 1E9IA 3GTHA 1G01A 2WAGA 4S38A 2UY5A 1PKLA 4PH6A 1S38A 1V0KA 1YHTA 1OZMA 4PMJA 4J35A 2VR5A 4Q8VA 4IQEA 1WDDA 1I75A 2YGYA 4W5ZA 2Y24A 5D8ZA 1H0GA 4AZGA 5BROA 4KCUA 4PUNA 5EGRA 2DJLA 4K39A 2ADAA 3W72A 2WCSA 1E6XM 1P5BA 2Z1XA 2PWEA 3E96A 4IL2A 2AMXA 2OT0A 5I3IA 3NXFA 4O15A 1I60A 2GK1A 4QDMA 3BCJA 1XGZA 3L4WA 4D6CA 2VR2A 4M6UA 4GNVA 2ACUA 3FY1A 1L9WA 3POHA 1EH9A 2PWGA 1UR9A 1E40A 1PZ3A 4HMDA 1PJ9A 2J7FA 1NEYA 4K3ZA 1DIKA 1LWIA 1ZB5A 4B5TA 1EZ2A 1R3TA 3M64A 5DQPA 3EX4A 3EDFA 3RM4A 4UTTA 5DY3A 1A5LC 2FH6A 2WBGA 1SM9A 4J3ZA 4MMWA 4JPGA 3VC5A 4PULA 1K4HA 3HQOA 3PS7A 2I7GA 5J8LA 2INFA 1MI3A 1NOFA 1ZBKA 5CJ5A 2XTKA 5IFPA 1KFJA 1GQLA 1WO2A 1WKYA 5FAGA 4NJJA 1GKQA 1W0MA 2FPVA 3BK0A 1JF5A 4S2CA 3UXKA 2YL9A 3SCOA 2ZZ4A 2FTWA 6XIMA 4D6GA 4MOZA 3AICA 1A5AA 2VZTA 4PB5A 4DBWA 3QBUA 1NTHA 1S2WA 4GNJA 4WKFA 4L1GA 1G1YA 5A8MA 2RHGA 3R94A 3UWEA 3THUA 3BOLA 1E1CA 1SZNA 2ZDSA 5CPOA 5EMLA 2B7PA 2ZUNA 4JHMA 3DECA 1W9VA 2QKFA 4MWAD 1X98A 4X9YA 1OD8A 4LCQA 1CBGA 3TAOA 5CBJA 2XVKA 2VEIA 3ZLFA 3NQGA 4QJ3B 5I09A 1QW7A 2ZICA 2OX4A 3VUSA 3C6CA 1CXIA 4MDPA 2I56A 1ZUAX 2YLAA 2GVLA 2J77A 1YYAA 4MWAC 4FEZA 4ZR8A 3WDIA 2WKJA 3PZGA 4Y2WA 7TAAA 1H0IA 3NURA 2V30A 5REQB 3S46A 4DNMA 4ZO8A 4PCTA 2OTDA 2OQLA 3A23A 4B5WA 3S1WA 3BAKA 1F74A 2BY3A 1H50A 3FYYA 4E2VA 2GSHA 4ZFMA 4Y8EA 1SGJA 2PDUA 2A85A 1FX6A 4PCPA 1QHZA 3WLRA 2WSYA 4LUTB 2VEKA 1VFOA 1ZS2A 1EDQA 3LN3A 1HT6A 1J6OA 3PUEA 1WPCA 3LHYA 2GVGA 3V5OA 3A5VA 2JE8A 4GO9A 3NFUA 2CZDA 3RUBL 2AL2A 2AKZA 4GUJA 2GJLA 1CT5A 5FSDC 1UUQA 3I4KA 2HE5A 4DLFA 1X8CA 4AF0B 1E0TA 2X7WA 3LGEA 4L5ZA 3U57A 4X3ZA 3MUZ1 3CPRA 3S5NA 1V7YA 3U2EA 2PPGA 3NEHA 4XZIA 1W1A1 1KXTA 1ZJHA 3F4NA 3L5LA 3MA8A 1CDGA 4U3CA 1Y8BA 3UWZA 1LT7A 3E02A 3VU2A 4GNKB 4GIEA 1D3HA 3W2KA 4X2RA 1VPQA 1HL9A 2GDQA 1ICQA 3RM8A 4CLMA 2NV9A 5LHEA 3RR1A 3T78A 2IPJA 5EB8A 1OVDA 4QISA 5AYYA 2PDKA 3UQNA 2ZA1A 1KWGA 3M0LA 3F5KA 3FKRA 4AYGA 3VNDA 1FY6A 4NU7A 4L80A 3T8LA 3SECA 4HHPA 4BY3A 4HTBA 4QDWA 1MNZA 3SJ3A 1EJTC 4HYWA 4K7YA 4A21A 3W0KA 3PBYA 2ZX5A 1UR1A 1E4MM 3T4WA 3ARSA 4JGDA 2REQA 3W6YA 4UCGA 3I7SA 2PU0A 2CWXA 1G0CA 3CT2A 5FJRA 4WHBA 1V6TA 5HR7A 4NF7A 3CWNA 5G4EA 1LM1A 1YMYA 4PMDA 5A95A 3BARA 1PEZA 1DJYA 4GFSA 2CYGA 4HJWA 1Z3NA 4AZCA 2A7RA 3R6IA 3DKLA 3WNPA 3NCOA 4XSLA 4FOUA 1MVYA 3FDKA 3NYZA 2QXWA 6TAAA 1OY0A 1PCWA 4O1CA 2OPJA 2CKRA 1SJBA 4WEVX 1P4CA 3CQKA 4GCXA 4GC3A 3LI1A 3S4TA 3T2QA 4UNLA 1I2NA 2A6NA 1R2SA 4RX0A 5BXTA 2HISA 3ZM8A 4FF5A 4AHPA 1MZRA 2RH9A 3UZYA 4ZO7A 1JR1A 1A5MC 1FCBA 2VFDA 1CGVA 3BWWA 4MAZA 2J66A 1MRQA 3VKCA 2PTYA 3RLUA 2BODX 2ZUMA 2V3EA 4NZFA 2AGTA 1MDRA 3S2CA 3WLHA 4ZQOA 3S2MA 4TX8A 1W3JA 1GWJA 1GQIA 1T99A 1A0CA 2R1MA 3SCRA 4Z1CA 3N34A 5G4WA 1O12A 1UR8A 3VE7A 2D22A 5KZ6A 4QE5A 1GT8A 1D3GA 4HOXA 1VJIA 2D3LA 2Y8UA 3AXMA 3TN4A 4L64A 4H1ZA 3WEZA 4IP7A 4L65A 4NAFB 2W91A 4Y9PA 5GPRA 2CERA 5A8NA 4FA3A 1JAKA 2DIKA 1QNSA 1H5VA 1Q6OA 4ES4A 5LNUA 4TV5A 1EWEA 3B4YA 1KW1A 3HA1A 4B9YA 3LPGA 3AHYA 4FS9A 2D24A 3SSJA 1X7FA 2WHKA 1XRSA 3BSGA 5BU9A 1QU4A 1F6KA 1XLMA 1W1PA 1TV7A 1E1FA 1Q45A 4W85A 2CBUA 2XIBA 3BC9A 3SQMA 3TSMA 1OC6A 3S9ZA 4LAMA 3PBWA 4M5PA 4XAYA 4IPLA 3TSBA 5EFFA 3TA6A 4YL2A 4OGZA 3LLDA 2OO6A 2PODA 3HPXA 4Y8FA 4LQ1A 2VT0A 2GVYA 2VO5A 3QYSA 4OKDA 3NQFA 4IIBA 4BHYA 3MS8A 5C7VA 4EK7A 2VX6A 4MZYA 3UYCA 1LOQA 2X7VA 3V7PA 1F07A 2L5HA 3W2UA 4HNVA 5LNSA 2VRJA 1EYEA 4GQRA 4GABA 1DIDA 4LNCA 1XHGA 1FKWA 1VD6A 3GR7A 2FZBA 1FUYA 4MF4A 1PCKA 4JL2A 1Q6RA 4P2VA 5DX7A 4NT0A 4HCHA 3G6MA 3I68A 4A3QA 4HHMA 4UOQA 3KOXA 3NDYA 2Y5JA 1YW1A 3VZXA 4NQ1A 3VIHA 3WIJA 3GS6A 2Y6ZA 1CXHA 3CK5A 3GTIA 1XR2A 3INPA 2DT2A 2A5HA 4JTEA 5CSYA 3BVJA 3FAXA 2VR4A 2EG8A 4GA8A 3P7YA 3B0UX 2X41A 2YJQA 4RXGA 5CPLA 3MKCA 1YTEA 1ZAIA 1F3WA 1FBAA 4GGBA 1MQQA 4IG2B 1O68A 3C3NA 2HWGA 4EF8A 4DJDC 3MV11 5DCDA 3W9ZA 1E9LA 5CGTA 2X2YA 3VMOA 1KM3A 1XLIA 3LHVA 4XVEA 1PX8A 4UQBA 3CLWA 4JFTA 3THCA 1LP6A 2XVPA 1AD1A 2Y0FA 1S2VA 4PTXA 4IX0A 3GXPA 1BWLA 4A05A 1M03A 4ACZA 4C7DA 5A6MA 3DI1A 3R8HA 4PL2A 2PP0A 3UGRA 4AY1A 3A5FA 2WMJA 5BWFA 3W28A 4QTGA 3IARA 4PB3A 4IH3A 2CLKA 4KRZA 3UVAA 3GAKA 2BZNA 1WZAA 1FCQA 3TTYA 3QM3A 5KZEA 5HWNA 1UB3A 1W3HA 2ZZ5A 3RMJA 2ZE0A 4YJ5A 1ISVA 3P8JA 4Q4OA 3M16A 3SRFA 1KCXA 3APYA 4HU8A 1WV2A 1R86A 4E2BA 3JUGA 3VIOA 1C91A 3NO5A 2QPXA 1V0MA 1T41A 3TYDA 3W25A 3NAVA 1H63A 2PRLA 1DWIM 2NSOA 1JCTA 1Y5VA 3VZZA 5EKYA 1TPWA 4QAWA 4HQVA 3R11A 5FACA 4LF2A 1LBLA 3PJTA 2E6AA 3BAJA 2NVCA 5LKYA 3QV6A 1K8ZA 4AF0A 2EAWA 4YYFA 4H6KA 1JZ2A 1CECA 3GTXA 4XUYA 4DJDA 2DZPA 4E38A 5T9BG 1P0BA 2UBPC 1I2OA 3AU2A 1XYBA 3FVDA 4MKVA 1W9UA 2J7HA 3HBLA 3K2GA 1BXCA 2X1UA 2QDHA 3WQVA 1HUVA 4M80A 3Q4DA 3V0SA 4RL3A 4J3XA 2NUXA 3OB8A 1S1RA 1KTNA 4CQCA 3HMJG 1H7RA 2B81A 3W1PA 4X63A 1LTDA 4GISA 1DL3A 1X6UA 1VJZA 1E72M 1YNYA 4EAMA 4ML9A 2VRQA 4E5TA 1IEWA 2WJZA 4B15A 3LMYA 3ELFA 1RLCL 4HN4A 2WSQA 2EPNA 3SUUA 2XDFA 3TC7A 3EPMA 4HPJA 4W8LA 2VRKA 1E6PA 2BGQA 3T8QA 1F8MA 4N9CA 5HMFA 3SIMA 1HL8A 3B04A 2QUTA 4M3PA 2CBIA 3LUTA 4MTVA 4OU1A 4ECLA 3M44A 3QY7A 2J13A 2AAMA 4H6QA 2AQOA 4KFOA 3ISIX 4FX7A 1QVBA 1XG3A 3HPFA 3C2EA 2PZ0A 3KBSA 3DN5A 4NG3A 3V0UA 1CB7B 3MI3A 4FOJA 4F0MA 3V1PA 5DCBA 2YDRA 3ZT7A 3W1AA 3HIJA 1QK2A 2CHRA 5IHSA 3CV7A 5G2WA 4U3AA 4P5UA 3DESA 3W75A 3DUGA 3UF9A 2JGYA 4MDOA 1EGVA 3GD6A 2YCJA 4GY1A 3C5QA 3P74A 4DWSB 3VKDA 3VPLA 3AXHA 4KKXA 4H9YA 1W1ZA 4BS0A 3VD9A 1GVFA 2EXOA 4UZSA 4W87A 4BQ2A 3TTSA 1TWDA 5K7JA 1FWCC 3UR7A 3M6YA 1YE4A 1XH2A 5FSEC 2ZXBA 4IMEA 5TQLA 4G7EA 2HVOA 5AVHA 5KSWA 1B1YA 5FIPA 4M7TA 5EL1A 4IPPA 2KZHA 3ME3A 4HPXA 4ADUA 2WM0A 4AG0A 2QPUA 2WQPA 1UBPC 2O4MA 3EX1A 2WMKA 3DFPA 4RDYA 5TD4A 3GY1A 3NQDA 3SY1A 4IGSA 3W85A 3RPTA 4KIEA 5E0CA 4C1KA 3MC5A 4R3UA 2CZ5A 3D47A 5I3FA 4IJBA 2ZRUA 1ZPTA 3CZEA 3QFEA 2HVMA 1T8QA 1NDVA 4IL0A 4JIHA 3WF2A 4B5NA 1VF8A 2DUZA 1BYCA 1L6WA 1BXNA 1UOZA 2PE4A 1AVAA 3BW4A 3SCNA 2X05A 5LXEA 5KINA 3NM3A 1H1ZA 5FL0A 4OZOA 1IWBA 3UU0A 3WLLA 1S46A 2WNQA 1KXHA 1GVEA 4JAWA 2YW4A 4NXKA 2J7DA 5DF0A 1GOMA 1ZQ5A 3GC5A 5AFDA 4EOUA 2G4JA 4LBRA 3MSDA 1UP0A 3N6HA 3CO8A 3PR2A 1W1B1 5F2IA 3QHOA 3MP3A 2YL6A 4WJ8A 2VFGA 1WAWA 1M7PA 3E2VA 3I10A 3W1LA 1WDSA 3T0TA 4IIFA 3L4XA 3SCPA 3ZWTA 4JKLA 2YOCA 5U7SA 3VOGA 2D2GA 1E15A 1UA3A 3DOPA 4J28A 3T0CA 3QYQA 1MW1A 2WZIA 1Q66A 1KWKA 2INZA 3M0ZA 2WBKA 4LYPA 4XAFA 4CEUC 3MJYA 1UA7A 4OOZA 1NJJA 4TV6A 3R25A 3QQ0A 1G4EA 4JIQA 3W2LA 2FZMA 4I3GA 1MZHA 3GIYA 3KP0A 4TVUA 1JDDA 3GNDA 2FVMA 2WVSA 4MWAB 1W3KA 1POJA 3H70A 3O1NA 3WLPA 5A8OA 2YBVA 3IJ8A 5CG7A 1O5RA 3U5UA 3U5YA 5CPTA 2YB1A 1ISYA 4J3TA 1KCKA 1K4GA 3NGJA 3M46A 1V77A 3AIBA 3SCUA 4S3FA 3WBAA 4W8BA 4I9JA 3MPGA 4E3TA 4PFMA 2VMFA 1RD5A 4NNCA 4K36A 5ECUA 3TYBA 4OECA 4HGXA 1I1XA 1B3WA 4Y7EA 1RBOB 4XX6A 4O4VA 2WMHA 3P60A 2A2IA 3CHVA 6A3HA 3CEPA 6REQA 1GTHA 4M1BA 4MFDA 4B3KA 4FNQA 4YU1A 2OWXA 4DJFC 3UBPC 1JPDX 2PI6A 1J5TA 3KHDA 3H26A 1TMHA 2JKEA 2VD9A 5HR6A 4UFLA 3VNKA 1JULA 1ZNNA 3U9IA 1H5YA 5T26A 4L6DA 1K77A 4MADA 1VPXA 2QJGA 3GW0A 2I17A 5I3DA 1ZHAA 2YW3A 4KW2A 4FIRA 3CTLA 1WZMA 2RKXA 1GVIA 3LBOA 2B7OA 2R94A 5HQMA 3TUUA 4TUFA 1MNSA 3HGJA 3BV4A 3L66A 5BMXA 2FFIA 4AEOA 3V1HA 3S6TA 1AA1B 4DELA 4KERA 1MXDA 4IX2A 5DXXA 1VC4A 5FEWA 5BWAA 1SMAA 5AY7A 3WLNA 2Z6IA 1JXKA 4CN1A 2PS2A 3EOEA 4ZOBA 5IM51 4XD3A 4GUFA 3VNZA 2WLYA 3NL2A 4X9SA 2QJHA 3CHFA 4DJEA 2PGFA 4I5XA 3W70A 1X1NA 1MO0A 3M0MA 2VWTA 1GKPA 2VDHA 3H2FA 1QO5A 1F9CA 2X0HA 3QY8A 2KX9A 4GO8A 4M6PA 4BI7A 2W27A 3QZEA 4IGMA 4LVGA 3U4AA 4FXSA 4PZVA 1PYMA 5F4XA 3TYEA 4XTDA 1KBKA 4D8LA 4HZ8A 3WLQA 4H8VA 3SQSA 3HGOA 1ZLPA 4S2BA 3LG3A 3F1QA 1AL8A 5C2GA 1H1YA 1RP8A 3N2MA 4AAJA 3M7SA 2NT0A 2BASA 3RK8A 4CQBA 2CITA 3WX7A 2Q8LA 3MT1A 2MUCA 5FEPA 2CLIA 4UFJA 3LM7A 3W02A 3EWZA 4AZ5A 2CXGA 5HOSA 1XW8A 3H21A 3KS5A 5I03A 1W9PA 1H7XA 2JK2A 5AC5A 4UFHA 1YX1A 5CZJA 3K5XA 2PDLA 3AMKA 4E4FA 4CQAA 3NZQA 3ERPA 1Q5MA 3OQEA 3MCOA 4C7GA 3BLFA 1JPMA 1EXPA 1R3SA 5E5CA 4N0RA 4US5D 3MZNA 1CB2A 2WLZA 1DVJA 2XN2A 3UETA 1OD0A 1XSJA 1QPOA 4AHOA 1KFKA 1Q6DA 1QNQA 1U2YA 2ZWYA 3GKAA 4HZ6A 1KQYA 1UKTA 1FH7A 3QSTA 1XFBA 3P0XA 3VGHA 3NZ1A 4XZHA 3W7LA 5I24A 3BMXA 3GG7A 3CPGA 4RCXA 3M0HA 3JU2A 5A5WA 3WQ6A 1UPPA 2CLFA 4XIAA 4O0QA 3KRZA 3WUFA 1VGAA 1K03A 1DXFA 1ISWA 1VIWA 1EC8A 3IVSA 4H6EA 1TPC1 2ZRXA 4MJZA 1Q3NA 3PPCA 4JL1A 2C1HA 2XSAA 2VP8A 3VYLA 3I6EA 2ZFAA 4AZBA 5BRBA 1GZGA 3KRBA 2VM8A 1UD3A 1X1OA 4MB3A 4RK8A 1KR0A 3WJWA 4KCTA 2O4QA 3KL0A 1QATA 1H4PA 4RV8A 3AYSA 3BQ6A 4O17A 4HKPA 4NZ4A 1T40A 3EEGA 1TWWA 2GGIA 4P8VA 2WMGA 1ZALA 2HCVA 4PMXA 4UTLA 1ITQA 1IZCA 4WDUA 1JVNA 1PO9A 3MWCA 1MSSA 3LZ5A 1QNVA 4LVFA 1JFHA 1UH2A 2I57A 2PGEA 2H8ZA 3QF0A 5JUVA 4RJEA 2P10A 1IYXA 3NQ7A 3TFCA 2WNWA 2HE8A 2D2JA 3M5ZA 1HZYA 1DQWA 1FCUA 3GG1A 1WXJA 4AC1X 1D8WA 5IHRA 1NFGA 1EJVC 2Z24A 3KOFA 4C6MA 1PL9A 4AHQA 1VFLA 1NELA 5AKQA 4Z2LA 3BO9A 5M2FX 4PN2A 1U30A 5FAJA 1RQEA 4GYPC 3NR0A 3I6TA 1FDYA 3LTYA 1SO6A 3SUTA 1ZENA 3QMTA 3WNNA 4PRTA 1OEPA 3GTFA 4XSMA 7ENLA 2VDIA 4Y9MA 1J0IA 4NNAA 1WCGA 2NQLA 3H4XA 1P43A 3AJ7A 1VB9A 2TAAA 4V27A 4V1YA 1WYIA 4LT9A 4F2BA 1OFBA 3AIRA 3NTYA 1REQA 1SMDA 4R7OA 2V3DA 3MI6A 1JZ6A 4BFAA 4EVZA 1KNWA 1XSKA 1KTBA 2F84A 2FH8A 3F4DA 2YDQA 3MANA 3AZRA 5FF4A 3TA9A 3T4CA 3WEOA 3TLQA 4Q6XA 3CMFA 2PZNA 4DBUA 1KM1A 4W93A 3KTSA 1OFPA 1N8WA 1EWDA 4ROQA 1KO0A 5LYRA 7REQA 3EMCA 1TZ7A 4PYSA 4MIMA 3FA4A 3UYIA 3VDCA 3QV7A 3REQB 4QX4A 6XIAA 1DTNA 2Z28A 2VKZG 1R7AA 2JEQA 3DX5A 1V3JA 4Z1YA 4JOMA 1UKQA 2VOTA 1CXKA 2R91A 4O13A 1DXIA 2GDVA 3O6AA 1R30A 1K9TA 3BV7A 4WOQA 1H61A 2WMIA 2Z00A 2QCLA 3CQHA 4JYEA 5FJUA 1X97A 1SVDA 3HF3A 5EU9A 1TPEA 2WSKA 3ZWSA 3DHPA 2OSXA 1CLKA 4A4AA 1MWOA 2BP1A 2VDGA 3IV8A 2DZSA 1KXVA 2AGKA 5I77A 3BXWA 1C90A 4XD5A 3UWYA 3IIXA 1OG6A 4OTKA 3NA8A 3N2CA 5A2AA 1VR6A 4E8GA 2ZUUA 5I3KA 1QK0A 4FXFA 2UY3A 4NUWA 1OX4A 2WC3A 3M47A 4GKLA 1DWJM 4HMEA 4GXMA 3L0NA 3QTPA 4DZHA 5C9RA 3UCDA 3DFSA 3CJPA 4K8GA 1XUZA 3GFXA 4CNOA 4XISA 4ADSA 5FEZA 3HQNA 5CBIA 3MYOA 2XH0A 4U2YA 2G3NA 2O9RA 2CW6A 4MY8A 2E9LA 4JFVA 1X6NA 2PDBA 3CQJA 2VHLA 3M7WA 3C3UA 4GI8A 3IGHX 3WLJA 2JIWA 1UD2A 3L4VA 1CTNA 3ENLA 2OZTA 5CQ1A 3QGKC 2VEPA 4ERGA 1C92A 1FWAC 2CLOA 1PWLA 1F05A 1UASA 1V79A 3S5SA 2VXNA 2WSRA 4LAUA 4U5KA 2Q01A 3HOJA 3OU8A 4DWDA 4GLEA 2ZX7A 5FJTA 1S3HA 2XINA 4K1GA 4I7WA 4C6IA 3PVFA 3UPMA 2GLKA 1QW8A 2OVLA 3MBDA 3T05A 2PA6A 4B91A 3L0GA 4LCRA 2IQ0A 2I9EA 1W5OA 4W7WA 1H49A 1NVMA 3V16A 2C14A 5CCZA 1F3EA 3U7BA 1ECQA 3BGAA 1E9ZB 1M04A 1QO2A 1VQTA 1P6BA 2W61A 4A8LA 1U22A 3UG5A 3SM0A 4N42A 1O94A 1UC4A 1D7KA 1M01A 1C8XA 5CC3A 4O54A 2ZC1A 3L2MA 1SFSA 5LA1A 1Z69A 2G3IA 2OSYA 3LHUA 4ILSA 1TTQA 1GOIA 3GFYA 3O7UA 2QCDB 1LQAA 1C9DA 3LGGA 4AUBA 1BYDA 3SFKA 2WHLA 4WK9A 1RQHA 5EYWA 5C0QA 1TR1A 4S3KA 3EDJA 4A29A 3M0KA 2GQ9A 2YZRA 1ADOA 3CNYA 4JY9A 1VRXA 1EOKA 2QVNA 1XISA 1I4NA 2R14A 3PG9A 1SUXA 3FV9A 1FHDA 3AS3A 3W3OA 1YKWA 4XAPA 2NV1A 2Y2WA 2IKHA 5HQLA 5J5RA 4PEEA 3GE7A 4J3WA 1BFNA 2YSWA 4AC7C 3ES7A 3ARZA 1YBQB 4UNKA 2XGIA 2DW6A 1UKOA 4MNKA 3W7EA 1LRNA 2TPSA 4J1OA 4ICCX 4GVIA 4CD5A 3W38A 5HBFA 2D2HA 4LC8A 4PCSA 7PTDA 1GVOA 1JYNA 1Q4WA 2O0TA 1TFVA 3MQTA 2Q71A 3LRMA 3LRLA 1PYFA 1Z48A 2E7FA 3MWAA 2DQXA 2HBVA 3ZLGA 1K1DA 1VRDA 1UHVA 4NZ5A 1O60A 3UCCA 4G5DA 5I6SA 2RFGA 1DWHM 4AIUA 2QDDA 4LF1A 3PC0A 5C9ZA 4RZ4A 3W84A 1PDYA 3W6MA 3WMBA 4PTDA 4DXVA 4IJRA 3THAA 1CCWB 3WD4A 2BVYA 5JH2A 5FL1A 4IJCA 1V8EA 1K8XA 4QNEA 5G2IA 2PB1A 1YDNA 3G1XA 4B9ZA 1NFBA 1XYLA 1E6QM 5D2WA 5BRPA 2GUYA 5CZTA 4I9MA 3WO8A 3NZPA 5I3JA 1MFVA 3P93A 5AYBA 1C8YA 3AHTA 4FZIA 5DY2A 1EB3A 1U5HA 3W1XA 1W8GA 3BLOA 1KM6A 4QCEA 4S3CA 3W7RA 1JI1A 1RJQA 4GZIA 1TV3A 1TQXA 4KFNA 2PC4A 2A3CA 2ZIDA 2MANA 1EJSC 2NQ9A 4Q4PA 2C3ZA 3DYOA 3S2NA 2W9MA 3SBFA 4OHQA 4GX8A 4CQ8A 4QSFA 2OOFA 3T81A 2P76A 1B2YA 1B30A 1XJBA 1VEMA 1IE7C 4JFSA 3WCZA 3PHAA 3D3AA 4MGGA 3TCEA 4RE2A 4LCSA 3CYVA 4JQ1A 3LSBA 3HQPA 4YCOA 3QQ1A 4JTSA 3ARRA 3QY6A 3ARTA 1VFMA 3WK0A 5IXEA 4AVOA 1UWTA 3HPZA 3B8TA 4AU0A 4LU0A 3OBAA 2TODA 2YB4A 5GVJA 3N3MA 2V5DA 3G8RA 1E3ZA 5DFAA 3FCPA 3WK3A 4PMOA 4N9BA 4W7UA 2EEXA 5BU6A 1WKDA 4YTSA 1W5NA 2CEQA 2EHHA 2YCEA 1JCYA 2EO7A 2VJXA 3XIMA 4GH3A 2AQWA 4HNTA 4H19A 2VX7A 1UIPA 4HYRA 4NY2A 1HP5A 4EWJA 2WNNA 2R6OA 1FWJC 1IT7A 3VDHA 3M4HA 3M41A 4LYKA 4TMBA 1Y65A 1MFUA 4QS6A 1ZJIA 1W1IE 3FLUA 3FEMA 4QG6A 1XSIA 3QV8A 3JW7A 3G1FA 5A6BD 1OQFA 5BCAA 3AMGA 3MSRA 1XLEA 2GYIA 3WELA 4OOUA 4TX9A 4QIUA 3GH4A 3L4ZA 3TYUA 4D8AA 2J27A 4F40A 2OT1A 1EA9C 2FJKA 1SJDA 3CWHA 2VC6A 3AS0A 2OB3A 1BEUA 2QEZA 4DAFA 3FXGA 1FCVA 1D3CA 1W3IA 4KETA 2NVDA 4H9VA 4Z1DA 5FEXA 1E70M 4QLKA 3A9BA 4JTLA 2BGNE 3HJZA 1TX2A 1EJRC 3TR2A 5G1YA 1R2RA 2WKGA 3MKVA 3B3DA 2C1IA 2G41A 3WJSA 2ZZ6A 5M1TA 3IK2A 5LNRA 2D1ZA 3GNPA 2DORA 4DXKA 3W87A 1OB0A 1HJQA 4X2PA 3LRKA 2H8XA 2RAGA 2OLAA 4FP1A 4BKNA 3FA3A 3PPHA 3CUXA 3R8GA 4JQ4A 1H60A 2NXIA 1B90A 3SDOA 2X1SA 3M0IA 2O9PA 3TQKA 2J75A 2PDHA 1W5PA 2XJ7A 1EKOA 4ZTYA 2Z1KA 3W82A 3VCNA 2R1PA 2JGQA 3OIHA 1P6WA 2XFYA 4LX4A 2JKAA 3WDRA 5FD0A 4WQ6A 2DT0A 3MSYA 1AH0A 3T42A 4AB4A 4R5EA 3KWSA 2GVJA 3URNA 2IXVA 2GOKA 1B54A 4MZ1A 1Q7MA 1GEHA 2OG9A 3O8AA 3B03A 4UMBA 5BW6A 4LYRA 5K9XA 4HA3A 5DANA 4WOZA 3WF0A 3TH6A 3WL1A 4RNJA 4DX3A 1Q8JA 3P84A 3M07A 3XINA 3APGA 3WFAA 2ISDA 4E0CA 2YYTA 2IW0A 3AZTA 2PRHA 4BCEA 3EMQA 1OFOA 1W5QA 2QIIA 1PKNA 3EGJA 1O7AA 2QCDA 4L1WA 2CHNA 1FDZA 1P7TB 2VUYA 4I5UA 3OVGA 5A3HA 1HKWA 2XH2A 4YXGA 1RCXB 1TZZA 4GIAA 5B80A 3IJ7A 4RZBA 3A12A 5D2YA 3BLEA 1DKWA 3KTCA 2Y8KA 4MNLA 1MEWA 2QF8A 3DEQA 1UWRA 3AIQA 1O1HA 3GYEA 3LBMA 1E0UA 3WK2A 3SRDA 4GXWA 2OQYA 4Q7BA 1H7OA 3A3WA 1W31A 4IT1A 3BTNA 3EA2A 3Q67A 1YIXA 1GQJA 2E09A 2ABAA 4C6QA 4Y9OA 1TTJA 2PD5A 2ZVIA 5FJIA 1TIMA 3WJYA 1QHOA 3VXGA 3S6DA 2VFEA 4DUOA 3WLOA 1LDCA 1TPFA 2XG9A 1JF6A 3C4UA 2VOMA 3KW3A 3H55A 4BQ3A 4JNYA 4OV9A 1MXSA 3QMSA 2PU1A 3PZIA 2EPOA 4LS1A 1V3LA 1ZJAA 5GJNA 1OC7A 4NX0A 1JFXA 3CUZA 1YRRA 2BDQA 2PBOA 2QCMA 3VO0A 4ZVJA 1V3IA 3U8GA 1ISXA 1FWSA 3GFZA 4ZCWA 5FOOA 1Q6QA 1MUMA 3CUJA 1GEQA 3ITXA 4F0KA 1UPMB 2BVDA 2PRMA 1EQPA 3S0CA 4FK9A 1JNEA 4ROPA 4G56A 4LVDA 2CLMA 5A6KA 2QVHA 3VFLA 3MUXA 2ZE3A 1UP2A 2CZEA 3BZJA 3L21A 3LPFA 3CUIA 4F0LA 3LCWA 3UESA 1QWGA 4IIGA 1TV5A 4HB7A 2H9AB 5BRQA 3TJXA 3VNLA 2EBNA 5CGMA 1OCJA 3VABA 1OADA 2GJXA 1KGUA 4BF9A 2GDUA 3E49A 4FXRA 4GZ7A 4C6NA 4B2DD 1NU5A 1OBAA 3KX6A 3G22A 1E6NA 1DV7A 1OSEA 4BI5A 2FB2A 2P88A 4W7VA 2V9DA 3LHTA 3DDMA 5D05A 2Z29A 3S8HA 4OFCA 1XM3A 4NJIA 3E0WA 4ZXLA 3SGUA 4H6RA 3L4YA 3BSMA 1O66A 4X0NA 5D04C 2YCLB 1HTIA 1NF7A 5DEZA 4L61A 1IXQA 4RE4A 1JCJA 1LWHA 4H7ZA 1DQUA 3R10A 2P3EA 3ICJA 2D0HA 1P0KA 3BOXA 2QUVA 2YCIX 3W73A 3P62A 2QDEA 1TPB1 3TQPA 4DVOA 3HTWA 2PWUA 3TEVA 1W8SA 3GXIA 2PDCA 4ZODA 3T08A 4WY0B 1KCZA 3HURA 4DO6A 4IP5A 4LVBA 1U33A 1J0HA 3BMVA 3GBDA 5BOOA 3CHDA 4O1AA 2A21A 1RVKA 3HMCA 2A4AA 3CV6A 1S2AA 3EYPA 1M41A 4L6HA 2V5LA 1XXXA 2F38A 2DV0A 3EWUA 4PSPA 3LNMA 4G8TA 3SCSA 4HMNA 3KCJA 4YTUA 3OZYA 3DERA 4FNSA 1JUEA 5BMWA 1V4YA 2PDJA 5G1TA 3G6LA 5H91A 3EOUA 1ME8A 2KAUC 4QNWA 4AWTA 1NDYA 3CUGA 3P8IA 1A5BA 3CZ8A 4UUIA 4E8CA 3KAOA 3QSRA 3WDPP 1B31A 1CGWA 2WV8A 2PDGA 3HN3A 4YIWA 3TNBA 3R0DA 4FMVA 1VBUA 2R8WA 3IAPA 3S1GA 1TUFA 4I6VA 5MF5A 1FFQA 1IT0A 1HKKA 3BG5A 2NV2A 4A3HA 1YTDA 2XIJA 3N14A 1B9ZA 2E28A 5EMJA 3TOPA 1KRAC 1YXYA 2C19A 4H9TA 3H8AA 3F2CA 1MDLA 1TO3A 3HFTA 1KGWA 2ZRZA 4PTMA 2OSWA 4Q7NA 4S1FA 1O1ZA 4UTJA 2PAJA 2OJPA 4YMZA 1R47A 1EA0A 2ZXQA 4HPGA 3DFYA 3NVTA 3KVLA 3PZMA 4P7LA 1I2QA 4LV9A 4H9UA 4LGXA 1FH8A 4LEQA 4CVUA 4FF7A 1G7UA 1IQ8A 3QZ6A 2Q8ZA 4C6BA 2Z1VA 3FHAA 4WSKA 4UTUA 3F2DA 1UROA 5D9OA 1HNYA 2QV5A 4OVXA 1K70A 5I00A 3ZS4A 4Z2JA 3CM4A 2DH3A 5TAOA 5E0FA 4JIRA 3T2OA 4WSJA 2A79A 4R85A 2E40A 3G1HA 5AZ0A 2ISWA 4CNTA 5L9FA 3BMWA 4DQWA 1GVSA 1DJNA 3LXAA 1SR9A 2PC8A 2PCQA 4AEEA 2PBGA 2Y5SA 1TWIA 4GJJA 1XI3A 5FF7A 1AUSL 2PMQA 1X96A 3TFXA 2FPYA 3RMEA 4U5IA 3AJXA 4AD1A 1G94A 3ZT6A 1DP0A 4CD8A 2D23A 3EOOA 3WJXA 4O52A 3EKLA 4NI8A 3WQGA 1TMLA 2GGHA 1A5SA 1OCNA 2CU0A 4JICA 4N6EA 1UD6A 3GH7A 1UWSA 3U2ZA 4EXBA 4F0SA 4GY7A 3NEVA 2VFFA 4H9ZA 1DJGA 1JXJA 1B3VA 2OZ8A 2GOUA 1V6VA 2DIEA 3MP5A 4WXZA 4LVAA 4UQCA 3KHJA 3PFRA 1J01A 3ANYA 3TYCA 1S5TA 3SCTA 4I7UA 3EOSA 1Q7ZA 2CC0A 3ORWA 1MUCA 2ONEA 1RY8A 4QR6A 3EWDA 2ZA3A 1QNPA 1XUUA 5LXXA 5I02A 4DPQA 3K4AA 2OKTA 1EIXA 2OXNA 1PIFA 1E4NA 1MMFA 3MMUA 3TQVA 2R24A 2XFRA 3IVUA 3L5AA 2ZBTA 3B97A 3H4GA 4PB4A 1TWSA 2V3FA 2XISA 3IRSA 3DCPA 4QCFA 1BVZA 4ERAA 4QDPA 4M7SA 1E3XA 4KH2A 3BH4A 3QPYA 2X2GA 1GONA 1QFEA 3HM7A 4MYAA 3WDHA 5HNRA 3MBFA 1XYMA 2BOEX 2XH4A 1EFZA 2W4XA 3VOFA 1MRAA 1PB0A 3PAJA 4CCZA 3TNOA 2VFIA 3NGFA 3KUMA 4ZQNA 4A3YA 4GE8A 1GOOA 4ZGYA 1EUNA 5ENLA 2P50A 2X8RA 2ZA2A 4GVHA 4XO7A 3SW6A 5C5YA 4D6EA 2G3FA 4ZMGA 3O0KA 1G5AA 4MWAE 4IQJA 2BHYA 3W7KA 1V3HA 1KRCC 4EIVA 1EHNA 5KTLA 2XU2A 1NAL1 1ZP4A 3TMQA 1UW9A 2R1KA 3QW3A 1TCMA 1L2UA 3TMLA 2R9RA 1OYBA 4XK2A 1TWZA 2XPKA 3ARVA 1HO4A 2F9RA 3IEBA 1GQKA 3BJSA 1OYCA 1EF2A 2H9AA 4ZO6A 3PTMA 1B57A 4GPNA 4RLIA 2QIWA 5CH9A 2VCCA 4KCWA 1LT8A 3WH7A 3AIWA 2BVTA 4LPCA 5E9XA 5D9NA 4AEFA 4NAEA 4E4PA 4GQ0A 1US0A 5ABEA 1SR0A 3M5VA 2GUUA 2PEVA 3E38A 4UTWC 4JKMA 2X1IA 3ID7A 3NSMA 3OVQA 4RE3A 1DJZA 3RITA 4LANA 3W7HA 3KZSA 3SR7A 1TA3B 3OIXA 2BHUA 3WL0A 1X38A 3DYMA 3WG6A 2O9OA 1OFQA 2V69A 4D1JA 3LXCA 3NQCA 4AW7A 2YDAA 5E6YA 1AMKA 1A5CA 1HJXA 1I45A 3LX9A 4MPQA 4H3DA 1FHUA 3SADA 4KF1A 1EL3A 3FJNA 4J2PA 1UZ4A 4JS3A 2WZEA 3C2OA 2F6KA 3UXDA 3TJLA 1F61A 4GGHA 3A4JA 4ONVA 3SGZA 2EQDA 1PDZA 1B3XA 2RDXA 4AMAA 1Z44A 3LQLA 3KVJA 1RH9A 4UQDA 1K8CA 3TLLA 3ZSSA 3C52A 1PS9A 2VX4A 4UXDA 3G24A 1T7LA 5AHLA 1LQ2A 3PWIA 5IDZA 4TTUA 6ENLA 5I0DA 1RCOB 1R38A 4JTUA 1IZKA 2PDQA 3FGCB 3SUVA 2VGBA 3EX2A 3T2PA 2WWDA 3T44A 5SWUA 4A2RA 3FEQA 1LOLA 2LLEA 5AECA 3LXBA 1PIGA 1UCWA 3WQPA 1V6WA 4FI4A 3PZUA 2BX7A 4GVFA 2POTA 4O8AA 4QHRA 4DM1A 3GHUA 1UR0A 2CZVA 3GRIA 3FKKA 1V6UA 3S5OA 2YFOA 4JEJA 4C1NB 1SQ7A 1BF6A 3NIYA 1W17A 2A6LA 4JTAA 3S9IA 1V6YA 3CB8A 4GACA 1O5XA 3WQEA 1KFCA 3STGA 1SFJA 2XHYA 1VFUA 3W7CA 3VOCA 4A3RA 4DHGA 1F3TA 3N17A 4GK8A 4E4UA 3I6RA 2VELA 2GSJA 4D6FA 1P48A 5CAKA 1UWAA 4PUWA 1EC9A 1LZOA 3ITCA 4G1NA 3VE9A 3LB0A 5HNUA 1EXBA 1W1VA 2PCEA 3W2NA 3W7PA 1RPKA 5DRIA 3QKEA 3IGUA 3UZ5A 2QS8A 3U7VA 3H7RA 3B8WA 1H11A 2CLLA 3FN9A 3B9NA 4P7QA 3F2BA 3M0YA 4CKQA 4C6OA 4REQB 2VWSA 2J9ZA 4UQ9A 3DH7A 4ZSTA 4KEVA 1T0OA 4N9DA 4FX6M 1PHQA 2C7FA 5CAHA 4GH1A 4JN8A 4CCCA 1WP6A 4K6AA 4HHHA 3Q58A 2DZWA 3L68A 1TV4A 2CHOA 2ZTJA 1IWPA 3ARXA 1ALDA 1E5JA 5L6UA 3WN6A 4O4WA 1WDQA 3VTRA 4DBSA 4FHAA 1OK4A 2BXYA 5HINA 3TKFA 1LLWA 1QI5A 4XBKA 3PSVA 2PDNA 1B3YA 1NQ6A 4N02A 4HHLA 1XH1A 3PULA 4JYFA 4PRRA 5M17A 4R88A 3R0UA 4U33A 4AWEA 1RK6A 4P7OA 4W9TA 1TVPA 4JTCA 3LCFA 5A8QA 1VCVA 5K3VA 1AH3A 2WJDA 4XAGA 5H1WA 3BW3A 2E8ZA 5EBAA 4QAIA 3OLEA 3TX9A 1SFLA 3SURA 4CQ9A 1EYWA 3RLVA 1G69A 6PTDA 1KLZA 3CYJA 1TJ2A 3B9OA 4OE7A 3EDEA 2PDWA 3UXAA 2XSBA 3AC0A 3T0DA 1E1EA 4RW3A 5EMUA 1DJQA 4D6IA 1JAEA 2Y85A 2GSEA 1VS1A 1JYWA 4S3DA 4S3EA 2ZUWA 1B4EA 3U2CA 1THFD 2DUXA 2CKSA 3G1DA 3RLHA 1UG6A 1VZWA 4EWND 3NZRA 1K9FA 1KFEA 2ZADA 1Z42A 2FHFA 2ZDRA 4Q4KA 1OWQA 2NVAA 1XPGA 3ANVA 5EMYA 2NUYA 4XZWA 2ZCGA 4DI8A 1FWRA 4NSBA 5E0KA 1TMQA 4KBXA 1BRLA 3WY1A 3TAKA 2OEMA 3RYSA 4DAIA 1K7EA 4H41A 2NX3A 3N13A 3IVTA 3U6WA 5AYXA 3QTGA 4Z1AA 1PZ1A 3TN5A 4IISA 3NQBA 1HXJA 2V38A 2A7NA 3PK7A 4M29A 1AMYA 1DJXA 3TTEA 1I1WA 5G1MA 1CNVA 3H4WA 3EAUA 1FWGC 3EWWA 3TN6A 4EPKA 3CIVA 5D2TA 3UGVA 2PTDA 4V15A 1ZAHA 4WJXA 3WNMA 3LD5A 1VEOA 4QE1A 1IEVA 3A4XA 1CW2A 1J96A 5MKGB 3GXMA 4FX8A 4QE4A 1EP2A 3TWAA 3VIPA 4GY0A 2WSPA 1AK5A 2FGZA 1K6AA 1EZWA 4O14A 3AALA 3KE0A 3S2LA 2QJNA 4HZ7A 3CZJA 4DF1A 2PWFA 1TA3A 1JZ3A 4M8UA 1DIOA 4YWIA 3MCNA 2A7PA 3RF9A 1ENUA 2E5BA 3QFWA 1W32A 4QGCA 3VM7A 2EJ1A 1K02A 4HA4A 3ZVIA 3NZGA 2QV4A 4PMUA 5ABFB 4YS1A 1XRVA 5CBBA 5RUBA 3WJZA 2H3BA 4PC8A 5ECVA 1N8FA 2BS9A 4R27A 4QEEA 4KIRA 1Q7QA 3AMLA 1DJIA 3BG9A 5U4NA 3BW2A 3SCWA 4S3GA 2VZVA 4UFKA 5FJPA 1LUCA 5F2MA 4WY0F 3R8RA 1R3VA 3HG4A 3KP1A 1HVQA 3SO7A 4HNNA 3ALFA 3AUJA 1E71M 3DENA 3N4AA 3ONCA 3WEMA 1JUKA 2DW7A 3TC3A 1QT1A 4GKTA 1A4MA 3FGCA 3W71A 1XV8A 1WB0A 3OYZA 1XCXA 1TRDA 1V7AA 3A4WA 3VNJA 3EA1A 2UZ9A 4JD4A 1BXBA 3IUDA 3K46A 4IMCA 3TYAA 1Z89A 3L0KA 2OU4A 1F2JA 1F6PA 1JL8A 1GJWA 3E2SA 3S1UA 4UOZA 1J11A 2PDMA 1JYVA 1I8JA 2WK2A 4PFHA 2ZRVA 1EF3A 3ABRA 4Z17A 5K9DA 5D9MA 2ZRWA 4CU6A 3WQDA 5F4SA 4C6PA 2E9MA 3GVGA 2G96A 1C29A 2BY0A 3N18A 1LROA 1XX1A 1RUSA 1XIJA 1CXEA 4C1NA 5C9XA 4M0XA 1X8FA 1C93A 4UMCA 1EO7A 1DJHA 3RX3A 5I23A 4D6JA 4BQ4A 4J5NA 1WXYA 4WX2A 4QLLA 1WX0A 2RDUA 1UR3M 3SGGA 3W4RA 4UBPC 3MP4A 4H4IA 1I6NA 2YA0A 1N2VA 2I5IA 2J7EA 3FNDA 4YWSA 4IUGA 1FHLA 1TRIA 4NZ1A 2QW5A 4A8RA 1XDMA 3WQCA 2GFTA 2VD8A 4B5VA 4JKKA 3NNTA 4OBSA 4Q8UA 3T40A 3ZR4A 4H8NA 4IUOA 1FA2A 4S3BA 3GYCA 2Y1HA 1LG1A 3IAQA 1IEXA 4JTRA 1ITXA 3LERA 3WMCA 3NL3A 4I8YA 1QPKA 4DUVA 3NSNA 4BWLA 4G1KA 3RRAA 5M3WA 3WZ0E 3T9PA 3BAWA 3NPWA 2J78A 2WJEA 4F66A 4C91A 3VIJA 3LY0A 3LCLA 1H41A 2QCGA 3G5EA 1XL9A 2UY2A 2V8ZA 1BSLA 2WCGA 5AC8A 3CASA 3QJAA 3FW6A 4ATLA 1GTEA 3MUAA 3GHRA 4BEUA 3PBMA 2FZNA 3G0XA 2IPWA 5K9CA 2OQHA 1KXQA 3VNMA 2DZVA 1OCQA 3Q37A 3VD3A 1R8LA 5JMUA 1BKSA 1TCDA 4I5RA 3ARUA 2C1GA 3G77A 4IMFA 3MDWA 4UFIA 1Q2SA 4LYQA 4UTKA 1ADDA 4DPPA 1TJRA 4V1XA 1PTDA 2XH7A 1UKSA 1E4LA 3CHEA 2BMBA 2J8TA 1IGWA 1EDGA 2PP1A 3IANA 2DSWA 4ZA0A 3QPZA 2BXZA 3DKJA 1FRBA 3QGVA 4CCDA 2PDPA 1FH9A 4XKYB 4HPNA 4JIIX 3MB9A 3KWXA 2XIQA 1JUBA 1QRQA 3WQ5A 3LI0A 1R85A 4IGNA 5EMMA 5BOFA 3LV6A 3TJ4A 3H53A 3W01A 2YXGA 1GORA 1XH0A 4WF7A 4ZSUA 3CGTA 5F1VA 5K4ZA 1OCBA 4KQNA 4XUGA 4HOWA 1P0NA 3G1AA 1ODZA 1WE5A 1E6RA 3RG6A 2VVNA 3EA3A 4GX9A 1FWDC 3GVVA 2QCCA 1RBLA 3K1GA 1BQGA 3BAXA 1W9XA 3GLCA 5D09A 2SFPA 3DFNA 5J5DA 3GDRA 4DZ5A 3KTXA 3RO8A 3KDNA 3W24A 1TJ1A 4HD5A 4G2DA 2J7GA 3TZNA 2CIPA 3WUEA 4DJDD 1TREA 4O0ZA 3UR5A 4IF2A 2BHZA 1Q13A 5JBFA 4BF7A 3DFQA 4AZHA 4L6OA 2PF0A 1Z9AA 3EMZA 3WBEA 4RZ6A 2HSAA 3UZWA 2A3EA 4U4MA 1QMLA 3VDBA 2I14A 3W37A 4XBSA 2PSNA 1E55A 2BWGA 3W83A 4Q4SA 3RPMA 1XIMA 4RNFA 4ML4A 4JN7A 3VOIA 1GUVA 5H8UA 1JRCA 5CG0A 2BBFA 3T1GA 5HATA 3H7UA 3BICA 9XIMA 4O10A 2C79A 1ZJBA 1GJUA 3IV3A 1EO5A 3FYOA 1T6MA 1RY0A 4ZB0A 4PR4A 4CQDA 5REQA 1CX9A 3L7RA 1SJCA 1XYAA 2RJHA 2Y62A 4IICA 2ZXAA 3R5EA 1NIUA 5D02A 2WVVB 5FESA 4DEFA 4G6CA 3S5YA 3ZT5A 4F0RA 1ECEA 4L4OA 3A6OA 2VL4A 4Z0SA 2XYLA 2CBJA 3B9DA 5HWMA 1DYSA 4EP8C 3I7RA 1RD6A 8TIMA 4LUTA 1U1JA 1GQNA 3AMCA 1A5NC 4LRTA 3WKZA 1A3HA 3E2QA 5FF2A 3QC3A 3GWQA 3C2FA 3W22A 4ALDA 5HXMA 1LBFA 1Q6LA 1Q6GA 3GU1A 3S9YA 2PDXA 5TBOA 1WQ5A 3QGAC 4KGJA 1XGDA 1E56A 1NQKA 1DXEA 1QI2A 1VBHA 3A24A 4RZ5A 1ME9A 3NQMA 3AO0A 4MY1A 1MYRA 3KBNA 2V3GA 4O8RA 3ZXWA 4QRNA 3VAVA 3AXXA 4K1WA 1BGGA 3P82A 3ALGA 5CEWA 3L67A 2A3BA 4P61A 4DYJA 2EPMX 3AXKA 5KITA 4B4FA 3W74A 3I3EA 5F2LA 4MKNA 4ERIA 1OGGA 1UUMA 3VVGA 4DF2A 2PUZA 3M9YA 4OWGA 2WMFA 3TROA 3OLIA 4DRSA 3HG3A 1ZBVA 4MB1A 3QPEA 3KLKA 4HCLA 4AX7A 1S5NA 2HBXA 5HJLA 5BXSA 1HKMA 5A94A 1RSCA 4JR5A 2VTFA 4AZIA 4DIAA 1J18A 4R9XA 4IXHA 4Y90A 3DZ1A 1M7OA 3H2CA 3STFA 3TYZA 4DXXA 2Y7GA 4HP5A 1S5MA 3RRXA 4JBRA 1LQ0A 3ZFHA 1V02A 4LAKA 4RUBA 4ZENA 2GK1B 3CUFA 4WR3A 3T09A 2OMAA 2V82A 4NP7A 1E6SM 2Z1WA 4GINA 1R3QA 2WW5A 3B9AA 3BLIA 3IIVA 5EFDA 1C8QA 1K7FA 2ZX9A 4IXXA 5LIUX 5LNWA 1JIBA 3NO3A 1EOMA 3PTDA 1A3XA 1GYNA 2Y89A 2BGSA 4HSHA 4BJHA 3VK5A 1GCYA 3W1RA 3M6DA 1YXDA 1HKJA 2CNCA 3EKZA 1ZY9A 4JDBA 1US3A 1ZAJA 1QI4A 1ZU8A 4BK9A 4XAZA 1QNRA 1P1MA 4B92A 1UQZA 1OHLA 1FHVA 1W2PA 2G4FA 1S1PA 1R7OA 1EQCA 2OLSA 5C6MA 2TSYA 4CD4A 4MFEA 1XYFA 1IEIA 4ZB2A 5A69A 3FA5A 3RCMA 4DI9A 1SW3A 1GHRA 4Z2IA 5FCZA 1VFFA 3CUHA 4AWUA 3MHUA 1B3OA 1V5XA 4NL1A 1UYQA 1XIEA 5GNZA 2ZUVA 5HUOA 4F8XA 5CXPA 1BKHA 5ABGA 1VPYA 1V0LA 1UH3A 1B0IA 3LOTA 2CWNA 4UB9A 4WIWA 1ZP3A 3UWQA 4OQVA 2P5NA 4RNIA 3H24A 4NAFA 2J6VA 1XQKA 3ZOAA 4JZ5A 2Q02A 3ARYA 4JTDA 3I7QA 4D6HA 4YTRA 4AFYA 4NZ3A 3W26A 3MCMA 3WLMA 3N6JA 3UD6A 4PUKA 1AJ2A 4XZMX 1MQPA 3RPDA 2VC9A 2X40A 4C1LA 6ALDA 1RXOB 3DI0A 2FGLA 3W7IA 4NYUA 4LNYA 5HWJA 4DLMA 1M1BA 4YLWA 3SY5A 1R0MA 3BZGA 5FJJA 5M5DA 2XSXA 1H7WA 1NDWA 2NQHA 1I2PA 4YTTA 3IIPA 4Q33A 1LF1A 4AIOA 5I2UA 3ITGA 1PKYA 3MY9A 2A0NA 3VNYA 1EBGA 1JNDA 4U31A 5IDIA 2VUNA 3GU2A 4RNHA 1MEHA 1W6TA 4FLOA 3CZLA 5C8BB 4DF0A 1G4PA 4V33A 1ML1A 3OJGA 2E3ZA 3O6DA 1SO5A 3D46A 1JEZA 3CH9A 1CEOA 3IUHA 3BL3A 3FIGA 1VLIA 2V2CA 1KLYA 3TK7A 1KA9F 1Z8AA 3NQ8A 3NOYA 4MB5A 2DZTA 5HDRA 1QXLA 4HNLA 3RN6A 3WD2A 2ZUTA 1FOBA 4CU8A 1R2TA 3O15A 4L9ZA 4CVWA 2HQAA 2P53A 2NLIA 4HN8A 1KM5A 4FR1A 3URBA 1N82A 2QCNA 1UP3A 1ADSA 3GXFA 4RW5A 2VGFA 3OG3A 4ACYA 1JRBA 4NI3A 3H22A 2GJRA 1QAPA 2IXUA 3UJFA 1BG4A 4RKAA 3AUOA 4IG2A 2W3ZA 2VCAA 3W7OA 3TSDA </